1JXNA

Crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
b'SDDLSFKFKNFSQNGKDLSFQGNASVIETGVLQLNKVGNNLPDETGGIARYIAPIHIWNCNTGELASFITSFSFFMETSANPKAATDGLTFFLAPPDSPLRRAGGYFGLFNDTKCDSSYQTVAVEFDTIGSPVNFWDPGFPHIGIDVNCVKSINAERWNKRYGLNNVANVEIIYEASSKTLTASLTYPSDQTSISVTSIVDLKEILPEWVSVGFSGSTYIGRQATHEVLNWYFTSTFINT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-H(O) lectin I
publication title Examination of the Structural Basis for O(H) Blood Group Specificity by Ulex europaeus Lectin I
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 58
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jxnA00
4YM0A 2EXKA 5H9RA 1GICA 2PHFA 3OJBA 2ZHKA 5JOXA 3USUA 3AYAA 5EYYA 1QDCA 1SCSA 4MYEA 4R9DA 4I30A 1FATA 1X50A 5DUWA 3SISA 1CR7A 3ZVXA 1S0EA 1F5FA 4YZ3A 3SH3A 2CWSA 4P9XA 1KQRA 1S0FA 4XBLA 2XB6C 3NV2A 3M3OA 3OBRA 1AVBA 4GA9A 3OYWB 5CB7A 4YGCA 1W6QB 2E7QA 1RINA 2R0HA 4ISRA 5T55A 4BLJA 2KM2A 4BLIA 1ULCA 1DLLA 4GALA 4LBNA 2ZGUA 4BOWA 3FLTA 1W6NB 4FOVA 1AX1A 3MW2A 2B7YA 2I2SA 3ILFA 3KM5A 5HCAA 5GLZA 2ZZJA 1DQ0A 2VW1A 1H9WA 3ZPYA 3HN1A 2TEPA 1LOEA 3UJQA 3AZZA 3V0BA 1MS5A 2ARXA 1VALA 3RG0A 1D2SA 2PHXA 2E6VA 2ERFA 5KXBA 2DVGA 5CA6A 1ENQA 3VKFC 2Z42A 1Q56A 4AGVA 3N36A 4FQZA 3WCRA 2EXJA 1LEDA 2OUJA 3VV1A 3WVJA 5T5PA 5H9SA 2VY0A 3AP4A 2GMMA 2GN3A 2ZA9A 2ZHNA 2OW4A 3RMYA 4AGRA 1YIFA 3OYWA 3V0AB 4FP3A 1W6QA 1BKZA 3AXDA 1UKGA 2ZGKA 2YY1A 1MS3A 1QOSA 2ZGNA 1G9CA 4SLIA 4XYXA 3VUOA 3T1MA 1LCLA 5IK5A 3WHUA 1DIWA 3D6EA 2EXIA 4LBQD 2ZAAA 4NO4A 2WNEA 1QOOA 1UMZA 3B01A 4JCKA 1DGLA 2WT0A 4YFWA 1Z0HA 2P34A 3POSA 5F5QA 3FUOA 3AZVA 4P14A 3IKWA 2NM1A 2LALA 4Y1ZA 3AZWA 1FNZA 1WLCA 3GALA 1B09A 3PVEA 1S0GA 4XBQA 1SBFA 2D6NA 4BMEA 3AK0A 2SLIA 1G9BA 1MS0A 4FOQA 3U4XA 2CTVA 4LBQB 2YMZA 4K1YA 5JVVA 2D3SA 1ULFA 4XILA 1CVNA 2EIGA 2WT1A 2D7FA 3AFKA 3SH5A 1DHKB 3WLUA 3N7JA 1KDMA 4XJUA 1Y7BA 2DVDA 1AXKA 2D43A 4R9BA 4Y1VA 1V6OA 3C2UA 3O5SA 3FFZA 4C1XA 1I1EA 1F9KA 1IS6A 2H0BA 4GXLA 1IKQA 1SLIA 2A6YA 2GALA 2ZBJA 2DYCA 4YW3A 2UWCA 2UWBA 1LOFC 2GN7A 3N35A 1LECA 3H0OA 4GWNA 4FPKA 2FMDA 5GZCA 3BIWE 2A6XA 1W6MB 1LOAA 3B9CA 2JKBA 1ULDA 3AJYA 1TEIA 5LK5A 2WKKA 4XTPA 1QU0A 1HKDA 2JD4A 2WQZC 3OBTA 1JOJA 4YZ2A 1IS5A 3D5OA 1UZZA 3INAA 1GKBA 3AP9A 5GLTA 1WW6A 4LBQA 4M00A 2P3KA 1GYKA 1YYNA 3ZXJA 2D6KA 1YI7A 4Y1YA 4DPNA 4XBNA 3ENRA 4P9YA 2D3PA 1AZDA 4Q27A 4XJ8A 1C1LA 4AYUA 4U2AA 3NV4A 2PHRA 2DTYA 3AP5A 3PVOA 3L2YA 3BODA 2GDFA 3WNXA 4Y20A 2AH2A 1WCSA 3VKLA 1G9DA 1MS4A 1LOFA 3UK9A 1MACA 1FYUA 1DFQA 1CJPA 1GBGA 1GZWB 1LGCA 1ULGA 1N3QA 3KQRA 3ZYPA 4YM2A 2Q5TA 4XXAA 1W6MA 3WZ1A 5KXDA 3AYEA 3AZYA 3LSDA 4FPJA 2C9AA 3RSJA 3UJOA 4BM8A 5JLVA 1GZCA 1W6OB 2ZGLA 4UW5A 3VKMA 3WUCA 4Q1PA 3ZSLA 5JOYA 3TAYA 2VW0A 2A3YA 2AREA 1UN1A 2W39A 5IUQA 3POYA 5BYNA 4AVTA 1JHNA 5GM0A 1V00A 4LBMA 3O0XA 3ZXFA 1IKPA 3AX4A 2ZGQA 3IM0A 4Y22B 1ULEA 4FPEA 2ZGRA 3QCWA 5E89A 4YG3A 4AVVA 2ZGOA 4FPOB 5E8AA 