1PO11

Poliovirus (type 1, mahoney) in complex with r80633, an inhibitor of viral replication
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
283
structure length
283
Chain Sequence
AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Ligand-induced conformational changes in poliovirus-antiviral drug complexes.
pubmed doi rcsb
total genus 48
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1po1100
1CJDA 2BFUL 1HXS2 2RS33 1PIV2 4JGYA 4RHV1 1PGW2 5BNPA 4JGYB 1PO21 3HAGA 3JB8A 1COV1 3VBFA 5C4WC 5CFCC 4WM8C 1QJY3 1QJX3 1TMF3 1V9U2 1AYN2 1C8M1 1WCDJ 1TME3 1OOPC 5D8AA 1RMU3 1OHFA 2HWB3 2QQPA 2BUKA 2HWC3 3M8LA 4Q4W2 1X36A 1W39A 4Q4V3 2RS13 1HXS1 2R061 2WFF3 5FOJB 1VRH3 2R071 3DPRC 3J8F3 4RHV3 1FPN3 1R081 4N53C 2WS92 2XBO3 1C8NA 5C4WA 5CFCA 1ASJ2 1POV1 4WM8A 1PGL1 1AR73 5C9AC 4WM8B 1NOVA 2DF7A 4CEWC 5A32B 2WZR3 1EAH2 1OOPB 3VBRC 5J96B 4IV1C 1RUE1 1ZBA2 1HXS3 2ZTNA 1AR82 2R073 3DPRB 1NG0A 1R1A1 4N53B 1ND3C 1RHI2 2GH8A 2RM21 3ZFEA 5L7OC 1V9U3 5C9AA 2RR11 3JD72 4CEWA 1QQP2 1RUF1 3JBG2 3VBRA 4Q4W3 1BMV1 2HWD2 2RMU2 4IV1B 1RVF1 1AR92 1NCRC 1VBB2 4CDUC 2WS93 5CFDC 2MEV1 1ASJ3 1ND3A 1VBA1 5L7OA 2BFUS 4YVSB 5L7OB 5DDJ1 1D4M1 2RR13 1EAH3 4IV3B 1NY71 1QJY2 1TMF2 3LOBA 4RR3B 2HWD1 1RUD2 1ZBA3 1X33A 1DDLA 4YVWB 1FMD1 1RUC1 1NCRA 1AL21 4Z92B 4Y5Z0 1HQNA 3TN91 2HWF1 1RUH1 4CDUA 5CFDA 4CDUB 1RHI3 5CFDB 1VBE1 2MEV3 4AEDC 2Y26A 3JD73 4QPGC 4GB32 1PO22 1QQP3 1COV2 1VBC1 3JBG3 4PDWC 3ZXAC 3FBMA 4QPIB 1C8M2 5ACA1 3VBOC 2HWD3 2RMU3 5A33A 1AR93 1VBB3 1GFF2 1RUC3 1AUYA 4CDWC 5LK7B 4GMP0 2R062 4RS5C 3CJIC 1VBE3 2R072 4GB31 4AEDB 1HRI1 1R082 4QPGA 1R092 4QPGB 1PGL2 2WLPA 4PDWB 1VB4A 4BCUA 1ND2B 1RUD3 1NCQB 1BBT1 3VBOB 4JGZC 1RUE2 1OPOA 4CDXC 1A6CA 4CDWA 4CDWB 5BNOB 4RS5A 1R091 4RS5B 3CJIB 4GB33 1PO23 1HRI3 1PO11 1COV3 1QJU1 1R1A2 2RM22 5A32A 2FZ1A 1C8M3 2RR12 1OOPA 3NAPC 1RUF2 4JGZA 4JGZB 3ZFGC 2ZZQA 1BMV2 3VBUC 2R063 1VAKA 4CDXA 1RVF2 4CDXB 3DPRA 1NA1C 1RUI1 3S6PA 4N53A 1R083 1R093 1VBD1 4YVSC 4RFT0 4NWVA 2MEV2 1POV3 3VBHC 1E57A 1VBA2 1B35B 4IV3C 5DDJ2 1D4M2 2BPA2 4RR3C 1CD3G 3NAPA 5GKAC 1NY72 3NAPB 4RQPC 2RS51 2PLV1 4IV1A 4YVWC 3ZFGA 2VQ0A 1RUE3 3VBUA 3ZFGB 1F2NA 3VBUB 1FMD2 4WM7C 1BEV1 1RUC2 1NA1A 1AL22 1RUG1 1MEC1 1NA1B 3TN92 2HWF2 1RUH2 4YVSA 3VBSC 1R1A3 2RM23 1VBE2 3VBHB 5BNNC 4IV3A 4FTEA 5ABJB 1RUF3 4QPIC 4RR3A 1VBC2 1RUJ1 1H8TB 4Q4X2 5C8CC 1AYM1 2R041 5AC91 4Q4Y1 4RQPB 4YVWA 5J98B 2PLV3 5ACA2 3IDEA 1RVF3 4WM7A 2IZWA 4WM7B 1MEC3 1Z7S1 2GSYA 3VBSA 1VBA3 4GH4C 3VBSB 4GMP1 5DDJ3 1D4M3 1HRI2 1IHMA 5BNNB 4Q4X1 3ZFFC 2HWE1 1SMVA 4QPIA 1HRV1 1ND2C 5C8CA 1NCQC 5C8CB 5AC93 1FOD1 3VDDB 1FMD3 1BBT2 2RS31 1AL23 3TN93 2HWF3 1RUH3 5BNOC 3VBFC 1HX6A 4AEDA 1QJX1 4GH4A 1ZBE1 1TME1 4GH4B 1RMU1 5D8AC 1PO12 1K5MC 1QJU2 1VBC3 1MQTB 2HWB1 4PDWA 4Q4X3 2FZ2A 2HWC1 1AR61 3ZFFB 1ND2A 1NCQA 5ACA3 3VBOA 4Q4V1 2RS11 2WFF1 1FOD3 1VRH1 1PVC1 3J8F1 1FPN1 4NWWA 3JB4C 2XBO1 5BNOA 5BNPB 5JZGC 3CJIA 1AR71 3VBFB 1RUI2 1EV11 1B35C 2X5IC 1ZBE3 1VBD2 2WZR1 1K5MA 5D8AB 1K5MB 1AL0G 1AR63 4FSJA 4LLFA 1BBT3 1PIV1 1PGW1 1QJZA 2RS52 2PLV2 1PVC3 5FMOL 3ZFEC 5JZGA 1V9U1 5K0UC 1BEV2 1AYN1 1VB2A 5C4WB 4CEYC 5CFCB 5JZGB 1RUG2 1MEC2 1B35A 1PO13 2X5IA 1EV13 1QJU3 2X5IB 5ABJC 1M06G 4Q4W1 1H8TC 1RUJ2 1AYM2 1PIV3 1POV0 2R042 5AC92 4Q4Y2 2WS91 4CDQC 1ASJ1 5K0UA 1RUI3 3ZFEB 4CEYA 5K0UB 1AYN3 5C9AB 1VBD3 4CEYB 4N43C 1Z7S2 1EAH1 3VBHA 4CEWB 5ABJA 1H8TA 3VBRB 1ZBA1 2HWE2 4RQPA 1HRV2 2WWSA 1AR81 2RS53 3VDDC 4FTSA 1RHI1 1FOD2 4CDQA 4CDQB 1BEV3 2RS32 4EJRA 3JD71 1RUG3 1ND3B 1QQP1 2TBVA 4N43A 3JBG1 4N43B 1QJX2 5BNNA 1MQTC 1ZBE2 1TME2 1RMU2 2RMU1 1F8VA 1AR91 1RUJ3 2HWB2 1RB8G 1AYM3 1VBB1 2HWC2 1AR62 2XPJA 4FTBA 2R043 3VDDA 4Q4Y3 1AR83 2ZAHA 4Q4V2 1NCRB 2RS12 2WFF2 4JGYC 1VRH2 5BNPC 1PVC2 3J8F2 4RHV2 1FPN2 1Z7S3 2XBO2 1QJY1 1TMF1 1AR72 5FMOS 4Y4YA 4GMP3 2BBVA 1MQTA 1EV12 1RUD1 3ZFFA 2WZR2 2HWE3 1HRV3 5A33B 4SBVA
chains in the Genus database with same CATH superfamily
4QXKA 2ARXA 4XUNA 1DIWA 1UY1A 4AAPA 2LS6A 1CAUA 3POYA 1G9FA 2ZEWA 1MS9A 4UW3A 1CAUB 1HXS2 1DCSA 2I2SA 4NRQA 1PIV2 1ST8A 1Y9MA 5KXEA 5BNPA 1G9BA 1KD7A 2WNEA 1O5LA 1S0IA 3M4FA 2O0OA 1PO21 2ARCA 4A4AA 4EWAA 4Y26A 3VBFA 5CFCC 2KXLA 1AX1A 2QKDA 3M3EA 1W8OA 2WA4A 2AC1A 3K4DA 3PVOA 1AYN2 4B8EA 1WCDJ 5F2SA 1HB1A 1TME3 3M3OA 5D8AA 2JD9A 5GALA 4XAEA 4D7YA 3THTA 1GZWB 2W1WA 4JZRA 3RWNA 2BUKA 1RJ7A 3GBGA 2HWC3 1UU5A 1YI7A 3M8LA 5FP3A 4ZONA 4BJ0A 5FWJA 4NAMA 3WG4A 3B94A 2RS13 1TNRA 2OPKA 2R061 4L2NA 4LBLA 2VVDA 2VULA 2Y6HA 5FOJB 3BI3A 4JC1A 4MGZE 3WNKA 4AQ6A 1FPN3 2W92A 4Y1ZA 4AG4A 1G8WA 1POV1 2BNOA 3U14A 2G4IA 1AR73 3W58A 5KBFA 3BTZA 4NIAA 4BQ1A 5A32B 1A34A 5D21A 1O5UA 1RINA 3AKRA 3H3ZA 3WZ1A 4OUEA 4QU2A 1YNAA 2D6MA 5DUWA 2OQ6A 5I8SA 3O12A 5LZ6A 3CJXA 1WBLA 2XG3A 4LLOA 1ZRDA 2JECA 4FQ4A 2YMZA 5EWSA 3GZUC 2ZS6B 4MVTA 2D3PA 1NG0A 4XUQA 3P3PA 2VMDA 5FTTC 5A6ZA 3I2GA 4UF0A 2R6QA 2VZQA 3CO2A 3GCWA 4XZPA 2RR11 3JD72 4FOVA 2QQKA 1L7LA 3EXUA 3NWKA 5T50A 4CUGA 2B7YA 4MG2A 1K3IA 1W2NA 5ANQA 3K2OA 2JDHA 2GMPA 4KGGA 2PFWA 1YJLA 4H2AA 2VOKA 1CIWA 1BMV1 2CNAA 1UY2A 