5LRRA

The transcriptional regulator prfa from listeria monocytogenes in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein
molecule keywords Listeriolysin positive regulatory factor A
total genus 76
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lrrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lrrA01
2XLGA 5CVJA 4OIPF 5FLHA 1R1TA 2R7DA 4FAHA 2PMUA 1R1VA 2D93A 2GZWA 5D8LB 3HRMA 3LQQA 1QZZA 2D1HA 2KKOA 3HHHA 1OD5A 2PA7A 3RJPA 2STWA 3OD0A 4JTNA 4K2EA 4XLNF 5E20A 5D5WB 1I6XA 2GC3A 2ELHA 3I4PA 3I59A 3SFZA 4LULA 2E1NA 1T0FA 3I53A 4XSZF 1PP7U 2W25A 2EA4A 2H0VA 1XB4A 2DFIA 3FHZA 1U6GA 3TDZC 4HDVA 2XLAA 4Z82A 3K2ZA 4L9TA 3OF1A 4WVZA 2PJPA 4LK1F 5D5VB 3FXRA 5K1YA 2QENA 3NVCA 2FQ3A 4OMYA 3CO7C 3TGNA 1ZARA 5HDKA 5FPXA 2CGPA 1RIOH 2UYAA 2LF7A 2DAOA 4IHTA 4Q0VA 1EP0A 5I0UA 3ST7A 2XV4S 5CVVA 3H50A 1BIAA 3RYPA 2OA4A 4PJYA 3HYIA 1YW7A 3JTHA 1KU7A 1ZZCA 5JR3A 4META 3SMHA 4X6QB 3GF2A 1ZG3A 1ZZ9A 2BYVE 2QNKA 5L3EA 4BXUA 5JR7B 5E1ZB 3O14A 1I1GA 5C6CA 1L3LA 3EDPA 4QM9A 3F8CA 2FBHA 2YR2A 3FJSA 4JTOA 3IC7A 1H9GA 5FPZA 5BPIA 3MDPA 1Z6RA 3CEWA 4GULA 1YLLA 3E5QA 2IXKA 4Y13A 3KLOA 2P5LC 5EEGA 1PMIA 3F8NA 4MTEA 2GXGA 1O7LA 2OYZA 3R0AA 2ZNZA 4HA8A 3I71A 3WTTC 1G4DA 2Z3YA 4QGNA 1XGMA 1LEBA 2QM3A 1ZYRF 1U8RA 4B29A 2TDXA 2VC0A 2OU2A 4A0ZA 2V6CA 2VBWA 4ZYDA 2KJCA 1BN5A 1GXPA 1QPMA 4HN1A 1IW7F 5BY5A 3UKTA 4EWDA 4PCQA 2H6BA 1JHHA 4M74A 4M9ZA 4DNCA 3GFLA 3ZMVA 1ZRCA 1DGRA 1O5LA 2XL9A 3LWCA 2VPVA 4HBLA 2OA2A 4MGYE 2P7CB 5L3CA 5FGMA 2B9UA 3C1DA 3BDDA 4FHTA 1Z7UA 5IT9K 1XE7A 1WRJA 3CF6E 2IRFG 2IXCA 5CLSA 4KWLA 5LHIA 1USSA 3HOSA 3WU0A 2ACJA 2OQGA 4YFNF 4OU0A 5D6EA 5LEKA 2GC0A 2IXJA 5BS6A 1UIJA 2V1DA 3ABTA 4P9GA 5A2QZ 2AS5F 4BYYA 2BNMA 4MQVA 1SFXA 5AIQA 4LJZF 4H0EA 2HFHA 4Z2YA 1K6OA 3D5LA 3HIFA 4KIFA 4QXKA 3P9CA 2HS5A 2QVOA 4KWJA 5FDBA 4ZYEA 1KQ0A 2EJRA 1B59A 2C6YA 5HLIA 2KIUA 3I64A 3QAHA 5T3NA 2EFQA 3ELKA 5BPDA 2O8QA 3TNPB 4HVOA 2Z69A 4MGIE 4LLLA 2D40A 4MZUA 3ZMTA 1QZYA 2UY8A 2VXZA 3SCGA 3IRRA 3DEUA 4E2SA 4P5OA 4MGKE 2HEOA 4XF1A 2FMLA 2LSOA 1NE4A 4KNYA 2P6SA 1HKSA 2YSRA 3D0JA 5D6FA 2O6GE 1I1SA 5JCTA 1O3SA 2IW5A 2DW4A 1MJ9A 2DQRA 3E3VA 2K02A 4LB5A 2DBBA 4LLNA 3WW2A 3CJNA 2M87A 2M45A 1IPJA 1CAUA 3EQLF 2LF8A 2IJLA 3M8FA 3MZYA 1CAWB 3V8KA 2F5CA 3BZ6A 1ZAOA 4RGRA 4WXCA 2VOOA 1OR7A 5FFZA 2JPCA 1XSDA 4X6RB 2D1VA 3H7YA 1EYBA 1YG2A 5HOOA 2PAMA 2O03A 1YIOA 4A5MA 2FE3A 2J5PA 4CICA 4EMSA 2FBIA 4NB5A 5JSPA 3BROA 3SXYA 2LDUA 4UBGA 5JAXA 1EV7A 2L02A 5LLQA 5FQ0B 2CG4A 3QRFF 4OMZA 4BHBA 4G9YA 4GO1A 2ET7A 3WE3A 1YWKA 3D82A 2RDPA 3DL3A 3E97A 2EFNA 3GX4X 2K9ZA 2CSOA 2EVXA 2A6EF 1B6AA 1DPUA 1VR3A 1FWZA 3CDHA 1STZA 1U12A 4AVCA 3RKXA 5ILSA 1BC8C 3EETA 1K78A 4XF9A 1F5TA 2Z9OA 5JSOA 5L3DA 1P6RA 3WTXC 2GC1A 3KMHA 2XAHA 3SHRA 2XAQA 1I27A 3TKYA 2NNYA 2EAAA 5DEQA 5C8WA 4A6DA 1EY2A 4M72A 3DPLC 1DUXC 1LDKB 2MA3A 4LA3A 1F1ZA 4HSLA 3JZVA 4RB3C 3VEPA 5K5QA 2IT0A 3PFIA 4XFFA 3R61A 4PGGA 3P9IA 4MGZE 4OIQF 4G6QA 3J7AO 3CUQC 4LK0F 2XGXA 4YSFA 5LEJA 2P4WA 2C0ZA 2XUBA 1OMIA 4AXOA 3MQ0A 3ZQ7A 4ONUA 2D45A 3ZN0A 1G6NA 2WTEA 3E5UA 2P17A 3P9KA 1UIKA 4LLOA 1RI7A 3HT1A 4HLTA 2X4HA 2L54A 2ZNYA 2GIVA 2O61A 3ZPLA 2A3SA 5D4SA 5HDNA 1ZZBA 2K0GA 3DF8A 3I5UA 3S7IA 4CHUA 3TO9A 2EA7A 2PG4A 1VP6A 5EFUA 3S2WA 4KICA 1UCXA 5I93A 1SFUA 4OFGA 2HWVA 3ERED 4ZU7A 4KFCA 1GQGA 1MDMA 4XFBA 2XHKA 5FD5A 3VB2A 1ON1A 1NZCA 3LAGA 4TLFA 2M30A 4KMUX 1IZ1A 2R3SA 3ZN1A 4KDPA 3K1PA 4M71A 4OIRF 3CUOA 3B02A 3RI4A 5E18F 4EQQA 3GXOA 3IKTA 2GU9A 4LTAA 1S7AA 2IP2A 3KP6A 3RYRA 1PUEE 1W4MA 4M73A 4KU7A 4LMYA 1XMAA 4A2UA 1ZREA 4KA4A 4RGUA 1BOAA 1XGSA 1VTNC 3KGLA 4KN4X 4EROA 4IRHA 4E2GA 3K9TA 4GYIA 4LG0A 2PQ8A 5EEHA 4XLPF 1ZG1A 1P4XA 4L9VA 3BJAA 3SCHA 1HXDA 5D4RA 3GVAA 2KRFA 2JRTA 2O3FA 3WU1B 4HX8A 4MV2A 2IA2A 5FFXA 3KP7A 1EH6A 3EJKA 1LQ1A 1WQ2A 2BGCA 2F4PA 2VE8A 2DI3A 1XSXA 4BAYA 2YPRA 2HYFA 2BNOA 3RPUA 4XF3A 4U0VA 2B0LA 4HVRA 1XSVA 1P4AA 3L2CA 2F5EA 4IEOA 3CL1A 4BHPA 1DP7P 4HV6A 1R22A 4RGSA 3M7GA 1LR5A 3LZZA 1ZZ6A 1TTYA 3BJOA 3WG9A 4A6EA 3NJZA 4KU8A 1KYZA 4IEQA 3ISPA 4RB1A 1T39A 1DDNA 1UW8A 2DO7A 1ZZ7A 3GEZA 4P9FA 5FCCA 1SMTA 3BWGA 1XCVA 3ZDSA 1TNSA 3QP5A 4IF4A 2E9QA 4QGMA 1HSTA 5HS8A 4YFXF 4YRDA 1UHMA 1D8JA 2K27A 1X8MA 3I7DA 5IT3A 2JZYA 2A07F 1XDSA 4M6YA 2AXLA 2UXNA 3S0MA 4I0BA 2XRNA 3GZ6A 3CO2A 4Y17A 4ESBA 1TQMA 3ML6A 1XGNA 1T2KA 1L3JA 5BPXA 1TBXA 4LB6B 1QNTA 1TW2A 3N4MA 2K7LA 2K86A 1L0OC 4KMFA 5DYMA 5I0RA 1O57A 4IXAA 5J8CA 4L9NA 4R8HA 2ESNA 1ZG5A 3MCZA 4M6XA 4WCGA 2XROA 4IJAA 5F64A 1TQ5A 4XFIA 3TQNA 4HLYA 1ZLKA 3JW4A 3L09A 4CGZA 5CVIA 2BE5F 2OD5A 1NE6A 5FD6A 2Z33A 4O3MA 1FXZA 1P4WA 5K5OA 3SHFA 4QMAA 4JQFA 4IEZA 3DXJF 3IL2A 2ZCWA 1R7JA 3GBFA 2WV0A 4MH0E 3T0YA 1IN5A 2KIMA 1IAWA 4GYGA 1LNWA 5DCMA 3HOTA 4WF2A 5K8SA 2WFPA 2COMA 2EFOA 2HTJA 2V9VA 3M3IA 4E70A 5I8TA 5J6XA 1R5GA 4JV4A 2BBYA 3V7RA 2V1XA 1S8NA 4XBFA 2CV6A 3O3KA 4Q0PA 5D1IA 5HS9A 3EYYA 4L0ZB 3SCFA 1P2FA 4AVPA 1RZ4A 4G94A 4AIHA 5KHHA 4Q4ZF 1CAUB 4ENNA 1ON2A 5E8GA 2Q0AA 4IESA 3WW3A 5E1RA 2L4MA 1FBQA 1U3EM 2NYXA 5L3GA 4WX9A 3LA2A 1J2XA 3GLXA 5FLXK 