5IK8A

Laminin a2lg45 i-form, g6/7 bound.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
381
structure length
381
Chain Sequence
APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Laminin subunit alpha-2
total genus 78
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A02
4YG6A 4YGBA 3LCPA 2A3WA 4RA0A 1YIFA 3TB0A 1LHWA 1LHNA 4BLIA 2EXJA 1MR5A 1MZ5A 1D0HA 1ULFA 2C5DA 2JECA 1SBDA 2R16A 1LHOA 1AXZA 1DQ1A 4CTEA 3RRDA 3ZSJA 5JOZA 4P9YA 3V0BA 4FPJA 2CTVA 4PCRA 1APNA 2DV9A 3FLTA 1W6MA 4CZSA 5E8AA 2A3XA 1YI7A 5EWSA 3INAA 2ZA9A 2ZGKA 1F5FA 1LECA 1ULEA 4Q8KA 3RSJA 4LBJA 3SLIA 2P34A 3ZXLA 1LOGA 2SBAA 2LTNA 2W68A 4FPGA 1ENRA 2R0FA 3CNAA 1H9PA 3ZXKA 1WLDA 2WSVA 1S0EA 1MS0A 3V0BB 4XBLA 1D2SA 5KXEA 3WV6A 4DQAA 3WG3A 4ATEA 1QMJA 2DUPA 1WW4A 1UL9A 2PHFA 3GALA 3OGGA 4Q8LA 4Y1XA 3SNMA 3W58A 3IN9A 5GLWA 2WT0A 1Z0HA 3KM5A 3ZSMA 4HANA 1MS9A 5CNAA 1WLCA 3LSEA 4FOWA 3ZSLA 3USUA 1W6QA 2SLIA 2OW4A 1ENQA 1CPMA 1MZ6A 3R4UA 3V65A 3AX4A 1XQNA 3M3CA 4XJWA 1AX0A 1W6PB 3IPVA 2DVAA 3TAYA 1HQLA 2GNMA 2VW2A 4AVSA 1FV2A 1IKQA 1LCLA 1QU0A 2GDFA 5GALA 3POWA 5GM0A 2D7FA 1LU2A 4K1ZA 1UN1A 5HCBA 4XJAA 3A4UA 2R1BA 3ZSKA 5E89A 1ULCA 2PHUA 1QOOA 2CL2A 5T52A 4XTPA 1CPNA 2ZGPA 1W6QB 2WT1A 5DZGA 3USUB 2PHRA 2ZGOA 4XJ8A 3LSDA 3N35A 4YZ5A 2JJ6A 1OKQA 1IS3A 3AYDA 5CA6A 1U0AA 2EF6A 3OYWA 5FRAA 2PHTA 2E7QA 3NV4A 2GMMA 1LOFA 4Y26A 2ZGQA 3AZXA 3ILNA 4YM2A 2ZACA 2FMDA 4Q2FA 4W65A 5DZEA 2D6MA 3WHUA 4AWDA 2A6ZA 2DURA 4LBQB 4R9DA 4YG0A 5HCAA 3ZYRA 1AX2A 4Y22A 3KQRA 2KM2A 3L2YA 3WHTA 1VIWB 1VLNA 1UZYA 3N7JA 3WDYA 4FQ4A 1HQWA 4WVWA 5DUVA 5EYXA 4TZDA 1AJKA 1DZQA 2A70A 5EYYA 1AZDA 2YROA 4AYUA 4DRRA 2ZKNA 1QNWA 1LEDA 4LBNA 1PZ7A 1DLLA 5T5OA 4M3CB 4YFWA 1I1EA 1GICA 1G9DA 2ES3A 1N3QA 3HN1A 1W0OA 4U36A 5H9SA 4XJUA 3A0KA 4YGEA 1YXWA 3NWKA 1IS5A 5CBLA 1LOBA 2OUJA 3VUOA 3HMYA 1AVBA 3N7LA 4WVVA 3B00A 1QOTA 2A6YA 1LENA 2WLQA 4M3CF 1VAMA 3FLRA 2P3IA 1DQ6A 2YV8A 1LULA 3RMYA 1PZ9A 2ENRA 4ITCA 1QOSA 2WJSA 3O5SA 4JCKA 4YW2A 1EPWA 4YGCA 4XIOA 2ZGRA 5JOWA 1Q8PA 2D6KA 4BMEA 4PBOA 5IUQA 1OFSA 2CWSA 2BQPA 1Q8SA 2TEPA 2GNDA 4Y1YA 1KRIA 4GWMA 1IOAA 1BXHA 1G9BA 2YXSA 2D6LX 5GZFA 3T2TA 1MACA 3JUUA 3WLUA 2NM1A 3B9CA 1V6NA 1G9AA 1CESA 1PZ8A 3SISA 5AVAA 2EXKA 4JRAA 4XMAA 4C1XA 1F31A 4GXLA 4C1WA 2RHPA 1SLTA 4YW3A 2AREA 4DS0A 3WDTA 3NV2A 3WDUA 1ONAA 5T54A 1R1ZA 2JKBA 2UURA 3I8TA 3WG1A 4YZ2A 1JYCA 1DGLA 2VW1A 4YW5A 3RMXA 1RITA 4R9AA 3AP9A 1GNZA 5T55A 2ZGUA 4GKYA 2P3KA 3OY8A 2JDZA 2ZGLA 4XE9A 3V0AA 4XHBA 4YZ1A 2Q5TA 3N3HA 5SV8A 1GYKA 5DG2A 2ARXA 3VKFC 2D3RA 4FP2A 3VKLA 5GLVA 3DUIA 1CN1A 1I3HA 1SCRA 1SFYA 1GLHA 1SLAA 4FPOB 4PF5A 4XHXA 3T1MA 3OBTA 1KDMA 3NV3A 5JVVA 1UPSA 2R0HA 1S0IA 1Q8OA 3WZ1A 2VXRA 1KDKA 3PMEA 1S1AA 2DU1A 1FYUA 1DBNA 1IS4A 2CNAA 3APBA 3GNEA 3I4IA 4Q1RA 3UJQA 2EIGA 4AVVA 1UX6A 1MVQA 1CVNA 1QNYA 4LBKA 2AENA 1DYKA 1WCSA 2NN8A 3AYCA 2NYYA 1JN2P 1DQ4A 3RQ0A 3UK9A 1F9KA 3QCWA 5H9RA 1FATA 1N3OA 2LALA 3B01A 2R49A 2ZGSA 3D5OA 3O0WA 3ZPYA 3BTAA 2I2SA 2E51A 4BQ1A 4LBMA 4IQPA 2HYKA 5JDBA 2D3SA 3WCSA 2ZHMA 2A3YA 4P9WA 3IKWA 1WW6A 2JD4A 3D4KA 3AXDA 1GNHA 2ZGNA 3WNXA 5IK4A 2PELA 4XDQA 1LGCA 4M3CA 2CWMA 4XTMA 1RIRA 1KQRA 4XBQA 1FAYA 3MEPA 4ZXKA 3FUQA 4DRVA 1LJ7A 2GNTA 3N36A 3ENRA 4FPYA 4D69A 1AF9A 3WDWA 3WDXA 1MS3A 3ILFA 3V64A 1N3PA 3AJYA 2FHRA 2VH9A 2NP0A 1DQ2A 1DQ5A 2YZ4A 4BMBA 4LBQA 2A6VA 5HCFA 2Z42A 2GNBA 4YW1A 5H9QA 4AGVA 1KITA 4XXAA 4PBPA 5IK8A 3ZXFA 2P37A 2ZHLA 2ZMLA 2JE9A 4FOQA 2A6XA 3AYEA 2NZ9A 4XJZA 1AX1A 4GALA 3DGTA 1G7YA 4AVTA 1V6LA 5T5PA 1URXA 3FLPA 1N1SA 3R4SA 1WD4A 2VUAA 1CIWA 5GLUA 3AZVA 4FPEA 4YG3A 4BM8A 2DVBA 3AP6A 1FNYA 4RL7A 5GLTA 3BIWE 3POYA 1SACA 1Q8VA 5L73A 4LBQD 2EXHA 3M3QA 5E88A 4NO4A 1LODA 5T5LA 1DYPA 1GKBA 4ISRA 1BZWA 5DXDA 5LK5A 2W39A 1JW6A 1VAVA 5DZFA 4ATFA 2YMZA 3H0OA 1O4ZA 1UZZA 2AGSA 3BOPA 1O4YA 3QLQA 4ISQA 1C1LA 4UW4A 3WG4A 3AFKA 5IT6A 3U4XA 2NMNA 1A3KA 1C57A 1HLCA 4LBLA 2ZBJA 4FPHA 1YO8A 1SCSA 2CYFA 4R9BA 3MW2A 4FOYA 1G9FA 1A78A 3FFZA 3RS6A 1V6JA 2UU8A 3IM0A 2C9AA 1LESA 2AUYA 1W6MB 2VY0A 2ZGMA 4LBOA 1MS5A 4CRQA 1GZCA 1DQ0A 3FBYA 3SH5A 1DIWA 2YY1A 3AP7A 2DVDA 1AJOA 2CY6A 1LGNA 1CQ9A 1X50A 3AP4A 1J1TA 3MPPG 1KJRA 4YM0A 2EAKA 4XIKA 2E7TA 1CJPA 4Y1ZA 3FUOA 1FX5A 1Z78A 3IMNA 3M3OA 1QGLA 1FV3A 2G4IA 3AZWA 1LOEA 1V00A 1UAIA 2ARBA 4FPFA 2E6VA 4M00A 2DVGA 1LHVA 1HKDA 3AYAA 3JU9A 1QDOA 2ZZJA 1LTEA 4I30A 1CONA 1QKQA 2GN7A 3AZYA 3PVNA 2WT2A 1GZ9A 2D6PA 1JBCA 1ENSA 4UW5A 3HR9A 2DTWA 4YFZA 2DVFA 4FPKA 2GN3A 1H9WA 1N1TA 2GMEA 3O0XA 5EXOA 3ASIA 2XB6C 3BODA 3RG0A 1ZM1A 2VW0A 1NXD1 2WNEA 4FPCA 3VKMA 3WG2A 2PHXA 1JYIA 1W6OB 3AK0A 2UWCA 3SH4A 4F83A 1V6KA 2V73A 3ZXEA 2D43A 2W08A 5IK7A 1H30A 4Y1VA 1S0CA 5GZDA 1GV9A 3O0VA 1BKZA 4OZXA 3W59A 1BJQA 1N1YA 4BPZA 4FP3A 1QF3A 4PQ9A 2GALA 2WSUA 2ZMKA 4XYXA 5BYNA 4YM1A 5CAZA 2EALA 1S0GA 1ULDA 1YRZA 4Y20B 2A7AA 2AR6A 3AJZA 1S0DA 4HL0A 2GMPA 3V0AB 1AXYA 3OY8B 2H0BA 4XBNA 2DWRA 5KXBA 3NV1A 1HDKA 1C1FA 3AXEA 4KBBA 5DG1A 4ASMB 2W52A 4FVVA 1SLIA 3WCRA 1YYNA 1Q56A 1UKGA 2D44A 4GKXA 4U2AA 1G86A 2ZGTA 1FNZA 1GZWB 4GA9A 4P9XA 3UJOA 4DFSA 1AXKA 