5IK8A

Laminin a2lg45 i-form, g6/7 bound.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
381
structure length
381
Chain Sequence
b'APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laminin subunit alpha-2
publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 78
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A02
2PHUA 1LGNA 1GZCA 2ZGUA 1WW6A 1LHUA 3MW3A 2UWBA 4Y24A 1C57A 2FHRA 4GKYA 4YGCA 1O4ZA 2R16A 3AYCA 2R0HA 1G9AA 3PVEA 1MVEA 2EIGA 5T50A 4Q1PA 2ZAAA 3PVNA 4YG0A 3OY8A 1I1EA 2JJ6A 2VY0A 1BKZA 2CWSA 4LBJA 4L8QA 4DS0A 1QNWA 1VAVA 4R9DA 1S1AA 2AH2A 2D6OX 4XILA 1Q8SA 1GZ9A 2A3YA 2E6VA 3ZXFA 1FYUA 1FNYA 2ZHNA 4RA0A 3ZSLA 1A78A 3WG3A 1N1VA 4M3CE 4DPNA 2DYCA 2TEPA 3WCSA 5HCAA 3AYAA 1V00A 5JOYA 4WVVA 2DUPA 1RITA 5DXDA 4JRAA 4PBPA 4I30A 4AVTA 4GALA 1GYKA 1S0BA 3AZWA 3AXEA 3N7KA 4PQ9A 3WG1A 3AYEA 4XDQA 3H0OA 1QKQA 2CTVA 2VW2A 5KXCA 1QGLA 1S0IA 5IK7A 1AX2A 2D3SA 3M1HA 4FOYA 2PHRA 4LBNA 1YYNA 4Y26A 4FVVA 5IUQA 4D69A 2DWRA 4YW1A 3V0BB 1LOBA 2DUQA 3NV3A 2PHFA 4NO4A 4AGGA 2PHXA 4Q1RA 4ATFA 3N3HA 1HLCA 4FOVA 5KXEA 1AXYA 1S0CA 4FOWA 4XHXA 2D6LX 4SLIA 1GKBA 1IKQA 2R1DA 2WNEA 1TEIA 3B00A 2D3PA 4JC1A 5T5PA 3W58A 1SCSA 4KBBA 2FMDA 1WD3A 1PZ8A 1N3OA 2ZGTA 3UL2A 1AX0A 3ZXJA 4BLIA 4U36A 1KITA 1DFQA 2GNBA 3AP6A 1LOEA 3RS6A 3WG4A 1LOCA 1O4YA 1OFSA 3VKFC 2DVGA 2A7AA 3WDTA 2WT2A 1UZYA 4K21A 1LEMA 4XYXA 2D6PA 3BOPA 3FLPA 3OY8B 2YROA 4WVWA 3FFZA 3ILNA 3AP7A 1SLTA 3BODA 3JU9A 1GLHA 2Q5TA 1MZ6A 2G4IA 1GV9A 3WG2A 1YO8A 2P3KA 4BQ1A 4YZ5A 4AVSA 2PHTA 3DGTA 2WT1A 4Q26A 4XJAA 1CJPA 3MEPA 2A6YA 3SLIA 1B09A 3WDUA 3T1MA 2VXRA 3R4SA 3HMYA 3L2YA 4UW3A 4Y22A 5EWSA 5HCBA 2RHPA 1LOFC 1CN1A 2W52A 3ZXKA 1YRZA 5GALA 3W59A 2D43A 1CESA 3APBA 1QU0A 1N1TA 3AK0A 3M3CA 1UKGA 1OKQA 3LSDA 1LHNA 4OZXA 1IS5A 1QF3A 1LODA 3ENRA 4YW4A 2WKKA 3WHTA 4AGRA 4BOWA 4Z8BA 1SFYA 3GALA 3O12A 4C1WA 1F9KA 4YM2A 4ISRA 2DVBA 2Z42A 5H9QA 4AYUA 4F83A 1KJRA 1LGCA 1SLAA 1IKPA 2GALA 3SH5A 1DLLA 5JOWA 5IT6A 1AJKA 5GJ6A 4FPFA 3N36A 1GNZA 3FLRA 2BQPA 2AUYA 3RMYA 1FNZA 3A0KA 2ZKNA 5DUXA 5GZCA 1Q8PA 5DG1A 1MZ5A 1LGBA 4YGDA 2D3RA 4XJ9A 2JD4A 3HR9A 2W68A 4H55A 2D6NA 1CR7A 3ZVXA 3OYWB 2XB6C 1N3PA 1WBLA 1GANA 4ASMB 5KXBA 2ARBA 4LBQA 3IKWA 1CQ9A 1APNA 4UW5A 2R0FA 1C1LA 4PCRA 4YGEA 1F31A 1MS0A 2ZHMA 4ZXKA 1G8WA 3ZYPA 2ZBJA 2ZACA 1W0OA 4LBKA 5LK5A 3RMXA 2OUHA 3MW4A 4BMBA 3VKMA 1A8DA 1WW7A 1H9WA 5JVVA 1HDKA 3CNAA 4XOGA 1PZ9A 3FBYA 2EXIA 3N35A 2ZGSA 4Y22B 3WV6A 4XXPA 3PMEA 1QOTA 3RRDA 4C1XA 3OGGA 2W08A 4XTPA 1FV3A 2ZMKA 3N7LA 1SLIA 3PJQA 4FQZA 1DZQA 4Y1UA 1D2SA 5E88A 3M3EA 1WW5A 3B01A 4WV8A 1DYKA 4YLZA 2CWMA 1W6NA 4CZSA 2P34A 2ZGOA 4P14A 1BJQA 5DG2A 2GMPA 2B7YA 2GNDA 3POSA 4K20A 3M3QA 1RINA 4XIKA 4FPLA 2WSVA 1LJ7A 4FPHA 3ZXEA 1CPMA 4BPZA 1W6QB 2ES3A 4P9XA 4XJ8A 4R9CA 2GNMA 4GWNA 1V6KA 5AVAA 4GKXA 1V6NA 4XBQA 1N3QA 2VUAA 1GZWA 3WUDA 1LHOA 1JXNA 3POYA 1LU1A 4YFWA 5EYYA 3WLUA 3ZSKA 2P3IA 5GLZA 3VV1A 4LBLA 4UW6A 5FRAA 4Y20A 1CPNA 2EXJA 1N47A 4DRVA 5HCFA 1LESA 3N7JA 1H9PA 3GNEA 1JN2P 5DUUA 1KDMA 4M3CF 3A4UA 1ENSA 4BMEA 2A5ZA 2A75A 5EYXA 4XMIA 4LBQB 2DU1A 3AZYA 1ENRA 5GZDA 1G86A 1LULA 2ZMNA 4XJWA 1QDCA 4YW2A 1C4RA 1SLLA 2NYYA 2JE9A 4Y1YA 3VKLA 4BLJA 5T5LA 1HQWA 1KQRA 4YZ4A 1UL9A 2OVUA 1AF9A 1V6JA 3ZXLA 1S0EA 3OYWA 4HANA 4XTMA 3INAA 3IM0A 3USUA 2WQZC 2NP0A 2H0BA 5T52A 4Y1ZA 2D7FA 1I3HA 5CA6A 4YW5A 3MPPG 3O0WA 4LBOA 2VU9A 5IK5A 3C2UA 5T5JA 2DVDA 1W6NB 3V65A 3T1LA 4TYSA 1ENQA 1KRIA 1OQ1A 4FPCA 3WDYA 5H9PA 4FOQA 1W6MB 1NLSA 2ERFA 1DQ1A 4XZPA 2YMZA 4YG6A 1MS1A 1HQLA 4LBQD 3WVJA 3NWKA 1V6IA 1MS5A 2ZABA 1URXA 2AR6A 4YM3A 3PVOA 3IN9A 3RSJA 3AP5A 2E51A 4MYEA 1ULEA 4JCKA 1GZWB 1KJLA 5GZFA 1UAIA 4FP3A 5GLTA 2UWCA 2VW0A 3M2MA 2EALA 4M00A 1DGLA 2C5DA 2A3WA 4IQPA 1QOSA 4Y20B 2ZGRA 5E89A 2EF6A 1Q56A 2EXHA 2NMOA 2CYFA 1W6QA 2AREA 2W39A 1LCLA 3AXDA 1ZA4A 2DU0A 3QCWA 4W65A 1EPWA 1DQ0A 1VAMA 2OUJA 3IMNA 5E8AA 1C1FA 2A6ZA 3ZSJA 4AWDA 4AVVA 3LSEA 3FUQA 2D6MA 2E53A 4Q8LA 2V73A 1MS3A 1AXZA 1Q8VA 1PZ7A 2ARXA 4Y1XA 2C9AA 5GLUA 3WDVA 3WHUA 2UURA 3JUUA 1QMJA 4M01A 4R9AA 1KDKA 2P2KA 4YW3A 3Q9OA 5DZEA 4WZFA 2ZGQA 1W6OA 3V64A 3O0XA 3BTAA 1NXD1 3USUB 4ITCA 1GSLA 4GXLA 3ILFA 1G9FA 2HYKA 3O5SA 3HN1A 1WW4A 5T55A 3ZSMA 3OBTA 1H30A 1SBFA 3V0AA 3SH4A 3NV1A 3OBRA 1W0PA 4Y1VA 5GLVA 1S0GA 1WLDA 2DTYA 4FPGA 5H9RA 5JLVA 1IS3A 1Y7BA 4K1ZA 4YM1A 1WUVA 2WSUA 5DZGA 3SH3A 2JKBA 2ZZJA 1GICA 1S0FA 3KM5A 3WZ1A 2ZGMA 2GMEA 1WLCA 2I2SA 4FPYA 1WCSA 1MS4A 2D6KA 5JOZA 1N1SA 2P37A 2ZGNA 5DUWA 1Z0HA 3AYDA 2A70A 1ULDA 2GMMA 2PELA 1SBEA 4XBLA 1YIFA 1DIWA 1SACA 4CRQA 5IK8A 2CL2A 3AP9A 2JE7A 1VALA 1JOJA 2UU8A 1RIRA 3T2TA 3FLTA 4P9YA 2KM2A 1WLWA 1W6MA 3R05A 1MVQA 1UZZA 3D5OA 2GN3A 1SCRA 2CY6A 3WDWA 4NOTA 2WJSA 4XBNA 4ZKTB 1FV2A 1DQ5A 1SLCA 2YY1A 1JYCA 4TZDA 3POWA 2DVAA 4XXAA 5CBLA 1LEDA 2OW4A 3D6EA 4FQ4A 2NN8A 1MR5A 1AVBA 2GDFA 1F5FA 5GLWA 4YFZA 4FPEA 2YXSA 3LCPA 2GNTA 1Z78A 1UPSA 5BYNA 3I4IA 1UX6A 1W6OB 4R9BA 1WD4A 3BIWE 1LOGA 3FUOA 2AENA 4CTEA 1MS9A 1CIWA 4Q8KA 2VW1A 4M3CB 1W6PA 4Q27A 1DHKB 2VH9A 1HKDA 5T5OA 3V0AB 1QOOA 3VKNA 3VKOA 4XJZA 1ULFA 2NZ9A 