5IK8A

Laminin a2lg45 i-form, g6/7 bound.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
381
structure length
381
Chain Sequence
APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laminin subunit alpha-2
publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 78
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A02
2R1BA 3B3QE 5AVAA 1YO8A 1N1SA 2UU8A 2A71A 2JDZA 2W08A 2R0FA 3AYDA 5KXEA 3OBRA 5DUXA 2V5YA 3VKFC 3OY8B 3ATGA 4YLZA 1QOTA 1MS5A 2CTVA 2YY1A 1JN2P 4K1YA 1DQ0A 1DYPA 2GN3A 4XHBA 2CL2A 4YGBA 3ILRA 2ZBJA 2A6VA 2P2KA 3CNAA 5JLVA 4YG0A 2ZGSA 5DUUA 2R1DA 4YG3A 1AX1A 1LULA 4Q1RA 4AGVA 3SH4A 1LOFC 1GLHA 3FFZA 2ZHKA 3OY8A 4FPFA 2ZMLA 3HMYA 5CBLA 4YGEA 3AZXA 3RSJA 5JOXA 4Y1ZA 2ZGTA 2E6VA 3BODA 1N3OA 2NYYA 3AYAA 3M1HA 4M00A 4XOGA 5GLVA 2V73A 1WBFA 4XZPA 2GNMA 2A5ZA 1MS4A 1Q8VA 4BLIA 1S0FA 1VLNA 1Q8PA 5T54A 5GLUA 3V0BB 4BOWA 3AK0A 3ZXFA 1V6LA 4YW1A 3V0AA 1VIWB 4ATEA 4NO4A 5DUVA 1CVNA 4Y1XA 1SLLA 2D3RA 2ZMKA 5GALA 4Q2FA 5H9RA 3ZSKA 3U4XA 1LOAA 1S0EA 2JE9A 3DGTA 3POSA 1QNYA 3B69A 1UZZA 2GMMA 3AJYA 4FOWA 1V6JA 3ILFA 3WDXA 5CAZA 4JCKA 3C2UA 3RS6A 1GKBA 1S0DA 1ONAA 1SBFA 3T1MA 3RQ0A 1UAIA 1N3PA 1S0BA 3JU9A 5JOYA 4BMBA 4YFZA 4LBKA 3WDUA 1SLAA 3V65A 2OVUA 4RA0A 3MW3A 3SH5A 1D2SA 2AREA 2GMEA 3VV1A 2EF6A 1QU0A 1YYNA 1GNHA 1DIWA 4HANA 2D6OX 4XXAA 1DYKA 1V6KA 2DYCA 4WVWA 3AP4A 5SV8A 4Y1UA 1Q8SA 3R4UA 4XHXA 4AGGA 1V6MA 1D0HA 3AZWA 2PHRA 4TZDA 2D6PA 2NMOA 3ZSLA 3ZXKA 2AYHA 4WV8A 4H55A 3UL2A 1S0CA 1DBNA 2BQPA 2GNDA 1CIWA 2R49A 3AP7A 3RG0A 4GKYA 1LOCA 1Q8QA 3UJOA 4YZ2A 1MZ5A 4K1ZA 3UJQA 2H0BA 4R9DA 3ZXJA 4FVVA 5T5LA 1LOEA 1TEIA 3FLRA 1OFSA 4Y22A 5JOZA 3NV3A 1LGBA 2P37A 2PHXA 4HL0A 1Z0HA 2DU1A 2R0HA 5E89A 3V64A 1S1AA 1W6OB 1MVQA 1LGCA 1SLBA 3WLUA 5JOWA 1PZ8A 2ZGKA 4LBOA 5EXOA 1G9DA 2OUJA 1GSLA 2JKBA 1FNZA 1OKQA 1UZYA 3O12A 3OJBA 3USUA 1SLIA 2PHWA 4FP2A 1NLSA 2OW4A 3L2YA 2NP0A 1ULFA 1C1LA 2DUPA 2JJ6A 5CNAA 5DXDA 1A3KA 2AENA 1UX6A 2AUYA 1C1FA 1ULDA 3WDWA 4XMIA 2YROA 2ZABA 5KXDA 4Q8KA 2E53A 3H0OA 4YGCA 1RIRA 3M2MA 1W6OA 2ZGNA 5HCFA 1JHNA 1X50A 4LBQA 2ZHLA 1F9KA 2KM2A 1FV3A 1ENQA 4FPYA 4R9AA 5JMCA 3I4IA 5DZFA 1MS9A 2P34A 1MVEA 3R4SA 2ZGPA 3WUCA 4P14A 4CTEA 3WVJA 1GYKA 2UWCA 3ZXLA 1WW7A 1CESA 3FLPA 3PVOA 4UW4A 3TAYA 4GWMA 4Q27A 2DVBA 4JC1A 3OGGA 4UW5A 5E88A 5L73A 5GZCA 3N7MA 2EIGA 5KXCA 4Q8LA 1UPSA 4XJAA 2EALA 3W58A 5T52A 3B9CA 1DZQA 1APNA 1IS5A 2A6ZA 3AYCA 3SITA 4ASMB 4Y1VA 5JDBA 4LBJA 1G7YA 4Y20A 1N1TA 3GALA 3POYA 1DLLA 4KBBA 3RRDA 3WCSA 4D69A 1ULGA 4XIOA 5GZEA 3UK9A 2ZGRA 1B09A 1BXHA 1HKDA 2P3KA 3WG1A 1Q56A 2ZA9A 1A78A 3QCWA 3LSEA 4U36A 3T2TA 4MYEA 5IUQA 1OQ1A 1KJRA 2PELA 3N36A 1CPMA 4XILA 5GLZA 4UW3A 3BOPA 1S0IA 4DPNA 5HCBA 1MS1A 4FP3A 3SLIA 4DS0A 3V0AB 1LENA 1HQLA 5GZGA 1LEMA 4TYSA 2C9AA 3IPVB 1MS0A 4ITCA 3AJZA 1AXZA 3AP9A 3PVEA 4ISRA 2YV8A 4YW3A 4U2AA 2GDFA 1AJOA 1JYIA 3WHUA 5FRAA 1F5FA 1IKPA 2G4IA 4OZXA 4FQ4A 1WBLA 3ZXEA 1BJQA 1CPNA 4PBPA 1RITA 2GN7A 4XE9A 2DUOA 3BIWE 1LOFA 2FHRA 4YW5A 1W6MA 3MW4A 4NOTA 4PBOA 5EWSA 5T50A 1MS3A 3A0NA 2W39A 4UW6A 4AYUA 1KRIA 3OYWB 2A3WA 3IPVA 2D3SA 1FV2A 2ZGLA 1AJKA 3D4KA 1N1VA 3NV2A 3POWA 4I30A 3INAA 5LK5A 2R16A 1CJPA 4YZ5A 4FPHA 1G9BA 3SH3A 1W6QA 2YXSA 2WLQA 1CN1A 1KDKA 4FPKA 1G9CA 3I8TA 5IK4A 3AP6A 1N3QA 2LTNA 3A4UA 4WZFA 5KXBA 1LGNA 3WZ1A 2HYKA 1CR7A 4DRVA 4Y24A 2SBAA 4K21A 1GICA 2XB6C 1IKQA 1WW5A 2P3JA 4AVTA 2DV9A 1GZWA 1I3HA 3OYWA 4W65A 1SBEA 4P9XA 1NXD1 1WD3A 3OBTA 4AGRA 1SCSA 2EAKA 4R9BA 3VKMA 5H9PA 2ZGMA 3MPPG 2VW0A 4Y22B 1C4RA 4ZKTB 2WKKA 1J1TA 3RMXA 1LHVA 5F5QA 2VW2A 3D5OA 5T5JA 5DG1A 2LALA 2ZHNA 2UWAA 2JECA 1I1EA 4XJ8A 2DUQA 2ZGOA 3USUB 2CNAA 4RL7A 3APBA 1G9AA 1O4YA 1ULEA 4YW2A 1ENRA 2WT2A 2SLIA 1AXYA 2GNBA 3PVNA 1LECA 1LHOA 1R1ZA 1DQ2A 1YIFA 1URXA 2DVGA 4K20A 1WW6A 4LBQB 3WG2A 2D6LX 2AH2A 5DUWA 2Z42A 1N47A 2ES3A 5IK7A 2E7TA 4GA9A 1AVBA 4XBLA 1Z78A 2CYFA 5DG2A 2YZ4A 3OPZA 2D43A 4L8QA 4R9CA 2D3PA 4YZ3A 5BYNA 2EXKA 1JUIA 1H9WA 2UWBA 3AZVA 1GANA 2NMNA 5GJ6A 1WLWA 4YM3A 1ULCA 2PHUA 3O0WA 1GZ9A 2A3XA 2ZHMA 1SCRA 3FBYA 2NZ9A 3QLQA 4XIKA 4Y20B 4XYXA 3AP5A 1N1YA 1BZWA 1DHKB 4FPJA 3ILNA 3N35A 1BYHA 1CQ9A 2VW1A 2AGSA 1VAVA 1WCSA 3ASIA 3Q9OA 4XJWA 1LOBA 2ZGQA 1FYUA 4JRAA 1SLTA 2EXJA 5GZDA 1H9PA 5IT6A 5H9SA 4YG6A 5T5OA 1S0JA 3WDVA 5EYXA 1JXNA 4Q1PA 3R05A 4XTPA 1W6PB 4WVVA 2UURA 1WLDA 3N3HA 4ISQA 4FPEA 3B01A 3ZYRA 2ZZJA 1AZDA 1DQ6A 5F9TA 1RINA 3TB0A 2ERFA 5IK8A 3KM5A 4YZ1A 1SLCA 3BTAA 3AFKA 1SACA 2GNTA 3WDYA 1WUVA 3NWKA 2XG3A 4P9WA 4YM0A 5E8AA 4AWDA 1LHWA 2JD4A 1LHUA 3JUUA 1MS8A 1QDOA 1C57A 1LHNA 3IKWA 1G8WA 2A6YA 1V00A 1V6NA 2CWSA 4FOYA 1DQ5A 3A0KA 4XBQA 4FPOB 2TEPA 4ZXKA 1W6PA 1CONA 4FOQA 1W6MB 1ZA4A 3ZSJA 4GALA 4Y1YA 1QOSA 3AXEA 3MW2A 1LOGA 1ZM1A 1AX0A 1Y7BA 4M01A 5DZGA 3M3QA 4YZ4A 1PZ9A 3D6EA 2D6MA 1GZCA 1MZ6A 1UKGA 1S0GA 1VALA 4FQZA 4CRQA 1ENSA 1W6NA 1JOJA 1GNZA 1LESA 1W6QB 3WDTA 2DVFA 2A6WA 1F31A 3B00A 3FLTA 3WNXA 2FMDA 1LU1A 2I2SA 1QOOA 2NN8A 2D6NA 2DVAA 2PHTA 1DFQA 4AVVA 5HCAA 1LJ7A 5DZEA 1GZWB 1IOAA 1V6IA 4GWNA 4BLJA 3VKNA 4XXPA 3AX4A 2WNEA 1KQRA 1LEDA 2D44A 1DQ1A 1DQ4A 1LODA 