5LRRA

The transcriptional regulator prfa from listeria monocytogenes in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin positive regulatory factor A
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein
total genus 76
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lrrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lrrA01
3F8FA 1D3YA 2V79A 4HZFA 2VE8A 2I45A 5FLHA 3NEUA 2WFPA 2RVCA 1Z05A 1HW2A 1XSDA 4KA4A 2A68F 4DNCA 1ZZ9A 4G9YA 4XFAA 1FBUA 2E7XA 5BPIA 3KP7A 4BAYA 2M45A 2L4MA 3BPVA 1LRHA 2STWA 4EQQA 1HSTA 2GC2A 1OYIA 3U10A 1S6LA 1H0MA 4U0WA 5BXXA 4RB3C 1KU3A 3CLOA 2Y0OA 3TDUC 1UIKA 3HSFA 3JSPA 4X6QB 1KYWA 4F8AA 4B29A 4ENJA 5FDBA 3GZ5A 2QJVA 2LSOA 1O5UA 1IXSB 1J3PA 3EYIA 1CAXA 3F72A 3E5UA 4GYGA 1T6SA 1SQ4A 3G73A 1G4DA 4ZYDA 4XLNF 2WC2A 5JR3A 3RYRA 3AAFA 4M74A 2H27A 3JZVA 4HF2A 2EV5A 4Q0UA 4E2QA 1BI1A 1QPMA 3QPTA 4JTOA 3LAGA 3WTWC 4EWAA 5LGTA 2DO7A 4UVAA 1RZ4A 3WGIA 3WW3A 1NYWA 4TLFA 3H7YA 2K27A 1UPIA 5KHGA 3WW2A 3QU6A 1Y3TA 2DQLA 2E7WA 1J2XA 4GO1A 3TO7A 4AXOA 2J5PA 1OR7A 3DPLC 4RAZA 5CVVA 4LULA 2MPFA 3L7WA 4UXAA 5FB2A 2A6HF 3IDBB 4Q0SA 4NQWA 3ISPA 1NE4A 2STTA 5EEGA 1SFEA 4HSLA 2OA4A 2A07F 3HUGA 4QM8A 3DXJF 2VC0A 3CF6E 2IXKA 2FOKA 3I53A 1ZNPA 3V7CA 5HLIA 1WI9A 4I0BA 1LEBA 4HN0A 2MHFA 4WXCA 5E1WA 1YFWA 5CVJA 1Z1DA 4O9GA 4Z2YA 3GXOA 3S7IA 4HVOA 4XLPF 4LUMA 3U11A 2EA4A 1BC8C 5HDNA 1UHWA 4LD5A 2IC1A 1FP1D 4ON0A 1IXRC 1J59A 1U78A 3ZMSA 1GXPA 4JK1X 4P9GA 2DQRA 1VR3A 4AVCA 5LEKA 4E2SA 4I98B 1QQIA 4YARA 3JW4A 4EM2A 3WTUC 4Q48A 2W24A 3PQJA 5I0TA 1R00A 5LEJA 1FYMA 2ELHA 4HN1A 3T5XA 2D1VA 4R79A 5DUIA 3BROA 1R22A 2VE9A 1OMIA 1TLHB 1W5TA 5I0UA 4HA8A 5DEQA 3GLXA 4LK0F 3BJ6A 5J6XA 2KXLA 2EFWA 5HLHA 2FQ3A 1XRUA 4AWXB 2G7UA 3BPXA 5FPXA 1HKQA 5IT9Z 2MC3A 4ZH4F 3GX4X 1FY7A 2GC1A 3H1MA 2EV0A 4TV7A 3FE5A 5KVRA 1DPUA 1L3JA 1EH8A 1U3EM 4EWEA 1OYYA 3BU7A 1SMTA 2QZ8A 3RKYA 4RB2C 3H9AA 2HEOA 2O0YA 4PGGA 2PFWA 1IN8A 1VJ2A 3VODA 4CDGA 2CV6A 2HR3A 3EQLF 3QAHA 4MGZE 3RI4A 2FMLA 4WBBA 4UV8A 2QNKA 3MQ0A 1SD7A 3HT2A 1IN4A 4QXKA 1GXQA 4PDKA 5A2QK 1ZH5A 4MQVA 4HBLA 3EJKA 3R4KA 1SFXA 4LB5A 4FBFA 4IHSA 3BDDA 2A69F 2O8QA 5CVIA 4ZU4A 5FD6A 2ET1A 2DAOA 4IRIA 3RJPA 1LNWA 4XF3A 4QGNA 5FCCA 3WGGA 1U5TB 4OINF 3KLNA 2CGPA 4ZU5A 1G6NA 1RC6A 3EO6A 2ISZA 1WQ2A 3JTHA 2VODA 3ECOA 5BUVA 4MNUA 5DD4A 1QNTA 3CLPA 3JAMZ 5L3GA 3VFZA 3JAMK 1IW7F 1F9NA 1P2FA 3L00A 3RDIA 1GQGA 3FXQA 4Q0QA 4E2GA 4RGXA 2D93A 3D0SA 4H7LA 2OBPA 4KIGA 3M7GA 1U5TC 4CICA 1K79A 4AQ6A 1YFYA 2W57A 2IA0A 3OOPA 4I2OA 1XMAA 5LHGA 4KU8A 4FT8A 1LR5A 3DKWA 5EEHA 3T1BA 5TJJA 3HQXA 5LRSA 2QWWA 1QZYA 1ZRCA 4U7BA 2H6BA 5HOOA 1IPJA 4LLOA 2PQQA 1H1IA 3CO6C 3FWEA 1W7PA 2A5YB 2EJRA 3O6BB 4UV9A 3RYKA 1Z6RA 5L3FA 2ZFWA 1R36A 2V09A 1S8NA 3Q9SA 1G3YA 3U2RA 2PHDA 3KP3A 3M8FA 2F5FA 3O2PE 3VEPA 2V1DA 2X4HA 3TNQA 4KWJA 5KHJA 2GIVA 1ZRRA 3G7DA 2MBFA 1RL3A 1QXRA 2ZO4A 3E3VA 4G6QA 4G7ZF 3MZHA 4UVBA 1L3LA 3LFKA 3W6JB 2E9QA 4AIKA 4XF1A 5HI0A 3F8MA 4U88A 3QOPA 4ASNA 1IF1A 4L0YB 2RKHA 3DQVC 1IZ1A 2LF8A 4UXNA 2M8EA 1G3WA 4Q5SF 2CW0F 2H6CA 1W5SA 4QWQA 1WKMA 4KDPA 2YU3A 5HLGA 2P5VA 4R1HA 4G94A 1YTYA 2EB7A 2PMUA 1A04A 4JQFA 2IP2A 4AVBA 2EFQA 2M30A 1RGSA 2GWRA 1YS6A 1T38A 3Q9VA 3EBRA 2OYZA 3BJAA 1NXMA 4IETA 3KETA 1FLIA 2ACJA 4HX8A 5K5RA 4BXUA 2PEXA 2PAEA 2MLGA 1GQHA 3GVAA 3F3XA 1YIOA 3KP4A 1JGSA 2OA2A 1PDNC 1JHHA 2L54A 4S05A 2RN7A 4HLTA 4OU0A 3HTSB 2HZTA 2BYVE 3HRTA 4KMFA 1FYKA 2P6SA 5LGUA 2CAVA 3S7EA 3NJZA 3SXWA 5D5WB 4CHUA 3F23A 5F6FA 2VBWA 3WTYC 1JHFA 5I0RA 2VQAA 3BZ6A 5LRRA 3UKTA 3BJOA 3H3UA 1IN6A 4B8XA 2ZMEA 2EA2A 5I8SA 2Q4SA 5LGNA 3PVBB 4B09A 1OD5A 3H92A 4IRGA 3OTFA 2GXGA 3QACA 2QBYA 1R58A 2Z5UA 4ETSA 2LKPA 4QLCU 1ZREA 3CJXA 2D1HA 4NHJA 2O61A 2OZUA 1CAVA 2Q0AA 3TQNA 3KCCA 2ETHA 1IAWA 3IIAA 4G7HF 2GC0A 3M1EA 5FD5A 5C8WA 1YQAA 3M70A 2ADUA 4S04A 3FF5A 5C6CA 2DK5A 1JUHA 4XFCA 1USSA 5HVQC 3HRSA 1I1SA 4IEYA 2VBYA 4LB6B 5BY5A 1UCRA 2PFBA 4IF4A 4EV0A 1ZN2A 5CU1A 1ONVA 3I64A 3EHKA 4BHBA 3L09A 1Q3EA 5E1RA 4L9NA 5JR7B 2HQRA 3E97A 1ZX5A 2W85A 1X8EA 1BJAA 3WTSC 2IXIA 3PFIA 3E6BA 4RB0A 3DL3A 1YW8A 5D4RA 1CAUA 3PQKA 1CF7B 4LUKA 4FX4A 3ACLA 4RS8A 1QO0D 5ICEA 4MH0E 4G7OF 4M73A 1QXJA 3CO7C 2CFXA 1DP7P 1MGTA 3HYIA 1J0RA 2F2EA 4M72A 1B9MA 4HW0A 4IESA 1EV7A 2Z3YA 1QZZA 2NYXA 4LMYA 2QENA 1HQCA 5BV6A 4Y17A 3MCZA 1Q43A 1J3RA 5K5OA 1QWRA 3HRUA 3IRQA 1D5VA 3BY6A 3O3KA 3OD0A 3CUQA 5DD8A 4P9FA 1FSEA 4MGRA 2PHLA 1I1GA 1B9NA 3KEOA 2K86A 2ZKLA 4KN4X 3ZDSA 1KU2A 2Q1ZB 1CAWA 1WSUA 4LEJA 3C7JA 1WLTA 4IEVA 1TBXA 4EJOA 1HW5A 2HTJA 2XL7A 1X3UA 2UY8A 2P6TA 3USSA 1K78A 5D5XB 3D0JA 3F6OA 5FLJA 3RKWA 1GHCA 3BOQA 2F5CA 2VECA 2CO5A 1XSVA 4KT5C 5E1XA 4XSXF 1F4KA 4AQ2A 1S29A 4L5JA 4UVCA 5FFZA 2PI0A 1EH6A 2HS5A 2D40A 1CAUB 2F4PA 4ESJA 2Z2SB 5I91A 3IWFA 5T3NA 1Y0UA 3V8KA 4HF1A 2RDPA 4KFCA 2YSRA 3ETQA 1PP8F 1J1LA 1RTVA 3CDHA 3WW1A 4ZZLA 5I93A 3QP5A 3I7DA 3ST7A 4LG0A 4AIJA 2R7FA 2PMHA 4IEQA 1Q1HA 5FLIA 5I0SA 1UD1A 3TKYA 4Y15A 5CVRA 3MZYA 3L9FA 1YFXA 3CL1A 2MA3A 1IUYA 1DZTA 3F22A 2BNNA 1OYWA 4A0XA 3FM5A 3KSCA 2VC1A 5ILSA 1O57A 3Q5FA 4XF9A 3I71A 