5F3GA

Crystal structure of human kdm4a in complex with compound 53a
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
339
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 339
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3gA01
5LW9A 5FY0A 2Q8EA 3U78A 5IVVA 5FZ1A 5A3TA 5FZ9A 5FXXA 3KV9A 4CCLA 5A80A 5ISLA 4Y4RA 4IGPA 5F3IA 4XDOA 5FY7A 5A7OA 4D6QA 5F39A 5FPUA 5K4LA 4CCKA 3KV5A 5A7PA 2OX0A 3AL5A 5FZ0A 5FYZA 5IVYA 3KV6A 4QX7A 2P5BA 3OPTA 3PU8A 5FYBA 5FZEA 4UF0A 3PTRB 5A7NA 5IVJA 4QX8A 5FZ8A 5FYHA 4NUBA 5A7SA 5FPAA 2YBKA 5IVCA 4LITA 5FZBA 4AI9A 5FZCA 4D6RA 4EZ4A 3AVSA 5FUNA 1VRBA 2OQ7A 3DXTA 3LD8A 5FZOA 5FYTA 3K2OA 2OQ6A 2YPDA 3UYJA 5F3CA 2OT7A 4QXCA 5FPLA 3OPWA 3AVRA 5A7WA 3PU3A 5FZKA 5FZ6A 5E6HA 5FV3A 2Q8CA 4EYUA 2WWJA 3KVAA 5A1LA 5FZ3A 2GP5A 5FPBA 5IVEA 4TN7A 5LWBA 5FZ4A 2Q8DA 3PUQA 3U4SA 5F3GA 3KV4A 5F32A 5A1FA 3DXUA 5FP4A 5FZGA 5F37A 4CCJA 3PURA 4Y33A 4UF0B 5FYVA 4BISA 3NJYA 4BXFA 4IGQA 5A7QA 5A3NA 5IVBA 2PXJA 4CCNA 4BU2A 5IW0A 4URAA 4LXLA 5IVFA 5FUPA 5F5CA 4CSWA 5LY2A 2GP3A 5FWJA 3PDQA 5FJKA 4D6SA 4XDPA 5A3PA 5FZOB 5F3EA 5F5AA 5FY1A 5FZAA 5FPVA 3KVBA 5FY5A 4LIUA 4V2WA 4CCOA 2XDVA 2XUEA 4HONA 5A7WB 4V2VA 5FP9A 4C8DA 2WWUA 4AAPA 3PUAA 4DO0A 5F2SA 5FYMA 5FYYA 5FYCA 5FP3A 2W2IA 3PUSA 4GD4A 5F2WA 4DIQA 3N9NA 5IWFA 5FYUA 5FZDA 5FWEA 5FYSA 4ASKA 4QXHA 2VD7A 5FY9A 3N9LA 3AL6A 3N9PA 2YU1A 4GAZA 5FZFA 3ZLIA 2YBSA 3N9QA 5FYIA 5FZLA 2YU2A 5FZMA 5A3WA 4EZHA 5FP8A 5FXZA 5FXWA 2YBPA 4CCMA 3N9OA 4QXBA 4QU1A 3K3NA 5CEHA 5FBJA 5FY4A 4GJYA 5ANQA 2XMLA 4Y3OA 5FZ7A 4E4HA 3N9MA 4CUGA 3K3OA 4GJZA 5F5IA 5FXVA 2OS2A 3RVHA 3LDBA 4HOOA 4QWNA 5FZHA 4IGOA 5FP7A 5FY8A 5LY1A 5FJHA 3ZPOA 5KR7A 2XXZA 5FZIA 4LIVA
chains in the Genus database with same CATH superfamily
2WFF2 2ZJCA 3KLSA 4NPLA 1POV1 4YVWC 1I1EA 2WL1A 2R1DA 2J1UA 2EA7A 4YPJA 3ZYBA 3CJIA 2DVAA 3H3ZA 3AMQA 4PT6A 5JOXA 3O1TA 3NV2A 3VV1A 1QDCA 2E51A 4P02B 3AK0A 1HN0A 3KV9A 2IXKA 5FLJA 5FRAA 1OBNA 1WCUA 5A6ZA 5A7OA 2ZBJA 3IMNA 1MS3A 3IDEA 3FHAA 2CU5A 4LHLA 5FAXA 1MS4A 1UY0A 2WNVA 2BOIA 3NAPC 3CHXA 4LKDA 4D7SA 4FPYA 1O4ZA 2BVBA 1SG3A 5ACA1 5FYHA 4BWOA 3KD4A 4I30A 2HWB2 2VVEA 1MPXA 3R4SA 4AFBA 3F95A 1YNAA 3RJ2X 3HAGA 1OFNA 2Z5WA 4Y4YA 3GHMA 1CONA 1HXS2 1W9FA 3ZYRA 2ZXQA 4EWDA 3I54A 3TWIA 3GZAA 4TZDA 3C8XA 2ZEWA 5FPLA 3AYCA 4ET7A 2WZR3 4GB33 3R05A 3OUJA 1R1ZA 2WO3A 5LBCA 1GOHA 4A42A 2WWJA 1JW6A 1ZBA3 4AFMA 3WG4A 2QQWA 1JN2P 4LHKA 2A6YA 2JG8B 2EICA 1FMD3 1C4RA 1WBLA 3GYDA 4R9DA 3S0MA 1HJGA 2X5IB 1VBA1 2ORZA 1JYWA 3KZ4C 2WNUC 4GZ9A 1LHUA 1IPKA 3SISA 3DPRB 1EP0A 4CPBD 1LU2A 4NRMA 3RFRA 1ZVFA 4BK4A 4IGQA 4RS5B 2ZA9A 3BUCA 2JDMA 2CY6A 2OUHA 3JZVA 3LIHA 5J3UA 3N7LA 2W92A 2ZKLA 3WV6A 4RGAA 2D3SA 3V65A 1GZWB 3WG3A 3N3HA 3OPZA 3DL3A 3USUB 4CU9A 4D6SA 4XDPA 3V0BB 1RUNA 3ZYGA 4Z1VA 1U5XA 3B7MA 3TAYA 3KVBA 2BGOA 5FY5A 5KHGA 1G7YA 1AX1A 2ZZJA 1XBFA 3I59B 3ZXEA 2MPFA 3MUY1 4QPGA 4BQXA 1L7RA 3IDCB 1AYN2 1OQDA 1X36A 1WLCA 4XPVA 4XJ8A 1S0GA 3OD0A 5JDBA 2DU0A 4Z07A 1Z78A 1RB8G 3O12A 3PJQA 4A44A 4XUPA 4AI3A 4P00B 4DIQA 1R1A2 5FYSA 1QXRA 1SMVA 3AZVA 1D4M2 3AYEA 4L9BA 4AQTA 5EQUA 4QDRA 3E97A 2HLEA 1ZYBA 1NCQC 2VOTA 5DDJ1 3I2FA 4GAZA 5F6KA 3LA2A 5BV6A 4NROA 5A6YA 2P1BA 3N9QA 5IATA 5HXVA 3T2TA 5DAXA 4NHKA 1W9SA 3WY6A 5FDBA 2WZR1 3LCPA 3MLLA 4GB31 2A6VA 4QU1A 4Z82A 4CEWA 5FY4A 2D6KA 5A33B 1AR63 1QJX3 4CVUA 2D6NA 1IZ3A 2VW0A 2R043 1NLSA 2RM22 4LBQB 2WQZC 1AR83 4W6YA 1U5IA 5ERLA 2OS2A 2VUJA 3I8TA 3B94A 1FMD1 2Y6HA 3Q8FA 3ILRA 2ADEA 5H9PA 4DNYA 1RINA 2FQPA 1BEV2 2WO1A 1ASJ2 1S2KA 1XU2A 1CZVA 3PUIA 4LA2A 4R4XA 4LO5B 2DUQA 4BDVB 1WLWA 3RS6A 1KEXA 3ZIWA 4AQ2A 5JOWA 1NG0A 3OBRA 4LIVA 3NNGA 4LK6A 3WX5A 1GWMA 1OT5A 4QHOA 3ZSEA 5BNPC 2VXRA 1ACCA 4CTEA 4COZA 3AB0A 2ZGSA 3O0WA 2GU9A 2PHDA 4CXYA 1RUOA 3IBMA 4WVMB 3B02A 5C3PA 3OEBA 5KXEA 1CAWB 4AVTA 4QHBA 4EN6B 4K9SA 3CL1A 4B7EA 2W47A 5CVRA 5IK7A 1AYM3 5FZ0A 4BQ1A 1ULEA 3T2PA 4YW1A 2DCJA 1CN1A 3WQBA 3H1YA 3WXPA 2NM1A 2VOVA 2UYAA 2FDFA 1H9PA 2W39A 3H3UA 1AXKA 1DCSA 1O8PA 1FYUA 5EJ3A 3FE5A 3WEZA 3M2MA 3K4AA 3SH3A 1CQ9A 2R30A 2XVGA 1RXFA 4WVWA 4AEDA 3VDAA 3VD5A 1GZCA 1F31A 1VB2A 4O9EA 4ISQA 4RR3A 3KVAA 2D40A 4RFT0 3AJZA 1J59A 4CCCA 2AUYA 4PHZA 3WUDA 1VAMA 4UFMA 1AR61 5HBAA 3KV4A 1E5IA 2R041 4NOTA 4ARXA 3DXUA 1AR81 5A1FA 1UD1A 3ABZA 4P5HA 4PIYA 1BMV1 2C0ZA 4C91A 1W6NA 3T4HB 3AKRA 2D6PA 2CGPA 1RMU3 4UF0B 4BISA 5I93A 2BVVA 3B9CA 1UMHA 1EV13 2ORXA 4R9AA 4Y20A 5CYYA 4XFIA 5EYXA 2GMEA 2D43A 2VPVA 4IE0A 5F9TA 5JSOA 3IB3A 1FNYA 5A3PA 2QZ2A 1F8VA 1OSGA 1VJ2A 4F8AA 4NHXA 4NIAA 3WNPA 4XC9A 1S0FA 1XNDA 1AJOA 2VNVA 2W3JA 4HONA 3VD3A 4ZY9A 1RVF3 2VZQA 4OLLA 3ZX7A 4I01A 2XONA 3URFA 1XJAA 3VZMA 4XACA 1AYM1 4D7TA 4JC1A 4CE8A 5FP3A 5JWPA 4XOGA 1LGBA 5FMOL 4PLOA 2D5HA 4K7JA 2LRPA 4XQ4A 4D94A 3BU0A 4Y22B 2QQNA 1N3QA 4QPIC 1M4WA 1OLQA 3DKQA 5FYIA 2YU2A 5FZMA 3VBFA 1DQ4A 3HNMA 3VKNA 5CADA 3ZN5A 4META 1VALA 5CA6A 2GH2A 3U0ZA 5LBEA 5DG1A 3JD73 2WDBA 1WMEA 2J22A 3FJSA 1SEFA 1V6JA 2W68A 3KCYA 3DF0A 3ST7A 4CXXA 4DEQA 1ZZ6A 2BPA2 3THPA 1EUUA 4DXTA 2QQPA 2FMYA 2VZPA 2HWD1 4FPKA 1AR72 4PBOA 1S55A 5F1RA 4LEJA 3GXUA 3OD4A 5CB7A 3TN93 2GDFA 2GALA 4AHZA 3NAPB 3N4MA 1W6OB 1ST8A 1NA1B 3N36A 1RMU1 3LA3A 5CKQA 2RS33 1K5MA 4X6RB 4AI8A 1SQ4A 3ILNA 5ABJB 1EV11 1EPZA 1EY2A 3E5XA 3FLRA 2R6QA 1NZIA 1OKOA 4IEOA 2JG8A 2WZR2 2XJSA 2X5IA 3RI9A 4QGMA 2NQYA 1ZBA2 4XFFA 4BQ5A 3AL5A 3VDDB 2XG3A 3DPRA 4MG2A 4Q0VA 1H2KA 2YB7A 1FMD2 3T4VA 1VB4A 5LK7B 4KQ7A 1DBNA 1FV2A 1RHI3 3LFMA 2KA3A 4UFLA 1LHWA 3LPGA 3WP6A 3ZFEA 2BWAA 2ZAAA 4M4RA 1X8MA 3ZR6A 2UYBA 1ULOA 4O65A 4CDWB 4ISRA 2XL7A 3KCCA 3T1MA 3ILFA 4DXZA 3V0BA 3IMMA 1W03A 1WW6A 3KWVA 4KWUA 5F3CA 1UW8A 1Y9GA 3I59A 3PU3A 4CDQB 4FVVA 5C3OA 5FV3A 2Q8CA 3JD71 5B4NA 1V00A 1MQTA 1WW5A 1WWYA 4AVCA 2R49A 2I07B 5H9SA 1RUE2 3U4SA 5JXHA 1FNZA 3HR9A 2AH2A 2R0HA 4HBNA 3B93A 3TN91 4IE7A 4OYUA 3N7JA 2B45X 4AGGA 3HEIA 2ZAHA 5E1RA 3U11A 1EUTA 1OH4A 3L2HA 4EJRA 1ZA7A 3ORJA 2RS31 3N7MA 2G1MA 4U2AA 3ZSMA 5LY2A 3P3NA 4AEMA 4C1XA 1OLMA 5JUVA 3ZXKA 1ZRRA 5A33A 1O59A 1H9WA 3PDQA 3UKNA 2UWBA 2XWBB 1H1IA 1OF3A 4KBZA 3CEWA 4E2SA 4YM2A 4QPGC 1IG3A 4FPGA 3NJZA 2XUEA 3WP5A 3RYRA 3ZYPA 1OPMA 2SLIA 1UZYA 1QJX2 1X50A 2XB6C 2ZGUA 1REEA 2R042 4ZZ5A 1AR82 1VRH2 1F9KA 4XAEA 1DQ2A 1LESA 5L9BA 1F2NA 3AP7A 4BM8A 1RHI1 2CHHA 2JENA 3ACHA 4JGZB 4QXHA 4Y26A 5FY9A 3H8UA 3I2KA 4Z8BA 4F7ZA 1E5RA 4P14A 4MOAA 3ZO0B 1UX7A 1JU3A 1Y4WA 3OEAA 1SLAA 3ZLIA 4OHWA 5EIYB 1FPN2 2A71A 3ELNA 1QH6A 1RUH3 4E4SA 2O8OA 1DYKA 3OTFA 4CEWC 4DFSA 2G9GA 3PIGA 4XURA 2JB4A 3I3QA 3BN6A 4FPLA 4O9GA 3VHOA 1YJLA 1X9TA 2ZX3A 2P6CA 4QKDA 2OUJA 4CDXC 2GNTA 2WT1A 2ZGMA 1AYM2 1SACA 1AR91 3FBMA 4GMP3 1CVNA 4OUMA 1UZWA 3HWJA 2OPWA 4MHUA 1C3HA 1I3HA 2VGDA 2QVSB 2AC1A 2VM9A 2ZGRA 4KH9A 1GP6A 1C57A 2VECA 3WVJA 4EE2A 4URTA 2AYHA 5FOJB 2Q8EA 2O1QA 3GZUC 4NIDA 1OKQA 1KFXL 2BZDA 4JTOA 3E6CC 3QH7A 3LDRA 4QX2A 1OH3A 5A3TA 3U1XA 3RPQA 4QB1A 5FXXA 3GJBA 4CCLA 2WSVA 3ACLA 3WDXA 4LTAA 4XDOA 2WR9A 2EXJA 3VBSC 3JBG3 2J42A 4OUEA 5KBFA 1XQNA 5K4LA 1QU0A 1KRIA 2QQUA 2WAAA 4CP1A 3EB7A 4ONUA 2GSYA 1WZXA 2XUMA 3PVOA 4QX7A 5IVJA 4P9IA 3RZZA 4UF0A 4WM8C 3QH6A 5GLVA 1HRI3 3TOJA 4ZONA 3WDYA 2F4PA 4NHYA 2D98A 2A73B 1ZA4A 2VL4A 2KXLA 2PHRA 1HRV3 2PA7A 2PQSA 2P17A 4PDWA 5A7SA 3VHRA 4OCTA 3VBHA 1WD3A 2WAOA 5JZGC 5A3UA 3DXTA 4AEDC 5FK8A 3LPFA 1W8HA 1DU3D 3DUIA 4OFGA 4FPJA 1C5HA 2BEOA 4QKNA 3ZFGB 1RUH1 1NKGA 2LTNA 3H0OA 4IEUA 4EYUA 5J96B 1JYNA 1RUG2 3ZIXA 1I9RA 2P34A 2YFZA 5FZ4A 2VCCA 1WCSA 1RVF2 4XUQA 2EVXA 5FP4A 4NVPA 3O0VA 5CFCC 1IHMA 5DAQA 1WCQA 4GMP1 4XCBA 5DABA 4CP2A 4N90A 5K8SA 1N3OA 2FCUA 5IVBA 4C90A 1JHJA 4K20A 4YW3A 2QTWB 2E7QA 2WIIB 4CCNA 3BCWA 3LE0A 2IVJA 4CSWA 2XGXA 1AL23 1H8TB 4RL7A 3R4UA 4IEYA 2RE9A 3JB8A 1PZ8A 2QQLA 1O5LA 1W8OA 2BW8A 3HQXA 1YXWA 4FQZA 2BU9A 4A4AA 2RR13 3INAA 2V4AA 4X8PA 3PTYA 1J84A 5F7UA 4BQ2A 1PK6B 3JBG1 5JI9A 3AM2A 4W4ZA 5K0UB 3S5AA 4BMBA 3ZYJB 3LAGA 1F5JA 3EBRA 1W6OA 4QAWA 3VD9A 1Q8PA 2ET7A 4UBGA 1NA1A 1AZDA 1Q43A 2X29A 4OQ9A 3T2QA 5FYCA 2GMMA 5LRRA 3BKZA 1HRI1 3TN92 2XBO3 5C3RA 2FDGA 4DY3A 4I02A 5GZEA 3WNLA 4OULA 5ABJA 3BODA 3UK9A 4QQPA 4FAHA 3AP5A 3WQ7A 2YHJA 5FO9B 1AUYA 2XPJA 1MS9A 3VBFC 2PYTA 3CMGA 4XF3A 4XDQA 5DZFA 2GC1A 1G9AA 1GZ9A 1OVSA 2BFUS 3WF4A 1PM7A 4FFIA 5DQ0A 2LW8A 2WC2A 2VZTA 3K3NA 4LO7A 3VDDA 2BGPA 5A6QA 5C9AC 3VBOA 4P9WA 4YYOA 1ND2B 1L7LA 5D8AC 3ZYIB 4QPWA 4NJ4A 4XVHA 4L8QA 1LJ7A 1FAYA 5FZHA 1NX9A 3U14A 3ZXAC 2K0GA 2JD9A 3JB4C 2OW4A 4YFWA 1W2NA 2P3IA 4QKFA 1RHI2 4CDWA 1MVEA 1K5MC 2XVKA 4LK7A 1VP6A 3OSDA 1ND3B 3AP6A 4QU2A 3HOBA 1W6PA 1J1TA 4HETA 2DVFA 1AVBA 4IV3C 4CDQA 1QJZA 4AWDA 3UNPA 1AL21 1IQDC 1DF0A 5IAVA 3WF1A 3OY8A 3VHPA 2AREA 5JXIA 3NV4A 5CKNA 5I0UA 5EXOA 2XJQA 4D0QA 2JDZA 4L2NA 1JHNA 3EQEA 4QDSA 5T54A 1MS1A 4E8CA 5FOBB 3PU8A 2Y8KA 5FZEA 5JLVA 1FX5A 1K12A 3O1SA 3WNXA 4CP9B 3ZFEC 1CPMA 2K9ZA 2VMIA 1DHKB 2XBO1 4FOWA 5T50A 4YM1A 3H1WA 4K8RB 1DGWX 4X8NA 4D6RA 2VZ3A 2DUOA 2CSGA 3DECA 4Q1PA 2JDUA 4OZOA 2OQ7A 2ZZQA 3KHBA 4XUNA 4IXLA 3HQUA 1QJFA 4DRVA 3UT0A 1OF4A 1LOCA 2QUOA 1MQTC 4XW3A 4XUOA 3TNPB 4H7MA 3J9SA 1MZ6A 3GM8A 4UFJA 4G3YC 3TB0A 3K77A 2XLFA 4BMEA 4HANA 1YJKA 3LKJA 5EHDA 4YZ2A 5FREA 2WNOA 2R062 1UZVA 4COYA 4NIIA 1MEC3 1UKRA 4N43B 