5CA6A 2DTWA 1WD4A 3ENRA 4SLIA 4CZSA 4XDQA 4Y26A 3MEPA 2WJSA 4C1WA 1W0OA 2DVDA 2YMZA 1SFYA 5T55A 3VUOA 1FNYA 5GM0A 2C5DA 2ZGUA 3NV1A 4P9YA 4YM2A 4PQ9A 1QKQA 2ARXA 4YW4A 1JW6A 4M3CE 5H9QA 3RMYA 3SISA 2ZMNA 4M3CB 1Q8OA 1XQNA 2W52A 3WCRA 3WOGA 4FOVA 4DQAA 5JVVA 2DURA 4YM1A 3ZPYA 4BM8A 2ZKNA 3FUQA 3N7LA 1YI7A 4PF5A 3IMNA 5CB7A 1MR5A 2DU0A 2VU9A 5EYYA 3ZYPA 3V0BA 2VUAA 2DWRA 1BQPA 2AR6A 3AYEA 3WG4A 3NV4A 3IM0A 1KDMA 3WV6A 4M3CA 1IS4A 2A6XA 3IN9A 4BQ1A 3HR9A 3WG3A 1G9FA 4LBNA 3AXDA 2RHPA 4ATFA 4DFSA 2ZACA 1FX5A 1YRZA 4LBQD 3SNMA 1DGLA 4YGDA 3M3CA 4DRRA 4F83A 3N7JA 4M3CF 2PHFA 1V6OA 4XBNA 2A75A 5GLTA 5IK5A 2A70A 1QNWA 2OUHA 2A7AA 1FAYA 2P3IA 1H30A 1GBGA 3DUIA 3KQRA 4XJUA 1A8DA 2WT0A 1GV9A 1KJLA 1QDCA 1PZ7A 2JE7A 4XJZA 1EPWA 1G86A 4YFWA 5T5PA 1JBCA 1U0AA 3WUDA 2ZAAA 4Z8BA 3O0VA 4LBMA 1VAMA 2E51A 1W0PA 2CWMA 4PCRA 3VKOA 1AF9A 2EXIA 1LU2A 1O4ZA 1YXWA 2VXRA 3PJQA 2CY6A 1FATA 1LCLA 1AXKA 4BPZA 4XTMA 5GLWA 4C1XA 2VY0A 1MACA 3M3OA 3O5SA 1AX2A 5GZFA 4XMAA 4FPGA 4FPLA 2A3YA 3AZYA 3LCPA 2D7FA 4LBLA 3ZVXA 2WSUA 1UMZA 1IS3A 2GALA 4FPCA 2VH9A 1WLCA 1QGLA 1HQWA 1HLCA 5FREA 2Q5TA 2WT1A 2EXHA 2NM1A 2E7QA 1UN1A 4AVSA 1HDKA 2ENRA 1IS6A 1WW4A 3HN1A 3VKLA 1BKZA 3GNEA 2WSVA 1W6NB 1UL9A 4GKXA 4IQPA 3O0XA 1LTEA 3N7KA 2WQZC 2DTYA 1QMJA 3T1LA 3M3EA 2D6KA 1JYCA 3PMEA 4GXLA 3ZSMA 3AZZA 1QF3A 3FUOA 3LSDA 3WHTA 4BMEA 2GMPA 1SBDA 2ARBA 2W68A 4Q26A 3W59A 4XJ9A 1KITA 2B7YA
chains in the Genus database with same CATH superfamily
4AG4A 5AVAA 4P5YA 1N1SA 5DDJ3 5JXJA 2Q8EA 1QJFA 2R0FA 3Q8BA 3WXPA 2H0VA 1W8ZA 2V5YA 4SBVA 4UT5A 5DUXA 2JENA 3UYJA 5K0UB 4XEZA 1NT0A 3AB0A 4K1YA 1OH3A 4G9SB 5FY8A 4QPIA 3ILRA 4GH4B 1UPIA 3AKRA 3H3ZA 3CNAA 1YJLA 3ZXDA 2R1DA 4AQTA 1AX1A 2XQRA 4QPYA 5K8SA 3SH4A 3VBFC 2VNRA 4QM9A 1O4TA 2JDUA 2QQMA 1GLHA 1AR61 3FFZA 1GUIA 3OY8A 3ZIXA 1A8MA 3PHMA 1C8M3 3CF6E 3BVCA 3HMYA 3CHXA 5JOXA 1QQP3 2PYTA 2NYYA 4HONA 4JDMA 5CKMA 4QQHA 3HQRA 1ASJ1 2GNMA 2K0GA 4BLIA 1I5PA 1Q8PA 1VLNA 1W9SA 2Q1MA 4QAWA 5F3IA 5T54A 3LEKA 1OLQA 1X8MA 2HWC1 4HT1T 1CVNA 4MHUA 1SLLA 2D3RA 2ZMKA 5H9RA 3ME2A 3QD6A 4CCMA 1YNAA 1EY2A 3ETPA 3DL3A 3TN92 2EAAA 2KXLA 4PDWB 3MUZ1 4XFHA 1QNYA 2XKPA 4YVSB 3WNMA 2JB8A 5JUVA 2QQLA 4QPWA 2X8KA 1T6GC 4FOWA 1Z7S1 2ATFA 3ILFA 3T2OA 3WDXA 3WNKA 1GKBA 4PF1A 5A3NA 5FLJA 1S0DA 1BVP1 1SBFA 3T1MA 3H8RA 2IWGB 1UAIA 5JOYA 4BMBA 3TNQA 3WDUA 4CEWB 4A2UA 1VBA3 1KFUL 2WAAA 4RA0A 1UOBA 3ACLA 2Q1ZB 1W2TA 3MIBA 1YQ2A 1OVPA 1VBD2 5A70A 1DYKA 1YEWA 4EE2A 4F8AA 1R093 4WVWA 5BXXA 4H7LA 1YJKA 1MEC3 3KVBA 4B7EA 4AGGA 1V6MA 4CDQB 4BQ4A 4CDXB 2Q30A 2PHRA 3KWVA 3E97A 4TLFA 4XZUG 2AYHA 3FE5A 1S0CA 5FPVA 3A21A 1ND3B 3JBG1 3KVAA 3RG0A 4CU8A 4E4HA 5AC92 2JDMA 1TME3 1LOCA 3UJOA 4YZ2A 5C3PA 1PIV3 2ZX3A 4K1ZA 4OUMA 4R9DA 3UJQA 3BCWA 1LOEA 3W20A 1TEIA 1K3IA 4E4SA 2X5IA 5JOZA 1NKGA 3NV3A 1LGBA 2HH9A 2RR12 4DXTA 4HL0A 4BWOA 3V64A 4CDWC 2Z2SB 3IIIA 4K8FA 1Q5OA 1RUH2 1W6OB 5C70A 1YCIA 1SLBA 3WLUA 5E16A 3SCHA 3VHOA 3CDZB 5EPAA 2MHFA 1G9DA 4Q0VA 1FNZA 2BDRA 4QB2A 2PHWA 5LK7B 4LKSA 3KMHA 1RHI2 1GOHA 1RVF2 3KF5A 3C7OA 5C4WC 2DUPA 2VBDA 5FP3A 3NJVA 5EFUA 2JDAA 1UX6A 1C1FA 4GB33 4XUPA 4AAPA 2CU5A 2VNOA 2Z69A 5KXDA 5L9VA 2RMU2 4YGCA 1RIRA 2YC2A 4DZGA 1SDDB 1X50A 3ZR5A 1FV3A 1ENQA 4KNCA 3VHRA 1MS9A 1YFUA 2BUKA 3AKQA 2ZGPA 5A33B 4CTEA 3KT7A 1GYKA 4RS5C 3CO2A 1Q3EA 3TAYA 4YNIA 5D2AA 1LAJA 4UFIA 2W9XA 2BFUS 2XVLA 2W91A 4G3YC 3N7MA 4J1XA 1PMHX 4XQ4A 5FZDA 5KXCA 4Q8LA 4XJAA 4Z1VA 2EALA 1RUJ2 2WBKA 2ZOEB 5T52A 2VVDA 2A6ZA 2D93A 1ODNA 2BGOA 3AMNA 5FZFA 4LBJA 1STMA 4CU6A 5F5CA 2WYSA 1R1A3 4KBBA 4X6QB 1R083 3WCSA 1PX3A 2XR4A 3UK9A 1C3HA 3LF7A 2JXAA 2ZGRA 3T4VA 3UT0A 4Y4RA 3VBSA 5LEJA 1BXHA 4IGOA 2YGLA 4UFKA 5FZHA 4CEYB 1FT9A 3LSEA 4FFGA 1H8VA 1RUG1 1HJGA 1R64A 1ODMA 4OMDA 2JG9A 1DGRN 1UY0A 1H2KA 1KJRA 2O0OA 3C7GA 4IV3B 2Z5WA 1O5UA 4D7SA 1S0IA 1UY2A 1UW8A 3SHRA 4CCDA 5HCBA 4DPNA 2KD7A 1MS1A 1J59A 3K75B 4OHYA 1LENA 4H14A 2HWE2 1Y9GA 2E26A 4XJ9A 4LEJA 4Q4Y1 5LY1A 4K8RB 4ISRA 1JZ3A 5L7OB 2CV6A 1OOPC 1DP0A 4G4FA 3WHUA 4DUVA 3RZMA 5ERLA 1IKPA 2G4IA 2HWB1 4IEVA 4OZXA 3LOIA 3RZJA 4JDNA 2B42B 1QJX3 4L0PA 4LULA 2VNGA 2GN7A 5LA2A 4TWTA 3NKGA 1NY72 5FZOA 5CKNA 5EJZB 4NIGA 5B4XA 2VNVA 3O1VA 3OBZA 3K4AA 1MS3A 4AYUA 1RUD3 3Q8CA 3IPVA 2ORZA 3SKJE 3O1MA 3NV2A 3INAA 2R16A 3ZFFB 5LASA 5F6LB 1BBT2 3SH3A 2VBPA 3BU7A 1CN1A 4FPKA 1VMHA 2OPKA 3GHMA 5IK4A 4I0AA 5LRRA 3CJXA 4RHV2 3AP6A 2LTNA 4EWAA 5KXBA 3MV01 1AR71 2BZDA 3RVHA 3U75A 4UBHA 4Y24A 4AVTA 1GICA 1IKQA 2P3JA 1GNYA 1GZWA 1I3HA 2Y6JA 1EV12 3ZDVA 1UMHA 2EAKA 3VKMA 2RVAA 5DAXA 1H0BA 5H9PA 2ZGMA 1NQJA 4OULA 4NPRA 4E27A 4Y22B 4E2SA 2R061 1UZ0A 3AMMA 2OT7A 5D1IA 3A22A 3RMXA 4D0QA 2XDVA 4HPKB 1QJU1 1JHJA 3LIGA 1JZ5A 2WZPP 1PK6B 1VPHA 1D4M1 1VJ2A 2V72A 2ZHNA 2PAKA 4XDOA 3RYKA 3QOPA 2DUQA 1AL21 2V09A 5I93A 2XBO3 3DPRB 4Q0PA 5CU1A 2YC4A 4QHBA 4AEJA 1O4YA 1XNCA 2BVBA 4IEWA 5FZ4A 4COUA 4D94A 5JI9A 1G9AA 5F5IA 1ENRA 4D6QA 1TNRA 1HXS2 2AACA 3VB9A 2V5DA 3BPZA 4AHZA 1ZVFA 1AYN3 2MNGA 4MOAA 4DINB 3IBMA 4CEWC 1XSRA 2VULA 1YIFA 5JI7A 4UXAA 3UNPA 4GMP0 1XC6A 4K20A 2WR9A 2R043 