1QOOA

Lectin uea-ii complexed with nag
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
236
structure length
234
Chain Sequence
SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords CHITIN BINDING LECTIN, UEA-II
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
total genus 54
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qooA00
3V0BB 1V6OA 1WUVA 4GKYA 1WW6A 5T5OA 1F9KA 4Y24A 3TB0A 4Y22A 1AVBA 1CIWA 2DVDA 1GZWA 1W6QA 4AVSA 4GKXA 3V65A 3I8TA 1Q8SA 4C1WA 4NOTA 3V64A 2ERFA 1N1VA 5GALA 3USUA 1X50A 3AXEA 3O0XA 4XTMA 3BODA 3FLRA 3U4XA 3NWKA 3ZXKA 1SLIA 1LOFA 2ZA9A 4XBNA 1BKZA 1VLNA 4XIKA 2WJSA 4Y1YA 1LCLA 5DZGA 4YW3A 4SLIA 5JDBA 4PBPA 1UL9A 2P37A 4LBLA 4YG6A 2LALA 4ASMB 1O4ZA 4LBQA 1WBFA 1G9AA 3SH5A 3R4SA 3AZXA 2UWCA 4R9AA 4AVVA 1Z0HA 1MVQA 4FPCA 4Y1XA 4AVTA 1IS3A 1FX5A 4K21A 2ZGSA 1UKGA 2GN3A 4BOWA 4Q26A 2A3YA 2GNDA 4CZSA 3UJQA 3RSJA 3NV2A 1VALA 2NN8A 4BQ1A 3WZ1A 2WQZC 1MS0A 1QNWA 5DG1A 4HL0A 4XJ8A 1RITA 1LGNA 1S1AA 2Q5TA 5CB7A 2R0FA 3N7JA 2ZGKA 3IPVA 1QU0A 2WLQA 3AZVA 4YZ4A 5DZFA 4Y22B 1CPMA 1W6QB 1N47A 2PHUA 1WBLA 4WZFA 2VW2A 4Y26A 1GNHA 4Y1VA 1QGLA 5BYNA 3TAYA 1FAYA 1JN2P 5JOXA 3I4IA 1LOAA 3USUB 3O0WA 3VKLA 3R05A 4OZXA 3H0OA 3QCWA 1DQ5A 1LODA 2DUPA 1F31A 1EPWA 1LOGA 1Q8PA 1CR7A 1QF3A 2EXHA 1LHVA 2P3JA 1SFYA 3B3QE 3GALA 4I30A 3WG3A 1HQLA 2LTNA 5KXDA 1LULA 1SLBA 2E51A 4XDQA 4DFSA 4YM1A 5GM0A 3WVJA 2R1DA 1Q8QA 1C57A 2XB6C 3M1HA 2D6MA 3JUUA 1F5FA 3IM0A 1BJQA 4XYXA 3VKOA 3LSDA 1JW6A 3NV4A 1D0HA 2A3WA 2D3SA 4YG3A 4TZDA 2ZGMA 1G8WA 3R4UA 3DGTA 4YZ1A 1LOFC 5GLWA 5GLUA 3V0BA 3A0NA 1IS5A 1PZ7A 3WG4A 3RRDA 2YY1A 1JUIA 4DRVA 2VY0A 4XILA 3WHTA 2PHRA 4XMAA 4C1XA 1FYUA 5JOYA 2JKBA 2AREA 1QMJA 1AXKA 1CJPA 5CBLA 3POWA 4GALA 5GLZA 3OJBA 1N1YA 1SBFA 1W6OB 2DUQA 2D6KA 3IPVB 4ZXKA 5GZCA 4DQAA 1W6PB 1ZM1A 2PELA 3WDTA 3AJZA 2GALA 2DTYA 2RHPA 5CNAA 3FLPA 1S0JA 1FATA 1WLCA 2ZACA 2ZGOA 4FP2A 4R9BA 2YXSA 2P3IA 5F9TA 3DUIA 3Q9OA 5KXCA 1U0AA 3ZSKA 1G9CA 1R1ZA 4K1ZA 1I1EA 3WNXA 5IK4A 1MS1A 2H0BA 2CWSA 4MYEA 3L2YA 4Q2FA 3HR9A 1ULEA 1AJOA 4AYUA 2WSUA 2CWMA 2DVAA 3N7LA 1N3OA 3AFKA 2OUHA 3BTAA 4FPJA 1DBNA 4DS0A 2ES3A 4YGBA 1AF9A 2ZABA 4M3CA 4ZKTB 1GKBA 1MZ6A 2KM2A 4XHBA 4Y1ZA 4FVVA 5GZDA 3AZYA 4GA9A 1W6NB 2PHFA 3SH4A 2GMEA 3WUDA 4LBJA 4YM2A 1LOCA 3N7MA 1QDOA 3C2UA 4YGEA 4XBLA 1DFQA 2A7AA 2OW4A 5DG2A 4YW1A 2D3PA 2DYCA 4FPKA 3MW3A 3OY8B 3AP5A 2R0HA 1GZ9A 2W68A 3ZYRA 1LOBA 4L8QA 1Q56A 1FV2A 5IK7A 3HN1A 5JVVA 3ZYPA 1KJLA 1KITA 1NLSA 2NZ9A 4ISRA 1PZ9A 2C5DA 2UURA 3WCSA 2WSVA 3ILNA 1G7YA 2A71A 2SLIA 3O12A 1CN1A 1V6IA 3M3CA 2NM1A 5T52A 1LGBA 3JU9A 5T50A 2D6LX 1RINA 1SLTA 1A78A 2ZGQA 4RL7A 4FPEA 4XBQA 1CONA 2EALA 2JE9A 3WDUA 4YW5A 5AVAA 4LBKA 3M2MA 4FPGA 4XZPA 1YXWA 2UU8A 1GBGA 1WW7A 3KQRA 4XJWA 3BOPA 4YGDA 2FHRA 3ASIA 2AH2A 4M3CB 2VW1A 2ZMKA 2D6OX 1DQ0A 1GYKA 4DRRA 1SBDA 1V6MA 1ULDA 2YMZA 4PBOA 5EWSA 1BQPA 4M01A 5IK5A 2V73A 1DHKB 1BXHA 2WKKA 4XJAA 1BYHA 5FRAA 4P9YA 1GSLA 3SLIA 3ZXLA 4CRQA 1YO8A 4Q1PA 3RG0A 4YM3A 1AXZA 2CY6A 1IS4A 4LBMA 5H9QA 4PF5A 3WV6A 1KRIA 1W6OA 4KBBA 1CVNA 3V0AA 2A6VA 1A8DA 1W6PA 1URXA 3MPPG 2R49A 2C9AA 4M3CE 2NMOA 2GNMA 4K1YA 1HKDA 5JLVA 2D43A 1LU1A 3RMYA 1Y7BA 3AYCA 5DUWA 4XHXA 1CESA 3UK9A 3N3HA 2VU9A 4BM8A 4WVVA 1G9BA 3ZXEA 2TEPA 3A0KA 1LHOA 3AYDA 5IK8A 1ULCA 1C1FA 1JBCA 3B9CA 2VH9A 2WT0A 1AX1A 1ULFA 3BIWE 3PVEA 1UZYA 1GZCA 2OVUA 2G4IA 1G86A 2EAKA 2GMPA 1YRZA 1V6LA 1DZQA 1YYNA 4FP3A 1LESA 2D3RA 4WV8A 2GNTA 5DUXA 3LSEA 3D4KA 3WDYA 2WT1A 2ZHNA 4UW6A 3ZXJA 1N1TA 1W6NA 4ATFA 1JYIA 1V6KA 2BQPA 2CTVA 2YZ4A 4XOGA 2OUJA 3A4UA 2JE7A 2R16A 4FPLA 1LU2A 2PHWA 3POYA 3RS6A 4FOYA 2ZGLA 3MW4A 1MS9A 4YZ5A 2HYKA 1S0BA 3OY8A 1CQ9A 4R9CA 3ZSJA 2WNEA 1AXYA 1CPNA 2XG3A 1UAIA 4YM0A 3ILRA 3VV1A 5E8AA 1H9WA 4BMEA 2ARXA 1LHNA 2SBAA 4AGRA 3W58A 3V0AB 2ZZJA 1MR5A 4Y20B 1C4RA 3OBRA 5HCBA 3SNMA 4BLJA 2EXKA 1H30A 3N7KA 1DQ6A 3OYWA 1MACA 1QOOA 2ZGTA 3POSA 3MW2A 2E53A 1S0GA 2E6VA 3SH3A 4JC1A 4XMIA 1DGLA 1TEIA 2EIGA 1N3PA 1Q8VA 2DV9A 3UJOA 4FQZA 1DYKA 3WDXA 3OPZA 1SLCA 4YW4A 2A70A 1MS8A 2AENA 2GN7A 1SCRA 1UMZA 2A6YA 3PMEA 4P9XA 2ZMNA 4XXAA 4FOVA 2D44A 2JD4A 3AP4A 1NXD1 3AYAA 3WDVA 1N3QA 1OQ1A 4FPHA 1OFSA 1DQ2A 1H9PA 2W39A 4LBQD 2DVFA 2EXIA 3WCRA 1ENSA 1VAMA 2ZGPA 3GNEA 2UWAA 2ZMLA 5H9RA 5E88A 5LK5A 4YFZA 2DURA 1FV3A 1LECA 4GWNA 3ZSLA 1LHUA 2ZGUA 3AP9A 1QOTA 1QNYA 3W59A 4Y1UA 3AJYA 3RQ0A 3VUOA 2DWRA 4Q1RA 4TYSA 4AGGA 1V6NA 1AJKA 1JXNA 1O4YA 2D6NA 1MS3A 3WDWA 1SCSA 1WLWA 4FPYA 1JOJA 1YIFA 2PHTA 3B00A 3ZPYA 4XE9A 4YGCA 4BMBA 2GNBA 3OYWB 5T5LA 2ZGRA 2A6ZA 2ZHMA 4Z8BA 4U2AA 1J1TA 1DYPA 4Q8LA 1S0FA 1JYCA 4IQPA 4LBOA 2AUYA 3AK0A 3INAA 2ZKNA 5F5QA 1W0PA 1S0CA 1HLCA 1GV9A 3AZZA 3SISA 3M3EA 5FREA 1UZZA 5SV8A 2D6PA 1D2SA 4P14A 1B09A 1QKQA 1OKQA 1IKPA 1WW4A 3PVNA 1KDMA 4JRAA 1WLDA 2ZBJA 2UWBA 4YZ3A 5E89A 4LBNA 1GICA 4BPZA 1QOSA 2VXRA 2ZHKA 1DQ4A 3MEPA 5GZEA 5KXEA 2ZHLA 4NO4A 4UW4A 1PZ8A 1V00A 1SACA 1UPSA 2B7YA 2JDZA 5JOZA 5GLTA 1LOEA 1XQNA 2A5ZA 3RMXA 2E7QA 3O0VA 4UW5A 1I3HA 4F83A 3T1MA 2YV8A 5IUQA 3IMNA 4FOQA 3WG2A 2P2KA 1S0EA 1LENA 3ATGA 1YI7A 4Y20A 2Z42A 