2OXBA 3AJYA 4S2FA 2ZPXA 3HJRA 4JGZA 5GLTA 1XE8A 2D97A 2R0FA 1SFYA 3MIBA 4GH4B 2VMCA 4WM7B 1RUJ3 4FP2A 1RUF3 3ZSJA 1JS9A 1PGW1 1NZCA 5HCAA 1LU1A 2G9ZA 3GBGA 4NRPA 5A7QA 1UN1A 2O0OA 3DKWA 2ID4A 4LBMA 4QX5A 4IDZA 1UY4A 3HIFA 3W58A 5FLHA 4KG8A 1NOVA 1OLME 1ZBE3 4YG3A 2A3WA 4B4QA 4P9YA 4ZZ8A 3BGAA 2FCVA 1ZZ8A 1TNFA 1XNCA 4QB2A 2P3KA 1O7FA 1MZFA 1RUH2 2CGOA 5FZAA 4MXVA 4JDMA 2H6CA 4FTBA 3ME2A 1AF9A 5APAA 2D6OX 4DPNA 4PI2A 5L73A 3D3AA 4XFCA 4AAPA 3RQ0A 2VULA 1NY71 3JCIA 4W50A 2RMU2 3ZFFC 4DO0A 4GWMA 5IFTA 4FP3A 1OVPA 2IZWA 3WF2A 4EWEA 4YZ5A 3IT8A 1VE0A 2VOKA 2VD7A 4UW5A 2A6WA 4M01A 1KITA 2BBAA 3BTXA 4PLNA 2GZWA 3MGUA 2NMNA 1LEMA 1W3XA 4HVOA 3EMRA 4EZHA 2JG9B 3PVBB 4N53C 1SZBA 1NUKA 2B42B 1GBGA 2XR4A 1W9TA 4PCRA 3ALQA 1D2QA 5F8PA 1QMJA 4Y1YA 5LBBA 4QQHA 3VZOA 3G6JB 4AG4A 4HN0A 1PVXA 2JWPA 3UJOA 1CESA 5GZCA 4CEYB 1MEC1 3WHUA 4P9XA 4M0NA 5ACA3 1OUSA 1EAH2 3MIHA 1YI9A 1HRI2 4RD7A 4BCUA 2EIGA 2WBKA 5LY1A 1H8VA 1RUJ1 2BNMA 5HCBA 1HRV2 2OKXA 5IK8A 5EYYA 1UPIA 4DQAA 3M70A 4JHZA 2CAUA 1QGLA 3ZFGA 4HG6B 1BHGA 2QQJA 4LQRA 3RNSA 1ZBE1 1AJKA 1GR3A 2GN3A 3WZ1A 4DUXA 5CFDC 3SKVA 2P37A 1UY3A 3HNBM 3UKVA 1NT0A 1R64A 2HWE2 1VBC3 5DAWA 5FY7A 5B4XA 1IS5A 4M3CB 1XXNA 4JX0A 5CU1A 1COV2 3OBTA 4XTPA 5IFPA 4EN8B 5IVYA 3KV6A 2P5BA 3NVCA 2EAAA 4OVEA 1JYCA 4FPFA 1B09A 3SKJE 4BQWA 4CCDA 3VKMA 4GXLA 1GUIA 4H14A 3VBHC 4GMP0 1G6NA 4MSVA 1POQA 4PF5A 2VZRA 3TEWA 1SLTA 2VMGA 2YBKA 4INDA 4ZHNA 4BOWA 1V9U3 3H8OA 3IM0A 5I0SA 4XZUG 2H6BA 1VRBA 4Y5TA 2UWAA 1UZZA 3ZXJA 1UYYA 5KC5A 4K6BA 3N7KA 4NMIA 1OC1A 4E4ZA 2H0BA 1ZZCA 1NCRB 3J7MA 5K0UA 1LR5A 3RDIA 4C0BA 1UWWA 5IUQA 5A70A 3AZWA 2Q1ZB 1B35A 2JXAA 5FZ3A 2RR12 3OYWB 1R081 2ZABA 3PMSA 2Q8DA 3TRSB 4W8JA 1JZ6A 1OA3A 3MUZ1 4CCJA 2DCKA 4O61A 3ZOIA 4YVSB 1CAVB 2XBO2 3LEKA 3NJYA 1QXPA 5A3OA 2HH9A 1NAEA 5FFOC 3PL0A 5C4WB 3MICA 3SQOA 3I3MA 1QF3A 2DVDA 5DDJ3 2A75A 4AK3A 1UU6A 4FPHA 5BNQA 1RUC3 1FOD2 3UETA 3APBA 3ETQA 4AHYA 4CP0A 5CBLA 5FZOB 4D8MA 5F3EA 1ND2A 5FKBA 3KF3A 3K4DA 1W06A 3SCGA 3M3IA 1VBC1 2JD4A 3CLPA 3MW3A 2PFWA 4L0PA 4ZKTB 4XXAA 4UW4A 3EHKA 3LIGA 2RS53 3FZ3A 2VZVA 1KS4A 2V4VA 3PVNA 1ND3A 2J1SA 3UGGA 5A6XA 4AVVA 4ES8A 5I8TA 4NWWA 3O1MA 1WUVA 1GOGA 4ZU5A 4E2GA 5SV8A 1WA6X 3AL6A 2OYZA 2AENA 1ULFA 1ONAA 2VZSA 1V9U1 4G9SB 1IKQA 1UYPA 1S2BA 1JUHA 4LUKA 4AE2A 1LOGA 2DV9A 5FXZA 4I0BA 2V5YA 4JGYB 3TEYA 1LODA 3IDAA 3VBOC 4BPZA 1UQXA 2W91A 1LEDA 5JMCA 2RJKA 2XJVA 4E27A 5BNOB 4AFAA 4N7UA 3CZJA 3POEA 3N9MA 4NWVA 2VVFA 4OI1A 4CUGA 4CP9A 3AP4A 1NY72 1S0IA 3LDBA 1CPNA 1ZRCA 4FAGA 5FP7A 4R9BA 5AFBA 3J4UH 4P9GA 3KHCA 3K48A 3OUHA 2GNDA 4Y5Z0 4A7ZA 1RITA 5K7PA 5LW9A 4SLIA 2DTWA 3B3QE 2Y6FA 2PAMA 5H9RA 4RHV3 1DYPA 1GU3A 1SFPA 4J25A 4MXWB 5IVVA 1RUC1 1SLLA 1KFUL 2DU1A 3DGTA 1CX1A 1OA4A 4CDUA 2DTYA 2OVUA 2VUAA 1PO23 2Y0OA 3EO6A 2ETEA 3ZMNA 4N43A 2ZOEB 3RMXA 2VBPA 3KMHA 5JI7A 3RYPA 3VBRC 5A7NA 1UX6A 1MEC2 2ZEZA 4HSJA 5FMBA 3RZGA 2RV9A 3MF6A 2AGSA 4OMCA 2RS51 5JPMB 5DXDA 1OOPB 1RUF2 1PGL2 1UO9A 1J58A 4LITA 1PMIA 1VMHA 4DY5A 2WS92 4HKLA 2EIEA 4LO8A 4A2UA 4R9CA 1AXZA 1CAUB 3G7DA 3HBZA 1X82A 4JRAA 4KWLA 1I5ZA 3ZDSA 4IEWA 1ZBE2 4IE6A 4LKEA 4M4PA 4XABA 1WBFA 1K45A 5AVAA 1E57A 3N35A 1C8M3 3S7EA 1XE7A 4ES9A 5C8CA 3NWKA 2O8QA 3AMNA 4HKWA 5C3QA 3WDWA 1H4HA 3LF7A 4U36A 5AC93 5FZGA 1LECA 2D93A 4HN1A 4Q4Y3 1GWLA 1LNSA 2FZ2A 4XIKA 1DQ5A 1G9CA 1WD4A 2ILMA 4JHTA 2QQVA 4QT6A 3VD4A 2V09A 2XKOA 5EWSA 4K8FA 1H6XA 4BU2A 1V70A 2JG9A 4LXLA 2QBXA 4ZU7A 2XJPA 2ZMKA 3SNMA 3FUOA 5F5CA 2E31A 3RG0A 4RHV1 1G9BA 1CIYA 3SXWA 4S2HA 1GKBA 2IUWA 4YZ3A 1XYNA 3AZZA 4LIUA 1HLCA 1PO21 4V2WA 2B39A 3KGLA 4CEYA 1QJU3 4HFSA 4V2VA 3ES1A 5I0RA 2BFUL 2HWD3 1YQCA 3PLQA 5KXCA 5LEKA 3CKHA 3ZXGA 3FWEA 1GQPA 3QBQA 4XF4A 5IT6A 3KB5A 1GWKA 2ZX2A 4Q5OA 1H4GA 2WT2A 5ACA2 1KQRA 5FYUA 4AHXA 3T0DA 1V6OA 2GNMA 2BP6A 3D8CA 5LK5A 2YXSA 4YW6A 1PO13 3EJKA 3ZKUA 3U4XA 5HV4A 1JYIA 2HJIA 3I7DA 2G4IA 3AX4A 5CNAA 2CDOA 2DUPA 4XQDA 3O1OA 2A7AA 3RZLA 4M3CA 3SEEA 1YIPA 4XETA 2UWCA 1C8M1 3E6DA 4AR2A 2ZHLA 3AP9A 1MACA 2JB8A 1DGWA 4PJYA 3VBUC 4QM9A 3WDUA 3GZEA 3WF3A 2BJSA 2JKBA 1VBA2 2R071 3BIWE 3T3YA 4XFGA 5AC91 4Q4Y1 1X33A 2PMWB 5A1AA 4OQ8A 4RQPB 1YQ8A 1YI7A 3FFZA 1GOFA 2PN5A 3IIIA 3VKFC 4YM0A 1D0GA 1JZ5A 3U07A 1BJQA 4QM8A 1BLZA 4LUMA 2XQXA 3VN4A 3ZSKA 3ATGA 3HQRA 1POV0 1O91A 3LDKA 2XOMA 5BNNB 1MS8A 3VHNA 5C33A 1JYTA 1JOPA 2WWSA 2GC0A 3ETPA 4YVWB 2ES3A 3OYWA 4Y4RA 2JDNA 2VZUA 4IL7A 2BYVE 2RVAA 4IV1C 2MNGA 1GLHA 1OFSA 3CNAA 2ENRA 4D6QA 5DMYA 5L7OC 3POFA 1H2MA 1QJU1 3M3CA 1J3RA 5L9RA 3CQOA 5FYBA 2VZOA 1HB3A 3OPTA 4IEPA 4YVSA 4UYBA 5GZDA 4YM3A 2VNRA 3AZXA 1QOSA 1TEIA 2YPJA 3BALA 5C4WA 4B29A 4B1LA 4MZUA 3RSJA 2LALA 4AL9A 2C4XA 5FZBA 1H1MA 5FZCA 4TLGA 1EPWA 2VOWA 3AYAA 5GLWA 3CJIC 3PUHA 1HQWA 5FZOA 1PO11 5DDJ2 1YHFA 2BOJA 5C3SA 2XLGA 3ZSLA 1T6GC 1B35C 1XB9A 1QDOA 4LBLA 3Q8AA 3V64A 1U12A 4GB32 4RGKA 1IPSA 5FPBA 2WNVC 1MZEA 1JBCA 4K1YA 4JKLA 4BLIA 1CWPA 3THCA 4Y5SA 4MGQA 3H9AA 2WQ8A 4MGIE 1ZZBA 3AC0A 4RS5A 2RS52 5KHIA 1GQGA 5DZGA 4BXFA 1BZWA 3FN9A 4B8EA 1HJFA 2WNUB 4XIOA 1GZWA 3NNFA 5IW0A 3D82A 4OHYA 5GM0A 1XNTA 3USUA 4Z2AA 4JGYA 3WSOA 5KHHA 5JAXA 1HB2A 2JIJA 4RA0A 1VBE3 2QQMA 2SBAA 1OPOA 2YY1A 4Q4W3 4QKBA 5BNOA 2WFPA 1YQ6A 4HLTA 4HMZA 1P8JA 1UOFA 1V6LA 1W0OA 3EXUA 5JIAA 4AQSA 2VVDA 5FP9A 3WG2A 3LB9A 1F4HA 1W3VA 2Q1MA 4TSVA 3VUOA 1AR93 5F2SA 5A3MA 1IS3A 4FOVA 3H8RA 1RTVA 4ASKA 5FZDA 4AXOA 1VBD3 2C26A 4RFRB 4JVAA 4TTGA 3N9LA 4MXWA 5FIXA 1Q8VA 3H7YA 3ACIA 4AFCA 2Y64A 2F4LA 2R1BA 4MADA 3MIGA 5FZLA 1DLCA 1XNAA 2NZ9A 4LO4B 2TEPA 5A3WA 5IK4A 1Q3EA 5IYYA 2XQRA 1S4CA 2NP0A 1NCQB 3AMMA 3VGIA 3LSDA 1W6QB 1XNBA 3NSTA 4LBQA 4IETA 5JPNB 1VBB3 4Y3OA 3ZVXA 3LOBA 3MIDA 4WVZA 1UAIA 2X53S 3IZOA 3K3OA 5F5IA 1AR62 4DEVA 1URXA 3HT1A 2VC9A 2BERA 2YZ4A 1UU5A 2C24A 1KJLA 1BMV2 1YYNA 3BOWA 1GQHA 1PVC1 1TNRA 1YO8A 4MGSA 1CAUA 2VG9A 2G9FA 2VU9A 4COUA 5FZIA 4YGEA 1I6XA 5LA2A 1GYKA 1YLLA 1S0BA 2RJ2A 1ZRIA 2B8MA 4ASLA 2EXKA 4WVMA 5JSPA 3UKTA 1DGRA 1CAWA 3VZNA 2QDRA 4LBOA 4XJ9A 3Q9OA 1VBE1 2ZMNA 4Q4W1 4DINB 3C7OA 5BNPB 1RL3A 1C8M2 4X6QB 1DQ0A 5K9YA 4FOQA 3BPZA 3FL7A 2WA3A 4W6WA 3OGRA 1MR5A 1DGLA 3WP4A 1QJY3 5AC92 3BIEA 2IFWA 1G8WA 3P1IA 2HWF3 3K46A 4OUSA 4Q4Y2 5M0TA 2FDIA 2BDRA 2JE7A 1UNBA 3AKPA 2ARXA 1VBD1 4EZ4A 3WCRA 3TEZA 1ZX5A 5FUNA 5CZKA 5FYTA 4ARYA 1VAKA 2A3XA 2VO5A 2ARCA 2OQ6A 3LSEA 4TLFA 4Z2WA 1IGOA 3SCFA 4KI5M 4MGYE 5FZ6A 5C8CC 1EYBA 2KD7A 3NO8A 2FBEA 3NJVA 4OHZA 3D6EA 2CYFA 4XJZA 4Q1RA 2MEV3 4KL1A 1VBB1 5JCTA 3LWCA 3OUIA 1QJU2 2W0XA 1RUD3 2VUDA 3PUQA 1GP4A 2HWD2 1GSLA 1HQLA 2OIIA 3R4DB 1C5IA 1QY4A 2ADDA 1QOOA 2DF7A 1UXZA 1OHFA 1XPWA 2XJUA 3C3VA 2VOXA 4KBBA 1Z0HA 5E89A 3MEPA 2WO7A 2PXJA 3POBA 3NNLA 1RMU2 2JDKA 1UXXX 2IXJA 2XL9A 5JXGA 5IVFA 2VMEA 5GZGA 1EV12 4LJHA 5C8WA 4BJ0A 4J6GA 4Y1XA 3POGA 3WW2A 4RR3C 3J8F3 3I49A 4YGCA 3FHQA 3NQHA 1QWRA 2LS6A 1O3QA 1YRZA 1Y9QA 5IAXA 1LHNA 1ODMA 3S57A 2JICA 3BPSA 2Y26A 2DCTA 1TMF3 2WJSA 3GZTB 1UIJA 1GNZA 1QJY1 2DFCA 3MIFA 1RJ7A 4Y22A 5LA9A 2HWF1 3BTZA 3OGGA 4XE9A 3H42B 2CV6A 1CAXB 1LOFA 4L99A 5DUWA 5BNNA 1XU1A 3UV9A 2ZGPA 1J83A 2Y6GA 4YVWA 2WT0A 2AR6A 3U37A 1NE6A 2DURA 5JMOA 4LE3A 4M3CE 5T52A 1OXCA 1HW5A 1KGYA 1BBT3 2Q5TA 3K4ZA 3KT7A 4HSLA 4QPIB 3I2JA 1OLRA 5FLIA 5EFUA 5KWRA 2D5FA 4GJYA 4XJAA 3JD72 4XFHA 4YSFA 1UPSA 2W5FA 2MEV1 1MS0A 3RVHA 1S0JA 3JQWA 1RJ8A 3VZKA 1RUD1 3NAPA 3RZMA 2OPKA 5E8AA 2X10A 5FMCA 4Y24A 1D4VB 2HEVF 2YGMA 2R7EB 5HPOA 2FD8A 3ACFA 3KT1A 5KR7A 3KF5A 5J98B 5FTTC 2Q4SA 2D3PA 3O5SA 2HBTA 2JDHA 3HD8B 3WQ0A 2PELA 1X9PA 1JOBA 2HYXA 5EJZB 3AXDA 5LRSA 2PLV3 2RS32 1VMJA 3DYPA 4YARA 2B5HA 2W1SA 4J1XA 3CJIB 3DCQA 3LQCA 4MX3A 3OBAA 4IGPA 1BCXA 2WKKA 4PF1A 5LBFA 2V73A 4BYYA 4LBJA 3J8F1 1HX6A 3CZUA 3Q8CA 1HV0A 4XUTA 1V6MA 3MI8A 4LT5A 3GBFA 3PTRB 4CYDA 2HEWF 3H3LA 4LOSA 2TBVA 4HK8A 1QH7A 2JJ6A 2WNUA 3BYWA 4PLMA 3W59A 2VTXA 3FLTA 1TMF1 4YWAA 4AHWA 1SCSA 2ZGNA 2EAKA 1UF2C 4HKOA 4YGDA 4AI9A 4YW2A 3ENRA 3WINE 3A0NA 4LNVA 3K2OA 5C70A 2W46A 2YMZA 4YFZA 5FK7A 2JG8C 4MGKE 1DQ1A 3FC0A 1BBT1 2X5IC 2UU8A 1NQDA 2LROA 2C1FA 1US2A 3ZDVA 2XHNA 3DPRC 4YG6A 2VBBA 5F32A 4JQTA 1PZ9A 1AR92 4PIZA 3PURA 3FHIB 4MV2A 1WA4A 2P2KA 3NMBA 1GNHA 2Y0IA 2ZHNA 3ZN4A 3K75B 3SCHA 4D69A 4K21A 5FUIA 1WCDJ 2V72A 2PLV1 4MO3M 2QQKA 1W8UA 3DV8A 4XXPA 4LA3A 1JZ2A 2WSUA 1Y43B 2I45A 5L9VA 3FBYA 5FMOS 2VQ0A 2CL2A 3NJXA 4DOUA 1H1AA 2Y33A 1LRHA 4JV4A 4C8DA 5JOZA 3R6SA 2WYSA 5KXBA 4B7KA 1YQ5A 4FBFA 4LKFA 1WW4A 4QPGB 3NV1A 1R1A3 1N1YA 2XWJB 3RRDA 4QGNA 3U75A 1JTZX 5J7MA 2ZX0A 4XQWA 1A3KA 2ZHMA 5DPNA 1HDKA 4DUVA 2E53A 3B69A 1BVP1 4RN5A 2Q8OA 1UY2A 2PHLA 1MS5A 2YU1A 3PMEA 4Y1UA 3IN9A 4KNCA 3AMPA 4IW3A 1OI6A 3MFCA 5T5OA 1G9FA 4LORA 2C5DA 2K2SA 4XFBA 4XZPA 4AGVA 4AQ6A 3KS7A 1W6MB 2E7TA 5I8YA 2ZGKA 3ITQA 4QDQA 2RM23 2EIBA 3IKWA 5ANQA 3WR0A 4CEWB 4JKKA 1J1LA 5GZFA 4IEZA 4XEZA 1N1TA 4IGOA 5I8SA 2E9QA 3OGJA 1QJY2 2J1RA 4XF9A 3ZPOA 4CDXB 2HWF2 1G9DA 5KHJA 1QQP3 4C1WA 3M1HA 1PIV3 3L2YA 3WNKA 3WF0A 3IDBB 5CIRA 4AI2A 3T0BA 2TUNA 1TZOA 1DQ6A 2ERFA 3PVEA 2ZACA 1IQAA 4L92A 1SDWA 1SDDB 3NL1A 3HNYM 2YG0A 1H6YA 3VLBB 4NIGA 1SBFA 1R083 3H50A 4CPBA 2NMOA 2V5DA 3JBG2 2JDPA 5F5QA 4EN9B 1JU4A 2GC3A 2VQTA 1MVQA 2HYKA 3LOIA 3VBSB 3VDCA 1R1A1 3GNEA 2F17A 1OA2A 4XBNA 