3RTRA 2EFWA 4UVBA 3ZMSA 1J59A 2DCTA 1Z9CA 2EB7A 4H7LA 3KP5A 3NRVA 3MAJA 4IVNA 2FU4A 3EBRA 1U2WA 4KT5C 3USSA 2GWRA 3CO6C 4UV9A 4U0YA 2XLFA 1FLIA 3WW1A 3M9AA 3LAJA 4I3PA 2OQRA 4MEXF 1YQAA 3ABUA 4LD5A 3J81Z 5ILUA 3WTUC 3F6OA 3G73A 4HX7A 4EJWA 1U5TA 1XRUA 3FZVA 3TO7A 2M1BA 4HF2A 2Z99A 3QP6A 1FPQA 2N7GA 1FZPB 1LEAA 3NQOA 3ULQB 3LOIA 2RV8A 2DPUA 2PI0A 1W5SA 1LB2A 2CAVA 3WTVC 3EHKA 3FM5A 1XD7A 1FI2A 1P92A 4EGZA 4LA2A 5I0SA 2Q8KA 1W7PD 4AD9A 5TJJA 1OYWA 5L3BA 1PP8F 1Z1DA 1BI3A 1Q5OA 1FBSA 1S29A 3HSRA 5ED4A 3ELNA 3F23A 2JPBA 4JBAA 3FM3A 3TOAA 3LA7A 3BB6A 2MPFA 3IWZA 1K78B 2QYOA 2MH2A 1PM7A 1O3TA 2UWMA 3OGJA 3KE2A 1TQPA 1WGPA 1A04A 5DDGA 1SD4A 2PQQA 2RN7A 4OLLA 2B8MA 1ZGJA 2IA1A 3Q5FA 5AVPA 5TRDA 2H09A 1U78A 3P7NA 4N9HA 4CYDA 4QM8A 3PVBB 1QGPA 2F2EA 2VBYA 2M8EA 1YHFA 1XCBA 4TV7A 4MGRA 2P6TA 4DINB 4WZCA 6PAXA 2ZBKA 3VFZA 5CVUA 2K4BA 2J5OA 2P5VA 1HW5A 4A0XA 1ONVA 2P8TA 1G3SA 2W57A 5JSRA 4HSJA 2BV6A 2CAUA 3WGHA 1O3QA 2HKOA 2MD5A 1O4TA 5HLHA 1RUNA 4CDGA 1O3RA 1UD1A 1CAVA 5K5RA 1SQ4A 2VBXA 3GWZA 3E6MA 2VT2A 1KQ8A 2QQ9A 1YFXA 4ZU4A 4EGYA 4YG2F 2FBKA 2Q0OA 1V70A 3ES4A 1R58A 1Q43A 1V3FA 2MHFA 4I0AA 5JVTA 1UHWA 2O0YA 2D2WA 4KL1A 3ZP5A 1T38A 3F8FA 2OZUA 2JSCA 4PDKA 5KHGA 5BQTA 1FYMA 1B1BA 1X82A 3QOPA 1ZVFA 1YW9A 1UFMA 2L4AA 2MH9A 2QQAA 3NKTA 1R1UA 1ZHFA 2FMYA 3H7JA 2CW0F 1RTVA 2A6HF 3H1WA 4FX0A 4RS8A 4RGXA 4I02A 3DKWA 5H20A 2YU3A 4AWXB 3IBMA 2CWEA 1O7FA 3HSEA 2VC1A 1R23A 1OKRA 4IEWA 3O6BB 2Z5UA 3Q9SA 3HT2A 2IC1A 1KU9A 5LBQA 1Y0UA 4UUVA 3REOA 4G7ZF 1I5ZA 1XGOA 1C0WA 1TLHB 4YARA 2ZMEB 5LHGA 1CAXA 5D5UB 2W84A 1XMKA 5CJ9A 4EJTA 4MNUA 4HMZA 3M1EA 4EWEA 1XE8A 1YO5C 5A2QK 4OOIA 3K1MA 3ROUA 4XEZA 4BH9A 1IXRC 3C3WA 2QLZA 1UCRA 3WODF 3WTZA 3FWEA 2FEZA 4AVAA 3EYIA 2NRAC 3GO5A 4G6DA 3RKWA 2JTVA 4IEXA 4Q48A 5IT9Z 5BUVA 4CZZA 3PNAA 2UZKA 3R6SA 1YS7A 3H1MA 5D8KB 4IPAA 1FNNA 4BNCA 4J1XA 2MLGA 2VE9A 2Q4SA 1FT9A 2L3DA 3FHIB 3RDIA 3WTWC 4XFAA 5F1RA 3G7DA 1SD5A 3LFKA 5HDGA 3SQNA 3V8JA 5E1XA 5LGUA 1B9MA 3KEQA 3C7JA 4D7SA 3KGZA 2DTRA 1LKNA 4L5JA 2W24A 5HLGA 1MJBA 1MGTA 2M5WA 4PIYA 3ACLA 5E1WA 3BY6A 1H1MA 3K69A 5JHUA 4HQMA 2PYTA 5H6RA 1CF7A 3DN7A 2Y48A 1BJAA 3H3ZA 1QO0D 3L00A 2XKPA 2PAEA 1ZRRA 1Z05A 4L11A 1HSJA 1Q3EA 3EUHA 4UNOA 4MEYF 3Q9VA 1YUDA 3E6BA 2A68F 3FMRA 3DP7A 1RUOA 2E7WA 2DPDA 2VBZA 3BP8A 4ZU5A 1LDJA 4UVCA 3H3UA 1Z6TA 2NAZA 4BIFA 2LKPA 4I98B 2HTSA 2STTA 1H0MA 4ETSA 4ENJA 3BU7A 2OBPA 5FB2A 4FBFA 5E17F 3RIRA 3VOEA 3E6CC 2XAFA 4YNIA 2VQAA 2FSWA 5I91A 2HDCA 3NEUA 4DQ2A 3RPQA 3W6JB 1H1IA 3M8EA 1IN6A 2HYGD 3UKNA 2HQNA 4WBBA 3NSTA 2XAJA 4ENKA 1MJAA 2OAZA 4KYWA 4LGWA 4FT8A 5DUKA 2K4JA 1BI1A 1LJ9A 4YIFA 3F22A 3HUGA 4IRGA 2KXLA 4Y15A 3MYXA 2CYYA 2IXHA 3U10A 1IRGA 5ICEA 3C3VA 4IEPA 3KP3A 3FFQA 4E2QA 4UXAA 4ZYGA 3V8LA 4EM0B 3KETA 2O1QA 3ZMUA 4I2OA 2BEOA 3DQVC 2ETHA 1IPKA 1EH7A 5ICCA 4U88A 4CO8A 3GUDA 1J0RA 4K8FA 4Z07A 5EZWA 3U11A 4O9EA 3FMSA 5JI6A 1G3WA 1JUHA 4EM2A 1H9TA 1YFYA 3I59B 4EJVA 1FOKA 1KGSA 2RKHA 2QDRA 4IEUA 3U0ZA 2Q1ZB 3IWFA 1JGSA 2WC2A 2MC3A 2EK5A 3BPXA 3M70A 2F5FA 3HHGA 4WXHA 4UHTA 1QBJA 5HVQC 2RGVA 2PN6A 1SFEA 4HAMA 2NNNA 5KBFA 2Q2EA 2NS0A 1ZLJA 4XSXF 1J3RA 4J1WA 2IXIA 3QPHA 2EFPA 2E1CA 4B09A 1TW3A 3HRSA 4RD7A 1J5YA 1YLFA 5KVRA 2A61A 1CX4A 2ZJ2A 4G7OF 1B4AA 2X0LA 3D0SA 5FLJA 4CXFA 4RAZA 1GHCA 1R36A 4XRFA 3O2PE 5ICGA 3WE2A 2ISZA 2A69F 4EJOA 4HN0A 4XETA 1ZH5A 4MX3A 2ISYA 3KZYA 4EVIA 2Y0MA 1WWXA 5J7MA 2FF4A 1QQIA 3CUQB 3KZZA 4NQWA 1CF7B 1RC6A 5KHKA 5J8FA 3CTAA 2IPQX 3ZMZA 2FOKA 3QU6A 4ZH4F 1J58A 4RB2C 3HRTA 1ZRDA 4P9UA 4G7HF 1XDUA 3H92A 1D5VA 4M9SA 5BXXA 1NYWA 1KU2A 3GFJA 3RNSA 4IRIA 2PEXA 1SEFA 1S7OA 4LUMA 1OPCA 5I0TA 2B5HA 3UKVA 3BPVA 3TDUC 3U2RA 3H9AA 2RC4A 1FP1D 4I7HA 2F5DA 3IHUA 1WLTA 2OZJA 2O8XA 5KHIA 2RQPA 2QQBA 3BALA 4YFKF 2A5YB 1J1LA 2H94A 2GA2A 1WA4A 2HKXA 4WXDA 1T6SA 2YX7A 4L0YB 3CLPA 2XIGA 5BMZA 2V79A 5BOXA 1LDDA 2VN2A 4HF0A 1USTA 2PFWA 2Q30A 4GXOA 1OYIA 4XFGA 2Y75A 2HR3A 3CJXA 3NW4A 4F7ZA 4D7TA 4KIBA 3WGGA 3IRQA 1Q1HA 3I0TA 2EWNA 4B8XA 2KJBA 3AAFA 2ADUA 2CO5A 1X3UA 3ES1A 3LAPA 2FXAA 3PLQA 1IRFA 4U7DA 3CUQA 2V09A 1G3YA 2FNPA 1EPZA 4LEJA 1BI2A 1ZNPA 1OYYA 4QWQA 3H8UA 4OINF 2IA0A 4PIXA 1J9IA 1SFNA 1IXSB 1KQ9A 3KLNA 3F3XA 1HW1A 1D8KA 4LUKA 5JFRA 4HOBA 3B73A 2HZTA 4IETA 3F8MA 3KCCA 4IEVA 5AONA 2ZMEA 1CAXB 5J48A 5CVRA 4EJUA 4EV0A 1UPIA 4MTDA 4WWCA 2MNGA 3GFIA 2I45A 2DLLA 3IKVA 1OI6A 4PIZA 3WW4A 4LLGF 2DT5A 1QXRA 2FRHA 2DU9A 2MBFA 2EV6A 3V7CA 3H1YA 1EH8A 3QACA 3FF5A 1X7NA 4LG0B 4GGGA 2FA5A 1G3TA 3SZPA 1BI0A 4R1HA 1REPC 1Z91A 3GZ5A 3E5XA 4KIGA 1JXSA 1U5TB 1ZN2A 3LSTA 4JK1X 2MLKA 5BV6A 1R5HA 4A12A 4ORFA 2XVCA 1E2XA 2E7XA 3F8BA 3DPTA 4KWKA 4PGHA 1B9NA 1GVJA 3COAC 2FQPA 2DK8A 3HTSB 3FMQA 3PQKA 2PFBA 3SZTA 2HQRA 2PBIA 3BCWA 5L3FA 2W85A 2CFXA 3HRUA 1DGWA 4YYOA 3FXUA 1FSEA 5I8SA 5DCMB 3F6VA 4MHGA 5CADA 4L2NA 4UV8A 3OTFA 2VODA 1YTYA 4XF0A 2RVCA 1TNTA 4O6JA 2GA1A 1IF1A 1JE8A 5D5XB 4UVAA 3T8TA 2V1UA 4EM1A 3U1DA 3WTYC 3J81K 2QUFA 1E17A 3GYHX 1FBUA 2GQQA 2PTMA 2PLYA 3GFMA 3OCPA 2JT1A 4HW0A 2WWYA 5LGTA 1XN7A 2LNBA 4NHJA 4L5IA 3R60A 1IN8A 