1D2QA

Crystal structure of human trail
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
161
structure length
134
Chain Sequence
RVAAHITGTRGNTLSKNEKALGRKINSWESSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRQMVQYIYKYTSYPDPILLMKSARNSCYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF-RELATED APOPTOSIS INDUCING LIGAND
publication title 2.8 A resolution crystal structure of human TRAIL, a cytokine with selective antitumor activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 17
structure length 134
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d2qA00
1I9RA 2RJKA 4E4SA 1S55A 1D2QA 2OIIA 4TSVA 2HEYF 2WNUB 3L9JT 2TUNA 1D4VB 1TNFA 1TNRA 4N90A 2JG9A 2R32A 2Q1MA 4DB5A 3K48A 1C3HA 4MXVA 4MXWA 3K51A 5KC5A 1GR3A 4NN0A 1OQEA 2QE3A 4KGQA 2JG8C 4QQHA 2QDNA 3URFA 1O91A 4QQLA 3FC0A 1RJ7A 4F3JA 1KXGA 1RJ8A 4G3YC 3TYJA 4G4FA 1PK6A 3B93A 4KGGA 5KC6A 1U5YA 4QQPA 2X29A 1U5ZA 2JG8A 4MXWB 5L36A 2WNUC 3WD5A 2WNVB 4KG8A 2Q8OA 3B9IA 4GIQA 5BNQA 3QD6A 4D7YA 4DOUA 1U5XA 3ME2A 2ZJCA 1XU1A 1PK6B 3IT8A 1XU2A 3V56A 4EN0A 3MI8A 2JG9B 4QQ2A 4OULA 4OUMA 2TNFA 1ALYA 4TWTA 1A8MA 5L19A 3LKJA 1WCKA 2E7AA 4J6GA 2HEVF 4MSVA 2RJLA 1C28A 1JTZX 2RE9A 2KA3A 3TWIA 1OSGA 3QBQA 5TSWA 1OQDA 4E4DX 2WNVC 4QPYA 5KWRA 4HT1T 2WNUA 3ALQA 1KD7A 1DG6A 4QQOA 2JG8B 5HBAA 2Z5WA 3AB0A 1D0GA 4RSUA 1IQAA 1DU3D 3B94A 2HEWF 2AZ5A 1PK6C 2R6QA 2R30A 5CIRA 2JG9C 1JH5A 2WNVA 4OUSA 2ZPXA 2O0OA
chains in the Genus database with same CATH superfamily
1WLCA 2A6XA 1I9RA 2RJKA 4XOGA 3KT7A 4E4SA 2A3XA 2QFEA 2XXZA 4E27A 2VH9A 5JR2A 3VHPA 3AZWA 3JD71 2YFUA 2PQSA 5E1RA 3WR0A 1TNFA 3IDEA 4NWVA 5BXXA 1LULA 2WZ8A 4ZHNA 5DN2A 1LCLA 2Z69A 3VBFA 5T3NA 3MZHA 2Q1FA 1G9BA 2PHRA 2Q1MA 3LEMA 4DQAA 1IGOA 2VW0A 1C3HA 1ENXA 1QNYA 4HMZA 3NAPC 1TEIA 2ZGPA 3QCWA 2VZSA 4LNVA 5F5IA 2ADDA 4DY3A 1YEWA 1NXD1 1OKOA 1OQEA 4N7UA 2QE3A 4LA3A 2HYXA 4LIVA 2EIDA 1S0DA 1Q3EA 1NKGA 1VBD3 5CB7A 1W0OA 2JG8C 2VZQA 3LPFA 1LNSA 1ZBE3 5ERLA 3AKQA 2P34A 4WVZA 4XDPA 4B1LA 3ZIWA 3N7MA 1ZBA1 1Z78A 2PAKA 3FBYA 1WW5A 5FXZA 3FC0A 4NRMA 4AZZA 1CJDA 4AVCA 4DEQA 4Q4W3 2VUDA 4FPKA 1WA6X 1YJLA 4QX5A 1JHNA 1XYNA 3SXWA 3WDWA 2CAVA 2E7TA 1VRH1 5CFDA 5JSPA 5G05L 3T2QA 3T3YA 3ZN6B 1K12A 2AGSA 3PUIA 4MXWB 4H3WA 1QJX2 4XJWA 4ZS2A 4CE8A 1C8NA 2SBAA 1LAJA 1G6NA 1CAUB 4CUCA 2BQPA 4RQPA 4OHZA 2OUJA 3N7JA 4OZXA 1SFPA 4PF5A 5FPAA 2VCCA 2H0BA 1MS5A 4NR1A 3AJZA 3OPZA 4N9IA 2BFUS 5EYYA 1UKRA 1I3HA 3WUCA 3GGLA 4XF1A 1F31A 5AVAA 4ZU4A 3RRDA 4BK5A 3WV6A 2RR11 4EN6B 2XKPA 2VVEA 1H2MA 5FZMA 2IXKA 2JE7A 3V56A 1BCXA 2WO1A 3HQXA 5FZGA 3GCWA 1DYPA 5F6KA 5IUQA 1PO22 3T1MA 1VBE1 4LKEA 4N53A 5H9RA 5C71A 1RGSA 5FPXA 2BWAA 4RS5B 5FY7A 2EAKA 2C5DA 3RZZA 3A22A 4BQ5A 1HXS1 4LHNA 1RUG1 2B5HA 3LDBA 5FZCA 2AREA 2AR6A 1CAVA 1V6OA 4D69A 2QQNA 5BNNC 1HLCA 2DTWA 4EN7B 1W03A 2YBPA 4RFT0 1ZZ7A 3R4DB 2HWF3 4MVTA 2JXAA 3QACA 4NIHA 4Y1YA 1EPZA 4Q4Y2 1V6KA 2HKXA 3U11A 4D3WA 4HXCA 3ZIXA 1UIKA 1RUI1 2AENA 3VBOC 1WWYA 3H0OA 1SPPA 4NO4A 4CEYA 1AR81 3WG2A 1IHMA 2VE1A 5LWBA 2R0FA 5FYSA 4DO0A 1STMA 4HFSA 4P5HA 5HBAA 1H1IA 2FBEA 5FPZA 2XG3A 1O4YA 2A6WA 2QJVA 4JX0A 4MHUA 4L8QA 2VULA 4AFDA 2PLV3 4LBLA 5CZKA 2HEWF 1C5IA 4LBOA 2W3JA 4WM8B 3ZFFC 3RZMA 2GNTA 3MPPG 4QKNA 2RS52 1KJRA 2VMCA 1F15A 2D3SA 4XPVA 3FLPA 5JMOA 1OFSA 1UU6A 1RUJ2 3ZM8A 1JU3A 1GNHA 1VMFA 1KFUL 1W8FA 2G1MA 3HD8B 4UAPA 5JI7A 4IV3B 3GYDA 4KQ7A 5FTTC 2FDGA 3J26N 1W99A 4OHWA 1D4VB 1WKYA 3LQCA 2XJSA 4XYXA 3KV6A 4D7SA 3P6BA 3ACFA 3ZO0B 3ZXKA 3O14A 3A0KA 3VHRA 4Y1XA 1HJGA 1S0CA 4M3CB 1GZ9A 4DIQA 4LJHA 3T4HB 2QQJA 3PJYA 5CISA 5JOWA 2P37A 3ZXJA 1MQTB 1QIQA 5CNAA 1M4WA 1X8EA 2I74A 4GULA 1UWWA 3VDAA 3WINE 4KBZA 1KITA 5JXIA 4XILA 4PLNA 3SNMA 2VUJA 5CBLA 1QJFA 2EA7A 2O8QA 1AX1A 4FVVA 1DQ0A 3TN93 3URFA 1EUUA 5FMDA 4COYA 4L9BA 4XJ8A 4HSJA 4B4QA 5IVFA 1COV3 2R1BA 4Q4V3 1UAIA 4UFMA 4G3YC 2WN3A 4JQTA 1AZDA 1GV9A 5LBCA 1VBA3 4C90A 2QQIA 5L7OC 3K4AA 5JSRA 1DQ2A 4XF4A 5I91A 2BDRA 4FTBA 4U36A 4DUVA 3JUUA 1QY4A 2Q4SA 5DG1A 3FWEA 5APAA 2QQOA 2W94A 2V73A 3LA7A 1RUD2 1WZXA 1UU4A 1AXZA 2ZZJA 5CEHA 1VBB3 4JC1A 1YWKA 4K1YA 4Q26A 3S6PA 4ZY9A 3WQBA 5BNPA 4JAAA 1MZ5A 4XQDA 1WMEA 4WM7C 4TZDA 5F7UA 1B35C 2HWB1 4YVWB 4JGYA 5FJHA 1MEC3 4QXHA 3CZJA 3K2OA 3SHRA 5A3OA 3SMHA 3T2PA 4XMAA 4KG0A 4COWA 4ZU7A 5FQ0B 3O1SA 2Q5TA 3CKHA 4A41A 4ITCA 3IT8A 3H8UA 3AX4A 3TOJA 4EN0A 3CJIC 4LBJA 2ORZA 1REEA 1EYBA 3AM2A 2DWRA 3T1LA 2OZJA 1MZEA 4IV1B 2ZHKA 2JDPA 5A7NA 4HSLA 1YXWA 2VY0A 2ZACA 4MGQA 3GALA 1SLTA 5KXBA 3H7JA 5FZDA 5LA1A 4EZHA 4XCBA 3M3EA 3LKJA 3OOXA 3ZDVA 3ZYBA 5A3UA 1OLME 3VKMA 1V9U1 1LU2A 4IEZA 1C28A 1DQ1A 5J7MA 3WW1A 5JMCA 2RDQA 2XJPA 3UV9A 1KS4A 3VBRA 3CLPA 4BXSV 2OUHA 3AMPA 4IGOA 3PNAA 4P9LA 4JRAA 3UNPA 1WW4A 2GC1A 3AFGA 4D8MA 1TME2 2GN3A 3LWCA 4HG6B 3S57A 5GLUA 3FLTA 2C9AA 4CXYA 4P9WA 5JDBA 1HQLA 1DGRN 4GKXA 2Z5WA 2W5FA 3AB0A 3S30A 5LK5A 1W2UA 3ZN6A 1CAXB 1BEV1 2IXLA 3BTZA 1QJY3 1CESA 1N3QA 3AVSA 3SKVA 3ZFEC 2R30A 3VBFC 3SH4A 1JH5A 1J3RA 1YUDA 3KQ4B 5A33A 4CPBA 3VHOA 4Q4X2 4IXLA 5F3IA 2XPJA 1RUF3 1X50A 1W2NA 2L9LA 1ULGA 4P9IA 3H1YA 4AE2A 1Q56A 4DNYA 4H14A 4GB31 