3A23A 2QJVA 2FDKA 4WM8B 2ZCWA 3JUUA 4R4ZA 5CG8A 2UY8A 1UL9A 2D6MA 2IC1A 1DYOA 2WA4A 4LOTA 4A6OA 5E16A 5I0TA 5JR2A 1A34A 1TME3 2RG4A 3SHRA 3MV11 2YPDA 5JZGB 4QXCA 1GZTA 4LR4A 2QCSB 5FZKA 4TYSA 4AEDB 1OD5A 3HMYA 1YFYA 3ZXLA 4ATFA 2VE1A 1DP0A 5H9QA 3A7QA 2RM21 5IVEA 1H0BA 2DWRA 4DMIA 4FXGB 2Y6JA 3MYXA 2WN2A 5J1XA 2PHFA 1ASJ1 1Q8SA 1CAXA 4XJUA 3A21A 2B9UA 3I3EA 2VTXJ 1NQJA 4PDWC 3BTYA 2VQAA 3KGZA 4OHVA 5FYVA 3IAPA 1W6NB 2J7MA 5FMDA 3WLUA 3W5MA 1H8TA 1QQP1 1W8FA 4FI9A 4HL0A 2DVGA 2ET1A 3IPVB 5A3NA 5CFCB 5J36A 1PIV1 2R32A 3ZPYA 2X8KA 1K5JA 2YROA 4YZ1A 3I3DA 4BH9A 4Y20B 2OZ6A 2J1TA 4AVSA 3BU7A 1AL22 3AKSA 4Y1ZA 4E9KA 4F3JA 4GIQA 3NV3A 4P9JA 4E4DX 5F5AA 3W5NA 3P6BA 4ZS2A 1PK6A 5FPVA 3TYJA 3RYKA 4I3PA 2VCMA 1ZNPA 3WOGA 1O3TA 3I2GA 1DIWA 1YFUA 2RS13 3IWZA 1CD3G 3CJXA 4XHBA 1W39A 2ZGOA 2NPIA 4GQ7A 3USSA 1S0CA 4HVQA 4HZFA 4UFHA 3I2IA 3AFKA 2QQOA 5KHKA 1E5SA 5DUUA 5CG9A 1JI6A 4Q0QA 3U10A 3VZLA 5AFEA 4A7YA 1V6KA 1S0EA 2OA2A 5EPAA 4QHZA 4YNIA 4XJWA 2ZGTA 2GN7A 3C7HA 4MLOA 4UOJA 5LASA 2QKDA 2PLV2 1GICA 1TME1 2BRTA 5FP8A 4AAXA 1A8DA 1XYOA 2P4EA 3KCXA 1YCIA 3VBFB 2YC2A 2CWMA 3LZZA 4NAMA 1AXYA 3WW1A 5J09A 1AR73 4RYDA 5A3LA 5FZ7A 1YFXA 3M8LA 2K46A 3OGSA 1ALYA 3HBKA 4GJZA 1FV3A 5FXVA 1NA1C 2CTVA 1QEXA 4PI0A 1HV1A 5C9AB 5GLZA 1DLLA 4NHLA 4XFAA 4OI4A 1GNYA 5D8AB 2XKPA 1D0HA 1X7NA 2WUHA 4S2DA 5ABJC 3S5QA 1PGW2 1WKYA 1WMFA 4BZ4A 1O4YA 3MLJA 1YWKA 5D1IA 4FPCA 1CGPA 2I74A 3E5UA 4Q0PA 1K5MB 3I2HA 3SITA 1UMIA 2A70A 1GV9A 1GP5A 2GC2A 3ZYHA 1G86A 2W52A 3JQXA 4KU7A 3VDDC 4XBQA 3AZYA 3HPNA 1N47A 1WLTA 4IV3B 4LE4A 2XJRA 3SH4A 4B1MA 4BQYA 2VJXA 4CUBA 1ULDA 4CCKA 2OX0A 3NNMA 5HCFA 4FFFA 3ECQA 5FYZA 4XF1A 3HT2A 2RS11 1Y7BA 2YUEA 1K3IA 4QX8A 5FZ8A 3ACGA 3RZKA 2BGCA 2E6VA 5GJ6A 2P3YA 4CDWC 1BXHA 2LM3A 5FPAA 5DZEA 3GBWA 4CUAA 1JYXA 3S7IA 4CDQC 2VAUA 1K42A 2FMDA 4FOYA 3ZFEB 4EWAA 1ZRDA 1ULCA 1GFF2 1RUI3 2PHTA 2VBDA 5GLUA 5C7GA 4SBVA 2P3JA 3OF1A 1ENSA 1SFNA 4P9LA 4LLOA 1ENXA 1ULPA 4IEQA 1ENQA 1RUE3 2W94A 3MBWA 2E7AA 1CZTA 4YW5A 1AR71 3AFGA 5LWBA 1NLRA 1MQTB 4GH4A 1PX4A 5F3GA 4H3WA 5LZ6A 4WM7A 3BVCA 1N1VA 3F2ZA 4PIXA 1OUXA 5IHRA 2I2SA 2FDHA 2W1QA 3OJBA 5LATA 1C8NA 4JQRA 3QCWA 4QMAA 3C7FA 4NO4A 5LEJA 5J37A 1RUJ2 4JCKA 4LHSA 1M06G 4UXAA 4CUCA 4HK9A 4ASMB 3RJRA 5FUPA 1W6MA 2VR4A 3ZMOA 3AYDA 1PMJX 3D4KA 2ZHKA 4TWTA 5CAZA 4XCAA 4AI0A 1W04A 5J48A 3D0JA 1APNA 2GMPA 4HVRA 3WT3A 3UESA 5LA0A 3ZN6B 1JZ3A 4ZXKA 2VNGA 4I2OA 4ITCA 4QQ2A 4AF9A 1S2EA 4CCOA 1YEWA 4CU6A 1Q8OA 1ZBA1 2XDVA 4HPKB 4F83A 5A7WB 3AMHA 1UCXA 1DDLA 3M7AA 3H8XA 1Q56A 1YUDA 1OD3A 1VRH3 4LLFA 1US3A 2Z79A 4JGZC 4MGZE 3X29B 4CDXA 5SV5A 2RHPA 2R073 5F2WA 3RMYA 4GWNA 1GMMA 1MZ5A 1AX2A 3ZFFB 2HEYF 2RDRA 4OI0A 4EV0A 1QQP2 1NXD1 1FPN3 5KC6A 3BI3A 1PIV2 1SBEA 3FMGA 4WZFA 5EV7A 2Z2SB 5CKMA 4AI1A 5BUVA 4CU7A 4XF0A 1D2SA 3O1VA 1O4TA 1NLQA 1RUI1 4A3XA 4QXBA 4YLZA 3WG1A 4A7KA 5CEHA 1Z7S3 1F4AA 5CISA 1RUE1 4N53B 3VBSA 4Q4X3 1R082 2JE8A 5C5TA 5HCHA 4N7IA 1R093 2RDQA 4UWDA 1UMZA 4HOOA 4K3UA 3VKLA 4A6SA 4DRRA 4QQOA 4I0AA 4QB6A 4AOCA 1V6IA 4WM8A 5FBZA 2ZEYA 3FLPA 5FO8B 2EXHA 3L9JT 3RZJA 1H30A 3POWA 4PBPA 4QX3A 2RJLA 2CNAA 3ES4A 4MH0E 5JZGA 2VCAA 2B9VA 1JZ4A 1L3JA 1UIKA 2PHXA 3BOPA 1RC6A 4WBBA 5JOYA 3THTA 1W99A 4JAAA 5FZ1A 1SLCA 1CIWA 1XSRA 2ARBA 1KDKA 1TME2 5FZ9A 5BPXA 1QKQA 2GNBA 5A80A 1T6BX 1A78A 1TG7A 5F3IA 1JZ7A 4BXSV 4FSJA 5F39A 5FPUA 2YDEA 4N8MA 2DCZA 4BB3A 1QJX1 4AVBA 5CFDB 5FR3A 1VBC2 4UBHA 4FTEA 3ASIA 2GH8A 4CZSA 2CAVA 2JE9A 1VRH1 4H55A 3C2UA 1ZREA 1AL0G 4Q26A 4FFHA 4V1PA 4JDNA 4IQPA 5CFCA 3HVDA 1PZ7A 3IPVA 1HB4A 1W8TA 3POJA 4DB5A 1HN1A 1W0NA 3PNAA 4PDWB 1LENA 3ZFGC 3AVSA 3VBHB 3WNNA 3B5LB 1FPN1 1NXMA 2YC4A 1V9U2 1UU4A 1UYXA 3J7HA 1W9WA 4M0HA 3QOPA 4N9HA 1NCRA 2PQQA 3MLKA 4CRQA 3V0AB 2VMDA 2O14A 1RUG3 2ZX1A 3DN7A 2QDNA 4KG0A 1I5PA 4Q29A 1XSQA 1F35A 1UZ0A 1T2XA 2QE3A 4XTMA 2BWCA 5E6HA 2HKXA 4IE5A 1IPJA 5BYNA 3QACA 1Z7S1 3A22A 5I0DA 3CU7A 2NYYA 1QNWA 3NRUA 3FUQA 3MW4A 4Q4X1 4CXWA 2C9KA 2WZPP 2RS12 1R091 1CAVA 5F37A 1WLDA 4W6XA 3ROUA 4Y33A 4IUGA 5G04L 1H8TC 1ZZ9A 5DUXA 1C1FA 1LKNA 2AEZA 2W1WA 5DAPA 3OBZA 4QD2A 4O7XA 4LHNA 4URAA 5FPXA 1Y3TA 4NPMA 4L11A 4I3GA 4LMFA 1JH5A 1XE0A 3T1LA 1WGPA 5FWJA 1PK6C 1RUC2 5FJKA 5K0UC 3IAQA 5HXMA 1OQ1A 2BV4A 2C6SA 3SC7X 5FCCA 4QQLA 2A3YA 5C9AA 4AGRA 4Q27A 3OGVA 2Z4FA 5D8AA 1V6NA 4RSUA 4JTNA 4UI9L 1BVVA 2IXHA 2WRAA 2PAEA 1PVC3 1Q5OA 3DYOA 3CDZB 3N9NA 4A3ZA 4EN7B 4NIHA 3ZYFA 4AFDA 2WABA 3OCPA 3UGHA 3AKQA 2VZ1A 3OB8A 2A6ZA 2Y38A 4ZPIA 1DZRA 2YBSA 1AX0A 4IV3A 1WMXA 1W05A 1ND2C 1N1SA 1ZM1A 4I0WB 3CO2A 2AZ5A 2D3RA 1OURA 1RUG1 2E32A 2JEMA 4UW6A 1TQ5A 1J3PA 2KM2A 2WZ8A 2DDUA 3PJYA 4XYXA 4COVA 1RVF1 4E4HA 2AEYA 4FFGA 3VBOB 3RI8A 2DCYA 3W20A 3WDVA 4EN0A 4NRQA 3VL8A 1ND3C 1IS4A 3WQ1A 4NN0A 4ATEA 2DBNA 2Q0AA 1O3RA 3T2OA 3SMHA 1PHMA 2WLPA 4QX0A 4XAAA 3E6BA 4RGGA 4UAPA 4HXCA 4FXKB 3MIEA 3KQRA 4Q0SA 3RGBA 1SLBA 4MUVA 5KXDA 2FCTA 2FZ1A 1UYZA 1W6PB 1CJPA 1XC6A 4UT5A 1RUI2 4RHV2 1JODA 2VUCA 2XHKA 5ISLA 2RDNA 3KT4A 4OZXA 5JVVA 3LEIA 1VLNA 4B4RA 1LB2A 3OY8B 2GAUA 1PO22 2B46X 1XYPA 5A7PA 2EF6A 3M4FA 2OZJA 2JX9A 3GHNA 1S1AA 3WW4A 1OOPA 2CDPA 2R16A 1F5FA 4COWA 4XMAA 1W0PA 1LGNA 4KGGA 3MPBA 4NUBA 3WNOA 1CR7A 3VBRB 1XNKA 4AVAA 3GCWA 5DN2A 4NPRA 3S6PA 3TEXA 5EZWA 3POSA 2WINB 3LA7A 4GULA 3ZN6A 1JYVA 3I2DA 4CDUC 5T5JA 4BLJA 2ZEXA 1KJRA 2NN8A 4HPKA 1VIWB 1W2UA 2BNOA 2E33A 3AVRA 4GALA 4YW7A 5A7WA 4P5YA 3WHTA 3D5OA 4N43C 2R063 2HBUA 2JKXA 4GH4C 2G19A 4LBNA 2J1AA 4WM7C 1QJEA 1V0AA 2Q1FA 3ZFFA 3GGLA 4A45A 4LBKA 3ZM8A 1W28A 2R072 4IERA 5GKAC 3MZHA 1ULGA 1VR3A 2ZKNA 1JOJA 2UURA 3WP3A 1ENRA 2IXCA 4YRDA 2VW2A 2W1UA 2YFUA 1W8ZA 3W9AA 4QX1A 3I3BA 4XBLA 2L9LA 2BNNA 1PM4A 4JDOA 5T5LA 4N53A 1VMFA 2QFEA 1FI2A 5HI0A 4NHMA 4FTSA 4BK5A 1Z7S2 2RMU3 3NKTA 2ARAA 4Q4X2 2WLQA 5A32B 3C7EA 3OOXA 4Z92B 2HWC3 1R092 2D44A 1UY1A 4IEVA 5L36A 3PHMA 4G4FA 2W2IA 3DYMA 4GD4A 3MO4A 5IWFA 5FWEA 5B2GB 3LFIA 4R52A 2JG9C 3N9PA 2VH9A 2FDJA 4K40A 3GDBA 1YQ2A 1ODNA 2CWSA 2JDAA 4ORFA 5FZFA 1PO12 3MW2A 3KM5A 3M3EA 2AACA 2YBPA 3CF6E 4UFKA 3VD7A 5CFDA 2ZTNA 2X05A 4CEYC 4DXSA 5G05L 3MDPA 2R061 3SLIA 1SLIA 3KSCA 4BQ3A 1NYWA 3WNMA 4BIOA 4E8DA 1EAH3 2NLRA 5T55A 4NR1A 4JKMA 4RQPA 4AEJA 2D6LX 4JZRA 1QHDA 5FJHA 4C0HA 3VBUB 2XXZA 2LUWA 5LA1A 3AXEA 5DAVA 3WDTA 4XILA 3UGFA 3V0AA 4K1ZA 4OMDA 5FY0A 3RZHA 1LCLA 4QGLA 2WN3A 3U78A 3O0XA 2EALA 1F15A 5BY5A 4GWIA 4M00A 1QNYA 2HWE3 4Q4V3 4GWJA 4BA6A 3O7OA 1D7PM 3J26N 4LULA 4WZCA 1PMHX 1BYHA 1COV3 1O8SA 4J1WA 2CGNA 1SPPB 3WW3A 1UOJA 3KV5A 2VNOA 3P3PA 2QNKA 2RMU1 3MFAA 3NW4A 3RWKX 5F6LB 4IV1B 3ZR5A 1LULA 5EJ1B 4LBQD 5C71A 1O6UA 5L7OB 4NAOA 4AZZA 2BTVC 3MF9A 2HWC1 1S0DA 2WQ4A 3AKTA 2YV8A 3BB6A 1OMIA 4LO6B 2VTFA 2WFF3 3WUCA 2IXLA 1UKGA 1RIRA 2WZEA 1PNFA 1NCRC 1NE4A 2DYCA 1XRUA 2BQPA 3H1MA 3LD8A 5FPZA 4A41A 5FQ0B 3T09A 3GJAA 3UL2A 1LAJA 3GCXA 1CJDA 1VAVA 2A6XA 4IESA 1WMDA 1PGSA 2PTMA 2GP5A 1DG6A 2X09A 1IG0A 3CIHA 5AVPA 4TN7A 1B35B 3I4IA 2IXIA 1YC61 4YVSC 1DFQA 1YFWA 4H7LA 4OI2A 1E5HA 2XVLA 1EAH1 1UOBA 5T3NA 5C4WC 2HWB3 4GKXA 4KGQA 3E1F1 4YGBA 2W87A 2WNVB 5D21A 5BXXA 2XJTA 1HRV1 3T08A 1OQEA 5D2AA 1SCRA 2JDYA 4DZGA 1PVC2 4Q8KA 3Q8BA 4GKYA 1ZRFA 1HXS3 1FOD3 3MV01 1X8EA 3THDA 1RXGA 3VB9A 3SEPA 3A4UA 3NKGA 1C28A 1TE1B 2A5ZA 1DZTA 3O14A 3S30A 3KQ4B 4Q4V1 2HWE1 4PQQA 2E26A 1REDA 4MVTA 5IJRA 3RWNA 3VKOA 3HN1A 1U5ZA 2DFBA 4FO9A 1W2TA 1VBE2 1COV1 4Q4W2 5L19A 5IK5A 4ZU4A 1O3SA 5C6CA 1RGSA 3OG2A 1VPHA 2Y6LA 4DUWA 1J3QA 5FKCA 4BE3A 1BK1A 3W21A 1HB1A 1BK0A 1YIFA 4RS5C 3PUSA 2VXJA 2DBIA 3VL9A 1SHWB 3M3OA 2TNFA 4DS0A 1FT9A 3H7JA 4I09A 1JMUB 2XLAA 2WFF1 4FCAA 3V56A 4FPOB 1VBD2 4JGYC 1LTEA 4TXWA 5JXJA 1STMA 1A6CA 1N3PA 1NCQA 4AW7A 1LOAA 1IS6A 2IFRA 1W6QA 4D3WA 5BNOC 5HV0A 3QD6A 1LOEA 1KD7A 1SBDA 2RR11 5FBJA 3JXSA 4QXKA 4MHRA 1LOBA 1QOTA 2P6HA 1AYN3 3TBDA 2BBVA 3NNJA 2VQUA 1W2OA 1U0AA 1W9YA 2Q30A 4Q2FA 1VBB2 2A1XA 2VY0A 2YGLA 1CX4A 3M3QA 2QQIA 4WV8A 5T5PA 3VBRA 1WW7A 5FY8A 3GF6A 3LEGA 2HWB1 2B7YA 1LHOA 1RYYA 2B4KA 2VMHA 5TSWA 1D4M3 3CBNA 2EXIA 1GANA 2PHUA 2Z42A 4Y1VA 4R8HA 1HXS1 1REFA 1FOD1 3EYPA 3ON7A 4FPEA 4UW3A 5I91A 1H2LA 1XOYA 3T30A 1IOAA 2BUKA 4P08A 3I2OA 5BNPA 2J1VA 1W8WA 4BQ4A 2W08A 2W9XA 4CA9A 4CDUB 1KXGA 4B3NA 4N9IA 4QPYA 3B01A 1H2NA 3A0KA 5DUVA 3FFQA 1A8MA 3K51A 1OOPC 2F6BA 2ZGLA 2N7GA 1BEV3 1ASJ3 3E5QA 2ZGQA 4Q8LA 1PNGA 4LPLA 4AYUA 2ZX4A 5ANNA 2WS93 2FHRA 2XH6A 1LHVA 4H2AA 1BKZA 3POYA 4KMQA 5IVCA 1HQNA 2PHWA 3BTAA 3QLQA 4YG0A 3T0AA 5C5UA 2H0VA 3LGRA 4CCEA 4BIFA 3J7NA 3SH5A 3DEMA 5DG2A 4D7YA 2MHFA 1QXJA 2Y6KA 3UYJA 3O1PA 2OT7A 1PX3A 3O1UA 3OPWA 2YC0A 5JSRA 3LEMA 4HT1T 2JIGA 2PAKA 4IEXA 4XMIA 3FX3A 3MHZA 2ZMLA 5A1LA 3R0RA 5A32A 3UJQA 1AHSA 1CZSA 2Y34A 2C9AA 4DXRA 4IE4A 3PIJA 1AYN1 5C8CB 2ATFA 4S2GA 4UFIA 1BQPA 2MEV2 2Y60A 3MPPG 1RUD2 4EROA 1C1LA 2HWC2 4YZ4A 2E63A 4FT8A 3ZKYA 3ZXFA 3WD5A 2W95A 1D4M1 1DZQA 1POV3 1Y9MA 2IWGB 4EQVA 2KR2A 3IIAA 4KWKA 5JR7B 4BHPA 2JECA 2Z69A 2GP3A 1KDMA 1JZ8A 1QIQA 3B9IA 3P5BA 2D7FA 5FY1A 3ZXDA 3HN3A 4Q0UA 5FO7B 4YW4A 2VMFA 1KS5A 4AEKA 2YYOA 3VZJA 2WWUA 2J1EA 3J8F2 4RR3B 3PUAA 2RDSA 4LKSA 3D0SA 3VBUA 5FYMA 2WO2A 5LB6A 3WCSA 5FYYA 1BEV1 3O1RA 4MYEA 4PQ9A 4MGTA 2IVIB 4OHXA 5EP9A 1RUF1 1PGL1 1JXNA 1TMF2 2WYFA 2VW1A 1O5UA 2EIDA 2WS91 3J7LA 4L97A 1WCKA 2WNEA 3Q8EA 4B4PA 4CU8A 1W2AX 2QZ3A 4KWJA 1UOGA 2VCBA 1Q8QA 1L7QA 4QPIA 3VDBA 1FATA 1SPPA 1IKPA 3C7GA 5FXWA 5GALA 4CCMA 4XHXA 3N9OA 4Q4V2 1HKDA 4GA9A 3B00A 1HIXA 1TVGA 2DVBA 3TNQA 4NE9A 2UY9A 1BBT2 4IV1A 5E88A 2XMLA 1W8NA 3I97A 4ZXEA 5L7OA 1ZZ7A 4WVVA 4FQ4A 5JIUA 1U5YA 1VBA3 1JUIA 4RQPC 3JU9A 4W65A 4QWNA 1FXZA 1DGRN 3POIA 1LGCA 1W90A 3GALA 4JRLA 4KU8A 1LOFC 4E2QA 4M3CF 5BNNC 5FQ0A 2ZS6B 4ZS3A 5LCWL
