5IK8A

Laminin a2lg45 i-form, g6/7 bound.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
381
structure length
381
Chain Sequence
APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Laminin subunit alpha-2
total genus 78
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik8A02
1FX5A 5E89A 1DQ4A 1GBGA 1YYNA 3AX4A 4Y22A 3V0BA 4Y1UA 1ULCA 2CYFA 3D4KA 3POWA 4DFSA 2CY6A 1DIWA 2A6YA 1S0IA 1O4YA 1QDCA 4Y1ZA 1N1VA 4M3CE 3U4XA 1H9WA 1LENA 1Z78A 3AYAA 3HN1A 4ZXKA 1WW4A 2ZHKA 4YG3A 1C1LA 1MS0A 1QGLA 1UPSA 2EIGA 3AZWA 4R9CA 3SISA 4LBOA 4XIOA 2AUYA 3T1LA 2ZMLA 3T2TA 3ZXJA 3NV1A 2GDFA 4XJZA 2AH2A 2ZGOA 2DVAA 5DG2A 4CTEA 4W65A 3ASIA 4WV8A 1U0AA 3RSJA 1JOJA 1SCRA 4K1ZA 3MW2A 2DU1A 2V5YA 1VLNA 3LSEA 5GLZA 4XHXA 5CB7A 1WLDA 4Q2FA 4FVVA 4BOWA 3FLPA 2EF6A 3O0WA 3AYCA 3WUCA 4ZKTB 3IKWA 3NV4A 2OW4A 1V6IA 3B9CA 2GNDA 3N7LA 3V65A 4LBNA 4FQZA 2AENA 1SCSA 3RRDA 1W0PA 1N1SA 4ASMB 4FPFA 2LTNA 5DXDA 1YRZA 1I3HA 2B7YA 1O4ZA 4YM3A 3JUUA 3M3CA 4YGCA 1HLCA 2E53A 1AXKA 2GALA 2ZGTA 3QLQA 5DZFA 5JOZA 3UJOA 4M00A 1HDKA 2EXKA 1F9KA 4FP2A 3A0NA 2TEPA 1RITA 5DZGA 1W6NB 3AP6A 2UURA 4ISRA 3R4UA 1JXNA 1N3QA 4BM8A 4AYUA 4XJUA 1D0HA 3A4UA 3V64A 1G8WA 3N7JA 1W6MA 5HCFA 2PHWA 3SLIA 2YXSA 1DHKB 2VW0A 3BIWE 4Q8LA 2W08A 1HQWA 1SLCA 1LODA 1QNYA 4FOWA 2UWBA 4AWDA 2SBAA 3WDTA 1QF3A 1WW6A 3WZ1A 2JDZA 1RIRA 2A3WA 2ZZJA 5GLWA 1W6OA 4GA9A 1H30A 3WDWA 3RG0A 4XOGA 1LOCA 4FP3A 1NLSA 2JKBA 1A8DA 5JVVA 1GZWA 3INAA 2P2KA 4FPJA 5JDBA 2ZMKA 1W0OA 1UX6A 5IK4A 3M2MA 3FFZA 2Z42A 4U2AA 1LU2A 2NN8A 2GNMA 3MEPA 1CESA 1GZ9A 3SH5A 1G9FA 2AREA 3WG1A 4BLJA 3TAYA 5GALA 2DV9A 4PBPA 1UN1A 4AGVA 3SH3A 1KQRA 1AXZA 1W6PA 5GM0A 4Y20B 4GXLA 3AXEA 4YGBA 4FOQA 3AP7A 3AP4A 1KRIA 1GNHA 1Q56A 4Q26A 1CJPA 1FYUA 4YFZA 1KJLA 4FOYA 4FPYA 3OGGA 1JBCA 1OQ1A 2ARBA 4GWMA 1W6PB 1ZA4A 1ULGA 2DVDA 3OJBA 2P3IA 1LHVA 5T55A 3ILRA 4ISQA 2ZGSA 4M3CF 4XJAA 1SBEA 1BXHA 2DTWA 4P9WA 4BMEA 2A6XA 4C1XA 3BOPA 1AXYA 1ENQA 4FPEA 1SLBA 2YROA 3AP9A 1FV2A 1YI7A 2A6VA 3O0XA 5CNAA 1ENSA 5GZCA 4IQPA 1GV9A 4RA0A 2DVGA 5E8AA 2D43A 3WDUA 1DQ6A 5H9QA 1QKQA 2R1BA 2W52A 1UZYA 1AX0A 1ULDA 4Y20A 4WVVA 4LBQD 1AJKA 5DZEA 3SNMA 4C1WA 3ILFA 4YW5A 1LOBA 3WDXA 1LHOA 4AVVA 4TYSA 1VAMA 4DS0A 1W6NA 2ZA9A 2EALA 1Z0HA 1DQ0A 2WSUA 3ZXFA 5JOWA 1VIWB 2D3RA 4LBKA 1LU1A 5L73A 2WT2A 5F9TA 2ZMNA 4P14A 5IK5A 4UW6A 1IS5A 3OY8B 3AZVA 1YO8A 1LTEA 5JLVA 4XMAA 2A6ZA 4YGDA 3OBRA 1GNZA 4WZFA 1DQ2A 2ZGPA 1JYCA 4Q1PA 1WD4A 3I8TA 1UKGA 2PHXA 4Z8BA 3N36A 1N47A 2NYYA 5GLUA 2A70A 2ZGRA 2HYKA 2VUAA 3C2UA 3OYWA 3KQRA 1AZDA 3FLRA 2R1DA 2CL2A 4NOTA 3RQ0A 2ZGNA 5LK5A 1GLHA 3O5SA 1DBNA 4YGEA 2ZBJA 1FNYA 1S0DA 2WSVA 1F31A 1VALA 1F5FA 3PJQA 2VW2A 4XILA 1HQLA 1LOAA 1WW7A 3B3QE 1CONA 1GYKA 1S0JA 5DUWA 1QNWA 1ULEA 1GSLA 2ZHLA 3WCSA 1SBFA 2WT0A 1MZ5A 2EXJA 2H0BA 2P34A 3POSA 2ZGMA 3ZXLA 2CNAA 2D6LX 1DQ5A 3USUB 4M3CB 1G7YA 2W68A 3FBYA 2FHRA 4LBQA 4PCRA 4SLIA 2V73A 1LULA 2JE9A 1FAYA 4XXAA 1LESA 2GMEA 1YXWA 1KDKA 1GICA 5F5QA 1KJRA 1QDOA 4JCKA 1N3PA 2NP0A 4HANA 2GMPA 4XBLA 3D6EA 1JW6A 3B01A 1S1AA 2D6NA 2PHRA 1OKQA 3D5OA 3KM5A 5CA6A 1CVNA 3DGTA 1WW5A 3USUA 2AGSA 4DPNA 1S0FA 4I30A 5JOYA 4XTMA 1LHNA 2YV8A 4LBMA 3ZSKA 5T5JA 4YZ1A 4Q1RA 1S0CA 2ZHMA 1IKQA 1Q8PA 3ZPYA 1CR7A 4LBQB 3PVNA 5EXOA 1GANA 3V0AA 1DQ1A 1MVEA 4PQ9A 2C5DA 2D6PA 3R05A 2D7FA 2OVUA 3WDYA 3FUOA 1X50A 2UU8A 4Y22B 2DUQA 2ZAAA 3N3HA 1LGCA 1SLIA 3ENRA 3WG4A 3O12A 3AJZA 1WLWA 1G9CA 1AX2A 4YM0A 3AXDA 1FV3A 2XB6C 1SLTA 2ERFA 5H9SA 3WCRA 2YY1A 3OYWB 3WVJA 2R0FA 2GNTA 3AFKA 4FPCA 5AVAA 2W39A 5IK8A 2Q5TA 5CBLA 1Q8VA 4TZDA 1B09A 1WBFA 4Y1YA 4Y26A 1IOAA 5GZFA 1ULFA 4FPKA 3UK9A 2GNBA 1AJOA 1C57A 2R16A 4FPHA 2D6KA 1LECA 2DU0A 1MS9A 1MS3A 3BTAA 1LHWA 3W59A 2E7QA 4YM2A 4GKYA 1ZM1A 1UAIA 1EPWA 1V6JA 3AZXA 3MW3A 5T54A 1LOFC 3VKLA 4YZ2A 4LBJA 5GLTA 4YG0A 1SBDA 1BJQA 5JMCA 2R0HA 3SITA 2FMDA 5E88A 1CPMA 1BQPA 5IUQA 3WHUA 2DWRA 5IK7A 3GALA 4JRAA 1UMZA 2UWCA 4GWNA 4H55A 4R9DA 5CAZA 5T5LA 2YMZA 3OY8A 1V6NA 3AZYA 1C4RA 2KM2A 5KXCA 5T52A 3HMYA 2DVFA 2EXIA 4M01A 5GZDA 1MR5A 1MS4A 2NMOA 2PHFA 3GNEA 3AYEA 4K1YA 4YZ4A 2A75A 4OZXA 5DG1A 4Y24A 1S0EA 3N7MA 4YZ5A 3LSDA 2AR6A 3M1HA 3N35A 3WDVA 4JC1A 1PZ8A 2A71A 1LJ7A 2ZABA 4FPLA 5H9PA 1KITA 3R4SA 4CZSA 2GMMA 4K20A 5DUXA 4FQ4A 1G86A 3VKOA 2NMNA 4GALA 2ZGUA 2R49A 2A6WA 1R1ZA 2DTYA 4CRQA 4XJ8A 1DGLA 4XJWA 1IKPA 1SACA 3HR9A 3NV3A 4RL7A 3WOGA 1UZZA 1JN2P 2VH9A 4UW5A 1JHNA 3VKNA 1LGNA 2A3YA 2JJ6A 2D3SA 3H0OA 4WVWA 4YW4A 4YM1A 1N1YA 5GZEA 4HL0A 2XG3A 2CWMA 1Q8QA 4GKXA 4Q27A 3DUIA 2D44A 1RINA 2PHUA 2P3JA 3NWKA 5EWSA 5HCAA 1G9BA 1C1FA 1PZ9A 1DFQA 1V6MA 4XDQA 2A7AA 1CN1A 4R9BA 2WQZC 2E7TA 5FREA 2VU9A 2DURA 5KXBA 3FUQA 3IM0A 1KDMA 1LOGA 3JU9A 1S0BA 4XTPA 5DUVA 1W6OB 5EYXA 2YZ4A 1AVBA 3UL2A 1V6KA 5JOXA 3WG2A 1Q8SA 1ENRA 1QOOA 2A5ZA 3AP5A 2GN7A 3SH4A 3ZVXA 3IN9A 1TEIA 3TB0A 4LBLA 1IS4A 2BQPA 4YW2A 4BMBA 1UL9A 4YW3A 3RMYA 4DRRA 3O0VA 2ES3A 1MVQA 3M3QA 1Q8OA 1PZ7A 2PHTA 3ZYPA 2WNEA 5EYYA 1I1EA 3RS6A 1WD3A 1LEMA 3WV6A 4L8QA 1D2SA 4DQAA 5H9RA 3Q9OA 4UW4A 1LGBA 3ZXKA 3POYA 2C9AA 4P9XA 1V6OA 1JUIA 1G9DA 5FRAA 