4EN9B 2Q1ZB 1Q8SA 2FCTA 3DYMA 4XF9A 1JW6A 3N9OA 4UW4A 3H3UA 5K8SA 1BLZA 1OVSA 4K1ZA 3MW3A 5FY0A 4RHV2 2WFPA 4OI2A 2R062 5A7PA 3DF0A 3A4UA 4IE6A 4RN5A 5FLIA 2OZ6A 4XFHA 4XAAA 2AEYA 1CN1A 4Y1UA 1UOBA 2BVVA 2YZ4A 4D6RA 2DCJA 3WHUA 5CADA 3PIJA 2VUAA 4B7EA 5C9AB 4DXTA 1D4M2 2ZBJA 4AAXA 2R7EB 3OSDA 4UW3A 2JDYA 3TBDA 5CKQA 5FYIA 1BK1A 1QJU1 5C33A 5LY1A 4UI9L 4QM8A 1EAH2 1PVC1 3OUIA 2QUOA 2KD7A 2PTMA 3KT1A 5B4NA 2QKDA 4RQPC 3AP5A 3HQUA 3ZVXA 1RUC3 1LTEA 4URAA 1LOAA 1FV3A 3CIHA 4LTAA 2ZGRA 2VTFA 3AZVA 5BY5A 2RJ2A 3PJQA 2C26A 3BYWA 4BYYA 1BMV1 1DQ4A 3E6CC 1GP5A 3VDDB 5HV0A 4XCAA 2A6ZA 5F5AA 1KS5A 3KCCA 4XF3A 4YYOA 4OI4A 1H8TB 2YUEA 4N53C 4ZONA 3O7OA 4YFZA 1SDDB 1W6QB 4E8CA 3P3NA 2IVIB 1VP6A 3M8LA 4XFBA 3H42B 4I0AA 3EMRA 4GWMA 4MX3A 5JZGC 4KBBA 1PK6B 3MIEA 1I6XA 2RMU1 4XBQA 4AVAA 4TN7A 2A5ZA 1V00A 2IXHA 2QZ3A 4EROA 5L9RA 4BQXA 3EO6A 3LDKA 3NV4A 4CEYC 5FMBA 1AR93 4XXPA 3BCWA 2YDEA 3D3AA 4JTNA 5A3LA 5FPBA 1A8MA 2R041 4OQ9A 3U4SA 4YRDA 1DP0A 1PO23 4CUGA 1NZIA 5CKNA 2E7AA 4FSJA 1S4CA 2BJSA 1URXA 2W92A 2V4AA 4AHYA 1AYN1 1SG3A 1QQP3 3MIGA 1FT9A 2GNMA 2JICA 4CSWA 1ZRDA 4AXOA 3LE0A 1WCDJ 1SLBA 3INAA 4PDWA 5GM0A 3O0VA 5AVPA 2X09A 4QDRA 2BWCA 1HB4A 3OGJA 3ALQA 3EXUA 1NLSA 3H1MA 2VZUA 3GM8A 1POQA 2HWD2 3HOBA 1BYHA 4MZUA 3R4SA 4XQ4A 5T54A 2ZMKA 1POV1 4LE3A 2G19A 4XJZA 3WVJA 2YU2A 3MHZA 2XL7A 4RGKA 5FYTA 1MVQA 3WNPA 2AZ5A 2JE9A 5H9PA 4AGRA 5K0UA 1W3VA 4BQ1A 4LIUA 2QQLA 1O7FA 2D40A 1RL3A 3UGFA 1HQNA 1C8M1 4CDWB 4AGVA 4L2NA 3H3ZA 4L97A 4L92A 3O1RA 5FPVA 3B69A 3POEA 1R1A1 4GXLA 3BODA 1OPMA 1QMJA 1PIV2 1Z7S2 4YVWA 5FK7A 3EQEA 1XSRA 2RS53 2VW1A 2YY1A 3BTAA 4FOYA 5KXEA 1GP4A 4FOQA 1TMF2 4MO3M 4E2QA 3NWKA 1RHI2 5FKCA 4QDQA 1HB3A 1H4GA 2ZAAA 5JOXA 2B8MA 5FCCA 2D44A 3IIIA 3QOPA 1EV13 4YZ2A 4XVHA 1ZZBA 3U75A 1JN2P 4JGZB 1W9TA 4E4ZA 5FUNA 2GU9A 2WZR2 1UZ0A 1R1ZA 3SQOA 3LPGA 1AYM1 1UIJA 1XC6A 3ILRA 4HK8A 1RMU2 4Y22A 2DV9A 4CCLA 1IPSA 4LO5B 2XVGA 5FPUA 1JYCA 2EALA 1OURA 1FPN3 2DCZA 5DMYA 3GBGA 4GQ7A 2DCKA 5LBFA 1V6JA 2AUYA 1W6MB 3MEPA 5T5JA 3LEKA 4EN8B 2GNDA 2XBO1 4LULA 3HQRA 4QQLA 1BK0A 1NCRC 4GAZA 4QX7A 4UFKA 1XE8A 5BNPC 1GWKA 5J1XA 2DUPA 2LW8A 3BUCA 1K5MB 3SKJE 1VRBA 2GN7A 1AR72 2JIGA 2ARCA 5DAXA 4AQSA 1WUVA 4XFIA 5M0TA 1A6CA 2PHWA 2BUKA 3D4KA 4LBNA 5L73A 3ZXLA 4BB3A 4QX1A 1JS9A 5GKAC 1OA4A 1W0PA 4OUEA 2LALA 5E16A 2VD7A 3T2TA 2D6LX 1R64A 1UYYA 4JHZA 1FOD2 3QD6A 5DAPA 1BBT1 1VAMA 2DVDA 4NIAA 1FMD1 4D6SA 1RUD3 3FJSA 4ZZ8A 4LKFA 1JZ7A 1HV1A 4CDQB 5GZDA 1VALA 3IN9A 1XU1A 1HRV3 4RA0A 1S0BA 4ZXKA 4RR3B 1UX7A 1XU2A 2WYSA 5I0TA 2J7MA 2P6HA 2RS12 1QHDA 3VZLA 4OULA 4OYUA 4AEDB 4A44A 3F95A 4M3CE 2UWAA 3RJ2X 1DZRA 2YGMA 3RI8A 4AL9A 4YZ5A 4HN1A 1O4ZA 2JDHA 3KF3A 2JE8A 5FZFA 4NIIA 4AVSA 4QKFA 4SBVA 3U37A 1QKQA 3W9AA 4BJ0A 3WNLA 2XJTA 3BOWA 2W47A 1FNZA 2NYYA 3HWJA 2PAMA 4NAMA 2Y6HA 3PTYA 2TEPA 2DF7A 5J98B 5T55A 1H9WA 1VR3A 1KFXL 3M3IA 1XPWA 2VCBA 4PIYA 4KL1A 3TEXA 3WNKA 5JCTA 1NZCA 4IERA 5IW0A 3KB5A 1YFXA 5C8CB 3OF1A 4QQOA 3LFMA 5FYUA 3JD72 3O1TA 4PHZA 1O3SA 3AYCA 1BZWA 3O1MA 2I45A 1JXNA 3GXUA 1PO13 1NQJA 2D97A 4BQ4A 5DDJ2 4RGAA 2GC0A 2Q8DA 2WFF3 4QPGB 3NSTA 2VAUA 1WD4A 1H8TA 4GMP3 4ISRA 1W6QA 2Z4FA 3POJA 4RS5C 2VOKA 4Y24A 5A80A 3M3OA 2FD8A 4N43B 3HPNA 3OCPA 4BHPA 3WXPA 3RPQA 5FZAA 4DEVA 1KGYA 3O5SA 4OHVA 5IK7A 2ZGQA 3KV9A 1XSQA 4QXBA 3T4VA 3L2HA 3H1WA 3L9JT 5FYMA 1XNDA 4Q4X3 2HWE3 1ULPA 3BN6A 1Q8VA 3I2FA 4R4ZA 5FY9A 1W06A 5C7GA 3USUA 5FP7A 1ZBA2 2A73B 4ASMB 2VNOA 4HKOA 5J09A 3ITQA 1A34A 3AMQA 3UKNA 3EBRA 2WNOA 4YFWA 2RDNA 4YM3A 2VOTA 1GR3A 1VRH2 4LKDA 3T0AA 2BP6A 4H55A 5A3MA 3TEWA 4FP3A 4YW7A 3HNYM 4YW1A 4DMIA 4EV0A 2W91A 2XH6A 5BYNA 2DU0A 2EF6A 2ZGLA 4ASLA 4IETA 1W8OA 1QJEA 3MPBA 3PURA 4XUPA 4XHXA 5EJ3A 3A21A 5A6QA 5AFEA 5I8TA 2Y64A 4WM8C 1UQXA 4QPIB 4IESA 4GD4A 1RJ7A 4CU8A 4XMIA 3FHIB 4D7TA 2J42A 2ZGOA 4X6QB 1AL23 2YC0A 1VBC1 4QKDA 4D0QA 3ETPA 3L2YA 3NNGA 4UBHA 3ZFFA 4XJUA 4XFFA 3ZXGA 2RR12 2AEZA 3ZSMA 3I2IA 4IV3C 1UY3A 4P9JA 4UYBA 4D94A 4C8DA 4Y1VA 4FCAA 3W20A 1H4HA 2LUWA 2WNVB 3CQOA 1VBE2 1X82A 5JLVA 4QU1A 5JPNB 4CP9A 2ZTNA 1YQ6A 1Z0HA 4MH0E 2BOIA 4K21A 4QM9A 3RYKA 4KU8A 1HXS2 5FZLA 1RUG2 4D7YA 4KMQA 5FBZA 2R072 2XWJB 3ES1A 5E8AA 3ZKUA 2XONA 4Y1ZA 3ZXAC 5AC91 2CGNA 3HJRA 3OD0A 2VVFA 4XETA 1RHI1 5D1IA 3WNNA 4BU2A 5FZOB 4C0BA 3J8F1 4HETA 1MQTC 4PLMA 1RUOA 2NM1A 3IDAA 4O9EA 2HJIA 2Y33A 1OF3A 3BB6A 3BI3A 1QXRA 3MI8A 1UKGA 4X8PA 4QQ2A 1ZZ6A 4EZ4A 1RUI2 1SLCA 2MHFA 2JB4A 1S0GA 1RUH1 3ETQA 1GLHA 3KT4A 4FPYA 4QXKA 1AR82 4AI0A 5A32A 5I8YA 1X8MA 2WINB 5J3UA 1ALYA 1GU3A 2JKBA 4JGZA 3WG3A 3VBSB 4FPFA 4TWTA 4UFHA 2NMNA 2WSVA 5A3PA 4WZCA 1AR63 2JEMA 4FAHA 3IPVA 1JODA 1NCQB 1UPSA 1F4AA 2FDJA 3WQ0A 4QHOA 3ZPOA 1JTZX 1QWRA 1R091 3POBA 4K9SA 5L7OA 4R9CA 3OJBA 2VVDA 1AR71 3MGUA 4XJ9A 2G4IA 4ZS3A 4KU7A 1T6BX 3HMYA 2YG0A 3K46A 3TNPB 1QOOA 1MS1A 4P9YA 3TRSB 4YVWC 1ASJ1 1W9WA 2YC4A 3CJXA 3PDQA 1W0NA 4LK6A 4WM7A 3B7MA 4NVPA 2MEV3 1B35A 1RVF3 3FHAA 2RM23 3OGGA 5JOYA 5DAQA 1RITA 4OUSA 1GQHA 2ZPXA 2O0OA 4IV1C 2J1VA 4M4RA 1TG7A 3MYXA 3NQHA 4AQ6A 1JYXA 3CJIA 5FYBA 3F2ZA 3DPRB 4RL7A 3NNLA 4M0NA 2WNUB 1UMHA 3BU0A 