1G9DA 3UJQA 1R1ZA 3WOGA 1BZWA 2D44A 3DUIA 4Q2FA 2CNAA 5KXDA 4AGVA 1QNYA 3I8TA 5CAZA 1LENA 4GA9A 1DYPA 1AZDA 4RL7A 3WCRA 3MW2A 2AYHA 2NMNA 3IPVA 3AX4A 4ATEA 4YG3A 1BYHA 1IOAA 1LECA 4HL0A 1V6MA 2SBAA 4BM8A 1SLBA 2WT0A 3NV2A 1DQ6A 1JUIA 1MACA 5JDBA 3VUOA 1JW6A 3AJYA 1Q8QA 1CVNA 4FPOB 1JHNA 3RG0A 3ZPYA 2P3JA 3ASIA 5H9SA 2ZHLA 3UK9A 1AXKA 2YZ4A 4FP2A 2A6VA 3AZXA 1YI7A 1A3KA 4YZ3A 4K1YA 1LU2A 5EXOA 1LHWA 4XJUA 2LALA 2GN7A 3QLQA 2SLIA 4YM0A 3AFKA 1ULGA 1LOAA 2ZGLA 1LHVA 5FREA 5GZEA 5L73A 5DZFA 2A6WA 4LBMA 2PHWA 3ATGA 2E7TA 3RQ0A 1DBNA 2ENRA 2YV8A 3SNMA 1G9BA 1J1TA 2ZGKA 2R49A 5F5QA 4YZ2A 3O0VA 1AX1A 4DRRA 2A71A 2DUOA 2JDZA 4PF5A 2JECA 4FPJA 1VIWB 3AZVA 3TAYA 5JMCA 1W6PB 1XQNA 1LTEA 5GZGA 4YGBA 4DFSA 1VLNA 3A0NA 1MS8A 1S0JA 3B69A 2ZHKA 4XE9A 1V6LA 1S0DA 1DQ4A 5DUVA 1JYIA 1G9CA 2DVFA 2AGSA 2DURA 3N7MA 4PBOA 3TB0A 3U4XA 1X50A 3B3QE 2ZA9A 5F9TA 2E7QA 2LTNA 1LOFA 3ILRA 4DQAA 1ZM1A 1CONA 3KQRA 5IK4A 1BXHA 2V5YA 1UN1A 1BQPA 2EAKA 2ZGPA 3D4KA 4ISQA 5CB7A 1ONAA 2XG3A 4M3CA 1IS4A 2DV9A 1JBCA 3IPVB 2UWAA 1WBFA 3WUCA 2WLQA 3OPZA 4XMAA 3OJBA 2EXKA 3AZZA 2A6XA 5JOXA 1AJOA 2NM1A 4XHBA 2ZMLA 5CNAA 5T54A 4U2AA 1YXWA 3SISA 3UJOA 5GM0A 3R4UA 1FAYA 2DTWA 1SBDA 1ULCA 4FPKA 3WDXA 3M3OA 3V0BA 1U0AA 1V6OA 1QDOA 1D0HA 1FX5A 1Q8OA 2R1BA 1GBGA 4YZ1A 3SITA 1DQ2A 3AP4A 3WNXA 1GNHA 4GWMA 3NV4A 2A3XA 1IS6A 3B9CA 4P9WA 4UW4A 1G7YA 3ZYRA 5SV8A 3AJZA 1UMZA 4XIOA 1N1YA 1FATA
chains in the Genus database with same CATH superfamily
2PHUA 2FMYA 2JENA 1GZCA 4YVWB 2Y6HA 4O9EA 1XB9A 4YGCA 1RUI1 2R16A 5L36A 4IERA 3AYCA 1X8EA 5ABJA 3Q8CA 3FL7A 1MVEA 1W3VA 5K0UC 2DCYA 1UXXX 1VBE1 3J8F1 1EAH3 2AEYA 2VNOA 3TEWA 3RFRA 2R071 4QHOA 2J42A 1ZZ8A 2XHKA 1MEC2 2N7GA 4R9DA 5C3OA 2WS91 5FP7A 3N9PA 3PVBB 1D4VB 4JKLA 5FCCA 5FZFA 3SEPA 4EQVA 5JMOA 5KHKA 1RUH3 3K4DA 5A3NA 3HBKA 1RUJ2 4RA0A 5AFEA 3MHZA 2R6QA 3WF3A 1RUF2 3ZSLA 1BLZA 5HCAA 4DPNA 2TEPA 4QHBA 2W47A 2QQUA 1MPXA 1NLQA 1V00A 1RUG3 2WABA 1HB4A 2JDHA 4PBPA 4I30A 1YNAA 3LE0A 4GALA 4AVTA 1OF4A 4IW3A 1UIKA 3N7KA 1NYWA 4PQ9A 4FTEA 1SDDB 4FFGA 3AYEA 2VECA 1OMIA 2BVVA 1QKQA 3KS7A 3RYRA 1FPN3 4RQPB 3AMQA 3WNOA 5CFCB 4HKLA 3AC0A 4P5HA 2ETEA 2YG0A 3M1HA 2PHRA 4QXBA 3T2QA 1BMV2 1YYNA 2E7AA 1RUC3 4FVVA 2DWRA 4YW1A 3VLBB 4D69A 2DUQA 3NV3A 4EJRA 3V0BB 1C3HA 5E16A 4FTSA 3WX5A 2LRPA 3DL3A 1HLCA 1XNCA 4NE9A 4QX7A 3UKNA 4E27A 4EN0A 1AXYA 4SLIA 2JG8B 3THPA 1IKQA 3B00A 1NAEA 1SCSA 4ES8A 2FMDA 2EIBA 5FPBA 1W03A 3Q8FA 3RYKA 1N3OA 4BQ5A 1OPMA 3I3QA 3AMNA 2JX9A 4KWLA 3ZXJA 2W9XA 4HVOA 2X05A 3UNPA 1WWYA 5I8SA 2HWC3 3WDTA 2JIGA 1ZRRA 1DGWX 4K21A 1QJX3 4XYXA 3UGFA 4BA6A 2WZR1 3QH7A 1DU3D 3MIHA 1GMMA 1S2BA 4UWDA 2F6BA 4B8EA 3ILNA 3LQCA 4CUAA 1SLTA 2Q30A 2X10A 1GLHA 4Q4Y1 2Q5TA 4UT5A 4KMQA 2G4IA 1QQP1 3FBMA 4MSVA 4BQ1A 1GZTA 4AVSA 2GP5A 3DGTA 1NQDA 2Q1MA 3ACLA 1YFUA 3JZVA 4E4ZA 5DAQA 2J1SA 2A6YA 1NE4A 1B09A 1J3QA 3THCA 3C7HA 5EP9A 4CXYA 3OUJA 4RR3A 3S5AA 2PXJA 3DEMA 1LOFC 3ZXKA 4A6SA 1YRZA 4BZ4A 2XHNA 1UU4A 3LIGA 4LKFA 3W59A 1CESA 3AK0A 1BBT2 3VHRA 4AEMA 3LSDA 1SPPB 4COUA 5F39A 4OZXA 1IS5A 4YW4A 5C9AA 4AGRA 4ZS2A 4CDUC 5JXHA 1POV1 4HG6B 3RZJA 1W3XA 3VD5A 1SFYA 4KG8A 3ZYHA 2BP6A 2XJPA 4PDWB 1E57A 1Y9GA 4CCMA 4ISRA 4LO7A 2VCBA 2Z42A 1H2KA 1NG0A 1OA2A 5FFOC 4IEQA 3MLJA 1SLAA 4H14A 2CGOA 2WC2A 2E63A 5GJ6A 1US3A 3N36A 3PJYA 5FY7A 1FNZA 1VBB2 4QPGA 4QU2A 4XQWA 2HWF3 5F3IA 5DG1A 5C5UA 4HMZA 1U5ZA 3VD9A 4YGDA 3RZMA 5FZ6A 4A2UA 4Z07A 2D3RA 1J3PA 2EVXA 2VTXA 4D8MA 3HR9A 4LO6B 1TE1B 5CISA 2D6NA 5FZEA 2XQRA 3ZVXA 2IFRA 3OYWB 2XB6C 3MIGA 4QQOA 3BTXA 4AXOA 3K51A 1GANA 2WNVA 3QACA 1JOPA 2G9FA 1ZVFA 3EJKA 4DB5A 4YRDA 4WM7B 5JXGA 1US2A 1RHI3 1ZNPA 3IKWA 4OHZA 3AL6A 4MZUA 4A4AA 4QX2A 5DN2A 2ZHMA 1AR71 1MS0A 1QJU2 4AF9A 1G8WA 3GHNA 2ZBJA 3CEWA 1RUOA 2Q8EA 3RMXA 3VKMA 3KT4A 5JVVA 1K5JA 1OOPC 1QJZA 2VCAA 2P3YA 3OB8A 3JBG2 1CGPA 4XW3A 1XJAA 3N35A 3I59B 5BNPB 4B1LA 4Y22B 4RS5A 4GD4A 2PAMA 4IETA 4PI0A 3MUY1 4MGZE 4O61A 2VJXA 2Z4FA 3BN6A 3H8UA 1W8OA 5A7NA 4MGKE 2RS13 4Y1UA 1W04A 1UW8A 3HOBA 1JUHA 4AW7A 2CWMA 1WMDA 2VR4A 1REFA 3WQ7A 4CCLA 5G04L 4LT5A 2F4LA 4IEUA 4QDSA 4YVSA 3E6CC 2XUMA 3M3QA 1MEC1 3MI8A 3WF2A 1GWMA 1R082 4TWTA 3WQ1A 4AFBA 4I01A 1LJ7A 4X6QB 3PTRB 1V0AA 1YFYA 1ENXA 1RUJ1 4Q0VA 4J1WA 2ES3A 1J83A 1VBC1 1H8TA 2GNMA 4XBQA 1GZWA 2CU5A 4GH4C 4YFWA 1R093 2XKPA 3ZX7A 4GJYA 4GB32 4KGGA 2DFBA 4LBLA 3CJIC 1H6XA 4UW6A 4Y20A 5FRAA 1CPNA 2EXJA 5FXWA 5A33B 1CAWB 4CPBA 1KS5A 2JEMA 3SQOA 4XQDA 3RJ2X 1H9PA 2YU1A 2VZOA 5J48A 1OFNA 3J26N 5DUUA 4CEWB 5JZGC 3NAPC 1Z7S2 4Z92B 2VL4A 5EYXA 4MGTA 1XPWA 1SG3A 1VE0A 3PNAA 1ENRA 1ZRFA 1RUE2 1G86A 1LULA 4YW2A 1KGYA 1SLLA 4C91A 4BLJA 2RMU3 2DF7A 1KQRA 3ZO0B 3HNMA 4Q4X3 2VZUA 1H8VA 4AFAA 1S0EA 1W2UA 4XTMA 3INAA 3I3EA 5IJRA 1W2TA 4O9GA 4XEZA 1VPHA 2WQZC 1ACCA 2R042 3GCXA 3MPPG 3VD3A 1Y9MA 4FO9A 2VU9A 5LASA 4S2GA 2PYTA 4OMDA 5C5TA 1GQGA 1W6NB 1TME3 4HKWA 4TYSA 1UU6A 1UY1A 4CDXA 4KU8A 4AVAA 4B3NA 3FHIB 5CFDA 4CXXA 2PLV3 4QPIC 2ERFA 4K8RB 4YG6A 5A3TA 3MFCA 2GH2A 1WCUA 4LBQD 3WEZA 3WVJA 4LKSA 3ZKUA 4BQYA 3P6BA 3AFGA 1MS5A 2Z69A 1URXA 2VMCA 4YM3A 