1PO11

Poliovirus (type 1, mahoney) in complex with r80633, an inhibitor of viral replication
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
283
structure length
283
Chain Sequence
AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced conformational changes in poliovirus-antiviral drug complexes.
pubmed doi rcsb
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
total genus 48
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1po1100
1MQTB 4CDXB 2MEV1 2ZAHA 1BMV2 1QJX3 4RR3C 1BBT3 1VBC2 1RUC1 2R062 2RS32 1VBE1 4RR3B 3DPRA 1RVF3 3ZFEC 4GMP0 3TN91 4Y4YA 1AYM1 5ABJA 1QJU2 3JB8A 4CEYB 1PGL1 1AR82 1H8TB 2WLPA 4Q4V1 4WM7B 2WS91 4JGYA 1PGL2 1VBB1 1AR63 1VBA2 1HRI3 1VBC1 2RS11 1BEV3 1RUD1 1RUF3 3VBRA 4PDWC 2FZ1A 2XBO2 1VBE2 4RFT0 5GKAC 4RS5C 1OPOA 5D8AA 4CDQC 2R073 5BNOB 2WZR3 1OOPB 2RM21 1RHI3 4N53B 1PGW2 1VBC3 1VBD3 3VBSC 1OOPC 4RQPA 5L7OB 1ND3C 4CDWB 4GH4C 1AR72 3VBSB 2WZR1 1NCQA 4SBVA 5ACA2 1NA1A 4CDUA 4WM7C 2BUKA 2RS13 2WFF2 3ZFGB 3CJIC 4QPIC 1RVF1 5D8AB 3HAGA 1AR92 2WS93 4CDXC 4YVWB 1QJX1 1VBD2 4IV3A 4YVWC 4N53C 5JZGB 2WZR2 2R072 1ASJ2 1RUH3 5C9AC 5A32A 1VBE3 4CEYA 1RUC3 2QQPA 5DDJ3 1WCDJ 1RUE2 2ZTNA 1V9U1 1HRV2 3J8F3 1RUI1 1CD3G 1AR83 5LK7B 5C4WB 1HRV1 1B35C 4Q4X3 1VRH3 2HWD3 1VB4A 5CFCA 2WS92 1M06G 4RHV2 1GFF2 5AC93 1C8M3 1B35A 2HWF3 4GH4A 1AL0G 1VBD1 4YVSB 2FZ2A 4JGYB 1RHI1 2RM23 1C8NA 1TME3 1NCRC 4WM8A 2IZWA 5K0UA 5D8AC 4CDQA 1RUG1 4RS5A 1BEV1 1RUF1 2HWC2 3VBUB 5C9AA 3VBFB 1FPN3 1HRI1 1VRH2 3DPRB 4N43C 4Q4X2 1VBB3 3VBHB 1F8VA 1QQP1 3VBFC 1HRI2 5CFDA 2WWSA 4Q4V3 1RUJ1 4Y5Z0 4CDXA 1QJY1 1MQTA 2RS51 5CFDC 4FTEA 1AYM3 1ZBE2 3TN93 1VAKA 4QPIA 1TMF1 4NWVA 1BBT1 1K5MA 1PIV3 2X5IB 3ZXAC 1QQP2 4GH4B 3VBOB 1COV3 1ND3A 3ZFEB 1QJX2 4FTSA 1A6CA 1R1A1 2RR13 1K5MC 1POV1 4QPIB 3LOBA 4N43A 4PDWA 4GB31 4CEWB 4Q4Y1 1AYN1 5J96B 1IHMA 1AR73 4JGYC 1R081 1FMD2 1ZBE1 4Q4W2 4FSJA 1R093 3VBFA 1QJY2 5FOJB 1BMV1 2XBO1 2HWE3 5A33A 4IV1C 1CJDA 1ZBA1 2RMU2 3ZFEA 5L7OC 3JBG1 4QPGC 4WM8B 5DDJ2 2WFF1 4CEYC 3S6PA 5J98B 1RUI2 3CJIB 4IV3B 2BFUL 5CFCC 5C4WC 1MQTC 4Q4V2 5FMOS 4AEDB 1AL22 3IDEA 1PO21 4Q4W3 3ZFGA 5ACA1 2HWC3 1EAH1 2R043 1RMU1 1AR93 1PO13 5FMOL 1ND2A 3JB4C 5C9AB 2BFUS 4RHV1 1PGW1 5C8CA 4WM8C 1NCRA 3JD72 5L7OA 1D4M3 2HWF2 1PVC2 4IV1A 3FBMA 1E57A 1AL21 4N53A 1QJZA 4IV3C 4EJRA 5AC92 1R1A2 4RHV3 1PIV2 4JGZB 3VBRC 1PO11 1EAH3 4WM7A 4YVWA 1R082 3TN92 1MEC3 1PO23 3M8LA 4Q4W1 2HWB1 1FOD3 1RMU2 5C4WA 1NCQB 1RUD2 3VDDB 3VBSA 2BPA2 2PLV3 1EV13 1QJU3 1VBB2 4GMP1 4CDUC 1NA1C 1RVF2 1ASJ3 4QPGA 2RMU3 4GMP3 2RS33 4RQPB 3JBG3 1Z7S1 3ZFFB 1QJU1 3JD71 1ZBA3 3NAPA 4RQPC 1OOPA 3VBRB 1PVC1 1NOVA 5JZGA 1FOD1 2RS31 1V9U2 1MEC1 1ASJ1 1AR71 2BBVA 2R061 1EV11 1TMF2 1HXS1 1C8M2 1FMD1 5BNNC 1POV3 2DF7A 2HWB3 2RS52 4CDUB 1NA1B 5ABJB 2HWD2 1NCRB 1COV2 1SMVA 1RUJ2 1AL23 1H8TC 4JGZC 1COV1 1VBA1 4CDWA 2TBVA 1RUE3 4BCUA 2XPJA 1BEV2 1RUF2 2GSYA 1RUE1 1VBA3 1AYM2 1AR62 1HX6A 1RMU3 2R041 1MEC2 2HWE2 1POV0 5BNOC 1QJY3 1R092 1RUJ3 1EAH2 2X5IA 1FMD3 3NAPB 5BNNA 4Q4Y2 4IV1B 1HXS3 3ZFFA 1AR91 2R063 1FPN1 2HWC1 1VB2A 5C8CB 5A33B 4QPGB 3VBHC 5BNPB 1TME2 2RS12 2WFF3 5K0UC 4RR3A 5BNPC 1PVC3 3VDDA 5CFDB 3JD73 1NG0A 1Z7S3 2HWF1 1DDLA 1ZBA2 2RMU1 4PDWB 3VBUA 1RHI2 4LLFA 4CDQB 1C8M1 1HXS2 4Q4Y3 2PLV1 4CDWC 2HWE1 2XBO3 4JGZA 3VBOC 4FTBA 1R091 2GH8A 1AYN2 1ZBE3 4Q4X1 1NCQC 1HRV3 1HQNA 4NWWA 1RB8G 1RUI3 3J8F1 4YVSC 1AYN3 1OHFA 4Z92B 4CEWC 1RUG2 1PIV1 1FPN2 1AUYA 1ND2B 4CEWA 5JZGC 1R1A3 4N43B 1F2NA 2RM22 3NAPC 2HWB2 2RS53 1D4M1 5BNPA 4AEDA 5C8CC 1TMF3 3VBOA 5K0UB 3CJIA 5ACA3 2RR12 1PO12 4YVSA 2R042 3ZFGC 4AEDC 4GB32 3VBUC 1NY71 1TME1 1B35B 1QQP3 3JBG2 1NY72 1X33A 1X36A 3J8F2 1RUG3 2R071 1EV12 2ZZQA 1W39A 2PLV2 3VBHA 1RUC2 1RUD3 4RS5B 1RUH2 1FOD2 2VQ0A 1PO22 1AR61 2X5IC 1R083 5BNNB 1AR81 5BNOA 5ABJC 1ND3B 5AC91 1ND2C 4GB33 5A32B 2Y26A 3ZFFC 1K5MB 5DDJ1 3DPRC 1BBT2 2HWD1 1VRH1 2RR11 1Z7S2 1RUH1 2MEV2 2MEV3 1H8TA 1V9U3 5CFCB 1D4M2 3VDDC
chains in the Genus database with same CATH superfamily
2GP3A 3KM5A 4E4DX 2MEV1 2XJUA 2P3IA 2WINB 4L2NA 4LJHA 4RR3C 4NPLA 4O65A 2JG9B 2R062 2RS32 2QNKA 2NYYA 1SLBA 1D4VB 5FZ1A 5A7QA 4L8QA 1UZ0A 5J36A 3NWKA 2XUMA 4GAZA 4TLGA 1QJU2 2VR4A 4AAPA 1IS6A 1RINA 2B4KA 4BQXA 3LOIA 4WVZA 2WLPA 1V6OA 2Q0AA 1LGNA 1KFUL 2WNUA 2ZEYA 2DUQA 1GQPA 3AP4A 3GBWA 1W9WA 2FCTA 3RRDA 3MV01 5EWSA 1WLTA 4NPRA 1PGL2 1US3A 1VBA2 2AC1A 1YFXA 2ETEA 4PJYA 3T2TA 4AHYA 1HRI3 1NYWA 2IXIA 3ME2A 1VBC1 1RUD1 1SBEA 1FATA 2G9GA 4PDWC 2FZ1A 3G7DA 2B5HA 2C1FA 3AFKA 4RFT0 5CISA 1D0GA 1NX9A 1SPPB 5EHDA 5B4XA 1O3TA 4JZRA 4CDQC 1G9BA 1IG0A 2WZR3 1W06A 3DL3A 3C7OA 2PHDA 1O6UA 4QDRA 5FWEA 2VECA 1SFPA 2D93A 2O14A 4PLNA 5DUXA 2PXJA 3R0RA 2R0HA 2ZAAA 3GYDA 4GH4C 3DYOA 5DABA 3WQ7A 3WY6A 5A3NA 2VQAA 4K6BA 3TEYA 4QDSA 3U07A 1IS5A 4PQQA 1XU1A 4SBVA 4EV0A 3NNJA 3E1F1 4NR1A 3F2ZA 3U37A 3R4UA 4A45A 3QH7A 5J37A 4D6SA 2WLQA 3GHNA 1D2QA 2BJSA 5EJ3A 1LB2A 1YIPA 3POJA 4C0HA 1UYPA 1R64A 5FKBA 3H1YA 3AKRA 4KQ7A 3USSA 2E7TA 3MIHA 4YVWB 2J1EA 3NNMA 1MVQA 3B69A 5A3OA 2VTXJ 3BI3A 3JCIA 1XYPA 3ZYHA 4BZ4A 3IWZA 4IV3A 5FY1A 