1JXNA

Crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
SDDLSFKFKNFSQNGKDLSFQGNASVIETGVLQLNKVGNNLPDETGGIARYIAPIHIWNCNTGELASFITSFSFFMETSANPKAATDGLTFFLAPPDSPLRRAGGYFGLFNDTKCDSSYQTVAVEFDTIGSPVNFWDPGFPHIGIDVNCVKSINAERWNKRYGLNNVANVEIIYEASSKTLTASLTYPSDQTSISVTSIVDLKEILPEWVSVGFSGSTYIGRQATHEVLNWYFTSTFINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-H(O) lectin I
publication title Examination of the Structural Basis for O(H) Blood Group Specificity by Ulex europaeus Lectin I
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 58
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jxnA00
1SLIA 1ENSA 1WD3A 4WZFA 1FAYA 1YIFA 1IS4A 2LALA 1G86A 5L73A 4FPLA 4PQ9A 2V5YA 2DTWA 2DUOA 4R9CA 1ENQA 2GALA 2UWCA 4YW2A 2A6XA 1H9WA 5T5LA 3T2TA 1ULEA 1RINA 2V73A 5F5QA 2XG3A 2CWMA 3O0VA 1V6KA 2OVUA 4PF5A 3VKNA 4XHBA 1LGBA 4AWDA 1I3HA 2C9AA 4WV8A 2DU1A 3KM5A 4BMEA 4JRAA 2E7TA 1SCRA 2ENRA 5GJ6A 5JOZA 2E6VA 1GYKA 1WCSA 1KJRA 1ONAA 5GLVA 3ZYRA 3M3OA 2ZHLA 2Z42A 3BOPA 4K1YA 1UKGA 4Y22A 3IM0A 5KXBA 2CYFA 5JDBA 1A3KA 1WW4A 4GKYA 1DIWA 4Y22B 4FQ4A 3PJQA 4XTPA 2W52A 2DU0A 3RG0A 2G4IA 4FOVA 1YI7A 2A3XA 5CNAA 1Z78A 4M01A 1LOEA 4M3CA 4M00A 4FQZA 3POWA 3WDUA 1LULA 1I1EA 2ARXA 2A75A 1UL9A 4RL7A 2D6NA 1AXYA 3WHTA 4DRVA 3BIWE 1XQNA 2UWAA 4ISRA 3FFZA 1DHKB 2D43A 1N3QA 2DTYA 3AZVA 3MEPA 3N7KA 2D6OX 3ZXJA 2D44A 4YZ2A 5CB7A 3USUB 2A5ZA 3WVJA 1AJOA 5T52A 4BLIA 3W58A 2P34A 3WHUA 1FV2A 1LU2A 3HMYA 1AF9A 5JLVA 2D7FA 4LBQB 5JOYA 4W65A 1H9PA 3SH5A 3I8TA 5DUXA 1F9KA 4NOTA 2JJ6A 4AGGA 1GZWA 1MACA 1KITA 1URXA 4YM0A 4I30A 1V6OA 3NV1A 2W08A 2ZGTA 1W6QB 1JBCA 4DFSA 4WVVA 3LSDA 1AXZA 2AH2A 1LENA 3ZXLA 2R0HA 1N3OA 4U2AA 4FPKA 2CNAA 1DBNA 1ULCA 1QU0A 2GMMA 1GZCA 3B01A 1GNHA 1QDOA 1MS3A 4YW4A 4XYXA 1YO8A 2ZAAA 4XJ8A 5JOWA 3VKOA 5KXCA 3WUDA 1W6NB 1N47A 2WQZC 2ZGQA 2DYCA 1H30A 4K20A 1JYIA 1SLBA 3AP7A 5E89A 5GLUA 3SH3A 1A78A 3FLTA 3LSEA 2ES3A 2H0BA 1W6PA 2R49A 2ZGMA 4P9YA 2SLIA 4CTEA 3AFKA 2A7AA 2R16A 1MZ5A 4YW1A 1W6PB 2A6VA 3WG3A 4YZ5A 4YM1A 4NO4A 3RRDA 1WW6A 4DRRA 5DZFA 1S1AA 4P9WA 3VUOA 1S0BA 4ASMB 3ZSMA 1WBFA 3WOGA 3D6EA 4YZ4A 1LOFC 5DUUA 3H0OA 3PVNA 1MS8A 3AXDA 3SH4A 5H9RA 4HANA 1KRIA 4XJUA 4FP3A 4R9DA 3M3EA 4JCKA 1WLCA 2DURA 2VH9A 1V6LA 3OGGA 3OY8A 1PZ8A 1QNYA 2FHRA 1WD4A 3ENRA 4YFWA 1JYCA 1BZWA 5T5OA 1SBFA 4OZXA 3WG2A 4YZ3A 4YGBA 1CONA 3A0NA 2A70A 2R1BA 2D3RA 2RHPA 2GMEA 4U36A 4Q8LA 1G9DA 2PHUA 3ILFA 5CBLA 3MW2A 1S0IA 4LBJA 2A3YA 2VXRA 1LCLA 1CPMA 1ENRA 1MS5A 4XXAA 3UJQA 1SACA 3QLQA 1V6JA 3OPZA 1DQ1A 1GANA 1UMZA 5EXOA 4AVSA 4ATFA 3FUQA 1PZ7A 3ASIA 1VAMA 1SLAA 3WV6A 3ILNA 2D6KA 2GMPA 3NV3A 1IS5A 3UJOA 4FPYA 1CQ9A 2LTNA 3VKLA 2GDFA 4C1XA 2D6LX 4Q2FA 3WDWA 1DQ2A 1LOBA 1ULFA 1Z0HA 2GN3A 1LHWA 2JECA 4LBQD 2W39A 4Q27A 2AUYA 1Y7BA 2ZMLA 3T1MA 2ZHKA 1N1VA 3I4IA 1G7YA 5T5JA 4YG3A 1IKQA 1C1LA 3N7MA 3B9CA 3OBTA 3WDTA 2R0FA 3ZXEA 3IKWA 4ZKTB 4UW4A 3B00A 5GZDA 1LOFA 1V6IA 4FPFA 5IK4A 4BPZA 5GZCA 4XBLA 1IS3A 3WZ1A 2WJSA 4LBKA 5CAZA 3D4KA 2R1DA 2NZ9A 1PZ9A 4HL0A 4Q8KA 1EPWA 4PBOA 1Q8SA 2OW4A 2EF6A 3N36A 2EAKA 1D2SA 1UPSA 2A71A 3ZXFA 4Z8BA 4YM2A 5FRAA 4Q26A 1FNZA 2I2SA 1DGLA 1W0PA 2VU9A 4XHXA 1QOTA 5IK5A 2YXSA 5HCFA 5HCAA 2BQPA 4GALA 4XDQA 2AENA 3AZYA 2P3KA 1DQ4A 3ZVXA 1FATA 2YROA 4H55A 3L2YA 2DVAA 1VLNA 2ZMKA 3AX4A 3PMEA 1SLLA 3AZZA 3USUA 3ZSKA 1N1TA 1BQPA 1GV9A 3R4UA 1CIWA 1AVBA 2EXJA 1ULGA 1S0JA 3DGTA 4FOWA 1LESA 1W6MB 3SLIA 1MS0A 1G9AA 1KDKA 4FPCA 1UZZA 4LBQA 1HQWA 2ARBA 3VV1A 3POYA 3GALA 1QNWA 1N1SA 2ZACA 2WT1A 2PHFA 4CRQA 2DUQA 1LTEA 4GKXA 1V00A 4FPGA 3MW3A 2YV8A 4XIKA 1B09A 1GZ9A 2D6MA 3V64A 2E51A 1W6QA 1C1FA 2WNEA 1O4YA 4ISQA 2D6PA 5DG1A 5T55A 5JMCA 1QOSA 3WG1A 2JE7A 4BOWA 3VKFC 4YZ1A 3AYDA 1LHOA 1SCSA 1LOAA 1GLHA 1SBDA 3C2UA 2ZHMA 3M2MA 2ZGPA 5AVAA 5GZEA 1APNA 1OQ1A 3AP6A 4TZDA 2CL2A 3AK0A 4JC1A 4ATEA 2DVDA 4D69A 3M3QA 1W6NA 2VUAA 1X50A 4FPHA 1R1ZA 4XILA 3ZSJA 1NXD1 1AXKA 3BTAA 2VY0A 2W68A 4F83A 5E88A 2NP0A 2ZGSA 1CESA 3A0KA 4XJWA 4YLZA 1MS9A 1MZ6A 1O4ZA 2GN7A 1Q8PA 1VALA 4MYEA 1S0DA 2PHXA 2AR6A 4FPEA 3SISA 4Q1PA 3VKMA 1MVEA 1VIWB 3RMYA 1ZM1A 3JUUA 5IUQA 3WLUA 1WW7A 2CY6A 2OUHA 3FBYA 3WDVA 5T50A 2WSUA 1LU1A 3AP9A 3O0WA 4ITCA 3RMXA 3O12A 1QDCA 2EALA 1JUIA 1Q8OA 2NYYA 3FUOA 5DUWA 5DZEA 2A3WA 4XTMA 1SLCA 2PHWA 4DS0A 1JW6A 1D0HA 2DVGA 5FREA 1LHNA 3IPVB 5EWSA 3INAA 3T1LA 4XMIA 3ZYPA 1LEMA 4GXLA 4M3CF 4BMBA 1V6MA 1ZA4A 1DQ5A 4AGRA 1F5FA 4DQAA 5IK8A 5KXEA 2A6ZA 1CVNA 1FYUA 1LHVA 1MR5A 1S0GA 3N7LA 1FX5A 1SFYA 1QKQA 2ZGLA 5GALA 5BYNA 1LHUA 3OBRA 3SITA 4CZSA 2A6YA 4PBPA 4KBBA 4BQ1A 1WLDA 3AP4A 1LODA 4TYSA 2EXHA 3ZPYA 2A6WA 2ZKNA 2ZMNA 4L8QA 2DUPA 2D3PA 1YRZA 4Y1UA 1YYNA 5DZGA 2E7QA 2P37A 4YGDA 5CA6A 2WSVA 2ZGNA 1GNZA 3ILRA 3AZWA 4YW3A 5DUVA 1N1YA 4Y20B 3W59A 4XOGA 2UU8A 2PHTA 4XXPA 1DYKA 2GNBA 1A8DA 2DV9A 1DFQA 3RSJA 3AXEA 2KM2A 2DWRA 3KQRA 4YFZA 4SLIA 3BODA 3WCRA 1IS6A 2ZGRA 1AX2A 1HLCA 1W6OA 1V6NA 1LGNA 3POSA 1IKPA 2NMNA 4Y1XA 1F31A 1S0CA 2ERFA 1W6OB 3WUCA 1G9BA 3PVEA 2ZGUA 1MS1A 4FPOB 3TB0A 1WLWA 1HDKA 3N7JA 1BXHA 4YM3A 5IT6A 1CN1A 4PCRA 4R9BA 5H9SA 1QF3A 2VW1A 3U4XA 4XBQA 3AZXA 2NM1A 4M3CE 4FVVA 