1REDA 4WVMB 2F17A 2E51A 5GZFA 1XNBA 4IV1C 3WNMA 3VBSA 4IXLA 1K12A 3M2MA 5JCTA 3ZN4A 1TQ5A 1A6CA 4IQPA 1QOSA 5BNOB 2ZGRA 5LBFA 1RXGA 4XFHA 1GQPA 4F7ZA 1Q56A 2NMOA 1AR63 3CQOA 1F15A 3NW4A 1UF2C 4CEWC 2W46A 4CDQA 5FBJA 3AXDA 3E5XA 2K46A 1O8SA 1DZRA 1VMJA 2DU0A 4Z1VA 3QCWA 1JI6A 1EPWA 1FOD2 4LJHA 1C1FA 2JDKA 3NVCA 4LHLA 5F3CA 4AVVA 2D6MA 5FZ4A 1JU4A 1K5MA 3AVRA 2XVKA 3WDVA 2UURA 3JUUA 1QMJA 3GGLA 3VZMA 1KDKA 2QZ3A 4AHXA 3Q9OA 3ME2A 5A3LA 5BXXA 1O91A 2VVFA 4GQ7A 4WVZA 1J84A 1NXD1 3SXWA 3USUB 3DN7A 3POBA 2QQMA 3ILFA 2VMEA 3O5SA 3POGA 3M3IA 1HXS1 3OBTA 4RGAA 2J1AA 5IAXA 2VNRA 1TZOA 1ZZ6A 5LA2A 1YHFA 4LK6A 3V0AA 1O3TA 3VBHA 1NOVA 5GLVA 1S0GA 4EROA 1W8FA 5D8AA 1WLDA 5FPLA 3VBUC 5L9VA 1IS3A 5A32B 1W90A 2R30A 3SH3A 1NCRB 4E2SA 1UX7A 1QJU1 1X9PA 1UD1A 4FPYA 3F95A 1PMHX 1JH5A 1QXPA 2WNUA 4JGZC 3ZYGA 2WFF3 3BVCA 2WN2A 4EN9B 3AYDA 1WA4A 1ULDA 2GMMA 4ZONA 5IWFA 5IATA 2R063 4XBLA 1YIFA 4LR4A 4CRQA 4MO3M 1D0GA 3AP9A 1RUD2 1W2AX 4QB2A 2UU8A 3IWZA 4Q4X1 3T2TA 5C3SA 2W1SA 3P1IA 3VBOB 3D5OA 4XFAA 1ASJ3 5A7SA 3B93A 3WDWA 2V4VA 2FQPA 1ZBE2 4NOTA 3L9JT 3D3AA 2XBO2 1CD3G 1YIPA 4QX0A 1ODMA 4FTBA 3POWA 1SHWB 2DVAA 4XXAA 5C8CB 3VBRB 4FBFA 3D6EA 5JSRA 1PGL1 2HBTA 4AQ2A 3WP6A 1F5FA 1OUXA 2YXSA 3LCPA 1UYYA 3KD4A 1PIV1 2X09A 2BWCA 2B9VA 5K9YA 5JPNB 1BCXA 1Z78A 5K0UA 4H7LA 1ULPA 2ZX2A 1UX6A 4JQRA 4R9BA 2P6CA 3O1VA 4CTEA 1YJLA 1CIWA 3ST7A 4C90A 3LEIA 5LRSA 1DHKB 2RVAA 1NQJA 3AMHA 4MADA 1U5YA 2NZ9A 3URFA 4EYUA 1GQHA 1CAVB 3ACHA 1HRI3 1QJY3 2CNAA 4BISA 1DDLA 2WA4A 2QQOA 2YPDA 5JAXA 1VBA2 4WBBA 1RUE1 2Q4SA 2VVDA 2FDKA 1LENA 1A34A 4RR3C 1DYPA 1RVF1 4N53C 3WCRA 1HV0A 3VZJA 1OKOA 2AYHA 3E97A 5FYBA 4Q4W2 4XFIA 1IOAA 4K40A 1AR82 5ANNA 5ACA1 4CCOA 4HL0A 4QD2A 2SBAA 5EQUA 5AVPA 2FZ1A 3P3PA 2R041 2HWB1 1JUIA 1JS9A 1VR3A 1PX3A 4M0HA 2A73B 3PUQA 4BQ4A 5KBFA 2XONA 2ZHLA 2WO1A 1CX4A 3F2ZA 4JDNA 4OHVA 1U5IA 2A6VA 3D82A 4OI0A 5CKQA 4W6WA 4YZ3A 3QOPA 2CGNA 5FR3A 5KR7A 3VDDB 2W91A 4O65A 4HSJA 4QKNA 1LHVA 2L9LA 5GZEA 3ZN5A 2EICA 2PN5A 1ST8A 5IW0A 1PO12 3LEGA 2E7TA 3RQ0A 1JYNA 3SNMA 3WP4A 3U14A 1R1A3 4ZZ5A 4N43B 5L19A 2JDNA 2JDZA 3USSA 3B7MA 4CDWB 1GWLA 2JECA 3KCYA 3LB9A 1F4AA 1EV12 2PAEA 1LTEA 4GWJA 5GZGA 5HBAA 1OQEA 1CX1A 1MS8A 3B69A 4IGQA 4AZZA 5IVCA 1K3IA 1DQ4A 1LKNA 3RJRA 1OPOA 5FYZA 2FDIA 2AGSA 5EHDA 2DURA 1ND2B 4PBOA 3UKVA 4FSJA 3N9NA 1YCIA 1FOD1 2RS53 3IDBB 1Y43B 2Y64A 2Y38A 1LOFA 3I2DA 1GP6A 4XDPA 5DABA 3O1PA 1CONA 5IK4A 5A6ZA 5A7WA 3RWKX 1BQPA 5JSPA 2XJTA 3HBZA 5FPVA 2XG3A 2YFZA 4M3CA 4S2HA 1IS4A 1NA1B 5FZ7A 1JOBA 1WBFA 4QPWA 3S5QA 4XMAA 3AZZA 4ZPIA 5E6HA 2A6XA 5T54A 3UJOA 2Y33A 2QQLA 4RQPA 4CDUA 5CFCA 3PU3A 2VQAA 3R4UA 2XL7A 4MGIE 4G4FA 1FAYA 1O59A 4AFMA 3V0BA 1U0AA 1AYM3 2JD9A 2R1BA 4Y5SA 4GAZA 4YZ1A 2VZRA 3T0BA 2GZWA 3AP4A 1OF3A 3WNXA 2OIIA 2VMIA 1GNHA 4OULA 4P9LA 4YPJA 2Q1ZB 3NV4A 4UF0B 5JSOA 1LB2A 1COV3 4UW4A 4P9WA 1Q3EA 3W20A 1H8TC 3AJZA 1VAKA 4XIOA 3VL8A 3HT2A 3CO2A 2ZGUA 1C8M3 1J3RA 3ETPA 2W2IA 1F4HA 2RDSA 5BV6A 1O4ZA 5FY1A 3G6JB 3IB3A 2HWD3 5IFTA 2ZOEB 1RUD1 5T50A 4AEKA 4Q1PA 3RZLA 3AKPA 2ZAAA 4YG0A 2MPFA 2JJ6A 2VY0A 5DAWA 4CDWC 3ZOIA 1EY2A 1AL21 1VMFA 1WKYA 1UOBA 1QNWA 1LAJA 4LTAA 3TNPB 2J22A 2XBO1 3N9QA 2IXJA 4IE5A 5FKBA 4ET7A 1X9TA 3GHMA 2FCVA 1PVC1 1OOPA 1Q8SA 5LATA 1GZ9A 3ZXFA 4HETA 1ND2C 1FNYA 2ZHNA 4Q4V2 3WG3A 1N1VA 4M3CE 4RHV3 2DYCA 2RS33 5JOYA 4COVA 1H1AA 2WQ4A 3M70A 4XC9A 1RITA 2XJVA 5DXDA 2K9ZA 2ET1A 3MGUA 1ZBA3 3TN93 4P00B 5DDJ2 3G7DA 3CJXA 3B94A 1L7LA 4MV2A 4NRMA 2CTVA 2C26A 5KXCA 5FYSA 4KBZA 2B4KA 3TWIA 1KXGA 1AX2A 2D3SA 4CDXC 1AYN1 5IVYA 4Y26A 3MF6A 1BHGA 1REEA 2VNVA 5FZ1A 2WFPA 4Q1RA 4ATFA 1TMF1 2XJUA 3HVDA 2MHFA 1ZREA 1VBE3 3J8F3 1RB8G 4QM9A 4XHXA 2D6LX 1GKBA 2R073 1TEIA 1ZZ9A 1WA6X 2BJSA 5T5PA 2JICA 1OH4A 2BVBA 2WO2A 4IEWA 4QKBA 4BK5A 1PZ8A 3MICA 4GH4A 2ZGTA 4UFMA 3UL2A 2WS93 3CJIA 2AACA 4PLOA 4Q4W1 2Z5WA 3D0JA 3RS6A 5A7OA 1AL0G 2DVGA 4WM8B 1UZYA 4HN1A 3NAPA 2D6PA 3BOPA 5LA9A 4WM7A 1H6YA 4NPRA 2XKOA 2B45X 3RI8A 3BODA 5KHHA 3U37A 4LPLA 3IDCB 1GV9A 3PMSA 3WG2A 2OPWA 1YQ5A 2P3KA 4YZ5A 4E2GA 4Q26A 4CP9A 2TUNA 3MEPA 4EZ4A 2HWE2 3T1MA 5BNPA 1XNAA 1PO22 3I59A 3L2YA 4Y22A 5HCBA 5AC92 3SKJE 3PUHA 2CGPA 1RTVA 1OBNA 4PHZA 2JG9B 1H2MA 1N1TA 1PO11 1X33A 1AR92 1D4M2 1OKQA 2CSGA 3ACGA 1LHNA 4AAPA 4UOJA 4ARYA 2QQPA 2VMFA 2NLRA 1LODA 4BOWA 2GSYA 3VBHC 4AAXA 2GH8A 4XPVA 1IPKA 3IMMA 2OA2A 3KGLA 4LO8A 3AKRA 4D3WA 4FFIA 1F9KA 3GZEA 3T30A 4FXGB 1EUTA 1L7RA 1LGCA 5FPZA 4F83A 5GKAC 3LFIA 1IKPA 2GALA 5LBEA 3JCIA 2WNUC 3WR0A 5IT6A 4FPFA 3J7MA 2BGCA 2E33A 2WZR3 3FLRA 2DCJA 2BQPA 3RMYA 1FMD1 3A0KA 1KFUL 4Q29A 4CVUA 2ZKNA 1F5JA 1QXRA 1EAH2 1Q8PA 2O8QA 4Q4Y3 5GZCA 1QQP3 2QBXA 4QB1A 1LGBA 4C8DA 5A33A 4XJ9A 1HB2A 5F37A 5FV3A 4IEPA 4P9JA 4H55A 1CR7A 2D5HA 1UZ0A 3MBWA 4CEWA 3KF5A 1WBLA 3AVSA 5KC5A 1RUH2 2RR11 5EIYB 5KXBA 2QQNA 2Q1FA 4NHXA 1QWRA 3E6BA 2VOWA 4EV0A 1RUG2 1CAXA 2ZACA 4HKOA 3ZXGA 4LBKA 1B35C 2OUHA 3MW4A 3X29B 1ALYA 1H9WA 3NNMA 5FUIA 1HDKA 1E5SA 1POV3 2VQTA 5FZCA 4CP0A 3CNAA 3HQRA 4BDVB 3FBYA 1ULOA 2A1XA 3BPZA 2QQJA 2ZGSA 5L7OB 5LY1A 2QCSB 4DIQA 3N9OA 