5LW9A

Crystal structure of human jarid1b in complex with s40563a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
462
structure length
456
Chain Sequence
MFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5B,Lysine-specific demethylase 5
publication title Crystal structure of human JARID1B in complex with S40563a
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 150
structure length 456
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5lw9A01
3KV6A 3AL6A 5A7OA 5FZ6A 5FJHA 3PUSA 5FYUA 5FPVA 3KV5A 5K4LA 5A7SA 4QXHA 5FZLA 4IGOA 4QXCA 5FY1A 4D6SA 3N9QA 5IVBA 3U78A 5LW9A 2XMLA 3LD8A 5FPBA 5FZ1A 3LDBA 5FXZA 5A1FA 3K3NA 4LIVA 5F2SA 3DXTA 4E4HA 3PU3A 4XDPA 5IVVA 3DXUA 3N9OA 5FZOA 3OPTA 5A7WA 5IW0A 5FZFA 5F3CA 5FBJA 5FZMA 3PUAA 3PU8A 4V2WA 5FZAA 5FY7A 3PURA 5FPUA 5F37A 5KR7A 4Y33A 5FUNA 4LITA 3AL5A 5IVFA 5FZ4A 5FYMA 5FP9A 5FZGA 3RVHA 3OPWA 5F2WA 5FYTA 4EZ4A 4EZHA 5A80A 3N9MA 5FP3A 4QX8A 4D6RA 2Q8CA 3NJYA 3PDQA 4Y4RA 4TN7A 5A7WB 5FY9A 4QXBA 5CEHA 5FWJA 5FYBA 5IVJA 2YBKA 4URAA 5FZIA 5F3GA 5FY4A 2P5BA 3N9LA 4V2VA 3KVBA 1VRBA 4CCKA 4AAPA 2OX0A 4XDOA 3N9NA 5FY5A 4HOOA 2GP3A 5IVYA 5A7NA 3UYJA 4CCMA 2W2IA 5E6HA 4GAZA 5FJKA 5F32A 5FP8A 4QX7A 3PUQA 2Q8DA 5FYSA 3AVRA 5FZBA 4BU2A 2VD7A 5FXVA 5FP4A 5FZKA 4CCJA 2OQ6A 5F5IA 5A3NA 5FZ8A 5IVEA 5A1LA 4BISA 2OQ7A 5F3IA 5FYHA 5FZ3A 4D6QA 2XUEA 5FYZA 2OS2A 5FY0A 3K3OA 4GJZA 5FPLA 3KVAA 5A7PA 5ANQA 5LY2A 4CCNA 5FYCA 5FZOB 4QWNA 5FZCA 5IWFA 5F5CA 5LWBA 5FZHA 4BXFA 5FXXA 3AVSA 4CUGA 5FYVA 2YBSA 5FYYA 4DIQA 5FP7A 5F5AA 4CCOA 3ZPOA 5FPAA 5F3EA 3U4SA 4LIUA 4UF0A 2YU1A 5FZ0A 2PXJA 4IGQA 4QU1A 5FZDA 5A3PA 2WWJA 5FUPA 4HONA 4IGPA 4GD4A 4GJYA 4AI9A 4CSWA 5FY8A 5FZEA 5FWEA 4C8DA 2GP5A 2Q8EA 2WWUA 2OT7A 2YPDA 3KV4A 5F39A 5ISLA 2XDVA 5IVCA 3K2OA 5FZ7A 2XXZA 5FYIA 2YU2A 5LY1A 5A3WA 4EYUA 3KV9A 5FXWA 3N9PA 4Y3OA 5FV3A 5FZ9A 5A7QA 4LXLA 5A3TA 2YBPA 4DO0A 3PTRB 4UF0B 4NUBA 3ZLIA 4ASKA 4CCLA
chains in the Genus database with same CATH superfamily
4AFAA 4G9SB 1DZRA 1HW5A 1NA1C 2AGSA 3KS7A 3AP6A 4HZFA 1H6XA 5C3OA 1PZ9A 1NA1B 2PHDA 2ZGSA 5I0SA 1OLQA 1F31A 2DU1A 3AFGA 4R8HA 3U78A 1ZBA1 3U07A 1H6YA 5DAPA 4B29A 3N9OA 2D97A 2B9VA 2FCUA 3OPTA 4R9AA 4KU7A 5FZFA 3I2FA 1PO22 3WEZA 4LK7A 3OF1A 2UY8A 1O59A 2MHFA 4E4DX 5FPUA 5LBEA 1W2UA 4A3XA 5FPXA 1A34A 1ACCA 1OT5A 4GKXA 2ZMLA 4LK6A 5FYMA 2WINB 1Q8OA 3KHCA 5C6CA 1PO23 4UW3A 1EPWA 1EAH1 5KHGA 3CZUA 4P00B 4QKDA 2QZ3A 4NWWA 4XJUA 1W0NA 1WWYA 4QQHA 4XUOA 1WCUA 1XJAA 3DKWA 4ZHNA 4YVSA 2C0ZA 2VZOA 1P8JA 1W39A 2XVLA 5FYBA 4GQ7A 2QE3A 4JTOA 4N7UA 1COV2 4HVOA 2XH6A 1AR92 1O6UA 1Q56A 1YC61 2OIIA 2RHPA 4YW1A 4V2VA 4DUVA 1PVC1 3POGA 5JDBA 1YFUA 4LHKA 4OZXA 1DP0A 1ZRRA 2JG9B 2R041 5JSPA 1QF3A 2JG8C 1GR3A 2I45A 4BH9A 1COV3 1JOPA 2HJIA 3AVRA 3V56A 4OHWA 1AR93 2Y6LA 2BOIA 3OGRA 1O7FA 4GWIA 1IKPA 2JG8B 1B09A 2XJPA 3E6BA 1AL22 5FZ3A 3KT4A 1J1TA 4PQ9A 3FFZA 1LOFC 2OS2A 3KQ4B 2DCJA 4IDZA 5LY2A 5FPLA 3DV8A 3NAPB 3AKPA 5FZOB 1GP6A 5FZCA 4BZ4A 1QOSA 4QB1A 3BIEA 3BI3A 1AL23 4YNIA 4UFKA 2DUQA 3KMHA 4MVTA 3NVCA 5GZGA 3RS6A 3VZOA 1MEC1 3DL3A 4EV0A 2RDSA 3SXWA 3VKOA 3U4SA 3WP3A 4RD7A 3VL8A 3ME2A 1JZ6A 3J8F1 4Q0SA 4FPOB 5FBZA 2CL2A 4JKLA 3ZN5A 5FUPA 4BQ4A 1AR62 5HCFA 2VQAA 4CSWA 2R071 2PELA 4MGZE 4E2QA 1C5IA 1LHOA 3VZLA 1PGSA 1KXGA 1QWRA 3HN3A 4XEZA 1YIFA 3ZSMA 4NRPA 4PDWC 5IYYA 2PHLA 3WW4A 3AYAA 4EWEA 4Z1VA 1UXXX 1UX7A 2DWRA 5FV3A 2ZGKA 1WBLA 2QQWA 4PDWB 5C33A 4YG0A 3PIJA 2V09A 2VCCA 1GWLA 4IEUA 1FPN2 4QAWA 1OLMA 1Y9MA 2HBUA 4XABA 5JIAA 2J22A 2WJSA 1TME1 2WDBA 2ZX2A 3OY8B 4NHYA 4O9EA 1XBFA 2JG9A 2BRTA 1GYKA 1PX4A 4N9IA 1C3HA 5FZLA 4YW3A 1QQP1 4LUMA 2BBAA 4QXCA 1UW8A 3AP9A 2C26A 2CDPA 1FPN3 2HWD3 3ZR6A 1ENRA 3VDAA 4N53B 1LGBA 1LOAA 3FUOA 1TQ5A 1RUF1 3LPFA 5AVAA 5I0DA 1F4AA 3NAPA 2ET7A 5FZOA 5IW0A 2EA7A 3CIHA 1JYTA 2DCKA 1DLLA 1VP6A 3NO8A 2IXIA 3GZUC 4L11A 1LKNA 4A45A 4LUKA 4U2AA 4AW7A 4A4AA 5KHKA 3IZOA 4ITCA 1OA3A 2G9ZA 4L0PA 2V4AA 5I0TA 1VRH2 1W8OA 3MYXA 1KFXL 4WVMA 3TAYA 1DYPA 1NQDA 4QGMA 4COVA 2ZGUA 2JDYA 2HWC2 1AR72 4TN7A 1ZZ7A 2W92A 3GM8A 4YRDA 4IE7A 2F4LA 3VBOC 5IK8A 5FWJA 4UFJA 1VRH3 2ZHMA 3SNMA 5FR3A 5IK4A 1RITA 4FTBA 3OUIA 4JGZC 3C3VA 4LPLA 4QDQA 3VBOB 1TG7A 1Y7BA 1N3OA 1VRBA 1LHVA 4R4XA 3LDKA 2HWC3 5KXEA 1J83A 1AR73 1C8NA 2WA4A 3ES4A 1O4YA 2ET1A 1VR3A 1U12A 2RM21 1JUHA 4YGEA 2EIEA 3USUB 5JAXA 2VVFA 3GZTB 4A2UA 5C7GA 3ACHA 5J09A 3IMMA 2ZZQA 4AFMA 4ZZ5A 1IS5A 2XG3A 5JXIA 1LR5A 2UWCA 4QQOA 4FAHA 1X50A 5CVRA 3AZXA 4DXSA 4P9XA 4GJZA 4BDVB 4MSVA 3AFKA 5FYCA 3ZFGA 3RGBA 5CA6A 1YQ8A 1YYNA 1IZ3A 2ZOEB 1HQNA 1A8MA 1NLRA 4BXFA 1H1MA 5K7PA 4JDNA 2DU0A 4UXAA 4OUMA 3WQ7A 1AX1A 1EV12 4N53A 4CP1A 3LEKA 1VB4A 2C5DA 1O91A 3GYDA 5FPAA 4CP2A 2RMU1 4XMIA 4QT6A 1GQHA 4XJAA 2VULA 5JUVA 1KS4A 1QH6A 3UNPA 4QU1A 1K42A 1EV13 3AMNA 2WC2A 2KD7A 3A23A 2YG0A 1LHNA 5FCCA 4NIIA 5JCTA 3NNFA 5A33A 2WNVA 5K9YA 1DQ4A 4XC9A 3OCPA 4AGVA 4MGQA 5JWPA 3BTZA 1GQPA 2Q4SA 4DB5A 5GLZA 5A3UA 4ZKTB 1ULDA 2ZTNA 2Y0OA 4JV4A 4EYUA 2YFUA 4HANA 1RMU2 1WA4A 3PNAA 3URFA 1WW6A 3A0NA 1W06A 2VMFA 2ZGQA 3AZZA 3LGRA 4ONUA 5JZGC 3GBWA 4CCLA 1R081 1S0JA 1EUUA 5EJ3A 3B02A 1ULFA 4HETA 4R9DA 5A32B 5JZGB 4KGGA 1RMU3 4LBJA 3S57A 2JKXA 2YYOA 3LEIA 2QZ2A 3J7HA 1V9U1 1Z0HA 2YHJA 2WABA 3DYPA 3KZ4C 3L9JT 5L9RA 3ZYPA 3ITQA 5GLVA 2KR2A 3PJYA 3IMNA 4FAGA 1HRI1 1ZBA2 2VL4A 2XWJB 4IEVA 4NOTA 1VIWB 1DZTA 2D6MA 3RMYA 3PU8A 4XTPA 3MIFA 4V2WA 4W6WA 4AQ6A 4LBKA 4LT5A 3HT2A 3EXUA 4IEQA 5K0UA 1RJ7A 3TEXA 1ZZ8A 1W8HA 1ZA7A 2G19A 3FJSA 1ZBA3 1D0HA 2B9UA 2NLRA 4EZHA 5FYTA 2ZEXA 1IQAA 1UMIA 1SLBA 4QU2A 4XUQA 3VKMA 1LULA 1NT0A 1VBE1 3M4FA 4OFGA 1V6JA 2PMWB 4QB2A 5FLIA 1UYZA 2VY0A 5A7WB 3RMXA 3RWKX 2HWF2 1YJLA 4XF0A 5AVPA 3ZSLA 1EAH2 2ZCWA 4H55A 3WUDA 1XNBA 3M3EA 3IKWA 3I4IA 1WBFA 4LBQA 3RG0A 3FC0A 1W04A 2KA3A 1UMHA 4XDOA 2D98A 4HOOA 4CU7A 2AEYA 2VZ3A 1EAH3 1ULOA 4K3UA 4FCAA 5C70A 1DGWA 1VBD1 1ASJ1 2WSUA 4OI4A 1W3XA 5JR7B 2VVDA 5AC91 4XBLA 1XYPA 4Q4X1 1QY4A 5EPAA 3WZ1A 5LA1A 2X53S 5JR2A 2R32A 5A32A 4QPGC 2BBVA 1PVC3 2AH2A 3T2TA 2WO1A 4JDMA 3AYEA 1WMFA 4ATFA 2PAMA 4NHXA 3VGIA 4QPGB 2VAUA 5DPNA 4ZS2A 3ES1A 2FDKA 2JICA 4Y5Z0 1U5IA 2RG4A 4DXRA 2YBSA 2JIGA 3P3NA 5A3MA 4XF9A 1S0BA 2GH8A 2GZWA 4EN7B 4A7YA 3RFRA 5FPZA 3ZPYA 4XURA 4LIUA 2XHKA 1GWKA 2OPWA 1MEC2 2WO2A 3MPBA 1SCSA 1V70A 4IGQA 4NPMA 4GD4A 3MW2A 1CIWA 2GH2A 3J8F2 4H2AA 4D7TA 2GC2A 1YIPA 3N7MA 4C1XA 1L7RA 1JXNA 5ISLA 1QJZA 2WN3A 1JYNA 1MEC3 2R072 1OSGA 5DABA 1HN1A 1ULGA 3D0JA 1GUIA 3KQRA 5LY1A 4JTNA 4LTAA 4B7KA 5LK7B 1VB2A 3J8F3 3HBKA 2RS31 1N1SA 3PTRB 4NUBA 2ZA9A 3WQBA 5CAZA 2R073 3WINE 1OMIA 1QDOA 5A7OA 4AI0A 2RDQA 4GH4B 3WDVA 2W0XA 5FOBB 1SBFA 3JD71 1QJFA 2ZJCA 4EROA 2QQKA 2XWBB 2WO7A 4JC1A 4LKFA 4KWUA 4K9SA 4RFRB 3LDBA 4DEVA 2D3RA 2AENA 1DQ0A 1GP5A 4MADA 3JXSA 2V72A 5JI7A 3AKRA 4P9LA 5CG9A 2XGXA 1TME3 4XXAA 2VBDA 3FHAA 1RUF2 2H6BA 5E1RA 5FY7A 1GP4A 2WIIB 1QQP3 1OD3A 1C28A 1HDKA 2BUKA 4P08A 4PF5A 2ZAAA 3MLLA 2JDNA 4EQVA 3OBTA 4FQ4A 1C5HA 4JX0A 2ARCA 4IEPA 4P02B 3U1XA 2OW4A 4EZ4A 4XACA 4IEOA 1TZOA 1RUF3 3MHZA 2YFZA 2ZEZA 4GMP1 4JZRA 4LKSA 4QX8A 5FLHA 1QJX1 4RYDA 4BB3A 4D69A 5EHDA 1OC1A 4ISQA 3BB6A 2K0GA 1V6OA 3CU7A 5F3GA 3RZGA 2JENA 3H3LA 3K77A 4WM7C 1HN0A 1OQ1A 3A22A 1JN2P 3WR0A 1RUC1 5DZGA 1PZ8A 3ST7A 1I1EA 2W46A 4WM7B 4C90A 5LRSA 1MVEA 4S2GA 2G9FA 5EZWA 2Q8DA 2B42B 5T5JA 4MGTA 1RINA 2VTXJ 4FBFA 1FYUA 1W6NA 4CCJA 4B1MA 2RM22 2WLQA 3CF6E 5CG8A 5FZ8A 4QQPA 5A1LA 4HVQA 3GGLA 4CP0A 4WM8C 1LOGA 2D6LX 2YUEA 2VNGA 4KG8A 4UWDA 3SKVA 3SEPA 4AQTA 4K40A 3H50A 3K3OA 4GH4A 5DDJ1 4WM8B 3ATGA 3O0VA 2XBO2 4MO3M 3BVCA 2RM23 2D7FA 3ZFFB 1VAVA 4HL0A 3W59A 2D6OX 2WS91 2IC1A 3IAQA 3ZOIA 1CPMA 4AFDA 4XFCA 3T2QA 2LUWA 1EYBA 5JLVA 4K8FA 1C57A 2VM9A 2UURA 2WZ8A 3JBG1 4M3CF 3USSA 5IAXA 4ATEA 4YZ1A 3U75A 2QBXA 1F35A 3NJVA 2VZTA 5LA9A 2E32A 4CDUC 4Q8KA 1UZVA 4CEWA 3ASIA 5LEJA 3GBFA 2SBAA 5I8YA 2DURA 5FUIA 4QMAA 4A6SA 2WQZC 1VLNA 5ABJC 5FWEA 4IL7A 4CDUB 3ZXKA 3FWEA 1PMHX 2NPIA 2Y6KA 4AHXA 3H3ZA 3FN9A 5FKCA 5L9BA 1F4HA 5ABJB 2HWB1 2IWGB 2WFPA 3HJRA 3QACA 2FD8A 2G9GA 2RMU3 2AR6A 3KB5A 2XQRA 1FMD2 1UZYA 1VBB1 4BLIA 2FDIA 1ST8A 3SISA 4E9KA 2FCVA 2GNDA 3WP5A 1ENQA 2XUMA 4Q5OA 2PAKA 3R4UA 4PIYA 3BIWE 5FMDA 4XVHA 1AR61 3MW3A 2P3KA 2A73B 1DG6A 4XUNA 4O65A 1LHUA 2QNKA 2VTFA 1R082 3TNPB 2P34A 4Y20B 1GBGA 3MFAA 4N43C 4BMEA 3VBUA 2Q0AA 4EWDA 4BIOA 3K51A 5KXCA 5HI0A 1KQRA 2ZBJA 4N43B 1FX5A 3OB8A 1G86A 2PHWA 1V9U2 2JDUA 3C7OA 1R083 5DUVA 4CRQA 1OA2A 4GWMA 1BEV2 3AP7A 2YC2A 5FZMA 1XU1A 1HRI2 2VGDA 3ZFFA 1LU1A 2GC0A 2I07B 3NV3A 4AOCA 4XJ9A 1NCQA 1OA4A 4AQ2A 2XVGA 4LEJA 3C2UA 1YQCA 1V9U3 1J59A 5EFUA 2P2KA 1ULCA 2ZGTA 2XONA 1BEV3 3RVHA 4B1LA 1HRI3 4OI2A 2CWMA 4QHBA 3O5SA 4V1PA 5A80A 2AACA 3WW2A 5A3LA 4I0AA 1D4M2 4Q0PA 5GKAC 4LOTA 1B35C 3OBRA 5GJ6A 3G7DA 5J96B 3LFMA 5FJHA 2WQ8A 4YFZA 5CEHA 1VMFA 1QGLA 2IUWA 3ZM8A 4URAA 1H2LA 5FZIA 1QKQA 3OGSA 1B35B 4BCUA 5KXDA 1W6QB 1ZRDA 4H3WA 1S4CA 4JDOA 3M7AA 2WFF2 3VBHA 5SV8A 4CZSA 1PVXA 4PI2A 3GALA 4KI5M 2VZ1A 3TEYA 4FTEA 4HFSA 3EB7A 4NIHA 4LJHA 5F32A 5FP8A 2Y0IA 4LLOA 1VBE3 3IDEA 1GU3A 5FZBA 2JE7A 3UKVA 4BU2A 3RYRA 2VD7A 5FZKA 4GXLA 5DAWA 5FKBA 3WY6A 3GCXA 4PBOA 1GQGA 1VBD2 1NX9A 1RGSA 2XL7A 1DLCA 1ASJ2 2HLEA 2Y26A 3LE0A 1BBT1 3ZYRA 4D6QA 4I30A 