4BLJA 3WUCA 1Q8QA 3MW4A 2E53A 1JUIA 1LOFC 3R05A 1N1VA 2AYHA 4Q27A 1WBLA 4NOTA 5KXDA 4L8QA 1WW5A 2WQZC 4K21A 3AP5A 3ZVXA 4AGGA 5JOYA 4M01A 4TYSA 2ZAAA 1A8DA 2A5ZA 1W6NB 3VV1A 4UW6A 3WVJA 5JOXA 1BYHA 2A71A 4FQZA 3N7KA 2D6NA 1IS6A 3T1LA 5DUXA 2ZHKA 4XILA 3POSA 4XJ9A 4P14A 3WDVA 4Z8BA 4Y1UA 3O12A 5FREA 1W6NA 3OJBA 5GZGA 3PVEA 2UWAA 1SLCA 4SLIA 1N47A 2NMOA 4YM3A 5KXCA 4WV8A 5CB7A 1C4RA 1DHKB 1WW7A 3PJQA 1OQ1A 1V6MA 2WKKA 3B3QE 1MS4A 2A6WA 3MW3A 2ZABA 1MS8A 5DUUA 3VKOA 1Y7BA 2B7YA 4YLZA 1G9CA 4YZ3A 1B09A 3SH3A 2D6OX 1KJLA 1SBFA 2JE7A 5F5QA 2OUHA 1GZWA 5JMCA 4K1YA 2EXIA 3SITA 4ZKTB 1V6OA 1LOAA 3B69A 1VALA 3D6EA 2DU0A 1SLBA 1ZA4A 1CR7A 4H55A 1RINA 4FOVA 5GJ6A 2P2KA 4Y24A 3M1HA 4Y22B 1JXNA 1WD3A 2XG3A 1MS1A 5GZEA 1WUVA 2A75A 2DTYA 2ERFA 1GBGA 4JC1A 4Q26A 3ZYPA 4GWNA 3UL2A 1JOJA 4FPLA 1JHNA 4MYEA 2DUOA 4WZFA 3WUDA 1SLLA 1WLWA 3OYWB 1G8WA 3AZZA 3C2UA 1UMZA 4YZ4A 1GSLA 1GANA 2R1DA 1MVEA 1W6OA 2V5YA 4K20A 1V6IA 3OPZA 2ZMNA 3M2MA 4M3CE 2AH2A 5DUWA 1S0BA 5GLZA 1LEMA 1DFQA 4YW4A 5JLVA 5T5JA 4DPNA 3ILRA 4Q1PA 1NLSA 5T50A 4UW3A 4XXPA 1W0PA 2DYCA 4Y20A 1SBEA 4XZPA 3ZXJA 3Q9OA 3WOGA 2ZHNA 1S0JA 1W6PA 3IPVB 4BOWA 1BQPA 4XMIA 1IKPA 1WBFA 3ATGA 3N7MA 5H9PA 4AGRA 1LOCA 1LHUA 2OVUA 4R9CA 3OBRA 5IK5A 1LU1A 2VU9A 3PVOA 2DUQA 5F9TA 2D3PA 2UWBA 4YGDA 4XOGA 1TEIA 3M3EA 1S0FA 3VKNA 1LGBA 1ULGA 2PHWA 2P3JA 5GZCA 1QDCA 3A0NA
chains in the Genus database with same CATH superfamily
1UZWA 2QQIA 2PLV3 4HSLA 4YGBA 1HN0A 2QQKA 3A21A 1XU1A 2A3WA 4LPLA 4RFT0 3WNPA 1ZA7A 4A45A 1LHNA 4BLIA 1VBE3 1DGRN 3DL3A 4CTEA 1DQ1A 5KWRA 1X9PA 2VZ3A 4DEQA 2HBTA 4IW3A 2DV9A 1C8M1 2RM22 1W6MA 1IGOA 4CZSA 5E8AA 2BGPA 3M3IA 3NJZA 1ZYBA 1YI7A 1XE8A 2OZ6A 4IEQA 1D2QA 2YU1A 4S2GA 1RHI3 2AEYA 2XGXA 1JHJA 3LAGA 4LULA 1D0GA 2MHFA 4Q8KA 2C26A 3C3VA 5EQUA 1UY0A 1LOGA 2Y38A 4X8NA 4LA3A 4Q4V1 3TN91 1JMUB 3AKPA 3VHRA 1EAH1 1MS0A 3V0BB 5FUPA 1PO23 5JXIA 4BK5A 4DQAA 1PGL1 2TBVA 2XHKA 1C8NA 2PQSA 5FP9A 5FWJA 4Q8LA 2FDKA 5A6QA 1W9WA 3NNGA 5A6XA 3O1UA 4R52A 4QGLA 2X05A 1Z7S3 1EY2A 5DMYA 2GP3A 2WT0A 4MXVA 1TVGA 3KB5A 4HANA 2JIJA 3ZSMA 5A3LA 3LSEA 3ZSLA 1W6QA 1RUE1 2J42A 1F4HA 1C8M2 1ENQA 2SLIA 5KHGA 3BGAA 3GXUA 1HB4A 4AEDB 1XQNA 2WNUA 1AX0A 3DF0A 5FPUA 2K9ZA 2Y33A 2Y6GA 2GNMA 2I07B 4AVSA 4F7ZA 3U75A 1GNYA 4HT1T 2GDFA 4BCUA 4FBFA 4QB6A 5GM0A 2D7FA 4JTOA 1FPN3 1ZNPA 1LU2A 4K1ZA 4RYDA 4QMAA 1ND3B 4F3JA 1W3VA 2VC9A 2VZTA 3MV01 4QU1A 1K5JA 2PHUA 4XFFA 4AQ2A 1X8MA 3KHCA 4XTPA 1XU2A 2ZGPA 3EYPA 4QX7A 5DZGA 3LIGA 1GOGA 5A7NA 4I09A 4O65A 3RI8A 2ZGOA 4YZ5A 3LSDA 1DGRA 1J59A 2BOIA 4AEMA 3POFA 4MOAA 5CA6A 3W5MA 4D7TA 4Q4X1 2VZQA 4QGMA 1RVF3 4QHOA 2E7QA 2B8MA 4YM2A 1W2OA 4V2WA 1UY1A 2DCZA 2ZGQA 3BYWA 4V1PA 3ZMOA 5I0DA 2YG0A 4Q2FA 2EIDA 4W65A 3ES1A 1EV11 1QQP1 2E9QA 3I2IA 1RXFA 4YG0A 5HCAA 3ZR5A 4QDRA 1AX2A 4Y22A 3ZN5A 2HBUA 1DZTA 2OZJA 1VLNA 2HJIA 1AL0G 3GF6A 3WDYA 2HWD2 1PNGA 4AFCA 5EYXA 3MLLA 2YDEA 1AJKA 2A70A 1R64A 2VVFA 4Q4W1 5DAQA 5EYYA 4AYUA 1CZVA 1Q3EA 4LBNA 1EAH2 3VZMA 5T5OA 4CEWB 4C91A 3ZDSA 1I1EA 1NKGA 1G9DA 2ES3A 1PM7A 3HN1A 3JCIA 1GQHA 1KS5A 2O1QA 3LA2A 4I01A 5DABA 5CBLA 3WQ0A 3C7EA 2Q8EA 3NNMA 4CCOA 3VUOA 3T2PA 1VMHA 4K7JA 5FY1A 5JCTA 1B35C 3S7EA 2E26A 3VBSB 4IEZA 4N7UA 4Z82A 1QOTA 2A6YA 2JEMA 1JTZX 5FZEA 4JVAA 3I54A 1SPPB 1T6GC 4M3CF 1HRI3 3FLRA 2IXHA 1DQ6A 2YV8A 4XF0A 1HRV1 1GOFA 4RGAA 4QX2A 4HKWA 2ENRA 3ALQA 4ITCA 4ONUA 3WW4A 4CCKA 4QPGB 4D0QA 3TYJA 1L7LA 1ZBE1 2WJSA 1EUTA 4B29A 1XPWA 4LUMA 2RS12 4N90A 2ZGRA 4DXZA 2BV4A 1OH4A 3MUZ1 1H4GA 4V2VA 4YVWC 2X10A 3MFCA 4A7KA 4PBOA 2XJSA 4BMEA 4C8DA 2J1VA 4QQLA 3MZHA 1OFSA 2TEPA 3ZXDA 4Y1YA 2GNDA 1S55A 5D1IA 5LZ6A 3JQXA 3M7AA 1TQ5A 1BXHA 5A7SA 5A3WA 3T2TA 2BJSA 3S6PA 3WLUA 4E8CA 1KFXL 3NMBA 4AFAA 1HB1A 1G9AA 3LIHA 4EYUA 2BFUL 3WW2A 4LXLA 4QPYA 1O3QA 1HV1A 1K3IA 3WDUA 1ONAA 3VGIA 4MZUA 2R061 5A3MA 1R1ZA 5EJ1B 3RMXA 1BVP1 4OMDA 4YW5A 1QXJA 5ACA1 1RITA 3U1XA 4IEYA 4WM7C 1VE0A 2TNFA 1GNZA 5A6YA 2ZEWA 4HPKB 4NWWA 3OY8A 5IAVA 5C3QA 2JDZA 3BPSA 4I3PA 3VZKA 4YVSA 2VNRA 1RUH1 4AQ6A 3N3HA 3LFIA 2VVDA 4QKNA 5IVJA 5J3UA 3K3OA 3VKFC 5J37A 2BUKA 4CE8A 2B4KA 4JGYC 1SCRA 2HWC3 4IE7A 4FPOB 3CJXA 4X6QB 2D98A 1OI6A 1E5IA 1NCRC 1H1AA 1XYNA 2RS52 2WAOA 3OBTA 4XZUG 1EUUA 3N9PA 3P5BA 1D4M1 3WT3A 4LO6B 2QVSB 5JVVA 3U07A 1U5XA 4HZFA 4BH9A 4I3GA 1PVXA 4IEWA 2PN5A 3CIHA 3H7YA 1PX3A 1HV0A 4LKEA 4HXCA 1ZVFA 3ELNA 2EIGA 3X29B 1L7RA 5C5TA 1CVNA 1GP5A 1OKOA 1GR3A 4BHPA 4UAPA 2AENA 1DYKA 4M0HA 5FP4A 4HVQA 2NN8A 3AYCA 1IPKA 2N7GA 3KCYA 1DQ4A 5FY8A 1JUHA 4OHZA 1IZ3A 3QCWA 4GAZA 3NO8A 5CFDA 3WP4A 1RUI2 2R49A 3WP3A 3CJIA 1YCIA 2RS31 1RUOA 1OOPA 1R1A3 2I2SA 5ERLA 4CU8A 2YYOA 2BWCA 2VCAA 3I59B 3P3NA 4CUAA 4W8JA 2VPVA 4EWEA 5JDBA 2J1EA 3JBG3 3G6JB 3WCSA 4OQ9A 2JICA 5A7OA 5LY2A 4P9WA 5LBEA 2Q4SA 1OLME 4GWJA 3HPNA 3D4KA 1TMF1 1GNHA 2VD7A 1NAEA 4AZZA 5IVBA 1CAXA 1JOPA 4AR2A 3OGVA 1UIKA 4LOTA 1WKYA 2KD7A 3LPFA 1RIRA 3RWKX 1KQRA 4XBQA 1FAYA 5ACA2 1PGSA 5I8TA 1UWWA 3AL6A 2JKXA 2GNTA 5FMOS 4D69A 4DRVA 3MIBA 5SV5A 3BTXA 1ND2C 2VZSA 3CQOA 4CDQC 3PUSA 2FHRA 2NP0A 1DQ2A 3ZXAC 2WDBA 4IEOA 