1D2QA

Crystal structure of human trail
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
161
structure length
134
Chain Sequence
b'RVAAHITGTRGNTLSKNEKALGRKINSWESSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRQMVQYIYKYTSYPDPILLMKSARNSCYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF-RELATED APOPTOSIS INDUCING LIGAND
publication title 2.8 A resolution crystal structure of human TRAIL, a cytokine with selective antitumor activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 17
structure length 134
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d2qA00
2AZ5A 3K48A 4G3YC 2WNUB 1C28A 5KWRA 4MXVA 1D0GA 1GR3A 4EN0A 1U5XA 2HEYF 1A8MA 1XU2A 4D7YA 1TNRA 1S55A 1PK6B 2Q1MA 3B9IA 1DG6A 4TSVA 2JG9B 4HT1T 1OSGA 3ME2A 2RE9A 4QPYA 5TSWA 4NN0A 1OQEA 3TWIA 2R6QA 3URFA 1I9RA 3ALQA 1O91A 2R32A 4KGQA 1RJ7A 2HEWF 1XU1A 1IQAA 4E4DX 3MI8A 2X29A 4E4SA 4OUMA 2WNVC 2JG8A 3QD6A 4QQ2A 4N90A 1RJ8A 2JG8B 2ZPXA 2KA3A 2HEVF 4QQOA 4GIQA 1JH5A 3FC0A 4RSUA 2WNUC 2R30A 2E7AA 2Z5WA 4MSVA 2Q8OA 4KG8A 4G4FA 3TYJA 3LKJA 2RJKA 1OQDA 1DU3D 4QQHA 2ZJCA 1ALYA 1JTZX 1C3HA 1PK6C 1U5YA 4MXWA 3B94A 5L36A 4MXWB 2OIIA 1U5ZA 2JG9C 1D4VB 2WNVA 4TWTA 2TNFA 2WNVB 1WCKA 3V56A 3WD5A 4QQPA 4F3JA 3IT8A 3QBQA 5CIRA 1KD7A 4OUSA 2QE3A 4DB5A 5BNQA 5KC5A 2RJLA 1PK6A 2JG8C 2QDNA 4OULA 4J6GA 5L19A 2JG9A 4DOUA 4QQLA 2TUNA 2O0OA 1TNFA 5HBAA 3AB0A 1D2QA 3K51A 3B93A 4KGGA 1KXGA 3L9JT 5KC6A 2WNUA
chains in the Genus database with same CATH superfamily
1AR93 4GD4A 3V0BB 5L7OA 2P3YA 5JCTA 2H6CA 4QKNA 2JDZA 1LEMA 1W6PB 1AUYA 2VCCA 1SLBA 4IV1B 5LY1A 4AI2A 4CDQA 2VPVA 3ILFA 3BPZA 2IXKA 1LKNA 3GF6A 4UFJA 1X50A 2OT7A 5C4WC 5JWPA 4OQ9A 3HBZA 4QAWA 5GZCA 3O1SA 1BYHA 2PN5A 3T30A 2DCJA 2LRPA 2XHNA 4ES8A 5IK4A 2DU1A 5DXDA 4KL1A 2XJQA 3LF7A 3ES1A 3RZJA 1ULPA 3MLLA 3OPZA 2VZPA 4A2UA 2EIDA 2MPFA 2FHRA 4FPHA 3BOPA 4C91A 3AZVA 4XCAA 1O4YA 3VKLA 3PVBB 2HWD2 4QPGC 4NPRA 3N4MA 1GZCA 1PMIA 4XF0A 1GLHA 4EWDA 1RUC1 4RFT0 2VVFA 1ZBA2 4BWOA 2VNRA 1KS5A 3ATGA 3KQ4B 1GV9A 4NIHA 4Q0QA 4QGLA 1HB3A 4DRRA 3AP9A 4L11A 3PTYA 4WZCA 3INAA 3POBA 4YGBA 4UF0B 2OUHA 1W0PA 2GNBA 1AYM2 1U5IA 4GXLA 3GHNA 3UETA 3RJRA 2X09A 1RUE3 1SZBA 1JU3A 3WY6A 1LODA 2ILMA 3ZLIA 3S0MA 1PMHX 4BHPA 5FZDA 2VZVA 1TG7A 4BJ0A 3W20A 5FYBA 2YROA 5K7PA 5CVRA 4CP0A 3CMGA 1FATA 3ECQA 2HKXA 1LOAA 3LOIA 3MDPA 3NV1A 3DECA 1UWWA 2G1MA 4O65A 3Q8EA 1ZX5A 3B94A 4A45A 2CYFA 2ID4A 2LROA 5IYYA 4Y1YA 5L36A 1DFQA 2J42A 5FV3A 2R49A 2VG9A 3AKTA 5EYXA 5A7PA 4C1WA 1D4VB 4CDUA 1QH7A 1GZWB 2FDKA 2CSGA 2R062 3IMMA 4D6QA 3C3VA 3KV5A 1CJPA 4AHZA 4NHXA 4CU9A 1QJU3 2GMEA 5F6KA 4RR3B 4R52A 1H2NA 2JKBA 2ERFA 3U10A 4QHOA 3P3PA 1MZ6A 4O61A 3IPVA 4P9XA 4BQYA 1A34A 4HMZA 4BIOA 3W21A 2RR13 1Y3TA 5K4LA 2W2IA 3R4UA 4YGEA 5LCWL 5DG2A 3OY8A 3VDAA 4DMIA 1GQGA 2WFF1 4FFHA 2BRTA 4KQ7A 4LULA 1ODMA 2GSYA 3ZFFC 3ZKYA 5CFDC 5J96B 1JZ2A 2JB4A 4HVOA 4MGIE 3A0NA 4A42A 1NUKA 2JG8C 5ANQA 1HX6A 2OQ7A 2QQIA 1S0CA 2NLRA 3H3LA 4M3CE 4HANA 4XFCA 3U37A 5CKNA 3TAYA 5JZGC 1W28A 1WW5A 2C24A 2WYSA 2CHHA 5FYMA 1VAKA 4LQRA 1XNBA 3N9NA 1KQRA 3TNPB 3C7GA 2XJVA 4O7XA 2WAOA 1JYWA 1V6MA 4MGZE 3OSDA 1I1EA 5EP9A 3C8XA 3AKRA 4L97A 4CCJA 3PVEA 4N53B 4FT8A 1UOBA 3I2DA 4RS5A 2I07B 3RYPA 3UGFA 3IZOA 4AHYA 2AZ5A 1UYZA 3K3NA 4LMFA 2BERA 3B3QE 3PNAA 3HT1A 3DYOA 1NCQC 2B7YA 3WNPA 3USUA 1BHGA 2HWD3 1MS8A 3H1YA 1LOEA 1W9WA 1RINA 1ZBA3 2VTXA 5JDBA 1O4ZA 1N1SA 1HW5A 2V72A 3MV01 5FREA 4IEWA 1KDMA 2YGLA 5JSRA 2QQMA 1DZTA 1H1AA 1K5MB 1RMU2 3I2GA 3N9OA 4QPYA 1QHDA 1OQEA 1XOYA 3PTRB 1QNWA 3WDVA 4EZ4A 3RMYA 3I8TA 2NP0A 1AYM3 1ZA7A 5LBCA 1BBT1 4ET7A 1VBE1 4E27A 3BTZA 1UL9A 4EE2A 3IIAA 3BCWA 2OXBA 4IL7A 5IVYA 2XJSA 1QXJA 4BQWA 1NE6A 1YNAA 2V5DA 1UMHA 4YVWB 4LIUA 3RZHA 3LDBA 3WX5A 1K3IA 3PJYA 4E4DX 2Y6JA 4OUMA 4LE3A 2HWB1 3D6EA 5IWFA 3MIDA 2ZXQA 1LB2A 3AYDA 2ZMNA 2DUOA 1CVNA 2XDVA 1WGPA 2R063 1GQHA 3FHQA 4A7YA 5C6CA 2W1SA 3BU7A 4AHXA 1OLQA 4QMAA 2WZ8A 2XBO1 2X5IB 2AC1A 2YZ4A 2VUAA 3FZ3A 3LZZA 3PJQA 4JDMA 4KWKA 1JTZX 3OF1A 2VZRA 4Q4Y1 3I3QA 2BW8A 1N47A 1OA2A 4QDSA 2E53A 1XXNA 1PK6C 2RS51 2YFUA 4Q29A 3PHMA 1L7LA 3TN92 1CZVA 1HDKA 1PGW1 4AEMA 4IEUA 1KS4A 4YARA 3O1VA 3F95A 4N9HA 4DRVA 2VMHA 5D2AA 2VUCA 3ZVXA 1GU3A 1B35A 2BV4A 4CXYA 3SEEA 1H30A 4P9LA 1EY2A 1EAH2 1WCKA 4IV3B 3WW1A 4ASLA 5IVVA 5IK5A 3HPNA 2GC1A 3HMYA 3IT8A 3MPPG 4GMP3 5FK7A 3B69A 2LM3A 5FPBA 4IESA 3P6BA 5IFTA 5T5PA 1OOPB 2DCKA 2R071 3CU7A 3NO8A 1GNHA 1POQA 3IDBB 4MGSA 1RUF2 5B4XA 1XNTA 1POV3 4L92A 2CU5A 2ZHKA 1YFXA 3ETQA 5JUVA 1MR5A 4MGTA 4GH4A 3RGBA 3FL7A 3VDDC 4UFHA 4DUVA 3AMNA 1V6JA 1YUDA 4S2FA 3I2IA 4WM7C 5F5CA 1PGL1 3OG2A 4QQLA 1BCXA 4BK4A 1EUTA 4JGYA 2Z79A 2Q8DA 4BH9A 5HXMA 1NE4A 4EQVA 1D2QA 5FY5A 3WQ1A 2E9QA 3B93A 4N7UA 4RD7A 3T2TA 1C4RA 3NAPC 3AZYA 3CLPA 4INDA 1RMU3 2FDGA 4E4ZA 4IEVA 4W6XA 3UGGA 1LOFA 2YY1A 2PXJA 4LBQB 4ZY9A 4K1ZA 2VQAA 4HN1A 1W6PA 2A3YA 5ERLA 4CE8A 1LAJA 4IV1A 4ZONA 4LBOA 1PM7A 5A3NA 5FZ3A 5BNNB 1C28A 2QQVA 2CV6A 3LOBA 4XJUA 3MUY1 3UV9A 1IG3A 3AM2A 3JQWA 3QOPA 4EN0A 4XCBA 1EV12 4UW5A 5D8AA 3ZX7A 1RVF3 2WLPA 4B4QA 3AP6A 2OUJA 2OVUA 4E2GA 1OXCA 3AMQA 