2K0GA 2O8XA 3J80Z 1RIOH 4MV2A 4ENKA 2ZCWA 3J7AO 4HQMA 1U12A 2FU4A 3IKTA 1TNTA 2HOEA 5LLQA 3RPUA 4HSJA 5BQTA 3UKNA 1IRFA 1P4WA 1SFNA 5KBFA 4I01A 1MKMA 1CAXB 3ECHA 1XB4A 3KZYA 4OMYA 4WXDA 3OCPA 4P55A 4J1WA 5JFRA 1ZLJA 5CLSA 3JTGA 2DPDA 1BI2A 3L2HA 1WRJA 3R60A 2OZ6A 1ZRDA 1STZA 3MFKA 4A2UA 2RQPA 1P6RA 2HWVA 3HHHA 3RKXA 1TQIA 5D8LB 3SZTA 4PJYA 1SAXA 2L02A 2Q0OA 3CTAA 5HDKA 2KIMA 3ES1A 1BN5A 1FC3A 1TTYA 4HV5A 3WTTC 1T0FA 4MGYE 2V6CA 3EETA 1TQMA 4GXOA 1TNSA 1BIAA 3HRMA 1YLFA 5H20A 5TRDA 1YO5C 1H9TA 1U2WA 2O3FA 4OIQF 4CGZA 1KQ8A 3HSEA 5IT9K 5J3UA 1TQ5A 2GA2A 4K8FA 4KNYA 1KQ0A 2IT0A 3DV8A 1ZYRF 3ZMVA 3GFIA 5DUKA 3FZVA 5EFUA 3LQRA 4O9EA 2CQKA 1O3SA 2V1UA 4U7DA 1BIBA 1SD4A 2ET7A 4IERA 2JTVA 2Z69A 4YFKF 2DCTA 2VONA 3H50A 2C6YA 4Q0PA 2IXHA 3R0AA 3I59A 4EJVA 2GC3A 4EWDA 1LDDA 3FFQA 4KYWA 4ONUA 5D6FA 1ZG5A 5JVTA 1FBQA 4LJZF 4HLYA 2K9ZA 3SQNA 1O4TA 4EGZA 1T2KA 2FRHA 1ON2A 2GXBA 4EVIA 1FT9A 2VBZA 2UZKA 4Y13A 3SFZA 1SMYF 5J7MA 2QLZA 5H6RA 4MX3A 2HKOA 4WF2A 4O5VA 2GAUA 4HF0A 4J1XA 3NKTA 2KJBA 3GFJA 3KGZA 3IHUA 4OFGA 1P4XA 2K7LA 4IEXA 3MWMA 1KU7A 4P5OA 4EJWA 2ZBKA 1LEAA 1PM7A 2F5DA 3V7RA 2JPCA 2IXJA 4XBFA 1ZARA 2PQ8A 2Y48A 4OIRF 2QVOA 3OV8A 2BGCA 1VTNC 1XGSA 1USTA 3OF1A 2K02A 3F8CA 3P9KA 2DK8A 1DPRA 2YPRA 4ENMA 2VBXA 5DCMA 4XEZA 1J7KA 3ABUA 4D0PA 1ZZ7A 2FBKA 2YX4A 2FXAA 2UWMA 5JI6A 5J48A 3TDZC 1XN7A 1ZGJA 2RV8A 2HYFA 2EFOA 2VN2A 3ELNA 3H1WA 2VXZA 5D4SA 4YFNF 2YX7A 3I59B 1XE7A 3F6VA 2E1CA 4ZYGA 2COMA 2IRFG 1XD7A 1K6OA 2BEOA 3ZMUA 1R7JA 3BWGA 2ATFA 4MGIE 3NQOA 4WK8F 4UBGA 1KYZA 3TGNA 3UKVA 5FFXA 3TO6A 3GO5A 5I8YA 3ML6A 3WU0A 1LVAA 4PIZA 2RGVA 4HOBA 5JAXA 2MD5A 2XLFA 1MZBA 1TW2A 4KICA 2C0ZA 5EZWA 1B4AA 4IPAA 3RPQA 1MDMA 1BI0A 1IN7A 1FX7A 2IXLA 3EYYA 5CVUA 3FMRA 1SEFA 1KGSA 2NAZA 1GVJA 2Q8KA 5K8SA 4AIHA 3ES4A 5CJ9A 5BPDA 3RIRA 4A0YA 2HTSA 1XCBA 3HT1A 3TOBA 2XLAA 4YSFA 2H0VA 1XE8A 3T8TA 2YR2A 3H3ZA 3RYPA 3WU1B 1MJBA 3K9TA 4FHTA 3V7SA 1FZPB 2MNGA 5JSPA 1G3SA 3K69A 1KQ9A 3DEUA 2P17A 4HV6A 2A3SA 3HHGA 2BNMA 3KZZA 4CO8A 3KP6A 1W7PB 1XGNA 1HW1A 2QCSB 4Q4ZF 2P5LC 3ZQ7A 1KA8A 2BV6A 4RAYA 3FZ3A 2OAZA 4OOIA 2QUFA 2X0LA 3ABTA 2XKOA 4OLLA 4PCQA 5E17F 2HQNA 2Z33A 4U0VA 4MEYF 3F8BA 4MUVA 1SD5A 3O14A 1T39A 4WCGA 2P5KA 1D8KA 2V9VA 4MZUA 4IEWA 3W6KB 2O03A 3PLQA 1BOAA 3GUDA 3ZN0A 4ZU7A 4KL1A 3SCGA 4CYDA 2ZKZA 4CZZA 3KE2A 3TNPB 1TW3A 1R1TA 2UXXA 4D7SA 1X7NA 1HKSA 2Y0MA 4ZZDA 1LDJA 1ZGAA 3HOTA 2EV6A 4HX4A 1X8MA 2CWEA 1HXDA 3IWZA 4N9IA 5AIPA 5L3CA 4QX5A 4Q0VA 4L2NA 3T0YA 5JHUA 4EGYA 3MAJA 4DQ2A 2P4WA 1DGRA 3WW4A 2CG4A 4E70A 2OD5A 4BQAA 4IEPA 3G3ZA 2LNBA 4G6DA 1JXSA 2DLLA 3ZMZA 1FOKA 4BNCA 1HSJA 3MYXA 3CO2A 4XFIA 2JSCA 4XFFA 2IW5A 2QQAA 3WGHA 1S7OA 3WTXC 4R52A 5FO5A 5DDGA 1JE8A 2DT5A 4WXHA 1FYLA 5LHHA 3P9CA 3N97A 2XV4S 5E18F 2G9WA 3U0ZA 3B02A 1UB9A 2P8TA 3BP8A 4KWKA 4O3MA 3PNAA 4RD7A 4HVRA 3ROUA 4QM9A 4H0EA 2M87A 2D45A 2OPKA 3BPZA 4D7TA 3E6DA 2FMYA 4I0AA 3RZZA 3S0MA 4PIXA 3V4GA 1FWZA 1V4RA 4L11A 4KIBA 1J75A 3GFLA 1REPC 3KEQA 3N4MA 1L0OC 2B0LA 4L5IA 3REOA 2ZMEB 1SFUA 2RC4A 5E16A 1IN5A 4BH9A 2WTEA 4BYYA 4PZJA 3D82A 2OQGA 3H1YA 2L3DA 2KKOA 2XROA 3K2ZA 5AONA 2QBYB 1ZZ6A 4XFGA 2QM3A 4L18B 1ODDA 1K7AA 3HSRA 4IJAA 1P4AA 4YNIA 4HVQA 1XDSA 1CAVB 3QU3A 3LSTA 2CAUA 1H9GA 1YHFA 4M9XA 1YW9A 1E17A 4QGMA 5FQ0A 4ENNA 5KHIA 4A0ZA 3GBFA 3ZN1A 3V8LA 1XDUA 4X6RB 3ZMTA 5BPXA 3VOEA 2CSOA 2IXCA 2XRNA 5DCFA 4GCVA 2A61A 2ZNZA 1J58A 1HKTA 2VT2A 1YW7A 5L3EA 1R1UA 2R3SA 4L9VA 4DINB 1YFUA 4JTNA 1QBJA 3C18A 2XL9A 2PYTA 3EUHA 2PLYA 2E1NA 4GYIA 4XF0A 3NRVA 3IC7A 1I5ZA 2KIFA 5DV5A 1YUDA 4AVAA 2H09A 4KN7X 2O6GE 1SD6A 2DBBA 1FI2A 4LA2A 3BALA 5FPZA 2DU9A 2HFHA 1IRGA 1AOYA 1B59A 3NSTA 2NNYA 1XGOA 5ED4A 3HIFA 3GYDA 1S3JA 2IPQX 4RGSA 2TDXA 1MJAA 1Q5OA 3KGLA 1NZCA 1LDKB 4Z07A 4L9JA 2ETEA 3CUQB 1EYBA 3MPBA 1ULYA 1H1MA 4XFBA 1LB2A 4BIFA 2B8MA 3IDCB 2NS0A 2QQ9A 2FSWA 1OI6A 2ESNA 3F21A 5HS7A 1EY2A 5I8TA 4ESFA 3LWCA 2B5HA 5FLXZ 1WWXA 1I27A 5FLXK 1FP2A 3R61A 4A12A 1ZZBA 4IEOA 1CAWB 5FQ0B 3U1DA 3WE3A 1PP7U 4MQ9F 3CUQC 4UNOA 3KP5A 5E8GA 3J80K 3I54A 2XAGA 5K1YA 1T98A 3C3VA 4L9TA 2VPVA 5E20A 1K78B 5ICGA 1DDNA 3FMSA 3FHIB 1BBYA 4M9ZA 1RUNA 2MLKA 2JZYA 4QMAA 1FXZA 3KFWX 5BOXA 3M9AA 1XMKA 1LJ9A 2M5WA 4FAGA 3QP6A 3MEXA 2BNOA 3DN7A 2FF4A 4WWCA 1WGPA 2F5EA 3DPTA 3BB6A 3C3WA 1NE6A 2PG4A 1R5GA 3HTUA 2OU2A 1V70A 1WA4A 3SCFA 4HDVA 5D8KB 1R5HA 3P9IA 2FA5A 4HX7A 1FNNA 4Z82A 1YLLA 4LTAA 2XHKA 1Z6TA 3EQEA 4LG0B 4HAMA 2XVCA 3ERED 2VT3A 3SZPA 4XRFA 3J81Z 3SHRA 2PAMA 4ZYHA 3J81K 3WTVC 1U5TA 2AS5F 2ESHA 3GWZA 4HYEA 4IVNA 2FE3A 2AXLA 2XAQA 5J8FA 3LZZA 2KJCA 4LA3A 3ELKA 1J5YA 3LAPA 1OFNA 2GA1A 5KHHA 2OZJA 2PTMA 3DFGA 2W84A 4YRDA 2NNNA 1S7AA 2EK5A 3KLOA 1B6AA 2R7DA 1YFHA 2DPUA 4OIOF 3GFMA 5L3BA 2EA7A 4P96A 4A5MA 3SCHA 3I4PA 4M6YA 2HJIA 4OMZA 1ON1A 1DUXC 3CUOA 5D5UB 1ZLKA 5FGMA 3K1MA 3FMQA 1Z9CA 4IHTA 3BCWA 1XGMA 5E1ZB 1ZZ8A 4N9HA 4Q29A 2GZWA 4GGGA 4K2EA 3LOIA 3KMHA 4ORFA 3EDPA 1U6GA 5D6EA 1UFMA 1Z91A 4LK1F 1ZVFA 5BS6A 1EPZA 3RNSA 5A2QZ 1J3QA 2FBIA 4FX0A 2PBIA 4A6EA 3LQQA 4JV4A 1YG2A 4ZYEA 1LKNA 5JSRA 3TOAA 3ZMDA 