5EP9A 5DAWA 1OLMA 3A7QA 3DYPA 2AH2A 4LKFA 1HB2A 5FMCA 1K42A 3O7OA 3Q8EA 4NIIA 3VD3A 3BTZA 3DCQA 2WWJA 3I2IA 4HMZA 4EN9B 2RDNA 2IVJA 4HN0A 5FZ6A 4CDQC 4CDWA 5BYNA 1AYM1 3SCFA 1TNFA 1H9WA 2UWBA 1COV2 2NMNA 2Y0IA 3ECQA 4Q0SA 5GJ6A 1S2EA 1ND3C 1OMIA 2AC1A 5JCTA 4AVAA 4Y3OA 4X6RB 5DDJ1 1XOYA 1CGPA 3WD5A 4FAHA 2DFBA 1NZIA 2P17A 4JQTA 1AL0G 4LIVA 2Y6LA 4RD7A 5C4WA 3AVRA 2NZ9A 4XIKA 4Y20B 1XYOA 5CFDB 4META 1AR62 1N1YA 3C8XA 1BZWA 1RUF3 4XCAA 4FPJA 2XJQA 3ILNA 1MPXA 3WQ7A 4BK5A 2W92A 4XUNA 2VW1A 1WCSA 2PMWB 3CMGA 5K7PA 1IZ3A 4JRAA 4JKLA 2LS6A 2VC9A 1WWYA 4WM8C 3OPTA 5FZAA 1MZFA 5FYVA 4EN8B 1OA3A 4EWEA 1UF2C 3WDVA 1S0JA 2CSGA 4ES8A 1XYPA 1J3PA 2X10A 4RS5A 4Q1PA 4I01A 1W6PB 3EBRA 1C8M1 5FZGA 3MLJA 3U1XA 1AZDA 3GCXA 5F9TA 1QQP1 5L36A 3KF3A 5ABJB 1HB3A 2ERFA 3CEWA 5IK8A 2P6HA 1Z7S2 4FBFA 5BNQA 3O1OA 1O3TA 3WDYA 3ZFGB 3P3NA 1TG7A 4BXFA 2O1QA 1X8EA 2OZJA 4AWDA 1NCQB 2JD4A 4LO5B 1LHUA 1UYPA 3T08A 1MS8A 4ZS2A 2A6YA 2CWSA 3ZYHA 2A73B 3MI8A 3M4FA 4ZXKA 5EV7A 1OQEA 1ZA4A 4AOCA 4Y1YA 5LEKA 1UKRA 1ZM1A 1AX0A 5A3PA 2C24A 5DZGA 4XF4A 1PZ9A 4YZ4A 4Q4X3 1GZCA 1MZ6A 3HQUA 3VDDA 4ONUA 4CRQA 4D6RA 1JOJA 3DV8A 1DG6A 4PLOA 4K3UA 4Q4V3 5FYHA 4OQ8A 1EP0A 1VBA1 1SEFA 3B00A 1K5MA 3JBG2 3GZEA 3FLTA 3S0MA 1PGL2 2W1WA 4JTNA 1SFPA 1RMU3 1XRUA 2FMDA 2EIDA 2RV9A 5A7QA 2GSYA 4W6YA 5JXHA 2D6NA 4AVVA 2XL9A 1DFQA 1OOPA 1O5LA 1R091 4MADA 3VHNA 2YYOA 4ZU7A 3HT1A 5HCAA 1GQHA 1X33A 1OSGA 1VBE3 1MEC1 3BOWA 3E5UA 4BU2A 1CZVA 1V6IA 4M4PA 5FP7A 3VKNA 4XXPA 3AX4A 1XSQA 4FT8A 2HKXA 1O3RA 5FY9A 4TLGA 1TME1 5FZIA 3MEPA 2NQYA 4C1WA 3I2FA 1JI6A 4KG8A 2QQIA 1ZYBA 3OUJA 4BIOA 1SFYA 4GH4A 4UYBA 5TSWA 4AF9A 4QPGC 1OPMA 1W2OA 5L7OC 2C5DA 4A6SA 3U78A 3WX5A 2YU2A 5IVVA 4PQ9A 4YW4A 2OQ6A 3MDPA 4M3CE 3AKPA 3POFA 2ZMNA 4M3CB 1Q8OA 2W52A 3VN4A 5FO9B 4FOVA 3TRSB 5CG9A 1NLQA 4HETA 4JQRA 1QJY3 1WLTA 4YSFA 5A3WA 3ZKUA 4QDSA 4V2VA 3D3AA 3MBWA 3FUQA 3MGUA 5CB7A 2DBIA 3H3UA 3N9NA 2DU0A 2H6BA 2F4LA 5L19A 3NJYA 4MVTA 5K4LA 5IAXA 2YU1A 4ZONA 1ENXA 1BQPA 3HEIA 4AI9A 3AYEA 4IEOA 3NV4A 3WG4A 5BV6A 3IM0A 4OZOA 1PO23 1W05A 3KGZA 4LOSA 5FPXA 4Z2WA 3IN9A 5BNNB 2EIEA 2VXJA 5KC5A 3I2JA 4PDWA 3AXDA 4XF9A 2ADEA 4UF0B 2VQAA 3S5QA 2ZAHA 1REDA 3EB7A 4ORFA 3M3CA 3QH7A 5CFCC 3HAGA 3N7JA 3ZPOA 1OBNA 1V6OA 2PHFA 3W5MA 4LUMA 4XBNA 1PNFA 2WO1A 1XE8A 4CEWA 3LEGA 1OF3A 2OUHA 2A7AA 2EICA 1POV3 1H30A 1GBGA 2FZ1A 4LNVA 1PK6C 3U10A 5JPMB 1A8DA 1RL3A 3D0SA 3BN6A 3JXSA 1R1A1 1IHMA 2HYXA 1R081 1KJLA 3KT4A 3Q8AA 4MGYE 5T5PA 5IVFA 3VDCA 3E6DA 3WUDA 4CDQA 1UOJA 4LBMA 4CDXA 4Q4Y2 3B5LB 5B2GB 3MIDA 2ZEXA 3RGBA 2KR2A 3KQ4B 2X53S 1ND3A 1P8JA 4AK3A 3JB8A 1ND2B 4C1XA 3M3OA 3O5SA 1AX2A 2R7EB 2V4AA 4HSLA 4FPGA 4PQQA 4HKLA 4IGQA 5GZFA 2OKXA 2A3YA 3GCWA 3VZOA 2VM9A 4MV2A 5IVEA 4HG6B 1QJZA 4LBLA 1OA2A 4JGYC 2OYZA 2CDOA 5ACA3 5LWBA 3RZHA 1QGLA 1XNKA 1QWRA 4M0NA 4CU9A 3T0DA 3LDKA 2QQNA 4WM7C 4JAAA 4IEUA 2W1QA 2E9QA 3CLPA 3NSTA 4V2WA 3BTYA 2VMFA 4CVUA 3DF0A 4WM8A 2B39A 2E7QA 3OG2A 1AR81 1NG0A 4AVSA 3EMRA 1DCSA 3HN1A 3VKLA 1BKZA 3R4DB 4IQPA 5A7SA 4LUKA 3ZN5A 2QVSB 1AR72 1KGYA 2WQZC 3ACHA 3TBDA 3H8OA 3GGLA 2VOXA 4A7ZA 3HWJA 5CFDC 3E6BA 4DOUA 5C33A 1VBB3 1A6CA 2D6KA 2Y6FA 3O1SA 1JYCA 3E5XA 4AQ6A 4A7KA 1QY4A 2W68A 1K45A 4Q26A 5GKAC 1VMJA 2R062 5A33A 1KITA 4QPIC 4NR1A 3D8CA 2LUWA 2XGXA 1QJU2 5I8TA 5KXEA 2FDKA 1GQGA 3OBRA 2XHNA 1D4M2 3NMBA 4AQ2A 4I09A 2P3YA 2CTVA 3MIGA 1AL22 1JN2P 4Q0QA 4LPLA 4XHBA 2O8OA 1H8TB 2CL2A 4YGBA 1XU1A 1OD3A 3ZFGC 2A6VA 2P2KA 5CEHA 2VOTA 4WZCA 5JLVA 4YG0A 2ZGSA 4L97A 2G9FA 1BCXA 1NX9A 5IVYA 4Q1RA 5APAA 5J36A 4OVEA 4KWLA 4R52A 1W99A 3I3QA 1LOFC 2ZHKA 4CEYA 1I5ZA 4AAXA 3FN9A 2ZMLA 4H3WA 2IFWA 3RSJA 3ZIWA 3IDEA 4PI2A 1YIPA 1UCXA 3AYAA 2HWD3 1UZVA 2QDNA 1VAKA 4XZPA 2WFF3 2W1UA 3V0BB 1Q8VA 4COWA 1AYN1 1S0FA 2VMDA 1AYM2 4BOWA 3AK0A 5F39A 1VIWB 4NO4A 1PM4A 4J6GA 3ZSKA 2YC0A 2QQVA 5FYIA 4Q2FA 4P5HA 4HVOA 2R073 2JE9A 3FFQA 4AI2A 5L7OA 4QPGA 1CD3G 5A3LA 4OHXA 4QDQA 2XH6A 5LB6A 3O1UA 3OGJA 1UZZA 4TN7A 3K4ZA 2RS13 1B35C 1OT5A 4C0HA 3LA3A 5FWEA 4OFGA 3AVSA 5FXXA 1OI6A 3H1YA 2Y6GA 3J26N 3NW4A 4HLTA 3RS6A 1M06G 2ORXA 3GXUA 4ZU4A 1BK1A 2OA2A 4D6SA 3K2OA 4N7IA 3ZFEB 2Q8DA 3RQ0A 5HXMA 1W28A 3JU9A 5FXZA 4LBKA 2BERA 3LD8A 1SLAA 3RWKX 2OVUA 5FZCA 3IDBB 3VV1A 5HI0A 4IDZA 2WAOA 1UU6A 1QU0A 5FMDA 1DIWA 5FDBA 2D6OX 2DYCA 3ZYBA 1C8M2 1RUF1 5SV8A 1UX7A 1RUE1 1QQP2 1NQDA 3R4UA 4XQDA 3KZ4C 2VUDA 3AZWA 3MF6A 4JTOA 1CAUB 3VD9A 2WQ4A 3QH6A 2D6PA 4KG0A 4RR3C 2IZWA 3UL2A 2BQPA 1DBNA 2GP3A 2GNDA 2R49A 3AP7A 2JX9A 4TXWA 4URAA 4LKDA 4AHYA 3QBQA 3DN7A 2H0BA 2Q0AA 2ARCA 2KA3A 3J7MA 4P9LA 3ZXJA 5C9AB 1PVC3 1SMVA 5CFCA 4NHXA 4URTA 3M8LA 4Y22A 3WINE 3W5NA 4FFHA 2C26A 4AVCA 2R0HA 1GOFA 5IVCA 3I59B 4HPKA 1S1AA 2WZR3 1MVQA 1F8VA 1PK6A 2DCJA 5BNNC 5FAXA 5FMBA 1PVXA 3BYWA 5FXVA 5CISA 2OUJA 3T0AA 1VBA2 1OKQA 1UZYA 3WY6A 2GP5A 4FP2A 1NLSA 4QXCA 5DXDA 4BZ4A 2J1VA 5FKCA 1R092 2AUYA 3I2HA 4JDOA 4Q4X1 4LTAA 2YROA 1MEC2 4PIYA 5FYBA 3H0OA 3ITQA 3C7FA 3ZKYA 2ZHLA 5IWFA 2KM2A 2BW8A 4FPYA 4R9AA 1RYYA 2FQPA 1Y3TA 2P34A 3DEMA 1TME2 3WUCA 4P14A 5FZMA 3ZXLA 3VBOB 2P5BA 3PVOA 2J22A 