4IGOA 2ZKLA 2VZSA 2Y8KA 4MUVA 1VBD2 2JDYA 1H2KA 1RXFA 1LECA 3AMPA 3ITQA 1SLLA 2D44A 2HJIA 2CWMA 4QU2A 1WA4A 4RFRB 1G9BA 1E5SA 2Q1ZB 4TYSA 3UK9A 2A6VA 5T5LA 3V64A 2XJTA 5H9QA 2YC0A 4FFFA 1W39A 1GWKA 2C5DA 3RRDA 1BVVA 3VBHB 3LEKA 4FPCA 2Y33A 1SHWB 4TXWA 3H1WA 5JXIA 1PX3A 4Q1PA 5IJRA 1JS9A 2XLGA 3Q9OA 1NOVA 1LHWA 3EYPA 4LJHA 3CJXA 5AVPA 4BDVB 1SDDB 3CQOA 3K4AA 5FUPA 2ZZJA 2Q1FA 2WR9A 2WZEA 2RS31 2P3JA 3KCXA 3PUHA 2PTMA 4QQOA 3THDA 1NY71 1VBA2 5C3RA 5J1XA 3GBGA 5FPZA 2O1QA 5JAXA 3MFCA 4M4RA 4XF3A 3JUUA 1S2BA 4MGYE 1EAH3 5JOZA 3AP5A 3ZFEB 4AFAA 3ZIXA 1US3A 2W47A 4FPYA 5FZKA 4C8DA 2D93A 3AKPA 1NLQA 1RUF3 4H14A 1HLCA 1U5YA 1ULCA 4L8QA 1V6LA 2AYHA 1QJX1 4AHWA 3POFA 4QPGB 1S0IA 1Z7S2 2NM1A 1UU6A 4GZ9A 4O9GA 1GZWA 1YLLA 1HN0A 3GGLA 4AR2A 1WBLA 4MLOA 2BNNA 4IEQA 4IUGA 4AVTA 4X8NA 4LK6A 1JYCA 4SLIA 4RR3A 3S5QA 3D82A 3OBRA 3WD5A 1RUJ2 1F5FA 5LZ6A 3NV3A 3IDCB 4FOYA 3VKOA 1O3RA 1Y7BA 3WINE 2VQTA 1TQ5A 3VD9A 4WVZA 2PLV2 4XMAA 1MACA 2C4XA 3GDBA 5JSOA 3RZGA 4RHV3 4Q4X2 4BXSV 1IPJA 3BALA 4EJRA 3S5AA 5FDBA 2QE3A 1OLMA 4L99A 1W06A 1XBFA 1Q56A 1ULFA 4AEKA 3HQXA 4AZZA 3MIFA 4GAZA 5FMOL 4YVSC 3KVAA 4CP1A 1EV13 2DVBA 4CA9A 4TLGA 3VZJA 4QXKA 2WAAA 4AYUA 1UZZA 1C8NA 4PBOA 5E89A 1YFYA 1VBD3 1O7FA 4FXGB 4YZ2A 1AL22 2OQ6A 4NAOA 1F4HA 1WW4A 2VW1A 3KMHA 4HFSA 2ZGLA 5T5JA 2O14A 3VKMA 1LOCA 5I0TA 2J1VA 3WOGA 5A3OA 1H9WA 5C3SA 4OI2A 2A6WA 1LHNA 3LSEA 2QQWA 4MHRA 2ARBA 3WV6A 2A6XA 4LPLA 1KDKA 5FOBB 5CFDB 3TNQA 1FYUA 3N9QA 3ZFGC 4ZZ5A 1X82A 5HCHA 2YC4A 1BVP1 3VHOA 3UNPA 1K5MA 5CNAA 3MZHA 3NNFA 1DG6A 1JMUB 2CGNA 1UO9A 4RA0A 5F37A 4YLZA 5FZFA 5HCFA 1GNZA 5IVCA 2MHFA 1U12A 3LWCA 4K9SA 2R6QA 4Q2FA 1VBA3 1GUIA 5I0UA 1O91A 4ZS3A 3IDAA 1OI6A 3SISA 4KGQA 1T6BX 5L9BA 2J1AA 4NRMA 4YVWA 1UU5A 3ZPOA 5FZLA 1QU0A 1W0OA 3POWA 2GAUA 1H1MA 4NMIA 1QH6A 2XKPA 2X29A 1WD4A 1NCQB 1SLTA 4DEVA 3ZM8A 4HOOA 4QXCA 1QQP1 1JHJA 2XLFA 3NL1A 4A7ZA 3WW4A 1HJFA 3H8UA 2D40A 5LA9A 5GZEA 1UZVA 4PI0A 2VBDA 2E63A 3WDXA 2WZR2 3MF9A 4NO4A 4Q8LA 1OHFA 4OYUA 3ZSLA 2X5IA 2J1UA 2WNUA 3ZO0B 5FMCA 3O1OA 2VE1A 4KG8A 3X29B 3A21A 2WBKA 1RUJ3 1SMVA 1OQDA 4QQHA 2Q8CA 5EIYB 2BJSA 2VZOA 4P5HA 1RUG2 2VMFA 3G6JB 3KLSA 4W50A 1A3KA 2PLV3 3C2UA 2OYZA 2VUDA 1FPN2 3VBUC 3PMEA 3U4XA 3LA3A 4P9WA 4XHBA 4KH9A 4Z92B 2BGOA 2OIIA 1QJY2 1U5ZA 4D8MA 2WUHA 3HIFA 1JYXA 1K45A 3NV2A 2W92A 4DO0A 4A6SA 1AR81 5KXBA 5IVBA 3CJIC 3U78A 4XAAA 4BQ5A 2HWE2 4IV3A 4YM0A 4PF5A 1MPXA 4U36A 5GZFA 4IEPA 1XPWA 1NKGA 1OOPA 1MQTC 1WBFA 2WWJA 2D3PA 1DHKB 2GC2A 4FCAA 1UXXX 3EHKA 1G9CA 2A71A 1AL23 2R0FA 4OUSA 3THPA 1OF3A 2BTVC 2VVDA 2OZ6A 1VMHA 2QJVA 2D6MA 2YV8A 5JIUA 3CZUA 1YQ8A 2HWC1 3CHXA 4Y5SA 3UL2A 5FP7A 5KC5A 1DZRA 4GWIA 4QX0A 2OW4A 5EYYA 1VB4A 2XXZA 3NNGA 3RWKX 3LA7A 1UKRA 3VN4A 3AL6A 4OFGA 4A6OA 2I74A 2O0OA 4CDUB 3K46A 4BCUA 5HBAA 4IEZA 1NXMA 4CEYC 3K51A 1HRI1 1SQ4A 1V00A 2BQPA 4HKLA 4KGGA 3VDBA 4QD2A 4LBQA 5DAXA 3ZSKA 2GNTA 2AEYA 1CPNA 3D0SA 3GJAA 3C7OA 5BNNA 4L9BA 3FUQA 2VM9A 3DPRB 2JDPA 1R092 4WM8C 3B9CA 4QPIB 2FCVA 2WT1A 2DYCA 1DDLA 4BLIA 5IATA 5J36A 1NQJA 3OY8B 1GR3A 1W9SA 2ET1A 2B4KA 2IXIA 2BNMA 4JX0A 2VMDA 5APAA 5FZ9A 2QUOA 2XLAA 4OUEA 4PI2A 4D7YA 1LGNA 3W5MA 1IOAA 4ZHNA 1YQ6A 4CDXC 2GH2A 3EO6A 5FZ7A 3WW3A 2C6SA 3M3QA 2CWSA 1GSLA 3BTAA 4AGVA 2FDFA 1PGSA 3MUZ1 4B7KA 4N7IA 4NOTA 2FDJA 1UQXA 2GMMA 2YYOA 4RQPB 3MW3A 5F39A 3VBHA 3GJBA 3RPQA 1H8TC 3NAPB 1COV1 4COVA 2GN7A 1H4HA 1AZDA 4NPMA 1CGPA 3KHCA 1UYPA 2VQ0A 3AZZA 1VRBA 4XDOA 2IC1A 1N3OA 1SEFA 2AACA 2C0ZA 1RUG3 3M4FA 4P14A 5HCAA 4QB6A 2DV9A 4QM8A 3VHPA 2CAUA 3FFZA 5LA1A 3DV8A 3RG0A 3H8OA 4DNYA 1OUSA 3VBOC 3H50A 1Q43A 4DINB 1ND3C 4XFBA 4DUWA 2HWE3 3AXEA 3O1RA 4CDWB 3VZLA 3B5LB 3ZFEA 4AQTA 3VD4A 1E5RA 2UY8A 1IGOA 2JDUA 3GALA 4EN6B 5FP8A 4A3XA 2ZJCA 4XC9A 2XJPA 2Y6HA 5KR7A 2QKDA 5ACA2 2QQKA 1M06G 2QCSB 1Z78A 4D7SA 4QPGA 4F83A 5EJZB 4FSJA 3C7HA 1X9PA 1RXGA 1O6UA 1I5ZA 2SLIA 3TEZA 1NZCA 2OX0A 2JG9C 2FD8A 1KITA 1L3JA 3FBYA 3OGJA 1QMJA 3WXPA 1VBE3 3VBFB 2VZ3A 4P9YA 5A70A 2J7MA 1XYPA 3VV1A 1YWKA 1RUH1 4B4RA 5F7UA 2EXHA 4HN0A 1PM4A 2XQXA 3HQUA 4H55A 4FPJA 1STMA 4CP9A 5FYZA 1H2MA 2G4IA 3J4UH 2UWCA 3DL3A 4XUPA 3BKZA 1N1TA 4RGGA 4XXPA 3PU8A 1KFUL 3A0KA 5CADA 1R093 3D0JA 4NHMA 4JQTA 1HB1A 2VW0A 3JZVA 1G9FA 3GM8A 3VDDB 3VZKA 3M3IA 1UKGA 3POYA 2PHFA 2HH9A 1UN1A 3AK0A 2XBO3 3J8F2 1BKZA 4HKOA 3WCRA 4AG4A 2GP5A 2UURA 1B35B 1XNKA 4Q4Y3 2CGOA 3O12A 2BWCA 2UWBA 3MIHA 1KXGA 2RM21 4JV4A 2RS53 4KWJA 4UFKA 1RUI2 1O3QA 1H8VA 4LK7A 1HRV2 3KF3A 1KGYA 2R7EB 4X8PA 4XQDA 1ULGA 4JRAA 3VD3A 1G9DA 2QQOA 2QFEA 2VQUA 5I93A 3SXWA 2RS12 5J48A 3OPTA 4HETA 1Y43B 1XSRA 3E5UA 3ZFFA 2PHDA 5CFDA 1GYKA 4BB3A 1N1YA 2QBXA 5F2WA 4B29A 4ATEA 5K9YA 5E6HA 1LGCA 3MGUA 5A33A 1WWYA 5LK5A 2H6BA 5FZ1A 3I7DA 2ARCA 4PJYA 4YVSB 3KZ4C 3E6CC 4XJ8A 3A4UA 4R9AA 4B1LA 5IHRA 1OVPA 2WN2A 4PIXA 2XQRA 1F35A 1PO11 2W68A 4OVEA 3EJKA 2XJUA 1PVC2 2JKXA 1K42A 2WNEA 4L2NA 1HQNA 3RFRA 1HKDA 1ZBE1 4JQRA 2BUKA 1U0AA 2QDRA 2X10A 4LORA 4UFLA 4I09A 4XDQA 5ACA3 1NCQA 4FPGA 5DUWA 5IK7A 1BK1A 4XXAA 4ZU5A 3T2PA 1J1TA 1S0DA 2WLQA 4XTMA 1OKOA 3HD8B 4AVAA 4W4ZA 2WNVC 5AC91 3IIIA 4FAHA 3OBAA 