1YUDA 1QIQA 3WT3A 1XNDA 3OBZA 2WZR2 2PAKA 1C5IA 5B2GB 1QGLA 4AFMA 2VUDA 1TNFA 2W1UA 3K46A 4CEYA 1W9TA 1VP6A 4YGDA 3RMYA 2QQPA 1WBFA 3S30A 1JYXA 2VVDA 1WCDJ 2Y6JA 4QX0A 4V2WA 3OGSA 3PJYA 4NIIA 4NHKA 1RUE2 3MW3A 2ZTNA 1V9U1 4YG0A 1RUI1 3LIHA 5EFUA 1CAVA 5FZBA 2BYVE 3OUJA 4JHZA 5LA9A 4LO6B 5LK7B 1FNZA 2NMNA 3N7LA 4UFLA 4Y5SA 4DOUA 1B35C 4Q4X3 3K4AA 3SCGA 2HWD3 2XJRA 5DG1A 3ZYIB 1VB4A 5F5AA 3ZYGA 2WABA 4A6OA 3S0MA 3KB5A 2UWAA 3CKHA 2RE9A 3LKJA 2OPKA 1WZXA 2V5YA 5J7MA 1LHVA 5FZOA 5ISLA 1XRUA 3VN4A 5JWPA 1C57A 2YBSA 3HOBA 3KGLA 3CJXA 2NN8A 4MO3M 4JRLA 4RGAA 3RYKA 4LK7A 4EN7B 1GNHA 3F95A 2RDQA 4XF4A 4B3NA 4NJ4A 4HK8A 5EQUA 1PMIA 1RHI1 1H2LA 2RM23 2PHLA 4FPCA 1C8NA 1LTEA 1TME3 1WW7A 4KGGA 4DEQA 5A3TA 4XF0A 1CWPA 2TUNA 1YFUA 4N7IA 2J1RA 1DZRA 5JXHA 3AZWA 3HBZA 2BV4A 2VCBA 4X6RB 5FBJA 3VBUB 4HN1A 1HN1A 1W6NB 4LHKA 1FPN3 3ZSEA 3VBHB 4FPKA 4XVHA 3NNGA 3VBFC 2B7YA 3S5AA 5A6QA 1JBCA 3PVBB 4H7LA 1X7NA 5AFBA 4Q29A 4Q4V3 4Y5Z0 2UYAA 3A4UA 1OLQA 1MQTA 3AP5A 3HQXA 2RS51 4P08A 3NJVA 1AX2A 4D7YA 4LITA 3KD4A 4YW6A 3E5UA 2JWPA 3TN93 1XYNA 1GOFA 2YYOA 2MPFA 3I3BA 3A0NA 1U5XA 2DCZA 4QB6A 1J83A 1GWMA 5GM0A 3PMEA 3POWA 1BBT1 2WA3A 1JYNA 3VHRA 5FYZA 1PIV3 2X5IB 4GKYA 2EXIA 3ZXAC 3R4DB 2JB4A 4Q0QA 2ZHNA 2ZKNA 2XL9A 1G9FA 4Y26A 4HBNA 3THTA 4HK9A 1KS4A 3WG4A 1M4WA 4LA3A 3WHUA 1UYXA 2C6SA 5G05L 4L92A 2NQYA 4UBGA 4Z2WA 5JPMB 4MXWA 1X8EA 2B45X 2XL7A 1UU6A 4B1LA 2XR4A 1EP0A 4AYUA 2EAKA 3LOBA 4BWOA 4L97A 1RXGA 1Q56A 2R49A 1D2SA 2Y6HA 3P1IA 4UW4A 4NIAA 2B9UA 4Q4Y1 5KHKA 1WUVA 1IHMA 3KF3A 1OVSA 5I8SA 4HSJA 3ZSJA 2NLRA 3VKMA 5JMCA 2BVVA 2J1AA 2VCMA 1ZBE1 4K1YA 2XVLA 1V6LA 4NROA 4PCRA 5FZDA 3AK0A 5ANNA 1PK6C 1W6NA 1HB2A 2BBAA 3AZVA 3WW3A 5FREA 5HI0A 1BMV1 2XBO1 3PJQA 1GBGA 5A33A 5EV7A 4EN0A 1CJDA 1ZBA1 2JG8C 5CU1A 1YFWA 3O0WA 5JOZA 1CPNA 2FDHA 4WM8B 1UXZA 1UPSA 2WFF1 2YC2A 1ZZBA 3S6PA 2UYBA 4FP2A 4CXYA 1DGWA 2Z2SB 1RUI2 2BGOA 3LEGA 2VZUA 1V6JA 1YEWA 5CFCC 1TNRA 2Y0IA 5C8WA 3Q8CA 4IW3A 4IDZA 2VY0A 1MQTC 1ZM1A 2HBUA 4H3WA 3WDUA 3WNMA 2PMWB 5FJHA 5JI9A 2JDZA 1JH5A 1D7PM 1OC1A 1PO21 1E5IA 1CAXB 1XE0A 3K51A 3MV11 4HVQA 3V0AB 2WIIB 4O7XA 3CZJA 3ZSKA 1EAH1 4I02A 4HONA 1IQDC 1AR93 1BVP1 3AMHA 4LE4A 5A3UA 5FMOL 3GHMA 1ND2A 1OA2A 1VJ2A 3JB4C 5C9AB 4RHV1 3WF3A 3RI8A 1W8FA 2ZX1A 2DVDA 3WQ0A 1GWLA 4NHXA 1FI2A 1O8PA 2HWF2 4OMCA 1APNA 3GBFA 1MPXA 5E88A 1QH7A 1IPSA 5FZCA 3VKLA 3ES1A 4NHLA 4FTSA 2ET1A 1CESA 2FMDA 4AOCA 5LRSA 4BMEA 2IVIB 1PIV2 1VAVA 3OGJA 2VUCA 2JJ6A 4JGZB 1SLCA 1JZ7A 2WZPP 3ELNA 1UIKA 3H1MA 2W91A 3AL5A 4JV4A 4Q2FA 3RMXA 4NHYA 5J1XA 3RZKA 5FMBA 4OLLA 1R082 4YVWA 3IDBB 2Q1MA 3TEWA 3LA3A 1MEC3 3MEPA 2VL4A 3M8LA 3UGGA 1FOD3 3PNAA 1W8HA 3EO6A 3PVEA 1HDKA 1NCQB 1RUD2 4LQRA 4DQAA 3JXSA 2J1TA 1OUXA 5FZHA 1JYVA 2PLV3 4QT6A 3IKWA 5JR7B 2FDKA 1XJAA 2CY6A 3FFQA 1KFXL 3JQXA 2QQVA 3POBA 1ASJ3 3AKPA 4BJ0A 4FAHA 4LO7A 4R4ZA 1S0CA 5EJ1B 3E6CC 4KWLA 1S2BA 3H9AA 3JBG3 5C5TA 3M3CA 2WUHA 3AYAA 3JD71 4N90A 5FZLA 5FZ3A 1QEXA 4LOSA 1HB4A 2W87A 1FOD1 1CQ9A 2RS31 4L11A 4CCJA 2PFWA 1MEC1 1OI6A 2ZJCA 1STMA 1UY0A 1XYOA 2ZZJA 3ZPOA 2EXJA 4BXFA 1JUHA 1F15A 4M4PA 1TMF2 3POGA 2HJIA 4XHBA 1JU3A 4DY3A 3A7QA 1UZZA 4IL7A 4OUSA 1O4ZA 1VPHA 4XFIA 1POV3 1UY3A 2OZ6A 4JDNA 2DF7A 4XUOA 2ATFA 4CDUB 1I1EA 2HWD2 1SMVA 1RUJ2 2DVAA 5FY0A 1KXGA 1XU2A 5FAXA 2C24A 5FLIA 5GLUA 2W39A 2FQPA 1VBA1 5BYNA 4MV2A 4OHXA 5GLZA 4QQOA 1UF2C 5AFEA 2GH2A 4D7SA 2XPJA 1T2XA 2ZMNA 2GSYA 1W99A 3H3UA 4M0NA 3OEAA 1JZ6A 2V4VA 2Z42A 1OA3A 5DZFA 4N9IA 3IDCB 4LBQB 1UKRA 1W2NA 4R4XA 2HWE2 1DQ5A 5IVCA 4PI0A 3PURA 3IAPA 1QJY3 3U4SA 1MZ6A 5HXVA 1ENQA 2A6XA 2WBKA 3FUOA 1SLAA 4Q4Y2 1XQNA 3I3EA 1F5FA 1LCLA 1OA4A 3UGFA 5FOBB 1S0DA 1S1AA 4KH9A 4COVA 4XURA 2HWC1 2IWGB 2WT0A 5C8CB 5IT6A 3VLBB 2C0ZA 4LKDA 2VAUA 4LIVA 4LUKA 3OPZA 2TEPA 4JQRA 5D21A 2WAAA 5K0UC 4RR3A 5GLTA 5E89A 5JIAA 1MS8A 1UKGA 4QHOA 1EY2A 4XILA 2O0OA 2PHXA 4Y4RA 3OG2A 5JVVA 1GKBA 1O7FA 5C5UA 1NG0A 1Z78A 4OHYA 2VUAA 2IFRA 2R1BA 3VBUA 3VKFC 4N9HA 2JB8A 2ZBJA 3MI8A 1YQ2A 5K7PA 1HXS2 1LU1A 1UY2A 1UY1A 4BM8A 5K8SA 1S0GA 2W1SA 3G6JB 1L3JA 2OW4A 1QWRA 3OY8B 2HWE1 1SZBA 4JGZA 4H7MA 1CAWB 4EWEA 1QNWA 4FTBA 4GJYA 2WO3A 1REDA 4P9XA 5A6ZA 1NCQC 1G9CA 3NJXA 3J8F1 3TEZA 2KXLA 4TWTA 4DXRA 4B7KA 4M00A 3QOPA 4HMZA 1K5JA 4ARYA 1VMFA 1SLIA 3LD8A 1AUYA 4HXCA 4E9KA 3OEBA 2WR9A 1ND2B 1BK1A 1DBNA 1XOYA 1ZX5A 4Q0SA 5KBFA 3NV4A 1ZVFA 1PM4A 4FFGA 1KD7A 3NW4A 2RM22 1U0AA 3NAPC 3N9OA 2HWB2 3LE0A 2W3JA 4MXWB 4OZOA 2WO2A 4XEZA 2FBEA 2XG3A 1UN1A 4LKEA 4QU1A 4D3WA 3WF0A 4AEDA 3H50A 5C8CC 1W0PA 2RJ2A 1H2KA 2Q8CA 2XHNA 2QDNA 4CP0A 5IK7A 3IDAA 1HB3A 2AENA 3GDBA 4LHNA 2YXSA 1J3PA 2EXHA 1O3RA 5C6CA 3V0BB 2KR2A 1NUKA 1DP0A 3VD5A 3ZMOA 3VBUC 3AKQA 1WGPA 5EXOA 3WDTA 1JOJA 1NY71 1XNCA 4JKMA 1RXFA 4KU8A 5IFTA 2Q4SA 2QKDA 2WNVB 4FI9A 5B4NA 4INDA 3ZXFA 1QQP3 1JZ8A 2VTFA 2AZ5A 3I2KA 1NY72 3SMHA 1W6QA 5FZOB 1LENA 5BV6A 2ZABA 3KZ4C 5FYYA 2WKKA 2R071 4XAAA 2VG9A 3AXEA 1EV12 4BIFA 5HBAA 1W39A 1UW8A 4AQSA 3ACHA 2VBPA 2DU1A 3Q8EA 5JXJA 3HR9A 1ODNA 5GZDA 1J3QA 2CL2A 2VZVA 4HL0A 2W46A 1WKYA 3RYRA 5C3OA 2Y38A 2X5IC 4LIUA 4XHXA 2D6LX 1UOGA 