5LW9A

Crystal structure of human jarid1b in complex with s40563a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
462
structure length
456
Chain Sequence
MFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 5B,Lysine-specific demethylase 5
publication title Crystal structure of human JARID1B in complex with S40563a
rcsb
source organism Homo sapiens
total genus 150
structure length 456
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5lw9A01
5FZOB 5FYUA 5FZBA 4GAZA 2WWJA 5FWJA 2PXJA 5FYVA 5A7PA 1VRBA 5FY4A 5FXWA 5A80A 5IVBA 5FZAA 5FZOA 2XMLA 3DXUA 4HOOA 4AAPA 5FZHA 4IGQA 4Y4RA 5FP9A 3KVBA 4QX8A 5FP3A 5FYIA 5IVYA 5F32A 5FBJA 5A7OA 5IVFA 5FZEA 5A1FA 4QXCA 5FYBA 5FXXA 5F5IA 5A7WA 5FY8A 5FUNA 5A3PA 5F3GA 4D6QA 3AVSA 4IGOA 5F2WA 4CUGA 5FPLA 3PUQA 5FY0A 3PU8A 3LDBA 5FYHA 5FZFA 4AI9A 2XXZA 5FZ1A 2GP5A 2GP3A 4GJYA 3LD8A 3N9MA 5FZIA 5F39A 4EZ4A 5FZ9A 4LITA 4E4HA 4CCKA 5F3IA 5FZ7A 5FZ4A 2W2IA 5FPUA 4D6RA 5KR7A 5FZMA 4CCNA 4CSWA 2Q8CA 4EYUA 2OS2A 5FZ0A 5K4LA 5FPAA 5FZGA 4ASKA 5A3WA 3KV9A 4XDPA 5FZLA 5A7WB 5CEHA 2XUEA 5FYZA 5FYCA 4LIUA 5FYYA 5FP7A 5ISLA 5FYMA 4Y3OA 5LWBA 4QWNA 5FZDA 3PTRB 5FZ8A 5FY5A 2YU1A 3N9LA 4C8DA 5FPBA 5FXZA 3KV6A 3PU3A 5A7NA 5FYTA 3AVRA 4UF0B 2OX0A 4V2WA 5E6HA 4DO0A 2YPDA 2Q8EA 5A7SA 4HONA 4LIVA 4XDOA 5FZ3A 5F37A 4LXLA 4BU2A 3OPWA 5IVJA 5F3EA 2OQ6A 4UF0A 5FP8A 3K2OA 5FPVA 3ZPOA 5FXVA 5FY1A 5FY9A 4DIQA 3U4SA 5FZCA 2YBSA 2YBPA 3PURA 5FJHA 4Y33A 4CCOA 5LW9A 3RVHA 4CCLA 4V2VA 2VD7A 4CCMA 3K3NA 5F5AA 3PUSA 4URAA 5A3TA 5A3NA 5FY7A 5IVCA 3AL5A 2YBKA 2Q8DA 5LY2A 3AL6A 5FZ6A 5ANQA 4D6SA 4IGPA 3DXTA 3PDQA 5IW0A 4TN7A 2OQ7A 3N9OA 5F5CA 3ZLIA 3OPTA 5F3CA 5IWFA 3KV4A 3KV5A 2WWUA 2P5BA 5FP4A 4QXBA 5FUPA 2XDVA 4GD4A 4NUBA 2YU2A 3N9QA 3N9PA 4EZHA 5LY1A 5FV3A 5A7QA 4BISA 3NJYA 4CCJA 5FJKA 5A1LA 5IVEA 4QX7A 3UYJA 4GJZA 3KVAA 4QXHA 4BXFA 5FYSA 3U78A 3N9NA 5IVVA 3PUAA 5FZKA 4QU1A 3K3OA 2OT7A 5FWEA 5F2SA
chains in the Genus database with same CATH superfamily
2XWBB 1NLQA 1UU5A 3MPBA 4XQDA 2GNTA 4YVWA 4GAZA 2IVJA 5E88A 2PA7A 3U0ZA 4IE5A 2WSUA 1H9PA 1HN0A 4P14A 2VOVA 5LBEA 4I2OA 4LUMA 5GLVA 3ROUA 3MHZA 4KBBA 1HV1A 1OLMA 4W65A 4X6QB 1LHUA 2BNMA 1YRZA 1R1ZA 5FP9A 3PMSA 5FP3A 3WW4A 1X8MA 1MS3A 1RUF3 1O6UA 2WFPA 3LIHA 2JWPA 4LQRA 1PNGA 5FCCA 4XFHA 4CCEA 4MGQA 5C8CB 5I93A 1H2MA 1MVQA 5L9BA 2DBIA 1UOJA 4XJAA 1ND3B 2XJQA 4RQPB 4H3WA 5FY8A 2Y26A 4N9IA 4YYOA 5J36A 3JZVA 4Y26A 1FPN3 5H9SA 1SCRA 3W59A 4BLJA 2BU9A 3M3EA 4JHTA 3PUQA 3WNOA 3J8F3 4NPMA 3O14A 4AXOA 1LTEA 2B7YA 1H30A 2WO2A 3PIJA 3VHOA 3ZSMA 5A6QA 1SPPB 1CZTA 3FFZA 3N9MA 5FZIA 3O0VA 4UW3A 1N47A 2VU9A 3IWZA 2FCVA 1F2NA 3UETA 3BPZA 3VKFC 4TLGA 3RMYA 1IKPA 1AL0G 1HW5A 1SFNA 3GXUA 1R1A3 3OGVA 3G6JB 4RHV3 2Y33A 1XSRA 1ZBA3 3USUA 3V65A 2VMEA 3ZDSA 4EWDA 3BIEA 2XHKA 1TMF1 3OBTA 1EAH2 1OURA 3C7OA 2VNGA 1JOBA 2CU5A 3BN6A 1DGWX 1H1AA 1RUG2 3L2YA 3KQ4B 1GFF2 1GOHA 3R05A 5ERLA 4ZXEA 4DEQA 4MOAA 4HN0A 2X29A 2VZTA 4XEZA 2CDPA 4DXZA 3JB8A 1QH6A 5I0RA 1ULFA 2WNOA 5KHIA 1RXGA 1GNHA 4IV3A 4NPRA 4HKWA 3B02A 3FN9A 1LOCA 1UY1A 2PHFA 2QQWA 3J9SA 4A6SA 4XFCA 3TNPB 4Q26A 5C3SA 2ZZQA 4Q4V2 4UF0A 4JRLA 3R0RA 4H14A 4UT5A 3VBUC 4GA9A 5HXVA 1CIWA 1TEIA 3HN3A 5DZFA 5FBZA 1VAVA 4HANA 3KT1A 2ZHKA 4MX3A 2IXCA 4NMIA 4Y22B 4K8RB 4DMIA 3FJSA 4XUNA 3J4UH 3R4DB 4YPJA 3RVHA 1N3OA 3CF6E 2HEVF 1SMVA 5BNPA 2TBVA 1W3VA 2LS6A 2WT1A 1ZZ9A 2H0VA 3HNBM 3VDDC 5JOXA 4LBQD 5EQUA 5JR7B 2FZ2A 2YDEA 1PX4A 4CUAA 2JDUA 3GBFA 3AMNA 4GH4B 4P08A 4B1LA 2XJTA 1JOPA 1QJX2 1RMU1 4HXCA 2J1RA 1Y3TA 1E5IA 1GICA 2FDGA 1B09A 2VGDA 1CAWA 3NW4A 2QQUA 4FPGA 5FP4A 4OQ9A 1ZRIA 5D1IA 5BUVA 2EIEA 4JGYB 5FMBA 3I3BA 4A45A 3IBMA 5DXDA 1POQA 4COVA 1J59A 2X09A 1OLQA 2XJRA 1QDCA 2W9XA 1ZREA 3AJYA 1EUTA 4A3XA 4E4SA 4YM3A 4UFKA 4QGLA 2A6YA 4Q0SA 2BNNA 3K3OA 1QH7A 2QE3A 2ILMA 2OVUA 3T30A 3NV2A 2Q8EA 2RJLA 5FZBA 5DDJ1 3EHKA 3RNSA 2A75A 3VD7A 1GANA 3I2JA 4DRVA 1LENA 4JKLA 1ODMA 3VBOC 5EJ3A 4K1ZA 2BVVA 1PGW1 5FZAA 5BNNB 4Q4Y1 2VZUA 2ZMNA 3T2TA 2HWF3 2JG9A 2ZX2A 3FLPA 3KQRA 3M3CA 3ACHA 4Q27A 5TSWA 2Q1ZB 2WQ8A 2FDHA 2CWSA 4QGNA 2WA4A 3VBHA 1CAVA 5FYBA 1VRH1 2YY1A 4JGZA 5F5IA 3WNPA 3BTAA 1WLDA 1CIYA 1U5ZA 4YVWB 2EVXA 4YWAA 3KHBA 3WP4A 2ZGMA 1DQ4A 1ASJ2 5A3NA 1DGWA 3UV9A 2DCJA 2EXKA 2VO5A 4Q2FA 1W2OA 3S30A 4BA6A 4BQ1A 4GWMA 2HWD2 3MV11 4EJRA 3TEXA 1FAYA 4L0PA 4UFHA 1TZOA 1J3PA 1TME3 2GN7A 3LB9A 1NA1C 2ZGKA 1ULOA 4DFSA 2XG3A 1QQP1 1HX6A 2FQPA 2OS2A 3E6CC 1BYHA 2QQPA 5C6CA 1LESA 3GNEA 4XFIA 2PHTA 2QQLA 5T55A 1OF4A 1S0EA 2WRAA 2RS33 2ZOEB 3VBRC 1UIKA 1Y43B 3BYWA 4LO8A 5C8WA 3PTRB 2PN5A 5C3PA 1LCLA 2E9QA 2UWBA 4XAEA 4W8JA 4AI1A 2ZACA 2DCKA 4QMAA 5FYTA 3T0AA 1W8NA 4GWIA 1ZM1A 4KG8A 4ZZ5A 2PMWB 4FPCA 5KXEA 4P9GA 3VL9A 5M0TA 5FZ3A 3VKNA 1ENQA 5JXIA 3USUB 3WY6A 2VNOA 4BLIA 5C7GA 2XLFA 1AR73 1QJY1 2AC1A 3OPWA 3SKVA 4BYYA 2IFRA 4LO7A 5ACA3 4XE9A 1RIRA 3VBSB 4FPKA 1OFSA 4B7EA 3UT0A 3NRUA 5CFDC 3SHRA 1D7PM 3JBG3 1L7QA 4UFMA 1JXNA 1YQ5A 2D97A 1EP0A 2ORXA 4LA2A 1JU4A 4LJHA 1ND2C 5JR2A 3MLKA 3HNYM 3WF0A 4IV3B 1TMF2 4Q4W3 4QKBA 1RHI3 5IJRA 1WCKA 4QQ2A 3ZN5A 1OFNA 3AL6A 1VBA3 1HRI3 2BEOA 1UY3A 4A41A 1DGRA 4XFFA 3GGLA 1O91A 1C8M3 2OQ7A 3ZDVA 3RZHA 1XNAA 3T1LA 2JEMA 1TNRA 1AYM3 1RL3A 2A70A 2BWAA 4GMP0 3KV5A 1H2KA 5GJ6A 1GOGA 4PDWC 2FDKA 1AL21 1S0FA 3C7GA 3FL7A 1OXCA 4CU6A 2ZEZA 5BNPB 3FUQA 1GKBA 4ATEA 3AKSA 4A6OA 3ZFGA 1MZ6A 5DUWA 3MI8A 5FR3A 4O9EA 2D40A 3CKHA 4OUMA 3AYAA 3PUAA 4D69A 1BCXA 1HXS3 3HQRA 1DQ6A 1A3KA 2EAKA 4MGKE 4LNVA 5E1RA 3M3OA 3JU9A 3H3UA 4XETA 4XFAA 2D5FA 2WT0A 1J84A 4L9BA 4XZPA 3ILRA 5DZEA 4OQ8A 3ZFEB 4LK6A 1F5JA 4BHPA 2Q30A 2XMLA 1UCXA 2ES3A 5HV4A 5IVYA 2P17A 1S0GA 2J1SA 1UMHA 2AUYA 1RMU2 1UN1A 5FBJA 1SCSA 1G86A 1JBCA 1GBGA 1JHNA 2PHLA 1DF0A 1G9FA 2WDBA 2BW8A 4FFIA 1JYTA 3MUZ1 2C5DA 4QX5A 3RSJA 2OPKA 1XOYA 1DZTA 2AREA 1V6KA 2PHRA 5EJZB 1W8UA 1Y9MA 5LATA 2XBO3 5BXXA 1AYN3 2XXZA 1GU3A 3WLUA 3KS7A 1HN1A 4GXLA 1PMHX 1PK6C 3PTYA 3BUCA 5FZ9A 3TN91 4Z2WA 4CCKA 3ZPYA 2XB6C 3NV3A 1LHOA 5F3IA 4Q0PA 4YLZA 1REFA 5DDJ2 3NMBA 4D7SA 2AYHA 4M4RA 5DAQA 3AYDA 1CAVB 4PIXA 2BGCA 5F5QA 2E26A 1PGW2 2Z69A 2XVKA 3ES1A 5E89A 4Q4Y2 2PAMA 4ZU4A 5FYZA 5J7MA 4CDUA 4DEVA 4FAHA 2W1WA 3KGZA 5FY5A 3TAYA 3QACA 2JX9A 4LBKA 5EJ1B 5FXZA 3BTXA 1VRH2 2Z2SB 4JV4A 2P3YA 1WWYA 2OX0A 2A7AA 3ASIA 4DO0A 5A7SA 1OH3A 1J1TA 1SBEA 1IPSA 1Y4WA 4LBQB 1MQTC 3WNMA 1W6NA 2OZ6A 5DUVA 3ZFFB 2OQ6A 4SBVA 3RWNA 4KBZA 1G9DA 4SLIA 1QDOA 4FFFA 3ZXKA 4QXKA 3VZNA 2R0FA 2VVFA 5F7UA 1W6MA 4FOVA 2ZAAA 1QIQA 4ZPIA 3ZPOA 4CDQC 5FXVA 1NLRA 1VBE3 4QDRA 4UOJA 3LPGA 1WMEA 1Z78A 1GYKA 3TRSB 1RINA 2J7MA 5EYYA 1L7LA 1QQP2 2JIGA 4YG3A 2VE1A 5GZEA 5T52A 2VUJA 4F8AA 4MGTA 1G7YA 1BK0A 1AXYA 3Q8CA 3NAPA 4IEZA 3SNMA 3SLIA 5K8SA 3HQUA 4DRRA 5BNOA 5A3LA 2YPJA 4IXLA 5ANQA 2PHXA 4D6SA 1QJU3 2FBEA 5SV5A 4ZU7A 1RUH3 1WLWA 4AGVA 3LPFA 4NAMA 4DOUA 1UD1A 4F3JA 2W1UA 1W9WA 3SH3A 3INAA 4WM8B 1PO13 2R32A 4L92A 5IWFA 3KV4A 5IYYA 3B93A 1HRV1 1NAEA 4QB1A 1QJY2 2VCCA 1D4VB 5FMDA 1WBLA 2WFF3 1HQWA 2JECA 3DGTA 4RGAA 5CAZA 4XF3A 2A1XA 3CJIC 3O7OA 2IZWA 3PVBB 1W2NA 5B2GB 4BXFA 2D6OX 3H7JA 4RR3B 5E16A 3H7YA 2NZ9A 1Q8OA 5A33B 3P5BA 4JDNA 3FFQA 5EPAA 5FZOB 4UW4A 2MEV1 3HT2A 5KXCA 4BQYA 4J1XA 2JICA 5L9RA 1SBFA 3OGGA 2EAAA 2DVBA 1QOSA 2B9UA 4MVTA 4LKEA 1DFQA 2VZRA 4IDZA 4CDWC 4MG2A 3BALA 2IXIA 1O59A 1RUI1 4UAPA 5IT6A 5FOJB 1JZ2A 2VCBA 1O4YA 1W6PA 2PHDA 3I2FA 4YW1A 5FZEA 3RZKA 4NROA 5JUVA 1UYYA 1PM4A 1ZBE1 2CNAA 4QPYA 4Y1ZA 2WNUB 3USSA 5FDBA 1Q8VA 1AL22 2ZMLA 1I5PA 2BV4A 2HH9A 4YW7A 4QX3A 3HVDA 1AX1A 3GDBA 1JYWA 4IW3A 5T5OA 2DUOA 5FREA 4C0BA 4WVVA 2GP5A 3LSEA 1W04A 5I8YA 5DG1A 4EZ4A 1AUYA 3ACGA 3WX5A 3ZYHA 1LOFA 1PVC3 1FOD1 4AEDC 5FPUA 1GV9A 5C3QA 4AHYA 4PCRA 4QHOA 3WNLA 3CBNA 2XKOA 4JHZA 1KGYA 4KWKA 4XF1A 1H2NA 3OBZA 1HKDA 4XUPA 2CGNA 1UXXX 4XIKA 1UIJA 4Q8KA 1N1YA 3IPVA 3NVCA 4HBNA 5H9PA 2VZVA 4AI8A 3C7HA 3KV6A 3LE0A 1XNCA 4BJ0A 2J1UA 5E6HA 1SQ4A 3CMGA 3LGRA 3OJBA 4AOCA 1E57A 5JMOA 1W8ZA 4AG4A 4MZUA 4U36A 3CHXA 4FPYA 3U37A 5H9RA 2B5HA 4GMP3 4XHXA 5CIRA 4DUWA 4META 3P3PA 1JMUB 3AP5A 3H1MA 3HBZA 4QQPA 2Y64A 3I54A 3ZIXA 4CDUB 1COV1 2YGLA 1CJDA 3TN92 3O5SA 4K3UA 3M1HA 3S5AA 2DYCA 2RMU3 2YBPA 4XYXA 1MEC3 2I45A 1P8JA 1TQ5A 2H6CA 2VR4A 3ES4A 2K46A 2WL1A 4V2VA 1W9TA 4DXRA 3UNPA 2WZ8A 1IQDC 1WLCA 4ZS3A 3LDRA 1O3QA 4IV1A 5FLIA 5KC5A 3TEZA 1W6NB 5LBCA 5D2AA 2VZ3A 3C8XA 5A3MA 2FZ1A 2LUWA 3LEMA 4AVCA 5JWPA 1H0BA 1V6IA 1W6MB 2ZGSA 2VZSA 3AMQA 1NUKA 2VC9A 3POEA 4XHBA 1HB3A 3O1SA 2WYFA 5GZDA 4LE4A 2W46A 3NQHA 3EXUA 3PJQA 1MVEA 4K40A 4NUBA 1ZX5A 3NAPB 2B8MA 2YROA 4RFT0 4N53A 2ENRA 4UXAA 4NRPA 4PIZA 1LHNA 2VW0A 4E8CA 4Q0UA 5CFCA 1Y9GA 3I8TA 4A42A 5L7OB 3VLBB 4TLFA 1VBC3 2RDRA 2VQ0A 3SQOA 4K8FA 1QF3A 1DZRA 1GQGA 1VE0A 1YFYA 1OPMA 1PM7A 1AHSA 5F2SA 5LBFA 4ARXA 1NXMA 1AR71 3JXSA 3T4HB 2HKXA 3E5QA 1H4HA 2X8KA 2IVIB 4YGDA 5JI7A 1Q8PA 1LAJA 5IVBA 4ES9A 1RUNA 2R7EB 3A0KA 3LWCA 2HWE1 3HOBA 1RYYA 4PI2A 2B9VA 1G6NA 5JOYA 4ET7A 1JODA 2WJSA 1AX2A 3VDCA 3WG3A 2VW1A 3LF7A 1RUE1 1X9PA 4LPLA 4NHMA 3BOWA 3IM0A 4C0HA 1WMFA 1HRV2 4JCKA 3TWIA 5LBBA 5C8CA 1VBA1 2KD7A 1N1SA 4GB31 4CXXA 4CP1A 5FPLA 2RM21 5FZFA 3WUCA 4CDXA 1VJ2A 3LEGA 4RQPA 5LRRA 3HWJA 2ZGRA 1MZEA 1ZRCA 4AVVA 5GALA 1BJQA 2XONA 4LITA 4IE0A 2PTMA 3MO4A 2HLEA 1Q8SA 1Q8QA 