5FZCA 5D8AB 1T6GC 1VAMA 2ATFA 4Q8KA 3SH3A 4BPZA 5C8CC 2EVXA 4LBMA 4GWNA 3I3BA 4XFAA 3MV11 2KA3A 2O8QA 5FZ6A 1IS6A 3H0OA 2Q0AA 5A7WB 2YXSA 4ZU7A 1TME1 4KU7A 5FIXA 5FK8A 2BOJA 3PURA 4Z8BA 1NXD1 3VZMA 4G4FA 1UPSA 4N43C 1VB2A 5DG1A 3T1LA 1DU3D 1GANA 2FMDA 3KT7A 3POEA 3IBMA 4QKFA 2P6HA 4UW6A 1SLCA 1ONAA 4OHYA 2WKKA 1DYKA 4XTPA 1V0AA 2DUPA 4YZ1A 5AFEA 5LK7B 3ZN5A 2RV9A 1W2UA 4HVQA 2VGDA 1FNYA 5GALA 3KD4A 5JR2A 1EP0A 4YM1A 5GLZA 4CCOA 2JX9A 2E33A 4C1XA 3WUDA 5LA2A 4QQPA 3J8F3 3N7JA 5HI0A 4QHZA 3ZPYA 4Q27A 2RDQA 3WDTA 4URAA 5K0UB 3PUSA 4FAGA 1UXZA 3S6PA 1W2NA 2CL2A 3R4DB 3LA2A 1LULA 2YGMA 1GNYA 1RUI3 2YU1A 4JRLA 4GQ7A 3ZYFA 1HRV3 3UYJA 4XPVA 1HXS1 3NNJA 4PLNA 5FMDA 2EF6A 2P4EA 4HK9A 2ES3A 4MV2A 1PK6A 5J7MA 3VL8A 3ZYPA 4BMEA 5C9AC 1VBB2 2RS13 3PMSA 2WQZC 5F3CA 4HG6B 4MVTA 2XOMA 4DXTA 3VBRC 2C1FA 4NIIA 1JYNA 2I45A 3B02A 3O5SA 2E26A 2QQLA 4NRQA 4YW7A 2TBVA 2XJRA 5KHIA 3WW2A 4PDWB 1ASJ1 5FWEA 5F6LB 3CJIB 3K77A 4M0HA 1RC6A 2IXJA 4BA6A 1IG0A 3WQ0A 3ZOIA 4CXXA 2OZJA 4ORFA 3E1F1 3GCWA 2D6KA 2XL7A 4LKFA 5LEJA 3DPRA 2FZ2A 1PVC3 5JOWA 4QPIA 2WSUA 3U75A 5KXDA 3I3DA 4FPEA 4CYDA 5FY9A 3PIGA 4HLTA 4MOAA 5FZHA 2YFZA 2PHWA 2YMZA 4JGZC 2EXJA 1U5XA 1QOTA 2Q4SA 5JXHA 1R081 1BEV2 1X8MA 4MGKE 5DDJ1 2XPJA 4KBZA 2FZ1A 4WM7A 1BMV1 3QACA 1AX1A 1OSGA 4XDPA 1AR71 2JE8A 3ME2A 3OYWB 1M4WA 3TB0A 5FJHA 4AXOA 1OBNA 2ZX3A 1YQ5A 1AX0A 2DTWA 4RQPA 1W0NA 1TE1B 5FXVA 2P5BA 4XE9A 5CB7A 2D98A 3NAPA 4F8AA 4Y5Z0 3P1IA 2Y6FA 5LEKA 1GQPA 3MEPA 5FXXA 3LIGA 3E5QA 3PUIA 2HEWF 4I30A 4Y1UA 5CBLA 5J3UA 1JOJA 1VRH2 4PIZA 2VZ1A 5ABJC 2PHUA 2BGPA 4UT5A 5HV4A 1OKQA 5B2GB 2W08A 3ZXDA 1RGSA 4H3WA 2VECA 3JCIA 4LBJA 3WEZA 1HJGA 4QXHA 4Y1ZA 2RMU1 4CDWA 5C8WA 5FP3A 4CDXB 4Q0PA 4NWVA 2WNUC 1W2OA 2EIEA 5BY5A 1C8M1 2ZX4A 5L7OC 1VMFA 2UU8A 3VBSC 3G7DA 3LKJA 3JD72 2A1XA 2VBPA 1BK0A 4CDQC 3I97A 4R4ZA 3MLJA 4U2AA 4YNIA 2QQPA 1LOGA 5FZIA 1RVF2 3NVCA 2JD9A 2VZQA 4CSWA 4Z2AA 2Y6KA 2IFRA 2BDRA 4M0NA 1Q5OA 1YXWA 1JOPA 2Z4FA 1NLRA 2EAAA 4BOWA 1LR5A 3VBFA 1VBB3 5FPXA 4CPBA 1YC61 4MO3M 3KCCA 2WQ8A 3IKWA 1CAXB 2WNOA 1UZWA 5A7QA 3V56A 4Q4V2 4LLFA 4IE5A 3CBNA 4PBPA 4E4HA 1NX9A 1ZZ9A 5A3MA 4Y22A 1CQ9A 1MS0A 4RGKA 4ISRA 4Q1RA 2JJ6A 4N8MA 3DYPA 4CEWB 4FI9A 1REEA 3OPWA 4FTBA 3Q8AA 3JBG1 4XJZA 5A1FA 4RYDA 5FRAA 3VGIA 2LW8A 4BLJA 1GP6A 1NZIA 5FMOS 3VDDA 2RJLA 1QWRA 1UOJA 3WQBA 4XOGA 1UZ0A 1FV2A 1UY4A 4WV8A 1REDA 3KT1A 2A3XA 2YG0A 3WNXA 1BEV3 1OA3A 1VBC2 2VOXA 3CO2A 4LR4A 1C5HA 1UD1A 3AB0A 4COZA 4X6RB 4C90A 1CR7A 4YW2A 2ETEA 5LY2A 3RSJA 3WDWA 3WF2A 1CX1A 3JB8A 5HPOA 4HPKA 4ZZ8A 1SFYA 5KC6A 2EAKA 2ZTNA 3K3OA 4EROA 3RZKA 4GWJA 3GYDA 2ZOEB 2V09A 4HSLA 1QOSA 1QOOA 1RYYA 1W9FA 1ZNPA 2E7QA 2VOWA 2LALA 1ACCA 4FXKB 5LA0A 1ZYBA 1FMD1 5A32B 2AR6A 2QZ2A 3T1MA 4YGDA 2ZHNA 3FMGA 1VRH3 2ZAAA 3CIHA 2HWF1 4YVSA 1AR62 4FFIA 3VL9A 2PHLA 1GZ9A 4LA3A 3BUCA 1BJQA 4YSFA 1AYN1 2V4AA 2VMIA 1JHNA 4ZPIA 5FYCA 4NN0A 3WP5A 1F2NA 1PIV1 1ZZBA 4ASMB 1IS3A 2B9VA 4AEJA 2Y6LA 3WNOA 1TMF1 1W9YA 2KR2A 2PHTA 3N35A 4RHV2 1GZTA 4LOTA 3J9SA 4LO7A 3JD73 3ACIA 2BPA2 1R1ZA 2KXLA 3A23A 1DGWA 3F2ZA 4XF4A 2W9XA 3IB3A 1UIJA 3VLBB 1JYIA 5FZ8A 1AR91 1W8WA 4LBQD 1D0HA 3CZJA 3GBWA 3FLPA 1G8WA 5BXXA 5FWJA 3L2YA 5FZOA 4M3CF 1QJZA 4YRDA 5HV0A 3ZFGA 1MEC1 3KGLA 5A7WA 5JOYA 3EBRA 3T0DA 4X6QB 2G19A 1JZ6A 2IVJA 1XJAA 1EPWA 2DVGA 3OTFA 3RZMA 4RS5C 1WW7A 2JENA 4Z1VA 5C71A 1NA1C 4Q4V3 1WMFA 1RUD2 2EICA 1WMDA 2IZWA 5G05L 4LBLA 5BUVA 1OLME 3O1TA 1GWLA 4XFHA 4ITCA 5EHDA 3C7FA 4KBBA 4XUNA 5I0DA 3NJXA 1CAUB 4OCTA 1JODA 2ORZA 1YHFA 4LEJA 4Y4RA 1SCRA 1D4M2 1RHI2 2ZMLA 3FN9A 5FYHA 3J7MA 1JN2P 3MLKA 5BNPC 4TWTA 3AC0A 2WNVB 4HK8A 3H8XA 5C4WB 4JTNA 3WT3A 3UKNA 5T3NA 2NZ9A 3H3UA 1QGLA 1VBC3 3FWEA 4LKDA 2B46X 4M00A 5K0UA 5IT6A 1MS9A 1EPZA 1W2AX 2D6OX 3H42B 3D8CA 5J37A 2NQYA 2RHPA 1XRUA 2DCZA 4I0BA 4XMIA 4YGCA 1EUUA 1PO22 2W39A 3WCSA 2WL1A 4N43B 2VY0A 3NQHA 5C3QA 1RUE1 1WW6A 5F1RA 3RYRA 2VOKA 2Q30A 4BXFA 1XE0A 5GM0A 5JMOA 2UYAA 5LW9A 4DZGA 3ZYRA 4COUA 4IETA 3AMMA 2ZGTA 1ZBE2 2Y64A 3MIBA 1XE8A 3LEGA 1IQDC 1CD3G 1ENSA 5JPMB 3AZWA 3I2HA 1OLRA 3ACGA 4PDWA 3RS6A 1TNFA 1AR63 3CJIA 5EXOA 2C9AA 2PYTA 3OJBA 3WG4A 5SV5A 1WLTA 4JCKA 1W9TA 2QVSB 1SCSA 1W03A 1W8OA 4NHYA 5FZGA 5DAQA 1GP5A 1UMZA 3ZXGA 1QJU1 4BQ1A 2R041 3K48A 1X7NA 5FCCA 4CP9B 1W8UA 4QB1A 1WLWA 5KWRA 3WG3A 1MZEA 5FKBA 4GB31 1G7YA 5F5QA 2FDIA 4TN7A 5T54A 2HLEA 1JUIA 2RR11 5D1IA 1F8VA 2PAEA 4OZXA 2BP6A 3W59A 3WP3A 4FP3A 5C9AB 1ND2C 3RNSA 3WHUA 3OYWA 3VBRB 1QJFA 1K12A 2D3SA 5D21A 2XWJB 5TSWA 3ZKUA 3ILRA 5FY8A 1RUC2 4A4AA 1QDOA 3TWIA 4D94A 3SC7X 4EWEA 5JI9A 4W8JA 2DBNA 2JICA 1S2KA 3BVCA 2D5HA 3I3EA 3PUAA 3SQOA 3RWNA 3B7MA 4PQQA 1IZ3A 5FYTA 3S57A 3ORJA 2OPWA 1RJ7A 1RUD3 4GH4C 1SACA 2P17A 4XFIA 4WM8A 5FOJB 1CZSA 1XYNA 3HBKA 2E32A 4Y5TA 4Y1VA 1DZQA 3SNMA 4AI8A 4AVBA 4EV0A 4FFGA 4KI5M 4CU6A 2VNVA 1PVXA 3ZFFB 5KXEA 1QEXA 4JGZB 2XB6C 2A75A 3UJOA 4W6WA 1D4M3 1RHI3 2JG8B 3OUJA 2HWD1 4E8CA 5EZWA 5A33B 4LHNA 4AQSA 5JZGB 3SH5A 4CDXA 1H0BA 5KHJA 4Q4W2 4ZS2A 1DF0A 2GNDA 3FC0A 5A7SA 1LOFC 4PF1A 3ZR5A 1LNSA 4V2VA 2E7AA 1TVGA 1QXRA 5CYYA 5LBBA 2PQSA 3TBDA 4AVVA 4IV1C 4GWMA 