2OZJA 4K1ZA 4KG0A 4A41A 3NKTA 1V70A 2QQOA 5FPXA 1AZDA 2IXHA 4OQ8A 3JU9A 3KT4A 2QQMA 1VMHA 3C7HA 4W6XA 3RGBA 4J25A 2YROA 2IXCA 3ACIA 4GB33 4CCCA 1JZ3A 2JG8B 2Y26A 1CGPA 3I7DA 2JXAA 3L9JT 5A7OA 5LATA 3ZFFC 1W9FA 3IPVB 5IATA 3MIEA 1LOBA 4A42A 4AGGA 2X05A 2NPIA 1Z7S2 2GN3A 1J58A 1RUH1 1DHKB 1AF9A 2WL1A 4DRVA 3GXUA 1LOGA 4FVVA 3C2UA 1H8TA 5CFCB 4ATEA 4CA9A 3WINE 3VDDC 4KGQA 1JI6A 2J1VA 1GZCA 4CDXB 4D94A 1FT9A 3T09A 2A71A 4ZKTB 1BMV2 1S0JA 1O4YA 2DCKA 4GJZA 4LUMA 4CZSA 1BBT3 3ABZA 5EPAA 1CAVB 5FYTA 1RUC1 4E8DA 3EHKA 4AI9A 4BQ3A 2R0FA 2VXJA 4DUXA 1V0AA 3DPRA 5CVRA 2CDPA 3CO2A 4HKOA 4C91A 3ZFEC 5JDBA 4GMP0 4QXHA 4XBLA 4C90A 1FXZA 1A34A 1AYM1 3ST7A 4ZY9A 1RL3A 3JB8A 2W92A 1S2KA 1ODMA 4L0PA 3T0AA 4AVSA 1PGL1 4Q26A 2PHUA 3PTRB 2GNBA 3MF9A 3NQHA 4Q4V1 5C33A 1LESA 4A7KA 2WS91 1HJFA 3GNEA 3MW2A 4JGYA 4BYYA 4BQ4A 5LEJA 2WZEA 1WW4A 2D5HA 1AR63 3BN6A 4XTMA 4R9CA 4JKKA 4YM3A 3AMPA 3GJBA 1IG3A 3GGLA 3RPQA 3LCPA 2G4IA 1RUF3 4WBBA 4YZ3A 2XBO2 5GKAC 2CDOA 4ISRA 1LEDA 3DECA 4NAMA 1OPOA 1SACA 4YLZA 1URXA 1I9RA 1G6NA 5D2AA 4OYUA 4R52A 4N53B 5A6YA 1YQCA 4NE9A 1VBC3 4YW3A 1W6PB 4YG3A 3INAA 4FPFA 4BXSV 3NO8A 4BHPA 1AX0A 1Q3EA 4GD4A 1KITA 4S2GA 5F2SA 1LHOA 1DF0A 1YC61 2QVSB 3NV2A 2P37A 3M70A 4Y20A 3NKGA 3FHAA 1QXJA 4CDUA 3ZSLA 4AK3A 2RHPA 4M3CF 5I8TA 3E6BA 4LK6A 4F7ZA 3WHTA 1K12A 2D40A 3CJIC 4QPIC 2V5DA 4AI0A 2A75A 2VCAA 5A7NA 3SISA 2RDSA 2D7FA 2YV8A 4GKXA 4COYA 4XOGA 5IK8A 1OQ1A 4XFHA 1QJX1 4AGVA 2BU9A 4DS0A 4G9SB 2PHFA 3MPBA 4ZU7A 5JZGB 1LNSA 4MSVA 1WMFA 2K9ZA 2YFZA 3MBWA 4K9SA 4TXWA 4XXAA 2BP6A 5DUWA 4AVAA 4OHWA 4B4QA 2WYSA 1YI7A 3ZN4A 3QD6A 3ZYRA 3MPPG 1FAYA 3W5NA 1RUC3 1SLLA 2P6CA 1U12A 3KHCA 2OT7A 5I0RA 2WNEA 1JXNA 3I4IA 5LZ6A 4YG6A 2G1MA 4IE7A 4LE3A 2VW1A 3BIWE 2EIDA 2NZ9A 3EJKA 2PTMA 3CU7A 1W3VA 4IEPA 4IEWA 4YZ1A 3J8F3 4FOQA 2IXJA 2K2SA 4COUA 3CBNA 4Y1YA 4JC1A 1HRV1 2GC1A 3VUOA 2F4PA 1GNYA 3V0AA 2P4EA 2XONA 3AZYA 4QHZA 5CFCA 2W1WA 2OA2A 2QQJA 2OQ6A 1R1ZA 1U5IA 2WS92 5KHGA 1M06G 4W8JA 3N7KA 4Y3OA 3THCA 2O1QA 3BIEA 3I2IA 4LBMA 5FIXA 2ZMLA 3WDXA 2B46X 1QY4A 4FCAA 1QOSA 2GALA 3IPVA 4IE6A 2WRAA 1CX1A 2LRPA 3USUB 1NLSA 3ZN5A 3ZYFA 4AL9A 3BGAA 4BQ5A 4FP3A 4GH4A 2QE3A 4PIYA 4Z07A 2ZX3A 4CCEA 1VBD1 3K3OA 4XBQA 4UF0B 1S55A 1G7YA 2Y64A 4QPYA 5E8AA 1ULGA 1F5JA 1S4CA 5FP7A 1NLQA 1OF3A 5J3UA 1XPWA 5K0UA 4CDQA 1ULPA 4AHZA 3UKVA 5JXGA 4FQZA 4RS5A 3U1XA 3D5OA 2HWC2 3ZYBA 3VBFB 2ARAA 4AVCA 1HRI1 4J1XA 2ID4A 1CPMA 2XQRA 3DPRB 4N43C 1OKQA 4K3UA 2WA4A 3OPTA 4BQYA 3PHMA 1QQP1 2YMZA 4FPJA 4FPOB 5F6KA 3AZZA 1UPIA 3EXUA 2WWSA 3UYJA 1RUJ1 3WW4A 2AYHA 1OUSA 2WQ4A 1W6QB 3UKNA 4UWDA 3WP3A 2QZ2A 3M3IA 4Z2AA 1VR3A 2RJKA 3I2DA 4QPIA 2CGPA 1XE7A 1TMF1 2ARXA 3VDAA 5CZKA 2H6CA 4RSUA 2IUWA 4AI3A 4CU7A 3W20A 3HNBM 3ITQA 1CIWA 3B9IA 1EPZA 4NVPA 4IEVA 2WDBA 1ND3A 5LASA 3LDKA 3C8XA 5HCFA 2QTWB 3DGTA 3ES4A 3JZVA 3KV9A 5FZKA 3V65A 4TZDA 4W50A 3M7AA 3PDQA 2RR13 3AFGA 1OXCA 1OQEA 4QPIB 3SC7X 2CAVA 5LRRA 2V72A 1SEFA 3POSA 2UU8A 1WBLA 3GCXA 4FXKB 3RWNA 4FPHA 5FPVA 1DLCA 1OD5A 1AR73 3AYDA 4MGIE 3MO4A 1DZTA 1FMD2 1UMZA 4ZU4A 4TTGA 3MUY1 1GZWA 3VDBA 3AYEA 3IMNA 2E7AA 3VBFA 2WFPA 5FOJB 3CQOA 3JQWA 1W8WA 4YFWA 3SH3A 5C7GA 5LY1A 2D5FA 2ZHKA 5DAPA 2JDYA 1XE8A 2A3YA 5H9PA 4QPGC 3O1MA 2P3YA 3QACA 2E9QA 4WZFA 2AEZA 3ZM8A 2XWBB 5FP8A 5FCCA 2P1BA 2P17A 4I0BA 1UZWA 3SQOA 3T30A 4Q1RA 1ZZCA 2VD7A 3LZZA 4FBFA 2A3WA 5C4WC 1W05A 4IESA 4ISQA 5IVJA 3LSDA 2BQPA 4KBBA 4XPVA 4XUPA 2UWBA 3IDEA 3KHBA 4UAPA 5H9QA 4HVOA 2YGMA 3HMYA 2RJLA 4R9DA 3ZFGA 4QAWA 1W28A 2HWC3 5H9SA 3MIBA 5FJKA 3UESA 5IFPA 1RMU1 3PIJA 1PO13 4NMIA 4Q27A 5FRAA 4JKLA 5GZCA 3HN3A 3AKSA 3SCHA 1PGW1 1H9PA 1YI9A 2VQTA 4Y5TA 1NCRA 5GZFA 5JSOA 5L7OA 2YUEA 1H4HA 1QXRA 2ZEXA 3FBMA 1E57A 3WCSA 1OPMA 2IXKA 4EZHA 3B02A 2GN7A 3OD0A 1OKOA 4IV3C 4XF1A 3N9MA 5IK4A 5JIUA 2J7MA 3E6DA 4WVVA 5AC92 1OQDA 1R1A2 1TQ5A 4CCKA 4QQLA 3USUA 4RHV3 3HPNA 3LIGA 1NQDA 4P9WA 3WG1A 4B8EA 1ULOA 1V6NA 4XUNA 2FDGA 3OBAA 2VOKA 1XSQA 2VU9A 4DEVA 4ONUA 4NIGA 3H3LA 5T5OA 3H8RA 4GALA 3TN92 1RITA 1WW5A 3OF1A 1ZRRA 3BPSA 3ZPYA 4QDQA 4Q4W1 5C3PA 1HQWA 5DZEA 4FPLA 5F5QA 3ILNA 1DQ0A 1RMU2 2EF6A 2OVUA 1C1FA 3VDDB 5CA6A 4GZ9A 2BPA2 2VNVA 1N3OA 2A3XA 1QJU3 1HW5A 2R32A 1GOGA 1N1SA 2P34A 3VKNA 3MW4A 2WZ8A 1JYIA 1CONA 2RS33 3WDYA 5H9RA 1IQAA 2DTYA 4P02B 3BU7A 1QJU1 3ZFFB 5FK8A 1WA6X 1ZBA3 3NAPA 1ZZ7A 4XJAA 1OOPA 1S0EA 3VBRB 4XFGA 1PVC1 4AVTA 1NOVA 4MYEA 5AVPA 4AI1A 1V9U2 3ZSMA 1OFSA 1V6IA 1SDDB 1GR3A 1ASJ1 1QF3A 3E5QA 1E5RA 4K8RB 3B93A 5JSRA 1ZREA 1NZCA 2XXZA 3BUCA 4QGMA 2Q5TA 5FXXA 3SITA 3WNPA 1DGRA 1FMD1 2BERA 2CTVA 4AWDA 4F8AA 5BNNC 1N1VA 2JDAA 3LPGA 2RS52 1UYZA 2VBBA 1NA1B 2AGSA 4XMAA 1O8SA 4Y20B 3VD7A 3O1PA 3H8XA 2RG4A 4DNYA 2QQUA 2Q8OA 1REEA 4XJ8A 1YNAA 4JGZC 3UKTA 1COV1 4K20A 1GSLA 3OOXA 1RUE3 2DU0A 2VCCA 4QKNA 3EYPA 3RSJA 4BCUA 1FNYA 2JE8A 5IVEA 3PTYA 1C5HA 1I5PA 1BEV2 1Q5OA 1Y43B 2VNGA 2ZA9A 2ZHMA 4NAOA 2B8MA 3ILRA 5L9BA 1SBFA 1CAXA 1OLME 2R30A 1SCSA 1RJ7A 3RDIA 1AR62 1HX6A 1N1TA 5FUNA 3RI9A 2DVFA 3ZMNA 4BU2A 2VVEA 4JCKA 4BISA 4GQ7A 4CCLA 2EAAA 1EYBA 1GANA 1QU0A 4QX7A 1R092 4UFIA 1EAH2 