1QOOA

Lectin uea-ii complexed with nag
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
236
structure length
234
Chain Sequence
b'SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN BINDING LECTIN, UEA-II
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
molecule tags Lectin
total genus 54
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qooA00
3MW4A 2EAKA 4Q1PA 4YGEA 3ZYPA 2NZ9A 1CN1A 2A6ZA 2WNEA 3IMNA 4DS0A 2E53A 1IS6A 1LULA 1MZ5A 2DYCA 1ULEA 4FPEA 4TZDA 4XJUA 4ISRA 4M3CE 3WDUA 5T50A 3AP6A 3AYDA 4HANA 1YXWA 1QU0A 4FQ4A 1GBGA 5GLVA 2A71A 2DUPA 1Z78A 2VUAA 3WZ1A 4XBQA 3SNMA 3ZXKA 2W08A 1G9CA 5T5LA 5IK7A 1WD3A 3ZSMA 3N7KA 5CA6A 2GMEA 1N1SA 3HN1A 1UPSA 5JLVA 2GMPA 4CRQA 5JOXA 4Y24A 1H30A 4YFWA 4XYXA 2WT0A 3VKFC 3N7LA 1APNA 4FPYA 3ZXFA 1LJ7A 2JECA 3AYEA 4XXPA 1OQ1A 1S0EA 1UZYA 1W6NA 5JDBA 1IOAA 1W6PA 1LHUA 1SLAA 4Y1ZA 3MW3A 1UN1A 3B69A 1Z0HA 1LOEA 4XZPA 5L73A 3ZPYA 4XMAA 1F9KA 2CWMA 1HKDA 2NMOA 1VAMA 4Q27A 4U36A 3IKWA 3PVOA 4DRRA 2UWBA 1O4YA 3TAYA 3T2TA 3WDTA 3AFKA 3OY8A 3A0NA 3ILFA 1N1TA 2EXIA 5GM0A 4P14A 4PQ9A 1SLCA 2JDZA 3PVEA 3WCSA 4XIOA 4GA9A 1W6NB 2TEPA 3M3OA 1Q8QA 1W6PB 1YI7A 3FUOA 4YZ2A 2EF6A 1GYKA 4DPNA 2A7AA 2G4IA 2OUJA 3AK0A 4XJ8A 2D6OX 2WSVA 4JRAA 1DHKB 3C2UA 5HCFA 5KXCA 2D6PA 2GMMA 4LBKA 3RS6A 1WW5A 1Y7BA 3A0KA 3OY8B 3WV6A 1LOBA 3N36A 3R4UA 4PBOA 3WCRA 3WDYA 3OJBA 4XILA 4FPHA 4YW4A 4BQ1A 1YIFA 2DTWA 1G86A 1YYNA 2ZHLA 2D44A 2YZ4A 2ZGQA 3D5OA 3V65A 1MVQA 1W0PA 2WT1A 3M3CA 1QDOA 4ISQA 4LBJA 4XE9A 3O0WA 4Y20A 1CJPA 3AYAA 2ZMLA 1LHOA 2AENA 2SLIA 1QOTA 3PVNA 5SV8A 1CONA 1SBEA 1JXNA 1CR7A 1ULGA 3POWA 4UW3A 3JUUA 1YRZA 1SLBA 1SFYA 4FP2A 1J1TA 1D0HA 3VKMA 2ZABA 3V64A 3ZXLA 1DLLA 2NN8A 1KRIA 1FATA 2A6YA 5IUQA 2ZGOA 4XIKA 5GLTA 4NO4A 5KXDA 1DQ0A 1BXHA 2ZGNA 4WVVA 4C1XA 3DUIA 3NWKA 3O0XA 1JYCA 1SBFA 1WLDA 2R49A 3LSDA 3OYWA 2NP0A 4R9BA 1ENSA 1MZ6A 2GNTA 1UAIA 4Y20B 3RG0A 3V0AA 2GALA 2P3KA 3NV3A 4L8QA 1KITA 2DVFA 3ILRA 3FLTA 1C1FA 1UKGA 4MYEA 1QNYA 3HR9A 1BZWA 4P9XA 1DQ6A 4XTPA 4YG6A 1C4RA 1LODA 4YZ5A 2WJSA 1AJOA 4XHBA 2WSUA 4AYUA 4ITCA 4P9YA 4FOWA 2ZMNA 2PHUA 2A6WA 4XJWA 3OYWB 5AVAA 3RRDA 1MS3A 2CL2A 2VH9A 2BQPA 3V0AB 4Y1UA 4XMIA 3WHUA 1QKQA 4M3CF 4Q1RA 2CYFA 4DQAA 2ENRA 3POYA 4FPLA 4BOWA 2ZACA 3WG1A 2OUHA 2AYHA 1MS8A 1LHWA 1GZ9A 3O12A 4YM1A 1N47A 3UL2A 1YO8A 3SLIA 3WG2A 4AWDA 5T52A 1FV3A 2PHTA 1DYPA 3OBRA 4WZFA 4WV8A 3TB0A 3RSJA 1UZZA 1I1EA 1GZCA 3B00A 4FOVA 2PHXA 3AX4A 1R1ZA 1GV9A 4M01A 1LOAA 1G9FA 1C57A 5GLWA 5GLUA 1LGBA 3NV2A 4Y22A 1KDKA 2D6KA 1SBDA 4PF5A 1BQPA 3AZVA 1AX0A 4AGGA 2DVBA 2AR6A 4F83A 3DGTA 1CPMA 3LCPA 3M2MA 3SH5A 2P37A 2D43A 2ZAAA 2ZGMA 5IK8A 2WKKA 3I4IA 3WLUA 3N35A 1VAVA 3O0VA 3N7MA 4YM0A 3T1LA 2ARXA 1AXZA 3ASIA 1LENA 2JD4A 4FQZA 1WLCA 2GNDA 2ES3A 2OW4A 2PHWA 3JU9A 4FVVA 5FRAA 5GZDA 5DUWA 3WNXA 3GALA 3ZSJA 5IK4A 2YMZA 1FNYA 4Y22B 2P3JA 2H0BA 1V6NA 4FPKA 5IK5A 1AVBA 3SH4A 3SISA 1V6MA 4BM8A 1MR5A 5BYNA 1Q8SA 1LGCA 2FHRA 3IN9A 5EYYA 1UL9A 3WUCA 3ZSLA 5CBLA 3BODA 4D69A 4RA0A 4Y1VA 1LESA 3ENRA 1HLCA 2D3SA 1W6MA 2V73A 4YGBA 3WUDA 4W65A 1LGNA 1W6QA 4GWNA 1A8DA 1LTEA 1MS4A 5EYXA 2NM1A 2ARBA 4R9DA 2P34A 2ZZJA 2P3IA 2ZA9A 5DUUA 1WCSA 2HYKA 2LTNA 1O4ZA 2R0FA 2D3RA 5CB7A 2UURA 1DQ4A 1CQ9A 2ZKNA 5GZEA 5T5OA 3W59A 1LU2A 1LOFA 3WVJA 1Q8OA 5KXEA 2E7QA 4U2AA 5GALA 3WDWA 1F31A 1W6MB 3AXEA 1UX6A 1Q8VA 4LBQA 1V00A 1GLHA 4Y1YA 1W6QB 3QLQA 1LECA 1GKBA 3BTAA 5DUXA 1JHNA 5JVVA 5JMCA 4UW4A 4BLJA 2E51A 4K1ZA 3ILNA 2E7TA 3B01A 2V5YA 4KBBA 5DG2A 2ZGTA 3ATGA 1MS5A 1IS3A 2EALA 2ZGKA 1FYUA 2YV8A 1OKQA 2DU0A 1WBFA 1N1YA 1V6KA 4JCKA 4LBNA 5GJ6A 2D6LX 1N3PA 2EXKA 5CNAA 4LBQB 1S1AA 1GZWA 1QOOA 3SH3A 3FLPA 2W39A 1OFSA 2DVDA 4XDQA 2EXHA 4YFZA 5F9TA 1DZQA 3INAA 1JYIA 5F5QA 1IKQA 2WLQA 1SACA 4FPJA 4Q26A 1ULCA 4YM3A 1LHNA 4ZKTB 3I8TA 2FMDA 3VKLA 3FUQA 4YZ3A 3UJQA 3VKOA 3L2YA 3ZSKA 3N3HA 1V6LA 1S0BA 2C9AA 4YW5A 4CTEA 2EIGA 1WUVA 2GN3A 1LEMA 1JBCA 4LBOA 1FX5A 1KJLA 1WW7A 1H9PA 1GZWB 4LBQD 4XXAA 1LOCA 3W58A 4UW5A 1HQLA 1DGLA 4Q8KA 1GSLA 1AXKA 1URXA 3RMYA 2D3PA 2D6MA 4Y26A 1WW4A 2A6VA 1F5FA 1FV2A 4YZ4A 4DFSA 1TEIA 2R16A 2DURA 4NOTA 2D6NA 2ZMKA 4YLZA 2LALA 5DZFA 2AUYA 1DIWA 3APBA 4AVVA 1NXD1 3M3QA 2VU9A 3NV1A 1KQRA 2VXRA 5GLZA 4R9CA 5CAZA 4K1YA 5E89A 2UWAA 3AP5A 3GNEA 5EXOA 3WHTA 5IT6A 1DFQA 1HDKA 1PZ8A 2DWRA 3UK9A 2DV9A 2DVGA 1ONAA 4BMEA 5EWSA 5T5JA 2A5ZA 1PZ7A 2ZHNA 2OVUA 3O5SA 4FP3A 4OZXA 2P2KA 4AVSA 2CY6A 1IS4A 3BIWE 1S0DA 2E6VA 3LSEA 1JOJA 1CIWA 3MPPG 1Q56A 1C1LA 3M3EA 4M00A 1WD4A 1MS1A 3AP9A 4Y1XA 4ATEA 1KDMA 5T54A 2JE7A 4ATFA 3MW2A 1B09A 3ZXJA 1S0IA 5JOWA 4YG3A 4YM2A 1AX2A 4K20A 5HCAA 4BPZA 2DTYA 3FBYA 5HCBA 1H9WA 1DQ2A 3USUA 2ZBJA 1GICA 5JOZA 1EPWA 2A3YA 3H0OA 4AGVA 4PCRA 3FLRA 1G8WA 4FPOB 4GWMA 1W0OA 5JOYA 1SCSA 4AVTA 2CTVA 3IPVA 1Q8PA 1AX1A 4FOYA 1MACA 1VLNA 1LCLA 1ULFA 2JKBA 2A6XA 3POSA 4FPCA 3ZVXA 1HQWA 2XB6C 1IKPA 1UMZA 1SLLA 2YY1A 2ZHKA 4YGCA 1S0FA 2C5DA 5FREA 3T1MA 3USUB 1U0AA 1WLWA 1PZ9A 1V6OA 1I3HA 2AGSA 3OPZA 2YROA 3V0BA 3R05A 5E8AA 3FFZA 3WDXA 4UW6A 2CWSA 4GKYA 4XJAA 2PELA 4YG0A 3IPVB 2Z42A 2ZGRA 3N7JA 4XJ9A 