4MUVA 2YPJA 4LBQA 4MLOA 4YW1A 1K5MA 4AGVA 1KITA 2RS32 1RUE3 1WGPA 5IK8A 2P37A 2GH2A 5F1RA 2JE9A 3AYEA 1H2KA 4XJZA 2XLGA 1ENXA 4GALA 1DDLA 3DGTA 2GZWA 1UD1A 1W05A 4LO7A 1W03A 3GDBA 2B45X 1URXA 3AKTA 4QDQA 1TME3 1QJY2 4W4ZA 5T5PA 2IXJA 3TNQA 3GZAA 2ETEA 3MF9A 3IZOA 2R6QA 2J22A 2ORXA 3AP6A 3WNLA 2XJQA 4UT5A 3BIWE 2IFWA 5HV0A 3ZPOA 4CDQB 3W9AA 5L73A 3FHQA 4LBQD 5E88A 3ZFFB 5C4WB 2VOTA 1BZWA 3F2ZA 5DXDA 5FXVA 3HVDA 4K6BA 4RN5A 4EJRA 5LK5A 3ZFGB 2RVAA 3J7NA 1I5PA 1UZZA 3WHUA 3BOPA 3PIGA 4BJ0A 3HNMA 2DFCA 5HBAA 1A3KA 2W2IA 3PDQA 1HLCA 4LBLA 3POJA 5K4LA 3WQ7A 2V5DA 1V9U1 2VAUA 1JZ5A 3ZO0B 1GUIA 1VBE2 4EN7B 1V6JA 2UU8A 1FOD1 4NIIA 2AUYA 4KWKA 4E9KA 2XVLA 1W8OA 4GH4B 2ID4A 1S2EA 4CRQA 1AJOA 3K46A 1KEXA 5FP8A 3ZYJB 4M4RA 1PHMA 1OMIA 2ZX3A 2RE9A 3EHKA 3VBHC 1WA6X 1Z7S1 5FXWA 3FUOA 4CEYA 5BNNB 2FZ2A 1POV1 3IMNA 4NHYA 1LKNA 1JYWA 5K9YA 1R083 4L97A 1V00A 4Y3OA 2ZJCA 4CSWA 5FXZA 1UW8A 4NWVA 4LK6A 3JD71 3ZYIB 5ABJB 2X53S 4MGQA 1B35A 3VD9A 3ME2A 4OUMA 3KD4A 4YSFA 1UCXA 2PFWA 3K75B 3UNPA 2D6PA 5BNOB 3IIIA 1YJLA 1ENSA 1UZVA 1YFWA 5L19A 3GJBA 3HR9A 3RGBA 3ZX7A 2DVFA 2P6HA 4FPKA 3RZKA 1RUG3 1FOD2 1DG6A 2GMEA 2JDPA 3O0XA 4WZCA 3ASIA 3JB4C 4PT6A 3RG0A 4AAXA 5LCWL 1C8M3 2OPWA 1VBC2 3U0ZA 2WNEA 4FPCA 1GP6A 1XSQA 3E6CC 4HOOA 4CDUC 1L3JA 4AVBA 2UWCA 3KGZA 1V6KA 2GSYA 2RJ2A 3ZXEA 4JDNA 4MHUA 3PTRB 1GV9A 1CAUA 1BKZA 2OIIA 4HFSA 1BJQA 5DQ0A 2R043 5F8PA 1XNKA 4NPLA 2WSUA 2ZMKA 3MIEA 2YC4A 4FXGB 1ULDA 3HNBM 4YVSB 3J8F1 5KXBA 2DWRA 2ADDA 3B7MA 4KBBA 4LMFA 4WVMB 5LRRA 2W52A 2FZ1A 3FZ3A 5A1LA 5IW0A 1Q56A 3S57A 1QJX2 4GKXA 3Q8EA 1G86A 2OS2A 3ETQA 4CUCA 2BNNA 1AXKA 4DZGA 3RZMA 2ADEA 3WUCA 1Q8QA 4LEJA 3P1IA 5EZWA 5CVRA 1JUIA 3FC0A 2AYHA 4Q27A 1C5HA 2VOKA 4NOTA 2BOJA 4XFIA 1UQXA 1VBA2 2WQZC 3ZVXA 1A34A 4W6WA 3MHZA 1E5RA 1QIQA 4JKKA 4DUWA 1ZZCA 1A8DA 2D97A 1OLQA 3WEZA 1W6NB 1W9TA 4UW6A 3B02A 3VV1A 1BYHA 1AHSA 5JOXA 3O1TA 1PGL2 3KV5A 1IS6A 1O59A 4XILA 1V0AA 5FYVA 3WDVA 2D93A 4Z8BA 2CAUA 3BOWA 2PAMA 4Y1UA 5FREA 2G9ZA 4B1MA 3T0BA 1A6CA 1OQDA 2UWAA 3LDRA 4H14A 1N47A 2NMOA 4XQ4A 3VDCA 1VBC1 4WV8A 3OGJA 4NIGA 3KS7A 1PMJX 4PJYA 3N9OA 4YARA 1MS4A 3I3QA 3O14A 3PURA 5IJRA 3AMQA 3KV6A 4Q4X3 4AI2A 4DUXA 1VBB2 4D8MA 1U12A 1K45A 1O8SA 4YZ3A 1B09A 1KJLA 1GFF2 3CDZB 2ATFA 3ECQA 4EN0A 2XQRA 1BK1A 1IPJA 1NA1A 1BBT3 2DU0A 2QZ3A 5GJ6A 3V56A 4Y24A 2ZX2A 3M1HA 2JWPA 3HOBA 4Y22B 3ORJA 5E6HA 1MS1A 4NR1A 5JPNB 1ZBA3 4Q26A 2AC1A 4XAEA 3UL2A 4E2QA 4OHWA 5LB6A 1WLTA 3PL0A 4WZFA 5JZGA 5K0UB 3OPTA 4COWA 5A33A 1C3HA 1XOYA 2WNVB 4L0PA 5FZOB 1ZRIA 2DBIA 1G8WA 5DDJ1 1AR71 1UOJA 3C2UA 1TME1 3H8RA 2GH8A 3JQWA 4MXWA 3FL7A 3KGLA 5JSPA 1W6OA 4NE9A 3VBSA 3H3ZA 2AH2A 4XABA 2XVGA 5DUWA 1DCSA 4BWOA 2H0VA 5IVFA 5JLVA 4JAAA 2UY9A 1UMIA 1PO21 4MGSA 1W8WA 3ZN6A 4XACA 3ILRA 3LWCA 3B5LB 2HWB1 4P9JA 1NLSA 5T50A 5I0SA 4XXPA 1W0PA 1V9U3 5FPXA 5BNOC 2EVXA 2WNUB 1BQPA 3FHAA 3M4FA 4XMIA 3VDDB 5M0TA 1H8TA 3DXUA 1RUJ2 2OA2A 2VU9A 4GJYA 5F3IA 2DUQA 5F9TA 4YGDA 5F39A 5L9VA 3WF1A 1S0FA 4L9BA 4N43A 3NJVA 2PHWA 2P3JA 5FO8B 2QQJA 5GZCA 4PLNA 1ZBE2 1RHI2 1HW5A 2WA3A 3PUHA 1YIFA 3VBHA 1LHWA 2DCJA 1DU3D 1RUF3 3MO4A 1NYWA 1D0HA 3TNPB 1QJFA 2R16A 3NAPC 4B4RA 2WWJA 4UBHA 2XUMA 1AXZA 3RRDA 5JOZA 5K8SA 5L36A 3V0BA 2CTVA 1APNA 1O91A 1U5IA 3FLTA 5FIXA 2JDAA 1PO22 5EIYB 5IVEA 2QE3A 2RS11 5BNPA 2X5IA 4PDWC 5BNOA 1SDWA 2ZGKA 1F5FA 4OZOA 3K2OA 1ULEA 2KA3A 3GHMA 2VQTA 4JKMA 4OFGA 4OHXA 4LBJA 3G7DA 3SLIA 2P34A 3UV9A 5BNPB 2SBAA 2W68A 3S30A 2F17A 5L7OB 2R0FA 4A3ZA 2XL9A 3ZFGC 2IFRA 1U5ZA 5CKMA 4B7KA 2WFF1 5FZGA 2R072 3FX3A 5FYBA 5FDBA 3ZKYA 4CDUA 4A7ZA 5HPOA 1AR72 1QMJA 2FDJA 4LIVA 1WMDA 2PHFA 2W92A 3GALA 5C4WC 3MFAA 3SNMA 3WQ1A 1XB9A 3W58A 4GMP0 3IN9A 2H6CA 3VLBB 5JXJA 3GM8A 4NIAA 4PI2A 3KM5A 2YGMA 5F2WA 4CP2A 4A6SA 1AR83 3USUA 3DPRB 3NAPB 1SG3A 3E5UA 1W2UA 3JXSA 3LKJA 3IDAA 4XJWA 3IPVA 4XFGA 2DVAA 4AEJA 3TAYA 2VW2A 1MPXA 1FV2A 1LCLA 3HIFA 3WF4A 2Q8DA 2VMHA 2VQUA 1UYXA 5HCBA 2WNOA 3A4UA 1YLLA 2VMEA 1GQGA 1RUD2 2CL2A 1OBNA 2R041 4J25A 1PVC1 2XBO3 3N35A 4MXWB 2QNKA 1XYOA 3K51A 1U0AA 3CHXA 4AAPA 2EF6A 2Q1ZB 4I2OA 4AFBA 2HWD3 5FRAA 1QJU1 2RMU1 3I2HA 1UU6A 4GIQA 3AZXA 3ILNA 3PJYA 1EYBA 2WS92 3IAQA 5DZEA 1WA4A 4AWDA 2A6ZA 2WN2A 3PIJA 2G19A 5FBJA 3ZYRA 1NY71 4LO4B 2KM2A 5J98B 3WHTA 4HVRA 4CDWC 1ASJ1 5FAXA 4TZDA 3TN92 1DZQA 4QX5A 1AZDA 2YROA 1US2A 2JDNA 4Y5Z0 1PZ7A 2HH9A 4KWLA 4DO0A 5H9SA 1W0OA 4U36A 2RR13 4ZY9A 3A0KA 3GCWA 1YQCA 1TE1B 1W8ZA 1IS5A 3IB3A 3LQCA 2YC2A 1E5SA 2NQYA 4YVWB 3VDAA 3FJSA 4IV1C 3BIEA 4NN0A 3WNOA 5FZIA 1W3XA 5LK7B 2IZWA 3C7HA 3RMYA 2WS91 5F7UA 4CDWB 4FTEA 4YW2A 1FOD3 1JU3A 4DXRA 5IVVA 1OVPA 4TLGA 2IUWA 2YFZA 4E4DX 3N9MA 2ZS6B 4IUGA 1QJEA 1ACCA 5FZ0A 1EV13 2CWSA 1ASJ2 1FMD2 1QQP3 1UY4A 1Y9MA 2BQPA 2WNUC 4BQ3A 3OGSA 4CCEA 2BDRA 3ETPA 4QX1A 4W6XA 3LD8A 4EWAA 4CCNA 2GAUA 2D6LX 3DXTA 4I0WB 1MACA 2RDQA 3ZYHA 5I91A 2B9UA 5C9AA 1V6NA 4N53A 1CESA 4RHV2 1PZ8A 3E6DA 2EXKA 4DEVA 5FPZA 2J1SA 1F31A 4GXLA 2P4EA 3QD6A 3WSOA 2VUDA 3NSTA 5ANQA 1QJU2 2RMU2 4YW3A 3UKTA 5A32A 3NV2A 4EV0A 1VBA1 1UPIA 1R1A1 2UURA 4YZ2A 3I8TA 5FZKA 2E7AA 