1D2QA

Crystal structure of human trail
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
161
structure length
134
Chain Sequence
RVAAHITGTRGNTLSKNEKALGRKINSWESSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRQMVQYIYKYTSYPDPILLMKSARNSCYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords TNF-RELATED APOPTOSIS INDUCING LIGAND
publication title 2.8 A resolution crystal structure of human TRAIL, a cytokine with selective antitumor activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 134
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d2qA00
4KGQA 2O0OA 1PK6A 3AB0A 2R6QA 1OQEA 4TSVA 2WNUA 1D4VB 4E4SA 5TSWA 5L19A 3QBQA 4MXWA 5BNQA 4QQPA 4QPYA 3ALQA 4KG8A 2JG9B 2QDNA 1I9RA 4TWTA 5L36A 4GIQA 2RE9A 5KC6A 2AZ5A 2QE3A 2JG8A 3ME2A 4G3YC 2JG9C 1TNRA 2HEWF 2Q1MA 4KGGA 2HEVF 4OUSA 4QQOA 4NN0A 4MSVA 2WNVC 3IT8A 2R30A 1OQDA 4HT1T 4OUMA 5KWRA 1A8MA 2R32A 1DG6A 3K51A 3B9IA 3QD6A 1XU1A 1GR3A 1U5XA 2KA3A 1XU2A 2WNVB 4G4FA 1OSGA 1PK6C 1ALYA 1WCKA 2OIIA 1JTZX 1RJ7A 2WNUC 4QQLA 1U5YA 2Z5WA 3LKJA 3WD5A 1U5ZA 1IQAA 1C3HA 2RJKA 2JG8B 1JH5A 5KC5A 1DU3D 1PK6B 3URFA 2WNUB 4F3JA 2X29A 4D7YA 2JG9A 2ZJCA 2ZPXA 1KD7A 1TNFA 2JG8C 1O91A 4MXWB 2Q8OA 4E4DX 3TWIA 3V56A 2TUNA 1C28A 4DOUA 4QQ2A 4DB5A 3B93A 2TNFA 4QQHA 4EN0A 1D0GA 3B94A 2WNVA 3L9JT 2HEYF 3FC0A 4OULA 4RSUA 1KXGA 2E7AA 1D2QA 3MI8A 1S55A 3K48A 4J6GA 4MXVA 4N90A 3TYJA 5HBAA 2RJLA 1RJ8A 5CIRA
chains in the Genus database with same CATH superfamily
2HWD1 4CUGA 2O14A 2ATFA 3D82A 4QM9A 4A45A 4YRDA 3I49A 2XJSA 4QGNA 4HK8A 1QHDA 1AR83 1PVC2 4XFFA 2WO7A 3OUHA 5CFCB 4FCAA 1BBT1 4LKEA 1Q43A 2WNOA 4LUKA 2BEOA 1OHFA 1ZRRA 4JRLA 2EIEA 5D8AC 3W58A 1TQ5A 5T5OA 3T2PA 1DQ0A 4KG8A 5EZWA 4QM8A 4ET7A 1T2XA 5IVYA 3ZLIA 3MW2A 1DQ6A 5F6KA 4Z1VA 5LB6A 1X33A 3APBA 3JBG2 5JOWA 4AEDA 5LCWL 4FP2A 2JDAA 3KB5A 1HKDA 1W6MA 4Y4RA 5F32A 2A7AA 2R1DA 3WW2A 1TEIA 4CEWB 2VUCA 3PUAA 2B5HA 5BY5A 4W65A 3SEPA 1QJX2 1J59A 4NPMA 4CDUC 2GSYA 5D1IA 4NVPA 3U37A 3TB0A 3WNMA 2E32A 2D6MA 2K46A 4WVMB 1XNCA 2XQRA 1S0BA 4NN0A 1JZ5A 2W08A 4NIGA 2WWUA 1H1AA 4MSVA 3PIJA 2ORZA 5CFCA 2PLV3 3CDZB 5FZHA 1V6MA 4OUMA 1OT5A 2I2SA 1XNDA 3LIHA 4PDWC 4CCNA 4EWEA 1BMV1 2XMLA 2FCTA 4XJAA 5IK7A 3OPZA 3AP7A 4GH4A 3ON7A 3E6DA 3Q8BA 1DYKA 3C7HA 4YW4A 3AYEA 1AL23 3LGRA 3NNMA 4FPYA 4GA9A 3NWKA 4JX0A 1GANA 5FZ7A 1CX4A 1XYNA 3M70A 1VIWB 2VR4A 1OVPA 1LGBA 4CDWB 5FMOS 4O9GA 3WW4A 1VRBA 3J7NA 5JXHA 3VBOA 4FFFA 1WCKA 1G6NA 4CEWA 1LOCA 5C71A 1ZZ8A 3D0JA 1KITA 4XFIA 4YGCA 4PF5A 1NX9A 1APNA 1MS9A 1WMXA 4HPKB 4QX2A 1MS8A 2D98A 2Y60A 5DXDA 2EAKA 2XH6A 4XJUA 5FXZA 1W90A 5IT6A 4N53A 5DG1A 1W8TA 2P5BA 1LNSA 5I91A 2CGPA 1MZFA 3DYPA 1FV3A 1V6LA 1QMJA 2GNDA 4H7LA 3ZFGB 2OPWA 4CDXB 1NZIA 5C5UA 1NOVA 1COV2 1PZ7A 2BBAA 5KHIA 3WW3A 3ACLA 4ASLA 5LBFA 4YG6A 4WVVA 4B4PA 2QDRA 2ZPXA 3INAA 2YBPA 3QOPA 4IGQA 1UY4A 5FMCA 3RJ2X 3UKTA 5DDJ1 5JXJA 5BNNB 3MIBA 4KG0A 3SKJE 1B35A 1GZTA 2DBNA 3N9OA 2HEYF 2GN7A 3FC0A 1UOJA 4FPLA 5DZGA 4D6QA 4HKWA 2E7AA 1AXKA 4NAOA 4CCCA 1ZM1A 1CJPA 2VMDA 2EAAA 1GOFA 2BUKA 1YQCA 1JYCA 3VHNA 4HPKA 1VB2A 2GC3A 5A7QA 1S55A 3K48A 3NJZA 2ZHKA 2VAUA 3DN7A 1E5HA 3FHQA 3IWZA 3ZIWA 3DXTA 1SG3A 1RIRA 2VECA 4R9BA 5C8CB 4AFDA 3FLPA 1R093 1RUG3 4KU7A 3ZR5A 5E89A 1ASJ1 1DGRA 1EUTA 3JQWA 1BEV3 1URXA 1BK0A 1TG7A 4PI2A 1NLRA 4OQ9A 5LW9A 1NT0A 4HETA 2BNOA 3VBFB 1JU3A 3OUJA 4P9JA 4QQPA 3SCGA 3MGUA 5DUVA 1XBFA 2VOKA 4RFT0 2AREA 3I2GA 1FYUA 4XDOA 4D94A 3LCPA 4AFMA 3BU7A 1OH3A 1OLQA 4ARYA 4OHWA 4L99A 4TWTA 4Q1PA 2C9AA 2PHDA 1MEC2 2WQZC 3OEBA 2R072 3I97A 4JGZA 1QQP3 4L97A 1GFF2 2A3YA 4IE5A 4EV0A 1NCQC 1W3VA 3C7FA 4N43B 3O5SA 5F2WA 3PL0A 5FIXA 2NP0A 2ZXQA 1OKOA 3OPTA 1UYPA 5FZCA 4MHRA 4LO4B 2BFUL 3C2UA 2Q1MA 2P3KA 4YFWA 3VDBA 2D93A 1QJEA 1S2EA 1SQ4A 4C1XA 1CPNA 2ZMKA 4HOOA 3WP3A 5LA1A 5KXBA 3H8RA 5F37A 3NJXA 2ZBJA 2Q4SA 2R041 4A7ZA 1NA1B 2R32A 1DG6A 2QQWA 4H2AA 4XXPA 3I59A 4LE3A 4I3PA 4YVWB 1C8M2 3H8OA 4P08A 1J3PA 1HRV1 2J1EA 1HRI2 4E4HA 4MG2A 3FUOA 2CHHA 2WNVB 1JI6A 3VBUA 2J1RA 4NPLA 1PK6C 5FBJA 1AZDA 3AL6A 1I5PA 5FWJA 5ANQA 1RJ7A 2WNUC 3UK9A 1LAJA 4N43A 2DWRA 5H9PA 5A3PA 3PVEA 1IQAA 1DQ2A 1GNYA 2G1MA 1I6XA 4URTA 1UU6A 3AKSA 1XSQA 4K7JA 4Q0UA 5A3WA 1CN1A 2ZHMA 4PLMA 3BYWA 2ADEA 3VBRB 4R9AA 3BPSA 3BTYA 3BOPA 4MH0E 2ILMA 2PHRA 1SLAA 4UT5A 4CPBA 1XNBA 2W1QA 5FBZA 2RS53 3J7LA 4XPVA 2RDNA 5F5IA 4E2QA 2DDUA 4JZRA 4AXOA 3FN9A 4KL1A 1AX0A 2VC9A 3CHXA 3O1VA 4UW5A 2CWMA 4AEMA 5K4LA 1WLDA 1AR81 4XETA 5BV6A 1W3XA 2K0GA 5FPBA 2VOWA 4QXHA 1RUD2 1NCRC 2WNVA 2JKXA 5IW0A 1YFXA 4FPOB 1QNWA 5DAVA 3E5UA 4RSUA 3PUIA 3GCXA 1IS3A 1POV3 1PX4A 3AVRA 3HN1A 4OHXA 2Y33A 1W9WA 1JZ2A 4Y1UA 5JZGB 2RR12 1EV13 5BYNA 5BPXA 1C1FA 1RMU2 1AR72 4N90A 1U12A 1CONA 2GP5A 2W47A 4W6WA 5C9AB 2YU1A 4V1PA 4C91A 3ZFEA 4PHZA 3A23A 2ZABA 4CP9A 1HIXA 2Z42A 1W6QA 1XQNA 3HAGA 4YW5A 5FQ0B 3THDA 1SBFA 3LEGA 1XJAA 4JAAA 3LFMA 3KLSA 1DQ1A 4AFAA 4BU2A 5I8YA 5ABJC 2BGCA 3L2HA 4M0NA 5FO7B 3WF1A 4CEYC 5HCBA 1C4RA 1SEFA 4GB33 4JC1A 3SNMA 3POWA 1UOFA 4AAPA 3KM5A 4LULA 5E88A 3DKWA 4O61A 1PM7A 5DAPA 4AHYA 2A6ZA 2ZHLA 3PU8A 4XFHA 3ZYPA 2GC2A 1N3PA 