5F3GA

Crystal structure of human kdm4a in complex with compound 53a
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
339
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 339
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3gA01
5FUNA 5FP3A 4BXFA 4AI9A 4D6RA 4GAZA 4AAPA 4UF0B 3PUQA 2OS2A 5FPLA 5FPUA 3NJYA 3ZLIA 5A80A 4CUGA 5A3PA 5FZOB 2OQ7A 4LIUA 5FYVA 5FPAA 3PUSA 5FZEA 5A7WB 5FZAA 3AVRA 5F3EA 2PXJA 3K3OA 5FYSA 5FZFA 4EZ4A 3OPTA 3KV5A 5FP7A 5FZ7A 4IGOA 4BISA 2P5BA 4V2WA 5FJKA 5FZKA 2XUEA 5F32A 2GP3A 3AL6A 5FZGA 5KR7A 5IVCA 5FYTA 3N9LA 4DO0A 5FPBA 5FPVA 4QWNA 4EZHA 2OT7A 5A3TA 5ANQA 5FWJA 5FWEA 5IVVA 5FXXA 5FYHA 4NUBA 3KVBA 3PU3A 5FY8A 1VRBA 5FZ0A 5IVJA 4Y33A 5FBJA 5F3GA 4QXHA 4CCMA 4QXCA 2Q8DA 5A1FA 5FY4A 3N9PA 5F2SA 3OPWA 5FYIA 3LD8A 5F39A 2Q8CA 5F5IA 3N9MA 4IGPA 4V2VA 2Q8EA 3U78A 5FYCA 5FXVA 5FZBA 4ASKA 4QU1A 4BU2A 4DIQA 2VD7A 2YPDA 2OQ6A 3N9OA 5FP8A 5FP4A 5FZIA 5FY0A 5FY9A 5IW0A 2WWUA 5ISLA 4E4HA 3PTRB 3RVHA 3K2OA 3ZPOA 3U4SA 5FY5A 5F5AA 5FY7A 5FXWA 5FXZA 5A1LA 2XXZA 5E6HA 5A7SA 3N9QA 3PU8A 4QX8A 4D6QA 2OX0A 5FYYA 4QXBA 5F3CA 5A7NA 2GP5A 4EYUA 5F5CA 5FYUA 5CEHA 5FYMA 4IGQA 3KV4A 4XDOA 3N9NA 2YU1A 2YBPA 5F2WA 4D6SA 5FY1A 3UYJA 3AVSA 5LW9A 5FZMA 4C8DA 3DXTA 4LXLA 4UF0A 3PUAA 2W2IA 5F37A 4LIVA 3KV6A 4TN7A 5IVYA 5IVBA 3AL5A 5FP9A 4LITA 5LY1A 5FZOA 4GJZA 4Y4RA 5A3WA 5A7WA 5K4LA 3LDBA 5FZ6A 3PURA 4CSWA 4QX7A 4CCNA 5FZ9A 5FZ1A 5IVFA 5FYZA 4GJYA 5FZ4A 5IWFA 4HONA 5FZLA 2WWJA 5A7QA 2YBKA 4CCJA 3KVAA 5A7OA 5A7PA 5FUPA 4GD4A 4HOOA 2XMLA 5FZ3A 5FZDA 2YBSA 5FZCA 5FJHA 5FZ8A 4CCKA 5IVEA 2YU2A 3KV9A 4Y3OA 2XDVA 3K3NA 4XDPA 4CCOA 5LWBA 5A3NA 5LY2A 4CCLA 5F3IA 5FZHA 4URAA 3DXUA 5FV3A 5FYBA 3PDQA
chains in the Genus database with same CATH superfamily
5EHDA 4BXFA 4AI9A 5I0SA 4PT6A 5A32A 4D94A 4INDA 3I2DA 1UU4A 1UOJA 2PQQA 4CUGA 1OA4A 2IXJA 4AGRA 4JGZB 3VBOA 3WDXA 3AKRA 5FZAA 4NPMA 2Q1FA 2JD4A 1C28A 4XF4A 1NZCA 4AFCA 3VKNA 4D7SA 1K45A 2BJSA 1SLAA 4X6RB 4EZ4A 5BUVA 4ISQA 5LBCA 2W1WA 3IM0A 1LOFA 1DBNA 3K4AA 1WZXA 2ZMNA 4M0NA 5LRRA 3VKLA 1W8OA 4C91A 1C3HA 1X33A 1BK1A 1UZZA 3WV6A 4E2SA 2KD7A 5EPAA 4A41A 2D43A 1X8MA 2QKDA 1QJX2 3RWNA 2VR4A 1WCKA 1GWKA 5FPBA 1YWKA 3A0KA 4OMCA 3MIBA 1ND3C 3TN91 1O59A 5KC6A 1PX4A 3LA2A 4A44A 1JUIA 2PN5A 2BDRA 3AMMA 3I2KA 3MW2A 2R16A 4YM3A 3I49A 2VECA 1K12A 3NV2A 2DU0A 2Y64A 1F31A 3LPGA 2IXLA 2WNUB 3J8F1 4Q4V3 2CGOA 3PHMA 5EJ1B 4ISRA 5CG8A 5C9AA 2BV4A 4E4ZA 4E4SA 4W65A 3ZDVA 4NIGA 3OPWA 4COUA 1CVNA 4ATFA 5JSPA 1AYM3 5JZGC 4JGYB 4PCRA 4FXKB 3VBSC 1AR81 3NL1A 1P8JA 1VRH3 4MSVA 1I5ZA 2VQAA 3LAGA 5HXVA 3M3CA 1PK6B 1WBLA 1GV9A 2FCUA 4ASKA 2IXIA 3OD0A 3WVJA 3N9OA 1WMXA 2WRAA 3T30A 3TWIA 5FY9A 1O4TA 1YCIA 2QQLA 2WWUA 5ISLA 2RS51 4LBQB 2FBEA 2QVSB 5EJ3A 1UPIA 3ZFEC 2YUEA 4BDVB 4BLIA 1BVP1 5IFPA 5F5AA 3POJA 5CBLA 1URXA 2K9ZA 5TSWA 1QNWA 2OX0A 2ZJCA 4CP0A 4XF0A 4WVWA 5BNOA 1AL23 3PL0A 4D6SA 5FY1A 3DKWA 1LU1A 1Q8QA 5AFEA 1ND2B 2VZPA 5LBFA 3DV8A 4YM1A 1ENSA 2QQOA 2D97A 4JDNA 3W9AA 4X8NA 2ZKLA 1RUF1 4NHKA 4LITA 1S0JA 1W04A 4UFHA 1NLSA 5K4LA 2FDIA 1RHI1 2E26A 1W9YA 3ORJA 1O8SA 4UT5A 1IQDC 4CEWC 3H3UA 4WVZA 4JVAA 4RQPA 4QPIC 1BQPA 1F5FA 1QHDA 3I59B 1S0FA 1QJX1 3FC0A 1GLHA 4XFHA 1RUI3 3V0AB 4AVTA 1UOBA 4FT8A 1WKYA 4GB31 1RUG3 5FZ8A 1QQP2 5IVEA 1C8M3 3UJOA 3WG2A 1DQ4A 2YU2A 2VZQA 4AVCA 5CFCC 5FPXA 4MGTA 1AR73 2WYFA 5GM0A 2IUWA 5H9SA 5ABJC 1WBFA 3DEMA 3H0OA 4AFMA 4CUBA 1VPHA 3ZYGA 4AAPA 2A71A 4HG6B 1KXGA 1H2KA 1XRUA 2CGNA 4HKLA 4XJ8A 3TEYA 3BIWE 5CKQA 1JBCA 2UU8A 3QCWA 4LOSA 3THDA 1AYN2 4GWJA 4L92A 3O7OA 2VU9A 3SLIA 3POBA 1W8TA 1YXWA 3I54A 1CN1A 2JDKA 4MXWA 4EV0A 1AXYA 3AP6A 5CNAA 1EAH1 1HQLA 1ULCA 1JUHA 4UBHA 4AG4A 4IE0A 1UY4A 1V6JA 2XL9A 5J96B 1LHNA 4IE4A 2C5DA 2WBKA 4GIQA 5FYTA 5FPVA 2ERFA 4FPCA 3WCSA 4D8MA 2W92A 4HETA 4W6XA 1RMU3 3THPA 2JDZA 1PGSA 2ZZJA 3CIHA 3WD5A 4LUKA 1WW6A 1KDMA 4JC1A 4JX0A 4WM8B 5A3MA 5J1XA 3WX5A 5C8CA 4PBPA 1OSGA 3LPFA 1ENRA 2WZR3 5IAVA 2ARXA 3E97A 1OLME 4GH4A 2D3RA 1L3JA 1TNFA 1PO21 1FOD3 5GZEA 3ZO0B 1COV1 5DMYA 1ZBA2 4IEUA 2FQPA 3VBUC 4YZ2A 5LRSA 3ACFA 4YZ3A 1A8DA 5DABA 4YZ5A 1V6NA 3HNBM 1OUSA 2W46A 2RS32 1PMHX 3EBRA 2UY8A 4MOAA 5FP8A 3ZKUA 4JQTA 4N8MA 4DB5A 3HMYA 2JXAA 3ZSLA 3ZXLA 4L9BA 1NZIA 1ZRFA 3H1MA 4D69A 1W6NA 4IEXA 1NLQA 1FYUA 2JEMA 2ZGNA 3AMHA 3W20A 5CYYA 1S1AA 4O9GA 3RJRA 1RUJ1 5C3PA 2P1BA 1JZ7A 1WMDA 2NMNA 1JODA 1US3A 1XSQA 2RMU2 2XJPA 3OYWA 4J25A 5FRAA 1H6YA 3KZ4C 4NO4A 2QNKA 3VHPA 4XUTA 2UWBA 2ZEYA 4LQRA 3BKZA 2E32A 1CWPA 1QJU3 2B7YA 3HBZA 1O5UA 4YW7A 5FBZA 1GNYA 4Y22B 4D3WA 4AZZA 2EAKA 2RJLA 1VBC3 2Y0IA 2PQSA 3OGGA 4LIVA 4TN7A 5F37A 4FP3A 4GJZA 4XAEA 3ST7A 1EPZA 1HB2A 3LFIA 4CCNA 5JDBA 4COWA 2VUJA 5C5UA 1TMF2 2WAAA 3OPZA 2QZ2A 2O8OA 1AR92 2P4EA 2W08A 1GUIA 4L8QA 4XJ9A 4N43C 1WW7A 4XBLA 3USUA 4JGZC 3NJXA 5A7OA 2V5DA 3WHUA 1LOAA 4CTEA 2VPVA 3ZFGA 4CCKA 4AEKA 1LOEA 3K3NA 2EIGA 4FP2A 4YPJA 5KXBA 3VDDA 4OUSA 5BY5A 2QCSB 4PJYA 4LBQA 3D0JA 1G7YA 1MS3A 4GAZA 1OQ1A 4KBZA 5T54A 1GFF2 1HRI3 1PZ9A 1IG3A 1O6UA 1IS5A 4CUAA 3ON7A 1VB4A 3RS6A 4LIUA 1WA4A 1ZBE1 4XC9A 1PO13 1UX7A 1PVC1 1HJGA 2PXJA 1O91A 5JI7A 5DPNA 3NJZA 3T4HB 2IXHA 2HKXA 2Q5TA 1XYOA 4ZZ8A 3TNPB 3BCWA 5FZKA 2XVGA 3OGSA 4Q27A 3UGGA 3LSDA 4XMIA 1YQ8A 2WNVA 5C33A 3THCA 3ZYRA 2YGLA 3T2OA 2JDMA 5D8AC 1QF3A 4FPLA 4LOTA 1JYTA 1VE0A 4P9WA 2FCVA 4HL0A 5DUWA 2JE7A 2R062 2ZZQA 1JU3A 1WGPA 2W47A 3VL8A 2L9LA 4B3NA 4Z1VA 2WS93 4GXLA 5IK5A 1MS0A 5GLWA 4E2GA 2D6OX 3ZFFB 1XB9A 4QXHA 1HN1A 1UZVA 2DTYA 3U11A 3WF4A 3PTYA 1JYVA 2EICA 4LKDA 3HT2A 3SEPA 5C7GA 1O7FA 3MO4A 2PAMA 4AXOA 5B2GB 2RDRA 3NNFA 2JB4A 4YZ4A 3FE5A 5FMOS 5EFUA 4MG2A 2B9UA 1QXJA 2WUHA 1O4ZA 1UU6A 3KGZA 4I0WB 5T5JA 4CCDA 1AF9A 3ZXGA 3ETQA 4LJHA 4DIQA 4AR2A 5BNNC 1GQHA 1PNGA 1YI9A 2BWAA 4HVOA 4M00A 5DUVA 3VZNA 4CDXB 1ENQA 1K5MA 3AYAA 4ARYA 4FTBA 5FKBA 1WLWA 3M4FA 4GA9A 1ODNA 4CDWA 1EUTA 4HK8A 2NZ9A 3PVNA 3ZPOA 2D93A 2H6BA 1FX5A 2WQZC 2DCZA 2PHTA 3BVCA 2VZUA 1Q3EA 4LORA 4Q4W1 2GC3A 1Z7S3 2BFUS 4RS5B 4CZSA 3GDBA 3ITQA 3B02A 1W05A 1TME3 2EAAA 3S7EA 1ZRIA 5FYUA 2YYOA 1OLMA 1OVPA 1IPKA 1OC1A 2ZKNA 4CEYA 1I6XA 3AVSA 2JDNA 2W1QA 4IXLA 4NVPA 2VM9A 5LBEA 1GP6A 2G9GA 1C8NA 3HOBA 4IW3A 1HB4A 1WCSA 4WM7B 3KV6A 3GZTB 4JKMA 3AL5A 4LBOA 3OGRA 1MQTA 1TE1B 4FAGA 2R0HA 5A7WA 2DWRA 4XUOA 1D2QA 3OEBA 5F1RA 3ZXAC 1KJRA 3ILRA 3AJZA 3IDAA 4OHWA 4YGDA 2EXJA 4BHPA 4RHV3 2PHFA 2X5IB 3HBKA 4QPGA 3RQ0A 3AYCA 4DS0A 1CJPA 1QMJA 4QQOA 4XETA 2JENA 5FLIA 3O12A 4H55A 4I3GA 1WCUA 4C1XA 5AC92 3M3QA 1V6MA 1MEC3 2VW0A 1H8TA 2RS12 4PDWB 4RR3A 5FZCA 2WZPP 1RVF3 4FI9A 3RGBA 4ET7A 1AR62 2R061 2ZGQA 3D8CA 3JZVA 1EV12 1SFYA 3WOGA 1CAXB 1CIWA 2FD8A 4JHTA 4CCLA 1XOYA 3IDEA 4Z8BA 2DTWA 5FYBA 5FUNA 2WFF1 2JB8A 5LZ6A 3VDBA 4EN9B 4K1ZA 2DUOA 4P14A 3NNGA 1GMMA 5EQUA 1OT5A 3AB0A 3NJYA 4KMQA 1NA1B 5FZOB 3LGRA 1KEXA 4YRDA 5FYVA 2W1SA 2XBO2 3VBRC 4WM8C 1SLTA 4NOTA 1L7RA 5L9RA 1LHVA 3M3EA 1R083 2F4LA 3KV5A 4K21A 4XF3A 4BISA 3JD73 3O1SA 2AC1A 3OBAA 5FJKA 2SBAA 1MR5A 3ZSEA 4QKNA 2HWC3 3ZR6A 1R1A2 1ZRCA 4MHRA 2Y6GA 2DFBA 3H50A 5EIYB 3NNMA 3GHMA 2R30A 4J1WA 1W6QB 3ZSKA 2YGMA 5FWEA 2P3IA 4O7XA 1JHJA 1Y9GA 3R4UA 5L7OB 1X82A 5D1IA 5GALA 4MGZE 2EA7A 5CIRA 4BMEA 4NJ4A 3KQRA 4W6YA 1DYOA 1YQCA 2NPIA 5FBJA 3M7AA 3TAYA 4P9IA 1RUC3 4CPBD 4QX3A 3I97A 4OHXA 5DAWA 2PHDA 4TWTA 2ZGMA 2MHFA 4QHZA 4FPOB 1N47A 1W2AX 4EN7B 3AZVA 3J26N 1RINA 3GM8A 4QHOA 5F2SA 4K40A 4ZKTB 1H2NA 2FDJA 2IFWA 3ZN6B 2R041 3POEA 1YQ2A 1AZDA 2BERA 3SNMA 3ZXKA 4NROA 4XFBA 1ZZ9A 4I2OA 3TRSB 5HPOA 2D44A 3MW4A 3UNPA 5I8SA 1D0GA 2A6VA 5JUVA 2MNGA 5AC91 3RZGA 1A6CA 2GALA 1RUH3 3JUUA 3MIDA 3QH6A 1F9KA 3CJIA 3VZKA 2RS11 3LEKA 1W2TA 5FMOL 1A8MA 1AR61 1UYPA 3Q9OA 1MZFA 5FY5A 4C0BA 3V0BA 5E6HA 5JIAA 3ZYJB 5KHGA 1EV11 1XYPA 2CHHA 1UCXA 2VUDA 5F3CA 2E7QA 1MVEA 2HWE1 1VBB3 3ACLA 2LROA 3CKHA 2BVBA 2E6VA 3ATGA 5FLHA 4AFBA 1ND3B 4C8DA 3INAA 1OI6A 5LW9A 3ZKYA 2BBVA 4ZONA 1HRV3 1YJLA 4PLOA 1UYYA 2WO3A 3MFCA 1XE0A 5LASA 3APBA 3A0NA 4UW5A 2EIBA 3C7FA 3JCIA 1E57A 2HEYF 4Y5Z0 1H4GA 2VNOA 1OD5A 5DQ0A 1R092 4LO4B 5JWPA 2J1AA 1QJY3 1TQ5A 4LKEA 1VBE2 1CZSA 4NR1A 5A7QA 1CAUB 3CMGA 2W3JA 4ZS2A 2OPWA 1YNAA 3JQXA 1H9PA 5B4NA 4HOOA 3E5UA 1FNZA 1I9RA 5FZ3A 4Q4Y1 2DBNA 4XYXA 5A6QA 5HCAA 5DAQA 4Z2WA 5FJHA 1UY3A 2PHWA 4YM2A 3T0DA 4MGKE 4RL7A 1OA3A 1OVSA 3RI8A 4CCOA 1RXGA 4EN8B 2J1RA 4Z92B 5FZHA 1ZRDA 4BWOA 5FV3A 1JZ8A 5JAXA 4OQ9A 3PDQA 2XWBB 4Q26A 4ASMB 3POYA 3UGHA 2WL1A 4IL7A 2YZ4A 1HXS2 3ZYPA 1OMIA 2OZJA 5FPUA 3T2PA 3ZFEB 4M01A 1DU3D 4OI2A 4OUMA 5A6XA 3VD4A 5FZEA 2JIJA 1JHNA 3O14A 4Q2FA 5FTTC 3T2TA 4F3JA 1G9AA 1FPN3 1SHWB 2HWB2 1BEV2 3OPTA 1BBT1 1KITA 1KS4A 3BALA 3FMGA 4IGOA 4Z07A 1O3QA 2B5HA 4M3CE 5DAXA 1GSLA 3KLSA 4FPYA 2ZGTA 5F6KA 5L19A 3RG0A 1H1MA 2BGOA 5GZCA 3CEWA 4AVSA 1OOPA 2XJRA 5KR7A 1RUD3 1H0BA 1RITA 1DFQA 2DCKA 2VJXA 1LGNA 4P9LA 2B9VA 2WQ8A 2RHPA 1H4HA 4YYOA 2A6XA 2A7AA 5DUUA 4YLZA 4XFFA 4XABA 1WD4A 2R072 2XLGA 3SH3A 1WLCA 4IV3B 4CDXC 4B29A 5G04L 2PHXA 5FZ0A 4GQ7A 4PQ9A 2ADDA 4LULA 3MF9A 4QB6A 4CEWB 4QPIB 4XJZA 5JOXA 3ACIA 4PIZA 3DECA 4HK9A 1D4M2 2VQ0A 4OZXA 3RMXA 2ARAA 4YW5A 4A7KA 3H1YA 1VAVA 3BTYA 2BNNA 4NIDA 4W4ZA 4YFWA 1AHSA 4YW1A 3LEIA 2IVIB 1B35A 2Y6FA 2XG3A 4MH0E 1LGBA 4P5HA 5LEJA 4FFFA 5B4XA 5JR2A 