5IK8A

Laminin a2lg45 i-form, g6/7 bound.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
381
structure length
381
Chain Sequence
APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Laminin subunit alpha-2
publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
total genus 78
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A02
3V64A 1MVEA 2DUOA 1SCSA 3B69A 4BOWA 2R49A 1Z0HA 2LALA 4FPGA 3SITA 1WCSA 3RG0A 1MVQA 5T5PA 3AYEA 2EF6A 3IKWA 4YW1A 2A70A 4FOWA 3D5OA 1IS3A 2EAKA 4FPFA 2ZHLA 2ZHNA 3LCPA 4AVTA 1N1VA 3OY8A 2PHXA 3FLTA 4DRVA 4Q8KA 4YW3A 5T5LA 2VH9A 3WG2A 4K1YA 4U2AA 1VAMA 1G86A 5DG2A 2ZAAA 1LULA 3N3HA 3QCWA 3AYCA 1LECA 2YMZA 2YY1A 4FPJA 3AZZA 1WBFA 2PELA 1UX6A 2VW1A 3OBRA 2PHTA 1CPMA 1LOCA 4XXAA 1LHUA 2ZGPA 3ASIA 1W6PA 3CNAA 4M3CB 4R9DA 1G9FA 2KM2A 2FHRA 2GDFA 3FUQA 1LCLA 4AGRA 5KXCA 2GALA 1H30A 2OW4A 4P9XA 2DVFA 5IT6A 1NLSA 1GZ9A 3NV1A 2VU9A 3ILRA 4XIOA 2A75A 1OQ1A 1SLCA 3DGTA 4LBQD 4L8QA 3GALA 5E88A 2DWRA 2DTWA 1J1TA 1N47A 2LTNA 2P3KA 2VUAA 3MEPA 2E53A 3OJBA 4AWDA 4YZ1A 4XMAA 1HQWA 1IS6A 1BKZA 4ATEA 1HLCA 2AREA 1ULGA 4LBLA 1AF9A 3WZ1A 1QDOA 3HN1A 1YXWA 1UL9A 1WD3A 1N1SA 3OY8B 3UJQA 1Q8VA 3O0WA 3AYDA 3FBYA 1ULCA 2ZMLA 2CY6A 4M00A 2EXHA 3O0VA 4WVWA 3AYAA 1N3QA 2DVDA 1Q8OA 2DU1A 3PVEA 1IOAA 4BQ1A 2CWSA 3I8TA 3NV2A 2BQPA 4XTPA 3PJQA 1FNYA 1CONA 1LGBA 5CAZA 2ZGMA 5T5OA 1LHOA 2NMNA 2UWAA 1AZDA 3ZSMA 5DUVA 5JLVA 2JD4A 1W6PB 5JOWA 4YGCA 2WT1A 3M2MA 1DHKB 3OPZA 5GLZA 2ZMNA 5HCBA 5SV8A 3R05A 3BTAA 4PBPA 5DG1A 4Q1PA 2Z42A 2UURA 3ZXLA 4K20A 3JUUA 1MS0A 1UKGA 1I3HA 1CESA 3AP4A 3GNEA 5FREA 4YW2A 5T54A 3PMEA 4P9WA 2WJSA 1O4ZA 1WBLA 3SNMA 2GNTA 1IKPA 4FQ4A 3W59A 1WUVA 1QU0A 2NP0A 4Y1XA 3FUOA 1B09A 1DYKA 1RINA 3MPPG 4ATFA 2EXKA 1WW7A 5IUQA 1DQ1A 4LBKA 2NN8A 3WG1A 1JYCA 4DRRA 2OUHA 4H55A 4LBOA 2ZBJA 1QKQA 3N7LA 5EYXA 1KDMA 5GALA 4YM3A 4W65A 1S0DA 4DFSA 1CR7A 5EXOA 1ZA4A 1FYUA 3O0XA 2EXJA 3U4XA 2VXRA 1QDCA 2D6OX 4XJWA 5H9QA 3ZYRA 5JOYA 2R0FA 1GLHA 1LODA 4BLJA 1GANA 1S1AA 5JMCA 1WW5A 1C1FA 2D6NA 5GZFA 4F83A 3A0KA 1LHWA 4CTEA 4UW6A 2ZGQA 3T1LA 1F5FA 1U0AA 4GALA 5CB7A 4HANA 3WDUA 2CTVA 3ZSJA 2E7QA 3ILNA 1WLWA 2W08A 5GLTA 1W0OA 2NYYA 1URXA 2CWMA 3POSA 1Z78A 2WT2A 3VV1A 1V6KA 1KJLA 3RMXA 3LSEA 5E89A 1LEMA 1N1TA 2SBAA 1CIWA 1LOBA 4Y1UA 4FPEA 4UW5A 1V6JA 1WW4A 2AYHA 1UMZA 2G4IA 2P3JA 3WNXA 1GNZA 4WV8A 3FLRA 1BZWA 5F5QA 2YV8A 1LOEA 2GNBA 1JW6A 2AGSA 5GM0A 2AENA 3R4UA 1G8WA 4FPLA 1MS3A 1N3OA 2W39A 1LOFC 4LBNA 1GZCA 3WDVA 5IK8A 2UWBA 1VLNA 5T5JA 1OFSA 2GN7A 3N36A 3WDXA 4WVVA 2WNEA 1V00A 2NMOA 1IS4A 4ITCA 1QGLA 2P3IA 4XJZA 1KDKA 3IMNA 4Q26A 3AJZA 1SLIA 3V0BA 1JBCA 1SLTA 5KXEA 3TAYA 2ARBA 2D6LX 4XXPA 2ES3A 3WDWA 1KRIA 4RA0A 1GZWA 2WSVA 2EALA 1ENRA 4Q2FA 3WG3A 3WDYA 3HMYA 3M3CA 4PCRA 1DIWA 4Y22A 3UK9A 1AXKA 2UWCA 4I30A 2DVAA 1C1LA 3D4KA 1FAYA 3RQ0A 1OKQA 4FOQA 3APBA 4NO4A 2GNDA 2V5YA 1ONAA 1G7YA 2D44A 1UN1A 5DUXA 5L73A 1JN2P 1D2SA 1IKQA 2VY0A 2ZGNA 1ULFA 1DQ0A 2DVGA 3AP6A 4IQPA 2E6VA 4YZ4A 2P34A 4AVVA 1DGLA 4XIKA 3V0AA 1MR5A 3N35A 4HL0A 4ISRA 2ERFA 3RS6A 4FP3A 4PBOA 3M3QA 5DUUA 1AX0A 1FV2A 1V6MA 1SBFA 1DQ2A 3WVJA 1IS5A 2A3XA 2WLQA 4SLIA 3A4UA 5GZEA 4YZ5A 4XTMA 2GMPA 1S0JA 3AXDA 5DZGA 1WD4A 2ZKNA 1CJPA 4XMIA 1PZ8A 5T52A 4BLIA 2NZ9A 1YIFA 3V0BB 1GBGA 2DTYA 2A5ZA 2ENRA 2H0BA 2XB6C 1LOGA 3B01A 4PF5A 5BYNA 2W52A 5GZGA 1WLCA 4YLZA 1GZWB 5H9PA 2SLIA 1BYHA 5HCFA 1Q8SA 4Y1VA 1CN1A 3A0NA 3AP9A 1JXNA 2R1DA 2CNAA 4Y22B 1G9AA 4XHBA 1CPNA 3AXEA 4ASMB 2D7FA 2DYCA 3OBTA 4JC1A 2DVBA 5IK4A 4LBJA 4CZSA 1A3KA 3M1HA 2ZGOA 3IM0A 1MS1A 2UU8A 2YXSA 1ZM1A 1EPWA 2PHFA 5KXDA 4ISQA 1BXHA 1H9WA 3N7MA 2EXIA 4XBQA 5GLWA 1SACA 3ZXJA 4Y24A 3V0AB 2JDZA 5CBLA 1YI7A 1LOAA 4YGDA 2ZGSA 4NOTA 1MS5A 3SH3A 5DZEA 1A8DA 1JYIA 4M01A 4ZKTB 1G9DA 4DQAA 5CNAA 2D3SA 2E51A 2D6PA 5H9RA 4YG3A 3BODA 1A78A 5HCAA 4FQZA 4P14A 1SFYA 1W6QA 1GV9A 1XQNA 2TEPA 5GJ6A 2ZGUA 2A7AA 1CQ9A 4KBBA 2GMMA 3M3EA 3VKMA 3SH4A 2ZHKA 3ZPYA 1O4YA 2WT0A 3AX4A 1G9CA 4DS0A 1Q8QA 3M3OA 1SBDA 2AH2A 3AFKA 4LBMA 4DPNA 3OGGA 4BMBA 3WHTA 3Q9OA 3BIWE 2ARXA 2JKBA 3OYWA 5EYYA 1D0HA 3SH5A 2VW2A 3ZVXA 3ZSKA 4BMEA 2PHRA 2GNMA 1APNA 5GLVA 3PVOA 5T55A 1BJQA 1X50A 2ZGKA 3RMYA 2R16A 3B9CA 3WCRA 2C5DA 3UJOA 4XHXA 3JU9A 4MYEA 1MS9A 2AUYA 3I4IA 4XJ8A 4R9AA 4YW5A 3WHUA 1SLBA 1V6IA 1VIWB 3DUIA 1W0PA 3B00A 3AZXA 2VW0A 4AGVA 4JRAA 1AX1A 2CL2A 1QOOA 1QMJA 3ATGA 4GWNA 1HQLA 1C4RA 1NXD1 4U36A 1DFQA 4XZPA 4YFZA 1HDKA 1W6QB 4Z8BA 4XJAA 4Y26A 1Y7BA 4XILA 3WUDA 3WV6A 2DURA 1W6OA 3KQRA 4GKYA 4YFWA 4M3CE 2DV9A 2HYKA 1LU2A 1LU1A 2A6ZA 2WSUA 4D69A 2ZA9A 3LSDA 3MW2A 3SISA 5JVVA 3N7JA 2EIGA 1JOJA 2OVUA 3O5SA 1AX2A 3R4SA 2ZGLA 4C1XA 1AXYA 1F31A 4XJUA 1V6LA 2DU0A 3OYWB 2R1BA 2I2SA 4LBQA 3FLPA 2ZACA 5GZCA 3AZWA 1LHVA 4YM2A 3UL2A 1QF3A 4Y20B 1S0CA 2YROA 1LGCA 1S0FA 2ZGRA 1YYNA 5H9SA 3WUCA 1PZ7A 2ZGTA 4BPZA 3H0OA 4Q1RA 1DLLA 4YM1A 1JUIA 5IK7A 1DBNA 1QOTA 2FMDA 4M3CF 1QOSA 5JDBA 1WLDA 1BQPA 4FPYA 3AP7A 1DZQA 2JJ6A 1LESA 4GA9A 1KJRA 2D6KA 5KXBA 1VAVA 2Q5TA 4Q27A 4UW4A 2AR6A 3WDTA 1KQRA 4YGEA 2R0HA 1N1YA 4XE9A 4TYSA 3N7KA 1SBEA 2B7YA 3ZXEA 1W6OB 