1PO11

Poliovirus (type 1, mahoney) in complex with r80633, an inhibitor of viral replication
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
283
structure length
283
Chain Sequence
AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced conformational changes in poliovirus-antiviral drug complexes.
pubmed doi rcsb
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
total genus 48
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1po1100
4CDXB 1RUJ1 1POV3 2RR12 1RVF1 4N43C 1QJU2 4CDXA 3VBFC 4AEDA 2PLV3 3ZFFA 1VB2A 4JGYA 4CDXC 4GH4A 5C8CA 4YVSC 5CFCA 2WZR2 5L7OA 3ZFEB 1VBA2 1BMV1 1R1A1 1VB4A 2RS52 5CFDA 4WM7C 1ND3A 1NG0A 1TMF3 1NCRA 1HXS2 4AEDB 2FZ2A 1VBD1 1BBT2 1HX6A 1F8VA 1VAKA 1PO11 4CDWC 5ABJB 1MEC3 1FOD2 1QJU3 1R083 1ZBE2 4N53A 4Q4Y1 2PLV1 4IV1C 3TN92 1BBT1 3VBSA 4CEYC 4IV1B 4N43B 4Q4V3 2MEV2 3J8F1 5LK7B 1QJY3 4JGZB 1F2NA 1RUD1 4Q4V2 5J98B 1AR81 3VBSB 1QJY2 1Z7S3 5JZGC 2RS31 4Y4YA 1ZBA2 2WFF3 3DPRC 3VBOB 2WLPA 1NA1A 5ABJA 2HWD2 2VQ0A 3VBRA 1AL0G 4CEYB 3LOBA 1SMVA 5ACA2 1PIV3 5ACA1 2XBO3 2X5IA 3JBG2 1EAH3 1H8TB 5FMOL 1FPN2 3J8F3 4BCUA 4RR3C 5BNNC 3VDDB 4GMP0 1ND2A 4CDWB 5C9AC 4CDUC 2RS32 1OHFA 1VBE2 4CDQC 1NY71 4RR3A 4YVWB 4CEWA 5A33B 1RHI3 1R081 3ZFGB 4Q4V1 1H8TA 1RUI1 4IV3A 5AC92 1ZBE3 2RM21 5C8CC 3NAPA 1ZBA1 3JD71 3VBHA 2WS92 2IZWA 3JB8A 1E57A 1RUE2 1RUH2 1D4M2 2ZZQA 3S6PA 1HRV1 3M8LA 3VBRC 5DDJ2 1OOPA 5BNOC 5A33A 4CEWB 1WCDJ 5C9AB 3VDDC 5BNNB 1QQP2 1AR93 1RUD2 2R041 3VDDA 4N43A 4GH4B 4RS5A 5A32B 2R071 1OOPC 5BNOA 1ASJ2 1PGL2 3ZFFB 5C4WA 3JBG3 1TME3 2BPA2 1ZBE1 1HXS1 1VRH3 1VBC3 5D8AC 5AC91 1C8M1 1RUC2 1B35A 1M06G 1AYM3 2WFF2 5K0UC 1AR71 4IV3B 2WS91 2RR13 3NAPC 3VBSC 4RS5B 1NCRB 1RUJ2 4N53C 2ZTNA 1OPOA 1R1A2 1HRI3 1C8NA 1R093 4WM8B 1HRI1 2HWE2 3TN93 5ABJC 4QPIC 1D4M3 1PGW2 5L7OC 1RUI2 4RHV3 1PGW1 1VBB2 1Z7S1 1QJZA 2R063 2QQPA 1MQTB 1BBT3 1NY72 1VRH1 5AC93 1RUC3 2HWB3 4Q4X2 1RUC1 4QPIA 1RUD3 3CJIA 1NCQA 3VBUA 2R073 4WM8A 4FTEA 1RUF2 1ASJ1 2RMU2 2R072 4YVSB 1R091 1RUF3 1V9U1 2RMU3 3ZFEA 5FOJB 4Q4Y2 1AR82 5ACA3 4IV1A 1C8M2 1PO13 3J8F2 1FPN3 2MEV1 1B35B 4QPGC 3JB4C 1COV3 1RMU3 1COV1 4FTSA 1ND2C 1AL22 1AR73 1RUH3 1PVC3 2R042 1CD3G 1RHI2 4RQPB 4LLFA 1R1A3 3JD72 1R092 2HWF3 4PDWB 4YVSA 1FMD2 1AR63 4WM7A 4PDWA 1QJX1 2RS51 1RUJ3 2Y26A 4PDWC 4RQPA 1BEV2 4JGYC 5CFCC 1RVF3 5BNPC 1VBD3 1X33A 3VBHB 4RQPC 1NA1B 4IV3C 2XBO2 1PVC1 1VBC2 5C4WB 1EAH1 1X36A 4QPGA 1AYM2 4GB33 2HWE1 5A32A 1ND3B 1AR83 5C4WC 2WZR3 5CFDB 1AYN2 1RMU1 2TBVA 1TME1 1HRI2 2RS53 5K0UA 1NCQB 3VBUB 1QJY1 4RFT0 1VBB1 2RS13 2X5IB 2HWC3 1PVC2 1VBC1 4NWWA 1AR61 4EJRA 1A6CA 3JBG1 2ZAHA 1NCQC 3VBUC 1QJX3 1C8M3 1PIV1 2XPJA 2XBO1 4GB31 1RMU2 3ZFGA 2HWC2 4FTBA 1PO21 1TMF2 2DF7A 1CJDA 5JZGA 4Q4W3 3ZFGC 1AYN3 1EV13 4JGZA 3TN91 1EV11 1NA1C 1K5MC 1EAH2 1EV12 1AUYA 1V9U2 2HWB2 3DPRA 2BBVA 4N53B 4QPIB 4JGYB 1PGL1 1MQTA 1H8TC 2PLV2 3NAPB 4GMP3 1RUI3 1W39A 1QJX2 1RB8G 1VBB3 1BEV3 2RM23 4RHV1 1NCRC 2RS11 1MQTC 1FMD3 3IDEA 1AR62 4Y5Z0 5CFDC 5K0UB 1PO22 4CDQA 1ND3C 2HWE3 1ND2B 4CDWA 1FPN1 2MEV3 5CFCB 1PO23 2FZ1A 2R043 1RUE1 1IHMA 5DDJ3 3ZFFC 1RUE3 2WZR1 1AYN1 3ZXAC 2HWF2 3VBRB 1MEC2 4GH4C 3HAGA 3VBHC 2WWSA 3VBFA 1R082 5BNPB 1VRH2 5FMOS 2RR11 1AL23 1AR72 1HXS3 2HWD1 1ASJ3 1K5MB 1TME2 4NWVA 1MEC1 2BUKA 2HWF1 4GMP1 5D8AB 4Q4Y3 2BFUL 1BEV1 1AR92 1RUG2 4CDQB 5C8CB 4CDUB 4Q4X3 1DDLA 4Z92B 2R061 4CEYA 4SBVA 4RHV2 5BNPA 1B35C 4QPGB 5DDJ1 1VBD2 5J96B 2WFF1 2X5IC 3VBFB 3FBMA 1ZBA3 2WS93 4FSJA 1PO12 1HQNA 1QQP1 4RR3B 1FMD1 1COV2 3DPRB 1VBE3 2RS12 2RS33 1HRV3 1POV0 3CJIC 1POV1 4YVWA 5L7OB 2HWC1 1FOD1 1RUG3 4JGZC 1AL21 1FOD3 1RUG1 4WM8C 4YVWC 1RHI1 2HWB1 4GB32 3VBOA 2R062 1D4M1 1RUH1 2GSYA 2HWD3 1PIV2 1QJU1 1RVF2 4Q4W1 4CEWC 1AR91 5BNOB 1VBE1 1BMV2 1Z7S2 1VBA1 2RMU1 1RUF1 1V9U3 1QQP3 1VBA3 4CDUA 1TMF1 5GKAC 2GH8A 2BFUS 3VBOC 1HRV2 5C9AA 4WM7B 5D8AA 4Q4X1 1OOPB 4RS5C 5BNNA 4Q4W2 3JD73 5JZGB 3ZFEC 1GFF2 2RM22 1AYM1 3CJIB 1K5MA 4AEDC 1NOVA
chains in the Genus database with same CATH superfamily
4GULA 2IXLA 3PVEA 3OEBA 2RR12 2BGPA 4HK8A 4PIZA 4Q0VA 5FPAA 4M4PA 2WRAA 4N43C 1OLRA 4Y1UA 4ZU5A 4BIOA 4CDXA 1MVQA 1Y9QA 4KWLA 5IVJA 1YQ2A 2EICA 4JGYA 1G8WA 4IL7A 3NNFA 4P9WA 2MPFA 1W8UA 4CUGA 4M3CF 2VE1A 1MVEA 1DGRA 4QT6A 2ATFA 1UF2C 4C0BA 5GLVA 5CZKA 4FAGA 5CFCA 2WZR2 1LGBA 1K45A 5CG8A 1CAWA 3OPZA 5HCAA 5H9QA 4AI9A 2JXAA 1GR3A 4Y4RA 4ZU7A 1AX1A 2XJVA 4WM7C 4IEYA 2LW8A 4YW1A 5FR3A 1G6NA 1JOPA 4YZ3A 3MO4A 1HXS2 4BQYA 4Y1ZA 2DCYA 1VBD1 1J1LA 2VZOA 2WWUA 5FLJA 3ZYRA 4WVMA 3C8XA 3MIBA 4IGOA 3N9MA 3JZVA 3RMXA 5KC6A 4A4AA 1G7YA 2YYOA 1PO11 4OYUA 4E2GA 1UD1A 3LPGA 3AYCA 2FMYA 1MEC3 2BVVA 4CU8A 2YBKA 1GANA 1OH3A 2O14A 1R083 2CNAA 2D93A 1MACA 3N3HA 4N9HA 4XYXA 1ZZ6A 4Q4Y1 4IV1C 4XFGA 2LM3A 4YGDA 3TN92 1RXGA 4CCNA 4JRAA 1W90A 3VBSA 4CEYC 1N47A 2GC1A 4Q4V3 2MEV2 3J8F1 4L0PA 1F15A 5F2WA 3ZPYA 5A70A 1OLQA 2R0HA 3JXSA 1W06A 4YG6A 3SEPA 4JGZB 5J98B 1AR81 3WP6A 1JZ8A 1SG3A 1UY1A 1IKQA 1EP0A 2XLGA 4AWDA 5C7GA 2Y6FA 5JZGC 4HXCA 4MGKE 3WDXA 2Q1MA 1ZBA2 1OD3A 1D7PM 2WFF3 4PCRA 3H42B 3AYEA 3SMHA 3FL7A 2VQ0A 4CEYB 2XGXA 