2PLV1 3N9LA 2XJPA 2E7QA 2UWCA 1N1VA 3IDEA 4XIOA 2DFBA 2A70A 1I9RA 2JE8A 2V09A 4UFMA 4YGDA 1Q3EA 3MUZ1 4CVUA 2VXJA 2DUOA 2LW8A 2WS92 3GJBA 3KV4A 1OQ1A 4QXBA 4ZXKA 1AL21 1J83A 1P8JA 2YG0A 1WCDJ 3IIAA 3HIFA 3J7MA 3LA3A 4CRQA 3ME2A 4JKMA 4IQPA 3NMBA 1Y4WA 2QQVA 2J7MA 4FPKA 1AR93 4XZPA 2EXKA 3W21A 1QJU2 2IUWA 5FQ0A 1OBNA 2ET1A 2BQPA 4OUSA 3OBRA 3S6PA 1LRHA 3A21A 4JRAA 4DRRA 2J42A 1GWKA 4IE7A 1OD3A 1OI6A 2GNMA 2MEV3 2VMCA 4P14A 4ZS3A 3LPFA 3TEWA 3ZYGA 2ZGOA 1O3RA 2YBKA 4UXAA 1X8EA 3VDDB 4QX1A 4CU7A 3D3AA 2VZUA 2BGPA 3T1MA 2VOXA 4V2WA 2HWF2 2HWE3 3GALA 4RR3A 4SLIA 4LBJA 1XU1A 5T54A 3PUSA 4B8EA 4DO0A 3MO4A 2LUWA 4JVAA 2C1FA 1ONAA 2YC4A 4G4FA 2GMMA 1VMFA 1OSGA 1VBE2 1ZZ9A 3I2HA 1FPN3 1PGSA 1UMIA 3K4ZA 2QQKA 5FZBA 2W1SA 1WGPA 1EUUA 4WVWA 3GM8A 3M3OA 1UF2C 2VZOA 2SBAA 3AKRA 1LEMA 1VRH3 2YV8A 5DAXA 5FYTA 3KCCA 3GCWA 1TMF2 3HBKA 5HPOA 3U4XA 1UOBA 4OI4A 4Q27A 1KFUL 1S0IA 3MIEA 4LO8A 4QDRA 5ACA3 2KXLA 3I3MA 1FATA 1HV0A 4Q8KA 2PHFA 3VBHA 4AEDC 4AVBA 4URAA 5JZGA 5FP3A 5EWSA 5BUVA 4IDZA 2YYOA 1SBEA 1KD7A 1TME2 4LR4A 2JB4A 4XF9A 2V5DA 1R091 1XSRA 1RUG1 5GJ6A 4XMAA 4QQ2A 1PMJX 2GN3A 2HYKA 3QCWA 1BEV1 1K5MB 3UESA 2I74A 1AVBA 2VNRA 2CTVA 4OMCA 4B7KA 1BCXA 3PJYA 5HCAA 1HN0A 3RYKA 1F5FA 3H7JA 3HNMA 1F5JA 1D2QA 2QVSB 3LEIA 1GUIA 3CNAA 3R05A 4Y20B 4MOAA 5CFCC 1GMMA 2QKDA 3MF6A 2JD4A 1ZZ7A 3VKMA 2XUEA 4UW3A 4GH4C 1W0OA 2VCCA 2JDMA 2BWAA 4PIXA 1QQP1 1VAMA 3T2TA 2ZKNA 3IDCB 3WP4A 2R6QA 3BTAA 4A42A 3MF9A 3ETQA 1LGCA 2XBO2 3NW4A 2ZEXA 2HH9A 2VVFA 5EXOA 5HCFA 3VBOC 4YPJA 1VBD3 5JI9A 1Z7S2 2D6KA 3VV1A 4AL9A 5C33A 1HQWA 2D3PA 3ALQA 2JG9B 2OYZA 4ES9A 2CDPA 3K4DA 4N53C 4XAEA 3HPNA 4JGYA 4O7XA 1W9SA 5LZ6A 1DZRA 1JYNA 4HKOA 2OX0A 3BIWE 1M4WA 4YM1A 3SH5A 2C5DA 3OGRA 2AZ5A 3OGSA 4R4ZA 4RQPB 3KT1A 5FP7A 5LRSA 5EIYB 1Z0HA 2RM21 2F6BA 3I3QA 1WCUA 4XMIA 1UY0A 1ULFA 5I0SA 2O8QA 1IHMA 4IE0A 3A7QA 3ZVXA 2HEVF 5A3OA 4RL7A 5C3SA 1B35C 4NIIA 4DUVA 1ZBA3 1JYIA 3N9QA 4JKKA 2E9QA 5FUNA 5A3LA 1WMFA 4H3WA 3ZXEA 2R1BA 4P00B 4NIAA 2VW2A 4M3CB 4HN0A 1PGW2 2FZ1A 3K51A 3BI3A 1W2TA 3IZOA 4IEQA 3DKQA 3LQCA 2RS51 2WSVA 3LPGA 4OI2A 1JOPA 2LALA 2WA3A 4M3CF 1LHOA 3BOWA 3OCPA 3WHUA 4CPBD 2QQPA 1ENRA 2D6NA 4MLOA 4PIZA 4IE6A 1REEA 2WWSA 3USUA 3ZFFB 5JR7B 3IKWA 2PELA 4I0AA 4XUTA 4ZY9A 5KXDA 2P37A 3C8XA 5FZ9A 4RQPA 5GALA 2RS12 4DXZA 1VAVA 4N7UA 4WZCA 3O1MA 2CDOA 4XEZA 1AX2A 1REDA 4Q4W2 4PJYA 1H30A 3WX5A 1POV1 5BNOB 4QB6A 5JOXA 1R081 2BNMA 2P3JA 3OY8B 5JLVA 1CQ9A 3PUHA 3T4VA 2C0ZA 1DBNA 1VR3A 5KHGA 2VZQA 4JGZC 4BOWA 1JYXA 3FJSA 2AACA 4M3CA 5FZ8A 5A7WB 4IEZA 3S5AA 5FY7A 3WCRA 3GBWA 4P9YA 5LEKA 2UYAA 1AYN2 1F9KA 1H6YA 1NYWA 5JI7A 3TWIA 4CUCA 5AFBA 1ZRFA 4DOUA 2RMU3 2JDNA 1QDOA 3AKTA 2NZ9A 3MYXA 4LOTA 4NHXA 5T5PA 4NJ4A 4D6SA 4GB31 1NLSA 3F95A 3ZFFA 2X09A 3NL1A 5GLWA 5A3TA 4DXSA 1KXGA 3DPRB 5J37A 4XIKA 2OQ6A 4HZFA 4X6RB 1MS1A 1OFSA 3FE5A 3TAYA 2V5YA 5FLIA 4YW7A 4WM8B 1R1A3 1AR63 2Q0AA 3AZZA 4YGEA 4B7EA 2C24A 1OFNA 3KMHA 1PZ9A 2XL9A 4QX8A 1RJ8A 1WA4A 2VQUA 4XXAA 4HSJA 2XXZA 3OY8A 3J4UH 4QKNA 4WM7C 3AX4A 2JEMA 1PGL1 1W6OB 1AR91 2ZGSA 2DCYA 2JDKA 3VBUC 1MACA 5IK8A 4TN7A 3F2ZA 2VMEA 1SLCA 1CIWA 4AYUA 1FI2A 4LPLA 2XKPA 4Y26A 2CSGA 4UF0B 3ORJA 3NV4A 2KM2A 1K3IA 2MEV1 3CO2A 5CBLA 1BJQA 3ENRA 4IEXA 2ZHNA 2XWJB 3DGTA 3MPBA 4XF3A 1OKQA 2WC2A 2JIGA 2IFWA 5FMDA 1J1TA 4FO9A 3T1LA 3NO8A 2HWE1 2JG8A 4WM8A 4EN6B 3UGFA 4EZ4A 3MLLA 1UW8A 3FBMA 4XQDA 2F4PA 1ZBE3 4LJHA 5A32B 5FY4A 1T6GC 1FPN1 4AHWA 3FFZA 2ZGRA 4QB1A 1AL0G 3SEEA 3AL5A 3DYOA 2WNVC 2EALA 1VRH1 2D3SA 1GLHA 2VZVA 4J25A 3VZMA 4C1WA 2ZAHA 5KHHA 4HT1T 2FHRA 2TBVA 5KWRA 1SLIA 2BVBA 3OGJA 4M4PA 1VB4A 4CCLA 4Z2WA 3KD4A 5FP9A 4QMAA 4DFSA 1GICA 2E63A 5ACA1 1QH7A 3KQ4B 4LO6B 4BIOA 3NAPB 5JSPA 2OS2A 1Y9QA 3ZFEC 4KWJA 1IZ3A 3PU3A 1LTEA 4FPHA 3A0KA 5FZEA 3WG4A 3TN92 5CB7A 3PLQA 1KDKA 3VL8A 2VY0A 1J3QA 3PMSA 3OB8A 1ZX5A 3TNQA 2PN5A 1FMD2 1JZ7A 2CGNA 5LY2A 3EXUA 5A32A 2XUMA 1CR7A 2DCZA 5SV8A 2DTWA 2XG3A 3ES1A 1VBC3 2XJVA 3MBWA 4JCKA 4N8MA 4XJ8A 3A4UA 1RGSA 3ZO0B 3KZ4C 3LDRA 4LO7A 4W50A 2GAUA 1AJKA 3EO6A 5L7OB 1OUXA 2AEZA 1W05A 3ACHA 3M3CA 4W6XA 1I1EA 3SXWA 1AXZA 3PIGA 4MGTA 2BU9A 2VZ3A 5JZGC 4QXKA 1CAVB 5CFDA 3LA2A 1PVC3 4XUOA 2VGDA 3WF4A 5C4WB 3UETA 4YVSA 2ZX0A 5FYIA 1WD4A 1NG0A 5DAQA 4BYYA 3VZKA 5I0DA 2UY9A 2EICA 4PCRA 2ETEA 1YJKA 1QGLA 1G9AA 3DF0A 2VNOA 5FYZA 4LMFA 4D3WA 3JBG3 1WLWA 4ZZ5A 3LE0A 1UD1A 4Y5TA 3SCHA 5FR3A 5CADA 1V6NA 3HJRA 1BK1A 2LRPA 5FYHA 5K0UA 2ZCWA 1BXHA 3MV11 1GQGA 5CIRA 1SPPA 5HV0A 1QJX3 1RB8G 1IQDC 2PHLA 4RR3C 5LBBA 1DGLA 5J98B 1ZRCA 3WNOA 3H8UA 5L7OA 2W1UA 1NXD1 2VW1A 4OI0A 4HFSA 2O8OA 3IB3A 4FFHA 5HCHA 4NUBA 1SMVA 5LA0A 3CLPA 4B4QA 5HXMA 4K1YA 5FZOA 2DF7A 4XACA 3JB8A 5FXXA 1F2NA 1S2KA 4DNYA 3LEKA 2BDRA 4JDOA 1ZBA1 2RJ2A 3OEAA 4DY3A 4BQYA 3JD72 5A33B 3NNFA 5F3GA 3KF3A 3GHNA 2O1QA 2NPIA 3HWJA 4PLNA 1SZBA 3HQUA 5FPAA 4Q4V2 4YSFA 1YFWA 1IPSA 2VVEA 4H55A 4K9SA 4XHXA 5GM0A 3VBHC 4BISA 4LHSA 3RS6A 4K8RB 3JB4C 3ZPYA 3J9SA 1DGRN 2ZEWA 1BVP1 2VZTA 4CP2A 5L73A 2BRTA 5CU1A 4QPIB 2B9VA 4Y3OA 1RUNA 4A4AA 1LU1A 2AENA 3AYDA 2R30A 3CEWA 1NUKA 1Q8VA 3PTRB 4MGQA 4P9XA 4LHLA 5FUPA 