1JXNA

Crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
SDDLSFKFKNFSQNGKDLSFQGNASVIETGVLQLNKVGNNLPDETGGIARYIAPIHIWNCNTGELASFITSFSFFMETSANPKAATDGLTFFLAPPDSPLRRAGGYFGLFNDTKCDSSYQTVAVEFDTIGSPVNFWDPGFPHIGIDVNCVKSINAERWNKRYGLNNVANVEIIYEASSKTLTASLTYPSDQTSISVTSIVDLKEILPEWVSVGFSGSTYIGRQATHEVLNWYFTSTFINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords anti-H(O) lectin I
publication title Examination of the Structural Basis for O(H) Blood Group Specificity by Ulex europaeus Lectin I
pubmed doi rcsb
total genus 58
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jxnA00
3WDUA 1DZQA 1ULGA 1CQ9A 5H9SA 1G7YA 3INAA 1KDKA 2I2SA 1GSLA 1MS4A 2VW1A 3IM0A 1C1FA 4WV8A 5T52A 3W58A 3B01A 1NLSA 1RITA 2AREA 5DG1A 3LSEA 2VUAA 1QGLA 3TAYA 2EXHA 3FFZA 3ZSKA 2ZKNA 4YW2A 2AR6A 2A75A 3W59A 1W0PA 3M1HA 4FPJA 2R0HA 4ASMB 1ENSA 5DZFA 1BJQA 4UW5A 1CPNA 5DG2A 2FHRA 5GLVA 5JOWA 2GNMA 4FOVA 3NV1A 3RS6A 4U36A 3IPVB 4FQ4A 4GKXA 1OFSA 2D43A 5GZEA 1IKPA 2A6WA 1PZ8A 3AXEA 5DXDA 1QNWA 5JOZA 2PHUA 1QDOA 3RMYA 1GICA 2PHFA 2WJSA 2W68A 1V6IA 1S0JA 2ZGOA 2D6MA 1LOAA 4OZXA 3UK9A 5EYYA 3SISA 2NP0A 2PHXA 3AZYA 2A5ZA 3D4KA 2DVAA 1B09A 1UN1A 2CY6A 1AJKA 1QKQA 2C9AA 3O0WA 4FVVA 4Q8LA 4PQ9A 5T55A 3N35A 1ULFA 5CB7A 4BPZA 5JOYA 1ZA4A 2ZGQA 4XXPA 3O0XA 3R4UA 1QOOA 1QOSA 1X50A 2A71A 3A0NA 4BMEA 4YLZA 3FLTA 1RIRA 4Q27A 1A78A 1VAVA 1G9FA 1JHNA 2D6OX 3AP4A 3Q9OA 4YG3A 2A6XA 3V0BA 4XBLA 1YRZA 1FNYA 1AX1A 2DU0A 4XJ8A 2OUHA 5EYXA 3AP6A 4XIOA 1S0DA 2AGSA 2ZA9A 1DIWA 1DQ2A 3SNMA 2WQZC 1N1SA 1JBCA 4XOGA 1HDKA 1RINA 4Y22A 3MPPG 3PVEA 4XJ9A 1BKZA 2ZHMA 3WDXA 3WDWA 1IS4A 4LBMA 3M3QA 5CNAA 3WOGA 5T5LA 1LTEA 2DV9A 4FOWA 5HCBA 1APNA 2DUPA 1FV3A 1Q8SA 5DUUA 3VKFC 3OY8B 3AJZA 4XMIA 2P3JA 2ZGRA 5GJ6A 2ZGNA 4FQZA 4K21A 1KRIA 2D6KA 1V6LA 2EALA 4TZDA 4LBOA 4FPGA 3FLPA 4AYUA 1AZDA 1MVEA 4NO4A 3AZWA 2GNBA 3OGGA 1OQ1A 1YIFA 1Q8QA 3N7JA 2WSUA 3OBRA 4YM2A 4DFSA 4DRVA 1LEMA 2ZMLA 1JN2P 1LHUA 3OYWA 1GZCA 2DVBA 4P9WA 4BLJA 3ZXFA 3VKMA 2A3XA 2GNDA 4XHXA 1CJPA 3UL2A 3VKOA 4YZ5A 5KXEA 1S0BA 2VXRA 4P9YA 4DRRA 2A70A 2JECA 2ZGMA 4M01A 5KXCA 3PVOA 1LHWA 4Y1YA 1CIWA 2LALA 5GZFA 5IK7A 2ZGSA 1OKQA 2DWRA 1GNZA 1BZWA 2GALA 2R16A 5LK5A 3T1LA 2UURA 1HQWA 4XXAA 1DYPA 2SLIA 1LOFC 4ATEA 3AP5A 4LBKA 4KBBA 4R9CA 3NWKA 3V0BB 4K1ZA 3BODA 4YFWA 3ILNA 4DPNA 3R05A 1Y7BA 1SLLA 3PMEA 4ZXKA 3AZXA 3LSDA 5JOXA 1BYHA 3AYCA 1SCSA 5JVVA 4C1WA 3O0VA 3AJYA 1Z78A 5IUQA 1VAMA 4Y22B 1YXWA 5T54A 2ZAAA 3SITA 3ZXJA 4GXLA 4AVTA 3ATGA 1C57A 5GLWA 1DHKB 1FATA 1UMZA 2Q5TA 2D7FA 2PHRA 3AYDA 3FUQA 3A4UA 4GA9A 4R9DA 2BQPA 3WV6A 4AGRA 5CAZA 3T1MA 4FPYA 1WD3A 2WLQA 3ZSMA 2NN8A 4XBNA 3MEPA 4YGBA 1LOEA 1N1VA 2CTVA 4Z8BA 4YGEA 1IS3A 2P34A 4M3CB 1DGLA 4RL7A 3M3CA 2DUOA 2E51A 2W52A 4XJAA 2DU1A 1S0GA 4MYEA 5HCFA 3WDYA 1LEDA 1WW4A 4XTMA 4DQAA 3IN9A 1KJLA 2ZBJA 1D0HA 1SCRA 3WUDA 3NV4A 3AK0A 3OY8A 4FPEA 3AFKA 3WZ1A 2UWCA 1JYIA 2A3WA 4PCRA 3ZPYA 2ZGTA 3GNEA 1Q8VA 1SBFA 3OYWB 1GYKA 1SLTA 1BQPA 2H0BA 4AVVA 4YM3A 5KXDA 1SLAA 1MS8A 4PBPA 3M3OA 4XHBA 4YZ4A 1C4RA 3HR9A 1QOTA 2YMZA 3HN1A 4GALA 3OJBA 2YV8A 3AZZA 5JDBA 5IK8A 1F9KA 2XB6C 3KQRA 3WCSA 3ZYPA 2DVGA 2E53A 1URXA 3AZVA 1CVNA 2VW0A 1MS1A 4Y1ZA 3FUOA 1ZM1A 2R49A 5DZGA 1GZWA 4ISQA 1YI7A 2EXKA 5GZDA 3N36A 3N7MA 1W6MB 4FPOB 2JE9A 2EF6A 1J1TA 2NZ9A 1W6QA 2GMPA 1LU1A 1LOGA 4ITCA 1N1YA 4GWNA 1DQ4A 1UAIA 2DURA 1DQ6A 2E6VA 4XYXA 2A3YA 4NOTA 2VW2A 1ULCA 1IKQA 1EPWA 1LESA 1N3OA 2CNAA 3O12A 4FOYA 4XBQA 1V6KA 2GDFA 4YZ1A 5F9TA 1A3KA 2PHWA 3SH5A 4UW3A 3M2MA 2GMEA 2ZGKA 4XILA 2R1DA 1WLWA 4PBOA 3WHUA 5DUXA 4YGDA 3QLQA 3TB0A 1S0IA 2EIGA 4R9BA 4YW3A 5IK4A 3JU9A 4YM1A 5GM0A 5AVAA 2YROA 1V6OA 1D2SA 3MW3A 4M3CA 4CZSA 1AXKA 1LU2A 2DVFA 5H9RA 4FP2A 1HLCA 3BTAA 2FMDA 3FLRA 1MVQA 3NV3A 1IOAA 1LOFA 2PELA 1YO8A 2NMOA 2GNTA 1A8DA 2LTNA 4UW4A 4XTPA 3WG1A 2AYHA 2D6NA 3B69A 4TYSA 4BLIA 2C5DA 2CYFA 2YZ4A 4FPFA 2JE7A 2EAKA 1UKGA 1JXNA 5FREA 1CPMA 3SH4A 1WLDA 4WZFA 3WHTA 3B3QE 4P14A 3ZVXA 1G9BA 1U0AA 1QDCA 2D3SA 3RQ0A 3OPZA 1ENQA 3VV1A 3N7KA 4YGCA 3IMNA 3SH3A 1GZWB 1KDMA 3ZXKA 1F5FA 1O4ZA 4Y26A 4BQ1A 3ZXEA 1H9WA 1JYCA 3I4IA 5T5JA 5DZEA 1KJRA 2E7QA 1W6QB 1FYUA 2DTYA 4RA0A 4XJZA 4YFZA 4LBQB 4FPCA 5HCAA 1LOBA 2WNEA 2OUJA 4LBNA 1ENRA 1SLCA 3M3EA 1Q56A 2W39A 3MW2A 3AXDA 1W6MA 3OBTA 3H0OA 1WCSA 5T50A 1Z0HA 4LBLA 1CONA 1V6NA 2UWBA 4Y24A 2ZGPA 5JLVA 1QU0A 1WLCA 1AJOA 1FNZA 1LOCA 1R1ZA 2JJ6A 3R4SA 4LBQD 1LGBA 5SV8A 3USUA 3WCRA 1GANA 1LENA 4UW6A 1AXZA 4FOQA 4HANA 1C1LA 1GV9A 1UZYA 2G4IA 4ISRA 1QMJA 1GBGA 1IS5A 1S0FA 1GZ9A 2NM1A 3B00A 1Q8OA 4XMAA 2CL2A 1FX5A 5L73A 3QCWA 1UX6A 3MW4A 4Q1RA 1SFYA 1MS3A 4D69A 2D6LX 2XG3A 2ZHLA 2P2KA 4HL0A 1KQRA 1LODA 5DUVA 4YW1A 1WBLA 2D3RA 2CWMA 5T5PA 3AYAA 1N1TA 2OVUA 3ILRA 4WVWA 3WG4A 1ULDA 1V6JA 1LHVA 4Q26A 5GLZA 1DQ0A 1S1AA 4PF5A 1IS6A 2DVDA 5EXOA 4CRQA 4DS0A 3PJQA 1W6NA 3ENRA 4Y1VA 2ZHNA 1N3QA 1N3PA 2B7YA 3V64A 1UPSA 1ULEA 1W6PB 4ATFA 5BYNA 2WT2A 1W6OA 3PVNA 1AVBA 1GLHA 5E8AA 1FV2A 3DUIA 2D3PA 2ZGLA 2EXJA 3T2TA 1I1EA 2ENRA 1DYKA 3A0KA 2AH2A 4CTEA 3V0AA 4XZPA 1LULA 3RMXA 4H55A 1HQLA 2E7TA 3CNAA 1CESA 2NMNA 2R1BA 4WVVA 4Y1XA 5E88A 