5LRRA

The transcriptional regulator prfa from listeria monocytogenes in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Listeriolysin positive regulatory factor A
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 76
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lrrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lrrA01
2WWYA 3LSTA 1Z6TA 3VB2A 2Z2SB 1PDNC 3REOA 5FB2A 1PP7U 4KL1A 4IERA 5HVQC 1YYVA 1T98A 3G3ZA 4ZZDA 1ZH5A 5DV5A 4I3PA 2OA4A 5F64A 4LUKA 3IDBB 1HQCA 1Q5OA 5LRRA 5CVVA 1WLTA 2CSOA 3QPHA 1QNTA 3GO5A 3EJKA 1U5TA 1XDUA 4LLLA 3RPUA 1XGSA 1TTYA 5J8CA 3SXWA 3QU6A 2OAZA 3FM3A 5EEHA 2QDRA 4KNYA 4HZFA 2JTVA 1GVJA 1X82A 3WW1A 2A3SA 3ZMZA 1HXDA 3TQNA 1QBJA 1L0OC 2VE8A 2BYVE 1O3RA 4CHUA 1MKMA 3WTZA 1YTYA 5J48A 1DZTA 2ZMEB 1ZZ7A 5I93A 4U88A 2CAVA 4EM0B 1Z6RA 5ICEA 1I5ZA 4UHTA 1DGWA 3FZVA 3N4MA 4WBBA 5FLHA 3I59A 1ZZCA 2IXKA 4Q0SA 1NHAA 4F8AA 1XGOA 4PIYA 3D0SA 3RZZA 3KEQA 2KJBA 3CJXA 2VPVA 2YX7A 5K1YA 2IW5A 3SFZA 1JGSA 4OIRF 1Z1DA 1STZA 4JK1X 3TDUC 1WI9A 1EH8A 4CDGA 1S8NA 2KIMA 2QQBA 3CF6E 2EA7A 3E5QA 1G4DA 4I01A 3ZN0A 3LAPA 1MDMA 1YFYA 3E5XA 2P5KA 3WG9A 3E6MA 3ES4A 2PMUA 3ECHA 4PGGA 5E20A 3CL1A 1R1UA 4BYYA 1WRJA 4LTAA 1DZRA 4KIGA 3HRSA 3MZHA 1TNTA 3CO6C 4ESFA 2Y75A 3OV8A 2HJIA 5E1ZB 2A6EF 1BC7C 2VBWA 5I91A 2FEZA 4Y17A 1O5LA 2GZWA 3HRTA 2DI3A 3LWFA 3PQJA 3U11A 5D6EA 2VN2A 4KFCA 2IRFG 5IT9K 1ODDA 2EFPA 5BPXA 3ML6A 3PVBB 2OYZA 3PFIA 4FHTA 3CO7C 5D5WB 3JSOA 3BPXA 5I0TA 5ICFA 1Y3TA 3GFMA 3HOSA 3HT2A 1O57A 2A69F 3ULQB 2VT2A 2LSOA 2EAAA 4MHGA 4Q0PA 5FD5A 5LGUA 4AVPA 2XL9A 3L09A 3J7AO 3KP7A 2EB7A 1KA8A 2Q8KA 2WTEA 3NSTA 1IRGA 5BQTA 2FOKA 1FXZA 4WXCA 3MZYA 3AAFA 1WKMA 3I7DA 3L9FA 4MUVA 3IDCB 5CADA 4I02A 4L5IA 2Z3YA 2D5HA 2EVXA 1VR3A 1ZN2A 3F8MA 2HEOA 3KSCA 3WW4A 1O7FA 2A61A 4M74A 3EHKA 3H92A 3D5LA 1BIBA 5HS9A 3JSPA 1BI1A 1TBXA 4RB0A 2A5YB 2V1XA 5TJJA 3IL2A 2VQAA 4IRHA 1TNSA 2UYBA 3LA7A 2HZTA 5DEQA 1HSJA 2ET1A 1LNWA 4MQVA 2P6SA 3RKYA 2Y0MA 5E16A 1R1VA 2PI0A 4LD5A 3ELKA 1H9GA 1LDDA 2QENA 5JHUA 4H7LA 3UKNA 3RPQA 5J7MA 4CYDA 5E1WA 2O8QA 3WW3A 4IEUA 2E9QA 4D7TA 3RJPA 3WE2A 2B9UA 4L2NA 2QJVA 3RKWA 2P6TA 1ZHFA 1K79A 1QXJA 3R0AA 1KYWA 2IXHA 5I0SA 3F22A 3ZQ7A 4BH9A 1XN7A 3ROUA 2ESNA 2GU9A 4XFBA 1KU3A 2HYGD 1H0MA 3CEWA 1RTVA 3WTXC 2D2WA 1FYKA 1R22A 2ZKLA 1OR7A 3HRUA 4M6XA 2ZMEA 2IP2A 4EM1A 3T0YA 3FMSA 2P4WA 4U7BA 3RTRA 2ATFA 2FMLA 5L3BA 1HW1A 1RIOH 3V8KA 4P9GA 5CJ9A 3WU1B 4PZJA 3M1EA 2MH9A 4UV8A 2RGVA 2K9ZA 1XMKA 1IN8A 3I71A 3FMRA 4HDVA 1FYLA 4IEYA 3LFKA 4Z2YA 4ENKA 1J3PA 2LF8A 4QM9A 5ILSA 1YFWA 3QRFF 4R79A 3ELNA 4QLCU 2QNKA 3OGJA 2RV8A 1R36A 3M9AA 4RAYA 1P2FA 1ZREA 2H6CA 4YRDA 5HDNA 5LBQA 4XLPF 4AVCA 1D3YA 3TOAA 2GIVA 4ENNA 1HW5A 4Z07A 3S7EA 5ERIA 5L3GA 2EA4A 2ISYA 2L54A 3FXQA 1BC8C 4ASNA 1OPCA 4AQ6A 4F7ZA 2O03A 4IETA 2K86A 2YPRA 4MGIE 1UIJA 1SMTA 5ICGA 2GC0A 2BNMA 4UUVA 4B8XA 1TLHB 4ZU5A 1YQAA 5EFUA 1IPKA 3OTFA 1LDKB 3JW4A 4G7HF 1FY7A 3F6OA 3MDPA 4EROA 3WTTC 2UZKA 3BROA 1XGNA 1G3SA 2IJLA 2HOEA 5I8SA 4WK8F 1U6GA 4KU8A 2F5CA 3RYRA 3F8CA 4HV5A 2VE9A 4O6JA 4ENJA 3PLQA 2ET7A 2MHFA 3U10A 3JTGA 2YR2A 4G6QA 4G6DA 4KIFA 1CAVB 4IESA 3F3XA 2CGPA 4OINF 2EJRA 2DPDA 4MX3A 2V6CA 3MQ0A 4MTDA 4UXNA 3S0MA 1HBXG 3LA2A 1EH6A 2O1QA 3SHRA 4IXAA 1YHFA 4L5JA 4QGMA 5JR3A 2XAFA 3K69A 1SEFA 3F72A 2L3DA 4ZYGA 1XRUA 1XSXA 4OFGA 1FPQA 2D40A 3LA3A 5FQ0B 3FHZA 5FGMA 1YUDA 4HLTA 1BM9A 1WWXA 4EJVA 1OYYA 3ST7A 2JT1A 3O6BB 2Z99A 2VECA 4HX4A 2UXNA 3K1PA 4LLGF 3H50A 2DBBA 3R4KA 2HQNA 2MH2A 5L3DA 4LGWA 4DINB 2XRNA 3TNPB 4IJAA 2XLAA 3M8FA 4BHCA 3K2ZA 5JAXA 5IT9Z 2HKOA 4MV2A 4OU0A 4MNUA 1PM7A 2BV6A 2ZO4A 1FBUA 3RYPA 3F23A 4YFKF 2Q30A 3KGLA 4QGLA 2NNYA 5AVPA 3BU7A 5JCTA 3DP7A 4HX8A 1DGRA 1FWZA 4RAZA 1MGTA 5KHGA 5KHIA 2WFPA 1LEBA 1MD0A 2PQ8A 3HTSB 4YARA 1F9NA 1CF7B 3ES1A 2DK8A 2YU3A 2H09A 1G6NA 4G9YA 3SHFA 2ACJA 2CV6A 2ZFWA 3HTUA 1U8RA 1J7KA 3TO7A 1F5TA 3BB6A 3FMQA 3ECOA 2P5LC 3J80K 3M8EA 1ZZBA 1ZYRF 2CW0F 3Q5FA 4IEVA 4QXKA 1J9IA 4YIFA 1KQ0A 1ZVFA 3KP2A 1R5HA 4UXAA 4E2GA 1IRFA 1JE8A 3V8JA 3HSRA 4O5VA 1D5VA 3IRRA 3J81K 3NEUA 2G7UA 1IXCA 2M5WA 5KHJA 2CQKA 3M3IA 1PP8F 3I0TA 1BI2A 4WF2A 1CX4A 4L0ZB 3WODF 2LF7A 4EJTA 4Q5SF 2QVSB 2A07F 3K9TA 3ETQA 1K6OA 1BI0A 4YG2F 1B6AA 4KYWA 3D0JA 4FX0A 4A5NA 1X3UA 3GZ6A 4E70A 3SQNA 4HVQA 1ZRFA 3L2HA 2XL7A 1J5YA 1ONVA 1X7NA 4XFFA 4L9NA 1IN7A 4ZH4F 1DPRA 1FT9A 2HYFA 2W57A 4X6RB 1MJ9A 3QAHA 3VOEA 3UKVA 3HSEA 5BV6A 3HYIA 1SFEA 4RGSA 4HN0A 1ZGAA 2XAHA 3KMHA 2TDXA 5E8IA 1D8JA 2MD5A 4EJWA 5DCFA 3V7CA 4JV4A 1IUYA 1HW2A 1Y9QA 1ZNPA 2Q0OA 3GBFA 2OBPA 5DD8A 4AD9A 3L7WA 3EO6A 2OA2A 2OU2A 3CUQB 5HDKA 4MZUA 1O3QA 3IIAA 4L9TA 5I0RA 4ZYDA 3DL3A 4A5MA 2EFOA 4ENMA 1OFNA 4EQQA 3BCWA 2HQRA 1G3WA 3SZPA 1Z9CA 1CAUB 3V8LA 4YFNF 2X4HA 1B59A 1Q3EA 3K1MA 1OMIA 3TDZC 1SD4A 3V4GA 1GXQA 3SCFA 3WTSC 2ZBKA 1CAVA 3HSFA 4XETA 3BY6A 3LOIA 3S2WA 4P5OA 3CJNA 4XRFA 1Q1HA 1RZ4A 4HV6A 5HLGA 3DF8A 1SFNA 2XAQA 4XF4A 1O7LA 3C7JA 1P4AA 3K1NA 1XSDA 3BALA 2G7HA 2R7DA 2WC2A 2HWVA 5JVTA 2RKHA 2FNPA 2QCSB 4IRIA 5FQ0A 3CDHA 2B0LA 3RI4A 1YLFA 4M9ZA 2J5OA 5CVUA 