5F3GA

Crystal structure of human kdm4a in complex with compound 53a
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
339
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 339
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3gA01
4LXLA 5F39A 5FZBA 3N9MA 4BXFA 5FPUA 2OT7A 4AI9A 5FP8A 5LWBA 5FY5A 5F3CA 5K4LA 4Y33A 5FYIA 5F3GA 5IWFA 5IVYA 2OS2A 2YBSA 4IGOA 4Y4RA 5LY1A 3KV6A 2WWJA 5F3IA 3RVHA 4QWNA 5A7NA 5FYMA 3N9QA 3AL5A 5FZLA 1VRBA 3PTRB 4QX8A 5FWJA 2XUEA 4QX7A 2GP3A 5FY9A 5FYTA 5FZ7A 5A80A 3U78A 5IVCA 2OQ6A 3N9OA 5LW9A 3U4SA 4HONA 5FZGA 5FZEA 5FY1A 4CCKA 2YU1A 5A7QA 5IVEA 4EZHA 4HOOA 4V2VA 5FV3A 3PUQA 2P5BA 5FZHA 3NJYA 4LIUA 2YU2A 5FZ0A 3LD8A 5FZ6A 3ZPOA 4QXHA 3PU3A 5FPLA 4GJZA 4CCMA 3N9NA 4CCJA 5FXVA 2Q8CA 4EZ4A 5F37A 5FP3A 5F2SA 5A3WA 4CCOA 3KV4A 5FXZA 3PU8A 5FP4A 4LITA 4CCNA 5A1LA 5A3TA 4TN7A 5CEHA 5FXXA 5F5AA 5FY7A 4CCLA 3AL6A 5FZ1A 5FJHA 2WWUA 4GD4A 5FZDA 5FZOB 3OPWA 3KV5A 4GJYA 5FYZA 3K2OA 5IVFA 5FYSA 5A3NA 3UYJA 5FY0A 5FP7A 2YBKA 5FYUA 2XMLA 5FPAA 3AVRA 4GAZA 5IVBA 5FY4A 3KVAA 5A7PA 5FPVA 5FZFA 5FZ3A 5F5CA 2W2IA 5A7OA 3PUAA 5FBJA 4LIVA 5FP9A 5FYHA 2Q8DA 4QXBA 4Y3OA 5F32A 2YBPA 4QXCA 4V2WA 3N9PA 5FUNA 5E6HA 5ISLA 2VD7A 5FJKA 2Q8EA 5FZAA 3K3OA 4IGQA 5FXWA 5A1FA 2OX0A 5A7WB 5FUPA 5FZMA 4URAA 4DO0A 2GP5A 5FYCA 4UF0B 5F2WA 3OPTA 2XXZA 4XDOA 3K3NA 5FZIA 4E4HA 5FZCA 5LY2A 5FYVA 3ZLIA 5F3EA 4D6RA 5IVJA 5FZ9A 5FWEA 4DIQA 5FZKA 5FPBA 5FZOA 3DXTA 4NUBA 4D6SA 4D6QA 4ASKA 4CSWA 3AVSA 5FY8A 3PURA 4IGPA 5A7WA 5A3PA 3PUSA 5FZ8A 4BISA 4UF0A 3KVBA 4CUGA 2XDVA 5IVVA 5ANQA 4QU1A 5FYYA 5FYBA 4EYUA 5IW0A 4C8DA 5A7SA 3DXUA 5F5IA 4BU2A 2OQ7A 4XDPA 2PXJA 3PDQA 3KV9A 3N9LA 5FZ4A 2YPDA 5KR7A 4AAPA 3LDBA
chains in the Genus database with same CATH superfamily
2ZEXA 1N3QA 1UY2A 1NCQA 4RHV1 2G9ZA 3LCPA 4EWEA 1BEV2 4WZCA 2XLAA 1BMV1 3MF9A 5K4LA 2E9QA 2HWF3 3WINE 5JR7B 1DZTA 2VNVA 5IWFA 3ACIA 1H2KA 5EWSA 3MBWA 2WWJA 3OGJA 3RVHA 2XL9A 4CTEA 5FLHA 3FJSA 1F15A 4BE3A 5GZCA 2UYBA 2E26A 3I2OA 1K42A 1ND2A 3D0JA 4DNYA 1K3IA 3NO8A 4IE7A 1IS5A 3GBFA 4UBGA 4L8QA 3DYOA 3AZZA 3VBSB 3GJBA 1W0OA 3H9AA 4KL1A 3BPSA 1U5XA 3RRDA 4CDXC 2HWB2 2QQVA 4AVCA 1PVXA 1OH3A 1NUKA 4KI5M 4HOOA 1LTEA 3F95A 3PJYA 2Z42A 2B39A 3EQEA 2W39A 3FHQA 2UURA 2VUJA 2YU2A 2BBAA 1UW8A 4Z07A 3ZPOA 2VOXA 5EYXA 4DEQA 3OBTA 1JXNA 2ZGTA 1S0JA 1MEC3 3VZJA 4LULA 5FP3A 5A3WA 3ZXFA 2JKBA 4O65A 1G9BA 4QPWA 5CEHA 2G9GA 1WBFA 3AKQA 4KNCA 4CCLA 4P5HA 5FKCA 1PM7A 4HN0A 4GD4A 3ZN6A 2JG9A 1JYXA 3ZXKA 3LZZA 4GJYA 4W4ZA 3RNSA 1LHVA 2BUKA 3KT7A 3OYWA 3E5XA 3SLIA 2R072 2D7FA 4NIDA 3LKJA 3MYXA 4Q4V1 4S2GA 5JOZA 2VQ0A 1COV2 1GNHA 3RPQA 2VVFA 1ACCA 1K5MA 3WP4A 5BNQA 1IS6A 4EN8B 2RDSA 2ZCWA 4IEPA 1XYPA 4IQPA 4I02A 2P3YA 4L2NA 5FOBB 1URXA 2VBBA 3HD8B 5GZFA 5BPXA 3CJIB 3VBOB 4H7LA 4XQ4A 3ZFEB 2WFF3 4QXBA 1RB8G 1OHFA 3J7LA 4GH4C 4AOCA 4B1MA 3AYEA 3K4DA 3MO4A 4LBQA 4OUMA 3UK9A 2WS91 4IGQA 3I7DA 3S5QA 1QY4A 1PO13 3A0KA 4UFLA 2ZGMA 1LOCA 2W87A 2RMU2 1UYYA 3ZXAC 3KS7A 3WX5A 1JS9A 2WUHA 1BXHA 4MXWA 1CIYA 4MOAA 5JI9A 3RJ2X 3M8LA 2HH9A 4D6RA 4HSJA 4LO6B 4HKOA 2W9XA 1AYM3 5DUWA 3CQOA 5FZOA 1GLHA 2LW8A 3UGFA 1H9WA 4EV0A 4OQ9A 4COUA 3AP9A 1D2SA 3PURA 4I0WB 5A3PA 1H1IA 1LU2A 1U0AA 2DUPA 4COYA 5C9AB 2XDVA 2E32A 1MS4A 4PCRA 4NPLA 4XZUG 3FBMA 3AFKA 2VZ1A 5FYYA 3UESA 1OKOA 3C7HA 4AVTA 2PAMA 1EUTA 1XNBA 3VKLA 4PLOA 4Q4W2 2Z2SB 1UZZA 2E53A 3UKNA 3PDQA 2FD8A 1W0NA 2QCSB 3O0WA 4RGAA 5A70A 5CKMA 4LXLA 4GIQA 2F4LA 1QJU3 1RVF2 2QVSB 2YG0A 3CF6E 4B29A 1D2QA 1REDA 3KCYA 3T2TA 3LOIA 4Y33A 1YJKA 1QJX3 1XSRA 2XWBB 2NLRA 3AZWA 1L3JA 4OUSA 1NZIA 2VY0A 1JZ8A 1X9PA 2PA7A 1UIKA 4K7JA 3MIBA 1Q8VA 1SLCA 2P4EA 3MGUA 2MEV1 4YM2A 3MLJA 3GM8A 4KGGA 4NWVA 1H6XA 1QXJA 2XLFA 3KMHA 3FLTA 1W2OA 4AGVA 4FSJA 3BCWA 2O0OA 2ZXQA 2W52A 4ONUA 2ETEA 2WT0A 1DU3D 3QBQA 3I2JA 4XE9A 1ODMA 4A7YA 1LODA 4MGKE 1AR92 3CIHA 3VL9A 4I3PA 4JDOA 3T2PA 3VB9A 3UKTA 2HKXA 2B8MA 1OXCA 1ULGA 1MQTC 4QM9A 2GH2A 2FZ1A 3POJA 1JZ4A 4AK3A 4XMAA 3RWNA 4QPIC 3K48A 5JXJA 3MW3A 4W6WA 1PO21 2Y6LA 3VHOA 4YARA 1S55A 3MV01 2JDHA 4XUNA 4IEVA 4MGYE 5L7OA 1OLMA 4GULA 1HQNA 2OW4A 3K4AA 4CDXB 1AR71 3NV2A 2R043 2XJPA 3DUIA 4XTMA 2CV6A 2WA3A 3DKQA 3MIFA 1OBNA 1J84A 3BODA 3L2YA 2LM3A 2VQAA 4XFBA 3KGLA 1BK0A 3J8F2 2MPFA 1NAEA 2VTFA 3IWZA 3WNOA 3IPVA 2GZWA 2R30A 3BGAA 1F5JA 3D3AA 5DUXA 3POSA 1H8TB 3WNMA 1BKZA 5JUVA 3BPZA 4B7KA 3VD7A 4CU7A 2BRTA 3J26N 1F4AA 5FY4A 2FMYA 1QJY3 2JXAA 2XH6A 2W1WA 4BQ4A 2W92A 4BQ5A 1JZ2A 1Y9GA 2H6BA 4K1YA 5JDBA 1G8WA 1QOTA 2X5IC 5A6XA 5LCWL 1QXPA 3D4KA 4NRPA 5T50A 3PUAA 3ASIA 4HVOA 5FYHA 2VE1A 5C3RA 2HWF2 1UKRA 1CONA 2HWC1 3OUIA 2B42B 4N53A 1ZZCA 2YY1A 2AREA 1GNZA 4QQLA 4UWDA 3RFRA 3V0BB 4AHWA 2SLIA 4HG6B 3OCPA 4ZXKA 3JBG1 3PTYA 4W6YA 1VAKA 2AEYA 4QKDA 1QJEA 5AC91 4J1XA 1RINA 3BTYA 2A6XA 4OQ8A 3HJRA 1NX9A 2V09A 4XBNA 4UW5A 4GH4B 1ULEA 2JG8C 1IPJA 2D6LX 4JC1A 3WNLA 3THPA 4A7ZA 5HCHA 3DXTA 1AR83 1KFXL 4B4QA 5SV8A 4Z2AA 1DQ1A 1RVF1 2XONA 1RUC1 1S0IA 2VOTA 4TZDA 3BOPA 3PUSA 4BPZA 4YW6A 1YWKA 3JCIA 2WO1A 1NE4A 3WD5A 3U14A 3IBMA 2Y0IA 3POIA 5A7SA 4YPJA 1NQJA 1UIJA 4U2AA 5F5IA 5FO7B 5FUIA 1PIV3 3P3PA 4QX0A 1TVGA 1O5LA 3FE5A 1PGL2 3RZKA 4ISQA 4GXLA 1JYIA 3W59A 1Q5OA 3I3QA 4GZ9A 5D1IA 1O59A 3SXWA 3WW3A 4AI9A 2D43A 1AR91 1Y7BA 3I97A 3JB8A 5FYIA 3WY6A 2JJ6A 4WBBA 3DYPA 3LPGA 1RUH3 5FQ0B 1PHMA 4ASLA 1DYPA 5A32B 3MW4A 2AGSA 1FX5A 2D3RA 2O8OA 5CFDC 3E1F1 5K7PA 4C1XA 1VRBA 3N4MA 3QOPA 2QQIA 2GP3A 2WFF2 5FY9A 1VBE3 1BQPA 3LIGA 5I91A 3NSTA 4Q4Y3 4AAXA 3J7MA 4N9HA 2EIBA 2VW1A 2FDHA 2AC1A 5DAPA 1BHGA 2V4VA 4RGGA 1O3QA 3E6BA 1UZVA 5FV3A 4LIUA 1PO12 1LCLA 1VRH2 3JD73 3MFCA 3OY8A 4EN0A 3H8RA 3R4DB 2DU0A 2QQOA 3RWKX 4NR1A 1P8JA 4XJZA 4JTOA 2DDUA 4CEYA 2PAEA 3VBUA 2K2SA 3ACHA 4ITCA 1AYM2 1YYNA 4Q1RA 1CJPA 4BB3A 4PF5A 4YG3A 1VBC1 1OLQA 3VKFC 2BYVE 2GSYA 4PF1A 5DAVA 3RZZA 1IS3A 4CDQC 5T5PA 5FPXA 1MQTB 1FMD1 3O0XA 4GALA 4J1WA 4JQRA 4K20A 4FPOB 4QAWA 5T5OA 3NNFA 4E4ZA 2HWF1 1OUXA 3RI8A 5KHHA 3WT3A 4A3XA 1GOHA 1VLNA 1E5HA 1YFWA 1V6JA 2ARBA 2W91A 3ALQA 1XNAA 4IV3C 5DZEA 3AVRA 4MG2A 1U12A 1OVPA 2XVKA 1ZRRA 1WLDA 3KVAA 2WO2A 2WYSA 5JPMB 3POEA 3ZXDA 5JXHA 1I3HA 5FZ3A 1UYZA 5LATA 1QJU2 1SDWA 5FBJA 2PHDA 1LGNA 2V72A 4PBOA 2EAKA 1W6OA 4FP3A 4U36A 4DINB 5IK4A 1QJX2 1V6NA 2YBPA 5CB7A 4QXCA 2V4AA 4V2WA 3WF3A 4B3NA 4UI9L 4YSFA 4TTGA 4GB33 1H4HA 2Q8EA 4D94A 1EPZA 4QQPA 1DCSA 4W8JA 2LS6A 1MEC1 2W3JA 2NN8A 5HBAA 1UX6A 2C1FA 4Q1PA 5JSOA 2X5IB 2ZX0A 3MPBA 4C91A 4CXYA 1TMF3 5K9YA 5J98B 1R1A3 3IAQA 3VBRC 4OUEA 4LBQD 4XXAA 5FZ9A 4TWTA 2MHFA 1L7LA 4N43C 4FFHA 3I3DA 4YG6A 2WA4A 4YW1A 1VBA3 3O1VA 3IN9A 2DCYA 4Y24A 1YJLA 3AVSA 3AMPA 4NVPA 2MNGA 3IKWA 5FFOC 4IETA 5JIAA 5IK8A 4HFSA 4BISA 1OD3A 4M0NA 4XFAA 4CUGA 1S1AA 4LO7A 4Q27A 3UJQA 4BQ1A 1NOVA 2W47A 3AYCA 3QLQA 4YRDA 5KC5A 1S2EA 1JOBA 1WWYA 5IW0A 3T09A 3UT0A 3M2MA 2R042 2XR4A 4WM8A 5C8CA 2JG8B 4XCAA 3HBKA 3KV9A 3N9LA 2JD9A 1FT9A 2I07B 1J1LA 3N9MA 4Z1VA 1V6OA 4LA3A 5FPUA 2A71A 2WN3A 3RZLA 1W8OA 4BDVB 1JYNA 1MZ6A 3NV4A 5J09A 1RHI3 4LOSA 1R083 2Y64A 1AR63 2YBSA 4NOTA 1YI9A 3CBNA 1EAH2 1HRV2 1QJY2 2RHPA 5T5JA 4YVWA 1WA4A 2D40A 4MYEA 3A22A 4OHZA 3GALA 1JN2P 2W68A 4FPCA 5IT6A 2Y6FA 3ON7A 2XUEA 4YW7A 3O5SA 5A3MA 4GWMA 1C5HA 4E4DX 1D4VB 4I3GA 2BWCA 2JIGA 4AE2A 3RZGA 2PHRA 1UAIA 1QDCA 1UY4A 4FPLA 5JSRA 4FTBA 1JHJA 5IVEA 3LAGA 1CZSA 4MX3A 5FZ0A 2OZJA 4OFGA 2W0XA 5CFDB 1PNGA 1H2LA 3C8XA 2DBNA 2CDPA 1AUYA 3IDBB 1O4TA 4CCMA 3FZ3A 2OPKA 2EIGA 4CCOA 2ZGKA 1RJ8A 4LITA 5ACA3 1XE0A 3FWEA 3POWA 2FHRA 3LA3A 1AR82 3PIGA 4AI8A 3POBA 5AVAA 1REEA 4UT5A 1BJQA 1E57A 4RL7A 1OUSA 1W6QA 4FPHA 4FQ4A 4XABA 5H9SA 3DN7A 3D82A 5KXDA 4NHKA 1QJX1 2VMEA 3H8UA 3LQCA 5EQUA 3IT8A 1W8HA 4GMP0 1OF4A 2AUYA 1O4YA 4NPRA 4YVSC 5G05L 1MZEA 3ZFFA 1PIV2 4FPGA 1OSGA 1QKQA 1WCDJ 4QX3A 1H1MA 4BLIA 4X8PA 1NLRA 4CDQB 3BVCA 1YCIA 5F8PA 4XAAA 4BQ3A 2GNTA 2WKKA 2VMDA 1VBD1 1OQ1A 1RUH2 3RMXA 1LJ7A 4IV3B 3RYKA 1R1ZA 2VTXA 1NZCA 3I3BA 3HN3A 1H2NA 3KM5A 1W04A 1CN1A 2ZAHA 5A1FA 3G6JB 4XF0A 1WGPA 3CJIA 2XKPA 4DXTA 1LGCA 4RQPC 4Y22A 3ZFEA 2PAKA 4AFAA 4Q4Y2 5FZIA 3J9SA 1HQLA 5DZFA 5L19A 1YEWA 4WVWA 5CBLA 3VD3A 5C3QA 1GWLA 2ZEZA 3U11A 2X8KA 2C6SA 1A78A 3JD72 1HKDA 4ASKA 4RS5C 3IMNA 3GF6A 3OG2A 4BCUA 5DMYA 3NL1A 1X9TA 3T0BA 3O1TA 1QF3A 2CL2A 2NPIA 3RI9A 5JR2A 3BTZA 1MVQA 4KBZA 2K0GA 3HQUA 4OI1A 3M3OA 3VBRB 1HJFA 1CGPA 5JIUA 3NKGA 4N43B 4URTA 2MEV3 2W1UA 4KWJA 1VBB1 3VZOA 4JCKA 2E63A 4R4ZA 2FQPA 4EWAA 1SLAA 2ZA9A 1SLBA 2WZR2 3U07A 3ZYRA 2Q5TA 2WR9A 3ZKUA 5F3CA 3OBRA 1RUD3 4FFGA 1YQ5A 4I30A 1TME3 5FK8A 2VR4A 2YUEA 1MS5A 4OYUA 2BJSA 4PI2A 1CPMA 4AEKA 4IEXA 4CEWC 4BQYA 3AL5A 5A3UA 1GR3A 4Z8BA 4Y20B 2BNMA 2VZVA 1PO23 5LEKA 3MICA 4WVVA 4KU7A 4QU2A 1GFF2 1QU0A 1ZRCA 1E5RA 4EZHA 4GB32 3AP7A 3R4UA 3HR9A 1SZBA 1GQGA 4YW5A 5KXEA 4LEJA 4YM0A 5BXXA 3VZLA 2R32A 2JB4A 2IZWA 4LHKA 4QXHA 3ZYBA 4C1WA 4JTNA 4GJZA 3V65A 1TMF2 2ZEYA 1R1A2 2VAUA 4CP1A 2YXSA 2WLQA 3PU8A 1GNYA 1OQEA 1SBEA 2R0FA 4MHRA 1OVSA 2XGXA 3PVOA 5LRRA 4ASMB 2DVAA 3IM0A 3WSOA 5JLVA 1VBA2 2BGOA 5K0UA 1BVP1 4CDUC 5B4XA 2CWSA 1HLCA 4HMZA 4XFIA 4C0HA 4QKFA 1OKQA 4AHYA 3UYJA 4RHV2 5EV7A 1RUH1 2WNVA 3HT1A 4IERA 3BKZA 1DG6A 3NAPA 4CDXA 4BH9A 4BLJA 1H0BA 2BNOA 2HWC3 5E89A 2X05A 3RZMA 1CWPA 1W9FA 