1ULEA 3PVNA 2E7TA 1GYKA 3V65A 4YZ3A 3NV3A 4GKXA 3WOGA 1DYPA 1W6MA 2A71A 2ZHMA 2P37A 2JECA 3O12A 4JCKA 1SLAA 5T50A 1W6NA 2DUQA 4AYUA 1N3PA 2XG3A 3B3QE 5DZFA 4YM0A 4XJ9A 5DUWA 4TZDA 4CRQA 1TEIA 1PZ9A 1ULDA 1YRZA 1SCRA 2NM1A 2A3WA 2D6MA 3USUA 3POYA 4XYXA 4LBQB 4YZ2A 2A6XA 4AVSA 3WLUA 1RIRA 3RRDA 1LJ7A 3MW4A 3POWA 4YGBA 5FRAA 1S0IA 1AJKA 1UZYA 1VALA 5F9TA 4FPOB 1S0BA 3IN9A 1UPSA 2CYFA 1MS8A 3FFZA 1RITA 4AGGA 4WZFA 1GNHA 3IPVA 1WW6A 3AP5A 3HR9A 1C57A 5DXDA 4BM8A 1V6OA 4R9BA 1AJOA 2W68A 4FPHA 1F9KA 1R1ZA 1Q56A 4FPKA 1LOFA 3NWKA 4XBLA 4OZXA 5JOXA 1MS4A 3VUOA 1FNZA 2A3YA 4YG6A 3C2UA 3ZYPA 4UW3A 1UAIA 4Y1YA 1S0EA 1W6MB 2YZ4A 1ENQA 3AK0A 1ENSA 3ENRA 4FPCA 3ZXFA 1I1EA 4XBNA 1W6NB 2V73A 3AZVA 1GSLA 4C1WA 4FVVA 4Y1ZA 1H9PA 1G9BA 5GZDA 4PQ9A 3T2TA 1MZ6A 3USUB 3WG4A 1Q8PA 2A6YA 3VKOA 5AVAA 1LEDA 3INAA 2OUJA 3VKNA 5CA6A 2D43A 3AJYA 3KM5A 5EWSA 1UZZA 1V6NA 3AZYA 4P9YA 3SLIA 2JE9A 2ZMKA 4GWMA 4K1ZA 1AXZA 1AVBA 2WQZC 1FATA 2RHPA 1MZ5A 1DQ4A 1GKBA 2WKKA 5JOZA 1KITA 2D3PA 4FOYA 1DQ6A 1GICA 1S0GA 4ZXKA 3IPVB 2PHWA 1JHNA 5IK5A 2D3RA 2JE7A 1YO8A 3ZSLA 3W58A 3WCSA 2P2KA 1QNWA 4Y20A 5E8AA 4XOGA 5LK5A 5GLUA 3ILFA 1LGNA 1DQ5A 1MACA 2A6VA 1LTEA 2GMEA 3NV4A 3QLQA 4YW4A 2PHUA 3RSJA 3D6EA 3BOPA 4K21A 1FX5A 3T1MA 3VKFC 1CVNA 1FV3A 2C9AA 1HKDA 4RL7A 1LENA 4GXLA 4M3CA 3MW3A 3VKLA 1LHNA 3ZXKA 4XDQA 4Q8LA 2DUPA 2ZZJA 4FP2A 4FOVA 1SLLA 2ZABA 4R9CA 4YG0A 2A6WA 1QNYA 2GN3A 3L2YA 3TB0A
chains in the Genus database with same CATH superfamily
2X5IB 2DUOA 2WFF3 1Z0HA 2YPDA 3JBG2 1C8M1 4GJZA 3SITA 1OD3A 1TNFA 5T5PA 4WVMA 2WNVC 2Y6LA 4OHZA 4YW1A 1RB8G 2E9QA 4IV1A 4ZS2A 4WM7A 3FHAA 4OI1A 5ACA1 3I3BA 1VBE3 4FFIA 1E5RA 4Q29A 5EFUA 2EAKA 2ZHLA 1X7NA 2ZHNA 3LCPA 1N1VA 3OF1A 2O1QA 2PHXA 1K42A 4YW3A 4QPIA 3RI8A 3WG2A 3GYDA 4P00B 4ZONA 1G86A 5FMCA 3KWVA 3THTA 1XU1A 2XJTA 4BQWA 2DBNA 1OF4A 1OLRA 3KCCA 4GQ7A 4CDUB 5G05L 2PHTA 1CPMA 5A7OA 5BNPC 1LOCA 1OFNA 4XXAA 2BVVA 2ZGPA 5JMOA 1W6PA 4ASKA 4R9DA 4EWEA 2PYTA 2JB8A 2KM2A 5KXCA 2HKXA 3BUCA 2GALA 3AMQA 3O1MA 3GZUC 5CU1A 2OW4A 4R8HA 4RFRB 4OHVA 3ACIA 4CP0A 1C3HA 5BV6A 1K5MC 1POV3 2VU9A 3ZO0B 3ZFEA 3LQCA 4XIOA 4C8DA 2H0VA 3POFA 2VBDA 5AVPA 4L8QA 1AR93 4CEYA 5JI9A 5FYVA 2E53A 3I3DA 4HOOA 4IV1B 4WM7B 5LEJA 5FYTA 1H2NA 3PNAA 2G1MA 4FXKB 1AL0G 1AR81 1OI6A 2PQQA 5A3UA 5A6ZA 1AF9A 4QX7A 1QDOA 3U75A 1WWYA 4ES8A 1WD3A 2Q1FA 3FBYA 3ME2A 4P9LA 4QPIB 4W6YA 3I3QA 4WVWA 3AYAA 1BHGA 1N3QA 1ND2C 2BV4A 2DVDA 2TBVA 4BQ1A 4IESA 3B94A 1W2OA 3PJQA 1ENXA 1HXS2 2JD4A 1W6PB 3ZDVA 5IAXA 5DPNA 3LDKA 2RS33 2DF7A 2ZMNA 5SV8A 4IE7A 4LOSA 4E4HA 2VZ3A 5IFPA 3ZXLA 3VBOC 1UKGA 3AP4A 4J25A 3RYPA 4M4RA 3J7HA 3OBZA 4TTGA 3RZZA 1S2EA 4P9WA 5C3PA 2WFF1 3ZFEB 1RUH2 4FQ4A 2V4AA 4L0PA 1NG0A 5SV5A 4CEYB 4XQWA 2ZOEB 3EB7A 5IUQA 1TME2 2XLGA 3FC0A 5FJHA 3RFRA 4I3PA 4H55A 5BNNB 2R062 4IE6A 3CIHA 2JX9A 2QFEA 5CADA 4W65A 1OXCA 4MGQA 3RZLA 2NPIA 5F3EA 1W2TA 2VXRA 2YBKA 2W3JA 2R0FA 5JOYA 4MH0E 2OQ7A 5JMCA 1PGSA 4Z82A 1RGSA 2ZGQA 4KL1A 1O3TA 3BU7A 4BK4A 1UNBA 3LF7A 4QXCA 4ZU7A 3DYOA 1ZX5A 4QT6A 4GMP0 4HANA 5CB7A 1SG3A 3WDUA 2E7QA 3ILNA 1WLWA 3PUSA 5L19A 1SQ4A 3EO6A 3O1TA 4IDZA 4G3YC 3MFAA 4IV3C 4BQ2A 1KFXL 2ORXA 1POV1 2J42A 2WT2A 3VHRA 2YBPA 3VV1A 1BMV1 1GUIA 1N1TA 1NE6A 1LOBA 1AR91 3GBFA 3G7DA 4GAZA 4OI2A 1UWWA 5FDBA 3ETPA 2CDPA 1A8MA 3JD71 5FZ6A 5HXVA 4LIUA 4F8AA 5LW9A 3PU8A 4Q4V1 2G4IA 2J7MA 4KG8A 2C9KA 4GB32 1BZWA 1RHI3 4A7ZA 5LY2A 1LOEA 1JW6A 4BQ3A 2AGSA 3CMGA 3THCA 3R4UA 4O9EA 1HJGA 1ODMA 4LORA 4XUOA 1GZCA 1YHFA 4OMCA 1O91A 5A7SA 1QY4A 3UKTA 2WO1A 3IMMA 2NMOA 2HEWF 4XJZA 1W06A 1CWPA 1BBT3 1PVC1 4PHZA 3J8F3 2RS31 3BU0A 2OYZA 1SLTA 4URAA 1ULPA 3WX5A 3TAYA 1E5IA 2WS93 3FHQA 2ET1A 3O1VA 3ECQA 4KG0A 4RA0A 2VMEA 2WSVA 1XNBA 4Y33A 4MHUA 4YARA 4LEJA 3WDYA 2UY9A 2JB4A 1PIV3 3UK9A 1AXKA 1NCRC 2C26A 4QXBA 4CUBA 3RQ0A 4P9JA 1Z7S3 1AR71 3ZN4A 4NO4A 3VD4A 2V5YA 3AKTA 5L73A 5DAVA 4YPJA 1NY72 1F15A 3AP6A 2ZGNA 1UZVA 4IQPA 5FMOS 3FX3A 1F5JA 4YW7A 1PMIA 3WF1A 1DGLA 1H6YA 1MR5A 3N35A 3VD3A 4CCOA 3VZNA 5C70A 2N7GA 1OH4A 1P8JA 1AX0A 1V6MA 3AL6A 3Q8CA 4K7JA 5FAXA 3WVJA 4CSWA 2ILMA 4QKBA 4A2UA 4NIHA 3A4UA 1J84A 2WWUA 2J22A 5ERLA 2GMPA 1S0JA 4FAGA 4YZ5A 1AYM1 5DZGA 1WD4A 2DBIA 3VZMA 4XMIA 3ZPOA 1PZ8A 2NZ9A 3M7AA 5ABJA 3NKTA 5FZEA 2GZWA 1LOGA 2GC1A 4PF5A 3TEZA 4JQTA 1WLCA 4YLZA 5KBFA 4LQRA 1MZFA 5HCFA 3VHNA 1VBA3 1W99A 3A0NA 4LKDA 4HK9A 4HKWA 3B9IA 4ORFA 2JG8A 3HAGA 4XHBA 4ES9A 2D7FA 3H7JA 3RGBA 2DYCA 3AVRA 1GMMA 2ZX4A 5FYIA 2PQSA 3U78A 2YXSA 1X36A 2Y8KA 4ISQA 1BXHA 1RHI1 4K40A 1YFUA 1W04A 2EXIA 2QQWA 2WFF2 4V2VA 5DQ0A 1SACA 3OGSA 1L3JA 4CP1A 3K4DA 4NIGA 1OVPA 1LOAA 1UZWA 2ZGSA 5FK7A 3KVBA 2VZSA 1MS5A 1YLLA 4NOTA 1VBE2 4Z92B 1OSGA 2WL1A 3HOBA 2XBO3 3LOIA 3RJ2X 3U0ZA 3JZVA 4AFCA 1BBT1 4UWDA 2VGDA 3R0RA 1JYIA 5ABJB 3PUHA 4YW6A 4ET7A 1H2KA 4M01A 1XSRA 1WMEA 4W50A 4OLLA 1ND3A 2VJXA 3MBWA 5LA2A 4ZKTB 4YNIA 5EQUA 4CYDA 1ASJ1 4AVCA 2BU9A 2PLV1 2ID4A 2D6PA 5H9RA 1QJX2 3LPFA 4MGSA 4S2GA 5FLHA 4P14A 3S5QA 1W6QA 3LFMA 2JG8B 4MGYE 4XACA 5GJ6A 2H6BA 3LFIA 2A7AA 4DNYA 1FT9A 1Z7S1 2R30A 3ZFGC 3R4DB 4D7TA 5BNPA 