3K3OA 1JBCA 4EE2A 2Y38A 3UJQA 1COV3 3D0SA 4ITCA 4YM0A 1NQDA 1ZZBA 3ZYHA 2J1VA 2JECA 1W9TA 2ADDA 1GR3A 4CCOA 2KA3A 1DYPA 5FZIA 1S4CA 2X53S 4BQ3A 3ZOIA 4XQWA 1YFYA 4I3GA 3K3NA 2Q8DA 4ZONA 1FV2A 4NIDA 1Q8PA 2RMU1 4CE8A 3MICA 1IG0A 3MHZA 2BW8A 2DBIA 1RUF2 3VKOA 1HQNA 1WKYA 3B5LB 5FUIA 4E9KA 4WZFA 1OURA 5EJ1B 2Q8CA 5A3NA 4LUMA 4D69A 1GP4A 2R042 3CU7A 3WHTA 2YPJA 4DY5A 4LQRA 2DVFA 4AQSA 1QJY3 1R1A1 1AR61 4JGYC 5GLZA 4MGYE 1HRV2 5J09A 1MS4A 1YCIA 3M3QA 4F3JA 5DMYA 1W8ZA 2D44A 4BCUA 3QACA 3RRDA 1LOAA 1WLCA 1O91A 3ZN6B 2IXHA 4TYSA 1W03A 3KHBA 5FK8A 4XTPA 4BQ5A 5LBCA 3MFAA 4JTNA 4GMP0 4QKDA 4XABA 5L9RA 3T2QA 1JYVA 2YZ4A 4KMQA 3VKFC 3AYCA 2X5IB 4RHV2 2WL1A 3HR9A 3NNLA 4NROA 1LOGA 3ZXFA 3O1TA 5LEJA 1LOEA 3R4UA 1UYYA 4X8NA 5T5JA 3U07A 1PIV2 3S30A 4XE9A 4WVMA 2VH9A 3VZOA 4CDQB 2PAMA 2XB6C 1MEC3 5IHRA 2R073 4LXLA 4IV1C 4QWNA 1GYKA 2IVIB 3GZUC 3C3VA 3UKVA 4YM2A 3OYWB 4RYDA 3ZMOA 1HW5A 1H2NA 1GZ9A 1PO12 5JMOA 2P34A 3WQ7A 1G9CA 1ZBE1 2BZDA 4XFBA 3RMXA 3RYPA 2FDFA 4Y4YA 2X05A 5JPNB 2W46A 2GH2A 4GULA 2B9UA 4AI0A 4RQPC 3PURA 1GQPA 2GMEA 1WCSA 4CDWA 2SLIA 4S2HA 3UT0A 4EROA 5AC91 4QPYA 5FWEA 4NR1A 2CY6A 2ZKLA 2X5IA 3Q8EA 1XOYA 2DYCA 1REFA 2I07B 2VXRA 3HNYM 4RGGA 1C8M3 1OA4A 3ZN5A 2VQ0A 5F7UA 2P1BA 4GWIA 2W3JA 2NLRA 3MIHA 5F9TA 1CX1A 2A3XA 1QEXA 4CDQA 3ZFGA 4CDXA 3O1OA 2DCTA 3M7AA 4PQQA 5JMCA 3CJXA 1SLLA 3ACGA 1BLZA 1WW5A 1O4TA 2IVJA 2XGXA 3EBRA 4OYUA 4LBMA 3MUY1 5AVPA 1NY72 2OUHA 2GMPA 2HWB2 1PMHX 4FPFA 3ZIXA 5BNNA 1J1LA 2FDGA 1YLLA 1GP5A 4OHZA 1YO8A 1VBC1 1W2NA 2PLV2 3WP6A 5CA6A 2ZGMA 2ID4A 4CP0A 2E7TA 4YM3A 4FFIA 1LOFC 2D5FA 2VCAA 3ZM8A 5AVAA 3GZEA 5FRAA 4GZ9A 1RVF2 5JPMB 4TTGA 2Y6FA 1G7YA 4Q29A 1RUH3 4KQ7A 1PVC1 1N1TA 1H9PA 4IV3B 1KS5A 3C7OA 3RSJA 1RUD3 3ZDVA 3TEYA 4LHKA 2H0VA 3VB9A 4YW1A 4CU9A 2HKXA 2WT1A 5FO9B 4RS5B 5F3EA 5C8CA 5E1RA 4RGKA 1DLLA 3W5MA 2HWC2 3WY6A 2XPJA 4QU2A 2RR13 1MQTB 3ZYJB 5J36A 3H8XA 4XJWA 1RMU3 1AR73 3PDQA 1OPOA 1LGNA 2Y6JA 3JBG1 1JUIA 1JZ6A 2PFWA 3MZHA 2Z2SB 1RYYA 3VBFA 4KBBA 4QX3A 2GC0A 2WN3A 4IL7A 4D7YA 3Q9OA 4OUEA 2D97A 2W5FA 4JDMA 3RVHA 1QJX1 4R9DA 1RHI2 2QQNA 2JG8C 3H7YA 5A6XA 2E6VA 2VULA 1ULDA 3VBSC 3IAQA 1WA6X 4O65A 4Q4X2 5LA9A 1YFUA 5IWFA 4DB5A 1Q8SA 3EJKA 2ZGLA 3WINE 4MZUA 2BWCA 1EAH2 1YQ8A 3VHPA 5FREA 4HXCA 1UU4A 3THTA 4IV3A 3HOBA 4BQ1A 4LNVA 5EHDA 1STMA 4LKDA 1O3SA 3MIFA 3RJRA 1LEDA 3WV6A 4INDA 4AI8A 4K40A 2ZOEB 3KHCA 3M1HA 3RDIA 1S0FA 5FJKA 4XJ9A 5C70A 3T0DA 4OHVA 1MQTA 1F4HA 1XC6A 1W28A 5A7NA 3WG2A 3R0RA 1NA1A 1I5ZA 2O0OA 2Q30A 3BN6A 3P5BA 4Q4Y2 1W9YA 1W06A 2E31A 2D43A 2R062 1QJU3 4W8JA 4YVWA 2YUEA 3IIIA 4ZS2A 4Z07A 4COZA 4AFCA 4QX7A 1RUC3 3T09A 4BMEA 4DXRA 1H2KA 1VAKA 1C5HA 1W2AX 4K1ZA 1YXWA 2YFZA 1CZSA 2NMOA 3I3BA 2VZRA 4V2VA 4FOVA 3RGBA 3TEZA 5I8TA 4DEQA 1X50A 3A0NA 5LATA 4AEKA 5IVVA 3AMNA 3S57A 3SQOA 3AJYA 3D8CA 2XL7A 2VUJA 4BLJA 4O9EA 5IJRA 3AZXA 1QXRA 1SDWA 1COV1 1JOBA 5A3UA 5IATA 5FXWA 2HWF3 2VM9A 3NVCA 2A6WA 4EN7B 4JKLA 4XCAA 3VBRA 2IXJA 2BV4A 3HQXA 3WF0A 1DQ4A 1NKGA 5CFDC 5FZDA 3RMYA 3VD5A 4XYXA 1DCSA 1H8VA 4PBPA 4YVSC 4HKLA 4DPNA 1HJFA 4QQOA 5GZCA 4Z2AA 3HEIA 1TMF3 2XWBB 2ZGPA 3OBAA 1WW4A 5IFPA 4AVAA 4ASKA 3TNPB 4A44A 1HXS2 1ND3B 2W52A 4HMZA 3USSA 1HN1A 4BQ2A 1ND2C 1QJY1 1EPZA 4LHNA 2D40A 2IXKA 4NHKA 5EV7A 5K0UC 2VJXA 5LK5A 1VBA2 1QF3A 1A6CA 1WD3A 5EJZB 2VE1A 1DFQA 3N7MA 5J96B 1MS5A 1ODNA 3WDTA 2RM22 4PBOA 1XYOA 2UY8A 2ZZJA 3ZSKA 1QOTA 4FPGA 1UPSA 2WFF3 4HN1A 3IDBB 5C9AA 1JTZX 2WLQA 1H8TB 2J1TA 1WBLA 1X36A 1ZZ6A 2ET7A 2VL4A 2Z5WA 2QQJA 3CKHA 3CMGA 4YW6A 4IGOA 4IEWA 1OA2A 2W1WA 4Q2FA 5H9QA 2ARAA 1KRIA 3I3DA 1VBB2 3RZLA 1OXCA 2VCBA 3H42B 2DTYA 5IVJA 4D7TA 5EFUA 2RVAA 2WAAA 3RG0A 3WNXA 1DDLA 4GKXA 1UX6A 1GQHA 4CA9A 2WAOA 4XBLA 4PI0A 4K21A 1MEC1 2R071 1JYTA 2RS32 2WUHA 1TVGA 3DUIA 3BKZA 1ZA7A 4Y1ZA 3U0ZA 2EXHA 3I54A 4FQ4A 5CG9A 4COWA 3D6EA 3CQOA 3PJQA 2XBO3 2ARBA 2NQYA 3P1IA 2Q8OA 1OOPB 1QOOA 1C28A 2G9ZA 4I09A 4QPGB 4MUVA 5C3OA 1Z7S3 1OVSA 4MADA 5EYXA 2BBVA 4AI9A 2Z79A 4N7IA 1OD5A 2ZX1A 3CL1A 4KI5M 4OZXA 1UY1A 4PIYA 4Q0VA 1GP6A 4P9GA 4JHZA 1LB2A 1R082 1W99A 3FZ3A 3MIGA 3SH4A 3N4MA 2FDKA 4GD4A 1C8M1 1NXMA 4YARA 4NHMA 4IUGA 4BHPA 1Y7BA 4QAWA 4F7ZA 1JW6A 2EA7A 1ULEA 3DCQA 3HNBM 3VDDA 1UNBA 1OQEA 4FQZA 3O1UA 1HB3A 3VLBB 4ZHNA 5AFEA 2YPDA 2WZR2 4XUNA 1RUI2 2VCMA 1DLCA 5FLJA 5J7MA 1O3TA 3GXUA 1Y3TA 4GB32 2DCJA 4NIHA 3IBMA 1BZWA 4LOSA 3B9CA 3MW4A 4DQAA 3OD4A 3SLIA 2A71A 2EIBA 4QPGA 3WDUA 1VPHA 4LIVA 4CDUB 1YUDA 2YHJA 4K6BA 4AQ2A 3IPVB 3JXSA 1O8SA 3H3ZA 2BFUS 2ARXA 1EP0A 2NN8A 3AP4A 3I2JA 5FYYA 2YMZA 3OGVA 2YBSA 5LY1A 1DF0A 3LDBA 2QE3A 1AUYA 2EVXA 4H7MA 2ORXA 3FHAA 2HBTA 5C3PA 1RUH1 2OA2A 2OW4A 3AM2A 3WG1A 1TNRA 2UWBA 4PDWB 5F2SA 4YZ1A 5T3NA 1QKQA 3WDWA 1UZWA 1RUD1 2QZ2A 3LFIA 4MYEA 4N9HA 2VZPA 1E5IA 1W2UA 2QBXA 4LORA 3WDYA 4CU8A 4CEWC 4Q4W3 3IT8A 5FZFA 4FOQA 2W94A 2OKXA 5L9BA 2RR11 4PT6A 5FY9A 1K5MA 1A8MA 1PO22 1RMU1 1AR71 3UGGA 5IK4A 4BZ4A 1V00A 4E27A 2RHPA 4NE9A 3AXDA 5GLVA 3O1SA 2OVUA 3U1XA 5FPUA 3WLUA 4Y20A 2JIJA 4P9WA 1C57A 1OUSA 3PUQA 2W68A 1AYN3 4QKBA 3WVJA 2OT7A 2VPVA 2WSUA 1KS4A 4XUQA 2BOJA 4F8AA 1U5IA 3JCIA 