1QOOA

Lectin uea-ii complexed with nag
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
236
structure length
234
Chain Sequence
SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN BINDING LECTIN, UEA-II
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
molecule tags Lectin
total genus 54
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qooA00
4D69A 4KBBA 1AXKA 2E51A 1S0BA 2WKKA 1ENQA 1HQLA 3PJQA 3H0OA 1LHNA 1WW5A 2XG3A 4UW6A 4FOYA 3KQRA 4K1YA 1LODA 1AJKA 1LOEA 2WNEA 5IK7A 1C4RA 1CPMA 1DYPA 2ZGMA 3FLPA 1LGBA 1AXYA 3GNEA 4FPGA 3ZXFA 2I2SA 1O4YA 1S0FA 2LTNA 4NO4A 1AXZA 4WZFA 3WDVA 3N7JA 3RRDA 2ZABA 4XBNA 2A6VA 1FATA 2GMMA 2H0BA 3M1HA 1JYCA 2JECA 4YW3A 1CIWA 2DUOA 2DTWA 4AGGA 4LBQB 2ZKNA 1AX0A 3AZYA 1F31A 1LECA 2YROA 1APNA 1UX6A 2G4IA 3BIWE 5DUUA 3ENRA 4AVVA 2GNBA 3O0WA 3WUCA 4Y1VA 1SLBA 3AP9A 4NOTA 1N3PA 3ZSKA 1PZ9A 4XOGA 1JHNA 1W6OB 1SLTA 3OJBA 4YG0A 3T1MA 3DUIA 5GZCA 2P3IA 5EXOA 2WT0A 3SLIA 4XHXA 1OFSA 1V6JA 2A6XA 2ARBA 2ZGKA 3AZVA 1DIWA 3R05A 2HYKA 5DG1A 1G9DA 3WV6A 1AJOA 4XZPA 3NV3A 3WHTA 4YGDA 1A78A 3NV4A 5JVVA 4DRVA 4XBQA 3WG1A 3POSA 3WLUA 1IKPA 3PVEA 3PVOA 5GALA 1IS4A 5GJ6A 5GLZA 2NP0A 2D6PA 4GALA 5GLUA 2E7TA 1SCRA 1DBNA 4FOWA 2B7YA 5E8AA 5EYYA 2KM2A 1CQ9A 1QOOA 1A3KA 1J1TA 3AYDA 4Y26A 1HKDA 2E6VA 4YM3A 1MVQA 2VH9A 3ASIA 1KRIA 3B9CA 5FREA 5HCAA 1YO8A 3WG3A 2A7AA 3AX4A 2YMZA 4P9WA 3VKFC 3B01A 3MW4A 3OYWB 1CN1A 3O12A 4ATFA 2TEPA 4TYSA 4I30A 2JD4A 1WLDA 2DTYA 4ISRA 1V6IA 1N47A 2A70A 3AP4A 4LBLA 1QGLA 2AH2A 1G9AA 1R1ZA 3ZVXA 4WV8A 3RSJA 3IMNA 1XQNA 2W08A 4YW2A 3ZXEA 2DUQA 5T5OA 2DVFA 2GNTA 4FPLA 3WNXA 1UAIA 1QNWA 1WBFA 1YRZA 2PHFA 2UWCA 4YM0A 1LESA 1LHOA 2GMPA 2JDZA 5IT6A 3M3OA 4XTPA 4Y20A 2ZGQA 3D5OA 3D6EA 1VIWB 1MS5A 2DU1A 2C5DA 5JLVA 1KJRA 5DUXA 3UJOA 1MS3A 1G9BA 3Q9OA 1B09A 5KXBA 2GNDA 4XBLA 1JOJA 2R1DA 4ATEA 3IN9A 1G9FA 2D6LX 2NZ9A 3QCWA 4GXLA 1CPNA 1N1TA 3I4IA 1QU0A 1A8DA 4BLIA 1CESA 4DRRA 1UMZA 2R1BA 5JOWA 5F5QA 1N1VA 1W6QB 4Z8BA 4RA0A 2VY0A 4JC1A 1AZDA 2DV9A 2NYYA 3OPZA 3WOGA 3JU9A 3WG2A 1OQ1A 4YM2A 1HLCA 1GBGA 1MS9A 4U36A 4RL7A 4LBNA 1QDCA 1MS8A 1SLIA 2Q5TA 1UKGA 2A6WA 3POWA 4XJZA 4XXPA 5GM0A 5HCBA 4XJAA 3SISA 4R9DA 1GZCA 3OBTA 4OZXA 3SITA 4YZ2A 2VXRA 4M3CF 3WVJA 3A4UA 2DWRA 2WT1A 4Q1RA 5T5JA 4AVSA 2D6OX 2VW2A 1UPSA 1YYNA 2EXHA 1W6MA 3A0KA 4Y22A 4AYUA 3D4KA 4CTEA 5E88A 1DQ2A 1MACA 1YIFA 1LJ7A 4XJWA 1DQ6A 1ULFA 2CL2A 3IPVA 3HR9A 3M3CA 2CWSA 3ZSMA 3USUB 4DFSA 3MPPG 3WHUA 3PMEA 2D6MA 3RQ0A 5KXCA 2XB6C 4BMEA 2P3JA 3W59A 5L73A 5T50A 2A3XA 4Y1YA 1KQRA 5E89A 2OW4A 3M3QA 4P9XA 5KXDA 1G8WA 2GN7A 2EXJA 4LBQD 3ILNA 4UW4A 3FUQA 5KXEA 1LHVA 1EPWA 4Y1ZA 3WCSA 5AVAA 4K21A 4FQ4A 2A6ZA 4FPOB 5EWSA 3FFZA 3AP7A 4Y1XA 2ZHNA 4IQPA 1DLLA 4TZDA 2PELA 4W65A 3ZPYA 1DFQA 1Z78A 2P2KA 3N7LA 4BPZA 3MW2A 2R0FA 4YM1A 1HQWA 2D6KA 4WVWA 4HL0A 4YZ5A 4CRQA 2PHUA 1JUIA 2E7QA 3AJYA 3AP6A 3ZXLA 1LOBA 4FP3A 2D6NA 4LBQA 1C1FA 2A5ZA 1WLWA 2ES3A 2YXSA 3C2UA 5CB7A 1DHKB 5JOXA 3RG0A 4ISQA 1X50A 4FOQA 5FRAA 3ZYRA 4L8QA 1IS6A 4FPKA 1U0AA 3FUOA 4LBJA 1DQ1A 1W6OA 3AXDA 3LSDA 2DVBA 1WD3A 4H55A 4XMIA 1Q8VA 3T1LA 1ENRA 4CZSA 1IKQA 5GZDA 1JN2P 3WZ1A 5GLVA 3WDYA 2WQZC 3SH3A 1FV3A 1AF9A 3HN1A 5H9RA 1SCSA 2ZGTA 4BOWA 4UW5A 3BOPA 5DZFA 4YZ3A 1SBFA 1Z0HA 1KJLA 1C57A 2SLIA 4YG3A 4DPNA 3NV2A 1JW6A 1H9PA 1LTEA 1LGNA 2NMOA 1GLHA 5CAZA 1DQ5A 5IK5A 1BXHA 4FPEA 1G7YA 1BYHA 1GV9A 4GWNA 1H30A 2DUPA 4LBOA 4XTMA 3UL2A 3VKLA 3AXEA 3L2YA 1IS5A 1MR5A 1DYKA 1C1LA 2V5YA 2AR6A 3BODA 1W6PB 1JXNA 5IK4A 4PQ9A 2DU0A 5T55A 3OYWA 2FHRA 2EALA 3U4XA 2CYFA 3PVNA 5GLTA 4YZ1A 2EAKA 4M3CE 4UW3A 4XIKA 1UZYA 2D3SA 1QOSA 3N35A 1WD4A 5GZFA 3POYA 5HCFA 1ULGA 2LALA 4GA9A 4AWDA 1IOAA 2JE7A 1S0JA 4FPCA 4R9CA 3OGGA 1FNYA 4YGCA 4WVVA 1V6KA 4BQ1A 5EYXA 2R0HA 2AENA 4Q8LA 1MVEA 5T5LA 4M01A 3AJZA 3N7KA 4SLIA 1S1AA 1KDMA 3N7MA 2A3YA 1NXD1 2ERFA 2GN3A 1N3QA 2FMDA 4YFWA 1I1EA 3SH5A 3T2TA 4HANA 2A3WA 3FLRA 3OY8B 4Q8KA 1QOTA 2VW0A 1LOFC 2AGSA 3JUUA 2EIGA 4R9AA 2ZZJA 1GICA 2PHXA 4JCKA 1V00A 4XJUA 4YZ4A 2P37A 4DQAA 1O4ZA 1JBCA 3V0BA 2A71A 3R4UA 1GZWB 3AYEA 3IM0A 3IKWA 4FPJA 3AYAA 1DQ4A 2ZGRA 1KITA 3GALA 1GSLA 2NN8A 5DXDA 1W6QA 4M00A 2ZHLA 1W6NB 2W68A 2ZGLA 1D2SA 2WJSA 3AZZA 1W0OA 2JJ6A 1BZWA 1VALA 2VW1A 5IUQA 2DVAA 1MZ5A 1RIRA 3AFKA 3BTAA 1BJQA 3FLTA 3NWKA 1V6LA 3ILFA 2ZGNA 1KDKA 1VAVA 3ZSJA 1DZQA 1LEMA 2P34A 4Q27A 1WBLA 4M3CA 4PBPA 4XMAA 1F9KA 1G9CA 4FOVA 4XYXA 5GLWA 1LU2A 5F9TA 2OUHA 3WCRA 2AYHA 4YW1A 3V64A 1BKZA 3APBA 4C1WA 2ZGPA 1LOGA 2ZACA 3N3HA 3UJQA 1MS1A 2R16A 3I8TA 3V0AB 2UURA 2A75A 1IS3A 4XE9A 1D0HA 3O0XA 4FPHA 1ULEA 1UN1A 3USUA 4F83A 4YFZA 4FP2A 4AGVA 1SLAA 2RHPA 3INAA 2CNAA 2PHWA 4JRAA 2DURA 4FVVA 2W39A 4YW5A 3ZXJA 3VKMA 1S0CA 3OBRA 5H9PA 2BQPA 3ZXKA 5CNAA 2ZGOA 1WW4A 2D3RA 1ULCA 2W52A 1RINA 2ZA9A 3B3QE 5GZGA 1PZ7A 2GMEA 1LOFA 1AVBA 1QMJA 3AYCA 3O0VA 3VUOA 1CJPA 1WCSA 4YG6A 1SLCA 1ZA4A 4Q26A 1Q56A 3TB0A 3O5SA 2ZMKA 5JOYA 1DGLA 1S0DA 1FV2A 2OUJA 2VU9A 2ZGUA 1QKQA 3WDUA 2E53A 4XILA 5GZEA 3V0AA 2CTVA 4LBMA 1WLCA 3SNMA 1Q8OA 1YI7A 2NM1A 2ZAAA 3WDXA 1JYIA 1UL9A 1VAMA 3N36A 2UU8A 2YZ4A 4C1XA 