4YLZA 2W52A 2GMMA 3AP7A 3IN9A 4WVWA 3UL2A 1FNYA 4Q8KA 1IS6A 4P9WA 3AZWA 3HMYA 3WOGA 1A3KA 5DUVA 3VKFC 1AX0A 1LEMA 2AGSA 3FUOA 5CA6A 4ISQA 2DVBA 3D5OA 1LEDA 2ARBA 1MS4A 2DU1A 4ITCA 1Z78A 4K20A 3VKNA 2P3KA 2DUOA 5GZGA 4M3CF 5EYYA 1HDKA 3T1LA 3PVOA 1MZ5A 1S0IA 1VIWB 2CL2A 1V6JA 2A6WA 1QDCA 1W6MA 2D7FA 2VW0A 3FLTA 1WD4A 1GZWB 4YW2A 3ZXFA 4YG0A 2A6XA 1GNZA 4H55A 5HCAA 4U36A 1VAVA 1LGCA 3O5SA 3AP6A 4RA0A 2PHXA 4FOWA 1G9DA 1RIRA 4XJZA 2DU0A 2A75A 3AX4A 3OBTA 3N36A 5EXOA 4R9DA 5L73A 4ATEA 2I2SA 1ENRA 2NMNA 5GZFA 2JECA 5T55A 1AZDA 5IT6A 4LBQB 3KM5A 3M3OA 5T54A 3NV1A 1MS5A 1DIWA 5H9SA 2DVGA 3APBA 4GXLA 1ENQA 2ZGNA 5JOWA 4AGVA 1IKQA 1G9FA 5DUUA 5T5PA 1LHWA 1MVEA 5CAZA 4HANA 1WD3A 3N35A 2CNAA 1C1LA 2YROA 1APNA 2ZAAA 1DQ1A 1IOAA 4BLIA 5KXBA 3NV3A 5DZEA 2R1BA 3B01A 1WCSA 3AYEA 1Q8OA 1ULGA 3OGGA 1SLAA 4FPOB 3WHUA 3ILFA 2NP0A 3M3QA 3WG1A 4FPFA 4DPNA 1GLHA 2P34A 3VKMA 4CTEA 5JMCA 2EF6A 4YZ2A 1ONAA 1UX6A 3IKWA 1BZWA 1KDKA 1UN1A 2FMDA 3D6EA 4XJ9A 4XTPA 3ZSMA 1GANA 5GLVA 3FUQA 1LJ7A 1W6MB 1KJRA 3FFZA 2A3XA 3T2TA 3B69A 4Q27A 5EYXA 4AWDA 1JHNA 2CYFA 4PQ9A 4GWMA 4XJUA 4JCKA 1AX2A 5H9PA 4XIOA 2JJ6A 2EXJA 2DTWA 2AYHA 5DXDA 3WLUA 3QLQA 3FBYA 2E7TA 1SBEA 1KQRA 3WUCA 5T5JA 1WW5A 2V5YA 4D69A 2NYYA 5GJ6A 2WT2A 1SLLA 1LTEA 1HQWA 2GDFA 2W08A 1N1SA 4M00A 4XXPA 2VUAA 2AR6A 1DLLA 4UW3A 1S0DA 3AXDA 3CNAA 5HCFA 4W65A 1FNZA 4YFWA 4FQ4A 3ZVXA 1ZA4A 4PCRA 2ENRA 3ENRA 3LCPA 3PJQA 1W0OA 3SITA
chains in the Genus database with same CATH superfamily
4QX8A 1ZRRA 1XNTA 4V2VA 3V0BB 2W1UA 1GU3A 1RJ8A 3AVSA 4O9EA 1WW6A 4LXLA 4AFDA 1TME1 4AQ2A 4Y24A 2RJKA 1R1A1 2HWF3 3MUZ1 3V65A 4QGNA 3I8TA 4KG8A 3AVRA 1Q8SA 5DAQA 3S5QA 3T08A 3V64A 2JIJA 4C1WA 4YVSB 5F6LB 5L7OA 1PX3A 5GALA 2VUCA 3I2IA 4XTMA 3BODA 3OD4A 4XUOA 1SDDB 4BU2A 2VG9A 2FDKA 2EICA 1LOFA 3MF6A 2B45X 2BWCA 2GH8A 1BKZA 4XBNA 3ZR5A 3J26N 3UYJA 3EQEA 1UL9A 5J37A 5FPAA 1WGPA 4G4FA 4YG6A 4WVZA 2X5IC 3DXTA 1SEFA 4WM7A 3UESA 3ZX7A 1UXZA 4Y1XA 4LA3A 4AVTA 3WX5A 1YQCA 2WRAA 3WQ1A 4BOWA 4I09A 4NWVA 4Q26A 4CEWC 2WNVA 2KA3A 1UY2A 4UYBA 3AB0A 3DPRB 3IDEA 3FL7A 2MNGA 5A6XA 2JDKA 3BKZA 3RSJA 4QXKA 3KV9A 4LK7A 5EP9A 1HJGA 1I5PA 2NN8A 5JAXA 5CZKA 3WZ1A 4BQ1A 5DDJ1 5FZLA 1LGNA 1S1AA 5JR2A 5CB7A 4P08A 2YBKA 4K7JA 3I49A 2BRTA 2VQTA 4LOSA 4RQPA 2RS52 1NG0A 4AOCA 4LKDA 4NIIA 1UZ0A 2G1MA 3A23A 4Y22B 5C8CC 4CDWB 1X33A 1Q3EA 3E6BA 4AR2A 2WZR1 1WBLA 5FXZA 3NL1A 1GNHA 1ZBE3 1QGLA 3WQ7A 5JOXA 2XVGA 1K5JA 4OCTA 3USUB 1IQDC 4PLMA 3ZR6A 1HRV2 2D98A 2Y6FA 4PIZA 3H0OA 2B46X 2D5FA 4RHV2 1LODA 2DUPA 5KBFA 4CEYB 1Q8PA 1W05A 1XU2A 4RS5C 4E4DX 1LHVA 2OS2A 1SFYA 3B3QE 3ME2A 4JTNA 1VR3A 3THDA 2E51A 2F6BA 4Z2AA 5F2WA 1NOVA 1COV1 2R1DA 5FZCA 4HVRA 1DP0A 4HVOA 1F5FA 2Q8DA 1ENXA 4W6YA 4YG3A 2IXKA 2ZGMA 2J22A 2HWC2 4Q4Y3 3VBSA 1G8WA 1YJLA 3R4UA 3DGTA 3U78A 4DNYA 3WR0A 3NJYA 5GLWA 3V0BA 4AI1A 2XJUA 5CFDA 1K45A 3VLBB 4AZZA 2ETEA 2FDFA 2PHRA 1BEV2 4XMAA 2VD7A 2VBPA 2LS6A 3AMQA 2F4LA 1QMJA 1BK1A 4KGQA 4P00B 5F3EA 3TEZA 5JSPA 3J7LA 5GLZA 1IG0A 1N1YA 5L9VA 3NAPC 4TLGA 1SBFA 4YVSA 3AKQA 3BU7A 4HMZA 2PELA 3AFGA 4P9LA 3TN91 2RDQA 4ZHNA 3NKGA 4GJZA 3TEWA 1JS9A 3HBZA 4INDA 4URTA 2FMYA 4QGMA 1CIYA 1QJFA 1PVC1 3ZPOA 4PI2A 2P3IA 1TE1B 4FI9A 5F9TA 5KXCA 4P5YA 1ZBA3 1G9CA 5FV3A 2XKOA 3UKNA 5IK4A 5CFCB 3AL6A 4NRQA 5CG8A 1ULEA 3N7LA 2B5HA 3RZJA 3ES4A 4KGGA 4LHKA 4QKFA 1FMD3 1DG6A 1VE0A 3OEBA 4M3CA 3LOBA 3H8RA 4GH4C 4LHNA 1WMXA 4HXCA 4XHBA 4KI5M 4IEOA 2RM21 3AZYA 4QPGC 2W2IA 2XH6A 5FY5A 2AACA 3D8CA 3SH4A 3KVAA 4D3WA 2IUWA 2XLFA 3C2UA 4IEUA 3ZYGA 1OXCA 1DFQA 1CJDA 4WBBA 2VPVA 5FZOA 5A6YA 3JB8A 2OW4A 5CVRA 1W90A 4YW1A 2D3PA 1YUDA 4FPKA 3POEA 1AYM3 3M3IA 4L8QA 3HT1A 3S7IA 4CU9A 2ARAA 2QZ2A 2VAUA 1RUJ1 2AEYA 5JZGA 4EZ4A 1YLLA 1KJLA 1NLSA 2GZWA 5JXGA 3SXWA 1PO11 1VMFA 4IV3B 2J1UA 2X53S 3MLKA 4QKDA 5JCTA 1AR81 1WKYA 5CU1A 2SLIA 3O12A 2VOWA 3RZZA 1CN1A 5LZ6A 4BQ2A 1XYNA 3RPQA 5FQ0B 3POBA 5IAVA 4WM8A 4IL7A 2VVEA 3GXUA 2ET7A 3JD73 4CCLA 4QKNA 3MFAA 2EALA 1RUD3 1W2OA 2JE9A 4IESA 4TSVA 1R092 1U5ZA 4YW5A 1OPOA 2OX0A 5LRRA 4XJWA 4CPBA 3WF3A 1RUH2 1RTVA 1AR91 2FHRA 1W3VA 4YGDA 5FY0A 3ROUA 1UCXA 1GYKA 1X82A 3F2ZA 1IGOA 1ULDA 3VBUA 1UYXA 3H50A 5F5IA 1BQPA 4M01A 2R072 2WKKA 1DHKB 3E5XA 4N53C 5IK5A 2XJVA 1NCRA 5LATA 1XNDA 4CP2A 4YM3A 2XXZA 4Q1PA 1AXZA 1RXGA 3PHMA 5LBFA 1KRIA 5A7NA 3FMGA 5FZGA 2JICA 1A8DA 5L36A 3ALQA 4M3CE 2GNMA 1ZZ7A 2YBPA 5A7WA 4A44A 5FYBA 2WWSA 5BY5A 2YU1A 4N43C 4EN6B 1Y7BA 2RR11 3AYCA 4LO5B 5DUWA 4D7TA 2VR4A 3PU3A 4GD4A 4Q5OA 4BM8A 1G9BA 4O65A 5FZIA 1OSGA 3RWKX 2JG9C 3AYDA 2ZX3A 3ZFFB 1ULCA 1ULPA 5BNNC 2N7GA 5LY2A 1EV11 4BISA 3OTFA 4JDNA 1AX1A 2W1WA 1OA4A 3KHBA 4Z07A 3KCXA 4GB31 1G86A 4NWWA 4RFRB 5AC91 1UWWA 1UU4A 1L7QA 1H8TB 2G9GA 4HLTA 2PN5A 2HWD2 3ZXJA 2ZHNA 4UW6A 4UWDA 4ATFA 2QNKA 1JYIA 4XOGA 2NPIA 3AKRA 3POYA 3PUIA 3BPZA 4OVEA 3MW4A 4OYUA 5FZKA 4CA9A 1JZ4A 4YZ5A 5G04L 3PTYA 1ZREA 1AR71 1RYYA 1R081 4A2UA 3UV9A 4XUTA 4NJ4A 4NRMA 4Q4X2 4R9CA 1JUHA 5B4XA 3T2QA 1CPNA 1L7RA 1NCQA 1UAIA 2VXJA 2RMU1 3ILRA 3URFA 5FPZA 4YARA 2B39A 3FJSA 5JI7A 3JCIA 3DXUA 4CUBA 4Y20B 3OBRA 2GC3A 