1D3YA 2ZFWA 5FLXZ 4XFCA 3PQJA 3JSOA 2OZ6A 5AIPA 3OV8A 2EA2A 3L9FA 1K79A 2Y0OA 2Z2SB 1J75A 5HI0A 3MWMA 1IXCA 2EV0A 3JAMZ 3J80Z 3T5XA 3WTSC 1ZX5A 2IXLA 4I09A 4AQ6A 4F8AA 4Q0UA 1CAWA 1J7KA 3K0LA 2HJIA 1FC3A 3KP2A 1HW2A 1J3QA 3KFWX 2YX4A 2UY9A 3F72A 4R52A 4P96A 4PZJA 5F6FA 4HBNA 5DUIA 1KYWA 4AQ2A 5ICFA 3R4KA 4HYEA 4D0PA 3JTGA 1IUYA 3W6KB 1HKQA 2ATFA 1PDNC 2VONA 2ZKLA 2XKOA 3ETQA 3JAMK 4FX4A 2QBYA 1QXJA 4ZYHA 4KUMA 3KEOA 1ZGAA 1FY7A 2P7VB 4EWAA 4O9GA 1SAXA 4HF1A 1SMYF 3ECHA 4Q5SF 2UXXA 1FX7A 3V7SA 2D5HA 3DV8A 1Y3TA 1IN7A 1SD6A 1OFNA 1VJ2A 4Q0SA 2KIFA 4IHSA 3SXWA 3VODA 5E16A 4HV5A 2IVMA 3NL1A 1KA8A 3RYKA 2QCSB 5CU1A 3E6DA 5KK1A 3QPTA 4ASNA 1FSHA 2XL7A 4HQEA 3KP4A 2R7FA 1HKTA 5DD4A 3KSCA 4MUVA 4ON0A 4UBHA 3WGIA 1AWCA 2QZ8A 3JSPA 2G7UA 4GCVA 2ET1A 1QWRA 3FXQA 3T8RA 1LRHA 4HX4A 4RB0A 4A0YA 4L9JA 5ILVA 3MFKA 3K1NA 4JVAA 3MEXA 2XASA 3L2HA 1S3JA 4P55A 1BC7C 2GAUA 5E8IA 1CGPA 1YFUA 1F9NA 4IEYA 5I8YA 2GC2A 3S7EA 5ERIA 1V4RA 3BJ6A 3L7WA 3J80K 1W5TA 2EV5A 1AOYA 2ZXJA 1RL3A 2PHLA 3DFGA 1BM9A 4YIIA 3U9GA 3RZZA 3HTUA 5DD8A 3R0JA 4AVBA 4ZZDA 3C18A 4LFUA 4ENMA 1MKMA 4HLXA 3IIAA 1WKMA 1W7PA 2DK5A 1MZBA 1BIBA 3HQXA 3ECOA 3F21A 2UYBA 1FP2A 1QY4A 1JHFA 4A5NA 3MPBA 3TOBA 2VOPA 4AIJA 3TO6A 5LRSA 2PHDA 4I01A 2BNNA 4XFHA 4KN7X 3BPZA 3IDCB 3I58A 5HS7A 2QJVA 4N9IA 1U5TC 2ZKZA 5FQ0A 1UB9A 1GXQA 1ODDA 1WSUA 2H6CA 4WK8F 3LQRA 3G3ZA 5H6QA 4AIKA 3GW2A 3HSFA 3T1BA 1DZRA 1YYVA 1SD7A 5FLIA 2G9WA 4U0WA 4BHCA 3EQEA 3IDBB 3N97A 5KHJA 3FZ3A 1FYLA 1MD0A 4M9XA 1W7PB 1DPRA 5DCFA 2GXBA 3V4GA 4FAGA 4HDUA 4IERA 1F4KA 2DQLA 4QLCU 4NVPA 4ESJA 1S6LA 3MZHA 1LVAA 2QVSB 2D5FA 4QX5A 4BQAA 3ZMDA 4R79A 5CYVA 2QBYB 2PMHA 1Y9QA 2VT3A 1TQIA 3EO6A 1KU3A 2QWWA 3TNQA 1MDMB 2H27A 4HVQA 1BBYA 1T98A 1YFHA 1ZRFA 3QU3A 3CLOA 1DZTA 5LRRA 2P5KA 5J3UA 4UXNA 4QGLA 2G7HA 1CAVB 2FNAA 1ZZ8A 2HGCA 1R00A 4MQ9F 4N0BA 4Q29A 4O5VA 4G8XA 1YW8A 1FYKA 3FE5A 4RAYA 1WI9A 3BOQA 2XAGA 1O5UA 2RNJA 4U7BA 1YS6A 1K7AA 1NXMA 4XF4A 5LGNA 2OPKA 2GH2A 1IN4A 3LA3A 1RGSA 4Q47A 3LWFA 4HZFA 1YFWA 1GQHA 4S04A 2ZO4A 1X8EA 2CQKA 1HQCA 4ESFA 2HOEA 4ZZLA 3GYDA 1HBXG 4S05A 1ULYA 5LHHA 2ETEA 2ESHA 4Q0QA 2PAKA 1RNLA 2L01A 3FX3A 1NHAA 3RKYA 3OOPA 3VHRA 4OIOF 4L18B 2VECA 3I54A 1J3PA 5FO5A 5DV5A
chains in the Genus database with same CATH superfamily
3DKQA 3N7LA 1MZ6A 2EIEA 2A6TA 1U5IA 2EICA 3I2IA 4PI2A 2HNHA 1HIXA 2RVAA 3WR0A 4OUSA 2GZWA 1OISA 5JOYA 4XYXA 3VDDC 2J1TA 3ZYIB 3TOJA 2UU8A 2PA7A 2STWA 2XAUA 4HG2A 3OD0A 4HG6B 4QD2A 4BPZA 2GM4A 1YRNA 5E20A 3ZXJA 3S57A 4U36A 1BBT2 2L0KA 4UW3A 4COVA 2DVAA 3SFZA 5FRMA 4B48A 1CZVA 4LULA 2E1NA 4Q5OA 1T0FA 1AVBA 1PP7U 2XQRA 2EA4A 2H0VA 2K9SA 4LHSA 2RS31 2DFIA 3WD5A 5A7SA 4HDVA 2XLAA 2VJ5A 2Z42A 4F3QA 1IHMA 1ZBA3 4L9TA 3OF1A 2JA2A 3TN93 1ENQA 5D5VB 2DFCA 4Y26A 2Y8KA 2PN5A 2QENA 2FQ3A 5LBEA 2GN7A 3CDLA 4KNCA 4ES8A 3CO7C 4C3HJ 1QQP3 3TGNA 5HDKA 1A31A 3WU2C 1LFBA 3H9GA 4CP0A 3VBOA 5HCBA 5IPAA 3VDBA 1IV8A 2LF7A 2C4XA 4E8CA 2ZBJA 4WM7A 4GFBA 3BR3A 4CA0A 1YW7A 4META 4Y22B 3GF2A 1ZR2A 3JBG3 3VBOB 1A3KA 3WDYA 1SLCA 2WA4A 1H8TB 3EDPA 4QM9A 4NAMA 1WJFA 4E7ZA 4JTOA 2YU1A 4QIWN 4JDMA 4A7YA 2X1EA 3RPUD 1JOBA 1HQLA 4GULA 1YLLA 4NE9A 4Y22A 4LHNA 2P5LC 3AL0B 3F8NA 2DDAA 2GXGA 4OHYA 4HA8A 3I71A 1G4DA 1NX9A 1ZYRF 2DDBA 1U8RA 4B29A 2Y2ZA 4QAWA 5M3FJ 4IGOA 3GCXA 4A0ZA 3ON7A 1US2A 2VBWA 4XIOA 5L36A 1QPMA 1SVLA 5C7GA 3HOXJ 1VBD2 4EWDA 2A70A 1MQTA 5LW9A 2H6BA 1JHHA 4V1PA 3M1CA 3ZMVA 1ZR4A 1ZRCA 1SCSA 1QJU2 2R0FA 2XL9A 1T8IA 5KXDA 2XRLA 1HCRA 3LWCA 5FYBA 4HBLA 1RJ7A 1JUIA 3TEZA 4DRRA 2YFUA 1S0FA 5M3MJ 3ONQA 1RIRA 2IRFG 5CLSA 3OYKA 2F17A 5LHIA 1FPN1 2ACJA 2QQMA 3R05A 2ZOEB 1SFOJ 3BTYA 5D6EA 4ASKA 2C6SA 3H42B 1DQ1A 5LEKA 1N77A 2IXJA 1UIJA 4LO4B 4V2FA 4BEHA 2V72A 2Y38A 2BNMA 1A36A 4MQVA 1G9BA 4KH9A 2JA6J 4LJZF 4H0EA 2XJVA 4KIFA 4QXKA 1QH6A 2QVOA 2LRPA 1PUFB 3LD8A 2EJRA 1UY4A 2AHQA 2AZ5A 4IHYA 5DS9A 5HLIA 4GWMA 1VBA2 4DEVA 2EFQA 4IE7A 2O8QA 5GLVA 1Y8QB 4MGIE 2LYCA 5A3MA 1W8OA 2UY8A 2L9VA 4AFBA 1R1A2 5FK7A 3ECQA 2WQZC 2OIIA 5IYCJ 4UF0A 2L7ZA 2FDIA 2LSOA 3PUAA 3TMOA 2P6SA 1WI3A 5EWSA 4EATA 3OYFA 5CFCA 2VE1A 5D6FA 2BQPA 4HK8A 3CNAA 2WNVC 1S0CA 4FCYA 4BJ5C 2K02A 1NG6A 4LB5A 2DBBA 3WW2A 3CJNA 3SITA 2HZDA 3WY6A 3E7LA 3K3OA 1CAUA 3MZYA 3BU0A 5KAIC 2N8GA 1ZGWA 2V26A 3LSMA 4LOSA 4QPGA 2VOOA 2WAOA 5T5JA 4EJRA 3IH2A 2VCBA 4ZPIA 4OULA 2D1VA 3H7YA 2HBUA 2C26A 5DAQA 5LA9A 2D6MA 3HN1A 2FE3A 4CICA 2LVSA 2FBIA 5JSPA 3BROA 5JAXA 4MFDA 1EV7A 2L02A 4OHVA 3VD3A 4F92B 3QRFF 4OMZA 4BHBA 4G9YA 1E3OC 5F5IA 1P9QC 2P6HA 2VZUA 1YWKA 5M5WJ 1AR73 1AR61 4LKFA 3TEWA 5F5AA 4CXWA 2WNVB 2A6EF 2ADEA 2VY0A 1VR3A 1FWZA 1STZA 4XONA 5F5CA 5FY1A 4NAOA 9ANTA 2X53S 1BC8C 1KEXA 1K78A 4XF9A 1X33A 3MEPA 4P9YA 1W6PB 3R4SA 3MKLA 2ORXA 1MVEA 5EGOB 3I3DA 2XAQA 5FZAA 2BJSA 3HG9A 2WFF1 5C8WA 5A3OA 2CDPA 1LOAA 3VBRC 4V2GA 3ACIA 3JZVA 5K5QA 2IT0A 2BERA 3N9PA 4FQGA 5FZMA 3K46A 3JBG1 2XGXA 2HWD3 4XOPA 2P4WA 4AXOA 3AZWA 1TMF3 2D45A 1FJLA 4ITCA 1XC5A 2P17A 3MW2A 1KITA 4RS5B 1HKDA 1UIKA 1RI7A 3HT1A 4HLTA 1Y1WJ 2XDVA 1CR7A 3DF8A 4HOOA 3S7IA 1G8WA 1R1A3 3LOBA 