2V73A 4R9AA 4XIKA 5GLUA 3ILFA 3POWA 3WG3A 1VIWB 3BIWE 3V65A 3WLUA 1MS0A 4JRAA 4LBQA 1MACA 2UWAA 3ZYRA 4FPKA 1BXHA 5GZGA 2DYCA 3ASIA 5DUWA 4JC1A 3USUB 3AX4A 3FBYA 3HMYA 5CA6A 4I30A 1MR5A 2NYYA 4YG0A 2KM2A 2A6VA 3O5SA 3APBA 1NXD1 3RG0A 1JOJA 2A7AA 2TEPA 2W08A 4K1YA 1S0EA 1MZ5A 1TEIA 2V5YA 3I8TA 4FPLA 1I3HA 3GALA 3ZXLA 4BM8A 5T5OA 1F31A 2ERFA 1QF3A 4JCKA 4YG6A 3D6EA 1LECA 3UJQA 1DLLA 5GZCA 2JDZA 4XE9A 3WG2A 1G8WA 1DBNA 1V6MA 2VH9A 2RHPA 4Q1PA 5JMCA 2PHTA 3AP9A 4U2AA 3L2YA 1WUVA 3C2UA 2UU8A 1UL9A 1W6NB 5H9QA 5KXBA 4XJUA 4AWDA 2ZABA 1LCLA 4W65A 5GALA 1Q8PA 2WSVA 4YZ2A 1VLNA 4ZKTB 2ARXA 3BOPA 5IK5A 3WDVA 3UJOA 4GKYA 2HYKA 3KM5A 1H30A 1CN1A 1LGNA 4XDQA 4Y20A 1W6OB 4AGVA 3U4XA 1AX0A 1XQNA 1CR7A 1DQ1A 1JW6A 3NV2A 3B9CA 1SLIA 1WD4A 4FP3A 2ES3A 5F5QA 4L8QA 2D44A 1WBFA 1SLBA 4BOWA 3V0AB 1HKDA 1SBEA 1UZZA 1LGCA 2JKBA 3ZSJA 4M00A 5GLTA 3WUCA 3WNXA 1W6PA 1AF9A 2GN7A 2R0FA 4XJWA 4GWMA 3SLIA 1LHOA 1MZ6A 5IT6A 4YM0A 5H9PA 1LJ7A 3POYA 1KITA 2WKKA 2CWSA 1S0CA 1N47A 1FAYA 1PZ9A 1V00A 1YYNA 1DQ5A 4AGGA 1WW6A 3LCPA 2VY0A 2VU9A 2DTWA 1GNHA 3WVJA 1PZ7A 1G9AA 1SACA 3DGTA 2ZGUA 3IPVA 1G9CA 2WT1A 4Y1UA 2A6YA 2P37A 1JUIA 1AX2A 2OW4A 3POSA 1GKBA 1SBDA 4M3CE 1WW7A 3RRDA 1MS5A 2ARBA 4Q2FA 4F83A 3VUOA 2AUYA 4YW5A 2P3IA 5EWSA 3WDTA 3ZSLA 1ONAA 4C1XA 2GN3A 5E89A 2SBAA 2AENA 1DFQA 4BMBA 2D6PA 1G9DA 3JUUA 2YY1A 2ZMNA 2ZHKA 1O4YA 2Z42A 4K20A 4YZ3A 3N7LA 4Q8KA 1H9PA 4SLIA 4AVSA 2ZZJA 1G86A 2ZACA 4LBJA 3VKNA 1LHNA 5FRAA 3VKLA 1VALA 3N3HA 1AXYA 1WW5A 2WT0A 2YXSA 2ZMKA 4M3CF 3RSJA 2EXIA 4P9XA 1W0OA 1QNYA 3IKWA 4Y20B 2JD4A 3AP7A 5CBLA 4YW4A 4IQPA 2GMMA 3D5OA 4FPHA 2A6ZA 1MS9A 2P3KA 3AYEA 2DUQA
chains in the Genus database with same CATH superfamily
2VBPA 1DZQA 5FBJA 2R062 5LK7B 1IGOA 1H0BA 1JOPA 1KDKA 1MS4A 1UNBA 2G9ZA 4IE6A 3W58A 3WW3A 1QWRA 2XONA 2XL9A 1RUF3 5FPXA 4OULA 4A7KA 2VUAA 1QGLA 5CKNA 4RS5C 3BUCA 2ZKNA 2IXLA 1H6XA 4YW2A 4EE2A 4NPLA 1W0PA 1AR61 4FPJA 3HQRA 4IEWA 3MFCA 3NQHA 4IE5A 1GOHA 1CPNA 2DCTA 2PAMA 4QB1A 1F35A 5JOWA 1K5MB 2BU9A 2Y38A 5FUIA 4NUBA 1JODA 3ITQA 5JR7B 4JHZA 1IKPA 4LE4A 1R083 3KD4A 5DXDA 2WQ8A 5G05L 4CUBA 1PHMA 1EV13 3NJZA 1AR72 4CEWC 3CBNA 3NNGA 3VBOA 1ZRFA 5FZFA 2W68A 2ZGOA 4MGSA 4RN5A 2BOJA 1OA3A 3WP3A 3J8F1 3E5UA 2PHXA 3AZYA 2C6SA 1LAJA 5JPNB 1CAUB 1I5PA 2CY6A 3Q8BA 5C8CC 2C9AA 5KC6A 2RS12 3N35A 1ODNA 2K2SA 5JOYA 3C7GA 5A7QA 5FPVA 4RR3C 3RDIA 1X8MA 3FHAA 4BU2A 3A0NA 4IV3B 1ND2C 3FLTA 1RIRA 1F4AA 3OSDA 5A3OA 2J1SA 3TN93 4I09A 4XJ8A 1FNYA 1AX1A 2PA7A 4G4FA 5CFDA 3ZXDA 4COVA 2YC4A 1BEV1 4GMP3 1OOPC 1JU3A 1YQCA 3GDBA 1DIWA 4PHZA 4Y33A 5FO8B 2YPJA 1N1SA 1JBCA 1RINA 4NHYA 4WM7B 5F6LB 5G04L 4LHSA 4AF9A 3PVEA 5IVFA 5FYSA 3WDWA 3BTXA 3W9AA 4LBMA 4RQPA 2CGNA 3OBAA 3CQOA 4QPIA 5BUVA 4K8RB 4L11A 3ZR5A 5HCBA 2HLEA 3ST7A 4QKDA 4LUKA 3EXUA 2HWD1 3EJKA 1Q8SA 2MNGA 3I97A 2JIGA 2I07B 3P3NA 3CJIC 4LK7A 1UYPA 1QJZA 4XMIA 3MZHA 2P3JA 4Q4W1 4OUMA 1KRIA 3SKJE 5CFCB 2XOMA 3J8F2 1V6LA 2LUWA 4J1WA 4LBOA 3OGSA 4C0BA 1AZDA 1MVEA 2LRPA 3N9OA 3AZWA 1FPN1 3OGGA 4LTAA 1AL0G 3WNLA 1Q8QA 1W9YA 2QKDA 4OMDA 2KD7A 4JV4A 1IZ3A 5I0RA 5CU1A 1NCRC 2VCMA 3KCXA 4PLNA 3ZXFA 4HN1A 5IFPA 2GNDA 3VKOA 4BB3A 4BZ4A 3UL2A 5JIUA 5KXEA 1AYM3 1SQ4A 1S0BA 4D7YA 4FFIA 4CDWC 4NHMA 4DRRA 3VN4A 1KS5A 1OLRA 2ZGMA 4M01A 4BHPA 4JX0A 3PVOA 2LALA 2HWF1 2DWRA 1BEV2 1KGYA 2Y60A 4XXAA 5JZGB 1DYPA 4LBKA 4WVMA 3TEZA 3V0BB 4UFLA 2BFUS 4AEKA 2VUCA 5L7OC 5FYVA 1Y7BA 1SLLA 3AB0A 4GB31 2BGOA 3AZXA 2UYBA 3EYPA 4XF3A 1QHDA 3AYCA 4IGOA 4CUCA 3LPFA 5IUQA 2HWD2 4LO6B 3UV9A 1TNRA 3SITA 4COUA 3AKSA 4GXLA 1C3HA 4QKFA 4NHLA 4Q4W2 1DHKB 4NMIA 4D6RA 2WAAA 1OH4A 3J4UH 4NE9A 1HB3A 4YNIA 3FUQA 3SC7X 3WV6A 5CG8A 2WLQA 2ZX0A 4EN6B 2NN8A 5EZWA 5BNOC 2JG8B 2BNMA 5JI9A 1N1VA 2J22A 3K51A 4YGEA 1IS3A 1FPN2 4M3CB 4BQ3A 2BERA 2CGOA 3M3CA 3S5QA 2W52A 2DU1A 5FZAA 3BIEA 3OBZA 5IVBA 4XTMA 2WYSA 2VVDA 2BRTA 5FYTA 4G9SB 3RZZA 3R6SA 2AEYA 1SCRA 1ZYBA 1OHFA 4YVWC 3PNAA 2IVJA 4MXWB 1CZTA 1Q8VA 4CPBD 1UZ0A 1J3RA 1GYKA 1SLTA 2H0BA 2HWF2 3DKQA 2VUJA 1SLAA 4O61A 3WF2A 2FBEA 1F4HA 4UYBA 4YZ4A 3Q8EA 2XR4A 4GALA 4JQTA 5CG9A 5FIXA 3J7MA 3AZZA 1F9KA 3KQRA 3POIA 4W6YA 2DCZA 2WO2A 1B35C 2E53A 3GBGA 5FXWA 3L2HA 4P9IA 3JBG1 3KV9A 1O7FA 4XAEA 4TLGA 1XSRA 5J37A 4Y1ZA 1Q3EA 5DZGA 3K2OA 3UKTA 3UGHA 1RUOA 2VOWA 1FT9A 3SCGA 4OUSA 5GZDA 5A3WA 5LEKA 5F2WA 3H1WA 4FPOB 5FQ0A 2X5IB 3RZHA 3Q8AA 2EF6A 4R52A 1J1TA 4EJRA 1H4HA 4LQRA 5ACA1 5JZGA 3HT2A 2WLPA 4Q4Y1 5A70A 3LKJA 3POFA 3ZSEA 4M4PA 4B8EA 3HBZA 3KCYA 4RD7A 4IDZA 4OHYA 1YQ6A 1DQ6A 2A3YA 2VW2A 4KWKA 1IKQA 1QQP3 3K3NA 5BNPB 2HEVF 4NRPA 4YZ1A 3VBSA 3I3MA 3A22A 3M2MA 3NL1A 5J98B 4DUXA 4HSLA 4B1MA 2OQ6A 4COWA 5IVJA 2J1RA 4I0WB 4E2GA 4YGDA 3F2ZA 1F15A 1A6CA 5EP9A 4AXOA 3BOWA 4ZPIA 3O1VA 3MIFA 1Y3TA 2JG8A 1CAVB 3OUHA 4IE0A 4UBGA 3ZN6A 3U37A 1D2SA 4M3CA 2EA7A 3VBOC 2O8QA 4CZSA 1AXKA 2CV6A 3R0RA 5LRRA 2VD7A 3NSTA 1W05A 4GZ9A 3C8XA 4XUPA 2VOKA 3NV3A 4NHXA 3JBG2 1IOAA 1HV0A 1WZXA 3AL5A 3JCIA 3VBUA 1RUE1 1OUXA 5IAXA 2QZ2A 4BLIA 1GU3A 4MGIE 4ASLA 3I3QA 2IVIB 2VCBA 1NZCA 3OUJA 5HXMA 1V9U1 1UKGA 2EAKA 5JXIA 4D8MA 4MXWA 1YJLA 1CPMA 4WZFA 