5AC92 3A21A 3M3QA 3B00A 5GM0A 3W5NA 1I5ZA 3NV1A 1PMIA 2VBPA 3GHMA 3VD9A 1G6NA 1OFSA 3Q8EA 4Q4X2 1CIYA 4JGYA 1CX1A 5C8CC 5L7OC 2VOTA 1VBD3 3ZMOA 1ASJ3 4HT1T 5CKQA 3ZDSA 3DYMA 1QIQA 2Y34A 4WV8A 4XJZA 3P6BA 5FYYA 5AC93 5C8CB 5L7OB 3VHPA 1MPXA 1W6OB 1SLAA 4Y1YA 1MQTC 4Q4X3 1OQDA 1IS6A 1CAVB 2HEVF 5C71A 3GXUA 2C1FA 4Z2WA 4F3JA 1V6KA 3RYPA 2QQLA 1VE0A 4XCAA 4XHXA 1OVPA 3UK9A 4AVCA 4BQ5A 4IERA 4ISRA 4Y4YA 2B7YA 2O0OA 1WW4A 3CO2A 1CJDA 5FIXA 4GZ9A 3U37A 5BV6A 1QXPA 3WNKA 3T0DA 3MZHA 1W6PB 2QTWB 3AC0A 4NIDA 1WLWA 4ARXA 1JU3A 1W3VA 3VLBB 2HBTA 1W8TA 1UZ0A 4COWA 3JZVA 2G1MA 4GALA 2GNTA 2K46A 1RUH1 2LROA 1ODMA 1DYKA 4FXGB 5H9QA 4CXWA 1FV2A 3I3EA 5C9AA 3PHMA 1TE1B 4NRQA 5AFEA 2XB6C 1XNKA 4DO0A 4AI2A 2WR9A 4YZ3A 3MIGA 4WVZA 3DYOA 1UZZA 2X5IB 1CONA 4H7MA 1TNFA 2RS32 1V6NA 5KBFA 2DFCA 3PUSA 1RUD1 3WOGA 3EQEA 5H9PA 4YZ2A 3THPA 4XFBA 5GZCA 4XUPA 2QQUA 1E5IA 2VECA 5CU1A 1QNWA 4BXSV 3OUJA 2RS33 1PNGA 4KWKA 4NN0A 2VOKA 2DBNA 2Q1MA 3WNPA 1IGOA 3S5QA 3CDZB 1XNTA 2XJUA 2PHRA 1HIXA 3F2ZA 1V6IA 4PHZA 5DUUA 5GZFA 3SHRA 3UESA 3MF9A 4NIGA 3IDBB 3B69A 5BUVA 5J7MA 1GV9A 3PUAA 2BGPA 4XF1A 1OOPA 2WBKA 1H8VA 3OSDA 3PLQA 4Q29A 1A8DA 1CAUA 2BWCA 3CL1A 3JD73 4QDSA 5DMYA 4PT6A 2PHFA 1J84A 1UO9A 5A3OA 1PK6A 1W8WA 4FPEA 1S2EA 3MW4A 4QX0A 3AL5A 2VCAA 3CMGA 4IV1C 4DQAA 1FI2A 2DDUA 1R091 3OPWA 4I2OA 4BMBA 1WZXA 3VHNA 3ELNA 1GOFA 4L2NA 5FY9A 3WP6A 1PM7A 3AJZA 3SH3A 3IIIA 3AX4A 4XIOA 3KT1A 4HPKB 1QJX2 4KQ7A 3ETPA 5HCAA 1HB2A 1K5MA 1W6PA 4KMQA 1BJQA 2OXBA 4CPBD 2OX0A 1RVF2 2BFUS 2W5FA 4CCMA 3WDUA 3IB3A 4GMP3 3ZXLA 1QJX3 4XPVA 5CADA 1RUC2 4LBLA 2X5IA 1CJPA 3O14A 3WQ1A 4YG6A 2FDHA 1W05A 4N9HA 3HWJA 2IVJA 4ASLA 5FYHA 1CX4A 2HWF1 2Y38A 5KHHA 4CP9B 3OBZA 1AJKA 4A3ZA 2B4KA 2R1DA 5FY0A 1FV3A 1AXYA 3KVAA 1GNHA 1JW6A 5FQ0A 3B3QE 1AJOA 4QWNA 1ZBE1 1SZBA 1RUC3 5T5OA 4AGGA 1AZDA 2ZGLA 4FOQA 4Q0VA 1XRUA 1ENXA 2A70A 1MZ5A 3LOBA 5DDJ2 4NWVA 4B4QA 4AEDA 3B93A 3WUCA 1W9FA 4NROA 5F5AA 2A3WA 1F15A 1S2KA 2WS92 1F5JA 3IBMA 4UFLA 1GOGA 2ID4A 1JTZX 3TEWA 4IE6A 3UJQA 4O7XA 1JZ3A 1JU4A 4E4ZA 4MG2A 3OD0A 5DDJ3 5FZDA 1NOVA 5CB7A 3JBG2 5J37A 1RB8G 4X8PA 3NNMA 4BK5A 4FSJA 2QDNA 4DXZA 4MHRA 4ZZ8A 4CDWC 4Y1UA 4GULA 5BNPC 2WS93 5I93A 3RJ2X 2OT7A 1UXZA 3I2GA 3KV4A 2IFRA 3WG4A 4PQQA 1NA1A 3IDAA 3WHUA 4CDWB 2QQOA 3AMQA 1NE4A 4K1ZA 3JBG3 3TBDA 3M3IA 3TOJA 1QH7A 2RJLA 2A3YA 2ZX3A 4RQPC 3CEWA 5I0UA 1LU2A 4IW3A 2HWB2 1SFPA 2DVFA 1WD4A 4UF0B 3UJOA 5B4NA 2VMCA 3KD4A 1VBB2 2AEZA 5HXMA 1E57A 2D6NA 3I7DA 5FMOS 3RSJA 1KRIA 1KDMA 4R4ZA 4ZU7A 2O14A 3LCPA 4UBHA 4JHZA 3MFCA 3MIDA 4AI1A 4D7SA 3KV5A 5E16A 5K4LA 1DGLA 5A7SA 1VMHA 3DCQA 2HWB3 3DPRC 1RUG1 1JODA 2JIJA 1PZ7A 2Y6HA 5FY1A 1PGL1 1VBB3 1RTVA 2YPJA 3N9QA 4Q26A 3U14A 5FAXA 2PHXA 1PNFA 4NHKA 3DPRB 4YVWC 1XYNA 3SCGA 4XIKA 4CP9A 5JOYA 5F5QA 5F2SA 5GLTA 1AX0A 2V5DA 2IXCA 2ADDA 4YVWB 4HBNA 1AR63 2BEOA 4GB32 3WDXA 1K12A 1XOYA 4Y1XA 1CGPA 2JDZA 3HAGA 1L7QA 5T52A 5CFCC 3LA2A 2WLPA 3B9IA 4L92A 2GN7A 3DUIA 2R0FA 5J48A 3OG2A 2CYFA 4YYOA 3N36A 2CAVA 2QFEA 3GF6A 4TWTA 2YDEA 2VTXA 5G05L 2VUCA 1TEIA 4E8CA 4META 4B4PA 4DEQA 1UAIA 2VZVA 3IIAA 5BYNA 4BQYA 1UQXA 2JECA 3FBMA 2GN3A 2JG8A 1O8PA 1PX3A 1HV1A 2X8KA 1REEA 3I2KA 4LO8A 3O1RA 4F8AA 4YW7A 1AXZA 4KBBA 2BQPA 2VUJA 4MGYE 2WRAA 1C1LA 4AAPA 3AXDA 4NO4A 1LOFA 1W9SA 1Z7S1 3ZYBA 2GP3A 4RN5A 1LAJA 3VD3A 1NXMA 4JQTA 1H8TC 2FMYA 3Q8AA 4D94A 4QX7A 1AL0G 2VQUA 3K75B 2W1SA 1LGNA 3R0RA 4MXWB 1W2NA 2VC9A 2VQTA 2OQ6A 3I3QA 5FTTC 4IEYA 4M3CE 4JHTA 3BGAA 5BNNC 2UY9A 2XUEA 1OF3A 5FYZA 2OUJA 1W9WA 4LKDA 3CNAA 4XUTA 4CUCA 1UY4A 3LA3A 5BNNB 3F95A 1BBT2 1XNDA 5IWFA 3W21A 1DFQA 4NPRA 5FZHA 5FXXA 1US2A 2XR4A 3R4SA 2VQ0A 5FYVA 1ZZCA 3HNYM 4ZY9A 2DCYA 3UKTA 3BTAA 3WW1A 2IFWA 1WD3A 4JGZB 3RJRA 1BBT3 2VBBA 2ZX0A 4PDWA 5I0RA 2VOWA 1K3IA 1YLLA 3SEEA 5LEKA 1YEWA 4LHSA 2D6PA 3ILRA 1NLSA 1XE8A 5ERLA 3VDDC 2UU8A 2GU9A 3JCIA 4MV2A 1GLHA 2E51A 5IFTA 2XBO1 2GP5A 3HQUA 3OY8A 4P5HA 3J7NA 3NNLA 4UYBA 4W6YA 3VDDB 4KWJA 2WNOA 4HSJA 2JJ6A 4XDQA 2PYTA 4RR3C 1HJGA 1JI6A 2JB8A 3BTYA 1DF0A 3WCSA 2YGMA 2BFUL 1UOBA 1YI9A 1POV0 3U4XA 4RR3B 4BYYA 1PGW1 5CKNA 4L8QA 3TWIA 1RUH2 4MXVA 3S7IA 1AX2A 4AWDA 2VNVA 4LHLA 3RZHA 1G8WA 3EYPA 1O4ZA 2P6CA 2QQMA 1C1FA 2DVBA 4IXLA 4AVTA 5FPVA 2XJSA 3I2IA 3WXPA 3WG1A 1CR7A 5DQ0A 4MXWA 1RUH3 5JMCA 2A71A 1RUD2 2XMLA 4F83A 2W95A 3D5OA 1MZEA 4H7LA 3HQRA 2NQYA 1FMD1 3U0ZA 4QPYA 3SCHA 3T08A 1H2NA 4LO6B 4E4HA 2E6VA 3PU3A 4XDPA 3I8TA 5DUXA 3ZFEC 4ASMB 4FPHA 2C6SA 3VV1A 4YW2A 3ZN4A 3J4UH 2OZJA 3IT8A 3H3UA 2FMDA 1DYOA 1RUD3 3ZFEB 4G4FA 3T1MA 4CUAA 3WV6A 3M2MA 4BHPA 3VBOA 4J6GA 4DY3A 2VR4A 3MBWA 4X8NA 4BQXA 1T6BX 4PLMA 4XZUG 4Y33A 1GSLA 5F6KA 4JGZA 1JBCA 5L73A 1E5SA 5FP9A 4E27A 4M0NA 3USUA 1Q8SA 1MACA 2VUDA 3A0KA 3CQOA 3GJAA 5EYXA 1G9BA 1JHNA 1UIJA 3K46A 1NG0A 2VMDA 2CY6A 3N9MA 3B5LB 3DECA 2HEYF 4QPIC 2YROA 4Y4RA 4BLJA 3E97A 1R092 4QXBA 2HYKA 4QPIB 4A44A 1JMUB 3P3PA 1BEV1 3M3CA 4HKOA 5C8WA 4DY5A 2JEMA 3NL1A 4XAAA 5FREA 3ZX7A 3POSA 5FMOL 5FY5A 3POIA 3ZVXA 3AKTA 1R093 1UIKA 1VPHA 2FDFA 2YC4A 5E6HA 3VD7A 1YI7A 4AG4A 2BERA 1CESA 4QX2A 3T1LA 4K8RB 4KNCA 1AXKA 1D4M1 3H7YA 3JQXA 4XFGA 3D8CA 1J58A 5DXDA 2CU5A 1CPNA 2PHUA 3EMRA 3KF5A 1DZQA 2O8QA 3PVEA 4CEYC 2QDRA 1APNA 2B39A 5T5LA 2NP0A 4CUBA 1JZ8A 1O4TA 4CEYB 2ILMA 5LA0A 2DVGA 2Q5TA 4FPCA 4Q2FA 5LWBA 2WFF1 2X09A 1MS9A 3B94A 3OJBA 3BU7A 1XSRA 1ZBE2 1LODA 1VBC1 5ANNA 1S2BA 3JQWA 1NZCA 1QOTA 2ZGNA 1XB9A 2CGNA 3FE5A 2HWF3 5KC5A 1F8VA 3DEMA 3PL0A 1H2MA 2WSVA 5T55A 1H0BA 4FFFA 1ZBE3 1UY0A 3MUY1 5JPMB 1YFWA 4RFT0 3H42B 2Q8EA 2WWUA 2Z5WA 1TVGA 5JZGA 4C0BA 2XDVA 2W9XA 1CAWB 3V0BB 3PJQA 3O1OA 1GICA 3WSOA 4QGNA 1LGCA 2J1EA 3S6PA 1FATA 2XJTA 4RGAA 4JRAA 2GALA 5EXOA 4XMAA 4OQ8A 3O1TA 1ZREA 3ZLIA 1CVNA 3AKSA 4HN1A 2ARXA 2PFWA 1IPSA 3GBGA 3JU9A 4MYEA 5FMCA 2G4IA 1R1A2 5FZ6A 1OHFA 1Y9QA 2J1AA 2V4VA 1MS8A 2Y6JA 3IM0A 1HKDA 1Z78A 5D1IA 5BNOC 4OVEA 4QXHA 4IV3C 4RA0A 4UFIA 5JSOA 4XFIA 2ENRA 3LQCA 2UWBA 4OUSA 5EWSA 5IUQA 3GZEA 5BNOB 2QQJA 3ZKYA 1LJ7A 3ZYHA 3CHXA 1RUG2 1NZIA 3OYWB 4XQDA 4LKEA 1PGL2 1FOD1 3DXTA 2WO3A 4I09A 2WNUC 3DXUA 2ADEA 5A7WA 5EV7A 4FFHA 5T50A 2WNUB 4UW6A 3DN7A 3KF3A 3O7OA 1A3KA 3T4VA 1RUG3 2RDRA 3OGJA 4TXWA 1BQPA 4COYA 1RIRA 1M06G 4EWAA 2WT2A 4QQ2A 5FUNA 2P3JA 4XTMA 2GMMA 1SPPB 1KFUL 1GZCA 5C4WC 4Q4W1 1I6XA 5IK7A 3LPGA 1W9TA 2H0BA 4FXKB 5KHIA 3VDBA 5C4WB 1BK1A 2RR11 2P3YA 2YBKA 5JI9A 3PIGA 2EICA 3ABZA 5HV4A 1Y4WA 5J3UA 5JIUA 3H7JA 3INAA 2P5BA 4JRLA 5DZEA 5TSWA 3KVBA 3AM2A 2DV9A 4IEWA 3SKJE 3PTYA 1RUJ1 2WWSA 3B7MA 3N7KA 3N9NA 2VOVA 4QPGA 5BNQA 2YV8A 2DF7A 2W2IA 3CJIC 2R1BA 2LTNA 4YM0A 1L7LA 2MEV1 1JYVA 5JMOA 2QJVA 3APBA 5T3NA 3FLPA 1Z7S2 2YZ4A 3RPQA 3T30A 3M8LA 3I2OA 4LR4A 1SDWA 1UX6A 4S2HA 3ACFA 3DGTA 4LE3A 4NVPA 5F3IA 2GAUA 5L36A 4YM1A 1AR81 4FT8A 3ZXJA 2QQNA 4XBNA 5A7PA 2K9ZA 4MZUA 1F2NA 4E2SA 1OFNA 3V0AB 5CIRA 2EF6A 3AKQA 4K21A 4I3PA 1Z7S3 5EQUA 1JYIA 3BALA 2BTVC 3SH4A 2R7EB 4AGRA 5KC6A 1RVF1 2HWE2 5JOXA 5CFDC 1IG0A 1QJY1 4IUGA 4SBVA 4CA9A 1E5HA 5EIYB 1BLZA 4XETA 1W2OA 1RUI1 4EN8B 1AYM1 4DNYA 2E63A 3H8RA 3J9SA 2CWSA 2KXLA 5FK8A 3NNJA 2PXJA 2YC0A 3AZVA 4O61A 4QKFA 2WWJA 4IGPA 2PTMA 2BPA2 1WA6X 2JKBA 3I3BA 3VKNA 2BDRA 4W4ZA 2XKPA 2ZX4A 4D3WA 2PLV2 4FQZA 5AFBA 2JDPA 5IVCA 2JDMA 2VCBA 4MGKE 5A6YA 1T2XA 5A3WA 1BVP1 2WQ4A 2RDNA 5FZ9A 5ACA1 4GKYA 5JSRA 1JZ2A 3AZWA 2GDFA 3E6CC 2F17A 4MGSA 4XBQA 4AI3A 2ZABA 4ASKA 2TBVA 2Z2SB 4UT5A 4COZA 1DHKB 3KV6A 2GNMA 4IEZA 4B8EA 1PGW2 2Z42A 2XBO3 3ENRA 1W28A 2JX9A 1GZTA 2PA7A 3QH6A 1WLDA 2PHTA 4P9YA 1NQJA 1SFNA 1UU5A 3J26N 4YFWA 1GZWB 1AVBA 5FPBA 2XLFA 1LNSA 1DU3D 1ZRIA 2ZGMA 1ULPA 3POBA 5LB6A 4LO5B 2QQVA 3HN1A 2E7QA 2VMGA 4YGCA 3V0AA 1RL3A 2IXHA 4R52A 5B2GB 1WMDA 2VH9A 5C5TA 4FP3A 1UMZA 3J7LA 3BKZA 3UGGA 1ZRFA 4BQ2A 1POQA 3QH7A 3FFQA 5KR7A 3DKQA 1WUVA 2ZGRA 3VKLA 3MO4A 3IPVB 2D5HA 1LENA 4PIZA 1FMD3 3W20A 4EN0A 3BPZA 2FBEA 4WM7A 2WA3A 2IZWA 1S0GA 3H1MA 1BVVA 1UF2C 2Z69A 3PDQA 1US3A 1DCSA 5IVJA 1IPKA 3KCCA 3CKHA 1SDDB 4AVBA 1XQNA 4GB31 5IJRA 1RJ8A 3N9LA 5IK5A 3JB4C 4WM8A 2QVSB 2ES3A 1C8M2 1LOEA 1W03A 4NPLA 5A7NA 4BPZA 1ND2C 2B8MA 5LRRA 4H14A 4M4PA 4GAZA 3BOPA 1ZX5A 5FFOC 4BJ0A 3PUQA 3J7MA 4UW5A 2GMEA 4NAOA 4R9CA 1ND2B 1QJU1 1SLTA 2A3XA 3ACGA 5D21A 1GZ9A 1PIV1 2Y33A 4HK8A 2VZPA 1C8M3 2NN8A 2Q1FA 1N1TA 1QNYA 4R9BA 2VMHA 2WYSA 3N35A 3BTXA 1NCRC 2GSYA 3QLQA 1QMJA 4PLNA 4U36A 3WF2A 2IXLA 4NMIA 3T3YA 4XAEA 3RZJA 1GZWA 1W6MB 2E7AA 2AC1A 4IE0A 2C24A 4C0HA 2OYZA 2EALA 2WYFA 4CDUA 1NCRB 2NM1A 3BOWA 4BQ1A 1VBA1 4RS5C 3SCFA 1W8FA 4FOYA 5H9SA 5H9RA 4PI0A 1D4M3 4A42A 5ABJA 2IXKA 4RS5B 5A6QA 2ATFA 2WNEA 3VBFC 4CCDA 4OHVA 1VBC2 5M0TA 2C4XA 1UPSA 2BVBA 4MX3A 4DRVA 3ZIXA 5A3PA 3TEZA 3RQ0A 1CN1A 2MPFA 4QXKA 5JOWA 2EXHA 4ZONA 2WFF3 2XJRA 2WAOA 5KWRA 3IPVA 3ILNA 3RI8A 4CDXC 4QQLA 1VBC3 3WD5A 4XJWA 4FO9A 4B7EA 3EHKA 1UKRA 2D93A 3ZN6B 1X8EA 3FX3A 4MH0E 4Y20A 4AEMA 1HRV2 4CDQC 2QQPA 2YU2A 4QX1A 4CDXB 4DINB 3BU0A 2NZ9A 3DF0A 1H4HA 2GC3A 3WG2A 5DG1A 1ND3C 5A7QA 3FHIB 3WNXA 3MICA 4JKMA 1IKQA 4OI1A 4N43A 3VDCA 1BMV2 4Y5TA 3LAGA 1IOAA 1ND3B 3H1WA 4GWJA 4RHV1 3T09A 3THTA 2ZPXA 2AZ5A 5T54A 1D2SA 3ZXAC 4F7ZA 1D4VB 1Q5OA 1FNZA 1KJRA 1MQTB 1W2TA 5JXJA 4OHXA 4Q27A 2I74A 4XW3A 4D6SA 1O8SA 1SCRA 3ALQA 2VUAA 2BGOA 4UAPA 4W50A 4MHUA 4Q0QA 2GC1A 1OKOA 