2RS33 2HEWF 4IV3A 5FMDA 2VQ0A 3WNOA 4OI0A 3OYWA 3UT0A 1MACA 1QOOA 3POSA 4N7IA 4KMQA 3CJIC 3MW2A 3HEIA 2Q1MA 3C8XA 3HQXA 4XCAA 3ZO0B 4JC1A 4DY5A 3NNGA 4XFBA 4OUSA 5C4WC 4IUGA 2EIGA 3SCFA 1Q8VA 2JE8A 3UJOA 1DYKA 3VBHC 3WDXA 5FQ0A 3OPZA 3LAGA 3HN3A 1MS8A 3PUAA 1OPMA 1PMHX 3S0MA 2BERA 2HWC3 2X5IA 1PX4A 3JBG1 2OQ6A 4FOVA 4XXAA 5FTTC 3O1SA 2QTWB 1FPN2 3AP4A 3LPFA 4LLFA 4LUMA 3T3YA 3VD7A 1ZRFA 2IFWA 2R063 5IVBA 4LBQD 4IE0A 1HIXA 4EJRA 3WCRA 5F3CA 4P5HA 5FY4A 1BEV3 2W94A 2XBO2 3MUY1 2W92A 4CYDA 4GMP1 2QQIA 5I8YA 2PHDA 1LECA 5FXWA 2J1RA 4LHLA 1K5MA 5ACA1 1B35C 1QNYA 2XUEA 3W59A 1OLMA 3I3MA 2ET1A 3RQ0A 1QJX2 1JYWA 4RR3C 2D6NA 1HXS2 2QZ3A 3SCGA 4BE3A 1W0NA 2Z2SB 1PO23 4DMIA 5F2SA 1WLWA 5J09A 1G6NA 1JOJA 4CCNA 4GMP0 1OQDA 2XGXA 1VPHA 2P17A 3LFMA 4MGSA 2A6ZA 3WF4A 2XL7A 4AVCA 4Z8BA 3FX3A 1TMF1 4YW7A 1DYPA 1KS4A 1S0FA 3FFQA 3H8UA 4BA6A 2HWB3 5CEHA 5IVFA 2TUNA 3KCYA 2DCZA 4E4ZA 1T6BX 3SISA 5FREA 1ASJ1 1QQP2 1UZZA 2WBKA 3H1MA 4ZZ8A 3LEGA 1QKQA 5LA2A 5IWFA 1UW8A 1WLDA 1S4CA 1A34A 1AYN3 2A1XA 3IBMA 4XF1A 1QOSA 2VXRA 2ZHKA 1DQ4A 4HN0A 4HZFA 2C6SA 2ZHLA 1KEXA 4DXRA 1DGRN 5GLTA 2W5FA 3WQ0A 4Y4RA 1XQNA 3B94A 5BNPA 2VCMA 1O59A 4F83A 4IEVA 3T1MA 2WZEA 2YV8A 3BU0A 4FOQA 2PLV1 1J58A 4XQ4A 1RUI2 1LENA 4Y20A 3HNYM 3KT1A 4IV1B 1OA3A 2HWE2 3NAPA 5A6QA 3T4HB 1DGWA 3Q8EA 1YQ5A 3WNNA 3JZVA 4EN9B 4CVUA 1US3A 4XCBA 2W47A 3AZWA 3IDAA 3ZXAC 5J36A 5C3OA 1MQTC 5FUNA 1A3KA 4JDOA 1W2AX 3GF6A 1VBC1 2OIIA 3ORJA 1LEMA 1OOPB 2WWJA 5A32B 2XKPA 3UETA 1R093 2DVBA 1V9U1 1LEDA 2JDMA 2PYTA 3D5OA 4QQOA 5DAVA 4ZS3A 4R8HA 2WLPA 2R041 1RUH3 2Q8OA 4BXFA 4D94A 4M3CF 2R6QA 2OYZA 3K4AA 3PUHA 1XRUA 4QMAA 4NR1A 3E5UA 4NN0A 1RUF2 3I7DA 1J84A 1F5JA 1EAH3 4B3NA 2VUJA 3GHNA 1W8ZA 4H55A 4UI9L 1VBA2 2ZAHA 3WQBA 5JSOA 3MIFA 2Z5WA 2FQPA 1VAVA 1BMV1 3OUHA 1QJU3 3AP6A 4KWJA 2PMWB 1H6XA 2PHXA 4RA0A 1ND2B 1OLQA 4NIGA 1XYOA 1YC61 2P4EA 2ZX1A 3AX4A 1JOPA 5FZEA 1O7FA 3KV6A 3LD8A 3SCHA 3T0BA 1ENRA 2BP6A 2NMNA 3W20A 4Q4V3 1AZDA 1W8HA 1C8M2 1VRBA 5EQUA 1DIWA 1IPJA 5CYYA 4YVWC 1TVGA 3KWVA 2IXJA 5H9SA 5LEJA 5FOJB 4JQTA 4QWNA 1D4VB 1LHWA 1X9TA 3LIGA 3J7HA 4ONUA 2HLEA 4QPIC 3RFRA 2YROA 1C1LA 1RUE3 3K3OA 1W8WA 2ZAAA 4Q0PA 2CSGA 5DPNA 4JGYB 3NV3A 3O14A 3VBOC 3EJKA 2ZJCA 5ABJA 2YFZA 1RUG3 5FWJA 1PGW1 4H2AA 3FC0A 2NP0A 1ZRCA 3WG1A 3VL8A 1GLHA 1GZTA 1Q43A 3VKMA 2EF6A 1UX6A 3ZSMA 5IVCA 4FAHA 1NUKA 1PMJX 2YG0A 2HYXA 4IERA 4Q4X3 3VD3A 3H42B 4DUXA 3EYPA 4GWMA 4PQ9A 4URAA 1POV1 1AX2A 1RHI3 5FZDA 1J59A 2EXJA 4NIHA 4HSLA 2E7TA 1EPZA 1H2KA 3LOIA 2VNGA 1KQRA 2JG8C 3FN9A 5LWBA 3GZAA 4IV1A 2V5YA 3WP3A 4O61A 3DKQA 4AHWA 4ES9A 3AMMA 1C3HA 4HVQA 1AR62 1C28A 2IC1A 5BXXA 1BVVA 1VBD2 4M00A 5JPNB 3AMNA 2V4VA 4LT5A 3J7NA 4UW3A 4XFHA 4ZZ5A 3CNAA 5HCFA 4CP9B 1US2A 1POV0 4IGOA 1ZA4A 2BGOA 4PCRA 1YJKA 2V5DA 5A32A 3PJQA 5J98B 4TWTA 2RS11 4XEZA 1D4M3 1SZBA 2DBIA 1V6OA 4KH9A 1JZ3A 1WUVA 1WCKA 1H4GA 5DQ0A 3VN4A 5BNNA 1JYTA 2C1FA 4JGZB 3RDIA 3TB0A 3WW1A 4LO6B 2C24A 1CIWA 2HWF1 2XBO3 4QDQA 3VBRC 1LKNA 1W6QA 2O8OA 1SPPB 5D21A 3LDBA 4NOTA 2ERFA 5FZFA 1VBB2 1ZYBA 3A7QA 4H14A 4KWUA 1VRH2 4SBVA 4OHVA 3AXEA 2X29A 4F3JA 5EFUA 4AEDB 1CZVA 3T0AA 1ND2A 4OMDA 1GR3A 1S55A 2J1AA 3DF0A 5FO8B 1RB8G 5DZGA 4YW3A 3C7OA 4Y1YA 1HXS3 1OHFA 2TBVA 1Z7S1 4PF1A 4AQ6A 2P37A 4LBLA 1F15A 1UO9A 5FYYA 4LK6A 3NNFA 2K2SA 3NW4A 5DABA 1O3SA 1GWKA 4R9AA 4OHYA 1ZZ9A 5LY1A 3HQRA 4K8FA 2ZGSA 5J48A 1POQA 3D0SA 1RUC2 2GNDA 5AFEA 1XU1A 2Q0AA 4CZSA 4E27A 2VZQA 3OPWA 2QCSB 4JGYA 1VALA 4TXWA 1GQHA 3ZDSA 2Z69A 1V0AA 2ZX0A 4QXBA 1MS0A 1QNWA 5K0UA 1W9WA 2ILMA 5A70A 1ND3A 3MZHA 4HL0A 4XJ8A 2VMIA 3H8XA 3RZHA 1RITA 5A3LA 2Q5TA 2R0FA 1ZRIA 5F32A 4IEQA 5K4LA 5FZMA 3N7JA 4Y5TA 2L9LA 1RVF3 3IPVA 3AZVA 4AHZA 1NAEA 3ETQA 4YZ4A 5DZFA 1VMJA 4NMIA 1AUYA 2MEV1 3IT8A 3J8F1 4N9HA 1CPMA 1N47A 3LZZA 4FCAA 2VW2A 1WLTA 5D8AB 1OURA 4Y1VA 5BYNA 1FAYA 2Y0IA 4QX7A 2RDNA 2VCCA 3I4IA 4MV2A 1LOAA 4LE3A 3VKLA 4IETA 4OZXA 2BNOA 3QCWA 2WO3A 1TZOA 4A7YA 1HB1A 1F31A 4FT8A 1LOGA 4CSWA 2EXHA 3GALA 2P3JA 2WS92 4CCMA 3WG3A 2BV4A 1HQLA 2LTNA 2JDNA 1O5LA 4XDQA 5KHIA 4LEJA 4CDWC 1Q8QA 2DCJA 3M1HA 5FK7A 3U4SA 3IM0A 1BJQA 2GSYA 1XNKA 4QX2A 4XYXA 3VHPA 3TYJA 1JW6A 4TZDA 2QBXA 4CP9A 2ADEA 4Q4Y1 3N9QA 3RI9A 5APAA 4JAAA 5A1FA 5A3NA 3A0NA 4MHUA 1FT9A 2OT7A 3HJRA 5FO9B 2Y33A 2YY1A 4K9SA 3TBDA 4KU7A 1JUIA 5KWRA 4JGZA 4W4ZA 4DRVA 1GOHA 4XILA 3BIEA 4C1XA 2EIBA 2JKBA 1HJFA 2AREA 2YC2A 1FI2A 1CJPA 1C5HA 1UQXA 3POWA 2FZ1A 3AC0A 4EROA 1FOD2 3OJBA 1PMIA 2DUQA 3EXUA 2D6KA 4ZXKA 3OGJA 1W6PB 1ZM1A 4DOUA 3AJZA 4B4QA 4UXAA 4AEDA 2GALA 2DTYA 1UNBA 1CWPA 1FATA 3JQXA 1WLCA 1VBE3 4FFIA 4RN5A 2W95A 4A42A 1QJY3 2X09A 4Q0VA 1QXJA 4I3PA 2ZPXA 4Y5Z0 2BFUS 1ZBA1 4K1ZA 2QQPA 3A21A 2WQ4A 2XLAA 4QQHA 3WNXA 1RGSA 3VL9A 1MS1A 2BOJA 3O1PA 1JZ5A 3L2YA 2RDSA 2LUWA 2G19A 3HR9A 3VBFA 5CKQA 5TSWA 2DVAA 2IXIA 3DN7A 4L99A 3VD9A 2OUHA 3BTAA 1DBNA 4ET7A 2ES3A 1GP4A 4AI8A 2O8QA 4LIUA 1AF9A 1TME2 2XONA 4CUAA 2ZX4A 5AFBA 1R1A2 2KM2A 5GZDA 4FVVA 2B4KA 4KG0A 2WAAA 4D6QA 1W6NB 2PHFA 3UKTA 4AHXA 2GMEA 1KGYA 3VZJA 4AI3A 4D6RA 4FBFA 4IE7A 1QDOA 4YGEA 1CAUA 5F6KA 