5LRRA

The transcriptional regulator prfa from listeria monocytogenes in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
b'NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin positive regulatory factor A
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein
total genus 76
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lrrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lrrA01
4N0BA 1Z6TA 4IEWA 1YQAA 3IRRA 2DAOA 3TOBA 2PHDA 4B09A 3R4KA 5JHUA 4CZZA 1R58A 1HSJA 2G7UA 4XEZA 1LEBA 4HSJA 2ZMEB 3SZPA 4HQMA 4EROA 2DK5A 5HOOA 1I5ZA 1U6GA 1MD0A 2OZJA 4XFCA 3BDDA 2PFBA 5I93A 4KUMA 2WWYA 1SFEA 2MH9A 4YARA 2DTRA 3BCWA 3K1NA 1LKNA 2M45A 3EHKA 2DT5A 4EM0B 2IXCA 1IPJA 3H50A 4A0YA 3ULQB 5DDGA 3GUDA 2OZUA 4K2EA 2X4HA 4FHTA 2D5FA 3CUQA 2NNYA 3IC7A 1GXPA 1J5YA 3JZVA 3JSOA 3HHHA 5FD5A 4ZU7A 3O14A 2P7CB 2GC1A 1GXQA 1Z91A 4HA8A 2V1DA 1QQIA 2CYYA 2HEOA 4AVCA 2DPUA 3ABUA 1ONVA 4IEPA 5KHIA 3TOAA 4ZU5A 1K6OA 2IXIA 5HI0A 3KE2A 1CAWB 4WXHA 2UXNA 3PQJA 4E2GA 2XLGA 1WGPA 3I4PA 1Z6RA 2FBIA 2A6EF 2FU4A 4LLOA 2YSRA 1SMTA 2Q2EA 2EWNA 1K79A 2FNAA 1U5TC 3V7CA 2BBYA 3RPUA 4XF0A 4IVNA 4EJTA 3CO2A 4Q47A 4WZCA 3V8JA 4IESA 3R0JA 4ZZDA 2VE8A 2PG4A 1IRFA 2K02A 4QMAA 1W5SA 2HYFA 3T1BA 2VODA 4AVPA 2VONA 3F6OA 2L4AA 3EYYA 2DO7A 2IVMA 3NJZA 3ST7A 3I59A 1IAWA 4MEYF 1XB4A 4MH0E 4PGHA 1FNNA 2VOPA 1H9TA 4MTEA 5E1XA 1YTYA 1QO0D 3OTFA 3GWZA 3K0LA 1ZNPA 3PFIA 5KBFA 2VE9A 1EV7A 1UIKA 2UWMA 4LGWA 2ETHA 4A6DA 2ADUA 1TQMA 1ZH5A 3DEUA 4Q4ZF 3WGGA 4KIFA 1ZZ7A 2F4PA 2QJVA 1D3YA 3GYHX 3F21A 4IHSA 1TQIA 1BC7C 4HSLA 4FX0A 4H0EA 4L9NA 5L3CA 4KICA 3L2CA 1JHFA 1X82A 4MTDA 2V1XA 1Z9CA 3DFGA 5HLHA 3RIRA 1ZZCA 2KJBA 2O8XA 5IT9Z 2HKXA 3E6CC 5HDGA 2M1BA 1FY7A 2XL7A 1UD1A 1EY2A 4Q29A 4RGXA 4FAHA 1HBXG 3FMRA 4K8FA 3M7GA 4MGYE 3PVBB 1EH6A 3E6BA 1XN7A 4DQ2A 1B59A 4IF4A 4HN1A 1J75A 3GLXA 1NHAA 2EJRA 4YYOA 1NE4A 4CGZA 1IF1A 4Q0UA 3MZHA 4ENMA 3BPXA 2NAZA 2HYGD 4IHTA 1DUXC 4M6YA 3BP8A 2UY9A 4EM1A 5FQ0B 4HV5A 2OD5A 2MBFA 2XAQA 1ZRRA 3I64A 3FHIB 3EETA 5BXXA 5LRRA 3TQNA 4LULA 1JUHA 4ORFA 1DPRA 3EO6A 2M5WA 4XFAA 4RB1A 1X7NA 1Q1HA 3MYXA 5DCFA 1W4MA 3J81Z 1YFHA 3H7JA 4OU0A 2PAMA 4IRIA 2IXJA 1W7PA 4XFIA 1H1IA 2KJCA 5J3UA 3ZMUA 2OAZA 2MNGA 3K69A 4EV0A 2H0VA 3Q9SA 1J7KA 5BQTA 2IT0A 5DYMA 5TJJA 3ROUA 3ZMVA 1FYLA 1O3QA 2PAEA 2FQ3A 3HT2A 5CADA 4KL1A 3WGIA 4ZZLA 1L3LA 4L5IA 3HYIA 2BEOA 3M3IA 2HR3A 2D40A 3NSTA 3MPBA 2IXLA 3PLQA 1YS7A 4M6XA 5EZWA 1ZZBA 1UHWA 2P7VB 1REPC 2COMA 3QACA 3SFZA 1FI2A 1HW2A 2K86A 2FQPA 1SFUA 2CQKA 1U78A 4O9EA 2EFNA 1DGRA 4IERA 4EJOA 1U2WA 3K9TA 2DI3A 4JQFA 3JTHA 1VP6A 5E16A 3GBFA 4U7DA 3C1DA 2QUFA 3HRSA 3HRTA 4NB5A 4YIFA 1WWXA 2V1UA 5A2QZ 4LTAA 4QXKA 4MQ9F 3WE3A 1XCVA 3OCPA 4FT8A 3S7EA 3MWMA 4IETA 3BALA 3RJPA 2GIVA 3OD0A 3I71A 4GCVA 2KRFA 4YG2F 3NL1A 3T5XA 3SCHA 4HYEA 2RNJA 5JR7B 3V7RA 2EAAA 5BMZA 3IHUA 1IN6A 3P9IA 3S7IA 1ULYA 4XLNF 4G6QA 5EEHA 4YIIA 3NKTA 4ONUA 1I1GA 4LG0B 2R7DA 4HVRA 3WU1B 3N4MA 2H09A 3ZMDA 2R3SA 1KYZA 3P7NA 3GZ5A 3WE2A 3BJOA 3SHFA 2V9VA 2CG4A 1UCRA 4IJAA 2K0GA 5CVIA 5H6QA 1USSA 3T8TA 2AS5F 1B1BA 3V8LA 2O61A 2J5OA 3KP6A 4H7LA 2Q1ZB 4LMYA 3OOPA 2ZMEA 2F5CA 1ON1A 3D0JA 4RB3C 2EV0A 3CJXA 2OBPA 4P55A 2YX7A 2RN7A 3N97A 1Y9QA 4AQ2A 5DD8A 2F5FA 1CAUB 5JSOA 3ACLA 1SD6A 5D4SA 4HQEA 3ETQA 3BJ6A 1FSEA 2EV6A 3KP4A 4IRHA 2OU2A 5LGTA 1XSDA 1U5TB 4OLLA 1QNTA 3UKTA 4G9YA 5LHHA 2IA0A 2Z33A 2NNNA 1YFUA 5ED4A 2QYOA 1FBUA 3GX4X 1O4TA 2WV0A 4O9GA 1YIOA 5BY5A 2XAFA 4BYYA 1J2XA 5LHGA 2W85A 2EA2A 3I7DA 2BNNA 2ZJ2A 2GU9A 3U1DA 2N7GA 4XRFA 4G94A 1OKRA 1CAWA 1GQGA 1T6SA 4G6DA 4YSFA 1SFNA 4LB6B 4EJWA 2MHFA 2MA3A 2G9WA 1ZGJA 4OIOF 3H1YA 3KZYA 2ZBKA 1XE7A 1OYYA 2ZXJA 3KEQA 1W7PD 3SCGA 5AONA 2Z3YA 1ZRDA 2QZ8A 2VN2A 3FZVA 1HSTA 3L7WA 2BE5F 2P5LC 1I27A 3TO9A 1SAXA 1KQ0A 4DNCA 2JZYA 5C8WA 1CGPA 2XUBA 2XKPA 3HOSA 3QOPA 2ZNZA 4Z07A 4O6JA 2CWEA 2STTA 2C0ZA 3G7DA 1XCBA 3WTTC 2XAGA 5LBQA 3E5UA 4ESJA 4HN0A 2EFOA 4HVQA 3F8FA 3WW2A 1LR5A 3RPQA 1KQ8A 1LJ9A 2HQRA 3HTSB 5J48A 5L3DA 2W84A 1QZYA 2PEXA 2MLGA 1TTYA 5AVPA 2UY8A 3NEUA 4MGIE 2M8EA 1BN5A 1LDJA 2IPQX 4UNOA 3BZ6A 2IP2A 1V3FA 2ZNYA 2ZO4A 3H1WA 3I54A 1GQHA 5FLHA 3RI4A 4M9ZA 1BC8C 1XGOA 1PM7A 2TDXA 1VJ2A 4NHJA 1FZPB 3KP7A 3J80Z 1I1SA 2QM3A 3LZZA 2DCTA 3V4GA 2B9UA 3ELKA 3I53A 5D8KB 2CO5A 1O3RA 4Q0VA 2HFHA 1WI9A 3WTWC 5ICFA 2ETEA 1J3PA 2XV4S 1ZN2A 3SCFA 4A0XA 3L9FA 2FBHA 3HHGA 4I3PA 4BHBA 2O0YA 4IEVA 3LWCA 2FMLA 4JK1X 2O6GE 3ZN1A 4KIBA 5H6RA 1R36A 1L3JA 3DQVC 1SQ4A 3F8BA 3LAGA 5FQ0A 5KK1A 2QENA 4KN4X 2ACJA 4META 4I0AA 4OINF 4EVIA 1WRJA 1NE6A 1BBYA 4R52A 4D7SA 4MGKE 1IPKA 2DLLA 2JPCA 3L09A 1DP7P 1OFNA 5E17F 2B0LA 3R61A 4A2UA 4M73A 3I58A 3GFIA 3COAC 5K1YA 2RC4A 4HLXA 1ZGAA 2DFIA 3F8CA 4LA2A 1D5VA 3RZZA 2RGVA 3VEPA 1U3EM 5BPXA 4RB0A 1IN4A 2PHLA 1KU2A 1QBJA 1GHCA 4GYGA 4A6EA 1FPQA 5CJ9A 1G6NA 1ZX5A 4QGMA 1WLTA 3FWEA 3IKVA 3LQQA 4WBBA 3FHZA 2V79A 3RDIA 3ZP5A 5ILSA 3LFKA 3MFKA 3TO6A 4IEQA 1FC3A 3MCZA 5IT3A 1BI2A 5FPZA 2UYBA 4Q48A 1J9IA 1YWKA 5JFRA 3BPVA 2F5EA 1O3SA 3FFQA 1TW3A 3CDHA 3KZZA 2CFXA 1LEAA 2ZKZA 5E1WA 3HUGA 4XF1A 4N9IA 2W57A 