5BY5A 3LB9A 3B3QE 1BCXA 4E8CA 4GH4A 5I0SA 1U0AA 2ZEWA 3ZX7A 5CVRA 1G9BA 3MV11 4C90A 2D3SA 1TE1B 5ACA2 2PFWA 5FYMA 4Q4Y2 1KEXA 4YGCA 5LASA 1FOD2 1PVC3 1AYN1 2GSYA 4Q5OA 3VBHA 1OLME 4CCKA 4BXSV 5CADA 3NJVA 4B3NA 5KC5A 3I54A 4PDWB 3ETQA 2ATFA 1H9WA 2ID4A 3OGJA 5DAWA 5C5UA 2OT7A 5DZEA 2QQLA 2E7QA 5BXXA 4CP2A 4KNCA 1FYUA 2DTYA 4CP9A 2OYZA 1EAH3 2P6CA 5FTTC 3KVAA 4RQPC 3T2PA 4JRLA 2WZEA 4QPIC 2JDMA 1PO23 3MW2A 4IEVA 5A6ZA 1OVPA 1RTVA 3UT0A 5A1FA 4AL9A 4PIYA 1Z0HA 2W1UA 2WWUA 2DCJA 1Q5OA 1XNKA 2G9FA 1R1A1 2QDRA 1LOCA 1FNZA 3MI8A 3KSCA 3O7OA 3FE5A 2O8OA 4XUOA 3T09A 3ELNA 4ZU4A 1QJU3 2VZRA 5F6KA 3WCRA 2X8KA 1RUE2 1AXZA 4FI9A 4OMCA 2G4IA 1QJFA 1XU1A 4N8MA 1GZ9A 1V9U2 2Y0IA 4XMAA 1FX5A 1ZBE3 4CSWA 4FSJA 4W4ZA 1K5MC 1MS3A 4QX3A 4YYOA 4HL0A 5A7WB 1LODA 2V5DA 5DUVA 5HCHA 2P4EA 1L7QA 1H8TA 2ORZA 3LEMA 1HRI3 4BQ5A 2VTFA 1CAVA 1VMFA 5AVPA 4Y4YA 1AYN2 3SCHA 3GYDA 3HQUA 1S1AA 2BOIA 2XMLA 4PF5A 1M4WA 1OT5A 1IS6A 1XNDA 2DVDA 4CRQA 4DS0A 3PJQA 5JXJA 4GJYA 1VBA1 2B7YA 3I3BA 2VNVA 3K75B 1BBT1 1VBC3 1K3IA 1NG0A 5L9RA 3WQBA 2FDGA 1YFUA 4R4ZA 2E33A 5LZ6A 3QD6A 5ABJB 1YFWA 1UYZA 1OA2A 2RS51 1O3TA 1AR73 5GKAC 3UGGA 2CGPA 3H1MA 4CTEA 3ZYBA 4Y3OA 1UCXA 3ZM8A 3RMXA 2UY9A 4BQYA 3CNAA 2E7TA 3DYMA 5LW9A 3H3UA 2R1BA 1R1A2 3K46A 4BIFA 3B02A 4WVVA 5FZLA 3U78A 1RUD3 2V4VA 4PDWA 1VB2A 2W5FA 3K48A 3OF1A 5GLUA 3ILFA 4E4DX 2IXKA 4RFRB 3WG3A 3CLPA 1W8ZA 4WM7C 3V65A 4PIZA 3WLUA 4CU9A 5A3MA 4JRAA 2G1MA 5BNNB 1LNSA 5GZGA 2DYCA 1FMD1 2WQ4A 3AX4A 3E6DA 3FBYA 3KVBA 4I30A 2W1WA 4GIQA 1H2KA 2RJLA 5FZOA 4CEWB 4I01A 4EYUA 4CCDA 3WP5A 3GXUA 3DYPA 3N9NA 3VBRA 1NKGA 1W8FA 3D0SA 4EZHA 2V5YA 1JMUB 3ZIXA 3I8TA 1AR63 1I3HA 1WA4A 2PAEA 4HZFA 3ZXLA 3RZKA 5CFCC 5BPXA 4KH9A 2D5HA 5C8CB 4S2DA 3BTZA 2JEMA 4HVQA 2ZS6B 2ERFA 4K8FA 1VBA2 1W90A 2GC0A 3D6EA 3RI8A 4I02A 5FYZA 1BBT2 5BV6A 2BZDA 4RR3B 4QM8A 5F5IA 1QY4A 1V6MA 3PJYA 4Q1PA 5D8AA 1JU4A 3L2YA 4YPJA 1W6NB 4AWDA 1HRV3 1DF0A 4LO5B 2WSVA 5IK5A 1VLNA 1HB1A 2ARXA 1XPWA 4GKYA 3T0AA 1CN1A 4AGVA 4CCMA 1OOPB 1CR7A 3FFQA 1NT0A 1GFF2 2VVEA 1C8M3 2Q1MA 1WD4A 4JTNA 2PLV1 4QKNA 1WBFA 5JZGC 5FZMA 3NO8A 4OZOA 1Y9GA 5GLTA 2XKPA 4OI1A 1H6YA 4S2GA 1HIXA 3KT7A 2QQJA 4XF9A 4BDVB 3ON7A 3S7EA 3M4FA 5H9PA 4EWDA 1LJ7A 1XNAA 1FMD2 3C7FA 3CJIB 1HJGA 4HSJA 2CWSA 1CAWB 4X6QB 3CMGA 1ZRRA 3VBSC 1N47A 2X09A 1PZ9A 3KMHA 4AVBA 4DIQA 2QJVA 1V00A 4RGGA 2FDFA 1Y4WA 2W46A 1BEV3 3MIGA 4RSUA 2VU9A 2RDQA 3E97A 4CU7A 4IGQA 5CKMA 1PZ7A 1G9AA 1SACA 3DGTA 2R071 3IPVA 4Q29A 3WW2A 2W87A 4AHZA 3U0ZA 2RMU3 5FYIA 2Q8DA 5JI7A 3ACGA 2JG8C 3B93A 2OW4A 4M3CE 1SBDA 1QJY1 3IAQA 1RJ7A 4GJZA 2BP6A 3EB7A 4S2FA 2WS91 1NCRB 1J1LA 1SZBA 5E89A 3VBUC 2SBAA 4AHYA 2ZOEB 4Q4W3 1UMIA 4RGAA 2YY1A 4CDWB 2ZMNA 5FPUA 5A3TA 3DXTA 5IFTA 2ZHKA 4I3GA 4Q8KA 2V4AA 2Q8CA 3FL7A 4MADA 5C8WA 4N9HA 5FRAA 3WQ7A 1VALA 1AXYA 2WT0A 3S7IA 4GH4C 4A7YA 2JDUA 2RV9A 2PLV2 2PTMA 2BYVE 4ARYA 5L7OB 3IKWA 3BU0A 4Y20B 2JD4A 2MHFA 5CBLA 3LIHA 4IQPA 2VZOA 5F5AA 1VRH1 3VBHC 2A6ZA 4UWDA 3WT3A 4JHTA 4AI0A 2J1UA 2DUQA 4E4HA 3GCWA 2YG0A 1ULGA 5H9SA 3WF1A 2Q4SA 3O14A 2WC2A 1GSLA 3AFGA 2FZ1A 3IM0A 2QQIA 3MHZA 1NLSA 2HWF3 1BK1A 3LSEA 3SQOA 1VBE1 5DAXA 4B4RA 1AR83 5BNOB 2R072 2A75A 4RHV1 3M1HA 4MGKE 2VQTA 4QB2A 2X5IC 4Z07A 2LM3A 4ASMB 3LA3A 1TZOA 2WA4A 4GB33 5FPLA 2XWBB 2YBPA 3GF6A 3ZYJB 1QJY2 3UYJA 2A1XA 1RHI1 3P6BA 5FZHA 4FQ4A 2D43A 4OUEA 4AI1A 4DXTA 1PZ8A 1UMHA 2WUHA 2QZ3A 2WIIB 4HXCA 5FZ0A 3HN3A 5JOZA 2NPIA 5AC92 3IDCB 1QXJA 3ETPA 2WJSA 3TRSB 1V6IA 1S0JA 2JWPA 1PIV3 2D6MA 2VZTA 2LS6A 1UZVA 4OZXA 2RS31 3RWNA 5EYYA 4H14A 3SISA 5FOBB 2NP0A 1J3QA 2A5ZA 2VL4A 3D4KA 3IDBB 3P5BA 1B09A 3PIGA 4QQLA 3O1PA 5F5CA 1DGWX 2HJIA 3O0WA 1GOFA 4FVVA 1H8TC 4GQ7A 4I3PA 1UW8A 5KWRA 4MGZE 4DEQA 5CKQA 1ZA4A 5B4XA 1VRH2 2QQPA 3O0XA 1WLTA 4KG0A 1QOSA 2A71A 4BMEA 1U12A 1W99A 4MGQA 2FDKA 1JHNA 4UF0B 2QUOA 3HAGA 3EHKA 2A6XA 4OLLA 1XE7A 3RGBA 4Z82A 2WZR1 1YRZA 3TNPB 2DU0A 5F32A 3ZFFA 1ZZ8A 3HOBA 2XJQA 2WFF3 4COZA 4XIOA 1S0DA 5LBEA 1KFUL 2BGCA 3RZGA 3TEWA 1CX1A 4BQWA 1UQXA 3SNMA 4RHV2 1W06A 5FZGA 4QPYA 3M70A 1QXRA 4IEPA 2V09A 1DLCA 3JBG3 4EV0A 1UY4A 2K9ZA 5CNAA 3PUAA 3FC0A 1XRUA 2VCAA 4XURA 1RHI2 2LROA 4EQVA 2DUPA 2QFEA 4PDWC 1JYNA 2VOTA 1UD1A 1YNAA 2D40A 3VKFC 2XGXA 3IMMA 5FY1A 2HYXA 5SV5A 1UOJA 5GJ6A 4MZUA 3AKTA 4I2OA 4FT8A 4XQDA 2WR9A 3KHCA 1X9TA 2HWC1 4CEYB 2RS32 5B2GB 5LEJA 5FCCA 1OKOA 4TZDA 4FPGA 3FLPA 4AYUA 5HBAA 3BU7A 3WEZA 1SMVA 2XJPA 3FHIB 4BE3A 3G6JB 2PXJA 5FZ3A 1LEMA 2ZMLA 1JN2P 4LKSA 5FP7A 3THCA 3VBRC 4CDQA 1RUJ3 5T3NA 1W8NA 5FY5A 4P9WA 1SFNA 4BLJA 3CF6E 1H2MA 5FY8A 3VKMA 5IAVA 1STMA 3KGLA 2C4XA 4ZXEA 2VXRA 2ZX4A 2VO5A 2I45A 2WZR2 3KF3A 4D7TA 3KV5A 5FMDA 4IW3A 2VMDA 4Y1YA 1CIWA 5A1AA 2ZGSA 1ZRDA 4CU8A 1GNZA 5L9VA 1BZWA 1IHMA 2PHDA 5LK5A 4KI5M 1VMJA 3WNPA 2SLIA 3ZMNA 4ATEA 3AP5A 4KBBA 4QHZA 3WQ0A 4YFWA 3K4DA 5EV7A 3PU8A 5CFDB 3R05A 3JQXA 2J1AA 3PMEA 3HNBM 4L0PA 2UYAA 3LSDA 5JOXA 1RUE3 1SCSA 2YPDA 1GR3A 3C7OA 5JVVA 3O0VA 4KU8A 4K6BA 2GC2A 3AJYA 4XFIA 3ZN5A 1OSGA 2WN2A 2GH8A 1YXWA 3VHNA 2XXZA 4EWEA 5GLWA 1IPKA 1UMZA 1OPOA 5A7OA 2PHRA 2YGLA 4QD2A 2PN5A 3JB8A 4H2AA 4Q0VA 2HWC2 