5F3GA

Crystal structure of human kdm4a in complex with compound 53a
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
339
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 107
structure length 339
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3gA01
5FZDA 4CUGA 2Q8EA 4Y4RA 5FZCA 3OPTA 5F37A 2XMLA 5A7PA 3KV4A 4CCLA 4EZ4A 5F5AA 5E6HA 4QWNA 4CCKA 3PU3A 5FZGA 3N9NA 4BU2A 2YU2A 4ASKA 5FZ1A 5FP3A 4BXFA 3PUQA 4LXLA 5FZ6A 5FY4A 2YBPA 5FXVA 2GP5A 5LY2A 5FPVA 5FZEA 5A3WA 5FY8A 4E4HA 5LWBA 1VRBA 2PXJA 5FPLA 5FZ0A 5A7WB 4LITA 3KV6A 5FJHA 4V2WA 5FWEA 5F3CA 3LDBA 2W2IA 4IGPA 3KVBA 5FP8A 2XDVA 3PDQA 5FYIA 4QXBA 5FJKA 5A7SA 5FPUA 5IVJA 3DXUA 3PURA 5FXXA 5FYYA 5KR7A 5IWFA 5FZIA 4AI9A 5FZ4A 5FP4A 4GJYA 5FZKA 5IVFA 2YBSA 3PTRB 3AL5A 5F2WA 2WWUA 3NJYA 5FZMA 3K2OA 4TN7A 4LIVA 5F5CA 5FP7A 4D6QA 5FY0A 4AAPA 4Y33A 5F39A 3N9OA 5FZ7A 4CCMA 5ISLA 4UF0B 5FBJA 5FUPA 4EYUA 3KV9A 5FZLA 5FZBA 3PUSA 5FY5A 5FYVA 5FUNA 5FYHA 3PUAA 5A1LA 4QX8A 3AL6A 4QXHA 4UF0A 3ZPOA 5A3PA 4IGOA 5IVEA 3U4SA 5FZ9A 5A1FA 4V2VA 3RVHA 5LY1A 5FV3A 4C8DA 2XXZA 2OQ7A 4IGQA 2P5BA 5FZ8A 4GJZA 5A7QA 5A7WA 5FY9A 4DIQA 3K3OA 4DO0A 5FPBA 4CSWA 5FY7A 5A80A 3ZLIA 3KVAA 4GD4A 2WWJA 4Y3OA 5FWJA 5K4LA 2XUEA 5A3TA 5IW0A 4NUBA 4CCJA 3N9LA 3AVSA 5F3IA 4EZHA 4LIUA 2OT7A 4BISA 5FY1A 5FXZA 5FPAA 5A3NA 4QU1A 5A7NA 4XDPA 5FYUA 3U78A 5CEHA 4XDOA 5FYMA 5IVVA 5FZOB 5IVYA 2OX0A 3KV5A 2Q8DA 4HONA 5FYTA 5F3GA 3UYJA 5F5IA 3PU8A 5FZ3A 5FYCA 4URAA 3N9MA 2Q8CA 2OS2A 3N9QA 5FYSA 5FZOA 5FP9A 2YPDA 3N9PA 4QX7A 2VD7A 2YU1A 5ANQA 5F2SA 5F32A 5FZAA 4HOOA 3OPWA 5IVCA 5FZFA 3DXTA 5IVBA 5A7OA 4GAZA 4CCOA 3LD8A 2OQ6A 3AVRA 4D6SA 5LW9A 5FZHA 5FYBA 2YBKA 4QXCA 3K3NA 5F3EA 5FYZA 4CCNA 2GP3A 4D6RA 5FXWA
chains in the Genus database with same CATH superfamily
3SITA 4LO8A 2E31A 4MADA 5A7PA 5LA1A 3I3EA 1SPPA 3UESA 5F5AA 1H6XA 3QCWA 4CCKA 1LB2A 3AB0A 1RC6A 5L9VA 3GZUC 1NA1C 4FPGA 4LJHA 1H8TB 1WMDA 4Y4YA 5J36A 3LFMA 2YBPA 1YCIA 2VAUA 1PZ8A 2Y6GA 2ZXQA 3B94A 1ZBE2 2DVAA 3ZN6B 1OMIA 1JU4A 3K51A 2GH2A 2DCKA 3OCPA 1JYVA 4UT5A 4K8FA 1W6QB 4UW3A 3PIJA 2W2IA 1RUG3 2ADEA 1G6NA 1I5PA 3BCWA 5IVJA 1O8SA 2EAKA 2CNAA 3KCXA 5KR7A 1AR83 1AR61 1H2MA 1H2LA 1V6MA 2H6BA 2YXSA 4KG0A 3MBWA 4NPRA 2P3KA 4XURA 4RQPB 5FZIA 1R092 2Q5TA 1D4M1 4QMAA 4RR3B 3RJRA 4GJYA 3I2DA 4JDMA 4GALA 2BOIA 2G1MA 3OF1A 4IV3B 1YQ6A 4XXAA 5JSPA 1SLIA 4RS5A 3K2OA 5FZMA 3VBFB 1URXA 5C9AA 3AZXA 5LBEA 3JD72 3WQ1A 3VD3A 5CBLA 2LW8A 1RUJ3 4Y1UA 2V4AA 3AFGA 4DXSA 3TEZA 1RVF2 3MV01 3VBHA 1XSQA 2P4EA 1JYXA 3POWA 3B02A 3U1XA 3VL8A 4QPWA 1FT9A 1YUDA 1F5FA 1X7NA 3WP3A 5EZWA 2QQUA 1GWMA 2VBBA 2DURA 2ZEXA 1S1AA 4AI1A 1W8WA 1C4RA 2OA2A 1X8EA 2NZ9A 1KFXL 3D4KA 2ZHLA 2V5YA 3GZAA 4AFCA 4H55A 4ZY9A 1GNHA 1S0FA 4I01A 4AEDB 3OEBA 3JD73 1GSLA 4CEYC 2R061 2ARCA 3BKZA 2NPIA 5D2AA 3N4MA 1LHWA 2PHDA 2NLRA 5FAXA 5AFEA 4XJWA 4UOJA 1UMZA 2IVJA 1LRHA 2NQYA 3WG4A 1O3SA 2K0GA 4JKLA 4AR2A 1OPMA 1R1ZA 3I2FA 3WX5A 2QFEA 3CO2A 4A44A 1T6BX 5LATA 2A1XA 1CZVA 1W3XA 5EV7A 4U2AA 4LO4B 4BQXA 2LALA 2RJLA 1OKQA 3NV2A 2GAUA 4CXWA 5DZFA 3MIFA 1RUH1 3I97A 4J1XA 5FYTA 1IS6A 1RUH3 3PU8A 1UAIA 2BVBA 2RDSA 5FMBA 3TB0A 1YNAA 5BNNC 1FYUA 4LHKA 5LEKA 3H1WA 4B8EA 2VZVA 1U5IA 5FMOS 2ZEZA 2VD7A 3TN91 1PGL1 1HN0A 1SBFA 3KWVA 3LSEA 1TZOA 1RXGA 2DU1A 5C8CA 4HPKA 2OQ6A 4CDXC 4JQTA 3JB8A 2RMU1 1CIWA 4WM7B 2ZS6B 3NJXA 5FK8A 3WDXA 1GV9A 4XCBA 4FTSA 3M1HA 3POFA 4OHWA 5I8TA 4DXRA 1NCRA 3FFZA 4X6RB 1RB8G 1LHUA 1BK1A 2OZ6A 2PYTA 1GP5A 4TZDA 4P02B 4LLFA 4A3ZA 1OLRA 2G9FA 3WHTA 1RMU2 3MFCA 1L7QA 1TNFA 4PDWA 5I8SA 3VBUC 1VR3A 2BEOA 4KH9A 3X29B 2D3PA 3T08A 5J48A 1W6MA 1UZ0A 4MXWB 1DGWX 1OF4A 3DYOA 3CMGA 4Q4Y3 4W65A 3I49A 2A6ZA 3ETPA 1BVP1 2ZEYA 2WFF1 4EN6B 1YFYA 3RZHA 5FY4A 3MV11 4HG6B 2VR4A 4FT8A 5GZCA 4AZZA 4XF0A 5L9BA 4JDOA 1TNRA 1W0PA 3OTFA 2XUMA 3H8UA 4AW7A 4QQLA 1QJZA 3ITQA 1PNGA 2V72A 4L99A 4QB2A 3RJ2X 2O8QA 1BKZA 1REDA 2A6YA 4R4ZA 2EVXA 2XBO1 1NA1B 1H1IA 4UXAA 4B4RA 4CDXB 5JIUA 4KQ7A 4YVSC 5H9QA 3RI9A 4YGCA 2PHRA 5JIAA 4RFT0 3C2UA 4BIFA 3AYDA 3ZN5A 1W8FA 3HVDA 3N3HA 3AYAA 4AQ2A 4WBBA 4C0BA 3PJYA 4XOGA 3UGHA 5FY5A 5JPNB 5FUNA 2BDRA 4LMFA 1FOD1 2J1VA 3ZFFA 1OVSA 3FWEA 2QQPA 3RZLA 1BCXA 3OEAA 2WN3A 3UKVA 3BODA 1IQDC 3AL6A 1PM7A 2JEMA 1ASJ2 4GWIA 3OUHA 4TSVA 2QQIA 1MVEA 4XTPA 3UT0A 4AXOA 2BOJA 3QD6A 4OMCA 2Y38A 2RS52 4BQ3A 3GNEA 1KJRA 1GQHA 2Y6LA 4PF5A 5GLTA 4NIDA 4IGQA 5A7QA 4QX0A 2ZHNA 3IN9A 2XR4A 4MV2A 1JODA 4NROA 3U4XA 4MUVA 3KGZA 4AOCA 1ULPA 4MGYE 5D8AC 4AFMA 5A33B 2Y6HA 3KZ4C 3GDBA 4CU6A 2MEV2 4XF1A 5DUWA 2Y0OA 4YVSB 1RGSA 1TME3 3ZO0B 2XUEA 2YC4A 2OUJA 1H0BA 1WW4A 4YW1A 4ZU5A 2CU5A 4AF9A 4Y1YA 5FYUA 4ARYA 5CEHA 4CDWB 2W0XA 1XU1A 2L9LA 3SCFA 2JDAA 2XQRA 2UURA 1LULA 1BQPA 3FLPA 1OC1A 4XQDA 1CAVB 5A32A 1UOJA 2CGNA 1EUUA 2D98A 5F3GA 3W5MA 5FZ3A 1EAH1 2ZX1A 4Y1XA 2OS2A 1K5MC 4KI5M 2EXJA 4COUA 5A6QA 5JSOA 4Y26A 4C0HA 1NE6A 2YU1A 1IGOA 3O1TA 3OPWA 4QT6A 4CPBD 1BVVA 4HN0A 2G9GA 3SNMA 1W6OB 2RS12 2FCUA 1JU3A 2J1SA 4IUGA 4DUWA 1Q5OA 2VVFA 5HXMA 4HSJA 1YFUA 4Q0VA 2WAAA 4XPVA 4A6OA 1AL0G 3POJA 3I3BA 1OSGA 5FZCA 3ZXAC 3ACHA 1IS3A 1DP0A 1S0CA 1GMMA 4O61A 2WNVC 1UY4A 1COV1 4B4QA 1QQP2 3A22A 2XVGA 3IDCB 4QD2A 2R0FA 4YGBA 3ZOIA 1K42A 4BXFA 1C1FA 4AK3A 3LGRA 1X50A 2VW0A 3NNJA 3HNYM 5ACA2 3S0MA 3LCPA 3NMBA 5FY8A 4E4HA 2BPA2 1D0GA 1VBC3 2WT1A 4GKXA 2GH8A 5FJHA 4V2WA 1ULEA 1CPNA 5FP8A 4YZ2A 3H1MA 4LUKA 4N7IA 4LKDA 1GBGA 1GZTA 3CJIA 3Q8CA 4IEVA 2IXCA 4K9SA 3O14A 5A3OA 4GIQA 2UWCA 1NZIA 5ERLA 4DEVA 2HWC1 4C90A 4QXKA 3ZXDA 2A6XA 2RS31 4BK5A 4JRLA 1EPWA 3VBFC 2HWD2 4HVOA 2J42A 3N7KA 2RM21 3LOBA 2AUYA 1GANA 3OOXA 3ZDSA 4GWJA 4NR1A 2C1FA 2P3JA 5LCWL 1ZBA3 2WZPP 3WF1A 5BY5A 2ILMA 2JIGA 4XJ8A 2C5DA 5CAZA 4S2GA 5FUPA 3WV6A 1VP6A 1YIFA 3OYWB 2R30A 4IEYA 2B46X 5FLJA 3S30A 2BGPA 5FKCA 1PO23 1ENXA 4M0HA 4UFKA 3ZKUA 3AZVA 1FX5A 4LBLA 1Q3EA 5F6KA 3SC7X 4NJ4A 5T5LA 1NE4A 4YW5A 1UOBA 3B93A 3KCYA 5C9AB 2J1AA 2RS13 3OBZA 3A21A 4RS5B 4Z8BA 2V5DA 1MS5A 1CESA 4P00B 2WO1A 4ZHNA 3HN1A 4NOTA 1N3PA 3PHMA 1MS4A 3RZGA 3KT4A 1C28A 2CY6A 4BQ4A 4HSLA 4DO0A 1JW6A 5HCHA 4INDA 2WO7A 4AEDC 2CAVA 3U10A 4Q0SA 3ROUA 1UKRA 4UFHA 4YW2A 5BNNB 4LKSA 2OUHA 1J84A 3I2OA 3K48A 3ZYPA 4UBGA 4NUBA 3QBQA 5DAVA 3SHRA 2VL4A 5HCBA 3WD5A 4CPBA 5CG8A 4LIUA 4BISA 1PMHX 2VG9A 1AR92 2WQ4A 2E33A 4M4PA 4P9GA 2E7QA 3KSCA 1E5IA 1AYM1 5FZOB 4OULA 1W39A 5GLZA 3J8F3 2RJKA 1LHNA 4XVHA 4QB6A 3FZ3A 3LIHA 1W8TA 4XJUA 4LE3A 3IDAA 4EQVA 2DFCA 4ISRA 4LUMA 4UFMA 3VDAA 1I5ZA 5ABJB 4EN0A 4Q0PA 5FP9A 1STMA 2WS91 1BLZA 4PJYA 4X6QB 3U37A 3VDDA 3DXTA 2P3IA 3IKWA 4AI0A 4YZ1A 1CAUA 4BIOA 1W2TA 2IFWA 2JG9A 2QQMA 4QDRA 3VZNA 4BB3A 1QJY2 3NJZA 3MZHA 2PFWA 1V00A 4LLOA 3UJOA 1BBT3 1MVQA 2BTVC 3GXUA 3W5NA 5IK5A 5A70A 3O0WA 4AVAA 5FQ0A 1LAJA 1LODA 3FE5A 4JVAA 5FFOC 3TAYA 4Y1ZA 1OA2A 1IPKA 1ND3A 1JS9A 1K5JA 4HN1A 4I0BA 1S0JA 5K7PA 2WFF2 3N9NA 4FOWA 4AGVA 5FZ1A 3I8TA 1W90A 3VZLA 4PQQA 3LE0A 1PX3A 2VH9A 5F9TA 3LQCA 1ND3C 2P17A 2ZJCA 4Q1PA 3S5AA 2PQQA 2WR9A 2PXJA 5FPLA 2F6BA 2D6KA 4YM0A 2A6VA 2JXAA 3T0DA 4PLNA 4Y22B 5EIYB 4YW4A 2ERFA 2MPFA 4LBKA 3ZXJA 2B39A 2ZX2A 3MIEA 2XDVA 4PIZA 5A7SA 5JXJA 2WYSA 3APBA 4D7TA 2VULA 3CBNA 3A23A 2KM2A 1S0EA 3SXWA 1LOFC 2ORZA 2NYYA 1DGRA 2HWE2 2YPJA 3KB5A 2HLEA 4L2NA 4XUNA 1DF0A 5FZ4A 4EN8B 2JG9B 2ETEA 3ZYHA 3U0ZA 1MEC1 3HT1A 1QJU1 2DDUA 3IT8A 3SKJE 1SEFA 4BQWA 2BQPA 1R1A3 2VXRA 1GU3A 1RINA 1R1A2 1GNYA 4W6WA 4LKEA 1AL23 1DQ5A 3BU7A 4RL7A 4Q4X1 4ZS3A 4YW3A 2Q1MA 4HPKB 2BBVA 3TBDA 3ZIXA 4I30A 5GZGA 4I2OA 4UF0A 2TUNA 4XIKA 1GZWB 1XPWA 4Q1RA 3LF7A 1MZEA 4URTA 2HWE3 3WCSA 4DY3A 3RYKA 3MI8A 2DV9A 1JH5A 1JOJA 2PLV1 2VOTA 3HBKA 4GH4B 1WLDA 4PCRA 4UFJA 4BH9A 4GZ9A 2P6HA 3EYPA 3RDIA 2VNRA 4CDWC 1NKGA 1SBDA 1ZRIA 3B01A 4HK9A 2QQJA 5FPBA 1QH6A 4D3WA 3IZOA 4YGDA 2A70A 1VBE3 1GKBA 3K4ZA 3WP6A 2R071 3M4FA 3PL0A 5C3OA 3LA2A 1BYHA 4YZ3A 2R16A 4W6YA 4WM8B 5K0UA 3LWCA 5IW0A 5A3MA 2W46A 3LFIA 4OHZA 4OZOA 3VZMA 5M0TA 2QJVA 2PAMA 4IEPA 3WSOA 4LKFA 1X82A 4JC1A 1WBLA 3E97A 1GQPA 1QU0A 1SLAA 5TSWA 4N53C 2VNGA 5L73A 1FOD3 1JMUB 4URAA 4OVEA 1VAMA 3POSA 1I6XA 4Q5OA 4AQ6A 5FTTC 1Z0HA 3VBOA 3D3AA 3SISA 1PO11 2KA3A 1LCLA 3W58A 5C3RA 1AYN1 5C7GA 1O4ZA 4PI0A 1Y3TA 2Q30A 3P3PA 1QEXA 3OGGA 4BLIA 4R9BA 5JWPA 5FYBA 2QQVA 2B4KA 4A4AA 3WOGA 1J3RA 1R1A1 3GALA 1SBEA 3ZFFC 3J8F1 3H8RA 4QPGC 1A8MA 1OD3A 1UZVA 2PHWA 1AHSA 1LJ7A 2R063 4GXLA 4N53B 5EPAA 4XE9A 1NYWA 3KV4A 4HL0A 4MGZE 2VCCA 4CCLA 3WF0A 5E6HA 5K0UB 1LECA 1UXZA 3CKHA 2A3WA 3OSDA 1OI6A 4XAAA 2RV9A 3QH7A 4QX3A 3NV3A 1S2EA 1BXHA 1UW8A 2PQSA 4FAGA 3K4AA 4BZ4A 3ZX7A 4M3CE 5JZGA 4LBQA 5IK7A 4KBZA 2JECA 3LZZA 4QM8A 4EN7B 3LEKA 1G9FA 3GYDA 5DABA 5A7WB 5LA2A 1UL9A 2BERA 5FWEA 1YQ2A 5DG2A 4IETA 5HCFA 2WO2A 1DZRA 1RUI3 1GZCA 2ZCWA 1RUC3 5FJKA 5T54A 4BQ5A 4CCDA 1DDLA 2YROA 1FNYA 5FYYA 3U11A 2C9KA 2NM1A 3H3ZA 1YWKA 5EP9A 1EAH3 5CISA 5KXCA 2DU0A 4Y5TA 5FP4A 2YC2A 3SLIA 1OH3A 3ACGA 4MX3A 4TN7A 4DY5A 2IZWA 4BYYA 3BVCA 5DUUA 4AAPA 5CADA 3BUCA 4Y33A 1HQLA 5F39A 1W04A 1CN1A 3N35A 2LRPA 2N7GA 2RR13 1YQ8A 1WW6A 4GULA 2Z2SB 5C70A 3AMNA 4FPEA 1FAYA 2HWB3 3PUAA 1LOFA 3PUHA 1DQ1A 1SG3A 2XLGA 4JHTA 1RVF1 3HAGA 4AGRA 3LKJA 4HLTA 3V64A 4OHYA 3I59B 1HXS2 2EIDA 2RS33 1W03A 3JCIA 4JGZB 4NWWA 5IAVA 5A1FA 2X8KA 3K75B 