1V6OA 4BLJA 2V73A 2ENRA 4XDQA 2CY6A 1LGCA 4MYEA 1QDOA 4YLZA 2GALA 4FQZA 5T52A 3VKOA 1UZZA 1S0IA 2AREA 2CWMA 1LULA 1YXWA 3MW3A 1V6MA 2P3KA 1WW6A 2AUYA 1I3HA 2ZMLA 1GKBA 3AZXA 3M2MA 1G86A 4K20A 2ZHKA 3HMYA 1OKQA 5H9QA 1ONAA 1Y7BA 1NLSA 1LCLA 4ZKTB 1SACA 3WUDA 1GYKA 4Q2FA 1LENA 1Q8PA 2D44A 4XXAA 3TAYA 3NV1A 2ZGSA 1W0PA 5JDBA 1AX2A 1AX1A 3R4SA 3ATGA 2D43A 4XHBA 5DUVA 5DG2A 1GNHA 1MZ6A 2C9AA 3RMYA 3ZYPA 2SBAA 2DYCA 2ZBJA 2ZMNA 4Q1PA 3MEPA 2UWBA 3B69A 2D3PA 2NMNA 2GNMA 4FPYA 5DUWA 1LHWA 4GKXA 1RITA 4XJ8A 1LU1A 1Q8SA 3M3EA 3ZSLA 2WSVA 2YV8A 1W6PA 1CVNA 2VUAA 4AGRA 1LOCA 3LSEA 3WG4A 1SBDA 3ILRA 1FNZA 2DVDA 3A0NA 3WDTA 1HDKA 5CBLA 1CR7A 1QF3A 4YGEA 2ZHMA 3W58A 1H9WA 4R9BA 1CONA 3LCPA 3RS6A 3SH4A 3AK0A 4Y20B 4BMBA 2Z42A 1FAYA 1F5FA 4P9YA 3AZWA 1Q8QA 2JE9A 5JOZA 1GNZA 1MS0A 1PZ8A 2WSUA 5DZEA 2EXKA 4XJ9A 5CA6A 1LEDA 1GANA 1ZM1A 3B00A 4FPFA 2ARXA 4P14A 1TEIA 2JKBA 1WW7A 4K1ZA 1S0EA 1LHUA 1FYUA 1BQPA 3OY8A 3VV1A 3WDWA 2PHTA 2GDFA 2UWAA 5LK5A 2WT2A 1N1YA 1QNYA 4YGBA 1VLNA 1MS4A 3V0BB 1N3OA 4BM8A 1SFYA 2EF6A 1ENSA 3V65A 3UK9A 2EXIA 1DQ0A 4U2AA 1GZWA 1V6NA 4ITCA 4Y24A 4PCRA 2WLQA 4ZXKA 1GZ9A 1W6NA 1SLLA 3FBYA 2DVGA 4GKYA 4XIOA 5SV8A 4ASMB 3RMXA 2OVUA 1N1SA 4PBOA 4Y22B 1W6MB 2A6YA 1URXA 4PF5A 4AVTA 4YW4A 3QLQA 4Y1UA 3KM5A 3IPVB 2D7FA 1FX5A 1SBEA 3CNAA 5T54A 4M3CB 2YY1A 3DGTA 2PHRA 3VKNA 5JMCA 5T5PA 5DZGA 5H9SA 3AP5A 5IK8A 4GWMA 4LBKA 1ULDA 1LOAA 1WUVA 4DS0A 5BYNA 1S0GA 2R49A
chains in the Genus database with same CATH superfamily
1UU4A 4QPYA 4DIQA 1K12A 1NCRB 2GU9A 2QZ3A 2XJRA 1ENQA 1HQLA 2G1MA 3FHIB 4FQZA 4M0HA 4UW6A 4HPKB 4UFJA 3ZFEA 3KQRA 4LKFA 3NNFA 1AJKA 1LOEA 5IK7A 1PO12 1C4RA 1MEC1 4IEWA 1LGBA 1AXYA 3ES1A 5E1RA 2OYZA 1JYNA 1QWRA 2DCZA 3KHCA 1W8WA 4Q4V2 5FZCA 4CEYC 2CSGA 1UNBA 2LTNA 3JB4C 4NO4A 4BHPA 4WZFA 3N7JA 3RRDA 2ZABA 3KCYA 4XBNA 4LHKA 4LEJA 2A6VA 1FATA 5D21A 5KHHA 4IL7A 2H0BA 2BJSA 1BBT3 1RVF2 4QDSA 2DUOA 4EN0A 2RM23 3AZYA 1AX0A 3CJIB 4LBQB 1XNBA 1UX6A 2YROA 1VMJA 3T30A 4AVVA 1UOFA 2Y6LA 4UAPA 5LRRA 1LB2A 2GNBA 5FUNA 2YGMA 1RVF1 1SLBA 1XYOA 3FL7A 3MV11 3ETPA 4AVCA 1POQA 1W6OB 2QJVA 3OJBA 2P3IA 3BCWA 1R083 1IG3A 2WT0A 4QU1A 4CP1A 4QQLA 2RMU3 3EB7A 4JDOA 2J1TA 3J7HA 2WNUB 4XZPA 3QH6A 3JBG3 1UOBA 3RYKA 5K9YA 2WABA 3B9IA 4PLNA 5JVVA 1NE4A 3VZMA 3LOBA 3O1UA 5C3PA 1W2UA 3POSA 3WLUA 2JG8C 3PVEA 4XUNA 3RWNA 5BNOA 1H8TB 5FZOB 2VZSA 1FMD1 4P00B 5LW9A 2WWJA 5E8AA 4EWEA 1RUC1 2PAEA 2ZAHA 2VZVA 4YVWC 3D0SA 1MVQA 2VH9A 1F4HA 3GYDA 1F4AA 5J7MA 1S55A 4IEOA 3QH7A 4XAEA 2FZ2A 3B94A 2A7AA 4HN0A 4P9WA 4CU8A 2C24A 1CN1A 5CFDB 4PLOA 3E6BA 1HIXA 4FAGA 4A3XA 1WCDJ 1Y4WA 1YJLA 3VZKA 4B29A 3H1WA 3I97A 3VHRA 2DFBA 3AP4A 4CEYA 4XFGA 4CXXA 2AH2A 3WXPA 2RDQA 4IV3B 4WV8A 4QXHA 3RSJA 1XQNA 2W08A 3NW4A 2RS52 4O9EA 5IFPA 2OZJA 2DVFA 3WNXA 1HB4A 4NPMA 2O0OA 1UF2C 3PUQA 4META 4PIYA 5DABA 4HK9A 5L7OB 1OH3A 1YRZA 2PHFA 3HT1A 3NMBA 3K4DA 1K3IA 4XETA 5A80A 4COVA 3M3OA 1H2NA 3GM8A 4JGZB 4KL1A 1UWWA 2HWD1 5DUXA 4Z82A 3BYWA 2PHLA 4IEUA 1B09A 2HWF2 2Y60A 4XABA 1CD3G 4Z07A 1JOJA 4AI1A 4EN9B 3JZVA 3BTXA 5FO8B 2X29A 5IVCA 2NZ9A 4GXLA 5A3UA 1N1TA 2PLV3 2XLFA 1RXGA 3NAPA 4N9IA 4OMCA 4PQQA 1D7PM 2JG8A 2VY0A 5FKBA 4EJRA 5IW0A 1AZDA 5JSPA 3WOGA 1IPKA 5A6XA 1JYTA 4YM2A 4QX5A 5F32A 2PHDA 4CCKA 5T3NA 2C6SA 4JVAA 2Q5TA 1EAH3 1H1AA 2A6WA 2MEV2 3POWA 2XVLA 4XJZA 4XXPA 3SISA 1OT5A 4YZ2A 4BK4A 1AL21 2VXRA 4GMP0 4NN0A 5T5JA 1AR71 2D6OX 4LA2A 1XB9A 3MO4A 4B4QA 1ZZ7A 3N9LA 1S4CA 4JKLA 4N43B 1W8TA 4QB2A 1DQ2A 3O1PA 1LJ7A 2LUWA 1DQ6A 1V0AA 2WDBA 4XJWA 3IPVA 1NA1B 3KD4A 1TMF3 2CWSA 5TSWA 1HN0A 3AMQA 4AK3A 4S2HA 3WHUA 2BTVC 2XKPA 2GP5A 2D6MA 1GOHA 2WQ4A 3ZDSA 1NG0A 5FY1A 4MZUA 3GF6A 3I3MA 2A3XA 5FYUA 3DEMA 3MFAA 4R8HA 1H0BA 1IG0A 1OQEA 3J8F2 5G04L 1ODNA 2JXAA 3ILNA 1JZ2A 3FUQA 4Y1ZA 2BNNA 2D5FA 1VR3A 3VBFA 4FPOB 3GZTB 1XU2A 1UY2A 2OXBA 4Y1XA 4IQPA 5KHIA 3JCIA 2P2KA 3GZEA 1ZZCA 3N7LA 3ZN6B 3MW2A 4EN6B 2E26A 2X10A 4FFHA 5DAPA 1HQWA 1FOD2 2JX9A 2D6KA 2VMHA 4A6OA 1TG7A 4HKLA 2F4LA 5CKQA 5FY7A 3SEPA 1T6BX 1O8SA 2XHNA 2OT7A 3H1YA 2Y26A 5ANNA 3HBKA 4PI0A 2YXSA 5CB7A 1DHKB 5JOXA 1RUJ1 5FY8A 3O1SA 3ZR6A 2VMIA 1RVF3 4FOQA 5FK8A 4L8QA 4QPGC 1DQ1A 1FT9A 3AXDA 1WMFA 3LSDA 4HETA 4S2FA 1U5IA 4XMIA 3T1LA 1ENRA 4CZSA 2WAAA 5GZDA 2E31A 4PI2A 3WZ1A 3VHNA 2TUNA 4CDXC 4E8DA 1AF9A 5LASA 2GZWA 4L9BA 4MV2A 5FIXA 1AYM2 3TEWA 1YUDA 2VQUA 1JS9A 2B42B 2Y0IA 1LTEA 4IV1C 3W20A 3ZR5A 4LIVA 5FJKA 1FMD3 5AVPA 5A7PA 4H7LA 3KV9A 4CUGA 5B2GB 5JZGC 1RUC3 1ND2B 1STMA 4I3GA 3ZSEA 4QXCA 4LO4B 1FI2A 3UL2A 5K8SA 2PQSA 4GZ9A 4PHZA 4OI1A 1IZ3A 4J1XA 1XNTA 2AR6A 4NWWA 3TYJA 1O91A 1JXNA 3NL1A 4O65A 3GCWA 5BXXA 5BNNB 5IK4A 1KEXA 2WO2A 3OYWA 3DL3A 2XWJB 3AB0A 2EALA 4UBGA 3PVNA 1W0NA 4HFSA 4QM9A 5JR2A 3U4XA 4UW3A 3FHAA 3OGJA 4P9JA 3ES4A 5APAA 2Z79A 1QOSA 5LZ6A 3E5XA 2Y34A 2Z5WA 1UY0A 3PTYA 4K9SA 4D3WA 4AWDA 2FMYA 1OC1A 2BUKA 3GJAA 1S0JA 3QBQA 4W6XA 3OGGA 4XFFA 4YGCA 5FV3A 1QXJA 2VTXA 4WVVA 3VBOC 1IQAA 1V6KA 3THTA 4CCJA 2AENA 1PNFA 2EVXA 1MVEA 3HNMA 1O3QA 2YC2A 3AJZA 3S0MA 3N7KA 1REEA 4JZRA 4MGSA 3RNSA 1O8PA 1KDMA 4CPBD 2WFF1 1OLMA 