4S05A 2VC0A 3EBRA 4HLXA 3CLOA 1FOKA 2STTA 1XDSA 2UY9A 2P7CB 4ZZLA 4A0XA 2XVCA 5BXXA 2B8MA 1QPMA 1U2WA 5IT3A 1UPIA 4AIKA 4A0ZA 2CG4A 2QQ9A 2RVCA 2XROA 1ZLJA 5FO5A 4XEZA 2EV6A 3QP5A 1SFXA 2P8TA 3SCHA 4GO1A 2C0ZA 2XLGA 1YWKA 4TV7A 1QZZA 3DV8A 4S04A 1KGSA 2D1VA 1JHFA 1V4RA 3GW2A 5ICCA 4QGNA 4MGZE 3GX4X 4A12A 4WXDA 4I98B 2L01A 2UY8A 1BIAA 4O9EA 3FWEA 1S6LA 4GXOA 4M6YA 4KWLA 2FQPA 1CF7A 5D5VB 5D1IA 2K7LA 3U1DA 4Y15A 4HA8A 1O4TA 3FZ3A 4HAMA 4CXFA 1GXPA 1J2XA 2PHLA 4CZZA 2EA2A 2QWWA 1J3QA 1MJBA 4RGUA 2K02A 4BIFA 3G7DA 1OKRA 3P9IA 4G8XA 3H1MA 2F2EA 4IVNA 2H94A 3EYIA 1J75A 3TGNA 5D8KB 2X0LA 5K5RA 3HHHA 5LGTA 2VBYA 3H9AA 1ZG3A 5H6RA 1RC6A 3IWZA 1J58A 5JSPA 4Q0QA 2L4MA 2KKOA 5FFXA 2IPQX 5K5QA 2PJPA 3ZPLA 4I09A 2XAGA 4UVAA 2D45A 5LHGA 1BI3A 3GYHX 3V7RA 4LB5A 4Z82A 4PGHA 2MPFA 2XGXA 2VC1A 1S3JA 4N9IA 5FLIA 4BXUA 2PQQA 2E1CA 2OZJA 1EPZA 1I27A 1ZZ9A 1I1GA 4YYOA 1YS7A 4OIOF 4JTOA 2XHKA 5E18F 1AWCA 2VONA 1XCBA 4WCGA 5I0UA 4I2OA 2FNAA 3Q9VA 3FXUA 3F8FA 3GLXA 5BS6A 3VEPA 3DQVC 1YFXA 3EQEA 1RI7A 4R8HA 5DDGA 1V3FA 1ON2A 5D8LB 5F1RA 2W84A 1DP7P 1C0WA 4NVPA 3KETA 1Z7UA 2FSWA 3C18A 3HIFA 2NAZA 1SAXA 3ABTA 3VFZA 4DNCA 1JXSA 3BP8A 4IEPA 1WQ2A 3EUHA 4YFXF 3LWCA 4LULA 1UB9A 4J1XA 1LDJA 1FC3A 1ZZ6A 2IT0A 1RUNA 3CUQA 3H3ZA 2EK5A 4GGGA 4A6EA 2AS5F 1HKTA 2LKPA 1ULYA 2ZNYA 5DYMA 3FFQA 2M87A 1H1IA 4BAYA 4XSXF 1U5TC 3F8NA 4LK0F 1YS6A 2HGCA 2EFWA 2FXAA 4KDPA 4HLYA 2DW4A 2BBYA 1SD5A 2E7XA 1W4MA 3J80Z 2CAUA 2KXLA 3BPZA 3U2RA 2WV0A 3MPBA 1OYIA 3WTWC 5BPIA 3T8TA 1LVAA 3J81Z 4I0AA 3IWFA 3GFJA 5LEKA 2OZUA 1P92A 2F4PA 5FDBA 2MNGA 3GYDA 5F6FA 1GQGA 5D5UB 1YLLA 1XCVA 1EY2A 2MBFA 2IXCA 5FFZA 5FLXK 2VODA 2OQGA 2LNBA 3OCPA 4ZYHA 5CVJA 4XSZF 1W7PB 3GWZA 2DLLA 3NL1A 1ZGJA 1IXRC 4HN1A 2OD5A 1I1SA 3T8RA 4B09A 1LEAA 2Q4SA 4KT5C 2V79A 1ZARA 3QACA 4FT8A 1UW8A 1TQMA 5FCCA 2Z5UA 4L0YB 3E6BA 5KVRA 1T2KA 3GF2A 4MEXF 3S7IA 4MGKE 4META 4P96A 3WGHA 4G7ZF 4KUMA 4HOBA 2B5HA 5H20A 1SQ4A 2DQLA 2KJCA 1P4WA 4O9GA 5CU1A 1KU9A 5LLQA 3R61A 1VTNC 3I58A 2MLKA 2IXIA 4UVBA 3KE2A 3DPTA 2G9WA 2N7GA 3H1WA 1YFHA 1H9TA 4HF1A 2QUFA 4B29A 3HT1A 3F21A 5ILVA 2GA2A 4MH0E 5BUVA 1R58A 1T0FA 2ISZA 3MCZA 1PUEE 3I4PA 2KIFA 4WX9A 3F6VA 5FPXA 4M9SA 2PTMA 5E17F 1REPC 5D4RA 2NRAC 4KN4X 2QBYB 2DO7A 4ORFA 1L3LA 2PFWA 2O8XA 2M8EA 2F5EA 1OYWA 5LEJA 1J59A 1EV7A 3DPLC 4LA3A 3QP6A 5BOXA 1VJ2A 3CLPA 2UWMA 2O6GE 1H1MA 3H7JA 2JPBA 3ABUA 3KLNA 3NQOA 4PCQA 5CVRA 4HMZA 4IEZA 2P5VA 5FPZA 1PMIA 2O61A 4XLNF 4QX5A 2ZCWA 5E8GA 4Q47A 3QOPA 1XSVA 1FBQA 3FXRA 3QU3A 1FZPB 2GC1A 1KQ9A 1NYWA 2BE5F 5E1XA 4ESJA 4E2QA 2GA1A 4QMAA 3WTVC 3T5XA 5LRSA 3KZYA 4J1WA 4HW0A 1XE7A 4XFGA 2GH2A 2Q2EA 4NB5A 3LZZA 2EFNA 1FSEA 1IN4A 2ADUA 2DQRA 3ZMDA 3E6DA 3WU0A 2E7WA 4HVRA 4XFHA 5D5XB 1J1LA 2AXLA 2ZXJA 3P7NA 3LQQA 2GXBA 3GEZA 4EJOA 3E5UA 4Q0VA 5HLIA 4M73A 4UV9A 1SD7A 4LLNA 2HTSA 1X8EA 1QQIA 1B9NA 4RD7A 3U9GA 4LEJA 3GXOA 3BJOA 3M70A 2XAJA 4AVBA 3BJAA 3DKWA 1YO5C 1GQHA 3O3KA 1T6SA 1LB2A 1RL3A 3HRMA 3WGGA 3KZZA 1R5GA 3M7GA 2EV5A 1XGMA 2UYAA 1KU7A 5LHIA 1W5SA 3H3UA 3D82A 1YW7A 4LB6B 2YX4A 2Z69A 1OI6A 3DEUA 4IRGA 2RC4A 1NE4A 4M72A 4OMZA 3VODA 4QWQA 3L00A 3OF1A 4GULA 4LFUA 1J0RA 3TNQA 4H0EA 1JUHA 1P4XA 1YW8A 1USTA 4HF2A 3EYYA 3G73A 5HDGA 4ONUA 3IRQA 6PAXA 1CAXB 1X8MA 1ZRCA 1TQ5A 1Y0UA 3P9KA 4BHBA 4L18B 2OZ6A 1W7PA 4HYEA 2IXJA 2JSCA 2ZNZA 1QWRA 2EFQA 4CICA 5HI0A 1RNLA 4L9VA 5JSOA 5HOOA 3E97A 1EYBA 1GHCA 5D6FA 1DDNA 2FBKA 2Y48A 4RB2C 3B73A 5J6XA 5K8SA 1E2XA 5LGNA 2HTJA 2V1DA 5C6CA 2M1BA 4IPAA 3R0JA 4DQ2A 1VP6A 1B1BA 3TOBA 4R52A 3MWMA 4AQ2A 3TO6A 4PIXA 4EVIA 2H0VA 5L3CA 4KN7X 1V70A 4NQWA 3ZN1A 2K0GA 4G7OF 3EDPA 3OD0A 3COAC 1FP2A 1TQIA 5KBFA 1FSHA 1QXRA 3SZTA 1BBYA 3EETA 1ON1A 2XUBA 1U3EM 2HFHA 1UCRA 1XD7A 3T1BA 4X6QB 3BDDA 1LQ1A 1NZCA 5E1RA 3LQRA 4PDKA 3C3VA 4Q0UA 5L3FA 1R23A 2XIGA 4D7SA 1FP1D 4HQMA 3WGIA 4LG0B 2P17A 3NW4A 2DTRA 1XE8A 5D4SA 3WTUC 2QBYA 4XF0A 1IXSB 4HSJA 2MC3A 3TKYA 1WGPA 5H6QA 4BHPA 2P7VB 4N0BA 4IF4A 4UVCA 4O3MA 2KIUA 4MQ9F 1IN5A 3GFIA 2IA1A 2F5FA 5ED4A 4KU7A 2V1UA 5FLXZ 2DPUA 3Q9SA 4N9HA 2HR3A 1EH7A 1ZX5A 2IVMA 1ZLKA 1O3SA 5LHHA 2IC1A 3KP4A 4XFAA 3W6KB 1Z05A 4UBGA 4JBAA 1P6RA 2GWRA 2VXZA 4RS8A 2NS0A 1Q43A 5HS7A 5FLJA 3ZMSA 4FAGA 3KCCA 1FI2A 4AIHA 4G94A 2PN6A 2NNNA 3CO2A 1W7PD 2YSRA 3LAGA 1LKNA 5KHHA 3RDIA 4Q29A 1O3TA 4FAHA 4U0VA 2PHDA 4CO8A 3RNSA 1LJ9A 5JI6A 2E1NA 1E17A 3IBMA 4UBHA 4Q48A 4EWEA 4A2UA 1T38A 3IKVA 4L9JA 3JAMZ 4XF1A 2H6BA 4HX7A 2K4JA 1B4AA 3HQXA 1UHWA 3GUDA 1ZRRA 2O0YA 5L3EA 2PYTA 3V7SA 1S7OA 1QGPA 2QM3A 2GC3A 5J8FA 2QYOA 4RGRA 4BQAA 4HF0A 2PAKA 4EJUA 2GQQA 4OIQF 3SMHA 4RB1A 5A2QK 2VOOA 4K8FA 4KWKA 1WSUA 3K0LA 5J3UA 3H7YA 2PFBA 2ZKZA 4IEWA 4OLLA 2VBXA 3FF5A 4K2EA 1TW2A 3QPTA 1BN5A 2F5DA 2JPCA 4JQFA 4Q4ZF 1IN6A 1LR5A 2QLZA 3JTHA 1XMAA 5KK1A 1T39A 3SXYA 4XBFA 1YIOA 4AIJA 2O3FA 2ELHA 1L3JA 5DCMB 4QM8A 3I53A 3RIRA 1CAWB 1G3YA 5BPDA 3KP5A 3N97A 4L11A 4EWDA 2HS5A 3BWGA 4JVAA 2RDPA 2DU9A 2PLYA 3KLOA 3NKTA 5I8TA 1CAXA 3IKTA 4A6DA 1RUOA 4LMYA 3R60A 3ERED 1G3TA 2GXGA 4FX4A 1S7AA 2W25A 2D93A 4YNIA 4U0YA 3FJSA 1K78B 3MFKA 2A68F 