4ATEA 3ATGA 2WLQA 3PVOA 2E51A 4FPOB 4XE9A 4XIKA 3V0BB 2JD4A 1MS8A 3ILNA 1AX1A 3B00A 2EXHA 3I4IA 1WBLA 2NZ9A 4Y1XA 4YLZA 1LEDA 4YG6A 1GZCA 1MACA 2ZKNA 5HCBA 2ZGQA 4XBNA 3OBTA 4AGRA 3IPVA 4XHBA 5DUUA 1IS6A 5KXDA 1VAVA 2VY0A 2CWSA 1IS3A 2UWAA 2I2SA 3VKMA 2RHPA 1GZWB 4PF5A 5KXEA 1LHUA 5SV8A 3APBA 3ZSJA 1FNZA 2LALA 2NM1A 2A3XA 3VKFC 1G9AA 1N1TA 1URXA 4NO4A 1LCLA 1QMJA 3PVEA 1LOEA 3L2YA 4U36A 4FOVA 3CNAA 2D3PA 3N7KA 1DYKA 1NXD1 2DYCA 4ATFA 3MPPG 1V6LA 4BQ1A 3WNXA 1H9PA 1LOFA 2PELA 4BLIA 2WT1A 4D69A 1QU0A 4AVSA 3WLUA 2ENRA 1QOTA 5IT6A 1CPNA 3QCWA 4ITCA 1BKZA 5T5OA 1J1TA 3AYDA 1AF9A 2D6OX 2OUHA 4XMIA 2SLIA 1YIFA 2ZACA 3AZZA 1ONAA 4UW3A 4XJ9A 1Y7BA 3ZXEA 4P9YA 1HKDA 3RMXA 3VUOA 2ARXA 1SFYA 2ZHNA 2P3KA 2DVBA 2WJSA 2D6MA 3BODA 1SLAA 2G4IA 1A3KA 2VXRA 3M3OA 3NV2A 5GLVA 2JE7A 4BPZA 4YZ3A 1FATA 1MS5A 4K21A 1A78A 4M3CA 4DRVA 4Q8KA 4XXPA 1W6MB 1XQNA 4F83A 1GKBA 2VW1A 1DZQA 4KBBA 3W58A 2P37A 2AYHA 2ZGKA 4PBOA 1W6QB 1WUVA 3LCPA 3WUDA 3M3EA 1MS1A 4FPGA 1N3OA 4R9AA 4XBQA 3V0AB 4YFWA 2CTVA 1SLLA 2OUJA 1S0GA 5T5PA 4XYXA 4MYEA 2DUPA 4YW1A 2EAKA 3ZYRA 4XZPA 5GJ6A 1WLCA 1CIWA 3PMEA 3ZSLA 5GZGA 2WKKA 4AGGA 3OPZA 2DUOA 1QOSA 3WHTA 3A0KA 4AVTA 2ZGLA 2E6VA 5BYNA 2JECA 1OFSA 1BZWA 3AJYA 1V00A 4Y1VA 3VV1A 3IPVB 3UJQA 3AK0A 5T50A 3MW4A 3FLTA 3T1MA 1JYIA 1WCSA 1CQ9A 1DYPA 1MZ6A 1BYHA 2GN3A 3ZSMA 1DLLA 3WG3A 3IMNA 1W6QA 1APNA 3B69A
chains in the Genus database with same CATH superfamily
2CAVA 4D6QA 3WF2A 1YJLA 1DQ4A 1GBGA 1YYNA 1YUDA 3AX4A 4OHXA 4Y22A 1ULCA 3VDDB 2CYFA 2VR4A 3OUHA 3POWA 4BHPA 3ZYHA 3S5AA 3VZJA 1S0IA 1D4VB 1QH7A 3ZFGA 1TE1B 2RS12 5IVYA 3R4DB 3U4XA 1H9WA 1V70A 1Z78A 2WABA 5HCHA 3TEXA 1WW4A 2ZHKA 4YG3A 1AR61 2HWB1 1PNFA 1SDWA 3AZWA 3U11A 4V2WA 1EV13 3CJIB 3T1LA 1VRH3 4K7JA 2GDFA 1AR92 1Y43B 1ZZ9A 4W65A 3ASIA 4WV8A 2ZX3A 5FCCA 1GP6A 1SCRA 5C5TA 5IYYA 2Q0AA 3MW2A 2V5YA 3LSEA 3NAPC 4X6RB 5DQ0A 5FLIA 4WVMB 3SCGA 4XF0A 1WCUA 2QZ2A 1IGOA 4O61A 5IVVA 4CCOA 1BVVA 3LEMA 4FVVA 1QJX1 2EIEA 4ZKTB 3IKWA 4W4ZA 1MZFA 4NMIA 2GNDA 4NVPA 1DF0A 1K5MA 3UT0A 5A3PA 2W9XA 4LBNA 1CGPA 4GB33 1SCSA 2ZEZA 3SEEA 4AFCA 2GZWA 2MHFA 2B7YA 3VBUC 3PVBB 2EAAA 2Y6HA 4YM3A 2Z79A 3UETA 1S4CA 4AG4A 2GALA 2ZGTA 5DZFA 4AAXA 2ZKLA 1F9KA 4DIQA 2TEPA 3LZZA 3HVDA 2P1BA 1W6NB 1V9U1 3AP6A 1ZVFA 1MQTA 4Y5Z0 4QHOA 1D0HA 3A4UA 3KCCA 3N7JA 2YGMA 4AAPA 4M0HA 2B8MA 5AC92 5FV3A 1QJU3 5FPZA 2XJSA 4D0QA 3KF5A 4FOWA 2UWBA 3MIGA 1AYM3 4JGYB 5JXGA 4MGYE 5CZKA 3HQUA 1QF3A 3PIGA 1WW6A 2QQLA 2A3WA 5LATA 4IEQA 4GA9A 3WP6A 2RJ2A 4XOGA 1QJEA 2E7AA 1KGYA 4FP3A 3WNMA 2K46A 4BYYA 3UESA 1O3RA 4YW6A 4KG0A 4B29A 1W0OA 1UX6A 2W5FA 1MEC3 5FUIA 4XETA 5FZ6A 5FP8A 1W8OA 2DCYA 2GNMA 3SH5A 3HPNA 1G9FA 2AREA 3IDCB 3WG1A 4BLJA 1O4TA 4XDPA 2OIIA 1JUHA 2DV9A 3QBQA 4PBPA 4D94A 5KWRA 1KQRA 4A41A 1AXZA 3HQXA 4P08A 5FK8A 3VBFA 1D4M2 4K40A 3AP7A 3AP4A 2WQ4A 2J1EA 3MLJA 2QQMA 4UI9L 3VZNA 1KRIA 4CDXC 4FOYA 5FZ3A 2CV6A 1UY0A 1ULOA 4FFFA 2VQAA 1ZA4A 1IG3A 3ITQA 3NAPA 5FO9B 1H6YA 1LHVA 3OPTA 3ILRA 2XH6A 2FDHA 4ISQA 2ZGSA 1SBEA 2BYVE 1O91A 3THPA 1F2NA 2DTWA 3ZN6B 4P9WA 1ZRDA 4BMEA 2A6XA 4UFKA 2PLV3 4HLTA 2BNMA 1TNFA 1FV2A 2Q1MA 5GZCA 1ENXA 1QJY3 4IQPA 1GV9A 4YARA 2XWJB 5FLHA 1WCDJ 5LEJA 1F35A 2WO1A 5A6QA 5DZEA 4CVUA 2FDIA 3WDXA 2JXAA 2R071 3I2HA 4SBVA 5HBAA 1UOGA 3CBNA 1CZVA 3PUQA 5EPAA 2ADDA 1VAMA 2ETEA 2ZA9A 2HEVF 2EALA 2LROA 4DXTA 3MFCA 3NAPB 1NE6A 5FXVA 1ND2B 4LBKA 1QEXA 1RUJ2 2VGDA 4F8AA 3L9JT 5L73A 2WT2A 2ZMNA 2O1QA 4DMIA 1ALYA 5I8SA 2QQIA 1ACCA 3SKJE 3VBHB 4COWA 4GB31 4AI1A 3A21A 3VBFB 4CP2A 2A6ZA 5CADA 1OC1A 3OBRA 1PIV1 1GNZA 3J8F3 4E4SA 1VRH2 3DXUA 1CZSA 1MEC1 3MV01 4IEVA 1JYCA 2ARAA 4N53B 1QXPA 4Q1PA 3SEPA 1UKGA 2WWJA 3P3PA 4AI2A 2HKXA 1YCIA 1R081 5GLUA 5J36A 2WLPA 2ZGRA 4QPGB 2QQOA 2XBO1 4XFBA 4BQWA 2VUAA 3C2UA 3KQRA 2V72A 3LEKA 3P5BA 1KS4A 5EQUA 2ZGNA 2YUEA 4LR4A 3KVAA 5AFBA 2FDGA 3NNJA 3O5SA 4JGYC 4PLMA 4YGEA 4E8DA 3MV11 2Y33A 5DMYA 4MGQA 4GB32 1S0DA 2WSVA 1F31A 2OPWA 3VN4A 4COYA 5FXWA 4XILA 1UNBA 1WW7A 4AFAA 2LW8A 4AE2A 2O8QA 4FAGA 3JBG3 2Y6JA 3ZR5A 4LPLA 4URTA 1SBFA 5FIXA 4B3NA 4IV1A 4N43A 2ADEA 2FBEA 5DAPA 4HSJA 4K3UA 3ZXLA 2FMYA 2CNAA 4CCKA 3USUB 3Q8EA 3FBYA 5B4XA 4QPYA 1MQTB 1YWKA 2QDRA 1NKGA 2LS6A 2ZX0A 4PI0A 5FXXA 2D5FA 5CKQA 4JTOA 4CDWA 1GICA 4BISA 4D3WA 1OQEA 1COV2 1S2BA 2GMPA 2RMU3 3CZJA 4IE7A 4O65A 5JPMB 3B01A 3T09A 2WC2A 5J37A 3E1F1 1W9SA 1OKQA 5CA6A 3KM5A 5LW9A 2WDBA 3AKPA 2D97A 4EV0A 4I30A 3TEWA 5KHIA 4XTMA 4IEPA 2YV8A 4YVSC 2B5HA 4OUEA 2ZXQA 5DDJ3 1OH3A 1SQ4A 3UGFA 4AXOA 3WP5A 1DQ1A 3I3MA 1GWLA 2MPFA 4LA2A 1OLME 2D7FA 4LUKA 1GU3A 4PIXA 3WDYA 2Z5WA 3ZM8A 5D8AC 3N3HA 5LA9A 2DF7A 1SLIA 2YU2A 3VBHA 4FT8A 2PQSA 2BW8A 2FZ1A 4YM0A 1NQJA 5EIYB 2K2SA 2XHNA 3PHMA 4XFFA 2BZDA 3AFKA 4OCTA 2Y6FA 3I2DA 3PNAA 2FDFA 1SPPA 5CBLA 5C6CA 1Q8VA 2VBBA 3VZOA 4RD7A 3FN9A 2IXHA 4N53A 5BNPC 5GZFA 4FPKA 4YVWB 4CA9A 1AJOA 4KQ7A 5A7SA 3UGHA 4OMCA 1LECA 5KC5A 2QTWB 1NLRA 5FWEA 1MS3A 3TYJA 3ZXGA 1DLCA 5FK7A 5FQ0B 4CPBA 1KXGA 1PO13 2E26A 3EHKA 3ZDSA 1ZM1A 1UAIA 1EPWA 4PLOA 2ID4A 1LOFC 3ZYIB 1UO9A 3J4UH 4IE4A 4LBJA 2XL7A 3KGLA 