1JYCA 1DGLA 2VW1A 1C28A 2VTFA 1VR3A 4QM8A 3ZYFA 1NLQA 2ORZA 1GU3A 2XWBB 1J3QA 2ZEZA 4JGZA 4KQ7A 2C0ZA 4OYUA 2C1FA 4FFGA 4KU7A 4CYDA 4YZ1A 3WW1A 1CX1A 1PIV3 1REFA 4Y5TA 1GYKA 1ZZ9A 2ARXA 4JGZB 3VBSC 3T2OA 2VMFA 4LTAA 3VBUC 3VKLA 2JDMA 4D3WA 5FOJB 4O9EA 1DGWX 3DUIA 1CN1A 2BGCA 5FYTA 4KG0A 5IVYA 4D94A 1SFYA 2VXJA 3QH6A 4PF5A 4XHXA 4CDXC 1R092 3QACA 4XUNA 3I2DA 1RUH2 2R0HA 3NRUA 4P08A 1S0IA 1CZTA 5DDJ3 3VZNA 1O4TA 3ACGA 4Z2AA 5JXGA 2VXRA 1KDKA 1K12A 2RR11 4LJHA 1X82A 3ZOIA 4DUVA 1UZ0A 5FY5A 1FYUA 1AYM1 1AL21 2WLPA 1R1A2 4QXCA 5CU1A 3VBRC 4B3NA 3C7FA 2OXBA 1BLZA 3JBG2 3JD72 4JV4A 4LBKA 3S5QA 3W20A 5FMOL 2V4VA 3RI9A 2NYYA 3UK9A 2IVJA 1RHI1 1F9KA 2G9FA 2MEV3 3D82A 4KI5M 4ZXEA 5H9RA 4HLTA 4BU2A 4IEPA 3O0WA 3ZPYA 4CEYC 5HXMA 4AI0A 2E51A 2BTVC 4GWIA 3T08A 4BQ1A 2WC2A 4LOSA 2HYKA 1SDDB 1UYYA 5JWPA 2FQPA 4QT6A 5BUVA 4CU7A 1XNAA 2ZHMA 3HT2A 4NAOA 2XQXA 1J84A 2K46A 3MIHA 1OT5A 1BBT2 2YHJA 4EE2A 2F4PA 4OUEA 3DKQA 3AXDA 4QD2A 2ZGNA 3WNXA 4A2UA 3PLQA 1AYM2 2PELA 4NVPA 1LGCA 2Y0OA 2DF7A 4A41A 1D4M3 4ZXKA 3UGGA 4W6YA 3HEIA 3FUQA 5C3PA 5AC91 3KCCA 2C9KA 2HWF2 2J1UA 1MEC1 3ILFA 2HWC1 3V64A 4ORFA 4MH0E 1DQ5A 3WF0A 2A6VA 3M8LA 1X9TA 5H9QA 4YYOA 3LGRA 4RGGA 4XXAA 5KHIA 1NE4A 1RUJ1 1QJX1 2QCSB 1LAJA 2EAAA 4JKLA 4OCTA 4CP1A 2LROA 2ZX0A 5F6LB 5FZ1A 4PQQA 2RDSA 3ON7A 3ZYBA 3K4DA 5FUIA 4AVTA 3BU0A 1W39A 2XONA 1JYVA 5GLUA 4YPJA 3AZVA 4FPEA 4QXHA 1W8FA 4XFHA 1FNYA 4RL7A 5A3OA 2WZPP 5FY4A 2WFF3 3VBOA 4JRLA 3MV11 4P9LA 3OOXA 1H6XA 4Q0VA 4CDUB 1HJGA 5C71A 4URTA 3UETA 4NO4A 5FR3A 1LODA 5J48A 5JXHA 3K4AA 3LFMA 3L9JT 4AF9A 4M4PA 5LEKA 2W39A 1JW6A 5DZFA 5L9RA 4ATFA 1RB8G 2O8OA 2WO1A 4XZPA 3UGFA 3QLQA 2FDGA 3LA7A 4PHZA 1C1LA 5IT6A 5FKCA 1XNCA 4COYA 5FYCA 3H1WA 3UT0A 2VNGA 3RVHA 1XSRA 4R9BA 5DAVA 2HKXA 4FOYA 3FFZA 4XFCA 1VB2A 2C9AA 1LESA 2E31A 3OUJA 2GC3A 1MS5A 3KV4A 1DQ0A 1HRV3 1DIWA 2A73B 3T4HB 1NQDA 2CY6A 4AFDA 1LGNA 1CQ9A 2HYXA 3DYMA 5DN2A 1AL23 1GWKA 1J1TA 1J58A 5JSRA 2VQAA 1REDA 2XJVA 3E97A 4MGYE 2EAKA 1PMHX 1H8TC 1T6BX 1CJPA 1XJAA 3HT1A 4XIKA 4YM0A 2XPJA 1AR61 1UXZA 3N9QA 2CAVA 2EA7A 4EN6B 5L7OA 1PO12 4GH4C 4IV3A 3CJIB 1AR93 2DVGA 3RZZA 1CWPA 2VMIA 4A42A 4OHVA 1HKDA 3AYAA 3JU9A 3EQEA 2R073 5FP3A 5CFDB 4GMP1 2GP5A 5LA2A 3PVNA 1GZ9A 3U14A 1FI2A 1JBCA 2XMLA 4R4ZA 4UW5A 3Q8FA 3TEXA 2WZR1 3SCHA 1I6XA 1IG0A 2GN3A 1H9WA 2XOMA 2R042 2XB6C 5F32A 3ACIA 3I3BA 1UIJA 3ITQA 3GBGA 5FY9A 3VKMA 2QQLA 1PX4A 3WG2A 1JYIA 2QDRA 3LEMA 3ZLIA 4IESA 3AK0A 1NCQA 4MX3A 4KNCA 4AQTA 4NIHA 4KWUA 3ZFEC 1M06G 1QXPA 4N43B 1EAH3 3H9AA 2BEOA 5GZDA 1WCQA 3RZGA 2RJKA 4KGGA 3WR0A 5A33B 2XJRA 4ARXA 2YB7A 3WW3A 5BV6A 1N1YA 4K8FA 1AYN3 4YVSC 4BPZA 3KZ4C 1YRZA 4OI2A 1UOBA 1YI9A 2AR6A 3AJZA 3CLPA 3NNFA 5C8CC 1AXYA 3OY8B 2C24A 4H7LA 3AXEA 1YQ6A 5BY5A 3WCRA 1CZSA 3MI8A 4QKDA 3TWIA 3BTZA 1NCRA 1UOFA 5L9BA 1BMV1 4U2AA 2PA7A 4DMIA 1GZWB 2E32A 1VBD1 3HN3A 4XETA 4NJ4A 4DFSA 2WS93 2IVIB 3DPRC 3LEGA 4JDMA 4ZZ5A 2PLV1 3QH7A 3EJKA 3MW4A 1JYNA 1RC6A 4GZ9A 1LOFC 4LR4A 5FZOA 2CSGA 1S2KA 2GC2A 5F2SA 5LBFA 2XH6A 2ZOEB 4L8QA 4K21A 3AP5A 2WZR3 4M01A 4TYSA 2ZAAA 4IETA 5FZCA 4UFLA 2A5ZA 4JQTA 2R071 2XVKA 3FHIB 1U5YA 4AHYA 3RYKA 1AR91 3T1LA 5DUXA 3IAPA 4Q4X2 3CMGA 5HCHA 4AL9A 5FYZA 4XJ9A 1DLCA 4RS5C 1ALYA 5K7PA 4OLLA 1WZXA 1W6NA 4QAWA 2JE8A 3PVEA 3B9IA 4GB32 3USSA 4ASLA 4FFHA 4DIQA 4YM3A 4IERA 2I45A 5IFPA 2CGPA 5KXCA 3EXUA 1TMF3 1C4RA 2XDVA 1WW7A 5A1FA 5A3PA 1V6MA 4UBGA 2A6WA 5DAXA 2HWD1 1JOBA 1MS8A 2JX9A 4AI1A 3LZZA 5FTTC 4Q4W2 4OI4A 2B7YA 3AKQA 3Q8AA 3KF5A 3I3MA 2AZ5A 5LA9A 2OUHA 4DY3A 1GZWA 2ZPXA 3ROUA 1CIYA 1HX6A 5D8AC 1UU4A 1V6OA 3SITA 1LOAA 2Y0IA 2IXKA 2B39A 4ZKTB 4COZA 5BNQA 2QQPA 2DCTA 2P2KA 3VDDC 4LKFA 5FLHA 1JXNA 1W8TA 1WD3A 1YNAA 1ST8A 2RM23 2XG3A 3RPQA 4ES9A 5FO7B 4Z2WA 1JYXA 1H2NA 2YBPA 4JC1A 1HJFA 4GWNA 1S4CA 1JU4A 3QOPA 2DUOA 2WWUA 4CP9A 1S2BA 3WUDA 1O3RA 3BKZA 1SLLA 4AQSA 1CAUB 2JB8A 2GC0A 4F8AA 5B4XA 5HXVA 5A32B 4AK3A 1GP4A 2JG8A 3H1YA 2Z79A 1NCQB 5D8AA 4FAGA 4K20A 2WIIB 2ZMNA 4M3CE 3UYJA 1RUJ3 1LR5A 5FZHA 4Y5SA 5CFCC 3H7JA 2FCUA 1S0BA 3CO2A 5GLZA 2QFEA 4WVMA 1ND3A 4HKOA 2W87A 4Q1PA 3LPGA 1NY72 5FCCA 1CAVA 5CADA 4UW3A 2DYCA 1X33A 1XBFA 3IT8A 1RUF2 2ZHNA 2WYSA 1STMA 1W6PA 1SFPA 3IIAA 4JX0A 1KGYA 4QKBA 5ACA3 1OVSA 4AGRA 1W8UA 3OBRA 4MGKE 4LT5A 5IK5A 4C0HA 2VNOA 3AC0A 2K0GA 3K3NA 2UWBA 3MGUA 3OCPA 3WP5A 2VZUA 2FD8A 1LGBA 2D5FA 1J1LA 2XJUA 2IXCA 3NNJA 4TN7A 5FYSA 3O1OA 1HXS3 3AM2A 2EXJA 2DBNA 2JECA 3WINE 3LA3A 1SBDA 3HJRA 4AI8A 4TTGA 4CDXA 4X6RB 2OPKA 1RYYA 2QQVA 3LDBA 5FP7A 1RUC2 2QUOA 1WMXA 4IE4A 4RSUA 5ANNA 3PUIA 5FY7A 4WM8B 4CCLA 1YFUA 1GQPA 4RR3A 4EQVA 1RUG1 3INAA 2ZA9A 5AFBA 1YC61 5C8WA 1LECA 4FXKB 1JS9A 2Y8KA 3CJIC 3KLSA 4RHV1 4PDWB 4IV1A 3OB8A 4C0BA 5FPAA 3AMMA 1PM4A 3ZXLA 4QQ2A 2CGOA 3AKRA 3J7HA 2LTNA 2QTWB 3CNAA 4LO5B 1ZRRA 4L99A 1WLDA 2WSVA 1MEC3 1AYM3 1S0EA 4LHLA 3THCA 2BWAA 4XBLA 1W28A 3SCFA 3AB0A 3ZFFA 1BEV3 1COV2 5CKQA 3WG3A 3O1MA 4NMIA 1WW4A 4Z1VA 1POV3 4Y1XA 2FDFA 1O7FA 2Y26A 1X7NA 4D6QA 2HWF3 2OQ7A 2B9VA 4A44A 5LBBA 1Z0HA 1MS9A 3IDCB 1WLCA 4FOWA 4KGQA 2OW4A 3D8CA 2WRAA 