2W68A 3ZO0B 5BNNA 2DCJA 2PYTA 1EUTA 2CAUA 3ETPA 4XIOA 4EWAA 4XFBA 3ZKYA 3FUQA 4LBKA 2CSGA 3NJZA 1VB2A 5F3GA 5HCBA 1PHMA 5I0TA 2WWUA 5BNPB 2RVAA 1UX7A 1TME2 4LNVA 1L7RA 3BTZA 4AXOA 1DZQA 2UWCA 3IBMA 5BNPC 1H9WA 4AAXA 4Y1VA 2BVBA 3R05A 4YNIA 1PM7A 1PVC3 1RYYA 3VDDA 2ZEZA 3WP6A 5CFDB 3VGIA 5A3LA 1T6GC 4BQWA 3WXPA 4RN5A 3B5LB 4IEYA 1UZYA 1Z7S3 2IVJA 5J09A 3R6SA 1AXKA 3N7MA 1NKGA 2VZQA 1MS0A 3A23A 3EBRA 3HEIA 4PDWB 2Y8KA 1MZ5A 2C26A 4LLFA 3RJ2X 4QXKA 1W8UA 5F32A 1C8M1 2ZGSA 4XYXA 4AFBA 2GC3A 3ZDVA 4CCNA 3WV6A 1XNKA 4XUQA 2VW0A 4CU9A 2D3PA 2Y6GA 1OT5A 3VBOC 1KDKA 4CCDA 2ZS6B 5LEKA 1R091 5A3WA 3ILFA 1ZBE3 3N7JA 2PELA 3I3DA 3TBDA 4FT8A 5IYYA 3MFAA 3VZOA 5AVAA 5HPOA 2VMEA 1RB8G 1SDWA 5DAXA 5FBZA 3WR0A 1N3QA 1AYN3 1OHFA 1YQ8A 5IVBA 1WMEA 2MHFA 3URFA 3GF6A 1JOPA 2Y6KA 3ZXKA 4Z92B 2JDHA 4CEWC 2ZEWA 1JZ4A 4DXZA 1GP6A 2BWCA 2QFEA 2ZOEB 4OUMA 4M3CE 1IS3A 4CEWA 2B42B 1LJ7A 5FPLA 1R1A3 4OI2A 3LSEA 5CKMA 5FZ4A 1PNFA 1F2NA 2ZGMA 2GP5A 2ZKLA 1SFYA 1LHWA 4QQPA 4Z82A 1ZZ9A 1D4M1 4K40A 2QJVA 3BU0A 3Q8AA 5FUIA 3ASIA 3ZYJB 4A6SA 3N9QA 4EQVA 4FQ4A 1UO9A 1YYNA 5CBLA 4MOAA 2E6VA 4YYOA 4G3YC 4SLIA 3VBOA 5K0UB 5F5IA 3SHRA 3DEMA 1ZA7A 1UU4A 4X6QB 3TRSB 1JN2P 2JD4A 4X8NA 1OLRA 4YVSA 2YBKA 3T2QA 2R042 3ZFGC 2WNVC 4AEDC 3OCPA 4CCOA 4O9EA 1ENRA 2Y6LA 1GWKA 2K46A 1YJLA 2VMDA 5DG2A 4AW7A 4IEQA 2BNNA 5T3NA 2DURA 1Q8QA 4P9LA 1Y4WA 2JDMA 4YGEA 3O1SA 1X36A 2J1UA 2WSVA 3WLUA 2GC0A 3AKTA 1TZOA 2E51A 5A1LA 3ZXDA 1KJRA 2AR6A 3VBHA 3WDWA 4BDVB 4LOTA 2XLAA 5EIYB 2GDFA 2DBNA 4XJUA 4WVMA 1WCSA 3OUHA 4CUGA 4I30A 4RS5B 3LGRA 5GLVA 5ANQA 3ZYPA 4AEJA 2ADEA 3BALA 1ULEA 4JHTA 5FPZA 4C1XA 1J1TA 2VZPA 5JPNB 2DUPA 2WNUC 1W6OB 1GV9A 2JG9C 2QUOA 5FLHA 4CSWA 3FX3A 2AREA 1OFNA 3GALA 1NE4A 3AB0A 5FY8A 2WSUA 4YZ2A 1ND3B 4CUAA 2ZX4A 1ND2C 3CMGA 3WNNA 5A1AA 1H1MA 5DDJ1 2ZGRA 5FXWA 3ACFA 3VD4A 1JTZX 4ES8A 3LB9A 2JKXA 2AACA 2A73B 3OJBA 3PVNA 2JDUA 1W90A 2ZGPA 3OB8A 4YRDA 3U78A 1JZ2A 4MVTA 4B4PA 4AI8A 1QDCA 2MEV2 5LY2A 4AE2A 3EMRA 1KS5A 5CB7A 5FZ0A 5FYUA 1MQTB 4W65A 3HWJA 1YCIA 5EYYA 4MLOA 1QJX3 1WMXA 1PZ7A 2GMMA 1MS4A 2QDRA 2A6WA 5A3PA 5FR3A 1JZ5A 3I49A 5FZMA 3VZJA 4IQPA 1VBE1 3FC0A 3PUAA 3R4SA 1RVF3 4BLIA 4HSLA 2W47A 2X8KA 3B9CA 1D0HA 4Y4YA 3LA2A 4RA0A 2AEYA 5ABJA 4WV8A 5A70A 3KWVA 4MGTA 5FYMA 4ORFA 3S7IA 4PBOA 3I2FA 4XF3A 4B1MA 3POYA 5KXCA 2VMGA 3VHOA 4QM9A 3ZLIA 1VBB1 5DAQA 2QZ3A 4UW3A 1Q8OA 4R9AA 5K9YA 1C28A 5LW9A 2XGXA 3UNPA 2RS11 2R16A 1BEV3 3VBRA 2JE9A 1SLTA 4UFJA 3KMHA 4RS5C 5IVFA 4IEOA 2OPWA 4XMIA 5D8AA 3DKQA 3N9PA 2QQWA 1OOPB 4PT6A 5DN2A 3RFRA 4AFDA 4CPBD 3BB6A 1AXYA 1TG7A 2I45A 1VBD3 4HKLA 1W6MA 1OOPC 4XQDA 4BB3A 5L7OB 4CDWB 2XJTA 5G04L 1WCUA 2VZ1A 1AR72 4HPKA 1L7LA 5M0TA 2WZR1 1NCQA 2E32A 3AYCA 2VNOA 2VZTA 1US2A 4B4RA 5ACA2 3O1OA 2WAOA 1NA1A 5TSWA 4ASMB 4WM7C 5JLVA 2C4XA 3PVOA 2BUKA 2RS13 2P5BA 3ACGA 4YM1A 5A80A 1RC6A 4W4ZA 2BGCA 2OYZA 2OKXA 3ZFGB 3RJRA 3U0ZA 5FYHA 2WT2A 1S0IA 5D8AB 4HN0A 2JIJA 3HAGA 1AR92 3K2OA 4KNCA 4Q1PA 5DXDA 5BXXA 5A1FA 3CL1A 4QU2A 4CDXC 5KHIA 4I01A 4GULA 3MLKA 2GU9A 4D69A 1VBD2 3WF4A 3PU3A 1OSGA 2VM9A 5L9RA 2ARBA 2FDJA 4OCTA 1AJKA 2R072 5FYVA 2GC2A 4MH0E 4I0AA 4CP2A 1RUH3 3OUIA 1PX3A 3H8UA 4UBHA 3WP4A 1VBE3 1GQGA 2VQUA 2LTNA 1W0OA 4Q0UA 2PHRA 1IZ3A 2D6MA 2EIGA 4YW4A 4IE5A 2WQZC 3I2HA 1ULCA 5FXZA 3FL7A 1SBDA 1XB9A 2VNRA 3SLIA 1CD3G 1AR83 3FHQA 1I6XA 2IC1A 5C4WB 2ZXQA 1VRH3 4IUGA 4OFGA 4E2QA 1IS4A 3N9LA 4YWAA 3KCCA 3WDVA 3PLQA 3T0DA 1X9PA 1H2NA 2VULA 3OPWA 3DN7A 3ZXLA 4P9GA 4RHV2 2OQ7A 5C3QA 3UGHA 5AC93 2FMYA 1C8M3 1ZZ8A 4UW5A 2ES3A 3O1RA 3AMQA 2I74A 1B35A 3ZKUA 4C8DA 2B9VA 2GMPA 4Q8KA 2WWJA 2HWF3 3AM2A 4Y22B 3TB0A 4UW6A 1AL0G 3B01A 1IKPA 4XFFA 2FZ2A 2VTXA 4JGYB 2DTWA 3AC0A 2HYKA 2A6ZA 1BZWA 3T3YA 3LDRA 3UT0A 1UD1A 1RGSA 2YPJA 4YPJA 1I3HA 1OH3A 3KCXA 4XC9A 1RUG1 3ROUA 4ASLA 1W8OA 3P3NA 1F31A 4MGZE 1RUF1 2JENA 3LWCA 3WF1A 4GWNA 4DXSA 1CAUA 1KGYA 3B94A 2VOVA 4GIQA 4IE4A 1VRH2 3ZDSA 3HT1A 1KQRA 4YW7A 2FDFA 4X8PA 1HN0A 5KXDA 3IN9A 4Y1UA 3KCYA 5CFDA 3X29B 5A7WB 3J9SA 4CDXA 1LR5A 3KF5A 1KRIA 3KQRA 3CNAA 5JSPA 5CFDC 3D8CA 1DGLA 1AYM3 2LS6A 4FTEA 1ZBE2 3ZR6A 3UETA 1VAKA 1LKNA 5APAA 4MXVA 4QX8A 4QXCA 3A0KA 3NV3A 1GU3A 1LOFA 2CU5A 4E2SA 4QD2A 2YU2A 5FZEA 3LEKA 1K5MA 5EP9A 2JG8A 3WZ1A 1LGCA 1CR7A 3T1MA 3VBOB 1COV3 2I07B 1QJX2 4MG2A 3ZXJA 4EROA 1UU5A 3HN1A 1DFQA 1R1A1 2ARCA 3M1HA 2FD8A 3ON7A 1SHWB 4DMIA 5FO9B 4FPYA 3BODA 1W2UA 3T4HB 1GQHA 1WD3A 2EICA 2OX0A 5DUVA 4OI1A 4DZGA 1X8MA 3FLRA 4N43A 4PDWA 4TLFA 4CP9B 1ZRCA 3AZXA 4LHLA 1LGBA 4GB31 5DUUA 4CEWB 2X09A 1AYN1 1YO8A 5J96B 1VMJA 5JUVA 1W9YA 3M3EA 3T2PA 4BMBA 1ZZ6A 5T5PA 1EPWA 3PL0A 4OQ9A 3I97A 3KGZA 2RV9A 2A70A 2Z69A 3K4DA 1GP4A 2Q1FA 3TNPB 3AX4A 3S57A 1R093 1CAUB 4H55A 3GZTB 2I2SA 2KM2A 2XLFA 4IV1C 4I3PA 3U75A 2VMFA 2IFWA 1XBFA 5F9TA 4PLMA 1WWYA 1BQPA 3J7NA 2W2IA 5F37A 3J4UH 1AVBA 1A8MA 5DDJ2 4CEYC 1CAWA 1IOAA 4PHZA 3H8OA 4XW3A 4V2VA 1Q8VA 3WX5A 3NMBA 4IV3B 4QQHA 2JDNA 3AVRA 3NNFA 3ATGA 4XACA 1Z0HA 3WW2A 4Q4V2 1AL22 2ORXA 5I91A 1RIRA 2LW8A 2HKXA 1MZFA 3NL1A 1UCXA 4LO5B 3OBTA 4HETA 4Q4W3 3N35A 2ILMA 1O59A 5KXEA 3MIGA 2JX9A 