4NPMA

Crystal structure of zebrafish alkbh5 in complex with succinic acid
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
221
structure length
210
Chain Sequence
EYEERRDAEARRVKSGIKQASIFTLEECARIEAKIDEVVAKADKGLYREHTVDRAPLRNKYFFGEGYTQERLYSKGEVDDIPDWVHELVIDRLVTHGVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFLFKPIRVSEPVLHLPVRRGSVTVLSGYAADDITHCIRPQDIKERRAVIILRKTRADAPRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RNA demethylase ALKBH5
publication title Crystal structure of the RNA demethylase ALKBH5 from zebrafish.
pubmed doi rcsb
source organism Danio rerio
total genus 60
structure length 210
sequence length 221
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4npmA00
3S5AA 4NPLA 3KHCA 2FDJA 4QKNA 4MGTA 4IE6A 4IE5A 4NRQA 3BI3A 3RZLA 3I49A 4O7XA 3RZMA 4OCTA 3BIEA 2FDKA 3T3YA 5F8PA 4NRMA 4QKBA 3BTXA 3H8OA 3BUCA 3RZKA 2FDHA 3RZJA 4NRPA 4NIHA 3KHBA 4NIGA 4CXWA 3I3QA 3O1SA 4O61A 4ZHNA 3RZHA 2FDGA 4ZS3A 4NROA 4JHTA 4NPMA 3H8RA 3O1RA 4CXXA 4QKDA 4QHOA 4IE7A 4IE0A 3BU0A 3S57A 3O1PA 4CXYA 3LFMA 4NIIA 3I3MA 4ZS2A 2FD8A 4QKFA 4NIDA 4IDZA 4RFRB 2FDIA 3O1TA 2IUWA 5DABA 2FDFA 3I2OA 3O1UA 4MG2A 3T4HB 3T4VA 3BTZA 3BTYA 4NJ4A 3O1MA 3BKZA 4IE4A 3RZGA 3O1OA 3H8XA 3O1VA
chains in the Genus database with same CATH superfamily
4UOJA 5FZLA 5JLVA 4OQ8A 2BFUS 3KHCA 5F9TA 3DPRC 4ISQA 3WHTA 1ODNA 2ETEA 2VZ1A 3JD73 2WUHA 3F2ZA 3ZYPA 1RB8G 4QX3A 2IFRA 2HWF3 4NRQA 3KS7A 2VNVA 1XB9A 5JMCA 3ZIXA 1VBD3 1ZZ7A 2ET1A 2XH6A 3C3VA 1JS9A 3AVRA 3D8CA 3SCHA 3AXDA 1FNZA 4GKYA 5EP9A 2JDKA 1NG0A 2YBSA 4Y3OA 3S7EA 3M3EA 5FYTA 2WFF1 3H8UA 4Q2FA 2XR4A 2HWD3 4UFMA 4OZOA 3SKJE 4CP9B 5C7GA 2ARCA 4Q4Y1 4NOTA 1MS0A 5FZ7A 1KDKA 3GBWA 4A6OA 3SLIA 1O6UA 5BNPB 3ZXEA 4UFHA 2YROA 3H0OA 4AYUA 4YGDA 4CU8A 4DRVA 1QJY2 5GLZA 3MLKA 1O3QA 1ZREA 3S0MA 1FMD3 3BB6A 3WQ7A 1WWYA 4PQQA 4DZGA 3ZFGC 3BUCA 1C4RA 1LOEA 2XBO3 3WG4A 3V0BA 2VBDA 4NIHA 3B00A 5FZKA 3LA7A 3ZMNA 4ITCA 5LCWL 5IAXA 4R8HA 5JIUA 1SMVA 1VBC1 2RDSA 2A5ZA 3PJQA 4OI4A 3C2UA 4HK9A 2PAEA 4MXWA 4W4ZA 2HYKA 1VBE1 4D7TA 4Q0SA 1N1SA 3K75B 4URTA 2GAUA 2VUCA 3OBAA 4DEVA 4EWEA 2OVUA 1VBA1 2Y26A 2ZGOA 2HWE3 4KG0A 4MHUA 1H0BA 2JG9A 2PHRA 3VGIA 3WW4A 5FR3A 2XMLA 4YGEA 2TUNA 3B7MA 2RVAA 3T2PA 1ZBE3 1SFPA 1ULFA 2J1SA 4FPHA 4QPGB 5DUXA 5GZDA 1JHNA 5DUVA 1W6PA 1MQTA 4DXZA 2Y6LA 1NOVA 3NWKA 4Q4V2 5A6ZA 3VDBA 4CCDA 1L3JA 1TME3 2P37A 5E1RA 4AQSA 2A6ZA 1UYPA 1DF0A 5FOJB 2ZMLA 1I1EA 5FZDA 3KV9A 1GOHA 2HWB1 1I6XA 3WZ1A 4IV3C 5A3OA 5IVFA 2XG3A 4Q4Y3 4Z2WA 4P14A 4CP0A 1PK6A 1QJU2 1KS5A 4BQ5A 2ZX0A 5JXGA 1GZWA 4F83A 1OURA 4O9EA 1MZ6A 1R1ZA 3O12A 1JZ8A 5FZOA 2J7MA 2FZ2A 4XTMA 1ZZ6A 1WCQA 1Y7BA 2VH9A 5FV3A 4CDXA 2FDIA 1OUXA 1PIV2 4HLTA 4HK8A 5FMBA 5DMYA 1W9FA 4UFIA 4AI2A 5I0SA 1T6BX 2V72A 3GBFA 1NCQA 1AYN2 1GKBA 1Q3EA 3CJIC 3L9JT 4CDQA 1GZWB 1PGW2 3EMRA 3FLRA 5A3LA 2ARAA 5LRRA 2R16A 5HBAA 4HFSA 4LKDA 2H0BA 1W8NA 3T4HB 5C5TA 4DY3A 5FZ6A 3VHPA 3ZXLA 1MEC3 1VBA3 1C3HA 5CU1A 1BMV1 4YLZA 4XBLA 4XDOA 1OFNA 1AYM1 1OHFA 4XFFA 1F5JA 1NCQB 2VCMA 3BPSA 1SLIA 4ATEA 4GD4A 4W6YA 1YI9A 1NY72 3CHXA 3HD8B 1NLQA 2A71A 4UT5A 4C1WA 1W8OA 4CPBD 2BFUL 1ND3C 3KCCA 2ZJCA 4NPRA 2D7FA 3AFGA 1XNTA 3IM0A 1RXFA 1N47A 3MW4A 4DINB 1D7PM 3H50A 4ONUA 4YVWA 5K0UC 4OFGA 4E2GA 2DTWA 3CLPA 1H2MA 3T0AA 5ISLA 1QMJA 1V9U1 1RUH3 2BV4A 4ZKTB 2YC4A 4E4DX 2ZBJA 2DFBA 2WDBA 3LD8A 1DHKB 3V56A 4KMQA 5HV0A 2DBIA 5FXVA 4FPJA 1EV12 1AR92 2D5HA 2IXLA 2LTNA 3U78A 4JDMA 1JZ3A 4AHZA 1M4WA 5FZ9A 3UL2A 2IXIA 2PQQA 4A41A 1OKOA 3IDEA 1LOCA 3J8F2 2ZX1A 1K12A 1ONAA 3OPTA 2JEMA 3I8TA 5FXXA 1YFUA 1N3OA 4FCAA 1UY3A 3I3DA 1JN2P 4B4RA 2WA4A 4RQPC 4ATFA 1RXGA 4AAXA 4BQ4A 1J3PA 3OBZA 3LKJA 5FK8A 1HRV3 4FVVA 4IUGA 1OF4A 3DYMA 4O61A 4AHYA 5HXMA 1SPPA 3PU3A 3WDWA 5K9YA 4XJ8A 3K2OA 4IEXA 2RS32 1D0HA 4XZPA 5FCCA 4R9CA 3PHMA 4GZ9A 4QQHA 3VDDC 3KD4A 1JYTA 5E16A 3WEZA 2WNUC 1W90A 2QE3A 4XF1A 3PMSA 4LITA 3CMGA 2ZHLA 2JG8A 4UBGA 3RWKX 5FPZA 3ON7A 5A1FA 3ZOIA 3HMYA 5JOYA 1G9DA 2RS51 1DQ2A 1RUI1 5EHDA 2W95A 2E32A 4RS5A 1RVF3 1T2XA 4QGLA 4BQ3A 3TWIA 1PGSA 3WF4A 1M06G 1LGCA 2X5IC 1MS8A 4FPCA 4CEYB 5I0RA 2ZAHA 1V9U3 3HNYM 1GICA 1OMIA 4MUVA 3MW3A 3T09A 2W92A 2B5HA 4ARYA 1YEWA 2Q1FA 1W99A 2FD8A 2XVKA 4KBBA 5FLHA 1SFNA 2D40A 4RS5B 1RUE2 2YPDA 3WV6A 1QXPA 4COYA 3RPQA 3OD4A 2R061 1K42A 3MO4A 1LJ7A 2Q4SA 3POWA 3ZYBA 5ACA3 1SCRA 2C24A 2VZSA 5AVPA 1W6MA 5T5PA 1QJFA 3K48A 1O4YA 3DPRB 4RGAA 1J3QA 1S2KA 3OG2A 4ZXEA 2R042 4FOWA 2AEZA 5FWEA 2JDUA 1VBB1 2P3JA 3HAGA 3WF1A 1X9TA 4JKKA 4QD2A 2QJVA 2VMDA 3U4SA 3ELNA 5FYMA 3TEZA 1F5FA 3ABZA 3GHMA 1W9YA 2C0ZA 2E7AA 2BTVC 1N1YA 4P9XA 5EYYA 5JSOA 3S5AA 1YCIA 2PHLA 4DIQA 1AR81 3ES4A 4BA6A 3VL8A 4DQAA 1PM4A 4K1YA 1IOAA 3IB3A 1DQ0A 2RS53 1RUI3 1U5XA 3M3OA 2VL4A 1LULA 2HBTA 1FPN2 1ODMA 1QU0A 1WLDA 2RR12 3WNPA 2WN2A 2A6VA 3BI3A 1LHOA 2P2KA 3EB7A 3KF5A 3ZFGB 3ZXJA 3I49A 2KA3A 2LALA 4K8RB 4G4FA 1JW6A 1SLCA 3ALQA 1GP6A 2Y6JA 1RUF2 3MV11 1OLQA 4M0NA 2QTWB 2RM22 1WW5A 2FDKA 3M2MA 1SZBA 4AGRA 1KITA 2RDQA 1OQEA 2RJ2A 4HOOA 1SLAA 1TG7A 2J1AA 4X8PA 3ZN5A 1LECA 3LA3A 3IIIA 1V6IA 3MLJA 4WM7C 4IGQA 5FZHA 3GZEA 4F7ZA 5JMOA 1HQLA 4AEJA 2JDAA 1W8UA 3ZFEA 1X82A 2J22A 1RMU2 3RJRA 2FDHA 1RUD3 3EHKA 5KXEA 4CEWA 2CGNA 5D21A 2DVDA 3KWVA 1LGNA 3N9PA 3WDYA 3IAQA 1DQ4A 2XUMA 1CD3G 3IKWA 4JX0A 5HCHA 1SCSA 3POSA 3Q8AA 2OQ7A 2QQPA 4RR3C 5G05L 4XQWA 5F3IA 2EF6A 2AACA 3P3NA 4YZ3A 1Q56A 2D6NA 4BQ2A 4G9SB 1NZCA 4GB32 4Q1RA 2RE9A 1RYYA 1XSQA 3ZN6A 1H9PA 2VQAA 4CA9A 1W2OA 2B9VA 2W46A 5FP8A 3AB0A 4IV3B 4QX7A 3VBFC 1C1LA 4A7ZA 4C0BA 1AR83 1VMJA 2E9QA 1SBEA 3PNAA 1SFYA 4DNYA 1N1TA 3W58A 1F31A 5APAA 3NKTA 2YY1A 5KXBA 1YIFA 3LFIA 1FV3A 1GWKA 5HCAA 3PUAA 2VW2A 2P34A 2KR2A 1GP5A 3ZN6B 3ZXKA 1QJZA 5F3EA 1WA4A 2ZKNA 3A7QA 2VQUA 2GC1A 1SBFA 3LPGA 3MF9A 3BU0A 5DPNA 2JJ6A 4UI9L 1UZ0A 5KHGA 3O1PA 1JOJA 4YW3A 1OPOA 5H9QA 2BGCA 3CJIB 3LFMA 3FHAA 3GXUA 4AZZA 1P8JA 4XFHA 2HWC3 4XURA 2VMHA 4JHZA 1F2NA 3WDUA 1REDA 5DUWA 1O4ZA 1NA1A 1UKRA 1NKGA 4RFRB 3AP6A 3CIHA 1REFA 5JXHA 2Z2SB 5D2AA 5FDBA 5T3NA 3WW2A 3ZXFA 5DAQA 4MSVA 5JXJA 1UY0A 2EIBA 1VP6A 3K77A 2C26A 4B3NA 1W6OB 3RQ0A 3OPZA 4C91A 2CWMA 1GYKA 2VJXA 3BOWA 1QOSA 1HW5A 2LRPA 2PA7A 2R30A 3D82A 3MIEA 3RJ2X 1ZRCA 3VHRA 4AFMA 1WW7A 4CDWC 1ND3B 5J7MA 1W28A 3VB9A 4DUVA 3WG1A 3ACLA 3OYWA 3ZKYA 4YFZA 4BIFA 1XE7A 1OOPA 5F37A 1CAXB 1ASJ1 3RI9A 2VCBA 3EYPA 4FOVA 4URAA 5FBJA 2CL2A 3VBHA 2AENA 2VBPA 3USUB 3W9AA 2AH2A 4QMAA 2W1SA 2XWJB 3VZOA 1XBFA 4ZXKA 2FDJA 3A22A 2Y0OA 1XU1A 2X53S 3AK0A 1POQA 1UY2A 1X33A 1O91A 3W59A 2ZGKA 4K20A 4JDNA 5D8AA 2JE7A 3J4UH 3POIA 4JVAA 3T1MA 1D4VB 1O8SA 1UY4A 2P5BA 3ACHA 1IHMA 3RFRA 2VW0A 1HN0A 4RQPB 2OPWA 1SHWB 4WM8A 3GBGA 1LOFC 3B69A 3RZMA 4QPYA 3RMXA 1OKQA 5FO9B 2ZX2A 3QCWA 3WNNA 1C1FA 4JGZC 4YWAA 2XHKA 3MBWA 1JUIA 5CZKA 3I54A 5FY9A 5IVBA 1LB2A 1Z7S2 2XXZA 4META 3VDDB 3MPPG 4XJ9A 5KWRA 4AI1A 3SHRA 1BVVA 2WNUB 3RYKA 3ZDVA 4H3WA 4OUSA 3LB9A 2PLV1 4RFT0 3ZXAC 2GP5A 2B4KA 3IN9A 5A3WA 3AP5A 5CEHA 5J09A 1ZM1A 3O7OA 2VMFA 5FY8A 1WD4A 3ZYRA 3OGGA 1GOFA 5HXVA 1WMEA 2IXHA 3QH7A 4QPIA 4D6QA 4NHMA 2X5IB 1QQP3 2VCCA 4ZHNA 1K45A 1OT5A 1ZYBA 2UYAA 3CJXA 3RSJA 3WXPA 4AXOA 5DN2A 2FDGA 3ZR5A 4AI8A 5C9AC 1TMF1 1RGSA 2GMPA 1ENRA 3SH4A 1C8M1 3KGZA 1RITA 3A4UA 3LDKA 2BRTA 4IQPA 4XXAA 2BZDA 1QDCA 2WSUA 4H7LA 4LORA 5C70A 4Q4V3 2WJSA 4C0HA 3LEIA 4PBPA 5EFUA 1D4M2 2JWPA 3JBG1 3DEMA 5DDJ1 2A75A 3GALA 2VD7A 3FE5A 5TSWA 2ZHNA 4KWLA 4AVBA 2MEV3 2Z69A 1H8TA 2Y60A 4EYUA 1PGL1 3MFAA 5FUIA 3OUJA 3ACFA 1QJU3 2RV9A 3DUIA 2IXKA 2VW1A 1HB1A 1V6OA 2IZWA 3OY8B 4IDZA 3POBA 3RVHA 1NX9A 1AL23 3BIWE 4LEJA 4N7UA 4UAPA 2DUQA 2GN3A 1O3SA 1KFUL 4W6WA 4OVEA 1JUHA 4RD7A 4TTGA 4Y1UA 4NR1A 4BCUA 2E53A 3LCPA 4P9YA 1KS4A 2VTXJ 2HEWF 2ENRA 2DVBA 4FP2A 4N53A 5FK7A 5A6QA 3KGLA 2R071 3I59A 4GJYA 2PAMA 4YM3A 2WNEA 3AL6A 1CWPA 1UX7A 4XUPA 3EQEA 3N9NA 4LO6B 1K5JA 2RS11 5GLWA 2JIJA 4Q5OA 5C3PA 2D6KA 1TMF3 3O1VA 1RUC2 3AYEA 4R9AA 2DVGA 3POFA 1VRH1 4QPGC 5CKMA 4GJZA 3HR9A 1O59A 2WSVA 1OLRA 1XE8A 2PAKA 4MYEA 5CFCA 1ULGA 3I97A 3OEAA 3KV5A 2NMNA 2SLIA 4WM7B 4Z82A 2UWAA 2FCUA 3PTYA 2ZOEB 5DDJ3 4MHRA 5FZMA 1E5SA 4LULA 4DS0A 3PVNA 3KM5A 3HN1A 2H0VA 2XUEA 1J1LA 3OTFA 4MGYE 4N43A 5LB6A 1MQTC 5CFDA 5CFCB 4E8CA 3FUOA 5FQ0A 3UKVA 2VOXA 4PF5A 2OZJA 1SQ4A 3NJVA 3P5BA 2NP0A 2W87A 5F8PA 1EV13 1AR93 3CKHA 1D2SA 4Y1ZA 3ZR6A 4ZPIA 4Z2AA 5ABJA 5IVCA 4RHV1 4LLOA 2XJTA 5A1LA 5C4WA 2DVAA 3VBFB 3M3IA 2JENA 5A32B 1ENXA 1DLCA 1PX4A 4EJRA 3VBUA 4ZZ8A 2EAKA 2VNOA 4GMP0 2QBXA 1PK6C 3IMMA 3I7DA 2OPKA 4HSLA 5T5OA 1LHWA 1NXD1 2XVGA 4LBQD 3VHOA 5FXZA 2EIEA 2CTVA 5ABJB 3CO2A 2R073 2RHPA 3V0AB 1OVPA 1VAKA 1O3TA 4CDXC 1EAH2 2C4XA 2W39A 5JPNB 2WYFA 1O5LA 2B7YA 2W68A 2RS13 1JODA 