2KM2A 3LOBA 2A7AA 1C4RA 1J83A 1OI6A 4QDRA 3RNSA 5GZGA 5LEKA 2GZWA 3E6BA 5GZDA 4J6GA 1EAH3 2PHXA 1NAEA 2PAMA 2UWAA 3I97A 3J8F3 4RR3C 1FXZA 1UQXA 1E5HA 2ERFA 4Z07A 5KXBA 3QBQA 1ND2A 4GMP0 4EQVA 5JXHA 4LBJA 1XB9A 1ZA7A 3POSA 1WMDA 1LOFC 3VKOA 4P00B 1CWPA 4UW4A 4QX0A 4LPLA 4JV4A 1JYWA 1RGSA 5FFOC 3SKVA 5CISA 1RUNA 4OULA 2VJXA 3ZO0B 3KD4A 4HETA 1LGNA 1MZEA 4GA9A 4IV3A 1ZRIA 3T09A 1WD3A 1XBFA 3NAPA 1QWRA 3OUIA 5IYYA 1XNKA 3AP7A 3SNMA 5J3UA 2IZWA 5L9VA 2FDGA 4QX8A 5F1RA 2B5HA 1E57A 1RUE2 2Q1FA 2Y8KA 1CX4A 2ZOEB 1BCXA 3VV1A 2ZKLA 5F39A 1OC1A 4D69A 2CGPA 3BB6A 3S5AA 1ZYBA 3WD5A 4FOWA 4B7EA 5BNOC 4CEWB 4HMZA 3BYWA 4YGEA 5IVYA 1WCDJ 2JE7A 2V5YA 3W5MA 2Y6JA 2QQKA 1IQAA 4D7YA 4RYDA 3HWJA 1O4ZA 2BDRA 4K21A 4D7TA 1AR93 5L36A 2ADEA 4OI0A 3VDDA 2B39A 4HSJA 4OHWA 3PURA 4RS5A 3RG0A 1SDWA 1H8VA 5HBAA 4LO7A 5I0SA 3I2HA 3VZOA 5HV0A 2Y6GA 4XFCA 4QDQA 4XFFA 2JG9C 1J3QA 3HPNA 4LBNA 5C4WA 2PYTA 2BPA2 2BOIA 2F4PA 3AMPA 1S2BA 2BNMA 2Y6HA 4LOTA 5AC91 1VBC3 1ULGA 2A5ZA 2X29A 2Z4FA 1RUC2 2ARBA 2D40A 4PQ9A 2I45A 4YFZA 5I93A 1AYM3 2VVDA 4I3PA 3FFZA 4N90A 2WS91 2VH9A 3RSJA 2YB7A 5IK4A 2OS2A 4AHZA 2G1MA 2JDZA 3VBSC 2PN5A 3THPA 1MS1A 1NCRB 1RUJ2 3MBWA 1OQ1A 1UMHA 1WW5A 2ZCWA 5FYHA 1UU6A 3RJRA 4YZ2A 3OBAA 3S5QA 5FP9A 1R1A2 4K6BA 1R1ZA 1WBLA 2RJKA 3ETPA 1C8NA 1R093 2WN2A 1XXNA 4XQDA 2OXBA 1HRI1 2HWE2 4ZHNA 3GF6A 4IEOA 4FO9A 2ETEA 2XJSA 4ASLA 3IIIA 3J7MA 4QPIC 3WCRA 3OGSA 5FY8A 3O1OA 1TEIA 3T2OA 1W0NA 4PIXA 2VG9A 3BU0A 3OTFA 4AGGA 2NN8A 4IE7A 1VBB2 1X9PA 1Z7S1 2DYCA 5EJ3A 2R063 1YHFA 3LD8A 1OQEA 2QQPA 1MQTB 4I09A 1UYXA 4GWJA 1K12A 1VRH1 1CN1A 1RUC3 2ZX4A 2P3IA 4GALA 5FZAA 3GM8A 3MIFA 2ZBJA 1RITA 4LBQD 3O0VA 4XQWA 4QX2A 5LRRA 1RYYA 2D43A 4EWDA 1BZWA 3AMQA 1RL3A 3CJIA 3PNAA 3QH6A 3CDZB 2XKOA 4Y33A 5EV7A 1RUF2 1FNZA 1MR5A 2R072 3Q8CA 3V65A 1R091 4HG6B 2RMU3 4MHUA 5K8SA 3ZFEA 2OQ7A 4YW5A 1KDKA 2O8QA 3D82A 4OI1A 4FPCA 4IV1A 4IE5A 5FYZA 3TYJA 4BQ4A 2D3SA 2VZTA 2YC0A 3I2FA 4ZZ8A 4LULA 1ZNPA 4XAAA 2EXHA 3JB4C 4XILA 1COV3 4XIOA 3EBRA 1O5UA 1BKZA 4X6RB 2QBXA 5DPNA 4LT5A 3IPVA 1PMJX 3B5LB 1LR5A 5C3SA 1GZWA 2O1QA 3AZXA 4TWTA 3PMEA 4O9EA 4AOCA 1RHI2 3POIA 4M3CB 4HANA 4U2AA 3JD72 3QACA 2VW0A 4O7XA 1GQPA 3OBTA 5JSPA 4YVSA 1LULA 2GALA 4Y22A 4OHVA 1G9DA 1IPSA 1QXRA 1REEA 4QXKA 4CTEA 3KZ4C 1NZIA 3LDRA 4DZGA 2JG8B 2WR9A 2RS51 3NV1A 4CCJA 4ZZ5A 1YFXA 4IEZA 5B4NA 1RUJ3 2WYSA 2YY1A 3M7AA 1W8OA 2ARAA 1LTEA 5E89A 1BEV2 4JGYC 3VZNA 4YW7A 2WSVA 3IM0A 3ITQA 4NHKA 1X33A 3O1RA 4HSLA 5EPAA 4TZDA 3ACFA 1OUXA 1JUHA 1EPWA 1VBC2 2XBO2 2XVKA 5FJHA 3LFIA 1YUDA 1AYM2 5FYBA 1RJ7A 4OLLA 4ZXEA 1YNAA 3BIEA 5A32A 3SHRA 4B7KA 1UW8A 1UYZA 2FDIA 2VBDA 3EYPA 3MDPA 3B7MA 3HBZA 5T52A 4EN8B 1W2UA 2F17A 1AR83 2JB4A 4UOJA 1UXZA 3MFAA 4JDOA 4AGRA 4M00A 4BQ5A 3NMBA 4MGQA 4YLZA 2VW2A 3N35A 2RS53 5FMCA 2CDPA 4XTPA 3SITA 5K0UA 3WF4A 1O5LA 1J59A 3MW2A 3TWIA 5IVCA 1JUIA 2VU9A 2OVUA 1QJY1 4AI8A 2YU1A 3S0MA 1VBB1 5J48A 5IUQA 2RS13 4R9AA 3PTRB 1PVC2 4A6OA 4NWWA 4NVPA 5CKMA 3UL2A 4DIQA 2VECA 5DUVA 2XLAA 3U14A 2VCAA 5F6KA 3VLBB 1NCQC 3O5SA 4NHLA 5FPLA 3J9SA 3LWCA 4FXKB 1C1FA 5ISLA 1PMIA 1Z0HA 2XPJA 3C7OA 1IG0A 3HJRA 3ABZA 4NJ4A 3FWEA 2NPIA 4MXVA 4FTBA 2WNUB 1PO21 3KV6A 1Y4WA 4JQRA 4QXHA 1TMF2 4S2FA 4YW3A 1CJDA 5FXZA 3IWZA 3CEWA 5JZGA 4A6SA 4BLIA 2DBIA 4E8DA 2QZ3A 4D7SA 2YXSA 4JRLA 4D6QA 3WZ1A 3O12A 2ZX0A 3OGJA 3RWKX 4HLTA 1NA1C 4YG0A 3TOJA 5JPMB 2RDQA 3E5QA 4KWUA 1PZ7A 1JS9A 3R4SA 5C3RA 2HYKA 2Z2SB 5HCHA 3KVAA 1XSQA 4KNCA 3V0AB 4BYYA 4QPIB 1MQTA 2E32A 4DB5A 3KWVA 1QH6A 2P4EA 3WCSA 4PLNA 4PBPA 3ZPOA 5I8TA 1VALA 1X8EA 1EUUA 3WNLA 4CCLA 3SH4A 1RUI3 5IVBA 4OQ8A 1CZSA 3NV2A 4R52A 4UW3A 4Q1RA 1YQ8A 2E6VA 1BEV3 3N9QA 5FLIA 1WW4A 1NQDA 5FP7A 3WW2A 4XHXA 4NIHA 3KF5A 2D3RA 3LPFA 2IVJA 5FY0A 4COZA 3V0AA 2B42B 2R30A 3ACHA 5KHHA 5LA0A 1MS9A 1UOFA 5FP3A 3KHBA 3AFGA 3K3NA 4CDQA 4BQ1A 1VPHA 4XMIA 5HXVA 4CDWA 3O1PA 5EP9A 1GWMA 1HQLA 2R043 4DEVA 4AAXA 5F37A 1GOHA 2P1BA 2A6WA 1CQ9A 2C6SA 4IERA 2ADDA 3FUOA 3WVJA 3ZXAC 4UAPA 4A7KA 1MEC2 2ZMNA 5T55A 1LKNA 3RYKA 1W8TA 2VM9A 3VBFA 4LTAA 2EXIA 4YWAA 5TSWA 1ULFA 5CA6A 1IZ3A 2A6YA 1VRH2 2JDKA 4O61A 2C9KA 2Y6LA 2AENA 5F2SA 3BVCA 5FMOS 2RR11 3POGA 1AR72 1HXS3 3BTAA 1ASJ3 2JECA 1XC6A 5FZHA 2WN3A 1UN1A 1XQNA 2H0VA 1MEC1 1LNSA 4NWVA 4XXAA 2QDNA 3AP4A 2G19A 4GMP1 4ITCA 5FBZA 3BPSA 3RZZA 2QUOA 5IAXA 4Q4Y3 3ZYFA 3RZHA 2GC2A 2K46A 1RIRA 4XJAA 4FPFA 4FBFA 3AMHA 2XH6A 3WF1A 4YGBA 2FCTA 2CHHA 1H2LA 4Q4X3 3POBA 2ARCA 2XJTA 4UW5A 3ZKUA 5FZOA 4FPHA 2DU0A 1W9TA 4Z92B 3WG2A 4X6QB 2R061 4DMIA 4MGTA 1DQ2A 1TE1B 2ORZA 4CEYA 2ZXQA 3RYRA 1NUKA 4RFRB 5GJ6A 1UZVA 5F9TA 5HI0A 2BNNA 2SBAA 1UKRA 3CZJA 1B35C 4ASKA 3KB5A 1VBD2 4RL7A 5BNPA 2WFF1 4OMDA 1F5JA 2IXIA 4YNIA 3P3PA 2RDNA 5CAZA 1AVBA 1DQ1A 1ZBA3 1ZRRA 4Q5OA 3H8OA 5T54A 4YZ5A 3VZJA 1V6IA 3MV11 4LHNA 3NNJA 5I8YA 2RS33 1POV0 3IZOA 5B2GB 1POV1 2QQUA 3ZR6A 3Q9OA 4YVWA 3VKNA 5L7OB 3TBDA 2XWJB 4AZZA 5C5UA 2JDMA 1H1MA 1M4WA 3ASIA 2ZEXA 1W9FA 1ZA4A 3FMGA 1H2KA 1X9TA 1XNCA 3LEKA 4I0AA 1RC6A 2AEZA 5FK7A 3VDCA 1UKGA 5FZGA 1LHWA 4C8DA 1RUG1 2DUOA 4YVWC 5FTTC 5F3EA 2DCZA 5E6HA 4CCKA 3PL0A 