2G1MA 3R4UA 3MBWA 3PUQA 1TNFA 3CEWA 4NIDA 3I2FA 3M3CA 3U4SA 2LS6A 2UYAA 1HQLA 1VMJA 4URAA 1K5MB 3O1SA 1QH7A 1ND3C 1IKQA 1KD7A 5EPAA 2V4AA 3T4VA 1W90A 1UN1A 4MO3M 2CU5A 4XJAA 3VB9A 2R1BA 2MEV1 3ZSKA 5E89A 4H3WA 5JI7A 5C4WA 1QOOA 1RVF1 1ZRDA 4QPIC 2WO3A 3NAPA 4QM9A 4WM7A 1CPNA 1AYN1 2WT1A 5JUVA 3LF7A 2CV6A 2WUHA 1OKQA 4K3UA 5FZBA 3ZKUA 1IS3A 1K5MC 3GGLA 3VL9A 1ZREA 3OYWA 1D4VB 3N9LA 1MZFA 3J8F2 5F37A 2PHTA 4LKDA 2VQ0A 1VPHA 2IC1A 2D40A 3UGHA 2HEVF 5C70A 3NV4A 4ARYA 2HWE2 1X36A 4RQPB 2FMDA 1VBC3 5IYYA 2DCKA 1UX7A 2CHHA 2QJVA 4LBQB 5A7PA 5LW9A 3KQRA 1RMU3 3L2YA 1WCUA 1VIWB 2YFUA 4GJZA 2V72A 4META 4XDPA 4FQ4A 3KVBA 4RD7A 5DUVA 3KCXA 5JIAA 3HWJA 4DRRA 4RR3B 2ZKNA 1QNWA 3SCGA 4XQDA 1DLLA 3ABZA 4M3CB 4YRDA 1GICA 3WNKA 3BB6A 4K40A 2VZRA 1N3QA 5C3OA 2JDUA 5DAPA 3L2HA 1YXWA 3NWKA 4YGEA 4A7YA 1LOBA 2OUJA 1AVBA 3N7LA 5FKBA 1K42A 5FMDA 1H6YA 2FBEA 2HWC2 4NAMA 2C6SA 1AR92 4WVVA 4JGYA 1HIXA 3VBHB 4G9SB 4BIFA 5FYUA 5FYYA 1QH6A 2WLQA 1QJX3 3I59A 1F5JA 1FPN2 2XWJB 2VO5A 4JCKA 4RQPC 2JDKA 4RHV3 2WBKA 4XIOA 4YGCA 1Q8PA 3POGA 4WM8C 3P3PA 4QB2A 4DXTA 4AHWA 4FT8A 4QX8A 1JZ2A 1Q8SA 4IDZA 3AKSA 3MLKA 3ZSEA 1CAVB 2BBAA 3TEWA 1KRIA 3KT4A 3ZN6B 2R063 3K48A 4HPKA 4JQRA 4IV3C 1ODNA 1OC1A 3LEKA 1CJDA 2FCTA 2W0XA 4I02A 4LNVA 5GZFA 1BMV2 5FZMA 3JUUA 2NM1A 3B9CA 4HONA 5JZGC 2VGDA 2QQWA 3SISA 2ZKLA 4NROA 3VHNA 2JG8B 2RHPA 2QQOA 3D3AA 2Y6KA 3H42B 4AHZA 4DS0A 4Q4V2 2KR2A 5T54A 3RYPA 4N53B 2JKBA 4R4XA 1BCXA 5I93A 1Y9GA 4CP9B 4XAAA 1YJKA 5CG8A 5T55A 3MIDA 4GKYA 3HBZA 1T2XA 3KT1A 3V0AA 2BRTA 4XHBA 5DDJ2 2Q5TA 2I74A 3RYRA 5FYIA 5SV8A 3LOBA 1OA4A 1TG7A 4C90A 2CDOA 1H1MA 1FMD1 1XXNA 2PMWB 5KHKA 2D3RA 4L11A 4FP2A 1UYZA 5G05L 4KH9A 5A1AA 2W1WA 1WCKA 4AE2A 5C3SA 1ULOA 2VVEA 4CDWA 1SMVA 1GLHA 2B5HA 3GBWA 4QPGA 3SMHA 5A7WB 4PF1A 3MYXA 3VBFC 2YUEA 4HKLA 3TEZA 5LEJA 1KDMA 3NV3A 4LHKA 2WL1A 5A3TA 1Q8OA 2Y6FA 3WZ1A 4PIZA 1ZBA2 2L9LA 3O1RA 3PMEA 3K77A 3VN4A 1RUI1 1AR62 2DU1A 1IPSA 4YVWA 2CNAA 1QJY3 4NRQA 3UJQA 4GD4A 1JYTA 4UFKA 5A3NA 1UX6A 2WO2A 2FDIA 1QNYA 5FQ0B 1V70A 3NJXA 2YC0A 1NQJA 5CYYA 3VBRB 5FOBB 1SFNA 2P3YA 2Z69A 3H1MA 5F5CA 3VD5A 4E4SA 1O5LA 1TNRA 4M0NA 4N7IA 4TLFA 4H2AA 1N3OA 1REEA 4DOUA 1M4WA 1POV0 4BXSV 4O61A 1OF4A 2WR9A 5EJZB 4EZHA 2WZEA 4UI9L 1OLRA 2MPFA 2VCCA 4LBMA 1P8JA 1SPPA 5FJKA 4NHXA 3VZJA 2D3SA 4RS5B 1NX9A 4CCJA 4OI1A 3W5NA 2A3YA 2XKPA 1C5IA 4JGZC 5LWBA 1UY3A 2ZX4A 2XLAA 5IK4A 1H8VA 4XDQA 3DV8A 4XTMA 2CWMA 4UOJA 4D7SA 3RJ2X 5A6ZA 3MEPA 2ZXQA 1LJ7A 1NCRB 2LM3A 3ENRA 3N36A 4FPYA 4CP0A 2JDYA 1QY4A 3WDWA 3NQHA 1VMFA 4QKFA 5EP9A 2VCBA 1N3PA 4CXYA 3C7GA 1GZTA 3H3UA 3MLJA 4LO8A 2PLV2 2RS53 3M70A 4CCMA 2Z42A 2GNBA 1VRH3 5FYMA 2PAEA 1W9YA 4PBPA 3N4MA 3FE5A 3ZXFA 2BW8A 4P02B 2A6XA 2ZEXA 1SZBA 3BPZA 1AX1A 2ZCWA 4JHZA 3PUAA 3A23A 2VECA 4LHNA 4Y33A 1G7YA 4BIOA 1V6LA 2HWF1 3FLPA 2J1TA 3R4SA 1WD4A 2VUAA 1CIWA 3KMHA 5A70A 4BM8A 2VG9A 4QPWA 2YBSA 4LLFA 5J09A 3H3LA 1BHGA 4Q0QA 1NLRA 3M3QA 5FFOC 3JBG1 5T5LA 5AC92 3URFA 5A3UA 3BCWA 3AMHA 3THPA 2V09A 5FJHA 2W3JA 1VAVA 4DNYA 2Q1FA 1O4ZA 2AGSA 3H0OA 1O4YA 1KFUL 1J3PA 2J7MA 5KC6A 5EHDA 1Z7S2 5FZ3A 2W1UA 2ZBJA 2ET7A 1YO8A 2PAKA 4FPHA 4L2NA 2CYFA 4XFBA 5FZ4A 4IV3B 4N43C 1QWRA 1A78A 4FTSA 4A4AA 5JIUA 3GZEA 1HB2A 2BVVA 1US3A 3OF1A 4FFIA 3SH5A 2YY1A 3AP7A 2VOWA 3AP4A 4N8MA 3B94A 2XBO1 3MPPG 3GCXA 4IGQA 4TXWA 5ABJA 2EIBA 2VBBA 4Y1ZA 3GBFA 3EB7A 1FX5A 2ZAHA 3ACHA 5D2AA 2HWE1 1QGLA 1QJZA 5LA1A 1FV3A 2G4IA 5TSWA 3CU7A 5EV7A 2ARBA 4HVOA 3BUCA 2RV9A 1MEC2 4IEVA 1WWYA 1H8TB 3J7MA 4RFRB 1LHVA 4QGNA 1HB3A 1LTEA 1COV3 4I30A 1QKQA 5ISLA 1FT9A 2GN7A 3AZYA 3PVBB 3VD3A 4IGPA 4XVHA 4BQ5A 2Y60A 3OSDA 1JI6A 1RVF2 4FTBA 5EXOA 1AYN2 4Y4YA 1OA3A 2KXLA 3BODA 3WP6A 4QHBA 3U10A 1GWLA 2BFUS 3BU7A 2PYTA 1W6OB 2HWB2 3FWEA 2R7EB 4XQWA 3SH4A 3D0JA 4Q4Y3 4F83A 4GQ7A 2D43A 1W99A 4P5HA 1H30A 5F3CA 3I97A 2GC1A 1JH5A 3O0VA 2WNVA 2VNVA 1F15A 1YFXA 1H1IA 3RWNA 1AUYA 1UO9A 1MQTC 2XL7A 3HD8B 4PQ9A 1QF3A 5CAZA 2GALA 4XYXA 5BYNA 3KHBA 2EALA 4CCCA 2LUWA 3ZIXA 3POEA 4AVCA 3SKVA 4XBNA 4FAHA 1HDKA 4IGOA 4QPIB 4KL1A 5DG1A 5T3NA 2WZR2 4DINB 4XPVA 4EWDA 4P9GA 1YYNA 2XJTA 4EN9B 2ZGTA 1FNZA 1ZRFA 1XE7A 2VZPA 4GA9A 3SC7X 4P9XA 2XUEA 4UYBA 2FDHA 1AR81 1O5UA 4I0AA 1CAXB 4K9SA 4KU8A 1R082 4BLJA 5L7OC 4P5YA 2H6BA 4N9HA 2E53A 3ZR6A 1UYPA 5BXXA 4AW7A 1N1VA 3C7OA 3OPWA 3AVRA 1MQTA 3KF3A 1WBLA 3ST7A 2Q1MA 1WW5A 1RUC1 3BVCA 3VL8A 2QQUA 3HQUA 4EN8B 5JOYA 5BPXA 1OFNA 3MIGA 4BISA 2OKXA 1DF0A 1ZZ6A 3FFQA 4E8DA 3HNYM 1WMFA 2A71A 4FQZA 3SHRA 4XF4A 5F5AA 1HN1A 4ZONA 3R6SA 3DN7A 4OVEA 3RDIA 4EZ4A 2ZHKA 3POSA 4P14A 3LDKA 4BA6A 5IATA 2O8QA 3O12A 3PHMA 5GZGA 3EO6A 5C5UA 2W1SA 4XEZA 1V9U2 4SLIA 4ZHNA 4MGIE 3T0DA 4ZPIA 1VBD2 4MSVA 3CZUA 5CB7A 5JAXA 1PIV2 5FWEA 1YUDA 4JGYB 2RG4A 4NRPA 1OQ1A 2WKKA 3B3QE 3THTA 2F6BA 3I2KA 4QB1A 3MW3A 5FMCA 4KBZA 3T09A 2BU9A 2VTXA 2W94A 5CIRA 3VKOA 4Q4Y1 5FMBA 1Y7BA 4G3YC 4XF1A 3NKGA 4C1WA 4BQXA 3SH3A 5F5QA 1OHFA 2WFPA 3OEBA 1ZX5A 1SQ4A 2WQ8A 2EXIA 3B69A 1VALA 3D6EA 3P6BA 1SLBA 1ULPA 2JENA 4XFAA 1CR7A 4H55A 1RINA 5LATA 4UFJA 3AVSA 5EJ3A 2W1QA 1LNSA 5GZEA 5A7QA 