5KHJA 3S57A 3M1HA 1POV0 3I2OA 2XJUA 4EROA 5DDJ3 3IZOA 4WM7C 1LENA 3J7NA 5ACA3 1WWYA 1R64A 4LBKA 1YRZA 2B46X 5JVVA 2RM22 1Q8OA 1XJAA 3WQBA 1W6OB 2LUWA 3MI8A 3VZOA 1JS9A 3AZXA 4LKFA 4JRLA 3M70A 1FMD1 1CR7A 3DUIA 3KB5A 3WDYA 2BQPA 2XXZA 4NIAA 2BEOA 2N7GA 5BV6A 4D6QA 2GNDA 4IUGA 1LJ7A 1W8HA 3DPRA 3OCPA 1YC61 2VZVA 4R9CA 1NCQA 4QX1A 1RUE2 3SCGA 2YBPA 4EJRA 3V56A 3NJVA 1BZWA 2ZTNA 1PMIA 3HWJA 4AVBA 1G9BA 3H1WA 4N90A 2VULA 5LY1A 1RIRA 1JXNA 2JKXA 2YFUA 2GZWA 2QQPA 4LK6A 4AAXA 5C4WB 4CSWA 5FZ6A 3VD3A 2HWB1 2VOTA 1LEMA 4N9IA 1LAJA 1CJDA 2BRTA 1LOGA 3TN92 3FL7A 4CXXA 5GZGA 2IXCA 3MZHA 4XFAA 2QJVA 3H3ZA 1CAVA 3QACA 1W6PB 2OUJA 3I8TA 4HKOA 4UFLA 2WN3A 4HONA 4UW4A 4YVSB 2GC1A 2JWPA 4LBMA 1GZCA 4OLLA 1Q5OA 4YNIA 3WF2A 1DZTA 1PM7A 2ZX3A 3GYDA 2D6PA 3T2QA 5KBFA 4QB1A 2Z5WA 3UKNA 3P6BA 1DQ1A 1POV3 1ST8A 2JG9C 3J8F2 4GULA 1V9U3 1JZ6A 4NIHA 1RUNA 2R071 4URAA 3CLPA 3AKSA 3WHTA 5AFBA 3S30A 1PNFA 1WA6X 1EP0A 1A3KA 3ZIWA 4D6RA 1AR82 2HWD3 3HVDA 4PBOA 2H6CA 1IKQA 2WQ4A 3IMNA 2RDQA 2VNVA 3BTAA 4FFGA 4YW2A 3WNNA 4BM8A 5A3PA 4QB2A 2AACA 2GH8A 3K75B 4XUNA 4ONUA 1WUVA 4I0AA 3VHRA 1J83A 4IQPA 4YGBA 4P02B 5T55A 5JOYA 2VMHA 2EXKA 4ATEA 1O5LA 1S0DA 2YMZA 1AX0A 3MLJA 4KNCA 5A3OA 4XIKA 4DXRA 3E6DA 1LULA 2QQUA 2W0XA 2O8QA 2GP3A 5IYYA 2UURA 1LGCA 3HJRA 1LCLA 1PGL2 2P3JA 2KR2A 3D6EA 4IESA 4UFMA 4JHZA 4DO0A 3RZJA 3BYWA 2BUKA 2JICA 4BQWA 2XHNA 1MS1A 2RM21 2TBVA 3KF3A 4Q4X3 1LU2A 2MEV2 3GZUC 3VZLA 4AQSA 3P3PA 4ASLA 5JXJA 5FXXA 1O3RA 3SXWA 5LA9A 1VRBA 1JU4A 4Y1UA 1NQDA 1L7QA 1MS8A 3EXUA 4N43B 1L7LA 1RUF2 3BI3A 5JZGA 3VBSA 1RUE1 2HBTA 4KG0A 1RHI2 4CP9B 2BVVA 4AI2A 1QGLA 4ITCA 3DYOA 3HPNA 4LEJA 3D3AA 1G86A 2Y6KA 4FPKA 2ZGSA 2WDBA 3KT7A 5A33B 1UOGA 2ZEWA 4G4FA 1DIWA 2RR13 4M3CA 5FYCA 4EN0A 1QH6A 5FMCA 3SKJE 3ZFEA 2ZGUA 3R6SA 5DXDA 4QDSA 2VCMA 1UO9A 4A6OA 2IC1A 4GB32 3PLQA 3S7IA 2NYYA 1I3HA 2RV9A 2VZ1A 2QQKA 5CFDA 3H8RA 4HVRA 4K1YA 1CX1A 3C7GA 3BIEA 4Y20A 1OQEA 4KQ7A 1KS5A 1JTZX 4A45A 5JPMB 1G6NA 4NHXA 3I3BA 4IV1A 4AF9A 1CESA 4P00B 4EE2A 1MZEA 4Q0UA 4J1XA 4Q0PA 5FYYA 2VNGA 3ZIXA 2GP5A 4EYUA 2WA4A 3VZJA 5D8AB 1IGOA 1YFXA 3F95A 3ELNA 3N7LA 3KCYA 2WABA 1QXRA 4QQPA 2VNRA 1GZWB 4IEWA 5ERLA 1JZ2A 2W2IA 1EAH2 1UYZA 3AXEA 4CEWA 1QOTA 2LALA 4N7UA 2DUQA 3HIFA 4B1LA 1TEIA 2AENA 1UZWA 1CGPA 4B4QA 3ZDSA 4DINB 1LHUA 1Z78A 5IVFA 4CUCA 2KXLA 3N36A 4KGGA 3RMYA 1BVVA 3VDAA 2HLEA 2YG0A 5E8AA 4D0QA 2QDRA 5CFCA 1PGL1 3POFA 5T5LA 4N53B 1NUKA 4DXSA 5ABJA 5KXCA 5LCWL 3HT1A 2ZAAA 1BJQA 5JR7B 4CU6A 4J6GA 2E7AA 1AL0G 2MEV1 3ZSMA 1VBA2 4BQ2A 4IEQA 4Q4V1 4Z2AA 1NG0A 5BNNB 2YDEA 4Q0QA 2RJKA 2WZ8A 1PO22 1KJLA 4SBVA 1COV2 3GZEA 3N35A 2JX9A 2KM2A 1ALYA 1UOFA 4E2QA 5CADA 1AYM1 1QJX3 1W9SA 3IKWA 1VRH1 2CWSA 5FQ0A 1UNBA 4UWDA 3CNAA 1SCRA 4L11A 4OYUA 4DRVA 4IV3C 2P3YA 3B94A 5F7UA 5FPAA 2A75A 4Y5SA 2BGPA 2RDNA 3BB6A 3VBHA 1QWRA 2DBIA 4RYDA 3O1VA 2B4KA 4YVWB 1LNSA 3GZAA 3FLPA 2ATFA 1SEFA 2BWCA 2VMCA 3USSA 3O1MA 1AX1A 1RMU2 3W21A 2ZGLA 2FCTA 4QHBA 5APAA 5FZGA 1RUJ2 2XR4A 1XPWA 4AVAA 1FT9A 1GBGA 1FI2A 3T3YA 5LEKA 1QDOA 3FWEA 1UF2C 3IDCB 4UOJA 5T5OA 3ZYBA 1AL21 1DGRN 4WZFA 4NUBA 2YY1A 5FYHA 1V6LA 3DGTA 4OI1A 2BZDA 4NRPA 4BLJA 1ULDA 4JDOA 4HANA 1CAWB 1JOJA 4I02A 1WMFA 3VL9A 4AEDA 3CQOA 2VMEA 2V09A 3A23A 1LHOA 1KD7A 1VP6A 2XJVA 4IERA 3VBUA 4XJWA 2FDKA 5IJRA 3UV9A 2WINB 3MHZA 2VCCA 2P3KA 4V1PA 4AFAA 2YC0A 3ZR5A 3LD8A 5EWSA 5IT6A 4FFIA 3WQ0A 5K8SA 2PELA 5FFOC 3U78A 4BU2A 5BNPA 1T6BX 3WUCA 1RUI1 1H2LA 2KA3A 3J7LA 5BNOC 2ZHNA 5FP4A 1RUG1 4HKWA 2ZX0A 1C8M1 3AZYA 4KG8A 4LTAA 5EV7A 4AHZA 4OVEA 2GNBA 1W8WA 5C4WC 1AR71 2VVFA 3VBRB 4FPJA 4PQQA 2EXIA 1WW4A 2XONA 5DZEA 4PHZA 3GNEA 3O1PA 1OHFA 1VBA1 2LS6A 2ZHKA 1JZ5A 4YVSC 3VHOA 4NHYA 4NE9A 3BODA 3QOPA 2X8KA 4OCTA 4AK3A 5A7NA 1VBC2 4RQPC 1ZBE2 2VVEA 2XHKA 3GALA 5LA1A 3VZMA 1DGLA 1PVC2 2QQIA 3HN3A 3UYJA 4RGAA 3FZ3A 1QEXA 2RE9A 2V73A 3J4UH 1U5XA 1APNA 1HQWA 2C0ZA 4YZ1A 1JYXA 1QQP3 5FMBA 2J1VA 5LBBA 1JI6A 3OUJA 1QKQA 4OZOA 2Q30A 4QKDA 1RB8G 3EJKA 4FO9A 3B9CA 4JGZA 4AI1A 5K0UB 5FCCA 4C1WA 3I2IA 2Y6LA 3I2HA 4OULA 4KL1A 5FYZA 4HLTA 4AI3A 4XTPA 3O1OA 3H8OA 1G8WA 1ULOA 4GJYA 1RMU1 1SPPB 4GWNA 1J59A 1CD3G 1RUOA 2WWJA 4M3CF 1I5PA 3U1XA 1MACA 4FVVA 3LA7A 1FXZA 4GMP1 1W2NA 3WR0A 1AYN3 3U75A 3RZLA 2G1MA 1AXZA 3MV01 5CVRA 2CV6A 2VBPA 2WZR1 5JXIA 1LR5A 2VQUA 3FUOA 3K77A 4GKYA 4YG3A 3T09A 1FOD1 3AZWA 1XNTA 4K8FA 4N9HA 1ENXA 1Y9QA 1W6MB 4QQ2A 2UYBA 3EMRA 1GYKA 2WNUA 3B93A 1X8EA 4A4AA 1YI7A 2OQ7A 3ZYHA 3J7HA 4R9AA 4P08A 4FPGA 4XZPA 2VMFA 1DQ2A 5GLUA 2ZGPA 3RJ2X 3O1RA 4IDZA 2AREA 1NKGA 1IPJA 2HWF2 2XQRA 3NAPB 3OG2A 4FXGB 5FZ7A 3ES1A 4JGYA 5FIXA 5FO9B 1QU0A 2BBAA 4XFGA 2XUEA 1O4YA 1UQXA 4E4DX 1PK6A 2ZMKA 4Q4W2 5C8CC 1W0PA 3H8XA 2XUMA 2A73B 5C5TA 1H2MA 4GH4C 2WLQA 2GDFA 1SZBA 1ZBA3 2OT7A 3SHRA 3RI9A 5IVVA 4AEMA 4LHSA 4Y24A 1QJU1 3SEEA 3KVBA 3WLUA 2VTFA 5BNPC 2RS33 1OH3A 1F4HA 3VDCA 2Q8OA 4EN6B 2DFCA 1VBC1 4XURA 2JDUA 1GKBA 4OI4A 3WNMA 4JZRA 3A7QA 1ZRRA 4YSFA 2E53A 4X8PA 4XEZA 2VGDA 3DL3A 3Q8CA 2GSYA 4B7EA 1UXXX 1ND2A 3DKQA 4GWIA 4MV2A 2OUHA 3AKQA 1CZTA 4IGPA 2XLFA 5JLVA 2RMU3 4I3PA 3VN4A 2WWSA 3C7OA 4A2UA 1PIV2 1OKQA 5HI0A 3I7DA 5FKCA 3GJAA 4DOUA 3NV1A 4P5YA 4H14A 3ZPYA 4D7TA 3E1F1 1SMVA 3HN1A 5GLZA 5IW0A 3I59A 5EYYA 2ZHLA 4R9DA 2DCTA 2VUAA 5T52A 3V0AA 4R4XA 2WFF2 1ZNPA 2ETEA 2R1DA 1HRI1 3NO8A 4K9SA 3X29B 1TMF3 1AR93 4MGQA 4N53C 2WNOA 2ES3A 5CEHA 4XDOA 1OD3A 4UYBA 2F4PA 1OF4A 4I09A 5D21A 3U14A 3KQ4B 4YW6A 2VOWA 2D98A 5IAXA 3BU0A 2CAVA 2GNTA 3ZFGC 4RHV2 2GNMA 2OXBA 4Y5TA 2FDHA 4DQAA 4COZA 2C9AA 1ZM1A 2HWF1 4LO5B 3RWKX 3MW3A 1XNKA 2WZEA 4LBJA 1UZYA 3GJBA 2XQXA 3NVCA 2JG8B 2NM1A 3VBFB 5GJ6A 5IWFA 1AUYA 4CCJA 1W9WA 2VTXJ 3MICA 2J22A 4K3UA 1SQ4A 1N1SA 2WS91 2XMLA 4X6QB 4Y1VA 2O1QA 4HPKB 4AQ6A 1KGYA 4YVWC 3OF1A 3N4MA 1Q8VA 1ZZ7A 3F2ZA 3DYPA 1B09A 1MS5A 4LMFA 5FREA 2XDVA 4UFJA 1TVGA 2OA2A 3MBWA 2ET7A 3DF0A 4BOWA 4W8JA 2SLIA 4XJUA 3FBYA 3OOXA 1BKZA 2W68A 4WM8A 2VCAA 3D5OA 1OFSA 4AVVA 3AP9A 4SLIA 5A3UA 4QAWA 1LOBA 2AZ5A 3B9IA 5FPLA 3PUQA 2R042 1IHMA 2ENRA 3KT4A 3CZUA 3VUOA 1F2NA 2BOIA 2BNOA 5KHKA 1MPXA 2OYZA 1GNZA 3ZMOA 3VD5A 5F5QA 2LW8A 3K3OA 5FYSA 5FZFA 5H9RA 4NPRA 5FP7A 3O0VA 1WCDJ 1PX3A 2J1SA 3U4XA 4BB3A 2DYCA 1JOPA 5I93A 1W03A 1PIV1 1VB2A 3AYEA 5CG9A 1SACA 1WD3A 1Z7S1 4DUXA 3LCPA 3GBWA 4WZCA 1TME1 4XIOA 2YFZA 4CVUA 2BW8A 3AK0A 1JW6A 3W58A 5JSOA 3ECQA 1DF0A 2HWE2 1UZ0A 2VC9A 3BTZA 3OY8B 2VY0A 5FY8A 4R52A 4KBBA 4MXVA 4FPFA 2R32A 1K5MC 4CCMA 3EB7A 4CXWA 1W2UA 2QQVA 1HIXA 3AFKA 3UL2A 5CAZA 2FMYA 2RJ2A 5EJZB 3CF6E 2VW2A 3B5LB 4Y22A 3VDDC 1O3TA 1OKOA 3UGFA 2JG9B 4DFSA 4RHV1 1OPOA 4FQ4A 2YC2A 1UY0A 2Y26A 2X05A 4HMZA 5JPNB 2WNEA 1W0OA 1PZ8A 3ZN5A 1ZX5A 4Q4Y2 3FLRA 1CONA 4GWMA 2R6QA 5SV8A 4K6BA 1DLLA 1RVF1 1XQNA 3WY6A 3KT1A 4PF1A 2XJTA 2YHJA 3AXDA 3CDZB 4BPZA 2GU9A 1XE8A 4QQLA 1ACCA 4B4RA 3A4UA 1S0CA 2CTVA 3PMSA 5K0UC 4CDUB 1R1ZA 1RJ8A 4OMDA 3RDIA 5JMOA 3EQEA 3P3NA 1MZ5A 3JXSA 3MIGA 5A3LA 1SFNA 4K8RB 4KWLA 5J98B 4QDRA 1OXCA 3G6JB 2XVKA 4JKLA 5CISA 4DEVA 3I3MA 2DF7A 1G9FA 3RRDA 1CPNA 2OW4A 3IPVB 3KS7A 5A6YA 5F9TA 3LDRA 1LTEA 3BOWA 1J3PA 3CBNA 5AC93 1XNCA 1BBT2 1R081 1S55A 1LODA 3GGLA 3WXPA 3AP7A 2A6ZA 5DN2A 3JD71 3WP3A 5C3SA 2RS13 4RR3C 4FTSA 4LPLA 5IVYA 1TZOA 2HWC1 2Z79A 4O9EA 3S0MA 4Y1XA 5A3WA 1EV13 3LDBA 3JU9A 4A7YA 4META 5L36A 2PLV3 1W9TA 2JJ6A 1ASJ3 3JBG3 1J1LA 3M3IA 3E6BA 1XBFA 2X53S 1JH5A 4Q1PA 1AJKA 3VKFC 2ARBA 1UMZA 4GKXA 5FZLA 3LB9A 2G19A 4LA3A 2ZACA 4AL9A 4B1MA 3NWKA 4PI0A 4TZDA 3NAPC 2XBO3 2GH2A 2UWAA 3MUZ1 4AW7A 2Z69A 3HQRA 3U0ZA 3PVEA 1RUC1 4XOGA 1NCRB 2BPA2 1WCQA 3E5QA 2XJSA 3ZSJA 1MZ6A 5F3IA 5IK8A 1UMHA 3DXUA 3PVOA 4NRMA 5HCFA 1SLLA 1R1A3 3NSTA 1W0NA 1YLLA 2Q1ZB 3WCRA 3ZFFA 5KC5A 1XU1A 5E88A 4RSUA 4UF0B 4KI5M 4A6SA 5I0RA 3W5NA 4OUEA 4D7YA 1M4WA 1IPSA 4P9GA 1LESA 4NRQA 5A80A 2ZGRA 4ARXA 5EYXA 3WW2A 5F3EA 4AHYA 4LBNA 3MF6A 4Q8KA 1RUD2 1XC6A 4M4RA 3H9AA 3ACGA 2EIEA 4H7LA 3RYPA 1RUH1 4FAHA 1FMD2 3OB8A 1YIPA 1C5HA 5GLVA 4CDXA 1VBD3 4RD7A 3D0SA 2VW1A 4LE3A 4QWNA 3QLQA 5ANQA 2VTXA 1XNBA 2IFRA 5LK7B 1G9CA 2B8MA 1VBB1 4QKFA 4JV4A 2XKPA 1Q43A 4RS5A 5BNQA 2JDPA 3I2JA 1LKNA 1UPSA 2CSGA 2EALA 1HRV1 4FCAA 4FPHA 1WW5A 5A32B 3RZMA 4JTOA 1QIQA 3ZYFA 2VZOA 5A1FA 1NY71 2AEZA 5LK5A 3NMBA 4FPEA 3IWZA 3PJYA 4DPNA 4PLNA 4FOVA 3VBOB 2ZGOA 3ZN4A 4FOWA 5DG1A 3CJIC 4MGSA 4DUVA 1LHWA 4BQ3A 4A42A 4WM7A 5DZFA 2WN2A 5K7PA 4XFIA 3O1UA 1ZZCA 3HEIA 1GNHA 2IWGB 3NKGA 2ADEA 2EVXA 4P9XA 1E5RA 4PIXA 4S2GA 3TYJA 3WDVA 3WP5A 5CA6A 2VMDA 5JSRA 5L9BA 5C71A 1Q56A 1XNAA 4NAOA 4RA0A 1X9TA 1V6IA 4QPWA 3WG1A 2C26A 2X5IA 2BU9A 4ORFA 1AXKA 5CU1A 4AWDA 2PMWB 1LECA 2W39A 2YXSA 3K2OA 1UAIA 3TEXA 3U4SA 2Y0OA 4O65A 2NQYA 2PHRA 3VV1A 2JG8C 4XTMA 4PDWA 3VBFC 4R4ZA 3FFZA 5J3UA 1QJZA 3ASIA 2UYAA 1R093 2NN8A 4IEVA 1CAXA 2W91A 3WSOA 1VBE3 2BNMA 5GZFA 1XE7A 2Q1MA 3DYMA 3N9NA 2R0FA 5C9AB 1W9FA 2B42B 1ONAA 2E51A 1FPN1 2B39A 4MGIE 1IZ3A 2ID4A 4XFCA 1YFYA 1VLNA 3K48A 4S2HA 1J84A 2K46A 1NA1A 5FZOA 4FBFA 3WNLA 2I74A 4NIIA 1RUD1 5FZ1A 3KCXA 5HCHA 3MYXA 1GR3A 3S6PA 3LKJA 3KHBA 1HXS3 3GCWA 3KVAA 2YPJA 4UFIA 3NKTA 1J1TA 3RZKA 2I2SA 2VOKA 3WDWA 4S2FA 1YQ6A 4KU8A 4AYUA 2Y60A 1W6QA 1BEV3 4QGMA 4MZUA 2Z4FA 1EYBA 4LO6B 5L7OA 3LOBA 5BPXA 1DGWA 1OFNA 5BNOB 3IAPA 