2W39A 4YGBA 1HQWA 1JHJA 1YCIA 3WHTA 4WVWA 1W90A 2ZEYA 5GLUA 1W6MA 1FOD2 2A6YA 4AF9A 1BKZA 2KM2A 4UFHA 1XE0A 1B35A 2P1BA 4XFHA 1W6QA 4I01A 4DXTA 3SLIA 3WF1A 2VZSA 3MI8A 4BK4A 1UU6A 2LALA 3I3MA 1WLCA 2XKOA 2LM3A 4S2FA 3SH5A 1MS4A 2W1WA 4X6QB 3HOBA 2W94A 2Y64A 1FOD3 4I0BA 4HK9A 1NY71 4ZXEA 4D6RA 4E2GA 1D0GA 4BM8A 5E8AA 1FT9A 4QKNA 1OVSA 4Q4W2 2ORZA 2BNOA 2Y6GA 4GIQA 4JAAA 1GKBA 3S5AA 1FNYA 1U0AA 4XFFA 5A6XA 3VZNA 3GHNA 1O5LA 1O3QA 5EJZB 3ZXEA 2JWPA 3WCRA 4Z07A 2RR12 3QD6A 2YXSA 4FFGA 2AREA 5CYYA 4RGGA 3IDCB 2J1SA 2OVUA 1MS1A 4YWAA 3GDBA 4Q4W3 2GMPA 5FDBA 3O1SA 2XVKA 4YVSC 4ZU4A 1RUJ2 3PVOA 4N8MA 4Y26A 3LZZA 5F9TA 5C8CA 5L7OA 1RHI1 1RUE1 2BV4A 1W6OA 2N7GA 1T6GC 2E31A 2RR13 1XNAA 4QB6A 4YVSB 2MEV2 1CAVA 4Z82A 4DS0A 4AHWA 4BOWA 3OGVA 2OKXA 1A78A 1MQTA 4IV1B 1RUJ3 2HEWF 2C9AA 3BYWA 3VD5A 2FZ1A 3NJZA 4RL7A 2E9QA 3NV2A 2AYHA 1AR82 3SC7X 2D6KA 3LWCA 1HB1A 4TZDA 2Y8KA 2A1XA 3ZXDA 1VJ2A 4A41A 2MEV3 3ZXGA 1DIWA 2A7AA 1URXA 1ZM1A 4YGDA 3WW3A 2VE1A 4DIQA 3O12A 4IE4A 3ILFA 5FP7A 3AB0A 2XOMA 3CZJA 3MIEA 1H4GA 2RJ2A 4I0WB 4NR1A 1JYXA 3RZLA 2DYCA 1HXS1 1Q8QA 1AR83 1QJY2 2EAKA 1WCQA 1PHMA 3L2YA 3EBRA 5FZ0A 5KXBA 4I02A 4ZU5A 1KGYA 1O3RA 1RUI2 2HH9A 3RZKA 1AYM2 5HCBA 5CISA 4OZOA 3TB0A 1X36A 3C7HA 1RVF3 2DTYA 1QU0A 4NRMA 4C8DA 2LRPA 2CHHA 1QJY3 3FLTA 3OOXA 3WF0A 1F5FA 3MDPA 5FZ7A 4KG0A 5T5PA 4DZGA 3KSCA 3WQ0A 4B4RA 1QOOA 5DZFA 4XYXA 4C1WA 1RUI3 2RS51 1JZ4A 3N9PA 1AYM3 4Y3OA 1KJLA 3TNQA 3VUOA 3UT0A 2EXIA 4RGKA 1H9PA 4M3CB 4YW5A 2P3IA 1PMJX 5I8SA 4LOSA 3VHOA 5ACA2 1C4RA 3TRSB 4AZZA 2E33A 2BNNA 3Q9OA 3HEIA 4HLTA 4KH9A 3K4ZA 4E8DA 1JS9A 3T2PA 3IN9A 1IS3A 1CZTA 4BQWA 4BQ3A 2DCTA 2F6BA 1UNBA 2QKDA 1LCLA 5IVBA 4M01A 5ACA3 3N7JA 1UL9A 1VAMA 3N7LA 5FZ1A 3ZSJA 2FDJA 1UN1A 1MS3A 3K3NA 4YSFA 4LIVA 1YHFA 1QEXA 3WG3A 5BNPB 4IV1A 2JG9C 1QXJA 1JYWA 4GA9A 4ZS3A 3O0XA 2W1UA 2YMZA 4HPKA 1R1A1 4D0QA 2R061 2C9KA 1VALA 1S0EA 1HJFA 1RC6A 3A7QA 1STMA 2OA2A 3PURA 2BVVA 4FPKA 5BXXA 4AR2A 4UW4A 3TYJA 4RQPB 4INDA 3UKNA 3Q8BA 2WZEA 3MIHA 4LITA 5FZ4A 1BHGA 3NAPC 5FZGA 5LBBA 4Q4V1 2WKKA 1AHSA 5HV0A 4CCEA 4TLFA 4A6OA 2XLGA 1FXZA 5LASA 2X29A 3ROUA 4JVAA 3POJA 1MZFA 3QCWA 1X82A 2J7MA 1OH3A 2YY1A 5C3PA 4E4SA 1NAEA 3LEGA 1WKYA 5CBLA 4QX3A 3U10A 2DUOA 5LATA 2UYBA 2XJVA 2D5FA 2EAAA 5CNAA 4P14A 5FO9B 2PAEA 4WVMB 2VW1A 3UYJA 4Q4Y2 5LK5A 3WT3A 2ZEWA 4M00A 4M3CA 5EJ1B 1Q43A 2DBIA 5G04L 3BODA 2QQIA 2J1TA 5A3NA 5CFCB 2Z79A 2OQ7A 4GB33 4OULA 2A6XA 4X6RB 1YFYA 3NWKA 4Q4Y3 2XPJA 1QJU2 3RWNA 1Q3EA 4CU6A 2YB7A 1UPIA 1PIV2 3LDRA 2BGCA 4HVRA 4Y5SA 2HYXA 4O9GA 1WMEA 3AVSA 4OHZA 2BJSA 4CPBA 4LULA 1NKGA 1IHMA 3LEMA 1WW7A 1UOJA 4D8MA 4CDWA 1QJU3 1KS5A 3OGGA 2B5HA 3KLSA 4CCOA 1OLRA 5BNPA 4JKKA 2HWD2 1PIV3 1VBA2 5CZKA 3ZFGC 3MGUA 3RYKA 1OKQA 2XL9A 1LB2A 1KEXA 1Y3TA 4QPWA 3D82A 4I3GA 4HKWA 4UF0A 4XCBA 4Y22B 3ZYFA 3PVBB 1UY2A 3ZFGB 4MLOA 3WP4A 4GJYA 2VXRA 1H8TB 3KGLA 4RQPA 4N53C 1OPMA 2W52A 3WNLA 3POEA 3MV01 2VNRA 4CE8A 1VBA3 4BWOA 1WCKA 2ETEA 3U11A 2Q8OA 4DUWA 5F39A 2LW8A 1CWPA 1POV1 2XXZA 3HQXA 1DQ5A 2HWE1 1SLIA 1PO11 2JD4A 4SLIA 3VZJA 4AFBA 3KV9A 5E88A 4XHBA 3DPRA 1R1ZA 4D7YA 1SFYA 3R6SA 3VD4A 2WNVC 2VNOA 2IXJA 1OH4A 2HKXA 3LB9A 4YVWA 4DPNA 2FHRA 3AK0A 1S1AA 2TNFA 3NW4A 3OBAA 4HN0A 5A33B 2WNVB 2VW0A 3H8UA 4K6BA 4COUA 1OLME 2ZXQA 2GNBA 5DAVA 4RHV2 2XQXA 1I9RA 3FUQA 1M4WA 2VW2A 2PLV1 3LIGA 4P9GA 3LKJA 3WVJA 1H1IA 2VOXA 1W99A 3HT1A 2R30A 4IQPA 4CTEA 5CFCA 2EIBA 1ZZ6A 3O1UA 4KWLA 1H30A 1HV0A 2JDAA 3HD8B 1BCXA 1S0DA 1XSQA 2VZRA 3HNMA 4RHV3 4AVSA 3FZ3A 1JZ5A 1ZVFA 5EYYA 1W0PA 5FBJA 4LBQD 2P37A 3WF3A 1QHDA 1H1AA 4LBNA 3GZAA 2ORXA 2BNMA 3UGHA 1CQ9A 3AYDA 3W5MA 3OEBA 1OQEA 2NMNA 3I2HA 5SV5A 4A7ZA 3VBRC 4NE9A 2SLIA 3KCYA 4DMIA 4QM9A 3A4UA 1U5ZA 1NLQA 4LNVA 3PUIA 1UWWA 4W6XA 4XQWA 2EXJA 1E5RA 5F2WA 3VBRB 3WDYA 4UFMA 4AQSA 4Y22A 2ZMKA 3I59B 3RI9A 5K0UC 1CZVA 2OUHA 1H8TA 4S2DA 2WZR1 2BWAA 3HVDA 1MZ6A 1LOCA 5J1XA 1NY72 3T2OA 4NHLA 1AUYA 1RUNA 3BCWA 5IAVA 2XHNA 4DFSA 1XE7A 5K0UB 3MIBA 3IAPA 2R49A 1W8ZA 5BNNA 2VZUA 4N90A 1RYYA 1W9YA 1ZRCA 4QDRA 1N1YA 2A6VA 3MV11 5FYSA 4K1YA 1X33A 5FP4A 2Z4FA 3LSEA 5F5IA 2F4PA 1J1LA 1BYHA 5JVVA 3FHQA 3D3AA 1RHI2 1RUE2 3THDA 1YFXA 2BU9A 1G9DA 4LBQB 4CCNA 1DQ1A 2VVEA 3FBYA 5ANQA 1YUDA 2ZKNA 3HPNA 3T0BA 3ZXFA 1C8M1 1YQ2A 2EXKA 3VDDA 4XF3A 1RHI3 1RUE3 1OI6A 3M70A 5HXVA 2VZQA 2BOJA 4PF1A 5A70A 4ORFA 4CCCA 4PJYA 1OXCA 1MR5A 1UY3A 2DFBA 4AXOA 4DRRA 5C3SA 1HB4A 4RR3A 5D8AC 3VB9A 1RUOA 5C3QA 1OD5A 4JCKA 4HONA 1HB3A 3RZZA 1YQ6A 1HXS2 2NYYA 4FPFA 3FMGA 5D8AB 3LOIA 3R05A 4YARA 3TN91 5KHJA 1TNRA 4YPJA 2ZACA 1JYCA 3VBRA 1RXFA 3K2OA 3AP4A 3KHBA 3VBSC 5C3RA 5FYIA 5JXHA 3ORJA 3AMMA 3I59A 4Y24A 1N1VA 2ZHLA 3ON7A 1HXS3 4OQ9A 1XC6A 3VBSB 4M4RA 1Q8VA 2LS6A 5F8PA 3GCWA 3C7FA 1ZZ9A 3K48A 1EUTA 2BW8A 2RS52 1JOBA 2ZHKA 3ECQA 2ERFA 4LO4B 1J3RA 3RNSA 3WX5A 3AL6A 1X9TA 3HBZA 3PUHA 4LLFA 2FDGA 1SHWB 1AYN1 3ZFEA 4AHZA 1GANA 3GJBA 4URTA 5IATA 1S0CA 2RVAA 2A5ZA 4OCTA 3MLJA 4IE5A 2DTWA 1UYYA 2RS53 2ZGOA 2FZ2A 1HRV1 1Y9GA 1F9KA 1REDA 3VL9A 2W1QA 3G6JB 3NQHA 1O3SA 2D44A 3MPPG 5A1FA 4LBMA 5FO8B 4YG3A 1N47A 5IVVA 1EY2A 2RJKA 3D4KA 4Q1RA 3ZYIB 4YZ5A 1HQLA 2E7TA 4AE2A 5K8SA 1KITA 1PM4A 5F3CA 4KU8A 1BMV1 2R16A 3E5UA 4QPIA 4YLZA 5DN2A 3RDIA 3T0AA 2O1QA 1XNCA 1PVC2 3NKTA 4EE2A 1S0FA 3O0WA 4QM8A 2JDKA 2VXJA 4J25A 5BPXA 2H6CA 5F37A 2MNGA 5LBCA 2R062 2R042 5IVFA 3O1PA 2UWAA 5FLJA 1UU4A 4Q1PA 4WVVA 3ZKUA 1N3QA 2VPVA 4YW4A 4AVAA 3LF7A 2VCMA 3NJYA 1IG3A 1Y43B 3AJYA 2J42A 2JE9A 3C7GA 4Q4V2 1DQ6A 2K2SA 4IV3B 5D8AA 5DAXA 4B3NA 1R1A3 3M3OA 2R063 2R043 2CAUA 4QKBA 4FOWA 4KL1A 3WDWA 4OHYA 2CGOA 1UKGA 2IVIB 4CEYA 1X7NA 4N7IA 4Q4V3 4RSUA 5DUWA 5IVYA 3VBSA 4LA2A 1WCSA 1IS4A 1ZYBA 3ACIA 4TSVA 4HXCA 3E1F1 1UCXA 5JOZA 4FI9A 1UZWA 1Q8PA 1LESA 5IVEA 2D3PA 1QDCA 1V6MA 1IPJA 5IFPA 4ZPIA 1ONAA 4FOVA 1YNAA 3KCXA 1R64A 4EN6B 3JB8A 2PN5A 4HSLA 1W0OA 4QX5A 5F5CA 4QHZA 3P5BA 4M0HA 1YJKA 4OMCA 4WZCA 1DBNA 5J36A 5E89A 5I8TA 1CAWA 2EVXA 3Q8FA 2ARBA 3V0BA 5GALA 1CAXB 4L9BA 4ES8A 1W6NB 2RS11 5F7UA 3N3HA 1LECA 5L19A 3ZPOA 1WMXA 2VMEA 3HNBM 5F3EA 2H0VA 4GH4C 4AFCA 1XYOA 3NV4A 3HIFA 4J1WA 4KBZA 3CJXA 5BY5A 1FAYA 4TTGA 1RXGA 1SQ4A 1YQ5A 1SG3A 3ZMNA 3D0SA 3THCA 1TMF1 2OZ6A 2W08A 4BIFA 4OLLA 3OPZA 4ZXKA 1X9PA 3POFA 3CJIB 4A7KA 5FMBA 5J98B 5L9VA 1TME2 2NMOA 2WT1A 2YGLA 5FY8A 5FZEA 1JOJA 1SBDA 5HPOA 1WGPA 2ZKLA 4LMFA 1ZNPA 3KWVA 5IT6A 4PCRA 1LEMA 1QQP2 4NHMA 2UYAA 4YZ4A 2D40A 5BNOA 3VKFC 1SEFA 4LE4A 5FXWA 4P9JA 4CEWC 4IV3A 3WF4A 1ZA4A 2V5YA 3P1IA 4LQRA 2YBPA 3OYWA 3UV9A 1PO12 1MS0A 3I97A 2VJXA 4XOGA 3SQOA 3VHRA 4CEWB 3L2HA 2DVDA 3GNEA 1I5PA 2ZHNA 5CFDB 3ZSKA 3AZYA 2DUPA 4KGQA 1A6CA 2WNUA 1KDKA 5FYUA 4MGIE 1YRZA 2B45X 4HKLA 1POV3 4CYDA 4YM3A 2HWE3 1PO13 4IGOA 4AYUA 2ZS6B 1REFA 1GOHA 3W58A 5LW9A 1WW5A 3T4HB 1SPPA 2OPKA 3AYCA 1PO21 1W8UA 2ZZJA 3BUCA 1OPOA 4FPYA 4AL9A 3POYA 2WN2A 3B01A 4NJ4A 4WZFA 4YW6A 4OI0A 1SBEA 5C4WA 1CZSA 1UY1A 3AMPA 3S7EA 4Z8BA 2BZDA 5FZAA 2P17A 3B9CA 3QBQA 3VBUC 3OTFA 3NJXA 2PLV3 1SACA 3LIHA 2AUYA 1CAXA 2CTVA 5FRAA 1LRHA 2BP6A 5HBAA 2A6ZA 1BZWA 3ZDVA 3I2JA 3VBUB 3Q8CA 4P5YA 4AK3A 4DOUA 5I91A 1VMJA 3NRUA 2W87A 4J1XA 4OYUA 2RV9A 2XLAA 4OMDA 3ZFFC 3C8XA 4AAXA 2JXAA 1COV1 2Q8CA 1G9AA 4XILA 3RZMA 1NCQC 5APAA 1AR91 4FVVA 3CJIA 4YM2A 5DG2A 4LA3A 4CVUA 4GMP0 1J3PA 1NCQB 3H9AA 4ARYA 2J1UA 2VO5A 3POWA 1VAKA 2WZR2 4XF4A 4W65A 2ARAA 2BYVE 4CCKA 1CD3G 1MS5A 2E53A 1U5YA 3UETA 1LEDA 2Q30A 1O5UA 4EN9B 2WT0A 4DUXA 1AL21 2ZMNA 1ALYA 4LORA 5IHRA 4WBBA 5FXVA 3RRDA 2RMU2 3FLRA 1SLCA 2WZR3 2XJQA 3E5XA 3K4AA 1G7YA 2J1RA 3NNGA 5LBFA 1H9WA 3H1YA 1NXD1 1OUSA 3HR9A 3PVNA 1K45A 4HMZA 4UBGA 5CFDA 2L9LA 3VBHC 3SITA 5FO7B 1DGRN 3WNOA 1W8NA 1X8MA 4XQ4A 3VZMA 2DCZA 4FPGA 1XXNA 3VBHB 4MOAA 1UOFA 2CSGA 4QGLA 1OF4A 1ULEA 4XZPA 3MF6A 4L99A 4Q4Y1 4CU9A 3CBNA 3H0OA 4CU8A 2FCTA 4IESA 5F6LB 2D3SA 3KT7A 3O1VA 2PQQA 3K4DA 5B4XA 3PMSA 3MEPA 4TLGA 2CV6A 1JH5A 2WAAA 4JGYC 2O8OA 5LCWL 5FOJB 2JB4A 1YO8A 2WL1A 5D2AA 1J3QA 1LHWA 3ZYGA 4JGYB 2B46X 3E5QA 1GWMA 4OUEA 3ZO0B 4AHYA 3WDTA 4GWNA 2YPDA 1XU2A 1K5JA 1XPWA 4CXYA 2CGPA 3PMEA 3AP5A 1HLCA 4AVVA 3TN92 1DQ2A 3EJKA 1JUIA 3AMHA 1FPN1 2HWD1 2ZAHA 3JUUA 4W8JA 5GLWA 3V65A 5HCHA 4LXLA 4XE9A 5A3TA 1LTEA 3MUZ1 1GMMA 3X29B 3ZYJB 4L97A 1UD1A 4CXXA 3ZR5A 5GZEA 3NKGA 3TN93 2R0HA 3OEAA 1DGWX 4G3YC 4HG6B 3WNNA 3S0MA 3LSDA 3VBFB 5C9AC 4PBPA 3UL2A 3QOPA 3W9AA 1OUXA 2JDHA 4P9WA 1V00A 1AYN2 5LZ6A 2I2SA 1U5XA 2P4EA 5C9AB 1L3JA 3LD8A 3ACLA 1S55A 2QCSB 1YXWA 3S30A 5FXZA 2J1VA 4TYSA 3ZSEA 4LBOA 1VBE2 3M1HA 1NYWA 1BK0A 5A6ZA 1EPZA 4AEJA 1ENSA 2VG9A 3ETQA 3C7EA 4FP2A 4IEXA 1WLTA 3OUHA 3SMHA 1AYN3 3UGFA 1OURA 4CDQB 1VRH1 2VU9A 3NMBA 2ZGPA 2WUHA 2Y60A 3EO6A 2W68A 4PIXA 1HRV3 3VN4A 2HWC1 1AR71 4UI9L 4P9IA 3BPSA 1EP0A 4QD2A 4UOJA 3I2DA 3MLKA 2W47A 2X10A 1H2KA 1OOPC 3AXEA 3OD4A 5FP3A 2JE8A 2TEPA 3ZIWA 4EJRA 1ND2A 1UOGA 2VMIA 4QHOA 1W2AX 4ET7A 2EIDA 3I54A 1S0IA 2R6QA 1YWKA 5C5UA 1OOPB 1PK6C 2TUNA 5GZDA 1QJEA 5FY4A 4NAMA 1CAUB 3N4MA 3KM5A 4JQRA 1PK6B 3BN6A 3NSTA 1I3HA 4MUVA 2W91A 4K7JA 3O1MA 1NCRA 2V73A 4Q0UA 4XFAA 5FJKA 4Z2AA 4Y1VA 5CKMA 3I3DA 5A1AA 1DDLA 3FL7A 3KGZA 5JPNB 4NIAA 1BXHA 4LO7A 3WNMA 4FPLA 4BE3A 4RS5A 1K5MC 1ZZBA 3E6DA 2D43A 4BISA 4FPJA 4Y1ZA 3D6EA 5JXGA 3CLPA 5FK7A 3HMYA 1D7PM 2PQSA 2FQPA 3H8XA 1K5MB 3VBFA 3I49A 1EV11 2A75A 2W3JA 1IQDC 4Z92B 3IWZA 2X5IC 1V0AA 4CUGA 4BA6A 2EIGA 3WLUA 1QXRA 3ZN6A 1NE6A 3LFIA 1WCDJ 4CDXA 3H8OA 4FTSA 1SMVA 2A6WA 2QUOA 1GNZA 2CNAA 1GFF2 5DAQA 3VZKA 2X05A 1NUKA 2JD9A 4AEKA 1V6LA 2RS12 4CDQA 1LOBA 1OBNA 2DVAA 2E26A 2YU1A 5FQ0B 2Y6FA 1G9CA 1AF9A 2CDOA 1O3TA 1ND3A 4LHNA 1GNYA 4AEDC 3LA7A 4AI9A 2RE9A 1G9FA 1HX6A 1TMF2 3R4DB 4C91A 1JZ7A 1ODNA 1N3PA 2ZX1A 3JD72 4XXPA 4AEDB 1DGRA 1MVQA 1RMU1 2RS13 1SLLA 4PLOA 2P6HA 4Q8LA 4ES9A 2Q1ZB 4FFIA 4K20A 5LA2A 5F1RA 4AI8A 3V64A 1TMF3 4XJ8A 5EP9A 1D2QA 2WZPP 1UYXA 4IETA 1KD7A 1UYPA