1KDMA 4WZCA 5LA9A 2HWB1 3UKTA 3AZWA 1OLME 2W87A 3ZSJA 4NO4A 1A34A 3MZHA 2VMGA 3RDIA 3H8UA 3KSCA 3T1MA 4NPMA 3AKTA 2K0GA 2ZGMA 3FX3A 3UGHA 4EN7B 1LOAA 5LK5A 3NRUA 1V9U3 1WCQA 1OVSA 1KS4A 4P08A 3A0KA 5LASA 3J7LA 3POFA 4KQ7A 4CDUA 2GH8A 5IJRA 3RZMA 3NQHA 3GBFA 3DYOA 1WZXA 3HNYM 1VRBA 1JBCA 3WY6A 3ZYHA 4I01A 4MLOA 5JAXA 1JYXA 5FXWA 4FQ4A 4AI2A 4OI4A 1W2TA 1G9FA 4XBNA 2V4AA 4F3JA 4YZ1A 4AR2A 5D1IA 3CJIB 1JU3A 4GJYA 4GZ9A 4A3XA 1K5MA 5H9PA 3ZMNA 2YC4A 4AFDA 5AFEA 3CJXA 5A7SA 1LHVA 4EROA 4KWJA 4CDXB 1QNWA 2UY9A 3WF0A 4BISA 4CCEA 2CYFA 4MO3M 4WVMB 4JX0A 1OQDA 1RVF1 4ASMB 4FFGA 5LBCA 3NNGA 3OYWB 2QDRA 4JCKA 1FNYA 2P3KA 3MIEA 1KXGA 1UZYA 4R9BA 5E1RA 5LA2A 3ZFFA 5H9RA 3ZDVA 3RPQA 2PHLA 3RRDA 1RJ8A 4CCDA 2D6KA 2ZGRA 3VDAA 2AUYA 1DBNA 4GH4A 1GICA 3KV4A 3WP4A 5C8CA 1X7NA 2WNOA 3H3UA 4LIVA 3ZFEB 1SBDA 3OSDA 2AZ5A 1BMV1 1OKQA 5IWFA 1W6NB 1A8MA 3I2DA 3ECQA 4P9YA 5DG1A 3I2GA 1AXYA 2PQSA 1JZ4A 1VB4A 4IDZA 3KS7A 3N7MA 3B93A 5CFDA 4AFAA 1UY0A 4M0HA 3SKJE 5JXGA 1ND3A 3CHXA 4NHMA 1GOGA 1NG0A 4BU2A 5FZFA 3C2UA 3E97A 4ZY9A 5T5OA 1NCRA 2LTNA 3IIAA 4KWKA 2BRTA 3N7JA 1QU0A 4D6SA 1HX6A 1QHDA 5FKCA 5HCBA 1Y3TA 2WA4A 1IOAA 4CDWC 4I2OA 4UT5A 3NV4A 2BZDA 4LIUA 4A42A 1YI9A 5JXIA 4QQOA 2JDAA 3HEIA 2GC3A 2J1AA 5KHKA 4N53A 4R9DA 1Q56A 3PU8A 2QQJA 2BOJA 4GXLA 5IHRA 3VHNA 4CZSA 3ME2A 2FDJA 5LK7B 3AVRA 1X8MA 3M3QA 3JCIA 4K3UA 4XDQA 1DYKA 5F32A 2XHKA 1HB1A 1CPMA 4J1WA 3U1XA 2H6BA 4B4RA 3NJXA 2AEYA 3ILFA 1FV2A 4FP2A 4BQ2A 3SH5A 3O7OA 5FWJA 1SPPB 1YYNA 2BYVE 4FVVA 3P3NA 1I3HA 4Y4YA 4OHXA 2YHJA 4FPYA 4DUXA 1O8PA 1QDCA 2VMIA 3MV01 1PK6B 1U0AA 2WQZC 2WFPA 3DPRC 2HH9A 4Y20A 5DAPA 3ZIXA 4F8AA 2YBPA 5C5TA 2FD8A 3AC0A 1NA1A 3AYDA 3HQXA 2GC0A 2VULA 2D6NA 1C1LA 1Y43B 1SMVA 4QKNA 4MGZE 3IMNA 3ZYPA 2CGOA 2QNKA 4YM1A 2OZ6A 2V72A 4BMBA 2VNVA 2OYZA 2X5IA 5LW9A 2W1SA 2DVBA 2WNVC 4PI2A 5FMOL 3WSOA 4AVBA 1FPN2 3C7HA 1QY4A 3AP9A 4UBGA 5A6YA 1BK1A 2NLRA 3VDDB 1VR3A 5LATA 2RE9A 5IT6A 4OUEA 3UJOA 3ZXEA 4MGSA 2DVGA 1KQRA 4G3YC 4HPKA 4HZFA 2BWAA 3J4UH 3POYA 5F5IA 4W50A 2VTFA 2VMHA 1O3RA 1MS4A 3W9AA 4A45A 4CEWA 3ZFGB 1ENSA 4Q4V1 1LU1A 3AM2A 5FZBA 4GKXA 1YI7A 4JHTA 2UWBA 3H1YA 4UI9L 5KBFA 2PQQA 4LBLA 4XXPA 5A80A 3U37A 3LSEA 4GJZA 3V0BA 2RM21 1NLQA 4KU8A 1I6XA 3JD71 2IFRA 3VBHA 2WS92 3MUY1 2Y34A 1PM4A 3MI8A 1I5PA 4NRPA 1RUH2 3OCPA 5FYMA 4EN0A 2JICA 1HRV1 1F31A 3M8LA 1DFQA 2CL2A 2N7GA 4L11A 4MGIE 4ZPIA 1W9WA 3DCQA 3TEYA 3ZYBA 4BK5A 3DUIA 5KC5A 3BOPA 3WOGA 3D0JA 2DVAA 3VDDC 1WCUA 1YO8A 3WINE 2WIIB 2W47A 2C5DA 3KF3A 4TYSA 4XF3A 4Y1XA 5CKQA 1V6KA 2Q8EA 4G4FA 1W0PA 1GUIA 4PT6A 2I07B 1W6QA 4CSWA 5A1AA 4XTMA 4AQTA 1KJRA 1KS5A 3GJBA 4XE9A 1W03A 1N1SA 1LHOA 4F7ZA 3SLIA 5D2AA 1UL9A 5BNOA 1XNTA 5FZLA 2X8KA 5FY7A 1PGL2 3GJAA 3LEIA 1OSGA 4IE4A 5K7PA 5IATA 2BJSA 4W8JA 4XAEA 1V6MA 3MFCA 3QOPA 2JE8A 1AR71 5LRSA 3R4UA 4IV3B 3NAPC 4QHZA 5J37A 1IQDC 3RFRA 1U5ZA 4N53C 4ISRA 1JYIA 4K40A 3MYXA 4I30A 4HT1T 3MIHA 2K2SA 1JHJA 2RHPA 2HJIA 2R1DA 2Y64A 4Z2AA 5JMOA 1Q8VA 2W92A 1OPOA 4KBZA 5FKBA 2Y33A 2BNOA 1HRI3 2A70A 2PXJA 2VL4A 4HPKB 4QQLA 4DXTA 2D6MA 2D6PA 4DXSA 2WABA 2R6QA 4P5YA 1UPSA 4W6XA 4XDOA 5FYIA 2G9FA 2VC9A 2QVSB 4KH9A 3M4FA 4RHV3 4DQAA 4JTOA 4AI1A 4LBMA 3B3QE 1V6JA 1QJZA 1J1TA 3K51A 4N7UA 5GLTA 1NY72 5AC93 4IW3A 4Q26A 4Y26A 1OBNA 3WDUA 1UZZA 5GM0A 5LEJA 2A6XA 5IVVA 3D6EA 3WNNA 1H2MA 1A8DA 2ET1A 1LOCA 1RUD3 4E4HA 1ODMA 3WEZA 1JW6A 2R073 4WM8A 4QPYA 4AFBA 2RMU2 5C70A 1V70A 5F8PA 5FJKA 1AHSA 3ZN5A 1H4HA 4CPBD 1AR82 3BKZA 4KU7A 5DZEA 3JQWA 3P5BA 5ACA3 1SLBA 4CP2A 3P1IA 1FT9A 2E7AA 4ARYA 1PO13 2G9ZA 2PHUA 2VCBA 3NVCA 4Q0PA 4QPGC 5FYUA 1I9RA 4CXYA 3NV3A 1DU3D 1VMFA 2RG4A 4XBQA 5M0TA 3AYAA 2VNOA 3WG1A 1YIFA 1NYWA 1GSLA 1UY4A 4E4SA 1HV0A 4IEVA 4NMIA 1RUH3 1XSRA 1PVC3 2EIGA 2YGLA 4TTGA 2XUMA 3CLPA 4PF1A 2P17A 4Y20B 4M4RA 3RYPA 1CD3G 1LOBA 1CAUB 2MHFA 1NLRA 4LLFA 4RQPB 1VAVA 4AK3A 2IVIB 4BQXA 4XUPA 3ZXJA 5FUPA 4Y3OA 2YFUA 3Q8AA 5LBEA 4PDWB 4MX3A 4V1PA 2TUNA 3EHKA 5LZ6A 3T0DA 5A3OA 1AR63 4QMAA 4WM7A 4J1XA 1CAXB 3OPTA 4NPRA 2LROA 2XLFA 2VMFA 1QJX1 2E9QA 3KVBA 5LCWL 1I5ZA 4XCBA 4XBLA 3SCFA 4QWNA 4YARA 1VBD3 3K4DA 1JYCA 4Z2WA 5EZWA 3VBHB 2L9LA 4N9IA 2VZ1A 3ZXGA 1AF9A 4QB1A 1NA1B 4IV3C 2W9XA 1PVC1 2D6LX 1EAH1 1X36A 1VE0A 2ZGOA 3FC0A 1O3SA 4DY3A 2NZ9A 4GB33 3IN9A 2MNGA 1GZTA 3D5OA 3I3QA 2CV6A 2QKDA 4C1XA 2ZGLA 3O1VA 1SPPA 4WVVA 3WQ0A 1DGWA 3PUAA 1ND3B 4EV0A 1SQ4A 4OHZA 4BOWA 5CFDB 1RMU1 3SISA 3PIGA 5EJ1B 3NO8A 2XKPA 3U11A 2V09A 1ZX5A 4H7MA 1W6NA 4L9BA 1NX9A 4OZOA 2WO1A 4XF0A 1URXA 2E51A 3AZVA 1ZRDA 3VBUB 3GZEA 4P9IA 4RFT0 5FUIA 4BQ3A 4XUQA 5FUNA 3X29B 3HIFA 5LB6A 2YFZA 1LCLA 5DUUA 5KHIA 5K9YA 2VXRA 2VTXA 3ZOIA 2DVFA 3AVSA 4FOYA 5FZ6A 3D0SA 1OURA 2A1XA 1A6CA 3CO2A 3PUIA 4MYEA 3SCHA 3KLSA 4C91A 4FPKA 4TLFA 3VBUC 4CCMA 5IK5A 4DY5A 1O8SA 4B3NA 3DF0A 5FBJA 5FPBA 2LALA 3SEEA 3VZKA 4MADA 3UGGA 2ZS6B 4QX3A 4P14A 3WNPA 5I0DA 2ZGUA 5JOZA 2EIEA 4N7IA 4EE2A 3OPWA 2NQYA 5EHDA 2DF7A 2JD4A 2XXZA 4IEWA 4QQHA 5EQUA 4NOTA 4DINB 2VOKA 2WYFA 4FPJA 3ZFGC 3U4XA 5JI9A 2CWSA 4MGYE 3ES1A 3TN91 2E31A 2PA7A 4G9SB 5JXJA 3ENRA 1GYKA 1J84A 2W52A 4UYBA 