5F3GA

Crystal structure of human kdm4a in complex with compound 53a
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
339
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
total genus 107
structure length 339
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3gA01
4EZ4A 5FUPA 5FXXA 4DO0A 4XDOA 4IGQA 5FP4A 5ISLA 5FY8A 2Q8CA 3AVRA 4IGPA 4CCOA 5FXVA 2YU1A 5K4LA 4CCKA 3U78A 4QXHA 5IVVA 3RVHA 4QWNA 5FPBA 5FYZA 4LIUA 5FP8A 5FYSA 5IVFA 2GP5A 4LIVA 4DIQA 5FZ3A 5FZ4A 5FJKA 3N9QA 4D6RA 2XMLA 4Y33A 4GAZA 3PUSA 5FYCA 2YBPA 4EZHA 5FZ6A 5FP7A 5FUNA 5A7QA 5FWEA 4CCJA 3ZLIA 4CCNA 5FZEA 4D6SA 5LWBA 4LITA 3DXTA 2OT7A 5A80A 2OX0A 5FYUA 5A7SA 4CSWA 5F2SA 3PU3A 5FZOB 5A3TA 4ASKA 4QXBA 4AAPA 2P5BA 5FZAA 4LXLA 2GP3A 3N9LA 5A3PA 5FZGA 2YU2A 5F32A 5FY7A 5FPLA 5IVEA 5A3WA 5A7PA 5FYIA 5FZBA 5FZKA 2WWJA 4V2WA 3PTRB 5FZMA 5F5AA 5IW0A 3LD8A 5FYVA 3PUQA 5IVCA 5IWFA 5FP3A 5A1FA 5F3EA 4C8DA 4BISA 2OQ7A 4BU2A 5FXWA 3KVBA 5E6HA 4AI9A 3KV6A 3N9PA 5FZDA 3AL5A 5F3GA 5FP9A 5FYYA 5FZFA 5FZLA 4CCMA 3OPWA 4URAA 4GJZA 5FYMA 5F5IA 4EYUA 4UF0B 3AVSA 4BXFA 4CCLA 5FJHA 4V2VA 3LDBA 5FZHA 3AL6A 5KR7A 3DXUA 4QU1A 5A7OA 2YBKA 2PXJA 3KV5A 5FY4A 5IVJA 5FBJA 5FZ1A 4XDPA 4Y4RA 5FZ8A 3N9NA 3N9OA 5A7WB 5IVBA 2VD7A 4HONA 4QXCA 5FZ7A 5FZIA 3PDQA 5FYHA 2WWUA 2Q8DA 3K3NA 5FXZA 5A7NA 5F39A 5FZ0A 5LY2A 5A3NA 4IGOA 5FPUA 3PURA 3PU8A 3KV9A 5FY9A 4GD4A 4Y3OA 5F3CA 2Q8EA 5FYTA 3PUAA 5FPAA 5FPVA 3OPTA 2W2IA 4QX8A 4D6QA 3KV4A 5CEHA 5LW9A 2XXZA 4HOOA 5F3IA 3K3OA 3ZPOA 5F37A 2YBSA 4GJYA 4UF0A 5FY1A 2OS2A 5A1LA 5A7WA 5FV3A 5FYBA 5FY0A 5F5CA 5FZCA 3UYJA 5FWJA 5FZOA 3U4SA 4E4HA 4QX7A 4CUGA 5FZ9A 2YPDA 4NUBA 5F2WA 5IVYA 1VRBA 3N9MA 5ANQA 2XDVA 5FY5A 3NJYA 3K2OA 5LY1A 4TN7A 2XUEA 2OQ6A 3KVAA
chains in the Genus database with same CATH superfamily
2EIEA 4QB1A 5FBZA 3IDAA 5CB7A 3VBRC 2HWE3 2XJVA 2P3JA 2PTMA 4OHYA 1AL22 2IWGB 4L97A 4GXLA 1BVP1 2GC0A 1ZZ7A 3JZVA 4CCEA 2B9UA 2QQMA 5BUVA 2FCVA 2BNNA 1CAXB 5ACA2 1OH4A 5FZ3A 2PHRA 1YFXA 1KXGA 3A22A 4N43B 3RWNA 4A7KA 1RUI1 2C6SA 2Y34A 4FI9A 4XXPA 1FOD1 2BBAA 1UL9A 1VPHA 3AMMA 3OGSA 3RG0A 4OI4A 2A6XA 5BPXA 4QM8A 1GNZA 3OY8B 2FCTA 4N90A 1TVGA 2ARBA 4XCBA 2HWF2 1Z78A 4NRPA 5DDJ3 2DVAA 2JG8B 1TNFA 4AK3A 4JC1A 4PHZA 4AFAA 5BNPB 4A45A 1YRZA 4QB6A 2NP0A 1S0EA 4ASKA 3GJBA 3SEPA 1PO22 4XFHA 3N9LA 2ZGSA 3MIFA 2W47A 2D43A 2X5IB 5FPLA 3OTFA 3RNSA 4AI8A 1QJFA 3OGJA 1BBT2 1D4M3 2C9KA 4RQPB 5A7PA 1K5JA 3SC7X 2XUMA 4UW6A 1FMD1 3GGLA 4XQ4A 2YC2A 3LD8A 2WR9A 5LBEA 2V72A 2ZGPA 3ZIXA 1ZZ8A 4HVOA 1W8TA 2YV8A 2UYBA 1PO23 1PM7A 2W52A 3VHNA 1VBE3 1GP4A 1AYM1 1VB2A 3GZEA 2A71A 1YFYA 4JAAA 1SHWB 4WM8B 2VMDA 3TNPB 3ZXEA 2V73A 1NY71 2OPKA 4JDMA 2KA3A 3JU9A 3FHAA 1MVEA 3OG2A 3O1OA 4RL7A 1W0NA 1O6UA 4QHBA 4DRVA 3WG1A 2YY1A 2YBKA 3WQBA 5FK7A 4OUSA 2FMDA 2BEOA 1H1AA 3KGZA 4FO9A 3BTZA 1QNYA 1GWLA 4PF5A 2WNUC 2XHNA 4UFIA 4R8HA 1W6MA 2XJPA 3AP4A 3L2YA 2GDFA 3SH5A 3O1SA 4NOTA 2WZ8A 4MADA 1KQRA 4GD4A 4OZXA 3VBFA 4FBFA 1BZWA 1SLBA 3I59A 3LA3A 3MW3A 4QDRA 5FYTA 3RMYA 3ZYPA 5FPAA 4BDVB 3I3DA 4XJWA 1NKGA 1L7QA 1GU3A 4CPBA 4S2DA 5EWSA 3NRUA 4LA2A 1MZ5A 4IV1C 5I91A 1TMF1 4IEPA 5KHKA 1IOAA 1NQDA 2WZR3 4OQ9A 3UKTA 2BERA 5D2AA 5FZOA 1QJY1 1Y9GA 1UKGA 4D7TA 2I74A 1WD3A 1D7PM 4MGIE 1IPSA 5DZFA 1HRI1 3C2UA 2IXKA 4L0PA 1JYNA 3WG4A 1W9WA 1NXMA 1X8EA 5BNNA 2UU8A 3ZXKA 1QH7A 3KM5A 2I45A 5FXVA 3WP4A 2HYKA 4CCKA 5LEJA 1W6OB 2EIBA 2BWCA 4JTOA 3KZ4C 1WA4A 3WXPA 1SPPB 4BE3A 2HWD2 2Z2SB 4D94A 3RYRA 3SCGA 5J1XA 1LECA 2VNGA 1TEIA 3KWVA 3DV8A 2XMLA 3J4UH 1JZ8A 3PUSA 3RZKA 2YBPA 3RZHA 4XXAA 2ZEYA 2DCTA 1OMIA 2VTFA 2WABA 3E1F1 3WDYA 1ND2A 5I8TA 4Y22A 1LGBA 3MV11 2FDHA 4QPGA 2A3YA 4X8PA 5A6XA 5A7SA 1EP0A 5I0SA 4FQZA 2K9ZA 1NOVA 2TEPA 1HB3A 1B09A 3GXUA 1NZIA 5JPNB 2Q4SA 2WO7A 3E97A 4XYXA 5DDJ2 1D2SA 4FOVA 4LPLA 4CDQA 3PVNA 1W6NB 1F9KA 3PTYA 2YB7A 1YQ6A 3WD5A 4KMQA 3IIAA 4IDZA 3PTRB 4Z1VA 2O0OA 1OVPA 4JGZC 1WCUA 2JDPA 1CZTA 4Q8KA 2EIGA 1UX7A 4R52A 5F6KA 1NCQB 1KD7A 2HH9A 3ATGA 4NHMA 4UAPA 3SLIA 2VR4A 4P9JA 4BXSV 2WKKA 2VM9A 2P6HA 3LFMA 3QD6A 4KG8A 5CU1A 3ZFGB 3ZR5A 5C8CA 1QDOA 5FYMA 1MS3A 4YVSA 5F5IA 1Q8PA 4BMEA 2IUWA 3DKQA 5CFDC 2GZWA 5FO9B 4UW3A 4I0BA 5IUQA 3IBMA 3WG3A 4KQ7A 3V0AA 5HCFA 4W6XA 1COV1 4XF4A 4DMIA 5FOJB 2DBIA 2OIIA 4QQLA 1COV2 3V64A 4CP2A 3L9JT 2JD4A 3D8CA 5C3RA 1RUG1 1ZBA1 4KGQA 2W3JA 4OUEA 4NIAA 5JLVA 1ZBA2 4QPYA 3IDBB 3B94A 2JG8C 1PVC1 2GN7A 2VG9A 3GM8A 1MPXA 4LBNA 4E4SA 1RUD1 3GCXA 3HMYA 3HOBA 3VBHB 4ATEA 3I2GA 4IEUA 4XFFA 5CG8A 2MPFA 4QKFA 1S0DA 1CAVB 2UYAA 4Q4Y2 5BV6A 1OLMA 1LOBA 1WA6X 1YJKA 2BJSA 3S7IA 2QFEA 2QQWA 4YW3A 1QOOA 5CEHA 5L9VA 4N43C 5LW9A 1JTZX 5IAVA 2WNVC 4YVWA 1BYHA 3B93A 4D7YA 3WF4A 2OZJA 5C3OA 4NIDA 2ZGNA 3O0WA 2K2SA 3O1VA 2WDBA 5FYBA 2WS93 2XL9A 2VQTA 5A3MA 5J3UA 2QQUA 1E57A 1UMIA 4Y1UA 1LB2A 3IIIA 4Y22B 5IVYA 4A7ZA 4QPGB 1AJKA 1EUTA 1X7NA 1Z7S2 3POJA 4MHUA 3E5QA 3TEYA 4RFT0 3M3OA 3VL8A 1L7RA 1HV0A 1VBD3 4YW2A 5EP9A 2NN8A 4JKKA 4DXZA 2ZACA 4FFGA 4KI5M 2D44A 5FP4A 1UO9A 2VVFA 1JI6A 1JZ4A 1YQCA 2WL1A 2V4VA 1FNYA 1H30A 3WG2A 4L8QA 1A8MA 1V9U3 2VW1A 3N3HA 1RJ7A 3I54A 5BNNB 4HLTA 1AR73 2CGNA 1LTEA 1QXRA 4Q0VA 4FXKB 5DAQA 5DUWA 3ZSEA 3I3MA 3LOIA 1VBB3 4BM8A 2ZXQA 2R043 3FZ3A 1GWMA 1IHMA 1UAIA 2OXBA 1ALYA 3M2MA 3PL0A 4XBNA 3I3BA 4CDUA 5DPNA 2PMWB 3IPVA 2FHRA 2R7EB 2VTXA 4NRMA 1V6IA 5A3TA 5BNQA 3E5UA 2B45X 1W3XA 1CPNA 2FDIA 1EAH2 1NUKA 1PIV3 4LK7A 1ND2B 5FZGA 3MF6A 2E51A 4K40A 3ILNA 1MEC3 4UWDA 5BNPC 3BCWA 1BHGA 2PELA 4UBHA 4WM7B 4OVEA 2DVGA 4GIQA 4XJ9A 3MLJA 1MR5A 4KWUA 3D82A 3GNEA 1I6XA 2RM21 4B4RA 4DEQA 4EV0A 5CKNA 3MW2A 1B35B 5LA9A 1J3RA 2VW0A 3ELNA 4XUNA 1UMHA 4FFHA 3AMHA 1ONAA 1R082 3VZMA 5LEKA 3VBRA 1DF0A 1EPWA 5F3EA 3PMSA 4TSVA 2YROA 4R9CA 1PIV2 1E5RA 1OLME 2FCUA 4CU8A 5F3GA 3TEZA 4UBGA 3AKRA 5LK7B 1O3RA 1GOHA 3ZFFB 2IXHA 1POV3 2EALA 2XL7A 1DP0A 2NM1A 2XB6C 4FT8A 4INDA 4NAOA 4XIOA 5DG2A 5FJHA 5FDBA 4QPIC 4QX1A 2CYFA 4QU1A 1W6QA 2BGPA 2W91A 3GJAA 1W04A 4D3WA 4MSVA 4PIYA 1BBT3 1D4M2 3GHNA 1UD1A 2BNOA 2YYOA 2VECA 4MGSA 5FZIA 1OD5A 1C28A 2Y6KA 2DTWA 4LKDA 2WWUA 4W50A 4AZZA 5FXZA 3H50A 5FLHA 4AI1A 4HKOA 4MUVA 3JD71 3VZNA 4OHXA 4COYA 4TWTA 3AYCA 3IMNA 3SEEA 4COVA 2VVEA 5CFCA 2RS32 1OVSA 1UXZA 3OPTA 1UKRA 4A6OA 1NXD1 4P08A 3AP7A 2XXZA 3Q8CA 5GLZA 5EIYB 3OBTA 3TB0A 2AH2A 2HWC1 1Q8OA 1WW7A 4WM8C 5HCHA 2YBSA 2WFF2 4KBBA 2OKXA 3ES4A 2XJQA 3MPPG 5FV3A 2PQQA 5FY0A 1RJ8A 5A7WA 1LKNA 4GZ9A 4KU7A 4QX7A 5I0UA 3RWKX 4YW6A 1F31A 2JKXA 4RA0A 3NJVA 4A6SA 5C9AB 2BYVE 1GKBA 3POYA 5KWRA 4CZSA 3NJYA 1IKPA 1S4CA 4NAMA 2O8QA 4TN7A 3I2DA 5GZEA 2ZGOA 4PLMA 5KC6A 3V0BB 1YEWA 1GNHA 2VZTA 4M4PA 2WO1A 1HN0A 3VV1A 1ASJ2 4CXXA 4LOTA 5IK4A 1X36A 1K5MA 4W4ZA 2XH6A 3KD4A 4CCOA 1S1AA 4WVZA 5HXVA 1WGPA 5IVVA 3U78A 3I3QA 2QE3A 3AKPA 4LMFA 1J83A 1QIQA 2CAUA 2D6NA 4LHNA 4O7XA 2V4AA 3HQXA 3RYKA 3ZO0B 4Y20A 1R092 3LOBA 3VDAA 1J58A 1O4TA 1JW6A 2D98A 4YWAA 4XMAA 4U36A 5EJ3A 3T1MA 1BQPA 1MEC2 1RHI3 2UY8A 1CJDA 2B8MA 1S55A 1UY1A 1WMEA 3D6EA 3RDIA 4GAZA 4AEJA 1HJGA 2BFUS 2VOWA 2VU9A 1WMFA 2VGDA 3ZLIA 5F9TA 2P3KA 2QTWB 3WNOA 4E2QA 3ZFFA 3ZFEC 4GMP0 4NHXA 4M3CB 1AUYA 5ERLA 3WZ1A 2VUDA 2R0FA 1NYWA 2BGCA 1JZ7A 5HV0A 3HIFA 2GH2A 1RVF2 2W1WA 2XLAA 2QKDA 4QQPA 1RVF1 1NCRC 4JV4A 1LESA 2JDKA 3POFA 4DZGA 5FR3A 3DECA 3GHMA 1JOPA 2W0XA 4CDUB 2ZOEB 3DUIA 2C9AA 3LSEA 5FZBA 5IT6A 1GQHA 1WMDA 2C0ZA 2HWD3 3LEIA 5EZWA 1RUOA 3PUQA 2Y0OA 3WDUA 5AFBA 2PHUA 4ITCA 4PDWA 4CEWC 4XACA 1QWRA 4BISA 4IW3A 2QVSB 5L7OB 2RVAA 5JZGA 1ZA7A 1WLDA 2BGOA 1JYCA 1NG0A 3HWJA 3ZSJA 4XUQA 4Q0SA 1ENQA 2XWJB 4PT6A 5CZKA 1GFF2 5JXGA 4GMP1 3O1TA 2BRTA 4BXFA 3AM2A 3UKVA 2FZ1A 1ULFA 2WSUA 4LBQB 1H2NA 4YVSC 1H2MA 3AL6A 1FAYA 3HN3A 1FMD2 1JU4A 1OFSA 1SLTA 4L11A 5FZHA 5KR7A 5BYNA 1MS5A 4Q4V3 4C0BA 4ISQA 3EQEA 1C1LA 4Y4RA 1DGRN 4HVQA 1Q8QA 1RUH2 1XNCA 5IFPA 3VUOA 3I2IA 1UOGA 1ZRRA 3EB7A 3VD7A 4LOSA 1S0BA 5JZGC 3W58A 1POV1 1CAUB 1O5UA 3FX3A 1TNRA 4JGYC 4AVSA 1OUSA 5HV4A 2EAAA 2RS12 4CDQC 2D3PA 1RUF1 3SISA 3V0BA 3I2KA 4QX8A 1RMU3 3H8RA 4FTBA 1W90A 4LO7A 2EICA 2VMGA 3KV4A 3RZZA 3JQWA 1AXKA 1Q8VA 2DURA 4E8DA 3MFCA 5KXEA 2B42B 5A70A 3AFKA 4E8CA 2WNVA 4Y5SA 1UY4A 2LUWA 4YVWC 1R64A 2OA2A 5IYYA 1RUE3 3HQRA 1RUE1 3U4SA 2CWSA 5GKAC 1AX2A 3OBRA 2SLIA 4XFBA 1FPN3 3IDCB 4ZU7A 1MEC1 4B1LA 4CA9A 5JOWA 2MHFA 2EXJA 1RMU2 1YFUA 1VBC2 1S0JA 2J1AA 2QJVA 3EHKA 4E2SA 2G4IA 1RMU1 4EWEA 3T4HB 1RUF3 4EWAA 2GC1A 4N9IA 2A1XA 1DCSA 1XJAA 3FBMA 1U5IA 3NAPC 5FUPA 1POV0 1STMA 4NO4A 4RQPC 3VBHA 2E32A 3WDWA 4OMCA 5J48A 3N4MA 4HG6B 1GOGA 5KC5A 4FTEA 1NA1B 5C8WA 5DMYA 2WUHA 4QWNA 4SBVA 3CL1A 5FYZA 1ODNA 1S2BA 4XOGA 4AHYA 1BEV1 3ZMOA 2AREA 5HCBA 1UOJA 3IKWA 2IC1A 5CKMA 2WZR2 3SQOA 4Z07A 3ZM8A 2ZPXA 1PGSA 2PFWA 3N9QA 4FPOB 4NHKA 4Q4V1 1L3JA 3RMXA 1V9U1 3TBDA 4COWA 3O1MA 1ULEA 3ZPYA 5A1AA 1X9PA 2HWF1 4LLOA 5FUNA 3ZIWA 2PAMA 4CCNA 1V70A 2W92A 4GALA 4GMP3 5EHDA 1LHOA 2AEZA 1W8UA 2WNOA 4ZU5A 3VKMA 5A3UA 1J3QA 1TME3 1CPMA 1E5HA 1W05A 4RQPA 1VBD2 2TBVA 2YFZA 1VBE2 2ZAAA 3K4AA 1H0BA 1VBD1 1MS4A 4LNVA 2QQOA 4XBQA 4D0QA 4UXAA 3NWKA 4E4ZA 1W3VA 4OZOA 2Z4FA 5SV5A 3VBUB 4KG0A 5FY7A 1RUJ2 1O5LA 2OZ6A 1SLIA 4X6QB 3P5BA 3SMHA 3KGLA 5JAXA 1VMHA 2AEYA 2WQ8A 5L36A 2NZ9A 5JMOA 2WS91 4MHRA 1DZTA 1U5ZA 2JX9A 1MS9A 5FPZA 4E2GA 2CGOA 