1G9DA 1REFA 4ZY9A 1CPMA 1QJEA 2ZOEB 2GAUA 2CNAA 4UI9L 4EQVA 1OOPC 1XSRA 5HV0A 2OS2A 3SCHA 2FMDA 1SBDA 4ZPIA 2JDYA 4CDQC 1QH7A 4BYYA 2PFWA 5JOZA 4JAAA 4F7ZA 3B7MA 4QGNA 4LA2A 2CYFA 1FNYA 2E31A 4FFHA 1V00A 5DDJ1 2VOXA 5CZKA 3R0RA 5BYNA 3J9SA 4JQRA 1GOHA 4CU9A 4NN0A 4RQPB 1IS4A 2E63A 3ZN6A 4HVQA 3C3VA 3SH5A 1D4M3 3B3QE 5F32A 3K51A 2GMPA 5DAVA 1T6GC 4A3ZA 4BMBA 5T50A 5FO8B 1S2KA 5DAPA 3KGLA 1M06G 2B45X 4EZHA 3HQUA 4IEOA 4IETA 2VZSA 1ZZ6A 2A70A 4MGYE 4XUQA 1YJKA 1JZ4A 2JE8A 1PGW1 1CZVA 4XCAA 3U37A 4BK5A 1Y4WA 2WC2A 4LUMA 2JKBA 4XQ4A 2D5FA 4WV8A 3JB8A 4CDUC 4IEPA 2YB7A 4Y26A 2D6KA 3A21A 2RM23 3TEWA 3HNYM 4TYSA 4F83A 3LIHA 4DZGA 1UY1A 1LEDA 1U12A 2HBUA 1ND3A 4Y1YA 2Z42A 2D3SA 3H3LA 4QDQA 3H42B 4MXWB 1WLTA 3KWVA 4QX0A 4XHBA 5I8TA 2E7TA 1EUUA 1JYIA 5JI9A 5D2AA 3OUIA 3ZXFA 3DPRC 3V64A 3KSCA 1NCQC 1OUXA 3MUY1 1RUE3 4LLOA 4PLMA 1HW5A 3DN7A 1POV1 1VJ2A 4Q4V2 5FY0A 1NT0A 1V9U1 2TUNA 4AGGA 4BJ0A 1D0HA 1CAUA 4YWAA 3O1TA 4I30A 4XACA 2GN3A 4YW3A 1S0IA 1N1YA 1RTVA 2R1BA 2C9KA 2IXKA 2RG4A 2QDNA 3WP6A 5GLTA 1AYM2 4HXCA 2YV8A 3WF0A 2XLAA 4AFDA 2X10A 2HWD1 1VRH2 3POWA 3MPPG 2ZMLA 3TN93 3LE0A 5C8CB 1SBEA 3MV11 3WNOA 2D3PA 4IGQA 4GH4B 2W1UA 4HSLA 2EXHA 2ZPXA 2AGSA 3PIJA 4NAMA 1RYYA 1ZA4A 2VAUA 3LEGA 1NCRC 3POIA 3LZZA 3J8F3 4IEZA 3CJXA 3GCXA 5FP9A 2W5FA 1DG6A 3UESA 3QD6A 5BNPB 4ZXEA 2HYKA 4QX7A 3L2HA 3CL1A 1ZREA 1OURA 3GBFA 3CHXA 4Q4X1 3KCCA 1AR83 1AL22 4QM9A 4K20A 2QQNA 5I91A 4AHWA 1W6NB 4TLFA 2P34A 2ORXA 3IDBB 2A3XA 5JCTA 4Y3OA 2PHUA 3OYWB 2OIIA 2RS53 1TG7A 2BTVC 3H7YA 2YC4A 1UXZA 4IV3A 4R8HA 3ROUA 1U0AA 2EF6A 1W8FA 3Q8AA 4UFKA 2NLRA 4QPIA 5I0UA 2V5YA 4H2AA 3T0AA 1US2A 2H0BA 2WJSA 3VKMA 2QE3A 1RXFA 1YFWA 2RR11 4P9YA 1F4AA 3WEZA 2MEV3 1RUI2 3I2GA 4XPVA 3AC0A 5FK7A 4CU7A 1RUG2 2P17A 1S0EA 1C8M2 3AFGA 4YG6A 4BQ1A 3I3DA 2P5BA 1AR72 1ZZ8A 4V2WA 3USUB 1RUF3 4AOCA 3VBOC 1JMUB 4BIOA 3C2UA 5BXXA 4ZU7A 3FLTA 1RHI3 2PHLA 1E5SA 2D5HA 2XWJB 4OHVA 3N9LA 4JCKA 4E8CA 3ZFGB 2PTMA 2Y38A 2DVFA 5FPZA 1LOFC 4BIFA 5C8WA 3B69A 2LRPA 2JDHA 5A3TA 1SG3A 2VVDA 2VG9A 1W6OA 3IB3A 3TBDA 2WYSA 2XL7A 4R9BA 3O5SA 2VE1A 5DUXA 3WW4A 1BMV2 4NWVA 5IVJA 2C24A 4GB33 5DZGA 1DZQA 2VXJA 4MUVA 3T1LA 1JYWA 1OBNA 4AI8A 5CFDC 4Q0VA 5IK4A 4WBBA 4QXKA 1JZ3A 4C90A 5FY4A 3N9PA 3OGVA 1HLCA 3THTA 4KGQA 1UKRA 1UWWA 2ZXQA 4YM0A 5F39A 4U2AA 4IV1C 4W6WA 3IN9A 1NAEA 2HH9A 1SDWA 2QQJA 2WNVB 4QU1A 5C4WA 4DUWA 5C9AC 1ZA7A 4Q5OA 2OQ6A 4HN0A 2XH6A 4BA6A 3ZXDA 4BXSV 2GMEA 2A1XA 2WZR2 3CZJA 4YVSA 1W6PA 1SLIA 1GWLA 4IEYA 3P5BA 1EAH3 1FOD2 3EO6A 1DQ0A 4QT6A 4GMP0 3U10A 3VHNA 4ES8A 1Q8PA 5FXZA 1N1TA 1F8VA 1BCXA 3HR9A 3SITA 3D4KA 5LB6A 4OHYA 1ZVFA 2VBDA 3NNLA 2C6SA 3FHAA 3TOJA 2VBBA 3LIGA 5FR3A 3ILFA 1UIJA 1MS9A 5LA2A 4MVTA 1VBA3 2ZA9A 2AYHA 2UWCA 3EHKA 1KFUL 3OSDA 3FN9A 4LHNA 1HV1A 3KMHA 4LR4A 1PO23 4Q0SA 1MS4A 2WO1A 1COV3 2CGPA 1K5MB 1DGRA 2H0VA 2GMMA 5GZDA 4CDWB 1V6OA 3SISA 1QJU2 4CYDA 1D4VB 1QNYA 3FHIB 2X09A 3VDDB 1BLZA 2WSVA 1W90A 1SLCA 4S2DA 5FZDA 5JXGA 4CCEA 2CDPA 3VBHC 1UY2A 3ES4A 1VMFA 2A6WA 3H7JA 5LWBA 4LK7A 4CXYA 3N7MA 1BMV1 3G7DA 1CQ9A 3OBRA 4QU2A 1UW8A 4CEYB 5FP3A 2ZX1A 1NOVA 1Y3TA 2CL2A 1N3OA 1RUJ3 1V0AA 4N43A 4GMP3 5G05L 2IZWA 5FLJA 1GICA 2JD9A 3NRUA 3ZLIA 2WO7A 1MQTB 3O0WA 4CP9A 3GBGA 3PUSA 3D82A 3PMEA 5A7WB 4BCUA 3WW3A 2DVGA 3N7KA 3I3QA 3T4VA 1ULGA 5T3NA 5A33A 1KQRA 4PIYA 4EWEA 3L9JT 3R4DB 4AEDC 4QPGB 1STMA 5A1AA 3TNQA 2RVAA 1EY2A 2WT2A 1OPMA 2Y8KA 3RZZA 3POSA 4JKKA 4LHLA 1HRI2 2OKXA 1ZZBA 1F15A 1H8TB 1VAMA 1YHFA 2P6HA 2WO2A 3Q8EA 4RR3B 2G9FA 3OEAA 1UKGA 2LM3A 3AM2A 3ME2A 3SCFA 3K4ZA 1X7NA 3VKOA 4BE3A 5FWJA 4O61A 1PO12 2CU5A 5J7MA 1GU3A 1UMIA 2VUCA 4XHXA 4RGKA 1SCSA 2J1EA 1RJ7A 1PZ7A 1BYHA 2XKOA 3BPZA 5CKNA 1S0BA 1QQP1 3K46A 4XDQA 4BQ4A 3VD7A 5D8AA 3N7JA 3FBMA 3K4DA 1TNRA 4XBNA 4XJAA 2O14A 1DGWX 1QOSA 3MDPA 1FV2A 1GZWA 3JB4C 2ZEZA 5F5IA 2AUYA 1REEA 1IS6A 1HKDA 1IG0A 2YROA 5HV4A 3AMQA 5FZBA 3BPSA 2ZCWA 5HBAA 2WS92 1ZBE3 1AYN1 4XF1A 3ZXJA 1PVC3 4XUPA 3CU7A 4LBQD 3WT3A 1XYNA 3T0BA 3LOIA 3NQHA 4FOYA 1OQDA 3PUHA 5KXDA 4E4HA 1OLQA 1BK0A 4K7JA 4N53A 4UBGA 3RPQA 2OZ6A 2XGXA 2WIIB 3WQ7A 2VH9A 3LEMA 4YW4A 4RFT0 1JYNA 5A7SA 4JTNA 3PU8A 1UL9A 4ZZ5A 2ILMA 3PVBB 4ZHNA 5BNNA 4FTEA 4DRRA 3U07A 2F17A 1A34A 1HN0A 3KV4A 4M0HA 2YU1A 2W9XA 1V70A 1F35A 5H9PA 1QXPA 3LFMA 2WKKA 2UY9A 3DXTA 1HX6A 4U36A 3PUAA 5FUIA 5C3QA 5IVBA 3VLBB 1AX2A 1Y43B 2C4XA 2DVDA 1U5IA 2CY6A 4JDMA 3RYRA 4AHXA 2K2SA 3AP4A 1Z7S2 5C3RA 4KWUA 1GQGA 3UKTA 3PURA 2WT0A 5E16A 1TME2 3FUQA 3MEPA 4CE8A 2J1TA 2A6YA 4L97A 4FSJA 2QTWB 2ZHMA 1ZBA1 4YVWA 4EWAA 2OVUA 4MLOA 2WNUC 3SQOA 2NMOA 3CJIB 2RDSA 2RS31 1CIYA 1DQ6A 3A22A 4ZXKA 5KXEA 2YBSA 1PMJX 3BGAA 4H7MA 3TB0A 3V0BB 5I8YA 2HWF3 3ENRA 4DXTA 4YFZA 1PO11 5ANNA 4JGYC 4ZU4A 4URTA 1XXNA 1UIKA 2DURA 1PK6C 2K0GA 1N3PA 4Q4W3 3GHNA 4ZS3A 2MPFA 1YUDA 1DP0A 4CA9A 1CAWA 4TSVA 1ULFA 1YIFA 1YQ5A 2XOMA 3I2FA 4HZFA 2VXRA 4OFGA 1E5IA 4AE2A 1DDLA 1QDCA 2VOVA 4XE9A 3IAQA 5IK7A 2RMU1 2TEPA 2WT1A 4TLGA 3RSJA 3URFA 1MEC2 3AYDA 2QBXA 5E1RA 2VCBA 1GQPA 2ZABA 1RVF2 3AVRA 3EYPA 3LWCA 1H6XA 4QX2A 1GOFA 1IKPA 2BOJA 4I0BA 1QY4A 3I3EA 4QMAA 4FOQA 4Y1ZA 1S2BA 5CB7A 1GP4A 4COVA 5FK8A 5IVCA 1UN1A 1H30A 1ND2C 4E9KA 1TMF1 4COYA 2WNVC 1AR91 1QJFA 3VBRA 1UU5A 4EWDA 4OQ8A 2DVAA 1U5YA 3IT8A 5KHIA 2PYTA 2QQMA 3I4IA 1AJOA 1R082 3WQ1A 1PIV3 1QOOA 1XU2A 5FO7B 4DY5A 3AKTA 3JD72 4MADA 4XILA 2HWC2 2R063 4UW3A 2FDFA 4RN5A 4UW6A 1NE4A 2D6NA 3WG3A 1VMHA 2GC2A 5IATA 4L2NA 1ZYBA 2Q8CA 3HD8B 1X36A 1YO8A 2WFF3 2DCYA 4JRAA 5DG2A 3OUHA 4V2VA 2Q8EA 4XXAA 3OGJA 2Y33A 3WF3A 2VD7A 2YPDA 1LRHA 1W28A 3NNJA 5K0UA 5FMDA 1OOPB 2VQTA 3R4SA 4XAAA 3WG4A 2I07B 4Q29A 4DMIA 2XVLA 1RUC2 2VMGA 5FZIA 2XB6C 1NX9A 3JQWA 3PNAA 3IMMA 4M4PA 4CDQB 1SPPA 4QQHA 1FAYA 1H1IA 5LA0A 3ZMNA 2ORZA 1W3XA 1X9PA 1UX6A 3M2MA 3PTRB 2FZ1A 4AEJA 3WUDA 2I45A 1NYWA 4HT1T 4P9JA 2QUOA 3BTXA 4CDWC 4Q8LA 3WNKA 1N3QA 1DYKA 1V6KA 2JE9A 1DHKB 3AKPA 3GF6A 4QXBA 3WF1A 4LO8A 5A6ZA 1CX4A 2NP0A 5HCBA 3RYKA 5F2WA 5JMCA 1KFXL 5K9YA 1IOAA 3E5XA 3OD4A 4L0PA 1W6MA 2PLV2 4NWWA 3JBG2 1ASJ2 3ETPA 1B35B 2JDAA 1RUH2 3LF7A 3WZ1A 1POQA 1MEC1 2ARCA 1SFPA 4Y4RA 3WNPA 4CEYC 5L9VA 5I0DA 1J3QA 3R05A 5FZ9A 3NAPA 1NLRA 3MLLA 1D2SA 3SKVA 2W95A 2DUPA 1MQTC 4FQZA 1FV3A 1REDA 1VBB2 2JECA 2R043 2YBKA 4QGLA 5A7PA 4YARA 4AI0A 1ODMA 3W5MA 2Z2SB 3M8LA 1S0GA 3HQXA 3AMNA 4GD4A 1O3SA 5KHHA 5T5PA 1S2EA 1HRV2 4Z82A 1RL3A 4QPGC 3KV9A 2FDGA 1NY72 3WP4A 3BN6A 3WINE 3ZOIA 4CP2A 5C3OA 2EIDA 3DPRB 3VGIA 5C6CA 1NCQB 1H1AA 1LOCA 1F5JA 1H8TC 2W87A 2WLPA 1AR63 1BXHA 1QJY2 4ES9A 4Y4YA 3IIAA 2FZ2A 2BGCA 4OHZA 1KDKA 4MX3A 2AH2A 4LNVA 3J7MA 1S4CA 5EZWA 5EP9A 2DDUA 4AQTA 4MHUA 2HWE3 4Q1RA 4CPBA 4DEQA 2CAUA 3MIEA 1HV0A 2CDOA 4G9SB 2AEYA 3N3HA 2DV9A 1VBD2 4XVHA 4KH9A 1CAVB 4IE5A 1I1EA 1YYNA 3MLKA 1W8UA 3FHQA 3UKVA 2TNFA 5GKAC 1O8PA 5J37A 3E6CC 3FX3A 2PAEA 4XBQA 3BU7A 3SMHA 1W39A 3AL6A 2D7FA 2J42A 1IS3A 3ZM8A 3NV3A 1DCSA 5IFTA 4BQ5A 4LO7A 4QD2A 3WNXA 4HN1A 5A70A 3PU3A 4TTGA 1FPN2 2GC0A 3BUCA 2W52A 4NPLA 3RFRA 4BZ4A 1GP5A 3MPBA 4UAPA 4Q4Y3 3L2YA 4Y33A 3T1MA 1LB2A 1H9WA 3ALQA 3AP5A 1K5JA 1YFUA 4NHLA 1DZRA 3CO2A 4QXCA 2Q8DA 3KHCA 2V4AA 3WDTA 4OI0A 3MFAA 3P1IA 1OF3A 1C4RA 4WVMB 4IE7A 2PLV1 3JBG1 1ASJ1 5FYIA 1K42A 1Z0HA 3UT0A 3FFQA 2C1FA 5J09A 3C7HA 4E8DA 3ACHA 2XJQA 2Q0AA 2ZX4A 4AQ2A 1DQ5A 5IUQA 5M0TA 5AVAA 5AVPA 1A78A 4W50A 2HYXA 5JXHA 2XBO1 3V65A 2VZ3A 1W2OA 1HQNA 1HJFA 2BFUL 2JG8A 2QQWA 4H3WA 3VBFA 1BBT3 3ILNA 5F8PA 4CRQA 5JOWA 4AGVA 3RVHA 2WAOA 1OLRA 1RGSA 3O0XA 3ZVXA 3PJQA 1R1A1 1GZTA 4N7IA 3SC7X 5FXWA 2Y34A 4HPKA 5FY7A 5C70A 5CKMA 1GZ9A 2VMIA 1IQAA 2ZS6B 3LSEA 4QX8A 5FDBA 5JZGB 4I01A 3VBSB 4YGEA 5F5CA 1W99A 5IHRA 1J3RA 1PHMA 3KF5A 5DDJ2 3AZZA 1QJY1 3Q8FA 4LKSA 1C57A 2DCJA 3FJSA 2HEWF 4E27A 4BK4A 3ZYIB 5ACA2 3C7EA 4CU8A 4PF5A 2QZ3A 4M3CB 2DVBA 2D6MA 4TXWA 2DU1A 3RNSA 3VB9A 3B00A 1VBD1 2E9QA 3ZFFC 1VAKA 3S5AA 5CFDB 3OBZA 4WVVA 5FZ4A 3S5QA 1T2XA 4KWJA 4CP1A 4Y20B 5FUPA 2FHRA 3TEZA 1UYXA 2F6BA 2BP6A 1C1LA 4A7ZA 3RZHA 1PGW2 4IV1B 3HNMA 1UD1A 1EPWA 4NMIA 2WSUA 1E5HA 2D6LX 1OA2A 4XDPA 4XQWA 1KRIA 5LY2A 3IIIA 3ZXEA 1HB3A 4XW3A 1C5IA 4CDQA 3LQCA 3IBMA 3OY8A 5F6LB 4RFRB 1FMD3 1D7PM 1SLBA 1DLCA 2D40A 4XXPA 2P2KA 5L73A 1W8NA 1VMJA 2HJIA 3MIHA 2HEVF 3ABZA 4YG0A 1HDKA 3MGUA 4HSJA 4UXAA 5KWRA 4GALA 2JG9A 4G3YC 4RS5C 1V9U2 2PA7A 4L99A 4MYEA 3NW4A 4B7KA 3WW1A 2XPJA 3B01A 5FOJB 2P37A 4XQDA 1Y9MA 1PM4A 1PVXA 2A3WA 3OJBA 5CFCB 2PAKA 3POGA 5SV5A 2A3YA 2ET1A 4LE4A 2HWB3 5ABJB 3UK9A 2HWD2 4BQXA 1N1VA 1NXMA 5FAXA 1VALA 1JN2P 1R091 1K3IA 5H9QA 1WMEA 2CWMA 3AX4A 1VBE1 4CDUA 3KD4A 1SBFA 4XZUG 4F8AA 1NQJA 2E33A 2P6CA 1GWMA 1JYCA 4LHKA 1HB1A 2Y6HA 4YGCA 5F3GA 1NE6A 4DXZA 4QM8A 4LBLA 2X29A 3UJQA 1W3VA 5FQ0B 1J58A 2R073 2X5IC 4KU7A 2ZX2A 2G9ZA 2V72A 1Q8SA 3IPVA 3PUIA 4C0HA 5ACA1 4DNYA 1C1FA 1Y7BA 3UETA 2JIGA 3VBHB 4Q4X2 3KM5A 3T08A 4GZ9A 4LT5A 4PDWC 4BH9A 1W06A 3N9MA 1HXS1 1W8ZA 2ZBJA 1VR3A 1MVQA 4MO3M 4B8EA 5FOBB 5FXVA 2ZEXA 2O0OA 3Q8BA 2R7EB 2WFPA 1B35C 2J7MA 3GXUA 5JIUA 5E89A 1BEV1 2OPKA 3PIGA 4QKBA 4PI2A 2VZTA 1NA1C 3VD9A 1RC6A 1GOGA 3M3OA 4ZU5A 1GANA 3QH7A 3ZX7A 4BQYA 5A1LA 4HFSA 4LLFA 3N9QA 2ZGKA 1OH4A 2W94A 2RR12 4IE6A 4AEDB 2QFEA 4QX5A 1NCRA 4XMAA 2LTNA 3VBUB 4DY3A 5FYMA 3QBQA 2R49A 4B4PA 2VZRA 2IVJA 3LDKA 3MIFA 3C8XA 1BHGA 4KWKA 5EXOA 5FZMA 3DCQA 1VIWB 2Q4SA 2ZAHA 3H8UA 4LXLA 4UF0A 3NV4A 1SDDB 5J36A 4XF9A 3WDUA 1D4M1 1H8VA 2BYVE 2WR9A 1DYPA 2Y6JA 2VO5A 3W59A 1FATA 5L7OC 4NHMA 4WVMA 1ULEA 3LA3A 3BOPA 1XNDA 4XCBA 5I0TA 3SH4A 3AMPA 3OTFA 4CCCA 1U5ZA 1WLDA 2RS52 2AR6A 2VL4A 1ULPA 4RGGA 5HXMA 1YEWA 1JOBA 2A5ZA 1NXD1 1X50A 1AVBA 4QPYA 4HBNA 4A3XA 2GN7A 5LATA 5A3NA 2V4VA 2WA3A 2G4IA 3AJYA 5J48A 3OBTA 3HAGA 2J1UA