2QDRA 2QQ9A 2DU9A 1PP7U 3T8RA 3KLOA 2M30A 2YX4A 3FF5A 4ETSA 3BWGA 4I09A 3IDCB 2W25A 5DD4A 1G3WA 4HBNA 2R7FA 5KHKA 3DF8A 1I6XA 2A61A 4EGYA 3TO7A 3F3XA 1SD5A 2FMYA 2BV6A 5T3NA 2EVXA 4PDKA 1ZVFA 3WW3A 4MZUA 2MH2A 1RUOA 5BOXA 4RAYA 3G73A 5DUKA 5HDNA 4U88A 3WTVC 3FMSA 1FYKA 4XF9A 3IWFA 2OPKA 1BIAA 4HV6A 4LUMA 2OQGA 2F5DA 3CJNA 2GA1A 1FXZA 2HZTA 1S3JA 4HF1A 4GYIA 1CF7B 4LG0A 3WG9A 3BY6A 1R5GA 4G8XA 1UIJA 3E6MA 3MEXA 1O7LA 1J3RA 1MKMA 2W24A 2A07F 3D5LA 2Z2SB 3B73A 5F6FA 2VPVA 1ZHFA 4AWXB 3KP3A 3EQEA 3KLNA 5CU1A 1XDSA 2KIUA 4CXFA 2BYVE 1YFYA 3EJKA 3S0MA 3IWZA 1Q3EA 1ZLKA 3GW2A 3SXYA 3S2WA 2VQAA 4BH9A 5J8CA 4LA3A 3B02A 3JW4A 1ZG3A 3FXRA 4O3MA 4CO8A 2DBBA 3H1MA 3QPHA 4WF2A 3SQNA 1QGPA 4HMZA 1X3UA 1CAUA 4RAZA 1S6LA 1O3TA 1T2KA 4BXUA 5FD6A 3WTYC 1ZRFA 4KFCA 5F1RA 4IXAA 5ICGA 3ES4A 4PGGA 3KFWX 1FBSA 4GXOA 1U5TA 1YHFA 1BOAA 2L4MA 4FAGA 1TBXA 3GF2A 3VODA 2UXXA 4DINB 4FBFA 1LNWA 2E7WA 4AXOA 5FCCA 5HVQC 1LRHA 2PLYA 4ZU4A 2A69F 1EH7A 1UFMA 3GVAA 4R8HA 3H8UA 1R22A 3SXWA 2HKOA 4UXAA 2OA4A 2HTSA 4AIKA 5IT9K 3QRFF 3OF1A 4EWEA 2YPRA 3D0SA 4TV7A 5EFUA 1J58A 3DKWA 3ZMTA 5KHJA 3CO7C 5HS8A 5HDKA 3GFLA 4PCQA 3K2ZA 2HWVA 2P17A 2H6CA 1B6AA 1FP1D 5BV6A 4AIHA 1IZ1A 2O1QA 4KWKA 2V09A 4LUKA 3ECHA 3DN7A 2ATFA 3CEWA 1MGTA 2OZ6A 4RGUA 3F23A 2P5KA 3ZN0A 3PNAA 2FOKA 3LA3A 1FSHA 3F6VA 2XKOA 4HDUA 2GH2A 1IUYA 2Z99A 2EB7A 2PQ8A 1HKTA 3JAMZ 5K5QA 3GO5A 4HF2A 5FLXZ 1P4XA 1IXCA 1S29A 2QNKA 3BB6A 4TLFA 3NVCA 3KP5A 1U12A 4EJVA 1XE8A 3M1EA 2RVCA 1TQPA 2RKHA 1NXMA 2L54A 1BM9A 1L0OC 3J81K 5ILUA 4ZYEA 3FE5A 4HLYA 3DPTA 2OA2A 3E3VA 1KA8A 2XL9A 1ZZ9A 1OYWA 4E2SA 2CSOA 2YU3A 5JR3A 4WK8F 3GFJA 4KA4A 1UCXA 3KP2A 2XVCA 1PMIA 5K8SA 2PAKA 2RQPA 4HBLA 3KEOA 1HKSA 4EWAA 3CUOA 3HSFA 3H7YA 3FZ3A 1SEFA 4HZFA 4MGRA 3EYIA 1ZREA 1IN5A 1SMYF 3ML6A 3VOEA 3HQXA 5AIPA 4X6RB 5FPXA 2GC3A 5FLIA 4ZYDA 5FDBA 3LQRA 1LVAA 2D2WA 5AIQA 1IN7A 5D5VB 3FJSA 2FXAA 1CAXA 2DK8A 3WW1A 2P5VA 2GC0A 4R1HA 1FBQA 4IEOA 1RL3A 2LNBA 2RV8A 4MX3A 2XROA 4HAMA 3WODF 1ZG5A 3F8NA 1J59A 4ESFA 4KIGA 2HQNA 1QY4A 2EA7A 2PQQA 4ASNA 2XHKA 4EMSA 4I98B 2UYAA 1JHHA 3JSPA 1YLLA 3H9AA 5HLGA 4EJUA 3HOTA 5A2QK 2CAUA 3LSTA 4R79A 1VTNC 3FM5A 3RTRA 1MJAA 1P2FA 3DL3A 1IW7F 1R1TA 3U11A 2B5HA 4MGZE 2DW4A 2D1HA 4L18B 4XSXF 3MZYA 4ZYHA 1UB9A 3WTUC 4LJZF 4NVPA 1FWZA 4OMZA 4I01A 2QCSB 2E7XA 3RNSA 6PAXA 2P6TA 4J1XA 3BPZA 3NRVA 3ZMZA 3CL1A 4QM9A 1XGNA 4LB5A 5HLIA 3RYPA 2IJLA 2FBKA 1DPUA 5ILVA 5L3GA 3EBRA 3HIFA 2Q0OA 3LAPA 1YW8A 4QM8A 4P9GA 3LA2A 2LF8A 1EP0A 1ON2A 1Y3TA 3SMHA 3W6KB 3OGJA 1BI1A 5FO5A 3VFZA 3L2HA 5CVRA 2KIMA 5D5WB 5KHGA 2VC1A 3WTXC 1R00A 4XFGA 1J1LA 3TKYA 3BJAA 4KYWA 4QX5A 4A12A 5JVTA 4LFUA 5LGNA 2Z69A 2XRNA 4HVOA 3DP7A 5JI6A 5E1ZB 4GGGA 2HGCA 1YW7A 1JGSA 1DZTA 1U8RA 3HSRA 5I0UA 1G4DA 1WQ2A 5FB2A 3NW4A 1ZARA 1WA4A 5J6XA 3TGNA 2NS0A 5ICCA 2IXKA 4HLTA 1HW1A 2Z9OA 1QZZA 4M71A 2VECA 2J5PA 3FXUA 2JSCA 4U7BA 1SD7A 4E2QA 4PJYA 1CAVB 4PIZA 1R7JA 3CTAA 2C6YA 5KVRA 3V8KA 2A6HF 3IIAA 1D8KA 3CUQC 1KQ9A 1Y0UA 5LEKA 4F7ZA 1S7AA 1SFXA 4HW0A 3KGZA 3USSA 5DUIA 1CF7A 3M70A 4LLGF 3SZTA 1TQ5A 4RGRA 1KU7A 4M74A 2UZKA 1HW5A 2GA2A 3ZQ7A 5DEQA 2QVOA 4WX9A 1ODDA 1P92A 2FA5A 3LA7A 5FLJA 2ET7A 3GXOA 1E2XA 2MPFA 1YS6A 2FNPA 3D82A 4RD7A 3ZPLA 1S8NA 4YFXF 1OMIA 1USTA 3RKXA 2AXLA 2STWA 2KIFA 3MDPA 1CAXB 2Q30A 5J8FA 2X0LA 3BU7A 3K1PA 1LDDA 3QP6A 2GQQA 4LLNA 5I8YA 2PA7A 3OV8A 2VBWA 3SHRA 2GC2A 2FE3A 3WU0A 2QBYB 1A04A 3P9CA 1E17A 1IXSB 5LRSA 3UKVA 2WTEA 4AVBA 2Y48A 4L0YB 2VBXA 4MEXF 4LEJA 2FRHA 1EYBA 2M87A 4U0WA 1IRGA 5LHIA 4KMFA 2HDCA 4L9TA 3R6SA 3CLOA 1TNTA 2D1VA 4B29A 4P96A 3M8FA 5I91A 2B8MA 2CW0F 1FYMA 5CVJA 1WSUA 2VT2A 5LGUA 4JV4A 1Z1DA 4CHUA 2IC1A 5I0SA 1HXDA 2EV5A 3J80K 4U0VA 1J0RA 1IN8A 2VXZA 5EEGA 2XLFA 4UBGA 4A5NA 1VR3A 3F8MA 2OYZA 1EH8A 1ZZ8A 1H1MA 5D8LB 1F4KA 4GULA 2QWWA 4Q0SA 1YG2A 1MZBA 3TNPB 2E1NA 2DQRA 2LKPA 1MDMB 3Q9VA 4KU8A 3DV8A 4JVAA 4L2NA 2P6SA 5J7MA 3IRQA 1XSVA 2DPDA 1HKQA 1MJ9A 1YO5C 1LB2A 4NQWA 2PI0A 2H6BA 4S04A 2G7HA 2HOEA 2VBZA 3CF6E 3U0ZA 1QPMA 4UBHA 3G3ZA 5D6EA 1Z05A 1BIBA 2JRTA 1T0FA 3ZMSA 5D6FA 2HS5A 4QWQA 3U9GA 4WWCA 3GEZA 1XGMA 4OFGA 3HT1A 3F72A 1KU9A 4O5VA 1R23A 1P4AA 1UPIA 2ZKLA 1F1ZA 2A3SA 4XF4A 1FP2A 4WXCA 4OOIA 4EM2A 4I0BA 2D45A 3BROA 3LAJA 1K78A 2WC2A 1T39A 4LLLA 4L0ZB 2H94A 5I0RA 3HRUA 4QGNA 2K4JA 3WTSC 4MUVA 1RIOH 4A5MA 1RUNA 2FF4A 3O3KA 1F5TA 4YRDA 3QP5A 4HF0A 4G7HF 4MHGA 3RYKA 1ZZ6A 5LLQA 3IKTA 2VOOA 4Z2YA 4P9FA 4LK0F 1JXSA 5D1IA 4EGZA 4GO1A 5E18F 4LK1F 2PTMA 3FXQA 5K5OA 4UV8A 1BI3A 1DDNA 1F9NA 3H3ZA 1RTVA 2I45A 1BJAA 1BI0A 1V70A 4J1WA 5FFZA 3WW4A 2IA1A 2QQBA 4ZYGA 2KXLA 4L5JA 2BGCA 4Y15A 4OIPF 3O6BB 2EFQA 1R1VA 4HX8A 5ERIA 5CVUA 1H0MA 2QLZA 3TDUC 1X8EA 1O5LA 4BIFA 4IEUA 2L02A 5BPDA 5E8GA 1AWCA 2PJPA 1T98A 2Y0MA 3GFMA 4WCGA 4RGSA 5C6CA 1NZCA 1H9GA 1KGSA 2YR2A 3L00A 2D93A 5FFXA 2E1CA 2Y0OA 4D0PA 1R1UA 1PDNC 2LF7A 3QU6A 4KDPA 2MLKA 4D7TA 4B8XA 1RNLA 3V7SA 5DCMA 2K9ZA 3U10A 2ESNA 1WKMA 2JT1A 4N9HA 1UW8A 4RS8A 3O2PE 4IPAA 3KCCA 4U0YA 3IDBB 1ZAOA 4KN7X 5D4RA 2LDUA 1RC6A 3HTUA 3VHRA 3C3WA 1LDKB 2PYTA 3QAHA 2XAJA 