5FV3A 3LZZA 3P6BA 1OLMA 1U5YA 1EPWA 2ZX3A 3JZVA 1ZRDA 3KVBA 2PHXA 4IEUA 3UV9A 4CDWC 4PDWA 3OD0A 5FPVA 4AR2A 1XNAA 2BYVE 3HVDA 1BKZA 1W9FA 2XJTA 4FOYA 3ZXDA 2VBBA 2X5IC 1CIYA 1DU3D 4L0PA 4AWDA 3QLQA 3GHMA 4FTSA 1US3A 4Y1XA 1RUJ2 4ZPIA 1PZ8A 2JG9A 3M8LA 1F4AA 1H9WA 1UIKA 5DG2A 3T2OA 1TNFA 1YJLA 1JS9A 3J8F2 4MXWB 4CDQC 3ZFGC 4CDXC 2Y6KA 2TUNA 1QJU1 2XKOA 3GYDA 1BVVA 5DUWA 4B4RA 1DQ5A 2WNEA 1GWLA 3EB7A 2A5ZA 2NYYA 3H3LA 1RUC1 2VQTA 3HN3A 3HMYA 3N9PA 5F5AA 1MZ6A 2W91A 5H9SA 5A3MA 2JE9A 4XOGA 2C9KA 1NAEA 3PMEA 2R16A 3DEMA 1O3QA 3VDCA 3K46A 5BNNC 4ORFA 4J1WA 1LHNA 4LKSA 4C0BA 5B4NA 3MI8A 1EV11 1A34A 2VBPA 3CBNA 4DINB 1GOGA 2A6XA 2HWF1 2FCVA 2RJLA 5A1FA 3VL9A 5FOBB 1ULOA 2JD9A 1M06G 4KGQA 3NKGA 3C7GA 4ISQA 1RUE2 1AYM2 1QU0A 1Z78A 1GV9A 5BXXA 4TSVA 4XFGA 2RDSA 2XDVA 4FPJA 1DZTA 4AE2A 3M3IA 4P9LA 5EQUA 3QBQA 1IPKA 2ZX4A 3FLRA 1MS0A 3AMPA 3FLTA 3ELNA 4MXWA 5J48A 2B7YA 2XVGA 3WSOA 5L9VA 1TMF1 5DUXA 4L9BA 1RITA 2OXBA 5FCCA 5C8CC 4UW4A 1HJGA 2HBUA 5KR7A 2Y64A 2FDIA 2E51A 1O8PA 4AW7A 5FDBA 3ZPOA 2EF6A 4DMIA 1O4ZA 3VBFC 2VOVA 2D7FA 1DIWA 5F39A 5GKAC 5D2AA 5BNOA 1ODMA 1IOAA 1YRZA 3TN93 1GNHA 3H3UA 1UN1A 4QD2A 3POEA 4BXSV 2DURA 2AYHA 2E26A 3E1F1 4AQ6A 5FZKA 3ILFA 2WFF1 3TBDA 1FMD3 2RDRA 1G86A 3E6CC 5A7WA 2WYFA 3MDPA 1KGYA 5FFOC 2WLPA 4N43C 4QGLA 3POIA 4GXLA 5FZ4A 3BTXA 1RTVA 1V9U2 4LE4A 4X6QB 4YGBA 4YFZA 1OQDA 3RZGA 2WZ8A 4LITA 4IESA 4CCJA 3I2DA 2WYSA 1VLNA 3Q8AA 1R1ZA 5AC93 5CYYA 3HBZA 3SC7X 4OCTA 5A6ZA 1UU5A 3DPRA 3VGIA 1FOD2 3AK0A 4BMBA 4DIQA 4ZZ8A 4DUXA 2DVBA 1KDMA 2HWD2 1XU2A 1CAXB 5FY0A 1NA1C 3VZNA 3WOGA 3AJZA 2GP3A 2XBO1 2DVDA 4XF0A 1W2OA 3RYRA 1SFYA 4UFKA 5LRRA 4YVWC 5HXVA 3PVNA 4AGRA 1BBT2 5M0TA 1GZCA 3KCYA 1U5ZA 1Z7S1 1D4M3 1FT9A 1V6JA 2FDHA 1XB9A 5FMOL 4IEOA 2D5HA 1W6OA 2ZGTA 5C3RA 2GH8A 2VMFA 3J7HA 2AH2A 5CNAA 3N9MA 3OBZA 4UF0A 4B1MA 3B00A 3H50A 5FYCA 2DUPA 4LEJA 1SFNA 1A78A 3ZXJA 1IS5A 1NCRB 4NOTA 5FPXA 1KJLA 2WO2A 2G4IA 2XONA 3CIHA 3N35A 3WQ1A 3VBRC 2W9XA 5F1RA 3U10A 2W2IA 1YI7A 4IE4A 2WWJA 1YIPA 2PMWB 4JV4A 3WG3A 1VMJA 4Z82A 2BTVC 4OI1A 4FTEA 3B93A 4EN0A 5KXEA 4UFHA 4LBQB 4Q8LA 4XURA 3GBGA 3JD73 4LIUA 1TZOA 3ATGA 3HD8B 1RINA 2AUYA 4AVCA 5FZ1A 3AC0A 1PGW1 4P9IA 1BMV2 1WUVA 3RNSA 1IPJA 1SFPA 4Q4V3 5B4XA 5ABJB 4CXYA 1OLME 1FNZA 2CYFA 1SDDB 2JJ6A 2W87A 4H14A 3OOXA 3SKVA 1SBDA 2PQQA 1BYHA 1QIQA 4I0BA 4RA0A 5FYSA 4DZGA 2VTXA 4AI2A 2ZX2A 1QOSA 1Q5OA 5FP8A 2VG9A 3WCSA 3CJIB 4L2NA 5FO8B 4MGKE 2R49A 3ECQA 3WEZA 1W6NB 4BQXA 1RXGA 1NCRA 2JXAA 3NAPA 3VKLA 5T52A 2WKKA 3ZMNA 5C9AC 1YEWA 1LKNA 3FHIB 5H9RA 5E8AA 4IXLA 4U36A 4CP1A 3NNJA 1VBD1 4I0WB 4Q4W1 4RFRB 3OSDA 3ZSEA 4QU1A 3CZUA 4LBQA 1H4GA 4GIQA 2X8KA 4DXTA 1YNAA 4M0HA 1ULGA 3J26N 2CAVA 1XE7A 1SLTA 5EP9A 2WRAA 2Z69A 2HYXA 2JB8A 3K77A 4JDNA 1UXZA 3K4AA 1UYZA 4NAMA 3PVBB 1AYN1 5DDJ2 1QH6A 4IETA 2BP6A 2ENRA 4QX5A 1RUF3 3B01A 4S2DA 2ZMNA 1GZWB 1UX7A 1CAVA 1Y9GA 4LO5B 3CJIA 2VOTA 3ZKUA 2CV6A 4Y5SA 5GLUA 2R043 5CVRA 5C4WA 2Q1ZB 4M3CE 5CEHA 3KV9A 1OC1A 2BJSA 2JWPA 4XBNA 4F83A 3ILRA 5LWBA 3T0AA 1YI9A 4D0QA 1CVNA 1QWRA 1YWKA 2V4VA 5A6QA 2AC1A 2XHKA 3DXUA 1Q8QA 2B46X 3H9AA 2CNAA 1WCQA 1UZ0A 1DGWX 1A8DA 4XFCA 5SV5A 1SACA 2LS6A 3VDDC 3M2MA 4BA6A 2L9LA 1W8HA 4E2SA 4OHYA 1ASJ2 1LULA 1S1AA 5A1LA 3DYMA 4UBHA 2VBDA 4RHV3 4UI9L 2PHWA 1E5SA 3QH6A 2B4KA 2K9ZA 3POGA 4EN9B 5I0RA 1AHSA 4AEDB 4AHXA 3B3QE 3M4FA 1PIV3 3BODA 1W6MB 4A7KA 4C90A 5FYBA 1CWPA 2FDJA 2ZA9A 3AYAA 4OZOA 4QPGC 1GZWA 3BU0A 4XHBA 1GSLA 2V73A 3NSTA 1E57A 4XBQA 3CZJA 5A33A 3UL2A 2X29A 5DAWA 4AK3A 3ZXGA 1L7RA 3EMRA 2VD7A 1CESA 1PO13 3B02A 2MPFA 3KGZA 2B8MA 2W0XA 3KGLA 1JU4A 4QB2A 4CCDA 1VP6A 1NZCA 4RN5A 4BQ4A 2J1AA 2P4EA 4KWKA 3VZLA 1H4HA 1ENQA 3G6JB 3U14A 4AG4A 3ZN4A 5JXIA 3R6SA 2VMGA 2MNGA 2Y26A 4E2GA 4GH4B 1SHWB 3POBA 4HONA 2WT0A 3EHKA 3LB9A 4Y22B 5F5QA 2QTWB 1N1SA 3Q8CA 1YYNA 2UYBA 4QPIA 5GZFA 4UFIA 4FAHA 5GZGA 2OZJA 4Y33A 2ZGNA 1EYBA 4J6GA 1AXYA 1K5MC 1WMEA 3NV1A 4UBGA 3W9AA 3VBOB 3WP5A 4AI3A 5FYMA 1Y43B 1W6PB 2BOIA 3NV3A 1GOHA 4E8CA 1PNFA 2W95A 2PHTA 4MO3M 2PTMA 3IM0A 3MPPG 2BGOA 1XYPA 3TN91 5CISA 4ATFA 1EY2A 3VDAA 1F8VA 4DUWA 5J3UA 5FKBA 4N53B 4J1XA 4XTMA 3GBFA 2ZS6B 1FMD1 4GJYA 1S0EA 2VMHA 2HWB3 2B42B 2A3WA 5BNQA 4OMDA 1X8MA 5HV4A 3G7DA 5CKQA 4M4RA 4LBOA 2QZ3A 3MIDA 4DRVA 2FBEA 4W6YA 1YIFA 1LECA 2IZWA 4COYA 5FZ0A 4ZU4A 2VNGA 3SMHA 1NQJA 2PHUA 4OQ8A 1IKPA 1K12A 2DVGA 4Y22A 1RVF3 1NE6A 2HLEA 3AMHA 1B35B 3H0OA 1ENXA 1UWWA 1WBFA 2JG9C 2P6CA 2RV9A 5JOZA 3UKNA 2G9FA 4L11A 5FYUA 5LK7B 1W6PA 3WW1A 4N9IA 1F15A 1AR82 2WIIB 1VALA 2CU5A 2JDYA 4KGGA 4UYBA 5JSOA 2WDBA 3WF2A 4FPEA 4GJZA 3V0BB 1D4M1 4XQ4A 3ZN6A 3IDAA 5FLHA 4EYUA 5G05L 2HWC3 3ZSJA 3RWNA 1MZ5A 4Z92B 3BIEA 2D6OX 3B69A 5A70A 2DU1A 1QY4A 4GQ7A 1LOBA 1LR5A 3AZWA 1MS3A 2W39A 2TEPA 3M3EA 1DZQA 3CF6E 4NRQA 3EQEA 4NMIA 4L92A 1HRI3 4FI9A 4I01A 3VN4A 1N3QA 1RHI3 5IVCA 4XDQA 2QQUA 2XR4A 1NLQA 3AMMA 1ZZCA 2G9GA 1HDKA 2WJSA 1KJRA 2X10A 3PTYA 4Q4X3 1AF9A 4P5YA 4NWWA 5IUQA 4UOJA 1ZNPA 1H1IA 3N9NA 4QDQA 2ERFA 2VUDA 3GNEA 1S0DA 4NRMA 4NHYA 1DHKB 4Q1RA 5F6LB 1EAH3 2C4XA 4BK5A 3LKJA 3OYWA 4EJRA 2CAUA 2GZWA 2UWAA 4OLLA 3UNPA 