1WUVA 2A75A 2E63A 3S7IA 4ES8A 4AHXA 1JZ3A 5C6CA 3VHPA 1F4AA 1JOJA 2VCMA 3J4UH 4COVA 4CA9A 3JD73 2UYBA 5J96B 4MYEA 1O3SA 1PVC2 2W47A 5FZ8A 4H7MA 1MQTB 2DCYA 1OURA 1R081 2DFBA 2VM9A 2W9XA 1Q43A 5LRSA 1E5HA 1VJ2A 3VBOC 1GSLA 1UF2C 1YIPA 3WY6A 2R1DA 1CAWB 3LEIA 5LASA 1ZZ7A 1A8MA 1W8HA 2J1RA 3WQBA 1DP0A 1V6IA 3FMGA 4Q29A 3M2MA 1XRUA 1AR73 2VZ1A 5C9AB 4AI3A 2Q30A 1CD3G 4AVAA 4MGTA 5C33A 1VRH1 1LEMA 1DFQA 2VMCA 4QPIA 3H8XA 2RS51 4QPGC 3SEEA 1GWMA 5CKNA 2Y64A 3OBZA 4KG8A 5E16A 4Y20A 3Q9OA 3LB9A 4IEUA 4XCAA 1S0JA 2FCVA 2RDRA 3GYDA 3KVAA 1NUKA 1IKPA 1WBFA 1B35B 2NLRA 3ATGA 3N7MA 1FXZA 5H9PA 1LOCA 2Y6JA 1LHUA 1SHWB 2XHNA 3PNAA 1AR63 1RUC3 3OBAA 4GB31 5JPMB 2JD9A 4OHYA 2DDUA 4J1XA 2CDPA 3K4ZA 2BVBA 1YQ8A 4YG6A 4DXSA 3WNMA 4AEKA 4CEYB 3N9NA 4J1WA 5BNNA 3LCPA 4CEWC 4P9IA 4RA0A 4Z07A 3TB0A 1GOHA 2XLFA 1MR5A 1MZ5A 4NUBA 2VZOA 4S2FA 3RFRA 1ULFA 2C5DA 2JIGA 5FZDA 1OSGA 1LHOA 4JHTA 3EBRA 5KBFA 3ZSJA 4P9YA 3DECA 2XR4A 2RS33 1RUE2 2PXJA 4FPJA 4GH4A 4PCRA 2D5HA 4FI9A 5DPNA 2P1BA 1DGWA 2VUJA 4B1LA 2A3XA 5LBCA 2Q8OA 5EWSA 5IWFA 4XDOA 3T2QA 2BERA 3RSJA 4DY5A 1VP6A 2QQNA 4GMP3 4FPGA 1ENRA 1UMHA 4LIUA 5FLIA 3SXWA 1H9PA 3ZXKA 4SBVA 1KXGA 1OOPC 3MUY1 4CDXB 1D2SA 4JDOA 5KXEA 3WV6A 5FPVA 4ATEA 2DUPA 2VULA 1UL9A 3OGGA 1XC6A 3RZLA 4BQYA 4LUKA 1H2MA 1TZOA 4AOCA 5GLWA 2OT7A 2QBXA 4CCDA 5CNAA 4NHKA 2LRPA 1VRH2 4UWDA 1CPMA 1MZ6A 3V65A 1HRV2 1I5ZA 3AX4A 5JI9A 1VRBA 4P00B 5CFCB 1COV1 1H4HA 2JXAA 4HG6B 1DYOA 1W6PB 2ZTNA 2JG9C 3AL5A 4I0BA 4IL7A 1NZCA 1CX4A 1QU0A 1VBB1 5GALA 3POWA 3J8F3 4OULA 3ZFFC 5I8SA 3O1VA 1EPZA 4S2DA 4WBBA 2HWE3 1OD3A 2JG9B 1ULCA 1R091 2VMGA 2Y34A 5AVPA 5T52A 4K8RB 1H2LA 4LORA 5JR2A 4OQ8A 5G04L 2VR4A 3DPRA 1W6QB 3USUB 1EV12 1QQP2 1XNTA 1POQA 2PHRA 4IE6A 3VHOA 4XJ8A 5C8CB 5C3RA 2JJ6A 3AYDA 1LRHA 4MADA 3ZIWA 4ASKA 2WZ8A 3DYPA 4NPMA 3I2OA 3KV9A 4AI9A 1OD5A 2GMMA 1LOFA 4Y26A 5APAA 5FZLA 4N53C 2XJPA 4CUGA 2OQ6A 4AG4A 3DEMA 1PGW2 1RJ7A 2ZACA 4DB5A 2D6MA 3OD4A 2OYZA 1RUG2 4HN0A 2DURA 2O0OA 2WN3A 1IQDC 1ZZ8A 3OEAA 4R9DA 4E2SA 4QQHA 4ZU4A 3WD5A 5FZFA 3WNNA 1RGSA 4X8PA 2GU9A 3CBNA 1H0BA 1UZYA 3N7JA 3SEPA 1O3TA 1HQWA 4WVWA 1YEWA 1HQNA 1OLMA 2X5IB 1HRI1 1LEDA 4BB3A 4BQWA 4BYYA 4YFWA 4UF0B 4YNIA 3I49A 1NE6A 2WQ4A 4XJUA 5B4NA 4XURA 3HMYA 1AR82 4QDSA 5I0RA 1EP0A 3TOJA 2WINB 3B00A 2AEZA 4KWJA 1RL3A 5E1RA 1LENA 1PNFA 3NVCA 1VAMA 2R062 2P3IA 3Q8BA 4S2HA 1LULA 2EIEA 2WWSA 1PGW1 1ZZBA 1PZ9A 2BBVA 2FMYA 4LE4A 1PK6A 4CPBA 1QOSA 4IE5A 3O5SA 4QQOA 1RMU1 1PIV1 2VJXA 1EPWA 4BK4A 3VDDA 4D6SA 1YFYA 2B42B 3OUIA 2D6KA 3ZDVA 5F3EA 5JOWA 2YBKA 3RZJA 4ZU7A 2VTXJ 3I2JA 2ZEYA 5IUQA 3VBRA 4Z92B 4LA2A 5FK8A 2QZ2A 5FQ0A 4GWMA 1IOAA 3DYOA 3FN9A 4Q4Y2 5CISA 3RJRA 1HRI2 1OPMA 3OGRA 3ZM8A 2YXSA 1G9BA 5F3GA 3UKNA 1VBA3 3KQ4B 2MNGA 1BK0A 1SEFA 3AMNA 5FZ7A 1IHMA 4EROA 1O8PA 5AVAA 4YW7A 4XMAA 4JRAA 4QQPA 4C1XA 4CPBD 1XE0A 1SLTA 2AREA 3A7QA 3WDTA 2RJLA 5F5IA 2PTMA 3I7DA 5A7WA 3VD4A 4IXLA 2JG8C 3PU8A 4GB33 3GHNA 3UKVA 3OG2A 3WG1A 1ND2B 2G9GA 3CL1A 3NJYA 5K0UA 5IVCA 2ILMA 5JZGB 2HEYF 1FPN1 1W06A 4R9AA 3AP9A 4LKSA 2ZGUA 5FZ9A 2P3KA 5KR7A 2ZGLA 1RTVA 3IMMA 4XE9A 2E33A 3PTYA 5D21A 4CU9A 5CEHA 2JDHA 4Q4W3 2HLEA 3ZFEB 1DZRA 5DG2A 2RR12 4XUOA 2VOXA 3I3DA 3KT7A 4HMZA 3IDEA 1D7PM 3E5QA 3E1F1 3H8UA 5GLVA 1NA1B 1I3HA 2PQQA 5I0UA 2C4XA 5CFDC 1SLAA 3A22A 3S0MA 3T1MA 1RUD1 3POBA 4Q5OA 5CZKA 4B8EA 4CXXA 3AFGA 4AFMA 5HI0A 1UPSA 4G4FA 2P6CA 1VB4A 2VE1A 5BNPC 2QDNA 2UY8A 4PIXA 5K0UC 1S1AA 1OXCA 3VZLA 3MF6A 1DBNA 1IS4A 1GMMA 3APBA 3GNEA 3I4IA 4HSJA 3DKWA 4Q1RA 2IXIA 2J1AA 4AVVA 1MVQA 3BTYA 1F8VA 1ASJ3 1FMD3 4UFHA 1OF3A 2WFF2 1WCSA 4KMQA 4CEWA 3U11A 3RQ0A 1JN2P 3RNSA 1PK6C 1OUXA 1BBT1 1FATA 2LALA 3B01A 3MICA 5GKAC 2ZGSA 4XC9A 5LA0A 3D5OA 3I3EA 4LITA 1PK6B 3BTAA 4TSVA 1XNBA 5J36A 3POIA 1QHDA 1VBE1 1QJU3 2RMU3 2WAAA 4IQPA 1HXS1 2XKOA 3KSCA 5EFUA 4IEXA 1QJY1 3IKWA 1WW6A 2JD4A 4Q0SA 4J6GA 1RUI3 3BN6A 2ZZQA 1E57A 4CU6A 3TEYA 4N9IA 3MIFA 2WO7A 4UF0A 4M3CA 2YU2A 3C8XA 1BEV1 2NPIA 4R8HA 1O6UA 2VOVA 1IQAA 1AF9A 4BZ4A 3WDXA 1MS3A 4B7EA 2JG9A 2PHLA 3R0RA 2BNOA 4HN1A 2VBDA 5FBZA 3U37A 1NA1C 3AJYA 2VBPA 2VH9A 3VBFA 1ZBE3 5J1XA 5KHJA 2YZ4A 3E6BA 3IDBB 1UKRA 5HCFA 4BMBA 5KHHA 3SKJE 4CVUA 1RUH3 5I8YA 2ZHLA 2ZMLA 3WF3A 4FOQA 2WNVC 2NZ9A 3HQXA 5FPLA 1MZEA 5AC93 1CGPA 2AACA 4ZS2A 5J7MA 3VBOB 4OMCA 1RUNA 1N1SA 1NOVA 3FBMA 3T0AA 3F95A 3PMSA 4YG3A 2DVBA 5C8CA 1F35A 5GLTA 4B4PA 5FO9B 5DAWA 1NZIA 3VBUA 2QQMA 1OH3A 3POYA 2YPDA 1SACA 3OTFA 2MEV2 1G6NA 1Q8VA 1XNDA 1PMIA 3UESA 2EXHA 4MV2A 4A6OA 1Y3TA 1BEV2 1NCQC 4OUSA 1DYPA 1GKBA 1I9RA 2VMDA 4ISRA 5FLJA 3WX5A 1TME2 3BI3A 4QU2A 2YMZA 4AEDC 3MDPA 4ISQA 3D0SA 4Y4RA 4UW4A 3WG4A 3U4XA 3AFKA 1BVVA 5CFCA 2ARAA 2NMNA 1C57A 2RDNA 3MPBA 4NRMA 5FUNA 1SCSA 3MW2A 4CXWA 1G9FA 3RS6A 1VAKA 3IM0A 4UXAA 1JZ7A 1W6MB 2VY0A 2ZGMA 1ODMA 1YWKA 3JB8A 4LBOA 4PLMA 1GZCA 2X09A 4FSJA 1YQ5A 3FBYA 2DVDA 2Y6HA 1X50A 1D4M2 3O7OA 5FXXA 1Y9QA 2K2SA 1KJRA 2E7TA 3WXPA 3WF2A 4E27A 3HAGA 5ABJC 4RS5A 1W2NA 1Z78A 1IG3A 2W91A 3M3OA 3H8OA 3AZWA 4JTNA 1LOEA 2BGOA 1UAIA 5FPBA 5BNNC 1RUD3 2E6VA 4FPFA 4M00A 3J9SA 