chains in the Genus database with same CATH topology
3KV6A 3AL6A 5A7OA 5FZ6A 5FJHA 3PUSA 5FYUA 5FPVA 3KV5A 5K4LA 5A7SA 4QXHA 5FZLA 4IGOA 4QXCA 5FY1A 4D6SA 3N9QA 5IVBA 3U78A 5LW9A 2XMLA 3LD8A 5FPBA 5FZ1A 3LDBA 5FXZA 5A1FA 3K3NA 4LIVA 5F2SA 3DXTA 4E4HA 3PU3A 4XDPA 5IVVA 3DXUA 3N9OA 5FZOA 3OPTA 5A7WA 5IW0A 5FZFA 5F3CA 5FBJA 5FZMA 3PUAA 3PU8A 4V2WA 5FZAA 5FY7A 3PURA 5FPUA 5F37A 5KR7A 4Y33A 5FUNA 4LITA 3AL5A 5IVFA 5FZ4A 5FYMA 5FP9A 5FZGA 3RVHA 3OPWA 5F2WA 5FYTA 4EZ4A 4EZHA 5A80A 3N9MA 5FP3A 4QX8A 4D6RA 2Q8CA 3NJYA 3PDQA 4Y4RA 4TN7A 5A7WB 5FY9A 4QXBA 5CEHA 5FWJA 5FYBA 5IVJA 2YBKA 4URAA 5FZIA 5F3GA 5FY4A 2P5BA 3N9LA 4V2VA 3KVBA 1VRBA 4CCKA 4AAPA 2OX0A 4XDOA 3N9NA 5FY5A 4HOOA 2GP3A 5IVYA 5A7NA 3UYJA 4CCMA 2W2IA 5E6HA 4GAZA 5FJKA 5F32A 5FP8A 4QX7A 3PUQA 2Q8DA 5FYSA 3AVRA 5FZBA 4BU2A 2VD7A 5FXVA 5FP4A 5FZKA 4CCJA 2OQ6A 5F5IA 5A3NA 5FZ8A 5IVEA 5A1LA 4BISA 2OQ7A 5F3IA 5FYHA 5FZ3A 4D6QA 2XUEA 5FYZA 2OS2A 5FY0A 3K3OA 4GJZA 5FPLA 3KVAA 5A7PA 5ANQA 5LY2A 4CCNA 5FYCA 5FZOB 4QWNA 5FZCA 5IWFA 5F5CA 5LWBA 5FZHA 4BXFA 5FXXA 3AVSA 4CUGA 5FYVA 2YBSA 5FYYA 4DIQA 5FP7A 5F5AA 4CCOA 3ZPOA 5FPAA 5F3EA 3U4SA 4LIUA 4UF0A 2YU1A 5FZ0A 2PXJA 4IGQA 4QU1A 5FZDA 5A3PA 2WWJA 5FUPA 4HONA 4IGPA 4GD4A 4GJYA 4AI9A 4CSWA 5FY8A 5FZEA 5FWEA 4C8DA 2GP5A 2Q8EA 2WWUA 2OT7A 2YPDA 3KV4A 5F39A 5ISLA 2XDVA 5IVCA 3K2OA 5FZ7A 2XXZA 5FYIA 2YU2A 5LY1A 5A3WA 4EYUA 3KV9A 5FXWA 3N9PA 4Y3OA 5FV3A 5FZ9A 5A7QA 4LXLA 5A3TA 2YBPA 4DO0A 3PTRB 4UF0B 4NUBA 3ZLIA 4ASKA 4CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV6 A;  3AL6 A;  5A7O A;  5FZ6 A;  5FJH A;  3PUS A;  5FYU A;  5FPV A;  3KV5 A;  5K4L A;  5A7S A;  4QXH A;  5FZL A;  4IGO A;  4QXC A;  5FY1 A;  4D6S A;  3N9Q A;  5IVB A;  3U78 A;  5LW9 A;  2XML A;  3LD8 A;  5FPB A;  5FZ1 A;  3LDB A;  5FXZ A;  5A1F A;  3K3N A;  4LIV A;  5F2S A;  3DXT A;  4E4H A;  3PU3 A;  4XDP A;  5IVV A;  3DXU A;  3N9O A;  5FZO A;  3OPT A;  5A7W A;  5IW0 A;  5FZF A;  5F3C A;  5FBJ A;  5FZM A;  3PUA A;  3PU8 A;  4V2W A;  5FZA A;  5FY7 A;  3PUR A;  5FPU A;  5F37 A;  5KR7 A;  4Y33 A;  5FUN A;  4LIT A;  3AL5 A;  5IVF A;  5FZ4 A;  5FYM A;  5FP9 A;  5FZG A;  3RVH A;  3OPW A;  5F2W A;  5FYT A;  4EZ4 A;  4EZH A;  5A80 A;  3N9M A;  5FP3 A;  4QX8 A;  4D6R A;  2Q8C A;  3NJY A;  3PDQ A;  4Y4R A;  4TN7 A;  5A7W B;  5FY9 A;  4QXB A;  5CEH A;  5FWJ A;  5FYB A;  5IVJ A;  2YBK A;  4URA A;  5FZI A;  5F3G A;  5FY4 A;  2P5B A;  3N9L A;  4V2V A;  3KVB A;  1VRB A;  4CCK A;  4AAP A;  2OX0 A;  4XDO A;  3N9N A;  5FY5 A;  4HOO A;  2GP3 A;  5IVY A;  5A7N A;  3UYJ A;  4CCM A;  2W2I A;  5E6H A;  4GAZ A;  5FJK A;  5F32 A;  5FP8 A;  4QX7 A;  3PUQ A;  2Q8D A;  5FYS A;  3AVR A;  5FZB A;  4BU2 A;  2VD7 A;  5FXV A;  5FP4 A;  5FZK A;  4CCJ A;  2OQ6 A;  5F5I A;  5A3N A;  5FZ8 A;  5IVE A;  5A1L A;  4BIS A;  2OQ7 A;  5F3I A;  5FYH A;  5FZ3 A;  4D6Q A;  2XUE A;  5FYZ A;  2OS2 A;  5FY0 A;  3K3O A;  4GJZ A;  5FPL A;  3KVA A;  5A7P A;  5ANQ A;  5LY2 A;  4CCN A;  5FYC A;  5FZO B;  4QWN A;  5FZC A;  5IWF A;  5F5C A;  5LWB A;  5FZH A;  4BXF A;  5FXX A;  3AVS A;  4CUG A;  5FYV A;  2YBS A;  5FYY A;  4DIQ A;  5FP7 A;  5F5A A;  4CCO A;  3ZPO A;  5FPA A;  5F3E A;  3U4S A;  4LIU A;  4UF0 A;  2YU1 A;  5FZ0 A;  2PXJ A;  4IGQ A;  4QU1 A;  5FZD A;  5A3P A;  2WWJ A;  5FUP A;  4HON A;  4IGP A;  4GD4 A;  4GJY A;  4AI9 A;  4CSW A;  5FY8 A;  5FZE A;  5FWE A;  4C8D A;  2GP5 A;  2Q8E A;  2WWU A;  2OT7 A;  2YPD A;  3KV4 A;  5F39 A;  5ISL A;  2XDV A;  5IVC A;  3K2O A;  5FZ7 A;  2XXZ A;  5FYI A;  2YU2 A;  5LY1 A;  5A3W A;  4EYU A;  3KV9 A;  5FXW A;  3N9P A;  4Y3O A;  5FV3 A;  5FZ9 A;  5A7Q A;  4LXL A;  5A3T A;  2YBP A;  4DO0 A;  3PTR B;  4UF0 B;  4NUB A;  3ZLI A;  4ASK A;  4CCL A; 
#chains in the Genus database with same CATH topology
 4AFA A;  4G9S B;  1DZR A;  1HW5 A;  1NA1 C;  2AGS A;  3KS7 A;  3AP6 A;  4HZF A;  1H6X A;  5C3O A;  1PZ9 A;  1NA1 B;  2PHD A;  2ZGS A;  5I0S A;  1OLQ A;  1F31 A;  2DU1 A;  3AFG A;  4R8H A;  3U78 A;  1ZBA 1;  3U07 A;  1H6Y A;  5DAP A;  4B29 A;  3N9O A;  2D97 A;  2B9V A;  2FCU A;  3OPT A;  4R9A A;  4KU7 A;  5FZF A;  3I2F A;  1PO2 2;  3WEZ A;  4LK7 A;  3OF1 A;  2UY8 A;  1O59 A;  2MHF A;  4E4D X;  5FPU A;  5LBE A;  1W2U A;  4A3X A;  5FPX A;  1A34 A;  1ACC A;  1OT5 A;  4GKX A;  2ZML A;  4LK6 A;  5FYM A;  2WIN B;  1Q8O A;  3KHC A;  5C6C A;  1PO2 3;  4UW3 A;  1EPW A;  1EAH 1;  5KHG A;  3CZU A;  4P00 B;  4QKD A;  2QZ3 A;  4NWW A;  4XJU A;  1W0N A;  1WWY A;  4QQH A;  4XUO A;  1WCU A;  1XJA A;  3DKW A;  4ZHN A;  4YVS A;  2C0Z A;  2VZO A;  1P8J A;  1W39 A;  2XVL A;  5FYB A;  4GQ7 A;  2QE3 A;  4JTO A;  4N7U A;  1COV 2;  4HVO A;  2XH6 A;  1AR9 2;  1O6U A;  1Q56 A;  1YC6 1;  2OII A;  2RHP A;  4YW1 A;  4V2V A;  4DUV A;  1PVC 1;  3POG A;  5JDB A;  1YFU A;  4LHK A;  4OZX A;  1DP0 A;  1ZRR A;  2JG9 B;  2R04 1;  5JSP A;  1QF3 A;  2JG8 C;  1GR3 A;  2I45 A;  4BH9 A;  1COV 3;  1JOP A;  2HJI A;  3AVR A;  3V56 A;  4OHW A;  1AR9 3;  2Y6L A;  2BOI A;  3OGR A;  1O7F A;  4GWI A;  1IKP A;  2JG8 B;  1B09 A;  2XJP A;  3E6B A;  1AL2 2;  5FZ3 A;  3KT4 A;  1J1T A;  4PQ9 A;  3FFZ A;  1LOF C;  2OS2 A;  3KQ4 B;  2DCJ A;  4IDZ A;  5LY2 A;  5FPL A;  3DV8 A;  3NAP B;  3AKP A;  5FZO B;  1GP6 A;  5FZC A;  4BZ4 A;  1QOS A;  4QB1 A;  3BIE A;  3BI3 A;  1AL2 3;  4YNI A;  4UFK A;  2DUQ A;  3KMH A;  4MVT A;  3NVC A;  5GZG A;  3RS6 A;  3VZO A;  1MEC 1;  3DL3 A;  4EV0 A;  2RDS A;  3SXW A;  3VKO A;  3U4S A;  3WP3 A;  4RD7 A;  3VL8 A;  3ME2 A;  1JZ6 A;  3J8F 1;  4Q0S A;  4FPO B;  5FBZ A;  2CL2 A;  4JKL A;  3ZN5 A;  5FUP A;  4BQ4 A;  1AR6 2;  5HCF A;  2VQA A;  4CSW A;  2R07 1;  2PEL A;  4MGZ E;  4E2Q A;  1C5I A;  1LHO A;  3VZL A;  1PGS A;  1KXG A;  1QWR A;  3HN3 A;  4XEZ A;  1YIF A;  3ZSM A;  4NRP A;  4PDW C;  5IYY A;  2PHL A;  3WW4 A;  3AYA A;  4EWE A;  4Z1V A;  1UXX X;  1UX7 A;  2DWR A;  5FV3 A;  2ZGK A;  1WBL A;  2QQW A;  4PDW B;  5C33 A;  4YG0 A;  3PIJ A;  2V09 A;  2VCC A;  1GWL A;  4IEU A;  1FPN 2;  4QAW A;  1OLM A;  1Y9M A;  2HBU A;  4XAB A;  5JIA A;  2J22 A;  2WJS A;  1TME 1;  2WDB A;  2ZX2 A;  3OY8 B;  4NHY A;  4O9E A;  1XBF A;  2JG9 A;  2BRT A;  1GYK A;  1PX4 A;  4N9I A;  1C3H A;  5FZL A;  4YW3 A;  1QQP 1;  4LUM A;  2BBA A;  4QXC A;  1UW8 A;  3AP9 A;  2C26 A;  2CDP A;  1FPN 3;  2HWD 3;  3ZR6 A;  1ENR A;  3VDA A;  4N53 B;  1LGB A;  1LOA A;  3FUO A;  1TQ5 A;  1RUF 1;  3LPF A;  5AVA A;  5I0D A;  1F4A A;  3NAP A;  2ET7 A;  5FZO A;  5IW0 A;  2EA7 A;  3CIH A;  1JYT A;  2DCK A;  1DLL A;  1VP6 A;  3NO8 A;  2IXI A;  3GZU C;  4L11 A;  1LKN A;  4A45 A;  4LUK A;  4U2A A;  4AW7 A;  4A4A A;  5KHK A;  3IZO A;  4ITC A;  1OA3 A;  2G9Z A;  4L0P A;  2V4A A;  5I0T A;  1VRH 2;  1W8O A;  3MYX A;  1KFX L;  4WVM A;  3TAY A;  1DYP A;  1NQD A;  4QGM A;  4COV A;  2ZGU A;  2JDY A;  2HWC 2;  1AR7 2;  4TN7 A;  1ZZ7 A;  2W92 A;  3GM8 A;  4YRD A;  4IE7 A;  2F4L A;  3VBO C;  5IK8 A;  5FWJ A;  4UFJ A;  1VRH 3;  2ZHM A;  3SNM A;  5FR3 A;  5IK4 A;  1RIT A;  4FTB A;  3OUI A;  4JGZ C;  3C3V A;  4LPL A;  4QDQ A;  3VBO B;  1TG7 A;  1Y7B A;  1N3O A;  1VRB A;  1LHV A;  4R4X A;  3LDK A;  2HWC 3;  5KXE A;  1J83 A;  1AR7 3;  1C8N A;  2WA4 A;  3ES4 A;  1O4Y A;  2ET1 A;  1VR3 A;  1U12 A;  2RM2 1;  1JUH A;  4YGE A;  2EIE A;  3USU B;  5JAX A;  2VVF A;  3GZT B;  4A2U A;  5C7G A;  3ACH A;  5J09 A;  3IMM A;  2ZZQ A;  4AFM A;  4ZZ5 A;  1IS5 A;  2XG3 A;  5JXI A;  1LR5 A;  2UWC A;  4QQO A;  4FAH A;  1X50 A;  5CVR A;  3AZX A;  4DXS A;  4P9X A;  4GJZ A;  4BDV B;  4MSV A;  3AFK A;  5FYC A;  3ZFG A;  3RGB A;  5CA6 A;  1YQ8 A;  1YYN A;  1IZ3 A;  2ZOE B;  1HQN A;  1A8M A;  1NLR A;  4BXF A;  1H1M A;  5K7P A;  4JDN A;  2DU0 A;  4UXA A;  4OUM A;  3WQ7 A;  1AX1 A;  1EV1 2;  4N53 A;  4CP1 A;  3LEK A;  1VB4 A;  2C5D A;  1O91 A;  3GYD A;  5FPA A;  4CP2 A;  2RMU 1;  4XMI A;  4QT6 A;  1GQH A;  4XJA A;  2VUL A;  5JUV A;  1KS4 A;  1QH6 A;  3UNP A;  4QU1 A;  1K42 A;  1EV1 3;  3AMN A;  2WC2 A;  2KD7 A;  3A23 A;  2YG0 A;  1LHN A;  5FCC A;  4NII A;  5JCT A;  3NNF A;  5A33 A;  2WNV A;  5K9Y A;  1DQ4 A;  4XC9 A;  3OCP A;  4AGV A;  4MGQ A;  5JWP A;  3BTZ A;  1GQP A;  2Q4S A;  4DB5 A;  5GLZ A;  5A3U A;  4ZKT B;  1ULD A;  2ZTN A;  2Y0O A;  4JV4 A;  4EYU A;  2YFU A;  4HAN A;  1RMU 2;  1WA4 A;  3PNA A;  3URF A;  1WW6 A;  3A0N A;  1W06 A;  2VMF A;  2ZGQ A;  3AZZ A;  3LGR A;  4ONU A;  5JZG C;  3GBW A;  4CCL A;  1R08 1;  1S0J A;  1EUU A;  5EJ3 A;  3B02 A;  1ULF A;  4HET A;  4R9D A;  5A32 B;  5JZG B;  4KGG A;  1RMU 3;  4LBJ A;  3S57 A;  2JKX A;  2YYO A;  3LEI A;  2QZ2 A;  3J7H A;  