2Q8OA 4C91A 2CWSA 2RMU2 1QKQA 3H1MA 1VP6A 4FXGB 2DUOA 5FP8A 2Q1ZB 1NCRC 3HOBA 4Z07A 3OD0A 4BK5A 1BKZA 2H6CA 4PI2A 5CFDC 1BXHA 3ZDSA 4KWJA 3CF6E 2MEV1 3KGZA 1VBA1 4L11A 2ZGNA 2VNGA 4QQLA 3R05A 4UFMA 2WO1A 4B4PA 1DQ4A 3OUHA 2JIGA 2VMGA 2YU2A 2VQTA 3BOWA 3UK9A 4UBHA 3N7MA 1GNHA 2CV6A 4BA6A 5C8WA 3ME2A 3U78A 1MR5A 3AYAA 1HB3A 2P6HA 3W59A 2HWD1 2VTXA 4P5YA 1O8PA 1J1TA 5FYZA 3QH7A 2GNDA 4DEQA 3T3YA 2WN2A 4LA3A 4JQRA 1LJ7A 4XAAA 4MGSA 1JH5A 5FYIA 3OY8B 4G4FA 1PZ9A 3BPZA 1HQNA 3VN4A 1RUH1 4LR4A 1UKGA 4EWDA 2BV4A 4GJZA 4YZ4A 4LO8A 3K3OA 3LA3A 4LBQA 1O3SA 2XWBB 1VBE1 3KV5A 2WO3A 3W9AA 1QXJA 5I0SA 2GDFA 5HCHA 3AYDA 2E6VA 2WQ4A 2ZX3A 4LT5A 2WQZC 1PO22 1QQP3 5HXVA 3AVSA 1H2NA 1EUTA 1NE4A 3GXUA 2BVBA 3D5OA 1YUDA 4PDWC 2TNFA 4QQHA 4S2DA 5FMDA 5CAZA 2PAKA 1RUNA 3LQCA 1WUVA 4ZS3A 5EYXA 2GAUA 3DECA 5ACA1 5I8YA 2ZJCA 3VBOC 2P37A 1BK0A 5JSPA 2NMNA 3TBDA 3I2IA 4KWKA 2EIDA 2OZ6A 1YLLA 1W3VA 4PHZA 4AVBA 2NPIA 4Q0PA 1X50A 5L36A 2D40A 3MIDA 3THPA 4LBMA 1F5JA 2IXJA 5EJ1B 4Y1UA 1IGOA 1OA4A 2D97A 2VNRA 4GMP0 4CDWC 5LK7B 2R062 1UIKA 4DB5A 1N1VA 2E53A 3VD9A 3RZLA 4GB31 5H9SA 5EYYA 3MICA 1HRI1 2ERFA 1UAIA 3SKJE 5FZ3A 3I3BA 4XOGA 4R9DA 1C3HA 4A42A 4XXPA 1ZYBA 4BHPA 4I0BA 3LWCA 3VUOA 4AHWA 1WW4A 2G19A 4AR2A 1DF0A 4R9AA 5BUVA 1ND2B 4HVQA 3RJRA 3B00A 1VR3A 1H9PA 5ANNA 2D6PA 2HLEA 5FZOA 4GAZA 4BIFA 1IQDC 1UN1A 2JB4A 3DGTA 1W90A 5DPNA 3THDA 1WD3A 4OQ9A 4IEVA 3KCCA 5IVFA 2RVAA 1U5XA 2VZVA 2D93A 4P5HA 4B7EA 5FLJA 4DY3A 4AOCA 2ZKNA 2ES3A 4NPRA 5BNOB 2OQ7A 5F5CA 5IWFA 3PURA 2VCAA 4UWDA 1R091 4TZDA 2B4KA 3RYKA 4HK9A 3RJ2X 5LASA 1W2TA 2P1BA 1QJU1 2BOJA 3MIFA 4CXYA 1GP6A 4NPMA 3FFZA 2VL4A 2XJPA 1YQCA 4X8PA 4YGEA 2FZ1A 2VPVA 4YGDA 1N1TA 2RR12 3CBNA 1GSLA 3VHNA 4COYA 1FAYA 3HBKA 1S0GA 4PLOA 1QIQA 1X9PA 1QXRA 2JICA 4BXFA 3FJSA 4GWIA 3O1UA 4IDZA 4D6QA 2VTXJ 3V65A 1W06A 1BMV2 2JG9A 4AGGA 5FO9B 4JDOA 2RDQA 4Y1XA 2J1VA 1HV0A 2BU9A 2WBKA 2X53S 1OH4A 4FO9A 2OX0A 3DPRA 4AE2A 1F31A 4QXBA 2FCTA 4MO3M 2A6WA 3PMEA 1ACCA 3T0DA 1G7YA 4RFT0 2VAUA 4CP0A 2MEV2 5IAXA 1UXZA 2VBDA 1E57A 1VBA2 2Q0AA 4BISA 5FZMA 3B01A 2VQUA 1D7PM 2IXIA 1OVSA 1O4YA 3MLLA 1AF9A 2F4LA 3JZVA 4IE5A 4UFJA 3VKMA 4M4RA 4A44A 5F3CA 3WW1A 3NAPA 4AGVA 1PMIA 1VAMA 1W6PB 3NAPB 4AI9A 1PMHX 4BLJA 4IV1A 3MIEA 4UYBA 3ZFGA 4Y22B 3RGBA 3MF9A 3U37A 3BN6A 3ZFGB 3I97A 4YFZA 3BTAA 4YZ2A 1A78A 1LOAA 2ZPXA 2YHJA 2QZ2A 1XXNA 2Y34A 4KBZA 3WOGA 3RZJA 4O61A 2C4XA 4LQRA 1D2SA 4PLMA 1RUH2 3ZXJA 4CP9A 2UWCA 3WP4A 2E31A 2HEYF 3AZXA 4CP9B 2HYXA 4CVUA 4W50A 1JODA 1VBE2 4I0WB 4XTMA 3OSDA 4AI3A 5BNNC 4IV3A 4KG0A 4FTEA 5A7PA 2JKXA 1N1YA 3TEZA 5ABJB 4RR3A 1JYXA 4GJYA 2LROA 2BTVC 1AYM1 3D4KA 3IZOA 2R041 2V09A 3GGLA 4A2UA 1YQ2A 1W8NA 4RQPB 3B02A 5J98B 5AC91 2PLV3 5ACA2 3NSTA 3O0VA 5AFBA 3IDEA 3UNPA 2A6YA 2W87A 2RE9A 4Q0VA 4PI0A 3J7HA 2GC3A 3I2HA 1F35A 1MEC3 4H3WA 4J6GA 2DURA 1YFWA 4MLOA 4GH4C 4XJAA 5CKMA 3IM0A 5DDJ3 5FKBA 1HRI2 2D7FA 2NZ9A 4ASKA 2ATFA 3WDVA 1SDDB 4MUVA 3JUUA 5IVEA 1ND2C 2ET7A 2KR2A 5APAA 5F32A 2FDIA 3ES1A 3I7DA 1IS6A 4LHSA 3SXWA 1IPKA 1D4VB 2W91A 4INDA 3K75B 1YFXA 1BLZA 1LOBA 1OQDA 4BQ2A 1AL23 1EPWA 2Y6LA 2ZHLA 4Q1RA 5BNOC 3V0BA 2YROA 3RNSA 2DCKA 3AFGA 3DKQA 5KR7A 2PTMA 3V0BB 1BHGA 5LWBA 1RJ8A 3ZXAC 2ZHKA 3VGIA 4ZZ5A 1TME1 1SHWB 5G04L 3POIA 5EZWA 4YZ1A 1ZA7A 1HQLA 4WZFA 2QVSB 1K5MC 1QJU2 2QFEA 2ZGQA 2FHRA 2GH2A 2HWC1 4AQSA 5A7WB 3L9JT 3MIHA 3SCFA 5A3TA 4HKLA 1ODMA 4Z8BA 2RS11 2WT0A 4I3PA 3SKVA 2Y0IA 3FN9A 1FOD3 2J1AA 4OLLA 5D2AA 1KS5A 1A3KA 4FXKB 1FPN1 2V4AA 3MFAA 3SC7X 1US3A 5FCCA 1JYNA 3U4XA 3HT2A 1AX2A 2ZMKA 1OC1A 1JOJA 2YFZA 1PMJX 4ITCA 1AR71 4IETA 4COUA 1I3HA 2Q8DA 3ZN5A 1EV11 4IW3A 1UU4A 2X5IC 4QB6A 5GZDA 3WP6A 2Y6JA 1W0NA 3U0ZA 1WZXA 3N35A 1PX3A 2E33A 4JX0A 1CAVA 3NMBA 1K12A 4ISRA 3BU7A 1ZZ6A 4LLFA 2YV8A 1N47A 3NJZA 4ZU5A 1Z0HA 3Q9OA 5JR2A 3E6CC 5JOWA 1PGW1 4B7KA 4CCDA 3UKTA 5T52A 1QOOA 1EYBA 4IEXA 3MLKA 3W21A 2FBEA 1RYYA 4YG0A 3ZXFA 3BOPA 3OGVA 1VB2A 1CN1A 3FLTA 4HBNA 5C4WB 5FY4A 3AZVA 1LGCA 1KS4A 4DXSA 4AVAA 2ZACA 3D8CA 5ABJC 1JUHA 1O3TA 1M06G 1I6XA 2AENA 1UMHA 3NNJA 4EQVA 3WP5A 2Y6FA 1T6BX 3WLUA 4ET7A 3TB0A 3ZR5A 2O1QA 3BU0A 4R9BA 1AYM2 4QX7A 3OGGA 3ZPOA 2R042 5AC92 2YC2A 4LKSA 1SPPA 1J3RA 5FZ0A 4QQPA 1SPPB 2XKOA 5EHDA 5GLVA 1DGRN 1NZCA 4QM9A 5K0UA 3WQ1A 3IDAA 1YWKA 1VMHA 5K0UB 5C9AB 1VMJA 2R0HA 1W6OA 2ENRA 3GM8A 2ADEA 3AB0A 3QD6A 3Q8BA 3EQEA 2RDRA 3VBHA 1O3QA 4KG8A 1K42A 2RDSA 2UWAA 2KA3A 2XOMA 1J3PA 3WNXA 3VD4A 5DG1A 4K8FA 4KBBA 4RGKA 4YG3A 2ZEXA 1OPMA 4XW3A 1JW6A 1K5JA 3UL2A 1HQWA 4AZZA 2P6CA 2EXHA 3K51A 5I0RA 3LEIA 1AR81 3WDYA 4IEZA 4FTSA 4FPHA 4LORA 3AJYA 4ASMB 4PQ9A 3EYPA 1W28A 1UU6A 4CDQA 5EQUA 3OTFA 5DABA 2WNVA 3AYCA 3U07A 1BEV3 4CDQB 1WD4A 1ND3B 4FAHA 1U5IA 1LKNA 1QQP1 2O8OA 5H9PA 3LIGA 1KDKA 4N43A 5JIUA 5LRSA 4XABA 4N43B 4O9EA 5GZCA 3J9SA 2D43A 3LAGA 1NLRA 1UPIA 2A6VA 5T3NA 1KDMA 1TME2 1WA4A 2C24A 1DQ6A 5BPXA 5GLTA 2JG8A 3DUIA 3HNBM 4FFHA 3AKSA 2JG8B 3N3HA 5EJ3A 4E4DX 5C7GA 2HWC2 2RG4A 1MPXA 2E32A 1S0DA 3GZTB 3T1LA 1W8UA 3AVRA 2LM3A 4Q4Y3 2IXLA 2XMLA 2E7TA 1YYNA 3ORJA 4LBQD 2EICA 4MOAA 4OUSA 4P08A 2OKXA 