3RMXA 2R1BA 3AJZA 3OBTA 1A78A 5E88A 4LBLA 2VW0A 1JN2P 1DQ1A 4BMBA 1ENQA 4YW1A 2PHRA 1IS5A 3AZZA 4HL0A 3SITA 1LU1A 1VIWB 3MEPA 2VY0A 1JUIA 3Q9OA 4R9AA 4AGRA 4DRVA 4Q2FA 4WVWA 5GZFA 1QDCA 2DUQA 1W6OA 1SLIA 1CPNA 2VW2A 1AJKA 1N3OA 4P9WA 4Q8LA 2WQZC 1FAYA 5KXBA 3KQRA 2WT2A 4XBLA 5H9RA 3V0BB 4YW2A 5GZCA 1D2SA 2ZHMA 3QCWA 4K21A 1QGLA 2RHPA 5H9QA 1BYHA 2A3XA 1G9BA 1N3QA 2AREA 3A4UA 5H9PA 1RITA 3AZXA 3M1HA 3WG4A 1QOSA 2ZGSA 4SLIA 3WDVA 3AYCA 5DZGA 3WG3A 1LOGA 3AZYA 3CNAA 4IQPA 1S0GA 3VKNA 2UWCA 2CNAA 4I30A 3WOGA 1DQ5A 5DUVA 2GNBA 1BJQA 3OGGA 5GZGA 1ENRA 1FNZA 2JE9A 1W6OB 3PJQA 5DXDA 3ZYRA 4BLIA 2JJ6A 3KM5A 4Z8BA 4TYSA 2DU1A 3NV4A 4JC1A 2B7YA 3AZWA 4YZ1A 3AP4A 2GNMA 4ASMB 4LBMA 1MVEA 3AXDA 2EXJA 4PBPA 2W52A 4CZSA 2Q5TA 2XG3A 2SBAA 1ULDA 3D4KA 1GNHA 1WBLA 2KM2A 3B9CA 4GALA 1AXYA 2R1DA 1AZDA 2A3WA 1QF3A 3UJOA 1X50A 2ERFA 2VW1A 1LEDA 3U4XA 1V6JA 1GANA 1DBNA 1LOFC 4ZXKA 1JW6A 1CVNA 1NLSA 4M3CA 2PHFA 3VUOA 4FPFA 1VALA 1KJRA 2ZGPA 3AJYA 1GNZA 1QNWA 4H55A 4XJZA 1S0CA 3ZXEA 1SCRA 1S0JA 1CESA 1DYKA 1ZM1A 1WW6A 1BKZA 1G7YA 1N1VA 3HMYA 2A75A 4XOGA 4XBNA 1ZA4A 5T55A 3AP7A 2ZGLA 2ZGUA 2UU8A 3R4SA 2R0HA 4XHXA 1V6IA 4GXLA 1RIRA 2AH2A 4XTMA 5LK5A 3D6EA 2NMNA 1A3KA 2A70A 4M3CB 2GN7A 2DVAA 1MS0A 2I2SA 4YW3A 1AF9A 1SLTA 4GKXA 3IM0A 2D7FA 3PMEA 1G9DA 1RINA 1XQNA 3VV1A 1G9AA 1MS9A 5T5PA 2W68A 3RQ0A 3B3QE 4FPGA 5DG1A 2DUOA 4C1WA 2YXSA 5H9SA 2NYYA 3BOPA 4FOQA 1LHVA 2GDFA 4RL7A 5DZEA 1QMJA 4YGDA
chains in the Genus database with same CATH superfamily
2WA4A 4XQDA 3MW4A 4Q1PA 4YGEA 1RUG1 4FFFA 1LULA 1UY0A 1YQ5A 3WDUA 1U5XA 2BOIA 2XLGA 2IXCA 3CHXA 3LB9A 5FPZA 4D94A 4A4AA 2RJLA 3AFGA 2QQUA 2E9QA 4CCDA 4CE8A 1Z78A 2VUAA 5HPOA 2XH6A 3USSA 1BEV3 4QT6A 2BUKA 2NPIA 2WLPA 1G9CA 5IK7A 3KGLA 3MF6A 1TNRA 1UXZA 4B29A 2NLRA 4BQ5A 2CAVA 3LPGA 2JDNA 2GMEA 4F8AA 3WNOA 3HN1A 1UPSA 2GMPA 4CRQA 4CEYC 4A6SA 1J3PA 1AUYA 3VKFC 1HXS3 5D2AA 2C9KA 3I59A 4BQ4A 1O3RA 3PIJA 3ELNA 1AR92 5LW9A 5JDBA 2BZDA 4UFHA 1V0AA 1VMHA 1W6PA 1AR91 2FDFA 4FTSA 4XURA 3T09A 1UW8A 3B69A 1Z0HA 3PDQA 4GQ7A 4XMAA 2HWC2 4Q27A 5LA1A 5FBJA 3KSCA 3PVOA 4DRRA 1R64A 1O4YA 2JG8B 2D5FA 4NRMA 3NKTA 2CHHA 4W8JA 2EXIA 4PQ9A 3JZVA 2MNGA 1REDA 2XUMA 1UD1A 1YUDA 3M3OA 5C71A 1Q8QA 5APAA 1W6PB 2KR2A 1NLQA 4KNCA 2EF6A 4E2QA 1GYKA 1CAUA 1LKNA 3JBG3 4OUMA 4XJ8A 2JXAA 1HW5A 2B39A 3ACFA 2D6OX 2WSVA 3BU0A 2K0GA 1ZVFA 1YNAA 4YW6A 4OQ9A 4LK7A 2F4PA 1EUUA 2D6PA 1R093 3H9AA 4HBNA 3RWNA 1W2NA 5IVFA 3NKGA 1WW5A 3CL1A 1LOBA 2JEMA 3WDYA 4FPHA 1YIFA 1NAEA 2J1AA 1G86A 1YYNA 4LORA 2YZ4A 3V65A 4TLGA 3D5OA 1NKGA 1MVQA 1W0PA 2WT1A 5F6LB 3CJXA 1PHMA 3AB0A 4AE2A 3CEWA 4Y20A 3U07A 3NNJA 2JG8C 3AYAA 3HBKA 2VBDA 1CAUB 1VRH2 3NNGA 2Q1MA 1QOTA 3PVNA 1W3XA 4UAPA 3PURA 5FZIA 4NWVA 4OI1A 1GWLA 4UW3A 2TNFA 4CU6A 1D2QA 2W1QA 3OUHA 3POWA 4LLOA 1YRZA 4CA9A 4XUTA 5KC5A 2R073 2ET7A 1PM7A 1J1TA 3TNPB 3ZXLA 1DLLA 2NN8A 3E1F1 2A6YA 1KRIA 5IUQA 5EFUA 1NUKA 5GLTA 5IHRA 4XAEA 2WINB 2YGMA 1QJFA 1BXHA 5FYSA 5IFTA 1WLDA 2ADDA 1VB2A 4R9BA 1YC61 2D5HA 2I45A 3PU8A 4Y20B 3NV3A 1OLRA 3J9SA 4CXWA 3FLTA 1C1FA 1UKGA 2J1VA 2TBVA 1QNYA 4QKBA 2WS92 1VBC2 3ZXAC 1BZWA 4RGGA 1DQ6A 2C6SA 1XNBA 4YG6A 1YFWA 1VBC1 1I9RA 1KFXL 4XHBA 5A1LA 5BNPA 4I01A 2Y38A 3UKNA 1IG3A 2O1QA 1O5UA 2ZMNA 3K51A 1UF2C 2A6WA 1HRI3 3H8OA 4XJWA 3RRDA 2J1EA 2QE3A 1P8JA 5FZFA 1DZTA 1Y43B 2BQPA 2LW8A 2LRPA 1QKQA 3G7DA 4FAHA 3P3PA 3C7OA 2IFRA 4LIUA 4M4RA 4OQ8A 4ONUA 3ORJA 3I2GA 3DKWA 4N7UA 4JQTA 5DQ0A 2CU5A 4Z1VA 5AFBA 1NQJA 4R52A 1PX3A 3UL2A 2RG4A 2YBSA 5B4XA 3SLIA 2VQUA 1O3QA 3WG2A 4FFIA 1CGPA 2Z2SB 5BNPB 1FV3A 2PHTA 2GC1A 5A7QA 4XF4A 1DYPA 2XJTA 4DXTA 1I6XA 2D98A 1J3QA 4M0NA 3RSJA 2QCSB 5JR7B 4QQPA 4LKDA 2JIJA 3AX4A 5F39A 3JD72 2QQVA 5GLWA 5I0SA 2AC1A 1Z7S2 1AR82 1NOVA 1BQPA 1UQXA 4RYDA 2Q8CA 2DVBA 3WW2A 2RM22 4AGGA 3DGTA 1CPMA 3M2MA 2P37A 1VBE1 1ZBA2 2K2SA 2D43A 3ZFEA 3L9JT 1H4HA 2RM21 3RZLA 5J7MA 1EY2A 2OA2A 3ZIWA 3I4IA 2ORXA 1ZBA1 2XWJB 2XGXA 1FMD1 1OXCA 2BEOA 2VZTA 1JZ2A 3F95A 1VBB3 3HEIA 2FCVA 2JD4A 4FQZA 1Q5OA 2ES3A 3UKVA 5A6XA 4M0HA 2B4KA 1GQGA 4P9LA 3WNXA 5IVEA 2LS6A 5BNPC 3A22A 2DCJA 3THPA 2P3JA 3QH6A 1SZBA 4IE6A 3GZEA 2EVXA 4JKKA 1V6NA 2XL9A 3H3ZA 4FPKA 3JB4C 2VQAA 5K0UA 1DLCA 3E5UA 3JQWA 1CWPA 5BYNA 4CCNA 3VDBA 3KCCA 1K5MA 1DDLA 5FZ0A 3IN9A 4NMIA 3GYDA 3ZFEB 3AKQA 5CBLA 1FXZA 5AC92 4D69A 5J3UA 1O91A 4Y1VA 1UKRA 5C6CA 3WF3A 5I8TA 4BDVB 5C8WA 4MGSA 1E5IA 1ZA7A 1AHSA 1W6MA 2D3SA 3GJAA 4QXCA 5AC91 4JKMA 4YGBA 3WUDA 5IFPA 2DDUA 2EIBA 4BISA 2VXJA 2KA3A 2NM1A 4UFMA 1TVGA 2P34A 5FOBB 4NIHA 1F4AA 1H2NA 2YHJA 2GU9A 1WCSA 3LOBA 1O4ZA 1Q43A 2V5DA 4LA3A 4AQ2A 4CCLA 2PMWB 3AMHA 5K0UB 4H2AA 3ZYGA 1W06A 1I5ZA 5T5OA 3D0JA 5K8SA 3PL0A 1K5MB 3LQCA 3W59A 2GH2A 1LOFA 1JU4A 4ZS2A 1Q3EA 3GZTB 5FYCA 2E7QA 5CVRA 3WD5A 1F31A 4JTNA 1W6MB 3KT4A 4QXHA 3BIEA 5IAXA 4LBQA 2C26A 5FAXA 3MV01 5JR2A 1GMMA 1XU2A 5DUXA 1GKBA 3T30A 4PHZA 5ACA3 3ZFEC 4BLJA 2E51A 4K1ZA 3LDKA 1O8SA 4IXLA 3ILNA 5FZHA 4MO3M 4LUKA 2V5YA 4QX0A 2WNVB 1MS5A 1IS3A 4JGYA 4GJYA 2G19A 3ME2A 4NR1A 1QJY2 3CKHA 5FZCA 1WBFA 4OI4A 1O59A 3AMMA 4JCKA 4B1MA 1UY3A 1QJY1 