1EV13 1SANA 5FYIA 5H9QA 3S2WA 2OJED 5FROA 2OKXA 4FO9A 4ZU7A 1MDMA 2O8KA 3AG4H 1NZCA 2VXRA 2D98A 2IVIB 2XWBB 1CZSA 2M30A 3RRDA 3K70C 1T33A 3E0JB 1YQ8A 4KDPA 3PU3A 2E5ZA 1AR91 2FD5A 1YIPA 1HC8A 4OQ9A 4EQQA 3VYSB 4DS0A 3GXOA 1S7AA 5A3NA 4M73A 4KU7A 4LMYA 4RA0A 4A2UA 2BVVA 3FXKA 1BOAA 2LREA 1OOPB 1ENSA 2JN6A 5J3LA 2BZTA 4C2TA 1UG0A 1VQLI 4D9JA 1WUVA 1HXS3 4EROA 4IRHA 3VDXA 4E2GA 1SC7A 3IUOA 4LG0A 3VDDA 2DJNA 2O3FA 4XXPA 1AYM3 3DUIA 1Z7LA 2IA2A 2Q8CA 4XR6A 2CU7A 2B9SA 1OLRA 3ALQA 2RQQA 3EJKA 4Y7NJ 4W8JA 3AX4A 2HYFA 3LDKA 5CFDA 3IMMA 4U0VA 4BCUA 2B0LA 1QJU3 1XSVA 1P4AA 3L2CA 2OQ7A 4BHPA 3VGIA 3RVHA 3ILFA 5JOZA 2CQQA 3JRAA 1YEWA 3O5SA 2R7EB 4P9WA 1IO2A 2E5NA 3M7GA 3VBOC 1TTYA 5JVVA 3I2GA 1T39A 2E51A 1TG7A 1VMHA 4BXXJ 1QA6A 1ZZ7A 3LEIA 2PMWB 2DTZA 2XSDC 2PHUA 3S3MA 3OYWA 3JU9A 1V9U3 4QGMA 4YFXF 1EKEA 1D8JA 2JK3A 4FQZA 2K27A 4E4ZA 3MGUA 5IT3A 4AVTA 1BW5A 1XDSA 2AXLA 4CUCA 4DY5A 3MIDA 3GZ6A 5E3OA 3Q8FA 3PIGA 1JGGA 3ZXLA 3ML6A 2KIQA 1RYYA 5JZGB 1YYNA 3JXSA 4L5EA 1TW2A 3S5QA 1EUTA 5CQEA 3ZN6A 5I0RA 1HJGA 1XG1A 4IXAA 4L9NA 4R8HA 5DUWA 4UY8I 3GTKJ 2E53A 1WBFA 2DU1A 1QVTA 4MIMA 2K3PA 4URTA 1Y0NA 3LL7A 1RUG1 4CGZA 5CVIA 3JB8A 3HBKA 4CDWC 4M3BA 1F31A 5FYZA 2Z33A 5E88A 1R1ZA 1ULFA 3VKOA 1FPN2 3S32A 4D6SA 3A02A 5FZ9A 3ASIA 1UY1A 1HXS2 2CWSA 4BQXA 1VI0A 2KIMA 4IL7A 3A01A 5K8SA 5J09A 2ZSIB 1Z21A 1PVC2 4LKDA 5JZGC 3FLTA 4M3CE 2V9VA 3M3IA 4HPKB 4E70A 3HOUJ 2CW7A 5KR7A 1JZ8A 4JV4A 4XRSA 4BK4A 3J7YJ 3EUKL 3LKJA 1C8M1 5GTIC 2CV6A 3O3KA 4L0ZB 4Y5Z0 2M0MA 4Q4Y3 2KR2A 4AIHA 4CXXA 1UY3A 1SAUA 1ON2A 3WW3A 4A4AA 3LFMA 5FMDA 5LASA 2V5DA 1J2XA 1X19A 1H1AA 2Q1MA 3GLXA 4CUBA 2EFWA 4DXZA 3CP2A 4NPMA 3KP5A 2JWPA 4JDOA 3H1CA 2FU4A 1LESA 2BRTA 3EBRA 2A1XA 4BLJA 2GWRA 3CO6C 3FL7A 5CFDC 2QCOA 2CUZA 3RG0A 4I3PA 5A6YA 2IS6A 5ILUA 3I3LA 4ZXEA 5LATA 2NQYA 3FUQA 1BJQA 5KC5A 1VBD1 3FZVA 2Z99A 3NNFA 3RFRA 5L7OB 1ZBA1 1FZPB 5EF6A 4ARYA 3OSGA 3H0GJ 4CEWC 3CC2I 3BCAA 4RDUA 3H9QA 5FR3A 1OA4A 1XNTA 1K42A 1XD7A 1FI2A 2HWB3 2RG4A 4BQ4A 4LA2A 4QSHA 5CFCC 1ODNA 1Q8PA 2Q8DA 2Q8KA 5EG0A 3FISA 3H3LA 3JB4C 2DFHA 2MEV1 3H3VK 2EIGA 2HDDA 5GZCA 3FKIJ 4AI9A 3VYUB 1OBNA 3PJRA 3AK0A 3DPRA 2BZDA 3IAS2 2MPFA 3BB6A 1UL9A 2RS12 4A3JJ 4QPGC 5FMCA 3IWZA 2MEV2 4IEJA 2KA3A 3KF5A 2DCYA 3S3OA 2J42A 4OAYA 2PQQA 3T2QA 2KRCA 2ZEWA 4GAZA 4JGZC 4OLLA 4EQVA 2B8MA 1VBC2 3I3QA 5C4WA 3Q5FA 5TRDA 1S1AA 4N9HA 2EIDA 1CPNA 1AR62 3PVBB 5GALA 1OCTC 1SBDA 1C5HA 1X2NA 2VR4A 2M4KA 2P4EA 4PJLA 4MGRA 1C4RA 2Y0IA 3CU7A 5AFEA 1ONAA 4JKMA 2J5OA 3DLLF 3PIOF 2P3YA 2WO7A 2W48A 5F08A 2W1UA 2P8TA 5JSRA 4HSJA 3DBRB 5ABJA 1WFXA 4QPOA 1AYN2 1CAVA 3T0DA 1YJLA 2JDAA 2VT2A 1S2EA 4EGYA 1UHSA 2FBEA 2W46A 4XBLA 4I0AA 2OW4A 3T2OA 2ZSHB 2O0YA 3LSHA 3ZP5A 2JVHA 1YO8A 4DOZA 5EV7A 2W7NA 3CJTB 4PDKA 5KHGA 3HPNA 3T3YA 3ZXEA 4RHV1 1PO13 4NHXA 1X82A 1OCPA 2WADA 3CJIA 2Y69H 4P08A 3ZQHA 2L4AA 3N7JA 4XURA 2QQAA 1GZWA 3NKTA 3WP6A 3WUCA 3M4OJ 3C7EA 5T52A 5HV4A 1SZBA 4D6RA 1FOD1 3H1WA 4RS8A 5A70A 2YU3A 4AWXB 1O7FA 1OFCX 1R23A 1GP6A 4FPCA 2VQTA 4PLMA 3O6BB 2KT0A 3Q9SA 2MC4A 4XC9A 5EP9A 1KU9A 4QPGB 1YI2I 2J22A 1Y0UA 1AR71 4UUVA 2RM22 3RZHA 4G7ZF 1I5ZA 4KI5M 3SH4A 2V6EA 4NHKA 1C0WA 1TLHB 4C0HA 4YARA 1CAXA 2YG0A 4NN0A 2DOEA 5CJ9A 4EJTA 4NC8A 5C4WB 4EWEA 3QPLA 3RZDJ 1DGLA 4OOIA 3AP5A 3NNJA 1MIJA 4FETA 1UXXX 5KXCA 4XEZA 3OYHA 3IIIA 2QLZA 3WODF 5J96B 4MOAA 2FEZA 2B39A 5FY8A 2VAUA 2NRAC 3K3NA 1D4M3 5IYDJ 4IEXA 4IQPA 2WWUA 2VVEA 2WDBA 4A3MJ 1C5IA 4LORA 5BNNB 2P2KA 4I30A 1JU3A 5C5UA 2VXJA 1W28A 1LE8B 1CWPA 2VG9A 3G7DA 3LFKA 5LGUA 2BXZA 3PO3J 3GJAA 2DTRA 3BC8A 4L5JA 2W24A 3TL4X 5HLGA 3VBUC 4C1WA 1RHI1 2WT2A 2CFOA 1WW5A 1QJU1 2WSUA 1H1MA 3KT4A 3D6EA 3W5MA 1AX0A 2P3KA 4TWTA 1CF7A 3PURA 1BJAA 2M3AA 4JGZB 5EQUA 1PNGA 4QKBA 1H2MA 2Y6GA 4UFKA 1WHUA 3EUHA 4CDQB 4MEYF 3Q9VA 4RFT0 3BR1A 2A68F 3ZSMA 3DP7A 1RUOA 2VBZA 2PXJA 4ZU5A 3WQ0A 2Y0SN 3H3UA 3POWA 3CESA 1Z6TA 5A6XA 4BIFA 4HSRA 5E89A 3ILNA 4DYRA 4XAEA 2DOAA 1X3ZB 1UU4A 2RS11 1W9WA 4XMYA 3QYFA 5FXVA 3RIRA 1NAEA 3PVOA 2VQAA 2HDCA 4L97A 2LKSA 2NLRA 2DA5A 3RPQA 4E4SA 4GD4A 3UKNA 4WBBA 1NQDA 2MW8A 1S5LC 3ME2A 5DUKA 3GCWA 3J8F3 4KMQA 3N9OA 1VBD3 2R16A 1COV2 2FCTA 2CYYA 4XN3A 3AG2H 1IRGA 5ICEA 4BB3A 5CZKA 3QQAA 4E2QA 4ZYGA 3WNPA 3KETA 1IS5A 2FCUA 3ZMUA 1LOEA 3ZOIA 2A05A 1HN0A 5CPRB 4CO8A 1L7QA 4X8NA 3NAPB 3BODA 4NIGA 5JI6A 1G3WA 3ZYRA 2HVRA 5GAEJ 4EM2A 1H9TA 1YFYA 3I59B 5F8PA 3KPHA 2FJ1A 1QPIA 1KGSA 2RKHA 2QDRA 3U0ZA 3IWFA 3ZR8X 5FYHA 4XJ8A 1JGSA 2WC2A 3RZJA 1POGA 4NQWB 3HHGA 4WVMA 2R071 1MZEA 1OVPA 3KEYA 1UAIA 1ASJ1 2JDNA 2RV9A 4HAMA 2BY0A 2R0HA 1QOSA 2V9PA 5IK7A 3HPGA 3KF3A 1ZLJA 2R063 3CMGA 1CD3G 3M4FA 2ZHLA 1AKHA 4CDQC 1UNBA 2H8WA 2IXIA 4R4XA 4RL7A 4CSWA 3ZFFA 1ZYBA 1W8UA 2J1RA 4B09A 3BKZA 1J5YA 1W05A 4GRIA 1DGWY 2VW2A 2ZJ2A 1B4AA 2X0LA 3D0SA 5FLJA 4CXFA 3UR3C 1GHCA 1R36A 4XRFA 3O2PE 2C9AA 2ERFA 3N3HA 2XPWA 2ISYA 1IKQA 4B3NA 5JXGA 3ZKUA 4YM2A 3OBRA 4AU7A 2XJSA 1NA1B 4AAXA 3ZN4A 2Y0MA 3MLKA 2FF4A 1QQIA 4NQWA 2O8OA 1RC6A 1ETKA 5J8FA 1H0BA 4D7NA 4AYBN 1EV11 4PCRA 2FOKA 3QU6A 5ERLA 4LBQA 2Y9ZA 