chains in the Genus database with same CATH topology
5FUNA 5FP3A 4BXFA 4AI9A 4D6RA 4GAZA 4AAPA 4UF0B 3PUQA 2OS2A 5FPLA 5FPUA 3NJYA 3ZLIA 5A80A 4CUGA 5A3PA 5FZOB 2OQ7A 4LIUA 5FYVA 5FPAA 3PUSA 5FZEA 5A7WB 5FZAA 3AVRA 5F3EA 2PXJA 3K3OA 5FYSA 5FZFA 4EZ4A 3OPTA 3KV5A 5FP7A 5FZ7A 4IGOA 4BISA 2P5BA 4V2WA 5FJKA 5FZKA 2XUEA 5F32A 2GP3A 3AL6A 5FZGA 5KR7A 5IVCA 5FYTA 3N9LA 4DO0A 5FPBA 5FPVA 4QWNA 4EZHA 2OT7A 5A3TA 5ANQA 5FWJA 5FWEA 5IVVA 5FXXA 5FYHA 4NUBA 3KVBA 3PU3A 5FY8A 1VRBA 5FZ0A 5IVJA 4Y33A 5FBJA 5F3GA 4QXHA 4CCMA 4QXCA 2Q8DA 5A1FA 5FY4A 3N9PA 5F2SA 3OPWA 5FYIA 3LD8A 5F39A 2Q8CA 5F5IA 3N9MA 4IGPA 4V2VA 2Q8EA 3U78A 5FYCA 5FXVA 5FZBA 4ASKA 4QU1A 4BU2A 4DIQA 2VD7A 2YPDA 2OQ6A 3N9OA 5FP8A 5FP4A 5FZIA 5FY0A 5FY9A 5IW0A 2WWUA 5ISLA 4E4HA 3PTRB 3RVHA 3K2OA 3ZPOA 3U4SA 5FY5A 5F5AA 5FY7A 5FXWA 5FXZA 5A1LA 2XXZA 5E6HA 5A7SA 3N9QA 3PU8A 4QX8A 4D6QA 2OX0A 5FYYA 4QXBA 5F3CA 5A7NA 2GP5A 4EYUA 5F5CA 5FYUA 5CEHA 5FYMA 4IGQA 3KV4A 4XDOA 3N9NA 2YU1A 2YBPA 5F2WA 4D6SA 5FY1A 3UYJA 3AVSA 5LW9A 5FZMA 4C8DA 3DXTA 4LXLA 4UF0A 3PUAA 2W2IA 5F37A 4LIVA 3KV6A 4TN7A 5IVYA 5IVBA 3AL5A 5FP9A 4LITA 5LY1A 5FZOA 4GJZA 4Y4RA 5A3WA 5A7WA 5K4LA 3LDBA 5FZ6A 3PURA 4CSWA 4QX7A 4CCNA 5FZ9A 5FZ1A 5IVFA 5FYZA 4GJYA 5FZ4A 5IWFA 4HONA 5FZLA 2WWJA 5A7QA 2YBKA 4CCJA 3KVAA 5A7OA 5A7PA 5FUPA 4GD4A 4HOOA 2XMLA 5FZ3A 5FZDA 2YBSA 5FZCA 5FJHA 5FZ8A 4CCKA 5IVEA 2YU2A 3KV9A 4Y3OA 2XDVA 3K3NA 4XDPA 4CCOA 5LWBA 5A3NA 5LY2A 4CCLA 5F3IA 5FZHA 4URAA 3DXUA 5FV3A 5FYBA 3PDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUN A;  5FP3 A;  4BXF A;  4AI9 A;  4D6R A;  4GAZ A;  4AAP A;  4UF0 B;  3PUQ A;  2OS2 A;  5FPL A;  5FPU A;  3NJY A;  3ZLI A;  5A80 A;  4CUG A;  5A3P A;  5FZO B;  2OQ7 A;  4LIU A;  5FYV A;  5FPA A;  3PUS A;  5FZE A;  5A7W B;  5FZA A;  3AVR A;  5F3E A;  2PXJ A;  3K3O A;  5FYS A;  5FZF A;  4EZ4 A;  3OPT A;  3KV5 A;  5FP7 A;  5FZ7 A;  4IGO A;  4BIS A;  2P5B A;  4V2W A;  5FJK A;  5FZK A;  2XUE A;  5F32 A;  2GP3 A;  3AL6 A;  5FZG A;  5KR7 A;  5IVC A;  5FYT A;  3N9L A;  4DO0 A;  5FPB A;  5FPV A;  4QWN A;  4EZH A;  2OT7 A;  5A3T A;  5ANQ A;  5FWJ A;  5FWE A;  5IVV A;  5FXX A;  5FYH A;  4NUB A;  3KVB A;  3PU3 A;  5FY8 A;  1VRB A;  5FZ0 A;  5IVJ A;  4Y33 A;  5FBJ A;  5F3G A;  4QXH A;  4CCM A;  4QXC A;  2Q8D A;  5A1F A;  5FY4 A;  3N9P A;  5F2S A;  3OPW A;  5FYI A;  3LD8 A;  5F39 A;  2Q8C A;  5F5I A;  3N9M A;  4IGP A;  4V2V A;  2Q8E A;  3U78 A;  5FYC A;  5FXV A;  5FZB A;  4ASK A;  4QU1 A;  4BU2 A;  4DIQ A;  2VD7 A;  2YPD A;  2OQ6 A;  3N9O A;  5FP8 A;  5FP4 A;  5FZI A;  5FY0 A;  5FY9 A;  5IW0 A;  2WWU A;  5ISL A;  4E4H A;  3PTR B;  3RVH A;  3K2O A;  3ZPO A;  3U4S A;  5FY5 A;  5F5A A;  5FY7 A;  5FXW A;  5FXZ A;  5A1L A;  2XXZ A;  5E6H A;  5A7S A;  3N9Q A;  3PU8 A;  4QX8 A;  4D6Q A;  2OX0 A;  5FYY A;  4QXB A;  5F3C A;  5A7N A;  2GP5 A;  4EYU A;  5F5C A;  5FYU A;  5CEH A;  5FYM A;  4IGQ A;  3KV4 A;  4XDO A;  3N9N A;  2YU1 A;  2YBP A;  5F2W A;  4D6S A;  5FY1 A;  3UYJ A;  3AVS A;  5LW9 A;  5FZM A;  4C8D A;  3DXT A;  4LXL A;  4UF0 A;  3PUA A;  2W2I A;  5F37 A;  4LIV A;  3KV6 A;  4TN7 A;  5IVY A;  5IVB A;  3AL5 A;  5FP9 A;  4LIT A;  5LY1 A;  5FZO A;  4GJZ A;  4Y4R A;  5A3W A;  5A7W A;  5K4L A;  3LDB A;  5FZ6 A;  3PUR A;  4CSW A;  4QX7 A;  4CCN A;  5FZ9 A;  5FZ1 A;  5IVF A;  5FYZ A;  4GJY A;  5FZ4 A;  5IWF A;  4HON A;  5FZL A;  2WWJ A;  5A7Q A;  2YBK A;  4CCJ A;  3KVA A;  5A7O A;  5A7P A;  5FUP A;  4GD4 A;  4HOO A;  2XML A;  5FZ3 A;  5FZD A;  2YBS A;  5FZC A;  5FJH A;  5FZ8 A;  4CCK A;  5IVE A;  2YU2 A;  3KV9 A;  4Y3O A;  2XDV A;  3K3N A;  4XDP A;  4CCO A;  5LWB A;  5A3N A;  5LY2 A;  4CCL A;  5F3I A;  5FZH A;  4URA A;  3DXU A;  5FV3 A;  5FYB A;  3PDQ A; 
#chains in the Genus database with same CATH topology
 5EHD A;  4BXF A;  4AI9 A;  5I0S A;  4PT6 A;  5A32 A;  4D94 A;  4IND A;  3I2D A;  1UU4 A;  1UOJ A;  2PQQ A;  4CUG A;  1OA4 A;  2IXJ A;  4AGR A;  4JGZ B;  3VBO A;  3WDX A;  3AKR A;  5FZA A;  4NPM A;  2Q1F A;  2JD4 A;  1C28 A;  4XF4 A;  1NZC A;  4AFC A;  3VKN A;  4D7S A;  1K45 A;  2BJS A;  1SLA A;  4X6R B;  4EZ4 A;  5BUV A;  4ISQ A;  5LBC A;  2W1W A;  3IM0 A;  1LOF A;  1DBN A;  3K4A A;  1WZX A;  2ZMN A;  4M0N A;  5LRR A;  3VKL A;  1W8O A;  4C91 A;  1C3H A;  1X33 A;  1BK1 A;  1UZZ A;  3WV6 A;  4E2S A;  2KD7 A;  5EPA A;  4A41 A;  2D43 A;  1X8M A;  2QKD A;  1QJX 2;  3RWN A;  2VR4 A;  1WCK A;  1GWK A;  5FPB A;  1YWK A;  3A0K A;  4OMC A;  3MIB A;  1ND3 C;  3TN9 1;  1O59 A;  5KC6 A;  1PX4 A;  3LA2 A;  4A44 A;  1JUI A;  2PN5 A;  2BDR A;  3AMM A;  3I2K A;  3MW2 A;  2R16 A;  4YM3 A;  3I49 A;  2VEC A;  1K12 A;  3NV2 A;  2DU0 A;  2Y64 A;  1F31 A;  3LPG A;  2IXL A;  2WNU B;  3J8F 1;  4Q4V 3;  2CGO A;  3PHM A;  5EJ1 B;  4ISR A;  5CG8 A;  5C9A A;  2BV4 A;  4E4Z A;  4E4S A;  4W65 A;  3ZDV A;  4NIG A;  3OPW A;  4COU A;  1CVN A;  4ATF A;  5JSP A;  1AYM 3;  5JZG C;  4JGY B;  4PCR A;  4FXK B;  3VBS C;  1AR8 1;  3NL1 A;  1P8J A;  1VRH 3;  4MSV A;  1I5Z A;  2VQA A;  3LAG A;  5HXV A;  3M3C A;  1PK6 B;  1WBL A;  1GV9 A;  2FCU A;  4ASK A;  2IXI A;  3OD0 A;  3WVJ A;  3N9O A;  1WMX A;  2WRA A;  3T30 A;  3TWI A;  5FY9 A;  1O4T A;  1YCI A;  2QQL A;  2WWU A;  5ISL A;  2RS5 1;  4LBQ B;  2FBE A;  2QVS B;  5EJ3 A;  1UPI A;  3ZFE C;  2YUE A;  4BDV B;  4BLI A;  1BVP 1;  5IFP A;  5F5A A;  3POJ A;  5CBL A;  1URX A;  2K9Z A;  5TSW A;  1QNW A;  2OX0 A;  2ZJC A;  4CP0 A;  4XF0 A;  4WVW A;  5BNO A;  1AL2 3;  3PL0 A;  4D6S A;  5FY1 A;  3DKW A;  1LU1 A;  1Q8Q A;  5AFE A;  1ND2 B;  2VZP A;  5LBF A;  3DV8 A;  4YM1 A;  1ENS A;  2QQO A;  2D97 A;  4JDN A;  3W9A A;  4X8N A;  2ZKL A;  1RUF 1;  4NHK A;  4LIT A;  1S0J A;  1W04 A;  4UFH A;  1NLS A;  5K4L A;  2FDI A;  1RHI 1;  2E26 A;  1W9Y A;  3ORJ A;  1O8S A;  4UT5 A;  1IQD C;  4CEW C;  3H3U A;  4WVZ A;  4JVA A;  4RQP A;  4QPI C;  1BQP A;  1F5F A;  1QHD A;  3I59 B;  1S0F A;  1QJX 1;  3FC0 A;  1GLH A;  4XFH A;  1RUI 3;  3V0A B;  4AVT A;  1UOB A;  4FT8 A;  1WKY A;  4GB3 1;  1RUG 3;  5FZ8 A;  1QQP 2;  5IVE A;  1C8M 3;  3UJO A;  3WG2 A;  1DQ4 A;  2YU2 A;  2VZQ A;  4AVC A;  5CFC C;  5FPX A;  4MGT A;  1AR7 3;  2WYF A;  5GM0 A;  2IUW A;  5H9S A;  5ABJ C;  1WBF A;  3DEM A;  3H0O A;  4AFM A;  4CUB A;  1VPH A;  3ZYG A;  4AAP A;  2A71 A;  4HG6 B;  1KXG A;  1H2K A;  1XRU A;  2CGN A;  4HKL A;  4XJ8 A;  3TEY A;  3BIW E;  5CKQ A;  1JBC A;  2UU8 A;  3QCW A;  4LOS A;  3THD A;  1AYN 2;  4GWJ A;  4L92 A;  3O7O A;  2VU9 A;  3SLI A;  3POB A;  1W8T A;  1YXW A;  3I54 A;  1CN1 A;  2JDK A;  4MXW A;  4EV0 A;  1AXY A;  3AP6 A;  5CNA A;  1EAH 1;  1HQL A;  1ULC A;  1JUH A;  4UBH A;  4AG4 A;  4IE0 A;  1UY4 A;  1V6J A;  2XL9 A;  5J96 B;  1LHN A;  4IE4 A;  2C5D A;  2WBK A;  4GIQ A;  5FYT A;  5FPV A;  2ERF A;  4FPC A;  3WCS A;  4D8M A;  2W92 A;  4HET A;  4W6X A;  1RMU 3;  3THP A;  2JDZ A;  1PGS A;  2ZZJ A;  3CIH A;  3WD5 A;  4LUK A;  1WW6 A;  1KDM A;  4JC1 A;  4JX0 A;  4WM8 B;  5A3M A;  5J1X A;  3WX5 A;  5C8C A;  4PBP A;  1OSG A;  3LPF A;  1ENR A;  2WZR 3;  5IAV A;  2ARX A;  3E97 A;  1OLM E;  4GH4 A;  2D3R A;  1L3J A;  1TNF A;  1PO2 1;  1FOD 3;  5GZE A;  3ZO0 B;  1COV 1;  5DMY A;  1ZBA 2;  4IEU A;  2FQP A;  3VBU C;  4YZ2 A;  5LRS A;  3ACF A;  4YZ3 A;  1A8D A;  5DAB A;  4YZ5 A;  1V6N A;  3HNB M;  1OUS A;  2W46 A;  2RS3 2;  1PMH X;  3EBR A;  2UY8 A;  4MOA A;  5FP8 A;  3ZKU A;  4JQT A;  4N8M A;  4DB5 A;  3HMY A;  2JXA A;  3ZSL A;  3ZXL A;  4L9B A;  1NZI A;  1ZRF A;  3H1M A;  4D69 A;  1W6N A;  4IEX A;  1NLQ A;  1FYU A;  2JEM A;  2ZGN A;  3AMH A;  3W20 A;  5CYY A;  1S1A A;  4O9G A;  3RJR A;  1RUJ 1;  5C3P A;  2P1B A;  1JZ7 A;  1WMD A;  2NMN A;  1JOD A;  1US3 A;  1XSQ A;  2RMU 2;  2XJP A;  3OYW A;  4J25 A;  5FRA A;  1H6Y A;  3KZ4 C;  4NO4 A;  2QNK A;  3VHP A;  4XUT A;  2UWB A;  2ZEY A;  4LQR A;  3BKZ A;  2E32 A;  1CWP A;  1QJU 3;  2B7Y A;  3HBZ A;  1O5U A;  4YW7 A;  5FBZ A;  1GNY A;  4Y22 B;  4D3W A;  4AZZ A;  2EAK A;  2RJL A;  1VBC 3;  2Y0I A;  2PQS A;  3OGG A;  4LIV A;  4TN7 A;  5F37 A;  4FP3 A;  4GJZ A;  4XAE A;  3ST7 A;  1EPZ A;  1HB2 A;  3LFI A;  4CCN A;  5JDB A;  4COW A;  2VUJ A;  5C5U A;  1TMF 2;  2WAA A;  3OPZ A;  2QZ2 A;  2O8O A;  1AR9 2;  2P4E A;  2W08 A;  1GUI A;  4L8Q A;  4XJ9 A;  4N43 C;  1WW7 A;  4XBL A;  3USU A;  4JGZ C;  3NJX A;  5A7O A;  2V5D A;  3WHU A;  1LOA A;  4CTE A;  2VPV A;  3ZFG A;  4CCK A;  4AEK A;  1LOE A;  3K3N A;  2EIG A;  4FP2 A;  4YPJ A;  5KXB A;  3VDD A;  4OUS A;  5BY5 A;  2QCS B;  4PJY A;  4LBQ A;  3D0J A;  1G7Y A;  1MS3 A;  4GAZ A;  1OQ1 A;  4KBZ A;  5T54 A;  1GFF 2;  1HRI 3;  1PZ9 A;  1IG3 A;  1O6U A;  1IS5 A;  4CUA A;  3ON7 A;  1VB4 A;  3RS6 A;  4LIU A;  1WA4 A;  1ZBE 