1G9CA 4DS0A 3O7OA 4QB2A 3ACHA 3H3ZA 2AH2A 4F7ZA 3AFKA 3CQOA 3H42B 3UYJA 2PN5A 4DPNA 4BMBA 1EYBA 4JTOA 3BIWE 2JKBA 3OYWA 4XAAA 4OQ9A 1AR92 5C4WA 3ZVXA 3GZAA 3ZSKA 2PHRA 2GNMA 4BMEA 5KHGA 1K5MA 1QJY3 3PHMA 4BQXA 3K46A 1J3QA 3K77A 2LW8A 1UOGA 5C8CC 2Y6GA 3CBNA 5F2SA 1JZ4A 3HIFA 4LITA 4XHXA 1VBB1 2AUYA 3OGVA 5FUPA 4AFMA 4R9AA 3LKJA 4FFGA 4YW5A 1VIWB 2R042 2YGLA 4MX3A 1J59A 5A1LA 1ND3B 2VW0A 2JDAA 1AX1A 2CL2A 1Q3EA 4Q4W1 1QMJA 4GWNA 4AI2A 1L7QA 4BWOA 1HQLA 3WP3A 3AVSA 2ADEA 3AFGA 1VBA1 1RUF3 1W6QB 3Q8AA 1ND2A 1W8HA 3GHNA 2IXLA 4PT6A 4XFAA 4XILA 5FTTC 4OI0A 2OX0A 2RS32 3I2KA 3MIGA 2BNMA 2OT7A 4YFWA 4ZXEA 4EN0A 2HYKA 1LU2A 1LU1A 2BNNA 2HWB3 4DUWA 5BNPB 3SISA 4XURA 3VHOA 2ETEA 5FZ3A 5A7QA 3PIJA 3NNMA 4C1XA 5FPAA 3BPZA 3ZYGA 2X5IC 1F31A 4JZRA 4HKOA 3OYWB 2P6HA 5FYBA 5GKAC 3VBOA 4B1MA 5C4WB 2I2SA 2LROA 4LBQA 3ZYJB 5DAPA 5ISLA 4N8MA 1K5MB 1R083 1O5LA 1D0GA 2RG4A 2XBO1 1LHVA 3H1WA 5DN2A 3O1OA 2Y38A 2Q8DA 1LGCA 4BQYA 1OC1A 1STMA 4NPMA 4P02B 2ZGTA 3WUCA 1UCXA 4L97A 3E5QA 4FTEA 5IK7A 4RGGA 5JDBA 3AP7A 5IVBA 2VMDA 5FXWA 3SCHA 1VAVA 2BP6A 3WQ7A 1XSQA 1BK1A 4Q0QA 2VMIA 2R0HA 1ND2B 3ZXGA 3J7MA 3N7KA 3PTRB 3C7FA 2R7EB 1X82A 3VZJA 3LOBA 1VB2A 1C8NA 4DXZA 3NV3A 2VNRA 1W0NA 2VUDA 3RVHA 2CAVA 4K3UA 3E5UA 5FYYA 5A33A 3UV9A 4UOJA 3B3QE 4XJ9A 5DUWA 2ADDA 4CRQA 1TEIA 5FY4A 4TZDA 2FDKA 2FZ1A 2NM1A 3OSDA 3VBOB 3BOWA 4HK8A 4IV3A 4LBQB 4NVPA 5FZOA 4CVUA 4UFLA 3WP5A 4IV1C 3L2HA 1F4HA 1ZVFA 4LOTA 4NPRA 4WM7C 2JDYA 3WLUA 1RIRA 1WMFA 4QGNA 5FP9A 3RRDA 3O1RA 1ZZ6A 2ZTNA 4CCKA 2IUWA 1RHI2 1S0IA 5FV3A 1SFPA 1UZYA 2A73B 2BGPA 4OMDA 4C0HA 1S0BA 5F9TA 2CYFA 3FFZA 1RITA 4AGGA 1YFYA 4LTAA 4OUSA 3IPVA 1WW6A 4BK5A 1NZCA 3HR9A 3ORJA 5DXDA 3WW1A 1AHSA 1XYNA 4R9BA 1AJOA 3SKVA 4Z8BA 1RUF1 3HWJA 1C28A 5JOXA 1U5YA 2CSGA 2AC1A 3J8F2 2WUHA 3C7GA 3GJBA 2GP5A 4QX2A 3TYJA 2A3YA 4YG6A 3T2QA 2HWB1 3AMMA 4BJ0A 2WS92 4HSLA 2YZ4A 3ES1A 3AK0A 3HNYM 5IW0A 5A33B 1UMHA 3VGIA 4I09A 1JZ3A 3HD8B 3VBUB 3ZR5A 1HB4A 2Y6HA 1PIV2 3DKWA 5FQ0A 5GZDA 4QM8A 3T2TA 4A3ZA 5LZ6A 4Q0UA 1XE7A 3WY6A 4IV3B 1Z7S2 5FZOB 1RUOA 1LEDA 1R081 1PGW1 3BPSA 3D0JA 4QMAA 2YU1A 3SLIA 5BNNC 2ZMKA 4FI9A 1VBC3 2VZTA 2YGMA 3K3NA 4GWMA 2WQZC 1AVBA 4K9SA 5FYZA 3BKZA 1MZ5A 2WO7A 1TG7A 1UX7A 3UGGA 2ZJCA 1GICA 5FZ4A 3IPVB 3NNFA 2DCTA 2JE7A 3HBZA 2XQXA 3WCSA 4NRMA 1XNTA 4CDQC 5C71A 2A6VA 3MV11 2C24A 3GZEA 1XYOA 4AHWA 1HV0A 4D0QA 1FX5A 3KV4A 3B7MA 3POBA 4XEZA 2XONA 1FV3A 2D93A 1TNRA 4JKKA 1VBA2 3DKQA 4M3CA 5K0UC 3VKLA 2BVBA 1QWRA 2XKPA 5FZGA 2DUPA 4NRQA 5FQ0B 4AFAA 5JI7A 3ZLIA 4BA6A 1SLLA 2ZABA 1MZEA 3OTFA 4RQPC 4AQTA 2Q30A 4TXWA 2GN3A 1NT0A 4CCDA 4COWA 4YVSC 1RYYA 2VOWA 2WYFA 2RVAA 4NHMA 3VL9A 5JSPA 2LALA 4FPGA 1QH6A 1RXFA 4DZGA 1DLCA 1WCSA 2AZ5A 3SEPA 4QQHA 4HMZA 4CU7A 3J9SA 1CZSA 2GSYA 3IKWA 4GULA 3ZSEA 2VG9A 4MV2A 3HVDA 3ELNA 5FP7A 5F5AA 2QVSB 2OS2A 3I2HA 1NE4A 5A1AA 2XBO2 1ZRFA 1HRI2 4FFHA 5I0SA 4AHZA 2QQPA 3SQOA 2A1XA 4NJ4A 2WINB 2WLPA 4U2AA 2JDHA 1VAMA 3EMRA 5JPMB 4XCBA 5DG2A 1UXXX 3QCWA 2I07B 1W9YA 3CJIC 2YMZA 2YY1A 2ZZQA 3PLQA 2E33A 4PLOA 5G04L 1US2A 1MPXA 2HEYF 1OQDA 1UX6A 1WBFA 2PELA 4M0HA 4ZPIA 5C3OA 1LHUA 3CNAA 3ASIA 4LO7A 4M3CB 4L11A 3MUZ1 4N7IA 4XQ4A 2FMYA 5FO7B 5A7PA 3FUQA 3VD5A 3BIEA 4HG6B 1BLZA 2J1UA 5LK7B 1TMF3 2VMCA 3SKJE 2Y34A 1RC6A 3DXTA 2QJVA 1UQXA 4OYUA 2VQUA 1NLRA 1LRHA 3H8OA 5DDJ3 1SLCA 5FZ8A 1XRUA 3J26N 2R6QA 2WAAA 4LBQD 5JSOA 3GALA 1PMHX 2PHDA 1J1TA 1N47A 3ZFGA 2P3KA 4IEZA 1QEXA 3BGAA 4AWDA 4CP2A 4YZ1A 4XMAA 2QQIA 3DN7A 4H7MA 1PGL2 3VLBB 3ZMNA 1QJY2 2XJVA 4CCMA 1HRV3 1PHMA 4X8NA 3HBKA 2V09A 3O0WA 1YFWA 4CCNA 1QJFA 1ULCA 2IVJA 1F4AA 2FCVA 2B45X 2CY6A 2EXHA 5LRSA 2B39A 3BTZA 5I93A 5C8CA 2CWSA 4KQ7A 3UT0A 5JR7B 4XTPA 1OH3A 1FNYA 1LGBA 2HWF3 4EQVA 4Z2AA 4TWTA 3ZSMA 3TEYA 1OPOA 4WBBA 5KHKA 5JLVA 4IL7A 5JOWA 4DINB 2WT1A 4BIFA 1M4WA 2O8QA 1DHKB 5FYHA 5LEKA 4PBPA 5DG1A 1T6GC 2UURA 2WZ8A 4K20A 5TSWA 4JHZA 1MS0A 3IT8A 1CESA 3USSA 1YEWA 4XVHA 4YW2A 3U14A 4LUKA 4CEWA 2WJSA 3H8XA 1RUH1 2PHLA 4Z07A 1IKPA 1QU0A 1JI6A 3FUOA 1RINA 1O8PA 3MPPG 3ZFGB 2QQKA 2OKXA 4QKFA 1TME1 1DQ1A 4H3WA 2RJLA 4EE2A 2EIEA 2OIIA 3W5MA 1QKQA 5F7UA 1KDMA 2W92A 4D6QA 4DMIA 1CR7A 2O14A 4J1WA 4DY5A 3MF9A 1PO23 4LULA 3U4XA 4CA9A 1NYWA 2X8KA 5FPXA 2ZEYA 5C8CB 1S1AA 2YU2A 2LM3A 1W8TA 5I8YA 2ARAA 2JICA 2VQ0A 2ATFA 3PIGA 4L2NA 3A0KA 1LHWA 3HPNA 4UW6A 3O1UA 4KU8A 4NIAA 1F5FA 1U0AA 1PX4A 2CTVA 2B46X 3TBDA 1MEC2 2JG8C 3JQXA 4QWNA 1KXGA 4QGMA 4COUA 5FFOC 3DEMA 1URXA 3T0AA 5C3SA 1CIYA 4CEWB 2ZX3A 3VBSC 3JQWA 5E89A 1LEMA 1CIWA 1YCIA 4Y1UA 2LUWA 3KZ4C 5F5CA 5JWPA 4FPEA 1V6JA 4MHRA 3PURA 2P1BA 1UMZA 2P3JA 3NVCA 4LK6A 4GB31 1B35A 3FLRA 3LGRA 1O3SA 2D98A 3FHIB 1DCSA 3MO4A 3WSOA 4LO8A 2VOVA 4A6OA 4FPLA 3DL3A 5DMYA 1MS3A 1DU3D 2Y0IA 1LOFC 3Q8EA 4XABA 3M3IA 1GOGA 1DYOA 1OFSA 3AM2A 3N36A 2VBBA 3FJSA 4PIYA 4A42A 4WVVA 5JXGA 1ND3C 1JH5A 4MG2A 1S2BA 2JXAA 1KDKA 4Q26A 3AJZA 2BOJA 2X09A 1JHJA 4CU6A 2XJUA 1EV13 1YUDA 2D6LX 4QX5A 2Z4FA 3ALQA 4O9GA 1V0AA 1KRIA 4OHWA 4URTA 2EALA 4MGIE 4EROA 3CZUA 4OCTA 4Q2FA 3WG3A 1QJX3 1ZZCA 2XVLA 5FY9A 3VBFC 2YC0A 1UPIA 3GF6A 