4U7DA 4IEOA 2L02A 1QY4A 2XASA 4KIBA 2FQ3A 1QO0D 4WZCA 2VBZA 4XF3A 1DPUA 4IEXA 2OPKA 2PG4A 3ZMVA 4HBNA 1W5TA 2M45A 3DFGA 2FBHA 5I8YA 3WTYC 4EM2A 3I64A 4MGRA 1CAUA 3NVCA 1USSA 2PAEA 4D0PA 2GAUA 3CTAA 2RN7A 1BJAA 1ZG5A 1EP0A 1RGSA 4GCVA 4HBLA 2IA2A 3BPVA 1QZYA 2XLFA 1UIKA 1R00A 4I7HA 2UXXA 3P9CA 4LG0A 2QQAA 3LAJA 3HHGA 1ZZ8A 3FE5A 5BMZA 4HSLA 2LDUA 1K7AA 2PMHA 3KP3A 4PIZA 4XF9A 4KMFA 3DXJF 3ZMTA 4EGZA 4ZYEA 3L2CA 1HKSA 4IEQA 2HKXA 2HDCA 5JR7B 2K27A 3I5UA 4ON0A 4EGYA 2D5FA 2PA7A 1CGPA 4OOIA 3USSA 5ILUA 3ZMUA 2DCTA 4WWCA 2ZJ2A 1IPJA 2DT5A 2FF4A 3BOQA 4BNCA 1U5TB 3WE3A 1FX7A 5DD4A 2Z33A 4OIPF 2CFXA 4ZU4A 3I54A 1R1TA 4YIIA 1TQPA 5DUKA 2FE3A 4M71A 1BOAA 4GYIA 4IHTA 5HLHA 1YW9A 3H8UA 1NXMA 3NRVA 2KRFA 4FBFA 2XKPA 1B9MA 3PQKA 5AIPA 4P9UA 4LK1F 4MGYE 1WA4A 2EV0A 4HVOA 3KFWX 2CO5A 2R3SA 5HS8A 2BGCA 2OQRA 3JAMK 2NYXA 1U78A 1IZ1A 2L4AA 3GVAA 5TRDA 3I59B 4EV0A 4E2SA 2PBIA 5C8WA 3VHRA 2W85A 4UNOA 1SD6A 2COMA 4ZU7A 2IA0A 2FMYA 4AVAA 4U0WA 3W6JB 2V09A 3HUGA 3C3WA 2CWEA 3ZP5A 2K4BA 2MLGA 1SMYF 5AONA 2XKOA 2A6HF 1R7JA 4KICA 3E6CC 2CYYA 2RQPA 4I0BA 3ACLA 4OMYA 4RB3C 1YFUA 3H1YA 3IHUA 2VT3A 4AWXB 4A0YA 2JRTA 5EZWA 4KA4A 3RYKA 4EWAA 2D1HA 2MA3A 4LLOA 3IC7A 2FA5A 3RKXA 5DUIA 2GC2A 2PEXA 1NE6A 2BNOA 5BY5A 1MDMB 4LJZF 4GYGA 1Z91A 3F8BA 1FBSA 5CLSA 4ESBA 3DN7A 3BJ6A 1FYMA 4R1HA 2EWNA 3JZVA 2H27A 4M9XA 4CGZA 4KMUX 1SFUA 1F1ZA 1IF1A 2ETEA 2DAOA 5AIQA 3MAJA 2C6YA 3MYXA 1IAWA 3O2PE 5DCMA 1CAWA 2I45A 5K5OA 5EEGA 1DUXC 3BZ6A 3MEXA 2BNNA 2STWA 4ETSA 2Q1ZB 5KHKA 1D8KA 4Y13A 2QZ8A 1YG2A 3HOTA 4NHJA 4XFIA 1KU2A 2DK5A 1HKQA 1MZBA 4HDUA 2XV4S 1JHHA 4XFCA 1KQ8A 3C1DA 1J3RA 3PNAA 4EMSA 3SCGA 1IW7F 3GFLA 2VOPA 1KYZA 2JZYA 2V9VA 1UD1A 1K78A 3TO9A 4P9FA 3GZ5A 1ZRDA 2QVOA 3O14A 1F4KA 3B02A 2RNJA 2Y0OA 1FLIA 3KGZA 3OOPA 5JFRA 4LA2A 2ETHA 4HQEA 1ZG1A 3ZDSA 3E3VA 1FNNA 1U12A 2M30A 2J5PA 4WVZA 3ISPA 1ZAOA 1OD5A 3NJZA 1AOYA 1O5UA 4JTNA 2ESHA 2BEOA 3R6SA 2R7FA 4P55A 5JSRA 2IXLA 1LRHA 2PAMA 3WW2A 3KP6A 1UHMA 1TW3A 2Q0AA 2FRHA 3U0ZA 1HSTA 3CUOA 1MJAA 2FBIA 5FD6A 4MEYF 3FHIB 2Z9OA 4IHSA 5CYVA 5T3NA 1UFMA 3FX3A 3UKTA 5A2QZ 1XB4A 4YSFA 4WXHA 4RGXA 4TLFA 1UCXA 4MTEA 1I6XA 1S29A 5CVIA 2DFIA 4KWJA 3FM5A 2W24A 3KEOA 2FU4A 3EQLF 4LUMA 1A04A 4PJYA 4AXOA 3CUQC
chains in the Genus database with same CATH superfamily
3LSTA 4DPNA 2W00A 3REOA 4JGZC 2DCEA 1H30A 4LK7A 1G9BA 4N53C 1YYVA 1X19A 5CKTA 4OHWA 4I3PA 5FO7B 4RMNA 2VNOA 1WLTA 1ULPA 3EJKA 1XDUA 4DBQA 3D8CA 4IL6C 1CZVA 4HPKA 2F5VA 1RVF3 2ZJQF 5B4XA 3FM3A 2JG8A 1AXZA 3WINE 2QDRA 1TME2 1W8WA 1WD4A 1GVJA 4GFBA 1CZTA 3VYRB 1OQEA 4DS0A 3QYEA 2YGLA 3ZMZA 1HXDA 1QBJA 1RUE3 5L7OA 1JYIA 1O3RA 4UWDA 4RS5B 4C3IJ 5C4JJ 5CFCB 2WWSA 2ZMEB 4A3KJ 1UY2A 1NX9A 4UY8I 4U88A 4EM0B 2IFWA 2VZ1A 2ZHNA 3I59A 1ZZCA 4FPEA 3PMEA 4NIHA 3AL5A 1O59A 5BNPC 1I6HJ 2ZS6B 3BR6A 1PMJX 4PIYA 3RQ4A 4NAOA 2ZGSA 3LSMA 4QX7A 1C8M1 2DFBA 3SFZA 3JCIA 2B9VA 5EDNA 1EH8A 1GQPA 5FPLA 1R64A 1S8NA 5KC5A 5GZGA 3VSKA 1R091 1YFYA 2RR13 1VQOI 1H2NA 2X1EA 1AYN2 5FZKA 1VQ4I 2PMUA 3ECHA 4ZXEA 2A70A 4A3LJ 1RXGA 1HF0A 4FFFA 1R1UA 1E3PA 4JOMA 1VBD1 2Y9ZA 4XJAA 5CIRA 3IPVB 1TNTA 4NBQA 2HJIA 5FUNA 3ZN6A 2FEZA 4Y17A 1O5LA 1JZ3A 5J40A 2R5ZA 3LWFA 2W82A 2BHYA 2VN2A 4CU8A 1JT0A 5IT9K 1ODDA 4COWA 1A6QA 3A0KA 4MHUA 4JX0A 3LMMA 2OYZA 2P6HA 3MICA 2VZSA 3BPXA 5I0TA 3GZEA 4AHYA 4LNVA 1HB4A 3MN2A 1O57A 3HT2A 1UXZA 2JJ7A 2H8RA 4G3YC 5A6XA 4MHGA 5JIUA 2V72A 5LGUA 3AZXA 4YW6A 2I8DA 2C24A 2EB7A 3Q8EA 1KA8A 1HDDC 3JBG2 1QHGA 2RJLA 3D4KA 5BQTA 1YRZA 2FOKA 3LDBA 3ZPOA 4BY7J 1JMUB 5ACA3 3AAFA 2XUEA 2WA0A 3I7DA 3POFA 5CADA 2D5HA 1VR3A 3FHNA 1VAKA 4C90A 2VXRA 1DU3D 2A61A 2DMPA 1V6LA 3H1CA 5JMCA 2BY3A 3HPNA 2VM9A 2DMUA 2EXKA 1Z0HA 1TBXA 2GOMA 2DOAA 2V1XA 3IL2A 2VQAA 4IRHA 5EG0B 3I3QA 2UYBA 2HZTA 2ET1A 2Z4FA 1SMVA 2W9XA 3NWSA 2CHHA 2P6SA 3RKYA 3ZGKA 2XPJA 1R1VA 2BWAA 4RGAA 5FKLA 3UKNA 4B4CA 4AYBN 5JWPA 3CC2I 5J7MA 3AL6A 4IEUA 2AENA 4D7TA 5B2GB 1MEC3 1W5CC 3RJPA 1S2BA 3PFYA 4UAPA 1W0TA 1ZQ3P 4NN0A 2QJVA 4HNTA 3R0AA 4EN9B 1U0AA 3FXMA 2E2JJ 1U5XA 3ZQ7A 4M3BA 1SLIA 4QPWA 3PSFA 3HGYA 4XFBA 3DU5A 2I2SA 4YW3A 4GB33 4LBJA 1P8JA 1RTVA 3I3DA 3WF4A 2ZKLA 4PBOA 2W87A 4M6XA 1MIJA 1NLSA 2E7TA 3CF2A 4EM1A 5DM6F 5A70A 2NP0A 3IM0A 1LGCA 1BR2A 2LROA 3I2KA 2FMLA 2X6XA 5J98B 2Y6FA 3MZ8A 3V8KA 4P9GA 3BTZA 2QQNA 1JT6A 1H89C 2OVUA 1IN8A 2M0CA 3FMRA 2IWGB 4BEHA 2VY0A 3LFKA 4Z2YA 4ENKA 1J3PA 5FJ8J 4Q4W2 5DG1A 3QRFF 1QEXA 1GZTA 3WXPA 2TCTA 2UWCA 3ZFEB 2YV8A 2JKBA 3ELNA 4QLCU 3B69A 3OY9A 1NCQB 3A22A 4S2FA 3I3BA 3ON7A 1XNBA 4NWVA 4LIUA 1ZREA 1BMV1 2HH9A 4YRDA 5GZEA 2DA5A 4INDA 2WADA 4ENNA 4Z07A 2E7QA 1VBA2 3S7EA 4XN3A 3CCVI 4XLFA 2Y0SA 3CCJI 3FXQA 3LKJA 1Z3YA 3ZDVA 4F7ZA 4NDLA 4AQ6A 1RUH2 4IETA 4L8QA 1BVVA 1DLLA 1WW7A 4XMAA 1K3IA 5EFUA 4L99A 3JW4A 5T5PA 1FY7A 4XONA 3CCUI 1XYPA 5FZOA 5H2FC 2ZX1A 5CPRB 3KD4A 4HKWA 2WNVB 2IJLA 5IK7A 4BS9A 2VZRA 4FP3A 3PVEA 1NK2P 1VRH2 3AFKA 5LBBA 2AZ5A 2VE9A 2HYXA 5C8CA 3AKQA 2HPIA 5J4VA 1EV11 3PLQA 4C30A 4XCBA 1POV3 4JAAA 4V19K 2Y33A 3ZFGC 1DYKA 1SPPB 1DQ2A 4G6DA 1Y7BA 4IESA 3ZR5A 3NNMA 2CGPA 