3OEBA 1J58A 2NOGA 2O7OA 3CJRB 3PVEA 4M3FA 3H92A 3A22A 1D5VA 4M9SA 2LW8A 3GFJA 1MZ5A 1SEFA 3POFA 1MW7A 1KJLA 3E1F1 5K9YA 4DZJA 3TDUC 4I7HA 2VZOA 2F5DA 5KHIA 2W4SA 4BXFA 2HYJA 4C30A 3UETA 2GA2A 1WA4A 2Y6LA 5DPNA 1POV3 1T6SA 1PGW1 3HNMA 4OAZA 4DZPA 1QHDA 4Y20B 5HCHA 4MFEA 1GDTA 2GLOA 1FV3A 4GXOA 1LHNA 2VTFA 4JGYC 4NC6A 3CCMI 1AJKA 4A41A 2VOVA 3NW4A 1QZEA 3P6BA 4WVMB 1Q1HA 4B8XA 2VOXA 3AAFA 2CO5A 4AYUA 1SDWA 2A5WA 4TZDA 2KHMA 3PLQA 4N7UA 4U7DA 4UFJA 4NOTA 2QA4I 1W39A 1NH3A 4B1LA 5LCWL 2BWAA 1MEC1 1PVEA 2XF6A 3H8UA 5D8AC 4NRPA 2E1MC 2IA0A 1O4XA 2FDHA 5AC93 3WDVA 3GZAA 1SFNA 3FC0A 1KQ9A 3KLNA 2ZEXA 4GXLA 3VZNA 2YMZA 4MVTA 2MG4A 1NA1A 3WZ1A 3DXUA 2Y26A 2HEVF 4EV0A 4MTDA 1KS5A 4FTHA 1SG3A 3ASOH 2DLLA 4GJZA 4LO7A 2EXHA 2BW3A 1QXRA 4N43B 3CHXA 3H1YA 1W2OA 1EH8A 3FF5A 4LG0B 1HF0A 2DWRA 1MACA 1DIWA 3SZPA 3PJYA 1BI0A 4QQLA 2W1SA 3DXTA 3LSTA 2HI3A 1C8M3 4S2FA 4IE4A 4FTEA 4XJAA 2K5CA 4PJNA 1E2XA 2E7XA 1HDDC 3MICA 1RUD3 1GVJA 2DK8A 2PFBA 2CQXA 2G0EA 4E7JA 3SZTA 3JREA 3JCUC 3BCWA 5L3FA 2VVDA 1C3HA 2W85A 3HRUA 1DGWA 3HOBA 4A69C 2J1UA 2EXIA 3VD5A 2ZJQF 2XR4A 1YTYA 3MKYB 5C3EJ 4XF0A 1I3QJ 1N47A 1VFCA 4P9IA 3V0BA 4YM0A 3LPGA 4UVAA 4EM1A 1IRXA 1GV2A 1QJEA 4A3DJ 2RAEA 2XF7A 1MSEC 5DAXA 1UZ0A 1QHHD 4L5IA 4S2HA 3R60A 5B4XA 1D3YA 2PHFA 3DTKA 2GDFA 1MNEA 2QBXA 3OV8A 2Y0OA 3B6CA 4QQ2A 3ZQQA 3O8HA 3JAMZ 2R5ZB 3WV6A 2JG9C 3J80Z 2RMU3 1PK6A 2B7YA 1ZX5A 2IXLA 4L92A 2FOWA 4CU8A 3ZQLA 4UFHA 4INDA 4HANA 3CZJA 4QB2A 1CAWA 4B4QA 1W6PA 1WMEA 1J7KA 1XMXA 2HJIA 1FC3A 1HW2A 5HPOA 3HPHA 3KFWX 1J3QA 4EN8B 4AUXA 5F9TA 4R52A 1SACA 4UFIA 5F6FA 4AGGA 4HYEA 2ZEYA 5GM0A 2FDFA 1IUYA 4EN9B 2R5YA 3UJQA 5L9BA 1FEXA 2VONA 2H1LA 3VKLA 4CCEA 4W6YA 2XKOA 2VNGA 4FX4A 4ZYHA 1YNAA 2L5QA 3LIHA 2P7VB 1TVGA 3ECHA 4Q5SF 3MPPG 2D5HA 4PHZA 2WL1A 1Y3TA 4BLIA 4Q0SA 1XPWA 3MW3A 2KIFA 4J19A 3VODA 2HWF3 5E16A 3WNOA 1LE8A 3AFGA 3RYKA 1PGL1 1W0OA 1OLMA 3B9CA 5KK1A 2R4GA 1ND3C 5AVAA 3QPTA 3BZKA 3PNYA 1LOFA 3OBZA 4MUVA 3WGIA 3DTEA 4GCVA 2A71A 4YWAA 1YJWI 5A3UA 4K1YA 2DCEA 4RB0A 2CGOA 1Y7BA 3GLLA 4L9JA 1R082 2WV1A 3MFKA 3ZYHA 1O6UA 3K1NA 4JVAA 1RMU3 1QDCA 5F5QA 3WG4A 1JT6A 3MIGA 1BA5A 4XKBA 3VPRA 3HOYJ 1MMNA 1JYXA 2ID3A 1Y6IA 2WWSA 1N78A 1V4RA 3BJ6A 3L7WA 5A3TA 1BCXA 2PHLA 3DFGA 1BM9A 3U9GA 3IP4B 1WLDA 2OV7A 3HTUA 1WD4A 5FYUA 4CP9A 4RS5A 4P02B 4HLXA 1S2BA 1WKMA 3G1OA 3VKNA 1BIBA 2JIGA 3ECOA 1NT0A 1JKRC 4M4PA 5F3CA 2UYBA 4G6TB 1QY4A 3PMEA 2TNFA 3SISA 2BXYA 2EILH 1VF9A 3TOBA 1EAH2 4AQSA 3BG6A 3TO6A 1W90A 2W39A 2PHRA 1Z7S3 5TISC 3RZGA 2YYOA 4FTSA 3MF9A 1QJX3 3ORJA 5C70A 2QJVA 1Q56A 2ZKZA 3HKZA 3L2RA 1OD3A 4Q8LA 2COBA 4XQWA 2X6XA 1G8XA 1BMV2 3G3ZA 4QB1A 1W6MA 1MNMC 2X6WA 1GV9A 1YYVA 2ZGMA 2DXIA 1F8VA 1V5GA 3T0AA 2G9WA 4U0WA 3EQEA 1E57A 1W7PB 1DPRA 1ZTRA 2ECBA 5DAWA 2GXBA 2DCKA 4FAGA 3VD4A 2DQLA 3OGGA 4ESJA 3MZHA 3U78A 3AG1H 4R79A 1S0DA 5CYVA 3KD4A 1RXGA 5FUNA 1ITYA 2VT3A 3RZLA 2I8DA 2W9XA 5DAPA 4F91B 1OFSA 1ZRFA 3JRHA 2XGCA 3MW4A 3CLOA 4LIUA 4NBQA 2P5KA 5IVCA 2P34A 3OR1C 2ZACA 5FFOC 4UXNA 2OQ6A 1AR93 1M4WA 4I76A 4WVWA 3UGGA 1ZZ8A 4K21A 2HGCA 2JG8A 4XUPA 2HXOA 5CBLA 2L9NA 4MQ9F 1WCUA 2RR13 4AC0A 5A32B 4Q29A 2KISA 4O5VA 2VUMJ 1YW8A 3FE5A 4RAYA 1W9TA 5J98B 5AC92 2R061 3G6EI 2WBKA 2LLKA 1D4M1 2D6OX 4TTGA 2RNJA 4ZDLA 3P5JA 4LE4A 1NXMA 5FZLA 4UOJA 2GH2A 1IN4A 3LA3A 1FTZA 4BDYA 2BUKA 3WNNA 4RLQA 2XG3A 1AYM1 4HZFA 1IG0A 1GQHA 1TC3C 4UB6C 2LFBA 5T50A 4ESFA 5IVBA 2A6XA 2SLIA 1C57A 1U5ZA 1JZ3A 1IQAA 4RGGA 5GZDA 2ETEA 5BNNC 2BTVC 4Q0QA 5F6KA 2HPMA 2PAKA 1RNLA 1QJY3 4NRQA 5DZGA 5IJRA 3RKYA 4WM8A 3OOPA 5GLZA 5C3RA 1RUG3 5LA0A 4ISRA 4CP9B 4B1RA 4S2GA 1BLZA 1LAJA 3UT0A 1TME3 2OT7A 1VQ8I 5FLHA 2FZ2A 1HJFA 2R7DA 3ACGA 4EZHA 4XN0A 3GZUC 1Z67A 1H8AC 3LQQA 2VI6A 2BV4A 2KKOA 3HHHA 1OD5A 3VV1A 5B1AH 2ZJPF 4Q4V1 5D5WB 2ZMLA 2OUJA 1SFYA 3BGAA 3LIGA 4ZZ8A 1GNZA 5FO7B 4BWOA 3ZIWA 1JUMA 4YVSB 4DOUA 5AFBA 4XSZF 4A7KA 1WCQA 4H2AA 2EINH 4GMP3 1U6GA 3CCSI 4Z82A 1CIWA 1YI9A 4YZ2A 1VLNA 4RA2A 4LK1F 5CKMA 5B4NA 4WM7B 1H88C 3AM2A 2VPLA 2XB0X 1OSGA 1Z78A 5K0UC 4AEDB 4HPQA 1RIOH 2E7AA 1PO11 1JH5A 1EAH3 4FTBA 4CEYB 2DAOA 4IHTA 1HV0A 5FLMJ 3LCPA 1UO9A 3LDRA 4QXBA 5LBFA 1UU5A 3H50A 3RYPA 2KZGA 3HYIA 2W91A 1ASJ2 4X6QB 4XLCA 2HVSA 5L3EA 3S2HJ 1OH3A 5E1ZB 4MHUA 4E7LA 4Z6YA 4R9AA 1I1GA 1BZWA 1L3LA 3FXMA 4CDUB 4COWA 5CG9A 1H9GA 5FPZA 1V5EA 1LGNA 2BP6A 3Q8AA 3CEWA 3Q8CA 4Y13A 5EEGA 1LEDA 1V6NA 3R0AA 3VUOA 3WTTC 4CPBD 1U8BA 5A7OA 4YW3A 3K10A 2VC0A 3POSA 2ARXA 3OBAA 3POEA 5F7UA 1GXPA 1TEIA 3KZIC 3MKWB 5BY5A 1D2QA 2IGKA 4PCQA 3OYLA 1TWFJ 4M9ZA 1DGRA 2VZ1A 1O5LA 4Y24A 1LGBA 1JODA 2O14A 4K20A 5FXWA 2QTWB 2ZGQA 2OA2A 4BKXA 4YELA 2P7CB 2JDYA 5FGMA 4MXVA 2AEZA 3BDDA 4FHTA 1Z7UA 1DU6A 4FPFA 3NWSA 2XBO2 4E27A 4B4PA 3GHMA 4KWLA 1USSA 3OPTA 1W9FA 1SBEA 1D1CA 1ENXA 4K40A 2OQGA 4OU0A 5CEHA 2D3RA 2RS53 1OQEA 1S7EA 1WLCA 4OWRB 2I2SA 2X85A 1RUJ3 4YPJA 5A2QZ 2AS5F 3DU5A 1Y8RB 2VOTA 2DVDA 1BVP1 5CIRA 1SFXA 5BNPA 5AIQA 1POV0 2HFHA 4Z8BA 2R0QC 2FDJA 3D5LA 2VOWA 5FIXA 2R5ZA 1GANA 3P9CA 4H3WA 4Y5SA 1UF2C 2E1MB 1N3QA 3TW7A 2WZR1 2QDNA 3QAHA 4LE3A 