1UOFA 3FLPA 4GWMA 4XFFA 4XAEA 3OTFA 5L73A 1EAH1 5FYTA 3V56A 5GZCA 5IFPA 2HWF3 2IUWA 2XKOA 5CG8A 4BYYA 3MF9A 1IS5A 2VUCA 4CUCA 4XC9A 4AL9A 1RJ8A 4Y20A 3VD4A 2JD9A 5CFDA 1W9WA 3GALA 3KV9A 3NNLA 4QX7A 2E63A 1T2XA 4UAPA 3RWNA 2PLV3 1UYXA 1WCQA 2UYBA 2FDIA 2ZA9A 1CJDA 3QCWA 5DABA 3B9IA 5LRSA 2FDFA 2ZKLA 1W8NA 2WS93 1Y9QA 3POIA 3SC7X 1O3SA 2EIBA 4EZ4A 3W9AA 3N36A 2BU9A 3LE0A 4MGZE 5GLZA 4RQPC 2DCZA 4UW3A 1X9TA 5I0RA 2Y38A 1QJY1 4LO7A 3GDBA 4FP3A 3SLIA 4DS0A 3V0AB 5GZGA 2WNVB 4TYSA 3TEYA 2C9AA 3RDIA 5ABJA 1AXZA 3ON7A 3PVEA 2YV8A 4HZFA 4KMQA 1Y4WA 2GDFA 3ZFGA 4CCCA 1NCQA 1JYTA 1SFNA 4FQ4A 1PO21 1UQXA 5A3TA 1BEV2 1UY1A 1QXRA 1W8TA 3W21A 1LOFA 2FHRA 4LK6A 3X29B 5C5TA 4LITA 1ZBA3 2IXCA 2W39A 4MGQA 4QGLA 1KRIA 1R082 3HBKA 4KWKA 4OMCA 2Y26A 1AJKA 3D4KA 1IG0A 1H8TC 5BNPB 5JXIA 5LCWL 1AHSA 5FYCA 4OI2A 3NO8A 5A80A 3KB5A 4FPHA 1W9YA 2X05A 5LA0A 1DGWX 1HRV3 1M4WA 2ID4A 3LDRA 1POV1 1CZSA 1QXPA 2RS53 5BNOC 3A4UA 3LFMA 1CWPA 1LGNA 3I3BA 3K3OA 3KV4A 4QX0A 3H7JA 3OUHA 3WZ1A 1CR7A 5A6XA 2SBAA 5HCHA 4K21A 5DQ0A 4GMP3 2N7GA 1B35A 5KHKA 4Y4YA 3OYWA 4W65A 5B4NA 2ETEA 3B94A 1NXD1 3GM8A 1SDWA 1OPOA 3T09A 3VZLA 4AXOA 4IE7A 3MICA 2WINB 1HB4A 4K9SA 4Y5Z0 1AR82 2XJVA 3D5OA 1W04A 3PUAA 5DG1A 2BBAA 3ZMNA 5SV5A 4XAAA 4XJ8A 4MGTA 2CGNA 1U5IA 5ACA1 4KU7A 1UYZA 5A32B 2CNAA 3RZGA 1L7RA 4GD4A 4RL7A 1ULEA 4YW2A 3VBHB 2WT2A 2WUHA 3PUHA 1NYWA 1ULPA 4LHNA 4AEDB 4N53B 3OD0A 2F6BA 2GNBA 4RR3A 2WNUB 1R1ZA 3KSCA 4A7YA 3ZO0B 4F3JA 1NLRA 2RE9A 2XL7A 4B29A 3JD71 1URXA 2DVGA 4YVWB 1TE1B 3WG2A 3WF0A 2RM21 1LRHA 2D6LX 5DUWA 2Z42A 4LHKA 5J7MA 5IK7A 1T6BX 1Z78A 4IE0A 2Z4FA 1TMF1 1VBB1 1DZTA 1VBC3 4W6XA 3UGGA 2D3PA 4YZ3A 2OQ7A 4XACA 3GYDA 4TTGA 1ZNPA 4NIAA 5BNNA 1C8NA 2WFPA 1WLWA 3ZLIA 2J1UA 2VOKA 4N9IA 4UF0A 4FTEA 2CAUA 2VZQA 2OS2A 2PHUA 3WF3A 4HVRA 2A3XA 4KWUA 5J98B 4CP9B 4H2AA 4N7UA 5LZ6A 5C5UA 4DY5A 2ZHMA 5FJKA 4EWDA 5AFBA 2DCTA 1H2LA 2WN3A 1WGPA 3LQCA 4I02A 1RUC3 1DYOA 1RUI1 3N35A 1WKYA 5IVJA 3WNLA 4E2QA 1VAVA 5JZGB 3Q9OA 1GU3A 1LOBA 4B7KA 1SLTA 4JHZA 4MLOA 1AYN2 1LKNA 5FQ0A 1H9PA 5IT6A 1BMV2 2ZX4A 3POBA 3WW3A 2YHJA 1VRH1 4LO4B 1WZXA 1JXNA 1UZWA 2VMCA 4CSWA 3FBMA 4XTPA 2BWCA 1O59A 1WLDA 2Q8CA 1DQ6A 4IUGA 4QGNA 1CAXB 1J3QA 2HWD1 3KM5A 2MEV1 5FZLA 2XJUA 1ND2A 1WUVA 3PIGA 2XG3A 4GWIA 4YM0A 2F17A 5JR7B 5FZKA 3RPQA 3N9OA 2HLEA 1XXNA 2JIGA 1C57A 3ELNA 4XABA 5F8PA 3IDAA 1V6NA 4FOYA 3VDDC 2R071 3A0KA 4BQYA 5A7WA 4FPOB 3SXWA 2TEPA 3U37A 5FXWA 4CPBD 1CONA 2QFEA 3IB3A 4FOQA 4GALA 1V70A 3MW2A 1G6NA 3FHQA 4LQRA 1K5MC 1LOGA 2BGCA 4M01A 2D98A 3GBFA 5FK8A 1PO11 3D6EA 2R32A 1JU4A 1RUE2 4EV0A 2HBTA 3LKJA 3SEEA 1ENSA 3G6JB 4RQPA 3TN93 2E31A 1DZRA 4IESA 1H4HA 5C6CA 3PTRB 5HPOA 5FZ0A 2LROA 3A23A 2Y6HA 3T30A 1F15A 4FAGA 4QXHA 1LU1A 1BVVA 1QOOA 5EIYB 4JV4A 1X9PA 4R4ZA 5K0UC 3G7DA 4FO9A 3WEZA 1ST8A 3AC0A 1Y43B 1IOAA 4Z07A 4BLJA 5JSOA 2YBKA 4GH4C 3S30A 1LEDA 4UOJA 1DQ1A 1DQ4A 1LODA 5KHJA 2DTWA 4UI9L 4XURA 4CZSA 4AR2A 1VBD3 4XDQA 3T0BA 5C3RA 2WNVC 1FPN2 1PNGA 4QHZA 1W0OA 1QEXA 2ZS6B 4LHLA 1H8TA 1PVC1 2XVGA 2JIJA 4E8DA 5KHGA 3VLBB 4JRLA 5GM0A 1HW5A 4GAZA 3PTYA 4IEYA 5L9BA 2YUEA 3NV1A 3VDAA 4YM2A 5AC93 2B45X 4BA6A 3BGAA 4Q4X2 3RMYA 3SISA 4DEVA 5BNOA 4MXVA 3HVDA 4LO6B 2QZ2A 2QQUA 4S2HA 5JVVA 4BH9A 4DQAA 4A4AA 2RR13 2WC2A 4YM1A 2ZKNA 5L9RA 4ASKA 5DPNA 4BM8A 3E5QA 3N7LA 3OD4A 4GJYA 2Y8KA 4QXKA 4UBGA 1RUH3 4PDWC 1MR5A 4W6WA 4XF0A 4N43B 4YVSC 5EYYA 5KHHA 3V0BA 1JZ2A 5I8YA 2DWRA 4FFIA 2AR6A 1EAH2 1ULOA 3LOBA 1E5IA 3WSOA 3E1F1 2A6XA 2YG0A 1RHI3 1RVF3 5FY7A 5F7UA 4LBNA 2RHPA 3FL7A 1S2KA 4ATFA 4DFSA 5IYYA 3IDCB 2YBSA 4I3GA 4CP9A 4EN7B 4YW7A 1REEA 5IJRA 3C7EA 2D97A 1E5SA 5DAPA 5C71A 5A3UA 4M3CF 3HQXA 3OSDA 2HWF1 2HJIA 3ACIA 4QGMA 2JB4A 5FK7A 5GLTA 5IK5A 2D5FA 2A70A 5FZ3A 5J09A 4CDXC 1FAYA 2YFZA 2RJ2A 4RN5A 4XJUA 2WT0A 1GV9A 1QJY2 1PZ7A 2ZPXA 4XJZA 1G86A 4A45A 1JBCA 2VTFA 1KS5A 5D21A 2PLV1 4JGZB 2YDEA 5I0DA 2ZAAA 3B02A 3FC0A 1J84A 2WLPA 2E51A 5D8AB 1CAUA 1W0PA 3UGHA 2VZ3A 3PU8A 4PCRA 3VKOA 4N53C 2WQ8A 2C9KA 4AEDC 1W2AX 1YXWA 1YI9A 2VXRA 1XNDA 2WNUC 2WS91 4NAMA 3ZDSA 3R0RA 4QT6A 1S55A 5GLWA 3TEWA 4MHRA 2QTWB 3RI9A 2JDKA 3WQ0A 1ASJ2 3LCPA 3ZVXA 4H7MA 2WSUA 1UMZA 2GALA 2HWC2 5FZ1A 1UWWA 3OUIA 1PGSA 5HV4A 3BI3A 2Q5TA 1PMIA 4IEPA 3LEMA 2ZCWA 2WT1A 2VMIA 2NM1A 4OYUA 2JDHA 3IT8A 1NAEA 1MZEA 1WW4A 1ZREA 3GNEA 1W6NB 1UL9A 2GZWA 3NAPB 3U0ZA 4Q29A 5LA1A 3POJA 4BXSV 1J83A 2DTYA 1QMJA 2I45A 2XHKA 3UETA 5FO7B 1JUHA 4FFFA 4IEZA 4JKKA 4A3ZA 4HK8A 5FIXA 2CGOA 1JZ7A 4GXLA 5JZGC 2CGPA 2ZX2A 1HRV1 3LSDA 2BNMA 2BNNA 3J7NA 3WHTA 4EZHA 3E6CC 4O61A 2PXJA 2MPFA 3W59A 3LA7A 2OZ6A 4HKWA 5GZEA 4PIXA 2D5HA 2A71A 4S2FA 5FY5A 1UU4A 2J1SA 3S7IA 4NN0A 3M70A 3OY8B 3ABZA 3T2QA 3ATGA 1OFNA 5FPLA 1UOGA 3HD8B 1QOTA 2QNKA 3VL9A 1ZRCA 5ACA2 1DQ0A 3GHNA 3S5AA 5J96B 4RHV3 1W3VA 4ZXEA 1OHFA 2ZBJA 4BJ0A 4CEYC 4UWDA 2FDHA 1JU3A 1UYYA 2ET1A 3NL1A 5DUUA 3KCXA 1W9FA 1ZZCA 4YG3A 3LFIA 4LXLA 4PT6A 4CXYA 4IV3C 1LULA 5FYYA 2TBVA 4AGVA 3U11A 3TYJA 5HBAA 2B5HA 3JD72 4DEQA 1WMXA 2NLRA 2RM22 3SCGA 5K0UA 4DO0A 3WNNA 1PIV1 4CCJA 4YGEA 3AZXA 1DGRA 2ZGTA 3M1HA 