1N3QA 2FMDA 2WAOA 3VHPA 1RUI2 3T2TA 2BGCA 2P6CA 2C9KA 2AC1A 4IEZA 2IXKA 3FLRA 1QOTA 1UOGA 2DCYA 2HWD3 4QPGA 5C3SA 3K2OA 2V09A 3OSDA 1F35A 1YFUA 1RUI1 2PHXA 3HJRA 3KB5A 3ZYHA 2B9UA 4XJUA 4CDXA 4YZ4A 1DGWX 1SEFA 3NAPB 4FPJA 1QHDA 3EMRA 3GALA 4CDUB 4RSUA 3N4MA 3EYPA 2XMLA 4IV1A 1PHMA 4NIAA 2ZPXA 4D0QA 3ZPOA 1W8UA 2ET1A 2DVAA 4P9GA 1UU6A 1W8HA 2OQ7A 2WZR2 3FLTA 1UZWA 2C4XA 3ILFA 4B1MA 1KDKA 2YC4A 2VBPA 4LITA 1DZQA 4RFRB 4RGAA 2F4PA 2Q30A 1AL23 4GJYA 1QIQA 1H6XA 1IGOA 2D40A 4FOVA 4IE0A 4XYXA 5IVYA 1LU2A 1AR73 2I45A 2AYHA 1UU5A 1Z7S2 2WLPA 3J7LA 3APBA 3K46A 4YW1A 2ZGPA 1XNKA 5JWPA 4N53A 1PGL2 2NQYA 3LEIA 4RFT0 3V0AB 2FDFA 2HH9A 2A75A 4FXKB 4XE9A 5A7NA 4CCLA 3O0XA 3NRUA 3KLSA 4Y5SA 2QUOA 3USUA 5ERLA 1JODA 4B3NA 2X5IB 1JU3A 1NUKA 1GOGA 2WUHA 2XQXA 3KCCA 3MIBA 4JRAA 4NJ4A 3ITQA 4A7KA 3T08A 3Q8EA 1R092 1RL3A 3ZYJB 3U75A 3ZXJA 1LNSA 1VBA3 5EJZB 2WBKA 5H9PA 4WM7C 4CCOA 2AEYA 5FP9A 4Y5Z0 4V2VA 5FUPA 5A3LA 2GMEA 3VBUB 4CUCA 3VUOA 1EUTA 2VZPA 3TB0A 5AFBA 4BE3A 4IEXA 1OFNA 1M4WA 2ZMKA 1D4VB 1IQDC 3EO6A 3IDBB 2OUJA 2ZGUA 3QD6A 3VGIA 3T4HB 5CG8A 4XILA 1OF4A 5BNQA 3ZMOA 3POJA 2H0VA 3TRSB 4DMIA 2A73B 4F7ZA 4DNYA 3BIEA 1OHFA 4MGTA 1Q8OA 2PYTA 4A41A 1VAMA 5JXHA 2YZ4A 1NCQB 5A1FA 1RUJ3 4C1XA 1V6OA 4URAA 3LFMA 2GC3A 4R4XA 3SHRA 3RZLA 1OOPC 4AL9A 4COWA 2W87A 4GH4B 4AQSA 3OCPA 1UZZA 3N9OA 2AREA 3I2DA 3V56A 1J3PA 1MQTB 1WW6A 4BA6A 4MHRA 1GKBA 2ORXA 1FPN2 5FYVA 4CDWC 1ONAA 2XJUA 1NLSA 4CP2A 2VPVA 2ZEXA 3C7OA 3MF9A 5LBBA 4QKFA 4RR3B 5FZBA 4HVOA 1XU1A 4D6RA 2VQTA 4B7EA 5DMYA 1RUD2 2MPFA 4Q4Y2 4ZS3A 5IVVA 1HN1A 4MXWA 1AX1A 2ZX2A 4BISA 4I0BA 3ATGA 4AEJA 3JD71 2X53S 5SV5A 1PVC1 2FQPA 3GDBA 1MZ6A 4RHV2 2C9AA 1JOBA 3ZYPA 4ZXEA 2SBAA 4BQ5A 2ZBJA 1ND3B 5HPOA 2FDKA 5KWRA 4DXSA 2VVDA 3WW3A 4R4ZA 2GNMA 3RZMA 1ENXA 4DY3A 3BN6A 4XJ8A 1OVSA 1RITA 2CAVA 2F17A 3AMHA 3IDCB 3KHBA 3M3EA 2WSVA 3N9QA 1DGRA 2W0XA 4FO9A 4WM7A 4DUXA 4AGGA 1IPSA 4AGRA 3LSEA 1O59A 3ZFGA 3LEKA 1SBDA 3UNPA 3MIHA 3WNOA 3VL8A 2ZX0A 4AQ6A 2JB4A 3SH4A 2HKXA 2LROA 4XUOA 1F5FA 1H6YA 4DINB 3AZWA 1GWLA 2TNFA 3FX3A 4Q0PA 1PMIA 2R30A 3O1RA 1PK6C 1XOYA 2G9GA 2EXKA 2WS91 3S5QA 1SHWB 5FOBB 2WFF3 5ISLA 1ZM1A 2ARXA 5FMDA 2IFWA 4P14A 3WEZA 5F1RA 1WW7A 3P6BA 4AAPA 1OOPA 2AEZA 2W1WA 1AR92 3IBMA 1Y43B 4HN1A 5C7GA 1ST8A 5HXMA 2UY8A 3U07A 2UWAA 2ORZA 4DO0A 1A8MA 2D97A 4YGBA 1VLNA 1MS4A 4HMZA 4OI4A 4UOJA 5C8CB 4JTNA 4P9LA 4CDWA 1H2KA 1SFYA 3AFGA 3KQ4B 5F5CA 3THCA 2R041 2X8KA 3BU7A 1K5MC 1L7QA 3Q8AA 4ZXKA 4BK5A 3GHMA 1X8EA 4D94A 3GZUC 4GKYA 3T0DA 2YBPA 1CAUB 1N1SA 5ABJB 3CBNA 3ZDVA 4Y22B 2A6YA 2QQLA 2XKOA 3NNJA 2HLEA 1J84A 4Y1UA 2QQOA 4MGYE 1FX5A 4QPIA 2Q8CA 2GAUA 3VKNA 5JMCA 4RS5C 2VCCA 3WW1A 3NKTA 5H9SA 3MUY1 3SCHA 1X8MA 2IZWA 5DPNA 5FY0A 5FZ1A 1BBT2 4X6QB 4D69A 2RM22 1I6XA 1QXPA 2WO3A 3H0OA 4AQ2A 4FOYA 4G9SB 4K1YA 1VRBA 1D2QA 2WNEA 2W95A 2YFZA 3OOXA 2ZGMA 2GC1A 3LDKA 4DEQA 1DDLA 4FPGA 3ZFFA 5FZ8A 5A3PA 1PK6A 3P3NA 2I2SA 3WP3A 3UGHA 5D2AA 5FBJA 1R082 3WDVA 4TWTA 1DCSA 4PLMA 2RMU2 5L9RA 3KF3A 4YW3A 1GMMA 4I09A 3MBWA 3HEIA 3VDDA 4TSVA 3JBG2 3P3PA 1CIWA 3WNKA 2DTWA 3E5QA 1UXZA 1LECA 2Q1FA 1APNA 2G4IA 3BIWE 4Y4RA 5DUUA 3ENRA 5FYYA 1JZ3A 2XH6A 4OZOA 5F3IA 1VB2A 3O0WA 4IV3C 3EQEA 2W92A 1PZ9A 4XOGA 1JHNA 2R061 4RGKA 1XPWA 5KHGA 4KWLA 3IDAA 5FLIA 2OKXA 3VD7A 3C7FA 1K5MA 3SLIA 4XHXA 1ZRCA 1V6JA 3R05A 2E33A 5L36A 3AZVA 1G9DA 2B39A 2HYKA 4CSWA 1XBFA 3JQWA 5F39A 2HBUA 4FFIA 3NV3A 4WM8A 5HXVA 4ET7A 1KGYA 1GWMA 1UYXA 4L11A 5F7UA 2Y0OA 2LS6A 4UXAA 3WF0A 3R0RA 3NVCA 1R64A 3WG1A 4LE3A 5GJ6A 3WP4A 3CZJA 2VUCA 2VZOA 4XFBA 5GLUA 3RGBA 3ROUA 1UOJA 4RS5A 5CFCB 2P5BA 2HWE1 4COUA 3ABZA 4JKKA 1QOOA 4HK8A 1KS4A 4I3PA 5EZWA 4QMAA 5B4XA 1ASJ3 1J1LA 3AVRA 4GMP1 1ZBE1 3D0JA 2FCTA 5EFUA 5FQ0A 3IIAA 2OZ6A 3SXWA 5IAXA 3OBAA 5C6CA 3D8CA 3M4FA 2K0GA 4ZS2A 3VKFC 3JD73 3B01A 3P5BA 4XCBA 3NJXA 1PVC3 1UMHA 4XQWA 4ATFA 3H8UA 2FDHA 4TYSA 3CJXA 2JD4A 2DTYA 4QX0A 1VBE1 4WBBA 5LEJA 5LY1A 3BKZA 4XAAA 3RZKA 4YVSC 2P3YA 2CDPA 2IVIB 3CMGA 5FMBA 3WP5A 1ZZ6A 1XE7A 1RMU1 3VBHA 1FXZA 4IGQA 3SKVA 3PU3A 1PM7A 3ZFGB 3BGAA 2GNTA 4FPLA 2ZJCA 3DXTA 2BWCA 3HBZA 1WBFA 4B8EA 2UWCA 3ECQA 3VBSB 1GP6A 2GMPA 3C7GA 2VUDA 2RE9A 4AAXA 1TNRA 1NX9A 3WF4A 4W4ZA 2ZGQA 2RJ2A 3D5OA 3D6EA 3H1MA 3H42B 1MS5A 2DU1A 2XJQA 4I0WB 1NY72 4KQ7A 3UJOA 3P1IA 5JLVA 4ZU5A 3BI3A 1S2KA 4XUPA 2Y6KA 1JZ6A 4D6QA 3OGRA 4DOUA 1T2XA 2FD8A 5FPVA 1EAH2 2IXCA 2WS93 3IN9A 5D8AB 3SEEA 2D6LX 5JSOA 5KR7A 1XRUA 3QCWA 4FCAA 5I0UA 1VBB3 3GBWA 4K8FA 4O9GA 1CESA 1WMEA 5FYHA 4RA0A 3IAPA 5FXXA 5A7WA 3JU9A 1VP6A 4HBNA 2ZCWA 4E27A 3TNPB 1CAVB 5IATA 1BEV1 4U36A 1BCXA 1D0GA 1TMF2 2GC0A 4LBNA 1QDCA 5C9AB 5HV0A 3PU8A 2R043 2HEVF 2ZKLA 5KBFA 1H4HA 3ZMNA 1GWKA 3OEBA 4XJAA 5HCBA 1HB2A 4R9DA 3U78A 2FZ1A 4BYYA 4OZXA 3SITA 1TMF1 5F3CA 1SPPA 3WQ0A 3A4UA 3ZX7A 2WT1A 5FP3A 3CKHA 1UIJA 5FZMA 3HAGA 2EXHA 2XJTA 3PIJA 4AYUA 3WW2A 3C7HA 3MLLA 1MACA 4QPIB 4MGKE 2O8OA 1HV1A 1ULFA 2CL2A 2B8MA 2L9LA 2UYAA 3MHZA 4YVSA 1KD7A 3HR9A 4HSJA 1RUG1 1I5ZA 2BP6A 3ZSMA 3MPPG 4DFSA 4EV0A 1W03A 4HONA 4LHNA 4NRPA 4QB6A 5E6HA 4OULA 1DG6A 4BMEA 2P3JA 2DFCA 