1UZWA 5JZGA 1OC1A 4XFGA 2L9LA 3H8XA 4Y5Z0 1LOGA 2BV4A 1O91A 4K8FA 1WCUA 3WZ1A 4DY3A 1VBE1 3JBG3 4Q4Y1 1YIPA 3H50A 4LIVA 5T55A 1H8TA 3LDKA 5FMBA 1N3PA 1QJZA 4P02B 4UAPA 2DURA 1I1EA 4HK8A 1WW6A 4YVSB 3KQRA 5FUNA 3JD71 3K3OA 4HPKA 4RR3A 1PVC1 2RJKA 4ZU4A 1F9KA 4P9LA 5FBZA 5IJRA 1AL0G 1RUC3 3TRSB 3W58A 3WR0A 3A7QA 4DO0A 2GP5A 5LEJA 2XB6C 5GZDA 1UX7A 1X7NA 2VXRA 4MLOA 1LOFC 4E27A 1GYKA 3R4SA 1CAWB 2I45A 3NNGA 2QQUA 4QX1A 5J48A 4DIQA 2QZ3A 4CP9B 3TEZA 1AX1A 1YI7A 4XEZA 4YGCA 2VZPA 1FNZA 1DQ5A 4HETA 2ZJCA 3J7HA 5CFCA 3V0BA 1WCSA 3I59B 2C9AA 5ABJC 2GC3A 2G9FA 2JECA 3LFIA 5KHGA 3PJQA 5HXMA 4FP2A 5LZ6A 4LE4A 4RQPB 4Q4X1 4AW7A 3M3QA 3DPRA 2QUOA 3AKRA 1CPNA 5ACA2 5FLIA 1RIRA 1C1FA 2ZACA 4NPMA 4BU2A 1YUDA 1I5ZA 3ZMNA 2WNUC 4H55A 2OYZA 1SACA 1WMXA 2BDRA 3Q8BA 4LTAA 2GAUA 3RZHA 4RS5B 5BNPA 3UGHA 3VDAA 1SFPA 3ZN5A 3WF0A 2JX9A 3M3IA 5DDJ1 2VUDA 4XJWA 3B7MA 1V6IA 4AVBA 2GU9A 1HV1A 2PHTA 3DECA 3WP6A 5HCAA 2Q30A 4Q2FA 2WWSA 2GC1A 3AK0A 1J3RA 4D69A 2WS92 4V1PA 1UYXA 5AVPA 5FYMA 1KXGA 5A33B 2CHHA 2YV8A 4QX7A 3O1SA 3RDIA 1MS1A 1FOD1 1SLLA 1XU1A 5IVCA 3N9OA 3UL2A 5FZGA 3E97A 3SCFA 5FZEA 3ZYIB 2YU1A 2VMGA 2G4IA 5I8SA 4Q8KA 1X33A 1YRZA 2KA3A 1JHNA 1VBC3 4MGIE 2LUWA 1GUIA 4HL0A 4YM3A 4CEWB 1FMD3 4CXXA 2XBO3 3N9NA 2QZ2A 1GSLA 4K6BA 5GLWA 1A8DA 1S2KA 2IXJA 1CAXA 1W8UA 4CCNA 5A3TA 3OGVA 3PMSA 4QGMA 3LFMA 4LJHA 5FWJA 3USUB 2QJVA 1ZRDA 3OBZA 1CD3G 2ADEA 2A3YA 5FYZA 5HCFA 4YG0A 3ZYHA 3BU0A 4DXZA 1KEXA 1RHI1 5EP9A 1R081 1NCRC 1AR61 2BTVC 1XOYA 2Q1MA 3T0DA 1UXZA 3NNLA 4QKBA 4LNVA 4XIKA 3NJZA 4DY5A 4XCBA 1QNYA 2ET7A 2EXJA 3WCSA 4DMIA 3LOBA 2MEV2 1SPPA 1PK6C 5FPVA 4NN0A 1ZNPA 3KZ4C 2QNKA 4CDUB 3ZIXA 4IEQA 1UO9A 2GN3A 4Y26A 5FP9A 1HX6A 2AZ5A 5BNNC 1RUD2 1ZREA 1N47A 1ND3C 1TME2 4YW4A 3H8OA 3GXUA 5ERLA 2WDBA 4UOJA 5LRSA 3IZOA 3EO6A 4CU8A 3H3UA 3K75B 1UU5A 4TXWA 5CKQA 2VMCA 2DVFA 2P2KA 3B3QE 3RGBA 3IDEA 3RG0A 4IE4A 3WDUA 1HW5A 5FUPA 1VP6A 4EQVA 3OSDA 3LE0A 3USSA 4EN6B 4HKWA 4P9GA 5F2WA 3C7OA 3A21A 1PO22 4P9JA 5ACA1 1GP4A 1POV1 5C71A 2G19A 3OEBA 4Q8LA 1AZDA 1ENXA 1JUHA 2R061 1AR72 4CCCA 2VVDA 1NE6A 2ZHMA 3QACA 4TYSA 4SBVA 2HBUA 4AI1A 1OPOA 1ALYA 5FZ8A 2TEPA 4LKSA 2VH9A 2VZRA 2PMWB 4HANA 4KWLA 3WF1A 3CKHA 1JYWA 1SBDA 4JKLA 1EYBA 4ZXEA 3T2QA 3WNXA 1XYNA 1GV9A 4AFCA 1AJOA 3LGRA 3PUHA 2PXJA 5CNAA 1S0BA 3FMGA 4MZUA 2UU8A 1IPSA 1ZZBA 3GYDA 4UYBA 2WINB 1JYVA 4AF9A 1W05A 5ABJB 3SHRA 1ULFA 2DFBA 2GNBA 3TB0A 1XQNA 4AQSA 1UY3A 1XE7A 4JKMA 4XYXA 1LB2A 2JD4A 1M06G 3LEMA 4Q29A 1IS4A 2EXIA 2GH8A 1NT0A 2HWC2 2Y6JA 3EBRA 2JG8A 4LKEA 2NMNA 5CG8A 1REFA 1NA1A 1YIFA 4YZ3A 5J96B 5IHRA 4XPVA 4JGYC 3VBHB 4F83A 2GNDA 2WNUB 4FO9A 4LR4A 1PMJX 3JBG2 4QPGC 4HXCA 3ST7A 5AC92 4K1ZA 5FYTA 5A80A 5LW9A 1UPSA 4HONA 1K45A 2WSUA 3ES4A 4LBKA 1MZ5A 4FXKB 2ZHKA 2W1SA 1OOPC 1C1LA 1H6YA 3H3ZA 5CU1A 3WVJA 3DYMA 5FZHA 3N7MA 4QHZA 3M3EA 4DUXA 1RUC2 1W8FA 5FPLA 3S6PA 2IFRA 3WW1A 1AL21 3ZN4A 3B02A 2A70A 2JKXA 4AEDC 2EIDA 2ID4A 3CNAA 5APAA 2Q8CA 4YGBA 2O1QA 4MSVA 1I6XA 2J1RA 2YC2A 4JGZC 5CYYA 2JDMA 2QDNA 1SG3A 2HEVF 4ES9A 2XG3A 1BCXA 5FCCA 2WABA 2D5FA 1BBT1 1HJGA 4AG4A 5BNOA 3B00A 1NCQC 4JKKA 1RUD1 3KWVA 4HK9A 1QH7A 1T6GC 1TME1 1KS4A 1RUJ1 4S2FA 5L9RA 3NQHA 5ANNA 3O1PA 1WD3A 3M4FA 1VBD3 3EXUA 2C0ZA 4QDSA 4Y4YA 4M00A 1OLRA 4EWDA 2XPJA 1FPN3 4BIFA 1XNTA 2Z69A 3O1OA 1BVVA 4LLOA 4R8HA 1QIQA 4NMIA 2BWAA 2D6KA 5DAQA 1LENA 2W2IA 2P3JA 4XTPA 1UNBA 2Q8DA 3HOBA 3WW2A 4NIIA 1NCRB 2ZX1A 1N3OA 3WLUA 4ES8A 1SHWB 2ZTNA 4BQ2A 5E6HA 3ZSMA 1A8MA 2IXIA 3N36A 3PLQA 3KSCA 4IUGA 4LKFA 3ZXJA 3V0AB 3N35A 4PIXA 3OOXA 1GICA 3FN9A 5A3OA 4OLLA 1PK6B 4HT1T 1XBFA 5JOXA 2VXJA 4UF0B 5JSPA 3DF0A 4D7TA 1FXZA 5LY2A 5BNNB 1V9U1 4WZFA 5DABA 5FO9B 1ND3B 4GKYA 4RA0A 4JVAA 1VMFA 1IG3A 4IV3A 3N7KA 5FPBA 5F7UA 1VBC2 2CTVA 3E5UA 4ZZ5A 2JG9C 3AMHA 5JOWA 3T4HB 1QQP1 3QH6A 1VBB3 3ZXEA 4N8MA 2ZHNA 2QQJA 2Q1FA 1FMD2 3CZUA 2XBO2 1RC6A 1LEDA 1AXKA 2ENRA 1WZXA 2VMFA 2XVLA 3D6EA 4IXLA 5CVRA 5EJZB 2VZ3A 1Z0HA 1ZBE3 1DGRA 4Q0QA 3EHKA 1DDLA 1K5MC 3HQXA 2FCVA 2XQXA 2ZKNA 1W2NA 2DCJA 1OH4A 2DUQA 1PX3A 3AYAA 2JIJA 1WLWA 2ZGLA 5LASA 4DXRA 4XETA 3BIWE 5T52A 2OKXA 5CIRA 4BMBA 5BYNA 4Q0PA 3MPPG 1UOGA 3VKNA 4RGKA 1DF0A 5D2AA 5LY1A 3VDDC 4ET7A 1UOJA 1VB2A 3LEIA 3AP4A 5DZGA 1Q8PA 3B94A 4QWNA 3IDCB 2CSGA 2A3WA 2VW2A 3DL3A 1XYOA 4IV1C 4Y1VA 2PELA 1MEC2 1GP5A 4QQHA 4TLFA 2HJIA 2D6NA 2QQWA 2Y38A 2EA7A 2DVDA 3LIHA 4FTSA 2VZOA 4AR2A 1NXMA 1H4GA 1T2XA 1VJ2A 2OUJA 4JRLA 4P08A 5DPNA 3U4XA 3RQ0A 1UPIA 3D5OA 1OA3A 1X8EA 3ZFGC 1IKPA 3C7EA 1MACA 1VIWB 3MIEA 4KWUA 4XFFA 2YB7A 4YLZA 3OGGA 4XJAA 1XB9A 4Y20A 5GKAC 3ZR5A 2X10A 4QHBA 2Q0AA 1WBLA 5B2GB 3WW4A 4GKXA 1KRIA 2WO7A 1A34A 4BZ4A 5JPNB 3I2GA 5C33A 1Q8OA 1X36A 3OPZA 2A6ZA 2R49A 1R64A 3ZSLA 4WVMB 5J3UA 3HN1A 4IL7A 1OOPB 2VNGA 1WCQA 1ULPA 3AMMA 1JU3A 4QGLA 4HSLA 5DN2A 1Q56A 2ZGPA 4XOGA 1QWRA 2VMHA 1RUI1 1W6MB 2AH2A 1O8PA 3ELNA 4LLFA 2LALA 3WG3A 4AEDB 2JB8A 3VBFC 4ZU7A 3BYWA 1H8VA 3I3EA 5L36A 2BFUS 4E9KA 2FDJA 3AMQA 4JGZB 2QBXA 2C26A 4CUCA 4UBHA 1OMIA 4ORFA 1J3QA 3F2ZA 3GZTB 2YFZA 1PMHX 3CHXA 2PFWA 1PVC3 1DBNA 4OZOA 4M3CF 4ZY9A 5KHJA 5TSWA 3M70A 3LF7A 3ACGA 1NCQB 2RR13 5HPOA 4XUPA 4CUBA 3NJVA 3OTFA 1G6NA 4Q0SA 1B35A 4DFSA 3ECQA 4X6QB 2H6CA 3PIJA 4CA9A 1NYWA 1NG0A 1ASJ3 2XBO1 3WQ0A 3LWCA 5FRAA 2DCZA 5KHKA 4QPIB 2FDGA 4DUVA 3VZKA 1MR5A 2BGPA 1BLZA 5L7OC 3CU7A 4Q4X3 2R6QA 4GA9A 1C8M3 1HRI3 4HBNA 5E8AA 4FPFA 1GQPA 3Q9OA 4P9IA 1IOAA 1DHKB 1HN1A 4AHZA 4CPBA 2DYCA 4D6SA 4XHXA 3AB0A 1VMHA 4QQ2A 2Y33A 1WA6X 1PZ8A 2WQZC 5DDJ3 4LUMA 2CGPA 4QU1A 1HB1A 4C8DA 1O6UA 1CAWA 3AZXA 4XAEA 2WLPA 3S30A 4CP9A 1W9TA 3GBGA 1FAYA 2FCTA 3LDRA 2Y60A 4DZGA 4SLIA 5JCTA 3MIHA 4KU8A 1C8NA 3I2HA 2VZQA 1DZQA 3ZN6B 2GC0A 2JG9B 3LDBA 3I59A 4FI9A 1CX4A 4XQDA 3TWIA 1D4M3 1O8SA 4O61A 1US3A 3E5QA 3LB9A 5LWBA 1HB4A 2HWD1 3OGRA 2VCMA 1FOD3 4LHNA 5CAZA 1APNA 1SFNA 1VBD2 2JE8A 2ILMA 2OA2A 3HWJA 3IB3A 1FPN2 2UWCA 1K5MB 1UD1A 4AFBA 4N53C 2Z4FA 4KGQA 2X29A 3VHPA 2V73A 4A44A 2E7AA 2YC0A 4QB6A 3WV6A 3H7JA 2IXHA 5JMOA 2ORXA 2CY6A 4RS5A 1K5JA 4LUKA 4QX8A 4HKLA 4XC9A 4QMAA 4ZONA 3S7IA 4FBFA 5M0TA 4GMP3 4BK5A 1MS0A 2LTNA 1UWWA 3U4SA 1ULCA 5C3OA 3VZNA 1ZVFA 3D0SA 4CDWA 3VDDB 3M1HA 3THTA 1JOPA 4FPJA 3KF3A 4Q26A 4AL9A 1YQ6A 1JH5A 3LD8A 3N7JA 5FZ6A 3WQBA 4IV1B 3ZXLA 2FBEA 5FIXA 1FYUA 1H2MA 1PGW2 4EZ4A 5F37A 2E51A 3AXEA 1CVNA 4PDWA 5F6LB 5JWPA 2JDZA 4MXWB 2HWE1 1OA2A 3B01A 5C70A 1F35A 1CZVA 4GWJA 4UW6A 5FZOB 1VBB2 3ZFGB 1RL3A 3WDVA 3FC0A 1VR3A 3JB4C 5FY0A 4OMCA 1UF2C 3I49A 1ZBE2 4XUQA 1POQA 1Z78A 2RJLA 2BGCA 4BHPA 1GZTA 1SCRA 3U75A 4P9WA 2IUWA 2RDQA 4BYYA 4ARXA 1XJAA 3AP5A 4YZ2A 5D21A 5FDBA 5FZFA 2Y6GA 4ZU5A 2VVEA 5EJ3A 3VBSA 2H0BA 5CZKA 5FMOS 4D8MA 2D6OX 3SNMA 1CAUB 5C6CA 2A6WA 1POV3 1W28A 3T1LA 3FX3A 2IXCA 2ARXA 3VBFB 5HXVA 1GWMA 2R063 1GQHA 2WT1A 2K46A 3O12A 3UNPA 4XILA 1IG0A 5FZAA 1MS3A 4F8AA 2ZX4A 4G4FA 3T0AA 1FV3A 2FMDA 4PQQA 3BUCA 5FZMA 2PLV3 4URAA 5IK5A 3L2HA 3OPTA 3FHAA 3VBUC 3BB6A 1FATA 2XJSA 4BA6A 4BOWA 5KXCA 2OPWA 1SCSA 2ZOEB 5CG9A 4A4AA 4MGZE 1GZCA 2PHWA 2RDRA 5FREA 1LGBA 3PVBB 2DVBA 3LA7A 2XJRA 1BK1A 1RUNA 1S0GA 5EZWA 1G7YA 1WMEA 1W03A 4NE9A 1AF9A 2V5DA 1FPN1 4MHUA 2VW0A 1XXNA 3T30A 5L7OB 4QHOA 2HYXA 2VO5A 1W9YA 3VZMA 1ONAA 2YDEA 3VBOA 1CJDA 2YPDA 4RN5A 1HN0A 3WHTA 1VBE2 3RYPA 2OT7A 4MADA 4LBLA 2PYTA 5LBBA 4H14A 1LESA 3IPVB 1KDKA 2P6HA 5F3GA 2OS2A 1CIWA 1RMU1 2IC1A 1LULA 2DTYA 2ZZJA 1S4CA 1WW7A 2HBTA 3EB7A 3KLSA 4JV4A 5C5UA 1JZ7A 5DUVA 1UL9A 2RM23 1PVC2 4JQTA 1ZA4A 4R9AA 1PGW1 1WLTA 5LA0A 1AL23 3TBDA 4X6RB 5ABJA 4WV8A 1W3XA 1HIXA 5DAXA 4E2QA 1RXFA 3AKSA 4IE0A 3ZOIA 1LHWA 4MGQA 4A42A 1IKQA 3WP5A 3GZUC 1XU2A 4IE6A 4R9DA 4KG8A 1O3TA 1ASJ2 1KJRA 3PUQA 1GMMA 4N53B 1WLCA 1SEFA 4E4SA 5GLTA 3VBHA 5BY5A 3PU3A 1BBT3 3ZO0B 5C9AA 3KCXA 2DBIA 1QNWA 1ZBE1 2D6PA 3ACLA 1K12A 1RUJ3 5I8YA 4Q4X2 4M3CE 1HRI2 3WP3A 1V70A 2WFPA 1JW6A 4W50A 5FXXA 1W6NB 2QE3A 1LKNA 4WM8C 3MLKA 2W94A 3HAGA 2WT2A 5CKNA 3DGTA 1DIWA 1RUOA 1W8TA 1LRHA 1V6KA 1W99A 2AACA 2Q4SA 4FQZA 5FAXA 4DXSA 4OULA 2VULA 5FYSA 1GBGA 2ZZQA 3WUCA 5A3NA 2GN7A 2WL1A 2GMPA 1WW5A 2R16A 2XHNA 3PVEA 1VAMA 1W2TA 4H3WA 5DDJ2 3T1MA 5DXDA 3KT4A 5I8TA 3H0OA 2FDKA 3E6CC 2ARCA 1XSQA 2C4XA 1C5IA 1L7RA 1QXRA 3HVDA 2VOWA 4NHXA 1LOEA 1NY71 4AWDA 2VBDA 4NRQA 4BQXA 4AZZA 1I5PA 3JU9A 1FNYA 3B5LB 4YZ1A 1D4M2 1UXXX 1HQWA 3SQOA 2QFEA 1FOD2 2R073 4B4RA 5C3SA 1V9U3 4LOTA 4DB5A 4E8CA 4ZKTB 2W1QA 3DEMA 3ZPYA 1DQ2A 3VL8A 4FAGA 3KD4A 1Q8QA 4JX0A 4D3WA 1YFYA 1QQP3 5I0UA 5F5QA 4PIYA 2CGOA 4FOQA 1IPKA 4L0PA 2Q1ZB 5FMCA 4RYDA 1LR5A 2DVGA 1UMIA 4XDOA 1A6CA 3KHBA 3K3NA 4DOUA 4NAOA 5FZCA 4E4HA 1OURA 4OI4A 3W5NA 1OFSA 1TNFA 3OD4A 4AYUA 1X8MA 4UFJA 2WBKA 1NQDA 2VCAA 1IQAA 4NUBA 2ZBJA 4W6XA 1PNFA 1LHUA 2GC2A 4RD7A 4MVTA 4IGPA 4AI0A 1WCKA 5GLVA 4K3UA 4LBNA 4UF0A 1LOAA 1RJ7A 2RMU3 3S57A 1RHI2 2WNEA 1R082 5IVVA 3AYDA 1AR62 2EVXA 1RUE3 2B9UA 5FYBA 3VBUB 3ZFFC 3ZR6A 3NNJA 1XE8A 1QH6A 4CPBD 3SISA 4LE3A 4AEMA 2PHUA 2D5HA 2PTMA 1ZYBA 2P3IA 4CZSA 3V64A 3EJKA 2PQSA 4KG0A 2PQQA 5EXOA 1KGYA 2RR11 3ETPA 3ZSEA 5FO8B 1ZM1A 3ZYPA 4CU6A 1FI2A 2BOJA 1EPWA 3P3NA 2BVBA 4S2DA 2IVJA 4Y4RA 1ASJ1 2EALA 1LHOA 3VDBA 2VC9A 3OUJA 3G7DA 5LA2A 1V6MA 1ZRIA 5JXGA 3CLPA 1W2AX 3K46A 3N9QA 4LHLA 3VKMA 2XLGA 2DFCA 