4QKFA 2YDEA 2YFUA 4IEPA 1ZVFA 4JGZB 4UWDA 3JD71 2R0HA 3ZFFC 5HI0A 3KS7A 1D2SA 2JDUA 2ZAAA 3SITA 2CL2A 3VKNA 3V0BA 1D7PM 1QJY2 3URFA 4Q4V1 3NQHA 4RD7A 2JE7A 1Y9MA 1LODA 4ONUA 5T50A 1AL22 3OF1A 4Q4Y3 2ZJCA 4XVHA 4AI1A 4AGGA 4A7YA 4B1LA 2JKBA 4IEVA 3RQ0A 2R063 4OFGA 4BM8A 4MV2A 5BNOC 1G9BA 5CG8A 4CU6A 3KCXA 1KFXL 5KHKA 4C0HA 4FBFA 4R4XA 4GAZA 4HSLA 2W92A 1W8WA 3U4SA 4GMP3 1ZA4A 4LLFA 2GALA 1IGOA 1OPMA 3N7LA 5FXVA 4FAGA 5BNPB 1POV0 2I45A 3I59B 2QQLA 1DGWA 3LOIA 3DV8A 4MX3A 2IWGB 4YWAA 3WNPA 5JXGA 3NJVA 4TLFA 3FUQA 4P02B 4BDVB 4WM7B 2GDFA 2BVVA 2QUOA 5DQ0A 5B2GB 3S7EA 2OPKA 4D7SA 1J58A 3VBUB 1WW7A 3TYJA 4MXVA 4LBQD 4AOCA 2ZGKA 5JCTA 3BALA 5K7PA 2GU9A 5FY1A 5EPAA 3POJA 3DPRC 4FOWA 4PQ9A 1X9PA 3WQ0A 3ZXLA 1NE4A 4WM8C 2Y6GA 3GDBA 5FOJB 2KR2A 3AZVA 3MLJA 5L19A 1ACCA 1CZVA 1YQ6A 1RUF1 3WUDA 2LTNA 1PX3A 1UIJA 1JOJA 4XAAA 1BQPA 1CZTA 3DECA 3IN9A 1IS4A 1HXS3 4XJZA 4BK4A 2B45X 4HVRA 1UZZA 3RI8A 3SCFA 2Y8KA 5BNPA 5JIAA 2WR9A 3AZYA 3IMNA 4AAXA 3P3PA 4RS5A 5A80A 4FXKB 4U2AA 2WS93 2RE9A 3BPZA 4BJ0A 4LA3A 1V6KA 1VBA3 1JN2P 3BCWA 4WM7A 4XW3A 5C7GA 3KV6A 3LF7A 4G3YC 2RM23 4YZ2A 4JQTA 2FCUA 3O0XA 2UURA 5I0UA 2ZEYA 4YW3A 1W8OA 2HEWF 1R092 1AJOA 1RUG2 1UL9A 2XJUA 2JDZA 3ZXAC 1C8NA 4FVVA 2B39A 1UPIA 3WNKA 4YNIA 1BEV2 4RHV1 2E33A 3AKPA 1VBB3 2ZZQA 3RZJA 2WABA 2XVLA 3AFGA 3ZFEB 1PIV1 2VO5A 4CP9B 1W6QB 2IXCA 2GNTA 4FP3A 3KT7A 5F8PA 2V72A 4WV8A 5LA2A 5JR2A 4CCKA 1LU2A 4XC9A 1JZ3A 4SBVA 5F5CA 1C5IA 1K5JA 2RS33 1W04A 1ZRIA 3IAPA 1HB2A 3GF6A 2C26A 5C5TA 2Y34A 3QD6A 1QQP2 1U5XA 3E97A 3NJYA 4QPWA 1PO11 3N36A 1LESA 5FZGA 3O1RA 1RUH2 1VBE3 2AR6A 4HL0A 1CAWB 4B29A 2Y6LA 1AX1A 3OBTA 3GGLA 3NAPC 2XHNA 3MLKA 1V0AA 1BHGA 2P3IA 1FAYA 1SLBA 4NPRA 1E5RA 2QQIA 1W39A 5FJHA 5CAZA 4ES8A 1R083 1IS6A 2BERA 2FMYA 3WNNA 3ST7A 4KH9A 3TRSB 3RFRA 3WXPA 1O5UA 2VTXJ 1JUHA 3WNLA 1O4YA 2XLFA 3RI9A 4KWLA 4Q0SA 4MHUA 1TME3 4LBNA 4KWUA 3SHRA 1XPWA 2ZGQA 1UMZA 1H1MA 1LHUA 1DYOA 4K3UA 1YC61 2WZR3 2ZACA 1RUI3 3V56A 2YY1A 3OTFA 1L7QA 3O14A 5L7OC 4Q5OA 5I93A 2MHFA 4QQHA 1NY71 3ACIA 2N7GA 1XXNA 3HQRA 4LK6A 5IVFA 4LK7A 2JDHA 2HWB1 4OULA 5G04L 1G9DA 1CAWA 2QQMA 3LWCA 3CJIC 1CJDA 4EN8B 3I4IA 4R52A 4RR3B 5C4WC 1N3OA 3OPWA 3P3NA 1XE0A 4KU8A 3UYJA 4A3XA 4YZ5A 2DUQA 3AXEA 1UQXA 4DS0A 3KV5A 1OMIA 2RS52 1RVF1 5FZAA 5K8SA 3V64A 1ND3A 2CGOA 3V65A 4MGIE 5IK5A 2OUJA 1O59A 3AB0A 3E6BA 4YW2A 5FZ6A 5FPZA 4R9CA 5GLTA 3SISA 1QNYA 2D6PA 2VUAA 4EWAA 1Q8OA 5TSWA 1RUC2 3ETPA 2PQSA 3AP5A 4UW6A 4JQRA 4RGAA 1FNYA 4YG0A 3R4SA 3UGHA 4CCEA 3VBHB 2HWC1 3I2OA 2ZTNA 2Q8EA 1H8TA 2D3RA 1PO23 2AEYA 3HT2A 4K8FA 1EV12 4LA2A 4BB3A 4BLIA 5L36A 3S0MA 3BB6A 5KC6A 4HVQA 1CGPA 1HRI1 4UFLA 1RHI1 1IG3A 2ES3A 5FYVA 4ARXA 1L3JA 5GZDA 4AQTA 5D8AB 3FMGA 4Q4X1 4QGMA 2QNKA 1ULCA 3FX3A 5D21A 3THCA 2OQ7A 4LTAA 3A22A 1W0PA 1EAH1 2R7EB 2QQOA 1JHJA 1WZXA 2J1UA 2Q1FA 1OA3A 1JMUB 1OOPA 5K9YA 2VMIA 4S2GA 3X29B 1PNGA 3RZKA 4FPCA 4YG3A 2Y0IA 2YU2A 3ZSMA 3ZYBA 1OF3A 4QPIC 5ISLA 2FD8A 2RG4A 1S0JA 4EQVA 3E5XA 4ISRA 3ACFA 3W5NA 1RUJ3 5C6CA 2P2KA 5FK7A 3ILNA 4Q4Y1 3J8F3 2HJIA 3TOJA 3U75A 1QJFA 4AGVA 2R061 1US2A 5FP4A 5FZ3A 2WN2A 2BNNA 3WQBA 1PGL2 1WLTA 4XDPA 1AR92 2WFF2 4IEYA 2LM3A 2OIIA 1UMHA 2RS13 1UCXA 4QQLA 5I0TA 3MV01 3WD5A 4JGYB 1UY3A 4GMP1 4AEJA 1VMHA 1PM4A 5D8AA 3B7MA 5FZLA 4R8HA 1GNZA 2MEV2 2AGSA 2XOMA 4BXFA 3HT1A 2PYTA 4GALA 2P17A 3ZR6A 3FBYA 3AFKA 4BWOA 4CXWA 1LHVA 2WFPA 2WQ4A 4NO4A 5DUUA 4AVVA 4CDUA 1RUE3 1B09A 2HWE2 4TLGA 1AYM3 3IPVA 4CSWA 4FSJA 1FX5A 1TE1B 4MGZE 4PF1A 1O5LA 2XVKA 2UU8A 3KT4A 1FPN2 3LOBA 2V4AA 3ZKYA 5A1AA 1ZYBA 1D0GA 2WQ8A 5JAXA 4IV1B 4LT5A 1GBGA 3I2FA 1VRH2 4S2FA 3ASIA 3O0VA 5ERLA 1HXS1 5E6HA 3VHRA 1LENA 4BE3A 4XF4A 5JDBA 3T30A 4IW3A 3USUB 4WBBA 1QJZA 3GZTB 4AZZA 5HBAA 1QDCA 3RPQA 3NRUA 1XNTA 2NM1A 1UZYA 2WS91 5ACA2 1HX6A 5CKMA 1WWYA 1VBA1 1PMIA 3D5OA 1CPMA 4BPZA 3JQXA 5FTTC 3OJBA 1X7NA 1ULPA 2YC2A 1GU3A 3PNAA 5CZKA 3ZYRA 2FZ2A 1H2MA 4CTEA 3NV2A 2D6LX 3T08A 2VZ1A 4E4SA 4CXXA 1V6IA 4FXGB 1MZEA 3O0WA 3PHMA 4UAPA 2Z4FA 4XCBA 4QHBA 3T0BA 4XILA 1V9U3 1VBB1 3I3EA 1VJ2A 1PVXA 2IC1A 2QDNA 4IV1A 4LBLA 1RUOA 2JICA 4HVOA 2IFRA 5FZMA 1FOD3 2RS31 5T5LA 3MW3A 4ATEA 4YZ3A 3FL7A 3VD4A 2HWD3 2KD7A 2XJQA 3W59A 2A6VA 1SCRA 1HB1A 1XRUA 1G9FA 2P3YA 1XE8A 4UFJA 5EJ3A 2J1SA 1PHMA 1VBE1 3H1MA 2VU9A 1BBT3 2WZEA 2YGLA 2PA7A 3JU9A 5F3CA 1QXJA 3I2KA 4NRPA 2LROA 4FTBA 2QFEA 2XLGA 5LBEA 5IVEA 2YXSA 1VBD2 4ZU5A 4CZSA 1LHWA 4KNCA 3BGAA 2VTFA 3WDXA 4CCMA 3VD9A 3FFQA 4Q0PA 3VD7A 1R64A 3E5QA 2BPA2 1K45A 1NCQB 4WVZA 4CYDA 4GWMA 3N3HA 1YHFA 4MVTA 4PLOA 4XF1A 5FAXA 1HQLA 2GC1A 2VQAA 2Y0OA 4B3NA 4E4ZA 1MVEA 4A41A 3V0AB 4A2UA 3NNGA 4YLZA 3ZYIB 2YC0A 5JWPA 1TME1 4YZ4A 5JIUA 1UY2A 1C1LA 2YGMA 3WR0A 3MEPA 1K42A 1F35A 1ALYA 5FMBA 4Y5Z0 4ZXEA 3BTZA 2WZR1 1RUI1 1N1YA 5IAVA 2VVDA 5APAA 4AHZA 3ROUA 5JSRA 2EIDA 2XJRA 4G9SB 3VUOA 2C6SA 3RWKX 1JHNA 4QXCA 5A7OA 3NKTA 4Z8BA 1UKRA 2FMDA 3AMQA 1ZBA2 1UOGA 5GZEA 3VD3A 1C3HA 1A3KA 1LOFA 4IV3C 2JG8B 1ST8A 4ASMB 3VBSB 2NMNA 1W8FA 5T55A 5BNPC 3R4DB 4HG6B 1PK6B 1WMDA 2WT2A 4RS5C 2PAEA 1W8NA 2WNUB 5F3IA 1O6UA 2EXJA 1NCQA 2OZ6A 2VZSA 3OGGA 1JZ8A 2EXIA 