2R073 4O9GA 1J1TA 2QDNA 2OQ7A 5FXWA 2HWE2 1HB2A 4ORFA 4K9SA 3JCIA 3N7MA 2JICA 1PVC2 3C7FA 3VDDB 5KXDA 2OYZA 2B5HA 4LA3A 5GZGA 5T5JA 4HMZA 4ASMB 1LENA 2W68A 1RUD3 1G9DA 2Y6GA 4CEYA 1ENXA 4QQ2A 1AR91 1O8SA 5EXOA 3DXUA 4C90A 4FPJA 3W5MA 4ARXA 1RHI1 1RUG3 2GC2A 1VBA1 2JXAA 3D4KA 1XSQA 1TMF2 3TWIA 4DXSA 5FPXA 1IKQA 1NZCA 3N9OA 4P02B 4CEWA 5L7OC 3UNPA 2JDZA 4F8AA 1QGLA 1G6NA 4UW5A 2ILMA 1GYKA 1OF4A 1QMJA 3CHXA 4LHSA 1KS4A 2EXKA 5A3NA 2A70A 4XFAA 4IQPA 4QD2A 2JIGA 5I0TA 4E27A 4LO4B 1E5SA 2XVKA 3AKSA 1F5FA 2BPA2 2QUOA 2W9XA 4XURA 4P9WA 3QOPA 5F3IA 1DGLA 4K8RB 5DUVA 3J26N 2RV9A 4KWLA 4EN9B 3C7EA 3VBFB 2PN5A 2W1QA 1FX5A 3USUA 3RPQA 3AJYA 1D0HA 1OQDA 3QLQA 4NN0A 5EJ1B 3THDA 2DCYA 2YPDA 3OEBA 3I2OA 3O5SA 5G04L 4Z82A 3M4FA 3WCRA 1J59A 3N9MA 1SBEA 5C3QA 1ZRFA 2R32A 1HQNA 4LE4A 2VULA 3J9SA 2HBUA 4P14A 4LULA 3KHCA 2JG9C 2PAKA 2B9VA 1XB9A 2WT1A 3W21A 5FXXA 4IGQA 4UT5A 5CNAA 4AQ2A 5A6QA 5FKCA 5FY8A 2BOIA 4NHLA 4ZONA 3JD73 4IGPA 3M3EA 3NV2A 4AFMA 2ZX2A 2D6MA 2PLV2 1VBC3 3K51A 4DRRA 1DIWA 4KH9A 3MO4A 2FQPA 1PMHX 3ZYJB 2ZMLA 1OBNA 4QX2A 4Y26A 3WF1A 3UETA 3PLQA 5BY5A 1D2QA 3FLTA 2WN2A 5JSRA 2MNGA 2DU0A 3WQ0A 2HYXA 3GBWA 3FJSA 1O91A 2E53A 5T55A 1GP6A 1G9FA 1JUHA 1SACA 2VQUA 3DGTA 3W59A 4KU8A 4BK5A 2WSVA 2MEV1 2UWBA 4QDSA 2RDSA 5GZDA 5G05L 1REFA 4Q0UA 3DXTA 2ZS6B 4WVWA 2XVLA 2JB4A 2PLV3 4M01A 1KRIA 3LEKA 1ZRIA 1BCXA 1XOYA 4LBOA 4N8MA 5T5LA 1GZWA 1JZ6A 5AC93 5BNOC 5C33A 1VRH2 3NSTA 4JHTA 4XPVA 4L9BA 4Y1VA 3FLPA 3E6BA 4MGKE 1RXGA 1K5MB 4QMAA 5IHRA 1ND3B 4KWKA 2OUJA 1R1A1 5CFDB 1SMVA 4CEYB 1DU3D 5JIUA 1N1SA 1XYNA 1OHFA 1QJY3 1AR92 1VMFA 3KT7A 1NCRB 4YYOA 2P37A 3VD4A 1T2XA 2MEV2 3MIGA 4XTPA 2RM23 1PNGA 4TXWA 4B3NA 3WDVA 1QXPA 1LEMA 1U5XA 4K7JA 5FAXA 4YW4A 5KHGA 1RUG2 2CY6A 5IJRA 3CNAA 4N53A 2XLGA 3VDDC 5AC92 1DQ4A 1JN2P 3O0XA 1PIV1 4HK8A 1O3TA 1S2KA 3GZAA 2NPIA 4GH4A 1CAXA 1APNA 1T6GC 1BJQA 4ZXKA 1V6LA 3V65A 4OULA 2D40A 1QEXA 2VMCA 1SLLA 3HN1A 1A78A 3LGRA 1YUDA 4BQXA 2BZDA 4HZFA 2RM22 2R041 5CBLA 4XE9A 1VBB1 5B4XA 3BTXA 3RI8A 1QHDA 1DQ1A 1AYN3 3VKNA 2PXJA 3H7YA 4I0WB 4MGYE 1AR71 3I2HA 4LR4A 4HT1T 5DUUA 3HQUA 3N9NA 4RSUA 4FSJA 5IVBA 3PVBB 2P34A 1CAWB 2OUHA 2GU9A 1M06G 2P17A 3POBA 4XIKA 3VLBB 1NE6A 3WHUA 1KEXA 1QQP3 4G3YC 1C8NA 2UWAA 3VKFC 2WYFA 5C3PA 4XUOA 4LKSA 1BMV2 4ONUA 1X82A 3BTAA 5AVPA 1UYXA 4PF1A 4PLOA 4Q1PA 5H9SA 3D0SA 1UIJA 3A21A 4J25A 3OSDA 3WINE 5C70A 3O1PA 4BCUA 4RS5B 1YXWA 3PVOA 4MGZE 4AHXA 4M4RA 3WR0A 1PMIA 1AXYA 5GZFA 1UYYA 1JYIA 2Y64A 5LA0A 4FOYA 3CEWA 1H6YA 1V6OA 1G7YA 1XE8A 3X29B 2RS11 3H1YA 2BU9A 1UY3A 3POIA 3UKNA 1BMV1 1AL0G 1RYYA 1IPKA 1VB4A 4EZ4A 4DO0A 1IZ3A 1IGOA 1ND3A 3ACFA 4I01A 4P00B 4P9IA 2Y6JA 4RS5C 3GBGA 1JH5A 1X33A 4LKFA 4ZY9A 1A6CA 5B2GB 1XNAA 5ACA1 1OA2A 1ZBA3 3VBOB 1FOD3 4ES9A 2CU5A 3AYDA 2VE1A 1NAEA 1RUI3 2VOTA 2ZMNA 4H14A 5FO7B 3WT3A 1JYWA 1JYTA 2AGSA 1UX6A 1WW5A 5A32B 4TLFA 1R1ZA 4KGGA 5FWEA 4URTA 4XFGA 5FZEA 4PLNA 4WM8A 4LK6A 3UGGA 1ULGA 2VMHA 2FDFA 1H8TC 3AMNA 3PIJA 2IFWA 3NVCA 1W9YA 1DGWX 4A42A 2WYSA 1CZSA 3U11A 2QQJA 3IDEA 4MH0E 1D4VB 4AF9A 4AFCA 2IXIA 1PK6B 1URXA 2ET7A 4AQ6A 2YU2A 4K1ZA 4YG0A 3RZGA 3ZN5A 5FO8B 5A3WA 1DQ5A 4JRAA 4O61A 5FYIA 3KCCA 1R093 1U0AA 2XBO2 2WWJA 3IT8A 2VMFA 2Y38A 4AVTA 4RGGA 2DVBA 2Y0IA 4OHZA 4XEZA 1GQPA 1Q5OA 3EYPA 2G9FA 3H42B 4ZZ5A 5LA1A 2G9ZA 1DG6A 1VP6A 2RDNA 4YLZA 3MIBA 4FAGA 4YG6A 2BBVA 1OUXA 2ARXA 3KVBA 5DXDA 1XC6A 5T3NA 2V5DA 1OQ1A 4XHBA 2GH8A 4XQWA 1NA1C 3CDZB 5FZLA 4URAA 4DUVA 2R0HA 4OFGA 1GWKA 5D8AB 1QU0A 1JMUB 1UZZA 2YGMA 2RS31 5CIRA 1XU2A 3AP9A 4FFIA 2VY0A 2CHHA 3ZOIA 4BQYA 1CX1A 4XF1A 4XZUG 5A33A 1YQ5A 2XLFA 4NVPA 1REDA 4WVMB 1R083 2DUOA 3OBZA 2IFRA 1DQ0A 1KDKA 1RUH1 1AXZA 2HKXA 2IZWA 3KCXA 1ZA4A 2VD7A 1QJU2 5LATA 1DZRA 1X9TA 5LBFA 2XKOA 3ZYHA 2BVVA 3OD0A 2Y33A 4C1XA 2PHFA 3K3NA 4HBNA 4CTEA 1ST8A 2JE8A 2X53S 2ZTNA 4NJ4A 5A3OA 1HW5A 5FPUA 5I8YA 1EAH3 3APBA 3NV1A 2ES3A 1QF3A 4Q4W3 3ZYRA 2P4EA 2R063 1OLRA 5DAVA 1HV1A 5FPVA 3HT1A 4XABA 2YUEA 3VDDA 5T54A 1F2NA 2LRPA 1HRI3 3KT1A 5HBAA 2AYHA 1OD3A 3VKLA 1Y43B 3DPRA 2VNOA 3ABZA 2CL2A 1GNYA 4UW4A 3S5QA 4LHLA 4O9EA 3UYJA 2CAVA 4MV2A 4BOWA 3DKWA 2GSYA 3FFZA 2HLEA 2D5FA 3SXWA 5LK5A 4Y24A 4BPZA 1TMF3 1VRBA 1W9FA 4GWIA 3CJIC 2XPJA 1AVBA 2RS33 1C8M3 3PIGA 5A32A 1HRI2 2RMU1 1PGW1 3JB8A 3WUCA 2VMIA 4QM9A 3WHTA 2IVJA 4N43A 4UFJA 4DY3A 1QNWA 3ACHA 3IAQA 3AVRA 2D6LX 4IERA 5DABA 2Q8CA 4AHZA 3PMEA 3BALA 4IUGA 4QKBA 3RVHA 5FLJA 4A41A 1QQP2 1CGPA 1Y9QA 4LHKA 2BTVC 5FP8A 5FYSA 3SITA 1TZOA 2UWCA 1VMJA 2WINB 2ZEXA 3EO6A 1DDLA 1BEV2 1YLLA 2YHJA 4Q4X2 2GMPA 4AEDA 3H8OA 4D6RA 5BXXA 1ZREA 2GN3A 3LA2A 2TNFA 1BKZA 2FDKA 4Q4V2 4QGNA 3R4UA 3N7KA 2ADEA 1P8JA 4QPIA 3IB3A 1MQTA 5JDBA 1MS0A 3IAPA 3POGA 4LITA 1CD3G 1Q56A 3I2JA 4MVTA 3WQ1A 2A6VA 4W8JA 3ZXDA 1GZCA 2Y26A 2VXRA 1CVNA 1F8VA 1QJEA 4AAPA 5J96B 3BGAA 1HXS3 1VBE1 2GP3A 2P6CA 5DAWA 1O8PA 1PO21 1WCQA 4WVMA 5DQ0A 4YZ2A 1S0IA 5DUXA 1C57A 1DGWA 4A44A 3OD4A 2D5HA 2WLQA 3H8XA 2QQIA 5FZKA 1NQJA 2VO5A 1FMD3 3DYPA 1EPZA 2Q5TA 4UOJA 1KS5A 5JSPA 3FBYA 1PZ7A 3USSA 5IFTA 3ILFA 4AVCA 5FP3A 3NW4A 3WCSA 4CDXA 5FCCA 3Q8AA 2CGPA 4FFFA 3WNKA 1N1VA 2LW8A 3ZVXA 1CAVA 2ZEWA 2RJLA 3OUHA 1N1TA 4MOAA 2OW4A 4IE4A 3H0OA 4JGZB 4Q4Y3 3MDPA 2E26A 1EV13 1UU4A 1UZVA 1EV11 4ISRA 4GJZA 3QBQA 4QHOA 3VBFC 3AZVA 3N36A 5DDJ1 1B35C 3ST7A 2RS13 2W1SA 4HXCA 1LOCA 3WNXA 2WO3A 4MXWB 4XJ8A 4CP1A 1US3A 1YCIA 5FY4A 3KV5A 3T3YA 1ND2C 2JG9A 1A8DA 2KD7A 1CQ9A 2QDRA 3LPFA 3NO8A 2XQRA 2A6ZA 3IPVB 5FQ0A 4PDWC 2ETEA 1PX3A 2VCBA 1RUE2 5EFUA 4BZ4A 3WF2A 5C4WC 5IK5A 5JI7A 3WY6A 1F15A 3T30A 2NLRA 5F3CA 3BOWA 4S2HA 5JMCA 1UIKA 3BU0A 3PUAA 3UL2A 4OMDA 3UESA 3A0KA 3OGVA 1SLAA 5BNNC 3K75B 1W8NA 4EWDA 1CAUA 3KS7A 3VBSA 2ZCWA 4GJYA 1W6PA 2VZQA 3H9AA 3ZXLA 2OS2A 5T5OA 1WCDJ 2EXIA 1H2KA 3LEGA 3VZOA 1SBDA 1GZWB 1AYN2 4EN8B 1NCQC 4J1XA 4F7ZA 1RUJ3 3MHZA 1AYN1 2P2KA 5ANNA 3DF0A 5LASA 1RL3A 4E9KA 2CWMA 3RJRA 4UYBA 2VW2A 1ULDA 4ZS3A 2JEMA 4JDNA 4XAAA 4AXOA 2ZGMA 4YM3A 5C6CA 5B4NA 3VKOA 1H1MA 3MV01 4DS0A 4P9GA 1I1EA 3UJQA 3BUCA 1DFQA 5KBFA 4QPGC 1SCSA 5LZ6A 2RS51 3BYWA 5JOXA 3FE5A 5D1IA 5FMOS 4YW7A 1YYNA 2J1SA 1C8M1 2YU1A 3U0ZA 3RZJA 1PGL2 1CAWA 1C8M2 3ETPA 2ZX1A 4LIUA 1ULPA 3J7NA 5E8AA 3AYAA 4KNCA 1SBFA 4LIVA 4OHWA 3OF1A 3W5NA 2VUCA 4HKLA 2CV6A 4QKNA 3VD5A 3HT2A 3H3UA 2Q1FA 2A73B 1R1A3 2WN3A 4E4DX 1JXNA 2E33A 3CO2A 3E6CC 1BLZA 4JGZA 4YGBA 5FZ6A 3KF5A 1QJX3 2XWBB 3T0DA 4MLOA 1POQA 2GMEA 1ZZCA 3LKJA 3C7GA 2OX0A 4KBZA 4AVBA 5AC91 1YI7A 3R6SA 3NNGA 1H1IA 4Q4W1 1DQ6A 2PLV1 1EAH1 1AR81 3AMQA 1OKOA 1JBCA 2NMOA 2O14A 3CIHA 3MICA 3R4DB 4YM1A 1AR82 4EN0A 4NWWA 3AP5A 2WZEA 1OOPA 4PJYA 4XF0A 5FFOC 4D8MA 5LRSA 1ZRCA 1VALA 2J7MA 3FWEA 3QH6A 2LROA 4JGYA 4XVHA 2P3YA 5F8PA 3T4VA 4HSLA 3U14A 2VZ1A 3WLUA 5GM0A 2GNMA 3PUIA 1RUH3 5DZEA 3TN92 2XOMA 1R081 1ZX5A 3ACGA 5IW0A 2Z79A 4HPKB 4CDXC 2XONA 1XXNA 2A3XA 4AQSA 4PQQA 4COUA 3HVDA 1W2NA 3J8F3 2B39A 1BK0A 2ZGRA 2RDQA 4FPLA 2VMEA 3N9PA 4MX3A 1EY2A 2ATFA 4IESA 5JPMB 4PIZA 2ZJCA 1XE7A 5HXMA 2ZZJA 3AK0A 3LDBA 2XBO1 3DYOA 2ZHNA 1PX4A 5IK7A 1JZ2A 1WLCA 3U37A 1CN1A 1SFNA 3RGBA 1SEFA 4GB33 1A34A 2VOKA 5J7MA 5IATA 1HB1A 3THPA 5KHJA 3U75A 3HNMA 4K6BA 3ZFEB 1FATA 4MXWA 5EV7A 5J98B 3ZKYA 4SLIA 3PU8A 4NPMA 4RD7A 1ASJ3 3JBG2 1LOFA 1RUD2 1TE1B 4Y3OA 5FREA 1V00A 1UMZA 4ZKTB 5FUIA 2B7YA 1MQTC 2ZHMA 5C8CB 2VBPA 1NLSA 2ZHKA 3ACLA 5DZGA 3ZFFC 1SFYA 4ARYA 1V6JA 3ZPOA 5F37A 1UOFA 1Z7S3 2VCMA 4OLLA 1HB4A 1RITA 3BKZA 5FZCA 2DDUA 5JZGB 3DN7A 3GBFA 3NJXA 5LB6A 1SCRA 2I2SA 3C8XA 1VBA3 4CCCA 3EBRA 1HLCA 1YI9A 4LQRA 3RRDA 1AJOA 5ACA3 2XDVA 2VZPA 4GULA 1AR93 2G19A 1JHJA 1CONA 2NQYA 2Y6FA 3K2OA 3VBSB 2A3WA 4BB3A 4CYDA 4OI0A 3VZLA 2ZAHA 1PO11 2XG3A 1WBFA 1FT9A 5L73A 2PHLA 4L99A 3B7MA 1SZBA 3NV3A 3I2FA 4J1WA 1K3IA 1GANA 3KMHA 4RR3C 4X6RB 4CDUC 1UU5A 1OURA 1OI6A 1PHMA 1XRUA 5GLVA 1CZVA 1WZXA 5BNOA 1HX6A 2ZGUA 2D3RA 4HANA 5K4LA 3L2HA 5C4WA 4QU2A 3S6PA 4CP9B 2RJ2A 4CXYA 1JS9A 1LGNA 4GWNA 4DIQA 3MEPA 4I2OA 1TG7A 4W6WA 1H8VA 3THTA 4CUBA 3DPRB 1LU1A 1OF3A 4RHV2 1Z0HA 3MW4A 4BA6A 3EXUA 4XTMA 1DLLA 2IXJA 2DYCA 4BQ2A 1LULA 2F17A 2WJSA 3B00A 4LBQA 4EZHA 2W87A 2YFUA 4OCTA 3I8TA 5CKQA 4FPYA 2BQPA 4JX0A 4P9LA 1ACCA 2ORXA 5FYUA 1JODA 2FD8A 3HR9A 4UFLA 2WFPA 4LO5B 4QX0A 1JUIA 3OUJA 1QQP1 2P1BA 3CF6E 1HN1A 2D6KA 2VH9A 1HRV1 5FK8A 4QQHA 3SKVA 2HWF3 1KITA 3VBRB 4PCRA 4XMIA 2FDGA 1QH6A 5T5PA 5J37A 1RUC3 4LE3A 4EN7B 5BNPA 4JQRA 1QXJA 3I7DA 2R042 4P9YA 3ENRA 4CU9A 2IXLA 4CDWC 3WVJA 2D6PA 4X8NA 4BH9A 4CP0A 2W46A 4LBMA 4HVRA 4C0HA 4JGYB 1C5IA 3KF3A 3W20A 3S30A 4META 4BU2A 4BYYA 1AYM2 2DV9A 1SDWA 2RR12 2JE9A 1Y4WA 2BWAA 1N1YA 2W1UA 2YZ4A 1DYKA 3HNYM 2QQNA 3AL5A 3ECQA 4BQ5A 1LHVA 4K21A 5FZFA 4BLIA 1ZYBA 4RN5A 4Q0QA 2E63A 2O8OA 1FI2A 1ZZ6A 1GBGA 1WD4A 4CEYC 2H0VA 1QJX2 4UI9L 4WM7A 5DG1A 2BP6A 3B3QE 4AGGA 4Z2WA 1RGSA 2YXSA 3DL3A 4G9SB 2FBEA 3H1WA 2WWSA 2ZABA 5JSOA 1W2AX 2ZX3A 1A3KA 4LLFA 3B69A 3T1LA 4AI2A 5CYYA 1N3PA 1RINA 3PJQA 1NA1A 3T2QA 4BQWA 3MYXA 1T6BX 3RS6A 4B1MA 1W2UA 5CA6A 2AR6A 1LOFC 3PJYA 4CDXB 2FZ2A 5A6YA 2GNBA 4DQAA 3PNAA 3H3LA 5FY9A 1HIXA 4GWJA 4UFHA 3K4DA 4LBJA 2R1DA 4QPIB 2Z42A 5TSWA 4HOOA 3H7JA 3K3OA 5EYXA 2MEV3 2QQPA 4OUMA 1XQNA 4EJRA 2WAOA 3B9IA 3G7DA 4IE5A 4UF0A 4Q26A 4BIOA 5I0RA 1LOAA 