1LODA 2A6ZA 2OUHA 1MS9A 2EF6A 3ZXEA 1MS1A 2ZACA 3MPPG 3N7KA 1WUVA 4GWMA 4M01A 4XJWA 1QNYA 1W6PB 2BQPA 4XTMA 3SH4A 3ZYRA 1GZWA 4F83A 2UU8A 1IS4A 3M3EA 4XOGA 1IS3A 4GKXA 1OFSA 4LBLA 5JOWA 3WDVA 2GNTA 1WW5A 2YV8A 5KXEA 4YGBA 2JECA 3WG3A 1LESA 1QNWA 1QMJA 1WD4A 1N1YA 1PZ7A 1N3OA 1SBEA 2VH9A 4XJZA 1V6MA 1S0CA 2DU1A 2WSUA 2R0FA 3QLQA 4RA0A 5CAZA 2CNAA 4ASMB 4UW4A 4XMIA 4YW5A 4ITCA 3M1HA 3OY8B 1V6LA 4Y22A 4YZ5A 3DGTA 1ZA4A 4K21A 3ZSKA 2CYFA 5F9TA 4FVVA 1RIRA 2FHRA 1DYPA 2R1DA 1W6NA 1LHVA 1I3HA 1KITA 1Q8OA 1WBFA 2DWRA 2R16A 5GZDA 1WBLA 2GMPA 4DRRA 4XE9A 2OVUA 1FV3A 2JE9A 4M3CB 1CIWA 2UWAA 5T50A 1YXWA 2C5DA 3D4KA 4TZDA 2NZ9A 1MS8A 3VKOA 2JJ6A 3ZSJA 2YZ4A 2A70A 1LENA 2ZABA 4W65A 2NMOA 1LULA 3FBYA 3HR9A 4M3CF 5L73A 4ATEA 1MZ6A 2DURA 1OKQA 2E53A 2EALA 5GZGA 3PVNA 4WZFA 4YGDA 5E88A 4YZ1A 2R49A 4CZSA 4YLZA 4AWDA 2DUOA 1V6KA 5DUVA 1LGBA 2AR6A 3LCPA 1ONAA 5EXOA 1AJKA 1WLWA 1N1SA 2G4IA 5T5OA 3ATGA 3PMEA 3WDYA 4YGEA 3V0AA 1VLNA 1GLHA 3MW3A 2VU9A 1GNZA 2VUAA 2YXSA 5JMCA 5DZEA 3DUIA 4FPLA 1JW6A 1CPMA 3M2MA 2AENA 4Z8BA 2P37A 1WW7A 4NOTA 5T52A 1DQ6A 1J1TA 1Q8PA 1VAMA 1S0BA 2EAKA 3BTAA 4Y1XA 3WG2A 4YFZA 4ATFA 5DZGA 2D6LX 4HL0A 3OGGA 1LGNA 1FV2A 3GNEA 3M3CA 5FREA 5GLWA 1JUIA 1SCRA 4XJAA 2CL2A 3M3QA 4R9CA 2D6MA 5FRAA 2DV9A 2PELA 1LEMA 3FLPA 3N7MA 4XMAA 3R05A 3V65A 1OQ1A 3WUDA 4YM3A 3WDWA 1UAIA 1URXA 1GSLA 2ZGPA 5CNAA 4LBKA 2P3JA 3ILRA 1AXZA 2ES3A 1HLCA 1KRIA 2ZGMA 2DTWA 4TYSA 5KXCA 1QF3A 2WLQA 2ZHLA 2DUPA 1LU1A 1W0OA 2ZGSA 3B3QE 3T2TA 5H9QA 4GKYA 1KJRA 4WVWA 1VIWB 1UZYA 2PHTA 3AYDA 2ZHMA 3W59A 3W58A 2V73A 4Q1RA 4DS0A 2DU0A 4FQ4A 5DUUA 3WCSA 2DVBA 1WW4A 3JU9A 1KDKA 1Q8VA 2DVAA 3IMNA 4JC1A 3TB0A 2W52A 2GNBA 1WLDA 1MVQA 1C57A 2HYKA 4KBBA 3AJZA 5T5JA 5GLUA 1SLBA 4Y1UA 5IT6A 1UX6A 1BZWA 1G9AA 1W0PA 4YG0A 1XQNA 3RS6A 4IQPA 4D69A 4AVSA 2CWMA 2AUYA 1SLCA 1G8WA 3WHTA 3UL2A 4Y24A 5CBLA 4CTEA 1HDKA 2ZGTA 3ASIA 1FNYA 3R4SA 3I4IA 2A6WA 4FP2A 4YZ4A 1QGLA 1SLLA 1GV9A 3T1LA 3V0BB 3A0NA 4FPHA 2ZMKA 1A8DA 2GNDA 4XIKA 3ZXKA 3RQ0A 3WOGA 2A6VA 4BQ1A 5IK7A 1CESA 1ENSA 4UW3A 3FUQA 3IPVB 1GANA 4ISQA 1CN1A 1PZ8A 1UPSA 1LOGA 3A0KA 4FPGA 4DQAA 3PJQA 4WV8A 2AYHA 5JDBA 1QDOA 1WD3A 4YG6A 4RL7A 3APBA 4BPZA 1BQPA 1W6OA 3ZXLA 4AGGA 5IK8A 2P2KA 4LBOA 1ZM1A 5EWSA 3AXEA 3POWA 3O12A 1MZ5A 1JYCA 1AXYA 1SACA 1U0AA 2CY6A 3I8TA 3WG4A 3O0WA 2ARBA 1V6IA 2ZKNA 4XZPA 1BJQA 1BXHA 1SFYA 2D6OX 3ZSMA 4YW4A 3MEPA 3WG1A 4WVVA 4XIOA 3CNAA 5T54A 1O4ZA 1MR5A 4YM1A 1IOAA 3R4UA 4XDQA 2DUQA 4CRQA 3SLIA 2WSVA 3NWKA 1LTEA 3A4UA 1R1ZA 5GZFA 5T5LA 3SITA 1DZQA 1W6PA 3AP6A 1AJOA 1YRZA 2JDZA 3IPVA 2PHUA 3RRDA 4BMBA 4PF5A 2NMNA 1SLTA 3N7LA 2ZMLA 1A3KA 1NXD1 4XHBA 1QOTA 4C1WA 4OZXA 2E7TA 1FX5A 1LOCA 1O4YA 5DZFA 1H9PA 2RHPA 5GLVA 4M3CE 4HANA 4P9WA 5IK4A 2D3RA 4XXPA 1HQWA 1G7YA 1LHUA 3OPZA 1CQ9A 2A7AA 2DVFA 1CPNA 3NV3A 1CONA 1N1TA 3WDUA 1C4RA 3WDXA 2P3IA 5DXDA 1AX0A 1LHOA 3WV6A 2SBAA 4Q8LA 4K1ZA 