4JGYC 4EJRA 4IE4A 1RITA 1WD4A 5GM0A 3PJQA 3LB9A 3ZYGA 1JYNA 2RR12 4B29A 4YM1A 1IG0A 3RNSA 2YFZA 2MNGA 2HEWF 5FO7B 1AYM3 4GWMA 3I3QA 3V0AB 3O1RA 1VBC1 1AVBA 2JDZA 3CJIB 1N1VA 1V9U3 3WDVA 3M3IA 4Q29A 4Y20A 4WM8A 5JR2A 2A73B 1REEA 2HWB1 2R7EB 2VO5A 3M3QA 4GMP0 4NPLA 4XFCA 1QDCA 3WINE 4RQPC 4FFGA 4JGYA 3AVSA 4KWKA 4M0NA 4BXSV 1DFQA 1V0AA 5C8CB 4MG2A 5E16A 3IM0A 1X9PA 2KD7A 4EN9B 1C8M1 5FRAA 1SFYA 1XQNA 1UYYA 4RN5A 4A6SA 4RSUA 1CJDA 4WVWA 3UYJA 3G7DA 2PHTA 1HRV2 2DUOA 3ZYJB 3TN92 3HD8B 4Q4X2 2HYXA 5E8AA 3C7EA 4JHZA 4K8RB 4AQTA 3D0JA 2D7FA 4DQAA 5A33A 5KXBA 1V6KA 2OYZA 4BMBA 2WNOA 2O14A 3LD8A 1H8TA 3AYEA 3WVJA 4Y24A 1W3VA 3NNLA 4DINB 5LW9A 1HKDA 2SBAA 4AVSA 3VHPA 3P6BA 1D2SA 1PK6C 4P9IA 4NIIA 1WMXA 4QHOA 4XBLA 2ZX0A 1XU2A 5DDJ3 1RMU3 3IAQA 5GJ6A 4O9EA 1YHFA 3IWZA 2XJQA 1FPN1 1GYKA 3E1F1 3ZSMA 3ES4A 2WFPA 3ZKYA 4YARA 3IIAA 1XYPA 4XUOA 4BK4A 4P9XA 4CEYA 4FFHA 3B3QE 1ND2A 1MQTB 5FR3A 1ZBE1 4CDWA 4UI9L 4AI2A 2B5HA 5DAQA 1JHJA 4JKMA 5JAXA 3O1OA 4FPKA 1IZ3A 2XHKA 4DZGA 1Z78A 4KL1A 1ND2B 1W2NA 1G86A 2PHFA 1VBC2 2A71A 4LBNA 2VZTA 2EALA 3GCXA 3IDBB 5ABJC 1SMVA 1ODNA 4AYUA 4QXBA 2NMNA 3JU9A 4F7ZA 3F95A 2HWB2 1R082 1ZYBA 3C7HA 4AI9A 1FMD1 1DGWA 3WG3A 5LZ6A 3AKSA 4XJ9A 5I93A 2RDNA 4BE3A 1HJGA 1JBCA 1YEWA 4P14A 3T1MA 2RS32 4HK8A 3VKFC 4Q0UA 1HQNA 2RDRA 3CNAA 4RS5C 1O91A 2PLV3 1QJY3 4LIVA 5DDJ1 2RMU2 1UIJA 3BGAA 3A7QA 3ATGA 3KGLA 4LHSA 4UFLA 4EYUA 1W06A 5FZBA 3PUSA 3PVOA 3OUIA 3QH6A 5FKBA 3VBSA 2VNVA 3ILFA 4AFDA 4GMP1 1ASJ1 3RPQA 4NRQA 3RWNA 4YM3A 5IFPA 1DQ2A 2QDNA 1ST8A 3R4SA 1PIV1 3O1UA 3USSA 4JX0A 1O3TA 3UL2A 2CWMA 1VBA3 5ABJA 3WEZA 1OOPC 3AP7A 3IPVB 4ATFA 1H2NA 1MEC3 4YFZA 1NCRB 1ZA4A 5CKQA 5JLVA 3OBAA 2FCVA 1W2UA 1CX4A 3POIA 5CB7A 4XJAA 2RMU3 1ND2C 4Y20B 5GZDA 3SQOA 2RHPA 4CSWA 2V73A 1UPSA 3P1IA 4EROA 5AC93 2C6SA 4OFGA 1T2XA 1HJFA 1UN1A 3THPA 5C3PA 3TYJA 4QKDA 4C1WA 4Y3OA 1L3JA 1PVC3 2P6CA 2LS6A 5FO9B 3VL9A 1FI2A 2RM23 3CZUA 4YG3A 3VBSB 1U0AA 4IERA 5CU1A 3FLRA 5I91A 2QQNA 5FY1A 5L36A 5IFTA 2SLIA 4QPIC 4YWAA 2D5FA 4W8JA 1QJU3 3K77A 1IPSA 1US2A 4R52A 4NIHA 3GM8A 1ZX5A 1MACA 2A75A 2VTFA 3VGIA 2J1RA 3MF6A 1LKNA 3DUIA 1W6OA 4Y22A 4AL9A 2GMMA 1PO22 3VDBA 1WA6X 1QY4A 1AR63 1W6NB 3OD0A 2R073 2IXIA 4RD7A 1OQDA 1S2KA 3E5XA 1H9PA 1ZM1A 1AXYA 4AHZA 2JE7A 1J3QA 1BEV1 5C71A 1BEV3 4D6SA 3PMSA 1J1TA 1LGCA 1LU1A 1QOOA 2X5IA 2CAUA 1F31A 4P5YA 5F3EA 2RR11 1B35A 1QOSA 4YZ4A 1FPN3 5FYZA 4AAXA 4AHWA 1HDKA 2D97A 1QNWA 2WINB 4Y5SA 5FZDA 4FPCA 4OLLA 4HXCA 1NCQA 1G8WA 3PLQA 4I3GA 4JGZA 3ZSLA 3SCGA 2DVDA 2QTWB 3UV9A 3O1PA 2VOWA 2WZR1 1VB4A 5I0UA 3VD5A 2R041 5LRSA 1OHFA 4XZPA 3PUQA 4LXLA 2ZGLA 1ENRA 2GP5A 3DEMA 3ZSJA 1S0BA 3VBRB 4LK6A 2E7TA 2JKBA 2J22A 4GH4C 2Y33A 4OZXA 4MH0E 1VPHA 4QX5A 1NCRC 4SBVA 4FPOB 1J83A 3ES1A 4IV3A 4IGPA 2WLPA 3VBRA 2FD8A 5EYYA 3WUCA 1ZZBA 1OKOA 5EQUA 2DVFA 1N1YA 2X53S 2ET1A 2GMEA 2ZMNA 5CFDA 4Q4Y1 4DEQA 4DFSA 1X9TA 5KHIA 4WVZA 4Q27A 4Q4V3 3S6PA 1RUOA 3UGFA 3G6JB 3ZYBA 4LOSA 1SLBA 2R6QA 3FBYA 1IOAA 3VUOA 5JOZA 1DCSA 1WLWA 4GQ7A 2QUOA 4UAPA 3HQUA 1EUTA 2VC9A 4CCMA 2XJUA 4IE5A 1YQ5A 3EXUA 4XFFA 2BNMA 2HEVF 2OZJA 4K21A 1K3IA 1PIV3 1IPJA 5SV8A 2HJIA 4YG0A 3VBHB 2WZR3 4FAHA 3WW2A 2BNOA 4YSFA 3ZXEA 4NVPA 4XFGA 1NZCA 1R093 4FPYA 2RS51 1OUXA 5FZ9A 4E2QA 3V0BB 4DB5A 1M4WA 1RJ7A 2PMWB 1HIXA 1W9SA 4P9LA 4BJ0A 2XHNA 2XXZA 2WQZC 3EQEA 4GJZA 5JXIA 1UU4A 4LE4A 2KR2A 1ZZ8A 1CD3G 3H7JA 1RUD3 2D3RA 4ZU4A 1WMEA 3N7MA 5A80A 5HCAA 2VU9A 2WWSA 2EAAA 1SZBA 1ULDA 1HLCA 1FNZA 1U5ZA 1BK0A 3WF4A 4YZ5A 2DUQA 4E2GA 3O5SA 4E8CA 3BTAA 4KNCA 4TLFA 2J7MA 5JOYA 4I0WB 5BPXA 5CFDB 2RG4A 1K45A 4LULA 2X09A 1S55A 1RHI2 1QIQA 3FL7A 3NNFA 4E2SA 4KWJA 4YVWB 1AYM2 4X8NA 4P9WA 3T2TA 5EJ3A 4HVRA 3WNNA 1I1EA 3N9MA 1PVC1 3BB6A 5JMCA 1CAXB 1NOVA 5FLHA 2WNVB 2HWE1 5FZOA 1ENQA 5FYSA 2YPDA 3N9PA 2JDMA 2VOKA 2QNKA 5F32A 2PA7A 4J6GA 3ZFEA 5DAPA 4Q4V2 4CE8A 2F17A 2R1BA 1YXWA 2WFF3 2WS92 3IDEA 3EHKA 2X05A 4UBHA 1PGL2 4BQ1A 1UY3A 3MLJA 1E57A 1EV11 3L2HA 2YBKA 4RA0A 4DRRA 3QACA 1R64A 4EWEA 1ZZ7A 3FUQA 1B09A 3WNLA 3BTYA 4CA9A 2MHFA 3M8LA 2Q8EA 3VD4A 3H0OA 3C7OA 3I3DA 1ULCA 5FIXA 1GZWA 2I2SA 2W08A 5KHJA 4YLZA 1O7FA 2BNNA 1AX2A 4FOYA 4QGNA 4TXWA 1OQEA 2BGCA 4CP1A 2ZGUA 3OGJA 4HETA 4ES8A 3BU0A 4ZXKA 4TLGA 2VOXA 2AR6A 3VHNA 5FP3A 4E9KA 5ACA1 1WCDJ 2A3YA 5FXVA 2DYCA 1UIKA 5LY2A 4ZZ8A 5FZEA 3WY6A 1ZA7A 2FDFA 4AVBA 4QQ2A 2A3XA 3THDA 2LTNA 5JSRA 5K9YA 4OI0A 3THTA 3SEEA 2BFUL 4LITA 3KV6A 4N9HA 1XC6A 1BJQA 4CDQB 4KWUA 3KVBA 1YI9A 1K12A 1AL22 2RDQA 1MS3A 3LDKA 5FYIA 1JZ2A 1WW5A 2WL1A 5KWRA 2HWC3 1H4HA 5FXXA 2CDPA 4RR3C 1OT5A 5IWFA 1MS8A 1AR82 1W2AX 4G9SB 4ZU7A 1VMJA 2UYAA 3ZM8A 5FK7A 4LO6B 5C8CC 4N7UA 5FZKA 3PTRB 1Y7BA 1LENA 4IEZA 3B9IA 5F2WA 1GLHA 4XXPA 4ET7A 1J3PA 3VD9A 3MUY1 4XUPA 4W50A 2BUKA 5FY0A 2OPKA 1JI6A 4YVSA 5LBCA 5J1XA 4LO7A 1VJ2A 1Z7S3 2XLAA 4UF0B 1Z7S2 1UNBA 2ZBJA 5FZLA 2ZZQA 3VBFA 1W0OA 4H14A 4QDSA 4PHZA 1S0GA 4J25A 4KGGA 5AFBA 1NX9A 4W6XA 1GICA 3A0KA 4RQPA 1LNSA 4Q4V1 5A3PA 4NE9A 3MUZ1 4KG8A 1C8M3 2QQOA 2W92A 2Z42A 5A1AA 2OPWA 4NAMA 1XBFA 2PLV2 3SCHA 3HT2A 3J7MA 3VHOA 5JXHA 3JBG3 5FY9A 1FATA 3MICA 4FO9A 4MYEA 2EIBA 4LBQB 1UY2A 1WKYA 2DTYA 2W1WA 1JTZX 3Q8AA 4FPHA 2VY0A 2UYBA 1OPOA 1KQRA 2UWBA 1AR73 3KVAA 3VKOA 1POV0 1NY71 4MLOA 4OMDA 2Q4SA 3BOWA 3DL3A 2R043 1HRI3 3DCQA 4CCJA 1VBA2 3RRDA 5A3UA 1W0NA 4AVCA 5C4WC 2QBXA 1YFXA 1XE0A 4OI4A 3GHMA 4WVVA 3NAPC 5FYMA 1LOGA 3M2MA 3MYXA 2CSGA 4S2FA 5BNOA 3H7YA 1DQ6A 1GZ9A 1KD7A 3FHQA 3H50A 1N3OA 3KT1A 1VRH1 3T1LA 1BMV2 2ES3A 2R1DA 3MIGA 5F1RA 1F9KA 1GUIA 1OA4A 1UMHA 3VBOB 4A7ZA 4DUVA 4WVMB 1MQTC 2W1UA 3ZYRA 4IEWA 1RUF2 3CU7A 4Q2FA 4GAZA 2DCZA 2YMZA 2JD9A 3I7DA 4RGAA 3UETA 3KHCA 5GLVA 2AEYA 1EPZA 3RI8A 3RG0A 3E6BA 5BNOB 2JB8A 1PVXA 1QXJA 2YHJA 5T5OA 5C4WA 5JR7B 3S5QA 4B3NA 2Q8OA 2Z69A 1UX7A 1VMFA 5D8AB 4XETA 3H8XA 4EZ4A 3BOPA 4QPYA 3BTXA 1GP4A 3NNMA 3SEPA 3NRUA 2YU2A 1D7PM 3HNMA 2P2KA 5C33A 4NWVA 2YFUA 1VAVA 3Q9OA 3ZR5A 5IT6A 4FI9A 1YO8A 4QKNA 1KDMA 2BBAA 3FFQA 4XF4A 2ARXA 2ZGKA 2GC2A 3H8OA 2JICA 2OXBA 2W1QA 4OI2A 2VZOA 3ORJA 5C6CA 2Q0AA 4Z92B 2D93A 1WLTA 1C57A 5G04L 1RUC2 4PLMA 4E4ZA 2B9VA 2X5IC 4AFBA 4FSJA 4XILA 4NHLA 1VBA1 4H3WA 4HFSA 1DU3D 1OBNA 1R081 3OBRA 1MEC2 4FXKB 2WWUA 2JX9A 1PK6B 2HYKA 2Y6FA 4YVWA 3AP6A 2JE9A 5FP7A 5C4WB 2ZMKA 3N9OA 1MZ6A 2VXJA 2ET7A 3KV9A 1ZZCA 2EXIA 5AC92 1NXMA 1DYPA 1QH7A 4M4RA 4D8MA 1DBNA 4AEJA 2GC0A 1O3RA 2VZ1A 2PHLA 1H8VA 3UJQA 3O1MA 1ZRCA 4ZXEA 1MZ5A 4CU7A 1NLRA 4PT6A 1UYZA 2QE3A 5KXEA 1YRZA 1HRI2 3ZR6A 1GP6A 2LM3A 3ABZA 4K7JA 4S2HA 5FV3A 4B4PA 2K2SA 3MFAA 4FQ4A 1BZWA 2QQWA 3NSTA 4CEYB 4IV1B 5JZGC 1F5JA 2JKXA 3AZWA 4FPFA 1W05A 1WCQA 2ORXA 3P3NA 2D43A 1JHNA 3I2HA 2PAKA 1TMF2 4UFIA 2VOVA 4XYXA 1VBB2 2EIGA 2GC3A 3PIGA 1QJEA 4COYA 1OUSA 3FHAA 3EO6A 3WNXA 2FZ2A 2WSUA 3WDWA 1PK6A 1TME1 3NKGA 4K40A 2JB4A 3N9LA 4LQRA 1UF2C 3I54A 1UD1A 4MGKE 3E5QA 4XFIA 3CDZB 4K6BA 5CKMA 5FQ0B 1HB3A 4QU1A 5FXZA 4E27A 2AREA 3ZYFA 2JIJA 4CXYA 4BLJA 1GOGA 5IVVA 4XDQA 1OFSA 1U12A 5CG9A 2BRTA 5HPOA 2E53A 4LHNA 4OQ8A 3ELNA 2JDUA 3O7OA 4UW4A 5A6ZA 3AP4A 1NCQB 2VW1A 1X8MA 1AR81 2IUWA 3C8XA 4NMIA 2ZZJA 4CP9A 4CYDA 5HI0A 3KF3A 1VBE1 4L8QA 1O4TA 5GKAC 3POEA 2W47A 2X5IB 4OCTA 2GN7A 5CIRA 2RM22 5IVCA 1XE8A 4E4SA 1VAKA 2B9UA 1ULGA 1H4GA 2BW8A 2VZRA 4XQWA 2XWJB 3AMMA 3MW4A 1N3QA 1LHOA 2I07B 3CL1A 1SPPB 4HKOA 3DECA 4D6RA 5AC91 3AM2A 3BN6A 4IESA 2VCMA 3J7HA 1OXCA 2ZPXA 4JV4A 3I2GA 4XQ4A 3RGBA 3BIEA 4HANA 1N1TA 2RVAA 1XYOA 2DF7A 4K3UA 2ARAA 4AVTA 1IHMA 1DLLA 3PU3A 5L7OB 3O0XA 5A6XA 1SACA 2WLQA 2O8OA 4FXGB 2O1QA 1JYCA 2D6NA 4GB31 1OH4A 3FX3A 4B1MA 1PNFA 2VMIA 5J37A 4YGEA 4NO4A 5T55A 3ZIWA 5C5UA 4AGGA 3ECQA 3GF6A 5LK5A 5I0TA 4AVVA 4GMP3 1LESA 4EWDA 1V6IA 3MF9A 2GN3A 3HQRA 1UY1A 1HW5A 3M7AA 1TMF1 3AZZA 1AJOA 3PMEA 1V6NA 3PDQA 1WWYA 3WQ0A 2YC0A 3K46A 3V0BA 1ZRDA 3R4UA 1KITA 4D94A 4NHMA 5IAXA 4WM7A 4XBNA 1Q8PA 2QCSB 3CIHA 2GNBA 3POYA 3NJYA 2AENA 1ZBA2 5F5QA 4TTGA 3HEIA 4L97A 3NQHA 2VM9A 1PX4A 4MOAA 4QPIB 2J1TA 3WF3A 1CWPA 2ZGPA 1OA3A 3D5OA 2FHRA 1N47A 4JAAA 2XKOA 3CJIC 5LK7B 3UGGA 4COWA 2Q1ZB 3FMGA 4JKKA 5GALA 4AEKA 3Q8FA 4IGOA 3ZYIB 4PDWB 1HX6A 1Q8OA 5KHHA 1RL3A 1UKGA 2WABA 1SHWB 3AJYA 3LPFA 2GSYA 4JGYB 4C8DA 3C3VA 3MIBA 2B7YA 3LAGA 5CYYA 1H30A 3T2OA 5T3NA 1QOTA 2YY1A 2Y0IA 5D8AA 1G9BA 2WT2A 3WLUA 4L11A 3RZJA 1RMU1 2IFRA 5ANNA 5FY7A 1IQAA 4Z2WA 2W91A 1UXXX 4BQYA 5E89A 3IMMA 4EV0A 3AXDA 5LA9A 2YUEA 5FWJA 5FLIA 5K4LA 1VALA 1ZRFA 1VBB1 5C5TA 4XF3A 1AR62 4PDWC 3VBUA 5A3TA 1PZ7A 2R072 3ZFFB 4B7EA 1AR93 2GZWA 1M06G 1C8M2 1MZFA 5BNPB 3U78A 1XYNA 3DPRB 4XDOA 1S4CA 1ODMA 5FDBA 5K8SA 4D0QA 3JD71 1RUC1 2P3YA 2QQKA 1RUI1 2WYFA 2XLFA 3FBMA 3POBA 4IE7A 4CTEA 2Y8KA 2ZKNA 3BI3A 4A2UA 5KHGA 1RUH2 2XB6C 4HKLA 3WDYA 3AKTA 1UX6A 2D3SA 1R091 1D4M2 2GALA 1WW7A 5LB6A 3WNOA 4K1YA 2AC1A 2A7AA 4META 1NT0A 2FQPA 5IVBA 1YFWA 1QJY1 3AX4A 3RYPA 4BOWA 3PVEA 1I9RA 1C3HA 3AVRA 5HXVA 5BNOC 2B8MA 3MLKA 4QQPA 5LBBA 3KLSA 1CAVA 1POV1 1VBD1 2ZHKA 3E5UA 4NIGA 4HBNA 1HB1A 1W8UA 3E6CC 1QXPA 2VW2A 3DF0A 4IEQA 1FOD2 2VMCA 3TEYA 3ZPYA 4R8HA 1VRH3 3GGLA 4XEZA 2MEV3 1AR72 2BP6A 2WZR2 4NAOA 3AMPA 3FN9A 3KT7A 3GJBA 2FDKA 3VKLA 1NAEA 3GBWA 3C7GA 5DZEA 3V65A 1YQCA 4R9AA 1YYNA 1JUHA 1W9WA 3H3LA 4AHYA 1OD5A 1RHI3 4ATEA 