1DIWA 4I30A 2FZ2A 2DVAA 1C1LA 4FSJA 5ANNA 1OKQA 2VVEA 1HN0A 3APBA 3MLKA 1ONAA 2UYAA 4HT1T 3LWCA 5LA9A 2D44A 5FWJA 1CZTA 1NY71 1BK0A 5C4WC 1I6XA 1B35B 2VY0A 1DQ0A 4QX1A 4YZ4A 4GJYA 5AFBA 4W8JA 1PO21 1QQP3 1VBC2 5AC93 3QACA 3LA2A 3KS7A 1FOD3 2RDNA 4ISRA 4JTNA 2ERFA 1SFNA 3RS6A 1UYPA 4FP3A 3U11A 5DUUA 5BNNA 3NJZA 3EYPA 4V2WA 1QJZA 3DF0A 4AEJA 4SLIA 5C5TA 4CXYA 4XTMA 3RZMA 4HVQA 2EIBA 2I74A 4QKNA 3KF3A 2B5HA 1CJPA 5JCTA 1REFA 2DTYA 2A5ZA 2ORZA 3KF5A 2R043 4IEXA 4LHKA 2XB6C 3B01A 2W52A 3S30A 1RMU3 2W87A 3WF4A 2SLIA 1W2UA 1BYHA 3S6PA 4AXOA 4CDQA 1RUJ3 4Y1VA 1CN1A 1JODA 4LHLA 4TN7A 1JXNA 3I2GA 4DOUA 4QPYA 1G9AA 4LLFA 3AXEA 1OUXA 5FZFA 1IQDC 4G9SB 2FDHA 3OBTA 1W8WA 4JC1A 4LBJA 3TN93 1H8TC 5M0TA 1JMUB 3FFQA 2P3YA 5CISA 2XLAA 5K0UA 1VMJA 2OPKA 4Y5TA 1H1MA 5KXDA 5IYYA 4XFIA 1Y43B 4Y24A 2VUCA 4RQPA 2W94A 5D8AC 2BOIA 1YI7A 4YVSA 5BNQA 2GH8A 1UOJA 1VBE1 1ZREA 2YDEA 5EP9A 1VJ2A 5IVJA 4JDOA 2RJKA 1A8DA 3NAPC 1YQ2A 4MGTA 5CKNA 1NA1C 5BXXA 4MLOA 3TWIA 3QH6A 2XJRA 2IXIA 1G9DA 1NAEA 4KWJA 1U12A 4ARYA 1DDLA 2E51A 2VZQA 4MADA 4AFBA 3UNPA 1HQNA 4L99A 4YVWA 1IPKA 1EUTA 4CDQB 1QJX1 3BODA 1A78A 4BZ4A 1GV9A 5EV7A 1K12A 2GC3A 4Z2WA 4H14A 1JTZX 5A3TA 2JDPA 1BCXA 3CJIA 1YQCA 3VBUC 2NQYA 1UOFA 4COVA 1TMF2 3GDBA 2Q8CA 4N7UA 2ZHKA 1BEV3 3KV6A 4X8PA 2WZPP 3ZPYA 5HV0A 2FCTA 1ZZ8A 5K0UB 2WQ4A 1KFUL 1KEXA 4AVAA 3KT7A 5DDJ2 3JB4C 5FJKA 3URFA 1QXRA 3D82A 4KWKA 4RQPB 3WHTA 2R32A 1FOD1 1GFF2 2VCAA 3SH5A 1OHFA 2QTWB 4YVSB 4RHV2 1APNA 1E5HA 2YHJA 3PVOA 5DABA 3O1PA 2WIIB 2ZX2A 1X50A 5CFDA 3I97A 1XNCA 2R16A 3UJOA 2WYSA 1HRV2 1Q43A 3TRSB 2GH2A 5C9AC 3ZFFA 4NIDA 4D7YA 2XVGA 1SLBA 1V6IA 1O7FA 4B8EA 2HWC3 2R041 3DUIA 3ZM8A 1W0PA 1YQ6A 3B00A 4AI3A 4AOCA 1NUKA 4AGVA 2WA4A 1QOOA 5FY0A 1ZRIA 1S4CA 4MVTA 4Q4Y3 4UBHA 2XL9A 4YVWB 2I45A 2HWF2 3KVAA 3NKGA 3RZKA 4U36A 1DFQA 4XZPA 1X8EA 2WRAA 3RJRA 3RPQA 4YFZA 2WN3A 3CJXA 3THDA 4JVAA 4LKSA 1W6OA 2RS13 4ZS3A 3CJIB 1RUC3 4WZCA 4UYBA 3MIHA 2P6CA 5D2AA 4XF3A 3LSDA 3GCWA 4XF1A 3T0BA 1J1LA 1U5IA 5JVVA 2OVUA 1AX2A 3R4SA 4UBGA 5JXJA 3A21A 4LA2A 2XLFA 1V6LA 4OULA 2R1BA 3IAPA 5EIYB 3KSCA 5JZGA 4NHYA 1XU2A 2WBKA 3BCWA 1VR3A 1YJKA 3H1MA 3IAQA 1QF3A 5L9RA 5CFDB 1U5XA 3TNQA 4N53A 2ZGRA 2HWD3 3ZFFB 5A6XA 1S2KA 1YYNA 1PO22 2YG0A 4BPZA 1W03A 3H0OA 1OA4A 2VOXA 1DLLA 1JUIA 1DBNA 1QOTA 1YQ5A 2FMDA 3ZYFA 4M3CF 1QOSA 1ZNPA 4N43B 1RUI3 1BQPA 1W8UA 4PLNA 1DZQA 2JJ6A 1LESA 5KXBA 2Q5TA 4Q27A 5HBAA 2WNOA 5CZKA 3T30A 4QD2A 5F8PA 3WDTA 4S2FA 1N1YA 1VB4A 3KCXA 2QQMA 1PM4A 2B7YA 2QQVA 1W6OB 4XCAA 1NQDA 5APAA 4P9IA 4A4AA 2E7TA 1BEV1 3NNJA 1DGWA 1DYPA 2IXJA 3GM8A 2P37A 1RUD3 3ACGA 4JCKA 2FDFA 1YQ8A 2DCZA 1W6NA 4AYUA 1N3PA 1D4VB 1OA2A 4LPLA 2YFUA 3MPBA 4LE4A 1PZ9A 1ULDA 3C8XA 3HT1A 3F95A 2D6MA 3USUA 1GP6A 2WWSA 3AKQA 2D5HA 3VBSA 5JZGB 1YFXA 3NJVA 3SHRA 4JDNA 3WNNA 4ZZ8A 2HH9A 3HQRA 3POWA 4YGBA 4N53B 3WF2A 4GZ9A 2BGOA 4AI0A 2BYVE 1VALA 3MF6A 5A1FA 2WAOA 2WZR3 4WZFA 2BNOA 3H3UA 3AP5A 4Q4Y1 3B5LB 4QX8A 3BALA 2WN2A 4S2HA 3H8UA 5F37A 1HRI3 2YB7A 3QOPA 2J1EA 1D7PM 2QQOA 2W1QA 2W68A 1F9KA 1H1IA 1Q56A 4XBLA 1LOFA 3UKVA 3W20A 4OZXA 3O14A 3WINE 2RS11 3J8F1 5CKQA 1J3PA 1EV12 1FNZA 1V9U3 4QQPA 3C2UA 2WS91 1UAIA 4Y1YA 1ODNA 3ENRA 4AEMA 1W6NB 5FXZA 2J1SA 2D5FA 2VNOA 2XUMA 3AZVA 5F32A 5K9YA 3ZYIB 4AI8A 1XNDA 3J4UH 1JUHA 4FVVA 3WP6A 1PIV1 1AR63 3V56A 4PQ9A 5EJ1B 2QDRA 3USUB 1Q8PA 1PNGA 4Y5SA 5AVAA 5FZDA 5HXMA 2VD7A 5FZLA 3VBSB 1PGL1 1GOFA 2QCSB 1IG0A 3AZYA 1OT5A 4FCAA 3GHMA 4P9YA 4AF9A 3CU7A 3FN9A 3PUAA 3I2IA 1QQP2 5AC92 2G9FA 2RHPA 4RGAA 5FZAA 2WKKA 3MUY1 2JWPA 4CCEA 1FOD2 2D3PA 2VZUA 4FOYA 5LA0A 1RUI1 5IK5A 5FUIA 1XNKA 1YO8A 3OEAA 3VDAA 2RR13 3ZOIA 4C91A 1GNYA 5F39A 2XJQA 1L7LA 3P3PA 4GWIA 3ILFA 1REEA 2ZX0A 1DQ5A 1RUE3 3QLQA 1LTEA 3NV4A 4TLGA 2W1SA 4AEDC 4AQ2A 4K21A 2W5FA 4AI1A 3OOXA 5JXHA 2IWGB 3T1MA 1H1AA 3U37A 2JD9A 2XR4A 4C90A 5J7MA 1RMU2 3HNBM 3GJAA 5DAQA 3M8LA 1RUJ2 4D94A 5L36A 3LZZA 3ZXKA 3ES4A 4LHNA 3NRUA 1UD1A 4CEWC 4FOVA 4R9CA 2Z5WA 4LUMA 4QPGC 5LCWL 1WMXA 1A6CA 3TN92 1SCSA 4AAXA 1WZXA 3T09A 4JAAA 2PAKA 4BE3A 2PFWA 2XWJB 3K3OA 3KLSA 3POEA 4D7SA 1H8TA 1OMIA 2JDMA 3FL7A 4FOWA 2YC2A 5IWFA 4CXXA 5FYUA 3WW2A 3D5OA 3POIA 1XPWA 1W3VA 3FMGA 5L7OC 4Q0VA 4FPFA 4O7XA 1HRI1 3F2ZA 2GAUA 4AE2A 2OZJA 5D8AA 4FTBA 2VH9A 4DUVA 1SZBA 4D3WA 4ONUA 4K1YA 4CUCA 1V9U1 4YSFA 2O0OA 2UY8A 2BFUS 1LECA 3AMHA 3NAPA 4FPJA 1UOBA 1NA1A 2VCMA 1CAXA 1JOBA 2VZPA 2VW1A 3OBRA 4HLTA 3LEGA 4JKMA 4AL9A 2BWAA 2YC4A 3IIAA 4RN5A 4AHXA 1F2NA 3VDBA 2WR9A 2GDFA 1AR61 1LCLA 2VAUA 5EJZB 5D1IA 2VVFA 4C0BA 1MEC3 3CF6E 1H30A 5FLJA 3WNMA 2DFBA 4UFJA 2VCBA 4Y5Z0 1BEV2 2JKXA 2PXJA 5CEHA 5IT6A 3TNPB 5IHRA 2P17A 1NLSA 1GZ9A 2QQUA 3I54A 4QXHA 3CDZB 3ILRA 4DO0A 1JYNA 2VZ1A 1OQ1A 2XXZA 4RSUA 1EPZA 3VBUA 1B35C 2DTWA 3LE0A 2LTNA 1H8TB 2VUAA 1XOYA 4M4PA 1HQWA 1IS6A 1BKZA 1W8OA 3CLPA 4W6XA 5IJRA 5CKMA 4A6SA 4ATEA 1ZRDA 2FDIA 1QJY1 4HBNA 3VD7A 3HN1A 1PVXA 2RR11 3IWZA 1UL9A 1N1SA 2YUEA 1Q8VA 1XBFA 2RJ2A 3AYDA 4GMP3 5D8AB 2ZMLA 2O8OA 4LA3A 1RUE1 3PDQA 4M00A 3O0VA 5BY5A 4ARXA 1OPMA 3PVEA 1ALYA 2HWC2 3PUQA 4CP9A 3VBHC 4E4ZA 1O3RA 