1MVEA 4Y26A 4XJ9A 2R1BA 3B69A 5GALA 3BOPA 5H9PA 1SLAA 2D6PA 3JUUA 1V6JA 1D0HA 2LTNA 3OY8A 4PCRA 1H30A 4Q26A 4ZXKA 2AGSA 3SNMA 4DRVA 2V5YA 1S0JA 1Z78A 5DG1A 3LSEA 1AF9A 1YO8A 1ENRA 2E51A 1FAYA 4FPFA 2W68A 4M3CA 1Q8QA 2WJSA 2ZMNA 4PQ9A 1C1FA 3IN9A 4K20A 1SBDA 4H55A 1DBNA 2UURA 2GMEA 1JBCA 1A78A 1N3PA 1UL9A 5GZEA 5AVAA 1S0DA 2VXRA 5EYXA 1JYIA 4LBJA 1QKQA 1NLSA 1AX2A 2EXHA 4XHXA 1EPWA 1S0IA 1JN2P 3HMYA 2A75A 4FOWA 3WDTA 2NP0A 1V6NA 1Q8SA 4Y20B 4PBPA 3B00A 2A3WA 1DQ2A 2WT2A 4JRAA 4L8QA 4PBOA 3RMXA 1G86A 1F31A 1LHNA 2A5ZA 3NV1A 4FOYA 5GJ6A 1RITA 4FPCA 4ZKTB 2XG3A 3USUB 1GNHA 1LHWA 3AP7A 2A3XA 5JOZA 3N3HA 5DUXA 1DQ5A 2GNMA 1DYKA 1G9FA 3FLRA 1DQ1A 5HCFA 3AZXA 1HQLA 4YW1A 2NN8A 2ENRA 2D44A 5DG2A 2W08A 4R9AA 1JXNA 1APNA 3O0VA 1N1VA 4UW6A 1PZ9A 2VW2A 5SV8A 1S1AA 1BYHA 2PHWA 1N47A 2NYYA 1LU2A 4YW2A 4U36A 1GZ9A 4Q8KA 2A71A 4DFSA 3MW4A 1KJLA 3ILNA 1VAVA 1LOBA 2JE7A 3AYCA 1LJ7A 5HCBA 4Q2FA 2YROA 3VKNA 3V64A 4FPYA 1DQ4A 3Q9OA
chains in the Genus database with same CATH superfamily
3WQ0A 3VD9A 2F6BA 2ZHKA 1QHDA 4DUWA 5KHGA 3AYAA 4AEJA 5FO9B 2D98A 5EYYA 4MYEA 1SCSA 3R6SA 4ASKA 3K3OA 4I30A 1FATA 4LE3A 5J98B 3USSA 1CR7A 2WS91 4HVOA 4W6YA 5FZCA 1F5FA 4H7LA 2ARCA 2XGXA 2VBBA 5JAXA 2WFF1 1HB3A 3OYWB 4B8EA 2YUEA 1W6QB 3PUQA 1W2UA 2VZUA 1QXRA 1RINA 1S4CA 4KH9A 4W6XA 5A32B 2QQOA 3SC7X 1QIQA 3ZOIA 4GALA 1WKYA 2ZGUA 5IVCA 2FCVA 4MLOA 2Q8EA 4Y5SA 3MW2A 2B7YA 2RS52 4UBHA 5HCAA 3BUCA 3I3DA 2HBTA 4GH4C 4QPGC 4GMP0 4O7XA 1ZZ8A 4AI3A 4FTBA 1W2TA 4DXSA 2HWB1 5LY1A 4CU9A 2Y38A 1PK6B 1J58A 2B9UA 3VGIA 2X8KA 1QH6A 2J1RA 4B4PA 1ENQA 4LE4A 3LA3A 5A6ZA 3AFGA 3U78A 1Q56A 1VAKA 3N36A 3WCRA 4AQSA 1OKOA 2EXJA 5JIUA 3VV1A 1H4HA 3WVJA 5T5PA 4Q0UA 5H9SA 1RGSA 2QDRA 2NQYA 4Q4W1 1EP0A 1BK1A 1WCKA 2ZHNA 1SG3A 4AGRA 4FP3A 1OVPA 1BKZA 1RUC1 2QQMA 3NAPC 3MDPA 2VTXA 3KGZA 4CU8A 1EUUA 2LS6A 5FCCA 3H1MA 1LKNA 4XYXA 3WF0A 4NAOA 1UMIA 3JD71 5F1RA 1OQEA 5F37A 2E31A 3CDZB 1XNAA 2X29A 1NCQA 4GZ9A 5FWEA 1W28A 4HSLA 1FI2A 3PDQA 4JCKA 4XFFA 2WT0A 4JDNA 4ONUA 3U4SA 4ASLA 1TG7A 3FUOA 4P14A 3MBWA 1TME2 1Q5OA 4RR3B 1ALYA 4P5YA 3AZWA 3ZFEA 1SFPA 3AMPA 1B09A 4QX7A 2WZR2 3MV11 4ZU5A 3EHKA 4QKDA 2BW8A 3U4XA 1XYNA 1AYM1 3TN91 1H2KA 2KA3A 2UY8A 4K1YA 1ZA7A 4FXKB 4XILA 2W3JA 4RD7A 2D7FA 5DAPA 2Z5WA 5J1XA 1DHKB 3WLUA 3VBUA 1KDMA 4HZFA 1Y7BA 2D43A 4ZS3A 2ZPXA 3O5SA 3ZO0B 3PUAA 2XVGA 2UYAA 1I5ZA 1DLCA 3I2KA 3LWCA 3Q8AA 5ABJA 1F9KA 1IPKA 3ZR5A 1CX1A 5IW0A 3VB9A 1NUKA 4JDMA 2WNVC 5IYYA 2UWBA 3PU8A 2C26A 3N35A 1LECA 3I2FA 2FMDA 2QUOA 3NRUA 2JKBA 1ULDA 1RUE1 4XTPA 4K8RB 1QU0A 1HKDA 5FUNA 1JOJA 1HIXA 1NXMA 4AFMA 5BY5A 2XKPA 1UZZA 3AL6A 1VMJA 3CBNA 2E33A 3INAA 4QWNA 3T2OA 2K46A 5LA0A 4Q4X3 3I2OA 4XF3A 3DV8A 4Y4YA 3ZXJA 1B35C 4N53B 4NWVA 4LPLA 4MSVA 4XBNA 4DPNA 1IQAA 1SHWB 4CP9B 3QACA 1HXS1 1C1LA 4XABA 3VL8A 5LW9A 2E63A 3HT1A 3WNXA 1FOD1 4Y20A 2AH2A 2O8OA 3BN6A 2VCAA 5K0UC 1RUI3 1FYUA 1DFQA 