4ASLA 2RS12 1BJQA 3OOXA 4LEJA 1CQ9A 3P6BA 2PHRA 3A0NA 5IVYA 1B09A 1O7FA 1WLWA 1MZ6A 1FPN2 3PNAA 1LR5A 3A22A 4PT6A 4A3XA 4AFDA 3CIHA 3FHAA 1GZCA 3WD5A 1QH7A 1JHNA 2W08A 1AR72 4Q27A 1U5YA 2BERA 2EA7A 4KMQA 4XJ9A 4GMP3 4KU8A 4SLIA 4YG6A 2VMEA 1EV12 2ZHNA 1W6NA 4GKYA 3ZFFA 4NVPA 5IYYA 3T2TA 4AEKA 1W6NB 2QUOA 4MGIE 1HRV3 4MH0E 3IBMA 1YQ8A 4GALA 5IUQA 1XBFA 1OD5A 2KD7A 3B7MA 3LA7A 4AFBA 2AZ5A 1GICA 3ZOIA 5GLUA 4IEOA 4YW3A 5JMCA 2QDRA 3GHNA 1UKRA 2WIIB 1PGW2 1L7QA 2JB8A 2P17A 3IPVB 4LXLA 2VOXA 4TN7A 5KXBA 3VDAA 2K0GA 2HBTA 3HAGA 3HR9A 3S30A 4HMZA 3KD4A 3TOJA 1J83A 4DXTA 1WWYA 5C4WC 4FVVA 1H0BA 1QJY3 2XL7A 4YFWA 2R16A 5L73A 1QJX3 1TMF3 3VD7A 3VL8A 4HVOA 1AXZA 5A3UA 1JZ3A 3W20A 3HN3A 3BKZA 2D6LX 1OOPC 2YU1A 1JXNA 3S5QA 3MHZA 4CCOA 3T0BA 5IHRA 2HWB3 2ZGMA 2QQVA 4IGPA 4JRLA 5DAWA 1MS8A 3E5XA 2B46X 3GCXA 2HBUA 3NNLA 4LULA 1W2UA 1X36A 2QQJA 1W39A 3J26N 5JIAA 1WCUA 3WUCA 4CU8A 3FE5A 3NJYA 5C3QA 4M3CB 4COWA 1HXS1 5FOBB 4JKKA 5FPZA 3RZHA 1KJRA 2VD7A 1VRH3 2WWUA 2XVGA 1QOSA 2CDOA 3J8F3 4RHV3 1CAXA 4N53C 5FPVA 3WW3A 5HCAA 1PK6C 4L0PA 5JR7B 5CFCA 2QDNA 5C9AC 3I2OA 4BXSV 1H4GA 2W1SA 4IEPA 3QCWA 2DDUA 4HANA 2B42B 1OF3A 1W99A 4OZOA 2SBAA 3ZIXA 1CAWB 3KF5A 1FATA 2G1MA 5SV8A 1W0OA 3AMNA 5JSRA 4HXCA 2DCJA 5F8PA 5K7PA 3A21A 3JXSA 3WQBA 4QDQA 3HJRA 2ZHMA 2JDZA 3GNEA 4BQ4A 3I3MA 2ZABA 4QD2A 2ZTNA 1LHVA 4OMDA 3OPZA 3DV8A 1AR82 4XF3A 5IT6A 3RI8A 2R073 1OSGA 4A7YA 1ZREA 2C0ZA 2CDPA 4QPYA 1OXCA 3ON7A 1ND3C 3VHOA 3ZFEA 1YIPA 3PUHA 3LF7A 5C3RA 1MS3A 3POBA 4QKFA 1JZ8A 2OPWA 1UY3A 1QHDA 1S2EA 4GWJA 4XUTA 1QQP2 3Q8EA 4LPLA 3WDWA 4FPOB 4AW7A 4Q4W3 2ZA9A 2FDFA 3WCSA 4YW7A 4Y5SA 1GZ9A 1ZZBA 2K2SA 5DUXA 3NRUA 3ZDVA 4LITA 3LFMA 1IG3A 1FNZA 2FCUA 2XDVA 2A75A 1JOBA 2VZ1A 1MS0A 4JV4A 4ZPIA 5F39A 4DXRA 3GJBA 4IGQA 4QKDA 4AI1A 2WS93 4CTEA 3RZMA 1ASJ3 3AP5A 2IVIB 1SG3A 1U12A 3O1MA 2VMHA 3U10A 2BFUS 5T54A 1LECA 3OBRA 3H50A 5DDJ1 4S2FA 3LFIA 1RUOA 1GWKA 3MW3A 5L9RA 3WY6A 4HETA 3LOBA 2ORXA 2DTYA 3CZUA 4XFAA 2ZGOA 3WNLA 4YW6A 1QJEA 1OQ1A 3ZYPA 5CVRA 1JZ6A 1X33A 2GC0A 3AJZA 4YVWB 3LPFA 3PTYA 5FP9A 5IK4A 4Q0QA 1DQ2A 1NCRA 3DF0A 3I59A 1AL21 4GWNA 2WLQA 1YJKA 3MI8A 4I09A 4Y5Z0 5IAVA 4C0HA 4D7TA 4Z92B 1JMUB 4TTGA 5CFDA 5CU1A 4NHLA 1RHI3 5CFDB 4MSVA 5DAVA 3HMYA 3M3IA 4P9WA 4AEDC 1FYUA 3NJXA 1SBEA 4LO7A 5C70A 4QPGC 2HH9A 5KHKA 4O65A 3V0AA 4EV0A 2W5FA 3H8OA 3V0AB 3I3QA 3FBMA 1RXGA 4FFIA 4OI2A 4LOSA 2JX9A 1OUXA 4QPIB 2VH9A 5B2GB 3EJKA 3DYMA 4XETA 1X82A 4PF1A 3SEEA 3PUQA 3OYWB 2PHXA 3WV6A 1E5RA 4GULA 1L7RA 1VBB3 3IIAA 2BNMA 2PHFA 5F5AA 1JYCA 3CMGA 3O1VA 1RUC3 4QB2A 1H2LA 4AI0A 1LU2A 3AP9A 3B3QE 4RS5C 3CJIC 2C9AA 5LBFA 3KT1A 4CPBA 1F9KA 4XF9A 1V70A 2NP0A 4ZU4A 4UXAA 4NO4A 2P5BA 3ZMOA 4S2GA 1N3PA 2VZRA 3HWJA 2GMEA 1RTVA 4X6QB 2WLPA 4PDWB 5F6KA 1GZWA 4META 2JENA 1VB4A 1W9TA 2VJXA 2CSGA 1DG6A 3USSA 3VBOB 4JGZC 2QBXA 2YYOA 4Z82A 1REFA 2WT2A 3FX3A 3ACIA 2XLFA 4OQ8A 4CDXC 1A6CA 2PQQA 3IWZA 1WMEA 2DUQA 3G6JB 5CB7A 4CDWA 2BEOA 1XRUA 4CDWB 1POQA 2E7AA 2EALA 1UO9A 2BGCA 2EXJA 5CKQA 5IVVA 5LA9A 1AHSA 4OI0A 3T2QA 3D0SA 3RZGA 3HQXA 3P3NA 3WEZA 4CCMA 1Q43A 5A1FA 5A32A 2A3YA 2V4VA 3POJA 5FIXA 2YDEA 3AKQA 1DFQA 2JDNA 4X6RB 4XEZA 1MVEA 2DYCA 2VU9A 3T2OA 5JXHA 5FPBA 4ZU7A 1SFPA 4FP3A 4MV2A 3VZKA 2ZEYA 3N36A 3NKTA 3VBUC 3L2HA 1BQPA 2DBIA 3SHRA 2WYSA 4IERA 3MUY1 4PIZA 5A3WA 2ZOEB 3HEIA 3K4AA 5LEJA 3S6PA 3RQ0A 4CU9A 4DQAA 1R083 3EHKA 1D2QA 1VE0A 4RA0A 2JDMA 1SBDA 1GLHA 4OCTA 4BYYA 4D7SA 5FYMA 1UYXA 3ELNA 3RS6A 1B35B 1LOEA 4MHRA 4D6SA 2VBBA 1ZM1A 2HEVF 3I2DA 1V00A 4L92A 5DDJ2 3ZYIB 5DAPA 3B9CA 5BXXA 2XLAA 2BPA2 3O14A 3JQWA 2W95A 1NYWA 1S0CA 3K4ZA 5C3OA 4AVTA 2AH2A 2P34A 1C1FA 4CCEA 1YQ6A 4WVMB 4YVWC 3USUB 3ZN6A 2WSVA 3I2JA 5AFEA 1RUE3 3ZN6B 3UJOA 4YWAA 2WABA 4WM7C 3M70A 3WDXA 1BEV1 5HI0A 5AVAA 1TQ5A 4LBJA 4RGAA 5LA2A 1AL22 3APBA 4LHKA 5DZFA 5T5LA 2WKKA 4XUOA 2D6OX 2DU0A 3LEKA 3S5AA 2ZAAA 1ULOA 2V72A 1IZ3A 1REEA 1R1A3 3VBSC 1ZVFA 4Z2WA 2RM23 5EP9A 3PMSA 4RSUA 2X10A 1YIFA 1WA6X 1MS1A 2W39A 4P9YA 1MZFA 2R49A 1F4AA 3ACFA 4QPIC 1W03A 3AFKA 5C8CC 1Q8QA 2A6XA 3C7OA 5JVVA 5KC6A 4ZHNA 2VVFA 1WKYA 2OXBA 4Q4Y1 4O7XA 3I8TA 1Y9GA 4ZS2A 5GJ6A 4HN0A 1RVF3 3OY8A 3AX4A 4IEYA 3O1RA 4DZGA 5T55A 4F83A 4NR1A 2GSYA 1XPWA 2B9UA 3O5SA 3KT4A 4XZUG 2C9KA 5IK8A 4BOWA 4GMP1 4JHTA 4OHWA 1D4M3 4TYSA 4NRPA 3PU8A 2WO2A 3H0OA 5BNNB 3ATGA 5JOZA 3NV4A 1JI6A 1HRV1 4AF9A 3OG2A 4GD4A 4BQWA 4K20A 1XNTA 5HV0A 3AYEA 4XACA 4HKWA 3VDDB 4PLNA 3B5LB 3H7YA 5FKCA 3P1IA 3T30A 1UPSA 5IFTA 2PHTA 4CCJA 3PVBB 3AMMA 2HWF3 4I02A 2AACA 3PUIA 3VBFC 1X8EA 4J1XA 4LA2A 3RI9A 1HX6A 4EZHA 1DYPA 1QJX1 3IAQA 4GH4A 1V6LA 3V64A 1NLQA 1W8WA 1ZBE1 3EBRA 4GH4B 3ASIA 3S57A 4E8DA 5D8AC 5FLIA 1YHFA 4XIKA 2GP3A 2HWB1 4HL0A 4Q4X3 2HJIA 4NN0A 4RL7A 3UKVA 3ILFA 1ND2A 4XIOA 3WW4A 5JXGA 4JVAA 4M00A 1URXA 2LRPA 1PVXA 3MYXA 5CA6A 4NRMA 2I45A 4RFRB 1KJLA 2IUWA 4URAA 5HV4A 3INAA 1VRH1 3AMHA 4XQDA 5FUPA 3J8F1 2P4EA 3MF6A 3ZXLA 5BYNA 5JPNB 2GN7A 4NWWA 2DFCA 2VW2A 1G6NA 3JB4C 2VOWA 1C57A 4FFGA 5BNOA 1UXXX 1US2A 5DZGA 3NV3A 1XSQA 2SLIA 1UWWA 1TEIA 3CHXA 3U4SA 4LUKA 3I3DA 1ZNPA 2BYVE 5E88A 