4XPVA 4EE2A 5T50A 1KQRA 1XNAA 2OW4A 3M3QA 3CEWA 4P9XA 5C70A 5ACA1 4QGNA 3DKWA 2J1SA 5FMOL 4LBQD 1WKYA 2J22A 1LHVA 1XE0A 1ZZ9A 2ZXQA 5KXEA 1ND2C 3ZFFB 5HV4A 2G9ZA 4FQ4A 3RZGA 5EWSA 2E7AA 4UYBA 3I2OA 5FLHA 1TQ5A 2PELA 4P02B 4BPZA 5A7SA 4QGMA 4MADA 2JDUA 3T09A 4CRQA 2XUMA 1E57A 1W06A 3J26N 2E7QA 4ZONA 3SCFA 2I74A 1OPMA 1POV0 4E4ZA 1ALYA 1OI6A 4FP3A 2D6NA 1W9YA 3C2UA 4KNCA 2P1BA 3LEMA 3RG0A 4AEDA 1UZVA 1JZ5A 1CZVA 5FRAA 1E5IA 4FPKA 1FMD2 5FO7B 2DVBA 2R063 3ACFA 1XXNA 3UESA 1JN2P 1RUC2 1JMUB 2RDNA 5I0DA 3LE0A 3LFIA 3LA7A 5GLVA 3WY6A 1K42A 5H9RA 5K0UB 4BOWA 4UW5A 3A23A 2XOMA 1SBFA 5FO9B 1W39A 1RYYA 2SLIA 3AKRA 4KGQA 4HVQA 4R52A 4YG3A 4DPNA 3WNNA 2FCUA 3RVHA 1SDDB 4TN7A 4PDWC 2GH8A 2PN5A 1DQ5A 3K51A 4BIOA 1BXHA 1NQDA 1EUUA 3U0ZA 1HRV3 1C5IA 3MPBA 1ZRDA 1BYHA 2HWE3 4GWNA 4OCTA 1GUIA 5FZ0A 4GMP3 2VMEA 3AXEA 1ZBE3 5I0SA 4A6SA 2BGOA 3K4ZA 2VQAA 1DYKA 2OPKA 5IHRA 4FAHA 5LBEA 3BODA 3LB9A 1U5XA 5JI9A 2VOXA 1ZRRA 2FHRA 3KVBA 1DF0A 1RUNA 5DN2A 4JRLA 2OIIA 1VBE3 2EAKA 2HWD2 4M3CE 4OHZA 4XIKA 4AHYA 3AMNA 4YZ1A 5BNPC 1UZYA 1CGPA 2D3SA 2WNVC 3N35A 2B5HA 5GZFA 5C4WB 4JDMA 5C3QA 4UF0A 1RMU3 1IOAA 5J48A 4Q4W1 5EYXA 2R0HA 4NIIA 2ZEWA 3S30A 4A45A 1F15A 1Y3TA 4SLIA 2VE1A 5A33A 2QE3A 3IZOA 2EIDA 2IXIA 5D1IA 3VBRC 1YQ5A 1I1EA 4WVMB 3SH5A 3RZHA 4QHZA 3OY8B 4Q8KA 5JPMB 1YLLA 2VW0A 4KBZA 1LOFC 4A3ZA 3JUUA 3OD4A 3POFA 3K4AA 2WWSA 3LF7A 3OG2A 2YBSA 4JCKA 1V00A 3KWVA 3ALQA 1O7FA 5A7OA 1O4ZA 3E6DA 4C0HA 4DQAA 4OQ8A 4LLFA 4UFLA 4CPBA 1E5SA 3NKGA 1AL22 3PUIA 4Z1VA 2XLGA 2ZGRA 1KITA 4YVWA 3TEXA 1RC6A 3I2JA 1AR72 1GSLA 1VMHA 5DXDA 5F5IA 1W6QA 4QXBA 2QQPA 4OUSA 4PDWA 1RXFA 1W6NB 2VCAA 2ZGLA 3L2HA 1D2SA 5A7WB 4JGYC 4EN7B 1W0OA 3KS7A 1BZWA 1C28A 1XYPA 4CDQB 3EXUA 2RJLA 3GHNA 1RIRA 1BEV3 3AFKA 3POEA 5J96B 1ZVFA 3HQXA 3H7JA 4KWUA 5JCTA 1NLRA 3O14A 3H8RA 4XW3A 4OMDA 2ZGNA 4QB1A 1WZXA 3LIGA 3I7DA 1LEMA 2NLRA 2BERA 3H7YA 4Q27A 2FDJA 4M3CA 4HKOA 1QJFA 2H6CA 4XUTA 5FYSA 1M06G 2KA3A 1VBA2 2NPIA 5AC93 5F9TA 2OUHA 2YC0A 2LRPA 4HZFA 4A42A 1BKZA 5LBFA 3CDZB 2ZACA 3PL0A 3MYXA 1J3RA 1UYZA 3LKJA 3LPGA 1AUYA 2B46X 3UKVA 3ZXAC 5BNPA 4OQ9A 2R7EB 2UURA 2VGDA 1VBA1 2WNVA 5KHJA 1IS3A 4RQPC 3ZFEB 1J59A 1D0HA 3B5LB 4EYUA 3ME2A 1ULEA 1RUG3 3FBMA 4AGVA 1XC6A 2RHPA 3INAA 1DP0A 2CNAA 5FY9A 3K77A 4IW3A 4FVVA 1Q43A 3VZNA 4YW5A 3U11A 3VBRA 2BQPA 2RS33 3HVDA 5ACA3 1US2A 3MIEA 1RUJ2 2WZ8A 5GZGA 3B3QE 4FFFA 1LOFA 2JDKA 1QMJA 3IAQA 5FZ6A 5FZ4A 4CXYA 1SLCA 5IJRA 4BXFA 4N7IA 4OHYA 4FT8A 1D4M1 3KCXA 4GULA 5ANQA 5JOYA 1QKQA 1VAKA 2CV6A 4XDPA 3FFQA 4LO7A 4K6BA 4LBMA 5FZKA 4I0AA 1OLME 3SNMA 2CU5A 2YBKA 2ZAAA 1EPZA 3NJVA 4GJZA 3WDXA 4AEDB 3H3LA 1OD3A 2JG9C 1YIPA 2RR11 1BLZA 3N36A 4JGYA 1XYNA 2GP3A 4XDQA 3BOWA 4D7SA 3BPSA 1LGCA 1RUH1 1O6UA 1QJX1 1VMFA 5FPZA 5T52A 2WN2A 2WINB 4E2QA 3HPNA 4DY5A 1US3A 1YXWA 3FWEA 1V6MA 2RS12 2P3KA 1BMV1 5BNOB 3M2MA 1HQNA 3SCGA 4LNVA 4GB33 3HMYA 1OKQA 1KXGA 5H9QA 3FE5A 1LCLA 3BB6A 5FPLA 3H3UA 2YDEA 2RS11 3WUDA 1OA2A 2ILMA 2VOWA 4Q2FA 1GQPA 1Q8PA 4TLGA 2D44A 2JB8A 4LJHA 3NV1A 2YB7A 3ACLA 5FJHA 5A1LA 4L97A 2BEOA 4RQPA 1TZOA 4CCEA 2K2SA 1GNHA 2YGLA 2DYCA 2KR2A 4XCAA 5J98B 1QQP1 3MEPA 2UWBA 4CEYB 3B69A 5DAWA 2D3PA 4F3JA 5A32A 2NMNA 4FPYA 5LB6A 5F6KA 4IETA 1Q8SA 1UQXA 3ZSLA 1W6PA 2VUAA 1ZRFA 4RYDA 2WFF2 3UV9A 4NAMA 1LOCA 3ZKUA 2VNVA 4CYDA 2HWB1 3WW4A 1FNZA 3A0NA 3WDTA 3IMMA 1HDKA 2BBVA 2VR4A 1QF3A 4YGEA 3U4SA 1WMDA 2VOKA 3OUJA 4JQRA 4COYA 4MG2A 1CONA 4QM8A 2CGNA 3A7QA 4BMBA 5CG9A 5FPAA 2XBO1 2ZX1A 4JHZA 4P9YA 3LDRA 1SG3A 1PMHX 2ET7A 3F95A 3I2KA 4Q4W3 4GD4A 4NHMA 1MS0A 1XJAA 3PUHA 5A33B 1GZTA 4PT6A 2JG9A 5FLJA 2XPJA 4RD7A 1JZ7A 1LEDA 2Y8KA 3DPRC 4MGZE 4GWJA 2YU1A 1C5HA 1FYUA 3WDWA 4NIDA 2WO7A 4PF1A 4CE8A 1QJU1 3J7MA 4NHXA 3E6CC 2JG8B 3USSA 2GDFA 1ZBA3 1VRH2 4E4DX 1B35C 4L2NA 2OQ6A 1H2MA 5F37A 4LK7A 5FP7A 5A3TA 4KWJA 1DQ0A 3I2GA 4U2AA 2E32A 1GZWA 2JE8A 5JZGA 2VZ3A 1Y9GA 1VRH1 4YVWB 3PURA 3I54A 4PCRA 3B7MA 2B9VA 2TBVA 4W8JA 5BV6A 1TVGA 2J1UA 2PMWB 1SLLA 3FBYA 4XIOA 4AI3A 4B7KA 5SV8A 2FBEA 4ZU4A 3RMXA 2OVUA 1MZFA 1HRI1 4LTAA 4PBOA 4UT5A 3C8XA 2BU9A 3E97A 2ZZQA 3WNMA 4AF9A 4EQVA 1UYPA 3GGLA 4AVTA 2VCMA 1PO23 4I2OA 3LQCA 3IPVB 4M3CB 4E2SA 5J09A 3CZUA 1W28A 5T5PA 1OQDA 4OHXA 3AP5A 3I3DA 3UT0A 4AVBA 1RUOA 4GWMA 3VBOA 2XJSA 1WUVA 1YQ2A 3LAGA 1NXMA 1S0GA 1WD3A 4ES8A 4P08A 5FYTA 3W9AA 1OUSA 3HOBA 1AXKA 2E51A 2WKKA 3QACA 4LMFA 4OHWA 1LHNA 3THPA 4YSFA 3RDIA 1LODA 3NSTA 1CPMA 2ATFA 3N9PA 3VBFB 4CU7A 2QKDA 3ZXFA 1L7LA 2XL7A 1LR5A 1O4YA 1S0FA 3M3IA 2FCVA 5A3NA 1AXZA 2Y33A 2A1XA 4UBHA 4CCCA 3RZJA 1E5HA 2VUJA 4KU8A 3VDBA 2MHFA 3DPRA 3M1HA 2JECA 1X36A 2ZEZA 1PX3A 2WL1A 4OLLA 1F31A 2W94A 4LKSA 3FJSA 3VZJA 3GCXA 1B35A 4QGLA 4BDVB 1D4M3 4TLFA 4H3WA 3AP9A 4NOTA 4C0BA 1N3PA 3BTYA 1ZA7A 3J7NA 4L99A 1SLTA 4YG0A 3PUAA 4NRMA 5FZEA 3T1MA 3DUIA 5JR7B 5GZCA 5EXOA 5CU1A 1OFSA 2ARBA 4IE6A 4DS0A 1ASJ2 2EIBA 4FTSA 3WV6A 1ZX5A 3VD5A 2RR13 1OH4A 1W05A 2DCTA 3CL1A 3I2HA 3MLJA 2WWUA 4UFHA 2PAKA 3NV4A 4IUGA 3UKTA 4AFMA 1RUH3 1QJX3 4J6GA 4DRVA 1ASJ1 3JD72 4CEWA 5AFEA 1PVC2 1IKPA 2WO1A 3PVOA 5GALA 2NP0A 1PIV1 5E16A 