5EZWA 5GJ6A 4ZHNA 3I49A 1NY72 4LBQB 5JIAA 1S1AA 3ZPOA 5K0UC 4BU2A 1GZWA 1PNGA 2BERA 1K5MC 3EHKA 2W39A 3SH3A 3U37A 1PGW2 1NY71 4Y4YA 4GD4A 3NSTA 1T6GC 5FQ0B 3NNMA 3ZYHA 3HT2A 5F5QA 4B7EA 1PGW1 3HQRA 4JQRA 4ARXA 2QQJA 2FMYA 2FMDA 3VKLA 2QJVA 4JGYB 3RI8A 4AHYA 4DEQA 1AYN1 3KS7A 4TTGA 3TN92 2VQTA 1S0BA 2WO7A 4IV3B 2VR4A 4B7KA 1PO22 1WCQA 2EIGA 4S2FA 1LEMA 3TN91 4K8FA 2HWD2 2VZOA 2WNVC 1PO21 1KJLA 1YLLA 1WW7A 1GZWB 1RUH3 4LR4A 5FYTA 3T3YA 2HWD1 3W58A 2HEVF 1D7PM 4QMAA 3U10A 2GH8A 3ZR5A 3T08A 1COV2 1UMIA 4LE4A 5C5UA 1AXKA 1URXA 3RMYA 2VZSA 4Q29A 2D6MA 4OHVA 1JMUB 4X8PA 4D8MA 2IXHA 3IDCB 2D6NA 4AEDA 2PYTA 1PVC2 3R6SA 4OHWA 4YLZA 1DU3D 1O4TA 2AUYA 4OUSA 1HN1A 1GOGA 4GWJA 2FDJA 4IESA 4LOTA 4Q0VA 4Q4Y3 3RGBA 1NE4A 4BA6A 4CVUA 1PVC1 4Q4X3 5A6ZA 3PUHA 3HT1A 4RGKA 1J1LA 3I54A 4JGYC 4EROA 5LA9A 4K1YA 1XB9A 3AMNA 4IV3C 3AP5A 5E89A 1OUXA 5EXOA 3POJA 1DFQA 1BVVA 5EYYA 2DV9A 1ONAA 4BMEA 5EWSA 1PX4A 2A5ZA 4KQ7A 2PLV2 4MGQA 2ZHNA 2OVUA 2RS52 3A21A 4FP3A 3PU3A 3GZAA 4IEQA 5LASA 2Z79A 1ZRRA 3KF3A 3BIWE 3CZJA 3AKTA 4AEDB 2RS51 2E6VA 3LSEA 3THTA 5FO9B 5LY1A 1MS1A 5JXJA 5F32A 5T54A 2A73B 3PVBB 4AQ6A 4YRDA 4BIOA 3ZXJA 2R042 1QQP3 1S0IA 5JOWA 4JHTA 1XE7A 5HCAA 2DTYA 5FYMA 2R041 5HCBA 1PIV3 4QQ2A 3M8LA 2VZ3A 3C7EA 5C3OA 4IETA 1RUE3 1TME3 2ZBJA 3TBDA 3VZJA 2OIIA 4TSVA 4FPOB 1TMF3 1W0OA 5FY0A 4XDPA 3POIA 3KV5A 5A7PA 1ZRCA 1NZCA 4PI0A 5FJKA 1MACA 1LCLA 3IDAA 1ULFA 2JKBA 3RJ2X 1OOPA 3LZZA 3ZKUA 1SDWA 3ZVXA 1HQWA 3WNLA 2XB6C 4IDZA 1IKPA 2WDBA 3ZMOA 1UMZA 1RUG3 4XFCA 1ZZ9A 2GC0A 5FYHA 3HQUA 1H6YA 2XWBB 4AEDC 5B2GB 1RXGA 2C5DA 1OLMA 4LKEA 3LA3A 5E16A 5FZMA 3KCXA 2AGSA 3DYOA 4IE5A 2P1BA 4MGTA 3FJSA 3R05A 5IYYA 3WDXA 4CDUA 4UW6A 2CWSA 1NLRA 3LIGA 3Q8FA 4XJAA 4YG0A 2Z42A 5L9BA 3N7JA 3RMXA 2YU2A 2FDHA 3OUIA 4ZY9A 3OBTA 5HCHA 3H7YA 2VW0A 5D8AA 5LWBA 1ENQA 4FT8A 2PHRA 4BHPA 4R9AA 1OOPB 3MEPA 2VTXA 2VY0A 1EUTA 4CUGA 4DRVA 5C70A 5C9AA 3VZNA 3FN9A 2RMU2 2DUQA 1WCUA 2YG0A 2E63A 2HYXA 3EBRA 4CP2A 1V9U2 4P9WA 4Q8LA 1OD5A 1W0NA 2WT2A 2QQIA 1AR93 2Y0OA 4UFJA 1QJX1 4GZ9A 3P3NA 4XBLA 4CDUB 1D2SA 3QCWA 4LKSA 4XETA 1V9U1 5FR3A 2XVLA 1NG0A 2A3XA 1NA1A 5BUVA 1CX1A 2AREA 3FX3A 3ZOIA 1RITA 4RQPA 2ZGSA 4LHKA 3VDDA 3TEZA 2FCTA 1KS5A 3QD6A 2XDVA 5DZGA 4BZ4A 3VBFA 2CNAA 4I30A 5C9AB 5DUVA 4IE4A 4QXBA 1UYPA 2GNBA 1BJQA 2HWE1 1FNZA 3CF6E 3PJQA 3U78A 3ZYRA 5E6HA 1ND2A 2JJ6A 4TYSA 1S4CA 3L2HA 1OOPC 4YZ1A 4OHYA 4RHV2 3TEXA 4AHZA 4ASMB 1H1IA 3GM8A 1NA1B 4JVAA 4RHV1 4COVA 4RQPB 2ZTNA 1ULDA 1CJDA 3HNMA 2BU9A 2QTWB 1AXYA 2R1DA 3CIHA 3VBFB 3UJOA 1W9TA 4CDUC 3ZN6B 4E2SA 1KEXA 2JX9A 2RDQA 3U4XA 4XFGA 5EPAA 2PXJA 1ND2B 3PUQA 3GBGA 1JW6A 1W2OA 5FZDA 2BWCA 3THDA 4YSFA 4FFHA 3VUOA 3WX5A 2X53S 5FYBA 1AR62 2YC2A 5FKBA 3WR0A 4H55A 4CP0A 1S0CA 4HMZA 5FPUA 5C9AC 1CESA 1DYKA 2XLFA 2X10A 1N1VA 3PTRB 5C3PA 2N7GA 3HMYA 2A75A 3DEMA 1ZA4A 5T55A 3AP7A 2WNUB 3KV9A 2ZCWA 3WF2A 2ZGUA 2HWB2 2VZVA 3LEMA 5A1FA 1W2UA 5A1AA 2HWB1 4O61A 1NA1C 2LUWA 3D6EA 3AVSA 2JDKA 2A70A 4RQPC 2GN7A 2DVAA 1MS0A 2VNVA 5J1XA 1AF9A 2X05A 1XU1A 3PMEA 1RINA 1XQNA 1JUHA 1MS9A 5T5PA 3VBFC 1US2A 3WXPA 1KS4A 5K9YA 3RPQA 3RQ0A 4FPGA 4DINB 2DUOA 3OD0A 5FJHA 1ND2C 5ANQA 2NYYA 1FI2A 3FFQA 1RUI2 2JICA 3OF1A 1VBC3 4RFRB 3ZSJA 1OA3A 3WINE 2JD9A 2WNEA 2A6ZA 4URTA 2W46A 3IMNA 4XDOA 4XQWA 5FP8A 5JPNB 2DYCA 4FPEA 1I5PA 2K9ZA 4ISRA 4M3CE 4E4SA 5T50A 2WNUC 5J36A 3POFA 1RMU2 4N90A 3UKTA 3B93A 3NL1A 5C7GA 1YXWA 1GFF2 3ROUA 3MF9A 3BPSA 1JZ3A 2QQMA 2DUPA 1RMU1 3HBZA 1CAXA 1RVF2 2PQSA 4XBQA 4XQ4A 2W08A 2OZ6A 2BVBA 4HKLA 1RVF1 4YVSB 5DDJ2 4S2GA 4AK3A 3N9PA 4CCKA 2VVDA 2DCZA 4JV4A 2Q4SA 5FLJA 1X33A 1QJU2 2RS32 1RUD1 2P6CA 3SEEA 1XE0A 3ZXFA 1NE6A 4NJ4A 4E27A 4NIGA 3AYEA 2VAUA 3X29B 1QJU1 1UZYA 1W6NA 4KG8A 1IOAA 3C3VA 4A41A 3THCA 1HJFA 2EIEA 2FDIA 2YBKA 3MW3A 1UN1A 1CAXB 2CWMA 1HKDA 4UI9L 1VAMA 4U36A 3IKWA 1F15A 3AVRA 2UWBA 2J1UA 1VBE3 1O7FA 1NZIA 4E8CA 1TE1B 3V56A 4GH4A 3WDTA 5C8CA 3ILFA 1J3RA 4LOSA 5CFCB 3BKZA 5SV5A 4P14A 1FMD3 1SLCA 1DP0A 2XHKA 2JDZA 4PI2A 2Y6GA 1ZRFA 3OBAA 1W6NB 4HONA 1OC1A 4YVSC 3J7NA 1YI7A 3FUOA 4CYDA 2VZPA 4YZ2A 4IE7A 4Y5Z0 1WWYA 3AKRA 3NMBA 4DPNA 2A7AA 2Y34A 5T3NA 4MGKE 2H0VA 2XHNA 2OPWA 3AK0A 4AFDA 4QB1A 2OS2A 4QGNA 5JI7A 4K8RB 5BPXA 2J1RA 4AVCA 5JSOA 4LBKA 3RS6A 4JDOA 1IPKA 1Y7BA 4G9SB 4COUA 1W2AX 3WV6A 5C8CB 3N36A 4XILA 2WRAA 4I3GA 4CU8A 5AC93 4A42A 4ISQA 3HNBM 3BUCA 3ZDSA 2Y6FA 5JUVA 3K2OA 2FZ2A 3ES1A 1LHOA 1KGYA 1ZZ7A 2VJXA 5SV8A 1SBEA 1ULGA 2VG9A 1CR7A 4CCJA 5CFCC 5FXZA 1NCQA 4KGGA 1SLBA 1OA2A 3ZMNA 1FATA 3S57A 2ZGOA 1CZTA 4P9JA 4LEJA 5KXDA 2FDKA 1DQ0A 2ID4A 3DUIA 1DYOA 1JYCA 2VQ0A 2R061 3SKVA 2NP0A 1ENSA 2VTXJ 1MZ6A 2VGDA 3ZFGA 3RG0A 1WGPA 1RHI1 2P3KA 5AVPA 3ILRA 5C8CC 1W8HA 2GP5A 4MVTA 4MYEA 4GB32 3HR9A 1DGWA 2ZJCA 1NCQB 3RZJA 2Z4FA 4OZOA 1C4RA 4KBZA 4GB31 2X5IB 4WVMA 4YZ5A 4RSUA 4QX5A 3UT0A 4KI5M 3NVCA 1QIQA 1AJOA 3VB9A 2WSUA 2JB4A 2LROA 3K48A 4JRLA 3W5NA 4AYUA 2Q1ZB 4ITCA 2RDSA 1QJY3 3H1WA 1OI6A 3LFIA 2VUCA 2UYAA 3RZKA 1MS3A 4XACA 1RUJ1 2VH9A 3OUJA 1BHGA 3ZFGB 4WM8A 4XMIA 1QHDA 2J22A 5EQUA 3WHUA 3DCQA 2CYFA 1RUC2 2YPDA 4IGPA 