3ITQA 4IERA 2WZPP 2F17A 1MQTC 2PXJA 3PVOA 1CAUB 1GWMA 2DVAA 3MFCA 4JTOA 3VZJA 1OH4A 4ZU7A 4EWDA 3V0AA 3POSA 4XFAA 5FPLA 4C8DA 3WDVA 3TEXA 1W8UA 3AP9A 1G8WA 3JUUA 2TNFA 2WBKA 3AKQA 3LAGA 1HB4A 4MGSA 3WZ1A 2A6YA 4QDSA 1ENSA 1IKQA 3H1WA 3KWVA 2WO1A 3U11A 1GKBA 4L8QA 2YB7A 3RZMA 1PO21 2GNBA 3K2OA 5KXCA 4A3ZA 4I2OA 1X82A 2ARCA 4YYOA 2H6BA 1O7FA 1W0NA 5LASA 4D8MA 4QHZA 5ANNA 3QH7A 3S5QA 3LA7A 3LD8A 3VBSA 3WF3A 3O7OA 1PK6A 5DDJ3 5J1XA 3AVSA 4M00A 4XZUG 1S2BA 2EIGA 2WNUA 3N7JA 1D4VB 4I30A 5C3QA 4META 5FY8A 2QCSB 3OG2A 1VE0A 2RMU2 5A7SA 4AFBA 2XQXA 1CAUA 2JDPA 1CAXA 1S0CA 2JENA 1J84A 4Q0QA 4COVA 1POQA 2CWSA 4HLTA 1CD3G 1H2LA 4K20A 1ZREA 4FFGA 3SH3A 2DFCA 1OLRA 5CKNA 3O1PA 2JX9A 3WT3A 2VW0A 5CFDB 3RZZA 3K75B 5A7PA 4HANA 3DL3A 1R1A2 3POYA 4E8DA 1AR62 2WA4A 1UO9A 4YVSB 2E53A 3C7EA 3KVAA 1RUJ1 3L2YA 3LEMA 4BIFA 4CEYB 4AF9A 5A6YA 1LJ7A 1JYWA 2P6HA 4HK9A 1UAIA 2Y6HA 4ZKTB 2J22A 2IXLA 3J8F1 4GWJA 1JODA 1DP0A 3S7IA 3UJOA 5C8WA 3LSEA 1ASJ3 3LSDA 1N47A 3FWEA 4FT8A 4NWVA 1UXXX 1U0AA 1KEXA 2RS11 1D0HA 1ND2B 3H1YA 4HBNA 3AP6A 4TZDA 5DABA 5DN2A 3ES4A 5E16A 5K0UB 4JHTA 5DZFA 5DZEA 4Q26A 4AVSA 5JVVA 2F4LA 4A6SA 1SPPB 1UKGA 3D4KA 1JXNA 2IXIA 1UYXA 2A75A 2QJVA 4M01A 3ZX7A 5IFTA 1J3RA 1SCSA 1UZVA 2XLAA 3KQRA 3OUIA 3B9IA 4QX0A 4W4ZA 2RDQA 5KBFA 2WO3A 4CUAA 5FZOB 3I2IA 1RUE1 1ND3C 1AYM1 2VNVA 2H6CA 5ABJA 2FQPA 4CEYA 1ZBE2 1LCLA 2WINB 3ZXKA 4XUPA 4LKFA 4IGPA 4D6RA 1H0BA 3KSCA 3LIGA 5EYYA 1F31A 1D4M2 1OF4A 1T6BX 1S0GA 2A1XA 4LBKA 3ZSLA 4CUBA 1V70A 5FY5A 5AC92 1YQ2A 1QXPA 5I8SA 1W6NA 4QT6A 1HV1A 5IAXA 4LLOA 2RJKA 1ND2A 4P5HA 1H8TC 4Y1VA 1JH5A 5KHJA 1MVQA 1HLCA 2A73B 5FKCA 3T4HB 5KC5A 1RC6A 4GWNA 4NHLA 5IVBA 1HRV3 3BUCA 2DV9A 2ZEZA 2ZGUA 4TXWA 1H6XA 4DEVA 4EZHA 3N7KA 1RXFA 1V6OA 4OVEA 3WUCA 4BQWA 2R0FA 3EYPA 1WW6A 3THPA 4GKYA 1FXZA 2YROA 3VHOA 3W20A 3ZDSA 3KF5A 3O12A 4E4DX 3GJAA 1X9TA 3LDKA 4Y24A 3ABZA 1RL3A 3GZAA 5JUVA 2K2SA 4X8PA 3RZHA 3B94A 3I7DA 3L9JT 4I02A 2ZMLA 1Q56A 3I8TA 3IMMA 3ZYFA 4BH9A 2PAKA 3POFA 1V9U1 5JOYA 1YQ5A 1JZ4A 1L7LA 1VBC2 1OOPC 3U78A 2H0BA 1I3HA 3BVCA 1KQRA 2G19A 4Y1YA 3T3YA 1XNKA 4QHOA 1MPXA 4A6OA 4AVTA 5IYYA 1MR5A 2Q5TA 5DPNA 1FOD1 2DCKA 3Q8FA 2DU0A 4COUA 4KBZA
chains in the Genus database with same CATH topology
2HWD1 3D82A 2ATFA 4QM9A 4YRDA 2XJSA 4QGNA 4HK8A 1QHDA 1AR83 1PVC2 4XFFA 5CFCB 4FCAA 1BBT1 1Q43A 4LUKA 2BEOA 1OHFA 1ZRRA 4JRLA 5D8AC 3W58A 1TQ5A 5T5OA 1DQ0A 4KG8A 5EZWA 4QM8A 3MW2A 1DQ6A 5F6KA 4Z1VA 1X33A 3APBA 3JBG2 5JOWA 4AEDA 4FP2A 3KB5A 1HKDA 1W6MA 3WW2A 2A7AA 2R1DA 1TEIA 4CEWB 2B5HA 5BY5A 4W65A 1QJX2 1J59A 4CDUC 2GSYA 5D1IA 4NVPA 3TB0A 2D6MA 4WVMB 1XNCA 1S0BA 4NN0A 2W08A 1H1AA 4MSVA 5CFCA 2PLV3 1V6MA 4OUMA 2I2SA 1XNDA 4PDWC 4EWEA 1BMV1 4XJAA 5IK7A 3OPZA 3AP7A 4GH4A 3E6DA 1DYKA 4YW4A 3AYEA 1AL23 3LGRA 4FPYA 4GA9A 3NWKA 1GANA 1CX4A 1XYNA 3M70A 1VIWB 4CDWB 1LGBA 5FMOS 4O9GA 3WW4A 3VBOA 1WCKA 1G6NA 4CEWA 1LOCA 1ZZ8A 3D0JA 1KITA 4XFIA 4YGCA 4PF5A 1APNA 1MS9A 4HPKB 1MS8A 2D98A 5DXDA 2EAKA 2XH6A 4XJUA 5IT6A 4N53A 5DG1A 5I91A 2CGPA 1MZFA 1FV3A 1V6LA 1QMJA 2GNDA 4H7LA 3ZFGB 4CDXB 1NOVA 1COV2 1PZ7A 5KHIA 3WW3A 3ACLA 4ASLA 4YG6A 4WVVA 4B4PA 2QDRA 2ZPXA 3INAA 3QOPA 3RJ2X 3UKTA 5DDJ1 5BNNB 3MIBA 4KG0A 1B35A 2HEYF 2GN7A 3FC0A 4FPLA 5DZGA 4HKWA 2E7AA 1AXKA 1ZM1A 1CJPA 2EAAA 2BUKA 1JYCA 3VHNA 4HPKA 1VB2A 2GC3A 1S55A 3K48A 3NJZA 2ZHKA 3DN7A 3IWZA 3ZIWA 1RIRA 2VECA 4R9BA 5C8CB 4AFDA 3FLPA 1R093 1RUG3 4KU7A 5E89A 1ASJ1 1DGRA 3JQWA 1BEV3 1URXA 1NLRA 4HETA 2BNOA 3VBFB 4P9JA 4QQPA 3SCGA 3MGUA 5DUVA 2VOKA 4RFT0 2AREA 1FYUA 4D94A 3LCPA 4AFMA 3BU7A 1OLQA 4OHWA 4L99A 4TWTA 4Q1PA 2C9AA 2PHDA 1MEC2 2WQZC 4JGZA 2R072 1QQP3 4L97A 1GFF2 2A3YA 4EV0A 1NCQC 4N43B 3O5SA 2NP0A 4LO4B 2BFUL 3C2UA 2Q1MA 2P3KA 4YFWA 2D93A 1SQ4A 4C1XA 1CPNA 2ZMKA 3WP3A 5KXBA 2ZBJA 2Q4SA 2R041 4A7ZA 1NA1B 2R32A 1DG6A 4XXPA 3I59A 4LE3A 4I3PA 4YVWB 1C8M2 1J3PA 1HRV1 1HRI2 3FUOA 2WNVB 3VBUA 1PK6C 1AZDA 1RJ7A 2WNUC 3UK9A 4N43A 2DWRA 5H9PA 3PVEA 1IQAA 1DQ2A 4URTA 1I6XA 1UU6A 3AKSA 4Q0UA 4K7JA 1CN1A 2ZHMA 4PLMA 3VBRB 4R9AA 3BOPA 4MH0E 2ILMA 2PHRA 1SLAA 1XNBA 5FBZA 2RS53 4XPVA 4E2QA 4AXOA 4KL1A 1AX0A 4UW5A 2CWMA 4AEMA 1WLDA 1AR81 4XETA 5BV6A 2K0GA 2VOWA 1RUD2 1NCRC 2WNVA 1YFXA 4FPOB 1QNWA 3E5UA 4RSUA 1IS3A 1POV3 3HN1A 4OHXA 4Y1UA 5JZGB 2RR12 1EV13 5BYNA 5BPXA 1C1FA 1RMU2 1AR72 4N90A 1U12A 1CONA 4W6WA 5C9AB 4V1PA 4C91A 3ZFEA 2ZABA 1HIXA 2Z42A 1W6QA 1XQNA 3HAGA 4YW5A 5FQ0B 1SBFA 4JAAA 3KLSA 1DQ1A 4AFAA 5I8YA 5ABJC 2BGCA 3L2HA 4M0NA 5FO7B 4CEYC 5HCBA 1C4RA 1SEFA 4GB33 4JC1A 3SNMA 3POWA 3KM5A 4LULA 5E88A 3DKWA 4AHYA 1PM7A 2A6ZA 2ZHLA 4XFHA 3ZYPA 2GC2A 1N3PA 2PLV1 2XJPA 2E7QA 2UWCA 1N1VA 3IDEA 4XIOA 2DFBA 2A70A 1I9RA 2V09A 4YGDA 1Q3EA 2DUOA 2WS92 1OQ1A 4ZXKA 1AL21 5JZGA 1WCDJ 3IIAA 3HIFA 3LA3A 4CRQA 3ME2A 4IQPA 4FPKA 1AR93 4XZPA 2EXKA 1QJU2 5FQ0A 2ET1A 2BQPA 4OUSA 3OBRA 3S6PA 1LRHA 4JRAA 4DRRA 1OI6A 2MEV3 2GNMA 4P14A 3ZYGA 2ZGOA 1O3RA 4UXAA 1X8EA 3VDDB 3T1MA 2VOXA 2HWF2 2HWE3 3GALA 4RR3A 4SLIA 4LBJA 1XU1A 5T54A 4B8EA 2LUWA 4JVAA 2C1FA 1ONAA 4G4FA 2GMMA 1OSGA 1VBE2 1ZZ9A 1FPN3 1PGSA 1WGPA 4WVWA 3M3OA 