2IXJA 2QQJA 2BOIA 3OF1A 5F5AA 1SCRA 4JTOA 1CAWA 2Q8EA 2VMGA 1CAXA 1NKGA 1VE0A 1DBNA 1X33A 2XL9A 4FOWA 5EYYA 2KM2A 1OMIA 2C1FA 2QQUA 3AYDA 2OA2A 1J1TA 2RS13 1HKDA 2VOTA 1KRIA 3B9CA 5FREA 5GKAC 5DAVA 1YFWA 1YO8A 2CAUA 2W1SA 3EHKA 2ZX3A 2YMZA 1UXXX 5FZFA 3K48A 5FZDA 4DUVA 1ZNPA 1OA4A 3HT2A 3MW4A 3OYWB 2H6BA 4J1WA 3O1TA 2TEPA 4QX8A 4QQHA 4I30A 4NRQA 5I93A 2R071 4ISRA 4RN5A 5FXZA 1J58A 5A70A 2ZS6B 1QQP3 1L7RA 1N47A 4KGGA 4MH0E 3PLQA 4V2WA 3UGFA 2A70A 4LBLA 1K5JA 3PHMA 1G9AA 5I91A 4BH9A 3IMNA 3CLPA 4MX3A 4EWAA 4YW2A 3ZXEA 1YI9A 2WS92 1UCXA 2QNKA 5EP9A 1YWKA 4QX2A 5FMCA 4BQ2A 3ZYFA 2ARCA 4ARYA 1VBB2 2HWB3 3MF6A 4YM0A 4N7UA 1LHOA 5FWEA 1NCRC 4AHZA 2XJVA 4XTPA 2P4EA 4GQ7A 2XR4A 4Y20A 1PM4A 1VIWB 2XBO3 4EN8B 4QPGB 1VBB1 3LEGA 1GQGA 1MS3A 1H1MA 1AYN3 4NHYA 4A4AA 4YNIA 1ZREA 4NWVA 2YYOA 4C90A 5KXBA 2VCBA 4XBLA 2R042 2QQVA 5FXWA 5IFTA 4CDXB 2BZDA 1G9FA 1POV1 1EV11 1C8M3 3R4DB 1CPNA 3LD8A 2BGPA 4BLIA 4ONUA 1EYBA 4DRRA 5JOWA 3CJIC 1N1VA 1QJU3 3DXUA 5A7QA 3ZYIB 4IV1B 4JC1A 4LQRA 3UETA 3VB9A 4AFDA 2BWAA 2DV9A 2J1EA 3AM2A 3OPZA 1OQ1A 1HLCA 2QQWA 5IWFA 1GBGA 5JZGB 4Q4X1 1YFYA 4RL7A 4NVPA 4IGOA 4CP9A 4BZ4A 5FZHA 1SLIA 3PTRB 1UKGA 1VRH3 3IDEA 2VNRA 4Q0UA 5F6LB 1JYVA 5GM0A 2J7MA 1GZCA 5JUVA 2CHHA 1HJFA 2WNUC 5FP8A 4ZY9A 3WVJA 4BQWA 2IFRA 4Q1RA 4PIZA 1A34A 3KV5A 1LKNA 4MO3M 1CJDA 1RUE1 3NJZA 1HRI3 1UPSA 4LXLA 3FHQA 1W6MA 4QQ2A 4BQ4A 4N53B 5F3EA 5E88A 5K7PA 1YIFA 5IAVA 3DECA 3T3YA 4EZ4A 1H8TC 1ZRIA 3MFCA 1NZCA 2RVAA 2W5FA 1UYYA 3USUB 3KMHA 2OS2A 1RGSA 5ACA2 3PMEA 3VBOB 2XQRA 4Q5OA 2JDNA 5IVJA 5JXIA 5F2SA 1KFXL 4MGIE 4KU7A 4XF0A 3RI8A 1KS5A 2VXJA 1NLQA 1AR81 3L9JT 1SFPA 2VC9A 5JMOA 1NCRA 1I5PA 1G8WA 1XSRA 4PJYA 4HPKA 1NE6A 1OF3A 2JD9A 2YPJA 3SQOA 2E9QA 4UFMA 5CFDC 4K21A 3U10A 2A6ZA 4AE2A 3FFZA 2J42A 3AP7A 2ZHNA 3OPWA 2R062 1DLLA 2GH2A 5DAXA 4TZDA 4W65A 1DFQA 2R0FA 1AR62 1EP0A 4HVRA 3KVAA 4BWOA 2VMFA 4HL0A 4YZ5A 2RG4A 3AJYA 4AEMA 5L7OC 4LBQA 1C1FA 2A5ZA 3CJIA 1WLWA 2ES3A 3WSOA 1AR61 5EJ1B 1V70A 4ISQA 1X50A 2DCKA 1W3VA 4E8CA 2V4VA 3HQUA 2VVEA 3Q8CA 4JGZC 3ZYRA 2XONA 4OUEA 3VN4A 5KC6A 5CEHA 3FUOA 4W6YA 3ZO0B 1W6OA 1HRV2 1YCIA 2W46A 3RFRA 1IKQA 2HWE2 3LDBA 3K3OA 3OGSA 3VLBB 3WDYA 5A3MA 2WQZC 2QFEA 3I2IA 4P5YA 2X05A 3SH3A 3HN1A 5IVEA 1ZBE2 4FBFA 1HRV1 2WNUA 1BK1A 2WIIB 4YZ3A 1Z0HA 1KJLA 4CEWB 2WYSA 3OTFA 5CISA 5HI0A 1JYXA 5HCHA 1JW6A 1H9PA 2JEMA 3THDA 5JIAA 4MXWB 2NMOA 1GLHA 1VBE2 1CAWB 1H8TA 3IT8A 1PIV3 5FZOA 1CAXB 5IK5A 1PGSA 4FPEA 1OLRA 5FZIA 1G7YA 3GBFA 1GV9A 3URFA 2ID4A 4KI5M 1RMU2 3O7OA 1QJZA 4XVHA 2G19A 1W3XA 4NMIA 3VKLA 3DYMA 1JH5A 2JIJA 4EWDA 2J1VA 1C1LA 3DYOA 3WQBA 1CWPA 4NHKA 4WM7B 3W5MA 4CDQC 2DU0A 5T55A 2VTFA 5CFDA 4JQTA 4JKMA 4N43C 1K45A 1RJ8A 1C8NA 2R073 3CF6E 1COV3 5DDJ1 1UKRA 2LM3A 1WD4A 4NROA 5C5UA 1NA1C 1ULGA 4IV3A 1OPOA 4XFCA 4YWAA 5FXVA 4M4PA 4QQPA 3OEAA 5C71A 3TOJA 4R9CA 2R6QA 1QEXA 3ACGA 1FNYA 3PIGA 4FPCA 4XF9A 5FP4A 2QBXA 3MDPA 5B4NA 4BQ1A 1G6NA 5L7OA 4QU2A 5T5LA 4M01A 1WCUA 1GU3A 1E5RA 1A6CA 4YRDA 1U12A 2JENA 2GN3A 3ZFEC 4AI0A 1J83A 1CIYA 4HANA 5DQ0A 2A3WA 1OOPB 4NIHA 2AGSA 1J3QA 1SMVA 1AHSA 3LPFA 1C3HA 4MSVA 1BEV2 1GICA 1RUF1 3KT4A 3ELNA 4MHUA 2Y6FA 4AHXA 4CDWB 5L9VA 1POV3 2B4KA 4FTBA 2VNGA 1CX4A 1VPHA 1JBCA 1EV13 2RV9A 2WA4A 4Y5TA 3FN9A 4CP0A 3ZN4A 4N8MA 3V0BA 1REFA 3K75B 4HT1T 1ZZBA 3AYAA 3MI8A 1DQ4A 4JHTA 4CUAA 5AC92 4LO5B 4Y4YA 4M00A 3SMHA 2ZHLA 2ARAA 4QHOA 1GP4A 3ZIWA 3UYJA 3AZZA 3I2FA 3VDCA 4BQXA 2VW1A 3B93A 5AC91 1MZ5A 2YU2A 4K7JA 4MXVA 4Q4X3 4EROA 2HWC1 3BTAA 5KC5A 1RUG2 3NWKA 2C26A 2Z4FA 3WQ7A 1YNAA 4XFHA 3ZSJA 1UW8A 1W2TA 4HG6B 2XUEA 1QJY1 1V9U1 1WBLA 2P34A 4E4HA 3CU7A 5KHKA 1DZRA 2BFUL 5GLWA 3RYPA 4FI9A 4WVZA 2RS32 4YW6A 4NIGA 3AKTA 3WP6A 1RUE3 3V64A 2P6HA 1VBD2 1SQ4A 4J25A 1HB1A 1LOGA 1W2AX 4LHLA 4N43A 3WQ1A 1MS1A 4C1WA 1JZ8A 5BNOC 5I0RA 1GQHA 5CKMA 4AHWA 2RS31 2RJKA 2KXLA 1VBD1 3DF0A 1UN1A 4YFZA 1AL0G 5FMOS 4B4RA 4FP2A 2X09A 1SLAA 2FDGA 3MV01 3EBRA 1RHI1 4E4SA 1PK6B 2QQMA 2DURA 4BQYA 2CGPA 2W39A 4K40A 1AR83 5L19A 4LT5A 1DZTA 3VKMA 2VTXJ 1S0CA 4MGQA 5EV7A 2JDAA 5CNAA 4X8NA 3TWIA 5A6ZA 5C3RA 1WW4A 2D3RA 3GBGA 1ULCA 2ZA9A 3VDDB 5BNNC 5A1AA 1PZ7A 3PUSA 5A3OA 1AVBA 4IERA 3AYCA 1DU3D 2ZX4A 3KV6A 1CJPA 1WCSA 1BK0A 5FPUA 4Q26A 5FWJA 1Q56A 2DF7A 1H8VA 5LCWL 1PO11 5FKCA 3VZOA 1UO9A 3AC0A 3ZN6A 1S0DA 2VU9A 2QDNA 3WDUA 4XF1A 4GB32 4F8AA 4Q4V1 5GZEA 2Q4SA 2WNOA 3AMMA 1NZIA 2CTVA 2O14A 1K5MB 3ZM8A 2OX0A 1WLCA 4XF3A 2BPA2 3LOIA 3DYPA 4LKEA 1JYIA 1OUXA 1AR63 1OKOA 1UL9A 2XJPA 2UU8A 3PDQA 4GB31 3S7EA 4WM8B 3RWKX 5FYZA 4D6SA 4BLJA 2ENRA 3MUZ1 1SFNA 2CY6A 4IEQA 1H1IA 4Q29A 3VKOA 4QD2A 4V1PA 1OD5A 1G86A 4QDQA 2R32A 1S2EA 3MIDA 4IE7A 1UMIA 4RS5B 3VD4A 4SBVA 1YJKA 3VZLA 1JHJA 3NAPC 3POIA 1YC61 3R6SA 2ZGSA 1W0PA 3TAYA 5FQ0B 1X82A 1ZYBA 3N9MA 4CDUC 1BVVA 2WRAA 3R4SA 5EIYB 4ASLA 3TEYA 2DCJA 4XHBA 5DUVA 4LA3A 5FBZA 5FPXA 3TEZA 4XQ4A 2UYBA 4NAOA 3KT7A 1W9FA 5LATA 1CZTA 2ZMNA 1ND2A 4Q1PA 3RPQA 1H2LA 3T0AA 4BQ3A 1W2NA 4Q4W2 4QKDA 5CVRA 4C8DA 4IXLA 3VBHB 3AMPA 1LU1A 2YV8A 1DLCA 5M0TA 1WMXA 1CVNA 5BNNA 3K3NA 2VJXA 4XZUG 5CBLA 1CR7A 1YHFA 