1;  4XC9 A;  1PO1 3;  1UX7 A;  1PVC 1;  1HJG A;  2PXJ A;  1O91 A;  5JI7 A;  5DPN A;  3NJZ A;  3T4H B;  2IXH A;  2HKX A;  2Q5T A;  1XYO A;  4ZZ8 A;  3TNP B;  3BCW A;  5FZK A;  2XVG A;  3OGS A;  4Q27 A;  3UGG A;  3LSD A;  4XMI A;  1YQ8 A;  2WNV A;  5C33 A;  3THC A;  3ZYR A;  2YGL A;  3T2O A;  2JDM A;  5D8A C;  1QF3 A;  4FPL A;  4LOT A;  1JYT A;  1VE0 A;  4P9W A;  2FCV A;  4HL0 A;  5DUW A;  2JE7 A;  2R06 2;  2ZZQ A;  1JU3 A;  1WGP A;  2W47 A;  3VL8 A;  2L9L A;  4B3N A;  4Z1V A;  2WS9 3;  4GXL A;  5IK5 A;  1MS0 A;  5GLW A;  4E2G A;  2D6O X;  3ZFF B;  1XB9 A;  4QXH A;  1HN1 A;  1UZV A;  2DTY A;  3U11 A;  3WF4 A;  3PTY A;  1JYV A;  2EIC A;  4LKD A;  3HT2 A;  3SEP A;  5C7G A;  1O7F A;  3MO4 A;  2PAM A;  4AXO A;  5B2G B;  2RDR A;  3NNF A;  2JB4 A;  4YZ4 A;  3FE5 A;  5FMO S;  5EFU A;  4MG2 A;  2B9U A;  1QXJ A;  2WUH A;  1O4Z A;  1UU6 A;  3KGZ A;  4I0W B;  5T5J A;  4CCD A;  1AF9 A;  3ZXG A;  3ETQ A;  4LJH A;  4DIQ A;  4AR2 A;  5BNN C;  1GQH A;  1PNG A;  1YI9 A;  2BWA A;  4HVO A;  4M00 A;  5DUV A;  3VZN A;  4CDX B;  1ENQ A;  1K5M A;  3AYA A;  4ARY A;  4FTB A;  5FKB A;  1WLW A;  3M4F A;  4GA9 A;  1ODN A;  4CDW A;  1EUT A;  4HK8 A;  2NZ9 A;  3PVN A;  3ZPO A;  2D93 A;  2H6B A;  1FX5 A;  2WQZ C;  2DCZ A;  2PHT A;  3BVC A;  2VZU A;  1Q3E A;  4LOR A;  4Q4W 1;  2GC3 A;  1Z7S 3;  2BFU S;  4RS5 B;  4CZS A;  3GDB A;  3ITQ A;  3B02 A;  1W05 A;  1TME 3;  2EAA A;  3S7E A;  1ZRI A;  5FYU A;  2YYO A;  1OLM A;  1OVP A;  1IPK A;  1OC1 A;  2ZKN A;  4CEY A;  1I6X A;  3AVS A;  2JDN A;  2W1Q A;  4IXL A;  4NVP A;  2VM9 A;  5LBE A;  1GP6 A;  2G9G A;  1C8N A;  3HOB A;  4IW3 A;  1HB4 A;  1WCS A;  4WM7 B;  3KV6 A;  3GZT B;  4JKM A;  3AL5 A;  4LBO A;  3OGR A;  1MQT A;  1TE1 B;  4FAG A;  2R0H A;  5A7W A;  2DWR A;  4XUO A;  1D2Q A;  3OEB A;  5F1R A;  3ZXA C;  1KJR A;  3ILR A;  3AJZ A;  3IDA A;  4OHW A;  4YGD A;  2EXJ A;  4BHP A;  4RHV 3;  2PHF A;  2X5I B;  3HBK A;  4QPG A;  3RQ0 A;  3AYC A;  4DS0 A;  1CJP A;  1QMJ A;  4QQO A;  4XET A;  2JEN A;  5FLI A;  3O12 A;  4H55 A;  4I3G A;  1WCU A;  4C1X A;  5AC9 2;  3M3Q A;  1V6M A;  1MEC 3;  2VW0 A;  1H8T A;  2RS1 2;  4PDW B;  4RR3 A;  5FZC A;  2WZP P;  1RVF 3;  4FI9 A;  3RGB A;  4ET7 A;  1AR6 2;  2R06 1;  2ZGQ A;  3D8C A;  3JZV A;  1EV1 2;  1SFY A;  3WOG A;  1CAX B;  1CIW A;  2FD8 A;  4JHT A;  4CCL A;  1XOY A;  3IDE A;  4Z8B A;  2DTW A;  5FYB A;  5FUN A;  2WFF 1;  2JB8 A;  5LZ6 A;  3VDB A;  4EN9 B;  4K1Z A;  2DUO A;  4P14 A;  3NNG A;  1GMM A;  5EQU A;  1OT5 A;  3AB0 A;  3NJY A;  4KMQ A;  1NA1 B;  5FZO B;  3LGR A;  1KEX A;  4YRD A;  5FYV A;  2W1S A;  2XBO 2;  3VBR C;  4WM8 C;  1SLT A;  4NOT A;  1L7R A;  5L9R A;  1LHV A;  3M3E A;  1R08 3;  2F4L A;  3KV5 A;  4K21 A;  4XF3 A;  4BIS A;  3JD7 3;  3O1S A;  2AC1 A;  3OBA A;  5FJK A;  2SBA A;  1MR5 A;  3ZSE A;  4QKN A;  2HWC 3;  3ZR6 A;  1R1A 2;  1ZRC A;  4MHR A;  2Y6G A;  2DFB A;  3H50 A;  5EIY B;  3NNM A;  3GHM A;  2R30 A;  4J1W A;  1W6Q B;  3ZSK A;  2YGM A;  5FWE A;  2P3I A;  4O7X A;  1JHJ A;  1Y9G A;  3R4U A;  5L7O B;  1X82 A;  5D1I A;  5GAL A;  4MGZ E;  2EA7 A;  5CIR A;  4BME A;  4NJ4 A;  3KQR A;  4W6Y A;  1DYO A;  1YQC A;  2NPI A;  5FBJ A;  3M7A A;  3TAY A;  4P9I A;  1RUC 3;  4CPB D;  4QX3 A;  3I97 A;  4OHX A;  5DAW A;  2PHD A;  4TWT A;  2ZGM A;  2MHF A;  4QHZ A;  4FPO B;  1N47 A;  1W2A X;  4EN7 B;  3AZV A;  3J26 N;  1RIN A;  3GM8 A;  4QHO A;  5F2S A;  4K40 A;  4ZKT B;  1H2N A;  2FDJ A;  2IFW A;  3ZN6 B;  2R04 1;  3POE A;  1YQ2 A;  1AZD A;  2BER A;  3SNM A;  3ZXK A;  4NRO A;  4XFB A;  1ZZ9 A;  4I2O A;  3TRS B;  5HPO A;  2D44 A;  3MW4 A;  3UNP A;  5I8S A;  1D0G A;  2A6V A;  5JUV A;  2MNG A;  5AC9 1;  3RZG A;  1A6C A;  2GAL A;  1RUH 3;  3JUU A;  3MID A;  3QH6 A;  1F9K A;  3CJI A;  3VZK A;  2RS1 1;  3LEK A;  1W2T A;  5FMO L;  1A8M A;  1AR6 1;  1UYP A;  3Q9O A;  1MZF A;  5FY5 A;  4C0B A;  3V0B A;  5E6H A;  5JIA A;  3ZYJ B;  5KHG A;  1EV1 1;  1XYP A;  2CHH A;  1UCX A;  2VUD A;  5F3C A;  2E7Q A;  1MVE A;  2HWE 1;  1VBB 3;  3ACL A;  2LRO A;  3CKH A;  2BVB A;  2E6V A;  3ATG A;  5FLH A;  4AFB A;  1ND3 B;  4C8D A;  3INA A;  1OI6 A;  5LW9 A;  3ZKY A;  2BBV A;  4ZON A;  1HRV 3;  1YJL A;  4PLO A;  1UYY A;  2WO3 A;  3MFC A;  1XE0 A;  5LAS A;  3APB A;  3A0N A;  4UW5 A;  2EIB A;  3C7F A;  3JCI A;  1E57 A;  2HEY F;  4Y5Z 0;  1H4G A;  2VNO A;  1OD5 A;  5DQ0 A;  1R09 2;  4LO4 B;  5JWP A;  2J1A A;  1QJY 3;  1TQ5 A;  4LKE A;  1VBE 2;  1CZS A;  4NR1 A;  5A7Q A;  1CAU B;  3CMG A;  2W3J A;  4ZS2 A;  2OPW A;  1YNA A;  3JQX A;  1H9P A;  5B4N A;  4HOO A;  3E5U A;  1FNZ A;  1I9R A;  5FZ3 A;  4Q4Y 1;  2DBN A;  4XYX A;  5A6Q A;  5HCA A;  5DAQ A;  4Z2W A;  5FJH A;  1UY3 A;  2PHW A;  4YM2 A;  3T0D A;  4MGK E;  4RL7 A;  1OA3 A;  1OVS A;  3RI8 A;  4CCO A;  1RXG A;  4EN8 B;  2J1R A;  4Z92 B;  5FZH A;  1ZRD A;  4BWO A;  5FV3 A;  1JZ8 A;  5JAX A;  4OQ9 A;  3PDQ A;  2XWB B;  4Q26 A;  4ASM B;  3POY A;  3UGH A;  2WL1 A;  4IL7 A;  2YZ4 A;  1HXS 2;  3ZYP A;  1OMI A;  2OZJ A;  5FPU A;  3T2P A;  3ZFE B;  4M01 A;  1DU3 D;  4OI2 A;  4OUM A;  5A6X A;  3VD4 A;  5FZE A;  2JIJ A;  1JHN A;  3O14 A;  4Q2F A;  5FTT C;  3T2T A;  4F3J A;  1G9A A;  1FPN 3;  1SHW B;  2HWB 2;  1BEV 2;  3OPT A;  1BBT 1;  1KIT A;  1KS4 A;  3BAL A;  3FMG A;  4IGO A;  4Z07 A;  1O3Q A;  2B5H A;  4M3C E;  5DAX A;  1GSL A;  3KLS A;  4FPY A;  2ZGT A;  5F6K A;  5L19 A;  3RG0 A;  1H1M A;  2BGO A;  5GZC A;  3CEW A;  4AVS A;  1OOP A;  2XJR A;  5KR7 A;  1RUD 3;  1H0B A;  1RIT A;  1DFQ A;  2DCK A;  2VJX A;  1LGN A;  4P9L A;  2B9V A;  2WQ8 A;  2RHP A;  1H4H A;  4YYO A;  2A6X A;  2A7A A;  5DUU A;  4YLZ A;  4XFF A;  4XAB A;  1WD4 A;  2R07 2;  2XLG A;  3SH3 A;  1WLC A;  4IV3 B;  4CDX C;  4B29 A;  5G04 L;  2PHX A;  5FZ0 A;  4GQ7 A;  4PQ9 A;  2ADD A;  4LUL A;  3MF9 A;  4QB6 A;  4CEW B;  4QPI B;  4XJZ A;  5JOX A;  3ACI A;  4PIZ A;  3DEC A;  4HK9 A;  1D4M 2;  2VQ0 A;  4OZX A;  3RMX A;  2ARA A;  4YW5 A;  4A7K A;  3H1Y A;  1VAV A;  3BTY A;  2BNN A;  4NID A;  4W4Z A;  4YFW A;  1AHS A;  4YW1 A;  3LEI A;  2IVI B;  1B35 A;  2Y6F A;  2XG3 A;  4MH0 E;  1LGB A;  4P5H A;  5LEJ A;  4FFF A;  5B4X A;  5JR2 A;  5KHJ A;  3S57 A;  3M1H A;  1POV 0;  3I2O A;  2XJU A;  4ERO A;  5DDJ 3;  3IZO A;  4WM7 C;  1LEN A;  3J7N A;  5ACA 3;  1WWY A;  1R64 A;  4LBK A;  1YRZ A;  2B46 X;  5JVV A;  2RM2 2;  1Q8O A;  1XJA A;  3WQB A;  1W6O B;  2LUW A;  3MI8 A;  3VZO A;  1JS9 A;  3AZX A;  4LKF A;  4JRL A;  3M70 A;  1FMD 1;  1CR7 A;  3DUI A;  3KB5 A;  3WDY A;  2BQP A;  2XXZ A;  4NIA A;  2BEO A;  2N7G A;  5BV6 A;  4D6Q A;  2GND A;  4IUG A;  1LJ7 A;  1W8H A;  3DPR A;  3OCP A;  1YC6 1;  2VZV A;  4R9C A;  1NCQ A;  4QX1 A;  1RUE 2;  3SCG A;  2YBP A;  4EJR A;  3V56 A;  3NJV A;  1BZW A;  2ZTN A;  1PMI A;  3HWJ A;  4AVB A;  1G9B A;  3H1W A;  4N90 A;  2VUL A;  5LY1 A;  1RIR A;  1JXN A;  2JKX A;  2YFU A;  2GZW A;  2QQP A;  4LK6 A;  4AAX A;  5C4W B;  4CSW A;  5FZ6 A;  3VD3 A;  2HWB 1;  2VOT A;  1LEM A;  4N9I A;  1LAJ A;  1CJD A;  2BRT A;  1LOG A;  3TN9 2;  3FL7 A;  4CXX A;  5GZG A;  2IXC A;  3MZH A;  4XFA A;  2QJV A;  3H3Z A;  1CAV A;  3QAC A;  1W6P B;  2OUJ A;  3I8T A;  4HKO A;  4UFL A;  2WN3 A;  4HON A;  4UW4 A;  4YVS B;  2GC1 A;  2JWP A;  4LBM A;  1GZC A;  4OLL A;  1Q5O A;  4YNI A;  3WF2 A;  1DZT A;  1PM7 A;  2ZX3 A;  3GYD A;  2D6P A;  3T2Q A;  5KBF A;  4QB1 A;  2Z5W A;  3UKN A;  3P6B A;  1DQ1 A;  1POV 3;  1ST8 A;  2JG9 C;  3J8F 2;  4GUL A;  1V9U 3;  1JZ6 A;  4NIH A;  1RUN A;  2R07 1;  4URA A;  3CLP A;  3AKS A;  3WHT A;  5AFB A;  3S30 A;  1PNF A;  1WA6 X;  1EP0 A;  1A3K A;  3ZIW A;  4D6R A;  1AR8 2;  2HWD 3;  3HVD A;  4PBO A;  2H6C A;  1IKQ A;  2WQ4 A;  3IMN A;  2RDQ A;  2VNV A;  3BTA A;  4FFG A;  4YW2 A;  3WNN A;  4BM8 A;  5A3P A;  4QB2 A;  2AAC A;  2GH8 A;  3K75 B;  4XUN A;  4ONU A;  1WUV A;  4I0A A;  3VHR A;  1J83 A;  4IQP A;  4YGB A;  4P02 B;  5T55 A;  5JOY A;  2VMH A;  2EXK A;  4ATE A;  1O5L A;  1S0D A;  2YMZ A;  1AX0 A;  3MLJ A;  4KNC A;  5A3O A;  4XIK A;  4DXR A;  3E6D A;  1LUL A;  2QQU A;  2W0X A;  2O8Q A;  2GP3 A;  5IYY A;  2UUR A;  1LGC A;  3HJR A;  1LCL A;  1PGL 2;  2P3J A;  2KR2 A;  3D6E A;  4IES A;  4UFM A;  4JHZ A;  4DO0 A;  3RZJ A;  3BYW A;  2BUK A;  2JIC A;  4BQW A;  2XHN A;  1MS1 A;  2RM2 1;  2TBV A;  3KF3 A;  4Q4X 3;  1LU2 A;  2MEV 2;  3GZU C;  3VZL A;  4AQS A;  3P3P A;  4ASL A;  5JXJ A;  5FXX A;  1O3R A;  3SXW A;  5LA9 A;  1VRB A;  1JU4 A;  4Y1U A;  1NQD A;  1L7Q A;  1MS8 A;  3EXU A;  4N43 B;  1L7L A;  1RUF 2;  3BI3 A;  5JZG A;  3VBS A;  1RUE 1;  2HBT A;  4KG0 A;  1RHI 2;  4CP9 B;  2BVV A;  4AI2 A;  1QGL A;  4ITC A;  3DYO A;  3HPN A;  4LEJ A;  3D3A A;  1G86 A;  2Y6K A;  4FPK A;  2ZGS A;  2WDB A;  3KT7 A;  5A33 B;  1UOG A;  2ZEW A;  4G4F A;  1DIW A;  2RR1 3;  4M3C A;  5FYC A;  4EN0 A;  1QH6 A;  5FMC A;  3SKJ E;  3ZFE A;  2ZGU A;  3R6S A;  5DXD A;  4QDS A;  2VCM A;  1UO9 A;  4A6O A;  2IC1 A;  4GB3 2;  3PLQ A;  3S7I A;  2NYY A;  1I3H A;  2RV9 A;  2VZ1 A;  2QQK A;  5CFD A;  3H8R A;  4HVR A;  4K1Y A;  1CX1 A;  3C7G A;  3BIE A;  4Y20 A;  1OQE A;  4KQ7 A;  1KS5 A;  1JTZ X;  4A45 A;  5JPM B;  1G6N