1YXWA 1W6PB 2MEV2 2R043 5FZMA 4EN6B 3U75A 1C5HA 4UW5A 1XE8A 1UWWA 3K4AA 5FZGA 1MS4A 3B94A 1CVNA 4ASKA 1FX5A 2EIGA 2VNVA 3W21A 2R071 3AXEA 3I2GA 4Q29A 5DPNA 5ABJC 3ZKUA 1W28A 1GMMA 5FUIA 4FOWA 2QVSB 1RUI2 2P6CA 3MLLA 1IPKA 1HXS1 4DZGA 1RUC3 3POGA 2ARBA 5HV0A 1JU3A 1D4M3 2QZ2A 1PIV1 2VMFA 1VR3A 1ZBE2 5JPMB 1JZ5A 3AVRA 4JRAA 1SLTA 3TYJA 2EALA 4AEMA 1BVVA 1D2SA 1UW8A 1XNTA 2RR13 4HONA 1S4CA 4XDOA 5FMOS 3JCIA 3MIDA 3QH6A 4G9SB 4C90A 2VJXA 1ZNPA 4KG0A 4R4XA 5FP8A 5CISA 5APAA 2JG8C 3OUJA 5JZGC 4AAXA 2F4PA 2P6HA 2YFUA 3NNJA 4I0AA 1BEV3 4W6WA 5FY9A 4LHLA 3RRDA 4FAGA 1FOD2 2R061 3IPVB 3SH4A 3AZVA 5AC93 3OUHA 4BE3A 4Y33A 4FI9A 4N43C 1VMJA 2XL7A 4QKNA 2QQNA 4PLMA 5F5AA 2QJVA 4Y22A 5FFOC 4AVTA 3ZM8A 3VD3A 3ON7A 1VBD3 5IVCA 3N7LA 4IEPA 4CU8A 4LULA 3RFRA 5DABA 1DLLA 1K3IA 1UMZA 4IGPA 2Y34A 3VBOA 1XRUA 2WSVA 4XILA 2YUEA 1S2BA 3UL2A 2VBPA 1DGRN 3AKQA 3H42B 4HK9A 4QGMA 4QM9A 5F5CA 1OT5A 2QQVA 5F3CA 5HXMA 3MIBA 4AHZA 3MFCA 1GWLA 2W91A 4JTNA 1YFUA 4A2UA 2VUDA 3RDIA 2JDHA 4QHBA 4EZHA 3LOBA 2HWC1 4FVVA 2GMPA 1GOFA 1COV2 1N1VA 1XQNA 5C5UA 3CU7A 3U78A 2EXHA 4E4DX 1O3TA 4HK8A 4ZZ8A 2RJKA 1PMJX 1VAKA 2RS13 1G9CA 2PAEA 4I3GA 4AVAA 4CA9A 4XUOA 5EWSA 2VQTA 4QQLA 1RUD3 2EF6A 5GZCA 3AZWA 5F6KA 2GNBA 3PVOA 5FXWA 4LEJA 4W6XA 1GLHA 3FX3A 3EJKA 2XVGA 3VBFC 1RGSA 1VMHA 4N53B 1UXZA 2BYVE 4CP2A 3POSA 2RDQA 4BXSV 3DV8A 1K42A 1FNYA 4OZOA 4B8EA 5CFCB 2WO7A 5J09A 4P9IA 1ULGA 1V6MA 3POFA 1QEXA 3H8XA 3RYPA 1O5LA 3HQXA 1F9KA 3ST7A 2OXBA 1OMIA 3AP6A 4IGOA 1LEDA 4GWJA 5E8AA 1W8FA 4UWDA 4AZZA 3S0MA 3NV1A 5FYHA 1WW5A 4KWUA 5L73A 1AR93 4AEJA 2NP0A 5KXBA 4KQ7A 1XU1A 3ACIA 5J37A 3HBKA 1WA4A 2ETEA 3BPSA 3MDPA 4LE3A 4CVUA 5J48A 4ZHNA 4HN1A 4X8NA 4GKYA 3WXPA 4D0QA 1O5UA 2E32A 1AR72 1S1AA 1ZZCA 1IOAA 2ZKNA 3E1F1 2WFF1 3A23A 1O7FA 4BB3A 4JDOA 5CFDA 5IK7A 5A3WA 2V5YA 3AXDA 4Y1UA 4YNIA 1VB4A 2HWE2 2Y6KA 4LIUA 4OVEA 1IGOA 5FK8A 4JQTA 3WW1A 2IWGB 2YV8A 4HMZA 4CDXB 2E33A 5JOWA 4DXTA 4Q1PA 5T50A 3I3DA 1AR61 4GIQA 4JC1A 4O9GA 1E5RA 2DF7A 2W92A 3F2ZA 5LZ6A 3P6BA 2JKXA 1BHGA 1LECA 1RXFA 2D98A 2HEWF 5GLUA 1RUE2 3V0BB 1Y7BA 4XXPA 1YQCA 2DCTA 4FPLA 3URFA 5BNQA 4YG6A 2E63A 5FKCA 3H0OA 3RZJA 1VBA2 4GB32 4YW6A 2RM22 1UZWA 3R6SA 1ULDA 4MYEA 3C7EA 1W03A 1IKQA 4PDWA 1BBT3 4Y1XA 5KHGA 4LKDA 2CAUA 4P9YA 1IS6A 1V6JA 2D6PA 4RS5C 2WABA 5LEJA 2D6KA 1PHMA 1JYCA 3OSDA 4XJ9A 2B4KA 5DN2A 3VBSA 3VDDB 4CYDA 4CCCA 3E5UA 4Q4X1 4XAAA 5DAXA 2WZR1 4L97A 1EPWA 2R072 2VTFA 2IXHA 2BRTA 4LBOA 4DUVA 1HXS2 3IIAA 2G9FA 1V6LA 3AM2A 1T2XA 2BZDA 5CKQA 3KB5A 4I02A 1PIV2 4IE4A 1WKYA 3O0WA 2VXRA 1IPJA 1TG7A 3MYXA 4W4ZA 3G7DA 4Z82A 4L2NA 1CZVA 3PVNA 4IQPA 2R16A 4XACA 5SV8A 3T2PA 5D8AA 1R081 2W1QA 4Z1VA 5IHRA 2HWB3 3IDBB 4BISA 4QKDA 4IEOA 3ZSKA 3ZYRA 3U1XA 3MUY1 3GF6A 4JDMA 3ILNA 2FDJA 4M3CA 4UI9L 2AZ5A 4B4PA 4QX0A 3MV01 3ZR5A 5C9AC 1FV2A 5IVVA 5K0UC 3N9NA 2R062 4QD2A 3ZYGA 1PNFA 3VBOB 3KWVA 1IG3A 2J1VA 4P9JA 4BK4A 5LA1A 1CAUA 1B35C 2XUMA 5FYVA 5GLTA 1JZ7A 4XJWA 2RVAA 2D3RA 2JENA 3I97A 4XBNA 5C33A 5LA2A 4UFLA 1KXGA 2PHWA 5G04L 3RI9A 1O8SA 2RMU1 4NHKA 3J26N 4M00A 1MEC1 3POYA 1AXZA 1M4WA 4TXWA 3IAQA 4XFGA 3U07A 3ZFEA 2WNVC 2VVEA 3R4UA 1BZWA 3SCHA 4N8MA 4Q0QA 3NV4A 1OI6A 4LHKA 1POV0 1QXPA 3KSCA 4LT5A 1MS5A 4QKFA 3M8LA 1KRIA 2HWC2 3PU8A 3SXWA 1XNBA 1UPIA 2OA2A 4AI9A 5JPNB 1NA1B 1WCUA 2WT2A 1HJGA 3KCXA 2BERA 1W05A 3AYCA 1JI6A 5FZ7A 2E7QA 3FHAA 1AJKA 1XU2A 4CU7A 3H9AA 1YI7A 2XJVA 4CDQA 3DYPA 1OUXA 2IFWA 1SFPA 4LO5B 1I5ZA 2VQUA 5FZLA 1NCQC 5CEHA 3O1UA 4HKOA 4NWWA 1YHFA 2WS93 2VTXA 2VCAA 4FP2A 2JDZA 3I59A 3NNLA 2UU8A 5FZDA 3I2OA 4Q8LA 4XIOA 2QTWB 3N9LA 2WO1A 1PO23 1V70A 2A71A 1C1FA 3WDTA 1JW6A 1OC1A 1WLTA 4BM8A 1X8EA 5F37A 2J1EA 3TOJA 5CFDB 2ID4A 1OUSA 2JD4A 3T0DA 1VP6A 4KL1A 2E51A 1NX9A 4YW2A 2RS51 4AI0A 4GH4C 3B3QE 4LO4B 4LBQA 1ND2B 4IEVA 3BU0A 1W06A 1WD3A 3ZFFA 3U4SA 3CJIA 3WDWA 5B4NA 2WFF2 2YC0A 3EMRA 1V9U1 1ALYA 3EYPA 3IMMA 1ZA7A 5GZGA 4OMDA 3PUSA 1GZWA 4CRQA 4HT1T 1W99A 4E4ZA 1W2UA 1C8NA 2PLV1 3AL5A 4LORA 2W5FA 3POBA 2MHFA 3H1WA 3QH7A 3WQ0A 1AR62 3IT8A 1X7NA 2R041 4KGQA 4PDWB 3V56A 1ZRRA 3WSOA 3TEWA 4RYDA 2VH9A 3IN9A 1BXHA 3OPTA 1W2TA 1LOAA 4O61A 1TVGA 5GLWA 3D0SA 3PVEA 4FOQA 4IE6A 5CU1A 5BNNC 5LCWL 3TEYA 4AF9A 1UOFA 1DQ2A 4WM8A 2YC2A 5FV3A 3EQEA 1UZVA 2ZX3A 3RZMA 1OD3A 4CXYA 2W3JA 4LA3A 1XPWA 4QX7A 1S55A 2CDOA 4RD7A 4BQXA 5AFBA 1R091 5FZKA 1X82A 1FMD1 3MPPG 5HPOA 2WR9A 5A6YA 1UAIA 5HBAA 4Q4X2 2WLPA 3HT1A 2WZR2 3WW2A 2BPA2 4E2GA 4RR3A 1UOBA 2VZQA 1G9BA 3L2HA 5D8AB 5A33A 4AEDA 3FWEA 5FZOA 3RYRA 4GKXA 5FAXA 2C4XA 4HOOA 4YW3A 4OLLA 3WHUA 4AFDA 4I3PA 2CHHA 5LA9A 1SLBA 5KC6A 1D0HA 1BMV1 4M3CB 4C1XA 3GYDA 4OULA 3HN1A 5DAPA 5F32A 3PUIA 3WEZA 3I49A 2AR6A 3I3MA 1QXRA 3LEIA 4NOTA 5CVRA 3A4UA 3VKLA 1FT9A 4Y5TA 1R082 5FXXA 5A7WA 4AQ2A 1PGL1 5IFPA 5FUNA 3BTZA 1PK6B 1CAUB 2IXLA 3UGFA 1HB2A 3LIGA 1VBB3 4EN7B 2WNUA 2LROA 2RV9A 4ZY9A 3ZXGA 2DUQA 3UJQA 3LEKA 1QWRA 4Y20A 2R1BA 1H6XA 5LEKA 5C3RA 4YZ1A 1EAH3 2P1BA 2GC0A 1K45A 3K46A 3QD6A 1RUG3 3WF4A 2IXKA 3WP6A 1BKZA 1LU2A 2R1DA 1GR3A 4URTA 3THTA 3ZSJA 4AEKA 5A70A 1S0DA 1U5YA 4B4RA 2TEPA 5L9VA 5HCHA 2RMU2 2NQYA 4KI5M 1H8TC 1S0CA 1MEC2 2RS11 1QXJA 2Z5WA 3I4IA 4L11A 4AE2A 4CP9A 2VW2A 5AFEA 2JE8A 4NHYA 2QFEA 2YPDA 3NKTA 4Q4V3 5I0UA 1AR81 4CPBD 4CDQB 1Y9QA 4BU2A 4N90A 2CY6A 5K9YA 3DF0A 1AX0A 4IEXA 1GP6A 4LHSA 4N9HA 4WM7C 4LKSA 1Q56A 1KITA 2O0OA 1MS9A 2CAVA 3CDZB 3AZXA 3I59B 4FSJA 5I91A 4WBBA 2P3JA 4DIQA 3UKVA 3VHPA 5BY5A 2E6VA 1G9AA 2XL9A 1STMA 3WP5A 1JYXA 1FXZA 4XFBA 5CNAA 4CCMA 1ZVFA 5JSRA 1K5MC 4JZRA 4BQWA 3N7KA 4XW3A 2C26A 2K0GA 2ZHNA 2X53S 3LFMA 2JIJA 1QJX3 1DQ1A 5DQ0A 3VZJA 1XXNA 3I2IA 3DXTA 1W8WA 3M2MA 3POJA 2D44A 5CG8A 4OCTA 2V4AA 2BNOA 1H6YA 1WCSA 2JB8A 4QDQA 4XZUG 1U5IA 1UYPA 3CJIB 4PQQA 1UU6A 2VPVA 3KD4A 3RPQA 1RUF1 4YGCA 1OQEA 4FXKB 4HSJA 1F15A 3VL8A 3T3YA 1ODNA 4XUTA 2W39A 2X5IA 2RS52 3N9PA 1GZWB 5FK7A 2RE9A 1POV3 5C4WC 1NZCA 2W94A 1W6QB 1FPN1 3OD4A 3VZOA 4XC9A 2EIDA 1LU1A 5FYSA 4AHWA 5BV6A 2Y6GA 4MADA 3J8F1 2DU1A 2A5ZA 2DCYA 3QLQA 3RG0A 1V9U2 2KXLA 4IERA 1LOBA 4BCUA 3CZUA 3MIFA 4C1WA 4CEYA 4DQAA 5B4XA 2AEZA 4ZKTB 5FWJA 5L7OA 1C1LA 5JXJA 5A7PA 3AP7A 2PLV2 1US2A 4PF5A 3FZ3A 4RHV1 5CADA 1R1A1 2DTYA 2JJ6A 1W0NA 1ZBA1 4K1YA 2VOWA 2JG9C 4L99A 5FZHA 4AFMA 5FYIA 3LCPA 2BBAA 4NPLA 5LB6A 4MHUA 2KA3A 2WN2A 3IB3A 2DURA 3Q8BA 2Q0AA 1KQRA 3VBHC 2KR2A 2B42B 4H55A 2BBVA 3IDEA 4I0BA 5FO8B 2LTNA 4JGZC 1ASJ3 1SFYA 3KZ4C 2LALA 4AQTA 4D6QA 5F2WA 2HWD3 5FY0A 4CUGA 4AVBA 3CQOA 3AMPA 1UYXA 2A3WA 1GNZA 1K12A 2VOXA 3ACFA 1Z7S3 3FLRA 4ISRA 4NWVA 5LK5A 5JDBA 1ENSA 2P2KA 1R092 3K48A 4EYUA 5IAXA 1FMD2 1DU3D 1E5SA 2JDNA 2QDNA 3BOPA 3E6DA 3O1VA 1CPMA 5KR7A 2ZGQA 3W20A 3GBWA 4XCAA 4J25A 1QJEA 5FPAA 3KV9A 5A7WB 4DNYA 2FCTA 1HQNA 3HPNA 2ZTNA 1GZTA 4B29A 3ALQA 1OQ1A 2VMCA 3IIIA 4FFHA 2BDRA 3W58A 3RZLA 1SDDB 1BMV2 1UNBA 1NQJA 3MF6A 1VLNA 3N35A 2UY9A 4XF0A 3DKWA 3FUOA 2C0ZA 2PAKA 5L19A 1C28A 4JVAA 2NM1A 4Y20B 2Y0IA 1GSLA 4LR4A 4QHZA 3B01A 1PGL2 2ARCA 4YM2A 2DVFA 1OVSA 4Q0VA 4ASLA 2BGPA 4S2HA 1SACA 2XLAA 3POWA 2J1AA 3VKMA 1Q43A 1I3HA 2P4EA 2IC1A 3U11A 4FFGA 4PF1A 2CWMA 5FTTC 2G19A 2XGXA 2A3XA 4XABA 1OF3A 1REEA 4MGIE 2QQOA 5LASA 4BWOA 4X8PA 3X29B 1N1TA 4QPWA 5FZCA 2Y60A 3OG2A 4ZONA 3B00A 3PURA 5J3UA 3PL0A 3KMHA 4P9LA 2UYAA 5T3NA 5LW9A 1VPHA 4CP9B 2VD7A 1W0OA 4L8QA 3H1YA 1QJFA 2HBTA 1OA4A 2QZ3A 4M01A 2XLGA 1NLSA 3OY8A 1XE0A 5FY7A 3WNNA 5LY2A 1GZCA 1DCSA 3ITQA 1H4GA 2RS12 3T08A 1ACCA 1W39A 3KCYA 3HR9A 3IZOA 1YEWA 3V64A 1OOPC 1YQ2A 2QQJA 2BFUL 4FP3A 2HWF1 4RGKA 2WAAA 3ETPA 1ZYBA 5G05L 4MV2A 3AJZA 3THCA 1AR82 3ZYBA 1KD7A 4LBMA 1SLLA 1DYOA 2GH8A 3AFKA 3B5LB 2A6VA 3ZFGC 2GU9A 5IVEA 5CB7A 4BDVB 4P9WA 2Y8KA 4E2QA 2J1TA 2ZXQA 4D3WA 2ZGOA 3I7DA 4QPIA 4NIDA 2DDUA 4AGRA 2VTXJ 4KGGA 4XQWA 1W90A 5DG2A 5FMOL 4E2SA 3M4FA 1O3SA 4EV0A 1ZA4A 2CTVA 1TME1 4IE7A 3PNAA 5FPXA 1WW4A 3S57A 3HMYA 1OLME 1H8VA 4FO9A 4M4PA 1RMU3 2X5IB 4CEWC 5JIUA 3ZYFA 4I09A 4FPOB 1BLZA 1WMDA 4QX8A 2P34A 2B45X 4QPGC 3DPRC 1YI9A 2RS31 2VBBA 3GM8A 5JIAA 4YFZA 5JOZA 1RUF2 1W8TA 3LOIA 2JXAA 4YZ2A 3R4SA 3VD4A 1LRHA 4CEYB 1PZ8A 3B9IA 4Y24A 1SHWB 2VUAA 2VL4A 5KHKA 3KLSA 3BIWE 5GKAC 1YYNA 1Q3EA 1FPN2 2XJSA 4QDSA 1TNFA 1MZFA 2Z42A 3LD8A 5T5LA 2Z79A 1UZ0A 4Q5OA 2FCUA 3J8F2 5DDJ3 5F39A 2CL2A 2QUOA 3T4VA 5ACA1 5KWRA 4NIAA 1LODA 2GN3A 1LKNA 4NR1A 5FLJA 3WW3A 4CCNA 4D6RA 5ABJB 1WBFA 4AQSA 5L36A 3CO2A 3AB0A 4Q4Y3 1HIXA 3WINE 3JBG1 5T54A 3H8UA 1O8PA 3O1PA 3AP9A 4FPJA 4RHV2 2VNRA 1R1A2 3D5OA 1ZBA2 4KWLA 3ZXEA 4CDUC 1VALA 1A34A 1W6OA 4Q4W1 2JDKA 3NNGA 2PHUA 1RHI1 5LWBA 2NMNA 5FLHA 2DWRA 2YU1A 4HLTA 3VZKA 2MPFA 3M70A 3S5QA 4LBLA 4AI3A 1V6NA 4H7LA 3O0XA 1HRI1 1DYPA 1KEXA 4K20A 5A7NA 3GZTB 1ULCA 2GC3A 1CR7A 2C9KA 1C8M1 2JG8B 3B7MA 4MLOA 5JZGB 4XMIA 1AYM1 1QY4A 1KFUL 1R64A 3WVJA 2A3YA 3V0BA 2N7GA 2W87A 4JQRA 2F6BA 3OGRA 2V5DA 2QBXA 4Z92B 3VBUA 1UYZA 2BFUS 4N43B 1QQP3 2BQPA 3ACLA 3FC0A 4FQ4A 4YVSC 2OW4A 1HV0A 3H3ZA 3OPZA 5FJHA 3U14A 1RUJ3 3S6PA 3VUOA 1RUOA 4CU9A 5C9AA 5K0UA 3NAPC 3SCGA 3WD5A 1XNDA 4QT6A 1VBB1 2DVDA 5IK5A 2ZGUA 4NHXA 1CN1A 2NYYA 5BNOC 4GULA 4TSVA 3VDDA 2GZWA 2Y6HA 2YBKA 5F1RA 3KM5A 2WUHA 5JXGA 1B35A 2D6LX 5JXHA 5ANNA 4KMQA 2WZEA 4BMEA 1SBDA 4NVPA 2H6BA 1QJY3 4YZ5A 1EYBA 1G8WA 5JI9A 2PELA 1NE4A 3GJBA 4AHXA 