5LRRA

The transcriptional regulator prfa from listeria monocytogenes in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein
molecule keywords Listeriolysin positive regulatory factor A
total genus 76
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lrrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lrrA01
4LA2A 2IC1A 1KQ9A 3O6BB 2LSOA 1I1GA 3T8TA 2IXHA 4KMUX 4XF3A 1C0WA 3ES1A 5LBQA 3KP2A 2O8QA 5JAXA 5ILVA 4MGYE 1GXQA 1R22A 2DAOA 3R4KA 4LB6B 2UY9A 2WFPA 5EEHA 5I8SA 3RZZA 1LNWA 1UHWA 4E70A 1OMIA 1BI2A 1MKMA 3LZZA 3VODA 4WCGA 1O3QA 1FYKA 5BY5A 1X7NA 2XROA 3F3XA 4AQ2A 5JHUA 1NE6A 1YWKA 3IIAA 1Z91A 2BYVE 4MQ9F 2FXAA 3EQEA 3DEUA 4UUVA 1FZPB 4H7LA 3KLNA 1F1ZA 2XL7A 1O7FA 5LGTA 1B4AA 2D1VA 2K86A 2XKOA 2Q2EA 1SD5A 4Q48A 4U7DA 1PP8F 2QLZA 1J59A 1B9MA 4I7HA 3BDDA 4MGZE 2GH2A 1GXPA 5F1RA 2W57A 3EJKA 3HRUA 2VECA 3FM5A 3WU1B 5J7MA 4ONUA 4FBFA 2FBIA 4EVIA 5AIQA 2EA4A 1IN6A 1IZ1A 4A2UA 2HKXA 2CGPA 4IXAA 1STZA 2D5HA 2OZUA 4XETA 3BROA 1JHFA 2Z5UA 5D8LB 5J48A 3C1DA 4P5OA 4RGUA 1BI0A 5EEGA 1PM7A 1U2WA 3JSOA 1XSXA 4FAGA 2O1QA 2PEXA 2RVCA 3QP6A 1VR3A 5LHIA 3ABUA 5AIPA 2EA2A 3MZYA 2STTA 3MWMA 3GW2A 2Y0OA 2Q0AA 3U10A 1DP7P 3ZDSA 5K1YA 4L5JA 1EY2A 2VT2A 4Q0SA 5BUVA 2YR2A 5E18F 2OQRA 2EJRA 2DK8A 2CW0F 2A07F 3HTSB 4GULA 2L4MA 3PQKA 3R60A 4BIFA 1D5VA 4UVBA 4GGGA 1BBYA 3IRQA 3QACA 2AS5F 4MNUA 1CF7B 4HBLA 1JXSA 1FXZA 1OKRA 2ATFA 5I0RA 2H0VA 3K1NA 4L9TA 1LDKB 1X82A 5JSOA 4K2EA 1J0RA 2P5LC 3H1MA 2FQ3A 3QU6A 5D5UB 2ZFWA 2M8EA 5FLXZ 3M8FA 2CYYA 1JUHA 1FC3A 2KXLA 5L3DA 3CUQA 5E1WA 5E8GA 4B09A 2VOPA 4ZZDA 2MHFA 1BOAA 1FOKA 4WXHA 4U0YA 1O3RA 4RB3C 2DCTA 4LFUA 2M45A 3IWZA 3K1MA 4A5NA 4BHCA 3W6KB 3FZ3A 2OA4A 3EO6A 1XCVA 3CJXA 3EYYA 3WTWC 4HMZA 5ICGA 2PFWA 4P96A 4ESBA 2PMUA 3T1BA 1FY7A 3OGJA 4QGMA 4XLNF 3SMHA 4RB2C 1T39A 2PQ8A 1LKNA 4AXOA 2XGXA 2M87A 3EQLF 3I0TA 1GQHA 3MCZA 1D3YA 2OA2A 3L2HA 3GFMA 3WTSC 4U0WA 1BIAA 3J81Z 3ZMVA 1HW2A 1DPUA 3JAMK 2EV5A 5HDGA 5IT3A 1OYYA 3W6JB 3K69A 4OIQF 3LAPA 2IRFG 4QLCU 3QOPA 3BPZA 3FFQA 5FDBA 4KWLA 1S7OA 2NAZA 2R7DA 4RAZA 4LJZF 1FP1D 2L54A 2XUBA 1IPKA 1T38A 5BPIA 4Q0PA 5DCMA 3IDBB 1NXMA 5HOOA 4L0YB 1J75A 4BHBA 4KN7X 2P6TA 3FXRA 4YYOA 5L3FA 1UCXA 4KT5C 1BM9A 2DPUA 3IC7A 1L0OC 3IRRA 2MH2A 4NB5A 1R1TA 4BAYA 4KN4X 1FYMA 5LHHA 4I0AA 5LHGA 4HBNA 2WTEA 4LGWA 3WODF 4N0BA 5LGUA 4FAHA 3CUOA 1P4AA 5FO5A 3ZMTA 4IEPA 3S7EA 1DZTA 4XEZA 1W7PD 2RNJA 1RTVA 3ZMUA 3G7DA 2VBXA 3DXJF 3R61A 2UZKA 5D1IA 5JCTA 3U11A 1S29A 4S05A 1XE8A 1XDUA 2Q8KA 2D93A 4L9NA 4FX0A 2FBHA 4Z2YA 2DTRA 3HSEA 2BBYA 1BN5A 2H6CA 1FX7A 2FA5A 3CLOA 4HLYA 3NKTA 1GHCA 4UVCA 2XLFA 2VPVA 4AWXB 3CJNA 1TQPA 3KZZA 1UHMA 2ZXJA 3HRTA 5D5XB 4R52A 1YTYA 2V9VA 5E16A 3I53A 2PJPA 1UCRA 4A12A 3J7AO 1J3RA 4FX4A 4YSFA 3P9KA 3IL2A 4ZYDA 1UFMA 2ACJA 4Q47A 4KYWA 4WK8F 3GYDA 4HOBA 2FBKA 3R0JA 2HYFA 2ET1A 2G9WA 3M1EA 1Z05A 4EJTA 1T98A 3WGGA 5LGNA 3CF6E 4M6YA 1ZG1A 3WGIA 4LULA 5D4SA 1UD1A 4HQEA 4G7HF 4OINF 2PQQA 3HHHA 2CWEA 2V1XA 3EYIA 5CJ9A 3ZMZA 3FMSA 4IERA 3GLXA 2BE5F 2IA0A 4PZJA 5I0TA 3M9AA 3UKTA 1W4MA 1LDJA 4F8AA 2IA2A 4OMYA 1ZHFA 5JR3A 4KWJA 4WBBA 4L2NA 1S3JA 2WC2A 3WE3A 4O3MA 3ML6A 5BPDA 1D8KA 1ZGAA 2B0LA 2P7VB 4PDKA 4UXNA 5JI6A 2BV6A 4TV7A 4A5MA 4LMYA 4BXUA 1VJ2A 1OI6A 1E2XA 3Q9VA 1IRFA 1IPJA 3PLQA 5FLJA 4IHTA 1ZGJA 4HSLA 1K79A 1R1VA 3HRSA 3RYKA 2RDPA 2UXNA 5LLQA 1WRJA 2O03A 2X4HA 1YIOA 3TQNA 2E7WA 4ETSA 1Q1HA 3WU0A 3RIRA 4O9GA 2IA1A 5KK1A 1BJAA 4M9ZA 5AVPA 2FEZA 3NSTA 1YQAA 1V70A 2W24A 2EWNA 1NZCA 4OMZA 4L11A 3K9TA 3GZ6A 3R0AA 4M72A 1RUNA 1R23A 3S2WA 3QAHA 4MGKE 4OIOF 3ZN0A 2QENA 1WKMA 3IHUA 3ECHA 1K78A 1XE7A 3U9GA 1X8MA 2PHLA 2XASA 1K78B 4PJYA 5CVRA 4M74A 4BNCA 2RV8A 5I8TA 4M71A 3L9FA 1DGRA 5HLHA 1LJ9A 4XFFA 2VBZA 1RUOA 4WVZA 1EH6A 2JPBA 4IEOA 1KYWA 5FFXA 2UWMA 4Z82A 1QZYA 2HWVA 3F6VA 1KQ0A 1O3TA 3DQVC 2PI0A 1ZREA 1I27A 3BCWA 4L0ZB 3LQQA 4I98B 3ST7A 1TW3A 2OAZA 2FSWA 1SQ4A 3BPXA 1QQIA 3MYXA 3GFJA 1CAXA 5J6XA 1CAWB 3O14A 2EAAA 2ZNYA 3NQOA 2GC2A 4UNOA 4KIBA 3LA2A 5I0UA 3G73A 2Y48A 1G6NA 3M8EA 1QXJA 1ZZBA 2P5VA 3HQXA 2L4AA 3HT1A 3QPHA 4RB0A 1Y9QA 3K2ZA 3I5UA 2LF8A 3SCFA 3QU3A 2TDXA 4G7ZF 2K27A 1H0MA 5A2QZ 4G6QA 3R6SA 3F8FA 3GYHX 4N9IA 4XSXF 3KGZA 1CF7A 2MNGA 1YO5C 5C6CA 1IW7F 1ZZ8A 4QMAA 4E2SA 4QM9A 3L00A 4ASNA 2JZYA 2PFBA 2HQNA 5J3UA 4A0YA 3HSFA 4DNCA 2B8MA 4Q0QA 4Q29A 1DUXC 2BNMA 4LTAA 3GZ5A 3WGHA 1RGSA 4J1XA 1G4DA 2DQRA 3KP6A 2V6CA 4MUVA 2ZCWA 2QCSB 1H1MA 1PDNC 2F5DA 3FE5A 4Y13A 1EYBA 2EFWA 2B5HA 3IKVA 5LRRA 3LFKA 1IN4A 5CVIA 3NVCA 2R7FA 4CHUA 5KHIA 3K0LA 3P9CA 1MGTA 2BNNA 1O7LA 2QNKA 3SHFA 3JAMZ 4GO1A 2ZNZA 2Z69A 4WXCA 3MQ0A 1MJBA 1O57A 5FFZA 3ES4A 4J1WA 4UBHA 3CUQB 2G7HA 1MDMA 4M73A 2FRHA 1O5UA 3GUDA 1OD5A 4HDVA 5L3EA 1TQ5A 1G3YA 4OIRF 2OBPA 1LR5A 4Q0UA 2PHDA 3M7GA 4CGZA 4HVRA 3BJ6A 2JRTA 3FJSA 4LG0A 4KDPA 3H3UA 1U12A 3UKVA 4RGXA 4R79A 1L3JA 4HVQA 1SD4A 3GWZA 1HKQA 5D6FA 4MX3A 3SHRA 4HF2A 1Z7UA 4O6JA 2DO7A 2O61A 4L5IA 1J2XA 2C6YA 1K7AA 1FWZA 4QXKA 4E2GA 3KFWX 5JSPA 2EK5A 4XFGA 1CAVA 1T0FA 1Q43A 4A0XA 1YUDA 4O5VA 3BALA 2D1HA 3KCCA 5DYMA 3HUGA 4IEQA 