3POYA 1W06A 4A6SA 2CV6A 4LPLA 1PVC2 1NCQC 3OJBA 2W47A 3ILNA 1XQNA 1QXJA 3LEMA 1AR72 1GBGA 5LA0A 4CDQC 4B8EA 1VRH3 2G4IA 1MS9A 3LEGA 1R64A 3URFA 4CCCA 3C7EA 5F7UA 5FOBB 3B94A 3INAA 1CX1A 5FY5A 2DU1A 3Q8BA 4PDWA 4QKDA 1IG3A 3FBMA 1F4AA 3D6EA 1PO22 3HNMA 4GXLA 3TOJA 2F17A 1UZYA 2EAAA 1CGPA 2FHRA 4NUBA 1HRI2 2W3JA 2WA3A 3I4IA 2OXBA 2VY0A 4YVSA 3NKGA 2JB8A 2QQVA 3ZM8A 1UYXA 4LBJA 4CDWB 2BPA2 3UGHA 4NHYA 1UIKA 5CAZA 3DXUA 2VZUA 4PDWB 1XNCA 4XEZA 3ZXDA 5M0TA 3ZIWA 1RUE3 4YVWC 1CZSA 2WO7A 1CPNA 1YO8A 2VC9A 3AMPA 4A7YA 2OYZA 2VNRA 1RHI1 3MDPA 4LA2A 2WQ4A 1GWMA 1VAVA 2KD7A 2ERFA 4ASKA 3BALA 4KQ7A 3VDCA 1B09A 5J36A 1Q8VA 3ECQA 3SISA 4EE2A 1GZTA 2WWUA 1HXS2 1ZNPA 3N9LA 2XONA 5KBFA 2YG0A 5AVAA 5EYXA 4LHSA 4D6SA 2JB4A 2GP3A 3TEXA 1Q8SA 3J7HA 1PZ7A 5FP3A 3HIFA 3LAGA 3K46A 3PDQA 2N7GA 1OVSA 4HL0A 4LHKA 2CSGA 4YZ4A 1E5IA 1R1A2 4AVSA 1FOD2 2NYYA 4I02A 4JGZB 4TXWA 4FFHA 4OMCA 4XMIA 4XXPA 3HQXA 5FAXA 5J48A 2P3KA 1VB4A 2BWAA 2YFUA 5FYIA 4YNIA 2BYVE 2L9LA 1BK0A 4LBLA 1FMD1 1FPN3 2AZ5A 2I07B 4Y1VA 1Q8PA 1WGPA 1TZOA 3K3NA 3VBRA 3VL9A 2D98A 2UWCA 2XBO1 1GWLA 4CRQA 4MXVA 1S0EA 1CX4A 2Q8OA 2JG8C 4Q4X2 1RUF3 2LS6A 1GOGA 2WS92 3WQ0A 4WZCA 2RM23 3BIEA 3MGUA 1CAVB 3HN3A 4RS5C 3NV1A 5DXDA 5FIXA 2V73A 2WINB 4JRLA 4DPNA 3PUIA 3BPZA 4Z07A 3AKTA 1CQ9A 1OF3A 3MHZA 1RHI3 3H1YA 1JU3A 4JC1A 2FCVA 4Q0VA 5C9AB 1LAJA 4YM1A 5I0UA 3AMNA 1DYPA 1ZBE1 2XDVA 3OBRA 2GNBA 4GWMA 4JGYA 3RZKA 1U5IA 4ES9A 4AEDA 1HJFA 5C3RA 5FKCA 3SEEA 1TME1 2ZGQA 3JXSA 3I3QA 5FKBA 2D97A 4N90A 4JKMA 2AR6A 4GB33 4XCAA 5F3CA 2NMOA 3APBA 1NE4A 4HVQA 2QDRA 5FYYA 3VKOA 3BYWA 1I9RA 4FPLA 3OBTA 5CISA 3SH5A 1UZVA 3J7LA 3IZOA 4FI9A 4MADA 4QDSA 4QM8A 4BQ1A 1BEV2 5IVYA 4F3JA 5BNNA 4M3CF 3DKQA 1R092 1YFYA 3KV6A 4MGQA 3LDRA 2DUPA 2RDRA 4ZONA 2MNGA 3N4MA 3VV1A 1ENQA 4XPVA 5FP7A 3W21A 4Z1VA 4MOAA 3WUCA 4HT1T 2PHWA 1HKDA 5T55A 4Y33A 1LOGA 4Q8LA 3I2GA 1ENSA 4XIKA 3OEBA 5LEJA 3OGJA 2QQIA 2W1WA 4ZS2A 1FNYA 5FPVA 4M4RA 5GJ6A 2DU0A 2VE1A 2ZHKA 5DG1A 4DFSA 1UPIA 4A7KA 4A45A 4ZZ5A 2DCYA 5FBZA 1G9BA 1MEC1 1UOJA 4CPBA 1XPWA 1QXRA 2OQ6A 1AR62 3V0BB 3FMGA 1MVQA 4CU7A 2D3RA 2RJKA 2D6MA 1HB2A 2CHHA 2ORZA 4XILA 4ZY9A 1WCDJ 2WO2A 5FTTC 2GC0A 4EWDA 2VUJA 3CU7A 4GIQA 5JOZA 5F5AA 2WQZC 4MXWB 4RL7A 1DBNA 4BK4A 4BPZA 5LBCA 1UKGA 5A3UA 1C8NA 1CVNA 2JG9B 2Y8KA 3MICA 3UYJA 4GWIA 4Q8KA 5KXCA 3ZFEC 1ASJ2 4M4PA 3E6BA 2BW8A 2VVDA 4CEWC 4FXKB 3TN92 1RUH1 2DUOA 3O1OA 1W6PB 1MQTB 3OB8A 4LKEA 1V70A 3KVBA 4CUAA 3WF0A 4PJYA 3PJYA 4NPLA 1BQPA 3DV8A 4AG4A 1DG6A 1U5YA 2BQPA 4PIZA 1W2UA 5CADA 2WT1A 4OHZA 2RMU1 1KD7A 4JZRA 5F1RA 4YFWA 2CGPA 2E51A 4IE5A 4BLJA 1SDDB 2WRAA 2QNKA 2QQKA 3OD0A 1DP0A 3GGLA 2IC1A 1I5PA 1LGBA 4AGVA 2BOIA 1PK6B 4JCKA 2VQ0A 4FAGA 5C5UA 3NO8A 1BLZA 4E2SA 4QDRA 5FYBA 4IETA 5KHKA 1ZBA2 2ZGTA 1XNDA 5FWJA 3B9CA 1NE6A 4QAWA 3ETQA 5DAPA 3B3QE 5FZOB 3W5NA 1HB3A 1HRV1 1EY2A 3AXEA 4M3CA 4P9JA 4XETA 3V64A 5I8YA 4CDXB 1SLLA 1PO13 2QZ3A 4EQVA 2UY9A 1AX2A 2VUDA 1CESA 5GZEA 1MR5A 3NV2A 3AFKA 4FTEA 2ID4A 1KXGA 1W6QA 1OFSA 2P1BA 3AKRA 2G9GA 3LPFA 1Z7S3 5IT6A 5LWBA 2GNDA 3OSDA 1OBNA 4CDQB 1W2AX 2PLV2 1JOBA 2OX0A 3T08A 1PMIA 4AHXA 2VAUA 5LY2A 5LW9A 4XMAA 2PELA 1RINA 1NA1C 1W6NA 4RN5A 1S55A 2JDPA 2PHXA 3OGSA 2BERA 1MZEA 3QOPA 4UYBA 3CQOA 1RVF1 5FMCA 2YDEA 1RL3A 3KLSA 1WLCA 2DURA 2R7EB 4GALA 5C3SA 2NPIA 4LKFA 2C5DA 4I0AA 4ASMB 2ZGLA 5I0TA 2JDZA 2DYCA 5JCTA 3U0ZA 2YGMA 3O5SA 2BEOA 3IMNA 5A1AA 4OZXA 3OPWA 1W8TA 4L0PA 5FZ1A 4AFDA 4QXHA 2ORXA 3NAPA 2RMU3 4QX5A 1N1VA 4B4PA 4YVWB 1OOPC 4TSVA 4C1XA 3PLQA 1NCRA 1H9WA 3JBG2 4CXXA 2W52A 5ACA1 1D4M3 3H1WA 1DCSA 2J1VA 3VBHC 3IWZA 1JZ7A 4GA9A 1S0DA 2UURA 4HXCA 3LF7A 4AEKA 1UW8A 1BHGA 1Y9GA 2R1BA 4K40A 1WD3A 2DCTA 3NL1A 3KZ4C 3VKMA 3AKPA 2PHFA 4U2AA 5EXOA 3E5XA 5D8AC 4R4ZA 1FXZA 2OIIA 4R9DA 2ZPXA 3OF1A 4CCJA 2V4AA 1GR3A 3WCRA 5AC92 2PHDA 3TYJA 3AL5A 3FL7A 3U4XA 4WM8C 3HBZA 1O8PA 3M4FA 2NN8A 3AZZA 3ZPYA 4E2QA 3O1TA 2ZEWA 2WO3A 3DL3A 3ZKUA 2WO1A 2CGOA 4IGPA 5BV6A 2XJQA 1SPPB 2VQTA 2WABA 2ZZJA 5FYCA 5HPOA 4BWOA 3VZMA 3WY6A 3JZVA 2FDFA 2EA7A 2J1EA 3UJQA 1MS1A 2FZ1A 2YBPA 4CZSA 2HLEA 1QH7A 3ZYJB 3TNQA 4EN0A 2JG8B 3DN7A 3EBRA 2VZRA 1RUC3 1VALA 4NE9A 3ZVXA 2EIDA 1W9WA 4YSFA 3JQXA 4QPIC 3GCXA 4I0WB 4Y1YA 1FATA 4LO8A 1YHFA 1S2BA 4CDUA 3R4DB 3ZLIA 1GNHA 2V5YA 5A7NA 1HQNA 2A1XA 2XJSA 3PVBB 2W0XA 5F32A 4P5YA 1FT9A 2BUKA 2PHTA 1RUJ1 1J1TA 1RUD1 1UQXA 1WLTA 2JE9A 2VNGA 3L2HA 4X6RB 1R081 2ZEYA 4XW3A 3MUZ1 3THPA 4BK5A 3SITA 1YLLA 5L7OA 3NSTA 4OI0A 1UIJA 2Z4FA 2X09A 1NT0A 1ZA4A 2Y6HA 4CDUB 3N7LA 3H42B 3PURA 1SBDA 2FMYA 4Y4RA 4IEPA 2WNVA 3WP5A 1UU5A 1W6MB 3F95A 4J25A 1GSLA 3VHNA 1UOGA 3NQHA 4CU6A 1AXZA 1ND2A 3D0JA 3I2KA 4D7SA 1H8TC 3ORJA 3NV3A 1ZVFA 3TEWA 1X8MA 4DMIA 1UX6A 5C6CA 5JPMB 4LBOA 1QJX2 3WNXA 3ZN4A 4H2AA 3SQOA 1VMHA 2J1TA 5DZEA 3RZJA 4LT5A 4ORFA 5JZGA 5FY0A 1CZTA 1XNKA 4H14A 1OUSA 1AZDA 1ULOA 4UF0A 1IG0A 3LEKA 2Y6GA 1GZ9A 3EJKA 4K8FA 5FZGA 4LA3A 1PVC3 4Y22A 3NV4A 1V0AA 2HWC1 4N53C 2WZR2 5FRAA 4JV4A 4LK7A 2ZXQA 3C7OA 5GLTA 4C8DA 4XFBA 5C33A 2ZX4A 2QQUA 1RUG1 2D3SA 2Y38A 3AZXA 3I2JA 3IPVA 3KMHA 3O0XA 5JZGB 1WCUA 3FHQA 4I3PA 5C8WA 5KC5A 4IV1A 3S7IA 2NM1A 4ISRA 3WF3A 5GLUA 2VZ3A 1CIYA 1IQDC 1KEXA 2VG9A 5GKAC 3VD5A 1RUJ3 4IE7A 2YBKA 1FX5A 1R083 2D93A 4GH4A 1HRI3 5A33A 5A3TA 1JBCA 1YQ8A 4Q1PA 2PFWA 1W9TA 2EALA 4DXSA 5CFCC 1BBT2 4M0HA 3KV4A 3D4KA 5A7PA 2VPVA 5FZFA 1K5MA 4S2HA 2ADEA 4WVVA 4A3XA 1UO9A 3ZFEB 4CSWA 4Q4W1 3M7AA 1BXHA 3OGRA 3MUY1 3N7JA 3V65A 4BQXA 2XJPA 3MEPA 3UESA 4CEWB 3H7JA 1AX0A 3WHUA 1IKQA 4P9IA 2W9XA 4N43C 4J1WA 1EP0A 3MLLA 4L8QA 5CFDC 2CAVA 3JD72 4YG3A 3NJYA 4DO0A 2HWF2 2QUOA 3G6JB 3FBYA 3VKLA 5EJ3A 5A3NA 2V4VA 5ABJC 5J1XA 1POV3 1VBD2 2OZ6A 3GDBA 1A3KA 2R0HA 5C4WC 1ULEA 3I2OA 1HV0A 1H1AA 3M70A 3K51A 4OUMA 1PHMA 2VO5A 3VBUC 1JYIA 1COV2 1JHJA 2EVXA 3H3ZA 5JSRA 4NHKA 1DIWA 2HWD2 1UD1A 4QX8A 2ZX3A 4XFAA 3TAYA 1BCXA 4NAOA 4IESA 3BKZA 1G9AA 4LE4A 4XJUA 1HJGA 2QQOA 3H8XA 3D3AA 4Y1XA 5L9BA 4DY5A 1QF3A 1RUG3 4IEWA 2UU8A 3BCWA 3WNMA 5CKNA 3MZHA 3HWJA 4OMDA 1IS4A 1SEFA 3WNLA 4CCNA 3N9MA 1UN1A 2OA2A 4IE6A 1DQ1A 1QJY1 2X05A 1G6NA 2BJSA 4BXFA 4XAAA 5LA1A 1UCXA 1X8EA 4NHXA 3WP3A 1WMXA 1YQ2A 1O5UA 2PTMA 2VMIA 1GQHA 3O14A 3N9QA 3IIAA 4AVAA 1NA1B 2YC0A 3B02A 4Q4X3 1VIWB 2BNOA 4BMBA 1EUUA 4G3YC 4N7IA 3BVCA 3WINE 2J1UA 2OKXA 1A8DA 1PX3A 4PDWC 5FZEA 3CDZB 4DXTA 3JUUA 1DZTA 2ZMKA 4CE8A 1QQP1 4Q4W3 1HQWA 3GCWA 2HWE2 2VZOA 5E89A 2WYSA 4XFCA 4PI2A 4YVSC 1XSRA 2OUHA 3HEIA 1HDKA 4M3CE 1OQ1A 4OHWA 3AJZA 4CU9A 2Y64A 1UOBA 2EXKA 2BU9A 2B45X 3RYRA 1X7NA 2SBAA 3OYWB 4P02B 3Q8EA 1YJLA 3GHNA 1S0GA 1YFXA 1OOPB 4FPKA 4NRPA 4Q4V1 2YU1A 5H9RA 1U12A 3D0SA 3SCGA 3WNOA 2CNAA 1YI7A 1RTVA 1Y9QA 1QGLA 2WAOA 1X9PA 3E6DA 3H9AA 3VBHB 1L7LA 5LASA 4AVVA 3ITQA 1YUDA 1LHUA 2WFF2 4BE3A 2JE8A 1UL9A 2YMZA 4WVWA 1CAUA 3LWCA 4Q4Y2 4D3WA 2IXCA 5FZCA 2MEV1 3BN6A 1E5HA 5LA2A 3ZYIB 4JAAA 1QJU1 5FUNA 4NROA 2Q1MA 5D8AB 4R52A 4JHTA 4IGOA 2X8KA 1W3XA 2WWSA 4PIXA 5F2WA 1BEV3 1KFXL 3H1MA 1QJY3 4OUEA 1AL21 4PQ9A 1OLMA 3O1RA 3FZ3A 4MLOA 1OI6A 1R093 3FX3A 2A70A 2VUAA 4WM8B 1PIV1 1APNA 2ZABA 5I8TA 4I0BA 3N36A 1H8VA 3KVAA 4TWTA 1LHNA 1VBC2 1AYN1 4LE3A 4UFLA 3NNGA 5CKQA 2NZ9A 3MIBA 1PGW1 2K9ZA 4MGKE 3HPNA 1VBE2 1OA3A 1OH3A 4Y20A 4NIIA 5GZGA 4UWDA 5IFTA 4D8MA 3JQWA 1CJPA 1VBA2 4FOYA 3VBRC 3UV9A 4NWWA 4XE9A 4FBFA 1CAWA 2BNNA 3LDBA 5E6HA 3FUQA 4XZUG 3D5OA 4CCKA 2XLAA 3IT8A 1S0JA 1YIPA 5EJZB 5G04L 5J37A 4XACA 4AI9A 4DUWA 1NY71 4QPIB 2R1DA 3MI8A 5EJ1B 5JWPA 3KCYA 5IYYA 4M00A 2ET7A 1H30A 3N7MA 3WF2A 2IFWA 1CJDA 2AGSA 4Y26A 1IS5A 5FP9A 2HWB2 1JYVA 1A34A 2W5FA 1RUH2 4JGYC 1OH4A 5H9SA 1XYOA 2I74A 3UKNA 4IE4A 4AEDC 4CCLA 1WMDA 2ZCWA 5IVJA 5HCBA 3RZGA 1H2KA 1AX1A 3KCXA 3M3QA 1EUTA 3I2DA 1QWRA 1EV11 1AR91 1Z0HA 1ZRRA 4LBQA 4COUA 1DLLA 2QZ2A 3A21A 2QQJA 2V09A 4IEVA 3ST7A 3UKTA 4MGTA 1L7RA 4EZ4A 2Y33A 1PIV3 3THCA 3J8F1 5EWSA 1H8TB 3ATGA 3UJOA 1W8ZA 4AR2A 3DF0A 5BUVA 1J84A 3PUHA 4PF1A 3S57A 4AVTA 1AYN3 2YUEA 4UW4A 1FYUA 4OI1A 5CIRA 5DG2A 2QQWA 3H3UA 1GANA 3KF3A 3MFCA 5BNNC 5JR2A 5F6LB 3UGGA 1BMV2 2VXRA 4PI0A 4TN7A 1A6CA 3VD3A 1AYM2 1DFQA 2DF7A 2RG4A 3GNEA 4JDOA 4YM0A 2GU9A 5A7SA 1LR5A 4PCRA 2RS31 1C28A 3C8XA 4QWNA 5I91A 2G1MA 4Y5Z0 4XHXA 3WQ1A 1GZCA 3NNFA 4FAHA 1CZVA 4N53B 2DCZA 2ZZQA 5T52A 3I59B 4LBNA 2QVSB 2WQ8A 5FMOS 2FMDA 1DDLA 2R6QA 3H7YA 3PTRB 4JRAA 4DXRA 1S2EA 1XJAA 2IVJA 2JG9C 3KHBA 5FZAA 4L11A 1YQCA 4KNCA 5I93A 1V9U2 3FJSA 2ZMNA 3RGBA 4K7JA 1LNSA 4MVTA 1OD5A 4HONA 1W0PA 4XDQA 5BXXA 3SEPA 1SLBA 1YYNA 3U10A 4DB5A 1GNZA 1LEDA 4QQ2A 3T2TA 4NPMA 1RUE1 4YPJA 4OHVA 3MYXA 4I3GA 4RR3A 3H8RA 1TVGA 1V6LA 5F5CA 2YU2A 4UBHA 1WLWA 3GJBA 3J8F3 2UWBA 4HN1A 4N43B 2W1UA 3AYAA 3NNJA 4OYUA 5CFDB 4UFKA 1AHSA 