4GA9A 4AGRA 3T1MA 4FPYA 3ZSMA 5LB6A 3AMMA 5ABJC 3CIHA 4YGBA 4I0BA 3H3ZA 1YWKA 1DZTA 2XVKA 3WP6A 4Z8BA 4KQ7A 5JCTA 1YIPA 1DGLA 2DF7A 2VQAA 3DECA 1UXZA 1QXPA 1HN0A 1LEDA 2TBVA 1WW4A 3N9QA 1POV3 1O6UA 1RGSA 2VBDA 3SMHA 1OFNA 3IN9A 4JGZA 1D0HA 4NPRA 2K46A 3NV4A 5DN2A 4ZONA 1UZWA 2UWCA 4AG4A 2A3WA 1ULOA 4TWTA 1I9RA 4FCAA 1REEA 1SBFA 2QVSB 5EHDA 3RNSA 3VDAA 5BNNC 1BQPA 5JUVA 4AVVA 4CEYA 1MS8A 1L7LA 4PBPA 4R4XA 3FWEA 2Y64A 4KWLA 1QOTA 1WCQA 4GWIA 3OJBA 4AI9A 1MEC1 3WCSA 3NJYA 3AZVA 3J7NA 4K9SA 1CVNA 5DAQA 2VW0A 4WVMB 1RMU3 1MS1A 3FUOA 3OB8A 1QH6A 5EQUA 2XWJB 2IXHA 4H7LA 3VL9A 4HG6B 3TYJA 1YI7A 1C28A 5FUPA 4IE7A 3H8XA 2EXKA 3ZDSA 2JDPA 3ZKYA 5IVEA 1EPZA 3IIAA 1W2UA 3ZKUA 1UY3A 3ACFA 4KG8A 2B8MA 3ZXGA 4QAWA 2GMPA 2XBO1 1AUYA 3LF7A 1LOGA 5A1LA 3BCWA 5FMBA 3VBFA 3X29B 3VL8A 1N1YA 4GWNA 1DQ4A 1UAIA 4AOCA 4XABA 4CE8A 1HV1A 5FY9A 3S6PA 1D4M3 4XAAA 2PAKA 5FAXA 5I8TA 3O12A 5FMOL 2GDFA 1AHSA 2X53S 5DDJ1 1BBT3 5FZ9A 2PHWA 3H9AA 3RFRA 2JKXA 1C5HA 4XILA 2R1DA 1AR91 5FZCA 1ASJ3 1WLWA 3WHUA 2RS53 1COV1 1OVSA 4Y5SA 3IZOA 4QX2A 3TB0A 2EIGA 1QJX1 1UPIA 5A3NA 3AMPA 2Y6GA 4LE3A 3JU9A 1SDDB 2HWE1 4QX8A 5GM0A 4CPBA 2GH2A 4HETA 1MEC2 1NYWA 2RDRA 3IIIA 4JDNA 1HLCA 3AKQA 4X8PA 3BTAA 2FMDA 4AEMA 1XXNA 3FLRA 3N9PA 3PMSA 4AQ6A 1K12A 2O1QA 1LOFA 2PELA 1YO8A 2ZEZA 2GNTA 2LTNA 3K77A 4UW4A 3HPNA 4XTPA 4BCUA 3LE0A 4L2NA 3WG1A 2C5DA 3TBDA 1H8VA 4XFFA 2YYOA 4IEOA 5FREA 3SH4A 1WLDA 4P14A 1W8OA 1X9PA 1ODMA 3ZVXA 1QDCA 3ES4A 4AAXA 1ZZ9A 3RQ0A 1ENQA 2IUWA 2YGMA 2MEV1 3MYXA 3IMNA 2XBO2 2DBIA 3ACLA 1KDMA 1F5FA 5I91A 3ZFFC 3ZYIB 1O4ZA 2HWB1 1TME2 5J7MA 2ZTNA 1KFXL 4R8HA 5FQ0B 4NROA 3AKRA 4L99A 1KJRA 3HJRA 2CDOA 1L7RA 5DDJ2 4RA0A 5FYYA 4YFZA 5LA1A 1US2A 2XJUA 1AR92 2OUJA 4LBNA 1GQPA 2JG9A 5FWEA 1COV2 1Q56A 2B39A 2YU1A 1QJX2 1JZ3A 5D2AA 4CXYA 2QDNA 3VBSB 3H0OA 5T50A 2HWE2 3DN7A 3FMGA 3VD7A 3BPSA 5J1XA 2VZQA 2ZGPA 1WLCA 1XYOA 4LKDA 4YRDA 5F7UA 2JJ6A 2VMFA 4E9KA 2C26A 4UFJA 5LBBA 3NKGA 4AK3A 3USUA 1HW5A 1PNGA 3OGRA 2ILMA 3ZN6B 5F2SA 4FOQA 1C1LA 1GV9A 1UZYA 1YI9A 3LDRA 1S4CA 4A2UA 1JYVA 1S0FA 2NM1A 3B00A 3AL6A 3OPWA 2WZPP 4CDQC 3LEIA 4Q1RA 3VBUB 2ZHLA 4URAA 1XNCA 2WABA 3K4AA 4COYA 3VHOA 2IXCA 4GMP0 1D4VB 3MIBA 5LY1A 1CAXA 4WVWA 2MEV2 5M0TA 1V6JA 2AEZA 3AMQA 1QH7A 1VRBA 3CEWA 1DQ0A 2HWB2 4V2WA 4B7EA 4GH4B 4QQPA 5C71A 3VDDB 5L36A 4LLOA 1XU2A 1CJDA 4IEQA 3V64A 1UPSA 1W6PB 2QE3A 3DPRA 5IWFA 1J3PA 2WS93 1W04A 4XW3A 5L9BA 3VBHB 3PVNA 1JI6A 1AVBA 4XUTA 2RM23 1NQDA 1FV2A 3DUIA 4L97A 2R043 1GP4A 2ZGLA 2EXJA 4O65A 3GZAA 4V2VA 3ZN4A 1ZZ7A 3GZEA 2OZ6A 4CP9B 3V0AA 2VMGA 1LULA 1AL23 2K0GA 1UKRA 4W8JA 4B1LA 4H55A 1HQLA 1NLRA 1OPMA 1HXS3 1ST8A 1DZRA 1CESA 3N9LA 3PDQA 4NPMA 4P5YA 1JZ5A 4Y1XA 1W2AX 4P9GA 2YC0A 4R9AA 5A7PA 4XPVA 4XIKA 3W5MA 3H7JA 1YCIA 2OS2A 2VAUA 2B9UA 2YFUA 1FOD1 5F8PA 5FLIA 3IDAA 2RVAA 2UWAA 3ZYRA 1UX7A 4MO3M 5FLHA 1UU4A 3ASIA 4NVPA 5DUWA 4DINB 1PMJX 4Q4X2 3IT8A 5CA6A 1MR5A 3B7MA 1O8PA 4JGZC 2NYYA 2KM2A 3GBWA 5FZ1A 1NAEA 1VBE3 2ETEA 1NXD1 2RR11 3OOXA 3RG0A 4D3WA 5A6XA 1JOJA 2A7AA 4HKOA 2YC2A 5DABA 1BMV1 5FZ4A 1RUG1 4FPLA 3LAGA 3WY6A 3LGRA 5FPAA 4CEYC 1DYOA 1GWMA 2FZ2A 1H8TB 5T5OA 2A73B 4QDQA 5I93A 4WZCA 1MZFA 4JCKA 4WM8B 4YG6A 1KXGA 5GZCA 2EIEA 2JDZA 2F17A 4CCNA 4AI3A 3IAPA 4B4QA 2OA2A 4QU1A 2Q1FA 5KXBA 2UU8A 3EO6A 5H9QA 2ZABA 5GALA 3OTFA 1CZSA 1RL3A 2JDAA 4JDOA 1UYYA 4YZ2A 3WDVA 3UJOA 2HYKA 3KM5A 4MLOA 1LGNA 2XHKA 4TN7A 2QNKA 1RVF1 2JXAA 1T6GC 5APAA 1AX0A 5ABJA 4A41A 1DQ1A 1SLIA 1T6BX 1ZZCA 2FDJA 4MX3A 5LBCA 5FZBA 3K3OA 5F5QA 1SLBA 5FFOC 1HKDA 3VDDA 5L19A 4BISA 3UNPA 1SBEA 1LGCA 4OQ9A 1W3VA 3MUZ1 1W6PA 2B9VA 2P17A 2R0FA 1ZZ6A 3PIJA 4N7UA 4NIAA 3VBFC 5CFDC 2JDYA 3SLIA 4XFAA 5FWJA 2NQYA 3MDPA 1KITA 1ZBA1 1JZ8A 2WZR3 4QT6A 4IERA 5C5TA 4YARA 1XE0A 4LUMA 5DPNA 4QPGB 2RR12 1BMV2 3RZJA 1WW6A 4LO7A 3RZLA 1RUG2 1GNHA 2ET1A 1JS9A 3ECQA 2ZGUA 2TUNA 3KB5A 4P5HA 5K8SA 2DCYA 3WD5A 2ZX3A 3QACA 1G9CA 5FMCA 5FZOB 3VHRA 2A6YA 2F6BA 2P37A 1JUIA 5E1RA 5HV0A 3POSA 3AM2A 1ZREA 3VBRB 3LFMA 4MG2A 3ZXAC 4Q2FA 1RUF1 1VJ2A 2AUYA 4YW5A 3GJBA 3WDTA 4C1XA 1MPXA 2I74A 3KF5A 1XYNA 3JUUA 3VZLA 1DGRN 4A6SA 4E4SA 3N4MA 3I3EA 1NCQA 4XQ4A 3BB6A 5C9AA 4QHBA 5FY0A 1RVF2 2R063 2O0OA 5D8AB 2VMEA 2ZJCA 4MSVA 1YLLA 2TNFA 2Q0AA 5K0UA 2XH6A 3T4VA 1OQDA 3NAPA 4JKMA 4P9XA 5DAVA 1BHGA 1R081 3AP7A 3AMHA 5FBZA 4NWVA 4WM8A 2GMMA 2Q8EA 1SPPA 1EV11 5A32A 4FPHA 1REFA 2W91A 4O7XA 2ZAAA 3EMRA 3AYEA 3N7MA 3NRUA 1CQ9A 2HBUA 1G7YA 4HKLA 4QGNA 2I2SA 1U5YA 1ZBA2 4M4RA 2GC1A 3USSA 2VW1A 5T52A 1MZEA 3B01A 1RITA 4X6RB 2JB4A 3LQCA 4LOTA 2BFUL 5DG1A 4AHXA 2D93A 2EXHA 2JG9C 2Z4FA 3ZSKA 1VP6A 1W0NA 2ARAA 5C3SA 1JZ7A 3T30A 2AR6A 2RE9A 4JGYA 2R7EB 2R0HA 3KV4A 2XHNA 5JSOA 2AC1A 3T0BA 3T2OA 4FFGA 1BJQA 4UW5A 2WO7A 2VOXA 2FHRA 4MGTA 4FOVA 3NV1A 4LA3A 4IEXA 4PLOA 4AI2A 5F3CA 3IPVB 3D3AA 1SG3A 1RUF2 2BJSA 2RS13 5GZEA 5FYBA 2ET7A 1SEFA 4GMP1 3AXEA 4ZS2A 1YQ8A 1V70A 2PHUA 4IE4A 2IC1A 1QDOA 3RMYA 1GICA 2AZ5A 4OI4A 1E5IA 2J42A 3HIFA 4QPGA 5F3IA 5IVYA 3UK9A 1LOAA 3ZOIA 1DGWA 2W92A 4K3UA 4BWOA 3WSOA 2DVAA 3HWJA 3MUY1 3WINE 1QKQA 2W95A 2VNGA 2ZCWA 4Q8LA 1VB4A 1R082 4AEDB 