1GKBA 3M3CA 1OFSA 4XZPA 3V0AA 3R05A 4DPNA 3WCSA 1YXWA 3AJYA 4LBOA 2Q5TA 2ZGKA 4ZXKA 3V0AB 1DQ6A 2XB6C 5GM0A 3TAYA 1JOJA 4XJZA 1LGCA 2PELA 4R9AA 3Q9OA 5IK7A 3MPPG 4UW5A 1MS4A 4WVWA 3DUIA 4FOYA 4C1WA 2YMZA 4YGEA 2GNMA 5GLTA 4IQPA 3SNMA 2CWSA 4XIOA 3M1HA 4Y1ZA 4GWMA 2ZABA 4XJAA 4YG6A 1W6MA 1QMJA 5GZGA 2P3JA 1C4RA 2ZA9A 2ZZJA 1AZDA 1QGLA 3MW4A 3AJZA 1FV3A 3A4UA 2ZGOA 3FLRA 5SV8A 1S0EA 1WBLA 3UK9A 3V0BA 3O5SA 1C57A 1TEIA 2YZ4A 4M3CB 5T54A 1NLSA 3NWKA 1RIRA 5T5PA 4XJ9A 2C5DA 3NV2A 4Y1VA 3ZXKA 4AYUA 1G9CA 3V0BB 1JXNA 2TEPA 4LBMA 4FP2A 1GSLA 1BYHA 3V65A 2EXIA 2WT2A 1LJ7A 4LBLA 1VAVA 4XBNA 4BM8A 4YG0A 4FPJA 1S0FA 1W0OA 3AYCA 4GWNA 3OYWA 3RQ0A 3ZSLA 5F9TA 1Q8QA 5KXDA 1GBGA 1AX1A 4Y1YA 3OYWB 3B69A 1KDMA 1RITA 3FLPA 3IN9A 4YW5A 1BJQA 4AVVA 4K21A 1KJLA 1UZYA 2JDZA 3N35A 1DQ0A 2VW2A 3ATGA 4LBNA 2P2KA 3OJBA 4UW3A 2JKBA 1LEDA 5DXDA 1WW5A 2AGSA 3QCWA 5DG2A 5E8AA 2E53A 4P14A 5H9PA 3UL2A 3B3QE 3D5OA 2AYHA 3HN1A 2NN8A 4AGVA 5JOXA 1GZWB 3NV4A 4K1ZA 2WKKA 4YGCA 3PVOA 2JE9A 2DVBA 2EXKA 1Q8VA 2NMOA 3WG4A 1SBEA 4XE9A 1G9FA 4XMAA 5EYXA 5LK5A 1CJPA 1OKQA 5GZFA 1UX6A 2AREA 1G8WA 2WT0A 1JN2P 1DZQA 5JVVA 2ZBJA 3JU9A 4P9XA 4BLJA 1IOAA 2PHRA 3IPVA 1QOOA 3IMNA 1CPNA 1SLTA 2OUJA 1ULDA 2P3IA 1AJKA 4Y26A 2EIGA 4UW6A 5EYYA 3RS6A 4GA9A 3WNXA 1UN1A 2FMDA 1CR7A 1FNYA 2YY1A 2UWBA 2HYKA 1HQLA 1JHNA 2WLQA 2GNTA 1DYPA 2ZHNA 1DLLA 2SBAA 5HCBA 1LOCA 5GLWA 3R4SA 3AYAA 1LOGA 4Q1RA 4FOQA 2GNDA 2UURA 1AX0A 3N3HA 2VW0A 1N3PA 2JD4A 3O0XA 2D3SA 5H9QA 3GNEA 1HKDA 2CTVA 1LECA 1KQRA 3AP5A 1GICA 1WUVA 3WDYA 4Y24A 1MVQA 3HR9A 5GLZA 1J1TA 3CNAA 1Q56A 4RA0A 1U0AA 1UAIA 3AYEA 2DVFA 1BKZA 4Y20A 3LCPA 3OY8B 3WDXA 4AVTA 3APBA 2B7YA
chains in the Genus database with same CATH superfamily
3RZGA 3PLQA 1RUH1 3KB5A 3GZAA 1YIFA 5DQ0A 2WZR3 5AC92 4FFGA 4R9CA 4Z2AA 1QXJA 2OS2A 4EJRA 2GALA 2UWCA 4K3UA 4XAEA 5C8CC 4YW2A 2A6XA 2PHDA 3RDIA 1H9WA 1NKGA 4IL7A 4MZUA 5T5LA 4CCKA 4XVHA 4HMZA 2PLV2 4NPLA 3O0VA 2OVUA 3KVBA 3B7MA 1AYN3 4OUMA 1LGBA 3VD9A 4FXKB 4LO7A 2RVAA 4AAXA 2X5IC 3WF0A 2WFPA 2IXKA 3KM5A 4K40A 3ZMOA 1D0GA 4JRAA 4AL9A 2BGPA 1WZXA 4BMEA 2P3YA 2E7TA 4CU8A 5JCTA 2ENRA 4RS5A 4D3WA 4JTOA 5GJ6A 2ARAA 3HPNA 1KJRA 3TNQA 4BXSV 4RS5B 1ENXA 3M3OA 2ZHLA 5FP9A 4DXZA 4CDQC 1S55A 4NE9A 1A3KA 3H8OA 4JDOA 1J83A 3ZYHA 5ERLA 1XPWA 2W52A 4PJYA 3W20A 2W1WA 5A70A 4H7MA 2R061 4KGGA 4LEJA 5CNAA 1Z78A 3GYDA 4BQYA 2P4EA 3AKSA 3A22A 4K7JA 4LKEA 3N4MA 4XFHA 4RL7A 2VZOA 3BN6A 1AXYA 4NRPA 5B4NA 1JZ5A 4IEVA 1XQNA 4P5HA 3ZFEB 4F8AA 4ISRA 1B35B 5EQUA 4N9HA 1RJ8A 1N3QA 3IIIA 3ZXJA 2D6OX 2D44A 2QQKA 1RGSA 4Q4W1 1R093 4Y5SA 1EP0A 1VBC1 4X6RB 3U11A 3CL1A 3CO2A 3UKVA 5T52A 2E26A 3N9OA 2IVJA 2P34A 4ARYA 2QQJA 2Y0IA 2VVFA 3EXUA 4CDXC 5JLVA 1EUTA 1AF9A 4QPGA 5FXZA 5BNPC 2BNMA 5LB6A 3EQEA 2BFUL 2WINB 2VOVA 1OOPA 2ZAHA 2XLGA 4NOTA 1HRI3 2JJ6A 4W6YA 2RR12 4ZU5A 4AGGA 5L36A 3FBMA 4IEXA 3LA7A 2X8KA 1DG6A 2HWD1 1AL0G 4YM0A 1WA6X 4CP0A 2ZGTA 5K7PA 5JZGC 5FYHA 4OI0A 5C3SA 5HXMA 1AR72 5I0SA 1K5JA 1VB4A 4WVVA 1W9SA 3LSDA 4C0BA 3THPA 5J98B 5JI7A 1QJX1 1AYM3 4QU2A 5A32B 4FPKA 5FMDA 2GMMA 2JIGA 3RJ2X 1OH3A 3H7JA 5F6KA 4D6RA 4WZCA 2ZAAA 3ECQA 1GWKA 1R083 2DBNA 3BGAA 3VKOA 3VZNA 1FMD1 4E4SA 3KT7A 1YFXA 1JYIA 2O0OA 1SLBA 5FV3A 5LA9A 4QM9A 1RVF3 1F4HA 2WZR2 5FYMA 2XWJB 4JKLA 3FL7A 1GNYA 2ES3A 1OUSA 1W6PA 2DCTA 2ZX1A 2SLIA 4QX8A 5FO7B 1SG3A 4YW1A 4CTEA 4FTEA 5FZKA 2TNFA 2VXJA 1W6PB 1I9RA 4YM1A 4NO4A 2LUWA 3RRDA 1ACCA 3T0BA 2YC0A 2FZ1A 5ACA2 3HNBM 4I01A 1XNKA 2WO7A 1WBFA 2Y33A 4MOAA 5DUUA 5FY7A 5FZ8A 3K75B 5TSWA 3U4SA 4HANA 2ADEA 1KRIA 4CU6A 3M3EA 4KU7A 1YEWA 3KCXA 5LRSA 3OY8A 1V6LA 4DNYA 1A34A 1QNYA 2PHLA 2XMLA 1BZWA 4QMAA 4OZXA 5A7OA 3WG2A 2CAVA 1GU3A 1CONA 1I6XA 5C71A 5LA0A 2Z2SB 1JYTA 1G9DA 2GMEA 4Q4V1 4QPIB 3P5BA 1O59A 1GP4A 2HEVF 3AMNA 3J7HA 4IGPA 1LCLA 1D7PM 1ENRA 1MS5A 2ZEXA 1VBE3 1RUG3 1V6JA 2HLEA 3OPZA 4JKKA 3RZKA 5KHHA 4AVSA 4Q0VA 4Z07A 3ASIA 1VAMA 3HOBA 5EJ3A 2C9KA 1RUOA 2D6KA 3NV3A 1YNAA 3VBFB 1CIYA 2WNVA 1MZFA 2QQLA 2W3JA 2GH2A 3DL3A 3VKLA 4QXBA 3U0ZA 1QJY1 2D6LX 2JECA 1Z0HA 1RMU1 2O8OA 2R071 3GCXA 3LB9A 3OF1A 4Q27A 3KT1A 5DN2A 5FY4A 3T2QA 2XJTA 4P02B 3BI3A 3IBMA 5T3NA 1COV3 3N7MA 4QT6A 3ZXEA 3KVAA 1H0BA 5GZDA 5IVFA 1AR63 1LOFA 5CKQA 4MO3M 2W1SA 1XE0A 4BPZA 5GZCA 2Z5WA 1LNSA 1YJKA 1ND3C 3WZ1A 5C9AB 2VNRA 4IE7A 1PZ9A 2JG8C 1BK0A 4CEWB 4AVBA 1JODA 4YVWC 2VCAA 3HT1A 1YIPA 1PMJX 1JU3A 2EF6A 3NQHA 2HWB3 5LEJA 1L7LA 1XXNA 1OURA 3H3LA 1D2SA 3PURA 1UQXA 3AKTA 5JXIA 3J8F1 3KZ4C 4YM2A 1PM4A 4AQ2A 4KU8A 3BTYA 1HJGA 4XHXA 2VR4A 1QOTA 2YXSA 1R1A2 4Q4X1 4V1PA 4JV4A 3WF2A 5IVVA 3SCHA 5LBFA 2XL9A 5LWBA 5F39A 5C8CA 3L2YA 1ZBA2 4BCUA 2DVAA 4NWVA 4CPBD 3HNYM 2ZMKA 3LFMA 3USUA 3PMEA 3AZZA 5FZ9A 1N1TA 1BQPA 3MICA 3R4UA 2EICA 1AVBA 2EXJA 1S0JA 4JDNA 1QJZA 1NG0A 4P08A 1RVF2 4UFMA 3E6BA 3BALA 4HKLA 4Y3OA 4AEJA 1JU4A 4QKDA 1JZ7A 1PVC1 4KG8A 2X5IA 4FFHA 2ARBA 4FAHA 3GALA 1JHJA 5K9YA 2X5IB 2HKXA 1IQDC 2WT1A 4CRQA 2DUQA 5BNNC 5J7MA 2PN5A 1V00A 2BNOA 1ZBE1 1POV0 2VZ1A 5EIYB 3RZHA 1W2NA 3NNGA 2D6MA 3VBRB 5A3UA 5F7UA 4BH9A 2ZTNA 1CAWB 1W6QA 4CDQA 5FBZA 2D6PA 2VQUA 3KD4A 5FXWA 3ZKUA 