1V9U 1;  1Z0H A;  2YHJ A;  2WAB A;  3DYP A;  3KZ4 C;  3L9J T;  5L9R A;  3ZYP A;  3ITQ A;  5GLV A;  2KR2 A;  3PJY A;  3IMN A;  4FAG A;  1HRI 1;  1ZBA 2;  2VL4 A;  2XWJ B;  4IEV A;  4NOT A;  1VIW B;  1DZT A;  2D6M A;  3RMY A;  3PU8 A;  4XTP A;  3MIF A;  4V2W A;  4W6W A;  4AQ6 A;  4LBK A;  4LT5 A;  3HT2 A;  3EXU A;  4IEQ A;  5K0U A;  1RJ7 A;  3TEX A;  1ZZ8 A;  1W8H A;  1ZA7 A;  2G19 A;  3FJS A;  1ZBA 3;  1D0H A;  2B9U A;  2NLR A;  4EZH A;  5FYT A;  2ZEX A;  1IQA A;  1UMI A;  1SLB A;  4QU2 A;  4XUQ A;  3VKM A;  1LUL A;  1NT0 A;  1VBE 1;  3M4F A;  4OFG A;  1V6J A;  2PMW B;  4QB2 A;  5FLI A;  1UYZ A;  2VY0 A;  5A7W B;  3RMX A;  3RWK X;  2HWF 2;  1YJL A;  4XF0 A;  5AVP A;  3ZSL A;  1EAH 2;  2ZCW A;  4H55 A;  3WUD A;  1XNB A;  3M3E A;  3IKW A;  3I4I A;  1WBF A;  4LBQ A;  3RG0 A;  3FC0 A;  1W04 A;  2KA3 A;  1UMH A;  4XDO A;  2D98 A;  4HOO A;  4CU7 A;  2AEY A;  2VZ3 A;  1EAH 3;  1ULO A;  4K3U A;  4FCA A;  5C70 A;  1DGW A;  1VBD 1;  1ASJ 1;  2WSU A;  4OI4 A;  1W3X A;  5JR7 B;  2VVD A;  5AC9 1;  4XBL A;  1XYP A;  4Q4X 1;  1QY4 A;  5EPA A;  3WZ1 A;  5LA1 A;  2X53 S;  5JR2 A;  2R32 A;  5A32 A;  4QPG C;  2BBV A;  1PVC 3;  2AH2 A;  3T2T A;  2WO1 A;  4JDM A;  3AYE A;  1WMF A;  4ATF A;  2PAM A;  4NHX A;  3VGI A;  4QPG B;  2VAU A;  5DPN A;  4ZS2 A;  3ES1 A;  2FDK A;  2JIC A;  4Y5Z 0;  1U5I A;  2RG4 A;  4DXR A;  2YBS A;  2JIG A;  3P3N A;  5A3M A;  4XF9 A;  1S0B A;  2GH8 A;  2GZW A;  4EN7 B;  4A7Y A;  3RFR A;  5FPZ A;  3ZPY A;  4XUR A;  4LIU A;  2XHK A;  1GWK A;  2OPW A;  1MEC 2;  2WO2 A;  3MPB A;  1SCS A;  1V70 A;  4IGQ A;  4NPM A;  4GD4 A;  3MW2 A;  1CIW A;  2GH2 A;  3J8F 2;  4H2A A;  4D7T A;  2GC2 A;  1YIP A;  3N7M A;  4C1X A;  1L7R A;  1JXN A;  5ISL A;  1QJZ A;  2WN3 A;  1JYN A;  1MEC 3;  2R07 2;  1OSG A;  5DAB A;  1HN1 A;  1ULG A;  3D0J A;  1GUI A;  3KQR A;  5LY1 A;  4JTN A;  4LTA A;  4B7K A;  5LK7 B;  1VB2 A;  3J8F 3;  3HBK A;  2RS3 1;  1N1S A;  3PTR B;  4NUB A;  2ZA9 A;  3WQB A;  5CAZ A;  2R07 3;  3WIN E;  1OMI A;  1QDO A;  5A7O A;  4AI0 A;  2RDQ A;  4GH4 B;  3WDV A;  2W0X A;  5FOB B;  1SBF A;  3JD7 1;  1QJF A;  2ZJC A;  4ERO A;  2QQK A;  2XWB B;  2WO7 A;  4JC1 A;  4LKF A;  4KWU A;  4K9S A;  4RFR B;  3LDB A;  4DEV A;  2D3R A;  2AEN A;  1DQ0 A;  1GP5 A;  4MAD A;  3JXS A;  2V72 A;  5JI7 A;  3AKR A;  4P9L A;  5CG9 A;  2XGX A;  1TME 3;  4XXA A;  2VBD A;  3FHA A;  1RUF 2;  2H6B A;  5E1R A;  5FY7 A;  1GP4 A;  2WII B;  1QQP 3;  1OD3 A;  1C28 A;  1HDK A;  2BUK A;  4P08 A;  4PF5 A;  2ZAA A;  3MLL A;  2JDN A;  4EQV A;  3OBT A;  4FQ4 A;  1C5H A;  4JX0 A;  2ARC A;  4IEP A;  4P02 B;  3U1X A;  2OW4 A;  4EZ4 A;  4XAC A;  4IEO A;  1TZO A;  1RUF 3;  3MHZ A;  2YFZ A;  2ZEZ A;  4GMP 1;  4JZR A;  4LKS A;  4QX8 A;  5FLH A;  1QJX 1;  4RYD A;  4BB3 A;  4D69 A;  5EHD A;  1OC1 A;  4ISQ A;  3BB6 A;  2K0G A;  1V6O A;  3CU7 A;  5F3G A;  3RZG A;  2JEN A;  3H3L A;  3K77 A;  4WM7 C;  1HN0 A;  1OQ1 A;  3A22 A;  1JN2 P;  3WR0 A;  1RUC 1;  5DZG A;  1PZ8 A;  3ST7 A;  1I1E A;  2W46 A;  4WM7 B;  4C90 A;  5LRS A;  1MVE A;  4S2G A;  2G9F A;  5EZW A;  2Q8D A;  2B42 B;  5T5J A;  4MGT A;  1RIN A;  2VTX J;  4FBF A;  1FYU A;  1W6N A;  4CCJ A;  4B1M A;  2RM2 2;  2WLQ A;  3CF6 E;  5CG8 A;  5FZ8 A;  4QQP A;  5A1L A;  4HVQ A;  3GGL A;  4CP0 A;  4WM8 C;  1LOG A;  2D6L X;  2YUE A;  2VNG A;  4KG8 A;  4UWD A;  3SKV A;  3SEP A;  4AQT A;  4K40 A;  3H50 A;  3K3O A;  4GH4 A;  5DDJ 1;  4WM8 B;  3ATG A;  3O0V A;  2XBO 2;  4MO3 M;  3BVC A;  2RM2 3;  2D7F A;  3ZFF B;  1VAV A;  4HL0 A;  3W59 A;  2D6O X;  2WS9 1;  2IC1 A;  3IAQ A;  3ZOI A;  1CPM A;  4AFD A;  4XFC A;  3T2Q A;  2LUW A;  1EYB A;  5JLV A;  4K8F A;  1C57 A;  2VM9 A;  2UUR A;  2WZ8 A;  3JBG 1;  4M3C F;  3USS A;  5IAX A;  4ATE A;  4YZ1 A;  3U75 A;  2QBX A;  1F35 A;  3NJV A;  2VZT A;  5LA9 A;  2E32 A;  4CDU C;  4Q8K A;  1UZV A;  4CEW A;  3ASI A;  5LEJ A;  3GBF A;  2SBA A;  5I8Y A;  2DUR A;  5FUI A;  4QMA A;  4A6S A;  2WQZ C;  1VLN A;  5ABJ C;  5FWE A;  4IL7 A;  4CDU B;  3ZXK A;  3FWE A;  1PMH X;  2NPI A;  2Y6K A;  4AHX A;  3H3Z A;  3FN9 A;  5FKC A;  5L9B A;  1F4H A;  5ABJ B;  2HWB 1;  2IWG B;  2WFP A;  3HJR A;  3QAC A;  2FD8 A;  2G9G A;  2RMU 3;  2AR6 A;  3KB5 A;  2XQR A;  1FMD 2;  1UZY A;  1VBB 1;  4BLI A;  2FDI A;  1ST8 A;  3SIS A;  4E9K A;  2FCV A;  2GND A;  3WP5 A;  1ENQ A;  2XUM A;  4Q5O A;  2PAK A;  3R4U A;  4PIY A;  3BIW E;  5FMD A;  4XVH A;  1AR6 1;  3MW3 A;  2P3K A;  2A73 B;  1DG6 A;  4XUN A;  4O65 A;  1LHU A;  2QNK A;  2VTF A;  1R08 2;  3TNP B;  2P34 A;  4Y20 B;  1GBG A;  3MFA A;  4N43 C;  4BME A;  3VBU A;  2Q0A A;  4EWD A;  4BIO A;  3K51 A;  5KXC A;  5HI0 A;  1KQR A;  2ZBJ A;  4N43 B;  1FX5 A;  3OB8 A;  1G86 A;  2PHW A;  1V9U 2;  2JDU A;  3C7O A;  1R08 3;  5DUV A;  4CRQ A;  1OA2 A;  4GWM A;  1BEV 2;  3AP7 A;  2YC2 A;  5FZM A;  1XU1 A;  1HRI 2;  2VGD A;  3ZFF A;  1LU1 A;  2GC0 A;  2I07 B;  3NV3 A;  4AOC A;  4XJ9 A;  1NCQ A;  1OA4 A;  4AQ2 A;  2XVG A;  4LEJ A;  3C2U A;  1YQC A;  1V9U 3;  1J59 A;  5EFU A;  2P2K A;  1ULC A;  2ZGT A;  2XON A;  1BEV 3;  3RVH A;  4B1L A;  1HRI 3;  4OI2 A;  2CWM A;  4QHB A;  3O5S A;  4V1P A;  5A80 A;  2AAC A;  3WW2 A;  5A3L A;  4I0A A;  1D4M 2;  4Q0P A;  5GKA C;  4LOT A;  1B35 C;  3OBR A;  5GJ6 A;  3G7D A;  5J96 B;  3LFM A;  5FJH A;  2WQ8 A;  4YFZ A;  5CEH A;  1VMF A;  1QGL A;  2IUW A;  3ZM8 A;  4URA A;  1H2L A;  5FZI A;  1QKQ A;  3OGS A;  1B35 B;  4BCU A;  5KXD A;  1W6Q B;  1ZRD A;  4H3W A;  1S4C A;  4JDO A;  3M7A A;  2WFF 2;  3VBH A;  5SV8 A;  4CZS A;  1PVX A;  4PI2 A;  3GAL A;  4KI5 M;  2VZ1 A;  3TEY A;  4FTE A;  4HFS A;  3EB7 A;  4NIH A;  4LJH A;  5F32 A;  5FP8 A;  2Y0I A;  4LLO A;  1VBE 3;  3IDE A;  1GU3 A;  5FZB A;  2JE7 A;  3UKV A;  4BU2 A;  3RYR A;  2VD7 A;  5FZK A;  4GXL A;  5DAW A;  5FKB A;  3WY6 A;  3GCX A;  4PBO A;  1GQG A;  1VBD 2;  1NX9 A;  1RGS A;  2XL7 A;  1DLC A;  1ASJ 2;  2HLE A;  2Y26 A;  3LE0 A;  1BBT 1;  3ZYR A;  4D6Q A;  4I30 A;  5AC9 2;  3A21 A;  3M3Q A;  3B00 A;  5GM0 A;  3W5N A;  1I5Z A;  3NV1 A;  1PMI A;  2VBP A;  3GHM A;  3VD9 A;  1G6N A;  1OFS A;  3Q8E A;  4Q4X 2;  1CIY A;  4JGY A;  1CX1 A;  5C8C C;  5L7O C;  2VOT A;  1VBD 3;  3ZMO A;  1ASJ 3;  4HT1 T;  5CKQ A;  3ZDS A;  3DYM A;  1QIQ A;  2Y34 A;  4WV8 A;  4XJZ A;  3P6B A;  5FYY A;  5AC9 3;  5C8C B;  5L7O B;  3VHP A;  1MPX A;  1W6O B;  1SLA A;  4Y1Y A;  1MQT C;  4Q4X 3;  1OQD A;  1IS6 A;  1CAV B;  2HEV F;  5C71 A;  3GXU A;  2C1F A;  4Z2W A;  4F3J A;  1V6K A;  3RYP A;  2QQL A;  1VE0 A;  4XCA A;  4XHX A;  1OVP A;  3UK9 A;  4AVC A;  4BQ5 A;  4IER A;  4ISR A;  4Y4Y A;  2B7Y A;  2O0O A;  1WW4 A;  3CO2 A;  1CJD A;  5FIX A;  4GZ9 A;  3U37 A;  5BV6 A;  1QXP A;  3WNK A;  3T0D A;  3MZH A;  1W6P B;  2QTW B;  3AC0 A;  4NID A;  1WLW A;  4ARX A;  1JU3 A;  1W3V A;  3VLB B;  2HBT A;  1W8T A;  1UZ0 A;  4COW A;  3JZV A;  2G1M A;  4GAL A;  2GNT A;  2K46 A;  1RUH 1;  2LRO A;  1ODM A;  1DYK A;  4FXG B;  5H9Q A;  4CXW A;  1FV2 A;  3I3E A;  5C9A A;  3PHM A;  1TE1 B;  4NRQ A;  5AFE A;  2XB6 C;  1XNK A;  4DO0 A;  4AI2 A;  2WR9 A;  4YZ3 A;  3MIG A;  4WVZ A;  3DYO A;  1UZZ A;  2X5I B;  1CON A;  4H7M A;  1TNF A;  2RS3 2;  1V6N A;  5KBF A;  2DFC A;  3PUS A;  1RUD 1;  3WOG A;  3EQE A;  5H9P A;  4YZ2 A;  3THP A;  4XFB A;  5GZC A;  4XUP A;  2QQU A;  1E5I A;  2VEC A;  5CU1 A;  1QNW A;  4BXS V;  3OUJ A;  2RS3 3;  1PNG A;  4KWK A;  4NN0 A;  2VOK A;  2DBN A;  2Q1M A;  3WNP A;  1IGO A;  3S5Q A;  3CDZ B;  1XNT A;  2XJU A;  2PHR A;  1HIX A;  3F2Z A;  1V6I A;  4PHZ A;  5DUU A;  5GZF A;  3SHR A;  3UES A;  3MF9 A;  4NIG A;  3IDB B;  3B69 A;  5BUV A;  5J7M A;  1GV9 A;  3PUA A;  2BGP A;  4XF1 A;  1OOP A;  2WBK A;  1H8V A;  3OSD A;  3PLQ A;  4Q29 A;  1A8D A;  1CAU A;  2BWC A;  3CL1 A;  3JD7 3;  4QDS A;  5DMY A;  4PT6 A;  2PHF A;  1J84 A;  1UO9 A;  5A3O A;  1PK6 A;  1W8W A;  4FPE A;  1S2E A;  3MW4 A;  4QX0 A;  3AL5 A;  2VCA A;  3CMG A;  4IV1 C;  4DQA A;  1FI2 A;  2DDU A;  1R09 1;  3OPW A;  4I2O A;  4BMB A;  1WZX A;  3VHN A;  3ELN A;  1GOF A;  4L2N A;  5FY9 A;  3WP6 A;  1PM7 A;  3AJZ A;  3SH3 A;  3III A;  3AX4 A;  4XIO A;  3KT1 A;  4HPK B;  1QJX 2;  4KQ7 A;  3ETP A;  5HCA A;  1HB2 A;  1K5M A;  1W6P A;  4KMQ A;  1BJQ A;  2OXB A;  4CPB D;  2OX0 A;  1RVF 2;  2BFU S;  2W5F A;  4CCM A;  3WDU A;  3IB3 A;  4GMP 3;  3ZXL A;  1QJX 3;  4XPV A;  5CAD A;  1RUC 2;  4LBL A;  2X5I A;  1CJP A;  3O14 A;  3WQ1 A;  4YG6 A;  2FDH A;  1W05 A;  4N9H A;  3HWJ A;  2IVJ A;  4ASL A;  5FYH A;  1CX4 A;  2HWF 1;  2Y38 A;  5KHH A;  4CP9 B;  3OBZ A;  1AJK A;  4A3Z A;  2B4K A;  2R1D A;  5FY0 A;  1FV3 A;  1AXY A;  3KVA A;  1GNH A;  1JW6 A;  5FQ0 A;  3B3Q E;  1AJO A;  4QWN A;  1ZBE 1;  1SZB A;  1RUC 3;  5T5O A;  4AGG A;  1AZD A;  2ZGL A;  4FOQ A;  4Q0V A;  1XRU A;  1ENX A;  2A70 A;  1MZ5 A;  3LOB A;  5DDJ 2;  4NWV A;  4B4Q A;  4AED A;  3B93 A;  3WUC A;  1W9F A;  4NRO A;  5F5A A;  2A3W A;  1F15 A;  1S2K A;  2WS9 2;  1F5J A;  3IBM A;  4UFL A;  1GOG A;  2ID4 A;  1JTZ X;  3TEW A;  4IE6 A;  3UJQ A;  4O7X A;  1JZ3 A;  1JU4 A;  4E4Z A;  4MG2 A;  3OD0 A;  5DDJ 3;  5FZD A;  1NOV A;  5CB7 A;  3JBG 2;  5J37 A;  1RB8 G;  4X8P A;  3NNM A;  