1QNYA 1Q8QA 4LOTA 5FQ0B 3ZO0B 1TEIA 2VMEA 4UXAA 4BYYA 1QOOA 2R041 3A0KA 2B9UA 1MVEA 4COZA 2VZVA 5C4WB 4KU8A 1TE1B 2XB6C 4QQPA 1C5IA 2WBKA 4KGGA 5LATA 3VBUB 1SG3A 2WWJA 1ZRDA 3MV01 2BGPA 2RS33 4QKFA 3VN4A 2AREA 2XKPA 5AC93 5IK7A 5IK8A 1X50A 1AL0G 1H6XA 5FJKA 3RDIA 2ZGPA 3ZXGA 5A6YA 1MZ5A 1LODA 1AJOA 3PUQA 2B8MA 2RS52 4Q0UA 1QHDA 1RUI2 2HJIA 5CBLA 5IVEA 1JH5A 2Z42A 2ILMA 4QB1A 2E31A 2E63A 2IUWA 1FPN1 4HANA 5FXWA 5C8CA 4AFCA 5FY1A 4I30A 1B35A 1IPJA 4P00B 3AMHA 1BVP1 3R6SA 1JXNA 3RZZA 4FP3A 2HYXA 4KWKA 2PYTA 5LRSA 5JR7B 1RUF1 2Q0AA 4NJ4A 3J7NA 5IJRA 3RWNA 3NMBA 5HI0A 2RM21 3PMEA 4HMZA 4FQ4A 2LM3A 4Y5TA 3AM2A 4MX3A 4XVHA 1QJEA 1W0NA 2D44A 4B1LA 2R062 2JIGA 3AP4A 3DYOA 3P6BA 1OA4A 2ZAAA 2VULA 5ERLA 5ANQA 3POJA 4YVSB 1L7QA 5FZ3A 4B7EA 4IW3A 2A73B 4LBMA 5GM0A 4C90A 1IS6A 5CVRA 4LQRA 2TNFA 1RMU1 4HKOA 1CPMA 4H55A 5LK7B 2W94A 1VBB2 2R043 2Y0IA 3NAPC 4K21A 1JYXA 1JYCA 4ET7A 2JDHA 4ZU7A 5JDBA 2HBUA 3R4UA 5LBBA 5T5LA 1UXXX 2QQNA 3UT0A 1NCRC 1W03A 4OCTA 3WUDA 4BOWA 5FUPA 2G9FA 4IEZA 3SH3A 2BDRA 3LIHA 4GB31 2P6HA 4BXSV 2XPJA 1S0IA 1DGLA 5GZFA 1AR82 3M3CA 4XJWA 3ZFFA 1Z78A 2WNOA 2ADDA 2QDNA 1WMFA 2EXHA 2JD9A 4BDVB 4YG6A 2P17A 2FBEA 1PVXA 4HPKA 1V00A 2P3YA 4KU7A 1QJX3 3WVJA 4BM8A 4KH9A 4M01A 2C9KA 2OS2A 2VMGA 1NQDA 1NLSA 2D5FA 1ULPA 4BU2A 2RR13 5C3QA 4QHZA 5FMOL 4R9BA 2V5DA 5A7OA 5CG8A 1IS3A 1F9KA 3GJAA 4WVMA 1UAIA 1SACA 3ES1A 4KWUA 4ES8A 5KC6A 4XFIA 3FN9A 4FPYA 4GKXA 3VZLA 3PVEA 4PHZA 3VBRB 5BNOA 2JKBA 5DAXA 1OSGA 1Y9MA 5LK5A 4IEOA 4XUQA 3VBOA 1AF9A 3AZYA 1UOFA 4NMIA 2R49A 3EO6A 1WW4A 1RMU3 1JYNA 1UF2C 4QQLA 3RG0A 3K4ZA 1TNRA 4LTAA 1BYHA 1NLRA 2TBVA 5L73A 3ZSLA 1WUVA 1OLME 2R32A 4CDUC 2VZPA 2WN3A 4HKWA 1BBT3 1I5ZA 5IK4A 5EQUA 3T0BA 2ZGNA 3EXUA 3JB8A 3UGFA 3FC0A 3I3MA 1RJ8A 1WBLA 1VJ2A 1WW6A 3THTA 4FTSA 1W9SA 4OQ9A 2WT2A 1ZZ9A 4OLLA 5A3MA 2VZQA 5L7OC 3I3EA 4JGYB 3P3PA 1LCLA 1MS4A 1W39A 2DCJA 4RYDA 4AEDB 2EXJA 4HBNA 1N3QA 1VPHA 4CP9A 3MIFA 4AE2A 3VD9A 1XNAA 5DQ0A 5FPUA 5LY1A 2I2SA 2Q30A 2WNVC 1DQ6A 2VGDA 3KT4A 3QD6A 5BNPA 4UW5A 1JZ5A 5BY5A 1RUNA 3POEA 1ND2C 4ASLA 2K0GA 4HKLA 4FFFA 3O1UA 5FLJA 1NQJA 1COV3 2JXAA 1WCKA 4CCEA 4LO5B 2Q8EA 1XC6A 2IWGB 5A6XA 3HBKA 3T4VA 4MG2A 4BQYA 2VR4A 3U1XA 3O1MA 4PLOA 3VKFC 5BNNB 5JSPA 1PZ9A 3PIJA 5JZGC 1NUKA 3O0WA 1V6KA 1FAYA 3DKWA 1PO11 4NAMA 3ZPOA 4YZ2A 2GDFA 2GSYA 1F35A 4FQZA 1J3RA 2ZTNA 1S0BA 4P9WA 1Z7S1 5IUQA 4WVZA 1QKQA 3SC7X 1KGYA 1W8HA 2GC3A 3N3HA 1XXNA 2F6BA 5JXIA 2BGOA 2YYOA 4O7XA 2UYBA 1C57A 1W8WA 4IV1C 4QPGA 4YRDA 4Z92B 3HNBM 3ACIA 4FFGA 3U11A 4I09A 1QQP2 4FFIA 5ANNA 1HIXA 5B4XA 3P1IA 4W6XA 4GH4C 2DWRA 4XABA 4QM9A 4BISA 3T30A 3ME2A 3ZSKA 1UMZA 4XFGA 3AC0A 1ACCA 1Y4WA 1W2TA 3CEWA 1F8VA 3KQRA 3NRUA 4AVCA 1QDOA 3AX4A 1K5MC 2WLQA 2B39A 5IK5A 1RJ7A 3ACGA 1IPSA 5F39A 4E4HA 3NNMA 3A23A 3E97A 3VDAA 1D4M1 4XUTA 2K46A 2ZKLA 3LIGA 2XJVA 5IW0A 5T54A 2QQLA 4HVRA 2WFF3 3NW4A 2CAUA 1H4HA 4FT8A 3ILRA 2MEV2 2NQYA 2VM9A 4KWJA 4K6BA 2O8QA 1PMJX 3I2IA 3WW3A 4COWA 3C7HA 5SV8A 5GALA 2K2SA 5DZGA 4ZS3A 3FFQA 5EZWA 5KHIA 2Q1ZB 2QKDA 1AL22 3HOBA 1AXYA 4QQOA 4QU1A 3I2HA 3WDXA 4FTBA 3S30A 4UW3A 2JD4A 2DV9A 4LOSA 3PUSA 4XIOA 4E4ZA 2VMCA 4M3CB 4LKSA 1VBC3 4YZ5A 2RJLA 2VECA 5LA9A 3ZSJA 3MIHA 1W6QB 1VBE3 3WLUA 1T6GC 1WA6X 2LW8A 4ARXA 3VD4A 2XQRA 1MS5A 3RS6A 1URXA 5JI9A 1ZRFA 2VU9A 3GZTB 4I01A 4AW7A 3VBSA 4N8MA 3JB4C 2C9AA 2O0OA 1TMF2 4GWNA 3SKVA 4NIDA 1W6NB 1PMHX 1C8M2 2YC2A 1RUC1 5L36A 1JU4A 5HV4A 4U36A 3CZUA 4GWJA 4QX0A 2BBVA 4XDPA 4MGZE 3PVOA 2A3WA 1GUIA 2BNMA 4E8DA 4Z8BA 3M8LA 3Q8FA 5DDJ2 5DABA 1HN1A 2HEYF 3VBSB 5GZCA 3DGTA 2HWB3 2DTYA 3HJRA 4NVPA 1LESA 4DOUA 1QNWA 4O65A 2IVIB 1PNFA 3ZSMA 4OULA 4GQ7A 1PGL2 2FQPA 3NAPB 5F5IA 3TRSB 1NAEA 3HT2A 4YW6A 2DFCA 2VOWA 5BNQA 1NCRB 4QGNA 4KBZA 1QY4A 1GNYA 2GNMA 2W08A 2Z5WA 3BGAA 4QDQA 1G9CA 4EN9B 1VRBA 2P4EA 4QKNA 3LZZA 5LZ6A 4N9HA 5FP4A 4CP1A 1HB4A 2ZGMA 2JECA 2BWCA 2E7TA 3K3OA 4V1PA 2CY6A 5CB7A 3LGRA 3FLTA 4FO9A 4XOGA 2UY8A 3G7DA 4HZFA 1G86A 5FZ4A 2R072 3QH6A 1OC1A 2BOJA 4QPWA 5FYZA 4A4AA 1QEXA 1YNAA 4IEUA 3WT3A 5L9VA 2XOMA 4K3UA 2KXLA 1EAH1 4LO4B 2RS12 1AYM3 3ZSEA 1IGOA 2AUYA 1DYOA 3AJYA 1AXKA 1Q8OA 1PVC1 3HVDA 4FPFA 5FZ0A 5BPXA 4X8NA 4XHBA 2GC2A 1VRH2 1AR71 4CEYA 4DEQA 1O3RA 4QXKA 1UZZA 4J1XA 5CA6A 3VZJA 4NWVA 4P9LA 4DRRA 3HQUA 5A3PA 3Q8CA 2OW4A 2D6OX 3IDBB 3LA2A 1J59A 2WAAA 3KT1A 1Y3TA 2DDUA 2AEYA 2VOKA 1PO21 2Y6KA 4P9GA 3Q9OA 1DGRN 1S4CA 1E57A 1HRI1 1KJRA 1OD3A 2HEVF 2C6SA 3IBMA 4LIUA 5A80A 5F3GA 3AYCA 2Q8DA 5EIYB 1X36A 4LUMA 3O1SA 3DPRA 4OHYA 3RRDA 4YARA 1JTZX 1US2A 4QB6A 2XGXA 4RHV2 4B1MA 2ZEZA 1W04A 2ZGSA 5I0DA 3JCIA 2E33A 2P6CA 3HT1A 3CZJA 4Q26A 5CNAA 4AHWA 4K1ZA 5L7OB 5K8SA 4B29A 1LRHA 4AFBA 2Y34A 1LHVA 4ZU4A 5FYHA 3NJXA 4MZUA 2ATFA 4YW2A 1RIRA 2XL9A 1UPSA 4LXLA 4TZDA 1CR7A 3B01A 3RI8A 2WNVB 2QCSB 1HV1A 1POV1 2WZEA 5HCFA 1HXS1 1EAH3 1PNGA 1ND2B 2VVEA 3KSCA 4Q29A 2XL7A 4XQ4A 2W1QA 1FI2A 1KQRA 3WSOA 3ZFGA 4R4XA 2TEPA 1AR73 2VTFA 1F15A 3PU8A 1O7FA 1A78A 1ZZCA 2H6CA 4S2DA 4XJAA 1NYWA 2D6PA 4L99A 3U07A 1R1A1 2CDPA 1UU4A 4LLFA 1FOD1 2A3XA 1OXCA 4UF0B 4CUCA 4HETA 2CYFA 2HKXA 3R0RA 1PO23 4PIYA 1ZA7A 4Y22B 4AQ6A 2ZGRA 3MIGA 4KG8A 3AMQA 4NIAA 2GN7A 4LO7A 5FPBA 3IPVB 4Q4X1 4YGBA 3ZYHA 1H1MA 3VZKA 2D6LX 3BTYA 2WS91 4IV1B 2ZGUA 3PL0A 5FFOC 2Y6FA 5A7WA 3T0DA 4LBKA 4IERA 1I3HA 3O0VA 1G9FA 5FPAA 1JZ4A 1N3PA 4KL1A 3U75A 5IWFA 2R063 4LIVA 1JZ6A 4GH4B 4CCOA 1RHI2 1EYBA 3QBQA 5A33B 2XJUA 4PT6A 4XUNA 3FWEA 5DZFA 3RMYA 2D43A 4Y4YA 4IV3A 1JZ2A 4HSJA 1IKPA 5A7WB 2LROA 1K5MB 4INDA 4XF3A 2JDNA 3UK9A 1VBB3 1PZ8A 4PLNA 1UMHA 1HXS3 1GQGA 5B4NA 1YJKA 1CIWA 1D2QA 4LK6A 3J7MA 1S1AA 3IDCB 3MW2A 4NO4A 4EN7B 1BK1A 2DVFA 1XNBA 3WW1A 3BTXA 4QX2A 1UY1A 4HVOA 1R1A3 2CU5A 2VXJA 3CJIA 1FOD3 4B4QA 3E5QA 4YW4A 1V6NA 4D6RA 1DZQA 4WBBA 1BEV1 4BQWA 2BP6A 4LMFA 5JIAA 1ZX5A 4AAPA 1VAMA 1FMD2 3W5MA 1YFWA 2XWBB 5IFPA 1LEMA 1A8MA 1R091 2XBO2 3AZWA 4NN0A 4AGGA 1W0OA 5T50A 1LTEA 4XBNA 4CXWA 4BIOA 2ZS6B 2JKXA 4LJHA 3VKNA 4OI2A 1W6OA 5K7PA 4W50A 1H1IA 2BVBA 4XQDA 3OUIA 2J1RA 2WS93 4QX1A 1HX6A 1AVBA 5FZIA 4B7KA 3HQRA 3IDAA 1MPXA 1E5RA 4LUKA 1D0GA 3DXTA 4XF0A 1GLHA 3LQCA 3QLQA 3CF6E 5C8CC 1ND3A 4TLFA 4D94A 1POV0 1B35C 1AR61 2MHFA 4LR4A 1HLCA 2DBNA 1ZRIA 5K0UA 4BJ0A 1CAXA 3AP7A 2VZTA 4JQTA 1ZBE2 3PIGA 5FLIA 2JDYA 3GYDA 4L9BA 4A3ZA 1TME2 2FCTA 3USUA 3BU7A 5DAVA 4EN6B 2A6XA 2WLPA 3ZYGA 5J3UA 3S6PA 2ARBA 5KR7A 3X29B 5KHHA 4XBQA 1XOYA 4UFJA 5K0UB 2JX9A 2QQMA 2J42A 3TEYA 1XYPA 3TN91 2Q8CA 2PN5A 2Z79A 4AI3A 1MZFA 4RQPA 4CCMA 4E27A 3WG2A 2VTXA 3WP4A 1UWWA 1VB2A 3AYDA 3BODA 5J98B 5IVVA 4W8JA 1EPZA 1VE0A 2OUJA 2X29A 4EROA 5JOXA 1XYNA 3W20A 3WP6A 2OT7A 4V2VA 5FO7B 1CAUB 4AI0A 4DUXA 4QGMA 4RGGA 3ZFFC 1BKZA 3USSA 1Q5OA 3POGA 1UYZA 5KHJA 3DECA 3VDDA 2RDNA 5JI7A 4FPGA 3ROUA 2VBBA 4QXCA 1QIQA 1LOAA 2WNUA 3I3BA 3ASIA 2VOVA 1U5ZA 1G8WA 1ZBA1 3K4AA 4J6GA 4EN8B 2QFEA 2NLRA 2P3IA 5KXDA 2YV8A 1GP4A 1DU3D 1MEC2 1PO12 2WR9A 3M1HA 4EZHA 4QB2A 4V2WA 1AR63 2I45A 2O1QA 1OA2A 2XHNA 3BOPA 1KDMA 3S5QA 4YGCA 1SLTA 2W91A 1KRIA 1C5HA 1W3VA 2W2IA 2X5IA 4XC9A 4A44A 1LU2A 2ZHMA 5EPAA 4Y20B 3GF6A 1K3IA 5JOWA 3CBNA 5K4LA 5L19A 2AYHA 4YM2A 4I2OA 4Q27A 4P08A 2H6BA 3U37A 5BNOC 2YB7A 1JMUB 4YG0A 1US3A 3RZLA 2D3PA 1CN1A 1CAWB 3NJZA 3WD5A 3VBOC 1U0AA 2YHJA 3MIDA 4LNVA 2A3YA 2F4PA 4GMP1 4F8AA 1ASJ3 3B5LB 1UU6A 3ZX7A 1TNFA 1VLNA 2ZACA 2XJRA 3N7KA 4S2FA 4L92A 5A7QA 5GLVA 3TN93 1H4GA 1KJLA 4NRMA 2GH8A 1V6MA 4L97A 5EV7A 1DGWX 1JOPA 5FY7A 2VCAA 4YZ1A 3H8OA 1H2NA 2RMU2 3N9OA 4A42A 1FV2A 3JU9A 2PMWB 1SDWA 1REEA 3TNPB 5IHRA 4JTOA 1MACA 3FFZA 3OY8A 5BYNA 1YXWA 2CWSA 4YW1A 4NIGA 3AP9A 4AF9A 2EIGA 4BLIA 1Y43B 2ES3A 4BB3A 2B46X 4LBQB 3FHIB 2A7AA 5IATA 1ZBA3 4XJZA 1RC6A 2MPFA 1HRV2 3ILFA 3QACA 5E88A 2PXJA 1WKYA 3LE0A 5T5JA 5BNPC 1JYWA 1JI6A 1LENA 2G9ZA 3LSDA 2R0FA 4PBOA 4YW7A 2F4LA 2GNTA 4BMEA 2XKOA 5AC91 4H7MA 1BJQA 4IEQA 4Y24A 3ETPA 5B2GB 1ZZBA 3SNMA 1XU2A 5LEKA 3DCQA 2PLV3 3GZAA 3RYPA 1WBFA 5L9RA 4WZFA 2WZPP 1V6JA 3UETA 1WCSA 4XF9A 4CYDA 5FO8B 3I2FA 3MF6A 1PM7A 5SV5A 2YPJA 4FSJA 5FZ8A 3AVSA 3IAPA 4MGIE 5FYVA 3RNSA 2YGLA 3VZNA 3SMHA 2A6WA 4XTPA 3T2QA 1RVF2 1NZIA 3CNAA 3OOXA 1IPKA 2O14A 4HN0A 4KGQA 1VR3A 4GMP3 3WCSA 4LHLA 1RUOA 4XUOA 4WM7A 1GFF2 4QXBA 4BH9A 5C71A 1UMIA 4MGSA 5FMDA 4CVUA 5FZBA 2GH2A 3SXWA 4AQ2A 2C1FA 1C8M3 1GU3A 4SBVA 3AZVA 3E6CC 3WX5A 4AOCA 2WL1A 2JDMA 1AUYA 1H6YA 4FXGB 4AFAA 4OHXA 5H9PA 3NNLA 5ACA2 1UYYA 3JBG3 2O8OA 1STMA 1LKNA 4UW6A 3B93A 1W8FA 3R4SA 4HG6B 3KQ4B 5AFEA 1GMMA 3VBFA 3WDVA 5A32A 2E7QA 1Q43A 2WT0A 4QT6A 1O4TA 4LHNA 4BZ4A 3E1F1 5E8AA 3C7GA 4TLGA 3ZDSA 4O9GA 2KM2A 3T2OA 4RR3B 3BTZA 1YC61 4IEYA 1YWKA 5LBEA 2VVFA 3J26N 2HH9A 4ZU5A 1F4HA 2WC2A 4XF4A 1CONA 2GZWA 1YRZA 2Q5TA 