1GBGA 1GZWB 2X10A 1BLZA 1JH5A 2VVEA 3KQRA 4YM2A 3ZYIB 1T6BX 2XJQA 1W6MA 5KXDA 1S2BA 5FV3A 2C9AA 5AC91 2PQSA 4GWJA 5JLVA 1W6OB 1VBA1 3WUCA 3ZSLA 3WD5A 1NKGA 1ZBE3 2W2IA 2DBNA 1UY2A 4NHLA 5CKMA 1XNTA 4FFHA 1UN1A 3X29B 2VQAA 3POYA 5BNOC 1JYVA 1ULPA 1V00A 3ACIA 4LBMA 5KHJA 1TNFA 4XQDA 2HWC3 2RS31 4L11A 4OMDA 5AFEA 3THTA 4IW3A 2ZAHA 4ZZ5A 1COV3 2XLAA 3QCWA 3ES1A 1QJY2 4YG3A 3BVCA 4GAZA 3B9IA 5E8AA 1W8OA 4AI2A 2CV6A 1MS1A 3HAGA 3MPPG 1O59A 5F9TA 4QB6A 2BQPA 3RYRA 4F83A 3DKWA 2RG4A 4WM8B 2VD7A 4XOGA 4E8CA 5A6QA 3OUHA 5F2SA 4MVTA 5D21A 2OQ6A 2JECA 4RQPB 3E97A 2BVBA 1REEA 1POV0 2W0XA 1WD4A 1RUC3 4NN0A 2VH9A 1N3OA 1R082 1OF4A 4NWWA 1BVVA 3NL1A 4CXWA 2JG8B 2VOWA 4OI1A 1L7LA 2DU1A 2WSUA 3QLQA 2QQIA 5A7WA 3DYOA 2X5IC 3J7NA 4MGZE 4UW4A 3POGA 5A3UA 4AL9A 3OY8B 4Y22A 4YZ5A 1CAXA 4JDOA 1REFA 3LOIA 4K21A 5F3CA 3I3QA 5DAXA 4MG2A 1ZZ7A 2D97A 2E9QA 2LUWA 2ZS6B 3EXUA 4QPYA 4QPGA 4GH4A 5GZDA 1CX4A 1WBLA 1AR82 1VBE3 2H6CA 2OVUA 1VRH1 3UGFA 4M3CB 3VZMA 5CFDB 3B5LB 1EYBA 1GOFA 2Y6HA 3LEIA 3IDEA 4Q4X2 5J3UA 1D4M1 2QBXA 4Z2WA 4COYA 4W65A 4ZU4A 3VDDC 4QPIC 4C90A 3S7IA 2XBO1 5DAWA 5LY2A 1FMD1 2FDIA 2R063 5A3LA 4WZFA 4YGDA 3LAGA 4YZ1A 4CZSA 4MGQA 4AWDA 1VB4A 1LGBA 4F7ZA 3KV5A 3KF3A 2G4IA 2C24A 3HIFA 3ATGA 3T0DA 3WDYA 3V0AA 2VAUA 4Q4V3 1VLNA 1GLHA 3KD4A 5JMCA 5DZEA 3DUIA 4JTOA 1RMU3 3VD4A 2PLV3 2AENA 4JHTA 5ACA1 5IAXA 2EIBA 4NOTA 3HBKA 3K46A 1J1TA 1RHI3 1R1A2 4AFBA 1JZ8A 4ATFA 3HBZA 5DZGA 1RUE3 4DZGA 5FZAA 2Q1FA 4H3WA 2JEMA 1EPZA 2YYOA 1OMIA 4IETA 5EFUA 3GNEA 4IEPA 5C7GA 3ZFFB 3M4FA 2WZEA 4XJAA 5C9AB 3M3QA 4RS5B 5LBFA 2PELA 5CVRA 1X33A 3FLPA 4OHZA 3GF6A 5A80A 2OS2A 4XMAA 5G05L 1GQHA 3MV01 1COV2 3R05A 1EY2A 1VBC1 1HXS3 4UWDA 4RFRB 1IZ3A 1UAIA 2VTFA 3OG2A 1V9U3 4P08A 2MHFA 2ILMA 3ALQA 2DTWA 1VBD3 4N43C 2RDQA 4TYSA 4ZPIA 5C3SA 1QF3A 2WLQA 3WW1A 3S30A 1UWWA 1IPJA 4QQPA 3T2TA 5IFTA 4GKYA 2QQPA 1ZRDA 4GIQA 4Y33A 1VIWB 2IFWA 2BNNA 3TWIA 4N90A 4CCNA 4YNIA 5FYYA 1F15A 4FFGA 1WCDJ 2XPJA 1CJDA 3EYPA 3W20A 1Q8VA 2OX0A 4EROA 4KWLA 5FUIA 2W52A 2IVIB 2GNBA 1TZOA 4PLOA 1NY72 2VMFA 3K51A 1ZBA1 1P8JA 3ZFGC 1WLDA 3PVBB 1AR62 3NSTA 3PIGA 3DXTA 2QDNA 4PQQA 1SLBA 3JZVA 2QQVA 2RS33 1X7NA 4K9SA 2BRTA 1UX6A 4NPMA 3M7AA 4M4PA 1DG6A 1XQNA 1B35A 2CWMA 5A1LA 3WHTA 5C33A 1OLME 1VBE2 4Y24A 1HDKA 2L9LA 1HRI2 1ZYBA 1U5XA 2C4XA 2VOTA 1QGLA 1GV9A 4R4XA 4Q0QA 4FPHA 5DMYA 2CGNA 4HVQA 1A8DA 2GNDA 2YFZA 4B7KA 2R062 5A7SA 4QQ2A 4BQ1A 1CESA 1ENSA 4CSWA 1DGWA 3IPVB 4O9GA 2VM9A 3ORJA 1UPSA 1LOGA 2RR11 3A0KA 3MZHA 2VZRA 3P1IA 4E8DA 1O91A 1TE1B 2IXCA 4Q4V2 3APBA 5I8YA 4KNCA 1W8UA 2HWE1 1OSGA 3GCWA 4AGGA 1E5IA 1RMU2 1TMF3 1O7FA 2PLV2 4QXKA 1EAH1 3NNGA 5EWSA 2VO5A 3AXEA 1WMDA 3VZJA 1MZ5A 2PAKA 3H8OA 1JYCA 1AXYA 1SACA 2CY6A 3I8TA 3LDBA 1RHI2 3VHNA 2ARBA 5D2AA 1BHGA 4XZPA 2Q1ZB 1BXHA 1VRH3 4TLFA 5BNPC 2EIEA 1C8M3 3W9AA 5I0SA 1W9FA 2VQ0A 2BNOA 5FZ7A 4DY3A 1O3TA 4EYUA 4UXAA 5KHKA 