chains in the Genus database with same CATH topology
5LW9A 5FY0A 2Q8EA 3U78A 5IVVA 5FZ1A 5A3TA 5FZ9A 5FXXA 3KV9A 4CCLA 5A80A 5ISLA 4Y4RA 4IGPA 5F3IA 4XDOA 5FY7A 5A7OA 4D6QA 5F39A 5FPUA 5K4LA 4CCKA 3KV5A 5A7PA 2OX0A 3AL5A 5FZ0A 5FYZA 5IVYA 3KV6A 4QX7A 2P5BA 3OPTA 3PU8A 5FYBA 5FZEA 4UF0A 3PTRB 5A7NA 5IVJA 4QX8A 5FZ8A 5FYHA 4NUBA 5A7SA 5FPAA 2YBKA 5IVCA 4LITA 5FZBA 4AI9A 5FZCA 4D6RA 4EZ4A 3AVSA 5FUNA 1VRBA 2OQ7A 3DXTA 3LD8A 5FZOA 5FYTA 3K2OA 2OQ6A 2YPDA 3UYJA 5F3CA 2OT7A 4QXCA 5FPLA 3OPWA 3AVRA 5A7WA 3PU3A 5FZKA 5FZ6A 5E6HA 5FV3A 2Q8CA 4EYUA 2WWJA 3KVAA 5A1LA 5FZ3A 2GP5A 5FPBA 5IVEA 4TN7A 5LWBA 5FZ4A 2Q8DA 3PUQA 3U4SA 5F3GA 3KV4A 5F32A 5A1FA 3DXUA 5FP4A 5FZGA 5F37A 4CCJA 3PURA 4Y33A 4UF0B 5FYVA 4BISA 3NJYA 4BXFA 4IGQA 5A7QA 5A3NA 5IVBA 2PXJA 4CCNA 4BU2A 5IW0A 4URAA 4LXLA 5IVFA 5FUPA 5F5CA 4CSWA 5LY2A 2GP3A 5FWJA 3PDQA 5FJKA 4D6SA 4XDPA 5A3PA 5FZOB 5F3EA 5F5AA 5FY1A 5FZAA 5FPVA 3KVBA 5FY5A 4LIUA 4V2WA 4CCOA 2XDVA 2XUEA 4HONA 5A7WB 4V2VA 5FP9A 4C8DA 2WWUA 4AAPA 3PUAA 4DO0A 5F2SA 5FYMA 5FYYA 5FYCA 5FP3A 2W2IA 3PUSA 4GD4A 5F2WA 4DIQA 3N9NA 5IWFA 5FYUA 5FZDA 5FWEA 5FYSA 4ASKA 4QXHA 2VD7A 5FY9A 3N9LA 3AL6A 3N9PA 2YU1A 4GAZA 5FZFA 3ZLIA 2YBSA 3N9QA 5FYIA 5FZLA 2YU2A 5FZMA 5A3WA 4EZHA 5FP8A 5FXZA 5FXWA 2YBPA 4CCMA 3N9OA 4QXBA 4QU1A 3K3NA 5CEHA 5FBJA 5FY4A 4GJYA 5ANQA 2XMLA 4Y3OA 5FZ7A 4E4HA 3N9MA 4CUGA 3K3OA 4GJZA 5F5IA 5FXVA 2OS2A 3RVHA 3LDBA 4HOOA 4QWNA 5FZHA 4IGOA 5FP7A 5FY8A 5LY1A 5FJHA 3ZPOA 5KR7A 2XXZA 5FZIA 4LIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LW9 A;  5FY0 A;  2Q8E A;  3U78 A;  5IVV A;  5FZ1 A;  5A3T A;  5FZ9 A;  5FXX A;  3KV9 A;  4CCL A;  5A80 A;  5ISL A;  4Y4R A;  4IGP A;  5F3I A;  4XDO A;  5FY7 A;  5A7O A;  4D6Q A;  5F39 A;  5FPU A;  5K4L A;  4CCK A;  3KV5 A;  5A7P A;  2OX0 A;  3AL5 A;  5FZ0 A;  5FYZ A;  5IVY A;  3KV6 A;  4QX7 A;  2P5B A;  3OPT A;  3PU8 A;  5FYB A;  5FZE A;  4UF0 A;  3PTR B;  5A7N A;  5IVJ A;  4QX8 A;  5FZ8 A;  5FYH A;  4NUB A;  5A7S A;  5FPA A;  2YBK A;  5IVC A;  4LIT A;  5FZB A;  4AI9 A;  5FZC A;  4D6R A;  4EZ4 A;  3AVS A;  5FUN A;  1VRB A;  2OQ7 A;  3DXT A;  3LD8 A;  5FZO A;  5FYT A;  3K2O A;  2OQ6 A;  2YPD A;  3UYJ A;  5F3C A;  2OT7 A;  4QXC A;  5FPL A;  3OPW A;  3AVR A;  5A7W A;  3PU3 A;  5FZK A;  5FZ6 A;  5E6H A;  5FV3 A;  2Q8C A;  4EYU A;  2WWJ A;  3KVA A;  5A1L A;  5FZ3 A;  2GP5 A;  5FPB A;  5IVE A;  4TN7 A;  5LWB A;  5FZ4 A;  2Q8D A;  3PUQ A;  3U4S A;  5F3G A;  3KV4 A;  5F32 A;  5A1F A;  3DXU A;  5FP4 A;  5FZG A;  5F37 A;  4CCJ A;  3PUR A;  4Y33 A;  4UF0 B;  5FYV A;  4BIS A;  3NJY A;  4BXF A;  4IGQ A;  5A7Q A;  5A3N A;  5IVB A;  2PXJ A;  4CCN A;  4BU2 A;  5IW0 A;  4URA A;  4LXL A;  5IVF A;  5FUP A;  5F5C A;  4CSW A;  5LY2 A;  2GP3 A;  5FWJ A;  3PDQ A;  5FJK A;  4D6S A;  4XDP A;  5A3P A;  5FZO B;  5F3E A;  5F5A A;  5FY1 A;  5FZA A;  5FPV A;  3KVB A;  5FY5 A;  4LIU A;  4V2W A;  4CCO A;  2XDV A;  2XUE A;  4HON A;  5A7W B;  4V2V A;  5FP9 A;  4C8D A;  2WWU A;  4AAP A;  3PUA A;  4DO0 A;  5F2S A;  5FYM A;  5FYY A;  5FYC A;  5FP3 A;  2W2I A;  3PUS A;  4GD4 A;  5F2W A;  4DIQ A;  3N9N A;  5IWF A;  5FYU A;  5FZD A;  5FWE A;  5FYS A;  4ASK A;  4QXH A;  2VD7 A;  5FY9 A;  3N9L A;  3AL6 A;  3N9P A;  2YU1 A;  4GAZ A;  5FZF A;  3ZLI A;  2YBS A;  3N9Q A;  5FYI A;  5FZL A;  2YU2 A;  5FZM A;  5A3W A;  4EZH A;  5FP8 A;  5FXZ A;  5FXW A;  2YBP A;  4CCM A;  3N9O A;  4QXB A;  4QU1 A;  3K3N A;  5CEH A;  5FBJ A;  5FY4 A;  4GJY A;  5ANQ A;  2XML A;  4Y3O A;  5FZ7 A;  4E4H A;  3N9M A;  4CUG A;  3K3O A;  4GJZ A;  5F5I A;  5FXV A;  2OS2 A;  3RVH A;  3LDB A;  4HOO A;  4QWN A;  5FZH A;  4IGO A;  5FP7 A;  5FY8 A;  5LY1 A;  5FJH A;  3ZPO A;  5KR7 A;  2XXZ A;  5FZI A;  4LIV A; 
#chains in the Genus database with same CATH topology
 2WFF 2;  2ZJC A;  3KLS A;  4NPL A;  1POV 1;  4YVW C;  1I1E A;  2WL1 A;  2R1D A;  2J1U A;  2EA7 A;  4YPJ A;  3ZYB A;  3CJI A;  2DVA A;  3H3Z A;  3AMQ A;  4PT6 A;  5JOX A;  3O1T A;  3NV2 A;  3VV1 A;  1QDC A;  2E51 A;  4P02 B;  3AK0 A;  1HN0 A;  3KV9 A;  2IXK A;  5FLJ A;  5FRA A;  1OBN A;  1WCU A;  5A6Z A;  5A7O A;  2ZBJ A;  3IMN A;  1MS3 A;  3IDE A;  3FHA A;  2CU5 A;  4LHL A;  5FAX A;  1MS4 A;  1UY0 A;  2WNV A;  2BOI A;  3NAP C;  3CHX A;  4LKD A;  4D7S A;  4FPY A;  1O4Z A;  2BVB A;  1SG3 A;  5ACA 1;  5FYH A;  4BWO A;  3KD4 A;  4I30 A;  2HWB 2;  2VVE A;  1MPX A;  3R4S A;  4AFB A;  3F95 A;  1YNA A;  3RJ2 X;  3HAG A;  1OFN A;  2Z5W A;  4Y4Y A;  3GHM A;  1CON A;  1HXS 2;  1W9F A;  3ZYR A;  2ZXQ A;  4EWD A;  3I54 A;  3TWI A;  3GZA A;  4TZD A;  3C8X A;  2ZEW A;  5FPL A;  3AYC A;  4ET7 A;  2WZR 3;  4GB3 3;  3R05 A;  3OUJ A;  1R1Z A;  2WO3 A;  5LBC A;  1GOH A;  4A42 A;  2WWJ A;  1JW6 A;  1ZBA 3;  4AFM A;  3WG4 A;  2QQW A;  1JN2 P;  4LHK A;  2A6Y A;  2JG8 B;  2EIC A;  1FMD 3;  1C4R A;  1WBL A;  3GYD A;  4R9D A;  3S0M A;  1HJG A;  2X5I B;  1VBA 1;  2ORZ A;  1JYW A;  3KZ4 C;  2WNU C;  4GZ9 A;  1LHU A;  1IPK A;  3SIS A;  3DPR B;  1EP0 A;  4CPB D;  1LU2 A;  4NRM A;  3RFR A;  1ZVF A;  4BK4 A;  4IGQ A;  4RS5 B;  2ZA9 A;  3BUC A;  2JDM A;  2CY6 A;  2OUH A;  3JZV A;  3LIH A;  5J3U A;  3N7L A;  2W92 A;  2ZKL A;  3WV6 A;  4RGA A;  2D3S A;  3V65 A;  1GZW B;  3WG3 A;  3N3H A;  3OPZ A;  3DL3 A;  3USU B;  4CU9 A;  4D6S A;  4XDP A;  3V0B B;  1RUN A;  3ZYG A;  4Z1V A;  1U5X A;  3B7M A;  3TAY A;  3KVB A;  2BGO A;  5FY5 A;  5KHG A;  1G7Y A;  1AX1 A;  2ZZJ A;  1XBF A;  3I59 B;  3ZXE A;  2MPF A;  3MUY 1;  4QPG A;  4BQX A;  1L7R A;  3IDC B;  1AYN 2;  1OQD A;  1X36 A;  1WLC A;  4XPV A;  4XJ8 A;  1S0G A;  3OD0 A;  5JDB A;  2DU0 A;  4Z07 A;  1Z78 A;  1RB8 G;  3O12 A;  3PJQ A;  4A44 A;  4XUP A;  4AI3 A;  4P00 B;  4DIQ A;  1R1A 2;  5FYS A;  1QXR A;  1SMV A;  3AZV A;  1D4M 2;  3AYE A;  4L9B A;  4AQT A;  5EQU A;  4QDR A;  3E97 A;  2HLE A;  1ZYB A;  1NCQ C;  2VOT A;  5DDJ 1;  3I2F A;  4GAZ A;  5F6K A;  3LA2 A;  5BV6 A;  4NRO A;  5A6Y A;  2P1B A;  3N9Q A;  5IAT A;  5HXV A;  3T2T A;  5DAX A;  4NHK A;  1W9S A;  3WY6 A;  5FDB A;  2WZR 1;  3LCP A;  3MLL A;  4GB3 1;  2A6V A;  4QU1 A;  4Z82 A;  4CEW A;  5FY4 A;  2D6K A;  5A33 B;  1AR6 3;  1QJX 3;  4CVU A;  2D6N A;  1IZ3 A;  2VW0 A;  2R04 3;  1NLS A;  2RM2 2;  4LBQ B;  2WQZ C;  1AR8 3;  4W6Y A;  1U5I A;  5ERL A;  2OS2 A;  2VUJ A;  3I8T A;  3B94 A;  1FMD 1;  2Y6H A;  3Q8F A;  3ILR A;  2ADE A;  5H9P A;  4DNY A;  1RIN A;  2FQP A;  1BEV 2;  2WO1 A;  1ASJ 2;  1S2K A;  1XU2 A;  1CZV A;  3PUI A;  4LA2 A;  4R4X A;  4LO5 B;  2DUQ A;  4BDV B;  1WLW A;  3RS6 A;  1KEX A;  3ZIW A;  4AQ2 A;  5JOW A;  1NG0 A;  3OBR A;  4LIV A;  3NNG A;  4LK6 A;  3WX5 A;  1GWM A;  1OT5 A;  4QHO A;  3ZSE A;  5BNP C;  2VXR A;  1ACC A;  4CTE A;  4COZ A;  3AB0 A;  2ZGS A;  3O0W A;  2GU9 A;  2PHD A;  4CXY A;  1RUO A;  3IBM A;  4WVM B;  3B02 A;  5C3P A;  3OEB A;  5KXE A;  1CAW B;  4AVT A;  4QHB A;  4EN6 B;  4K9S A;  3CL1 A;  4B7E A;  2W47 A;  5CVR A;  5IK7 A;  1AYM 3;  5FZ0 A;  4BQ1 A;  1ULE A;  3T2P A;  4YW1 A;  2DCJ A;  1CN1 A;  3WQB A;  3H1Y A;  3WXP A;  2NM1 A;  2VOV A;  2UYA A;  2FDF A;  1H9P A;  2W39 A;  3H3U A;  1AXK A;  1DCS A;  1O8P A;  1FYU A;  5EJ3 A;  3FE5 A;  3WEZ A;  3M2M A;  3K4A A;  3SH3 A;  1CQ9 A;  2R30 A;  2XVG A;  1RXF A;  4WVW A;  4AED A;  3VDA A;  3VD5 A;  1GZC A;  1F31 A;  1VB2 A;  4O9E A;  4ISQ A;  4RR3 A;  3KVA A;  2D40 A;  4RFT 0;  3AJZ A;  1J59 A;  4CCC A;  2AUY A;  4PHZ A;  3WUD A;  1VAM A;  4UFM A;  1AR6 1;  5HBA A;  3KV4 A;  1E5I A;  2R04 1;  4NOT A;  4ARX A;  3DXU A;  1AR8 1;  5A1F A;  1UD1 A;  3ABZ A;  4P5H A;  4PIY A;  1BMV 1;  2C0Z A;  4C91 A;  1W6N A;  3T4H B;  3AKR A;  2D6P A;  2CGP A;  1RMU 3;  4UF0 B;  4BIS A;  5I93 A;  2BVV A;  3B9C A;  1UMH A;  1EV1 3;  2ORX A;  4R9A A;  4Y20 A;  5CYY A;  4XFI A;  5EYX A;  2GME A;  2D43 A;  2VPV A;  4IE0 A;  5F9T A;  5JSO A;  3IB3 A;  1FNY A;  5A3P A;  2QZ2 A;  1F8V A;  1OSG A;  1VJ2 A;  4F8A A;  4NHX A;  4NIA A;  3WNP A;  4XC9 A;  1S0F A;  1XND A;  1AJO A;  2VNV A;  2W3J A;  4HON A;  3VD3 A;  4ZY9 A;  1RVF 3;  2VZQ A;  4OLL A;  3ZX7 A;  4I01 A;  2XON A;  3URF A;  1XJA A;  3VZM A;  4XAC A;  1AYM 1;  4D7T A;  4JC1 A;  4CE8 A;  5FP3 A;  5JWP A;  4XOG A;  1LGB A;  5FMO L;  4PLO A;  2D5H A;  4K7J A;  2LRP A;  4XQ4 A;  4D94 A;  3BU0 A;  4Y22 B;  2QQN A;  1N3Q A;  4QPI C;  1M4W A;  1OLQ A;  3DKQ A;  5FYI A;  2YU2 A;  5FZM A;  3VBF A;  1DQ4 A;  3HNM A;  3VKN A;  5CAD A;  3ZN5 A;  4MET A;  1VAL A;  5CA6 A;  2GH2 A;  3U0Z A;  5LBE A;  5DG1 A;  3JD7 3;  2WDB A;  1WME A;  2J22 A;  3FJS A;  1SEF A;  1V6J A;  2W68 A;  3KCY A;  3DF0 A;  3ST7 A;  4CXX A;  4DEQ A;  1ZZ6 A;  2BPA 2;  3THP A;  1EUU A;  4DXT A;  2QQP A;  2FMY A;  2VZP A;  