4KQ7A 1FPN2 5LW9A 4R8HA 3OGGA 4NHKA 2WZ8A 4FQZA 1RUC2 2QUOA 2HKXA 1PNGA 2NPIA 2OZJA 3M3EA 3B01A 4WV8A 4HPKB 2J1UA 1W6NA 3VBUA 2ZGOA 2OKXA 4DEVA 1BJQA 5DG2A 3K48A 5FY4A 3W9AA 2VOKA 3S7EA 4CUCA 3ZR6A 5FXZA 1FXZA 1PX4A 4XIKA 4FPLA 1HRV2 1JU3A 4JGZA 2ID4A 5FBZA 4FPHA 2RG4A 3EMRA 1OUSA 1NE6A 3OGSA 4Q4V1 3SHRA 3SKVA 4R9CA 4SBVA 4WVMA 1V6KA 1ZRIA 1V6NA 2GAUA 3FHAA 3HQUA 3KCXA 1AR73 2I45A 1QJX2 4DMIA 2Y0IA 1BK0A 3KCCA 5GLZA 3VV1A 4FAHA 1OHFA 3THDA 5BNOA 1N47A 3I2KA 4OVEA 4DRVA 5I0SA 2K0GA 3CMGA 3BU7A 3N7JA 3ZDSA 1DP0A 2YC4A 1RXFA 3KV9A 1I9RA 2KA3A 1QXJA 1UYPA 3E5QA 2A5ZA 2A75A 5A70A 4PI2A 4AFCA 4XMIA 4LBQB 2OYZA 3AZYA 1UXZA 4XJWA 2O1QA 4JVAA 4XUNA 4YVWC 2GC1A 3OD4A 2JE9A 4Y1YA 3VKLA 4H7MA 5JPMB 2WNOA 4PJYA 5BNNB 3K77A 4YZ4A 3ZIXA 1UL9A 2IXLA 4A3ZA 4CCJA 1MEC3 3I2IA 4UXAA 1W2OA 3USUA 2H0BA 4IGOA 1W8ZA 2QZ2A 4Y1ZA 3ZN6A 3NSTA 4YW5A 2ADEA 3GBGA 4LBOA 1RUJ3 1DZTA 4NIGA 4TN7A 1WMFA 3C2UA 1VBC3 2OXBA 3POEA 3I97A 4XUTA 5LEKA 3OCPA 1KRIA 1OQ1A 4FPCA 5FZMA 3TEXA 5H9PA 1NCRA 3HT1A 1W6MB 1DQ1A 3KHBA 4L11A 5LZ6A 4N53A 2HLEA 2W0XA 3WNNA 5BUVA 2HWF2 5FZOA 4AEDB 2VUJA 3B02A 4LLFA 2AR6A 4GZ9A 5F6LB 3AP5A 4QDRA 3KVBA 4JCKA 4E2QA 5CFCC 4J6GA 4RQPC 5J37A 1XC6A 1DGLA 1K45A 5FO7B 1RHI2 5AFBA 5KWRA 1UWWA 4MVTA 2PQSA 3VZOA 4CP2A 5HV0A 3MIDA 1W6QA 3A7QA 4QAWA 2W39A 2FBEA 2JG8C 4TLGA 4BIFA 1E5HA 2HEYF 4W65A 2OUJA 5FZDA 3BTZA 3IMNA 4LKEA 4UFJA 5APAA 3ZSJA 4AWDA 3VZNA 3LSEA 2VAUA 4AVBA 2P1BA 3R4DB 2E53A 4Y1XA 3T09A 4DS0A 1PZ7A 2VNGA 3LA2A 5BNNC 4M01A 1JZ4A 2P2KA 4YW3A 5C4WB 3T3YA 4WZFA 2PHLA 2ZGQA 4MX3A 3ZFGB 2C0ZA 3THTA 3V64A 3TBDA 1NY71 3BTAA 4ITCA 1G9FA 3U4SA 2HYKA 4DINB 4BH9A 3MZHA 3FE5A 5T55A 1JZ2A 1O8PA 4A44A 2MEV1 3EO6A 5J96B 1SDWA 3I2JA 1CAVA 4K8FA 2DTYA 4CCNA 5JLVA 2Q8CA 1WUVA 3J7LA 2JKBA 2ZZJA 5TSWA 1EPZA 2WDBA 3RDIA 2ZGMA 3UESA 2GMEA 1XSQA 1R092 2YFUA 4ZHNA 1MS4A 1A8MA 2P37A 2ZGNA 1PVXA 3BOWA 2PELA 1SBEA 2XWJB 1DIWA 5IK8A 2VMGA 4DOUA 4NR1A 3HAGA 3RWNA 2JE7A 1VALA 2PMWB 4YW7A 3UYJA 2ORZA 1ZRCA 5FP8A 2BPA2 3C7OA 4LA2A 3OD0A 2KM2A 5A6QA 3KLSA 4PDWC 4XUPA 2DFCA 3LPGA 5DMYA 4QQ2A 4AI1A 2CY6A 1QH6A 5JIAA 3EXUA 4W8JA 4RSUA 4JHTA 3GM8A 4OZOA 1DQ5A 1SLCA 2RMU2 1V9U2 1JYCA 2YY1A 3PURA 4BB3A 1UMHA 4TZDA 1RUF1 3NO8A 5LEJA 3VDDA 1LEDA 1S2EA 4FQ4A 5K7PA 2NN8A 4QM8A 1HRV1 1AVBA 4NROA 1HXS3 4XACA 3TEZA 4AQSA 3KV4A 1IPJA 4LHKA 3CHXA 3VGIA 1W06A 5I8YA 1DYOA 3ZMNA 1GNYA 4N43A 1QJU3 1LOGA 1HJFA 2Y6KA 2AENA 4TLFA 1OLMA 4CDWA 1BMV1 3KMHA 4WM7C 4Q8KA 2VW1A 3GZAA 2PLV2 1OLQA 4LKDA 4Q27A 2VH9A 4AI3A 4B4QA 4Q0PA 3VKOA 2WAOA 1G9DA 2CHHA 1R1ZA 5C70A 5FO9B 2XXZA 1BZWA 2D44A 1ND2A 5KXDA 1BVP1 2IFWA 4IEZA 4D6QA 3IDAA 5BNPC 5CAZA 5F6KA 1LR5A 1AZDA 3BGAA 3IT8A 3HNYM 4TTGA 3MW2A 1XE0A 1CZTA 4NHMA 3S30A 3IAQA 3CZUA 1NA1A 2D93A 3VDAA 4ATEA 1SMVA 2CDOA 2OS2A 1ODNA 2YC2A 4KG0A 3VD7A 5FQ0A 4XUQA 3T0DA 1VRH2 3E1F1 2BBAA 2VOVA 1SLBA 2G9GA 5JDBA 3AJYA 1GOGA 2RM22 1PIV3 4IE4A 3ZPYA 1IG3A 2P3JA 3CBNA 3FX3A 4AEJA 5H9SA 3RZKA 4YWAA 4HZFA 1CJDA 5EXOA 1LU2A 1LHWA 1D7PM 4XJUA 4CE8A 2LALA 4DZGA 5I0RA 3LOBA 5I91A 4FI9A 3P3NA 2SLIA 4X6RB 1YFWA 3AFKA 4ZXEA 4NMIA 3KT7A 5FREA 1W9FA 3LD8A 4MH0E 5DZFA 1BBT1 4LBMA 1BEV2 1STMA 3UT0A 2FD8A 1RUE3 2HBUA 4MG2A 2HYXA 5F5QA 1RYYA 2HEWF 1RVF3 2XJRA 2G19A 2A71A 2Y60A 4DRRA 3POIA 2Y6JA 1W39A 1UIJA 3AZVA 1TG7A 3TAYA 4F3JA 5JMCA 2JDYA 2WLPA 4XFGA 2ZHKA 5ACA3 4XE9A 1S0DA 4LEJA 3FZ3A 1G6NA 1G9CA 1JYIA 2WFF2 4OI1A 4IDZA 3N7MA 5L9RA 3U4XA 1X50A 2R043 2HWB3 1VBB1 5F9TA 3WNLA 3ILRA 3JQWA 1UKRA 1ZM1A 3HPNA 4I0WB 4AHYA 1BXHA 4NRPA 1UN1A 3D4KA 4DQAA 4ISQA 4AHWA 1XYPA 1P8JA 3IPVB 5FZ3A 3GF6A 3OPZA 3OJBA 1VB4A 3K75B 2XDVA 4MGSA 5I0UA 4XHBA 2ZMLA 3SISA 3GDBA 3T2PA 2HEVF 1SBDA 1ULCA 4FPKA 4NIDA 2PAKA 3M3OA 3KV5A 2D98A 2LW8A 3SITA 3JB4C 3PU8A 3RYPA 4AG4A 3EB7A 4GWMA 2YUEA 1OQDA 1T6BX 3B9CA 3JBG1 5F5IA 5SV8A 1SFPA 2VM9A 1HN1A 3GCWA 2EIDA 1LGNA 2CV6A 1ZZCA 1K42A 2FDGA 1WW6A 1OXCA 3MIBA 3MW3A 5IYYA 1I6XA 2OT7A 5KHGA 1NKGA 3NMBA 4GKYA 1R64A 1FI2A 1UZWA 4QDQA 3FMGA 4CUGA 5BNOC 2R0HA 1EP0A 1OD5A 3PVEA 5SV5A 1GR3A 1FOD3 1UPIA 2YDEA 1UNBA 3EHKA 3PVNA 4OLLA 1HRI2 1QJY2 4GJZA 3UGGA 4BU2A 1I1EA 2CWSA 3CL1A 4IV3B 1WCKA 4LBJA 4L8QA 4OUEA 2YPJA 3E5UA 3WP5A 1HIXA 1R081 2OZ6A 3HWJA 5LA1A 1B35A 2OPKA 2AH2A 3QH6A 3K3NA 2D6OX 4G9SB 1F35A 2XJQA 1V9U1 4IEOA 4RD7A 4URTA 1CAUB 4B4RA 2E6VA 1RUNA 5J1XA 2VO5A 3OG2A 4BXFA 3WCSA 3L2HA 4QXHA 4LA3A 2X5IB 2DUPA 4GB31 4I09A 4QQLA 2JG9A 3NNLA 4J25A 2BFUS 4KWUA 1GYKA 1S0BA 3AZWA 3WG1A 1T6GC 4QMAA 5CEHA 3H0OA 2X29A 5C8WA 5I93A 1MQTB 2VW2A 2JB4A 1Z7S1 3PDQA 4MGYE 5C3RA 1VP6A 1JYXA 3ETQA 2OQ7A 1O5UA 1V70A 4FOYA 4LBNA 1RMU2 3BALA 1NCRC 2ZPXA 4L92A 1IG0A 5IUQA 4NIAA 5IHRA 4BHPA 1WCQA 2PHFA 4NO4A 1SZBA 1RUD3 2EIEA 1MZEA 2CAUA 2VC9A 2ZAHA 1AHSA 1GOFA 1PGW2 3N3HA 5KXEA 1S0CA 2WNVB 1E5IA 1HB1A 5I8TA 4JC1A 2VZTA 3WNKA 3CDZB 2D3PA 3WW1A 1AL23 4KBBA 1WD3A 1R1A2 1TNRA 3JQXA 4XQ4A 1XNTA 2XBO3 1NCQB 4EWDA 3H3LA 4BLIA 3VBOC 2QE3A 1PVC3 1OVPA 3HIFA 1VRBA 1GOHA 3AP6A 4XUOA 1W9WA 3C8XA 5F3GA 1LOCA 3VKFC 3WG4A 2ET7A 4CCDA 4LXLA 2XQXA 1VRH1 2W1WA 2WT2A 3I3BA 3H50A 1JTZX 4RS5B 