5C71A 1YIPA 2WAOA 2A6WA 3CLPA 1RVF3 2R6QA 3OY8B 4P00B 3A7QA 3VKOA 3VDBA 4C91A 3OYWA 2VAUA 1HJFA 1LNSA 1UL9A 2BP6A 1X36A 4BZ4A 3NJZA 2XBO1 1GZ9A 4KWJA 5A6ZA 1AYN1 2OT7A 4AVSA 2CSGA 1XE7A 5LK7B 2QNKA 4HVOA 1OLRA 1OQDA 2WYSA 4EWAA 2E53A 2AGSA 2PXJA 4AEDB 4B3NA 1XYOA 2G1MA 5A80A 4COYA 3BU7A 1BVP1 4EN0A 5EXOA 5C3OA 2JDAA 1CESA 1CPNA 1MACA 2ZEYA 4NO4A 3ZXDA 3AMMA 2RHPA 1HB4A 1NCQA 1OHFA 4B7KA 5F8PA 2HWF2 5J98B 2R0HA 2D43A 2UURA 2YGMA 2ZEWA 3GZAA 4QPIB 5A1FA 4QXCA 1UU4A 3IDCB 4LBJA 2XH6A 2RG4A 2ORZA 2D6NA 2DU0A 2AENA 2VMIA 1ZZ8A 1KS4A 1KJRA 5CZKA 5F6LB 2XJUA 4BOWA 4YM0A 2GP3A 4I0WB 1NCRC 3ECQA 3H3LA 3WCRA 2VULA 3OEBA 1WA6X 5HCBA 3H8RA 1YFWA 1L7RA 1ONAA 1QKQA 4D8MA 1LOFC 1WW6A 1LOGA 2WC2A 4GALA 4HZFA 5FZ4A 1NA1A 2EXIA 3KT7A 1VBE1 3WP3A 1TME2 5K4LA 4FTBA 3VN4A 3JUUA 3N7MA 4NAOA 4EQVA 3OGJA 2XHNA 4XBQA 1WGPA 3LFIA 5FIXA 2VXJA 3O1MA 1OSGA 2W47A 3VHNA 1DIWA 2A6XA 3VBRA 2VECA 2GALA 1HQLA 2WIIB 4MGZE 2JDPA 1WCDJ 1PZ9A 4O7XA 4MHRA 5A32A 1REDA 1F4HA 2RS32 5EIYB 2ET7A 3PHMA 1FI2A 1QJU1 1RUH1 3T0BA 2KM2A 2J42A 4OHXA 3S7EA 1LOEA 4A7YA 1RC6A 4I30A 2ZA9A 3WF3A 4BQ2A 4RS5B 2QCSB 4WV8A 4DB5A 1PO11 2NLRA 4IETA 2FD8A 3TN93 1GWMA 3FHQA 5FPVA 1W6OB 1NQDA 1CD3G 3CNAA 5ACA2 1LULA 2Q1MA 4YW5A 2WQ4A 2O8QA 2ZX4A 4WVZA 4TTGA 3M3QA 5IUQA 1ND2A 3JBG2 3ME2A 1KDKA 4MGSA 2CV6A 4BQ4A 3K3NA 3GCXA 4B4QA 3IDAA 1YUDA 2ADEA 3M7AA 1Z7S1 4IV1C 1SLIA 4RL7A 2ZGTA 4URAA 2YC4A 4Q4W2 1GNYA 2Q8DA 1RHI2 1UQXA 3D6EA 5FO9B 3VBUB 1AJOA 3PDQA 1HRI2 4HVRA 5CKMA 4XBLA 1UF2C 1N3PA 1IS4A 3O12A 1C8M2 4Y4YA 1CAXA 1IHMA 2FMDA 3E97A 4QXBA 1AYM2 2DCZA 2XDVA 4GD4A 4LKFA 5C9AB 5K0UB 2PYTA 4FQZA 3RQ0A 4LOSA 1JZ3A 2YU2A 1ENRA 4N53C 4OYUA 1PMIA 4W6YA 2V09A 4IUGA 4AR2A 1JYVA 5FPZA 3AKTA 3ZYIB 2ZZJA 4P5YA 5CFCC 2Y0OA 2Y38A 1B35B 2G4IA 1YC61 1WMXA 4AWDA 2E7AA 3V0AA 4XTMA 1QOTA 1IQAA 1VBB2 3ILFA 2EXJA 4CP0A 2WO3A 5JVVA 1PVC1 3K4DA 1APNA 5FY4A 4E8DA 4E9KA 3OCPA 3SISA 2WNVB 1OA2A 3WUDA 4IGQA 4UYBA 2UY8A 3BCWA 4ZS2A 3S7IA 4OI4A 4RN5A 3SITA 1JHJA 2DBNA 3TBDA 3OYWB 5A7OA 4NN0A 5A6XA 1HRV3 4XJ8A 5I0TA 3ZMNA 4UBGA 4K7JA 1GQHA 3WF2A 3HIFA 1H8TA 2R30A 3DKQA 2TNFA 4ARYA 4WZCA 4PI0A 5C8CC 3AVSA 4PHZA 4BMBA 1GP4A 4CDXC 4DINB 1UZZA 3O1OA 5AVPA 3OD0A 3MFAA 3H8OA 1ND3C 2P3KA 4R9BA 4RQPC 3BKZA 5EP9A 4GJYA 2GSYA 1PK6A 2W1SA 2ERFA 2XBO2 2MEV3 4GMP1 3HAGA 1AYN2 2GAUA 1S0BA 2WLQA 3SKJE 2QQIA 3VZMA 5JAXA 3DECA 1NCQB 3KHCA 4WM7A 1CX4A 1AZDA 1K5JA 5A3UA 1UY4A 2GH2A 4XURA 3AP4A 4DUXA 4M3CF 2BUKA 3JB4C 1RUI3 2VCMA 3JD73 4FOYA 2EIBA 1YCIA 4MH0E 4YZ4A 5FYYA 1UMIA 3TNQA 5CA6A 2I74A 4QWNA 1WD4A 1ZBE3 2X05A 5JSOA 1K5MA 1BQPA 3MZHA 1W8HA 2WWSA 4YM1A 1KDMA 1J3QA 4QQHA 1DGLA 4BPZA 4ONUA 1EPZA 3VB9A 1M06G 3APBA 2AH2A 2W95A 3LA3A 2HJIA 4LIVA 2TUNA 1MQTA 2BOJA 1E5HA 4HL0A 3IAPA 1QHDA 1JTZX 3TB0A 5FQ0A 5LRSA 4RA0A 1FOD3 2ZEXA 1SEFA 4R4ZA 2OIIA 4XCBA 1U5XA 1W9FA 3VBRB 3ABZA 1EV13 2ZJCA 5A32B 5C4WA 4YG0A 1VBE2 3ZXJA 3DUIA 2JD9A 1VBC1 4BIFA 1UZYA 3GHMA 3MGUA 4H2AA 4NE9A 1IS5A 1OA3A 2ZPXA 1T6GC 1DQ0A 4Y1YA 2J22A 1XC6A 4BIOA 4KU8A 2AEYA 2W0XA 4TN7A 3SC7X 4RFRB 3A21A 3N9OA 1QJU2 1YQ6A 1CX1A 2A73B 1RUH2 1UOGA 1UPSA 4LHNA 2ARAA 2Y6LA 1LR5A 2XR4A 2E7TA 1UY2A 5HI0A 1MS0A 3WG2A 1PO12 1COV3 4BQ3A 2OZJA 2FDIA 2H0BA 1O3RA 5FRAA 2YFZA 5LY1A 3QOPA 5CG9A 5A7QA 2Q8OA 4XF9A 3HD8B 3SCFA 3UYJA 3C3VA 1YLLA 3PMEA 2ET1A 4I01A 3K51A 2C9AA 4JGYC 5AVAA 4S2DA 3RWKX 2O8OA 3FMGA 3A0NA 2ZMKA 2ZAHA 1X33A 1N3QA 1U0AA 1IG0A 2Q1FA 1W6QA 2V72A 2BWCA 1Z7S2 1CAXB 4OI0A 4HETA 1HB1A 2RJ2A 4G3YC 3EB7A 2ARXA 1ZRFA 3D82A 4WVMA 4CDWA 4Z07A 1RUJ1 2BJSA 3T2OA 2UWCA 1F8VA 4A7KA 2VZPA 4MXWA 3BGAA 2PFWA 1RUC1 3HJRA 1X50A 3V0AB 1D4M1 4UFJA 1W2AX 2VZOA 4WVWA 2NPIA 2Y6JA 3GHNA 3QCWA 1YNAA 5DAWA 4DPNA 4F7ZA 2RR11 3RJ2X 4JX0A 4Z8BA 1W0PA 5KBFA 3CJXA 4YGEA 4YVWC 1I9RA 5KXDA 4E4HA 4YSFA 1YJLA 1F5FA 2W2IA 2XQRA 1XBFA 3LDKA 3SEPA 4YARA 2D3SA 2W08A 1BEV1 4PBOA 2HWE3 5I8SA 1PVC2 5AC91 4DY3A 1H8TB 1RVF1 4UFIA 4DS0A 4DY5A 3N4MA 3NO8A 5DUUA 3WQ7A 5BYNA 1ZRDA 1O4ZA 3I3QA 3U4XA 1W3XA 3MF9A 1RUE3 5FZ8A 1HLCA 4AFCA 1JN2P 1YJKA 3POIA 1VBD1 4PBPA 1S2KA 3J7HA 3LAGA 2YHJA 4QB6A 5FPBA 3RZZA 3WCSA 4C8DA 4EE2A 2B46X 4GB33 4UF0B 1D0GA 4WM7B 2RM23 3LA2A 1OKQA 2C1FA 3C7FA 3WOGA 4P5HA 1OOPA 3Q9OA 4LLOA 3LKJA 1S0IA 3P3NA 2HBUA 1LHWA 4OUSA 3B69A 3U10A 2XVLA 4XQ4A 1FYUA 4LK7A 4OI1A 3PJYA 1NT0A 3JQWA 2DFCA 3AKPA 1K5MB 2ZGPA 3K77A 3ZYPA 5JCTA 5GM0A 3VBSC 3MW2A 2R073 4NJ4A 5DZGA 2BVBA 2VOTA 4CXWA 3NKGA 4YW4A 5C70A 3T2QA 2ZBJA 2VY0A 1MQTB 2P37A 1L3JA 2ZKLA 3VV1A 4D94A 5JMCA 1RUD1 1PIV3 4YZ3A 1CAWB 2PQSA 3MICA 4IV3C 5FQ0B 3ZR6A 3W5NA 2V4VA 4AI2A 3ZVXA 3ELNA 2CYFA 4R9CA 4PLNA 2Q4SA 2VMHA 4CEWA 3ZLIA 1J83A 1X9TA 2ATFA 4XUQA 2ZHMA 2C6SA 3GJAA 4XOGA 2WWUA 3ZO0B 5D8AC 5C4WB 4FTEA 4QPGA 3ORJA 1QNYA 3DPRA 3FE5A 3Q8AA 2X10A 1J3RA 3J7LA 2R063 4PJYA 1AVBA 4LO6B 5I8TA 5FJKA 1GWKA 1OPOA 2G9GA 1LJ7A 1F4AA 4R8HA 2YB7A 1KS5A 2VBDA 5BNPC 3RI8A 1CZSA 1Q5OA 1VMFA 1AR91 3KF3A 2JDYA 3MW4A 4R9AA 1WCQA 2WN3A 3ZKYA 3WQBA 3ZXAC 1VBC2 4KH9A 1WUVA 4TWTA 5IAVA 2JG9B 3N36A 1JZ4A 3AFGA 2JDMA 3ATGA 3ZIWA 4EROA 1YIFA 4AQ6A 2QDRA 4U2AA 3SMHA 3VBHB 2SBAA 3RS6A 3AZZA 4Z2AA 3ZX7A 4Y4RA 4JGZB 2F4LA 4AL9A 2GMMA 1RTVA 5I0SA 3ZFEC 4COUA 1FV3A 4P02B 1XYNA 4XJUA 4EN9B 1ENXA 4OHYA 1UKRA 3KGLA 3MW3A 1JZ6A 3ZOIA 1DDLA 2HWC3 5A3PA 2C24A 2ZABA 4IESA 4ZU5A 3FLTA 5EHDA 5IATA 2WZPP 4EN8B 4GQ7A 5BPXA 3ZN6A 4A4AA 4HPKA 4QU2A 4PIYA 4S2FA 2SLIA 1V0AA 3H50A 4FPEA 3BI3A 4WVMB 4CDWB 1H9WA 2GNDA 2RDNA 1MPXA 1HDKA 1LGBA 2D93A 1JUIA 1BBT1 1JOJA 2DV9A 4CSWA 1NOVA 2Q8CA 2GNMA 2Y6FA 2XPJA 4FTSA 4MXWB 2R042 3I3EA 1A8MA 4YVSA 5C5TA 4ES8A 3C2UA 5J1XA 4CPBA 4OHVA 4HSLA 4M0HA 3WT3A 5ABJA 5ISLA 2GDFA 4M0NA 1RUJ2 2XQXA 1DYKA 3DN7A 2LRPA 3ZXLA 2FDFA 5A1AA 3DYMA 3NNFA 5CBLA 5HCFA 1RUC2 4ATFA 3UK9A 4V2WA 3D0JA 4V1PA 3K4ZA 1D4M2 2HYXA 2YG0A 4FBFA 5GLZA 5F9TA 5D21A 2PQQA 1XSQA 2YZ4A 4CUCA 5IVJA 1J1LA 2RR12 4AK3A 4AYUA 2JKBA 4FPHA 4GWNA 4Y5Z0 3NJXA 3MEPA 3GBGA 3VD5A 4AFBA 3NL1A 4HVQA 3FBMA 2ZGLA 2JG8A 3K2OA 4KNCA 4OUEA 2HWB1 5JZGA 4JKKA 4EWEA 3ENRA 4CCDA 1MS1A 5FY1A 3OB8A 1J58A 3ZFFC 1LGNA 1ZZ7A 2D6MA 1DLCA 2P3IA 5FO7B 4A7ZA 3JQXA 4LLFA 4CCOA 1BEV2 2MNGA 2ADDA 1TE1B 4N43A 4OHWA 4ZXKA 4CCLA 2B39A 5AC92 2DUPA 1XJAA 1RVF2 3LSDA 2GC1A 4XDQA 1U12A 1AR63 5A3TA 2VMDA 3WV6A 5DMYA 1SDWA 1OOPB 2WNEA 2OPWA 1VBD2 3VD9A 3W9AA 2BGOA 1W8OA 1ST8A 2ZX1A 1LB2A 2VOKA 1PGSA 1FNZA 4JKMA 2R49A 3PLQA 4XJZA 3JD71 3ZFGB 1SZBA 3O1RA 4AFAA 5FUPA 4BK5A 4J1WA 1W9SA 2VVDA 2ZCWA 4WM8C 4LTAA 3DEMA 4MUVA 1WZXA 4IEWA 4J6GA 1CGPA 1TMF3 2F17A 3N3HA 4UW6A 1MR5A 4MXVA 4CCJA 5A1LA 4IL7A 4QXHA 2DTWA 5A3OA 3LQCA 4NIIA 1GP5A 1LHVA 1DP0A 1MZ5A 1KJLA 2WKKA 4IEUA 2WZR3 2P5BA 4Q4X3 3WDXA 4HKLA 2O14A 3HNMA 4XPVA 4JAAA 1UY0A 3AK0A 1CQ9A 2ZX0A 4CEWB 5T5JA 1NCRA 5IK4A 2WWJA 1PVXA 1XNKA 1XYPA 4OI2A 4RR3C 3WG4A 5JLVA 4QPGB 1VRBA 4CZSA 4QM8A 1RUD2 3I2HA 5T5PA 3DPRB 3AKRA 3CEWA 2AACA 3VBFA 2CGOA 2JB4A 3GZEA 3MIHA 4AAPA 4D7YA 3DYOA 1JUHA 1C57A 1EV11 2LM3A 3KVBA 4QQOA 2LW8A 3BTYA 5K7PA 1EUUA 2NN8A 2VZ1A 2WS91 1R083 4ITCA 5KHJA 2QKDA 2I2SA 3D3AA 4X6RB 3K75B 2WQZC 2IXJA 4FT8A 1VAMA 2L9LA 3O1TA 1GUIA 5DUXA 1PO21 2XOMA 5HCAA 3QBQA 1EY2A 1AF9A 1F31A 4G4FA 4MGYE 5F3GA 3ZXFA 1A8DA 1PZ7A 4QB2A 4NIGA 3KT4A 1OH4A 2WNUC 3LDBA 1RJ7A 1T6BX 5CYYA 5FZ1A 1H1IA 3UKTA 3VGIA 3BVCA 3RZGA 1UX7A 5H9QA 5LA0A 3WHTA 1CONA 1AR92 2UWAA 1NY71 3RGBA 1Z0HA 4QAWA 3CIHA 1JYIA 3W5MA 3AMHA 2JE7A 2BOIA 2W68A 4A3ZA 1I6XA 2IUWA 4QX2A 1CWPA 3CL1A 4XDPA 3P1IA 2GC2A 1WW7A 1UX6A 1C4RA 3Q8EA 1F35A 5FYCA 2V73A 5FP7A 4FPFA 5FYMA 4Y3OA 3ZN6B 1YWKA 4HPKB 2OUJA 3WDVA 3OGSA 2FHRA 4NHLA 4FCAA 3THPA 3WQ1A 3AYEA 4UBHA 1RB8G 1US3A 3VHRA 1MS8A 4LXLA 1ULEA 2OKXA 5JSPA 4N7IA 3A22A 3MBWA 4MO3M 3NWKA 2EA7A 3Q8FA 4YVSB 4Y1VA 2Z4FA 3LA7A 1OBNA 3D8CA 4ISQA 4YRDA 4RS5A 4KU7A 1YO8A 1BBT2 2YBSA 3OUIA 3LZZA 5BNOB 2XWJB 3MLJA 3WR0A 1DG6A 4B1MA 4Q1RA 1JZ8A 3WNKA 4NRQA 5EYXA 1BK1A 3ZMOA 3THDA 1D2QA 1VRH3 4INDA 1A6CA 1GQPA 2VM9A 2XJPA 1PX3A 2D7FA 1YQ8A 4PLOA 4A44A 3J7NA 4OFGA 1IZ3A 3WNXA 1DHKB 3GALA 1QU0A 4YGBA 2W52A 3IKWA 4XVHA 3I2KA 2NMOA 3BB6A 4PT6A 3MIEA 3VZLA 3GZUC 1H1MA 3J7MA 2QQMA 2VQAA 2RS53 4XXAA 4COWA 4CUBA 2X5IC 4M3CE 4E27A 2CGPA 3OBAA 1IS3A 4K6BA 4RGGA 2HWB2 2YXSA 3AZYA 1JH5A 3ETQA 3EBRA 4OZXA 3KVAA 5DAVA 1V9U3 2DVGA 1V00A 3MIGA 3L9JT 2XUEA 4CE8A 1LEMA 1SLAA 1ND3A 5GZFA 5FYUA 4P9XA 3OOXA 1C5IA 2PLV3 4CEYC 4LMFA 1FATA 1RJ8A 1OD5A 2WA3A 4LUKA 5EZWA 3WDYA 5L7OC 3UGGA 2A6ZA 4GZ9A 1EAH1 1QNWA 1SLCA 2K9ZA 1SPPA 3DXUA 5FOBB 5I0DA 1DQ5A 1RUG1 2UYBA 2G9ZA 4OHZA 1ZZ6A 3E6BA 3OEAA 4XMAA 1C3HA 5IVFA 3CZJA 4TYSA 2DVAA 2WNVA 3AC0A 2VUCA 5IK8A 3JD72 3E5XA 3OTFA 3IMNA 5CKNA 3NSTA 1DZQA 1NCRB 1QGLA 3AX4A 4LBNA 3UJOA 3ZYJB 1R093 5FKBA 3UESA 1FMD3 4Q4V1 4N7UA 5EV7A 4BQ5A 4QX1A 1YFXA 2Q5TA 1QMJA 3VBFB 2D3PA 4COZA 1CJPA 1VIWB 2ZS6B 2DFBA 1AXKA 2HYKA 4W50A 2WBKA 1W9YA 3T1MA 2VMGA 2ZGNA 5FZ0A 2YMZA 4K9SA 5FMCA 2VG9A 3N7JA 4AGGA 3DCQA 4DXSA 1XB9A 4H7MA 1AL23 1H2LA 3FBYA 1EV12 3UGHA 1O4TA 4ORFA 4F83A 2WS92 4K21A 5EFUA 1JYNA 2RDSA 2GMEA 3RJRA 1OVPA 1QJX1 3KCCA 3PU3A 2OUHA 2WINB 1PO22 2K2SA 1QJZA 3DL3A 2QQKA 3NNMA 1KFXL 2FMYA 1ZZBA 5F3EA 3KF5A 2I07B 2EICA 1A78A 2BTVC 4HFSA 4OMCA 4PQ9A 4R52A 1UO9A 4Y5SA 3T09A 4NIHA 4GH4A 3RYKA 2OYZA 3F95A 3M3IA 1NE6A 2D5HA 3B9CA 4HG6B 5KHHA 3SH5A 4ASMB 1RITA 4D7TA 1UKGA 3BODA 3ZSLA 3HEIA 1NY72 4MSVA 1POV1 1NXD1 4IV1B 1NKGA 4JGYA 3FHIB 4S2GA 4FXGB 3WG1A 1NYWA 4AW7A 1V6OA 2O1QA 2YYOA 3ZSEA 4RSUA 3SEEA 1NG0A 1URXA 5FZ6A 4BH9A 1I1EA 3ZN4A 4XTPA 4O65A 1S2EA 1LGCA 4IEQA 1VB2A 4NRMA 3EO6A 5IW0A 3PIGA 3OBRA 3D4KA 1OKOA 1AR83 3GCWA 4YFWA 5J96B 4JTOA 5IFTA 2HEYF 4WZFA 2ZHLA 1SG3A 3PUHA 2XKPA 4IEYA 3NJVA 3VDAA 3RMXA 5BNNA 2JE9A 4R9DA 1S0JA 1JS9A 4LOTA 3N9QA 1NZIA 3UKNA 1ASJ1 3WDUA 1DBNA 3NJYA 3I2DA 3OF1A 4XF4A 3WZ1A 4GJZA 2E31A 3WF1A 1ULPA 2HWD1 4CTEA 4TZDA 4QPIC 4QU1A 1QOOA 5FWEA