1XE0A 2W08A 1IPJA 1OFSA 1MS0A 3ZSEA 1V9U2 2HWB2 4AVCA 1SLLA 1IG3A 1YFWA 2JDNA 1UOBA 4BA6A 4CU9A 2F6BA 2OUJA 1PGL1 3Q8EA 1H8TC 4XEZA 2WNVB 3WHUA 4JKMA 4HVQA 2VMEA 2W5FA 1VMHA 1DQ4A 1W39A 1AJOA 5LWBA 1VBB3 3LIHA 5F5QA 2ZAAA 3BODA 3D3AA 4KGGA 2DWRA 4HBNA 1PNGA 3OD4A 4H3WA 4RHV1 2EIBA 4XDPA 1NCRC 3WDTA 3GCXA 4AVAA 1MQTC 2QE3A 4AFMA 2W95A 1FMD3 2BQPA 2IXKA 1DP0A 2XJQA 2ZEWA 4Y5Z0 2E26A 3H3ZA 4DO0A 1D4VB 4Y1YA 2VZQA 2VVEA 4AGVA 4MXWB 2MEV3 2X05A 4QM8A 5FAXA 2OKXA 1PO23 2J1EA 3CMGA 5DDJ3 4AW7A 4A2UA 1RUE3 2WZR1 4NIIA 1BLZA 4XPVA 2JG9A 1F5FA 1HB4A 1YXWA 3BCWA 1IKPA 3K75B 4XFBA 1UYPA 3G6JB 4D3WA 4BHPA 4DOUA 2HWF2 2J1TA 3VBRB 4W6WA 3B9IA 2WWSA 2B45X 2XUEA 5ERLA 2D97A 2W46A 3MGUA 1OFNA 5BNPB 3MIGA 2ZHMA 3GZUC 3OJBA 4FCAA 4AVVA 2VOVA 2ZMLA 1FAYA 4DFSA 2HWD1 1TG7A 2A6VA 3BTXA 1GKBA 1TME2 2WUHA 4K8FA 1UNBA 2BUKA 4CP1A 3H8XA 4DXRA 2O8OA 2NM1A 2ZGQA 5FRAA 4IQPA 5LY2A 1Q5OA 1W6QB 1BEV1 5I0UA 5JSRA 2VOXA 1RUG2 4MHRA 4CDQB 3GGLA 2Q8OA 5IFPA 2GAUA 3BN6A 3D4KA 1SCSA 3MICA 4CP9A 2WQ8A 1ULCA 3AXEA 5JWPA 3AP5A 1H6XA 3PVBB 4SBVA 4LMFA 4COVA 4DRVA 2PTMA 5JMCA 3ATGA 3F95A 5EYXA 3UNPA 3VKFC 3VBFB 3N9LA 3NW4A 3FHAA 4QQ2A 3USUB 1Y9MA 4QGNA 1T6GC 3M3CA 4XZUG 2JD9A 1WLCA 3AKPA 2HKXA 2VMCA 5CKNA 3O1TA 1HQNA 3LCPA 4LHKA 4FSJA 1QQP1 2DCKA 4RR3B 1KFUL 2DUQA 2ZX3A 2AREA 1SHWB 3CJIC 5A6XA 4V2WA 2PHWA 2WBKA 5FY4A 3SXWA 1OF4A 3FN9A 2VNRA 2HWC1 3KT4A 4Q0UA 4D94A 3IAPA 1YIPA 1RUG3 2WQ4A 3ON7A 2EAKA 4DUWA 5D21A 3W20A 1SBEA 2FDKA 1AL21 1FOD3 4WM8C 2P6HA 1K5JA 2HLEA 3R0RA 4EWEA 5FPUA 3WT3A 2WNUA 1B09A 4ZU4A 1H2NA 4S2DA 4BH9A 1QOSA 2C24A 2X09A 4QX7A 3BGAA 4HN0A 3VBOA 3IB3A 2CSGA 3EJKA 4GD4A 5FZ1A 1D4M1 2ZGTA 5EJZB 3WDWA 4LE4A 4GWNA 1YRZA 4CU6A 1PIV2 2VZVA 1CAVB 3FZ3A 5CYYA 4Q8KA 1S0FA 1WMFA 3IDAA 1H6YA 3I3EA 3MLJA 1RVF2 4LKEA 4Q4W1 4CEWC 3FLPA 1Z7S2 4LNVA 1YQ5A 2O0OA 1XNBA 2DCTA 1JXNA 2W94A 4XJ9A 1RUF1 1PX4A 3N7KA 1VBA3 1C5HA 1ENQA 1TMF1 3MF6A 1SLCA 1ONAA 2NYYA 1GZCA 1LODA 1RINA 3LEGA 4S2GA 3W59A 3GHMA 1NE6A 4IE0A 5BNNA 2FCUA 4L2NA 2Z79A 4Q4W2 1HLCA 1Z78A 4R4ZA 5JZGB 1KFXL 1S0JA 1UXXX 2XJPA 3WX5A 1JZ3A 2RM22 1ZRCA 2IWGB 4NAMA 4B29A 2KA3A 2W39A 2FQPA 1GNYA 1AZDA 4FPGA 4BM8A 1DG6A 1JYVA 2WO2A 1RUJ1 2WNEA 5A7OA 3U78A 2XB6C 3WG4A 4BWOA 3M3OA 2OW4A 1H0BA 1LOGA 1QJU2 1QJEA 1W6MA 2VOTA 2OT7A 3DKQA 3I59A 4ES8A 4EZ4A 1JTZX 4QQPA 3VBFC 1AXZA 2PLV3 2WT0A 2WSUA 4CUAA 1CGPA 4CA9A 5C71A 4NHYA 4OVEA 3UV9A 1WLTA 1YEWA 5A3MA 3ORJA 1XNDA 1BK0A 2JENA 2H0BA 1VBA2 3T4VA 2J1UA 1QDOA 1F35A 4PJYA 3T0BA 2WLQA 1ZREA 2RS52 4Y5SA 4FFHA 3SCGA 4JZRA 1FV3A 2VZ3A 3OEAA 5DZFA 1DZRA 2H6CA 1SBFA 2OIIA 5FDBA 5DAWA 4YRDA 4AEDB 5FZ4A 5JDBA 2FZ2A 1TQ5A 3VUOA 5K4LA 2XMLA 2E53A 1EYBA 4X8PA 2XVLA 1XE8A 4DXZA 3CQOA 1H9WA 4NAOA 2DTWA 5DAXA 2VW1A 3DYPA 3U07A 5FO8B 4RN5A 5ABJB 1FOD2 4LK7A 1QJU3 4PIYA 5FPXA 2R49A 1LJ7A 1QOTA 4CP9B 1O6UA 2YMZA 1DYOA 4FFFA 1YFUA 5E16A 2R7EB 3OBRA 4AHWA 4JTNA 3WQBA 4IV1B 4R8HA 4LKDA 1S55A 3I3DA 3NJVA 4YW6A 3VHRA 1O3TA 1CX1A 2Y0IA 4QKFA 3N9NA 3CZUA 1F2NA 1RUD1 2DU1A 3DN7A 1JODA 5F3GA 2RDRA 3RMYA 3WXPA 3HN3A 2JDYA 3OB8A 1QJY2 3VBSB 3B9CA 2VZPA 1Z7S3 1KRIA 3THCA 3M1HA 2GMMA 5JIUA 1QKQA 2KD7A 2VBBA 2A75A 3ZXLA 5DUWA 3NSTA 3ZN4A 3M3IA 2XJRA 4YM2A 1UU4A 4W65A 3BU7A 3IAQA 1HB2A 5ABJA 4FI9A 2HWD2 3VBRA 4YG3A 3WV6A 1HJGA 1ZZBA 1PIV3 3ILRA 5ACA2 5SV5A 4OHYA 3IBMA 1REDA 5ACA1 3AKQA 4F83A 3FBYA 2XBO3 4JDNA 5FMBA 1H8TB 4IE6A 4BCUA 3LA2A 5C3OA 1AX2A 3FJSA 2Z42A 3HR9A 3LFMA 5C9AC 2VQTA 2W1UA 3IDCB 3VHOA 4UFLA 3LE0A 4CVUA 2CGNA 1A3KA 2RS32 4IEQA 4JKLA 1OHFA 4OUSA 1VBE2 4WBBA 1UCXA 2BGOA 3L2YA 4P02B 5APAA 4AYUA 1BJQA 4E9KA 1NY71 4YVWB 1OD5A 5LY1A 3KGZA 5FCCA 4AI0A 1RHI3 5DZGA 1R081 5A33B 3O1SA 2VGDA 1XYOA 5AC92 3NL1A 4K20A 2J1VA 1ZBE3 2B9UA 4A44A 4L92A 3ALQA 3LOIA 3PHMA 5C8CC 1ZBA1 4LKSA 5BYNA 1O3QA 3WF3A 2BERA 2D3PA 2VCCA 1J3RA 2IUWA 1YQ6A 1HN1A 2J7MA 1QIQA 1P8JA 1S2EA 3NJYA 2VCMA 4M0NA 3OY8A 1WKYA 1ULEA 3VBRC 3I2OA 2AYHA 2CWMA 5FZCA 4AEKA 1OOPA 5A7NA 1UYYA 3KQ4B 4XACA 5JLVA 2JWPA 2TEPA 3VL9A 1TVGA 4R9CA 4Y22B 4LBKA 4XUTA 1AJKA 1VAMA 2YG0A 5BNNB 2BGCA 5A7PA 1QQP2 2XOMA 3KQRA 1RUD2 4TN7A 2OZJA 5A3WA 2YDEA 1QXJA 4N43A 1IPKA 2AGSA 2BBAA 4E4DX 2JE9A 2G9GA 4AEMA 3RZLA 3C7FA 3MUZ1 2ORXA 5FWEA 3MW4A 1ASJ2 3H0OA 4UWDA 4WVZA 2CAUA 4ISQA 1YC61 3JBG3 1L7LA 3RGBA 3FLRA 4LJHA 5HPOA 4CXXA 1C8M1 2ZACA 1FX5A 1M06G 5FZDA 2Y60A 5K0UC 4QGMA 1DGRN 1LAJA 2BEOA 3AP6A 2KR2A 4CCCA 1IS3A 1REFA 2VVFA 4I0WB 1ULPA 4RS5B 3OGVA 4OMCA 5L73A 4EZHA 3UESA 5IVEA 3I8TA 3GNEA 2B7YA 1ZM1A 2FBEA 2WKKA 1W8FA 5J7MA 1TNRA 4UFKA 2ZX2A 1HKDA 1S0BA 2ZEZA 2WWJA 2ZTNA 2W2IA 2PHFA 5T50A 3CNAA 4WM8B 1DGWX 1G9CA 2ENRA 3C3VA 3TN93 3HN1A 5FV3A 1D4M3 2WAAA 1S2KA 3HQRA 5GALA 1XRUA 2XQRA 4NIGA 2C0ZA 4D0QA 1HV1A 3E1F1 3A7QA 4URTA 1JI6A 2BU9A 4FAHA 2PAEA 2QZ2A 4XC9A 1BBT3 3F2ZA 3VD4A 3LQCA 2VTXJ 2WINB 1YJKA 3UYJA 5C3PA 1W8ZA 3EMRA 2HWB3 3IMMA 3HBKA 1WA4A 4Q4X2 4GWMA 5T5PA 4QPIA 1NCQA 2Y0OA 4FTEA 1JMUB 3O1UA 1V6OA 3ZXKA 4RGKA 3BIWE 2GN3A 1V9U1 3MW3A 4ATFA 3DXTA 2BP6A 3V56A 1OH4A 2B9VA 5BUVA 5FYCA 2A73B 4Q4Y2 3BUCA 1W6PA 3ELNA 5C33A 5HXMA 1OVPA 3LIGA 5FY9A 3ZVXA 