1BEV2 1FT9A 1MR5A 1NLRA 1QJFA 1QJZA 5FFOC 4Y5TA 2XJSA 1LTEA 4X8PA 1ND3C 1DZQA 1W6PA 2HWD3 2JDZA 1YRZA 2VQTA 3RRDA 2PHUA 3UGGA 4BMBA 4CPBD 5JSPA 1HQNA 1PO23 3GBGA 4X8NA 5IVFA 1NXD1 1QOTA 2XOMA 4C1WA 2YFUA 2E7TA 1O4YA 3C7HA 3FX3A 2RHPA 1H8TC 1HQWA 1CZVA 3E6CC 1DCSA 2BP6A 2N7GA 2DVFA 3NV3A 4IESA 4F3JA 2YHJA 4IEYA 1IHMA 3WDXA 1PVXA 5L7OB 5B4XA 1GZTA 1RUD3 2SBAA 4Q8LA 4K1ZA 5CISA 4Y26A 5ABJB 3TBDA 4XJ9A 3I2DA 2R1BA 2B45X 3BB6A 5GALA 5A1FA 4MXWB 3BU0A 2F17A 1VBB1 2D6PA 4HKOA 3WDWA 4PCRA 4Q26A 4DRVA 2V5YA 1S0JA 4NROA 1Z78A 2JDKA 3LSEA 4QAWA 3CKHA 5DAQA 1ENRA 4CDWC 1W39A 1Q8QA 2XDVA 2I07B 2B9VA 1PO12 2UURA 1QJU1 2GMEA 3I59A 4PDWC 4YW7A 3VDDA 5LZ6A 1RUH1 2Y34A 2VXRA 3RGBA 4I2OA 3DCQA 3OEAA 4AEDB 2R32A 5FMDA 3VBFA 4R4ZA 5BNNC 1NLSA 4QGLA 5CYYA 1CAVA 2JB8A 3IB3A 4IE5A 4XHXA 5L36A 3RZGA 5FUPA 4DOUA 3HMYA 2A75A 4G3YC 4BB3A 3U37A 3VBRA 5I8SA 1FPN3 1UXZA 4IDZA 4Y20B 3V56A 3EBRA 5DPNA 2A3WA 4A4AA 4C91A 2AZ5A 4KWUA 2NPIA 1O4TA 2GH2A 5CEHA 2HEYF 4OHYA 3C7GA 3ZX7A 3NV1A 5GJ6A 1PHMA 4ZKTB 3L2HA 3J26N 3MIEA 1H0BA 5A70A 5DUXA 2Y64A 4BH9A 2GNMA 4OCTA 2IXKA 3AZXA 5JZGA 3WP5A 1MQTB 2WINB 4UF0A 1HQLA 1W0NA 5LASA 2ETEA 4EE2A 2GC1A 2XJVA 1OF3A 4EN6B 3O0VA 1WMFA 4BQWA 5SV8A 2PHWA 3WR0A 2BV4A 1AL21 1PIV1 3UKVA 4H2AA 2JE7A 3J8F2 4N43A 4AI1A 4AFAA 4DXRA 4FI9A 4GWIA 3DYMA 4Q2FA 1W3VA 2YG0A 3RFRA 1PO22 1DQ4A 2XHNA 1ENXA 1O8PA 2EXKA 5H9RA 1REDA 1GICA 2PHFA 3VZNA 1GQGA 5JOXA 1OHFA 4CDXC 1RYYA 1HV1A 4CE8A 1GWMA 3AMMA 4R9DA 4XF4A 1ASJ1 2HWE3 4KU7A 2Q0AA 3ZFGA 4KWKA 3LF7A 5LA9A 3SISA 3MLJA 1EAH3 3SH3A 1RUD2 4YZ3A 5FZ6A 3FN9A 4HSJA 2VZTA 4E4SA 3W5MA 2P6CA 3FWEA 1S0FA 3WSOA 2JIGA 4AF9A 1TME1 2XB6C 1H1IA 3M3OA 4QX0A 4S2GA 4A7KA 2RJ2A 5FQ0A 4KGGA 2E7QA 2X09A 2R0HA 3U1XA 1ULCA 3N9QA 4LBNA 4EN7B 2ZX0A 4LORA 2OQ7A 3FLTA 1X8MA 3WNMA 2AEZA 1IPSA 4QPGB 4GH4B 5FBJA 1AX1A 1IGOA 1XB9A 2I2SA 2W46A 2PQQA 3ILFA 3LEMA 4W6WA 2VNRA 5KHIA 4HK8A 4BK4A 5A3MA 4N8MA 4QT6A 2VW1A 5FP7A 1H9WA 4AEMA 3LOBA 3PNAA 1U5YA 5FDBA 3UJQA 3V0BA 1NCQC 5FY9A 1MS5A 2ZEXA 5IFPA 1BMV2 3RG0A 2J1EA 5FO8B 2E6VA 5FLIA 3AKPA 4I02A 4UFKA 3WF1A 2DVGA 1ZVFA 2FDGA 1MEC1 4G4FA 3RPQA 2Z42A 4KI5M 1I5PA 4AGVA 1ZRFA 4FQZA 5LB6A 4JVAA 3ZFEC 3PL0A 2MEV3 4BISA 4CYDA 4ZY9A 1W9WA 1FPN2 2B8MA 2QKDA 2W5FA 2WDBA 3AP4A 3POIA 2YBPA 2GMMA 2OW4A 3FZ3A 3NAPB 3V0AB 2YBSA 4CDUC 1ZNPA 3AXDA 1AUYA 4V2WA 1W05A 3WF4A 2ZGKA 2LRPA 3POEA 5LBBA 2BOJA 4Q4Y1 3VBUC 5I8TA 5BNPA 2Q4SA 4FO9A 3ZXGA 1HB4A 4GB33 5FZDA 3WHUA 1ND2A 3H8XA 3BTXA 1DIWA 1YWKA 3O7OA 5A7OA 2ZAAA 1W8WA 2WNEA 2Y60A 4OQ8A 3ZPOA 1RUH3 5JMOA 4ARXA 5C3RA 3GZEA 5ANQA 2NM1A 1UNBA 4Y1ZA 5FZLA 4COVA 3CMGA 1EUTA 5HXMA 3GALA 4UFLA 4ORFA 2VMIA 3PJYA 2ZEZA 2D6NA 2Y0IA 2XKOA 1PGSA 2SLIA 3AK0A 3AMNA 4UFMA 5FP9A 5FXWA 3U11A 4DINB 4HONA 3TEWA 5FYMA 1NCRC 4LBQB 1H8TA 5EHDA 5FMOL 2YMZA 2X53S 3D0SA 2D3SA 1ULFA 2EIGA 3BIEA 4META 1SFNA 3KV9A 2EIDA 5A3WA 2DVDA 4Y1VA 4PT6A 2J22A 