1W2OA 3W5NA 1VBB2 4ZS2A 5CYYA 5CFDB 1UW8A 4I0AA 4BOWA 2W46A 4YZ1A 2VBDA 1UPIA 4EN6B 1GLHA 2VULA 3I3DA 5AVAA 2D98A 1SQ4A 3MLLA 1APNA 3NNMA 4JC1A 4E4DX 4RR3B 3WW2A 2DVDA 1F2NA 1TMF3 2EIDA 1X7NA 1W6NA 2BEOA 2FCVA 3M3QA 3DXUA 1UY2A 4PLMA 3IDBB 3THCA 3WW1A 4DZGA 4V2VA 5A3PA 4MGTA 3ZSJA 2A73B 4F83A 3Q8FA 5HPOA 1RXGA 1VBE2 2ZGSA 1RUG2 1VBD1 5LCWL 3A0KA 4DMIA 5G04L 2MEV1 4QDSA 1E5SA 2Q1FA 3GDBA 4MXWA 4B3NA 3PUSA 3B5LB 3IDCB 5IUQA 2XUMA 3WLUA 4CDXA 3FBYA 3K4AA 5T50A 5BNPA 3O7OA 1MPXA 2WSUA 5DAPA 4BXFA 3C7GA 3AP9A 1W8TA 5DDJ3 1QDCA 1JUIA 4OUEA 2DCYA 3LEMA 4DS0A 5FREA 3FFQA 3T1LA 1BBT1 5JZGA 4GMP1 1AR62 1ZRCA 3TEXA 4XMIA 3ZYPA 2QCSB 4M3CF 4QWNA 1ZZ9A 1V6MA 2BW8A 3ZXGA 1HB3A 2VMGA 4DB5A 1FPN1 1DGWA 5AVPA 2A6ZA 2N7GA 4LMFA 1C8M3 5FYIA 4TWTA 5GALA 2WC2A 2W91A 3AMQA 3PU8A 1LHUA 1U5IA 3OBRA 4Y33A 5L9RA 3SITA 5FZCA 4KBBA 3U37A 1LAJA 2D97A 2HWB2 3I2GA 5L9BA 3POIA 1UY0A 1W2UA 4ET7A 2ZMNA 2WQ8A 1VMFA 1ZREA 4QX7A 1YYNA 4IE4A 2J7MA 1EAH3 1TNFA 4BQ4A 2WSVA 2ZGNA 3O1PA 1T6GC 3ILRA 4IEZA 1ZYBA 5FZDA 4QX0A 2UU8A 4XXPA 3N9MA 2HWF1 3ACLA 5JSPA 4W4ZA 1DFQA 2KM2A 2QQMA 3KQRA 2Q4SA 2QQNA 3ZYIB 1EV13 3H1MA 1AR91 1W6OA 2QFEA 3BPSA 1OD3A 2Q30A 1V6NA 4Y1XA 3VZKA 2NMNA 4AHXA 1AL23 1S0CA 1PNFA 1W6OB 2Q0AA 5FIXA 5HV4A 1G9BA 2C24A 3TB0A 2R041 1WLWA 1HDKA 3A23A 5JR2A 1CN1A 4PCRA 4EE2A 2ETEA 5H9SA 5AFEA 2LRPA 1CAUA 2VW1A 3WP6A 3ZXAC 3L2HA 3D8CA 1GKBA 3M3CA 4XZPA 1KEXA 4DPNA 4ZS3A 3WCSA 1ST8A 2Q5TA 1Q3EA 3TAYA 3K3OA 4BE3A 4R9AA 3Q9OA 5FO8B 3NAPB 2JDPA 1DGWX 4UW5A 4WVWA 3HWJA 2F17A 4RHV2 2BGOA 4QQPA 3ZPOA 3I59A 3VHOA 4Y1ZA 2Z4FA 4GWMA 2C4XA 1VRH1 1U5XA 5FKCA 5FZGA 3I59B 5GZGA 1JOBA 2ZA9A 1SPPB 4I2OA 1PGL1 2XGXA 1NQJA 5ABJA 3D0JA 5BUVA 3MW4A 3AJZA 2JEMA 1VPHA 2DDUA 1UZ0A 1TEIA 3HD8B 4HKWA 4IW3A 4M3CB 2J1AA 1ALYA 4AE2A 1RHI3 3BOWA 4XJ9A 1IPSA 1PO23 2DFCA 2OT7A 2YC4A 1JXNA 4HOOA 1G9CA 4BZ4A 2FZ2A 1AR81 3VBHC 1H1IA 2EXIA 2WS93 1YQ6A 4YG0A 1ND3A 1F8VA 4GJYA 4AXOA 1XNBA 1O3TA 5BNOC 3JBG3 2JG8A 2WDBA 1U5YA 4GWNA 4IDZA 5FBJA 2CAUA 3RQ0A 2FBEA 2J1UA 1GFF2 1AX1A 4QQOA 1OD5A 3UESA 1RITA 3FLPA 4MHUA 2W1UA 4IEUA 5FK7A 1BJQA 1OLQA 3RNSA 3TYJA 5C5TA 1W3VA 4XF1A 1DQ0A 5LATA 2GP3A 3OJBA 4UW3A 5DXDA 5K4LA 2AGSA 4DO0A 4OZOA 1J1LA 1UYXA 2RM23 4HVQA 4LLFA 3B3QE 4AGVA 1AYN1 2R062 4XF0A 3DPRC 3AKQA 1GZWB 4OCTA 2FD8A 4JKMA 4K1ZA 2WKKA 4NHKA 4YGCA 4A3ZA 3PNAA 2DVBA 2NMOA 4GB31 3ZYGA 4P00B 2W92A 5EYXA 3CJIB 1WWYA 2WNOA 3PUIA 1QQP3 1CJPA 1CGPA 5CU1A 3ZLIA 4QGLA 3MFCA 4I02A 5L9VA 5C3QA 5BNNA 4OHXA 1CAXA 1XC6A 1RUF3 1JN2P 3BYWA 3U78A 4CCOA 5DAVA 4TLGA 1VBC2 1CAXB 3NJVA 5LASA 5LY1A 2PHRA 5K8SA 1QOOA 3VD3A 4OULA 3PU3A 4KL1A 1H4GA 4Y26A 2UYAA 1DGRA 1E5IA 1REEA 1STMA 2EIGA 3EO6A 2ZXQA 3RS6A 5CKNA 1XSQA 2O8QA 1JYXA 5LA2A 4HT1T 1HQLA 1AL22 4PIXA 2X10A 1DLLA 2SBAA 4NPMA 3TNPB 3FHAA 3WNLA 1LOGA 2VCMA 4FOQA 2UURA 4Y4YA 5CEHA 2VMCA 2VW0A 3GM8A 3EMRA 4RS5C 4CP2A 2ZCWA 5FMOS 4FT8A 1H2NA 4HPKB 5JPMB 1VMJA 5CVRA 1QJX2 1R091 1WUVA 3WDYA 5GLZA 5C6CA 3T0DA 3WDXA 2CSGA 2LS6A 1H2LA 1FMD2 4CCNA 1W28A 1O6UA 1UX7A 1FAYA 2JB8A 2P6CA 1IS4A 1HRI1 2JIJA 2LALA 1G86A 5L73A 2GC2A 4UFIA 3ZFGB 4E4HA 1NA1B 1PNGA 3OBZA 4PQ9A 2V5YA 2EIEA 3ZFEC 4WVMA 5KHIA 1B35C 1XU1A 1PIV3 5L7OB 3FJSA 4NIIA 2OYZA 5E16A 4YARA 4D6QA 3JCIA 1RINA 2X53S 3HQXA 2VMHA 1XYOA 3HQRA 1V6KA 3MIEA 3OGVA 3E6CC 2RS53 4XHBA 4URAA 2XWBB 3E97A 3LA3A 1JZ6A 1I3HA 2C9AA 3NJXA 4GWJA 4WV8A 1RYYA 1Z7S1 2RE9A 5FZOA 3JBG2 2RMU1 4AF9A 4F7ZA 1BCXA 1OVPA 5FZOB 3P3PA 3GJBA 3OOXA 2F4LA 3SC7X 2E6VA 2WWJA 5A7NA 1UMHA 1WCSA 3DV8A 3MIDA 4CEYC 3RYPA 1HJFA 1ONAA 5F8PA 1HN1A 4G3YC 2PQSA 1L7RA 3DN7A 4DUXA 1SDWA 4K1YA 2TUNA 4RGGA 3CZJA 5KXBA 2CYFA 2XHNA 3ZN6B 2B5HA 1OLRA 2YU1A 3U1XA 4FQ4A 3AKRA 4JX0A 3I3QA 1FOD1 3PJQA 2CGPA 4OFGA 2R32A 2DU0A 1XE8A 2G4IA 5KHGA 5AC93 1XOYA 3CDZB 1IG3A 2XDVA 3OGJA 4RGAA 4CCJA 1LOEA 4FQZA 5DPNA 5IHRA 3WDUA 1HXS1 2ARXA 2A75A 4QGNA 1ODMA 2PLV3 4OHYA 3GXUA 4DRVA 1EY2A 1QQP2 5IJRA 1E5HA 5IVEA 2QE3A 2V4VA 5CKMA 1RMU2 4QB1A 4QDQA 1VP6A 3FHQA 3LDBA 3VL8A 5FXVA 1POV3 2OPWA 1OA2A 2W0XA 4CCMA 5A3LA 5LRRA 4BLIA 3W58A 1VAKA 2RDRA 4QXCA 2DFBA 3HMYA 1DU3D 2JDUA 1UKRA 3LE0A 3SCGA 2HBTA 5JOYA 2BYVE 1F9KA 3OCPA 1BEV2 1PX4A 2VAUA 2EIBA 3AL6A 4HSLA 4NHLA 1QJU2 2CV6A 2P1BA 2WAOA 3I2JA 1MACA 1KITA 4LUKA 4OHWA 4V2WA 1URXA 3RI8A 2X29A 5FY5A 2W1QA 3ALQA 1EYBA 3WNPA 3U75A 4LKSA 1JBCA 2QQUA 4QPIC 4JHTA 4Q4X2 4IEYA 5HXVA 4L11A 1AXZA 2OKXA 3ZXLA 2R0HA 1OSGA 4U2AA 1ULCA 4EWEA 1QU0A 3B01A 1GZCA 4YW4A 2QUOA 3O14A 4XJ8A 3ZR6A 3WUDA 4CA9A 5FYZA 4NRQA 5FY9A 5KWRA 3VBFC 4ASKA 2DYCA 3WP5A 1H30A 4K20A 3VBHA 4UF0A 4LOTA 1XYPA 5J1XA 3OUIA 2WA4A 5E89A 5GLUA 1W8WA 3VBSB 1A78A 3WQBA 5BNOA 3H9AA 1HV1A 1K42A 1H8TB 3VDBA 4CXXA 1Y4WA 3AFKA 3MFAA 2R16A 2XVGA 1MZ5A 3LD8A 3UKTA 3S7EA 3WG3A 4HSJA 2RR13 3IB3A 3U14A 1NYWA 1PM7A 1WW6A 4GIQA 4EYUA 3CF6E 4ES9A 2WN2A 3UKNA 4ZZ5A 3ZSMA 1YFYA 4YZ4A 1AR73 1LOFC 1QH7A 4AI1A 4CUGA 3M70A 2HWC1 3H0OA 3PVNA 5FPXA 1MS8A 5C9AC 2HEYF 2EA7A 4A6SA 2XKOA 4CEWC 5FLHA 4JCKA 2WL1A 2ZEWA 3DPRA 4UFJA 1ZZ8A 4Y5Z0 1UO9A 4LORA 2FHRA 1WD4A 3CBNA 3ENRA 1JYCA 4EN7B 1GWLA 4XZUG 3LWCA 2RHPA 2D3RA 2E32A 4U36A 