2MEV1 3J8F2 4AEJA 3N9OA 3BI3A 2VQAA 1YJLA 4OUMA 4XW3A 3WNXA 4CU7A 5FZEA 3UETA 3WLUA 2V4VA 3J26N 1PNFA 3GDBA 1ND2C 3AL5A 1AL22 1OPMA 4QHBA 5AFBA 4Q0QA 4NUBA 1YWKA 2R042 3WDVA 1C5IA 2HEWF 2ZKNA 2XR4A 1LHNA 4IETA 5FPZA 3SQOA 5I91A 2D98A 4TLGA 4CXWA 1STMA 3CU7A 1WWYA 3FUQA 3VB9A 2YV8A 2ZMKA 3ZR5A 3E5XA 3WNMA 3LDKA 3BTZA 4LBQA 1OMIA 1Q8OA 4U36A 4CUBA 4EYUA 3WNOA 1W6OB 5GZEA 3TAYA 1O7FA 1SLIA 1J58A 4LOSA 1L3JA 1SFNA 4AG4A 4COWA 4LEJA 2PELA 2AACA 4ATEA 2QQLA 1UPIA 3W58A 3NKTA 1JHNA 4RQPC 1AXKA 3LSDA 1VJ2A 3WG3A 1GZ9A 2ZGNA 1GQHA 2VO5A 3ETQA 4QPGA 5AVPA 3RZJA 1N3PA 1GP6A 2ZHLA 1LGCA 2ZJCA 1UMIA 2UY8A 2YC2A 1CR7A 5EXOA 4CPBA 1QJFA 3BOWA 1DHKB 4QM9A 5JR7B 2WZR3 2NP0A 1AYN2 1WLDA 2TBVA 1DIWA 1TME1 1WCSA 4BLJA 4AFCA 3S57A 4XETA 4JDMA 2ES3A 1QGLA 2CDOA 3EO6A 4AHYA 3TEZA 3O0XA 4B1LA 3OD0A 1NCQB 3VZMA 4E8CA 3J7HA 5H9SA 3I3MA 3MPPG 1DGLA 1DZTA 2JG8C 2X5IB 4NRQA 2HWC3 1W8NA 3T4HB 3FE5A 1AR61 2ILMA 5FY5A 4EJRA 1WW7A 3HVDA 1ZZ8A 4BDVB 3JBG1 1V6LA 4LORA 4CCOA 3QH7A 1QJX3 3DGTA 4NN0A 1QEXA 1GZWB 1QNYA 2QFEA 4FFIA 1C8M3 1FYUA 2ZABA 4K8RB 1BHGA 1C57A 4NR1A 4E27A 3AKRA 3MLLA 1X82A 3S7IA 2WNUC 5A7WA 1VLNA 1GOFA 4I0BA 1W2NA 2RJ2A 2ET7A 1F4AA 2CTVA 4PHZA 1PZ8A 2XONA 4GB31 3ZFGA 2HWC2 1UAIA 3MF9A 5FZIA 1NKGA 3ZDSA 5A1LA 1U5XA 2PAKA 1CAWB 3WW1A 4Q4W3 1NXMA 4FT8A 3N36A 5GLZA 1AYN3 3UKVA 4R4XA 3ZSKA 1WLWA 4IUGA 3UT0A 2HEVF 1EV11 3OGGA 5F5AA 1QF3A 1EAH2 4HKLA 1BVP1 1EV12 2EF6A 1LOEA 3SC7X 4C0HA 5BNQA 4XJZA 4L8QA 3DPRA 1F9KA 3IDBB 4Q0SA 2BBVA 3GBWA 4N53B 1T2XA 4JGYB 4DEQA 4XFAA 5F3CA 5HV4A 3QD6A 3KCCA 1ENRA 4K1ZA 1ZZ9A 4XZPA 5A3PA 3ES4A 3T3YA 2PLV2 3OGRA 3THDA 3K2OA 3ZMOA 2I2SA 3A22A 5JI7A 4UBHA 1UU5A 4WV8A 1QJX2 4S2HA 1ULOA 2RM23 5DUXA 1H30A 3RI8A 4AVSA 4AAPA 1PHMA 1GMMA 3H50A 5FO7B 2RS11 5BPXA 3VD3A 2VR4A 4XMAA 4BJ0A 1RTVA 5A7QA 3HT1A 3GZAA 1PO22 4ZONA 1SDDB 2HWE3 1ND3C 1QOOA 2G4IA 4XQ4A 1O59A 1QMJA 1FPN1 2FZ1A 3EB7A 3N4MA 1RUE1 1HW5A 1IHMA 4ORFA 4ES9A 1W0OA 3ZFFC 5IK8A 3PVNA 5LBFA 2LUWA 3JUUA 4H7LA 4XABA 3I2KA 1UO9A 1SACA 3DKWA 4W4ZA 3KHCA 4GH4C 4MOAA 1CJPA 3HAGA 3VBHC 3T1LA 3OYWA 1Q8PA 4V2VA 2XVGA 1E5IA 5FMDA 4EWAA 2GNTA 1N3OA 3AZZA 4O65A 1R082 5ANNA 4YSFA 1PK6A 1XE7A 3GCWA 1W9YA 2GNBA 5JR2A 3KCXA 2IXCA 3ILNA 1K5MB 4XUNA 2VZUA 1DF0A 3AX4A 4UFJA 4PF5A 3PJYA 4XOGA 3AKSA 5DG2A 4HK9A 3J7NA 5D8AB 2ARXA 4DUVA 5BXXA 4QDSA 2BFUL 1CAXA 2HYXA 1I1EA 3RZKA 3AK0A 3VKMA 1AR92 3K3OA 2D44A 4MG2A 1W9SA 2BVBA 3S7EA 4CDUB 5C8CB 4Q29A 3CIHA 1POQA 1JYTA 3PJQA 4MVTA 1ACCA 4ONUA 3LGRA 3B00A 5JOYA 1O4TA 2YUEA 5I0TA 2D6OX 4RHV2 3URFA 2VQUA 3OUJA 2HEYF 4QPGB 5DDJ1 4LK6A 4MH0E 5G04L 4BZ4A 5J96B 4L99A 3HNBM 3T0AA 5C6CA 2WS93 1DZQA 3HNMA 2C1FA 3WQ7A 4FOVA 3E6CC 1CONA 3R05A 1COV2 1CESA 5FYVA 1VBE3 1AX0A 1HN0A 4PI0A 2W1QA 2JDPA 2K9ZA 5FZ8A 3INAA 2VUJA 2PHRA 2VXJA 3IKWA 1F4HA 5FP8A 1PMHX 1X50A 3ZSMA 3V64A 1S0GA 4AI3A 5F7UA 1Q8SA 2FHRA 4HFSA 4QAWA 3WHTA 1FOD1 2R0FA 2GNMA 4UXAA 3ROUA 2WA3A 4GWIA 2E7QA 4XURA 3ZXDA 1UY3A 2WJSA 2VOWA 4Q27A 1OT5A 1GWKA 5FZOB 1U5YA 2GMEA 3KT1A 1RHI1 5AVAA 3LAGA 2R062 5IW0A 3A0NA 5CIRA 4JHZA 4WVWA 2X10A 2YPJA 3ZIWA 3AMMA 1RUH1 2UYAA 3U75A 1LENA 3ZX7A 2EALA 4QGLA 4OCTA 2NMOA 5BNOB 1VBE1 4UFMA 1BMV2 1VBA1 3RWNA 2E7TA 2RMU1 3A23A 1QQP3 3N7LA 4DS0A 1U5IA 1UY2A 4KG0A 4LBQB 1LEDA 1WGPA 4NPLA 4UW6A 5F6LB 2Q8DA 4K9SA 4LKFA 3VBOC 5C9AA 2FDFA 2AR6A 4Q4X1 4RS5C 2PFWA 1KEXA 5EIYB 3H9AA 4QKDA 1NT0A 1CVNA 2OPKA 1TNFA 2W0XA 3JD73 3U0ZA 3POJA 4YFWA 3WP3A 2YPDA 1SCRA 1R64A 2QCSB 1NOVA 2GN7A 4AEDC 2P3JA 4AQ6A 1WMXA 3KCYA 3I59B 4MZUA 2B46X 1POV3 2D5FA 4D8MA 2ZX1A 1YLLA 1ALYA 1OF3A 3HMYA 3THTA 3VGIA 2SLIA 3PVOA 5LBBA 4AEDA 1VB2A 3H8RA 1SLAA 4M01A 2QQVA 4HOOA 4CDXC 2P34A 2WO3A 3POEA 4UFIA 1W6OA 2C9AA 3LA3A 4YVSC 3MIDA 5J36A 3ZYIB 5L7OA 5CU1A 4AQ2A 1PM7A 4Q8LA 2EVXA 2JDHA 2XL7A 3LEMA 1R1A1 3O0WA 1N3QA 1NLSA 2UWCA 2KXLA 4M3CE 3MPBA 1JU4A 1TMF3 5F3IA 5FZ3A 1DQ5A 1SLTA 4KMQA 2Q0AA 1BBT2 4C1WA 5KHJA 1F8VA 3PLQA 3R6SA 1JZ7A 1VAKA 3GYDA 3ST7A 3ZXFA 2DFBA 4FPOB 4QPWA 3HQUA 1WCKA 5BV6A 1S0DA 5KHGA 5B4XA 1ZBE2 2ID4A 4RGGA 2PLV1 1UZWA 5FO9B 3FFQA 5HCFA 1BBT1 1H9PA 4KG8A 1W6PB 1DLCA 4XUOA 5IFTA 1D0GA 4HKOA 3ZN6B 2W91A 4N43B 3ZYGA 4FOQA 2J1RA 3HOBA 3VL8A 4KGQA 2V5DA 2BW8A 1FATA 1DYPA 1HQWA 1QJY3 2VZRA 2RVAA 1KITA 3NNMA 4QU1A 4SLIA 3RVHA 4Q4V2 3E5UA 4ZS3A 3WP5A 4C90A 3VDBA 2AC1A 5A3LA 3M70A 4XCAA 1ST8A 5JVVA 3QCWA 2RS31 4IEPA 1OKOA 3FHQA 4LA3A 3BTYA 3WDYA 1KGYA 1SFPA 4LXLA 3T2TA 2TNFA 1UZ0A 2IFWA 2IXJA 4YW2A 3VBOB 2WLPA 1HB3A 3LKJA 2YBSA 2RV9A 3W21A 3M3EA 1G86A 2XDVA 1AL0G 4LO6B 1L7RA 1WBFA 4YGCA 4DNYA 2UU8A 2YROA 1KD7A 2P6CA 2ZGPA 3BPZA 5DAVA 3LF7A 4FPLA 1S0CA 1HIXA 3JBG2 3K46A 2DTYA 2GP5A 5BNNC 1N1TA 2W3JA 4CDWB 3I2IA 3B94A 2P2KA 4LA2A 4NE9A 5FREA 3PU3A 3GXUA 3ZSLA 3NNLA 4YW4A 3I3BA 5C8WA 3A21A 1HJFA 1LHUA 2Z5WA 4PLMA 5L9BA 4CDQC 4QB2A 4RR3A 4Z8BA 4BIFA 4Y1VA 5E88A 2JDUA 2R16A 2XWBB 5DN2A 3K77A 1H8TA 1RUI1 3USUA 4XFIA 1VP6A 4HVRA 4AL9A 3DECA 4AVTA 4BB3A 1GBGA 1H1IA 1JZ2A 4ARXA 1W8WA 3JB8A 3TNQA 3CKHA 1D4M2 1MS5A 1MZ5A 2ZZQA 2VMDA 3S6PA 3K48A 2OUHA 2EXKA 4IEUA 5DDJ2 3N9PA 3H1MA 1O91A 5A33A 