3ZMOA 3V0AA 4A2UA 3OGVA 1DYKA 4L2NA 1DZRA 3AMMA 1IQAA 1UZWA 3KB5A 5DUUA 1GQPA 1YQ6A 2EXIA 1ALYA 4D7YA 4RA0A 3TBDA 2JICA 1G7YA 1QJX1 4PLMA 5FPLA 2A6YA 4GULA 4E9KA 4AEMA 1H2LA 1IZ3A 2WIIB 2RR11 4BHPA 3WOGA 2LUWA 2AC1A 2YFZA 5F2SA 5IAVA 4CUBA 4CTEA 3H3LA 1UNBA 4QHBA 1ULDA 1DQ5A 1XRUA 3T3YA 5JUVA 2ZEXA 1EPWA 4AWDA 4QKBA 2G19A 3U14A 3WG3A 3VD7A 2WZR1 3GZUC 3E5UA 4E4SA 3ENRA 3VLBB 2BBAA 4S2GA 3ZYFA 4EV0A 1VMFA 5C8CB 1AJKA 2DCKA 5F6KA 4CDWA 4JQRA 1MS3A 3KT7A 1B35B 3VBSC 5FREA 2GALA 2IXJA 1RUJ2 5FYUA 1RUD2 1LU1A 5D1IA 1R082 3GM8A 3FLPA 3LOBA 5AFBA 1S0CA 2WKKA 5J96B 1QH6A 3UNPA 1J58A 1OPMA 1NXMA 1S0FA 3AKQA 1BBT1 1GV9A 3MPBA 4FPEA 5JAXA 4XYXA 4W65A 2CDOA 3THDA 3RZHA 4Q0QA 1UXZA 1W05A 4KI5M 4RHV3 3A0NA 4YW5A 3SCFA 3WDTA 4COVA 2GMMA 2VOTA 4AQTA 4K9SA 2BVVA 1YQ5A 3NVCA 4JTNA 4QU2A 1WZXA 3B9IA 4EWAA 3LOIA 4FOQA 2PQSA 1ST8A 2YXSA 3JD71 1LOFA 3R05A 1DGWA 2PHUA 4GAZA 2HWF1 4QHOA 2B42B 4SLIA 3T1LA 3C7FA 4RSUA 4WV8A 5FYSA 5C3OA 1DGRA 3LSEA 4FPOB 3VUOA 1BZWA 4JGZA 1VBD1 4IE0A 4MV2A 2ARXA 4IXLA 2WFPA 5DAWA 1XE0A 4D0QA 4Q0PA 4AK3A 3ZFFB 4CXYA 1COV1 4Y5SA 1QOTA 5LBFA 2HWD1 2HWC2 4HPKB 2WZ8A 3N35A 2X10A 3OCPA 2XLGA 2WZR3 5FY4A 5I8SA 5A70A 1RUG2 2E26A 4AL9A 4RGKA 3AKSA 4CP2A 2XVLA 5F5QA 2YZ4A 4YYOA 2XQXA 1CAVA 2GMEA 4N9IA 3WR0A 5CG9A 4TYSA 1OQDA 4IL7A 2E6VA 2EICA 3CL1A 3J9SA 3WQBA 3L2YA 4WVMB 4MH0E 4JKLA 4MO3M 3TB0A 4CEYC 4XCBA 2ZA9A 5FJHA 4XAEA 4CUGA 3WNKA 1TQ5A 1ULCA 2XLFA 1J83A 5C9AA 3DYPA 5BNOB 4NHLA 4X6QB 1W2NA 1LOBA 5FPXA 5CYYA 4D69A 5JVVA 3VBOB 3OUHA 4P5HA 4Q4W2 3BTAA 3K4DA 1ZZ8A 2HWE1
chains in the Genus database with same CATH topology
3S5AA 4NPLA 3KHCA 2FDJA 4QKNA 4MGTA 4IE6A 4IE5A 4NRQA 3BI3A 3RZLA 3I49A 4O7XA 3RZMA 4OCTA 3BIEA 2FDKA 3T3YA 5F8PA 4NRMA 4QKBA 3BTXA 3H8OA 3BUCA 3RZKA 2FDHA 3RZJA 4NRPA 4NIHA 3KHBA 4NIGA 4CXWA 3I3QA 3O1SA 4O61A 4ZHNA 3RZHA 2FDGA 4ZS3A 4NROA 4JHTA 4NPMA 3H8RA 3O1RA 4CXXA 4QKDA 4QHOA 4IE7A 4IE0A 3BU0A 3S57A 3O1PA 4CXYA 3LFMA 4NIIA 3I3MA 4ZS2A 2FD8A 4QKFA 4NIDA 4IDZA 4RFRB 2FDIA 3O1TA 2IUWA 5DABA 2FDFA 3I2OA 3O1UA 4MG2A 3T4HB 3T4VA 3BTZA 3BTYA 4NJ4A 3O1MA 3BKZA 4IE4A 3RZGA 3O1OA 3H8XA 3O1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5A A;  4NPL A;  3KHC A;  2FDJ A;  4QKN A;  4MGT A;  4IE6 A;  4IE5 A;  4NRQ A;  3BI3 A;  3RZL A;  3I49 A;  4O7X A;  3RZM A;  4OCT A;  3BIE A;  2FDK A;  3T3Y A;  5F8P A;  4NRM A;  4QKB A;  3BTX A;  3H8O A;  3BUC A;  3RZK A;  2FDH A;  3RZJ A;  4NRP A;  4NIH A;  3KHB A;  4NIG A;  4CXW A;  3I3Q A;  3O1S A;  4O61 A;  4ZHN A;  3RZH A;  2FDG A;  4ZS3 A;  4NRO A;  4JHT A;  4NPM A;  3H8R A;  3O1R A;  4CXX A;  4QKD A;  4QHO A;  4IE7 A;  4IE0 A;  3BU0 A;  3S57 A;  3O1P A;  4CXY A;  3LFM A;  4NII A;  3I3M A;  4ZS2 A;  2FD8 A;  4QKF A;  4NID A;  4IDZ A;  4RFR B;  2FDI A;  3O1T A;  2IUW A;  5DAB A;  2FDF A;  3I2O A;  3O1U A;  4MG2 A;  3T4H B;  3T4V A;  3BTZ A;  3BTY A;  4NJ4 A;  3O1M A;  3BKZ A;  4IE4 A;  3RZG A;  3O1O A;  3H8X A;  3O1V A; 
#chains in the Genus database with same CATH topology
 4UOJ A;  5FZL A;  5JLV A;  4OQ8 A;  2BFU S;  3KHC A;  5F9T A;  3DPR C;  4ISQ A;  3WHT A;  1ODN A;  2ETE A;  2VZ1 A;  3JD7 3;  2WUH A;  3F2Z A;  3ZYP A;  1RB8 G;  4QX3 A;  2IFR A;  2HWF 3;  4NRQ A;  3KS7 A;  2VNV A;  1XB9 A;  5JMC A;  3ZIX A;  1VBD 3;  1ZZ7 A;  2ET1 A;  2XH6 A;  3C3V A;  1JS9 A;  3AVR A;  3D8C A;  3SCH A;  3AXD A;  1FNZ A;  4GKY A;  5EP9 A;  2JDK A;  1NG0 A;  2YBS A;  4Y3O A;  3S7E A;  3M3E A;  5FYT A;  2WFF 1;  3H8U A;  4Q2F A;  2XR4 A;  2HWD 3;  4UFM A;  4OZO A;  3SKJ E;  4CP9 B;  5C7G A;  2ARC A;  4Q4Y 1;  4NOT A;  1MS0 A;  5FZ7 A;  1KDK A;  3GBW A;  4A6O A;  3SLI A;  1O6U A;  5BNP B;  3ZXE A;  4UFH A;  2YRO A;  3H0O A;  4AYU A;  4YGD A;  4CU8 A;  4DRV A;  1QJY 2;  5GLZ A;  3MLK A;  1O3Q A;  1ZRE A;  3S0M A;  1FMD 3;  3BB6 A;  3WQ7 A;  1WWY A;  4PQQ A;  4DZG A;  3ZFG C;  3BUC A;  1C4R A;  1LOE A;  2XBO 3;  3WG4 A;  3V0B A;  2VBD A;  4NIH A;  3B00 A;  5FZK A;  3LA7 A;  3ZMN A;  4ITC A;  5LCW L;  5IAX A;  4R8H A;  5JIU A;  1SMV A;  1VBC 1;  2RDS A;  2A5Z A;  3PJQ A;  4OI4 A;  3C2U A;  4HK9 A;  2PAE A;  4MXW A;  4W4Z A;  2HYK A;  1VBE 1;  4D7T A;  4Q0S A;  1N1S A;  3K75 B;  4URT A;  2GAU A;  2VUC A;  3OBA A;  4DEV A;  4EWE A;  2OVU A;  1VBA 1;  2Y26 A;  2ZGO A;  2HWE 3;  4KG0 A;  4MHU A;  1H0B A;  2JG9 A;  2PHR A;  3VGI A;  3WW4 A;  5FR3 A;  2XML A;  4YGE A;  2TUN A;  3B7M A;  2RVA A;  3T2P A;  1ZBE 3;  1SFP A;  1ULF A;  2J1S A;  4FPH A;  4QPG B;  5DUX A;  5GZD A;  1JHN A;  5DUV A;  1W6P A;  1MQT A;  4DXZ A;  2Y6L A;  1NOV A;  3NWK A;  4Q4V 2;  5A6Z A;  3VDB A;  4CCD A;  1L3J A;  1TME 3;  2P37 A;  5E1R A;  4AQS A;  2A6Z A;  1UYP A;  1DF0 A;  5FOJ B;  2ZML A;  1I1E A;  5FZD A;  3KV9 A;  1GOH A;  2HWB 1;  1I6X A;  3WZ1 A;  4IV3 C;  5A3O A;  5IVF A;  2XG3 A;  4Q4Y 3;  4Z2W A;  4P14 A;  4CP0 A;  1PK6 A;  1QJU 2;  1KS5 A;  4BQ5 A;  2ZX0 A;  5JXG A;  1GZW A;  4F83 A;  1OUR A;  4O9E A;  1MZ6 A;  1R1Z A;  3O12 A;  1JZ8 A;  5FZO A;  2J7M A;  2FZ2 A;  4XTM A;  1ZZ6 A;  1WCQ A;  1Y7B A;  2VH9 A;  5FV3 A;  4CDX A;  2FDI A;  1OUX A;  1PIV 2;  4HLT A;  4HK8 A;  5FMB A;  5DMY A;  1W9F A;  4UFI A;  4AI2 A;  5I0S A;  1T6B X;  2V72 A;  3GBF A;  1NCQ A;  1AYN 2;  1GKB A;  1Q3E A;  3CJI C;  3L9J T;  4CDQ A;  1GZW B;  1PGW 2;  3EMR A;  3FLR A;  5A3L A;  2ARA A;  5LRR A;  2R16 A;  5HBA A;  4HFS A;  4LKD A;  2H0B A;  1W8N A;  3T4H B;  5C5T A;  4DY3 A;  5FZ6 A;  3VHP A;  3ZXL A;  1MEC 3;  1VBA 3;  1C3H A;  5CU1 A;  1BMV 1;  4YLZ A;  4XBL A;  4XDO A;  1OFN A;  1AYM 1;  1OHF A;  4XFF A;  1F5J A;  1NCQ B;  2VCM A;  3BPS A;  1SLI A;  4ATE A;  4GD4 A;  4W6Y A;  1YI9 A;  1NY7 2;  3CHX A;  3HD8 B;  1NLQ A;  2A71 A;  4UT5 A;  4C1W A;  1W8O A;  4CPB D;  2BFU L;  1ND3 C;  3KCC A;  2ZJC A;  4NPR A;  2D7F A;  3AFG A;  1XNT A;  3IM0 A;  1RXF A;  1N47 A;  3MW4 A;  4DIN B;  1D7P M;  3H50 A;  4ONU A;  4YVW A;  5K0U C;  4OFG A;  4E2G A;  2DTW A;  3CLP A;  1H2M A;  3T0A A;  5ISL A;  1QMJ A;  1V9U 1;  1RUH 3;  2BV4 A;  4ZKT B;  2YC4 A;  4E4D X;  2ZBJ A;  2DFB A;  2WDB A;  3LD8 A;  1DHK B;  3V56 A;  4KMQ A;  5HV0 A;  2DBI A;  5FXV A;  4FPJ A;  1EV1 2;  1AR9 2;  2D5H A;  2IXL A;  2LTN A;  3U78 A;  4JDM A;  1JZ3 A;  4AHZ A;  1M4W A;  5FZ9 A;  3UL2 A;  2IXI A;  2PQQ A;  4A41 A;  1OKO A;  3IDE A;  1LOC A;  3J8F 2;  2ZX1 A;  1K12 A;  1ONA A;  3OPT A;  2JEM A;  3I8T A;  5FXX A;  1YFU A;  1N3O A;  4FCA A;  1UY3 A;  3I3D A;  1JN2 P;  4B4R A;  2WA4 A;  4RQP C;  4ATF A;  1RXG A;  4AAX A;  4BQ4 A;  1J3P A;  3OBZ A;  3LKJ A;  5FK8 A;  1HRV 3;  4FVV A;  4IUG A;  1OF4 A;  3DYM A;  4O61 A;  4AHY A;  5HXM A;  1SPP A;  3PU3 A;  3WDW A;  5K9Y A;  4XJ8 A;  3K2O A;  4IEX A;  2RS3 2;  1D0H A;  4XZP A;  5FCC A;  4R9C A;  3PHM A;  4GZ9 A;  4QQH A;  3VDD C;  3KD4 A;  1JYT A;  5E16 A;  3WEZ A;  2WNU C;  1W90 A;  2QE3 A;  4XF1 A;  3PMS A;  4LIT A;  3CMG A;  2ZHL A;  2JG8 A;  4UBG A;  3RWK X;  5FPZ A;  3ON7 A;  5A1F A;  3ZOI A;  3HMY A;  5JOY A;  1G9D A;  2RS5 1;  1DQ2 A;  1RUI 1;  5EHD A;  2W95 A;  2E32 A;  4RS5 A;  1RVF 3;  1T2X A;  4QGL A;  4BQ3 A;  3TWI A;  1PGS A;  3WF4 A;  1M06 G;  1LGC A;  2X5I C;  1MS8 A;  4FPC A;  4CEY B;  5I0R A;  2ZAH A;  1V9U 3;  3HNY M;  1GIC A;  1OMI A;  4MUV A;  3MW3 A;  3T09 A;  2W92 A;  2B5H A;  4ARY A;  1YEW A;  2Q1F A;  1W99 A;  2FD8 A;  2XVK A;  4KBB A;  5FLH A;  1SFN A;  2D40 A;  4RS5 B;  1RUE 2;  2YPD A;  3WV6 A;  1QXP A;  4COY A;  3RPQ A;  3OD4 A;  2R06 1;  1K42 A;  3MO4 A;  1LJ7 A;  2Q4S A;  3POW A;  3ZYB A;  5ACA 3;  1SCR A;  2C24 A;  2VZS A;  5AVP A;  1W6M A;  5T5P A;  1QJF A;  3K48 A;  1O4Y A;  3DPR B;  4RGA A;  1J3Q A;  1S2K A;  3OG2 A;  4ZXE A;  2R04 2;  4FOW A;  2AEZ A;  5FWE A;  2JDU A;  1VBB 1;  2P3J A;  3HAG A;  3WF1 A;  1X9T A;  4JKK A;  4QD2 A;  2QJV A;  2VMD A;  3U4S A;  3ELN A;  5FYM A;  3TEZ A;  1F5F A;  3ABZ A;  3GHM A;  1W9Y A;  2C0Z A;  2E7A A;  2BTV C;  1N1Y A;  4P9X A;  5EYY A;  5JSO A;  3S5A A;  1YCI A;  2PHL A;  4DIQ A;  1AR8 1;  3ES4 A;  4BA6 A;  3VL8 A;  4DQA A;  1PM4 A;  4K1Y A;  1IOA A;  3IB3 A;  1DQ0 A;  2RS5 3;  1RUI 3;  1U5X A;  3M3O A;  2VL4 A;  1LUL A;  2HBT A;  1FPN 2;  1ODM A;  1QU0 A;  1WLD A;  2RR1 2;  3WNP A;  2WN2 A;  2A6V A;  3BI3 A;  1LHO A;  2P2K A;  3EB7 A;  3KF5 A;  3ZFG B;  3ZXJ A;  3I49 A;  2KA3 A;  2LAL A;  4K8R B;  4G4F A;  1JW6 A;  1SLC A;  3ALQ A;  1GP6 A;  2Y6J A;  1RUF 2;  3MV1 1;  1OLQ A;  4M0N A;  2QTW B;  2RM2 2;  1WW5 A;  2FDK A;  3M2M A;  1SZB A;  4AGR A;  1KIT A;  2RDQ A;  1OQE A;  2RJ2 A;  4HOO A;  1SLA A;  1TG7 A;  2J1A A;  4X8P A;  3ZN5 A;  1LEC A;  3LA3 A;  3III