2HLEA 3OGVA 2EJRA 4NPRA 2HOAA 4ZXKA 2R7RA 4MX3A 4Q8LA 4E7KA 3LSHA 2WN3A 1HOMA 1XPXA 3POSA 3BTXA 3P6BA 2O1QA 4Y20B 2RS33 3Q8AA 1VBE1 5JR3A 1SVMA 4ZYGA 2VZPA 1XRUA 4P9IA 4OFGA 1UKGA 3VB9A 4CU9A 1Z21A 3PNVA 3TBDA 2F4OB 4EJVA 4W6YA 4BL0B 3ST7A 1YO8A 2WJSA 2Z99A 3PDQA 5JOXA 3TAYA 4HX4A 3KYLA 3K1PA 4LLGF 1RUG2 2IZWA 1WW6A 3A1YA 1H9WA 3H50A 1HJFA 3ZXAC 2HQNA 1XNAA 3ZR6A 4IJAA 2DFCA 5E89A 5ANNA 5IVJA 4YZ4A 5IT9Z 2DYCA 3C2BA 4OU0A 2RVAA 2G9ZA 3POIA 2R5YA 2BV6A 2ZO4A 1OKQA 3RYPA 4CU7A 1OF3A 1MVQA 3ACGA 5FZHA 5GZFA 3KGLA 4NPLA 4CCEA 3DP7A 5KHIA 1MGTA 5KHGA 2A5ZA 4DXRA 3IIIA 1KONA 3ZOIA 5KNLA 1CF7B 3MV11 3ACIA 1K4TA 2CGOA 4A6SA 3HTUA 4ZYAA 4Z2AA 3FMQA 2FQ4A 5FJKA 4IUGA 3ECOA 3I2OA 2WWJA 4QXKA 4YIFA 5IFPA 4YVSA 2WA3A 1XOYA 3WG2A 3UYJA 5KAFC 1QJY1 3I0TA 5BNOB 4ITVA 1CX4A 4EJTA 4RR3C 2QVSB 4EE2A 1YITI 1FNZA 3BR2A 2Y34A 3D0JA 5GADJ 1GZWB 5LW9A 3CF5F 2DUPA 2R073 5L9VA 4DXZA 3FBMA 4RGGA 1PVEA 4QQHA 4U36A 4IEJA 2UURA 3L2HA 3HZJA 2PMZN 1H8TB 1X7NA 3AZZA 4ZH4F 1DPRA 3DBRB 3CDIA 5GTIC 1MJ9A 5LK7B 5C4WC 2L9VA 3QAHA 2QQOA 4RAFA 1WJFA 2GBYA 3CC7I 2V9PA 2XJUA 4RA2A 1W2TA 3UK9A 1S7EA 2TDXA 1DU6A 5E8IA 2OKXA 4B4QA 2MD5A 4EJWA 1HW2A 1Z0XA 1K4SA 1R083 5DD8A 3J7HA 1LOFA 1O3QA 5I0RA 5DS9A 2D3RA 3E0JB 1J1TA 3LSEA 4ENMA 4Y52J 4EQQA 4N53B 1NOVA 1Z9CA 1WZXA 5ERLA 3V8LA 3IAQA 3VD7A 1BJQA 4UUSA 4BZ4A 3G1LA 4TSVA 1OMIA 1C28A 1US3A 4GWMA 4JHZA 2WAQN 3SCFA 1CAVA 1COV2 3OS1A 3OYCA 3ZQQA 1Z7S1 2E33A 3AKPA 3LFIA 2CDPA 2VE1A 3S2WA 5FKKA 3KV4A 4COUA 1BYHA 4HV6A 2NPIA 5EWSA 1JHNA 1O7LA 3ZN4A 2QUOA 4WVMA 3S30A 1WW4A 1H6XA 5HXMA 2W39A 2ARBA 1VRBA 2G7HA 4BISA 4JKLA 1DFQA 2V26A 5JXHA 1ZBA2 4ZKTB 1GUIA 5FQ0A 1VQNI 1X1BA 2B0LA 2E34A 1US2A 1OF4A 2ZGPA 5BNPB 2GNDA 2STTA 2W1OA 4ZZLA 4A0XA 5CFDA 3U4SA 1W8FA 3VDCA 4E8CA 4AIKA 3V64A 3GCWA 2CG4A 2QQ9A 5DDJ3 1BLZA 1VMFA 4GMP1 2EV6A 3TMOA 1ETKA 3B5LB 1SANA 4LIVA 3VBOA 2XRLA 2XPUA 2HWC2 3B7MA 4JKMA 5I0DA 2VZVA 5L9BA 4HL0A 4TV7A 2VQGA 4EJRA 4XMYA 5CNAA 3TEZA 1GP6A 1HRI3 1OA4A 2PHFA 3ZXLA 1M06G 1ND3B 2VQCA 4QGNA 2QF7A 4M3CF 4MGZE 2VKDA 3GX4X 1QDCA 4LQRA 2DF7A 3SLIA 2UY8A 4LOTA 4O9EA 2MEV3 3MD2A 5FYTA 5D8AA 1JOBA 2JVHA 1GNHA 1W9FA 2WINB 4BU2A 3K70D 3U1DA 4Y15A 1O4TA 1RKTA 4B3NA 3N9QA 4JZRA 2EA2A 4GJYA 4YGBA 1MACA 1GUUA 4RGUA 4CEWB 4G8XA 2WL1A 3W6VA 3RI9A 1J75A 1RC9A 1TZOA 2ZGQA 4MGQA 1CVNA 4LBMA 1J58A 3KM5A 2KKOA 5FFXA 4UF0A 2XAGA 4UVAA 2KRHA 2FZ2A 2JMWA 2IS2A 4Z82A 2L9LA 2XF5A 4YEJA 2DA7A 1F43A 5FLIA 3DKYA 4A3ZA 5LFAA 2FCTA 4AAPA 4YYOA 3T2OA 4OIOF 1DG6A 2DA6A 1NTCA 1PHMA 4ANJA 5I0UA 3U1XA 3FXUA 3CCSI 1YI2I 3CJRB 4YVWA 1RI7A 2VJ4A 2VNRA 1JZ6A 1UAIA 1C0WA 3KETA 3DTEA 1Z7UA 1JKQC 2FSWA 3V56A 3C18A 3HIFA 2XONA 1TME1 3MLJA 2VJ5A 3ABTA 3VFZA 4RL7A 2NM1A 1LJ7A 3T09A 2WAAA 2VAUA 3H36A 1ENRA 1ZZ6A 3M3CA 2EK5A 4LHNA 2IVIB 1HKTA 4QDSA 5JPNB 5DYMA 5FPVA 4OMCA 5F6LB 4D6RA 1U5TC 4AYBA 1UQXA 2FXAA 2WZPP 3B93A 2KXLA 4HONA 3U2RA 1V6KA 5A1FA 4OHXA 2WT2A 5BPIA 1VQPI 3T8TA 3RVHA 5IOZA 4BQXA 5E3NA 1MS8A 3ZYFA 3GFJA 4URTA 4C1XA 3L2YA 4M0NA 2QEXI 2W1UA 4JKKA 4EQVA 1P92A 2DMTA 1W3XA 4W6WA 1AYN1 4MYEA 1YQ2A 4E7JA 3CCMI 2IXCA 5FFZA 4PJNA 3AKZA 1Z67A 2FOWA 2OQGA 2LNBA 4RHV3 1EV13 3UGHA 4XLEA 2DV9A 4KT5C 1ZARA 3QYBA 2YBPA 4HPKB 3WVJA 1C3HA 3PUAA 5CG9A 3HKZN 2Z5UA 3URFA 2KRCA 4IOAF 2RMU2 3N9NA 1T08B 5KVRA 4MGKE 5KXDA 2VOVA 2RM22 1OKOA 2QBXA 3NV3A 1WI3A 4P96A 1H2MA 4KUMA 2ARCA 1MMSA 2JWTA 1SQ4A 3GMEA 2DQLA 2M7BA 3VSLA 1P4WA 1PUFA 4BOWA 1X2MA 2J22A 4DOZA 5LLQA 5M5YJ 3WNKA 1VTNC 3I58A 3M4OJ 4A45A 1LCLA 1JZ2A 5T50A 3J7ZI 5IVVA 2N7GA 1WH5A 2R0QC 3RZDJ 1YFHA 2ZXWH 5TGTA 3JBG1 1NLRA 2D6OX 2DMNA 4OQ9A 4B29A 3HT1A 3GJBA 4OAYA 2VI6A 1Y9GA 3WD5A 3PO2J 1PUEE 3ZXFA 3M07A 5FPXA 1REPC 4KN4X 2O8XA 1X3WB 1DGLA 2JB4A 5K0UC 3DPLC 2HEYF 3M2MA 4A7ZA 4M4RA 3CLPA 4DZPA 1LECA 2LTNA 5GAEJ 3OR1C 1VIWB 1FTZA 5FKMA 3H7JA 3VBSA 3AMNA 3R4DB 3ZFFC 1D0YA 4Y1ZA 2WNUC 3VKMA 5CVRA 4DBRA 1YIJI 2DOFA 4K7JA 2O9LA 4R9DA 3ZXGA 3ZFGB 3LF7A 1PMIA 2XR4A 2O61A 3MHZA 3G1OA 3ZN6B 4Q47A 1XSVA 3FXRA 2LY1A 2GC1A 1AJOA 1QOTA 5JXIA 3PMSA 3GM8A 4OZXA 4RLQA 3RZHA 3NJXA 3T5XA 2WFF3 5LRSA 1XE7A 1BK0A 4DY3A 2Q2EA 3LZZA 2AGSA 1V6IA 4TTGA 3E6DA 1RUC3 1UZVA 4HVRA 3LSRA 3TN93 3LFUA 3H0GJ 4YM0A 1SDWA 5D2AA 2ZXJA 3P7NA 1ULOA 3LQQA 3S16J 2KP6A 3AP7A 1EPWA 1X8EA 1B9NA 4NO4A 1PK6A 4LEJA 4C2UA 2YC2A 5A33B 2HQ5A 3BJOA 5F0CA 3FUOA 3OL3A 1C1LA 3BJAA 3R05A 4DQAA 1YO5C 1Q1VA 3O3KA 1LB2A 3RWNA 3HRMA 1R5GA 1SAUA 3RQ0A 3BQZA 2L5QA 2CTVA 1GP4A 3N7MA 2W3JA 5FJHA 1ONAA 5LHIA 3D82A 5K9YA 3QQAA 5F3EA 1DDLA 5LBCA 5A6YA 4Q4W1 1X4OA 2BFUS 4QKDA 2MGQA 2RC4A 3PUQA 1NE4A 4OMZA 3L00A 1Y9MA 3THPA 2EZIA 1EUUA 3TNQA 1YW8A 1AVBA 3G73A 1QGLA 2WT1A 3AYDA 4FQZA 2JDHA 4K21A 2GM4A 1IGNA 2P34A 1VBA1 1ZRCA 4PSXA 5DQ0A 5F08A 2VMDA 3P9KA 4BHBA 3AG1H 4KI5M 4CICA 2QTWB 3LL7A 4CDQC 1MQTC 1RUH1 5D6FA 3NJVA 4MADA 4PCRA 2VUAA 3C7EA 1ETXA 2V1DA 3KT7A 5C6CA 4N43C 1Z7S3 3DU6A 2LBFA 4A3CJ 3C7HA 3OB8A 3MIHA 5L9RA 3KT4A 1V00A 3MWMA 1RXFA 5F04A 3WSOA 5L3CA 3KQRA 4KN7X 4CP9A 4XIKA 2K0GA 3EDPA 1VRH1 1FP2A 4P02B 1XNDA 1OJLA 5KBFA 1D0XA 1YE9A 1JH5A 4OUMA 