2JG8A 3FMGA 4YSFA 2RS51 3ZN6A 4IL7A 2QVSB 4Z2WA 2VOWA 3R6SA 4CYDA 2FMDA 1W8TA 2PTMA 3NJXA 4EN7B 3SC7X 1CPMA 4OI4A 1BQPA 5IUQA 1ZRCA 2XKPA 3RZKA 2P3YA 1HRV3 5IK7A 1WMDA 5LA1A 3K4AA 4JRAA 1BEV3 2IXIA 4GWNA 4RHV3 5CAZA 5FZFA 4FTSA 2GC0A 4XUOA 1AR93 2EXIA 4XPVA 4BWOA 3LB9A 3ZIXA 2JENA 1W3VA 3MUY1 5ANQA 2RR13 4S2FA 3M1HA 5FZ0A 3CIHA 3H50A 1WA4A 4JC1A 5FY9A 4S2HA 1RMU2 2QCSB 3EXUA 1W3XA 3CJIC 1OVSA 5L36A 4FPLA 2ZABA 3PLQA 1KITA 3AC0A 3SKVA 4CZSA 1XE7A 4K20A 1EV12 5BXXA 2W1SA 4GALA 2R49A 2A6WA 1R1ZA 4QQPA 3LPFA 1O3QA 5TSWA 3HR9A 1X9PA 2F6BA 4OI0A 4QKFA 1JTZX 1CX4A 1DGRN 3KCXA 3WOGA 4E2GA 5DN2A 2VH9A 4PJYA 4UW5A 1C28A 3VKNA 1LGNA 1UQXA 2A3YA 5BNOA 4YM1A 2YBKA 4HL0A 3WT3A 2CWMA 1Q8QA 2QUOA 4GKXA 1XJAA 2D44A 5EWSA 3NWKA 5HCAA 1A34A 3VBUA 1SHWB 2WRAA 3VBSA 4IV3A 3BYWA 1DFQA 3BKZA 4IGOA 4W6WA 4LKDA 4Q4V2 2WQZC 2RS52 1J84A 2RS32 1KEXA 3IM0A 1OSGA 2JG9C 2HBUA 2DCTA 4CUGA 4C91A 4QDSA 3P1IA 2BBAA 1HB2A 2R042 5EYXA 2YZ4A 1F4HA 2Y38A 3FX3A 1VBD2 5FOJB 1JHJA 2J1UA 2VXJA 4ZS3A 1PO21 4GULA 5JI9A 2WO3A 1NLQA 1ND2A 2C26A 2E9QA 4NWWA 5DAWA 2ES3A 3THDA 4A3XA 4AI8A 2YDEA 3EBRA 4LUMA 1R091 1Q8OA 5FY1A 2HYXA 5CFDA 2TUNA 2Q8EA 5CKMA 3J9SA 1I1EA 4E2QA 2WYSA 3ZXAC 4L8QA 2VMCA 4PHZA 1JYXA 2GU9A 4DY3A 3Q9OA 4P9JA 2BOIA 1ASJ2 4Q4W2 5FY8A 1GR3A 2O0OA 5IATA 5FRAA 1OLMA 1D7PM 5I0TA 2WLQA 5K0UC 1VBE1 2C1FA 4FPOB 4XIKA 3V0BB 1RUNA 2JD4A 3ILNA 4FSJA 3LA7A 3UV9A 3VD5A 1MQTC 3OB8A 4HKOA 3I4IA 2BVVA 2Y6GA 1WKYA 4HN0A 4YLZA 3PL0A 3IAPA 2ZGQA 3BB6A 3CEWA 1CJDA 4B7KA 3B7MA 2VM9A 5FYMA 4XHBA 3RWNA 3J8F2 1WCKA 4HT1T 1VB4A 1VAVA 2CWSA 5KXEA 2I2SA 3VKMA 2RHPA 1GZWB 4A42A 4HOOA 2GH8A 4PDWA 1T6BX 2NM1A 2A3XA 1S2EA 4CCJA 1GWMA 4CCLA 1URXA 5C9AC 1QMJA 3POIA 1LOEA 4FOVA 2OZJA 4OHWA 2ZS6B 1LOFA 4FI9A 1L7RA 2WT1A 3CL1A 5A3WA 3O1UA 4AVSA 1AR72 4CU9A 2JDPA 3AMPA 2Q1FA 1PNGA 1AF9A 1R082 2D6OX 4A7ZA 2SLIA 2BFUL 4QX8A 3ZXEA 4YVWA 1OA4A 4WM8B 2J22A 3D82A 4B1LA 3KSCA 4TN7A 4DUXA 2Z4FA 2WJSA 2DVBA 2Y34A 2ZHNA 3AFGA 4Z82A 4AQ6A 4ARXA 3VD7A 5GLVA 3J7MA 4O9EA 1UY1A 1FATA 1MS5A 1ZBA3 4KNCA 3WNLA 4DRVA 3TBDA 1UY3A 1XQNA 2VW1A 1DZQA 3WW2A 2P37A 2QBXA 1EAH3 4EN0A 2ZGKA 4AVCA 1FMD1 5F5IA 4G9SB 3TN93 3VBSC 1N3OA 4R9AA 3I2JA 5F3CA 3V0AB 5KBFA 1SLLA 1PIV3 2OUJA 1S0GA 3J8F1 5F37A 3W20A 1AR71 4MYEA 3MIEA 2H6CA 3I59A 5EHDA 5M0TA 5BPXA 1CIWA 4Y4YA 5GZGA 4Q4Y2 3W5MA 1X7NA 4AGGA 2ZEXA 4LHKA 2ZGLA 2E6VA 3VLBB 1OFSA 4XACA 5FUNA 5CYYA 1RUC1 1R64A 4Q4X1 4BQYA 2WL1A 4E27A 2HWD2 1HRI1 5T50A 3UJQA 4A45A 5L19A 2JWPA 3AB0A 5DAXA 2HWC2 1CQ9A 1OA3A 5IVJA 1REDA 1F5JA 1MZ6A 1RUC3 4CUAA 3PDQA 2Y60A 3I2GA 3MFAA 1W6QA 3I2IA 4GWIA 1FX5A 3VBRB 4LHNA 2IZWA 3IMMA 4QU2A 3V0BA 4XZUG 2WNUB 3RI9A 4BQ5A 2CY6A 1DIWA 2A6YA 1O4YA 1O3SA 1QDCA 1WZXA 2QKDA 1AR73 4Y4RA 3HN1A 4ZXKA 4IW3A 3T30A 2B9UA 4BH9A 1C1LA 1O8SA 4WM7C 4B7EA 4JV4A 4RFT0 3MGUA 4PT6A 4LBOA 4XIOA 1RUOA 5CG9A 3FJSA 2I45A 3ROUA 3T2TA 5JAXA 3H8RA 3NV1A 4FCAA 1UXZA 4XJZA 5FZOA 1VBA3 3I49A 1UYPA 2XJPA 1GQGA 3E5XA 3MHZA 5DG2A 4GMP3 1JOJA 2WZR1 4K1ZA 2WFF2 3ACIA 3B5LB 4HKLA 5GLZA 5ABJB 1OHFA 4JZRA 3GBGA 5FR3A 4IDZA 1JU4A 3FLPA 2EF6A 3GDBA 3AYCA 1T2XA 4CPBD 1NYWA 3C7EA 3NV4A 1J59A 1V6IA 2HBTA 3N7LA 4FQZA 2AENA 3RRDA 1S2KA 5B4NA 1FI2A 5I0SA 2WZPP 2VL4A 3USSA 2YFZA 3H3UA 2R063 4QM8A 1O4ZA 3VL8A 3ZKUA 4QDQA 5LZ6A 1VBB2 3JUUA 4YGCA 3GGLA 4ZHNA 3WW3A 3A22A 4XF4A 1ASJ3 3CDZB 1HDKA 2EXKA 4DY5A 3A0NA 5G04L 4ORFA 2V09A 5JR2A 3R4UA 5HXMA 5C33A 1N3QA 4PDWB 4AYUA 4XJUA 2ZCWA 3V64A 2PHWA 3FWEA 3EYPA 2WZ8A 1DHKB 2VW0A 4I02A 4Q8LA 5AFEA 3LDBA 2P17A 4UWDA 2UY8A 1FT9A 5DAVA 5LASA 2VQ0A 2Q1ZB 3S57A 1VR3A 1L7QA 4QD2A 2VMEA 2SBAA 2XMLA 3WZ1A 3CF6E 1HW5A 2J7MA 1RIRA 3POBA 4CXXA 2HEYF 2ZZJA 4MXWB 5GLWA 1H30A 3DV8A 3RG0A 4EYUA 5ACA1 1LOCA 3V56A 4RFRB 1TMF2 5A1AA 4OUSA 2AZ5A 4XW3A 2RS53 3INAA 2P2KA 5JDBA 2ZMKA 3FE5A 1NY71 3HD8B 1W99A 3GYDA 4K8FA 4OULA 5F8PA 4Q4Y3 4MSVA 4A4AA 4IEXA 1CESA 1GZ9A 1QJY1 1D2QA 1XNTA 4BA6A 5FOBB 3UKVA 1TMF3 5FPAA 3DYMA 3TAYA 1IQAA 4I09A 4M4PA 4GZ9A 5GALA 1JYNA 5GKAC 5I93A 1R1A1 2ARCA 2PAEA 4R4XA 4GXLA 4LEJA 3AXEA 1RUH1 2LM3A 4GD4A 1YFYA 5IVCA 4YGBA 1NCRB 1TMF1 4Z07A 4AHXA 1GP4A 1GNHA 4JHZA 5C8WA 3KCYA 3NQHA 4Q26A 1FYUA 1KJLA 3OGGA 5C3PA 1QJU2 5I8YA 3PTRB 4G3YC 2VMDA 3CQOA 2VZRA 5D1IA 4B4RA 2DVDA 2W46A 1RGSA 2P3IA 3VDBA 3Q8BA 1QH6A 5C3RA 3O1RA 4XJAA 2JD9A 1SPPB 1BXHA 2AEZA 3B9IA 3HNMA 2VMGA 4XEZA 2LUWA 2RDSA 1X82A 3HAGA 1AXYA 1ENQA 1RUF3 4QPIA 3VD3A 3U14A 1Y3TA 5FZIA 3B93A 3WDUA 2D43A 2TNFA 5FQ0A 3U0ZA 5FJHA 5H9QA 4BCUA 4LTAA 2W52A 2R1BA 1NCQA 3S7EA 1M06G 4P5YA 4Y20A 5A3OA 5FZDA 5LRRA 3WNPA 3JCIA 4LBQD 3SNMA 4C1WA 3ILFA 4MGZE 1UMHA 1O8PA 1OLQA 3WW4A 3AMMA 5CFDB 4DS0A 4D8MA 4OI2A 5LBCA 5ABJC 1RJ8A 2WSUA 4IESA 2X05A 4B4QA 1AUYA 1UKRA 3T4HB 1HX6A 4H3WA 4W50A 3N9NA 3KHBA 5D8AB 4QX5A 4MGTA 3WXPA 1IS5A 4AI9A 3OY8B 4AFDA 4WZCA 1TME3 2BOJA 1LTEA 2X5IB 4UF0A 5HV4A 2Y0IA 1UZ0A 1UY2A 5F3GA 5LRSA 1LB2A 3I8TA 3PTYA 2DCKA 1BBT1 2WR9A 2YB7A 2XWBB 1A8MA 1R093 2A70A 5FMDA 2HYKA 4CEWB 3OYWA 2JDKA 4RGAA 3FLRA 2R1DA 2CL2A 1ND2C 5EV7A 3RQ0A 5LK5A 3SCFA 1X8MA 1GLHA 3OTFA 1POQA 