2W1SA 4M3CA 3TWIA 4KMQA 1OOPA 4OUMA 1KDKA 3IIIA 3WG1A 2ZTNA 1RUG2 2WA4A 2H0BA 3DXUA 4MHRA 3ZSEA 5BNQA 5FUIA 3W20A 4I02A 3KHBA 4IDZA 2WC2A 5J09A 2VCAA 3J7LA 3WW1A 4MGSA 5FMDA 2KXLA 3CHXA 3AYCA 3AXEA 2EIEA 1NXD1 2PTMA 3VB9A 3AZYA 3ZFEC 3UKNA 4P08A 3WNKA 1KGYA 4B7KA 4ASLA 2C9AA 5J7MA 4D6QA 5J3UA 5B4NA 5DG1A 4WZCA 5BNNA 2FDIA 1JOBA 3U07A 1RUI2 2IXKA 3RFRA 5CFDC 3WF2A 2AZ5A 2O0OA 5KC5A 2FDJA 4LA3A 1RUE2 2XWBB 1MR5A 3ZXKA 4F3JA 1WBFA 2Y64A 2WDBA 3FJSA 3KQ4B 1UQXA 3VDCA 2JWPA 1PO12 2VUJA 2GC1A 2Z4FA 3HMYA 4ORFA 5JUVA 2PN5A 4TWTA 1OLQA 5DAWA 3ST7A 4D69A 2XL9A 1DGLA 3VZJA 4JDNA 3NV4A 4AFAA 1CR7A 4YNIA 2JDHA 2OQ7A 4AEDA 4CU9A 2WNEA 1A78A 5L9RA 2G4IA 2Y60A 4PIYA 4QB1A 5I0SA 3HIFA 2VZSA 1PGW1 2RJ2A 3ZLIA 2G9ZA 4AI3A 2BGOA 1G9AA 3QOPA 2Y6JA 1NCQC 1WCSA 2D44A 1EY2A 2XJVA 3NVCA 3PVBB 5CVRA 1W9TA 4OHVA 1ASJ3 1US3A 1YI7A 2UY9A 1UU5A 2WBKA 3GJAA 3VBUB 2Y26A 3DV8A 2VMGA 3GCWA 2OT7A 4RYDA 4DS0A 2VGDA 1EYBA 3T3YA 5JCTA 4B1LA 1CAXA 4U36A 3ILNA 2Q8DA 2ZGTA 3RMXA 1Q43A 1SLCA 4AHXA 2NMOA 2ZGSA 4I09A 4MGIE 5LA0A 3LOIA 3NL1A 5CZKA 1HV1A 1W28A 5EWSA 3AFKA 3ASIA 5DXDA 2VZPA 2YGLA 5B4XA 1JZ7A 1UZZA 2XOMA 2XBO2 4CU8A 1VRH2 4TYSA 3I2JA 2VZ3A 5C8WA 1LTEA 1DG6A 3EB7A 3OBTA 5FZAA 2WS93 4FBFA 2FZ1A 5JDBA 3E6DA 1GQGA 1LHVA 1H1AA 2CTVA 4XABA 5FMCA 2W39A 2Z79A 3CF6E 4XFBA 5A7OA 2F4PA 3VHRA 3ETQA 3I3MA 4XAEA 4QDQA 2DUPA 1OURA 2W95A 4D7YA 1LOCA 4I0AA 3ZXFA 1ZVFA 2Y34A 2ZACA 1O8PA 1W6PB 4DRVA 5A6YA 2X29A 1RUE1 3TRSB 4Q26A 2K9ZA 2VZUA 4K20A 4XFHA 4R9DA 2YB7A 3BIWE 1DQ0A 1HXS3 4LBOA 1W9FA 1JYIA 3WHUA 2GNMA 2DBNA 1G7YA 3MLLA 3EJKA 4IV1C 5CA6A 3EMRA 3V0AA 1NLQA 4XIOA 2J1EA 5E88A 1GWKA 5FZ0A 5GZEA 1ZNPA 5B2GB 3NV1A 1JYTA 4FP2A 1DIWA 2BWCA 4ASMB 5BV6A 2MEV1 3BPZA 4QU2A 3VBHC 2JD4A 4XJZA 4NRMA 1EAH2 3N7JA 2YZ4A 3GZEA 1W6PA 2VCBA 2JG9C 2V09A 3T09A 2BJSA 1YLLA 4MZUA 1QF3A 4CP2A 4MHUA 1LR5A 2UWAA 1MS1A 2ENRA 2C24A 4N43B 4XW3A 2WN2A 5C9AC 1ONAA 4QQHA 5IATA 1MS0A 3GBFA 4FPLA 2WNUB 3TNQA 2RS53 1FV2A 3JBG2 1EV12 5T5JA 1KS4A 4HZFA 1XNCA 1JZ8A 2WRAA 2R0HA 2VE1A 4PBPA 4OHXA 2ZABA 1QJFA 3ME2A 4Q0QA 4PQ9A 2CL2A 1H2KA 1HXS1 2ZGRA 2PAEA 3DN7A 2I74A 3IB3A 3LA3A 4UYBA 2LUWA 4RR3A 4W4ZA 3H42B 4N90A 3ZMOA 3NAPA 4LR4A 4UW6A 3ZPOA 2VQUA 5IVEA 3GZTB 1QQP1 1OLMA 1KXGA 2RS11 2ZHMA 4IL7A 4JRAA 2TNFA 4N43C 3SH4A 4Q8LA 2WT0A 3OY8A 2VVEA 3NW4A 4AQSA 1LEDA 1W6QA 3AP5A 3DPRC 1AXZA 3ZMNA 2P5BA 1U5YA 1LEMA 4IE6A 3DKWA 4CUAA 5T52A 1GR3A 3SH3A 1YJLA 2CGOA 2JG8C 5I0DA 3TN93 4HVQA 3HN3A 4NHKA 3HNBM 1V9U2 1VIWB 1JZ3A 1HRV3 2HH9A 3T30A 1J59A 2VTXA 4COZA 2WIIB 3OPZA 5FO8B 1ACCA 2GU9A 1UOGA 4XC9A 5T50A 3V56A 2BWAA 3IAPA 5FPAA 2W94A 4RFRB 4QKFA 1SFNA 2D6PA 2BYVE 2UU8A 1AX0A 4A7YA 4FOVA 1W6NA 2YG0A 1WLCA 3AP9A 2HWF3 1K5MA 5BXXA 3AMQA 3PTYA 2HWF1 1A8DA 2FBEA 3Q8BA 3HQXA 3VBOC 1AXKA 3OYWA 5CFCA 1D0HA 4ONUA 3N9QA 4R4XA 3HBZA 1TEIA 1YJKA 3GBGA 2VMHA 3IMNA 4IE0A 4HOOA 5DQ0A 5BNPA 1HQWA 3RZMA 5JXGA 1Y9MA 4M00A 5T5PA 1QJU2 3TNPB 4CRQA 1O5LA 2WJSA 1L7RA 3PVNA 1HB4A 2VTXJ 5LBFA 2GP3A 3W9AA 1F4HA 1FPN2 5CKNA 4CUGA 4SLIA 1L7LA 1O6UA 1SFPA 2JDNA 5K0UC 1TG7A 4FFFA 4A42A 1WUVA 1DLCA 4YG6A 1G9CA 2CYFA 3VN4A 3T0AA 5AVAA 4ASKA 3H3UA 4AE2A 1UOFA 2PHXA 1ULFA 4D7SA 4JQRA 4QHZA 3BYWA 2VMEA 4XHBA 2VUDA 4RGGA 4GB32 5A3WA 3O1VA 2W5FA 2P1BA 2WZ8A 4KBBA 1POV3 4Q4W1 4GB33 1EV13 4LHLA 4BDVB 5LASA 1QGLA 4CCCA 4DXZA 4JTNA 2NN8A 2JE8A 3LDBA 2VMFA 1H6YA 2ZX4A 1RYYA 3P5BA 5FPUA 2WSVA 3DKQA 3PURA 4LK7A 5DUVA 4RHV1 5SV5A 1XB9A 1Q8QA 1T6GC 2ZMLA 3S57A 1IS5A 2FMYA 2HWD3 1A3KA 1KEXA 1RIRA 2DCTA 2BU9A 2XKPA 5BNPC 3HR9A 3BPSA 3AJZA 1XE7A 3A0NA 3VZKA 5JPMB 2IXHA 3J9SA 5KXDA 1BBT2 4YVWC 4Z2AA 5FBJA 1PHMA 3MIHA 4LA2A 3BTZA 2BZDA 2BV4A 3JB4C 4GA9A 1GOFA 2VZQA 4WZFA 5FYVA 3RYRA 2IXLA 2E7AA 1VBB3 2WO3A 2VVDA 3AMHA 4IEUA 1CZSA 1XNBA 3U4SA 3VBRC 1DYOA 5F7UA 1W99A 3I2KA 4LEJA 1PM4A 4O7XA 5GZFA 4A45A 1AZDA 5FZ8A 3J8F2 4CCEA 1PGSA 3MGUA 2ARBA 3WNPA 3WXPA 1UCXA 3RZKA 3B7MA 1APNA 5FBZA 4AEMA 3HWJA 3LSDA 4O65A 3LEMA 3UNPA 3JQWA 3CZJA 3WT3A 4OQ9A 1O59A 2D6OX 4XUQA 3WCRA 1E5SA 2WWJA 4QPGA 4AI8A 2ADDA 4XHXA 1HV0A 2VUAA 5EJZB 3MW3A 3VKMA 4F83A 1A34A 3TOJA 4LO5B 4H2AA 3URFA 3WG2A 1DGRN 4A41A 4QHBA 2VQ0A 4XMAA 5F3IA 3AK0A 1W9YA 4BHPA 3MEPA 1SDWA 5A3NA 1GFF2 1B35C 3ENRA 5A7NA 3H9AA 2JDPA 1ZBE3 2HBTA 2LROA 4IW3A 3ZFGA 1LGBA 1VE0A 4UWDA 4CP9B 2Y6KA 2WKKA 2OX0A 5IVYA 3ILRA 1RUJ2 1GWLA 4ZPIA 3PUIA 2G19A 3VDDC 5LEJA 2Z5WA 4RHV2 2YV8A 1VBE2 4LOTA 3AC0A 4RHV3 1PO13 1SLTA 2XJPA 4QX7A 4YPJA 1PZ9A 5ANQA 4CEWB 5FMOL 3MW2A 3ON7A 4XTMA 3D0SA 1SQ4A 4CCOA 3FHIB 1OOPB 1OVPA 3CQOA 2VBPA 3LIGA 3M3CA 2XPJA 3WNMA 2DCJA 2QZ3A 2ZA9A 3O12A 4G4FA 3CJXA 3K3NA 3T4HB 1WA4A 1RUD2 5APAA 1SCSA 2Q1FA 1S0DA 2ZX3A 1F35A 4L0PA 5E1RA 1D4VB 3OPTA 4A3XA 3NNGA 4FTBA 3HOBA 4F8AA 2R49A 1VMHA 4QWNA 5A32B 2DCYA 2VUCA 4BU2A 2YGMA 3KM5A 2A5ZA 3JXSA 3ZXLA 3DPRA 5FZ6A 4MXVA 1IS4A 5FPVA 4H7LA 1QWRA 4COVA 1B35B 2D5HA 2FMDA 3ZN4A 4ARXA 1V70A 5LWBA 5EXOA 5L7OA 5FPZA 2F4LA 1RHI1 2ZGQA 3LEIA 2VBDA 4UW5A 1O5UA 5F3CA 2ZGOA 4BPZA 1QNYA 4KU7A 1V9U1 2XVLA 1JXNA 3VLBB 2QQLA 3ACIA 2ZOEB 3RS6A 1PVC2 1BHGA 2JJ6A 4XCAA 1JN2P 3ALQA 1XNKA 3H1YA 3B9CA 3VV1A 1UYXA 2H0VA 5F6LB 4LT5A 4CUCA 3KF5A 1XSRA 4MSVA 1MPXA 1QKQA 4LPLA 5JVVA 4ZZ5A 1J58A 3IPVA 3K4DA 4LORA 2E63A 1WGPA 4CEWA 4Q4W3 5C3SA 1ALYA 1RUJ1 5EFUA 4QGMA 2C4XA 5F8PA 3DYPA 2EICA 4FOQA 4DMIA 1RVF3 2OKXA 1DZQA 1LU2A 4XUTA 2VQAA 4N9IA 1W8OA 2DVBA 3D6EA 1OF3A 4FFIA 4DNYA 3R0RA 3TEWA 4LNVA 1AUYA 1JYWA 1D4M3 2XJRA 4QPIA 2PELA 3VKNA 4LBJA 4GH4A 2R042 4BQ2A 3RVHA 5FREA 4PI2A 4DXTA 3AKQA 2W3JA 1F15A 2EXKA 3NAPB 4HMZA 4OYUA 3ZVXA 5IHRA 4Q4W2 2ZAHA 4MGTA 1EP0A 4DOUA 1RXFA 2YDEA 3NKTA 3CLPA 3HJRA 4LTAA 4Y5Z0 3R6SA 5GLWA 1GOHA 3WP5A 4BA6A 2CV6A 3J26N 1ZREA 2BVVA 1Q8VA 1SCRA 3J7NA 4ES9A 3NO8A 3U14A 4GD4A 4JZRA 2AH2A 4ZS2A 3KD4A 1LOEA 1OQ1A 2D40A 4Q4Y2 5JMOA 1AYN3 4WV8A 1H8TC 4XDPA 1CONA 2W87A 5JOWA 4QX2A 1C8NA 2QDRA 1N1SA 2CDOA 1BBT1 3LEGA 3L9JT 3OB8A 4H7MA 3S7EA 4CUBA 1GNZA 4ITCA 5F5IA 2WUHA 4P5HA 3T4VA 5FYCA 2RE9A 1RUE3 2I45A 4QQOA 3N7LA 5IJRA 2Q8CA 1CZTA 2HWC2 4CEWC 1HRV1 3INAA 4I3PA 1AYN2 1KRIA 3WR0A 2W68A 5D1IA 3ZSKA 3Q8EA 4R9CA 3FUOA 1NLSA 4QM9A 4M3CF 1LGNA 3ZFGC 5I8YA 1RUF3 4L92A 3OGSA 5GLUA 1RUF1 4P9JA 4X8PA 5FZHA 3J4UH 1AJKA 1LOAA 4FPJA 3VD7A 4IV3C 1HB2A 3JUUA 1X36A 4XMIA 4E8DA 1TQ5A 5DMYA 3LDRA 5FOBB 4GWNA 1ZZ9A 2QKDA 3OGVA 2WNUC 4PIXA 4Z07A 4CVUA 1A6CA 1KS5A 4Y4RA 1RUD1 3F2ZA 5AVPA 3PNAA 2XMLA 1UMIA 5EHDA 5L7OC 3IBMA 4XF9A 2XONA 4CDUB 2XGXA 5FZGA 1W8HA 1CJPA 1UU6A 3ZN6A 1XRUA 2JG8A 1CAUB 1ULOA 2XJTA 3ACLA 4FP3A 3O1SA 2IVIB 1REFA 4FVVA 4OI1A 3ZFGB 4LBQD 3QLQA 5HV0A 2AGSA 5I0RA 1QJX3 2V4VA 1VLNA 2PHUA 5DAXA 3UKTA 2WNVA 3WP4A 5ACA3 2CGPA 1XOYA 1AL21 1E5HA 2TBVA 4IQPA 3AKPA 3FC0A 4QPGB 3O0VA 2GDFA 4XACA 1WD3A 3WW3A 2DBIA 3ACFA 4NIAA 3MO4A 4GKYA 1JUIA 4J1WA 5FCCA 5EJ1B 1XJAA 1XXNA 5IK4A 2XJSA 4A7KA 2D6MA 1BMV1 2JG8B 2W52A 4OUSA 5BYNA 1O4YA 3VZOA 1F2NA 5IVFA 2OW4A 2YBSA 1AR91 3GHNA 5CFCC 5JI7A 1ENSA 2QZ2A 2DTWA 3L2YA 3UK9A 1JZ6A 1AF9A 5F5CA 5FPXA 3A4UA 4C91A 4XZUG 1VB2A 4BWOA 1IG3A 2TEPA 5IUQA 1QJX1 4PBOA 4V1PA 5HV4A 4MO3M 2VPVA 1QDOA 4NRPA 5DDJ2 5DUXA 3WQ7A 1NQDA 1Y4WA 4MVTA 2E6VA 4NHXA 2EF6A 4QX8A 5D21A 1AR71 2VECA 2B45X 1KFUL 3C7FA 1J1LA 1PMIA 1COV2 1FMD3 3B5LB 2FDGA 2W9XA 1DHKB 2OVUA 2DWRA 5LY1A 4PLOA 1XNAA 2ZEWA 3KCCA 5IYYA 1OLME 1XNDA 5H9PA 4YM2A 1LOBA 1D2QA 1RUNA 1Y43B 2E51A 4IV1A 2BFUS 4DIQA 3JQXA 1DYKA 4JTOA 3M70A 4QGLA 5CNAA 5DZGA 4YRDA 4YW7A 2R062 4CDQC 3BALA 1PGW2 3R05A 1RUG1 3KMHA 1JOPA 1G9DA 4DPNA 5CFCB 3FLTA 1W6MB 4JGZC 1QMJA 4MXWA 1COV3 1FMD2 3KQRA 1CVNA 3POGA 2D6LX 2E9QA 4EZHA 3LPGA 4FTEA 2HWD1 3I4IA 2WA3A 1W2OA 3KS7A 3VBSC 3NWKA 3MPBA 5IK8A 3RQ0A 4IEXA 1CPMA 3KV5A 3MDPA 4NPMA 1F8VA 2DVGA 1Y9QA 1UYPA 4IXLA 4XBQA 1F4AA 1V6OA 4M3CB 2XBO3 4N53A 4Q4X3 1W8NA 2FCTA 2YYOA 2WZEA 1QQP3 5L19A 4Y1VA 1Q56A 1VBD3 1O3QA 5C3QA 2NP0A 1POQA 2P34A 4WM7C 3RSJA 1VBD2 2XL7A 2GNDA 3JBG1 1WCKA 5DN2A 5KBFA 1BEV2 4QXCA 3NJVA 1QJX2 4WVMA 3R4DB 3RMYA 3ZDVA 4CDUA 2JDYA 3WUDA 1CIYA 3EBRA 3OY8B 4E4DX 4Z1VA 5JZGB 5EYXA 2H6CA 2HEYF 2ZGMA 2AACA 1H9WA 1Q8SA 1U5XA 5F37A 1NUKA 2E26A 3HPNA 4LBMA 4CDQA 1PMJX 3B69A 5H9RA 4HKWA 4BMEA 1K5MB 1R083 1C1LA 3B00A 1HN1A 3WW4A 2ZGNA 4QX1A 3T0BA 1NA1A 1NY72 3WDUA 4KGQA 3SKVA 1IKQA 3MIDA 1Y9GA 1KJLA 4RGKA 2WAOA 5J96B 2VJXA 3DGTA 3DYMA 3WQBA 1JZ5A 1CGPA 2EA7A 2XQXA 1VRBA 2WNUA 1IKPA 1CAWA 2HKXA 3W59A 2K46A 2AEZA 3OG2A 3RWKX 3OJBA 4N43A 3THCA 3N36A 2C0ZA 4YYOA 4C1XA 4CDUC 1WCUA 3ZXGA 5BUVA 2XVKA 5H9SA 1X33A 1QXRA 1SDDB 3W21A 1MQTA 1AX1A 1TME2 3I59A 4PF1A 3SMHA 3U75A 2P37A 1RJ8A 4L9BA 4BM8A 4NN0A 5KHKA 1CQ9A 3I2IA 2UY8A 1C5IA 3AL5A 3RZZA 1UZYA 1V6LA 2QVSB 2XG3A 3D8CA 4YW6A 3WDTA 1C5HA 3MHZA 3WZ1A 2B42B 3ZFEB 1UZWA 2A6WA 1RTVA 1TVGA 2CHHA 2J1UA 5FZ7A 5ISLA 1UO9A 1YIPA 2VQTA 1PO21 1PIV2 5FYHA 4AG4A 1QHDA 3T2QA 3USUB 1P8JA 2VMDA 2X10A 5A1LA 2XH6A 2IWGB 1CX1A 2E32A 2JENA 1YC61 1I3HA 4QXHA 3TEXA 2WQ8A 4EE2A 1TE1B 4WM8C 2R32A 5JI9A 4V2VA 1NG0A 4FQZA 1MS9A 5J98B 1XNTA 1DZTA 4KU8A 5A7WA 4YFWA 1WZXA 3T2PA 3K3OA 2GMPA 4BCUA 3JZVA 4Z82A 4FCAA 5G05L 3MPPG 3VDDB 1JZ4A 1S2BA 1TMF3 5FOJB 2CWSA 2IXJA 4ISQA 1UPIA 2JDKA 2ATFA 1S0IA 4NHYA 4QAWA 3D82A 2C26A 4K1ZA 2OIIA 4G3YC 4P9YA 3USUA 5A3LA 3LA7A 4ZKTB 3M3EA 5HBAA 3OUJA 1WMFA 2DFBA 2HBUA 1SLLA 4N8MA 2EXHA 4CDXA 1E5RA 3S7IA 5KC6A 4CXXA 4HT1T 2GNTA 4QKBA 1FXZA 2ID4A 2HWF2 2ZKLA 2FDHA 4HONA 1ND3B 4ZONA 4IEOA 4M01A 4CZSA 4O9GA 3AKRA 5JOXA 4JCKA 3SH5A 5DPNA 1H1MA 1NQJA 5F2SA 3M3OA 4EWAA 1FV3A 4MGQA 1UY0A 1DQ4A 2IC1A 3OD4A 5FZFA 4Q8KA 4XFAA 4CP0A 1ZBA1 4OUEA 1UWWA 3OGRA 4AWDA 1HRI1 2AYHA 4DUXA 1ZRRA 5LRRA 3CEWA 4KWLA 1CAWB 1W8ZA 2ZAAA 4CCNA 1Z7S1 4S2DA 5FXWA 1V6JA 1OFNA 1ZZ6A 2VNOA