4A2UA 3SEPA 4C1XA 4C0HA 3NNJA 4LXLA 1W8ZA 3ZN5A 2QQJA 4LHSA 2H0BA 1IS6A 2WNVB 4AHWA 2CHHA 2A6YA 3QH6A 3KT1A 1NYWA 3S57A 2DYCA 2BFUL 2GC2A 2VZVA 4DEVA 4XC9A 1QJY1 1RXFA 2Y26A 4FPKA 1PNFA 4GWNA 5EQUA 1UY3A 4JTNA 5FAXA 1PX4A 2DCKA 2WNUC 4PDWA 2WKKA 4RHV2 4JKKA 2JD4A 3WW4A 2MPFA 3WNLA 1V70A 1IS5A 3D5OA 2XUEA 3CO2A 1NG0A 1AL23 1GKBA 3AP9A 5GLTA 1B35B 3AC0A 4JHZA 3DEMA 3I3BA 3ITQA 4M00A 1GYKA 1RB8G 3MGUA 1UOFA 4IV3A 3K2OA 4OI2A 3ENRA 4XCAA 5HV0A 2TNFA 3PUSA 3TNPB 1BBT2 5I91A 4OHVA 2PHRA 2DTYA 3VLBB 4AHYA 3PVOA 3L2YA 2R041 2VULA 3LD8A 3VN4A 4FAGA 2V4AA 4XQ4A 5K0UB 1JU4A 1C5IA 1WCSA 2YC0A 4IEVA 4QKFA 1R64A 1MS4A 2CSGA 1TVGA 1N3QA 4XQWA 1CJPA 1L7RA 3Q8BA 1T2XA 2GP5A 1ZRCA 2ZXQA 1YFXA 3KF5A 2AACA 5FY5A 5F5CA 1CGPA 3LSDA 1AR81 4FPJA 3MF6A 4FXGB 1TQ5A 1ZREA 4CEYC 5FZBA 2R073 2R7EB 5JOYA 4KMQA 2PFWA 2BYVE 5BNOB 2VW0A 1GOHA 4I01A 3E1F1 5IUQA 2O0OA 3ZXFA 4O61A 1JZ5A 3W21A 4NVPA 4QHOA 1HRV1 3AX4A 2FDJA 1ULEA 2O14A 4WZCA 4NUBA 2ZGRA 1PMJX 5E89A 4CUAA 3EB7A 2VG9A 3O1VA 3LE0A 4AVVA 2ZGOA 1LODA 3HNMA 2OUHA 4UAPA 1MS9A 3ZXEA 1MEC3 3IMMA 3H7JA 4YYOA 1QNYA 1W6PB 4BHPA 1AYN3 1R091 2F4LA 2G19A 3O1RA 4IGOA 5HCHA 4CDXA 5C5TA 2XJRA 4LBLA 4BYYA 5I0RA 2GNTA 3WNKA 5KXEA 1R1A1 2IC1A 4YGBA 3ZMNA 3OD4A 4HPKA 4J6GA 1RUF1 4N7IA 4COZA 3OOXA 4CEWC 5DDJ2 2X5IB 4A42A 3IDCB 2VL4A 4AG4A 4AQ6A 4RA0A 4CU7A 1YNAA 4K8FA 4ITCA 5ERLA 1WGPA 3N4MA 2GSYA 4YW6A 3RWKX 3CQOA 3C3VA 3ZIWA 4R8HA 1RUJ3 1E5HA 3RZHA 3JB8A 2FHRA 2RMU1 2R1DA 3LA7A 4NHYA 1W6NA 2VUCA 4IE6A 1LHVA 5FMCA 3ZR6A 5FPUA 5FJHA 1H6XA 1PGW2 4KL1A 2J1AA 3MUY1 1HB1A 3HN3A 2QJVA 2XLGA 4CCCA 4N9HA 2BBVA 3VDDB 2JJ6A 4QPIB 4G9SB 2WBKA 2A70A 4QX8A 1YQ8A 2ZABA 4ATEA 1LULA 4X6RB 4HK9A 5IVVA 1DP0A 5IWFA 1MZ6A 3B02A 3GJAA 3ON7A 3VBFB 3OBAA 1CAVB 2EALA 2XUMA 3FBMA 2IXIA 2JG9A 4KGQA 3FL7A 2IXLA 4LO7A 1HN1A 4M0HA 2WL1A 5EXOA 1N1SA 4CDUA 2FCTA 5T5OA 4YGEA 1GUIA 2XR4A 3ZYBA 2YXSA 3DXUA 3MO4A 1PVC1 3M2MA 2W1QA 3AMQA 1OA2A 2QQLA 3ZKUA 3KHCA 2VNVA 1WW7A 2FMYA 5BPXA 3UT0A 3BI3A 1Q8PA 4YFZA 5FZEA 1HX6A 2EAKA 1W9YA 1XE0A 3BTAA 3WG2A 5A1AA 3ETQA 1NZCA 3WXPA 5E6HA 5TSWA 1CD3G 2HKXA 3ZYJB 1K5MA 2GU9A 1QJX3 1LGNA 4HL0A 4P9JA 5CZKA 2VGDA 4EN8B 5FREA 1Z7S3 3I3EA 4D7YA 3PU3A 2PMWB 2D6MA 3TRSB 2WFPA 3N7MA 1QEXA 2ORZA 2P6HA 3JB4C 4CUBA 1NCRA 1OQ1A 3I2HA 1OA4A 1J83A 1NT0A 2G9ZA 2JDNA 3OGSA 2CDPA 4N43B 1EV11 1D7PM 1XU1A 4CCLA 4IEOA 4AHXA 3RDIA 4LK6A 5FZFA 2XWBB 3KCYA 3HQUA 5KXCA 1AYN2 2FBEA 2ZGSA 1QQP1 3O14A 4CCMA 2XLFA 4ARYA 1UZYA 4I3PA 1X9TA 1XYPA 2ZHMA 4JAAA 2V73A 4NR1A 2W1SA 2Q1MA 3N9PA 4NIDA 4M0NA 1WW4A 3ZFGB 3TB0A 5CFCA 1JZ7A 1JODA 5LBEA 2FQPA 3KV4A 1PM7A 2WS93 3NJXA 1YUDA 3HQXA 5FZ0A 1C57A 2HYKA 2WNUA 3AJZA 3BPZA 4JRLA 3S6PA 4EZHA 4RGGA 4LHKA 3ACGA 2WFF3 3J4UH 3LIGA 2QQWA 3PLQA 3Q8FA 3SXWA 3P6BA 1RUJ2 4XDPA 1RC6A 2C1FA 5F8PA 1W0PA 4D69A 4DUVA 2BUKA 2DCZA 2TUNA 2YGMA 1OBNA 1DU3D 2VOVA 4QB1A 4XF0A 3UL2A 5C5UA 4BXFA 1Y43B 