4HMZA 3SHFA 1DGWA 4L0ZB 2Z99A 1P92A 3LA2A 1W7PD 1U8RA 3FJSA 1MD0A 2ZNYA 5ILVA 2PA7A 3MDPA 2DTRA 3HOSA 2ZJ2A 2Q2EA 3D5LA 4KIFA 3E6CC 3GEZA 3E6MA 4YYOA 1BI3A 3B73A 4CXFA 4UUVA 4I02A 2WV0A 4M6XA 3T8RA 1OPCA 5ILUA 2VOPA 4AVPA 3FX3A 1YS7A 3LAJA 5D1IA 5F1RA 2JRTA 4P9UA 4UBHA 2HKXA 1O3QA 3FXRA 1UW8A 3QRFF 2OQRA 2JT1A 2GU9A 2D5FA 4RGRA 3GF2A 1O3TA 3NW4A 2CYYA 1ZZCA 1ZAOA 2GQQA 1O7LA 2HYGD 2L01A 3NVCA 2QYOA 5IT3A 4EM1A 3M8EA 5KHKA 2QQBA 2MH9A 4WZCA 2IVMA 3CJNA 2UYAA 2A6EF 3JSOA 3I5UA 3K1PA 3FXUA 4AD9A 5DYMA 1RUOA 3K1NA 4IRHA 3IL2A 3R6SA 1VP6A 4EJTA 2EVXA 4U0YA 2VOOA 4A5NA 3RTRA 4XFHA 4I09A 2N7GA 2HGCA 2HDCA 2XASA 3WG9A 2K4JA 4LLLA 3GZ6A 2RNJA 3SMHA 3H8UA 1EH7A 4OIPF 3H7JA 6PAXA 4YG2F 2XAFA 1PUEE 3C1DA 2ISYA 5KK1A 2PN6A 4JBAA 2O1QA 3OGJA 5AVPA 2BBYA 4NVPA 3I0TA 4F7ZA 4XF4A 1BM9A 1F1ZA 2B9UA 1G3TA 1B1BA 5J8CA 3IRRA 2EAAA 4LGWA 4NB5A 4PIYA 5CADA 2XUBA 3ZPLA 3WE2A 1HBXG 4KMUX 1MJ9A 1V3FA 1XCVA 2H94A 5LBQA 3LA7A 4XSZF 1C0WA 3VB2A 4HLXA 2GH2A 3TO9A 4I7HA 1O7FA 1NHAA 3IBMA 5AIQA 1UHMA 2EFPA 4MTEA 5DCMB 2ZXJA 2DI3A 1CX4A 5BMZA 3ZP5A 3K0LA 4EM0B 1ZG1A 1FPQA 2FEZA 1BC7C 4BHCA 3DP7A 5F64A 3IKVA 2JPBA 2FNAA 1ZHFA 1X82A 2IA1A 2EFNA 2V1XA 5JCTA 2W25A 1AWCA 3WODF 1E2XA 1RI7A 2BE5F 2Q30A 2P7VB 2XAJA 5L3DA 2L4AA 3GW2A 1W4MA 1RNLA 1ZRFA 4XETA 4YIFA 3L2CA 2QVSB 2J5OA 4WX9A 3S2WA 3NL1A 1CF7A 4KU7A 2XIGA 3SXYA 4META 2Y75A 3DF8A 1PMIA 1R23A 2PAKA 2KRFA 4RGUA 1LQ1A 2XLGA 5ICFA 1MDMB 2XGXA 1IXCA 2EWNA 3VHRA 2M1BA 4MEXF 2Z9OA 1KU9A 4RB1A 5D5VB 1D8JA 2XKPA 3FHZA 3KP2A 2PJPA 5CYVA 1YWKA 3F8NA 4LLGF 4M71A 3QPHA 4FAHA 3FM3A 1I6XA 4HDUA 2P7CB 4Q47A 4MTDA 1QGPA 1TQPA 4JVAA 1OKRA 4G8XA 4WVZA 4R8HA 4LLNA 4YFXF 5HS9A 1Z7UA 4IEUA 1J9IA 4LFUA 3V8JA 3WTZA 1UCXA 4KUMA 2FBHA 4I3PA 1FBSA 3P7NA 5ERIA 1YYVA 4BHPA 1O3RA 3ULQB 5LHIA 4UHTA 4YIIA 4HQEA 3M3IA 3LA3A 1CGPA 1IPKA 5JSOA 1QY4A 2QDRA 2D2WA 2DW4A 2LDUA 2KIUA 1ZG3A 4ESBA 2UXNA 2IA2A 2K4BA 5E8IA 5HDGA 1UIJA 2XAHA 4PGHA 1R1VA 1F5TA 4EMSA 2D5HA 4MHGA 1XSXA 2DFIA 4QGLA 4HBNA 4EROA 2LF7A 1DZRA 4KWLA 2UYBA 3CEWA 3I58A 5HS8A 4A6DA 3E5XA 3E5QA 2NRAC 2IJLA 4N0BA 4EJUA 5ICCA 1FSHA 2UY9A 4O6JA 4MGKE 2WWYA 2MH2A 3R0JA 2G7HA 1O5LA 3COAC 3U9GA 3GYHX 4GULA 3LWFA 1Y9QA 5H6QA 4IXAA 1EP0A 4IEZA 2FNPA 5K5QA 4M9SA 2FQPA
chains in the Genus database with same CATH superfamily
2ZSIB 2A70A 1D3YA 2VE8A 4V19K 3K46A 2RVCA 3SEEA 2HWF2 3IUOA 4CDUC 3N35A 1NX9A 4BAYA 4Z8BA 1Z21A 1HCRA 1Z7S3 3SQOA 1AR92 1D0GA 1H8AC 1VBD1 1OYIA 3NV3A 3U10A 4AEJA 2DVBA 1H0MA 5K9YA 1WA6X 1V55H 1LFBA 2VQTA 4F8AA 3U14A 4ENJA 2IFRA 2A71A 1EPWA 2LSOA 3NMBA 1J3PA 2X6OA 3HEIA 1C1LA 4YVWA 3KHCA 2JICA 3AYCA 2CSGA 1SQ4A 3G73A 1G4DA 1QJY3 3WNPA 3U21A 5JOYA 2A3WA 3RYRA 3BU0A 3AAFA 4HT1T 5LA9A 1RYYA 3IAQA 4DS0A 1K5MC 1AYM2 4E2QA 2HEVF 3ZXEA 4JTOA 2RR13 4PQ9A 4N4OB 3WTWC 4HOOA 3T30A 2W1SA 4D5CA 3U37A 1WMFA 2ZJQF 2DQLA 3LKJA 3TO7A 4GO1A 2VR4A 5DUWA 4AXOA 2Y9YA 5F5QA 5FB2A 4Q1PA 4IQJA 2R93J 2E7TA 2STTA 4JGYC 1ASJ3 3VBHC 3HUGA 2L9LA 1OJLA 1F5FA 3PVNA 3QPLA 4CVUA 3PUFA 1XC6A 4RA2A 2IVIB 3V7CA 5HLIA 3VV1A 4ZXKA 1ULPA 4AFDA 3N7JA 3PSIA 1XE0A 4FP3A 3K10A 1GU3A 4XLPF 5FYMA 2B42B 3HEFA 1BC8C 5JLXA 2ID3A 4DY3A 3GJBA 1OA2A 2CQNA 2Y2ZA 3IZOA 1P7JA 2A05A 5EJ1B 2JDHA 3CJRB 4JK1X 4XUNA 4P02B 1SLIA 4MFEA 2EALA 4C1WA 3AVSA 2DT7B 4Q48A 2VTXJ 4ZYAA 2HEYF 2R072 1CJDA 2JIGA 1X9TA 5FUNA 4AI1A 2VE9A 1BR4A 1O8SA 1WCDJ 1YHQI 3DXUA 5I0UA 2LBFB 5DEQA 3GLXA 1UYPA 2ORXA 3HBLA 3BIEA 3C7OA 1JZ6A 5J1UA 2EFWA 1QJX2 5LK5A 1LFPA 3L2UA 3OIPA 2MABA 3JUUA 4LIUA 3BPXA 1JS9A 1NUKA 1FTTA 1N1SA 5BNNC 2GDFA 1HKQA 4ITCA 3GX4X 3EYPA 4GB32 4HL0A 3L2WA 5KVRA 1DPUA 1L3JA 1U3EM 3KD4A 4EWEA 2BERA 1SMTA 4YVSC 2QZ8A 4YG3A 1R64A 3RKYA 4Y5Z0 3H9AA 2HEOA 5DAQA 2AREA 4IDZA 2ORZA 2YC0A 5LCWL 4QU2A 2NS7A 3PIPF 3A1YA 2IFWA 4IO9F 2P0WA 1F35A 4MGZE 2FMLA 4KISA 2Z4FA 2QNKA 2OUHA 3HT2A 4Y20A 3FLTA 4QXKA 1GXQA 2K2SA 1KFUL 2E26A 3ZSMA 1ZH5A 4MQVA 3EJKA 4LB5A 5FFOC 2O8QA 1GWMA 2PN5A 1PO11 2MC4A 1WHUA 3WQ0A 1V6LA 4IRIA 3M1CA 4OI0A 2XF6A 4KG8A 4MO7A 3RS6A 2GMMA 3MMYB 3G71I 3OGGA 3WGGA 4OINF 4S2HA 4ZU5A 1G6NA 1NQJA 1RC6A 1WQ2A 3JTHA 3ECOA 1POV1 3SLIA 3ZIXA 1QNTA 3JAMZ 3WHUA 1IW7F 3L00A 3FXQA 5GALA 4RGXA 4WV8A 3M7GA 2WINB 1BQPA 1K79A 3AMPA 3AP4A 1QJFA 2R061 2W57A 2IA0A 4I76A 1R1A2 2P81A 1XMAA 1AA7A 1XTAA 5DZGA 3ZSJA 4AYBN 3HKZN 3T1BA 2VMCA 3HQXA 3L2QA 4Y52J 4IV3A 3LSPA 1AR81 2NS8A 1ZA7A 1IPJA 3PO3J 2A5YB 2VUCA 3O6BB 1R082 3WVJA 3ILFA 1H8TC 1OT5A 1R36A 2CUJA 3MD2A 2E6VA 1S8NA 4LBNA 2PHDA 3M8FA 3O2PE 3KYDB 2Y31A 2B9VA 4KWJA 2WNUA 4JKKA 3B7MA 3OWTA 1MZEA 3G7DA 1ZRRA 1LU1A 2IS1A 2FUG2 2Q2EB 1ETQA 2ZO4A 3I3MA 2V4AA 1Z0HA 2XHNA 4UVBA 2VOVA 5KC5A 4PT6A 1L3LA 5ERLA 4WM7C 2VZUA 4CEWC 4AIKA 2CNAA 3WHTA 3POEA 1X1BA 5A7NA 4UF0A 4L0YB 4F91B 4GD4A 1YI7A 2UWBA 3VBUB 4UXNA 3S14J 1HQNA 1HXS2 2VQGA 5DG1A 4QWQA 3FUOA 4FFIA 5FZEA 5LBBA 3TOJA 3APBA 4KDPA 2XJUA 3B93A 2YU3A 4NOTA 1WH7A 3CF2A 3U07A 2DDUA 2P5VA 2YUSA 1C57A 3K51A 4D6SA 1RUC1 1OLMA 3DXTA 3WG4A 1HKDA 1UXZA 2P37A 4IV3B 4YW2A 2I5UA 1YS6A 1T38A 3Q9VA 3EUKL 1JKRC 3BJAA 1NXMA 4IETA 5JOWA 3RZDJ 