chains in the Genus database with same CATH topology
5FZOB 5FYUA 5FZBA 4GAZA 2WWJA 5FWJA 2PXJA 5FYVA 5A7PA 1VRBA 5FY4A 5FXWA 5A80A 5IVBA 5FZAA 5FZOA 2XMLA 3DXUA 4HOOA 4AAPA 5FZHA 4IGQA 4Y4RA 5FP9A 3KVBA 4QX8A 5FP3A 5FYIA 5IVYA 5F32A 5FBJA 5A7OA 5IVFA 5FZEA 5A1FA 4QXCA 5FYBA 5FXXA 5F5IA 5A7WA 5FY8A 5FUNA 5A3PA 5F3GA 4D6QA 3AVSA 4IGOA 5F2WA 4CUGA 5FPLA 3PUQA 5FY0A 3PU8A 3LDBA 5FYHA 5FZFA 4AI9A 2XXZA 5FZ1A 2GP5A 2GP3A 4GJYA 3LD8A 3N9MA 5FZIA 5F39A 4EZ4A 5FZ9A 4LITA 4E4HA 4CCKA 5F3IA 5FZ7A 5FZ4A 2W2IA 5FPUA 4D6RA 5KR7A 5FZMA 4CCNA 4CSWA 2Q8CA 4EYUA 2OS2A 5FZ0A 5K4LA 5FPAA 5FZGA 4ASKA 5A3WA 3KV9A 4XDPA 5FZLA 5A7WB 5CEHA 2XUEA 5FYZA 5FYCA 4LIUA 5FYYA 5FP7A 5ISLA 5FYMA 4Y3OA 5LWBA 4QWNA 5FZDA 3PTRB 5FZ8A 5FY5A 2YU1A 3N9LA 4C8DA 5FPBA 5FXZA 3KV6A 3PU3A 5A7NA 5FYTA 3AVRA 4UF0B 2OX0A 4V2WA 5E6HA 4DO0A 2YPDA 2Q8EA 5A7SA 4HONA 4LIVA 4XDOA 5FZ3A 5F37A 4LXLA 4BU2A 3OPWA 5IVJA 5F3EA 2OQ6A 4UF0A 5FP8A 3K2OA 5FPVA 3ZPOA 5FXVA 5FY1A 5FY9A 4DIQA 3U4SA 5FZCA 2YBSA 2YBPA 3PURA 5FJHA 4Y33A 4CCOA 5LW9A 3RVHA 4CCLA 4V2VA 2VD7A 4CCMA 3K3NA 5F5AA 3PUSA 4URAA 5A3TA 5A3NA 5FY7A 5IVCA 3AL5A 2YBKA 2Q8DA 5LY2A 3AL6A 5FZ6A 5ANQA 4D6SA 4IGPA 3DXTA 3PDQA 5IW0A 4TN7A 2OQ7A 3N9OA 5F5CA 3ZLIA 3OPTA 5F3CA 5IWFA 3KV4A 3KV5A 2WWUA 2P5BA 5FP4A 4QXBA 5FUPA 2XDVA 4GD4A 4NUBA 2YU2A 3N9QA 3N9PA 4EZHA 5LY1A 5FV3A 5A7QA 4BISA 3NJYA 4CCJA 5FJKA 5A1LA 5IVEA 4QX7A 3UYJA 4GJZA 3KVAA 4QXHA 4BXFA 5FYSA 3U78A 3N9NA 5IVVA 3PUAA 5FZKA 4QU1A 3K3OA 2OT7A 5FWEA 5F2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZO B;  5FYU A;  5FZB A;  4GAZ A;  2WWJ A;  5FWJ A;  2PXJ A;  5FYV A;  5A7P A;  1VRB A;  5FY4 A;  5FXW A;  5A80 A;  5IVB A;  5FZA A;  5FZO A;  2XML A;  3DXU A;  4HOO A;  4AAP A;  5FZH A;  4IGQ A;  4Y4R A;  5FP9 A;  3KVB A;  4QX8 A;  5FP3 A;  5FYI A;  5IVY A;  5F32 A;  5FBJ A;  5A7O A;  5IVF A;  5FZE A;  5A1F A;  4QXC A;  5FYB A;  5FXX A;  5F5I A;  5A7W A;  5FY8 A;  5FUN A;  5A3P A;  5F3G A;  4D6Q A;  3AVS A;  4IGO A;  5F2W A;  4CUG A;  5FPL A;  3PUQ A;  5FY0 A;  3PU8 A;  3LDB A;  5FYH A;  5FZF A;  4AI9 A;  2XXZ A;  5FZ1 A;  2GP5 A;  2GP3 A;  4GJY A;  3LD8 A;  3N9M A;  5FZI A;  5F39 A;  4EZ4 A;  5FZ9 A;  4LIT A;  4E4H A;  4CCK A;  5F3I A;  5FZ7 A;  5FZ4 A;  2W2I A;  5FPU A;  4D6R A;  5KR7 A;  5FZM A;  4CCN A;  4CSW A;  2Q8C A;  4EYU A;  2OS2 A;  5FZ0 A;  5K4L A;  5FPA A;  5FZG A;  4ASK A;  5A3W A;  3KV9 A;  4XDP A;  5FZL A;  5A7W B;  5CEH A;  2XUE A;  5FYZ A;  5FYC A;  4LIU A;  5FYY A;  5FP7 A;  5ISL A;  5FYM A;  4Y3O A;  5LWB A;  4QWN A;  5FZD A;  3PTR B;  5FZ8 A;  5FY5 A;  2YU1 A;  3N9L A;  4C8D A;  5FPB A;  5FXZ A;  3KV6 A;  3PU3 A;  5A7N A;  5FYT A;  3AVR A;  4UF0 B;  2OX0 A;  4V2W A;  5E6H A;  4DO0 A;  2YPD A;  2Q8E A;  5A7S A;  4HON A;  4LIV A;  4XDO A;  5FZ3 A;  5F37 A;  4LXL A;  4BU2 A;  3OPW A;  5IVJ A;  5F3E A;  2OQ6 A;  4UF0 A;  5FP8 A;  3K2O A;  5FPV A;  3ZPO A;  5FXV A;  5FY1 A;  5FY9 A;  4DIQ A;  3U4S A;  5FZC A;  2YBS A;  2YBP A;  3PUR A;  5FJH A;  4Y33 A;  4CCO A;  5LW9 A;  3RVH A;  4CCL A;  4V2V A;  2VD7 A;  4CCM A;  3K3N A;  5F5A A;  3PUS A;  4URA A;  5A3T A;  5A3N A;  5FY7 A;  5IVC A;  3AL5 A;  2YBK A;  2Q8D A;  5LY2 A;  3AL6 A;  5FZ6 A;  5ANQ A;  4D6S A;  4IGP A;  3DXT A;  3PDQ A;  5IW0 A;  4TN7 A;  2OQ7 A;  3N9O A;  5F5C A;  3ZLI A;  3OPT A;  5F3C A;  5IWF A;  3KV4 A;  3KV5 A;  2WWU A;  2P5B A;  5FP4 A;  4QXB A;  5FUP A;  2XDV A;  4GD4 A;  4NUB A;  2YU2 A;  3N9Q A;  3N9P A;  4EZH A;  5LY1 A;  5FV3 A;  5A7Q A;  4BIS A;  3NJY A;  4CCJ A;  5FJK A;  5A1L A;  5IVE A;  4QX7 A;  3UYJ A;  4GJZ A;  3KVA A;  4QXH A;  4BXF A;  5FYS A;  3U78 A;  3N9N A;  5IVV A;  3PUA A;  5FZK A;  4QU1 A;  3K3O A;  2OT7 A;  5FWE A;  5F2S A; 
#chains in the Genus database with same CATH topology
 2XWB B;  1NLQ A;  1UU5 A;  3MPB A;  4XQD A;  2GNT A;  4YVW A;  4GAZ A;  2IVJ A;  5E88 A;  2PA7 A;  3U0Z A;  4IE5 A;  2WSU A;  1H9P A;  1HN0 A;  4P14 A;  2VOV A;  5LBE A;  4I2O A;  4LUM A;  5GLV A;  3ROU A;  3MHZ A;  4KBB A;  1HV1 A;  1OLM A;  4W65 A;  4X6Q B;  1LHU A;  2BNM A;  1YRZ A;  1R1Z A;  5FP9 A;  3PMS A;  5FP3 A;  3WW4 A;  1X8M A;  1MS3 A;  1RUF 3;  1O6U A;  2WFP A;  3LIH A;  2JWP A;  4LQR A;  1PNG A;  5FCC A;  4XFH A;  4CCE A;  4MGQ A;  5C8C B;  5I93 A;  1H2M A;  1MVQ A;  5L9B A;  2DBI A;  1UOJ A;  4XJA A;  1ND3 B;  2XJQ A;  4RQP B;  4H3W A;  5FY8 A;  2Y26 A;  4N9I A;  4YYO A;  5J36 A;  3JZV A;  4Y26 A;  1FPN 3;  5H9S A;  1SCR A;  3W59 A;  4BLJ A;  2BU9 A;  3M3E A;  4JHT A;  3PUQ A;  3WNO A;  3J8F 3;  4NPM A;  3O14 A;  4AXO A;  1LTE A;  2B7Y A;  1H30 A;  2WO2 A;  3PIJ A;  3VHO A;  3ZSM A;  5A6Q A;  1SPP B;  1CZT A;  3FFZ A;  3N9M A;  5FZI A;  3O0V A;  4UW3 A;  1N47 A;  2VU9 A;  3IWZ A;  2FCV A;  1F2N A;  3UET A;  3BPZ A;  3VKF C;  4TLG A;  3RMY A;  1IKP A;  1AL0 G;  1HW5 A;  1SFN A;  3GXU A;  1R1A 3;  3OGV A;  3G6J B;  4RHV 3;  2Y33 A;  1XSR A;  1ZBA 3;  3USU A;  3V65 A;  2VME A;  3ZDS A;  4EWD A;  3BIE A;  2XHK A;  1TMF 1;  3OBT A;  1EAH 2;  1OUR A;  3C7O A;  2VNG A;  1JOB A;  2CU5 A;  3BN6 A;  1DGW X;  1H1A A;  1RUG 2;  3L2Y A;  3KQ4 B;  1GFF 2;  1GOH A;  3R05 A;  5ERL A;  4ZXE A;  4DEQ A;  4MOA A;  4HN0 A;  2X29 A;  2VZT A;  4XEZ A;  2CDP A;  4DXZ A;  3JB8 A;  1QH6 A;  5I0R A;  1ULF A;  2WNO A;  5KHI A;  1RXG A;  1GNH A;  4IV3 A;  4NPR A;  4HKW A;  3B02 A;  3FN9 A;  1LOC A;  1UY1 A;  2PHF A;  2QQW A;  3J9S A;  4A6S A;  4XFC A;  3TNP B;  4Q26 A;  5C3S A;  2ZZQ A;  4Q4V 2;  4UF0 A;  4JRL A;  3R0R A;  4H14 A;  4UT5 A;  3VBU C;  4GA9 A;  5HXV A;  1CIW A;  1TEI A;  3HN3 A;  5DZF A;  5FBZ A;  1VAV A;  4HAN A;  3KT1 A;  2ZHK A;  4MX3 A;  2IXC A;  4NMI A;  4Y22 B;  4K8R B;  4DMI A;  3FJS A;  4XUN A;  3J4U H;  3R4D B;  4YPJ A;  3RVH A;  1N3O A;  3CF6 E;  2HEV F;  1SMV A;  5BNP A;  2TBV A;  1W3V A;  2LS6 A;  2WT1 A;  1ZZ9 A;  2H0V A;  3HNB M;  3VDD C;  5JOX A;  4LBQ D;  5EQU A;  5JR7 B;  2FZ2 A;  2YDE A;  1PX4 A;  4CUA A;  2JDU A;  3GBF A;  3AMN A;  4GH4 B;  4P08 A;  4B1L A;  2XJT A;  1JOP A;  1QJX 2;  1RMU 1;  4HXC A;  2J1R A;  1Y3T A;  1E5I A;  1GIC A;  2FDG A;  1B09 A;  2VGD A;  1CAW A;  3NW4 A;  2QQU A;  4FPG A;  5FP4 A;  4OQ9 A;  1ZRI A;  5D1I A;  5BUV A;  2EIE A;  4JGY B;  5FMB A;  3I3B A;  4A45 A;  3IBM A;  5DXD A;  1POQ A;  4COV A;  1J59 A;  2X09 A;  1OLQ A;  2XJR A;  1QDC A;  2W9X A;  1ZRE A;  3AJY A;  1EUT A;  4A3X A;  4E4S A;  4YM3 A;  4UFK A;  4QGL A;  2A6Y A;  4Q0S A;  2BNN A;  3K3O A;  1QH7 A;  2QE3 A;  2ILM A;  2OVU A;  3T30 A;  3NV2 A;  2Q8E A;  2RJL A;  5FZB A;  5DDJ 1;  3EHK A;  3RNS A;  2A75 A;  3VD7 A;  1GAN A;  3I2J A;  4DRV A;  1LEN A;  4JKL A;  1ODM A;  3VBO C;  5EJ3 A;  4K1Z A;  2BVV A;  1PGW 1;  5FZA A;  5BNN B;  4Q4Y 1;  2VZU A;  2ZMN A;  3T2T A;  2HWF 3;  2JG9 A;  2ZX2 A;  3FLP A;  3KQR A;  3M3C A;  3ACH A;  4Q27 A;  5TSW A;  2Q1Z B;  2WQ8 A;  2FDH A;  2CWS A;  4QGN A;  2WA4 A;  3VBH A;  1CAV A;  5FYB A;  1VRH 1;  2YY1 A;  4JGZ A;  5F5I A;  3WNP A;  3BTA A;  1WLD A;  1CIY A;  1U5Z A;  4YVW B;  2EVX A;  4YWA A;  3KHB A;  3WP4 A;  2ZGM A;  1DQ4 A;  1ASJ 2;  5A3N A;  1DGW A;  3UV9 A;  2DCJ A;  2EXK A;  2VO5 A;  4Q2F A;  1W2O A;  3S30 A;  4BA6 A;  4BQ1 A;  4GWM A;  2HWD 2;  3MV1 1;  4EJR A;  3TEX A;  1FAY A;  4L0P A;  4UFH A;  1TZO A;  1J3P A;  1TME 3;  2GN7 A;  3LB9 A;  1NA1 C;  2ZGK A;  1ULO A;  4DFS A;  2XG3 A;  1QQP 1;  1HX6 A;  2FQP A;  2OS2 A;  3E6C C;  1BYH A;  2QQP A;  5C6C A;  1LES A;  3GNE A;  4XFI A;  2PHT A;  2QQL A;  5T55 A;  1OF4 A;  1S0E A;  2WRA A;  2RS3 3;  2ZOE B;  3VBR C;  1UIK A;  1Y43 B;  3BYW A;  4LO8 A;  5C8W A;  3PTR B;  2PN5 A;  5C3P A;  1LCL A;  2E9Q A;  2UWB A;  4XAE A;  4W8J A;  4AI1 A;  2ZAC A;  2DCK A;  4QMA A;  5FYT A;  3T0A A;  1W8N A;  4GWI A;  1ZM1 A;  4KG8 A;  4ZZ5 A;  2PMW B;  4FPC A;  5KXE A;  4P9G A;  3VL9 A;  5M0T A;  5FZ3 A;  3VKN A;  1ENQ A;  5JXI A;  3USU B;  3WY6 A;  2VNO A;  4BLI A;  5C7G A;  2XLF A;  1AR7 3;  1QJY 1;  2AC1 A;  3OPW A;  3SKV A;  4BYY A;  2IFR A;  4LO7 A;  5ACA 3;  4XE9 A;  1RIR A;  3VBS B;  4FPK A;  1OFS A;  4B7E A;  3UT0 A;  3NRU A;  5CFD C;  3SHR A;  1D7P M;  3JBG 3;  1L7Q A;  4UFM A;  1JXN A;  1YQ5 A;  2D97 A;  1EP0 A;  2ORX A;  4LA2 A;  1JU4 A;  4LJH A;  1ND2 C;  5JR2 A;  3MLK A;  3HNY M;  3WF0 A;  4IV3 B;  1TMF 2;  4Q4W 3;  4QKB A;  1RHI 3;  5IJR A;  1WCK A;  4QQ2 A;  3ZN5 A;  1OFN A;  3AL6 A;  1VBA 3;  1HRI 3;  2BEO A;  1UY3 A;  4A41 A;  1DGR A;  4XFF A;  3GGL A;  1O91 A;  1C8M 3;  2OQ7 A;  3ZDV A;  3RZH A;  1XNA A;  3T1L A;  2JEM A;  1TNR A;  1AYM 3;  1RL3 A;  2A70 