1W06A 1N3OA 4M00A 1YUDA 4Y1ZA 4XOGA 1TMF2 1VBB2 4D7YA 1K5JA 3PJYA 1MS4A 2JEMA 4V1PA 4CPBA 5CIRA 3ZN6B 2QDRA 4IEQA 3LPFA 4P00B 1V6LA 4C0BA 4YW1A 3V0AA 3WT3A 2WNVA 4L2NA 4ATEA 5DUVA 3PUSA 4XF3A 4O65A 1REFA 5I8SA 3BALA 4Z2AA 5LW9A 3U4XA 1LOAA 4NIDA 1S0EA 2BP6A 3POSA 2IXKA 3B69A 4D7TA 2QKDA 1I9RA 3D82A 5A6ZA 3BUCA 1V6JA 5EJ3A 4BQ2A 5CAZA 3OOXA 4IE4A 2VMEA 2FMYA 3I2OA 5FYUA 3ZFFC 1RUI2 1ONAA 2EA7A 5LY2A 2VD7A 1O6UA 1N3PA 3H50A 4GB31 4YFZA 3WQ1A 1JYNA 1J58A 1W90A 5FZEA 4YYOA 3MW3A 3SH5A 1D2SA 2GMEA 4BDVB 2FCTA 3EXUA 4PLMA 1QHDA 2ZEWA 2RJKA 1VRH2 4ARYA 2FCUA 5C8WA 2AZ5A 4HANA 4AFDA 4YVSA 1COV3 1V6KA 3F95A 2IFRA 3JCIA 1Q8SA 3BIEA 4XHXA 1D0HA 5EQUA 5FY0A 2HWD2 4AFMA 2MEV2 4OQ9A 2NMOA 1E5HA 1W8FA 3EQEA 4H55A 4WV8A 5F6KA 3NQHA 4B1MA 1CIWA 1RUG2 1W2NA 3LZZA 4GKYA 1U5YA 2VZ1A 1CX4A 1MZ5A 1XE0A 1RXGA 1US2A 2JDPA 4IERA 1ZX5A 4QXBA 1NXMA 1W8WA 4DY3A 2FCVA 3DPRC 4IV1B 2P37A 5KBFA 1UY4A 5E89A 4LK7A 2QBXA 2XQXA 4LHSA 1PO12 2PHLA 1H1AA 3GJBA 4QX2A 5JOWA 5FYSA 3H42B 2RJLA 1JODA 4LBOA 4BISA 4I2OA 3I7DA 4BB3A 2HWB2 3O14A 3OJBA 1SLIA 1CIYA 2XJPA 2YGMA 4QDRA 2OW4A 3L2YA 3ZYGA 2VOVA 1ULFA 2NP0A 4KGGA 4AEDA 4K7JA 4N53A 1A3KA 1AR93 1W2UA 4J25A 3AL6A 1W03A 1ULDA 2WNUA 3H1MA 1U5ZA 2ZABA 4CP0A 2E53A 3LWCA 5JXGA 3M2MA 3PDQA 1W6OA 4YVWA 4S2GA 1RB8G 2WRAA 3F2ZA 1OD5A 2Z79A 5JMCA 3I4IA 2PAEA 5DZFA 4EJRA 3UKTA 1QJX1 4AVBA 4C90A 1MVEA 3WVJA 4HOOA 2RDRA 5FUIA 1CESA 4BQ5A 2QCSB 2DVBA 2W3JA 4JC1A 5D8AC 1RUD1 5A1FA 3B7MA 1V9U3 1ZRFA 2Y64A 3JBG3 4YWAA 3ROUA 2WWUA 1IG3A 4OHVA 1UMIA 4A41A 4ASMB 2VAUA 2L9LA 5BUVA 2W2IA 3N9LA 1N1TA 3POYA 3KCCA 3RRDA 1ULGA 4XIOA 3RYRA 1B09A 1OA4A 2P3KA 4B4PA 1Q56A 3IIAA 5FMOL 5FZ7A 5JZGA 5A7OA 2VCBA 4M0HA 3TWIA 3S57A 4BQXA 5ABJC 2WL1A 1S4CA 5IUQA 1RC6A 1OQ1A 5FKBA 3VBFB 1V0AA 4XILA 4D8MA 1H2MA 2JDYA 3BOPA 3NNFA 4NRQA 1NCQC 4CP1A 1UD1A 4W50A 3B93A 1RUOA 4COZA 1HQLA 4ARXA 4DB5A 4E9KA 1O3QA 1LEMA 2ZEZA 1CAXA 1KEXA 2RG4A 1MS0A 3I2GA 3IPVB 5ANNA 3AJZA 3AP9A 4YW3A 4Y5SA 5A3OA 4U2AA 2BVVA 2XBO1 1F5FA 4LJHA 3OGRA 2VL4A 2HWF2 1WBLA 3ZXEA 1BJQA 5FZ8A 5IHRA 1W0NA 1RXFA 2WZEA 4IV3A 1GQPA 4JHTA 4PBPA 1RITA 4XE9A 2DUOA 5C3OA 4KL1A 3MW4A 5EWSA 3CIHA 3I97A 4PBOA 5T50A 3S7EA 1LB2A 3A0NA 2W94A 4UW6A 1SZBA 4RGGA 1HQNA 2PAMA 4XF1A 2P1BA 2D3SA 2R041 1FV2A 2ZGLA 4I30A 4OI1A 1N1VA 5DDJ2 5LK5A 2AEZA 1H1MA 2PLV2 4A6OA 1IPJA 1CJPA 5F1RA 1G9BA 2J42A 2YXSA 1HRI3 2WLQA 3ZX7A 5FV3A 1G9CA 2EVXA 5I0SA 2HEWF 2WS92 3I8TA 5G05L 5C7GA 1LNSA 3MLLA 4IE6A 4BQ3A 2VZUA 1N3QA 4WZFA 2J7MA 3GF6A 1RJ7A 5IVBA 2HYKA 3DXTA 4DRVA 2H6CA 3K4DA 1QJEA 1GWLA 2VGDA 3IWZA 3KV6A 3WNOA 4UFJA 2R6QA 4XVHA 3VBRB 4Q4W3 3VDBA 1WD3A 3ZFFA 2RS33 5LBFA 4CCEA 1FOD3 4ZKTB 4IETA 2WKKA 4CP2A 3BKZA 1LHVA 5F5QA 2BOIA 3EJKA 3OGVA 3MFAA 5T5JA 4KBZA 2LALA 1JZ8A 4QX5A 1NA1B 3USUB 2WA4A 3JB4C 4I3PA 4CDWB 3H8UA 4OHWA 4WVZA 3WNPA 2V4VA 1E57A 1LHOA 3GZUC 1HRV2 4QU1A 2VCAA 4LLOA 3KS7A 1OQDA 4MZUA 3URFA 4COVA 1VMFA 1WW6A 5JWPA 4LBQB 4Z92B 1W39A 5C4WB 1N47A 2ES3A 2VCCA 2E7TA 1H4GA 4K40A 1AVBA 3DPRA 3SMHA 2CYFA 2YZ4A 4GJZA 3OPZA 4L8QA 2WZ8A 2DBNA 4R9CA 3WF1A 3PUQA 2EXKA 3VBUB 3FHAA 5FCCA 3AZVA 1GANA 1WMEA 4P9JA 2XLAA 2G19A 5CKQA 3H7YA 5CVRA 3LIHA 4RS5B 4AFBA 4X8NA 5LBCA 4Q4V1 4RFT0 1SCRA 5FTTC 3FBYA 3QLQA 4ZS3A 3N9MA 4P9IA 3ST7A 4DXRA 1RMU1 1DHKB 2I74A 1PIV2 3OPWA 2UY8A 2R063 2LW8A 4MG2A 1BYHA 1CQ9A 2AEYA 4Y5TA 1QJU3 3ASIA 1J3RA 1EUUA 2QQKA 4XJWA 1VBE1 2ZGQA 2EXJA 3HBZA 1D4M3 1YWKA 5GZDA 3S6PA 1IPKA 5H9SA 2GC2A 4YG6A 5T5OA 3ZSEA 1ND2C 5EYXA 4NHYA 1ZZ9A 1JOBA 4QD2A 4WVVA 5D8AA 4B4RA 1TQ5A 2B8MA 2X29A 3RJRA 4INDA 4FPEA 3ZYRA 2ZZJA 1CZTA 3TEXA 4CUGA 3MIHA 1RINA 2E7AA 3TB0A 2PN5A 1A34A 3P5BA 1SLCA 3BTAA 5LATA 4BE3A 1IQAA 3NWKA 1GWMA 3NNGA 2VE1A 2XLGA 5A3MA 3MUY1 4FXKB 4GB32 1TVGA 4HVQA 1LHNA 1OH4A 4AI1A 3AKTA 2WABA 3IKWA 1V00A 3MIFA 3MO4A 4LIUA 2QZ3A 1ALYA 3FMGA 4XUQA 4JVAA 4DMIA 3O1PA 1W6PA 2BOJA 1W6MB 1OOPB 2YPJA 3AXEA 1AYM3 1CAWB 5C8CB 1ZA7A 3MFCA 5FBJA 1CAVB 2G9ZA 1ZBE3 3M3QA 2D6MA 1UKGA 4WVMB 1W6NA 1GNZA 2BTVC 3VZKA 3NAPA 1LESA 1W6QB 2XVKA 2DVFA 2O14A 4EN6B 5E6HA 2A6WA 1F31A 5FO8B 2ZX1A 2WNOA 3C7HA 3VZMA 4S2DA 2BWAA 4UFHA 3NJXA 1VB4A 3ZM8A 1D2QA 1COV1 4O9GA 2NPIA 1F4AA 4NWVA 5DZEA 4CA9A 1R1A2 2YBPA 3CZUA 1XNAA 4L99A 4B1LA 2WO2A 3VHPA 4LO8A 3DYOA 2C4XA 2XWJB 1WCUA 5C3SA 5J37A 1WD4A 4QKNA 2G1MA 4AI8A 4P08A 4BIFA 1DLCA 5JSRA 2VQTA 1DGWA 2DVDA 2IXHA 2K9ZA 5T55A 2VZSA 5LBBA 3VUOA 1FNYA 2P4EA 4IL7A 4FI9A 4KWJA 3EO6A 1IPSA 1W8OA 4P9YA 3I3EA 1XE7A 3J8F3 3ACGA 4ZZ8A 1JMUB 1XQNA 2B9UA 4IXLA 3WCRA 4E4DX 2OPWA 3CJIB 4QKDA 3GZAA 2JG8B 3ZPYA 1QJX2 2B46X 2BGPA 3HOBA 3HN3A 4I0WB 4MXWB 1IGOA 2J1EA 3J7LA 4LORA 3IMNA 4E2GA 1AR91 1FMD3 2IXIA 2VUAA 4BQWA 4JKMA 3ZN6A 1RUD2 2W1SA 2VZRA 2WYFA 1RUNA 3FJSA 4F7ZA 2GH2A 1H6YA 3OF1A 2ILMA 1KDMA 5FOBB 2W95A 4XFBA 4M3CA 3WV6A 5KHIA 1IS4A 3ZN4A 4BQ1A 3HR9A 3CQOA 3ETQA 3WG3A 3ZFEC 1GMMA 1UU5A 4ASLA 3EYPA 2ZACA 1FX5A 4YARA 3VBRC 1FXZA 3UKVA 1RGSA 3KD4A 4LBQD 4NROA 2PA7A 5FBZA 3SNMA 4YGDA 1V9U1 3WF4A 4DRRA 1UXZA 3THTA 1JTZX 2A75A 1PGL1 1AUYA 1W8HA 2XOMA 4XFIA 1FI2A 1YLLA 1NE4A 4OUEA 2VVFA 