4Y5SA 2VUJA 1YQ2A 2VD7A 4KU7A 5CKNA 1S2EA 2DBNA 3WG1A 4WVMB 2RR12 1MZFA 1AYN3 3NAPA 2VMIA 5DABA 3RYPA 2XL7A 4WZFA 4NHYA 5DN2A 3WQBA 3TN93 1NCQC 1FOD2 1GZCA 1OPMA 1PO23 2X5IC 2XONA 2HWD3 1FOD1 1FPN2 4QWNA 4WM8B 1W03A 1LOAA 1C57A 5GLUA 3NV2A 1SBDA 2ZZQA 1K3IA 5JI9A 1FPN1 2AR6A 2ZX4A 3D82A 3SH5A 1H1MA 1BK1A 1W9WA 4AHXA 2OQ7A 3ZFGC 1OT5A 1PMHX 3NAPB 4BQ2A 3WLUA 4L0PA 4L2NA 3T1LA 3ASIA 2Y6JA 4MXWA 1LENA 2VOKA 1PVC3 4IERA 1WLCA 1UYZA 5IVYA 5FRAA 1PO12 4FVVA 3RFRA 3KGZA 4Y4RA 5GZDA 5DUWA 2AEYA 1Y9QA 1PO11 2VNOA 4W6YA 3WQ7A 1HQNA 2DBIA 1W8UA 4LKFA 4QPYA 3PNAA 3SISA 4B4QA 1V6MA 4G4FA 5IJRA 2OT7A 1BLZA 2E31A 3ZSLA 3O7OA 1UL9A 3BODA 1NT0A 2HWC1 4WM8C 5JSRA 3ENRA 1HLCA 4QB6A 5JZGA 2R32A 4XC9A 5FZ3A 2VMDA 4MXWB 4W65A 1SEFA 1LGNA 3I59B 4GWNA 3LA2A 1UCXA 4NPMA 4K40A 4TWTA 5EYXA 3BGAA 3J7LA 4R9DA 2ARBA 3MIHA 3NAPC 3IZOA 2ZZJA 4FXKB 3P5BA 4J1XA 4COWA 2ZA9A 5DUUA 4D7YA 1GOHA 3RNSA 2R0FA 3G6JB 4QB2A 5L7OA 1QWRA 3WSOA 2JDAA 5CB7A 2ZX3A 4C90A 1CQ9A 2W0XA 4BQ3A 4WBBA 3WVJA 4LA2A 2F17A 4NIDA 2OPKA 4U2AA 4NHXA 5FY5A 3F2ZA 4MHRA 3AXEA 3UV9A 1Q8VA 2WL1A 1HB1A 3T4VA 1LECA 5JMCA 5A7NA 5J48A 2RS13 4HN0A 4PQQA 1RUF2 2VZ1A 4WVZA 3VHNA 5L7OB 5DAXA 3TWIA 1RUF1 3ATGA 1J83A 1VRH1 3I2DA 2ZGKA 3VDCA 2WFF2 2B5HA 4CDXA 1OKQA 3GDBA 5ANNA 2DU0A 5FIXA 1N1YA 3JB8A 4C91A 1M4WA 1WA6X 5KC6A 4B4RA 3IMMA 4EN8B 4QX8A 4NVPA 1R082 2WIIB 3GXUA 1G6NA 2MEV2 4XZUG 2Y8KA 4DB5A 3BB6A 3WW3A 5KHKA 3DXTA 1YHFA 1E5HA 1C5HA 1OF3A 5F9TA 2MEV1 3I2OA 1SACA 4Q26A 2ORZA 4N9HA 5FP9A 4ZKTB 4N53A 3I8TA 2ETEA 1NQDA 1TZOA 1O6UA 1QJX3 3UJQA 1A34A 4UFLA 4XFFA 1V9U3 1F5JA 2WS91 2ARCA 1A6CA 1XE8A 5GKAC 3ZYBA 1WUVA 5I91A 2GN3A 4LBOA 4EE2A 5L7OC 4N43A 1MZEA 3MO4A 4XXAA 3IT8A 1J59A 3W9AA 2ZPXA 3E5XA 5C3QA 2HWE3 1H4GA 1H2MA 1R1A2 3NJVA 5F5IA 5HI0A 2ZKLA 1C8M2 3A7QA 4N53B 1JH5A 3RYKA 2A6VA 3N9LA 1JZ6A 1R1A1 2I07B 1C8M1 2R16A 4XCBA 3S5QA 4KWLA 4AVBA 1WCDJ 4NROA 1PGSA 3OEAA 4NHKA 2RVAA 4RHV3 4XPVA 5A3LA 2YDEA 4WM7A 1DIWA 3APBA 4AVVA 4A3XA 1YQ6A 4KG0A 2VU9A 3NV1A 5CKQA 3FMGA 3KWVA 4CDXC 4DUXA 4J1WA 4LTAA 5LEKA 3KB5A 3GNEA 4HK8A 3N9NA 2LM3A 2DWRA 1UZWA 1W8ZA 4QD2A 2QQPA 1HB4A 1ZREA 1JZ4A 1PZ7A 3O5SA 3JD71 4XUQA 2P2KA 4AG4A 1Z7S1 5A32A 1AR81 2BNOA 2CY6A 5FO8B 3T2PA 4FI9A 1F2NA 3CQOA 1JHJA 2XBO2 4BXSV 4M00A 1WD4A 3VD9A 4WM7B 3E5QA 3LA7A 4ATEA 1KDMA 4N53C 4NPRA 4UYBA 3MUY1 4Y3OA 4EN6B 5A3WA 3TNQA 2OYZA 3FL7A 1DGWX 4QDRA 4K20A 1ZNPA 2IXKA 4BPZA 5K7PA 1E5SA 2HWB3 1JU3A 1UZVA 2WA3A 4CPBD 1JYVA 4QQOA 1GICA 1RJ7A 3VZKA 2A3YA 4CDQA 2BPA2 3FLRA 1G8WA 1MEC2 4NHLA 5JOYA 4XAAA 4CSWA 3TEYA 3VHRA 5A32B 2MHFA 4AXOA 5KHJA 1MEC1 4FOYA 1VLNA 4PIYA 2XJPA 4IEOA 3VHPA 5FP4A 1A8MA 3HAGA 4CCMA 4Q5OA 5JWPA 4QU1A 1SLLA 4HSLA 4HFSA 2YY1A 4YGCA 3ZSEA 1S0FA 4OI0A 3PJYA 4X8NA 3VBUA 3WP6A 1PZ9A 1V6OA 4WM7C 2WZPP 3OPZA 4CDQB 2YROA 2VCCA 5A3MA 1H8VA 3K46A 3VL8A 5F3EA 1RMU3 4XJ9A 3O1TA 1Y9MA 2AEZA 1ASJ3 2O14A 1RVF3 2J42A 1DQ1A 5FZGA 5A3PA 4HL0A 1IS5A 3SITA 2WWSA 1LU1A 1VIWB 5IAVA 3Q9OA 5CFDA 4XF3A 4CCCA 4MLOA 1POV3 1YQCA 1RUD3 3CU7A 1CPNA 4LPLA 3Q8CA 1QJU3 3VBUB 4EWEA 1AJKA 1N3OA 3ACLA 1FAYA 4OMCA 5JXHA 4F7ZA 3MDPA 4K21A 5H9QA 2PHDA 1N3QA 1VMJA 3A4UA 1TNFA 5FUPA 3AZXA 3B02A 3M1HA 3WG4A 2WO1A 4O9EA 1EP0A 4EWDA 4AI3A 1JYXA 4SLIA 1T6BX 4NUBA 3WG3A 3WT3A 2BWAA 2VNGA 3CNAA 4AQSA 4IQPA 3VKNA 4CDQC 5CFDB 2UWCA 3UGGA 1QH6A 3H1YA 2GC3A 3NJZA 4MXVA 3OGGA 3MZHA 4Q0SA 3FWEA 3GJBA 2JE9A 5DXDA 4CEWA 1ST8A 2ZEYA 1XBFA 2P3YA 1CZVA 2XJSA 1UIKA 2PAKA 4LBMA 3WP3A 5D21A 2PHLA 3SMHA 1GQHA 2SBAA 3VBUC 3D4KA 4CXYA 2VTFA 2XQXA 3M70A 4Q4W3 5JCTA 1AZDA 4YYOA 2FD8A 2VCMA 1IZ3A 3KQ4B 1JZ7A 4URAA 3SEPA 3PUIA 3J7HA 2B46X 1GANA 4CEWB 1DBNA 1LOFC 2D93A 1NLSA 1CVNA 4M3CA 4UFKA 2PHFA 4ZXKA 4FPFA 1VALA 2VBPA 3PUSA 2ZGPA 3H8UA 4I0WB 5DPNA 5J37A 4L92A 4XJZA 4NWWA 5I8SA 1BBT3 1F4HA 5CFDC 1UOJA 4AFMA 1NX9A 1COV1 1ODMA 2WZ8A 4QDSA 3TRSB 2E7AA 2GC2A 2PA7A 3WY6A 3ZX7A 2HKXA 5BNNA 4Z92B 1GU3A 3ZR6A 3H3LA 1L3JA 2ZGLA 4L11A 2L9LA 1X82A 1XNDA 4AHWA 1RTVA 4ET7A 4M4PA 3OB8A 2Y6LA 1PK6A 4BYYA 3FBMA 2AH2A 4RS5A 5EV7A 2R063 4HZFA 4M3CB 1OVSA 1BEV2 3N4MA 1T2XA 2YBPA 4QDQA 4AI8A 5CZKA 4H7MA 1RHI3 4XW3A 1ZBE2 5EJ1B 1VBD2 4YW7A 4BH9A 2XVGA 3H42B 5JPMB 4F3JA 4A7ZA 5BNNB 4GJZA 2BDRA 3B3QE 1ZBE1 2PLV1 2RDNA 1VBD1 5FBZA 3NRUA 4C1WA 4CEWC 5H9SA 1OUSA 4GB33 2KXLA 4RR3A 1QMJA 3FHAA 1PMIA 4BCUA 2Q0AA 3NO8A 3ZYPA 1W2TA 4CU7A 2VCBA 1ZZCA 2E53A 5FP7A 4ES9A 1PK6B 1MZ5A 1XXNA 4RS5B 4XJUA 4OHZA 2WWUA 2MPFA 4H3WA 5C3RA 5KBFA 3AP6A 3AYDA 1RUJ3 5FXWA 2Y60A 4HETA 1GBGA 1WA4A 2WBKA 4BE3A 1PMJX 3LOIA 2A71A 3VBHA 2CV6A 2JIGA 2GAUA 3EQEA 1UIJA 3ZXKA 4QX2A 5T5LA 3C8XA 1WD3A 3GBFA 2ATFA 4P5YA 1ACCA 4MHUA 5IVBA 3N7KA 1X8MA 5CA6A 2W47A 2VL4A 3RVHA 4DMIA 4AZZA 4DXRA 1XSQA 3JQXA 1F35A 2O8OA 4Q0UA 4Y24A 4K7JA 5JOXA 1APNA 4FPYA 3JBG2 1H2LA 3M3IA 3MHZA 1WZXA 4XXPA 1OQ1A 3LGRA 5BNNC 1HRV2 2QQWA 4QX1A 5FY1A 2D97A 3EXUA 1LHUA 3JBG1 4IV1A 1HRV1 2ET1A 3BYWA 4IEPA 1R092 4AFAA 3MIDA 3VBHB 1LOEA 2XMLA 1KFUL 3LDRA 4MV2A 3ZPYA 3KLSA 1PK6C 1NYWA 2NMOA 5FY4A 1R091 4RS5C 3WQ0A 2B9VA 5CG8A 3TAYA 5B4NA 3PMSA 3AFKA 4NPLA 4W50A 1AR72 