4YIFA 1U6GA 2OQGA 2DLLA 3I59B 3SZTA 4JTOA 3EETA 1ON1A 1YS7A 3FM3A 4AVBA 2P8TA 3D0SA 3RYRA 3WTYC 2IXKA 2KRFA 2VC0A 4IETA 4FHTA 1QWRA 2Z2SB 3VOEA 4HX8A 4EJVA 3WTVC 3B73A 3I58A 4QX5A 4XFAA 2UXXA 3FMRA 3GFLA 1IN7A 3HOTA 1VP6A 4Q0VA 2Q0OA 2PLYA 3DFGA 2W85A 5HDNA 3CTAA 1YFYA 3DL3A 1J3PA 5EFUA 2OD5A 2VN2A 3E6MA 3LWFA 3LWCA 3DF8A 2XLAA 3CO2A 1HW5A 4KU8A 2PYTA 2MPFA 2CO5A 2GXBA 1XRUA 2JTVA 1W7PB 3PNAA 3JSPA 2DPDA 2FOKA 1ZZ7A 3BPVA 2QYOA 4PIZA 2COMA 4XLPF 2VBWA 3P9IA 4EM1A 2EV6A 5BXXA 2PMHA 2HQRA 3E5QA 4UXAA 4EQQA 4YFXF 1IXSB 4IEVA 1ZVFA 1XDSA 2YU3A 2H27A 4KMFA 3IWFA 2P7CB 4OU0A 1XMKA 5H6RA 2VXZA 1P92A 1Q3EA 3F8MA 4ZZLA 3V7SA 1USSA 1F5TA 1QNTA 3V4GA 1FI2A 4ZYGA 4U7BA 4PIXA 4B29A 4EM2A 1HSTA 5DDGA 1QY4A 3K1PA 1YHFA 4QWQA 2A3SA 1TTYA 2V09A 4I2OA 1T6SA 4F7ZA 1XSDA 4XF9A 1YFUA 4UBGA 4MV2A 4KWKA 3J81K 5ILSA 2A68F 3F72A 3ROUA 2IPQX 1KU9A 2HTJA 3WE2A 3LSTA 3FHZA 5FB2A 1WWXA 4YFNF 1TNTA 1OYIA 2H94A 3USSA 3RI4A 2FNAA 2VONA 3GBFA 4B8XA 2GC1A 3KZYA 2DT5A 3WTUC 3EHKA 2V79A 5HLIA 1P4XA 2BNOA 3DP7A 1G3TA 4BYYA 1XGOA 2F2EA 3J80K 1HBXG 2PAEA 3G3ZA 4XF0A 4AVAA 1YLLA 2IXLA 4DQ2A 3BY6A 2QJVA 2XAQA 3V8LA 4WZCA 3ECOA 3CUQC 2ELHA 1SFUA 3ZMDA 1J3QA 4PCQA 4G7OF 4ZU4A 2GC0A 4GYGA 2IVMA 5D8KB 3KP5A 1ZARA 1S7AA 2J5OA 4CO8A 3DPTA 2V1UA 3C3WA 2XKPA 4ENJA 1P6RA 2FQPA 3ZMSA 1CGPA 2YPRA 3TGNA 3NEUA 3U2RA 4OFGA 4GXOA 1H9GA 3DKWA 3JZVA 3E6DA 2NNYA 1R36A 2CG4A 3BJOA 3O3KA 3PVBB 3L2CA 2CAVA 1DPRA 4IEXA 3H3ZA 2F5CA 1FP2A 2ZMEA 4G9YA 5ED4A 2GQQA 1XMAA 2QZ8A 2KIFA 1ZLJA 2P6SA 1SFXA 5A2QK 4EJOA 3HHGA 3TOBA 5FD6A 4ZU5A 1KA8A 2K4JA 4P9UA 4CZZA 2K0GA 2VBYA 5E17F 2HTSA 5CYVA 4AIHA 4ON0A 2IJLA 1X3UA 4WX9A 2RC4A 3MDPA 2E1NA 3TNQA 3T8RA 3KSCA 2Q4SA 3N97A 3ZQ7A 2I45A 2EB7A 4LUMA 3KE2A 2O6GE 2ZKZA 5K8SA 3RNSA 3SXWA 2YX4A 4I09A 5CVUA 1WA4A 4IRGA 5CVJA 3KMHA 5CADA 3H1WA 3MAJA 1CAWA 2GIVA 3WTTC 3BP8A 5I93A 4OIPF 3M3IA 1RI7A 2C0ZA 5ICEA 2RKHA 2VT3A 5I0SA 2HKOA 1MD0A 4D7SA 2Z9OA 5FQ0B 2LDUA 2EFPA 2KJBA 4UV9A 2E9QA 2Z33A 2QDRA 2HGCA 2MBFA 1UIKA 2MD5A 1U8RA 3H1YA 2RQPA 1OR7A 3OF1A 1PP7U 3TO7A 1R5GA 4ENKA 5ILUA 3KGLA 2QWWA 5DEQA 1J5YA 2H6BA 3OOPA 3F23A 3BJAA 2GU9A 5L3CA 2HFHA 2ZJ2A 3RDIA 3CO7C 4JTNA 3KP3A 2VOOA 4HAMA 4NVPA 5CU1A 3RTRA 1TQMA 1ZLKA 3F21A 5FPXA 4Y15A 3I64A 4MGRA 2Z3YA 4WWCA 1AWCA 4CICA 2RN7A 3BOQA 1ZN2A 4K8FA 2P5KA 2HZTA 1RNLA 3LA3A 4QGNA 5BPXA 1YLFA 3E5UA 2STWA 2EFQA 2E1CA 2OZ6A 2MLKA 5JVTA 1LDDA 4AIJA 1ZZCA 2KIMA 3I54A 2ZMEB 3JW4A 4UHTA 3F8NA 1J58A 3MFKA 2HR3A 3E97A 5TRDA 3QPTA 1FBSA 3MEXA 1U5TB 2XVCA 2IP2A 3H7YA 4IHSA 1QXRA 3ETQA 3V7CA 2F4PA 4TLFA 1XGMA 1RIOH 1Q5OA 5DCFA 5I8YA 2HS5A 1WSUA 2WWYA 4U88A 3VFZA 4R1HA 3E3VA 5BS6A 3BZ6A 3TO6A 2CFXA 1I6XA 1LQ1A 1LEBA 4QM8A 3C7JA 1F9NA 1RC6A 1SMYF 4KIGA 5ICFA 1BI3A 1EH8A 1OPCA 4EWAA 3JTHA 3NJZA 2F5EA 1KU2A 3CLPA 5HI0A 2KKOA 1XCBA 1ZH5A 4HA8A 1ODDA 3C18A 4ZU7A 3ACLA 4LK0F 2VE8A 1T2KA 1LEAA 5D5WB 2B9UA 3O2PE 2M30A 1J7KA 3SZPA 1FLIA 4PGGA 2GWRA 3I71A 3WW2A 3FX3A 2WV0A 1IN8A 4BHPA 3EDPA 1SEFA 4RGRA 4AQ6A 3OCPA 5BQTA 4XF1A 4EWDA 1XN7A 4A6DA 1QO0D 1L3LA 2PBIA 2Y75A 3F6OA 4L18B 1IXRC 4CDGA 3BU7A 4IVNA 3HSRA 4PGHA 2QQAA 3P7NA 1EPZA 1YS6A 1ZRFA 5F6FA 1K6OA 3BWGA 3I4PA 2O3FA 4S04A 3ERED 2LKPA 2CAUA 1R00A 1P2FA 1TNSA 1RL3A 2G7UA 5DD8A 1PMIA 4N9HA 5IT9K 3LAJA 1XGSA 5HLGA 5I91A 2XAFA 4JVAA 5F64A 3H8UA 3E6CC 1B1BA 2ESNA 1TLHB 2O8XA 3U0ZA 4HLTA 1NHAA 3CDHA 3VB2A 2QVOA 5HS9A 2D40A 2BEOA 2GZWA 1XGNA 2ISZA 4JBAA 2EFOA 4YRDA 1ONVA 1ZG3A 3KETA 4XFHA 4KICA 4YG2F 1SAXA 2ETEA 3AAFA 3F8BA 4I3PA 3V7RA 4M9SA 1TBXA 3S0MA 1U5TC 4HN1A 5FD5A 2CV6A 1MDMB 4IEYA 3TOAA 2KIUA 1EV7A 2V1DA 2ZO4A 3WW4A 5LEKA 4IPAA 2IT0A 4RAYA 2L01A 3UKNA 3RKYA 1ZYRF 4HYEA 1XSVA 1ZRRA 3OD0A 3MZHA 2XIGA 1DDNA 2P17A 1R58A 1JHHA 3M70A 2GAUA 4AD9A 1U3EM 1FSEA 1G3SA 2D5FA 1QBJA 2AXLA 1IXCA 4HV5A 1MJ9A 2VODA 5FGMA 4LB5A 4EGYA 4MTDA 2P4WA 3SCHA 2L3DA 1WLTA 1ZZ6A 3CEWA 4ORFA 4AVCA 4ZH4F 3T0YA 5KHKA 4YFKF 4LLOA 2W84A 1WI9A 1TQIA 1ZZ9A 4A6EA 2A61A 2VQAA 4KL1A 3IKTA 3T5XA 4MTEA 5HDKA 4IEZA 3D0JA 3DN7A 4L9JA 1O3SA 4D7TA 4WF2A 3KEQA 3HTUA 2K02A 4LLLA 2IW5A 2DBBA 1B59A 3LAGA 4IRIA 4ESFA 1SFNA 3ZPLA 4KNYA 1AOYA 1Z1DA 2XAJA 2Y0MA 1MZBA 2E7XA 3F22A 1ZRDA 1KGSA 3GO5A 4P9FA 4EWEA 3LOIA 1LRHA 3FXQA 3F8CA 4A0ZA 4D0PA 2ET7A 3Q5FA 4IRHA 2DW4A 5KBFA 4DINB 3NW4A 3SFZA 1J9IA 3NL1A 2RGVA 3V8KA 1D8JA 3HRMA 1V4RA 1FSHA 2A6HF 4HSJA 2NS0A 1E17A 1X8EA 4EV0A 3HT2A 2QUFA 1FBQA 2GC3A 3TNPB 3BB6A 1HKSA 5TJJA 4I02A 3TDUC 3E5XA 2JT1A 1HKTA 2QVSB 1UW8A 4ENMA 3WW1A 4G94A 1BIBA 3WTXC 1SD6A 4HDUA 3REOA 3KP7A 1REPC 4HN0A 3RKXA 4P55A 4M9XA 1XD7A 5J8CA 4YARA 2IXIA 4HX4A 4P9GA 2Q1ZB 1IAWA 2HYGD 4LD5A 5BMZA 4EJUA 5H20A 1B6AA 1ULYA 4LUKA 2EVXA 1FT9A 3WTZA 4MEXF 1EH7A 4ZYEA 4KA4A 4LLNA 1G3WA 4GYIA 3FHIB 4WXDA 3DPLC 6PAXA 3IDCB 1USTA 2BGCA 3FXUA 3QRFF 3KLOA 3CL1A 3SXYA 3KEOA 2VC1A 2XAGA 3LA7A 2JPCA 1QGPA 1LB2A 1ZX5A 2YX7A 4MEYF 3ZP5A 2A69F 4XFCA 1XB4A 4MZUA 3OTFA 5KHJA 1FPQA 1YFHA 5FLIA 2Z99A 1LVAA 3B02A 1NE4A 2XV4S 5DUKA 5DV5A 3WW3A 4Z07A 2M1BA 2LF7A 5LEJA 4X6RB 5JR7B 4CXFA 1HSJA 2JSCA 4Q5SF 4JQFA 2FE3A 2MH9A 