2HWE1 1DBNA 3H3LA 1GNYA 3SXWA 5FYCA 2B4KA 4EROA 1JH5A 1OPOA 1J1LA 1VALA 1F5FA 2VOXA 5C5UA 4LHSA 2WYFA 4XFIA 1LOAA 3OD4A 1B35A 2CGNA 4LO4B 4X6QB 3B3QE 4MXVA 2JEMA 1S0JA 5HV0A 1QNWA 1ULEA 5A3TA 5K8SA 3O1OA 3FL7A 2J1TA 2ZGMA 2GP5A 4AQSA 1BVP1 3RJRA 1DQ5A 2RM23 2VCBA 2W68A 3MIDA 4PF1A 3ACLA 3ZLIA 4P9IA 4LBQA 4PCRA 4MGIE 4SLIA 2RMU1 2V73A 1LULA 1H0BA 1MPXA 5BUVA 1FAYA 4QDRA 5I91A 5C3QA 5C8CA 2WZR3 2FCTA 5F5QA 5A32A 2CSGA 4COVA 1PGW1 4QMAA 5BNPB 4NHLA 5EP9A 3C7OA 1VBA1 4JCKA 2OPKA 2NLRA 1PO22 5A6YA 2QQPA 1S1AA 5FZCA 2JICA 1QXRA 5CFCA 4CP9B 4DPNA 5IFTA 1H2NA 5JOYA 2RR11 2VPVA 3NL1A 3ZYJB 1Y9QA 3I59B 1S0CA 5T3NA 1RVF2 1IKQA 2ZHMA 2QDNA 2BWCA 4LBQB 2PA7A 1GANA 3V0AA 1HXS1 3K48A 4W8JA 2D6PA 3IDBB 3NJYA 4MG2A 3HIFA 4CP9A 3DPRB 3ES1A 1X50A 3M4FA 2UU8A 2XLGA 4L92A 4ASKA 3VZMA 3EB7A 3GHNA 4JDOA 2VE1A 3O12A 4LE3A 1G9CA 2VNOA 2RMU2 1PK6C 1FV3A 4NUBA 2XB6C 1SLTA 2VCAA 3RPQA 3WCRA 3DL3A 3ZMOA 2R0FA 3OUIA 5E1RA 1RL3A 2XDVA 2Z69A 1OUSA 1OBNA 1EAH2 4QQOA 1D4M1 1AYM2 1QJU1 1B09A 2VZ1A 1JI6A 3BCWA 1QJFA 4LHLA 1QJX2 1ULFA 3LIGA 4FPHA 4MOAA 2JX9A 1H8TA 1RMU1 4QQ2A 1ZX5A 4UYBA 1VBB3 4L97A 3BTAA 3TN91 3CJXA 3W59A 4CEWA 4D7TA 2VTFA 2E7QA 3I97A 4CCCA 3U10A 2PHDA 3H1YA 5T54A 2ZEYA 3VKLA 4YZ2A 3U4SA 3MIBA 2ATFA 2XQXA 3SMHA 1JZ6A 2WNVA 1OOPA 4LORA 5GLTA 1B35C 1BEV1 1OT5A 4FTEA 2R0HA 3E6BA 4QB2A 5E88A 4E9KA 3LFMA 4QU1A 2Y26A 4Z2AA 2IC1A 1SDDB 2X53S 3ZDVA 2X29A 3F2ZA 2UWCA 3EO6A 4EZHA 1C5HA 4IEYA 2JB4A 4MVTA 3VL9A 3X29B 4RS5A 3I2FA 5EFUA 3ZR6A 4J6GA 4XFCA 1K45A 1ND3A 2VOVA 3K4ZA 1RXFA 3POFA 5KHHA 5T52A 3HMYA 2DVFA 3J7HA 2CDPA 1MR5A 4HN1A 4Q0SA 3JB4C 5JXJA 2NMOA 2PHFA 3P6BA 4CDWB 1PHMA 1AYM1 4OZXA 1S0EA 1DYOA 1VMHA 3N7MA 2AR6A 3WINE 1HN0A 4N53C 4YVSA 4URAA 1V9U2 2XGXA 4EE2A 4DZGA 3BI3A 3R4SA 1XNAA 2EA7A 2RS11 2X5IC 3HWJA 4IV3B 4QKBA 4TWTA 4NIAA 5CFCC 2FD8A 5DUXA 4FQ4A 1LKNA 5A7WB 3VKOA 2XPJA 1C8M1 2ZGUA 5C7GA 1RUG3 1IKPA 4I0WB 2WA4A 2YU1A 3GZUC 4NAOA 4FBFA 1UMIA 1UZZA 5JZGA 2VMIA 1HB4A 1SFPA 2G19A 1BHGA 4YVWC 2JJ6A 3H0OA 1VMFA 4UF0B 4WVWA 1N1YA 2XG3A 3J7NA 3DUIA 1UCXA 2PHUA 3T0DA 4Z92B 1C1FA 1NT0A 3ZPOA 1DP0A 5FP3A 4JDNA 4XDQA 1X33A 2FZ2A 1ZZ6A 5E6HA 2LRPA 4R9BA 5FREA 2E7TA 4DXRA 2DURA 1C8M2 3NRUA 2XXZA 1DZRA 3S30A 5K4LA 1PMHX 3UNPA 1S0BA 4XTPA 2GH2A 4P9GA 4XURA 5FAXA 3E5QA 1AVBA 2QNKA 1PGW2 1RVF1 4NHXA 3OCPA 5J98B 2VC9A 1ENRA 1KS5A 1QOOA 2DCJA 4RS5C 2NQYA 3MUZ1 1SG3A 2KR2A 2QJVA 3SH4A 3BU0A 1TEIA 5FY4A 3LF7A 4LBLA 1IS4A 4HZFA 1NQDA 4YW2A 4XAEA 3SQOA 5C71A 5C9AA 3SHRA 4YYOA 3WSOA 1MVQA 1YFUA 3HEIA 3M3QA 1RUH3 1PZ7A 1QXJA 2PHTA 1UIKA 2XJVA 1O3TA 2WNEA 2VZUA 2YBPA 5EYYA 3URFA 1AR91 1LEMA 2IXKA 1UU6A 2JG8B 4BB3A 4BXFA 3O1MA 4Y5TA 1LGBA 3HQRA 3WF1A 1ZYBA 4P9XA 1V6OA 4PI2A 1HB3A 4NPRA 3N9MA 3ATGA 4KU7A 4HVQA 4XE9A 5CISA 1FPN3 5L7OC 2WN3A 1GZTA 1RUE2 3JBG2 4N7IA 4CCDA 3LOBA 5J7MA 2EXHA 2PYTA 4HVRA 4Y1XA 3POGA 4EWDA 4A44A 1TZOA 4R52A 4TSVA 4HONA 4EZ4A 1M4WA 1BLZA 3I2KA 1AL22 2WN2A 4YW7A 1ZBE3 4FXKB 2BU9A 5IW0A 1DCSA 1IS6A 1PMIA 2VZ3A 2VOTA 3FHQA 2VY0A 1IS3A 4PQQA 1US2A 4PF5A 5C70A 2PXJA 1O5UA 3NNFA 3APBA 3ZSJA 4BQ4A 1FNZA 1G9AA 5CG8A 3NW4A 2CGPA 2HWE2 4NO4A 2WAAA 4NJ4A 5KXBA 2YFUA 1ZBE2 4ARYA 1W9FA 2JDYA 1NZIA 2YPDA 1XSRA 1DYKA 1NXD1 2DYCA 4BQ1A 2PELA 3PJYA 1RJ7A 3RZGA 1QU0A 4GH4A 3L2HA 1GOHA 3MF9A 2XJUA 1Q43A 5A70A 3QCWA 2ZJCA 4OQ8A 1BKZA 2BFUS 2VBPA 4QKNA 3RI8A 4AZZA 5CFCB 2QQWA 5IVBA 3AYDA 5BNNC 1YC61 2DBIA 4K6BA 1CAUA 2ZACA 3OGSA 4RQPA 2RG4A 1YI9A 1Y7BA 4UW3A 5A33B 1HKDA 3ELNA 2BNNA 4BE3A 1QWRA 2O8OA 3PUHA 4QM9A 4UFJA 2Q4SA 2X09A 4XUNA 2UY9A 2Q8CA 4JKKA 3S5QA 2H0VA 3CZUA 2WNOA 3H1MA 3U37A 1TQ5A 4ZY9A 4AQ2A 5IFPA 1A3KA 2WFF3 4KGGA 3M3OA 3NV2A 2JE7A 3KWVA 4YZ3A 4K21A 1W06A 1A78A 3GCXA 4UFMA 3RZZA 1OF3A 1W6MB 1GKBA 4JGZB 2ZPXA 4KBBA 5F1RA 2OX0A 1F4AA 2X8KA 3LFIA 5FZEA 1S55A 4PIZA 1J3PA 1VBD3 4HPKB 1H1IA 1D4M3 3LCPA 4L99A 4XC9A 3M3EA 4FPGA 1RUH2 4DB5A 4LO8A 4KWUA 2DDUA 1B35B 2XR4A 5E16A 1IPKA 4RS5B 1EUTA 4XCAA 1JOPA 2D40A 2EAKA 4Y33A 4LOSA 4YW1A 3F95A 1UWWA 3GHMA 5DDJ1 3J7LA 4OFGA 2G9GA 4A6SA 2X5IA 5A6XA 3VBRA 1BMV1 1W90A 2BP6A 2XUEA 3ZFEB 3T08A 1JZ4A 1GOFA 1QOSA 2DUOA 4GMP0 5FYZA 1UXXX 2W1UA 2VQUA 1GMMA 2HWC3 2JDNA 2YC0A 4O9GA 3IPVB 3DCQA 3LEGA 4Q0QA 4W6YA 4DNYA 2HH9A 1JYIA 1PX4A 3WR0A 3U1XA 3WF4A 1DYPA 2GN3A 1BYHA 4AQTA 5AC91 5JIUA 2N7GA 4EQVA 4Q4X3 4XF9A 5FZ8A 3VBOB 1EAH1 3B02A 1NCQB 2IFRA 4Y1UA 3D4KA 4QXKA 3H42B 5FXZA 2PMWB 2WZEA 4H14A 5AC93 1UZWA 3C8XA 1HV1A 3H1WA 4MH0E 4Y1ZA 5LA0A 1LENA 1RMU3 1YIPA 2Z2SB 1OURA 1Q3EA 3TEZA 3WQBA 1ODNA 1K5JA 1DGRA 1R092 3TN92 4IV3C 1MS0A 5FYTA 1ST8A 2EIGA 4KBZA 3FHAA 1RYYA 4RR3B 3FHIB 5FP7A 2ZMLA 4CE8A 2IWGB 1AYN1 3H8OA 2XBO2 2AH2A 2BV4A 4YPJA 2DVAA 2VO5A 3PURA 4PIYA 1U0AA 2DU1A 1RUD1 2WAOA 3AL5A 1VRH1 1HRV2 3RYKA 4C0BA 3THCA 5C3SA 4NPMA 4Q2FA 5FPUA 5L7OA 1J3QA 2V4VA 4J1WA 4BOWA 3K3OA 5FYYA 3WUCA 3K75B 2OW4A 4KH9A 3B9CA 3MIHA 5FBJA 4D7SA 4LJHA 3V65A 2D93A 3WQ7A 2FCUA 1W0PA 3WNNA 2R32A 4BU2A 4RHV2 3KV6A 4FPFA 4QXHA 2LTNA 4ASMB 5DXDA 4I3GA 3LA2A 1I3HA 3H7YA 1FPN2 1HIXA 2UYBA 4FFGA 4JAAA 3I2OA 1GQPA 1HLCA 3UYJA 1WCQA 