1CAVB 3DV8A 3MF6A 4PLNA 2TUNA 2QQNA 1TQ5A 3CDZB 3O7OA 1C8M1 1HRI1 1KITA 3FUOA 3HEIA 2JDUA 4GH4A 4LA2A 4OHVA 1SDDB 1W6OB 2AENA 2BNNA 5J7MA 2I2SA 1KFUL 1T6BX 2EAAA 2R062 2VPVA 3MLLA 4B1LA 1G9CA 3HMYA 5JMCA 4AFDA 4NROA 4FAHA 2IXKA 2KM2A 2PLV2 4L97A 4Z82A 3AJZA 3JUUA 2BERA 4YFWA 3SEPA 1RUI3 2VG9A 2RV9A 5FXZA 3MIGA 4XACA 3S7EA 1DGWX 5I0RA 1ZA7A 5FJHA 4XF4A 5FZDA 5T5LA 4AGGA 3SC7X 3WG2A 1D4M1 3LEKA 2VZUA 1JTZX 1V6LA 1S0CA 3K2OA 2CAVA 3GBWA 3ZSKA 1D0HA 5FP7A 1YLLA 5C5TA 5FQ0A 4YGEA 2XMLA 1JMUB 4RSUA 5IATA 1J59A 3PHMA 3EYPA 4R9CA 5A32A 1KJLA 2RG4A 5K8SA 3WXPA 1LHNA 3UETA 1OOPA 1JZ6A 4WM8B 4XJ9A 2Y6HA 1GZ9A 2CWMA 1H1AA 3BALA 4GMP1 3M3CA 5C4WC 1F4HA 2P37A 2WSVA 3FFQA 1Y3TA 4L99A 2CAUA 2E7TA 2ZGUA 5F32A 4ZS3A 2IXLA 3TOJA 4N90A 2IVIB 2QKDA 4PIZA 1CZTA 3AFGA 5FOJB 3O1MA 5L9BA 4EE2A 2VM9A 2PN5A 3H3LA 1O4ZA 2OX0A 2QQMA 2RJ2A 3PUIA 4P14A 5E88A 4GWNA 4A7KA 1AL22 4ZZ8A 3IDAA 4UFMA 3O14A 4ZHNA 1QOSA 2DCKA 4AEJA 1AYN1 1RUF1 3FUQA 4YYOA 2EXHA 1QEXA 2RS51 1M4WA 2R1BA 1TG7A 5EJ1B 4E2GA 1KDMA 2XJVA 5K0UC 4F3JA 1MQTA 4RFT0 2B4KA 3MDPA 1BBT2 2XVGA 2Y6KA 3R0RA 4QPIA 1AXZA 4PJYA 2ZPXA 1RUJ2 1ZZ6A 2J1EA 2WNVC 1NLQA 2HWD3 1O5UA 2ERFA 5ANQA 1QDOA 1SLIA 3BU7A 4EYUA 3RSJA 5CA6A 3N3HA 2JENA 2WO3A 2IFWA 3L9JT 3NAPC 3NNMA 4MV2A 2D44A 5EFUA 3BTAA 5JZGC 4FTEA 2G1MA 2Y8KA 4NIAA 1F5FA 3ILFA 2D93A 3GZEA 2AR6A 4Z92B 1W6QB 4P9XA 3KT1A 2WC2A 3I54A 3AP6A 5FY5A 3THCA 4Q5OA 5GALA 2VQTA 3PMEA 1H8TC 1WKYA 1UOFA 2X53S 4OHYA 1VE0A 2VU9A 2XJUA 4MO3M 5GLZA 3ZYJB 5G04L 5EIYB 3B69A 2BU9A 3KV6A 3OEAA 1OLME 3UKVA 3ZFFB 3BI3A 3AZVA 1GOFA 3SKVA 2PLV1 1GWKA 2OXBA 3MUZ1 4RR3C 1G9AA 5KXBA 2VCBA 1Q8SA 1RTVA 1ZBA1 2X5IA 3BN6A 2DF7A 1PM4A 5FZ7A 2RS31 1CQ9A 3CO2A 3HQRA 1CESA 1V9U2 2ZAAA 2JE7A 2YYOA 4I0BA 4I2OA 4FXGB 2HWE3 4FFIA 4P9YA 1DFQA 3O0VA 2J7MA 4XUTA 3A4UA 3A23A 1QQP2 3CMGA 4UFHA 3FLRA 5CFCC 2VZSA 3ZKYA 4DRVA 4A2UA 5FXVA 3C7GA 5H9QA 1DGLA 1US2A 2GALA 4Y22B 2BOIA 2ZMKA 3ZDVA 1GZWB 3DPRC 5D8AC 4B7EA 4LBMA 2WAOA 4TN7A 2VBPA 1OI6A 4G3YC 4GWIA 5FY7A 2GNMA 2YC4A 4AVVA 3AL6A 4IESA 3VDDA 3AC0A 1W90A 3KGZA 4MGSA 1DQ6A 5FZ1A 1JYTA 3WG1A 2YROA 4PI0A 2ZGSA 1AX0A 2P6CA 2TNFA 4IV1A 1RUG3 3V56A 1VRH3 2VNRA 1F8VA 1JU4A 5BNPC 5IVFA 3BTXA 2VOVA 4ZPIA 2KXLA 1RUE2 2JDYA 2JDKA 2YBKA 4WM7C 5FPAA 4LQRA 1Y43B 2O14A 2VUCA 4GAZA 4JAAA 4JRAA 5BV6A 3TAYA 2RM21 3JQWA 3QH7A 1Z7S1 5DG1A 3T2OA 5IFTA 2ZGRA 3SCGA 4I01A 4K9SA 4M4RA 2BQPA 4COWA 3ZFGA 4AI2A 1STMA 4Y1ZA 4D7YA 5A1AA 4XFCA 4D0QA 1BEV1 4M4PA 4Y3OA 3HT2A 2C24A 3MZHA 1Q43A 3N9PA 2VUAA 1XNKA 4K21A 4Y1UA 2UWBA 4BXSV 5CFDA 5L73A 5FXWA 3MIDA 2XHKA 1MPXA 3GGLA 1ULOA 3AMNA 1U5ZA 2P34A 4E8DA 4QD2A 4KBBA 5C3PA 5C4WB 1V0AA 1CAUA 2ZEWA 3Q8CA 1HXS3 4B4PA 1W6PB 2HWB1 5IVJA 4QDRA 3EMRA 5FTTC 1QHDA 2A75A 3GZAA 2Z5WA 3VBFA 5FZKA 5HV4A 1O3SA 1W8NA 1ND2C 4HN1A 4COVA 1ST8A 2JDPA 4C90A 2GMMA 2BFUL 1JI6A 2A5ZA 3W9AA 3SMHA 1R093 1YO8A 5FR3A 4XBQA 4CE8A 2I74A 4QDQA 2KD7A 1RUI2 4PLMA 1N1TA 3K4ZA 4G9SB 2ORZA 3PL0A 3U1XA 4Y1XA 2OQ7A 1RMU3 1UY1A 3NRUA 3ZIWA 2ARAA 1U5YA 4IEYA 2NZ9A 3HBZA 2H0VA 4IDZA 4CCEA 5FPZA 1C4RA 1JBCA 4CDQA 4CRQA 2F6BA 5K0UB 4QKNA 1BYHA 1EV13 2B45X 4LMFA 4YZ4A 2P3KA 2R071 3C2UA 5F39A 4BXFA 1IZ3A 5CISA 4LPLA 3ME2A 2P17A 1COV1 1TEIA 2WAAA 2WNVB 3HNBM 1DQ0A 4AFMA 4EJRA 4FOVA 3C3VA 1SQ4A 3S0MA 1X50A 4LO5B 4BIOA 3NAPB 1PX4A 4A6OA 5JZGB 3OBAA 5DG2A 5FZLA 3RJRA 3WCRA 4F7ZA 5DQ0A 1YQ2A 1D0GA 3HNYM 4O7XA 1VB4A 5IFPA 5IK7A 2OQ6A 2VGDA 4KH9A 4PT6A 1NXD1 3TNPB 3S5AA 5FKBA 2XQRA 5FY1A 3OF1A 3W20A 1DGRN 5A7QA 1U5IA 1UN1A 1EAH3 1HRV3 4CP2A 4DEVA 3A0NA 2BVVA 3VHRA 4HPKB 1B09A 3J7NA 1W9WA 2RMU1 4RR3B 1XNDA 1W39A 5E1RA 2ZABA 4CP0A 5KWRA 4W65A 4LBOA 1RUE1 2B46X 3FFZA 2NP0A 2DV9A 2W95A 1AHSA 5J36A 3GDBA 1N1SA 2HEWF 3VBRA 5T3NA 5BUVA 3GHMA 1W3VA 4ATEA 2EICA 4N43A 2J1SA 4Y5TA 2WZEA 4L9BA 4P00B 3U0ZA 2HEYF 2R1DA 3OPWA 4A41A 3FLPA 3QD6A 5KBFA 1DQ4A 1ENQA 1JUIA 2PHXA 4FCAA 1UMHA 5CFCB 1HB2A 2CGNA 3C7FA 4GQ7A 3VD9A 4M3CB 5CADA 2NMOA 2HWD2 4Z2WA 1QOOA 3WNKA 4NHLA 1GOGA 1Y9QA 3DPRB 3ABZA 5D8AB 4Q4W1 1W6NA 3LSEA 3OGSA 1LECA 2UWAA 1NA1C 2ZS6B 3CJXA 3POYA 5EYYA 5FMDA 4JGYB 4DS0A 5A6QA 5GZGA 5B4NA 2NYYA 1O7FA 1Q3EA 1YFXA 3BOWA 1F31A 4QPGB 1H30A 4CVUA 5IAVA 1ZX5A 1UYPA 5BNPB 4H7MA 5EHDA 2BEOA 2HLEA 4IEZA 4AI3A 1TE1B 3CL1A 2JICA 1VMJA 3WQ7A 1SBFA 4WM7B 3RZJA 1UU6A 3I2DA 2AYHA 4XQWA 2DCTA 4QM8A 4LORA 3VN4A 2YFUA 4J6GA 2XUMA 5I0DA 3TNQA 2D97A 4YFZA 2VL4A 2YMZA 3GJAA 2Z79A 2ZMLA 2WIIB 1OPMA 3KB5A 2BPA2 2WN2A 1UOBA 4K8RB 3T4VA 5F3EA 4H2AA 4JDMA 2J1AA 2HWE2 2YGMA 3JZVA 5JI7A 4LK6A 1G86A 1J58A 3NW4A 1WD4A 1GP6A 1ZZ8A 3O1UA 1UZYA 5A7WA 3CZJA 2DTWA 2A3XA 5BNOC 3QCWA 4OI0A 2BW8A 3VKOA 1GU3A 4I0AA 3VD4A 5GM0A 1A3KA 2VOKA 1J3PA 1S0EA 3NMBA 5HCBA 3WEZA 5F1RA 4NRMA 2JEMA 1CAXB 4HVQA 5FMOL 2GMEA 2XOMA 2PHLA 4QX5A 5C7GA 3I3MA 4RFRB 5LK7B 4QPYA 1HB3A 1ND2B 1RUG2 4AAPA 3TEWA 3J8F1 3HNMA 5FZBA 2VZTA 1V00A 2EF6A 5JVVA 5LBEA 2ET1A 3PNAA 1ZZ9A 5FP8A 3R05A 4YW3A 2D3PA 3AX4A 3K77A 3Q8EA 4XUOA 4YVSA 1L7QA 1WUVA 3OUHA 2D6MA 2E6VA 2Y26A 2VCCA 3MHZA 3P1IA 3WG4A 3BIEA 3ROUA 3AXDA 3VDCA 5HV0A 1DLLA 4JHZA 1SPPB 2BP6A 2P1BA 3MW2A 1LNSA 1D7PM 2RDNA 3WF2A 4R4XA 2DWRA 4ZS2A 4PHZA 3AKTA 4UFKA 4BJ0A 1E5IA 2WZR3 1PMIA 4BQWA 4Y5SA 1IGOA 1JODA 1OA4A 2WZ8A 4V2VA 3POFA 2QQKA 4PQ9A 2RS13 2XJTA 5H9RA 5AFEA 2WJSA 3IIIA 2YHJA 2JE9A 5KC6A 3ZMOA 2B5HA 1W8ZA 2CYFA 4FFFA 3OYWB 2WZPP 1CAVA 1NKGA 2VNOA 4RQPA 4LKDA 2Y0OA 3U10A 2VMIA 4LK7A 1HXS2 3KV4A 4QQOA 4MGTA 1KS5A 2ZHLA 4IW3A 4LBJA 3RYRA 3WNPA 4M0HA 5HI0A 2WWUA 2JDNA 3K51A 1GKBA 1LOBA 1NLSA 4AQ6A 4S2HA 1IHMA 1ENRA 1R092 4LT5A 4ISRA 5FLJA 1UQXA 4AVSA 1N1VA 2DU1A 2RE9A 2E31A 2C9KA 1W8WA 3WDTA 4QGNA 4UFIA 2JDAA 5ISLA 4LBQB 2WNOA 1RMU2 3TN93 4AGRA 3GCWA 4NO4A 5J37A 2F17A 1PGL1 1GANA 3KF5A 4FOWA 5A33A 3UV9A 2QQPA 1DYKA 1EV12 1W0PA 3ZM8A 1YFUA 3O1RA 3UJOA 2DUOA 3SITA 5IUQA 4RHV3 4IEUA 1AYN3 4LHSA 1RUF3 1AXYA 2LROA 2RS53 4XJUA 2OVUA 1DZRA 2CU5A 2C5DA 4CEWA 3DKWA 1NA1B 4XDQA 2EXKA 4NHMA 3AJYA 3SEEA 3LA2A 2WFF1 3ATGA 3OD0A 1FV2A 5E16A 4ARYA 4AVAA 2WQ8A 1JZ5A 1RITA 2A6YA 4NHYA 2UY9A 5FWEA 1XNCA 4Q0VA 3USUA 3INAA 1WW4A 3MEPA 4EN9B 3H7YA 1RUG1 2IWGB 3RS6A 1PO11 1VRH1 4YM1A 4YWAA 1TNRA 2X09A 2J22A 1AJKA 4TLGA 4YZ5A 1DGWA 3ZYFA 4HZFA 4LO4B 1Y4WA 4Q0UA 5F6KA 2YZ4A 5H9PA 3IMMA 4NIHA 3FBYA 1MS9A 4JHTA 1UU4A 2YPJA 4OVEA 2W46A 1AYM1 5LBCA 2RVAA 4YNIA 3GCXA 4XDPA 2Q8OA 3VGIA 1J83A 3GNEA 3NV1A 1NY72 3ZYGA 5FP4A 4CDUA 4META 3B9IA 4EROA 3MUY1 1ZBA3 4M01A 1C28A 4CEYC 3WHUA 2FDIA 5GZEA 3URFA 1SLTA 5BNOB 3IIAA 3SH3A 3JXSA 2QTWB 2RS33 4XURA 5IVYA 4Q4V3 4IGOA 4AHXA 1B35C 1QJFA 1XRUA 4XXPA 5F3IA 2F4PA 4AXOA 3ILNA 1W06A 3ZVXA 1QJU1 2HYKA 1RYYA 1O3RA 1W2UA 1F2NA 1VPHA 1UMZA 4FT8A 4IEOA 1HXS1 3FHIB 3U78A 2CNAA 2W08A 2WYFA 4INDA 5LA9A 1PZ9A 3AZYA 2R7EB 3ITQA 1R091 3LSDA 3NJYA 3WF4A 2N7GA 2WS93 2YGLA 5I93A 3OJBA 4CCJA 5I0TA 4K40A 4O9EA 2ZX2A 3WOGA 3I4IA 1LOFA 2SBAA 2FDFA 4KMQA 2J1UA 3AKPA 4FPEA 3PVNA 3TEXA 4YW2A 5KHIA 1Z7S3 1S0DA 4XMIA 3NKTA 4OZXA 1EV11 2A7AA 2J42A 4HVRA 1C57A 4O9GA 5T54A 3U37A 1LAJA 3WDYA 1OFNA 4HLTA 2RR12 1DP0A 4UW4A 2ES3A 1HDKA 1OQDA 1BEV3 4A6SA 4AQ2A 5FYUA 1GZWA 2VQUA 3VLBB 4N9IA 2WQ4A 3MV11 1PGSA 5IVBA 2R041 2OIIA 5A7PA 3THDA 1KD7A 3UGGA 1SFYA 4X8NA 1UY0A 2WNUA 5A6YA 4IE5A 1YXWA 2D98A 2NQYA 2W5FA 5A7OA 3IAPA 1YC61 2LRPA 3D8CA 4JZRA 3KQ4B 4JDNA 3TEYA 1C8M2 4XHBA 2KR2A 4FOYA 4XJ8A 3NWKA 3W5MA 2HWB3 4MH0E 4CDWC 1EAH1 1HRV1 1H9PA 1POV0 1QJY1 1EUUA 2QQLA 4N7UA 4QXKA 5C8CC 3ES1A 4B8EA 2XWJB 4D7SA 1JOJA 2J1TA 4E2SA 4UW3A 3T3YA 4XW3A 1MVEA 3SKJE 4R52A 4CUAA 5IAXA 5FYCA 3KHCA 1WMDA 2VECA 2E33A 2UY8A 3NVCA 1RGSA 2XXZA 4YGDA 5IYYA 1YQ8A 3I2KA 4PBPA 4PDWC 4Y1YA 2NM1A 3VD5A 3ZLIA 4BM8A 5LB6A 3M7AA 5LA1A 2OUHA 4XF3A 5GJ6A 4P5YA 5DAWA 3WNNA 5JAXA 4NIGA 4I09A 2EIEA 4XFHA 4YVWC 5LK5A 2RS12 4QT6A 3ZXGA 3X29B 4CXWA 1HV0A 2CDOA 4CSWA 4UXAA 1BZWA 1J1TA 1G9FA 1PZ7A 4XBLA 2JWPA 5FY8A 3E6DA 4A3ZA 1UKGA 3KVBA 4OMDA 5I0SA 5C4WA 2O8QA 4CU9A 1VALA 2FCUA 2ZGOA 1E5SA 2K9ZA 2ZGQA 3GHNA 1AVBA 1W6PA 1COV3 2ATFA 1ZRFA 1CX1A 2AEZA 2J1VA 4OHXA 2A6VA 1N1YA 5J1XA 1AR81 1AR73 1DYOA 4MUVA 5FZ4A 3B9CA 1EP0A 3P6BA 3B93A 3VBSC 1OD5A 2BBVA 1Y9MA 4WVZA 1VAVA 1NCRA 4BMEA 2BZDA 5F9TA 1W9SA 2QDRA 1UCXA 3I2FA 1LU1A 4D6QA 4XZPA 3V0AA 1PIV1 3TN92 4QB2A 3NJXA 1QMJA 1TZOA 1PK6A 5LBFA 5A7NA 3OY8B 4A45A 3I8TA 4OHWA 2TBVA 4L92A 5L9VA 3PTRB 1I9RA 1RXGA 2XKOA 3HPNA 4MXVA 1OF3A 3WUDA 4NAMA 4N7IA 4CEYB 1YQCA 5BNNA 1MS8A 1ND3A 5A3LA 1LEMA 3H1WA 1AYN2 2ZKLA 1RUF2 1JYCA 4CCKA 2E7QA 1BMV2 1CR7A 1KQRA 2RS52 3NV3A 4BWOA 1B35B 5FK7A 3J4UH 4LO8A 2D3SA 2P5BA 2GDFA 4FPYA 1UZ0A 1YNAA 5C8WA 4CCDA 3AM2A 3ZDSA 2VJXA 3WDWA 4IEWA 2XL7A 3DCQA 2V5YA 3LEGA 1JZ3A 3W21A 3H1YA 5F2SA 3RMYA 2OZ6A 5AC93 1X82A 4XF9A 5A1LA 3ZSJA 3FL7A 5F5AA 4Q4W3 4XIOA 3Q8FA 2Y34A 3CJIC 3VBOC 3KV5A 3ZFEC 1RVF3 3SH4A 1QGLA 3TYJA 4C0BA 4NJ4A 2ADDA 3N7LA 3MFAA 3VV1A 3ENRA 4XF1A 2R0HA 2WRAA 3CEWA 3WQ1A 5GLUA 1ULDA 5JXIA 4QB1A 1MZFA 1G9DA 4EN7B 4DUWA 1C3HA 3ACFA 3HIFA 1S0FA 1ZBA2 1XC6A 3MI8A 5F5CA 3SCHA 2WZR1 1WMFA 2XJQA 3VHNA 3R6SA 4M3CA 4QX2A 2RS32 4OCTA 3ETQA 1YHFA 1AR93 2RS11 4Q4V2 2B9VA 5D8AA 2VD7A 5FJKA 4AQTA 3ZX7A 5DUUA 4CYDA 4L11A 2PHFA 4JGYA 4KQ7A 3VBHC 2UYAA 5C9AC 4QPGA 1IQDC 4NWWA 3P5BA 3H1MA 4TSVA 5FYVA 3APBA 4WVMA 4WM7A 4XVHA 3OB8A 4GB31 4DPNA 4DQAA 4CDWB 5C8CB 1AX2A 2A1XA 3H42B 1ENSA 4COZA 4R9BA 1S2BA 5A7WB 5AFBA 1W6MA 3J8F3 3SH5A 1SMVA 2A73B 3LPFA 2VTXJ 5SV5A 1EY2A 1TMF1 1XPWA 4AEDA 4ATFA 5JOYA 1DLCA 1R1A1 3JQXA 2FZ2A 4FPKA 3ILRA 3KCCA 5EPAA 3Q8AA 3TN91 3T08A 3DXUA 4JGZA 4FVVA 4PDWB 2ZGNA 4KWKA 5A6ZA 1ODNA 4J25A 2ZMNA 2ZX3A 2RM22 3VUOA 5KR7A 1VBA1 1Z7S2 2B7YA 3I2IA 4YVWB 3WDXA 4DRRA 1ZZ7A 3POGA 4BK4A 4OI2A 3ORJA 1OT5A