5JFRA 2NRAC 4AIKA 4LEJA 4G8XA 1S8NA 5K5RA 5IT9Z 4R8HA 2H09A 4EJWA 3IBMA 5BOXA 4UVAA 3SCGA 4OOIA 1CAVB 2HEOA 2ZKLA 1HQCA 1CAXB 1ZG5A 2D45A 1GVJA 2XLGA 4HF1A 2A6EF 4EM0B 3SQNA 1WGPA 1BC7C 1J1LA 2LNBA 4OLLA 2M5WA 1IN5A 5C8WA 2MLGA 4XFBA 2OU2A 2MC3A 4HLXA 1IUYA 1O4TA 4MGIE 2GXGA 4LLGF 2FU4A 3MPBA 3FZVA 4AVPA 2OZJA 2YSRA 2ETHA 4JK1X 5E20A 2PA7A 1VTNC 1UPIA 4I01A 3KP4A 5E1ZB 1RZ4A 1SD7A 1YFWA 1IRGA 1FBUA 4RD7A 2HJIA 3PFIA 3GXOA 1OYWA 1YW9A 4LK1F 4KFCA 2A5YB 4I0BA 4LG0B 4ENNA 3TKYA 2L02A 1UIJA 5EZWA 5CVVA 3HYIA 5E1RA 2ZBKA 2NYXA 4ESJA 4RB1A 2W25A 2QQ9A 4ZYHA 3VHRA 3HIFA 1BI1A 2D2WA 3OV8A 1I5ZA 5FCCA 4HX7A 2FMYA 3WG9A 2ESHA 1Z6TA 3ULQB 3FWEA 1ZAOA 4Q4ZF 4EGZA 4PIYA 3J80Z 3L7WA 3GVAA 1SFEA 4XBFA 2DFIA 3TO9A 3C3VA 1A04A 2EFNA 3EUHA 2QBYB 1U5TA 2FNPA 3ELKA 1IF1A 1R5HA 4Y17A 1FNNA 5FQ0A 2XHKA 2N7GA 2PTMA 2PN6A 2GA2A 2DQLA 2PAKA 4KIFA 5D6EA 2R3SA 4HZFA 1W5SA 4XF4A 1Z6RA 1HXDA 3E6BA 3QP5A 1KYZA 1MJAA 1TW2A 3Q9SA 3LQRA 4IJAA 1DZRA 3RPUA 3NRVA 1W5TA 2UYBA 5DD4A 2FF4A 2K4BA 1SMTA 1B9NA 3CO6C 4M6XA 4QGLA 5ERIA 1F4KA 3JTGA 3RPQA 1Y0UA 1H1IA 5KHHA 1Y3TA 3I59A 1H9TA 1KU7A 2KJCA 2NNNA 4YNIA 2DK5A 2DU9A 4BH9A 3H50A 2XL9A 4EROA 5HS7A 4UV8A 1KQ8A 4NHJA 2ADUA 3H9AA 1QPMA 5AONA 5HS8A 1YW8A 3D82A 5D4RA 5E8IA 4H0EA 5L3BA 4O9EA 1HW1A 2CQKA 3N4MA 3DV8A 1R1UA 2VE9A 4RGSA 4EMSA 5K5OA 3U1DA 2HOEA 5HVQC 1P4WA 5CLSA 2QBYA 2EV0A 3GEZA 4IF4A 1ON2A 3ABTA 1JGSA 5H6QA 1WQ2A 3H7JA 1YYVA 5JSRA 5BV6A 1JE8A 4XSZF 1DGWA 5L3GA 3RYPA 1EP0A 1ZNPA 2OYZA 5FPZA 3RJPA 4XFIA 2CSOA 1I1SA 3FF5A 4MHGA 2HDCA 2Q30A 3ZN1A 4BQAA 1PUEE 5KHGA 5KVRA 1KU3A 2FMLA 2DI3A 4META 3RKWA 4U0VA 3EBRA 2X0LA 4XRFA 1YG2A 4HW0A 4RS8A 3ELNA 1GQGA 4YIIA 4LA3A 5K5QA 4NQWA 4JV4A 1FYLA 3H92A 2O0YA 1BC8C 1CX4A 1ZRCA 5T3NA 2EA7A 3ISPA 4L9VA 2OPKA 1R7JA 3S7IA 1CAUB 2PAMA 4KUMA 2QM3A 3FMQA 2K7LA 1OFNA 1U78A 1S6LA 1CAUA 3GF2A 2XAHA 4E2QA 5J8FA 3TDZC 5ICCA 3PQJA 4FT8A 2IXJA 2K9ZA 4HF0A 1V3FA 5E1XA 4IESA 3VEPA 5DCMB 3I7DA 4HV6A 2QQBA 2ISYA 4G6DA 4HQMA 3L09A 1W7PA 4MQVA 2UY8A 3V8JA 1NYWA 3HOSA 5DUIA 4GCVA 4IEUA 2IXCA 4CYDA 2XRNA 5D5VB 2UYAA 2GA1A 5FLXK 3COAC 2MA3A 4HVOA 4MH0E 4X6QB 1O5LA 1UB9A 3D5LA 1YW7A 1YFXA 1Z9CA 5FLHA 2F5FA 2PG4A 5LRSA 2J5PA 4KU7A 3GFIA 4IEWA 1QZZA 3GX4X
chains in the Genus database with same CATH superfamily
1G9DA 4LA2A 1MBHA 2IS2A 3KHCA 4ABZA 3T8TA 2P0WA 3BUCA 4XF3A 3ES1A 5LBQA 1LE8A 1Z77A 3K4ZA 1SLCA 2DA5A 5LK5A 1AYN2 4LB6B 1D4VB 3RZZA 1UHWA 3DBLB 5LWBA 1T6GC 5BNNA 2XROA 2VW1A 5F04A 4AW7A 1V6KA 3NARA 2AREA 1QIQA 1YWKA 3OYIA 1FOD2 2YU2A 4CRQA 3DEUA 2VKVA 4H7LA 1F1ZA 1H2NA 3WP4A 2D1VA 4C91A 3RMYA 4ZZ8A 4CCCA 3WNXA 2WWUA 2FUG2 4U7DA 1OVPA 3BDDA 1DZQA 4MGZE 1GXPA 1UYZA 1WMXA 4LIUA 4BDZA 2LY1A 5IJRA 3HRUA 3L2WA 2OQ7A 3LIGA 1JZ3A 2FJ1A 1W3XA 1YJKA 4FBFA 3I4IA 5AIQA 2HKXA 4AEKA 2P34A 2W94A 3VBRC 3UGGA 3O8HA 2VKHA 2OKXA 2FDJA 3TP0A 2ZX1A 4CDQB 1BI0A 3RWNA 2LBFB 3IAM2 4Y26A 3JSOA 5F7UA 1PVXA 3M4OJ 3JRHA 1XSXA 3RGBA 1VR3A 2M3AA 5LHIA 3ABUA 3BGAA 3PU3A 3HWJA 4MGTA 3MW2A 3FHNA 1N78A 2Q0AA 1OLRA 3I4NJ 2CU5A 1EY2A 4XORA 4CCNA 3HBZA 3T09A 3GXUA 1KJLA 4HKWA 3H36A 2D6LX 2ZGOA 2EH3A 2OQRA 4UFIA 3N35A 2B42B 2ZMNA 1OA3A 2A07F 3AKQA 3HTSB 3PQKA 3R60A 3AKPA 2WV1A 2XDVA 1WBFA 1DP3A 2YPJA 1D5VA 3JQXA 3GTQJ 1C8M1 1LOBA 2AS5F 2K5CA 5ABJA 1SFPA 3IV5A 1JXSA 4YEJA 1GICA 1MMNA 5JSOA 1JYTA 2P5LC 4JRLA 1SFOJ 2Q1MA 2FQ3A 4R9CA 2B7EA 2X6XA 3A0KA 3ZSEA 3S2DJ 2X10A 2CYYA 2GN3A 4W4ZA 2RR13 1JUHA 4XPVA 2IFRA 3E7LA 5L3DA 5E1WA 5BNPC 2DT6A 2O5RA 1NG6A 4RM2A 3RG0A 2M45A 4QHBA 3IWZA 4BHCA 1HN0A 3W6KB 2JIJA 5CG8A 3WTWC 2E2IJ 2F4IA 4HMZA 3BR5A 2PFWA 4BE1A 4P96A 4ESBA 1FY7A 4XACA 4QGMA 3C2GA 4RB2C 2PQ8A 2VZTA 4AXOA 3EQLF 1GQHA 5HXMA 3MFAA 2OA2A 1JT6A 1IPSA 3ZMVA 2L7KA 1K12A 1VBC3 2PLV1 1ZYBA 2ES3A 2EV5A 5HDGA 3W6JB 1GUUA 4OIQF 3RRDA 5BNOB 3QOPA 5FWEA 5FDBA 5FLMJ 2W08A 4IUGA 2NAZA 3RZDJ 5FUIA 1GOFA 3WQ7A 2O9LA 2WDBA 2XGCA 5CBLA 4JDNA 3ZKYA 3O0WA 2HWC3 2P6TA 2E33A 4V19K 3LQCA 2XQRA 4YW6A 1S2EA 3IC7A 1W6OB 1K6YA 3J7ZI 1HOMA 5L36A 2MH2A 3OBZA 1R1TA 1FYMA 4BJ0A 5LHGA 1GYKA 4HBNA 2HWF2 5DG1A 4AF9A 2NVYJ 2K9NA 5LGUA 3OYDA 1K5MA 1P4AA 4NC6A 4IEPA 3FLRA 5J4YA 3ZMUA 2VBXA 3PUQA 5F1JA 3LFIA 2VIXA 1PIV1 4AEJA 5CFDC 4S05A 3MHZA 3CP8A 3SEPA 1ENSA 5GZDA 2FBHA 1H8TA 1S2BA 2NM1A 3WP6A 1HJGA 4JDMA 4X0GA 1W6NA 2FMDA 4OI0A 2BBYA 2YBPA 2XJSA 2X53S 2H6CA 3FFZA 2FA5A 3CLOA 2LW8A 4UVCA 4AWXB 3CJNA 1TQPA 2WAAA 4YVSB 2NXNB 3O1TA 2V9VA 5E16A 3I53A 1S55A 4A12A 1HXS1 4KI5M 1RJ8A 1RYYA 2HZDA 4KYWA 4HOBA 1LFUP 4I99C 3B3QE 3R0JA 3PURA 2HYFA 4FE7A 4BEHB 2G9WA 3M1EA 3WGGA 2IGKA 2L7FP 3OYWA 5D4SA 1VQ9I 1IS3A 5FZOA 4FO9A 2PQQA 3ASOH 1WCUA 5C9AC 3C7GA 1XE0A 5E3LA 5JI7A 3M9AA 1LDJA 3JCIA 4Q4Y3 2IA2A 2VOKA 4ASKA 5EG0B 2VKEA 1ZHFA 1W8OA 1YJNI 1S3JA 5IP9J 5GLTA 2WZPP 2P7VB 3U4SA 5JI6A 4TV7A 4BXUA 3NRUA 2C26A 3A21A 5FO8B 1E2XA 3B01A 3Q9VA 2XH6A 3WG2A 3CJRB 2VR4A 3RYKA 5A3TA 3CBNA 2RDPA 3Q0VA 1VRH1 1NH3A 2ZX3A 4EN8B 4XIOA 1ASJ2 2DVBA 5FXWA 3BR2A 1ODNA 5ANQA 3OGSA 4DBRA 1YIOA 5B66C 1I3QJ 3OGVA 4O9GA 5CFCC 1U0JA 1PZ9A 5KXDA 1F43A 4XBNA 1JH5A 3ZYPA 1FYUA 