5CB7A 4BPZA 1LRHA 3H50A 2ZGQA 1LKNA 1HJFA 3POEA 1FXZA 1EV12 2R6QA 4XZUG 3MBWA 1FI2A 1RYYA 2IXJA 4IV1A 4YLZA 1GZTA 3BALA 3NMBA 1A78A 4Q27A 4ES8A 1G9FA 2D6OX 4YG3A 2GAUA 1PNFA 4AFCA 4AI8A 5FP3A 5EJ1B 3DPRC 4H7MA 4UOJA 2RJKA 1DGRA 1TVGA 2OUHA 3I2OA 4CCOA 2AGSA 1HB2A 1X82A 3O1SA 2WQZC 4CDUA 5F1RA 1R091 4XOGA 2FQPA 4Y22A 2J1VA 3MPPG 4XJ9A 4LIVA 1BKZA 2ZHMA 1VPHA 5F3GA 1IS4A 1AYM1 1OH3A 3J8F3 4GD4A 3M3QA 3RJRA 1UU6A 3SXWA 3WOGA 5C3OA 2DV9A 3A23A 3ZFGA 2BBAA 2VMIA 1CGPA 2WO3A 4ES9A 5DUUA 1JZ2A 2ZAHA 3JD71 1H1MA 3GGLA 1TMF1 5KBFA 3Q8CA 3BKZA 4QM9A 3T3YA 2VJXA 2BNNA 5J09A 2G19A 3U1XA 2Y6JA 4N7IA 2D6KA 3ACIA 2CAUA 2YUEA 4ORFA 4AR2A 2EALA 1PX4A 2XLGA 1F2NA 3S57A 1OQ1A 5FJKA 3SCFA 1YIFA 4PJYA 4DMIA 2XLAA 4QXCA 3N7JA 3OBRA 4YM2A 4DRVA 4M0HA 3I59B 4DFSA 2EICA 2FCVA 5DDJ3 3OYWA 1GZCA 5I0DA 3OUIA 4TSVA 1JYWA 1H4GA 3N9MA 2XPJA 4XHXA 1AR93 4YZ5A 4Z92B 4NRMA 4FO9A 1W39A 4A44A 5EJ3A 4P9YA 2A70A 1OMIA 3NJXA 3O1RA 3O1OA 4UI9L 1QJX3 4PT6A 2YU2A 2HWD3 2XKOA 4HT1T 1OKQA 2PQQA 1GP5A 2HWE3 2CSGA 3VDBA 3AKPA 4IEZA 2UURA 2JIJA 5FK7A 1R092 3ZO0B 3TEXA 3ZLIA 4UT5A 5AC91 4K1ZA 3RVHA 1GUIA 2VXJA 1Q43A 2D98A 3ZFFB 5LA2A 1AYM2 4RS5A 4IEYA 4AEDA 4NAMA 3KLSA 1XBFA 4ZXKA 5C7GA 1VBD1 1BYHA 2QTWB 2C1FA 2W9XA 5JMOA 1FPN3 1Z78A 1RUNA 1VAMA 2WZ8A 3JD72 3O1UA 4LT5A 3E5QA 1QJEA 3KZ4C 3VDDC 3ZXJA 1TMF2 1C57A 2YDEA 1FATA 5KHJA 2D7FA 2NLRA 2WINB 2BW8A 4J25A 3H1YA 1JZ4A 2R30A 1C8NA 2BQPA 1WD3A 2WBKA 1GWLA 1KS4A 4XBNA 1W3XA 3MEPA 2ADDA 1LOEA 2VM9A 1IQAA 2ZZQA 2CTVA 4AQTA 4ZZ5A 4ZZ8A 3I2DA 2P34A 4OFGA 5A6QA 3ZDVA 4RYDA 2DUOA 4AQ2A 3LPGA 3E5XA 4B4PA 3WDYA 2Y33A 3KT4A 4DOUA 4LO4B 2VG9A 2JX9A 2ZBJA 2VGDA 4I0AA 1JYTA 3WUDA 4N90A 2YHJA 3CHXA 4Q0SA 2VTXJ 3AK0A 4YW6A 3WZ1A 4CDXA 4PCRA 3GHNA 4MGYE 2ZGTA 3GBFA 4CDQB 1XE8A 4LA2A 3M7AA 5A7SA 2J1EA 4YM3A 3H8OA 3M3OA 2PMWB 1US3A 1W9WA 1C4RA 1QQP1 1VE0A 4CVUA 2JB8A 1BVVA 4MH0E 1QEXA 2YMZA 3HN1A 4DZGA 4EZ4A 1JH5A 2YV8A 4QDSA 1RJ8A 2XB6C 4Q4V1 3TOJA 5C9AC 5CISA 4LK6A 1OD5A 2OZJA 1URXA 3CO2A 3I59A 3NNLA 1VBD2 3BYWA 5JPMB 3IBMA 2XUMA 2VZUA 3VB9A 1U5XA 5K0UC 5J36A 3BGAA 1WMFA 3NAPC 1NOVA 2Z5WA 4N9IA 1ZM1A 2R49A 2XJTA 1W28A 1GZWA 4ISQA 4WM8C 1EUUA 5FZ7A 4C0HA 4FAGA 2KR2A 4MVTA 3VZKA 3N36A 1EY2A 1OF3A 5JIAA 3MFAA 1W6MB 2WFPA 5FV3A 3JZVA 1VMHA 1GWKA 1W6QA 1LU1A 2VE1A 3EQEA 4ITCA 1NE4A 1EUTA 4CCCA 2P6HA 2DURA 1RUC1 5DQ0A 4XYXA 4KL1A 4NOTA 5A3UA 3THPA 2CNAA 5ERLA 1N3OA 2JE8A 1V6KA 4JGYC 4AQSA 2VZPA 5FYUA 2AACA 2VULA 3ZYHA 4BA6A 2GMEA 1VBB1 4CP0A 3EBRA 1HN1A 1PVC1 3QLQA 2EIDA 4Y4RA 4BXFA 3C7HA 3AVRA 5I0TA 5JAXA 4JGZB 4EN9B 2IFRA 4YW3A 5FO9B 5FOJB 3SEPA 4PIXA 1E57A 1UXXX 1QQP2 2E31A 3KS7A 4L92A 2YROA 2LW8A 1U5IA 2VVFA 4QPGC 4Q4V2 4QX7A 3ZPOA 2DVFA 5H9RA 4FP2A 3GHMA 5C4WA 5IW0A 5ACA3 2ORXA 4Q4Y3 1PO21 2NMOA 4J1XA 1FOD3 4CU6A 5KHGA 4WVZA 3BI3A 2H6CA 3HD8B 3E6BA 1WCUA 2HH9A 2JE7A 5K4LA 1JXNA 1YUDA 2KXLA 4ARXA 4F7ZA 1IPSA 2RR13 4OYUA 4JZRA 2XUEA 4KWUA 1RUG3 3P3PA 3SH3A 2BDRA 3OEBA 3ZXKA 5EJZB 3ALQA 1RUC2 4Y26A 1RC6A 3ZXEA 5D8AC 3M3IA 3I4IA 4HVOA 5LATA 1ZBE1 4KGGA 4NIIA 4CDUC 2VOVA 2X05A 3I2FA 4GWJA 3THDA 2B46X 4W6XA 1HQNA 4XJZA 3RYPA 3POJA 3VBFB 4LKEA 2D97A 3MO4A 1LOBA 1VBB2 1HRI1 5HCAA 3O1TA 1E5RA 1SLCA 3M3EA 5FP4A 1PVC2 1PO11 2W39A 4IL7A 4XCAA 5FZEA 2Q1ZB 2V72A 3ZFGC 4BQ4A 4NHKA 3AXDA 1W6MA 3J26N 4NJ4A 1WCSA 1ZRIA 2B4KA 3S0MA 1JUHA 1V9U3 4LBLA 2UWBA 1V6NA 1UOGA 4PI0A 4MV2A 5IJRA 4QHOA 4CUGA 1X36A 3J9SA 3FJSA 1R1ZA 1VBC1 2GU9A 1NE6A 1EAH2 3R4SA 1J83A 4BK5A 1MQTA 1T2XA 1WMEA 4LBQD 4NAOA 4B29A 1LGBA 5SV8A 3ZYGA 2WNUB 1LENA 1PO22 4CP1A 1AYN3 2CU5A 4HANA 4A6OA 1OC1A 4ISRA 5F37A 3I2GA 1IS5A 4K7JA 1NLQA 5LCWL 1W2NA 4XF1A 1JHJA 1UX6A 3C7EA 1SFYA 2H0VA 2WNVA 3PUSA 2D6LX 2WO1A 4D69A 2P2KA 1KQRA 1TNFA 4KBZA 1S2EA 1RUD1 2GC3A 1OQEA 2VNOA 4QGMA 3A7QA 3AYAA 3WG4A 2OVUA 3ILRA 4FXKB 4INDA 1ULDA 5HV4A 1O3RA 1F8VA 1LHVA 1ZVFA 4LHKA 1JZ6A 3KWVA 3ROUA 5EXOA 1OXCA 3U11A 4P08A 2L9LA 1ZBE2 3ENRA 4Y1VA 5FPBA 5EIYB 1N3QA 3K4ZA 1N3PA 1R1A3 1ULEA 1NA1A 5A7NA 3ZFEB 4CXWA 5BYNA 4NR1A 2ZKLA 4A3ZA 1W6OA 1HRI2 4AEDC 5E8AA 3VD9A 4AE2A 1I6XA 3T2TA 1PO12 3PTYA 3VGIA 1I1EA 1W9SA 3VD5A 1DYKA 3H42B 5FPZA 2AH2A 5FZIA 2IWGB 1I5ZA 1XJAA 1EYBA 2VQ0A 3URFA 4RGKA 4CCJA 3PUIA 3I49A 3TEYA 2JG9B 5IVVA 2NMNA 2HEYF 4LULA 1VBC2 1VR3A 5E88A 1GOGA 2WNOA 3DF0A 1OA4A 1OD3A 2KA3A 2RDSA 2E63A 3QH6A 4Z1VA 4D7SA 4Z2WA 1VIWB 3RZMA 3BIWE 1HRV1 3S30A 3H8UA 4XFHA 2R32A 1SDWA 4LPLA 3ABZA 4Q0PA 1BXHA 1BK0A 4FTSA 1TME1 2DFBA 4JC1A 4HBNA 3PUHA 1VBA3 1OBNA 1XC6A 3BPZA 1IG3A 4XFBA 3USUB 5C3RA 2BVVA 1C8M1 1RUD2 3O5SA 4YVSA 2Y34A 4CDXC 3A21A 2YFZA 2OQ7A 1UO9A 2W47A 4K1YA 1S0EA 1TEIA 2Z79A 3B5LB 3M8LA 4LLFA 4QGLA 3UKVA 4OQ8A 4LNVA 4UFHA 5IYYA 5FYHA 4D6SA 4SBVA 4K40A 4Y5Z0 1BLZA 1F31A 2WNUA 1CAXB 2B42B 3MGUA 4XFGA 3WX5A 3P1IA 1LECA 2IZWA 3MPBA 4BH9A 2PQSA 4HKWA 1OLMA 4LORA 4PQQA 4XE9A 3WG2A 4E8DA 1ZZBA 2VH9A 1YC61 2RHPA 4Y5TA 4U2AA 1WUVA 4BK4A 2WAOA 4XJUA 1LCLA 1AR62 2UY8A 3ZR6A 1NX9A 1O91A 3BOPA 3DPRB 4GAZA 2RMU1 1XYPA 2QQMA 4CCEA 2VQUA 4LITA 1ZA7A 5EFUA 2P5BA 3PU3A 4XF4A 1PK6A 2YBKA 1FMD3 5KHIA 1JW6A 2BEOA 3I2HA 1L3JA 4HPKB 4W6WA 2J1TA 3GZTB 