3ZQIA 5GAHJ 1A8DA 1ON1A 2LC2A 5DXDA 1SHWB 1GYKA 3T1BA 5GLVA 4CZSA 4QD2A 3WP4A 4CEYA 3HG9A 4S2HA 1NZCA 2JG9C 4GRIA 5DZFA 1LHWA 5L3FA 5FWJA 1QJFA 1R23A 1D5YA 2YPJA 4D7SA 1MSEC 4LG0B 1TNFA 2PMZA 2P17A 4PI0A 1T95A 5C4WB 4P5YA 1H1AA 3VYSB 5J1UA 2VKVA 1FOD3 2DT7B 2VVEA 1K61A 3WTUC 1PIV2 4EN6B 5FXVA 1S55A 2MC3A 3ACFA 4V2WA 2JA5J 4GMP0 4JRAA 4A42A 1IKQA 1BW5A 1WGPA 1UG0A 5IVBA 3CDLA 2WA4A 2X85A 4MQ9F 2RS12 1OA2A 1RUI3 1A31A 4YW2A 1WCUA 3WHUA 1WJAA 5IK4A 3MI8A 1EH7A 1ZX5A 1RUG1 5FKNA 2XQRA 2IVMA 1N1SA 1ZLKA 1O3SA 2AEZA 1LEDA 3I8TA 5E79C 2PHRA 2WAQA 1QOOA 4JBAA 3ESWB 1P6RA 5EJCA 1CN1A 1HQWA 4QPIA 3VD5A 3V0BB 1V9U2 1LFUP 1G9CA 3ZMSA 2ZAAA 3KCCA 1FI2A 2VTXA 3OYWA 4BQ1A 4FAGA 4G94A 1ACIA 1O4XA 5KHHA 4GDFA 4XCAA 2RDNA 4Q29A 2AH2A 1O3TA 1SC7A 1V54H 1GR3A 1EUTA 4WVWA 1LJ9A 2L9SA 2CWSA 5C8CB 4NMIA 1OLRA 1T38A 4HANA 1LVKA 2DFFA 1N1YA 2X6OA 1Z78A 2D7FA 3HUGB 2H6BA 1NLQA 2K4JA 5C3QA 2G9FA 3GUDA 3WLUA 1ZRIA 3QBQA 1QGPA 2QM3A 2NOGA 1VBC1 2GC3A 2OPTA 3WNLA 1QJX2 2J1AA 2GQQA 4OIQF 3SMHA 1W6QA 1DYPA 4K8FA 1VMHA 1JOPA 1RUF2 2B42B 2ZKZA 4RFRB 3FF5A 4K2EA 1TWFJ 1TW2A 3QPTA 1BN5A 2R6QA 3JRDA 2B63J 5FMDA 1FX5A 1NCRA 3AYCA 1XMAA 3SXYA 3CNAA 4PI2A 3QLQA 2WY8Q 1L3JA 1AR62 4QM8A 4NIIA 5BPDA 3IH4A 3OG2A 4BQ5A 1GWKA 4AHZA 1H9PA 3CMEI 3H9JA 3HEFA 5G04L 2LYCA 1R6RA 2PLYA 5FMOS 4FISA 1WWYA 1CAXA 4A6DA 3R60A 5JI9A 1IDYA 4NHLA 3B6CA 1QJEA 4JGYA 4L0PA 2A68F 3TP0A 2IS4A 4IEOA 4DGWB 4N4OB 1U5YA 1KZHA 4KIBA 1QO0D 4XF3A 4HBNA 1T6GC 1B72B 2C6SA 4C91A 4LORA 3BN6A 1AYN3 1USSA 3LD8A 4D0PA 1V5GA 2EIGA 2GH8A 2WR9A 1RGSA 3HBKA 1NA1A 3BG3A 3S14J 3AMPA 3HOBA 3VBRA 1UIKA 5GLTA 1MBGA 2Y0IA 1R00A 5LA9A 3HBLA 1COV1 3W9AA 2YUEA 4YGDA 5L7OC 4YVSB 3K4DA 1YIFA 1WJDA 3LAJA 5BMZA 3T08A 4CXYA 2PMHA 2JUCA 4GD4A 4QPYA 4XF9A 4KMFA 2NVXJ 5FPAA 2BPA2 4EGZA 4ZYEA 4FTHA 2HDCA 1W28A 4NUBA 4ON0A 4EGYA 2Y69H 3VZLA 2WWUA 1XSRA 4CXXA 1FOXA 4OOIA 5GZDA 2XF6A 5ILUA 3MFCA 4UB6C 3ZMUA 2WQZC 2K3PA 2Z1DA 3BOQA 1U5TB 3JBG3 5HPOA 1N3PA 2CFXA 2TBVA 1QXPA 3ZPYA 4TYSA 4AVSA 2FE3A 1GANA 4M71A 1BOAA 4IHTA 3H8UA 2BY2A 5KXBA 4BBSJ 4CA9A 1IOAA 1UZYA 2HWC1 1B9MA 4N4NB 5AIPA 3GTQJ 1CR7A 4CDUA 3AZVA 1RIRA 2ZHMA 1ZBE3 2EV0A 3A7QA 1DZQA 2R3SA 3NRUA 5HS8A 3CLQA 2KLOA 1ENSA 4XNFA 1W8ZA 4BLJA 2L4AA 5TRDA 4E7SA 5C8WA 3VHRA 1ZELA 5H9PA 3IAS2 2JICA 3O8HA 1CESA 4YLZA 2X5IC 3ATGA 4ZU7A 2IA0A 1JZ8A 5FO8B 1W6OA 4U0WA 4UUSB 1GOFA 1ZM1A 3C3WA 1JKOC 3ZP5A 1SMYF 1RVF2 4UW4A 1R7JA 4NNJA 2RQPA 3ACLA 2QKLB 4I0BA 1YFUA 4LO7A 3IHUA 2JRTA 5GP9A 2F17A 2A6TA 4KA4A 1Z7LA 2VZ3A 3HKZA 5DUIA 1HIXA 2PEXA 1NE6A 2IGKA 4FPJA 1RUE2 4GYGA 4ZZ8A 3DN7A 3MIDA 3KHBA 3OR2C 3JZVA 3OJBA 2A1XA 4WVMB 3GJAA 1L7LA 1SFUA 1IF1A 2ETEA 3KIOA 2E60A 3AKTA 4BE3A 1IAWA 3O2PE 5DCMA 2LS6A 1S0IA 4XRMA 2DDBA 1DUXC 3ZYHA 3P3PA 5DAWA 1D8KA 2QQ8A 1YRNB 3H3VK 1OFSA 4NHJA 3MIEA 1KU2A 2SBAA 4Y1XA 3OYDA 2E31A 2DK5A 3AZYA 4XFCA 4MO7A 1KQ8A 3C1DA 1CPNA 3KVAA 4EMSA 1VBB2 1UY3A 4I0WB 2JZYA 1E3HA 1UD1A 2QSGX 2WN2A 2VH9A 5EP9A 3WHCA 3O14A 4AVZA 4QX2A 4UOJA 3PURA 3B02A 4A3EJ 3PIJA 3B01A 5B5EC 1W03A 2DTZA 1D4M3 3ZFFB 5L73A 3OOPA 1OISA 3UJOA 4B7KA 2WNUB 5EGOA 3ZDSA 3E3VA 1FNNA 2OCCH 1WCSA 4K1YA 1CPMA 2VGDA 3T0DA 1O5UA 4JTNA 4MOAA 1HA8A 2R7FA 5FZ7A 3U4XA 1G8XA 3WW2A 2ZACA 4CRQA 4H14A 2FBIA 5CYVA 1AHDP 4I30A 4YSFA 1UCXA 4QQOA 1W2UA 3VBFC 1LE8A 2VR4A 3VDDA 1I6XA 5CVIA 3EUHC 2NVQJ 1BK1A 5JZGA 4QXBA 4K3UA 4CUCA 3TEDA 1VQLI 3DGTA 4PJYA 3RKQA 4LITA 3VB2A 1PDNC 5KR7A 1FV3A 5ACA2 4IERA 5FUIA 2E5ZA 4CZCA 1UZCA 3AYAA 1UF2C 5DV5A 3CMGA 2X6YA 2ZEZA 4LUKA 2R7ZJ 3IDBB 2WZEA 5CVVA 1LPQA 1QNTA 5HCHA 1UJ8A 3ABMH 3RPUA 1WKYA 1XGSA 1JUIA 4CP0A 2OAZA 1R4MB 5EEHA 1AX1A 4HZFA 1X82A 2RMU1 4PFOA 3TQNA 3WNNA 2RM21 3NO8A 3VHNA 2VE8A 2BYVE 4FETA 1YTYA 5J48A 3GF6A 1DZTA 2X51A 5IAVA 3S6PA 5ICEA 2JVGA 1DGWA 3N4MA 5FK8A 3BOPA 5IYDJ 4JQTA 4X8NA 1MEC2 5FY0A 4F8AA 1XGOA 4ISRA 5LASA 3WDUA 1YJNI 1NQDA 5TSWA 2PJRB 5K1YA 2IW5A 1RUG3 4XIDA 1P7JA 4CDQB 1MQTB 4A3XA 5KXEA 1JGSA 1VQ9I 2RHPA 4OIRF 3EMRA 1STZA 4JK1X 3TDUC 4FFIA 4N43B 4CDGA 1R9TJ 2EA7A 4I01A 3ZN0A 1DHKB 2BFUL 4GB32 3LAPA 1MDMA 3BZCA 5FP9A 3IAM2 1FOYA 3K6GA 3I2JA 3ES4A 4PLNA 2OX0A 5AC93 2E32A 3TP3A 1EKEA 4ABZA 4CP2A 1WRJA 2X10A 3KF3A 4R9AA 3SQOA 4KIGA 1F4AA 4J25A 4ESFA 5E1ZB 2OUJA 2DDAA 2JG9B 4DYRA 3HRTA 1GWMA 5D6EA 5GKAC 3CJQB 1UHSA 1QHHD 2IFRA 4UFMA 3ML6A 4G12A 3PVBB 3U14A 3PFIA 3MEPA 3PUSA 3CO7C 1NY72 4BQ3A 4GXLA 5ICFA 3SH5A 1JOJA 4A4AA 3FBYA 1L7QA 2LSOA 1BJZA 5FD5A 2QGUA 3PL8A 1AJKA 3L09A 3J7AO 5HV0A 4WVVA 3PVNA 1AF9A 3DYMA 2DOEA 3NSTA 3OOUA 1B8IA 1FXZA 4CCJA 4DUXA 1WKMA 5IJRA 2DDUA 2UV1A 2MG4A 4EZ4A 1W0UA 3F8MA 3U75A 1RETA 1FEXA 2VJJA 3O1MA 4A41A 4ES8A 5BYNA 4M74A 3EHKA 1BIBA 3JSPA 3SFIA 4J19A 1ASJ2 1BI1A 4Q4Y2 3HAGA 2A5YB 5TJJA 3I2IA 3VBHA 3LA7A 1HSJA 5F9TA 3HOWJ 2FDGA 1A8MA 5GPCA 2BW3A 5E16A 4LD5A 4QB6A 3FN9A 1H9GA 1CJPA 1LDDA 2QENA 3OGGA 1C5IA 2XBO3 2Y6HA 1HB2A 2O8QA 2CSGA 2E9QA 2OXBA 2CV1A 4AI3A 3DCFA 3WE2A 4IKFA 5EV7A 3HOZJ 2BU9A 2B9UA 1W0PA 4ZS3A 4YZ3A 2SLIA 2VC9A 1SFOJ 3O1VA 3MV01 5A1AA 4MFDA 1KYWA 2KHMA 2RS32 1PGSA 2GNMA 2BVBA 3GNEA 