5ACA1 4HZFA 1B09A 5HXMA 2R043 2JE7A 1PK6B 1YWKA 2AH2A 2JDPA 5C3RA 1HV1A 3AMMA 1DIWA 2PHTA 3CEWA 4BQ1A 2RDRA 2BFUS 1J1LA 2VVFA 3C7FA 3WNXA 3ZX7A 4AF9A 4CYDA 3SEEA 5C8CA 1C1LA 3LPFA 5IAXA 3JD72 1SQ4A 3P5BA 2DVBA 2B39A 1W6MB 2W08A 5F8PA 4IV1A 4J6GA 2CV6A 2WN3A 4MHRA 1VAMA 1AL21 2W1QA 5FZ8A 4N53A 4YFZA 1HQLA 1OD3A 4RGGA 1JU4A 2TNFA 1LOEA 1POQA 4EJRA 4E8CA 1W8NA 2DDUA 2FHRA 1H0BA 2XWJB 1L7QA 5F39A 4HT1T 4LEJA 1W0NA 4URTA 4XJ9A 2ZGOA 3OY8A 4S2DA 4LO8A 3PMSA 4U2AA 3VBRC 5LBFA 4FOYA 3KLSA 1PO11 4P5HA 3CIHA 4P14A 1HJGA 3WQBA 3IIAA 3ZN6B 3UK9A 1JW6A 1Q43A 2A5ZA 4QHBA 4CVUA 5LBCA 2HWB1 3W59A 3LFMA 3ZXGA 2VC9A 3AVSA 3RZHA 3QCWA 4V1PA 5C4WA 4LMFA 5F3EA 1TVGA 5HV4A 4QQ2A 3VBSA 1C4RA 4EE2A 1REFA 2VJXA 1IPJA 4M3CA 1BKZA 2DYCA 1VBB2 5LBBA 4AEMA 4L99A 5ERLA 1DYPA 3VHNA 4GMP1 3VZLA 2ORZA 4QGNA 4QWNA 3SKVA 4CDUC 3WG2A 2P2KA 3H1WA 4LBOA 4QPGA 3GZAA 1NQJA 1XSRA 2RMU3 2VOXA 4GMP3 2VZSA 1U5YA 5CIRA 3VV1A 5IUQA 3WNKA 4ZU5A 5L19A 4OULA 2R7EB 4NHMA 4RQPC 5E16A 4E4HA 4NRPA 5JCTA 4F83A 4I0WB 5FZ7A 2F6BA 3WVJA 1OLMA 5T52A 1AR71 1Y9GA 4KU7A 4M0HA 2D98A 4XETA 4OVEA 2R061 2VUJA 4HFSA 1EV11 1NT0A 4W6WA 1C8M2 4PF1A 1CZTA 5F3CA 4CXXA 2YC0A 2QQNA 1JYTA 2DFCA 4IGQA 2F17A 3T08A 2D6KA 5KWRA 1DU3D 1SCRA 1LODA 4LBLA 4XDQA 3APBA 4XCBA 1U5ZA 4A44A 4E4SA 1BYHA 5ABJB 1NCRB 4LO4B 1UIJA 1COV2 2JG9A 2UY9A 5IJRA 1G8WA 2VGDA 3SH4A 1AL23 1H8TC 3ETQA 4YM2A 1AHSA 4CDWA 4BE3A 3W5MA 1K42A 2QBXA 5FZ6A 3AP6A 3PIGA 4TN7A 2D97A 3FN9A 1RUF2 1O3QA 3DUIA 3AJYA 3N36A 2ZPXA 1K3IA 3VL9A 4Q8LA 4NPMA 4PF5A 3V56A 2XJQA 1VBA3 2VZRA 3LFIA 4COWA 2R041 1HV0A 2XKOA 1DGWX 1J84A 5FUPA 4A7ZA 1ENXA 4J1WA 5FZAA 3K3NA 1JUIA 5BNOC 3M4FA 1H8VA 3H42B 5FXVA 2YG0A 5FY9A 3FJSA 3HBKA 1RUJ3 4BPZA 2X5IA 2E7QA 1NZIA 3BCWA 1HLCA 2ZX2A 3THDA 3GZEA 5IAVA 4ZS3A 4LR4A 4HG6B 4TSVA 3BYWA 3ZFFA 3MFCA 2R063 3W58A 5DAVA 5DPNA 1O5UA 2VMIA 4AGRA 4D7TA 3VB9A 5GLWA 2WFF3 2DCYA 3BKZA 2N7GA 3OYWB 1SG3A 1LULA 3O14A 3U11A 5LWBA 2CWMA 3MIFA 1MS1A 4JTOA 2PAEA 2W0XA 3JD73 3KT1A 2CWSA 2W52A 4FFIA 5DMYA 2D43A 1PVXA 4ZXKA 1UOFA 4FO9A 5FO7B 3O1TA 1ZBA2 1YQ5A 2RMU1 2XB6C 3DKWA 5SV8A 1VIWB 3WUCA 5C70A 2X29A 1RHI2 4IEXA 3WQ1A 4ATFA 4CDQB 4DUVA 5JOWA 4Q4Y3 3OGRA 3GM8A 1LU2A 2PLV1 1MACA 4GWIA 4LXLA 4K8FA 4B7EA 4XUTA 5DZGA 3TNQA 4P00B 2D6NA 2ZCWA 5FWJA 2GH8A 5HCAA 3KQ4B 3BPZA 2HLEA 4XQWA 1HRV3 3H7YA 2QQKA 4QX2A 1UWWA 4PIZA 3OGGA 3VD9A 1ZRDA 5IVYA 3OGVA 3NV1A 4NWWA 1DLLA 1TE1B 3KVBA 1PMHX 3NVCA 5FO8B 4EYUA 1GZWB 4H14A 1N1YA 4PBPA 2DWRA 1ALYA 2XLGA 1H1AA 2BOIA 3VZMA 1UOBA 2ENRA 1RUG2 1PIV1 4GA9A 5IWFA 4QXBA 3FZ3A 5BNQA 4HANA 4CP1A 4RYDA 2W5FA 5FMDA 2HEWF 5JZGC 4IE0A 1YRZA 4N43B 3TWIA 2UURA 2BW8A 3WNLA 1QXPA 1UX6A 5A7SA 4LBNA 2RS53 1S2EA 4XIKA 3ZOIA 4QX5A 4ZZ5A 5EZWA 2KA3A 1JYCA 4Y33A 4BA6A 5BNPA 2H6BA 3H3ZA 5KC6A 2GZWA 1TMF3 3T2OA 4OZXA 5FY5A 3CJIA 4CUBA 1RTVA 3J7LA 5ACA3 2JEMA 1PO12 1UQXA 4P9IA 4I2OA 1Y3TA 3CZUA 3ALQA 3TEXA 4MGYE 4R8HA 1TME1 3LF7A 1B35B 4AI2A 3C7EA 1HB1A 3JBG2 5A7PA 3D3AA 5IVVA 1AXZA 4META 4OUEA 5L36A 5F7UA 2G9ZA 1UMHA 1F4HA 2XJPA 4RGKA 5IW0A 2ZZQA 3OYWA 5BPXA 5FP4A 1LAJA 3I3QA 3WOGA 4QKBA 1YXWA 4UT5A 5FV3A 3SH5A 2E26A 3MYXA 3QBQA 5FZ9A 1RUH2 4LKFA 1FOD2 2R6QA 1CZSA 3WP5A 1AR61 4K21A 4LULA 2O8QA 5KC5A 4XBNA 3IB3A 4IEUA 3SNMA 3N9NA 2YPDA 2RDNA 1AR81 1GP5A 1Y9QA 2EIEA 3GBGA 4CTEA 5BNOA 5CG9A 4BH9A 1J59A 4XFCA 4QX3A 3DXUA 3E97A 4JRAA 4ZPIA 1W8TA 4DFSA 5GALA 3DPRC 1E5SA 2VZ3A 4UFHA 3I3MA 4AFCA 1Y9MA 1N3PA 4Z8BA 5JAXA 2WNOA 4HKWA 2ZGTA 1W03A 4H2AA 1BCXA 4LTAA 1LOAA 4LBQA 3MLJA 3VKOA 1VALA 3HNYM 5J48A 3W21A 3GJAA 5KHHA 2D44A 1QJFA 2ZAHA 1NXD1 4AZZA 1VBC2 2BGPA 2YFUA 4JAAA 3PUSA 4LORA 1RUOA 3LQCA 1LOFC 4RR3B 3CLPA 4CU8A 2JECA 4JTNA 5GZGA 5EJZB 5IK5A 1G9AA 4PI2A 5FPUA 3I2GA 1IGOA 1H4GA 2CNAA 4S2FA 5LB6A 3TN91 4CUCA 1BHGA 1VE0A 1UXXX 3C7GA 3I59B 3MHZA 4CEYB 2GNTA 1AR82 1H8TB 5I0DA 3PU8A 5JMOA 3J26N 2E33A 4FPEA 4JDOA 2Q30A 2UY8A 4M4RA 1OBNA 4WM7B 4JVAA 2HEVF 1W9SA 5FQ0A 2ADDA 5DAWA 3WCRA 4DIQA 2X53S 4U36A 4MX3A 2Q8DA 1DG6A 5IHRA 1CJPA 1VBE2 4YW1A 3D4KA 2R073 4ZZ8A 5BNOB 2WNUB 4GWJA 2RM21 1RHI3 1PGW2 3KSCA 3VL8A 1FV2A 2OIIA 4A3XA 2EXKA 3VBSC 4AHWA 4RQPA 2C9KA 1ND3C 1NE6A 2GNDA 4M3CB 3ZXEA 5FY7A 2NMOA 3VBSB 1TEIA 5FZFA 4MGQA 3L2HA 3WEZA 3HQRA 1OF4A 1JHNA 2WO7A 2WFF2 2XDVA 2X10A 1RVF1 2OUHA 4KI5M 1H30A 2PA7A 4Q5OA 2WS93 2VOTA 1UAIA 2JDKA 1UL9A 2VOWA 1JS9A 1ZA4A 4DB5A 5LCWL 2DUOA 5KR7A 4YVWC 4N53C 2J42A 3A21A 1LRHA 3H0OA 1OVPA 3MICA 4QMAA 3BTAA 1UOJA 4NRMA 1ASJ2 4Q0PA 3WSOA 5C9AC 2HH9A 5A32A 1GZTA 5FTTC 4EN8B 1W2TA 3PUQA 3ZR5A 3I54A 3O0VA 5FYCA 3RZMA 5DDJ3 5FKCA 2VW2A 3OSDA 2Z4FA 2ZGUA 3J7HA 1BVVA 4CRQA 2HBTA 1HRV2 4NRQA 3CHXA 3K77A 1CN1A 1DQ4A 2WO1A 4I09A 4NUBA 1BJQA 2NP0A 3DV8A 5EYXA 4KWJA 3UL2A 3BVCA 2EALA 3IIIA 4WVWA 5KXBA 1E5HA 4CXWA 3ZN6A 4YSFA 1CZVA 4RL7A 4YM0A 4HLTA 1GFF2 3KVAA 5C71A 4LA2A 1W04A 3LA7A 5FYSA 1W8ZA 1GOHA 2ZGNA 3AXDA 3MUZ1 4GXLA 4YGCA 1ZRFA 5A6XA 5C3SA 1QKQA 2C5DA 2VO5A 3I8TA 3AJZA 3MGUA 4BK5A 4JX0A 4AVVA 1CIYA 4FFHA 3NJYA 4YVSB 4BLJA 1H6YA 3NRUA 5LK5A 3BOPA 4P9JA 1NCRC 4WM8A 2IZWA 2YHJA 5JR2A 1CX4A 5D8AC 1UZVA 1GICA 