1Q8SA 2XF7A 4HX8A 5BNPC 2VE1A 4BXUA 2GIZA 2DU1A 1GQHA 5F8PA 5T50A 2ZC2A 1PDNC 3ACFA 3IDEA 1UQXA 2RN7A 3HTSB 1GP5A 2ZGUA 4MIMA 1CJPA 1FYKA 5LGUA 2CAVA 3S7EA 3NJZA 3ZXKA 3OSFA 1LHWA 3C2HA 5I0RA 3UKTA 3VBSC 3DLLF 1MMSA 1KEXA 4CSWA 2QUOA 4DXTA 3PVBB 4B09A 1DQ4A 4CDQC 2OT7A 5C8CB 4AYUA 3DBHB 2LKPA 5FJKA 1F15A 4V2FA 2LM3A 3CJXA 5J36A 2CDPA 1DFQA 4TTGA 4HRIA 3A0HC 4MXWA 4QX3A 2LKSA 3BLYA 2Q0AA 3TQNA 2IAIA 3SEPA 3ZDVA 4AU7A 1IAWA 5AFEA 3UGHA 2GC0A 3M1EA 3FMGA 4RGAA 3M70A 1Z78A 2DK5A 4FPFA 4A3MJ 1USSA 1IUFA 3DTEA 1MNEA 1I1SA 3BG3A 1PK6B 4IEYA 3VYTB 4LB6B 5JHFA 3BG5A 2FD5A 4AM3A 3POGA 2M34A 4CEYA 1ZN2A 3EHKA 4BHBA 1D4M1 1R093 5E1RA 5JR7B 2XC7A 3E97A 1GT0C 1ZX5A 1X8EA 2IXIA 3DL3A 3B6CA 3PQKA 1CF7B 2HBTA 5IYYA 3ACLA 1CONA 4LXLA 3MV01 3CO7C 3KYLA 4UAPA 2F2EA 1HRV1 2ZAHA 4IHYA 3OUJA 2QGUA 2O8OA 3RSNA 3S2HJ 4IESA 1ULCA 2NYXA 2E2HJ 4FCAA 3LCPA 3GF6A 1HQCA 1WCKA 1Q43A 1GVDA 5FYVA 1HDPA 1ETXA 5K5OA 1QWRA 2VZ3A 4JAAA 2DCKA 3AYDA 1I5PA 1GP6A 1ITYA 3BTZA 4AI8A 3RZJA 3CUQA 5DD8A 3WX5A 5L9BA 1FSEA 1I1GA 5F5CA 5FP8A 3ZYRA 2TUNA 2WLQA 2ZJCA 3ZDSA 1UPSA 3O5SA 2KT0A 3PJRA 4TXWA 5M0TA 3B01A 1RMU2 1TWFJ 1YNAA 5TISC 2WN2A 3CP2A 2AYHA 4EJOA 2YDEA 3WDVA 1RUF2 2E31A 2ZJPF 3D0JA 5FLJA 2VXJA 2F6CA 3RKWA 1COV2 2VECA 5FLVA 4PSWA 3MVPA 2COBA 4XSXF 4BJ5C 2JE7A 4AQ2A 4M3CA 5GZEA 4Y4YA 1WCSA 4GZ9A 2HWB3 5D8AC 1AL21 1VQNI 5T3NA 1Y0UA 3V8KA 4IXLA 4AOCA 4DBQA 2D6LX 2MYSA 5HV4A 2GNDA 3N9MA 3CDHA 4ZZLA 4FFHA 3CZJA 3QP5A 1TMF2 4XL9A 4I6ZA 1G2HA 4YM2A 3BR3A 2PMHA 5I0SA 1O91A 4LHLA 1ZGWA 2Q5TA 1OPOA 1VBA1 2R7ZJ 5CVRA 5HBAA 2WWUA 4GWIA 3BUCA 1YFXA 3CL1A 4B44A 5DG2A 2ZGLA 1OYWA 5DAWA 1HA8A 3VDDA 1G86A 2JMWA 5ACA1 1JODA 1O57A 1U0JA 4FE4A 5DN2A 2I10A 2GP3A 3I2IA 4M0NA 4XABA 5AC92 3LFMA 4EYUA 1XNDA 4AGGA 3GTGJ 4UW5A 4DZJA 4XLFA 1Z7LA 4COYA 1WMEA 1V5GA 3AFGA 4EQVA 2I07B 3A0KA 4YW5A 1ND2C 5KBFA 1ULFA 1V6JA 4RM3A 4ZS2A 1QVTA 5HV0A 5FK8A 1XB4A 3KZYA 2M2EA 3HNYM 4KGGA 3KCXA 1VBB3 4C1XA 5CLSA 3HGYA 1BI2A 1R71A 5H9SA 1ZRDA 4OHVA 1QH6A 1STZA 1UYYA 1RUG3 1BYHA 2HWVA 5FXZA 1ND3C 3CJIC 1D1AA 2VTXA 1VQ8I 5D8LB 2NVTJ 4YZ1A 2XQXA 3MKLA 2L02A 5HDKA 3CTAA 1KGYA 3RI8A 2I74A 5GADJ 3GCWA 1BN5A 4UFJA 4QPIB 3VLBB 2M4KA 2A7AA 4F92B 3VZMA 1T0FA 1VI0A 3AL5A 3P5BA 2JB8A 4XCAA 3EETA 1TQMA 2RJKA 1TNSA 4NQWB 5H20A 1PO23 4FQGA 3FBMA 2DMQA 4OIQF 4CGZA 4NRMA 3NV2A 3HSEA 5J3UA 2P3YA 4HONA 3C7EA 3G1OA 1KQ0A 3WY6A 5JIUA 1OR7C 5DUKA 1V9U1 3IH2A 1BXHA 1S0JA 2CQKA 5HCHA 1O3SA 4J6GA 2P3IA 3OIOA 4F55A 5M3FJ 4YFKF 3THPA 4Z1VA 3OPWA 3A7QA 3CJQB 2LR8A 2IXHA 5CFDA 2VD7A 3I59A 1O6UA 4AEDB 2KISA 2EZKA 3CC4I 3SQNA 4EGZA 1T2KA 3H8RA 4XKWA 2X53S 1BW6A 2C4XA 1SMYF 5J7MA 2GOMA 5GAEJ 4MX3A 5J4YA 1HB2A 2DMTA 4XJUA 2GAUA 4HK8A 1D4M3 4YZ3A 4GDFA 3AG1H 3HWJA 2W46A 1K42A 2R7VA 4RHV1 1XMXA 4UUSA 3AJYA 3KGZA 5A7WB 3AP6A 2CQ7A 1QH7A 1JU3A 1L7LA 2VZRA 4IEXA 3MWMA 1KU7A 1FATA 1LEAA 1W99A 2Y6GA 3WR0A 3MIDA 5C3RA 2JVHA 2CQQA 1ZARA 4OIRF 3OV8A 4MLOA 3O1RA 3RKQA 4UWDA 1DHKB 4UI9L 5DTDA 2DCJA 3GDBA 1WJFA 5DCMA 3J7HA 4L5EA 4D0PA 1ZZ7A 3ZXDA 1OCZH 4AEKA 2EXKA 1ZGJA 3BT9A 2EFOA 2VN2A 5JXIA 2ZA9A 5LBEA 3UNPA 3H1WA 2YX7A 3I59B 2ICWG 1QQP3 2E1CA 4XCBA 1XD7A 5IATA 2VNGA 1ONAA 2DCYA 2E7AA 3JD72 2JK3A 4MGIE 4WK8F 1KYZA 3UKVA 3JU9A 3ZFGB 4BWOA 1W5CC 3GO5A 3IPVA 3BYWA 5I8YA 3WU0A 1LVAA 4GAZA 5SV5A 4TWTA 4LT5A 2XLFA 1TW2A 4KICA 1WW5A 2PJRB 3GTLJ 1U5XA 2ZXHA 1R4NB 3T2TA 1IV8A 5EQUA 4NC8A 2NAZA 5A1FA 2V5DA 2Q8KA 3EPZA 2ZHKA 5CJ9A 1WI3A 5J37A 1KITA 4IEJA 2KD7A 4E8DA 1GFF2 1XCBA 1DU6A 3GALA 2HWD2 5EXOA 3HT1A 1JU4A 2ZX3A 2XVKA 3T8TA 2Y64A 4Y22A 2H1KA 2XG3A 3FIWA 1B35B 1YJLA 3DCQA 3V7SA 2VPRA 1G3SA 3K69A 4DO0A 3MIBA 1W05A 4HV6A 1A5JA 2A3SA 3HHGA 1X1PA 1VBA3 1XGNA 2VUAA 5FMOS 2QCSB 4Q4ZF 2J7MA 2P5LC 2Y60A 5C4WC 1KA8A 4DRVA 2YYOA 2BXYA 3BCAA 4RAYA 5BNOC 2OAZA 4OOIA 4JRLA 4PCQA 3IB3A 3N3HA 2HQNA 2RMU1 1VBE2 5DAXA 3TN91 3O14A 1T39A 2W5FA 4B43A 4RN5A 2O03A 1BOAA 2ADEA 3T09A 3U78A 3I2JA 2QSGX 4ZU7A 1Y9MA 4FQ4A 3ZPYA 3N05A 1U8BA 4QX1A 4W6WA 4AVTA 3KE2A 1TW3A 1OLRA 1R1TA 2UXXA 1HKSA 2Y6KA 1ZGAA 3HOTA 2EV6A 2ZGNA 4HX4A 1YRNB 1KFXL 3IWZA 4AGRA 5GLTA 4L2NA 3K4KA 1OVPA 4DQ2A 5IPAA 4FOQA 4XK4A 3N9NA 4Y7NJ 2X09A 3ZIWA 1A8MA 4XRSA 1ZA4A 4ZONA 4OI1A 3WZ1A 3RGBA 1JXSA 1MBHA 3ZMZA 1HSJA 5DZEA 3GMEA 1XU2A 4XFIA 4B4QA 4XFFA 3PUHA 3WGHA 3BG9A 2WZR1 4R52A 1AYN1 2P6CA 2DT5A 4Q26A 1MBKA 2QEXI 2OQ7A 4RS5B 5FLMJ 5H9RA 2XV4S 3ZXAC 3FHNA 1PZ9A 3JBG2 1FPN3 3GNEA 4XHXA 1REDA 1LOBA 4RD7A 1MMDA 1HDDC 4B48A 4H0EA 1MBFA 1LHOA 3M8LA 2NVUB 3AG2H 3RZZA 3CMGA 3V4GA 4WVMA 1ZTRA 3ABLH 4UW4A 3AVRA 1LENA 5B5EC 1BL0A 1PVEA 3HM5A 4CP1A 1I50J 5E16A 1QU0A 3ORJA 4NC7A 1WBLA 5FYSA 4BQQA 3D82A 1POGA 5IVJA 2QM3A 2X29A 1V5EA 2HXIA 4JGYA 5HODA 4OHZA 4HVQA 1PGL1 5KXCA 1NKGA 4QDSA 3VKOA 4IW3A 1H9GA 4XOGA 1TVGA 3WP4A 1YHFA 3NNFA 4M9XA 1NK2P 4BPZA 3OY8B 3V0AB 3ZN1A 4IHVA 2LG4A 3ZMTA 1AXKA 4I30A 3OYDA 4AQSA 4II3A 4A7YA 5ANQA 2XRNA 5DCFA 3RQ0A 2ZX1A 4GCVA 2BGOA 1H4HA 2VC9A 1F8VA 4A41A 1WW6A 1TME2 2XMLA 5M5XJ 4ES9A 2DFBA 2XL9A 2PYTA 5C3OA 3EUHA 2A6ZA 1I5ZA 3LPFA 3L2RA 4V2WA 4QDRA 2KIFA 1YUDA 