2P3IA 4CXXA 3DUIA 2YPDA 2K2SA 3KQRA 4RGAA 2WN2A 1YFXA 2JE7A 1QDCA 4I0BA 1NA1C 1U0AA 5KR7A 4QM8A 3O0VA 3NKTA 2WWSA 5C9AC 3ES4A 2P6CA 2ET7A 4WM8B 1O4ZA 3PJQA 4XPVA 2XBO2 2XJTA 4B4QA 1SQ4A 1PMJX 2WO7A 5FLHA 2CY6A 1FATA 1LCLA 1AXKA 1ZZ7A 4XTMA 1OF4A 3GBWA 2VY0A 1MACA 5F32A 5F2SA 5IW0A 4XMAA 4FPLA 3AZYA 3QACA 4PLNA 3PLQA 4PJYA 1IS3A 3GJAA 4IV1A 5I0TA 2VH9A 4IEXA 1WLCA 1QIQA 1HQWA 1ZRRA 5M0TA 2R042 2DCKA 3VBUC 4CDUB 4NVPA 1X82A 1ZRIA 2PQQA 2UYAA 3L2HA 4NHLA 4XETA 4A3XA 2XXZA 1UN1A 3DECA 4NPMA 2I07B 4KQ7A 4OUSA 2GU9A 1IS6A 2WFF1 3HNBM 4KU8A 2VPVA 2WSVA 4LT5A 3IAQA 1LTEA 2B4KA 4DIQA 2LRPA 3K48A 2ARAA 4NHKA 4CCKA 3PIJA 4LMFA 3T1LA 1EUTA 1VR3A 4NHMA 3VBOC 4L92A 5F2WA 5ISLA 1BEV3 1JZ4A 2XLFA 4DXSA 1HRI1 2RS11 1QF3A 3MIEA 4BMEA 2FD8A 5FFOC 5A1LA 3IZOA 1RUF2 1OUXA 3WG1A 4LLFA 3ZR6A 2R1BA 3B3QE 5J3UA 1YO8A 1I6XA 2UU8A 2VCMA 2JDZA 1SG3A 2W08A 3AYDA 3H1WA 4C8DA 3VKFC 3N4MA 2QQWA 4QQ2A 2D40A 5KC6A 2VQ0A 4Q4W1 4YLZA 1MS5A 4R8HA 1KFXL 2VUJA 2YY1A 1DYPA 2GN3A 3BB6A 3RJ2X 2RS31 5FMOS 4GWJA 1FOD1 1OC1A 1PGW1 2Q1FA 1GR3A 1UY3A 4ZPIA 3HNYM 3WQBA 3KCYA 4MSVA 4AFAA 4HK9A 2DFCA 5JAXA 2VMHA 2IXLA 1YQCA 3KHBA 4FPFA 1YC61 4QPGB 5FY4A 3VD7A 5FR3A 5JSPA 5C8CC 3U14A 5CBLA 3BODA 2E6VA 5GLVA 1XU2A 5T3NA 5FZ9A 1AR83 2GC3A 1W9TA 1JYXA 5K9YA 2V73A 1WBFA 3K77A 5F3GA 3VBFA 2A5ZA 1HV1A 1UXXX 1MQTB 2Y33A 3MHZA 5GLUA 4NWWA 3ZXFA 4NRPA 4DNYA 1F4HA 4R4XA 4Y1XA 2WZR1 1KXGA 3PU3A 2X09A 5GALA 2VOWA 5FY1A 4IW3A 3HJRA 3DGTA 4Q4V2 4W8JA 3CU7A 2GH8A 2GMMA 3AJYA 2Y0OA 2VR4A 1GP6A 5JMOA 4XW3A 4JCKA 3C2UA 4KI5M 4C91A 1HX6A 1RMU2 1EYBA 5BNPC 4JX0A 3USSA 1S0BA 1C5IA 3BPSA 1VBE2 3I54A 1HB1A 3V65A 1F5JA 3VZNA 4QU2A 5I91A 2AREA 1XB9A 3RZLA 2VG9A 3PMSA 1RTVA 2IVIB 2EF6A 2GAUA 2WO3A 5FPUA 1OXCA 1YYNA 1GNHA 1JS9A 4QWNA 4XXAA 3DKQA 4NE9A 5CFCB 3FZ3A 1XBFA 2VTXA 3AP4A 4OI4A 4Y1UA 5LBEA 3WP6A 2WIIB 5CADA 1SPPB 1H1IA 3O1RA 2FDGA 1WMFA 5AFEA 2RMU3 1J1LA 2VZVA 1NCRB 3ZSLA 3ZFEA 3ZXKA 4TZDA 1DDLA 1HIXA 3CJIC 3K51A 4MUVA 3TNPB 1W8UA 1Q8QA 2JG8C 3VBRA 2QQOA 2IC1A 4FVVA 2A1XA 5CZKA 5T5LA 3VZJA 2BV4A 3LPGA 1KS4A 1QH7A 3P3PA 3FLRA 1OFSA 3KLSA 3FX3A 5HXVA 5FJHA 4GIQA 2PHXA 3PVBB 3OEBA 1RUJ3 1Z0HA 2DU1A 5CYYA 3THPA 2WDBA 3ZXGA 2ZJCA 3VBHC 1LGCA 3CKHA 1PZ8A 3J7HA 5FUPA 2ZGKA 5EXOA 1GSLA 1ZZBA 1NA1A 1YQ8A 2JKBA 3O12A 4JGYB 5FYMA 4X8PA 3USUA 4BCUA 4DUWA 1PO22 5A6YA 4YVWC 1UIKA 3J9SA 2DDUA 4WBBA 4WM7B 4QB1A 5C9AA 1C1LA 2TNFA 2JJ6A 5CNAA 3MV11 4RGKA 2FZ2A 3D0JA 4XFGA 3HNMA 2AENA 1ZBE1 1BLZA 2XUMA 3OB8A 4CCLA 4LE3A 4W4ZA 3WDWA 4XMIA 2W0XA 4O7XA 4RSUA 5ANQA 3I59A 4Q8KA 3AM2A 2ZGNA 4XUOA 1JHNA 1O7FA 4LBQA 5HCFA 5KWRA 1F9KA 1F2NA 4NJ4A 2UY9A 4Q5OA 2HWE3 3GBGA 5DN2A 3R4SA 1CX1A 3M3IA 4AHWA 2UWCA 3WW2A 1WW7A 1RUE3 4UW4A 3VBUA 1ZBA1 4Q27A 4CUBA 3OGGA 1YHFA 4UW5A 5E88A 1H6XA 4XFCA 2EIGA 1UPSA 1UO9A 4CE8A 4QX3A 3W58A 1JYWA 4QPIB 4KH9A 3B9CA 4XDPA 1DZQA 4QX8A 4COYA 1APNA 1GZTA 3SITA 2CDPA 3AMPA 1GOGA 3AYCA 4ES9A 4Y1VA 5JDBA 3ZYFA 2JE8A 2VZOA 1G7YA 5FWJA 2RS51 2OXBA 1DLLA 4D69A 4LE4A 3VBOA 3SEPA 5JR2A 4NPLA 1HKDA 3LAGA 4AW7A 4GMP1 1A78A 4CDUC 1BBT3 2O8QA 5IFTA 4CYDA 4CXWA 2W5FA 1AR92 2XWBB 4U36A 3RZZA 3T2TA 1L7QA 4OCTA 3BU0A 3J8F1 2ZX0A 4MYEA 5IAVA 1D7PM 1FPN3 1U5XA 2PELA 4E4ZA 1CPMA 4PHZA 1SHWB 2IXJA 2VMGA 2W87A 1C5HA 2YFUA 1GP5A 2C6SA 3KT1A 3POEA 2QUOA 5DMYA 1EV13 4ITCA 5FZBA 2E32A 1Y9MA 2VBBA 3T3YA 1FMD1 4MX3A 1AJOA 3OGSA 1JYIA 5FRAA 1V9U2 4MGIE 1HN1A 3WP3A 5A1AA 1CPNA 5BPXA 4OI0A 1O8PA 4HXCA 3BIWE 3LA2A 4YW5A 4AQSA 1W6MA 5F3CA 4NOTA 4DXZA 2TUNA 4HFSA 1CAWA 2E33A 5C8CA 1B35B 4AZZA 3OYWB 1EAH3 1OKOA 1WA6X 1CAVA 2A3WA 4Y33A 3POWA 1NOVA 4A44A 3ACFA 3I3DA 4MH0E 1HXS3 2WA3A 4WVMA 2PHDA 4PI0A 1OUSA 1DU3D 1UIJA 4P02B 4YZ5A 1W6QA 1DF0A 2LM3A 1KDKA 1VBC1 4GZ9A 5E1RA 4ZHNA 3TOJA 3RFRA 1WA4A 3JQWA 3DXUA 1EPZA 3WP4A 1XYNA 4HSJA 5G04L 2XB6C 1WW5A 4QKBA 3PNAA 2QJVA 2DV9A 4OLLA 5A7PA 3O1TA 5A7NA 1SBEA 2BBVA 4P9XA 3OBTA 4AGRA 1SCSA 5BNPA 4R9BA 1GFF2 2W46A 1XNTA 3ORJA 1W3XA 3MPPG 2VW0A 4RR3B 5FYZA 4AEMA 2X5IB 1MQTC 1RUC1 3CZJA 1C4RA 4QQPA 3L9JT 1J1TA 4MGKE 3WR0A 2VW2A 2Y60A 3NNJA 2WFF2 1C28A 2UWAA 2JECA 3LDBA 1I1EA 1AR63 2BYVE 1PX4A 2ZGOA 1D0GA 2VECA 3APBA 2F4PA 4ZU5A 2R072 2QQPA 4KGQA 3HT2A 3RZKA 4LKEA 4N43C 4N9HA 1U12A 2FBEA 1ASJ3 1AXYA 2SLIA 3PVNA 3R6SA 1LECA 1HRI2 2RS12 3RYPA 4QMAA 3WW1A 1PM7A 3CJIA 1DQ2A 2HWC3 1XNBA 2JG8A 4QQLA 3CBNA 3Q8FA 4MXWA 4IGPA 3RI8A 1D4VB 4GA9A 5A32A 3MYXA 4XBLA 5DG2A 1GP4A 2BNOA 4Q4W2 4AE2A 4B3NA 2D43A 1BEV1 1Z7S3 4HN1A 2JWPA 3N9PA 5FPAA 3T2PA 1X7NA 4K6BA 5BY5A 3VBHA 5J1XA 4N90A 4XUTA 1JUIA 1NCRC 2RS32 4XFAA 1QXJA 2XJRA 4EROA 4DUXA 5JIUA 1ZRDA 4YM3A 2Y34A 1FOD2 1PGW2 1YFWA 2XUEA 1ULCA 3HPNA 3AMHA 5FQ0B 5IATA 2XPJA 3KV5A 3O0WA 1GZ9A 3TN91 3WW4A 1JH5A 3MPBA 2QQJA 5JPNB 1VP6A 4NUBA 4XYXA 2BFUL 3AP5A 2B9VA 5I0UA 4JGZC 3AMQA 3VBSB 3DKWA 3NRUA 5FPZA 3FHIB 1HJFA 2AGSA 1PVC2 2PTMA 2JICA 1FYUA 2ZEYA 3JZVA 5J48A 2JG9B 4RYDA 3BTXA 3P6BA 4CCNA 3P1IA 5F5AA 2BRTA 3K46A 5A7WB 1E5RA 2OIIA 2WZR2 4EN0A 3R05A 1VBD1 2UURA 2HEYF 2VO5A 5DAQA 3N3HA 4ISQA 4UFMA 3B01A 2RDQA 4QB6A 5EHDA 3CL1A 4LR4A 1XJAA 2C1FA 3ZXAC 