5FYCA 5CFDB 4QHBA 5DG2A 4CUGA 3AMHA 3MW3A 5LA1A 3AP5A 3T2OA 4PT6A 2XPJA 1AYM1 3RZKA 3GGLA 4CP0A 5HXVA 4GULA 2X05A 1FV2A 1OH3A 3BVCA 3FBMA 1BBT1 4PIYA 5D8AA 3HN1A 5I8SA 4DZGA 4KNCA 3MPBA 4ISRA 2UYBA 4DXSA 1H0BA 1NY71 5IW0A 2C5DA 2WFF1 2XJRA 2W1SA 3WCSA 3KF3A 4JV4A 4XACA 1DYOA 1ODNA 1GP5A 3ILNA 5FMOS 4J1WA 2W87A 4QQPA 4A4AA 3BALA 1JYXA 4F7ZA 4BK4A 4G3YC 5T50A 1RINA 2D5HA 1A78A 1S2EA 4I01A 2VCBA 2K0GA 1UU5A 4XC9A 1J3QA 3JD71 1BK0A 4LBKA 3M2MA 1HX6A 5DDJ2 2XVKA 1KS5A 3N9PA 4GAZA 3BOPA 3CQOA 2AH2A 4M3CB 3T4VA 2VW1A 1RMU3 5I91A 2RDRA 1QH6A 5FPVA 3IDCB 3GZEA 2AZ5A 3KSCA 2WZR2 3U75A 4PBOA 5EWSA 1WZXA 1QJEA 3HVDA 1M4WA 4XJAA 1BYHA 3I2FA 4P9YA 3ZXLA 3LGRA 5BNOA 2CGPA 1VRH3 5H9QA 4L92A 4LBMA 4QAWA 5FZOB 1HV1A 1CVNA 1NKGA 3ABZA 3KMHA 1W6PA 1NZIA 2VZ1A 5A3OA 1URXA 1VB4A 2R49A 3MPPG 4JKMA 2PAEA 5F5CA 2QQNA 4NAOA 3NSTA 2VUDA 1COV2 4YNIA 4TN7A 5JZGB 4XHXA 1AL23 2F4PA 3I59A 4LTAA 4N90A 4UFKA 4B4RA 4Q4W3 4WVVA 2WYFA 3ZYIB 4BQ4A 3RZMA 2BJSA 2YU2A 2QKDA 3ZDVA 2ZOEB 2XUMA 3FZ3A 2BVBA 2VH9A 4XF9A 1RUC3 2JG8A 2RVAA 4CDUC 1UZYA 2OVUA 3FHQA 4WM8B 2VVFA 3CKHA 5CADA 3KD4A 4FP3A 4XF3A 1YYNA 1V6LA 4LKSA 5FCCA 2FZ2A 1NZCA 3KF5A 5DAPA 2D3RA 4M4PA 2RJ2A 4HOOA 5C5UA 2GNTA 1OFNA 3LSEA 5DUXA 3CLPA 3K46A 2WZPP 1N1TA 1W6NA 3DYOA 4UFIA 2Y6HA 1V6KA 5E6HA 1ZNPA 3A4UA 2R32A 4FPLA 1MEC1 2QJVA 3ZFFC 2ZGLA 4FTEA 1MS9A 5LASA 3TN92 2HBUA 3CZUA 2X10A 2HEVF 4UBHA 5KC5A 1REFA 3VBUB 4OQ8A 1CQ9A 1NCRB 4AEKA 1PVC2 4YM0A 2G9ZA 1UKRA 4COWA 1H8TC 3X29B 5E8AA 2VTXA 2ARXA 1LHNA 3W58A 4V1PA 1OLRA 1OMIA 4BLJA 3ACGA 2HBTA 3ZFEC 1OC1A 3N7KA 1DQ6A 2RS31 5I0SA 1H2NA 3I2KA 5A7WB 2E53A 1W2UA 2GC1A 4XMIA 2YPJA 4HKWA 2DV9A 2XMLA 4FQZA 4BWOA 1E5RA 3SKVA 3CL1A 1SLCA 2RM22 3UGHA 2GN7A 3K2OA 5FZ1A 2OZ6A 4MADA 3AKSA 5BV6A 4AI0A 4NE9A 2ZMNA 4UFJA 1PIV3 2VQUA 4NHMA 3U37A 2JD4A 4ORFA 5ANQA 2BW8A 5FP9A 3AYAA 4EQVA 4FPHA 1H9PA 2W39A 4QT6A 2R061 4XFCA 2EXIA 2OPKA 4DXTA 1F8VA 4MG2A 2W0XA 1ENSA 3GNEA 1BEV1 3VDDC 5E88A 2XDVA 3WNMA 1RUJ2 5L9BA 5LK5A 4FFGA 1FV3A 1FOD3 4GWNA 2B42B 2J42A 3B9IA 2D40A 3DKWA 4W8JA 5FFOC 3ZFGC 5KC6A 1PO12 3WW2A 5BNQA 1U5XA 4Y3OA 3OG2A 1AR82 2BYVE 2DWRA 4Q1RA 1V6NA 1QIQA 1AJKA 1O4YA 5FZ7A 3U1XA 3QH7A 5A1LA 1NCQB 4IDZA 2BBAA 1MS3A 3OPTA 5FPUA 2QQKA 5HBAA 4HK9A 1PK6A 4CDQC 1CZTA 1PO21 2WA4A 1IPSA 1JI6A 2PHTA 4R52A 4XE9A 5CKNA 2Q1FA 3IAPA 3LKJA 3OYWB 1WA6X 2ZHMA 1NA1C 4AAXA 1AR92 4IQPA 5IFTA 2OA2A 4LBOA 3PL0A 2HWB1 1TME3 2VZUA 3INAA 2IXHA 2BOIA 2ZKNA 3MICA 1W0PA 1XYPA 5F5QA 3AZZA 4AI2A 3KV5A 3M3EA 3I54A 1UPIA 2X5IB 5SV8A 2D6PA 1D2SA 3OB8A 4P14A 2WFPA 1YFYA 4EN0A 1LAJA 1OKQA 3NO8A 5DMYA 4JRAA 4UOJA 2DFCA 3HNMA 3MBWA 2QFEA 4ZPIA 1UMIA 1K12A 3O1MA 1GICA 1NT0A 4BPZA 1AYN1 4QGLA 3CHXA 4K3UA 5FPLA 3MO4A 1PNGA 1CAWA 4NO4A 5GZEA 4UW4A 1V00A 4CEWB 1UPSA 2XOMA 4GJYA 5JOZA 4PLOA 3PUQA 1J83A 1LOEA 1OH4A 2PQSA 2RR12 1Y9GA 3R6SA 2A5ZA 2IVIB 2VZVA 5CKMA 3RMXA 2E7QA 5IYYA 1AHSA 4YYOA 1K5MB 2B9UA 3B93A 1XSQA 3K3NA 3WG2A 1JTZX 1YCIA 2Z42A 2BWAA 2NQYA 1XBFA 2VNVA 3JXSA 3WNLA 1EV12 3E5QA 2W52A 2GMMA 3AP7A 5I8TA 4WVWA 3HAGA 1FNYA 3KZ4C 4Q8KA 4MZUA 1IS6A 4P9WA 3IZOA 1STMA 2ORZA 3HMYA 4GB32 5F5AA 5C71A 3W9AA 3WOGA 5A33B 5AC92 3GJBA 5DUVA 2P6HA 3VKFC 4ZU7A 3VZLA 3CJXA 1CX1A 1W06A 3FUOA 4ISQA 4JRLA 3VZOA 1EY2A 5DDJ3 2ARBA 3LQCA 2DU1A 3OF1A 1FXZA 1Z78A 5FUIA 4CCOA 2P3KA 4RS5B 4MGTA 1OF4A 3THCA 1MZ5A 1AR72 1VIWB 1R082 1MZEA 1V6JA 2WDBA 4MLOA 1W6MA 2D7FA 2VW0A 2WZR3 1WD4A 1UOBA 1GZWB 3FLTA 3N9MA 3POGA 3B5LB 5FPBA 5C9AC 4YG0A 2A6XA 2RMU2 3RYPA 1EAH1 1GNZA 1OOPC 2ID4A 2VE1A 4TTGA 1JU4A 4FTSA 1LGCA 3O5SA 3LA7A 5IVYA 2RS53 1QJU1 4HN1A 4UFHA 1YI9A 2QUOA 2WNUC 3OBTA 5L73A 4I02A 1HB2A 2GP5A 2YHJA 2I2SA 4ATEA 3CO2A 5GZFA 2JECA 1OBNA 5BNPB 5JI9A 3M3OA 3C7GA 4Q4V1 5FY9A 5T54A 2EIDA 2HJIA 3NNLA 1HRV3 5FYZA 1WMDA 5K7PA 4X8NA 4IE5A 2J1TA 3APBA 4RHV3 1ENQA 4OZOA 3NAPB 4QQ2A 2YB7A 1IKQA 3JBG2 4PI0A 1OF3A 5T5PA 3VDAA 4A6SA 3WSOA 1O8SA 1WD3A 1BVP1 3U11A 4IEWA 4XFAA 3PMSA 5KXBA 1DQ1A 1IOAA 1RUE1 3NJXA 3B02A 4MGZE 5A3UA 3MIDA 2R1BA 4R4ZA 5FYTA 3NRUA 4S2FA 3OGGA 4BYYA 1CAXB 1RUG1 1SLAA 5F3IA 1Y43B 4KL1A 5EJ1B 1LRHA 2R7EB 2Y6KA 2DF7A 5IVVA 5ACA2 3NKTA 1PM4A 3N9LA 2EVXA 1ONAA 1QXPA 4QX5A 2FMDA 2DFBA 1KDKA 1UN1A 1UYZA 3G7DA 4XJ9A 4C0BA 5GLVA 1O5UA 1LJ7A 3KS7A 4OLLA 5FMBA 1KJRA 2WN3A 2A3XA 3FFZA 4CEWA 4JHTA 1JHNA 2A73B 5A7PA 3MLLA 4JCKA 5J7MA 4W6WA 5BPXA 3OSDA 5H9PA 4XIOA 1RHI1 1E5HA 1GP6A 1ZZ8A 2DTWA 5F3GA 1UY3A 5A80A 3U0ZA 3QLQA 3FBYA 1SBEA 2JENA 3QD6A 4LJHA 1EUTA 2MHFA 4MX3A 2W3JA 5T5JA 3JB4C 1TMF2 5HI0A 1UD1A 4JKLA 3PDQA 5GJ6A 4PDWC 4AL9A 2ZX2A 5C8CA 3BN6A 4QD2A 4TLFA 2VUAA 2AR6A 1PGSA 1ASJ2 5A33A 4EN7B 4LO7A 4YFWA 2O14A 3ENRA 4LA2A 3LCPA 4COYA 2VMFA 2BU9A 3HWJA 4CDXC 1D4M1 2LROA 4RS5A 3ZLIA 1GQGA 4GKYA 3EMRA 3AL5A 5T5OA 2BFUL 1F9KA 4JQRA 3LDKA 4JVAA 5ABJB 3MHZA 2VVDA 5GKAC 4CDUA 4QM8A 1AVBA 5FDBA 1W28A 2PQQA 1GZWA 4GKXA 2D93A 1DLCA 1YQ6A 2RV9A 1UOJA 3RWNA 5FZ4A 2C9KA 3O1UA 1N1VA 2PLV2 3MV01 5FXXA 4BZ4A 1X50A 3LEIA 3FLRA 1W03A 3U4XA 2WZ8A 3ZXKA 2VMHA 2XJQA 4P9IA 2ZA9A 4OQ9A 3HD8B 1VLNA 2WJSA 1LCLA 1YQ2A 5JDBA 4SLIA 5IJRA 