1F8VA 5KR7A 2BQPA 3NAPB 4IGPA 1H2MA 5JPNB 5CAZA 1NA1B 5T5OA 1CAXB 1LHOA 2EICA 4Q4Y2 4A7KA 4E2GA 5C9AA 3TOJA 3LEMA 3I49A 1I5PA 2WO3A 1W8ZA 1ZZ7A 4O65A 5FMBA 3M2MA 3P6BA 1JS9A 1O4TA 5HCBA 1U5ZA 3R05A 2RS12 2AEYA 3AKRA 1PM7A 1RUC2 2Z42A 3AKSA 5FZ0A 4BDVB 3JUUA 4WM8C 4E2SA 1I3HA 2RDRA 2XWBB 4GIQA 4E4SA 2FDGA 3EQEA 5T54A 1O4ZA 1WBLA 4E9KA 3SNMA 2VXJA 2QKDA 2Z69A 3W59A 1WUVA 5I91A 2NP0A 4BHPA 1B09A 1DYKA 5FZ1A 1JZ6A 2EXKA 4L9BA 3D0SA 3VZOA 3WG1A 4H2AA 3RYKA 4LBOA 4DUXA 5CG8A 1UU4A 4Z1VA 3N7LA 4PJYA 5EYXA 1S0DA 4IEYA 5J96B 1J83A 4MOAA 1COV3 1WCDJ 2VNGA 4BYYA 5JSRA 1ZA4A 4FT8A 3O0XA 1POV0 2HWD2 3C7OA 3RZJA 1VBD3 4OUMA 3PUIA 2PAEA 2G9GA 4LIVA 1LODA 4BLJA 4CP9B 1W8FA 4BXSV 3E97A 1X9PA 4I0WB 5GZFA 4FBFA 1RUI2 4F83A 5C9AB 1LNSA 1GWKA 4CTEA 1UU6A 1R1A3 2WNUA 5IVEA 3ZXDA 5FYCA 1LB2A 1DGWX 1MEC1 1UY4A 4BQ4A 4P9GA 2NYYA 5GLTA 1YI9A 2XMLA 4LE3A 3KT1A 3DPRC 3POSA 4NPLA 1RUD2 5FLIA 1Z78A 3CZJA 3ON7A 1CGPA 4XAEA 2VMGA 1O3QA 1WMDA 1UY2A 5J48A 3RMXA 3LSEA 5CIRA 1Q5OA 4YRDA 1ZBA3 3RWNA 4UW5A 1WW4A 3EHKA 4AQ6A 4XC9A 1OLQA 4QB6A 1QXJA 2Y6FA 3JB8A 3WNXA 1GNZA 4WV8A 4L92A 5F5QA 2OQ6A 4Q4X2 2YV8A 4GMP1 1GWMA 2GNBA 3MV01 4HVOA 2WA3A 1UW8A 1HIXA 2AENA 2W39A 5A32B 3WDVA 2WZR2 1VLNA 2GN7A 3WDXA 5L9VA 3I3EA 4AQSA 4F3JA 1V00A 4ITCA 1IS4A 1QGLA 4I02A 2P3IA 4J1XA 4KH9A 2WNUB 5FPLA 3IMNA 3KB5A 4EJRA 4YVWC 1SLIA 4UFKA 3V0BA 2K0GA 4AVBA 5IVCA 1JBCA 2Q1MA 2ES3A 1CX1A 1GQPA 1V9U2 2BGCA 2JDUA 3HEIA 1JU4A 1ENRA 4Y4RA 3SCFA 3VL8A 4B3NA 3HMYA 3M3CA 4EZHA 3WD5A 4BQ5A 2IXHA 1RUG3 2UWCA 3D4KA 3I2DA 1FAYA 4UFHA 1R093 1DGRA 1AR62 2VO5A 2GC2A 1RXGA 2GNDA 3M4FA 3DXUA 1G7YA 5A6YA 4MXVA 4I2OA 3IDBB 1D2SA 1IKQA 1QH7A 1TQ5A 2DVGA 3SXWA 1A34A 1IG3A 2P34A 1WCUA 3BB6A 1IZ3A 1J58A 1VBC1 2W91A 4H7LA 4QAWA 1ZYBA 2HEVF 2Y26A 4BH9A 5CFDC 3AKPA 4XIKA 1VBD1 3BTYA 3EXUA 4HL0A 2D40A 4HETA 3PJYA 3ZFFC 3LEKA 4RHV3 4PBOA 2HWE3 4QDSA 4UF0A 1FV2A 3UGHA 1SBFA 1DQ2A 4NN0A 4NAMA 4X6QB 2A3XA 2RE9A 2E7AA 3T2PA 5GZEA 4N9IA 1NXMA 3MICA 2RR12 4QHZA 4N43C 1R1A1 4CDXA 2ZKNA 4BLIA 5T52A 5CFCC 3V0BB 4Y4YA 4S2DA 3SC7X 1GBGA 1HV1A 2BRTA 2BWCA 1RUE2 4OFGA 3T4HB 2H0BA 3ZKYA 5B2GB 4K6BA 5BYNA 1W9TA 4GWJA 5FKCA 5H9PA 5FY7A 2WO2A 2F4PA 2KXLA 3KHCA 1Q8SA 4AEDA 3AP9A 3ABZA 3IDEA 1ACCA 3AL5A 3M70A 2R1DA 4IGOA 4AW7A 3SCGA 1CPNA 1Y3TA 2XGXA 3UKNA 4B4RA 4QB1A 3BI3A 3E1F1 2WC2A 4N90A 5EPAA 4EYUA 1FI2A 1VMHA 3WNLA 1A3KA 3M1HA 1OVSA 3T2OA 5F2WA 1ZM1A 1EPWA 2LRPA 3X29B 5BUVA 2ARCA 1AYN2 3NO8A 4RGKA 3ROUA 3LAGA 5J3UA 5JZGC 2C0ZA 4IE4A 3OEBA 4QPGA 3ZR6A 4CE8A 4HVRA 3W9AA 5ACA3 2W1UA 4N53C 1W39A 4YGDA 4COZA 1UYYA 2MEV3 4UF0B 3LD8A 3SH3A 1ULOA 2RMU2 2NLRA 1FMD3 2IXKA 3MI8A 4CDXB 3S57A 2G9ZA 1Y9QA 2RDQA 3WR0A 1WCKA 2HBUA 5L7OA 1YC61 4KGQA 1XE0A 3H7YA 3P5BA 5A3LA 4MGKE 2BFUL 3A22A 4FQZA 4AEDB 3TEXA 1JOPA 4AHYA 1RUG1 1XQNA 2TEPA 2Z79A 4IEUA 2ZGUA 4LO4B 2XKOA 4KWUA 4W4ZA 1CQ9A 1R091 4JQRA 1H4HA 4KBBA 3M3EA 4KBZA 4LMFA 2V5DA 3VKMA 3P1IA 1W3XA 2VECA 5D21A 1TMF1 3VBFA 3SH4A 2B9VA 4QU1A 3AX4A 2JIGA 4NUBA 5A7WA 2PA7A 1GOHA 3NQHA 3TEWA 4ZY9A 1OLME 3OGGA 5DDJ1 3Q9OA 4QPGB 3I3MA 2ARXA 2KD7A 1E5SA 4XETA 4CUGA 2VW2A 3KHBA 1T6BX 1AR83 4RHV1 2HWE1 3WNOA 3N4MA 1VPHA 3H9AA 3RNSA 2GU9A 1BJQA 2Y33A 5IVYA 5JUVA 3DYMA 5FPVA 3JU9A 4ZU4A 1HRV1 5A80A 1MS9A 3I4IA 3NW4A 4RYDA 2VBPA 1W2NA 3IBMA 3H8RA 3THPA 5A7NA 1GQGA 3AZXA 5L7OB 2XVKA 4JRAA 4XQDA 1EY2A 5IAVA 3ATGA 3PTYA 1IPJA 3G6JB 4XFBA 1C4RA 1D2QA 1NXD1 2HWF1 2W1WA 2WWJA 4UT5A 2VL4A 5FZKA 4OI4A 3K4ZA 1HDKA 2QDNA 4KNCA 4HZFA 2HYXA 1Y7BA 4IEWA 3VBHA 5IVVA 3KQRA 5FP3A 4CPBA 1POQA 3OD4A 1CZVA 3KD4A 2DV9A 1WCQA 2A6ZA 2WSUA 3KMHA 2OXBA 1CX4A 1FXZA 1YNAA 2IXCA 5F3IA 3VBFB 3E6BA 4CUAA 3MW2A 3DYPA 5A3PA 3N7JA 5A7WB 4MXWA 2EIGA 4FTSA 3O5SA 2ZEWA 5J98B 4E27A 4NAOA 3UESA 4MUVA 4NHXA 1GP5A 2J1VA 1XE8A 4PIXA 3MZHA 4WM8A 5LASA 4XFGA 1VAKA 1XNAA 3FLPA 4FFFA 2MEV1 4FO9A 1J3RA 3RZHA 1HB1A 3GBGA 3VDDC 2VZVA 4AR2A 3U4SA 4YM2A 1FMD1 4Y20B 2YROA 1S0FA 1COV2 1TE1B 2F17A 4XDPA 5LWBA 2E63A 5H9SA 1PZ7A 4AEKA 4JGYC 1VBD2 2Y60A 4YM1A 2BJSA 3VD9A 4XUQA 1WLDA 4FPYA 2ZPXA 4QX3A 2H6CA 2XOMA 4KI5M 1CAVA 2YBSA 1BVVA 3ZN6A 4UW4A 2AR6A 3IIIA 1KQRA 4XE9A 5F5IA 1HW5A 1R1A2 3T08A 1SBEA 3VBHB 1EAH3 1LKNA 3W21A 5J1XA 1H6XA 3PVNA 1GYKA 3V65A 2PAMA 4YZ3A 4XFCA 3VHPA 5B4NA 2A71A 1W6MA 4UI9L 2ZHMA 5FKBA 5FPUA 5IFTA 1SLAA 2W46A 3C3VA 4MXWB 1ZA7A 5JR2A 3RZGA 4OZOA 2TUNA 2XG3A 5DZFA 4WVMB 1DZRA 1XJAA 5LBFA 3ZYHA 5KHHA 2CU5A 4XFFA 3JD73 4WM8B 1OUSA 1ZBA2 2A3WA 4SBVA 2YPJA 3POYA 4XYXA 4YZ2A 2D97A 3MIDA 2A6XA 3DPRA 4ASLA 1KD7A 4Q4V3 1RL3A 4META 5FP4A 1KS4A 2HJIA 3BVCA 3LEIA 2R072 3KGLA 5HI0A 1ZZBA 1LJ7A 1WA6X 1H4GA 5E16A 5FRAA 3FE5A 1AJKA 1GQHA 5F6KA 4DXTA 1UPSA 5AFEA 4EN8B 1NOVA 3WW3A 1MQTA 1H8VA 1GNHA 4FAHA 3I2FA 1C57A 3DV8A 1CAVB 1V6OA 4E2QA 3ZN6B 1JZ2A 1PVC3 4FPHA 1R1ZA 1PX3A 4EWAA 2VCCA 5FZHA 5JIUA 5FZMA 1H0BA 2Z2SB 2IZWA 1UKRA 1EV11 4B7EA 1PK6C 2EAAA 2P5BA 4XZUG 3ZYPA 1AL23 1W90A 3BTXA 1W6MB 3ZXFA 1I1EA 1ENSA 2KA3A 4FPCA 5A3MA 2V73A 1Y9GA 3AMPA 4IW3A 1H9PA 1RUG2 1G9BA 3N9MA 1AR73 5FZ7A 1MZ6A 2QBXA 1R092 1UIKA 2E26A 1NLQA 5C6CA 2WFPA 1IGOA 