1UIKA 4Q8LA 1PGSA 3RI9A 5CBLA 1W03A 3QOPA 4LBJA 2FDHA 2A3YA 5FQ0A 1UY4A 1W8UA 1VJ2A 1VBD2 1WCQA 3LDRA 3QLQA 1DDLA 5FQ0B 4Z1VA 3J9SA 3ZDSA 2MEV2 3T0AA 5F6LB 1BMV1 4ATFA 2HWE3 3RVHA 5FZ6A 2VQAA 5JIAA 1T6BX 4A4AA 4BQ2A 5FP3A 4N8MA 1SLAA 4GJZA 5F32A 2VOXA 1OLME 1O8PA 3ILNA 2GMPA 5A6XA 3H50A 5DAQA 2WWSA 5ACA3 3QH6A 4GZ9A 4PI2A 4Q2FA 2UYBA 1LOBA 2GN3A 2YFUA 2B45X 1PK6B 3OBAA 4D7YA 1NX9A 3G7DA 4MLOA 4XDOA 3I4IA 3NW4A 1US2A 4YG3A 1C1LA 3OBTA 2Q8CA 3VBRC 4A41A 3IKWA 1HQNA 5KR7A 5C8WA 2LW8A 4KI5M 5BNQA 4FPFA 3VL9A 4B4QA 1FPN2 1IS3A 4A7ZA 4META 2PYTA 3RYRA 5CFDC 1VE0A 3AMPA 3OD0A 5FWEA 5FK8A 4Q29A 4GD4A 4RFRB 5J48A 2EAKA 3AKPA 4RR3C 2OQ6A 1OPOA 4Z8BA 5IK5A 2VU9A 1HB4A 4ZU4A 5IVBA 2CDOA 4JRLA 2Y26A 5HCAA 2P3KA 5FZBA 5C3PA 1J59A 3ZFEA 4K9SA 4BHPA 4AAPA 1B35A 1IPKA 2VTXJ 4QM8A 5DAXA 3K4ZA 4BA6A 1OA3A 2IFRA 4CU7A 3N9LA 3M7AA 1F5JA 3O1TA 2Y6FA 4TTGA 3POBA 2HWF2 2NPIA 1C8M1 1JMUB 1W6MB 3DGTA 3SLIA 5A6ZA 1G9AA 5A1FA 4FTBA 1GWMA 1KDKA 1W2TA 4E2SA 3I2KA 4BK4A 1HQWA 3WQ1A 1E57A 2C6SA 3MI8A 3I2IA 2R042 4MVTA 5A1LA 5D21A 2YV8A 4CEYA 2J22A 2ZX3A 1HB2A 5SV5A 1UOGA 5F3EA 3V64A 3ZDVA 1GUIA 1SFPA 4KQ7A 4CEYB 3POGA 2E51A 4OQ8A 3IWZA 3VHRA 4ISQA 5EHDA 4CUBA 1RUJ1 1JUHA 5DG1A 4NHXA 5T55A 1QOSA 1R1A3 1NE6A 5A32A 1XJAA 4CP1A 1LHOA 1SCSA 2CHHA 4TLFA 3LA2A 3VHNA 4AFMA 1EV11 1ZBA3 4HXCA 3AK0A 1QJFA 4ATEA 1YQCA 4OQ9A 3T4HB 1VRH2 2VUAA 1X50A 3NO8A 1V9U1 4FPHA 5A7SA 1HIXA 4XDPA 3PDQA 2OX0A 5IVCA 5FLIA 4BISA 2VY0A 4LR4A 4IEOA 1KD7A 1TVGA 3IIAA 4E2GA 2RJLA 4CPBA 1MS9A 3AC0A 1MEC2 2CDPA 4MYEA 5FXXA 1S0DA 2QJVA 2VZTA 2HWE2 5CZKA 4Q1PA 2VOKA 1MVEA 3GBFA 3VKMA 1PGW1 1ZM1A 3POFA 3QH7A 1DGRN 3CU7A 4QD2A 5EJ1B 3QACA 4AFCA 3JUUA 2C0ZA 4NWWA 1AR82 5C70A 2OUHA 2RV9A 2WO1A 3P1IA 4LA3A 3O12A 4OHVA 3FUOA 2GZWA 2XJQA 1OQEA 1RUE1 2A3WA 3VD7A 1VBB3 4A7YA 3MF9A 4LKDA 1LHNA 2YBSA 3INAA 1RUD1 4R52A 1CZVA 2NLRA 4IERA 2WLPA 4QPIA 2JDMA 2ZS6B 4C8DA 1DQ5A 1NQDA 1F5FA 1RTVA 5KXEA 1FYUA 2JE8A 1LHVA 3RGBA 4R8HA 3NAPC 5JXJA 1G6NA 2VBPA 1POQA 1K3IA 3C7OA 4ZHNA 1ASJ1 1W9FA 4BQ1A 4RD7A 4GH4B 1IZ3A 5B2GB 2ARCA 2VNVA 4TYSA 2YUEA 3ZPYA 2A6WA 3D0SA 5JSOA 4L8QA 3VBFA 3VDCA 1W05A 4UI9L 2VQ0A 1NY71 2K9ZA 3BUCA 1Y9GA 4HG6B 3VDDB 2P37A 5CA6A 5IWFA 5FCCA 3WQ0A 1A6CA 1CZSA 4CE8A 1J3PA 2WABA 5DUVA 1N1YA 4Y20B 5KC5A 2XQRA 4XOGA 1SZBA 5LEKA 2Y38A 1A8DA 2DV9A 4LE4A 3PHMA 3RSJA 3H1YA 5KHJA 2DWRA 4YFZA 1JTZX 2JG9B 1AX2A 1HLCA 1RUI1 4KWKA 3G6JB 2RS11 3T30A 3A21A 3POSA 3WUCA 1YQ8A 5C9AA 2BOJA 5BV6A 4CEWA 5FZHA 2ZGUA 4XPVA 5FPAA 2GSYA 4LT5A 1HV0A 3N7JA 3GZEA 3LPGA 1QF3A 1CZTA 5CFCC 1NT0A 2YPJA 3T2OA 3RYKA 3U4XA 1SHWB 2NM1A 4FVVA 3O1OA 5KC6A 3R05A 2ZGKA 3BB6A 5LBBA 5IK7A 3IDAA 5FZ3A 3SMHA 4AOCA 4AFAA 1MS4A 3DUIA 1YHFA 1UYZA 1ZZBA 1OPMA 3OEBA 3PUHA 4O9GA 3VZMA 3GF6A 1ND2B 2CWSA 3ZSEA 3F95A 3ZM8A 2VZQA 1UU5A 1HW5A 1XNTA 4YG6A 1QMJA 4ZPIA 5EJZB 4LKFA 2P3JA 2H0VA 1C4RA 3I2HA 4LTAA 2BDRA 1VBA1 1Y9QA 3CJIC 4A6OA 1KFUL 1QIQA 1OUXA 2VBBA 5F1RA 2ILMA 2PA7A 2XLFA 5JR7B 1BVP1 4PHZA 3A4UA 4MGSA 2ZGOA 5DABA 3WF1A 1W99A 4A42A 3LOBA 2XOMA 3RPQA 3GBWA 4PLNA 1J58A 5T54A 3VBRA 3NKTA 4N90A 3MUZ1 1CAWA 4LBMA 1Y3TA 4D7TA 5FKBA 3V65A 2WAAA 2WT2A 3IAPA 1WCUA 5DMYA 4GMP0 1GP6A 2VZSA 5EFUA 4OVEA 2ZEYA 3KWVA 1Z7S2 2MNGA 5CFDA 5FYBA 3DYMA 3O1RA 4B4PA 3ZSLA 5F9TA 2JDHA 4AVAA 5KXDA 2RS32 4E8DA 3O1MA 3LAGA 3B69A 4FSJA 5B4XA 4RR3A 4RHV3 5HCHA 2OPKA 1PIV1 2VL4A 1UZYA 4G4FA 3MLJA 3ATGA 3T3YA 2P2KA 4COVA 1RUH3 1LEDA 1P8JA 4R4XA 1UXZA 4HONA 5F3CA 5LBCA 3UL2A 3JD71 4NHYA 4OI4A 4IGOA 3HN1A 2AYHA 5JOXA 1HRV1 2WYFA 3MO4A 3NV4A 2F6BA 1D4M1 1K5MC 4NVPA 2EXKA 1JYWA 2XH6A 3R0RA 4IGQA 2BFUS 3I3EA 3R4DB 1G9FA 3ZFGC 1NA1C 2QDNA 2X09A 3GGLA 1L7QA 2YFZA 5L7OC 1RUC1 1G8WA 2O1QA 3OUJA 4XQ4A 2DBIA 2Q8DA 3BU0A 4EQVA 1DZQA 1XNAA 5JVVA 5ANNA 4P9XA 3JU9A 4Q0QA 2QQPA 1JYVA 4MG2A 3ACHA 1CPNA 1SLTA 1LRHA 3EB7A 4LLOA 1ULDA 2D40A 1AJKA 4UW6A 1GQPA 1W0NA 5FMOL 5FFOC 3WEZA 4NAOA 2UWBA 4LIUA 3KV6A 3OSDA 1LOCA 5GLWA 2OIIA 3AYAA 4IESA 4JAAA 3JB4C 1KXGA 2GNDA 3M4FA 2RDNA 3N3HA 4XFFA 1W90A 2R063 2WFF1 3Q8BA 1TME2 5H9QA 3GNEA 2VZVA 4LITA 1LECA 1QY4A 2CGOA 3EHKA 1GICA 5ABJC 3NNJA 2B46X 4LE3A 4ZONA 3PVBB 2Z69A 1IQAA 4QXKA 4EN9B 4RA0A 1U0AA 4QKNA 1GZTA 4IEPA 1BKZA 3WF4A 3LCPA 3WNMA 4AVTA 5F5IA 5I0UA 4MSVA 1UY3A 3E5QA 3Q8CA 1ENSA 1ZZ6A 1WD3A 2YPDA 3JQXA 4COYA 1VBC3 1ZX5A 1OBNA 4RGKA 2JDAA 4WZFA 4CCCA 2FDKA 1RXFA 3H3ZA 1TQ5A 1V70A 3NVCA 2DUOA 4LQRA 5JWPA 3E5XA 3WNOA 3AVRA 4COWA 4AI2A 4OHZA 5F5QA 4AI0A 3VBUA 2GU9A 2XG3A 2CWMA 3DKWA 3I3BA 3DYPA 3VBUB 2QZ2A 2HWD3 3OGSA 1Y43B 3JZVA 3JQWA 4PF5A 2FMYA 4AWDA 5I8YA 3TEWA 4AI9A 2AEZA 1QHDA 3ZN4A 4B8EA 5FP7A 2J1EA 2DU1A 2WIIB 3NAPA 5D8AB 1QJX3 2H6BA 1DZRA 4AEDB 5JOZA 2Y64A 1H6XA 1C5HA 3ZYRA 4L9BA 3TN91 5FMBA 2XQXA 4Y22A 5EPAA 5JDBA 1FMD3 1I5ZA 1RUH2 2Q8OA 1WW4A 3THTA 1DIWA 1SPPA 4Y22B 5FY1A 4LULA 4MADA 3WW4A 4Y4RA 3U07A 5FYUA 1H1AA 1NE4A 2PQQA 1PO11 1UOFA 2A3XA 4M01A 4M3CA 2G1MA 3POWA 4N53C 1LULA 4D94A 3TRSB 1I1EA 2E33A 5A3NA 2ORXA 1UL9A 4Q4Y1 2Z79A 2XBO1 4H14A 4JGYB 3TOJA 1OQDA 2WN3A 3LEKA 3VBOB 4BK5A 1XRUA 3UGHA 3WHTA 1JZ2A 2WZEA 3VBSC 4AW7A 1CX1A 4BJ0A 1H8TC 