1XN7A 2ESNA 3OL4A 3PUBA 3N9PA 5FREA 2WRAA 3RG0A 5EYYA 4JDOA 2H1KA 3WDYA 1H0MA 4CCMA 3WTXC 1I3AA 1WBLA 3N3HA 5E3OA 1R22A 4RS5A 5CFCA 3ILFA 2ZMEA 5JLVA 5K7ZA 4U7BA 3RTRA 1PVC3 2ATFA 1ZBA3 2MW8A 2QKDA 1HW1A 3ZYPA 4D1QA 2CL2A 1T33A 2EINH 4E7HA 5FWEA 4UV8A 4AL9A 2K9ZA 5J4YA 3I71A 5LK5A 4HDVA 2WV1A 1N75A 3H5AA 1YFWA 4XHBA 1MS3A 1LOFC 5IPAA 2JA7J 1PIV1 1U9NA 2RV8A 1ZGWA 4RAYA 1P2FA 3S2DJ 2CU7A 2GNTA 2NZ9A 3KV6A 4NC6A 1QRYA 4OHVA 5LBQA 3B00A 2E7AA 4XLPF 2W2IA 3TOAA 1HW5A 1IRXA 2WS93 5A3PA 1DYOA 1FNYA 5ERIA 2EBIA 2ISYA 1YI7A 1VI0A 2L54A 4KBZA 4AR2A 1BC8C 5FMOL 3CQOA 1OPCA 4D6SA 4V1PA 3IPVA 2O03A 2Y60A 4BMEA 1SMTA 5ICGA 3KS7A 1D0ZA 2GC0A 2BNMA 1OCOH 3ZOBA 3BTIA 1IPKA 4G7HF 5DN2A 2UZKA 1XGNA 1G3SA 2WAFA 1V9U1 4BBRJ 2BOIA 3OYLA 2YU1A 2JDMA 1V0AA 4GKXA 2L9NA 4WK8F 4KG0A 4KU8A 3RYRA 1OXCA 1FPN2 2E53A 4HV5A 3AL0B 1CD3G 4O6JA 1BBT2 2VTXJ 1W05A 3EUAA 2K9SA 2R072 3BKZA 5AFBA 3U10A 1NQJA 4L97A 5K7FA 4YRVA 4G6QA 4KIFA 3WG1A 4CEYB 4L92A 2WLPA 4RQPC 3VBOC 3PU3A 1RYYA 1YX5A 1F15A 2V6CA 1QJX1 2K40A 1UO9A 4WM8C 3BC8A 1W2NA 1IPSA 4NIDA 4UXNA 3SHRA 1WZ2A 2R93J 4L5JA 1RUF1 1R082 2O5RA 4B43A 2CRGA 5EG0A 3AZWA 3WG3A 1YUDA 1WWXA 5A3OA 2A6VA 3A21A 3O6BB 3DPRC 2OQ6A 1KS5A 3CMAI 1AR61 4QX8A 2X5IB 3L2RA 3HD8B 2IUWA 5JUVA 1SVOA 3LCPA 2DBBA 1UPSA 4DINB 4I3GA 5BNNC 1AL22 1X50A 1STMA 3A2KA 3IV5A 4MG2A 3W20A 4LOSA 2YFZA 4MV2A 5C7GA 1R1A3 1FBUA 3ZX7A 3SEQA 3F23A 2Q30A 5LY2A 2VMFA 3S5QA 5FZ8A 1CJDA 1B35C 3BR1A 4QGLA 2R7SA 5AVPA 3BU7A 2QA4I 3BG5A 5FZ4A 1FWZA 4RAZA 3K77A 3QPSA 3FBNB 3V0AB 4YARA 2GMPA 2YU3A 2H09A 1G6NA 4G9YA 2ACJA 1ULFA 1ZA7A 3UGFA 2J1SA 2CV6A 5F3GA 1U8RA 3TO7A 2VZTA 4QTRA 4FFHA 3OOXA 3W2VA 5DDJ2 1JBCA 1ZYRF 3HOYJ 2R7TA 1R5HA 2MFZA 4XJ8A 1R4NB 3V8JA 1K5JA 1HRI2 3NJYA 3J81K 2G7UA 2M5WA 4D69A 2A3XA 1PP8F 2WSVA 4KWUA 3DBHB 4AUXA 4WF2A 4QXCA 3LSPA 1NCQA 2LF7A 2MEV2 4XOPA 1OT5A 4JDMA 3JR9A 3C2UA 5F32A 4DYQA 3ETQA 1K6OA 4B8EA 3M3YJ 4A5NA 4AGGA 1X3UA 1Y56A 5F0FA 1D1AA 4E70A 2VPLA 4M3CB 4TZDA 2ZX3A 2VUMJ 2M4KA 3W2AA 1ONVA 3L2UA 1IN7A 2DBIA 1FT9A 2W57A 4JGYB 1W99A 1IS3A 2FDIA 3HYIA 4RGSA 1GFF2 2MC4A 5GLWA 3VBFB 3BR0A 3O0XA 4JV4A 1UWWA 2WNVA 3UNGC 4OYUA 4AD9A 2OA2A 2V4VA 5HDKA 3MF6A 4CDWB 5GALA 3BUCA 4B44A 3DL3A 2EFOA 4RLFA 2JXAA 4HEA2 3SZPA 4XUNA 1IHMA 1WH7A 4A3BJ 3VDXA 4IE7A 4QQ2A 5F0HA 3WP3A 3TDZC 4WM7C 1ND2A 4AE2A 4FTSA 1GXQA 2UWAA 5K4LA 3BCBA 4IV1C 3GHMA 4P9JA 2E1MC 5GLZA 1RVF1 3HSFA 4OULA 4P5OA 3VKLA 2LKSA 1Q1HA 2XAQA 3C7JA 4E7IA 1P4AA 2DTYA 1RUE1 1OVPA 4A6OA 2AQFA 2R7DA 4FOQA 2WC2A 3OPTA 1WBFA 4XR6A 2HWVA 2TNFA 2FNPA 1LHUA 4IW3A 1HDKA 1BA5A 1HXS3 3RI4A 3DCQA 1JW6A 4S05A 4XTMA 4IXLA 2ZEWA 3EBRA 3CLOA 4FPHA 2QQIA 3ECQA 1JYNA 4D8MA 2F4MB 2E26A 5BXXA 1QPMA 1U2WA 5LA0A 1MS9A 3AC0A 5IT3A 1UPIA 1YNAA 2RVCA 1LOGA 1ZLJA 5C3SA 2Q1FA 3QP5A 2R063 3NARA 4QPQA 3Q8BA 4XE9A 3H9GA 1D0GA 2RV9A 2XLGA 2C0ZA 1QZZA 4S04A 1KGSA 2XJTA 2D5VA 3AG3H 4D3WA 1GDTA 1BIAA 5ABJC 1X58A 1LENA 5GJ6A 1P7IA 4RHV2 4B1MA 1U8BA 2R0FA 4GXOA 4M6YA 3F0CA 2CY6A 3OBRA 2FQPA 4N8MA 1CF7A 5D5VB 5D1IA 2ID4A 3OBZA 3W5MA 3AMHA 3FZ3A 4CXFA 1J2XA 4G6TB 2PHLA 2VMIA 3O1RA 4CZZA 1FMVA 1J3QA 4BIFA 1QU0A 3CU7A 2H94A 3EYIA 1D4VB 2ZJPF 4D6QA 2X0LA 4B48A 5T5JA 3HHHA 1DP0A 3DXUA 5LGTA 2DURA 4NJ4A 3HOUJ 3KEYA 5H6RA 4ZDOA 3T1LA 1RC6A 4Q0QA 2VW0A 2L4MA 2X8KA 5FY1A 5C9AC 3NKGA 2RAEA 4DZGA 2NLRA 2DU0A 2D45A 5LHGA 1C1FA 1BI3A 3GYHX 3T0BA 1RINA 4PGHA 2MPFA 2XGXA 1Z77A 1S3JA 3AP4A 4N9IA 1WUVA 1QVTA 2P37A 4BXUA 2PQQA 5EXOA 3WDTA 5ACA1 1EPZA 3POWA 4B4PA 1GZWA 2M7AA 4YFWA 5F6KA 3WF1A 2VONA 4C2TA 2RJ2A 3VHPA 4WCGA 4I2OA 3GLXA 5BS6A 3L9JT 3WNMA 1GKBA 5EYXA 3VEPA 1OD3A 3KT1A 1H8TA 2ZGTA 2K2SA 4UFLA 4B47A 4JQRA 4LHLA 4R8HA 5DDGA 1V3FA 2HWB2 1ON2A 5D8LB 2KQRA 4IHVA 5FFOC 1JYWA 4Q2FA 4DRRA 4FPYA 5LA1A 2W48A 3FMGA 3PJRA 5A3MA 2K9QA 2VCCA 1YXWA 3J8F3 4J1XA 1LDJA 3WHBA 2IT0A 1RUNA 3FKIJ 4IV3C 1NG6A 1HB1A 4JGZA 2RS13 2DUQA 2ZNYA 4Y26A 4N53A 2ZKNA 3OUJA 2WIIB 5DMYA 1G2HA 1GOHA 1OH3A 1MEC1 1YS6A 2HGCA 3VLBB 4KDPA 3OYFA 1H4HA 2BBYA 3KZIC 5H9SA 2CAUA 4XOGA 5F2WA 4KG8A 3JD73 3MPBA 4BY1J 2WFF2 1JYVA 2QQVA 2ZXIA 4ZS2A 1SDDB 3FFZA 1LVAA 3J81Z 3IWFA 1RUC2 4UI9L 3W3CA 3TN92 5LEKA 4GB31 2C4XA 3WQ0A 3O8GA 2V5DA 3LEKA 2HU9A 3I3LA 5FDBA 3CJTB 1TEIA 1GQGA 1N1VA 1XCVA 1JHJA 2UWBA 5FLXK 4A7KA 4JRLA 3Q0VA 5A7WB 2DLLA 3NL1A 4AFMA 4CXWA 1IXRC 3OYHA 5BNPA 2LD5A 3G4SI 1LEAA 2DYSH 1URXA 3SEPA 3K4LA 5FLVA 3QACA 3JXSA 2A75A 1FATA 2R7XA 1BEV2 1XC6A 1HQLA 1WHUA 3EUKL 1T2KA 3GF2A 3P5BA 4META 1VQ6I 1G59A 2WO1A 2B5HA 4XMIA 1IG0A 1NY71 2W1QA 4FO9A 2KJCA 2UUZA 2IGNA 5CU1A 1RPWA 5EZHA 4OMDA 3R61A 4QIWN 2CUFA 3DPTA 4FOWA 2P3JA 2G9WA 1F9KA 4HF1A 2HYJA 1LFBA 2AC1A 4BCUA 3F21A 2J1UA 3WU2C 3WV6A 5F5AA 2CQNA 1ITYA 4QPIC 4U2AA 1R58A 3MCZA 4WX9A 1U5ZA 3MW3A 3IMMA 4M9SA 4BA6A 2W95A 4ORFA 2LALA 2F6CA 3JRBA 1EJ9A 2DVGA 3CMYA 1AHSA 2VB6A 1AKHA 2WKKA 2MABA 2GLOA 2F5EA 1OYWA 1Q8OA 3MIFA 4AI8A 3RZLA 1ASJ1 3QP6A 1IDZA 1F8VA 2UWMA 3BTYA 4Q4Y1 2W47A 4KITB 5H9RA 5EHDA 3POBA 3S17J 3NQOA 3T1MA 3T4VA 4M3FA 4PCQA 2I10A 1H6YA 2R7EB 3S93A 4IEZA 4HRIA 1NT0A 3ZLIA 1TVGA 