5DAVA 3ZDSA 3B01A 5JPNB 2BFUL 2VOVA 3LEMA 4JAAA 4V1PA 5I91A 1H8TA 2AH2A 2P2KA 3MW4A 3RDIA 4BQ4A 1AYM1 4BYYA 1PO23 3HAGA 3WNNA 3PVNA 3AYAA 1WCQA 4IEXA 2R1BA 4Y4YA 1L7QA 2ZEZA 2AEZA 2W95A 1GBGA 4XETA 1HV0A 4HZFA 1W8FA 2XGXA 3WF4A 1E5HA 2MEV1 3MIEA 4LLOA 4NE9A 4Z07A 1CAXA 4AVCA 1FV3A 3D5OA 2OKXA 3VKNA 1ZBE3 2WFF2 4DS0A 5CFCC 3THCA 3CNAA 1OURA 2W87A 1KEXA 1GOHA 2WINB 1DIWA 3KV9A 2D43A 4M01A 5CIRA 4CXWA 4CEWA 2XL9A 3LDRA 4UFIA 1J3QA 5AVAA 4XEZA 1AHSA 5FKCA 2R061 1X33A 5IW0A 1J3RA 2PHXA 1WA6X 2P3IA 5IAVA 1LOBA 3HN3A 4J1WA 4EZHA 5BPXA 4WVWA 3BPSA 4W65A 1Q3EA 3QCWA 5DABA 5E1RA 1UIKA 3MIGA 3NJVA 3OOXA 1C5IA 5BYNA 4J6GA 3UGHA 4YZ5A 5EJ1B 1NLSA 3OB8A 3MICA 4FPLA 1P8JA 1A78A 2JG9A 3NNMA 1I5PA 4R8HA 2OPKA 4DOUA 4CVUA 1V9U1 1ST8A 4Q0SA 4XILA 1UW8A 2RVAA 3OGRA 3ZXJA 5IVEA 1FNZA 4BK5A 1WMEA 3OUIA 4TLFA 3NJZA 1RUC3 5FUNA 4Q0UA 2NMOA 4YFWA 5JXGA 2UY9A 1LU1A 5LBEA 4AE2A 5FZMA 2ZBJA 4GMP1 3S7EA 1NAEA 1DQ0A 5F9TA 4K8RB 2ZX2A 5C3OA 2VL4A 5A32A 5LBFA 1D0GA 3T0BA 4LBNA 2BOIA 3P3NA 5FY0A 4R9CA 1XU2A 2CNAA 1C8M2 3NMBA 1POV1 4K8FA 1BBT2 1PK6B 4RR3C 4R4XA 1VBE2 5I8SA 3ILNA 5IVFA 3KGZA 4XW3A 4CUBA 4O9EA 2K0GA 4BM8A 1UY3A 2F6BA 3DCQA 2JEMA 4URTA 4K1YA 2ZKNA 2GC3A 3T3YA 1DQ2A 3O0XA 1SBEA 5FP4A 4Q4W3 5A6QA 3AYCA 4MZUA 3KWVA 3VDCA 4AFMA 2HWB2 2LUWA 4CRQA 4Q4W1 1NQDA 1OH3A 2J22A 2BGCA 1LENA 1RMU1 2X8KA 3N36A 3WG2A 1Y9QA 1JZ7A 1YRZA 4NHKA 4YG3A 1I6XA 4BISA 3FHAA 1LU2A 3EXUA 5T52A 4PCRA 2XBO2 4YM2A 2PAMA 4W6YA 2W0XA 3LIHA 2EIGA 1X36A 2E51A 4N90A 4HKWA 5DUXA 5L9VA 4N53C 4Q4Y2 5FYIA 1VR3A 4Y1XA 2DVFA 1OD3A 2YHJA 4IXLA 4WVMB 5FPAA 3U0ZA 1ULEA 2RS52 4WM7B 3SCFA 1PHMA 5LB6A 4RSUA 2WFF3 3I49A 4YYOA 3O0WA 1DLLA 1PGW2 1ZVFA 5A6ZA 2WDBA 1ZM1A 4D69A 3VUOA 4NHLA 4K21A 3QLQA 2ZMKA 1FI2A 3DEMA 2JD4A 5F3IA 5A7OA 4PQ9A 4CUGA 3SHRA 1X8EA 2FCUA 4XUTA 3U1XA 4EWAA 4KG0A 5C33A 1RUOA 1CAUA 4GULA 3HVDA 4LOSA 5FJKA 2YBPA 3CDZB 4AFCA 2OA2A 3BB6A 3E97A 5LATA 3H7JA 2ZAHA 2WA3A 3OBTA 2R072 2VTXJ 1H4GA 2Z42A 1ZRRA 1OPMA 2WNVA 3POSA 2BZDA 3AX4A 3I4IA 5C4WA 3ZDVA 1VLNA 2DUQA 1MZFA 5C8CA 1W8ZA 1DGWX 1VMJA 1DYOA 1H1IA 3KM5A 1VIWB 3B00A 3DF0A 3MW2A 4I3PA 3TN91 4RL7A 3T09A 2D6LX 2WS91 5FBJA 1OUXA 1UYYA 3WNMA 4FOWA 5BV6A 4LKSA 1PGL2 2XVKA 3WZ1A 1W8HA 2W52A 2A73B 4N43A 2X05A 1NA1B 3ZXAC 3LE0A 1EAH1 2WO3A 4NR1A 2JDNA 4GJZA 4MX3A 2VZUA 3NSTA 4PHZA 1R1A1 1S0JA 3BU0A 1UNBA 3WSOA 5CZKA 2CTVA 2E6VA 1C8M3 1DQ6A 1O5LA 1RUF1 2ORXA 3OEBA 4QKBA 4UBGA 5JIAA 2TUNA 3ES4A 2N7GA 4G9SB 4NIGA 1OH4A 1BBT3 3LPGA 2EA7A 3GXUA 5BNPB 5KHGA 4QX3A 1J84A 1WLDA 4AAXA 3WDUA 5EFUA 1YFUA 4ONUA 4Y26A 1JBCA 1G6NA 5JI7A 3ZYJB 4Y22B 4CPBD 4MG2A 3ON7A 3ST7A 1OFSA 2GN3A 2Y38A 1VAVA 2HWB3 2GC0A 4S2GA 1IPSA 2B8MA 1MVQA 5AFBA 5GLVA 3LQCA 5IAXA 3ZXFA 2HEYF 1A8MA 2AREA 1AJOA 1AXYA 2RDSA 3OEAA 1NG0A 1QKQA 1O4TA 2ADDA 5C9AA 4JKLA 1JUHA 2DCTA 5A3PA 1JZ3A 2A70A 1J58A 2RJ2A 4MHUA 1JI6A 1AXKA 3VBRA 2KM2A 3FBMA 1F4AA 1GP4A 4M3CB 5GJ6A 5FZBA 2HYKA 3CKHA 1EV11 4IERA 3UJQA 3KSCA 1DGLA 4QGMA 2CAVA 5A3LA 4FTSA 3M3CA 4LO6B 3KV4A 5CA6A 1SBDA 4BU2A 4HPKB 1VBD1 5FZ0A 1LCLA 3WUCA 2RS32 3U11A 3MF6A 3ZXEA 1NY72 4QT6A 4WVVA 4DPNA 1WCSA 4UAPA 2WO2A 1IQAA 5GZDA 3MI8A 4JGZA 4DUXA 2VO5A 3LDKA 2JDKA 1UAIA 2JG8A 3AKSA 4MGQA 4IDZA 2YBSA 5JZGA 2ZPXA 2R073 4D6RA 1W6QB 1CAVA 2BWAA 1JW6A 2JECA 2MNGA 3VHRA 4LITA 3J7HA 3NKGA 1ND2B 3TEXA 5FPUA 1QJX2 4IQPA 3DGTA 2R30A 5FAXA 1UPIA 2EXIA 3NRUA 5F3GA 5FXZA 5GLTA 5BNNC 5FUIA 1OVSA 3APBA 3WF1A 3ZYIB 3AFGA 2HWF3 1VBA1 3GZAA 4XQWA 4LHKA 2ZHLA 1AYN3 2D6NA 1BZWA 4XYXA 3QH7A 4S2HA 4AFBA 1PIV3 1A6CA 5ABJA 5G04L 5HXVA 5FLIA 3O0VA 2ZS6B 4LT5A 4XACA 1NYWA 3M2MA 2EIBA 1W6NB 4GKXA 3V0AA 5FZOB 1BXHA 2ZX1A 4CU8A 2A3WA 5DZEA 1LHUA 2XMLA 3ZFGB 1S1AA 1Y9MA 3UKVA 1GICA 2X53S 1Z7S1 3OD0A 2ZABA 4JTOA 1AL0G 1CIYA 1Q8VA 1KD7A 3GBFA 4H2AA 5F2SA 5DUVA 4XUQA 4ZU4A 1WCUA 2B42B 3VBSA 2K9ZA 1HQLA 4B1MA 1XNCA 4FTEA 1UYXA 1H6YA 2EALA 5EJ3A 5H9SA 2LTNA 2NN8A 1MEC3 2Y60A 2YDEA 3POGA 3JU9A 3M1HA 4AI0A 4DY5A 1RUJ1 3HWJA 4CZSA 3FFQA 3A7QA 3S30A 4LO4B 4P9GA 4OLLA 2KD7A 4LXLA 3SH4A 4AK3A 5BNOC 5T55A 3TRSB 2PLV1 3VD7A 1ZREA 4NIAA 3IN9A 1E5IA 2BU9A 4Q4X1 2P34A 2VCAA 2SBAA 1S0GA 1CAWA 1US2A 3KVBA 3ZFEC 2W3JA 2YB7A 5K8SA 2A6YA 3IAPA 1OD5A 4QM9A 1W2TA 5CFCB 4MH0E 3RMXA 4FQ4A 2QNKA 2XKOA 4H7LA 2PQQA 4A44A 4UI9L 1YJLA 2VUJA 4OQ8A 1NCRC 4M4PA 4UOJA 3WG1A 1UOGA 2VNGA 1CPMA 1KJLA 4MXVA 1AL21 4QB2A 2RS33 5FFOC 2Y0OA 2HBTA 3E6BA 5SV8A 2OS2A 2F4PA 1JZ5A 1S0BA 3WVJA 3VBUB 4FQZA 4FBFA 3Q8FA 2Z69A 3I3MA 1YIFA 1O5UA 4AGRA 4TZDA 2ZZQA 3NW4A 4FPOB 4A7KA 2ZACA 3GZTB 5A3TA 2L9LA 4FPKA 2NYYA 5GZGA 4EN8B 5C5TA 3FX3A 1QJX3 1QQP2 2MEV2 1QXPA 3H7YA 4XUOA 1MZ5A 1MQTB 5E8AA 4BE3A 5EWSA 2RDRA 4QWNA 1DQ5A 3KF5A 1OF4A 1W8TA 2UYBA 4R9BA 3PVOA 3RZZA 1F31A 1V70A 4H7MA 2QQJA 2VOTA 5FR3A 4XFGA 1R64A 3VHNA 4HBNA 3QD6A 3UT0A 1S4CA 1OC1A 1WLCA 3WDYA 3MYXA 5B4NA 1MS1A 1RITA 3IMNA 2BBVA 4WVMA 3R0RA 5M0TA 2GALA 5F5AA 2R043 1HV1A 1H9PA 1VP6A 4GIQA 3RJ2X 1HQWA 5IUQA 3M3EA 2WJSA 5H9PA 1REFA 2Z5WA 2B45X 2XUMA 4GB33 4QX7A 4JDNA 4UW4A 1XSQA 1TEIA 4CEYB 1OQ1A 1GWMA 5A6XA 1V9U2 1JZ8A 1AR82 2JIGA 3LPFA 1UX7A 3POJA 2WZR1 3O1MA 