4AD9A 1YYVA 4BAYA 2DQLA 4JTNA 3M9AA 4KWLA 3UKNA 4UVAA 4MNUA 3T0YA 1FOKA 2L3DA 2P4WA 1DGWA 4L11A 4UXNA 3U2RA 2OQRA 5JSRA 1OYIA 2GXGA 2QQAA 1J3QA 3EDPA 4XFHA 2PN6A 2BNMA 1RI7A 3DPLC 3KGLA 2V6CA 1B4AA 1P6RA 2ET1A 4XBFA 1XSXA 5I8SA 1K7AA 4F8AA 1UHMA 3ABTA 4HDVA 2EA4A 3CUQB 1YFXA 4KWJA 1XMAA 4MQVA 4HX7A 3E5XA 1R5HA 3P9KA 4UV9A 2EFPA 2ISYA 2XASA 5HS7A 2ELHA 3LWFA 4Q0QA 3MQ0A 4YNIA 4HOBA 4Q5SF 4AVAA 4RB2C 4BQAA 1DZRA 4WVZA 1Q43A 1RGSA 3KMHA 3Q5FA 2L01A 3ZDSA 5CVVA 1OPCA 1FX7A 1TW2A 3HSEA 5TRDA 3RKWA 2GZWA 4ENNA 3JTGA 3ERED 4UUVA 1K78B 1CAVA 1ZLJA 3M8EA 5K5RA 5I8TA 5BS6A 3LOIA 3WGHA 4JTOA 4HX4A 5D5XB 2VT3A 4XETA 1HQCA 2MD5A 1ZRCA 3R60A 4Q0PA 4AQ6A 3IBMA 1B9NA 5L3EA 4M72A 2ZCWA 2XAHA 1RZ4A 3REOA 2Y75A 5JAXA 4I2OA 4KT5C 2IXHA 4CYDA 4P5OA 5CLSA 1X8MA 4G7ZF 3K1MA 4ZH4F 2Q4SA 1IXRC 3TNQA 1CX4A 3I59B 3CO6C 3VB2A 3NQOA 4WXDA 1ZYRF 2Q0AA 4PZJA 2ZFWA 1G3YA 3FM3A 4M9XA 5FGMA 4L9VA 3I5UA 1FLIA 3JAMK 1TNSA 3FX3A 4OMYA 5FLXK 4OIRF 2E9QA 2GAUA 1S7OA 5H20A 4YFNF 3RKYA 2QBYA 1LQ1A 4XFBA 2K7LA 4UVCA 2O03A 5BPIA 1XGSA 5CYVA 3DXJF 1O5UA 4PIYA 5DV5A 4S05A 1YUDA 2PFWA 5KHHA 4L9JA 1G3SA 3GYDA 2XGXA 4I7HA 2CGPA 5DCMB 4AIJA 1PUEE 2VC0A 1OR7A 2HJIA 5E20A 2K27A 4UVBA 1C0WA 5JCTA 1ZG1A 3TDZC 1XRUA 4KMUX 1XD7A 4ON0A 3IL2A 4MV2A 3PQKA 1QXRA 1FT9A 4IRGA 3QPTA 3HRMA 3BOQA 1STZA 2P8TA 5F64A 4Y17A 2K4BA 5E8IA 3EUHA 4EWDA 2GWRA 3W6JB 4P9UA 1YFWA 3F22A 4E70A 2EK5A 1GVJA 4ENJA 2CV6A 1B9MA 2NRAC 2QVSB 1MDMA 1JE8A 2MC3A 2FSWA 2RDPA 1NYWA 4FX4A 1W5TA 3KETA 1W7PB 3KSCA 3E97A 3FMQA 2D5HA 1QWRA 2ISZA 1T38A 4CICA 3CLPA 4XLPF 4IEXA 4KU7A 4X6QB 3H3UA 1OD5A 4PIXA 1XDUA 2ESHA 2PMHA 2PBIA 5I0TA 1MJBA 5E1RA 2XIGA 1YW9A 3ELNA 2Z5UA 4XSZF 4QGLA 3ECOA 2A68F 3EQLF 4BNCA 1Q5OA 1EPZA 4Y13A 5JSPA 5L3FA 2O8QA 3H92A 2HTJA 2NYXA 3RYRA 3E5QA 3MAJA 4EQQA 5ICEA 4M9SA 4UHTA 2JPBA 3WTZA 4OIQF 4LD5A 1KU3A 3J7AO 1D8JA 3ISPA 3R0AA 2O3FA 4QLCU 4BHCA 4XF3A 3E6DA 3GZ6A 4IEZA 2WFPA 3AAFA 1YLFA 5LEJA 4KNYA 2FEZA 4IEYA 4A0ZA 3C18A 1KYWA 1G3TA 1XMKA 2BNOA 3ES1A 2H27A 2IW5A 4G7OF 3QU3A 4ESBA 1V4RA 5BUVA 2JTVA 4JBAA 4I02A 2VBYA 2XLAA 4BHPA 4ENKA 2GXBA 2F2EA 2EFWA 4Z82A 4XFFA 2Q8KA 2PMUA 1TLHB 2CAVA 5L3BA 4CDGA 2A5YB 2IA2A 1P4WA 1Z7UA 1O7FA 1AOYA 1QXJA 1OI6A 1O57A 5HS9A 3I0TA 5D5UB 1SD4A 2LSOA 2IRFG 2KKOA 1PP8F 4YFKF 3C3VA 3C7JA
chains in the Genus database with same CATH superfamily
1FX5A 4UW4A 1Z6TA 4IEWA 1YQAA 4CDUB 1VBD1 2OVUA 4P14A 2DAOA 5IAXA 4B09A 1C28A 2G7UA 2XJPA 3SZPA 4IHYA 5HV4A 4PJJA 3BIWE 3PJQA 5IVVA 1MD0A 3VZKA 5C3EJ 4A3ZA 2HWC3 5I93A 4KUMA 2G9GA 1OLMA 3QD6A 1KZHA 5C3QA 1M06G 4FP3A 2M45A 3EHKA 1BLZA 1IPJA 3H50A 5FWJA 5E3MA 3OS0A 2OZUA 4V1PA 3LSJA 4K2EA 1J84A 2X4HA 4FHTA 1F43A 4FXGB 1YYNA 4Y1XA 4CU9A 4XRMA 1ETYA 1OH4A 3I3MA 2P7CB 1GXQA 1Z91A 1V6JA 5CG8A 1RVF1 2HEYF 5FKMA 4BU2A 3ETPA 3AKSA 4PUSA 4UF0A 2LREA 1ONVA 4LK7A 3PHMA 3WX5A 4HETA 5FZIA 5CISA 4ZU5A 3KE2A 1XSQA 2UXNA 2J1EA 3RRDA 2ZX3A 4YRVA 3ESWB 4ASKA 4OUEA 1UU5A 1NT0A 4CEYA 4AYBA 2FU4A 4A3MJ 3N05A 4LLOA 3LOBA 2BY2A 2Q2EA 2W91A 3V56A 1K79A 2FNAA 4BEHA 3VDCA 4M3CB 3VBOA 4IESA 4HL0A 2K02A 3AXDA 2M0MA 1QJX1 1R4NB 4Y5TA 2VONA 1ZR4A 1GP4A 5IK5A 2W82A 3F6OA 1PK6B 1W8FA 2L4AA 3VBUC 3NMBA 1H8TA 1UKRA 1XB4A 2F6BA 4PGHA 1FNNA 3VYUB 1DZQA 3I2IA 3GWZA 5CQGA 3CBNA 3PFIA 5IVBA 4XE9A 4LGWA 2ETHA 4FVVA 3AMNA 4QQOA 2Y6FA 1TQMA 3IAPA 2YFUA 3WGGA 2H0BA 2OXBA 1GOGA 4BXSV 2IGNA 3F21A 2FJ1A 4MIMA 4BY1J 1QDOA 2RM22 4FX0A 4H0EA 3VSLA 2VVDA 3OBAA 5FY4A 2YZ4A 1ZZCA 2KJBA 2EIEA 3BR5A 3AMMA 5HDGA 1FY7A 2XSDC 1YJNI 2VZRA 4Q29A 4KGQA 2OUHA 2EBIA 1HBXG 1EH6A 4LBJA 3OYBA 1XN7A 3S5QA 4HN1A 1VRBA 2A6ZA 4CDQA 1OCZH 5KCMA 1NE4A 2VVFA 3BCBA 3MZHA 3BPXA 2D5VA 1TWFJ 4BISA 4IHTA 4M6YA 3BP8A 3B93A 4EM1A 1K42A 1KFXL 2OD5A 1E0EA 2WN2A 2CQXA 2XAQA 3HOVJ 4B48A 4Q1RA 5BXXA 2R5ZB 3N36A 3IKWA 3BUCA 1RUC2 2IXSA 3EO6A 2M5WA 4NBQA 5C33A 4RB1A 4RGGA 1Q1HA 1W4MA 1YFHA 3LFMA 3JCIA 4BMBA 3GTPJ 3CZUA 4JRLA 1ULEA 2KJCA 2VZOA 3ZN6B 1KQRA 3U4XA 3KHBA 4CDWC 4BB3A 2BHZA 5BQTA 1RUG1 1QQP3 5TJJA 3ZMVA 1WMEA 1JZ2A 2JIJA 3AJYA 1LFBA 3WGIA 1JW6A 4DRRA 2JA6J 4UF0B 5EYXA 4BJTA 4QPGA 4PJNA 3M3IA 4M4RA 3MPBA 2KMUA 5BNQA 5LZ6A 3MLLA 2R5YB 4M6XA 3K7AJ 2R49A 3I3LA 2COMA 3QACA 1NY72 3N3HA 3FMGA 3WG2A 5C3SA 5J40A 5LBBA 4EJOA 5F6LB 3OPZA 1OLRA 2V9KA 2Y0IA 4JQFA 5CKMA 3MEPA 3DLAA 2VD7A 1MBFA 1UY1A 4AAPA 5HCHA 2QUFA 3HRTA 1O4YA 2W48A 4NB5A 1F9KA 3GNEA 5A2QZ 4LTAA 3ITQA 4ZZ8A 3W2VA 1KRIA 4FT8A 3MWMA 1OFSA 4XRSG 1COV1 2X5IA 4PI0A 2WV1A 2KRFA 4GCVA 3BGAA 3U75A 3NL1A 3T5XA 3HOWJ 4LIVA 1RR7A 2DTWA 2D98A 3Q0WA 5JR7B 1OT5A 1K12A 3P9IA 4G6QA 5EEHA 3NKTA 1UZYA 2H09A 1ULDA 3POSA 1GICA 2RJKA 3DLLF 3WE2A 2WR9A 3BR6A 2MSYA 2HWE3 5TGTA 2ARXA 1UCRA 2JMWA 1GMMA 3PTYA 3T8TA 3JU9A 3ZXAC 4HNUA 1RUI3 2O61A 2J5OA 2F4LA 4H7LA 2JE7A 4LNVA 2ZMEA 1XXNA 5FYVA 1ON1A 2VCCA 4Q26A 2YB7A 1QJY2 2OBPA 5LA0A 2WZ8A 3CMGA 3L2RA 3N97A 3H3VK 1WCDJ 1FOXA 2F5FA 4M3CF 3ACLA 5DABA 5LA9A 2CMPA 3CDIA 3BJ6A 3LPFA 4EYUA 2EV6A 1X1DA 3O12A 4IRHA 1DU6A 1FIAA 2WAQA 3I8TA 1WPKA 4YGEA 1GKBA 1QNTA 1GFF2 4D6SA 5H2FC 1UZ0A 5IHRA 4IEJA 1V5FA 2ZGSA 5AC92 