5C71A 2W94A 1RUG1 3KVBA 1FNYA 1G6NA 3C8XA 3R4SA 4AI8A 5JSOA 2A6WA 1OUXA 4OULA 3GYDA 1SLLA 2HWB3 2QE3A 5JR2A 5L19A 3V0BB 4I3GA 2ZMKA 3I97A 3WEZA 1ZZ6A 5IATA 2O1QA 3RQ0A 2JENA 3WOGA 3KVAA 1J3RA 3PTRB 2A6VA 4Y4RA 1RVF1 2WYSA 2VOXA 1UOJA 1RUF3 1AR91 3ZYFA 1CN1A 1PZ8A 3K4ZA 5GKAC 3AKTA 4FPGA 2BJSA 2Z79A 4AXOA 1O3RA 1QWRA 3VHRA 2XL9A 3POFA 1W2AX 1OLMA 1XOYA 4Q4W3 4CEYA 3FC0A 1UO9A 4RL7A 5LRRA 3RNSA 1BQPA 4C0BA 1C3HA 1YQ6A 3I54A 3F95A 2OYZA 5IK8A 3MHZA 1HB2A 1PO11 4JQTA 2VNOA 5E1RA 1XXNA 1SPPA 4YWAA 5BNPB 1OOPC 2CAUA 3JD73 2XHKA 1C5HA 1YIPA 3WQ1A 5I0DA 4YW4A 2CU5A 3SCFA 4LUKA 5CADA 3WG1A 1Z7S2 3ZXLA 5LWBA 2W47A 1US2A 5FXVA 2WNOA 4HETA 4CUGA 4IEWA 3KS7A 4YM1A 1IOAA 5C3OA 4XDQA 5B2GB 1ND3B 1W9SA 4L0PA 4CRQA 3ST7A 4QXCA 5K4LA 1CAWA 3RJ2X 4NIIA 3SITA 3VDAA 4AQ2A 5DN2A 2V72A 3OF1A 3U75A 2WRAA 1ZZCA 1XNBA 4PF5A 4B7EA 4D0QA 4DEQA 4XCBA 3N7LA 2ZMLA 5FWJA 1AYM3 3TN93 1H8TB 4AEKA 5CG9A 4AI9A 3N9NA 5IK4A 4P9WA 4CEWA 4Y5Z0 2IVJA 1G7YA 3VBFC 2A7AA 3RWNA 4CCKA 4PLNA 1N1TA 4BXSV 4OUSA 1NAEA 3DKQA 3P3PA 1VMHA 1WMXA 3ACFA 3GHMA 3HNBM 3BOPA 1RUI2 3IBMA 3VBRC 3JBG1 1D0HA 4ZXKA 2AGSA 3RZMA 4I0AA 4QDQA 5EP9A 1VJ2A 4CDWB 3T0AA 1YO8A 1J1LA 2E51A 1HN0A 4FPFA 3WQBA 4MGTA 2PTMA 1UYYA 5LK7B 4PDWB 3ZMOA 4P00B 4BU2A 1JYWA 1S2KA 4PQ9A 4E4DX 1C1FA 5FPXA 3ZN6A 3H3LA 1DBNA 1ZBE2 2RM21 1A8MA 1JBCA 1N3PA 2BU9A 4GMP1 5FZ9A 1ULOA 2JDHA 5JZGC 4I0WB 4HKWA 5BNNB 1F2NA 3ZKYA 4Q29A 5T3NA 5FKCA 2DFBA 3HVDA 2JDPA 2HWC2 1V0AA 4LBJA 3ZYHA 4A3ZA 1QJEA 1SEFA 2RE9A 2XJPA 3VD3A 2HWB2 2OXBA 1UXXX 4FOWA 3OUIA 4PJYA 4FT8A 2PHDA 4QXBA 3T08A 2NP0A 3EO6A 3LZZA 1Q8SA 3KZ4C 5FYIA 4IV1C 2OKXA 4AK3A 1FOD3 4PBPA 5BUVA 1WA6X 2JDYA 3K4AA 3RMXA 1RUOA 4HG6B 1G86A 4IUGA 1JS9A 1LHNA 5C4WC 1J59A 3ECQA 5LBCA 2PN5A 1I6XA 2W9XA 2WA4A 5FPZA 4AAPA 4QX3A 1AR71 1DQ5A 5AC93 1RUC2 1VBA3 2VBPA 3KCXA 5FPBA 5FZOA 4CXXA 4YRDA 4XVHA 1G9BA 2Y33A 2FZ1A 2D44A 5DG2A 4R9AA 2Y8KA 1JXNA 1APNA 1TNRA 5FLJA 4OHXA 1QH7A 1W8FA 2B46X 2LM3A 2VW2A 4KU8A 5FIXA 3VBSA 1S1AA 3W5NA 1N47A 3ACLA 5FR3A 4Z1VA 1GZ9A 4Z82A 2A71A 2ZOEB 3T09A 4DFSA 3ILNA 3POBA 1C28A 1LOBA 4ET7A 1UMHA 3AYCA 1OD5A 4QGNA 4LO8A 4LHNA 4BE3A 4J1XA 3V64A 4YSFA 3CF6E 5C70A 3Q9OA 1LNSA 4YM0A 1AYM2 5LATA 3TN92 4CDXB 3RJRA 1GNYA 3USUA 3O1PA 5FYSA 4NAMA 3TEXA 3WW3A 1H1MA 1QDCA 3BCWA 3ZDVA 3M3IA 3MIGA 5JCTA 4LO6B 5DUWA 3FJSA 1F35A 1DF0A 1S0EA 4AZZA 1UPIA 2CWSA 1D4VB 1W8HA 3KLSA 5DABA 3UESA 4XBLA 3NV2A 4B1MA 3OBRA 1AVBA 1YHFA 5CB7A 5A3TA 5I0TA 3UYJA 4A6SA 1S55A 5T55A 1QXJA 2B4KA 5SV5A 4JGZC 4BLIA 1GFF2 2BWCA 4BOWA 1W6NB 1XSRA 5C8CC 3O1SA 2VZOA 2R6QA 4AE2A 2XQXA 1RJ7A 1RUE2 2VOKA 3VBHA 3EQEA 2ZZJA 1NCQB 2RS11 3POJA 4NPRA 3NW4A 4Q0PA 1ND2C 3HN1A 2C6SA 1D4M3 1UZ0A 3AZZA 3WP3A 2BGPA 1XSQA 1RXGA 3UKTA 1VALA 4DXZA 1D2SA 2PHXA 4OYUA 4C8DA 2B39A 1XU2A 5KXBA 1SDWA 3ZFEB 2XBO3 2CGPA 1SDDB 2Y6JA 3RYPA 1FMD3 4QXHA 1MPXA 1HXS2 1LEDA 2QZ2A 3U0ZA 3TEZA 1V9U2 3LKJA 