4FP3A 2D44A 2HKXA 4BOWA 4ZU7A 2DCKA 3V0AB 1POV0 2WL1A 3WF4A 5KHHA 2JKBA 3MLLA 4LHNA 3ZSJA 1HRV2 3WUCA 3LDKA 3WNXA 3ZFEA 3VD4A 4AAPA 3NW4A 2WA3A 3DKWA 4XJWA 4Q0UA 4ET7A 1LHOA 4AHWA 5IT6A 4YM0A 3B94A 3POYA 5CEHA 1A8MA 1S0CA 1FAYA 1W8TA 1C8M2 2BWCA 4HMZA 2VBBA 4TLFA 1YYNA 4AFMA 2YBSA 4QPWA 2VY0A 1RUH1 4IESA 2DTWA 4O9GA 1DU3D 1K5MA 1R093 4XEZA 4OI0A 4KMQA 2OKXA 4JQRA 2WT1A 3VD3A 3SKVA 1TQ5A 2XVGA 1IQDC 1Y9MA 4FTEA 2ARBA 3VUOA 1GP6A 1YFYA 3JD73 5EWSA 5C4WC 1UOFA 2PLV3 1JYXA 4MHUA 2GN3A 1TMF3 1C5IA 2AENA 4BMBA 1AR81 3H3LA 4E2QA 5JXHA 2IXIA 1CAUA 2RMU2 5C70A 4FTBA 1O4YA 2Y6FA 3N7LA 1H2NA 1H9PA 2QQVA 4SLIA 4AVSA 2ZZJA 4LBJA 3KCCA 3TWIA 1CD3G 4OHVA 4XETA 3ES1A 1JTZX 1WW5A 2YXSA 2OIIA 3LA2A 4IV3A 4Q4X1 5D1IA 3RSJA 1OURA 1QNYA 3ZYFA 3MIHA 2OPWA 1WKYA 3D5OA 4DY5A 2R073 4ASKA 2XQRA 2WNEA 1PIV1 3WDUA 3BVCA 1XNBA 3INAA 3U4SA 1CIYA 1QJY3 4WM7A 4WV8A 1C1FA 1YEWA 3KHBA 4J6GA 2AREA 3TAYA 3G7DA 3FFZA 1RUH2 4P9LA 1H2LA 4B7KA 3W59A 2C0ZA 5AC93 4HPKA 4P9JA 5LBFA 1ENSA 2B5HA 1UWWA 5DZFA 2F4PA 1VBD3 5DG2A 2WDBA 5LA0A 5GLVA 2GNMA 4LR4A 3RS6A 2W2IA 4U36A 4NIHA 4TTGA 3QBQA 5CFCA 4GKXA 1MQTC 1OFSA 4ATFA 4CUAA 2WFF1 5AFBA 4UFKA 2A6WA 3CJXA 2EIBA 1AR82 3U10A 1O8SA 1G6NA 1QNWA 2Y6KA 1VRH3 2VZ3A 3MV01 2PHFA 1JYIA 3WXPA 4GB32 2JDKA 3POBA 3DXUA 2DDUA 2GP3A 3CU7A 1J58A 3AMNA 3U75A 4AVAA 2WNVC 4QQHA 1UN1A 2ZEXA 5IVCA 1AJKA 2CDPA 4QMAA 5ANNA 5FZKA 1NCQB 1S2KA 4IEUA 4OHXA 4PQ9A 1W8HA 5T55A 5C9AB 4N53B 3QOPA 3U14A 1JOBA 1ULFA 4NWWA 3POGA 4X8NA 1Z7S1 5A80A 3VZOA 2VC9A 2XJSA 4XXPA 4AFDA 4EN8B 3R4UA 4RHV3 4NIDA 1QOOA 1X50A 3S5AA 5HPOA 2FDHA 1PIV2 5K0UB 3MICA 3RPQA 2O14A 1VAVA 1W2TA 2VECA 3NAPB 3AP4A 3NVCA 3Q9OA 4N43B 4QX0A 4E4ZA 3E1F1 2RJ2A 3V0BA 4XBLA 1NA1C 4XDOA 1RHI3 1W2OA 1SPPB 3MF9A 3GJAA 5A32B 2VR4A 5EYXA 4XACA 3AP6A 1ZNPA 1NY71 2ZA9A 1D2QA 1DQ2A 1S55A 1RUJ1 1M06G 4CYDA 1SHWB 4JTOA 1HDKA 2QQKA 4JKKA 2QBXA 4Q4V3 4LHLA 3WDXA 5JSRA 3LWCA 3MF6A 3PHMA 2RS33 5B4NA 2WYFA 5FZ8A 1GQGA 5T5LA 1LTEA 1RUI1 2XJRA 3LDBA 4FOWA 2JDHA 1X8EA 1APNA 3W5NA 3BTYA 4JGYB 2DBNA 4OVEA 5E16A 1FV3A 5A6YA 2H6BA 2WFF2 3MLKA 1NUKA 3FN9A 4ZS3A 2QQWA 3FX3A 3OY8B 2VUDA 3AJZA 2ZGRA 2ZGNA 1UY1A 5K9YA 4FQZA 4K21A 4DUVA 5FDBA 4QDRA 3DEMA 2G9GA 4QU2A 5DMYA 3OEAA 1ND3B 4QXHA 2GZWA 1WWYA 4IUGA 4MOAA 3OPTA 4NO4A 3E6CC 1PM4A 2GNBA 2JICA 2VZ1A 1RUC3 4MUVA 4YVSC 3RI9A 4AVCA 2WSUA 5ANQA 1W9TA 1Z7S2 1UY2A 1LHUA 4URTA 5D21A 2EAAA 4O9EA 4NRQA 2DVBA 4GULA 2C9KA 2MPFA 1PMHX 4QB6A 5BNQA 1SFPA 2Q30A 2A3XA 1CJPA 1VBB3 4XFCA 2WWJA 5CZKA 2WNUC 4HFSA 3RWKX 1WCDJ 4IXLA 2JECA 1PMIA 4YWAA 3UETA 4A3XA 5KXCA 3OCPA 1LHWA 3NNFA 2ADEA 2XJVA 5GZFA 5IK7A 4IV1B 1X33A 4V1PA 2GALA 1UY0A 1WMXA 1NY72 2D5FA 2R16A 4JVAA 3T1LA 1HQWA 4A42A 1O3SA 1RUJ2 1LOFC 5FUNA 1NXMA 1POV1 4AEJA 4HN0A 2GP5A 4R9CA 3NWKA 5ISLA 2VMHA 3ORJA 3BODA 1OI6A 2HWC3 2YB7A 3ILNA 4DPNA 4N53A 1PK6C 2OXBA 1RUI2 5FXZA 4QWNA 4C1WA 4HK8A 5EPAA 4CDUB 4NIGA 1PVXA 2HEWF 2P3YA 1WA6X 2X5IA 3D8CA 3WR0A 4Y22B 3C3VA 5F39A 3T0DA 5T54A 4N43A 3OGVA 2WN3A 3ATGA 4AVTA 5KHKA 4HONA 4PF1A 3ZFEC 1RXGA 2Q5TA 2Y8KA 3AYDA 3ZFGB 1H1IA 3A4UA 3T2QA 4QX5A 4R9DA 5E6HA 4E27A 5CAZA 3OD0A 1W03A 5BNPA 4LO8A 1RMU1 4RL7A 3D0JA 1TG7A 2PHLA 2E51A 3OG2A 4LIUA 4QQ2A 2FDIA 4XJAA 4XVHA 4MYEA 1S0GA 5HCFA 2EVXA 4DXRA 5FY4A 5FK8A 1E5SA 4DQAA 3FZ3A 1KJLA 2Q8OA 4H3WA 1J84A 1REDA 3LD8A 2BWAA 3CL1A 3OY8A 4FPEA 1UU5A 2Y0OA 3AFKA 5FJHA 1PO13 1EP0A 3ZPYA 3GNEA 2W3JA 5JXGA 5I8SA 3TN91 1ZX5A 3OYWB 3HNMA 3JB4C 5KXDA 1ACCA 4A4AA 1DCSA 4BJ0A 1D4M1 1ND3A 4XHBA 3HR9A 4FXGB 3BN6A 1K5JA 5JDBA 5IK8A 2E7AA 2BPA2 3ZYPA 2DVGA 1ASJ1 2WWSA 3HVDA 2ZPXA 2W94A 4LKFA 4IV3C 2C24A 4DO0A 5JWPA 2RDNA 1R64A 4IETA 1OLQA 3D82A 1U5ZA 3THTA 4RS5B 4EROA 2XVLA 1UOBA 3I7DA 3PL0A 2PYTA 4QKBA 2VPVA 2JENA 2JE9A 2QCSB 3NNJA 4QQOA 4UFIA 5FR3A 1W8WA 2NZ9A 3FBMA 4OI2A 1HX6A 2CAVA 2W1SA 1PGL1 1RMU2 1POQA 1NQJA 2E6VA 3T4HB 4LEJA 2VNRA 1ULCA 5FZDA 4CXXA 1LESA 1EPWA 4FOYA 4XBQA 5F9TA 3CDZB 3JQWA 3VLBB 1O5UA 1A3KA 1BVP1 1P8JA 3ACHA 3H8RA 3SH5A 4UW3A 5C3PA 1MEC3 1VAKA 2ZGKA 2E9QA 3J7HA 4JKLA 4PBOA 5DUXA 4DNYA 1RXFA 3I2IA 4MHRA 3TN92 2CHHA 3F95A 5JR2A 1S0IA 3KT1A 4R9BA 5IK4A 3PUQA 2Y26A 1D4M2 4YM1A 5HXVA 5AVAA 3UESA 3NNMA 2X10A 5I0UA 1V6OA 5LA9A 4CDXB 1GMMA 3MW3A 4BQ2A 1NZIA 1LU2A 1YHFA 5FP9A 3GCXA 2N7GA 1ND2B 4NN0A 1ASJ2 1MVQA 2RS52 1RB8G 5A7WA 2XBO3 3DV8A 1A8DA 4F8AA 4UBHA 4F3JA 1F5JA 5FXVA 4ONUA 1YQ2A 2AYHA 2D6NA 1TME3 3B69A 3DCQA 4TYSA 2YZ4A 2CYFA 3WW4A 4FPFA 3HEIA 3H7YA 3KQ4B 4P02B 3WHTA 4DXSA 3GM8A 5AFEA 1DP0A 3ME2A 3VZJA 1PM7A 1XSQA 2BUKA 1DDLA 4BIOA 3OPZA 3VV1A 3N7KA 2J7MA 2VZVA 1COV3 1GZWB 2Z2SB 1PGL2 2Z69A 3WNOA 1X7NA 4P00B 1KD7A 1YFXA 4BQ1A 1QIQA 3LOIA 1JYCA 4META 2P1BA 4M0NA 5T5JA 3VZNA 1XB9A 1GQHA 1Y9QA 4E2SA 1PGW1 3VDCA 1W6QB 2IFWA 4AFAA 4LBQB 5FO7B 4FPCA 3UKNA 1ENRA 1O5LA 4LMFA 3RYRA 2HBTA 3WQ1A 2OX0A 3I2JA 2XQXA 3W21A 2Y6LA 4LXLA 4FBFA 3OBTA 1D7PM 2QQOA 4OCTA 1PX3A 3KGZA 1CONA 5JLVA 1QU0A 3WNKA 4YSFA 1AJOA 5BNNA 2W0XA 2RM21 4PLMA 1Y43B 1D0GA 2R041 2MEV3 3MLJA 1GANA 4UXAA 4XDPA 5LRSA 4D6QA 2OPKA 4UW6A 2E32A 1IPJA 4LOSA 4ZHNA 3I2KA 3RYKA 3VHPA 3HBKA 4CEWA 5J96B 