5BY5A 2XAFA 2XGEA 4BYYA 5LHGA 2ZJ2A 3AKPA 4Y3OA 2YFZA 1PX4A 3DKYA 3VBUB 3B9CA 1CAWA 4O61A 4LB6B 4EJWA 2MHFA 2I5UA 1HC8A 1YJ9I 3GZAA 3H1YA 4LQRA 1MNMC 3H9GA 3KEQA 4C2MJ 3SCGA 2QZ8A 1E5SA 1W28A 4DO0A 1Q1VA 1HB2A 4QX3A 2JDHA 2VW0A 1SAXA 2JZYA 5C8WA 2XUBA 2WNOA 2ZNZA 4Z07A 2JA7J 1YOVB 1DG6A 2XAGA 5LBQA 4ESJA 4HN0A 5EZHA 4C9YA 1VAVA 2D6NA 4LO8A 4QXCA 4HG6B 4R9BA 3WW2A 1MNDA 1QDCA 4L9BA 3FXMA 5JXIA 5FMCA 2BVMA 2ZGLA 3HTSB 2P3YA 1QJU2 1P7JA 1L7RA 2PEXA 5KC6A 2OJED 2W9XA 3KVAA 3O1SA 4P9YA 3X29B 2M8EA 3B3QE 1BN5A 2CUEA 4UNOA 2E31A 2ZO4A 1W9SA 2DA1A 2JVHA 3S2HJ 2XJQA 3OSFA 1VJ2A 3FUQA 3OBZA 4EN7B 1FZPB 3K4LA 1T0FC 5FIXA 3ZQIA 3CJIA 3ELKA 4OHWA 2R1DA 5D8KB 3PIOF 1LGCA 3USUA 4FPKA 1W6QB 2DU1A 1G2HA 2ZZJA 1J3PA 2XV4S 3OSGA 1ZN2A 3SCFA 4A0XA 3MKWB 1QU3A 4LXLA 3HL2A 3A01A 3MIFA 5EYYA 4BHBA 2BBAA 1HX6A 4AHZA 4NRMA 4CDWB 2K5CA 1PM4A 1CONA 3G1MA 2CQ7A 1AYM1 4JKMA 3DQVC 3WQBA 5ERLA 2K9LA 5C4XJ 2VASA 2ACJA 4OINF 1D0HA 1WRJA 3CC2I 1W9YA 5K7ZA 1VQNI 4KITB 3OJBA 3VD3A 2VKHA 2LW8A 1VQ6I 2DCZA 3L09A 1DP7P 5E17F 3GTQJ 4AUXA 3I58A 1A8MA 4B7KA 3GFIA 1YJWI 3S32A 3WG7H 1D4M1 3UETA 1U3EM 1W90A 3AP7A 5FZ1A 5GLUA 5HODA 5CJ9A 4R9CA 3LQQA 4WBBA 1HRI3 2MG4A 3RDIA 3D1NI 3OYHA 2YUEA 3LFKA 5C70A 2DA3A 2ZGRA 3MCZA 5IT3A 5EQUA 1GWLA 4CSWA 3HB9A 2COBA 2UWAA 3VN4A 5JFRA 3I2DA 4NAMA 3CCVI 3BPVA 5FYSA 5IWFA 2F5EA 3NNFA 5GP9A 3CD6I 4F92B 2WDBA 2M8GX 4BUPA 2FDKA 1IRZA 3T8RA 1SG3A 4BK4A 1VBC3 2JA8J 1KITA 1JYCA 2RDSA 2DBIA 3IDCB 3UJOA 1KONA 5FKBA 3GBGA 2A61A 3SH5A 2VL4A 4AF9A 3BU0A 2RS33 4YM0A 1OLTA 2D43A 1LAJA 4GQ7A 3G73A 2C5DA 3AYAA 4K9SA 4NIAA 2XPVA 2DODA 1NLRA 3ABKH 2OPKA 3X2QH 1US3A 1BIAA 1ETOA 4EN0A 1FXZA 4A69C 4DYRA 1NQDA 1SLCA 1D0GA 4RS5A 4G8XA 2VULA 1UIJA 3CHXA 2W24A 2A07F 3A2KA 2Z2SB 1ZHFA 5CB7A 4N53A 2BYVE 3EJKA 1ZR2A 3GW2A 4OMCA 4IV3C 1X3ZB 5DS9A 3OYJA 1XNCA 5J8CA 3ZXSA 4LA3A 3DKXA 2W5FA 2EQRA 3SEEA 2DBBA 3QPHA 4WF2A 1S55A 3V0BA 4XACA 5E89A 2FCUA 2LBFB 1ENXA 1O3TA 1UNBA 2A6WA 3WTYC 1ZRFA 3A0NA 3AYDA 2EICA 5ICGA 3ZMNA 4PGGA 2YHJA 5CEHA 2B9SA 2YBPA 1YHFA 1BOAA 4PSWA 3AL0C 3BTZA 2UXXA 5A1LA 1JUMA 2QKMB 2E7WA 1QH7A 1B35A 1NH3A 4IHWA 3IPVB 2UU8A 2ZJCA 4BA6A 4RN5A 3H8UA 1R22A 3SXWA 2HKOA 3TN92 2Y64A 5IT9K 3T4VA 2JN6A 4GD4A 3D0SA 1JI8A 4W97A 4YW6A 1GVDA 4DXSA 3CO7C 5HS8A 2DTZA 2RMU1 1TWHJ 2VAUA 1VBA2 5HDKA 3GFLA 3K2ZA 3MKYB 4LOSA 2P17A 1B6AA 2JA5J 4IL6C 2OS2A 2O1QA 2ZGNA 3ECHA 4XL9A 3CEWA 1PNGA 1S2KA 1W03A 4RGUA 3F23A 3UNPA 2DCKA 2CDOA 4C8DA 3ZN0A 1CZVA 4NQWB 2FOKA 4J19A 1W0TA 4JKKA 1FSHA 4C1WA 4HDUA 4XKCA 1IUYA 1AR91 2XJTA 3SC7X 1HKTA 3ZSMA 1RUE1 2DOFA 3CU7A 3UR3C 1AR82 3KP5A 2VKVA 4EJVA 3ZGKA 1U12A 3M1EA 1XE8A 3I4NJ 3DPUA 1S0DA 4AOCA 2L54A 3FLPA 1BM9A 4XIDA 4GWNA 4IV3A 1YI7A 3MUZ1 3E3VA 1KA8A 3GTOJ 2WS93 2XL9A 2DXIA 1ZZ9A 1YI2I 4GH4A 3C8XA 1VZ0A 1W8NA 2YU3A 4WK8F 4ISQA 3GFJA 2AR6A 4KA4A 4XR6A 2OIIA 3OGRA 5E3NA 3KP2A 1IDZA 4MO3M 5K8SA 2PAKA 1HLVA 3ATGA 1W2AX 4HXCA 1IC8A 3RZOJ 3HSFA 4HZFA 3PTRB 3TOJA 1ZREA 1IN5A 3ML6A 4UB6C 5AIPA 3D8CA 5F7UA 4ZYDA 5FDBA 3LQRA 1AHSA 2F5VA 1BOBA 2HPIA 1TP4A 5EV7A 5D5VB 5FZMA 4D7YA 2DK8A 2R7QA 2CUJA 2IZWA 3WT3A 3K46A 2V7FA 4D3WA 1JZ6A 3WODF 1ETKA 5FPUA 1J59A 2R7VA 4DNYA 1MIJA 2HQNA 1ND2C 4S0HB 4ASNA 1JHHA 5HLGA 4NPRA 3CJQB 5FJ8J 3HOTA 2CAUA 1VTNC 2NN8A 5K4LA 1BR2A 1LHVA 5LBCA 1OOPC 3VBHB 2OT7A 2R043 2LMDA 2D1HA 2CWMA 1XC6A 1KXGA 4IE5A 5EP9A 2AEYA 4M3FA 2O0OA 1C1LA 4NVPA 1BKZA 1FPN2 4OMZA 2RM23 1ZQ3P 2QCSB 3RNSA 6PAXA 3OBRA 4LBMA 2P6TA 2E7TA 2BOJA 3CL1A 1WD3A 2DUPA 1XGNA 2PELA 2BW3A 2XF5A 2L9LA 5L3GA 4UFMA 9ANTA 2Q0OA 1UX6A 2RNGA 5CFCC 2V26A 3BQYA 3B6CA 4JGYC 1EP0A 1OF4A 4ZC3A 4AIDA 3SMHA 2VUCA 3W6KB 4QQHA 1BI1A 1C8M1 2M0CA 2X1DA 2QQPA 2ZX4A 1RJ8A 4SBVA 2RDNA 3HJRA 3BYWA 4XBQA 4BQOA 4XFGA 1WUVA 3TKYA 3HBLA 2BY1A 3OIOA 2GOXB 3H9JA 3DEMA 4BQ2A 5JVTA 4LFUA 5LGNA 3O0VA 2PN5A 2DURA 4GGGA 3HKZN 2HGCA 3Q3SA 2JKXA 1JGSA 1Y7BA 4LE4A 1VRH1 3J7LA 4ANJA 4ZXKA 4I0WB 3IH2A 5C3PA 2XVKA 3DECA 5C8CA 4XK4A 2QQ8A 5JIUA 3OIQA 2GN3A 1HF0A 2NOGA 4ZTFA 1ZARA 1RB8G 4KMQA 4F93B 3ZR6A 5J6XA 4MG2A 5ICCA 3VDAA 3A02A 2V1NA 1RUH1 4M71A 2VECA 2AO9A 4PHZA 2ZGTA 4Q4W2 4DEQA 1VBB1 4U7BA 3DPRB 4IV3B 1SD7A 4E2QA 4PJYA 4LHNA 1UJ8A 2PHTA 1PO11 2C6YA 3V8KA 2A6HF 1JHJA 3CUQC 3ECQA 1KQ9A 1AKHB 3ZO0B 3E0JB 2Y26A 4XLCA 1S7AA 1SFXA 2O8KA 5DUIA 4LLGF 1STMA 3SZTA 4AGGA 4RGRA 1Q8QA 1HW5A 3ZQ7A 4HKOA 5FFOC 5CFDA 1HDPA 2EIKH 3DTEA 4I76A 1RUJ3 3O8GA 1E57A 2X09A 2PHXA 4LBKA 3KQ4B 4A4AA 2IBDA 4TZDA 2ET7A 3J4UH 1V5GA 4MXWB 2IVJA 1ETQA 3GHMA 3EMRA 2P3IA 4YFXF 1W6NA 4IGQA 3MDPA 3CZ6A 2QZ3A 3K1PA 4KI5M 1ZBA1 2EIBA 2P4EA 5LK7B 1EV12 2PA7A 3HGYA 4B43A 1A35A 5JIAA 2GC2A 4B4QA 3GBWA 4GB32 1W2OA 3U4SA 1E17A 1ZK8A 2IS6A 5LRSA 4XILA 1MZ5A 3UKVA 2WTEA 2FD5A 4LBQB 4TWTA 1CIWA 4NRPA 1E3OC 1R092 3HNMA 3O8HA 4KMFA 2HDCA 4WVVA 4FTHA 3R6SA 3CLOA 1DQ6A 3S1RJ 2WQ8A 3POYA 2B8MA 5FYBA 4XJ8A 1FYMA 3JRHA 3LSEA 1WSUA 5FY9A 5T5PA 2JICA 2VT2A 2JXAA 1Z7S3 2NLRA 2NYYA 3ZMOA 1FOD2 2D3RA 3LIHA 4E4SA 2FQ4A 1HXDA 1DLLA 2EV5A 3J80K 3KHCA 1IN8A 2W87A 5FYUA 3MBWA 2YUSA 4E8CA 2M3AA 1X4PA 3WNOA 1J09A 3F8MA 5FUPA 