A;  4NHX A;  3I3B A;  4IV1 A;  4AF9 A;  1CES A;  4P00 B;  4EE2 A;  1MZE A;  4Q0U A;  4J1X A;  4Q0P A;  5FYY A;  2VNG A;  3ZIX A;  2GP5 A;  4EYU A;  2WA4 A;  3VZJ A;  5D8A B;  1IGO A;  1YFX A;  3F95 A;  3ELN A;  3N7L A;  3KCY A;  2WAB A;  1QXR A;  4QQP A;  2VNR A;  1GZW B;  4IEW A;  5ERL A;  1JZ2 A;  2W2I A;  1EAH 2;  1UYZ A;  3AXE A;  4CEW A;  1QOT A;  2LAL A;  4N7U A;  2DUQ A;  3HIF A;  4B1L A;  1TEI A;  2AEN A;  1UZW A;  1CGP A;  4B4Q A;  3ZDS A;  4DIN B;  1LHU A;  1Z78 A;  5IVF A;  4CUC A;  2KXL A;  3N36 A;  4KGG A;  3RMY A;  1BVV A;  3VDA A;  2HLE A;  2YG0 A;  5E8A A;  4D0Q A;  2QDR A;  5CFC A;  1PGL 1;  3POF A;  5T5L A;  4N53 B;  1NUK A;  4DXS A;  5ABJ A;  5KXC A;  5LCW L;  3HT1 A;  2ZAA A;  1BJQ A;  5JR7 B;  4CU6 A;  4J6G A;  2E7A A;  1AL0 G;  2MEV 1;  3ZSM A;  1VBA 2;  4BQ2 A;  4IEQ A;  4Q4V 1;  4Z2A A;  1NG0 A;  5BNN B;  2YDE A;  4Q0Q A;  2RJK A;  2WZ8 A;  1PO2 2;  1KJL A;  4SBV A;  1COV 2;  3GZE A;  3N35 A;  2JX9 A;  2KM2 A;  1ALY A;  1UOF A;  4E2Q A;  5CAD A;  1AYM 1;  1QJX 3;  1W9S A;  3IKW A;  1VRH 1;  2CWS A;  5FQ0 A;  1UNB A;  4UWD A;  3CNA A;  1SCR A;  4L11 A;  4OYU A;  4DRV A;  4IV3 C;  2P3Y A;  3B94 A;  5F7U A;  5FPA A;  2A75 A;  4Y5S A;  2BGP A;  2RDN A;  3BB6 A;  3VBH A;  1QWR A;  2DBI A;  4RYD A;  3O1V A;  2B4K A;  4YVW B;  1LNS A;  3GZA A;  3FLP A;  2ATF A;  1SEF A;  2BWC A;  2VMC A;  3USS A;  3O1M A;  1AX1 A;  1RMU 2;  3W21 A;  2ZGL A;  2FCT A;  4QHB A;  5APA A;  5FZG A;  1RUJ 2;  2XR4 A;  1XPW A;  4AVA A;  1FT9 A;  1GBG A;  1FI2 A;  3T3Y A;  5LEK A;  1QDO A;  3FWE A;  1UF2 C;  3IDC B;  4UOJ A;  5T5O A;  3ZYB A;  1AL2 1;  1DGR N;  4WZF A;  4NUB A;  2YY1 A;  5FYH A;  1V6L A;  3DGT A;  4OI1 A;  2BZD A;  4NRP A;  4BLJ A;  1ULD A;  4JDO A;  4HAN A;  1CAW B;  1JOJ A;  4I02 A;  1WMF A;  3VL9 A;  4AED A;  3CQO A;  2VME A;  2V09 A;  3A23 A;  1LHO A;  1KD7 A;  1VP6 A;  2XJV A;  4IER A;  3VBU A;  4XJW A;  2FDK A;  5IJR A;  3UV9 A;  2WIN B;  3MHZ A;  2VCC A;  2P3K A;  4V1P A;  4AFA A;  2YC0 A;  3ZR5 A;  3LD8 A;  5EWS A;  5IT6 A;  4FFI A;  3WQ0 A;  5K8S A;  2PEL A;  5FFO C;  3U78 A;  4BU2 A;  5BNP A;  1T6B X;  3WUC A;  1RUI 1;  1H2L A;  2KA3 A;  3J7L A;  5BNO C;  2ZHN A;  5FP4 A;  1RUG 1;  4HKW A;  2ZX0 A;  1C8M 1;  3AZY A;  4KG8 A;  4LTA A;  5EV7 A;  4AHZ A;  4OVE A;  2GNB A;  1W8W A;  5C4W C;  1AR7 1;  2VVF A;  3VBR B;  4FPJ A;  4PQQ A;  2EXI A;  1WW4 A;  2XON A;  5DZE A;  4PHZ A;  3GNE A;  3O1P A;  1OHF A;  1VBA 1;  2LS6 A;  2ZHK A;  1JZ5 A;  4YVS C;  3VHO A;  4NHY A;  4NE9 A;  3BOD A;  3QOP A;  2X8K A;  4OCT A;  4AK3 A;  5A7N A;  1VBC 2;  4RQP C;  1ZBE 2;  2VVE A;  2XHK A;  3GAL A;  5LA1 A;  3VZM A;  1DGL A;  1PVC 2;  2QQI A;  3HN3 A;  3UYJ A;  4RGA A;  3FZ3 A;  1QEX A;  2RE9 A;  2V73 A;  3J4U H;  1U5X A;  1APN A;  1HQW A;  2C0Z A;  4YZ1 A;  1JYX A;  1QQP 3;  5FMB A;  2J1V A;  5LBB A;  1JI6 A;  3OUJ A;  1QKQ A;  4OZO A;  2Q30 A;  4QKD A;  1RB8 G;  3EJK A;  4FO9 A;  3B9C A;  4JGZ A;  4AI1 A;  5K0U B;  5FCC A;  4C1W A;  3I2I A;  2Y6L A;  3I2H A;  4OUL A;  4KL1 A;  5FYZ A;  4HLT A;  4AI3 A;  4XTP A;  3O1O A;  3H8O A;  1G8W A;  1ULO A;  4GJY A;  1RMU 1;  1SPP B;  4GWN A;  1J59 A;  1CD3 G;  1RUO A;  2WWJ A;  4M3C F;  1I5P A;  3U1X A;  1MAC A;  4FVV A;  3LA7 A;  1FXZ A;  4GMP 1;  1W2N A;  3WR0 A;  1AYN 3;  3U75 A;  3RZL A;  2G1M A;  1AXZ A;  3MV0 1;  5CVR A;  2CV6 A;  2VBP A;  2WZR 1;  5JXI A;  1LR5 A;  2VQU A;  3FUO A;  3K77 A;  4GKY A;  4YG3 A;  3T09 A;  1FOD 1;  3AZW A;  1XNT A;  4K8F A;  4N9H A;  1ENX A;  1Y9Q A;  1W6M B;  4QQ2 A;  2UYB A;  3EMR A;  1GYK A;  2WNU A;  3B93 A;  1X8E A;  4A4A A;  1YI7 A;  2OQ7 A;  3ZYH A;  3J7H A;  4R9A A;  4P08 A;  4FPG A;  4XZP A;  2VMF A;  1DQ2 A;  5GLU A;  2ZGP A;  3RJ2 X;  3O1R A;  4IDZ A;  2ARE A;  1NKG A;  1IPJ A;  2HWF 2;  2XQR A;  3NAP B;  3OG2 A;  4FXG B;  5FZ7 A;  3ES1 A;  4JGY A;  5FIX A;  5FO9 B;  1QU0 A;  2BBA A;  4XFG A;  2XUE A;  1O4Y A;  1UQX A;  4E4D X;  1PK6 A;  2ZMK A;  4Q4W 2;  5C8C C;  1W0P A;  3H8X A;  2XUM A;  2A73 B;  5C5T A;  1H2M A;  4GH4 C;  2WLQ A;  2GDF A;  1SZB A;  1ZBA 3;  2OT7 A;  3SHR A;  3RI9 A;  5IVV A;  4AEM A;  4LHS A;  4Y24 A;  1QJU 1;  3SEE A;  3KVB A;  3WLU A;  2VTF A;  5BNP C;  2RS3 3;  1OH3 A;  1F4H A;  3VDC A;  2Q8O A;  4EN6 B;  2DFC A;  1VBC 1;  4XUR A;  2JDU A;  1GKB A;  4OI4 A;  3WNM A;  4JZR A;  3A7Q A;  1ZRR A;  4YSF A;  2E53 A;  4X8P A;  4XEZ A;  2VGD A;  3DL3 A;  3Q8C A;  2GSY A;  4B7E A;  1UXX X;  1ND2 A;  3DKQ A;  4GWI A;  4MV2 A;  2OUH A;  3AKQ A;  1CZT A;  4IGP A;  2XLF A;  5JLV A;  2RMU 3;  4I3P A;  3VN4 A;  2WWS A;  3C7O A;  4A2U A;  1PIV 2;  1OKQ A;  5HI0 A;  3I7D A;  5FKC A;  3GJA A;  4DOU A;  3NV1 A;  4P5Y A;  4H14 A;  3ZPY A;  4D7T A;  3E1F 1;  1SMV A;  3HN1 A;  5GLZ A;  5IW0 A;  3I59 A;  5EYY A;  2ZHL A;  4R9D A;  2DCT A;  2VUA A;  5T52 A;  3V0A A;  4R4X A;  2WFF 2;  1ZNP A;  2ETE A;  2R1D A;  1HRI 1;  3NO8 A;  4K9S A;  3X29 B;  1TMF 3;  1AR9 3;  4MGQ A;  4N53 C;  2WNO A;  2ES3 A;  5CEH A;  4XDO A;  1OD3 A;  4UYB A;  2F4P A;  1OF4 A;  4I09 A;  5D21 A;  3U14 A;  3KQ4 B;  4YW6 A;  2VOW A;  2D98 A;  5IAX A;  3BU0 A;  2CAV A;  2GNT A;  3ZFG C;  4RHV 2;  2GNM A;  2OXB A;  4Y5T A;  2FDH A;  4DQA A;  4COZ A;  2C9A A;  1ZM1 A;  2HWF 1;  4LO5 B;  3RWK X;  3MW3 A;  1XNK A;  2WZE A;  4LBJ A;  1UZY A;  3GJB A;  2XQX A;  3NVC A;  2JG8 B;  2NM1 A;  3VBF B;  5GJ6 A;  5IWF A;  1AUY A;  4CCJ A;  1W9W A;  2VTX J;  3MIC A;  2J22 A;  4K3U A;  1SQ4 A;  1N1S A;  2WS9 1;  2XML A;  4X6Q B;  4Y1V A;  2O1Q A;  4HPK B;  4AQ6 A;  1KGY A;  4YVW C;  3OF1 A;  3N4M A;  1Q8V A;  1ZZ7 A;  3F2Z A;  3DYP A;  1B09 A;  1MS5 A;  4LMF A;  5FRE A;  2XDV A;  4UFJ A;  1TVG A;  2OA2 A;  3MBW A;  2ET7 A;  3DF0 A;  4BOW A;  4W8J A;  2SLI A;  4XJU A;  3FBY A;  3OOX A;  1BKZ A;  2W68 A;  4WM8 A;  2VCA A;  3D5O A;  1OFS A;  4AVV A;  3AP9 A;  4SLI A;  5A3U A;  4QAW A;  1LOB A;  2AZ5 A;  3B9I A;  5FPL A;  3PUQ A;  2R04 2;  1IHM A;  2ENR A;  3KT4 A;  3CZU A;  3VUO A;  1F2N A;  2BOI A;  2BNO A;  5KHK A;  1MPX A;  2OYZ A;  1GNZ A;  3ZMO A;  3VD5 A;  5F5Q A;  2LW8 A;  3K3O A;  5FYS A;  5FZF A;  5H9R A;  4NPR A;  5FP7 A;  3O0V A;  1WCD J;  1PX3 A;  2J1S A;  3U4X A;  4BB3 A;  2DYC A;  1JOP A;  5I93 A;  1W03 A;  1PIV 1;  1VB2 A;  3AYE A;  5CG9 A;  1SAC A;  1WD3 A;  1Z7S 1;  4DUX A;  3LCP A;  3GBW A;  4WZC A;  1TME 1;  4XIO A;  2YFZ A;  4CVU A;  2BW8 A;  3AK0 A;  1JW6 A;  3W58 A;  5JSO A;  3ECQ A;  1DF0 A;  2HWE 2;  1UZ0 A;  2VC9 A;  3BTZ A;  3OY8 B;  2VY0 A;  5FY8 A;  4R52 A;  4KBB A;  4MXV A;  4FPF A;  2R32 A;  1K5M C;  4CCM A;  3EB7 A;  4CXW A;  1W2U A;  2QQV A;  1HIX A;  3AFK A;  3UL2 A;  5CAZ A;  2FMY A;  2RJ2 A;  5EJZ B;  3CF6 E;  2VW2 A;  3B5L B;  4Y22 A;  3VDD C;  1O3T A;  1OKO A;  3UGF A;  2JG9 B;  4DFS A;  4RHV 1;  1OPO A;  4FQ4 A;  2YC2 A;  1UY0 A;  2Y26 A;  2X05 A;  4HMZ A;  5JPN B;  2WNE A;  1W0O A;  1PZ8 A;  3ZN5 A;  1ZX5 A;  4Q4Y 2;  3FLR A;  1CON A;  4GWM A;  2R6Q A;  5SV8 A;  4K6B A;  1DLL A;  1RVF 1;  1XQN A;  3WY6 A;  3KT1 A;  4PF1 A;  2XJT A;  2YHJ A;  3AXD A;  3CDZ B;  4BPZ A;  2GU9 A;  1XE8 A;  4QQL A;  1ACC A;  4B4R A;  3A4U A;  1S0C A;  2CTV A;  3PMS A;  5K0U C;  4CDU B;  1R1Z A;  1RJ8 A;  4OMD A;  3RDI A;  5JMO A;  3EQE A;  3P3N A;  1MZ5 A;  3JXS A;  3MIG A;  5A3L A;  1SFN A;  4K8R B;  4KWL A;  5J98 B;  4QDR A;  1OXC A;  3G6J B;  2XVK A;  4JKL A;  5CIS A;  4DEV A;  3I3M A;  2DF7 A;  1G9F A;  3RRD A;  1CPN A;  2OW4 A;  3IPV B;  3KS7 A;  5A6Y A;  5F9T A;  3LDR A;  1LTE A;  3BOW A;  1J3P A;  3CBN A;  5AC9 3;  1XNC A;  1BBT 2;  1R08 1;  1S55 A;  1LOD A;  3GGL A;  3WXP A;  3AP7 A;  2A6Z A;  5DN2 A;  3JD7 1;  3WP3 A;  5C3S A;  2RS1 3;  4RR3 C;  4FTS A;  4LPL A;  5IVY A;  1TZO A;  2HWC 1;  2Z79 A;  4O9E A;  3S0M A;  4Y1X A;  5A3W A;  1EV1 3;  3LDB A;  3JU9 A;  4A7Y A;  4MET A;  5L36 A;  2PLV 3;  1W9T A;  2JJ6 A;  1ASJ 3;  3JBG 3;  1J1L A;  3M3I A;  3E6B A;  1XBF A;  2X53 S;  1JH5 A;  4Q1P A;  1AJK A;  3VKF C;  2ARB A;  1UMZ A;  4GKX A;  5FZL A;  3LB9 A;  2G19 A;  4LA3 A;  2ZAC A;  4AL9 A;  4B1M A;  3NWK A;  4PI0 A;  4TZD A;  3NAP C;  2XBO 3;  2GH2 A;  2UWA A;  3MUZ 1;  4AW7 A;  2Z69 A;  3HQR A;  3U0Z A;  3PVE A;  1RUC 1;  4XOG A;  1NCR B;  2BPA 2;  1WCQ A;  3E5Q A;  2XJS A;  3ZSJ A;  1MZ6 A;  5F3I A;  5IK8 A;  1UMH A;  3DXU A;  3PVO A;  4NRM A;  5HCF A;  1SLL A;  1R1A 3;  3NST A;  1W0N A;  1YLL A;  2Q1Z B;  3WCR A;  3ZFF A;  5KC5 A;  1XU1 A;  5E88 A;  4RSU A;  4UF0 B;  4KI5 M;  4A6S A;  5I0R A;  3W5N A;  4OUE A;  4D7Y A;  1M4W A;  1IPS A;  4P9G A;  1LES A;  4NRQ A;  5A80 A;  2ZGR A;  4ARX A;  5EYX A;  3WW2 A;  5F3E A;  4AHY A;  4LBN A;  3MF6 A;  4Q8K A;  1RUD 2;  1XC6 A;  4M4R A;  3H9A A;  3ACG A;  2EIE A;  4H7L A;  3RYP A;  1RUH 1;  4FAH A;  1FMD 2;  3OB8 A;  1YIP A;  1C5H A;  5GLV A;  4CDX A;  1VBD 3;  4RD7 A;  3D0S A;  2VW1 A;  4LE3 A;  4QWN A;  3QLQ A;  5ANQ A;  2VTX A;  1XNB A;  2IFR A;  5LK7 B;  1G9C A;  2B8M A;  1VBB 1;  4QKF A;  4JV4 A;  2XKP A;  1Q43 A;  4RS5 A;  5BNQ A;  2JDP A;  3I2J A;  1LKN A;  1UPS A;  2CSG A;  2EAL A;  1HRV 1;  4FCA A;  4FPH