2HWD 1;  4FPK A;  1AR7 2;  4PBO A;  1S55 A;  5F1R A;  4LEJ A;  3GXU A;  3OD4 A;  5CB7 A;  3TN9 3;  2GDF A;  2GAL A;  4AHZ A;  3NAP B;  3N4M A;  1W6O B;  1ST8 A;  1NA1 B;  3N36 A;  1RMU 1;  3LA3 A;  5CKQ A;  2RS3 3;  1K5M A;  4X6R B;  4AI8 A;  1SQ4 A;  3ILN A;  5ABJ B;  1EV1 1;  1EPZ A;  1EY2 A;  3E5X A;  3FLR A;  2R6Q A;  1NZI A;  1OKO A;  4IEO A;  2JG8 A;  2WZR 2;  2XJS A;  2X5I A;  3RI9 A;  4QGM A;  2NQY A;  1ZBA 2;  4XFF A;  4BQ5 A;  3AL5 A;  3VDD B;  2XG3 A;  3DPR A;  4MG2 A;  4Q0V A;  1H2K A;  2YB7 A;  1FMD 2;  3T4V A;  1VB4 A;  5LK7 B;  4KQ7 A;  1DBN A;  1FV2 A;  1RHI 3;  3LFM A;  2KA3 A;  4UFL A;  1LHW A;  3LPG A;  3WP6 A;  3ZFE A;  2BWA A;  2ZAA A;  4M4R A;  1X8M A;  3ZR6 A;  2UYB A;  1ULO A;  4O65 A;  4CDW B;  4ISR A;  2XL7 A;  3KCC A;  3T1M A;  3ILF A;  4DXZ A;  3V0B A;  3IMM A;  1W03 A;  1WW6 A;  3KWV A;  4KWU A;  5F3C A;  1UW8 A;  1Y9G A;  3I59 A;  3PU3 A;  4CDQ B;  4FVV A;  5C3O A;  5FV3 A;  2Q8C A;  3JD7 1;  5B4N A;  1V00 A;  1MQT A;  1WW5 A;  1WWY A;  4AVC A;  2R49 A;  2I07 B;  5H9S A;  1RUE 2;  3U4S A;  5JXH A;  1FNZ A;  3HR9 A;  2AH2 A;  2R0H A;  4HBN A;  3B93 A;  3TN9 1;  4IE7 A;  4OYU A;  3N7J A;  2B45 X;  4AGG A;  3HEI A;  2ZAH A;  5E1R A;  3U11 A;  1EUT A;  1OH4 A;  3L2H A;  4EJR A;  1ZA7 A;  3ORJ A;  2RS3 1;  3N7M A;  2G1M A;  4U2A A;  3ZSM A;  5LY2 A;  3P3N A;  4AEM A;  4C1X A;  1OLM A;  5JUV A;  3ZXK A;  1ZRR A;  5A33 A;  1O59 A;  1H9W A;  3PDQ A;  3UKN A;  2UWB A;  2XWB B;  1H1I A;  1OF3 A;  4KBZ A;  3CEW A;  4E2S A;  4YM2 A;  4QPG C;  1IG3 A;  4FPG A;  3NJZ A;  2XUE A;  3WP5 A;  3RYR A;  3ZYP A;  1OPM A;  2SLI A;  1UZY A;  1QJX 2;  1X50 A;  2XB6 C;  2ZGU A;  1REE A;  2R04 2;  4ZZ5 A;  1AR8 2;  1VRH 2;  1F9K A;  4XAE A;  1DQ2 A;  1LES A;  5L9B A;  1F2N A;  3AP7 A;  4BM8 A;  1RHI 1;  2CHH A;  2JEN A;  3ACH A;  4JGZ B;  4QXH A;  4Y26 A;  5FY9 A;  3H8U A;  3I2K A;  4Z8B A;  4F7Z A;  1E5R A;  4P14 A;  4MOA A;  3ZO0 B;  1UX7 A;  1JU3 A;  1Y4W A;  3OEA A;  1SLA A;  3ZLI A;  4OHW A;  5EIY B;  1FPN 2;  2A71 A;  3ELN A;  1QH6 A;  1RUH 3;  4E4S A;  2O8O A;  1DYK A;  3OTF A;  4CEW C;  4DFS A;  2G9G A;  3PIG A;  4XUR A;  2JB4 A;  3I3Q A;  3BN6 A;  4FPL A;  4O9G A;  3VHO A;  1YJL A;  1X9T A;  2ZX3 A;  2P6C A;  4QKD A;  2OUJ A;  4CDX C;  2GNT A;  2WT1 A;  2ZGM A;  1AYM 2;  1SAC A;  1AR9 1;  3FBM A;  4GMP 3;  1CVN A;  4OUM A;  1UZW A;  3HWJ A;  2OPW A;  4MHU A;  1C3H A;  1I3H A;  2VGD A;  2QVS B;  2AC1 A;  2VM9 A;  2ZGR A;  4KH9 A;  1GP6 A;  1C57 A;  2VEC A;  3WVJ A;  4EE2 A;  4URT A;  2AYH A;  5FOJ B;  2Q8E A;  2O1Q A;  3GZU C;  4NID A;  1OKQ A;  1KFX L;  2BZD A;  4JTO A;  3E6C C;  3QH7 A;  3LDR A;  4QX2 A;  1OH3 A;  5A3T A;  3U1X A;  3RPQ A;  4QB1 A;  5FXX A;  3GJB A;  4CCL A;  2WSV A;  3ACL A;  3WDX A;  4LTA A;  4XDO A;  2WR9 A;  2EXJ A;  3VBS C;  3JBG 3;  2J42 A;  4OUE A;  5KBF A;  1XQN A;  5K4L A;  1QU0 A;  1KRI A;  2QQU A;  2WAA A;  4CP1 A;  3EB7 A;  4ONU A;  2GSY A;  1WZX A;  2XUM A;  3PVO A;  4QX7 A;  5IVJ A;  4P9I A;  3RZZ A;  4UF0 A;  4WM8 C;  3QH6 A;  5GLV A;  1HRI 3;  3TOJ A;  4ZON A;  3WDY A;  2F4P A;  4NHY A;  2D98 A;  2A73 B;  1ZA4 A;  2VL4 A;  2KXL A;  2PHR A;  1HRV 3;  2PA7 A;  2PQS A;  2P17 A;  4PDW A;  5A7S A;  3VHR A;  4OCT A;  3VBH A;  1WD3 A;  2WAO A;  5JZG C;  5A3U A;  3DXT A;  4AED C;  5FK8 A;  3LPF A;  1W8H A;  1DU3 D;  3DUI A;  4OFG A;  4FPJ A;  1C5H A;  2BEO A;  4QKN A;  3ZFG B;  1RUH 1;  1NKG A;  2LTN A;  3H0O A;  4IEU A;  4EYU A;  5J96 B;  1JYN A;  1RUG 2;  3ZIX A;  1I9R A;  2P34 A;  2YFZ A;  5FZ4 A;  2VCC A;  1WCS A;  1RVF 2;  4XUQ A;  2EVX A;  5FP4 A;  4NVP A;  3O0V A;  5CFC C;  1IHM A;  5DAQ A;  1WCQ A;  4GMP 1;  4XCB A;  5DAB A;  4CP2 A;  4N90 A;  5K8S A;  1N3O A;  2FCU A;  5IVB A;  4C90 A;  1JHJ A;  4K20 A;  4YW3 A;  2QTW B;  2E7Q A;  2WII B;  4CCN A;  3BCW A;  3LE0 A;  2IVJ A;  4CSW A;  2XGX A;  1AL2 3;  1H8T B;  4RL7 A;  3R4U A;  4IEY A;  2RE9 A;  3JB8 A;  1PZ8 A;  2QQL A;  1O5L A;  1W8O A;  2BW8 A;  3HQX A;  1YXW A;  4FQZ A;  2BU9 A;  4A4A A;  2RR1 3;  3INA A;  2V4A A;  4X8P A;  3PTY A;  1J84 A;  5F7U A;  4BQ2 A;  1PK6 B;  3JBG 1;  5JI9 A;  3AM2 A;  4W4Z A;  5K0U B;  3S5A A;  4BMB A;  3ZYJ B;  3LAG A;  1F5J A;  3EBR A;  1W6O A;  4QAW A;  3VD9 A;  1Q8P A;  2ET7 A;  4UBG A;  1NA1 A;  1AZD A;  1Q43 A;  2X29 A;  4OQ9 A;  3T2Q A;  5FYC A;  2GMM A;  5LRR A;  3BKZ A;  1HRI 1;  3TN9 2;  2XBO 3;  5C3R A;  2FDG A;  4DY3 A;  4I02 A;  5GZE A;  3WNL A;  4OUL A;  5ABJ A;  3BOD A;  3UK9 A;  4QQP A;  4FAH A;  3AP5 A;  3WQ7 A;  2YHJ A;  5FO9 B;  1AUY A;  2XPJ A;  1MS9 A;  3VBF C;  2PYT A;  3CMG A;  4XF3 A;  4XDQ A;  5DZF A;  2GC1 A;  1G9A A;  1GZ9 A;  1OVS A;  2BFU S;  3WF4 A;  1PM7 A;  4FFI A;  5DQ0 A;  2LW8 A;  2WC2 A;  2VZT A;  3K3N A;  4LO7 A;  3VDD A;  2BGP A;  5A6Q A;  5C9A C;  3VBO A;  4P9W A;  4YYO A;  1ND2 B;  1L7L A;  5D8A C;  3ZYI B;  4QPW A;  4NJ4 A;  4XVH A;  4L8Q A;  1LJ7 A;  1FAY A;  5FZH A;  1NX9 A;  3U14 A;  3ZXA C;  2K0G A;  2JD9 A;  3JB4 C;  2OW4 A;  4YFW A;  1W2N A;  2P3I A;  4QKF A;  1RHI 2;  4CDW A;  1MVE A;  1K5M C;  2XVK A;  4LK7 A;  1VP6 A;  3OSD A;  1ND3 B;  3AP6 A;  4QU2 A;  3HOB A;  1W6P A;  1J1T A;  4HET A;  2DVF A;  1AVB A;  4IV3 C;  4CDQ A;  1QJZ A;  4AWD A;  3UNP A;  1AL2 1;  1IQD C;  1DF0 A;  5IAV A;  3WF1 A;  3OY8 A;  3VHP A;  2ARE A;  5JXI A;  3NV4 A;  5CKN A;  5I0U A;  5EXO A;  2XJQ A;  4D0Q A;  2JDZ A;  4L2N A;  1JHN A;  3EQE A;  4QDS A;  5T54 A;  1MS1 A;  4E8C A;  5FOB B;  3PU8 A;  2Y8K A;  5FZE A;  5JLV A;  1FX5 A;  1K12 A;  3O1S A;  3WNX A;  4CP9 B;  3ZFE C;  1CPM A;  2K9Z A;  2VMI A;  1DHK B;  2XBO 1;  4FOW A;  5T50 A;  4YM1 A;  3H1W A;  4K8R B;  1DGW X;  4X8N A;  4D6R A;  2VZ3 A;  2DUO A;  2CSG A;  3DEC A;  4Q1P A;  2JDU A;  4OZO A;  2OQ7 A;  2ZZQ A;  3KHB A;  4XUN A;  4IXL A;  3HQU A;  1QJF A;  4DRV A;  3UT0 A;  1OF4 A;  1LOC A;  2QUO A;  1MQT C;  4XW3 A;  4XUO A;  3TNP B;  4H7M A;  3J9S A;  1MZ6 A;  3GM8 A;  4UFJ A;  4G3Y C;  3TB0 A;  3K77 A;  2XLF A;  4BME A;  4HAN A;  1YJK A;  3LKJ A;  5EHD A;  4YZ2 A;  5FRE A;  2WNO A;  2R06 2;  1UZV A;  4COY A;  4NII A;  1MEC 3;  1UKR A;  4N43 B;  2OXB A;  3AJY A;  4S2F A;  2ZPX A;  3HJR A;  4JGZ A;  5GLT A;  1XE8 A;  2D97 A;  2R0F A;  1SFY A;  3MIB A;  4GH4 B;  2VMC A;  4WM7 B;  1RUJ 3;  4FP2 A;  1RUF 3;  3ZSJ A;  1JS9 A;  1PGW 1;  1NZC A;  5HCA A;  1LU1 A;  2G9Z A;  3GBG A;  4NRP A;  5A7Q A;  1UN1 A;  2O0O A;  3DKW A;  2ID4 A;  4LBM A;  4QX5 A;  4IDZ A;  1UY4 A;  3HIF A;  3W58 A;  5FLH A;  4KG8 A;  1NOV A;  1OLM E;  1ZBE 3;  4YG3 A;  2A3W A;  4B4Q A;  4P9Y A;  4ZZ8 A;  3BGA A;  2FCV A;  1ZZ8 A;  1TNF A;  1XNC A;  4QB2 A;  2P3K A;  1O7F A;  1MZF A;  1RUH 2;  2CGO A;  5FZA A;  4MXV A;  4JDM A;  2H6C A;  4FTB A;  3ME2 A;  1AF9 A;  5APA A;  2D6O X;  4DPN A;  4PI2 A;  5L73 A;  3D3A A;  4XFC A;  4AAP A;  3RQ0 A;  2VUL A;  1NY7 1;  3JCI A;  4W50 A;  2RMU 2;  3ZFF C;  4DO0 A;  4GWM A;  5IFT A;  4FP3 A;  1OVP A;  2IZW A;  3WF2 A;  4EWE A;  4YZ5 A;  3IT8 A;  1VE0 A;  2VOK A;  2VD7 A;  4UW5 A;  2A6W A;  4M01 A;  1KIT A;  2BBA A;  3BTX A;  4PLN A;  2GZW A;  3MGU A;  2NMN A;  1LEM A;  1W3X A;  4HVO A;  3EMR A;  4EZH A;  2JG9 B;  3PVB B;  4N53 C;  1SZB A;  1NUK A;  2B42 B;  1GBG A;  2XR4 A;  1W9T A;  4PCR A;  3ALQ A;  1D2Q A;  5F8P A;  1QMJ A;  4Y1Y A;  5LBB A;  4QQH A;  3VZO A;  3G6J B;  4AG4 A;  4HN0 A;  1PVX A;  2JWP A;  3UJO A;  1CES A;  5GZC A;  4CEY B;  1MEC 1;  3WHU A;  4P9X A;  4M0N A;  5ACA 3;  1OUS A;  1EAH 2;  3MIH A;  1YI9 A;  1HRI 2;  4RD7 A;  4BCU A;  2EIG A;  2WBK A;  5LY1 A;  1H8V A;  1RUJ 1;  2BNM A;  5HCB A;  1HRV 2;  2OKX A;  5IK8 A;  5EYY A;  1UPI A;  4DQA A;  3M70 A;  4JHZ A;  2CAU A;  1QGL A;  3ZFG A;  4HG6 B;  1BHG A;  2QQJ A;  4LQR A;  3RNS A;  1ZBE 1;  1AJK A;  1GR3 A;  2GN3 A;  3WZ1 A;  4DUX A;  5CFD C;  3SKV A;  2P37 A;  1UY3 A;  3HNB M;  3UKV A;  1NT0 A;  1R64 A;  2HWE 2;  1VBC 3;  5DAW A;  5FY7 A;  5B4X A;  1IS5 A;  4M3C B;  1XXN A;  4JX0 A;  5CU1 A;  1COV 2;  3OBT A;  4XTP A;  5IFP A;  4EN8 B;  5IVY A;  3KV6 A;  2P5B A;  3NVC A;  2EAA A;  4OVE A;  1JYC A;  4FPF A;  1B09 A;  3SKJ E;  4BQW A;  4CCD A;  3VKM A;  4GXL A;  1GUI A;  4H14 A;  3VBH C;  4GMP 0;  1G6N A;  4MSV A;  1POQ A;  4PF5 A;  2VZR A;  3TEW A;  1SLT A;  2VMG A;  2YBK A;  4IND A;  4ZHN A;  4BOW A;  1V9U 3;  3H8O A;  3IM0 A;  5I0S A;  4XZU G;  2H6B A;  1VRB A;  4Y5T A;  2UWA A;  1UZZ A;  3ZXJ A;  1UYY A;  5KC5 A;  4K6B A;  3N7K A;  4NMI A;  1OC1 A;  4E4Z A;  2H0B A;  1ZZC A;  1NCR B;  3J7M A;  5K0U A;  1LR5 A;  3RDI A;  4C0B A;  1UWW A;  5IUQ A;  5A70 A;  3AZW A;  2Q1Z B;  1B35 A;  2JXA A;  5FZ3 A;  2RR1 2;  3OYW B;  1R08 1;  2ZAB A;  3PMS A;  2Q8D A;  3TRS B;  4W8J A;  1JZ6 A;  1OA3 A;  3MUZ 1;  4CCJ A;  2DCK A;  4O61 A;  3ZOI A;  4YVS B;  1CAV B;  2XBO 2;  3LEK A;  3NJY A;  1QXP A;  5A3O A;  2HH9 A;  1NAE A;  5FFO C;  3PL0 A;  5C4W B;  3MIC A;  3SQO A;  3I3M A;  1QF3 A;  2DVD A;  5DDJ 3;  2A75 A;  4AK3 A;  1UU6 A;  4FPH A;  5BNQ A;  1RUC 3;  1FOD 2;  3UET A;  3APB A;  3ETQ A;  4AHY A;  4CP0 A;  5CBL A;  5FZO B;  4D8M A;  5F3E A;  1ND2 