2HWB3 1QMJA 1GBGA 1OUSA 2E26A 1AL21 2VTXA 5C4WB 1Q8OA 5FP8A 2CL2A 5L73A 1HXS1 2VMCA 3QCWA 1IG0A 3MW4A 4AZZA 3CZJA 2XG3A 4UFMA 2VCCA 5C8CA 1DG6A 4YW1A 1O59A 5HI0A 1WBLA 2D3RA 2CWMA 2VZSA 4HK9A 1N1TA 1RUH3 5T5PA 4XF0A 4CCLA 5A3PA 3FHQA 2XL7A 3SHRA 4RR3A 4ZY9A 4JDMA 4Q26A 5GLZA 4JAAA 3VZMA 3ZMOA 4PI2A 1ND2A 3MIDA 4YW7A 1W6NA 3IDEA 4EN0A 3O1MA 2ZHNA 1PGW2 4KGQA 1ENXA 3RJ2X 1NCQC 1WMDA 2BGPA 4LJHA 2WT2A 3L9JT 5A33B 4N53C 1GLHA 4FFHA 1LB2A 2D3PA 4DUWA 1OOPA 5FMOS 4AW7A 3UGFA 2FD8A 2ENRA 2BTVC 3A0KA 3WW1A 2FCUA 4XC9A 2B45X 4HOOA 1ULPA 3IB3A 4XZPA 4N43C 2JD9A 3QH7A 1XNTA 5J48A 3LEGA 4BYYA 3Q8FA 4Q4X3 2WS92 3WNMA 4XUNA 1W8UA 2V73A 2XDVA 4XCBA 5C6CA 2RM22 4D0QA 1CWPA 2R042 2ZEYA 3CJIA 5TSWA 4A7ZA 4YVWB 5BNPC 1CAWA 3POWA 4OHZA 1WGPA 2BV4A 1MS0A 4L9BA 5FZ6A 4LBQA 1MACA 3WNNA 1H1AA 4FPKA 3T08A 1AL22 1MQTB 1HXS2 4UAPA 3TNQA 3WF3A 5A3LA 3HMYA 3HQXA 1UYXA 5IHRA 4Q0QA 4YG0A 2A6VA 3PURA 3APBA 3SEEA 1UF2C 2BVBA 3LFIA 1UIKA 1B35B 2TEPA 2W08A 2FMYA 1YQ5A 1MZ5A 1S2BA 2WNVB 1NCRA 3GALA 4A45A 2RG4A 3JXSA 4Z2AA 4WBBA 3MIEA 4BM8A 4QX1A 3DL3A 1ND3C 4D94A 4XQWA 3AVSA 5DAPA 4DXZA 1QF3A 3UJQA 3V56A 4CDWA 1DLLA 4FAHA 2Y6HA 1VBE2 2WRAA 1G8WA 1DBNA 1EAH1 5JMCA 2PHTA 3AP9A 1CZVA 4DEVA 3C2UA 1UL9A 3I3DA 3WP4A 4HLTA 3OD4A 4W65A 3W20A 4EN7B 1Q8PA 4ZKTB 3LOBA 5L7OA 1NA1B 2QQUA 3CKHA 4XDQA 1H30A 4Y20A 3U4XA 1W6OB 3LZZA 5FXXA 1E5HA 4XUQA 4QXBA 5C33A 3PTRB 1XQNA 3NV2A 3B9CA 3LEKA 4IGPA 2ZX1A 3NKTA 4IV1C 2ES3A 1LR5A 4L8QA 5CYYA 1QJU1 1ALYA 1A34A 2XLFA 1Z7S3 2ZXQA 5LWBA 1UZZA 4KU7A 4KWJA 4M00A 5F3EA 3AC0A 1AF9A 2GN7A 3HT1A 3IWZA 5A33A 1PGSA 4GWMA 2BNOA 2R061 1GNYA 1MZ6A 4FFFA 5BNOA 1UIJA 1V0AA 2WKKA 5FLJA 2DFCA 5K7PA 2W1QA 3VBOB 2JDNA 3ZIWA 3DYOA 5CIRA 3PLQA 1DQ5A 5FKBA 4AGGA 5IATA 5FY7A 5JSPA 3LCPA 3J7LA 2F4LA 3WVJA 1YJKA 3PVBB 5I8YA 5KR7A 3HNYM 4G3YC 1O4TA 4TXWA 1K45A 5LY2A 4S2HA 4Y1UA 2FCTA 1RVF3 4YVSB 4BQXA 4YVWA 1AX2A 3RRDA 1GKBA 1RUI3 1WW7A 1WCKA 2X29A 1MS5A 1J59A 3U07A 2QQNA 1W9FA 4F83A 3ZSLA 2P3IA 3LA7A 5FKCA 1ONAA 1XOYA 3CZUA 4RFT0 4C91A 1ZRCA 3WF0A 3R4DB 3KV6A 1DFQA 2D6PA 1G9DA 2ARCA 1AR71 1CX4A 3GZUC 4MXVA 4W50A 2BBVA 4K20A 2Z42A 4YZ3A 1OF4A 1B35A 1G86A 2ZACA 3VKNA 3VKLA 1LHNA 1ZBA3 4ZU5A 4C8DA 4CA9A 1O3QA 1K42A 3N3HA 2ZMKA 3LIGA 4M3CF 5FYCA 5J3UA 2EXIA 4HVRA 2RS11 1QJU2 1W0OA 4UF0A 4EWAA 5C3QA 4QXKA 4AFBA 4RQPB 4YW4A 4OHWA 4DB5A 2ZX2A 1PK6B 3B9IA 4QPIB 4DY3A 1HB4A 1MS9A 4Y24A 2P3KA
chains in the Genus database with same CATH topology
1DZQA 2R062 5LK7B 1IGOA 1H0BA 1KDKA 1MS4A 3W58A 3WW3A 1QWRA 2XL9A 1RUF3 5FPXA 4OULA 4A7KA 2VUAA 1QGLA 4RS5C 2ZKNA 2IXLA 4YW2A 1W0PA 1AR61 4FPJA 4IEWA 3MFCA 2DCTA 1CPNA 2PAMA 5JOWA 1K5MB 2Y38A 5JR7B 1IKPA 4LE4A 1R083 3KD4A 5DXDA 1PHMA 1EV13 3NJZA 1AR72 4CEWC 3VBOA 1ZRFA 2W68A 2ZGOA 1OA3A 3WP3A 3J8F1 3E5UA 2PHXA 3AZYA 5JPNB 1CAUB 2CY6A 5C8CC 2C9AA 5KC6A 2RS12 3N35A 2K2SA 5JOYA 4RR3C 3RDIA 1X8MA 3A0NA 4IV3B 1ND2C 3FLTA 1RIRA 3TN93 4I09A 4XJ8A 1FNYA 1AX1A 2PA7A 4G4FA 5CFDA 3ZXDA 4COVA 1BEV1 4GMP3 1OOPC 1DIWA 5FO8B 2YPJA 1N1SA 1JBCA 1RINA 5F6LB 4WM7B 4AF9A 3PVEA 3WDWA 3W9AA 4LBMA 4RQPA 2CGNA 4QPIA 5BUVA 4L11A 5HCBA 3ST7A 4LUKA 3EXUA 2HWD1 3EJKA 1Q8SA 2MNGA 2I07B 3P3NA 3CJIC 4XMIA 1QJZA 3MZHA 2P3JA 4Q4W1 4OUMA 1KRIA 5CFCB 3J8F2 1V6LA 2LUWA 4J1WA 4LBOA 1AZDA 1MVEA 3AZWA 1FPN1 3OGGA 4LTAA 1AL0G 1Q8QA 2QKDA 4JV4A 1IZ3A 5I0RA 5CU1A 1NCRC 4PLNA 3KCXA 3ZXFA 4HN1A 2GNDA 3VKOA 4BZ4A 5JIUA 3UL2A 5KXEA 1AYM3 1SQ4A 1S0BA 4D7YA 4CDWC 4NHMA 4DRRA 3VN4A 1KS5A 1OLRA 2ZGMA 4M01A 4BHPA 3PVOA 2LALA 2HWF1 2DWRA 1BEV2 4XXAA 5JZGB 1DYPA 4LBKA 4WVMA 3V0BB 5L7OC 2BFUS 4AEKA 1Y7BA 1SLLA 3AB0A 4GB31 3AZXA 2UYBA 4XF3A 1QHDA 3AYCA 5IUQA 2HWD2 4LO6B 3UV9A 1TNRA 3SITA 4COUA 3AKSA 4GXLA 1C3HA 4NHLA 4Q4W2 1DHKB 3J4UH 4YNIA 3FUQA 3WV6A 5CG8A 2WLQA 2ZX0A 4EN6B 2NN8A 5EZWA 5BNOC 2JG8B 2BNMA 5JI9A 1N1VA 3K51A 4YGEA 1IS3A 1FPN2 4M3CB 2CGOA 3M3CA 2W52A 2DU1A 4XTMA 2VVDA 3RZZA 4G9SB 3R6SA 1SCRA 1ZYBA 1OHFA 4YVWC 3PNAA 4MXWB 1Q8VA 1J3RA 1GYKA 1SLTA 2H0BA 2HWF2 2VUJA 1SLAA 2FBEA 4YZ4A 4GALA 5CG9A 3AZZA 1F9KA 3KQRA 4W6YA 2DCZA 1B35C 2E53A 3GBGA 3L2HA 4P9IA 3JBG1 1O7FA 5J37A 4Y1ZA 1Q3EA 5DZGA 3UKTA 1RUOA 2VOWA 1FT9A 3SCGA 4OUSA 5GZDA 5LEKA 3H1WA 4FPOB 5FQ0A 2X5IB 4R52A 2EF6A 1J1TA 4EJRA 1H4HA 5ACA1 5JZGA 3HT2A 2WLPA 4Q4Y1 3LKJA 3ZSEA 4B8EA 3HBZA 3KCYA 4RD7A 4OHYA 1DQ6A 2A3YA 2VW2A 4KWKA 1IKQA 1QQP3 5BNPB 2HEVF 4YZ1A 3VBSA 5J98B 3M2MA 3NL1A 4HSLA 4COWA 4E2GA 4I0WB 4YGDA 1A6CA 4AXOA 3BOWA 3MIFA 1Y3TA 2JG8A 1CAVB 3ZN6A 4UBGA 1D2SA 4M3CA 2EA7A 3VBOC 2O8QA 4CZSA 1AXKA 2CV6A 3R0RA 5LRRA 3NSTA 2VOKA 3NV3A 3JBG2 1IOAA 1HV0A 3VBUA 3JCIA 1RUE1 2QZ2A 4BLIA 4MGIE 4ASLA 1NZCA 1V9U1 1UKGA 2EAKA 4MXWA 1YJLA 1CPMA 4WZFA 5BY5A 3LB9A 3B3QE 1BCXA 5I0SA 4GH4A 1G9BA 1U0AA 3ZX7A 5CVRA 4C90A 2D3SA 1TE1B 5ACA2 2PFWA 4Q4Y2 4YGCA 1FOD2 1PVC3 1AYN1 2GSYA 3VBHA 5CADA 4B3NA 5KC5A 3I54A 4PDWB 3ETQA 2ATFA 1H9WA 3OGJA 5DZEA 4CP2A 2E7QA 5BXXA 4KNCA 1FYUA 2DTYA 2OYZA 1EAH3 5FTTC 4RQPC 4JRLA 4QPIC 1PO23 3MW2A 4IEVA 1RTVA 4PIYA 1Z0HA 2DCJA 1Q5OA 1XNKA 2QDRA 1R1A1 2G9FA 1LOCA 1FNZA 3MI8A 3KSCA 3O7OA 3FE5A 2O8OA 3ELNA 4ZU4A 