chains in the Genus database with same CATH topology
5FZDA 4CUGA 2Q8EA 4Y4RA 5FZCA 3OPTA 5F37A 2XMLA 5A7PA 3KV4A 4CCLA 4EZ4A 5F5AA 5E6HA 4QWNA 4CCKA 3PU3A 5FZGA 3N9NA 4BU2A 2YU2A 4ASKA 5FZ1A 5FP3A 4BXFA 3PUQA 4LXLA 5FZ6A 5FY4A 2YBPA 5FXVA 2GP5A 5LY2A 5FPVA 5FZEA 5A3WA 5FY8A 4E4HA 5LWBA 1VRBA 2PXJA 5FPLA 5FZ0A 5A7WB 4LITA 3KV6A 5FJHA 4V2WA 5FWEA 5F3CA 3LDBA 2W2IA 4IGPA 3KVBA 5FP8A 2XDVA 3PDQA 5FYIA 4QXBA 5FJKA 5A7SA 5FPUA 5IVJA 3DXUA 3PURA 5FXXA 5FYYA 5KR7A 5IWFA 5FZIA 4AI9A 5FZ4A 5FP4A 4GJYA 5FZKA 5IVFA 2YBSA 3PTRB 3AL5A 5F2WA 2WWUA 3NJYA 5FZMA 3K2OA 4TN7A 4LIVA 5F5CA 5FP7A 4D6QA 5FY0A 4AAPA 4Y33A 5F39A 3N9OA 5FZ7A 4CCMA 5ISLA 4UF0B 5FBJA 5FUPA 4EYUA 3KV9A 5FZLA 5FZBA 3PUSA 5FY5A 5FYVA 5FUNA 5FYHA 3PUAA 5A1LA 4QX8A 3AL6A 4QXHA 4UF0A 3ZPOA 5A3PA 4IGOA 5IVEA 3U4SA 5FZ9A 5A1FA 4V2VA 3RVHA 5LY1A 5FV3A 4C8DA 2XXZA 2OQ7A 4IGQA 2P5BA 5FZ8A 4GJZA 5A7QA 5A7WA 5FY9A 4DIQA 3K3OA 4DO0A 5FPBA 4CSWA 5FY7A 5A80A 3ZLIA 3KVAA 4GD4A 2WWJA 4Y3OA 5FWJA 5K4LA 2XUEA 5A3TA 5IW0A 4NUBA 4CCJA 3N9LA 3AVSA 5F3IA 4EZHA 4LIUA 2OT7A 4BISA 5FY1A 5FXZA 5FPAA 5A3NA 4QU1A 5A7NA 4XDPA 5FYUA 3U78A 5CEHA 4XDOA 5FYMA 5IVVA 5FZOB 5IVYA 2OX0A 3KV5A 2Q8DA 4HONA 5FYTA 5F3GA 3UYJA 5F5IA 3PU8A 5FZ3A 5FYCA 4URAA 3N9MA 2Q8CA 2OS2A 3N9QA 5FYSA 5FZOA 5FP9A 2YPDA 3N9PA 4QX7A 2VD7A 2YU1A 5ANQA 5F2SA 5F32A 5FZAA 4HOOA 3OPWA 5IVCA 5FZFA 3DXTA 5IVBA 5A7OA 4GAZA 4CCOA 3LD8A 2OQ6A 3AVRA 4D6SA 5LW9A 5FZHA 5FYBA 2YBKA 4QXCA 3K3NA 5F3EA 5FYZA 4CCNA 2GP3A 4D6RA 5FXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZD A;  4CUG A;  2Q8E A;  4Y4R A;  5FZC A;  3OPT A;  5F37 A;  2XML A;  5A7P A;  3KV4 A;  4CCL A;  4EZ4 A;  5F5A A;  5E6H A;  4QWN A;  4CCK A;  3PU3 A;  5FZG A;  3N9N A;  4BU2 A;  2YU2 A;  4ASK A;  5FZ1 A;  5FP3 A;  4BXF A;  3PUQ A;  4LXL A;  5FZ6 A;  5FY4 A;  2YBP A;  5FXV A;  2GP5 A;  5LY2 A;  5FPV A;  5FZE A;  5A3W A;  5FY8 A;  4E4H A;  5LWB A;  1VRB A;  2PXJ A;  5FPL A;  5FZ0 A;  5A7W B;  4LIT A;  3KV6 A;  5FJH A;  4V2W A;  5FWE A;  5F3C A;  3LDB A;  2W2I A;  4IGP A;  3KVB A;  5FP8 A;  2XDV A;  3PDQ A;  5FYI A;  4QXB A;  5FJK A;  5A7S A;  5FPU A;  5IVJ A;  3DXU A;  3PUR A;  5FXX A;  5FYY A;  5KR7 A;  5IWF A;  5FZI A;  4AI9 A;  5FZ4 A;  5FP4 A;  4GJY A;  5FZK A;  5IVF A;  2YBS A;  3PTR B;  3AL5 A;  5F2W A;  2WWU A;  3NJY A;  5FZM A;  3K2O A;  4TN7 A;  4LIV A;  5F5C A;  5FP7 A;  4D6Q A;  5FY0 A;  4AAP A;  4Y33 A;  5F39 A;  3N9O A;  5FZ7 A;  4CCM A;  5ISL A;  4UF0 B;  5FBJ A;  5FUP A;  4EYU A;  3KV9 A;  5FZL A;  5FZB A;  3PUS A;  5FY5 A;  5FYV A;  5FUN A;  5FYH A;  3PUA A;  5A1L A;  4QX8 A;  3AL6 A;  4QXH A;  4UF0 A;  3ZPO A;  5A3P A;  4IGO A;  5IVE A;  3U4S A;  5FZ9 A;  5A1F A;  4V2V A;  3RVH A;  5LY1 A;  5FV3 A;  4C8D A;  2XXZ A;  2OQ7 A;  4IGQ A;  2P5B A;  5FZ8 A;  4GJZ A;  5A7Q A;  5A7W A;  5FY9 A;  4DIQ A;  3K3O A;  4DO0 A;  5FPB A;  4CSW A;  5FY7 A;  5A80 A;  3ZLI A;  3KVA A;  4GD4 A;  2WWJ A;  4Y3O A;  5FWJ A;  5K4L A;  2XUE A;  5A3T A;  5IW0 A;  4NUB A;  4CCJ A;  3N9L A;  3AVS A;  5F3I A;  4EZH A;  4LIU A;  2OT7 A;  4BIS A;  5FY1 A;  5FXZ A;  5FPA A;  5A3N A;  4QU1 A;  5A7N A;  4XDP A;  5FYU A;  3U78 A;  5CEH A;  4XDO A;  5FYM A;  5IVV A;  5FZO B;  5IVY A;  2OX0 A;  3KV5 A;  2Q8D A;  4HON A;  5FYT A;  5F3G A;  3UYJ A;  5F5I A;  3PU8 A;  5FZ3 A;  5FYC A;  4URA A;  3N9M A;  2Q8C A;  2OS2 A;  3N9Q A;  5FYS A;  5FZO A;  5FP9 A;  2YPD A;  3N9P A;  4QX7 A;  2VD7 A;  2YU1 A;  5ANQ A;  5F2S A;  5F32 A;  5FZA A;  4HOO A;  3OPW A;  5IVC A;  5FZF A;  3DXT A;  5IVB A;  5A7O A;  4GAZ A;  4CCO A;  3LD8 A;  2OQ6 A;  3AVR A;  4D6S A;  5LW9 A;  5FZH A;  5FYB A;  2YBK A;  4QXC A;  3K3N A;  5F3E A;  5FYZ A;  4CCN A;  2GP3 A;  4D6R A;  5FXW A; 
#chains in the Genus database with same CATH topology
 3SIT A;  4LO8 A;  2E31 A;  4MAD A;  5A7P A;  5LA1 A;  3I3E A;  1SPP A;  3UES A;  5F5A A;  1H6X A;  3QCW A;  4CCK A;  1LB2 A;  3AB0 A;  1RC6 A;  5L9V A;  3GZU C;  1NA1 C;  4FPG A;  4LJH A;  1H8T B;  1WMD A;  4Y4Y A;  5J36 A;  3LFM A;  2YBP A;  1YCI A;  2VAU A;  1PZ8 A;  2Y6G A;  2ZXQ A;  3B94 A;  1ZBE 2;  2DVA A;  3ZN6 B;  1OMI A;  1JU4 A;  3K51 A;  2GH2 A;  2DCK A;  3OCP A;  1JYV A;  4UT5 A;  4K8F A;  1W6Q B;  4UW3 A;  3PIJ A;  2W2I A;  1RUG 3;  2ADE A;  1G6N A;  1I5P A;  3BCW A;  5IVJ A;  1O8S A;  2EAK A;  2CNA A;  3KCX A;  5KR7 A;  1AR8 3;  1AR6 1;  1H2M A;  1H2L A;  1V6M A;  2H6B A;  2YXS A;  4KG0 A;  3MBW A;  4NPR A;  2P3K A;  4XUR A;  4RQP B;  5FZI A;  1R09 2;  2Q5T A;  1D4M 1;  4QMA A;  4RR3 B;  3RJR A;  4GJY A;  3I2D A;  4JDM A;  4GAL A;  2BOI A;  2G1M A;  3OF1 A;  4IV3 B;  1YQ6 A;  4XXA A;  5JSP A;  1SLI A;  4RS5 A;  3K2O A;  5FZM A;  3VBF B;  1URX A;  5C9A A;  3AZX A;  5LBE A;  3JD7 2;  3WQ1 A;  3VD3 A;  5CBL A;  2LW8 A;  1RUJ 3;  4Y1U A;  2V4A A;  3AFG A;  4DXS A;  3TEZ A;  1RVF 2;  3MV0 1;  3VBH A;  1XSQ A;  2P4E A;  1JYX A;  3POW A;  3B02 A;  3U1X A;  3VL8 A;  4QPW A;  1FT9 A;  1YUD A;  1F5F A;  1X7N A;  3WP3 A;  5EZW A;  2QQU A;  1GWM A;  2VBB A;  2DUR A;  2ZEX A;  1S1A A;  4AI1 A;  1W8W A;  1C4R A;  2OA2 A;  1X8E A;  2NZ9 A;  1KFX L;  3D4K A;  2ZHL A;  2V5Y A;  3GZA A;  4AFC A;  4H55 A;  4ZY9 A;  1GNH A;  1S0F A;  4I01 A;  4AED B;  3OEB A;  3JD7 3;  1GSL A;  4CEY C;  2R06 1;  2ARC A;  3BKZ A;  2NPI A;  5D2A A;  3N4M A;  1LHW A;  2PHD A;  2NLR A;  5FAX A;  5AFE A;  4XJW A;  4UOJ A;  1UMZ A;  2IVJ A;  1LRH A;  2NQY A;  3WG4 A;  1O3S A;  2K0G A;  4JKL A;  4AR2 A;  1OPM A;  1R1Z A;  3I2F A;  3WX5 A;  2QFE A;  3CO2 A;  4A44 A;  1T6B X;  5LAT A;  2A1X A;  1CZV A;  1W3X A;  5EV7 A;  4U2A A;  4LO4 B;  4BQX A;  2LAL A;  2RJL A;  1OKQ A;  3NV2 A;  2GAU A;  4CXW A;  5DZF A;  3MIF A;  1RUH 1;  3I97 A;  4J1X A;  5FYT A;  1IS6 A;  1RUH 3;  3PU8 A;  1UAI A;  2BVB A;  2RDS A;  5FMB A;  3TB0 A;  1YNA A;  5BNN C;  1FYU A;  4LHK A;  5LEK A;  3H1W A;  4B8E A;  2VZV A;  1U5I A;  5FMO S;  2ZEZ A;  2VD7 A;  3TN9 1;  1PGL 1;  1HN0 A;  1SBF A;  3KWV A;  3LSE A;  1TZO A;  1RXG A;  2DU1 A;  5C8C A;  4HPK A;  2OQ6 A;  4CDX C;  4JQT A;  3JB8 A;  2RMU 1;  1CIW A;  4WM7 B;  2ZS6 B;  3NJX A;  5FK8 A;  3WDX A;  1GV9 A;  4XCB A;  4FTS A;  3M1H A;  3POF A;  4OHW A;  5I8T A;  4DXR A;  1NCR A;  3FFZ A;  4X6R B;  1RB8 G;  1LHU A;  1BK1 A;  2OZ6 A;  2PYT A;  1GP5 A;  4TZD A;  4P02 B;  4LLF A;  4A3Z A;  1OLR A;  2G9F A;  3WHT A;  1RMU 2;  3MFC A;  1L7Q A;  1TNF A;  4PDW A;  5I8S A;  3VBU C;  1VR3 A;  2BEO A;  4KH9 A;  3X29 B;  2D3P A;  3T08 A;  5J48 A;  1W6M A;  1UZ0 A;  4MXW B;  1DGW X;  1OF4 A;  3DYO A;  3CMG A;  4Q4Y 3;  4W65 A;  3I49 A;  2A6Z A;  3ETP A;  1BVP 1;  2ZEY A;  2WFF 1;  4EN6 B;  1YFY A;  3RZH A;  5FY4 A;  3MV1 1;  4HG6 B;  2VR4 A;  4FT8 A;  5GZC A;  4AZZ A;  4XF0 A;  5L9B A;  4JDO A;  1TNR A;  1W0P A;  3OTF A;  2XUM A;  3H8U A;  4AW7 A;  4QQL A;  1QJZ A;  3ITQ A;  1PNG A;  2V72 A;  4L99 A;  4QB2 A;  3RJ2 X;  2O8Q A;  1BKZ A;  1RED A;  2A6Y A;  4R4Z A;  2EVX A;  2XBO 1;  1NA1 B;  1H1I A;  4UXA A;  4B4R A;  4CDX B;  5JIU A;  4KQ7 A;  4YVS C;  5H9Q A;  3RI9 A;  4YGC A;  2PHR A;  5JIA A;  4RFT 0;  3C2U A;  4BIF A;  3AYD A;  3ZN5 A;  1W8F A;  3HVD A;  3N3H A;  3AYA A;  4AQ2 A;  4WBB A;  4C0B A;  3PJY A;  4XOG A;  3UGH A;  5FY5 A;  5JPN B;  5FUN A;  2BDR A;  4LMF A;  1FOD 1;  2J1V A;  3ZFF A;  1OVS A;  3FWE A;  2QQP A;  3RZL A;  1BCX A;  3OEA A;  2WN3 A;  3UKV A;  3BOD A;  1IQD C;  3AL6 A;  1PM7 A;  2JEM A;  1ASJ 2;  4GWI A;  3OUH A;  4TSV A;  2QQI A;  1MVE A;  4XTP A;  3UT0 A;  4AXO A;  2BOJ A;  3QD6 A;  4OMC A;  2Y38 A;  2RS5 2;  4BQ3 A;  3GNE A;  1KJR A;  1GQH A;  2Y6L A;  4PF5 A;  5GLT A;  4NID A;  4IGQ A;  5A7Q A;  4QX0 A;  2ZHN A;  3IN9 A;  2XR4 A;  4MV2 A;  1JOD A;  4NRO A;  3U4X A;  4MUV A;  3KGZ A;  4AOC A;  1ULP A;  4MGY E;  5D8A C;  4AFM A;  5A33 B;  2Y6H A;  3KZ4 C;  3GDB A;  4CU6 A;  2MEV 2;  4XF1 A;  5DUW A;  2Y0O A;  4YVS B;  1RGS A;  1TME 3;  3ZO0 B;  2XUE A;  2YC4 A;  2OUJ A;  1H0B A;  1WW4 A;  4YW1 A;  4ZU5 A;  2CU5 A;  4AF9 A;  4Y1Y A;  5FYU A;  4ARY A;  5CEH A;  4CDW B;  2W0X A;  1XU1 A;  2L9L A;  3SCF A;  2JDA A;  2XQR A;  2UUR A;  1LUL A;  1BQP A;  3FLP A;  1OC1 A;  4XQD A;  1CAV B;  5A32 A;  1UOJ A;  2CGN A;  1EUU A;  2D98 A;  5F3G A;  3W5M A;  5FZ3 A;  1EAH 1;  2ZX1 A;  4Y1X A;  2OS2 A;  1K5M C;  4KI5 M;  2EXJ A;  4COU A;  5A6Q A;  5JSO A;  4Y26 A;  4C0H A;  1NE6 A;  2YU1 A;  1IGO A;  3O1T A;  3OPW A;  4QT6 A;  4CPB D;  1BVV A;  4HN0 A;  2G9G A;  3SNM A;  1W6O B;  2RS1 2;  2FCU A;  1JU3 A;  2J1S A;  4IUG A;  4DUW A;  1Q5O A;  2VVF A;  5HXM A;  4HSJ A;  1YFU A;  4Q0V A;  2WAA A;  4XPV A;  4A6O A;  1AL0 G;  3POJ A;  3I3B A;  1OSG A;  5FZC A;  