4PI2A 3NJZA 4CDQA 4FFIA 4AHXA 4QHBA 5FZ0A 1ZBE1 4XUOA 2B45X 5LA0A 4CPBD 1XBFA 3LGRA 1PIV3 1Z7S3 4AHWA 4Z2AA 1ZVFA 1E5RA 1IG3A 1H9PA 1YNAA 4FP2A 4LOTA 3DYPA 3OUHA 2XOMA 4Q4W1 2B4KA 2W1WA 4CCCA 1WBFA 4LBQB 2YBKA 1O6UA 4GJYA 3RYPA 3RZKA 5KHHA 1J1TA 1HIXA 1OD3A 1C4RA 2IUWA 5FUPA 4I3GA 1H0BA 5J48A 1OD5A 4GALA 1NY71 2C4XA 4Q5OA 5HXVA 2EAAA 2OYZA 3T0DA 1WGPA 1ZYBA 1RMU3 1O3RA 1RXFA 1JYIA 4B4PA 2HWB2 2VZTA 2IVJA 1VB4A 2W0XA 4A3ZA 5CVRA 1FV2A 4COUA 3EHKA 5ACA3 4XQWA 3ZFEA 4A7KA 3GBFA 4UFLA 1W9SA 4HVRA 5DDJ1 2RDSA 5GLWA 1MS9A 1S1AA 4BXFA 1Y4WA 2QQPA 2VNVA 2C0ZA 4W65A 3GZAA 4QPGA 5F6LB 2IXCA 2VMEA 3V64A 1Q8QA 3I2KA 3VZJA 4Q0UA 1WLTA 2VMGA 4DOUA 3RWKX 4CUAA 1REDA 2HWF1 4AEKA 5E89A 4V1PA 5F3EA 4LORA 1DFQA 1V9U2 2OVUA 2VU9A 1FOD3 5C9AC 4LLOA 1QH6A 5K9YA 5KBFA 1O3TA 4R9BA 1PM4A 1MPXA 2WJSA 3THCA 5JWPA 2CWMA 1LB2A 4L11A 3PVBB 3ES4A 3POYA 5FLJA 1V6IA 4BA6A 2UY9A 4YG6A 1PMJX 2ES3A 2ORXA 3LIGA 3WDVA 2WC2A 1SBDA 4MUVA 4Z8BA 3U0ZA 3AKPA 3AL5A 5L19A 5KXDA 4IEWA 4IDZA 2IC1A 3KGZA 4CCEA 3VN4A 4K20A 5JXGA 1O8SA 1X36A 1BEV2 3WP3A 5IK8A 3AMNA 1ENRA 4DPNA 3FN9A 5BNOB 3AZZA 1YFWA 3KHBA 1D7PM 1SDWA 4CEWB 3VDDC 3D5OA 2ZX2A 3MV01 3ZKYA 1CVNA 1JUIA 1H8TC 2WAOA 2VMFA 1WA4A 3HBKA 3VKNA 5I0DA 4M3CF 1VB2A 5C3OA 4GB32 1D0GA 4JDOA 5JPMB 3N3HA 3NJVA 4C1WA 3N4MA 1PK6C 2JDAA 1YO8A 3WF1A 2R071 3ILFA 2ARBA 4AI1A 1H30A 2WNVA 2Y6LA 3JD73 1BKZA 1X9PA 3LFIA 4IGQA 4XE9A 3MFCA 3Q8AA 4AFAA 5JZGA 3W5MA 3PLQA 3OUJA 1NUKA 1EY2A 4YARA 1OLMA 3IKWA 3K3NA 2GMPA 4QPWA 5BPXA 1WMFA 3ABZA 4WVMB 1CPMA 1QJU2 2VO5A 3K4DA 5DZGA 5EXOA 3ZR5A 4JV4A 4P9GA 3OY8A 2ZGTA 3DL3A 1JOJA 1PVC2 4QWNA 1CQ9A 4X8NA 1H1MA 2EXHA 1LGBA 4Y20B 5IK4A 1PNGA 3E5XA 1OMIA 1AF9A 1COV1 5LA2A 5KR7A 1UXZA 3POIA 4ATFA 3CMGA 1RINA 3T0BA 1W8UA 1F4HA 1XOYA 3V0BB 1G86A 1Q8PA 3VBUB 4BISA 5FLHA 1KQRA 3N35A 3VBSA 1F9KA 3OB8A 4ZKTB 4LHSA 3RQ0A 1HRI3 4DXZA 4UW6A 5C4WB 5F2SA 1VBB1 1OA3A 3KF5A 1BMV2 2K0GA 2W87A 3D8CA 2A6VA 2P17A 4IEYA 4LBKA 2A3YA 2H0VA 3RZLA 3OD4A 4CDWC 3AP6A 5A6ZA 2E31A 3OBRA 3AP7A 5BV6A 2RMU2 1FI2A 1SCSA 4C1XA 5D8AB 1GZCA 3QH7A 3R0RA 1E5SA 2WQ4A 4GIQA 5HCAA 2GAUA 3I49A 2A3WA 1YQ2A 3FLRA 4I30A 4S2HA 1UU5A 1W6NB 2A70A 4JQRA 2Y34A 2R042 2ZS6B 4JGZC 3U07A 1UZVA 2UYAA 2YBSA 5A3TA 1J84A 2VBBA 3I2OA 2ZJCA 1AYN2 2D93A 3KZ4C 1DZQA 2RV9A 5GLZA 2D6PA 3AJYA 4ASKA 1VAVA 3OG2A 5CA6A 3I8TA 4Q0SA 5A1AA 3MICA 1QDCA 2CNAA 2E32A 1VJ2A 1K5MC 4W6YA 4J1WA 3POFA 3AMHA 4DY5A 1NCRA 1OH4A 4IEUA 3DXTA 1AR83 4YLZA 4MSVA 1I5ZA 4HN0A 4KWLA 3RG0A 5KHJA 1QJY1 1JBCA 1C8M2 3ZPYA 4A6SA 2XKOA 5KWRA 1QOSA 5FY8A 3T09A 4AR2A 1R1A2 5EP9A 1O59A 1XE7A 1KEXA 2XL9A 5FZ8A 2X05A 4B4RA 1F5JA 4FPJA 1QEXA 4PLOA 4R9AA 4URTA 4CDQC 3UKTA 1DU3D 4CXWA 4MHRA 4XUNA 4YW6A 3LDRA 4RR3C 5FZIA 3VB9A 2JECA 3WDTA 4AEDC 2CGOA 3AZXA 1DGLA 4XTMA 4XC9A 1GICA 2D6OX 1LRHA 1XQNA 1DGRA 4FOWA 2VXRA 3BIWE 4HBNA 1AYM2 1VMJA 3NW4A 1OA2A 2E53A 3KV5A 1AJOA 1CZVA 5FPLA 1V0AA 3AL6A 1C1LA 4BMBA 4I01A 2FZ2A 2VZRA 5IVJA 5J36A 1HX6A 1MS4A 3TAYA 4AEJA 1RUC1 2QNKA 2XBO2 1JU4A 2P5BA 5DZFA 4Z07A 4AI3A 1W39A 5FOBB 3AXDA 2BGCA 3VZKA 2UURA 3FFZA 4CP2A 2B9UA 4MXWA 4X6RB 5FY5A 4BQ3A 1HN1A 1WCSA 2WO2A 1CAUA 1R083 2BYVE 2DVAA 4WVWA 1EPWA 3KWVA 5C8CC 4M01A 2F17A 1GUIA 1OH3A 2WSUA 4XURA 5JAXA 2BNMA 3D0SA 1DBNA 1APNA 2XMLA 1JOPA 5BNOA 4HANA 4UT5A 4XTPA 1BBT2 3IDCB 2D5HA 1RJ8A 4QPGC 1FMD2 4UWDA 3AKSA 2E7QA 1VE0A 5C3SA 3VZNA 1QU0A 2GH2A 2FCUA 2R0HA 3J7NA 5FYYA 4N43C 1LECA 2DURA 2PFWA 4HVOA 2BW8A 1X7NA 5F8PA 2FDKA 3J7HA 1UY4A 1RIRA 3OGSA 1YQ5A 4LUKA 3DV8A 4AI9A 3U4XA 4RS5A 3P3PA 4HK9A 3VV1A 3BALA 1CR7A 3DXUA 3H50A 4YM2A 3UGHA 4LK7A 2RS31 2CU5A 5B2GB 1OVPA 1HB2A 1AR91 1PNFA 2JIJA 4BIOA 1GMMA 1OLQA 4BLIA 5DAWA 1U5XA 4YG0A 2O1QA 3RZGA 5IK5A 1Y9GA 1ZRCA 4MGSA 3RI9A 1DYKA 4QX0A 2UWCA 1RYYA 3C7HA 4KWJA 1IS6A 1QQP1 2GC2A 3WG1A 2RHPA 2X10A 3AZYA 4RYDA 5EIYB 1KJLA 4N7IA 3FX3A 1I5PA 5C5TA 3JXSA 1MACA 4IQPA 4PBPA 1H6YA 2KM2A 3BVCA 5HXMA 1N3PA 1PGSA 1V9U3 1PMIA 1H2NA 2ZHNA 4LE4A 3SCFA 5IVYA 5FWJA 4QPIC 2WZPP 3ENRA 4HLTA 2YV8A 5GALA 1NQDA 3U14A 2Y6GA 1LHNA 2IFWA 4WM8A 4R9DA 4AG4A 4XBNA 1HW5A 1QJZA 3M70A 2WS91 4LHLA 1QJX3 3WNMA 5F39A 5GJ6A 5SV5A 5C4WA 3TWIA 2GDFA 1JYNA 1OOPB 5TSWA 4I09A 2WNVC 3VD4A 4IV3A 4AFBA 1BEV3 4HKLA 3N9MA 5A3NA 1KD7A 3QH6A 1YIFA 4JDMA 1K5JA 4RSUA 5HI0A 1UOFA 1SEFA 2WAAA 2XJQA 4M3CA 3O0XA 1RUNA 2YFZA 3UYJA 1EV11 3IB3A 4ZZ5A 5C70A 1ZM1A 4GB33 4XIKA 1MQTA 2XB6C 4MADA 1UZYA 1MS3A 4TSVA 3GBWA 3IDBB 1O5UA 2EIGA 3AVRA 1DQ6A 3KS7A 3NKTA 1JOBA 3KM5A 1V70A 3VBSC 3WDXA 5ISLA 2VQ0A 3VZOA 3MIDA 1J1LA 3PTRB 2TUNA 3EJKA 5EJ1B 4DINB 3O1OA 5LASA 4AEMA 1NCQC 1AVBA 2P6CA 5GLVA 1GYKA 3OBZA 4Q4Y3 2YHJA 3Q9OA 4I3PA 3SH5A 3ZSJA 4GKYA 2VBDA 2ET1A 3HNMA 3WCRA 1QJU3 5DAVA 3K4ZA 1VBC2 4HOOA 3UT0A 4A2UA 2P4EA 4TTGA 1SQ4A 3CL1A 1U0AA 1HDKA 3FBMA 4PJYA 1S0JA 3KD4A 1LHOA 2OQ7A 1UW8A 2WIIB 2YPJA 3LCPA 4AHZA 4F7ZA 2JDMA 4LHKA 1LHWA 1ST8A 2ZEWA 4QQHA 1KDMA 3AFKA 3CNAA 1QH7A 5FR3A 5JSOA 4K7JA 1NE6A 1ZA7A 4F3JA 5F9TA 1DDLA 5FQ0A 3OPWA 3VL9A 5AC92 1XNTA 4MV2A 1RUJ3 4LT5A 5CAZA 5DUWA 4O9GA 3DPRC 2ZEXA 3J8F2 5LA9A 3RFRA 2C9KA 3VGIA 4Y4YA 2GALA 4IV1A 2WNUC 