4XF9A 1RIRA 3VN4A 2Y6LA 4IV1B 1QJU1 2RDRA 3WNLA 2WNUA 4LO8A 4R9DA 4YFWA 5JI9A 4XFIA 3W9AA 1PZ9A 2JG9B 3LAGA 3RI9A 5L19A 1RUI2 3JB4C 3BPZA 1ZRDA 3ZN4A 1VBC1 1NLRA 3OYWA 4XBLA 3BIEA 4YZ4A 1TME2 3FC0A 4ZU4A 2X8KA 3N35A 4DNYA 1LHWA 3UV9A 3H3ZA 4FXGB 3RQ0A 4LBQD 1AR63 2VPVA 1AL21 1K45A 5FMCA 3WQ7A 3H8UA 2XVGA 3MI8A 4YW1A 1ODMA 2ZA9A 4DY5A 4QPWA 4CU6A 3BI3A 3PHMA 2E31A 2VAUA 5FRAA 4B4PA 1W8HA 3I97A 3ZR6A 4CU7A 5IVFA 1QJY2 1UCXA 3ON7A 4M0HA 2HWD1 4FP2A 1DLCA 5JXHA 1W6PB 3SHRA 2WC2A 4DXRA 2EAKA 2J1TA 2H6BA 3G6JB 1N3OA 3WF3A 4Y4YA 1LNSA 2CTVA 3AX4A 3K77A 4Q29A 3ZFGA 1RVF3 5DAPA 3TEXA 2XQXA 3LEMA 2F4LA 3MPBA 4Y1ZA 5LRRA 2ZGTA 2JECA 3RZLA 5JWPA 3TOJA 3AJZA 3U10A 4K20A 3JQXA 5GZCA 2C4XA 5KHIA 2P5BA 1XNBA 4LUKA 1IS6A 1H4GA 2ZX0A 3PVEA 4HK9A 1YC61 4RGKA 2V09A 1UNBA 3FHQA 3T2TA 4EN6B 1WBLA 3DYMA 4NMIA 3ZYBA 1JZ3A 1WUVA 3QH7A 4GKXA 2HWB1 1CR7A 2QQLA 4H7LA 4EQVA 5LCWL 1UF2C 4V2WA 4B4QA 2B46X 5JUVA 5FZMA 5DN2A 1CIYA 2DUPA 1UPSA 1IQDC 2F4PA 2WBKA 3IMMA 3NNFA 4I3PA 3LFIA 4K8FA 1H6XA 1AZDA 1C4RA 1GSLA 1FYUA 4F3JA 4RGAA 1VE0A 3SCFA 1SDDB 3ZSMA 3KV6A 3FHIB 3MLLA 1ZBE2 5FP9A 2ZGKA 5FTTC 4BQ4A 4YG3A 4YVWB 2JG8A 2W39A 1W0OA 1ZNPA 4CDWB 2AENA 1CJPA 4Z8BA 2HWB2 4V2VA 1GR3A 1HJFA 2R071 2RR13 3T0BA 3ZYIB 1O3SA 3P6BA 1OA3A 3CZUA 5IVJA 1YQ2A 1SFPA 4LO6B 2H6CA 1HKDA 1JOBA 2LALA 2WA4A 5EPAA 4FAHA 4QXCA 4XQDA 2Q8DA 2HWC3 5AVAA 5K0UB 1BVVA 1GOFA 3D5OA 2FDJA 1V6NA 1KFXL 1RC6A 1UN1A 4XDQA 2VOXA 2WNVB 2Q8EA 3VB9A 1TME1 1S0GA 1ZM1A 3FLRA 3MIDA 3VL9A 3OY8A 4PI2A 2Y6HA 2D7FA 3O14A 4TLGA 2DVDA 3ZMNA 1H9PA 5ABJC 3OOXA 4BHPA 4Q0PA 5F5CA 4L2NA 3VHRA 4GH4B 1OXCA 2J1RA 3FN9A 4CUGA 5FZ9A 4E4HA 3ETQA 1V6KA 4L92A 1W8ZA 1BEV3 3F95A 4Q4X1 4IEWA 4MYEA 2K46A 1IS5A 2X5IA 3AP6A 4B8EA 1PGW2 3E5XA 3NV4A 3FL7A 5CFCC 3RFRA 2Q1MA 3VBSC 3BODA 2ET1A 1VRH3 2EIDA 2RS52 4FPHA 3INAA 4XDOA 3UGHA 4AFDA 3LDRA 5F5QA 4Z2AA 1DZQA 3FUQA 1XPWA 4QAWA 2RJKA 3OCPA 3BTYA 4YZ5A 2LM3A 2JD9A 2ORZA 3VZJA 1QOTA 4ZXEA 1FPN1 2QZ2A 4AL9A 2YC4A 2QQVA 1QDCA 1FPN2 4FOWA 4JDOA 4YZ1A 3I3EA 4PBPA 4PIXA 3TNQA 4F83A 3ZSLA 1PVXA 4M0NA 3BB6A 1YFWA 3D0JA 4XZPA 4OI2A 1YNAA 4QQOA 5FP7A 1DYOA 2JDMA 5A7QA 4D6SA 3SH3A 1QY4A 2C5DA 4XC9A 4Y5Z0 3WOGA 1KGYA 2QBXA 3AC0A 3CMGA 3KSCA 3NJZA 1KFUL 3R05A 4IETA 1VRH1 5F2SA 4RS5A 1KJRA 5FZOB 1W0PA 1G9AA 1CWPA 2VZVA 1EV12 2WQ4A 1UQXA 4KL1A 1MS8A 3LE0A 2ADDA 2NMNA 1AF9A 1ULOA 3FFQA 1YHFA 4Q4X3 4CDWA 2DCKA 1K12A 1YJLA 1AX0A 1WMXA 4Y1YA 2VZSA 5F5AA 3POEA 4NE9A 3MF9A 3VBHC 4MO3M 3DPRC 3DEMA 3Q8BA 3KB5A 1BXHA 4NPLA 4Q4W2 5C9AC 5CADA 4QX5A 3NNMA 4PBOA 1J84A 1PZ8A 1AX1A 4YGDA 3S57A 2G9GA 3I4IA 2V5YA 5CISA 1MS1A 2KR2A 4NPRA 1C1FA 1H9WA 4FCAA 2JDYA 1WWYA 1Q3EA 2D97A 3AZYA 3VHPA 1MZEA 5FBJA 1DGRA 2FMYA 1RUC2 3LB9A 1S0FA 3P3NA 3ZX7A 5FZ8A 5A3LA 5T52A 5A7WB 3WNPA 4QDQA 4HL0A 2JDNA 4GA9A 1W6OA 2RR11 2EF6A 4LKEA 5CG9A 1FV3A 5GALA 4Y1XA 2K0GA 5C9AA 4OYUA 2A5ZA 4IGOA 5JXIA 3HAGA 1UZWA 3KV9A 3NMBA 1OLQA 2YG0A 5E88A 3JBG1 1VAVA 4IV3B 4U2AA 5SV8A 1OPMA 2HJIA 1SQ4A 4IL7A 3S7EA 2HWC2 3VZKA 3NKGA 4YARA 2WFF1 5DAXA 3VBOC 2E9QA 4NIHA 2EA7A 4GQ7A 1VLNA 3EJKA 5FQ0B 3WDTA 2VNVA 3CJXA 4I09A 4JQTA 2CDOA 4WV8A 3DCQA 5EQUA 5LBCA 4Y20B 1X8MA 3ASIA 5F2WA 1COV3 2HWB3 4NWVA 3V56A 4YSFA 5ANQA 2XGXA 3JD72 2GAUA 5J09A 4NIGA 2WFF3 4J6GA 5LY1A 4JTNA 5C7GA 1F4HA 1W9SA 4CVUA 1O3QA 2DCZA 3M8LA 1H4HA 2ZGQA 3AKTA 3JBG3 4FPKA 4NR1A 1JHNA 1WCSA 2JDAA 2XKPA 1VJ2A 3KQ4B 1XYPA 2BDRA 1C3HA 2VJXA 4QHZA 3C7HA 3NNJA 4DOUA 2C1FA 1HQLA 3ZN6A 5C71A 3WP3A 1Q8SA 3OJBA 3IWZA 3WW4A 2WO2A 4FPCA 4RYDA 3ZXGA 4D69A 5FZ4A 1EUUA 2C24A 1ULCA 1O7FA 1NLQA 2CDPA 3M1HA 2BOJA 1E5IA 1I5PA 4QGMA 4Y33A 3A7QA 4C1WA 1GICA 4CUAA 3P1IA 4GWMA 1OOPB 4HPKA 2Z69A 1H8TA 3B01A 4AE2A 1N3QA 1O4YA 2GALA 3Q8FA 1AL23 4XHXA 1XYOA 1AR61 5I93A 2AACA 4AAXA 5J36A 1UW8A 2ENRA 3O1RA 1CX4A 1S0CA 2WLPA 4AEKA 3J8F2 2GMMA 3JXSA 3MBWA 2JDUA 5A3PA 1L7LA 3B02A 4IE7A 4TYSA 2A7AA 3TYJA 3IN9A 1VIWB 3LQCA 4AI0A 2XJSA 4M3CA 3JUUA 4H2AA 1R1A2 3AZXA 1BBT1 2PA7A 1W8FA 3UGFA 1QJU3 4YRDA 2VNRA 1PK6C 3LWCA 2DF7A 2J1UA 2RG4A 1LODA 1AR72 1REEA 4AR2A 2DVFA 4YNIA 5IVCA 4QGLA 3I49A 4ET7A 2Y60A 5KXBA 3KCYA 2R062 3NNLA 2YC0A 4HSJA 2WNUB 5FZDA 3A4UA 3VD9A 4ZHNA 3O12A 2PAEA 3C7OA 2EXHA 5CVRA 4Q1RA 3RJ2X 3WW2A 3KQRA 4BJ0A 2VZRA 3ZSKA 2PHXA 4XJZA 1W99A 3R0RA 2PQSA 2W5FA 3ZFEA 4H3WA 4N53C 3RSJA 5K7PA 2XJTA 4XDPA 2R16A 4JVAA 2VQAA 4NIIA 3ZYGA 4FPGA 4FPFA 4BQ1A 3IM0A 3QACA 4OI1A 4AI3A 1NCRA 2VCCA 4V1PA 3M3CA 3HPNA 4WZCA 3WUDA 2ARAA 5F39A 1LJ7A 3ZDSA 5M0TA 3E6DA 5CAZA 3KLSA 5FOBB 4LUMA 1HDKA 2J1VA 1GV9A 5KHHA 5A6ZA 2VUJA 4YGCA 3WEZA 4D6QA 1H2LA 2X10A 2BW8A 5D8AC 3UK9A 3KT4A 2WIIB 4MGTA 2XR4A 5BNOB 1WW4A 4AEDB 1UPIA 2D6OX 4HKWA 1MZ6A 1QJZA 3GZTB 2LS6A 4CP9A 2VXJA 4CPBD 3A23A 1F4AA 4XCAA 4HN0A 5I8SA 3T08A 3VHOA 1GZ9A 1H8TB 1ZZBA 1IG0A 2JKBA 5F1RA 1FNZA 3M7AA 4IV3C 1LU2A 3OUIA 2JJ6A 3SKJE 2VZOA 3R4SA 4AOCA 3KVAA 4DFSA 3HEIA 1N47A 1VAMA 1W6QB 4LBKA 3T2OA 2RMU2 3VGIA 3WSOA 3MFAA 1AYM3 4FQ4A 4GKYA 4O65A 1O59A 3CQOA 3AKQA 2IVIB 2IXCA 4NROA 2HBTA 2GP5A 1HRV2 4HN1A 3O7OA 1GQGA 1QKQA 1JZ5A 1XNTA 5CFCB 1OOPC 2XJRA 3LIGA 4UFMA 3ROUA 4BIFA 2DUQA 4BLJA 5JOYA 3LZZA 1V6MA 3BU7A 4A2UA 3HNBM 3ME2A 3VD3A 4AHWA 1IG3A 3WW3A 3ACIA 1S2EA 1UZ0A 4AVVA 2ZEZA 1UYZA 1CESA 1U12A 4AWDA 3RZMA 4MXVA 3TAYA 3BN6A 4QXBA 5FZAA 3T2PA 3GALA 1BK1A 2JENA 2BVBA 2XJUA 1XBFA 3H1MA 1PVC3 1W9TA 2R6QA 2VZ3A 1OFNA 4N9HA 4ZPIA 4YGEA 2UURA 3NAPB 4YW5A 3Q9OA 1V9U2 5LA2A 4Z92B 2DFBA 2Y8KA 1W06A 4JCKA 3VBOA 2WS92 3U07A 3VBUA 2ZKNA 4JKLA 2CNAA 1FV2A 4IEOA 4QT6A 1EYBA 1W8WA 1YIPA 4B7KA 2HWE1 3K46A 5F7UA 1UOBA 2BNMA 2JB8A 3LA7A 5JR7B 4IE6A 3S5AA 2DFCA 2D3SA 1OKQA 2I07B 1W39A 2YPJA 4XETA 1NY72 1W6NA 2C26A 5FMDA 3CJIA 5JR2A 4RHV3 4YM2A 5JVVA 1RTVA 1LOGA 2WT0A 1RXFA 3HJRA 3J7LA 4IEQA 1PK6A 3CLPA 4W65A 4XUTA 5HCAA 2GC3A 1UU6A 4Q8LA 4ZS2A 4A3ZA 1K42A 2G1MA 4Q27A 3GCWA 1PM4A 3K48A 2KXLA 2OVUA 3USUB 4IV1A 5JIAA 4AEMA 5K9YA 2ZX4A 1W2TA 1DBNA 3AZWA 4AQTA 5A7NA 4DPNA 4IXLA 1QOSA 3SH4A 1YWKA 3WP6A 3MIHA 3MLKA 4AGRA 4NRQA 3VDCA 1WLTA 2DCJA 2E7QA 1IPJA 4WM7C 3ZDVA 4DINB 2R072 4LEJA 1G9BA 2WRAA 3GF6A 4IEZA 3OB8A 4HFSA 2HEYF 3LF7A 2WT2A 2A75A 4N7UA 4XAEA 3QCWA 4R4XA 3WV6A 4OQ8A 4P5HA 1YQ8A 3ZXFA 4D7SA 3ZYFA 2QCSB 2WZPP 3ZXAC 3V0AB 3NKTA 4H55A 4B29A 4YZ3A 5C5TA 4CUCA 4CCLA 5FY5A 3BPSA 1SLCA 3UJOA 1FOD2 1M4WA 3WDXA 4NHYA 3PUHA 4I02A 5JXJA 4YM0A 2R30A 2VQ0A 5K0UC 4CRQA 5HPOA 1GMMA 4XJUA 1FXZA 3MZHA 2QZ3A 1W03A 1PGL1 1NT0A 3NAPA 3SCHA 4PI0A 3ALQA 4ZZ8A 3D3AA 4QXHA 5FLIA 3FMGA 1WLWA 5T50A 2GNDA 1LCLA 3J7MA 1MQTB 2J1EA 5AFEA 5C8CC 2KM2A 2ZZQA 3TN93 4XF3A 2VBBA 2ID4A 2ZGLA 4TTGA 2VL4A 2BFUL 2ZBJA 4HETA 2WZR1 4IV3A 1NE4A 4LJHA 1I3HA 4N7IA 1UZYA 1I9RA 1YIFA 2DU1A 2EVXA 4W6YA 1HXS2 4H7MA 4YPJA 1VAKA 2A6YA 4CCJA 5LWBA 4R9AA 4CSWA 4I3GA 4ASLA 4WBBA 2PHDA 1NX9A 3KHBA 3PU3A 4IE0A 1G86A 4RFRB 5E1RA 1LHNA 1ZBE1 1UYPA 3POWA 4LXLA 4XUPA 4EE2A 1PMJX 4AG4A 5HI0A 4AEDC 2YMZA 3LIHA 4YFZA 3K4ZA 4XW3A 1IS3A 2AC1A 1UY0A 1IS4A 2DTYA 3GZUC 5F32A 1LGCA 5EYYA 5H9QA 5JOZA 1DYPA 3NQHA 1RUJ1 1HQWA 3I59B 4QB2A 3WP5A 2HEWF 5IAXA 1LHUA 3CZJA 5FMOL 3LDKA 2YGLA 3ITQA 2JWPA 1RHI2 1W6MB 4FP3A 1RUC1 4JRLA 4M3CF 5E16A 5H9PA 5IWFA 1ENSA 5A1FA 1Y7BA 1GZTA 4C8DA 1HRV3 2F6BA 4S2GA 2PHWA 1AR62 4GH4C 4A3XA 1JYVA 1GLHA 1W2OA 4AI9A 3U4XA 3AYEA 3FUOA 1SPPA 2SBAA 3POSA 4FPEA 3OPWA 4FVVA 1MACA 1XE0A 1G8WA 4EYUA 1J3PA 4MG2A 4N53B 4IEXA 4M3CE 5L9RA 4I30A 2JIJA 5K0UA 1XU1A 1F5JA 1VBA2 2VOVA 1VBB2 4BQ3A 5IK8A 3CU7A 3J7HA 2OPWA 2WNEA 4XILA 4R4ZA 5H9RA 1D4M1 5EJZB 3BIWE 4HONA 5C4WB 1LRHA 5LBBA 1JOJA 3PDQA 3ZN6B 3AFGA 4WVVA 4ATFA 4S2FA 5LY2A 2Q30A 2O1QA 4G4FA 3BOPA 1DHKB 1Y3TA 2B4KA 2JDHA 2VBDA 2WA3A 2X29A 5FIXA 2X05A 4DB5A 1G9CA 2W2IA 4Q4Y1 1PO13 1PNFA 5C3SA 2RE9A 5D21A 4ES8A 3TEWA 4K3UA 2VTXJ 3WNNA 4QXKA 5A1LA 3T0AA 1F35A 3LPGA 1WKYA 4AW7A 5FWJA 3N7LA 1MVQA 2E7TA 4IEVA 3URFA 3WW1A 4A4AA 3ZKUA 3AMPA 4AGVA 1Z7S1 2E6VA 2AUYA 1U5YA 1LR5A 4BMBA 1D0GA 2Q1ZB 4XJAA 4CDQB 1OT5A 1PO12 2JE7A 2PHTA 2XUEA 1HXS1 1IQAA 4FTSA 2WAAA 1LEDA 3MUZ1 4DXTA 2UY9A 2ERFA 2RHPA 2ZKLA 1Q43A 3IZOA 3VBUC 5C5UA 5ISLA 2TUNA 1ASJ1 2E7AA 3CKHA 3O0VA 2PYTA 1GUIA 1YO8A 1NCQA 2A6WA 3B9CA 5FPBA 5JCTA 4FOQA 3WF0A 3LSDA 4RR3B 4GB31 2ZMKA 4Q5OA 2XHKA 4K1YA 1JU3A 4DUWA 4OHVA 5FJKA 3AB0A 1GP5A 2R1BA 4YVSB 4CE8A 3OGGA 4I0AA 4AFBA 1I5ZA 5FYCA 2L9LA 2XBO3 1ENRA 1C5HA 4JKMA 1ZBE3 1XNKA 2OT7A 3M3IA 4PDWB 4Y5TA 1ZZ9A 5D8AA 5A80A 1ND3C 3N7JA 1K5MC 1JYXA 2D93A 1XNDA 3OGRA 3ORJA 5GJ6A 4CEWB 2W95A 2RMU3 2DBNA 3M3QA 2ZHLA 1SG3A 3J8F1 4LTAA 2BUKA 1OC1A 3C3VA 4GB32 4IEYA 1UXXX 1KDMA 4LBLA 1OSGA 2VCAA 4JHZA 2Q8OA 3HBZA 3S0MA 1XSRA 5IVEA 1WCKA 3OBAA 3Q8EA 5L9BA 2GNTA 4CCDA 2VUAA 1US2A 2H0BA 4DUXA 4PQ9A 1VR3A 3OPZA 4LT5A 2YDEA 3ZXJA 3AZZA 2X09A 5FYVA 3TN91 3ZFGC 5ABJB 3EMRA 4M00A 3AXEA 2W08A 4B7EA 1X50A 2NYYA 1OPOA 4JZRA 4BWOA 4BK4A 4QX3A 5E89A 1OH3A 4LORA 3AXDA 5E6HA 2VC9A 3BVCA 3SNMA 3CBNA 1AR83 2Q0AA 4XFCA 3HBKA 2DWRA 2R061 2Z5WA 4P9XA 5FYYA 4CCMA 3P3PA 1W28A 2J42A 3VDBA 2QNKA 4EROA 4UF0B 2BV4A 3AVSA 4UFKA 1QJX1 1J1LA 1KJLA 3NL1A 2VVDA 5A7OA 5GLWA 4COZA 4QKDA 3T09A 5KXCA 2VZUA 1MZFA 1ZVFA 3HD8B 5FZ1A 3M70A 1LOEA 5FMBA 4DEVA 1AHSA 3OYWB 1WW6A 2R49A 2AZ5A 5F6LB 3O1UA 3MUY1 4CXWA 5L7OA 3ILRA 5FZ7A 3U1XA 4AYUA 2CSGA 3A0NA 5FYHA 2QQKA 5ABJA 2J22A 4P5YA 4A7YA 3THCA 5A33B 5FZ0A 5GLTA 4Q2FA 3PURA 3UT0A 2RS53 1TQ5A 3LCPA 4TZDA 2WQZC 1LAJA 3WX5A 5I0DA 1O4ZA 2LTNA 4KWJA 4MGQA 1B35A 5GLUA 5K8SA 3OEAA 2X5IC 1RUF2 1OA4A 3F2ZA 4RR3A 1UY2A 2ARCA 3GYDA 2P3IA 1W8OA 4MZUA 3MGUA 3ES1A 2HEVF 5FY1A 3MIEA 1V0AA 1UWWA 1RUNA 4WZFA 1DQ2A 1Y9MA 2W94A 4R9BA 3WNMA 1R091 4C91A 4NUBA 3CJIB 3RYPA 3TRSB 1RB8G 4RHV1 3GDBA 3B5LB 4AVAA 5CFDA 1CIWA 5APAA 2N7GA 2OQ6A 1OQEA 5FKBA