4PBPA 1NQJA 4N7UA 4NUBA 3O1RA 4FO9A 2LALA 4ASMB 4NROA 1O4ZA 1ZVFA 4F8AA 1G9AA 1VBC2 3N9NA 4N53B 3SH5A 3AZXA 4XUNA 2UWCA 5IAXA 1V9U2 1Z0HA 2JDPA 2P3YA 3H7YA 5L9RA 4LO8A 3TEYA 1XB9A 1IS3A 4XUPA 4K21A 1UKGA 2R042 2E31A 1AR93 2A3YA 3K4ZA 3WT3A 3ZFEA 1Y4WA 3MLJA 2YYOA 2FDHA 4OUMA 2Z4FA 4BIOA 1TNRA 3UJQA 3O1OA 4N9IA 2AC1A 3DYMA 5FMOL 1CAXA 2CDOA 1BMV2 2JG9B 3C7EA 3SC7X 4LMFA 2ZGKA 3NMBA 5BNNB 1RUOA 1QU0A 2WLQA 1RVF1 2YGMA 4LO4B 3M70A 1W6QB 4KWLA 1XSRA 2R073 5EPAA 4Y26A 1IG3A 3WY6A 3BTZA 4YPJA 4GH4A 5FY8A 3TAYA 1YEWA 5FKCA 2HH9A 4QPGA 4AFBA 1W04A 3O0WA 1PM7A 3MFCA 3VDDA 2FD8A 3ZSEA 4B1LA 1DQ5A 3WNKA 2VL4A 1EPWA 5FJHA 3ZFGA 1CR7A 4S2DA 1TG7A 4I30A 1NE6A 1XE8A 1W2NA 1LULA 1SLBA 4DFSA 2O1QA 3VB9A 1I6XA 3WVJA 2YDEA 1UY0A 2D6MA 3JUUA 2YPDA 5AC93 3GM8A 2VECA 4OI2A 1HRI1 5CISA 3KT7A 5L7OC 4AI9A 1D0HA 1PGW2 2D3SA 2GC0A 3ZN4A 3I3QA 3LF7A 2I45A 4YZ1A 2E9QA 2WUHA 1LOFC 2OZJA 2ZKLA 2AEZA 3M8LA 4CCEA 1IS5A 1PZ7A 1YFXA 2J1SA 3WG4A 4MXWA 5C6CA 3H8OA 4AF9A 1LNSA 2XHKA 4AQTA 3I3DA 3WHTA 1DCSA 5FZAA 1XNAA 5K0UB 3VBHB 1ND3B 2HWD3 3RZLA 2KXLA 4WM7C 5CBLA 4DEVA 5FYHA 4YRDA 4FXKB 4GALA 3U10A 1J3RA 1OQEA 1Y9QA 3LA3A 2Y38A 3H7JA 1U5IA 3IPVB 4D7SA 4DQAA 1HQNA 2WNVC 3WDTA 2TNFA 3GZUC 3HIFA 3NNJA 2WA3A 3FLPA 4A7ZA 4CCDA 3E97A 2VGDA 2ZACA 4FP2A 3RNSA 4NPRA 4RGGA 4EWAA 4XETA 2YXSA 1VBE1 3P1IA 2BUKA 3DUIA 4OI4A 1U0AA 2XJSA 3FHIB 4IGQA 5C3SA 1R1ZA 1QJY1 4N53A 1I1EA 5JIUA 4RGKA 2Y6GA 2H0BA 4JX0A 2FCTA 4MYEA 4RQPC 2RS12 2BNNA 4Q2FA 4HK8A 2VMCA 1CZSA 5FZ3A 1AJOA 4AYUA 2WSUA 4DUVA 2CWMA 4DS0A 1N3OA 3USSA 5LW9A 1NLRA 5FZ0A 4YGBA 4ZKTB 2ZABA 4RGAA 3P3NA 1WMFA 4RR3B 1GKBA 1MZ6A 2P1BA 3R4DB 1QXRA 4Y1ZA 4N43A 2HWF2 2YBSA 2VZSA 3SMHA 4GMP3 3LFIA 4QDRA 2GC2A 5FP8A 3N7MA 2H0VA 4S2GA 1FPN3 3M4FA 4NHKA 5ACA3 1H2MA 2JG9A 3I2DA 2WINB 5J96B 3OGRA 4PQQA 4EWDA 2RE9A 2XQRA 3OY8B 3THPA 1SMVA 1GZ9A 4J1XA 1LOBA 1Z7S2 4BQ3A 1Q56A 4NRPA 4JHZA 3TNPB 2OXBA 4XQDA 3VBSC 4NPMA 1KITA 2Y6LA 5FLJA 5I0RA 2NZ9A 1PGL1 4FFHA 3T0DA 4OHXA 5E1RA 1TMF3 1QJX3 4CXWA 2K46A 2WSVA 5CFDC 4G9SB 5A1AA 3UKVA 4L97A 3WXPA 3M3CA 1XJAA 1R64A 2JXAA 1LGBA 2NM1A 3K4DA 3SKJE 3VHOA 4DY3A 3JU9A 5FY7A 1SLTA 4ARYA 4FPEA 2ZEZA 4QB6A 4XBQA 1CONA 1UF2C 4Z1VA 3UGFA 2H6CA 3WF2A 4YVSC 3TRSB 3WDUA 3VBFB 4FPGA 4HKOA 4XZPA 2UU8A 1GBGA 3PVBB 3KQRA 3IMMA 5F7UA 4C91A 3ASIA 5A3PA 3F95A 1JYNA 2ZMKA 3MV11 5A3WA 3CJIA 2MEV2 3J8F2 1RMU1 1V6MA 5FXVA 4AFCA 1QQP3 2YMZA 3QBQA 5C4WA 4NHYA 1MQTB 2VMEA 4UBGA 1BXHA 2YUEA 5FRAA 3VBHA 5F37A 4Q29A 4B1MA 4CRQA 3WNPA 1YO8A 1JZ2A 2CY6A 1CAUB 5F39A 4MHRA 2XHNA 4PHZA 5FP4A 4GWIA 3BB6A 4KBBA 3V0AA 4B7KA 1JU3A 2VOVA 3DPRC 5G05L 3VZMA 1W8TA 1REEA 2IVJA 1HKDA 3C7HA 4K1YA 3VDCA 5JLVA 1UIKA 1JH5A 2D43A 3H3ZA 3MGUA 3QACA 4XABA 4BJ0A 1ZBE1 2JB4A 3GDBA 4KU8A 1HV0A 1CESA 1VBC3 3I2JA 3N3HA 3UK9A 2GU9A 1AL21 2XWBB 1RUI3 3PURA 4Q4W1 4D6SA 1REDA 4UT5A 3RYKA 1XC6A 4Q4Y2 2HWE3 2Y64A 5FLIA 5ERLA 5FYSA 1C1FA 1JBCA 4HKLA 1B35A 4E8CA 3A22A 2WT0A 4OI1A 1GZCA 1BCXA 4MUVA 2G4IA 1GWLA 2GMPA 1DZQA 4RR3A 4ZXEA 4PDWA 5JZGC 4M0NA 2BDRA 2C26A 2JIGA 3D4KA 2R30A 1CD3G 3WDYA 2WN2A 4YVWB 3OEAA 2CTVA 2JE7A 4CEYC 4FOYA 2WQ8A 3T09A 1QY4A 4QPIB 2KR2A 2ZEWA 3GBGA 1RUF3 1S0BA 4LLOA 3OY8A 4KQ7A 4WM8C 3ZSJA 4UFLA 2WNEA 2J1VA 1W8NA 2PAMA 4N8MA 5BNOB 1VBA3 2Q4SA 3DL3A 3SQOA 4DUWA 1H9WA 1ZZ6A 2SBAA 2XL9A 4LNVA 1ZBA2 1WCUA 2ZZJA 3I2OA 4MGYE 5FZ9A 3RYRA 1D2QA 3TNQA 3ZXGA 5IATA 2ZGTA 1UU6A 2E6VA 4E2SA 1N3PA 4EV0A 3I59B 1C8M3 3IWZA 4BQWA 5ISLA 1NCRC 2DDUA 1OA2A 2A70A 3ZYHA 1H2LA 3S6PA 5IVEA 3LPGA 4NPLA 3POIA 1UMZA 1JODA 2A6YA 2IWGB 4IGPA 1GMMA 2UY8A 1KXGA 1M06G 3AM2A 3ZYJB 2H6BA 1CAVA 2J1EA 1PIV1 2JG8B 1NXD1 4JDMA 1DGWX 3Q8CA 2RS13 5KHHA 3WDVA 1N3QA 4BQXA 3P3PA 1FMD1 4I0WB 2CAVA 2QE3A 1QWRA 1YWKA 3WINE 3N4MA 4DINB 4ASLA 3BTXA 1SQ4A 1AYM2 1VAMA 2ZGPA 3LWCA 2UWAA 2IZWA 1DZTA 1NX9A 1MQTA 4LIVA 1BBT2 2Z79A 2XR4A 4HBNA 2DURA 4BXSV 1LHUA 3I3EA 2JX9A 4MGKE 5CFCC 4LUKA 1NY72 4GWJA 4Y1UA 1U5YA 2WFF2 4KWKA 3AJYA 4AEJA 2DBNA 3VUOA 4TYSA 3EBRA 1JXNA 3H3UA 4GQ7A 5EHDA 5KHKA 4NIAA 4LE4A 4BIFA 1SCSA 1HB3A 3D0JA 4FPYA 4WVMA 1L7LA 1IZ3A 1YIFA 2Y6JA 3B00A 3JD72 4LKEA 4UF0B 4HPKB 2JEMA 3ZPYA 4YGCA 1XE7A 4XQWA 2ZGRA 5LBEA 4U2AA 2VZRA 3DEMA 5FZBA 4Q8LA 4D8MA 1HB4A 1JYCA 3ZIWA 1SG3A 2CV6A 4OULA 3VZNA 4DO0A 1YQ8A 2QQMA 1O3QA 1AR63 3H1YA 1VBD3 1YNAA 4QX0A 1NCQC 5FMCA 4YSFA 1S0CA 1HLCA 1GV9A 4IXLA 1H1IA 1RUD1 1IKPA 1WW4A 3MF9A 1KDMA 2ZEYA 4IV3C 4ZS2A 2WL1A 4YVWA 1PHMA 2ZBJA 4GZ9A 2EA7A 1WMEA 2VC9A 4YZ3A 5E89A 2K9ZA 4I0AA 2HEYF 3MEPA 4E4HA 3ZYFA 5JMOA 4QPIA 1DF0A 1PZ8A 1SACA 4J25A 5FY1A 1VMHA 1T6GC 4IEYA 1E5SA 1Z7S3 5DN2A 5FLHA 3VBOA 1JZ7A 1VBB3 1I3HA 2VNOA 3HNBM 3I2GA 2Q30A 4XW3A 2XJTA 5IUQA 3ZSKA 4O7XA 4NAMA 4XZUG 4JTOA 4FAGA 4AHYA 1NLQA 4M4RA 1UY4A 2B9VA 3IN9A 4COVA 4CU8A 2G9FA 4Y4YA 4OHWA 1YFWA 1XNBA 1PK6B 2CU5A 2QQVA 2MPFA 2Y34A 2UYAA 2Y60A 3WP6A 3IIIA 3PLQA 5JXHA 4LQRA 1JHJA 2AGSA 3MI8A 3KCCA 4A7KA 2JWPA 3LEMA 5CA6A 1K5MC 4H3WA 4KBZA 4ARXA 1MS4A 3GYDA 4ITCA 3K48A 1MEC2 4K20A 3VKNA 2DUOA 2Y8KA 4BCUA 5GZGA 2HKXA 5FIXA 1HN0A 3PVOA 3KLSA 3ST7A 4CU7A 3BTYA 1WCDJ 2MEV3 