4GULA 3FKJA 4ZDPA 2WIIB 2W00A 4Q0SA 5JMCA 1UYPA 3BTXA 4B4CA 2LKPA 3DV8A 4JVAA 3MW4A 2DPDA 1IUFA 3CF6E 1QJY3 3SH4A 3QQAA 3G3ZA 2OV7A 3BT9A 3ZMSA 1HXS1 2L0KA 3BTCA 4QWQA 3VZLA 4IZZA 3HT1A 1OKQA 3F72A 2LY2A 1KU9A 5CKNA 3TEDA 3F0CA 4G6TB 4WXCA 4OOIA 3LAJA 3M8LA 4BJ0A 3W9AA 4MADA 2CV2A 2XH6A 3FXOA 2PHUA 2K4JA 3VDDC 4MUVA 5FZBA 3GCWA 2WZR2 1C57A 1ND2B 4Q1PA 4FPCA 4HF0A 1SANA 3RYKA 1ZZ6A 2E7AA 1QVTA 1HN0A 2GM4A 5FKCA 5CQEA 3VWBA 2WSVA 4GO1A 1Y8RB 1ULOA 2R1BA 2ZGQA 4FETA 5K5OA 1OOPB 1SPPA 3W21A 1RTVA 2BQPA 3H0DA 2XPUA 1BI0A 5FFZA 3WW4A 2CGOA 1MSEC 2QFEA 3O6BB 4HX8A 5CVUA 4QDQA 3TDUC 5ACA2 1X8EA 2M2EA 4BIFA 4IEUA 2L02A 4LJHA 3ZR8X 1AWCA 4LBLA 1OQEA 2Y0MA 4RQPB 1UL9A 3H42B 1SLIA 2WWSA 4WCGA 4URTA 1F36A 1NZCA 1H9GA 2YR2A 3JD72 3LD8A 1R1UA 1SVMA 2LF7A 3QU6A 3AC0A 5CFCB 4JGYB 4B8XA 3OS2A 4M6VA 4XLHA 1HOMA 2K9ZA 1WKMA 4N9HA 2DMQA 1VMHA 4IPAA 4LOTA 1QJU3 4U0YA 2E2JJ 1AL21 1ZAOA 2LDUA 3PNYA 1URXA 2KD7A 3K4BA 4WM7B 2XAJA 2DMUA 3MLJA 3I4IA 1AU7A 2E2IJ 5L36A 1UQXA 3UKNA 2DA6A 5GAGJ 2ZXHA 4XAEA 4MNUA 2L3DA 3KCXA 1S2BA 4UXNA 2LRPA 2OQRA 5JSRA 4NHYA 1RXGA 4B44A 1AX1A 5FXXA 1F4HA 3JRDA 1NCQC 3LSIA 2PN6A 2BNMA 4HEA2 5L9RA 3N35A 3RS6A 1XBFA 1K5MA 3KGLA 4V2FA 1P6RA 2ET1A 2V4AA 3S6PA 1GP5A 4CVUA 3ABTA 5DN2A 2QQMA 3CUQB 2L9SA 3NNMA 3JREA 4KWJA 3D5RC 4ASLA 4MQVA 4XVHA 3E5XA 1OR7C 1KJRA 1JT6A 2G0EA 1JZ4A 5HS7A 5BNPC 5J96B 2E5NA 4HOBA 2L7KA 2X6YA 2R071 2RJ2A 2WYSA 2WBMA 3WP4A 2G4IA 4FQGA 4WVZA 3A0HC 3GTJJ 1H2MA 4HPKB 3ZDSA 4RGKA 3OYLA 2WA4A 1FX7A 1TW2A 3HSEA 1F2NA 2HYJA 1ZTRA 2B45X 2C9KA 2LP0A 2Y38A 3SLIA 3WF0A 4UUVA 2ZGOA 1CAVA 2R7SA 5K5RA 4RBOA 2WT1A 4BQ3A 2EXIA 3ZQCA 4GZ9A 1E5IA 2C4XA 3BR1A 1JOJA 2HU9A 2LR8A 2JG8C 2JE8A 4AQ6A 3IBMA 2CW7A 5FZCA 2ZCWA 1LOFA 4NROA 1N1SA 2Y75A 5JLWA 1KGYA 4XMYA 2Q8EA 2XBO1 2ZOEB 4G7ZF 3K1MA 5HBAA 3WDUA 3S16J 3WG1A 1W2UA 1VQPI 1X2MA 3NQOA 3ZLIA 5C5UA 1IKQA 4NO4A 3M1HA 5AFBA 2ZXQA 3ZCOA 2BDRA 2P81A 2DN0A 4IGPA 2VGDA 4CXXA 3FM3A 4L9VA 3POEA 4OMYA 1V9U1 5JLVA 1VF9A 4YFNF 3RKYA 1TME3 4XFBA 4FPYA 5BPIA 2O5RA 1XGSA 2Y6GA 2W1UA 4S05A 3CF2A 4CCNA 1MVEA 5LBEA 4L9JA 1VQKI 1MEC1 2XPWA 3TAYA 4XKVA 1GANA 3PUAA 2JECA 2VC0A 5J1XA 1OR7A 2K27A 2MGQA 1G9AA 4UVBA 1OJLA 2VL8A 3PL8A 1C0WA 1ENSA 1A6IA 1ZG1A 4M3CE 3HNYM 4XC9A 4ON0A 4AFDA 1SDDB 1DQ4A 2G9ZA 2AGSA 2HWF2 3C2UA 4JX6A 1FT9A 1W0UA 1CPNA 2DFHA 3E1SA 4QB2A 3HRMA 3S1NJ 5CPRB 2P8TA 5F64A 2XC7A 3WF4A 2FDJA 2R062 1F5FA 1XNBA 2VJXA 2O9LA 3EUHA 4XQWA 4EWDA 3W6JB 4P9UA 1WW5A 4LBNA 1AR71 2ZX2A 3T0AA 3Q8CA 1GVJA 5EJZB 2AENA 2JUCA 5IYBJ 3VDDB 1JE8A 5FMBA 2FSWA 2YGLA 3MFCA 4ES8A 3HWJA 3ZYFA 4FX4A 2D5HA 3PFYA 2MEV1 2TUNA 4AI0A 5IAVA 2RR12 1DIWA 2OTJI 4PIXA 1XDUA 3CMYA 3VKLA 2ESHA 1EAH2 3ABMH 5E1RA 3ELNA 4XSZF 4L99A 2IGKA 4BNCA 4FTBA 2R7ZJ 1Q5OA 4Y13A 5JSPA 3T1MA 2J1VA 4M0HA 1PNFA 1UMZA 2ZHLA 2WZEA 3RYRA 2VXJA 4EQQA 1PIV2 5FUIA 3APBA 2CRGA 2R7WA 1X9PA 1KS5A 1N3OA 2L7MP 4LD5A 4M3DA 4XZPA 3ISPA 2FX0A 3R0AA 2O3FA 4QHOA 3KZ4C 4AEMA 1VBA3 3WNPA 1VI0A 1UWWA 4CCEA 4E7IA 3GZ6A 1H2NA 2MW8A 3AAFA 2Z4FA 1YLFA 4IEYA 4A0ZA 1REFA 5F32A 3A4UA 4XHBA 1OLME 2A05A 5F3GA 2K3FA 3M1CA 2FD8A 3FK6A 1I3QJ 1LFUP 1V54H 3CDZB 5A6QA 4ESBA 2VPLA 4Y5Z0 5BUVA 2JTVA 2VBYA 4JX0A 3DXUA 2BZTA 4BHPA 4AFAA 4IOAF 5FY5A 2VQCA 2F2EA 3LF7A 4XUNA 2EFWA 3RCOA 2Y6HA 2ZXIA 1O59A 1NCQB 4PDWA 5FTTC 5L7OC 4QPIC 1QQP1 5FMOS 4NC6A 4LITA 4Y33A 3KF3A 1XNDA 1O7FA 2ARAA 3GALA 4OI2A 3VKFC 1DDLA 5HS9A 4F83A 3AB0A 2IRFG 3RZKA 1RMU2 3C7JA 5K7PA 3PM1A 4RYDA 4N0BA 4Q4V2 2BXZA 4CCDA 1BA5A 3IRRA 1YNAA 2R7RA 3S2DJ 3TOBA 4PT6A 3ON7A 5ABJC 3OIPA 3R4KA 5JHUA 4OUSA 4Q8KA 1HSJA 4XEZA 5BNPB 1U0JA 1VBD2 1VE0A 5FZ4A 3RJ2X 2XWBB 1FV3A 3VHOA 2OZJA 1TZOA 4Y22A 4Q4Y2 4ZPIA 3BR0A 3F2ZA 3L2QA 2WAAA 3MI8A 4YARA 3K2OA 2KDZA 1LKNA 4DUVA 4JC1A 4EM0B 3ZQHA 4K40A 2X29A 2DOAA 3ZYGA 5CKQA 4WM8C 1GXPA 3JZVA 5B66C 2VTXJ 3O14A 2ZAAA 5KR7A 2GC1A 2JG8B 2WNUC 2V1DA 3MIEA 4L0PA 1QQIA 2PJRA 3IAM2 2DPUA 1RVF2 3ABUA 5FPAA 2GDFA 2BHYA 1VQLI 2VLAA 4YFWA 2DVDA 1RINA 2EAKA 2NS7A 3TOAA 5FK7A 1JTZX 2QBXA 4RGAA 3R0RA 4BXFA 5DM6F 3PQJA 4DUWA 3RGBA 2XLGA 3NO8A 3I4PA 1Z6RA 1RETA 1CJPA 2FBIA 5A70A 1TT5B 2A6EF 5TSWA 2P0WA 4ZTJA 3J7ZI 1MS4A 4AWDA 3LSGA 4NIIA 5L7OA 2FZ2A 1PVEA 1POV1 3NAPC 4YM3A 4W8JA 3CO2A 4Q47A 1U5YA 1JTYA 3SYTA 4XUQA 4AQTA 1U5XA 2VE8A 3AP5A 3OGGA 2Q8CA 1ULFA 2W08A 3QODA 3VPRA 4E7SA 1QJX2 3EYYA 1Y0NA 1R1A1 1M4WA 4UAPA 3LFUA 3I59A 3JRCA 1RHI1 4MEYF 3NJVA 1H9TA 4GMP0 5E1XA 3GZUC 4QX0A 4IUGA 1UIKA 3MV01 3I3QA 3BKZA 2JDPA 4A6DA 2ADUA 1HB1A 3MW3A 2KHMA 4IGOA 3L2YA 4U87A 1ZZ7A 2QJVA 3GYHX 3VBRA 1BC7C 4HSLA 2L9VA 2BFUS 3LEKA 5L3CA 5E79C 4MTDA 4RR3A 2V1XA 3DFGA 5J1YA 1Z21A 3O1UA 2O8XA 3RG0A 2HKXA 5LWBA 1MW7A 1DYPA 2XL7A 4Q4W3 3W59A 1PJRA 4RGXA 3OR1C 5EYRA 4LE3A 3FMRA 4DOZA 1CPMA 3PVBB 3E6BA 4DQ2A 4HNTA 1B59A 2J42A 3DWLE 2JE9A 1Z77A 1LOBA 3BN6A 4J6GA 1GZWA 5BNNA 3VHNA 4CGZA 3AFGA 4CCCA 1LNSA 1HN1A 3PJRA 3BODA 4Z92B 1Q8VA 2KZGA 2UY9A 4WV8A 1N25A 4XOTA 4UFJA 4YFZA 1DQ5A 3I3EA 3EETA 5FP8A 5LRRA 1JXNA 3OBTA 3TQNA 2JVGA 1YHQI 2CSGA 1Q8SA 3MYXA 5DCFA 1XOYA 3MIBA 3ME2A 3CCYA 2R7EB 2IXJA 