4CE8A 1BW6A 2R7SA 2KP6A 2ZGPA 3TNPB 3J7NA 3VHPA 2D6NA 4LLLA 1X36A 5HV0A 4MZUA 3GZEA 1JMUB 1QZYA 4AHXA 4C90A 3SCGA 3K6GA 1LOBA 2VMEA 2BGOA 4MGKE 1TMF1 4CP2A 2XQXA 3CCLI 2R5YB 4KNYA 2FX0A 4BE0A 4NWVA 1JJ6C 2QE3A 3SDGA 2A6ZA 3WQBA 2CUFA 1UJ8A 2DQRA 2HWC3 4YZ4A 1D0YA 4FPJA 1XSRA 2L9RA 2LF8A 3M8FA 5F2SA 1CAWB 3CCJI 3MIFA 3PUIA 3I3MA 5FKKA 3M3EA 1MNDA 1Z7S2 1C1FA 1UXZA 5FFZA 1XQNA 5GPCA 2JPCA 2VMIA 4X6RB 3WP4A 3DEMA 1YG2A 4D5FA 1YIOA 2VZVA 1AXKA 4EZ4A 3C2BA 2LDUA 4UBGA 4BEHB 2HWE2 3OL3A 3WSOA 2QZ2A 4DXSA 4BY1J 4M0HA 2ZA9A 5C3QA 3GBGA 4GO1A 5EYRA 5FYYA 2ET7A 3WE3A 2ZZQA 2RDPA 2HOSA 2BPA2 1JS9A 3DL3A 4BM8A 4I99C 2EFNA 2K9ZA 2E7QA 3SEZA 4A42A 3K4LA 1DPUA 2L9LA 3PU8A 2QQIA 1U12A 1NCQB 2CTVA 3ETPA 3UGHA 4LBLA 4MLOA 2AENA 1A6QA 5L3DA 4PBOA 3UESA 1P6RA 4E7KA 3VBFB 1BR4A 3WTXC 2VBPA 3THPA 1PGL2 3KS7A 2EAAA 3WNMA 5DEQA 2BOJA 3ZYBA 4A6DA 4M72A 5C8CC 1DUXC 1LDKB 4IV1C 2RJLA 2QQJA 3VEPA 3R61A 4PGGA 4OI2A 3P9IA 4MGZE 4OIQF 2HWC2 5A1LA 3S1MJ 3WCRA 4N4NB 3WT3A 3WDWA 1PZ8A 3NJYA 5LEJA 1GOFA 2X48A 1N75A 1OMIA 1YX5A 1UY2A 4NPLA 1G6NA 3E5UA 2ZMEC 2DA3A 3P9KA 1WD3A 2XC7A 5FZOB 2GIVA 2O61A 4XL9A 5D4SA 5HDNA 2CY6A 5FO9B 2K0GA 3GTPJ 3K4NA 3UK9A 1VBC3 5EFUA 1DF0A 3AFKA 4NRMA 4P5YA 1WZXA 1F2NA 1SFUA 4OFGA 3ERED 2WUHA 1H9WA 5FD5A 1ON1A 3AL6A 4TLFA 3FHNA 4KMUX 1IZ1A 4PF5A 3FHAA 4DY3A 3CUOA 2XJRA 3IB3A 4ZDPA 3M3QA 1JTXA 3B01A 2GMMA 4XQDA 5JPMB 3GF6A 3WDUA 1CJPA 4KA4A 1VTNC 1JBCA 5JOXA 2KLOA 3N36A 2P81A 1RUJ2 4NPRA 4BA6A 3BQYA 3VBHB 2JA7J 2PQ8A 1OURA 1JZ4A 4D5CA 3EYPA 2QQPA 1ZG1A 4QHOA 2QQNA 4L9VA 3BJAA 2HWE1 1KQRA 4MV2A 2GXAA 4DUXA 5FFXA 2VCAA 1DU3D 3KP7A 1EH6A 3CIHA 2HDWA 2PMZA 1WQ2A 2BGCA 2VE8A 2DI3A 2K3FA 1XSXA 1YIFA 4Y20A 4FPHA 2ZXQA 1BK1A 4AHZA 4YIRX 1OT5A 4LBJA 3T1LA 4FPYA 2QQUA 4HVRA 3H0OA 2OS2A 3NJVA 2WINB 5L9RA 4IEOA 1OQYA 1RJ8A 1VQMI 4JKKA 3O1SA 3S17J 1L7RA 5FY7A 3CCVI 3NJZA 2HLEA 4QX3A 1KYZA 1KS4A 3ISPA 2GNDA 2WIIB 1UW8A 2X51A 3RQ0A 2RS51 5A7WA 4P9FA 4M01A 3BIWE 4PFOA 5FCCA 4G12A 3HBZA 3A23A 4AFDA 1TNSA 4CCOA 1VBA1 2IVJA 4W6WA 4IF4A 3OIQA 1HSTA 5HS8A 5DUVA 1UHMA 2VMHA 1VQ9I 4ZHNA 1V6LA 1BOBA 2A5ZA 3OMYA 3A0NA 2MYSA 4UW5A 2ES3A 1I5PA 4LXLA 4IV1A 4I0BA 1RKTA 2XRNA 1XOYA 1JYIA 3CO2A 4C9YA 1DYPA 1VBB2 1L3JA 4LB6B 5FAXA 1L0OC 2DYSH 4Q4W1 3HEIA 3LQCA 3CLQA 5J8CA 2BVBA 4WCGA 2HVQA 1D2SA 4IJAA 2DA4A 3FXLA 3TQNA 4H55A 1UG2A 1ZLKA 2IFRA 3OJBA 1RB8G 3TEXA 4O3MA 2XH6A 1FXZA 1ZM1A 1O8SA 3PNVA 3MV01 2HEWF 1HX6A 4NJ4A 3T09A 1PZ7A 1FIPA 5BNGA 3IL2A 1O4ZA 3GBFA 3BR6A 3POGA 1WLWA 1VPHA 2WV0A 1RETA 3T0YA 1NXD1 1IAWA 5FKNA 5DCMA 1TWAJ 4GIQA 2EFOA 3OGRA 3H5AA 5B66C 2R041 3ZMOA 1X58A 1W8NA 2H0BA 5FKBA 4NC7A 2W52A 5HS9A 4YVWA 4A45A 4G94A 4ENNA 2QKLB 1MMGA 2L4MA 1TME2 5T5LA 4IQJA 3CJIB 3HNBM 1LHUA 3CCQI 4QX2A 3ZMSA 1J59A 2DCTA 4W65A 3VBSB 2EB7A 4H7LA 5C4XJ 3NRVA 2WZEA 1ND3B 4IVNA 1Z3YA 4UV9A 4U0YA 3W2AA 1CESA 2ZABA 1QKQA 4CPBA 3RSNA 4BU2A 4GB31 1XRUA 3TO7A 5EYXA 2BBVA 3QP6A 4AW7A 2PHTA 5F39A 1FPQA 3KHCA 3ESWB 2N7GA 5IOZA 1LEAA 2IBDA 2EBIA 1F43A 5ACA1 2DPUA 2W82A 1LB2A 3VZLA 2E6VA 1YQCA 1OF4A 1O91A 4DUWA 2WS92 4QB6A 3JR9A 2DUQA 1CX1A 4EGZA 4FP2A 4BE1A 1W7PD 3NV1A 4AD9A 5EGOA 3ZPYA 4ZC3A 3HBLA 1Z1DA 4JX6A 1BI3A 2X5IC 3ELNA 5J4YA 3F23A 2VW0A 1MSFC 2WKKA 3WOGA 3AKRA 3TWIA 3UL2A 3CQOA 3AVSA 2MH2A 1O3TA 4Z92B 2OX0A 3KE2A 1WGPA 2ZXIA 1A04A 2MSYA 1SD4A 2OVUA 3ITQA 1PO12 2DT7B 2QGUA 2IA1A 5E3NA 2DA6A 2H09A 1PX3A 4CYDA 1GLNA 1QGPA 2R7RA 3THTA 2K46A 3IMNA 3LDBA 2M4GA 1XCBA 2JG8C 3LPFA 4XTPA 1X1BA 3JD71 2ZMKA 2A73B 2ZBKA 3ATGA 2K4BA 1QJFA 3S1NJ 2HQ5A 1HW5A 4A0XA 3N9NA 1MBGA 3J9SA 2HKOA 3G4SI 5HLHA 1VQNI 5FP4A 5K5RA 4YRVA 2VBXA 2L7FP 3E6MA 3GWZA 4DIQA 2G19A 2FBKA 2VLAA 2Q0OA 1GUIA 1Q43A 2MHFA 1GZWB 1UHWA 4QHBA 2D2WA 4KL1A 5BYNA 3F8FA 1S9HA 5E8AA 2Z5WA 5BQTA 2NVTJ 4FE7A 4XK4A 1SPPA 1ENRA 2X1DA 2D6LX 5JMOA 1DDLA 4BK5A 1TP4A 1V5FA 4BBRJ 1R1UA 5JPNB 2AYHA 4V2VA 1ZHFA 4NR1A 4AL9A 2AH2A 1UZWA 2FMYA 2CW0F 3NWTA 4B4RA 4FX0A 1SLIA 4IGQA 3HOZJ 4OMCA 3CJQB 4FPLA 4IKFA 3K7AJ 1T0FC 3U14A 5JR2A 4Q4Y1 1SLBA 1R092 1XGOA 2CQNA 3K48A 3O1VA 4FPEA 1FOD3 2ZMEB 4L8QA 1GQPA 4OI4A 1AYN3 4MNUA 4C2MJ 1DGRN 3M1EA 5CG8A 2R93J 1PX4A 3RWNA 2ZX1A 3K1MA 2RS52 3OSFA 2QSGX 3USUA 3C7HA 1IXRC 1JJ8C 1WJAA 1GVDA 5FYCA 3PUFA 4PLOA 3S16J 1RUI3 5F3IA 3VN4A 3EYIA 3VL9A 1YJ9I 1HRI2 1NQJA 4AI2A 2JTVA 2ZHKA 1D0ZA 3B5LB 4AEDC 4DXTA 3H1MA 4FI9A 3KV6A 4CH7A 4CU6A 1FNNA 2R043 4BQ1A 2B7EA 2MLGA 4SLIA 2L3DA 5APAA 3SH5A 5F1RA 2RM21 5HDGA 3SQNA 3THCA 3V8JA 5E1XA 1NZIA 3KGZA 3M3OA 1LKNA 1JN2P 3PUBA 1YJKA 3AMMA 1MGTA 5A1AA 2M5WA 2NP0A 3CF5F 3ACLA 3WQ7A 2MEV3 1BVVA 3GMEA 1MR5A 2WAAA 4CDUC 2A3YA 2PYTA 3PMSA 1G9DA 3DN7A 5FOJB 3LSGA 3H3ZA 2XKPA 5F0CA 2PAEA 4HT1T 2ARCA 4L11A 3BZCA 2VC9A 4BMEA 4W97A 5HODA 4UNOA 2SBAA 1RVF2 4CDXA 4R9CA 3FMRA 4XJZA 1X9TA 1R4MB 4BUPA 2DPDA 2RMU2 2VKDA 4CEYC 2NAZA 1ETQA 3CDIA 5KXEA 1CN1A 2JE7A 5FP7A 3A21A 5C9AB 3I4NJ 3BU7A 5FZ6A 4RLFA 2OBPA 4FBFA 2VUJA 1QHGA 3MIHA 2V9KA 3KQ4B 2XAFA 1B35A 4YNIA 2FSWA 1V55H 1T2XA 1UOBA 4DQ2A 5DG1A 4WZFA 4AVVA 3M8EA 3HGGA 1IN6A 4AGRA 2EAKA 4HL0A 1UQXA 2YY1A 