1OLRA 2XJSA 4YZ1A 3AFKA 1SACA 1YQ5A 2GNTA 4FCAA 4P9GA 4RQPB 3JD73 4HBNA 4P9WA 5E8AA 3WP5A 4YW6A 3IAPA 4D3WA 1LHWA 5AC91 2J1AA 2RM23 3JUUA 4QHOA 4AFCA 4B8EA 1QDOA 2R30A 1G8WA 1DQ5A 4XBQA 1YFYA 3ALQA 3KHCA 1YQ6A 1TMF3 3NAPC 2J1RA 5FZOB 2BPA2 3ZSJA 3C3VA 4CDUA 1VB2A 4NAOA 4CU7A 2PFWA 1QOSA 5FUNA 2RR11 3DYMA 1Y7BA 4NRMA 1BK0A 1VRBA 3NVCA 4FQZA 5HV0A 1IQDC 1RUH1 1VALA 1S0GA 4HKOA 2PQSA 1LR5A 3ES1A 2G9GA 5JIAA 4A42A 3ZYJB 5LA9A 1L7LA 3WDTA 2GC1A 4BK4A 4NMIA 4MGSA 5FPBA 1JZ6A 2DF7A 2BEOA 3WNXA 1RHI1 1RVF1 5FP4A 4L11A 4NIHA 2I2SA 2NN8A 1RUI3 2DVAA 5DAVA 2PHTA 3TEZA 3VD5A 1LJ7A 4AEKA 1GZWB 1NE6A 2DCYA 3UGFA 3LB9A 4GWNA 2RMU1 1X36A 3OBAA 2WNEA 1KQRA 2XONA 4BHPA 5BNOB 2D44A 4Z82A 4FSJA 1VRH3 3M7AA 1KD7A 5CA6A 3ENRA 4RFRB 4SLIA 4AI0A 3ZYIB 4Y26A 1ZZ6A 2WJSA 5FLIA 3KGLA 1JOPA 4GQ7A 5A6QA 2MEV3 2YMZA 4E8CA 3PUIA 1ZZ8A 1US3A 1BMV1 2ZGUA 2YB7A 1RUG3 1RUJ1 3H9AA 1QKQA 1ZBE2 2ARXA 1JW6A 2VTXJ 3HIFA 4Q0UA 5H9QA 1OVSA 3POGA 4MO3M 2JKXA 3JQXA 3WOGA 1PHMA 4CCOA 2J1TA 5FOJB 3PL0A 5EZWA 2DURA 1OLME 4L9BA 1ACCA 4QX1A 4EYUA 3EHKA 1PO13 4Q4Y3 4AI3A 1YI7A 2GC0A 4PF5A 3SQOA 2VU9A 3ZYPA 4TSVA 3WF2A 1ZBA2 3I2DA 1MQTA 4FTSA 1WCDJ 1S2BA 2FDJA 2HWB3 4OHZA 1O91A 4JZRA 2JDNA 3H3LA 1XPWA 1NZCA 1O8SA 1Q43A 5F3EA 1G9FA 1K12A 1L3JA 3AL5A 5FP8A 2VZTA 2HWE1 3N9QA 3OCPA 3MZHA 2RS52 4YPJA 1YRZA 5EJ1B 5F37A 1DGLA 3UESA 3PURA 3AKSA 4N43A 4F83A 2ZXQA 2BJSA 3AFGA 2X5IC 2Q8OA 1H2NA 1QNWA 3J8F2 4CUAA 4LA2A 1NY71 2C0ZA 4QQOA 2ZTNA 4IE5A 5AVPA 1AR73 3T4HB 5C3QA 2CAVA 3I2KA 1EPWA 4YFWA 4YRDA 2ZZQA 1SPPA 1JYVA 4Z8BA 1WMDA 2Q4SA 1VAMA 3SKVA 1BBT1 2CWMA 1TZOA 3LGRA 1NCRA 1AF9A 1FMD2 2EXIA 4XQWA 1LU2A 3U07A 4IV1C 3ZOIA 1OURA 1FPN1 1POQA 3NJZA 4RHV1 4BPZA 3J4UH 1VE0A 4M4RA 1BHGA 3LEIA 2W47A 3UV9A 1HN0A 2VJXA 2RDSA 2D7FA 3GZTB 2XMLA 4J1WA 3NNMA 4PIZA 2HEVF 2Y6KA 1EV11 3VGIA 4FTBA 1AL23 4FPCA 4AHXA 4JGZA 4LOTA 4ZY9A 1HLCA 4QKFA 5FREA 3U4SA 4FXGB 1POV0 3RNSA 4GULA 3OEAA 2EXHA 3THCA 1HV0A 1HDKA 1VBC2 2ENRA 3H8XA 4ZZ5A 4JGYA 3VDDB 1QH6A 3I49A 2ADDA 1WCKA 2HBUA 4GKXA 5FP9A 3O0XA 4WM7A 3MLKA 4LA3A 3N7KA 3THDA 3VL8A 2K46A 1K5MB 1NUKA 2VQUA 2VZPA 4N8MA 1F35A 4XCBA 3FWEA 1GWKA 3M3EA 3VBSC 1HXS1 3ZMOA 4UFLA 4ET7A 3UKNA 2OX0A 3PMEA 3ZSMA 2VVEA 3AZZA 3FUOA 4EQVA 2CHHA 1UNBA 1SBDA 2ARBA 2GMPA 3IMMA 4O9EA 3I3MA 2QE3A 1RUC2 2JG9C 3K3NA 2B7YA
chains in the Genus database with same CATH topology
4AG4A 5AVAA 1N1SA 5DDJ3 2R0FA 3WXPA 2H0VA 5DUXA 2V5YA 4SBVA 2JENA 5K0UB 4XEZA 3AB0A 4K1YA 4G9SB 4QPIA 3ILRA 4GH4B 1UPIA 3AKRA 3H3ZA 3CNAA 1YJLA 3ZXDA 2R1DA 4AQTA 1AX1A 4QPYA 5K8SA 3SH4A 3VBFC 2VNRA 4QM9A 1O4TA 1GLHA 1AR61 3FFZA 3OY8A 3ZIXA 1A8MA 3PHMA 1C8M3 3CF6E 3HMYA 5JOXA 1QQP3 2PYTA 2NYYA 4JDMA 4QQHA 1ASJ1 2GNMA 2K0GA 4BLIA 1VLNA 1Q8PA 5T54A 2Q1MA 1OLQA 1X8MA 2HWC1 4HT1T 1CVNA 1SLLA 2D3RA 2ZMKA 5H9RA 3ME2A 3QD6A 1YNAA 1EY2A 3TN92 3DL3A 2EAAA 2KXLA 4PDWB 4XFHA 1QNYA 2XKPA 4YVSB 2X8KA 1T6GC 4FOWA 1Z7S1 2ATFA 3ILFA 3WDXA 1GKBA 5FLJA 1S0DA 1BVP1 1SBFA 3T1MA 2IWGB 1UAIA 5JOYA 4BMBA 3TNQA 3WDUA 4CEWB 4A2UA 1VBA3 1KFUL 4RA0A 3ACLA 2Q1ZB 3MIBA 1VBD2 1DYKA 4F8AA 1R093 4WVWA 5BXXA 4H7LA 1YJKA 1MEC3 4B7EA 4AGGA 1V6MA 4CDQB 4CDXB 2Q30A 2PHRA 3E97A 4TLFA 2AYHA 3FE5A 1S0CA 3JBG1 1ND3B 3RG0A 5AC92 1TME3 1LOCA 3UJOA 4YZ2A 1PIV3 2ZX3A 4K1ZA 4OUMA 4R9DA 3UJQA 3BCWA 1LOEA 1TEIA 4E4SA 2X5IA 5JOZA 3NV3A 1LGBA 2RR12 4HL0A 4BWOA 3V64A 4CDWC 2Z2SB 4K8FA 1Q5OA 1RUH2 1W6OB 1YCIA 1SLBA 3WLUA 5E16A 3SCHA 3VHOA 1G9DA 2MHFA 4Q0VA 1FNZA 2PHWA 5LK7B 3KMHA 1RHI2 1RVF2 5C4WC 2DUPA 5EFUA 1UX6A 1C1FA 4GB33 2VNOA 2Z69A 5KXDA 2RMU2 4YGCA 1RIRA 1X50A 1FV3A 1ENQA 4KNCA 3VHRA 1MS9A 1YFUA 2BUKA 3AKQA 2ZGPA 5A33B 4CTEA 3KT7A 1GYKA 4RS5C 3CO2A 1Q3EA 3TAYA 4YNIA 2BFUS 2XVLA 4G3YC 4J1XA 3N7MA 4XQ4A 5KXCA 4Q8LA 4XJAA 4Z1VA 2EALA 1RUJ2 5T52A 2ZOEB 2VVDA 2A6ZA 2D93A 3AMNA 4LBJA 1R1A3 4KBBA 4X6QB 1R083 3WCSA 3UK9A 1C3HA 5LEJA 2JXAA 2ZGRA 3VBSA 1BXHA 2YGLA 4CEYB 1FT9A 3LSEA 1H8VA 1RUG1 2JG9A 1DGRN 1H2KA 1KJRA 2O0OA 4IV3B 2Z5WA 1O5UA 4D7SA 1S0IA 1UW8A 3SHRA 4DPNA 5HCBA 1J59A 1MS1A 4OHYA 1LENA 4H14A 2HWE2 4LEJA 4Q4Y1 4ISRA 5L7OB 2CV6A 1OOPC 4G4FA 3WHUA 1IKPA 2G4IA 2HWB1 4IEVA 4OZXA 3LOIA 4JDNA 2B42B 1QJX3 4LULA 2VNGA 2GN7A 4TWTA 3NKGA 1NY72 1MS3A 4AYUA 1RUD3 3IPVA 3NV2A 3INAA 2R16A 3ZFFB 5F6LB 1BBT2 3SH3A 3BU7A 1CN1A 4FPKA 2OPKA 3GHMA 5IK4A 4I0AA 5LRRA 3CJXA 4RHV2 3AP6A 2LTNA 4EWAA 5KXBA 1AR71 4UBHA 4Y24A 4AVTA 1GICA 1IKQA 2P3JA 1GZWA 1I3HA 1EV12 2EAKA 3VKMA 5H9PA 1H0BA 2ZGMA 1NQJA 4OULA 4NPRA 4E27A 4Y22B 4E2SA 2R061 3AMMA 5D1IA 3RMXA 4HPKB 1QJU1 2WZPP 1PK6B 1D4M1 1VJ2A 2ZHNA 2PAKA 3RYKA 3QOPA 2DUQA 1AL21 2V09A 5I93A 2XBO3 3DPRB 4Q0PA 5CU1A 4QHBA 4AEJA 1O4YA 1XNCA 2BVBA 4IEWA 4COUA 4D94A 1G9AA 5JI9A 1ENRA 1TNRA 1HXS2 3BPZA 4AHZA 1ZVFA 1AYN3 2MNGA 4DINB 3IBMA 4CEWC 2VULA 1YIFA 5JI7A 4UXAA 4GMP0 4K20A 2R043 2AH2A 3O7OA 4HMZA 4EN9B 5BYNA 4HN0A 4CDQC 4CDWA 1AYM1 3SCFA 1TNFA 2UWBA 1H9WA 1COV2 2NMNA 2Y0IA 3ECQA 4Q0SA 5GJ6A 1ND3C 1OMIA 5JCTA 4AVAA 4X6RB 5DDJ1 1CGPA 3WD5A 4FAHA 2DFBA 2P17A 4RD7A 1AL0G 5C4WA 4Y20B 2NZ9A 4XIKA 1AR62 1XYOA 5CFDB 4META 