chains in the Genus database with same CATH topology
4LXLA 5F39A 5FZBA 3N9MA 4BXFA 5FPUA 2OT7A 4AI9A 5FP8A 5LWBA 5FY5A 5F3CA 5K4LA 4Y33A 5FYIA 5F3GA 5IWFA 5IVYA 2OS2A 2YBSA 4IGOA 4Y4RA 5LY1A 3KV6A 2WWJA 5F3IA 3RVHA 4QWNA 5A7NA 5FYMA 3N9QA 3AL5A 5FZLA 1VRBA 3PTRB 4QX8A 5FWJA 2XUEA 4QX7A 2GP3A 5FY9A 5FYTA 5FZ7A 5A80A 3U78A 5IVCA 2OQ6A 3N9OA 5LW9A 3U4SA 4HONA 5FZGA 5FZEA 5FY1A 4CCKA 2YU1A 5A7QA 5IVEA 4EZHA 4HOOA 4V2VA 5FV3A 3PUQA 2P5BA 5FZHA 3NJYA 4LIUA 2YU2A 5FZ0A 3LD8A 5FZ6A 3ZPOA 4QXHA 3PU3A 5FPLA 4GJZA 4CCMA 3N9NA 4CCJA 5FXVA 2Q8CA 4EZ4A 5F37A 5FP3A 5F2SA 5A3WA 4CCOA 3KV4A 5FXZA 3PU8A 5FP4A 4LITA 4CCNA 5A1LA 5A3TA 4TN7A 5CEHA 5FXXA 5F5AA 5FY7A 4CCLA 3AL6A 5FZ1A 5FJHA 2WWUA 4GD4A 5FZDA 5FZOB 3OPWA 3KV5A 4GJYA 5FYZA 3K2OA 5IVFA 5FYSA 5A3NA 3UYJA 5FY0A 5FP7A 2YBKA 5FYUA 2XMLA 5FPAA 3AVRA 4GAZA 5IVBA 5FY4A 3KVAA 5A7PA 5FPVA 5FZFA 5FZ3A 5F5CA 2W2IA 5A7OA 3PUAA 5FBJA 4LIVA 5FP9A 5FYHA 2Q8DA 4QXBA 4Y3OA 5F32A 2YBPA 4QXCA 4V2WA 3N9PA 5FUNA 5E6HA 5ISLA 2VD7A 5FJKA 2Q8EA 5FZAA 3K3OA 4IGQA 5FXWA 5A1FA 2OX0A 5A7WB 5FUPA 5FZMA 4URAA 4DO0A 2GP5A 5FYCA 4UF0B 5F2WA 3OPTA 2XXZA 4XDOA 3K3NA 5FZIA 4E4HA 5FZCA 5LY2A 5FYVA 3ZLIA 5F3EA 4D6RA 5IVJA 5FZ9A 5FWEA 4DIQA 5FZKA 5FPBA 5FZOA 3DXTA 4NUBA 4D6SA 4D6QA 4ASKA 4CSWA 3AVSA 5FY8A 3PURA 4IGPA 5A7WA 5A3PA 3PUSA 5FZ8A 4BISA 4UF0A 3KVBA 4CUGA 2XDVA 5IVVA 5ANQA 4QU1A 5FYYA 5FYBA 4EYUA 5IW0A 4C8DA 5A7SA 3DXUA 5F5IA 4BU2A 2OQ7A 4XDPA 2PXJA 3PDQA 3KV9A 3N9LA 5FZ4A 2YPDA 5KR7A 4AAPA 3LDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LXL A;  5F39 A;  5FZB A;  3N9M A;  4BXF A;  5FPU A;  2OT7 A;  4AI9 A;  5FP8 A;  5LWB A;  5FY5 A;  5F3C A;  5K4L A;  4Y33 A;  5FYI A;  5F3G A;  5IWF A;  5IVY A;  2OS2 A;  2YBS A;  4IGO A;  4Y4R A;  5LY1 A;  3KV6 A;  2WWJ A;  5F3I A;  3RVH A;  4QWN A;  5A7N A;  5FYM A;  3N9Q A;  3AL5 A;  5FZL A;  1VRB A;  3PTR B;  4QX8 A;  5FWJ A;  2XUE A;  4QX7 A;  2GP3 A;  5FY9 A;  5FYT A;  5FZ7 A;  5A80 A;  3U78 A;  5IVC A;  2OQ6 A;  3N9O A;  5LW9 A;  3U4S A;  4HON A;  5FZG A;  5FZE A;  5FY1 A;  4CCK A;  2YU1 A;  5A7Q A;  5IVE A;  4EZH A;  4HOO A;  4V2V A;  5FV3 A;  3PUQ A;  2P5B A;  5FZH A;  3NJY A;  4LIU A;  2YU2 A;  5FZ0 A;  3LD8 A;  5FZ6 A;  3ZPO A;  4QXH A;  3PU3 A;  5FPL A;  4GJZ A;  4CCM A;  3N9N A;  4CCJ A;  5FXV A;  2Q8C A;  4EZ4 A;  5F37 A;  5FP3 A;  5F2S A;  5A3W A;  4CCO A;  3KV4 A;  5FXZ A;  3PU8 A;  5FP4 A;  4LIT A;  4CCN A;  5A1L A;  5A3T A;  4TN7 A;  5CEH A;  5FXX A;  5F5A A;  5FY7 A;  4CCL A;  3AL6 A;  5FZ1 A;  5FJH A;  2WWU A;  4GD4 A;  5FZD A;  5FZO B;  3OPW A;  3KV5 A;  4GJY A;  5FYZ A;  3K2O A;  5IVF A;  5FYS A;  5A3N A;  3UYJ A;  5FY0 A;  5FP7 A;  2YBK A;  5FYU A;  2XML A;  5FPA A;  3AVR A;  4GAZ A;  5IVB A;  5FY4 A;  3KVA A;  5A7P A;  5FPV A;  5FZF A;  5FZ3 A;  5F5C A;  2W2I A;  5A7O A;  3PUA A;  5FBJ A;  4LIV A;  5FP9 A;  5FYH A;  2Q8D A;  4QXB A;  4Y3O A;  5F32 A;  2YBP A;  4QXC A;  4V2W A;  3N9P A;  5FUN A;  5E6H A;  5ISL A;  2VD7 A;  5FJK A;  2Q8E A;  5FZA A;  3K3O A;  4IGQ A;  5FXW A;  5A1F A;  2OX0 A;  5A7W B;  5FUP A;  5FZM A;  4URA A;  4DO0 A;  2GP5 A;  5FYC A;  4UF0 B;  5F2W A;  3OPT A;  2XXZ A;  4XDO A;  3K3N A;  5FZI A;  4E4H A;  5FZC A;  5LY2 A;  5FYV A;  3ZLI A;  5F3E A;  4D6R A;  5IVJ A;  5FZ9 A;  5FWE A;  4DIQ A;  5FZK A;  5FPB A;  5FZO A;  3DXT A;  4NUB A;  4D6S A;  4D6Q A;  4ASK A;  4CSW A;  3AVS A;  5FY8 A;  3PUR A;  4IGP A;  5A7W A;  5A3P A;  3PUS A;  5FZ8 A;  4BIS A;  4UF0 A;  3KVB A;  4CUG A;  2XDV A;  5IVV A;  5ANQ A;  4QU1 A;  5FYY A;  5FYB A;  4EYU A;  5IW0 A;  4C8D A;  5A7S A;  3DXU A;  5F5I A;  4BU2 A;  2OQ7 A;  4XDP A;  2PXJ A;  3PDQ A;  3KV9 A;  3N9L A;  5FZ4 A;  2YPD A;  5KR7 A;  4AAP A;  3LDB A; 
#chains in the Genus database with same CATH topology
 2ZEX A;  1N3Q A;  1UY2 A;  1NCQ A;  4RHV 1;  2G9Z A;  3LCP A;  4EWE A;  1BEV 2;  4WZC A;  2XLA A;  1BMV 1;  3MF9 A;  5K4L A;  2E9Q A;  2HWF 3;  3WIN E;  5JR7 B;  1DZT A;  2VNV A;  5IWF A;  3ACI A;  1H2K A;  5EWS A;  3MBW A;  2WWJ A;  3OGJ A;  3RVH A;  2XL9 A;  4CTE A;  5FLH A;  3FJS A;  1F15 A;  4BE3 A;  5GZC A;  2UYB A;  2E26 A;  3I2O A;  1K42 A;  1ND2 A;  3D0J A;  4DNY A;  1K3I A;  3NO8 A;  4IE7 A;  1IS5 A;  3GBF A;  4UBG A;  4L8Q A;  3DYO A;  3AZZ A;  3VBS B;  3GJB A;  1W0O A;  3H9A A;  4KL1 A;  3BPS A;  1U5X A;  3RRD A;  4CDX C;  2HWB 2;  2QQV A;  4AVC A;  1PVX A;  1OH3 A;  1NUK A;  4KI5 M;  4HOO A;  1LTE A;  3F95 A;  3PJY A;  2Z42 A;  2B39 A;  3EQE A;  2W39 A;  3FHQ A;  2UUR A;  2VUJ A;  2YU2 A;  2BBA A;  1UW8 A;  4Z07 A;  3ZPO A;  2VOX A;  5EYX A;  4DEQ A;  3OBT A;  1JXN A;  2ZGT A;  1S0J A;  1MEC 3;  3VZJ A;  4LUL A;  5FP3 A;  5A3W A;  3ZXF A;  2JKB A;  4O65 A;  1G9B A;  4QPW A;  5CEH A;  2G9G A;  1WBF A;  3AKQ A;  4KNC A;  4CCL A;  4P5H A;  5FKC A;  1PM7 A;  4HN0 A;  4GD4 A;  3ZN6 A;  2JG9 A;  1JYX A;  3ZXK A;  3LZZ A;  4GJY A;  4W4Z A;  3RNS A;  1LHV A;  2BUK A;  3KT7 A;  3OYW A;  3E5X A;  3SLI A;  2R07 2;  2D7F A;  4NID A;  3LKJ A;  3MYX A;  4Q4V 1;  4S2G A;  5JOZ A;  2VQ0 A;  1COV 2;  1GNH A;  3RPQ A;  2VVF A;  1ACC A;  1K5M A;  3WP4 A;  5BNQ A;  1IS6 A;  4EN8 B;  2RDS A;  2ZCW A;  4IEP A;  1XYP A;  4IQP A;  4I02 A;  2P3Y A;  4L2N A;  5FOB B;  1URX A;  2VBB A;  3HD8 B;  5GZF A;  5BPX A;  3CJI B;  3VBO B;  4H7L A;  4XQ4 A;  3ZFE B;  2WFF 3;  4QXB A;  1RB8 G;  1OHF A;  3J7L A;  4GH4 C;  4AOC A;  4B1M A;  3AYE A;  3K4D A;  3MO4 A;  4LBQ A;  4OUM A;  3UK9 A;  2WS9 1;  4IGQ A;  3I7D A;  3S5Q A;  1QY4 A;  1PO1 3;  3A0K A;  4UFL A;  2ZGM A;  1LOC A;  2W87 A;  2RMU 2;  1UYY A;  3ZXA C;  3KS7 A;  3WX5 A;  1JS9 A;  2WUH A;  1BXH A;  4MXW A;  1CIY A;  4MOA A;  5JI9 A;  3RJ2 X;  3M8L A;  2HH9 A;  4D6R A;  4HSJ A;  4LO6 B;  4HKO A;  2W9X A;  1AYM 3;  5DUW A;  3CQO A;  5FZO A;  1GLH A;  2LW8 A;  3UGF A;  1H9W A;  4EV0 A;  4OQ9 A;  4COU A;  3AP9 A;  1D2S A;  3PUR A;  4I0W B;  5A3P A;  1H1I A;  1LU2 A;  1U0A A;  2DUP A;  4COY A;  5C9A B;  2XDV A;  2E32 A;  1MS4 A;  4PCR A;  4NPL A;  4XZU G;  3FBM A;  3AFK A;  2VZ1 A;  5FYY A;  3UES A;  1OKO A;  3C7H A;  4AVT A;  2PAM A;  1EUT A;  1XNB A;  3VKL A;  4PLO A;  4Q4W 2;  2Z2S B;  1UZZ A;  2E53 A;  3UKN A;  3PDQ A;  2FD8 A;  1W0N A;  2QCS B;  3O0W A;  4RGA A;  5A70 A;  5CKM A;  4LXL A;  4GIQ A;  2F4L A;  1QJU 3;  1RVF 2;  2QVS B;  2YG0 A;  3CF6 E;  4B29 A;  1D2Q A;  1RED A;  3KCY A;  3T2T A;  3LOI A;  4Y33 A;  1YJK A;  1QJX 3;  1XSR A;  2XWB B;  2NLR A;  3AZW A;  1L3J A;  4OUS A;  1NZI A;  2VY0 A;  1JZ8 A;  1X9P A;  2PA7 A;  1UIK A;  4K7J A;  3MIB A;  1Q8V A;  1SLC A;  2P4E A;  3MGU A;  2MEV 1;  4YM2 A;  3MLJ A;  3GM8 A;  4KGG A;  4NWV A;  1H6X A;  1QXJ A;  2XLF A;  3KMH A;  3FLT A;  1W2O A;  4AGV A;  4FSJ A;  3BCW A;  2O0O A;  2ZXQ A;  2W52 A;  4ONU A;  2ETE A;  2WT0 A;  1DU3 D;  3QBQ A;  3I2J A;  4XE9 A;  1ODM A;  4A7Y A;  1LOD A;  4MGK E;  1AR9 2;  3CIH A;  3VL9 A;  4I3P A;  4JDO A;  3T2P A;  3VB9 A;  3UKT A;  2HKX A;  2B8M A;  1OXC A;  1ULG A;  1MQT C;  4QM9 A;  2GH2 A;  2FZ1 A;  3POJ A;  1JZ4 A;  4AK3 A;  4XMA A;  3RWN A;  4QPI C;  3K48 A;  5JXJ A;  3MW3 A;  4W6W A;  1PO2 1;  2Y6L A;  3VHO A;  4YAR A;  1S55 A;  3MV0 1;  2JDH A;  4XUN A;  4IEV A;  4MGY E;  5L7O A;  1OLM A;  4GUL A;  1HQN A;  2OW4 A;  3K4A A;  4CDX B;  1AR7 1;  3NV2 A;  2R04 3;  2XJP A;  3DUI A;  4XTM A;  2CV6 A;  2WA3 A;  3DKQ A;  3MIF A;  1OBN A;  1J84 A;  3BOD A;  3L2Y A;  2LM3 A;  2VQA A;  4XFB A;  3KGL A;  1BK0 A;  3J8F 2;  2MPF A;  1NAE A;  2VTF A;  3IWZ A;  3WNO A;  3IPV A;  2GZW A;  2R30 A;  3BGA A;  1F5J A;  3D3A A;  5DUX A;  3POS A;  1H8T B;  3WNM A;  1BKZ A;  5JUV A;  3BPZ A;  4B7K A;  3VD7 A;  4CU7 A;  2BRT A;  3J26 N;  1F4A A;  5FY4 A;  2FMY A;  1QJY 3;  2JXA A;  2XH6 A;  2W1W A;  4BQ4 A;  2W92 A;  4BQ5 A;  1JZ2 A;  1Y9G A;  2H6B A;  4K1Y A;  5JDB A;  1G8W A;  1QOT A;  2X5I C;  5A6X A;  5LCW L;  1QXP A;  3D4K A;  4NRP A;  5T50 A;  3PUA A;  3ASI A;  4HVO A;  5FYH A;  2VE1 A;  5C3R A;  2HWF 2;  1UKR A;  1CON A;  2HWC 1;  3OUI A;  2B42 B;  4N53 A;  1ZZC A;  2YY1 A;  2ARE A;  1GNZ A;  4QQL A;  4UWD A;  3RFR A;  3V0B B;  4AHW A;  2SLI A;  4HG6 B;  3OCP A;  4ZXK A;  3JBG 1;  3PTY A;  4W6Y A;  1VAK A;  2AEY A;  4QKD A;  1QJE A;  5AC9 1;  4J1X A;  1RIN A;  3BTY A;  2A6X A;  4OQ8 A;  3HJR A;  1NX9 A;  2V09 A;  4XBN A;  4UW5 A;  4GH4 B;  1ULE A;  2JG8 C;  1IPJ A;  2D6L X;  4JC1 A;  3WNL A;  3THP A;  4A7Z A;  5HCH A;  3DXT A;  1AR8 3;  1KFX L;  4B4Q A;  5SV8 A;  4Z2A A;  1DQ1 A;  1RVF 1;  2XON A;  1RUC 1;  1S0I A;  2VOT A;  4TZD A;  3BOP A;  3PUS A;  4BPZ A;  4YW6 A;  1YWK A;  3JCI A;  2WO1 A;  1NE4 A;  3WD5 A;  3U14 A;  3IBM A;  2Y0I A;  3POI A;  