1AXKA 1QIQA 4JRLA 4S2DA 4DOUA 5JOZA 3TEYA 4M00A 4XAAA 1PGL2 5IJRA 3WP3A 1ODMA 4CUCA 4FFIA 1I5ZA 1JXNA 1REFA 4LKEA 1L7LA 4OYUA 2OQ7A 1G8WA 5HCFA 4DXSA 2MEV1 2YXSA 4ZXEA 3SLIA 4BDVB 4BXSV 1VBA2 2ZX4A 1HQWA 1SLCA 1QNYA 3KQ4B 4LQRA 5FUPA 4AEMA 1NA1B 4Y5SA 2Q8OA 4CDUA 4AR2A 4AWDA 1XC6A 1NCRA 4XVHA 3VDCA 3ZYBA 1GFF2 3FZ3A 4LO6B 1W6OA 3WDWA 2W1WA 1RHI2 2ZAHA 2AC1A 1NLSA 2JKBA 3MIFA 1A8DA 3DPRC 4I3PA 5JVVA 1GZWA 2EIBA 3K46A 1HN1A 4WM7B 4JGYA 4JKMA 2KD7A 3M2MA 2Z42A 1LU2A 1XB9A 2B42B 3KV9A 5CKNA 2RJLA 3RNSA 4UXAA 1H1MA 2J1SA 4GMP1 5LA2A 1HV0A 5FYBA 5IWFA 4ES8A 2VUCA 2DBNA 5DPNA 2JDMA 1Y9GA 4JQTA 3SH3A 3VBRC 4COZA 1BCXA 1W6PA 5JZGB 5K9YA 5GM0A 5CFDC 1WMFA 4Y20B 5FYUA 5A1FA 3I54A 3IDEA 3OGRA 4E4HA 2XJRA 5JUVA 5JMOA 1CJPA 5A7NA 4QXCA 4B8EA 4YFZA 4FPYA 1JBCA 2ARBA 1XYNA 4KWLA 3T2QA 4KG8A 4OVEA 1EPZA 2PLV1 2RDQA 2YHJA 3GXUA 3RYRA 3MPBA 4XF3A 4BIOA 2PAMA 1RUG1 4HK8A 4LKFA 2IVJA 1JODA 2ZTNA 1OVPA 4I0BA 4FPEA 5ISLA 1SLBA 2YROA 2CHHA 3AP9A 3ZYFA 1Q5OA 1RHI1 3NNMA 1A6CA 5CNAA 3VBUB 4LLFA 5ABJA 4RA0A 2DVGA 3ETQA 1DQ6A 3HN3A 4QB1A 2XONA 2GSYA 5FYHA 2VUDA 1AX0A 2PQQA 1CAWB 4BZ4A 5FO7B 1MZEA 3N4MA 4CUBA 4YW5A 2WS91 4OHVA 5FLJA 4ONUA 3RDIA 5I8TA 1PVC3 1JYTA 2JKXA 4LLOA 4TYSA 3T0BA 3O1PA 1W6NA 1Z0HA 5A3UA 3LA3A 1FMD3 3VHOA 3ZXFA 1KD7A 2P6HA 1LU1A 2OA2A 5F9TA 4P14A 1OKOA 5IK5A 4UAPA 5A6ZA 2JIGA 2L9LA 4A7YA 3AZVA 1YO8A 4MADA 2Y0OA 4GIQA 4XMAA 5JLVA 4YGDA 1SFNA 3KV5A 1DQ2A 5FPBA 1RUJ3 2GP3A 2BGPA 3OGVA 4AI0A 2PHXA 3DYOA 3N36A 1I5PA 1N47A 4AEDA 1TNRA 3O1VA 2WO2A 4CDXA 1IZ3A 2GC3A 2CAUA 4OQ9A 1PVC2 3PUIA 4KU8A 3AMHA 1AZDA 4YNIA 3VDDC 3IBMA 4NOTA 4B1MA 1OUXA 3N9QA 2YBSA 4TLGA 1YQ2A 1XE8A 4Q5OA 4NE9A 1DDLA 1AR81 4XQWA 2ZBJA 1DGWX 4MHUA 5FPXA 5JSPA 1QY4A 3I3QA 5SV5A 2EIDA 2VW2A 1UPIA 2PLV2 3NNLA 1YNAA 4H7MA 1CONA 4LK6A 1XNDA 1GSLA 1XNCA 1KFXL 2WT0A 1MZ5A 1AR63 2HWB3 4XABA 2XLAA 3WCSA 5C3OA 2P34A 3POSA 3LQCA 4OLLA 3VBOA 1UOJA 5DABA 2F4PA 3C7FA 4ES9A 3K3NA 4XUTA 4RSUA 3ZFFB 4E4ZA 1G7YA 3VDDA 1W28A 4P5HA 2MNGA 1ZNPA 2DCZA 2JE9A 1HB1A 4F7ZA 1PO23 3T2OA 1LESA 2GMEA 1YXWA 1KDKA 3LD8A 3RVHA 1KJRA 4LK7A 5FYSA 2FDJA 2QE3A 1PIV2 1NCRC 1RUI1 4QX7A 1QDOA 2BWAA 3IDAA 1N3PA 1JU3A 2HWF3 4HANA 2VVEA 3I7DA 5LBBA 3D6EA 1JW6A 1W2AX 2D6NA 3KVBA 5C4WA 1U5IA 3D5OA 3IIAA 4CXWA 3BOWA 1CVNA 3DGTA 4AEJA 1JOBA 1S0FA 4ZZ8A 5I0DA 4CEYB 1NE4A 2HEWF 4RR3A 1BK0A 4YZ1A 4ZU4A 4GQ7A 1AR82 4YRDA 1XSQA 4WM8C 4YWAA 4AHWA 1XYOA 1Q8PA 5D2AA 3ZPYA 3J26N 1CR7A 3PVNA 5EXOA 1MVEA 4HKWA 2E32A 2RM21 3R05A 2OVUA 4PLNA 3AMNA 3FUOA 4P00B 3VHPA 4XUQA 2Y6LA 3P3NA 1R083 2DUQA 1VRBA 2ZAAA 2WIIB 3ENRA 3ZX7A 5FWJA 3AJZA 2WO7A 3OD0A 1QQP3 1NA1C 3RZHA 2BJSA 2AACA 1DU3D 2ERFA 5H9SA 4FTBA 3OYWB 4Q0PA 4AI3A 3MDPA 2GNTA 1E5SA 2WZR2 4FPCA 4J1XA 5A1LA 3M8LA 4RQPB 4IGQA 1YQCA 4QHZA 5FYIA 2Q5TA 3HT2A 5IK8A 1YFXA 1FPN1 4TZDA 1JZ3A 4HXCA 1YEWA 1AL0G 2BGOA 2JB8A 4Y1YA 3LDRA 4Y26A 3CMGA 3UK9A 3BPSA 1C57A 2R16A 1ZZBA 5I0UA 1VBC3 2D6KA 2VECA 3ES4A 1LHWA 1P8JA 4FXGB 4UFHA 5BY5A 2VTXA 4UBHA 4YM2A 3T2PA 3ORJA 1V6JA 4HSLA 5DAQA 5LBFA 4AFBA 4KL1A 4ZS2A 3BU7A 5F7UA 1HRV1 2W0XA 1V0AA 3WD5A 4NRQA 2ORZA 3GJAA 4HPKA 3S0MA 4N8MA 1BJQA 3ZSEA 4DEQA 1W8UA 3GM8A 1PGL1 5F6LB 2FQPA 4XCBA 3VGIA 3GALA 3IZOA 4NHKA 3EQEA 3VB9A 4AHYA 1UMZA 4JGZC 4H55A 5G05L 2VTXJ 2GC2A 3OOXA 3OY8A 1C4RA 5A3MA 3ZFGC 4UFIA 2KM2A 3W9AA 5FP4A 2QQUA 1W9YA 4M01A 3CO2A 5FTTC 3I3EA 2K0GA 3AVRA 4K1YA 4MHRA 4YZ4A 4EWAA 3DKQA 3DECA 4UBGA 4Y24A 5DG1A 1VBB1 2XL9A 3LSDA 3N35A 2X10A 4LIUA 3Q8FA 4QKDA 2A71A 1LJ7A 4V2VA 2BVBA 3HT1A 3BALA 2IUWA 5EJ3A 1ZA7A 2GMMA 1RUF1 2VZVA 4QPIC 1XU2A 5KHKA 4QPGA 1FMD2 5FO8B 2DTYA 4LOTA 3ZO0B 4XJ8A 1DGLA 4CRQA 1DGWA 1NXMA 3I3BA 4R4ZA 3NV3A 1NCQC 4LULA 4RL7A 4CSWA 3DXTA 1J83A 4WM8A 1JHNA 4G4FA 3E5UA 4HG6B 4EN9B 2D3SA 1QQP2 4YW4A 3AVSA 4N7UA 5GZEA 1ND3B 1HRI3 5A80A 4QGNA 1W2NA 4M4RA 4CDUB 5I0RA 2P3JA 2VVFA 3QD6A 3ZFEA 1JZ8A 1G9BA 1PZ9A 2Q30A 4LNVA 3UKTA 3WW1A 5FMCA 2ET1A 4GH4B 5J3UA 5IHRA 2ORXA 3VD9A 2IXLA 1CAVB 2VU9A 1RUE1 2HWD1 2K9ZA 2VVDA 2YGLA 3HBZA 4E2SA 2OZ6A 1KDMA 2BTVC 4HK9A 2XUMA 1YQ6A 3JU9A 3VZLA 1REEA 3HBKA 1YQ5A 2R7EB 4GWJA 3ZOIA 1X8EA 5HXVA 4NIHA 5DUVA 1W6OB 3QH6A 3BTZA 4J25A 4L11A 4P02B 3UL2A 4Q4Y1 5JOXA 5FMBA 2IXJA 1SZBA 3WG2A 3BTYA 3UKNA 2A5ZA 3AP5A 4MO3M 2RM22 4H7LA 3IN9A 1X36A 3TB0A 2W47A 3N9PA 5J96B 1POV3 1COV3 4CCMA 1UL9A 5FZBA 1SMVA 3O0VA 4LXLA 3WY6A 2HWB2 4MXWA 4S2GA 1AR62 3ZYPA 1XBFA 3N9OA 3KD4A 5JZGC 2PAKA 1WD3A 2JG8C 3LKJA 1CAXA 3NKTA 1D2SA 4JDMA 1JZ2A 4BIFA 5CU1A 1C5IA 1DZTA 5H9RA 1RTVA 1HXS2 1UU4A 3MLKA 5L9BA 1OD5A 4QPGC 1QHDA 3PUAA 1ZREA 1ZBA2 1G9DA 4YZ5A 4ATEA 1U12A 2E31A 2E51A 4C0HA 1OI6A 1NZCA 2UYAA 3TNQA 3OGJA 1NAEA 1XE0A 5FKCA 4OHYA 1W8HA 1ZBE1 4KWKA 4BQ3A 4NN0A 3EJKA 5BNNB 2D98A 2VOKA 2W94A 1CD3G 2WA3A 3EMRA 4YG6A 4JX0A 2OYZA 1BK1A 3RYPA 2V4AA 2VZPA 5HCBA 1X9TA 2Y6KA 1D0GA 4LT5A 1W03A 3OBTA 1XNKA 2B46X 3U75A 3IPVA 4QT6A 2VULA 4LMFA 4KWJA 5FY0A 5KXDA 3KV4A 2VNRA 3LWCA 4IERA 1PO12 1H2MA 1LHUA 5FKBA 1H6XA 5SV8A 1HJGA 2LALA 4MX3A 5LEKA 3VKFC 4BK4A 1RUI3 1N1TA 2WNVB 4XFAA 3PVEA 3ZN4A 5A3LA 3JD71 3D0JA 2ET7A 