A;  2BWA A;  4GMP 0;  3KV5 A;  1H2K A;  5GJ6 A;  1GOG A;  4PDW C;  2FDK A;  1AL2 1;  1S0F A;  3C7G A;  3FL7 A;  1OXC A;  4CU6 A;  2ZEZ A;  5BNP B;  3FUQ A;  1GKB A;  4ATE A;  3AKS A;  4A6O A;  3ZFG A;  1MZ6 A;  5DUW A;  3MI8 A;  5FR3 A;  4O9E A;  2D40 A;  3CKH A;  4OUM A;  3AYA A;  3PUA A;  4D69 A;  1BCX A;  1HXS 3;  3HQR A;  1DQ6 A;  1A3K A;  2EAK A;  4MGK E;  4LNV A;  5E1R A;  3M3O A;  3JU9 A;  3H3U A;  4XET A;  4XFA A;  2D5F A;  2WT0 A;  1J84 A;  4L9B A;  4XZP A;  3ILR A;  5DZE A;  4OQ8 A;  3ZFE B;  4LK6 A;  1F5J A;  4BHP A;  2Q30 A;  2XML A;  1UCX A;  2ES3 A;  5HV4 A;  5IVY A;  2P17 A;  1S0G A;  2J1S A;  1UMH A;  2AUY A;  1RMU 2;  1UN1 A;  5FBJ A;  1SCS A;  1G86 A;  1JBC A;  1GBG A;  1JHN A;  2PHL A;  1DF0 A;  1G9F A;  2WDB A;  2BW8 A;  4FFI A;  1JYT A;  3MUZ 1;  2C5D A;  4QX5 A;  3RSJ A;  2OPK A;  1XOY A;  1DZT A;  2ARE A;  1V6K A;  2PHR A;  5EJZ B;  1W8U A;  1Y9M A;  5LAT A;  2XBO 3;  5BXX A;  1AYN 3;  2XXZ A;  1GU3 A;  3WLU A;  3KS7 A;  1HN1 A;  4GXL A;  1PMH X;  1PK6 C;  3PTY A;  3BUC A;  5FZ9 A;  3TN9 1;  4Z2W A;  4CCK A;  3ZPY A;  2XB6 C;  3NV3 A;  1LHO A;  5F3I A;  4Q0P A;  4YLZ A;  1REF A;  5DDJ 2;  3NMB A;  4D7S A;  2AYH A;  4M4R A;  5DAQ A;  3AYD A;  1CAV B;  4PIX A;  2BGC A;  5F5Q A;  2E26 A;  1PGW 2;  2Z69 A;  2XVK A;  3ES1 A;  5E89 A;  4Q4Y 2;  2PAM A;  4ZU4 A;  5FYZ A;  5J7M A;  4CDU A;  4DEV A;  4FAH A;  2W1W A;  3KGZ A;  5FY5 A;  3TAY A;  3QAC A;  2JX9 A;  4LBK A;  5EJ1 B;  5FXZ A;  3BTX A;  1VRH 2;  2Z2S B;  4JV4 A;  2P3Y A;  1WWY A;  2OX0 A;  2A7A A;  3ASI A;  4DO0 A;  5A7S A;  1OH3 A;  1J1T A;  1SBE A;  1IPS A;  1Y4W A;  4LBQ B;  1MQT C;  3WNM A;  1W6N A;  2OZ6 A;  5DUV A;  3ZFF B;  2OQ6 A;  4SBV A;  3RWN A;  4KBZ A;  1G9D A;  4SLI A;  1QDO A;  4FFF A;  3ZXK A;  4QXK A;  3VZN A;  2R0F A;  2VVF A;  5F7U A;  1W6M A;  4FOV A;  2ZAA A;  1QIQ A;  4ZPI A;  3ZPO A;  4CDQ C;  5FXV A;  1NLR A;  1VBE 3;  4QDR A;  4UOJ A;  3LPG A;  1WME A;  1Z78 A;  1GYK A;  3TRS B;  1RIN A;  2J7M A;  5EYY A;  1L7L A;  1QQP 2;  2JIG A;  4YG3 A;  2VE1 A;  5GZE A;  5T52 A;  2VUJ A;  4F8A A;  4MGT A;  1G7Y A;  1BK0 A;  1AXY A;  3Q8C A;  3NAP A;  4IEZ A;  3SNM A;  3SLI A;  5K8S A;  3HQU A;  4DRR A;  5BNO A;  5A3L A;  2YPJ A;  4IXL A;  5ANQ A;  2PHX A;  4D6S A;  1QJU 3;  2FBE A;  5SV5 A;  4ZU7 A;  1RUH 3;  1WLW A;  4AGV A;  3LPF A;  4NAM A;  4DOU A;  1UD1 A;  4F3J A;  2W1U A;  1W9W A;  3SH3 A;  3INA A;  4WM8 B;  1PO1 3;  2R32 A;  4L92 A;  5IWF A;  3KV4 A;  5IYY A;  3B93 A;  1HRV 1;  1NAE A;  4QB1 A;  1QJY 2;  2VCC A;  1D4V B;  5FMD A;  1WBL A;  2WFF 3;  1HQW A;  2JEC A;  3DGT A;  4RGA A;  5CAZ A;  4XF3 A;  2A1X A;  3CJI C;  3O7O A;  2IZW A;  3PVB B;  1W2N A;  5B2G B;  4BXF A;  2D6O X;  3H7J A;  4RR3 B;  5E16 A;  3H7Y A;  2NZ9 A;  1Q8O A;  5A33 B;  3P5B A;  4JDN A;  3FFQ A;  5EPA A;  5FZO B;  4UW4 A;  2MEV 1;  3HT2 A;  5KXC A;  4BQY A;  4J1X A;  2JIC A;  5L9R A;  1SBF A;  3OGG A;  2EAA A;  2DVB A;  1QOS A;  2B9U A;  4MVT A;  4LKE A;  1DFQ A;  2VZR A;  4IDZ A;  4CDW C;  4MG2 A;  3BAL A;  2IXI A;  1O59 A;  1RUI 1;  4UAP A;  5IT6 A;  5FOJ B;  1JZ2 A;  2VCB A;  1O4Y A;  1W6P A;  2PHD A;  3I2F A;  4YW1 A;  5FZE A;  3RZK A;  4NRO A;  5JUV A;  1UYY A;  1PM4 A;  1ZBE 1;  2CNA A;  4QPY A;  4Y1Z A;  2WNU B;  3USS A;  5FDB A;  1Q8V A;  1AL2 2;  2ZML A;  1I5P A;  2BV4 A;  2HH9 A;  4YW7 A;  4QX3 A;  3HVD A;  1AX1 A;  3GDB A;  1JYW A;  4IW3 A;  5T5O A;  2DUO A;  5FRE A;  4C0B A;  4WVV A;  2GP5 A;  3LSE A;  1W04 A;  5I8Y A;  5DG1 A;  4EZ4 A;  1AUY A;  3ACG A;  3WX5 A;  3ZYH A;  1LOF A;  1PVC 3;  1FOD 1;  4AED C;  5FPU A;  1GV9 A;  5C3Q A;  4AHY A;  4PCR A;  4QHO A;  3WNL A;  3CBN A;  2XKO A;  4JHZ A;  1KGY A;  4KWK A;  4XF1 A;  1H2N A;  3OBZ A;  1HKD A;  4XUP A;  2CGN A;  1UXX X;  4XIK A;  1UIJ A;  4Q8K A;  1N1Y A;  3IPV A;  3NVC A;  4HBN A;  5H9P A;  2VZV A;  4AI8 A;  3C7H A;  3KV6 A;  3LE0 A;  1XNC A;  4BJ0 A;  2J1U A;  5E6H A;  1SQ4 A;  3CMG A;  3LGR A;  3OJB A;  4AOC A;  1E57 A;  5JMO A;  1W8Z A;  4AG4 A;  4MZU A;  4U36 A;  3CHX A;  4FPY A;  3U37 A;  5H9R A;  2B5H A;  4GMP 3;  4XHX A;  5CIR A;  4DUW A;  4MET A;  3P3P A;  1JMU B;  3AP5 A;  3H1M A;  3HBZ A;  4QQP A;  2Y64 A;  3I54 A;  3ZIX A;  4CDU B;  1COV 1;  2YGL A;  1CJD A;  3TN9 2;  3O5S A;  4K3U A;  3M1H A;  3S5A A;  2DYC A;  2RMU 3;  2YBP A;  4XYX A;  1MEC 3;  2I45 A;  1P8J A;  1TQ5 A;  2H6C A;  2VR4 A;  3ES4 A;  2K46 A;  2WL1 A;  4V2V A;  1W9T A;  4DXR A;  3UNP A;  2WZ8 A;  1IQD C;  1WLC A;  4ZS3 A;  3LDR A;  1O3Q A;  4IV1 A;  5FLI A;  5KC5 A;  3TEZ A;  1W6N B;  5LBC A;  5D2A A;  2VZ3 A;  3C8X A;  5A3M A;  2FZ1 A;  2LUW A;  3LEM A;  4AVC A;  5JWP A;  1H0B A;  1V6I A;  1W6M B;  2ZGS A;  2VZS A;  3AMQ A;  1NUK A;  2VC9 A;  3POE A;  4XHB A;  1HB3 A;  3O1S A;  2WYF A;  5GZD A;  4LE4 A;  2W46 A;  3NQH A;  3EXU A;  3PJQ A;  1MVE A;  4K40 A;  4NUB A;  1ZX5 A;  3NAP B;  2B8M A;  2YRO A;  4RFT 0;  4N53 A;  2ENR A;  4UXA A;  4NRP A;  4PIZ A;  1LHN A;  2VW0 A;  4E8C A;  4Q0U A;  5CFC A;  1Y9G A;  3I8T A;  4A42 A;  5L7O B;  3VLB B;  4TLF A;  1VBC 3;  2RDR A;  2VQ0 A;  3SQO A;  4K8F A;  1QF3 A;  1DZR A;  1GQG A;  1VE0 A;  1YFY A;  1OPM A;  1PM7 A;  1AHS A;  5F2S A;  5LBF A;  4ARX A;  1NXM A;  1AR7 1;  3JXS A;  3T4H B;  2HKX A;  3E5Q A;  1H4H A;  2X8K A;  2IVI B;  4YGD A;  5JI7 A;  1Q8P A;  1LAJ A;  5IVB A;  4ES9 A;  1RUN A;  2R7E B;  3A0K A;  3LWC A;  2HWE 1;  3HOB A;  1RYY A;  4PI2 A;  2B9V A;  1G6N A;  5JOY A;  4ET7 A;  1JOD A;  2WJS A;  1AX2 A;  3VDC A;  3WG3 A;  2VW1 A;  3LF7 A;  1RUE 1;  1X9P A;  4LPL A;  4NHM A;  3BOW A;  3IM0 A;  4C0H A;  1WMF A;  1HRV 2;  4JCK A;  3TWI A;  5LBB A;  5C8C A;  1VBA 1;  2KD7 A;  1N1S A;  4GB3 1;  4CXX A;  4CP1 A;  5FPL A;  2RM2 1;  5FZF A;  3WUC A;  4CDX A;  1VJ2 A;  3LEG A;  4RQP A;  5LRR A;  3HWJ A;  2ZGR A;  1MZE A;  1ZRC A;  4AVV A;  5GAL A;  1BJQ A;  2XON A;  4LIT A;  4IE0 A;  2PTM A;  3MO4 A;  2HLE A;  1Q8S A;  1Q8Q A;  1YXW A;  1W6P B;  2MEV 2;  2R04 3;  5FZM A;  4EN6 B;  3U75 A;  1C5H A;  4UW5 A;  1XE8 A;  1UWW A;  3K4A A;  5FZG A;  1MS4 A;  3B94 A;  1CVN A;  4ASK A;  1FX5 A;  2EIG A;  2VNV A;  3W21 A;  2R07 1;  3AXE A;  3I2G A;  4Q29 A;  5DPN A;  5ABJ C;  3ZKU A;  1W28 A;  1GMM A;  5FUI A;  4FOW A;  2QVS B;  1RUI 2;  2P6C A;  3MLL A;  1IPK A;  1HXS 1;  4DZG A;  1RUC 3;  3POG A;  2ARB A;  5HV0 A;  1JU3 A;  1D4M 3;  2QZ2 A;  1PIV 1;  2VMF A;  1VR3 A;  1ZBE 2;  5JPM B;  1JZ5 A;  3AVR A;  4JRA A;  1SLT A;  3TYJ A;  2EAL A;  4AEM A;  1BVV A;  1D2S A;  1UW8 A;  1XNT A;  2RR1 3;  4HON A;  1S4C A;  4XDO A;  5FMO S;  3JCI A;  3MID A;  3QH6 A;  4G9S B;  4C90 A;  2VJX A;  1ZNP A;  4KG0 A;  4R4X A;  5FP8 A;  5CIS A;  5APA A;  2JG8 C;  3OUJ A;  5JZG C;  4AAX A;  2F4P A;  2P6H A;  2YFU A;  3NNJ A;  4I0A A;  1BEV 3;  4W6W A;  5FY9 A;  4LHL A;  3RRD A;  4FAG A;  1FOD 2;  2R06 1;  3IPV B;  3SH4 A;  3AZV A;  5AC9 3;  3OUH A;  4BE3 A;  4Y33 A;  4FI9 A;  4N43 C;  1VMJ A;  2XL7 A;  4QKN A;  2QQN A;  4PLM A;  5F5A A;  2QJV A;  4Y22 A;  5FFO C;  4AVT A;  3ZM8 A;  3VD3 A;  3ON7 A;  1VBD 3;  5IVC A;  3N7L A;  4IEP A;  4CU8 A;  4LUL A;  3RFR A;  5DAB A;  1DLL A;  1K3I A;  1UMZ A;  4IGP A;  2Y34 A;  3VBO A;  1XRU A;  2WSV A;  4XIL A;  2YUE A;  1S2B A;  3UL2 A;  2VBP A;  1DGR N;  3AKQ A;  3H42 B;  4HK9 A;  4QGM A;  4QM9 A;  5F5C A;  1OT5 A;  2QQV A;  5F3C A;  5HXM A;  3MIB A;  4AHZ A;  3MFC A;  1GWL A;  2W91 A;  4JTN A;  1YFU A;  4A2U A;  2VUD A;  3RDI A;  2JDH A;  4QHB A;  4EZH A;  3LOB A;  2HWC 1;  4FVV A;  2GMP A;  1GOF A;  1COV 2;  1N1V A;  1XQN A;  5C5U A;  3CU7 A;  3U78 A;  2EXH A;  4E4D X;  1O3T A;  4HK8 A;  4ZZ8 A;  2RJK A;  1PMJ X;  1VAK A;  2RS1 3;  1G9C A;  2PAE A;  4I3G A;  4AVA A;  4CA9 A;  4XUO A;  5EWS A;  2VQT A;  4QQL A;  1RUD 3;  2EF6 A;  5GZC A;  3AZW A;  5F6K A;  2GNB A;  3PVO A;  5FXW A;  4LEJ A;  4W6X A;  1GLH A;  3FX3 A;  3EJK A;  2XVG A;  3VBF C;  1RGS A;  1VMH A;  4N53 B;  1UXZ A;  2BYV E;  4CP2 A;  3POS A;  2RDQ A;  4BXS V;  3DV8 A;  1K42 A;  1FNY A;  4OZO A;  4B8E A;  5CFC B;  2WO7 A;  5J09 A;  4P9I A;  1ULG A;  1V6M A;  3POF A;  1QEX A;  3H8X A;  3RYP A;  1O5L A;  3HQX A;  1F9K A;  3ST7 A;  2OXB A;  1OMI A;  3AP6 A;  4IGO A;  1LED A;  4GWJ A;  5E8A A;  1W8F A;  4UWD A;  4AZZ A;  3S0M A;  3NV1 A;  5FYH A;  1WW5 A;  4KWU A;  5L73 A;  1AR9 3;  4AEJ A;  2NP0 A;  5KXB A;  4KQ7 A;  1XU1 A;  3ACI A;  5J37 A;  3HBK A;  1WA4 A;  2ETE A;  3BPS A;  3MDP A;  4LE3 A;  4CVU A;  5J48 A;  4ZHN A;  4HN1 A;  4X8N A;  4GKY A;  3WXP A;  4D0Q A;  1O5U A;  2E32 A;  1AR7 2;  1S1A A;  1ZZC A;  1IOA A;  2ZKN A;  3E1F 1;  2WFF 1;  3A23 A;  1O7F A;  4BB3 A;  4JDO A;  5CFD A;  5IK7 A;  5A3W A;  2V5Y A;  3AXD A;  4Y1U A;  4YNI A;  1VB4 A;  2HWE 2;  2Y6K A;  4LIU A;  4OVE A;  1IGO A;  5FK8 A;  4JQT A;  3WW1 A;  2IWG B;  2YV8 A;  4HMZ A;  4CDX B;  2E33 A;  5JOW A;  4DXT A;  4Q1P A;  5T50 A;  3I3D A;  1AR6 1;  4GIQ A;  4JC1 A;  4O9G A;  1E5R A;  2DF7 A;  2W92 A;  3F2Z A;  5LZ6 A;  3P6B A;  2JKX A;  1BHG A;  1LEC A;  1RXF A;  2D98 A;  2HEW F;  5GLU A;  1RUE 2;  3V0B B;  1Y7B A;  4XXP A;  1YQC A;  2DCT A;  4FPL