3A22A 1SFPA 2H09A 1C28A 2D6KA 2O6GE 1QJU1 1R4MB 2DCEA 2DU9A 3D5RC 4N4NB 2HFHA 4QHBA 2OQ6A 1LOFC 2I8DA 1XGOA 3HIFA 4Y1XA 4BQ2A 4LG3A 4IV1B 5IAVA 1NZCA 4COVA 4Z07A 3C7HA 2HWE1 2ETEA 4L9JA 3FC0A 3H36A 3MPBA 4BKXA 5A7OA 1ULYA 5BNNA 1QKQA 3Q3SA 2NS0A 1OI6A 4BLJA 2DA4A 1EY2A 3LWCA 2B5HA 3VHOA 2B7EA 1I27A 4BDVB 1SFKA 2ZXQA 4A12A 1ZZBA 4YVSA 4IEOA 3WE3A 2PLV2 4P9YA 3PU8A 3GHNA 4XMYA 5H2FC 4UNOA 2V73A 2G9GA 1JUMA 2VKHA 1VQ5I 5C7GA 2HQ5A 3BC8A 1U5ZA 3ALQA 2W91A 5A3NA 3FHIB 4UB8C 4M9ZA 1RUNA 4DW6A 5A6QA 2MLKA 2JZYA 4QMAA 4HETA 2W95A 4ISQA 3M9AA 3CIHA 2LFBA 1LJ9A 2DUOA 3ESWB 1RR7A 1B8IB 5K0UC 1DU3D 2P3JA 4CA9A 3DPTA 2EIBA 3BB6A 4HNTA 1NE6A 1HN0A 1IGNA 1V70A 3SCFA 3W2WA 3P9IA 2VIXA 2FA5A 1FNNA 5C70A 2WFF1 4XUQA 2XHKA 1Z6TA 3AZXA 1PMHX 4EN0A 3CESA 4Y1UA 3SZPA 2AR6A 2PAMA 3J81K 4LQRA 3RCOA 5A6XA 1UY0A 4CCKA 2R042 4FI9A 3GWZA 5DAVA 1AR63 3MLLA 2ZPXA 4C91A 4LA3A 2YMZA 1EAH1 4B1MA 4C3IJ 4AFAA 1FAYA 2KP6A 2NPIA 1RXGA 4XJ9A 2NNNA 2PXJA 2AHQA 4H2AA 4NMIA 2NP0A 3UT0A 3X2QH 2TCTA 5A3UA 2J42A 2UWAA 5J40A 3S1QJ 3DPRB 1LEMA 2DPUA 3ASOH 4OIOF 3GFMA 1JKPC 2EA7A 5IK5A 3SCHA 1H8TA 1RUH1 3I4PA 2X51A 1N25A 1ON1A 3CZ6A 1DUXC 5A80A 5FGMA 3LEGA 1XGMA 2FDKA 4EN7B 5A32A 1IDZA 2Q8EA 4N9HA 1PVC1 1WW4A 3ZSLA 2F4LA 3LOIA 4D7MA 1OSGA 3KMHA 4ORFA 5JVVA 1YE9A 1UFMA 1Z91A 1EPZA 3RNSA 2FBIA 4I99C 4BZ4A 5F32A 4A6EA 3VB9A 3LQQA 2EXJA 4ZYEA 4AGVA 3TOAA 4N8MA 1QOTA 4B4PA 3T2QA 1DGWA 4L0ZB 4XBLA 3LA2A 1W7PD 1MEC1 3FJSA 5FMBA 2VVEA 1AR71 3Q8FA 2ZJ2A 3D5LA 4KIFA 3E6CC 4YYOA 2O14A 1FJLA 2AEZA 1MBEA 1MACA 3P3NA 3T8RA 5EZHA 4H55A 2VOPA 4Q4Y1 5FRMA 1YS7A 3B69A 1WD3A 2Y0SA 2QQ8A 4DUVA 3GTKJ 2FHRA 4CZSA 2QE3A 3D1NI 1O3QA 5JXHA 3FXRA 1Z67A 2JT1A 3ZN6B 3BR1A 4RGRA 3G6EI 3GF2A 1APLC 3D5SC 1ZAOA 2GQQA 4BBSJ 2WAOA 2FBEA 2WB1A 5A7SA 2MH9A 4XIKA 4BUPA 2FDIA 2CU5A 4WZCA 1CZTA 3CJNA 3AZWA 2A6EF 3I5UA 1D2SA 2ZGOA 5DYMA 3OYKA 5KR7A 4IHXA 4RLQA 3IDAA 2Y0IA 4IRHA 3IL2A 3CCVI 4QXBA 2RDNA 3R6SA 2EVXA 2XJRA 4Q4V1 1H30A 2PMWB 3FK6A 3WSOA 4XFHA 2WZ8A 4CP2A 2N7GA 2EINH 5GZDA 2XASA 1CIYA 4XN3A 2RNJA 3H8UA 4YG2F 2XAFA 5L7OC 3HPGA 3KQRA 1C1FA 4XLHA 4E8CA 1PJRA 1T95A 4CDQA 4OCTA 4M01A 1ZBA1 3WDWA 2XAUA 2W9XA 3OGJA 2BBYA 4NVPA 2GNMA 4F7ZA 1B1BA 4MGTA 2EAAA 4PIYA 2VXDA 1R9TJ 5FZ8A 3ZPLA 1QJU3 4AVZA 4HPQA 1HBXG 4NWVA 1KONA 4YW6A 3HQRA 1XCVA 2PMZA 3OYWA 3TO9A 1XXNA 2ZZJA 2FCTA 2AO9A 1FNYA 4Q4W3 3ZP5A 2HWE3 3PM1A 2E36A 2ARXA 5JIAA 1ZG1A 3J7AY 3RQIA 3ZMNA 3GCXA 3TYJA 1WMDA 2XJQA 2FDHA 4OQ9A 1GV9A 3IKVA 1R5ID 2R7WA 2NVYJ 4INDA 3WODF 4XPVA 4HEA2 2P7VB 1GICA 1UY2A 3JRIA 2YU1A 1ZRFA 5FO8B 4JZRA 3L2CA 1RR8C 3KWVA 4L97A 4KU7A 2XIGA 1W8HA 2KRFA 4RGUA 2YFUA 4XN0A 5ICFA 3USUB 5KNLA 5FO7B 4LKEA 1PIV1 2XGXA 5J09A 2RM21 3VHRA 3A2KA 5ABJB 2VMHA 2Z9OA 2WDBA 2VCBA 2VL4A 2VU9A 1LE8A 1BOBA 4M71A 3N9PA 1Y4WA 1DG6A 2WFF3 2L7MP 1A6CA 1UWWA 1C5HA 1QGPA 4JC1A 1EF4A 4BQYA 5GZFA 1RIRA 1VPHA 4R8HA 3LFIA 1Z7UA 4IEUA 1J9IA 3MBWA 1HJGA 2FBHA 3VPRA 4BQ3A 1YYVA 4BHPA 3ULQB 3GHMA 4LHSA 4E7SA 3BIWE 3R4SA 2Q1FA 2CWSA 3M3IA 4G3YC 1T8IA 2TNFA 4JP0A 3LFUA 3O0VA 4B3NA 1REFA 1WCQA 3ZYJB 2QDRA 2D2WA 3MFAA 4YFZA 5A6ZA 3PIGA 4CP9B 3KQ4B 1RC9A 1UIJA 2X8KA 1Y9GA 3ZXLA 4FPOB 2D5HA 1CQ9A 2J1EA 2X48A 3ZXGA 4EROA 2XPJA 3K4JA 3O1OA 2UYBA 4JX5A 3CEWA 4XURA 2JG9B 3VSKA 2BHZA 4A6DA 2X5IC 5FKNA 1GWLA 3J9SA 2QKLB 1PVC3 5CZKA 2UY9A 4O6JA 1Y56A 3HNMA 2YFZA 5EYYA 1MQTC 4IQPA 3H0OA 1S0EA 3R0JA 2G7HA 1W2OA 1HN1A 3U9GA 4BDZA 2YB7A 3JRBA 2HWC1 5K5QA 2ID6A 3C7GA 5IVBA 3H3LA 3F8FA 4HZFA 1X3WB 2V79A 4BEHA 4ZZ5A 2ZEXA 2M7BA 3ENRA 2XOMA 4K7JA 1XSDA 3AKPA 1MEC3 4A3XA 3J4UH 4DNCA 5IVVA 5DUXA 4W1UA 2M45A 5B4NA 1G8XA 1VLNA 5GP9A 4XUTA 2TRTA 2GC2A 3CNAA 1OOPC 1UZCA 4YRVA 2FZ1A 3CLOA 4Q4Y3 1GOGA 3RZKA 4H4KC 3KV5A 4B29A 2BDRA 1ETYA 3GZ5A 1R081 2QJVA 3WG7H 1N1TA 1ND3A 1CAXA 4XE9A 1FV2A 3HNBM 3F72A 1UYZA 3WEZA 1JJ8C 3E5UA 1VQMI 4N7IA 1AR93 4LO7A 3AZZA 4XLNF 3W3CA 3PJQA 4N53B 5AVAA 4DUXA 4A3EJ 4XDQA 3ONQA 3V0BB 1MS9A 2WT0A 4Q0UA 3TRSB 2KLOA 1QPMA 5HNFA 1BEV1 1XNAA 3VHNA 4Q4V3 2WBMA 3DUIA 5IK8A 4RQPB 2DO7A 3GBGA 1MNDA 3K4BA 1NG6A 2ENRA 1SANA 4NHXA 3B5LB 4K40A 2K27A 1UPIA 1E3HA 3BOPA 5KHGA 2RDRA 1M1EB 1J2XA 1OR7A 1PNGA 3DPLC 4LULA 3CQOA 4UXAA 4GH4C 2A6HF 3IDBB 5FOJB 4XC9A 1ZBA3 1NE4A 5JZGC 4FOWA 5EEGA 1AYM3 4FO9A 4Q27A 3IP4B 1ZNPA 1WI9A 4I0BA 1LEBA 2MHFA 3K48A 2W7NA 5FZLA 1JI8A 3IN9A 1JKQC 5CVJA 4CU6A 1Z1DA 3AP5A 4Z2YA 3ECQA 1GV5A 3U11A 1BKZA 5HDNA 4JRAA 3CMMA 2GP5A 4B1RA 1UHWA 1LESA 3V56A 1J59A 5IW0A 2L9VA 2D6NA 1PHMA 4GKYA 3ON7A 1NZIA 3VKNA 3W58A 4AZZA 3PQJA 3T0AA 3OUHA 2LK2A 4NIAA 4R9AA 3T5XA 2HBUA 2W94A 2JDZA 2DDAA 3LIGA 3BROA 1R22A 4GWJA 2BWCA 4A69C 2ZHMA 4YVWC 1YITI 2LRDA 1Q8VA 4JGZA 2QDNA 3MIHA 2IWGB 1UOJA 2ME0A 1QIQA 4CCCA 4IX7A 2WSUA 2KXLA 3SITA 5HLHA 1TZOA 2FQ3A 3AKRA 3WG1A 4AWXB 1IKQA 2V26A 5IT9Z 3MW2A 4Z6YA 2MC3A 2R073 3K4AA 1FY7A 3MIFA 2RM23 3H1MA 4NJ4A 1SCRA 4LBQA 2CQXA 3BU7A 3WP5A 4N43A 3ZFFB 1FMD2 1SPPA 1RUJ2 4RB2C 1MS3A 4PGGA 1VJ2A 3VODA 4CDGA 2CV6A 1F43A 1UU6A 2WYFA 5IVFA 3MQ0A 5C44J 1SD7A 1M06G 2VQUA 4PDKA 1NCRB 5A2QK 1XQNA 5J1XA 3R4KA 3H5AA 4GB33 