A;  1V6I A;  3MLJ A;  4WM7 C;  4IGQ A;  5FZH A;  3GZE A;  4F7Z A;  5JMO A;  1HQL A;  4AEJ A;  2JDA A;  1W8U A;  3ZFE A;  1X82 A;  2J22 A;  1RMU 2;  3RJR A;  2FDH A;  1RUD 3;  3EHK A;  5KXE A;  4CEW A;  2CGN A;  5D21 A;  2DVD A;  3KWV A;  1LGN A;  3N9P A;  3WDY A;  3IAQ A;  1DQ4 A;  2XUM A;  1CD3 G;  3IKW A;  4JX0 A;  5HCH A;  1SCS A;  3POS A;  3Q8A A;  2OQ7 A;  2QQP A;  4RR3 C;  5G05 L;  4XQW A;  5F3I A;  2EF6 A;  2AAC A;  3P3N A;  4YZ3 A;  1Q56 A;  2D6N A;  4BQ2 A;  4G9S B;  1NZC A;  4GB3 2;  4Q1R A;  2RE9 A;  1RYY A;  1XSQ A;  3ZN6 A;  1H9P A;  2VQA A;  4CA9 A;  1W2O A;  2B9V A;  2W46 A;  5FP8 A;  3AB0 A;  4IV3 B;  4QX7 A;  3VBF C;  1C1L A;  4A7Z A;  4C0B A;  1AR8 3;  1VMJ A;  2E9Q A;  1SBE A;  3PNA A;  1SFY A;  4DNY A;  1N1T A;  3W58 A;  1F31 A;  5APA A;  3NKT A;  2YY1 A;  5KXB A;  1YIF A;  3LFI A;  1FV3 A;  1GWK A;  5HCA A;  3PUA A;  2VW2 A;  2P34 A;  2KR2 A;  1GP5 A;  3ZN6 B;  3ZXK A;  1QJZ A;  5F3E A;  1WA4 A;  2ZKN A;  3A7Q A;  2VQU A;  2GC1 A;  1SBF A;  3LPG A;  3MF9 A;  3BU0 A;  5DPN A;  2JJ6 A;  4UI9 L;  1UZ0 A;  5KHG A;  3O1P A;  1JOJ A;  4YW3 A;  1OPO A;  5H9Q A;  2BGC A;  3CJI B;  3LFM A;  3FHA A;  3GXU A;  4AZZ A;  1P8J A;  4XFH A;  2HWC 3;  4XUR A;  2VMH A;  4JHZ A;  1F2N A;  3WDU A;  1RED A;  5DUW A;  1O4Z A;  1NA1 A;  1UKR A;  1NKG A;  4RFR B;  3AP6 A;  3CIH A;  1REF A;  5JXH A;  2Z2S B;  5D2A A;  5FDB A;  5T3N A;  3WW2 A;  3ZXF A;  5DAQ A;  4MSV A;  5JXJ A;  1UY0 A;  2EIB A;  1VP6 A;  3K77 A;  2C26 A;  4B3N A;  1W6O B;  3RQ0 A;  3OPZ A;  4C91 A;  2CWM A;  1GYK A;  2VJX A;  3BOW A;  1QOS A;  1HW5 A;  2LRP A;  2PA7 A;  2R30 A;  3D82 A;  3MIE A;  3RJ2 X;  1ZRC A;  3VHR A;  4AFM A;  1WW7 A;  4CDW C;  1ND3 B;  5J7M A;  1W28 A;  3VB9 A;  4DUV A;  3WG1 A;  3ACL A;  3OYW A;  3ZKY A;  4YFZ A;  4BIF A;  1XE7 A;  1OOP A;  5F37 A;  1CAX B;  1ASJ 1;  3RI9 A;  2VCB A;  3EYP A;  4FOV A;  4URA A;  5FBJ A;  2CL2 A;  3VBH A;  2AEN A;  2VBP A;  3USU B;  3W9A A;  2AH2 A;  4QMA A;  2W1S A;  2XWJ B;  3VZO A;  1XBF A;  4ZXK A;  2FDJ A;  3A22 A;  2Y0O A;  1XU1 A;  2X53 S;  3AK0 A;  1POQ A;  1UY2 A;  1X33 A;  1O91 A;  3W59 A;  2ZGK A;  4K20 A;  4JDN A;  5D8A A;  2JE7 A;  3J4U H;  3POI A;  4JVA A;  3T1M A;  1D4V B;  1O8S A;  1UY4 A;  2P5B A;  3ACH A;  1IHM A;  3RFR A;  2VW0 A;  1HN0 A;  4RQP B;  2OPW A;  1SHW B;  4WM8 A;  3GBG A;  1LOF C;  3B69 A;  3RZM A;  4QPY A;  3RMX A;  1OKQ A;  5FO9 B;  2ZX2 A;  3QCW A;  3WNN A;  1C1F A;  4JGZ C;  4YWA A;  2XHK A;  3MBW A;  1JUI A;  5CZK A;  3I54 A;  5FY9 A;  5IVB A;  1LB2 A;  1Z7S 2;  2XXZ A;  4MET A;  3VDD B;  3MPP G;  4XJ9 A;  5KWR A;  4AI1 A;  3SHR A;  1BVV A;  2WNU B;  3RYK A;  3ZDV A;  4H3W A;  4OUS A;  3LB9 A;  2PLV 1;  4RFT 0;  3ZXA C;  2GP5 A;  2B4K A;  3IN9 A;  5A3W A;  3AP5 A;  5CEH A;  5J09 A;  1ZM1 A;  3O7O A;  2VMF A;  5FY8 A;  1WD4 A;  3ZYR A;  3OGG A;  1GOF A;  5HXV A;  1WME A;  2IXH A;  3QH7 A;  4QPI A;  4D6Q A;  4NHM A;  2X5I B;  1QQP 3;  2VCC A;  4ZHN A;  1K45 A;  1OT5 A;  1ZYB A;  2UYA A;  3CJX A;  3RSJ A;  3WXP A;  4AXO A;  5DN2 A;  2FDG A;  3ZR5 A;  4AI8 A;  5C9A C;  1TMF 1;  1RGS A;  2GMP A;  1ENR A;  3SH4 A;  1C8M 1;  3KGZ A;  1RIT A;  3A4U A;  3LDK A;  2BRT A;  4IQP A;  4XXA A;  2BZD A;  1QDC A;  2WSU A;  4H7L A;  4LOR A;  5C70 A;  4Q4V 3;  2WJS A;  4C0H A;  3LEI A;  4PBP A;  5EFU A;  1D4M 2;  2JWP A;  3JBG 1;  3DEM A;  5DDJ 1;  2A75 A;  3GAL A;  2VD7 A;  3FE5 A;  5TSW A;  2ZHN A;  4KWL A;  4AVB A;  2MEV 3;  2Z69 A;  1H8T A;  2Y60 A;  4EYU A;  1PGL 1;  3MFA A;  5FUI A;  3OUJ A;  3ACF A;  1QJU 3;  2RV9 A;  3DUI A;  2IXK A;  2VW1 A;  1HB1 A;  1V6O A;  2IZW A;  3OY8 B;  4IDZ A;  3POB A;  3RVH A;  1NX9 A;  1AL2 3;  3BIW E;  4LEJ A;  4N7U A;  4UAP A;  2DUQ A;  2GN3 A;  1O3S A;  1KFU L;  4W6W A;  4OVE A;  1JUH A;  4RD7 A;  4TTG A;  4Y1U A;  4NR1 A;  4BCU A;  2E53 A;  3LCP A;  4P9Y A;  1KS4 A;  2VTX J;  2HEW F;  2ENR A;  2DVB A;  4FP2 A;  4N53 A;  5FK7 A;  5A6Q A;  3KGL A;  2R07 1;  3I59 A;  4GJY A;  2PAM A;  4YM3 A;  2WNE A;  3AL6 A;  1CWP A;  1UX7 A;  4XUP A;  3EQE A;  3N9N A;  4LO6 B;  1K5J A;  2RS1 1;  5GLW A;  2JIJ A;  4Q5O A;  5C3P A;  2D6K A;  1TMF 3;  3O1V A;  1RUC 2;  3AYE A;  4R9A A;  2DVG A;  3POF A;  1VRH 1;  4QPG C;  5CKM A;  4GJZ A;  3HR9 A;  1O59 A;  2WSV A;  1OLR A;  1XE8 A;  2PAK A;  4MYE A;  5CFC A;  1ULG A;  3I97 A;  3OEA A;  3KV5 A;  2NMN A;  2SLI A;  4WM7 B;  4Z82 A;  2UWA A;  2FCU A;  3PTY A;  2ZOE B;  5DDJ 3;  4MHR A;  5FZM A;  1E5S A;  4LUL A;  4DS0 A;  3PVN A;  3KM5 A;  3HN1 A;  2H0V A;  2XUE A;  1J1L A;  3OTF A;  4MGY E;  4N43 A;  5LB6 A;  1MQT C;  5CFD A;  5CFC B;  4E8C A;  3FUO A;  5FQ0 A;  3UKV A;  2VOX A;  4PF5 A;  2OZJ A;  1SQ4 A;  3NJV A;  3P5B A;  2NP0 A;  2W87 A;  5F8P A;  1EV1 3;  1AR9 3;  3CKH A;  1D2S A;  4Y1Z A;  3ZR6 A;  4ZPI A;  4Z2A A;  5ABJ A;  5IVC A;  4RHV 1;  4LLO A;  2XJT A;  5A1L A;  5C4W A;  2DVA A;  3VBF B;  3M3I A;  2JEN A;  5A32 B;  1ENX A;  1DLC A;  1PX4 A;  4EJR A;  3VBU A;  4ZZ8 A;  2EAK A;  2VNO A;  4GMP 0;  2QBX A;  1PK6 C;  3IMM A;  3I7D A;  2OPK A;  4HSL A;  5T5O A;  1LHW A;  1NXD 1;  2XVG A;  4LBQ D;  3VHO A;  5FXZ A;  2EIE A;  2CTV A;  5ABJ B;  3CO2 A;  2R07 3;  2RHP A;  3V0A B;  1OVP A;  1VAK A;  1O3T A;  4CDX C;  1EAH 2;  2C4X A;  2W39 A;  5JPN B;  2WYF A;  1O5L A;  2B7Y A;  2W68 A;  2RS1 3;  1JOD A;  3POY A;  1W06 A;  4A6S A;  2CV6 A;  4LPL A;  1PVC 2;  1NCQ C;  3OJB A;  2W47 A;  3ILN A;  1XQN A;  1QXJ A;  3LEM A;  1AR7 2;  1GBG A;  5LA0 A;  4CDQ C;  4B8E A;  1VRH 3;  2G4I A;  1MS9 A;  3LEG A;  1R64 A;  3URF A;  4CCC A;  3C7E A;  5F7U A;  5FOB B;  3B94 A;  3INA A;  1CX1 A;  5FY5 A;  2DU1 A;  3Q8B A;  4PDW A;  4QKD A;  1IG3 A;  3FBM A;  1F4A A;  3D6E A;  1PO2 2;  3HNM A;  4GXL A;  3TOJ A;  2F17 A;  1UZY A;  2EAA A;  1CGP A;  2FHR A;  4NUB A;  1HRI 2;  2W3J A;  2WA3 A;  3I4I A;  2OXB A;  2VY0 A;  4YVS A;  3NKG A;  2JB8 A;  2QQV A;  3ZM8 A;  1UYX A;  4LBJ A;  4CDW B;  2BPA 2;  3UGH A;  4NHY A;  1UIK A;  5CAZ A;  3DXU A;  2VZU A;  4PDW B;  1XNC A;  4XEZ A;  3ZXD A;  5M0T A;  3ZIW A;  1RUE 3;  4YVW C;  1CZS A;  2WO7 A;  1CPN A;  1YO8 A;  2VC9 A;  3AMP A;  4A7Y A;  2OYZ A;  2VNR A;  1RHI 1;  3MDP A;  4LA2 A;  2WQ4 A;  1GWM A;  1VAV A;  2KD7 A;  2ERF A;  4ASK A;  3BAL A;  4KQ7 A;  3VDC A;  1B09 A;  5J36 A;  1Q8V A;  3ECQ A;  3SIS A;  4EE2 A;  1GZT A;  2WWU A;  1HXS 2;  1ZNP A;  3N9L A;  2XON A;  5KBF A;  2YG0 A;  5AVA A;  5EYX A;  4LHS A;  4D6S A;  2JB4 A;  2GP3 A;  3TEX A;  1Q8S A;  3J7H A;  1PZ7 A;  5FP3 A;  3HIF A;  3LAG A;  3K46 A;  3PDQ A;  2N7G A;  1OVS A;  4HL0 A;  4LHK A;  2CSG A;  4YZ4 A;  1E5I A;  1R1A 2;  4AVS A;  1FOD 2;  2NYY A;  4I02 A;  4JGZ B;  4TXW A;  4FFH A;  4OMC A;  4XMI A;  4XXP A;  3HQX A;  5FAX A;  5J48 A;  2P3K A;  1VB4 A;  2BWA A;  2YFU A;  5FYI A;  4YNI A;  2BYV E;  2L9L A;  1BK0 A;  4LBL A;  1FMD 1;  1FPN 3;  2AZ5 A;  2I07 B;  4Y1V A;  1Q8P A;  1WGP A;  1TZO A;  3K3N A;  3VBR A;  3VL9 A;  2D98 A;  2UWC A;  2XBO 1;  1GWL A;  4CRQ A;  4MXV A;  1S0E A;  1CX4 A;  2Q8O A;  2JG8 C;  4Q4X 2;  1RUF 3;  2LS6 A;  1GOG A;  2WS9 2;  3WQ0 A;  4WZC A;  2RM2 3;  3BIE A;  3MGU A;  1CAV B;  3HN3 A;  4RS5 C;  3NV1 A;  5DXD A;  5FIX A;  2V73 A;  2WIN B;  4JRL A;  4DPN A;  3PUI A;  3BPZ A;  4Z07 A;  3AKT A;  1CQ9 A;  1OF3 A;  3MHZ A;  1RHI 3;  3H1Y A;  1JU3 A;  4JC1 A;  2FCV A;  4Q0V A;  5C9A B;  1LAJ A;  4YM1 A;  5I0U A;  3AMN A;  1DYP A;  1ZBE 1;  2XDV A;  3OBR A;  2GNB A;  4GWM A;  4JGY A;  3RZK A;  1U5I A;  4ES9 A;  4AED A;  1HJF A;  5C3R A;  5FKC A;  3SEE A;  1TME 1;  2ZGQ A;  3JXS A;  3I3Q A;  5FKB A;  2D97 A;  4N90 A;  4JKM A;  2AR6 A;  4GB3 3;  4XCA A;  5F3C A;  2NMO A;  3APB A;  1NE4 A;  4HVQ A;  2QDR A;  5FYY A;  3VKO A;  3BYW A;  1I9R A;  4FPL A;  3OBT A;  5CIS A;  3SH5 A;  1UZV A;  3J7L A;  3IZO A;  4FI9 A;  4MAD A;  4QDS A;  4QM8 A;  4BQ1 A;  1BEV 2;  5IVY A;  4F3J A;  5BNN A;  4M3C F;  3DKQ A;  1R09 2;  1YFY A;  3KV6 A;  4MGQ A;  3LDR A;  2DUP A;  2RDR A;  4ZON A;  2MNG A;  3N4M A;  3VV1 A;  1ENQ A;  4XPV A;  5FP7 A;  3W21 A;  4Z1V A;  4MOA A;  3WUC A;  4HT1 T;  2PHW A;  1HKD A;  5T55 A;  4Y33 A;  1LOG A;  4Q8L A;  3I2G A;  1ENS A;  4XIK A;  3OEB A;  5LEJ A;  3OGJ A;  2QQI A;  2W1W A;  4ZS2 A;  1FNY A;  5FPV A;  4M4R A;  5GJ6 A;  2DU0 A;  2VE1 A;  2ZHK A;  5DG1 A;  4DFS A;  1UPI A;  4A7K A;  4A45 A;  4ZZ5 A;  2DCY A;  5FBZ A;  1G9B A;  1MEC 1;  1UOJ A;  4CPB A;  1XPW A;  1QXR A;  2OQ6 A;  1AR6 2;  3V0B B;  3FMG A;  1MVQ A;  4CU7 A;  2D3R A;  2RJK A;  2D6M A;  1HB2 A;  2CHH A;  2ORZ A;  4XIL A;  4ZY9 A;  1WCD