1SMVA 3DPRB 3OBAA 5L9BA 4IEVA 4LNVA 1WKYA 2OUJA 3U07A 2D43A 3KM5A 2TNFA 1UZZA 5C33A 2VM9A 4HKLA 1OURA 4K1ZA 1D4M2 1R64A 1AXZA 2EVXA 1ZRCA 1XYPA 2B8MA 1FATA 5FPZA 1QQP1 5AC91 1SDWA 3WF3A 1DQ4A 1MQTB 1DQ6A 2VZOA 5CVRA 2PHWA 1JHNA 2HWE2 5K8SA 3EBRA 3W58A 3ZSLA 5F6LB 1AYM3 1QNWA 3MFCA 5E8AA 4XOGA 4E4DX 5FOJB 3SMHA 4O61A 2IC1A 5GLUA 1MACA 1EAH1 2VZRA 2ZS6B 3BN6A 2BPA2 5FY8A 3D6EA 1NCQC 2OA2A 3N9PA 4KWLA 3VKFC 1CVNA 1RMU1 1TVGA 1PMJX 4N43A 5K7PA 1VMFA 2BZDA 2C9AA 5JAXA 4JV4A 5CFCA 4RL7A 4GXLA 1RUJ1 3PU3A 1WA4A 2OPWA 5LBBA 4XDQA 4Q8LA 1QJEA 2CGOA 4FP2A 4DEQA 1DGRN 4XW3A 4PDWC 3ZX7A 3ZN5A 3C7EA 4AK3A 2XHNA 1QNYA 5EHDA 2ZEZA 3L2YA 3TN91 3V64A 1MVEA 3B69A 1HJFA 4BOWA 1OBNA 2R49A 1UY3A 2GC0A 4B4QA 5KHIA 3FWEA 4IEPA 1C8M2 4XDOA 2XPJA 3RG0A 1JU3A 1X9TA 1MVQA 3WT3A 3AYEA 2BEOA 4R52A 2EF6A 1ZRRA 2A70A 4XF9A 5ACA2 3S5AA 2PMWB 2W0XA 2MEV2 5I0UA 1IS3A 1JYXA 4PI2A 4AVTA 1FMD2 3OY8A 4IE0A 3FLTA 4DRVA 4Q8KA 2DCKA 1UYXA 2RM23 3PL0A 5T5LA 1NX9A 3WNPA 5HV4A 2FD8A 2IFWA 4IXLA 4JGZA 4LT5A 4GH4C 4IERA 3VN4A 2WNUC 2CHHA 5EJ3A 3T3YA 1WLTA 1Y4WA 5FR3A 4I3GA 1AL21 1LULA 1REDA 1ASJ3 2ZAAA 3AYCA 2PLV3 3KCYA 3N3HA 3ZIWA 4J6GA 3AZZA 4EWDA 1M06G 5CFCB 3J7LA 4CPBD 2BTVC 3GZTB 1VRH3 4DY3A 1G9FA 2FHRA 4IEQA 4AGRA 5BNOC 2JG9A 4P9XA 2VE1A 2DVFA 4QQLA 3NV1A 2X05A 3VBRC 4CU9A 5F3GA 1SPPA 2A75A 3DGTA 5HPOA 1JZ8A 2VTXA 5JIAA 1PO13 1JYWA 5E88A 5I8SA 4COYA 5HCHA 3MEPA 3J7NA 3OJBA 1O6UA 2L9LA 2B42B 3OGJA 3GBWA 1GZTA 3OG2A 1K3IA 1HLCA 2X10A 1AR82 1I9RA 1ULGA 2AREA 2J1AA 4IGQA 4LBLA 3WZ1A 2GP3A 4RFT0 1YXWA 5J37A 1VBB3 3UJQA 3OY8B 2ET7A 2VTXJ 4XPVA 4Q4X3 3VB9A 2MPFA 3D8CA 3POGA 3K51A 1AUYA 3I2JA 5FO8B 4CDWA 4JGZB 2BERA 1Q8OA 2DU1A 2HWC1 1IOAA 5C5UA 3I8TA 4Q4W3 3NV2A 4PQQA 4IETA 4QDRA 1CONA 1Y9MA 2ZGMA 3C7HA 2UWAA 2NMNA 3Q8BA 2QNKA 1AZDA 5DUVA 5FXXA 3BYWA 1JZ5A 1VE0A 4YGCA 5I0TA 4G4FA 3OPZA 3OGRA 5GLWA 5E6HA 5GLZA 1RUNA 4RS5C 3BTAA 1UO9A 4Q1PA 1RUC1 4HN0A 3WEZA 2JG9B 2Q4SA 3GNEA 4JKLA 5FREA 1XB9A 1YJLA 3N9LA 4HXCA 3PMEA 4XF0A 2FQPA 3POJA 4MGZE 1SPPB 2GNTA 2BBVA 1HB2A 5LY1A 4Y1XA 5FOBB 4ATFA 3WQ0A 2XQRA 1WW7A 3U10A 4LBKA 2NN8A 4DRRA 1JYCA 2MNGA 2OUHA 2VQAA 3LPGA 4CCCA 2ZBJA 4RR3C 3CHXA 5GALA 4A41A 4CXWA 4YM3A 2WNVA 4DFSA 3DECA 3NMBA 5EZWA 5EXOA 3O1SA 4XUPA 2RM21 1FYUA 3FZ3A 2RS53 5DAWA 5LB6A 2HWD1 2EXJA 1QDCA 2D6OX 3K2OA 4XJWA 4CDWB 5ANQA 5H9QA 2K9ZA 2J1TA 2V4VA 3VDDA 3LIGA 1GLHA 3KV9A 3ZYRA 2CAUA 4CDXC 1GANA 3HNMA 1WW5A 1C1FA 2D6NA 4D6RA 2JIJA 3D3AA 4QHOA 3KQ4B 3WNKA 1DP0A 1LR5A 4JGYA 3T1LA 3ZDSA 1VRH1 3LIHA 3IB3A 1UY0A 1DG6A 3HJRA 1QHDA 3K4AA 4GALA 3ZSJA 1EAH2 2W08A 1W0OA 4XF4A 3N9OA 2CWMA 3A7QA 4RD7A 1RUD1 3N9NA 3AB0A 1W8NA 1V6KA 1BMV2 4W6WA 1KJLA 1OOPC 1PO11 2SBAA 2DFCA 3JD72 1WGPA 4GD4A 2AYHA 4Q4V2 2UYBA 1JYTA 3EJKA 2WNVB 1F35A 1AYN3 3VZLA 4JX0A 4Q4X1 3OD0A 2KR2A 4AAPA 5GM0A 3CO2A 3S7IA 1G8WA 4INDA 3S7EA 1N3OA 3VDDB 4LBNA 2WZR1 5IK8A 2B9UA 2UWBA 5T5JA 2B4KA 5A3WA 1SDDB 2RMU3 1KGYA 2ZCWA 1VRBA 5FYSA 4BIOA 1C5IA 2WNEA 3VZKA 3NSTA 4AI9A 5A3OA 4JGYB 4Y3OA 3OUJA 3OPTA 2X53S 2JDNA 1PVC2 1RJ8A 5FZIA 4LK7A 3LDRA 1UF2C 5KXEA 2ARBA 1W05A 4XXPA 1DF0A 1O5UA 4QU2A 2IFRA 3PMSA 3WDWA 5T3NA 3LA7A 1GZWA 3I59A 1AL22 4AFDA 4OUEA 4E8DA 3GXUA 1ZBE3 4A3XA 3HT2A 4HPKA 4P5HA 4PI0A 3WQBA 5DAXA 4DXSA 1RVF3 4PCRA 4Y22A 4QQOA 1YWKA 1PK6A 1QJU3 1G6NA 3K48A 2VMHA 2WQ8A 4FOQA 1AR72 5FK8A 1CD3G 1UN1A 5DUXA 3UETA 1JN2P 3U1XA 5FP8A 3W5NA 1ULFA 3IDCB 3ZXAC 4AVVA 3NL1A 2E6VA 1UYZA 1LAJA 5A3NA 1FPN3 3ACFA 3RYRA 2RS51 2W95A 1XXNA 1EP0A 3V0AA 1W9FA 1IPSA 1BVP1 5FYMA 3M3QA 1QIQA 1IS5A 2WLQA 1C5HA 3AXDA 4E8CA 1AYM2 4CDUC 2CGPA 2VUJA 2W2IA 3NJYA 3NNGA 1YIFA 2DCYA 3ITQA 2ENRA 1HN1A 1EUUA 5GZGA 1W28A 3HQXA 5A70A 1GZWB 3DCQA 1K45A 3I59B 3GGLA 2VOTA 2ZX1A 1OD5A 3I7DA 4UFIA 5BPXA 4N9HA 4A45A 1NZIA 4EN6B 4HPKB 1W2AX 4NR1A 3T4VA 3VDCA 2CNAA 4Y22B 1NCQA 2Y0OA 2VULA 1PK6B 4ASMB 1H2LA 4NWVA 2VPVA 1IHMA 2C6SA 2DVBA 4YYOA 5IK4A 4CZSA 2W9XA 4LKEA 2ZGOA 4LO6B 3IM0A 3I2OA 2RV9A 1TZOA 1MS1A 2JDKA 2UU8A 3OUHA 4Q5OA 4EN7B 3JBG3 2PHFA 3K75B 1AYN1 4LLOA 2QQJA 1H9WA 3N7MA 3QBQA 4HN1A 4LKFA 4LXLA 4I01A 4XBQA 5C8WA 4ZZ5A 5KWRA 3ZXJA 4PDWA 2C4XA 4A44A 5K4LA 3V0AB 2JDZA 2XH6A 4QPIC 4QGLA 5CBLA 4YWAA 1OQEA 1ST8A 4ZHNA 2BUKA 2RMU1 4D8MA 4EZ4A 4PF1A 3NJXA 5DZEA 1JZ7A 2HBTA 2F4LA 5F3CA 5KHJA 1K5JA 1BBT2 3WP4A 2RM22 4M0NA 3ZIXA 4DQAA 5CNAA 2D3SA 2Q8EA 3PVBB 5A32A 1ASJ2 2QQLA 1ZZ9A 2PLV2 1ZBE1 4YG3A 3QD6A 4BCUA 5HCAA 3A23A 3WXPA 1SFYA 1RVF1 1HB3A 4FXGB 4GH4A 4DXRA 3MYXA 1SEFA 1NCQB 1QJU1 3ZFEC 1VRH2 2GMMA 4B29A 4CEYC 5CG9A 2AACA 1O4YA 2WT0A 2OZ6A 4NHLA 1NCRA 1Q8QA 1SHWB 3M3OA 5FY1A 3R6SA 5KC5A 2QUOA 1SBDA 1KS5A 5FBJA 5J09A 1FPN1 1VP6A 4LBMA 5FMOL 4PDWB 1GWLA 5BNOA 1GR3A 2QZ2A 1PO12 3UGFA 5EYYA 3MHZA 1D0HA 4QQ2A 4QM9A 4MO3M 2DCJA 2WABA 5GLVA 4TSVA 4QKDA 5LBEA 5T55A 5FZBA 2J1RA 3VBRA 4CCJA 2ZGKA 1MQTC 3RMYA 2R073 3B9CA 3WCRA 3JCIA 2C5DA 1VBB2 4MYEA 5LRRA 2VQTA 4XJ8A 1UMIA 4PIZA 5FIXA 3WHUA 5F1RA 3OCPA 5IATA 2JENA 3IZOA 2XUEA 2BBAA 4BXFA 1OF3A 4WVZA 1X8MA 4Q4W2 3ZYBA 1HXS3 1UY1A 1GP4A 5LA1A 4GH4B 4XJAA 4Y26A 4QHBA 2W47A 2XHKA 3WUDA 