4XFIA 5J3UA 1EV13 3ZMUA 2OAZA 2MNGA 3K69A 4Y5SA 1DU0A 4Y4YA 4GB33 4P9LA 3IDEA 1P9QC 4F52A 1PGW1 1QGLA 3GCMA 4DYQA 2HBUA 4BBSJ 4BACA 3ZFGA 1RUG2 3HT2A 2WNVA 4IQPA 4KL1A 1R093 2OCEA 4NIHA 3HYIA 2OF7A 4MLOA 2V4VA 2HR3A 1ETWA 3NSTA 1A5JA 2EIMH 1FAYA 2IXLA 4MXVA 2VZ1A 1S1AA 3NV2A 2DWRA 2P7VB 3PUSA 1FOD3 3VBFC 3SFZA 1QIQA 1S2EA 3HVDA 1SFUA 3CMMA 3MFAA 2AH2A 1U78A 2EFNA 1GV2A 1DGRA 3A4CA 3A23A 3HUGB 3K9TA 5L7OB 4QPIB 5IP9J 3MVPA 1VP6A 1RR8C 4U7DA 3C1DA 3M3QA 3VYRB 1V55H 3FBYA 4YIFA 4HKWA 2V1UA 2VNVA 2PX9A 4QXKA 4MQ9F 4BE1A 3N9OA 3JB4C 3S7EA 1S5LC 4IETA 3RJPA 2GIVA 5E88A 3OD0A 1RPWA 1COV2 5ABJB 1BQPA 2HVRA 4YEJA 2RNJA 1MVQA 5C44J 3V7RA 5BMZA 3IHUA 3AMQA 1IN6A 3S7IA 1ULYA 2ZHMA 1VQ7I 3JCUC 1OSGA 1W6OB 5BYNA 1I1GA 5T5OA 4LG0B 2ZSIB 4A45A 2HWC2 4DXTA 2R93J 4DGWB 1V0AA 4YVSA 1IS4A 1XE0A 1SCRA 2R3SA 1KYZA 1LHWA 2WZR3 3GZ5A 4WM8B 2RREA 3BTJA 5FZ9A 3K6GA 1ACCA 5J1UA 3V42A 2WNUB 2K0GA 3S8PA 4P1WA 4O7XA 3AX4A 2AS5F 4P5HA 4XXPA 3OOPA 4EJRA 2HDDA 4YZ5A 3PMEA 1AJKA 1HRV1 4A44A 4P55A 2RN7A 3SZGA 5DD8A 1CAUB 5D4SA 1VBC1 4WVMB 3ETQA 4B3NA 3LSHA 2D6KA 4D5CA 5ACA3 3CESA 2OU2A 5LGTA 3RJRA 1POGA 1A8DA 2RS31 3B9IA 1VFCA 2L9RA 3NAPB 4G9YA 5LHHA 2Z33A 2NNNA 4FE7A 1WJCA 2IAIA 5FZHA 3JD73 4AEJA 1YIOA 4J01A 3MKLA 2JSPA 4CUGA 3RSJA 2J1UA 1BVVA 1VQ5I 5M5WJ 5FLVA 3LEMA 3I2FA 4CEWA 4XRFA 3IAS2 4G94A 1OKRA 1HQLA 1GQGA 1T6SA 5J4VA 2HQ5A 3OEBA 2VNOA 4INDA 1YC61 1ZGJA 4OIOF 3KZYA 1WCUA 3AFHA 3NRUA 4OI4A 1K5JA 2PMZN 1XE7A 4QX2A 1V6NA 1W7PD 1YQ2A 2JD4A 1BBT1 5F5IA 1HDDC 2VN2A 4P9WA 3ILNA 2B46X 3L7WA 2BE5F 2OC6A 4XOPA 3TO9A 4BE3A 3CJRB 3D6EA 1Y8QB 4FSJA 5FXWA 2CWEA 2GLOA 4C90A 3OL3A 1CWPA 3E5UA 1JYNA 4GFBA 1AA7A 3ZIWA 4FFIA 3F8FA 3UGGA 3RPQA 3ILRA 1ENRA 2HQRA 3T08A 1GUIA 4CDXA 1ZRIA 5J48A 1GZTA 2WB1N 3G1OA 4K8RB 2MLGA 4LPLA 1TTYA 4PFOA 1T08B 2XXZA 3NEUA 3VBSC 4OWRB 4BL0B 2R7OA 2IPQX 2IP2A 1V3FA 2ZNYA 2ADEA 4RSUA 1UMIA 2WRAA 4NRQA 3I54A 3WHUA 5FLHA 1PM7A 2IS2A 2TDXA 1IG7A 1WMFA 5M0TA 1Y6IA 1I1SA 4EZHA 2LUWA 2B9UA 1Y1VJ 1SZBA 2VOXA 3I53A 2CO5A 4YZ4A 4Z1VA 4Q4X1 3IH4A 5ICFA 2R0QC 1IRXA 2R7XA 4I3PA 2O0YA 2E36A 3WY6A 3T3YA 2OUJA 2WINB 4JK1X 4D6RA 4YVWA 2CY6A 1JI6A 1WA6X 4KIBA 3ZFEC 1PMJX 5DPNA 4C1XA 4GMP3 1SQ4A 5F3CA 3F8BA 5ISLA 2ZEZA 3ONQA 5FQ0A 2QENA 2YU2A 5KAIC 1OF3A 4META 1T6GC 1TT0A 5FXVA 1BBYA 4R52A 4D7SA 2XMLA 3FC0A 4MGKE 1LESA 5T50A 5LW9A 5T55A 3DYMA 5LB6A 1Q56A 1OVSA 4CU7A 4XKBA 3VBFB 3R61A 3LSKA 4ZS3A 2RC4A 1UY4A 2VOTA 3T2OA 3J8F1 1ZGAA 2DFIA 4QU1A 3F8CA 1TG7A 4TSVA 5EGOB 1G8WA 1MZFA 1IN4A 3WDWA 1X4OA 2PHLA 1D4M2 1LHUA 4C30A 4A6EA 3NV1A 1WBFA 4FTSA 3A0BC 4I30A 1F8VA 3FWEA 2DDUA 2BBVA 3FHZA 4UI9L 1SFYA 4O65A 2O8OA 4HSRA 3TO6A 1FC3A 1UZVA 5FPLA 4E4DX 1NA1A 5FZGA 4A3CJ 4HSTA 4YW3A 5FPZA 2AYHA 1DYOA 4Q48A 1YX3A 3HOYJ 1MQTA 2HWF3 2Q1MA 4CZSA 5F04A 1D4VB 1LEAA 5DZFA 4FO9A 1HIXA 2Y0SN 1IGNA 2W57A 2NS8A 4DQAA 1AYN1 2QDRA 1WVRA 2M30A 2DCJA 2GNBA 4BLIA 4CCJA 2BVBA 1PVXA 5A7OA 3CZJA 4B1LA 4ITCA 3DF8A 1WJDA 4PF1A 3F3XA 3ZFEA 2FMYA 3DTIA 2GH8A 5T3NA 2EVXA 1T56A 5H9PA 1RUOA 1OLQA 4RAYA 3OY8B 1R6RA 3WTVC 2B39A 2RR13 4NWWA 3MICA 3FMSA 1Y9MA 2DCEA 4XF9A 3VHPA 5D8AC 5IVCA 1FOWA 3OUJA 2F5DA 1RC9A 3IAQA 3L2VA 4ET7A 1S3JA 4W1UA 4HF1A 4GYIA 3WG9A 2Y69H 3BY6A 5IW0A 1VIWB 2O7OA 3C7HA 1O7LA 2BVVA 1MKMA 4LKFA 3D5LA 5F6FA 1ENHA 4A6OA 1PIV3 2X10A 4GAZA 4AK3A 1NG7A 1AXZA 2J1TA 2QQUA 4XKWA 3K77A 4BJ5C 4MHUA 3S2WA 3N9LA 3RI8A 4DXRA 4ZZ5A 2LROA 1ZG3A 4XONA 2ZJRF 1Z0HA 2ZEWA 5EWSA 4P9IA 4XRSA 1VQMI 3W5MA 3K4AA 3SQNA 1UOFA 3TYJA 1QGPA 4HMZA 4UW3A 4Y26A 2FHRA 2LRDA 3QPLA 3UV9A 4CPBD 4BXUA 4K1YA 5HLTA 4FPOB 4KFCA 1RUC1 5F1RA 3ZSKA 2WLQA 4BCUA 1D7PM 4NR1A 2DJIA 1GU3A 1FBSA 2W1OA 4GXOA 1U5TA 2LVSA 1WJ5A 2L4MA 4FBFA 4AXOA 2OTLI 5SV5A 2YXSA 1LRHA 1B8IA 2XF7A 1VQ9I 5JXGA 4G4FA 4AM3A 4V2WA 1EH7A 4E7JA 3T2PA 2KRHA 2GMMA 2OA4A 5A6YA 4B1RA 3QRFF 1O6UA 2HWB1 2UURA 4TV7A 1J58A 3ZMTA 1FMWA 1RKTA 3IUOA 2DVGA 3S1QJ 2VZVA 5FRMA 2HWVA 3K4JA 2RMU2 2H6CA 2FDGA 4Q4V3 5C4WA 1IZ1A 2A3YA 4KWKA 2A3WA 1GOHA 5FZ7A 3VBSB 4A93J 4BBRJ 2I07B 1MGTA 1VBD3 3PNAA 1PUFA 4FOYA 1N77A 1UYXA 4OI0A 3OUIA 4P08A 2Z99A 2RS11 4DYCA 4UYBA 4Q4Y3 1MS3A 1P4XA 2QNKA 1AR92 3BB6A 4XMAA 3NVCA 4Y1ZA 3IP4B 2K9MA 1RUE2 2RVCA 2RKHA 4OZXA 1NXMA 1L0OC 3J81K 3ZSLA 3CQZJ 5ILUA 5FK8A 1XSRA 4HLYA 3TEWA 4DY5A 3MF6A 5FLMJ 1OYWA 5EEAA 4IDZA 3ZFEB 1FTTA 2RJLA 3T4HB 1RVF3 4LMFA 3CF5F 4BY7J 4HBLA 1ASJ1 1HKSA 2CH0A 4IQJA 4PSXA 2EXKA 4L5EA 3H7YA 1SEFA 3WV6A 1OQ1A 1SMYF 1YRNB 3HQXA 1HCRA 4HANA 2D6LX 3LB9A 3FXLA 1LVAA 2BGPA 3MIGA 3J7AY 5A7NA 3M3CA 1WH5A 3U1XA 2VIXA 4PLNA 2XDVA 2XVLA 1CAXA 1LU2A 4R1HA 3H5RA 1FBQA 1RJ7A 1RL3A 4LOCA 3AXEA 4ZONA 1FMD1 2RV8A 4MX3A 2XROA 2JK3A 1DQ2A 3P3PA 5DZGA 3F8NA 3K4ZA 4ESFA 1EJ9A 5BNOC 1H30A 2ID4A 3WUDA 3S5AA 2PQQA 2UYAA 3KYDB 4OVEA 1QJX3 1SVLA 4EJUA 1W8ZA 1YJKA 1OQYA 3RTRA 2OUMA 1P2FA 3DL3A 1R1TA 3C2HA 2LH9A 2QQNA 1IQDC 1LENA 3I3DA 2IEKA 4MGZE 4K1ZA 1S0CA 5F27A 1SBEA 2BV4A 3HC7A 3L2UA 4ISRA 4I01A 4E27A 2E7XA 3K70C 1GP6A 2XONA 1ZBE1 3BPZA 1BEV1 2Y34A 5AC91 4LB5A 5HLIA 4AYBN 3RYPA 4ATFA 2FBKA 4ES9A 1DPUA 2RDRA 1YW8A 3H3LA 