4MGQA 4C30A 4AFCA 5FP4A 2KZVA 1BJQA 5CB7A 1GFF2 2EWNA 3IDEA 1XNDA 3TN93 4RA2A 4XJ8A 1POGA 1BW5A 5K7HA 2DCKA 2R073 4E8CA 1XXNA 3ZN0A 2QENA 3ECHA 1IGNA 1RUC1 3U9GA 3MUZ1 2C24A 2PHLA 2XASA 1W2AX 4DFSA 3LGRA 2WB1A 3WHCA 1QQP3 2OUHA 1WJFA 4KGGA 2DOEA 4W65A 2WFF1 2P3JA 3Q3SA 4Z82A 1I50J 1QHDA 1KQ0A 3DQVC 1ZREA 1TEIA 4L0ZB 1IS4A 3WNPA 4CH7A 1WFXA 2FSWA 1SQ4A 3M1CA 2Y26A 1NCRB 1QQIA 4NAMA 2E5NA 3O14A 3ZPOA 4XRSA 5F3CA 4D8MA 1UZYA 1SVLA 4KIBA 3AG4H 4QQPA 2GNBA 1G6NA 3K7AJ 5L19A 3WP5A 5FYTA 4QKNA 3KF5A 3HQXA 1K5MC 4PJLA 2L4AA 1T95A 1MVEA 2FX0A 4RB0A 5AC91 2LALA 3BCBA 3I5UA 3K2ZA 4OZXA 1CZTA 2TDXA 1YO8A 1UQXA 3ZM8A 3CCMI 3F8FA 1CF7A 3PM1A 4M3DA 1C5IA 3B69A 1S2KA 1IQDC 3LSPA 4J19A 3CCLI 4OQ8A 2OUJA 2BUKA 5LA9A 2JZYA 2HQ5A 1JZ6A 4OZOA 1QJX3 3W58A 2WBKA 5FKBA 4XKVA 2DQRA 3P5BA 4MUVA 2JA8J 1H1MA 3FE5A 1VBD1 1JZ4A 2QQKA 3AX4A 1T2XA 2M8GX 1KONA 4XAAA 3WNOA 3LFKA 3ZQIA 1S72I 2R7FA 2KDZA 4CHUA 2ZOEB 4SLIA 1JUMA 4FI9A 2CH0A 3AFGA 2ZEYA 3JAMZ 1OXCA 3I2KA 1RR7A 2YDEA 4DRRA 2KIQA 1ETXA 5FFZA 3ES4A 2VMCA 2UURA 1MDMA 4YM0A 1DU6A 4M73A 3GUDA 4HDVA 4A41A 1TQ5A 4OIRF 2OBPA 3BTIA 3K3OA 5EJ1B 1W39A 1TP4A 1ZBA1 4NHMA 5ABJB 4CGZA 2YROA 1T6BX 2ZXIA 1H8TC 4QPGA 5FO7B 1URXA 1TE1B 2RR11 1AZDA 2W68A 2G9ZA 2ZXHA 4KBZA 4R79A 2LRPA 4AEMA 3MKYB 3P1IA 1HKQA 3PUBA 5GLUA 4PI0A 5D6FA 1S0DA 4MX3A 4DEVA 2DO7A 5DUXA 3CZJA 3DECA 2R5YB 1FWZA 1AYM3 1RB8G 4LNVA 4OI4A 3CCRI 4XFGA 1AYM2 1C8M3 3VKFC 4JGYB 2JA5J 1VQ4I 3BALA 2GSYA 2WWJA 2NVXJ 1XS9A 5DYMA 4OUMA 2R0QC 3VBOC 4FFHA 4D1QA 5L7OC 3POGA 2IXKA 2UV1A 3OMYA 4FHTA 1QWRA 3VOEA 4HX8A 2W47A 3B73A 3WF3A 1VF9A 4CDXB 2XWJB 3HOTA 1TWHJ 5T5LA 3S93A 2DMPA 4IV1B 1D0GA 5ISLA 3N05A 3CCSI 5EFUA 1D5YA 5HV0A 4BJ6C 1W9WA 3ZFEC 1COV1 1VBE1 3OSFA 5F3GA 2ORXA 3TYJA 3CO2A 4FPOB 4ZC3A 2PYTA 4IE5A 4OUEA 2GXBA 1Q1VA 1W7PB 4CP9A 2ELKA 4JOMA 1FOD1 4B3XA 2HOSA 1JOPA 2X5IA 4RR3C 4PJMA 3VGIA 1ZZ7A 1GV5A 3BPVA 2F6CA 3U75A 4YVWA 2NPIA 3IM0A 2ZX0A 1OR7C 2COMA 5H2FC 3SKJE 4LXLA 1VLNA 1DU0A 4LPLA 5FXVA 4NQWB 2VPRA 3VZKA 2HQRA 4UXAA 4EQQA 4LO8A 1UY3A 3LKJA 3USUA 3RI9A 2VZOA 3DF0A 3K4JA 2TCTA 4ZZLA 2HVSA 4N43C 4XBLA 2X51A 1F5TA 1H9WA 2I74A 3OR2C 2E7QA 4PIXA 1F36A 2R7WA 1JGGA 3MI8A 3K1PA 3A01B 3R05A 1TTYA 3OR1C 1OF4A 3POFA 3EXUA 2DODA 4F7ZA 1XSDA 4COZA 4KWKA 2NP0A 3HDDA 3MICA 3IAPA 3H8OA 4G3YC 4CEYC 3JRCA 3AZZA 4YFNF 4NR1A 2H94A 3X29B 3RI4A 2FNAA 1GZTA 5FAXA 3HPGA 3KZYA 3MFCA 5FMOS 2M0MA 4C9YA 2A5ZA 1G3TA 3N9LA 4PT6A 2F2EA 3J9SA 4JHTA 3J80K 1R6RA 1DF0A 5DDJ3 1RUJ1 5FRNA 4UFLA 2IXLA 4R9BA 4GB32 3VDDC 1GNZA 4FPGA 4DMIA 2G19A 5GZEA 3MD2A 1QDOA 4JKKA 2RS11 4PCQA 4LR4A 4HKOA 2KD7A 1UELB 2GMEA 4BMEA 5DDJ1 5JHFA 4UB6C 5FMOL 3T2OA 2OPWA 1S7AA 3BTLA 2R93J 3MV01 4AHYA 1I1EA 1IKPA 1G9CA 2XKPA 2YG0A 2EALA 4OFGA 3DPRA 3ZMSA 2JWTA 5DS9A 4ITCA 1I5PA 4HPKB 2IFWA 5L9VA 4G6TB 3DKWA 2LK2A 3NWKA 3E6DA 2NNYA 2JDMA 3GCWA 1H30A 3SITA 1HLVA 1F15A 1PUFA 5DTDA 2BBAA 1FP2A 4G9YA 4IE4A 2P3KA 4LT5A 2HWE1 1AR63 2DV9A 1DGWX 4EJOA 4YFWA 3TOBA 5KWRA 3O1OA 4AFBA 1D1CA 2VBYA 4F91B 5E17F 1F5JA 4ON0A 1SC7A 1X3UA 2E1NA 2MYSA 3I2JA 4FASD 2EB7A 2O6GE 2ZKZA 2I2SA 4BACA 3GM8A 4I09A 5CVUA 4IRGA 1X58A 3HNMA 4Y1UA 1VB2A 3MAJA 1CAWA 3UGHA 2JVGA 3WTTC 4Q4W3 1HB2A 5LA0A 2J1SA 1OPMA 2R5ZB 3GZEA 2WR9A 3KQRA 3OY8A 2C0ZA 2GNDA 3DPUA 2VXDA 4UWDA 3VLBB 1MD0A 4RGGA 1NZIA 5F5CA 1JKRC 2MD5A 1WUVA 4TXWA 3RZKA 1G7YA 3K70C 4QPIB 1PP7U 4KNCA 4IOAF 1J5YA 4BQ1A 3EPZA 3F23A 2GU9A 3KCYA 2HFHA 2NMOA 4NHXA 4LORA 3CJIB 1R1ZA 3AJZA 2VOOA 4C3IJ 3IMMA 4NVPA 3LSGA 2JRMA 1G8WA 5FPXA 4Y15A 3I64A 1OSGA 2C1FA 1AWCA 2L9VA 2RN7A 3R0RA 2DWRA 1ZN2A 4TN7A 1OISA 5C5TA 2M34A 3JD72 1Z3XA 2ZGTA 1GOHA 2EFQA 1G86A 3HAGA 2MLKA 1LDDA 4FE4A 4DEQA 2WO3A 3WNKA 4XJ9A 3LF7A 3F8NA 5L7OA 3OGGA 5TRDA 2X48A 1DDLA 3QPTA 3MEXA 1U5TB 3IAQA 1ENRA 5FWJA 4A3FJ 2LM3A 3H7YA 1E5SA 1IKQA 1I3AA 2ZGKA 4WM7B 4AYBA 5AVAA 4TLFA 1RIOH 4EEFG 1KRIA 4NPRA 2BFUS 1JYXA 2JVHA 1OOPB 4HRIA 3QPLA 3S1MJ 2OCCH 3HEFA 3FUQA 2Q2EB 3VFZA 4QXHA 2LD5A 1YI2I 3ETPA 3S14J 3W5MA 1I6XA 5F3IA 1LQ1A 2Y6FA 3ATGA 1OVSA 5IHRA 1BI3A 5E89A 3AMQA 2HWE2 2Y2ZA 4Y22A 2AZ5A 1NCQC 1YRNB 3JTHA 4XQWA 3VZMA 3NJZA 2F5EA 3UESA 4NIHA 4Y24A 3OS1A 1W2UA 1SZBA 4GJZA 4BBRJ 2WO2A 4ZU7A 2XJUA 3G1LA 5D5WB 2B9UA 3LFMA 3O2PE 4AE2A 3VPRA 1Z21A 3VV1A 4XABA 1ACCA 3GZAA 3EB7A 3I71A 3VHPA 5C3SA 3FXKA 1VQ8I 1WWYA 4BHPA 4IV3B 1SEFA 3KZ4C 5BQTA 1N3OA 3IDAA 4KISA 4YZ4A 4EWDA 3ZQHA 1XN7A 4A6DA 1QO0D 2XONA 2GXAA 3PU8A 2EZKA 4L18B 1POQA 4CDGA 2ZSHB 3VBHC 3TMOA 1AHDP 5H9QA 3VBFA 1N25A 1OUXA 1YITI 3UKGA 4QD2A 1CZVA 5LBFA 1QQP2 2W3JA 4UOJA 1TNSA 1UKRA 4IV1A 5T5OA 4N9HA 2VZPA 2L9SA 4Y1VA 2X85A 4CUCA 4BOWA 5FPAA 1PO21 2ESNA 1ND2A 1NHAA 3CDHA 3VB2A 1ETYA 1W6MB 5ACA2 4JBAA 1DQ5A 1XX5A 4CDWA 1M1EB 1ULFA 1D0ZA 3KETA 4KICA 1STMA 3F8BA 1NT0A 1X9TA 4A7YA 3H9QA 4I3PA 1U5TC 4HN1A 5B2GB 1WMDA 2A7AA 2QA4I 3PJRA 4X8PA 5LA1A 1Q8PA 1MBEA 1YEWA 1MS8A 5JLWA 1EV7A 4Y1YA 3SFIA 3J8F2 3WW4A 1AVBA 2IT0A 4RAYA 1RUH1 2LS6A 1ZYRF 1XSVA 1GU3A 2P17A 1R58A 3OUJA 2GIZA 2M7BA 4K21A 2AQFA 4NOTA 1O59A 5K9YA 1HJFA 2JG9C 3PFYA 1QBJA 1BVP1 