4GJZA 1SBEA 1PGL1 4NHXA 1S2EA 3TEZA 1G9DA 2QQWA 1DLLA 4U2AA 1RUH2 1SBFA 2W95A 1NX9A 3ELNA 1K42A 4NPMA 1DHKB 2VCAA 4AVTA 3I2GA 2BEOA 3V0AB 2NN8A 4FFGA 4B3NA 4QB2A 2C24A 4A7ZA 2BERA 3E6BA 1UCXA 2X5IB 2D5FA 2W08A 1IKQA 1R092 4EE2A 5IT6A 2ZAHA 1S0EA 3JB8A 4NJ4A 4MGYE 5FZ3A 5C3RA 5LCWL 3RGBA 5T50A 3WZ1A 5IFTA 5CG8A 4FPEA 1AYN3 1YJKA 3VBHB 2ET7A 5LZ6A 2CYFA 3BTYA 5FJKA 1CAXA 3N36A 1ASJ2 3PU3A 1XJAA 1GNYA 2DBNA 4PQ9A 2W52A 1H6XA 2WWSA 2HEVF 1AL0G 5B4XA 1PO11 3I3MA 2UWBA 5HCHA 1U12A 2Y6KA 2WFF1 1TE1B 1PGW1 2ZEYA 3AYDA 2ZCWA 3DEMA 5FWEA 4DXSA 4E4DX 2P3IA 2V4VA 3ECQA 1OI6A 2Q30A 4HT1T 1Q5OA 4KH9A 1ZREA 4ATEA 3I3EA 4Q0VA 2MNGA 2PELA 1DG6A 4XZUG 1JYVA 2NZ9A 1F35A 1B09A 2VOWA 2VTXJ 4H2AA 4BOWA 1C8M3 3A23A 3M4FA 2HWE1 1JZ5A 3DCQA 3DUIA 2FZ1A 1ZBE2 1R1A3 3IMMA 5HPOA 2VM9A 1W8TA 2W9XA 3IMNA 5CIRA 3K3OA 2VZOA 2GP3A 2XGXA 4MGKE 5I93A 1SMVA 2GNBA 5C9AA 4Q4W2 2VQTA 5A1FA 2DCYA 1ZX5A 1HB1A 3GZUC 2OIIA 3PVNA 3I3DA 4YW4A 3B02A 2ILMA 1CAWB 4Q8KA 4OVEA 2ZZQA 1NY72 1UY2A 4YGDA 2XLAA 4OI0A 4META 4BQYA 3POSA 3WQ1A 2D7FA 4COZA 1AYM3 3ASIA 4IEQA 2AH2A 5DABA 3VZMA 3M1HA 1DCSA 1OBNA 2ADEA 2ZHLA 4Q0PA 1S0IA 5BNOC 4CEWC 1AL21 5LEJA 1MZFA 2YPDA 1TME3 4O7XA 3W21A 1W6OB 3WNOA 2VZ3A 2G9FA 5KC5A 5FZHA 2XBO3 4YWAA 3T30A 2WABA 5FZ4A 2JDZA 1O4TA 3C7GA 3VDDA 2OX0A 4IL7A 2B39A 3E6DA 4XACA 2VPVA 4ONUA 3I3BA 2QDNA 2K46A 2A7AA 5J37A 4NIGA 5C8WA 3WG4A 2J1AA 4ARYA 5IVCA 4DZGA 1UY1A 3JBG1 4I0WB 4IE5A 3OGRA 1F5FA 3C7FA 4BH9A 2VTXA 5GZFA 1PK6A 3WP4A 3B93A 4BWOA 4QB1A 4CVUA 4OHXA 2HWF2 2CY6A 4EQVA 2ZXQA 1ONAA 3BPZA 3DGTA 4R8HA 4XFGA 1JZ3A 3IBMA 4AI8A 1BBT3 3ROUA 1CZSA 3SCGA 4LR4A 3LD8A 3M3QA 4OZOA 4AVVA 3J9SA 1LR5A 1ENQA 3CO2A 4CDXB 4RHV3 4LMFA 1S0FA 2R063 3LA3A 4QXCA 4G9SB 3ZYJB 4YG3A 4DUWA 1YYNA 1AR61 3VBUC 5BUVA 1D4M3 2NMOA 3WNXA 4CP1A 4A42A 3VDBA 1T2XA 3M7AA 4AF9A 5CFDB 4IW3A 1PZ9A 1EAH3 3SEPA 4MGIE 1A8DA 3NO8A 1LESA 5C4WC 2VMDA 4I2OA 5CFCB 4FTSA 2CWSA 5A7WB 1O8PA 1REFA 4GA9A 5I8SA 3WF0A 5A6YA 1RUE1 1W05A 2CL2A 1ZRIA 4IE0A 4Q2FA 5IAVA 1TZOA 2BGPA 1ULEA 2DTYA 1EUTA 3NJYA 4J6GA 5F32A 1K3IA 3GJBA 3LEGA 2RJLA 4XDQA 2MEV1 4FPGA 3H8RA 4CDWA 2KA3A 1W28A 1ULDA 2RM21 1WCQA 1RXGA 5D8AC 3ACGA 4QPYA 5L9VA 2ZGUA 4N9HA 3MW4A 4Q8LA 5HCFA 3MLJA 5I0SA 1W2AX 3W58A 2ZX1A 3LOIA 3B3QE 1N3OA 3DYOA 3OEBA 1YIPA 1X33A 4GMP0 1CAVB 4HVQA 3PL0A 1VAKA 3N7KA 1BQPA 1LGNA 3ZFGB 1GOGA 4NHMA 5T5LA 3LOBA 2ERFA 3U1XA 3TN92 5A1LA 2R1DA 3JU9A 1CIYA 5FP3A 4LO6B 3NNJA 4QB6A 2B42B 5IATA 5JXJA 2J1TA 1COV2 1ND2B 4Q4V2 2GMMA 5DUUA 3X29B 1OFNA 2HWC1 2OW4A 3HEIA 3Q8EA 4K3UA 4YGBA 2OQ6A 4A6OA 4OI1A 1SPPB 4DUXA 1W6MA 1J59A 1GQPA 3KVAA 2PQQA 2VXJA 2Q0AA 2X5IA 4PCRA 1NE4A 3V65A 5LK7B 1RB8G 3HIFA 1UMIA 1VBB2 2XHKA 5FO7B 4TYSA 1NA1B 1US2A 2CHHA 5T5OA 3KSCA 3AMMA 4YVSB 3ZYIB 1K5MA 2PHLA 2WQ8A 3Q8FA 4CCDA 4NPLA 2DFBA 3HBZA 1LOFA 3LEIA 1PZ8A 3THDA 3K48A 3NRUA 5FDBA 5FO9B 1MEC2 4MXVA 1LKNA 4MG2A 3ZLIA 3CBNA 3HAGA 3U10A 5IJRA 4FOVA 2HWD3 1SLLA 5FZ7A 4E2GA 4EWAA 3MF9A 4PT6A 4COVA 2QTWB 3I4IA 1OXCA 1IQDC 5EFUA 1JZ4A 3IWZA 1OT5A 2VOVA 5GZGA 2E9QA 1VBD1 1ZA4A 3Q8BA 4TLGA 1XRUA 3SITA 1CX4A 4RR3A 1I1EA 3NV3A 4XW3A 1U5YA 4AEDA 4Z92B 3NMBA 2P3KA 4QKBA 1O5LA 3E5UA 4FT8A 1XNKA 3ZMOA 4YW2A 2JJ6A 3Q8CA 1GFF2 4CP0A 1TMF3 1NYWA 5FZEA 4AQTA 2VQUA 1BVVA 1D2SA 1TQ5A 4F8AA 5AC93 1GNZA 2Q8EA 1FXZA 2WT1A 4BMEA 2CGPA 1RHI3 1VIWB 3VD9A 3GHNA 4LBMA 3J8F3 2D6MA 4P00B 1NG0A 2A75A 2ZX4A 3K77A 2YB7A 3THPA 3O12A 5LEKA 2ZKLA 3ZSLA 1GSLA 4NRPA 1LEMA 2WZR3 3C8XA 1HKDA 3I54A 3UETA 4FI9A 1QGLA 2WNEA 3POWA 2BBAA 3RMXA 4YSFA 3N7LA 2UU8A 4YNIA 1QJY2 2JG9B 2WDBA 4LQRA 3VKFC 4OUMA 5A70A 1DIWA 1S2KA 2DUQA 2V09A 4EYUA 5C8CA 1L7QA 3ORJA 2BBVA 4QX3A 1UOGA 2VW2A 4BM8A 1R093 1ODMA 5IHRA 3GHMA 1LJ7A 4Y4RA 5DUXA 3RZJA 2N7GA 1AR73 2EVXA 1CX1A 4PQQA 2RDRA 4JGYB 2RE9A 3FZ3A 3ZXEA 4XDOA 1N1VA 2BGOA 2JB8A 2QBXA 1GWMA 4JRLA 1LOCA 1OSGA 4MLOA 4QX8A 1ASJ3 2V5YA 3WX5A 3RZHA 4N43A 1V6MA 3FE5A 2D98A 3UK9A 3WW4A 3JQWA 5F37A 1WMXA 3OPTA 5ABJB 5FIXA 3MLKA 1G9FA 3WHTA 3GZEA 1C5HA 1N1TA 1NLRA 3WF4A 5K7PA 3MIFA 3I2HA 2WT2A 3PUAA 1JYWA 3OBTA 2WLQA 1RUC2 4NUBA 5EWSA 2RS13 4L99A 3ZN4A 2DVGA 4P5YA 4CDXA 5C3PA 2PLV1 3VBRB 1LOBA 4RFRB 3LB9A 2XJUA 4XIOA 4NHYA 3ZMNA 3SCHA 1HRI1 2WR9A 2XR4A 1T6GC 5F3CA 2ZA9A 4LO4B 1FAYA 4BIFA 2ZGMA 4QPIA 4OFGA 4KWUA 2Y8KA 4N8MA 4QMAA 2Z79A 3SEEA 2J1RA 1GOHA 1QXJA 4N90A 4QD2A 2R32A 5T5PA 1CZTA 4AFCA 1OOPC 3JZVA 4P9XA 2BV4A 5CFCA 3NV1A 1YLLA 5A7WA 3RDIA 3MBWA 5A33B 4NHKA 1AXKA 4ISQA 2WRAA 3ZSKA 1JZ6A 3HT1A 3WY6A 4PIZA 2ZGSA 5LBEA 5LRRA 3ZOIA 2XLGA 5FK8A 4EJRA 1O91A 2VC9A 5DG2A 1UX6A 5DDJ3 4IEPA 1ND3B 2GH8A 2RS32 2WO7A 4NWWA 1AR92 2CAUA 2WT0A 5A3WA 1AJKA 4Q0QA 3K75B 5FZOA 1WLDA 4G4FA 4O65A 4Q29A 3JB4C 1NT0A 3BIEA 2W68A 3TN91 1HJFA 2YYOA 5CU1A 5EZWA 3ST7A 2B9VA 1XNAA 1QQP2 3WDYA 1F8VA 4Q4V1 4UF0B 5FFOC 3ZFGA 1VBA1 3WD5A 3ZYFA 2IWGB 3THTA 2W39A 4KG8A 1WD3A 2CTVA 1ZBA3 1F2NA 1SFYA 4GWJA 3R05A 1IPKA 1ND2A 2C6SA 1LODA 2B46X 1NCQA 3ON7A 3MO4A 4QGNA 2XDVA 2Y0IA 2EIBA 1VRH3 4XAEA 1ENSA 3D6EA 4BDVB 2WS92 1X9TA 2OPKA 4HZFA 1CJPA 2VUCA 3UESA 2ZX0A 2J1SA 5FYCA 1XE0A 2VZPA 5CYYA 3IIAA 1MEC1 3MDPA 