A;  1WW5 A;  5A32 B;  3RZM A;  4JTO A;  1QIQ A;  3ZYF A;  2VZO A;  5A1F A;  1NY7 1;  2AEZ A;  5LK5 A;  3NMB A;  4FPE A;  3IWZ A;  3PJY A;  4DPN A;  4PLN A;  4FOV A;  3VBO B;  2ZGO A;  3ZN4 A;  4FOW A;  5DG1 A;  3CJI C;  4MGS A;  4DUV A;  1LHW A;  4BQ3 A;  4A42 A;  4WM7 A;  5DZF A;  2WN2 A;  5K7P A;  4XFI A;  3O1U A;  1ZZC A;  3HEI A;  1GNH A;  2IWG B;  3NKG A;  2ADE A;  2EVX A;  4P9X A;  1E5R A;  4PIX A;  4S2G A;  3TYJ A;  3WDV A;  3WP5 A;  5CA6 A;  2VMD A;  5JSR A;  5L9B A;  5C71 A;  1Q56 A;  1XNA A;  4NAO A;  4RA0 A;  1X9T A;  1V6I A;  4QPW A;  3WG1 A;  2C26 A;  2X5I A;  2BU9 A;  4ORF A;  1AXK A;  5CU1 A;  4AWD A;  2PMW B;  1LEC A;  2W39 A;  2YXS A;  3K2O A;  1UAI A;  3TEX A;  3U4S A;  2Y0O A;  4O65 A;  2NQY A;  2PHR A;  3VV1 A;  2JG8 C;  4XTM A;  4PDW A;  3VBF C;  4R4Z A;  3FFZ A;  5J3U A;  1QJZ A;  3ASI A;  2UYA A;  1R09 3;  2NN8 A;  4IEV A;  1CAX A;  2W91 A;  3WSO A;  1VBE 3;  2BNM A;  5GZF A;  1XE7 A;  2Q1M A;  3DYM A;  3N9N A;  2R0F A;  5C9A B;  1W9F A;  2B42 B;  1ONA A;  2E51 A;  1FPN 1;  2B39 A;  4MGI E;  1IZ3 A;  2ID4 A;  4XFC A;  1YFY A;  1VLN A;  3K48 A;  4S2H A;  1J84 A;  2K46 A;  1NA1 A;  5FZO A;  4FBF A;  3WNL A;  2I74 A;  4NII A;  1RUD 1;  5FZ1 A;  3KCX A;  5HCH A;  3MYX A;  1GR3 A;  3S6P A;  3LKJ A;  3KHB A;  1HXS 3;  3GCW A;  3KVA A;  2YPJ A;  4UFI A;  3NKT A;  1J1T A;  3RZK A;  2I2S A;  2VOK A;  3WDW A;  4S2F A;  1YQ6 A;  4KU8 A;  4AYU A;  2Y60 A;  1W6Q A;  1BEV 3;  4QGM A;  4MZU A;  2Z4F A;  1EYB A;  4LO6 B;  5L7O A;  3LOB A;  5BPX A;  1DGW A;  1OFN A;  5BNO B;  3IAP A;  1G9D A;  1REF A;  4ZY9 A;  1CPM A;  1QJE A;  2ZOE B;  2GAU A;  2CNA A;  4UI9 L;  4EQV A;  1OOP C;  1XSR A;  5HV0 A;  2OS2 A;  3SCH A;  2FMD A;  1SBD A;  4ZPI A;  2JDY A;  4CDQ C;  1QH7 A;  4BYY A;  2PFW A;  5JOZ A;  4JAA A;  4F7Z A;  3B7M A;  4QGN A;  4LA2 A;  2CYF A;  1FNY A;  2E31 A;  4FFH A;  1V00 A;  5DDJ 1;  2VOX A;  5CZK A;  3R0R A;  5BYN A;  3J9S A;  4JQR A;  1GOH A;  4CU9 A;  4NN0 A;  4RQP B;  1IS4 A;  2E63 A;  3ZN6 A;  4HVQ A;  3C3V A;  3SH5 A;  1D4M 3;  3B3Q E;  5F32 A;  3K51 A;  2GMP A;  5DAV A;  1T6G C;  4A3Z A;  4BMB A;  5T50 A;  5FO8 B;  1S2K A;  5DAP A;  3KGL A;  1M06 G;  2B45 X;  4EZH A;  3HQU A;  4IEO A;  4IET A;  2VZS A;  1ZZ6 A;  2A70 A;  4MGY E;  4XUQ A;  1YJK A;  1JZ4 A;  2JE8 A;  1PGW 1;  1CZV A;  4XCA A;  3U37 A;  4BK5 A;  1Y4W A;  2WC2 A;  4LUM A;  2JKB A;  4XQ4 A;  2D5F A;  4WV8 A;  3JB8 A;  4CDU C;  4IEP A;  2YB7 A;  4Y26 A;  2D6K A;  3A21 A;  2RM2 3;  3TEW A;  3HNY M;  4TYS A;  4F83 A;  3LIH A;  4DZG A;  1UY1 A;  1LED A;  1U12 A;  2HBU A;  1ND3 A;  4Y1Y A;  2Z42 A;  2D3S A;  3H3L A;  4QDQ A;  3H42 B;  4MXW B;  1WLT A;  3KWV A;  4QX0 A;  4XHB A;  5I8T A;  2E7T A;  1EUU A;  1JYI A;  5JI9 A;  5D2A A;  3OUI A;  3ZXF A;  3DPR C;  3V64 A;  3KSC A;  1NCQ C;  1OUX A;  3MUY 1;  1RUE 3;  4LLO A;  4PLM A;  1HW5 A;  3DN7 A;  1POV 1;  1VJ2 A;  4Q4V 2;  5FY0 A;  1NT0 A;  1V9U 1;  2TUN A;  4AGG A;  4BJ0 A;  1D0H A;  1CAU A;  4YWA A;  3O1T A;  4I30 A;  4XAC A;  2GN3 A;  4YW3 A;  1S0I A;  1N1Y A;  1RTV A;  2R1B A;  2C9K A;  2IXK A;  2RG4 A;  2QDN A;  3WP6 A;  5GLT A;  1AYM 2;  4HXC A;  2YV8 A;  3WF0 A;  2XLA A;  4AFD A;  2X10 A;  2HWD 1;  1VRH 2;  3POW A;  3MPP G;  2ZML A;  3TN9 3;  3LE0 A;  5C8C B;  1SBE A;  3MV1 1;  3WNO A;  2D3P A;  4IGQ A;  4GH4 B;  2W1U A;  4HSL A;  2EXH A;  2ZPX A;  2AGS A;  3PIJ A;  4NAM A;  1RYY A;  1ZA4 A;  2VAU A;  3LEG A;  1NCR C;  3POI A;  3LZZ A;  3J8F 3;  4IEZ A;  3CJX A;  3GCX A;  5FP9 A;  2W5F A;  1DG6 A;  3UES A;  3QD6 A;  5BNP B;  4ZXE A;  2HYK A;  4QX7 A;  3L2H A;  3CL1 A;  1ZRE A;  1OUR A;  3GBF A;  3CHX A;  4Q4X 1;  3KCC A;  1AR8 3;  1AL2 2;  4QM9 A;  4K20 A;  2QQN A;  5I91 A;  4AHW A;  1W6N B;  4TLF A;  2P34 A;  2ORX A;  3IDB B;  2A3X A;  5JCT A;  4Y3O A;  2PHU A;  3OYW B;  2OII A;  2RS5 3;  1TG7 A;  2BTV C;  3H7Y A;  2YC4 A;  1UXZ A;  4IV3 A;  4R8H A;  3ROU A;  1U0A A;  2EF6 A;  1W8F A;  3Q8A A;  4UFK A;  2NLR A;  4QPI A;  5I0U A;  2V5Y A;  4H2A A;  3T0A A;  1US2 A;  2H0B A;  2WJS A;  3VKM A;  2QE3 A;  1RXF A;  1YFW A;  2RR1 1;  4P9Y A;  1F4A A;  3WEZ A;  2MEV 3;  1RUI 2;  3I2G A;  4XPV A;  3AC0 A;  5FK7 A;  4CU7 A;  1RUG 2;  2P17 A;  1S0E A;  1C8M 2;  3AFG A;  4YG6 A;  4BQ1 A;  3I3D A;  2P5B A;  1AR7 2;  1ZZ8 A;  4V2W A;  3USU B;  1RUF 3;  4AOC A;  3VBO C;  1JMU B;  4BIO A;  3C2U A;  5BXX A;  4ZU7 A;  3FLT A;  1RHI 3;  2PHL A;  1E5S A;  2D5H A;  2XWJ B;  4OHV A;  3N9L A;  4JCK A;  4E8C A;  3ZFG B;  2PTM A;  2Y38 A;  2DVF A;  5FPZ A;  1LOF C;  4BIF A;  5C8W A;  3B69 A;  2LRP A;  2JDH A;  5A3T A;  1SG3 A;  2VVD A;  2VG9 A;  1W6O A;  3IB3 A;  3TBD A;  2WYS A;  2XL7 A;  4R9B A;  3O5S A;  2VE1 A;  5DUX A;  3WW4 A;  1BMV 2;  4NWV A;  5IVJ A;  2C24 A;  4GB3 3;  5DZG A;  1DZQ A;  2VXJ A;  4MUV A;  3T1L A;  1JYW A;  1OBN A;  4AI8 A;  5CFD C;  4Q0V A;  5IK4 A;  4WBB A;  4QXK A;  1JZ3 A;  4C90 A;  5FY4 A;  3N9P A;  3OGV A;  1HLC A;  3THT A;  4KGQ A;  1UKR A;  1UWW A;  2ZXQ A;  4YM0 A;  5F39 A;  4U2A A;  4IV1 C;  4W6W A;  3IN9 A;  1NAE A;  2HH9 A;  1SDW A;  2QQJ A;  2WNV B;  4QU1 A;  5C4W A;  4DUW A;  5C9A C;  1ZA7 A;  4Q5O A;  2OQ6 A;  4HN0 A;  2XH6 A;  4BA6 A;  3ZXD A;  4BXS V;  2GME A;  2A1X A;  2WZR 2;  3CZJ A;  4YVS A;  1W6P A;  1SLI A;  1GWL A;  4IEY A;  3P5B A;  1EAH 3;  1FOD 2;  3EO6 A;  1DQ0 A;  4QT6 A;  4GMP 0;  3U10 A;  3VHN A;  4ES8 A;  1Q8P A;  5FXZ A;  1N1T A;  1F8V A;  1BCX A;  3HR9 A;  3SIT A;  3D4K A;  5LB6 A;  4OHY A;  1ZVF A;  2VBD A;  3NNL A;  2C6S A;  3FHA A;  3TOJ A;  2VBB A;  3LIG A;  5FR3 A;  3ILF A;  1UIJ A;  1MS9 A;  5LA2 A;  4MVT A;  1VBA 3;  2ZA9 A;  2AYH A;  2UWC A;  3EHK A;  1KFU L;  3OSD A;  3FN9 A;  4LHN A;  1HV1 A;  3KMH A;  4LR4 A;  1PO2 3;  4Q0S A;  1MS4 A;  2WO1 A;  1COV 3;  2CGP A;  1K5M B;  1DGR A;  2H0V A;  2GMM A;  5GZD A;  4CDW B;  1V6O A;  3SIS A;  1QJU 2;  4CYD A;  1D4V B;  1QNY A;  3FHI B;  2X09 A;  3VDD B;  1BLZ A;  2WSV A;  1W90 A;  1SLC A;  4S2D A;  5FZD A;  5JXG A;  4CCE A;  2CDP A;  3VBH C;  1UY2 A;  3ES4 A;  1VMF A;  2A6W A;  3H7J A;  5LWB A;  4LK7 A;  4CXY A;  3N7M A;  1BMV 1;  3G7D A;  1CQ9 A;  3OBR A;  4QU2 A;  1UW8 A;  4CEY B;  5FP3 A;  2ZX1 A;  1NOV A;  1Y3T A;  2CL2 A;  1N3O A;  1RUJ 3;  1V0A A;  4N43 A;  4GMP 3;  5G05 L;  2IZW A;  5FLJ A;  1GIC A;  2JD9 A;  3NRU A;  3ZLI A;  2WO7 A;  1MQT B;  3O0W A;  4CP9 A;  3GBG A;  3PUS A;  3D82 A;  3PME A;  5A7W B;  4BCU A;  3WW3 A;  2DVG A;  3N7K A;  3I3Q A;  3T4V A;  1ULG A;  5T3N A;  5A33 A;  1KQR A;  4PIY A;  4EWE A;  3L9J T;  3R4D B;  4AED C;  4QPG B;  1STM A;  5A1A A;  3TNQ A;  2RVA A;  1EY2 A;  2WT2 A;  1OPM A;  2Y8K A;  3RZZ A;  3POS A;  4JKK A;  4LHL A;  1HRI 2;  2OKX A;  1ZZB A;  1F15 A;  1H8T B;  1VAM A;  1YHF A;  2P6H A;  2WO2 A;  3Q8E A;  4RR3 B;  2G9F A;  3OEA A;  1UKG A;  2LM3 A;  3AM2 A;  3ME2 A;  3SCF A;  3K4Z A;  1X7N A;  3VKO A;  4BE3 A;  5FWJ A;  4O61 A;  1PO1 2;  2CU5 A;  5J7M A;  1GU3 A;  1UMI A;  2VUC A;  4XHX A;  4RGK A;  1SCS A;  2J1E A;  1RJ7 A;  1PZ7 A;  1BYH A;  2XKO A;  3BPZ A;  5CKN A;  1S0B A;  1QQP 1;  3K46 A;  4XDQ A;  4BQ4 A;  3VD7 A;  5D8A A;  3N7J A;  3FBM A;  3K4D A;  1TNR A;  4XBN A;  4XJA A;  2O14 A;  1DGW X;  1QOS A;  3MDP A;  1FV2 A;  1GZW A;  3JB4 C;  2ZEZ A;  5F5I A;  2AUY A;  1REE A;  1IS6 A;  1HKD A;  1IG0 A;  2YRO A;  5HV4 A;  3AMQ A;  5FZB A;  3BPS A;  2ZCW A;  5HBA A;  2WS9 2;  1ZBE 3;  1AYN 1;  4XF1 A;  3ZXJ A;  1PVC 3;  4XUP A;  3CU7 A;  4LBQ D;  3WT3 A;  1XYN A;  3T0B A;  3LOI A;  3NQH A;  4FOY A;  1OQD A;  3PUH A;  5KXD A;  4E4H A;  1OLQ A;  1BK0 A;  4K7J A;  4N53 A;  4UBG A;  3RPQ A;  2OZ6 A;  2XGX A;  2WII B;  3WQ7 A;  2VH9 A;  3LEM A;  4YW4 A;  4RFT 0;  1JYN A;  5A7S A;  4JTN A;  3PU8 A;  1UL9 A;  4ZZ5 A;  2ILM A;  3PVB B;  4ZHN A;  5BNN A;  4FTE A;  4DRR A;  3U07 A;  2F17 A;  1A34 A;  1HN0 A;  3KV4 A;  4M0H A;  2YU1 A;  2W9X A;  1V70 A;  1F35 A;  5H9P A;  1QXP A;  3LFM A;  2WKK A;  2UY9 A;  3DXT A;  1HX6 A;  4U36 A;  3PUA A;  5FUI A;  5C3Q A;  5IVB A;  3VLB B;  1AX2 A;  1Y43 B;  2C4X A;  2DVD A;  1U5I A;  2CY6 A;  4JDM A;  3RYR A;  4AHX A;  2K2S A;  3AP4 A;  1Z7S 2;  5C3R A;  4KWU A;  1GQG A;  3UKT A;  3PUR A;  2WT0 A;  5E16 A;  1TME 2;  3FUQ A;  3MEP A;  4CE8 A;  2J1T A;  2A6Y A;  4L97 A;  4FSJ A;  2QTW B;  2ZHM A;  1ZBA 1;  4YVW A;  4EWA A;  2OVU A;  4MLO A;  2WNU C;  3SQO A;  2NMO A;  3CJI B;  2RDS A;  2RS3 1;  1CIY A;  1DQ6 A;  3A22 A;  4ZXK A;  5KXE A;  2YBS A;  1PMJ X;  3BGA A;  4H7M A;  3TB0 A;  3V0B B;  5I8Y A;  2HWF 3;  3ENR A;  4DXT A;  4YFZ A;  1PO1 1;  5ANN A;  4JGY C;  4ZU4 A;  4URT A;  1XXN A;  1UIK A;  2DUR A;  1PK6 C;  2K0G A;  1N3P A;  4Q4W 3;  3GHN A;  4ZS3 A;  2MPF A;  1YUD A;  1DP0 A;  4CA9 A;  1CAW A;  4TSV A;  1ULF A;  1YIF A;  1YQ5 A;  2XOM A;  3I2F A;  4HZF A;  2VXR A;  4OFG A;  1E5I A;  4AE2 A;  1DDL A;  1QDC A;  2VOV A;  4XE9 A;  3IAQ A;  5IK7 A;  2RMU 1;  2TEP A;  2WT1 A;  4TLG A;  3RSJ A;  3URF A;  1MEC 2;  3AYD A;  2QBX A;  5E1R A;  2VCB A;  1GQP A;  2ZAB A;  1RVF 2;  3AVR A;  3EYP A;  3LWC A;  1H6X A;  4QX2 A;  1GOF