A;  3URF A;  5BNQ A;  4YG6 A;  2E63 A;  5FKC A;  3H0O A;  3RZJ A;  1VBA 2;  4GB3 2;  4YW6 A;  2RM2 2;  1UZW A;  3R6S A;  1ULD A;  4MYE A;  3C7E A;  1W03 A;  1IKQ A;  4PDW A;  1BBT 3;  4Y1X A;  5KHG A;  4LKD A;  2CAU A;  4P9Y A;  1IS6 A;  1V6J A;  2D6P A;  4RS5 C;  2WAB A;  5LEJ A;  2D6K A;  1PHM A;  1JYC A;  3OSD A;  4XJ9 A;  2B4K A;  5DN2 A;  3VBS A;  3VDD B;  4CYD A;  4CCC A;  3E5U A;  4Q4X 1;  4XAA A;  5DAX A;  2WZR 1;  4L97 A;  1EPW A;  2R07 2;  2VTF A;  2IXH A;  2BRT A;  4LBO A;  4DUV A;  1HXS 2;  3IIA A;  2G9F A;  1V6L A;  3AM2 A;  1T2X A;  2BZD A;  5CKQ A;  3KB5 A;  4I02 A;  1PIV 2;  4IE4 A;  1WKY A;  3O0W A;  2VXR A;  1IPJ A;  1TG7 A;  3MYX A;  4W4Z A;  3G7D A;  4Z82 A;  4L2N A;  1CZV A;  3PVN A;  4IQP A;  2R16 A;  4XAC A;  5SV8 A;  3T2P A;  5D8A A;  1R08 1;  2W1Q A;  4Z1V A;  5IHR A;  2HWB 3;  3IDB B;  4BIS A;  4QKD A;  4IEO A;  3ZSK A;  3ZYR A;  3U1X A;  3MUY 1;  3GF6 A;  4JDM A;  3ILN A;  2FDJ A;  4M3C A;  4UI9 L;  2AZ5 A;  4B4P A;  4QX0 A;  3MV0 1;  3ZR5 A;  5C9A C;  1FV2 A;  5IVV A;  5K0U C;  3N9N A;  2R06 2;  4QD2 A;  3ZYG A;  1PNF A;  3VBO B;  3KWV A;  1IG3 A;  2J1V A;  4P9J A;  4BK4 A;  5LA1 A;  1CAU A;  1B35 C;  2XUM A;  5FYV A;  5GLT A;  1JZ7 A;  4XJW A;  2RVA A;  2D3R A;  2JEN A;  3I97 A;  4XBN A;  5C33 A;  5LA2 A;  4UFL A;  1KXG A;  2PHW A;  5G04 L;  3RI9 A;  1O8S A;  2RMU 1;  4NHK A;  3J26 N;  4M00 A;  1MEC 1;  3POY A;  1AXZ A;  1M4W A;  4TXW A;  3IAQ A;  4XFG A;  3U07 A;  3ZFE A;  2WNV C;  2VVE A;  3R4U A;  1BZW A;  3SCH A;  4N8M A;  4Q0Q A;  3NV4 A;  1OI6 A;  4LHK A;  1POV 0;  1QXP A;  3KSC A;  4LT5 A;  1MS5 A;  4QKF A;  3M8L A;  1KRI A;  2HWC 2;  3PU8 A;  3SXW A;  1XNB A;  1UPI A;  2OA2 A;  4AI9 A;  5JPN B;  1NA1 B;  1WCU A;  2WT2 A;  1HJG A;  3KCX A;  2BER A;  1W05 A;  3AYC A;  1JI6 A;  5FZ7 A;  2E7Q A;  3FHA A;  1AJK A;  1XU2 A;  4CU7 A;  3H9A A;  1YI7 A;  2XJV A;  4CDQ A;  3DYP A;  1OUX A;  2IFW A;  1SFP A;  4LO5 B;  1I5Z A;  2VQU A;  5FZL A;  1NCQ C;  5CEH A;  3O1U A;  4HKO A;  4NWW A;  1YHF A;  2WS9 3;  2VTX A;  2VCA A;  4FP2 A;  2JDZ A;  3I59 A;  3NNL A;  2UU8 A;  5FZD A;  3I2O A;  4Q8L A;  4XIO A;  2QTW B;  3N9L A;  2WO1 A;  1PO2 3;  1V70 A;  2A71 A;  1C1F A;  3WDT A;  1JW6 A;  1OC1 A;  1WLT A;  4BM8 A;  1X8E A;  5F37 A;  2J1E A;  3TOJ A;  5CFD B;  2ID4 A;  1OUS A;  2JD4 A;  3T0D A;  1VP6 A;  4KL1 A;  2E51 A;  1NX9 A;  4YW2 A;  2RS5 1;  4AI0 A;  4GH4 C;  3B3Q E;  4LO4 B;  4LBQ A;  1ND2 B;  4IEV A;  3BU0 A;  1W06 A;  1WD3 A;  3ZFF A;  3U4S A;  3CJI A;  3WDW A;  5B4N A;  2WFF 2;  2YC0 A;  3EMR A;  1V9U 1;  1ALY A;  3EYP A;  3IMM A;  1ZA7 A;  5GZG A;  4OMD A;  3PUS A;  1GZW A;  4CRQ A;  4HT1 T;  1W99 A;  4E4Z A;  1W2U A;  1C8N A;  2PLV 1;  3AL5 A;  4LOR A;  2W5F A;  3POB A;  2MHF A;  3H1W A;  3QH7 A;  3WQ0 A;  1AR6 2;  3IT8 A;  1X7N A;  2R04 1;  4KGQ A;  4PDW B;  3V56 A;  1ZRR A;  3WSO A;  3TEW A;  4RYD A;  2VH9 A;  3IN9 A;  1BXH A;  3OPT A;  1W2T A;  1LOA A;  4O61 A;  1TVG A;  5GLW A;  3D0S A;  3PVE A;  4FOQ A;  4IE6 A;  5CU1 A;  5BNN C;  5LCW L;  3TEY A;  4AF9 A;  1UOF A;  1DQ2 A;  4WM8 A;  2YC2 A;  5FV3 A;  3EQE A;  1UZV A;  2ZX3 A;  3RZM A;  1OD3 A;  4CXY A;  2W3J A;  4LA3 A;  1XPW A;  4QX7 A;  1S55 A;  2CDO A;  4RD7 A;  4BQX A;  5AFB A;  1R09 1;  5FZK A;  1X82 A;  1FMD 1;  3MPP G;  5HPO A;  2WR9 A;  5A6Y A;  1UAI A;  5HBA A;  4Q4X 2;  2WLP A;  3HT1 A;  2WZR 2;  3WW2 A;  2BPA 2;  4E2G A;  4RR3 A;  1UOB A;  2VZQ A;  1G9B A;  3L2H A;  5D8A B;  5A33 A;  4AED A;  3FWE A;  5FZO A;  3RYR A;  4GKX A;  5FAX A;  2C4X A;  4HOO A;  4YW3 A;  4OLL A;  3WHU A;  4AFD A;  4I3P A;  2CHH A;  5LA9 A;  1SLB A;  5KC6 A;  1D0H A;  1BMV 1;  4M3C B;  4C1X A;  3GYD A;  4OUL A;  3HN1 A;  5DAP A;  5F32 A;  3PUI A;  3WEZ A;  3I49 A;  2AR6 A;  3I3M A;  1QXR A;  3LEI A;  4NOT A;  5CVR A;  3A4U A;  3VKL A;  1FT9 A;  4Y5T A;  1R08 2;  5FXX A;  5A7W A;  4AQ2 A;  1PGL 1;  5IFP A;  5FUN A;  3BTZ A;  1PK6 B;  1CAU B;  2IXL A;  3UGF A;  1HB2 A;  3LIG A;  1VBB 3;  4EN7 B;  2WNU A;  2LRO A;  2RV9 A;  4ZY9 A;  3ZXG A;  2DUQ A;  3UJQ A;  3LEK A;  1QWR A;  4Y20 A;  2R1B A;  1H6X A;  5LEK A;  5C3R A;  4YZ1 A;  1EAH 3;  2P1B A;  2GC0 A;  1K45 A;  3K46 A;  3QD6 A;  1RUG 3;  3WF4 A;  2IXK A;  3WP6 A;  1BKZ A;  1LU2 A;  2R1D A;  1GR3 A;  4URT A;  3THT A;  3ZSJ A;  4AEK A;  5A70 A;  1S0D A;  1U5Y A;  4B4R A;  2TEP A;  5L9V A;  5HCH A;  2RMU 2;  2NQY A;  4KI5 M;  1H8T C;  1S0C A;  1MEC 2;  2RS1 1;  1QXJ A;  2Z5W A;  3I4I A;  4L11 A;  4AE2 A;  4CP9 A;  2VW2 A;  5AFE A;  2JE8 A;  4NHY A;  2QFE A;  2YPD A;  3NKT A;  4Q4V 3;  5I0U A;  1AR8 1;  4CPB D;  4CDQ B;  1Y9Q A;  4BU2 A;  4N90 A;  2CY6 A;  5K9Y A;  3DF0 A;  1AX0 A;  4IEX A;  1GP6 A;  4LHS A;  4N9H A;  4WM7 C;  4LKS A;  1Q56 A;  1KIT A;  2O0O A;  1MS9 A;  2CAV A;  3CDZ B;  3AZX A;  3I59 B;  4FSJ A;  5I91 A;  4WBB A;  2P3J A;  4DIQ A;  3UKV A;  3VHP A;  5BY5 A;  2E6V A;  1G9A A;  2XL9 A;  1STM A;  3WP5 A;  1JYX A;  1FXZ A;  4XFB A;  5CNA A;  4CCM A;  1ZVF A;  5JSR A;  1K5M C;  4JZR A;  4BQW A;  3N7K A;  4XW3 A;  2C26 A;  2K0G A;  2ZHN A;  2X53 S;  3LFM A;  2JIJ A;  1QJX 3;  1DQ1 A;  5DQ0 A;  3VZJ A;  1XXN A;  3I2I A;  3DXT A;  1W8W A;  3M2M A;  3POJ A;  2D44 A;  5CG8 A;  4OCT A;  2V4A A;  2BNO A;  1H6Y A;  1WCS A;  2JB8 A;  4QDQ A;  4XZU G;  1U5I A;  1UYP A;  3CJI B;  4PQQ A;  1UU6 A;  2VPV A;  3KD4 A;  3RPQ A;  1RUF 1;  4YGC A;  1OQE A;  4FXK B;  4HSJ A;  1F15 A;  3VL8 A;  3T3Y A;  1ODN A;  4XUT A;  2W39 A;  2X5I A;  2RS5 2;  3N9P A;  1GZW B;  5FK7 A;  2RE9 A;  1POV 3;  5C4W C;  1NZC A;  2W94 A;  1W6Q B;  1FPN 1;  3OD4 A;  3VZO A;  4XC9 A;  2EID A;  1LU1 A;  5FYS A;  4AHW A;  5BV6 A;  2Y6G A;  4MAD A;  3J8F 1;  2DU1 A;  2A5Z A;  2DCY A;  3QLQ A;  3RG0 A;  1V9U 2;  2KXL A;  4IER A;  1LOB A;  4BCU A;  3CZU A;  3MIF A;  4C1W A;  4CEY A;  4DQA A;  5B4X A;  2AEZ A;  4ZKT B;  5FWJ A;  5L7O A;  1C1L A;  5JXJ A;  5A7P A;  3AP7 A;  2PLV 2;  1US2 A;  4PF5 A;  3FZ3 A;  4RHV 1;  5CAD A;  1R1A 1;  2DTY A;  2JJ6 A;  1W0N A;  1ZBA 1;  4K1Y A;  2VOW A;  2JG9 C;  4L99 A;  5FZH A;  4AFM A;  5FYI A;  3LCP A;  2BBA A;  4NPL A;  5LB6 A;  4MHU A;  2KA3 A;  2WN2 A;  3IB3 A;  2DUR A;  3Q8B A;  2Q0A A;  1KQR A;  3VBH C;  2KR2 A;  2B42 B;  4H55 A;  2BBV A;  3IDE A;  4I0B A;  5FO8 B;  2LTN A;  4JGZ C;  1ASJ 3;  1SFY A;  3KZ4 C;  2LAL A;  4AQT A;  4D6Q A;  5F2W A;  2HWD 3;  5FY0 A;  4CUG A;  4AVB A;  3CQO A;  3AMP A;  1UYX A;  2A3W A;  1GNZ A;  1K12 A;  2VOX A;  3ACF A;  1Z7S 3;  3FLR A;  4ISR A;  4NWV A;  5LK5 A;  5JDB A;  1ENS A;  2P2K A;  1R09 2;  3K48 A;  4EYU A;  5IAX A;  1FMD 2;  1DU3 D;  1E5S A;  2JDN A;  2QDN A;  3BOP A;  3E6D A;  3O1V A;  1CPM A;  5KR7 A;  2ZGQ A;  3W20 A;  3GBW A;  4XCA A;  4J25 A;  1QJE A;  5FPA A;  3KV9 A;  5A7W B;  4DNY A;  2FCT A;  1HQN A;  3HPN A;  2ZTN A;  1GZT A;  4B29 A;  3ALQ A;  1OQ1 A;  2VMC A;  3III A;  4FFH A;  2BDR A;  3W58 A;  3RZL A;  1SDD B;  1BMV 2;  1UNB A;  1NQJ A;  3MF6 A;  1VLN A;  3N35 A;  2UY9 A;  4XF0 A;  3DKW A;  3FUO A;  2C0Z A;  2PAK A;  5L19 A;  1C28 A;  4JVA A;  2NM1 A;  4Y20 B;  2Y0I A;  1GSL A;  4LR4 A;  4QHZ A;  3B01 A;  1PGL 2;  2ARC A;  4YM2 A;  2DVF A;  1OVS A;  4Q0V A;  4ASL A;  2BGP A;  4S2H A;  1SAC A;  2XLA A;  3POW A;  2J1A A;  3VKM A;  1Q43 A;  1I3H A;  2P4E A;  2IC1 A;  3U11 A;  4FFG A;  4PF1 A;  2CWM A;  5FTT C;  2G19 A;  2XGX A;  2A3X A;  4XAB A;  1OF3 A;  1REE A;  4MGI E;  2QQO A;  5LAS A;  4BWO A;  4X8P A;  3X29 B;  1N1T A;  4QPW A;  5FZC A;  2Y60 A;  3OG2 A;  4ZON A;  3B00 A;  3PUR A;  5J3U A;  3PL0 A;  3KMH A;  4P9L A;  2UYA A;  5T3N A;  5LW9 A;  1VPH A;  4CP9 B;  2VD7 A;  1W0O A;  4L8Q A;  3H1Y A;  1QJF A;  2HBT A;  1OA4 A;  2QZ3 A;  4M01 A;  2XLG A;  1NLS A;  3OY8 A;  1XE0 A;  5FY7 A;  3WNN A;  5LY2 A;  1GZC A;  1DCS A;  3ITQ A;  1H4G A;  2RS1 2;  3T08 A;  1ACC A;  1W39 A;  3KCY A;  3HR9 A;  3IZO A;  1YEW A;  3V64 A;  1OOP C;  1YQ2 A;  2QQJ A;  2BFU L;  4FP3 A;  2HWF 1;  4RGK A;  2WAA A;  3ETP A;  1ZYB A;  5G05 L;  4MV2 A;  3AJZ A;  3THC A;  1AR8 2;  3ZYB A;  1KD7 A;  4LBM A;  1SLL A;  1DYO A;  2GH8 A;  3AFK A;  3B5L B;  2A6V A;  3ZFG C;  2GU9 A;  5IVE A;  5CB7 A;  4BDV B;  4P9W A;  2Y8K A;  4E2Q A;  2J1T A;  2ZXQ A;  4D3W A;  2ZGO A;  3I7D A;  4QPI A;  4NID A;  2DDU A;  4AGR A;  2VTX J;  4KGG A;  4XQW A;  1W90 A;  5DG2 A;  5FMO L;  4E2S A;  3M4F A;  1O3S A;  4EV0 A;  1ZA4 A;  2CTV A;  1TME 1;  4IE7 A;  3PNA A;  5FPX A;  1WW4 A;  3S57 A;  3HMY A;  1OLM E;  1H8V A;  4FO9 A;  4M4P A;  1RMU 3;  2X5I B;  4CEW C;  5JIU A;  3ZYF A;  4I09 A;  4FPO B;  1BLZ A;  1WMD A;  4QX8 A;  2P34 A;  2B45 X;  4QPG C;  3DPR C;  1YI9 A;  2RS3 1;  2VBB A;  3GM8 A;  5JIA A;  4YFZ A;  5JOZ A;  1RUF 2;  1W8T A;  3LOI A;  2JXA A;  4YZ2 A;  3R4S A;  3VD4 A;  1LRH A;  4CEY B;  1PZ8 A;  3B9I A;  4Y24 A;  1SHW B;  2VUA A;  2VL4 A;  5KHK A;  3KLS A;  3BIW E;  5GKA C;  1YYN A;  1Q3E A;  1FPN 2;  2XJS A;  4QDS A;  1TNF A;  1MZF A;  2Z42 A;  3LD8 A;  5T5L A;  2Z79 A;  1UZ0 A;  4Q5O A;  2FCU A;  3J8F 2;  5DDJ 3;  5F39 A;  2CL2 A;  2QUO A;  3T4V A;  5ACA 1;  5KWR A;  4NIA A;  1LOD A;  2GN3 A;  1LKN