1UF2C 3AKRA 2SBAA 1LEMA 1VRH3 2YV8A 3KCCA 1TMF2 3U4XA 4OI4A 4Q27A 1KFUL 1S0IA 3MIEA 4LO8A 5ACA3 2KXLA 1FATA 1HV0A 4Q8KA 2PHFA 3VBHA 4AEDC 4AVBA 5EWSA 5BUVA 2YYOA 1SBEA 1KD7A 1TME2 4LR4A 4XF9A 5GJ6A 1R091 1RUG1 4XMAA 4QQ2A 2GN3A 2HYKA 3QCWA 1BEV1 1K5MB 2I74A 1AVBA 2VNRA 2CTVA 4B7KA 1BCXA 3PJYA 3RYKA 1F5FA 3H7JA 1F5JA 1D2QA 2QVSB 3R05A 3CNAA 4Y20B 5CFCC 2QKDA 3MF6A 2JD4A 1ZZ7A 3VKMA 4UW3A 4GH4C 1W0OA 2BWAA 4PIXA 1QQP1 1VAMA 3T2TA 2ZKNA 3IDCB 3WP4A 2R6QA 3BTAA 3MF9A 3ETQA 1LGCA 2XBO2 3NW4A 5EXOA 2VVFA 5HCFA 3VBOC 1VBD3 5JI9A 1Z7S2 2D6KA 3VV1A 5C33A 1HQWA 2D3PA 3ALQA 2JG9B 2OYZA 4ES9A 4N53C 4JGYA 1DZRA 4HKOA 3BIWE 1M4WA 4YM1A 3SH5A 2C5DA 2AZ5A 4R4ZA 4RQPB 3KT1A 5LRSA 1Z0HA 2RM21 2F6BA 4XMIA 5I0SA 1ULFA 2O8QA 1IHMA 3ZVXA 2HEVF 4RL7A 1B35C 1ZBA3 1JYIA 2E9QA 5A3LA 1WMFA 4H3WA 3ZXEA 2R1BA 2VW2A 4M3CB 4HN0A 1PGW2 2FZ1A 3K51A 4IEQA 2RS51 2WSVA 4OI2A 4B7EA 2LALA 2WA3A 4DFSA 4M3CF 1LHOA 3BOWA 3OCPA 3WHUA 2QQPA 1ENRA 2D6NA 4MLOA 4PIZA 1REEA 2WWSA 3USUA 3ZFFB 5JR7B 3IKWA 2PELA 4I0AA 5KXDA 2P37A 4RQPA 5GALA 2RS12 4DXZA 1VAVA 4N7UA 4WZCA 4XEZA 1AX2A 1REDA 4Q4W2 4PJYA 1H30A 3WX5A 1POV1 5BNOB 5JOXA 1R081 2BNMA 2P3JA 3OY8B 5JLVA 1CQ9A 2C0ZA 1DBNA 1VR3A 5KHGA 4JGZC 4BOWA 3FJSA 4M3CA 4IEZA 3WCRA 3GBWA 4P9YA 5LEKA 2UYAA 1AYN2 1F9KA 1NYWA 5JI7A 3TWIA 5AFBA 1ZRFA 4DOUA 2RMU3 1QDOA 3AKTA 2NZ9A 3MYXA 5T5PA 4GB31 1NLSA 3ZFFA 3NL1A 5GLWA 1KXGA 3DPRB 5J37A 4XIKA 4HZFA 4X6RB 1MS1A 1OFSA 3FE5A 3TAYA 2V5YA 5FLIA 4WM8B 1R1A3 1AR63 2Q0AA 3AZZA 4YGEA 1OFNA 3KMHA 1PZ9A 2XL9A 1RJ8A 1WA4A 4XXAA 4HSJA 3OY8A 3J4UH 4WM7C 3AX4A 2JEMA 1PGL1 1W6OB 1AR91 2ZGSA 2DCYA 3VBUC 5IK8A 1MACA 1SLCA 1CIWA 4AYUA 1FI2A 4Y26A 2XKPA 3NV4A 2KM2A 2MEV1 3CO2A 5CBLA 1BJQA 3ENRA 4IEXA 2ZHNA 2XWJB 3DGTA 3MPBA 4XF3A 1OKQA 2WC2A 2IFWA 1J1TA 4FO9A 3T1LA 3NO8A 2HWE1 2JG8A 4WM8A 4EN6B 3MLLA 1UW8A 3FBMA 4XQDA 2F4PA 1ZBE3 5A32B 1T6GC 1FPN1 4AHWA 3FFZA 2ZGRA 1AL0G 5AC93 3VZMA 2WNVC 2EALA 1VRH1 2D3SA 1GLHA 4C1WA 2ZAHA 5KHHA 4HT1T 2FHRA 2TBVA 5KWRA 1SLIA 2BVBA 3OGJA 4Z2WA 1VB4A 3KD4A 4QMAA 1GICA 2E63A 5ACA1 1QH7A 4LO6B 4BIOA 3NAPB 5JSPA 1Y9QA 3ZFEC 4KWJA 1IZ3A 1LTEA 4FPHA 3A0KA 3WG4A 3TN92 5CB7A 3PLQA 1KDKA 3VL8A 2VY0A 1J3QA 3PMSA 1ZX5A 3TNQA 2PN5A 1FMD2 2CGNA 3EXUA 5A32A 2XUMA 1CR7A 2DCZA 5SV8A 2DTWA 2XG3A 3ES1A 1VBC3 2XJVA 4JCKA 4XJ8A 3A4UA 1RGSA 3ZO0B 3KZ4C 4LO7A 2GAUA 1AJKA 3EO6A 5L7OB 4W6XA 1I1EA 3M3CA 3SXWA 1AXZA 5JZGC 4QXKA 1CAVB 5CFDA 3LA2A 1PVC3 2VGDA 5C4WB 4YVSA 2ZX0A 1WD4A 1NG0A 4BYYA 3VZKA 2UY9A 4PCRA 2ETEA 1YJKA 1QGLA 1G9AA 3DF0A 2VNOA 4D3WA 3JBG3 1WLWA 1UD1A 3SCHA 5CADA 1V6NA 1BK1A 5K0UA 2ZCWA 1BXHA 1GQGA 5CIRA 1QJX3 1RB8G 2PHLA 4RR3C 1DGLA 5J98B 1ZRCA 3H8UA 5L7OA 1NXD1 2VW1A 4OI0A 4HFSA 2O8OA 1SMVA 3CLPA 4B4QA 4K1YA 2DF7A 3JB8A 1F2NA 1S2KA 4DNYA 4JDOA 4DY3A 1ZBA1 5A33B 3JD72 3GHNA 2O1QA 2NPIA 3HWJA 4PLNA 4Q4V2 4YSFA 1YFWA 2VVEA 4H55A 4K9SA 4XHXA 5GM0A 3VBHC 3RS6A 3JB4C 3ZPYA 3J9SA 1DGRN 1BVP1 4CP2A 5L73A 5CU1A 4QPIB 1RUNA 1LU1A 2AENA 3AYDA 2R30A 3CEWA 1Q8VA 4P9XA 4LHLA 1JBCA 2Y38A 3UJQA 1COV3 3D0SA 4ITCA 4YM0A 1NQDA 1ZZBA 2JECA 1GR3A 2KA3A 1DYPA 2X53S 4XQWA 1YFYA 4I3GA 1FV2A 1Q8PA 2RMU1 3MICA 2BW8A 1RUF2 3VKOA 1HQNA 3B5LB 4E9KA 4WZFA 4LUMA 4D69A 2R042 3CU7A 3WHTA 2YPJA 4DY5A 2DVFA 4AQSA 1QJY3 1R1A1 1AR61 4JGYC 5GLZA 4MGYE 1HRV2 5J09A 1MS4A 1YCIA 3M3QA 4F3JA 2D44A 4BCUA 3QACA 3RRDA 1LOAA 1WLCA 1O91A 3ZN6B 2IXHA 4TYSA 4XTPA 3MFAA 4JTNA 4GMP0 2YZ4A 3VKFC 3AYCA 2X5IB 4RHV2 2WL1A 3HR9A 1LOGA 3ZXFA 5LEJA 1LOEA 3R4UA 4X8NA 5T5JA 3U07A 1PIV2 3S30A 4XE9A 4WVMA 2VH9A 3VZOA 4CDQB 2PAMA 2XB6C 1MEC3 2R073 4IV1C 1GYKA 3GZUC 3C3VA 3UKVA 4YM2A 3OYWB 3ZMOA 1HW5A 1H2NA 1GZ9A 1PO12 1G9CA 2P34A 3WQ7A 1ZBE1 4XFBA 3RMXA 3RYPA 4Y4YA 5JPNB 4COZA 2GH2A 4GULA 2B9UA 4AI0A 4RQPC 2GMEA 1WCSA 4CDWA 2SLIA 4S2HA 4EROA 5AC91 4QPYA 4NR1A 2CY6A 2ZKLA 2X5IA 2DYCA 4RGGA 1REFA 2I07B 2VXRA 1C8M3 1OA4A 3ZN5A 2VQ0A 2NLRA 3MIHA 5F9TA 2A3XA 4CDQA 3ZFGA 4CDXA 2DCTA 3M7AA 5JMCA 3CJXA 1SLLA 1WW5A 1O4TA 2XGXA 3EBRA 4LBMA 5AVPA 1NY72 2OUHA 2GMPA 2HWB2 4FPFA 3ZIXA 5BNNA 1J1LA 1KRIA 1YLLA 4OHZA 1YO8A 1VBC1 2PLV2 3WP6A 5CA6A 2ZGMA 4CP0A 2E7TA 4YM3A 1LOFC 2D5FA 5AVAA 5FRAA 1RVF2 5JPMB 1G7YA 4Q29A 1RUH3 4KQ7A 1PVC1 1N1TA 1H9PA 4IV3B 1KS5A 3RSJA 1RUD3 4LHKA 2H0VA 4YW1A 2HKXA 2WT1A 5FO9B 4RS5B 5C8CA 5E1RA 1DLLA 2HWC2 3WY6A 2XPJA 4QU2A 2RR13 1MQTB 3ZYJB 5J36A 4XJWA 1RMU3 1AR73 1OPOA 1LGNA 3JBG1 1JUIA 2PFWA 3MZHA 2Z2SB 3VBFA 4KBBA 2GC0A 4IL7A 4D7YA 3Q9OA 2D97A 4JDMA 1QJX1 4R9DA 1RHI2 3H7YA 2JG8C 2E6VA 2VULA 1ULDA 3VBSC 4Q4X2 1YFUA 4DB5A 1Q8SA 3EJKA 2ZGLA 3WINE 4MZUA 2BWCA 1EAH2 3VHPA 5FREA 1UU4A 3THTA 4IV3A 4BQ1A 4LNVA 1O3SA 3MIFA 3RJRA 1LEDA 3WV6A 4INDA 4AI8A 4K40A 2ZOEB 3M1HA 3RDIA 1S0FA 4XJ9A 4OHVA 1MQTA 3WG2A 3R0RA 1NA1A 1I5ZA 2O0OA 2Q30A 4Q4Y2 2D43A 2R062 1QJU3 4YVWA 2YUEA 4Z07A 4AFCA 1RUC3 4BMEA 1H2KA 1VAKA 1C5HA 4K1ZA 1YXWA 2NMOA 4FOVA 5I8TA 1X50A 3A0NA 4AEKA 3AMNA 3AJYA 3D8CA 2XL7A 2VUJA 4BLJA 4O9EA 3AZXA 1QXRA 1SDWA 1COV1 2HWF3 3NVCA 2A6WA 4EN7B 3VBRA 2IXJA 3HQXA 1DQ4A 5CFDC 3RMYA 4XYXA 1H8VA 4PBPA 4YVSC 4HKLA 4DPNA 4QQOA 5GZCA 1TMF3 2XWBB 2ZGPA 