2R1DA 1SPPB 3OGGA 1RTVA 1V6NA 3OGSA 5DZFA 4YWAA 1MS5A 4WM8B 2DF7A 1DYPA 1PZ7A 4MXWB 1XE7A 4PLMA 5KXCA 4D0QA 2JB8A 1FAYA 3PLQA 3M8LA 1YCIA 5KBFA 1RUG1 3CL1A 4P9JA 5FMBA 4BIFA 5FZ4A 3E6DA 1I3HA 3LCPA 1FPN1 2HWC2 2G9FA 4PIYA 1Z0HA 4I0AA 3RQ0A 2ZHMA 3LGRA 1QJY1 4OI1A 2WWUA 4C0HA 2ZGKA 4E2QA 1PZ9A 2GP3A 1NA1A 2WO1A 3VZNA 2DTYA 3POIA 3Q8CA 3OBZA 5FLHA 2HWE1 3P5BA 3SCHA 2XWBB 4XURA 5J98B 1L7RA 3T4HB 5FO8B 5LWBA 5ANNA 3SITA 4XIOA 1JXNA 4DB5A 1H8TB 1HIXA 1HRI2 1OA4A 2QDNA 4OMCA 2WQ4A 4XBLA 3N9LA 1W04A 5I0SA 2CGPA 2H0VA 3BTXA 2V73A 2ENRA 2DVDA 4QPWA 3KT4A 1CIWA 2QQNA 4XF9A 5BNPA 2WRAA 1AVBA 4HL0A 3R6SA 4IE4A 4OHWA 2IVIB 4OI0A 1IS5A 1OMIA 4AEDA 3VBOB 3L9JT 3GZEA 4K40A 3ENRA 3USSA 2P3KA 3K4DA 1S0FA 1ND3B 1SLIA 4DXRA 4XABA 4KWLA 2ZEYA 4NIDA 4K3UA 2AGSA 5CEHA 1QQP3 2MEV3 4DXZA 4IE7A 1T2XA 3ETPA 4FPFA 3AZXA 2DDUA 3PDQA 1FX5A 1W6OB 2ZGSA 3N7LA 1S55A 2GNMA 4JZRA 2RG4A 3ACFA 4XZUG 2XG3A 2IWGB 4QKDA 4WBBA 5JVVA 2Q1MA 5L9RA 3VD5A 3ZSJA 3BTYA 4LO8A 2Y6GA 3B9IA 3HOBA 1COV2 4B8EA 1WMXA 1R091 2XH6A 4M3CA 4ZXEA 3Q8BA 3W5NA 2DBIA 2ZGQA 4TSVA 4ISQA 3ELNA 1LRHA 2JG9B 3MBWA 4HT1T 2WT2A 3U07A 3HJRA 2RE9A 1YYNA 1FOD1 1LESA 2J1EA 3SLIA 2GDFA 1ODNA 4NAMA 3VB9A 1B09A 2W1UA 1F5JA 2WN3A 1O8SA 4EN9B 4HXCA 3C7EA 5FY1A 3ZMOA 1J83A 2ADEA 1UF2C 1AX2A 1WUVA 1V9U3 4XJWA 3ROUA 4COWA 1YFWA 1AR83 5C7GA 3CF6E 2WS92 5DUUA 4Z2WA 1Y4WA 5DAWA 1D7PM 1MVEA 4CDUC 4AWDA 1ZZ8A 2XVLA 3KS7A 5DPNA 4QQ2A 5I8TA 3AL5A 1W6QA 1ULDA 2BNOA 3FLRA 3ACHA 4Y20B 1ND2A 2ZGNA 5CKQA 2PMWB 2Y34A 4QX1A 1IKPA 1JH5A 1XQNA 3A22A 3EQEA 3LD8A 1O8PA 4I2OA 3DPRC 1R1A2 5FY4A 5T5OA 2D3RA 2W46A 2BFUS 4QPIC 4C0BA 1MS4A 2HWC3 2GZWA 1QDCA 3ACLA 4P9IA 4HVRA 3ZXKA 1C3HA 3BIWE 3R05A 5JLVA 3HN1A 3I2OA 1YI7A 2ZGUA 5A3UA 1J1LA 1CZTA 4WZFA 3BYWA 5L73A 1MS3A 1RUH2 1URXA 2E31A 4V2WA 3SKJE 4LIVA 2JE7A 1YI9A 2VXJA 1FT9A 1HRI3 1W6NA 2BBAA 2ZA9A 1ZRIA 4E9KA 3OD4A 4UW3A 2ARXA 2TNFA 2ZGRA 3ZN4A 5ACA1 2A7AA 2WZPP 4ARYA 4RQPC 5FO7B 3IWZA 3V0BA 2LS6A 5CG8A 1CWPA 4JKMA 4IEYA 2VH9A 3HNBM 5FYYA 3I2JA 3ZIWA 3AP7A 5JSPA 2PA7A 1J3PA 1BQPA 1JZ4A 4AI9A 5BNQA 4XVHA 4DEQA 1ZRCA 4AFDA 2RM22 4CU7A 4YZ4A 4D6SA 5FTTC 2VR4A 5L19A 4QDRA 4CCKA 1QNYA 1JOBA 2NMNA 4CDWC 5F8PA 3WLUA 4AF9A 4FVVA 3N9PA 4XQ4A 2EXKA 1COV3 2WABA 4YZ3A 5FBZA 5A80A 5CFCA 5C8CB 2HYXA 2R16A 1IHMA 3TEYA 2PHRA 4P02B 5I0RA 1W99A 4CUAA 3J8F1 1S0EA 3PL0A 1RIRA 2ZGMA 1ENQA 1RB8G 5AC93 1SLAA 3ZN6B 1PO12 1GOFA 1QIQA 3K4ZA 3AFKA 3VBFC 1LGBA 3TN93 2W91A 1RUI1 4NVPA 3VBUA 1W8NA 1WD3A 1HRV1 3DUIA 2WS93 1SFPA 1Q8OA 2WA4A 3FUOA 5FZAA 4UF0A 3RVHA 5IVJA 5BNOB 4UYBA 4Q0VA 3RI9A 2K46A 2RS11 2ET7A 3NV4A 2CDPA 4YW6A 5FLJA 4XIKA 2WFPA 3T2OA 2P1BA 4LO5B 3BI3A 1O59A 4DFSA 5AC92 3O1PA 1MQTA 5CKMA 4CP2A 5KHHA 1R1A3 3UESA 4BQXA 1UY0A 1X9TA 1YEWA 4E8DA 2ZGOA 1TZOA 2YPDA 3AVRA 4CCMA 5FQ0B 3J26N 4ZXKA 3KB5A 1NCRB 1TME2 3NJYA 3K75B 4I02A 1S2EA 4CCCA 1PVC1 4JHZA 1JU4A 1YO8A 2HBUA 4LNVA 4RGAA 4AOCA 1RUH3 4E4SA 1W90A 3GNEA 1FXZA 1B35C 3IM0A 3M3OA 1IKQA 1W05A 4EYUA 3HNMA 2W1QA 3WNKA 2WYFA 1W6MB 1UOFA 2HEVF 2C9KA 3N7MA 5C5UA 4IW3A 1GOGA 5FYSA 4LHSA 1GFF2 4CEYA 4MSVA 4XJAA 1RL3A 3FLTA 5CG9A 1ALYA 4XBQA 4NROA 5HCBA 2YU2A 2BYVE 1SPPA 1KRIA 4MXWA 5ISLA 1H6XA 2DFCA 4ATFA 1Q8PA 3GHMA 4TTGA 1OT5A 3HEIA 4XF1A 3GCXA 3M7AA 1LTEA 2RM23 3DKQA 4JGYC 3D4KA 4JDOA 5LRRA 1ZA4A 4AEDC 1ZRFA 2B39A 4LHLA 3NWKA 4OI4A 4AL9A 4N53A 4CCEA 1NT0A 1N1VA 3ZR6A 1HXS2 2BVBA 3CEWA 5I8YA 5KHKA 4YM3A 1CAVB 1ZBA1 4CTEA 2VCMA 1DCSA 2Z2SB 2J1RA 3V65A 2QTWB 2BVVA 3ZYGA 1XNDA 2VMCA 1SFNA 3FHIB 2AUYA 1Q8QA 1W3VA 5CISA 1F15A 1SDWA 2YBKA 1UCXA 2VW2A 5F3EA 1O3TA 1ASJ2 2J1TA 5D8AC 4YW3A 3DN7A 2YC2A 4OULA 4E2SA 1E57A 2H0BA 4IE6A 4BMBA 1CONA 1PO13 2VTFA 4R9DA 3T2QA 1UZYA 4KNCA 4OHVA 4HONA 1HN1A 3THTA 3VBOA 1DP0A 4JKKA 4XFFA 3WF3A 2A6ZA 2FQPA 4LTAA 3V0AB 2XHKA 4UBHA 1AJKA 1ND3A 1VBB1 3ZSMA 2XR4A 1ULOA 4LKEA 1R082 3I59B 2Y26A 1VJ2A 3H1MA 4OZOA 3PIJA 5DDJ2 2B9UA 3J7NA 1DQ4A 2D5FA 1YJKA 4IGQA 3LEIA 2WNUB 4NJ4A 2RDNA 3AP4A 3O14A 4META 4XAEA 1OFNA 3BGAA 2GH8A 3E5XA 1V6IA 4Y3OA 4MADA 5FPLA 4Y33A 2Y0IA 3VBSB 5L7OB 1BMV2 1ENXA 4UWDA 3U4SA 1AR72 3ZSEA 1W6OA 2AENA 2PELA 4CDQB 2DFBA 3BN6A 1TNRA 4YPJA 3ABZA 3AXDA 1TME3 5FYVA 1Z7S3 4DY3A 1APNA 2D6PA 5JMCA 3GZUC 5DN2A 3LFIA 2VU9A 4AQ2A 2E7TA 1CN1A 5K0UC 4N9IA 3ZMNA 3J7LA 3O7OA 3LAGA 4QX2A 5GKAC 1W3XA 4B3NA 4D7TA 4SBVA 4NPLA 5DAPA 1DLCA 1IS4A 3AJYA 3OUHA 2QZ3A 1CAWB 1BEV1 2QQUA 5FYUA 4AAPA 1PNFA 3ZYHA 4YG6A 4NUBA 4PLOA 3SEPA 3LSDA 3MFAA 4Q5OA 3W58A 1XU1A 2JWPA 3H9AA 3M70A 4HSJA 2RMU2 1Y9GA 4NRPA 2ZX0A 4Q4X3 4COYA 1QY4A 4EN7B 3VKFC 3JQXA 2P6CA 3NNLA 3LFMA 5DZGA 1LHVA 2F17A 3TEWA 4FP2A 5JOXA 4PDWC 4Y20A 3PUQA 4Z82A 2JDAA 3JB4C 1VALA 2IXCA 4GALA 1O3SA 3WP6A 2IXLA 2R0HA 5FY7A 3S7IA 2VMGA 1VRH1 5IK8A 3K2OA 1SG3A 3H8RA 4YW1A 2YUEA 1F9KA 2W5FA 2WSVA 3I54A 2VC9A 4QU1A 2Q8OA 1HXS3 1LEDA 3PU3A 5DQ0A 3RI8A 2VZTA 2DCYA 2RJKA 2F4LA 2XUEA 2IUWA 1DQ1A 4OMDA 5LRSA 3VZOA 1SBFA 4A41A 3KQRA 4UFMA 2W1WA 3LB9A 1VPHA 1C1FA 5F5IA 4LUKA 3N3HA 5FP9A 2V5YA 1PX4A 3D3AA 1J59A 3UKTA 5A1AA 1ASJ3 4YG0A 2JDMA 3JD71 5FPVA 4CCDA 3WP4A 3WNLA 3FE5A 4S2DA 4D3WA 4DXSA 2O8OA 