1N1YA 1BZWA 1RUF3 4FPJA 2XJQA 3ILNA 3WQ7A 2VW1A 1WCSA 5K7PA 1IZ3A 4JRAA 4WM8C 4EN8B 4EWEA 1MZFA 1OA3A 1UF2C 3WDVA 1S0JA 4ES8A 1XYPA 1J3PA 4RS5A 4Q1PA 4I01A 1W6PB 3EBRA 1C8M1 3MLJA 1AZDA 5F9TA 5L36A 1QQP1 5ABJB 2ERFA 3CEWA 5IK8A 1Z7S2 4FBFA 5BNQA 1O3TA 3WDYA 3ZFGB 3P3NA 2O1QA 1X8EA 2OZJA 4AWDA 1NCQB 2JD4A 4LO5B 1LHUA 1MS8A 2A6YA 2CWSA 2A73B 3MI8A 3M4FA 4ZXKA 5EV7A 1OQEA 1ZA4A 4Y1YA 5LEKA 1UKRA 1ZM1A 1AX0A 5DZGA 4XF4A 1PZ9A 4YZ4A 4Q4X3 1GZCA 1MZ6A 4CRQA 3VDDA 4ONUA 1JOJA 3DV8A 1DG6A 4PLOA 4K3UA 4Q4V3 1EP0A 1VBA1 1SEFA 3B00A 1K5MA 3JBG2 3S0MA 3FLTA 1PGL2 4JTNA 1XRUA 1RMU3 2FMDA 2GSYA 4W6YA 2D6NA 4AVVA 2XL9A 1DFQA 1OOPA 1O5LA 1R091 5HCAA 3VHNA 2YYOA 4ZU7A 3HT1A 1GQHA 1OSGA 1VBE3 1X33A 1MEC1 3BOWA 3E5UA 1V6IA 3VKNA 4XXPA 3AX4A 4FT8A 2HKXA 1O3RA 1TME1 3MEPA 2NQYA 4C1WA 4KG8A 1ZYBA 4BIOA 1SFYA 4GH4A 5TSWA 4AF9A 5L7OC 4QPGC 1OPMA 2C5DA 3WX5A 4PQ9A 4YW4A 3MDPA 4M3CE 3AKPA 2ZMNA 4M3CB 1Q8OA 2W52A 3VN4A 5FO9B 4FOVA 3TRSB 5CG9A 4HETA 4JQRA 1QJY3 1WLTA 4YSFA 3FUQA 3MGUA 5CB7A 3H3UA 2DU0A 2H6BA 5L19A 4MVTA 5BV6A 1ENXA 1BQPA 3AYEA 4IEOA 3NV4A 3WG4A 3IM0A 1PO23 3KGZA 5FPXA 4Z2WA 3IN9A 5BNNB 5KC5A 4PDWA 3AXDA 4XF9A 2VQAA 2ZAHA 1REDA 4ORFA 3M3CA 3QH7A 5CFCC 3HAGA 3N7JA 2PHFA 1V6OA 4LUMA 4XBNA 1PNFA 1XE8A 4CEWA 2OUHA 2A7AA 1POV3 1H30A 1GBGA 2FZ1A 4LNVA 1PK6C 3U10A 5JPMB 1A8DA 1RL3A 3D0SA 3KT4A 1R1A1 1IHMA 1R081 1KJLA 5T5PA 4MGYE 3E6DA 3WUDA 4CDQA 4LBMA 4CDXA 4Q4Y2 3B5LB 5B2GB 3MIDA 2X53S 1ND3A 4AK3A 3JB8A 1ND2B 4C1XA 3M3OA 3O5SA 1AX2A 4HSLA 5GZFA 4FPGA 4HKLA 3VZOA 2A3YA 4MV2A 4LBLA 1QJZA 1OA2A 4JGYC 2OYZA 5ACA3 1QGLA 1XNKA 1QWRA 4M0NA 4WM7C 4JAAA 4IEUA 3CLPA 2E9QA 3NSTA 3DF0A 4WM8A 2B39A 2E7QA 4AVSA 1AR81 1NG0A 3HN1A 3VKLA 1BKZA 3R4DB 4IQPA 4LUKA 3ZN5A 2QVSB 1AR72 3TBDA 2WQZC 4A7ZA 2VOXA 5CFDC 3HWJA 3E6BA 4DOUA 5C33A 1VBB3 1A6CA 2D6KA 1JYCA 3E5XA 4AQ6A 4A7KA 1QY4A 2W68A 4Q26A 5GKAC 2R062 5A33A 1KITA 4QPIC 4NR1A 3D8CA 2LUWA 2XGXA 1QJU2 5I8TA 5KXEA 1GQGA 3OBRA 1D4M2 4AQ2A 4I09A 2CTVA 3MIGA 1AL22 1JN2P 4Q0QA 4XHBA 2O8OA 1H8TB 2CL2A 4YGBA 1XU1A 3ZFGC 2A6VA 2P2KA 4WZCA 5JLVA 4YG0A 2ZGSA 4L97A 2G9FA 1BCXA 4Q1RA 5J36A 4OVEA 4KWLA 4R52A 1LOFC 2ZHKA 4CEYA 1I5ZA 2ZMLA 4H3WA 2IFWA 3RSJA 3ZIWA 3IDEA 1YIPA 1UCXA 3AYAA 2HWD3 2QDNA 1VAKA 4XZPA 2WFF3 3V0BB 1Q8VA 4COWA 1AYN1 1S0FA 1AYM2 4BOWA 3AK0A 1VIWB 4NO4A 4J6GA 3ZSKA 2YC0A 4Q2FA 4P5HA 4HVOA 2R073 2JE9A 3FFQA 4AI2A 5L7OA 4QPGA 1CD3G 5A3LA 4OHXA 2XH6A 3OGJA 1UZZA 4C0HA 2RS13 1B35C 3LA3A 4OFGA 1OI6A 3H1YA 3NW4A 3J26N 4HLTA 3RS6A 1M06G 4ZU4A 1BK1A 2OA2A 4N7IA 3ZFEB 3RQ0A 3JU9A 4LBKA 1SLAA 2OVUA 3IDBB 3VV1A 5HI0A 1UU6A 1QU0A 1DIWA 5FDBA 2D6OX 2DYCA 1C8M2 1RUF1 5SV8A 1RUE1 1QQP2 1NQDA 3R4UA 4XQDA 3KZ4C 3AZWA 3MF6A 4JTOA 1CAUB 2WQ4A 3QH6A 2D6PA 4KG0A 4RR3C 2IZWA 3UL2A 2BQPA 1DBNA 4DZGA 2GNDA 2R49A 3AP7A 2JX9A 4AHYA 3QBQA 3DN7A 2H0BA 2Q0AA 4P9LA 2KA3A 3ZXJA 5C9AB 1PVC3 1SMVA 5CFCA 4URTA 3M8LA 4Y22A 3WINE 4AVCA 2R0HA 3I59B 4HPKA 1S1AA 2WZR3 1MVQA 1F8VA 1PK6A 2DCJA 5BNNC 5FAXA 1PVXA 2OUJA 1VBA2 1OKQA 1UZYA 3WY6A 4FP2A 1NLSA 5DXDA 4BZ4A 1R092 2AUYA 4JDOA 4Q4X1 4LTAA 2YROA 1MEC2 4PIYA 3H0OA 2ZHLA 2KM2A 2BW8A 4FPYA 4R9AA 2FQPA 1Y3TA 2P34A 1TME2 3WUCA 4P14A 3ZXLA 3VBOB 3PVOA 3FLPA 4GWMA 4XFFA 3OTFA 5L73A 1EAH1 3V56A 5GZCA 2HWF3 2XKOA 5CG8A 4BYYA 3MF9A 1IS5A 1RJ8A 4Y20A 5CFDA 3GALA 2E63A 3RWNA 2PLV3 2UYBA 2ZA9A 1CJDA 3QCWA 3B9IA 5LRSA 2ZKLA 2WS93 1Y9QA 1O3SA 3W9AA 3N36A 4MGZE 5GLZA 4RQPC 2DCZA 4UW3A 5I0RA 2Y38A 1QJY1 4LO7A 4FP3A 3SLIA 4DS0A 3V0AB 5GZGA 2WNVB 4TYSA 2C9AA 3RDIA 5ABJA 1AXZA 3PVEA 2YV8A 4HZFA 3ZFGA 2GDFA 1NCQA 1SFNA 4FQ4A 1PO21 1BEV2 1QXRA 1LOFA 2FHRA 3X29B 1ZBA3 2IXCA 2W39A 4QGLA 1KRIA 1R082 4KWKA 2Y26A 1AJKA 3D4KA 1H8TC 5BNPB 1AHSA 4OI2A 3NO8A 3KB5A 4FPHA 1DGWX 1HRV3 1M4WA 1POV1 1QXPA 2RS53 5BNOC 3A4UA 1LGNA 3H7JA 3WZ1A 1CR7A 2SBAA 4K21A 4GMP3 2N7GA 1B35A 5KHKA 4Y4YA 3OYWA 4W65A 2ETEA 3B94A 1NXD1 1SDWA 1OPOA 3VZLA 4AXOA 3MICA 2WINB 4K9SA 4Y5Z0 1AR82 2XJVA 3D5OA 5DG1A 3ZMNA 5SV5A 4XJ8A 2CGNA 1U5IA 5ACA1 4KU7A 5A32B 2CNAA 4RL7A 1ULEA 4YW2A 3VBHB 2WT2A 1NYWA 4LHNA 4AEDB 4N53B 3OD0A 2F6BA 2GNBA 4RR3A 2WNUB 1R1ZA 3KSCA 4A7YA 3ZO0B 4F3JA 1NLRA 2RE9A 2XL7A 4B29A 3JD71 1URXA 2DVGA 4YVWB 1TE1B 3WG2A 2RM21 1LRHA 2D6LX 5DUWA 2Z42A 4LHKA 5J7MA 5IK7A 1Z78A 1TMF1 1VBB1 1DZTA 1VBC3 4W6XA 2D3PA 4YZ3A 3GYDA 1ZNPA 5BNNA 1C8NA 2WFPA 1WLWA 2VOKA 4N9IA 4FTEA 2CAUA 2PHUA 4HVRA 2A3XA 5J98B 4N7UA 4DY5A 2ZHMA 4EWDA 5AFBA 2DCTA 1H2LA 1WGPA 4I02A 1RUC3 1RUI1 3N35A 4E2QA 1VAVA 5JZGB 3Q9OA 1LOBA 4B7KA 1SLTA 4MLOA 1AYN2 1LKNA 5FQ0A 1H9PA 5IT6A 1BMV2 2ZX4A 3WW3A 2YHJA 1VRH1 4LO4B 1JXNA 3FBMA 4XTPA 2BWCA 1WLDA 1DQ6A 4QGNA 1CAXB 1J3QA 2HWD1 3KM5A 2MEV1 2XJUA 1ND2A 1WUVA 4YM0A 2XG3A 5JR7B 3RPQA 1XXNA 1C57A 3ELNA 1V6NA 4FOYA 3VDDC 2R071 3A0KA 4FPOB 3SXWA 2TEPA 1CONA 2QFEA 4FOQA 4GALA 1V70A 3MW2A 1G6NA 1K5MC 1LOGA 2BGCA 4M01A 2D98A 3GBFA 1PO11 3D6EA 2R32A 1RUE2 4EV0A 3LKJA 1ENSA 3G6JB 4RQPA 3TN93 1DZRA 4IESA 1H4HA 5C6CA 4FAGA 1LU1A 1BVVA 1QOOA 4JV4A 4R4ZA 5K0UC 3G7DA 4FO9A 1Y43B 1IOAA 4Z07A 4BLJA 5JSOA 4GH4C 3S30A 1LEDA 1DQ1A 1DQ4A