3NSTA 3FWEA 2Y34A 3KV4A 2LUWA 4MUVA 1BEV1 4Q0VA 4ZONA 5C9AA 1AJOA 2XHKA 4ZHNA 3E5XA 1CVNA 1PZ8A 4UYBA 4PIXA 2CYFA 4Q4X2 1F8VA 1VBB3 2YDEA 3SCFA 3U14A 4OI4A 3AMNA 1PK6A 3A22A 1HRI2 4ET7A 3TYJA 3QH6A 1BXHA 4QPWA 3UV9A 1W2AX 2XVGA 3MDPA 4CPBA 1QJY1 3D6EA 3DF0A 3RZZA 4CP9A 2PHWA 3AP9A 4KMQA 1Q8SA 4YGBA 5T54A 4XZUG 4BIOA 5JOXA 4XDPA 1FYUA 4XCAA 1X82A 4HVRA 5CG8A 5HCHA 3C3VA 2Z79A 2ET7A 4BK4A 4NWVA 2DV9A 1G9DA 1GZ9A 2WN2A 3V0BA 1QHDA 3LDBA 1V00A 4XZPA 1O4TA 2SBAA 2H0VA 1I5ZA 1PMJX 3WF2A 1QQP2 4GH4B 5CNAA 4HOOA 5LBEA 4CCMA 3FMGA 4DO0A 5E6HA 3N3HA 3ZFEB 2P3JA 1A6CA 4ARXA 1PZ9A 4LKSA 2VBDA 1AX1A 1DQ2A 1H6XA 1A8DA 2YGLA 3DXTA 4XF9A 2XOMA 2XUEA 2GMEA 1K5MC 4L9BA 1P8JA 1POV1 2XKPA 3KS7A 3RNSA 4FFFA 4MHUA 5FDBA 5FZGA 1ONAA 4MADA 5FMCA 5FLJA 2VPVA 2IXLA 3PUIA 4OMDA 2FCVA 5GJ6A 3D82A 1SFNA 5A7WA 4D6QA 4PLOA 1O3SA 4EZ4A 1DGRN 4P9YA 2C9AA 4JGYC 2XQXA 1R081 1W2OA 4TYSA 2LM3A 2JD9A 1QOOA 4XAEA 2BNOA 3VZKA 1V6KA 1BLZA 2PN5A 1UNBA 4Q4W2 4FSJA 1QJY2 2VH9A 4DUWA 4Y1XA 2HWE3 1HIXA 4S2HA 2RMU2 4LPLA 4PQ9A 4XTPA 3WG3A 2A6YA 3ZFEA 5L7OC 3JBG1 3AL6A 4DPNA 1YQ6A 2WYFA 2ZX0A 3VHPA 3HT2A 2ZHLA 3MIDA 2VZOA 1GMMA 3Q8BA 3I2OA 3J7MA 2VMHA 2DVGA 1WMDA 3MZHA 5J98B 4AFAA 2FDIA 1A78A 1MS3A 1ULDA 1XNBA 3CJIB 3HNMA 4RFRB 3IMMA 3SXWA 2BFUL 3Q9OA 1V6MA 5K4LA 4OHVA 5FMOS 4AEDB 2YY1A 4FOWA 3CF6E 2D6OX 2A6VA 2BDRA 3TAYA 2YBPA 3HQUA 5HV0A 3KV6A 4KBZA 4KL1A 3H7JA 2ZGKA 3IT8A 3RZJA 2W94A 3B3QE 3EQEA 1O91A 2R1DA 4EN6B 4G4FA 3GZUC 2W95A 1IKQA 2DCTA 4D0QA 5CEHA 4WM8C 1DYOA 1LEMA 1D4M3 2CGOA 4R9BA 5LA0A 3M3QA 2D6PA 4UI9L 1O5LA 1PVC2 1WLDA 2EA7A 1QJZA 4AQTA 4A2UA 2P6HA 3HD8B 1MZEA 4P5YA 2WQ8A 4NIHA 1ACCA 1NXMA 3S7EA 2Y33A 1OURA 3GCWA 1ZRIA 2OXBA 4QKDA 4AHXA 5I8YA 4XXPA 1A3KA 1HKDA 4IEZA 4NN0A 2J1SA 4QB1A 5FQ0B 2MNGA 1C3HA 1EAH3 3RG0A 5LA2A 2WJSA 3DYPA 4WM7A 1ZYBA 5T5LA 4CE8A 1NLRA 1MR5A 5BY5A 4K7JA 1YLLA 5T5JA 3LEMA 1T6BX 1PO23 1X50A 1N47A 1QNYA 2PAMA 5FP3A 5I0UA 2YB7A 3WNOA 1QOTA 5I93A 2NM1A 1WW6A 3POIA 4CU6A 4AG4A 1X9TA 2BWAA 1MS9A 2CGNA 1QH6A 2ZGQA 3EB7A 4KWUA 4AR2A 5JOYA 3BOWA 1KDMA 2QQLA 1EV13 3U10A 2DFBA 4BOWA 4ES9A 4JQTA 5CKNA 5CKQA 4YZ4A 1NA1C 1RVF2 2BEOA 3RYPA 4M01A 4LHSA 3HIFA 4RQPB 2XJSA 1Z7S1 1W6PA 1DCSA 2QQIA 1XXNA 4DY5A 3WD5A 1KJLA 1PX4A 1UY4A 1QMJA 3D0SA 3UJQA 4NIDA 1W3XA 2J22A 4QX1A 5JI7A 4AQ2A 4MZUA 3P3PA 2KD7A 5JZGA 1SPPA 2AUYA 5BUVA 5JXIA 3POEA 1GLHA 3POFA 4LBQD 4D8MA 1ZNPA 4AQ6A 2Q1ZB 5F2WA 2BBVA 5A3MA 4FPGA 4OHZA 4YW5A 1HXS1 3FHIB 3FFZA 4A7YA 3WUDA 3ZIXA 4E4ZA 4I3GA 4A3ZA 2D3SA 1W6OA 1KEXA 2HWB3 5GZEA 4KG8A 5CADA 4XQ4A 3DCQA 1VLNA 3LEIA 1NAEA 5D1IA 1JOBA 3M2MA 4D6RA 5FYBA 4E27A 4E2GA 4HPKB 1UMIA 3KV5A 2P3KA 3O1VA 2XJVA 5FFOC 2TBVA 4W6YA 3S5QA 5F5CA 3W9AA 5L73A 4AEKA 4O61A 4ITCA 3FLTA 2BRTA 4UXAA 1RUE1 2Z5WA 1BK0A 4DXTA 1G86A 1AYM2 2CHHA 3RVHA 1RUNA 1RMU3 5FK7A 1WA4A 2BOJA 5KHJA 5T50A 1OMIA 2WC2A 4QM8A 1MEC2 1POV0 1XNAA 4XFAA 1JHJA 2ZACA 3LAGA 2E53A 5CYYA 5FPBA 3WW1A 3L2YA 4B29A 1ST8A 2XH6A 3CDZB 4BQ2A 1FMD3 5LA1A 3NAPB 3MLLA 4RD7A 4IV1B 2F4LA 1DYKA 1HXS3 2HYXA 1AR91 3O12A 3I59A 5F3IA 1FPN1 1Q8PA 5A33B 5CAZA 4QPGB 5FP9A 3VBHC 3FLPA 3BTYA 2RS12 1LOCA 4EWDA 3DYMA 4QGLA 4AVBA 2Y6FA 3ECQA 4GWMA 5L9VA 3P6BA 4UOJA 3OBRA 3B7MA 3THPA 1H1IA 1LHUA 4WVMB 4UFKA 3NNLA 2V09A 4Y1ZA 2HWF1 2G9FA 1VRBA 1LECA 1DDLA 3N4MA 2BNMA 3IZOA 1YHFA 2BZDA 3O7OA 2WNVA 3AP7A 4LBJA 3SEPA 4IERA 5F6LB 4IGPA 5FY4A 5FYIA 4ASKA 3KT7A 4CDWC 2XBO3 2GAUA 2Q8EA 3PUHA 2GNMA 2ZGLA 1LHNA 1AYN2 2E63A 3RZGA 4Q4X1 3T1LA 1HQNA 3HVDA 4ZXEA 2OUJA 1GYKA 4NOTA 4IGOA 1FV3A 1UYYA 2E31A 2JICA 3OD4A 1RUI3 1XC6A 4YVSC 2JIGA 4Z1VA 5E1RA 3MF6A 2ZMKA 4LLOA 3VZNA 1DQ6A 3ENRA 3OTFA 5FZIA 1WLCA 4YARA 2WT1A 4DRRA 1PGSA 1FPN2 2YU1A 2K0GA 1K45A 2ERFA 2L9LA 3QLQA 1DQ1A 1QJEA 3B00A 1GNZA 4MGSA 3O5SA 3IM0A 4WZCA 3VD3A 5FPAA 4Y24A 4YZ5A 1YJKA 3JUUA 4FOVA 1WD4A 3Q8FA 4FXGB 2XVKA 3D0JA 2FCUA 1ENSA 2W9XA 3IAQA 4XJWA 1RJ8A 3V64A 5I0SA 1FX5A 3VDCA 4XE9A 3RQ0A 4JDMA 2H0BA 1WLWA 5T55A 4C1WA 4F3JA 2V4AA 4YW2A 2BTVC 1YIFA 1MVEA 2LALA 2RR12 4COZA 2DBIA 3ZVXA 1OH4A 2EVXA 4GB32 4XDOA 4Y22A 1J3RA 4N8MA 3FE5A 4FAGA 3O1UA 1WCQA 1JMUB 2YC4A 4IETA 2QCSB 4N7UA 2HEYF 3I2JA 1MS5A 1XNTA 3UJOA 4QB2A 1X33A 2JKBA 2A1XA 3ZIWA 3K4ZA 2XMLA 3J8F2 1F35A 4KWKA 1YFYA 2OS2A 1RUG3 2VMCA 2Y60A 3U4XA 3K48A 3T4VA 2PLV2 3RZLA 3FBYA 3ORJA 2A7AA 1RUC2 4QKFA 1JYWA 4A4AA 3HJRA 1RUD3 3ACLA 4URAA 2LROA 1QDOA 4LT5A 3SKJE 1GUIA 2VQ0A 1PO22 1F9KA 4IXLA 1R083 5BNNB 1F4AA 2SLIA 3BTXA 1S0BA 2VE1A 4UF0A 4DINB 2VXRA 5F1RA 5ABJC 5AC91 3RS6A 1EUUA 1PNGA 2PQQA 3RWKX 5A32B 4EN9B 1ULFA 4ZS2A 4NO4A 4UFMA 3K75B 4XJZA 1K5MB 4C0BA 2G19A 1BBT2 3T0BA 4XABA 2O8OA 1JODA 2YZ4A 2HWD1 1WCKA 1VRH1 2D3RA 4MGKE 2EIBA 4O9GA 2RR11 5SV5A 1S0FA 3M3OA 5DQ0A 1H2MA 2PQSA 1Y7BA 1IPKA 2V73A 4OI0A 3TOJA 2MEV3 1V9U3 2Y0OA 1D4M2 3O0XA
chains in the Genus database with same CATH topology