5FLHA 3UJQA 1EUTA 2QTWB 1JN2P 5C9AB 1S4CA 1UIJA 4E2SA 4E2QA 5CADA 2VUAA 2BV4A 1VIWB 2GP3A 3B69A 1JZ5A 2JEMA 1SZBA 4Q2FA 2XQXA 3KT7A 3ACIA 1K3IA 2R041 4P9XA 1E5RA 4XF9A 3PTYA 1JH5A 4GH4B 4RA0A 4LE3A 3T2QA 1GV9A 2VPVA 1NZCA 2R071 4PLOA 5A32B 5A3TA 1FI2A 1OOPC 1Q43A 5FZ0A 1IS6A 3WF2A 3ZFFB 5FXXA 1TME3 5FQ0B 2ZZJA 1ZBE1 5J1XA 2PHDA 1WD4A 1HXS1 4AF9A 1O4YA 3D8CA 1VRH3 5D8AC 2J42A 2DFCA 3Q8FA 5LA1A 1B35A 2WFF2 2DCJA 1UIKA 2LS6A 2Q30A 2WO7A 4UF0A 4CDUC 2RR13 2JIGA 3ACLA 1E5SA 4LUKA 2CY6A 4LBOA 2Y38A 2VUCA 2X53S 3KV5A 3NKGA 4GKYA 5FPVA 5KR7A 1XNAA 5SV8A 2J1SA 4BXFA 2HBTA 3AJZA 1G9AA 1W99A 3VD5A 2QQNA 4I02A 5FZMA 5GZCA 3O14A 1PVXA 5DQ0A 2EAAA 4B4PA 2RDSA 4B4QA 1LEMA 3PIJA 4QXCA 1L7QA 2V73A 5ABJC 2WZPP 2A6ZA 1MPXA 1QXPA 4UF0B 4CP0A 5A6ZA 3CF6E 1PGW2 5L7OC 1GNZA 1RUI2 1LRHA 3PUQA 1PGW1 5JOWA 5KXEA 2VBPA 5FYYA 1JOJA 3MHZA 1N1YA 3CBNA 4FPEA 4KI5M 5A1FA 2AH2A 2NMNA 4INDA 3OOXA 5GLWA 2D7FA 4Y24A 1ZZ7A 2E33A 1IS4A 4IESA 1RUC1 5IAVA 4A7YA 2VD7A 4WZFA 1JYNA 3PDQA 4XJUA 1UWWA 2QJVA 3VBUA 4W6YA 3ACGA 5CBLA 4OI2A 3APBA 1W2OA 1ASJ1 3E6DA 1Y7BA 3NWKA 4YVSB 1UOJA 3GHNA 4LO4B 1RUF3 2JB8A 3WUCA 4BMEA 5JUVA 1H4GA 5DAQA 2OX0A 1A78A 2PHTA 5FOJB 1LB2A 4NIDA 3AZYA 2GU9A 2JKXA 2DURA 3I54A 4M3CA 1DQ0A 2JKBA 2OQ6A 1C8M2 2GMPA 1JZ6A 5J09A 4L97A 1UOGA 2YU2A 1FPN3 2ZPXA 5GLUA 5JPNB 1B35B 1CIWA 1ZRFA 3OG2A 3EXUA 1RMU3 3RQ0A 1D0HA 4RSUA 1CAVA 4HN1A 5L19A 1COV1 1TZOA 1XYNA 4HVOA 4NRMA 1W6MB 3I49A 4FTSA 1RUOA 5DMYA 2PMWB 1AR73 3PUSA 2XG3A 1EPZA 2ZA9A 3WW3A 4P5HA 4IGQA 3MEPA 1XJAA 1R1A3 1LU2A 1Y9GA 1GQGA 1R092 1XU2A 2HWF3 3TEXA 5T5JA 1MZFA 2P3YA 3LA7A 1JOBA 1UX6A 4FQZA 4P9GA 4I3GA 3VD7A 1BXHA 1FMD2 5C3QA 1Q8QA 4PDWA 3NJZA 5DXDA 3T08A 4HONA 4LITA 1U12A 4UFHA 4META 2Q1ZB 1GLHA 1GWLA 1WW6A 1D2SA 3LDBA 2Y26A 2WT2A 4PDWC 1CAUA 2EXJA 4RQPA 3B01A 5CFCC 1LESA 1RVF3 2XJUA 5BNPC 3ZKYA 4NIAA 5EWSA 1PGSA 4OQ9A 4CUCA 3H3LA 4IGPA 4YYOA 5GZFA 4LLOA 3RI9A 4XF1A 5CNAA 3WQ1A 3CL1A 4XJ8A 5C4WB 4J25A 4GIQA 1V00A 3TB0A 2DVDA 2VUDA 4BQWA 5A6QA 2HWE1 2DBNA 4D6RA 2WC2A 2DUPA 4BK4A 5A3NA 3VN4A 5C4WC 5T5LA 1BYHA 2CU5A 3BALA 4IXLA 3RZGA 3DEMA 1HRI2 1XU1A 3HT2A 4QX5A 1DQ6A 4XFHA 1OXCA 4CE8A 2WZEA 4CRQA 1CZVA 4JAAA 1S0IA 1W3XA 1WUVA 3OUHA 4H55A 1PZ9A 5FYSA 3USSA 2Y6KA 5ANQA 1NXD1 2EA7A 3DL3A 1DLLA 1VBC1 3OBZA 3WNKA 1VMJA 4LHSA 1T6BX 4QKBA 2GH2A 1EY2A 4ZKTB 3VD9A 2XHNA 2ZAHA 5FXVA 1YFYA 4LUMA 1GU3A 3JU9A 4CYDA 5JOXA 4TXWA 2WL1A 1PIV1 2QQIA 3TNPB 3RJ2X 1W3VA 4X8NA 1YQCA 3LB9A 4OZXA 3UKNA 2XBO1 4N8MA 1MZ6A 1UX7A 2IC1A 3FHIB 4MV2A 4QHOA 4JQTA 4H2AA 1OUSA 1RMU2 3G7DA 5KXCA 2GNDA 4DPNA 3PUHA 4RD7A 4TSVA 4ZS2A 3ZLIA 4DRRA 1C3HA 2XL9A 1ZVFA 1BQPA 2I74A 5KWRA 3W5NA 4HKWA 1PX3A 3GALA 1EV13 4JGZA 1WA6X 3ZN6A 1CZTA 1K5MC 3AFKA 1GP5A 2HBUA 3AXDA 4COYA 2J22A 2QQWA 3KM5A 3Q8BA 1QH7A 4URAA 1AUYA 1CPNA 1W2AX 2R1BA 4KBBA 3L2HA 4QU2A 1LOFA 4PQQA 2D5HA 3RS6A 2DV9A 2A3WA 2W1WA 4QX1A 3AL6A 4Y5TA 3NAPB 4AXOA 2UURA 3R4DB 4NHXA 5EYYA 4AHXA 2OA2A 2CAVA 4GMP3 1RB8G 1KJLA 3I2JA 1UMZA 4LO5B 3AJYA 1XOYA 2WAOA 5EFUA 2WNVA 3L9JT 2QQMA 4LR4A 2ZGSA 4E4ZA 2JG9B 1HDKA 3QLQA 2Q8CA 1APNA 4A3ZA 4YM3A 5BY5A 4ZXKA 2Z69A 3WW4A 3IDEA 1ZZCA 1AR62 2VY0A 4JKKA 4YZ4A 5CFDC 4MXWA 5K0UB 1W04A 1ULDA 1WMEA 2YZ4A 1ND2B 2IXHA 1CIYA 2OPWA 4COUA 5CFCB 1GP4A 2Q5TA 5KXDA 2BTVC 2VAUA 4XHBA 5CVRA 1US3A 4QD2A 4H14A 2R32A 2GDFA 3U10A 5A3UA 1AYN1 1J3PA 4BPZA 3FLTA 3IT8A 4Z82A 1W28A 4O9GA 2W68A 4YPJA 2Q4SA 1Q3EA 2ZEYA 4OFGA 3V0BB 2VZSA 3M2MA 4LHLA 4PBOA 3SH3A 3DYMA 2C4XA 2UYBA 2A71A 1AL23 2JX9A 3MLKA 4QB6A 5FQ0A 5G05L 4K1YA 1C28A 3KGLA 1IS5A 2E63A 2HWF1 1V0AA 4K7JA 4KL1A 3UGFA 2A3YA 4RGAA 2JG8A 3KV9A 5CB7A 4AE2A 2P5BA 1SFYA 4MUVA 5CEHA 4BE3A 2WDBA 3KMHA 3AMNA 4MSVA 5FP4A 4GAZA 3TRSB 4FXGB 1N1VA 3I7DA 4JC1A 5I8SA 3UK9A 4FP3A 1DDLA 5E8AA 4XIKA 1YCIA 3AB0A 3EQEA 5FOBB 3I4IA 1LECA 3A4UA 1H1AA 2BWCA 3WR0A 5FZKA 2B8MA 2VNGA 1S1AA 1BVVA 3GBGA 3IPVB 3VHPA 2X5IC 2DDUA 1G9BA 4EN9B 3TEWA 2ZHNA 1IGOA 1V6NA 3FBMA 1XYPA 5CG9A 5IVFA 2LRPA 1PO12 3PMSA 3OF1A 2FCVA 4YM0A 2F4LA 1OA4A 5FZ9A 1FMD1 2ZGKA 1PK6C 3DPRB 1SEFA 1NQJA 1W8HA 2FMDA 2RS12 1HRV3 3H1WA 3H7JA 4LO8A 4Q1PA 4QXBA 5FIXA 4A7ZA 1GNHA 3DXUA 4XVHA 2JJ6A 2WT1A 5FY1A 4EN6B 5T3NA 4JGZC 2ZHKA 3GZTB 2B4KA 2RJLA 5DABA 3U4SA 3T30A 1ODNA 5F5CA 4P9LA 3C7GA 5FK8A 3DV8A 5JSOA 3P6BA 3B02A 3POWA 1MS8A 1S0EA 4GB32 3K4ZA 4Z1VA 1MS3A 5I0RA 3VZLA 4A41A 1RXFA 2GSYA 4LQRA 3HD8B 1XPWA 2HWD3 5JIAA 5L9RA 3T2PA 3VKLA 2P37A 3ZM8A 1QJU1 4XF4A 1ENXA 4AQSA 1AR91 4GQ7A 4XJWA 4B1MA 3H7YA 4B8EA 1OA3A 2JIJA 5GKAC 3ZYJB 2WZ8A 2BFUS 1W05A 4NROA 1HRV2 4IEXA 3C7EA 2C26A 1DCSA 1OLMA 4P9JA 1NE4A 4WM7B 5D8AA 1D2QA 1OOPB 5FZ7A 3WUDA 4ET7A 2EIDA 5FYTA 3S30A 5JCTA 3O1MA 4BXSV 2FDHA 2QQOA 3OY8B 5IK7A 3K4AA 3ZFEC 1GFF2 1OA2A 3LZZA 4JVAA 1K42A 1AYM1 2YGMA 4HL0A 2A3XA 3JQXA 1US2A 5A7WB
chains in the Genus database with same CATH topology