2HEYF 1MJAA 1QOTA 1LU2A 4NDLA 2K9NA 4XKVA 4YIFA 3HUGA 3I3EA 4IUGA 3WF4A 5FY4A 2KXLA 4D6QA 4Y15A 3U10A 4RGKA 1EJ9A 3C3VA 1LTEA 4IEPA 3KP3A 3FFQA 1VRH1 2JG8B 5FBJA 5GLUA 4YW2A 2K9QA 5GZGA 3V8LA 2F4LA 2O1QA 1PZ9A 2V7FA 3T4HB 3F9KA 2K9LA 3DQVC 5ICCA 1NCRA 2HOTA 4U88A 1J0RA 4K8FA 2K2SA 1XYOA 4Z07A 5EZWA 4QX1A 2LRDA 5FY5A 1RUF1 1D5YA 3OPWA 1FOKA 4OHZA 1BYHA 5FKLA 4OHWA 3W20A 2MC3A 3HJRA 4DYQA 2DMTA 4FPKA 4NMIA 1VQ6I 1AA7A 2F5FA 1XS9A 3VL8A 3X2QH 5H9PA 2NZ9A 3O1PA 5HVQC 4D7YA 4L0PA 3C7FA 5KBFA 2Q2EA 2NS0A 1W9SA 3ZN6B 1Q8OA 1RITA 5J36A 2VD7A 4IE0A 4MGQA 3FMGA 4DZGA 1MMAA 4J1WA 2CNAA 4NHYA 3TBDA 2XSJC 2W94A 2FMDA 3M1HA 1NG0A 1E0EA 1TW3A 3DPUA 4PJMA 1UN1A 4XUOA 1H8TA 5KVRA 2A61A 1CX4A 3MHZA 3ZSEA 4G7OF 2EIBA 2YU2A 2EQRA 3K4DA 3C2UA 5ICGA 2VBBA 2VQCA 4HN0A 3OWTA 5FYMA 1ZH5A 1H9PA 2TCTA 3J7MA 1EUUA 1SMVA 2WFF2 4PF1A 2RE9A 4CCMA 3VDDB 1IDZA 3VZMA 5B2GB 4XUQA 2P6CA 3I2FA 3CTAA 2IPQX 2ZJRF 4RB2C 2LK2A 2YBSA 4PDWB 1OA2A 4MGSA 3UNPA 1ETWA 4C0BA 4P9UA 1VQ7I 3AG3H 1ZA7A 1OLTA 1S7OA 2M34A 3FK6A 1HA8A 2B5HA 4YGDA 3F0CA 3BPVA 2JWTA 3LSJA 1GMMA 4Q4X1 1WLTA 3IHUA 2JE8A 2O8XA 3FIWA 1RUD1 2RQPA 5A3WA 4ZONA 2IEKA 1RVF1 4YFKF 2A5YB 3S15J 2HKXA 4WXDA 5E6HA 3FBNB 4DUVA 3CLPA 3CC7I 2Y6HA 2XIGA 2VN2A 1FOXA 4R9BA 1B35C 2PFWA 3I2JA 4U87A 1B72B 2Y6JA 2WN2A 3WNXA 4LBNA 3LEGA 1R71A 5GLWA 4F7ZA 4D7TA 4M3DA 3IH4A 3B94A 1XYNA 1YITI 4AOCA 2XJPA 1IJWC 3MVPA 4XOTA 1F4AA 3P3PA 1D4M2 4LO6B 2Y9YA 2WWJA 4XCAA 1TMF2 3IV5A 1ND2C 4G3YC 3LAPA 3H8OA 1F35A 2FXAA 3BCBA 1R64A 4FP3A 3CUQA 2XXZA 1H6XA 2V09A 4W4ZA 3FKJA 2FD8A 4BZ4A 1Y9MA 1OYYA 2NN8A 3LFIA 1IS3A 3OYCA 4FOWA 3ERMA 3IH3A 2BGPA 3P5BA 2ZMNA 2IS4A 4HOBA 2G1MA 4WVVA 4F52A 3N35A 4IEVA 1PK6B 2VUAA 3NAPC 2ZMEA 1JKQC 4QX0A 5CVRA 1UU6A 1UPIA 2MNGA 4GMP0 3DECA 3GFIA 2I45A 3AMQA 1CPMA 3WF0A 3IKVA 1LPQA 3ENRA 5LK5A 4G9SB 2EV6A 5LBCA 1MZFA 3QACA 3ACHA 4GGGA 2CUJA 1IS6A 4R1HA 1Z91A 2WAFA 4KIGA 2EIJH 2Y33A 1RUH1 3I55I 2FDKA 3HWJA 4A12A 2XVCA 4IX7A 5C33A 5IT6A 3V56A 3S8PA 2YGMA 1SPPB 3DPTA 5DUUA 4PGHA 1B9NA 3OIOA 1E5RA 3HTSB 3PQKA 3JCIA 3AJZA 5GZEA 2PBIA 3AP6A 3OIPA 2WRAA 2DA2A 5CYYA 2CFXA 4YYOA 2CGNA 4QQPA 4UV8A 4D94A 3I8TA 5GKAC 2GA1A 1IF1A 1JOPA 1JE8A 3T8TA 3M3CA 1GP5A 3U1DA 4BJTA 2ZS6B 2XONA 3HOWJ 2GQQA 1JHJA 3OCPA 2E26A 1GZTA 1AZDA 4UF0B 2UWCA 1FTTA 1IN8A 5ANQA 3PQJA 1A6IA 1UX6A 2C1FA 2JDUA 1S0JA 4BGDA 5HI0A 1K83J 4DW6A 1MBFA 3JQWA 4IHWA 3MI8A 3RQ4A 4X6AJ 2LR8A 3WTSC 4IV3A 5K7FA 2ID6A 4JRAA 2VASA 4AYBA 2TEPA 3ZN5A 2Y34A 4QU1A 5CKTA 2VJJA 1G9CA 2DMNA 4IQ4A 3TYJA 3BVCA 1MQTC 3DKYA 2YROA 3H8XA 3K0LA 4B44A 2B42B 3KP2A 2M7AA 3UJOA 3X29B 3F72A 4B7KA 5GADJ 3OYMA 4HBNA 3W2WA 4ZYAA 5ICFA 2XJUA 2HWB2 3JTGA 1G9FA 3W6KB 3V65A 1PDNC 2J1VA 2JDHA 2X5IB 3HMYA 2VZSA 3AKTA 1RUI1 1TL8A 2QBYA 1JYVA 1REDA 3KEOA 2ARAA 1JTYA 1ZGAA 2XBO3 2A6YA 4EWAA 2E71A 1I3AA 1ODMA 4HF1A 3J7AY 1FX7A 3V7SA 3DV8A 1SD6A 2QQ8A 1DYKA 1OFNA 4BQ5A 4CDWA 2ZEZA 1O4YA 1QMJA 4HV5A 4XKCA 1RUI2 2NPIA 2QCSB 5FPLA 5CU1A 3E6DA 3W5NA 1NA1C 3VWBA 1K5MC 1ERDA 4ASNA 1FSHA 2XL7A 4HQEA 3KP4A 4NROA 1HKTA 4YVWB 5A32A 1U0AA 4N53B 5DD4A 4UBHA 2GNBA 2G7UA 1AL21 1VNDA 2CH0A 1D1BA 4A93J 4NIDA 3VBHA 2RDNA 1LRHA 3AKQA 4HX4A 4A0YA 5ILVA 4XE9A 3DYPA 3GHNA 2PELA 2R7ZJ 1JI8A 3ZMNA 1S3JA 3HAGA 2F4OB 5E8IA 1WBLA 4IEYA 5I8YA 5B1BH 2A6VA 2GC2A 4FVVA 3S7EA 3CMEI 4YW5A 1W5TA 4A3IJ 3KV5A 1ZK8A 1GICA 2ZXJA 2W1QA 4JHZA 4MG2A 5DM6F 4W50A 3RZZA 3R0JA 2LY1A 3BTCA 3C18A 4MO3M 4XHXA 4EN0A 1OCZH 3NAUA 5IFTA 2OPWA 4A3XA 1IS4A 4H14A 3HQXA 1HRV2 2VPRA 3VYTB 1D0HA 4A5NA 5JMCA 2VOPA 4AIJA 5FKOA 4ABZA 3PL8A 2LOOA 4E4DX 1W0NA 3GTLJ 2K40A 5LRSA 1F9KA 1IOAA 3NNLA 1RHI2 1PIV3 4KN7X 3SQOA 3JUUA 2HH9A 3I58A 1S0BA 1U5TC 5FQ0A 1ULEA 1UB9A 4TN7A 1ODDA 1WSUA 1A8DA 4OI0A 1VBB3 5LY2A 1DZRA 4UYBA 4Y5TA 2XHNA 4M3CF 3DGTA 3MO4A 4MHRA 1T08B 4BE3A 4CYCA 5KHJA 3FZ3A 4XOGA 2GOMA 5FZOA 4FQ4A 3G2BA 2BW8A 4MXWB 1NLRA 4HDUA 1E5SA 1PVC1 1X1PA 1F4KA 1VRH3 2X5IA 2QVSB 1WCKA 4QX5A 4BQAA 2XVGA 4WM7C 2QBYB 2PMHA 5FBZA 1Y9QA 2GOXB 3ZPOA 4KG0A 1TQIA 1P7JA 1BBYA 3QU3A 2GALA 4YVSA 5FO8B 5J3UA 3K75B 3PO2J 3AKSA 3DBLB 4QGLA 3ZYFA 2FNAA 1W5CC 1QJY2 2GN3A 2LY9A 4QQOA 1HB4A 3CMMA 1LU1A 4G8XA 5JHFA 3LOCA 1FYKA 1QJX1 4FFFA 1KFXL 4P14A 3KT7A 2PMZN 2ZJCA 4GJYA 4XF4A 3M2MA 1IPSA 2OPKA 1GWLA 1RGSA 1UZYA 4LBQB 1YCIA 1YFWA 4YZ5A 2R49A 2ZO4A 5CAZA 2CQKA 2WA0A 1HQCA 3C8XA 2AR6A 2HOEA 5IYBJ 2D97A 4TSVA 3D5OA 2G9ZA 3O1TA 5FJ8J 2XVKA 4S05A 5LHHA 1GWMA 2W2IA 1AX2A 3FX3A 1NHAA 4UB8C 3OYWB 3VHRA 4BOWA 3AYCA 4L18B 1LHVA 1MS4A 3NRUA 2VECA 1J3PA 5DV5A 2GSYA 4RHV2 4OI1A 2CV1A 5CVJA 4OIPF 5BNPC 4YFWA 5K7HA 1R6RA 2PMUA 1DYOA 4TLGA 1R1VA 2D93A 1KDMA 4CTEA 5FP3A 4KWUA 1EV12 2WSVA 4JTNA 4K2EA 2B45X 1K45A 3H8RA 1YQ6A 2GC3A 2ELHA 3I4PA 3I59A 3T08A 1BKZA 2AACA 1QOOA 1XB4A 2P0WA 2R1BA 3FHZA 4D3WA 4RQPB 2IWGB 1XB9A 5H9RA 1O8PA 3JBG2 3K2ZA 3OUHA 4WVZA 4ZTFA 1MS8A 1IZ3A 4COUA 3FXRA 3FLPA 3SYTA 5F37A 3NVCA 4OMYA 3VBSA 5FMBA 4DO0A 1YHQI 4AFAA 2VZQA 5FPXA 3AZYA 2UYAA 2HYKA 4BDVB 1OF3A 1HRV3 4Q0VA 4GB32 2E1OA 2XV4S 2QUOA 2OA4A 4PJYA 5FXXA 3VBUA 3JTHA 5LB6A 1ZZCA 1ZG3A 