5FK7A 2XH6A 2VGDA 3ES1A 3FLPA 3OY8B 2YROA 1KD7A 4B4PA 5KHJA 4HVQA 2RM21 4WVWA 1VJ2A 5C8CC 3VBRC 5F7UA 4JTNA 2RS52 1HW5A 3EBRA 1UYXA 4YVWA 2XVGA 1MZ6A 2IXKA 3FN9A 2PHTA 5M0TA 2WT1A 4BQXA 1CJPA 3S0MA 5CADA 1VBD2 4YVSB 3WDUA 5L7OA 1NXMA 2BZDA 2XWBB 4JTOA 5FP9A 1AYN3 5EWSA 1UY3A 1WCDJ 4L99A 2RHPA 3PL0A 3T0AA 4OI4A 3DYMA 4K9SA 3WP3A 3KT1A 1TMF3 3APBA 4K7JA 1OVSA 3ZDVA 2WZEA 3M3CA 1AYM2 1T2XA 4A3XA 1UKGA 4HPKA 4QXKA 1Q5OA 3ENRA 3WHTA 1MQTC 5B4NA 1PMJX 2ZX1A 2AEZA 4URAA 2JDAA 3WW3A 1COV2 3VN4A 3CU7A 4Q4W3 4YM2A 5H9QA 3VDCA 2IWGB 4P02B 1C8M2 3WY6A 3H7YA 5FPUA 3AKTA 3SH5A 4E8DA 5JOWA 2VE1A 3W5MA 2B42B 2HWD2 3OTFA 4L97A 2AUYA 2WO7A 2H6BA 4MGQA 4DUXA 5IVJA 2E32A 5DUXA 4QX3A 3S57A 1WZXA 1MZ5A 2QDNA 2GC3A 4L2NA 2JD4A 2PFWA 2W68A 2XMLA 3GJBA 3NL1A 5FLJA 5HXVA 5EFUA 2CDPA 2TBVA 5FUNA 4BIOA 4PQQA 5FMOS 2JG8A 2WUHA 3LWCA 3OSDA 2VQ0A 4XAAA 2ARBA 4LBQA 3NJZA 3VDDC 3H1MA 4RHV2 2R0FA 1PO13 4PCRA 2W5FA 2RS32 2UYAA 5FY5A 4QQHA 2QDRA 4AI0A 5LK5A 4BMBA 5BNNA 1A8DA 1NZIA 1WW7A 3ZYJB 1ZBA2 2B39A 1UO9A 3KWVA 4IL7A 4XOGA 3IIIA 3TN92 4D0QA 4EN6B 1JZ7A 3KF3A 4CEYB 1I5PA 3WW4A 4N43C 4XXPA 3WV6A 4EE2A 5A1FA 4LO5B 4ASLA 5DAVA 3LEMA 1QOTA 5B4XA 3RRDA 4AE2A 4C1XA 4A45A 3U11A 4DXTA 1J1LA 2ZMKA 1RUI2 1QIQA 1OA4A 3PJQA 1DZQA 2DBIA 1ZBE1 2BU9A 1OD3A 5E88A 4ZS3A 1WW5A 5CYYA 1DYKA 1FMD3 2QQWA 2VTXJ 2Z79A 1W05A 1JZ8A 4CZSA 1JYTA 2P34A 1TVGA 2XLAA 3KQ4B 4P14A 1VBE2 3J8F2 3VBSB 4DEQA 4N90A 2WR9A 2R072 4KU7A 3POSA 3N9LA 4MHRA 3KV6A 3ON7A 4LUKA 4KI5M 2TNFA 4MXWB 1O3QA 4AEDA 4ORFA 3ZXEA 1NA1C 3KHCA 4UI9L 2RR13 1SPPA 4XJ8A 5A1AA 4IESA 4KH9A 1GUIA 1Y4WA 3O1SA 1N3QA 2FCTA 3WUDA 1H4HA 1JXNA 1PK6B 1LU1A 3POYA 5EYYA 3WLUA 2YC0A 3ZSKA 4LQRA 5A3PA 2BERA 4PDWA 1K5MB 3ECQA 1OT5A 1EUUA 5HCFA 3NNJA 4JGYB 4B1MA 3VBFB 3BCWA 5CG9A 5FPAA 1QHDA 2I74A 2JE8A 3Q8AA 4ASKA 1KDMA 4D94A 3DPRB 4FFHA 5A80A 1ENSA 3A22A 3MO4A 4EZHA 3DYOA 1RMU1 1VBA1 2IXHA 3WF4A 4ONUA 4COYA 3RZHA 5CZKA 4JDMA 2XJSA 4Q0SA 3N4MA 5CKNA 1LNSA 5KHIA 1C4RA 1PGW1 1UOJA 2NYYA 3DCQA 5FJHA 3VZLA 2BOIA 2WA3A 5FYIA 1H4GA 5F2WA 5JI7A 1AR81 3GYDA 1AF9A 1V6JA 3AMPA 5C4WA 2HH9A 3ZFGA 3ZXLA 3OYWA 4HANA 4ZZ8A 4CEYC 1OI6A 3NKGA 1LRHA 5T52A 4I0AA 3FJSA 2J7MA 4AQTA 5CA6A 2RV9A 1S55A 3ELNA 3JD72 4CA9A 3O1OA 3HEIA 4Q4V3 4MOAA 4QU1A 1RJ8A 5C3PA 4C0BA 3C7GA 3V65A 3T1LA 4OHYA 2BNMA 2WZR2 4FOQA 3W5NA 1NLSA 5A7QA 4Y5Z0 4XZPA 3BIEA 2YMZA 4V2WA 1MS1A 1TNFA 4Q4Y2 2ZEXA 3EYPA 1QQP2 4HXCA 4I3GA 1V6IA 5D21A 1VBD1 2ZABA 1O3SA 3CF6E 3J9SA 5FYUA 1X8MA 1ND3B 5EJZB 4MYEA 4INDA 1PK6C 1UAIA 2V72A 3CLPA 4FP3A 4CU7A 3LOIA 1EV11 3AM2A 2A3WA 5HPOA 4YYOA 3GZUC 1KFXL 4HOOA 5E89A 4XDOA 2EF6A 1O5LA 2EXHA 2H6CA 4NJ4A 4AFDA 1W8UA 3VL9A 3W21A 2CYFA 4OQ8A 2AREA 3KSCA 3U10A 4CSWA 2HJIA 1QY4A 5EJ1B 2UYBA 1ZA4A 3ZYBA 3VZKA 5E8AA 2YGLA 2W87A 5D2AA 2B8MA 3FUQA 4QKFA 1Q8VA 1AXZA 2O8OA 2ARXA 5FLIA 5GLUA 1XU1A 1CAWA 2LS6A 1PM4A 4R9AA 5D1IA 5DZEA 5FWEA 2IXIA 3LZZA 2Y6GA 1JODA 3ZMOA 4WM8C 5JIUA 4ZY9A 3KGZA 3OBAA 2Y0OA 4GXLA 4HN0A 2LUWA 4Y33A 3HN1A 1WW4A 3ZSMA 1H2NA 2JDPA 3H42B 4JKKA 1UU5A 1H30A 1SBFA 2ILMA 3U0ZA 3MYXA 3NV1A 4CPBD 1GP5A 5BPXA 4N7UA 5H9RA 1Y7BA 1O7FA 1QEXA 4I02A 3J4UH 3J7NA 4K1ZA 4UBGA 5EPAA 2WSUA 5K4LA 5J09A 4QPYA 3A23A 1S0FA 3DYPA 3WZ1A 3SCHA 1WLCA 1AR72 5LA0A 5JOZA 3V56A 3ZFEB 2DBNA 1N1SA 5DUWA 1IGOA 2JG9C 1OLRA 1Z0HA 3K46A 4DNYA 5JUVA 5ISLA 1J59A 5IVBA 2D5FA 1JZ3A 4QWNA 1XE8A 4I2OA 1SACA 2CL2A 3H3UA 1ND3C 1JOJA 4GMP1 1RIRA 2VTFA 3FLTA 5FMCA 4BYYA 1Y9QA 4PLNA 4P9YA 2J1EA 4GMP0 4RGGA 3ZXAC 1MVQA 1W8TA 2BGPA 2GN3A 4XF4A 1RGSA 4XBNA 4ZKTB 1JZ6A 1BVVA 4BK4A 1O4TA 3T4VA 1H2LA 2HWC2 3LFMA 5FYCA 5CBLA 1W28A 4NWWA 3CIHA 2XR4A 3EQEA 1MR5A 5FOBB 4G3YC 2MEV3 4E4SA 2R32A 3TRSB 4LOTA 4YFZA 2XLGA 4FPEA 5FDBA 1H0BA 3HD8B 3KB5A 5A3UA 1JMUB 2WIIB 2G1MA 1M06G 4OYUA 2LM3A 5DDJ1 1ZYBA 2WO3A 4FT8A 1FT9A 1VBC2 1UPSA 3J7HA 3DXTA 3I4IA 1POQA 1W6OB 3LDRA 4D7TA 1PHMA 4EN7B 4F8AA 1WD4A 3BIWE 2PQQA 5LY2A 4BQWA 4HK9A 4JRLA 4BE3A 2W1UA 5A7WB 1MS9A 3OEAA 4XFCA 5EZWA 3NQHA 2BEOA 4M3CB 4HONA 4XABA 5A3WA 1HKDA 2FCUA 1XXNA 4IEYA 5T5OA 3T08A 4CYDA 4XJZA 3VHPA 4CDUB 4NUBA 4Q2FA 4RFRB 4NPLA 4RN5A 4QB6A 4JQTA 4BXSV 5L7OC 3LDKA 4LE4A 3TYJA 4DY3A 3TNQA 2VBDA 2VXJA 5FZIA 4EN8B 3ZFEC 4KWJA 4YZ2A 2Y6LA 2ZS6B 3AX4A 3IPVA 2YGMA 3OUHA 1CZVA 5FYMA 1RUF3 1S4CA 3C7FA 1LECA 1H1IA 2VQUA 3LA7A 4NIIA 4XAEA 1HRV3 4BM8A 3POJA 5A32A 4C0HA 1SEFA 3NV2A 1DQ6A 3JD71 1Q8QA 2Y8KA 1JHNA 3FHQA 4K6BA 3ASIA 2OQ6A 3PIJA 1HJGA 4X8NA 3DF0A 3SMHA 1YI7A 1A3KA 2RJLA 4FFFA 4JHZA 4K1YA 5FZ8A 5DPNA 2HWE1 5IVFA 1PO21 3QLQA 3SC7X 3MIFA 3WSOA 5AC91 4XCBA 4CU8A 2W95A 4GIQA 1ZZBA 4UFLA 2ZGLA 2WYFA 3RVHA 4LULA 4A7ZA 4UAPA 4BWOA 3VBOA 5L73A 1OOPB 2PHWA 1AR91 1D4M1 2VD7A 2E31A 3ATGA 1DBNA 2ENRA 1G9BA 3OOXA 2I07B 4AQ6A 1J1TA 1UQXA 3MLKA 1UY0A 1RL3A 1AX1A 2VBPA 2IC1A 3AKQA 3ORJA 4RYDA 1XYNA 2DUOA 2UY9A 5C8CA 4IV3A 3VBRA 4FPJA 2IXCA 1W6PB 2BV4A 1XQNA 4XF3A 3BPSA 2Z2SB 4OFGA 4HT1T 1XNKA 4YGBA 5FP3A 1VLNA 3A0NA 1QJEA 3CKHA 4I3PA 2V5DA 3K3OA 1CAUA 2DVFA 1ZA7A 4PLMA 3TOJA 5K8SA 2C4XA 3TB0A 4JDOA 2RS12 4AI9A 2JWPA 3B3QE 4P9IA 1POV0 2ZA9A 