1FNYA 4I02A 1NA1A 1L3JA 2AACA 4YVSA 3J7MA 3NNMA 4QGLA 1WW7A 5EV7A 1CONA 4A3XA 1SFNA 3ZXFA 5FYZA 4UFJA 4M0HA 2YC2A 3MIBA 5JIUA 3CU7A 5FP8A 4MGZE 4JKLA 2D6NA 3AYEA 4K8RB 4AOCA 2BPA2 1L7RA 4CDUB 3SH3A 2RR13 4IGPA 3ZYGA 3O1PA 4CYDA 4NOTA 2ZMNA 2OT7A 5FP9A 5CKMA 3U78A 1EV12 4PBOA 4AK3A 3DPRA 4UXAA 1JZ2A 1VBE3 3C7EA 3N9NA 1DYOA 4AFMA 3RS6A 2FDHA 2WNUA 2AC1A 3W5NA 4W6XA 3MF6A 4YW5A 2BNNA 1HXS3 1RUG3 3AYAA 1DF0A 5GLTA 3WUDA 2CSGA 2PXJA 2R073 4JHTA 2UY8A 4V2WA 1FPN2 1L7LA 4WBBA 2QZ2A 4P08A 2X5IC 3EB7A 4XEZA 4HONA 2R6QA 3AP9A 5F2WA 3FUQA 1WW6A 3KV4A 4IE4A 4CCOA 5JOZA 1RUI3 4LBQA 2BU9A 3SC7X 1AX0A 1LOFC 4LITA 5FP4A 1FX5A 2YROA 2VQAA 4CUBA 2YGLA 1N1SA 5D21A 3RWNA 3P1IA 3O1UA 1D2QA 2F4LA 4PDWB 5DQ0A 3VBHC 3C7OA 3NVCA 5DZEA 4UFIA 1TVGA 1R081 1IOAA 1E57A 1LOEA 2H6BA 2W1SA 5LBBA 3TNQA 2Q8CA 5D2AA 2D6KA 4UBGA 4DS0A 4HL0A 1S2BA 1BVP1 4WVVA 1ZRFA 1RUF1 4YZ4A 2WQZC 3I2DA 1UYZA 3R4UA 4ZXEA 3N9PA 3ZX7A 4DRRA 4H7LA 2Y60A 5FZ6A 2JG9A 1IPJA 4XABA 3KMHA 4Y33A 5EPAA 2WA4A 4NIDA 2XUEA 2WL1A 2ZABA 1SLAA 1J3QA 5K0UB 1J83A 4JZRA 4LKSA 1UY0A 4M00A 2PHUA 2XLFA 4DXRA 5JXHA 1YRZA 3RJRA 2ENRA 3PU8A 1HRV2 3P5BA 1ODNA 3PVOA 5DPNA 1NOVA 1PGL2 4KGQA 2HBTA 3GCXA 4FPCA 1W9YA 2G9ZA 3B00A 5HCBA 2LM3A 2Y26A 4BE3A 2V72A 1IS4A 2Z42A 3PUQA 5ANNA 4XZPA 3S5QA 1LHVA 4W50A 1H8VA 3I59B 2VJXA 2RG4A 2IZWA 4FPLA 5FV3A 5ABJA 1JZ8A 3MLLA 5FO8B 1UO9A 3MFAA 2LROA 4GH4B 2C1FA 4FO9A 2HBUA 5L36A 4GZ9A 5C5UA 2I2SA 3S5AA 2KR2A 4XHBA 4Y22B 2HH9A 1W8ZA 4I0BA 2X53S 3I2JA 5AFBA 4Y5Z0 5JIAA 4E2SA 4INDA 3WQ7A 2DFCA 1ULOA 2PHTA 5F5QA 4TLFA 4YZ1A 3A7QA 1PZ7A 2ZOEB 3MW2A 2DVFA 3D82A 1NAEA 2FDIA 2DBIA 1UPIA 2LS6A 5LATA 4Y5TA 1PO12 4CEWA 1QJX1 1YC61 5HV4A 2WWJA 5FZ9A 1YCIA 2PMWB 2WFF2 1PGW2 1JI6A 1GOFA 2I07B 3HVDA 1UXXX 4QT6A 4BQ2A 5JUVA 1GQGA 2UYBA 1GZWB 2XWBB 2P3JA 1ZNPA 2F4PA 2HWB3 3AKRA 4NRQA 5G04L 4BQWA 1C57A 1E5IA 3KVBA 3VD7A 2ZHMA 2HWE2 4QU2A 5FXVA 2ID4A 2XJRA 3KLSA 1K45A 4NPRA 1GKBA 1VMHA 2DCTA 3B9CA 3CZUA 5GZCA 4P14A 5A7QA 1YHFA 1ULCA 4ZU5A 1PO21 3KCXA 3NAPB 1W90A 4KI5M 1U5IA 2RVAA 3RYRA 1ND3A 4BPZA 4CDXC 4UOJA 5LW9A 4WVMA 4PF1A 4XJAA 2OA2A 4HPKB 4Z2WA 3FMGA 2PYTA 2JG8B 3KCYA 4Y20A 3B5LB 3DECA 3UGGA 2R16A 3QLQA 2JDUA 1Y7BA 2A71A 4Q4Y1 4UF0A 4FBFA 3UJOA 3S7IA 5CFDC 2P1BA 1SZBA 3V0BA 1W8NA 4CTEA 3VBUA 3C2UA 2W1QA 1AL22 2VOXA 4Q1PA 1S55A 1YQCA 3ZXDA 2K9ZA 3UKVA 2IFRA 1GANA 5CFCC 3BTXA 2BFUL 4IE7A 3ZDSA 5DXDA 1WLWA 2TBVA 1HN0A 2F6BA 2K2SA 2BRTA 3O0WA 1JHJA 3WW2A 1XNBA 1J3PA 2XHNA 3IM0A 1G8WA 1N1YA 2RS51 2NLRA 3JBG2 4JKKA 4DB5A 4CRQA 4JDNA 4WZFA 1OUSA 1JUHA 2ZGNA 3NV2A 4SLIA 1C1FA 5FMOS 1RUJ1 1IG0A 2Y6JA 4LOSA 1OKQA 1XNCA 3FUOA 5D8AA 4BZ4A 5IVEA 4LO7A 3I3QA 2WO3A 1AUYA 4K6BA 4CDUA 3FL7A 2VMHA 3WSOA 1YI9A 4YGEA 3KGLA 4ORFA 2A1XA 2MPFA 3ZFGC 4Z1VA 4QX2A 1W6NA 1N47A 5F3GA 3BKZA 3H7YA 2JKXA 5IYYA 1FPN1 3OTFA 3USUB 3D0JA 4NAOA 1ND2C 5BNNB 2E51A 3CDZB 2OPWA 5LY2A 3PUSA 1AR62 5KC6A 4FFHA 1JMUB 2X29A 3C3VA 2GP5A 2RS33 3UL2A 4A4AA 4NE9A 2QQMA 4C0HA 5A6XA 2WZEA 3VBOB 1A3KA 1W2TA 3T08A 1PVC3 5F5CA 4S2DA 4NHLA 1NA1C 1BJQA 2IXIA 5BNQA 4YVSC 4XUTA 3UJQA 2ZKNA 2VR4A 1RUE2 2QQVA 3VL8A 2O8OA 4XF0A 4KWKA 3ZYPA 5DUVA 5IVVA 4XFAA 5E88A 1MZ6A 4CA9A 3ME2A 2ARXA 2LRPA 2J1EA 4V2VA 2MEV2 5C6CA 3ZFFB 1RVF2 1MVEA 2VL4A 4AAPA 2RM22 5KHKA 1RUD1 2JD4A 2TNFA 4ES8A 3VLBB 3OYWB 5FY1A 2WS93 5IAXA 1HRV1 1JYTA 1UOJA 3G7DA 5FYVA 4BK4A 4FAGA 5KXCA 1Y9MA 4CP9B 4IUGA 3ILNA 1VLNA 2EICA 3WF2A 5KHIA 2J22A 3HNBM 3H3LA 2E63A 1YFUA 3WT3A 2VBPA 3H9AA 1OF4A 4LLFA 2P2KA 4Y5SA 3PVEA 4CCJA 4F83A 2QVSB 2RMU3 2WA3A 5F1RA 4B29A 5FOJB 1CGPA 1DQ5A 1DGWA 1YI7A 2E6VA 4PIXA 5FKBA 1IS3A 2HWC2 1AX2A 2PHFA 4IEOA 3LF7A 2YMZA 4IEVA 2BNOA 4CU7A 3I59A 5A32B 1H1AA 3J7LA 2R043 2OS2A 2YXSA 4DRVA 3AP4A 1O3QA 3ACHA 4QAWA 1ZZ9A 1LEDA 3LSDA 4GH4A 3VUOA 4IEXA 3MV11 4CCNA 3AKTA 4RGGA 3WP5A 3ZSEA 2FQPA 2PA7A 3IPVB 2DYCA 3I7DA 2JG9C 4XBLA 1GP6A 1DGWX 2VNGA 4JVAA 5L7OB 1TME1 2WN2A 4Y26A 5ACA2 2H6CA 1UN1A 2DVBA 1YQ8A 4AVBA 3NJXA 2HEYF 4AW7A 1RTVA 2HLEA 3B01A 4S2GA 5FBJA 4YW3A 3IAPA 4A7YA 4OCTA 1POV3 1LU1A 2O14A 1FYUA 4GMP1 4JGYC 5IVBA 2NP0A 1MR5A 1W6PB 1OC1A 2FDFA 4Y3OA 1V6LA 4W4ZA 4WM7B 1B35B 1VBD2 5GZEA 5LRSA 1IZ3A 1GZWA 3ACLA 4Q4X1 1UNBA 4FPOB 4FQZA 4XUQA 1Y9QA 1OHFA 1US3A 1W8HA 2W2IA 2XVLA 1AHSA 3BOPA 3FHQA 5ABJC 1GBGA 1Q8OA 3JQXA 3CJIB 4WV8A 5JVVA 3T2OA 1ZZCA 2B7YA 1UZZA 3ATGA 3MIHA 3WCSA 2Y38A 2YU1A 1H2LA 4MYEA 4RHV1 3PMEA 5JI9A 3H8OA 1YFYA 4R52A 5H9SA 2R061 2XQXA 3ACIA 4AQ2A 3NAPA 1SLIA 3GJAA 4PI0A 5FXXA 3TB0A 3TYJA 2VNRA 3RSJA 4KGGA 1MS8A 4HPKA 1W8WA 2EIEA 5FZ1A 5L9BA 3VBRC 4EWDA 3GF6A 1D4M1 2VZ1A 4RD7A 3M3CA 1IS5A 2JG8A 4S2FA 2Z2SB 1UMZA 5JR7B 3LIHA 3PMSA 3JCIA 4GWIA 1EAH1 3GZTB 4LPLA 4OMCA 3KHCA 1D0HA 4MOAA 1QNWA 1OQ1A 5FRAA 2Q8OA 3B9IA 3HN1A 3J4UH 2D3PA 4BCUA 3PIGA 1CD3G 2ZX3A 1ACCA 3HR9A 4M4PA 3LZZA 4GWNA 3TEYA 2E33A 2BZDA 1GWLA 3ZR6A 1XB9A 4JCKA 2QCSB 4NMIA 5FUIA 4AWDA 2LTNA 5CG9A 1J58A 1OOPA 5FY4A 1Y43B 5K4LA 4NROA 5E6HA 5LB6A 2FMDA 3ZFEB 4Q27A 4ES9A 3VBFB 2XJVA 3FFQA 2CDOA 4AGGA 3IZOA 2OKXA 1DLCA 1HQWA 5ANQA 1PVXA 3DN7A 4CZSA 4E4HA 5A7SA 1ND3C 1FMD3 1CPNA 1ZRRA 3IAQA 4L0PA 