4GULA 2IXLA 3PVEA 2RR12 4HK8A 4PIZA 4Q0VA 4N43C 4ZU5A 4Y1UA 1OLRA 4BIOA 4CDXA 1MVQA 1Y9QA 4KWLA 4JGYA 1G8WA 4IL7A 4P9WA 2MPFA 4M3CF 1MVEA 1DGRA 4QT6A 2ATFA 1UF2C 4C0BA 5GLVA 4FAGA 5CFCA 2WZR2 1LGBA 5CG8A 1CAWA 3OPZA 5HCAA 5H9QA 2JXAA 1GR3A 4ZU7A 1AX1A 2XJVA 4WM7C 4IEYA 4YW1A 1G6NA 4YZ3A 1HXS2 4Y1ZA 2DCYA 1VBD1 1J1LA 5FLJA 3ZYRA 4WVMA 5KC6A 3MIBA 3RMXA 3JZVA 1G7YA 2YYOA 1PO11 4E2GA 1UD1A 3AYCA 2FMYA 1MEC3 2BVVA 1GANA 1R083 2CNAA 2D93A 1MACA 3N3HA 4N9HA 4XYXA 1ZZ6A 4Q4Y1 4IV1C 4XFGA 2LM3A 4YGDA 3TN92 4JRAA 3VBSA 4CEYC 1N47A 2GC1A 4Q4V3 2MEV2 3J8F1 3ZPYA 1OLQA 2R0HA 4YG6A 4JGZB 5J98B 1AR81 3WP6A 1IKQA 1EP0A 2XLGA 4AWDA 5JZGC 3WDXA 4MGKE 2Q1MA 1ZBA2 2WFF3 4PCRA 3AYEA 3SMHA 2VQ0A 4CEYB 2XGXA 2KM2A 3LOBA 2A7AA 1C4RA 1OI6A 5GZGA 3RNSA 5LEKA 2GZWA 3E6BA 5GZDA 4J6GA 1EAH3 2PHXA 2PAMA 2UWAA 3J8F3 4RR3C 4Z07A 1FXZA 2ERFA 5KXBA 3QBQA 1ND2A 4GMP0 4LBJA 3POSA 1WMDA 1LOFC 3VKOA 4UW4A 4JV4A 1RGSA 5FFOC 1RUNA 4OULA 3ZO0B 3KD4A 4HETA 1LGNA 1MZEA 4GA9A 4IV3A 1WD3A 3NAPA 1QWRA 1XNKA 3AP7A 3SNMA 5J3UA 2IZWA 2B5HA 1E57A 1RUE2 1CX4A 2ZOEB 1BCXA 3VV1A 2ZKLA 4D69A 2CGPA 3BB6A 1ZYBA 3WD5A 4FOWA 4B7EA 5BNOC 4CEWB 4HMZA 4YGEA 1WCDJ 2JE7A 2V5YA 1IQAA 4D7YA 3HWJA 1O4ZA 4K21A 4D7TA 1AR93 5L36A 4OI0A 3VDDA 2B39A 4HSJA 4OHWA 4RS5A 3RG0A 1SDWA 1H8VA 5HBAA 4LO7A 5I0SA 3VZOA 4XFCA 4XFFA 2JG9C 1J3QA 4LBNA 5C4WA 2PYTA 2BPA2 2F4PA 3AMPA 1S2BA 2BNMA 5AC91 1VBC3 1ULGA 2A5ZA 2X29A 4PQ9A 1RUC2 2ARBA 2D40A 4YFZA 2I45A 5I93A 1AYM3 2VVDA 4I3PA 3FFZA 4N90A 2WS91 2VH9A 3RSJA 5IK4A 4AHZA 2JDZA 3VBSC 2PN5A 3THPA 1MS1A 1NCRB 1RUJ2 1OQ1A 1WW5A 2ZCWA 1UU6A 3RJRA 4YZ2A 1R1A2 4K6BA 1R1ZA 1WBLA 2RJKA 1C8NA 1R093 4XQDA 1XXNA 1HRI1 2HWE2 3GF6A 4IEOA 4FO9A 2ETEA 2XJSA 4ASLA 4QPIC 3WCRA 1TEIA 4PIXA 2VG9A 3OTFA 4AGGA 2NN8A 1VBB2 1Z7S1 2DYCA 5EJ3A 2R063 1YHFA 1OQEA 2QQPA 1MQTB 4I09A 1VRH1 1CN1A 1RUC3 2ZX4A 2P3IA 4GALA 3MIFA 2ZBJA 1RITA 4LBQD 3O0VA 4XQWA 5LRRA 2D43A 4EWDA 1BZWA 3AMQA 1RL3A 3CJIA 3PNAA 3QH6A 2XKOA 5EV7A 1RUF2 1FNZA 1MR5A 2R072 3V65A 1R091 2RMU3 5K8SA 3ZFEA 4YW5A 1KDKA 2O8QA 3D82A 4OI1A 4FPCA 4IV1A 3TYJA 2D3SA 2YC0A 4LULA 1ZNPA 2EXHA 3JB4C 4XILA 1COV3 4XIOA 3EBRA 1O5UA 1BKZA 4X6RB 4LT5A 3IPVA 3B5LB 1LR5A 3AZXA 1GZWA 2O1QA 4TWTA 3PMEA 4O9EA 1RHI2 4M3CB 4HANA 4U2AA 3JD72 3QACA 2VW0A 5JSPA 3OBTA 4YVSA 1LULA 2GALA 4Y22A 4OHVA 1G9DA 4QXKA 1QXRA 1REEA 4CTEA 3KZ4C 4DZGA 2JG8B 2RS51 3NV1A 1YFXA 4IEZA 1RUJ3 2YY1A 3M7AA 1LTEA 5E89A 1BEV2 4JGYC 3VZNA 2WSVA 3IM0A 4NHKA 1X33A 4HSLA 4TZDA 1JUHA 1EPWA 1VBC2 2XBO2 2XVKA 1YUDA 1AYM2 1RJ7A 4OLLA 1YNAA 5A32A 3SHRA 4B7KA 1UW8A 3MDPA 5T52A 3B7MA 3HBZA 4EN8B 1W2UA 1AR83 3MFAA 4JDOA 4AGRA 4M00A 4YLZA 2VW2A 3N35A 2RS53 3SITA 4XTPA 5K0UA 1O5LA 1J59A 3MW2A 3TWIA 1JUIA 2VU9A 2OVUA 1QJY1 4AI8A 3S0MA 1VBB1 5J48A 5IUQA 2RS13 4R9AA 1PVC2 4NWWA 4NVPA 3UL2A 2VECA 5DUVA 2XLAA 5F6KA 3VLBB 1NCQC 3O5SA 4NHLA 3J9SA 3LWCA 4FXKB 1C1FA 1PMIA 1Z0HA 2XPJA 3FWEA 2NPIA 4MXVA 4FTBA 2WNUB 1PO21 4JQRA 5F1RA 4YW3A 1TMF2 4S2FA 1CJDA 5JZGA 3IWZA 3CEWA 4BLIA 2QZ3A 4D7SA 2YXSA 4JRLA 3WZ1A 3O12A 2ZX0A 3OGJA 4HLTA 1NA1C 4YG0A 3TOJA 5JPMB 3E5QA 1PZ7A 3R4SA 2HYKA 2Z2SB 4KNCA 3V0AB 4BYYA 4QPIB 1MQTA 4DB5A 1QH6A 3WCSA 4PLNA 4PBPA 5I8TA 1VALA 1X8EA 3SH4A 1RUI3 3NV2A 4R52A 4UW3A 4Q1RA 2E6VA 1BEV3 5FLIA 1WW4A 1NQDA 3WW2A 4XHXA 2D3RA 3V0AA 4COZA 2B42B 2R30A 5KHHA 1MS9A 3AFGA 4CDQA 4BQ1A 4XMIA 5HXVA 4CDWA 1HQLA 2R043 2A6WA 1CQ9A 4IERA 3WVJA 3FUOA 3ZXAC 4A7KA 1MEC2 2ZMNA 5T55A 1LKNA 3RYKA 3VBFA 4LTAA 2EXIA 5TSWA 5CA6A 1ULFA 1IZ3A 2A6YA 1VRH2 2AENA 5FMOS 2RR11 1AR72 1HXS3 3BTAA 1ASJ3 2JECA 1UN1A 1XQNA 2H0VA 1MEC1 4NWVA 4XXAA 2QDNA 3AP4A 4ITCA 4GMP1 5FBZA 3RZZA 2QUOA 4Q4Y3 2GC2A 1RIRA 4XJAA 4FPFA 4FBFA 3AMHA 2XH6A 4YGBA 1H2LA 4Q4X3 2XJTA 4UW5A 4FPHA 2DU0A 4Z92B 3WG2A 4X6QB 2R061 4DMIA 1DQ2A 1TE1B 4CEYA 5HI0A 3RYRA 5GJ6A 5F9TA 2BNNA 2SBAA 1UKRA 5BNPA 1B35C 3KB5A 1VBD2 4RL7A 2WFF1 1F5JA 2IXIA 4YNIA 3P3PA 5CAZA 1AVBA 1DQ1A 1ZBA3 1ZRRA 5T54A 4YZ5A 3VZJA 1V6IA 4LHNA 5I8YA 2RS33 1POV0 5B2GB 1POV1 3Q9OA 4YVWA 3VKNA 5L7OB 3TBDA 2XWJB 3FMGA 3ASIA 1H1MA 1M4WA 1ZA4A 1H2KA 1XNCA 4I0AA 1RC6A 1UKGA 1LHWA 1RUG1 2DUOA 4YVWC 5FTTC 2DCZA 4WZCA 1KDMA 2HWB1 3UKTA 3AZWA 3ZSJA 4NO4A 3MZHA 2VMGA 3RDIA 3H8UA 3KSCA 3T1MA 3AKTA 2K0GA 2ZGMA 3FX3A 4EN7B 1LOAA 5LK5A 1V9U3 1KS4A 4CDUA 3A0KA 4KQ7A 2GH8A 3GBFA 1JBCA 3WY6A 5JAXA 4I01A 4MLOA 4FQ4A 4AI2A 4OI4A 1G9FA 4XBNA 4YZ1A 4F3JA 5D1IA 3CJIB 4A3XA 1K5MA 5H9PA 3ZMNA 4AFDA 5AFEA 3CJXA 4EROA 1LHVA 4KWJA 4CDXB 1QNWA 2UY9A 2CYFA 4WVMB 4ASMB 1OQDA 1RVF1 3OYWB 2QDRA 4JCKA 1FNYA 2P3KA 3MIEA 1KXGA 1UZYA 4R9BA 5E1RA 3ZFFA 5H9RA 3RPQA 2PHLA 3RRDA 1RJ8A 2D6KA 2ZGRA 2AUYA 1DBNA 4GH4A 1GICA 5C8CA 3WP4A 1X7NA 3H3UA 3ZFEB 1SBDA 2AZ5A 1BMV1 1OKQA 1W6NB 1A8MA 3I2DA 3ECQA 4P9YA 5DG1A 1AXYA 1VB4A 3KS7A 3N7MA 3B93A 5CFDA 4AFAA 4M0HA 1ND3A 4NHMA 1NG0A 5T5OA 3C2UA 3E97A 1NCRA 2LTNA 3IIAA 4KWKA 3N7JA 1QU0A 1HX6A 1QHDA 5HCBA 1Y3TA 2WA4A 1IOAA 4CDWC 4I2OA 3NV4A 1YI9A 4QQOA 2GC3A 5KHKA 4N53A 4R9DA 1Q56A 4GXLA 3VHNA 4CZSA 3ME2A 5LK7B 1X8MA 3M3QA 3JCIA 4K3UA 4XDQA 1DYKA 2XHKA 1CPMA 4J1WA 2H6BA 4B4RA 3ILFA 1FV2A 4FP2A 3SH5A 3O7OA 1YYNA 2BYVE 4FVVA 3P3NA 1I3HA 4Y4YA 4OHXA 2YHJA 4FPYA 1QDCA 2VMIA 1PK6B 1U0AA 2WQZC 2WFPA 3DPRC 4Y20A 3ZIXA 4F8AA 3AYDA 1NA1A 3HQXA 2GC0A 2VULA 2D6NA 1C1LA 1Y43B 1SMVA 4MGZE 3IMNA 3ZYPA 2CGOA 