3WV6A 2K2SA 2DURA 2EIDA 4GKYA 3OB8A 2IVIB 4JHTA 4M3CE 2QQNA 3H3LA 3QH7A 5FWEA 4BB3A 2Y64A 2ZA9A 3GCXA 4D69A 3LDBA 4UAPA 2F6BA 1NCRB 2P4EA 5FMDA 1W9SA 3JBG1 1RUH3 1JOJA 5C3QA 2ZGLA 2XDVA 4RS5A 1NQJA 3WW4A 4AG4A 5BNOB 1AXYA 2VTFA 4XJUA 1NKGA 2DU0A 5FZCA 4OQ8A 1I5ZA 3B02A 5B4XA 3MIEA 1TME3 3OUIA 4PLMA 1UXZA 2R063 2ZACA 4P08A 5GZCA 4LR4A 3VBRB 3AZWA 3MLJA 1XC6A 3FBMA 4LO5B 4NE9A 1E57A 2Q8OA 3UL2A 4XUNA 1S0CA 1CAWA 4CU8A 4XFHA 1D4M3 1COV1 2RDSA 4BISA 1OA3A 2RS52 3LA3A 4OHXA 4CCLA 4Q1RA 3SEEA 4DB5A 2ZEXA 2FDJA 4RR3A 4TLFA 1X33A 4QPWA 4LJHA 1PNFA 1UIJA 1CAUA 4GA9A 4B1LA 1KJRA 2D6KA 2DDUA 4NIIA 3AMNA 2ZKLA 4V1PA 4QXKA 4HFSA 4K8FA 4KMQA 4QX0A 4R4XA 4YGEA 4Q0PA 2BW8A 3KV5A 4TYSA 5A6QA 3WQ1A 3CL1A 3ZXEA 5LBCA 2V72A 3OPWA 1ULEA 4UXAA 1US3A 4GKXA 3WOGA 3O12A 4R4ZA 2JECA 2E32A 5T50A 2VVDA 2DUQA 4A7YA 3KGZA 2G19A 4NRPA 4MZUA 3ST7A 4RS5B 4YM0A 1RJ7A 4Q0SA 4K8RB 2VR4A 4OVEA 1YRZA 1SCRA 3B93A 4QDQA 1ZBA1 2EA7A 4HONA 1L7RA 4XUTA 5FUNA 3Q8FA 1YIPA 5C7GA 2VMFA 3WF0A 4GB33 4AVSA 4EV0A 4OHYA 3RI9A 2E31A 1QXPA 1OOPA 2R071 2QE3A 1CAWB 4MSVA 3RWKX 2CV6A 1C8M3 2BDRA 3MW4A 2YYOA 2K46A 4FPOB 3IN9A 4NROA 5I8TA 3T0DA 1MS8A 4DEVA 4RR3B 5J36A 2XJSA 3H1YA 3E6DA 3CKHA 4NHKA 2AEZA 4JGZC 1CAUB 1UZ0A 1OKOA 4BM8A 2VC9A 1HXS1 1IQAA 5FPBA 5LATA 1JYVA 1RUF2 5E1RA 4FPKA 3NWKA 4HSJA 2Q1ZB 1HX6A 1MS4A 4B4PA 3VUOA 2ZAHA 3AC0A 3KT4A 2HWB2 4UW3A 5JXIA 1S0EA 2FCUA 1ENQA 2XJPA 2VNVA 3IDAA 4XBNA 5FXVA 4C1WA 1GSLA 1ZBE2 2CDOA 2JG9C 2JE8A 2X29A 1DZTA 2FBEA 2YFZA 5FO9B 1W9WA 1GU3A 1RVF2 4Y1ZA 1QJU2 3WG4A 3LB9A 5FBZA 3HQUA 2A6YA 2C1FA 2LS6A 2R061 3VKOA 3CEWA 3MIBA 3INAA 5KC6A 1R082 1PGW2 1OLMA 5C3RA 4NMIA 4NWWA 2VOKA 3VKNA 2XL7A 3AJYA 5EWSA 2X5IA 1OOPB 1V6NA 2MHFA 5CA6A 2JE9A 4I0AA 2WDBA 4JDMA 1D4M1 2QZ3A 3ZMOA 1FPN2 4IE5A 4I0BA 4P5YA 2Q0AA 2WZEA 1GKBA 1T2XA 3H50A 5JOZA 1KITA 3S0MA 3E6CC 5FY5A 5ABJC 1S0GA 3RDIA 3HN3A 2JEMA 5IVFA 4ZXKA 4CDWC 1UU5A 5I0DA 2D3RA 4BU2A 4B7KA 2P2KA 3MIFA 2Y6KA 4Y20A 2CGNA 5LK5A 3MDPA 3MGUA 1LGNA 4YW4A 3RSJA 1O8SA 2GMEA 2PHUA 3NNLA 3BOPA 2ZXQA 1O59A 4AZZA 2Y6JA 3L9JT 3P3NA 2PTMA 4JRLA 4ZU5A 4CDUA 1HKDA 1CJDA 4IUGA 3ZKUA 1S55A 4LHSA 4IEOA 1LENA 4X6RB 1RTVA 1V70A 3MW3A 1LHNA 3ETQA 5FZ9A 4UFMA 3ACLA 5I0RA 4DIQA 2ZZJA 4KGGA 4KU7A 5FCCA 3JXSA 4YG0A 4EN9B 4D6SA 2A6WA 5CYYA 3N9QA 2DWRA 3MLLA 2HLEA 3TB0A 3E5XA
chains in the Genus database with same CATH topology
2X5IB 2DUOA 2WFF3 1Z0HA 3JBG2 1C8M1 3SITA 1TNFA 5T5PA 4WVMA 2WNVC 4OHZA 4YW1A 1RB8G 2E9QA 4IV1A 4WM7A 4OI1A 5ACA1 1VBE3 4Q29A 5EFUA 2EAKA 2ZHLA 1X7NA 2ZHNA 3LCPA 1N1VA 3OF1A 2O1QA 2PHXA 4YW3A 4QPIA 3RI8A 3WG2A 3GYDA 1G86A 3THTA 2XJTA 1XU1A 4CDUB 1OLRA 3KCCA 4GQ7A 2PHTA 1CPMA 5BNPC 1LOCA 1OFNA 4XXAA 2BVVA 2ZGPA 1W6PA 4R9DA 4EWEA 2PYTA 2KM2A 5KXCA 2HKXA 2GALA 3AMQA 3GZUC 5CU1A 2OW4A 4R8HA 4OHVA 4CP0A 1C3HA 5BV6A 1K5MC 1POV3 2VU9A 3ZO0B 3ZFEA 4XIOA 2H0VA 5AVPA 4L8QA 1AR93 4CEYA 5JI9A 2E53A 4IV1B 4WM7B 5LEJA 1H2NA 3PNAA 4FXKB 1AL0G 1AR81 1OI6A 2PQQA 1AF9A 1QDOA 4ES8A 1WD3A 3FBYA 3ME2A 4P9LA 4QPIB 4W6YA 4WVWA 3AYAA 1ND2C 1N3QA 2DVDA 2TBVA 4BQ1A 4IESA 3B94A 3PJQA 1ENXA 1HXS2 2JD4A 1W6PB 2RS33 2DF7A 2ZMNA 5SV8A 3ZXLA 3VBOC 1UKGA 3AP4A 3RYPA 3RZZA 4P9WA 2WFF1 3ZFEB 1RUH2 4FQ4A 1NG0A 5SV5A 4CEYB 4XQWA 2ZOEB 5IUQA 1TME2 2XLGA 3FC0A 5BNNB 4I3PA 4H55A 2R062 2JX9A 2QFEA 5CADA 4W65A 2NPIA 2VXRA 5JOYA 2R0FA 4MH0E 5JMCA 1PGSA 4Z82A 1RGSA 2ZGQA 4KL1A 1O3TA 3BU7A 4ZU7A 1ZX5A 4QT6A 4GMP0 4HANA 5CB7A 3WDUA 2E7QA 3ILNA 1WLWA 5L19A 1SQ4A 3EO6A 4G3YC 3MFAA 4IV3C 1KFXL 1POV1 2WT2A 3VHRA 3VV1A 1BMV1 1N1TA 1NE6A 1LOBA 1AR91 3GBFA 3G7DA 4OI2A 5FDBA 3JD71 1A8MA 5HXVA 4F8AA 4Q4V1 2G4IA 4KG8A 4GB32 1BZWA 1RHI3 4A7ZA 1LOEA 1JW6A 2AGSA 3R4UA 4O9EA 1GZCA 1YHFA 1O91A 3UKTA 1QY4A 2NMOA 2HEWF 4XJZA 1BBT3 1PVC1 3J8F3 2RS31 2OYZA 1SLTA 3WX5A 3TAYA 2WS93 2ET1A 3ECQA 4KG0A 4RA0A 2WSVA 1XNBA 4YARA 4LEJA 3WDYA 2UY9A 1PIV3 3UK9A 1AXKA 1NCRC 3RQ0A 4P9JA 1Z7S3 1AR71 3ZN4A 4NO4A 2V5YA 3AKTA 5L73A 1NY72 3AP6A 2ZGNA 4IQPA 5FMOS 3FX3A 1F5JA 1PMIA 1DGLA 1MR5A 3N35A 3VZNA 2N7GA 4K7JA 1AX0A 1V6MA 5FAXA 3WVJA 2ILMA 4A2UA 3A4UA 4FAGA 4YZ5A 2GMPA 1S0JA 1AYM1 5DZGA 1WD4A 3VZMA 4XMIA 1PZ8A 2NZ9A 3M7AA 5ABJA 3NKTA 2GZWA 1LOGA 2GC1A 4PF5A 1WLCA 4YLZA 5KBFA 1MZFA 5HCFA 3VHNA 1VBA3 3A0NA 4HK9A 4HKWA 3B9IA 4ORFA 2JG8A 3HAGA 4XHBA 4ES9A 2D7FA 3H7JA 2DYCA 2ZX4A 2YXSA 1X36A 4ISQA 1BXHA 1RHI1 4K40A 1YFUA 2EXIA 5GLWA 2WFF2 1SACA 1L3JA 4CP1A 1LOAA 2ZGSA 4NOTA 1MS5A 1YLLA 4Z92B 1VBE2 1OSGA 2WL1A 2XBO3 3LOIA 3RJ2X 3JZVA 4AFCA 1BBT1 2VGDA 3R0RA 1JYIA 5ABJB 1H2KA 4M01A 4ZKTB 1WMEA 4OLLA 1ND3A 4YNIA 4CYDA 1ASJ1 4AVCA 2PLV1 2D6PA 5H9RA 1QJX2 4S2GA 5FLHA 4P14A 1W6QA 4MGYE 2JG8B 5GJ6A 2H6BA 2A7AA 4DNYA 1FT9A 1Z7S1 2R30A 3ZFGC 3R4DB 4D7TA 5BNPA 1G9CA 4DS0A 3O7OA 3H3ZA 2AH2A 4F7ZA 3AFKA 2PN5A 4DPNA 4BMBA 1EYBA 4JTOA 3BIWE 2JKBA 3OYWA 1AR92 5C4WA 3ZVXA 3GZAA 3ZSKA 2PHRA 2GNMA 4BMEA 5KHGA 1K5MA 1QJY3 3PHMA 1J3QA 5C8CC 3HIFA 4XHXA 1VBB1 2AUYA 4AFMA 4R9AA 3LKJA 4YW5A 1VIWB 2R042 2YGLA 4MX3A 1J59A 1ND3B 2VW0A 1AX1A 2CL2A 1Q3EA 4Q4W1 1QMJA 4GWNA 4AI2A 4BWOA 1HQLA 3WP3A 3AFGA 