chains in the Genus database with same CATH topology
4EZ4A 5FUPA 5FXXA 4DO0A 4XDOA 4IGQA 5FP4A 5ISLA 5FY8A 2Q8CA 3AVRA 4IGPA 4CCOA 5FXVA 2YU1A 5K4LA 4CCKA 3U78A 4QXHA 5IVVA 3RVHA 4QWNA 5FPBA 5FYZA 4LIUA 5FP8A 5FYSA 5IVFA 2GP5A 4LIVA 4DIQA 5FZ3A 5FZ4A 5FJKA 3N9QA 4D6RA 2XMLA 4Y33A 4GAZA 3PUSA 5FYCA 2YBPA 4EZHA 5FZ6A 5FP7A 5FUNA 5A7QA 5FWEA 4CCJA 3ZLIA 4CCNA 5FZEA 4D6SA 5LWBA 4LITA 3DXTA 2OT7A 5A80A 2OX0A 5FYUA 5A7SA 4CSWA 5F2SA 3PU3A 5FZOB 5A3TA 4ASKA 4QXBA 4AAPA 2P5BA 5FZAA 4LXLA 2GP3A 3N9LA 5A3PA 5FZGA 2YU2A 5F32A 5FY7A 5FPLA 5IVEA 5A3WA 5A7PA 5FYIA 5FZBA 5FZKA 2WWJA 4V2WA 3PTRB 5FZMA 5F5AA 5IW0A 3LD8A 5FYVA 3PUQA 5IVCA 5IWFA 5FP3A 5A1FA 5F3EA 4C8DA 4BISA 2OQ7A 4BU2A 5FXWA 3KVBA 5E6HA 4AI9A 3KV6A 3N9PA 5FZDA 3AL5A 5F3GA 5FP9A 5FYYA 5FZFA 5FZLA 4CCMA 3OPWA 4URAA 4GJZA 5FYMA 5F5IA 4EYUA 4UF0B 3AVSA 4BXFA 4CCLA 5FJHA 4V2VA 3LDBA 5FZHA 3AL6A 5KR7A 3DXUA 4QU1A 5A7OA 2YBKA 2PXJA 3KV5A 5FY4A 5IVJA 5FBJA 5FZ1A 4XDPA 4Y4RA 5FZ8A 3N9NA 3N9OA 5A7WB 5IVBA 2VD7A 4HONA 4QXCA 5FZ7A 5FZIA 3PDQA 5FYHA 2WWUA 2Q8DA 3K3NA 5FXZA 5A7NA 5F39A 5FZ0A 5LY2A 5A3NA 4IGOA 5FPUA 3PURA 3PU8A 3KV9A 5FY9A 4GD4A 4Y3OA 5F3CA 2Q8EA 5FYTA 3PUAA 5FPAA 5FPVA 3OPTA 2W2IA 4QX8A 4D6QA 3KV4A 5CEHA 5LW9A 2XXZA 4HOOA 5F3IA 3K3OA 3ZPOA 5F37A 2YBSA 4GJYA 4UF0A 5FY1A 2OS2A 5A1LA 5A7WA 5FV3A 5FYBA 5FY0A 5F5CA 5FZCA 3UYJA 5FWJA 5FZOA 3U4SA 4E4HA 4QX7A 4CUGA 5FZ9A 2YPDA 4NUBA 5F2WA 5IVYA 1VRBA 3N9MA 5ANQA 2XDVA 5FY5A 3NJYA 3K2OA 5LY1A 4TN7A 2XUEA 2OQ6A 3KVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZ4 A;  5FUP A;  5FXX A;  4DO0 A;  4XDO A;  4IGQ A;  5FP4 A;  5ISL A;  5FY8 A;  2Q8C A;  3AVR A;  4IGP A;  4CCO A;  5FXV A;  2YU1 A;  5K4L A;  4CCK A;  3U78 A;  4QXH A;  5IVV A;  3RVH A;  4QWN A;  5FPB A;  5FYZ A;  4LIU A;  5FP8 A;  5FYS A;  5IVF A;  2GP5 A;  4LIV A;  4DIQ A;  5FZ3 A;  5FZ4 A;  5FJK A;  3N9Q A;  4D6R A;  2XML A;  4Y33 A;  4GAZ A;  3PUS A;  5FYC A;  2YBP A;  4EZH A;  5FZ6 A;  5FP7 A;  5FUN A;  5A7Q A;  5FWE A;  4CCJ A;  3ZLI A;  4CCN A;  5FZE A;  4D6S A;  5LWB A;  4LIT A;  3DXT A;  2OT7 A;  5A80 A;  2OX0 A;  5FYU A;  5A7S A;  4CSW A;  5F2S A;  3PU3 A;  5FZO B;  5A3T A;  4ASK A;  4QXB A;  4AAP A;  2P5B A;  5FZA A;  4LXL A;  2GP3 A;  3N9L A;  5A3P A;  5FZG A;  2YU2 A;  5F32 A;  5FY7 A;  5FPL A;  5IVE A;  5A3W A;  5A7P A;  5FYI A;  5FZB A;  5FZK A;  2WWJ A;  4V2W A;  3PTR B;  5FZM A;  5F5A A;  5IW0 A;  3LD8 A;  5FYV A;  3PUQ A;  5IVC A;  5IWF A;  5FP3 A;  5A1F A;  5F3E A;  4C8D A;  4BIS A;  2OQ7 A;  4BU2 A;  5FXW A;  3KVB A;  5E6H A;  4AI9 A;  3KV6 A;  3N9P A;  5FZD A;  3AL5 A;  5F3G A;  5FP9 A;  5FYY A;  5FZF A;  5FZL A;  4CCM A;  3OPW A;  4URA A;  4GJZ A;  5FYM A;  5F5I A;  4EYU A;  4UF0 B;  3AVS A;  4BXF A;  4CCL A;  5FJH A;  4V2V A;  3LDB A;  5FZH A;  3AL6 A;  5KR7 A;  3DXU A;  4QU1 A;  5A7O A;  2YBK A;  2PXJ A;  3KV5 A;  5FY4 A;  5IVJ A;  5FBJ A;  5FZ1 A;  4XDP A;  4Y4R A;  5FZ8 A;  3N9N A;  3N9O A;  5A7W B;  5IVB A;  2VD7 A;  4HON A;  4QXC A;  5FZ7 A;  5FZI A;  3PDQ A;  5FYH A;  2WWU A;  2Q8D A;  3K3N A;  5FXZ A;  5A7N A;  5F39 A;  5FZ0 A;  5LY2 A;  5A3N A;  4IGO A;  5FPU A;  3PUR A;  3PU8 A;  3KV9 A;  5FY9 A;  4GD4 A;  4Y3O A;  5F3C A;  2Q8E A;  5FYT A;  3PUA A;  5FPA A;  5FPV A;  3OPT A;  2W2I A;  4QX8 A;  4D6Q A;  3KV4 A;  5CEH A;  5LW9 A;  2XXZ A;  4HOO A;  5F3I A;  3K3O A;  3ZPO A;  5F37 A;  2YBS A;  4GJY A;  4UF0 A;  5FY1 A;  2OS2 A;  5A1L A;  5A7W A;  5FV3 A;  5FYB A;  5FY0 A;  5F5C A;  5FZC A;  3UYJ A;  5FWJ A;  5FZO A;  3U4S A;  4E4H A;  4QX7 A;  4CUG A;  5FZ9 A;  2YPD A;  4NUB A;  5F2W A;  5IVY A;  1VRB A;  3N9M A;  5ANQ A;  2XDV A;  5FY5 A;  3NJY A;  3K2O A;  5LY1 A;  4TN7 A;  2XUE A;  2OQ6 A;  3KVA A; 
#chains in the Genus database with same CATH topology
 2EIE A;  4QB1 A;  5FBZ A;  3IDA A;  5CB7 A;  3VBR C;  2HWE 3;  2XJV A;  2P3J A;  2PTM A;  4OHY A;  1AL2 2;  2IWG B;  4L97 A;  4GXL A;  1BVP 1;  2GC0 A;  1ZZ7 A;  3JZV A;  4CCE A;  2B9U A;  2QQM A;  5BUV A;  2FCV A;  2BNN A;  1CAX B;  5ACA 2;  1OH4 A;  5FZ3 A;  2PHR A;  1YFX A;  1KXG A;  3A22 A;  4N43 B;  3RWN A;  4A7K A;  1RUI 1;  2C6S A;  2Y34 A;  4FI9 A;  4XXP A;  1FOD 1;  2BBA A;  1UL9 A;  1VPH A;  3AMM A;  3OGS A;  3RG0 A;  4OI4 A;  2A6X A;  5BPX A;  4QM8 A;  1GNZ A;  3OY8 B;  2FCT A;  4N90 A;  1TVG A;  2ARB A;  4XCB A;  2HWF 2;  1Z78 A;  4NRP A;  5DDJ 3;  2DVA A;  2JG8 B;  1TNF A;  4AK3 A;  4JC1 A;  4PHZ A;  4AFA A;  5BNP B;  4A45 A;  1YRZ A;  4QB6 A;  2NP0 A;  1S0E A;  4ASK A;  3GJB A;  3SEP A;  1PO2 2;  4XFH A;  3N9L A;  2ZGS A;  3MIF A;  2W47 A;  2D43 A;  2X5I B;  5FPL A;  3OTF A;  3RNS A;  4AI8 A;  1QJF A;  3OGJ A;  1BBT 2;  1D4M 3;  2C9K A;  4RQP B;  5A7P A;  1K5J A;  3SC7 X;  2XUM A;  4UW6 A;  1FMD 1;  3GGL A;  4XQ4 A;  2YC2 A;  3LD8 A;  2WR9 A;  5LBE A;  2V72 A;  2ZGP A;  3ZIX A;  1ZZ8 A;  4HVO A;  1W8T A;  2YV8 A;  2UYB A;  1PO2 3;  1PM7 A;  2W52 A;  3VHN A;  1VBE 3;  1GP4 A;  1AYM 1;  1VB2 A;  3GZE A;  2A71 A;  1YFY A;  4JAA A;  1SHW B;  4WM8 B;  2VMD A;  3TNP B;  3ZXE A;  2V73 A;  1NY7 1;  2OPK A;  4JDM A;  2KA3 A;  3JU9 A;  3FHA A;  1MVE A;  3OG2 A;  3O1O A;  4RL7 A;  1W0N A;  1O6U A;  4QHB A;  4DRV A;  3WG1 A;  2YY1 A;  2YBK A;  3WQB A;  5FK7 A;  4OUS A;  2FMD A;  2BEO A;  1H1A A;  3KGZ A;  4FO9 A;  3BTZ A;  1QNY A;  1GWL A;  4PF5 A;  2WNU C;  2XHN A;  4UFI A;  4R8H A;  1W6M A;  2XJP A;  3AP4 A;  3L2Y A;  2GDF A;  3SH5 A;  3O1S A;  4NOT A;  2WZ8 A;  4MAD A;  1KQR A;  4GD4 A;  4OZX A;  3VBF A;  4FBF A;  1BZW A;  1SLB A;  3I59 A;  3LA3 A;  3MW3 A;  4QDR A;  5FYT A;  3RMY A;  3ZYP A;  5FPA A;  4BDV B;  3I3D A;  4XJW A;  1NKG A;  1L7Q A;  1GU3 A;  4CPB A;  4S2D A;  5EWS A;  3NRU A;  4LA2 A;  1MZ5 A;  4IV1 C;  5I91 A;  1TMF 1;  4IEP A;  5KHK A;  1IOA A;  1NQD A;  2WZR 3;  4OQ9 A;  3UKT A;  2BER A;  5D2A A;  5FZO A;  1QJY 1;  1Y9G A;  1UKG A;  4D7T A;  2I74 A;  1WD3 A;  1D7P M;  4MGI E;  1IPS A;  5DZF A;  1HRI 1;  3C2U A;  2IXK A;  4L0P A;  1JYN A;  3WG4 A;  1W9W A;  1NXM A;  1X8E A;  5BNN A;  2UU8 A;  3ZXK A;  1QH7 A;  3KM5 A;  2I45 A;  5FXV A;  3WP4 A;  2HYK A;  4CCK A;  5LEJ A;  1W6O B;  2EIB A;  2BWC A;  4JTO A;  3KZ4 C;  1WA4 A;  3WXP A;  1SPP B;  4BE3 A;  2HWD 2;  2Z2S B;  4D94 A;  3RYR A;  3SCG A;  5J1X A;  1LEC A;  2VNG A;  1TEI A;  3KWV A;  3DV8 A;  2XML A;  3J4U H;  1JZ8 A;  3PUS A;  3RZK A;  2YBP A;  3RZH A;  4XXA A;  2ZEY A;  2DCT A;  1OMI A;  2VTF A;  2WAB A;  3E1F 1;  3WDY A;  1ND2 A;  5I8T A;  4Y22 A;  1LGB A;  3MV1 1;  2FDH A;  4QPG A;  2A3Y A;  4X8P A;  5A6X A;  5A7S A;  1EP0 A;  5I0S A;  4FQZ A;  2K9Z A;  1NOV A;  2TEP A;  1HB3 A;  1B09 A;  3GXU A;  1NZI A;  5JPN B;  2Q4S A;  2WO7 A;  3E97 A;  4XYX A;  5DDJ 2;  1D2S A;  4FOV A;  4LPL A;  4CDQ A;  3PVN A;  1W6N B;  1F9K A;  3PTY A;  2YB7 A;  1YQ6 A;  3WD5 A;  4KMQ A;  3IIA A;  4IDZ A;  3PTR B;  4Z1V A;  2O0O A;  1OVP A;  4JGZ C;  1WCU A;  2JDP A;  1CZT A;  4Q8K A;  2EIG A;  1UX7 A;  4R52 A;  5F6K A;  1NCQ B;  1KD7 A;  2HH9 A;  3ATG A;  4NHM A;  4UAP A;  3SLI A;  2VR4 A;  4P9J A;  4BXS V;  2WKK A;  2VM9 A;  2P6H A;  3LFM A;  3QD6 A;  4KG8 A;  5CU1 A;  3ZFG B;  3ZR5 A;  5C8C A;  1QDO A;  5FYM A;  1MS3 A;  4YVS A;  5F5I A;  1Q8P A;  4BME A;  2IUW A;  3DKQ A;  5CFD C;  2GZW A;  5FO9 B;  4UW3 A;  4I0B A;  5IUQ A;  3IBM A;  3WG3 A;  4KQ7 A;  3V0A A;  5HCF A;  4W6X A;  1COV 1;  4XF4 A;  4DMI A;  5FOJ B;  2DBI A;  2OII A;  4QQL A;  1COV 2;  3V64 A;  4CP2 A;  3L9J T;  2JD4 A;  3D8C A;  5C3R A;  1RUG 1;  1ZBA 1;  4KGQ A;  2W3J A;  4OUE A;  4NIA A;  5JLV A;  1ZBA 2;  4QPY A;  3IDB B;  3B94 A;  2JG8 C;  1PVC 1;  2GN7 A;  2VG9 A;  3GM8 A;  1MPX A;  4LBN A;  4E4S A;  1RUD 1;  3GCX A;  3HMY A;  3HOB A;  3VBH B;  4ATE A;  3I2G A;  4IEU A;  4XFF A;  5CG8 A;  2MPF A;  4QKF A;  1S0D A;  1CAV B;  2UYA A;  4Q4Y 2;  5BV6 A;  1OLM A;  1LOB A;  1WA6 X;  1YJK A;  2BJS A;  3S7I A;  2QFE A;  2QQW A;  4YW3 A;  1QOO A;  5CEH A;  5L9V A;  4N43 C;  5LW9 A;  1JTZ X;  5IAV A;  2WNV C;  4YVW A;  1BYH A;  3B93 A;  4D7Y A;  3WF4 A;  2OZJ A;  5C3O A;  4NID A;  2ZGN A;  3O0W A;  2K2S A;  3O1V A;  2WDB A;  5FYB A;  2WS9 3;  2XL9 A;  2VQT A;  5A3M A;  5J3U A;  2QQU A;  1E57 A;  1UMI A;  4Y1U A;  1LB2 A;  3III A;  4Y22 B;  5IVY A;  4A7Z A;  4QPG B;  1AJK A;  1EUT A;  1X7N A;  1Z7S 2;  3POJ A;  4MHU A;  3E5Q A;  3TEY A;  4RFT 0;  3M3O A;  3VL8 A;  1L7R A;  1HV0 A;  1VBD 3;  4YW2 A;  5EP9 A;  2NN8 A;  4JKK A;  4DXZ A;  2ZAC A;  4FFG A;  4KI5 M;  2D44 A;  5FP4 A;  1UO9 A;  2VVF A;  1JI6 A;  1JZ4 A;  1YQC A;  2WL1 A;  2V4V A;  1FNY A;  1H30 A;  3WG2 A;  4L8Q A;  1A8M A;  1V9U 3;  2VW1 A;  3N3H A;  1RJ7 A;  3I54 