4IV1B 2X5IC 4MHRA 4PDWA 4B4QA 1QDOA 2HWB3 2XBO2 1RXGA 2ZZJA 3QBQA 4D6RA 3J7LA 1CONA 1Y43B 2VL4A 3T30A 3U78A 2WT2A 2BPA2 3R4DB 3ZFGA 4WM8A 3AMPA 2DTWA 2OX0A 3TRSB 4YFZA 2ZX1A 3HBKA 4XF3A 1N1TA 4PLOA 5FK7A 2RS13 3ACLA 4O7XA 1PO11 5C7GA 1ZM1A 2VW0A 3OUHA 1L7QA 1NXD1 4JZRA 4CDQA 1LB2A 1RMU2 2PHDA 3JZVA 5KC5A 2PHXA 1W2AX 4NHLA 3VBUB 1JZ6A 3VDBA 1UOGA 1W9FA 1XYPA 1CAWA 3S5AA 1QXRA 1OUSA 2IXLA 3DCQA 2V73A 4QX3A 5JSOA 4QX0A 2W08A 1RUF1 4BE3A 1TMF2 2Y6LA 3T3YA 5IK7A 4Y1VA 1S0CA 2BP6A 3SQOA 3TN93 4OZXA 3W59A 4LE3A 2ARCA 1Q5OA 2O14A 4FP3A 5FZAA 3GZTB 4YM1A 4ZS3A 1UY2A 1S0GA 2JB4A 4Y20B 2A7AA 1S0DA 4HL0A 2GMPA 3V0AB 3VBFB 3ZYGA 4TWTA 2H0BA 2A1XA 3ZN4A 1UU5A 1C1FA 2LW8A 3NV1A 3E5XA 4ASMB 4FVVA 2BNMA 1AL22 1SLIA 5CG9A 1UKGA 2D44A 1W04A 2QKDA 1UXXX 5D8AB 2R30A 4UFIA 3UJOA 2YGLA 4O9GA 4UFMA 4MGZE 4YW6A 3GJAA 4E4HA 3J26N 3KWVA 3R05A 1NXMA 1PO13 4PI0A 2F4LA 5KXDA 1J3RA 2EICA 2ET1A 4LLOA 4ZU5A 4XCBA 4BQ4A 4COUA 3OD0A 4HK9A 4IE0A 1J83A 4NPRA 4XUPA 3LOIA 4AGGA 5F6KA 3ACFA 1RJ8A 2B46X 2W95A 1VBD3 4INDA 2Z4FA 3CZJA 3PU3A 1OOPB 4QHZA 3WVJA 4HETA 3N7KA 4XUQA 1W9SA 4HK8A 2D6NA 4BXFA 4E2GA 1F2NA 4Q4V3 3ES4A 1ZBA1 2X29A 4MG2A 1NG0A 1WMEA 3IBMA 3NL1A 5FY0A 4AEDA 3RZHA 1YHFA 4OI0A 2HEWF 3OJBA 5I0TA 1OQEA 1Y4WA 2X8KA 1SLCA 5IAXA 5HV4A 4ET7A 3Q8CA 4MVTA 3ZMNA 1DHKB 3PJQA 5IFTA 2TUNA 3H50A 2ZABA 4YWAA 5DUUA 4AXOA 2BYVE 2Z2SB 3IWZA 1UNBA 2P5BA 1G9CA 4YLZA 5A80A 3VD7A 2D6OX 4W50A 1SBFA 2JE7A 2W5FA 5JMCA 1PVC3 2VUCA 4K1YA 5FYHA 3B93A 3CF6E 2RM21 3LE0A 1HXS2 4NHMA 4ZZ8A 5FZ6A 1R093 1ZA4A 5IHRA 4FCAA 4FOVA 2XXZA 3ZXGA 2IWGB 3ZFEA 2VZVA 1YQ2A 2DTYA 1VBB3 2ERFA 1GBGA 4XW3A 1W0NA 4WVZA 5AFEA 3THDA 3ZYPA 2WYFA 4RR3C 1WCDJ 4FPLA 1JHNA 3CKHA 4GULA 4RQPA 1JZ4A 2BZDA 4LK7A 4LQRA 1ND2A 3EMRA 4PIYA 1JODA 4FO9A 1WLWA 3GZUC 3OYWB 3AZZA 5C9AC 3HQRA 1UMZA 4YZ4A 2W46A 4XUTA 1GANA 1W8NA 3NNLA 4QXKA 2CGNA 2WA4A 2Z5WA 1MVEA 4A3XA 2V5YA 4Q0PA 3OPZA 4LHSA 4QXBA 4WM7B 2Q8CA 1OPOA 3NW4A 1JZ8A 4FFFA 1X8EA 4YW4A 4L92A 5T5JA 3VZOA 5B2GB 1NT0A 4RGKA 4DPNA 1W2TA 5FV3A 4HBNA 2WABA 4XF9A 3W21A 4CUBA 1SBEA 2P17A 3ZXJA 3WOGA 3TBDA 1KS4A 4D7YA 3IPVB 4Q0UA 1QEXA 3I2GA 4BDVB 4BOWA 1OA2A 5JR7B 2OVUA 4R9CA 4BQ2A 1LU1A 3PVOA 3NKTA 5LY1A 3BALA 1ZRCA 2D3PA 2R32A 4XOGA 1TEIA 3M3EA 4QWNA 3VKNA 1ULGA 2Q0AA 5JMOA 3O1PA 4E4ZA 1QDCA 3A0NA
chains in the Genus database with same CATH topology
4HSLA 4YGBA 2PLV3 1XU1A 2A3WA 4RFT0 1LHNA 4BLIA 1VBE3 1DGRN 3DL3A 4CTEA 1DQ1A 5KWRA 2DV9A 1C8M1 2RM22 1W6MA 1IGOA 4CZSA 5E8AA 3M3IA 3NJZA 1ZYBA 1YI7A 1XE8A 2OZ6A 4IEQA 1D2QA 4S2GA 1RHI3 2XGXA 3LAGA 4LULA 1D0GA 2MHFA 4Q8KA 3C3VA 1LOGA 2Y38A 4X8NA 4LA3A 4Q4V1 3TN91 3AKPA 3VHRA 1EAH1 1MS0A 3V0BB 1PO23 1PGL1 4DQAA 2TBVA 2XHKA 1C8NA 4Q8LA 4R52A 4QGLA 1Z7S3 1EY2A 4MXVA 2WT0A 3KB5A 3ZSMA 4HANA 5A3LA 3LSEA 3ZSLA 1W6QA 1RUE1 2SLIA 1C8M2 1ENQA 5KHGA 4AEDB 1XQNA 2WNUA 1AX0A 3DF0A 2K9ZA 2GNMA 2I07B 4AVSA 4F7ZA 4FBFA 4HT1T 2GDFA 4BCUA 5GM0A 2D7FA 1FPN3 1ZNPA 1LU2A 4K1ZA 4QMAA 1ND3B 4AQ2A 4XFFA 2PHUA 1X8MA 4XTPA 1XU2A 2ZGPA 5DZGA 3VBSB 3RI8A 4I09A 2ZGOA 4YZ5A 3LSDA 1DGRA 1J59A 4AEMA 5CA6A 4D7TA 4Q4X1 4QGMA 1RVF3 2E7QA 2B8MA 4YM2A 2DCZA 2ZGQA 3ZMOA 4V1PA 4Q2FA 4W65A 3ES1A 1EV11 1QQP1 2E9QA 4YG0A 5HCAA 1AX2A 4Y22A 3ZN5A 1DZTA 2OZJA 1VLNA 2HJIA 1AL0G 3GF6A 3WDYA 2HWD2 1PNGA 4AFCA 5EYXA 3MLLA 2YDEA 1AJKA 2A70A 5EYYA 2VVFA 4Q4W1 4AYUA 1Q3EA 4LBNA 1EAH2 3VZMA 5T5OA 4CEWB 4C91A 3ZDSA 1I1EA 1G9DA 2ES3A 1PM7A 3HN1A 3JCIA 1GQHA 1KS5A 2O1QA 3LA2A 4I01A 5CBLA 3WQ0A 3VUOA 4K7JA 5JCTA 1B35C 3S7EA 4IEZA 4N7UA 4Z82A 1QOTA 2A6YA 2JEMA 1JTZX 4JVAA 3I54A 1T6GC 4M3CF 1HRI3 3FLRA 2IXHA 1DQ6A 2YV8A 4XF0A 1HRV1 4RGAA 3WW4A 4HKWA 2ENRA 3ALQA 4ITCA 4ONUA 4QPGB 3TYJA 1ZBE1 2WJSA 4B29A 4LUMA 2RS12 4N90A 2ZGRA 4DXZA 1H4GA 4YVWC 4BMEA 3MFCA 4A7KA 4PBOA 2XJSA 4QQLA 3MZHA 1OFSA 2TEPA 3ZXDA 4Y1YA 2GNDA 1S55A 5D1IA 3JQXA 3M7AA 1TQ5A 1BXHA 3T2TA 3S6PA 3WLUA 1KFXL 4AFAA 1G9AA 2BFUL 3WW2A 4QPYA 1O3QA 1HV1A 3WDUA 1ONAA 3VGIA 4MZUA 2R061 5A3MA 1R1ZA 3RMXA 1BVP1 4YW5A 1QXJA 5ACA1 1RITA 4IEYA 4WM7C 2TNFA 1GNZA 4HPKB 4NWWA 3OY8A 2JDZA 4I3PA 3VZKA 4YVSA 2VNRA 1RUH1 4AQ6A 3N3HA 2VVDA 5J3UA 3VKFC 5J37A 2BUKA 4JGYC 1SCRA 2HWC3 4FPOB 3CJXA 4X6QB 2D98A 1OI6A 3OBTA 1NCRC 1H1AA 1XYNA 2RS52 1D4M1 3WT3A 4LO6B 2QVSB 5JVVA 3U07A 1U5XA 4HZFA 4BH9A 4I3GA 1PVXA 4IEWA 2PN5A 3H7YA 1HV0A 1ZVFA 3ELNA 2EIGA 3X29B 1CVNA 1GR3A 4BHPA 2AENA 1DYKA 4M0HA 4HVQA 2NN8A 3AYCA 1IPKA 2N7GA 3KCYA 1DQ4A 4OHZA 1JUHA 1IZ3A 3QCWA 5CFDA 3NO8A 3WP4A 1RUI2 2R49A 3WP3A 3CJIA 1YCIA 2RS31 1RUOA 1OOPA 1R1A3 2I2SA 2YYOA 2BWCA 3I59B 3P3NA 2VPVA 4EWEA 5JDBA 3JBG3 3G6JB 3WCSA 2JICA 4P9WA 2Q4SA 3D4KA 1TMF1 1GNHA 1CAXA 1UIKA 1RIRA 5ACA2 1KQRA 4XBQA 1FAYA 5I8TA 1PGSA 5FMOS 2GNTA 4D69A 4DRVA 3MIBA 5SV5A 1ND2C 4CDQC 2FHRA 2NP0A 1DQ2A 3ZXAC 4MUVA 4IEOA 2YPJA 4LBQA 4MLOA 4YW1A 1K5MA 4AGVA 1KITA 2RS32 1RUE3 1WGPA 5IK8A 2P37A 2GH2A 5F1RA 2JE9A 3AYEA 1H2KA 4XJZA 2XLGA 1ENXA 4GALA 3DGTA 2GZWA 1UD1A 4LO7A 2B45X 1URXA 3AKTA 5T5PA 1TME3 1QJY2 3TNQA 2IXJA 3GZAA 2ETEA 3MF9A 2R6QA 3AP6A 2XJQA 3BIWE 2IFWA 4CDQB 3W9AA 5L73A 