2BJSA 1N1TA 4AAXA 3I2HA 2QZ3A 5GM0A 3ZIXA 4XUNA 4P5HA 1AR71 2WAAA 3ZN4A 4XIOA 4GA9A 4HKOA 4D7TA 4XVHA 4XF0A 4EN9B 1UMHA 2UYBA 1OPOA 4MADA 2RMU1 4IV1B 1W3VA 4P02B 1PO13 3I97A 1Y9GA 2XQRA 5FK8A 1UY4A 5LBEA 3ES4A 3BTZA 2GMMA 5D8AB 1D4M2 4FFGA 2Q8EA 1GR3A 1PGL2 4OMDA 3A0KA 2HWC3 3WCRA 4PBOA 4BQ1A 3OJBA 2QDNA 1D4M1 3VBHC 2V72A 3KF5A 2DCKA 3FC0A 2H6CA 2ZHLA 1PGL1 4LHSA 3I3EA 2JG9A 1QDOA 1ZZ6A 2B45X 4LBJA 3O0WA 4PLNA 5F37A 3Q8AA 5FZOA 3VZOA 4D6RA 1W04A 3RI9A 2AENA 4CU9A 4OCTA 3ZDVA 5I0DA 1CONA 4HLTA 4MGYE 5FTTC 4E4DX 1S55A 4FP2A 4O65A 3H8RA 1BMV2 2IUWA 2ZABA 2HJIA 1HJGA 1HRI2 4UFIA 3VDDB 5E1RA 4DY5A 1BMV1 1DF0A 4IV1C 3O14A 4NO4A 1HRI1 2ZGNA 4UWDA 4WVVA 4C1XA 1BK0A 1HB2A 1YFUA 1BCXA 3OYWA 2JG9B 3HD8B 2W1UA 5KR7A 2GNTA 3H50A 5D8AC 1PNFA 5FZOB 4O9GA 1KITA 2YFZA 3R4DB 2W92A 5C5TA 1CAWA 5FMBA 4XTPA 1AR61 1RUF3 1VRH3 5EJ3A 5A33A 1XNAA 2P6HA 4N8MA 2RV9A 5FY8A 1EYBA 4V2VA 1H6XA 1OHFA 2BFUS 4FOWA 4XF9A 2P5BA 4DEVA 2PHUA 2HWF2 3OYWB 3ST7A 2GP3A 5AVAA 2A1XA 4A2UA 3M4FA 3NJXA 2VM9A 2HWF1 4B3NA 4H7LA 4Y1UA 1ODNA 2GZWA 3VDDC 1SDDB 3P1IA 2MEV3 3MIGA 1REEA 2ENRA 4FPLA 4XFBA 1CAWB 4YNIA 4BOWA 2ZACA 1US3A 3IAPA 3VDAA 3ETPA 2OUHA 3OPTA 2AYHA 4INDA 2WABA 1LHWA 2JG9C 2YC4A 3RWKX 1VBB2 1YO8A 3VBSA 5A33B 1IG0A 5T52A 2WS93 3ITQA 4GMP0 1VBB1 3HN3A 3U75A 5JMOA 4WV8A 3TB0A 3SCGA 4ORFA 1RUI1 2JDMA 1I1EA 1WMXA 4UBGA 2QFEA 5CISA 4ZU4A 4XFHA 1MPXA 4BB3A 4QM8A 1GV9A 4M01A 1XNTA 4LO6B 3W21A 4IEXA 1X8EA 1LGBA 4YW4A 4Y22A 2D6KA 1AYM2 3OGRA 3T4HB 1AX0A 1V70A 4IGOA 5F5CA 4MGIE 3U0ZA 1AYM1 3MFCA 2ZAAA 4AVAA 5FPAA 3VBSB 1S2KA 2WQ8A 1C8M3 5IK8A 2WKKA 4XFIA 3O0VA 3N7MA 4FO9A 5CIRA 2YFUA 5DDJ1 4W6WA 5FYUA 1RL3A 1H1AA 1IQDC 4DZGA 2GNDA 2OW4A 3LEIA 5LB6A 5FWJA 2XKOA 3T0DA 2PAMA 2Z69A 4I09A 4H14A 2RS31 5F5AA 5LA0A 1STMA 3KV4A 3MIEA 3UGFA 5IK4A 3DF0A 1VB4A 2YMZA 5BY5A 3HQXA 4Y22B 1IHMA 5IK5A 2BGOA 2VO5A 4HVOA 3JCIA 4FSJA 2CGOA 5K4LA 3JD73 1Q8SA 2FHRA 4Y5TA 3WUCA 5A3NA 1Z7S3 3C7GA 1AR83 3H3UA 4RA0A 1LESA 2RM23 5ACA2 4JDNA 2WNOA 1ZBA3 2BNNA 3O1UA 1X36A 2XR4A 2V73A 3POBA 5ACA1 1W6QA 1Y4WA 2P4EA 1MS4A 3U11A 3VBSC 5CKMA 2XKPA 5TSWA 3J26N 1HV0A 2P3IA 4AW7A 3T0AA 2OXBA 2BW8A 2HYKA 4CDWA 3AMPA 2RE9A 3MFAA 2Y33A 2R30A 2YPJA 2W1WA 3IWZA 4CP1A 1C28A 1IGOA 4YWAA 2UURA 1DQ4A 4E9KA 2ZKNA 2BGPA 5GZEA 4CP9A 1OD3A 2XPJA 3I2JA 1LU2A 1Y3TA 5LRSA 4P9IA 2DCTA 1LNSA 1Q8OA 1MEC3 3MLJA 4GH4B 1VRBA 4QPGA 5KXEA 2ZX0A 1OSGA 4QQHA 1VPHA 2WFPA 3VL9A 1UX6A 1V00A 4OYUA 1GLHA 4WZCA 1OKOA 5DAVA 1W6QB 1L7RA 2R7EB 2F6BA 2G9ZA 3BTAA 3QLQA 1JHNA 4GWIA 4LHLA 4UW4A 3DV8A 5FYYA 4D6SA 1LB2A 1XNKA 1YWKA 5ABJA 1D0GA 3B01A 1XSRA 4CDWB 5DG2A 2ZGTA 3ZM8A 3I2KA 3U14A 1EAH2 5FZKA 2EALA 2VMHA 5LZ6A 5KHGA 2CGNA 3EMRA 3HPNA 1H0BA 5KWRA 5CG9A 1EAH1 1RUH2 1V6KA 3E97A 5FYZA 4LNVA 4QPGB 1J58A 4HT1T 4LBNA 4B4PA 2D6LX 2EXKA 2J7MA 2W1SA 5CNAA 3I3MA 3SCFA 2VNRA 4GMP1 4QPIA 4E4HA 1O8PA 1YEWA 1QOOA 4HOOA 4XABA 3FLPA 3RJRA 3U4SA 4AFCA 5FZ1A 5ABJB 4CUBA 1DZQA 3INAA 4X6RB 5F8PA 1IKQA 2WLQA 4GH4C 4FPJA 1JYIA 1ULCA 2PAEA 2BBVA 3I3DA 3FUQA 4Z82A 2BRTA 1UOBA 4G3YC 2BFUL 4JAAA 5DAPA 4Q4X2 3S7IA 3VKOA 1QJEA 3ZSKA 3N3HA 4YW5A 3FHIB 3LF7A 4UXAA 4CTEA 2XUEA 4QHZA 5IWFA 3BOWA 3SQOA 3D3AA 4CDWC 4CXXA 3ZO0B 1JBCA 1H2KA 1VMFA 1W9SA 4COZA 5ISLA 5LRRA 4QPIB 3K3OA 2HBTA 4LBQD 4MSVA 1RUOA 1LOCA 4KGQA 4UW5A 4ARYA 4QPGC 3FZ3A 2OQ6A 3GHNA 1W8WA 2D3PA 3UESA 1JS9A 5EIYB 1WW4A 4DUWA 1F5FA 1RUC1 4YZ4A 5G04L 4DFSA 3KMHA 2ZMKA 3LE0A 1QQP2 2VECA 4R4XA 5ABJC 2LALA 1CD3G 2HEYF 3D0SA 4LULA 4XF1A 2RR11 5HV0A 2J1TA 1NXD1 1RUE2 4V2WA 3BPZA 3LAGA 5GLZA 2PQQA 4LO7A 5CAZA 1TMF2 2JDUA 2BTVC 5IT6A 4EZHA 1HDKA 1PZ8A 3POGA 4XCAA 5FXXA 4C0HA 3UK9A 2DVGA 2JB8A 1KXGA 4D3WA 2IC1A 1SG3A 2HBUA 4QPIC 1EV12 4AVSA 5KHIA 1OQDA 1COV3 1IS4A 1MQTA 2WWJA 5FP3A 5I8YA 4SBVA 3WF1A 1EV11 3MPPG 1RUG2 1Q56A 3AP9A 2WC2A 3WW4A 4PLOA 5I0UA 2JE7A 3EYPA 3ZYJB 1B09A 2BOJA 2I74A 3ABZA 4JGZA 2W91A 4LO5B 5FZBA 2JKXA 1JZ8A 3K77A 3FBYA 3N9OA 3WEZA 1H9WA 3USUA 3DXUA 4KWKA 4ZXEA 2VVEA 4GWMA 2ZEZA 1SCSA 4AVTA 1GZTA 1F8VA 1MQTB 1WKYA 1ZBE3 2EA7A 2PLV3 1VBD3 3T2OA 4V1PA 2JG8A 2RS53 3B5LB 2DFBA 2VCAA 2A6XA 1ZZ8A 3B7MA 3POSA 4S2DA 5FO7B 3KCYA 3H8XA 1K45A 2JDHA 1SQ4A 4DOUA 3AMQA 3TOJA 4JGZB 5CADA 2BNMA 2R6QA 3CLPA 1HIXA 4XFAA 5FREA 2ZEWA 2UY8A 3USUB 2R043 1U0AA 1WLWA 3U1XA 3M7AA 5LEJA 1I3HA 3V0BA 5E8AA 4TLFA 4GKYA 3ZLIA 2PELA 4MGZE 2WUHA 2R1BA 3RZGA 2X8KA 2HH9A 2QQKA 4AAPA 4LBLA 2VZRA 4QGLA 3UNPA 4N9IA 1JN2P 4OFGA 4BMBA 5JZGB 4YW1A 5FUNA 4LMFA 4ZZ5A 2FCUA 4BIFA 1RB8G 4WVWA 5GZFA 1QDCA 3SHRA 1MQTC 1SLIA 4YVWA 3KT7A 4IW3A 4W4ZA 3VD5A 2YGLA 1JOPA 1YIPA 3PUAA 3KQRA 3V0BB 4META 3ACGA 1HRV3 4RFT0 1REFA 2ZHMA 3LDBA 4ES8A 1QGLA 2RHPA 4JGZC 3KHCA 1G9BA 3ETQA 4CUAA 5H9PA 3EB7A 2ZOEB 4FBFA 2V4VA 2WFF1 4FXGB 4AEKA 3AC0A 1LOGA 2C0ZA 4OHXA 3VGIA 4ZZ8A 1XYOA 5J98B 4BQXA 1ENRA 4YVWB 1AR73 1R081 1U12A 4Z8BA 2DU1A 3NV4A 3VD3A 2FBEA 5JZGC 4JC1A 3CO2A 3DKQA 3MICA 5IVVA 2RMU3 1BVP1 5HXMA 1IPJA 2BYVE 3MBWA 1UPIA 1MVEA 2BBAA 3AXDA 4CDXB 5C33A 1B35A 4CZSA 2Q5TA 2XG3A 1AL0G 2QDRA 5FZAA 4NIIA 1UXXX 1WBLA 2KM2A 4GALA 2QZ2A 5F3IA 4AL9A 