A;  5BNN B;  4HLT A;  1AR7 3;  2CGN A;  1LTE A;  1QXR A;  4Q0V A;  4FXK B;  5DAQ A;  5DUW A;  3ZSE A;  3I3M A;  3LOI A;  1VBB 3;  4BM8 A;  2ZXQ A;  2R04 3;  3FZ3 A;  1GWM A;  1IHM A;  1UAI A;  2OXB A;  1ALY A;  3M2M A;  3PL0 A;  4XBN A;  3I3B A;  4CDU A;  5DPN A;  2PMW B;  3IPV A;  2FHR A;  2R7E B;  2VTX A;  4NRM A;  1V6I A;  5A3T A;  5BNQ A;  3E5U A;  2B45 X;  1W3X A;  1CPN A;  2FDI A;  1EAH 2;  1NUK A;  1PIV 3;  4LK7 A;  1ND2 B;  5FZG A;  3MF6 A;  2E51 A;  4K40 A;  3ILN A;  1MEC 3;  4UWD A;  5BNP C;  3BCW A;  1BHG A;  2PEL A;  4UBH A;  4WM7 B;  4OVE A;  2DVG A;  4GIQ A;  4XJ9 A;  3MLJ A;  1MR5 A;  4KWU A;  3D82 A;  3GNE A;  1I6X A;  2RM2 1;  4B4R A;  4DEQ A;  4EV0 A;  5CKN A;  3MW2 A;  1B35 B;  5LA9 A;  1J3R A;  2VW0 A;  3ELN A;  4XUN A;  1UMH A;  4FFH A;  3AMH A;  1ONA A;  1R08 2;  3VZM A;  5LEK A;  3VBR A;  1DF0 A;  1EPW A;  5F3E A;  3PMS A;  4TSV A;  2YRO A;  4R9C A;  1PIV 2;  1E5R A;  1OLM E;  2FCU A;  4CU8 A;  5F3G A;  3TEZ A;  4UBG A;  3AKR A;  5LK7 B;  1O3R A;  1GOH A;  3ZFF B;  2IXH A;  1POV 3;  2EAL A;  2XL7 A;  1DP0 A;  2NM1 A;  2XB6 C;  4FT8 A;  4IND A;  4NAO A;  4XIO A;  5DG2 A;  5FJH A;  5FDB A;  4QPI C;  4QX1 A;  2CYF A;  4QU1 A;  1W6Q A;  2BGP A;  2W91 A;  3GJA A;  1W04 A;  4D3W A;  4MSV A;  4PIY A;  1BBT 3;  1D4M 2;  3GHN A;  1UD1 A;  2BNO A;  2YYO A;  2VEC A;  4MGS A;  5FZI A;  1OD5 A;  1C28 A;  2Y6K A;  2DTW A;  4LKD A;  2WWU A;  4W50 A;  4AZZ A;  5FXZ A;  3H50 A;  5FLH A;  4AI1 A;  4HKO A;  4MUV A;  3JD7 1;  3VZN A;  4OHX A;  4COY A;  4TWT A;  3AYC A;  3IMN A;  3SEE A;  4COV A;  2VVE A;  5CFC A;  2RS3 2;  1OVS A;  1UXZ A;  3OPT A;  1UKR A;  4A6O A;  1NXD 1;  4P08 A;  3AP7 A;  2XXZ A;  3Q8C A;  5GLZ A;  5EIY B;  3OBT A;  3TB0 A;  2AH2 A;  2HWC 1;  1Q8O A;  1WW7 A;  4WM8 C;  5HCH A;  2YBS A;  2WFF 2;  4KBB A;  2OKX A;  3ES4 A;  2XJQ A;  3MPP G;  5FV3 A;  2PQQ A;  5FY0 A;  1RJ8 A;  5A7W A;  1LKN A;  4GZ9 A;  4KU7 A;  4QX7 A;  5I0U A;  3RWK X;  4YW6 A;  1F31 A;  2JKX A;  4RA0 A;  3NJV A;  4A6S A;  5C9A B;  2BYV E;  1GKB A;  3POY A;  5KWR A;  4CZS A;  3NJY A;  1IKP A;  1S4C A;  4NAM A;  2O8Q A;  4TN7 A;  3I2D A;  5GZE A;  2ZGO A;  4PLM A;  5KC6 A;  3V0B B;  1YEW A;  1GNH A;  2VZT A;  4M4P A;  2WO1 A;  1HN0 A;  3VV1 A;  1ASJ 2;  4CXX A;  4LOT A;  5IK4 A;  1X36 A;  1K5M A;  4W4Z A;  2XH6 A;  3KD4 A;  4CCO A;  1S1A A;  4WVZ A;  5HXV A;  1WGP A;  5IVV A;  3U78 A;  3I3Q A;  2QE3 A;  3AKP A;  4LMF A;  1J83 A;  1QIQ A;  2CAU A;  2D6N A;  4LHN A;  4O7X A;  2V4A A;  3HQX A;  3RYK A;  3ZO0 B;  4Y20 A;  1R09 2;  3LOB A;  3VDA A;  1J58 A;  1O4T A;  1JW6 A;  2D98 A;  4YWA A;  4XMA A;  4U36 A;  5EJ3 A;  3T1M A;  1BQP A;  1MEC 2;  1RHI 3;  2UY8 A;  1CJD A;  2B8M A;  1S55 A;  1UY1 A;  1WME A;  3D6E A;  3RDI A;  4GAZ A;  4AEJ A;  1HJG A;  2BFU S;  2VOW A;  2VU9 A;  1WMF A;  2VGD A;  3ZLI A;  5F9T A;  2P3K A;  2QTW B;  3WNO A;  4E2Q A;  3ZFF A;  3ZFE C;  4GMP 0;  4NHX A;  4M3C B;  1AUY A;  5ERL A;  3WZ1 A;  2VUD A;  2R0F A;  1NYW A;  2BGC A;  1JZ7 A;  5HV0 A;  3HIF A;  2GH2 A;  1RVF 2;  2W1W A;  2XLA A;  2QKD A;  4QQP A;  1RVF 1;  1NCR C;  4JV4 A;  1LES A;  2JDK A;  3POF A;  4DZG A;  5FR3 A;  3DEC A;  3GHM A;  1JOP A;  2W0X A;  4CDU B;  2ZOE B;  3DUI A;  2C9A A;  3LSE A;  5FZB A;  5IT6 A;  1GQH A;  1WMD A;  2C0Z A;  2HWD 3;  3LEI A;  5EZW A;  1RUO A;  3PUQ A;  2Y0O A;  3WDU A;  5AFB A;  2PHU A;  4ITC A;  4PDW A;  4CEW C;  4XAC A;  1QWR A;  4BIS A;  4IW3 A;  2QVS B;  5L7O B;  2RVA A;  5JZG A;  1ZA7 A;  1WLD A;  2BGO A;  1JYC A;  1NG0 A;  3HWJ A;  3ZSJ A;  4XUQ A;  4Q0S A;  1ENQ A;  2XWJ B;  4PT6 A;  5CZK A;  1GFF 2;  5JXG A;  4GMP 1;  3O1T A;  2BRT A;  4BXF A;  3AM2 A;  3UKV A;  2FZ1 A;  1ULF A;  2WSU A;  4LBQ B;  1H2N A;  4YVS C;  1H2M A;  3AL6 A;  1FAY A;  3HN3 A;  1FMD 2;  1JU4 A;  1OFS A;  1SLT A;  4L11 A;  5FZH A;  5KR7 A;  5BYN A;  1MS5 A;  4Q4V 3;  4C0B A;  4ISQ A;  3EQE A;  1C1L A;  4Y4R A;  1DGR N;  4HVQ A;  1Q8Q A;  1RUH 2;  1XNC A;  5IFP A;  3VUO A;  3I2I A;  1UOG A;  1ZRR A;  3EB7 A;  3VD7 A;  4LOS A;  1S0B A;  5JZG C;  3W58 A;  1POV 1;  1CAU B;  1O5U A;  3FX3 A;  1TNR A;  4JGY C;  4AVS A;  1OUS A;  5HV4 A;  2EAA A;  2RS1 2;  4CDQ C;  2D3P A;  1RUF 1;  3SIS A;  3V0B A;  3I2K A;  4QX8 A;  1RMU 3;  3H8R A;  4FTB A;  1W90 A;  4LO7 A;  2EIC A;  2VMG A;  3KV4 A;  3RZZ A;  3JQW A;  1AXK A;  1Q8V A;  2DUR A;  4E8D A;  3MFC A;  5KXE A;  2B42 B;  5A70 A;  3AFK A;  4E8C A;  2WNV A;  4Y5S A;  1UY4 A;  2LUW A;  4YVW C;  1R64 A;  2OA2 A;  5IYY A;  1RUE 3;  3HQR A;  1RUE 1;  3U4S A;  2CWS A;  5GKA C;  1AX2 A;  3OBR A;  2SLI A;  4XFB A;  1FPN 3;  3IDC B;  4ZU7 A;  1MEC 1;  4B1L A;  4CA9 A;  5JOW A;  2MHF A;  2EXJ A;  1RMU 2;  1YFU A;  1VBC 2;  1S0J A;  2J1A A;  2QJV A;  3EHK A;  4E2S A;  2G4I A;  1RMU 1;  4EWE A;  3T4H B;  1RUF 3;  4EWA A;  2GC1 A;  4N9I A;  2A1X A;  1DCS A;  1XJA A;  3FBM A;  1U5I A;  3NAP C;  5FUP A;  1POV 0;  1STM A;  4NO4 A;  4RQP C;  3VBH A;  2E32 A;  3WDW A;  4OMC A;  5J48 A;  3N4M A;  4HG6 B;  1GOG A;  5KC5 A;  4FTE A;  1NA1 B;  5C8W A;  5DMY A;  2WUH A;  4QWN A;  4SBV A;  3CL1 A;  5FYZ A;  1ODN A;  1S2B A;  4XOG A;  4AHY A;  1BEV 1;  3ZMO A;  2ARE A;  5HCB A;  1UOJ A;  3IKW A;  2IC1 A;  5CKM A;  2WZR 2;  3SQO A;  4Z07 A;  3ZM8 A;  2ZPX A;  1PGS A;  2PFW A;  3N9Q A;  4FPO B;  4NHK A;  4Q4V 1;  1L3J A;  3RMX A;  1V9U 1;  3TBD A;  4COW A;  3O1M A;  1ULE A;  3ZPY A;  5A1A A;  1X9P A;  2HWF 1;  4LLO A;  5FUN A;  3ZIW A;  2PAM A;  4CCN A;  1V70 A;  2W92 A;  4GAL A;  4GMP 3;  5EHD A;  1LHO A;  2AEZ A;  1W8U A;  2WNO A;  4ZU5 A;  3VKM A;  5A3U A;  1J3Q A;  1TME 3;  1CPM A;  1E5H A;  1W05 A;  4RQP A;  1VBD 2;  2TBV A;  2YFZ A;  1VBE 2;  2ZAA A;  3K4A A;  1H0B A;  1VBD 1;  1MS4 A;  4LNV A;  2QQO A;  4XBQ A;  4D0Q A;  4UXA A;  3NWK A;  4E4Z A;  1W3V A;  4OZO A;  2Z4F A;  5SV5 A;  3VBU B;  4KG0 A;  5FY7 A;  1RUJ 2;  1O5L A;  2OZ6 A;  1SLI A;  4X6Q B;  3P5B A;  3SMH A;  3KGL A;  5JAX A;  1VMH A;  2AEY A;  2WQ8 A;  5L36 A;  2NZ9 A;  5JMO A;  2WS9 1;  4MHR A;  1DZT A;  1U5Z A;  2JX9 A;  1MS9 A;  5FPZ A;  4E2G A;  2CGO A;  2R07 3;  4O9G A;  1J1T A;  2QDN A;  2OQ7 A;  5FXW A;  2HWE 2;  1HB2 A;  4ORF A;  4K9S A;  3JCI A;  3N7M A;  2JIC A;  1PVC 2;  3C7F A;  3VDD B;  5KXD A;  2OYZ A;  2B5H A;  4LA3 A;  5GZG A;  5T5J A;  4HMZ A;  4ASM B;  1LEN A;  2W68 A;  1RUD 3;  1G9D A;  2Y6G A;  4CEY A;  1ENX A;  4QQ2 A;  1AR9 1;  1O8S A;  5EXO A;  3DXU A;  4C90 A;  4FPJ A;  3W5M A;  4ARX A;  1RHI 1;  1RUG 3;  2GC2 A;  1VBA 1;  2JXA A;  3D4K A;  1XSQ A;  1TMF 2;  3TWI A;  4DXS A;  5FPX A;  1IKQ A;  1NZC A;  3N9O A;  4P02 B;  4CEW A;  5L7O C;  3UNP A;  2JDZ A;  4F8A A;  1QGL A;  1G6N A;  4UW5 A;  2ILM A;  1GYK A;  1OF4 A;  1QMJ A;  3CHX A;  4LHS A;  1KS4 A;  2EXK A;  5A3N A;  2A70 A;  4XFA A;  4IQP A;  4QD2 A;  2JIG A;  5I0T A;  4E27 A;  4LO4 B;  1E5S A;  2XVK A;  3AKS A;  1F5F A;  2BPA 2;  2QUO A;  2W9X A;  4XUR A;  4P9W A;  3QOP A;  5F3I A;  1DGL A;  4K8R B;  5DUV A;  3J26 N;  2RV9 A;  4KWL A;  4EN9 B;  3C7E A;  3VBF B;  2PN5 A;  2W1Q A;  1FX5 A;  3USU A;  3RPQ A;  3AJY A;  1D0H A;  1OQD A;  3QLQ A;  4NN0 A;  5EJ1 B;  3THD A;  2DCY A;  2YPD A;  3OEB A;  3I2O A;  3O5S A;  5G04 L;  4Z82 A;  3M4F A;  3WCR A;  1J59 A;  3N9M A;  1SBE A;  5C3Q A;  1ZRF A;  2R32 A;  1HQN A;  4LE4 A;  2VUL A;  3J9S A;  2HBU A;  4P14 A;  4LUL A;  3KHC A;  2JG9 C;  2PAK A;  2B9V A;  1XB9 A;  2WT1 A;  3W21 A;  5FXX A;  4IGQ A;  4UT5 A;  5CNA A;  4AQ2 A;  5A6Q A;  5FKC A;  5FY8 A;  2BOI A;  4NHL A;  4ZON A;  3JD7 3;  4IGP A;  3M3E A;  3NV2 A;  4AFM A;  2ZX2 A;  2D6M A;  2PLV 2;  1VBC 3;  3K51 A;  4DRR A;  1DIW A;  4KH9 A;  3MO4 A;  2FQP A;  1PMH X;  3ZYJ B;  2ZML A;  1OBN A;  4QX2 A;  4Y26 A;  3WF1 A;  3UET A;  3PLQ A;  5BY5 A;  1D2Q A;  3FLT A;  2WN2 A;  5JSR A;  2MNG A;  2DU0 A;  3WQ0 A;  2HYX A;  3GBW A;  3FJS A;  1O91 A;  2E53 A;  5T55 A;  1GP6 A;  1G9F A;  1JUH A;  1SAC A;  2VQU A;  3DGT A;  3W59 A;  4KU8 A;  4BK5 A;  2WSV A;  2MEV 1;  2UWB A;  4QDS A;  2RDS A;  5GZD A;  5G05 L;  1REF A;  4Q0U A;  3DXT A;  2ZS6 B;  4WVW A;  2XVL A;  2JB4 A;  2PLV 3;  4M01 A;  1KRI A;  3LEK A;  1ZRI A;  1BCX A;  1XOY A;  4LBO A;  4N8M A;  5T5L A;  1GZW A;  1JZ6 A;  5AC9 3;  5BNO C;  5C33 A;  1VRH 2;  3NST A;  4JHT A;  4XPV A;  4L9B A;  4Y1V A;  3FLP A;  3E6B A;  4MGK E;  1RXG A;  1K5M B;  4QMA A;  5IHR A;  1ND3 B;  4KWK A;  2OUJ A;  1R1A 1;  5CFD B;  1SMV A;  4CEY B;  1DU3 D;  5JIU A;  1N1S A;  1XYN A;  1OHF A;  1QJY 3;  1AR9 2;  1VMF A;  3KT7 A;  1NCR B;  4YYO A;  2P37 A;  3VD4 A;  1T2X A;  2MEV 2;  3MIG A;  4XTP A;  2RM2 3;  1PNG A;  4TXW A;  4B3N A;  3WDV A;  1QXP A;  1LEM A;  1U5X A;  4K7J A;  5FAX A;  4YW4 A;  5KHG A;  1RUG 2;  2CY6 A;  5IJR A;  3CNA A;  4N53 A;  2XLG A;  3VDD C;  5AC9 2;  1DQ4 A;  1JN2 P;  3O0X A;  1PIV 1;  4HK8 A;  1O3T A;  1S2K A;  3GZA A;  2NPI A;  4GH4 A;  1CAX A;  1APN A;  1T6G C;  1BJQ A;  4ZXK A;  1V6L A;  3V65 A;  4OUL A;  2D40 A;  1QEX A;  2VMC A;  1SLL A;  3HN1 A;  1A78 A;  3LGR A;  1YUD A;  4BQX A;  2BZD A;  4HZF A;  2RM2 2;  2R04 1;  5CBL A;  