3J8F3 5FO7B 2VULA 3CEWA 5J1XA 2CAUA 3R0RA 1OD5A 2QVSB 4YW2A 1P8JA 5EIYB 4E2QA 5FAXA 3O7OA 2Q1ZB 4QHZA 1ZZCA 5FP7A 2C0ZA 4HONA 4W6XA 3ZM8A 1CAWB 2FDIA 4FOWA 3OUIA 2RS32 2RS51 5E16A 4XJZA 5I0TA 4QX1A 5LBCA 1OUXA 1GQPA 3N36A 4R9DA 2VOXA 5FYMA 3K51A 2BPA2 4NVPA 1PVXA 4AVBA 3H9AA 2FCUA 4LBQB 1Q5OA 4MGIE 3TEXA 3QOPA 5JWPA 1ST8A 3VBRA 2PFWA 1OD3A 4UF0A 1HRV1 3RJ2X 4GXLA 4HPKA 5JOWA 4RHV1 3WF1A 4AGVA 1G9FA 2WS93 2WWUA 1MVEA 3ITQA 3OGVA 4LITA 4S2HA 4HANA 1YIPA 3N35A 5JSRA 2CNAA 4LULA 4P9GA 1O6UA 1APNA 2R062 5BNPC 3Q8FA 1QHDA 3D3AA 1ULGA 3WHUA 5ANNA 4META 3UNPA 2HWC1 2YGLA 4FPFA 3N9OA 2LW8A 1ODMA 2P34A 2WO7A 4CTEA 4YZ2A 5JMCA 1BZWA 1OT5A 3ZIXA 3J7MA 3D6EA 4I3GA 1NYWA 1YHFA 1GANA 1W39A 3FUQA 3WF0A 1W6MB 3JQWA 1QEXA 3T2TA 3B69A 2E63A 5I0DA 3VDBA 4AWDA 2CYFA 4XJUA 4AFMA 2OKXA 5C70A 4PJYA 4JKKA 2W9XA 2Q8CA 3VGIA 2CGOA 5FZ8A 1PO22 2JJ6A 1J3PA 1SFNA 5DXDA 2AYHA 4LKFA 3WLUA 3VHNA 2XWJB 4R4XA 5L19A 2JDYA 2PXJA 2I74A 2WC2A 1GOGA 2J7MA 2NYYA 4XAEA 3ZKYA 3BOWA 3ACIA 2WT2A 4Z82A 2HWB2 4C8DA 2YC0A 1UOFA 1ZZBA 1LTEA 1HQWA 2GDFA 2QDNA 1N1SA 2W08A 3DPRA 5C3PA 1DLLA 2WR9A 1S0DA 3NVCA 5A7SA 3WP5A 4A45A 4FQ4A 3ZVXA 4BK5A 5F8PA 1IHMA 1WA4A 1W0OA 3GJAA 5HV4A 2W91A 2E32A 3KT4A 5IHRA 1RL3A 2WNOA 3ZN5A 1O91A 1F4HA 4EWEA 4IEZA 1I5ZA 3KV4A 1AYN2 1J1LA 3BUCA 1DU3D 1E57A 1W8FA 4DXZA 1R1A3 3SHRA 1X9PA 1JYVA 4Y22A 4L0PA 4FSJA 4CDWA 2DVDA 3D82A 4AVSA 1BBT3 4XPVA 4IE4A 1W9YA 2EAAA 4CU6A 5JUVA 4NHXA 4V2WA 3USUA 3O0XA 2DCKA 3BI3A 2WFF3 3GBFA 5EJ3A 3NWKA 3RI8A 4LORA 3PIGA 4XF4A 1SLIA 1UZWA 3C3VA 4RSUA 4CEYA 1Y3TA 4XIKA 2VMDA 1CX4A 3FHAA 5ABJC 3VZKA 2ZEXA 4LBQA 1WBFA 1XXNA 5FZ6A 3KHCA 2FDGA 3R4SA 1AL0G 2XQXA 4AVVA 1MVQA 1NE4A 2GH2A 3ELNA 4FPCA 2ZCWA 4E2GA 1FX5A 4LPLA 4MXVA 4DB5A 2GN3A 2V72A 5C8CB 4QX3A 2X8KA 1W9SA 2DCTA 1SDWA 3NV2A 3WW4A 2EIEA 4M0HA 2WQZC 5DG1A 1EAH2 1H8VA 1U12A 1R091 2JKXA 4WZCA 3S30A 4MH0E 3ZXDA 3VD5A 4IV1C 4A6OA 1UXXX 2WO1A 3VHRA 1RUH1 2OQ7A 3PTRB 1QJU2 1XE0A 4ZU4A 5LCWL 3V56A 4CUCA 4EE2A 4CDUB 4NIDA 2PHUA 2JD9A 2BVVA 1UIJA 3LDRA 4WZFA 4RD7A 2R071 4YW6A 3W21A 2CDPA 2W46A 3AMPA 4Q4V2 1OKOA 1JN2P 5KHJA 2VMGA 4L9BA 3R05A 4B29A 2QQWA 5KHGA 1H6YA 4QPYA 3P6BA 1QF3A 1GUIA 4BMBA 3IAQA 5CFCA 5KXDA 1COV3 3IB3A 1E5IA 1X7NA 4YM1A 1RUE2 5GM0A 2XB6C 1C57A 4OUEA 4Y5SA 4AW7A 5I93A 3ETPA 3ZOIA 4P9JA 1OVPA 3DCQA 3VKOA 1F2NA 3LSDA 3NV4A 4AEMA 2A3WA 1RUG2 5LBBA 3EHKA 3GCWA 1MEC3 1ND2C 3ZFEB 2BZDA 3J4UH 3BGAA 5GLUA 2XLGA 4L11A 1ZX5A 5FYUA 5KXEA 3RRDA 4AE2A 3E6CC 3K75B 4IEXA 2VY0A 3OCPA 4ZONA 2WYSA 1FYUA 3DECA 5JOYA 1W9FA 5LEKA 1AXKA 2HWD1 2O0OA 2BEOA 3GHMA 1RHI2 1RUNA 1L3JA 1W6OB 1ALYA 5GZCA 3G6JB 3RZGA 1TQ5A 3TN93 5DAXA 1W8OA 2RHPA 1BLZA 3H1WA 3IIAA 4XDPA 5CNAA 4ZY9A 3SEPA 1S0JA 2C4XA 2QQJA 1YFUA 1DZRA 1UOGA 2ZTNA 4GH4B 2ZGOA 4JGYC 4Q4X1 1PVC3 1UYYA 1X36A 4IE6A 4QPGB 4R9BA 5LA9A 1VB2A 3HQUA 5K0UC 1ND3C 3Q9OA 3VDDB 4CPBD 5FOBB 2QQLA 4A3ZA 3Q8BA 3ZFGB 4B8EA 3WW3A 2CWSA 3BCWA 3EB7A 4Q0SA 4CXYA 1EUUA 1IQAA 1XPWA 1D4M2 3HPNA 5FUPA 4AAPA 5HV0A 3AFKA 4FPJA 3DYPA 4X6QB 4XVHA 3IDBB 5C3RA 3Q8AA 5AVPA 1S2KA 2RM23 3ES1A 4QU2A 4K6BA 4GA9A 4HFSA 4CDQB 3LEKA 1D7PM 5B2GB 3WUDA 4LBJA 4YM2A 1LOCA 3LE0A 4IEPA 4QU1A 5FBJA 4XBLA 2V4AA 1FPN1 2VOKA 1NA1B 3KGZA 2A7AA 4LHSA 4MXWB 4AQSA 5FJKA 4GIQA 1GWMA 2DYCA 2R0HA 3OGSA 2W68A 3W5MA 3ZYRA 4QXHA 2XBO1 5CG9A 2PAKA 1RUJ3 3NJZA 4A41A 4A3XA 5LA0A 5IK7A 1O3RA 5JVVA 4XF0A 3ZYPA 1WWYA 4HSJA 1PO13 1PZ9A 2Y26A 2F17A 1AR83 2UURA 1W2TA 3ACLA 1QJX1 3CZJA 1G7YA 2A71A 3L9JT 3WEZA 3ZFFA 4JGZC 1V6IA 3QH6A 1O3TA 1X8MA 1HXS1 4XURA 5T52A 4XFFA 5FZHA 4X8PA 4FFFA 5JR7B 4XDOA 2D6LX 2ZGQA 5A7QA 5T3NA 4RL7A 1W8UA 4CCKA 3KQ4B 3LA2A 3THTA 1H8TA 5AVAA 3OUJA 5FYVA 1A8MA 4NHLA 1YXWA 4L2NA 5FP3A 3KVBA 1WW7A 2BGPA 3WD5A 1F4AA 5FYIA 4AEDC 2VZ3A 3S5AA 2FDJA 1RVF2 2D6OX 1X8EA 1DQ0A 2QQUA 4DRRA 5C5TA 1SBDA 3CBNA 4N43B 4O9GA 1JMUB 3PJYA 4K40A 4UAPA 1QQP1 1XNCA 2V73A 4BB3A 3LIHA 3MYXA 4B4PA 1GFF2 5C7GA 1GSLA 3ZMNA 3SLIA 1JOBA 3W5NA 3RG0A 4QB1A 1IS4A 3VBFC 4PF5A 3WV6A 4D7YA 1W6OA 3AKPA 3KB5A 2A6VA 2VZOA 2VZTA 1IPKA 1T2XA 2C9AA 3NNMA 4MGQA 2NMOA 5HCHA 1O4TA 2RR13 1LU1A 3RMYA 3MDPA 2D97A 3CU7A 1HRI2 4QXCA 1C8NA 3HOBA 2VU9A 5C9AB 1XOYA 2WO2A 4HG6B 3ZXEA 1Y9MA 2TEPA 1RUI1 5LRSA 5I0UA 3GCXA 4CXXA 3A0KA 1LHOA 1UMHA 1EV13 5FWEA 3OOXA 4YWAA 5IK8A 1NQDA 1OLME 2HWE1 3E6DA 4K8RB 3B9CA 1ULFA 3BIWE 3PVEA 1MPXA 2WNUB 4GB33 5F1RA 1GNYA 2E33A 2ZXQA 2EAKA 1YRZA 2VOTA 5D8AC 1LESA 4XFGA 3T2PA 4WV8A 3GBWA 4BQ5A 4CDQA 1LB2A 2WT1A 2W1QA 5C8WA 2B8MA 2BQPA 2GP3A 2YZ4A 3POJA 2OUJA 3ECQA 5SV5A 2R16A 2P5BA 1LU2A 2PHWA 2VO5A 3RS6A 3ACFA 1NA1A 1AR73 3CJIB 1R083 4MVTA 2HYKA 4AFAA 5A3MA 3ZKUA 5C4WB 2YFUA 2KD7A 3HBKA 1RUF1 1VJ2A 1LR5A 1AXYA 2RMU3 2XG3A 3BYWA 1VBE2 4MOAA 3VV1A 5A7OA 1VBA1 2RJLA 4BMEA 4AGRA 1QJY2 2YC4A 1I9RA 3V0AB 5FK8A 3NQHA 1MR5A 1H1MA 2XVLA 1CGPA 1C4RA 5HCBA 3SNMA 3S57A 2EXKA 4I0BA 1H30A 2V09A 4E8DA 4FXGB 3B7MA 3SEEA 1S0GA 2LRPA 3SH3A 5JPMB 1DGLA 2JDAA 3M7AA 4OMCA 1TEIA 1UYPA 3OD0A 3O1TA 5EZWA 2ZS6B 1C8M1 5KR7A 3E1F1 4YW4A 5D1IA 5BNOC 2AENA 1SCRA 3I3BA 3TOJA 2UY9A 1SFPA 3JBG3 3PMEA 4P9XA 