A;  5FKB A;  3KF3 A;  3K4D A;  1W06 A;  3SCG A;  3M3I A;  1VBC 1;  2JD4 A;  3CLP A;  3MW3 A;  2PFW A;  4L0P A;  4ZKT B;  4XXA A;  4UW4 A;  3EHK A;  3LIG A;  2RS5 3;  3FZ3 A;  2VZV A;  1KS4 A;  2V4V A;  3PVN A;  1ND3 A;  2J1S A;  3UGG A;  5A6X A;  4AVV A;  4ES8 A;  5I8T A;  4NWW A;  3O1M A;  1WUV A;  1GOG A;  4ZU5 A;  4E2G A;  5SV8 A;  1WA6 X;  3AL6 A;  2OYZ A;  2AEN A;  1ULF A;  1ONA A;  2VZS A;  1V9U 1;  4G9S B;  1IKQ A;  1UYP A;  1S2B A;  1JUH A;  4LUK A;  4AE2 A;  1LOG A;  2DV9 A;  5FXZ A;  4I0B A;  2V5Y A;  4JGY B;  3TEY A;  1LOD A;  3IDA A;  3VBO C;  4BPZ A;  1UQX A;  2W91 A;  1LED A;  5JMC A;  2RJK A;  2XJV A;  4E27 A;  5BNO B;  4AFA A;  4N7U A;  3CZJ A;  3POE A;  3N9M A;  4NWV A;  2VVF A;  4OI1 A;  4CUG A;  4CP9 A;  3AP4 A;  1NY7 2;  1S0I A;  3LDB A;  1CPN A;  1ZRC A;  4FAG A;  5FP7 A;  4R9B A;  5AFB A;  3J4U H;  4P9G A;  3KHC A;  3K48 A;  3OUH A;  2GND A;  4Y5Z 0;  4A7Z A;  1RIT A;  5K7P A;  5LW9 A;  4SLI A;  2DTW A;  3B3Q E;  2Y6F A;  2PAM A;  5H9R A;  4RHV 3;  1DYP A;  1GU3 A;  1SFP A;  4J25 A;  4MXW B;  5IVV A;  1RUC 1;  1SLL A;  1KFU L;  2DU1 A;  3DGT A;  1CX1 A;  1OA4 A;  4CDU A;  2DTY A;  2OVU A;  2VUA A;  1PO2 3;  2Y0O A;  3EO6 A;  2ETE A;  3ZMN A;  4N43 A;  2ZOE B;  3RMX A;  2VBP A;  3KMH A;  5JI7 A;  3RYP A;  3VBR C;  5A7N A;  1UX6 A;  1MEC 2;  2ZEZ A;  4HSJ A;  5FMB A;  3RZG A;  2RV9 A;  3MF6 A;  2AGS A;  4OMC A;  2RS5 1;  5JPM B;  5DXD A;  1OOP B;  1RUF 2;  1PGL 2;  1UO9 A;  1J58 A;  4LIT A;  1PMI A;  1VMH A;  4DY5 A;  2WS9 2;  4HKL A;  2EIE A;  4LO8 A;  4A2U A;  4R9C A;  1AXZ A;  1CAU B;  3G7D A;  3HBZ A;  1X82 A;  4JRA A;  4KWL A;  1I5Z A;  3ZDS A;  4IEW A;  1ZBE 2;  4IE6 A;  4LKE A;  4M4P A;  4XAB A;  1WBF A;  1K45 A;  5AVA A;  1E57 A;  3N35 A;  1C8M 3;  3S7E A;  1XE7 A;  4ES9 A;  5C8C A;  3NWK A;  2O8Q A;  3AMN A;  4HKW A;  5C3Q A;  3WDW A;  1H4H A;  3LF7 A;  4U36 A;  5AC9 3;  5FZG A;  1LEC A;  2D93 A;  4HN1 A;  4Q4Y 3;  1GWL A;  1LNS A;  2FZ2 A;  4XIK A;  1DQ5 A;  1G9C A;  1WD4 A;  2ILM A;  4JHT A;  2QQV A;  4QT6 A;  3VD4 A;  2V09 A;  2XKO A;  5EWS A;  4K8F A;  1H6X A;  4BU2 A;  1V70 A;  2JG9 A;  4LXL A;  2QBX A;  4ZU7 A;  2XJP A;  2ZMK A;  3SNM A;  3FUO A;  5F5C A;  2E31 A;  3RG0 A;  4RHV 1;  1G9B A;  1CIY A;  3SXW A;  4S2H A;  1GKB A;  2IUW A;  4YZ3 A;  1XYN A;  3AZZ A;  4LIU A;  1HLC A;  1PO2 1;  4V2W A;  2B39 A;  3KGL A;  4CEY A;  1QJU 3;  4HFS A;  4V2V A;  3ES1 A;  5I0R A;  2BFU L;  2HWD 3;  1YQC A;  3PLQ A;  5KXC A;  5LEK A;  3CKH A;  3ZXG A;  3FWE A;  1GQP A;  3QBQ A;  4XF4 A;  5IT6 A;  3KB5 A;  1GWK A;  2ZX2 A;  4Q5O A;  1H4G A;  2WT2 A;  5ACA 2;  1KQR A;  5FYU A;  4AHX A;  3T0D A;  1V6O A;  2GNM A;  2BP6 A;  3D8C A;  5LK5 A;  2YXS A;  4YW6 A;  1PO1 3;  3EJK A;  3ZKU A;  3U4X A;  5HV4 A;  1JYI A;  2HJI A;  3I7D A;  2G4I A;  3AX4 A;  5CNA A;  2CDO A;  2DUP A;  4XQD A;  3O1O A;  2A7A A;  3RZL A;  4M3C A;  3SEE A;  1YIP A;  4XET A;  2UWC A;  1C8M 1;  3E6D A;  4AR2 A;  2ZHL A;  3AP9 A;  1MAC A;  2JB8 A;  1DGW A;  4PJY A;  3VBU C;  4QM9 A;  3WDU A;  3GZE A;  3WF3 A;  2BJS A;  2JKB A;  1VBA 2;  2R07 1;  3BIW E;  3T3Y A;  4XFG A;  5AC9 1;  4Q4Y 1;  1X33 A;  2PMW B;  5A1A A;  4OQ8 A;  4RQP B;  1YQ8 A;  1YI7 A;  3FFZ A;  1GOF A;  2PN5 A;  3III A;  3VKF C;  4YM0 A;  1D0G A;  1JZ5 A;  3U07 A;  1BJQ A;  4QM8 A;  1BLZ A;  4LUM A;  2XQX A;  3VN4 A;  3ZSK A;  3ATG A;  3HQR A;  1POV 0;  1O91 A;  3LDK A;  2XOM A;  5BNN B;  1MS8 A;  3VHN A;  5C33 A;  1JYT A;  1JOP A;  2WWS A;  2GC0 A;  3ETP A;  4YVW B;  2ES3 A;  3OYW A;  4Y4R A;  2JDN A;  2VZU A;  4IL7 A;  2BYV E;  2RVA A;  4IV1 C;  2MNG A;  1GLH A;  1OFS A;  3CNA A;  2ENR A;  4D6Q A;  5DMY A;  5L7O C;  3POF A;  1H2M A;  1QJU 1;  3M3C A;  1J3R A;  5L9R A;  3CQO A;  5FYB A;  2VZO A;  1HB3 A;  3OPT A;  4IEP A;  4YVS A;  4UYB A;  5GZD A;  4YM3 A;  2VNR A;  3AZX A;  1QOS A;  1TEI A;  2YPJ A;  3BAL A;  5C4W A;  4B29 A;  4B1L A;  4MZU A;  3RSJ A;  2LAL A;  4AL9 A;  2C4X A;  5FZB A;  1H1M A;  5FZC A;  4TLG A;  1EPW A;  2VOW A;  3AYA A;  5GLW A;  3CJI C;  3PUH A;  1HQW A;  5FZO A;  1PO1 1;  5DDJ 2;  1YHF A;  2BOJ A;  5C3S A;  2XLG A;  3ZSL A;  1T6G C;  1B35 C;  1XB9 A;  1QDO A;  4LBL A;  3Q8A A;  3V64 A;  1U12 A;  4GB3 2;  4RGK A;  1IPS A;  5FPB A;  2WNV C;  1MZE A;  1JBC A;  4K1Y A;  4JKL A;  4BLI A;  1CWP A;  3THC A;  4Y5S A;  4MGQ A;  3H9A A;  2WQ8 A;  4MGI E;  1ZZB A;  3AC0 A;  4RS5 A;  2RS5 2;  5KHI A;  1GQG A;  5DZG A;  4BXF A;  1BZW A;  3FN9 A;  4B8E A;  1HJF A;  2WNU B;  4XIO A;  1GZW A;  3NNF A;  5IW0 A;  3D82 A;  4OHY A;  5GM0 A;  1XNT A;  3USU A;  4Z2A A;  4JGY A;  3WSO A;  5KHH A;  5JAX A;  1HB2 A;  2JIJ A;  4RA0 A;  1VBE 3;  2QQM A;  2SBA A;  1OPO A;  2YY1 A;  4Q4W 3;  4QKB A;  5BNO A;  2WFP A;  1YQ6 A;  4HLT A;  4HMZ A;  1P8J A;  1UOF A;  1V6L A;  1W0O A;  3EXU A;  5JIA A;  4AQS A;  2VVD A;  5FP9 A;  3WG2 A;  3LB9 A;  1F4H A;  1W3V A;  2Q1M A;  4TSV A;  3VUO A;  1AR9 3;  5F2S A;  5A3M A;  1IS3 A;  4FOV A;  3H8R A;  1RTV A;  4ASK A;  5FZD A;  4AXO A;  1VBD 3;  2C26 A;  4RFR B;  4JVA A;  4TTG A;  3N9L A;  4MXW A;  5FIX A;  1Q8V A;  3H7Y A;  3ACI A;  4AFC A;  2Y64 A;  2F4L A;  2R1B A;  4MAD A;  3MIG A;  5FZL A;  1DLC A;  1XNA A;  2NZ9 A;  4LO4 B;  2TEP A;  5A3W A;  5IK4 A;  1Q3E A;  5IYY A;  2XQR A;  1S4C A;  2NP0 A;  1NCQ B;  3AMM A;  3VGI A;  3LSD A;  1W6Q B;  1XNB A;  3NST A;  4LBQ A;  4IET A;  5JPN B;  1VBB 3;  4Y3O A;  3ZVX A;  3LOB A;  3MID A;  4WVZ A;  1UAI A;  2X53 S;  3IZO A;  3K3O A;  5F5I A;  1AR6 2;  4DEV A;  1URX A;  3HT1 A;  2VC9 A;  2BER A;  2YZ4 A;  1UU5 A;  2C24 A;  1KJL A;  1BMV 2;  1YYN A;  3BOW A;  1GQH A;  1PVC 1;  1TNR A;  1YO8 A;  4MGS A;  1CAU A;  2VG9 A;  2G9F A;  2VU9 A;  4COU A;  5FZI A;  4YGE A;  1I6X A;  5LA2 A;  1GYK A;  1YLL A;  1S0B A;  2RJ2 A;  1ZRI A;  2B8M A;  4ASL A;  2EXK A;  4WVM A;  5JSP A;  3UKT A;  1DGR A;  1CAW A;  3VZN A;  2QDR A;  4LBO A;  4XJ9 A;  3Q9O A;  1VBE 1;  2ZMN A;  4Q4W 1;  4DIN B;  3C7O A;  5BNP B;  1RL3 A;  1C8M 2;  4X6Q B;  1DQ0 A;  5K9Y A;  4FOQ A;  3BPZ A;  3FL7 A;  2WA3 A;  4W6W A;  3OGR A;  1MR5 A;  1DGL A;  3WP4 A;  1QJY 3;  5AC9 2;  3BIE A;  2IFW A;  1G8W A;  3P1I A;  2HWF 3;  3K46 A;  4OUS A;  4Q4Y 2;  5M0T A;  2FDI A;  2BDR A;  2JE7 A;  1UNB A;  3AKP A;  2ARX A;  1VBD 1;  4EZ4 A;  3WCR A;  3TEZ A;  1ZX5 A;  5FUN A;  5CZK A;  5FYT A;  4ARY A;  1VAK A;  2A3X A;  2VO5 A;  2ARC A;  2OQ6 A;  3LSE A;  4TLF A;  4Z2W A;  1IGO A;  3SCF A;  4KI5 M;  4MGY E;  5FZ6 A;  5C8C C;  1EYB A;  2KD7 A;  3NO8 A;  2FBE A;  3NJV A;  4OHZ A;  3D6E A;  2CYF A;  4XJZ A;  4Q1R A;  2MEV 3;  4KL1 A;  1VBB 1;  5JCT A;  3LWC A;  3OUI A;  1QJU 2;  2W0X A;  1RUD 3;  2VUD A;  3PUQ A;  1GP4 A;  2HWD 2;  1GSL A;  1HQL A;  2OII A;  3R4D B;  1C5I A;  1QY4 A;  2ADD A;  1QOO A;  2DF7 A;  1UXZ A;  1OHF A;  1XPW A;  2XJU A;  3C3V A;  2VOX A;  4KBB A;  1Z0H A;  5E89 A;  3MEP A;  2WO7 A;  2PXJ A;  3POB A;  3NNL A;  1RMU 2;  2JDK A;  1UXX X;  2IXJ A;  2XL9 A;  5JXG A;  5IVF A;  2VME A;  5GZG A;  1EV1 2;  4LJH A;  5C8W A;  4BJ0 A;  4J6G A;  4Y1X A;  3POG A;  3WW2 A;  4RR3 C;  3J8F 3;  3I49 A;  4YGC A;  3FHQ A;  3NQH A;  1QWR A;  2LS6 A;  1O3Q A;  1YRZ A;  1Y9Q A;  5IAX A;  1LHN A;  1ODM A;  3S57 A;  2JIC A;  3BPS A;  2Y26 A;  2DCT A;  1TMF 3;  2WJS A;  3GZT B;  1UIJ A;  1GNZ A;  1QJY 1;  2DFC A;  3MIF A;  1RJ7 A;  4Y22 A;  5LA9 A;  2HWF 1;  3BTZ A;  3OGG A;  4XE9 A;  3H42 B;  2CV6 A;  1CAX B;  1LOF A;  4L99 A;  5DUW A;  5BNN A;  1XU1 A;  3UV9 A;  2ZGP A;  1J83 A;  2Y6G A;  4YVW A;  2WT0 A;  2AR6 A;  3U37 A;  1NE6 A;  2DUR A;  5JMO A;  4LE3 A;  4M3C E;  5T52 A;  1OXC A;  1HW5 A;  1KGY A;  1BBT 3;  2Q5T A;  3K4Z A;  3KT7 A;  4HSL A;  4QPI B;  3I2J A;  1OLR A;  5FLI A;  5EFU A;  5KWR A;  2D5F A;  4GJY A;  4XJA A;  3JD7 2;  4XFH A;  4YSF A;  1UPS A;  2W5F A;  2MEV 1;  1MS0 A;  3RVH A;  1S0J A;  3JQW A;  1RJ8 A;  3VZK A;  1RUD 1;  3NAP A;  3RZM A;  2OPK A;  5E8A A;  2X10 A;  5FMC A;  4Y24 A;  1D4V B;  2HEV F;  2YGM A;  2R7E B;  5HPO A;  2FD8 A;  3ACF A;  3KT1 A;  5KR7 A;  3KF5 A;  5J98 B;  5FTT C;  2Q4S A;  2D3P A;  3O5S A;  2HBT A;  2JDH A;  3HD8 B;  3WQ0 A;  2PEL A;  1X9P A;  1JOB A;  2HYX A;  5EJZ B;  3AXD A;  5LRS A;  2PLV 3;  2RS3 2;  1VMJ A;  3DYP A;  4YAR A;  2B5H A;  2W1S A;  4J1X A;  3CJI B;  3DCQ A;  3LQC A;  4MX3 A;  3OBA A;  4IGP A;  1BCX A;  2WKK A;  4PF1 A;  5LBF A;  2V73 A;  4BYY A;  4LBJ A;  3J8F 1;  1HX6 A;  3CZU A;  3Q8C A;  1HV0 A;  4XUT A;  1V6M A;  3MI8 A;  4LT5 A;  3GBF A;  3PTR B;  4CYD A;  2HEW F;  3H3L A;  4LOS A;  2TBV A;  4HK8 A;  1QH7 A;  2JJ6 A;  2WNU A;  3BYW A;  4PLM A;  3W59 A;  2VTX A;  3FLT A;  1TMF 1;  4YWA A;  4AHW A;  1SCS A;  2ZGN A;  2EAK A;  1UF2 C;  4HKO A;  4YGD A;  4AI9 A;  4YW2 A;  3ENR A;  3WIN E;  3A0N A;  4LNV A;  3K2O A;  5C70 A;  2W46 A;  2YMZ A;  4YFZ A;  5FK7 A;  2JG8 C;  4MGK E;  1DQ1 A;  3FC0 A;  1BBT 1;  2X5I C;  2UU8 A;  1NQD A;  2LRO A;  2C1F A;  1US2 A;  3ZDV A;  2XHN A;  3DPR C;  4YG6 A;  2VBB A;  5F32 A;  4JQT A;  1PZ9 A;  1AR9 2;  4PIZ A;  3PUR A;  3FHI B;  4MV2 A;  1WA4 A;  2P2K