4BK5 A;  4FSJ A;  2QDN A;  4DXZ A;  4MHR A;  4ZZ8 A;  4CDW C;  4Y1U A;  4GUL A;  5BNP C;  2WS9 3;  5I93 A;  3RJ2 X;  2OT7 A;  1UXZ A;  3I2G A;  3KV4 A;  2IFR A;  3WG4 A;  4PQQ A;  1NA1 A;  3IDA A;  3WHU A;  4CDW B;  2QQO A;  3AMQ A;  1NE4 A;  4K1Z A;  3JBG 3;  3TBD A;  3M3I A;  3TOJ A;  1QH7 A;  2RJL A;  2A3Y A;  2ZX3 A;  4RQP C;  3CEW A;  5I0U A;  1LU2 A;  4IW3 A;  2HWB 2;  1SFP A;  2DVF A;  1WD4 A;  4UF0 B;  3UJO A;  5B4N A;  2VMC A;  3KD4 A;  1VBB 2;  2AEZ A;  5HXM A;  1E57 A;  2D6N A;  3I7D A;  5FMO S;  3RSJ A;  1KRI A;  1KDM A;  4R4Z A;  4ZU7 A;  2O14 A;  3LCP A;  4UBH A;  4JHZ A;  3MFC A;  3MID A;  4AI1 A;  4D7S A;  3KV5 A;  5E16 A;  5K4L A;  1DGL A;  5A7S A;  1VMH A;  3DCQ A;  2HWB 3;  3DPR C;  1RUG 1;  1JOD A;  2JIJ A;  1PZ7 A;  2Y6H A;  5FY1 A;  1PGL 1;  1VBB 3;  1RTV A;  2YPJ A;  3N9Q A;  4Q26 A;  3U14 A;  5FAX A;  2PHX A;  1PNF A;  4NHK A;  3DPR B;  4YVW C;  1XYN A;  3SCG A;  4XIK A;  4CP9 A;  5JOY A;  5F5Q A;  5F2S A;  5GLT A;  1AX0 A;  2V5D A;  2IXC A;  2ADD A;  4YVW B;  4HBN A;  1AR6 3;  2BEO A;  4GB3 2;  3WDX A;  1K12 A;  1XOY A;  4Y1X A;  1CGP A;  2JDZ A;  3HAG A;  1L7Q A;  5T52 A;  5CFC C;  3LA2 A;  2WLP A;  3B9I A;  4L92 A;  2GN7 A;  3DUI A;  2R0F A;  5J48 A;  3OG2 A;  2CYF A;  4YYO A;  3N36 A;  2CAV A;  2QFE A;  3GF6 A;  4TWT A;  2YDE A;  2VTX A;  5G05 L;  2VUC A;  1TEI A;  4E8C A;  4MET A;  4B4P A;  4DEQ A;  1UAI A;  2VZV A;  3IIA A;  5BYN A;  4BQY A;  1UQX A;  2JEC A;  3FBM A;  2GN3 A;  2JG8 A;  1O8P A;  1PX3 A;  1HV1 A;  2X8K A;  1REE A;  3I2K A;  4LO8 A;  3O1R A;  4F8A A;  4YW7 A;  1AXZ A;  4KBB A;  2BQP A;  2VUJ A;  4MGY E;  2WRA A;  1C1L A;  4AAP A;  3AXD A;  4NO4 A;  1LOF A;  1W9S A;  1Z7S 1;  3ZYB A;  2GP3 A;  4RN5 A;  1LAJ A;  3VD3 A;  1NXM A;  4JQT A;  1H8T C;  2FMY A;  3Q8A A;  4D94 A;  4QX7 A;  1AL0 G;  2VQU A;  3K75 B;  2W1S A;  1LGN A;  3R0R A;  4MXW B;  1W2N A;  2VC9 A;  2VQT A;  2OQ6 A;  3I3Q A;  5FTT C;  4IEY A;  4M3C E;  4JHT A;  3BGA A;  5BNN C;  2UY9 A;  2XUE A;  1OF3 A;  5FYZ A;  2OUJ A;  1W9W A;  4LKD A;  3CNA A;  4XUT A;  4CUC A;  1UY4 A;  3LA3 A;  5BNN B;  3F95 A;  1BBT 2;  1XND A;  5IWF A;  3W21 A;  1DFQ A;  4NPR A;  5FZH A;  5FXX A;  1US2 A;  2XR4 A;  3R4S A;  2VQ0 A;  5FYV A;  1ZZC A;  3HNY M;  4ZY9 A;  2DCY A;  3UKT A;  3BTA A;  3WW1 A;  2IFW A;  1WD3 A;  4JGZ B;  3RJR A;  1BBT 3;  2VBB A;  2ZX0 A;  4PDW A;  5I0R A;  2VOW A;  1K3I A;  1YLL A;  3SEE A;  5LEK A;  1YEW A;  4LHS A;  2D6P A;  3ILR A;  1NLS A;  1XE8 A;  5ERL A;  3VDD C;  2UU8 A;  2GU9 A;  3JCI A;  4MV2 A;  1GLH A;  2E51 A;  5IFT A;  2XBO 1;  2GP5 A;  3HQU A;  3OY8 A;  4P5H A;  3J7N A;  3NNL A;  4UYB A;  4W6Y A;  3VDD B;  4KWJ A;  2WNO A;  4HSJ A;  2JJ6 A;  4XDQ A;  2PYT A;  4RR3 C;  1HJG A;  1JI6 A;  2JB8 A;  3BTY A;  1DF0 A;  3WCS A;  2YGM A;  2BFU L;  1UOB A;  1YI9 A;  1POV 0;  3U4X A;  4RR3 B;  4BYY A;  1PGW 1;  5CKN A;  4L8Q A;  3TWI A;  1RUH 2;  4MXV A;  3S7I A;  1AX2 A;  4AWD A;  2VNV A;  4LHL A;  3RZH A;  1G8W A;  3EYP A;  1O4Z A;  2P6C A;  2QQM A;  1C1F A;  2DVB A;  4IXL A;  4AVT A;  5FPV A;  2XJS A;  3I2I A;  3WXP A;  3WG1 A;  1CR7 A;  5DQ0 A;  4MXW A;  1RUH 3;  5JMC A;  2A71 A;  1RUD 2;  2XML A;  4F83 A;  2W95 A;  3D5O A;  1MZE A;  4H7L A;  3HQR A;  2NQY A;  1FMD 1;  3U0Z A;  4QPY A;  3SCH A;  3T08 A;  1H2N A;  4LO6 B;  4E4H A;  2E6V A;  3PU3 A;  4XDP A;  3I8T A;  5DUX A;  3ZFE C;  4ASM B;  4FPH A;  2C6S A;  3VV1 A;  4YW2 A;  3ZN4 A;  3J4U H;  2OZJ A;  3IT8 A;  3H3U A;  2FMD A;  1DYO A;  1RUD 3;  3ZFE B;  4G4F A;  3T1M A;  4CUA A;  3WV6 A;  3M2M A;  4BHP A;  3VBO A;  4J6G A;  4DY3 A;  2VR4 A;  3MBW A;  4X8N A;  4BQX A;  1T6B X;  4PLM A;  4XZU G;  4Y33 A;  1GSL A;  5F6K A;  4JGZ A;  1JBC A;  5L73 A;  1E5S A;  5FP9 A;  4E27 A;  4M0N A;  3USU A;  1Q8S A;  1MAC A;  2VUD A;  3A0K A;  3CQO A;  3GJA A;  5EYX A;  1G9B A;  1JHN A;  1UIJ A;  3K46 A;  1NG0 A;  2VMD A;  2CY6 A;  3N9M A;  3B5L B;  3DEC A;  2HEY F;  4QPI C;  2YRO A;  4Y4R A;  4BLJ A;  3E97 A;  1R09 2;  4QXB A;  2HYK A;  4QPI B;  4A44 A;  1JMU B;  3P3P A;  1BEV 1;  3M3C A;  4HKO A;  5C8W A;  4DY5 A;  2JEM A;  3NL1 A;  4XAA A;  5FRE A;  3ZX7 A;  3POS A;  5FMO L;  5FY5 A;  3POI A;  3ZVX A;  3AKT A;  1R09 3;  1UIK A;  1VPH A;  2FDF A;  2YC4 A;  5E6H A;  3VD7 A;  1YI7 A;  4AG4 A;  2BER A;  1CES A;  4QX2 A;  3T1L A;  4K8R B;  4KNC A;  1AXK A;  1D4M 1;  3H7Y A;  3JQX A;  4XFG A;  3D8C A;  1J58 A;  5DXD A;  2CU5 A;  1CPN A;  2PHU A;  3EMR A;  3KF5 A;  1DZQ A;  2O8Q A;  3PVE A;  4CEY C;  2QDR A;  1APN A;  2B39 A;  5T5L A;  2NP0 A;  4CUB A;  1JZ8 A;  1O4T A;  4CEY B;  2ILM A;  5LA0 A;  2DVG A;  2Q5T A;  4FPC A;  4Q2F A;  5LWB A;  2WFF 1;  2X09 A;  1MS9 A;  3B94 A;  3OJB A;  3BU7 A;  1XSR A;  1ZBE 2;  1LOD A;  1VBC 1;  5ANN A;  1S2B A;  3JQW A;  1NZC A;  1QOT A;  2ZGN A;  1XB9 A;  2CGN A;  3FE5 A;  2HWF 3;  5KC5 A;  1F8V A;  3DEM A;  3PL0 A;  1H2M A;  2WSV A;  5T55 A;  1H0B A;  4FFF A;  1ZBE 3;  1UY0 A;  3MUY 1;  5JPM B;  1YFW A;  4RFT 0;  3H42 B;  2Q8E A;  2WWU A;  2Z5W A;  1TVG A;  5JZG A;  4C0B A;  2XDV A;  2W9X A;  1CAW B;  3V0B B;  3PJQ A;  3O1O A;  1GIC A;  3WSO A;  4QGN A;  1LGC A;  2J1E A;  3S6P A;  1FAT A;  2XJT A;  4RGA A;  4JRA A;  2GAL A;  5EXO A;  4XMA A;  4OQ8 A;  3O1T A;  1ZRE A;  3ZLI A;  1CVN A;  3AKS A;  4HN1 A;  2ARX A;  2PFW A;  1IPS A;  3GBG A;  3JU9 A;  4MYE A;  5FMC A;  2G4I A;  1R1A 2;  5FZ6 A;  1OHF A;  1Y9Q A;  2J1A A;  2V4V A;  1MS8 A;  2Y6J A;  3IM0 A;  1HKD A;  1Z78 A;  5D1I A;  5BNO C;  4OVE A;  4QXH A;  4IV3 C;  4RA0 A;  4UFI A;  5JSO A;  4XFI A;  2ENR A;  3LQC A;  2UWB A;  4OUS A;  5EWS A;  5IUQ A;  3GZE A;  5BNO B;  2QQJ A;  3ZKY A;  1LJ7 A;  3ZYH A;  3CHX A;  1RUG 2;  1NZI A;  3OYW B;  4XQD A;  4LKE A;  1PGL 2;  1FOD 1;  3DXT A;  2WO3 A;  4I09 A;  2WNU C;  3DXU A;  2ADE A;  5A7W A;  5EV7 A;  4FFH A;  5T50 A;  2WNU B;  4UW6 A;  3DN7 A;  3KF3 A;  3O7O A;  1A3K A;  3T4V A;  1RUG 3;  2RDR A;  3OGJ A;  4TXW A;  1BQP A;  4COY A;  1RIR A;  1M06 G;  4EWA A;  2WT2 A;  4QQ2 A;  5FUN A;  2P3J A;  4XTM A;  2GMM A;  1SPP B;  1KFU L;  1GZC A;  5C4W C;  4Q4W 1;  1I6X A;  5IK7 A;  3LPG A;  1W9T A;  2H0B A;  4FXK B;  5KHI A;  3VDB A;  5C4W B;  1BK1 A;  2RR1 1;  2P3Y A;  2YBK A;  5JI9 A;  3PIG A;  2EIC A;  3ABZ A;  5HV4 A;  1Y4W A;  5J3U A;  5JIU A;  3H7J A;  3INA A;  2P5B A;  4JRL A;  5DZE A;  5TSW A;  3KVB A;  3AM2 A;  2DV9 A;  4IEW A;  3SKJ E;  3PTY A;  1RUJ 1;  2WWS A;  3B7M A;  3N7K A;  3N9N A;  2VOV A;  4QPG A;  5BNQ A;  2YV8 A;  2DF7 A;  2W2I A;  3CJI C;  2R1B A;  2LTN A;  4YM0 A;  1L7L A;  2MEV 1;  1JYV A;  5JMO A;  2QJV A;  3APB A;  5T3N A;  3FLP A;  1Z7S 2;  2YZ4 A;  3RPQ A;  3T30 A;  3M8L A;  3I2O A;  4LR4 A;  1SDW A;  1UX6 A;  4S2H A;  3ACF A;  3DGT A;  4LE3 A;  4NVP A;  5F3I A;  2GAU A;  5L36 A;  4YM1 A;  1AR8 1;  4FT8 A;  3ZXJ A;  2QQN A;  4XBN A;  5A7P A;  2K9Z A;  4MZU A;  1F2N A;  4E2S A;  1OFN A;  3V0A B;  5CIR A;  2EF6 A;  3AKQ A;  4K21 A;  4I3P A;  1Z7S 3;  5EQU A;  1JYI A;  3BAL A;  2BTV C;  3SH4 A;  2R7E B;  4AGR A;  5KC6 A;  1RVF 1;  2HWE 2;  5JOX A;  5CFD C;  1IG0 A;  1QJY 1;  4IUG A;  4SBV A;  4CA9 A;  1E5H A;  5EIY B;  1BLZ A;  4XET A;  1W2O A;  1RUI 1;  4EN8 B;  1AYM 1;  4DNY A;  2E63 A;  3H8R A;  3J9S A;  2CWS A;  2KXL A;  5FK8 A;  3NNJ A;  2PXJ A;  2YC0 A;  3AZV A;  4O61 A;  4QKF A;  2WWJ A;  4IGP A;  2PTM A;  2BPA 2;  1WA6 X;  2JKB A;  3I3B A;  3VKN A;  2BDR A;  4W4Z A;  2XKP A;  2ZX4 A;  4D3W A;  2PLV 2;  4FQZ A;  5AFB A;  2JDP A;  5IVC A;  2JDM A;  2VCB A;  4MGK E;  5A6Y A;  1T2X A;  5A3W A;  1BVP 1;  2WQ4 A;  2RDN A;  5FZ9 A;  5ACA 1;  4GKY A;  5JSR A;  1JZ2 A;  3AZW A;  2GDF A;  3E6C C;  2F17 A;  4MGS A;  4XBQ A;  4AI3 A;  2ZAB A;  4ASK A;  2TBV A;  2Z2S B;  4UT5 A;  4COZ A;  1DHK B;  3KV6 A;  2GNM A;  4IEZ A;  4B8E A;  1PGW 2;  2Z42 A;  2XBO 3;  3ENR A;  1W28 A;  2JX9 A;  1GZT A;  2PA7 A;  3QH6 A;  1WLD A;  2PHT A;  4P9Y A;  1NQJ A;  1SFN A;  1UU5 A;  3J26 N;  4YFW A;  1GZW B;  1AVB A;  5FPB A;  2XLF A;  1LNS A;  1DU3 D;  1ZRI A;  2ZGM A;  1ULP A;  3POB A;  5LB6 A;  4LO5 B;  2QQV A;  3HN1 A;  2E7Q A;  2VMG A;  4YGC A;  3V0A A;  1RL3 A;  2IXH A;  4R52 A;  5B2G B;  1WMD A;  2VH9 A;  5C5T A;  4FP3 A;  1UMZ A;  3J7L A;  3BKZ A;  3UGG A;  1ZRF A;  4BQ2 A;  1POQ A;  3QH7 A;  3FFQ A;  5KR7 A;  3DKQ A;  1WUV A;  2ZGR A;  3VKL A;  3MO4 A;  3IPV B;  2D5H A;  1LEN A;  4PIZ A;  1FMD 3;  3W20 A;  4EN0 A;  3BPZ A;  2FBE A;  4WM7 A;  2WA3 A;  2IZW A;  1S0G A;  3H1M A;  1BVV A;  1UF2 C;  2Z69 A;  3PDQ A;  1US3 A;  1DCS A;  5IVJ A;  1IPK A;  3KCC A;  3CKH A;  1SDD B;  4AVB A;  1XQN A;  4GB3 1;  5IJR A;  1RJ8 A;  3N9L A;  5IK5 A;  3JB4 C;  4WM8 A;  2QVS B;  2ES3 A;  1C8M 2;  1LOE A;  1W03 A;  4NPL A;  5A7N A;  4BPZ A;  1ND2 C;  2B8M A;  5LRR A;  4H14 A;  4M4P A;  4GAZ A;  3BOP A;  1ZX5 A;  5FFO C;  4BJ0 A;  3PUQ A;  3J7M A;  4UW5 A;  2GME A;  4NAO A;  4R9C A;  1ND2 B;  1QJU 1;  1SLT A;  2A3X A;  3ACG A;  5D21 A;  1GZ9 A;  1PIV 1;  2Y33 A;  4HK8 A;  2VZP A;  1C8M 3;  2NN8 A;  2Q1F A;  1N1T A;  1QNY A;  4R9B A;  2VMH A;  2WYS A;  3N35 A;  3BTX A;  1NCR C;  2GSY