5LY2A 3WF0A 4FAGA 1JZ5A 5FKCA 1U5YA 1X50A 2ERFA 2VW1A 1D4M3 1LEDA 3J8F2 2VOTA 2WYFA 4K3UA 5L36A 3J8F1 3K4DA 3TYJA 5A6YA 2XXZA 3E6CC 1QNWA 1XC6A 3DECA 3S5AA 4AOCA 2JENA 4BK5A 2VZQA 1SCRA 2IWGB 1WW6A 1G7YA 2ZX1A 1YQ8A 1WLTA 4HSJA 1B35B 4XBNA 1AL22 3JXSA 1HV1A 4YVWC 1OLQA 2YUEA 1E5RA 3T0BA 4KWUA 3CJIA 1AL21 1VE0A 3R4SA 4QM9A 3VHOA 4C8DA 4XHXA 4N43B 3KVAA 5EP9A 5A7OA 1V6IA 4GXLA 1RIRA 1U5IA 4HK9A 5AFEA 5JAXA 2NMNA 1OURA 5F1RA 2I2SA 1SLTA 4GKXA 3IM0A 3VV1A 4AI0A 4NHMA 1GQPA 2W68A 4I02A 4OUEA 3VBRA 1AR63 2YC0A 2GDFA 4RL7A 2VOWA 1VP6A 3CJIB 2JE8A 2EAKA 3RZHA 2XBO1 3ACHA 4DO0A 4RGAA 2NZ9A 1CN1A 2WZR2 3DN7A 3VN4A 4DS0A 4BJ0A 4PLMA 1JTZX 1IS6A 2VVFA 1ND3A 1ULEA 4TZDA 4ASLA 1B35C 2WZR1 3K4ZA 1JYWA 5EJZB 2QBXA 3AL6A 3J7MA 4HANA 5FMOS 1WMEA 4COYA 1QU0A 2HWF3 2VMFA 4FQ4A 1VBE2 2Y6KA 4O7XA 5GLVA 5DZFA 5FZ4A 4N43C 4PJYA 3P6BA 4D6QA 3WZ1A 3SXWA 4AI1A 1POQA 4DXZA 3SNMA 4QU2A 3VBRB 3POEA 1FMD2 4EV0A 4EYUA 5I93A 3ZSMA 4J6GA 5A3UA 3CBNA 2VMGA 4RD7A 4EJRA 4EWAA 1N1SA 1WMFA 5JLVA 2W3JA 4JZRA 4PDWA 1UU4A 1SFNA 1H30A 1YJLA 2Y6HA 3I2FA 3GF6A 2WT0A 3MUZ1 4XYXA 3N7LA 4YFWA 1LJ7A 2DF7A 1ND3B 1RUI3 1XNCA 2JECA 2DFCA 1S0EA 3I7DA 3OSDA 1XYPA 4JTOA 2IFWA 3ACIA 5A7SA 1J84A 3GGLA 1SLAA 2ILMA 3CJIC 4Q0PA 4Y1ZA 5L73A 2QVSB 4XZPA 4KWJA 1F9KA 5F3GA 3B9IA 4HXCA 2V09A 4LUMA 5CYYA 2DCYA 1C3HA 1DZRA 1AYM3 4MUVA 4K6BA 5FZ9A 3IB3A 3I3QA 3T2TA 4FTBA 5IW0A 1JYTA 3OY8A 3A0NA 3VD4A 5JSPA 2IVJA 3HIFA 4PDWB 4PIXA 4AR2A 3O1OA 2W94A 1W8OA 5DDJ3 3PVEA 3OD4A 1OQEA 3VBRC 3WCSA 2ARAA 2TEPA 5M0TA 1QY4A 2RS33 3ZFFA 2QQNA 5FLHA 1LAJA 1TQ5A 3PHMA 1WCKA 2G4IA 2OUJA 2WNVA 4J25A 4GAZA 4E8DA 2ZXQA 4JRAA 5DMYA 1DHKB 1ND3C 3C2UA 5HCFA 5KXCA 1UOGA 5HV4A 3B94A 1VBA2 3GCWA 3OY8B 4NAMA 5FY9A 3R4UA 5HBAA 1YCIA 4FCAA 2WAOA 2DTWA 3MYXA 1VBA1 1W9YA 2D44A 2ZGQA 2BP6A 3M3CA 3OCPA 4XE9A 1ZYBA 2WQ4A 2C1FA 3S30A 5FQ0A 1CJPA 4AEJA 1UY1A 3ZFFB 2ZMLA 4QX7A 3WP4A 1JOBA 2SLIA 3E6BA 1C8NA 4ZU5A 4PDWC 1O3SA 3WW1A 1UX7A 1JXNA 3UGHA 5FZLA 3JUUA 1IQAA 3HWJA 4UF0A 3IIAA 1SFYA 3ZXDA 4Q4V2 4BQYA 1D0HA 3VKMA 3V64A 3CZUA 4IV3A 4C0BA 5JIUA 3W5MA 3WP5A 3GZUC 2IXJA 2V4AA 4HN1A 4Q4V1 4XIKA 3QOPA 1TG7A 3NNFA 5D1IA 4UOJA 2W87A 2OKXA 3NWKA 1W99A 4L99A 3O0XA 1SBFA 3LSDA 2R49A 5FWEA 4DUVA 3V0AA 1UAIA 1UNBA 2VULA 2GALA 4L8QA 2DVFA 3RZMA 5G05L 3MV11 5IVCA 1AYN2 3WQ1A 1K42A 4LHNA 1OMIA 4UF0B 4P9XA 5LCWL 4IEUA 1LODA 4QXKA 5FOJB 1PM4A 2WJSA 5BNQA 2B9UA 4GULA 3ZFFC 2CSGA 1EAH3 5L9RA 3EO6A 3S7EA 4P9YA 1ALYA 4HKWA 3TEWA 2W9XA 3LEKA 4DNYA 2CAUA 3QBQA 5KHHA 4GMP3 2CL2A 2B42B 4JKLA 3O1VA 3KVBA 3V0AB 1LR5A 5EHDA 1QXJA 4Q1RA 1X9TA 3DPRA 4M3CF 3CMGA 5F2SA 2AZ5A 3IDBB 3RDIA 4DQAA 1W28A 3POYA 1JYNA 4Z2AA 1O3TA 1BEV1 4AQTA 3BALA 5FPBA 3MI8A 1MS8A 2P17A 1DGRN 1GZ9A 3O12A 1QXRA 1N47A 4YM1A 4PF1A 4NE9A 3OGJA 1HXS2 4AWDA 4L9BA 4XEZA 2UY9A 2BVVA 3OBRA 1VR3A 1HXS1 1GWMA 1NCRA 3R0RA 5FMOL 1UZZA 1ZZBA 4MG2A 3B00A 4E2GA 1X7NA 4FOVA 3NJYA 2PHXA 4Z2WA 3O1MA 3UYJA 1R1ZA 2E26A 3DPRB 1G9FA 2XOMA 4KL1A 1KDKA 4F83A 4PF5A 3AZVA 3VBOA 2WR9A 3LCPA 3KZ4C 4HVRA 1GWKA 1UWWA 2Q30A 4KU8A 4DIQA 4EN0A 1RUC3 2X29A 2ZGMA 2VC9A 4A45A 3K3NA 4RR3B 2F4LA 2EICA 3N35A 1VAVA 4P9GA 4YM0A 3MLKA 4ZU7A 5FCCA 2ARXA 1AXZA 1NCRB 2RR13 5FZEA 3SC7X 5F6KA 3VD7A 5A80A 2PHWA 3JU9A 4KH9A 5A3TA 3OEBA 3WNKA 4AI9A 4KMQA 3GALA 1GUIA 5IATA 1FNYA 1ZX5A 1FOD3 2H0BA 5FPVA 1VJ2A 3VBOB 2Q8OA 4A7YA 4EQVA 1AVBA 3AKSA 1CX4A 3SH4A 4BM8A 1YFYA 1MR5A 4XUPA 1FPN3 5LA2A 2OX0A 2VBBA 1LGCA 2W5FA 1OFNA 3OGVA 4P00B 2PFWA 1GP4A 2W2IA 3BU7A 4R4ZA 4I2OA 2VUDA 4LK6A 3DPRC 4NRPA 5A3OA 1EV13 1OH4A 3K4AA 2RS12 2PTMA 5LBCA 3RYRA 2OZJA 1A8DA 1SPPA 3LFMA 1LTEA 4LO8A 5FZ6A 2RS11 1YFXA 2R072 4RR3C 4QPWA 2YB7A 4YPJA 2LTNA 3C7HA 5FLIA 2D3RA 4IL7A 1NCRC 2R071 2ZS6B 1JODA 2Z5WA 2XVKA 2CDOA 4MZUA 1RJ8A 5FV3A 5J09A 4QHBA 5FZ8A 1UY2A 2GSYA 4IEZA 1OA4A 5GALA 3WDWA 4LE3A 3IBMA 3VBOC 1XRUA 2XJVA 4Y1YA 1CZSA 1U5ZA 1SPPB 2C24A 3CDZB 5JVVA 5LBFA 5DAWA 1VAKA 5J96B 1ZRDA 2Q1FA 5I0TA 1QJX2 4GIQA 2E7TA 3I3BA 4KBBA 1W8FA 4L97A 4BXFA 3ON7A 4QHOA 3K75B 3IIIA 4LJHA 3UETA 2IXLA 1FYUA 2VOVA 2YV8A 3W20A 2AACA 1NXMA 3DL3A 2FZ1A 1DGRA 1XJAA 4W6XA 1QXPA 1POV0 4CUCA 2HEWF 3ZYIB 4ASKA 3S6PA 1N3PA 2HWE2 1W90A 2VMEA 2VE1A 5A6QA 3ZN6A 4TN7A 4NRQA 2Y26A 4PIZA 3FHQA 1OFSA 2DVDA 4XDQA 2EXHA 4YFZA 2K46A 1CIYA 3NNLA 1QEXA 2WZEA 1OF4A 2IVIB 4E4ZA 2Q8DA 1LHNA 4YM3A 4AF9A 4UBHA 3H1MA 3WNMA 1XPWA 5BV6A 4YZ3A 4ZS3A 3MGUA 2QQLA 3L2YA 4HPKA 4AI2A 1V6LA 1W8NA 2C9AA 1L7QA 2WNUA 3KT1A 4IE0A 1UZ0A 2FQPA 3WNNA 4AFBA 2CGPA 3KD4A 5FXVA 3MIBA 2WFF3 3PIGA 3DYMA 1FX5A 1DCSA 4TXWA 1H9PA 4JHZA 1RC6A 1RYYA 1ENXA 4CPBA 3ZN5A 1H8TA 1HQLA 2JWPA 4MX3A 1X9PA 1DGLA 2C4XA 2G9GA 3C7FA 1GSLA 1R083 1GNYA 4Q8KA 3D8CA 4N7IA 4Y26A 2J1SA 5FPXA 1HN0A 1FV2A 4QX3A 2WYSA 4RN5A 4HPKB 1TEIA 4NOTA 1GP6A 2DURA 2VMCA 5FK7A 3I2IA 1YJKA 1UU5A 1W39A 2ZEXA 2TUNA 1UYXA 5FDBA 5LK7B 3AL5A 4OLLA 5BNOA 1RGSA 2IZWA 1E57A 4DY3A 5C3SA 4LQRA 4HVQA 3M3QA 2JDYA 1KQRA 2VXRA 1QJZA 4R9CA 4X6QB 4QQLA 1O5LA 2UWAA 1H8TB 3WHTA 4D7SA 1D4VB 4A44A 3NQHA 2CDPA 3SCHA 4QGMA 1CAVA 3J8F3 3N9QA 3BTYA 5T5JA 4Z07A 1S2BA 5A7WA 