1W2OA 2WRAA 5LA1A 1B35C 1I5PA 5FZ9A 2Q8EA 1FI2A 4XF0A 1KFUL 4XCBA 1K5MA 2DCYA 3CLPA 5FPLA 3Q8CA 5JSOA 1K5MB 1Q56A 1BZWA 1AL0G 1AR63 3VLBB 4FSJA 3LE0A 3ZSEA 4BDVB 4Q26A 1KGYA 4BQ3A 5FDBA 1NUKA 4B4RA 3OPWA 2TEPA 2VMFA 1QJZA 4JKMA 5JI7A 3BIEA 1PVC3 5FYBA 5FMOL 3QACA 1WLTA 3E1F1 5FYTA 2Z69A 1H4HA 1BEV2 3FUQA 3RFRA 5J09A 1S1AA 1GOFA 4CUAA 4D3WA 1PO13 2X5IA 1WMDA 2J7MA 2XVLA 3KF3A 3N9MA 2X5IB 1IQAA 1RGSA 3WNOA 3GZEA 4Q4W1 3PJYA 5BY5A 1S0BA 1W8TA 5FP4A 5IATA 1W6PA 2PHUA 2C26A 3I3EA 3RZZA 2BDRA 5GLWA 1GR3A 4Y22A 1DGLA 1SACA 2JE8A 2XXZA 3SISA 1DZTA 2V5YA 1PIV3 4HPKA 4ATFA 5JAXA 4QX8A 3N9OA 4HPKB 4Q4Y2 2WS91 4HG6B 4CZSA 1IPJA 2CGPA 2W0XA 4W65A 4XC9A 3WG3A 1ASJ1 5L7OC 1XE7A 3T4HB 2WA3A 4GWMA 2X29A 5FO8B 5F3GA 3ETQA 4E4SA 5JXJA 3J4UH 1AYN3 4Q5OA 1VBD3 5C5UA 2DWRA 4DO0A 4P9JA 4CEWB 4HZFA 5FZEA 2OIIA 1W6QB 4OZXA 1W9WA 5ABJA 2E7QA 4JDMA 1O8SA 2EF6A 1YO8A 5FZ8A 3N9NA 2G9ZA 3VBRB 1QGLA 1N1SA 3KV4A 2X09A 1GZTA 1APNA 4QM8A 2VC9A 5J1XA 4RQPA 1HRV2 3WG2A 1XNBA 4M3CF 2RS53 5E6HA 3VDDC 5FPUA 4NIGA 2VXRA 1NAEA 1A8DA 1XOYA 1CPNA 3DXUA 1ENQA 1LGBA 5A3OA 1RHI1 3A7QA 2Z42A 5A3NA 2QZ3A 2Y8KA 1GWMA 1O91A 2ZCWA 5KXCA 4N7UA 3ZYJB 2XUEA 4EWEA 3CNAA 1RUG3 1NZIA 1RIRA 4QGMA 4BQYA 1OURA 4CCNA 3WQ7A 4EN8B 4CUCA 1QJX2 4AFCA 2VOTA 3K46A 2R1DA 1ZBE2 1WW5A 3FL7A 3P5BA 5FYCA 3RSJA 3OF1A 2VE1A 4I2OA 2HWB2 1RB8G 4LE3A 4EZ4A 1VBB1 2WAOA 2YXSA 1SLTA 2RHPA 5FZLA 2XPJA 2PYTA 4FTBA 1PNFA 3NQHA 3NO8A 4UT5A 3SCGA 2GC2A 2GC1A 1CZTA 2OUJA 4BPZA 1BK1A 4A41A 1AXKA 4JGYC 3OBAA 3FC0A 4IQPA 5FUIA 1DHKB 1VRH2 4DINB 3J8F2 3MLJA 4RHV2 1WLCA 4ES8A 1KXGA 4LO5B 4C1WA 4XFGA 4YM0A 4BWOA 5C71A 4FI9A 1ULCA 3A0KA 1OKQA 5DUVA 4A6OA 4Y3OA 5FR3A 5CNAA 4JHZA 1AVBA 2QE3A 3MPPG 2GP5A 5A7WA 2HWE3 2FDKA 2WO7A 4FOWA 5A33B 4SBVA 2EXKA 2ARAA 5KWRA 2BQPA 3WQ0A 1KEXA 4ARYA 1GOGA 1Y4WA 5FYSA 5FYUA 3RDIA 3VDCA 2QNKA 1E5IA 3DL3A 1QXPA 4CPBD 3RYRA 1W2AX 3I2KA 1OLQA 2RS33 1GWLA 1RL3A 3BVCA 3IDCB 3LSEA 3VKOA 1JUIA 2Q5TA 3CQOA 1HV1A 2P3KA 3HNMA 1CX4A 2AEZA 3KVBA 3JB8A 3ZYBA 4GA9A 4WM8C 3ZXEA 3MZHA 2C6SA 2EAKA 3J7LA 2VZTA 3F95A 4W6YA 5FRAA 2YPDA 4DFSA 3HQUA 1U5ZA 2XONA 4TXWA 1P8JA 1AJOA 1MZEA 4HN1A 3OBZA 2H0VA 4N9IA 2B5HA 5DQ0A 1OHFA 2ZEZA 3M2MA 2W52A 3AL5A 3WUDA 2QQPA 5IVCA 4ISQA 1C28A 1OLMA 4Q4W2 4Q4V3 3KLSA 2CHHA 2CL2A 2JG9C 4HVRA 3E97A 4OYUA 2VZUA 1ENXA 2QQUA 5E16A 1ENSA 1XU2A 3DPRC 4GKXA 3PHMA 3TAYA 1R081 5KXDA 2FQPA 4QPWA 2WS92 1XYNA 3GHMA 5C4WA 4YM3A 1JZ5A 3N9PA 1ASJ2 2Z2SB 3KSCA 5T5JA 4CRQA 1ALYA 2ZZJA 3MW4A 4H7LA 3OGRA 1HB4A 1H9WA 3PVEA 4CEWC 3H1YA 1V6MA 5IVBA 5A7NA 4MYEA 2Y0OA 3WHTA 4LUMA 2GN3A 3UGGA 1OOPB 2W1UA 3VBRC 1ZA4A 3LKJA 4MXWA 2CU5A 4MXWB 5J96B 2F17A 2VG9A 4IV1C 4PQQA 1OA2A 1RUE1 4JTOA 1QY4A 5FY5A 4AHZA 3NJVA 1LESA 1LODA 1GUIA 3FMGA 5K4LA 2J1EA 3ZKUA 5FXZA 4H7MA 1HW5A 5FY7A 2ZX1A 3LDRA 3GDBA 1PK6A 1LHUA 2PHLA 1R1A1 2W46A 1RHI2 3KQRA 1PK6B 2RM21 4N53B 4NHYA 4NUBA 5CZKA 5DZEA 1V9U3 4FPYA 1SFNA 4XVHA 5E8AA 4M0NA 4CXWA 5C9AA 1K45A 4QT6A 1Y43B 3A23A 2HEWF 3POFA 1MS5A 1REDA 1DYOA 1CPMA 5FWEA 5B4XA 4C1XA 4R9CA 1ENRA 3MPBA 3AP4A 2GNMA 3S0MA 3ZXKA 4BIOA 3VKFC 2R1BA 4XBLA 4DRRA 1C4RA 1RVF1 3MDPA 4QDRA 3VZJA 4UFHA 2DFBA 2PELA 5JWPA 2FDJA 1I5ZA 1VBB2 4CDUC 4AQ2A 5KC5A 2JXAA 3MEPA 2Y33A 5BNQA 4ZXEA 1ND3A 3MBWA 1NX9A 1EY2A 4QGNA 4YVSB 3LA2A 3UGFA 1D4M1 3WF1A 2R30A 2RR13 1XJAA 2OW4A 4E2SA 4YARA 3MFCA 1EAH3 1NQDA 5FXWA 1H8VA 4AHYA 2CAVA 3OD4A 4KH9A 2ZGLA 4CXXA 5TSWA 1FV2A 2VGDA 1G9CA 3O7OA 5IW0A 2ZGRA 1VAVA 3IB3A 1SEFA 1ZBA3 1UYPA 1DDLA 2WUHA 4FT8A 2VY0A 3WNPA 4MX3A 4X8NA 4ZXKA 4BQXA 5BNPC 3B9IA 3ETPA 1QNYA 4B1LA 4UI9L 3NKGA 3PLQA 2HWF1 4TSVA 3DEMA 3D82A 4YYOA 3FLPA 3RMYA 4XFFA 5C5TA 2MEV3 5IJRA 1YCIA 2ID4A 2Y26A 3ACLA 4YW2A 4EN9B 1R64A 4LJHA 1IOAA 4BK4A 1HN1A 1EP0A 2BVVA 3ST7A 2H0BA 3JBG3 4EROA 4N7IA 3TYJA 3BALA 2YBPA 1YI9A 4OHXA 1SDWA 1NXD1 2DCZA 2HWD3 1WCSA 5E1RA 3DN7A 3I2FA 4QKNA 3I49A 1D0HA 4GXLA 1N3OA 1AR93 4L97A 3ES4A 4H14A 3FZ3A 4PIXA 5FQ0B 5SV5A 3T4VA 4B3NA 1GFF2 4KL1A 4NE9A 1GMMA 4HOOA 4BB3A 3C7FA 1AUYA 2JDAA 2ZX4A 5I91A 3IPVA 4CSWA 1OVPA 5AVPA 5FZFA 2VTFA 3VZOA 1CX1A 1VBE3 1UX7A 2OA2A 3DYPA 4AEDB 2J1SA 4UW6A 5LY1A 1R082 2BJSA 4QPGA 2UWBA 4QPGB 3C2UA 2OT7A 4RGGA 4LHLA 2PAEA 1OBNA 4AWDA 1UD1A 1TG7A 3BB6A 1UZZA 1V6NA 3B93A 2OZJA 4P9LA 4BCUA 5FYHA 1RUD3 3PIJA 1OT5A 1NCQB 2WC2A 1F5FA 4PBOA 2GALA 4LBNA 3VDBA 4HSJA 3LCPA 2FMDA 4OHYA 4M3CA 1DYKA 5KHGA 3AP7A 3HD8B 5CG9A 1RUE2 4WZCA 1OPOA 1OF4A 4MGYE 5LCWL 2YB7A 3IN9A 1MVQA 4UW4A 5F2WA 5L9BA 4J1WA 1T2XA 4OHVA 4RS5A 3O1PA 4RS5B 3CJIB 1H1AA 1LEDA 4GB33 3PJQA 1ULPA 4ZKTB 1S55A 1HRI3 1PO11 2JWPA 1COV3 2DV9A 2Q1MA 4P9IA 3ZR6A 4N8MA 1R1A2 2RM22 4P02B 1CAWA 1GP4A 1C8M3 3C7EA 3ILNA 2I74A 4ORFA 1O6UA 2PN5A 1OI6A 1J84A 1ZRIA 4AHXA 4EN7B 2ZGKA 4JGZA 1X7NA 5J7MA 1DGRA 4XBQA 5LW9A 4JGZB 2EVXA 2ZZQA 2VOVA 4C0BA 1PX4A 3N4MA 1WW7A 1LU1A 1LHWA 3Q8FA 1VAKA 4CDXA 1RVF2 5CIRA 1TNFA 2XHNA 4XDOA 4CDXB 3K77A 1KRIA 4A7KA 1NA1C 2VUDA 3R0RA 2Q4SA 4NIIA 4PJYA 2P2KA 2ZMNA 1R093 1VBD1 1XYPA 4LBKA 4YVSC 4YGBA 5FZ4A 4DMIA 5JLVA 3M7AA 4PF5A 4DNYA 1KFXL 3JCIA 5FZBA 3VBHC 4XJUA 4KNCA 