2ZHMA 5DDJ3 1H9WA 4R9BA 3LCPA 3RS6A 4NPLA 2XLAA 2RDRA 2D98A 3AK0A 4IGPA 4INDA 2Z42A 1ZBA2 5EPAA 1FAYA 4NR1A 4A7ZA 3I3BA 2ADEA 2Y6GA 3H50A 5FZAA 1R1A3 3GZAA 2X5IC 2XDVA 1GNZA 1RJ7A 1RTVA 1DGWA 1W9SA 4HXCA 1PZ8A 1IPJA 1ZBA1 2YFUA 5DZEA 1XNDA 2C0ZA 1GNYA 2RS51 5FTTC 5CA6A 5I0TA 4FPFA 4UFIA 3E1F1 2JKBA 1BQPA 2WFPA 3VBFC 4XACA 3VBUC 4Z92B 4HLTA 4FFGA 4UI9L 2WT2A 1QNYA 1RUF3 4PIXA 5C8WA 1PO22 3HIFA 3RI9A 3V0BB 1N3OA 3J9SA 2EF6A 4BM8A 2HWF1 5G05L 4AI2A 2EXIA 3VDAA 4AOCA 5JXGA 2F6BA 2Y6JA 4ITCA 4Y24A 1PGW2 1PO21 2ZTNA 4GWIA 4QKNA 4CDUA 4Q0QA 1GZ9A 3FC0A 4MLOA 1NCQC 1SPPB 2DVGA 4D7YA 4KG0A 2BNMA 2W47A 3TBDA 4ASMB 4K8RB 4FSJA 2DBIA 1P8JA 1PGW1 4DXRA 1EY2A 1WCKA 3H3ZA 3POGA 4GH4C 1UY1A 2HWC3 2JDYA 3NNLA 1MQTC 4HSLA 4YW4A 4YVSB 4ARXA 3KM5A 3HQRA 2D7FA 1SBEA 3NJYA 4LKDA 3AKPA 1NYWA 2YY1A 2AACA 3DGTA 3KGZA 4N9HA 3WX5A 2PHRA 1QJY3 1V9U3 4E2GA 2QTWB 2VM9A 1UPIA 2BNOA 4W50A 2MEV1 4RR3C 4H2AA 2YG0A 5DZGA 2P17A 5IK8A 1ULDA 2PAMA 4QAWA 2R49A 2BRTA 4KBBA 1HXS3 1S0BA 3M8LA 3PJQA 3V0AA 2XG3A 1WW5A 3UGGA 2IWGB 4DEVA 3PVBB 3OD0A 5I8YA 1VBD3 1D4M2 2V72A 1DYPA 4LPLA 3FLPA 2XXZA 2X5IA 2EAAA 1ND3C 3GNEA 2BW8A 3MICA 4MOAA 1RHI3 3ACHA 3WF1A 3HNYM 4K3UA 4AXOA 3VL9A 3U14A 3ORJA 2GMMA 1U5ZA 1JYCA 2RR12 1MEC3 5CKNA 3BPZA 5FK7A 3RJRA 2BYVE 2ZKNA 4LOSA 2WZPP 1WCQA 3J8F1 3OB8A 3VBUA 4A2UA 1ODMA 1QJX2 1RUH2 2MNGA 3WUCA 1PO13 2PQQA 1W8OA 2VOVA 4Y1VA 1BMV2 4LE4A 3ZSKA 4Q4V3 5BY5A 5EQUA 3WNLA 3NNMA 1W8NA 4LOTA 1OA3A 3B02A 4H14A 2A6XA 2ZGKA 1FOD1 2HJIA 5DG1A 1DIWA 4QDRA 3ZN5A 4CCNA 1AJOA 1YEWA 1NCQA 4L0PA 3WHTA 1PMJX 4OYUA 4P9IA 1HB3A 4YGDA 1A78A 3KSCA 4LORA 4BJ0A 4XBQA 4GH4A 3BTZA 2QQNA 3I3EA 1MQTA 3T0BA 1IS4A 5GLZA 4ASKA 2JDMA 2D6PA 4GALA 1QQP2 2E7TA 5C8CC 4QPWA 2B7YA 1CQ9A 4RR3A 3F2ZA 1A3KA 1XE8A 4Y26A 4YM3A 2E6VA 3ASIA 4TTGA 5HCAA 1AYM1 4NUBA 4QHBA 1IHMA 3WG3A 2HWB2 4COZA 3ZOIA 3AX4A 4IDZA 4OFGA 1X9TA 5JSRA 3UKNA 3E5UA 1UIKA 5ABJC 3KZ4C 3O12A 4ORFA 5FYBA 3WF3A 1WLDA 3C3VA 2XBO2 2XVGA 1ND3A 3IWZA 1H4GA 1V6IA 1Y9QA 1QH6A 4QT6A 1AYN2 1UY3A 3Q8BA 3CHXA 2Q8OA 1QGLA 3NO8A 4UF0B 1R1ZA 5FCCA 3ZVXA 5C3OA 4AZZA 2GSYA 2DUQA 5T5OA 1AYN1 2VZRA 1C8M2 1UAIA 4N53C 1QNWA 4XEZA 2XVKA 3WF2A 1LESA 2VZTA 2JDZA 5IT6A 2FDIA 4LR4A 1QJU2 2VAUA 4NE9A 1C8M1 1OLQA 5JPNB 2C5DA 3MZHA 1KJRA 3MIFA 1DGRN 1PVXA 5FFOC 4OUMA 3TNQA 3Q9OA 4AR2A 1G9BA 4DXTA 5IVBA 3O1VA 4IEYA 2GNDA 2VECA 4LUMA 2R1DA 1YQ8A 2Z2SB 3DKQA 4OI0A 1U5YA 3PNAA 3AKSA 2RS53 3A21A 4ATEA 4QWNA 3HWJA 1VBC2 3I4IA 4QX3A 3DN7A 1QU0A 4I01A 1QXRA 1A8DA 4JAAA 1MPXA 1W9WA 3S57A 2Q0AA 3ZLIA 3ZXGA 1UMZA 2R1BA 2RDSA 4DB5A 5CADA 5F5QA 1W6QB 2QVSB 1HRI2 4PDWB 4CA9A 4Z8BA 2VBDA 4Q0VA 1VBC1 4S2DA 3G6JB 1O4TA 2NYYA 5C8CA 3WG2A 4FTEA 2VNOA 1MS9A 2HWF3 2Q1MA 2WA3A 3LA2A 5FPBA 4B4PA 3H8XA 1MS8A 2Y64A 1F8VA 4HKWA 5FYCA 3OBTA 2VQ0A 3WNPA 4CVUA 4M3CF 3FZ3A 2DWRA 2VMCA 4FXGB 4I02A 4AVSA 1CAUA 4Y33A 5ABJA 2VW2A 1YYNA 4Y22A 2W3JA 3A0KA 3JXSA 3D4KA 4CTEA 4ZZ5A 3BALA 5FOJB 5BNPB 2WNVB 4CUBA 1JYWA 1QY4A 3W21A 3W5NA 1TME2 3G7DA 3M3CA 1JZ4A 2JKXA 3CO2A 2WZR1 3JB8A 5FDBA 4QQOA 5CFCC 5LWBA 2HEWF 3AL6A 3PMSA 2MEV3 2ETEA 1YQCA 1YFXA 2G9FA 4EZHA 3RQ0A 5KXCA 3D3AA 4OHVA 1TME1 2XB6C 3VD3A 3W59A 4DZGA 5L73A 1WWYA 4Y1YA 5E89A 3RZZA 3KT1A 3VBRB 5KXDA 2GN7A 1Z7S1 1I9RA 2EXJA 1PGL1 4UW4A 4BU2A 4OI2A 5F3GA 1EPWA 4HOOA 3WCSA 5EHDA 5AVAA 4AEKA 1YQ6A 3IB3A 2IUWA 2V5DA 5I8SA 3ZPYA 1Z78A 4Q0SA 2I07B 4WZCA 4YM1A 4KH9A 1RB8G 3ON7A 4B1LA 4WVWA 4CCDA 2PHUA 1JUIA 3ZFGC 1R091 1VB4A 2Q1ZB 3AP6A 1LOBA 3ZXLA 5BUVA 4XDOA 4QXKA 2BVVA 3J8F3 3VBSC 3T2QA 4UWDA 4JGYB 5LRSA 3OBZA 2KD7A 3EJKA 4Z2WA 1PIV2 1IS6A 1Y9MA 1U0AA 2VO5A 4LBJA 1O3RA 4JV4A 4XFIA 3GJBA 4H55A 1Q8VA 1JUHA 3CIHA 2QCSB 2AZ5A 1ULOA 2VULA 5C5TA 1REDA 1FOD3 1FV3A 5D8AC 1O3TA 1SCSA 2ZGTA 3GXUA 5JAXA 3JQXA 3BOPA 5DZFA 2IVJA 1C57A 5LBCA 5FAXA 3NV2A 4BIFA 3OGVA 5FY5A 1BVP1 2Q8DA 1LGNA 1ULPA 3N9NA 2BBAA 4LIUA 2R072 5CAZA 2WQ8A 4RQPB 1COV2 3ZYBA 2Z69A 4G4FA 3OUHA 5CFCA 2JICA 1H30A 1FPN1 5C9AC 1UD1A 2DUPA 2W1UA 5F8PA 4H7MA 4LBOA 4XTMA 3I49A 1COV1 3L2YA 4ZPIA 4AI9A 1IS5A 2GC2A 5A32B 1MR5A 1AYM3 2HEYF 2YHJA 2V5YA 4NPRA 3NQHA 4S2GA 1W6PB 1W8FA 1RUD1 4Q4Y1 4PQ9A 3POBA 1GOFA 4CU6A 2CYFA 4LO6B 5GLTA 2HYXA 3CQOA 1UY4A 4QPIC 5A6QA 4RHV1 3POYA 5HCFA 4AFBA 1WLTA 2LALA 4GA9A 2JE7A 4AFCA 3I59A 1EV12 3MGUA 4Q8LA 2K9ZA 2EIEA 3RYRA 3FMGA 4URTA 1UZ0A 1OVPA 3VBSA 1O3SA 1S1AA 1WA6X 2JG9B 3HD8B 2A3YA 3N7MA 1NXD1 3WR0A 2ERFA 4KG8A 2YPDA 3HN3A 3MIGA 4YFWA 5L9BA 2VL4A 5FYIA 3ST7A 2IC1A 2O1QA 3WT3A 3ZFFC 2EIGA 3WD5A 3O1MA 4R9AA 1JU4A 2ZZJA 3LIHA 3T4VA 1HX6A 4ZZ8A 3IIIA 4O61A 4Q4X2 5JI7A 1OURA 3LWCA 3AKQA 4TXWA 5D8AA 1QH7A 4A44A 4ZU7A 4IE4A 2P37A 5LA2A 4AG4A 2B45X 4QKBA 5FZGA 2A71A 3VDDC 3R4UA 1GZWB 1GP5A 3AYEA 3IM0A 4L92A 1UX7A 3IKWA 5BPXA 1NAEA 4YYOA 3TN92 2JWPA 2NN8A 3ZKYA 4M0NA 1RUE2 2PXJA 4CCMA 5J1XA 1RUI3 2W1QA 4LLOA 2W68A 2PA7A 1VBC3 2VD7A 4QX7A 2WJSA 2YUEA 1AR91 2JJ6A 5FY4A 2JDHA 1VALA 3TN91 4CXWA 1CAVA 1XNCA 2LW8A 5IUQA 1W8ZA 5EJ3A 3LZZA 1NT0A 3S5AA 2QZ2A 2WN3A 4LO8A 5C9AA 1BJQA 4DUWA 1V6LA 3I3QA 5K4LA 5LEKA 1VAVA 1ACCA 4M4RA 4MVTA 4WM8C 5K0UC 1G9CA 