5A7S A;  4YPJ A;  1NQJ A;  1UIJ A;  4U2A A;  5F5I A;  5FO7 B;  5FUI A;  1PIV 3;  3P3P A;  4QX0 A;  1TVG A;  1O5L A;  3FE5 A;  1PGL 2;  3RZK A;  4ISQ A;  4GXL A;  1JYI A;  3W59 A;  1Q5O A;  3I3Q A;  4GZ9 A;  5D1I A;  1O59 A;  3SXW A;  3WW3 A;  4AI9 A;  2D43 A;  1AR9 1;  1Y7B A;  3I97 A;  3JB8 A;  5FYI A;  3WY6 A;  2JJ6 A;  4WBB A;  3DYP A;  3LPG A;  1RUH 3;  5FQ0 B;  1PHM A;  4ASL A;  1DYP A;  5A32 B;  3MW4 A;  2AGS A;  1FX5 A;  2D3R A;  2O8O A;  5CFD C;  3E1F 1;  5K7P A;  4C1X A;  1VRB A;  3N4M A;  3QOP A;  2QQI A;  2GP3 A;  2WFF 2;  5FY9 A;  1VBE 3;  1BQP A;  3LIG A;  5I91 A;  3NST A;  4Q4Y 3;  4AAX A;  3J7M A;  4N9H A;  2EIB A;  2VW1 A;  2FDH A;  2AC1 A;  5DAP A;  1BHG A;  2V4V A;  4RGG A;  1O3Q A;  3E6B A;  1UZV A;  5FV3 A;  4LIU A;  1PO1 2;  1LCL A;  1VRH 2;  3JD7 3;  3MFC A;  3OY8 A;  4EN0 A;  3H8R A;  3R4D B;  2DU0 A;  2QQO A;  3RWK X;  4NR1 A;  1P8J A;  4XJZ A;  4JTO A;  2DDU A;  4CEY A;  2PAE A;  3VBU A;  2K2S A;  3ACH A;  4ITC A;  1AYM 2;  1YYN A;  4Q1R A;  1CJP A;  4BB3 A;  4PF5 A;  4YG3 A;  1VBC 1;  1OLQ A;  3VKF C;  2BYV E;  2GSY A;  4PF1 A;  5DAV A;  3RZZ A;  1IS3 A;  4CDQ C;  5T5P A;  5FPX A;  1MQT B;  1FMD 1;  3O0X A;  4GAL A;  4J1W A;  4JQR A;  4K20 A;  4FPO B;  4QAW A;  5T5O A;  3NNF A;  4E4Z A;  2HWF 1;  1OUX A;  3RI8 A;  5KHH A;  3WT3 A;  4A3X A;  1GOH A;  1VLN A;  1E5H A;  1YFW A;  1V6J A;  2ARB A;  2W91 A;  3ALQ A;  1XNA A;  4IV3 C;  5DZE A;  3AVR A;  4MG2 A;  1U12 A;  1OVP A;  2XVK A;  1ZRR A;  1WLD A;  3KVA A;  2WO2 A;  2WYS A;  5JPM B;  3POE A;  3ZXD A;  5JXH A;  1I3H A;  5FZ3 A;  1UYZ A;  5LAT A;  1QJU 2;  1SDW A;  5FBJ A;  2PHD A;  1LGN A;  2V72 A;  4PBO A;  2EAK A;  1W6O A;  4FP3 A;  4U36 A;  4DIN B;  5IK4 A;  1QJX 2;  1V6N A;  2YBP A;  5CB7 A;  4QXC A;  2V4A A;  4V2W A;  3WF3 A;  4B3N A;  4UI9 L;  4YSF A;  4TTG A;  4GB3 3;  1H4H A;  2Q8E A;  4D94 A;  1EPZ A;  4QQP A;  1DCS A;  4W8J A;  2LS6 A;  1MEC 1;  2W3J A;  2NN8 A;  5HBA A;  1UX6 A;  2C1F A;  4Q1P A;  5JSO A;  2X5I B;  2ZX0 A;  3MPB A;  4C91 A;  4CXY A;  1TMF 3;  5K9Y A;  5J98 B;  1R1A 3;  3IAQ A;  3VBR C;  4OUE A;  4LBQ D;  4XXA A;  5FZ9 A;  4TWT A;  2MHF A;  1L7L A;  4N43 C;  4FFH A;  3I3D A;  4YG6 A;  2WA4 A;  4YW1 A;  1VBA 3;  3O1V A;  3IN9 A;  2DCY A;  4Y24 A;  1YJL A;  3AVS A;  3AMP A;  4NVP A;  2MNG A;  3IKW A;  5FFO C;  4IET A;  5JIA A;  5IK8 A;  4HFS A;  4BIS A;  1OD3 A;  4M0N A;  4XFA A;  4CUG A;  1S1A A;  4LO7 A;  4Q27 A;  3UJQ A;  4BQ1 A;  1NOV A;  2W47 A;  3AYC A;  3QLQ A;  4YRD A;  5KC5 A;  1S2E A;  1JOB A;  1WWY A;  5IW0 A;  3T09 A;  3UT0 A;  3M2M A;  2R04 2;  2XR4 A;  4WM8 A;  5C8C A;  2JG8 B;  4XCA A;  3HBK A;  3KV9 A;  3N9L A;  2JD9 A;  1FT9 A;  2I07 B;  1J1L A;  3N9M A;  4Z1V A;  1V6O A;  4LA3 A;  5FPU A;  2A71 A;  2WN3 A;  3RZL A;  1W8O A;  4BDV B;  1JYN A;  1MZ6 A;  3NV4 A;  5J09 A;  1RHI 3;  4LOS A;  1R08 3;  2Y64 A;  1AR6 3;  2YBS A;  4NOT A;  1YI9 A;  3CBN A;  1EAH 2;  1HRV 2;  1QJY 2;  2RHP A;  5T5J A;  4YVW A;  1WA4 A;  2D40 A;  4MYE A;  3A22 A;  4OHZ A;  3GAL A;  1JN2 P;  2W68 A;  4FPC A;  5IT6 A;  2Y6F A;  3ON7 A;  2XUE A;  4YW7 A;  3O5S A;  5A3M A;  4GWM A;  1C5H A;  4E4D X;  1D4V B;  4I3G A;  2BWC A;  2JIG A;  4AE2 A;  3RZG A;  2PHR A;  1UAI A;  1QDC A;  1UY4 A;  4FPL A;  5JSR A;  4FTB A;  1JHJ A;  5IVE A;  3LAG A;  1CZS A;  4MX3 A;  5FZ0 A;  2OZJ A;  4OFG A;  2W0X A;  5CFD B;  1PNG A;  1H2L A;  3C8X A;  2DBN A;  2CDP A;  1AUY A;  3IDB B;  1O4T A;  4CCM A;  3FZ3 A;  2OPK A;  2EIG A;  4CCO A;  2ZGK A;  1RJ8 A;  4LIT A;  5ACA 3;  1XE0 A;  3FWE A;  3POW A;  2FHR A;  3LA3 A;  1AR8 2;  3PIG A;  4AI8 A;  3POB A;  5AVA A;  1REE A;  4UT5 A;  1BJQ A;  1E57 A;  4RL7 A;  1OUS A;  1W6Q A;  4FPH A;  4FQ4 A;  4XAB A;  5H9S A;  3DN7 A;  3D82 A;  5KXD A;  4NHK A;  1QJX 1;  2VME A;  3H8U A;  3LQC A;  5EQU A;  3IT8 A;  1W8H A;  4GMP 0;  1OF4 A;  2AUY A;  1O4Y A;  4NPR A;  4YVS C;  5G05 L;  1MZE A;  3ZFF A;  1PIV 2;  4FPG A;  1OSG A;  1QKQ A;  1WCD J;  4QX3 A;  1H1M A;  4BLI A;  4X8P A;  1NLR A;  4CDQ B;  3BVC A;  1YCI A;  5F8P A;  4XAA A;  4BQ3 A;  2GNT A;  2WKK A;  2VMD A;  1VBD 1;  1OQ1 A;  1RUH 2;  3RMX A;  1LJ7 A;  4IV3 B;  3RYK A;  1R1Z A;  2VTX A;  1NZC A;  3I3B A;  3HN3 A;  1H2N A;  3KM5 A;  1W04 A;  1CN1 A;  2ZAH A;  5A1F A;  3G6J B;  4XF0 A;  1WGP A;  3CJI A;  2XKP A;  4DXT A;  1LGC A;  4RQP C;  4Y22 A;  3ZFE A;  2PAK A;  4AFA A;  4Q4Y 2;  5FZI A;  3J9S A;  1HQL A;  5DZF A;  5L19 A;  1YEW A;  4WVW A;  5CBL A;  3VD3 A;  5C3Q A;  1GWL A;  2ZEZ A;  3U11 A;  2X8K A;  2C6S A;  1A78 A;  3JD7 2;  1HKD A;  4ASK A;  4RS5 C;  3IMN A;  3GF6 A;  3OG2 A;  4BCU A;  5DMY A;  3NL1 A;  1X9T A;  3T0B A;  3O1T A;  1QF3 A;  2CL2 A;  2NPI A;  3RI9 A;  5JR2 A;  3BTZ A;  1MVQ A;  4KBZ A;  2K0G A;  3HQU A;  4OI1 A;  3M3O A;  3VBR B;  1HJF A;  1CGP A;  5JIU A;  3NKG A;  4N43 B;  4URT A;  2MEV 3;  2W1U A;  4KWJ A;  1VBB 1;  3VZO A;  4JCK A;  2E63 A;  4R4Z A;  2FQP A;  4EWA A;  1SLA A;  2ZA9 A;  1SLB A;  2WZR 2;  3U07 A;  3ZYR A;  2Q5T A;  2WR9 A;  3ZKU A;  5F3C A;  3OBR A;  1RUD 3;  4FFG A;  1YQ5 A;  4I30 A;  1TME 3;  5FK8 A;  2VR4 A;  2YUE A;  1MS5 A;  4OYU A;  2BJS A;  4PI2 A;  1CPM A;  4AEK A;  4IEX A;  4CEW C;  4BQY A;  3AL5 A;  5A3U A;  1GR3 A;  4Z8B A;  4Y20 B;  2BNM A;  2VZV A;  1PO2 3;  5LEK A;  3MIC A;  4WVV A;  4KU7 A;  4QU2 A;  1GFF 2;  1QU0 A;  1ZRC A;  1E5R A;  4EZH A;  4GB3 2;  3AP7 A;  3R4U A;  3HR9 A;  1SZB A;  1GQG A;  4YW5 A;  5KXE A;  4LEJ A;  4YM0 A;  5BXX A;  3VZL A;  2R32 A;  2JB4 A;  2IZW A;  4LHK A;  4QXH A;  3ZYB A;  4C1W A;  4JTN A;  4GJZ A;  3V65 A;  1TMF 2;  2ZEY A;  1R1A 2;  2VAU A;  4CP1 A;  2YXS A;  2WLQ A;  3PU8 A;  1GNY A;  1OQE A;  1SBE A;  2R0F A;  4MHR A;  1OVS A;  2XGX A;  3PVO A;  5LRR A;  4ASM B;  2DVA A;  3IM0 A;  3WSO A;  5JLV A;  1VBA 2;  2BGO A;  5K0U A;  1BVP 1;  4CDU C;  5B4X A;  2CWS A;  1HLC A;  4HMZ A;  4XFI A;  4C0H A;  4QKF A;  1OKQ A;  4AHY A;  3UYJ A;  4RHV 2;  5EV7 A;  1RUH 1;  2WNV A;  3HT1 A;  4IER A;  3BKZ A;  1DG6 A;  3NAP A;  4CDX A;  4BH9 A;  4BLJ A;  1H0B A;  2BNO A;  2HWC 3;  5E89 A;  2X05 A;  3RZM A;  1CWP A;  1W9F A;  1UZW A;  5JZG A;  1OC1 A;  4XFG A;  2L9L A;  3H8X A;  4Y5Z 0;  1LOG A;  2BV4 A;  1O91 A;  4K8F A;  1WCU A;  3WZ1 A;  4DY3 A;  1VBE 1;  3JBG 3;  4Q4Y 1;  1YIP A;  3H50 A;  4LIV A;  5T55 A;  1H8T A;  3LDK A;  5FMB A;  1N3P A;  1QJZ A;  4P02 B;  4UAP A;  2DUR A;  1I1E A;  4HK8 A;  1WW6 A;  4YVS B;  3KQR A;  5FUN A;  3JD7 1;  3K3O A;  4HPK A;  4RR3 A;  1PVC 1;  2RJK A;  4ZU4 A;  1F9K A;  4P9L A;  5FBZ A;  5IJR A;  1AL0 G;  1RUC 3;  3TRS B;  3W58 A;  3WR0 A;  3A7Q A;  4DO0 A;  2GP5 A;  5LEJ A;  2XB6 C;  5GZD A;  1UX7 A;  1X7N A;  2VXR A;  4MLO A;  1LOF C;  4E27 A;  1GYK A;  3R4S A;  1CAW B;  2I45 A;  3NNG A;  2QQU A;  4QX1 A;  5J48 A;  4DIQ A;  2QZ3 A;  4CP9 B;  3TEZ A;  1AX1 A;  1YI7 A;  4XEZ A;  4YGC A;  2VZP A;  1FNZ A;  1DQ5 A;  4HET A;  2ZJC A;  3J7H A;  5CFC A;  3V0B A;  1WCS A;  3I59 B;  2C9A A;  5ABJ C;  2GC3 A;  2G9F A;  2JEC A;  3LFI A;  5KHG A;  3PJQ A;  5HXM A;  4FP2 A;  5LZ6 A;  4LE4 A;  4RQP B;  4Q4X 1;  4AW7 A;  3M3Q A;  3DPR A;  2QUO A;  3AKR A;  1CPN A;  5ACA 2;  5FLI A;  1RIR A;  1C1F A;  2ZAC A;  4NPM A;  4BU2 A;  1YUD A;  1I5Z A;  3ZMN A;  2WNU C;  4H55 A;  2OYZ A;  1SAC A;  1WMX A;  2BDR A;  3Q8B A;  4LTA A;  2GAU A;  3RZH A;  4RS5 B;  5BNP A;  3UGH A;  3VDA A;  1SFP A;  3ZN5 A;  3WF0 A;  2JX9 A;  3M3I A;  5DDJ 1;  2VUD A;  4XJW A;  3B7M A;  1V6I A;  4AVB A;  2GU9 A;  1HV1 A;  2PHT A;  3DEC A;  3WP6 A;  5HCA A;  2Q30 A;  4Q2F A;  2WWS A;  2GC1 A;  3AK0 A;  1J3R A;  4D69 A;  2WS9 2;  4V1P A;  1UYX A;  5AVP A;  5FYM A;  1KXG A;  5A33 B;  2CHH A;  2YV8 A;  4QX7 A;  3O1S A;  3RDI A;  1MS1 A;  1FOD 1;  1SLL A;  1XU1 A;  5IVC A;  3N9O A;  3UL2 A;  5FZG A;  3E97 A;  3SCF A;  5FZE A;  3ZYI B;  2YU1 A;  2VMG A;  2G4I A;  5I8S A;  4Q8K A;  1X33 A;  1YRZ A;  2KA3 A;  1JHN A;  1VBC 3;  4MGI E;  2LUW A;  1GUI A;  4HL0 A;  4YM3 A;  4CEW B;  1FMD 3;  4CXX A;  2XBO 3;  3N9N A;  2QZ2 A;  1GSL A;  4K6B A;  5GLW A;  1A8D A;  1S2K A;  2IXJ A;  1CAX A;  1W8U A;  4CCN A;  5A3T A;  3OGV A;  3PMS A;  4QGM A;  3LFM A;  4LJH A;  5FWJ A;  3USU B;  2QJV A;  1ZRD A;  3OBZ A;  1CD3 G;  2ADE A;  2A3Y A;  5FYZ A;  5HCF A;  4YG0 A;  3ZYH A;  3BU0 A;  4DXZ A;  1KEX A;  1RHI 1;  5EP9 A;  1R08 1;  1NCR C;  1AR6 1;  2BTV C;  1XOY A;  2Q1M A;  3T0D A;  1UXZ A;  3NNL A;  4QKB A;  4LNV A;  4XIK A;  3NJZ A;  4DY5 A;  4XCB A;  1QNY A;  2ET7 A;  2EXJ A;  3WCS A;  4DMI A;  3LOB A;  2MEV 2;  1SPP A;  1PK6 C;  5FPV A;  4NN0 A;  1ZNP A;  3KZ4 C;  2QNK A;  4CDU B;  3ZIX A;  4IEQ A;  1UO9 A;  2GN3 A;  4Y26 A;  5FP9 A;  1HX6 A;  2AZ5 A;  5BNN C;  1RUD 2;  1ZRE A;  1N47 A;  1ND3 C;  1TME 2;  4YW4 A;  3H8O A;  3GXU A;  5ERL A;  2WDB A;  4UOJ A;  5LRS A;  3IZO A;  3EO6 A;  4CU8 A;  3H3U A;  3K75 B;  1UU5 A;  4TXW A;  5CKQ A;  2VMC A;  2DVF A;  2P2K A;  3B3Q E;  3RGB A;  3IDE A;  3RG0 A;  4IE4 A;  3WDU A;  1HW5 A;  5FUP A;  1VP6 A;  4EQV A;  3OSD A;  3LE0 A;  3USS A;  4EN6 B;  4HKW A;  4P9G A;  5F2W A;  3C7O