4XE9 A;  1VBB 1;  5B4X A;  3BTX A;  3RI8 A;  1QHD A;  1DQ1 A;  1AYN 3;  3VKN A;  2PXJ A;  3H7Y A;  4I0W B;  4MGY E;  1AR7 1;  3I2H A;  4LR4 A;  4HT1 T;  5DUU A;  3HQU A;  3N9N A;  4RSU A;  4FSJ A;  5IVB A;  3PVB B;  2P34 A;  1CAW B;  2OUH A;  2GU9 A;  1M06 G;  2P17 A;  3POB A;  4XIK A;  3VLB B;  1NE6 A;  3WHU A;  1KEX A;  1QQP 3;  4G3Y C;  1C8N A;  2UWA A;  3VKF C;  2WYF A;  5C3P A;  4XUO A;  4LKS A;  1BMV 2;  4ONU A;  1X82 A;  3BTA A;  5AVP A;  1UYX A;  4PF1 A;  4PLO A;  4Q1P A;  5H9S A;  3D0S A;  1UIJ A;  3A21 A;  4J25 A;  3OSD A;  3WIN E;  5C70 A;  3O1P A;  4BCU A;  4RS5 B;  1YXW A;  3PVO A;  4MGZ E;  4AHX A;  4M4R A;  3WR0 A;  1PMI A;  1AXY A;  5GZF A;  1UYY A;  1JYI A;  2Y64 A;  5LA0 A;  4FOY A;  3CEW A;  1H6Y A;  1V6O A;  1G7Y A;  1XE8 A;  3X29 B;  2RS1 1;  3H1Y A;  2BU9 A;  1UY3 A;  3POI A;  3UKN A;  1BMV 1;  1AL0 G;  1RYY A;  1IPK A;  1VB4 A;  4EZ4 A;  4DO0 A;  1IZ3 A;  1IGO A;  1ND3 A;  3ACF A;  4I01 A;  4P00 B;  4P9I A;  2Y6J A;  4RS5 C;  3GBG A;  1JH5 A;  1X33 A;  4LKF A;  4ZY9 A;  1A6C A;  5B2G B;  1XNA A;  5ACA 1;  1OA2 A;  1ZBA 3;  3VBO B;  1FOD 3;  4ES9 A;  2CU5 A;  3AYD A;  2VE1 A;  1NAE A;  1RUI 3;  2VOT A;  2ZMN A;  4H14 A;  5FO7 B;  3WT3 A;  1JYW A;  1JYT A;  2AGS A;  1UX6 A;  1WW5 A;  5A32 B;  4TLF A;  1R1Z A;  4KGG A;  5FWE A;  4URT A;  4XFG A;  5FZE A;  4PLN A;  4WM8 A;  4LK6 A;  3UGG A;  1ULG A;  2VMH A;  2FDF A;  1H8T C;  3AMN A;  3PIJ A;  2IFW A;  3NVC A;  1W9Y A;  1DGW X;  4A42 A;  2WYS A;  1CZS A;  3U11 A;  2QQJ A;  3IDE A;  4MH0 E;  1D4V B;  4AF9 A;  4AFC A;  2IXI A;  1PK6 B;  1URX A;  2ET7 A;  4AQ6 A;  2YU2 A;  4K1Z A;  4YG0 A;  3RZG A;  3ZN5 A;  5FO8 B;  5A3W A;  1DQ5 A;  4JRA A;  4O61 A;  5FYI A;  3KCC A;  1R09 3;  1U0A A;  2XBO 2;  2WWJ A;  3IT8 A;  2VMF A;  2Y38 A;  4AVT A;  4RGG A;  2DVB A;  2Y0I A;  4OHZ A;  4XEZ A;  1GQP A;  1Q5O A;  3EYP A;  2G9F A;  3H42 B;  4ZZ5 A;  5LA1 A;  2G9Z A;  1DG6 A;  1VP6 A;  2RDN A;  4YLZ A;  3MIB A;  4FAG A;  4YG6 A;  2BBV A;  1OUX A;  2ARX A;  3KVB A;  5DXD A;  1XC6 A;  5T3N A;  2V5D A;  1OQ1 A;  4XHB A;  2GH8 A;  4XQW A;  1NA1 C;  3CDZ B;  5FZL A;  4URA A;  4DUV A;  2R0H A;  4OFG A;  1GWK A;  5D8A B;  1QU0 A;  1JMU B;  1UZZ A;  2YGM A;  2RS3 1;  5CIR A;  1XU2 A;  3AP9 A;  4FFI A;  2VY0 A;  2CHH A;  3ZOI A;  4BQY A;  1CX1 A;  4XF1 A;  4XZU G;  5A33 A;  1YQ5 A;  2XLF A;  4NVP A;  1RED A;  4WVM B;  1R08 3;  2DUO A;  3OBZ A;  2IFR A;  1DQ0 A;  1KDK A;  1RUH 1;  1AXZ A;  2HKX A;  2IZW A;  3KCX A;  1ZA4 A;  2VD7 A;  1QJU 2;  5LAT A;  1DZR A;  1X9T A;  5LBF A;  2XKO A;  3ZYH A;  2BVV A;  3OD0 A;  2Y33 A;  4C1X A;  2PHF A;  3K3N A;  4HBN A;  4CTE A;  1ST8 A;  2JE8 A;  2X53 S;  2ZTN A;  4NJ4 A;  5A3O A;  1HW5 A;  5FPU A;  5I8Y A;  1EAH 3;  3APB A;  3NV1 A;  2ES3 A;  1QF3 A;  4Q4W 3;  3ZYR A;  2P4E A;  2R06 3;  1OLR A;  5DAV A;  1HV1 A;  5FPV A;  3HT1 A;  4XAB A;  2YUE A;  3VDD A;  5T54 A;  1F2N A;  2LRP A;  1HRI 3;  3KT1 A;  5HBA A;  2AYH A;  1OD3 A;  3VKL A;  1Y43 B;  3DPR A;  2VNO A;  3ABZ A;  2CL2 A;  1GNY A;  4UW4 A;  3S5Q A;  4LHL A;  4O9E A;  3UYJ A;  2CAV A;  4MV2 A;  4BOW A;  3DKW A;  2GSY A;  3FFZ A;  2HLE A;  2D5F A;  3SXW A;  5LK5 A;  4Y24 A;  4BPZ A;  1TMF 3;  1VRB A;  1W9F A;  4GWI A;  3CJI C;  2XPJ A;  1AVB A;  2RS3 3;  1C8M 3;  3PIG A;  5A32 A;  1HRI 2;  2RMU 1;  1PGW 1;  3JB8 A;  3WUC A;  2VMI A;  4QM9 A;  3WHT A;  2IVJ A;  4N43 A;  4UFJ A;  4DY3 A;  1QNW A;  3ACH A;  3IAQ A;  3AVR A;  2D6L X;  4IER A;  5DAB A;  2Q8C A;  4AHZ A;  3PME A;  3BAL A;  4IUG A;  4QKB A;  3RVH A;  5FLJ A;  4A41 A;  1QQP 2;  1CGP A;  1Y9Q A;  4LHK A;  2BTV C;  5FP8 A;  5FYS A;  3SIT A;  1TZO A;  2UWC A;  1VMJ A;  2WIN B;  2ZEX A;  3EO6 A;  1DDL A;  1BEV 2;  1YLL A;  2YHJ A;  4Q4X 2;  2GMP A;  4AED A;  3H8O A;  4D6R A;  5BXX A;  1ZRE A;  2GN3 A;  3LA2 A;  2TNF A;  1BKZ A;  2FDK A;  4Q4V 2;  4QGN A;  3R4U A;  3N7K A;  2ADE A;  1P8J A;  4QPI A;  3IB3 A;  1MQT A;  5JDB A;  1MS0 A;  3IAP A;  3POG A;  4LIT A;  1CD3 G;  1Q56 A;  3I2J A;  4MVT A;  3WQ1 A;  2A6V A;  4W8J A;  3ZXD A;  1GZC A;  2Y26 A;  2VXR A;  1CVN A;  1F8V A;  1QJE A;  4AAP A;  5J96 B;  3BGA A;  1HXS 3;  1VBE 1;  2GP3 A;  2P6C A;  5DAW A;  1O8P A;  1PO2 1;  1WCQ A;  4WVM A;  5DQ0 A;  4YZ2 A;  1S0I A;  5DUX A;  1C57 A;  1DGW A;  4A44 A;  3OD4 A;  2D5H A;  2WLQ A;  3H8X A;  2QQI A;  5FZK A;  1NQJ A;  2VO5 A;  1FMD 3;  3DYP A;  1EPZ A;  2Q5T A;  4UOJ A;  1KS5 A;  5JSP A;  3FBY A;  1PZ7 A;  3USS A;  5IFT A;  3ILF A;  4AVC A;  5FP3 A;  3NW4 A;  3WCS A;  4CDX A;  5FCC A;  3Q8A A;  2CGP A;  4FFF A;  3WNK A;  1N1V A;  2LW8 A;  3ZVX A;  1CAV A;  2ZEW A;  2RJL A;  3OUH A;  1N1T A;  4MOA A;  2OW4 A;  4IE4 A;  3H0O A;  4JGZ B;  4Q4Y 3;  3MDP A;  2E26 A;  1EV1 3;  1UU4 A;  1UZV A;  1EV1 1;  4ISR A;  4GJZ A;  3QBQ A;  4QHO A;  3VBF C;  3AZV A;  3N36 A;  5DDJ 1;  1B35 C;  3ST7 A;  2RS1 3;  2W1S A;  4HXC A;  1LOC A;  3WNX A;  2WO3 A;  4MXW B;  4XJ8 A;  4CP1 A;  1US3 A;  1YCI A;  5FY4 A;  3KV5 A;  3T3Y A;  1ND2 C;  2JG9 A;  1A8D A;  2KD7 A;  1CQ9 A;  2QDR A;  3LPF A;  3NO8 A;  2XQR A;  2A6Z A;  3IPV B;  5FQ0 A;  4PDW C;  2ETE A;  1PX3 A;  2VCB A;  1RUE 2;  5EFU A;  4BZ4 A;  3WF2 A;  5C4W C;  5IK5 A;  5JI7 A;  3WY6 A;  1F15 A;  3T30 A;  2NLR A;  5F3C A;  3BOW A;  4S2H A;  5JMC A;  1UIK A;  3BU0 A;  3PUA A;  3UL2 A;  4OMD A;  3UES A;  3A0K A;  3OGV A;  1SLA A;  5BNN C;  3K75 B;  1W8N A;  4EWD A;  1CAU A;  3KS7 A;  3VBS A;  2ZCW A;  4GJY A;  1W6P A;  2VZQ A;  3H9A A;  3ZXL A;  2OS2 A;  5T5O A;  1WCD J;  2EXI A;  1H2K A;  3LEG A;  3VZO A;  1SBD A;  1GZW B;  1AYN 2;  4EN8 B;  1NCQ C;  4J1X A;  4F7Z A;  1RUJ 3;  3MHZ A;  1AYN 1;  2P2K A;  5ANN A;  3DF0 A;  5LAS A;  1RL3 A;  4E9K A;  2CWM A;  3RJR A;  4UYB A;  2VW2 A;  1ULD A;  4ZS3 A;  2JEM A;  4JDN A;  4XAA A;  4AXO A;  2ZGM A;  4YM3 A;  5C6C A;  5B4N A;  3VKO A;  1H1M A;  3MV0 1;  4DS0 A;  4P9G A;  1I1E A;  3UJQ A;  3BUC A;  1DFQ A;  5KBF A;  4QPG C;  1SCS A;  5LZ6 A;  2RS5 1;  3BYW A;  5JOX A;  3FE5 A;  5D1I A;  5FMO S;  4YW7 A;  1YYN A;  2J1S A;  1C8M 1;  2YU1 A;  3U0Z A;  3RZJ A;  1PGL 2;  1CAW A;  1C8M 2;  3ETP A;  2ZX1 A;  4LIU A;  1ULP A;  3J7N A;  5E8A A;  3AYA A;  4KNC A;  1SBF A;  4LIV A;  4OHW A;  3OF1 A;  3W5N A;  2VUC A;  4HKL A;  2CV6 A;  4QKN A;  3VD5 A;  3HT2 A;  3H3U A;  2Q1F A;  2A73 B;  1R1A 3;  2WN3 A;  4E4D X;  1JXN A;  2E33 A;  3CO2 A;  3E6C C;  1BLZ A;  4JGZ A;  4YGB A;  5FZ6 A;  3KF5 A;  1QJX 3;  2XWB B;  3T0D A;  4MLO A;  1POQ A;  2GME A;  1ZZC A;  3LKJ A;  3C7G A;  2OX0 A;  4KBZ A;  4AVB A;  5AC9 1;  1YI7 A;  3R6S A;  3NNG A;  1H1I A;  4Q4W 1;  1DQ6 A;  2PLV 1;  1EAH 1;  1AR8 1;  3AMQ A;  1OKO A;  1JBC A;  2NMO A;  2O14 A;  3CIH A;  3MIC A;  3R4D B;  4YM1 A;  1AR8 2;  4EN0 A;  4NWW A;  3AP5 A;  2WZE A;  1OOP A;  4PJY A;  4XF0 A;  5FFO C;  4D8M A;  5LRS A;  1ZRC A;  1VAL A;  2J7M A;  3FWE A;  3QH6 A;  2LRO A;  4JGY A;  4XVH A;  2P3Y A;  5F8P A;  3T4V A;  4HSL A;  3U14 A;  2VZ1 A;  3WLU A;  5GM0 A;  2GNM A;  3PUI A;  1RUH 3;  5DZE A;  3TN9 2;  2XOM A;  1R08 1;  1ZX5 A;  3ACG A;  5IW0 A;  2Z79 A;  4HPK B;  4CDX C;  2XON A;  1XXN A;  2A3X A;  4AQS A;  4PQQ A;  4COU A;  3HVD A;  1W2N A;  3J8F 3;  2B39 A;  1BK0 A;  2ZGR A;  2RDQ A;  4FPL A;  2VME A;  3N9P A;  4MX3 A;  1EY2 A;  2ATF A;  4IES A;  5JPM B;  4PIZ A;  2ZJC A;  1XE7 A;  5HXM A;  2ZZJ A;  3AK0 A;  3LDB A;  2XBO 1;  3DYO A;  2ZHN A;  1PX4 A;  5IK7 A;  1JZ2 A;  1WLC A;  3U37 A;  1CN1 A;  1SFN A;  3RGB A;  1SEF A;  4GB3 3;  1A34 A;  2VOK A;  5J7M A;  5IAT A;  1HB1 A;  3THP A;  5KHJ A;  3U75 A;  3HNM A;  4K6B A;  3ZFE B;  1FAT A;  4MXW A;  5EV7 A;  5J98 B;  3ZKY A;  4SLI A;  3PU8 A;  4NPM A;  4RD7 A;  1ASJ 3;  3JBG 2;  1LOF A;  1RUD 2;  1TE1 B;  4Y3O A;  5FRE A;  1V00 A;  1UMZ A;  4ZKT B;  5FUI A;  2B7Y A;  1MQT C;  2ZHM A;  5C8C B;  2VBP A;  1NLS A;  2ZHK A;  3ACL A;  5DZG A;  3ZFF C;  1SFY A;  4ARY A;  1V6J A;  3ZPO A;  5F37 A;  1UOF A;  1Z7S 3;  2VCM A;  4OLL A;  1HB4 A;  1RIT A;  3BKZ A;  5FZC A;  2DDU A;  5JZG B;  3DN7 A;  3GBF A;  3NJX A;  5LB6 A;  1SCR A;  2I2S A;  3C8X A;  1VBA 3;  4CCC A;  3EBR A;  1HLC A;  1YI9 A;  4LQR A;  3RRD A;  1AJO A;  5ACA 3;  2XDV A;  2VZP A;  4GUL A;  1AR9 3;  2G19 A;  1JHJ A;  1CON A;  2NQY A;  2Y6F A;  3K2O A;  3VBS B;  2A3W A;  4BB3 A;  4CYD A;  4OI0 A;  3VZL A;  2ZAH A;  1PO1 1;  2XG3 A;  1WBF A;  1FT9 A;  5L73 A;  2PHL A;  4L99 A;  3B7M A;  1SZB A;  3NV3 A;  3I2F A;  4J1W A;  1K3I A;  1GAN A;  3KMH A;  4RR3 C;  4X6R B;  4CDU C;  1UU5 A;  1OUR A;  1OI6 A;  1PHM A;  1XRU A;  5GLV A;  1CZV A;  1WZX A;  5BNO A;  1HX6 A;  2ZGU A;  2D3R A;  4HAN A;  5K4L A;  3L2H A;  5C4W A;  4QU2 A;  3S6P A;  4CP9 B;  2RJ2 A;  4CXY A;  1JS9 A;  1LGN A;  4GWN A;  4DIQ A;  3MEP A;  4I2O A;  1TG7 A;  4W6W A;  1H8V A;  3THT A;  4CUB A;  3DPR B;  1LU1 A;  1OF3 A;  4RHV 2;  1Z0H A;  3MW4 A;  4BA6 A;  3EXU A;  4XTM A;  1DLL A;  2IXJ A;  2DYC A;  4BQ2 A;  1LUL A;  2F17 A;  2WJS A;  3B00 A;  4LBQ A;  4EZH A;  2W87 A;  2YFU A;  4OCT A;  3I8T A;  5CKQ A;  4FPY A;  2BQP A;  4JX0 A;  4P9L A;  1ACC A;  2ORX