1VBA1 1RUF3 1W6QB 4Z8BA 1ND2A 3GHNA 4XFAA 2IXLA 5FTTC 4XILA 4OI0A 2RS32 3MIGA 4YFWA 2BNMA 4EN0A 2HYKA 1LU2A 1LU1A 2BNNA 2HWB3 5BNPB 3SISA 3VHOA 2ETEA 4C1XA 3ZYGA 3BPZA 2X5IC 1F31A 4HKOA 3OYWB 5GKAC 3VBOA 5C4WB 2I2SA 4LBQA 3ZYJB 1K5MB 1R083 1O5LA 1D0GA 2XBO1 3H1WA 1LHVA 2Y38A 1LGCA 3WUCA 2ZGTA 1UCXA 4L97A 3E5QA 4FTEA 5IK7A 4RGGA 5JDBA 3AP7A 3SCHA 1VAVA 3WQ7A 1BK1A 4Q0QA 2VMIA 2R0HA 1ND2B 3ZXGA 3N7KA 1X82A 3VZJA 3LOBA 1VB2A 1C8NA 4DXZA 3NV3A 2VNRA 2CAVA 4K3UA 3E5UA 5A33A 3UV9A 3B3QE 4XJ9A 5DUWA 4TZDA 4CRQA 1TEIA 2FZ1A 2NM1A 3VBOB 3BOWA 4HK8A 4IV3A 4LBQB 4NVPA 3WP5A 4IV1C 3L2HA 4NPRA 1ZVFA 4WM7C 3WLUA 1RIRA 1WMFA 4QGNA 3RRDA 1ZZ6A 2ZTNA 1RHI2 1S0IA 1UZYA 2A73B 4C0HA 5F9TA 1S0BA 2CYFA 3FFZA 1RITA 4AGGA 1YFYA 4LTAA 4OUSA 3IPVA 1WW6A 1NZCA 3HR9A 5DXDA 3WW1A 1AHSA 1XYNA 4R9BA 1AJOA 1RUF1 3HWJA 1C28A 5JOXA 1U5YA 3J8F2 3TYJA 2A3YA 4YG6A 2HWB1 3AMMA 2WS92 4HSLA 2YZ4A 3ES1A 3AK0A 5A33B 3VGIA 4I09A 3HD8B 3VBUB 1PIV2 3DKWA 5FQ0A 5GZDA 4QM8A 3T2TA 4Q0UA 1XE7A 4IV3B 1Z7S2 1RUOA 1LEDA 1R081 1PGW1 3D0JA 4QMAA 3SLIA 5BNNC 2ZMKA 1VBC3 2YGMA 4GWMA 4K9SA 2WQZC 1AVBA 1MZ5A 2ZJCA 1GICA 3IPVB 2DCTA 2JE7A 3HBZA 3WCSA 4CDQC 2A6VA 1XYOA 4AHWA 1HV0A 1FX5A 3B7MA 4XEZA 1FV3A 2D93A 1TNRA 1VBA2 4M3CA 5K0UC 3VKLA 2BVBA 1QWRA 2XKPA 2DUPA 5FQ0B 4AFAA 5JI7A 4BA6A 1SLLA 2ZABA 1MZEA 3OTFA 4RQPC 4AQTA 2Q30A 2GN3A 4COWA 4YVSC 2VOWA 4NHMA 3VL9A 5JSPA 2LALA 4FPGA 1QH6A 4DZGA 1WCSA 2AZ5A 4QQHA 4HMZA 3J9SA 2GSYA 3IKWA 4GULA 3ZSEA 2VG9A 4MV2A 3ELNA 2QVSB 1NE4A 2XBO2 1ZRFA 1HRI2 5I0SA 4AHZA 2QQPA 2WINB 2WLPA 4U2AA 1VAMA 5JPMB 5DG2A 3QCWA 2I07B 3PLQA 3CJIC 2YMZA 2YY1A 2ZZQA 4PLOA 1WBFA 2HEYF 2PELA 1OQDA 1UX6A 4M0HA 1LHUA 3CNAA 3ASIA 4LO7A 4M3CB 4L11A 4N7IA 4XQ4A 2FMYA 5FO7B 3FUQA 5LK7B 1TMF3 1RC6A 2QJVA 1NLRA 1LRHA 5DDJ3 1SLCA 1XRUA 3J26N 2R6QA 4LBQD 5JSOA 3GALA 2PHDA 1J1TA 1N47A 3ZFGA 2P3KA 4IEZA 4AWDA 4CP2A 4YZ1A 4XMAA 3DN7A 4H7MA 1PGL2 3VLBB 3ZMNA 1QJY2 2XJVA 1HRV3 1PHMA 4X8NA 2V09A 3O0WA 1YFWA 1ULCA 5LRSA 2B45X 2CY6A 2EXHA 2B39A 5I93A 5C8CA 2CWSA 4KQ7A 5JR7B 4XTPA 2HWF3 1FNYA 1LGBA 4TWTA 3ZSMA 1OPOA 4WBBA 5KHKA 5JLVA 4IL7A 5JOWA 4DINB 2WT1A 4BIFA 1M4WA 2O8QA 1DHKB 5LEKA 4PBPA 5DG1A 1T6GC 2UURA 5TSWA 4K20A 1MS0A 3IT8A 1CESA 3USSA 4YW2A 4CEWA 4LUKA 2WJSA 1RUH1 2PHLA 4Z07A 1IKPA 1QU0A 3FUOA 1RINA 3MPPG 3ZFGB 1TME1 1DQ1A 4H3WA 2RJLA 2OIIA 1QKQA 1KDMA 4DMIA 1CR7A 4J1WA 4DY5A 3MF9A 1PO23 4LULA 3U4XA 1NYWA 2X8KA 5FPXA 5C8CB 1S1AA 2LM3A 5I8YA 2JICA 2VQ0A 2ATFA 4L2NA 3A0KA 1LHWA 4UW6A 4KU8A 1F5FA 1U0AA 3TBDA 2CTVA 2B46X 1MEC2 2JG8C 3JQXA 1KXGA 4QGMA 4COUA 5FFOC 1URXA 4CEWB 2ZX3A 3VBSC 3JQWA 5E89A 1LEMA 1CIWA 1YCIA 4Y1UA 2LUWA 3KZ4C 5JWPA 4FPEA 1V6JA 1UMZA 2P3JA 3NVCA 4GB31 1B35A 3FLRA 3LGRA 1O3SA 2D98A 3FHIB 4LO8A 2VOVA 4FPLA 3DL3A 1MS3A 1DU3D 2Y0IA 1LOFC 3M3IA 3AM2A 1OFSA 3N36A 3FJSA 4PIYA 4WVVA 1ND3C 1JH5A 1S2BA 2JXAA 1KDKA 4Q26A 3AJZA 2XJUA 1EV13 1YUDA 2D6LX 4QX5A 3ALQA 4O9GA 1KRIA 4OHWA 4URTA 2EALA 4MGIE 4EROA 4Q2FA 3WG3A 1QJX3 1ZZCA 2XVLA 2YC0A 1UPIA 3GF6A 1DIWA 4I30A 2FZ2A 2DVAA 1C1LA 4FSJA 1OKQA 2VVEA 3APBA 3MLKA 1ONAA 2UYAA 4HT1T 3LWCA 2D44A 1NY71 5C4WC 1I6XA 1B35B 2VY0A 1DQ0A 4YZ4A 5AFBA 1PO21 1QQP3 1VBC2 5AC93 3QACA 3LA2A 3KS7A 1FOD3 4ISRA 4JTNA 2ERFA 1SFNA 3RS6A 4FP3A 3U11A 5DUUA 5BNNA 3NJZA 4AEJA 1QJZA 3DF0A 4SLIA 4XTMA 4HVQA 2I74A 2B5HA 1CJPA 5JCTA 1REFA 2DTYA 2A5ZA 2R043 4IEXA 4LHKA 2XB6C 3B01A 2W52A 3S30A 1RMU3 2SLIA 1W2UA 1BYHA 3S6PA 4AXOA 4CDQA 1RUJ3 4Y1VA 1CN1A 4LHLA 1JXNA 4DOUA 4QPYA 1G9AA 4LLFA 3AXEA 4G9SB 3OBTA 4JC1A 4LBJA 3TN93 1H8TC 3FFQA 2XLAA 5K0UA 2OPKA 1H1MA 5KXDA 4XFIA 1Y43B 4Y24A 4RQPA 5D8AC 1YI7A 4YVSA 5BNQA 2GH8A 1VBE1 1ZREA 2YDEA 1VJ2A 4JDOA 2RJKA 1A8DA 3NAPC 1NA1C 5BXXA 4MLOA 3TWIA 3QH6A 2XJRA 2IXIA 1G9DA 4KWJA 1U12A 1DDLA 2E51A 4AFBA 1HQNA 4L99A 4YVWA 1IPKA 4CDQB 1QJX1 3BODA 1A78A 4BZ4A 1GV9A 5EV7A 4Z2WA 2GC3A 4H14A 1JTZX 1BCXA 3CJIA 3VBUC 2NQYA 4COVA 1TMF2 4N7UA 2ZHKA 1BEV3 4X8PA 2WZPP 3ZPYA 1ZZ8A 5K0UB 2WQ4A 1KFUL 4AVAA 3KT7A 5DDJ2 3JB4C 3URFA 3WHTA 1QXRA 3D82A 4KWKA 4RQPB 2R32A 1FOD1 1GFF2 3SH5A 1OHFA 4YVSB 4RHV2 1APNA 2YHJA 3PVOA 2WIIB 2ZX2A 1X50A 5CFDA 1XNCA 2R16A 3UJOA 3TRSB 1HRV2 1Q43A 2GH2A 5C9AC 3ZFFA 4D7YA 2XVGA 1SLBA 1V6IA 1O7FA 4B8EA 2HWC3 2R041 3DUIA 4AI3A 1W0PA 3B00A 4AGVA 2WA4A 1QOOA 4MVTA 4Q4Y3 4UBHA 2XL9A 4YVWB 2I45A 2HWF2 3NKGA 4U36A 1DFQA 4XZPA 1X8EA 3RJRA 3RPQA 4YFZA 3CJXA 4JVAA 1W6OA 2RS13 3CJIB 1RUC3 4WZCA 3MIHA 4XF3A 3LSDA 4XF1A 1J1LA 1U5IA 5JVVA 2OVUA 1AX2A 3R4SA 4UBGA 4LA2A 2XLFA 1V6LA 4OULA 2R1BA 3KSCA 5JZGA 1XU2A 3H1MA 3BCWA 1VR3A 1YJKA 5CFDB 1QF3A 1U5XA 3TNQA 4N53A 2ZGRA 2HWD3 3ZFFB 1S2KA 1YYNA 1PO22 4BPZA 3H0OA 1OA4A 2VOXA 1DLLA 1JUIA 1DBNA 1QOTA 2FMDA 4M3CF 1QOSA 1ZNPA 4N43B 1RUI3 1BQPA 4PLNA 1DZQA 2JJ6A 1LESA 5KXBA 2Q5TA 4Q27A 5HBAA 4QD2A 3WDTA 4S2FA 1N1YA 1VB4A 3KCXA 2B7YA 1W6OB 1NQDA 4P9IA 2E7TA 1BEV1 1DGWA 1DYPA 2IXJA 4JCKA 2P37A 1RUD3 2DCZA 1W6NA 4AYUA 1N3PA 1D4VB 1OA2A 3MPBA 4LE4A 1PZ9A 1ULDA 3HT1A 2D6MA 3USUA 2WWSA 3AKQA 2D5HA 3VBSA 5JZGB 1YFXA 3SHRA 4JDNA 3POWA 4YGBA 4N53B 4AI0A 2BYVE 1VALA 3MF6A