A;  3A21 A;  1PO2 2;  4P9J A;  5ACA 1;  1GP4 A;  1POV 1;  5C71 A;  2G19 A;  3OEB A;  4Q8L A;  1AZD A;  1ENX A;  1JUH A;  2R06 1;  1AR7 2;  4CCC A;  2VVD A;  1NE6 A;  2ZHM A;  3QAC A;  4TYS A;  4SBV A;  2HBU A;  4AI1 A;  1OPO A;  1ALY A;  5FZ8 A;  2TEP A;  4LKS A;  2VH9 A;  2VZR A;  2PMW B;  4HAN A;  4KWL A;  3WF1 A;  3CKH A;  1JYW A;  1SBD A;  4JKL A;  1EYB A;  4ZXE A;  3T2Q A;  3WNX A;  1XYN A;  1GV9 A;  4AFC A;  1AJO A;  3LGR A;  3PUH A;  2PXJ A;  5CNA A;  1S0B A;  3FMG A;  4MZU A;  2UU8 A;  1IPS A;  1ZZB A;  3GYD A;  4UYB A;  2WIN B;  1JYV A;  4AF9 A;  1W05 A;  5ABJ B;  3SHR A;  1ULF A;  2DFB A;  2GNB A;  3TB0 A;  1XQN A;  4AQS A;  1UY3 A;  1XE7 A;  4JKM A;  4XYX A;  1LB2 A;  2JD4 A;  1M06 G;  3LEM A;  4Q29 A;  1IS4 A;  2EXI A;  2GH8 A;  1NT0 A;  2HWC 2;  2Y6J A;  3EBR A;  2JG8 A;  4LKE A;  2NMN A;  5CG8 A;  1REF A;  1NA1 A;  1YIF A;  4YZ3 A;  5J96 B;  5IHR A;  4XPV A;  4JGY C;  3VBH B;  4F83 A;  2GND A;  2WNU B;  4FO9 A;  4LR4 A;  1PMJ X;  3JBG 2;  4QPG C;  4HXC A;  3ST7 A;  5AC9 2;  4K1Z A;  5FYT A;  5A80 A;  5LW9 A;  1UPS A;  4HON A;  1K45 A;  2WSU A;  3ES4 A;  4LBK A;  1MZ5 A;  4FXK B;  2ZHK A;  2W1S A;  1OOP C;  1C1L A;  1H6Y A;  3H3Z A;  5CU1 A;  3WVJ A;  3DYM A;  5FZH A;  3N7M A;  4QHZ A;  3M3E A;  4DUX A;  1RUC 2;  1W8F A;  5FPL A;  3S6P A;  2IFR A;  3WW1 A;  1AL2 1;  3ZN4 A;  3B02 A;  2A70 A;  2JKX A;  4AED C;  2EID A;  2ID4 A;  3CNA A;  5APA A;  2Q8C A;  4YGB A;  2O1Q A;  4MSV A;  1I6X A;  2J1R A;  2YC2 A;  4JGZ C;  5CYY A;  2JDM A;  2QDN A;  1SG3 A;  2HEV F;  4ES9 A;  2XG3 A;  1BCX A;  5FCC A;  2WAB A;  2D5F A;  1BBT 1;  1HJG A;  4AG4 A;  5BNO A;  3B00 A;  1NCQ C;  4JKK A;  1RUD 1;  3KWV A;  4HK9 A;  1QH7 A;  1T6G C;  1TME 1;  1KS4 A;  1RUJ 1;  4S2F A;  5L9R A;  3NQH A;  5ANN A;  3O1P A;  1WD3 A;  3M4F A;  1VBD 3;  3EXU A;  2C0Z A;  4QDS A;  4Y4Y A;  4M00 A;  1OLR A;  4EWD A;  2XPJ A;  1FPN 3;  4BIF A;  1XNT A;  2Z69 A;  3O1O A;  1BVV A;  4LLO A;  4R8H A;  1QIQ A;  4NMI A;  2BWA A;  2D6K A;  5DAQ A;  1LEN A;  2W2I A;  2P3J A;  4XTP A;  1UNB A;  2Q8D A;  3HOB A;  3WW2 A;  4NII A;  1NCR B;  2ZX1 A;  1N3O A;  3WLU A;  4ES8 A;  1SHW B;  2ZTN A;  4BQ2 A;  5E6H A;  3ZSM A;  1A8M A;  2IXI A;  3N36 A;  3PLQ A;  3KSC A;  4IUG A;  4LKF A;  3ZXJ A;  3V0A B;  3N35 A;  4PIX A;  3OOX A;  1GIC A;  3FN9 A;  5A3O A;  4OLL A;  1PK6 B;  4HT1 T;  1XBF A;  5JOX A;  2VXJ A;  4UF0 B;  5JSP A;  3DF0 A;  4D7T A;  1FXZ A;  5LY2 A;  5BNN B;  1V9U 1;  4WZF A;  5DAB A;  5FO9 B;  1ND3 B;  4GKY A;  4RA0 A;  4JVA A;  1VMF A;  1IG3 A;  4IV3 A;  3N7K A;  5FPB A;  5F7U A;  1VBC 2;  2CTV A;  3E5U A;  4ZZ5 A;  2JG9 C;  3AMH A;  5JOW A;  3T4H B;  1QQP 1;  3QH6 A;  1VBB 3;  3ZXE A;  4N8M A;  2ZHN A;  2QQJ A;  2Q1F A;  1FMD 2;  3CZU A;  2XBO 2;  1RC6 A;  1LED A;  1AXK A;  2ENR A;  1WZX A;  2VMF A;  2XVL A;  3D6E A;  4IXL A;  5CVR A;  5EJZ B;  2VZ3 A;  1Z0H A;  1ZBE 3;  1DGR A;  4Q0Q A;  3EHK A;  1DDL A;  1K5M C;  3HQX A;  2FCV A;  2XQX A;  2ZKN A;  1W2N A;  2DCJ A;  1OH4 A;  2DUQ A;  1PX3 A;  3AYA A;  2JIJ A;  1WLW A;  2ZGL A;  5LAS A;  4DXR A;  4XET A;  3BIW E;  5T52 A;  2OKX A;  5CIR A;  4BMB A;  5BYN A;  4Q0P A;  3MPP G;  1UOG A;  3VKN A;  4RGK A;  1DF0 A;  5D2A A;  5LY1 A;  3VDD C;  4ET7 A;  1UOJ A;  1VB2 A;  3LEI A;  3AP4 A;  5DZG A;  1Q8P A;  3B94 A;  4QWN A;  3IDC B;  2CSG A;  2A3W A;  2VW2 A;  3DL3 A;  1XYO A;  4IV1 C;  4Y1V A;  2PEL A;  1MEC 2;  1GP5 A;  4QQH A;  4TLF A;  2HJI A;  2D6N A;  2QQW A;  2Y38 A;  2EA7 A;  2DVD A;  3LIH A;  4FTS A;  2VZO A;  4AR2 A;  1NXM A;  1H4G A;  1T2X A;  1VJ2 A;  2OUJ A;  4JRL A;  4P08 A;  5DPN A;  3U4X A;  3RQ0 A;  1UPI A;  3D5O A;  1OA3 A;  1X8E A;  3ZFG C;  1IKP A;  3C7E A;  1MAC A;  1VIW B;  3MIE A;  4KWU A;  4XFF A;  2YB7 A;  4YLZ A;  3OGG A;  4XJA A;  1XB9 A;  4Y20 A;  5GKA C;  3ZR5 A;  2X10 A;  4QHB A;  2Q0A A;  1WBL A;  5B2G B;  3WW4 A;  4GKX A;  1KRI A;  2WO7 A;  1A34 A;  4BZ4 A;  5JPN B;  3I2G A;  5C33 A;  1Q8O A;  1X36 A;  3OPZ A;  2A6Z A;  2R49 A;  1R64 A;  3ZSL A;  4WVM B;  5J3U A;  3HN1 A;  4IL7 A;  1OOP B;  2VNG A;  1WCQ A;  1ULP A;  3AMM A;  1JU3 A;  4QGL A;  4HSL A;  5DN2 A;  1Q56 A;  2ZGP A;  4XOG A;  1QWR A;  2VMH A;  1RUI 1;  1W6M B;  2AH2 A;  1O8P A;  3ELN A;  4LLF A;  2LAL A;  3WG3 A;  4AED B;  2JB8 A;  3VBF C;  4ZU7 A;  3BYW A;  1H8V A;  3I3E A;  5L36 A;  2BFU S;  4E9K A;  2FDJ A;  3AMQ A;  4JGZ B;  2QBX A;  2C26 A;  4CUC A;  4UBH A;  1OMI A;  4ORF A;  1J3Q A;  3F2Z A;  3GZT B;  2YFZ A;  1PMH X;  3CHX A;  2PFW A;  1PVC 3;  1DBN A;  4OZO A;  4M3C F;  4ZY9 A;  5KHJ A;  5TSW A;  3M70 A;  3LF7 A;  3ACG A;  1NCQ B;  2RR1 3;  5HPO A;  4XUP A;  4CUB A;  3NJV A;  3OTF A;  1G6N A;  4Q0S A;  1B35 A;  4DFS A;  3ECQ A;  4X6Q B;  2H6C A;  3PIJ A;  4CA9 A;  1NYW A;  1NG0 A;  1ASJ 3;  2XBO 1;  3WQ0 A;  3LWC A;  5FRA A;  2DCZ A;  5KHK A;  4QPI B;  2FDG A;  4DUV A;  3VZK A;  1MR5 A;  2BGP A;  1BLZ A;  5L7O C;  3CU7 A;  4Q4X 3;  2R6Q A;  4GA9 A;  1C8M 3;  1HRI 3;  4HBN A;  5E8A A;  4FPF A;  1GQP A;  3Q9O A;  4P9I A;  1IOA A;  1DHK B;  1HN1 A;  4AHZ A;  4CPB A;  2DYC A;  4D6S A;  4XHX A;  3AB0 A;  1VMH A;  4QQ2 A;  2Y33 A;  1WA6 X;  1PZ8 A;  2WQZ C;  5DDJ 3;  4LUM A;  2CGP A;  4QU1 A;  1HB1 A;  4C8D A;  1O6U A;  1CAW A;  3AZX A;  4XAE A;  2WLP A;  3S30 A;  4CP9 A;  1W9T A;  3GBG A;  1FAY A;  2FCT A;  3LDR A;  2Y60 A;  4DZG A;  4SLI A;  5JCT A;  3MIH A;  4KU8 A;  1C8N A;  3I2H A;  2VZQ A;  1DZQ A;  3ZN6 B;  2GC0 A;  2JG9 B;  3LDB A;  3I59 A;  4FI9 A;  1CX4 A;  4XQD A;  3TWI A;  1D4M 3;  1O8S A;  4O61 A;  1US3 A;  3E5Q A;  3LB9 A;  5LWB A;  1HB4 A;  2HWD 1;  3OGR A;  2VCM A;  1FOD 3;  4LHN A;  5CAZ A;  1APN A;  1SFN A;  1VBD 2;  2JE8 A;  2ILM A;  2OA2 A;  3HWJ A;  3IB3 A;  1FPN 2;  2UWC A;  1K5M B;  1UD1 A;  4AFB A;  4N53 C;  2Z4F A;  4KGQ A;  2X29 A;  3VHP A;  2V73 A;  4A44 A;  2E7A A;  2YC0 A;  4QB6 A;  3WV6 A;  3H7J A;  2IXH A;  5JMO A;  2ORX A;  2CY6 A;  4RS5 A;  1K5J A;  4LUK A;  4QX8 A;  4HKL A;  4XC9 A;  4QMA A;  4ZON A;  3S7I A;  4FBF A;  5M0T A;  4GMP 3;  4BK5 A;  1MS0 A;  2LTN A;  1UWW A;  3U4S A;  1ULC A;  5C3O A;  3VZN A;  1ZVF A;  3D0S A;  4CDW A;  3VDD B;  3M1H A;  3THT A;  1JOP A;  4FPJ A;  3KF3 A;  4Q26 A;  4AL9 A;  1YQ6 A;  1JH5 A;  3LD8 A;  3N7J A;  5FZ6 A;  3WQB A;  4IV1 B;  3ZXL A;  2FBE A;  5FIX A;  1FYU A;  1H2M A;  1PGW 2;  4EZ4 A;  5F37 A;  2E51 A;  3AXE A;  1CVN A;  4PDW A;  5F6L B;  5JWP A;  2JDZ A;  4MXW B;  2HWE 1;  1OA2 A;  3B01 A;  5C70 A;  1F35 A;  1CZV A;  4GWJ A;  4UW6 A;  5FZO B;  1VBB 2;  3ZFG B;  1RL3 A;  3WDV A;  3FC0 A;  1VR3 A;  3JB4 C;  5FY0 A;  4OMC A;  1UF2 C;  3I49 A;  1ZBE 2;  4XUQ A;  1POQ A;  1Z78 A;  2RJL A;  2BGC A;  4BHP A;  1GZT A;  1SCR A;  3U75 A;  4P9W A;  2IUW A;  2RDQ A;  4BYY A;  4ARX A;  1XJA A;  3AP5 A;  4YZ2 A;  5D21 A;  5FDB A;  5FZF A;  2Y6G A;  4ZU5 A;  2VVE A;  5EJ3 A;  3VBS A;  2H0B A;  5CZK A;  5FMO S;  4D8M A;  2D6O X;  3SNM A;  1CAU B;  5C6C A;  2A6W A;  1POV 3;  1W28 A;  3T1L A;  3FX3 A;  2IXC A;  2ARX A;  3VBF B;  5HXV A;  1GWM A;  2R06 3;  1GQH A;  2WT1 A;  2K46 A;  3O12 A;  3UNP A;  4XIL A;  1IG0 A;  5FZA A;  1MS3 A;  4F8A A;  2ZX4 A;  4G4F A;  3T0A A;  1FV3 A;  2FMD A;  4PQQ A;  3BUC A;  5FZM A;  2PLV 3;  4URA A;  5IK5 A;  3L2H A;  3OPT A;  3FHA A;  3VBU C;  3BB6 A;  1FAT A;  2XJS A;  4BA6 A;  4BOW A;  5KXC A;  2OPW A;  1SCS A;  2ZOE B;  5CG9 A;  4A4A A;  4MGZ E;  1GZC A;  2PHW A;  2RDR A;  5FRE A;  1LGB A;  3PVB B;  2DVB A;  3LA7 A;  2XJR A;  1BK1 A;  1RUN A;  1S0G A;  5EZW A;  1G7Y A;  1WME A;  1W03 A;  4NE9 A;  1AF9 A;  2V5D A;  1FPN 1;  4MHU A;  2VW0 A;  1XXN A;  3T30 A;  5L7O B;  4QHO A;  2HYX A;  2VO5 A;  1W9Y A;  3VZM A;  1ONA A;  2YDE A;  3VBO A;  1CJD A;  2YPD A;  4RN5 A;  1HN0 A;  3WHT A;  1VBE 2;  3RYP A;  2OT7 A;  4MAD A;  4LBL A;  2PYT A;  5LBB A;  4H14 A;  1LES A;  3IPV B;  1KDK A;  2P6H A;  5F3G A;  2OS2 A;  1CIW A;  1RMU 1;  2IC1 A;  1LUL A;  2DTY A;  2ZZJ A;  1S4C A;  1WW7 A;  2HBT A;  3EB7 A;  3KLS A;  4JV4 A;  5C5U A;  1JZ7 A;  5DUV A;  1UL9 A;  2RM2 3;  1PVC 2;  4JQT A;  1ZA4 A;  4R9A A;  1PGW 1;  1WLT A;  5LA0 A;  1AL2 3;  3TBD A;  4X6R B;  5ABJ A;  4WV8 A;  1W3X A;  1HIX A;  5DAX A;  4E2Q A;  1RXF A;  3AKS A;  4IE0 A;  3ZOI A;  1LHW A;  4MGQ A;  4A42 A;  1IKQ A;  3WP5 A;  3GZU C;  1XU2 A;  4IE6 A;  4R9D A;  4KG8 A;  1O3T A;  1ASJ 2;  1KJR A;  3PUQ A;  1GMM A;  4N53 B;  1WLC A;  1SEF A;  4E4S A;  5GLT A;  3VBH A;  5BY5 A;  3PU3 A;  1BBT 3;  3ZO0 B;  5C9A A;  3KCX A;  2DBI A;  1QNW A;  1ZBE 1;  2D6P A;  3ACL A;  1K12 A;  1RUJ 3;  5I8Y A;  4Q4X 2;  4M3C E;  1HRI 2;  3WP3 A;  1V70 A;  2WFP A;  1JW6 A;  4W50 A;  5FXX A;  1W6N B;  2QE3 A;  1LKN A;  4WM8 C;  3MLK A;  2W94 A;  3HAG A;  2WT2 A;  5CKN A;  3DGT A;  1DIW A;  1RUO A;  1W8T A;  1LRH A;  1V6K A;  1W99 A;  2AAC A;  2Q4S A;  4FQZ A;  5FAX A;  4DXS A;  4OUL A;  2VUL A;  5FYS A;  1GBG A;  2ZZQ A;  3WUC A;  5A3N A;  2GN7 A;  2WL1 A;  2GMP A;  1WW5 A;  2R16 A;  2XHN A;  3PVE A;  1VAM A;  1W2T A;  4H3W A;  5DDJ 2;  3T1M A;  5DXD A;  3KT4 A;  5I8T A;  3H0O A;  2FDK