3OPWA 1WGPA 3OBAA 3U07A 4CDQA 2D3PA 1GUIA 4ATFA 3MPPG 1V6LA 3OBZA 3Q8CA 5F5CA 4EN8B 4BLIA 1US3A 3CHXA 3ZFEC 4C8DA 3W21A 3WLUA 1QOTA 1BEV2 3E6DA 3LEIA 4NR1A 5IT6A 1CPNA 4ITCA 4MGSA 5A7PA 5C8CC 2VZTA 2YG0A 3DKWA 4L0PA 5LBEA 5T5OA 5HPOA 2OUHA 4ZU7A 4XMIA 3AZZA 4Q4W3 1WA6X 5FBZA 3VBFC 1IHMA 1KFUL 1PGSA 2BERA 1EV11 4P9YA 5FZGA 3RMXA 4IEWA 3OF1A 2BGCA 5CEHA 2JG9A 4FO9A 1EYBA 1CIYA 1NUKA 2B39A 3UGGA 1CWPA 3AMQA 1SLAA 5DDJ2 2G1MA 1AR83 3DEMA 2VXRA 2C9KA 1W0NA 1O6UA 4NRMA 2G9FA 3BVCA 1BBT2 4C90A 4EN6B 2XVGA 3A7QA 1QJY2 4M3CA 3JD73 4DINB 4UFLA 4NIDA 1PVC1 3WEZA 3CJIA 5L9VA 2J42A 4COUA 1VBC1 3NVCA 5BNOC 4LO5B 4PBOA 3WUDA 1MS1A 3MICA 4XBQA 4NIIA 1JYWA 2RJKA 2W2IA 4YFWA 2CTVA 1I9RA 3KZ4C 1ZRIA 5T5PA 3ZYGA 4JQRA 4HETA 3ZYRA 1UX7A 4JHTA 1C8M3 5GJ6A 1WLCA 1U5XA 1OOPC 1PX3A 2ZZQA 3ZSLA 3O1TA 1NOVA 3I3DA 4LE4A 3JD72 1MEC2 2G9ZA 3A0KA 3B94A 1R1A3 5LCWL 2JECA 1BBT3 1BZWA 3R0RA 1OF4A 4Y1VA 3VV1A 2WFPA 2RS31 2WS92 5JR7B 2WNVC 3ST7A 3FLTA 3T1MA 2QQKA 4AK3A 1ND3C 1RB8G 1Y4WA 4UT5A 4CDUC 2C24A 3ZSMA 4QB6A 3BPZA 2B45X 2RDNA 2XKOA 3B69A 3PIJA 1FOD2 5E89A 1VBD1 5LB6A 1CZTA 4XUPA 3TRSB 1Y9MA 4DFSA 4X8PA 3DF0A 2EICA 5EJ1B 1N1VA 4M3CE 3KT4A 3FBMA 5FZLA 3ETPA 3AYAA 3KF3A 4IEUA 4INDA 1F8VA 2YPJA 1QGLA 1UPSA 5K0UA 5KC6A 4R9CA 4ZU5A 3SISA 5J09A 2AUYA 2J1AA 4JTNA 2BNOA 5BNNA 3Q8AA 5FZAA 5FFOC 1OH4A 3KT7A 3ZXJA 3K2OA 4ASLA 1CAUB 2ZGOA 2GAUA 4I01A 4CTEA 2BPA2 4OUMA 3RSJA 2Y64A 3RZMA 3PU3A 2R30A 3JXSA 1VLNA 1YHFA 1NX9A 4XHXA 5CB7A 1K3IA 1WLDA 3GZEA 4FAHA 1W9TA 3O0WA 4B4PA 4E4DX 5FMOS 5C4WC 2VD7A 4NIGA 2YYOA 2BEOA 2WUHA 2XQRA 1N1SA 3BN6A 1VPHA 4PDWC 3AL6A 4RR3C 4Y3OA 1YRZA 2CDOA 5D8AA 1GWKA 5F5AA 5BNQA 1OQDA 3M3CA 3G6JB 1VMJA 2E53A 3H7JA 1OLRA 2XBO3 3QLQA 2ILMA 1HXS3 1RUF2 1ZZ7A 3UJOA 2BBVA 2JG9B 3PUSA 4FP2A 3T0AA 1AYN3 3KB5A 4QGMA 1RITA 1O59A 2F17A 5DZGA 1W39A 2WBKA 2IVIB 2UURA 3IT8A 4ISRA 5FPVA 5A7QA 4BM8A 2CU5A 2KA3A 1HJFA 1COV1 1W6MA 2J1VA 3GBWA 3HJRA 3RWKX 3BIWE 4AFMA 4XDOA 2VJXA 4CU6A 1CAWA 2W08A 1LODA 3QACA 5FZKA 5JI7A 1OFNA 3WDTA 3OSDA 2JDZA 1PK6B 2OQ6A 3TOJA 2VNGA 4E8CA 4OZOA 3GZTB 1IPSA 5BV6A 2RS13 5B2GB 1IG0A 1RUE3 4CP0A 2QQJA 4CCNA 2WQ8A 4WVZA 5LK7B 4MLOA 2P6CA 4FPJA 4Q4V3 2W3JA 2A73B 1PMJX 2OXBA 2ZX1A 4MZUA 2Q8DA 5IK4A 3KHCA 1NG0A 1Z7S1 3FFZA 4U2AA 4IV1C 3VBSB 2NN8A 1UZVA 5FY5A 1H4GA 3MEPA 5JWPA 1WMXA 1H2KA 4QX1A 4V1PA 4YVSB 4ZZ5A 5IVEA 4QPWA 3E97A 3CLPA 3WX5A 2XVLA 1UN1A 4AGVA 1ZBA1 3ME2A 3NMBA 2FDKA 5F39A 4FOQA 1GQHA 4WVMA 5K7PA 1Q56A 2VNVA 4QWNA 3H3ZA 5IAVA 2PHLA 3W5NA 2IXCA 1OQ1A 1VJ2A 4GWMA 3WNOA 4MGKE 5FZOB 1W6PB 1ULGA 3C3VA 5FPLA 1SEFA 5T55A 3AKRA 3RJ2X 1XXNA 4M3CF 1K12A 1OOPB 4IE0A 1WMEA 1H8TC 1UW8A 3C7HA 3GZAA 3H9AA 3IAQA 3OEAA 4C1XA 3BOPA 1PK6A 4UOJA 3NSTA 2BUKA 2A6VA 1YI7A 3O0XA 1UD1A 1ENSA 1AL21 1BMV2 5E8AA 4BJ0A 1YLLA 4WM7A 1W2OA 1J3RA 5A3NA 5J48A 1QKQA 2VCMA 1UZYA 3WP4A 5FMOL 1ULDA 4QX2A 2MEV3 2WINB 4RQPC 1AJKA 1E5RA 1GP5A 1RHI3 3KGZA 1K5MC 1LOBA 2FCVA 2OT7A 4R8HA 1LHOA 1W9WA 4WVVA 4K9SA 4AVVA 4M0NA 4Q29A 4A3ZA 3GJBA 2J1RA 1DQ0A 4XFHA 5JOWA 5FZ9A 1PO11 1VIWB 2D3RA 2P4EA 1RUI2 2PFWA 3VHRA 5ACA2 3PU8A 4UW6A 4AVAA 4P9LA 5F2SA 2HJIA 4RGKA 4A2UA 1PM7A 1UYZA 3OUJA 4RGGA 2RDRA 4QGLA 5A7OA 5JSOA 1FXZA 4RN5A 4WZFA 5JXIA 2ZGPA 1HQNA 1WD4A 5L7OB 4IEZA 4Z8BA 1TME1 5FZ4A 3H8XA 5K0UB 1UY4A 5D21A 2HWE3 4D6SA 2NYYA 4NRPA 5KHGA 2DFBA 2AEYA 1QQP1 5CVRA 3NO8A 2QFEA 3ZFGB 1XRUA 4MV2A 2HWF1 2RE9A 3FC0A 5JXHA 1OA2A 4EWEA 1FNYA 1O5LA 2JDHA 5FP9A 2W1QA 1L3JA 3PJQA 4HBNA 4QHBA 4DO0A 4META 1HQLA 2XVKA 1VE0A 3C7GA 1W8WA 1OPMA 1GYKA 1W2TA 1W8FA 2HWD3 1VBE3 2ZHLA 5DUWA 4I2OA 5A7WA 2EXJA 2H0BA 4QQHA 4IEOA 4IUGA 1RUJ1 1UU5A 3NNGA 2D6LX 4XQ4A 4MUVA 4M3CB 4TXWA 3QOPA 5F3IA 2JDUA 1RC6A 2FHRA 4H2AA 2QQVA 1H4HA 2WFF1 4CXYA 4XXAA 3WQ0A 3VHNA 1YQ8A 1Z7S3 1POV1 2VMHA 1UOBA 2JDAA 3OEBA 2PN5A 3K4DA 2NP0A 5BNPA 4XBLA 5JSRA 1PM4A 2RS33 3HNBM 2PHRA 3IIIA 3ZN5A 4F3JA 2R6QA 1WW5A 2VG9A 2XJQA 4JKLA 2AGSA 3USUA 4Q4X2 4CU8A 2R043 1LHNA 3ZSKA 4LBMA 5T5JA 4IV1B 2VQTA 4Q1RA 3ZKYA 1VBE2 4JVAA 2W92A 4Q4W1 5JCTA 3G7DA 4PQ9A 1ASJ1 2XLFA 1ZZ8A 4CDQB 5KR7A 2C5DA 3LGRA 5C8CB 2HLEA 3POJA 1LNSA 5F32A 3T4VA 1RUG2 1QJZA 2HWC1 4Y22B 4QAWA 3M3IA 5FYVA 4QXBA 5EJZB 1LGCA 3ACFA 4JGZA 1HRI2 5FY7A 1GOGA 4OHZA 3WG4A 1WLWA 1AX2A 4AF9A 3AXDA 5FZ7A 3AM2A 4DXZA 1NY72 3VDAA 1C8NA 2YY1A 3WVJA 4BQ2A 4RHV1 1VB2A 5AVAA 1AHSA 2W39A 3RZLA 1EP0A 2VCCA 2VMFA 5FZMA 4CEYA 3BGAA 4CU7A 4AL9A 1WBFA 4D7YA 5IAXA 1IOAA 2RV9A 5F6KA 2WWSA 5FDBA 5A33A 2GNBA 3KS7A 1WWYA 4TTGA 2DU0A 1MS9A 2VAUA 3ABZA 3CKHA 5IVFA 1ULPA 4GKYA 1FOD1 3MW3A 1LRHA 1UYYA 4QPIB 3AZXA 3GF6A 3MYXA 3TNPB 1AYN2 3TWIA 4NHYA 3THTA 4AVBA 1IQDC 4LIVA 2DFCA 4NHMA 4YG0A 4GJYA 1SBDA 3HOBA 5JMCA 3SITA 4W6XA 1CX1A 4I0AA 3JB8A 4L9BA 3O14A 3WQ1A 3WHUA 2DWRA 2C0ZA 3RFRA 1JMUB 5C4WB 2VZOA 2W91A 1E5HA 3N9LA 4R9DA 4DEVA 1W8NA 5T5LA 2YMZA 4XQDA 1V6NA 3AZYA 5ERLA 3MI8A 4ZPIA 3WF3A 2XJTA 4AEDB 5KXCA 5GZDA 4CEWC 5A32B 1MS4A 1CAXB 3K51A 3GNEA 1XYPA 3AYEA 3QH7A 1XOYA 2A75A 3D8CA 3WDVA 1G6NA 3HNYM 2ZOEB 1PZ8A 1W04A 1W05A 3ZFFA 3MLLA 5H9PA 1VBC2 4O7XA 1OMIA 5ACA3 