3ZR5A 1MNEA 5FKMA 3ECQA 1UY4A 3V42A 3CF5F 2B46X 5LZ6A 2YS9A 4RFT0 3HG9A 3NNGA 2FCUA 4AVCA 3ZYIB 1OURA 1MH4A 4CZCA 1JTYA 5D2AA 5KHKA 2K9LA 3GJBA 2XG3A 3OS2A 1DQ0A 5BNGA 1POV1 2A61A 4EYUA 2VQAA 4KL1A 4QPIC 4AAPA 3JRBA 1HCRA 1RUC3 2VCAA 1XNTA 2JG8C 1WW5A 2YZ4A 2RS33 1O3SA 3KEQA 2K02A 4K1YA 4LLLA 3TN91 2DBBA 1B59A 4IRIA 2XSDC 1ODMA 5F37A 5CYYA 3AZXA 1Z1DA 4XL9A 4PSWA 4IE0A 1MZBA 1H89C 3F22A 1ZRDA 1KGSA 1T08B 1QKQA 1OLME 2HWC2 4RGAA 4LO4B 2QQVA 5HV4A 3F8CA 2JDKA 2XQXA 3Q5FA 4N4NB 2DW4A 1ZBE1 3NW4A 3SFZA 2W1OA 1D8JA 2D44A 2WAOA 3HT2A 4B1MA 5DDJ2 3WX5A 2JT1A 4NWVA 1EV11 1UW8A 3TOJA 2WNUB 2JE7A 1BIBA 1HX6A 3ZCOA 1REPC 4HN0A 3DLLF 4UW4A 2W4SA 3IP4B 2IXIA 1FX5A 4HX4A 4D7MA 1IAWA 2ZEXA 4LD5A 1FPN3 3OYMA 2ME6A 1FOD3 4M3CB 3AL6A 1W0TA 1X3ZB 4YGBA 2ARBA 1HV1A 4LLNA 4GYIA 3DPLC 1S5LC 1ENXA 1A6CA 5J1YA 3EUAA 2BGCA 1KFXL 4L0PA 1X50A 3KEOA 2JPCA 5T54A 1LB2A 2J42A 2OJED 2JDAA 3ZP5A 4N8MA 5FZLA 2WZEA 2WJSA 3OY8B 1FPQA 2A6ZA 1JW6A 5FLIA 2P4EA 4D7YA 1FMVA 1AX1A 5DV5A 3MW4A 1VZ0A 2J1AA 4Z07A 3K70D 1UOBA 2IVJA 1NLSA 5IP7J 4CXFA 1HSJA 4M00A 4Q5SF 1UAAA 3TWIA 2NRAC 4LEJA 4AIKA 2LVSA 4V2VA 3UJOA 4F3QA 3VDXA 2HWF3 1NOVA 4QPQA 1UZWA 4EJWA 1CQ9A 3T0BA 1OCZH 1SAUA 2X5IC 4RR3A 3T3YA 2JA7J 1ETKA 4LBLA 2AQEA 4HF1A 5EJZB 3SQNA 1UAIA 5GAHJ 2FDIA 3VKMA 5C8WA 2MLGA 2ZHKA 3MKLA 5FZHA 1YRZA 4A3KJ 2OU2A 3KF3A 3CDIA 4UUSA 5APAA 2MC3A 1DLLA 2FU4A 3JRIA 3MPBA 4UB8C 3I2FA 2OZJA 2R5YA 5JIAA 3VBUA 1W6QA 2DYSH 3C2HA 1RZ4A 4PJ0C 2R16A 5FZKA 2Y0SA 3PFIA 1UOGA 2A5YB 1UJ8A 1XPXA 4Y4YA 1SBFA 5ERLA 2ORZA 3MZ8A 5IYDJ 2DVFA 5IW0A 2CWSA 4CE8A 1OFCX 4RB1A 5CFDA 2VBDA 4JGZA 4A3ZA 2W25A 2QQ9A 2NZ9A 4BISA 4CDWC 1N1YA 4LKFA 1BZWA 4UF0B 2SBAA 2VW2A 4KGQA 3WG9A 4CUBA 4DUWA 3CLQA 2ESHA 1OOPC 4ZTFA 1C57A 3OUHA 4FFGA 3ULQB 3MLJA 1X1DA 3HB9A 3AMPA 3J80Z 2QGUA 1JYCA 3L7WA 3MF9A 2ZFUA 2NVUB 1SFEA 3ZQLA 4PK4A 1A04A 3EUHA 5A1AA 1U5TA 1IF1A 5EHDA 3RJRA 2QZ2A 1R5HA 2BW3A 2CV1A 5FZDA 5FQ0A 2N7GA 4COVA 3ITQA 4GWNA 4KQ7A 4CUGA 2QQWA 1CJPA 3RI8A 4XF4A 1HXDA 4GXLA 3QP5A 1EAH2 5FZMA 1BK1A 3LQRA 1RR8C 3KPHA 3K77A 2Y0IA 5FJKA 1WI3A 3HR9A 4PJNA 5DD4A 1W90A 3K3NA 4A3MJ 1POV0 3ME2A 2BU9A 2W52A 3NV3A 3CO6C 1VBD3 3M3CA 5ERIA 3F2ZA 1MMDA 3RPQA 3HPHA 1DGRN 1UXZA 1W9TA 2XUEA 2VXJA 2MEV1 2VVDA 1AJOA 4FOYA 3D8CA 2EICA 2DU9A 4I0WB 1IGOA 5FZFA 5HS7A 4FTHA 3FXJA 1E0EA 1IRXA 2EAKA 1YW8A 1X1PA 3D82A 4JZRA 5BNOA 5E8IA 3DCQA 3V0BB 4N4OB 3TEXA 3DV8A 1IZ3A 2W0XA 5CISA 4AOCA 5K5OA 2RQQA 2D3PA 4HSTA 3AG1H 2EV0A 3AKRA 2AACA 5F08A 4JCKA 3H7JA 1JE8A 2VASA 1RVF2 4XSZF 1FMD1 1DGWA 5L3GA 1IUFA 1I3HA 1EP0A 3PVOA 4E4DX 2OYZA 2G4IA 2BXYA 3RJPA 4XFIA 2O7OA 3K4AA 2CSOA 4XTPA 4A3CJ 3ILFA 5KHGA 2ZGRA 1BJZA 5KVRA 1KU3A 3AL0C 2DI3A 3SH4A 4NO4A 2CDOA 3RKWA 3POSA 4RS8A 1SMVA 1OCTC 5K5QA 3OOXA 1V6IA 3U1KA 3H92A 2EBIA 3MLKA 4CSWA 1GWKA 2L7ZA 1CX4A 2JDUA 5T3NA 5EYRA 2EA7A 4A3EJ 3ISPA 2WT2A 1R7JA 1OLQA 1CAUB 3TEWA 1GZCA 3FMQA 1X2MA 3T08A 3GF2A 3G2BA 1FATA 2G9GA 2IXJA 2K9ZA 4RQPC 2JD9A 1V3FA 5E1XA 3BQYA 2D98A 2QQBA 4G6DA 1W9YA 2DCZA 4MIMA 1MS3A 3GDBA 1W7PA 4MQVA 3WOGA 1W06A 2UY8A 1ZA4A 3CMGA 3PMEA 2E60A 4IEUA 3IB3A 4QSHA 2IXCA 4GMP3 2N8GA 5D5VB 2UYAA 4WM8A 3COAC 2BVBA 3BR6A 2FD8A 5EZGA 4BXXJ 4O7XA 2LBFA 2P6CA 1MH3A 5FFOC 4QIWN 1GR3A 5FLHA 5IYYA 3JU9A 1EPWA 3BT9A 2PG4A 2WYSA 4KU7A 4UY8I 1UHSA 4XILA 3AYEA 3FBNB 3H0DA 2IC1A 3VHNA 3O6BB 4XONA 1XU1A 1I1GA 2IXHA 2Z4FA 3KP2A 1VBB3 4ZS2A 1QMJA 4C2UA 5GLZA 5JAXA 3N3HA 1GXQA 3BKZA 5I8SA 4E70A 1BI2A 4WCGA 2LY9A 5BY5A 4W6XA 1WMEA 3K4NA 5ACA1 2XPVA 3F3XA 3I97A 4GZ9A 3AXEA 2CRGA 2XVKA 4P02B 1A3KA 2RG4A 3EQEA 3LDKA 4LKEA 1YCIA 4AU7A 1Y7BA 4Q4X1 5IK8A 5CFCB 1LHUA 4LHKA 1O7FA 5LGTA 4SBVA 3QYFA 2XKOA 5FUPA 1W6PA 2VL8A 3WF2A 3ZPYA 3ERMA 1OCOH 1J59A 4CCKA 5M5XJ 2VJJA 4I7HA 1VAMA 4K6BA 2G0EA 2BOIA 3FISA 1QH6A 1S7EA 3AZWA 3JUUA 3WU1B 3P3NA 3MBWA 3JRGA 2FBIA 3O0VA 4EVIA 2EA4A 1IN6A 4XN3A 1OC1A 3RWKX 1XJAA 1STZA 5CFCA 1JHFA 3BTJA 5LY1A 1A78A 3PMSA 3C1DA 5F32A 1PM7A 3K51A 4E27A 1RHI3 4YWAA 2O1QA 3EYPA 4DGWB 3G4SI 4P9JA 2EA2A 3G6EI 3MZYA 2STTA 3MWMA 3DXTA 2Y6LA 4L99A 2VUDA 4JGYC 1HV0A 3SNMA 3U10A 4NN0A 3BTZA 4P5HA 1Y9GA 4L5JA 5BUVA 3B00A 2CUFA 1UY0A 2EJRA 5FJHA 4J01A 1GNHA 2J1EA 3QD6A 2HXIA 3DLAA 3AP6A 3ON7A 3NWSA 1BBYA 3QACA 1SLLA 5FK7A 3SEQA 5GLVA 4MNUA 2BPA2 1CF7B 3BU0A 4HBLA 3K1NA 4L9TA 5A70A 1LDKB 3PL8A 1O6UA 1J0RA 4ZS3A 2OVUA 5CFDB 2M8EA 3M8FA 2Q5TA 1DU3D 1FC3A 3CUQA 5E8GA 4AI2A 1RXGA 2LTPA 3ZQQA 2MHFA 1MPXA 4RB3C 5FPUA 1PIV2 1WGXA 1RUJ2 3RSJA 3FZ3A 4B4RA 3EO6A 2ZZJA 2EZLA 3IUOA 1S4CA 3CJXA 2Z5WA 4ZY9A 3EYYA 5B1BH 4FTSA 4Y3OA 2YXSA 2PMUA 1I6HJ 1SDWA 1E3OC 1T0FC 3SMHA 1DP0A 1N3PA 4HNTA 1WJEA 4U0WA 3AYDA 4ASLA 1LHOA 1BIAA 1U5IA 3J81Z 4PFOA 1HW2A 2WBMA 1DQ4A 2JG8B 3PIOF 5IT3A 1CD3G 2IRFG 4QLCU 3BPZA 2UU8A 3RMXA 1S7OA 2R7DA 1D4M1 5BNOC 4BS9A 4ZPIA 3ONQA 2XUBA 5J37A 5BPIA 2J1VA 4Q0PA 4BJ5C 1NXMA 4AVVA 5HOOA 1UOFA 1RUE2 1REEA 1U9OA 3DEWA 4WVWA 5L3FA 3ACIA 1BM9A 3DU5A 1WH5A 2DPUA 4DO0A 4GH4C 3ABKH 4S0HB 3IRRA 3C7EA 4NB5A 2J7MA 4BAYA 3ZFFA 5LHHA 3HEIA 2WTEA 2E7TA 2V4JC 2BERA 3WODF 4Z92B 3BN6A 1OKQA 