4FBFA 3SFIA 1ZBE1 3WCSA 3WNLA 5CVIA 3WLUA 4ZU4A 3I8TA 2BPA2 5FD6A 3FISA 2MW8A 2ET1A 3F95A 2DAOA 4A7KA 1FMVA 2BY1A 3RJPA 5L36A 1LNWA 3VSLA 4XF3A 1UU5A 2O9LA 3BODA 1UELB 4ANJA 4YPJA 5FKMA 4G12A 2JA2A 2VODA 1QZEA 4FETA 5DD4A 1RRJA 3HGGA 3ITQA 4L99A 1F9NA 1P2FA 1GQGA 4MYEA 3D0SA 1CVNA 2KR2A 2A6TA 2EBIA 1RPWA 4H7LA 2OBPA 5DS9A 3S5AA 4KIGA 3S32A 3ZR6A 5FZ7A 3OOPA 1GUIA 3H0DA 4CCMA 1NA1B 5C4WA 1XPXA 1C4RA 3DKWA 3ZKYA 4JKMA 1BBT1 4N43B 2FD8A 4U7BA 2XBO1 3VBOA 2RJ2A 2H0BA 4LLOA 2PQQA 1H1IA 3RZLA 3FWEA 1W7PA 4NO4A 1CESA 4QX2A 4BE1A 1AXZA 2JWTA 3AKTA 1Z6RA 5L3FA 4OZXA 4LBOA 1AX0A 1A34A 3Q9SA 5IOZA 4I3GA 1STMA 1UJ8A 4JHZA 3KP3A 3PO2J 1WD4A 1JHJA 4NHKA 3OL3A 1X58A 1JOJA 1OC1A 5C3EJ 1RITA 4CDWA 5HLTA 2WAQA 2HOAA 2YBSA 2GIVA 2MBFA 1G9AA 4ZTFA 1RL3A 5DM7F 1QXRA 3A0NA 4XZPA 3E3VA 1T56A 1R083 2QBXA 2VBDA 1UAAA 3JRFA 3LFKA 2E9QA 1GLHA 5HI0A 2W87A 2VJJA 3PMEA 4U88A 3QOPA 1IF1A 3KS7A 2RKHA 3GBWA 3DQVC 3GLLA 2KZVA 2LF8A 3HL2A 1GKBA 2CW0F 2H6CA 1MVEA 3VBRA 3ACHA 5CB7A 5CFCB 3DF0A 1W9SA 2VMEA 1JT6A 4R1HA 2EB7A 4XIOA 2PMUA 3VBUC 4JQFA 4AVBA 2M30A 1RGSA 4CCLA 1W8ZA 1HV0A 3ZXSA 2K9MA 1FLIA 2NMOA 2EF6A 5K5RA 1EKEA 3MKZA 1WLDA 3OYHA 4IE6A 4W4ZA 2OCEA 3G4SI 4IV3C 4OU0A 2KRCA 4II2A 3HRTA 2GMEA 1X2NA 3PUAA 2OKXA 1VRH2 2O8KA 2E63A 2YXSA 5FBJA 2VBWA 3WTYC 3RI9A 1JHFA 3BZ6A 5LRRA 2R7EB 2KA3A 3H3UA 5LA0A 2EA2A 1XNCA 2JA8J 1OD5A 1Y8QB 2VZ1A 4RAGA 4IRGA 2Q1MA 2GXGA 2KM2A 3VZLA 2K9LA 2VG9A 4MVTA 3NNJA 2QBYA 1R58A 4Z92B 2VW1A 2DA6A 2VQ0A 4QLCU 1JYNA 2O0OA 5CQEA 2D1HA 4D69A 5E8AA 4B3XA 2EZLA 5EG0A 5FYUA 1CAVA 3JQXA 3SH5A 2MGQA 4GALA 4XQDA 4A4AA 3AX4A 5GLWA 1GZWA 5C8WA 3CU7A 5F3CA 2ADUA 5C8CC 4MHUA 2WA3A 5HVQC 3AKSA 2VBYA 4QB1A 1UCRA 2PFBA 4CCEA 1ZKGA 3EXUA 1IRZA 2L9SA 1NK3P 2GN3A 3I64A 1VQPI 2GH8A 2WQZC 3L09A 1Q3EA 3K75B 4L9NA 4EN9B 1SVMA 2W85A 2DCZA 1BJAA 3PFIA 3E6BA 4RB0A 2XSDC 1HC8A 3OOXA 4RS8A 4XILA 3OEAA 1QO0D 4YW1A 4ZY9A 3CCUI 1QXJA 2W39A 2CFXA 1MGTA 4XXPA 1Z7S2 2D3PA 2WNVA 5A1AA 4CDUB 2Z3YA 5F39A 2DFHA 4DY5A 4YZ4A 4UFKA 1JZ8A 1ZBE3 1UOGA 3BY6A 2HVRA 5EYRA 3HD8B 3O3KA 3W5NA 3OD0A 1SVOA 4P9FA 3U1XA 3RZOJ 5A3MA 3FL7A 3W20A 4L8QA 2Q8OA 5A3OA 2W47A 4Y4RA 3WT3A 4AAPA 1WSUA 1X1AA 2E53A 4ZDOA 3C7JA 2BOJA 4IEVA 1UAIA 1DQ5A 3RZGA 1SZBA 2HTJA 2XL7A 2GLOA 3USSA 4XNFA 5D5XB 5E89A 1K5MB 2RDSA 3F6OA 3BOQA 2F5CA 5FPVA 2AGSA 1YIJI 3CBNA 5E1XA 1F4KA 2PI0A 1Q8OA 1EH6A 2R7RA 4A3CJ 2RG4A 2BW3A 1RMU3 3HN3A 5KHDA 2VKDA 3M07A 2XBO3 3G1LA 4CEYC 2JKBA 3UESA 3NNLA 2RDPA 4KFCA 3ETQA 1PUFA 4BA6A 1PP8F 2XGEA 1RTVA 3ZYFA 5LWBA 3WW1A 3AZYA 1COV3 5I93A 1F4AA 4PDWA 4LG0A 2BGPA 4IE0A 2R7FA 2LD5A 1Q1HA 2JDAA 3TKYA 2GNBA 5HCAA 4ZDPA 4JDNA 1QHHD 3GXUA 4F93B 4HKWA 5F1JA 1ENQA 3OYNA 3KSCA 5ILSA 1DQ6A 1YIFA 4XF9A 2K0GA 1SFYA 1W06A 3DKQA 3J80Z 5IK4A 1RIOH 2LS6A 4MV2A 1U12A 4L9BA 5IVCA 3IIIA 1VMHA 4HSJA 5BQTA 4LHKA 1K83J 1T2XA 2BQPA 2DODA 3Q8BA 5IVEA 2OUJA 3DWLE 1GMMA 3OCPA 2ZGQA 4PFPA 1T33A 5JFRA 5FBZA 3OS1A 3O8GA 3JTGA 2B9SA 2DPDA 2Z42A 1VAVA 5AC93 4RSUA 3OYJA 3B00A 1SBFA 1S2KA 3B6AA 3BTLA 2ZEZA 3PIOF 4ASMB 1SAXA 2KIMA 3GZTB 4PDWB 5JVGF 4NR1A 4E4SA 3MUY1 1LOCA 2EXIA 1FC3A 1Z77A 1TTYA 1OD3A 1WBFA 3VDXA 1YO5C 5CIRA 3RQ4A 3T4HB 1KQ8A 4HNVA 2DN0A 2CW8A 2JN6A 2BJSA 2VUDA 3KLSA 1A6IA 2VVDA 2IT0A 1RHI1 4D7NA 3GFIA 4HG6B 1HDKA 3FZVA 5EFUA 2AH2A 3HAGA 4GJYA 3QH6A 2V1UA 3FKIJ 5FZHA 1BIBA 1UG0A 1SD4A 3PL0A 2QQMA 4IERA 1RESA 3S16J 5E3MA 2C6YA 2KQRA 2E2IJ 2CWMA 5FZKA 2GC3A 2R5YA 5D6FA 1FBQA 4LJZF 4BJ0A 1WW7A 4CXWA 2K9ZA 3D4KA 1OA4A 3K4NA 1L7QA 2FRHA 1ON2A 1HQWA 1FT9A 5DAPA 3OY9A 4W97A 3MW3A 1H2KA 5BYNA 1BR2A 4CU8A 2K46A 4WF2A 3BI3A 4HF0A 4J1XA 2O7OA 5FPUA 4Q4X1 2KJBA 4AI2A 4D8MA 1W6NA 4A45A 3GFJA 3IHUA 3NAPB 3GTQJ 4DEVA 4E4DX 2K7LA 3PNVA 3WCRA 1D4VB 4EJWA 3S17J 2ZBKA 4QWNA 4CTEA 3M8JA 2WYSA 1PM7A 2IXJA 1PMJX 2Y48A 1VBD2 1VTNC 4DOZA 1XGSA 1ST8A 2K02A 1ORKA 3F8CA 2DYSH 2DK8A 2YPRA 4CUCA 4AVVA 4XEZA 1TEIA 2YX4A 2UWMA 5JI6A 5J48A 3TDZC 2BW8A 3MFCA 4U36A 3QODA 1OPMA 3FXJA 1QJY1 2JDPA 5FKKA 3ELNA 2VXZA 4YFNF 1KD7A 3PUSA 1XG1A 1GLNA 5C9AB 2R5YB 4BB3A 1VFCA 4Z2WA 2LTPA 1QNWA 5DABA 2IRFG 5FV3A 4WM7B 2P3KA 4CEWB 1NAEA 1AKHB 1BK1A 4UOJA 2XONA 3CF5F 2RR11 2QFEA 2CUZA 4UBGA 4PBPA 2BOIA 3PU3A 5FFXA 3TO6A 3RZMA 3ML6A 4PIZA 1BVVA 4HOBA 2OCCH 2L7KA 2B46X 2C0ZA 1B4AA 4IPAA 3ZYHA 3BTYA 1IN7A 1ASJ1 1FX7A 3ZFGC 3FMRA 3VZNA 1U0AA 5BPDA 3JD73 3RIRA 4A0YA 5FJ8J 2QF7A 3LIHA 3S57A 4NN0A 5FY5A 5EGOB 4AYBA 3WF1A 2H0VA 1XE8A 3ABKH 3H3ZA 3RYPA 3WU1B 3T1LA 1MJBA 3K9TA 2PELA 4FHTA 3LD8A 2MNGA 2R1BA 3POIA 4OI2A 4A42A 2P17A 4UW3A 1NY71 3TMOA 2BNMA 3KZZA 4LLFA 3KP6A 5SV8A 1JZ3A 1MBJA 1MZFA 2J1VA 3LSJA 2BV6A 3VBSB 4OLLA 2X0LA 4J19A 2WADA 1UMZA 1B35C 5I0DA 4UYBA 2HWD3 4NPLA 4P1WA 4MEYF 3F8BA 2XGDA 2V9VA 4MOAA 2XWJB 4IEWA 1VQ7I 4AUXA 1AZDA 2ECCA 2WO7A 3OYEA 2VM9A 4XJ8A 2XJTA 3SCGA 1MS5A 1MQTA 1QHGA 4CZZA 2B39A 1K4TA 3PNYA 2VUMJ 5K7HA 3FHQA 2ZEWA 2HQAA 3VHPA 3DU6A 3WQ7A 4D7SA 1V6OA 2VH9A 1XX5A 4ZZDA 1IPSA 4NIDA 5C33A 2IUWA 2HDWA 1X8MA 3POBA 2HH9A 3OBTA 1VBE3 1VZ0A 5F3EA 4N9IA 4QX5A 4Q0VA 4EGYA 1LUJB 5LD2C 1OBNA 2P4WA 5FP4A 