1JZ5A 4ZONA 5FZ1A 3KLSA 1JS9A 1G86A 1POV0 2NMNA 1AL23 3AKSA 4OMDA 4XJWA 5F3EA 3LIHA 1SACA 4CEYC 4NPLA 1RUC2 2WWUA 3AKTA 4QQLA 1K42A 3JQWA 2WNUC 1JN2P 1H2LA 2WS93 2F4LA 2E63A 3MO4A 4GH4C 2O14A 3MF6A 4Q27A 3K77A 4AEKA 5C9AB 1RINA 1H1AA 1R1A2 1OXCA 5ANNA 5J1XA 3MZHA 2R073 1W2UA 4QX3A 1V6MA 1JZ7A 2A7AA 1CN1A 2IFWA 3FUQA 1RVF3 1LAJA 1EUUA 3ECQA 5FZHA 3BIEA 4LKSA 1LOGA 1RXGA 2XHKA 5F2WA 4GJZA 3RGBA 4HVOA 2R061 4DUWA 1EY2A 4BQXA 1C3HA 3ZMNA 1V6KA 3LPGA 1Q8SA 2Y8KA 2I74A 3ZIWA 1CAVA 4N9IA 4XF1A 1WLTA 2GN7A 3ZVXA 4LO7A 4IXLA 2I07B 4XFGA 2TBVA 2BQPA 4BMBA 5BNOB 2VZSA 3IB3A 4GAZA 4YW3A 3RMYA 4DRRA 1V9U3 3VD4A 1LR5A 1RUD2 4EJRA 4N90A 4RYDA 1Z7S2 2C4XA 2RR12 1UYXA 1XPWA 3ON7A 5LY2A 2OKXA 4AEDC 1F15A 3RS6A 3IWZA 3DN7A 3WV6A 3U78A 1UIJA 2JIJA 4DQAA 4UW4A 3ZXKA 2R072 2R041 3POYA 2C9AA 1JUIA 2BDRA 4OI1A 2EVXA 1TG7A 2V5DA 3PVOA 3SCHA 3H8UA 4Q0VA 1DG6A 1MS8A 2QZ3A 4N43C 1AX1A 2OS2A 2H6BA 3B00A 1H8VA 1WBLA 2P5BA 2NZ9A 4LITA 1LEDA 3KT1A 1GZCA 5JPNB 4A7KA 1YFWA 1MACA 2ZKNA 3D3AA 1STMA 3T3YA 3ZXDA 4XBNA 1T6GC 2ZEWA 4AGRA 4HMZA 1I6XA 2QQNA 5DUUA 5LY1A 4IE6A 2CGOA 3VBOC 4A6OA 2RVAA 1VAKA 2UWAA 1J58A 3E6CC 2NPIA 2VZQA 4NROA 5LWBA 4CCEA 1K5MB 4D6RA 1ZRRA 4U36A 1LCLA 3RZJA 3L2YA 1ZZCA 4KI5M 1U5YA 2JE8A 3LDKA 4TLFA 3CNAA 2C6SA 4QX0A 3N7KA 5HI0A 3WNXA 3GCWA 1H9PA 1NA1A 4D69A 1E5IA 2YC2A 5L9RA 1TME2 4X8NA 3WNKA 1IPJA 2ENRA 2ZX2A 4FFHA 4Q0UA 1UOFA 2R062 1H8TB 3M70A 4Z1VA 4HFSA 3JQXA 5AVPA 4KMQA 3JBG1 1PVXA 3POEA 4AOCA 1J1TA 4K8RB 4CDQC 4ET7A 3NJVA 4KGQA 4N43B 1TVGA 3BUCA 3S6PA 1YIFA 1ONAA 4XJ9A 2YC4A 1OD3A 1O7FA 3LE0A 3VBHC 2D5HA 3NKGA 2W95A 3VUOA 4LA3A 2ARXA 1SFYA 1UF2C 3ACHA 2P3KA 1XNBA 2MEV2 2D6MA 3BODA 4IETA 4CDWC 4CP1A 2G4IA 2XOMA 3DYPA 1RUD3 3KMHA 4L2NA 4BPZA 3PMSA 4IE5A 4N9HA 3FFQA 3M7AA 4AW7A 3A23A 4Q8KA 4BK5A 4XXPA 1QJX3 2WNUA 3NJZA 3OG2A 4F83A 3W58A 2AYHA 1W6QB 1WUVA 2VBDA 3DPRA 5CIRA 3CU7A 4NAMA 2HWF2 3VZKA 4IGPA 3O1SA 4Q4V1 3O7OA 2A1XA 3ALQA 3MBWA 3JZVA 1U5ZA 4AHZA 3D0SA 4XYXA 2E33A 3ACGA 2DUPA 3GBFA 3WF0A 3ZFFC 4WBBA 4XZPA 3PMEA 3BTXA 1FOD3 3LOIA 2W87A 2WKKA 3OPZA 5KHJA 3WHTA 4AVTA 5BYNA 1XU1A 2GC1A 2VUJA 3AJYA 4NWVA 1V00A 5EZWA 3S7IA 1W8ZA 1JYVA 5APAA 4DUVA 3AK0A 5JIAA 5FJKA 1VP6A 3LAGA 4CDXB 2KXLA 3MW4A 1E57A 1YJKA 2BRTA 1WCSA 1ZRFA 2B9VA 3AKQA 1DLLA 3WG3A 3IMNA 1APNA 3OJBA
chains in the Genus database with same CATH topology
2CAVA 1YJLA 1DQ4A 1GBGA 1YYNA 1YUDA 3AX4A 4OHXA 4Y22A 1ULCA 3VDDB 2CYFA 3POWA 4BHPA 3VZJA 1S0IA 1D4VB 1QH7A 3ZFGA 1TE1B 2RS12 3U4XA 3R4DB 1H9WA 1V70A 1Z78A 1WW4A 2ZHKA 4YG3A 1AR61 2HWB1 1PNFA 1SDWA 3AZWA 3U11A 1EV13 3CJIB 3T1LA 1VRH3 4K7JA 2GDFA 1AR92 1Y43B 1ZZ9A 4W65A 3ASIA 4WV8A 2ZX3A 5FCCA 1SCRA 2Q0AA 3MW2A 2V5YA 3LSEA 3NAPC 4X6RB 5FLIA 3SCGA 4WVMB 4AW7A 4XF0A 2QZ2A 1IGOA 1BVVA 4FVVA 1QJX1 4ZKTB 3IKWA 1MZFA 2GNDA 4NVPA 1DF0A 1K5MA 1CGPA 4LBNA 4GB33 1SCSA 4AFCA 2GZWA 2MHFA 2B7YA 3VBUC 3PVBB 2EAAA 4YM3A 2Z79A 4AG4A 2GALA 2ZGTA 5DZFA 2ZKLA 1F9KA 2TEPA 3LZZA 1W6NB 1V9U1 3AP6A 1ZVFA 1MQTA 4Y5Z0 1D0HA 3A4UA 3KCCA 3N7JA 2YGMA 4M0HA 2B8MA 5AC92 1QJU3 5FPZA 2XJSA 4FOWA 2UWBA 3MIGA 1AYM3 4JGYB 4MGYE 1QF3A 1WW6A 2A3WA 4IEQA 4GA9A 3WP6A 4XOGA 2E7AA 4FP3A 4BYYA 1O3RA 4KG0A 4B29A 1W0OA 1UX6A 1MEC3 4XETA 2DCYA 2GNMA 3SH5A 1G9FA 2AREA 3IDCB 3WG1A 4BLJA 1O4TA 2OIIA 1JUHA 2DV9A 3QBQA 4PBPA 4D94A 5KWRA 1KQRA 1AXZA 3HQXA 3VBFA 1D4M2 4K40A 3AP7A 3AP4A 2WQ4A 3VZNA 3MLJA 1KRIA 4CDXC 4FOYA 2CV6A 2VQAA 1ZA4A 3NAPA 5FO9B 1LHVA 3ILRA 2XH6A 4ISQA 2ZGSA 1SBEA 2BYVE 1O91A 3THPA 1F2NA 2DTWA 3ZN6B 4P9WA 1ZRDA 4BMEA 2A6XA 2PLV3 4HLTA 2BNMA 1TNFA 1FV2A 2Q1MA 5GZCA 1ENXA 1QJY3 4IQPA 1GV9A 4YARA 2XWJB 5FLHA 1WCDJ 5LEJA 5DZEA 3WDXA 2JXAA 2R071 4SBVA 5HBAA 1VAMA 2ETEA 2ZA9A 2HEVF 2EALA 3MFCA 3NAPB 1NE6A 1ND2B 4LBKA 4F8AA 1RUJ2 2VGDA 3L9JT 5L73A 2WT2A 2ZMNA 2O1QA 4DMIA 1ALYA 5I8SA 3VBHB 4COWA 4GB31 4AI1A 3VBFB 4CP2A 2A6ZA 5CADA 3OBRA 1PIV1 1GNZA 3J8F3 4E4SA 1VRH2 1MEC1 4IEVA 4N53B 1JYCA 4Q1PA 1QXPA 1UKGA 4AI2A 3P3PA 2HKXA 1YCIA 1R081 5GLUA 5J36A 2WLPA 2ZGRA 4QPGB 2XBO1 4XFBA 2VUAA 3C2UA 3KQRA 1KS4A 2ZGNA 2YUEA 4LR4A 5AFBA 4JGYC 3O5SA 4PLMA 4YGEA 4GB32 1S0DA 2WSVA 1F31A 3VN4A 4COYA 4XILA 1WW7A 4AFAA 4AE2A 2O8QA 4FAGA 3JBG3 4URTA 1SBFA 4B3NA 4IV1A 4N43A 2FBEA 4HSJA 4K3UA 3ZXLA 2FMYA 2CNAA 3USUB 3FBYA 4QPYA 1MQTB 1YWKA 2QDRA 2ZX0A 2D5FA 4CDWA 4JTOA 1GICA 4D3WA 1OQEA 1COV2 1S2BA 2GMPA 2RMU3 5JPMB 3B01A 2WC2A 5J37A 1OKQA 5CA6A 3KM5A 3AKPA 2D97A 4EV0A 4I30A 5KHIA 4XTMA 4IEPA 2YV8A 4YVSC 2B5HA 5DDJ3 1SQ4A 4AXOA 3WP5A 1DQ1A 2MPFA 4LA2A 2D7FA 4LUKA 3WDYA 4PIXA 2Z5WA 5D8AC 3N3HA 2DF7A 1SLIA 3VBHA 4FT8A 2BW8A 2FZ1A 4YM0A 1NQJA 2K2SA 3PHMA 4XFFA 3AFKA 3I2DA 3PNAA 5CBLA 5C6CA 1Q8VA 3VZOA 4RD7A 5BNPC 2IXHA 4N53A 5GZFA 4FPKA 4YVWB 1AJOA 4KQ7A 1LECA 5KC5A 3TYJA 1NLRA 1MS3A 3ZXGA 5FQ0B 1KXGA 1PO13 3EHKA 3ZDSA 1ZM1A 1UAIA 1EPWA 4PLOA 1LOFC 3ZYIB 3J4UH 4LBJA 2XL7A 3KGLA 2JG8A 3FMGA 4YSFA 2RS51 3ZN6A 4IL7A 2QVSB 4Z2WA 2VOWA 3R6SA 4CYDA 2FMDA 2PTMA 4EN7B 1CPMA 4OI4A 1BQPA 5IUQA 1ZRCA 2XKPA 1HRV3 5IK7A 1WMDA 4JRAA 1BEV3 2IXIA 4GWNA 4RHV3 5CAZA 4FTSA 2GC0A 1AR93 