J;  2WO2 A;  5FTT C;  2GC0 A;  4EWD A;  2VUJ A;  3CU7 A;  4GIQ A;  5JOZ A;  5F5A A;  2WQZ C;  4MXW B;  4RL7 A;  1DBN A;  4BK4 A;  4BPZ A;  5LBC A;  1UKG A;  5A3U A;  1C8N A;  1CVN A;  2JG9 B;  2Y8K A;  3MIC A;  3UYJ A;  4GWI A;  4Q8K A;  5KXC A;  3ZFE C;  1ASJ 2;  4M4P A;  3E6B A;  2BW8 A;  2VVD A;  4CEW C;  4FXK B;  3TN9 2;  1RUH 1;  2DUO A;  3O1O A;  1W6P B;  1MQT B;  3OB8 A;  4LKE A;  1V70 A;  3KVB A;  4CUA A;  3WF0 A;  4PJY A;  3PJY A;  4NPL A;  1BQP A;  3DV8 A;  4AG4 A;  1DG6 A;  1U5Y A;  2BQP A;  4PIZ A;  1W2U A;  5CAD A;  2WT1 A;  4OHZ A;  2RMU 1;  1KD7 A;  4JZR A;  5F1R A;  4YFW A;  2CGP A;  2E51 A;  4IE5 A;  4BLJ A;  1SDD B;  2WRA A;  2QNK A;  2QQK A;  3OD0 A;  1DP0 A;  3GGL A;  2IC1 A;  1I5P A;  1LGB A;  4AGV A;  2BOI A;  1PK6 B;  4JCK A;  2VQ0 A;  4FAG A;  5C5U A;  3NO8 A;  1BLZ A;  4E2S A;  4QDR A;  5FYB A;  4IET A;  5KHK A;  1ZBA 2;  2ZGT A;  1XND A;  5FWJ A;  3B9C A;  1NE6 A;  4QAW A;  3ETQ A;  5DAP A;  3B3Q E;  5FZO B;  3W5N A;  1HB3 A;  1HRV 1;  1EY2 A;  3AXE A;  4M3C A;  4P9J A;  4XET A;  3V64 A;  5I8Y A;  4CDX B;  1SLL A;  1PO1 3;  2QZ3 A;  4EQV A;  2UY9 A;  1AX2 A;  2VUD A;  1CES A;  5GZE A;  1MR5 A;  3NV2 A;  3AFK A;  4FTE A;  2ID4 A;  1KXG A;  1W6Q A;  1OFS A;  2P1B A;  3AKR A;  2G9G A;  3LPF A;  1Z7S 3;  5IT6 A;  5LWB A;  2GND A;  3OSD A;  1OBN A;  4CDQ B;  1W2A X;  2PLV 2;  1JOB A;  2OX0 A;  3T08 A;  1PMI A;  4AHX A;  2VAU A;  5LY2 A;  5LW9 A;  4XMA A;  2PEL A;  1RIN A;  1NA1 C;  1W6N A;  4RN5 A;  1S55 A;  2JDP A;  2PHX A;  3OGS A;  2BER A;  1MZE A;  3QOP A;  4UYB A;  3CQO A;  1RVF 1;  5FMC A;  2YDE A;  1RL3 A;  3KLS A;  1WLC A;  2DUR A;  2R7E B;  4GAL A;  5C3S A;  2NPI A;  4LKF A;  2C5D A;  4I0A A;  4ASM B;  2ZGL A;  5I0T A;  2JDZ A;  2DYC A;  5JCT A;  3U0Z A;  2YGM A;  3O5S A;  2BEO A;  3IMN A;  5A1A A;  4OZX A;  3OPW A;  1W8T A;  4L0P A;  5FZ1 A;  4AFD A;  4QXH A;  2ORX A;  3NAP A;  2RMU 3;  4QX5 A;  1N1V A;  4B4P A;  4YVW B;  1OOP C;  4TSV A;  4C1X A;  3PLQ A;  1NCR A;  1H9W A;  3JBG 2;  4CXX A;  2W52 A;  5ACA 1;  1D4M 3;  3H1W A;  1DCS A;  2J1V A;  3VBH C;  3IWZ A;  1JZ7 A;  4GA9 A;  1S0D A;  2UUR A;  4HXC A;  3LF7 A;  4AEK A;  1UW8 A;  1BHG A;  1Y9G A;  2R1B A;  4K40 A;  1WD3 A;  2DCT A;  3NL1 A;  3KZ4 C;  3VKM A;  3AKP A;  2PHF A;  4U2A A;  5EXO A;  3E5X A;  5D8A C;  4R4Z A;  1FXZ A;  2OII A;  4R9D A;  2ZPX A;  3OF1 A;  4CCJ A;  2V4A A;  1GR3 A;  3WCR A;  5AC9 2;  2PHD A;  3TYJ A;  3AL5 A;  3FL7 A;  3U4X A;  4WM8 C;  3HBZ A;  1O8P A;  3M4F A;  2NN8 A;  3AZZ A;  3ZPY A;  4E2Q A;  3O1T A;  2ZEW A;  2WO3 A;  3DL3 A;  3ZKU A;  2WO1 A;  2CGO A;  4IGP A;  5BV6 A;  2XJQ A;  1SPP B;  2VQT A;  2WAB A;  2ZZJ A;  5FYC A;  5HPO A;  4BWO A;  3VZM A;  3WY6 A;  3JZV A;  2FDF A;  2EA7 A;  2J1E A;  3UJQ A;  1MS1 A;  2FZ1 A;  2YBP A;  4CZS A;  2HLE A;  1QH7 A;  3ZYJ B;  3TNQ A;  4EN0 A;  2JG8 B;  3DN7 A;  3EBR A;  2VZR A;  1RUC 3;  1VAL A;  4NE9 A;  3ZVX A;  2EID A;  1W9W A;  4YSF A;  3JQX A;  4QPI C;  3GCX A;  4I0W B;  4Y1Y A;  1FAT A;  4LO8 A;  1YHF A;  1S2B A;  4CDU A;  3R4D B;  3ZLI A;  1GNH A;  2V5Y A;  5A7N A;  1HQN A;  2A1X A;  2XJS A;  3PVB B;  2W0X A;  5F32 A;  4P5Y A;  1FT9 A;  2BUK A;  2PHT A;  1RUJ 1;  1J1T A;  1RUD 1;  1UQX A;  1WLT A;  2JE9 A;  2VNG A;  3L2H A;  4X6R B;  1R08 1;  2ZEY A;  4XW3 A;  3MUZ 1;  3THP A;  4BK5 A;  3SIT A;  1YLL A;  5L7O A;  3NST A;  4OI0 A;  1UIJ A;  2Z4F A;  2X09 A;  1NT0 A;  1ZA4 A;  2Y6H A;  4CDU B;  3N7L A;  3H42 B;  3PUR A;  1SBD A;  2FMY A;  4Y4R A;  4IEP A;  2WNV A;  3WP5 A;  1UU5 A;  1W6M B;  3F95 A;  4J25 A;  1GSL A;  3VHN A;  1UOG A;  3NQH A;  4CU6 A;  1AXZ A;  1ND2 A;  3D0J A;  3I2K A;  4D7S A;  1H8T C;  3ORJ A;  3NV3 A;  1ZVF A;  3TEW A;  1X8M A;  4DMI A;  1UX6 A;  5C6C A;  5JPM B;  4LBO A;  1QJX 2;  3WNX A;  3ZN4 A;  4H2A A;  3SQO A;  1VMH A;  2J1T A;  5DZE A;  3RZJ A;  4LT5 A;  4ORF A;  5JZG A;  5FY0 A;  1CZT A;  1XNK A;  4H14 A;  1OUS A;  1AZD A;  1ULO A;  4UF0 A;  1IG0 A;  3LEK A;  2Y6G A;  1GZ9 A;  3EJK A;  4K8F A;  5FZG A;  4LA3 A;  1PVC 3;  4Y22 A;  3NV4 A;  1V0A A;  2HWC 1;  4N53 C;  2WZR 2;  5FRA A;  4JV4 A;  4LK7 A;  2ZXQ A;  3C7O A;  5GLT A;  4C8D A;  4XFB A;  5C33 A;  2ZX4 A;  2QQU A;  1RUG 1;  2D3S A;  2Y38 A;  3AZX A;  3I2J A;  3IPV A;  3KMH A;  3O0X A;  5JZG B;  1WCU A;  3FHQ A;  4I3P A;  5C8W A;  5KC5 A;  4IV1 A;  3S7I A;  2NM1 A;  4ISR A;  3WF3 A;  5GLU A;  2VZ3 A;  1CIY A;  1IQD C;  1KEX A;  2VG9 A;  5GKA C;  3VD5 A;  1RUJ 3;  4IE7 A;  2YBK A;  1FX5 A;  1R08 3;  2D93 A;  4GH4 A;  1HRI 3;  5A33 A;  5A3T A;  1JBC A;  1YQ8 A;  4Q1P A;  2PFW A;  1W9T A;  2EAL A;  4DXS A;  5CFC C;  1BBT 2;  4M0H A;  3KV4 A;  3D4K A;  5A7P A;  2VPV A;  5FZF A;  1K5M A;  4S2H A;  2ADE A;  4WVV A;  4A3X A;  1UO9 A;  3ZFE B;  4CSW A;  4Q4W 1;  3M7A A;  1BXH A;  3OGR A;  3MUY 1;  3N7J A;  3V65 A;  4BQX A;  2XJP A;  3MEP A;  3UES A;  4CEW B;  3H7J A;  1AX0 A;  3WHU A;  1IKQ A;  4P9I A;  2W9X A;  4N43 C;  4J1W A;  1EP0 A;  3MLL A;  4L8Q A;  5CFD C;  2CAV A;  3JD7 2;  4YG3 A;  3NJY A;  4DO0 A;  2HWF 2;  2QUO A;  3G6J B;  3FBY A;  3VKL A;  5EJ3 A;  5A3N A;  2V4V A;  5ABJ C;  5J1X A;  1POV 3;  1VBD 2;  2OZ6 A;  3GDB A;  1A3K A;  2R0H A;  5C4W C;  1ULE A;  3I2O A;  1HV0 A;  1H1A A;  3M70 A;  3K51 A;  4OUM A;  1PHM A;  2VO5 A;  3VBU C;  1JYI A;  1COV 2;  1JHJ A;  2EVX A;  3H3Z A;  5JSR A;  4NHK A;  1DIW A;  2HWD 2;  1UD1 A;  4QX8 A;  2ZX3 A;  4XFA A;  3TAY A;  1BCX A;  4NAO A;  4IES A;  3BKZ A;  1G9A A;  4LE4 A;  4XJU A;  1HJG A;  2QQO A;  3H8X A;  3D3A A;  4Y1X A;  5L9B A;  4DY5 A;  1QF3 A;  1RUG 3;  4IEW A;  2UU8 A;  3BCW A;  3WNM A;  5CKN A;  3MZH A;  3HWJ A;  4OMD A;  1IS4 A;  1SEF A;  3WNL A;  4CCN A;  3N9M A;  1UN1 A;  2OA2 A;  4IE6 A;  1DQ1 A;  1QJY 1;  2X05 A;  1G6N A;  2BJS A;  4BXF A;  4XAA A;  5LA1 A;  1UCX A;  1X8E A;  4NHX A;  3WP3 A;  1WMX A;  1YQ2 A;  1O5U A;  2PTM A;  2VMI A;  1GQH A;  3O14 A;  3N9Q A;  3IIA A;  4AVA A;  1NA1 B;  2YC0 A;  3B02 A;  4Q4X 3;  1VIW B;  2BNO A;  4BMB A;  1EUU A;  4G3Y C;  4N7I A;  3BVC A;  3WIN E;  2J1U A;  2OKX A;  1A8D A;  1PX3 A;  4PDW C;  5FZE A;  3CDZ B;  4DXT A;  3JUU A;  1DZT A;  2ZMK A;  4CE8 A;  1QQP 1;  4Q4W 3;  1HQW A;  3GCW A;  2HWE 2;  2VZO A;  5E89 A;  2WYS A;  4XFC A;  4PI2 A;  4YVS C;  1XSR A;  2OUH A;  3HEI A;  1HDK A;  4M3C E;  1OQ1 A;  4OHW A;  3AJZ A;  4CU9 A;  2Y64 A;  1UOB A;  2EXK A;  2BU9 A;  2B45 X;  3RYR A;  1X7N A;  2SBA A;  3OYW B;  4P02 B;  3Q8E A;  1YJL A;  3GHN A;  1S0G A;  1YFX A;  1OOP B;  4FPK A;  4NRP A;  4Q4V 1;  2YU1 A;  5H9R A;  1U12 A;  3D0S A;  3SCG A;  3WNO A;  2CNA A;  1YI7 A;  1RTV A;  1Y9Q A;  1QGL A;  2WAO A;  1X9P A;  3E6D A;  3H9A A;  3VBH B;  1L7L A;  5LAS A;  4AVV A;  3ITQ A;  1YUD A;  1LHU A;  2WFF 2;  4BE3 A;  2JE8 A;  1UL9 A;  2YMZ A;  4WVW A;  1CAU A;  3LWC A;  4Q4Y 2;  4D3W A;  2IXC A;  5FZC A;  2MEV 1;  3BN6 A;  1E5H A;  5LA2 A;  3ZYI B;  4JAA A;  1QJU 1;  5FUN A;  4NRO A;  2Q1M A;  5D8A B;  4R52 A;  4JHT A;  4IGO A;  2X8K A;  1W3X A;  2WWS A;  4PIX A;  5F2W A;  1BEV 3;  1KFX L;  3H1M A;  1QJY 3;  4OUE A;  1AL2 1;  4PQ9 A;  1OLM A;  3O1R A;  3FZ3 A;  4MLO A;  1OI6 A;  1R09 3;  3FX3 A;  2A70 A;  2VUA A;  4WM8 B;  1PIV 1;  1APN A;  2ZAB A;  5I8T A;  4I0B A;  3N36 A;  1H8V A;  3KVA A;  4TWT A;  1LHN A;  1VBC 2;  1AYN 1;  4LE3 A;  4UFL A;  3NNG A;  5CKQ A;  2NZ9 A;  3MIB A;  1PGW 1;  2K9Z A;  4MGK E;  3HPN A;  1VBE 2;  1OA3 A;  1OH3 A;  4Y20 A;  4NII A;  5GZG A;  4UWD A;  5IFT A;  4D8M A;  3JQW A;  1CJP A;  1VBA 2;  4FOY A;  3VBR C;  3UV9 A;  4NWW A;  4XE9 A;  4FBF A;  1CAW A;  2BNN A;  3LDB A;  5E6H A;  3FUQ A;  4XZU G;  3D5O A;  4CCK A;  2XLA A;  3IT8 A;  1S0J A;  1YIP A;  5EJZ B;  5G04 L;  5J37 A;  4XAC A;  4AI9 A;  4DUW A;  1NY7 1;  4QPI B;  2R1D A;  3MI8 A;  5EJ1 B;  5JWP A;  3KCY A;  5IYY A;  4M00 A;  2ET7 A;  1H30 A;  3N7M A;  3WF2 A;  2IFW A;  1CJD A;  2AGS A;  4Y26 A;  1IS5 A;  5FP9 A;  2HWB 2;  1JYV A;  1A34 A;  2W5F A;  1RUH 2;  4JGY C;  1OH4 A;  5H9S A;  1XYO A;  2I74 A;  3UKN A;  4IE4 A;  4AED C;  4CCL A;  1WMD A;  2ZCW A;  5IVJ A;  5HCB A;  3RZG A;  1H2K A;  1AX1 A;  3KCX A;  3M3Q A;  1EUT A;  3I2D A;  1QWR A;  1EV1 1;  1AR9 1;  1Z0H A;  1ZRR A;  4LBQ A;  4COU A;  1DLL A;  2QZ2 A;  3A21 A;  2QQJ A;  2V09 A;  4IEV A;  3ST7 A;  3UKT A;  4MGT A;  1L7R A;  4EZ4 A;  2Y33 A;  1PIV 3;  3THC A;  3J8F 1;  5EWS A;  1H8T B;  3ATG A;  3UJO A;  1W8Z A;  4AR2 A;  3DF0 A;  5BUV A;  1J84 A;  3PUH A;  4PF1 A;  3S57 A;  4AVT A;  1AYN 3;  2YUE A;  4UW4 A;  1FYU A;  4OI1 A;  5CIR A;  5DG2 A;  