A;  5FYU A;  1JOD A;  2FD8 A;  3HR9 A;  4UFL A;  2WFP A;  4LO5 B;  4QX0 A;  1JUI A;  3OUJ A;  1QQP 1;  2P1B A;  3CF6 E;  1HN1 A;  2D6K A;  2VH9 A;  1HRV 1;  5FK8 A;  4QQH A;  3SKV A;  2HWF 3;  1KIT A;  3VBR B;  4PCR A;  4XMI A;  2FDG A;  1QH6 A;  5T5P A;  5J37 A;  1RUC 3;  4LE3 A;  4EN7 B;  5BNP A;  4JQR A;  1QXJ A;  3I7D A;  2R04 2;  4P9Y A;  3ENR A;  4CU9 A;  2IXL A;  4CDW C;  3WVJ A;  2D6P A;  4X8N A;  4BH9 A;  4CP0 A;  2W46 A;  4LBM A;  4HVR A;  4C0H A;  4JGY B;  1C5I A;  3KF3 A;  3W20 A;  3S30 A;  4MET A;  4BU2 A;  4BYY A;  1AYM 2;  2DV9 A;  1SDW A;  2RR1 2;  2JE9 A;  1Y4W A;  2BWA A;  1N1Y A;  2W1U A;  2YZ4 A;  1DYK A;  3HNY M;  2QQN A;  3AL5 A;  3ECQ A;  4BQ5 A;  1LHV A;  4K21 A;  5FZF A;  4BLI A;  1ZYB A;  4RN5 A;  4Q0Q A;  2E63 A;  2O8O A;  1FI2 A;  1ZZ6 A;  1GBG A;  1WD4 A;  4CEY C;  2H0V A;  1QJX 2;  4UI9 L;  4WM7 A;  5DG1 A;  2BP6 A;  3B3Q E;  4AGG A;  4Z2W A;  1RGS A;  2YXS A;  3DL3 A;  4G9S B;  2FBE A;  3H1W A;  2WWS A;  2ZAB A;  5JSO A;  1W2A X;  2ZX3 A;  1A3K A;  4LLF A;  3B69 A;  3T1L A;  4AI2 A;  5CYY A;  1N3P A;  1RIN A;  3PJQ A;  1NA1 A;  3T2Q A;  4BQW A;  3MYX A;  1T6B X;  3RS6 A;  4B1M A;  1W2U A;  5CA6 A;  2AR6 A;  1LOF C;  3PJY A;  4CDX B;  2FZ2 A;  5A6Y A;  2GNB A;  4DQA A;  3PNA A;  3H3L A;  5FY9 A;  1HIX A;  4GWJ A;  4UFH A;  3K4D A;  4LBJ A;  2R1D A;  4QPI B;  2Z42 A;  5TSW A;  4HOO A;  3H7J A;  3K3O A;  5EYX A;  2MEV 3;  2QQP A;  4OUM A;  1XQN A;  4EJR A;  2WAO A;  3B9I A;  3G7D A;  4IE5 A;  4UF0 A;  4Q26 A;  4BIO A;  5I0R A;  1LOA A;  4XF9 A;  1RIR A;  3VN4 A;  2Y6L A;  4IV1 B;  1QJU 1;  2RDR A;  3WNL A;  2WNU A;  4LO8 A;  4R9D A;  4YFW A;  5JI9 A;  4XFI A;  3W9A A;  1PZ9 A;  2JG9 B;  3LAG A;  3RI9 A;  5L19 A;  1RUI 2;  3JB4 C;  3BPZ A;  1ZRD A;  3ZN4 A;  1VBC 1;  1NLR A;  3OYW A;  4XBL A;  3BIE A;  4YZ4 A;  1TME 2;  3FC0 A;  4ZU4 A;  2X8K A;  3N35 A;  4DNY A;  1LHW A;  3UV9 A;  3H3Z A;  4FXG B;  3RQ0 A;  4LBQ D;  1AR6 3;  2VPV A;  1AL2 1;  1K45 A;  5FMC A;  3WQ7 A;  3H8U A;  2XVG A;  3MI8 A;  4YW1 A;  1ODM A;  2ZA9 A;  4DY5 A;  4QPW A;  4CU6 A;  3BI3 A;  3PHM A;  2E31 A;  2VAU A;  5FRA A;  4B4P A;  1W8H A;  3I97 A;  3ZR6 A;  4CU7 A;  5IVF A;  1QJY 2;  1UCX A;  3ON7 A;  4M0H A;  2HWD 1;  4FP2 A;  1DLC A;  5JXH A;  1W6P B;  3SHR A;  2WC2 A;  4DXR A;  2EAK A;  2J1T A;  2H6B A;  3G6J B;  1N3O A;  3WF3 A;  4Y4Y A;  1LNS A;  2CTV A;  3AX4 A;  3K77 A;  4Q29 A;  3ZFG A;  1RVF 3;  5DAP A;  3TEX A;  2XQX A;  3LEM A;  2F4L A;  3MPB A;  4Y1Z A;  5LRR A;  2ZGT A;  2JEC A;  3RZL A;  5JWP A;  3TOJ A;  3AJZ A;  3U10 A;  4K20 A;  3JQX A;  5GZC A;  2C4X A;  5KHI A;  2P5B A;  1XNB A;  4LUK A;  1IS6 A;  1H4G A;  2ZX0 A;  3PVE A;  4HK9 A;  1YC6 1;  4RGK A;  2V09 A;  1UNB A;  3FHQ A;  3T2T A;  4EN6 B;  1WBL A;  3DYM A;  4NMI A;  3ZYB A;  1JZ3 A;  1WUV A;  3QH7 A;  4GKX A;  2HWB 1;  1CR7 A;  2QQL A;  4H7L A;  4EQV A;  5LCW L;  1UF2 C;  4V2W A;  4B4Q A;  2B46 X;  5JUV A;  5FZM A;  5DN2 A;  1CIY A;  2DUP A;  1UPS A;  1IQD C;  2F4P A;  2WBK A;  3IMM A;  3NNF A;  4I3P A;  3LFI A;  4K8F A;  1H6X A;  1AZD A;  1C4R A;  1GSL A;  1FYU A;  4F3J A;  4RGA A;  1VE0 A;  3SCF A;  1SDD B;  3ZSM A;  3KV6 A;  3FHI B;  3MLL A;  1ZBE 2;  5FP9 A;  2ZGK A;  5FTT C;  4BQ4 A;  4YG3 A;  4YVW B;  2JG8 A;  2W39 A;  1W0O A;  1ZNP A;  4CDW B;  2AEN A;  1CJP A;  4Z8B A;  2HWB 2;  4V2V A;  1GR3 A;  1HJF A;  2R07 1;  2RR1 3;  3T0B A;  3ZYI B;  1O3S A;  3P6B A;  1OA3 A;  3CZU A;  5IVJ A;  1YQ2 A;  1SFP A;  4LO6 B;  2H6C A;  1HKD A;  1JOB A;  2LAL A;  2WA4 A;  5EPA A;  4FAH A;  4QXC A;  4XQD A;  2Q8D A;  2HWC 3;  5AVA A;  5K0U B;  1BVV A;  1GOF A;  3D5O A;  2FDJ A;  1V6N A;  1KFX L;  1RC6 A;  1UN1 A;  4XDQ A;  2VOX A;  2WNV B;  2Q8E A;  3VB9 A;  1TME 1;  1S0G A;  1ZM1 A;  3FLR A;  3MID A;  3VL9 A;  3OY8 A;  4PI2 A;  2Y6H A;  2D7F A;  3O14 A;  4TLG A;  2DVD A;  3ZMN A;  1H9P A;  5ABJ C;  3OOX A;  4BHP A;  4Q0P A;  5F5C A;  4L2N A;  3VHR A;  4GH4 B;  1OXC A;  2J1R A;  3FN9 A;  4CUG A;  5FZ9 A;  4E4H A;  3ETQ A;  1V6K A;  4L92 A;  1W8Z A;  1BEV 3;  3F95 A;  4Q4X 1;  4IEW A;  4MYE A;  2K46 A;  1IS5 A;  2X5I A;  3AP6 A;  4B8E A;  1PGW 2;  3E5X A;  3NV4 A;  3FL7 A;  5CFC C;  3RFR A;  2Q1M A;  3VBS C;  3BOD A;  2ET1 A;  1VRH 3;  2EID A;  2RS5 2;  4FPH A;  3INA A;  4XDO A;  3UGH A;  4AFD A;  3LDR A;  5F5Q A;  4Z2A A;  1DZQ A;  3FUQ A;  1XPW A;  4QAW A;  2RJK A;  3OCP A;  3BTY A;  4YZ5 A;  2LM3 A;  2JD9 A;  2ORZ A;  3VZJ A;  1QOT A;  4ZXE A;  1FPN 1;  2QZ2 A;  4AL9 A;  2YC4 A;  2QQV A;  1QDC A;  1FPN 2;  4FOW A;  4JDO A;  4YZ1 A;  3I3E A;  4PBP A;  4PIX A;  3TNQ A;  4F83 A;  3ZSL A;  1PVX A;  4M0N A;  3BB6 A;  1YFW A;  3D0J A;  4XZP A;  4OI2 A;  1YNA A;  4QQO A;  5FP7 A;  1DYO A;  2JDM A;  5A7Q A;  4D6S A;  3SH3 A;  1QY4 A;  2C5D A;  4XC9 A;  4Y5Z 0;  3WOG A;  1KGY A;  2QBX A;  3AC0 A;  3CMG A;  3KSC A;  3NJZ A;  1KFU L;  3R05 A;  4IET A;  1VRH 1;  5F2S A;  4RS5 A;  1KJR A;  5FZO B;  1W0P A;  1G9A A;  1CWP A;  2VZV A;  1EV1 2;  2WQ4 A;  1UQX A;  4KL1 A;  1MS8 A;  3LE0 A;  2ADD A;  2NMN A;  1AF9 A;  1ULO A;  3FFQ A;  1YHF A;  4Q4X 3;  4CDW A;  2DCK A;  1K12 A;  1YJL A;  1AX0 A;  1WMX A;  4Y1Y A;  2VZS A;  5F5A A;  3POE A;  4NE9 A;  3MF9 A;  3VBH C;  4MO3 M;  3DPR C;  3DEM A;  3Q8B A;  3KB5 A;  1BXH A;  4NPL A;  4Q4W 2;  5C9A C;  5CAD A;  4QX5 A;  3NNM A;  4PBO A;  1J84 A;  1PZ8 A;  1AX1 A;  4YGD A;  3S57 A;  2G9G A;  3I4I A;  2V5Y A;  5CIS A;  1MS1 A;  2KR2 A;  4NPR A;  1C1F A;  1H9W A;  4FCA A;  2JDY A;  1WWY A;  1Q3E A;  2D97 A;  3AZY A;  3VHP A;  1MZE A;  5FBJ A;  1DGR A;  2FMY A;  1RUC 2;  3LB9 A;  1S0F A;  3P3N A;  3ZX7 A;  5FZ8 A;  5A3L A;  5T52 A;  5A7W B;  3WNP A;  4QDQ A;  4HL0 A;  2JDN A;  4GA9 A;  1W6O A;  2RR1 1;  2EF6 A;  4LKE A;  5CG9 A;  1FV3 A;  5GAL A;  4Y1X A;  2K0G A;  5C9A A;  4OYU A;  2A5Z A;  4IGO A;  5JXI A;  3HAG A;  1UZW A;  3KV9 A;  3NMB A;  1OLQ A;  2YG0 A;  5E88 A;  3JBG 1;  1VAV A;  4IV3 B;  4U2A A;  5SV8 A;  1OPM A;  2HJI A;  1SQ4 A;  4IL7 A;  3S7E A;  2HWC 2;  3VZK A;  3NKG A;  4YAR A;  2WFF 1;  5DAX A;  3VBO C;  2E9Q A;  4NIH A;  2EA7 A;  4GQ7 A;  1VLN A;  3EJK A;  5FQ0 B;  3WDT A;  2VNV A;  3CJX A;  4I09 A;  4JQT A;  2CDO A;  4WV8 A;  3DCQ A;  5EQU A;  5LBC A;  4Y20 B;  1X8M A;  3ASI A;  5F2W A;  1COV 3;  2HWB 3;  4NWV A;  3V56 A;  4YSF A;  5ANQ A;  2XGX A;  3JD7 2;  2GAU A;  5J09 A;  4NIG A;  2WFF 3;  4J6G A;  5LY1 A;  4JTN A;  5C7G A;  1F4H A;  1W9S A;  4CVU A;  1O3Q A;  2DCZ A;  3M8L A;  1H4H A;  2ZGQ A;  3AKT A;  3JBG 3;  4FPK A;  4NR1 A;  1JHN A;  1WCS A;  2JDA A;  2XKP A;  1VJ2 A;  3KQ4 B;  1XYP A;  2BDR A;  1C3H A;  2VJX A;  4QHZ A;  3C7H A;  3NNJ A;  4DOU A;  2C1F A;  1HQL A;  3ZN6 A;  5C71 A;  3WP3 A;  1Q8S A;  3OJB A;  3IWZ A;  3WW4 A;  2WO2 A;  4FPC A;  4RYD A;  3ZXG A;  4D69 A;  5FZ4 A;  1EUU A;  2C24 A;  1ULC A;  1O7F A;  1NLQ A;  2CDP A;  3M1H A;  2BOJ A;  1E5I A;  1I5P A;  4QGM A;  4Y33 A;  3A7Q A;  4C1W A;  1GIC A;  4CUA A;  3P1I A;  4GWM A;  1OOP B;  4HPK A;  2Z69 A;  1H8T A;  3B01 A;  4AE2 A;  1N3Q A;  1O4Y A;  2GAL A;  3Q8F A;  1AL2 3;  4XHX A;  1XYO A;  1AR6 1;  5I93 A;  2AAC A;  4AAX A;  5J36 A;  1UW8 A;  2ENR A;  3O1R A;  1CX4 A;  1S0C A;  2WLP A;  4AEK A;  3J8F 2;  2GMM A;  3JXS A;  3MBW A;  2JDU A;  5A3P A;  1L7L A;  3B02 A;  4IE7 A;  4TYS A;  2A7A A;  3TYJ A;  3IN9 A;  1VIW B;  3LQC A;  4AI0 A;  2XJS A;  4M3C A;  3JUU A;  4H2A A;  1R1A 2;  3AZX A;  1BBT 1;  2PA7 A;  1W8F A;  3UGF A;  1QJU 3;  4YRD A;  2VNR A;  1PK6 C;  3LWC A;  2DF7 A;  2J1U A;  2RG4 A;  1LOD A;  1AR7 2;  1REE A;  4AR2 A;  2DVF A;  4YNI A;  5IVC A;  4QGL A;  3I49 A;  4ET7 A;  2Y60 A;  5KXB A;  3KCY A;  2R06 2;  3NNL A;  2YC0 A;  4HSJ A;  2WNU B;  5FZD A;  3A4U A;  3VD9 A;  4ZHN A;  3O12 A;  2PAE A;  3C7O A;  2EXH A;  5CVR A;  4Q1R A;  3RJ2 X;  3WW2 A;  3KQR A;  4BJ0 A;  2VZR A;  3ZSK A;  2PHX A;  4XJZ A;  1W99 A;  3R0R A;  2PQS A;  2W5F A;  3ZFE A;  4H3W A;  4N53 C;  3RSJ A;  5K7P A;  2XJT A;  4XDP A;  2R16 A;  4JVA A;  2VQA A;  4NII A;  3ZYG A;  4FPG A;  4FPF A;  4BQ1 A;  3IM0 A;  3QAC A;  4OI1 A;  4AI3 A;  1NCR A;  2VCC A;  4V1P A;  3M3C A;  3HPN A;  4WZC A;  3WUD A;  2ARA A;  5F39 A;  1LJ7 A;  3ZDS A;  5M0T A;  3E6D A;  5CAZ A;  3KLS A;  5FOB B;  4LUM A;  1HDK A;  2J1V A;  1GV9 A;  5KHH A;  5A6Z A;  2VUJ A;  4YGC A;  3WEZ A;  4D6Q A;  1H2L A;  2X10 A;  2BW8 A;  5D8A C;  3UK9 A;  3KT4 A;  2WII B;  4MGT A;  2XR4 A;  5BNO B;  1WW4 A;  4AED B;  1UPI A;  2D6O X;  4HKW A;  1MZ6 A;  1QJZ A;  3GZT B;  2LS6 A;  4CP9 A;  2VXJ A;  4CPB D;  3A23 A;  1F4A A;  4XCA A;  4HN0 A;  5I8S A;  3T08 A;  3VHO A;  1GZ9 A;  1H8T B;  1ZZB A;  1IG0 A;  2JKB A;  5F1R A;  1FNZ A;  3M7A A;  4IV3 C;  1LU2 A;  3OUI A;  2JJ6 A;  3SKJ E;  2VZO A;  3R4S A;  4AOC A;  3KVA A;  4DFS A;  3HEI A;  1N47 A;  1VAM A;  1W6Q B;  4LBK A;  3T2O A;  2RMU 2;  3VGI A;  3WSO A;  3MFA A;  1AYM 3;  4FQ4 A;  4GKY A;  4O65 A;  1O59 A;  3CQO A;  3AKQ A;  2IVI B;  2IXC A;  4NRO A;  2HBT A;  2GP5 A;  1HRV 2;  4HN1 A;  3O7O A;  1GQG A;  1QKQ A;  1JZ5 A;  1XNT A;  5CFC B;  1OOP C;  2XJR A;  