2QUOA 4MOAA 2XJUA 2NQYA 2W95A 3BI3A 4OZXA 4A3ZA 1M06G 1R1A3 4I3PA 1S0DA 3AM2A 1GP5A 3MLLA 4LT5A 4YVSA 1JOJA 1CIWA 3NW4A 3E6DA 1C1LA 3M3EA 4Y1XA 1SMVA 3KHBA 2ZX2A 4CCEA 5BNOB 1YI9A 3MW2A 1AL23 4ATFA 3LD8A 4LXLA 4YG3A 5FZ7A 2HLEA 1AX2A 2WN3A 2WN2A 4YM2A 4NIAA 1OBNA 5LBBA 1IPSA 2BGCA 1DQ2A 2VPVA 3BN6A 5FYIA 4A6OA 4AEMA 1CAVB 1EPWA 1XYNA 3H0OA 1OH3A 5CU1A 4PCRA 4AGVA 1ASJ2 5JOZA 2QQOA 3Q8BA 4NN0A 5A7WB 1UYYA 1UO9A 5FYVA 2CTVA 3IPVA 1ASJ1 1Q8PA 2E32A 3HOBA 2EIDA 1JI6A 1AX1A 1H8TC 1K5JA 1PVXA 3LPFA 4LO4B 3ZXGA 4BK4A 1FT9A 1RUD2 2H6BA 3ECQA 4HG6B 4ZONA 4LIVA 3S0MA 4FPCA 5CFCA 1POV1 4I0BA 2XBO3 5FFOC 2ZAHA 4P08A 3OOXA 2ZHKA 3MPBA 3BCWA 5F3CA 5DAQA 3T1MA 2WZR3 5L19A 5JXGA 3Q8EA 3LEGA 4EN7B 5BNOC 4LLFA 4BQWA 5A70A 3FFZA 3IAQA 2BV4A 2O0OA 4OI2A 3WF4A 3IPVB 3QH7A 2ZGRA 3AJZA 3OGSA 2KD7A 3PTYA 4OULA 1A78A 2IXIA 1LRHA 5E88A 3VLBB 2YU1A 4PT6A 3OTFA 3AZZA 4YARA 5ERLA 3BVCA 1XOYA 2VZUA 2WO2A 1JUIA 2Y64A 2O8QA 3LKJA 4I0AA 4QKDA 4AGRA 1RXFA 4Q2FA 3OG2A 5LATA 1W6OA 2VW2A 4IUGA 3HNYM 5L9VA 5KXBA 3URFA 2WQZC 4EZ4A 5IVJA 3HJRA 5H9RA 3ALQA 4YW2A 5CEHA 5GZCA 4ZPIA 1W8TA 3BTXA 2G9FA 2G1MA 3GHMA 1BYHA 4Q4W2 4CP9B 3EJKA 3H7JA 2YYOA 1QOSA 1GOFA 4R8HA 2RDRA 1SHWB 4Q4W1 3WDVA 4DXSA 4IGQA 3AYCA 5C4WA 3AZYA 1RUH1 1S0GA 3WOGA 4B1LA 1DQ5A 3J4UH 5GZGA 4D0QA 2B8MA 1BBT2 3O1RA 1W6OB 5HXVA 4BLIA 3FE5A 1OLME 3AKPA 4CCOA 3KM5A 4S2HA 3O1SA 2QNKA 1BBT1 4NAOA 2B7YA 3AZWA 4JX0A 5F7UA 3AP4A 2GNMA 4Q4Y2 5FUIA 2FDGA 3IDEA 3ZKYA 4FTEA 2JDPA 2EXJA 4PBPA 3VZLA 2W52A 2X5IA 1W9FA 4Q4Y1 3LWCA 1GNHA 4Q4X1 2X09A 3B9CA 5F2WA 2R062 5C4WB 1DG6A 1QF3A 2A3WA 1UU6A 3PLQA 2D40A 4B8EA 4QAWA 1RHI2 4A7KA 2QKDA 2WO3A 1V6JA 1VBA3 2E33A 3A23A 3QACA 4K9SA 4Y33A 1KJRA 2RJKA 1L7LA 3AJYA 1GNZA 2RJ2A 3GCXA 3ZXEA 1SFPA 3WNPA 4CEYA 3LIHA 3SKJE 1S0JA 1QH7A 1HX6A 2VOXA 3ZYFA 1ZM1A 1BKZA 1HB3A 4XOGA 1EPZA 1ULPA 4BWOA 3KV6A 2PN5A 1KD7A 4QKFA 2XLAA 4OVEA 3DYPA 1K12A 2UU8A 3O1PA 4IEVA 1PIV2 1QQP1 4Q4V3 1RUJ2 2R0HA 4IEWA 5FMDA 1TME2 1UOFA 2EAAA 3RZZA 1PIV1 1C5IA 1W05A 4IEYA 4XTMA 5LK5A 1WMDA 3OBZA 1RUE1 1TME1 1ULOA 4XUOA 1A3KA 4JDMA 3HVDA 5FPLA 3VZMA 5JXIA 2XJRA 4Q0QA 1RUNA 4QKNA 4YW3A 1OVPA 4UT5A 1TMF1 2D7FA 5C4WC 1G9DA 4LITA 4CEYB 1G9AA 5FMCA 3OPWA 4MH0E 3T2QA 5BXXA 5DG1A 2ADEA 2YXSA 3BOPA 4FOQA 1ZRIA 1LHVA 3GBWA 3MIFA 3N9MA 5DZEA 5FY7A 2Y0IA 4YGDA 2XJQA 5I0RA
chains in the Genus database with same CATH topology
2WA4A 4XQDA 3MW4A 4Q1PA 4YGEA 1RUG1 1LULA 3WDUA 1U5XA 2XLGA 3LB9A 2IXCA 5FPZA 4D94A 2RJLA 3AFGA 2E9QA 1Z78A 2VUAA 2XH6A 3USSA 1BEV3 4QT6A 2BUKA 2NPIA 2WLPA 1G9CA 5IK7A 3KGLA 3MF6A 1TNRA 4B29A 2NLRA 2CAVA 2GMEA 4F8AA 3HN1A 1UPSA 2GMPA 4CRQA 4CEYC 1J3PA 1AUYA 3VKFC 1HXS3 1O3RA 3I59A 3ELNA 1AR92 5JDBA 1W6PA 1AR91 4FTSA 1UW8A 3B69A 1Z0HA 4GQ7A 4XMAA 2HWC2 4Q27A 3KSCA 3PVOA 4DRRA 1O4YA 2JG8B 2D5FA 3NKTA 2EXIA 4PQ9A 3JZVA 2MNGA 1REDA 2XUMA 1UD1A 1YUDA 3M3OA 1Q8QA 1W6PB 4KNCA 2EF6A 4E2QA 1GYKA 1CAUA 1LKNA 3JBG3 4OUMA 4XJ8A 2JXAA 1HW5A 2B39A 2D6OX 2WSVA 2K0GA 1ZVFA 1YNAA 2F4PA 2D6PA 1R093 3H9AA 4HBNA 3RWNA 3NKGA 1WW5A 3CL1A 1LOBA 2JEMA 3WDYA 4FPHA 1YIFA 1G86A 1YYNA 2YZ4A 3V65A 3D5OA 1MVQA 1W0PA 2WT1A 5F6LB 3CJXA 1PHMA 3AB0A 4AE2A 3CEWA 4Y20A 3U07A 2JG8C 3AYAA 1CAUB 1VRH2 2Q1MA 1QOTA 3PVNA 4OI1A 4NWVA 4UW3A 2TNFA 1D2QA 3POWA 4LLOA 1YRZA 5KC5A 2R073 2ET7A 1PM7A 1J1TA 3TNPB 3ZXLA 1DLLA 2NN8A 1KRIA 2A6YA 5IUQA 5EFUA 5GLTA 2WINB 2YGMA 1BXHA 1WLDA 1VB2A 4R9BA 2D5HA 2I45A 4Y20B 3NV3A 1OLRA 3J9SA 3FLTA 1C1FA 1UKGA 2TBVA 1QNYA 3ZXAC 2WS92 1VBC2 1BZWA 4RGGA 1DQ6A 4YG6A 1XNBA 1YFWA 1VBC1 1I9RA 1KFXL 4XHBA 5BNPA 4I01A 2Y38A 3UKNA 2O1QA 1O5UA 2ZMNA 3K51A 1UF2C 2A6WA 1HRI3 4XJWA 3RRDA 2QE3A 1DZTA 1Y43B 2BQPA 1QKQA 3G7DA 4FAHA 3P3PA 2IFRA 4ONUA 3DKWA 4N7UA 4Z1VA 5AFBA 1NQJA 4R52A 3UL2A 3SLIA 1O3QA 3WG2A 1CGPA 2Z2SB 5BNPB 1FV3A 2PHTA 2GC1A 4XF4A 1DYPA 2XJTA 1I6XA 2D98A 1J3QA 4M0NA 3RSJA 2QCSB 5JR7B 4QQPA 3AX4A 3JD72 5GLWA 5I0SA 1Z7S2 1AR82 1NOVA 1BQPA 3WW2A 4AGGA 2DVBA 2RM22 3DGTA 1CPMA 3M2MA 2P37A 1VBE1 1ZBA2 2K2SA 2D43A 3ZFEA 3L9JT 1H4HA 2RM21 5J7MA 1EY2A 2OA2A 3ZIWA 3I4IA 1ZBA1 2XWJB 2XGXA 1FMD1 2BEOA 1VBB3 2JD4A 4FQZA 1Q5OA 2ES3A 3UKVA 4M0HA 1GQGA 4P9LA 3WNXA 5BNPC 2DCJA 3THPA 2P3JA 3QH6A 4OI0A 2EVXA 1V6NA 2XL9A 3H3ZA 4FPKA 3JB4C 2VQAA 5K0UA 3E5UA 3JQWA 5BYNA 1DDLA 3KCCA 1K5MA 3IN9A 3ZFEB 3GYDA 3AKQA 5CBLA 1FXZA 5AC92 4D69A 5J3UA 1O91A 4Y1VA 1UKRA 5C6CA 5I8TA 5C8WA 2D3SA 1AHSA 1W6MA 5AC91 4YGBA 3WUDA 2KA3A 2NM1A 5FOBB 2P34A 1H2NA 2YHJA 2GU9A 1WCSA 3LOBA 1O4ZA 1Q43A 4LA3A 4AQ2A 3AMHA 5K0UB 3ZYGA 1I5ZA 5T5OA 3D0JA 5K8SA 1K5MB 3W59A 2GH2A 1LOFA 1Q3EA 3GZTB 2E7QA 5CVRA 3WD5A 1F31A 4JTNA 1W6MB 3KT4A 4LBQA 5FAXA 1XU2A 5DUXA 1GKBA 5ACA3 3ZFEC 4BLJA 2E51A 4K1ZA 4IXLA 3ILNA 4LUKA 2V5YA 2WNVB 1MS5A 1IS3A 4JGYA 3ME2A 4NR1A 1QJY2 1WBFA 4OI4A 4JCKA 3AMMA 1QJY1 5EZWA 5GJ6A 1NY72 4LBQB 5JIAA 1S1AA 5K0UC 1GZWA 1PNGA 1K5MC 3EHKA 2W39A 3SH3A 1PGW2 1NY71 4Y4YA 3NSTA 1T6GC 5FQ0B 3HT2A 5F5QA 4B7EA 1PGW1 4JQRA 2FMYA 2FMDA 3VKLA 2QJVA 4JGYB 3RI8A 4AHYA 1AYN1 3KS7A 3TN92 1S0BA 4IV3B 4B7KA 1PO22 2EIGA 4S2FA 1LEMA 3TN91 4K8FA 2HWD2 2WNVC 