3UJQA 4K3UA 2A73B 2GNBA 4FPGA 5F5IA 1C1LA 1D4M2 1LHNA 3E6BA 3UYJA 3OUIA 2NN8A 5GKAC 4HFSA 4OI1A 1ULFA 1GQGA 4IL7A 4K40A 4NROA 5KHJA 2RS51 3SH4A 2PLV1 2UYBA 3HN1A 3VV1A 4Q0SA 1UMIA 3T1MA 3VBUA 1GQHA 1XNKA 1JHJA 1QNWA 1FV3A 1DQ0A 4QU1A 1OLRA 5FZHA 3VBUB 1JZ7A 5E89A 1XNAA 4M3CE 5CG8A 4A6SA 3DXTA 4LO6B 2D5FA 2WNVC 3RWKX 3ZYHA 1ZX5A 1RUG1 1MEC1 1N3QA 1UY4A 2XJUA 5FXXA 5BV6A 2HWF2 3AXEA 2EIBA 2ORZA 4G9SB 1IKQA 1QDOA 2CYFA 2VBPA 2VCCA 4QX0A 2WZPP 3M3CA 2AUYA 4BMEA 4QGLA 5ISLA 2YC4A 5J48A 2W1QA 4DEVA 1RUF3 4COVA 1AJKA 5ERLA 5J36A 2A6ZA 4TLGA 3WF4A 1H8TB 4Q4X2 5CYYA 4CP2A 2VZSA 1SBFA 5B4NA 2DU1A 5D1IA 3LD8A 4YVWA 3VKLA 2FD8A 4WVVA 2J1RA 3AZWA 5FMBA 5H9RA 3WG1A 2XH6A 5CEHA 4DXZA 4TLFA 4XJWA 4ARXA 4WM7A 1GV9A 2RJ2A 4E2GA 1S2BA 3E5UA 4K8RB 4WM7B 5LA0A 3ZN4A 1XU1A 4NAOA 3VBSA 1TZOA 1FX5A 2GMMA 1LOGA 4CUBA 3N7LA 3VBSB 2P3YA 4WV8A 5JCTA 1UF2C 1H1MA 3ILRA 4XFIA 2IFWA 2Y6KA 4XMIA 5I8TA 4QX5A 2E9QA 5L19A 3ZFFC 2AEYA 1SMVA 2HWE1 2JDPA 4QPIA 5DAQA 4AVCA 1T6GC 1G86A 2BGPA 5C8CA 4XPVA 1S0JA 1NCQC 5C8CB 2D3SA 3K3NA 4BZ4A 3OYWA 1ZZCA 1EUUA 4M0HA 2XJVA 5AC93 4M4PA 1FOD1 4F7ZA 3MV11 1FMD3 1LHOA 1CWPA 2RS31 3MGUA 4YNIA 5FFOC 1QU0A 1SLIA 3TN93 3KWVA 3WNNA 5FJHA 1W9SA 3OB8A 1SLAA 2D5HA 1HLCA 3C8XA 3POSA 2CAUA 3SH3A 3JQXA 2FMYA 3J7NA 2E26A 1PO12 1SCSA 2B9VA 1VBC3 4FPEA 1MQTB 4LKFA 4PDWA 1LOFC 3ZMNA 3RZKA 1D0GA 1UZWA 2VMCA 2FZ2A 4Z1VA 4AVSA 5IFPA 3VHPA 3VBOA 4Q4V1 3S7EA 4IXLA 3GBFA 1OH3A 4XFBA 3W5NA 2QJVA 5GZFA 3NV1A 4EN0A 1MACA 1QDCA 4WVZA 3ZXDA 2XJSA 2WZ8A 4GIQA 2MPFA 4YRDA 5F5QA 4OUMA 1JYTA 5BNPB 4C8DA 2VZPA 1PM7A 4QB1A 4LHNA 1V6OA 5JZGC 4JKLA 3VBFB 3URFA 4B1MA 1QMJA 1OA3A 4XQ4A 4FPFA 3BODA 1UYYA 1VBD2 4AXOA 5FZ7A 5J37A 5D8AB 1ZZ7A 2DUPA 5C3SA 1VMFA 3OCPA 1FNYA 3IAPA 2PQSA 4IESA 1BVP1 5F3EA 1BBT3 2VNVA 1WCKA 4QX3A 1CIYA 1HKDA 3R4UA 4MXVA 2RS52 3PIGA 2PLV2 1QJFA 4M01A 1V6JA 3H7JA 4QWNA 1E5SA 5FJKA 3BUCA 4DY5A 3MUZ1 1OUSA 2QCSB 4XMAA 1IKPA 3AKPA 3ZYRA 3ZFEC 2D98A 1WGPA 1V9U1 2WNUC 4DOUA 5FZGA 4DIQA 3AL6A 4CEYC 1H30A 1RUG2 1MEC2 1B35A 2WAAA 1EV13 5I0TA 2ARBA 1CR7A 1IG0A 3ITQA 4WVWA 3KQ4B 3VZMA 3KM5A 1H8TC 4XDQA 1J1LA 1I9RA 1XSRA 4WVMA 3TEXA 2XJRA 3PDQA 4W6XA 3USUA 2VCMA 1NXMA 3VL9A 2IVJA 1W05A 5FPXA 2IC1A 3H9AA 3PUAA 5FLHA 1POV0 4B4QA 2VUJA 5FZDA 1YFYA 4FQZA 4Q8LA 1Q5OA 1QWRA 3N7JA 3IMMA 1U0AA 1GKBA 5F37A 1W8FA 1RUI3 2DVAA 2FCVA 4OULA 1YEWA 2A3XA 3ECQA 4YM2A 5JPMB 4UF0B 3AXDA 1EAH1 4I0AA 2DCTA 2AREA 4Q2FA 4QXCA 5HXMA 1JU3A 2GZWA 4Y1VA 5FYVA 4JDNA 3CL1A 3GF6A 1ZBA1 4CE8A 5LBBA 1F15A 2W94A 2HWE2 2BZDA 2WINB 4DUVA 1JYIA 1VIWB 4OVEA 4Y24A 3M1HA 2VNOA 1IS3A 2A3WA 1LEMA 3OGJA 4LK6A 5A80A 3AP6A 5I0DA 5GZGA 1FOD2 2B39A 4LIUA 2LTNA 2WN3A 5JMOA 3JU9A 2RS32 4PIYA 2YPJA 4UFKA 1YXWA 4XDPA 2TBVA 3LEGA 1JBCA 4UW5A 2IXCA 3JBG1 3VHRA 2UY9A 3TRSB 5A6QA 4BH9A 5BNNA 1LOCA 4FOYA 3KVAA 4YM1A 3LOIA 3GJAA 1MQTC 3OBTA 3VKNA 5F6LB 5A3LA 1I1EA 3ENRA 1DZRA 3ZKYA 2CTVA 1F8VA 1AR91 1XYOA 1RUJ3 3NVCA 4ZZ8A 3RVHA 1ZZ8A 3OPTA 1LULA 4U2AA 3TEYA 3VDDA 1AR83 3LIHA 4Q4V2 3WX5A 2ZGPA 4XJ8A 4EYUA 1H6XA 3NNMA 2W3JA 4YZ3A 3DYOA 5FZKA 3OGSA 4OFGA 1XNDA 2BNNA 4UOJA 2B45X 4LBQB 4AEMA 1H6YA 2J22A 2IFRA 2VUAA 3ZVXA 5JOYA 1Z7S3 3KMHA 1QJY1 1KITA 1UOJA 1Z78A 2BRTA 4KI5M 1TMF1 3AM2A 2XGXA 3WDUA 4YPJA 5HBAA 3R4DB 4AGRA 3POEA 4KWLA 1C5IA 4HK8A 1S0FA 4D69A 1PNGA 1RUD1 3V56A 1HDKA 3Q8AA 4QAWA 4AEJA 4K1ZA 4XF1A 4FAGA 5GLZA 1DGWA 1OD3A 2OS2A 4LE4A 1AXYA 1CJDA 5FZ6A 2BFUL 3NV2A 3KZ4C 5A7SA 2NQYA 3OEBA 3QLQA 5EIYB 2MNGA 4HONA 1CZVA 4RHV1 4JGYA 4XF4A 2Z4FA 4QMAA 2WJSA 4JGYB 2YBKA 4DUWA 3IDBB 1OQEA 5DXDA 1COV1 4HKOA 1YFUA 1SLLA 3N9QA 3KCXA 4C90A 2BP6A 1V9U2 5I93A 2I07B 1QOTA 3HIFA 4R4ZA 1C8M1 1DGWX 3TNQA 1ZRRA 2FDGA 2GU9A 1H1IA 1RMU3 1R1ZA 1W3XA 5T5PA 2JEMA 1HIXA 1JTZX 5FY9A 3MO4A 2LW8A 1JYWA 2VMIA 1NKGA 2VVEA 3AZZA 5FZOB 1AX0A 3WVJA 2VM9A 2AR6A 4IUGA 3UKNA 5C3PA 1Y9QA 2Y38A 2WFF3 1CONA 1NT0A 3GYDA 4QKBA 4AQTA 2WWJA 4FPCA 2R071 3HT1A 1C5HA 4FOQA 1LNSA 4YSFA 2YFUA 2XBO3 1C8NA 5T5OA 3QOPA 4WM8A 5JDBA 1PGL1 3BTXA 5LK5A 2L9LA 1NOVA 4WM8B 1MZ5A 2DF7A 2IWGB 4O9GA 2WZR3 4UFIA 3H8UA 1EAH2 5LBCA 3UESA 2YGLA 1WCQA 1XC6A 3HBZA 4AYUA 2V5DA 2Y60A 4QHOA 1J3QA 1GANA 1UY0A 1ZBA2 2PAMA 5FK7A 1YRZA 4QX1A 5LATA 2DBNA 2JG9B 1HXS3 2XL9A 4XXAA 3ZXGA 2OVUA 3UETA 4CYDA 1PZ7A 3DCQA 4AK3A 3DPRB 2NLRA 3KV9A 4ONUA 4OI4A 5DG2A 3ZYFA 1UL9A 2GH8A 2VW0A 2ZMLA 4AFMA 4CCCA 3H8RA 5LBEA 2Q30A 4YLZA 3HVDA 2CY6A 2DVFA 5A6XA 4CEWA 5I0UA 4K21A 1W6QA 1RUF1 3WF2A 2YG0A 1HN0A 3JBG2 1RXFA 1SLCA 2AGSA 4RD7A 4CCLA 3VBRA 1XE0A 4I30A 4NHXA 1OFSA 4XQWA 3ZSLA 2X8KA 2VECA 3H3UA 2HWD2 4A45A 1W9YA 2JE9A 3DKWA 4IV1B 2VR4A 1AR92 1S4CA 4PCRA 1UZVA 4QHBA 2PHDA 2ZX0A 4B29A 1FXZA 4AAXA 4K1YA 3H1WA 2PHWA 4AI2A 1F4HA 3WNMA 1DZQA 1ULEA 2EAAA 5L7OA 1GBGA 4F3JA 1W0PA 5L7OB 3POGA 3ZM8A 4N9HA 3AZYA 1UX6A 3OEAA 1KQRA 3RPQA 2A5ZA 2NMOA 4N90A 4IV3B 2OYZA 1NY71 1QJY2 1GOHA 5HCFA 3RRDA 2XQXA 1TMF2 5FY1A 3W5MA 4RR3B 4W4ZA 3MV01 4BE3A 2UY8A 5CISA 1V6IA 2QTWB 1SFYA 4FP2A 2C1FA 1RUD2 2XUMA 2XVKA 3FLRA 4JQTA 4L8QA 5FP7A 4DS0A 2ZBJA 1FMD1 3WW2A 5F9TA 5A70A 3E6DA 3WHUA 1RUC1 2VCBA 1CESA 