A;  3QLQ A;  1QMJ A;  4PLN A;  4U36 A;  3WF2 A;  2IXL A;  4NMI A;  3T3Y A;  4XAE A;  3RZJ A;  1GZW A;  1W6M B;  2E7A A;  2AC1 A;  4IE0 A;  2C24 A;  4C0H A;  2OYZ A;  2EAL A;  2WYF A;  4CDU A;  1NCR B;  2NM1 A;  3BOW A;  4BQ1 A;  1VBA 1;  4RS5 C;  3SCF A;  1W8F A;  4FOY A;  5H9S A;  5H9R A;  4PI0 A;  1D4M 3;  4A42 A;  5ABJ A;  2IXK A;  4RS5 B;  5A6Q A;  2ATF A;  2WNE A;  3VBF C;  4CCD A;  4OHV A;  1VBC 2;  5M0T A;  2C4X A;  1UPS A;  2BVB A;  4MX3 A;  4DRV A;  3ZIX A;  5A3P A;  3TEZ A;  3RQ0 A;  1CN1 A;  2MPF A;  4QXK A;  5JOW A;  2EXH A;  4ZON A;  2WFF 3;  2XJR A;  2WAO A;  5KWR A;  3IPV A;  3ILN A;  3RI8 A;  4CDX C;  4QQL A;  1VBC 3;  3WD5 A;  4XJW A;  4FO9 A;  4B7E A;  3EHK A;  1UKR A;  2D93 A;  3ZN6 B;  1X8E A;  3FX3 A;  4MH0 E;  4Y20 A;  4AEM A;  1HRV 2;  4CDQ C;  2QQP A;  2YU2 A;  4QX1 A;  4CDX B;  4DIN B;  3BU0 A;  2NZ9 A;  3DF0 A;  1H4H A;  2GC3 A;  3WG2 A;  5DG1 A;  1ND3 C;  5A7Q A;  3FHI B;  3WNX A;  3MIC A;  4JKM A;  1IKQ A;  4OI1 A;  4N43 A;  3VDC A;  1BMV 2;  4Y5T A;  3LAG A;  1IOA A;  1ND3 B;  3H1W A;  4GWJ A;  4RHV 1;  3T09 A;  3THT A;  2ZPX A;  2AZ5 A;  5T54 A;  1D2S A;  3ZXA C;  4F7Z A;  1D4V B;  1Q5O A;  1FNZ A;  1KJR A;  1MQT B;  1W2T A;  5JXJ A;  4OHX A;  4Q27 A;  2I74 A;  4XW3 A;  4D6S A;  1O8S A;  1SCR A;  3ALQ A;  2VUA A;  2BGO A;  4UAP A;  4W50 A;  4MHU A;  4Q0Q A;  2GC1 A;  1OKO A;  2W39 A;  4YGB A;  1HQW A;  1JHJ A;  1YCI A;  3WHT A;  4WVW A;  1W90 A;  2ZEY A;  5GLU A;  1W6M A;  1FOD 2;  2A6Y A;  4AF9 A;  1BKZ A;  2KM2 A;  4UFH A;  1XE0 A;  1B35 A;  2P1B A;  4XFH A;  1W6Q A;  4I01 A;  4DXT A;  3SLI A;  3WF1 A;  2VZS A;  3MI8 A;  4BK4 A;  1UU6 A;  2LAL A;  3I3M A;  1WLC A;  2XKO A;  2LM3 A;  4S2F A;  3SH5 A;  1MS4 A;  2W1W A;  4X6Q B;  3HOB A;  2W94 A;  2Y64 A;  1FOD 3;  4I0B A;  4HK9 A;  1NY7 1;  4ZXE A;  4D6R A;  4E2G A;  1D0G A;  4BM8 A;  5E8A A;  1FT9 A;  4QKN A;  1OVS A;  4Q4W 2;  2ORZ A;  2BNO A;  2Y6G A;  4GIQ A;  4JAA A;  1GKB A;  3S5A A;  1FNY A;  1U0A A;  4XFF A;  5A6X A;  3VZN A;  3GHN A;  1O5L A;  1O3Q A;  5EJZ B;  3ZXE A;  2JWP A;  3WCR A;  4Z07 A;  2RR1 2;  3QD6 A;  2YXS A;  4FFG A;  2ARE A;  5CYY A;  4RGG A;  3IDC B;  2J1S A;  2OVU A;  1MS1 A;  4YWA A;  3GDB A;  4Q4W 3;  2GMP A;  5FDB A;  3O1S A;  2XVK A;  4YVS C;  4ZU4 A;  1RUJ 2;  3PVO A;  4N8M A;  4Y26 A;  3LZZ A;  5F9T A;  5C8C A;  5L7O A;  1RHI 1;  1RUE 1;  2BV4 A;  1W6O A;  2N7G A;  1T6G C;  2E31 A;  2RR1 3;  1XNA A;  4QB6 A;  4YVS B;  2MEV 2;  1CAV A;  4Z82 A;  4DS0 A;  4AHW A;  4BOW A;  3OGV A;  2OKX A;  1A78 A;  1MQT A;  4IV1 B;  1RUJ 3;  2HEW F;  2C9A A;  3BYW A;  3VD5 A;  2FZ1 A;  3NJZ A;  4RL7 A;  2E9Q A;  3NV2 A;  2AYH A;  1AR8 2;  3SC7 X;  2D6K A;  3LWC A;  1HB1 A;  4TZD A;  2Y8K A;  2A1X A;  3ZXD A;  1VJ2 A;  4A41 A;  2MEV 3;  3ZXG A;  1DIW A;  2A7A A;  1URX A;  1ZM1 A;  4YGD A;  3WW3 A;  2VE1 A;  4DIQ A;  3O12 A;  4IE4 A;  3ILF A;  5FP7 A;  3AB0 A;  2XOM A;  3CZJ A;  3MIE A;  1H4G A;  2RJ2 A;  4I0W B;  4NR1 A;  1JYX A;  3RZL A;  2DYC A;  1HXS 1;  1Q8Q A;  1AR8 3;  1QJY 2;  2EAK A;  1WCQ A;  1PHM A;  3L2Y A;  3EBR A;  5FZ0 A;  5KXB A;  4I02 A;  4ZU5 A;  1KGY A;  1O3R A;  1RUI 2;  2HH9 A;  3RZK A;  1AYM 2;  5HCB A;  5CIS A;  4OZO A;  3TB0 A;  1X36 A;  3C7H A;  1RVF 3;  2DTY A;  1QU0 A;  4NRM A;  4C8D A;  2LRP A;  2CHH A;  1QJY 3;  3FLT A;  3OOX A;  3WF0 A;  1F5F A;  3MDP A;  5FZ7 A;  4KG0 A;  5T5P A;  4DZG A;  3KSC A;  3WQ0 A;  4B4R A;  1QOO A;  5DZF A;  4XYX A;  4C1W A;  1RUI 3;  2RS5 1;  1JZ4 A;  3N9P A;  1AYM 3;  4Y3O A;  1KJL A;  3TNQ A;  3VUO A;  3UT0 A;  2EXI A;  4RGK A;  1H9P A;  4M3C B;  4YW5 A;  2P3I A;  1PMJ X;  5I8S A;  4LOS A;  3VHO A;  5ACA 2;  1C4R A;  3TRS B;  4AZZ A;  2E33 A;  2BNN A;  3Q9O A;  3HEI A;  4HLT A;  4KH9 A;  3K4Z A;  4E8D A;  1JS9 A;  3T2P A;  3IN9 A;  1IS3 A;  1CZT A;  4BQW A;  4BQ3 A;  2DCT A;  2F6B A;  1UNB A;  2QKD A;  1LCL A;  5IVB A;  4M01 A;  5ACA 3;  3N7J A;  1UL9 A;  1VAM A;  3N7L A;  5FZ1 A;  3ZSJ A;  2FDJ A;  1UN1 A;  1MS3 A;  3K3N A;  4YSF A;  4LIV A;  1YHF A;  1QEX A;  3WG3 A;  5BNP B;  4IV1 A;  2JG9 C;  1QXJ A;  1JYW A;  4GA9 A;  4ZS3 A;  3O0X A;  2W1U A;  2YMZ A;  4HPK A;  1R1A 1;  4D0Q A;  2R06 1;  2C9K A;  1VAL A;  1S0E A;  1HJF A;  1RC6 A;  3A7Q A;  1STM A;  2OA2 A;  3PUR A;  2BVV A;  4FPK A;  5BXX A;  4AR2 A;  4UW4 A;  3TYJ A;  4RQP B;  4IND A;  3UKN A;  3Q8B A;  2WZE A;  3MIH A;  4LIT A;  5FZ4 A;  1BHG A;  3NAP C;  5FZG A;  5LBB A;  4Q4V 1;  2WKK A;  1AHS A;  5HV0 A;  4CCE A;  4TLF A;  4A6O A;  2XLG A;  1FXZ A;  5LAS A;  2X29 A;  3ROU A;  4JVA A;  3POJ A;  1MZF A;  3QCW A;  1X82 A;  2J7M A;  1OH3 A;  2YY1 A;  5C3P A;  4E4S A;  1NAE A;  3LEG A;  1WKY A;  5CBL A;  4QX3 A;  3U10 A;  2DUO A;  5LAT A;  2UYB A;  2XJV A;  2D5F A;  2EAA A;  5CNA A;  4P14 A;  5FO9 B;  2PAE A;  4WVM B;  2VW1 A;  3UYJ A;  4Q4Y 2;  5LK5 A;  3WT3 A;  2ZEW A;  4M00 A;  4M3C A;  5EJ1 B;  1Q43 A;  2DBI A;  5G04 L;  3BOD A;  2QQI A;  2J1T A;  5A3N A;  5CFC B;  2Z79 A;  2OQ7 A;  4GB3 3;  4OUL A;  2A6X A;  4X6R B;  1YFY A;  3NWK A;  4Q4Y 3;  2XPJ A;  1QJU 2;  3RWN A;  1Q3E A;  4CU6 A;  2YB7 A;  1UPI A;  1PIV 2;  3LDR A;  2BGC A;  4HVR A;  4Y5S A;  2HYX A;  4O9G A;  1WME A;  3AVS A;  4OHZ A;  2BJS A;  4CPB A;  4LUL A;  1NKG A;  1IHM A;  3LEM A;  1WW7 A;  1UOJ A;  4D8M A;  4CDW A;  1QJU 3;  1KS5 A;  3OGG A;  2B5H A;  3KLS A;  4CCO A;  1OLR A;  5BNP A;  4JKK A;  2HWD 2;  1PIV 3;  1VBA 2;  5CZK A;  3ZFG C;  3MGU A;  3RYK A;  1OKQ A;  2XL9 A;  1LB2 A;  1KEX A;  1Y3T A;  4QPW A;  3D82 A;  4I3G A;  4HKW A;  4UF0 A;  4XCB A;  4Y22 B;  3ZYF A;  3PVB B;  1UY2 A;  3ZFG B;  4MLO A;  3WP4 A;  4GJY A;  2VXR A;  1H8T B;  3KGL A;  4RQP A;  4N53 C;  1OPM A;  2W52 A;  3WNL A;  3POE A;  3MV0 1;  2VNR A;  4CE8 A;  1VBA 3;  4BWO A;  1WCK A;  2ETE A;  3U11 A;  2Q8O A;  4DUW A;  5F39 A;  2LW8 A;  1CWP A;  1POV 1;  2XXZ A;  3HQX A;  1DQ5 A;  2HWE 1;  1SLI A;  1PO1 1;  2JD4 A;  4SLI A;  3VZJ A;  4AFB A;  3KV9 A;  5E88 A;  4XHB A;  3DPR A;  1R1Z A;  4D7Y A;  1SFY A;  3R6S A;  3VD4 A;  2WNV C;  2VNO A;  2IXJ A;  1OH4 A;  2HKX A;  3LB9 A;  4YVW A;  4DPN A;  2FHR A;  3AK0 A;  1S1A A;  2TNF A;  3NW4 A;  3OBA A;  4HN0 A;  5A33 B;  2WNV B;  2VW0 A;  3H8U A;  4K6B A;  4COU A;  1OLM E;  2ZXQ A;  2GNB A;  5DAV A;  4RHV 2;  2XQX A;  1I9R A;  3FUQ A;  1M4W A;  2VW2 A;  2PLV 1;  3LIG A;  4P9G A;  3LKJ A;  3WVJ A;  1H1I A;  2VOX A;  1W99 A;  3HT1 A;  2R30 A;  4IQP A;  4CTE A;  5CFC A;  2EIB A;  1ZZ6 A;  3O1U A;  4KWL A;  1H30 A;  1HV0 A;  2JDA A;  3HD8 B;  1BCX A;  1S0D A;  1XSQ A;  2VZR A;  3HNM A;  4RHV 3;  4AVS A;  3FZ3 A;  1JZ5 A;  1ZVF A;  5EYY A;  1W0P A;  5FBJ A;  4LBQ D;  2P37 A;  3WF3 A;  1QHD A;  1H1A A;  4LBN A;  3GZA A;  2ORX A;  2BNM A;  3UGH A;  1CQ9 A;  3AYD A;  3W5M A;  3OEB A;  1OQE A;  2NMN A;  3I2H A;  5SV5 A;  4A7Z A;  3VBR C;  4NE9 A;  2SLI A;  3KCY A;  4DMI A;  4QM9 A;  3A4U A;  1U5Z A;  1NLQ A;  4LNV A;  3PUI A;  1UWW A;  4W6X A;  4XQW A;  2EXJ A;  1E5R A;  5F2W A;  3VBR B;  3WDY A;  4UFM A;  4AQS A;  4Y22 A;  2ZMK A;  3I59 B;  3RI9 A;  5K0U C;  1CZV A;  2OUH A;  1H8T A;  4S2D A;  2WZR 1;  2BWA A;  3HVD A;  1MZ6 A;  1LOC A;  5J1X A;  1NY7 2;  3T2O A;  4NHL A;  1AUY A;  1RUN A;  3BCW A;  5IAV A;  2XHN A;  4DFS A;  1XE7 A;  5K0U B;  3MIB A;  3IAP A;  2R49 A;  1W8Z A;  5BNN A;  2VZU A;  4N90 A;  1RYY A;  1W9Y A;  1ZRC A;  4QDR A;  1N1Y A;  2A6V A;  3MV1 1;  5FYS A;  4K1Y A;  1X33 A;  5FP4 A;  2Z4F A;  3LSE A;  5F5I A;  2F4P A;  1J1L A;  1BYH A;  5JVV A;  3FHQ A;  3D3A A;  1RHI 2;  1RUE 2;  3THD A;  1YFX A;  2BU9 A;  1G9D A;  4LBQ B;  4CCN A;  1DQ1 A;  2VVE A;  3FBY A;  5ANQ A;  1YUD A;  2ZKN A;  3HPN A;  3T0B A;  3ZXF A;  1C8M 1;  1YQ2 A;  2EXK A;  3VDD A;  4XF3 A;  1RHI 3;  1RUE 3;  1OI6 A;  3M70 A;  5HXV A;  2VZQ A;  2BOJ A;  4PF1 A;  5A70 A;  4ORF A;  4CCC A;  4PJY A;  1OXC A;  1MR5 A;  1UY3 A;  2DFB A;  4AXO A;  4DRR A;  5C3S A;  1HB4 A;  4RR3 A;  5D8A C;  3VB9 A;  1RUO A;  5C3Q A;  1OD5 A;  4JCK A;  4HON A;  1HB3 A;  3RZZ A;  1YQ6 A;  1HXS 2;  2NYY A;  4FPF A;  3FMG A;  5D8A B;  3LOI A;  3R05 A;  4YAR A;  3TN9 1;  5KHJ A;  1TNR A;  4YPJ A;  2ZAC A;  1JYC A;  3VBR A;  1RXF A;  3K2O A;  3AP4 A;  3KHB A;  3VBS C;  5C3R A;  5FYI A;  5JXH A;  3ORJ A;  3AMM A;  3I59 A;  4Y24 A;  1N1V A;  2ZHL A;  3ON7 A;  1HXS 3;  4OQ9 A;  1XC6 A;  3VBS B;  4M4R A;  1Q8V A;  2LS6 A;  5F8P A;  3GCW A;  3C7F A;  1ZZ9 A;  3K48 A;  1EUT A;  2BW8 A;  2RS5 2;  1JOB A;  2ZHK A;  3ECQ A;  2ERF A;  4LO4 B;  1J3R A;  3RNS A;  3WX5 A;  3AL6 A;  1X9T A;  3HBZ A;  3PUH A;  4LLF A;  2FDG A;  1SHW B;  1AYN 1;  3ZFE A;  4AHZ A;  1GAN A;  3GJB A;  4URT A;  5IAT A;  1S0C A;  2RVA A;  2A5Z A;  4OCT A;  3MLJ A;  4IE5 A;  2DTW A;  1UYY A;  2RS5 3;  2ZGO A;  2FZ2 A;  1HRV 1;  1Y9G A;  1F9K A;  1RED A;  3VL9 A;  2W1Q A;  3G6J B;  3NQH A;  1O3S A;  2D44 A;  3MPP G;  5A1F A;  4LBM A;  5FO8 B;  4YG3 A;  1N47 A;  5IVV A;  1EY2 A;  2RJK A;  3D4K A;  4Q1R A;  3ZYI B;  4YZ5 A;  1HQL A;  2E7T A;  4AE2 A;  5K8S A;  1KIT A;  1PM4 A;  5F3C A;  4KU8 A;  1BMV 1;  2R16 A;  3E5U A;  4QPI A;  4YLZ A;  5DN2 