4LUMA 4E8DA 3LA2A 4J1XA 4YM1A 4CXXA 1XYPA 2FMYA 1BXHA 1QF3A 1POV0 1WCKA 1GZTA 4OQ8A 2ARAA 4YM0A 4HKWA 5H9QA 3PHMA 2WLPA 3WF3A 4W6WA 4BLJA 2ATFA 3POGA 4QDSA 2NQYA 2WWUA 2WBKA 5FREA 1LENA 3A0NA 1FATA 2FCVA 3AK0A 5I0RA 4B7KA 3OGVA 1M06G 1OQDA 3VHNA 1G9AA 2IXJA 3PUHA 2PLV2 2D43A 2VECA 2WYFA 2XQRA 3HT2A 3NNFA 2J1UA 2ZMLA 4E9KA 5BNNA 3CEWA 5FZBA 3KQRA 4XXAA 2WKKA 3MUY1 1HRI2 1LHUA 2Y0OA 3HN3A 2PAEA 4CCKA 1HV0A 2G9GA 3ZYHA 1IQAA 5C3QA 2OXBA 3CF6E 4RQPB 4LA2A 5SV8A 4QGMA 1DZTA 3VD5A 3WP6A 3E97A 3NL1A 3VBOA 1UD1A 5A7OA 2DU1A 2EXJA 2VG9A 1NXMA 5FMOL 2D3RA 1UYXA 3WDUA 1NLQA 2W1UA 1U5ZA 5IWFA 3WLUA 3ZN5A 4FTEA 2GMEA 2VCMA 3E5QA 2QDRA 1OLRA 1W04A 4C91A 1RVF1 4FXGB 3BPSA 4B1MA 2HWD1 4ARXA 4YGCA 4YPJA 4QHZA 3W59A 2CV6A 3RVHA 2GSYA 2JDKA 1A78A 1QDOA 2GZWA 2JWPA 4CDUC 4LBQD 5IFPA 1TNRA 4CU9A 3VD3A 4N53B 5FYHA 3NKGA 3AXEA 2DUOA 4DFSA 3G6JB 1UYPA 1BHGA 3N9QA 3OYWA 1G9CA 3VDCA 1MS0A 2X8KA 5KHGA 2BOJA 3DKWA 4H7MA 3K51A 3WEZA 1EP0A 2R49A 1PX3A 4NN0A 1PIV1 1Z7S1 4JKMA 4Z82A 5JZGB 1UZWA 2FHRA 2CDPA 3OBAA 3JBG3 1UF2C 4K40A 2XUMA 1TMF1 1VBA2 5EHDA 2Y6FA 3N9LA 4EWEA 1SACA 5FZKA 3V0AA 3LAGA 3OY8B 5T52A 4CEYB 2PHXA 1VPHA 1Q43A 1KXGA 1W9FA 4FPHA 3R6SA 3H8XA 5J96B 2VGDA 2WZR1 2KXLA 4FQ4A 2JX9A 4OMDA 4PDWC 3E1F1 4QQPA 3O1VA 1RMU1 2JDNA 1WMDA 3VKLA 1QXPA 2VZVA 3RMYA 1LGCA 1W3XA 3I97A 1XXNA 1RC6A 1PHMA 2PHDA 4FFFA 2SLIA 5EJZB 3VKOA 3VBHA 5ACA1 1G7YA 3RNSA 1OPOA 5EYXA 5FAXA 1IKPA 4MGTA 1OUXA 1SCRA 4A45A 2GC3A 2P3YA 4UW5A 1Y3TA 4B8EA 2ZEZA 4FXKB 1SHWB 1VBC3 2ETEA 3S7EA 5K0UC 2EXIA 4OHYA 4LO8A 4CU6A 3OEAA 1AXYA 1W2OA 3EYPA 1ULFA 2PN5A 4W8JA 4ZPIA 3WW3A 1RUE3 3LSEA 1PM7A 3WOGA 1W6PA 4R4XA 1CIWA 4KNCA 1FOD1 1P8JA 5I0UA 3SISA 3GNEA 2HYKA 3ZYRA 4ET7A 4OLLA 4LXLA 1QOTA 4AYUA 2V5DA 1E5HA 1KDKA 1WBLA 3APBA 3M2MA 4K8FA 3AC0A 3S0MA 2WUHA 1V6NA 2E26A 5EQUA 3DKQA 3USSA 3BGAA 4GH4C 3CHXA 2BVBA 4P02B 5FXWA 1UL9A 2QQUA 2RS11 1KRIA 4YZ3A 2A6YA 3MUZ1 1WCUA 2JD9A 2NPIA 3QBQA 4Q1RA 4D6QA 1CWPA 2AYHA 2QQKA 1RUH3 4JTOA 1CAWA 2VMIA 1PX4A 4AI2A 3BU7A 1ZZ8A 4O61A 1LOGA 1R082 2XVKA 2EXKA 1PMHX 2DDUA 3SLIA 4LEJA 4CCMA 2BTVC 2JENA 2W46A 1H2KA 2HWC3 1RUF2 3B94A 3GDBA 4J25A 4XFCA 1NCRB 4TXWA 5BNPB 2ZGKA 1W6OA 5FMCA 1XYOA
chains in the Genus database with same CATH topology
1WLCA 2A6XA 1I9RA 2RJKA 4XOGA 3KT7A 4E4SA 2A3XA 2QFEA 4E27A 2VH9A 3VHPA 3AZWA 3JD71 5E1RA 3WR0A 1TNFA 3IDEA 4NWVA 5BXXA 1LULA 1LCLA 2Z69A 3VBFA 5T3NA 3MZHA 1G9BA 2PHRA 2Q1MA 4DQAA 1IGOA 2VW0A 1C3HA 1ENXA 1QNYA 4HMZA 3NAPC 1TEIA 2ZGPA 3QCWA 4LNVA 4DY3A 4N7UA 1NXD1 1OQEA 2QE3A 4LA3A 1S0DA 1Q3EA 1VBD3 5CB7A 1W0OA 2JG8C 1ZBE3 3AKQA 2P34A 4WVZA 3ZIWA 3N7MA 1ZBA1 1Z78A 2PAKA 3FBYA 1WW5A 3FC0A 1CJDA 4AVCA 4Q4W3 4FPKA 4QX5A 1YJLA 3SXWA 1JHNA 1XYNA 3WDWA 2CAVA 2E7TA 1VRH1 5CFDA 5JSPA 3ZN6B 2AGSA 4MXWB 4H3WA 1QJX2 4XJWA 1C8NA 2SBAA 1G6NA 1CAUB 2BQPA 4RQPA 4OHZA 2OUJA 3N7JA 4OZXA 4PF5A 2H0BA 1MS5A 4NR1A 3AJZA 3OPZA 4N9IA 2BFUS 5EYYA 1UKRA 1I3HA 3WUCA 4XF1A 1F31A 5AVAA 4ZU4A 3RRDA 4EN6B 3WV6A 2RR11 2XKPA 2VVEA 1H2MA 2IXKA 2JE7A 3V56A 1BCXA 3HQXA 1DYPA 5F6KA 5IUQA 1PO22 3T1MA 1VBE1 4N53A 5FPXA 5H9RA 1RGSA 2BWAA 4RS5B 2EAKA 2C5DA 3RZZA 1HXS1 4LHNA 1RUG1 2B5HA 2AREA 2AR6A 1CAVA 1V6OA 4D69A 5BNNC 1HLCA 2DTWA 4EN7B 4RFT0 1ZZ7A 3R4DB 2HWF3 4MVTA 2JXAA 3QACA 4Y1YA 1EPZA 4Q4Y2 1V6KA 2HKXA 3U11A 4D3WA 3ZIXA 1UIKA 1RUI1 2AENA 3VBOC 3H0OA 4NO4A 4CEYA 1AR81 3WG2A 1IHMA 2R0FA 4HFSA 4P5HA 5HBAA 1H1IA 2FBEA 5FPZA 2XG3A 1O4YA 2A6WA 2QJVA 4L8QA 2VULA 4AFDA 2PLV3 4LBLA 2HEWF 1C5IA 4LBOA 4WM8B 3ZFFC 2GNTA 3MPPG 2RS52 1KJRA 2D3SA 4XPVA 3FLPA 1OFSA 1UU6A 1RUJ2 1GNHA 1KFUL 3HD8B 5JI7A 4IV3B 3GYDA 4KQ7A 5FTTC 3J26N 4OHWA 1D4VB 2XJSA 4XYXA 4D7SA 3ZO0B 3ZXKA 3O14A 3A0KA 3VHRA 4Y1XA 1S0CA 4M3CB 1GZ9A 3PJYA 5JOWA 2P37A 3ZXJA 1MQTB 5CNAA 1M4WA 1X8EA 2I74A 4GULA 3WINE 1KITA 4XILA 4PLNA 3SNMA 2VUJA 5CBLA 2EA7A 4FVVA 2O8QA 1AX1A 3URFA 1DQ0A 3TN93 4COYA 4L9BA 4XJ8A 4HSJA 4B4QA 1COV3 2R1BA 4Q4V3 1UAIA 4G3YC 4C90A 1AZDA 1GV9A 1VBA3 5L7OC 5JSRA 1DQ2A 4XF4A 5I91A 4FTBA 4U36A 3JUUA 1QY4A 2Q4SA 5DG1A 3FWEA 2V73A 3LA7A 1RUD2 1UU4A 1AXZA 2ZZJA 1VBB3 4JC1A 1YWKA 4K1YA 4Q26A 3S6PA 5BNPA 4JAAA 1MZ5A 4XQDA 1WMEA 4WM7C 4TZDA 1B35C 2HWB1 4YVWB 4JGYA 1MEC3 3SHRA 3SMHA 4COWA 4XMAA 4KG0A 4ZU7A 5FQ0B 2Q5TA 4ITCA 3IT8A 3H8UA 3AX4A 3TOJA 4EN0A 3CJIC 4LBJA 1REEA 1EYBA 3AM2A 2DWRA 3T1LA 2OZJA 1MZEA 4IV1B 2ZHKA 4HSLA 1YXWA 2VY0A 2ZACA 3GALA 1SLTA 5KXBA 3H7JA 3M3EA 3LKJA 3VKMA 1V9U1 1LU2A 4IEZA 1C28A 1DQ1A 5J7MA 3WW1A 5JMCA 2XJPA 3UV9A 1KS4A 3VBRA 3CLPA 2OUHA 3AMPA 3PNAA 4P9LA 4JRAA 1WW4A 2GC1A 3AFGA 1TME2 2GN3A 3LWCA 5GLUA 3FLTA 2C9AA 4P9WA 5JDBA 1HQLA 1DGRN 4GKXA 2Z5WA 3AB0A 3S30A 5LK5A 1W2UA 3ZN6A 1CAXB 1BEV1 2IXLA 1QJY3 1CESA 1N3QA 3ZFEC 2R30A 3VBFC 3SH4A 1JH5A 1J3RA 1YUDA 5A33A 3VHOA 4Q4X2 4IXLA 2XPJA 1RUF3 1X50A 1ULGA 4P9IA 3H1YA 4AE2A 1Q56A 4DNYA 4H14A 4GB31 4EN9B 2Q1ZB 1Q8SA 4XF9A 1JW6A 4UW4A 3H3UA 5K8SA 4K1ZA 3MW3A 4RHV2 2WFPA 4OI2A 2R062 3DF0A 3A4UA 5FLIA 2OZ6A 4XFHA 1CN1A 4Y1UA 2BVVA 2YZ4A 2DCJA 3WHUA 5CADA 2VUAA 4B7EA 5C9AB 1D4M2 2ZBJA 4UW3A 3TBDA 1BK1A 1QJU1 5C33A 4QM8A 1EAH2 1PVC1 2QUOA 