3ZXA C;  3ACH A;  1IS3 A;  1DP0 A;  1S0C A;  1GMM A;  4O61 A;  2WNV C;  1UY4 A;  1COV 1;  4B4Q A;  1QQP 2;  3A22 A;  2XVG A;  3IDC B;  4QD2 A;  2R0F A;  4YGB A;  3ZOI A;  1K42 A;  4BXF A;  1C1F A;  4AK3 A;  3LGR A;  1X50 A;  2VW0 A;  3NNJ A;  3HNY M;  5ACA 2;  3S0M A;  3LCP A;  3NMB A;  5FY8 A;  4E4H A;  2BPA 2;  1D0G A;  1VBC 3;  2WT1 A;  4GKX A;  2GH8 A;  5FJH A;  4V2W A;  1ULE A;  1CPN A;  5FP8 A;  4YZ2 A;  3H1M A;  4LUK A;  4N7I A;  4LKD A;  1GBG A;  1GZT A;  3CJI A;  3Q8C A;  4IEV A;  2IXC A;  4K9S A;  3O14 A;  5A3O A;  4GIQ A;  2UWC A;  1NZI A;  5ERL A;  4DEV A;  2HWC 1;  4C90 A;  4QXK A;  3ZXD A;  2A6X A;  2RS3 1;  4BK5 A;  4JRL A;  1EPW A;  3VBF C;  2HWD 2;  4HVO A;  2J42 A;  3N7K A;  2RM2 1;  3LOB A;  2AUY A;  1GAN A;  3OOX A;  3ZDS A;  4GWJ A;  4NR1 A;  2C1F A;  2P3J A;  5LCW L;  1ZBA 3;  2WZP P;  3WF1 A;  5BY5 A;  2ILM A;  2JIG A;  4XJ8 A;  2C5D A;  5CAZ A;  4S2G A;  5FUP A;  3WV6 A;  1VP6 A;  1YIF A;  3OYW B;  2R30 A;  4IEY A;  2B46 X;  5FLJ A;  3S30 A;  2BGP A;  5FKC A;  1PO2 3;  1ENX A;  4M0H A;  4UFK A;  3ZKU A;  3AZV A;  1FX5 A;  4LBL A;  1Q3E A;  5F6K A;  3SC7 X;  4NJ4 A;  5T5L A;  1NE4 A;  4YW5 A;  1UOB A;  3B93 A;  3KCY A;  5C9A B;  2J1A A;  2RS1 3;  3OBZ A;  3A21 A;  4RS5 B;  4Z8B A;  2V5D A;  1MS5 A;  1CES A;  4P00 B;  2WO1 A;  4ZHN A;  3HN1 A;  4NOT A;  1N3P A;  3PHM A;  1MS4 A;  3RZG A;  3KT4 A;  1C28 A;  2CY6 A;  4BQ4 A;  4HSL A;  4DO0 A;  1JW6 A;  5HCH A;  4IND A;  2WO7 A;  4AED C;  2CAV A;  3U10 A;  4Q0S A;  3ROU A;  1UKR A;  4UFH A;  4YW2 A;  5BNN B;  4LKS A;  2OUH A;  1J84 A;  3I2O A;  3K48 A;  3ZYP A;  4UBG A;  4NUB A;  3QBQ A;  5DAV A;  3SHR A;  2VL4 A;  5HCB A;  3WD5 A;  4CPB A;  5CG8 A;  4LIU A;  4BIS A;  1PMH X;  2VG9 A;  1AR9 2;  2WQ4 A;  2E33 A;  4M4P A;  4P9G A;  2E7Q A;  3KSC A;  1E5I A;  1AYM 1;  5FZO B;  4OUL A;  1W39 A;  5GLZ A;  3J8F 3;  2RJK A;  1LHN A;  4XVH A;  4QB6 A;  3FZ3 A;  3LIH A;  1W8T A;  4XJU A;  4LE3 A;  3IDA A;  4EQV A;  2DFC A;  4ISR A;  4LUM A;  4UFM A;  3VDA A;  1I5Z A;  5ABJ B;  4EN0 A;  4Q0P A;  5FP9 A;  1STM A;  2WS9 1;  1BLZ A;  4PJY A;  4X6Q B;  3U37 A;  3VDD A;  3DXT A;  2P3I A;  3IKW A;  4AI0 A;  4YZ1 A;  1CAU A;  4BIO A;  1W2T A;  2IFW A;  2JG9 A;  2QQM A;  4QDR A;  3VZN A;  4BB3 A;  1QJY 2;  3NJZ A;  3MZH A;  2PFW A;  1V00 A;  4LLO A;  3UJO A;  1BBT 3;  1MVQ A;  2BTV C;  3GXU A;  3W5N A;  5IK5 A;  5A70 A;  3O0W A;  4AVA A;  5FQ0 A;  1LAJ A;  1LOD A;  3FE5 A;  4JVA A;  5FFO C;  3TAY A;  4Y1Z A;  1OA2 A;  1IPK A;  1ND3 A;  1JS9 A;  1K5J A;  4HN1 A;  4I0B A;  1S0J A;  5K7P A;  2WFF 2;  3N9N A;  4FOW A;  4AGV A;  5FZ1 A;  3I8T A;  1W90 A;  3VZL A;  4PQQ A;  3LE0 A;  1PX3 A;  2VH9 A;  5F9T A;  3LQC A;  1ND3 C;  2P17 A;  2ZJC A;  4Q1P A;  3S5A A;  2PQQ A;  2WR9 A;  2PXJ A;  5FPL A;  2F6B A;  2D6K A;  4YM0 A;  2A6V A;  2JXA A;  3T0D A;  4PLN A;  4Y22 B;  5EIY B;  4YW4 A;  2ERF A;  2MPF A;  4LBK A;  3ZXJ A;  2B39 A;  2ZX2 A;  3MIE A;  2XDV A;  4PIZ A;  5A7S A;  5JXJ A;  2WYS A;  3APB A;  4D7T A;  2VUL A;  3CBN A;  3A23 A;  2KM2 A;  1S0E A;  3SXW A;  1LOF C;  2ORZ A;  2NYY A;  1DGR A;  2HWE 2;  2YPJ A;  3KB5 A;  2HLE A;  4L2N A;  4XUN A;  1DF0 A;  5FZ4 A;  4EN8 B;  2JG9 B;  2ETE A;  3ZYH A;  3U0Z A;  1MEC 1;  3HT1 A;  1QJU 1;  2DDU A;  3IT8 A;  3SKJ E;  1SEF A;  4BQW A;  2BQP A;  1R1A 3;  2VXR A;  1GU3 A;  1RIN A;  1R1A 2;  1GNY A;  4W6W A;  4LKE A;  1AL2 3;  1DQ5 A;  3BU7 A;  4RL7 A;  4Q4X 1;  4ZS3 A;  4YW3 A;  2Q1M A;  4HPK B;  2BBV A;  3TBD A;  3ZIX A;  4I30 A;  5GZG A;  4I2O A;  4UF0 A;  2TUN A;  4XIK A;  1GZW B;  1XPW A;  4Q1R A;  3LF7 A;  1MZE A;  4URT A;  2HWE 3;  3WCS A;  4DY3 A;  3RYK A;  3MI8 A;  2DV9 A;  1JH5 A;  1JOJ A;  2PLV 1;  2VOT A;  3HBK A;  4GH4 B;  1WLD A;  4PCR A;  4UFJ A;  4BH9 A;  4GZ9 A;  2P6H A;  3EYP A;  3RDI A;  2VNR A;  4CDW C;  1NKG A;  1SBD A;  1ZRI A;  3B01 A;  4HK9 A;  2QQJ A;  5FPB A;  1QH6 A;  4D3W A;  3IZO A;  4YGD A;  2A70 A;  1VBE 3;  1GKB A;  3K4Z A;  3WP6 A;  2R07 1;  3M4F A;  3PL0 A;  5C3O A;  3LA2 A;  1BYH A;  4YZ3 A;  2R16 A;  4W6Y A;  4WM8 B;  5K0U A;  3LWC A;  5IW0 A;  5A3M A;  2W46 A;  3LFI A;  4OHZ A;  4OZO A;  3VZM A;  5M0T A;  2QJV A;  2PAM A;  4IEP A;  3WSO A;  4LKF A;  1X82 A;  4JC1 A;  1WBL A;  3E97 A;  1GQP A;  1QU0 A;  1SLA A;  5TSW A;  4N53 C;  2VNG A;  5L73 A;  1FOD 3;  1JMU B;  4URA A;  4OVE A;  1VAM A;  3POS A;  1I6X A;  4Q5O A;  4AQ6 A;  5FTT C;  1Z0H A;  3VBO A;  3D3A A;  3SIS A;  1PO1 1;  2KA3 A;  1LCL A;  3W58 A;  5C3R A;  1AYN 1;  5C7G A;  1O4Z A;  4PI0 A;  1Y3T A;  2Q30 A;  3P3P A;  1QEX A;  3OGG A;  4BLI A;  4R9B A;  5JWP A;  5FYB A;  2QQV A;  2B4K A;  4A4A A;  3WOG A;  1J3R A;  1R1A 1;  3GAL A;  1SBE A;  3ZFF C;  3J8F 1;  3H8R A;  4QPG C;  1A8M A;  1OD3 A;  1UZV A;  2PHW A;  1AHS A;  1LJ7 A;  2R06 3;  4GXL A;  4N53 B;  5EPA A;  4XE9 A;  1NYW A;  3KV4 A;  4HL0 A;  4MGZ E;  2VCC A;  4CCL A;  3WF0 A;  5E6H A;  5K0U B;  1LEC A;  1UXZ A;  3CKH A;  2A3W A;  3OSD A;  1OI6 A;  4XAA A;  2RV9 A;  3QH7 A;  4QX3 A;  3NV3 A;  1S2E A;  1BXH A;  1UW8 A;  2PQS A;  4FAG A;  3K4A A;  4BZ4 A;  3ZX7 A;  4M3C E;  5JZG A;  4LBQ A;  5IK7 A;  4KBZ A;  2JEC A;  3LZZ A;  4QM8 A;  4EN7 B;  3LEK A;  1G9F A;  3GYD A;  5DAB A;  5A7W B;  5LA2 A;  1UL9 A;  2BER A;  5FWE A;  1YQ2 A;  5DG2 A;  4IET A;  5HCF A;  2WO2 A;  1DZR A;  1RUI 3;  1GZC A;  2ZCW A;  1RUC 3;  5FJK A;  5T54 A;  4BQ5 A;  4CCD A;  1DDL A;  2YRO A;  1FNY A;  5FYY A;  3U11 A;  2C9K A;  2NM1 A;  3H3Z A;  1YWK A;  5EP9 A;  1EAH 3;  5CIS A;  5KXC A;  2DU0 A;  4Y5T A;  5FP4 A;  2YC2 A;  3SLI A;  1OH3 A;  3ACG A;  4MX3 A;  4TN7 A;  4DY5 A;  2IZW A;  4BYY A;  3BVC A;  5DUU A;  4AAP A;  5CAD A;  3BUC A;  4Y33 A;  1HQL A;  5F39 A;  1W04 A;  1CN1 A;  3N35 A;  2LRP A;  2N7G A;  2RR1 3;  1YQ8 A;  1WW6 A;  4GUL A;  2Z2S B;  5C70 A;  3AMN A;  4FPE A;  1FAY A;  2HWB 3;  3PUA A;  1LOF A;  3PUH A;  1DQ1 A;  1SG3 A;  2XLG A;  4JHT A;  1RVF 1;  3HAG A;  4AGR A;  3LKJ A;  4HLT A;  3V64 A;  4OHY A;  3I59 B;  1HXS 2;  2EID A;  2RS3 3;  1W03 A;  3JCI A;  4JGZ B;  4NWW A;  5IAV A;  5A1F A;  2X8K A;  3K75 B;  4JGY C;  4EJR A;  4IE4 A;  1RIT A;  1WD4 A;  5GM0 A;  3PJQ A;  3LB9 A;  3ZYG A;  1JYN A;  2RR1 2;  4B29 A;  4YM1 A;  1IG0 A;  3RNS A;  2YFZ A;  2MNG A;  2HEW F;  5FO7 B;  1AYM 3;  4GWM A;  3I3Q A;  3V0A B;  3O1R A;  1VBC 1;  1AVB A;  2JDZ A;  3CJI B;  1N1V A;  1V9U 3;  3WDV A;  3M3I A;  4Q29 A;  4Y20 A;  4WM8 A;  5JR2 A;  2A73 B;  1REE A;  2HWB 1;  2R7E B;  2VO5 A;  3M3Q A;  4GMP 0;  4NPL A;  4XFC A;  1QDC A;  3WIN E;  4RQP C;  4FFG A;  4JGY A;  3AVS A;  4KWK A;  4M0N A;  4BXS V;  1DFQ A;  1V0A A;  5C8C B;  4MG2 A;  5E16 A;  3IM0 A;  1X9P A;  2KD7 A;  4EN9 B;  1C8M 1;  5FRA A;  1SFY A;  1XQN A;  1UYY A;  4RN5 A;  4A6S A;  4RSU A;  1CJD A;  4WVW A;  3UYJ A;  3G7D A;  2PHT A;  1HRV 2;  2DUO A;  3ZYJ B;  3TN9 2;  3HD8 B;  4Q4X 2;  2HYX A;  5E8A A;  3C7E A;  4JHZ A;  4K8R B;  4AQT A;  3D0J A;  2D7F A;  4DQA A;  5A33 A;  5KXB A;  1V6K A;  2OYZ A;  4BMB A;  2WNO A;  2O14 A;  3LD8 A;  1H8T A;  3AYE A;  3WVJ A;  4Y24 A;  1W3V A;  3NNL A;  4DIN B;  5LW9 A;  1HKD A;  2SBA A;  4AVS A;  3VHP A;  3P6B A;  1D2S A;  1PK6 C;  4P9I A;  4NII A;  1WMX A;  4QHO A;  4XBL A;  2ZX0 A;  1XU2 A;  5DDJ 3;  1RMU 3;  3IAQ A;  5GJ6 A;  4O9E A;  1YHF A;  3IWZ A;  2XJQ A;  1FPN 1;  1GYK A;  3E1F 1;  3ZSM A;  3ES4 A;  2WFP A;  3ZKY A;  4YAR A;  3IIA A;  1XYP A;  4XUO A;  4BK4 A;  4P9X A;  4CEY A;  4FFH A;  3B3Q E;  1ND2 A;  1MQT B;  5FR3 A;  1ZBE 1;  4CDW A;  4UI9 L;  4AI2 A;  2B5H A;  5DAQ A;  1JHJ A;  4JKM A;  5JAX A;  3O1O A;  4FPK A;  1IZ3 A;  2XHK A;  4DZG A;  1Z78 A;  4KL1 A;  1ND2 B;  1W2N A;  1G86 A;  2PHF A;  1VBC 2;  2A71 A;  4LBN A;  2VZT A;  2EAL A;  3GCX A;  3IDB B;  5ABJ C;  1SMV A;  1ODN A;  4AYU A;  4QXB A;  2NMN A;  3JU9 A;  4F7Z A;  3F95 A;  2HWB 2;  1R08 2;  1ZYB A;  3C7H A;  4AI9 A;  1FMD 1;  1DGW A;  3WG3 A;  5LZ6 A;  3AKS A;  4XJ9 A;  5I93 A;  2RDN A;  4BE3 A;  1HJG A;  1JBC A;  1YEW A;  4P14 A;  3T1M A;  2RS3 2;  4HK8 A;  3VKF C;  4Q0U A;  1HQN A;  2RDR A;  3CNA A;  4RS5 C;  1O91 A;  2PLV 3;  1QJY 3;  4LIV A;  5DDJ 1;  2RMU 2;  1UIJ A;  3BGA A;  3A7Q A;  3ATG A;  3KGL A;  4LHS A;  4UFL A;  4EYU A;  1W06 A;  5FZB A;  3PUS A;  3PVO A;  3OUI A;  3QH6 A;  5FKB A;  3VBS A;  2VNV A;  3ILF A;  4AFD A;  4GMP 1;  1ASJ 1;  3RPQ A;  4NRQ A;  3RWN A;  4YM3 A;  5IFP A;  1DQ2 A;  2QDN A;  1ST8 A;  3R4S A;  1PIV 1;  3O1U A;  3USS A;  4JX0 A;  1O3T A;  3UL2 A;  2CWM A;  1VBA 3;  5ABJ A;  3WEZ A;  1OOP C;  3AP7 A;  3IPV B;  4ATF A;  1H2N A;  1MEC 3;  4YFZ A;  1NCR B;  1ZA4 A;  5CKQ A;  5JLV A;  3OBA A;  2FCV A;  1W2U A;  1CX4 A;  3POI A;  5CB7 A;  4XJA A;  2RMU 3;  1ND2 C;  4Y20 B;  5GZD A;  3SQO A;  2RHP A;  4CSW A;  2V73 A;  1UPS A;  3P1I A;  4ERO A;  5AC9 3;  2C6S A;  4OFG A;  1T2X A;  1HJF A;  1UN1 A;  3THP A;  5C3P A;  3TYJ A;  4QKD A;  4C1W A;  4Y3O A;  1L3J A;  1PVC 3;  2P6C A;  2LS6 A;  5FO9 B;  3VL9 A;  1FI2 A;  2RM2 3;  3CZU A;  4YG3 A;  3VBS B;  1U0A A;  4IER A;  5CU1 A;  3FLR A;  5I91 A;  2QQN A;  5FY1 