5FIXA 1YC61 3VDBA 5FZ0A 4IE0A 1EAH1 4HK8A 2X5IA 4TXWA 4D6SA 4LUMA 2VCCA 2ZGPA 2EAKA 3RNSA 5CB7A 4DXSA 1ONAA 5BY5A 1H1MA 2YHJA 2UWAA 1YWKA 1J58A 3HNBM 2ZXQA 3NJYA 4KNCA 2EXKA 5JOXA 1AJOA 1MQTA 2NM1A 5CNAA 4GH4B 1RUH1 1YXWA 2WRAA 4U2AA 3I2HA 3U07A 5IAVA 3CJIB 1F2NA 3WT3A 5CU1A 1KEXA 2D40A 1BBT3 3M7AA 1QDOA 1Q8OA 4XETA 1RUG1 1HXS2 4XFFA 2D97A 2VZQA 5JR2A 3BUCA 2B9UA 5FLHA 4AEDC 3LF7A 1W9SA 5FMDA 2Q8DA 5JZGB 4OCTA 2A3XA 2BUKA 3NAPB 5FXVA 2VG9A 4ES9A 3ZYRA 3R0RA 4LIUA 3IBMA 1XE7A 1N1YA 1KS4A 1I5ZA 3E6DA 4FPOB 1L3JA 1FPN1 4PIXA 3SEEA 3WF1A 2WL1A 1LHUA 1NCQA 2UWBA 2YB7A 2EA7A 4Y24A 3ZKYA 1C57A 2FHRA 1YI9A 2XUEA 4LNVA 1RUC1 4CP9B 1G9AA 5LCWL 4Z82A 1VBB3 2EIGA 5LWBA 4Y4YA 1W8WA 4HBNA 2VZPA 3OY8A 1XOYA 4Q4X2 1CZSA 1BKZA 4GULA 4CCKA 2VZ3A 1YFXA 3K2OA 1VAVA 5E1RA 4NN0A 5J98B 5DQ0A 1W99A 4AR2A 5JXIA 2QVSB 1S1AA 2XPJA 5DAPA 5DAXA 4XILA 2A3YA 4ZU4A 4BJ0A 4EWAA 3PTYA 1FYUA 1O3RA 2HWC1 4WZCA 3PLQA 4H3WA 3KVAA 1A78A 4QPIB 5FYYA 5C4WC 1W9YA 3ZFGC 1QJFA 4BQ2A 1PGL2 1TME2 1QJX1 3AYAA 2XGXA 5A3OA 4WVVA 2B46X 3OGJA 4KWKA 3HQXA 3LDBA 4JRAA 1C5HA 2DCKA 4L9BA 1PIV2 4QT6A 2BW8A 4ZU5A 4COZA 3AXEA 3JBG3 2VMHA 1QH7A 3KZ4C 1OH3A 4XDQA 4NPMA 3RZGA 5LBBA 1NLRA 2K2SA 4IV1B 4QXCA 1YQ2A 1QGLA 1S0IA 5FZ9A 4Y4RA 1Q43A 4OI2A 3K4AA 2ZJCA 3ZSEA 1LOBA 2J1RA 5A6YA 3QBQA 2QNKA 4UFHA 2PHXA 4DY5A 4W6YA 4FOVA 3IIAA 4FOWA 1W8NA 4Q5OA 5A7PA 1JYWA 2R1DA 5LB6A 2WNEA 3W58A 2ORXA 5FYVA 2B5HA 3ZFFB 1F8VA 1UMIA 3MV11 4V2VA 2OX0A 1AR62 1IHMA 4XF0A 1R083 2BDRA 5FY8A 2F4PA 1RVF2 3RGBA 1AX0A 2FZ2A 1CAXB 1JYVA 4U36A 1KITA 1V9U3 1DFQA 2GNBA 4CUBA 1LOEA 2VUCA 4JKMA 3ZYFA 5ABJB 1O4YA 1OFSA 5FO8B 3BYWA 2A7AA 5ACA2 5F5CA 5FOJB 4JX0A 1C5IA 1LEMA 1PGSA 1HQNA 4UF0A 5A1LA 5BNQA 4GB33 1AUYA 5FXXA 4KL1A 5FYHA 1BK1A 3OGRA 2HWB2 3S7IA 3FFZA 1UY2A 1WGPA 3AP7A 3VHNA 3JU9A 2BBVA 2HWF1 2X53S 1YO8A 4QKDA 3VBUB 3AL5A 3WNPA 4XJAA 2Y34A 1Z7S3 1X36A 4LMFA 1OLME 3M4FA 1NUKA 4P9GA 3SLIA 1EYBA 2VXRA 4A41A 5J36A 4CEYA 3R4SA 3HMYA 4UW3A 4QX8A 1JHJA 3BTYA 2W52A 1CN1A 4AOCA 4JGZB 5GALA 4W50A 3IAPA 1IPSA 2D43A 1RHI1 1NX9A 2BTVC 1DG6A 3GBWA 1QU0A 3GXUA 5EJ3A 4H2AA 4BCUA 4TSVA 5FK8A 5C6CA 4CXWA 2VPVA 2V4AA 5ERLA 1QF3A 4CCCA 2WKKA 1OSGA 4Z8BA 1XBFA 3GALA 3O12A 5F32A 4C1WA 5CVRA 5FUPA 2R062 5FY0A 2DVBA 4N9IA 2H0VA 4MXWA 5CIRA 4AYUA 4E4DX 1KJRA 2YU2A 1ZX5A 3LEKA 5I0TA 1VRH3 3AMMA 1DGRN 1DLLA 2QJVA 2WQ8A 1AJKA 3PIGA 2ADDA 5FZGA 2RS11 1ASJ2 1C8NA 1GNZA 4LHSA 1JZ5A 2RM23 5F2SA 2FDHA 3ZFFC 3SCFA 1PK6A 3CZJA 1OC1A 2PTMA 2MNGA 3HJRA 4LHNA 4R4XA 4RFT0 3HN3A 2WYSA 4NIHA 4NHLA 4META 4XURA 4M4PA 3GBFA 4JGYA 3VBFA 2BYVE 5ABJC 1S2KA 4OMCA 4AI2A 1Y3TA 3FC0A 1N3PA 2W92A 3DPRA 2VOXA 3NJXA 2ZX4A 3ZN6B 4YARA 3K4ZA 4ASMB 2JDMA 3NNFA 5J3UA 5C7GA 1CQ9A 1APNA 1BEV3 4UBHA 4UW5A 1C1LA 4NRQA 4YGEA 3U75A 1F31A 5FY9A 1R091 3PUAA 2IVIB 5FJKA 4ZXKA 2JXAA 3ZYPA 1W0OA 2QQIA 5FZBA 4DXRA 2WWJA 4PF1A 3S6PA 5JR7B 3OEBA 5B2GB 4I0BA 1PZ9A 1SFNA 1YJKA 2EXIA 2C1FA 1YQ8A 3I2FA 4WM8A 2IUWA 4AHZA 4CP1A 4RR3B 2O14A 3NRUA 3PMEA 4N53B 4W4ZA 3H8XA 4QGMA 4XTPA 2W08A 5FZOB 1FV3A 4ZU7A 3LIHA 3B5LB 3N7LA 2VZVA 1SLIA 3OBZA 1VMHA 1WMEA 1D2SA 5FTTC 3U1XA 4L0PA 4YLZA 3WQ0A 4JAAA 2C24A 1GWKA 2RMU1 3WQBA 3ZR5A 5C9AB 4OQ9A 2GMPA 2B7YA 3ZM8A 3Q8EA 2GNDA 1PNFA 2VBBA 4K20A 1AL22 1RINA 2G9ZA 2ATFA 1WMXA 2KXLA 2WSVA 1ZRDA 2GU9A 1YUDA 1CPMA 4NAOA 1W6QB 1PVC2 4OUSA 4AI8A 4BPZA 4P9XA 4R4ZA 5AVAA 4GWNA 3H9AA 3DKQA 4GKXA 1ND3A 5A3MA 1TME1 2GP3A 2VUAA 4QPGB 1LHOA 4XF1A 3MPBA 2P3IA 1NZCA 4S2DA 2PLV1 4ARXA 3PHMA 3B9IA 2RE9A 4FXKB 4B7EA 5CG8A 4LIVA 3I3MA 1LESA 5FWJA 2VUDA 2ZKLA 3GNEA 4YW6A 5EV7A 1JN2P 4E4HA 4M3CF 5L9BA 5JXJA 1UYZA 4XF9A 3A4UA 4BMEA 3AKSA 3ES4A 2QQVA 2Y6FA 2DU1A 2ZCWA 4B7KA 2P5BA 4QX1A 1AYN2 2ARCA 5GZDA 3WXPA 2ZMNA 1ZBE3 3GJAA 1QDCA 2C6SA 3ALQA 5FZLA 3O1RA 1TMF2 2NQYA 2AZ5A 1HQWA 4JZRA 4LK7A 5T5LA 4A6OA 5J7MA 5HI0A 2OVUA 1CIYA 5F5AA 4IEXA 1AR61 1MZFA 1XU2A 2C9KA 3IM0A 1CWPA 4QQPA 2NP0A 2VULA 2WINB 3O14A 1DF0A 1I3HA 2D7FA 5FMBA 4IV3C 2BFUL 3H1YA 3O0WA 3JXSA 4RGKA 5IK5A 1IQDC 5T5JA 2ARAA 2DVDA 3H8OA 2XOMA 3VHOA 3MLLA 5C9AC 2ZEZA 1ENQA 3WDYA 2QKDA 1UCXA 4M4RA 4X8PA 3ITQA 1UOGA 1X7NA 3OGVA 1XYOA 4M0NA 2RDQA 2W3JA 3C3VA 1PM7A 1HQLA 3ABZA 2X5IC 3O7OA 4LITA 3NWKA 3ZFEA 4COWA 2RJ2A 1BEV1 2RDRA 4MUVA 4XFBA 2E9QA 5FZAA 1H8TB 1RMU3 1VBA3 3IN9A 3PVOA 4XCAA 3RSJA 4MLOA 1HN0A 4PIZA 5F8PA 5HXMA 1ULEA 1GZWB 1KJLA 4P08A 3LPFA 4QPGC 4Y5TA 5GLTA 2UWCA 2VW0A 4M00A 2EALA 2VVEA 3UGHA 4PT6A 3VD4A 2C5DA 4Y20B 4E9KA 1OA3A 1YLLA 5C71A 1AR83 2P6HA 2R7EB 5F3EA 1SQ4A 1YQCA 1GP4A 2WFF1 2WNVC 1LCLA 2W94A 2R061 4LORA 1DQ0A 1VAMA 2A6ZA 3MIEA 4BQ3A 3M8LA 1NCQC 4Q8LA 2V73A 1MS3A 5IK7A 1YQ6A 2C9AA 3WHUA 2J1TA 1M4WA 1ASJ1 2ZX3A 1UZVA 4CU9A 4HVRA 4IUGA 1IZ3A 3JB8A 2YBPA 1DGRA 1W6OA 1FMD2 3O0XA 4LOSA 4RS5C 1GSLA 3H7JA 2P4EA 2Q0AA 4IE6A 4DXZA 3OPWA 4O7XA 2BNOA 5FKCA 5HV4A 2PHDA 1VBD3 3MUZ1 1E5RA 1L7QA 3SH4A 2VZ1A 3OBRA 1W0PA 4Y1VA 5FQ0B 4MXVA 3DKWA 4FPGA 4UFIA 4LLOA 5F1RA 1U12A 3IDEA 3POFA 4YM1A 2RR12 4YVSC 1EV13 3NKTA 4GWIA 5DZGA 5FP4A 3ZLIA 4CDXB 1GICA 4CCEA 5CFDB 3KM5A 3RI9A 2I2SA 2O0OA 1WCSA 4K3UA 