3AVSA 1HB2A 3JBG2 3FJSA 2UWAA 4J25A 4P08A 1C57A 2Q8EA 4OHZA 1RVF1 1PMJX 3WQ7A 1BLZA 4MYEA 4YW4A 3WR0A 4F3JA 2JIJA 2ARAA 2WIIB 1Q8SA 2VCBA 4LA2A 2WO7A 4XZPA 4A3ZA 5A6YA 3IPVB 3EMRA 4XHXA 2JXAA 4YW5A 1R083 5DDJ3 5FZEA 1KJRA 4BZ4A 5EQUA 2DVAA 1UMIA 2WWSA 2JDHA 4FOQA 4Q4V1 1FOD2 4JHTA 3H3ZA 1GKBA 3I2FA 2K2SA 4DIQA 3WHTA 5E16A 2ZCWA 5A7NA 4AVSA 1AR73 4XBNA 4AQ6A 2B5HA 1K5MC 4QGNA 3N7KA 2A5ZA 1XB9A 2FMYA 5CU1A 2VVEA 1A8DA 5ABJB 1FMD2 2WZR3 1OPOA 3R4SA 4QX5A 4FO9A 3JXSA 1YIPA 3U14A 2Q5TA 2C26A 3KV6A 2HWF2 1ZZ6A 4G3YC 4LBKA 1VBC1 4RS5B 4GJYA 4YVWC 5FXWA 3T08A 3ZN6A 4ARXA 2FDHA 3EB7A 4JC1A 1WZXA 1AYN2 4I3GA 3WF0A 4P00B 1AF9A 1YQCA 3HQRA 1PIV2 3USUB 2V4VA 1FPN3 2RMU3 1WKYA 2BEOA 1LHOA 3AKQA 5EV7A 1TMF2 2IFWA 3IAQA 1QJY3 1ZZCA 2DU0A 5BNOA 4I0WB 3T0AA 4GMP0 4I01A 4KMQA 2FBEA 3IDEA 3RZLA 2G9GA 1JYVA 2DURA 4AI3A 5A3WA 3TOJA 2X5IC 4CEWC 1GMMA 4QXBA 3KCYA 3HNYM 1AR92 3URFA 1C1LA 1I9RA 1POV0 3NKTA 4UXAA 4B7EA 5GLUA 3ALQA 1EYBA 2TEPA 2R32A 2VULA 2XVGA 3L2HA 4AEDB 1AR61 4BQ3A 5DMYA 3BIEA 2NPIA 5T50A 5FQ0A 4AW7A 1H2LA 1MEC2 3I2KA 1N3PA 3SMHA 3ASIA 1NCRA 3AYEA 2ZEWA 1UU4A 1UX6A 4IEOA 3BOWA 2DWRA 1VE0A 4LE4A 3ZYBA 1DBNA 3BODA 1G86A 1ZZ7A 2VJXA 4K6BA 2VD7A 4RHV1 1W6MA 4IV3C 4K20A 1RJ8A 2VBBA 1CX4A 5C70A 1N3QA 4QHBA 4CCNA 2PAKA 1OOPC 1K5JA 1XNAA 4RN5A 3JBG3 1CJDA 4XJ9A 5EPAA 5FO9B 4DQAA 3MPBA 1KFXL 2D7FA 3KHBA 4AGGA 4K7JA 2I2SA 3TYJA 3AMHA 1PNGA 1WCDJ 1DGRA 2W94A 4NWWA 3MHZA 1QF3A 5E88A 4AI1A 5J09A 5C3PA 4YFZA 4KWUA 4LUMA 4BQ2A 4OHXA 3SCGA 1HB4A 4ASKA 5F32A 4L0PA 1JYTA 1FOD3 2CY6A 2GMPA 1RUD1 4P5YA 3HT2A 1UY1A 2WC2A 3RYKA 1AXZA 2JE9A 1RUNA 4FOVA 1V6OA 4GKYA 3W9AA 5GLWA 4B4PA 4GA9A 5IFPA 4Y24A 1RUE2 5CAZA 2YPJA 1CESA 4ES9A 3DKWA 2VMEA 3QBQA 2P37A 1ZRDA 4Q26A 4JVAA 3OGVA 4IE0A 2PFWA 1D4M1 1RHI1 2VNOA 1FMD3 3ZXLA 3T4VA 3SKVA 2XONA 2J1SA 1XC6A 1YQ2A 2D97A 4CUCA 1QJEA 4QX8A 1UY2A 3N9MA 4ZKTB 1G9AA 3DXTA 1PZ8A 2G9ZA 4GH4B 3O1UA 5JXJA 5LASA 2ZEXA 3OCPA 3DYMA 4QDQA 1IPKA 1QJU2 5A1LA 2R042 4CCLA 1PO21 3AJZA 4KU8A 2FCTA 3HR9A 1TMF3 4F7ZA 2WT0A 4JGYB 3QH6A 4IGPA 1XYOA 2ZGPA 1V6KA 4GB32 4J1XA 3I59A 2VAUA 5JR7B 2RR12 5H9RA 1LJ7A 2GU9A 3VBHC 2IXHA 1DGRN 3DXUA 1ENRA 3MO4A 4PT6A 2CDOA 2VXRA 1D2SA
chains in the Genus database with same CATH topology
1AR93 3V0BB 5L7OA 5JCTA 2H6CA 2JDZA 1LEMA 1W6PB 1AUYA 1SLBA 4IV1B 4AI2A 4CDQA 2VPVA 3ILFA 3BPZA 2IXKA 1LKNA 3GF6A 1X50A 5JWPA 5C4WC 5GZCA 3HBZA 1BYHA 2PN5A 2DCJA 4ES8A 5IK4A 2DU1A 5DXDA 4KL1A 2XJQA 3ES1A 3MLLA 3OPZA 4A2UA 2MPFA 2FHRA 4FPHA 3BOPA 4C91A 3AZVA 1O4YA 3VKLA 3PVBB 2HWD2 4QPGC 4NPRA 3N4MA 1GZCA 1PMIA 4XF0A 1GLHA 4EWDA 1RUC1 4RFT0 2VVFA 1ZBA2 4BWOA 2VNRA 1KS5A 3ATGA 1GV9A 4Q0QA 4QGLA 4DRRA 3AP9A 4L11A 3PTYA 4WZCA 3INAA 4YGBA 5FLIA 2OUHA 1W0PA 2GNBA 1AYM2 1U5IA 4GXLA 3GHNA 3RJRA 1RUE3 3WY6A 1LODA 2ILMA 3S0MA 4BHPA 2YROA 5K7PA 5CVRA 4CP0A 1FATA 3ECQA 2HKXA 1LOAA 3LOIA 3MDPA 3NV1A 4Q4W1 1ZX5A 3B94A 2CYFA 4Y1YA 5L36A 1DFQA 2R49A 2VG9A 3AKTA 5EYXA 4C1WA 1D4VB 4CDUA 1QH7A 1GZWB 2R062 3C3VA 1CJPA 4AHZA 1QJU3 2GMEA 5F6KA 4RR3B 4R52A 1H2NA 2JKBA 2ERFA 3U10A 3P3PA 1MZ6A 4P9XA 3IPVA 4HMZA 4BIOA 2RR13 1Y3TA 3R4UA 4YGEA 5DG2A 3OY8A 4DMIA 1GQGA 2WFF1 4KQ7A 4LULA 2GSYA 3ZFFC 5J96B 5CFDC 4HVOA 4MGIE 3A0NA 2JG8C 1HX6A 1S0CA 2NLRA 4M3CE 4HANA 4XFCA 5JZGC 3TAYA 1WW5A 1VAKA 1XNBA 1KQRA 3TNPB 2XJVA 1V6MA 4MGZE 1I1EA 3AKRA 4L97A 3PVEA 4N53B 4FT8A 3I2DA 4RS5A 2I07B 3RYPA 4AHYA 2AZ5A 3B3QE 3PNAA 3HT1A 1NCQC 2B7YA 3USUA 2HWD3 1MS8A 3H1YA 1LOEA 1RINA 1ZBA3 5JDBA 1O4ZA 1N1SA 1HW5A 5FREA 4IEWA 1KDMA 2YGLA 5JSRA 1DZTA 1H1AA 1K5MB 1RMU2 4QPYA 1QHDA 1OQEA 1QNWA 3WDVA 3RMYA 3I8TA 2NP0A 1AYM3 1BBT1 1VBE1 4E27A 1UL9A 3IIAA 3BCWA 4IL7A 2XJSA 1QXJA 1NE6A 1YNAA 4YVWB 3WX5A 3PJYA 4E4DX 4OUMA 4LE3A 2HWB1 3D6EA 3MIDA 1LB2A 3AYDA 2ZMNA 2DUOA 1CVNA 1WGPA 2R063 1GQHA 4A7YA 5C6CA 4AHXA 3BU7A 1OLQA 4QMAA 2XBO1 2X5IB 2YZ4A 2VUAA 3FZ3A 3LZZA 3PJQA 4JDMA 4KWKA 1JTZX 3OF1A 4Q4Y1 2BW8A 1N47A 1OA2A 2E53A 1XXNA 1PK6C 2RS51 4Q29A 3PHMA 3TN92 4YARA 1HDKA 1PGW1 4AEMA 4IEUA 1KS4A 4N9HA 4DRVA 2VMHA 3ZVXA 1B35A 1H30A 4P9LA 1EY2A 1EAH2 1WCKA 4IV3B 3WW1A 4ASLA 5IK5A 2GC1A 3HMYA 3IT8A 3MPPG 4GMP3 3B69A 2LM3A 4IESA 5T5PA 1OOPB 2DCKA 2R071 3CU7A 3NO8A 1GNHA 3IDBB 1RUF2 1POV3 4L92A 2ZHKA 1YFXA 3ETQA 1MR5A 4GH4A 3AMNA 1V6JA 1YUDA 4S2FA 1PGL1 4WM7C 4QQLA 1BCXA 4JGYA 2Z79A 4BH9A 1NE4A 1D2QA 3WQ1A 2E9QA 3B93A 4N7UA 4RD7A 3T2TA 1C4RA 3NAPC 3AZYA 3CLPA 4INDA 1RMU3 4E4ZA 4IEVA 4W6XA 1LOFA 2YY1A 4LBQB 4K1ZA 2VQAA 4HN1A 1W6PA 2A3YA 4IV1A 4LBOA 1PM7A 5BNNB 1C28A 3LOBA 2CV6A 4XJUA 3UV9A 3QOPA 3AM2A 3JQWA 4EN0A 1EV12 4UW5A 5D8AA 3ZX7A 1RVF3 2WLPA 4B4QA 3AP6A 2OUJA 2OVUA 4E2GA 3AMQA 2ZKLA 4MUVA 1VBD2 1H2KA 1LECA 3AMPA 1SLLA 2D44A 2HJIA 2CWMA 4QU2A 1WA4A 1G9BA 2Q1ZB 4TYSA 3UK9A 2A6VA 5T5LA 3V64A 2XJTA 5H9QA 2YC0A 1W39A 3VBHB 2C5DA 3RRDA 1BVVA 4FPCA 3H1WA 4Q1PA 2XLGA 3Q9OA 1NOVA 1LHWA 3CJXA 5AVPA 2ZZJA 2RS31 2P3JA 3KCXA 2PTMA 4QQOA 1NY71 1VBA2 3GBGA 5FPZA 2O1QA 5JAXA 3MFCA 4XF3A 3JUUA 1S2BA 2VXRA 4MGYE 1EAH3 5JOZA 3AP5A 3ZFEB 4AFAA 3ZIXA 4FPYA 2D93A 3AKPA 3VDDC 1RUF3 4H14A 1HLCA 1U5YA 1ULCA 4L8QA 1V6LA 