A;  4NR1 A;  5FLJ A;  3WW3 A;  4CCN A;  4D6R A;  5ABJ B;  1WBF A;  4AQS A;  5L36 A;  3CO2 A;  3AB0 A;  4Q4Y 3;  1HIX A;  3WIN E;  3JBG 1;  5T54 A;  3H8U A;  1O8P A;  3O1P A;  3AP9 A;  4FPJ A;  4RHV 2;  2VNR A;  1R1A 2;  3D5O A;  1ZBA 2;  4KWL A;  3ZXE A;  4CDU C;  1VAL A;  1A34 A;  1W6O A;  4Q4W 1;  2JDK A;  3NNG A;  2PHU A;  1RHI 1;  5LWB A;  2NMN A;  5FLH A;  2DWR A;  2YU1 A;  4HLT A;  3VZK A;  2MPF A;  3M70 A;  3S5Q A;  4LBL A;  4AI3 A;  1V6N A;  4H7L A;  3O0X A;  1HRI 1;  1DYP A;  1KEX A;  4K20 A;  5A7N A;  3GZT B;  1ULC A;  2GC3 A;  1CR7 A;  2C9K A;  1C8M 1;  2JG8 B;  3B7M A;  4MLO A;  5JZG B;  4XMI A;  1AYM 1;  1QY4 A;  1KFU L;  1R64 A;  3WVJ A;  2A3Y A;  3V0B A;  2N7G A;  2W87 A;  4JQR A;  2F6B A;  3OGR A;  2V5D A;  2QBX A;  4Z92 B;  3VBU A;  1UYZ A;  2BFU S;  4N43 B;  1QQP 3;  2BQP A;  3ACL A;  3FC0 A;  4FQ4 A;  4YVS C;  2OW4 A;  1HV0 A;  3H3Z A;  3OPZ A;  5FJH A;  3U14 A;  1RUJ 3;  3S6P A;  3VUO A;  1RUO A;  4CU9 A;  5C9A A;  5K0U A;  3NAP C;  3SCG A;  3WD5 A;  1XND A;  4QT6 A;  1VBB 1;  2DVD A;  5IK5 A;  2ZGU A;  4NHX A;  1CN1 A;  2NYY A;  5BNO C;  4GUL A;  4TSV A;  3VDD A;  2GZW A;  2Y6H A;  2YBK A;  5F1R A;  3KM5 A;  2WUH A;  5JXG A;  1B35 A;  2D6L X;  5JXH A;  5ANN A;  4KMQ A;  2WZE A;  4BME A;  1SBD A;  4NVP A;  2H6B A;  1QJY 3;  4YZ5 A;  1EYB A;  1G8W A;  5JI9 A;  2PEL A;  1NE4 A;  3GJB A;  4AHX A;  5C71 A;  1YIP A;  2WAO A;  2A6W A;  3CLP A;  1RVF 3;  2R6Q A;  3OY8 B;  4P00 B;  3A7Q A;  3VKO A;  3VDB A;  4C91 A;  3OYW A;  2VAU A;  1HJF A;  1LNS A;  1UL9 A;  2BP6 A;  1X36 A;  4BZ4 A;  3NJZ A;  2XBO 1;  1GZ9 A;  4KWJ A;  5A6Z A;  1AYN 1;  2OT7 A;  4AVS A;  2CSG A;  1XE7 A;  5LK7 B;  2QNK A;  4HVO A;  1OLR A;  1OQD A;  2WYS A;  4EWA A;  2E53 A;  2AGS A;  2PXJ A;  4AED B;  4B3N A;  1XYO A;  2G1M A;  5A80 A;  4COY A;  3BU7 A;  1BVP 1;  4EN0 A;  5EXO A;  5C3O A;  2JDA A;  1CES A;  1CPN A;  1MAC A;  2ZEY A;  4NO4 A;  3ZXD A;  3AMM A;  2RHP A;  1HB4 A;  1NCQ A;  1OHF A;  4B7K A;  5F8P A;  2HWF 2;  5J98 B;  2R0H A;  2D43 A;  2UUR A;  2YGM A;  2ZEW A;  3GZA A;  4QPI B;  5A1F A;  4QXC A;  1UU4 A;  3IDC B;  4LBJ A;  2XH6 A;  2RG4 A;  2ORZ A;  2D6N A;  2DU0 A;  2AEN A;  2VMI A;  1ZZ8 A;  1KS4 A;  1KJR A;  5CZK A;  5F6L B;  2XJU A;  4BOW A;  4YM0 A;  2GP3 A;  4I0W B;  1NCR C;  3ECQ A;  3H3L A;  3WCR A;  2VUL A;  3OEB A;  1WA6 X;  5HCB A;  3H8R A;  1YFW A;  1L7R A;  1ONA A;  1QKQ A;  4D8M A;  1LOF C;  1WW6 A;  1LOG A;  2WC2 A;  4GAL A;  4HZF A;  5FZ4 A;  1NA1 A;  2EXI A;  3KT7 A;  1VBE 1;  3WP3 A;  1TME 2;  5K4L A;  4FTB A;  3VN4 A;  3JUU A;  3N7M A;  4NAO A;  4EQV A;  3OGJ A;  2XHN A;  4XBQ A;  1WGP A;  3LFI A;  5FIX A;  2VXJ A;  3O1M A;  1OSG A;  2W47 A;  3VHN A;  1DIW A;  2A6X A;  3VBR A;  2VEC A;  2GAL A;  1HQL A;  2WII B;  4MGZ E;  2JDP A;  1WCD J;  1PZ9 A;  4O7X A;  4MHR A;  5A32 A;  1RED A;  1F4H A;  2RS3 2;  5EIY B;  2ET7 A;  3PHM A;  1FI2 A;  1QJU 1;  1RUH 1;  3T0B A;  2KM2 A;  2J42 A;  4OHX A;  3S7E A;  1LOE A;  4A7Y A;  1RC6 A;  4I30 A;  2ZA9 A;  3WF3 A;  4BQ2 A;  4RS5 B;  2QCS B;  4WV8 A;  4DB5 A;  1PO1 1;  2NLR A;  4IET A;  2FD8 A;  3TN9 3;  1GWM A;  3FHQ A;  5FPV A;  1W6O B;  1NQD A;  1CD3 G;  3CNA A;  5ACA 2;  1LUL A;  2Q1M A;  4YW5 A;  2WQ4 A;  2O8Q A;  2ZX4 A;  4WVZ A;  4TTG A;  3M3Q A;  5IUQ A;  1ND2 A;  3JBG 2;  3ME2 A;  1KDK A;  4MGS A;  2CV6 A;  4BQ4 A;  3K3N A;  3GCX A;  4B4Q A;  3IDA A;  1YUD A;  2ADE A;  3M7A A;  1Z7S 1;  4IV1 C;  1SLI A;  4RL7 A;  2ZGT A;  4URA A;  2YC4 A;  4Q4W 2;  1GNY A;  2Q8D A;  1RHI 2;  1UQX A;  3D6E A;  5FO9 B;  3VBU B;  1AJO A;  3PDQ A;  1HRI 2;  4HVR A;  5CKM A;  4XBL A;  1UF2 C;  1N3P A;  1IS4 A;  3O12 A;  1C8M 2;  4Y4Y A;  1CAX A;  1IHM A;  2FMD A;  3E97 A;  4QXB A;  1AYM 2;  2DCZ A;  2XDV A;  4GD4 A;  4LKF A;  5C9A B;  5K0U B;  2PYT A;  4FQZ A;  3RQ0 A;  4LOS A;  1JZ3 A;  2YU2 A;  1ENR A;  4N53 C;  4OYU A;  1PMI A;  4W6Y A;  2V09 A;  4IUG A;  4AR2 A;  1JYV A;  5FPZ A;  3AKT A;  3ZYI B;  2ZZJ A;  4P5Y A;  5CFC C;  2Y0O A;  2Y38 A;  1B35 B;  2G4I A;  1YC6 1;  1WMX A;  4AWD A;  2E7A A;  3V0A A;  4XTM A;  1QOT A;  1IQA A;  1VBB 2;  3ILF A;  2EXJ A;  4CP0 A;  2WO3 A;  5JVV A;  1PVC 1;  3K4D A;  1APN A;  5FY4 A;  4E8D A;  4E9K A;  3OCP A;  3SIS A;  2WNV B;  1OA2 A;  3WUD A;  4IGQ A;  4UYB A;  2UY8 A;  3BCW A;  4ZS2 A;  3S7I A;  4OI4 A;  4RN5 A;  3SIT A;  1JHJ A;  2DBN A;  3TBD A;  3OYW B;  5A7O A;  4NN0 A;  5A6X A;  1HRV 3;  4XJ8 A;  5I0T A;  3ZMN A;  4UBG A;  4K7J A;  1GQH A;  3WF2 A;  3HIF A;  1H8T A;  2R30 A;  3DKQ A;  2TNF A;  4ARY A;  4WZC A;  4PI0 A;  5C8C C;  3AVS A;  4PHZ A;  4BMB A;  1GP4 A;  4CDX C;  4DIN B;  1UZZ A;  3O1O A;  5AVP A;  3OD0 A;  3MFA A;  3H8O A;  1ND3 C;  2P3K A;  4R9B A;  4RQP C;  3BKZ A;  5EP9 A;  4GJY A;  2GSY A;  1PK6 A;  2W1S A;  2ERF A;  2XBO 2;  2MEV 3;  4GMP 1;  3HAG A;  1AYN 2;  2GAU A;  1S0B A;  2WLQ A;  3SKJ E;  2QQI A;  3VZM A;  5JAX A;  3DEC A;  1NCQ B;  3KHC A;  4WM7 A;  1CX4 A;  1AZD A;  1K5J A;  5A3U A;  1UY4 A;  2GH2 A;  4XUR A;  3AP4 A;  4DUX A;  4M3C F;  2BUK A;  3JB4 C;  1RUI 3;  2VCM A;  3JD7 3;  4FOY A;  2EIB A;  1YCI A;  4MH0 E;  4YZ4 A;  5FYY A;  1UMI A;  3TNQ A;  5CA6 A;  2I74 A;  4QWN A;  1WD4 A;  1ZBE 3;  2X05 A;  5JSO A;  1K5M A;  1BQP A;  3MZH A;  1W8H A;  2WWS A;  4YM1 A;  1KDM A;  1J3Q A;  4QQH A;  1DGL A;  4BPZ A;  4ONU A;  1EPZ A;  3VB9 A;  1M06 G;  3APB A;  2AH2 A;  2W95 A;  3LA3 A;  2HJI A;  4LIV A;  2TUN A;  1MQT A;  2BOJ A;  1E5H A;  4HL0 A;  3IAP A;  1QHD A;  1JTZ X;  3TB0 A;  5FQ0 A;  5LRS A;  4RA0 A;  1FOD 3;  2ZEX A;  1SEF A;  4R4Z A;  2OII A;  4XCB A;  1U5X A;  1W9F A;  3VBR B;  3ABZ A;  1EV1 3;  2ZJC A;  5A32 B;  5C4W A;  4YG0 A;  1VBE 2;  3ZXJ A;  3DUI A;  2JD9 A;  1VBC 1;  4BIF A;  1UZY A;  3GHM A;  3MGU A;  4H2A A;  4NE9 A;  1IS5 A;  1OA3 A;  2ZPX A;  1T6G C;  1DQ0 A;  4Y1Y A;  2J22 A;  1XC6 A;  4BIO A;  4KU8 A;  2AEY A;  2W0X A;  4TN7 A;  3SC7 X;  4RFR B;  3A21 A;  3N9O A;  1QJU 2;  1YQ6 A;  1CX1 A;  2A73 B;  1RUH 2;  1UOG A;  1UPS A;  4LHN A;  2ARA A;  2Y6L A;  1LR5 A;  2XR4 A;  2E7T A;  1UY2 A;  5HI0 A;  1MS0 A;  3WG2 A;  1PO1 2;  1COV 3;  4BQ3 A;  2OZJ A;  2FDI A;  2H0B A;  1O3R A;  5FRA A;  2YFZ A;  5LY1 A;  3QOP A;  5CG9 A;  5A7Q A;  2Q8O A;  4XF9 A;  3HD8 B;  3SCF A;  3UYJ A;  3C3V A;  1YLL A;  3PME A;  2ET1 A;  4I01 A;  3K51 A;  2C9A A;  4JGY C;  5AVA A;  4S2D A;  3RWK X;  2O8O A;  3FMG A;  3A0N A;  2ZMK A;  2ZAH A;  1X33 A;  1N3Q A;  1U0A A;  1IG0 A;  2Q1F A;  1W6Q A;  2V72 A;  2BWC A;  1Z7S 2;  1CAX B;  4OI0 A;  4HET A;  1HB1 A;  2RJ2 A;  4G3Y C;  3EB7 A;  2ARX A;  1ZRF A;  3D82 A;  4WVM A;  4CDW A;  4Z07 A;  1RUJ 1;  2BJS A;  3T2O A;  2UWC A;  1F8V A;  4A7K A;  2VZP A;  4MXW A;  3BGA A;  2PFW A;  1RUC 1;  3HJR A;  1X50 A;  3V0A B;  1D4M 1;  4UFJ A;  1W2A X;  2VZO A;  4WVW A;  2NPI A;  2Y6J A;  3GHN A;  3QCW A;  1YNA A;  5DAW A;  4DPN A;  4F7Z A;  2RR1 1;  3RJ2 X;  4JX0 A;  4Z8B A;  1W0P A;  5KBF A;  3CJX A;  4YGE A;  4YVW C;  1I9R A;  5KXD A;  4E4H A;  4YSF A;  1YJL A;  1F5F A;  2W2I A;  2XQR A;  1XBF A;  3LDK A;  3SEP A;  4YAR A;  2D3S A;  2W08 A;  1BEV 1;  4PBO A;  2HWE 3;  5I8S A;  1PVC 2;  5AC9 1;  4DY3 A;  1H8T B;  1RVF 1;  4UFI A;  4DS0 A;  4DY5 A;  3N4M A;  3NO8 A;  5DUU A;  3WQ7 A;  5BYN A;  1ZRD A;  1O4Z A;  3I3Q A;  3U4X A;  1W3X A;  3MF9 A;  1RUE 3;  5FZ8 A;  1HLC A;  4AFC A;  1JN2 P;  1YJK A;  3POI A;  1VBD 1;  4PBP A;  1S2K A;  3J7H A;  3LAG A;  2YHJ A;  4QB6 A;  5FPB A;  3RZZ A;  3WCS A;  4C8D A;  4EE2 A;  2B46 X;  4GB3 3;  4UF0 B;  1D0G A;  4WM7 B;  2RM2 3;  3LA2 A;  1OKQ A;  2C1F A;  3C7F A;  3WOG A;  4P5H A;  1OOP A;  3Q9O A;  4LLO A;  3LKJ A;  1S0I A;  3P3N A;  2HBU A;  1LHW A;  4OUS A;  3B69 A;  3U10 A;  2XVL A;  4XQ4 A;  1FYU A;  4LK7 A;  4OI1 A;  3PJY A;  1NT0 A;  3JQW A;  2DFC A;  3AKP A;  1K5M B;  2ZGP A;  3K77 A;  3ZYP A;  5JCT A;  5GM0 A;  3VBS C;  3MW2 A;  2R07 3;  4NJ4 A;  5DZG A;  2BVB A;  2VOT A;  4CXW A;  3NKG A;  4YW4 A;  5C70 A;  3T2Q A;  2ZBJ A;  2VY0 A;  1MQT B;  2P37 A;  1L3J A;  2ZKL A;  3VV1 A;  4D94 A;  5JMC A;  1RUD 1;  1PIV 3;  4YZ3 A;  1CAW B;  2PQS A;  3MIC A;  4IV3 C;  5FQ0 B;  3ZR6 A;  3W5N A;  2V4V A;  4AI2 A;  3ZVX A;  3ELN A;  2CYF A;  4R9C A;  4PLN A;  2Q4S A;  2VMH A;  4CEW A;  3ZLI A;  1J83 A;  1X9T A;  2ATF A;  4XUQ A;  2ZHM A;  2C6S A;  3GJA A;  4XOG A;  2WWU A;  3ZO0 B;  5D8A C;  5C4W B;  4FTE A;  4QPG A;  3ORJ A;  1QNY A;  3DPR A;  3FE5 A;  3Q8A A;  2X10 A;  1J3R A;  3J7L A;  2R06 3;  4PJY A;  1AVB A;  4LO6 B;  5I8T A;  5FJK A;  1GWK A;  1OPO A;  2G9G A;  1LJ7 A;  1F4A A;  4R8H A;  2YB7 A;  1KS5 A;  2VBD A;  5BNP C;  3RI8 A;  1CZS A;  1Q5O A;  1VMF A;  1AR9 1;  3KF3 A;  2JDY A;  3MW4 A;  4R9A A;  1WCQ A;  2WN3 A;  3ZKY A;  3WQB A;  3ZXA C;  1VBC 2;  4KH9 A;  1WUV A;  4TWT A;  5IAV A;  2JG9 B;  3N36 A;  1JZ4 A;  3AFG A;  2JDM A;  3ATG A;  3ZIW A;  4ERO A;  1YIF A;  4AQ6 A;  2QDR A;  4U2A A;  3SMH A;  3VBH B;  2SBA A;  3RS6 A;  3AZZ A;  4Z2A A;  3ZX7 A;  4Y4R A;  4JGZ B;  2F4L A;  4AL9 A;  2GMM A;  1RTV A;  5I0S A;  3ZFE C;  4COU A;  1FV3 A;  4P02 B;  1XYN A;  4XJU