2QQW A;  3H3U A;  1GAN A;  3KF3 A;  3MFC A;  5BNN C;  5JR2 A;  5F6L B;  3UGG A;  1BMV 2;  2VXR A;  4PI0 A;  4TN7 A;  1A6C A;  3VD3 A;  1AYM 2;  1DFQ A;  2DF7 A;  2RG4 A;  3GNE A;  4JDO A;  4YM0 A;  2GU9 A;  5A7S A;  1LR5 A;  4PCR A;  2RS3 1;  1C28 A;  3C8X A;  4QWN A;  5I91 A;  2G1M A;  4Y5Z 0;  4XHX A;  3WQ1 A;  1GZC A;  3NNF A;  4FAH A;  1CZV A;  4N53 B;  2DCZ A;  2ZZQ A;  5T52 A;  3I59 B;  4LBN A;  2QVS B;  2WQ8 A;  5FMO S;  2FMD A;  1DDL A;  2R6Q A;  3H7Y A;  3PTR B;  4JRA A;  4DXR A;  1S2E A;  1XJA A;  2IVJ A;  2JG9 C;  3KHB A;  5FZA A;  4L11 A;  1YQC A;  4KNC A;  5I93 A;  1V9U 2;  3FJS A;  2ZMN A;  3RGB A;  4K7J A;  1LNS A;  4MVT A;  1OD5 A;  4HON A;  1W0P A;  4XDQ A;  5BXX A;  3SEP A;  1SLB A;  1YYN A;  3U10 A;  4DB5 A;  1GNZ A;  1LED A;  4QQ2 A;  3T2T A;  4NPM A;  1RUE 1;  4YPJ A;  4OHV A;  3MYX A;  4I3G A;  4RR3 A;  3H8R A;  1TVG A;  1V6L A;  5F5C A;  2YU2 A;  4UBH A;  1WLW A;  3GJB A;  3J8F 3;  2UWB A;  4HN1 A;  4N43 B;  2W1U A;  3AYA A;  3NNJ A;  4OYU A;  5CFD B;  4UFK A;  1AHS A;  1QNY A;  1Q8Q A;  4LOT A;  5FQ0 B;  3ZO0 B;  1TEI A;  2VME A;  4UXA A;  4BYY A;  1QOO A;  2R04 1;  3A0K A;  2B9U A;  1MVE A;  4COZ A;  2VZV A;  5C4W B;  4KU8 A;  1TE1 B;  2XB6 C;  4QQP A;  1C5I A;  2WBK A;  4KGG A;  5LAT A;  3VBU B;  1SG3 A;  2WWJ A;  1ZRD A;  3MV0 1;  2BGP A;  2RS3 3;  4QKF A;  3VN4 A;  2ARE A;  2XKP A;  5AC9 3;  5IK7 A;  5IK8 A;  1X50 A;  1AL0 G;  1H6X A;  5FJK A;  3RDI A;  2ZGP A;  3ZXG A;  5A6Y A;  1MZ5 A;  1LOD A;  1AJO A;  3PUQ A;  2B8M A;  2RS5 2;  4Q0U A;  1QHD A;  1RUI 2;  2HJI A;  5CBL A;  5IVE A;  1JH5 A;  2Z42 A;  2ILM A;  4QB1 A;  2E31 A;  2E63 A;  2IUW A;  1FPN 1;  4HAN A;  5FXW A;  5C8C A;  4AFC A;  5FY1 A;  4I30 A;  1B35 A;  1IPJ A;  4P00 B;  3AMH A;  1BVP 1;  3R6S A;  1JXN A;  3RZZ A;  4FP3 A;  2HYX A;  4KWK A;  2PYT A;  5LRS A;  5JR7 B;  1RUF 1;  2Q0A A;  4NJ4 A;  3J7N A;  5IJR A;  3RWN A;  3NMB A;  5HI0 A;  2RM2 1;  3PME A;  4HMZ A;  4FQ4 A;  2LM3 A;  4Y5T A;  3AM2 A;  4MX3 A;  4XVH A;  1QJE A;  1W0N A;  2D44 A;  4B1L A;  2R06 2;  2JIG A;  3AP4 A;  3DYO A;  3P6B A;  1OA4 A;  2ZAA A;  2VUL A;  5ERL A;  5ANQ A;  3POJ A;  4YVS B;  1L7Q A;  5FZ3 A;  4B7E A;  4IW3 A;  2A73 B;  4LBM A;  5GM0 A;  4C90 A;  1IS6 A;  5CVR A;  4LQR A;  2TNF A;  1RMU 1;  4HKO A;  1CPM A;  4H55 A;  5LK7 B;  2W94 A;  1VBB 2;  2R04 3;  2Y0I A;  3NAP C;  4K21 A;  1JYX A;  1JYC A;  4ET7 A;  2JDH A;  4ZU7 A;  5JDB A;  2HBU A;  3R4U A;  5LBB A;  5T5L A;  1UXX X;  2QQN A;  3UT0 A;  1NCR C;  1W03 A;  4OCT A;  3WUD A;  4BOW A;  5FUP A;  2G9F A;  4IEZ A;  3SH3 A;  2BDR A;  3LIH A;  4GB3 1;  2P6H A;  4BXS V;  2XPJ A;  1S0I A;  1DGL A;  5GZF A;  1AR8 2;  3M3C A;  4XJW A;  3ZFF A;  1Z78 A;  2WNO A;  2ADD A;  2QDN A;  1WMF A;  2EXH A;  2JD9 A;  4BDV B;  4YG6 A;  2P17 A;  2FBE A;  1PVX A;  4HPK A;  1V00 A;  2P3Y A;  4KU7 A;  1QJX 3;  3WVJ A;  4BM8 A;  4KH9 A;  4M01 A;  2C9K A;  2OS2 A;  2VMG A;  1NQD A;  1NLS A;  2D5F A;  1ULP A;  4BU2 A;  2RR1 3;  5C3Q A;  4QHZ A;  5FMO L;  4R9B A;  2V5D A;  5A7O A;  5CG8 A;  1IS3 A;  1F9K A;  3GJA A;  4WVM A;  1UAI A;  1SAC A;  3ES1 A;  4KWU A;  4ES8 A;  5KC6 A;  4XFI A;  3FN9 A;  4FPY A;  4GKX A;  3VZL A;  3PVE A;  4PHZ A;  3VBR B;  5BNO A;  2JKB A;  5DAX A;  1OSG A;  1Y9M A;  5LK5 A;  4IEO A;  4XUQ A;  3VBO A;  1AF9 A;  3AZY A;  1UOF A;  4NMI A;  2R49 A;  3EO6 A;  1WW4 A;  1RMU 3;  1JYN A;  1UF2 C;  4QQL A;  3RG0 A;  3K4Z A;  1TNR A;  4LTA A;  1BYH A;  1NLR A;  2TBV A;  5L73 A;  3ZSL A;  1WUV A;  1OLM E;  2R32 A;  4CDU C;  2VZP A;  2WN3 A;  4HKW A;  1BBT 3;  1I5Z A;  5IK4 A;  5EQU A;  3T0B A;  2ZGN A;  3EXU A;  3JB8 A;  3UGF A;  3FC0 A;  3I3M A;  1RJ8 A;  1WBL A;  1VJ2 A;  1WW6 A;  3THT A;  4FTS A;  1W9S A;  4OQ9 A;  2WT2 A;  1ZZ9 A;  4OLL A;  5A3M A;  2VZQ A;  5L7O C;  3I3E A;  4JGY B;  3P3P A;  1LCL A;  1MS4 A;  1W39 A;  2DCJ A;  4RYD A;  4AED B;  2EXJ A;  4HBN A;  1N3Q A;  1VPH A;  4CP9 A;  3MIF A;  4AE2 A;  3VD9 A;  1XNA A;  5DQ0 A;  5FPU A;  5LY1 A;  2I2S A;  2Q30 A;  2WNV C;  1DQ6 A;  2VGD A;  3KT4 A;  3QD6 A;  5BNP A;  4UW5 A;  1JZ5 A;  5BY5 A;  1RUN A;  3POE A;  1ND2 C;  4ASL A;  2K0G A;  4HKL A;  4FFF A;  3O1U A;  5FLJ A;  1NQJ A;  1COV 3;  2JXA A;  1WCK A;  4CCE A;  4LO5 B;  2Q8E A;  1XC6 A;  2IWG B;  5A6X A;  3HBK A;  3T4V A;  4MG2 A;  4BQY A;  2VR4 A;  3U1X A;  3O1M A;  4PLO A;  3VKF C;  5BNN B;  5JSP A;  1PZ9 A;  3PIJ A;  5JZG C;  1NUK A;  3O0W A;  1V6K A;  1FAY A;  3DKW A;  1PO1 1;  4NAM A;  3ZPO A;  4YZ2 A;  2GDF A;  2GSY A;  1F35 A;  4FQZ A;  1J3R A;  2ZTN A;  1S0B A;  4P9W A;  1Z7S 1;  5IUQ A;  4WVZ A;  1QKQ A;  3SC7 X;  1KGY A;  1W8H A;  2GC3 A;  3N3H A;  1XXN A;  2F6B A;  5JXI A;  2BGO A;  2YYO A;  4O7X A;  2UYB A;  1C57 A;  1W8W A;  4IV1 C;  4QPG A;  4YRD A;  4Z92 B;  3HNB M;  3ACI A;  4FFG A;  3U11 A;  4I09 A;  1QQP 2;  4FFI A;  5ANN A;  1HIX A;  5B4X A;  3P1I A;  4W6X A;  4GH4 C;  2DWR A;  4XAB A;  4QM9 A;  4BIS A;  3T30 A;  3ME2 A;  3ZSK A;  1UMZ A;  4XFG A;  3AC0 A;  1ACC A;  1Y4W A;  1W2T A;  3CEW A;  1F8V A;  3KQR A;  3NRU A;  4AVC A;  1QDO A;  3AX4 A;  1K5M C;  2WLQ A;  2B39 A;  5IK5 A;  1RJ7 A;  3ACG A;  1IPS A;  5F39 A;  4E4H A;  3NNM A;  3A23 A;  3E97 A;  3VDA A;  1D4M 1;  4XUT A;  2K46 A;  2ZKL A;  3LIG A;  2XJV A;  5IW0 A;  5T54 A;  2QQL A;  4HVR A;  2WFF 3;  3NW4 A;  2CAU A;  1H4H A;  4FT8 A;  3ILR A;  2MEV 2;  2NQY A;  2VM9 A;  4KWJ A;  4K6B A;  2O8Q A;  1PMJ X;  3I2I A;  3WW3 A;  4COW A;  3C7H A;  5SV8 A;  5GAL A;  2K2S A;  5DZG A;  4ZS3 A;  3FFQ A;  5EZW A;  5KHI A;  2Q1Z B;  2QKD A;  1AL2 2;  3HOB A;  1AXY A;  4QQO A;  4QU1 A;  3I2H A;  3WDX A;  4FTB A;  3S30 A;  4UW3 A;  2JD4 A;  2DV9 A;  4LOS A;  3PUS A;  4XIO A;  4E4Z A;  2VMC A;  4M3C B;  4LKS A;  1VBC 3;  4YZ5 A;  2RJL A;  2VEC A;  5LA9 A;  3ZSJ A;  3MIH A;  1W6Q B;  1VBE 3;  3WLU A;  1T6G C;  1WA6 X;  2LW8 A;  4ARX A;  3VD4 A;  2XQR A;  1MS5 A;  3RS6 A;  1URX A;  5JI9 A;  1ZRF A;  2VU9 A;  3GZT B;  4I01 A;  4AW7 A;  3VBS A;  4N8M A;  3JB4 C;  2C9A A;  2O0O A;  1TMF 2;  4GWN A;  3SKV A;  4NID A;  1W6N B;  1PMH X;  1C8M 2;  2YC2 A;  1RUC 1;  5L36 A;  1JU4 A;  5HV4 A;  4U36 A;  3CZU A;  4GWJ A;  4QX0 A;  2BBV A;  4XDP A;  4MGZ E;  3PVO A;  2A3W A;  1GUI A;  2BNM A;  4E8D A;  4Z8B A;  3M8L A;  3Q8F A;  5DDJ 2;  5DAB A;  1HN1 A;  2HEY F;  3VBS B;  5GZC A;  3DGT A;  2HWB 3;  2DTY A;  3HJR A;  4NVP A;  1LES A;  4DOU A;  1QNW A;  4O65 A;  2IVI B;  1PNF A;  3ZSM A;  4OUL A;  4GQ7 A;  1PGL 2;  2FQP A;  3NAP B;  5F5I A;  3TRS B;  1NAE A;  3HT2 A;  4YW6 A;  2DFC A;  2VOW A;  5BNQ A;  1NCR B;  4QGN A;  4KBZ A;  1QY4 A;  1GNY A;  2GNM A;  2W08 A;  2Z5W A;  3BGA A;  4QDQ A;  1G9C A;  4EN9 B;  1VRB A;  2P4E A;  4QKN A;  3LZZ A;  5LZ6 A;  4N9H A;  5FP4 A;  4CP1 A;  1HB4 A;  2ZGM A;  2JEC A;  2BWC A;  2E7T A;  3K3O A;  4V1P A;  2CY6 A;  5CB7 A;  3LGR A;  3FLT A;  4FO9 A;  4XOG A;  2UY8 A;  3G7D A;  4HZF A;  1G86 A;  5FZ4 A;  2R07 2;  3QH6 A;  1OC1 A;  2BOJ A;  4QPW A;  5FYZ A;  4A4A A;  1QEX A;  1YNA A;  4IEU A;  3WT3 A;  5L9V A;  2XOM A;  4K3U A;  2KXL A;  1EAH 1;  4LO4 B;  2RS1 2;  1AYM 3;  3ZSE A;  1IGO A;  2AUY A;  1DYO A;  3AJY A;  1AXK A;  1Q8O A;  1PVC 1;  3HVD A;  4FPF A;  5FZ0 A;  5BPX A;  4X8N A;  4XHB A;  2GC2 A;  1VRH 2;  1AR7 1;  4CEY A;  4DEQ A;  1O3R A;  4QXK A;  1UZZ A;  4J1X A;  5CA6 A;  3VZJ A;  4NWV A;  4P9L A;  4DRR A;  3HQU A;  5A3P A;  3Q8C A;  2OW4 A;  2D6O X;  3IDB B;  3LA2 A;  1J59 A;  2WAA A;  3KT1 A;  1Y3T A;  2DDU A;  2AEY A;  2VOK A;  1PO2 1;  2Y6K A;  4P9G A;  3Q9O A;  1DGR N;  1S4C A;  1E57 A;  1HRI 1;  1KJR A;  1OD3 A;  2HEV F;  2C6S A;  3IBM A;  4LIU A;  5A80 A;  5F3G A;  3AYC A;  2Q8D A;  5EIY B;  1X36 A;  4LUM A;  3O1S A;  3DPR A;  4OHY A;  3RRD A;  4YAR A;  1JTZ X;  1US2 A;  4QB6 A;  2XGX A;  4RHV 2;  4B1M A;  2ZEZ A;  1W04 A;  2ZGS A;  5I0D A;  3JCI A;  2E33 A;  2P6C A;  3HT1 A;  3CZJ A;  4Q26 A;  5CNA A;  4AHW A;  4K1Z A;  5L7O B;  5K8S A;  4B29 A;  1LRH A;  4AFB A;  2Y34 A;  1LHV A;  4ZU4 A;  5FYH A;  3NJX A;  4MZU A;  2ATF A;  4YW2 A;  1RIR A;  2XL9 A;  1UPS A;  4LXL A;  4TZD A;  1CR7 A;  3B01 A;  3RI8 A;  2WNV B;  2QCS B;  1HV1 A;  1POV 1;  2WZE A;  5HCF A;  1HXS 1;  1EAH 3;  1PNG A;  1ND2 B;  2VVE A;  3KSC A;  4Q29 A;  2XL7 A;  4XQ4 A;  2W1Q A;  1FI2 A;  1KQR A;  3WSO A;  3ZFG A;  4R4X A;  2TEP A;  1AR7 3;  2VTF A;  1F15 A;  3PU8 A;  1O7F A;  1A78 A;  1ZZC A;  2H6C A;  4S2D A;  4XJA A;  1NYW A;  2D6P A;  4L99 A;  3U07 A;  1R1A 1;  2CDP A;  1UU4 A;  4LLF A;  1FOD 1;  2A3X A;  1OXC A;  4UF0 B;  4CUC A;  