2JJ6A 2ZKLA 3I54A 1V0AA 3TN91 4CDUA 4CDUB 1L3JA 2VZOA 2WSUA 2WL1A 3WCRA 5KHIA 4YW5A 2WNOA 5M0TA 4D8MA 1ODNA 1WW6A 3JD73 1DQ5A 4QQ2A 3LSDA 2Q8CA 3O0XA 3IIIA 4GB32 5FY8A 3WT3A 4XCAA 3B69A 1COV2 2K46A 1VBC1 4AFAA 2B8MA 2DTWA 3SMHA 1QEXA 4R52A 1EPZA 3UV9A 1OKOA 4NHMA 2W47A 1C8M2 3FFQA 3AMPA 3ABZA 2VXJA 4D94A 2RMU3 1UCXA 1FT9A 5A33A 4LKDA 4Q1PA 1W9FA 4LKEA 5IVJA 4BQ5A 3IMNA 1UYZA 3SLIA 4BLIA 1TE1B 2V73A 4NHKA 4Y4RA 2Y64A 2JDKA 4P00B 2YC0A 3AMQA 3LGRA 4IE7A 3KT7A 4XILA 3OJBA 3WR0A 3WXPA 1Q8OA 1JOPA 2R072 1OFNA 1VPHA 1TVGA 2P3IA 4FPJA 1CZSA 1R092 3WP3A 2F6BA 3BPSA 4R4XA 4K6BA 4D6RA 2BOIA 2XWJB 2GNTA 2ZGSA 4MADA 5CBLA 1PGL2 2BW8A 3C7GA 5LEKA 1STMA 2DVBA 1UZYA 5A3PA 4AVVA 3SEPA 2YUEA 1BBT1 1JS9A 1GNZA 3FBYA 2XB6C 2NM1A 3C3VA 4AL9A 3GALA 2J1UA 3MW2A 3C7HA 4XFHA 2Q1FA 4LTAA 5EV7A 4ZY9A 4E27A 1CGPA 1NLSA 4Y5TA 2UYAA 1PO23 3FHQA 3SNMA 3ZSJA 4YZ5A 3KV6A 2JE7A 2N7GA 3R4SA 5A3MA 3KS7A 1OOPA 4QHZA 2WFPA 4CU6A 4EN6B 1QH6A 3WF3A 3NAPC 1CAVB 4YW4A 1WBFA 4TWTA 4OHZA 1NQJA 1RUF2 2VQAA 4LMFA 1H2MA 5A7OA 4Q0UA 4RYDA 2EXIA 4H55A 4HT1T 3ZFGC 3BCWA 5CKNA 5FZCA 2ILMA 3ZYGA 2R063 4OMCA 1UIJA 4A3ZA 3FWEA 5FZIA 3BTYA 1WMFA 5FBZA 5JI9A 2O8QA 4FBFA 1RUI1 5FY0A 4YGCA 4N53A 2NYYA 3EB7A 1DLCA 4NIHA 1LRHA 4FPKA 3D6EA 4NWVA 4IEWA 1POV3 2A7AA 2JKBA 2ZX2A 4JTNA 4COZA 2D44A 4IV3C 5FZAA 4ES9A 5HCBA 2G9FA 2YY1A 3ACGA 4RR3C 1CD3G 4QQOA 2IXKA 1NY72 3I4IA 5H9QA 4RQPC 3D3AA 1LTEA 2QQLA 2VQ0A 3H42B 1HB2A 1OLME 1F2NA 3LDKA 1FMD2 1S2KA 4I3GA 4LK7A 3ZSKA 1RUC2 5L9VA 1NA1A 2RV9A 4LBOA 4R8HA 4U36A 5EPAA 2ZGTA 1NA1B 3TN92 1NE6A 1Q8VA 3VD5A 4YVSA 5HPOA 2R7EB 2A70A 1W6OB 4ATEA 4IEQA 1J59A 2QQMA 3VBHB 4Y33A 5FREA 2UURA 2OUHA 5JUVA 3CDZB 4S2HA 4UBGA 3TWIA 2PA7A 2D6KA 1XNCA 5FO7B 1VBC2 1HJFA 1RUJ1 4BU2A 3K48A 5FPAA 3U75A 4NJ4A 1UMZA 3FHIB 4E4ZA 3ZIWA 5K8SA 2QQIA 4Q29A 5DN2A 4GZ9A 4XHBA 3WSOA 2WT1A 1X9TA 1VJ2A 1XB9A 2IZWA 1WMXA 2W9XA 3F2ZA 2D3RA 5A6YA 2WNVB 3VZLA 5IK7A 1Z7S1 4IGOA 3T2PA 4IE0A 4BM8A 5F1RA 3O1OA 4P9XA 3WDTA 1VBA3 5FUNA 4DUXA 2XR4A 1YC61 1IHMA 5A7QA 3WINE 2G9GA 4IEUA 4Q4X1 4XURA 2J42A 2JDYA 3U1XA 3J7MA 3LEMA 1DQ1A 1IS4A 1ZZ9A 1LGNA 4UFLA 1OMIA 5CADA 3GZAA 1XE8A 2XJTA 2AYHA 5FQ0A 3PU3A 4L9BA 5KHHA 5LRRA 2W2IA 3QH6A 4JCKA 2A1XA 4KGQA 3ZX7A 4WBBA 1BBT2 4A7ZA 3PUSA 3ZPYA 3CEWA 1Q8PA 2C5DA 1SZBA 3MIGA 4CP1A 4URTA 1Y3TA 1RUH3 3MIBA 3D0JA 2R0FA 4CU7A 3ZLIA 4AEDA 1RC6A 4E4HA 4L99A 4XYXA 2X05A 4Z2AA 2ZXQA 1GYKA 3FUOA 4KWUA 5FYYA 1S0EA 3ACHA 1RMU1 1AZDA 4NMIA 1MS4A 1M4WA 3POWA 5FMCA 5K9YA 1GU3A 4GQ7A 5C6CA 1AR61 1ONAA 2D6NA 3ZFFB 2EIGA 1NCQA 5EXOA 5FK8A 5ACA3 5DMYA 2CWMA 2WFF1 1IPSA 4JAAA 4V1PA 3T09A 2E51A 3AK0A 4XFCA 4XE9A 1PVC1 3LZZA 4FPLA 4CCKA 1ZRFA 2XBO1 3O1SA 2FDHA 3CJIA 2BBAA 1BCXA 3M3QA 3NL1A 4LO4B 4LOTA 1RUI2 2LUWA 1PM4A 4FFFA 2O14A 4I01A 1PGSA 1SLBA 4W6WA 3WF0A 3H8XA 1LAJA 3KHCA 1ZBE3 2MHFA 2WZR1 3E5QA 4Q8KA 3A4UA 1QF3A 3KCYA 1LENA 1J58A 1RITA 2JDUA 5GM0A 1LOFA 1UW8A 2XKPA 1ULGA 4HSLA 1W6MA 2RJLA 4HLTA 4XHXA 2KM2A 2LALA 2EIEA 1BYHA 2PXJA 1UOBA 1W6MB 4G3YC 5FV3A 3T0AA 3THCA 1JZ2A 3BGAA 3N9LA 2VZ3A 1PIV1 4XTPA 1DLLA 3QBQA 1UNBA 4FCAA 4UAPA 1Q8SA 2YBSA 3L2YA 3CU7A 3PTRB 3ZO0B 3ZSMA 5GZEA 1Q3EA 1Y7BA 1YQ5A 2E63A 3LPGA 2JD4A 4P14A 1JN2P 3LB9A 5EJZB 1CAXB 1ZRCA 3RG0A 2BGOA 1BVVA 5JZGA 3CKHA 4BMBA 5K0UC 1JYVA 1AYN1 3O0WA 5CFCB 3RYPA 5JZGB 2J1TA 4PBPA 2DVGA 4LIVA 3VD3A 4K7JA 1QJU3 5C33A 2YZ4A 4QXHA 1O3RA 4E2QA 3GBWA 4J25A 5JXIA 2W68A 5DUUA 4LNVA 4K9SA 5F3IA 1DBNA 3AC0A 2WR9A 3TEWA 1LCLA 2RDNA 4XJZA 3EO6A 4QX2A 5IK5A 1RUJ2 3T08A 1UQXA 2UU8A 4NOTA 3SITA 2ET1A 3H3LA 5A1LA 5J3UA 3U11A 2ETEA 4Y1YA 3N7KA 3HPNA 4CDQC 5DAXA 1LB2A 4NIDA 1SCRA 2VW1A 5LB6A 2WNUA 3KB5A 4DRVA 3ZFEB 1JZ4A 2WNUB 4CEYA 4KU7A 2YGMA 4NPLA 3VB9A 3X29B 4CEYB 4N43C 1Z7S2 1HJGA 1W04A 1VALA 3HNYM 2RJKA 4AI8A 2ZGUA 3BIWE 2WYFA 1H8TA 2VUCA 3HQRA 2JG8C 3BYWA 4V2VA 2PMWB 4QDSA 5FBJA 2XQRA 2WWSA 2WZEA 4D0QA 4MGKE 1O4ZA 3KGLA 1X8MA 4F8AA 4E8CA 2F4PA 2TUNA 2XJQA 4W8JA 5FAXA 5LY2A 3KHBA 1W8HA 1CJPA 1JU4A 1PZ8A 5JOXA 2HYKA 4P9GA 3RMXA 1WLDA 3IT8A 4EJRA 1UOFA 3AKTA 3JD71 3EMRA 4V2WA 1VRBA 2ADDA 1GQPA 4CA9A 3CZJA 4IE6A 1DP0A 3SH5A 3S7IA 1ULDA 1XQNA 4MZUA 2Z79A 3SCHA 3UGHA 4YW1A 2IXHA 1RMU2 2R32A 2RMU1 3G7DA 4XBNA 3UT0A 3SQOA 1VLNA 2K9ZA 2QQNA 3IKWA 4EE2A 2DVDA 1AYM3 3ALQA 1AR62 2JIJA 4E9KA 2R043 3NW4A 1SQ4A 1UZ0A 2QQWA 4MGTA 2ZAHA 4MHUA 1NCRB 2H6BA 3I59B 1O4TA 2BWAA 2A71A 1UOGA 2WFF2 1GNYA 4IE4A 2WDBA 3PVNA 2BWCA 4KQ7A 5FZ1A 5FXVA 3ROUA 5A1AA 4XUPA 2HKXA 2CGOA 2Z5WA 3PL0A 1H2KA 1PVC2 2WQ8A 1E5HA 3LDBA 3O1TA 5G05L 1G9DA 1GP5A 1PHMA 3R6SA 2XBO2 5EFUA 2Y6GA 3VZNA 1O59A 1G9AA 4Y20A 3NNFA 2VO5A 5FMOS 4Y4YA 4Y20B 1W8ZA 2P3JA 1MQTA 2XLGA 2QQOA 3OUJA 4DPNA 2BBVA 4MGQA 2WZR2 2CGNA 3TNPB 2XHKA 4RN5A 1IS5A 1CVNA 1A8MA 1V6KA 1DU3D 3NNGA 5F7UA 4JRAA
chains in the Genus database with same CATH topology