4P9GA 4UUSB 1ZM1A 3UYJA 4QX1A 5A7PA 2ELKA 3OGJA 3VZJA 2WY8Q 3VFZA 4NJ4A 4K7JA 3L2HA 1YX5A 1DQUA 4KH9A 3ZSJA 5D5WB 5KHGA 3J7MA 1C8M2 3WTXC 4R9AA 5D8AB 3BJAA 1YCIA 2LY9A 5KHDA 2CU5A 2DTYA 4I3GA 4CP0A 3DP7A 5E1ZB 4B47A 1AF9A 3POBA 2R0FA 1DZTA 3FUOA 4LHKA 3HSRA 3RZHA 4AI9A 3WF2A 1G4DA 1VRH2 1MBKA 5FB2A 4NHLA 2JQ7A 1WA4A 1SDWA 4P9XA 4HLTA 1QZZA 3PU8A 1MMSA 2JSCA 4AYUA 4Q27A 1RUH2 2QE3A 2ZMKA 2ZPXA 4EZ4A 2WT2A 1YQ8A 3NWKA 3OS1A 1D8KA 1PO12 4Q2FA 2WNEA 1RUG3 4HW0A 3I97A 3N7KA 3SH3A 1CF7A 3M70A 5F9TA 2ZTNA 3CCJI 1PZ8A 4BS9A 4M74A 1I5PA 2QVOA 4WX9A 2FA5A 3BVCA 5D2AA 5FLJA 1NK2P 1E2XA 1O8SA 2KZVA 1YS6A 2FNPA 5CA6A 4XZUG 3KIOA 1OMIA 4YG3A 3AKQA 1F4AA 4IE7A 4JYKA 2KIFA 1CAXB 2Q30A 4CEYC 5J8FA 3VKMA 2FDHA 4YW4A 2NVQJ 3ZVXA 1A6CA 2XVGA 3DF0A 1AZDA 5I8YA 1MPXA 2VBWA 3O1OA 5A32A 1A04A 3CCMI 2ILMA 2P3KA 3I56I 3GGLA 4X8PA 5EJ3A 2Y48A 5EIYB 3J26N 5KWRA 2A7AA 4TLGA 1WLWA 4Y4RA 4S2FA 3A21A 3M3YJ 4AEDA 4AHXA 2WZPP 5FZOB 3BPSA 1APNA 3RSNA 4CTEA 2LG4A 2D1VA 1COV3 4P96A 1DYKA 5FYCA 5A33A 1H8TC 3M8FA 3GLLA 3DTKA 3O1VA 2TNFA 1A34A 4II2A 3MV11 3I2HA 4QHZA 3K4NA 5A6ZA 1X19A 3OD4A 4JV4A 4FPFA 2D3PA 2YPDA 4CHUA 1BXHA 3KT1A 2Y6KA 3GTMJ 2IS4A 5I0SA 1J0RA 4QPOA 4CP1A 1OPOA 3CMEI 3K4KA 4UBGA 5A3WA 3CJTB 5DDJ1 2R32A 2OYZA 1S0BA 1ZZ8A 3MW2A 5D8LB 1VQ8I 4A42A 1YG2A 1MZBA 2V72A 1LGBA 2WS92 2E1NA 1MDMB 1QF3A 1HKQA 3A1YA 2VZSA 2HOEA 2VBZA 3JRIA 4UBHA 4CDQC 4XLEA 1VAMA 3WNNA 1Z05A 1WLDA 2HS5A 1XNKA 1WW7A 3HXLA 4O5VA 4AVTA 1R23A 1HXS2 1P4AA 4GWJA 3ZQFA 2A3SA 4BDYA 4B3XA 4XF4A 1FP2A 2P2KA 3LL7A 3CCUI 3BROA 3ZYJB 1K78A 1XYOA 3ZFFB 4NIGA 1T39A 3TMOA 1D0YA 4PFPA 4LLLA 1A78A 1REDA 5I0RA 3HRUA 4A7YA 3AMHA 5BNOB 4GDFA 1UN1A 4A5MA 2FF4A 3O3KA 4G7HF 2EPFA 1KD7A 4MHGA 3I9V2 4C3IJ 1B72B 4Z2YA 5FY8A 4LK0F 3SDGA 4MGTA 1ZKGA 2PTMA 3ZXEA 4UV8A 2EXHA 1OXCA 3AMPA 1BJAA 1MBGA 4HT1T 4ZYGA 2KXLA 2W0XA 2R042 5JXJA 4QPGC 2EFQA 5F2SA 1W6PA 4D7MA 2ZFUA 1T98A 2JD9A 4RGSA 1S0JA 5HCAA 2Y0OA 4DY3A 3AG4H 2E1CA 1UU4A 3I2JA 2WAQN 3WP3A 1IGOA 2NMOA 2FCTA 5DCMA 2ESNA 4E8DA 1JS9A 1YJLA 5FREA 3BCAA 5AFEA 2OQ7A 1TZLA 3WF1A 2NMNA 3IDBB 4KN7X 5D4RA 1VBE1 1D0ZA 2A5WA 3FBIB 2R6QA 2VUDA 2EZKA 3QBQA 4ZXEA 1OCTC 4AD9A 1YYVA 2VVEA 2HOSA 2XGDA 5HXVA 2DQLA 4YIRX 4JTNA 2F6CA 5DUWA 3LSDA 1BR1A 4KWLA 2X5IC 2Q8DA 1MMDA 4XLAA 4OHVA 5KXDA 1UY3A 2WAEA 1NKGA 5D21A 3ZR5A 3AZWA 2P4WA 3UGFA 3TN91 3Q9OA 4L11A 2EF6A 4MFDA 2HVSA 2QQAA 2YPJA 5FR3A 1DP0A 1MS1A 2DV9A 2JG9A 4QKBA 2KPMA 1TWGJ 4YW5A 2V6CA 4BQ5A 1WLCA 1XSXA 5I8SA 4PJLA 1JUPA 1UHMA 1OCCH 4KG0A 4HDVA 4I99C 4H14A 1FYUA 4DXZA 1AYM3 1FATA 1W8HA 3C2GA 3BTLA 2XJVA 2M7BA 2B63J 3H1CA 4CYCA 3P9KA 4UV9A 1IDYA 1AVBA 2XASA 2CYFA 3QLQA 3LWFA 4OHZA 1UOGA 2ZMEC 1AR81 4NN0A 4AVAA 4BQAA 1DZRA 3N9MA 3LOCA 3ZXDA 3INAA 1RGSA 1RUJ2 3KMHA 5HXMA 2R072 4Y52J 4HK8A 5F3EA 5HCBA 1Y9GA 3AL5A 1D1BA 2GZWA 3RKWA 1N78A 3JTGA 2CUZA 1K78B 1G7YA 3ZYIB 4CEYB 2BU9A 4KISA 5I8TA 1MS5A 3LOIA 3WGHA 4WZFA 4JTOA 1LHNA 2VT3A 2Q2EB 1D4M3 4XETA 3JQXA 1HQCA 2XUMA 4BEHB 1JH5A 1LE8A 5CYYA 4QPQA 3TB0A 1ZRCA 4Q0PA 3ENRA 3LSPA 3QH7A 3VBOB 3REOA 3N7JA 3QYEA 2IXHA 5FPBA 5FZDA 2Q4SA 4RHV1 3J9SA 2MD0A 5F1JA 1H8TB 2XBO2 4FPJA 1VQ4I 3K48A 4WXDA 1ZYRF 1YI9A 2ZFWA 3CCSI 1G3YA 3WDYA 2JA2A 1W06A 4Y20A 3PSFA 1WCMJ 5TISC 1Z7S2 5FGMA 5A1AA 3P1IA 1JYWA 3JAMK 3H5AA 5FLXK 4OIRF 3VKOA 2BW8A 3HBZA 2QBYA 1LQ1A 2ORZA 4B4PA 2CV1A 1V9U2 3GCXA 2K7LA 4UVCA 2X6XA 3G71I 4PIYA 3NNLA 4EN8B 4W6XA 3UKGA 1KJLA 1G3SA 1RUD1 3ZIXA 5DCMB 2NVXJ 1GR3A 5IATA 1GNZA 1PUEE 1R1ZA 1PGL1 1MEC2 2CUFA 2ZZQA 3PL0A 2CQQA 1AL0G 1FPN1 4CDQB 5JCTA 2HVQA 4KMUX 4JGZA 4MV2A 4FFGA 2VOVA 1SMVA 4IRGA 2E7QA 1E3PA 3GDBA 2R4GA 4JRAA 3BOQA 1STZA 4QAWA 2DMTA 4Y17A 1HQWA 2ERFA 1WI3A 2K4BA 5JZGA 4CE8A 2GWRA 2ECCA 3C7OA 2P6HA 2G1MA 3CJIC 3HEIA 4E70A 1S9HA 4A3JJ 4E4ZA 2CV6A 1B9MA 2NRAC 2R30A 2R16A 2JDYA 2RDPA 4DPNA 1W5TA 3KSCA 4AVZA 3FMQA 5IOYA 2VMDA 1QWRA 2ISZA 4IEXA 3H3UA 1WW6A 2ZGPA 2MEV2 5JVGF 2C9AA 3OEAA 2PMHA 4LO7A 5I0TA 1MJBA 1K83J 1V5EA 2LD5A 2VPRA 3FIWA 3EQLF 1IS6A 1WCKA 2XB0X 4RMNA 5GZGA 1IO2A 4QPGB 1BW5A 3D4KA 3WU2C 3RI9A 5L3FA 4C91A 1TNFA 4YZ2A 3HM5A 2K2SA 2VM9A 3H92A 2ORXA 4J00A 2H8RA 2VJ5A 1OHFA 3WHBA 4A3XA 3WTZA 3WDXA 4XUPA 3B6AA 2JDZA 2W68A 4OIQF 1KU3A 5DUUA 3LSRA 5IJRA 3PUQA 4IKFA 2ZGUA 4QLCU 4YLZA 1JGGA 1W1WE 4GWMA 2RMU3 4H2AA 4KNYA 2FEZA 1APLC 2KT0A 4G3YC 5F8PA 3C18A 3AZVA 2LTPA 2E26A 1G3TA 2VMIA 1XMKA 2BNOA 2H27A 4G7OF 5C71A 1ULCA 3QU3A 5EG0A 1BW6A 4CP9A 2X5IB 5GZFA 4BE0A 4OUMA 3OYEA 2XR4A 2P6CA 2XLAA 4OCTA 3HPHA 1AR93 4C2TA 2QA4I 1ODNA 1K3IA 1RUE3 5GZDA 4GB31 3KB5A 4LORA 1OCOH 3K4DA 2A5YB 2IA2A 4IX7A 3O1RA 3BOWA 2EH3A 2JDKA 4PF5A 3WD5A 3I0TA 1NCRA 2ZSHB 2OPWA 2DVAA 3C3VA 1TMF1 4N7IA 1JUIA 1TC3C 1XC5A 4XMIA 4BQWA 2IVIB 2YMZA 4CZZA 1R58A 1J83A 2ZMEB 3LNQA 3BZKA 3POWA 4EROA 1MBEA 2DK5A 1IOAA 2E6VA 5DG1A 4LBQD 1UO9A 4XFCA 1MSFC 1MS8A 1SFEA 4CCKA 1OC1A 3U78A 3JQWA 1W2TA 2DTRA 3K1NA 4RS5C 4NHXA 1VALA 3RZGA 1U9NA 2ZGKA 5JOWA 1S0GA 4DBRA 4A0YA 3ULQB 5GLVA 4LKSA 4N4OB 3LPGA 4BGDA 2NNYA 3IC7A 3O0WA 1J5YA 3JBG1 5FD5A 3DYOA 4ZU7A 3ZKUA 4N53C 3PDQA 4HA8A 