4XMAA 4PBPA 1F9KA 4Y3OA 5LA9A 1AR82 1TE1B 4ZHNA 3WCRA 1OXCA 5J36A 3AVSA 3MLKA 3N3HA 3UJQA 4BB3A 2R16A 4N90A 2W2IA 3I8TA 5A6YA 1L3JA 3LA3A 1JOPA 3DV8A 5FUIA 2CGOA 1W2OA 1LAJA 4FPHA 2WZR3 3WINE 4QX1A 4F83A 2O8QA 4UFKA 5FZ3A 3KV4A 1XSQA 2PHWA 1TNFA 5FZ9A 3BUCA 1TME3 5FR3A 3LGRA 1HW5A 3OBRA 4JX0A 5F2WA 3ZXKA 3DPRB 4GIQA 1Z7S3 2ZGOA 1BBT1 2ZEYA 1W90A 1RINA 2W52A 3ZYGA 2Y38A 2RM21 3SKJE 3O0VA 4YG6A 1ZA4A 1B35B 3O5SA 1PX4A 4GAZA 3ZIXA 3U1XA 3VBHC 5C4WC 3ACIA 1DGLA 3SC7X 1FV2A 1NOVA 4KMQA 4AI8A 2E53A 2QQKA 4AFAA 4Z2AA 1X7NA 4ES9A 1R081 1R093 1Q3EA 3HNBM 2RMU1 1YI7A 2NM1A 1F2NA 3H9AA 4D8MA 5HBAA 1NQJA 3JBG1 2BDRA 2V73A 3OPTA 4XURA 2DDUA 1SZBA 4CEWC 4MYEA 2WYFA 1X9PA 2JIGA 1QDOA 4YLZA 2GALA 1S0IA 2CWMA 2OPWA 1LULA 3BVCA 2VZ1A 1MZEA 2ZOEB 3MW3A 2AUYA 3DCQA 1I3HA 2ZMLA 3AZXA 5FYMA 5JXJA 3O1OA 3ZXDA 1OSGA 3A22A 4K20A 2UY9A 2ZHKA 4MUVA 2PFWA 4YPJA 1Y7BA 3VD9A 5K0UA 2XGXA 3U37A 4ZKTB 1SACA 2VG9A 3D82A 1GYKA 1LENA 1QJEA 2CDOA 3T2OA 3QOPA 4XXAA 2BOJA 5CIRA 5JDBA 4RGGA 1W9TA 4XF4A 4IEVA 1AX2A 3J4UH 3C7EA 2D43A 2J1RA 5DDJ2 2JDPA 5DG2A 1CZSA 5A3WA 1ZZ8A 4W6WA 1OBNA 3RMYA 5CYYA 2QQIA 4A7YA 1FPN3 2XWBB 2W91A 2DBNA 2BVBA 4XFAA 1HJGA 1R1A2 2J1AA 4JDNA 1F5JA 3M7AA 2ADDA 5FZLA 4NHLA 5DUWA 4D7TA 1LHWA 4GKXA 4KWKA 4AW7A 5CZKA 1S2BA 2HBTA 1SDWA 2XHKA 1RUD3 4Q4Y3 2D93A 1R1A1 3OUIA 4X8PA 3WG4A 1T6GC 3ILRA 2DVDA 4YARA 2WC2A 5FZ7A 5J3UA 3X29B 5J37A 1CX1A 1LRHA 2VVFA 3W58A 1GFF2 4DXZA 4Y20B 4RHV3 5C4WA 2EICA 4E9KA 2QDRA 1RUF2 1O5LA 4JGZA 3I59B 3AL5A 2WR9A 4LULA 4AVAA 1Q8QA 2JE9A 2PLV2 4IESA 5JOZA 1Q5OA 2WSUA 5C33A 4XJ9A 1WGPA 4P5HA 1GANA 2VBBA 3B00A 2PLV1 4WVMA 2EA7A 1GR3A 1TEIA 1WA4A 4K1ZA 1S0EA 1LHUA 3OY8A 3VV1A 1DYOA 4BCUA 1PNGA 4XUQA 4IEPA 2PTMA 2PHTA 5LA1A 5LK5A 5LY2A 4G3YC 1N1YA 2BV4A 2HWC2 1NY71 4C91A 1BHGA 1W99A 3T2PA 5IYYA 4O7XA 1ENSA 1HV0A 4XC9A 4OVEA 3V65A 3UK9A 2IXHA 4CU9A 5DAQA 4CP9B 1V6NA 2V4AA 1QJY2 1V9U2 1EAH1 3H8OA 1W04A 5I8TA 2WLQA 3KGLA 4AQTA 2D5HA 3VHOA 4AEDC 3BU0A 1W6NA 4IE5A 3KF5A 3Q8FA 4XQDA 2E63A 2VMDA 3M70A 1HXS2 1AR93 4X6RB 2WZEA 4YW7A 4CDQA 5LA0A 3TN93 2Y6HA 2BFUS 1W6MB 4LHSA 1URXA 5IVFA 3S6PA 4PF5A 3PJYA 4LK6A 2VZUA 2VZQA 1O5UA 3QLQA 1HXS1 3CNAA 5T54A 1VJ2A 1RHI2 2N7GA 3S7IA 1NA1A 2K46A 3NNGA 2W9XA 1KFUL 4BXSV 2IXLA 5JIUA 4LBKA 3ETQA 4LUKA 1LOAA 5BYNA 5LK7B 1JTZX 1MEC2 3RJ2X 1JI6A
chains in the Genus database with same CATH topology
1UU4A 4QPYA 2GU9A 1NCRB 2QZ3A 3FHIB 2XJRA 1ENQA 1HQLA 4FQZA 4M0HA 4UW6A 4HPKB 3ZFEA 3KQRA 1AJKA 1LOEA 5IK7A 1PO12 1C4RA 1MEC1 4IEWA 1LGBA 1AXYA 3ES1A 5E1RA 2OYZA 1QWRA 2DCZA 4Q4V2 4CEYC 2LTNA 3JB4C 4NO4A 4BHPA 4WZFA 3N7JA 3RRDA 2ZABA 3KCYA 4XBNA 4LHKA 4LEJA 2A6VA 1FATA 5KHHA 4IL7A 2H0BA 1BBT3 1RVF2 2DUOA 4EN0A 2RM23 3AZYA 1AX0A 3CJIB 4LBQB 1XNBA 1UX6A 2YROA 4AVVA 1LB2A 5LRRA 2GNBA 2YGMA 1RVF1 1SLBA 1XYOA 4AVCA 1W6OB 2QJVA 3OJBA 2P3IA 3BCWA 1R083 2WT0A 4CP1A 4QQLA 2RMU3 4JDOA 2WNUB 4XZPA 3QH6A 3JBG3 3RYKA 5K9YA 3B9IA 4PLNA 5JVVA 1NE4A 3VZMA 3LOBA 1W2UA 3POSA 3WLUA 2JG8C 3PVEA 3RWNA 5BNOA 1H8TB 1FMD1 5E8AA 4EWEA 1RUC1 2PAEA 2ZAHA 4YVWC 3D0SA 1MVQA 2VH9A 3GYDA 5J7MA 1S55A 4IEOA 3QH7A 2FZ2A 3B94A 2A7AA 4HN0A 4P9WA 1CN1A 5CFDB 4PLOA 3E6BA 1HIXA 4FAGA 1WCDJ 1YJLA 3VZKA 4B29A 3H1WA 3VHRA 4CEYA 2DFBA 3AP4A 4XFGA 2AH2A 3WXPA 4IV3B 4WV8A 3RSJA 1XQNA 2W08A 3NW4A 2RS52 4O9EA 2OZJA 2DVFA 3WNXA 2O0OA 1UF2C 4META 4PIYA 5L7OB 4HK9A 1YRZA 2PHFA 3HT1A 4XETA 4COVA 3M3OA 1H2NA 4JGZB 4KL1A 2HWD1 5DUXA 4Z82A 2PHLA 4IEUA 1B09A 2HWF2 1CD3G 4Z07A 1JOJA 4AI1A 4EN9B 3JZVA 5FO8B 2X29A 2NZ9A 4GXLA 1N1TA 2PLV3 2XLFA 3NAPA 4N9IA 2JG8A 2VY0A 4EJRA 1AZDA 5JSPA 3WOGA 1IPKA 4YM2A 4QX5A 2PHDA 5T3NA 4JVAA 2Q5TA 1EAH3 1H1AA 2A6WA 2MEV2 3POWA 2XVLA 4XJZA 4XXPA 3SISA 4YZ2A 1AL21 2VXRA 4GMP0 4NN0A 5T5JA 1AR71 2D6OX 4LA2A 4B4QA 1ZZ7A 4N43B 1DQ2A 1LJ7A 2LUWA 1DQ6A 4XJWA 3IPVA 1NA1B 3KD4A 1TMF3 2CWSA 5TSWA 3AMQA 4AK3A 4S2HA 3WHUA 2BTVC 2XKPA 2D6MA 2WQ4A 3ZDSA 1NG0A 4MZUA 3GF6A 2A3XA 3MFAA 4R8HA 1H0BA 1OQEA 3J8F2 3ILNA 2JXAA 3FUQA 4Y1ZA 2BNNA 2D5FA 1VR3A 3VBFA 4FPOB 3GZTB 1XU2A 4Y1XA 4IQPA 5KHIA 3JCIA 2P2KA 3N7LA 1ZZCA 3ZN6B 4EN6B 3MW2A 1HQWA 1FOD2 2JX9A 2D6KA 2VMHA 4HKLA 3H1YA 2Y26A 5CB7A 2YXSA 1DHKB 5JOXA 1RUJ1 2VMIA 1RVF3 4FOQA 4L8QA 4QPGC 1DQ1A 1FT9A 3AXDA 1WMFA 3LSDA 4HETA 4S2FA 1U5IA 4XMIA 3T1LA 1ENRA 4CZSA 5GZDA 3WZ1A 3VHNA 2TUNA 4CDXC 1AF9A 2GZWA 4L9BA 4MV2A 1AYM2 1YUDA 2B42B 2Y0IA 1LTEA 4IV1C 1FMD3 5AVPA 4H7LA 5B2GB 5JZGC 1RUC3 1ND2B 4I3GA 4LO4B 1FI2A 3UL2A 5K8SA 4OI1A 1IZ3A 4J1XA 2AR6A 4NWWA 3TYJA 1O91A 1JXNA 3NL1A 5IK4A 5BXXA 5BNNB 3OYWA 3DL3A 2XWJB 3AB0A 2EALA 4UBGA 3PVNA 4HFSA 3U4XA 4QM9A 4UW3A 3OGJA 4P9JA 3ES4A 2Z79A 1QOSA 3E5XA 2Z5WA 3PTYA 4K9SA 4D3WA 4AWDA 2FMYA 2BUKA 3QBQA 1S0JA 4W6XA 3VBOC 3OGGA 4XFFA 4YGCA 4A3XA 1QXJA 4WVVA 1IQAA 1V6KA 3THTA 2AENA 1PNFA 2EVXA 1MVEA 1O3QA 3AJZA 3S0MA 3N7KA 1REEA 3RNSA 1KDMA 2WFF1 1N3QA 2FMDA 3VHPA 1RUI2 3T2TA 2BGCA 4IEZA 2IXKA 3FLRA 1QOTA 2DCYA 2HWD3 4QPGA 2V09A 1YFUA 1RUI1 2PHXA 3KB5A 2B9UA 4XJUA 4CDXA 4YZ4A 1DGWX 1SEFA 3NAPB 4FPJA 1QHDA 3GALA 4CDUB 4RSUA 3N4MA 4IV1A 1PHMA 2ZPXA 2ET1A 