4XLCA 4V2VA 4RQPB 3QU3A 2O0OA 1L7RA 1NYWA 2K9NA 1FOD2 2BE5F 1RUD3 3MF9A 3D5RC 1O4ZA 1REEA 4Y5Z0 1HN1A 2RS31 4NB5A 2EFNA 1IN4A 1ULDA 2ADUA 2AXTC 3ZMDA 1RUI2 2E7WA 3WUCA 2W92A 5D5XB 4FPCA 2D6NA 1J1LA 4V2GA 2GXBA 3OYAA 3DPRB 2ZOEB 4HKOA 4Q0VA 5HLIA 1B8IB 1YI9A 4IE6A 1SD7A 1MNDA 4LLNA 4RD7A 3U9GA 5BNNB 2J7MA 1AL0G 1IG3A 3M70A 4AVBA 4NROA 3T0AA 3AMMA 1K5MC 3OIOA 1K83J 1RL3A 1S9HA 3KWVA 2DODA 3M7GA 3DEWA 1XGMA 2EV5A 4A44A 2UYAA 4XPVA 2YYOA 4BXFA 3P5JA 1W5SA 3K46A 1YW7A 2BXYA 2Z69A 3OIQA 1TT0A 3DEUA 3OUHA 4M72A 3VODA 3OF1A 4QWQA 1XJAA 3VBHB 5FMCA 1NG7A 4XACA 2FBEA 1OR7C 4P9XA 4II2A 1JUHA 3B6AA 4HF2A 2BW3B 2EPFA 4AEMA 3HQUA 4ONUA 4UW5A 4FCAA 3LE0A 4S0HB 3IRQA 2NVUB 3S1RJ 3RSNA 1X8MA 4QX1A 2EXJA 1TQ5A 1WCDJ 1UKRA 2WO7A 1FYUA 2BERA 2IXJA 1S0FA 3VV1A 2JSCA 4L9VA 3BODA 5JSOA 2ZSHB 4PJJA 2CV0A 4CDXC 5M0TA 1W36C 3B73A 4YM3A 1E2XA 5LGNA 2HTJA 2WZ8A 2M1BA 3H9QA 4IPAA 4DQ2A 2LKXA 1PGL2 4BE1A 4R52A 2XGDA 3HB9A 2CNAA 3TO6A 2ICWG 2LRPA 4AQ2A 4EN7B 4EVIA 2O8KA 2R7VA 2LREA 2LTPA 1KD7A 1V70A 1PMHX 2WY7Q 4G7OF 2FCUA 4AVVA 1FPN1 3I49A 3OD0A 3COAC 3GZAA 2VPRA 4LLFA 3EETA 2XUBA 4MO3M 5FZIA 2HFHA 2R071 1XD7A 4E7ZA 1YX3A 5E1RA 4PDKA 1HLCA 4C1WA 3C3VA 2DVBA 2ZGRA 3BIEA 2QSHX 1IG7A 2ORZA 5SV5A 3LNQA 4PQQA 3ZYJB 1FP1D 4HQMA 1Y0NA 2DTRA 1XE8A 5D4SA 4W65A 1IXSB 4LO8A 3VZNA 4FPGA 2DUOA 3O1UA 3NNLA 1VBB3 1T2XA 1MH4A 4AEJA 3TKYA 1YC61 1HC8A 4OI1A 1R081 4XKWA 2LM3A 3D3AA 4TXWA 4NHYA 5A7QA 2V4JC 1SG3A 2VZQA 2VQ0A 5FLXZ 2JEMA 1XG1A 3VKFC 3PNYA 2A7AA 3ZFGA 3TBIA 4IV1B 3KP4A 3JCUC 3S8PA 3W6KB 2E1MB 1AL21 1OOPB 1R1ZA 4ZTFA 4RS8A 4IOCF 2NS0A 4C9YA 1GU3A 1JU3A 1YJ9I 2JJ6A 2ZABA 3K3NA 3WR0A 5FLJA 2XPVA 4XUOA 4DYCA 4AIHA 2NNNA 2YSRA 2QQMA 3LAGA 1POQA 4XDOA 4JYKA 4XQFA 4FAHA 4CO8A 3HPGA 4AG4A 2TEPA 4BXSV 4XORA 1E17A 3QODA 5LCWL 4UBHA 1VE0A 4JX4A 3Q0UA 4L9JA 3ZSLA 4AI0A 4XF1A 5FYUA 3RJ2X 4HX7A 5JPMB 3HQXA 1UHWA 1ZRRA 4L5EA 3LEGA 1S7OA 1R5ID 5J8FA 4HF0A 5A33A 3SKVA 1WCMJ 2EXIA 5DDJ1 4RB1A 2WO2A 4LBLA 1OLQA 2VOOA 3K2AA 3H7YA 2E51A 4QHZA 4OLLA 3HJRA 1WCKA 1ZBE2 2JPCA 3VGIA 1IN6A 1HRI1 2QLZA 3JTHA 4C3JJ 5KK1A 3UV9A 5J36A 2ELHA 5ABJB 3A02A 3UR3C 1JJ6C 2MEV1 3ZCOA 3N35A 1MS0A 4EWDA 2DA1A 1IQDC 1MR5A 3RCOA 1HLVA 3ITQA 1N1TA 2VUCA 2RDPA 2ZJCA 2BJSA 5C5TA 3NKTA 4ZDLA 1UX7A 4ZTJA 5E3MA 5HBAA 4F3QA 2UU8A 3KYDB 1CIWA 4PDWC 2W25A 1SZBA 3MLLA 1OHFA 3FJSA 5C3EJ 3DXTA 1FJLA 3P3NA 3DECA 1VQMI 2D6MA 2B4KA 4PLOA 5HXVA 4DW6A 2PHXA 4HOOA 1DBNA 5C9AB 2OPKA 2PG4A 3ZMVA 3DFGA 5FMBA 2A3YA 2FBHA 5I8YA 2F6BA 4P9WA 5DUWA 1W8UA 3I64A 3D5SC 4TLGA 3NVCA 4UW6A 2PAEA 4P5HA 4Y4YA 2GAUA 2G19A 1OA3A 2AYHA 1ZG5A 1BJAA 2EZKA 4GCVA 2LVSA 2H0BA 2W94A 4H3WA 1RJ8A 4XUTA 2EIBA 2VJXA 2ZJRF 3FHAA 3ZVXA 3P9CA 4LG0A 2XVLA 2QQAA 5C4WA 1DIWA 4ASMB 3HHGA 1ZZ8A 3MIGA 5BNGA 4PIZA 3A0BC 3DXJF 3AJZA 1D4M2 3FDYA 3U78A 3K10A 4IEQA 3CD6I 3I5UA 3IT8A 3B9CA 5M5XJ 1MSFC 1ETVA 4MXVA 3SH3A 2W0XA 4PUSA 4WV8A 4LBKA 1A5JA 1E5HA 4WWCA 5CQGA 1JODA 4BNCA 2FF4A 2Z5WA 1W8OA 3WE3A 1FX7A 5DD4A 2A6ZA 2HVQA 2R4GA 3I54A 4XJWA 1R1TA 3BTAA 3D6EA 3VD9A 5DUKA 1KXGA 3N7JA 4GYIA 5HLHA 1VQ7I 2LP0A 5A3TA 2JQ7A 2VIXA 2P5BA 1PJRA 1NXMA 2CQXA 2KRFA 5CISA 3V0BA 4FOYA 4CVUA 3OSFA 2XKPA 2JDPA 4FCYA 4P9UA 4MGYE 4F3JA 2BVLA 3NNJA 2Q8OA 1ASJ3 1XB9A 3P1IA 1Q56A 5EQUA 5C4XJ 3JAMK 2NYXA 4Q4Y3 1JZ4A 4E2SA 5FZ6A 3B9IA 4XQ4A 4AFDA 1DGWY 4UNOA 1PO23 2PELA 4RHV1 4AVAA 2IVJA 4IHYA 1S0GA 3HUGA 2OIIA 2XJVA 1ND2B 3IP4B 4KICA 2HQAA 2XH6A 2CYYA 3DTIA 1POV0 4AWXB 5H9QA 3K4ZA 4EWAA 3THDA 1ALYA 3AP5A 3LFMA 2BNOA 3ORJA 1F2NA 5BY5A 3VD3A 4ESBA 1UU6A 3BJ6A 4C2MJ 4NHKA 1NXD1 1FYMA 3H8XA 3SDGA 4CGZA 2VO5A 1F1ZA 2WYSA 2CJJA 2C6YA 1SLAA 5FP3A 3HN1A 1GT0C 5K5OA 4PF1A 2BNNA 4P00B 5HNFA 4Y13A 4QDRA 3HOTA 3VBUC 4HDUA 3DUIA 3ZIXA 1YEWA 2I5UA 3AFHA 2VUJA 5SV8A 3IB3A 2P0WA 3PNAA 1JTZX 3N9LA 2BZTA 4U87A 3SCGA 4IE5A 4LBQB 1KYZA 2V9VA 4XXAA 3OGRA 2L9RA 1K6YA 2I07B 2HWB1 3OSDA 1MS4A 2P81A 1ZRDA 2QVOA 3PU8A 1GVDA 4PHZA 3WNOA 5AC92 1GWLA 2FDHA 3CESA 4CCDA 2RNJA 1FLIA 3KGZA 2EXHA 1OSGA 2YPDA 1KJLA 1W6NB 3OPWA 4LA2A 2ETHA 5IW0A 5M3MJ 1T8IA 4HQEA 1B72A 5CKNA 3RJRA 2J5PA 3ISPA 4AHWA 1ZAOA 4BQWA 4C8DA 3NJZA 4EEFG 2LW8A 2ESHA 1H8VA 2WBKA 2KA3A 1UHMA 1PGW2 4XJUA 2AR6A 4MEYF 3FHIB 3H0OA 3Q0WA 2Z9OA 3N9MA 2DN0A 5DUXA 3R0RA 3UKTA 1XB4A 2NXNB 4TLFA 2V6EA 1RR8C 4MTEA 2WFF1 4LBOA 3W2WA 1PVXA 2ARXA 3PJYA 2FU4A 4LUMA 4LT5A 1A04A 1RUC1 4QDQA 3CUQC 3TN91 2WWYA 4DJAA 1Z6TA 1V5EA 2Z2SB 5FB2A 1NUKA 4KL1A 4YW4A 4CYCB 1QJZA 1RR7A 3NAPC 1FPN3 2B39A 5HVQC 1YOVB 4ZZDA 1S5LC 2OA4A 4XW3A 1BBT3 2VBDA 4TN7A 3QPHA 3GO5A 1VQ8I 1U5TA 2L7ZA 2VJIA 4LLLA 1K5MB 5J8CA 1OPOA 3CCRI 3SXWA 5A7NA 2WLQA 4Q4X3 4AI2A 2P3KA 5DAVA 3DEEA 4LOCA 3LQCA 2A6WA 4KNYA 2JTVA 2A3SA 2JUGA 4H7MA 3NNFA 5LB6A 4O65A 4H55A 3BT9A 3RGBA 3CIHA 2ID6A 4C0HA 1I3HA 4F92B 2XBO2 3HNYM 4WBBA 5FLHA 4EATA 4JGZB 4Q0SA 5FYBA 2XB6C 2P3YA 3D0SA 3RZZA 4QHOA 3KEQA 4RFT0 2KJBA 1AUYA 3CJXA 5CKQA 3EB7A 4AVTA 2VPVA 4XBLA 1QH6A 4Y1YA 4Q4V3 1SFPA 1AL23 4AZZA 1GP5A 4XQWA 3CF6E 2KIMA 2VKHA 1LU1A 3BGAA 5CZKA 3OMYA 1G4DA 2EZHA 1XXNA 1ULEA 4Q1PA 4E4HA 4RBOA 2JENA 2M9HA 