A;  3NMB A;  1GNH A;  2Y0I A;  2ZHN A;  3ZN4 A;  3K75 B;  3SCH A;  4D69 A;  4K21 A;  5FUI A;  1WCD J;  2V72 A;  2PLV 1;  4MO3 M;  2QQK A;  1W8U A;  3DV8 A;  4XXP A;  4LA3 A;  1JZ2 A;  2WSU A;  1Y43 B;  2I45 A;  5L9V A;  3FBY A;  5FMO S;  2VQ0 A;  2CL2 A;  3NJX A;  4DOU A;  1H1A A;  2Y33 A;  1LRH A;  4JV4 A;  4C8D A;  5JOZ A;  3R6S A;  2WYS A;  5KXB A;  4B7K A;  1YQ5 A;  4FBF A;  4LKF A;  1WW4 A;  4QPG B;  3NV1 A;  1R1A 3;  1N1Y A;  2XWJ B;  3RRD A;  4QGN A;  3U75 A;  1JTZ X;  5J7M A;  2ZX0 A;  4XQW A;  1A3K A;  2ZHM A;  5DPN A;  1HDK A;  4DUV A;  2E53 A;  3B69 A;  1BVP 1;  4RN5 A;  2Q8O A;  1UY2 A;  2PHL A;  1MS5 A;  2YU1 A;  3PME A;  4Y1U A;  3IN9 A;  4KNC A;  3AMP A;  4IW3 A;  1OI6 A;  3MFC A;  5T5O A;  1G9F A;  4LOR A;  2C5D A;  2K2S A;  4XFB A;  4XZP A;  4AGV A;  4AQ6 A;  3KS7 A;  1W6M B;  2E7T A;  5I8Y A;  2ZGK A;  3ITQ A;  4QDQ A;  2RM2 3;  2EIB A;  3IKW A;  5ANQ A;  3WR0 A;  4CEW B;  4JKK A;  1J1L A;  5GZF A;  4IEZ A;  4XEZ A;  1N1T A;  4IGO A;  5I8S A;  2E9Q A;  3OGJ A;  1QJY 2;  2J1R A;  4XF9 A;  3ZPO A;  4CDX B;  2HWF 2;  1G9D A;  5KHJ A;  1QQP 3;  4C1W A;  3M1H A;  1PIV 3;  3L2Y A;  3WNK A;  3WF0 A;  3IDB B;  5CIR A;  4AI2 A;  3T0B A;  2TUN A;  1TZO A;  1DQ6 A;  2ERF A;  3PVE A;  2ZAC A;  1IQA A;  4L92 A;  1SDW A;  1SDD B;  3NL1 A;  3HNY M;  2YG0 A;  1H6Y A;  3VLB B;  4NIG A;  1SBF A;  1R08 3;  3H50 A;  4CPB A;  2NMO A;  2V5D A;  3JBG 2;  2JDP A;  5F5Q A;  4EN9 B;  1JU4 A;  2GC3 A;  2VQT A;  1MVQ A;  2HYK A;  3LOI A;  3VBS B;  3VDC A;  1R1A 1;  3GNE A;  2F17 A;  1OA2 A;  4XBN A;  3A23 A;  2QJV A;  2FDK A;  4WM8 B;  2ZCW A;  3JUU A;  4R4Z A;  5CG8 A;  2UY8 A;  1UL9 A;  2D6M A;  2IC1 A;  1DYO A;  2WA4 A;  4LOT A;  4A6O A;  5E16 A;  5I0T A;  5JR2 A;  1A34 A;  1TME 3;  2RG4 A;  3SHR A;  3MV1 1;  2YPD A;  5JZG B;  4QXC A;  1GZT A;  4LR4 A;  2QCS B;  5FZK A;  4TYS A;  4AED B;  1OD5 A;  3HMY A;  1YFY A;  3ZXL A;  4ATF A;  2VE1 A;  1DP0 A;  5H9Q A;  3A7Q A;  2RM2 1;  5IVE A;  1H0B A;  2DWR A;  4DMI A;  4FXG B;  2Y6J A;  3MYX A;  2WN2 A;  5J1X A;  2PHF A;  1ASJ 1;  1Q8S A;  1CAX A;  4XJU A;  3A21 A;  2B9U A;  3I3E A;  2VTX J;  1NQJ A;  4PDW C;  3BTY A;  2VQA A;  3KGZ A;  4OHV A;  5FYV A;  3IAP A;  1W6N B;  2J7M A;  5FMD A;  3WLU A;  3W5M A;  1H8T A;  1QQP 1;  1W8F A;  4FI9 A;  4HL0 A;  2DVG A;  2ET1 A;  3IPV B;  5A3N A;  5CFC B;  5J36 A;  1PIV 1;  2R32 A;  3ZPY A;  2X8K A;  1K5J A;  2YRO A;  4YZ1 A;  3I3D A;  4BH9 A;  4Y20 B;  2OZ6 A;  2J1T A;  4AVS A;  3BU7 A;  1AL2 2;  3AKS A;  4Y1Z A;  4E9K A;  4F3J A;  4GIQ A;  3NV3 A;  4P9J A;  4E4D X;  5F5A A;  3W5N A;  3P6B A;  4ZS2 A;  1PK6 A;  5FPV A;  3TYJ A;  3RYK A;  4I3P A;  2VCM A;  1ZNP A;  3WOG A;  1O3T A;  3I2G A;  1DIW A;  1YFU A;  2RS1 3;  3IWZ A;  1CD3 G;  3CJX A;  4XHB A;  1W39 A;  2ZGO A;  2NPI A;  4GQ7 A;  3USS A;  1S0C A;  4HVQ A;  4HZF A;  4UFH A;  3I2I A;  3AFK A;  2QQO A;  5KHK A;  1E5S A;  5DUU A;  5CG9 A;  1JI6 A;  4Q0Q A;  3U10 A;  3VZL A;  5AFE A;  4A7Y A;  1V6K A;  1S0E A;  2OA2 A;  5EPA A;  4QHZ A;  4YNI A;  4XJW A;  2ZGT A;  2GN7 A;  3C7H A;  4MLO A;  4UOJ A;  5LAS A;  2QKD A;  2PLV 2;  1GIC A;  1TME 1;  2BRT A;  5FP8 A;  4AAX A;  1A8D A;  1XYO A;  2P4E A;  3KCX A;  1YCI A;  3VBF B;  2YC2 A;  2CWM A;  3LZZ A;  4NAM A;  1AXY A;  3WW1 A;  5J09 A;  1AR7 3;  4RYD A;  5A3L A;  5FZ7 A;  1YFX A;  3M8L A;  2K46 A;  3OGS A;  1ALY A;  3HBK A;  4GJZ A;  1FV3 A;  5FXV A;  1NA1 C;  2CTV A;  1QEX A;  4PI0 A;  1HV1 A;  5C9A B;  5GLZ A;  1DLL A;  4NHL A;  4XFA A;  4OI4 A;  1GNY A;  5D8A B;  2XKP A;  1D0H A;  1X7N A;  2WUH A;  4S2D A;  5ABJ C;  3S5Q A;  1PGW 2;  1WKY A;  1WMF A;  4BZ4 A;  1O4Y A;  3MLJ A;  1YWK A;  5D1I A;  4FPC A;  1CGP A;  2I74 A;  3E5U A;  4Q0P A;  1K5M B;  3I2H A;  3SIT A;  1UMI A;  2A70 A;  1GV9 A;  1GP5 A;  2GC2 A;  3ZYH A;  1G86 A;  2W52 A;  3JQX A;  4KU7 A;  3VDD C;  4XBQ A;  3AZY A;  3HPN A;  1N47 A;  1WLT A;  4IV3 B;  4LE4 A;  2XJR A;  3SH4 A;  4B1M A;  4BQY A;  2VJX A;  4CUB A;  1ULD A;  4CCK A;  2OX0 A;  3NNM A;  5HCF A;  4FFF A;  3ECQ A;  5FYZ A;  4XF1 A;  3HT2 A;  2RS1 1;  1Y7B A;  2YUE A;  1K3I A;  4QX8 A;  5FZ8 A;  3ACG A;  3RZK A;  2BGC A;  2E6V A;  5GJ6 A;  2P3Y A;  4CDW C;  1BXH A;  2LM3 A;  5FPA A;  5DZE A;  3GBW A;  4CUA A;  1JYX A;  3S7I A;  4CDQ C;  2VAU A;  1K42 A;  2FMD A;  4FOY A;  3ZFE B;  4EWA A;  1ZRD A;  1ULC A;  1GFF 2;  1RUI 3;  2PHT A;  2VBD A;  5GLU A;  5C7G A;  4SBV A;  2P3J A;  3OF1 A;  1ENS A;  1SFN A;  4P9L A;  4LLO A;  1ENX A;  1ULP A;  4IEQ A;  1ENQ A;  1RUE 3;  2W94 A;  3MBW A;  2E7A A;  1CZT A;  4YW5 A;  1AR7 1;  3AFG A;  5LWB A;  1NLR A;  1MQT B;  4GH4 A;  1PX4 A;  5F3G A;  4H3W A;  5LZ6 A;  4WM7 A;  3BVC A;  1N1V A;  3F2Z A;  4PIX A;  1OUX A;  5IHR A;  2I2S A;  2FDH A;  2W1Q A;  3OJB A;  5LAT A;  1C8N A;  4JQR A;  3QCW A;  4QMA A;  3C7F A;  4NO4 A;  5LEJ A;  5J37 A;  1RUJ 2;  4JCK A;  4LHS A;  1M06 G;  4UXA A;  4CUC A;  4HK9 A;  4ASM B;  3RJR A;  5FUP A;  1W6M A;  2VR4 A;  3ZMO A;  3AYD A;  1PMJ X;  3D4K A;  2ZHK A;  4TWT A;  5CAZ A;  4XCA A;  4AI0 A;  1W04 A;  5J48 A;  3D0J A;  1APN A;  2GMP A;  4HVR A;  3WT3 A;  3UES A;  5LA0 A;  3ZN6 B;  1JZ3 A;  4ZXK A;  2VNG A;  4I2O A;  4ITC A;  4QQ2 A;  4AF9 A;  1S2E A;  4CCO A;  1YEW A;  4CU6 A;  1Q8O A;  1ZBA 1;  2XDV A;  4HPK B;  4F83 A;  5A7W B;  3AMH A;  1UCX A;  1DDL A;  3M7A A;  3H8X A;  1Q56 A;  1YUD A;  1OD3 A;  1VRH 3;  4LLF A;  1US3 A;  2Z79 A;  4JGZ C;  4MGZ E;  3X29 B;  4CDX A;  5SV5 A;  2RHP A;  2R07 3;  5F2W A;  3RMY A;  4GWN A;  1GMM A;  1MZ5 A;  1AX2 A;  3ZFF B;  2HEY F;  2RDR A;  4OI0 A;  4EV0 A;  1QQP 2;  1NXD 1;  1FPN 3;  5KC6 A;  3BI3 A;  1PIV 2;  1SBE A;  3FMG A;  4WZF A;  5EV7 A;  2Z2S B;  5CKM A;  4AI1 A;  5BUV A;  4CU7 A;  4XF0 A;  1D2S A;  3O1V A;  1O4T A;  1NLQ A;  1RUI 1;  4A3X A;  4QXB A;  4YLZ A;  3WG1 A;  4A7K A;  5CEH A;  1Z7S 3;  1F4A A;  5CIS A;  1RUE 1;  4N53 B;  3VBS A;  4Q4X 3;  1R08 2;  2JE8 A;  5C5T A;  5HCH A;  4N7I A;  1R09 3;  2RDQ A;  4UWD A;  1UMZ A;  4HOO A;  4K3U A;  3VKL A;  4A6S A;  4DRR A;  4QQO A;  4I0A A;  4QB6 A;  4AOC A;  1V6I A;  4WM8 A;  5FBZ A;  2ZEY A;  3FLP A;  5FO8 B;  2EXH A;  3L9J T;  3RZJ A;  1H30 A;  3POW A;  4PBP A;  4QX3 A;  2RJL A;  2CNA A;  3ES4 A;  4MH0 E;  5JZG A;  2VCA A;  2B9V A;  1JZ4 A;  1L3J A;  1UIK A;  2PHX A;  3BOP A;  1RC6 A;  4WBB A;  5JOY A;  3THT A;  1W99 A;  4JAA A;  5FZ1 A;  1SLC A;  1CIW A;  1XSR A;  2ARB A;  1KDK A;  1TME 2;  5FZ9 A;  5BPX A;  1QKQ A;  2GNB A;  5A80 A;  1T6B X;  1A78 A;  1TG7 A;  5F3I A;  1JZ7 A;  4BXS V;  4FSJ A;  5F39 A;  5FPU A;  2YDE A;  4N8M A;  2DCZ A;  4BB3 A;  1QJX 1;  4AVB A;  5CFD B;  5FR3 A;  1VBC 2;  4UBH A;  4FTE A;  3ASI A;  2GH8 A;  4CZS A;  2CAV A;  2JE9 A;  1VRH 1;  4H55 A;  3C2U A;  1ZRE A;  1AL0 G;  4Q26 A;  4FFH A;  4V1P A;  4JDN A;  4IQP A;  5CFC A;  3HVD A;  1PZ7 A;  3IPV A;  1HB4 A;  1W8T A;  3POJ A;  4DB5 A;  1HN1 A;  1W0N A;  3PNA A;  4PDW B;  1LEN A;  3ZFG C;  3AVS A;  3VBH B;  3WNN A;  3B5L B;  1FPN 1;  1NXM A;  2YC4 A;  1V9U 2;  1UU4 A;  1UYX A;  3J7H A;  1W9W A;  4M0H A;  3QOP A;  4N9H A;  1NCR A;  2PQQ A;  3MLK A;  4CRQ A;  3V0A B;  2VMD A;  2O14 A;  1RUG 3;  2ZX1 A;  3DN7 A;  2QDN A;  4KG0 A;  1I5P A;  4Q29 A;  1XSQ A;  1F35 A;  1UZ0 A;  1T2X A;  2QE3 A;  4XTM A;  2BWC A;  5E6H A;  2HKX A;  4IE5 A;  1IPJ A;  5BYN A;  3QAC A;  1Z7S 1;  3A22 A;  5I0D A;  3CU7 A;  2NYY A;  1QNW A;  3NRU A;  3FUQ A;  3MW4 A;  4Q4X 1;  4CXW A;  2C9K A;  2WZP P;  2RS1 2;  1R09 1;  1CAV A;  5F37 A;  1WLD A;  4W6X A;  3ROU A;  4Y33 A;  4IUG A;  5G04 L;  1H8T C;  1ZZ9 A;  5DUX A;  1C1F A;  1LKN A;  2AEZ A;  2W1W A;  5DAP A;  3OBZ A;  4QD2 A;  4O7X A;  4LHN A;  4URA A;  5FPX A;  1Y3T A;  4NPM A;  4L11 A;  4I3G A;  4LMF A;  1JH5 A;  1XE0 A;  3T1L A;  1WGP A;  5FWJ A;  1PK6 C;  1RUC 2;  5FJK A;  5K0U C;  3IAQ A;  5HXM A;  1OQ1 A;  2BV4 A;  2C6S A;  3SC7 X;  5FCC A;  4QQL A;  2A3Y A;  5C9A A;  4AGR A;  4Q27 A;  3OGV A;  2Z4F A;  5D8A A;  1V6N A;  4RSU A;  4JTN A;  4UI9 L;  1BVV A;  2IXH A;  2WRA A;  2PAE A;  1PVC 3;  1Q5O A;  3DYO A;  3CDZ B;  3N9N A;  4A3Z A;  4EN7 B;  4NIH A;  3ZYF A;  4AFD A;  2WAB A;  3OCP A;  3UGH A;  3AKQ A;  2VZ1 A;  3OB8 A;  2A6Z A;  2Y38 A;  4ZPI A;  1DZR A;  2YBS A;  1AX0 A;  4IV3 A;  1WMX A;  1W05 A;  1ND2 C;  1N1S A;  1ZM1 A;  4I0W B;  3CO2 A;  2AZ5 A;  2D3R A;  1OUR A;  1RUG 1;  2E32 A;  2JEM A;  4UW6 A;  1TQ5 A;  1J3P A;  2KM2 A;  2WZ8 A;  2DDU A;  3PJY A;  4XYX A;  4COV A;  1RVF 1;  4E4H A;  2AEY A;  4FFG A;  3VBO B;  3RI8 A;  2DCY A;  3W20 A;  3WDV A;  4EN0 A;  4NRQ A;  3VL8 A;  1ND3 C;  1IS4 A;  3WQ1 A;  4NN0 A;  4ATE A;  2DBN A;  2Q0A A;  1O3R A;  3T2O A;  3SMH A;  1PHM A;  2WLP A;  4QX0 A;  4XAA A;  3E6B A;  4RGG A;  4UAP A;  4HXC A;  4FXK B;  3MIE A;  3KQR A;  4Q0S A;  3RGB A;  1SLB A;  4MUV A;  5KXD A;  2FCT A;  2FZ1 A;  1UYZ A;  1W6P B;  1CJP A;  1XC6 A;  4UT5 A;  1RUI 2;  4RHV 2;  1JOD A;  2VUC A;  2XHK A;  5ISL A;  2RDN A;  3KT4 A;  4OZX A;  5JVV A;  3LEI A;  1VLN A;  4B4R A;  1LB2 A;  3OY8 B;  2GAU A;  1PO2 2;  2B46 X;  1XYP