2D43A 2DTYA 3AZVA 3LIHA 4J25A 4XF4A 5IFPA 1F35A 5CB7A 2A5ZA 1GP5A 3BCWA 5C4WC 5CFCA 1AJOA 4E27A 4XUNA 4NIAA 2BOIA 3WT3A 2WYSA 2WZR1 2E63A 5CFCB 2W87A 2P6HA 4AG4A 1FV2A 1LU2A 4QB2A 3HT2A 2D7FA 1AHSA 4LBQB 4Q4V3 1H6YA 1H9PA 4I3PA 3SH5A 3I8TA 3RZZA 5K0UC 2WQ4A 5C7GA 1OI6A 1KS4A 3S30A 3FMGA 1GZWA 1VRBA 4HETA 1WMEA 4M0HA 4CUCA 1V6OA 4C90A 5FZFA 2W08A 2AC1A 1O91A 1NCRC 2W9XA 4ASLA 5HI0A 3PUQA 4PLOA 3CJIA 3VZOA 1LENA 4UAPA 4QB6A 3P6BA 4QPWA 4N43C 5BXXA 1QJY3 2ADDA 1S2BA 2ZPXA 4CDWB 1GNHA 2R073 1QDOA 1RMU3 1O3QA 4XYXA 3HVDA 5JOWA 2QTWB 4Q4W2 5A33A 1LB2A 2VMFA 2WQZC 2ZGQA 4NRMA 3K51A 4W50A 1OA4A 2BWAA 3AP7A 3HBZA 4I09A 5D2AA 3DEMA 5A33B 3E1F1 2IZWA 3ME2A 2PTMA 3FLTA 3LSEA 4XF3A 4QPYA 4M4PA 3FX3A 2H0BA 4XEZA 4AI3A 2R49A 2ZGMA 1PK6C 4P9YA 5I0DA 4FCAA 2A7AA 3PTYA 5FYVA 1EUUA 3USSA 4YZ5A 1BEV3 3GHNA 1PHMA 4XABA 3UETA 3GHMA 5FR3A 1QJU3 2FQPA 2VNOA 3PIGA 4AQ6A 2BJSA 5DZFA 2HWD2 1S1AA 2XVLA 4P9WA 1WCKA 4YVSB 5IATA 3VUOA 2ZX2A 3DF0A 4HPKA 4ASMB 3J8F3 1RUJ2 3D6EA 5FPUA 4LO4B 3H42B 4AZZA 4ZU7A 4PQQA 1XNCA 3MGUA 3AXDA 4Q4X3 1OH4A 2BBAA 2DCKA 3ROUA 4XJUA 4LK6A 4LIVA 3SH4A 4J6GA 3J4UH 1NUKA 4R9DA 3KQ4B 4DUVA 1WLCA 3OGGA 2JXAA 2VH9A 4XUTA 1PZ8A 3T09A 5T5OA 4YFWA 2UY8A 4H3WA 1SBFA 2IXIA 1K5MA 2Y6JA 4UFLA 4YGBA 4AR2A 2JKXA 1V9U2 1K5MB 2PHUA 3ILFA 4YNIA 1O8SA 3ZFGA 1NA1A 3ZYFA 4MGQA 4XFCA 4XXAA 3I97A 3UJQA 4B1LA 5I93A 1SACA 1OHFA 3Q8EA 2Y6KA 1TG7A 5L7OA 3B9IA 1PVC3 1UMZA 2B9VA 3EYPA 5EXOA 2Y8KA 4QKBA 4S2HA 5CIRA 5LBEA 1PZ7A 4XF9A 1PGW2 3WV6A 3J7MA 4RYDA 3UV9A 2D5FA 4OI1A 4IE6A 4ZXEA 3UJOA 1AYM1 4BQ3A 4FPYA 4DY5A 1CQ9A 1WMFA 2LTNA 4KH9A 5J3UA 2BP6A 1YJLA 2GDFA 4QHZA 4PDWB 1ZNPA 3I54A 3J7NA 1ZRRA 4LBQD 4HVOA 1LHWA 1W8FA 3MYXA 2W39A 1RUE2 1W9TA 2AUYA 2D93A 1T2XA 1Y7BA 2ZMLA 1R081 4JVAA 1N1VA 1OF4A 4MX3A 4JHZA 4NR1A 3ZFFB 3B9CA 3MIFA 3WDTA 4L2NA 1RUD2 1RVF1 4ZKTB 5KXCA 2XJUA 4UW4A 3B00A 3ZX7A 4AHYA 1UU4A 1V6IA 3WF3A 2Y6LA 2HBUA 2BGCA 3ZN6A 4Q4V2 4XBLA 1UF2C 4Z82A 4LBKA 3D4KA 2R1DA 2NZ9A 2VD7A 2GP5A 4Q0SA 4Q8KA 4LOSA 1OLMA 4D7SA 1EPWA 4AQTA 3GCWA 3KV5A 1VBD3 4E2QA 1ASJ2 3N36A 2E31A 2MEV3 1QXRA 2A71A 4S2FA 3ZXFA 2B4KA 4FXGB 5FYSA 1NY72 5HCFA 4AK3A 2E9QA 3CZUA 4GALA 4LHSA 4XDQA 4QX1A 3SCFA 1FATA 4FBFA 2YROA 3K48A 3POJA 1RJ7A 1QJY2 3VD4A 4C0HA 2R072 1VLNA 3AX4A 3ZSKA 5A3TA 4LJHA 2QDRA 4XQDA 3I2DA 1QEXA 4NIGA 4MH0E 2ZJCA 1ULGA 1H2MA 3WSOA 5JXGA 1VBE1 2J42A 3LEGA 1RUG1 4FPCA 3W5MA 5A3OA 1WLTA 1O4TA 4LHLA 3POYA 4P9JA 1QNWA 1GR3A 1O5LA 1N1SA 2J1VA 2RDSA 2ATFA 1FPN3 2ZACA 2K2SA 1LTEA 1ZA7A 4GKXA 3MW3A 2L9LA 3AB0A 2LROA 4RSUA 4D8MA 1UWWA 3H7YA 3IAQA 5I91A 1CAVB 4QX5A 5J37A 4NROA 1C1FA 5A7WB 5JPNB 1O4YA 1MQTC 1NOVA 2KXLA 3J8F2 2W2IA 3FHIB 4NHMA 3WINE 4AEMA 4Q5OA 1ZZCA 2YGMA 3VKFC 4H2AA 4TXWA 1COV1 5FY0A 3M2MA 2ZHMA 3AMMA 1U12A 4EN8B 2H6CA 2VZUA 1OQ1A 3AP6A 2PFWA 4GH4C 4L0PA 1AR61 3ETQA 2VMIA 4N53A 4D69A 2VZ3A 3OGRA 4CXYA 3E6DA 4IV3B 2BBVA 4IEQA 3U10A 3JB8A 1GQGA 4N53B 2HWF3 1NXD1 1AXKA 3BTAA 3IDEA 2W68A 1S2KA 1VBA2 4DY3A 1WKYA 3VDDC 5E88A 3VBSA 3JXSA 3HAGA 4GAZA 3LIGA 5FZ1A 4XJWA 1X8MA 1AR93 1PVC2 1H8TA 4XACA 2HWB1 1MZ6A 4YLZA 2AZ5A 3VZJA 1Q8PA 1DZTA 2PHXA 1S4CA 4FPEA 1VIWB 4OMDA 2R043 5C4WA 4CXWA 2A1XA 3MV01 1JZ8A 1ZBE2 5C4WB 1YQ5A 1UZVA 1WW7A 3WDVA 2JDYA 1SEFA 1V0AA 2JG9C 4CVUA 5F3GA 3ZO0B 4QHBA 4HK8A 4GULA 4HKOA 3RMXA 2EALA 1Q8OA 2YU2A 5K0UA 4I3GA 5E6HA 4XTMA 4CDUB 1SLCA 1WCDJ 4MGYE 5K0UB 1JW6A 3ELNA 2DVGA 4RN5A 3I3MA 1H2KA 1UU6A 3SQOA 4CCEA 3IPVB 2RDQA 2XUEA 3KSCA 4I0BA 1NCRA 4N9IA 3TWIA 3WP3A 4ES8A 3VHPA 1NCRB 1VRH3 4RQPB 4AGRA 5J09A 3F2ZA 4KMQA 5IK8A 2XL7A 1CVNA 3JD72 1S0GA 4N43A 4XFAA 1FX5A 1SFYA 1QKQA 2ZGLA 1XU2A 3AL5A 3KHBA 1W2AX 3N9QA 1XBFA 1HRV2 2A6YA 4N43B 1OF3A 4PBPA 1ND2C 1JOPA 2WNUB 1D4M2 1LODA 1MEC3 5CADA 1JZ3A 4WM8B 2ZKNA 5IAVA 2DUPA 2D3PA 3KT4A 5I8SA 4WM7B 4A2UA 4UFKA 1YRZA 5HV0A 5DZGA 4DXRA 4YGDA 3C8XA 1AR83 1NLRA 4RHV1 4QHOA 3RZJA 2JDNA 1RUC2 1PK6A 3AZWA 1QJEA 2C1FA 1TMF1 3MZHA 4XUPA 4X8PA 1A8MA 2YG0A 1OT5A 2GNBA 1R64A 5JAXA 3HN3A 4HVRA 3AXEA 2KR2A 2FCTA 2VECA 4SLIA 1BBT2 3BODA 3MBWA 5EP9A 1IS6A 4XC9A 2BU9A 2VZRA 3ES1A 4CU9A 1LGNA 1IKPA 1F31A 1W8ZA 4LHNA 3PVEA 2FDFA 4C91A 4L99A 3HJRA 4XURA 4CUAA 5IT6A 1W8HA 4HFSA 2IFWA 4R9BA 2IC1A 1W3XA 3KV9A 3NNLA 2WFF2 5ISLA 1BHGA 3AZXA 5D1IA 3UGGA 3HEIA 1OFSA 5EZWA 3V0AA 5DDJ1 1YXWA 3AJYA 4GB33 4LBOA 4OI2A 4ZXKA 3V0AB 2VOTA 1DQ6A 2XB6C 4XCAA 5GM0A 3S7IA 1LGCA 1OVSA 2PELA 3ES4A 4EWDA 4C1WA 5FOBB 3FC0A 3LPFA 4YGEA 3BU7A 5GLTA 4IQPA 4D6SA 2RJKA 4CYDA 1ZVFA 4WVZA 2VQTA 5FPLA 1W6MA 2GH8A 4CCDA 5FAXA 1FI2A 3BTXA 4JTNA 3M8LA 2ZZJA 2V72A 1X9PA 1AR92 4KWLA 4CSWA 1BLZA 1XSRA 1ZRFA 1FV3A 1TZOA 4P9GA 3FLRA 2ZX4A 4L97A 1YCIA 1WBLA 5SV8A 2GC1A 4BQWA 3V0BA 1NLSA 3NWKA 1REFA 2XVKA 5T5PA 2C5DA 3NV2A 2QQIA 3ZMNA 3ZXKA 3V0BB 2TEPA 2VM9A 3ZYJB 4FP2A 1EAH1 2HYXA 1UMIA 2ZZQA 3C3VA 4LBLA 4O65A 4XBNA 2CGNA 3L9JT 4FPJA 1S0FA 2IXLA 3AYCA 4BU2A 3TEYA 3WW3A 4Y5TA 1Q8QA 2HEWF 1GBGA 3RFRA 1NCQC 3WR0A 2XXZA 2Y6GA 3CIHA 3H8RA 5FPBA 2VC9A 4AVVA 1M4WA 3TN92 4OLLA 3LGRA 4LO6B 3T2PA 3ACGA 4M0NA 2JDZA 3N35A 2VW2A 4A7KA 5AFBA 1AL21 2JKBA 4QPGB 1WW5A 2XR4A 4KGQA 