1WW4A 4AVAA 3TNPB 1HXS2 1ND3B 2W52A 4HMZA 3USSA 1ND2C 1QJY1 1EPZA 4LHNA 2D40A 2IXKA 4NHKA 5EV7A 5K0UC 5LK5A 1VBA2 1QF3A 1A6CA 1WD3A 5J96B 1DFQA 3N7MA 1MS5A 3WDTA 2RM22 4PBOA 2UY8A 1XYOA 2ZZJA 3ZSKA 1QOTA 4FPGA 1UPSA 2WFF3 4HN1A 3IDBB 5C9AA 1JTZX 2WLQA 1H8TB 1WBLA 1X36A 1ZZ6A 2ET7A 2Z5WA 5H9QA 4Q2FA 4IEWA 1OA2A 1VBB2 2DTYA 4D7TA 5EFUA 1DDLA 3RG0A 3WNXA 4GKXA 1UX6A 1GQHA 4XBLA 4K21A 1MEC1 2R071 2RS32 3DUIA 4Y1ZA 3U0ZA 2EXHA 3I54A 4FQ4A 5CG9A 4COWA 3D6EA 3PJQA 2XBO3 2ARBA 2NQYA 2Q8OA 1OOPB 1QOOA 1C28A 4I09A 4QPGB 4MUVA 1Z7S3 5EYXA 2BBVA 2Z79A 4N7IA 1OD5A 2ZX1A 3CL1A 4OZXA 4PIYA 4Q0VA 4P9GA 1LB2A 1R082 3SH4A 3FZ3A 3MIGA 3N4MA 1C8M1 1NXMA 4YARA 4NHMA 4BHPA 1Y7BA 4F7ZA 1JW6A 2EA7A 1ULEA 3VDDA 1OQEA 4FQZA 3VLBB 5AFEA 2WZR2 5FLJA 1RUI2 5J7MA 1O3TA 1Y3TA 4GB32 2DCJA 3IBMA 1BZWA 3B9CA 3MW4A 4DQAA 3OD4A 3SLIA 2A71A 4QPGA 3WDUA 4CDUB 1YUDA 2YHJA 4K6BA 4AQ2A 3IPVB 3H3ZA 2BFUS 2ARXA 1EP0A 2NN8A 3AP4A 2YMZA 1DF0A 2QE3A 1AUYA 2EVXA 4H7MA 1RUH1 2OA2A 2OW4A 3AM2A 3WG1A 1TNRA 2UWBA 4PDWB 4YZ1A 5T3NA 1QKQA 3WDWA 2QZ2A 1RUD1 4MYEA 5HCAA 4N9HA 3WDYA 1W2UA 4CEWC 4Q4W3 3IT8A 4FOQA 2RR11 1K5MA 1A8MA 1PO22 1RMU1 1AR71 5IK4A 4BZ4A 1V00A 4E27A 2RHPA 5GLVA 3AXDA 2OVUA 3WLUA 4Y20A 4P9WA 1C57A 2W68A 1AYN3 3WVJA 2WSUA 2VPVA 1KS4A 4F8AA 1U5IA 3JCIA 3LZZA 1U5YA 1EPWA 2ZX3A 3JZVA 1ZRDA 2PHXA 4IEUA 3UV9A 4CDWC 4PDWA 3OD0A 2BYVE 1BKZA 2XJTA 4FOYA 3ZXDA 2X5IC 1DU3D 4AWDA 3QLQA 3GHMA 4Y1XA 1RUJ2 1PZ8A 2JG9A 3M8LA 5DG2A 1H9WA 1UIKA 1TNFA 1YJLA 3J8F2 4MXWB 4CDQC 3ZFGC 4CDXC 2TUNA 1QJU1 2XKOA 3GYDA 1BVVA 5DUWA 4B4RA 1DQ5A 2WNEA 2A5ZA 2NYYA 1RUC1 3HMYA 1MZ6A 5H9SA 5A3MA 2JE9A 4XOGA 3PMEA 2R16A 1O3QA 5BNNC 4ORFA 4J1WA 1LHNA 4C0BA 3MI8A 1EV11 4DINB 2A6XA 2HWF1 2RJLA 3VL9A 5FOBB 1M06G 4KGQA 3NKGA 4ISQA 1RUE2 1AYM2 1QU0A 1Z78A 1GV9A 5BXXA 4TSVA 4XFGA 4FPJA 4AE2A 1DZTA 3M3IA 4P9LA 3QBQA 1IPKA 2ZX4A 3FLRA 1MS0A 3AMPA 3FLTA 3ELNA 4MXWA 5J48A 2B7YA 2XVGA 1TMF1 5DUXA 4L9BA 1RITA 5FCCA 5C8CC 4UW4A 2E51A 4AW7A 5FDBA 2EF6A 4DMIA 1O4ZA 3VBFC 2VOVA 2D7FA 1DIWA 5GKAC 5BNOA 1IOAA 1YRZA 3TN93 1GNHA 3H3UA 1UN1A 4QD2A 2DURA 2AYHA 4AQ6A 3ILFA 2WFF1 3TBDA 1FMD3 1G86A 3E6CC 3MDPA 5FFOC 2WLPA 4N43C 4QGLA 4GXLA 1RTVA 1V9U2 4LE4A 4X6QB 4YGBA 4YFZA 1OQDA 4IESA 3I2DA 1VLNA 1R1ZA 3HBZA 1UU5A 3DPRA 3VGIA 1FOD2 3AK0A 4BMBA 2DVBA 1KDMA 2HWD2 1XU2A 1CAXB 1NA1C 3VZNA 3WOGA 3AJZA 2XBO1 2DVDA 4XF0A 3RYRA 1SFYA 5LRRA 4YVWC 5HXVA 3PVNA 4AGRA 1BBT2 1GZCA 3KCYA 1U5ZA 1Z7S1 1D4M3 1FT9A 1V6JA 5FMOL 4IEOA 2D5HA 1W6OA 2ZGTA 2GH8A 2AH2A 5CNAA 3B00A 3H50A 2DUPA 4LEJA 1SFNA 1A78A 3ZXJA 1IS5A 1NCRB 4NOTA 5FPXA 1KJLA 2G4IA 3N35A 3WQ1A 3VBRC 5F1RA 3U10A 1YI7A 1YIPA 3WG3A 4JV4A 4Z82A 2BTVC 4OI1A 4FTEA 3B93A 4EN0A 5KXEA 4LBQB 4Q8LA 3GBGA 3JD73 3ATGA 3HD8B 1RINA 2AUYA 4AVCA 1PGW1 4P9IA 1BMV2 1WUVA 3RNSA 1IPJA 4Q4V3 5ABJB 1FNZA 2CYFA 2JJ6A 4H14A 1SBDA 2PQQA 1BYHA 4I0BA 4RA0A 4DZGA 4AI2A 2ZX2A 1QOSA 1Q5OA 3WCSA 2VG9A 3CJIB 4L2NA 4MGKE 2R49A 3ECQA 1W6NB 1NCRA 2JXAA 3NAPA 3VKLA 5T52A 2WKKA 3ZMNA 5C9AC 1LKNA 3FHIB 5H9RA 5E8AA 4IXLA 4U36A 4CP1A 1VBD1 4I0WB 4Q4W1 3ZSEA 4LBQA 1H4GA 4GIQA 2X8KA 1YNAA 4M0HA 1ULGA 3J26N 2CAVA 1XE7A 1SLTA 2Z69A 4JDNA 3PVBB 1AYN1 5DDJ2 1QH6A 4IETA 2ENRA 4QX5A 1RUF3 3B01A 4S2DA 2ZMNA 1GZWB 1CAVA 4LO5B 3CJIA 2CV6A 5GLUA 2R043 5CVRA 5C4WA 2Q1ZB 4M3CE 4XBNA 4F83A 3ILRA 1YI9A 1CVNA 1QWRA 1YWKA 2XHKA 1Q8QA 2B46X 3H9AA 2CNAA 5SV5A 1DGWX 1A8DA 4XFCA 1SACA 3VDDC 3M2MA 4BA6A 4E2SA 4OHYA 1ASJ2 1LULA 1S1AA 4UBHA 4RHV3 2PHWA 3QH6A 2K9ZA 4EN9B 5I0RA 1AHSA 4AEDB 4AHXA 3B3QE 3M4FA 1PIV3 3BODA 1W6MB 4A7KA 4C90A 2ZA9A 3AYAA 4QPGC 1GZWA 4XHBA 1GSLA 2V73A 3NSTA 1E57A 4XBQA 3UL2A 5A33A 2X29A 4AK3A 3ZXGA 1CESA 1PO13 3B02A 2MPFA 3KGZA 2B8MA 2W0XA 3KGLA 1VP6A 1NZCA 4KWKA 4BE3A 3VZLA 4AG4A 1H4HA 1ENQA 3G6JB 3ZN4A 3R6SA 2VMGA 2MNGA 2Y26A 4E2GA 4GH4B 2WT0A 3EHKA 3LB9A 4Y22B 5F5QA 1N1SA 5GZFA 1YYNA 2UYBA 4QPIA 4FAHA 5GZGA 2OZJA 2ZGNA 1EYBA 4J6GA 1AXYA 1K5MC 1WMEA 3NV1A 4UBGA 3W9AA 3VBOB 3WP5A 4AI3A 1Y43B 1W6PB 3NV3A 1PNFA 2PHTA 2PTMA 3IM0A 3MPPG 1XYPA 3TN91 4ATFA 1EY2A 1F8VA 5J3UA 4N53B 4J1XA 4XTMA 3GBFA 2ZS6B 1FMD1 1S0EA 2VMHA 2HWB3 2B42B 2A3WA 5BNQA 1X8MA 3G7DA 4LBOA 2QZ3A 3MIDA 4DRVA 2FBEA 4W6YA 1YIFA 1LECA 2IZWA 4COYA 4ZU4A 2VNGA 3SMHA 1NQJA 2PHUA 1IKPA 2DVGA 4Y22A 1RVF3 1NE6A 3AMHA 1B35B 3H0OA 1ENXA 1WBFA 2JG9C 5JOZA 3UKNA 2G9FA 4L11A 5LK7B 1W6PA 3WW1A 4N9IA 1AR82 2WIIB 1VALA 4KGGA 5JSOA 4FPEA 3V0BB 1D4M1 4XQ4A 3ZN6A 5FLHA 2HWC3 3ZSJA 3RWNA 1MZ5A 4Z92B 2D6OX 3B69A 2DU1A 1QY4A 4GQ7A 1LOBA 1LR5A 3AZWA 1MS3A 2W39A 2TEPA 3M3EA 1DZQA 3CF6E 3EQEA 4L92A 1HRI3 4I01A 3VN4A 1N3QA 1RHI3 4XDQA 3AMMA 1ZZCA 2WJSA 1HDKA 2G9GA 1KJRA 3PTYA 4Q4X3 4XF1A 1AF9A 5IUQA 4NWWA 1ZNPA 1H1IA 2ERFA 3GNEA 1S0DA 1DHKB 4Q1RA 5F6LB 1EAH3 4FTSA 3LKJA 3OYWA 4EJRA 2CAUA 2GZWA 2UWAA 4OLLA 2YDEA 4IEPA 1ZVFA 4JGZB 3JD71 2R0HA 3ZFFC 5HI0A 3KS7A 1D2SA 2ZAAA 3SITA 3VKNA 2CL2A 3V0BA 1QJY2 3URFA 4Q4V1 4RD7A 2JE7A 5T50A 1LODA 4ONUA 4AI1A 1AL22 3OF1A 4Q4Y3 2ZJCA 4AGGA 4A7YA 4BM8A 2JKBA 4IEVA 3RQ0A 2R063 4OFGA 5BNOC 4MV2A 1G9BA 5CG8A 3KCXA 1KFXL 5KHKA 4C0HA 4FBFA 4R4XA 4HSLA 5FO8