A;  5L36 A;  5IFT A;  2SLI A;  4QPI C;  4YWA A;  2D5F A;  4W8J A;  1QJU 3;  3K77 A;  1IPS A;  1US2 A;  4R52 A;  4NIH A;  3GM8 A;  1ZX5 A;  1MAC A;  2A75 A;  2VTF A;  3VGI A;  2J1R A;  3MF6 A;  1LKN A;  3DUI A;  1W6O A;  4Y22 A;  4AL9 A;  2GMM A;  1PO2 2;  3VDB A;  1WA6 X;  1QY4 A;  1AR6 3;  1W6N B;  3OD0 A;  2R07 3;  2IXI A;  4RD7 A;  1OQD A;  1S2K A;  3E5X A;  1H9P A;  1ZM1 A;  1AXY A;  4AHZ A;  2JE7 A;  1J3Q A;  1BEV 1;  5C71 A;  1BEV 3;  4D6S A;  3PMS A;  1J1T A;  1LGC A;  1LU1 A;  1QOO A;  2X5I A;  2CAU A;  1F31 A;  4P5Y A;  5F3E A;  2RR1 1;  1B35 A;  1QOS A;  4YZ4 A;  1FPN 3;  5FYZ A;  4AAX A;  4AHW A;  1HDK A;  2D97 A;  1QNW A;  2WIN B;  4Y5S A;  5FZD A;  4FPC A;  4OLL A;  4HXC A;  1NCQ A;  1G8W A;  3PLQ A;  4I3G A;  4JGZ A;  3ZSL A;  3SCG A;  2DVD A;  2QTW B;  3UV9 A;  3O1P A;  2VOW A;  2WZR 1;  1VB4 A;  5I0U A;  3VD5 A;  2R04 1;  5LRS A;  1OHF A;  4XZP A;  3PUQ A;  4LXL A;  2ZGL A;  1ENR A;  2GP5 A;  3DEM A;  3ZSJ A;  1S0B A;  3VBR B;  4LK6 A;  2E7T A;  2JKB A;  2J22 A;  4GH4 C;  2Y33 A;  4OZX A;  4MH0 E;  1VPH A;  4QX5 A;  1NCR C;  4SBV A;  4FPO B;  1J83 A;  3ES1 A;  4IV3 A;  4IGP A;  2WLP A;  3VBR A;  2FD8 A;  5EYY A;  3WUC A;  1ZZB A;  1OKO A;  5EQU A;  2DVF A;  1N1Y A;  2X53 S;  2ET1 A;  2GME A;  2ZMN A;  5CFD A;  4Q4Y 1;  4DEQ A;  4DFS A;  1X9T A;  5KHI A;  4WVZ A;  4Q27 A;  4Q4V 3;  3S6P A;  1RUO A;  3UGF A;  3G6J B;  3ZYB A;  4LOS A;  1SLB A;  2R6Q A;  3FBY A;  1IOA A;  3VUO A;  5JOZ A;  1DCS A;  1WLW A;  4GQ7 A;  2QUO A;  4UAP A;  3HQU A;  1EUT A;  2VC9 A;  4CCM A;  2XJU A;  4IE5 A;  1YQ5 A;  3EXU A;  4XFF A;  2BNM A;  2HEV F;  2OZJ A;  4K21 A;  1K3I A;  1PIV 3;  1IPJ A;  5SV8 A;  2HJI A;  4YG0 A;  3VBH B;  2WZR 3;  4FAH A;  3WW2 A;  2BNO A;  4YSF A;  3ZXE A;  4NVP A;  4XFG A;  1NZC A;  1R09 3;  4FPY A;  2RS5 1;  1OUX A;  5FZ9 A;  4E2Q A;  3V0B B;  4DB5 A;  1M4W A;  1RJ7 A;  2PMW B;  1HIX A;  1W9S A;  4P9L A;  4BJ0 A;  2XHN A;  2XXZ A;  2WQZ C;  3EQE A;  4GJZ A;  5JXI A;  1UU4 A;  4LE4 A;  2KR2 A;  1ZZ8 A;  1CD3 G;  3H7J A;  1RUD 3;  2D3R A;  4ZU4 A;  1WME A;  3N7M A;  5A80 A;  5HCA A;  2VU9 A;  2WWS A;  2EAA A;  1SZB A;  1ULD A;  1HLC A;  1FNZ A;  1U5Z A;  1BK0 A;  3WF4 A;  4YZ5 A;  2DUQ A;  4E2G A;  3O5S A;  4E8C A;  3BTA A;  4KNC A;  4TLF A;  2J7M A;  5JOY A;  4I0W B;  5BPX A;  5CFD B;  2RG4 A;  1K45 A;  4LUL A;  2X09 A;  1S55 A;  1RHI 2;  1QIQ A;  3FL7 A;  3NNF A;  4E2S A;  4KWJ A;  4YVW B;  1AYM 2;  4X8N A;  4P9W A;  3T2T A;  5EJ3 A;  4HVR A;  3WNN A;  1I1E A;  3N9M A;  1PVC 1;  3BB6 A;  5JMC A;  1CAX B;  1NOV A;  5FLH A;  2WNV B;  2HWE 1;  5FZO A;  1ENQ A;  5FYS A;  2YPD A;  3N9P A;  2JDM A;  2VOK A;  2QNK A;  5F32 A;  2PA7 A;  4J6G A;  3ZFE A;  5DAP A;  4Q4V 2;  4CE8 A;  2F17 A;  2R1B A;  1YXW A;  2WFF 3;  2WS9 2;  3IDE A;  3EHK A;  2X05 A;  4UBH A;  1PGL 2;  4BQ1 A;  1UY3 A;  3MLJ A;  1E57 A;  1EV1 1;  3L2H A;  2YBK A;  4RA0 A;  4DRR A;  3QAC A;  1R64 A;  4EWE A;  1ZZ7 A;  3FUQ A;  1B09 A;  3WNL A;  3BTY A;  4CA9 A;  2MHF A;  3M8L A;  2Q8E A;  3VD4 A;  3H0O A;  3C7O A;  3I3D A;  1ULC A;  5FIX A;  1GZW A;  2I2S A;  2W08 A;  5KHJ A;  4YLZ A;  1O7F A;  2BNN A;  1AX2 A;  4FOY A;  4QGN A;  4TXW A;  1OQE A;  2BGC A;  4CP1 A;  2ZGU A;  3OGJ A;  4HET A;  4ES8 A;  3BU0 A;  4ZXK A;  4TLG A;  2VOX A;  2AR6 A;  3VHN A;  5FP3 A;  4E9K A;  5ACA 1;  1WCD J;  2A3Y A;  5FXV A;  2DYC A;  1UIK A;  5LY2 A;  4ZZ8 A;  5FZE A;  3WY6 A;  1ZA7 A;  2FDF A;  4AVB A;  4QQ2 A;  2A3X A;  3THD A;  2LTN A;  5JSR A;  5K9Y A;  4OI0 A;  3THT A;  3SEE A;  2BFU L;  4LIT A;  3KV6 A;  4N9H A;  1XC6 A;  1BJQ A;  4CDQ B;  4KWU A;  3KVB A;  1YI9 A;  1K12 A;  1AL2 2;  2RDQ A;  1MS3 A;  3LDK A;  5FYI A;  1JZ2 A;  1WW5 A;  2WL1 A;  5KWR A;  2HWC 3;  1H4H A;  5FXX A;  2CDP A;  4RR3 C;  1OT5 A;  5IWF A;  1MS8 A;  1AR8 2;  1W2A X;  4G9S B;  4ZU7 A;  1VMJ A;  2UYA A;  3ZM8 A;  5FK7 A;  4LO6 B;  5C8C C;  4N7U A;  5FZK A;  3PTR B;  1Y7B A;  1LEN A;  4IEZ A;  3B9I A;  5F2W A;  1GLH A;  4XXP A;  4ET7 A;  1J3P A;  3VD9 A;  3MUY 1;  4XUP A;  4W50 A;  2BUK A;  5FY0 A;  2OPK A;  1JI6 A;  4YVS A;  5LBC A;  5J1X A;  4LO7 A;  1VJ2 A;  1Z7S 3;  2XLA A;  4UF0 B;  1Z7S 2;  1UNB A;  2ZBJ A;  5FZL A;  2ZZQ A;  3VBF A;  1W0O A;  4H14 A;  4QDS A;  4PHZ A;  1S0G A;  4J25 A;  4KGG A;  5AFB A;  1NX9 A;  4W6X A;  1GIC A;  3A0K A;  4RQP A;  1LNS A;  4Q4V 1;  5A3P A;  4NE9 A;  3MUZ 1;  4KG8 A;  1C8M 3;  2QQO A;  2W92 A;  2Z42 A;  5A1A A;  2OPW A;  4NAM A;  1XBF A;  2PLV 2;  3SCH A;  3HT2 A;  3J7M A;  3VHO A;  5JXH A;  3JBG 3;  5FY9 A;  1FAT A;  3MIC A;  4FO9 A;  4MYE A;  2EIB A;  4LBQ B;  1UY2 A;  1WKY A;  2DTY A;  2W1W A;  1JTZ X;  3Q8A A;  4FPH A;  2VY0 A;  2UYB A;  1OPO A;  1KQR A;  2UWB A;  1AR7 3;  3KVA A;  3VKO A;  1POV 0;  1NY7 1;  4MLO A;  4OMD A;  2Q4S A;  3BOW A;  3DL3 A;  2R04 3;  1HRI 3;  3DCQ A;  4CCJ A;  1VBA 2;  3RRD A;  5A3U A;  1W0N A;  4AVC A;  5C4W C;  2QBX A;  1YFX A;  1XE0 A;  4OI4 A;  3GHM A;  4WVV A;  3NAP C;  5FYM A;  1LOG A;  3M2M A;  3MYX A;  2CSG A;  4S2F A;  5BNO A;  3H7Y A;  1DQ6 A;  1GZ9 A;  1KD7 A;  3FHQ A;  3H50 A;  1N3O A;  3KT1 A;  1VRH 1;  3T1L A;  1BMV 2;  2ES3 A;  2R1D A;  3MIG A;  5F1R A;  1F9K A;  1GUI A;  1OA4 A;  1UMH A;  3VBO B;  4A7Z A;  4DUV A;  4WVM B;  1MQT C;  2W1U A;  3ZYR A;  4IEW A;  1RUF 2;  3CU7 A;  4Q2F A;  4GAZ A;  2DCZ A;  2YMZ A;  2JD9 A;  3I7D A;  4RGA A;  3UET A;  3KHC A;  5GLV A;  2AEY A;  1EPZ A;  3RI8 A;  3RG0 A;  3E6B A;  5BNO B;  2JB8 A;  1PVX A;  1QXJ A;  2YHJ A;  5T5O A;  5C4W A;  5JR7 B;  3S5Q A;  4B3N A;  2Q8O A;  2Z69 A;  1UX7 A;  1VMF A;  5D8A B;  4XET A;  3H8X A;  4EZ4 A;  3BOP A;  4QPY A;  3BTX A;  1GP4 A;  3NNM A;  3SEP A;  3NRU A;  2YU2 A;  1D7P M;  3HNM A;  2P2K A;  5C33 A;  4NWV A;  2YFU A;  1VAV A;  3Q9O A;  3ZR5 A;  5IT6 A;  4FI9 A;  1YO8 A;  4QKN A;  1KDM A;  2BBA A;  3FFQ A;  4XF4 A;  2ARX A;  2ZGK A;  2GC2 A;  3H8O A;  2JIC A;  2OXB A;  2W1Q A;  4OI2 A;  2VZO A;  3ORJ A;  5C6C A;  2Q0A A;  4Z92 B;  2D93 A;  1WLT A;  1C57 A;  5G04 L;  1RUC 2;  4PLM A;  4E4Z A;  2B9V A;  2X5I C;  4AFB A;  4FSJ A;  4XIL A;  4NHL A;  1VBA 1;  4H3W A;  4HFS A;  1DU3 D;  1OBN A;  1R08 1;  3OBR A;  1MEC 2;  4FXK B;  2WWU A;  2JX9 A;  1PK6 B;  2HYK A;  2Y6F A;  4YVW A;  3AP6 A;  2JE9 A;  5FP7 A;  5C4W B;  2ZMK A;  3N9O A;  1MZ6 A;  2VXJ A;  2ET7 A;  3KV9 A;  1ZZC A;  2EXI A;  5AC9 2;  1NXM A;  1DYP A;  1QH7 A;  4M4R A;  4D8M A;  1DBN A;  4AEJ A;  2GC0 A;  1O3R A;  2VZ1 A;  2PHL A;  1H8V A;  3UJQ A;  3O1M A;  1ZRC A;  4ZXE A;  1MZ5 A;  4CU7 A;  1NLR A;  4PT6 A;  1UYZ A;  2QE3 A;  5KXE A;  1YRZ A;  1HRI 2;  3ZR6 A;  1GP6 A;  2LM3 A;  3ABZ A;  4K7J A;  4S2H A;  5FV3 A;  4B4P A;  2K2S A;  3MFA A;  4FQ4 A;  1BZW A;  2QQW A;  3NST A;  4CEY B;  4IV1 B;  5JZG C;  1F5J A;  2JKX A;  3AZW A;  4FPF A;  1W05 A;  1WCQ A;  2ORX A;  3P3N A;  2D43 A;  1JHN A;  3I2H A;  2PAK A;  1TMF 2;  4UFI A;  2VOV A;  4XYX A;  1VBB 2;  2EIG A;  2GC3 A;  3PIG A;  1QJE A;  4COY A;  1OUS A;  3FHA A;  3EO6 A;  3WNX A;  2FZ2 A;  2WSU A;  3WDW A;  1PK6 A;  1TME 1;  3NKG A;  4K40 A;  2JB4 A;  3N9L A;  4LQR A;  1UF2 C;  3I54 A;  1UD1 A;  4MGK E;  3E5Q A;  4XFI A;  3CDZ B;  4K6B A;  5CKM A;  5FQ0 B;  1HB3 A;  4QU1 A;  5FXZ A;  4E27 A;  2ARE A;  3ZYF A;  2JIJ A;  4CXY A;  4BLJ A;  1GOG A;  5IVV A;  4XDQ A;  1OFS A;  1U12 A;  5CG9 A;  2BRT A;  5HPO A;  2E53 A;  4LHN A;  4OQ8 A;  3ELN A;  2JDU A;  3O7O A;  4UW4 A;  5A6Z A;  3AP4 A;  1NCQ B;  2VW1 A;  1X8M A;  1AR8 1;  2IUW A;  3C8X A;  4NMI A;  2ZZJ A;  4CP9 A;  4CYD A;  5HI0 A;  3KF3 A;  1VBE 1;  4L8Q A;  1O4T A;  5GKA C;  3POE A;  2W47 A;  2X5I B;  4OCT A;  2GN7 A;  5CIR A;  2RM2 2;  5IVC A;  1XE8 A;  4E4S A;  1VAK A;  2B9U A;  1ULG A;  1H4G A;  2BW8 A;  2VZR A;  4XQW A;  2XWJ B;  3AMM A;  3MW4 A;  1N3Q A;  1LHO A;  2I07 B;  3CL1 A;  1SPP B;  4HKO A;  3DEC A;  4D6R A;  5AC9 1;  3AM2 A;  3BN6 A;  4IES A;  2VCM A;  3J7H A;  1OXC A;  2ZPX A;  4JV4 A;  3I2G A;  4XQ4 A;  3RGB A;  3BIE A;  4HAN A;  1N1T A;  2RVA A;  1XYO A;  2DF7 A;  4K3U A;  2ARA A;  4AVT A;  1IHM A;  1DLL A;  3PU3 A;  5L7O B;  3O0X A;  5A6X A;  1SAC A;  2WLQ A;  2O8O A;  4FXG B;  2O1Q A;  1JYC A;  2D6N A;  4GB3 1;  1OH4 A;  3FX3 A;  4B1M A;  1PNF A;  2VMI A;  5J37 A;  4YGE A;  4NO4 A;  5T55 A;  3ZIW A;  5C5U A;  4AGG A;  3ECQ A;  3GF6 A;  5LK5 A;  5I0T A;  4AVV A;  4GMP 3;  1LES A;  4EWD A;  1V6I A;  3MF9 A;  2GN3 A;  3HQR A;  1UY1 A;  1HW5 A;  3M7A A;  1TMF 1;  3AZZ A;  1AJO A;  3PME A;  1V6N A;  3PDQ A;  1WWY A;  3WQ0 A;  2YC0 A;  3K46 A;  3V0B A;  1ZRD A;  3R4U A;  1KIT A;  4D94 A;  4NHM A;  5IAX A;  4WM7 A;  4XBN A;  1Q8P A;  2QCS B;  3CIH A;  2GNB A;  3POY A;  3NJY A;  2AEN A;  1ZBA 2;  5F5Q A;  4TTG A;  3HEI A;  4L97 A;  3NQH A;  2VM9 A;  1PX4 A;  4MOA A;  4QPI B;  2J1T A;  3WF3 A;  1CWP A;  2ZGP A;  1OA3 A;  3D5O A;  2FHR A;  1N47 A;  4JAA A;  2XKO A;  3CJI C;  5LK7 B;  3UGG A;  4COW A;  2Q1Z B;  3FMG A;  4JKK A;  5GAL A;  4AEK A;  3Q8F A;  4IGO A;  3ZYI B;  4PDW B;  1HX6 A;  1Q8O A;  5KHH A;  1RL3 A;  1UKG A;  2WAB A;  1SHW B;  3AJY A;  