A;  4EN9 B;  1ENX A;  4OHY A;  1UKR A;  3KGL A;  3MW3 A;  1JZ6 A;  3ZOI A;  1DDL A;  2HWC 3;  5A3P A;  2C24 A;  2ZAB A;  4IES A;  4ZU5 A;  3FLT A;  5EHD A;  5IAT A;  2WZP P;  4EN8 B;  4GQ7 A;  5BPX A;  3ZN6 A;  4A4A A;  4HPK A;  4QU2 A;  4PIY A;  4S2F A;  2SLI A;  1V0A A;  3H50 A;  4FPE A;  3BI3 A;  4WVM B;  4CDW B;  1H9W A;  2GND A;  2RDN A;  1MPX A;  1HDK A;  1LGB A;  2D93 A;  1JUI A;  1BBT 1;  1JOJ A;  2DV9 A;  4CSW A;  1NOV A;  2Q8C A;  2GNM A;  2Y6F A;  2XPJ A;  4FTS A;  4MXW B;  2R04 2;  3I3E A;  1A8M A;  4YVS A;  5C5T A;  4ES8 A;  3C2U A;  5J1X A;  4CPB A;  4OHV A;  4HSL A;  4M0H A;  3WT3 A;  5ABJ A;  5ISL A;  2GDF A;  4M0N A;  1RUJ 2;  2XQX A;  1DYK A;  3DN7 A;  2LRP A;  3ZXL A;  2FDF A;  5A1A A;  3DYM A;  3NNF A;  5CBL A;  5HCF A;  1RUC 2;  4ATF A;  3UK9 A;  4V2W A;  3D0J A;  4V1P A;  3K4Z A;  1D4M 2;  2HYX A;  2YG0 A;  4FBF A;  5GLZ A;  5F9T A;  5D21 A;  2PQQ A;  1XSQ A;  2YZ4 A;  4CUC A;  5IVJ A;  1J1L A;  2RR1 2;  4AK3 A;  4AYU A;  2JKB A;  4FPH A;  4GWN A;  4Y5Z 0;  3NJX A;  3MEP A;  3GBG A;  3VD5 A;  4AFB A;  3NL1 A;  4HVQ A;  3FBM A;  2ZGL A;  2JG8 A;  3K2O A;  4KNC A;  4OUE A;  2HWB 1;  5JZG A;  4JKK A;  4EWE A;  3ENR A;  4CCD A;  1MS1 A;  5FY1 A;  3OB8 A;  1J58 A;  3ZFF C;  1LGN A;  1ZZ7 A;  2D6M A;  1DLC A;  2P3I A;  5FO7 B;  4A7Z A;  3JQX A;  4LLF A;  4CCO A;  1BEV 2;  2MNG A;  2ADD A;  1TE1 B;  4N43 A;  4OHW A;  4ZXK A;  4CCL A;  2B39 A;  5AC9 2;  2DUP A;  1XJA A;  1RVF 2;  3LSD A;  2GC1 A;  4XDQ A;  1U12 A;  1AR6 3;  5A3T A;  2VMD A;  3WV6 A;  5DMY A;  1SDW A;  1OOP B;  2WNE A;  2OPW A;  1VBD 2;  3VD9 A;  3W9A A;  2BGO A;  1W8O A;  1ST8 A;  2ZX1 A;  1LB2 A;  2VOK A;  1PGS A;  1FNZ A;  4JKM A;  2R49 A;  3PLQ A;  4XJZ A;  3JD7 1;  3ZFG B;  1SZB A;  3O1R A;  4AFA A;  5FUP A;  4BK5 A;  4J1W A;  1W9S A;  2VVD A;  2ZCW A;  4WM8 C;  4LTA A;  3DEM A;  4MUV A;  1WZX A;  4IEW A;  4J6G A;  1CGP A;  1TMF 3;  2F17 A;  3N3H A;  4UW6 A;  1MR5 A;  4MXV A;  4CCJ A;  5A1L A;  4IL7 A;  4QXH A;  2DTW A;  5A3O A;  3LQC A;  4NII A;  1GP5 A;  1LHV A;  1DP0 A;  1MZ5 A;  1KJL A;  2WKK A;  4IEU A;  2WZR 3;  2P5B A;  4Q4X 3;  3WDX A;  4HKL A;  2O14 A;  3HNM A;  4XPV A;  4JAA A;  1UY0 A;  3AK0 A;  1CQ9 A;  2ZX0 A;  4CEW B;  5T5J A;  1NCR A;  5IK4 A;  2WWJ A;  1PVX A;  1XNK A;  1XYP A;  4OI2 A;  4RR3 C;  3WG4 A;  5JLV A;  4QPG B;  1VRB A;  4CZS A;  4QM8 A;  1RUD 2;  3I2H A;  5T5P A;  3DPR B;  3AKR A;  3CEW A;  2AAC A;  3VBF A;  2CGO A;  2JB4 A;  3GZE A;  3MIH A;  4AAP A;  4D7Y A;  3DYO A;  1JUH A;  1C57 A;  1EV1 1;  2LM3 A;  3KVB A;  4QQO A;  2LW8 A;  3BTY A;  5K7P A;  1EUU A;  2NN8 A;  2VZ1 A;  2WS9 1;  1R08 3;  4ITC A;  5KHJ A;  2QKD A;  2I2S A;  3D3A A;  4X6R B;  3K75 B;  2WQZ C;  2IXJ A;  4FT8 A;  1VAM A;  2L9L A;  3O1T A;  1GUI A;  5DUX A;  1PO2 1;  2XOM A;  5HCA A;  3QBQ A;  1EY2 A;  1AF9 A;  1F31 A;  4G4F A;  4MGY E;  5F3G A;  3ZXF A;  1A8D A;  1PZ7 A;  4QB2 A;  4NIG A;  3KT4 A;  1OH4 A;  2WNU C;  3LDB A;  1RJ7 A;  1T6B X;  5CYY A;  5FZ1 A;  1H1I A;  3UKT A;  3VGI A;  3BVC A;  3RZG A;  1UX7 A;  5H9Q A;  5LA0 A;  3WHT A;  1CON A;  1AR9 2;  2UWA A;  1NY7 1;  3RGB A;  1Z0H A;  4QAW A;  3CIH A;  1JYI A;  3W5M A;  3AMH A;  2JE7 A;  2BOI A;  2W68 A;  4A3Z A;  1I6X A;  2IUW A;  4QX2 A;  1CWP A;  3CL1 A;  4XDP A;  3P1I A;  2GC2 A;  1WW7 A;  1UX6 A;  1C4R A;  3Q8E A;  1F35 A;  5FYC A;  2V73 A;  5FP7 A;  4FPF A;  5FYM A;  4Y3O A;  3ZN6 B;  1YWK A;  4HPK B;  2OUJ A;  3WDV A;  3OGS A;  2FHR A;  4NHL A;  4FCA A;  3THP A;  3WQ1 A;  3AYE A;  4UBH A;  1RB8 G;  1US3 A;  3VHR A;  1MS8 A;  4LXL A;  1ULE A;  2OKX A;  5JSP A;  4N7I A;  3A22 A;  3MBW A;  4MO3 M;  3NWK A;  2EA7 A;  3Q8F A;  4YVS B;  4Y1V A;  2Z4F A;  3LA7 A;  1OBN A;  3D8C A;  4ISQ A;  4YRD A;  4RS5 A;  4KU7 A;  1YO8 A;  1BBT 2;  2YBS A;  3OUI A;  3LZZ A;  5BNO B;  2XWJ B;  3MLJ A;  3WR0 A;  1DG6 A;  4B1M A;  4Q1R A;  1JZ8 A;  3WNK A;  4NRQ A;  5EYX A;  1BK1 A;  3ZMO A;  3THD A;  1D2Q A;  1VRH 3;  4IND A;  1A6C A;  1GQP A;  2VM9 A;  2XJP A;  1PX3 A;  2D7F A;  1YQ8 A;  4PLO A;  4A44 A;  3J7N A;  4OFG A;  1IZ3 A;  3WNX A;  1DHK B;  3GAL A;  1QU0 A;  4YGB A;  2W52 A;  3IKW A;  4XVH A;  3I2K A;  2NMO A;  3BB6 A;  4PT6 A;  3MIE A;  3VZL A;  3GZU C;  1H1M A;  3J7M A;  2QQM A;  2VQA A;  2RS5 3;  4XXA A;  4COW A;  4CUB A;  2X5I C;  4M3C E;  4E27 A;  2CGP A;  3OBA A;  1IS3 A;  4K6B A;  4RGG A;  2HWB 2;  2YXS A;  3AZY A;  1JH5 A;  3ETQ A;  3EBR A;  4OZX A;  3KVA A;  5DAV A;  1V9U 3;  2DVG A;  1V00 A;  3MIG A;  3L9J T;  2XUE A;  4CE8 A;  1LEM A;  1SLA A;  1ND3 A;  5GZF A;  5FYU A;  4P9X A;  3OOX A;  1C5I A;  2PLV 3;  4CEY C;  4LMF A;  1FAT A;  1RJ8 A;  1OD5 A;  2WA3 A;  4LUK A;  5EZW A;  3WDY A;  5L7O C;  3UGG A;  2A6Z A;  4GZ9 A;  1EAH 1;  1QNW A;  1SLC A;  2K9Z A;  1SPP A;  3DXU A;  5FOB B;  5I0D A;  1DQ5 A;  1RUG 1;  2UYB A;  2G9Z A;  4OHZ A;  1ZZ6 A;  3E6B A;  3OEA A;  4XMA A;  1C3H A;  5IVF A;  3CZJ A;  4TYS A;  2DVA A;  2WNV A;  3AC0 A;  2VUC A;  5IK8 A;  3JD7 2;  3E5X A;  3OTF A;  3IMN A;  5CKN A;  3NST A;  1DZQ A;  1NCR B;  1QGL A;  3AX4 A;  4LBN A;  3UJO A;  3ZYJ B;  1R09 3;  5FKB A;  3UES A;  1FMD 3;  4Q4V 1;  4N7U A;  5EV7 A;  4BQ5 A;  4QX1 A;  1YFX A;  2Q5T A;  1QMJ A;  3VBF B;  2D3P A;  4COZ A;  1CJP A;  1VIW B;  2ZS6 B;  2DFB A;  1AXK A;  2HYK A;  4W50 A;  2WBK A;  1W9Y A;  3T1M A;  2VMG A;  2ZGN A;  5FZ0 A;  2YMZ A;  4K9S A;  5FMC A;  2VG9 A;  3N7J A;  4AGG A;  3DCQ A;  4DXS A;  1XB9 A;  4H7M A;  1AL2 3;  1H2L A;  3FBY A;  1EV1 2;  3UGH A;  1O4T A;  4ORF A;  4F83 A;  2WS9 2;  4K21 A;  5EFU A;  1JYN A;  2RDS A;  2GME A;  3RJR A;  1OVP A;  1QJX 1;  3KCC A;  3PU3 A;  2OUH A;  2WIN B;  1PO2 2;  2K2S A;  1QJZ A;  3DL3 A;  2QQK A;  3NNM A;  1KFX L;  2FMY A;  1ZZB A;  5F3E A;  3KF5 A;  2I07 B;  2EIC A;  1A78 A;  2BTV C;  4HFS A;  4OMC A;  4PQ9 A;  4R52 A;  1UO9 A;  4Y5S A;  3T09 A;  4NIH A;  4GH4 A;  3RYK A;  2OYZ A;  3F95 A;  3M3I A;  1NE6 A;  2D5H A;  3B9C A;  4HG6 B;  5KHH A;  3SH5 A;  4ASM B;  1RIT A;  4D7T A;  1UKG A;  3BOD A;  3ZSL A;  3HEI A;  1NY7 2;  4MSV A;  1POV 1;  1NXD 1;  4IV1 B;  1NKG A;  4JGY A;  3FHI B;  4S2G A;  4FXG B;  3WG1 A;  1NYW A;  4AW7 A;  1V6O A;  2O1Q A;  2YYO A;  3ZSE A;  4RSU A;  3SEE A;  1NG0 A;  1URX A;  5FZ6 A;  4BH9 A;  1I1E A;  3ZN4 A;  4XTP A;  4O65 A;  1S2E A;  1LGC A;  4IEQ A;  1VB2 A;  4NRM A;  3EO6 A;  5IW0 A;  3PIG A;  3OBR A;  3D4K A;  1OKO A;  1AR8 3;  3GCW A;  4YFW A;  5J96 B;  4JTO A;  5IFT A;  2HEY F;  4WZF A;  2ZHL A;  1SG3 A;  3PUH A;  2XKP A;  4IEY A;  3NJV A;  3VDA A;  3RMX A;  5BNN A;  2JE9 A;  4R9D A;  1S0J A;  1JS9 A;  4LOT A;  3N9Q A;  1NZI A;  3UKN A;  1ASJ 1;  3WDU A;  1DBN A;  3NJY A;  3I2D A;  3OF1 A;  4XF4 A;  3WZ1 A;  4GJZ A;  2E31 A;  3WF1 A;  1ULP A;  2HWD 1;  4CTE A;  4TZD A;  4QPI C;  4QU1 A;  1QOO A;  5FWE A; 
#chains in the Genus database with same CATH homology
 5FZO B;  5FYU A;  5FZB A;  4GAZ A;  2WWJ A;  5FWJ A;  2PXJ A;  5FYV A;  5A7P A;  1VRB A;  5FY4 A;  5FXW A;  5A80 A;  5IVB A;  5FZA A;  5FZO A;  2XML A;  3DXU A;  4HOO A;  4AAP A;  5FZH A;  4IGQ A;  4Y4R A;  5FP9 A;  3KVB A;  4QX8 A;  5FP3 A;  5FYI A;  5IVY A;  5F32 A;  5FBJ A;  5A7O A;  5IVF A;  5FZE A;  5A1F A;  4QXC A;  5FYB A;  5FXX A;  5F5I A;  5A7W A;  5FY8 A;  5FUN A;  5A3P A;  5F3G A;  4D6Q A;  3AVS A;  4IGO A;  5F2W A;  4CUG A;  5FPL A;  3PUQ A;  5FY0 A;  3PU8 A;  3LDB A;  5FYH A;  5FZF A;  4AI9 A;  2XXZ A;  5FZ1 A;  2GP5 A;  2GP3 A;  4GJY A;  3LD8 A;  3N9M A;  5FZI A;  5F39 A;  4EZ4 A;  5FZ9 A;  4LIT A;  4E4H A;  4CCK A;  5F3I A;  5FZ7 A;  5FZ4 A;  2W2I A;  5FPU A;  4D6R A;  5KR7 A;  5FZM A;  4CCN A;  4CSW A;  2Q8C A;  4EYU A;  2OS2 A;  5FZ0 A;  5K4L A;  5FPA A;  5FZG A;  4ASK A;  5A3W A;  3KV9 A;  4XDP A;  5FZL A;  5A7W B;  5CEH A;  2XUE A;  5FYZ A;  5FYC A;  4LIU A;  5FYY A;  5FP7 A;  5ISL A;  5FYM A;  4Y3O A;  5LWB A;  4QWN A;  5FZD A;  3PTR B;  5FZ8 A;  5FY5 A;  2YU1 A;  3N9L A;  4C8D A;  5FPB A;  5FXZ A;  3KV6 A;  3PU3 A;  5A7N A;  5FYT A;  3AVR A;  4UF0 B;  2OX0 A;  4V2W A;  5E6H A;  4DO0 A;  2YPD A;  2Q8E A;  5A7S A;  4HON A;  4LIV A;  4XDO A;  5FZ3 A;  5F37 A;  4LXL A;  4BU2 A;  3OPW A;  5IVJ A;  5F3E A;  2OQ6 A;  4UF0 A;  5FP8 A;  3K2O A;  5FPV A;  3ZPO A;  5FXV A;  5FY1 A;  5FY9 A;  4DIQ A;  3U4S A;  5FZC A;  2YBS A;  2YBP A;  3PUR A;  5FJH A;  4Y33 A;  4CCO A;  5LW9 A;  3RVH A;  4CCL A;  4V2V A;  2VD7 A;  4CCM A;  3K3N A;  5F5A A;  3PUS A;  4URA A;  5A3T A;  5A3N A;  5FY7 A;  5IVC A;  3AL5 A;  2YBK A;  2Q8D A;  5LY2 A;  3AL6 A;  5FZ6 A;  5ANQ A;  4D6S A;  4IGP A;  3DXT A;  3PDQ A;  5IW0 A;  4TN7 A;  2OQ7 A;  3N9O A;  5F5C A;  3ZLI A;  3OPT A;  5F3C A;  5IWF A;  3KV4 A;  3KV5 A;  2WWU A;  2P5B A;  5FP4 A;  4QXB A;  5FUP A;  2XDV A;  4GD4 A;  4NUB A;  2YU2 A;  3N9Q A;  3N9P A;  4EZH A;  5LY1 A;  5FV3 A;  5A7Q A;  4BIS A;  3NJY A;  4CCJ A;  5FJK A;  5A1L A;  5IVE A;  4QX7 A;  3UYJ A;  4GJZ A;  3KVA A;  4QXH A;  4BXF A;  5FYS A;  3U78 A;  3N9N A;  5IVV A;  3PUA A;  5FZK A;  4QU1 A;  3K3O A;  2OT7 A;  5FWE A;  5F2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...