2A73B 3N9OA 2J22A 3ZXFA 1ND2B 1W7PD 2RNJA 3OYGA 1S0IA 3JREA 1A6IA 5L73A 5EDNA 5JOWA 1MMGA 2Y8KA 4N90A 5JMOA 5E3NA 1PGL1 3ABMH 3K4LA 3Q0WA 2C5DA 2Q8KA 1NLQA 4L9NA 5DQ0A 4Z2YA 1QJFA 1NY71 1NKGA 1FX7A 3W9AA 3ENRA 4HLYA 1GHCA 3AFHA 4GKYA 4BE2A 2YV8A 1WKYA 3ZYFA 4AGGA 4R52A 5DMYA 4CCOA 2OCEA 4URTA 1YTYA 2PJPA 4AQSA 3J7AO 4YSFA 3RZHA 1UFMA 2ACJA 4WK8F 4INDA 2FBKA 2KISA 3RZGA 2MSYA 1NXD1 2KP6A 4B44A 4BQ5A 4EJTA 4XICA 3VBHB 2ZA9A 1W28A 1R092 3CF6E 5FLVA 2R7SA 3WGIA 3OWTA 3A02A 1GP5A 5JDBA 4RBOA 2YGMA 4CYCB 3EYIA 4IERA 3ZMZA 3FMSA 2PHUA 3GLXA 4XJZA 2VBPA 1Z7S1 2IA0A 2WY7Q 4PZJA 1ITYA 2QF7A 5LA2A 1AL23 1W2NA 5HPOA 1W4MA 4OMYA 5SV5A 3CMYA 2CV2A 1YQ6A 4KWJA 4WBBA 1N47A 5L9BA 2WC2A 4MSVA 3KCXA 1D8KA 1ZGAA 2EIGA 2R6QA 2TBVA 4RS5A 3CC4I 2QQLA 5FZ6A 3VD9A 1VJ2A 5FXXA 1IRFA 1IPJA 5FLJA 1NCQB 4G9SB 3FXLA 2ECCA 1Y4WA 2WIIB 4K3UA 2E6VA 4TZDA 5LLQA 2O03A 1WCSA 2QEXI 3OYCA 1PZ7A 2X4HA 1GDTA 5A1LA 3WINE 2E7WA 4ETSA 1Q1HA 3WU0A 1LHNA 1TT5B 3RIRA 3IN9A 5KK1A 1J1TA 3HNBM 4M9ZA 3KV5A 4YM2A 5GAEJ 2KHMA 3CF2A 2FEZA 3NSTA 3WQ1A 4WM7C 5IVVA 4OHYA 4PJJA 1RUD1 1MSFC 3CQOA 4O65A 3IKWA 2WZ8A 4OMZA 5CKNA 3GZ6A 5J1UA 2XHNA 3R0AA 4M72A 2ZMEC 2L5QA 3ABLH 4BQ2A 5EQUA 1R23A 4MGKE 2JIGA 2LMDA 1EUUA 3IHUA 1MSEC 1XE7A 3OYJA 3O1PA 1ZQ3P 4PJYA 4M74A 4BNCA 4UW3A 3IPVB 5D8AC 2AHQA 4C2TA 4M71A 3KYLA 4JQTA 1LJ9A 1EH6A 1S9HA 4IEOA 5FFXA 1N75A 1AF9A 5JPMB 2HWVA 4QTRA 3W2VA 4AWDA 1DBNA 4QHZA 1BEV3 4I98B 3CJIC 2Y9YA 2NVQJ 3BPXA 1VQPI 1MBFA 2B9SA 3BOPA 3PJYA 3OSGA 3KVBA 2ZNYA 3NQOA 2A05A 3AMMA 3BR1A 2WSUA 3PJQA 4A3DJ 5C33A 5I0UA 2Y48A 3M8EA 4HNVA 4XBQA 4QPGB 2HDDA 4A7ZA 1R9TJ 3H8XA 1GVDA 3UYJA 4HG6B 3ACGA 3QPHA 1X9PA 1IHMA 3HD8B 3PHMA 2LF8A 3CCEI 4DXZA 3WY6A 2P3YA 1YX3A 4MHRA 4WVVA 4G7ZF 2K27A 5TISC 1SANA 3R6SA 3KGZA 3GMEA 2XVLA 5GZFA 2Y6JA 2CMPA 2MNGA 1YO5C 3EMRA 3OOUA 4QX1A 5FZ1A 1XMXA 3NO8A 5LD2C 1IW7F 4X8NA 3OEAA 4AVTA 1D4M3 4R9DA 4QM9A 3L00A 1B8IB 1HQNA 2PFBA 4A0YA 3HOYJ 3QH7A 4AI8A 3JCUC 1H4HA 4Q29A 2BNMA 2B4KA 3FHAA 1HQLA 2W1QA 4JAAA 3UK9A 2BOLA 1RVF1 1Q8SA 4J1XA 5DZGA 4XC9A 3FBIB 1G4DA 4M4RA 4ATEA 2DYCA 3KP6A 2BDRA 2QCSB 3GTOJ 1PDNC 4UUTA 4LK6A 3VN4A 4Y13A 1GZWA 4G4FA 3RQ4A 3U1XA 5F5AA 1PM4A 3LPGA 2V6EA 3P9CA 1MGTA 2WO7A 2BNNA 1DYPA 3AYAA 3PTYA 5C8CB 4GO1A 4BB3A 4XKBA 2Z69A 3MQ0A 1VBC2 2M2EA 3WDWA 2ENRA 1MJBA 2DCEA 1O57A 3JRDA 4UBHA 4PF1A 1AR71 5K0UC 1VQ6I 2RE9A 1OD5A 5L3EA 1E3PA 2BY3A 2OTLI 3HPNA 1OBNA 3D5SC 3DKQA 1UY2A 3ZFGB 5A7OA 2JRTA 1JKQC 3VBFB 2F6BA 3H3UA 4CEWB 2VZVA 1U12A 2LOOA 1L3JA 2D97A 1SCSA 1EF4A 3GWZA 1RUG3 1AKHB 2G9FA 1SPPA 1SACA 4A45A 1JYWA 2O61A 1VBB2 4L5IA 2C6YA 4QXKA 1L7LA 2ADEA 2RS53 3KFWX 5JSPA 2EK5A 3VYSB 3AMNA 4F3JA 4JP0A 1O8SA 4A0XA 2RS31 1XBFA 4O5VA 3B7MA 1C28A 4W8JA 3K6GA 3U4XA 2PX9A 2ERFA 4B4CA 4YIFA 5DM7F 3I59B 4JTOA 4BQOA 4PQ9A 4CPBD 4NBQA 1UG0A 1BK0A 1ON1A 4N43B 1YS7A 3FM3A 4ATFA 4IETA 2Z2SB 1PO12 1H6XA 4AEDB 3I58A 3MMYB 4A44A 4B47A 3ZYBA 1IN7A 5J98B 2Q0OA 2PLYA 3DFGA 4XCBA 4DPNA 1PNGA 3CTAA 5T5JA 2I07B 1J3PA 2OD5A 1A36A 2VN2A 3RQ0A 2PMZN 4UFJA 3E6MA 2XLAA 1VMJA 1HW5A 3PNAA 1A6QA 1YOVB 2FZ1A 3FKJA 1MZEA 2HVRA 3ZSMA 4IL6C 4D6SA 2DVAA 4PIZA 1DLCA 2VBWA 1SLTA 3P9IA 2HEWF 2WA0A 4EM1A 3PO2J 4MVTA 3U07A 2EV6A 5AFBA 4CDXC 1R49A 1BW6A 2H27A 2OV7A 1Q3EA 1PO23 3V7SA 3CD6I 3KIOA 1XOYA 3ZR8X 3OYWB 1W6OA 4U7BA 2VMHA 3I2DA 5FZ9A 4IW3A 2XVGA 4B29A 5DDGA 3GTMJ 5EGOB 5FZCA 1BR2A 1YIFA 4BY7J 1R091 2OXBA 2Y6HA 4A7KA 1YFUA 4UBGA 3L2QA 3S1RJ 2A68F 3ROUA 4FPCA 5JZGA 4YLZA 2Q1FA 1YYNA 5FB2A 2UUZA 1OYIA 3USSA 2VW0A 1APNA 4EJRA 3WTUC 1DGWY 2V79A 5HLIA 2KMUA 1PK6A 3DP7A 4BYYA 1AX2A 2VQ0A 3WDXA 4QPOA 1IV8A 1H8TB 2PAEA 3G3ZA 4GMP1 4AVAA 1FIAA 1NUKA 3OJBA 1YLLA 4DNYA 3N9MA 1WLDA 2XAQA 2QJVA 3VDAA 4Y1XA 1UOJA 3X2QH 3CUQC 3ZMDA 2R5ZA 1HC8A 2EF6A 2Z16A 4G7OF 4ZU4A 2GC0A 1YJ9I 1LGNA 2IVMA 2HYXA 5C5UA 3UGFA 4A6SA 5HODA 3DPTA 1W9SA 4NHLA 4ES8A 3GTGJ 2FQPA 2HI3A 1P6RA 1Y9MA 1CGPA 3TGNA 2PQSA 4OI2A 4GXOA 3O1UA 1H9GA 4DYQA 2EQRA 3MN2A 1N1TA 1XPWA 1OCCH 3BJOA 3UT0A 1IS6A 3L2CA 4AI3A 2W87A 4NROA 1DPRA 2R043 3PVNA 4NRPA 3S5AA 3M7AA 4IEJA 4XRMA 2O0OA 2R7TA 3VZOA 2GQQA 2QZ8A 2JB8A 1MMSA 2AEZA 3W59A 4Q1PA 4P9LA 4CEYA 2HWB2 5F3EA 3PTRB 4E4ZA 3PIJA 5E6HA 2WAEA 4QQOA 2VZ1A 1C5HA 2DF7A 4XLCA 5CYVA 4AIHA 5M3FJ 1X36A 4YW2A 1UYYA 3VDCA 4WM8B 2M7AA 1VI0A 3MIGA 2EZIA 3M07A 2YUEA 5K8SA 2DTYA 3LCPA 4CCEA 2MGQA 2GIVA 2BW8A 5I93A 3I2IA 3VDBA 3CKHA 3AXDA 1RI7A 2VT3A 4FP2A 4COYA 2XWBB 4DZJA 2R1BA 3LE0A 2Z33A 1S0FA 2MBFA 1U8RA 2Y6KA 4YGDA 3DYOA 2RQPA 1QU0A 3NWTA 4CU9A 4BKXA 4ENKA 5ILUA 1R082 5C3RA 4LBKA 2H6BA 1MEC2 2BHZA 2JEMA 2ZJ2A 2E63A 3KP3A 3THCA 1V5GA 1NAEA 1LOFC 4XQ4A 1MZ5A 5KHDA 3F21A 4Q5OA 3TAYA 4HEA2 2GMMA 4CICA 3BOQA 5DUWA 1XSQA 1RNLA 4UFKA 4GRIA 5I0DA 3ZDVA 1IQAA 2STWA 2OZ6A 5JVTA 3NAPB 3BG9A 2KIMA 2V4AA 2YFZA 3JW4A 4UHTA 1J58A 3L1PA 2ID6A 5T52A 3E97A 3I2OA 2IP2A 3ZQGA 3ZFEA 2GLOA 1QJU3 4XHBA 1GBGA 4COUA 3ETQA 2AH2A 3V7CA 1PJRA 1XGMA 4R9AA 2GOMA 2A6TA 2HS5A 1WSUA 3JD71 2R7ZJ 3ZGKA 1X1BA 5BS6A 3BZ6A 3KZIC 2CFXA 4E8DA 1LULA 1ZBA3 2UWBA 1SMYF 1YJWI 1BYHA 5ICFA 3H3LA 