3KM5A 4E4DX 2MEV1 2XJUA 2P3IA 2WINB 4L2NA 4RR3C 2JG9B 2R062 2RS32 2QNKA 2NYYA 1SLBA 1D4VB 4L8QA 5J36A 3NWKA 2XUMA 1QJU2 1IS6A 1RINA 3LOIA 4WVZA 2WLPA 1V6OA 2Q0AA 1LGNA 1KFUL 2WNUA 3AP4A 2DUQA 4EN7B 3GBWA 3RRDA 1PGL2 5EWSA 1WLTA 4NPRA 1VBA2 2ETEA 1YFXA 4PJYA 4AHYA 3T2TA 1HRI3 1NYWA 2IXIA 3ME2A 1VBC1 1RUD1 1SBEA 1FATA 2G9GA 4PDWC 2FZ1A 3G7DA 2B5HA 2C1FA 3AFKA 4RFT0 1D0GA 1O3TA 4CDQC 1G9BA 2WZR3 3DL3A 2PHDA 2VECA 2D93A 4PLNA 5DUXA 3R0RA 2R0HA 2ZAAA 3GYDA 4GH4C 3WY6A 3WQ7A 2VQAA 4K6BA 3U07A 1IS5A 4SBVA 1XU1A 4EV0A 4NR1A 3R4UA 3QH7A 5J37A 2WLQA 3GHNA 1D2QA 5EJ3A 1LB2A 1YIPA 4C0HA 3H1YA 3AKRA 4KQ7A 3USSA 2E7TA 3MIHA 4YVWB 1MVQA 3B69A 3JCIA 1XYPA 4BZ4A 3IWZA 4IV3A 1YUDA 3WT3A 1XNDA 2WZR2 2PAKA 1C5IA 5B2GB 1QGLA 4AFMA 1TNFA 4CEYA 1VP6A 4YGDA 3RMYA 2QQPA 1WBFA 3S30A 2VVDA 1WCDJ 3PJYA 4NHKA 1RUE2 3MW3A 2ZTNA 1V9U1 4YG0A 1RUI1 5EFUA 1CAVA 2BYVE 5LK7B 4LO6B 1FNZA 2NMNA 3N7LA 4DOUA 1B35C 4Q4X3 3SCGA 2HWD3 2XJRA 5DG1A 3ZYIB 1VB4A 3ZYGA 3S0MA 3KB5A 2UWAA 2RE9A 3LKJA 2OPKA 2V5YA 5J7MA 1LHVA 1XRUA 3VN4A 5JWPA 1C57A 3KGLA 3CJXA 2NN8A 4JRLA 4RGAA 3RYKA 1GNHA 4XF4A 4B3NA 4HK8A 1PMIA 1RHI1 1H2LA 2RM23 2PHLA 4FPCA 1C8NA 1LTEA 1TME3 1WW7A 4KGGA 4XF0A 2TUNA 1YFUA 4N7IA 1DZRA 3AZWA 3HBZA 4X6RB 3VBUB 4HN1A 1W6NB 4LHKA 1FPN3 3ZSEA 3VBHB 4FPKA 3VBFC 2B7YA 1JBCA 3PVBB 4H7LA 1X7NA 5AFBA 4Q29A 4Q4V3 4Y5Z0 2UYAA 3A4UA 1OLQA 1MQTA 3AP5A 3HQXA 2RS51 1AX2A 4D7YA 3KD4A 3TN93 3E5UA 1XYNA 2YYOA 2MPFA 3A0NA 1U5XA 2DCZA 5GM0A 3PMEA 3POWA 1BBT1 2WA3A 3VHRA 3ZXAC 1PIV3 2X5IB 4GKYA 2EXIA 3R4DB 4Q0QA 2ZHNA 2ZKNA 2XL9A 1G9FA 4Y26A 4HBNA 3THTA 4HK9A 1KS4A 3WG4A 1M4WA 4LA3A 3WHUA 4L92A 2NQYA 4UBGA 4Z2WA 5JPMB 4MXWA 1X8EA 2B45X 2XL7A 1UU6A 1EP0A 4AYUA 2EAKA 3LOBA 4BWOA 4L97A 1Q56A 2R49A 1D2SA 4UW4A 2B9UA 4Q4Y1 5KHKA 1WUVA 1IHMA 5I8SA 4HSJA 3ZSJA 2NLRA 3VKMA 5JMCA 2BVVA 1ZBE1 4K1YA 2XVLA 1V6LA 4PCRA 3AK0A 5HI0A 1PK6C 1W6NA 3WW3A 3AZVA 5FREA 1BMV1 2XBO1 3PJQA 1GBGA 5A33A 5EV7A 4EN0A 1CJDA 1ZBA1 2JG8C 5CU1A 1YFWA 3O0WA 5JOZA 1CPNA 4WM8B 1UPSA 2WFF1 1ZZBA 3S6PA 2UYBA 4FP2A 1DGWA 2Z2SB 1RUI2 1V6JA 5CFCC 1TNRA 2Y0IA 5C8WA 2VY0A 1MQTC 1ZM1A 4H3WA 3WDUA 5JI9A 2JDZA 1JH5A 1PO21 3K51A 1CAXB 3V0AB 4HVQA 2WIIB 3ZSKA 1EAH1 4I02A 1AR93 1BVP1 3AMHA 4LE4A 5FMOL 3GHMA 1ND2A 1OA2A 1VJ2A 3JB4C 5C9AB 4RHV1 3RI8A 2ZX1A 2DVDA 3WQ0A 1FI2A 2HWF2 1APNA 3GBFA 5E88A 1QH7A 3VKLA 3ES1A 4NHLA 2ET1A 1CESA 2FMDA 5LRSA 4BMEA 1PIV2 1VAVA 3OGJA 4JGZB 2JJ6A 1SLCA 2WZPP 3ELNA 1UIKA 3H1MA 4Q2FA 4JV4A 3RMXA 4OLLA 1R082 4YVWA 3IDBB 2Q1MA 3LA3A 1MEC3 3MEPA 3M8LA 1FOD3 3PNAA 3EO6A 3PVEA 1HDKA 1NCQB 1RUD2 4DQAA 2PLV3 4QT6A 3IKWA 5JR7B 2CY6A 3FFQA 1KFXL 3JQXA 1ASJ3 3AKPA 4FAHA 4LO7A 4R4ZA 1S0CA 3E6CC 4KWLA 1S2BA 3H9AA 3JBG3 3M3CA 3AYAA 3JD71 4N90A 1FOD1 1CQ9A 2RS31 4L11A 2PFWA 1MEC1 1OI6A 2ZJCA 1XYOA 2ZZJA 2EXJA 1JUHA 1TMF2 4XHBA 2HJIA 4DY3A 1UZZA 4IL7A 4OUSA 1O4ZA 4XFIA 1POV3 2OZ6A 4JDNA 2DF7A 2ATFA 4CDUB 1I1EA 2HWD2 1SMVA 1RUJ2 2DVAA 1KXGA 1XU2A 5FAXA 5FLIA 5GLUA 2W39A 2FQPA 1VBA1 5BYNA 4MV2A 4OHXA 5GLZA 4QQOA 1UF2C 5AFEA 2GH2A 4D7SA 2XPJA 2ZMNA 2GSYA 3H3UA 4M0NA 2Z42A 1OA3A 5DZFA 4N9IA 3IDCB 4LBQB 1UKRA 4R4XA 2HWE2 1DQ5A 1QJY3 1MZ6A 5HXVA 1ENQA 2A6XA 3FUOA 1SLAA 4Q4Y2 1XQNA 1F5FA 1LCLA 1OA4A 5FOBB 1S0DA 1S1AA 4KH9A 4COVA 2HWC1 2IWGB 2WT0A 5C8CB 5IT6A 3VLBB 2C0ZA 4LUKA 3OPZA 2TEPA 4JQRA 5K0UC 4RR3A 5GLTA 5E89A 5JIAA 1MS8A 1UKGA 1EY2A 4XILA 2O0OA 2PHXA 5JVVA 1GKBA 1O7FA 1NG0A 1Z78A 4OHYA 2VUAA 2IFRA 2R1BA 3VBUA 3VKFC 4N9HA 2ZBJA 3MI8A 5K7PA 1HXS2 1LU1A 4BM8A 5K8SA 1S0GA 3G6JB 1L3JA 2OW4A 1QWRA 3OY8B 2HWE1 4JGZA 4H7MA 1CAWB 4EWEA 1QNWA 4FTBA 1REDA 4P9XA 1NCQC 1G9CA 3J8F1 2KXLA 4TWTA 4B7KA 4M00A 3QOPA 4HMZA 1SLIA 1AUYA 4E9KA 1ND2B 1BK1A 1DBNA 1ZX5A 4Q0SA 5KBFA 3NV4A 1ZVFA 1KD7A 3NW4A 2RM22 1U0AA 3NAPC 4MXWB 2HWB2 4XEZA 2FBEA 2XG3A 1UN1A 4D3WA 4AEDA 3H50A 5C8CC 1W0PA 1H2KA 2QDNA 4CP0A 5IK7A 2AENA 4LHNA 2YXSA 1J3PA 2EXHA 1O3RA 5C6CA 3V0BB 3ZMOA 3VBUC 3AKQA 1WGPA 5EXOA 3WDTA 1JOJA 1NY71 1XNCA 4KU8A 2Q4SA 2QKDA 2WNVB 4INDA 3ZXFA 1QQP3 2AZ5A 1NY72 3SMHA 1W6QA 1LENA 5BV6A 2ZABA 3KZ4C 2WKKA 2R071 2VG9A 3AXEA 1EV12 4BIFA 5HBAA 1W39A 1UW8A 4AQSA 2DU1A 3HR9A 5GZDA 1J3QA 2CL2A 4HL0A 3RYRA 2Y38A 2X5IC 4XHXA 2D6LX 2OZJA 4KG0A 4K1ZA 3NKTA 1V70A 5FPXA 1AZDA 2IXHA 3JU9A 3KT4A 4W6XA 2YROA 2IXCA 4GB33 2JG8B 2Y26A 1CGPA 3I7DA 2JXAA 3L9JT 3ZFFC 3IPVB 3MIEA 1LOBA 4AGGA 2NPIA 1Z7S2 2GN3A 1J58A 1RUH1 1DHKB 1AF9A 2WL1A 4DRVA 1LOGA 4FVVA 3C2UA 1H8TA 5CFCB 4ATEA 3WINE 3VDDC 4KGQA 1GZCA 4CDXB 4D94A 1FT9A 2A71A 4ZKTB 1BMV2 1S0JA 1O4YA 2DCKA 4LUMA 4CZSA 1BBT3 1CAVB 1RUC1 3EHKA 2R0FA 3DPRA 3CO2A 4HKOA 4C91A 3ZFEC 5JDBA 4GMP0 4XBLA 4C90A 1FXZA 1AYM1 3ST7A 1RL3A 3JB8A 1S2KA 4AVSA 1PGL1 4Q26A 2PHUA 5C33A 2GNBA 3MF9A 4Q4V1 1LESA 4A7KA 2WS91 3GNEA 3MW2A 4JGYA 4BYYA 5LEJA 1WW4A 2D5HA 1AR63 4XTMA 4R9CA 4YM3A 3AMPA 3RPQA 3LCPA 2G4IA 1RUF3 4WBBA 4YZ3A 2XBO2 5GKAC 4ISRA 1LEDA 1OPOA 1SACA 4YLZA 1URXA 1I9RA 1G6NA 4R52A 4N53B 1VBC3 4YW3A 1W6PB 4YG3A 3INAA 4FPFA 3NO8A 4BHPA 1AX0A 1Q3EA 4S2GA 1KITA 1LHOA 1DF0A 2QVSB 3NV2A 2P37A 3M70A 4Y20A 3NKGA 1QXJA 4CDUA 3ZSLA 4AK3A 2RHPA 4M3CF 5I8TA 3E6BA 4F7ZA 3WHTA 3CJIC 2D40A 4QPIC 4AI0A 2A75A 3SISA 2D7FA 2YV8A 4GKXA 4COYA 4XOGA 5IK8A 1OQ1A 4XFHA 1QJX1 4AGVA 4DS0A 4G9SB 2PHFA 3MPBA 4ZU7A 5JZGB 4MSVA 1WMFA 2K9ZA 4XXAA 4K9SA 5DUWA 4AVAA 4OHWA 