A;  3RDI A;  3T0A A;  2O1Q A;  1XNC A;  1PVC 2;  3NKT A;  4EE2 A;  1S0F A;  3O0W A;  4QM8 A;  2JDK A;  2VXJ A;  4J25 A;  5BPX A;  2H6C A;  5F37 A;  2MNG A;  5LBC A;  2R06 2;  2R04 2;  5IVF A;  3O1P A;  2UWA A;  5FLJ A;  1UU4 A;  4Q1P A;  4WVV A;  3ZKU A;  1N3Q A;  2VPV A;  4YW4 A;  4AVA A;  3LF7 A;  2VCM A;  3NJY A;  1IG3 A;  1Y43 B;  3AJY A;  2J42 A;  2JE9 A;  3C7G A;  4Q4V 2;  1DQ6 A;  2K2S A;  4IV3 B;  5D8A A;  5DAX A;  4B3N A;  1R1A 3;  3M3O A;  2R06 3;  2R04 3;  2CAU A;  4QKB A;  4FOW A;  4KL1 A;  3WDW A;  4OHY A;  2CGO A;  1UKG A;  2IVI B;  4CEY A;  1X7N A;  4N7I A;  4Q4V 3;  4RSU A;  5DUW A;  5IVY A;  3VBS A;  4LA2 A;  1WCS A;  1IS4 A;  1ZYB A;  3ACI A;  4TSV A;  4HXC A;  3E1F 1;  1UCX A;  5JOZ A;  4FI9 A;  1UZW A;  1Q8P A;  1LES A;  5IVE A;  2D3P A;  1QDC A;  1V6M A;  1IPJ A;  5IFP A;  4ZPI A;  1ONA A;  4FOV A;  1YNA A;  3KCX A;  1R64 A;  4EN6 B;  3JB8 A;  2PN5 A;  4HSL A;  1W0O A;  4QX5 A;  5F5C A;  4QHZ A;  3P5B A;  4M0H A;  1YJK A;  4OMC A;  4WZC A;  1DBN A;  5J36 A;  5E89 A;  5I8T A;  1CAW A;  2EVX A;  3Q8F A;  2ARB A;  3V0B A;  5GAL A;  1CAX B;  4L9B A;  4ES8 A;  1W6N B;  2RS1 1;  5F7U A;  3N3H A;  1LEC A;  5L19 A;  3ZPO A;  1WMX A;  2VME A;  3HNB M;  5F3E A;  2H0V A;  4GH4 C;  4AFC A;  1XYO A;  3NV4 A;  3HIF A;  4J1W A;  4KBZ A;  3CJX A;  5BY5 A;  1FAY A;  4TTG A;  1RXG A;  1SQ4 A;  1YQ5 A;  1SG3 A;  3ZMN A;  3D0S A;  3THC A;  1TMF 1;  2OZ6 A;  2W08 A;  4BIF A;  4OLL A;  3OPZ A;  4ZXK A;  1X9P A;  3POF A;  3CJI B;  4A7K A;  5FMB A;  5J98 B;  5L9V A;  1TME 2;  2NMO A;  2WT1 A;  2YGL A;  5FY8 A;  5FZE A;  1JOJ A;  1SBD A;  5HPO A;  1WGP A;  2ZKL A;  4LMF A;  1ZNP A;  3KWV A;  5IT6 A;  4PCR A;  1LEM A;  1QQP 2;  4NHM A;  2UYA A;  4YZ4 A;  2D40 A;  5BNO A;  3VKF C;  1SEF A;  4LE4 A;  5FXW A;  4P9J A;  4CEW C;  4IV3 A;  3WF4 A;  1ZA4 A;  2V5Y A;  3P1I A;  4LQR A;  2YBP A;  3OYW A;  3UV9 A;  1PO1 2;  1MS0 A;  3I97 A;  2VJX A;  4XOG A;  3SQO A;  3VHR A;  4CEW B;  3L2H A;  2DVD A;  3GNE A;  1I5P A;  2ZHN A;  5CFD B;  3ZSK A;  3AZY A;  2DUP A;  4KGQ A;  1A6C A;  2WNU A;  1KDK A;  5FYU A;  4MGI E;  1YRZ A;  2B45 X;  4HKL A;  1POV 3;  4CYD A;  4YM3 A;  2HWE 3;  1PO1 3;  4IGO A;  4AYU A;  2ZS6 B;  1REF A;  1GOH A;  3W58 A;  5LW9 A;  1WW5 A;  3T4H B;  1SPP A;  2OPK A;  3AYC A;  1PO2 1;  1W8U A;  2ZZJ A;  3BUC A;  1OPO A;  4FPY A;  4AL9 A;  3POY A;  2WN2 A;  3B01 A;  4NJ4 A;  4WZF A;  4YW6 A;  4OI0 A;  1SBE A;  5C4W A;  1CZS A;  1UY1 A;  3AMP A;  3S7E A;  4Z8B A;  2BZD A;  5FZA A;  2P17 A;  3B9C A;  3QBQ A;  3VBU C;  3OTF A;  3NJX A;  2PLV 3;  1SAC A;  3LIH A;  2AUY A;  1CAX A;  2CTV A;  5FRA A;  1LRH A;  2BP6 A;  5HBA A;  2A6Z A;  1BZW A;  3ZDV A;  3I2J A;  3VBU B;  3Q8C A;  4P5Y A;  4AK3 A;  4DOU A;  5I91 A;  1VMJ A;  3NRU A;  2W87 A;  4J1X A;  4OYU A;  2RV9 A;  2XLA A;  4OMD A;  3ZFF C;  3C8X A;  4AAX A;  2JXA A;  1COV 1;  2Q8C A;  1G9A A;  4XIL A;  3RZM A;  1NCQ C;  5APA A;  1AR9 1;  4FVV A;  3CJI A;  4YM2 A;  5DG2 A;  4LA3 A;  4CVU A;  4GMP 0;  1J3P A;  1NCQ B;  3H9A A;  4ARY A;  2J1U A;  2VO5 A;  3POW A;  1VAK A;  2WZR 2;  4XF4 A;  4W65 A;  2ARA A;  2BYV E;  4CCK A;  1CD3 G;  1MS5 A;  2E53 A;  1U5Y A;  3UET A;  1LED A;  2Q30 A;  1O5U A;  4EN9 B;  2WT0 A;  4DUX A;  1AL2 1;  2ZMN A;  1ALY A;  4LOR A;  5IHR A;  4WBB A;  5FXV A;  3RRD A;  2RMU 2;  3FLR A;  1SLC A;  2WZR 3;  2XJQ A;  3E5X A;  3K4A A;  1G7Y A;  2J1R A;  3NNG A;  5LBF A;  1H9W A;  3H1Y A;  1NXD 1;  1OUS A;  3HR9 A;  3PVN A;  1K45 A;  4HMZ A;  4UBG A;  5CFD A;  2L9L A;  3VBH C;  3SIT A;  5FO7 B;  1DGR N;  3WNO A;  1W8N A;  1X8M A;  4XQ4 A;  3VZM A;  2DCZ A;  4FPG A;  1XXN A;  3VBH B;  4MOA A;  1UOF A;  2CSG A;  4QGL A;  1OF4 A;  1ULE A;  4XZP A;  3MF6 A;  4L99 A;  4Q4Y 1;  4CU9 A;  3CBN A;  3H0O A;  4CU8 A;  2FCT A;  4IES A;  5F6L B;  2D3S A;  3KT7 A;  3O1V A;  2PQQ A;  3K4D A;  5B4X A;  3PMS A;  3MEP A;  4TLG A;  2CV6 A;  1JH5 A;  2WAA A;  4JGY C;  2O8O A;  5LCW L;  5FOJ B;  2JB4 A;  1YO8 A;  2WL1 A;  5D2A A;  1J3Q A;  1LHW A;  3ZYG A;  4JGY B;  2B46 X;  3E5Q A;  1GWM A;  4OUE A;  3ZO0 B;  4AHY A;  3WDT A;  4GWN A;  2YPD A;  1XU2 A;  1K5J A;  1XPW A;  4CXY A;  2CGP A;  3PME A;  3AP5 A;  1HLC A;  4AVV A;  3TN9 2;  1DQ2 A;  3EJK A;  1JUI A;  3AMH A;  1FPN 1;  2HWD 1;  2ZAH A;  3JUU A;  4W8J A;  5GLW A;  3V65 A;  5HCH A;  4LXL A;  4XE9 A;  5A3T A;  1LTE A;  3MUZ 1;  1GMM A;  3X29 B;  3ZYJ B;  4L97 A;  1UD1 A;  4CXX A;  3ZR5 A;  5GZE A;  3NKG A;  3TN9 3;  2R0H A;  3OEA A;  1DGW X;  4G3Y C;  4HG6 B;  3WNN A;  3S0M A;  3LSD A;  3VBF B;  5C9A C;  4PBP A;  3UL2 A;  3QOP A;  3W9A A;  1OUX A;  2JDH A;  4P9W A;  1V00 A;  1AYN 2;  5LZ6 A;  2I2S A;  1U5X A;  2P4E A;  5C9A B;  1L3J A;  3LD8 A;  3ACL A;  1S55 A;  2QCS B;  1YXW A;  3S30 A;  5FXZ A;  2J1V A;  4TYS A;  3ZSE A;  4LBO A;  1VBE 2;  3M1H A;  1NYW A;  1BK0 A;  5A6Z A;  1EPZ A;  4AEJ A;  1ENS A;  2VG9 A;  3ETQ A;  3C7E A;  4FP2 A;  4IEX A;  1WLT A;  3OUH A;  3SMH A;  1AYN 3;  3UGF A;  1OUR A;  4CDQ B;  1VRH 1;  2VU9 A;  3NMB A;  2ZGP A;  2WUH A;  2Y60 A;  3EO6 A;  2W68 A;  4PIX A;  1HRV 3;  3VN4 A;  2HWC 1;  1AR7 1;  4UI9 L;  4P9I A;  3BPS A;  1EP0 A;  4QD2 A;  4UOJ A;  3I2D A;  3MLK A;  2W47 A;  2X10 A;  1H2K A;  1OOP C;  3AXE A;  3OD4 A;  5FP3 A;  2JE8 A;  2TEP A;  3ZIW A;  4EJR A;  1ND2 A;  1UOG A;  2VMI A;  4QHO A;  1W2A X;  4ET7 A;  2EID A;  3I54 A;  1S0I A;  2R6Q A;  1YWK A;  5C5U A;  1OOP B;  1PK6 C;  2TUN A;  5GZD A;  1QJE A;  5FY4 A;  4NAM A;  1CAU B;  3N4M A;  3KM5 A;  4JQR A;  1PK6 B;  3BN6 A;  3NST A;  1I3H A;  4MUV A;  2W91 A;  4K7J A;  3O1M A;  1NCR A;  2V73 A;  4Q0U A;  4XFA A;  5FJK A;  4Z2A A;  4Y1V A;  5CKM A;  3I3D A;  5A1A A;  1DDL A;  3FL7 A;  3KGZ A;  5JPN B;  4NIA A;  1BXH A;  4LO7 A;  3WNM A;  4FPL A;  4BE3 A;  4RS5 A;  1K5M C;  1ZZB A;  3E6D A;  2D43 A;  4BIS A;  4FPJ A;  4Y1Z A;  3D6E A;  5JXG A;  3CLP A;  5FK7 A;  3HMY A;  1D7P M;  2PQS A;  2FQP A;  3H8X A;  1K5M B;  3VBF A;  3I49 A;  1EV1 1;  2A75 A;  2W3J A;  1IQD C;  4Z92 B;  3IWZ A;  2X5I C;  1V0A A;  4CUG A;  4BA6 A;  2EIG A;  3WLU A;  1QXR A;  3ZN6 A;  1NE6 A;  3LFI A;  1WCD J;  4CDX A;  3H8O A;  4FTS A;  1SMV A;  2A6W A;  2QUO A;  1GNZ A;  2CNA A;  1GFF 2;  5DAQ A;  3VZK A;  2X05 A;  1NUK A;  2JD9 A;  4AEK A;  1V6L A;  2RS1 2;  4CDQ A;  1LOB A;  1OBN A;  2DVA A;  2E26 A;  2YU1 A;  5FQ0 B;  2Y6F A;  1G9C A;  1AF9 A;  2CDO A;  1O3T A;  1ND3 A;  4LHN A;  1GNY A;  4AED C;  3LA7 A;  4AI9 A;  2RE9 A;  1G9F A;  1HX6 A;  1TMF 2;  3R4D B;  4C91 A;  1JZ7 A;  1ODN A;  1N3P A;  2ZX1 A;  3JD7 2;  4XXP A;  4AED B;  1DGR A;  1MVQ A;  1RMU 1;  2RS1 3;  1SLL A;  4PLO A;  2P6H A;  4Q8L A;  4ES9 A;  2Q1Z B;  4FFI A;  4K20 A;  5LA2 A;  5F1R A;  4AI8 A;  3V64 A;  1TMF 3;  4XJ8 A;  5EP9 A;  1D2Q A;  2WZP P;  1UYX A;  4IET A;  1KD7 A;  1UYP A; 
#chains in the Genus database with same CATH homology
 3KV6 A;  3AL6 A;  5A7O A;  5FZ6 A;  5FJH A;  3PUS A;  5FYU A;  5FPV A;  3KV5 A;  5K4L A;  5A7S A;  4QXH A;  5FZL A;  4IGO A;  4QXC A;  5FY1 A;  4D6S A;  3N9Q A;  5IVB A;  3U78 A;  5LW9 A;  2XML A;  3LD8 A;  5FPB A;  5FZ1 A;  3LDB A;  5FXZ A;  5A1F A;  3K3N A;  4LIV A;  5F2S A;  3DXT A;  4E4H A;  3PU3 A;  4XDP A;  5IVV A;  3DXU A;  3N9O A;  5FZO A;  3OPT A;  5A7W A;  5IW0 A;  5FZF A;  5F3C A;  5FBJ A;  5FZM A;  3PUA A;  3PU8 A;  4V2W A;  5FZA A;  5FY7 A;  3PUR A;  5FPU A;  5F37 A;  5KR7 A;  4Y33 A;  5FUN A;  4LIT A;  3AL5 A;  5IVF A;  5FZ4 A;  5FYM A;  5FP9 A;  5FZG A;  3RVH A;  3OPW A;  5F2W A;  5FYT A;  4EZ4 A;  4EZH A;  5A80 A;  3N9M A;  5FP3 A;  4QX8 A;  4D6R A;  2Q8C A;  3NJY A;  3PDQ A;  4Y4R A;  4TN7 A;  5A7W B;  5FY9 A;  4QXB A;  5CEH A;  5FWJ A;  5FYB A;  5IVJ A;  2YBK A;  4URA A;  5FZI A;  5F3G A;  5FY4 A;  2P5B A;  3N9L A;  4V2V A;  3KVB A;  1VRB A;  4CCK A;  4AAP A;  2OX0 A;  4XDO A;  3N9N A;  5FY5 A;  4HOO A;  2GP3 A;  5IVY A;  5A7N A;  3UYJ A;  4CCM A;  2W2I A;  5E6H A;  4GAZ A;  5FJK A;  5F32 A;  5FP8 A;  4QX7 A;  3PUQ A;  2Q8D A;  5FYS A;  3AVR A;  5FZB A;  4BU2 A;  2VD7 A;  5FXV A;  5FP4 A;  5FZK A;  4CCJ A;  2OQ6 A;  5F5I A;  5A3N A;  5FZ8 A;  5IVE A;  5A1L A;  4BIS A;  2OQ7 A;  5F3I A;  5FYH A;  5FZ3 A;  4D6Q A;  2XUE A;  5FYZ A;  2OS2 A;  5FY0 A;  3K3O A;  4GJZ A;  5FPL A;  3KVA A;  5A7P A;  5ANQ A;  5LY2 A;  4CCN A;  5FYC A;  5FZO B;  4QWN A;  5FZC A;  5IWF A;  5F5C A;  5LWB A;  5FZH A;  4BXF A;  5FXX A;  3AVS A;  4CUG A;  5FYV A;  2YBS A;  5FYY A;  4DIQ A;  5FP7 A;  5F5A A;  4CCO A;  3ZPO A;  5FPA A;  5F3E A;  3U4S A;  4LIU A;  4UF0 A;  2YU1 A;  5FZ0 A;  2PXJ A;  4IGQ A;  4QU1 A;  5FZD A;  5A3P A;  2WWJ A;  5FUP A;  4HON A;  4IGP A;  4GD4 A;  4GJY A;  4AI9 A;  4CSW A;  5FY8 A;  5FZE A;  5FWE A;  4C8D A;  2GP5 A;  2Q8E A;  2WWU A;  2OT7 A;  2YPD A;  3KV4 A;  5F39 A;  5ISL A;  2XDV A;  5IVC A;  3K2O A;  5FZ7 A;  2XXZ A;  5FYI A;  2YU2 A;  5LY1 A;  5A3W A;  4EYU A;  3KV9 A;  5FXW A;  3N9P A;  4Y3O A;  5FV3 A;  5FZ9 A;  5A7Q A;  4LXL A;  5A3T A;  2YBP A;  4DO0 A;  3PTR B;  4UF0 B;  4NUB A;  3ZLI A;  4ASK A;  4CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...