2JSPA 3NV4A 4EWAA 2EIEA 3DTIA 5A3WA 5IK5A 3IH3A 1UMIA 4IHYA 1ZH5A 5IAVA 3Q8FA 3ZFEB 1S0BA 1H2KA 4NJ4A 3ACLA 4RN5A 4XAEA 2D5VA 2E31A 5D21A 1AKHA 1T2KA 1LEAA 2Q8EA 4IV1C 4II2A 2M30A 1S0GA 3N36A 4GH4A 5FY4A 3BTXA 1V5FA 3QLQA 1O4XA 4PGGA 2GWRA 3WW2A 2ZACA 4MOAA 2IGNA 1RUF3 3BZKA 3NJYA 4AQ6A 1H8VA 2HOAA 3F6OA 2JA6J 2AXTC 3OPTA 4KWUA 3VBOB 1YRNA 4IVNA 1QOTA 1H9PA 4PGHA 4Y7NJ 2E1MB 2QQAA 1VBD2 1ZA7A 5LBBA 4V2WA 2JQ7A 1SLIA 1ZRFA 5F6FA 3I4PA 2Y60A 3C7HA 4LKSA 2O3FA 4S04A 3ERED 2DMNA 3AZVA 1R00A 3LPFA 1P2FA 3BC8A 4GDFA 2CQQA 4YM1A 4JGZC 1PMIA 5HLGA 5FRAA 5A7SA 5I91A 1H2MA 4JVAA 3H8UA 1SFKA 1B1BA 5EYYA 2O8XA 5JLVA 3S8PA 2WSVA 3PNTA 3K48A 2D40A 1OA4A 2A75A 5ABJC 1MBKA 1ONVA 1ZG3A 5JI9A 5JXHA 3DXUA 5E3MA 4XFHA 2JWPA 5C7GA 4YG2F 2CU7A 1SAXA 2QTWB 4GD4A 5B4NA 4BGDA 3S0MA 2JDYA 4IKFA 1ZKGA 1H88C 3B94A 4ZZ5A 2ZO4A 4YW5A 2NMNA 2L01A 1YC61 3OD0A 1QJY3 3MZHA 3WV6A 2A6YA 1DDNA 5FY1A 3M70A 4JRAA 3HKZA 1U3EM 5HXVA 3S57A 5IK4A 1UYPA 5DAVA 4DXRA 2D5FA 2GP5A 4EN6B 1IXCA 1HF0A 5HBAA 1QHHD 2W1SA 1X4PA 1GT0C 2Y31A 5DM6F 5FGMA 1YI7A 3S6PA 3HJRA 4XMYA 1W05A 4GKXA 1ZZ6A 1W6NB 3A7QA 3S3MA 3U21A 2M4KA 1MNDA 1FTTA 4YFKF 5HNHA 4A6EA 3WLUA 3IKTA 1V6MA 1NTCA 3T5XA 3K46A 3RSNA 5HDKA 3D0JA 4TTGA 3DN7A 2DOFA 1VQMI 2YPDA 4AI1A 1RUG1 1RMU3 2R041 1H8AC 4LG3A 1OLMA 4ES9A 4HONA 3WG1A 5EIYB 3ZPLA 1QJZA 4QXCA 4YIRX 4CDQA 4AR2A 2VM9A 4NHKA 3I4MJ 1SFYA 1Y39A 3CC2I 1K5MB 3LFUA 4E6KG 3GO5A 4P9FA 2BY1A 2BWCA 3ZN5A 1EAH3 1QU3A 4D0PA 1HB1A 4N53B 3UETA 2LROA 1IO2A 3WG3A 2YFUA 1J9IA 2RGVA 3V8KA 3QOEA 3HRMA 2NS0A 4DJAA 1XSRA 5FYBA 1NCRC 1Q8VA 3DTEA 4EV0A 1FOYA 1XYPA 5GPCA 4CA0A 2GC3A 5G04L 3KV6A 3TNPB 4I02A 2QSHX 1BEV2 1T33A 2ZJRF 1RUG2 3LMMA 2YU9J 4X6AJ 2TUNA 1SD6A 1JUPA 3AYCA 1P7IA 3REOA 3CJIA 2WNVA 1D2SA 5JZGB 1XD7A 3VKOA 5EV7A 5B1AH 1OA2A 4YARA 4P9GA 3BLYA 4EJUA 1POV3 5H20A 1B6AA 1R083 5F2WA 1F8VA 3WTZA 3BIEA 2VQLA 2VAUA 2Z1DA 1NLRA 3KEYA 2JD4A 1G3WA 3HOZJ 3IDCB 2BWAA 4A42A 2KLOA 1YIPA 1USTA 3LA7A 2VC1A 2ADDA 4M3EA 3M3EA 4MEYF 2WNUA 3PNVA 4FOQA 1XB4A 3WD5A 4MFEA 2D6KA 5KHJA 1YFHA 4MG2A 5JUVA 4K40A 1FV2A 2Z99A 4CDQC 3B02A 1W36C 1RUE1 3WW3A 1QJY1 1YQCA 1TZOA 4PUSA 3FUOA 2M1BA 2ARCA 2WLQA 3VBRB 4CU7A 5LY2A 2VOWA 5E79C 1HDPA 4B4QA 1TNFA 4JQFA 2MH9A 3OYAA 4FPJA 1OLTA 4GFBA 1PVEA 1DQ1A 3FHQA 1RC9A 1V9U3 1P8JA 1UMQA 3T2QA 2JJ7A 1HLCA 4R8HA 1KXGA 4D6RA 3IBMA 3A23A 5BOXA 5F5IA 4UVAA 3C2BA 4OOIA 3K4MA 3TBDA 1O4YA 1AR93 2HWD3 3OB8A 2ZKLA 1CAXB 2W82A 1WLCA 3IMNA 3I3DA 2GNTA 4XZPA 2XLGA 3L2UA 4EM0B 3AG2H 2LC2A 5C44J 1YXWA 2LNBA 4DXTA 2M5WA 1IN5A 4Y5Z0 5C9AB 4HNUA 1IUYA 4Y5TA 4LLGF 3FZVA 3WHBA 3M4FA 1PGW1 2ETHA 3LEIA 3ORJA 2RVAA 2DBIA 2PA7A 1WD4A 3KP4A 1IRGA 5IOYA 3GXOA 1OYWA 4B1LA 1CIWA 3SKVA 4B8EA 4I0BA 4LG0B 4IE6A 4ENNA 4LOCA 2L02A 4P08A 1R5ID 2BHYA 2HDWA 1C1FA 2ZBKA 5IFPA 4ESJA 5KAFC 4RHV1 3LDRA 5DXDA 5DAWA 1WHUA 4BXFA 4ZYHA 3DBHB 3VHRA 2PLV2 1I5ZA 5FCCA 4HX7A 4LO5B 1Z6TA 4BQYA 4IGOA 3Q8EA 2M0CA 4YRVA 3OD4A 1JJ6C 5C4WB 1ZR2A 4PIYA 4B3AA 2RM22 2W1WA 2VQGA 3O8GA 2FNPA 2XUMA 1NG7A 4LE3A 3NNMA 4LMFA 2R7UA 4PBOA 4Y17A 2PTMA 4LK7A 2PN6A 1EAH1 4KIFA 5D6EA 1WCQA 1US3A 2Y6GA 1RKTA 2CS3A 2DJIA 2R3SA 1Z6RA 2D6MA 3E6BA 2L0KA 1KYZA 1MJAA 1UNBA 1AXZA 3Q9SA 1DGRM 1RUD2 5J47A 1HXS3 3O1VA 2C9AA 5FREA 4QGLA 1JI6A 5J36A 1GWMA 5KHHA 1Y3TA 3I59A 3OBRA 4XDOA 4XDQA 2DA6A 2KJCA 2NNNA 4YNIA 5FY7A 3LEGA 1LHWA 2DMTA 2KR2A 3VBFC 2HWF1 1MACA 4P9IA 2GH8A 1A34A 3H9AA 1BKZA 3JBG3 2DA2A 4BE0A 5HS8A 2ZKNA 2WAQA 1HRI2 1O91A 1JZ5A 2VPLA 4H0EA 4O9EA 4W50A 3I3BA 1HW1A 2CQKA 5CZKA 4RGSA 4EMSA 3POJA 1ENHA 2HOEA 4M3CE 2QBYA 1GSLA 2PXJA 3AFKA 3ABTA 1AYN3 1WQ2A 1YYVA 1V55H 1AXYA 5C8CC 2XRLA 3LEKA 5C70A 2PN5A 3JBG1 1LVKA 2NOJB 2VMFA 3BCAA 1QH7A 5FPZA 5SV8A 3CHXA 5FZ8A 1FNZA 3FF5A 1LFPA 2Q30A 3B6CA 4B7EA 4OVEA 2YBKA 4TSVA 3V0BA 4OMCA 4NIDA 4U0VA 4HW0A 4D5FA 5J1XA 1VBB1 4NQWA 4JV4A 2AYHA 2VVFA 1FYLA 1VB4A 3OG2A 1ZRCA 1LE8B 1TMF3 1LOCA 3H35A 2VQHA 1IG3A 1HB4A 5C3EJ 2CL2A 4L9VA 2OPKA 4F52A 3SDBA 3U78A 4EQVA 4RGKA 1OFNA 3S30A 1PVC1 1CPNA 2MEV2 2XAHA 1PMJX 1RRJA 1N77A 5J8FA 3ZQFA 4HF0A 4KT6A 1N1VA 3NKGA 1EV13 3I2HA 3MIFA 3L09A 4KG8A 5DZFA 3KB5A 3V8JA 1NYWA 1VAVA 3ZXJA 2W91A 3CCUI 4URAA 4CYDA 2MA3A 3C7OA 5FZGA 4MH0E 3ZR6A 3N7MA 3N7JA 3FXMA 1YFXA 1Z9CA 1F5FA 1OKOA 1ZK8A 4XTMA 3GFIA 1ND3B 4BQQA 1PX3A 2R4GA 3TB0A 1KQ9A 1NA1C 2ZJPF 1CR7A 5FZ4A 5EJ3A 4W6WA 4HFSA 2ZABA 3OYLA 1C0WA 5DAQA 2CFOA 3G6JB 3P5JA 1YIJI 3ALQA 1RUF2 5ILVA 3BR0A 2DAOA 5IVBA 2WQ8A 5EEHA 4AHWA 1LNWA 1OMIA 3LZZA 1FYKA 1X7NA 1WH7A 5IK7A 4RHV3 5FPBA 2NS7A 3BTAA 1BQPA 3R4UA 4NC7A 2EIMH 1HRI3 1J09A 1NE6A 4XOPA 1KD7A 3IIAA 1Z91A 4H2AA 3THPA 5FY0A 2BYVE 4MQ9F 2FXAA 4XUPA 1V9U2 4M3CA 1FZPB 2VVEA 2L7MP 2A70A 2FD5A 2XL7A 3ZRGA 3OEBA 2V9PA 3SZGA 1WJDA 1OCRH 5FZBA 4P00B 1B72A 1TME3 4AHXA 1AR92 2HWD2 2Q2EA 4S2DA 4YW3A 1IRZA 1PP8F 2QLZA 1B9MA 5A32B 3VKNA 4BLIA 2MW8A 1FTZA 4BBSJ 1RUH3 2GH2A 2O8OA 2RMU3 2CV0A 5F1RA 2W57A 5FY8A 4F93B 1BLZA 2VZ3A 1NA1B 5JVVA 3FM5A 3PUFA 5J7MA 1X19A 2I8DA 1D0HA 2V26A 4QX2A 1ASJ3 3V56A 3GTKJ 2D5HA 5DG2A 4XETA 3NJXA 2Z5UA 5D8LB 5J48A 