5C4WB 4LBQD 5E88A 3ZFFB 1BZWA 5DXDA 4K6BA 4EJRA 5LK5A 3ZFGB 3WHUA 1UZZA 3BOPA 2DFCA 5HBAA 1A3KA 3WQ7A 1HLCA 4LBLA 1V9U1 3ZO0B 1VBE2 4EN7B 1DDLA 1V6JA 2UU8A 1FOD1 4E9KA 2AUYA 4KWKA 2XVLA 4GH4B 4CRQA 1AJOA 3ZYJB 1PHMA 1OMIA 2ZX3A 2RE9A 3EHKA 3VBHC 1Z7S1 3FUOA 4CEYA 5BNNB 2FZ2A 1POV1 3IMNA 1LKNA 5K9YA 1R083 4L97A 1V00A 2ZJCA 1UW8A 4NWVA 3ZYIB 3JD71 5ABJB 2X53S 1B35A 3ME2A 4OUMA 3KD4A 4YSFA 1UCXA 2PFWA 2D6PA 5BNOB 1YJLA 1ENSA 1YFWA 5L19A 3HR9A 3ZX7A 2DVFA 4FPKA 1RUG3 1FOD2 1DG6A 2GMEA 3O0XA 4WZCA 3ASIA 3JB4C 3RG0A 1C8M3 1VBC2 3U0ZA 2WNEA 4FPCA 3E6CC 4CDUC 1L3JA 4AVBA 2UWCA 3KGZA 1V6KA 2GSYA 3ZXEA 4JDNA 1GV9A 1CAUA 1BKZA 2OIIA 4HFSA 1BJQA 2R043 1XNKA 2WSUA 2ZMKA 3MIEA 4FXGB 1ULDA 4YVSB 3J8F1 5KXBA 2DWRA 3B7MA 4KBBA 4WVMB 5LRRA 2W52A 2FZ1A 3FZ3A 1Q56A 1QJX2 4GKXA 1G86A 3ETQA 2BNNA 1AXKA 4DZGA 3WUCA 1Q8QA 4LEJA 5EZWA 5CVRA 1JUIA 3FC0A 2AYHA 4Q27A 1C5HA 2VOKA 4NOTA 4XFIA 1VBA2 2WQZC 3ZVXA 4W6WA 1ZZCA 1A8DA 2D97A 1OLQA 1W6NB 3VV1A 4UW6A 3B02A 5JOXA 1BYHA 1AHSA 1PGL2 1IS6A 4XILA 3WDVA 2D93A 4Z8BA 2CAUA 3BOWA 2PAMA 4Y1UA 5FREA 1A6CA 1OQDA 2UWAA 4H14A 1N47A 2NMOA 4XQ4A 1VBC1 4WV8A 3OGJA 3KS7A 4PJYA 4YARA 1MS4A 3O14A 4AI2A 3AMQA 4Q4X3 1VBB2 1U12A 4YZ3A 1B09A 1KJLA 1GFF2 2ATFA 3ECQA 4EN0A 1BK1A 1IPJA 1NA1A 1BBT3 2DU0A 2QZ3A 5GJ6A 3V56A 4Y24A 2ZX2A 3M1HA 4Y22B 1MS1A 4NR1A 5JPNB 1ZBA3 4Q26A 4E2QA 3UL2A 4OHWA 1WLTA 4WZFA 5JZGA 5K0UB 4COWA 5A33A 1C3HA 2WNVB 1G8WA 5DDJ1 1AR71 3C2UA 1TME1 2GH8A 3JQWA 4MXWA 3KGLA 5JSPA 1W6OA 3VBSA 3H3ZA 2AH2A 2XVGA 5DUWA 4BWOA 2H0VA 5JLVA 4JAAA 2UY9A 1PO21 3ZN6A 3ILRA 3LWCA 3B5LB 2HWB1 4P9JA 1NLSA 5T50A 5I0SA 4XXPA 1W0PA 1V9U3 5FPXA 5BNOC 2EVXA 2WNUB 1BQPA 3M4FA 4XMIA 3VDDB 1H8TA 1RUJ2 2OA2A 2VU9A 2DUQA 5F9TA 4YGDA 1S0FA 4L9BA 4N43A 2PHWA 2P3JA 5FO8B 5GZCA 4PLNA 1ZBE2 1RHI2 1HW5A 2WA3A 1YIFA 3VBHA 1LHWA 2DCJA 1DU3D 1RUF3 1NYWA 1D0HA 3TNPB 2R16A 3NAPC 4B4RA 4UBHA 2XUMA 1AXZA 3RRDA 5JOZA 5K8SA 5L36A 3V0BA 2CTVA 1APNA 1O91A 1U5IA 3FLTA 1PO22 2QE3A 2RS11 5BNPA 2X5IA 4PDWC 5BNOA 1SDWA 2ZGKA 1F5FA 1ULEA 2KA3A 3GHMA 4OFGA 4OHXA 4LBJA 3G7DA 3SLIA 2P34A 3UV9A 5BNPB 2SBAA 2W68A 3S30A 5L7OB 2R0FA 2XL9A 3ZFGC 2IFRA 1U5ZA 4B7KA 2WFF1 2R072 3FX3A 5FDBA 4CDUA 4A7ZA 1AR72 1QMJA 1WMDA 2PHFA 3GALA 5C4WC 3MFAA 3SNMA 3WQ1A 3W58A 4GMP0 3IN9A 2H6CA 3VLBB 3KM5A 2YGMA 4CP2A 1AR83 3USUA 3DPRB 3NAPB 3E5UA 1W2UA 3LKJA 4XJWA 3IPVA 4XFGA 2DVAA 4AEJA 3TAYA 2VW2A 1FV2A 1LCLA 3HIFA 2VMHA 5HCBA 3A4UA 1YLLA 1GQGA 1RUD2 2CL2A 2R041 1PVC1 2XBO3 3N35A 4MXWB 2QNKA 1XYOA 3K51A 1U0AA 4I2OA 2EF6A 2Q1ZB 4AFBA 2HWD3 5FRAA 1QJU1 2RMU1 1UU6A 4GIQA 3AZXA 3ILNA 3PJYA 1EYBA 2WS92 5DZEA 1WA4A 4AWDA 2A6ZA 3ZYRA 1NY71 4LO4B 2KM2A 5J98B 3WHTA 4HVRA 4CDWC 1ASJ1 5FAXA 4TZDA 3TN92 1DZQA 4QX5A 1AZDA 2YROA 4Y5Z0 1PZ7A 4KWLA 5H9SA 1W0OA 4U36A 2RR13 3A0KA 1TE1B 1IS5A 2NQYA 4YVWB 3FJSA 4IV1C 4NN0A 5LK7B 2IZWA 3RMYA 2WS91 4CDWB 4FTEA 4YW2A 1FOD3 4E4DX 2ZS6B 1EV13 1ASJ2 1FMD2 1QQP3 2BQPA 2CWSA 2WNUC 4EWAA 4W6XA 2GAUA 2D6LX 4I0WB 5I91A 1MACA 2B9UA 5C9AA 1V6NA 4N53A 1CESA 4RHV2 1PZ8A 3E6DA 2EXKA 5FPZA 1F31A 4GXLA 3QD6A 4C1WA 3NSTA 4YW3A 1QJU2 2RMU2 3UKTA 5A32A 3NV2A 4EV0A 1VBA1 1UPIA 1R1A1 2UURA 4YZ2A 3I8TA 2E7AA 2VW1A 1JYCA 1DGLA 1C28A 4QM8A 1VR3A 2XWBB 1J3QA 4JGZA 4KQ7A 2C0ZA 2C1FA 4KU7A 4CYDA 4YZ1A 3WW1A 1PIV3 1REFA 1GYKA 1ZZ9A 2ARXA 4JGZB 3VBSC 3VBUC 4LTAA 3VKLA 4D3WA 5FOJB 4O9EA 1DGWX 3DUIA 1CN1A 2BGCA 4KG0A 4D94A 1SFYA 3QH6A 4PF5A 4XHXA 4CDXC 1R092 3QACA 3I2DA 1RUH2 2R0HA 5DDJ3 3VZNA 1S0IA 1O4TA 2VXRA 1KDKA 2RR11 1X82A 1FYUA 1AYM1 1AL21 2WLPA 1R1A2 5CU1A 3VBRC 4B3NA 3JBG2 3JD72 4JV4A 4LBKA 5FMOL 3RI9A 2NYYA 3UK9A 1RHI1 1F9KA 2G9FA 2MEV3 3D82A 5H9RA 4HLTA 4IEPA 3O0WA 3ZPYA 4CEYC 4AI0A 2E51A 2BTVC 4BQ1A 2WC2A 2HYKA 5JWPA 2FQPA 4QT6A 5BUVA 2ZHMA 3HT2A 3MIHA 1BBT2 2YHJA 2F4PA 3AXDA 4QD2A 2ZGNA 3WNXA 4A2UA 3PLQA 1AYM2 2PELA 4NVPA 1LGCA 2Y0OA 2DF7A 1D4M3 4ZXKA 4W6YA 3FUQA 5AC91 3KCCA 3ILFA 2HWF2 3V64A 1MEC1 2HWC1 4ORFA 4MH0E 1DQ5A 2A6VA 3M8LA 5H9QA 4YYOA 3LGRA 4RGGA 4XXAA 5KHIA 1NE4A 1RUJ1 1QJX1 2QCSB 2EAAA 4CP1A 2ZX0A 5F6LB 4AVTA 1W39A 5GLUA 3AZVA 4FPEA 4XFHA 1FNYA 4RL7A 2WZPP 2WFF3 3VBOA 4JRLA 4P9LA 4Q0VA 4CDUB 4URTA 4NO4A 1LODA 5J48A 3L9JT 4AF9A 5LEKA 2W39A 1JW6A 5DZFA 4ATFA 1RB8G 2O8OA 4XZPA 3QLQA 3LA7A 1C1LA 5IT6A 1XNCA 4COYA 3H1WA 2VNGA 4R9BA 2HKXA 4FOYA 3FFZA 4XFCA 1VB2A 2C9AA 1LESA 1MS5A 2GC3A 1DQ0A 1HRV3 1DIWA 2A73B 1NQDA 2CY6A 4AFDA 1LGNA 1CQ9A 1AL23 1J1TA 1J58A 5JSRA 2VQAA 1REDA 2XJVA 3E97A 4MGYE 2EAKA 4XIKA 1H8TC 4YM0A 1CJPA 3HT1A 2XPJA 1AR61 2CAVA 2EA7A 4EN6B 5L7OA 1PO12 4GH4C 4IV3A 3CJIB 1AR93 2DVGA 3RZZA 2VMIA 4OHVA 1HKDA 3AYAA 3JU9A 3EQEA 2R073 5CFDB 4GMP1 3PVNA 1GZ9A 1FI2A 1JBCA 4R4ZA 4UW5A 2WZR1 3SCHA 1I6XA 2GN3A 1H9WA 2R042 2XB6C 1UIJA 3GBGA 3VKMA 3WG2A 1JYIA 2QDRA 4IESA 3AK0A 1NCQA 4MX3A 4KNCA 4AQTA 3ZFEC 1M06G 1QXPA 4N43B 1EAH3 3H9AA 2BEOA 5GZDA 2RJKA 4KGGA 3WR0A 5A33B 2XJRA 5BV6A 3WW3A 1N1YA 4K8FA 1AYN3 4YVSC 4BPZA 3KZ4C 1YRZA 4OI2A 1YI9A 2AR6A 3AJZA 3CLPA 5C8CC 1AXYA 3OY8B 4H7LA 3AXEA 5BY5A 3WCRA 3MI8A 3TWIA 1NCRA 1BMV1 4U2AA 2PA7A 4DMI