A;  1IKP A;  2BOJ A;  4I0B A;  1QY4 A;  3I3E A;  4QMA A;  4FOQ A;  4Y1Z A;  1S2B A;  5CB7 A;  1GP4 A;  4COV A;  5FK8 A;  5IVC A;  1UN1 A;  1H30 A;  1ND2 C;  4E9K A;  1TMF 1;  4COY A;  2WNV C;  1AR9 1;  1QJF A;  3VBR A;  1UU5 A;  4EWD A;  4OQ8 A;  2DVA A;  1U5Y A;  3IT8 A;  5KHI A;  2PYT A;  2QQM A;  3I4I A;  1AJO A;  1R08 2;  3WQ1 A;  1PIV 3;  1QOO A;  1XU2 A;  5FO7 B;  4DY5 A;  3AKT A;  3JD7 2;  4MAD A;  4XIL A;  2HWC 2;  2R06 3;  4UW3 A;  2FDF A;  4RN5 A;  4UW6 A;  1NE4 A;  2D6N A;  3WG3 A;  1VMH A;  2GC2 A;  5IAT A;  4L2N A;  1ZYB A;  2Q8C A;  3HD8 B;  1X36 A;  1YO8 A;  2WFF 3;  2DCY A;  4JRA A;  5DG2 A;  3OUH A;  4V2V A;  2Q8E A;  4XXA A;  3OGJ A;  2Y33 A;  3WF3 A;  2VD7 A;  2YPD A;  1LRH A;  1W28 A;  3NNJ A;  5K0U A;  5FMD A;  1OOP B;  2VQT A;  3R4S A;  4XAA A;  3WG4 A;  2I07 B;  4Q29 A;  4DMI A;  2XVL A;  1RUC 2;  2VMG A;  5FZI A;  2XB6 C;  1NX9 A;  3JQW A;  3PNA A;  3IMM A;  4M4P A;  4CDQ B;  1SPP A;  4QQH A;  1FAY A;  1H1I A;  5LA0 A;  3ZMN A;  2ORZ A;  1W3X A;  1X9P A;  1UX6 A;  3M2M A;  3PTR B;  2FZ1 A;  4AEJ A;  3WUD A;  2I45 A;  1NYW A;  4HT1 T;  4P9J A;  2QUO A;  3BTX A;  4CDW C;  4Q8L A;  3WNK A;  1N3Q A;  1DYK A;  1V6K A;  2JE9 A;  1DHK B;  3AKP A;  3GF6 A;  4QXB A;  3WF1 A;  4LO8 A;  5A6Z A;  1CX4 A;  2NP0 A;  5HCB A;  3RYK A;  5F2W A;  5JMC A;  1KFX L;  5K9Y A;  1IOA A;  3E5X A;  3OD4 A;  4L0P A;  1W6M A;  2PLV 2;  4NWW A;  3JBG 2;  1ASJ 2;  3ETP A;  1B35 B;  2JDA A;  1RUH 2;  3LF7 A;  3WZ1 A;  1POQ A;  1MEC 1;  2ARC A;  1SFP A;  4Y4R A;  3WNP A;  4CEY C;  5L9V A;  5I0D A;  1J3Q A;  3R05 A;  5FZ9 A;  3NAP A;  1NLR A;  3MLL A;  1D2S A;  3SKV A;  2W95 A;  2DUP A;  1MQT C;  4FQZ A;  1FV3 A;  1RED A;  1VBB 2;  2JEC A;  2R04 3;  2YBK A;  4QGL A;  5A7P A;  4YAR A;  4AI0 A;  1ODM A;  3W5M A;  2Z2S B;  3M8L A;  1S0G A;  3HQX A;  3AMN A;  4GD4 A;  1O3S A;  5KHH A;  5T5P A;  1S2E A;  1HRV 2;  4Z82 A;  1RL3 A;  4QPG C;  3KV9 A;  2FDG A;  1NY7 2;  3WP4 A;  3BN6 A;  3WIN E;  3ZOI A;  4CP2 A;  5C3O A;  2EID A;  3DPR B;  3VGI A;  5C6C A;  1NCQ B;  1H1A A;  1LOC A;  1F5J A;  1H8T C;  2W87 A;  2WLP A;  1AR6 3;  1BXH A;  1QJY 2;  4ES9 A;  4Y4Y A;  3IIA A;  2FZ2 A;  2BGC A;  4OHZ A;  1KDK A;  4MX3 A;  2AH2 A;  4LNV A;  3J7M A;  1S4C A;  5EZW A;  5EP9 A;  2DDU A;  4AQT A;  4MHU A;  2HWE 3;  4Q1R A;  4CPB A;  4DEQ A;  2CAU A;  3MIE A;  1HV0 A;  2CDO A;  4G9S B;  2AEY A;  3N3H A;  2DV9 A;  1VBD 2;  4XVH A;  4KH9 A;  1CAV B;  4IE5 A;  1I1E A;  1YYN A;  3MLK A;  1W8U A;  3FHQ A;  3UKV A;  2TNF A;  5GKA C;  1O8P A;  5J37 A;  3E6C C;  3FX3 A;  2PAE A;  4XBQ A;  3BU7 A;  3SMH A;  1W39 A;  3AL6 A;  2D7F A;  2J42 A;  1IS3 A;  3ZM8 A;  3NV3 A;  1DCS A;  5IFT A;  4BQ5 A;  4LO7 A;  4QD2 A;  3WNX A;  4HN1 A;  5A70 A;  3PU3 A;  4TTG A;  1FPN 2;  2GC0 A;  3BUC A;  2W52 A;  4NPL A;  3RFR A;  4BZ4 A;  1GP5 A;  3MPB A;  4UAP A;  4Q4Y 3;  3L2Y A;  4Y33 A;  3T1M A;  1LB2 A;  1H9W A;  3ALQ A;  3AP5 A;  1K5J A;  1YFU A;  4NHL A;  1DZR A;  3CO2 A;  4QXC A;  2Q8D A;  3KHC A;  2V4A A;  3WDT A;  4OI0 A;  3MFA A;  3P1I A;  1OF3 A;  1C4R A;  4WVM B;  4IE7 A;  2PLV 1;  3JBG 1;  1ASJ 1;  5FYI A;  1K42 A;  1Z0H A;  3UT0 A;  3FFQ A;  2C1F A;  5J09 A;  3C7H A;  4E8D A;  3ACH A;  2XJQ A;  2Q0A A;  2ZX4 A;  4AQ2 A;  1DQ5 A;  5IUQ A;  5M0T A;  5AVA A;  5AVP A;  1A78 A;  4W50 A;  2HYX A;  5JXH A;  2XBO 1;  3V65 A;  2VZ3 A;  1W2O A;  1HQN A;  1HJF A;  2BFU L;  2JG8 A;  2QQW A;  4H3W A;  3VBF A;  1BBT 3;  3ILN A;  5F8P A;  4CRQ A;  5JOW A;  4AGV A;  3RVH A;  2WAO A;  1OLR A;  1RGS A;  3O0X A;  3ZVX A;  3PJQ A;  1R1A 1;  1GZT A;  4N7I A;  3SC7 X;  5FXW A;  2Y34 A;  4HPK A;  5FY7 A;  5C70 A;  5CKM A;  1GZ9 A;  2VMI A;  1IQA A;  2ZS6 B;  3LSE A;  4QX8 A;  5FDB A;  5JZG B;  4I01 A;  3VBS B;  4YGE A;  5F5C A;  1W99 A;  5IHR A;  1J3R A;  1PHM A;  3KF5 A;  5DDJ 2;  3AZZ A;  1QJY 1;  3Q8F A;  4LKS A;  1C57 A;  2DCJ A;  3FJS A;  2HEW F;  4E27 A;  4BK4 A;  3ZYI B;  5ACA 2;  3C7E A;  4CU8 A;  4PF5 A;  2QZ3 A;  4M3C B;  2DVB A;  2D6M A;  4TXW A;  2DU1 A;  3RNS A;  3VB9 A;  3B00 A;  1VBD 1;  2E9Q A;  3ZFF C;  1VAK A;  3S5A A;  5CFD B;  3OBZ A;  4WVV A;  5FZ4 A;  3S5Q A;  1T2X A;  4KWJ A;  4CP1 A;  4Y20 B;  5FUP A;  2FHR A;  3TEZ A;  1UYX A;  2F6B A;  2BP6 A;  1C1L A;  4A7Z A;  3RZH A;  1PGW 2;  4IV1 B;  3HNM A;  1UD1 A;  1EPW A;  4NMI A;  2WSU A;  1E5H A;  2D6L X;  1OA2 A;  4XDP A;  4XQW A;  1KRI A;  5LY2 A;  3III A;  3ZXE A;  1HB3 A;  4XW3 A;  1C5I A;  4CDQ A;  3LQC A;  3IBM A;  3OY8 A;  5F6L B;  4RFR B;  1FMD 3;  1D7P M;  1SLB A;  1DLC A;  2D40 A;  4XXP A;  2P2K A;  5L73 A;  1W8N A;  1VMJ A;  2HJI A;  3MIH A;  2HEV F;  3ABZ A;  4YG0 A;  1HDK A;  3MGU A;  4HSJ A;  4UXA A;  5KWR A;  4GAL A;  2JG9 A;  4G3Y C;  4RS5 C;  1V9U 2;  2PA7 A;  4L99 A;  4MYE A;  3NW4 A;  4B7K A;  3WW1 A;  2XPJ A;  3B01 A;  5FOJ B;  2P37 A;  4XQD A;  1Y9M A;  1PM4 A;  1PVX A;  2A3W A;  3OJB A;  5CFC B;  2PAK A;  3POG A;  5SV5 A;  2A3Y A;  2ET1 A;  4LE4 A;  2HWB 3;  5ABJ B;  3UK9 A;  2HWD 2;  4BQX A;  1N1V A;  1NXM A;  5FAX A;  1VAL A;  1JN2 P;  1R09 1;  1K3I A;  5H9Q A;  1WME A;  2CWM A;  3AX4 A;  1VBE 1;  4CDU A;  3KD4 A;  1SBF A;  4XZU G;  4F8A A;  1NQJ A;  2E33 A;  2P6C A;  1GWM A;  1JYC A;  4LHK A;  1HB1 A;  2Y6H A;  4YGC A;  5F3G A;  1NE6 A;  4DXZ A;  4QM8 A;  4LBL A;  2X29 A;  3UJQ A;  1W3V A;  5FQ0 B;  1J58 A;  2R07 3;  2X5I C;  4KU7 A;  2ZX2 A;  2G9Z A;  2V72 A;  1Q8S A;  3IPV A;  3PUI A;  4C0H A;  5ACA 1;  4DNY A;  1C1F A;  1Y7B A;  3UET A;  2JIG A;  3VBH B;  4Q4X 2;  3KM5 A;  3T08 A;  4GZ9 A;  4LT5 A;  4PDW C;  4BH9 A;  1W06 A;  3N9M A;  1HXS 1;  1W8Z A;  2ZBJ A;  1VR3 A;  1MVQ A;  4MO3 M;  4B8E A;  5FOB B;  5FXV A;  2ZEX A;  2O0O A;  3Q8B A;  2R7E B;  2WFP A;  1B35 C;  2J7M A;  3GXU A;  5JIU A;  5E89 A;  1BEV 1;  2OPK A;  3PIG A;  4QKB A;  4PI2 A;  2VZT A;  1NA1 C;  3VD9 A;  1RC6 A;  1GOG A;  3M3O A;  4ZU5 A;  1GAN A;  3QH7 A;  3ZX7 A;  4BQY A;  5A1L A;  4HFS A;  4LLF A;  3N9Q A;  2ZGK A;  1OH4 A;  2W94 A;  2RR1 2;  4IE6 A;  4AED B;  2QFE A;  4QX5 A;  1NCR A;  4XMA A;  2LTN A;  3VBU B;  4DY3 A;  5FYM A;  3QBQ A;  2R49 A;  4B4P A;  2VZR A;  2IVJ A;  3LDK A;  3MIF A;  3C8X A;  1BHG A;  4KWK A;  5EXO A;  5FZM A;  3DCQ A;  1VIW B;  2Q4S A;  2ZAH A;  3H8U A;  4LXL A;  4UF0 A;  3NV4 A;  1SDD B;  5J36 A;  4XF9 A;  3WDU A;  1D4M 1;  1H8V A;  2BYV E;  2WR9 A;  1DYP A;  2Y6J A;  2VO5 A;  3W59 A;  1FAT A;  5L7O C;  4NHM A;  4WVM A;  1ULE A;  3LA3 A;  3BOP A;  1XND A;  4XCB A;  5I0T A;  3SH4 A;  3AMP A;  3OTF A;  4CCC A;  1U5Z A;  1WLD A;  2RS5 2;  2AR6 A;  2VL4 A;  1ULP A;  4RGG A;  5HXM A;  1YEW A;  1JOB A;  2A5Z A;  1NXD 1;  1X50 A;  1AVB A;  4QPY A;  4HBN A;  4A3X A;  2GN7 A;  5LAT A;  5A3N A;  2V4V A;  2WA3 A;  2G4I A;  3AJY A;  5J48 A;  3OBT A;  3HAG A;  2J1U A; 
#chains in the Genus database with same CATH homology
 5FUN A;  5FP3 A;  4BXF A;  4AI9 A;  4D6R A;  4GAZ A;  4AAP A;  4UF0 B;  3PUQ A;  2OS2 A;  5FPL A;  5FPU A;  3NJY A;  3ZLI A;  5A80 A;  4CUG A;  5A3P A;  5FZO B;  2OQ7 A;  4LIU A;  5FYV A;  5FPA A;  3PUS A;  5FZE A;  5A7W B;  5FZA A;  3AVR A;  5F3E A;  2PXJ A;  3K3O A;  5FYS A;  5FZF A;  4EZ4 A;  3OPT A;  3KV5 A;  5FP7 A;  5FZ7 A;  4IGO A;  4BIS A;  2P5B A;  4V2W A;  5FJK A;  5FZK A;  2XUE A;  5F32 A;  2GP3 A;  3AL6 A;  5FZG A;  5KR7 A;  5IVC A;  5FYT A;  3N9L A;  4DO0 A;  5FPB A;  5FPV A;  4QWN A;  4EZH A;  2OT7 A;  5A3T A;  5ANQ A;  5FWJ A;  5FWE A;  5IVV A;  5FXX A;  5FYH A;  4NUB A;  3KVB A;  3PU3 A;  5FY8 A;  1VRB A;  5FZ0 A;  5IVJ A;  4Y33 A;  5FBJ A;  5F3G A;  4QXH A;  4CCM A;  4QXC A;  2Q8D A;  5A1F A;  5FY4 A;  3N9P A;  5F2S A;  3OPW A;  5FYI A;  3LD8 A;  5F39 A;  2Q8C A;  5F5I A;  3N9M A;  4IGP A;  4V2V A;  2Q8E A;  3U78 A;  5FYC A;  5FXV A;  5FZB A;  4ASK A;  4QU1 A;  4BU2 A;  4DIQ A;  2VD7 A;  2YPD A;  2OQ6 A;  3N9O A;  5FP8 A;  5FP4 A;  5FZI A;  5FY0 A;  5FY9 A;  5IW0 A;  2WWU A;  5ISL A;  4E4H A;  3PTR B;  3RVH A;  3K2O A;  3ZPO A;  3U4S A;  5FY5 A;  5F5A A;  5FY7 A;  5FXW A;  5FXZ A;  5A1L A;  2XXZ A;  5E6H A;  5A7S A;  3N9Q A;  3PU8 A;  4QX8 A;  4D6Q A;  2OX0 A;  5FYY A;  4QXB A;  5F3C A;  5A7N A;  2GP5 A;  4EYU A;  5F5C A;  5FYU A;  5CEH A;  5FYM A;  4IGQ A;  3KV4 A;  4XDO A;  3N9N A;  2YU1 A;  2YBP A;  5F2W A;  4D6S A;  5FY1 A;  3UYJ A;  3AVS A;  5LW9 A;  5FZM A;  4C8D A;  3DXT A;  4LXL A;  4UF0 A;  3PUA A;  2W2I A;  5F37 A;  4LIV A;  3KV6 A;  4TN7 A;  5IVY A;  5IVB A;  3AL5 A;  5FP9 A;  4LIT A;  5LY1 A;  5FZO A;  4GJZ A;  4Y4R A;  5A3W A;  5A7W A;  5K4L A;  3LDB A;  5FZ6 A;  3PUR A;  4CSW A;  4QX7 A;  4CCN A;  5FZ9 A;  5FZ1 A;  5IVF A;  5FYZ A;  4GJY A;  5FZ4 A;  5IWF A;  4HON A;  5FZL A;  2WWJ A;  5A7Q A;  2YBK A;  4CCJ A;  3KVA A;  5A7O A;  5A7P A;  5FUP A;  4GD4 A;  4HOO A;  2XML A;  5FZ3 A;  5FZD A;  2YBS A;  5FZC A;  5FJH A;  5FZ8 A;  4CCK A;  5IVE A;  2YU2 A;  3KV9 A;  4Y3O A;  2XDV A;  3K3N A;  4XDP A;  4CCO A;  5LWB A;  5A3N A;  5LY2 A;  4CCL A;  5F3I A;  5FZH A;  4URA A;  3DXU A;  5FV3 A;  5FYB A;  3PDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...