2PTMA 3KT1A 2QKDA 4RQPC 3AP5A 3ZVXA 1RUC3 1LTEA 1LOAA 1FV3A 4LTAA 2ZGRA 3AZVA 5BY5A 3PJQA 4BYYA 1BMV1 1DQ4A 3E6CC 3VDDB 2A6ZA 1KS5A 3KCCA 4XF3A 4YYOA 4OI4A 1H8TB 2YUEA 4N53C 4YFZA 3O7OA 1W6QB 3P3NA 1VP6A 3M8LA 4XFBA 4I0AA 4GWMA 4MX3A 5JZGC 4KBBA 1PK6B 3MIEA 1I6XA 2RMU1 4XBQA 4AVAA 2A5ZA 1V00A 2IXHA 2QZ3A 4EROA 3EO6A 3NV4A 4CEYC 1AR93 4XXPA 3BCWA 2YDEA 4JTNA 5A3LA 1A8MA 2R041 4YRDA 1PO23 2E7AA 4FSJA 1URXA 4AHYA 1AYN1 1QQP3 3MIGA 1FT9A 2GNMA 2JICA 1ZRDA 4AXOA 1WCDJ 1SLBA 3INAA 4PDWA 5GM0A 3O0VA 5AVPA 2BWCA 3OGJA 3ALQA 3EXUA 1NLSA 3H1MA 2HWD2 1BYHA 4MZUA 3R4SA 4XQ4A 5T54A 2ZMKA 1POV1 4LE3A 4XJZA 3WVJA 2XL7A 1MVQA 2AZ5A 2JE9A 5H9PA 4AGRA 5K0UA 4BQ1A 1O7FA 1RL3A 2D40A 1HQNA 1C8M1 4CDWB 4AGVA 4L2NA 3H3ZA 4L97A 4L92A 3B69A 1R1A1 4GXLA 3BODA 1OPMA 1QMJA 1PIV2 1Z7S2 4YVWA 3EQEA 2RS53 2VW1A 2YY1A 3BTAA 4FOYA 5KXEA 4FOQA 1TMF2 4E2QA 3NWKA 1RHI2 2ZAAA 1H4GA 5JOXA 2B8MA 5FCCA 2D44A 3QOPA 1EV13 4YZ2A 1ZZBA 1JN2P 4JGZB 4E4ZA 2GU9A 2WZR2 1R1ZA 1AYM1 1UIJA 3ILRA 4HK8A 1RMU2 4Y22A 2DV9A 4LO5B 2XVGA 1JYCA 2EALA 1FPN3 2DCZA 3GBGA 4GQ7A 2DCKA 1V6JA 2AUYA 1W6MB 3MEPA 5T5JA 4EN8B 2GNDA 2XBO1 4LULA 4QQLA 1NCRC 1XE8A 5BNPC 2DUPA 1K5MB 2GN7A 1AR72 4AQSA 1WUVA 4XFIA 1A6CA 2PHWA 2BUKA 3D4KA 4LBNA 5L73A 3ZXLA 5GKAC 1OA4A 1W0PA 2LALA 5E16A 3T2TA 2D6LX 1FOD2 3QD6A 1BBT1 1VAMA 2DVDA 1FMD1 1RUD3 3FJSA 1HV1A 4CDQB 5GZDA 1VALA 3IN9A 1XU1A 1HRV3 4RA0A 1S0BA 4ZXKA 4RR3B 1XU2A 5I0TA 4AEDB 2RS12 3VZLA 1QHDA 4OULA 4M3CE 2UWAA 3RJ2X 1DZRA 2YGMA 3RI8A 4YZ5A 4HN1A 1O4ZA 4AVSA 3W9AA 4SBVA 1QKQA 2XJTA 3BOWA 1FNZA 2NYYA 3HWJA 2PAMA 3PTYA 2TEPA 2DF7A 5J98B 5T55A 1H9WA 1VR3A 1KFXL 3M3IA 4PIYA 4KL1A 5JCTA 1NZCA 4IERA 3KB5A 1YFXA 5C8CB 3OF1A 4QQOA 3JD72 1O3SA 3AYCA 1BZWA 2I45A 1JXNA 1PO13 1NQJA 2D97A 5DDJ2 4RGAA 2GC0A 2WFF3 4QPGB 3NSTA 1WD4A 1H8TA 4GMP3 4ISRA 1W6QA 4Y24A 4RS5C 2VOKA 3M3OA 4N43B 4BHPA 3OCPA 3WXPA 3RPQA 3O5SA 4OHVA 5IK7A 2ZGQA 3L2HA 3H1WA 3L9JT 1XNDA 4Q4X3 2HWE3 1Q8VA 4R4ZA 3USUA 1ZBA2 2A73B 4ASMB 2VNOA 4HKOA 5J09A 3AMQA 3UKNA 3EBRA 4YFWA 4YM3A 1GR3A 1VRH2 5A3MA 4H55A 4FP3A 4YW1A 4DMIA 4EV0A 2XH6A 5BYNA 2DU0A 2EF6A 2ZGLA 4ASLA 4IETA 5I93A 3MPBA 4XHXA 5EJ3A 5AFEA 5I8TA 4WM8C 4QPIB 4IESA 1RJ7A 4XMIA 3FHIB 4D7TA 2ZGOA 4X6QB 1AL23 2YC0A 1VBC1 3L2YA 4UBHA 3ZFFA 4XJUA 4XFFA 3ZXGA 2RR12 3ZSMA 4IV3C 4P9JA 4D94A 4Y1VA 4FCAA 1H4HA 2LUWA 2WNVB 1VBE2 1X82A 5JLVA 5JPNB 2ZTNA 1Z0HA 4MH0E 4QM9A 4K21A 3RYKA 4KU8A 1HXS2 1RUG2 4D7YA 5FBZA 2R072 2XWJB 3ES1A 5E8AA 4Y1ZA 3ZXAC 5AC91 2CGNA 3OD0A 4XETA 2VVFA 5D1IA 1RHI1 4C0BA 4HVQA 3J8F1 4HETA 1MQTC 4PLMA 1RUOA 2NM1A 4O9EA 2HJIA 3BB6A 1QXRA 3MI8A 1UKGA 4X8PA 4QQ2A 1ZZ6A 1RUI2 1SLCA 2MHFA 3ETQA 1S0GA 1RUH1 3KT4A 1GLHA 4QXKA 4FPYA 4AI0A 1AR82 5A32A 5I8YA 1X8MA 2WINB 5J3UA 1ALYA 2JKBA 4JGZA 3WG3A 3VBSB 4FPFA 4TWTA 2NMNA 2WSVA 4WZCA 1AR63 2JEMA 4FAHA 3IPVA 1NCQB 1UPSA 3WQ0A 1JTZX 1QWRA 1R091 4K9SA 5L7OA 4R9CA 3OJBA 2VVDA 1AR71 3MGUA 4XJ9A 2G4IA 4KU7A 3HMYA 3TNPB 1QOOA 1MS1A 4P9YA 3TRSB 4YVWC 1ASJ1 3CJXA 4WM7A 3B7MA 4NVPA 2MEV3 1B35A 1RVF3 2RM23 3OGGA 5JOYA 1RITA 4OUSA 1GQHA 2ZPXA 2O0OA 4IV1C 4AQ6A 3MYXA 3CJIA 3DPRB 4RL7A 4M0NA 2WNUB 3NJZA 4CDQA 4AHXA 4QHBA 1ZBE1 2B45X 3LGRA 1PIV3 1Z7S3 4AHWA 1ZVFA 1YNAA 1H9PA 4FP2A 4Q4W1 1WBFA 4LBQB 3RYPA 5KHHA 1J1TA 1HIXA 1C4RA 4I3GA 1H0BA 5J48A 1OD5A 4GALA 1NY71 5HXVA 2OYZA 2EAAA 1WGPA 1ZYBA 1RMU3 1O3RA 1JYIA 4B4PA 2HWB2 1VB4A 2W0XA 4COUA 5CVRA 1FV2A 3EHKA 5ACA3 4XQWA 3ZFEA 4A7KA 3GBFA 4HVRA 5DDJ1 5GLWA 1MS9A 1S1AA 2QQPA 2C0ZA 4W65A 3GZAA 4QPGA 5F6LB 2IXCA 3V64A 1Q8QA 3VZJA 4Q0UA 1WLTA 2VMGA 4DOUA 1REDA 2HWF1 4AEKA 5E89A 4V1PA 1DFQA 1V9U2 2OVUA 2VU9A 1FOD3 5C9AC 4LLOA 1QH6A 5K9YA 5KBFA 1O3TA 4R9BA 2WJSA 5JWPA 2CWMA 1LB2A 4L11A 3PVBB 3ES4A 3POYA 5FLJA 1V6IA 4BA6A 2UY9A 4YG6A 2ES3A 3WDVA 2WC2A 1SBDA 4MUVA 4Z8BA 3U0ZA 3AKPA 5L19A 5KXDA 4IEWA 2IC1A 3KGZA 3VN4A 4K20A 1X36A 1BEV2 3WP3A 5IK8A 3AMNA 1ENRA 4DPNA 5BNOB 3AZZA 1YFWA 4CEWB 1SDWA 3VDDC 3D5OA 2ZX2A 1CVNA 1JUIA 1H8TC 1WA4A 3VKNA 4M3CF 1VB2A 4GB32 1D0GA 4JDOA 5JPMB 3N3HA 4C1WA 3N4MA 1PK6C 1YO8A 2R071 3ILFA 2ARBA 4AI1A 1H30A 2WNVA 3JD73 4XE9A 1BKZA 5JZGA 3MFCA 4AFAA 3PLQA 1EY2A 4YARA 3IKWA 2GMPA 5BPXA 1WMFA 4WVMB 1CPMA 1QJU2 5DZGA 5EXOA 4JV4A 4P9GA 3OY8A 2ZGTA 3DL3A 1JOJA 1PVC2 1CQ9A 4X8NA 1H1MA 2EXHA 1LGBA 4Y20B 5IK4A 1PNGA 3E5XA 1OMIA 1AF9A 1COV1 4ATFA 1RINA 3V0BB 1G86A 1Q8PA 3VBUB 5FLHA 1KQRA 3N35A 3VBSA 1F9KA 4ZKTB 3RQ0A 1HRI3 4DXZA 4UW6A 5C4WB 1BMV2 1VBB1 1OA3A 2K0GA 3D8CA 2A6VA 2P17A 4IEYA 4LBKA 2A3YA 2H0VA 3OD4A 4CDWC 3AP6A 3OBRA 3AP7A 5BV6A 2RMU2 1FI2A 1SCSA 4C1XA 5D8AB 1GZCA 3QH7A 3R0RA 2WQ4A 4GIQA 5HCAA 2GAUA 2A3WA 3FLRA 4I30A 4S2HA 1UU5A 1W6NB 2A70A 4JQRA 4JGZC 2R042 2ZS6B 3U07A 2UYAA 2ZJCA 1AYN2 2D93A 3KZ4C 1DZQA 5GLZA 2D6PA 3AJYA 1VAVA 5CA6A 3I8TA 4Q0SA 3MICA 1QDCA 2CNAA 1VJ2A 1K5MC 4W6YA 4J1WA 3AMHA 4DY5A 1NCRA 4IEUA 1AR83 4YLZA 4MSVA 1I5ZA 4HN0A 4KWLA 3RG0A 5KHJA 1QJY1 1JBCA 1C8M2 3ZPYA 2XKOA 5KWRA 1QOSA 1R1A2 1XE7A 2XL9A 4B4RA 1F5JA 4FPJA 4PLOA 4R9AA 4URTA 4CDQC 3UKTA 1DU3D 4RR3C 2JECA 3WDTA 4AEDC 2CGOA 3AZXA 1DGLA 4XTMA 1GICA 2D6OX 1LRHA 1XQNA 1DGRA 