4DOUA 3MV11 5DG2A 2E53A 2VCCA 1OOPB 5F3IA 1PGL2 1PO12 3D5OA 4INDA 4MUVA 2NN8A 2WR9A 3O1VA 4ORFA 3CHXA 4K8RB 2LM3A 3UGFA 3K3NA 4RFT0 4H7LA 2XJRA 4UOJA 5LA1A 5FZLA 1Q8VA 3WG4A 1SBEA 5FPVA 4Q4Y2 4XE9A 4BQXA 2XBO2 4EZHA 3BTZA 3NMBA 1H4HA 3IZOA 5LK5A 4COUA 3T4VA 3MDPA 4N7IA 1UX6A 3GBGA 1DP0A 3VD5A 2AREA 5FZ4A 3B02A 1WMXA 2VZPA 1JI6A 4B7EA 1Z7S3 4BB3A 1JYNA 2RMU3 1QWRA 4A44A 2ZBJA 4NMIA 4BLJA 2RS33 2JICA 4BDVB 2I45A 3VBUC 3O1SA 2P3IA 1HX6A 4BYYA 1MQTA 4GA9A 3WNXA 4MGZE 1BVVA 3N9NA 1CR7A 2HYKA 1MQTB 3OEAA 2GNTA 2PAMA 1FT9A 2TBVA 2ZHNA 5D8AC 1VB2A 1H1MA 3WNNA 4AEDC 4B1MA 1FOD3 4A45A 1RHI1 4Q1RA 1PO21 5A6QA 4GH4A 1AX0A 1AYN2 2BVVA 3CQOA 4AFDA 2WS91 1N3PA 1C5IA 2MPFA 4S2DA 4AFBA 2G9GA 1YLLA 1OFNA 1HKDA 4XETA 2CTVA 4HLTA 1HXS3 1KQRA 4IUGA 4MGKE 3AP5A 4OYUA 4GB32 3JBG1 4QXHA 5IW0A 3EJKA 5F37A 4W6WA 3VDDA 5IYYA 4LNVA 1MVQA 1J1TA 5A1AA 1UAIA 2BV4A 3AYEA 3KV4A 3UT0A 4Y20A 5FRAA 3OY8B 2Q1ZB 4PT6A 1JZ4A 4MXVA 2B7YA 2ORZA 3N9PA 1SLIA 1XNDA 2HH9A 3P3NA 3DYOA 4KWUA 2O14A 2QVSB 4MHRA 4JGYC 4EZ4A 2RM21 3VBOC 2BERA 2JG9A 2V09A 4FPLA 3RWNA 4KG0A 4XUOA 3UYJA 1UCXA 2YGLA 2DTWA 1ENQA 2J1TA 5FUIA 2JD9A 3J7LA 2Q8EA 4R4ZA 4NUBA 1NXMA 3V56A 1X33A 1ULEA 2V73A 3SEEA 3T2TA 4XW3A 4XAAA 3WX5A 4NIHA 4IXLA 4QQHA 2WNVB 3VKNA 1QQP1 4BWOA 4EN0A 5LK7B 1TME3 3H3UA 1K12A 3PL0A 3DKQA 2VTFA 3H8UA 3PIJA 1RUF1 4XFIA 3MPBA 4YRDA 4QQ2A 4CP9B 1R092 4B7KA 4I0WB 4DXSA 1ZZ7A 4DIQA 1SCRA 3GZTB 1GYKA 1ND2A 4J1WA 1UOJA 5GLVA 3C7HA 5FZ0A 3TEZA 2Z42A 3BOPA 1UKGA 3IM0A 2R30A 2IVIB 4IEWA 5F5AA 3S6PA 4GKYA 5IVYA 1BEV1 1HRI2 4XFGA 4XTPA 2WRAA 1QJU1 3LOIA 3RG0A 4UBHA 4FOVA 1YI7A 4CDWC 4QKFA 3TBDA 4M00A 3B94A 2QZ3A 3A7QA 4FFIA 3RWKX 1O7FA 3GJAA 1S2EA 4YWAA 1BK1A 3LFIA 1AYM2 4JQTA 2D6NA 4DXTA 2VUJA 1UIJA 5I0RA 3BIWE 3VB9A 1NAEA 4LA2A 2PMWB 2UWAA 4KNCA 2E7AA 4LUMA 3FFZA 5C8CB 1DHKB 2KD7A 3MEPA 3N7KA 4AVCA 2HWC3 1R082 4YZ2A 2RMU2 4B4RA 5BY5A 4JDMA 3USUB 3ON7A 2B39A 3IT8A 3WVJA 3J26N 3GZUC 3I2OA 1Y9MA 3WHUA 4NIDA 4YVSC 2X05A 5A7PA 4W65A 2WZ8A 5FPZA 1CJDA 3RZLA 4FTSA 5DUXA 3HIFA 1SFNA 4XUQA 3ZR5A 1FOD2 5IVJA 2VMEA 4IV1C 1Q5OA 3MF6A 2GAUA 4PI0A 4I30A 3VN4A 2RS51 3NV1A 2OA2A 5FWJA 2D5HA 2VTXA 1HB1A 1W6QB 2WWUA 4CDQB 2XPJA 1HXS2 1C3HA 1UYYA 2RJ2A 4P9IA 4LPLA 3T08A 1YQ2A 4AHWA 4DFSA 1ZRDA 5M0TA 2AH2A 3UNPA 1N3OA 3MUY1 2VO5A 2OXBA 3I2FA 1TE1B 2V4AA 2CNAA 1DBNA 5L19A 1MZEA 1MS3A 1M06G 1OKOA 2YC2A 3HBKA 1YO8A 1O3SA 3QD6A 1J3QA 4LK7A 1L3JA 1N47A 1W6NB 3SKVA 5C5UA 3LQCA 5IFTA 3VDAA 5JIUA 3H1WA 1DLCA 1Q43A 3D3AA 3DXTA 5HBAA 4OUSA 3SH3A 5ANQA 5AC91 5FDBA 5J36A 4PDWC 4DEVA 5A3MA 1DYOA 2F4PA 1JH5A 4DUWA 3DECA 1U5ZA 3LEIA 3SKJE 3WXPA 2DCZA 5JI9A 3DCQA 1YFUA 1YFWA 3I7DA 3LZZA 1NCQA 3Q8AA 2A6VA 4MXWB 3ITQA 3ZFFC 1RL3A 2PLV1 4XCBA 3AM2A 5FZ7A 1NCQB 4DRRA 3BVCA 2JENA 1ULPA 4CDXB 1S0BA 2BWCA 2ID4A 3WOGA 5BNPB 3K4DA 1SMVA 5FJHA 2BVBA 1O5UA 1W04A 5H9RA 2XLAA 3KF5A 4AI8A 1POV1 2AEYA 4FP3A 1OXCA 1COV2 3MHZA 3OB8A 1H8VA 2DURA 4OMCA 5J96B 3POEA 2NQYA 1W39A 3OUHA 4YZ3A 2XJPA 3A0NA 5JZGB 2A70A 2R1BA 4SBVA 2OZ6A 3MW2A 4Q4W3 1S0IA 2J1RA 2OZJA 3OG2A 3CMGA 2VXRA 1CPMA 2IXJA 1GOGA 4PIYA 4Z2WA 2FDGA 5JXHA 1DQ1A 4UWDA 1GANA 2KA3A 1YC61 2PXJA 2K0GA 4WBBA 2XJSA 4Q0UA 2BUKA 3WNKA 2W47A 3FUQA 1J84A 1DCSA 4COZA 5FTTC 4JGZC 1REDA 3LDKA 5A3WA 1IS5A 4HBNA 2VCBA 3HNMA 5C3RA 1QH6A 4L92A 2VVDA 4C1XA 5JSRA 3WDWA 4DINB 1DQ2A 1ULFA 3X29B 1RUJ3 5D8AA 4AEDA 1DF0A 2HWC2 3T1MA 2FDIA 2ZHKA 1G7YA 5T5JA 4HN1A 4IETA 4KWJA 1IKQA 2R0FA 2ZEZA 2XJVA 2B42B 4IE5A 5IAXA 3ST7A 3SEPA 5IK4A 2VG9A 4UBGA 3O1UA 1V9U3 5CAZA 2WJSA 4YSFA 2VE1A 4GQ7A 1F4AA 2YYOA 3VGIA 4HL0A 2ZX0A 3ACIA 2BPA2 2RR11 4S2GA 4PBOA 1Q8SA 5C3OA 2OW4A 3ZYBA 1W8OA 1X8EA 1UPSA 1X9TA 1BMV2 1CAUB 1PMHX 2K46A 1E5RA 4IV3C 1FNZA 2I2SA 1AR71 1DGLA 1W0PA 3CJXA 4MV2A 4Q26A 4EROA 4JGYA 5FYTA 3VBOA 2WO2A 1UZWA 2BQPA 2AENA 1ODNA 3AZYA 1DQ4A 3C7EA 3ZVXA 3E5UA 4HZFA 4H55A 1RUNA 3ZOIA 1KS5A 1TMF2 4X8NA 5FP8A 1SLLA 1RUE3 2C26A 1K45A 5LW9A 3AVSA 4A3XA 1GV9A 1CIWA 3NNFA 4PF1A 4FOWA 3PUAA 1LESA 1MS0A 1TNRA 1RUD3 1HN0A 1UZZA 4AEKA 2W5FA 2QKDA 4LBQA 3VV1A 1MEC1 2DCJA 2I07B 5ABJB 1ZRIA 5I8TA 2HWE1 3WP4A 2PHFA 5C33A 2EAAA 2Y0OA 5FO9B 3NJZA 4CDUC 1KFXL 4FPGA 3MLKA 3BKZA 3KMHA 3ZXDA 3KGZA 4XIKA 4M4RA 2XKPA 3R6SA 5DAWA 1B09A 1GZ9A 3OPTA 1ASJ3 5ACA1 1GQHA 3WQ7A 4FFFA 2G9FA 5FZAA 2WNEA 4YW6A 5DDJ2 4RQPC 5FOJB 5LZ6A 5JMCA 3RZMA 3WG1A 1ND3B 2JE7A 4YVWA 2JG8B 3AYDA 3URFA 1LOAA 4CDWA 1F15A 1SBDA 3C2UA 4YVWB 1W9YA 2ZGPA 5GZEA 1CX4A 2VUDA 4E4ZA 2WNUC 2CL2A 3KGLA 3ACFA 2YBKA 4TZDA 3LKJA 1RB8G 4UFHA 4WM8C 3EBRA 4F3JA 1R1ZA 4XILA 4WM7C 1C8M2 1UD1A 2Y34A 2NP0A 1CESA 2P5BA 5FZEA 1XYNA 2AACA 1PMIA 1RUI3 3H8XA 5FLJA 2RS13 1O4ZA 2GN7A 1VALA 2AR6A 3NKGA 3SISA 3WY6A 4ZZ8A 2JB4A 2IWGB 2J1SA 2PAEA 3AMHA 3RMYA 5A80A 4UYBA 4QQLA 2FCUA 3VLBB 4YVSA 1EAH2 2V5DA 2CY6A 1WA4A 3FE5A 1XE7A 3PTRB 4FO9A 1AUYA 3PMSA 2HJIA 3CEWA 5G05L 1LU1A 2G9ZA 2YBPA 3O0WA 4ITCA 2WZPP 2DF7A 5DZEA 5DUWA 3S5QA 1D4VB 2NYYA 2RG4A 4CP9A 5BNNB 4FAGA 2JX9A 2PHWA 4IV1A 5FZMA 1D0HA 1LR5A 4AHZA 4IV1B 5EWSA 1QXPA 4TSVA 5FP4A 1J3RA 1EV12 4HN0A 4UXAA 4DEQA 2JWPA 3K77A 1LEMA 4GXLA 5APAA 5FY8A 1IHMA 