4QXKA 2ARXA 1DIWA 1CAUA 3POYA 1G9FA 1MS9A 4UW3A 1CAUB 1HXS2 2I2SA 1PIV2 5KXEA 5BNPA 1G9BA 1KD7A 2WNEA 1O5LA 1S0IA 3M4FA 2O0OA 1PO21 4EWAA 4Y26A 3VBFA 5CFCC 2KXLA 1AX1A 2QKDA 3M3EA 2WA4A 3PVOA 1AYN2 4B8EA 1WCDJ 1TME3 3M3OA 5D8AA 4D7YA 5GALA 3THTA 1GZWB 3RWNA 2BUKA 1RJ7A 3GBGA 2HWC3 1UU5A 1YI7A 3M8LA 3WG4A 3B94A 2RS13 1TNRA 2OPKA 2R061 4L2NA 4LBLA 2VVDA 2VULA 5FOJB 4JC1A 4MGZE 4AQ6A 1FPN3 4Y1ZA 4AG4A 1G8WA 1POV1 2BNOA 3W58A 2G4IA 1AR73 5KBFA 4BQ1A 5A32B 1O5UA 1RINA 3AKRA 3H3ZA 3WZ1A 4QU2A 1YNAA 2D6MA 5DUWA 5I8SA 3O12A 3CJXA 1WBLA 2XG3A 4LLOA 1ZRDA 2JECA 4FQ4A 2YMZA 5EWSA 3GZUC 2ZS6B 4MVTA 2D3PA 1NG0A 3P3PA 5FTTC 2R6QA 3CO2A 4XZPA 2RR11 3JD72 4FOVA 3EXUA 3NWKA 5T50A 2B7YA 4KGGA 2GMPA 2PFWA 1YJLA 2VOKA 1CIWA 1BMV1 2CNAA 2Q8OA 4C91A 2CWSA 2RMU2 1QKQA 3H1MA 1VP6A 4FXGB 2DUOA 2Q1ZB 1NCRC 4Z07A 3OD0A 1BKZA 2H6CA 5CFDC 1BXHA 3ZDSA 4KWJA 3CF6E 2MEV1 3KGZA 1VBA1 4L11A 2ZGNA 2VNGA 4QQLA 3R05A 4B4PA 1DQ4A 2VMGA 3BOWA 3UK9A 4UBHA 3N7MA 1GNHA 2CV6A 4BA6A 5C8WA 3ME2A 1MR5A 3AYAA 3W59A 2HWD1 1J1TA 3QH7A 2GNDA 4LA3A 4JQRA 1LJ7A 1JH5A 3OY8B 4G4FA 1PZ9A 3BPZA 1HQNA 3VN4A 1RUH1 4LR4A 1UKGA 4EWDA 4YZ4A 4LO8A 3LA3A 4LBQA 1O3SA 2XWBB 1VBE1 3W9AA 1QXJA 5I0SA 2GDFA 3AYDA 2E6VA 2WQ4A 2ZX3A 4LT5A 2WQZC 1PO22 1QQP3 5HXVA 1H2NA 1NE4A 4S2DA 2BVBA 3D5OA 1YUDA 4PDWC 2TNFA 4QQHA 5CAZA 2PAKA 1RUNA 1WUVA 5EYXA 2GAUA 5ACA1 5I8YA 2ZJCA 3VBOC 2P37A 5JSPA 2NMNA 3TBDA 4KWKA 2OZ6A 1YLLA 4AVBA 2NPIA 4Q0PA 1X50A 5L36A 2D40A 3MIDA 3THPA 4LBMA 1F5JA 2IXJA 4Y1UA 1IGOA 1OA4A 2D97A 2VNRA 4GMP0 4CDWC 5LK7B 2R062 1UIKA 4DB5A 1N1VA 2E53A 4GB31 5H9SA 5EYYA 3MICA 1HRI1 2ERFA 1UAIA 4XOGA 4R9DA 1C3HA 4XXPA 1ZYBA 4BHPA 4I0BA 3LWCA 3VUOA 4AHWA 1WW4A 5BUVA 1DF0A 4R9AA 1ND2B 4HVQA 3RJRA 3B00A 1VR3A 1H9PA 2D6PA 4BIFA 1UN1A 3DGTA 1WD3A 4IEVA 3KCCA 1U5XA 2D93A 4P5HA 4B7EA 5FLJA 4DY3A 2ZKNA 2ES3A 4NPRA 5BNOB 4TZDA 1R091 3RYKA 4HK9A 3RJ2X 1QJU1 3MIFA 5KC5A 4X8PA 3FFZA 2XJPA 4YGEA 2FZ1A 2VPVA 4YGDA 1N1TA 2RR12 1GSLA 3VHNA 4COYA 1FAYA 1S0GA 4PLOA 2JICA 1QXRA 3FJSA 3V65A 1BMV2 2JG9A 4AGGA 4JDOA 4Y1XA 2X53S 1HV0A 4FO9A 3DPRA 4AE2A 1F31A 2A6WA 3PMEA 1G7YA 4RFT0 4CP0A 2MEV2 1E57A 1VBA2 2Q0AA 3B01A 2IXIA 1O4YA 3MLLA 1AF9A 3JZVA 3VKMA 3WW1A 3NAPA 4AGVA 1PMIA 1VAMA 1W6PB 3NAPB 4BLJA 4IV1A 3MIEA 3ZFGA 4Y22B 3MF9A 3ZFGB 4YFZA 3BTAA 4YZ2A 1A78A 1LOAA 2ZPXA 2YHJA 2QZ2A 1XXNA 3WOGA 4PLMA 1D2SA 1RUH2 3ZXJA 2UWCA 3WP4A 2HEYF 3AZXA 4I0WB 1VBE2 4XTMA 4AI3A 5BNNC 4IV3A 4KG0A 4FTEA 1N1YA 5ABJB 4RR3A 2BTVC 1AYM1 3D4KA 2R041 2V09A 4A2UA 5AC91 4RQPB 3B02A 5J98B 5ACA2 2PLV3 3NSTA 3O0VA 5AFBA 3IDEA 2A6YA 2RE9A 4Q0VA 2GC3A 1MEC3 4H3WA 4J6GA 2DURA 1YFWA 4MLOA 4GH4C 4XJAA 3IM0A 5DDJ3 1HRI2 2D7FA 2NZ9A 2ATFA 3WDVA 4MUVA 3JUUA 1ND2C 2ET7A 3ES1A 3I7DA 1IS6A 3SXWA 1IPKA 1D4VB 4INDA 1YFXA 1LOBA 1OQDA 1AL23 1EPWA 2ZHLA 4Q1RA 5BNOC 3V0BA 2YROA 3RNSA 2DCKA 3AFGA 3V0BB 2PTMA 1RJ8A 2ZHKA 3VGIA 1TME1 5EZWA 4YZ1A 1HQLA 4WZFA 2QVSB 1K5MC 1QJU2 2QFEA 2ZGQA 2FHRA 2GH2A 2HWC1 4AQSA 3L9JT 3MIHA 3SCFA 4HKLA 4Z8BA 2RS11 2WT0A 4I3PA 2Y0IA 1FOD3 4OLLA 1KS5A 1A3KA 4FXKB 1FPN1 3MFAA 3U4XA 5FCCA 3HT2A 1AX2A 2ZMKA 1JOJA 4ITCA 1AR71 4IETA 4COUA 1I3HA 3ZN5A 1EV11 1UU4A 2X5IC 5GZDA 3WP6A 3U0ZA 3N35A 1CAVA 4ISRA 3BU7A 1ZZ6A 4LLFA 2YV8A 1N47A 3NJZA 4ZU5A 1Z0HA 3Q9OA 3E6CC 5JOWA 1PGW1 4B7KA 3UKTA 5T52A 1QOOA 1EYBA 4IEXA 3MLKA 2FBEA 4YG0A 3ZXFA 3BOPA 5C4WB 1VB2A 1CN1A 3FLTA 4HBNA 3AZVA 1LGCA 1KS4A 4AVAA 2ZACA 3D8CA 5ABJC 1JUHA 1O3TA 1M06G 1I6XA 2AENA 3WP5A 3WLUA 3TB0A 2O1QA 4R9BA 1AYM2 3OGGA 2R042 5AC92 1J3RA 4QQPA 2XKOA 5GLVA 1DGRN 1NZCA 4QM9A 5K0UA 3WQ1A 1YWKA 5K0UB 5C9AB 2R0HA 1W6OA 2ENRA 3QD6A 5IK4A 3AB0A 3EQEA 1O3QA 3VBHA 4KG8A 2UWAA 2KA3A 1J3PA 3WNXA 5DG1A 4K8FA 4KBBA 4YG3A 1OPMA 4XW3A 1JW6A 3UL2A 1HQWA 2EXHA 3K51A 5I0RA 1AR81 3WDYA 4IEZA 4FTSA 4FPHA 3AJYA 4ASMB 4PQ9A 1UU6A 4CDQA 3OTFA 2WNVA 3AYCA 3U07A 1BEV3 4CDQB 1WD4A 1ND3B 4FAHA 1U5IA 1LKNA 1QQP1 2O8OA 5H9PA 1KDKA 4N43A 5JIUA 5LRSA 4N43B 4O9EA 5GZCA 3J9SA 2D43A 3LAGA 1NLRA 1UPIA 2A6VA 5T3NA 1KDMA 1TME2 1WA4A 5BPXA 1DQ6A 5GLTA 2JG8A 3DUIA 3AKSA 2JG8B 3N3HA 5EJ3A 4E4DX 2HWC2 3GZTB 3T1LA 1S0DA 2LM3A 4Q4Y3 2IXLA 2E7TA 1YYNA 4LBQD 4OUSA 4ASLA 2RS12 1BJQA 4LEJA 1CQ9A 2PHRA 3A0NA 1B09A 1O7FA 1WLWA 1MZ6A 1FPN2 3PNAA 1LR5A 4A3XA 4AFDA 1GZCA 3WD5A 1QH7A 1JHNA 2W08A 1AR72 4Q27A 1U5YA 2EA7A 4XJ9A 4GMP3 4KU8A 4SLIA 4YG6A 1EV12 2ZHNA 1W6NA 4GKYA 3ZFFA 4NVPA 3T2TA 4AEKA 1W6NB 2QUOA 4MGIE 1HRV3 4MH0E 3IBMA 4GALA 5IUQA 1OD5A 3B7MA 3LA7A 4AFBA 2AZ5A 1GICA 5GLUA 4IEOA 4YW3A 5JMCA 2QDRA 3GHNA 1UKRA 2WIIB 1PGW2 2P17A 3IPVB 5KXBA 2VOXA 2K0GA 3HAGA 3S30A 3HR9A 4HMZA 3KD4A 3TOJA 5C4WC 4FVVA 1H0BA 1QJY3 2XL7A 4YFWA 2R16A 5L73A 1QJX3 1TMF3 5FO9B 3VL8A 4HVOA 1AXZA 2D6LX 1OOPC 1JXNA 2HWB3 2ZGMA 4JRLA 1MS8A 3E5XA 2B46X 4LULA 1W2UA 1X36A 5JIAA 1W39A 3J26N 3WUCA 5JPMB 3FE5A 4M3CB 4COWA 1HXS1 5FOBB 5FPZA 1KJRA 2XVGA 1VRH3 1QOSA 3J8F3 4RHV3 1CAXA 4N53C 3WW3A 1PK6C 5JR7B 5CFCA 2QDNA 5C9AC 1H4GA 4IEPA 3QCWA 4HANA 2B42B 2SBAA 3ZIXA 1CAWB 5SV8A 1FATA 1W0OA 3AMNA 5JSRA 2DCJA 5K7PA 2ZHMA 2JDZA 3GNEA 2ZABA 4QD2A 2ZTNA 1LHVA 3OPZA 3DV8A 1AR82 4XF3A 5IT6A 3RI8A 2R073 1OSGA 4A7YA 1ZREA 2C0ZA 4QPYA 3VHOA 1ND3C 3ZFEA 1YIPA 1MS3A 1QHDA 1QQP2 3WDWA 4FPOB 4AW7A 4Q4W3 2ZA9A 3WCSA 1GZ9A 1ZZBA 2K2SA 5DUXA 1FNZA 2A75A 1MS0A 4JV4A 4AI1A 2WS93 4CTEA 1ASJ3 3AP5A 1U12A 