4Q1PA 1ZBA2 5DN2A 4A3CJ 2QNKA 3DEEA 2WO3A 3AC0A 5JR7B 4F83A 5C6CA 3RZKA 3F8CA 2FBHA 3WG1A 2YR2A 3IC7A 2BBAA 4AGVA 5BPIA 1UZVA 1EPWA 3MDPA 1D0XA 1MS1A 3E5QA 2IXKA 1K5MB 1O7LA 5IK4A 2ZNZA 3ZXSA 1W2TA 5EG0B 1MH3A 3BR0A 1LEBA 2QM3A 3SEQA 3NV3A 4N7IA 4CDXC 2OU2A 4Q26A 1NY71 2LH9A 4HN1A 1IW7F 1NLSA 5F3GA 3I4IA 5FREA 5LBBA 4LJHA 1VAMA 4M74A 5L7OA 2I5UA 4LHKA 3GFLA 1T56A 4XNFA 2VQ0A 4X1EA 2RR11 1RRJA 2VPVA 4ISQA 2WLQA 1KDKA 2E7TA 4YG6A 5L3CA 5IVVA 2B46X 4RQPC 5IT9K 4UW6A 1ZKGA 1LJ7A 2PQSA 3ZXFA 1WRJA 3N05A 1UKRA 4LIVA 3ABLH 1N3OA 2F4IA 2YPJA 5LWBA 3HOSA 3WU0A 5GLTA 3WHBA 2GC0A 2X9DA 4F93B 3RWKX 3MIEA 4QTRA 4Q4W2 2CRGA 1VBA3 3GDBA 4V2WA 2V1DA 4ZXKA 3BUCA 3AP4A 3OYNA 4UFLA 3PDQA 1RXFA 4XIKA 1H2LA 4QDSA 3BQZA 4RBOA 2CDOA 5JWPA 1GP4A 1K5MA 3I97A 4GWIA 1K6OA 2HS5A 5LY1A 2LKXA 5E79C 2W1OA 5KWRA 4KWJA 4ZYEA 1FMWA 5J40A 1KQ0A 1R9TJ 5FKCA 1EF4A 4HK9A 2C6YA 3U75A 3DKXA 3W58A 1AR72 4COYA 4QX8A 2GIZA 4QPQA 3ELKA 5BPDA 2YPDA 3E1SA 4O65A 1LGCA 3LGRA 1JXNA 2D40A 2VCCA 2NS8A 3PIJA 3IRRA 2PLV1 3OR2C 4P5OA 4XF1A 3WQ1A 5FXZA 1MH4A 1HQWA 1NE4A 1HKSA 2O0OA 5CISA 4XDPA 3D0JA 4JX0A 2RDRA 4A3BJ 5JCTA 2UURA 3GCMA 1R081 1RPWA 2IW5A 2E2IJ 2DW4A 4LBMA 1MJ9A 1P7IA 1RUC1 2XBO1 4LLNA 1NK3P 2DDUA 1WMDA 4Z2WA 5GAHJ 1U0JA 5FZ0A 1OOPC 4FPOB 5CNAA 4PQ9A 1OR7A 3URFA 1EAH1 3AYDA 5JVGF 3K4AA 1ETVA 1KXGA 3N9QA 2PAMA 3MBWA 4EMSA 2BVMA 4G4FA 4GA9A 1E5HA 4RFRB 5FMOL 2LROA 5FQ0B 2WJSA 2CG4A 1ETOA 4XJWA 3IPVB 3BT9A 4LT5A 2BHZA 2GNTA 5IY5H 1BHGA 3MUY1 1CONA 3E97A 4BY7J 1G9AA 2CSOA 2EVXA 1B6AA 1ZBE3 5ABJB 4XQ4A 1MMDA 4QDRA 2VMFA 4AVCA 4AEKA 3IPVA 4GB33 3RKXA 1AL22 1B35B 5ILSA 4F3JA 1F5TA 2LUWA 3V0AB 2VZTA 3HC7A 1QNWA 3S1QJ 1RMU2 2NNYA 3BTLA 2VM9A 3UNGC 3WG3A 4JKLA 3DPLC 3K4JA 4KITB 4HSLA 1J1TA 2J1EA 3MIBA 4LITA 3VBFA 1OXCA 4H4KC 4G6QA 3CUQC 5DZEA 4LK0F 3LSPA 3JD72 3ZQ7A 1W03A 1XPXA 3INAA 2W08A 2VQGA 3ZN0A 1AR81 1MS3A 2WTEA 1UYPA 2VMGA 3LB9A 2J1SA 4K7JA 4PLNA 4LLOA 1VMJA 2X4HA 4RAGA 5C9AA 3CD6I 3ZPLA 1W2NA 1TT0A 3I5UA 2X8KA 1LOCA 3LSRA 2EA7A 2PG4A 5DTDA 3LSDA 5I93A 2R6QA 3MV11 2L9SA 3WP5A 4XFBA 2XHKA 3K70D 3L2QA 1IG3A 2ZPXA 3LAGA 2GH8A 1V0AA 2R3SA 5ANNA 4FPGA 4EYUA 4M71A 4OIRF 1H4HA 3B02A 2Y6FA 3RI4A 4PQQA 3VYRB 5E18F 2G9FA 4Y1VA 3D3AA 3ASNH 2DURA 3IKTA 3RYRA 1PUEE 1S0GA 5JZGA 3SNMA 2FHRA 4RN5A 4CU7A 1SFKA 2ZGNA 5F0HA 1ZREA 3MLJA 5FRAA 2XPJA 3KGLA 5EZHA 3CCRI 5FJHA 4KN4X 3K9TA 1WW4A 1D7PM 4CCNA 4YGCA 3I4MJ 4ATFA 1P4XA 3ZXDA 3SCHA 5D4RA 1NCRB 2KRFA 2JRTA 1ASJ3 4AK3A 4AI0A 3ZX7A 4DNYA 5IVYA 2EF6A 2G9GA 1AR83 5LA2A 1K3IA 3RMYA 4BAYA 3ZFFB 1A8MA 4GH4B 5CA6A 5FPUA 1GV5A 4CUAA 2UWBA 1HLVA 1REEA 3RPUA 5K7PA 3MZ8A 2DYCA 3A1YA 4Y1XA 3NQHA 4HRIA 2F5EA 3CL1A 2R062 4UFMA 4PSXA 4HPKA 3TN92 3OYIA 4HV6A 1R22A 5D8AB 3LZZA 1JKPC 1ZZ6A 3WG9A 4A6EA 4KU8A 5CFDB 1NUKA 4B8EA 1M1EB 4IEQA 1RUH3 2DA7A 4RB1A 2DFFA 5FZEA 2AO9A 4FXKB 1SMTA 1AL0G 2WQ8A 3QP5A 2TUNA 3HQRA 2E9QA 5GTHC 4GWJA 3MUZ1 4H7MA 5F3EA 3SJMA 3LE0A 1PNFA 4P1WA 4D8MA 3CCUI 2A07F 4M6YA 3A4CA 4QKFA 3S6PA 1RUC2 2DT6A 4Y17A 5FZ4A 1SVOA 2OTLI 2E36A 3ZQGA 2M0CA 1T2KA 3PNTA 2IZWA 3N4MA 2DCZA 4YW1A 2K7LA 2K86A 2IAIA 4N8MA 1HRI1 1D4VB 1O57A 3ZR5A 1YOVB 1VBE3 2ESNA 2RHPA 4ZS2A 1POQA 3KM5A 4XTMA 5F64A 1V00A 4XFIA 3L09A 3ZM8A 2BE5F 1TWHJ 2OD5A 1NE6A 5L7OC 5FD6A 2RJKA 1JYTA 2ZZJA 3BTIA 4ET7A 1SBFA 4J00A 3AB0A 4HSTA 3SHFA 1JUSA 4QMAA 4IEZA 5KXBA 3VHOA 1IV6A 4MH0E 1IN5A 4RQPA 1W8WA 1YC61 2WFPA 2COMA 2HTJA 1RVF3 3DBHB 2KM2A 3CCEI 3T2PA 5HXVA 2BVLA 5I8TA 5J6XA 2D5VA 3V7RA 4Q4X2 4XBFA 2YC4A 4Q0PA 5D1IA 1OCCH 3EYYA 3SZGA 1P2FA 4PJ0C 2CV0A 1NY72 1VE0A 4AM3A 2FCVA 4LG3A 5KHHA 1S55A 2IUWA 2OXBA 4IESA 2JB8A 2R7VA 1FBQA 2NS7A 3ZYJB 1MS5A 4WX9A 1R4NB 3LA2A 4HEA2 3P3NA 3RS6A 1URXA 5FLXK 5C71A 1TZLA 3ZGKA 3MAJA 2WABA 1U2WA 3USSA 3M8JA 2XLFA 3WW1A 3AYAA 2H8RA 1DQ2A 4IDZA 2OQRA 3ABUA 4LD5A 3J81Z 1WJ5A 1OCOH 4JX5A 4HX7A 2M1BA 1H30A 3FK7A 1JU4A 1ACCA 3AMPA 2LBFA 5LD2C 2FUG2 3NQOA 3PSIA 3ULQB 4XQFA 4XABA 4D69A 1QIQA 2ZGSA 3WTVC 2BU9A 1H6YA 3FM5A 1RHI3 4IOAF 5I0SA 4X0GA 1SLAA 1K6YA 1OYWA 4QKNA 1PP8F 3PM1A 4YZ1A 3BR2A 1Q5OA 1OA3A 4FFHA 1FBSA 1S29A 3HSRA 3OYDA 4QPIB 4JBAA 2HPIA 2BY2A 3FM3A 4E6KG 3QOEA 4JGYA 3TOAA 2BOIA 3IAPA 3CKHA 1OH4A 4Q4V2 1K78B 5D2AA 1MBHA 1PM7A 1AUYA 2DUPA 2MFZA 2ORZA 2XPUA 3RI9A 5DDGA 2RN7A 1BEV2 1LHOA 3KYLA 1ZGJA 1U78A 3O8GA 3P7NA 1W6QB 2VVFA 4B1MA 1YJNI 1K4TA 4GKXA 3FXJA 1B8IA 2Z1DA 4AI1A 1W8FA 4E7HA 2VBYA 2WAQN 4JCKA 4C91A 2WYFA 3DCFA 2P6TA 2YC2A 3KV4A 2DU0A 4HFSA 4AHWA 5EXOA 3VFZA 2P5BA 3Q9OA 2O9LA 2WB1A 1ONVA 2W0XA 3QYBA 2W57A 4BDZA 1UMIA 2BV6A 3WGHA 4XLAA 1O3QA 1Q8VA 2BWCA 2MD5A 1O4TA 4CDGA 3EXUA 1Q8SA 1UD1A 3CF2A 5J37A 2YHJA 1SQ4A 1UOFA 1KQ8A 5DMYA 3OOXA 1ST8A 2DBIA 4YG2F 3K2OA 3M3YJ 2VMCA 4YW6A 1UYXA 3VHNA 3ES4A 1R58A 1CQ9A 3TRSB 3AL5A 1JZ7A 2M7BA 5KNLA 5AC91 2EPFA 3LNQA 1C8M2 1JZ5A 2Q5TA 3RJRA 1FMD3 1S0IA 3SC7X 3NNMA 1BR1A 1B1BA 2LS6A 2JDKA 1WZ2A 4JP0A 3W59A 1YW9A 2EXKA 4CCKA 2MH9A 1UYYA 3FUOA 3NNGA 4ZS3A 1Y1VJ 1PJRA 1RTVA 3WINE 1BL0A 4NHMA 1YX3A 4RGXA 3DKWA 3HUGB 5H20A 3IBMA 2VC1A 2VMDA 4AZZA 1ETXA 4IEWA 2Z5UA 3HT2A