2AYHA 1QJX1 4AHWA 4QPGB 1S0IA 1Z7S2 2NM1A 1UU6A 4O9GA 1GZWA 1YLLA 1WBLA 4MLOA 2BNNA 4IEQA 4AVTA 4X8NA 1JYCA 4SLIA 4RR3A 3D82A 3OBRA 3WD5A 1RUJ2 1F5FA 1O3RA 3NV3A 3IDCB 4FOYA 3VKOA 1Y7BA 3WINE 1TQ5A 4WVZA 2PLV2 4XMAA 1MACA 5JSOA 4RHV3 4Q4X2 1IPJA 3BALA 4EJRA 5FDBA 2QE3A 4L99A 1Q56A 1ULFA 4AEKA 3HQXA 3MIFA 5FMOL 4YVSC 4CP1A 1EV13 2DVBA 3VZJA 4QXKA 4AYUA 1UZZA 1C8NA 4PBOA 5E89A 1YFYA 1VBD3 1O7FA 4FXGB 4YZ2A 1AL22 1WW4A 2VW1A 3KMHA 4HFSA 2ZGLA 5T5JA 3VKMA 1LOCA 5I0TA 3WOGA 1H9WA 4OI2A 2A6WA 1LHNA 3LSEA 2ARBA 3WV6A 2A6XA 1KDKA 5FOBB 5CFDB 3TNQA 1FYUA 3ZFGC 1X82A 1BVP1 3VHOA 1K5MA 5CNAA 3MZHA 1DG6A 2CGNA 4RA0A 4YLZA 5HCFA 1GNZA 2MHFA 1U12A 3LWCA 4K9SA 2R6QA 4Q2FA 1VBA3 5I0UA 1O91A 1OI6A 3SISA 4KGQA 4YVWA 1UU5A 1QU0A 1W0OA 3POWA 2GAUA 1H1MA 1QH6A 2XKPA 2X29A 1WD4A 1NCQB 1SLTA 1QQP1 2XLFA 3NL1A 4A7ZA 3WW4A 3H8UA 2D40A 5GZEA 2E63A 3WDXA 2WZR2 3MF9A 4NO4A 4Q8LA 1OHFA 3ZSLA 2X5IA 3ZO0B 4KG8A 3X29B 1RUJ3 1SMVA 1OQDA 4QQHA 4P5HA 1RUG2 3G6JB 3KLSA 1A3KA 2PLV3 3C2UA 2OYZA 3U4XA 1FPN2 3VBUC 3PMEA 3LA3A 4P9WA 4XHBA 4KH9A 4Z92B 2OIIA 1QJY2 1U5ZA 3HIFA 3NV2A 5KXBA 1AR81 3CJIC 2HWE2 4IV3A 4YM0A 4PF5A 4U36A 5GZFA 4IEPA 1OOPA 1MQTC 1WBFA 2D3PA 1DHKB 2GC2A 4FCAA 1G9CA 3EHKA 2A71A 1AL23 2R0FA 4OUSA 3THPA 2BTVC 2VVDA 2OZ6A 2QJVA 2D6MA 2YV8A 5JIUA 2HWC1 3UL2A 5KC5A 1DZRA 2OW4A 5EYYA 1VB4A 3LA7A 1UKRA 3VN4A 4OFGA 2I74A 2O0OA 4CDUB 4BCUA 5HBAA 4IEZA 1NXMA 4CEYC 3K51A 1HRI1 1SQ4A 1V00A 2BQPA 4HKLA 4KGGA 4QD2A 4LBQA 3ZSKA 2GNTA 1CPNA 3D0SA 5BNNA 4L9BA 3FUQA 3DPRB 1R092 4WM8C 3B9CA 4QPIB 2WT1A 2DYCA 1DDLA 4BLIA 5J36A 1NQJA 3OY8B 1GR3A 2ET1A 2IXIA 4AVVA 2BNMA 2QUOA 2XLAA 4D7YA 1LGNA 1IOAA 4CDXC 2GH2A 3EO6A 3WW3A 3M3QA 2CWSA 1GSLA 3BTAA 4AGVA 1PGSA 4N7IA 4NOTA 2GMMA 2YYOA 4RQPB 3MW3A 3VBHA 3RPQA 1H8TC 3NAPB 1COV1 4COVA 2GN7A 1H4HA 1AZDA 1CGPA 2VQ0A 3AZZA 2IC1A 1N3OA 1SEFA 2C0ZA 1RUG3 3M4FA 4P14A 5HCAA 2DV9A 4QM8A 3VHPA 2CAUA 3FFZA 3DV8A 3RG0A 4DNYA 3VBOC 3H50A 1Q43A 4DINB 1ND3C 2HWE3 3AXEA 4CDWB 3VZLA 3B5LB 3ZFEA 4AQTA 2UY8A 3GALA 1IGOA 4EN6B 4A3XA 2ZJCA 2XJPA 2QKDA 5ACA2 1M06G 2QCSB 1Z78A 4D7SA 4QPGA 4F83A 4FSJA 1I5ZA 2SLIA 1NZCA 2JG9C 1KITA 1L3JA 3FBYA 3OGJA 1QMJA 3WXPA 1VBE3 3VBFB 4P9YA 1XYPA 3VV1A 1YWKA 1RUH1 4B4RA 2EXHA 4HN0A 4H55A 4FPJA 1H2MA 2G4IA 3J4UH 2UWCA 3DL3A 1N1TA 4RGGA 4XXPA 1KFUL 3A0KA 5CADA 1R093 3D0JA 4NHMA 2VW0A 3JZVA 1G9FA 3VDDB 3VZKA 3M3IA 1UKGA 3POYA 2PHFA 1UN1A 3AK0A 2XBO3 3J8F2 1BKZA 4HKOA 3WCRA 4AG4A 2UURA 1B35B 1XNKA 4Q4Y3 2CGOA 3O12A 2BWCA 2UWBA 3MIHA 1KXGA 2RM21 4JV4A 2RS53 4KWJA 1RUI2 1O3QA 1H8VA 1HRV2 4XQDA 4X8PA 1ULGA 4JRAA 1G9DA 2QFEA 5I93A 3SXWA 2RS12 5J48A 4HETA 1Y43B 3E5UA 3ZFFA 2PHDA 5CFDA 1GYKA 1N1YA 4B29A 4ATEA 5K9YA 1LGCA 3MGUA 5A33A 5LK5A 2H6BA 3I7DA 4PJYA 4YVSB 3KZ4C 3E6CC 4XJ8A 3A4UA 4R9AA 4PIXA 1PO11 2W68A 4OVEA 3EJKA 2XJUA 1PVC2 2WNEA 4L2NA 1HQNA 1HKDA 1ZBE1 4JQRA 2BUKA 1U0AA 2QDRA 4I09A 4XDQA 5ACA3 1NCQA 4FPGA 5DUWA 5IK7A 1BK1A 4XXAA 4ZU5A 4AVAA 1J1TA 1S0DA 2WLQA 4XTMA 3HD8B 5AC91 2WNVC 4FAHA 5D8AB 1T6GC 1VAMA 2ATFA 4Q8KA 3SH3A 4BPZA 5C8CC 2EVXA 4LBMA 4GWNA 4XFAA 2KA3A 2O8QA 4ZU7A 1IS6A 3H0OA 2Q0AA 2YXSA 1TME1 4KU7A 4Z8BA 1NXD1 3VZMA 4G4FA 1UPSA 4N43C 1VB2A 5DG1A 3T1LA 1DU3D 1GANA 2FMDA 3KT7A 3IBMA 4UW6A 1SLCA 1ONAA 4OHYA 2WKKA 1DYKA 4XTPA 2DUPA 5LK7B 4YZ1A 5AFEA 3ZN5A 1W2UA 4HVQA 2VGDA 1FNYA 5GALA 3KD4A 1EP0A 4YM1A 5GLZA 2JX9A 4C1XA 3WUDA 4QQPA 3J8F3 3N7JA 5HI0A 3ZPYA 4Q27A 3WDTA 5K0UB 4FAGA 3S6PA 2CL2A 3R4DB 3LA2A 1LULA 2YGMA 4JRLA 1RUI3 4GQ7A 1HRV3 4XPVA 1HXS1 4PLNA 2EF6A 4HK9A 5J7MA 2ES3A 4MV2A 1PK6A 3VL8A 3ZYPA 4BMEA 5C9AC 1VBB2 2RS13 3PMSA 2WQZC 4MVTA 3VBRC 2C1FA 2I45A 3B02A 3O5SA 2TBVA 2XJRA 5KHIA 3WW2A 4PDWB 1ASJ1 5F6LB 3CJIB 4M0HA 1RC6A 2IXJA 4BA6A 3WQ0A 2OZJA 4ORFA 2D6KA 2XL7A 5LEJA 3DPRA 2FZ2A 1PVC3 5JOWA 4QPIA 2WSUA 5KXDA 4FPEA 4CYDA 4HLTA 2PHWA 2YMZA 4JGZC 2EXJA 1U5XA 1QOTA 2Q4SA 1R081 1BEV2 1X8MA 4MGKE 5DDJ1 2XPJA 2FZ1A 4WM7A 1BMV1 3QACA 1AX1A 1OSGA 1AR71 3ME2A 3OYWB 1M4WA 3TB0A 4AXOA 4B7KA 2ZX3A 1AX0A 2DTWA 4RQPA 1TE1B 4XE9A 5CB7A 2D98A 3NAPA 4F8AA 4Y5Z0 5LEKA 3MEPA 5CBLA 3E5QA 4I30A 2HEWF 4Y1UA 5J3UA 1JOJA 1VRH2 4PIZA 5ABJC 2PHUA 1OKQA 5B2GB 2W08A 3ZXDA 1RGSA 4H3WA 2VECA 3JCIA 4LBJA 4Y1ZA 2RMU1 4CDWA 5C8WA 4CDXB 4Q0PA 4NWVA 2WNUC 5BY5A 1C8M1 2ZX4A 5L7OC 2UU8A 3VBSC 3G7DA 3LKJA 3JD72 4CDQC 4R4ZA 3MLJA 4U2AA 4YNIA 2QQPA 1LOGA 1RVF2 3NVCA 2IFRA 4M0NA 1Q5OA 1YXWA 1NLRA 2EAAA 4BOWA 1LR5A 3VBFA 1VBB3 5FPXA 3KCCA 3IKWA 1CAXB 3V56A 4Q4V2 4LLFA 4PBPA 1ZZ9A 5A3MA 4Y22A 1CQ9A 1MS0A 4ISRA 4Q1RA 2JJ6A 4CEWB 1REEA 4FTBA 3JBG1 4XJZA 5FRAA 3VGIA 4BLJA 5FMOS 3VDDA 2RJLA 1QWRA 4XOGA 1FV2A 4WV8A 1REDA 3KT1A 2A3XA 3WNXA 1BEV3 1OA3A 1VBC2 2VOXA 3CO2A 4LR4A 1C5HA 1UD1A 3AB0A 4COZA 4X6RB 4C90A 1CR7A 4YW2A 2ETEA 3RSJA 3WDWA 3JB8A 4HPKA 1SFYA 5KC6A 2EAKA 2ZTNA 4EROA 3GYDA 2ZOEB 2V09A 4HSLA 1QOSA 1QOOA 1ZNPA 2E7QA 2VOWA 2LALA 4FXKB 1ZYBA 1FMD1 5A32B 2AR6A 2QZ2A 3T1MA 4YGDA 2ZHNA 3FMGA 1VRH3 2ZAAA 2HWF1 4YVSA 1AR62 3VL9A 2PHLA 1GZ9A 4LA3A 1BJQA 4YSFA 1AYN1 2VMIA 1JHNA 3WP5A 4NN0A 1F2NA 1PIV1 1ZZBA 4ASMB 1IS3A 4AEJA 1TMF1 3N35A 2PHTA 4RHV2 