A;  3E6C C;  2ARC A;  1XSQ A;  2C4X A;  1C5I A;  1L7R A;  1QXR A;  3HVD A;  2VOW A;  4NHX A;  1LOE A;  1NY7 1;  4AWD A;  2VBD A;  4NRQ A;  4BQX A;  4AZZ A;  1I5P A;  3JU9 A;  1FNY A;  3B5L B;  4YZ1 A;  1D4M 2;  1UXX X;  1HQW A;  3SQO A;  2QFE A;  1FOD 2;  2R07 3;  4B4R A;  5C3S A;  1V9U 3;  4LOT A;  4DB5 A;  4E8C A;  4ZKT B;  2W1Q A;  3DEM A;  3ZPY A;  1DQ2 A;  3VL8 A;  4FAG A;  3KD4 A;  1Q8Q A;  4JX0 A;  4D3W A;  1YFY A;  1QQP 3;  5I0U A;  5F5Q A;  4PIY A;  2CGO A;  4FOQ A;  1IPK A;  4L0P A;  2Q1Z B;  5FMC A;  4RYD A;  1LR5 A;  2DVG A;  1UMI A;  4XDO A;  1A6C A;  3KHB A;  3K3N A;  4DOU A;  4NAO A;  5FZC A;  4E4H A;  1OUR A;  4OI4 A;  3W5N A;  1OFS A;  1TNF A;  3OD4 A;  4AYU A;  1X8M A;  4UFJ A;  2WBK A;  1NQD A;  2VCA A;  1IQA A;  4NUB A;  2ZBJ A;  4W6X A;  1PNF A;  1LHU A;  2GC2 A;  4RD7 A;  4MVT A;  4IGP A;  4AI0 A;  1WCK A;  5GLV A;  4K3U A;  4LBN A;  4UF0 A;  1LOA A;  1RJ7 A;  2RMU 3;  3S57 A;  1RHI 2;  2WNE A;  1R08 2;  5IVV A;  3AYD A;  1AR6 2;  2EVX A;  1RUE 3;  2B9U A;  5FYB A;  3VBU B;  3ZFF C;  3ZR6 A;  3NNJ A;  1XE8 A;  1QH6 A;  4CPB D;  3SIS A;  4LE3 A;  4AEM A;  2PHU A;  2D5H A;  2PTM A;  1ZYB A;  2P3I A;  4CZS A;  3V64 A;  3EJK A;  2PQS A;  4KG0 A;  2PQQ A;  5EXO A;  1KGY A;  2RR1 1;  3ETP A;  3ZSE A;  5FO8 B;  1ZM1 A;  3ZYP A;  4CU6 A;  1FI2 A;  2BOJ A;  1EPW A;  3P3N A;  2BVB A;  4S2D A;  2IVJ A;  4Y4R A;  1ASJ 1;  2EAL A;  1LHO A;  3VDB A;  2VC9 A;  3OUJ A;  3G7D A;  5LA2 A;  1V6M A;  1ZRI A;  5JXG A;  3CLP A;  1W2A X;  3K46 A;  3N9Q A;  4LHL A;  3VKM A;  2XLG A;  2DFC A;  1CAV B;  3DV8 A;  3MF6 A;  4PLN A;  2TUN A;  2QQN A;  1TQ5 A;  3CDZ B;  3O7O A;  1C8M 1;  1HRI 1;  1KIT A;  3FUO A;  3HEI A;  2JDU A;  4GH4 A;  4LA2 A;  4OHV A;  1SDD B;  1W6O B;  2AEN A;  2BNN A;  5J7M A;  2I2S A;  1KFU L;  1T6B X;  2EAA A;  2R06 2;  2VPV A;  3MLL A;  4B1L A;  1G9C A;  3HMY A;  5JMC A;  4AFD A;  4NRO A;  4FAH A;  2IXK A;  2KM2 A;  2PLV 2;  4L97 A;  4Z82 A;  3AJZ A;  3JUU A;  2BER A;  4YFW A;  3SEP A;  1RUI 3;  2VG9 A;  2RV9 A;  5FXZ A;  3MIG A;  4XAC A;  3S7E A;  1DGW X;  5I0R A;  1ZA7 A;  5FJH A;  4XF4 A;  5FZD A;  5T5L A;  4AGG A;  3SC7 X;  3WG2 A;  1D4M 1;  3LEK A;  2VZU A;  1JTZ X;  1V6L A;  1S0C A;  3K2O A;  2CAV A;  3GBW A;  3ZSK A;  1D0H A;  5FP7 A;  1YLL A;  5C5T A;  5FQ0 A;  4YGE A;  2XML A;  1JMU B;  4RSU A;  5IAT A;  1J59 A;  3PHM A;  3EYP A;  4R9C A;  5A32 A;  1KJL A;  2RG4 A;  5K8S A;  3WXP A;  1LHN A;  3UET A;  1OOP A;  1JZ6 A;  4WM8 B;  4XJ9 A;  2Y6H A;  1GZ9 A;  2CWM A;  1H1A A;  3BAL A;  4GMP 1;  3M3C A;  5C4W C;  1F4H A;  2P37 A;  2WSV A;  3FFQ A;  1Y3T A;  4L99 A;  2CAU A;  2E7T A;  2ZGU A;  5F32 A;  4ZS3 A;  2IXL A;  3TOJ A;  4N90 A;  2IVI B;  2QKD A;  4PIZ A;  1CZT A;  3AFG A;  5FOJ B;  3O1M A;  5L9B A;  4EE2 A;  2VM9 A;  2PN5 A;  3H3L A;  1O4Z A;  2OX0 A;  2QQM A;  2RJ2 A;  3PUI A;  4P14 A;  5E88 A;  4GWN A;  4A7K A;  1AL2 2;  4ZZ8 A;  3IDA A;  4UFM A;  3O14 A;  4ZHN A;  1QOS A;  2DCK A;  4AEJ A;  1AYN 1;  1RUF 1;  3FUQ A;  4YYO A;  2EXH A;  1QEX A;  2RS5 1;  1M4W A;  2R1B A;  1TG7 A;  5EJ1 B;  4E2G A;  1KDM A;  2XJV A;  5K0U C;  4F3J A;  1MQT A;  4RFT 0;  2B4K A;  3MDP A;  1BBT 2;  2XVG A;  2Y6K A;  3R0R A;  4QPI A;  1AXZ A;  4PJY A;  2ZPX A;  1RUJ 2;  1ZZ6 A;  2J1E A;  2WNV C;  1NLQ A;  2HWD 3;  1O5U A;  2ERF A;  5ANQ A;  1QDO A;  1SLI A;  3BU7 A;  4EYU A;  3RSJ A;  5CA6 A;  3N3H A;  2JEN A;  2WO3 A;  2IFW A;  3L9J T;  3NAP C;  3NNM A;  4MV2 A;  2D44 A;  5EFU A;  3BTA A;  5JZG C;  4FTE A;  2G1M A;  2Y8K A;  4NIA A;  1F5F A;  3ILF A;  2D93 A;  3GZE A;  2AR6 A;  4Z92 B;  1W6Q B;  4P9X A;  3KT1 A;  2WC2 A;  3I54 A;  3AP6 A;  5FY5 A;  3THC A;  4Q5O A;  5GAL A;  2VQT A;  3PME A;  1H8T C;  1WKY A;  1UOF A;  2X53 S;  4OHY A;  1VE0 A;  2VU9 A;  2XJU A;  4MO3 M;  5GLZ A;  3ZYJ B;  5G04 L;  5EIY B;  3B69 A;  2BU9 A;  3KV6 A;  3OEA A;  1OLM E;  3UKV A;  3ZFF B;  3BI3 A;  3AZV A;  1GOF A;  3SKV A;  2PLV 1;  1GWK A;  2OXB A;  3MUZ 1;  4RR3 C;  1G9A A;  5KXB A;  2VCB A;  1Q8S A;  1RTV A;  1ZBA 1;  2X5I A;  3BN6 A;  2DF7 A;  1PM4 A;  5FZ7 A;  2RS3 1;  1CQ9 A;  3CO2 A;  3HQR A;  1CES A;  1V9U 2;  2ZAA A;  2JE7 A;  2YYO A;  4I0B A;  4I2O A;  4FXG B;  2HWE 3;  4FFI A;  4P9Y A;  1DFQ A;  3O0V A;  2J7M A;  4XUT A;  3A4U A;  3A23 A;  1QQP 2;  3CMG A;  4UFH A;  3FLR A;  5CFC C;  2VZS A;  3ZKY A;  4DRV A;  4A2U A;  5FXV A;  3C7G A;  5H9Q A;  1DGL A;  1US2 A;  2GAL A;  4Y22 B;  2BOI A;  2ZMK A;  3ZDV A;  1GZW B;  3DPR C;  5D8A C;  4B7E A;  4LBM A;  2WAO A;  4TN7 A;  2VBP A;  1OI6 A;  4G3Y C;  4GWI A;  5FY7 A;  2GNM A;  2YC4 A;  4AVV A;  3AL6 A;  4IES A;  3VDD A;  3AC0 A;  1W90 A;  3KGZ A;  4MGS A;  1DQ6 A;  5FZ1 A;  1JYT A;  3WG1 A;  2YRO A;  4PI0 A;  2ZGS A;  1AX0 A;  2P6C A;  2TNF A;  4IV1 A;  1RUG 3;  3V56 A;  1VRH 3;  2VNR A;  1F8V A;  1JU4 A;  5BNP C;  5IVF A;  3BTX A;  2VOV A;  4ZPI A;  2KXL A;  1RUE 2;  2JDY A;  2JDK A;  2YBK A;  4WM7 C;  5FPA A;  4LQR A;  1Y43 B;  2O14 A;  2VUC A;  4GAZ A;  4JAA A;  4JRA A;  5BV6 A;  3TAY A;  2RM2 1;  3JQW A;  3QH7 A;  1Z7S 1;  5DG1 A;  3T2O A;  5IFT A;  2ZGR A;  3SCG A;  4I01 A;  4K9S A;  4M4R A;  2BQP A;  4COW A;  3ZFG A;  4AI2 A;  1STM A;  4Y1Z A;  4D7Y A;  5A1A A;  4XFC A;  4D0Q A;  1BEV 1;  4M4P A;  4Y3O A;  3HT2 A;  2C24 A;  3MZH A;  1Q43 A;  3N9P A;  2VUA A;  1XNK A;  4K21 A;  4Y1U A;  2UWB A;  4BXS V;  5CFD A;  5L73 A;  5FXW A;  3MID A;  2XHK A;  1MPX A;  3GGL A;  1ULO A;  3AMN A;  1U5Z A;  2P34 A;  4E8D A;  4QD2 A;  4KBB A;  5C3P A;  5C4W B;  1V0A A;  1CAU A;  2ZEW A;  3Q8C A;  1HXS 3;  4B4P A;  1W6P B;  2HWB 1;  5IVJ A;  4QDR A;  3EMR A;  5FTT C;  1QHD A;  2A75 A;  3GZA A;  2Z5W A;  3VBF A;  5FZK A;  5HV4 A;  1O3S A;  1W8N A;  1ND2 C;  4HN1 A;  4COV A;  1ST8 A;  2JDP A;  4C90 A;  2GMM A;  2BFU L;  1JI6 A;  2A5Z A;  3W9A A;  3SMH A;  1R09 3;  1YO8 A;  5FR3 A;  4XBQ A;  4CE8 A;  2I74 A;  4QDQ A;  2KD7 A;  1RUI 2;  4PLM A;  1N1T A;  3K4Z A;  4G9S B;  2ORZ A;  3PL0 A;  3U1X A;  4Y1X A;  2OQ7 A;  1RMU 3;  1UY1 A;  3NRU A;  3ZIW A;  2ARA A;  1U5Y A;  4IEY A;  2NZ9 A;  3HBZ A;  2H0V A;  4IDZ A;  4CCE A;  5FPZ A;  1C4R A;  1JBC A;  4CDQ A;  4CRQ A;  2F6B A;  5K0U B;  4QKN A;  1BYH A;  1EV1 3;  2B45 X;  4LMF A;  4YZ4 A;  2P3K A;  2R07 1;  3C2U A;  5F39 A;  4BXF A;  1IZ3 A;  5CIS A;  4LPL A;  3ME2 A;  2P17 A;  1COV 1;  1TEI A;  2WAA A;  2WNV B;  3HNB M;  1DQ0 A;  4AFM A;  4EJR A;  4FOV A;  3C3V A;  1SQ4 A;  3S0M A;  1X50 A;  4LO5 B;  4BIO A;  3NAP B;  1PX4 A;  4A6O A;  5JZG B;  3OBA A;  5DG2 A;  5FZL A;  3RJR A;  3WCR A;  4F7Z A;  5DQ0 A;  1YQ2 A;  1D0G A;  3HNY M;  4O7X A;  1VB4 A;  5IFP A;  5IK7 A;  2OQ6 A;  2VGD A;  4KH9 A;  4PT6 A;  1NXD 1;  3TNP B;  3S5A A;  5FKB A;  2XQR A;  5FY1 A;  3OF1 A;  3W20 A;  1DGR N;  5A7Q A;  1U5I A;  1UN1 A;  1EAH 3;  1HRV 3;  4CP2 A;  4DEV A;  3A0N A;  2BVV A;  3VHR A;  4HPK B;  1B09 A;  3J7N A;  1W9W A;  2RMU 1;  4RR3 B;  1XND A;  1W39 A;  5E1R A;  2ZAB A;  4CP0 A;  5KWR A;  4W65 A;  4LBO A;  1RUE 1;  2B46 X;  3FFZ A;  2NP0 A;  2DV9 A;  2W95 A;  1AHS A;  5J36 A;  3GDB A;  1N1S A;  2HEW F;  3VBR A;  5T3N A;  5BUV A;  3GHM A;  1W3V A;  4ATE A;  2EIC A;  4N43 A;  2J1S A;  4Y5T A;  2WZE A;  4L9B A;  4P00 B;  3U0Z A;  2HEY F;  2R1D A;  3OPW A;  4A41 A;  3FLP A;  3QD6 A;  5KBF A;  1DQ4 A;  1ENQ A;  1JUI A;  2PHX A;  4FCA A;  1UMH A;  5CFC B;  1HB2 A;  2CGN A;  3C7F A;  4GQ7 A;  3VD9 A;  4M3C B;  5CAD A;  2NMO A;  2HWD 2;  4Z2W A;  1QOO A;  3WNK A;  4NHL A;  1GOG A;  1Y9Q A;  3DPR B;  3ABZ A;  5D8A B;  4Q4W 1;  1W6N A;  3LSE A;  3OGS A;  1LEC A;  2UWA A;  1NA1 C;  2ZS6 B;  3CJX A;  3POY A;  5EYY A;  5FMD A;  4JGY B;  4DS0 A;  5A6Q A;  5GZG A;  5B4N A;  2NYY A;  1O7F A;  1Q3E A;  1YFX A;  3BOW A;  1F31 A;  4QPG B;  1H30 A;  4CVU A;  5IAV A;  1ZX5 A;  1UYP A;  5BNP B;  4H7M A;  5EHD A;  2BEO A;  2HLE A;  4IEZ A;  4AI3 A;  1TE1 B;  3CL1 A;  2JIC A;  1VMJ A;  3WQ7 A;  1SBF A;  4WM7 B;  3RZJ A;  1UU6 A;  3I2D A;  2AYH A;  4XQW A;  2DCT A;  4QM8 A;  4LOR A;  3VN4 A;  2YFU A;  4J6G A;  2XUM A;  5I0D A;  3TNQ A;  2D97 A;  4YFZ A;  2VL4 A;  2YMZ A;  3GJA A;  2Z79 A;  2ZML A;  2WII B;  1OPM A;  3KB5 A;  2BPA 2;  2WN2 A;  1UOB A;  4K8R B;  3T4V A;  5F3E A;  4H2A A;  4JDM A;  2J1A A;  2HWE 2;  2YGM A;  3JZV A;  5JI7 A;  4LK6 A;  1G86 A;  1J58 A;  3NW4 A;  1WD4 A;  1GP6 A;  1ZZ8 A;  3O1U A;  1UZY A;  5A7W A;  3CZJ A;  2DTW A;  2A3X A;  5BNO C;  3QCW A;  4OI0 A;  2BW8 A;  3VKO A;  1GU3 A;  4I0A A;  3VD4 A;  5GM0 A;  1A3K A;  2VOK A;  1J3P A;  1S0E A;  3NMB A;  5HCB A;  3WEZ A;  5F1R A;  4NRM A;  2JEM A;  1CAX B;  4HVQ A;  5FMO L;  2GME A;  2XOM A;  2PHL A;  4QX5 A;  5C7G A;  3I3M A;  4RFR B;  5LK7 B;  4QPY A;  1HB3 A;  1ND2 B;  1RUG 2;  4AAP A;  3TEW A;  3J8F 1;  3HNM A;  5FZB A;  2VZT A;  1V00 A;  2EF6 A;  5JVV A;  5LBE A;  2ET1 A;  3PNA A;  1ZZ9 A;  5FP8 A;  3R05 A;  4YW3 A;  2D3P A;  3AX4 A;  3K77 A;  3Q8E A;  4XUO A;  4YVS A;  1L7Q A;  1WUV A;  3OUH A;  2D6M A;  2E6V A;  2Y26 A;  2VCC A;  3MHZ A;  3P1I A;  3WG4 A;  3BIE A;  3ROU A;  3AXD A;  3VDC A;  5HV0 