3WD5A 2D6KA 2JIJA 4V1PA 3I3DA 5FAXA 1RJ7A 2JB8A 3A21A 3N9MA 3Q8BA 3ZXDA 5C33A 5C3QA 2A70A 3ZIWA 4J1XA 4UYBA 4D7SA 2DCTA 2YYOA 1OURA 3D8CA 3LGRA 3H8RA 1DLCA 1HRI1 1QJY1 2BRTA 2CAVA 3BB6A 2RJKA 3MF9A 2VMDA 3UKTA 3ZYIB 1WLWA 1W6MA 1U5XA 2EAAA 2ZZQA 1UZZA 3R05A 3T4HB 2Y26A 2IZWA 4Q0QA 1SCRA 4Z2WA 2FDFA 2WJSA 2WS92 3H1WA 5LRRA 2VCMA 1FV2A 4AK3A 5FMOL 2RDNA 3DV8A 2FDJA 4CDQB 2AC1A 3NJVA 3MV01 4QX5A 3GZTB 4EWEA 4OHXA 2OW4A 2WAAA 2VZSA 1YEWA 3O1MA 1VB2A 2GDFA 3WINE 2JKXA 5GLWA 3BU0A 4OHWA 1ZZ7A 2WN3A 4LO4B 2GNTA 4UFKA 1W2NA 3UETA 5BYNA 3TEYA 2PA7A 3FUOA 1GFF2 1C28A 1UY4A 4MHUA 4CU6A 4D6RA 1WLTA 1W6PA 4Z2AA 4Q0UA 1D2QA 3V0AB 4N7IA 1QOOA 4R52A 2QFEA 2UY8A 3D0SA 3VKNA 1ULFA 4QGNA 3VBHB 1NT0A 2WZPP 3UJQA 4A7KA 5D8AB 4GMP3 3WOGA 3DUIA 4A7YA 5A6XA 1HB3A 4YNIA 4AGVA 4AL9A 3ACIA 1QNYA 1RUI3 4NHYA 1R1A1 2W1QA 3I8TA 5CFDC 3NNGA 4B29A 4GA9A 4N8MA 4S2FA 4RL7A 3AB0A 2WBKA 2E26A 4QHZA 5HCHA 2WNUB 3O1TA 3BKZA 2NMNA 2DCZA 3I7DA 2BWAA 1BYHA 4YG3A 4IGPA 5FPXA 3R6SA 5I0DA 1DCSA 1V6MA 5IVVA 3VBSC 5LK7B 2WT0A 2ZEWA 1XSRA 1MACA 5IVEA 4DUVA 1JW6A 3VUOA 2RS51 1CVNA 1HV1A 3RG0A 5FYTA 5JI9A 5DDJ3 4P5YA 4OUMA 3UK9A 1AXKA 1W8HA 2YZ4A 1GU3A 3C7EA 3PUSA 4FP2A 4NAMA 3DXUA 3UV9A 3AZXA 3WF0A 4DUWA 5JZGA 3LA3A 4D7YA 3OPTA 1W0NA 2IVJA 2XL9A 4CDQC 2X8KA 4HLTA 2GN7A 2P17A 2YBKA 4YM0A 2KD7A 1ULGA 1LOAA 4XZUG 1HX6A 3I2GA 3T2OA 1B35B 1UOFA 2BOJA 2QQKA 2WWUA 3LKJA 3WW2A 3FWEA 1K5MC 2A6WA 4PIYA 1AYM1 2QTWB 3SCGA 3I49A 1IQAA 5JWPA 1XNDA 4IEVA 4JGYC 1X82A 2GC2A 2YV8A 2ZEYA 3DECA 5FZKA 2YBSA 3VBFC 5K0UB 2ZGKA 1RC6A 2LROA 2R49A 2V09A 4HFSA 2WWSA 3DPRC 3O0VA 5IFPA 1COV1 4PF5A 4LE3A 5T3NA 2BGOA 1XRUA 3OF1A 3I54A 1VIWB 4AVCA 3MDPA 3I2OA 1C8M1 4DFSA 1S0JA 2J1VA 3H3ZA 1O6UA 1V6LA 3ACFA 5DUVA 5FZHA 2XLFA 4FCAA 4NWVA 1DGWA 2HWD1 2GC0A 5D8AC 4QPIA 4HSLA 3JD73 4JV4A 2E7QA 4A42A 2LTNA 1W9TA 2ZX0A 3KQRA 3LAGA 3ROUA 2V5YA 2Q8OA 5LBCA 3IZOA 4W6XA 4E8CA 2DV9A 3RPQA 1JBCA 5ANQA 3BI3A 3OUIA 3O1UA 2JDUA 3WUCA 2HWE3 2WLQA 2KR2A 1PO23 2XVLA 2VOTA 4IV1A 5AC93 1NY72 5GM0A 5KC6A 4IE7A 2DDUA 3VB9A 1PMIA 4Y3OA 2DTWA 3FFQA 4RHV1 5CKMA 3P5BA 3WDXA 3U78A 1V6OA 1D0HA 1AR93 1D4M3 1FX5A 2RS31 1GBGA 3PUIA 2MEV2 1DQ2A 2BNNA 4FAGA 4YSFA 4KGQA 5G05L 3ZPOA 4N9HA 2ZTNA 4XVHA 1ZBA1 4DO0A 1IS6A 4QGLA 3TN91 3RZZA 1G7YA 3QD6A 3MFAA 4NVPA 3ZFFA 1UMZA 4AGGA 1FATA
chains in the Genus database with same CATH topology
2PHUA 2FMYA 2JENA 1GZCA 4YVWB 4O9EA 5L36A 4YGCA 1RUI1 2R16A 4IERA 3AYCA 1X8EA 5ABJA 1MVEA 5K0UC 2DCYA 1VBE1 3J8F1 1EAH3 2VNOA 2R071 1ZZ8A 2XHKA 1MEC2 2N7GA 4R9DA 2WS91 3PVBB 5FCCA 1D4VB 5KHKA 1RUH3 1RUJ2 4RA0A 5AFEA 3ZSLA 2R6QA 1RUF2 5HCAA 4DPNA 2TEPA 4QHBA 1V00A 1RUG3 4PBPA 4I30A 1YNAA 4AVTA 4GALA 1UIKA 3N7KA 1NYWA 4PQ9A 4FTEA 3AYEA 2VECA 1OMIA 2BVVA 1QKQA 3KS7A 3RYRA 1FPN3 4RQPB 3AMQA 5CFCB 4HKLA 4P5HA 2ETEA 3M1HA 2PHRA 1BMV2 1YYNA 2E7AA 1RUC3 4FVVA 2DWRA 4YW1A 3VLBB 4D69A 2DUQA 3NV3A 4EJRA 3V0BB 1C3HA 5E16A 4FTSA 3WX5A 3DL3A 1HLCA 1XNCA 3UKNA 4E27A 4EN0A 1AXYA 4SLIA 2JG8B 3THPA 1IKQA 3B00A 1SCSA 4ES8A 2FMDA 3RYKA 1N3OA 1OPMA 3AMNA 2JX9A 4KWLA 3ZXJA 4HVOA 5I8SA 2HWC3 3WDTA 1ZRRA 1DGWX 4K21A 1QJX3 4XYXA 4BA6A 2WZR1 3QH7A 1DU3D 3MIHA 1S2BA 2F6BA 4B8EA 3ILNA 1SLTA 2Q30A 1GLHA 4Q4Y1 2Q5TA 2G4IA 1QQP1 3FBMA 4MSVA 4BQ1A 4AVSA 3DGTA 1NQDA 2Q1MA 3ACLA 1YFUA 3JZVA 4E4ZA 2A6YA 1NE4A 1B09A 1J3QA 4RR3A 1LOFC 3ZXKA 1YRZA 4BZ4A 3W59A 1UU4A 1CESA 3AK0A 1BBT2 3VHRA 4AEMA 3LSDA 4COUA 4OZXA 1IS5A 4YW4A 5C9AA 4AGRA 4CDUC 1POV1 1SFYA 4KG8A 2XJPA 4PDWB 1E57A 4ISRA 4LO7A 2Z42A 1H2KA 1NG0A 1OA2A 5FFOC 4IEQA 3MLJA 1SLAA 4H14A 2CGOA 2WC2A 2E63A 5GJ6A 3N36A 3PJYA 1FNZA 1VBB2 4QPGA 4QU2A 4XQWA 2HWF3 5DG1A 4HMZA 1U5ZA 4YGDA 4A2UA 4Z07A 2D3RA 1J3PA 2EVXA 3HR9A 4LO6B 1TE1B 2D6NA 3ZVXA 2IFRA 3OYWB 2XB6C 3MIGA 4QQOA 4AXOA 3K51A 1GANA 2WNVA 3QACA 2G9FA 1ZVFA 3EJKA 4DB5A 4YRDA 4WM7B 1RHI3 1ZNPA 3IKWA 4OHZA 4MZUA 2ZHMA 1AR71 1MS0A 1QJU2 1G8WA 3GHNA 2ZBJA 3CEWA 1RUOA 3RMXA 3VKMA 3KT4A 5JVVA 1OOPC 1QJZA 3JBG2 1CGPA 4XW3A 3N35A 3I59B 5BNPB 4Y22B 4RS5A 2PAMA 4IETA 4MGZE 3H8UA 4MGKE 2RS13 4Y1UA 1UW8A 1JUHA 4AW7A 2CWMA 1WMDA 1REFA 3WQ7A 4LT5A 4IEUA 4YVSA 3E6CC 2XUMA 3M3QA 1MEC1 3MI8A 1R082 4TWTA 3WQ1A 4AFBA 4I01A 1LJ7A 4X6QB 1YFYA 1ENXA 1RUJ1 4Q0VA 4J1WA 2ES3A 1VBC1 1H8TA 2GNMA 4XBQA 1GZWA 4GH4C 4YFWA 1R093 2XKPA 3ZX7A 4GB32 4KGGA 2DFBA 4LBLA 3CJIC 4UW6A 4Y20A 5FRAA 1CPNA 2EXJA 5A33B 1CAWB 1KS5A 2JEMA 4XQDA 3RJ2X 1H9PA 5J48A 1OFNA 3J26N 5DUUA 4CEWB 5JZGC 3NAPC 1Z7S2 4Z92B 5EYXA 3PNAA 1ENRA 1ZRFA 1RUE2 1G86A 1LULA 4YW2A 1SLLA 4C91A 4BLJA 2RMU3 2DF7A 1KQRA 3ZO0B 4Q4X3 1H8VA 4AFAA 1S0EA 1W2UA 4XTMA 3INAA 4O9GA 4XEZA 2WQZC 2R042 3MPPG 4FO9A 2VU9A 4S2GA 2PYTA 1GQGA 1W6NB 1TME3 4HKWA 4TYSA 1UU6A 4CDXA 4KU8A 4AVAA 4B3NA 3FHIB 5CFDA 2PLV3 4QPIC 2ERFA 4YG6A 3MFCA 2GH2A 4LBQD 3WVJA 3AFGA 1MS5A 2Z69A 1URXA 4YM3A 1REDA 4WVMB 2E51A 5GZFA 1XNBA 4IV1C 3VBSA 4IXLA 5JCTA 3M2MA 3ZN4A 1TQ5A 1A6CA 4IQPA 1QOSA 5BNOB 2ZGRA 4XFHA 4F7ZA 1Q56A 2NMOA 1AR63 3NW4A 1UF2C 4CEWC 4CDQA 3AXDA 3E5XA 1DZRA 4Z1VA 2DU0A 3QCWA 1EPWA 1FOD2 1C1FA 3NVCA 4LHLA 4AVVA 2D6MA 