A;  5A7P A;  2EF6 A;  3M4F A;  2OZJ A;  2JX9 A;  3GHN A;  1S1A A;  3WW4 A;  1OOP A;  2CDP A;  2R16 A;  1F5F A;  4COW A;  4XMA A;  1W0P A;  1LGN A;  4KGG A;  3MPB A;  4NUB A;  3WNO A;  1CR7 A;  3VBR B;  1XNK A;  4AVA A;  3GCW A;  5DN2 A;  4NPR A;  3S6P A;  3TEX A;  5EZW A;  3POS A;  2WIN B;  3LA7 A;  4GUL A;  3ZN6 A;  1JYV A;  3I2D A;  4CDU C;  5T5J A;  4BLJ A;  2ZEX A;  1KJR A;  2NN8 A;  4HPK A;  1VIW B;  1W2U A;  2BNO A;  2E33 A;  3AVR A;  4GAL A;  4YW7 A;  5A7W A;  4P5Y A;  3WHT A;  3D5O A;  4N43 C;  2R06 3;  2HBU A;  2JKX A;  4GH4 C;  2G19 A;  4LBN A;  2J1A A;  4WM7 C;  1QJE A;  1V0A A;  2Q1F A;  3ZFF A;  3GGL A;  4A45 A;  4LBK A;  3ZM8 A;  1W28 A;  2R07 2;  4IER A;  5GKA C;  3MZH A;  1ULG A;  1VR3 A;  2ZKN A;  1JOJ A;  2UUR A;  3WP3 A;  1ENR A;  2IXC A;  4YRD A;  2VW2 A;  2W1U A;  2YFU A;  1W8Z A;  3W9A A;  4QX1 A;  3I3B A;  4XBL A;  2L9L A;  2BNN A;  1PM4 A;  4JDO A;  5T5L A;  4N53 A;  1VMF A;  2QFE A;  1FI2 A;  5HI0 A;  4NHM A;  4FTS A;  4BK5 A;  1Z7S 2;  2RMU 3;  3NKT A;  2ARA A;  4Q4X 2;  2WLQ A;  5A32 B;  3C7E A;  3OOX A;  4Z92 B;  2HWC 3;  1R09 2;  2D44 A;  1UY1 A;  4IEV A;  5L36 A;  3PHM A;  4G4F A;  2W2I A;  3DYM A;  4GD4 A;  3MO4 A;  5IWF A;  5FWE A;  5B2G B;  3LFI A;  4R52 A;  2JG9 C;  3N9P A;  2VH9 A;  2FDJ A;  4K40 A;  3GDB A;  1YQ2 A;  1ODN A;  2CWS A;  2JDA A;  4ORF A;  5FZF A;  1PO1 2;  3MW2 A;  3KM5 A;  3M3E A;  2AAC A;  2YBP A;  3CF6 E;  4UFK A;  3VD7 A;  5CFD A;  2ZTN A;  2X05 A;  4CEY C;  4DXS A;  5G05 L;  3MDP A;  2R06 1;  3SLI A;  1SLI A;  3KSC A;  4BQ3 A;  1NYW A;  3WNM A;  4BIO A;  4E8D A;  1EAH 3;  2NLR A;  5T55 A;  4NR1 A;  4JKM A;  4RQP A;  4AEJ A;  2D6L X;  4JZR A;  1QHD A;  5FJH A;  4C0H A;  3VBU B;  2XXZ A;  2LUW A;  5LA1 A;  3AXE A;  5DAV A;  3WDT A;  4XIL A;  3UGF A;  3V0A A;  4K1Z A;  4OMD A;  5FY0 A;  3RZH A;  1LCL A;  4QGL A;  2WN3 A;  3U78 A;  3O0X A;  2EAL A;  1F15 A;  5BY5 A;  4GWI A;  4M00 A;  1QNY A;  2HWE 3;  4Q4V 3;  4GWJ A;  4BA6 A;  3O7O A;  1D7P M;  3J26 N;  4LUL A;  4WZC A;  1PMH X;  1BYH A;  1COV 3;  1O8S A;  4J1W A;  2CGN A;  1SPP B;  3WW3 A;  1UOJ A;  3KV5 A;  2VNO A;  3P3P A;  2QNK A;  2RMU 1;  3MFA A;  3NW4 A;  3RWK X;  5F6L B;  4IV1 B;  3ZR5 A;  1LUL A;  5EJ1 B;  4LBQ D;  5C71 A;  1O6U A;  5L7O B;  4NAO A;  4AZZ A;  2BTV C;  3MF9 A;  2HWC 1;  1S0D A;  2WQ4 A;  3AKT A;  2YV8 A;  3BB6 A;  1OMI A;  4LO6 B;  2VTF A;  2WFF 3;  3WUC A;  2IXL A;  1UKG A;  1RIR A;  2WZE A;  1PNF A;  1NCR C;  1NE4 A;  2DYC A;  1XRU A;  2BQP A;  3H1M A;  3LD8 A;  5FPZ A;  4A41 A;  5FQ0 B;  3T09 A;  3GJA A;  3UL2 A;  1LAJ A;  3GCX A;  1CJD A;  1VAV A;  2A6X A;  4IES A;  1WMD A;  1PGS A;  2PTM A;  2GP5 A;  1DG6 A;  2X09 A;  1IG0 A;  3CIH A;  5AVP A;  4TN7 A;  1B35 B;  3I4I A;  2IXI A;  1YC6 1;  4YVS C;  1DFQ A;  1YFW A;  4H7L A;  4OI2 A;  1E5H A;  2XVL A;  1EAH 1;  1UOB A;  5T3N A;  5C4W C;  2HWB 3;  4GKX A;  4KGQ A;  3E1F 1;  4YGB A;  2W87 A;  2WNV B;  5D21 A;  5BXX A;  2XJT A;  1HRV 1;  3T08 A;  1OQE A;  5D2A A;  1SCR A;  2JDY A;  4DZG A;  1PVC 2;  4Q8K A;  3Q8B A;  4GKY A;  1ZRF A;  1HXS 3;  1FOD 3;  3MV0 1;  1X8E A;  3THD A;  1RXG A;  3VB9 A;  3SEP A;  3A4U A;  3NKG A;  1C28 A;  1TE1 B;  2A5Z A;  1DZT A;  3O14 A;  3S30 A;  3KQ4 B;  4Q4V 1;  2HWE 1;  4PQQ A;  2E26 A;  1RED A;  4MVT A;  5IJR A;  3RWN A;  3VKO A;  3HN1 A;  1U5Z A;  2DFB A;  4FO9 A;  1W2T A;  1VBE 2;  1COV 1;  4Q4W 2;  5L19 A;  5IK5 A;  4ZU4 A;  1O3S A;  5C6C A;  1RGS A;  3OG2 A;  1VPH A;  2Y6L A;  4DUW A;  1J3Q A;  5FKC A;  4BE3 A;  1BK1 A;  3W21 A;  1HB1 A;  1BK0 A;  1YIF A;  4RS5 C;  3PUS A;  2VXJ A;  2DBI A;  3VL9 A;  1SHW B;  3M3O A;  2TNF A;  4DS0 A;  1FT9 A;  3H7J A;  4I09 A;  1JMU B;  2XLA A;  2WFF 1;  4FCA A;  3V56 A;  4FPO B;  1VBD 2;  4JGY C;  1LTE A;  4TXW A;  5JXJ A;  1STM A;  1A6C A;  1N3P A;  1NCQ A;  4AW7 A;  1LOA A;  1IS6 A;  2IFR A;  1W6Q A;  4D3W A;  5BNO C;  5HV0 A;  3QD6 A;  1LOE A;  1KD7 A;  1SBD A;  2RR1 1;  5FBJ A;  3JXS A;  4QXK A;  4MHR A;  1LOB A;  1QOT A;  2P6H A;  1AYN 3;  3TBD A;  2BBV A;  3NNJ A;  2VQU A;  1W2O A;  1U0A A;  1W9Y A;  2Q30 A;  4Q2F A;  1VBB 2;  2A1X A;  2VY0 A;  2YGL A;  1CX4 A;  3M3Q A;  2QQI A;  4WV8 A;  5T5P A;  3VBR A;  1WW7 A;  5FY8 A;  3GF6 A;  3LEG A;  2HWB 1;  2B7Y A;  1LHO A;  1RYY A;  2B4K A;  2VMH A;  5TSW A;  1D4M 3;  3CBN A;  2EXI A;  1GAN A;  2PHU A;  2Z42 A;  4Y1V A;  4R8H A;  1HXS 1;  1REF A;  1FOD 1;  3EYP A;  3ON7 A;  4FPE A;  4UW3 A;  5I91 A;  1H2L A;  1XOY A;  3T30 A;  1IOA A;  2BUK A;  4P08 A;  3I2O A;  5BNP A;  2J1V A;  1W8W A;  4BQ4 A;  2W08 A;  2W9X A;  4CA9 A;  4CDU B;  1KXG A;  4B3N A;  4N9I A;  4QPY A;  3B01 A;  1H2N A;  3A0K A;  5DUV A;  3FFQ A;  1A8M A;  3K51 A;  1OOP C;  2F6B A;  2ZGL A;  2N7G A;  1BEV 3;  1ASJ 3;  3E5Q A;  2ZGQ A;  4Q8L A;  1PNG A;  4LPL A;  4AYU A;  2ZX4 A;  5ANN A;  2WS9 3;  2FHR A;  2XH6 A;  1LHV A;  4H2A A;  1BKZ A;  3POY A;  4KMQ A;  5IVC A;  1HQN A;  2PHW A;  3BTA A;  3QLQ A;  4YG0 A;  3T0A A;  5C5U A;  2H0V A;  3LGR A;  4CCE A;  4BIF A;  3J7N A;  3SH5 A;  3DEM A;  5DG2 A;  4D7Y A;  2MHF A;  1QXJ A;  2Y6K A;  3UYJ A;  3O1P A;  2OT7 A;  1PX3 A;  3O1U A;  3OPW A;  2YC0 A;  5JSR A;  3LEM A;  4HT1 T;  2JIG A;  2PAK A;  4IEX A;  4XMI A;  3FX3 A;  3MHZ A;  2ZML A;  5A1L A;  3R0R A;  5A32 A;  3UJQ A;  1AHS A;  1CZS A;  2Y34 A;  2C9A A;  4DXR A;  4IE4 A;  3PIJ A;  1AYN 1;  5C8C B;  2ATF A;  4S2G A;  4UFI A;  1BQP A;  2MEV 2;  2Y60 A;  3MPP G;  1RUD 2;  4ERO A;  1C1L A;  2HWC 2;  4YZ4 A;  2E63 A;  4FT8 A;  3ZKY A;  3ZXF A;  3WD5 A;  2W95 A;  1D4M 1;  1DZQ A;  1POV 3;  1Y9M A;  2IWG B;  4EQV A;  2KR2 A;  3IIA A;  4KWK A;  5JR7 B;  4BHP A;  2JEC A;  2Z69 A;  2GP3 A;  1KDM A;  1JZ8 A;  1QIQ A;  3B9I A;  3P5B A;  2D7F A;  5FY1 A;  3ZXD A;  3HN3 A;  4Q0U A;  5FO7 B;  4YW4 A;  2VMF A;  1KS5 A;  4AEK A;  2YYO A;  3VZJ A;  2WWU A;  2J1E A;  3J8F 2;  4RR3 B;  3PUA A;  2RDS A;  4LKS A;  3D0S A;  3VBU A;  5FYM A;  2WO2 A;  5LB6 A;  3WCS A;  5FYY A;  1BEV 1;  3O1R A;  4MYE A;  4PQ9 A;  4MGT A;  2IVI B;  4OHX A;  5EP9 A;  1RUF 1;  1PGL 1;  1JXN A;  1TMF 2;  2WYF A;  2VW1 A;  1O5U A;  2EID A;  2WS9 1;  3J7L A;  4L97 A;  1WCK A;  2WNE A;  3Q8E A;  4B4P A;  4CU8 A;  1W2A X;  2QZ3 A;  4KWJ A;  1UOG A;  2VCB A;  1Q8Q A;  1L7Q A;  4QPI A;  3VDB A;  1FAT A;  1SPP A;  1IKP A;  3C7G A;  5FXW A;  5GAL A;  4CCM A;  4XHX A;  3N9O A;  4Q4V 2;  1HKD A;  4GA9 A;  3B00 A;  1HIX A;  1TVG A;  2DVB A;  3TNQ A;  4NE9 A;  2UY9 A;  1BBT 2;  4IV1 A;  5E88 A;  2XML A;  1W8N A;  3I97 A;  4ZXE A;  5L7O A;  1ZZ7 A;  4WVV A;  4FQ4 A;  5JIU A;  1U5Y A;  1VBA 3;  1JUI A;  4RQP C;  3JU9 A;  4W65 A;  4QWN A;  1FXZ A;  1DGR N;  3POI A;  1LGC A;  1W90 A;  3GAL A;  4JRL A;  4KU8 A;  1LOF C;  4E2Q A;  4M3C F;  5BNN C;  5FQ0 A;  2ZS6 B;  4ZS3 A;  5LCW L; 
#chains in the Genus database with same CATH homology
 5LW9 A;  5FY0 A;  2Q8E A;  3U78 A;  5IVV A;  5FZ1 A;  5A3T A;  5FZ9 A;  5FXX A;  3KV9 A;  4CCL A;  5A80 A;  5ISL A;  4Y4R A;  4IGP A;  5F3I A;  4XDO A;  5FY7 A;  5A7O A;  4D6Q A;  5F39 A;  5FPU A;  5K4L A;  4CCK A;  3KV5 A;  5A7P A;  2OX0 A;  3AL5 A;  5FZ0 A;  5FYZ A;  5IVY A;  3KV6 A;  4QX7 A;  2P5B A;  3OPT A;  3PU8 A;  5FYB A;  5FZE A;  4UF0 A;  3PTR B;  5A7N A;  5IVJ A;  4QX8 A;  5FZ8 A;  5FYH A;  4NUB A;  5A7S A;  5FPA A;  2YBK A;  5IVC A;  4LIT A;  5FZB A;  4AI9 A;  5FZC A;  4D6R A;  4EZ4 A;  3AVS A;  5FUN A;  1VRB A;  2OQ7 A;  3DXT A;  3LD8 A;  5FZO A;  5FYT A;  3K2O A;  2OQ6 A;  2YPD A;  3UYJ A;  5F3C A;  2OT7 A;  4QXC A;  5FPL A;  3OPW A;  3AVR A;  5A7W A;  3PU3 A;  5FZK A;  5FZ6 A;  5E6H A;  5FV3 A;  2Q8C A;  4EYU A;  2WWJ A;  3KVA A;  5A1L A;  5FZ3 A;  2GP5 A;  5FPB A;  5IVE A;  4TN7 A;  5LWB A;  5FZ4 A;  2Q8D A;  3PUQ A;  3U4S A;  5F3G A;  3KV4 A;  5F32 A;  5A1F A;  3DXU A;  5FP4 A;  5FZG A;  5F37 A;  4CCJ A;  3PUR A;  4Y33 A;  4UF0 B;  5FYV A;  4BIS A;  3NJY A;  4BXF A;  4IGQ A;  5A7Q A;  5A3N A;  5IVB A;  2PXJ A;  4CCN A;  4BU2 A;  5IW0 A;  4URA A;  4LXL A;  5IVF A;  5FUP A;  5F5C A;  4CSW A;  5LY2 A;  2GP3 A;  5FWJ A;  3PDQ A;  5FJK A;  4D6S A;  4XDP A;  5A3P A;  5FZO B;  5F3E A;  5F5A A;  5FY1 A;  5FZA A;  5FPV A;  3KVB A;  5FY5 A;  4LIU A;  4V2W A;  4CCO A;  2XDV A;  2XUE A;  4HON A;  5A7W B;  4V2V A;  5FP9 A;  4C8D A;  2WWU A;  4AAP A;  3PUA A;  4DO0 A;  5F2S A;  5FYM A;  5FYY A;  5FYC A;  5FP3 A;  2W2I A;  3PUS A;  4GD4 A;  5F2W A;  4DIQ A;  3N9N A;  5IWF A;  5FYU A;  5FZD A;  5FWE A;  5FYS A;  4ASK A;  4QXH A;  2VD7 A;  5FY9 A;  3N9L A;  3AL6 A;  3N9P A;  2YU1 A;  4GAZ A;  5FZF A;  3ZLI A;  2YBS A;  3N9Q A;  5FYI A;  5FZL A;  2YU2 A;  5FZM A;  5A3W A;  4EZH A;  5FP8 A;  5FXZ A;  5FXW A;  2YBP A;  4CCM A;  3N9O A;  4QXB A;  4QU1 A;  3K3N A;  5CEH A;  5FBJ A;  5FY4 A;  4GJY A;  5ANQ A;  2XML A;  4Y3O A;  5FZ7 A;  4E4H A;  3N9M A;  4CUG A;  3K3O A;  4GJZ A;  5F5I A;  5FXV A;  2OS2 A;  3RVH A;  3LDB A;  4HOO A;  4QWN A;  5FZH A;  4IGO A;  5FP7 A;  5FY8 A;  5LY1 A;  5FJH A;  3ZPO A;  5KR7 A;  2XXZ A;  5FZI A;  4LIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...