4HET A;  2CYF A;  2HKX A;  3R0R A;  1PO2 3;  4PIY A;  1ZA7 A;  4Y22 B;  4AQ6 A;  2ZGR A;  3MIG A;  4KG8 A;  3AMQ A;  4NIA A;  2GN7 A;  4LO7 A;  5FPB A;  3IPV B;  4Q4X 1;  4YGB A;  3ZYH A;  1H1M A;  3VZK A;  2D6L X;  3BTY A;  2WS9 1;  4IV1 B;  2ZGU A;  3PL0 A;  5FFO C;  2Y6F A;  5A7W A;  3T0D A;  4LBK A;  4IER A;  1I3H A;  3O0V A;  1G9F A;  5FPA A;  1JZ4 A;  1N3P A;  4KL1 A;  3U75 A;  5IWF A;  2R06 3;  4LIV A;  1JZ6 A;  4GH4 B;  4CCO A;  1RHI 2;  1EYB A;  3QBQ A;  5A33 B;  2XJU A;  4PT6 A;  4XUN A;  3FWE A;  5DZF A;  3RMY A;  2D43 A;  4Y4Y A;  4IV3 A;  1JZ2 A;  4HSJ A;  1IKP A;  5A7W B;  2LRO A;  1K5M B;  4IND A;  4XF3 A;  2JDN A;  3UK9 A;  1VBB 3;  1PZ8 A;  4PLN A;  1UMH A;  1HXS 3;  1GQG A;  5B4N A;  1YJK A;  1CIW A;  1D2Q A;  4LK6 A;  3J7M A;  1S1A A;  3IDC B;  3MW2 A;  4NO4 A;  4EN7 B;  1BK1 A;  2DVF A;  1XNB A;  3WW1 A;  3BTX A;  4QX2 A;  1UY1 A;  4HVO A;  1R1A 3;  2CU5 A;  2VXJ A;  3CJI A;  1FOD 3;  4B4Q A;  3E5Q A;  4YW4 A;  1V6N A;  4D6R A;  1DZQ A;  4WBB A;  1BEV 1;  4BQW A;  2BP6 A;  4LMF A;  5JIA A;  1ZX5 A;  4AAP A;  1VAM A;  1FMD 2;  3W5M A;  1YFW A;  2XWB B;  5IFP A;  1LEM A;  1A8M A;  1R09 1;  2XBO 2;  3AZW A;  4NN0 A;  4AGG A;  1W0O A;  5T50 A;  1LTE A;  4XBN A;  4CXW A;  4BIO A;  2ZS6 B;  2JKX A;  4LJH A;  3VKN A;  4OI2 A;  1W6O A;  5K7P A;  4W50 A;  1H1I A;  2BVB A;  4XQD A;  3OUI A;  2J1R A;  2WS9 3;  4QX1 A;  1HX6 A;  1AVB A;  5FZI A;  4B7K A;  3HQR A;  3IDA A;  1MPX A;  1E5R A;  4LUK A;  1D0G A;  3DXT A;  4XF0 A;  1GLH A;  3LQC A;  3QLQ A;  3CF6 E;  5C8C C;  1ND3 A;  4TLF A;  4D94 A;  1POV 0;  1B35 C;  1AR6 1;  2MHF A;  4LR4 A;  1HLC A;  2DBN A;  1ZRI A;  5K0U A;  4BJ0 A;  1CAX A;  3AP7 A;  2VZT A;  4JQT A;  1ZBE 2;  3PIG A;  5FLI A;  2JDY A;  3GYD A;  4L9B A;  4A3Z A;  1TME 2;  2FCT A;  3USU A;  3BU7 A;  5DAV A;  4EN6 B;  2A6X A;  2WLP A;  3ZYG A;  5J3U A;  3S6P A;  2ARB A;  5KR7 A;  3X29 B;  5KHH A;  4XBQ A;  1XOY A;  4UFJ A;  5K0U B;  2JX9 A;  2QQM A;  2J42 A;  3TEY A;  1XYP A;  3TN9 1;  2Q8C A;  2PN5 A;  2Z79 A;  4AI3 A;  1MZF A;  4RQP A;  4CCM A;  4E27 A;  3WG2 A;  2VTX A;  3WP4 A;  1UWW A;  1VB2 A;  3AYD A;  3BOD A;  5J98 B;  5IVV A;  4W8J A;  1EPZ A;  1VE0 A;  2OUJ A;  2X29 A;  4ERO A;  5JOX A;  1XYN A;  3W20 A;  3WP6 A;  2OT7 A;  4V2V A;  5FO7 B;  1CAU B;  4AI0 A;  4DUX A;  4QGM A;  4RGG A;  3ZFF C;  1BKZ A;  3USS A;  1Q5O A;  3POG A;  1UYZ A;  5KHJ A;  3DEC A;  3VDD A;  2RDN A;  5JI7 A;  4FPG A;  3ROU A;  2VBB A;  4QXC A;  1QIQ A;  1LOA A;  2WNU A;  3I3B A;  3ASI A;  2VOV A;  1U5Z A;  1G8W A;  1ZBA 1;  3K4A A;  4J6G A;  4EN8 B;  2QFE A;  2NLR A;  2P3I A;  5KXD A;  2YV8 A;  1GP4 A;  1DU3 D;  1MEC 2;  1PO1 2;  2WR9 A;  3M1H A;  4EZH A;  4QB2 A;  4V2W A;  1AR6 3;  2I45 A;  2O1Q A;  1OA2 A;  2XHN A;  3BOP A;  1KDM A;  3S5Q A;  4YGC A;  1SLT A;  2W91 A;  1KRI A;  1C5H A;  1W3V A;  2W2I A;  2X5I A;  4XC9 A;  4A44 A;  1LU2 A;  2ZHM A;  5EPA A;  4Y20 B;  3GF6 A;  1K3I A;  5JOW A;  3CBN A;  5K4L A;  5L19 A;  2AYH A;  4YM2 A;  4I2O A;  4Q27 A;  4P08 A;  2H6B A;  3U37 A;  5BNO C;  2YB7 A;  1JMU B;  4YG0 A;  1US3 A;  3RZL A;  2D3P A;  1CN1 A;  1CAW B;  3NJZ A;  3WD5 A;  3VBO C;  1U0A A;  2YHJ A;  3MID A;  4LNV A;  2A3Y A;  2F4P A;  4GMP 1;  4F8A A;  1ASJ 3;  3B5L B;  1UU6 A;  3ZX7 A;  1TNF A;  1VLN A;  2ZAC A;  2XJR A;  3N7K A;  4S2F A;  4L92 A;  5A7Q A;  5GLV A;  3TN9 3;  1H4G A;  1KJL A;  4NRM A;  2GH8 A;  1V6M A;  4L97 A;  5EV7 A;  1DGW X;  1JOP A;  5FY7 A;  2VCA A;  4YZ1 A;  3H8O A;  1H2N A;  2RMU 2;  3N9O A;  4A42 A;  1FV2 A;  3JU9 A;  2PMW B;  1SDW A;  1REE A;  3TNP B;  5IHR A;  4JTO A;  1MAC A;  3FFZ A;  3OY8 A;  5BYN A;  1YXW A;  2CWS A;  4YW1 A;  4NIG A;  3AP9 A;  4AF9 A;  2EIG A;  4BLI A;  1Y43 B;  2ES3 A;  4BB3 A;  2B46 X;  4LBQ B;  3FHI B;  2A7A A;  5IAT A;  1ZBA 3;  4XJZ A;  1RC6 A;  2MPF A;  1HRV 2;  3ILF A;  3QAC A;  5E88 A;  2PXJ A;  1WKY A;  3LE0 A;  5T5J A;  5BNP C;  1JYW A;  1JI6 A;  1LEN A;  2G9Z A;  3LSD A;  2R0F A;  4PBO A;  4YW7 A;  2F4L A;  2GNT A;  4BME A;  2XKO A;  5AC9 1;  4H7M A;  1BJQ A;  4IEQ A;  4Y24 A;  3ETP A;  5B2G B;  1ZZB A;  3SNM A;  1XU2 A;  5LEK A;  3DCQ A;  2PLV 3;  3GZA A;  3RYP A;  1WBF A;  5L9R A;  4WZF A;  2WZP P;  1V6J A;  3UET A;  1WCS A;  4XF9 A;  4CYD A;  5FO8 B;  3I2F A;  3MF6 A;  1PM7 A;  5SV5 A;  2YPJ A;  4FSJ A;  5FZ8 A;  3AVS A;  3IAP A;  4MGI E;  5FYV A;  3RNS A;  2YGL A;  3VZN A;  3SMH A;  2A6W A;  4XTP A;  3T2Q A;  1RVF 2;  1NZI A;  3CNA A;  3OOX A;  1IPK A;  2O14 A;  4HN0 A;  4KGQ A;  1VR3 A;  4GMP 3;  3WCS A;  4LHL A;  1RUO A;  4XUO A;  4WM7 A;  1GFF 2;  4QXB A;  4BH9 A;  5C71 A;  1UMI A;  4MGS A;  5FMD A;  4CVU A;  5FZB A;  2GH2 A;  3SXW A;  4AQ2 A;  2C1F A;  1C8M 3;  1GU3 A;  4SBV A;  3AZV A;  3E6C C;  3WX5 A;  4AOC A;  2WL1 A;  2JDM A;  1AUY A;  1H6Y A;  4FXG B;  4AFA A;  4OHX A;  5H9P A;  3NNL A;  5ACA 2;  1UYY A;  3JBG 3;  2O8O A;  1STM A;  1LKN A;  4UW6 A;  3B93 A;  1W8F A;  3R4S A;  4HG6 B;  3KQ4 B;  5AFE A;  1GMM A;  3VBF A;  3WDV A;  5A32 A;  2E7Q A;  1Q43 A;  2WT0 A;  4QT6 A;  1O4T A;  4LHN A;  4BZ4 A;  3E1F 1;  5E8A A;  3C7G A;  4TLG A;  3ZDS A;  4O9G A;  2KM2 A;  3T2O A;  4RR3 B;  3BTZ A;  1YC6 1;  4IEY A;  1YWK A;  5LBE A;  2VVF A;  3J26 N;  2HH9 A;  4ZU5 A;  1F4H A;  2WC2 A;  4XF4 A;  1CON A;  2GZW A;  1YRZ A;  2Q5T A;  3ZMO A;  3V0A A;  4A2U A;  3OGV A;  1DYK A;  4L2N A;  1DZR A;  3AMM A;  1IQA A;  1UZW A;  3KB5 A;  5DUU A;  1GQP A;  1YQ6 A;  2EXI A;  1ALY A;  4D7Y A;  4RA0 A;  3TBD A;  2JIC A;  1G7Y A;  1QJX 1;  4PLM A;  5FPL A;  2A6Y A;  4GUL A;  4E9K A;  4AEM A;  1H2L A;  1IZ3 A;  2WII B;  2RR1 1;  4BHP A;  3WOG A;  2LUW A;  2AC1 A;  2YFZ A;  5F2S A;  5IAV A;  4CUB A;  4CTE A;  3H3L A;  1UNB A;  4QHB A;  1ULD A;  1DQ5 A;  1XRU A;  3T3Y A;  5JUV A;  2ZEX A;  1EPW A;  4AWD A;  4QKB A;  2G19 A;  3U14 A;  3WG3 A;  3VD7 A;  2WZR 1;  3GZU C;  3E5U A;  4E4S A;  3ENR A;  3VLB B;  2BBA A;  4S2G A;  3ZYF A;  4EV0 A;  1VMF A;  5C8C B;  1AJK A;  2DCK A;  5F6K A;  4CDW A;  4JQR A;  1MS3 A;  3KT7 A;  1B35 B;  3VBS C;  5FRE A;  2GAL A;  2IXJ A;  1RUJ 2;  5FYU A;  1RUD 2;  1LU1 A;  5D1I A;  1R08 2;  3GM8 A;  3FLP A;  3LOB A;  5AFB A;  1S0C A;  2WKK A;  5J96 B;  1QH6 A;  3UNP A;  1J58 A;  1OPM A;  1NXM A;  1S0F A;  3AKQ A;  1BBT 1;  1GV9 A;  3MPB A;  4FPE A;  5JAX A;  4XYX A;  4W65 A;  2CDO A;  3THD A;  3RZH A;  4Q0Q A;  1UXZ A;  1W05 A;  4KI5 M;  4RHV 3;  3A0N A;  4YW5 A;  3SCF A;  3WDT A;  4COV A;  2GMM A;  2VOT A;  4AQT A;  4K9S A;  2BVV A;  1YQ5 A;  3NVC A;  4JTN A;  4QU2 A;  1WZX A;  3B9I A;  4EWA A;  3LOI A;  4FOQ A;  2PQS A;  1ST8 A;  2YXS A;  3JD7 1;  1LOF A;  3R05 A;  1DGW A;  2PHU A;  4GAZ A;  2HWF 1;  4QHO A;  2B42 B;  4SLI A;  3T1L A;  3C7F A;  4RSU A;  4WV8 A;  5FYS A;  5C3O A;  1DGR A;  3LSE A;  4FPO B;  3VUO A;  1BZW A;  4JGZ A;  1VBD 1;  4IE0 A;  4MV2 A;  2ARX A;  4IXL A;  2WFP A;  5DAW A;  1XE0 A;  4D0Q A;  4Q0P A;  4AK3 A;  3ZFF B;  4CXY A;  1COV 1;  4Y5S A;  1QOT A;  5LBF A;  2HWD 1;  2HWC 2;  4HPK B;  2WZ8 A;  3N35 A;  2X10 A;  3OCP A;  2XLG A;  2WZR 3;  5FY4 A;  5I8S A;  5A70 A;  1RUG 2;  2E26 A;  4AL9 A;  4RGK A;  3AKS A;  4CP2 A;  2XVL A;  5F5Q A;  2YZ4 A;  4YYO A;  2XQX A;  1CAV A;  2GME A;  4N9I A;  3WR0 A;  5CG9 A;  4TYS A;  1OQD A;  4IL7 A;  2E6V A;  2EIC A;  3CL1 A;  3J9S A;  3WQB A;  3L2Y A;  4WVM B;  4MH0 E;  4JKL A;  4MO3 M;  3TB0 A;  4CEY C;  4XCB A;  2ZA9 A;  5FJH A;  4XAE A;  4CUG A;  3WNK A;  1TQ5 A;  1ULC A;  2XLF A;  1J83 A;  5C9A A;  3DYP A;  5BNO B;  4NHL A;  4X6Q B;  1W2N A;  1LOB A;  5FPX A;  5CYY A;  4D69 A;  5JVV A;  3VBO B;  3OUH A;  4P5H A;  4Q4W 2;  3BTA A;  3K4D A;  1ZZ8 A;  2HWE 1; 
#chains in the Genus database with same CATH homology
 3S5A A;  4NPL A;  3KHC A;  2FDJ A;  4QKN A;  4MGT A;  4IE6 A;  4IE5 A;  4NRQ A;  3BI3 A;  3RZL A;  3I49 A;  4O7X A;  3RZM A;  4OCT A;  3BIE A;  2FDK A;  3T3Y A;  5F8P A;  4NRM A;  4QKB A;  3BTX A;  3H8O A;  3BUC A;  3RZK A;  2FDH A;  3RZJ A;  4NRP A;  4NIH A;  3KHB A;  4NIG A;  4CXW A;  3I3Q A;  3O1S A;  4O61 A;  4ZHN A;  3RZH A;  2FDG A;  4ZS3 A;  4NRO A;  4JHT A;  4NPM A;  3H8R A;  3O1R A;  4CXX A;  4QKD A;  4QHO A;  4IE7 A;  4IE0 A;  3BU0 A;  3S57 A;  3O1P A;  4CXY A;  3LFM A;  4NII A;  3I3M A;  4ZS2 A;  2FD8 A;  4QKF A;  4NID A;  4IDZ A;  4RFR B;  2FDI A;  3O1T A;  2IUW A;  5DAB A;  2FDF A;  3I2O A;  3O1U A;  4MG2 A;  3T4H B;  3T4V A;  3BTZ A;  3BTY A;  4NJ4 A;  3O1M A;  3BKZ A;  4IE4 A;  3RZG A;  3O1O A;  3H8X A;  3O1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...