4BMBA 2BTVC 1ZA4A 4D0QA 2ZOEB 4QX3A 1CWPA 5GKAC 1UY1A 4DQAA 3KCYA 1MR5A 1WMDA 3N7LA 1VBA3 2QQWA 4TN7A 4UT5A 5BYNA 2WO3A 1LKNA 4CZSA 3QBQA 1WLDA 3M3IA 3AP4A 3IMMA 3W21A 2EXHA 2I74A 3S5AA 1UNBA 4KBZA 1RC6A 4B29A 5JUVA 4QGMA 3W9AA 1R1A1 2ZKLA 3NL1A 3B93A 1ZBE3 4Y1UA 1FXZA 2E7QA 3BPZA 2JDKA 2VMDA 4PDWA 4LO8A 1GNZA 2VOWA 1ZBA1 4YW3A 4EV0A 2VUCA 5F5CA 4BIOA 3W59A 2PHTA 4QDRA 3ZIXA 2G19A 3ZFFA 1DYKA 1YWKA 5FUPA 5BPXA 4K8FA 1EPZA 4HK9A 3CLPA 3ZKYA 3C7FA 3WCRA 3OPWA 2ZGRA 1JS9A 1I5PA 4WVMB 2ERFA 5F2WA 4NPRA 1MS1A 4FPOB 2R7EB 2ET7A 1RHI2 4URTA 4PIZA 4YM3A 1BXHA 1PO22 3JD73 4O9EA 1X82A 5KHKA 1GMMA 5KBFA 1YI9A 2WS92 1HRV3 4XBQA 3I49A 4NAMA 3FWEA 4M3CE 3MIGA 1D4M3 5FJKA 4O7XA 3KF3A 4ARXA 4YYOA 1KGYA 2P17A 4QPGC 3SXWA 4GWIA 1W06A 1VBB1 4YPJA 1JOJA 2QNKA 3KS7A 2RS31 4XJZA 3MPPG 1OOPC 4FOYA 2YMZA 5FMCA 2BZDA 2GNMA 4J1XA 3SNMA 1X36A 4XIOA 1RUC3 3M1HA 4ONUA 4JGZA 4QU1A 2ZABA 3KCCA 4XJAA 5A7QA 4FI9A 4EWAA 1NLQA 3S57A 2QQVA 4JGZB 2IXHA 1O3RA 2IUWA 2RM22 4NJ4A 3NJYA 1C28A 2MHFA 1OC1A 2EVXA 3HQUA 3MIBA 4E8CA 1AZDA 1BBT3 1QGLA 4GMP3 5CG8A 1RUI2 4IE0A 4XQWA 2RS12 4JZRA 2WUHA 1PX3A 3UK9A 1S0EA 3ORJA 3O5SA 4BQ5A 1C57A 1GOHA 2YZ4A 4MGIE 2OQ7A 1RIRA 4AQSA 1CAVA 1US3A 3WD5A 4Y1VA 3SHRA 4AYUA 2YDEA 5FUNA 5JMOA 4Z92B 5A7WA 2XHKA 1GSLA 1BYHA 5EV7A 3ABZA 2WFF3 1UYPA 4ZY9A 1LJ7A 2ET1A 1VAVA 2W95A 4BM8A 3K46A 2YB7A 1PVXA 1RUF2 1W0OA 2WBKA 3ZIWA 3OYWA 1NZCA 4Y1YA 2CU5A 3OYWB 1KDMA 4LXLA 3IN9A 2FDJA 4W6XA 4YW5A 2W94A 4IV3A 2PAKA 4K21A 1KJLA 2B9UA 3THDA 4LBNA 5E1RA 4QAWA 2BNNA 3QCWA 2VNGA 4QX2A 5E8AA 4P14A 3ZN5A 5H9PA 1VMHA 2Y60A 1IG0A 3LF7A 2UY9A 1TME1 3OTFA 2IXCA 3PVOA 2JE9A 4X6QB 1XB9A 3S0MA 4BIFA 2GC3A 2XONA 1NZIA 4XMAA 2YHJA 4LHKA 4Q0PA 1OKQA 2Q1MA 2R6QA 5GZFA 2VGDA 3FN9A 3CKHA 4CDUA 2WT0A 3PJYA 3MIHA 1W8NA 4XFBA 2VPVA 1ULOA 5CG9A 4P5YA 1IOAA 3IPVA 1VR3A 3IMNA 1C8NA 4P9LA 3RJRA 3ETPA 2OUJA 5FZIA 4N7UA 2BRTA 3NSTA 4O61A 2WNVC 5FYCA 5LY2A 5EYYA 3VBHB 3KHCA 4UF0B 3BIEA 2QQOA 1UN1A 3D82A 2FMDA 4JQRA 1PIV2 4LO5B 4RQPA 3TN93 4CCLA 1FNYA 2YY1A 1CD3G 1JHNA 2WLQA 3AFGA 5BNOB 3OD4A 1DYPA 5FYYA 1D2QA 1WGPA 2B8MA 5HCBA 3R4SA 1GOFA 1YUDA 2WNUA 3NRUA 1OMIA 1PO13 2RS52 3FZ3A 4K6BA 3O0XA 2JD4A 4YW7A 2D3SA 2VJXA 4WM8A 5A6YA 2QBXA 1IGOA 4WM7A 1UXXX 1W9WA 3K2OA 2VVEA 4Q4Y3 2WA3A 4NN0A 2XBO3 4Y24A 4E9KA 3HR9A 1SDDB 2Y6HA 3CNAA 1Q56A 4W8JA 3KLSA 3VZLA 1IPJA 2DVFA 5CISA 4G9SB 3DPRB 1UOBA 5I0TA 5F2SA 3APBA 2GC0A
chains in the Genus database with same CATH topology
3PLQA 1RUH1 3KB5A 3GZAA 1YIFA 2WZR3 5AC92 4R9CA 1QXJA 4EJRA 2GALA 2UWCA 4K3UA 5C8CC 4YW2A 2A6XA 2PHDA 3RDIA 1H9WA 4IL7A 4MZUA 5T5LA 4HMZA 2PLV2 3O0VA 2OVUA 3B7MA 1AYN3 4OUMA 1LGBA 4FXKB 4LO7A 2X5IC 2WFPA 2IXKA 3KM5A 4K40A 3ZMOA 1D0GA 4JRAA 4BMEA 2E7TA 5JCTA 2ENRA 4RS5A 4D3WA 4JTOA 5GJ6A 1KJRA 3TNQA 4RS5B 1ENXA 3M3OA 2ZHLA 4DXZA 4CDQC 1S55A 1A3KA 4JDOA 2W52A 4PJYA 4H7MA 2R061 4KGGA 4LEJA 5CNAA 1Z78A 3GYDA 3AKSA 4K7JA 3N4MA 4XFHA 4RL7A 1AXYA 4IEVA 1XQNA 4P5HA 3ZFEB 4F8AA 4ISRA 1B35B 4N9HA 1RJ8A 1N3QA 3ZXJA 2D6OX 2D44A 1RGSA 4Q4W1 1R093 3U11A 1EP0A 1VBC1 4X6RB 3CL1A 3CO2A 3UKVA 5T52A 2P34A 2Y0IA 2VVFA 3EXUA 4CDXC 5JLVA 1AF9A 4QPGA 5BNPC 2BNMA 3EQEA 2BFUL 2WINB 2VOVA 1OOPA 2ZAHA 2XLGA 4NOTA 1HRI3 2JJ6A 4W6YA 2RR12 4ZU5A 4AGGA 5L36A 3FBMA 4IEXA 3LA7A 2X8KA 1DG6A 2HWD1 1AL0G 4YM0A 4CP0A 2ZGTA 5K7PA 5JZGC 4OI0A 1AR72 5I0SA 1VB4A 4WVVA 4C0BA 3LSDA 3THPA 5J98B 5JI7A 1QJX1 1AYM3 4QU2A 5A32B 4FPKA 2GMMA 3RJ2X 3H7JA 5F6KA 4WZCA 2ZAAA 3ECQA 1R083 1O3RA 3VKOA 3VZNA 1FMD1 4E4SA 3KT7A 1YFXA 1JYIA 2O0OA 1SLBA 4QM9A 1RVF3 2WZR2 2XWJB 2ES3A 1W6PA 2DCTA 2ZX1A 5FO7B 2SLIA 4CTEA 4YW1A 4FTEA 2TNFA 1W6PB 1I9RA 4YM1A 4NO4A 2LUWA 3RRDA 2YC0A 2FZ1A 5ACA2 4I01A 1XNKA 1WBFA 5DUUA 5TSWA 4HANA 1KRIA 3M3EA 4KU7A 3KCXA 5LRSA 3OY8A 1V6LA 4DNYA 1QNYA 2PHLA 1BZWA 4QMAA 4OZXA 3WG2A 2CAVA 1I6XA 1CONA 2Z2SB 1G9DA 2GMEA 4Q4V1 4QPIB 2HEVF 3AMNA 1LCLA 1ENRA 1MS5A 1VBE3 1RUG3 1V6JA 3OPZA 5KHHA 4AVSA 4Q0VA 4Z07A 3ASIA 1VAMA 5EJ3A 1RUOA 2D6KA 3NV3A 1YNAA 3VBFB 2WNVA 1MZFA 3DL3A 3VKLA 2GH2A 3U0ZA 1QJY1 2D6LX 2JECA 1Z0HA 1RMU1 2R071 2O8OA 3OF1A 3LB9A 4Q27A 5ABJC 3KT1A 2XJTA 3IBMA 5T3NA 1COV3 3N7MA 4QT6A 3ZXEA 1H0BA 5GZDA 1AR63 1LOFA 4BPZA 5GZCA 2Z5WA 1YJKA 1ND3C 3WZ1A 5C9AB 2VNRA 1PZ9A 2JG8C 4CEWB 4AVBA 4YVWC 3HT1A 1YIPA 2EF6A 2HWB3 5LEJA 1XXNA 1D2SA 3AKTA 3J8F1 3KZ4C 4YM2A 4AQ2A 4KU8A 4XHXA 1QOTA 2YXSA 1R1A2 4Q4X1 4V1PA 4JV4A 3SCHA 2XL9A 5C8CA 3L2YA 1ZBA2 4BCUA 2DVAA 4NWVA 2ZMKA 3USUA 3PMEA 3AZZA 1N1TA 1BQPA 3MICA 3R4UA 1AVBA 2EXJA 1S0JA 4JDNA 1QJZA 1NG0A 4AEJA 1RVF2 3E6BA 3BALA 4HKLA 1PVC1 4KG8A 2X5IA 2ARBA 4FAHA 3GALA 5K9YA 2X5IB 2HKXA 2WT1A 4CRQA 5BNNC 2DUQA 5J7MA 2PN5A 1V00A 2BNOA 1ZBE1 1POV0 3VBRB 2D6MA 4BH9A 2ZTNA 1CAWB 1W6QA 4CDQA 5FBZA 2D6PA 3KD4A 1VBB2 5CFDB 1UW8A 4I0AA 4BOWA 4YZ1A 1UPIA 4EN6B 1GLHA 2VULA 5AVAA 2D98A 1SQ4A 3MLLA 1APNA 4JC1A 4E4DX 4RR3B 3WW2A 2DVDA 1F2NA 1TMF3 3M3QA 1X7NA 1W6NA 2BEOA 4PLMA 3WW1A 3IDBB 4DZGA 3ZSJA 2A73B 4F83A 1VBE2 2ZGSA 1RUG2 1VBD1 3A0KA 4DMIA 2MEV1 4MXWA 4B3NA 3B5LB 3IDCB 5IUQA 2XUMA 3WLUA 4CDXA 3FBYA 5T50A 5BNPA 3O7OA 2WSUA 3AP9A 5DDJ3 