2R042 2A73B 2P5KA 3WG9A 1TG7A 3I3EA 1RHI3 3CL1A 4XRSG 4OUEA 1PVC2 1XMXA 3BOWA 4BYYA 1SCRA 1KFXL 3S1QJ 4IE0A 3ZMNA 3HRSA 3MZHA 1OUXA 3F9KA 3OV8A 3IMNA 3HR9A 1NZIA 1T0FC 2QQLA 2VBWA 5I91A 1B09A 1VB2A 3WDVA 2DI3A 4RM3A 1YRNA 2RDRA 4KFCA 2IRFG 2EFPA 4BXXJ 2OCEA 3RZJA 1GZ9A 4FHTA 1FOD1 2NQYA 2X29A 3JSOA 4QKFA 2XWBB 3HOSA 1UZWA 2XDVA 5A6QA 3ULQB 3G6JB 2EAAA 4Q0PA 1MW7A 4AC0A 4AVPA 2WS92 5FZ0A 1LKXA 1RUI1 5F37A 3ZFFA 1A6CA 2WNUA 3ENRA 1AYM3 3NV2A 3RWKX 4I02A 1QNYA 2Z3YA 2EVXA 4GWIA 2E1OA 2BDRA 1ZN2A 5J47A 3EYPA 2IS1A 1JUSA 2HEOA 1PZ7A 3KSCA 2A3WA 4BMBA 3V42A 2GALA 4ZZ5A 1IKPA 2R7OA 5HS9A 3ERMA 4XBQA 2ZGUA 1AKHB 5DUVA 3BVCA 3ZXSA 4RB0A 4NE9A 4EYUA 1D0HA 1KDMA 4X1EA 4D7YA 5IY5H 4CCNA 4NRQA 3CBNA 2PXJA 2Y0MA 2PI0A 5IT6A 2ELJA 1OCTC 3ELKA 5F3IA 4Q8KA 2CU5A 4GAZA 1QOSA 5JHUA 4H7LA 5A80A 1ENHA 2EQRA 3RPQA 2DTWA 2CFOA 1QQP2 1TZLA 3SNMA 4GH4C 1TMF2 3RZGA 3RKWA 2W52A 1ZHFA 2G9GA 4KH9A 4W1UA 1K79A 1LGBA 1QXJA 2J1RA 4QQLA 5A32B 3ZFEC 2YBKA 2BUKA 3F22A 5JR2A 1NCQC 3ROUA 2X53S 2ORXA 2GU9A 1PGL1 2HYGD 1ZTRA 1NK3P 1N47A 3WP6A 4AI1A 5E88A 3CEWA 4UT5A 4PFPA 2D2WA 1FYKA 1A3KA 1MBFA 4A69C 3T0YA 2P4WA 4GKYA 1N25A 4FFGA 2PMWB 3LEMA 2JA6J 5L3BA 2D43A 3OYNA 4HK8A 4DUVA 3K4AA 3CKHA 5CJ9A 4PDWB 2PJRA 4PZJA 3M1EA 1ZR2A 4QAWA 2ZX4A 1R1A2 2RGVA 5FP7A 1XMKA 4CDQA 1MQTA 5KWRA 2R7WA 4IEYA 2XUMA 2LF8A 1U5IA 4QM9A 4R9CA 4FSJA 5ILSA 1VQKI 5C44J 1JI6A 4N43A 1BZWA 4HNVA 3OGJA 5AVAA 4QX3A 1RUJ3 2WDBA 1QHDA 4AEDC 4E6KG 5HDNA 1X3ZB 4AVCA 2Q5TA 1D3YA 2CUJA 2GIVA 2QZ2A 2ZMLA 2LUWA 5IUQA 3OY8B 2EA4A 3T4HB 3CJIC 1E0EA 5A3WA 2K86A 2YPRA 4MGIE 1XS9A 1UIJA 5FY7A 3WT3A 2ZGNA 2G4IA 2JG9A 3BTCA 5FZ3A 4B8XA 5FZBA 1TLHB 5JHFA 4ZU5A 3GTJJ 1LDKB 3H0DA 3F6OA 3EPZA 3M8JA 3R4UA 5JOWA 4BB3A 1BXHA 3D1NI 4Y4RA 2V1NA 1F4HA 1X4PA 2HOEA 3I4IA 1RB8G 3F8CA 1PO13 2VNVA 2ZZQA 3AX4A 4ENJA 3TRSB 5G05L 3IH2A 2ET7A 2MHFA 1W9TA 3JTGA 3HEIA 1UU5A 2YR2A 2QQJA 3F3XA 3OBAA 5FRNA 2FDJA 1O4YA 1DQ1A 4CPBA 3HN3A 2DPDA 3WQBA 5FV3A 4FI9A 3PIOF 4MTDA 3DBLB 3TOJA 1EH6A 2FJ1A 1SCSA 3APBA 2JDYA 3M7AA 4QGMA 2QQWA 2RQQA 1QVUA 3U07A 3MGUA 3F72A 2XB0X 1AZDA 3KCXA 2HWB3 1ZBE1 1F5FA 3LA3A 3FHZA 1S72I 5FGMA 4HLTA 1LOEA 2PLV2 2Y64A 3HXLA 2VECA 2UXNA 1QJU3 5A1LA 2ENRA 2MH2A 2XRNA 3PL0A 5IYYA 3WNPA 4PQ9A 3POEA 4CUBA 2VVDA 5A6ZA 2XLAA 4LE3A 5GPAA 1P9QC 1JS9A 4LHKA 2HKOA 4MNUA 2QSFX 3ABLH 2RJKA 4R4ZA 5E6HA 5KC6A 2EALA 5BNOC 2OQ7A 3WF2A 3BG6A 2NNYA 1F5JA 4HX8A 4ZHNA 1LEBA 3FC0A 1HXS2 3HTSB 3DLLF 3PUHA 3ES1A 3JB4C 4XUQA 2R32A 3J7NA 2AUYA 2J42A 2OJED 2ZFWA 3O0VA 1ZKGA 3BB6A 1H8AC 1W9YA 2YBSA 2D44A 2XC7A 1EF4A 2L2OA 4HT1T 3F95A 3CP8A 1ZZBA 2OS2A 2R062 1SFKA 1NG0A 3AJYA 2CW0F 3Q5FA 1G8WA 1LAJA 1I5PA 2YDEA 3I2GA 2EF6A 2OUMA 3KP2A 5HV4A 1OC1A 2DCYA 3ACHA 4QU2A 4EN8B 4UXAA 4BLIA 3FLRA 3VD4A 1JE8A 3ZXDA 4O5VA 1D5VA 2Q8CA 2RE9A 3IRRA 1BEV3 3ZKUA 5FK7A 1MVEA 1IXCA 5ISLA 5KHJA 4CPBD 2B9SA 4DNYA 1S0JA 2NYYA 2OTJI 1D4M1 2VNGA 2O8OA 2A07F 2XJRA 3K9TA 4IZZA 2WZR2 3SJMA 3MKLA 2CS3A 2RDSA 1B6AA 4KYWA 2ZTNA 2OW4A 4FX0A 4F93B 1ZA4A 2XSDC 2HNHA 5T54A 2GXAA 4E4ZA 3VZMA 3MUZ1 3FISA 3ONQA 3B3QE 2XL7A 5L36A 1J5YA 4XFFA 4BQYA 4FASD 4W8JA 2D98A 2HYFA 2P3IA 3ZMOA 3VOEA 3UKVA 1MBKA 1SFEA 3S57A 4AHXA 4HN0A 2XAHA 2VW2A 3V7CA 3RZMA 2Q0OA 3GBFA 4FTEA 3L7WA 3EO6A 1X1AA 3CUQB 5DPNA 3SITA 2A6XA 3IIAA 3IN9A 5CBLA 2OUHA 4BQ2A 4ITCA 1AX0A 1TNRA 2W1SA 3PTRB 2VCAA 3BCWA 3NAPB 2HQRA 4RR3B 1PNGA 4YFNF 2FX0A 1B59A 2YU9J 3K1MA 3JREA 4OCTA 5CEHA 1MMDA 1SD4A 3NQHA 5F27A 4XYXA 1S4CA 3FXOA 2ZBKA 2JIJA 1LODA 3IKWA 1BQPA 4ES9A 3ZYGA 3AVRA 3LOIA 2FDFA 4OUSA 3CJNA 4XRFA 4MFEA 1SFNA 1LNSA 9ANTA 1ND3C 2M2EA 5T52A 5F2SA 1XNCA 5CKMA 3QH6A 3WEZA 3J8F2 2XF7A 4YPJA 5FZCA 5JVTA 4B3XA 2RKHA 1MS1A 4ATEA 5CB7A 1APLC 4QHBA 5C71A 1QMJA 3CDHA 3AB0A 5A7SA 2PN5A 4LE4A 4HLXA 4BDZA 2X5IA 1XDSA 2P7CB 2KMUA 4CEWC 1HQNA 2IGOA 1UMIA 3JD72 4H4KC 2XROA 1D1BA 1AR73 1UY1A 3VHOA 1SFXA 2P8TA 3SCHA 2ZXQA 1UYYA 3I56I 2ZMKA 1YWKA 2JDNA 4XK4A 3DV8A 2D1VA 1JHFA 2IEKA 2KM2A 2W08A 1W8HA 1OQYA 4HSRA 2NVYJ 3TW6A 1LHVA 5FY8A 2HWD3 4WXDA 3PTYA 4I98B 2L01A 1UOJA 1CWPA 5AC91 1Q8VA 2B7YA 3FWEA 1WJBA 1MMGA 1REFA 3V0AA 4YZ5A 3QOEA 3ZRGA 5FKBA 2V5YA 3OS0A 4HA8A 1J84A 1F35A 4HAMA 4RSUA 4KT6A 2HEWF 2JKXA 4D7MA 3CDZB 4Z6YA 4CE8A 2K02A 1OKRA 1E57A 3H1MA 4IVNA 2G1MA 1XX5A 1PGW1 2ADEA 2XJSA 5D8KB 4QPGC 3CMMA 2XWJB 3H9AA 2HVSA 2YROA 3IWZA 3PUFA 1A35A 3I9V2 5CAZA 3OWTA 3H8OA 2IPQX 5F5QA 5M5WJ 4I09A 4DUWA 2EIDA 5FZMA 2FZ1A 3I3MA 1CX1A 1M1EB 3V7RA 3VL8A 3S15J 2Y2ZA 2FUG2 2VQLA 2E1CA 2R92J 2OZJA 2XXZA 1ZZ9A 1PX4A 1YS7A 4JTOA 2XHKA 4M3CA 1AWCA 2C5DA 4Y5SA 2Z42A 2FNAA 2WT0A 3F8FA 2WO3A 2QDNA 3O12A 1BR1A 2VOTA 2ZGMA 1LTEA 5FOJB 1DP7P 2HBTA 3M3EA 2K46A 3CZJA 2HEVF 3VBFA 1QDOA 5FKCA 3OEAA 4DNCA 1JXSA 3EUHA 4F55A 4F91B 5FRMA 1GSLA 3LWCA 1HRV2 4LULA 2CMPA 3H3ZA 4BJ5C 3F2ZA 4B1LA 4CDWA 4GGGA 4A6EA 2AS5F 3MW4A 2LKPA 1ULYA 1MZEA 4K1ZA 3NNGA 3HOXJ 2M87A 2XBO1 4BAYA 4IX7A 3UT0A 1CZSA 5F7UA 3F8NA 2VOWA 4LK0F 1WA6X 3GBGA 3JRFA 1XTAA 4GH4B 4QKNA 4I99C 1SD5A 1RUD2 1W4MA 4J01A 3J26N 2JG8C 4XICA 2RREA 3W58A 1OYIA 3WTWC 2HWE3