A;  1DLL A;  4JHZ A;  1SPP B;  2BP6 A;  2P1B A;  3MW2 A;  1LNS A;  1D7P M;  2RDN A;  3WF2 A;  4R4X A;  2DWR A;  4ZS2 A;  4PHZ A;  3AKT A;  4UFK A;  4BJ0 A;  1E5I A;  2WZR 3;  1PMI A;  4BQW A;  4Y5S A;  1IGO A;  1JOD A;  1OA4 A;  2WZ8 A;  4V2V A;  3POF A;  2QQK A;  4PQ9 A;  2RS1 3;  2XJT A;  5H9R A;  5AFE A;  2WJS A;  3III A;  2YHJ A;  2JE9 A;  5KC6 A;  3ZMO A;  2B5H A;  1W8Z A;  2CYF A;  4FFF A;  3OYW B;  2WZP P;  1CAV A;  1NKG A;  2VNO A;  4RQP A;  4LKD A;  2Y0O A;  3U10 A;  2VMI A;  4LK7 A;  1HXS 2;  3KV4 A;  4QQO A;  4MGT A;  1KS5 A;  2ZHL A;  4IW3 A;  4LBJ A;  3RYR A;  3WNP A;  4M0H A;  5HI0 A;  2WWU A;  2JDN A;  3K51 A;  1GKB A;  1LOB A;  1NLS A;  4AQ6 A;  4S2H A;  1IHM A;  1ENR A;  1R09 2;  4LT5 A;  4ISR A;  5FLJ A;  1UQX A;  4AVS A;  1N1V A;  2DU1 A;  2RE9 A;  2E31 A;  2C9K A;  1W8W A;  3WDT A;  4QGN A;  4UFI A;  2JDA A;  5ISL A;  4LBQ B;  2WNO A;  1RMU 2;  3TN9 3;  4AGR A;  3GCW A;  4NO4 A;  5J37 A;  2F17 A;  1PGL 1;  1GAN A;  3KF5 A;  4FOW A;  5A33 A;  3UV9 A;  2QQP A;  1DYK A;  1EV1 2;  1W0P A;  3ZM8 A;  1YFU A;  3O1R A;  3UJO A;  2DUO A;  3SIT A;  5IUQ A;  4RHV 3;  4IEU A;  1AYN 3;  4LHS A;  1RUF 3;  1AXY A;  2LRO A;  2RS5 3;  4XJU A;  2OVU A;  1DZR A;  2CU5 A;  2C5D A;  4CEW A;  3DKW A;  1NA1 B;  4XDQ A;  2EXK A;  4NHM A;  3AJY A;  3SEE A;  3LA2 A;  2WFF 1;  3ATG A;  3OD0 A;  1FV2 A;  5E16 A;  4ARY A;  4AVA A;  2WQ8 A;  1JZ5 A;  1RIT A;  2A6Y A;  4NHY A;  2UY9 A;  5FWE A;  1XNC A;  4Q0V A;  3USU A;  3INA A;  1WW4 A;  3MEP A;  4EN9 B;  3H7Y A;  1RUG 1;  2IWG B;  3RS6 A;  1PO1 1;  1VRH 1;  4YM1 A;  4YWA A;  1TNR A;  2X09 A;  2J22 A;  1AJK A;  4TLG A;  4YZ5 A;  1DGW A;  3ZYF A;  4HZF A;  4LO4 B;  1Y4W A;  4Q0U A;  5F6K A;  2YZ4 A;  5H9P A;  3IMM A;  4NIH A;  3FBY A;  1MS9 A;  4JHT A;  1UU4 A;  2YPJ A;  4OVE A;  2W46 A;  1AYM 1;  5LBC A;  2RVA A;  4YNI A;  3GCX A;  4XDP A;  2Q8O A;  3VGI A;  1J83 A;  3GNE A;  3NV1 A;  1NY7 2;  3ZYG A;  5FP4 A;  4CDU A;  4MET A;  3B9I A;  4ERO A;  3MUY 1;  1ZBA 3;  4M01 A;  1C28 A;  4CEY C;  3WHU A;  2FDI A;  5GZE A;  3URF A;  1SLT A;  5BNO B;  3IIA A;  3SH3 A;  3JXS A;  2QTW B;  2RS3 3;  4XUR A;  5IVY A;  4Q4V 3;  4IGO A;  4AHX A;  1B35 C;  1QJF A;  1XRU A;  4XXP A;  5F3I A;  2F4P A;  4AXO A;  3ILN A;  1W06 A;  3ZVX A;  1QJU 1;  2HYK A;  1RYY A;  1O3R A;  1W2U A;  1F2N A;  1VPH A;  1UMZ A;  4FT8 A;  4IEO A;  1HXS 1;  3FHI B;  3U78 A;  2CNA A;  2W08 A;  2WYF A;  4IND A;  5LA9 A;  1PZ9 A;  3AZY A;  2R7E B;  3ITQ A;  1R09 1;  3LSD A;  3NJY A;  3WF4 A;  2N7G A;  2WS9 3;  2YGL A;  5I93 A;  3OJB A;  4CCJ A;  5I0T A;  4K40 A;  4O9E A;  2ZX2 A;  3WOG A;  3I4I A;  1LOF A;  2SBA A;  2FDF A;  4KMQ A;  2J1U A;  3AKP A;  4FPE A;  3PVN A;  3TEX A;  4YW2 A;  5KHI A;  1Z7S 3;  1S0D A;  4XMI A;  3NKT A;  4OZX A;  1EV1 1;  2A7A A;  2J42 A;  4HVR A;  1C57 A;  4O9G A;  5T54 A;  3U37 A;  1LAJ A;  3WDY A;  1OFN A;  4HLT A;  2RR1 2;  1DP0 A;  4UW4 A;  2ES3 A;  1HDK A;  1OQD A;  1BEV 3;  4A6S A;  4AQ2 A;  5FYU A;  1GZW A;  2VQU A;  3VLB B;  4N9I A;  2WQ4 A;  3MV1 1;  1PGS A;  5IVB A;  2R04 1;  2OII A;  5A7P A;  3THD A;  1KD7 A;  3UGG A;  1SFY A;  4X8N A;  1UY0 A;  2WNU A;  5A6Y A;  4IE5 A;  1YXW A;  2D98 A;  2NQY A;  2W5F A;  5A7O A;  3IAP A;  1YC6 1;  2LRP A;  3D8C A;  4JZR A;  3KQ4 B;  4JDN A;  3TEY A;  1C8M 2;  4XHB A;  2KR2 A;  4FOY A;  4XJ8 A;  3NWK A;  3W5M A;  2HWB 3;  4MH0 E;  4CDW C;  1EAH 1;  1HRV 1;  1H9P A;  1POV 0;  1QJY 1;  1EUU A;  2QQL A;  4N7U A;  4QXK A;  5C8C C;  3ES1 A;  4B8E A;  2XWJ B;  4D7S A;  1JOJ A;  2J1T A;  4E2S A;  4UW3 A;  3T3Y A;  4XW3 A;  1MVE A;  3SKJ E;  4R52 A;  4CUA A;  5IAX A;  5FYC A;  3KHC A;  1WMD A;  2VEC A;  2E33 A;  2UY8 A;  3NVC A;  1RGS A;  2XXZ A;  4YGD A;  5IYY A;  1YQ8 A;  3I2K A;  4PBP A;  4PDW C;  4Y1Y A;  2NM1 A;  3VD5 A;  3ZLI A;  4BM8 A;  5LB6 A;  3M7A A;  5LA1 A;  2OUH A;  4XF3 A;  5GJ6 A;  4P5Y A;  5DAW A;  3WNN A;  5JAX A;  4NIG A;  4I09 A;  2EIE A;  4XFH A;  4YVW C;  5LK5 A;  2RS1 2;  4QT6 A;  3ZXG A;  3X29 B;  4CXW A;  1HV0 A;  2CDO A;  4CSW A;  4UXA A;  1BZW A;  1J1T A;  1G9F A;  1PZ7 A;  4XBL A;  2JWP A;  5FY8 A;  3E6D A;  4A3Z A;  1UKG A;  3KVB A;  4OMD A;  5I0S A;  5C4W A;  2O8Q A;  4CU9 A;  1VAL A;  2FCU A;  2ZGO A;  1E5S A;  2K9Z A;  2ZGQ A;  3GHN A;  1AVB A;  1W6P A;  1COV 3;  2ATF A;  1ZRF A;  1CX1 A;  2AEZ A;  2J1V A;  4OHX A;  2A6V A;  1N1Y A;  5J1X A;  1AR8 1;  1AR7 3;  1DYO A;  4MUV A;  5FZ4 A;  3B9C A;  1EP0 A;  3P6B A;  3B93 A;  3VBS C;  1OD5 A;  2BBV A;  1Y9M A;  4WVZ A;  1VAV A;  1NCR A;  4BME A;  2BZD A;  5F9T A;  1W9S A;  2QDR A;  1UCX A;  3I2F A;  1LU1 A;  4D6Q A;  4XZP A;  3V0A A;  1PIV 1;  3TN9 2;  4QB2 A;  3NJX A;  1QMJ A;  1TZO A;  1PK6 A;  5LBF A;  5A7N A;  3OY8 B;  4A45 A;  3I8T A;  4OHW A;  2TBV A;  4L92 A;  5L9V A;  3PTR B;  1I9R A;  1RXG A;  2XKO A;  3HPN A;  4MXV A;  1OF3 A;  3WUD A;  4NAM A;  4N7I A;  4CEY B;  1YQC A;  5BNN A;  1MS8 A;  1ND3 A;  5A3L A;  1LEM A;  3H1W A;  1AYN 2;  2ZKL A;  1RUF 2;  1JYC A;  4CCK A;  2E7Q A;  1BMV 2;  1CR7 A;  1KQR A;  2RS5 2;  3NV3 A;  4BWO A;  1B35 B;  5FK7 A;  3J4U H;  4LO8 A;  2D3S A;  2P5B A;  2GDF A;  4FPY A;  1UZ0 A;  1YNA A;  5C8W A;  4CCD A;  3AM2 A;  3ZDS A;  2VJX A;  3WDW A;  4IEW A;  2XL7 A;  3DCQ A;  2V5Y A;  3LEG A;  1JZ3 A;  3W21 A;  3H1Y A;  5F2S A;  3RMY A;  2OZ6 A;  5AC9 3;  1X82 A;  4XF9 A;  5A1L A;  3ZSJ A;  3FL7 A;  5F5A A;  4Q4W 3;  4XIO A;  3Q8F A;  2Y34 A;  3CJI C;  3VBO C;  3KV5 A;  3ZFE C;  1RVF 3;  3SH4 A;  1QGL A;  3TYJ A;  4C0B A;  4NJ4 A;  2ADD A;  3N7L A;  3MFA A;  3VV1 A;  3ENR A;  4XF1 A;  2R0H A;  2WRA A;  3CEW A;  3WQ1 A;  5GLU A;  1ULD A;  5JXI A;  4QB1 A;  1MZF A;  1G9D A;  4EN7 B;  4DUW A;  1C3H A;  3ACF A;  3HIF A;  1S0F A;  1ZBA 2;  1XC6 A;  3MI8 A;  5F5C A;  3SCH A;  2WZR 1;  1WMF A;  2XJQ A;  3VHN A;  3R6S A;  4M3C A;  4QX2 A;  2RS3 2;  4OCT A;  3ETQ A;  1YHF A;  1AR9 3;  2RS1 1;  4Q4V 2;  2B9V A;  5D8A A;  2VD7 A;  5FJK A;  4AQT A;  3ZX7 A;  5DUU A;  4CYD A;  4L11 A;  2PHF A;  4JGY A;  4KQ7 A;  3VBH C;  2UYA A;  5C9A C;  4QPG A;  1IQD C;  4NWW A;  3P5B A;  3H1M A;  4TSV A;  5FYV A;  3APB A;  4WVM A;  4WM7 A;  4XVH A;  3OB8 A;  4GB3 1;  4DPN A;  4DQA A;  4CDW B;  5C8C B;  1AX2 A;  2A1X A;  3H42 B;  1ENS A;  4COZ A;  4R9B A;  1S2B A;  5A7W B;  5AFB A;  1W6M A;  3J8F 3;  3SH5 A;  1SMV A;  2A73 B;  3LPF A;  2VTX J;  5SV5 A;  1EY2 A;  1TMF 1;  1XPW A;  4AED A;  4ATF A;  5JOY A;  1DLC A;  1R1A 1;  3JQX A;  2FZ2 A;  4FPK A;  3ILR A;  3KCC A;  5EPA A;  3Q8A A;  3TN9 1;  3T08 A;  3DXU A;  4JGZ A;  4FVV A;  4PDW B;  2ZGN A;  4KWK A;  5A6Z A;  1ODN A;  4J25 A;  2ZMN A;  2ZX3 A;  2RM2 2;  3VUO A;  5KR7 A;  1VBA 1;  1Z7S 2;  2B7Y A;  3I2I A;  4YVW B;  3WDX A;  4DRR A;  1ZZ7 A;  3POG A;  4BK4 A;  4OI2 A;  3ORJ A;  1OT5 A; 
#chains in the Genus database with same CATH homology
 4LXL A;  5F39 A;  5FZB A;  3N9M A;  4BXF A;  5FPU A;  2OT7 A;  4AI9 A;  5FP8 A;  5LWB A;  5FY5 A;  5F3C A;  5K4L A;  4Y33 A;  5FYI A;  5F3G A;  5IWF A;  5IVY A;  2OS2 A;  2YBS A;  4IGO A;  4Y4R A;  5LY1 A;  3KV6 A;  2WWJ A;  5F3I A;  3RVH A;  4QWN A;  5A7N A;  5FYM A;  3N9Q A;  3AL5 A;  5FZL A;  1VRB A;  3PTR B;  4QX8 A;  5FWJ A;  2XUE A;  4QX7 A;  2GP3 A;  5FY9 A;  5FYT A;  5FZ7 A;  5A80 A;  3U78 A;  5IVC A;  2OQ6 A;  3N9O A;  5LW9 A;  3U4S A;  4HON A;  5FZG A;  5FZE A;  5FY1 A;  4CCK A;  2YU1 A;  5A7Q A;  5IVE A;  4EZH A;  4HOO A;  4V2V A;  5FV3 A;  3PUQ A;  2P5B A;  5FZH A;  3NJY A;  4LIU A;  2YU2 A;  5FZ0 A;  3LD8 A;  5FZ6 A;  3ZPO A;  4QXH A;  3PU3 A;  5FPL A;  4GJZ A;  4CCM A;  3N9N A;  4CCJ A;  5FXV A;  2Q8C A;  4EZ4 A;  5F37 A;  5FP3 A;  5F2S A;  5A3W A;  4CCO A;  3KV4 A;  5FXZ A;  3PU8 A;  5FP4 A;  4LIT A;  4CCN A;  5A1L A;  5A3T A;  4TN7 A;  5CEH A;  5FXX A;  5F5A A;  5FY7 A;  4CCL A;  3AL6 A;  5FZ1 A;  5FJH A;  2WWU A;  4GD4 A;  5FZD A;  5FZO B;  3OPW A;  3KV5 A;  4GJY A;  5FYZ A;  3K2O A;  5IVF A;  5FYS A;  5A3N A;  3UYJ A;  5FY0 A;  5FP7 A;  2YBK A;  5FYU A;  2XML A;  5FPA A;  3AVR A;  4GAZ A;  5IVB A;  5FY4 A;  3KVA A;  5A7P A;  5FPV A;  5FZF A;  5FZ3 A;  5F5C A;  2W2I A;  5A7O A;  3PUA A;  5FBJ A;  4LIV A;  5FP9 A;  5FYH A;  2Q8D A;  4QXB A;  4Y3O A;  5F32 A;  2YBP A;  4QXC A;  4V2W A;  3N9P A;  5FUN A;  5E6H A;  5ISL A;  2VD7 A;  5FJK A;  2Q8E A;  5FZA A;  3K3O A;  4IGQ A;  5FXW A;  5A1F A;  2OX0 A;  5A7W B;  5FUP A;  5FZM A;  4URA A;  4DO0 A;  2GP5 A;  5FYC A;  4UF0 B;  5F2W A;  3OPT A;  2XXZ A;  4XDO A;  3K3N A;  5FZI A;  4E4H A;  5FZC A;  5LY2 A;  5FYV A;  3ZLI A;  5F3E A;  4D6R A;  5IVJ A;  5FZ9 A;  5FWE A;  4DIQ A;  5FZK A;  5FPB A;  5FZO A;  3DXT A;  4NUB A;  4D6S A;  4D6Q A;  4ASK A;  4CSW A;  3AVS A;  5FY8 A;  3PUR A;  4IGP A;  5A7W A;  5A3P A;  3PUS A;  5FZ8 A;  4BIS A;  4UF0 A;  3KVB A;  4CUG A;  2XDV A;  5IVV A;  5ANQ A;  4QU1 A;  5FYY A;  5FYB A;  4EYU A;  5IW0 A;  4C8D A;  5A7S A;  3DXU A;  5F5I A;  4BU2 A;  2OQ7 A;  4XDP A;  2PXJ A;  3PDQ A;  3KV9 A;  3N9L A;  5FZ4 A;  2YPD A;  5KR7 A;  4AAP A;  3LDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...