1QDCA 1JUIA 2DCYA 4DS0A 5FREA 3FFQA 3T1LA 1BBT1 5JZGA 4GMP1 1AR62 1ZRCA 4XMIA 3ZYPA 2QCSB 4M3CF 1ZZ9A 1V6MA 2BW8A 3ZXGA 2VMGA 4DB5A 1FPN1 1DGWA 5AVPA 2A6ZA 2N7GA 1C8M3 4TWTA 5GALA 2WC2A 3AMQA 1LHUA 1U5IA 3OBRA 3SITA 4KBBA 2D97A 2HWB2 1W2UA 2ZMNA 1ZREA 1YYNA 1EAH3 1TNFA 2WSVA 2ZGNA 1T6GC 3ILRA 4IEZA 1ZYBA 2UU8A 4XXPA 2HWF1 3ACLA 5JSPA 1DFQA 2KM2A 3KQRA 2Q4SA 3ZYIB 1EV13 3H1MA 1AR91 1W6OA 2QFEA 2Q30A 1V6NA 4Y1XA 3VZKA 2NMNA 4AHXA 1AL23 1S0CA 1PNFA 1W6OB 2Q0AA 1G9BA 3TB0A 2R041 1WLWA 1HDKA 1CN1A 4PCRA 2ETEA 5H9SA 5AFEA 1CAUA 2VW1A 3WP6A 3ZXAC 3L2HA 3D8CA 1GKBA 3M3CA 4XZPA 4DPNA 3WCSA 2Q5TA 1Q3EA 3TAYA 4BE3A 4R9AA 3Q9OA 5FO8B 3NAPB 4UW5A 1DGWX 4WVWA 3HWJA 4RHV2 4QQPA 3I59A 3VHOA 4Y1ZA 4GWMA 1VRH1 1U5XA 3I59B 5GZGA 2ZA9A 4I2OA 1PGL1 2XGXA 1NQJA 5ABJA 3D0JA 5BUVA 3MW4A 3AJZA 2JEMA 1TEIA 3HD8B 4HKWA 4M3CB 1ALYA 4AE2A 1RHI3 3BOWA 4XJ9A 1PO23 2DFCA 1G9CA 1JXNA 4BZ4A 2FZ2A 1AR81 3VBHC 1H1IA 2EXIA 2WS93 4YG0A 1ND3A 4AXOA 1XNBA 1O3TA 5BNOC 3JBG3 2JG8A 4GWNA 1U5YA 3RQ0A 2CAUA 2FBEA 1GFF2 1AX1A 4QQOA 1OD5A 1RITA 3FLPA 4IEUA 1BJQA 1OLQA 3RNSA 3TYJA 4XF1A 1DQ0A 3OJBA 4UW3A 5DXDA 2AGSA 1J1LA 2RM23 4HVQA 4LLFA 3B3QE 4AGVA 1AYN1 2R062 4XF0A 3DPRC 3AKQA 1GZWB 4K1ZA 2WKKA 4NHKA 4YGCA 3PNAA 2DVBA 2NMOA 4GB31 3ZYGA 5EYXA 3CJIB 1QQP3 1CJPA 1CGPA 5CU1A 4QGLA 3MFCA 4I02A 5BNNA 4OHXA 1CAXA 1RUF3 1JN2P 1VBC2 1CAXB 2PHRA 5K8SA 1QOOA 4OULA 4KL1A 4Y26A 1H4GA 2UYAA 1DGRA 2EIGA 1REEA 3EO6A 3RS6A 2O8QA 4HT1T 1HQLA 1AL22 4PIXA 1DLLA 2SBAA 3TNPB 1LOGA 4FOQA 2UURA 4Y4YA 2VW0A 4RS5C 4CP2A 2ZCWA 5FMOS 4FT8A 1H2NA 4HPKB 5JPMB 5CVRA 1QJX2 1R091 1WUVA 3WDYA 5GLZA 5C6CA 3WDXA 1H2LA 1FMD2 1FAYA 1IS4A 1HRI1 2LALA 1G86A 5L73A 2GC2A 3ZFGB 1NA1B 1PNGA 4PQ9A 2V5YA 3ZFEC 4WVMA 5KHIA 1B35C 1XU1A 1PIV3 5L7OB 3FJSA 2OYZA 5E16A 4YARA 3JCIA 1RINA 2X53S 3HQXA 2VMHA 1XYOA 1V6KA 3MIEA 3E6CC 2RS53 4XHBA 2XWBB 3E97A 3LA3A 1I3HA 2C9AA 4WV8A 4F7ZA 1Z7S1 2RE9A 3JBG2 2RMU1 4AF9A 1BCXA 3P3PA 2E6VA 4CEYC 1WCSA 3DV8A 3MIDA 3RYPA 1ONAA 4G3YC 3DN7A 1SDWA 4K1YA 2TUNA 4RGGA 5KXBA 2CYFA 3ZN6B 2B5HA 1OLRA 4FQ4A 3AKRA 3PJQA 1FOD1 2CGPA 4OFGA 2R32A 2DU0A 1XE8A 2G4IA 5KHGA 5AC93 3OGJA 4RGAA 1LOEA 4FQZA 3WDUA 1HXS1 2ARXA 2A75A 4QGNA 2PLV3 4OHYA 4DRVA 1EY2A 1QQP2 2QE3A 1RMU2 1VP6A 3VL8A 1POV3 1OA2A 2W0XA 5A3LA 5LRRA 4BLIA 3W58A 1VAKA 2DFBA 3HMYA 1DU3D 3SCGA 1UKRA 5JOYA 2BYVE 1F9KA 3OCPA 1BEV2 4HSLA 4NHLA 1QJU2 2CV6A 4LUKA 1MACA 1KITA 4OHWA 3RI8A 1URXA 2X29A 3ALQA 1EYBA 1JBCA 4QPIC 4Q4X2 4IEYA 5HXVA 4L11A 1AXZA 3ZXLA 2R0HA 1OSGA 4U2AA 1ULCA 4EWEA 1QU0A 3B01A 1GZCA 4YW4A 2QUOA 3O14A 4XJ8A 3WUDA 5KWRA 3VBFC 2DYCA 3WP5A 1H30A 4K20A 3VBHA 1XYPA 2WA4A 5E89A 5GLUA 3VBSB 1A78A 5BNOA 3H9AA 1HV1A 1H8TB 3AFKA 3MFAA 2R16A 2XVGA 1MZ5A 3UKTA 3S7EA 3WG3A 4HSJA 2RR13 1NYWA 1PM7A 1WW6A 4GIQA 3CF6E 4ES9A 3UKNA 3ZSMA 1YFYA 4YZ4A 1AR73 1LOFC 1QH7A 4AI1A 5FPXA 3M70A 2HWC1 3H0OA 3PVNA 1MS8A 5C9AC 2HEYF 2EA7A 2XKOA 4CEWC 5FLHA 4JCKA 2WL1A 4Y5Z0 3DPRA 1ZZ8A 4EN7B 2FHRA 1WD4A 3ENRA 1JYCA 3LWCA 2RHPA 2D3RA 4U36A 1UIKA 4Q8LA 1PGSA 3RI9A 5CBLA 3QOPA 4LBJA 2A3YA 5FQ0A 1VJ2A 1VBD2 3QLQA 1DDLA 5FQ0B 4Z1VA 3J9SA 3ZDSA 2MEV2 1BMV1 5F6LB 4ATFA 2HWE3 5JIAA 2VQAA 1SLAA 2VOXA 3ILNA 2GMPA 3H50A 2WWSA 5ACA3 3QH6A 4Q2FA 2UYBA 1LOBA 2GN3A 2B45X 1PK6B 4D7YA 3G7DA 4MLOA 3I4IA 3NW4A 4YG3A 1C1LA 3OBTA 3VBRC 3IKWA 1HQNA 5C8WA 5BNQA 4FPFA 3VL9A 4B4QA 1FPN2 1IS3A 4A7ZA 4META 2PYTA 3RYRA 5CFDC 3AMPA 3OD0A 4Q29A 5J48A 2EAKA 3AKPA 4RR3C 1OPOA 4Z8BA 5IK5A 2VU9A 4ZU4A 4JRLA 2Y26A 5HCAA 2P3KA 1J59A 3ZFEA 4K9SA 4BHPA 1B35A 1IPKA 4QM8A 4BA6A 1OA3A 2IFRA 3M7AA 1F5JA 2HWF2 2NPIA 1C8M1 3DGTA 1W6MB 3SLIA 1G9AA 4FTBA 1KDKA 4E2SA 1HQWA 3WQ1A 1E57A 3MI8A 4MVTA 2R042 2YV8A 4CEYA 2ZX3A 5SV5A 3V64A 4KQ7A 4CEYB 2E51A 3IWZA 3VHRA 4ISQA 1RUJ1 1JUHA 5DG1A 5T55A 1QOSA 1R1A3 1NE6A 5A32A 4CP1A 1LHOA 1SCSA 4TLFA 3LA2A 3VHNA 4AFMA 1EV11 1ZBA3 3AK0A 4ATEA 1VRH2 2VUAA 1X50A 3NO8A 1V9U1 4FPHA 1HIXA 5FLIA 2VY0A 4LR4A 4IEOA 1KD7A 3IIAA 4E2GA 2RJLA 1MS9A 1MEC2 4MYEA 1S0DA 2QJVA 2HWE2 4Q1PA 2VOKA 1MVEA 3GBFA 3VKMA 1PGW1 1ZM1A 4AFCA 3QH7A 1DGRN 3CU7A 4QD2A 3QACA 3JUUA 2C0ZA 4NWWA 1AR82 2OUHA 4LA3A 3O12A 4OHVA 3FUOA 2XJQA 2GZWA 1OQEA 1RUE1 2A3WA 1VBB3 4A7YA 3MF9A 1LHNA 3INAA 1RUD1 4R52A 2NLRA 4IERA 2WLPA 4QPIA 2ZS6B 1DQ5A 1NQDA 1F5FA 1RTVA 5KXEA 1FYUA 1LHVA 4R8HA 3NAPC 1G6NA 1ASJ1 4BQ1A 4RD7A 4GH4B 1IZ3A 5B2GB 4TYSA 2YUEA 3ZPYA 2A6WA 3D0SA 5JSOA 4L8QA 3VBFA 2VQ0A 1NY71 2K9ZA 3VDDB 2P37A 5CA6A 5FCCA 3WQ0A 1A6CA 1J3PA 5DUVA 1N1YA 4Y20B 5KC5A 4XOGA 5LEKA 2Y38A 1A8DA 2DV9A 4LE4A 3PHMA 3RSJA 3H1YA 5KHJA 2DWRA 4YFZA 1JTZX 2JG9B 1AX2A 1HLCA 1RUI1 4KWKA 3G6JB 2RS11 3WUCA 3POSA 5C9AA 5BV6A 4CEWA 2ZGUA 4XPVA 2GSYA 4LT5A 1HV0A 3N7JA 1QF3A 5CFCC 2YPJA 3RYKA 3U4XA 2NM1A 4FVVA 5KC6A 3R05A 2ZGKA 3BB6A 5IK7A 3SMHA 4AFAA 1MS4A 3DUIA 1YHFA 1ZZBA 1OPMA 4O9GA 3VZMA 3GF6A 1ND2B 2CWSA 3ZSEA 1UU5A 1HW5A 4YG6A 1QMJA 2P3JA 2H0VA 1C4RA 4LTAA 1VBA1 1Y9QA 3CJIC 1KFUL 5F1RA 2ILMA 2PA7A 2XLFA 5JR7B 1BVP1 3A4UA 2ZGOA 3LOBA 3RPQA 3GBWA 4PLNA 1J58A 5T54A 3VBRA 3NKTA 4N90A 4LBMA 1CAWA 1Y3TA 4D7TA 3V65A 2WT2A 4GMP0 5EFUA 4OVEA 1Z7S2 2MNGA