3J9SA 4LO7A 3JD73 2BPA2 1R1ZA 2KXLA 1DGWA 4XF4A 1JYIA 3VLBB 1UIJA 1AR91 4LBQD 1D0HA 3GBWA 3FLPA 1G8WA 5BXXA 3L2YA 4M3CF 1QJZA 4YRDA 3ZFGA 1MEC1 3KGLA 5JOYA 3EBRA 4X6QB 1EPWA 2DVGA 3OTFA 4RS5C 1WW7A 2JENA 4Z1VA 1NA1C 4Q4V3 2IZWA 1WMFA 1RUD2 1WMDA 4LBLA 5BUVA 4XFHA 4ITCA 4KBBA 1CAUB 1YHFA 4LEJA 1SCRA 1D4M2 1RHI2 2ZMLA 1JN2P 3MLKA 5BNPC 4TWTA 2WNVB 4HK8A 5C4WB 4JTNA 3WT3A 3UKNA 5T3NA 2NZ9A 3H3UA 1QGLA 1VBC3 3FWEA 4M00A 2B46X 5K0UA 4AEDC 5IT6A 1MS9A 1EPZA 2D6OX 3D8CA 5J37A 2NQYA 2RHPA 1XRUA 2DCZA 4I0BA 4XMIA 4YGCA 1PO22 2W39A 3WCSA 2WL1A 4N43B 2VY0A 1RUE1 1WW6A 5F1RA 3RYRA 2VOKA 2Q30A 5GM0A 2UYAA 4DZGA 3ZYRA 4COUA 4IETA 3AMMA 2ZGTA 1ZBE2 3MIBA 1XE8A 1ENSA 1CD3G 5JPMB 3AZWA 3RS6A 1OLRA 4PDWA 1TNFA 1AR63 3CJIA 5EXOA 2C9AA 2PYTA 3OJBA 3WG4A 5SV5A 1WLTA 4JCKA 2QVSB 1SCSA 1UMZA 3ZXGA 1QJU1 4BQ1A 2R041 3K48A 1X7NA 5FCCA 1WLWA 5KWRA 3WG3A 1MZEA 4GB31 1G7YA 5F5QA 5T54A 1JUIA 2RR11 5D1IA 1F8VA 2PAEA 4OZXA 3W59A 3WP3A 4FP3A 5C9AB 1ND2C 3RNSA 3WHUA 3OYWA 3VBRB 2D3SA 2XWJB 5TSWA 3ILRA 1RUC2 1QDOA 3TWIA 4D94A 4EWEA 5JI9A 2JICA 1S2KA 2D5HA 3RWNA 3B7MA 1IZ3A 1RJ7A 1RUD3 4GH4C 1SACA 2P17A 4XFIA 4WM8A 5FOJB 1XYNA 4AVBA 4AI8A 4Y1VA 1DZQA 4EV0A 1PVXA 3ZFFB 5KXEA 4JGZB 2XB6C 2A75A 3UJOA 4W6WA 1D4M3 1RHI3 2JG8B 2HWD1 5EZWA 5A33B 4LHNA 4AQSA 5JZGB 3SH5A 4CDXA 1H0BA 5KHJA 4Q4W2 1DF0A 2GNDA 3FC0A 1LOFC 2E7AA 3TBDA 1QXRA 4IV1C 4GWMA 5JPNB 3ZDSA 3B01A 2BFUL 2VOVA 5I91A 4JAAA 4V1PA 1H8TA 2AH2A 2P2KA 3MW4A 3RDIA 1AYM1 4BYYA 1PO23 3HAGA 3PVNA 3AYAA 4IEXA 2R1BA 4Y4YA 1GBGA 4XETA 1HV0A 4HZFA 2XGXA 4AVCA 2MEV1 3MIEA 4LLOA 4Z07A 5ABJB 1CAXA 1FV3A 3D5OA 3VKNA 1ZBE3 2WFF2 4DS0A 5CFCC 3CNAA 2WINB 1DIWA 2D43A 4M01A 5CIRA 4CEWA 2XL9A 1J3QA 5AVAA 4XEZA 1AHSA 2R061 1X33A 1J3RA 2PHXA 2P3IA 4YM3A 1LOBA 4J1WA 5BPXA 4WVWA 4W65A 1Q3EA 3QCWA 5E1RA 1UIKA 3MIGA 1C5IA 5BYNA 4J6GA 4YZ5A 1NLSA 3MICA 4FPLA 1A78A 2JG9A 4R8HA 4DOUA 2OPKA 1V9U1 4Q0SA 4XILA 1UW8A 3ZXJA 1FNZA 1WMEA 4TLFA 3NJZA 1RUC3 4Q0UA 2NMOA 4YFWA 2UY9A 1LU1A 4AE2A 2ZBJA 4GMP1 3S7EA 5F9TA 1DQ0A 2ZX2A 5A32A 1D0GA 4LBNA 3P3NA 4R9CA 1XU2A 2CNAA 1C8M2 1POV1 4K8FA 1BBT2 1PK6B 4RR3C 4R4XA 1VBE2 5I8SA 3ILNA 3KGZA 4XW3A 4O9EA 2K0GA 4BM8A 2F6BA 2JEMA 4URTA 4K1YA 2ZKNA 2GC3A 1DQ2A 3O0XA 1SBEA 4Q4W3 3AYCA 4MZUA 4AFMA 2HWB2 2LUWA 4CRQA 1NQDA 2BGCA 1LENA 1RMU1 2X8KA 3N36A 3WG2A 1Y9QA 1YRZA 4NHKA 4YG3A 1I6XA 1LU2A 3EXUA 5T52A 4PCRA 2XBO2 4YM2A 2PAMA 4W6YA 2W0XA 2EIGA 1X36A 2E51A 4N90A 4HKWA 5DUXA 4N53C 4Q4Y2 1VR3A 4Y1XA 2DVFA 2YHJA 4WVMB 4IXLA 3U0ZA 1ULEA 2RS52 4WM7B 3SCFA 1PHMA 4RSUA 2WFF3 4YYOA 3O0WA 1DLLA 1PGW2 1ZVFA 1ZM1A 4D69A 3VUOA 4NHLA 4K21A 3QLQA 2ZMKA 1FI2A 3SNMA 2JD4A 4EWAA 4PQ9A 5C33A 3SHRA 1X8EA 1RUOA 4KG0A 1CAUA 4GULA 4AFCA 2OA2A 3BB6A 3E97A 3H7JA 2ZAHA 2WA3A 3OBTA 2R072 1H4GA 2Z42A 1ZRRA 1OPMA 2WNVA 3POSA 3AX4A 3I4IA 5C4WA 1VLNA 2DUQA 1MZFA 5C8CA 1DGWX 1H1IA 3KM5A 1VIWB 3B00A 3DF0A 3MW2A 4I3PA 3TN91 4RL7A 2D6LX 2WS91 4FOWA 5BV6A 1PGL2 2XVKA 3WZ1A 2W52A 2A73B 4N43A 1NA1B 3ZXAC 1EAH1 4NR1A 4MX3A 3NSTA 1R1A1 1S0JA 2CTVA 2E6VA 1C8M3 1DQ6A 1O5LA 1RUF1 5JIAA 4UBGA 2TUNA 3ES4A 2N7GA 4G9SB 1BBT3 2EA7A 5BNPB 5KHGA 1WLDA 3WDUA 5EFUA 1YFUA 4ONUA 4Y26A 1JBCA 1G6NA 5JI7A 3ZYJB 4Y22B 3ST7A 1OFSA 2GN3A 2Y38A 1VAVA 2HWB3 2GC0A 4S2GA 2B8MA 1MVQA 5AFBA 5GLVA 3ZXFA 2HEYF 1A8MA 2AREA 1AJOA 1AXYA 1NG0A 1QKQA 1O4TA 5C9AA 1JUHA 2DCTA 2A70A 1J58A 1AXKA 3VBRA 2KM2A 3FBMA 4M3CB 5GJ6A 2HYKA 3UJQA 1EV11 4IERA 3KSCA 1DGLA 4QGMA 2CAVA 5A3LA 4FTSA 3M3CA 4LO6B 5CA6A 1SBDA 4HPKB 1VBD1 1LCLA 3WUCA 2RS32 3U11A 3MF6A 3ZXEA 1NY72 4QT6A 4WVVA 4DPNA 1WCSA 1IQAA 5GZDA 3MI8A 4JGZA 1UAIA 2JG8A 3AKSA 5JZGA 2ZPXA 2R073 1W6QB 1CAVA 2BWAA 1JW6A 2JECA 2MNGA 3VHRA 3NKGA 1ND2B 1QJX2 4IQPA 3DGTA 2R30A 5FAXA 1UPIA 2EXIA 5BNNC 5GLTA 3APBA 3ZYIB 3AFGA 2HWF3 1VBA1 3GZAA 4XQWA 4LHKA 2ZHLA 1AYN3 2D6NA 1BZWA 4XYXA 3QH7A 4S2HA 4AFBA 1PIV3 1A6CA 5ABJA 5HXVA 3O0VA 2ZS6B 4LT5A 1NYWA 3M2MA 4GKXA 1W6NB 3V0AA 1BXHA 2ZX1A 2A3WA 5DZEA 1LHUA 3ZFGB 1S1AA 3UKVA 1GICA 2X53S 1Z7S1 3OD0A 2ZABA 4JTOA 1AL0G 1Q8VA 1KD7A 3GBFA 5DUVA 4ZU4A 2B42B 3VBSA 2K9ZA 1HQLA 1XNCA 4FTEA 2EALA 5EJ3A 5H9SA 2LTNA 2NN8A 1MEC3 2YDEA 4DY5A 4AI0A 3JU9A 3M1HA 1RUJ1 3HWJA 4CZSA 3FFQA 3S30A 4LO4B 4P9GA 4OLLA 3SH4A 4AK3A 5BNOC 5T55A 3TRSB 2PLV1 1ZREA 3IN9A 4Q4X1 2P34A 2SBAA 1S0GA 1CAWA 3ZFEC 5K8SA 2A6YA 1OD5A 4QM9A 5CFCB 4MH0E 3RMXA 4FQ4A 2QNKA 2XKOA 4H7LA 2PQQA 2VUJA 1YJLA 1NCRC 3WG1A 2VNGA 1CPMA 1KJLA 4MXVA 1AL21 2RS33 5FFOC 2Y0OA 5SV8A 3E6BA 2F4PA 1S0BA 3WVJA 3VBUB 4FQZA 4FBFA 2Z69A 1YIFA 1O5UA 4AGRA 4TZDA 2ZZQA 3NW4A 4FPOB 4A7KA 2ZACA 3GZTB 4FPKA 2NYYA 5GZGA 4EN8B 3FX3A 1QJX3 1QQP2 2MEV2 1QXPA 3H7YA 1MZ5A 1MQTB 5E8AA 4BE3A 5EWSA 1DQ5A 4R9BA 2UYBA 3PVOA 3RZZA 1F31A 1V70A 4H7MA 4XFGA 3VHNA 4HBNA 3QD6A 1WLCA 3WDYA 3MYXA 1MS1A 1RITA 3IMNA 2BBVA 4WVMA 3R0RA 2GALA 2R043 1HV1A 1H9PA 1VP6A 4GIQA 3RJ2X 1HQWA 5IUQA 3M3EA 2WJSA 5H9PA 1REFA 2Z5WA 2B45X 2XUMA 4GB33 4JDNA 4UW4A 1TEIA 4CEYB 1OQ1A 1V9U2 1AR82 2WZR1 2R1DA 3OGGA 1RTVA 1V6NA 5DZFA 1MS5A 4WM8B 1DYPA 1PZ7A 2DF7A 4MXWB 1XE7A 4PLMA 5KXCA 3PLQA 1FAYA 3M8LA 1YCIA 5KBFA 1RUG1 3CL1A