4B4QA 1YI7A 3ZN4A 3QD6A 3ZYRA 3MPPG 1FAYA 1RUC3 1SLLA 1U12A 5I0RA 2WNEA 1JXNA 3I4IA 4YG6A 4LE3A 2VW1A 3BIWE 2NZ9A 3EJKA 2PTMA 3CU7A 4IEWA 4IEPA 4YZ1A 3J8F3 4FOQA 2IXJA 2K2SA 4COUA 4Y1YA 4JC1A 1HRV1 2GC1A 3VUOA 2F4PA 3V0AA 3AZYA 5CFCA 2WS92 2OA2A 5KHGA 1M06G 1R1ZA 1U5IA 3N7KA 2O1QA 4LBMA 2ZMLA 3WDXA 2B46X 1QY4A 4FCAA 1QOSA 2GALA 3IPVA 3USUB 1NLSA 3ZN5A 4FP3A 4GH4A 2QE3A 4PIYA 4Z07A 2ZX3A 1VBD1 4XBQA 1S55A 1G7YA 4QPYA 5E8AA 1ULGA 1F5JA 5J3UA 5K0UA 4CDQA 4AHZA 3UKVA 4FQZA 4RS5A 3D5OA 2HWC2 3VBFB 4AVCA 1HRI1 4J1XA 1CPMA 3DPRB 4N43C 1OKQA 4K3UA 2WA4A 3PHMA 1QQP1 2YMZA 4FPJA 4FPOB 5F6KA 3AZZA 1UPIA 3EXUA 2WWSA 1RUJ1 3WW4A 2AYHA 2WQ4A 1W6QB 3UKNA 3WP3A 2QZ2A 3M3IA 1VR3A 2RJKA 3I2DA 4QPIA 2CGPA 1XE7A 1TMF1 2ARXA 2H6CA 4RSUA 4AI3A 1CIWA 3B9IA 1EPZA 4NVPA 4IEVA 1ND3A 3V65A 4FTSA 5HCFA 3ES4A 3DGTA 3JZVA 4TZDA 3M7AA 2RR13 3AFGA 1OQEA 4QPIB 2CAVA 5LRRA 1SEFA 3POSA 2UU8A 1WBLA 4FXKB 3RWNA 4FPHA 1OD5A 1AR73 3AYDA 4MGIE 4ZU4A 1DZTA 1FMD2 1UMZA 1GZWA 3AYEA 3IMNA 2E7AA 3VBFA 2WFPA 5FOJB 3JQWA 4YFWA 3SH3A 2D5FA 2ZHKA 1XE8A 2A3YA 5H9PA 4QPGC 3QACA 2E9QA 4WZFA 2XWBB 5FCCA 2P17A 4I0BA 4Q1RA 1ZZCA 3LZZA 4FBFA 2A3WA 5C4WC 4IESA 4ISQA 3LSDA 2BQPA 4KBBA 4XPVA 2UWBA 3IDEA 5H9QA 4HVOA 2YGMA 3HMYA 2RJLA 4R9DA 3ZFGA 2HWC3 5H9SA 3MIBA 1RMU1 1PO13 4Q27A 5FRAA 5GZCA 3SCHA 3AKSA 5JSOA 1PGW1 1H9PA 1YI9A 5GZFA 1NCRA 5L7OA 2YUEA 1H4HA 1QXRA 3FBMA 1E57A 3WCSA 1OPMA 2IXKA 3B02A 2GN7A 3OD0A 4IV3C 4XF1A 5IK4A 5JIUA 3E6DA 4WVVA 5AC92 1OQDA 1R1A2 1TQ5A 4QQLA 3USUA 4RHV3 1NQDA 4P9WA 3WG1A 4B8EA 1V6NA 2VOKA 2VU9A 4ONUA 5T5OA 4GALA 3TN92 1RITA 1WW5A 3OF1A 1ZRRA 3ZPYA 4Q4W1 1HQWA 5DZEA 4FPLA 5F5QA 3ILNA 1DQ0A 1RMU2 2EF6A 2OVUA 1C1FA 3VDDB 5CA6A 2BPA2 1N3OA 2A3XA 1QJU3 1HW5A 2R32A 1N1SA 2P34A 3VKNA 3MW4A 1JYIA 1CONA 2RS33 3WDYA 5H9RA 1IQAA 2DTYA 3ZFFB 3BU7A 1QJU1 1ZBA3 3NAPA 1ZZ7A 4XJAA 1OOPA 1S0EA 3VBRB 4XFGA 1PVC1 4AVTA 1NOVA 4MYEA 5AVPA 4AI1A 1V9U2 3ZSMA 1OFSA 1V6IA 1GR3A 1ASJ1 1QF3A 3E5QA 3B93A 5JSRA 1ZREA 1NZCA 4QGMA 2Q5TA 3SITA 1DGRA 1FMD1 2CTVA 4AWDA 4F8AA 5BNNC 1N1VA 2RS52 1NA1B 2AGSA 4XMAA 4Y20B 4DNYA 2Q8OA 1REEA 4XJ8A 1YNAA 4JGZC 3UKTA 1COV1 4K20A 1GSLA 1RUE3 2DU0A 3RSJA 4BCUA 1FNYA 3PTYA 1C5HA 1Q5OA 1BEV2 1Y43B 2VNGA 2ZA9A 2ZHMA 5CVRA 2B8MA 3ILRA 1SBFA 1CAXA 2R30A 1SCSA 1RJ7A 3RDIA 1AR62 1HX6A 1N1TA 3RI9A 2DVFA 3ZMNA 2VVEA 4JCKA 4GQ7A 2EAAA 1EYBA 1GANA 1QU0A 1R092 1EAH2 2W68A 3ZO0B 5BNNA 2DCJA 2PYTA 2CAUA 4XIOA 4EWAA 4XFBA 3FUQA 4LBKA 3NJZA 5HCBA 1VB2A 5I0TA 1PHMA 5BNPB 1TME2 4LNVA 4AXOA 1DZQA 2UWCA 3IBMA 5BNPC 1H9WA 4Y1VA 2BVBA 3R05A 4YNIA 1PM7A 1PVC3 3VDDA 3WP6A 5CFDB 3VGIA 5A3LA 1T6GC 3WXPA 3B5LB 4IEYA 1UZYA 1Z7S3 5J09A 3R6SA 1AXKA 3N7MA 1MS0A 3EBRA 4PDWB 1MZ5A 4LLFA 3RJ2X 4QXKA 4AFBA 1C8M1 2ZGSA 4XYXA 2GC3A 3WV6A 1XNKA 2VW0A 2D3PA 3VBOC 1KDKA 2ZS6B 5LEKA 1R091 3ILFA 1ZBE3 3N7JA 2PELA 3TBDA 4FT8A 3MFAA 3VZOA 5AVAA 1RB8G 1SDWA 5FBZA 3WR0A 1N3QA 1AYN3 1OHFA 1WMEA 2MHFA 3URFA 3GF6A 4Z92B 3ZXKA 4CEWC 4DXZA 2QFEA 2BWCA 2ZOEB 4OUMA 4M3CE 1IS3A 4CEWA 2B42B 1LJ7A 1R1A3 4OI2A 3LSEA 1PNFA 1F2NA 2ZGMA 2ZKLA 1SFYA 1LHWA 4QQPA 4Z82A 1ZZ9A 1D4M1 4K40A 2QJVA 3ASIA 3ZYJB 4FQ4A 1YYNA 5CBLA 4YYOA 2E6VA 4G3YC 4SLIA 3VBOA 5K0UB 3SHRA 1UU4A 4X6QB 3TRSB 1JN2P 2JD4A 4X8NA 1OLRA 4YVSA 2R042 3ZFGC 2WNVC 4AEDC 3OCPA 4O9EA 1ENRA 1YJLA 5DG2A 4AW7A 4IEQA 2BNNA 5T3NA 2DURA 1Q8QA 4P9LA 4YGEA 1X36A 3WLUA 2WSVA 2GC0A 3AKTA 2E51A 3ZXDA 1KJRA 2AR6A 3VBHA 3WDWA 2XLAA 2GDFA 4XJUA 4WVMA 1WCSA 4I30A 4RS5B 3LGRA 5GLVA 3ZYPA 4AEJA 3BALA 1ULEA 5FPZA 4C1XA 1J1TA 5JPNB 2DUPA 2WNUC 1W6OB 1GV9A 2JG9C 2QUOA 5FLHA 3FX3A 2AREA 1OFNA 3GALA 1NE4A 3AB0A 2WSUA 4YZ2A 1ND3B 2ZX4A 1ND2C 1H1MA 5DDJ1 2ZGRA 1JTZX 4ES8A 3LB9A 2A73B 3OJBA 3PVNA 2ZGPA 4YRDA 4MVTA 4B4PA 4AI8A 1QDCA 2MEV2 4AE2A 1KS5A 5CB7A 1MQTB 4W65A 3HWJA 1YCIA 5EYYA 4MLOA 1QJX3 1PZ7A 2GMMA 1MS4A 2QDRA 2A6WA 3VZJA 4IQPA 1VBE1 3FC0A 3R4SA 1RVF3 4BLIA 4HSLA 2X8KA 3B9CA 1D0HA 4Y4YA 3LA2A 4RA0A 5ABJA 4WV8A 4ORFA 3S7IA 4PBOA 4XF3A 3POYA 5KXCA 2VMGA 3VHOA 4QM9A 1VBB1 2QZ3A 4UW3A 1Q8OA 4R9AA 5K9YA 1C28A 2XGXA 2RS11 2R16A 1BEV3 3VBRA 2JE9A 1SLTA 3KMHA 4RS5C 4IEOA 4XMIA 5D8AA 4AFDA 1OOPB 3BB6A 1AXYA 2I45A 1VBD3 4HKLA 1W6MA 1OOPC 4XQDA 5L7OB 4CDWB 2XJTA 1AR72 4HPKA 2WZR1 1NCQA 3AYCA 2VNOA 4B4RA 5ACA2 1NA1A 5TSWA 4ASMB 4WM7C 5JLVA 3PVOA 2BUKA 2RS13 4YM1A 3T1LA 1RC6A 2OYZA 2BGCA 3ZFGB 3U0ZA 3RJRA 2WT2A 1S0IA 5D8AB 4HN0A 3HAGA 1AR92 4KNCA 4Q1PA 5DXDA 5BXXA 3CL1A 4QU2A 4CDXC 5KHIA 4I01A 4GULA 3MLKA 2GU9A 4D69A 1VBD2 1OSGA 2ARBA 1AJKA 2R072 2GC2A 4MH0E 4I0AA 4CP2A 1RUH3 3H8UA 4UBHA 3WP4A 1VBE3 1GQGA 2LTNA 1W0OA 4Q0UA 2PHRA 1IZ3A 2D6MA 2EIGA 4YW4A 2WQZC 1ULCA 1SBDA 2VNRA 3SLIA 1CD3G 1AR83 1I6XA 2IC1A 5C4WB 1VRH3 4E2QA 4OFGA 1IS4A 3KCCA 3WDVA 3PLQA 1H2NA 2VULA 3DN7A 3ZXLA 4P9GA 4RHV2 5AC93 2FMYA 1C8M3 1ZZ8A 4UW5A 2ES3A 3AMQA 2I74A 1B35A 2GMPA 4Q8KA 2HWF3 3AM2A 4Y22B 3TB0A 4UW6A 1AL0G 3B01A 1IKPA 4XFFA 2FZ2A 4JGYB 2DTWA 2HYKA 2A6ZA 1BZWA 1UD1A 1RGSA 2YPJA 3ROUA 1I3HA 3KCXA 4ASLA 1RUG1 5I93A 3P3NA 1F31A 4MGZE 1RUF1 2JENA 3LWCA 4GWNA 1CAUA 3B94A 2VOVA 4GIQA 1VRH2 3ZDSA 3HT1A