4E70A 2OD5A 2X1CA 1IKPA 3NRUA 4G6DA 1OOPA 3P6BA 3TEWA 3M3YJ 1PZ8A 4BNCA 3POYA 1OF3A 1IG0A 4CUGA 3B94A 2JSCA 2IW5A 1J84A 2W92A 5HCBA 5FO5A 5GLVA 2L9NA 1JE8A 1WKYA 4UUTA 1FYLA 4NHMA 3U0ZA 3OBRA 3B02A 2DMUA 1YI2I 1GNZA 4KWKA 4AAXA 4O3MA 2R16A 3PNAA 5FMOL 4HVRA 2I2SA 2R7OA 3N9QA 2IGNA 3VKLA 3ROUA 1PO12 4DRRA 2D45A 2OPKA 4D7TA 1UX6A 4Q8LA 2FMYA 2BY3A 1G9FA 3S0MA 1SBEA 3BTIA 2DYRH 3GGLA 4L11A 1J75A 3GFLA 2QQOA 1REPC 3KEQA 2G4IA 3REOA 2MEV1 2ZGMA 2ZMEB 2NOGA 2VNRA 1IN5A 4AC0A 4BH9A 2E34A 3JBG3 3FLPA 1O4XA 1IQAA 1IG7A 4BYYA 4PZJA 4JX0A 3H1YA 3T3YA 4XFGA 2XROA 2W1OA 5FP3A 1ODDA 1ULDA 3HSRA 2RS51 4IJAA 4DNYA 2R062 1G9DA 1YX5A 2XPWA 4D9JA 5DM6F 4MSVA 4Q5OA 3LSTA 2JRMA 1X33A 3ASIA 1YW9A 4IL7A 4ENNA 4GRIA 5KHIA 3AMQA 1X3ZB 2WV1A 3GBFA 1AR82 4X6RB 1ODNA 4Q4X3 2IXCA 4E9KA 1N75A 2XVLA 3O1MA 4IE5A 3THCA 2A61A 1OFCX 1TZLA 5D8AB 1J58A 1J83A 2VJ4A 1HKTA 2SBAA 5L3EA 2JDYA 4DINB 2NLRA 1SEUA 4JTNA 2DBIA 4D6QA 3C18A 4ZKTB 1Q8QA 2IS2A 3FN9A 3IC7A 2P1BA 2ZMLA 4BOWA 4KG0A 4AVAA 4KN7X 4BY1J 3N9LA 3OSDA 3BALA 1IRGA 3K70C 1GZTA 3DKYA 1H0BA 2NNYA 2DXIA 3GYDA 1S3JA 4N90A 2IPQX 4RGSA 2TDXA 3VD3A 1MJAA 1Q5OA 3KGLA 2WO2A 1LDKB 4RM2A 1X2MA 4BCUA 4ATFA 2B8MA 1AJKA 3IDCB 2QQ9A 5FAXA 2LBFA 3A4CA 3KT7A 2ESNA 3BR2A 5I8TA 1VE0A 5H9QA 3S1RJ 1ND2B 5FLXK 1FP2A 1DCSA 1CAWB 1RUC2 3QYEA 2D6MA 3GTMJ 5IP9J 1OUXA 4JHTA 2Z1DA 2VPVA 5E20A 1K78B 3WDXA 1DDNA 4BJTA 3FMSA 4G9SB 1Y1WJ 1FXZA 3CJIB 1S72I 4MG2A 4A6SA 2A3YA 3QBQA 2M5WA 3H5RA 3D6EA 4FAGA 2BNOA 1Z3YA 2JG8B 1HB1A 3DN7A 2SLIA 1SLCA 5C3QA 2IXSA 3ZSKA 2W2IA 1LTEA 2UV1A 4KBZA 2PG4A 3VL9A 4PUSA 3MIEA 4M4PA 1Q8PA 2KZGA 2LOOA 3OYBA 1WLWA 3WDUA 1YC61 4LTAA 4L0PA 4Y5TA 3WDYA 4YM1A 3IMNA 2WAEA 3EUHC 2ARCA 3EQEA 4HAMA 3UYJA 3ERED 4JYKA 4XRFA 4TN7A 4YGEA 3J81Z 4E7KA 4ZYHA 3WTVC 2AS5F 2NZ9A 1TP4A 4LKFA 5FYIA 2FE3A 3BG7A 5J8FA 2KJCA 2WAAA 4GIQA 1J5YA 1IHMA 3MF6A 4S2GA 2DMNA 2Z5WA 2Y0SN 1W90A 1PYVA 1TNRA 2OZJA 2W84A 4YRDA 3CCLI 5LASA 3KLOA 1VBC1 2LC2A 3HOXJ 5FO9B 3OPTA 1YFHA 3J8F1 3BZCA 2LREA 1Y39A 1R091 4LORA 1FIPA 2YC4A 4IE7A 1S7EA 4P96A 5HNHA 4OMZA 1D4M2 3HR9A 4QKFA 3KCYA 1GV2A 2QSHX 5E1ZB 5DQ0A 2CUEA 2GZWA 1W39A 5IWFA 3CDZB 3DPRC 4K2EA 1I6HJ 1JYTA 5D6EA 4JDOA 1ZVFA 2WUHA 5CKQA 1S9HA 1HRV2 3H0GJ 1YG2A 5JSRA 2OPWA 3ZMDA 1ACCA 2ZB9A 1JOPA 4KGQA 1EA3A 2ARAA 2VMDA 3A03A 2LYCA 2Q2EA 2BXZA 2D97A 5IYDJ 4BXXJ 4L92A 2XF5A 3VKFC 3E6MA 3ZQCA 3HPHA 1UKRA 4CXFA 4UUVA 3ASNH 4I02A 4BQ1A 1P7IA 2QZ2A 2GM4A 5FZ3A 1NLQA 5F1RA 3OYLA 1IOAA 2JRTA 2MEV3 2VJIA 4UBHA 4IL6C 3VBUA 3IAS2 1JJ6C 2D5FA 3HJRA 2RS11 1O3TA 1OVSA 2XJVA 3WDTA 2CYYA 1ZZCA 1O7LA 5IT3A 2RS53 3T2PA 5CKNA 4JQTA 1X1CA 1Y1VJ 4C3HJ 5FP7A 4UW6A 4PJNA 2ZMKA 3H42B 2HWB1 3JSOA 4KBBA 3FXUA 1RUOA 2M0MA 4EJRA 3DYOA 2HLEA 4EJTA 1BW5A 3U75A 2VOOA 2CHHA 2R7XA 3HDDA 4A5NA 3VD5A 1AL22 3RTRA 3JXSA 2WWJA 2HDCA 1OA3A 2QKMB 2K4JA 4AHWA 1QEXA 3PHMA 1EH7A 2JENA 3H7JA 6PAXA 3LSGA 2PX9A 1PUEE 1BCXA 5EZGA 1XNTA 3C1DA 2GOXB 4MO3M 1B09A 2O1QA 5F5IA 4C3JJ 5FPBA 3I0TA 4QXHA 1F1ZA 1V54H 1VBA2 2B9UA 3OIQA 3WNXA 2DFEA 4LGWA 5CADA 5FOBB 4PI2A 1LKXA 2D3SA 5E6HA 3QPSA 4KMUX 5E3NA 3CP8A 5ACA2 1QMJA 3LA7A 4XSZF 1C0WA 3VB2A 2RS31 5C8CA 4GJZA 5BNOB 1POQA 1D7PM 4DBRA 3BGAA 2ZFUA 3Q8CA 3MKWB 4YG0A 3UR3C 1NG7A 2Y9ZA 4K1YA 1D0XA 4EM0B 5FYHA 1VBB1 1FPQA 3SDBA 2W1QA 3HOUJ 2V4JC 1W6PB 2FNAA 1X82A 2DA3A 2IA1A 2V1XA 4BE3A 3AP9A 1PK6A 1W9TA 1RUG1 2W25A 1AHSA 3TBDA 5FTTC 4C90A 3ZYGA 3POJA 4KWUA 4G4FA 4AK3A 2PHRA 1RNLA 4XETA 4W6XA 4J00A 2DUQA 2QVSB 3S2WA 3NL1A 1CF7A 4META 2DVDA 3DF8A 4FPJA 1GUUA 2W68A 1LQ1A 1CZVA 4WM8B 1PO21 1JZ2A 1MDMB 2N8GA 5A33A 2UWCA 2A6WA 2EWNA 2Y6LA 4OULA 2FCUA 3K70D 4RB1A 3L9JT 4TYSA 4XQFA 5GZGA 3KP2A 5EJCA 3HQUA 4LLGF 2OW4A 2X85A 5FZDA 3QPHA 1EV12 2IS6A 2VLAA 4FAHA 2E5NA 3CCYA 1V9U2 3LSRA 2P7CB 4Q47A 2CUFA 4MTDA 4JVAA 1GZ9A 2WA4A 1OKRA 4WVZA 4W8JA 3SH4A 5BNGA 3POFA 3V8JA 1UCXA 3WTZA 1ULOA 4KUMA 3MV11 1OH3A 4I3PA 1FBSA 3P7NA 3ZN4A 5FZ6A 4PF1A 2K9SA 1O3RA 1FIAA 1KS5A 5TSWA 5F6LB 4KQ7A 1W36C 3LA3A 1PZ7A 1H2LA 1ZK8A 4YELA 3ZQLA 5FKBA 5F37A 3IH3A 4F52A 1IPKA 1QY4A 1VBC3 5FY1A 4LOSA 2HXOA 5FIXA 3J8F3 1DIWA 3FBNB 4OHYA 4QPQA 2DOEA 2CV2A 4RBOA 4KMQA 1YQ5A 5A7QA 4O65A 3MGUA 1XSXA 1O59A 4QGLA 2CW7A 5FZGA 2LF7A 2V6EA 2ZMNA 4RHV2 1N47A 3E5XA 5FMDA 5M5WJ 2KDOA 3CKHA 5A33B 5ICCA 1YJ9I 5FMCA 5EJ3A 3JR9A 1QU3A 3VZKA 3S1MJ 1Y9QA 3A02A 1EP0A 4IEZA 4LK6A 2VCCA 4X8NA 4XHBA 2A75A 5EP9A 5J98B 3OMYA 4BQ4A 1FOXA 3NEUA 2WFPA 1Z05A 1E0EA 4P9XA 4KA4A 1XS9A 4DZPA 2W1UA 2CMPA 3AM2A 3K4ZA 4XFAA 2E7XA 3WNNA 4BQXA 3JRHA 2VULA 5BPIA 3BPVA 2DOAA 1QQP1 1LRHA 3IMMA 1HSTA 2BY0A 5L19A 1IS5A 4B8EA 1HB4A 2EZHA 3CCEI 1S6LA 4U0WA 5BXXA 2QQJA 3K6GA 4C8DA 3IH4A 4X6QB 1KYWA 1XOYA 1T08B 1LU2A 3ZQFA 2IZWA 2RS13 1IXSB 3CCMI 1WJEA 4FPKA 4A3ZA 4XXAA 1FEXA 1LEDA 3H9JA 1T6SA 2KMUA 2WC2A 5JR3A 4M74A 2H27A 1LHUA 3N7MA 2EV5A 3OD4A 3KF5A 3QPTA 3ME2A 4XM3A 3POSA 4E7IA 4BIOA 3VD9A 4EWAA 3WGIA 2CY6A 1NYWA 4TLFA 3WW2A 2CJJA 4Q2FA 1W6QB 1Y3TA 2E7WA 2VKVA 4QPIA 1WPKA 1U9NA 5HCFA 5B4XA 2E7QA 1S0DA 3VBFB 5F6KA 2LY2A 5DDJ1 2ARBA 2BVBA 3TEDA 3THDA 5B2GB 