5EV7A 5JXIA 5LK7B 1KFUL 1B35B 5DAWA 3HT2A 2D44A 2Q8EA 5IFPA 2VBBA 3CF6E 4ASKA 1OQ1A 4HETA 1OFSA 1QJZA 1DQ2A 2PHLA 4BQYA 1F35A 2DVFA 3K77A 4PDWB 1MZFA 2ZMLA 5H9RA 4HT1T 1VP6A 5HPOA 4YFZA 4H7MA 5JIAA 4E4SA 4FTBA 3DV8A 3ZSLA 2VM9A 2ZGUA 2VZPA 3AP9A 3PIJA 1KD7A 2QDRA 1QOTA 4AK3A 4CE8A 1PGL2 1UY1A 4X6RB 4CDXB 4AGGA 3CIHA 1JZ6A 5K9YA 2P6CA 5IVJA 4BHPA 1WCQA 3LB9A 5C33A 3ON7A 3CMGA 3WDWA 4JZRA 1H4HA 3ZYBA 3NJVA 2PTMA 2BBVA 5C9AA 2FBEA 1DGRA 1OOPA 1ZA7A 2GNBA 5T5LA 1JZ8A 1EP0A 2VTFA 1J1TA 4ZU5A 3P5BA 4E9KA 1UZVA 2AUYA 3AK0A 2WNUA 1RXFA 1AR61 4B7EA 3H3LA 2E7AA 1RMU2 4BH9A 1VBD1 5C3QA 1C5IA 1ASJ3 2ATFA 1W9TA 5LB6A 1RJ7A 4PIXA 1B09A 1GOFA 3BPSA 4RYDA 3FWEA 4C0HA 2ADDA 3PVNA 1CAVB 3RJRA 2UWBA 4UFMA 1QH7A 3I97A 4LBNA 4AVAA 3RVHA 5B4NA 2IFRA 4XAAA 2B7YA 5HXMA 2JDZA 5CIRA 3PUSA 1ZBE2 2JB8A 2OPWA 3O0VA 4UW5A 3TWIA 4QDSA 1AL22 1VBB1 2PLV3 1VRH1 3IMNA 4Q4W2 5FKBA 4LOTA 2P2KA 1S0EA 3ZN6B 3ATGA 1YI7A 4CCJA 4OFGA 4YLZA 5A6ZA 5FR3A 1OUSA 3MIBA 3UL2A 2BTVC 2XJPA 4WVMB 3CDZB 1D0GA 1HW5A 1O8PA 4DIQA 1AX0A 4RFT0 1V9U3 3FE5A 2JDUA 3MIEA 3UGGA 4Z2WA 4Z92B 2VQAA 3I2HA 2R043 3U14A 4BDVB 1BHGA 3PU8A 5EYYA 1HDKA 1RUC1 1V70A 4Q0QA 3T1LA 1S0IA 2CL2A 3L2HA 1OI6A 1VAKA 3ZMOA 1A6CA 2A6WA 1PK6C 1QDCA 2NLRA 1K42A 4QPWA 5BUVA 2E26A 1KFXL 3ZXFA 5D2AA 1RC6A 3VD4A 1W3XA 4P02B 1TNFA 2Y0OA 5L7OB 4OHZA 5HCAA 4U36A 3GZTB 4EYUA 3POFA 5JXJA 2VJXA 1G9DA 1RIRA 5K8SA 2JDHA 2ARCA 2DU0A 2A75A 4CDXA 5EXOA 4COZA 4DEQA 5FPXA 4XFIA 5T55A 4MSVA 3VBOB 3U07A 5IT6A 4QB2A 3KM5A 4LR4A 1ACCA 4CCCA 3NV1A 2CGNA 1HRI3 4QHOA 1MS5A 2DCYA 4W50A 3MIHA 4WM7B 2BGCA 2DVGA 2QQOA 2WABA 1HN1A 2ZGNA 3T30A 4AG4A 5DUUA 4J6GA 1NXMA 4COUA 2WS91 5CAZA 1PIV2 2WNVB 3OBZA 4AXOA 4MO3M 2ORXA 3VBUC 4C90A 1S2BA 1FMD2 4BLIA 3WP4A 5J3UA 2FCVA 1W99A 5DZEA 1EYBA 2IXLA 3B01A 1WCSA 2IXCA 5A3TA 3AKTA 3AYEA 1Q8OA 4FPOB 1PNFA 1SPPA 3ILFA 3M3QA 4PLNA 1OVSA 1H1AA 2VBDA 3C7FA 4DPNA 4RQPB 2GAUA 3IKWA 2BNMA 4IW3A 4ES8A 4XTPA 1ZRDA 2VCAA 4Q27A 3KGLA 3OBAA 5EYXA 4XUQA 5FBZA 1POV3 2CHHA 2PA7A 4QKBA 5EJZB 3S7EA 1FOD1 3ACHA 3RGBA 4H7LA 3WUCA 3EO6A 3ZN6A 4QM9A 1WW5A 2WIIB 4D69A 2LM3A 4EZHA 4QQLA 4CP1A 2VNRA 4Y33A 4EN8B 1SLLA 4D0QA 3PNAA 3MIGA 3J9SA 3VBRB 1DDLA 2ZZQA 4XXPA 2RG4A 2I07B 3O1VA 3AXDA 1UX7A 4W65A 1ULOA 5M0TA 1RUD2 1SHWB 2ENRA 2VTXJ 2WAOA 1K3IA 4Q0UA 3VBSB 1FNZA 3SITA 4I2OA
chains in the Genus database with same CATH topology
1ZRRA 3V0BB 1RJ8A 4O9EA 1WW6A 4AFDA 1TME1 4AQ2A 4Y24A 2RJKA 1R1A1 2HWF3 3V65A 4QGNA 3I8TA 4KG8A 1Q8SA 4C1WA 3V64A 4YVSB 5F6LB 5L7OA 5GALA 4XTMA 3BODA 3OD4A 2VG9A 3MF6A 1LOFA 2B45X 2BWCA 2GH8A 1BKZA 4XBNA 3J26N 3EQEA 1UL9A 5J37A 1WGPA 4G4FA 4YG6A 4WVZA 2X5IC 1SEFA 4WM7A 3ZX7A 4Y1XA 4LA3A 4AVTA 3WX5A 3WQ1A 4BOWA 4I09A 4NWVA 4Q26A 4CEWC 2WNVA 2KA3A 3AB0A 3DPRB 3IDEA 2MNGA 3RSJA 4QXKA 2NN8A 5JAXA 4BQ1A 3WZ1A 5DDJ1 1LGNA 1S1AA 5CB7A 4K7JA 4RQPA 2RS52 1NG0A 4Y22B 5C8CC 4CDWB 1X33A 1Q3EA 3E6BA 2WZR1 1WBLA 3NL1A 1GNHA 1ZBE3 1QGLA 3WQ7A 5JOXA 2XVGA 3USUB 4PLMA 1HRV2 2D98A 4PIZA 3H0OA 2B46X 2D5FA 4RHV2 1LODA 2DUPA 5KBFA 4CEYB 1Q8PA 4RS5C 1XU2A 4E4DX 1LHVA 3ME2A 1SFYA 3B3QE 4JTNA 1VR3A 2E51A 2F6BA 1NOVA 1COV1 2R1DA 4HVRA 4HVOA 1F5FA 1ENXA 4W6YA 4YG3A 2IXKA 2ZGMA 4Q4Y3 2HWC2 3VBSA 1G8WA 1YJLA 3R4UA 3DGTA 4DNYA 3WR0A 5GLWA 3V0BA 4AI1A 2XJUA 5CFDA 3VLBB 2ETEA 2PHRA 1BEV2 4XMAA 1LB2A 3AMQA 1QMJA 1BK1A 4KGQA 5JSPA 5GLZA 1N1YA 3NAPC 1SBFA 4YVSA 3AKQA 3BU7A 4HMZA 2PELA 3AFGA 4P9LA 3TN91 3NKGA 3HBZA 4INDA 4URTA 2FMYA 4QGMA 1PVC1 2P3IA 1TE1B 5F9TA 5KXCA 1ZBA3 1G9CA 2XKOA 3UKNA 5IK4A 5CFCB 5CG8A 1ULEA 3N7LA 2B5HA 3ES4A 4KGGA 4LHKA 1FMD3 1DG6A 3LOBA 4M3CA 4GH4C 4LHNA 4XHBA 4IEOA 2RM21 3AZYA 4QPGC 2XH6A 3D8CA 3SH4A 4D3WA 2XLFA 3C2UA 4IEUA 3ZYGA 1DFQA 1CJDA 4WBBA 2VPVA 3JB8A 2OW4A 5CVRA 4YW1A 2D3PA 1YUDA 4FPKA 1AYM3 3M3IA 4L8QA 3HT1A 3S7IA 2QZ2A 1RUJ1 5JZGA 1YLLA 1KJLA 1NLSA 2GZWA 3SXWA 1PO11 4IV3B 2X53S 3MLKA 5JCTA 1AR81 5CU1A 2SLIA 3O12A 2VOWA 3RZZA 1CN1A 1XYNA 3RPQA 5FQ0B 4WM8A 4IL7A 2VVEA 2ET7A 3JD73 3MFAA 2EALA 1RUD3 2JE9A 4IESA 4TSVA 4YW5A 1R092 1U5ZA 1OPOA 5LRRA 4XJWA 1RUH2 1RTVA 1AR91 2FHRA 4YGDA 3ROUA 1UCXA 1GYKA 1X82A 1IGOA 1ULDA 3VBUA 3H50A 1BQPA 4M01A 2R072 2WKKA 1DHKB 3E5XA 4N53C 5IK5A 2XJVA 1NCRA 1XNDA 4CP2A 4YM3A 4Q1PA 1AXZA 3PHMA 1KRIA 3FMGA 2JICA 1A8DA 5L36A 3ALQA 4M3CE 2GNMA 1ZZ7A 5BY5A 2WWSA 4N43C 4EN6B 1Y7BA 2RR11 3AYCA 4LO5B 5DUWA 4D7TA 4BM8A 1G9BA 1OSGA 2JG9C 3AYDA 2ZX3A 3ZFFB 1ULCA 5BNNC 2N7GA 1EV11 3OTFA 4JDNA 1AX1A 1OA4A 4Z07A 3KCXA 4GB31 1G86A 4NWWA 5AC91 1UU4A 1H8TB 2G9GA 4HLTA 2PN5A 2HWD2 3ZXJA 2ZHNA 4UW6A 4ATFA 2QNKA 1JYIA 4XOGA 2NPIA 3AKRA 3POYA 3BPZA 4OVEA 3MW4A 4YZ5A 3PTYA 1ZREA 1AR71 4A2UA 1R081 3UV9A 4Q4X2 4R9CA 1JUHA 1CPNA 1NCQA 1UAIA 2RMU1 3ILRA 3URFA 5FPZA 4YARA 2B39A 3FJSA 5JI7A 3JCIA 4Y20B 3OBRA 2GC3A 2RS33 2HEWF 4IV3A 4OI0A 2VQ0A 3OYWA 1MACA 1QOOA 3POSA 4N7IA 3CJIC 3MW2A 3ZO0B 2Q1MA 3HQXA 4DY5A 4JC1A 4XFBA 4OUSA 5C4WC 2EIGA 3SCFA 1Q8VA 3UJOA 1DYKA 3VBHC 3WDXA 5FQ0A 3OPZA 3LAGA 1MS8A 1OPMA 3S0MA 2HWC3 2X5IA 3JBG1 4XXAA 4FOVA 5FTTC 1FPN2 3AP4A 4LLFA 4LUMA 1ZRFA 2IFWA 2R063 4LBQD 