3LPF A;  2GSY A;  4JGY B;  4C8D A;  3C3V A;  3MIB A;  2B7Y A;  3LAG A;  5CYY A;  1H30 A;  3T2O A;  5T3N A;  1QOT A;  2YY1 A;  2Y0I A;  5D8A A;  1G9B A;  2WT2 A;  3WLU A;  4L11 A;  3RZJ A;  1RMU 1;  2IFR A;  5ANN A;  5FY7 A;  1IQA A;  4Z2W A;  2W91 A;  1UXX X;  4BQY A;  5E89 A;  3IMM A;  4EV0 A;  3AXD A;  5LA9 A;  2YUE A;  5FWJ A;  5FLI A;  5K4L A;  1VAL A;  1ZRF A;  1VBB 1;  5C5T A;  4XF3 A;  1AR6 2;  4PDW C;  3VBU A;  5A3T A;  1PZ7 A;  2R07 2;  3ZFF B;  4B7E A;  1AR9 3;  2GZW A;  1M06 G;  1C8M 2;  1MZF A;  5BNP B;  3U78 A;  1XYN A;  3DPR B;  4XDO A;  1S4C A;  1ODM A;  5FDB A;  5K8S A;  4D0Q A;  3JD7 1;  1RUC 1;  2P3Y A;  2QQK A;  1RUI 1;  2WYF A;  2XLF A;  3FBM A;  3POB A;  4IE7 A;  4CTE A;  2Y8K A;  2ZKN A;  3BI3 A;  4A2U A;  5KHG A;  1RUH 2;  2XB6 C;  4HKL A;  3WDY A;  3AKT A;  1UX6 A;  2D3S A;  1R09 1;  1D4M 2;  2GAL A;  1WW7 A;  5LB6 A;  3WNO A;  4K1Y A;  2AC1 A;  2A7A A;  4MET A;  1NT0 A;  2FQP A;  5IVB A;  1YFW A;  1QJY 1;  3AX4 A;  3RYP A;  4BOW A;  3PVE A;  1I9R A;  1C3H A;  3AVR A;  5HXV A;  5BNO C;  2B8M A;  3MLK A;  4QQP A;  5LBB A;  3KLS A;  1CAV A;  1POV 1;  1VBD 1;  2ZHK A;  3E5U A;  4NIG A;  4HBN A;  1HB1 A;  1W8U A;  3E6C C;  1QXP A;  2VW2 A;  3DF0 A;  4IEQ A;  1FOD 2;  2VMC A;  3TEY A;  3ZPY A;  4R8H A;  1VRH 3;  3GGL A;  4XEZ A;  2MEV 3;  1AR7 2;  2BP6 A;  2WZR 2;  4NAO A;  3AMP A;  3FN9 A;  3KT7 A;  3GJB A;  2FDK A;  3VKL A;  1NAE A;  3GBW A;  3C7G A;  5DZE A;  3V65 A;  1YQC A;  4R9A A;  1YYN A;  1JUH A;  1W9W A;  3H3L A;  4AHY A;  1OD5 A;  1RHI 3;  4ATE A;  2W1S A;  4M3C A;  3TWI A;  4KMQ A;  1OOP A;  4OUM A;  1KDK A;  3III A;  3WG1 A;  2ZTN A;  1RUG 2;  2WA4 A;  2H0B A;  3DXU A;  4MHR A;  3ZSE A;  5BNQ A;  5FUI A;  3W20 A;  4I02 A;  3KHB A;  4IDZ A;  2WC2 A;  5J09 A;  2VCA A;  3J7L A;  3WW1 A;  4MGS A;  5FMD A;  2KXL A;  3CHX A;  3AYC A;  3AXE A;  2EIE A;  1NXD 1;  2PTM A;  3VB9 A;  3AZY A;  3ZFE C;  3UKN A;  4P08 A;  3WNK A;  1KGY A;  4B7K A;  4ASL A;  2C9A A;  5J7M A;  4D6Q A;  5J3U A;  5B4N A;  5DG1 A;  4WZC A;  5BNN A;  2FDI A;  1JOB A;  3U07 A;  1RUI 2;  2IXK A;  3RFR A;  5CFD C;  3WF2 A;  2AZ5 A;  2O0O A;  5KC5 A;  2FDJ A;  4LA3 A;  1RUE 2;  2XWB B;  1MR5 A;  3ZXK A;  4F3J A;  1WBF A;  2Y64 A;  2WDB A;  3FJS A;  3KQ4 B;  1UQX A;  3VDC A;  2JWP A;  1PO1 2;  2VUJ A;  2GC1 A;  2Z4F A;  3HMY A;  4ORF A;  5JUV A;  2PN5 A;  4TWT A;  1OLQ A;  5DAW A;  3ST7 A;  4D69 A;  2XL9 A;  1DGL A;  3VZJ A;  4JDN A;  3NV4 A;  4AFA A;  1CR7 A;  4YNI A;  2JDH A;  2OQ7 A;  4AED A;  4CU9 A;  2WNE A;  1A78 A;  5L9R A;  2G4I A;  2Y60 A;  4PIY A;  4QB1 A;  5I0S A;  3HIF A;  2VZS A;  1PGW 1;  2RJ2 A;  3ZLI A;  2G9Z A;  4AI3 A;  2BGO A;  1G9A A;  3QOP A;  2Y6J A;  1NCQ C;  1WCS A;  2D44 A;  1EY2 A;  2XJV A;  3NVC A;  3PVB B;  5CVR A;  1W9T A;  4OHV A;  1ASJ 3;  1US3 A;  1YI7 A;  2UY9 A;  1UU5 A;  2WBK A;  3GJA A;  3VBU B;  2Y26 A;  3DV8 A;  2VMG A;  3GCW A;  2OT7 A;  4RYD A;  4DS0 A;  2VGD A;  1EYB A;  3T3Y A;  5JCT A;  4B1L A;  1CAX A;  4U36 A;  3ILN A;  2Q8D A;  2ZGT A;  3RMX A;  1Q43 A;  1SLC A;  4AHX A;  2NMO A;  2ZGS A;  4I09 A;  4MGI E;  5LA0 A;  3LOI A;  3NL1 A;  5CZK A;  1HV1 A;  1W28 A;  5EWS A;  3AFK A;  3ASI A;  5DXD A;  2VZP A;  2YGL A;  5B4X A;  1JZ7 A;  1UZZ A;  2XOM A;  2XBO 2;  4CU8 A;  1VRH 2;  4TYS A;  3I2J A;  2VZ3 A;  5C8W A;  1LTE A;  1DG6 A;  3EB7 A;  3OBT A;  5FZA A;  2WS9 3;  4FBF A;  2FZ1 A;  5JDB A;  3E6D A;  1GQG A;  1LHV A;  1H1A A;  2CTV A;  4XAB A;  5FMC A;  2W39 A;  2Z79 A;  3CF6 E;  4XFB A;  5A7O A;  2F4P A;  3VHR A;  3ETQ A;  3I3M A;  4XAE A;  4QDQ A;  2DUP A;  1OUR A;  2W95 A;  4D7Y A;  1LOC A;  4I0A A;  3ZXF A;  1ZVF A;  2Y34 A;  2ZAC A;  1O8P A;  1W6P B;  4DRV A;  5A6Y A;  2X29 A;  1RUE 1;  3TRS B;  4Q26 A;  2K9Z A;  2VZU A;  4K20 A;  4XFH A;  4R9D A;  2YB7 A;  3BIW E;  1DQ0 A;  1HXS 3;  4LBO A;  1W9F A;  1JYI A;  3WHU A;  2GNM A;  2DBN A;  1G7Y A;  3MLL A;  3EJK A;  4IV1 C;  5CA6 A;  3EMR A;  3V0A A;  1NLQ A;  4XIO A;  2J1E A;  5E88 A;  1GWK A;  5FZ0 A;  5GZE A;  1ZNP A;  5B2G B;  3NV1 A;  1JYT A;  4FP2 A;  1DIW A;  2BWC A;  4ASM B;  5BV6 A;  2MEV 1;  3BPZ A;  4QU2 A;  3VBH C;  2JD4 A;  4XJZ A;  4NRM A;  1EAH 2;  3N7J A;  2YZ4 A;  3GZE A;  1W6P A;  2VCB A;  2JG9 C;  2V09 A;  3T09 A;  2BJS A;  1YLL A;  4MZU A;  1QF3 A;  4CP2 A;  4MHU A;  1LR5 A;  2UWA A;  1MS1 A;  2ENR A;  2C24 A;  4N43 B;  4XW3 A;  2WN2 A;  5C9A C;  1ONA A;  4QQH A;  5IAT A;  1MS0 A;  3GBF A;  4FPL A;  2WNU B;  3TNQ A;  2RS5 3;  1FV2 A;  3JBG 2;  1EV1 2;  5T5J A;  1KS4 A;  4HZF A;  1XNC A;  1JZ8 A;  2WRA A;  2R0H A;  2VE1 A;  4PBP A;  4OHX A;  2ZAB A;  1QJF A;  3ME2 A;  4Q0Q A;  4PQ9 A;  2CL2 A;  1H2K A;  1HXS 1;  2ZGR A;  2PAE A;  3DN7 A;  2I74 A;  3IB3 A;  3LA3 A;  4UYB A;  2LUW A;  4RR3 A;  4W4Z A;  3H42 B;  4N90 A;  3ZMO A;  3NAP A;  4LR4 A;  4UW6 A;  3ZPO A;  2VQU A;  5IVE A;  3GZT B;  1QQP 1;  1OLM A;  1KXG A;  2RS1 1;  2ZHM A;  4IL7 A;  4JRA A;  2TNF A;  4N43 C;  3SH4 A;  4Q8L A;  2WT0 A;  3OY8 A;  2VVE A;  3NW4 A;  4AQS A;  1LED A;  1W6Q A;  3AP5 A;  3DPR C;  1AXZ A;  3ZMN A;  2P5B A;  1U5Y A;  1LEM A;  4IE6 A;  3DKW A;  4CUA A;  5T52 A;  1GR3 A;  3SH3 A;  1YJL A;  2CGO A;  2JG8 C;  5I0D A;  3TN9 3;  4HVQ A;  3HN3 A;  4NHK A;  3HNB M;  1V9U 2;  1VIW B;  1JZ3 A;  1HRV 3;  2HH9 A;  3T30 A;  1J59 A;  2VTX A;  4COZ A;  2WII B;  3OPZ A;  5FO8 B;  1ACC A;  2GU9 A;  1UOG A;  4XC9 A;  5T50 A;  3V56 A;  2BWA A;  3IAP A;  5FPA A;  2W94 A;  4RFR B;  4QKF A;  1SFN A;  2D6P A;  2BYV E;  2UU8 A;  1AX0 A;  4A7Y A;  4FOV A;  1W6N A;  2YG0 A;  1WLC A;  3AP9 A;  2HWF 3;  1K5M A;  5BXX A;  3AMQ A;  3PTY A;  2HWF 1;  1A8D A;  2FBE A;  3Q8B A;  3HQX A;  3VBO C;  1AXK A;  3OYW A;  5CFC A;  1D0H A;  4ONU A;  3N9Q A;  4R4X A;  3HBZ A;  1TEI A;  1YJK A;  3GBG A;  2VMH A;  3IMN A;  4IE0 A;  4HOO A;  5DQ0 A;  5BNP A;  1HQW A;  3RZM A;  5JXG A;  1Y9M A;  4M00 A;  5T5P A;  1QJU 2;  3TNP B;  4CRQ A;  1O5L A;  2WJS A;  1L7R A;  3PVN A;  1HB4 A;  2VTX J;  5LBF A;  2GP3 A;  3W9A A;  1F4H A;  1FPN 2;  5CKN A;  4CUG A;  4SLI A;  1L7L A;  1O6U A;  1SFP A;  2JDN A;  5K0U C;  1TG7 A;  4FFF A;  4A42 A;  1WUV A;  1DLC A;  4YG6 A;  1G9C A;  2CYF A;  3VN4 A;  3T0A A;  5AVA A;  4ASK A;  3H3U A;  4AE2 A;  1UOF A;  2PHX A;  1ULF A;  4D7S A;  4JQR A;  4QHZ A;  3BYW A;  2VME A;  4XHB A;  2VUD A;  4RGG A;  4GB3 2;  5A3W A;  3O1V A;  2W5F A;  2P1B A;  2WZ8 A;  4KBB A;  1POV 3;  4Q4W 1;  4GB3 3;  1EV1 3;  4LHL A;  4BDV B;  5LAS A;  1QGL A;  4CCC A;  4DXZ A;  4JTN A;  2NN8 A;  2JE8 A;  3LDB A;  2VMF A;  1H6Y A;  2ZX4 A;  1RYY A;  3P5B A;  5FPU A;  2WSV A;  3DKQ A;  3PUR A;  4LK7 A;  5DUV A;  4RHV 1;  5SV5 A;  1XB9 A;  1Q8Q A;  1T6G C;  2ZML A;  3S57 A;  1IS5 A;  2FMY A;  2HWD 3;  1A3K A;  1KEX A;  1RIR A;  2DCT A;  2BU9 A;  2XKP A;  5BNP C;  3HR9 A;  3BPS A;  3AJZ A;  1XE7 A;  3A0N A;  3VZK A;  5JPM B;  2IXH A;  3J9S A;  5KXD A;  1BBT 2;  4YVW C;  4Z2A A;  5FBJ A;  1PHM A;  3MIH A;  4LA2 A;  3BTZ A;  2BZD A;  2BV4 A;  3JB4 C;  4GA9 A;  1GOF A;  2VZQ A;  4WZF A;  5FYV A;  3RYR A;  2IXL A;  2E7A A;  1VBB 3;  2WO3 A;  2VVD A;  3AMH A;  4IEU A;  1CZS A;  1XNB A;  3U4S A;  3VBR C;  1DYO A;  5F7U A;  1W99 A;  3I2K A;  4LEJ A;  1PM4 A;  4O7X A;  5GZF A;  4A45 A;  1AZD A;  5FZ8 A;  3J8F 2;  4CCE A;  1PGS A;  3MGU A;  2ARB A;  3WNP A;  3WXP A;  1UCX A;  3RZK A;  3B7M A;  1APN A;  5FBZ A;  4AEM A;  3HWJ A;  3LSD A;  4O65 A;  3LEM A;  3UNP A;  3JQW A;  3CZJ A;  3WT3 A;  4OQ9 A;  1O59 A;  2D6O X;  4XUQ A;  3WCR A;  1E5S A;  2WWJ A;  4QPG A;  4AI8 A;  2ADD A;  4XHX A;  1HV0 A;  2VUA A;  5EJZ B;  3MW3 A;  3VKM A;  4F83 A;  1A34 A;  3TOJ A;  4LO5 B;  4H2A A;  3URF A;  3WG2 A;  1DGR N;  4A41 A;  4QHB A;  2VQ0 A;  4XMA A;  5F3I A;  3AK0 A;  1W9Y A;  4BHP A;  3MEP A;  1SDW A;  5A3N A;  1GFF 2;  1B35 C;  3ENR A;  5A7N A;  3H9A A;  2JDP A;  1ZBE 3;  2HBT A;  2LRO A;  4IW3 A;  3ZFG A;  1LGB A;  1VE0 A;  4UWD A;  4CP9 B;  2Y6K A;  2WKK A;  2OX0 A;  5IVY A;  3ILR A;  1RUJ 2;  1GWL A;  4ZPI A;  3PUI A;  2G19 A;  3VDD C;  5LEJ A;  2Z5W A;  4RHV 2;  2YV8 A;  1VBE 2;  4LOT A;  3AC0 A;  4RHV 3;  1PO1 3;  1SLT A;  2XJP A;  4QX7 A;  4YPJ A;  1PZ9 A;  5ANQ A;  4CEW B;  5FMO L;  3MW2 A;  3ON7 A;  4XTM A;  3D0S A;  1SQ4 A;  4CCO A;  3FHI B;  1OOP B;  1OVP A;  3CQO A;  2VBP A;  3LIG A;  3M3C A;  2XPJ A;  3WNM A;  2DCJ A;  2QZ3 A;  2ZA9 A;  3O12 A;  4G4F A;  3CJX A;  3K3N A;  3T4H B;  1WA4 A;  1RUD 2;  5APA A;  1SCS A;  2Q1F A;  1S0D A;  2ZX3 A;  1F35 A;  4L0P A;  5E1R A;  1D4V B;  3OPT A;  4A3X A;  3NNG A;  4FTB A;  3HOB A;  4F8A A;  2R49 A;  1VMH A;  4QWN A;  5A32 B;  2DCY A;  2VUC A;  4BU2 A;  2YGM A;  3KM5 A;  2A5Z A;  3JXS A;  3ZXL A;  3DPR A;  5FZ6 A;  4MXV A;  1IS4 A;  5FPV A;  4H7L A;  1QWR A;  4COV A;  1B35 B;  2D5H A;  2FMD A;  3ZN4 A;  4ARX A;  1V70 A;  5LWB A;  5EXO A;  5L7O A;  5FPZ A;  2F4L A;  1RHI 1;  2ZGQ A;  3LEI A;  2VBD A;  4UW5 A;  1O5U A;  5F3C A;  2ZGO A;  4BPZ A;  1QNY A;  4KU7 A;  1V9U 1;  2XVL A;  1JXN A;  3VLB B;  2QQL A;  3ACI A;  2ZOE B;  3RS6 A;  1PVC 2;  1BHG A;  2JJ6 