1K5MA 2XVKA 3WDVA 2UURA 3JUUA 1QMJA 3VZMA 4AHXA 1KDKA 2QZ3A 3Q9OA 3ME2A 5A3LA 5BXXA 1O91A 2VVFA 4GQ7A 4WVZA 1NXD1 3SXWA 3USUB 3DN7A 3ILFA 3O5SA 3M3IA 1HXS1 3OBTA 4RGAA 3V0AA 2VNRA 1ZZ6A 1O3TA 1YHFA 3VBHA 1NOVA 5GLVA 1S0GA 4EROA 3VBUC 5D8AA 1WLDA 1IS3A 5A32B 2R30A 3SH3A 1NCRB 4E2SA 1QJU1 1UD1A 4FPYA 4JGZC 1QXPA 1JH5A 2WNUA 3ZYGA 2WFF3 4EN9B 3AYDA 1WA4A 1ULDA 2GMMA 2R063 4XBLA 1YIFA 4LR4A 4CRQA 1D0GA 3AP9A 1RUD2 2UU8A 3IWZA 4Q4X1 3T2TA 3VBOB 3D5OA 4XFAA 1ASJ3 3B93A 3WDWA 2FQPA 1ZBE2 4NOTA 3L9JT 2XBO2 1CD3G 1YIPA 3POWA 2DVAA 4XXAA 5C8CB 3VBRB 4FBFA 3D6EA 5JSRA 1PGL1 4AQ2A 3WP6A 1F5FA 2YXSA 3LCPA 3KD4A 1PIV1 2BWCA 5K9YA 5JPNB 1BCXA 1Z78A 5K0UA 4H7LA 2ZX2A 1UX6A 4JQRA 4R9BA 4CTEA 1YJLA 1CIWA 3ST7A 4C90A 5LRSA 1DHKB 1NQJA 3AMHA 1U5YA 2NZ9A 3URFA 1GQHA 1CAVB 1HRI3 1QJY3 2CNAA 1DDLA 2WA4A 5JAXA 1VBA2 4WBBA 1RUE1 2Q4SA 2VVDA 1LENA 4RR3C 1DYPA 1RVF1 4N53C 3WCRA 1HV0A 3VZJA 2AYHA 3E97A 4Q4W2 4XFIA 1IOAA 4K40A 1AR82 5ACA1 4HL0A 4QD2A 2SBAA 5AVPA 2FZ1A 3P3PA 2R041 2HWB1 1JUIA 1VR3A 4M0HA 2A73B 5KBFA 2ZHLA 1CX4A 4JDNA 4OHVA 1U5IA 2A6VA 3D82A 4OI0A 4W6WA 4YZ3A 3QOPA 2CGNA 3VDDB 4HSJA 1LHVA 5GZEA 3ZN5A 2PN5A 1PO12 2E7TA 3RQ0A 3SNMA 3WP4A 1R1A3 4N43B 5L19A 2JDZA 3USSA 3B7MA 4CDWB 3KCYA 2JECA 3LB9A 1EV12 2PAEA 1LTEA 5GZGA 5HBAA 1OQEA 1MS8A 3B69A 1DQ4A 1LKNA 3RJRA 1OPOA 2AGSA 2DURA 1ND2B 4PBOA 3UKVA 4FSJA 1YCIA 1FOD1 2RS53 3IDBB 1Y43B 2Y38A 1LOFA 3I2DA 1CONA 5IK4A 5JSPA 1BQPA 2XJTA 3HBZA 2XG3A 4M3CA 4S2HA 1IS4A 1NA1B 1WBFA 4XMAA 3AZZA 2A6XA 5T54A 3UJOA 4CDUA 4RQPA 5CFCA 2VQAA 3R4UA 2XL7A 4MGIE 4G4FA 1FAYA 4AFMA 3V0BA 1U0AA 1AYM3 2R1BA 4YZ1A 2GZWA 3AP4A 3WNXA 2OIIA 2VMIA 1GNHA 4OULA 4P9LA 2Q1ZB 3NV4A 5JSOA 1LB2A 1COV3 4UW4A 4P9WA 1Q3EA 1H8TC 3AJZA 1VAKA 4XIOA 3VL8A 3HT2A 3CO2A 2ZGUA 1C8M3 1J3RA 5BV6A 1O4ZA 3G6JB 2HWD3 2ZOEB 1RUD1 5T50A 4AEKA 4Q1PA 3AKPA 2ZAAA 4YG0A 2MPFA 2JJ6A 2VY0A 4CDWC 1EY2A 1AL21 1QNWA 4LTAA 3TNPB 2XBO1 2IXJA 3GHMA 1PVC1 1OOPA 1Q8SA 1GZ9A 3ZXFA 4HETA 1ND2C 1FNYA 2ZHNA 4Q4V2 3WG3A 1N1VA 4M3CE 4RHV3 2DYCA 2RS33 5JOYA 4COVA 1H1AA 2WQ4A 3M70A 1RITA 2XJVA 5DXDA 2K9ZA 2ET1A 3MGUA 1ZBA3 3TN93 5DDJ2 3G7DA 3CJXA 3B94A 4MV2A 2CTVA 5KXCA 3TWIA 1KXGA 1AX2A 2D3SA 4CDXC 1AYN1 4Y26A 3MF6A 1REEA 2WFPA 4Q1RA 4ATFA 1TMF1 2XJUA 2MHFA 1ZREA 1VBE3 3J8F3 1RB8G 4QM9A 4XHXA 2D6LX 1GKBA 2R073 1TEIA 1ZZ9A 5T5PA 2JICA 2BVBA 4IEWA 1PZ8A 3MICA 4GH4A 2ZGTA 3UL2A 2WS93 3CJIA 4PLOA 4Q4W1 2Z5WA 3D0JA 3RS6A 1AL0G 2DVGA 4WM8B 1UZYA 4HN1A 3NAPA 2D6PA 3BOPA 4WM7A 4NPRA 2XKOA 2B45X 3RI8A 3BODA 5KHHA 3IDCB 1GV9A 3PMSA 3WG2A 2P3KA 4YZ5A 4E2GA 4Q26A 2TUNA 3MEPA 2HWE2 3T1MA 5BNPA 3I59A 1PO22 3L2YA 4Y22A 5HCBA 5AC92 2CGPA 1RTVA 2JG9B 1H2MA 1N1TA 1PO11 1X33A 1AR92 1D4M2 1OKQA 2QQPA 1LHNA 2NLRA 1LODA 4BOWA 2GSYA 3VBHC 2GH8A 4XPVA 1IPKA 2OA2A 3KGLA 4LO8A 3AKRA 4D3WA 1F9KA 4FXGB 5FPZA 1LGCA 4F83A 5GKAC 1IKPA 2GALA 3JCIA 2WNUC 3WR0A 5IT6A 4FPFA 2BGCA 2WZR3 3FLRA 2DCJA 2BQPA 3RMYA 1FMD1 3A0KA 1KFUL 4Q29A 2ZKNA 1F5JA 1QXRA 1EAH2 1Q8PA 2O8QA 4Q4Y3 5GZCA 1QQP3 1LGBA 5A33A 4XJ9A 4IEPA 4P9JA 4H55A 1CR7A 2D5HA 4CEWA 5KC5A 1WBLA 1RUH2 2RR11 5KXBA 1QWRA 3E6BA 2VOWA 4EV0A 1RUG2 1CAXA 2ZACA 4HKOA 3ZXGA 4LBKA 1B35C 2OUHA 3MW4A 3X29B 1ALYA 1H9WA 4CP0A 1HDKA 1POV3 3CNAA 3FBYA 3BPZA 5L7OB 2ZGSA 2QCSB 4KQ7A 1FPN2 4R8HA 3OGGA 4NHKA 4FQZA 1RUC2 2QUOA 2HKXA 1PNGA 2NPIA 2OZJA 3M3EA 3B01A 4WV8A 4HPKB 1W6NA 3VBUA 2ZGOA 1BJQA 5DG2A 3K48A 3W9AA 2VOKA 3S7EA 1FXZA 4XIKA 4FPLA 1HRV2 4JGZA 5FBZA 4FPHA 4Q4V1 1NE6A 3SHRA 4R9CA 4SBVA 4WVMA 1V6KA 1V6NA 2GAUA 3KCXA 1AR73 2I45A 1QJX2 4DMIA 2Y0IA 5GLZA 3KCCA 3VV1A 4FAHA 1OHFA 5BNOA 1N47A 4OVEA 4DRVA 5I0SA 2K0GA 3ZDSA 3BU7A 3N7JA 1I9RA 2KA3A 1QXJA 3E5QA 2A5ZA 2A75A 4AFCA 4XMIA 4LBQB 2OYZA 3AZYA 4XJWA 2O1QA 4JVAA 4YVWC 2GC1A 3OD4A 2JE9A 4Y1YA 3VKLA 4H7MA 5JPMB 4PJYA 5BNNB 3ZIXA 4YZ4A 1UL9A 2IXLA 1MEC3 4UXAA 3USUA 2H0BA 2QZ2A 3ZN6A 4Y1ZA 3NSTA 4YW5A 3GBGA 4LBOA 1RUJ3 1DZTA 1WMFA 3C2UA 1VBC3 5LEKA 3OCPA 1KRIA 1OQ1A 4FPCA 5H9PA 1NCRA 3HT1A 1W6MB 1DQ1A 4L11A 4N53A 2W0XA 5BUVA 2HWF2 4AEDB 2VUJA 3B02A 4LLFA 2AR6A 5F6LB 3AP5A 4JCKA 4E2QA 5CFCC 4J6GA 4RQPC 5J37A 1DGLA 5FO7B 1RHI2 5AFBA 5KWRA 4MVTA 3VZOA 4CP2A 3MIDA 1W6QA 2W39A 2FBEA 2JG8C 4BIFA 2HEYF 4W65A 2OUJA 3IMNA 3ZSJA 4AWDA 3VZNA 3LSEA 4AVBA 3R4DB 2E53A 4Y1XA 4DS0A 1PZ7A 2VNGA 3LA2A 5BNNC 4M01A 2P2KA 4YW3A 5C4WB 4WZFA 2PHLA 2ZGQA 4MX3A 3ZFGB 2C0ZA 3THTA 3V64A 3TBDA 1NY71 3BTAA 4ITCA 1G9FA 2HYKA 4DINB 4BH9A 3MZHA 3FE5A 5T55A 2MEV1 3EO6A 5J96B 1SDWA 4K8FA 1CAVA 2DTYA 5JLVA 1WUVA 2JKBA 2ZZJA 5TSWA 1EPZA 3RDIA 2ZGMA 2GMEA 1R092 1MS4A 1A8MA 2P37A 2ZGNA 1PVXA 3BOWA 2PELA 2XWJB 1SBEA 1DIWA 5IK8A 2VMGA 4DOUA 4NR1A 3HAGA 3RWNA 2JE7A 1VALA 2BPA2 1ZRCA 4LA2A 3OD0A 2KM2A 3KLSA 4PDWC 2DFCA 4QQ2A 4AI1A 2CY6A 1QH6A 5JIAA 3EXUA 4RSUA 1DQ5A 1SLCA 2RMU2 1V9U2 1JYCA 2YY1A 4TZDA 1RUF1 3NO8A 5LEJA 3VDDA 1LEDA 4FQ4A 5K7PA 2NN8A 4QM8A 1HRV1 1AVBA 1HXS3 4AQSA 1IPJA 4LHKA 3VGIA 5I8YA 3ZMNA 4N43A 1QJU3 1LOGA 2AENA 4TLFA 4CDWA 1BMV1 3KMHA 4WM7C 4Q8KA 2VW1A 3GZAA 2PLV2 1OLQA 4Q27A 2VH9A 4AI3A 4B4QA 4Q0PA 3VKOA 1G9DA 1R1ZA 1BZWA