2EXIA 4XPVA 4BWOA 3LB9A 3ZIXA 2JENA 4YZ5A 2RR13 4S2FA 3M1HA 3H50A 1WA4A 4JC1A 4S2HA 1RMU2 2QCSB 3EXUA 3CJIC 5L36A 4FPLA 2ZABA 3PLQA 1KITA 4CZSA 1XE7A 4K20A 1EV12 5BXXA 4GALA 2R49A 2A6WA 1R1ZA 4QQPA 1O3QA 5TSWA 3HR9A 4OI0A 2F6BA 1JTZX 1CX4A 1DGRN 3KCXA 3WOGA 4E2GA 2VH9A 4PJYA 4UW5A 1C28A 3VKNA 1LGNA 2A3YA 5BNOA 4YM1A 4HL0A 3WT3A 2CWMA 1Q8QA 2QUOA 4GKXA 5EWSA 2D44A 5HCAA 3NWKA 3VBUA 3VBSA 4IV3A 1DFQA 4W6WA 4Q4V2 2WQZC 2RS52 2RS32 3IM0A 1OSGA 2JG9C 2DCTA 4C91A 2R042 5EYXA 2YZ4A 2Y38A 3FX3A 1VBD2 5FOJB 1PO21 4GULA 5JI9A 1ND2A 2E9QA 4NWWA 2ES3A 4AI8A 4A3XA 2YDEA 3EBRA 4LUMA 1R091 1Q8OA 5CFDA 2TUNA 3J9SA 1I1EA 4E2QA 3ZXAC 4L8QA 2GU9A 4DY3A 3Q9OA 4P9JA 1ASJ2 4Q4W2 1GR3A 2O0OA 5FRAA 5K0UC 5I0TA 2WLQA 1VBE1 2C1FA 4FPOB 4XIKA 3V0BB 1RUNA 2JD4A 3ILNA 4FSJA 3LA7A 3UV9A 1MQTC 4HKOA 3I4IA 2BVVA 4HN0A 4YLZA 2ZGQA 3BB6A 3CEWA 1CJDA 4B7KA 3B7MA 4XHBA 3RWNA 3J8F2 1WCKA 4HT1T 1VB4A 1VAVA 2CWSA 5KXEA 2I2SA 3VKMA 2RHPA 1GZWB 2GH8A 4PDWA 2NM1A 2A3XA 1URXA 5C9AC 1QMJA 1LOEA 4FOVA 2OZJA 4OHWA 2ZS6B 1LOFA 2WT1A 3CL1A 4AVSA 1AR72 3AMPA 1PNGA 1AF9A 1R082 2D6OX 4A7ZA 2SLIA 2BFUL 3ZXEA 4YVWA 1OA4A 4WM8B 3D82A 3KSCA 2ZHNA 2WJSA 2DVBA 4Z82A 3AFGA 4AQ6A 5GLVA 4O9EA 1FATA 1MS5A 1ZBA3 4KNCA 4DRVA 3TBDA 1XQNA 2VW1A 1DZQA 3WW2A 2P37A 1EAH3 4EN0A 2ZGKA 4AVCA 1FMD1 4G9SB 3TN93 3VBSC 1N3OA 4R9AA 3V0AB 5KBFA 1SLLA 1PIV3 2OUJA 1S0GA 3J8F1 1AR71 4MYEA 3MIEA 2H6CA 3I59A 5BPXA 1CIWA 4Y4YA 5GZGA 4Q4Y2 1X7NA 4AGGA 4LHKA 2ZGLA 2E6VA 3VLBB 1OFSA 1RUC1 4Q4X1 2WL1A 4E27A 2HWD2 1HRI1 5T50A 3UJQA 5L19A 3AB0A 2HWC2 1CQ9A 1OA3A 1REDA 1F5JA 1MZ6A 1RUC3 3MFAA 1W6QA 1FX5A 3VBRB 4LHNA 2IZWA 3V0BA 4QU2A 2WNUB 3RI9A 2CY6A 1DIWA 2A6YA 1O4YA 1O3SA 1QDCA 2QKDA 1AR73 3HN1A 4ZXKA 2B9UA 4BH9A 1C1LA 4WM7C 4B7EA 4JV4A 4RFT0 3MGUA 1RUOA 4LBOA 4XIOA 5CG9A 3FJSA 2I45A 3ROUA 3T2TA 5JAXA 3NV1A 4FCAA 4XJZA 1VBA3 2XJPA 1GQGA 3E5XA 5DG2A 4GMP3 1JOJA 2WZR1 4K1ZA 2WFF2 3B5LB 4HKLA 5GLZA 5ABJB 1OHFA 3GBGA 3FLPA 2EF6A 3AYCA 1NYWA 3NV4A 1J59A 1V6IA 3N7LA 4FQZA 2AENA 3RRDA 1S2KA 1FI2A 5I0SA 2WZPP 3USSA 3H3UA 4QM8A 2R063 3VL8A 1O4ZA 1VBB2 3JUUA 4YGCA 3WW3A 4XF4A 1ASJ3 1HDKA 2EXKA 4DY5A 3A0NA 4ORFA 2V09A 3R4UA 5C33A 1N3QA 4PDWB 4AYUA 4XJUA 2ZCWA 3V64A 2PHWA 3FWEA 4I02A 1DHKB 2VW0A 4Q8LA 5AFEA 2P17A 2UY8A 1FT9A 2VQ0A 2Q1ZB 1VR3A 4QD2A 2SBAA 3WZ1A 3CF6E 1HW5A 1RIRA 2HEYF 2ZZJA 4MXWB 5GLWA 1H30A 3DV8A 3RG0A 5ACA1 1LOCA 3V56A 1TMF2 4OUSA 2AZ5A 4XW3A 2RS53 3INAA 2P2KA 5JDBA 2ZMKA 3FE5A 1NY71 3HD8B 4OULA 3GYDA 4K8FA 4Q4Y3 4MSVA 4IEXA 1CESA 1GZ9A 1QJY1 1D2QA 4BA6A 5FOBB 3UKVA 1TMF3 3TAYA 1IQAA 4I09A 5GALA 5GKAC 5I93A 1R1A1 2PAEA 4R4XA 4GXLA 4LEJA 3AXEA 1RUH1 2LM3A 1YFYA 4YGBA 1NCRB 1TMF1 4Z07A 4AHXA 1GNHA 5C8WA 3KCYA 4Q26A 1FYUA 1KJLA 3OGGA 1QJU2 5I8YA 4G3YC 5D1IA 4B4RA 2DVDA 1RGSA 2P3IA 1QH6A 4XJAA 1BXHA 3B9IA 2VMGA 4XEZA 2LUWA 1X82A 3HAGA 1AXYA 1ENQA 1RUF3 4QPIA 1Y3TA 3B93A 3WDUA 2D43A 2TNFA 5FQ0A 3U0ZA 5H9QA 4BCUA 4LTAA 2W52A 2R1BA 1NCQA 3S7EA 1M06G 4Y20A 5LRRA 3JCIA 4LBQD 3SNMA 4C1WA 3ILFA 4MGZE 1OLQA 3WW4A 3AMMA 5CFDB 4DS0A 4OI2A 5ABJC 1RJ8A 2WSUA 4IESA 4B4QA 1AUYA 1UKRA 1HX6A 4H3WA 5D8AB 4QX5A 3WXPA 1IS5A 3OY8B 4AFDA 4WZCA 1TME3 1LTEA 2X5IB 2Y0IA 5LRSA 1LB2A 3I8TA 3PTYA 2DCKA 1BBT1 2XWBB 1A8MA 1R093 2A70A 2HYKA 4CEWB 3OYWA 4RGAA 3FLRA 2R1DA 2CL2A 1ND2C 5EV7A 3RQ0A 5LK5A 3SCFA 1X8MA 1GLHA 3OTFA 2HWE1 1DBNA 3SXWA 4EROA 1JH5A 1OPOA 1J1LA 1VALA 1F5FA 2VOXA 4XFIA 1LOAA 3OD4A 1B35A 2CGNA 4LO4B 4X6QB 3B3QE 4MXVA 2JEMA 1S0JA 1QNWA 1ULEA 5K8SA 2ZGMA 4AQSA 1BVP1 3RJRA 1DQ5A 2RM23 2W68A 3MIDA 3ACLA 4P9IA 4LBQA 4PCRA 4MGIE 4SLIA 2RMU1 2V73A 1LULA 1H0BA 5BUVA 5I91A 1FAYA 5C8CA 2WZR3 5F5QA 5BNPB 5A32A 4COVA 1PGW1 4QMAA 4NHLA 1VBA1 4JCKA 2OPKA 2NLRA 1PO22 2QQPA 1S1AA 2JICA 1QXRA 5CFCA 4DPNA 1H2NA 5JOYA 2RR11 2VPVA 3NL1A 3ZYJB 1Y9QA 3I59B 1S0CA 5T3NA 1RVF2 1IKQA 2ZHMA 2QDNA 2BWCA 4LBQB 2PA7A 1GANA 3V0AA 1HXS1 3K48A 2D6PA 3IDBB 3HIFA 3DPRB 3ES1A 1X50A 3M4FA 2UU8A 2XLGA 4L92A 3VZMA 3GHNA 4JDOA 3O12A 4LE3A 1G9CA 2VNOA 2RMU2 1PK6C 1FV3A 2XB6C 1SLTA 3RPQA 3WCRA 3DL3A 3ZMOA 2R0FA 5E1RA 1RL3A 2Z69A 4QQOA 1EAH2 1D4M1 1AYM2 1QJU1 1B09A 3BCWA 4LHLA 1QJX2 1ULFA 4FPHA 2JX9A 1H8TA 1RMU1 4QQ2A 1ZX5A 1VBB3 4L97A 3BTAA 3TN91 3CJXA 3W59A 4CEWA 4D7TA 2E7QA 3U10A 2PHDA 3H1YA 5T54A 3VKLA 4YZ2A 3MIBA 2ATFA 3SMHA 2WNVA 1OOPA 5GLTA 1B35C 1BEV1 4FTEA 2R0HA 3E6BA 4E9KA 5E88A 2Y26A 2IC1A 2X53S 2X29A 2UWCA 3EO6A 1C5HA 4IEYA 4MVTA 3VL9A 3X29B 4RS5A 5EFUA 4J6GA 4XFCA 2VOVA 1ND3A 5KHHA 5T52A 3HMYA 2DVFA 1MR5A 4HN1A 4Q0SA 3JB4C 2NMOA 2PHFA 4CDWB 1PHMA 1AYM1 4OZXA 1S0EA 3N7MA 2AR6A 3WINE 4N53C 4YVSA 1V9U2 2XGXA 4DZGA 3R4SA 2X5IC 2EA7A 2RS11 3HWJA 4TWTA 4IV3B 5CFCC 5DUXA 4FQ4A 1LKNA 3VKOA 2XPJA 1C8M1 2ZGUA 1RUG3 1IKPA 4I0WB 2WA4A 3GZUC 4FBFA 1UZZA 5JZGA 2VMIA 4YVWC 2JJ6A 3H0OA 4WVWA 1N1YA 2XG3A 3DUIA 1UCXA 2PHUA 4Z92B 1C1FA 4JDNA 4XDQA 1X33A 2FZ2A 1ZZ6A 4R9BA 5FREA 2E7TA 2DURA 1C8M2 1DZRA 3S30A 1S0BA 4XTPA 2GH2A 4P9GA 5FAXA 3E5QA 1AVBA 2QNKA 1PGW2 1RVF1 3OCPA 5J98B 1ENRA 1KS5A 1QOOA 2DCJA 4RS5C 2NQYA 2QJVA 3SH4A 1TEIA 4LBLA 1IS4A 4HZFA 1NQD