1QJU3 5F6KA 3WCRA 2X8KA 1RUE2 1AXZA 2G4IA 1XU1A 1GZ9A 1V9U2 2Y0IA 4XMAA 1FX5A 1ZBE3 4FSJA 1K5MC 1MS3A 4YYOA 4HL0A 1LODA 5DUVA 1H8TA 1HRI3 1CAVA 5AVPA 4Y4YA 1AYN2 3SCHA 3GYDA 1S1AA 4PF5A 1M4WA 1XNDA 1IS6A 2DVDA 4CRQA 4DS0A 3PJQA 1VBA1 2B7YA 1BBT1 1VBC3 1NG0A 1YFUA 4R4ZA 3QD6A 5ABJB 1YFWA 1OA2A 2RS51 1O3TA 1AR73 5GKAC 2CGPA 3H1MA 4CTEA 1UCXA 3RMXA 2UY9A 3CNAA 2E7TA 3H3UA 2R1BA 1R1A2 4BIFA 3B02A 4WVVA 1RUD3 4PDWA 1VB2A 3K48A 3OF1A 5GLUA 3ILFA 4E4DX 2IXKA 3WG3A 3CLPA 4WM7C 3V65A 5A3MA 4PIZA 3WLUA 4JRAA 5BNNB 5GZGA 2DYCA 1FMD1 2WQ4A 3AX4A 3E6DA 3FBYA 4I30A 4GIQA 1H2KA 2RJLA 4CEWB 4I01A 3WP5A 3VBRA 3D0SA 2V5YA 3ZIXA 3I8TA 1AR63 1I3HA 1WA4A 2PAEA 4HZFA 3ZXLA 5CFCC 5BPXA 4KH9A 2D5HA 5C8CB 4S2DA 2JEMA 4HVQA 2ZS6B 2ERFA 4K8FA 1VBA2 2GC0A 3D6EA 3RI8A 4I02A 5BV6A 1BBT2 4RR3B 4QM8A 1QY4A 1V6MA 3PJYA 4Q1PA 5D8AA 3L2YA 1W6NB 4AWDA 1HRV3 1DF0A 4LO5B 2WSVA 5IK5A 1VLNA 2ARXA 4GKYA 1CN1A 4AGVA 1OOPB 1CR7A 3FFQA 1GFF2 2VVEA 1C8M3 2Q1MA 1WD4A 4JTNA 2PLV1 1WBFA 5JZGC 3NO8A 5GLTA 2XKPA 4OI1A 4S2GA 1HIXA 3KT7A 4XF9A 3S7EA 3M4FA 5H9PA 4EWDA 1LJ7A 3CJIB 1FMD2 4HSJA 4X6QB 5ABJA 2CWSA 1CAWB 1ZRRA 3VBSC 1N47A 3KMHA 1PZ9A 4AVBA 2QJVA 1V00A 4RGGA 1BEV3 3MIGA 4RSUA 2VU9A 3E97A 1G9AA 1PZ7A 1SACA 3DGTA 2R071 3IPVA 4Q29A 3WW2A 4AHZA 3U0ZA 2RMU3 5JI7A 2JG8C 3B93A 2OW4A 4M3CE 1SBDA 1QJY1 1RJ7A 4S2FA 2WS91 1NCRB 1J1LA 5E89A 3VBUC 2SBAA 4AHYA 2ZOEB 4Q4W3 4RGAA 2YY1A 4CDWB 2ZMNA 2ZHKA 4I3GA 4Q8KA 5C8WA 4N9HA 5FRAA 3WQ7A 1VALA 1AXYA 2WT0A 3S7IA 4GH4C 4A7YA 2PLV2 2PTMA 2BYVE 5L7OB 3IKWA 4Y20B 2JD4A 2MHFA 5CBLA 4IQPA 1VRH1 3VBHC 2A6ZA 3WT3A 4AI0A 2DUQA 1ULGA 5H9SA 2Q4SA 3O14A 2WC2A 1GSLA 3AFGA 2FZ1A 3IM0A 1NLSA 2HWF3 1BK1A 3LSEA 1VBE1 4B4RA 1AR83 5BNOB 2R072 2A75A 4RHV1 3M1HA 4MGKE 2X5IC 4Z07A 2LM3A 4ASMB 3LA3A 2WA4A 4GB33 2XWBB 3GF6A 3ZYJB 1QJY2 1RHI1 4FQ4A 2D43A 4AI1A 1PZ8A 2WIIB 2QZ3A 5JOZA 2NPIA 5AC92 3IDCB 1QXJA 2WJSA 3TRSB 1V6IA 1S0JA 4OZXA 1PIV3 2D6MA 3RWNA 2RS31 5EYYA 4H14A 3SISA 5FOBB 2NP0A 1J3QA 2A5ZA 3D4KA 3IDBB 1B09A 4QQLA 1DGWX 2HJIA 3O0WA 4FVVA 4GQ7A 1H8TC 4I3PA 5KWRA 1UW8A 4MGZE 1ZA4A 1VRH2 2QQPA 3O0XA 1WLTA 4KG0A 1QOSA 2A71A 4BMEA 1U12A 1JHNA 2QUOA 3HAGA 3EHKA 2A6XA 4OLLA 1XE7A 4Z82A 2WZR1 1YRZA 3TNPB 2DU0A 3ZFFA 1ZZ8A 2XJQA 2WFF3 4COZA 4XIOA 1S0DA 1KFUL 2BGCA 3SNMA 4RHV2 4QPYA 3M70A 1QXRA 4IEPA 2V09A 3JBG3 4EV0A 2K9ZA 5CNAA 3FC0A 1XRUA 1RHI2 2DUPA 2QFEA 4PDWC 1UD1A 1YNAA 2D40A 3VKFC 2XGXA 5SV5A 5GJ6A 4MZUA 3AKTA 4I2OA 4FT8A 4XQDA 2HWC1 4CEYB 2RS32 5B2GB 5LEJA 5FCCA 4TZDA 4FPGA 3FLPA 4AYUA 5HBAA 3BU7A 1SMVA 2XJPA 3FHIB 3G6JB 1LEMA 2ZMLA 1JN2P 3VBRC 4CDQA 1RUJ3 5T3NA 4BLJA 4P9WA 1SFNA 3CF6E 1H2MA 3VKMA 3KGLA 2VXRA 2ZX4A 2I45A 2WZR2 4D7TA 4Y1YA 1CIWA 2ZGSA 1ZRDA 1GNZA 1BZWA 1IHMA 2PHDA 5LK5A 2SLIA 3ZMNA 4ATEA 3AP5A 4KBBA 3WQ0A 4YFWA 5EV7A 5CFDB 3R05A 3JQXA 3PMEA 2UYAA 3LSDA 5JOXA 1RUE3 1SCSA 1GR3A 5JVVA 3O0VA 4KU8A 4K6BA 2GC2A 3AJYA 4XFIA 3ZN5A 1OSGA 2GH8A 1YXWA 3VHNA 4EWEA 5GLWA 1IPKA 1UMZA 1OPOA 2PHRA 2YGLA 4QD2A 2PN5A 3JB8A 4Q0VA 2HWC2 4GA9A 4AGRA 3T1MA 4FPYA 3ZSMA 3AMMA 5ABJC 4YGBA 4I0BA 3H3ZA 1YWKA 1DZTA 2XVKA 3WP6A 4Z8BA 4KQ7A 5JCTA 1YIPA 1DGLA 2DF7A 2VQAA 1QXPA 1LEDA 2TBVA 1WW4A 1POV3 1RGSA 3SMHA 1OFNA 3IN9A 4JGZA 1D0HA 4NPRA 3NV4A 2UWCA 4AG4A 2A3WA 4TWTA 1I9RA 4FCAA 1REEA 1SBFA 2QVSB 3RNSA 5BNNC 1BQPA 4AVVA 4CEYA 1MS8A 4PBPA 4R4XA 3FWEA 4KWLA 1QOTA 3OJBA 1MEC1 3WCSA 3AZVA 4K9SA 1CVNA 2VW0A 4WVMB 1RMU3 1MS1A 3FUOA 1QH6A 2XWJB 2IXHA 4H7LA 3VL9A 3TYJA 1YI7A 1C28A 2EXKA 3ZDSA 1EPZA 3IIAA 1W2UA 4KG8A 2B8MA 3ZXGA 2GMPA 2XBO1 1AUYA 1LOGA 3BCWA 3VBFA 3X29B 3VL8A 1N1YA 4GWNA 1DQ4A 1UAIA 1HV1A 3S6PA 1D4M3 2PAKA 5FAXA 5I8TA 3O12A 5FMOL 2GDFA 1AHSA 2X53S 5DDJ1 1BBT3 2PHWA 3H9AA 4XILA 1C5HA 2R1DA 1AR91 1ASJ3 1WLWA 3WHUA 2RS53 1COV1 3TB0A 2EIGA 1QJX1 1UPIA 3AMPA 4LE3A 3JU9A 2HWE1 5GM0A 2GH2A 4HETA 1MEC2 1NYWA 4JDNA 4X8PA 1HLCA 3AKQA 4AEMA 3BTAA 2FMDA 4AQ6A 1XXNA 3FLRA 3PMSA 2O1QA 1LOFA 2PELA 1YO8A 2GNTA 2LTNA 4UW4A 4XTPA 4BCUA 4L2NA 3WG1A 2C5DA 3TBDA 1H8VA 4XFFA 2YYOA 4IEOA 5FREA 3SH4A 1WLDA 4P14A 3ZVXA 1QDCA 3ES4A 1ZZ9A 3RQ0A 1ENQA 2YGMA 3MYXA 2MEV1 3IMNA 2XBO2 3ACLA 1KDMA 1F5FA 5I91A 3ZFFC 3ZYIB 1O4ZA 2HWB1 1TME2 5J7MA 2ZTNA 1KFXL 4R8HA 5FQ0B 3AKRA 4L99A 1KJRA 5DDJ2 4RA0A 4YFZA 2XJUA 1AR92 2OUJA 4LBNA 2JG9A 1COV2 1Q56A 2B39A 1QJX2 2QDNA 3VBSB 3H0OA 5T50A 2HWE2 3DN7A 3FMGA 2ZGPA 1WLCA 1XYOA 4YRDA 2JJ6A 4E9KA 3NKGA 4AK3A 3USUA 1HW5A 1PNGA 2ILMA 3ZN6B 4FOQA 1C1LA 1GV9A 1UZYA 1YI9A 4A2UA 1S0FA 2NM1A 3B00A 4CDQC 2WZPP 4Q1RA 3VBUB 2ZHLA 1XNCA 4COYA 3VHOA 2IXCA 4GMP0 1D4VB 3MIBA 1CAXA 4WVWA 2MEV2 1V6JA 3AMQA 1QH7A 3CEWA 1DQ0A 2HWB2 4B7EA 4GH4B 4QQPA 3VDDB 5L36A 4LLOA 1XU2A 1CJDA 4IEQA 3V64A 1UPSA 2QE3A 1W6PB 3DPRA 4ATFA 1J3PA 2WS93 4XW3A 3VBHB 3PVNA 1AVBA 2RM23 1NQDA 1FV2A 3DUIA 4L97A 2R043 2ZGLA 2EXJA 3GZAA 3ZN4A 1ZZ7A 2OZ6A 3V0AA 2VMGA 1LULA 1AL23 2K0GA 1UKRA 4C0BA 4BE3A 4H55A 1HQLA 1NLRA 1OPMA 1HXS3 1DZRA 1CESA 4Y1XA 4P9GA 2YC0A 4R9AA 4XPVA 4XIKA 3H7JA 1YCIA 2B9UA 5FLIA 1FOD1 2UWAA 3ZYRA 5FLHA 1UU4A 3ASIA 4NVPA 5DUWA 4DINB 4Q4X2 3IT8A 5CA6A 1MR5A 3B7MA 4JGZC 2NYYA 2KM2A 3GBWA