4P5OA 1WCKA 4RGUA 1RINA 2IZWA 1U2WA 4YVWC 2JG8A 1LU1A 2HWE3 3DWLE 3HBKA 3A4CA 3HOBA 3S3NA 2WS93 2DFCA 1GKBA 2RVCA 4U87A 3W2WA 3ASNH 4A3BJ 3GW2A 4LOTA 2AUYA 2P6HA 3ZDSA 1EV12 2VT2A 4Q0SA 3R4DB 3H0GJ 2LP0A 2YR2A 5E18F 2VUMJ 1AR72 1LU2A 5C3PA 4A3GJ 2BTVC 2JE9A 3A03A 5GKAC 1MQTC 3QBQA 2CW0F 2OUMA 4FPFA 4GULA 2L4MA 3VHOA 1BBT3 2HWB1 4CDXA 1F4HA 4UVBA 3URFA 1V6JA 1K42A 1GMMA 3H0OA 4XQDA 4CEWC 2EPFA 2E19A 3ZYGA 2ATFA 1CONA 4B1RA 1HXS2 2UWAA 4Q26A 1VNDA 3H1MA 3QU6A 2D7FA 5D5UB 2YU1A 2ZFWA 5FLXZ 1LENA 4FOWA 2SLIA 2KXLA 3WP3A 4B09A 5KXEA 1QOOA 1JUSA 3C7FA 2WZR1 4XZUG 4M6VA 1FOKA 4UI9L 1WZ2A 1UX7A 4U0YA 2WAFA 2OX0A 3GLLA 2DCTA 2BVLA 1KS5A 2OA4A 1PGL2 1XCVA 1XB9A 5ICGA 2R063 4E7HA 3IAS2 3T1BA 2B63J 1TMF1 3H5AA 4XLNF 5GZCA 1PO11 4GMP0 2LG4A 3USUB 1JODA 1T39A 1LKNA 2XGXA 4QQHA 1F9KA 2M87A 3ZFFC 1VQLI 3MCZA 1D3YA 3L2HA 3GFMA 2GNMA 3WTSC 1GANA 5L9RA 1DPUA 1JHJA 2WY8Q 3K69A 4I6ZA 1H0BA 1TWAJ 3NAPA 3FFQA 2H8RA 3K4DA 2LTNA 3CCJI 4ZYAA 4BMBA 4RAZA 4LJZF 4QPWA 1FP1D 1BA5A 3H8RA 1IPKA 2COBA 1T38A 3IDBB 1DYOA 4XJUA 1J75A 5A3PA 3HUGB 4KN7X 1RHI1 4CEWA 3FXRA 1W2TA 3D3AA 1UCXA 4ANJA 1L0OC 2HQAA 4QKFA 1N3QA 5F5QA 3KM5A 4LGWA 1D0YA 2E34A 5A3MA 1YJLA 3CUOA 4QPGC 3ZMTA 3W6VA 2FDHA 1RTVA 3B6AA 3DXJF 2UZKA 5D1IA 2W2IA 1SLAA 1JTXA 5C4WC 2EXJA 2HWC1 1S29A 4YGCA 1XE8A 2DA3A 4S2GA 2D93A 2QZ3A 4UAPA 2HEVF 2VCCA 3HSEA 1MQTA 1WCMJ 2WA3A 4FXKB 3NKTA 1F4AA 2FDGA 5C4JJ 2DXIA 1NY72 4FPKA 2ZXJA 3BTCA 3HRTA 2CQNA 5FJ8J 1MEC1 1UCRA 5AFEA 4XIDA 1J3RA 4FX4A 3GHNA 1VQKI 3N7KA 3GYDA 2EIBA 3PSIA 2PELA 3MW3A 2ET1A 3A0HC 1Z05A 4ITVA 2TNFA 5DABA 5AC92 5LGNA 4B3NA 4M6YA 1D1AA 1TVGA 1UZVA 1VMHA 3ACFA 1QDCA 3HHHA 1GLNA 2WNOA 5I0TA 1XNCA 4WVMA 3UKTA 3KD4A 4F8AA 4D6QA 4CDUC 3FKIJ 4N7UA 1LGCA 1JI8A 1XNKA 5JR3A 1W36D 2UWCA 3WE3A 4O3MA 2RDQA 3FLPA 3ML6A 5BPDA 4YM3A 1EKEA 1TT0A 2B0LA 4PDKA 4UXNA 2BV6A 2P37A 4A5MA 3WHTA 4LMYA 1D2QA 3SLIA 4IHTA 4KG0A 4LQRA 2Z79A 4HSLA 5EZHA 1K79A 3A01A 3WDYA 1CX1A 3HRSA 1R4MB 1T56A 2XGEA 5G05L 2UXNA 1VFCA 2MABA 1R71A 1TG7A 1W0NA 5F27A 2ZGQA 2LKSA 3TQNA 1X1AA 2R7OA 2NN8A 2X9DA 3PUSA 2A1XA 1RUI1 5AVPA 4BEHA 1RVF3 4BDVB 4O61A 4Q27A 4QX7A 1NZCA 4L11A 3K9TA 2VNVA 2E36A 4C3JJ 2RAEA 1RUNA 3S2WA 2WS92 4CVUA 4OIOF 3IIIA 2MFZA 1WKMA 2DFFA 1LGBA 2R7XA 5JZGC 1K78B 1I9RA 3GCMA 5CVRA 4NWWA 5I8TA 1MZ6A 2TEPA 3L9FA 1DGRA 5HLHA 2JA2A 1WW6A 4WVZA 1LNSA 4NIAA 1QZYA 3F6VA 1ETWA 5E8AA 1U5ZA 3M8JA 3BCWA 2Q8DA 3LQQA 4HPQA 1YX5A 2WL1A 1IDYA 4DY5A 5B4XA 5FK8A 3MYXA 2Q8OA 2RV9A 4HK8A 3I3LA 2XBO3 3CNAA 2GC2A 4ZDOA 4FPLA 2R92J 3G1OA 2ZJQF 2H1KA 1QXJA 2K9SA 3DPRC 1ZZBA 3LSEA 2K3PA 2VH9A 2P5VA 1XU2A 3AB0A 4PLNA 1DQ2A 5T50A 2C4XA 4ZJZA 1Y9QA 1AJKA 5K7ZA 2F4LA 1QJX2 2XBO1 3G1MA 3SCFA 2LREA 3QU3A 1VIWB 1H0MA 3DYMA 5A2QZ 1CJDA 3WUCA 3GYHX 5JXGA 1W8UA 4LBNA 1HDDC 1ZZ8A 2NQYA 4YW1A 4WM8C 2Y0SN 5DUVA 4ASNA 4K8RB 5J3UA 2FCVA 2VE1A 2R062 4R4ZA 3HSFA 3QWLA 4DNCA 2B45X 2B8MA 4Q0QA 2R7QA 1A8MA 4XCAA 3HOXJ 1DUXC 3C2UA 2D3SA 4AI9A 4LTAA 5CAZA 3ZSKA 2JG9A 3GZ5A 3V64A 3FBYA 3DCFA 3OPWA 1MBGA 3O1RA 2F5DA 3AL0B 1EYBA 1V00A 1TME1 4UT5A 2EFWA 3IKVA 1U9NA 1ZELA 3DUIA 2LYCA 2X6WA 4GWJA 1IN4A 3NVCA 4AFDA 5KHIA 2E7AA 3ZYRA 3DBRB 1O7LA 2QNKA 3SHFA 2P1BA 5A7WA 1F2NA 1X3WB 4B4PA 3QQAA 1S1AA 4V2GA 1V54H 4EE2A 1C8NA 4GQ7A 3CUQB 3PUIA 4ET7A 2FRHA 5FYCA 1ONAA 2XC7A 4BM8A 4KBBA 1G3YA 1LR5A 4Q0UA 5JIUA 4YPJA 2HWB3 2XJTA 3M7GA 4HVRA 2RJ2A 3BJ6A 4P9YA 4AM3A 3FJSA 1R1A2 3FC0A 1DGLA 3MO4A 1QVUA 1RPWA 4CP9B 1R093 4OULA 2WLPA 2RS12 3FN9A 5J3LA 1SD4A 2ARAA 2VI6A 4JDOA 2E1OA 1GP4A 5ANNA 1PMHX 1Z7UA 4O6JA 4JGZB 1TWGJ 4Y20A 2YMZA 1PYVA 1K7AA 1KGYA 2VMGA 1W0OA 1AA7A 2X09A 1WA6X 1CAVA 5F0HA 1T0FA 1KDKA 1Q43A 2HPMA 2BGPA 2QDNA 2D1HA 3KCCA 3MVPA 2J1TA 3ZQCA 4IEQA 4JKMA 2OQGA 4LBMA 4I30A 2DYRH 1QJEA 3D0SA 2P2KA 3WTYC 2CUEA 2ZMKA 1JYVA 5FKLA 2BZDA 4BIOA 4EJVA 4QX5A 4XFAA 1ORKA 3JRFA 2QQOA 4OAYA 3RQIA 4UFHA 4Q0VA 2V5YA 1ERDA 3EUHC 1QEXA 5KAIC 2RDRA 5HDNA 4LJHA 1G59A 3DL3A 3RCOA 2HEYF 1JTZX 5FTTC 4XRSG 3QCWA 1W8WA 3NNJA 3LWCA 4CDWB 3OYEA 3DF8A 4P14A 3WU2C 1WD3A 4KU8A 1FIPA 1JJ8C 2CO5A 4UW5A 2JTVA 3JSPA 4LHNA 3UNGC 2DPDA 3S1NJ 2FOKA 2QYOA 1YE9A 3J7MA 1TNRA 3RS6A 4I3GA 4XLPF 2DFHA 2CHHA 2BZTA 2VY0A 3AP7A 1FPN1 2QQJA 3OPZA 1QF3A 4FVVA 2IBDA 3ZO0B 2PMHA 3E5QA 1SDDB 4IEVA 1XDSA 2O14A 2YU3A 3LSRA 4OU0A 5H6RA 3AKTA 1P92A 3F8MA 1ETOA 3CIHA 2E71A 3TN92 1FI2A 3FXOA 5FO9B 1E5IA 4ZYGA 2KL4A 4GB31 2BY2A 2XJQA 4EM2A 2DURA 1HSTA 2VUJA 2WADA 1FJLA 4C1XA 4QWQA 2A3SA 3ZVXA 3ZIWA 2RJKA 4Q4X2 2V09A 4BY1J 4I2OA 1T6SA 4XF9A 4Q4X3 3F72A 3OSDA 2HTJA 3LSTA 3FHZA 2KM2A 1WWXA 1TNTA 2K2SA 3HGYA 2VQCA 1RMU1 2VONA 2GC1A 2VZRA 4JX6A 1MS1A 3EHKA 3RVHA 3BZCA 4DUXA 4C8DA 1UY1A 1XGOA 1K61A 2ZXQA 1CN1A 2HNHA 3BTYA 4XNFA 1UZCA 4IQ4A 2ID4A 5KCMA 2A6XA 2A3XA 2JB4A 4RS5C 2OQ6A 4M01A 2QQNA 3V8LA 1N1SA 4D69A 3OL4A 4TLGA 4WZCA 3EUKL 2QQUA 1ACIA 1AXKA 4XOTA 1WW4A 4MLOA 1SFUA 2WYFA 4MXWA 4GYGA 2V1NA 4RQPB 1UU4A 3VBSC 1ZARA 2J5OA 3ZKUA 3HKZN 4ENJA 3NEUA 3J26N 3AP5A 3H5RA 4P1WA 1JU3A 3GZTB 5FYIA 2CG4A 1QXPA 4D7NA 1XNAA 3PVBB 2CAVA 3H3ZA 2F5CA 5M5YJ 2WNUC