2VMHA 3U10A 2BFUS 5T54A 1LECA 3OBRA 3H50A 5DDJ1 4S2FA 1RUOA 3MW3A 3WY6A 4HETA 3LOBA 2DTYA 4XFAA 2ZGOA 3ZYPA 1OQ1A 5CVRA 1X33A 2GC0A 3AJZA 4YVWB 3PTYA 4Q0QA 1DQ2A 1NCRA 3DF0A 3I59A 1AL21 4GWNA 2WLQA 1YJKA 3MI8A 4I09A 4Y5Z0 4C0HA 4D7TA 4Z92B 5CFDA 5CU1A 4NHLA 1RHI3 5CFDB 4MSVA 3HMYA 3M3IA 4P9WA 4AEDC 1FYUA 1SBEA 4LO7A 4QPGC 5KHKA 3V0AA 4EV0A 3V0AB 3ZXAC 3FBMA 4QPIB 4OI2A 2JX9A 5B2GB 2VH9A 3EJKA 4XETA 1X82A 3OYWB 2PHXA 3WV6A 4GULA 3IIAA 1VBB3 2BNMA 2PHFA 1JYCA 1RUC3 1H2LA 4AI0A 1LU2A 3AP9A 3B3QE 4RS5C 3CJIC 2C9AA 3KT1A 1F9KA 4XF9A 1V70A 2NP0A 4ZU4A 4UXAA 4NO4A 3ZMOA 4S2GA 1N3PA 3HWJA 2GMEA 1RTVA 4X6QB 2WLPA 4PDWB 5F6KA 1GZWA 4META 2JENA 1VB4A 1DG6A 3USSA 3VBOB 4JGZC 2YYOA 4Z82A 1REFA 2WT2A 3FX3A 2XLFA 4CDXC 1A6CA 2PQQA 3IWZA 1WMEA 2DUQA 3G6JB 5CB7A 4CDWA 2BEOA 1XRUA 4CDWB 2E7AA 2EALA 2BGCA 2EXJA 1AHSA 4OI0A 3D0SA 3HQXA 3P3NA 1Q43A 5A32A 2A3YA 2YDEA 3AKQA 1DFQA 4X6RB 4XEZA 1MVEA 2DYCA 2VU9A 4ZU7A 4FP3A 4MV2A 3VZKA 3N36A 3NKTA 3VBUC 3L2HA 1BQPA 3SHRA 4IERA 4PIZA 2ZOEB 5LEJA 3S6PA 3RQ0A 4DQAA 1R083 3EHKA 1D2QA 4RA0A 1SBDA 1GLHA 4BYYA 4D7SA 3ELNA 3RS6A 1B35B 1LOEA 1ZM1A 2HEVF 3I2DA 1V00A 4L92A 5DDJ2 3ZYIB 2BPA2 3B9CA 5BXXA 2XLAA 3O14A 3JQWA 1NYWA 1S0CA 4AVTA 2AH2A 2P34A 1C1FA 4WVMB 4YVWC 3USUB 3ZN6A 2WSVA 5AFEA 1RUE3 3ZN6B 3UJOA 4WM7C 3M70A 3WDXA 1BEV1 5HI0A 5AVAA 1TQ5A 4LBJA 4RGAA 1AL22 3APBA 4LHKA 5DZFA 5T5LA 2WKKA 2D6OX 2DU0A 2ZAAA 5FPXA 1IZ3A 1REEA 1R1A3 3VBSC 1ZVFA 4Z2WA 2RM23 3PMSA 4RSUA 1YIFA 1MS1A 2W39A 4P9YA 1MZFA 2R49A 4QPIC 3AFKA 5C8CC 1Q8QA 2A6XA 5JVVA 5KC6A 2VVFA 4Q4Y1 3I8TA 5GJ6A 4HN0A 1RVF3 3OY8A 3AX4A 4IEYA 4DZGA 5T55A 4F83A 4NR1A 2GSYA 2B9UA 3O5SA 3KT4A 5IK8A 4BOWA 4GMP1 4OHWA 1D4M3 4TYSA 5BNNB 5JOZA 3H0OA 3ATGA 3NV4A 1HRV1 4AF9A 4K20A 3AYEA 4HKWA 3VDDB 4PLNA 3B5LB 3H7YA 1UPSA 2PHTA 3PVBB 3AMMA 2HWF3 4I02A 3VBFC 1X8EA 4J1XA 4LA2A 3RI9A 1HX6A 1DYPA 1QJX1 4GH4A 1V6LA 3V64A 3EBRA 1ZBE1 4GH4B 3ASIA 5D8AC 5FLIA 1YHFA 4XIKA 2HWB1 4HL0A 4Q4X3 2HJIA 4NN0A 4RL7A 3UKVA 3ILFA 1ND2A 4XIOA 3WW4A 4JVAA 4M00A 1URXA 1PVXA 3MYXA 5CA6A 2I45A 1KJLA 3INAA 1VRH1 3AMHA 4XQDA 3ZXLA 3J8F1 5BYNA 3MF6A 5JPNB 2GN7A 4NWWA 2DFCA 2VW2A 1G6NA 3JB4C 2VOWA 1C57A 5BNOA 5DZGA 3NV3A 2SLIA 1TEIA 4LUKA 1ZNPA 2BYVE 5E88A 1B35C 1FI2A 4XF0A 1KFUL 1K5MA 2DCYA 3CLPA 5JSOA 1K5MB 1Q56A 1BZWA 1AL0G 1AR63 3VLBB 4FSJA 3ZSEA 4Q26A 5FDBA 4B4RA 2TEPA 1QJZA 5JI7A 1PVC3 5FMOL 3QACA 1WLTA 2Z69A 1H4HA 1BEV2 3FUQA 5J09A 1S1AA 4D3WA 1PO13 2X5IA 1WMDA 2XVLA 2X5IB 1IQAA 1RGSA 4Q4W1 3PJYA 5BY5A 1S0BA 1W6PA 2PHUA 3RZZA 5GLWA 1GR3A 4Y22A 1DGLA 1SACA 3SISA 1DZTA 2V5YA 1PIV3 4HPKA 4ATFA 5JAXA 4Q4Y2 4HPKB 4CZSA 2WS91 1IPJA 2CGPA 2W0XA 4W65A 3WG3A 1ASJ1 1XE7A 2WA3A 4GWMA 2X29A 5FO8B 3ETQA 4E4SA 3J4UH 1AYN3 1VBD3 2DWRA 4P9JA 4CEWB 4HZFA 2OIIA 1W6QB 4OZXA 5ABJA 2E7QA 4JDMA 2EF6A 1YO8A 3VBRB 1QGLA 1N1SA 4QM8A 1APNA 4RQPA 1HRV2 3WG2A 1XNBA 4M3CF 2RS53 3VDDC 2VXRA 1A8DA 1CPNA 1ENQA 1LGBA 1RHI1 2Z42A 2QZ3A 5KXCA 1O91A 2ZCWA 4N7UA 3ZYJB 4EWEA 3CNAA 1RUG3 1RIRA 4QGMA 3WQ7A 4EN8B 1QJX2 4AFCA 2R1DA 1ZBE2 1WW5A 3RSJA 3OF1A 4I2OA 2HWB2 1RB8G 4LE3A 4FTBA 1VBB1 2YXSA 2XPJA 1SLTA 2RHPA 2PYTA 1PNFA 3NO8A 3SCGA 2GC2A 2GC1A 2OUJA 4BPZA 1BK1A 1AXKA 4JGYC 4IQPA 3FC0A 4DINB 1DHKB 1VRH2 3J8F2 3MLJA 4RHV2 1WLCA 4ES8A 1KXGA 4LO5B 4C1WA 4XFGA 4YM0A 4BWOA 1ULCA 3A0KA 1OKQA 5DUVA 5CNAA 1AVBA 2QE3A 3MPPG 2HWE3 4FOWA 5A33B 4SBVA 2EXKA 5KWRA 2BQPA 3WQ0A 3RDIA 2QNKA 3DL3A 1QXPA 3RYRA 1OLQA 2RS33 1RL3A 3IDCB 3LSEA 3VKOA 1JUIA 2Q5TA 1HV1A 2P3KA 1CX4A 3JB8A 4GA9A 4WM8C 3ZXEA 3MZHA 2EAKA 4W6YA 5FRAA 4DFSA 1U5ZA 4N9IA 1AJOA 1MZEA 4HN1A 2H0VA 2B5HA 1OHFA 3M2MA 2W52A 3WUDA 2QQPA 4ISQA 1C28A 4Q4W2 4Q4V3 3KLSA 2JG9C 2CL2A 4HVRA 3E97A 1ENXA 5E16A 1ENSA 1XU2A 3DPRC 4GKXA 3PHMA 3TAYA 1R081 5KXDA 2FQPA 2WS92 1XYNA 3GHMA 5C4WA 4YM3A 1ASJ2 2Z2SB 3KSCA 5T5JA 4CRQA 1ALYA 2ZZJA 3MW4A 4H7LA 1H9WA 3PVEA 4CEWC 3H1YA 1V6MA 4MYEA 2Y0OA 3WHTA 4LUMA 2GN3A 1OOPB 3VBRC 1ZA4A 3LKJA 4MXWA 4MXWB 5J96B 2VG9A 4IV1C 1OA2A 1RUE1 4JTOA 1QY4A 4AHZA 1LESA 1LODA 3FMGA 4H7MA 1HW5A 2ZX1A 1PK6A 1LHUA 2PHLA 1R1A1 3KQRA 1RHI2 4N53B 1PK6B 2RM21 5DZEA 4B4QA 5L7OC 5E8AA 1V9U3 4FPYA 1SFNA 5C9AA 4M0NA 4QT6A 1Y43B 2HEWF 1MS5A 1REDA 1CPMA 4C1XA 4R9CA 1ENRA 3MPBA 3AP4A 2GNMA 3S0MA 3ZXKA 4BIOA 3VKFC 2R1BA 4XBLA 4DRRA 1C4RA 1RVF1 3MDPA 3VZJA 2DFBA 2PELA 5JWPA 1I5ZA 1VBB2 4CDUC 4AQ2A 2JXAA 3MEPA 5BNQA 1ND3A 1EY2A 4QGNA 4YVSB 3LA2A 1D4M1 2R30A 2RR13 4YARA 2OW4A 4E2SA 3MFCA 1EAH3 1NQDA 4AHYA 1H8VA 2CAVA 3OD4A 4KH9A 2ZGLA 5TSWA 1FV2A 2VGDA 1G9CA 3O7OA 2ZGRA 1VAVA 1SEFA 1ZBA3 1DDLA 4FT8A 2VY0A 4MX3A 4X8NA 4ZXKA 3B9IA 1QNYA 3NKGA 3PLQA 2HWF1 4TSVA 3D82A 4YYOA 3FLPA 3RMYA 4XFFA 2MEV3 1YCIA 2Y26A 3ACLA 4YW2A 4EN9B 1IOAA 1EP0A 2BVVA 3ST7A 2H0BA 3JBG3 4EROA 4N7IA 3TYJA 3BALA 1YI9A 4OHXA 1SDWA 1NXD1 2DCZA 2HWD3 1WCSA 5E1RA 3DN7A 1D0HA 4GXLA 1N3OA 1AR93 4L97A 3ES4A 4H14A 3FZ3A 4PIXA 5FQ0B 5SV5A 4B3NA 1GFF2 4KL1A 1AUYA 2ZX4A 5I91A 3IPVA 5AVPA 3VZOA 1VBE3 2OA2A 4AEDB 4UW6A 1R082 4QPGA 2UWBA 4QPGB 3C2UA 4RGGA 4LHLA 2PAEA 4AWDA 1UD1A 3BB6A 1UZZA 1V6NA 3B93A 2OZJA 4P9LA 4BCUA