4KBZA 1W36C 1BJZA 2HEOA 4F3QA 1NAEA 1IS5A 3O1MA 4NPLA 4IEPA 2BWAA 3KEYA 4CU8A 5KHIA 2VCAA 1K6OA 2IXIA 5HI0A 2CFOA 1CAWB 4WXHA 1OUSA 4E2GA 4COWA 3HQRA 1QH6A 4PK4A 1JUSA 4M3EA 1W9FA 2E60A 2YSRA 5HNFA 3K51A 2CHHA 1SMTA 4BIOA 2EWNA 1H8AC 2ECBA 3V7CA 2WKKA 2BBYA 2P37A 3VSKA 4LO6B 4EJTA 2KISA 1XX5A 1QJZA 4WZCA 1B35C 3V8JA 2XSJC 3R0JA 4M01A 4ZZDA 4XURA 2YDEA 1TME2 5J09A 2PG4A 4QMAA 4AVPA 1MBJA 4HOOA 1VAKA 1W9TA 3NJZA 3OB8A 3V0AA 1IAWA 2BTVC 3VV1A 1C8M3 2E2HJ 3LDBA 5C3OA 3FBNB 1R1A2 2W94A 1RHI2 1QO0D 2VBPA 3K0LA 3FBMA 3OTFA 2VE9A 2UWMA 2VU9A 2ELJA 3A03A 3DEUA 2F4PA 1D3YA 1HDKA 4IHSA 1GNHA 2DOEA 1TQIA 3SQOA 1MH3A 2WO2A 4L9NA 3L2CA 3H36A 1VRH3 3NNJA 1WBLA 5HLHA 3RIRA 2RS51 3K75B 2E1MC 3JRGA 1JU3A 5IT9Z 3E6CC 3CJIB 2M1BA 4XYXA 2XOMA 2GNTA 4IV1A 3USUB 2D97A 4FAHA 1RUH3 4K8FA 3M7GA 4MGYE 3CMAI 3IH3A 3DCQA 3BG7A 3A01B 5K0UA 3ZX7A 2UWCA 4MYEA 1J75A 1NHAA 1PO13 2A5ZA 4YYOA 1WHUA 2AUYA 3CKHA 4GH4C 1IF1A 4YW2A 1N1VA 2E34A 1Y39A 3WG4A 3FHIB 2K9SA 1JUHA 3GZEA 3A7QA 1X7NA 2ZEYA 1IV6A 4RM3A 4FPGA 3JR9A 1CR7A 5F3IA 2PAMA 2Z5WA 4IRIA 1W7PA 5B4XA 1LOAA 1RKWA 3KV4A 5FV3A 4AAXA 4AFBA 2ZC2A 4MO7A 4TYSA 1ZBA3 2AXTC 1SFPA 1X33A 3Q9SA 2VW1A 2CW8A 4CDUC 5DYMA 1FYLA 3J7YJ 1O3QA 1HKDA 2FQ3A 4ZDLA 2CTVA 3S30A 4A3BJ 1PGW2 4XOGA 4S2HA 2YC0A 1L3LA 4L5IA 4ZY9A 1MMAA 2W46A 2BEOA 4KQ7A 5FROA 1J1TA 3PLQA 1T95A 1X36A 3PIPF 5EZWA 5JR2A 3WHCA 4FP2A 4F3JA 3OYWA 1UHWA 2X6WA 1REPC 5F5AA 1D1AA 2DA2A 1G9CA 1HW2A 5C9AA 5IOZA 4IERA 3CCEI 1U2WA 4YGCA 4AGVA 1H6YA 3IB3A 4CCLA 3GBFA 2DT6A 3WEZA 3HJEA 1PO21 4LO5B 1WWXA 3KM5A 2ZS6B 4FFHA 1BK1A 1XCVA 3OCPA 4MGSA 3BALA 3W2AA 2RG4A 1WJEA 5IFTA 3UL2A 2VZQA 3O0XA 1N3QA 1C1FA 5M3FJ 5IPAA 1JYTA 3ZYHA 4EE2A 4CXWA 3RPUD 1W6MA 1HXS3 3EUAA 4A3LJ 2ZMNA 4RAGA 2QQJA 4ZKTB 5GPAA 4HPQA 3RZMA 3ZRGA 1YEWA 3FXJA 4AU7A 3WP6A 1JJ6C 4XLNF 2EIGA 2VKEA 5J4YA 4YIIA 1D2SA 1QPIA 4OZOA 5IYYA 4RS5B 3KQRA 2R7DA 1AX2A 3JRAA 5C8CC 3W20A 5DAWA 3BJOA 2QZ2A 3OMYA 4COUA 2V9VA 4N53B 4CDUA 1K45A 4ZDOA 2VMEA 5CVIA 2KL4A 4UT5A 3OWTA 4PBPA 1B1BA 4HRIA 5A3LA 3V8LA 4KGGA 3KP6A 2VBDA 2Q1ZB 4LMYA 4XXAA 4LLFA 5EXOA 2EV0A 3CJXA 1O4XA 1RITA 3V0BB 4XNFA 2R061 1Y9QA 1JYXA 1O91A 4FPHA 4AQ2A 5DMYA 2L7FP 5JSOA 1SD6A 4YW7A 4NHMA 5CFDC 3L1PA 1S0EA 3WXPA 1CQ9A 5H9QA 1XSDA 1QHDA 3GZTB 4OQ9A 5LA1A 1S4CA 1YFUA 3UNGC 1B35B 5LCWL 5FYZA 3GX4X 1O4TA 4XJWA 2WV0A 4O9GA 3GXUA 3KS7A 5GAEJ 1EAH1 1J2XA 2BVLA 4RDUA 2W85A 3I7DA 2FMDA 2BNNA 2GU9A 2FUG2 2Y9YA 3U1DA 1RESA 5CBLA 2BERA 3FHAA 2P1BA 4W65A 3ACHA 4AGRA 3H5NA 2ZBJA 2W1WA 4TXWA 1A3KA 4JZRA 4UFLA 4QB6A 2NVYJ 3ZKYA 3S1MJ 1W0OA 3EB7A 4FPEA 2G9WA 3L9JT 5A3UA 3LDRA 2ZBKA 5IY5H 1R081 2ZXJA 4XIKA 3H8RA 3FZVA 1I27A 4M3CA 3DEEA 1BBT2 4DNCA 1HV1A 1YQ6A 1ETVA 3THPA 4R4ZA 4O6JA 2RHPA 2E1MB 2EINH 3G7DA 1XCBA 1PK6A 3T2QA 3WTTC 2EFOA 5FYIA 4HVQA 3FXKA 2W1QA 2WLPA 2RVAA 1POV0 4LK6A 1D1CA 3LEIA 4MSVA 5JPNB 2ARBA 2D6PA 2HWD1 2R7TA 4GH4B 5AVPA 2UY8A 4L8QA 3T30A 2NZ9A 2WFF2 4W50A 4MGIE 3B94A 2O14A 3T0DA 1LDJA 2NXNB 5LA2A 1N1YA 1GQHA 4CA0A 1BC8C 4LHSA 4E7HA 2R073 3KP7A 3J80Z 3LZZA 2DCTA 1D2QA 4CPBA 3AL0B 3I4MJ 2A1XA 1O3RA 4Q0VA 5EPAA 1WI9A 2DMPA 2ETEA 5K7FA 4OULA 3VL8A 4AI8A 4Q4X2 4F55A 2J1AA 3Q8AA 4MFEA 4B1MA 1X1CA 1RMU1 4TTGA 3LWCA 4HG2A 2FMLA 3NV4A 2O6GE 1F5JA 3ZN1A 5H6RA 4ZYAA 1L3JA 2HPMA 3SEPA 5F39A 2LS6A 3LAGA 5KK1A 4KN4X 4E7LA 1QKQA 2R5ZA 2XBO3 4Q4Y1 5FZKA 1IPKA 2IWGB 3OYIA 2DLLA 5FP3A 1XNTA 1ZGWA 2W47A 1MACA 4MGQA 1OFNA 2QGUA 2B0LA 2GXAA 4A2UA 4M73A 2V4JC 2WUHA 4UFHA 2UUZA 4HLXA 2VMCA 2WWUA 3ZN6A 1T33A 4UFKA 1D5VA 4BPZA 2I8DA 3J8F2 1V9U3 3BOPA 1NZIA 1KU2A 1QBJA 1CD3G 1UAAA 2NM1A 3I2GA 4QKFA 3WVJA 2BW3B 1YXWA 1G6NA 5FY7A 1ZX5A 1WLTA 3IKVA 2BPA2 3POGA 3AKZA 1KDKA 4GJZA 5ILSA 1VQOI 1MEC3 4IEQA 2KRCA 5FKOA 4A3KJ 1BI2A 1CX1A 4FOWA 4QKNA 2R5YA 3KCYA 1ERDA 2TRTA 1J9IA 1YWKA 3S57A 3M3OA 1O3SA 3FFQA 1TW3A 1QMJA 4N90A 2X85A 2M34A 2CFXA 1WMXA 2ZKZA 2HZDA 5E1WA 3ZQQA 2AREA 2WT0A 3HQUA 3S93A 4COYA 1PP7U 3FF5A 3VDXA 1AYN2 3BWGA 4I09A 5DD4A 5C8CB 4HBNA 2LYCA 2R7FA 2PXJA 5KHKA 1H89C 1I6XA 3OYDA 4EGYA 1AR73 3QYBA 2VR4A 3TO7A 4RM2A 2KR2A 2VC9A 2XQXA 3GZNB 1SD5A 2BV6A 2ME0A 4PDKA 4MZUA 4FXKB 2MH2A 1K5MC 5BOXA 1T8IA 2R92J 1OA3A 3H35A 3TRSB 2MEV3 2PLV2 2ID6A 1MBHA 2X1CA 3R05A 3PIGA 3S17J 2WSUA 3RQ4A 3AVRA 3JXSA 2OQGA 3MUY1 3CJNA 2GA1A 2HZTA 4L97A 3P6BA 4FFFA 5HPOA 2JJ7A 3AKTA 1R5GA 2LFBA 3AM2A 2DVBA 5CFDB 3E6MA 3MEXA 5ANNA 3UJQA 1DLCA 1AR61 3FISA 2DDBA 3CNAA 4AWXB 3KP3A 4CU6A 3KLNA 1RUF1 2KIUA 3DGTA 2YY1A 4CXFA 1FNZA 4QPYA 3GTGJ 3RKQA 1YFYA 3S0MA 1NTCA 3IWZA 1Q3EA 1ZLKA 5FJHA 4MOAA 1UXZA 2HXOA 3HOUJ 3IMMA 1W6NB 2VQAA 3H8XA 5FYHA 1Q8OA 2QQIA 4YWAA 2JX9A 3B02A 3FXRA 2H1KA 2VJIA 2P34A 1RYYA 4RFT0 3S14J 2M4GA 1QU0A 1X3UA 5FRAA 4AHYA 4XBLA 4PJMA 4RAZA 1DQ1A 1T2KA 3N9QA 5FD6A 1LOFC 3AYEA 4JKLA 4IXAA 4N8MA 3W2WA 4CA9A 4JDMA 1H1AA 5IK8A 1PVC1 2J22A 3N9PA 3VODA 3GF2A 4BQ4A 4D6QA 4DINB 5FMOL 4KWUA 5L73A 2DFBA 1GOFA 1SFOJ 2PLYA 2A69F 3GVAA 1UFMA 1DGWX 3O1TA 4UXAA 1LTEA 3MF9A 3OF1A 4EWEA 3HG9A 2ZGMA 3PU3A 3VBUA 1QNWA 4AVVA 1MR5A 5EFUA 2HWB2 2XHNA 5KXEA 4QXBA 5EDNA 1W8WA 3KT4A