A;  4XCA A;  1JN2 P;  3ALQ A;  1XNK A;  3H1Y A;  3B9C A;  3VV1 A;  1UYX A;  2H0V A;  5F6L B;  4LT5 A;  4CUC A;  3KF5 A;  1XSR A;  4MSV A;  1MPX A;  1QKQ A;  4LPL A;  5JVV A;  4ZZ5 A;  1J58 A;  3IPV A;  3K4D A;  4LOR A;  2E63 A;  1WGP A;  4CEW A;  4Q4W 3;  5C3S A;  1ALY A;  1RUJ 1;  5EFU A;  4QGM A;  2C4X A;  5F8P A;  3DYP A;  2EIC A;  4FOQ A;  4DMI A;  1RVF 3;  2OKX A;  1DZQ A;  1LU2 A;  4XUT A;  2VQA A;  4N9I A;  1W8O A;  2DVB A;  3D6E A;  1OF3 A;  4FFI A;  4DNY A;  3R0R A;  3TEW A;  4LNV A;  1AUY A;  1JYW A;  1D4M 3;  2XJR A;  4QPI A;  2PEL A;  3VKN A;  4LBJ A;  4GH4 A;  2R04 2;  4BQ2 A;  3RVH A;  5FRE A;  4PI2 A;  4DXT A;  3AKQ A;  2W3J A;  1F15 A;  2EXK A;  3NAP B;  4HMZ A;  4OYU A;  3ZVX A;  5IHR A;  4Q4W 2;  2ZAH A;  4MGT A;  1EP0 A;  4DOU A;  1RXF A;  2YDE A;  3NKT A;  3CLP A;  3HJR A;  4LTA A;  4Y5Z 0;  3R6S A;  5GLW A;  1GOH A;  3WP5 A;  4BA6 A;  2CV6 A;  3J26 N;  1ZRE A;  2BVV A;  1Q8V A;  1SCR A;  3J7N A;  4ES9 A;  3NO8 A;  3U14 A;  4GD4 A;  4JZR A;  2AH2 A;  4ZS2 A;  3KD4 A;  1LOE A;  1OQ1 A;  2D40 A;  4Q4Y 2;  5JMO A;  1AYN 3;  4WV8 A;  1H8T C;  4XDP A;  1CON A;  2W87 A;  5JOW A;  4QX2 A;  1C8N A;  2QDR A;  1N1S A;  2CDO A;  1BBT 1;  3LEG A;  3L9J T;  3OB8 A;  4H7M A;  3S7E A;  4CUB A;  1GNZ A;  4ITC A;  5F5I A;  2WUH A;  4P5H A;  3T4V A;  5FYC A;  2RE9 A;  1RUE 3;  2I45 A;  4QQO A;  3N7L A;  5IJR A;  2Q8C A;  1CZT A;  2HWC 2;  4CEW C;  1HRV 1;  3INA A;  4I3P A;  1AYN 2;  1KRI A;  3WR0 A;  2W68 A;  5D1I A;  3ZSK A;  3Q8E A;  4R9C A;  3FUO A;  1NLS A;  4QM9 A;  4M3C F;  1LGN A;  3ZFG C;  5I8Y A;  1RUF 3;  4L92 A;  3OGS A;  5GLU A;  1RUF 1;  4P9J A;  4X8P A;  5FZH A;  3J4U H;  1AJK A;  1LOA A;  4FPJ A;  3VD7 A;  4IV3 C;  1HB2 A;  3JUU A;  1X36 A;  4XMI A;  4E8D A;  1TQ5 A;  5DMY A;  3LDR A;  5FOB B;  4GWN A;  1ZZ9 A;  2QKD A;  3OGV A;  2WNU C;  4PIX A;  4Z07 A;  4CVU A;  1A6C A;  1KS5 A;  4Y4R A;  1RUD 1;  3F2Z A;  5AVP A;  3PNA A;  2XML A;  1UMI A;  5EHD A;  5L7O C;  3IBM A;  4XF9 A;  2XON A;  4CDU B;  2XGX A;  5FZG A;  1W8H A;  1CJP A;  1UU6 A;  3ZN6 A;  1XRU A;  2JG8 A;  1CAU B;  1ULO A;  2XJT A;  3ACL A;  4FP3 A;  3O1S A;  2IVI B;  1REF A;  4FVV A;  4OI1 A;  3ZFG B;  4LBQ D;  3QLQ A;  5HV0 A;  2AGS A;  5I0R A;  1QJX 3;  2V4V A;  1VLN A;  2PHU A;  5DAX A;  3UKT A;  2WNV A;  3WP4 A;  5ACA 3;  2CGP A;  1XOY A;  1AL2 1;  1E5H A;  2TBV A;  4IQP A;  3AKP A;  3FC0 A;  4QPG B;  3O0V A;  2GDF A;  4XAC A;  1WD3 A;  3WW3 A;  2DBI A;  3ACF A;  4NIA A;  3MO4 A;  4GKY A;  1JUI A;  4J1W A;  5FCC A;  5EJ1 B;  1XJA A;  1XXN A;  5IK4 A;  2XJS A;  4A7K A;  2D6M A;  1BMV 1;  2JG8 B;  2W52 A;  4OUS A;  5BYN A;  1O4Y A;  3VZO A;  1F2N A;  5IVF A;  2OW4 A;  2YBS A;  1AR9 1;  3GHN A;  5CFC C;  5JI7 A;  1ENS A;  2QZ2 A;  2DTW A;  3L2Y A;  3UK9 A;  1JZ6 A;  1AF9 A;  5F5C A;  5FPX A;  3A4U A;  4C91 A;  4XZU G;  1VB2 A;  4BWO A;  1IG3 A;  2TEP A;  5IUQ A;  1QJX 1;  4PBO A;  4V1P A;  5HV4 A;  4MO3 M;  2VPV A;  1QDO A;  4NRP A;  5DDJ 2;  5DUX A;  3WQ7 A;  1NQD A;  1Y4W A;  4MVT A;  2E6V A;  4NHX A;  2EF6 A;  4QX8 A;  5D21 A;  1AR7 1;  2VEC A;  2B45 X;  1KFU L;  3C7F A;  1J1L A;  1PMI A;  1COV 2;  1FMD 3;  3B5L B;  2FDG A;  2W9X A;  1DHK B;  2OVU A;  2DWR A;  5LY1 A;  4PLO A;  1XNA A;  2ZEW A;  3KCC A;  5IYY A;  1OLM E;  1XND A;  5H9P A;  4YM2 A;  1LOB A;  1D2Q A;  1RUN A;  1Y43 B;  2E51 A;  4IV1 A;  2BFU S;  4DIQ A;  3JQX A;  1DYK A;  4JTO A;  3M70 A;  4QGL A;  5CNA A;  5DZG A;  4YRD A;  4YW7 A;  2R06 2;  4CDQ C;  3BAL A;  1PGW 2;  3R05 A;  1RUG 1;  3KMH A;  1JOP A;  1G9D A;  4DPN A;  5CFC B;  3FLT A;  1W6M B;  4JGZ C;  1QMJ A;  4MXW A;  1COV 3;  1FMD 2;  3KQR A;  1CVN A;  3POG A;  2D6L X;  2E9Q A;  4EZH A;  3LPG A;  4FTE A;  2HWD 1;  3I4I A;  2WA3 A;  1W2O A;  3KS7 A;  3VBS C;  3NWK A;  3MPB A;  5IK8 A;  3RQ0 A;  4IEX A;  1CPM A;  3KV5 A;  3MDP A;  4NPM A;  1F8V A;  2DVG A;  1Y9Q A;  1UYP A;  4IXL A;  4XBQ A;  1F4A A;  1V6O A;  4M3C B;  2XBO 3;  4N53 A;  4Q4X 3;  1W8N A;  2FCT A;  2YYO A;  2WZE A;  1QQP 3;  5L19 A;  4Y1V A;  1Q56 A;  1VBD 3;  1O3Q A;  5C3Q A;  2NP0 A;  1POQ A;  2P34 A;  4WM7 C;  3RSJ A;  1VBD 2;  2XL7 A;  2GND A;  3JBG 1;  1WCK A;  5DN2 A;  5KBF A;  1BEV 2;  4QXC A;  3NJV A;  1QJX 2;  4WVM A;  3R4D B;  3RMY A;  3ZDV A;  4CDU A;  2JDY A;  3WUD A;  1CIY A;  3EBR A;  3OY8 B;  4E4D X;  4Z1V A;  5JZG B;  5EYX A;  2H6C A;  2HEY F;  2ZGM A;  2AAC A;  1H9W A;  1Q8S A;  1U5X A;  5F37 A;  1NUK A;  2E26 A;  3HPN A;  4LBM A;  4CDQ A;  1PMJ X;  3B69 A;  5H9R A;  4HKW A;  4BME A;  1K5M B;  1R08 3;  1C1L A;  3B00 A;  1HN1 A;  3WW4 A;  2ZGN A;  4QX1 A;  3T0B A;  1NA1 A;  1NY7 2;  3WDU A;  4KGQ A;  3SKV A;  1IKQ A;  3MID A;  1Y9G A;  1KJL A;  4RGK A;  2WAO A;  5J96 B;  2VJX A;  3DGT A;  3DYM A;  3WQB A;  1JZ5 A;  1CGP A;  2EA7 A;  2XQX A;  1VRB A;  2WNU A;  1IKP A;  1CAW A;  2HKX A;  3W59 A;  2K46 A;  2AEZ A;  3OG2 A;  3RWK X;  3OJB A;  4N43 A;  3THC A;  3N36 A;  2C0Z A;  4YYO A;  4C1X A;  4CDU C;  1WCU A;  3ZXG A;  5BUV A;  2XVK A;  5H9S A;  1X33 A;  1QXR A;  1SDD B;  3W21 A;  1MQT A;  1AX1 A;  1TME 2;  3I59 A;  4PF1 A;  3SMH A;  3U75 A;  2P37 A;  1RJ8 A;  4L9B A;  4BM8 A;  4NN0 A;  5KHK A;  1CQ9 A;  3I2I A;  2UY8 A;  1C5I A;  3AL5 A;  3RZZ A;  1UZY A;  1V6L A;  2QVS B;  2XG3 A;  3D8C A;  4YW6 A;  3WDT A;  1C5H A;  3MHZ A;  3WZ1 A;  2B42 B;  3ZFE B;  1UZW A;  2A6W A;  1RTV A;  1TVG A;  2CHH A;  2J1U A;  5FZ7 A;  5ISL A;  1UO9 A;  1YIP A;  2VQT A;  1PO2 1;  1PIV 2;  5FYH A;  4AG4 A;  1QHD A;  3T2Q A;  3USU B;  1P8J A;  2VMD A;  2X10 A;  5A1L A;  2XH6 A;  2IWG B;  1CX1 A;  2E32 A;  2JEN A;  1YC6 1;  1I3H A;  4QXH A;  3TEX A;  2WQ8 A;  4EE2 A;  1TE1 B;  4WM8 C;  2R32 A;  5JI9 A;  4V2V A;  1NG0 A;  4FQZ A;  1MS9 A;  5J98 B;  1XNT A;  1DZT A;  4KU8 A;  5A7W A;  4YFW A;  1WZX A;  3T2P A;  3K3O A;  2GMP A;  4BCU A;  3JZV A;  4Z82 A;  4FCA A;  5G05 L;  3MPP G;  3VDD B;  1JZ4 A;  1S2B A;  1TMF 3;  5FOJ B;  2CWS A;  2IXJ A;  4ISQ A;  1UPI A;  2JDK A;  2ATF A;  1S0I A;  4NHY A;  4QAW A;  3D82 A;  2C26 A;  4K1Z A;  2OII A;  4G3Y C;  4P9Y A;  3USU A;  5A3L A;  3LA7 A;  4ZKT B;  3M3E A;  5HBA A;  3OUJ A;  1WMF A;  2DFB A;  2HBU A;  1SLL A;  4N8M A;  2EXH A;  4CDX A;  1E5R A;  3S7I A;  5KC6 A;  4CXX A;  4HT1 T;  2GNT A;  4QKB A;  1FXZ A;  2ID4 A;  2HWF 2;  2ZKL A;  2FDH A;  4HON A;  1ND3 B;  4ZON A;  4IEO A;  4M01 A;  4CZS A;  4O9G A;  3AKR A;  5JOX A;  4JCK A;  3SH5 A;  5DPN A;  1H1M A;  1NQJ A;  5F2S A;  3M3O A;  4EWA A;  1FV3 A;  4MGQ A;  1UY0 A;  1DQ4 A;  2IC1 A;  3OD4 A;  5FZF A;  4Q8K A;  4XFA A;  4CP0 A;  1ZBA 1;  4OUE A;  1UWW A;  3OGR A;  4AWD A;  1HRI 1;  2AYH A;  4DUX A;  1ZRR A;  5LRR A;  3CEW A;  4KWL A;  1CAW B;  1W8Z A;  2ZAA A;  4CCN A;  1Z7S 1;  4S2D A;  5FXW A;  1V6J A;  1OFN A;  1ZZ6 A;  2VNO A; 
#chains in the Genus database with same CATH homology
 5FZD A;  4CUG A;  2Q8E A;  4Y4R A;  5FZC A;  3OPT A;  5F37 A;  2XML A;  5A7P A;  3KV4 A;  4CCL A;  4EZ4 A;  5F5A A;  5E6H A;  4QWN A;  4CCK A;  3PU3 A;  5FZG A;  3N9N A;  4BU2 A;  2YU2 A;  4ASK A;  5FZ1 A;  5FP3 A;  4BXF A;  3PUQ A;  4LXL A;  5FZ6 A;  5FY4 A;  2YBP A;  5FXV A;  2GP5 A;  5LY2 A;  5FPV A;  5FZE A;  5A3W A;  5FY8 A;  4E4H A;  5LWB A;  1VRB A;  2PXJ A;  5FPL A;  5FZ0 A;  5A7W B;  4LIT A;  3KV6 A;  5FJH A;  4V2W A;  5FWE A;  5F3C A;  3LDB A;  2W2I A;  4IGP A;  3KVB A;  5FP8 A;  2XDV A;  3PDQ A;  5FYI A;  4QXB A;  5FJK A;  5A7S A;  5FPU A;  5IVJ A;  3DXU A;  3PUR A;  5FXX A;  5FYY A;  5KR7 A;  5IWF A;  5FZI A;  4AI9 A;  5FZ4 A;  5FP4 A;  4GJY A;  5FZK A;  5IVF A;  2YBS A;  3PTR B;  3AL5 A;  5F2W A;  2WWU A;  3NJY A;  5FZM A;  3K2O A;  4TN7 A;  4LIV A;  5F5C A;  5FP7 A;  4D6Q A;  5FY0 A;  4AAP A;  4Y33 A;  5F39 A;  3N9O A;  5FZ7 A;  4CCM A;  5ISL A;  4UF0 B;  5FBJ A;  5FUP A;  4EYU A;  3KV9 A;  5FZL A;  5FZB A;  3PUS A;  5FY5 A;  5FYV A;  5FUN A;  5FYH A;  3PUA A;  5A1L A;  4QX8 A;  3AL6 A;  4QXH A;  4UF0 A;  3ZPO A;  5A3P A;  4IGO A;  5IVE A;  3U4S A;  5FZ9 A;  5A1F A;  4V2V A;  3RVH A;  5LY1 A;  5FV3 A;  4C8D A;  2XXZ A;  2OQ7 A;  4IGQ A;  2P5B A;  5FZ8 A;  4GJZ A;  5A7Q A;  5A7W A;  5FY9 A;  4DIQ A;  3K3O A;  4DO0 A;  5FPB A;  4CSW A;  5FY7 A;  5A80 A;  3ZLI A;  3KVA A;  4GD4 A;  2WWJ A;  4Y3O A;  5FWJ A;  5K4L A;  2XUE A;  5A3T A;  5IW0 A;  4NUB A;  4CCJ A;  3N9L A;  3AVS A;  5F3I A;  4EZH A;  4LIU A;  2OT7 A;  4BIS A;  5FY1 A;  5FXZ A;  5FPA A;  5A3N A;  4QU1 A;  5A7N A;  4XDP A;  5FYU A;  3U78 A;  5CEH A;  4XDO A;  5FYM A;  5IVV A;  5FZO B;  5IVY A;  2OX0 A;  3KV5 A;  2Q8D A;  4HON A;  5FYT A;  5F3G A;  3UYJ A;  5F5I A;  3PU8 A;  5FZ3 A;  5FYC A;  4URA A;  3N9M A;  2Q8C A;  2OS2 A;  3N9Q A;  5FYS A;  5FZO A;  5FP9 A;  2YPD A;  3N9P A;  4QX7 A;  2VD7 A;  2YU1 A;  5ANQ A;  5F2S A;  5F32 A;  5FZA A;  4HOO A;  3OPW A;  5IVC A;  5FZF A;  3DXT A;  5IVB A;  5A7O A;  4GAZ A;  4CCO A;  3LD8 A;  2OQ6 A;  3AVR A;  4D6S A;  5LW9 A;  5FZH A;  5FYB A;  2YBK A;  4QXC A;  3K3N A;  5F3E A;  5FYZ A;  4CCN A;  2GP3 A;  4D6R A;  5FXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...