3LIG A;  4UFM A;  3ROU A;  4BIF A;  2DUQ A;  4BLJ A;  5JOY A;  3LZZ A;  1V6M A;  3BU7 A;  4A2U A;  3HNB M;  3ME2 A;  3VD3 A;  4AHW A;  1IG3 A;  3WW3 A;  3ACI A;  1S2E A;  1UZ0 A;  4AVV A;  2ZEZ A;  1UYZ A;  1CES A;  1U12 A;  4AWD A;  3RZM A;  4MXV A;  3TAY A;  3BN6 A;  4QXB A;  5FZA A;  3T2P A;  3GAL A;  1BK1 A;  2JEN A;  2BVB A;  2XJU A;  1XBF A;  3H1M A;  1PVC 3;  1W9T A;  2R6Q A;  2VZ3 A;  1OFN A;  4N9H A;  4ZPI A;  4YGE A;  2UUR A;  3NAP B;  4YW5 A;  3Q9O A;  1V9U 2;  5LA2 A;  4Z92 B;  2DFB A;  2Y8K A;  1W06 A;  4JCK A;  3VBO A;  2WS9 2;  3U07 A;  3VBU A;  2ZKN A;  4JKL A;  2CNA A;  1FV2 A;  4IEO A;  4QT6 A;  1EYB A;  1W8W A;  1YIP A;  4B7K A;  2HWE 1;  3K46 A;  5F7U A;  1UOB A;  2BNM A;  2JB8 A;  3LA7 A;  5JR7 B;  4IE6 A;  3S5A A;  2DFC A;  2D3S A;  1OKQ A;  2I07 B;  1W39 A;  2YPJ A;  4XET A;  1NY7 2;  1W6N A;  2C26 A;  5FMD A;  3CJI A;  5JR2 A;  4RHV 3;  4YM2 A;  5JVV A;  1RTV A;  1LOG A;  2WT0 A;  1RXF A;  3HJR A;  3J7L A;  4IEQ A;  1PK6 A;  3CLP A;  4W65 A;  4XUT A;  5HCA A;  2GC3 A;  1UU6 A;  4Q8L A;  4ZS2 A;  4A3Z A;  1K42 A;  2G1M A;  4Q27 A;  3GCW A;  1PM4 A;  3K48 A;  2KXL A;  2OVU A;  3USU B;  4IV1 A;  5JIA A;  4AEM A;  5K9Y A;  2ZX4 A;  1W2T A;  1DBN A;  3AZW A;  4AQT A;  5A7N A;  4DPN A;  4IXL A;  1QOS A;  3SH4 A;  1YWK A;  3WP6 A;  3MIH A;  3MLK A;  4AGR A;  4NRQ A;  3VDC A;  1WLT A;  2DCJ A;  2E7Q A;  1IPJ A;  4WM7 C;  3ZDV A;  4DIN B;  2R07 2;  4LEJ A;  1G9B A;  2WRA A;  3GF6 A;  4IEZ A;  3OB8 A;  4HFS A;  2HEY F;  3LF7 A;  2WT2 A;  2A75 A;  4N7U A;  4XAE A;  3QCW A;  4R4X A;  3WV6 A;  4OQ8 A;  4P5H A;  1YQ8 A;  3ZXF A;  4D7S A;  3ZYF A;  2QCS B;  2WZP P;  3ZXA C;  3V0A B;  3NKT A;  4H55 A;  4B29 A;  4YZ3 A;  5C5T A;  4CUC A;  4CCL A;  5FY5 A;  3BPS A;  1SLC A;  3UJO A;  1FOD 2;  1M4W A;  3WDX A;  4NHY A;  3PUH A;  4I02 A;  5JXJ A;  4YM0 A;  2R30 A;  2VQ0 A;  5K0U C;  4CRQ A;  5HPO A;  1GMM A;  4XJU A;  1FXZ A;  3MZH A;  2QZ3 A;  1W03 A;  1PGL 1;  1NT0 A;  3NAP A;  3SCH A;  4PI0 A;  3ALQ A;  4ZZ8 A;  3D3A A;  4QXH A;  5FLI A;  3FMG A;  1WLW A;  5T50 A;  2GND A;  1LCL A;  3J7M A;  1MQT B;  2J1E A;  5AFE A;  5C8C C;  2KM2 A;  2ZZQ A;  3TN9 3;  4XF3 A;  2VBB A;  2ID4 A;  2ZGL A;  4TTG A;  2VL4 A;  2BFU L;  2ZBJ A;  4HET A;  2WZR 1;  4IV3 A;  1NE4 A;  4LJH A;  1I3H A;  4N7I A;  1UZY A;  1I9R A;  1YIF A;  2DU1 A;  2EVX A;  4W6Y A;  1HXS 2;  4H7M A;  4YPJ A;  1VAK A;  2A6Y A;  4CCJ A;  5LWB A;  4R9A A;  4CSW A;  4I3G A;  4ASL A;  4WBB A;  2PHD A;  1NX9 A;  3KHB A;  3PU3 A;  4IE0 A;  1G86 A;  4RFR B;  5E1R A;  1LHN A;  1ZBE 1;  1UYP A;  3POW A;  4LXL A;  4XUP A;  4EE2 A;  1PMJ X;  4AG4 A;  5HI0 A;  4AED C;  2YMZ A;  3LIH A;  4YFZ A;  3K4Z A;  4XW3 A;  1IS3 A;  2AC1 A;  1UY0 A;  1IS4 A;  2DTY A;  3GZU C;  5F32 A;  1LGC A;  5EYY A;  5H9Q A;  5JOZ A;  1DYP A;  3NQH A;  1RUJ 1;  1HQW A;  3I59 B;  4QB2 A;  3WP5 A;  2HEW F;  5IAX A;  1LHU A;  3CZJ A;  5FMO L;  3LDK A;  2YGL A;  3ITQ A;  2JWP A;  1RHI 2;  1W6M B;  4FP3 A;  1RUC 1;  4JRL A;  4M3C F;  5E16 A;  5H9P A;  5IWF A;  1ENS A;  5A1F A;  1Y7B A;  1GZT A;  4C8D A;  1HRV 3;  2F6B A;  4S2G A;  2PHW A;  1AR6 2;  4GH4 C;  4A3X A;  1JYV A;  1GLH A;  1W2O A;  4AI9 A;  3U4X A;  3AYE A;  3FUO A;  1SPP A;  2SBA A;  3POS A;  4FPE A;  3OPW A;  4FVV A;  1MAC A;  1XE0 A;  1G8W A;  4EYU A;  1J3P A;  4MG2 A;  4N53 B;  4IEX A;  4M3C E;  5L9R A;  4I30 A;  2JIJ A;  5K0U A;  1XU1 A;  1F5J A;  1VBA 2;  2VOV A;  1VBB 2;  4BQ3 A;  5IK8 A;  3CU7 A;  3J7H A;  2OPW A;  2WNE A;  4XIL A;  4R4Z A;  5H9R A;  1D4M 1;  5EJZ B;  3BIW E;  4HON A;  5C4W B;  1LRH A;  5LBB A;  1JOJ A;  3PDQ A;  3ZN6 B;  3AFG A;  4WVV A;  4ATF A;  4S2F A;  5LY2 A;  2Q30 A;  2O1Q A;  4G4F A;  3BOP A;  1DHK B;  1Y3T A;  2B4K A;  2JDH A;  2VBD A;  2WA3 A;  2X29 A;  5FIX A;  2X05 A;  4DB5 A;  1G9C A;  2W2I A;  4Q4Y 1;  1PO1 3;  1PNF A;  5C3S A;  2RE9 A;  5D21 A;  4ES8 A;  3TEW A;  4K3U A;  2VTX J;  3WNN A;  4QXK A;  5A1L A;  3T0A A;  1F35 A;  3LPG A;  1WKY A;  4AW7 A;  5FWJ A;  3N7L A;  1MVQ A;  2E7T A;  4IEV A;  3URF A;  3WW1 A;  4A4A A;  3ZKU A;  3AMP A;  4AGV A;  1Z7S 1;  2E6V A;  2AUY A;  1U5Y A;  1LR5 A;  4BMB A;  1D0G A;  2Q1Z B;  4XJA A;  4CDQ B;  1OT5 A;  1PO1 2;  2JE7 A;  2PHT A;  2XUE A;  1HXS 1;  1IQA A;  4FTS A;  2WAA A;  1LED A;  3MUZ 1;  4DXT A;  2UY9 A;  2ERF A;  2RHP A;  2ZKL A;  1Q43 A;  3IZO A;  3VBU C;  5C5U A;  5ISL A;  2TUN A;  1ASJ 1;  2E7A A;  3CKH A;  3O0V A;  2PYT A;  1GUI A;  1YO8 A;  1NCQ A;  2A6W A;  3B9C A;  5FPB A;  5JCT A;  4FOQ A;  3WF0 A;  3LSD A;  4RR3 B;  4GB3 1;  2ZMK A;  4Q5O A;  2XHK A;  4K1Y A;  1JU3 A;  4DUW A;  4OHV A;  5FJK A;  3AB0 A;  1GP5 A;  2R1B A;  4YVS B;  4CE8 A;  3OGG A;  4I0A A;  4AFB A;  1I5Z A;  5FYC A;  2L9L A;  2XBO 3;  1ENR A;  1C5H A;  4JKM A;  1ZBE 3;  1XNK A;  2OT7 A;  3M3I A;  4PDW B;  4Y5T A;  1ZZ9 A;  5D8A A;  5A80 A;  1ND3 C;  3N7J A;  1K5M C;  1JYX A;  2D93 A;  1XND A;  3OGR A;  3ORJ A;  5GJ6 A;  4CEW B;  2W95 A;  2RMU 3;  2DBN A;  3M3Q A;  2ZHL A;  1SG3 A;  3J8F 1;  4LTA A;  2BUK A;  1OC1 A;  3C3V A;  4GB3 2;  4IEY A;  1UXX X;  1KDM A;  4LBL A;  1OSG A;  2VCA A;  4JHZ A;  2Q8O A;  3HBZ A;  3S0M A;  1XSR A;  5IVE A;  1WCK A;  3OBA A;  3Q8E A;  5L9B A;  2GNT A;  4CCD A;  2VUA A;  1US2 A;  2H0B A;  4DUX A;  4PQ9 A;  1VR3 A;  3OPZ A;  4LT5 A;  2YDE A;  3ZXJ A;  3AZZ A;  2X09 A;  5FYV A;  3TN9 1;  3ZFG C;  5ABJ B;  3EMR A;  4M00 A;  3AXE A;  2W08 A;  4B7E A;  1X50 A;  2NYY A;  1OPO A;  4JZR A;  4BWO A;  4BK4 A;  4QX3 A;  5E89 A;  1OH3 A;  4LOR A;  3AXD A;  5E6H A;  2VC9 A;  3BVC A;  3SNM A;  3CBN A;  1AR8 3;  2Q0A A;  4XFC A;  3HBK A;  2DWR A;  2R06 1;  2Z5W A;  4P9X A;  5FYY A;  4CCM A;  3P3P A;  1W28 A;  2J42 A;  3VDB A;  2QNK A;  4ERO A;  4UF0 B;  2BV4 A;  3AVS A;  4UFK A;  1QJX 1;  1J1L A;  1KJL A;  3NL1 A;  2VVD A;  5A7O A;  5GLW A;  4COZ A;  4QKD A;  3T09 A;  5KXC A;  2VZU A;  1MZF A;  1ZVF A;  3HD8 B;  5FZ1 A;  3M70 A;  1LOE A;  5FMB A;  4DEV A;  1AHS A;  3OYW B;  1WW6 A;  2R49 A;  2AZ5 A;  5F6L B;  3O1U A;  3MUY 1;  4CXW A;  5L7O A;  3ILR A;  5FZ7 A;  3U1X A;  4AYU A;  2CSG A;  3A0N A;  5FYH A;  2QQK A;  5ABJ A;  2J22 A;  4P5Y A;  4A7Y A;  3THC A;  5A33 B;  5FZ0 A;  5GLT A;  4Q2F A;  3PUR A;  3UT0 A;  2RS5 3;  1TQ5 A;  3LCP A;  4TZD A;  2WQZ C;  1LAJ A;  3WX5 A;  5I0D A;  1O4Z A;  2LTN A;  4KWJ A;  4MGQ A;  1B35 A;  5GLU A;  5K8S A;  3OEA A;  2X5I C;  1RUF 2;  1OA4 A;  3F2Z A;  4RR3 A;  1UY2 A;  2ARC A;  3GYD A;  2P3I A;  1W8O A;  4MZU A;  3MGU A;  3ES1 A;  2HEV F;  5FY1 A;  3MIE A;  1V0A A;  1UWW A;  1RUN A;  4WZF A;  1DQ2 A;  1Y9M A;  2W94 A;  4R9B A;  3WNM A;  1R09 1;  4C91 A;  4NUB A;  3CJI B;  3RYP A;  3TRS B;  1RB8 G;  4RHV 1;  3GDB A;  3B5L B;  4AVA A;  5CFD A;  1CIW A;  5APA A;  2N7G A;  2OQ6 A;  1OQE A;  5FKB A; 
#chains in the Genus database with same CATH homology
 4EZ4 A;  5FUP A;  5FXX A;  4DO0 A;  4XDO A;  4IGQ A;  5FP4 A;  5ISL A;  5FY8 A;  2Q8C A;  3AVR A;  4IGP A;  4CCO A;  5FXV A;  2YU1 A;  5K4L A;  4CCK A;  3U78 A;  4QXH A;  5IVV A;  3RVH A;  4QWN A;  5FPB A;  5FYZ A;  4LIU A;  5FP8 A;  5FYS A;  5IVF A;  2GP5 A;  4LIV A;  4DIQ A;  5FZ3 A;  5FZ4 A;  5FJK A;  3N9Q A;  4D6R A;  2XML A;  4Y33 A;  4GAZ A;  3PUS A;  5FYC A;  2YBP A;  4EZH A;  5FZ6 A;  5FP7 A;  5FUN A;  5A7Q A;  5FWE A;  4CCJ A;  3ZLI A;  4CCN A;  5FZE A;  4D6S A;  5LWB A;  4LIT A;  3DXT A;  2OT7 A;  5A80 A;  2OX0 A;  5FYU A;  5A7S A;  4CSW A;  5F2S A;  3PU3 A;  5FZO B;  5A3T A;  4ASK A;  4QXB A;  4AAP A;  2P5B A;  5FZA A;  4LXL A;  2GP3 A;  3N9L A;  5A3P A;  5FZG A;  2YU2 A;  5F32 A;  5FY7 A;  5FPL A;  5IVE A;  5A3W A;  5A7P A;  5FYI A;  5FZB A;  5FZK A;  2WWJ A;  4V2W A;  3PTR B;  5FZM A;  5F5A A;  5IW0 A;  3LD8 A;  5FYV A;  3PUQ A;  5IVC A;  5IWF A;  5FP3 A;  5A1F A;  5F3E A;  4C8D A;  4BIS A;  2OQ7 A;  4BU2 A;  5FXW A;  3KVB A;  5E6H A;  4AI9 A;  3KV6 A;  3N9P A;  5FZD A;  3AL5 A;  5F3G A;  5FP9 A;  5FYY A;  5FZF A;  5FZL A;  4CCM A;  3OPW A;  4URA A;  4GJZ A;  5FYM A;  5F5I A;  4EYU A;  4UF0 B;  3AVS A;  4BXF A;  4CCL A;  5FJH A;  4V2V A;  3LDB A;  5FZH A;  3AL6 A;  5KR7 A;  3DXU A;  4QU1 A;  5A7O A;  2YBK A;  2PXJ A;  3KV5 A;  5FY4 A;  5IVJ A;  5FBJ A;  5FZ1 A;  4XDP A;  4Y4R A;  5FZ8 A;  3N9N A;  3N9O A;  5A7W B;  5IVB A;  2VD7 A;  4HON A;  4QXC A;  5FZ7 A;  5FZI A;  3PDQ A;  5FYH A;  2WWU A;  2Q8D A;  3K3N A;  5FXZ A;  5A7N A;  5F39 A;  5FZ0 A;  5LY2 A;  5A3N A;  4IGO A;  5FPU A;  3PUR A;  3PU8 A;  3KV9 A;  5FY9 A;  4GD4 A;  4Y3O A;  5F3C A;  2Q8E A;  5FYT A;  3PUA A;  5FPA A;  5FPV A;  3OPT A;  2W2I A;  4QX8 A;  4D6Q A;  3KV4 A;  5CEH A;  5LW9 A;  2XXZ A;  4HOO A;  5F3I A;  3K3O A;  3ZPO A;  5F37 A;  2YBS A;  4GJY A;  4UF0 A;  5FY1 A;  2OS2 A;  5A1L A;  5A7W A;  5FV3 A;  5FYB A;  5FY0 A;  5F5C A;  5FZC A;  3UYJ A;  5FWJ A;  5FZO A;  3U4S A;  4E4H A;  4QX7 A;  4CUG A;  5FZ9 A;  2YPD A;  4NUB A;  5F2W A;  5IVY A;  1VRB A;  3N9M A;  5ANQ A;  2XDV A;  5FY5 A;  3NJY A;  3K2O A;  5LY1 A;  4TN7 A;  2XUE A;  2OQ6 A;  3KVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...