1PO21 1KJLA 1YLLA 1WW7A 1GZWB 1RUH3 4LR4A 2HWD1 3W58A 2HEVF 4QMAA 3U10A 2GH8A 1COV2 4LE4A 1AXKA 1URXA 3RMYA 4Q29A 2D6MA 4OHVA 4X8PA 2IXHA 3IDCB 2D6NA 4AEDA 2PYTA 1PVC2 3R6SA 4OHWA 4YLZA 1DU3D 1O4TA 2AUYA 4OUSA 4Q0VA 4IESA 4Q4Y3 5DZFA 4BA6A 1NE4A 1PVC1 4Q4X3 3HT1A 1J1LA 3I54A 4JGYC 4EROA 4K1YA 3AMNA 4IV3C 3AP5A 5E89A 5EXOA 1DFQA 1BVVA 2DV9A 1ONAA 4BMEA 5EWSA 2A5ZA 4KQ7A 2PLV2 2ZHNA 2OVUA 2RS52 4FP3A 4IEQA 3GZAA 2Z79A 1ZRRA 3BIWE 3AKTA 4AEDB 2RS51 2E6VA 3LSEA 3THTA 5FO9B 1MS1A 5T54A 2A73B 3PVBB 4AQ6A 4YRDA 4BIOA 3ZXJA 2R042 1QQP3 1S0IA 5JOWA 1XE7A 5HCAA 2DTYA 2R041 5HCBA 1PIV3 4QQ2A 3M8LA 4IETA 1RUE3 1TME3 2ZBJA 3TBDA 3VZJA 2OIIA 4TSVA 4FPOB 1TMF3 1W0OA 1ZRCA 1NZCA 1MACA 1LCLA 1ULFA 2JKBA 3RJ2X 1OOPA 3LZZA 1SDWA 3ZVXA 1HQWA 2XB6C 1IKPA 3ZMOA 1UMZA 1RUG3 4XFCA 1ZZ9A 2GC0A 2XWBB 4AEDC 5B2GB 2C5DA 3LA3A 5E16A 3KCXA 2AGSA 3FJSA 3R05A 3WDXA 4CDUA 4UW6A 2CWSA 1NLRA 4XJAA 4YG0A 3RMXA 2Z42A 3N7JA 3OBTA 3H7YA 2VW0A 5D8AA 1ENQA 4FT8A 2PHRA 4BHPA 4R9AA 1OOPB 3MEPA 2VY0A 4DRVA 5C9AA 3VZNA 2RMU2 2DUQA 2E63A 4CP2A 3EBRA 1V9U2 4P9WA 4Q8LA 1OD5A 2WT2A 2Y0OA 1AR93 4XBLA 1QJX1 3P3NA 4CDUB 1D2SA 3QCWA 4XETA 1V9U1 2XVLA 1NG0A 2A3XA 1NA1A 5BUVA 2AREA 3FX3A 1RITA 4RQPA 2ZGSA 4LHKA 3VDDA 5DZGA 1KS5A 3QD6A 4BZ4A 3VBFA 2CNAA 4I30A 5C9AB 5DUVA 2GNBA 1BJQA 2HWE1 1FNZA 3CF6E 3PJQA 3ZYRA 1ND2A 2JJ6A 4TYSA 3L2HA 1OOPC 4YZ1A 4OHYA 4RHV2 4AHZA 4ASMB 1H1IA 1NA1B 4JVAA 4RHV1 4COVA 4RQPB 2ZTNA 1ULDA 1CJDA 1AXYA 2R1DA 3VBFB 3UJOA 4CDUC 3ZN6B 4E2SA 2JX9A 3U4XA 4XFGA 1ND2B 3GBGA 1JW6A 3VUOA 2BWCA 4YSFA 3WX5A 2X53S 1AR62 4CP0A 3WR0A 4H55A 1S0CA 4HMZA 5C9AC 1CESA 2XLFA 1DYKA 1N1VA 2N7GA 3HMYA 2A75A 1ZA4A 5T55A 3AP7A 2WNUB 2ZCWA 2ZGUA 2HWB2 1W2UA 2HWB1 1NA1C 2LUWA 3D6EA 2A70A 4RQPC 2GN7A 2DVAA 1MS0A 1AF9A 1XU1A 3PMEA 1RINA 1XQNA 1JUHA 1MS9A 5T5PA 3VBFC 3WXPA 1KS4A 5K9YA 3RPQA 3RQ0A 4FPGA 4DINB 2DUOA 3OD0A 1ND2C 2NYYA 1FI2A 3FFQA 1RUI2 2JICA 3OF1A 1VBC3 3ZSJA 1OA3A 3WINE 2WNEA 2A6ZA 4URTA 4XQWA 3IMNA 5JPNB 2DYCA 4FPEA 2K9ZA 4ISRA 4M3CE 4E4SA 5T50A 2WNUC 5J36A 1RMU2 4N90A 3UKTA 3B93A 3NL1A 1YXWA 1GFF2 3ROUA 3MF9A 3HBZA 2DUPA 1RMU1 1CAXA 1RVF2 4XBQA 4XQ4A 2W08A 2OZ6A 2BVBA 4HKLA 1RVF1 4YVSB 5DDJ2 4S2GA 4AK3A 2VVDA 2DCZA 4JV4A 2Q4SA 5FLJA 1X33A 1QJU2 2RS32 1RUD1 4E27A 3ZXFA 1NE6A 3AYEA 3X29B 1QJU1 1UZYA 1W6NA 4KG8A 1IOAA 3C3VA 3MW3A 1UN1A 1CAXB 2CWMA 1HKDA 1VAMA 4U36A 3IKWA 2UWBA 1VBE3 1O7FA 1TE1B 3V56A 4GH4A 3WDTA 5C8CA 3ILFA 1J3RA 5CFCB 5SV5A 4P14A 1FMD3 1SLCA 2XHKA 2JDZA 1ZRFA 1W6NB 4YVSC 1YI7A 3FUOA 4CYDA 4YZ2A 4Y5Z0 3AKRA 4DPNA 2A7AA 5T3NA 4MGKE 2H0VA 3AK0A 4AFDA 4QGNA 5JI7A 5BPXA 4AVCA 5JSOA 4LBKA 3RS6A 4JDOA 1IPKA 1Y7BA 4G9SB 4COUA 3WV6A 5C8CB 3N36A 4XILA 4I3GA 5AC93 4ISQA 3ZDSA 2FZ2A 3ES1A 1LHOA 1ZZ7A 5SV8A 1SBEA 1ULGA 2VG9A 1CR7A 5CFCC 1NCQA 4KGGA 1SLBA 1OA2A 3ZMNA 1FATA 2ZGOA 4P9JA 4LEJA 5KXDA 1DQ0A 3DUIA 1JYCA 2VQ0A 2R061 2NP0A 1ENSA 1MZ6A 2VGDA 3ZFGA 3RG0A 1WGPA 1RHI1 2P3KA 5AVPA 3ILRA 5C8CC 4MYEA 4MVTA 4GB32 3HR9A 1DGWA 2ZJCA 1NCQB 1C4RA 4GB31 2X5IB 4WVMA 4YZ5A 4RSUA 4QX5A 3NVCA 1AJOA 2WSUA 3K48A 4JRLA 4AYUA 2Q1ZB 4ITCA 3H1WA 1QJY3 1OI6A 2UYAA 1MS3A 1RUJ1 2VH9A 3ZFGB 4WM8A 4XMIA 1QHDA 3WHUA 2CYFA 1RUC2 2VUJA 4KU7A 3WG1A 4WVMB 2RR12 1MZFA 1AYN3 3NAPA 2VMIA 3RYPA 2XL7A 4WZFA 3TN93 1NCQC 1FOD2 1GZCA 1OPMA 1PO23 2X5IC 2HWD3 1FOD1 1FPN2 4WM8B 1LOAA 1C57A 5GLUA 3NV2A 1SBDA 2ZZQA 5JI9A 1FPN1 2AR6A 2ZX4A 3D82A 3SH5A 1H1MA 1BK1A 4AHXA 3ZFGC 3NAPB 3WLUA 4L2NA 3T1LA 3ASIA 4MXWA 1LENA 2VOKA 1PVC3 4IERA 1WLCA 5FRAA 1PO12 4FVVA 3KGZA 5GZDA 5DUWA 1Y9QA 1PO11 2VNOA 4W6YA 3WQ7A 1HQNA 4QPYA 4B4QA 3PNAA 3SISA 1V6MA 4G4FA 3ZSLA 3O7OA 1UL9A 3BODA 2HWC1 4WM8C 5JSRA 3ENRA 1HLCA 5JZGA 2R32A 4MXWB 4W65A 1SEFA 1LGNA 3I59B 4GWNA 3LA2A 1UCXA 4TWTA 4K40A 5EYXA 4R9DA 2ARBA 3MIHA 3NAPC 2ZZJA 4FXKB 4COWA 4J1XA 2ZA9A 5DUUA 4D7YA 3RNSA 2R0FA 3G6JB 5L7OA 1QWRA 5CB7A 4C90A 2ZX3A 1CQ9A 2W0XA 4WBBA 3WVJA 4LA2A 2OPKA 4U2AA 3AXEA 3UV9A 1Q8VA 2WL1A 1LECA 5JMCA 5J48A 2RS13 4HN0A 1RUF2 4WVZA 3VHNA 5L7OB 3TWIA 1RUF1 3ATGA 1VRH1 3I2DA 2ZGKA 2WFF2 2B5HA 4CDXA 1OKQA 2DU0A 1N1YA 3JB8A 4C91A 1M4WA 5KC6A 4B4RA 4EN8B 4NVPA 1R082 2WIIB 1G6NA 2MEV2 4DB5A 3BB6A 3WW3A 5KHKA 1YHFA 5F9TA 1C5HA 2MEV1 1SACA 4Q26A 4N9HA 4ZKTB 4N53A 3I8TA 2ETEA 1NQDA 1QJX3 3UJQA 4XFFA 1V9U3 1F5JA 2WS91 1A6CA 1XE8A 5GKAC 1WUVA 5I91A 2GN3A 4LBOA 5L7OC 4N43A 1MZEA 4XXAA 1J59A 3IT8A 3W9AA 2ZPXA 3E5XA 2HWE3 1H4GA 1H2MA 1R1A2 5HI0A 2ZKLA 1C8M2 4N53B 1JH5A 3RYKA 2A6VA 1R1A1 2I07B 1C8M1 2R16A 4AVBA 4KWLA 1WCDJ 1PGSA 4NHKA 5A3LA 4RHV3 4XPVA 2YDEA 4WM7A 1DIWA 3APBA 4AVVA 4A3XA 4KG0A 2VU9A 3NV1A 3FMGA 4CDXC 4J1WA 4LTAA 5LEKA 3KB5A 3GNEA 4HK8A 2LM3A 2DWRA 4QD2A 2QQPA 1ZREA 1PZ7A 3O5SA 3JD71 2P2KA 4AG4A 1Z7S1 5A32A 1AR81 2BNOA 2CY6A 5FO8B 1F2NA 2XBO2 4M00A 1WD4A 4WM7B 3E5QA 3LA7A 4ATEA 1KDMA 4N53C 4NPRA 4EN6B 3TNQA 2OYZA 1DGWX 4K20A 1ZNPA 2IXKA 4BPZA 5K7PA 2HWB3 2WA3A 4QQOA 1GICA 1RJ7A 3VZKA 2A3YA 4CDQA 2BPA2 3FLRA 1G8WA 1MEC2 4NHLA 5JOYA 3VHRA 5A32B 2MHFA 4AXOA 5KHJA 1MEC1 4FOYA 1VLNA 4PIYA 2XJPA 4IEOA 3VHPA 1A8MA 3HAGA 5JWPA 1SLLA 4HSLA