2QNKA 4YM1A 2OZ6A 4BMBA 2OYZA 2X5IA 2DVBA 2WNVC 5FMOL 4AVBA 1FPN2 1QY4A 3AP9A 4UBGA 1BK1A 2NLRA 3VDDB 1VR3A 5IT6A 2RE9A 3UJOA 3ZXEA 2DVGA 1KQRA 4G3YC 4HPKA 4HZFA 2BWAA 3J4UH 3POYA 2VMHA 1O3RA 1MS4A 3W9AA 4CEWA 3ZFGB 1ENSA 4Q4V1 1LU1A 3AM2A 4GKXA 1YI7A 2UWBA 3H1YA 5KBFA 2PQQA 4LBLA 4XXPA 3V0BA 3LSEA 2RM21 4KU8A 1I6XA 3JD71 2IFRA 3VBHA 2WS92 3MI8A 1RUH2 3OCPA 4EN0A 2JICA 1HRV1 1F31A 3M8LA 1DFQA 2CL2A 2N7GA 4L11A 4MGIE 3DUIA 5KC5A 3BOPA 3WOGA 3D0JA 2DVAA 3VDDC 3WINE 1YO8A 2WIIB 2C5DA 4TYSA 4XF3A 4Y1XA 1V6KA 4G4FA 1W0PA 2I07B 1W6QA 4XTMA 4AQTA 1KJRA 1KS5A 4XE9A 1N1SA 1LHOA 4F7ZA 3SLIA 1UL9A 5BNOA 2X8KA 1PGL2 1OSGA 5K7PA 1V6MA 3MFCA 3QOPA 5LRSA 1AR71 3R4UA 4IV3B 3NAPC 5J37A 1U5ZA 4N53C 4ISRA 1JYIA 4K40A 3MYXA 4I30A 4HT1T 3MIHA 2K2SA 2RHPA 2HJIA 2R1DA 1Q8VA 1OPOA 2BNOA 1HRI3 2A70A 4HPKB 4QQLA 2D6MA 2D6PA 2R6QA 1UPSA 4W6XA 2G9FA 2QVSB 4KH9A 3M4FA 4RHV3 4DQAA 4JTOA 4AI1A 4LBMA 3B3QE 1V6JA 1QJZA 1J1TA 3K51A 4N7UA 5GLTA 1NY72 5AC93 4Q26A 4Y26A 3WDUA 1UZZA 5GM0A 5LEJA 2A6XA 3D6EA 1H2MA 1A8DA 2ET1A 1LOCA 1RUD3 1JW6A 2R073 4WM8A 4QPYA 4AFBA 2RMU2 1V70A 1AHSA 3ZN5A 1H4HA 1AR82 4KU7A 5DZEA 3JQWA 5ACA3 1SLBA 4CP2A 1FT9A 2E7AA 1PO13 2PHUA 4Q0PA 3NVCA 4QPGC 1I9RA 3NV3A 1DU3D 4XBQA 3AYAA 2VNOA 3WG1A 1YIFA 1NYWA 1GSLA 4E4SA 1HV0A 4IEVA 1RUH3 1PVC3 2EIGA 2YGLA 2XUMA 3CLPA 2P17A 4Y20B 3RYPA 1CD3G 1LOBA 1CAUB 2MHFA 1NLRA 4LLFA 4RQPB 1VAVA 4AK3A 3ZXJA 4PDWB 4MX3A 4V1PA 2TUNA 3EHKA 1AR63 4QMAA 4WM7A 4J1XA 1CAXB 4NPRA 2XLFA 1QJX1 2E9QA 1I5ZA 4XBLA 3SCFA 4YARA 1VBD3 1JYCA 4Z2WA 5EZWA 3VBHB 3ZXGA 4N9IA 1AF9A 1NA1B 4IV3C 1PVC1 2D6LX 1EAH1 1X36A 2ZGOA 3FC0A 1O3SA 4DY3A 2NZ9A 4GB33 3IN9A 2MNGA 3D5OA 2CV6A 2QKDA 4C1XA 2ZGLA 4WVVA 3WQ0A 1DGWA 1ND3B 4EV0A 1SQ4A 4OHZA 4BOWA 5CFDB 1RMU1 3SISA 3NO8A 2XKPA 3U11A 2V09A 1ZX5A 4H7MA 1W6NA 4L9BA 4XF0A 1URXA 2E51A 3AZVA 1ZRDA 3VBUB 4P9IA 4RFT0 3X29B 3HIFA 1LCLA 5DUUA 5KHIA 5K9YA 2VXRA 2DVFA 4FOYA 3D0SA 3CO2A 1A6CA 3SCHA 4MYEA 4C91A 3KLSA 4FPKA 4TLFA 3VBUC 5IK5A 4DY5A 4B3NA 3DF0A 2LALA 3VZKA 2ZS6B 4P14A 2ZGUA 5JOZA 4N7IA 2NQYA 2DF7A 2JD4A 4IEWA 4QQHA 4NOTA 4DINB 2VOKA 4FPJA 3ZFGC 3U4XA 5JI9A 2CWSA 4MGYE 3ES1A 3TN91 2PA7A 4G9SB 3ENRA 1GYKA 2W52A 2W08A 1IPJA 1OFSA 1MS0A 3ZSEA 1V9U2 2HWB2 4AVCA 1SLLA 1YFWA 4BA6A 2F6BA 2OUJA 1PGL1 4XEZA 1H8TC 3WHUA 2WNVB 4HVQA 1DQ4A 1W39A 1AJOA 1VBB3 5F5QA 2ZAAA 3BODA 4KGGA 2DWRA 4HBNA 1PNGA 3OD4A 4H3WA 4RHV1 3WDTA 4AVAA 1NCRC 1MQTC 2QE3A 4AFMA 1FMD3 2BQPA 2IXKA 2XJQA 4Y5Z0 3H3ZA 1D4VB 4Y1YA 2VVEA 4AGVA 4MXWB 2MEV3 4QM8A 5FAXA 1PO23 5DDJ3 4AW7A 4A2UA 1RUE3 2WZR1 4XPVA 2JG9A 1F5FA 1YXWA 3BCWA 4D3WA 1IKPA 4XFBA 3G6JB 4DOUA 4BHPA 2HWF2 3VBRB 4W6WA 3B9IA 2WWSA 2B45X 2D97A 3MGUA 1OFNA 5BNPB 3MIGA 2ZHMA 3GZUC 3OJBA 4FCAA 4AVVA 2VOVA 2ZMLA 1FAYA 4DFSA 2HWD1 2A6VA 1GKBA 1TME2 4K8FA 4CP1A 2BUKA 2O8OA 2NM1A 2ZGQA 5FRAA 4IQPA 1Q5OA 1W6QB 1BEV1 5I0UA 5JSRA 2VOXA 1RUG2 4CDQB 2Q8OA 2GAUA 3D4KA 1SCSA 3MICA 1ULCA 3AXEA 5JWPA 3AP5A 3PVBB 4SBVA 4DRVA 4COVA 2PTMA 5JMCA 3ATGA 5EYXA 3VKFC 3VBFB 3NW4A 4QQ2A 3USUB 4QGNA 1T6GC 3M3CA 1WLCA 3AKPA 2HKXA 4FSJA 1HQNA 3LCPA 4LHKA 1QQP1 2DCKA 4RR3B 1KFUL 2DUQA 2ZX3A 2AREA 3CJIC 2PHWA 3SXWA 2VNRA 2HWC1 3KT4A 4Q0UA 4D94A 1YIPA 1RUG3 2WQ4A 2EAKA 1SBEA 1AL21 1FOD3 4WM8C 4EWEA 3R0RA 3WT3A 2WNUA 1B09A 4ZU4A 1H2NA 4S2DA 4BH9A 1QOSA 4HN0A 3VBOA 3EJKA 1D4M1 2ZGTA 3WDWA 4LE4A 4GWNA 1YRZA 1PIV2 1CAVB 3FZ3A 4Q8KA 1S0FA 1WMFA 3MLJA 1RVF2 4Q4W1 4CEWC 3FLPA 1Z7S2 4LNVA 2O0OA 1XNBA 2DCTA 1JXNA 4XJ9A 1RUF1 3N7KA 1VBA3 1C5HA 1ENQA 1TMF1 3MF6A 1SLCA 1ONAA 2NYYA 1GZCA 1LODA 1RINA 4S2GA 3W59A 3GHMA 1NE6A 5BNNA 4L2NA 2Z79A 4Q4W2 1HLCA 1Z78A 4R4ZA 5JZGB 1KFXL 1S0JA 3WX5A 2XJPA 1ZRCA 2RM22 2IWGB 4B29A 2KA3A 2W39A 2FQPA 1AZDA 4FPGA 4BM8A 1DG6A 1RUJ1 2WNEA 2XB6C 3WG4A 4BWOA 3M3OA 2OW4A 1H0BA 1LOGA 1QJU2 1W6MA 3I59A 4ES8A 1JTZX 4QQPA 3VBFC 1AXZA 2PLV3 2WT0A 2WSUA 1CGPA 4OVEA 3UV9A 1WLTA 1XNDA 2JENA 2H0BA 1VBA2 1QDOA 4PJYA 1ZREA 2WLQA 2RS52 3SCGA 1FV3A 5DZFA 1DZRA 2H6CA 1SBFA 2OIIA 5FDBA 4YRDA 4AEDB 5JDBA 2FZ2A 1TQ5A 3VUOA 2E53A 1EYBA 4X8PA 2XVLA 1XE8A 4DXZA 1H9WA 2DTWA 2VW1A 3U07A 5FO8B 5ABJB 1FOD2 1QJU3 4PIYA 5FPXA 2R49A 1LJ7A 1QOTA 2YMZA 1YFUA 5E16A 3OBRA 4AHWA 4JTNA 4IV1B 4R8HA 1S55A 3VHRA 1O3TA 2Y0IA 1F2NA 1RUD1 2DU1A 3DN7A 3WXPA 3RMYA 3VBSB 1QJY2 3B9CA 1Z7S3 1KRIA 3M1HA 2GMMA 5JIUA 1QKQA 2A75A 3ZXLA 5DUWA 3NSTA 3ZN4A 3M3IA 2XJRA 4YM2A 1UU4A 4W65A 3BU7A 5ABJA 2HWD2 3VBRA 4YG3A 3WV6A 1ZZBA 1PIV3 3ILRA 5ACA2 5SV5A 4OHYA 3IBMA 1REDA 5ACA1 3AKQA 4F83A 3FBYA 2XBO3 4JDNA 1H8TB 4BCUA 3LA2A 1AX2A 3FJSA 2Z42A 3HR9A 5C9AC 3IDCB 3VHOA 2CGNA 1A3KA 2RS32 4IEQA 4OUSA 1OHFA 4WBBA 1VBE2 4CDUC 1UCXA 3L2YA 4AYUA 1BJQA 4E9KA 1NY71 4YVWB 1OD5A 3KGZA 5FCCA 4AI0A 1RHI3 5DZGA 1R081 5A33B 2VGDA 1XYOA 5AC92 3NL1A 4K20A 1ZBE3 2B9UA 4L92A 3ALQA 3LOIA 3PHMA 5C8CC 1ZBA1 5BYNA 1O3QA 2D3PA 1J3RA 4M0NA 3OY8A 1ULEA 3VBRC 2AYHA 2CWMA 4AEKA 1OOPA 5JLVA 2TEPA 3VL9A 4R9CA 4Y22B 4LBKA 1AJKA 1VAMA 5BNNB 2BGCA 1QQP2 3KQRA 1RUD2 2OZJA 2YDEA 1QXJA 4N43A 1IPKA 2AGSA 4E4DX 2JE9A 2G9GA 4AEMA 3MW4A 1ASJ2 3H0OA 4WVZA 2CAUA 4ISQA 3JBG3 3FLRA