4EJRA 1HIXA 3WCRA 4P5HA 1BEV3 2XBO2 4CYDA 4GMP1 5I8YA 2PHDA 1LECA 4LHLA 1K5MA 5ACA1 1B35C 1QNYA 3W59A 2ET1A 3RQ0A 1QJX2 4RR3C 2D6NA 1HXS2 2QZ3A 3SCGA 4BE3A 2Z2SB 1PO23 4DMIA 5J09A 1WLWA 1G6NA 1JOJA 4GMP0 1OQDA 2XGXA 2P17A 2A6ZA 4AVCA 2XL7A 4Z8BA 3FX3A 1TMF1 1DYPA 1KS4A 1S0FA 3FFQA 3H8UA 4BA6A 2HWB3 2TUNA 3KCYA 2DCZA 4E4ZA 3SISA 5FREA 1ASJ1 1QQP2 1UZZA 3H1MA 1QKQA 1UW8A 1WLDA 1AYN3 4XF1A 3IBMA 1QOSA 2VXRA 2ZHKA 1DQ4A 4HN0A 4HZFA 2ZHLA 1DGRN 5GLTA 3WQ0A 1XQNA 3B94A 5BNPA 4F83A 4IEVA 3T1MA 2YV8A 4FOQA 2PLV1 1J58A 4XQ4A 1RUI2 1LENA 4Y20A 3KT1A 4IV1B 1OA3A 2HWE2 3NAPA 1DGWA 3JZVA 4EN9B 3AZWA 3ZXAC 5J36A 1MQTC 1A3KA 4JDOA 3GF6A 1VBC1 2OIIA 1LEMA 1OOPB 5A32B 2XKPA 1R093 2DVBA 1V9U1 1LEDA 2PYTA 3D5OA 4QQOA 4R8HA 2WLPA 2R041 1RUH3 2Q8OA 4D94A 4M3CF 2R6QA 2OYZA 4QMAA 1XRUA 4NR1A 3E5UA 4NN0A 1RUF2 3I7DA 1F5JA 1EAH3 4B3NA 2VUJA 3GHNA 4H55A 1VBA2 2ZAHA 5JSOA 3MIFA 2Z5WA 2FQPA 1VAVA 1BMV1 1QJU3 3AP6A 4KWJA 4RA0A 2PHXA 1ND2B 1OLQA 1XYOA 2ZX1A 3AX4A 1O7FA 3SCHA 1ENRA 2NMNA 4Q4V3 1AZDA 1C8M2 1DIWA 1IPJA 4YVWC 5LEJA 2IXJA 5H9SA 5FOJB 1D4VB 1LHWA 4QPIC 4ONUA 2YROA 1C1LA 1RUE3 4Q0PA 2ZAAA 4JGYB 3NV3A 3O14A 3VBOC 3EJKA 2ZJCA 5ABJA 1RUG3 1PGW1 1ZRCA 3FC0A 2NP0A 3WG1A 3VL8A 1GLHA 1Q43A 3VKMA 2EF6A 1UX6A 3ZSMA 4FAHA 4IERA 4Q4X3 4PQ9A 4GWMA 1POV1 1AX2A 1RHI3 1J59A 2EXJA 4HSLA 2E7TA 1EPZA 1H2KA 3LOIA 2VNGA 1KQRA 2JG8C 3GZAA 4IV1A 2V5YA 3WP3A 4AHWA 4ES9A 3AMMA 1C3HA 4HVQA 1AR62 1C28A 2IC1A 5BXXA 1BVVA 1VBD2 4M00A 5JPNB 3AMNA 4UW3A 4XFHA 3CNAA 5HCFA 1POV0 1ZA4A 4PCRA 1YJKA 5A32A 3PJQA 5J98B 4TWTA 2RS11 4XEZA 1D4M3 1V6OA 4KH9A 1WUVA 1WCKA 1H4GA 3VN4A 5BNNA 2C1FA 4JGZB 3RDIA 3TB0A 3WW1A 4LO6B 3VBRC 1CIWA 2HWF1 2XBO3 1LKNA 1W6QA 2O8OA 4NOTA 2ERFA 1VBB2 1ZYBA 4H14A 1VRH2 4SBVA 4OHVA 3AXEA 2X29A 4F3JA 5EFUA 4AEDB 1ND2A 1GR3A 1S55A 3DF0A 5FO8B 1RB8G 5DZGA 4YW3A 4Y1YA 1HXS3 1OHFA 2TBVA 1Z7S1 4AQ6A 2P37A 4LBLA 2K2SA 3NW4A 1O3SA 4R9AA 4OHYA 1ZZ9A 4K8FA 2ZGSA 5J48A 3D0SA 1RUC2 2GNDA 1XU1A 2Q0AA 4CZSA 4E27A 2QCSB 4JGYA 1VALA 1GQHA 3ZDSA 2Z69A 2ZX0A 1MS0A 1QNWA 5K0UA 2ILMA 3MZHA 1ND3A 4HL0A 4XJ8A 2VMIA 1RITA 5A3LA 2Q5TA 2R0FA 4IEQA 3N7JA 1RVF3 3IPVA 3AZVA 4AHZA 3ETQA 4YZ4A 5DZFA 1AUYA 2MEV1 3IT8A 3J8F1 4N9HA 1CPMA 1N47A 3LZZA 4FCAA 2VW2A 1WLTA 5D8AB 4Y1VA 5BYNA 1FAYA 2Y0IA 3I4IA 4MV2A 1LOAA 4LE3A 3VKLA 4IETA 4OZXA 2BNOA 3QCWA 4A7YA 1F31A 4FT8A 1LOGA 2EXHA 3GALA 2P3JA 2WS92 3WG3A 1HQLA 2LTNA 1O5LA 4XDQA 5KHIA 4LEJA 4CDWC 1Q8QA 2DCJA 3M1HA 3IM0A 1BJQA 2GSYA 1XNKA 4XYXA 3VHPA 3TYJA 1JW6A 4TZDA 4Q4Y1 3RI9A 4JAAA 3A0NA 1FT9A 5FO9B 2YY1A 4K9SA 3TBDA 4KU7A 1JUIA 5KWRA 4JGZA 4DRVA 4XILA 4C1XA 2JKBA 2AREA 1FI2A 1CJPA 1C5HA 3POWA 2FZ1A 4EROA 1FOD2 3OJBA 1PMIA 2DUQA 3EXUA 2D6KA 4ZXKA 3OGJA 1W6PB 1ZM1A 4DOUA 3AJZA 4B4QA 4UXAA 4AEDA 2GALA 2DTYA 1FATA 3JQXA 1WLCA 1VBE3 1QJY3 4Q0VA 4Y5Z0 1QXJA 4I3PA 2ZPXA 3ZSKA 2BFUS 1ZBA1 4K1ZA 2QQPA 2WQ4A 2XLAA 4QQHA 3WNXA 1RGSA 3VL9A 1MS1A 3L2YA 3VBFA 2LUWA 3HR9A 5TSWA 2DVAA 2IXIA 3DN7A 4L99A 2OUHA 3BTAA 1DBNA 2ES3A 4AI8A 2O8QA 1AF9A 1TME2 2ZX4A 5AFBA 1R1A2 2KM2A 5GZDA 4FVVA 4KG0A 1W6NB 2PHFA 3UKTA 4AHXA 2GMEA 3VZJA 4AI3A 4FBFA 1QDOA 4YGEA 1CAUA 5F6KA 5CFDB 4QHBA 5DG2A 3AMHA 3MW3A 3AP5A 2XPJA 1AYM1 4CP0A 5HXVA 4GULA 1FV2A 5D8AA 3FBMA 1BBT1 4PIYA 3HN1A 5I8SA 4DZGA 4KNCA 3MPBA 4ISRA 2UYBA 1H0BA 1NY71 2C5DA 2WFF1 2XJRA 3WCSA 4JV4A 3ILNA 5FMOS 4J1WA 4QQPA 3BALA 4F7ZA 4G3YC 5T50A 1RINA 2D5HA 1A78A 4I01A 2K0GA 1UU5A 1J3QA 3JD71 4LBKA 3M2MA 1HX6A 5DDJ2 2XVKA 1KS5A 3BOPA 2AH2A 4M3CB 2VW1A 1RMU3 5I91A 1QH6A 3IDCB 2AZ5A 3KSCA 2WZR2 4PBOA 5EWSA 1M4WA 4XJAA 1BYHA 4P9YA 3ZXLA 3LGRA 5BNOA 2CGPA 1VRH3 5H9QA 4L92A 4LBMA 1HV1A 1CVNA 3KMHA 1W6PA 1URXA 1VB4A 2R49A 3MPPG 2PAEA 3NSTA 1COV2 4YNIA 5JZGB 4XHXA 1AL23 2F4PA 3I59A 4LTAA 4N90A 4B4RA 4Q4W3 4WVVA 3ZYIB 2QKDA 2ZOEB 2XUMA 3FZ3A 2BVBA 2VH9A 4XF9A 1RUC3 2JG8A 4CDUC 1UZYA 2OVUA 5CADA 4WM8B 2VVFA 3KD4A 4FP3A 4XF3A 1YYNA 1V6LA 5FCCA 2FZ2A 1NZCA 2D3RA 2GNTA 1OFNA 3LSEA 5DUXA 3CLPA 2WZPP 1N1TA 1W6NA 1V6KA 1ZNPA 3A4UA 2R32A 4FPLA 1MEC1 2QJVA 3ZFFC 2ZGLA 4FTEA 1MS9A 3TN92 2HEVF 4UBHA 5KC5A 1REFA 3VBUB 1CQ9A 1NCRB 4AEKA 1PVC2 4YM0A 4COWA 1UKRA 1H8TC 3X29B 5E8AA 2ARXA 1LHNA 3W58A 4V1PA 1OLRA 1OMIA 4BLJA 3ZFEC 3N7KA 1DQ6A 2RS31 5I0SA 1H2NA 2E53A 1W2UA 2GC1A 4XMIA 2YPJA 4HKWA 2DV9A 4FQZA 4BWOA 3CL1A 1SLCA 2RM22 2GN7A 2OZ6A 5BV6A 3AKSA 4AI0A 2ZMNA 1PIV3 4NHMA 2JD4A 4ORFA 2BW8A 3AYAA 4FPHA 1H9PA 2W39A 4QT6A 2R061 4XFCA 2EXIA 2OPKA 1F8VA 2W0XA 1ENSA 3GNEA 1BEV1 3VDDC 5E88A 1RUJ2 5LK5A 1FV3A 1FOD3 4GWNA 2B42B 3DKWA 3B9IA 2D40A 3ZFGC 5KC6A 5FFOC 1PO12 3WW2A 5BNQA 1U5XA 1AR82 2BYVE 2DWRA 4Q1RA 1V6NA 1AJKA 1O4YA 3QH7A 1NCQB 1MS3A 5HBAA 4HK9A 1PK6A 4CDQC 1PO21 2WA4A 2PHTA 4R52A 4XE9A 3OYWB 3LKJA 2ZHMA 1NA1C 1AR92 4IQPA 2OA2A 4LBOA 2HWB1 1TME3 3INAA 2IXHA 2ZKNA 3MICA 1W0PA 1XYPA 5F5QA 3AZZA 4AI2A 3M3EA 3I54A 1UPIA 2X5IB 5SV8A 2D6PA 1D2SA 4EN0A 4P14A 2WFPA 1YFYA 1OKQA 3NO8A 4JRAA 2DFCA 2QFEA 1GICA 4BPZA 1AYN1 4QGLA 5GZEA 4K3UA 1PNGA 1CAWA 4NO4A 4CEWB 4UW4A 1V00A 5KXEA 1UPSA 5JOZA 4PLOA 1LOEA 3R6SA 2RR12 2A5ZA 3RMXA 2E7QA