4NQWA 3ISPA 2V7FA 1A8DA 4RQPC 2VVFA 1SFEA 2OA4A 5C4XJ 2A07F 4URTA 2QQPA 2HI3A 3DXJF 2VC0A 2IXKA 4P5HA 2UUZA 2WO3A 5JOXA 4HN0A 3RWKX 1YFWA 1OLME 3I2HA 2RMU2 4O9GA 2RS33 4P9IA 3TN92 1JYIA 4HVOA 4LUMA 2E51A 2EA4A 2XQRA 3TP0A 4LD5A 2R0HA 1IXRC 3ZMSA 2G1MA 4AEDA 4QQHA 1D2QA 4P9GA 1JZ4A 2DQRA 1VR3A 4AVCA 4E2SA 4RR3B 3PSFA 4YARA 1CX1A 4EM2A 4QB2A 2W24A 2BP6A 1R00A 1US3A 2OIIA 5LEJA 2VASA 1RUI1 2L7ZA 3N36A 4AHXA 2ELHA 2K85A 3R0RA 2D1VA 4R79A 1IZ3A 3ETPA 5DUIA 2GBYA 2PQSA 1LODA 3M3QA 1BJZA 3JRAA 1PNFA 1K4SA 1JYWA 3OL4A 3J7NA 4HA8A 1PGSA 5L9RA 4LK0F 3MF9A 2ZXIA 2JUCA 3OYMA 5J6XA 1O8PA 3I2GA 5A7WA 1NXD1 1XRUA 3O1TA 4BL0B 1H88C 2WZR2 4CA0A 3ZQHA 1FPN1 1AYN2 2QQUA 2GC1A 1OKQA 2EV0A 3AJZA 5AFBA 1NG0A 1EH8A 4XRMA 1OYYA 5T5OA 4KITB 1W04A 3KYCB 1FX5A 2WT1A 3J7ZI 3BPSA 3DGTA 3QAHA 2JQ7A 4XW3A 2KIQA 4W50A 1IN4A 2WS91 4H14A 5GPAA 5FRNA 1SFXA 3ZCOA 1Y43B 2VZPA 2A69F 1VMFA 3OGVA 4HSTA 4NBQA 3MN2A 4MGQA 2BRTA 1FMD3 1RUJ3 4QKNA 1B72B 2V5YA 3ZFGA 5GJ6A 3H8OA 4QGNA 1PVXA 4OYUA 1U5TB 3KLNA 3AYAA 5FXVA 3EO6A 2ISZA 1PGL2 1E3PA 4HG2A 5BUVA 4K8RB 2PJRA 4FISA 1JI6A 1PX4A 4E2GA 1SAUA 3RDIA 4C9YA 1W8NA 2D93A 4NIGA 4RGKA 4IZZA 4AWDA 5CQGA 4CH7A 1YFYA 2FOWA 1RKTA 2LMDA 4I2OA 4GMP3 3PJYA 4IHWA 5G04L 4HKLA 4KU8A 4JGZC 5EEHA 1RUD1 2Y69H 5TJJA 4CZCA 5LRSA 4LE4A 1QZYA 1B35A 2ZKNA 1CD3G 4XLAA 3ATGA 1VNDA 2LY1A 3GCMA 4ET7A 3CO6C 4OZOA 3TB0A 4CDXA 1KRIA 2EJRA 2B7YA 1NA1C 4XBNA 3RYKA 4A3KJ 3CC2I 5FKOA 1V6IA 2V09A 1W36D 1ODMA 4N43C 2AUYA 1GZCA 2E71A 1S55A 4XUPA 1G3YA 3O1VA 1QOSA 1WCMJ 5FZCA 2F5FA 3VEPA 4M3CE 2DA1A 2WJSA 2RQQA 3ILNA 1RUE1 5KHJA 2XVGA 2XDVA 5GLZA 4AFBA 2GALA 1E57A 3DBLB 4DQAA 2A6YA 4G6QA 4I0WB 4G7ZF 3Q0UA 2A73B 2J22A 4YGDA 3LSKA 4XF1A 4EZ4A 4A3GJ 2K3FA 3SEZA 3F8MA 1YRNA 1OQDA 3S15J 1IZ1A 5IY5H 4EEFG 3LE0A 3BOWA 4Q5SF 3QCWA 3QLQA 1W5SA 1W1WE 1RVF1 3F9KA 1WKMA 4WVVA 4A3IJ 1H2NA 2G9FA 3FXKA 2M4GA 2R5ZA 1A04A 2DT6A 4M3GA 1HRI1 5FZ9A 1XYNA 4NUBA 2GWRA 4QTRA 5DDJ3 1MMGA 4A3FJ 2R7TA 3EBRA 2OYZA 4FTBA 4ABZA 4RS5A 4CDXB 1IV6A 2IGOA 1S5LC 4OMDA 2PEXA 1YIOA 3F3XA 1JGSA 3M2MA 1JHHA 1LVKA 4S05A 2WFF2 2NQYA 2HZTA 3TAYA 4GWNA 3VBOC 2P6SA 3FLRA 1PGW1 1AR61 5D5WB 5JLVA 5IK7A 5F6FA 4BQ5A 2FJ1A 4PBOA 1MMAA 2VZQA 3BJOA 4B8XA 5I8SA 4BXSV 3WHCA 1EAH2 1W8OA 1FNZA 2PHFA 3LPGA 3H92A 3QACA 3P3PA 1EJ9A 4CDWC 1WZXA 1S0CA 3PVEA 1RUI3 1BHGA 4XKCA 5JXGA 3S5QA 4NHJA 2OZUA 1ZELA 2ZSHB 4F3QA 2JD4A 1OXCA 1RUH2 1KXGA 2P6HA 5A3LA 4QQLA 1YQAA 4S04A 1TC3C 3NJXA 5C6CA 2R5ZB 3FXOA 3PUIA 4FFFA 4XFCA 3OY8A 3V0AA 3BTCA 1QF3A 5GAGJ 3HRSA 5FKCA 3U1KA 1PVC2 3MLKA 3VBRC 4FQZA 2WY8Q 2X1EA 2QQWA 4IF4A 2X5IB 4EV0A 2DBNA 1D1CA 3IM0A 3AKZA 1JTZX 2HQRA 1KDMA 4NAMA 4LBJA 4XZUG 1UZ0A 5D4RA 3VYRB 2VMFA 4LUKA 1WH5A 4QU1A 1W3VA 1MEC2 4BACA 2AENA 3SKJE 4G7OF 4M73A 1AR72 2AQFA 4PHZA 4M72A 1B9MA 1C8M1 4HW0A 4XMAA 1EV7A 2WABA 2WNEA 2M7AA 4LMYA 5J1RA 2WS93 4X1EA 4Z2AA 3N7KA 3AL0B 5BV6A 4Y17A 1X4OA 3MCZA 2YROA 2V72A 4DPNA 1J3RA 4Q4Y2 4MGSA 4IV1A 1RETA 1D5VA 2DMPA 4XYXA 3TW7A 1V6MA 2WT2A 4SBVA 5C71A 2ZGKA 2OF7A 3KIOA 4MGRA 2LKXA 3CMEI 1A3KA 1B9NA 4K1ZA 1W0OA 2IVJA 3BR6A 4KN4X 1OQYA 4A93J 1KU2A 2ZXWH 5FZIA 3I2FA 3A0BC 1NQDA 2C5DA 1WLTA 4C2TA 1TBXA 2HU9A 2UY8A 1MW7A 2VNOA 1PX3A 2JWPA 4Q4V2 2HVQA 4NROA 2DVAA 5JMCA 3A01B 4OWRB 2CO5A 2L7FP 5J96B 2VW2A 4KT5C 2ECBA 3QWLA 1S29A 2WL1A 2NMNA 4V2GA 4BQWA 4UVCA 1RUD3 2HS5A 1UNBA 2DV9A 2D40A 1UU4A 4HNUA 1S0IA 4X6AJ 4ASKA 1B8IA 4ESJA 2Z2SB 2W52A 1FOD1 1ZBA2 2J1RA 5I91A 3OYGA 1W2TA 4YGCA 1P9QC 5FXWA 3M1HA 4GH4B 2FMDA 5F2SA 2NXNB 3I2KA 4OVEA 2DJIA 5IAXA 5JZGB 2ZHLA 4LO6B 1W6OB 3ZFEB 1OURA 1S0GA 3VDBA 1BA5A 4XLCA 3ST7A 1U5IA 3ZYBA 2DTZA 5LB6A 2A1XA 5F0FA 2HOSA 1O4ZA 1DQ2A 4IEQA 2Y6FA 3SDGA 5FLIA 1DLCA 3L2YA 4Q4W1 2A3XA 1N3PA 1SFOJ 3R4DB 2QQIA 2WNVC 3L9FA 4Q8KA 2MA3A 1IUYA 1DZTA 2QSFX 1IRXA 1RUE3 2PHUA 3H5NA 4XDPA 4DGWB 4AQTA 3FM5A 3KEYA 3Q5FA 1UKGA 4YLZA 3W21A 2R30A 4ENKA 4PLOA 2WWSA 2RHPA 2ZCWA 2WQ4A 4HQMA 2FU4A 3H1CA 4AHYA 1UF2C 3IKTA 2VB6A 3NJYA 3DPRA 1HV1A 5LLQA 2F17A 3UKNA 1IRFA 1P4WA 2NVXJ 3AMHA 4I01A 5FUPA 1RVF3 1OQ1A 2MG4A 1LECA 4YVWB 2R7UA 2YY1A 3MIGA 4Y1ZA 1OCRH 1UY4A 1RB8G 3NNGA 1HRI3 2GNTA 2HEWF 3MFKA 1PIV2 4PQQA 2CL2A 3CZUA 2RQPA 2AEYA 1P6RA 3HHHA 1XYPA 3RKXA 2RM22 1TQIA 4LBQD 4R4ZA 3ZQIA 5IP6A 4QPYA 1QGLA 1W0NA 4COUA 2F4MB 3SZTA 2RV9A 3W9AA 2WBKA 1Y8RB 2Q0OA 3ES1A 1KS4A 1OUSA 4ZDLA 5F08A 3AYEA 4HV5A 3WTTC 5A70A 2V6CA 1U2WA 4LE3A 4QQPA 5IT9K 3AG3H 4JKLA 3HUGB 1TQ5A 4K8FA 4PDWC 3DV8A 1ZYRF 1VB2A 3ZMVA 3C2BA 3KT1A 1WMXA 2BZTA 2X05A 4O9EA 2OXBA 2H1LA 1LNSA 4IGPA 3ZN6A 4KNCA 4DYQA 1L7RA 3INAA 4EE2A 2DCTA 2Y38A 4DB5A 3ACIA 3OR2C 1LDDA 3FFQA 4KYWA 4ONUA 4ATEA 5JVTA 4EN6B 3LQCA 3NNMA 4EN8B 3PURA 4HLYA 1W9YA 4CPBA 5JOZA 3OS2A 9ANTA 2GXBA 2K9NA 4EVIA 2VUJA 2D6OX 5K7ZA 4QPGA 1W0PA 1J09A 2BBVA 4B7EA 1D1BA 4O5VA 3VZJA 3VD4A 2HZDA 1VQ6I 2HWC2 1WJDA 4BXFA 2FZ2A 2ZJRF 3TP3A 4RLFA 2P2KA 2YC2A 2BFUS 4OFGA 2KDZA 1X9PA 5EF6A 4JDMA 2WZEA 1H9PA 1QVUA 1S1AA 4J25A 2F5DA 1UXXX 3V7RA 5JXJA 4XBFA 4ZJZA 1C8M3 2QVOA 4QKDA 1YJWI 4LOTA 5KAIC 3NAPC 3OF1A 3OGSA 4A44A 2VZTA 2VBXA 2HWF1