4FOWA 2VXRA 3BIWE 4HBNA 1AYM2 3NW4A 1OA2A 2E53A 1AJOA 1C1LA 4BMBA 4I01A 2FZ2A 5J36A 1HX6A 1MS4A 3TAYA 4AEJA 1RUC1 2QNKA 2XBO2 4Z07A 4AI3A 5DZFA 1W39A 5FOBB 3AXDA 2BGCA 3VZKA 2UURA 3FFZA 4CP2A 2B9UA 4MXWA 4X6RB 1WCSA 1CAUA 1R083 2BYVE 2DVAA 4WVWA 1EPWA 5C8CC 4M01A 2WSUA 5JAXA 2BNMA 3D0SA 1DBNA 1APNA 5BNOA 4HANA 4XTPA 1BBT2 3IDCB 2D5HA 1RJ8A 4QPGC 1FMD2 3AKSA 2E7QA 3VZNA 1QU0A 2GH2A 2R0HA 4N43C 1LECA 2DURA 2PFWA 4HVOA 1X7NA 2BW8A 4LUKA 1RIRA 3U4XA 3DV8A 4RS5A 3P3PA 4HK9A 3VV1A 3BALA 1CR7A 3H50A 4YM2A 2RS31 5B2GB 4BLIA 1AR91 1PNFA 4BIOA 1OLQA 1U5XA 4YG0A 2O1QA 5IK5A 1ZRCA 3RI9A 1DYKA 2UWCA 4KWJA 1IS6A 1QQP1 2GC2A 3WG1A 2RHPA 3AZYA 1KJLA 4N7IA 3FX3A 4PBPA 1MACA 4IQPA 2KM2A 1N3PA 1PGSA 1V9U3 1PMIA 1H2NA 2ZHNA 4LE4A 3SCFA 4QPIC 2WZPP 3ENRA 4HLTA 2YV8A 5GALA 1NQDA 1LHNA 2IFWA 4WM8A 4R9DA 4AG4A 4XBNA 1HW5A 1QJZA 3M70A 2WS91 4LHLA 1QJX3 5GJ6A 5SV5A 5C4WA 3TWIA 2GDFA 1OOPB 5TSWA 4I09A 2WNVC 4IV3A 4AFBA 1BEV3 4HKLA 1KD7A 3QH6A 1YIFA 4JDMA 4RSUA 5HI0A 1SEFA 4M3CA 2XJQA 3O0XA 1RUNA 1EV11 1ZM1A 4GB33 4XIKA 2XB6C 1MQTA 1UZYA 1MS3A 4TSVA 3GBWA 3IDBB 1O5UA 2EIGA 1DQ6A 3KS7A 3NKTA 3KM5A 3VBSC 1V70A 3WDXA 2VQ0A 3VZOA 3MIDA 1J1LA 2TUNA 3EJKA 4DINB 4AEMA 1NCQC 1AVBA 5GLVA 1GYKA 4Q4Y3 2YHJA 3Q9OA 4I3PA 3SH5A 3ZSJA 4GKYA 2ET1A 3WCRA 1QJU3 1VBC2 4A2UA 1SQ4A 3CL1A 1U0AA 1HDKA 3FBMA 4PJYA 1S0JA 3KD4A 1LHOA 1UW8A 2WIIB 2YPJA 3LCPA 4AHZA 4F7ZA 4LHKA 1LHWA 4QQHA 1KDMA 3AFKA 3CNAA 1QH7A 5JSOA 4K7JA 1NE6A 4F3JA 5F9TA 1DDLA 5FQ0A 3VL9A 5AC92 4LT5A 4MV2A 1RUJ3 5CAZA 5DUWA 4O9GA 3DPRC 3J8F2 3VGIA 4Y4YA 2GALA 4IV1A 2WNUC 1SBEA 1PGL1 1G9DA 1DLLA 4U2AA 1RUH2 1SBFA 3ELNA 1DHKB 4AVTA 2BEOA 3V0AB 2NN8A 4B3NA 4A7ZA 3E6BA 1UCXA 2X5IB 2D5FA 2W08A 1IKQA 1R092 5IT6A 2ZAHA 1S0EA 3JB8A 4MGYE 5T50A 3WZ1A 5CG8A 4FPEA 1AYN3 1YJKA 3VBHB 2ET7A 2CYFA 1CAXA 3N36A 1ASJ2 4PQ9A 2W52A 2WWSA 2HEVF 1AL0G 1PO11 2UWBA 1U12A 2WFF1 1TE1B 1PGW1 3AYDA 2ZCWA 4E4DX 2P3IA 3ECQA 1OI6A 2Q30A 4HT1T 1Q5OA 4KH9A 1ZREA 4ATEA 4Q0VA 2MNGA 2PELA 1DG6A 2NZ9A 2VOWA 1B09A 4BOWA 1C8M3 3M4FA 2HWE1 3DUIA 2FZ1A 1ZBE2 1R1A3 3IMNA 5CIRA 2XGXA 4MGKE 1SMVA 2GNBA 5C9AA 4Q4W2 2DCYA 1ZX5A 3GZUC 2OIIA 3PVNA 4YW4A 3B02A 2ILMA 1CAWB 4Q8KA 4OVEA 2ZZQA 1NY72 4YGDA 2XLAA 4OI0A 4META 3POSA 3WQ1A 2D7FA 4COZA 1AYM3 3ASIA 4IEQA 2AH2A 3VZMA 3M1HA 2ZHLA 4Q0PA 1S0IA 5BNOC 4CEWC 1AL21 5LEJA 1MZFA 1TME3 1W6OB 5KC5A 2G9FA 2XBO3 2JDZA 1O4TA 3VDDA 4IL7A 2B39A 3E6DA 2VPVA 4ONUA 2QDNA 2A7AA 5J37A 5C8WA 3WG4A 4DZGA 3JBG1 4I0WB 1F5FA 4BH9A 5GZFA 1PK6A 3WP4A 3B93A 4BWOA 4OHXA 2HWF2 2CY6A 4XFGA 1ONAA 3BPZA 3DGTA 4R8HA 3IBMA 4AI8A 1BBT3 3ROUA 3SCGA 4LR4A 3M3QA 4AVVA 3J9SA 1LR5A 1ENQA 3CO2A 4CDXB 4RHV3 1S0FA 2R063 3LA3A 4G9SB 3ZYJB 4YG3A 1YYNA 1AR61 3VBUC 5BUVA 1D4M3 2NMOA 3WNXA 4CP1A 3M7AA 4AF9A 5CFDB 1PZ9A 1EAH3 4MGIE 1A8DA 3NO8A 1LESA 5C4WC 4I2OA 5CFCB 4FTSA 2CWSA 4GA9A 1REFA 5I8SA 1RUE1 2CL2A 4Q2FA 1ULEA 2DTYA 4J6GA 2RJLA 4XDQA 2MEV1 4FPGA 4CDWA 2KA3A 1ULDA 2RM21 5D8AC 4QPYA 2ZGUA 4N9HA 3MW4A 4Q8LA 5HCFA 3MLJA 5I0SA 3W58A 2ZX1A 3LOIA 3B3QE 1N3OA 1YIPA 1X33A 4GMP0 1CAVB 1VAKA 3N7KA 1BQPA 1LGNA 3ZFGB 4NHMA 5T5LA 3LOBA 2ERFA 3TN92 2R1DA 3JU9A 4LO6B 2B42B 1COV2 1ND2B 4Q4V2 2GMMA 5DUUA 3X29B 1OFNA 2HWC1 2OW4A 4K3UA 4YGBA 4OI1A 1W6MA 1J59A 2PQQA 2Q0AA 2X5IA 4PCRA 1NE4A 3V65A 5LK7B 1RB8G 3HIFA 1VBB2 2XHKA 5FO7B 4TYSA 1NA1B 5T5OA 3ZYIB 3KSCA 3AMMA 4YVSB 1K5MA 2PHLA 2DFBA 3HBZA 1LOFA 1PZ8A 3K48A 5FDBA 5FO9B 1MEC2 4MXVA 1LKNA 3HAGA 3U10A 4FOVA 2HWD3 1SLLA 4E2GA 4EWAA 3MF9A 4COVA 3I4IA 5EFUA 3IWZA 2VOVA 5GZGA 2E9QA 1VBD1 1ZA4A 1XRUA 3SITA 1CX4A 4RR3A 1I1EA 3NV3A 4XW3A 1U5YA 4AEDA 4Z92B 2P3KA 1O5LA 3E5UA 4FT8A 1XNKA 3ZMOA 4YW2A 2JJ6A 4CP0A 1GFF2 1TMF3 1NYWA 4AQTA 4F8AA 1BVVA 1D2SA 1TQ5A 5AC93 1GNZA 1FXZA 2WT1A 4BMEA 2CGPA 1RHI3 1VIWB 3GHNA 4LBMA 3J8F3 2D6MA 1NG0A 2A75A 2ZX4A 3THPA 3O12A 5LEKA 2ZKLA 3ZSLA 1GSLA 1LEMA 2WZR3 1HKDA 3I54A 1QGLA 2WNEA 3POWA 3RMXA 4YSFA 3N7LA 2UU8A 4YNIA 1QJY2 2JG9B 3VKFC 4OUMA 1DIWA 1S2KA 2DUQA 2V09A 5C8CA 2BBVA 2VW2A 4BM8A 1R093 3GHMA 1LJ7A 5DUXA 2N7GA 1AR73 2EVXA 4JGYB 2RE9A 3FZ3A 3ZXEA 1N1VA 4JRLA 3WX5A 1LOCA 1OSGA 4MLOA 1ASJ3 2V5YA 4N43A 1V6MA 3FE5A 2D98A 3UK9A 3WW4A 3JQWA 5ABJB 3MLKA 1G9FA 3WHTA 1C5HA 1N1TA 1NLRA 5K7PA 3MIFA 2WT2A 3OBTA 2WLQA 1RUC2 5EWSA 2RS13 4L99A 3ZN4A 2DVGA 4CDXA 2PLV1 3VBRB 1LOBA 3LB9A 2XJUA 4XIOA 3ZMNA 3SCHA 1HRI1 1T6GC 2ZA9A 4LO4B 1FAYA 4BIFA 2ZGMA 4QPIA 4OFGA 4QMAA 2Z79A 1QXJA 4N90A 4QD2A 2R32A 5T5PA 4AFCA 1OOPC 3JZVA 4P9XA 5CFCA 3NV1A 1YLLA 3RDIA 5A33B 4NHKA 1AXKA 4ISQA 3ZSKA 3HT1A 3WY6A 4PIZA 2ZGSA 4EJRA 5LRRA 2XLGA 1O91A 5DG2A 1UX6A 5DDJ3 4IEPA 1ND3B 2GH8A 2RS32 4NWWA 1AR92 2CAUA 2WT0A 1AJKA 4Q0QA 1WLDA 4G4FA 4Q29A 3JB4C 2W68A 3TN91 2YYOA 5CU1A 5EZWA 3ST7A 1QQP2 3WDYA 1F8VA 4Q4V1 5FFOC 3ZFGA 1VBA1 3WD5A 2IWGB 3THTA 2W39A 4KG8A 1WD3A 2CTVA 1ZBA3 1F2NA 1SFYA 3R05A 1IPKA 1ND2A 1LODA 2B46X 1NCQA 4QGNA 2Y0IA 1VRH3 1ENSA 3D6EA 2WS92 2OPKA 4HZFA 1CJPA 2ZX0A 3IIAA 1MEC1 3MDPA 1FNYA 4I02A 1NA1A 1L3JA 4YVSA 4QGLA 1WW7A 5EV7A 1CONA 4A3XA 1SFNA 3ZXFA 4M0HA 3MIBA 5JIUA 3CU7A 4MGZE 2D6NA 3AYEA 2BPA2 4CDUB 3SH3A 2RR13