2DVAA 4P9GA 1UU6A 2WZR2 3FLTA 3ILFA 1KDKA 1DZQA 4RGAA 2F4PA 2Q30A 1AL23 1IGOA 2D40A 4FOVA 4XYXA 1LU2A 1AR73 2I45A 2AYHA 1UU5A 1Z7S2 2WLPA 4YW1A 3APBA 4CEWC 5JWPA 2ZGPA 1XNKA 1PGL2 4N53A 2NQYA 4RFT0 3V0AB 2A75A 4FXKB 4XE9A 3O0XA 3KLSA 2QUOA 3USUA 4B3NA 2X5IB 3MIBA 3KCCA 4JRAA 4A7KA 1R092 1RL3A 3ZYJB 3ZXJA 1VBA3 5H9PA 4WM7C 4Y5Z0 5A3LA 2GMEA 3VBUB 3VUOA 3TB0A 5AFBA 4BE3A 4IEXA 1OFNA 1M4WA 2ZMKA 1D4VB 3EO6A 3IDBB 2OUJA 2ZGUA 3QD6A 3VGIA 5CG8A 4XILA 5BNQA 3ZMOA 2H0VA 3TRSB 4DMIA 2A73B 4F7ZA 4DNYA 1OHFA 1Q8OA 2PYTA 1VAMA 2YZ4A 1NCQB 1RUJ3 4C1XA 1V6OA 2GC3A 4R4XA 3SHRA 1OOPC 4COWA 4AQSA 4GH4B 3OCPA 1UZZA 2AREA 3I2DA 3V56A 1J3PA 1MQTB 1WW6A 4BA6A 1GKBA 1FPN2 4CDWC 1ONAA 2XJUA 1NLSA 4CP2A 2VPVA 3MF9A 4RR3B 4HVOA 1XU1A 4B7EA 1RUD2 2MPFA 4Q4Y2 4MXWA 1AX1A 2ZX2A 4I0BA 3ATGA 4AEJA 3JD71 2X53S 5SV5A 1PVC1 2FQPA 1MZ6A 4RHV2 2C9AA 3ZYPA 2SBAA 2ZBJA 1ND3B 5KWRA 2VVDA 3WW3A 4R4ZA 2GNMA 1ENXA 4DY3A 4AHZA 4XJ8A 1RITA 2CAVA 3AMHA 3IDCB 3M3EA 4FO9A 2WSVA 4WM7A 1DGRA 2W0XA 4AGRA 3LSEA 3ZFGA 1SBDA 3MIHA 3VL8A 2ZX0A 4AQ6A 3SH4A 2HKXA 1F5FA 4DINB 3AZWA 2TNFA 3FX3A 4Q0PA 1PMIA 2R30A 1PK6C 2G9GA 2EXKA 2WS91 5FOBB 2WFF3 1ZM1A 2ARXA 2IFWA 4P14A 5F1RA 1WW7A 1OOPA 3IBMA 1AR92 1Y43B 4HN1A 2UY8A 3U07A 2UWAA 1A8MA 2D97A 4YGBA 1VLNA 1MS4A 4HMZA 4OI4A 5C8CB 4JTNA 4P9LA 4CDWA 1H2KA 1SFYA 3AFGA 2R041 2X8KA 3BU7A 1K5MC 4ZXKA 3GHMA 1X8EA 4D94A 3GZUC 4GKYA 1CAUB 1N1SA 5ABJB 4Y22B 2A6YA 2XKOA 4Y1UA 4MGYE 1FX5A 4QPIA 2GAUA 3VKNA 5JMCA 4RS5C 3WW1A 3NKTA 5H9SA 3SCHA 1X8MA 2IZWA 1BBT2 4X6QB 4D69A 2RM22 1I6XA 1QXPA 3H0OA 4AQ2A 4FOYA 4G9SB 4K1YA 1D2QA 2WNEA 2ZGMA 2GC1A 1DDLA 4FPGA 3ZFFA 1PK6A 3P3NA 2I2SA 3WP3A 1R082 3WDVA 4TWTA 4PLMA 2RMU2 4YW3A 4I09A 3VDDA 4TSVA 3JBG2 3P3PA 1CIWA 2DTWA 3E5QA 1LECA 3BIWE 1APNA 2G4IA 5DUUA 3ENRA 2XH6A 1VB2A 3O0WA 4IV3C 3EQEA 1PZ9A 4XOGA 1JHNA 2R061 5KHGA 4KWLA 5FLIA 3SLIA 1K5MA 1ZRCA 4XHXA 1V6JA 3R05A 5L36A 3AZVA 1G9DA 2B39A 2HYKA 3JQWA 3NV3A 4WM8A 5HXVA 4L11A 2Y0OA 4UXAA 3R0RA 3NVCA 3WG1A 4LE3A 5GJ6A 3WP4A 4XFBA 5GLUA 3ROUA 4RS5A 5CFCB 4COUA 2HWE1 1QOOA 4HK8A 1KS4A 4I3PA 5EZWA 4QMAA 1ASJ3 1J1LA 4GMP1 1ZBE1 3D0JA 5EFUA 5FQ0A 3IIAA 2OZ6A 3SXWA 5C6CA 3D8CA 3M4FA 2K0GA 3VKFC 3JD73 3B01A 4XQWA 1PVC3 4ATFA 3H8UA 4TYSA 3CJXA 2JD4A 2DTYA 1VBE1 4WBBA 5LEJA 4YVSC 3WP5A 1ZZ6A 1XE7A 1RMU1 3VBHA 1FXZA 1PM7A 3ZFGB 2GNTA 4FPLA 2ZJCA 4B8EA 2BWCA 3HBZA 1WBFA 2UWCA 3ECQA 3VBSB 2GMPA 2RE9A 1TNRA 2ZGQA 3D5OA 3D6EA 3H1MA 4I0WB 4ZU5A 1MS5A 2DU1A 2XJQA 4KQ7A 1NY72 3UJOA 5JLVA 4OI0A 1S2KA 4DOUA 1EAH2 2IXCA 2WS93 3IN9A 5D8AB 5JSOA 2D6LX 1XRUA 3QCWA 4FCAA 5I0UA 1VBB3 3GBWA 4K8FA 4O9GA 1CESA 1WMEA 4RA0A 3JU9A 1VP6A 4HBNA 2ZCWA 4E27A 3TNPB 1CAVB 1BEV1 4U36A 1BCXA 1D0GA 1TMF2 2GC0A 4LBNA 1QDCA 5C9AB 2R043 2HEVF 2ZKLA 5KBFA 1H4HA 3ZMNA 5HCBA 4XJAA 4R9DA 2FZ1A 4BYYA 4OZXA 3SITA 1TMF1 3WQ0A 3A4UA 3ZX7A 2WT1A 1UIJA 3HAGA 2EXHA 2XJTA 4AYUA 3WW2A 3MLLA 1MACA 4QPIB 4MGKE 2O8OA 1HV1A 1ULFA 2CL2A 2B8MA 4YVSA 2UYAA 1KD7A 3HR9A 4HSJA 1RUG1 1I5ZA 3ZSMA 4DFSA 3MPPG 4EV0A 4LHNA 4OULA 1DG6A 4BMEA 2P3JA 2DFCA 4XPVA 5T50A 1KQRA 2OW4A 3M3QA 3CEWA 4P9XA 5ACA1 4QGNA 3DKWA 5FMOL 4LBQD 5KXEA 1LHVA 1ZZ9A 1ND2C 3ZFFB 4FQ4A 5EWSA 2E7AA 5FLHA 1TQ5A 2PELA 4BPZA 4QGMA 4CRQA 2XUMA 1E57A 3J26N 3SCFA 2E7QA 2I74A 1OPMA 1POV0 4E4ZA 1ALYA 1OI6A 4FP3A 2D6NA 3C2UA 4KNCA 3RG0A 4AEDA 5FRAA 4FPKA 1FMD2 5FO7B 2DVBA 2R063 1XXNA 1JN2P 1RUC2 5GLVA 3LA7A 3WY6A 5H9RA 5K0UB 4BOWA 4UW5A 1SBFA 5FO9B 1W39A 2SLIA 3AKRA 4KGQA 4HVQA 4R52A 4YG3A 4DPNA 4PDWC 2GH8A 2PN5A 1DQ5A 3K51A 4BIOA 1BXHA 1NQDA 3U0ZA 1C5IA 1HRV3 3MPBA 1ZRDA 1BYHA 2HWE3 4GWNA 4GMP3 3AXEA 5I0SA 1ZBE3 2VQAA 1DYKA 2OPKA 4FAHA 3BODA 3LB9A 1U5XA 5JI9A 2VOXA 1ZRRA 2FHRA 1DF0A 1RUNA 4JRLA 2OIIA 1VBE3 2EAKA 2HWD2 4M3CE 4OHZA 4XIKA 4AHYA 3AMNA 4YZ1A 5BNPC 1UZYA 1CGPA 2D3SA 2WNVC 3N35A 2B5HA 5GZFA 5C4WB 4JDMA 1RMU3 1IOAA 5J48A 4Q4W1 5EYXA 2R0HA 3S30A 1Y3TA 4SLIA 5A33A 2QE3A 3VBRC 2IXIA 5D1IA 1I1EA 4WVMB 3SH5A 3OY8B 4Q8KA 5JPMB 1YLLA 2VW0A 1LOFC 3JUUA 3OD4A 2WWSA 4JCKA 1V00A 3ALQA 1O7FA 4DQAA 1O4ZA 3E6DA 4C0HA 4LLFA 3NKGA 1AL22 4Z1VA 2XLGA 2ZGRA 1KITA 4YVWA 1RC6A 1AR72 1GSLA 5DXDA 1W6QA 2QQPA 4OUSA 4PDWA 1W6NB 4EN7B 2ZGLA 3L2HA 1D2SA 4JGYC 1W0OA 3KS7A 1BZWA 1C28A 1XYPA 4CDQB 3EXUA 2RJLA 3GHNA 1RIRA 1BEV3 3AFKA 5J96B 1ZVFA 3HQXA 3H7JA 5JCTA 1NLRA 3O14A 4XW3A 2ZGNA 3I7DA 1LEMA 2NLRA 4Q27A 3H7YA 4M3CA 4HKOA 1M06G 2H6CA 2KA3A 1VBA2 2NPIA 5AC93 5F9TA 2OUHA 2YC0A 4HZFA 1BKZA 2ZACA 3MYXA 1J3RA 3ZXAC 3LKJA 1AUYA 2B46X 3UKVA 5BNPA 2UURA 2VGDA 2WNVA 1VBA1 5KHJA 1IS3A 4RQPC 3ZFEB 1J59A 1D0HA 3B5LB 3ME2A 1ULEA 1RUG3 3FBMA 4AGVA 2RHPA 3INAA 2CNAA 4FVVA 1Q43A 3VZNA 4YW5A 3U11A 3VBRA 2BQPA 2RS33 5ACA3 3MIEA 1RUJ2 5GZGA 3B3QE 1LOFA 1QMJA 1SLCA 4N7IA 4OHYA 4FT8A 1D4M1 3KCXA 4GULA 5JOYA 1QKQA 1VAKA 2CV6A 3FFQA 4LO7A 4K6BA 4LBMA 4I0AA 3SNMA 2ZAAA 1EPZA 3WDXA 4AEDB 2JG9C 2RR11 1YIPA 3N36A 4JGYA 1XYNA 4XDQA 3BOWA 4D7SA 1LGCA 1RUH1 1QJX1 5FPZA 5T52A 2WINB 4E2QA 4DY5A 1YXWA 3FWEA 1V6MA 2RS12 2P3KA 1BMV1 5BNOB 3M2MA 1HQNA 3SCGA 4LNVA 4GB33 3HMYA 1OKQA 1KXGA 5H9QA 3FE5A 1LCLA