4BZ4A 1XRUA 3ZDSA 4CDUB 4Z92B 2FDFA 2ZJCA 4E4ZA 2GN3A 1VBD2 3OYWA 4AFCA 4RHV1 4Q5OA 1W6QA 3RI8A 3OEBA 5A32A 3VBUB 2ET7A 3BKZA 1PGL1 2YY1A 1MS3A 1QOSA 2VUDA 1OOPA 5EJZB 1WMEA 2ZGNA 4CA9A 5ACA3 3JQXA 2FDKA 4MZUA 4URAA 1UKRA 3VUOA 5KWRA 2ZX1A 5FMBA 4QB2A 5IK5A 5AC92 5FZIA 1VBA2 2OPKA 1MZEA 2HWF1 2VJXA 1BCXA 1NE4A 4LBQD 3SHRA 3NJZA 4K3UA 1BBT1 1UMZA 2RM23 1DGLA 1Z0HA 1PK6A 3FHQA 3POSA 5C3PA 1US3A 1OD3A 3AZVA 5LEJA 3IKWA 1YFWA 5JR7B 2GP3A 2LALA 5A3OA 4LLFA 2WQ4A 3GGLA 2RDNA 3VL9A 2RS32 2PXJA 3MF9A 3NJYA 3PVEA 3WT3A 4D6RA 1NCRB 1SBFA 4BMEA 3GXUA 5EPAA 1MS0A 1VBC3 4FOQA 4LQRA 3SKVA 5HPOA 5JXIA 2UYBA 4HBNA 5JVVA 4HN1A 1CVNA 1XE8A 5LA2A 2WAOA 5FKBA 3N7JA 3BU7A 4IV3C 1JZ4A 4WVMA 4EV0A 1JOBA 2J1UA 3FFZA 3MIDA 3PMSA 1KS5A 1POV1 5J7MA 1JI6A 2CDOA 3N9LA 2FCUA 1OC1A 2VNGA 1AR73 1PX3A 3OBZA 1IKQA 1SLIA 1YQCA 5F5IA 3WW2A 2GALA 2UY9A 4L97A 3HPNA 4YW3A 2UWCA 4LIUA 1ZBA3 2GN7A 3H0OA 4M4RA 2WNUB 3H50A 2DFCA 1W6MB 3B9CA 2Y6GA 3ETPA 4K7JA 4RR3A 4DXTA 2RS51 5D1IA 4FBFA 5C6CA 3AJYA 1TEIA 5LK5A 1OXCA 2WQZC 3CU7A 4NRQA 1TMF2 5FZ1A 3H3UA 1WW6A 5KHHA 4CP1A 4QQLA 1VR3A 2RJLA 4H7MA 3S5QA 1YYNA 2WWJA 4IEXA 1VRH2 4IXLA 1C8M2 5DAVA 4DMIA 4P9YA 5HBAA 1AZDA 3P5BA 4K40A 4Q27A 2VBDA 4TSVA 1D4M2 4XUQA 4AYUA 1HJGA 3NV4A 4IV1A 4U2AA 5DDJ1 1NLQA 1ZZ9A 3BODA 4O65A 3LB9A 3I2JA 2XBO2 2BVVA 2QQKA 3H7YA 4EN0A 2PHLA 5C4WA 2HWD2 3KHBA 1LOFA 1IG0A 1H2LA 1MACA 2XVLA 3UK9A 1ULGA 4HMZA 3VDCA 1DGRN 1Q43A 2WUHA 2IXJA 4A7ZA 2BPA2 2RR13 2ZZQA 4QX2A 4XXAA 1XYOA 2BGCA 2W1UA 4COWA 4LA3A 3WZ1A 1YC61 4CEYB 4ZHNA 3IIAA 2TBVA 3UJOA 4BM8A 1OT5A 1OH3A 4LTAA 3VKMA 1PGW1 2VC9A 4LJHA 3KSCA 5ACA2 4QX5A 1UW8A 2A3YA 1W8TA 1SPPB 1RTVA 2P5BA 2D93A 4FCAA 2W39A 4OUMA 3UKNA 5A7WB 5BYNA 1BVP1 5GM0A 3I7DA 2BOIA 3O0XA 1W99A 4NIAA 1IKPA 3GHNA 2KXLA 2RJKA 3IM0A 4Y22B 1CAXB 2WZR1 3F2ZA 3IIIA 4RGAA 3C7OA 4FPEA 5F6LB 3IDAA 3DN7A 4AR2A 4WBBA 5I0UA 4FPOB 1GMMA 3VD7A 2FZ2A 2EF6A 2ZACA 3N7KA 1K3IA 1M4WA 1WUVA 4XJWA 2WO3A 1OVSA 4XTMA 2WO7A 3ZYRA 1GZWA 1XC6A 5HI0A 1VBC2 2UU8A 4LR4A 1IS4A 3M3EA 4LNVA 4XPVA 1NA1C 4GKXA 2J1SA 3NKGA 5JOWA 2EAAA 2YBKA 3WDVA 1WW5A 4GJYA 4CEWB 2MNGA 1OUSA 2JDUA 1QNWA 1QMJA 1N1YA 1SBEA 1XBFA 1Y9GA 2BEOA 4XJZA 1GR3A 4XUNA 2BTVC 2JG9C 4XFHA 5ISLA 3FHAA 1S0CA 4I09A 4OHWA 2R0FA 4YPJA 4EZ4A 5K8SA 3O1MA 2CNAA 4UOJA 4JGZA 4QU1A 5FY1A 3M1HA 2YC2A 3E5XA 2HBUA 1V6LA 2H0VA 1VBB3 1ZA4A 4LKEA 4E27A 5C8CA 3VD5A 3BPSA 1ZBA2 3NMBA 3A7QA 1GP5A 4IEUA 1DYPA 5J96B 1WBFA 2R16A 4XDOA 2JDAA 4DRRA 3ZN4A 1CIWA 2UWAA 5T50A 5JXGA 4FTEA 2VUJA 2GC0A 3CJIC 2P1BA 3VBOC 3D4KA 3ZN6B 4TZDA 2HEVF 1PMHX 3ZSJA 1QJU3 2XJUA 1K5MC 2NMOA 4MUVA 2VPVA 4Z2AA 4RQPA 2QFEA 5JWPA 1OKQA 2E53A 3PVNA 1UYXA 2OZJA 4QGMA 1OURA 5E88A 5BNQA 2YPJA 2R49A 4YLZA 4DNYA 5IVJA 1Q3EA 5F7UA 5DUVA 1CZTA 2JG8A 1AJKA 3LEGA 2FD8A 3NO8A 3PMEA 1UY4A 4NJ4A 2JIJA 1GNZA 1OLRA 2VUAA 3AKRA 3L9JT 4FPLA 5LRSA 4XFCA 4YVSC 5FPAA 3GZUC 3H9AA 2ADEA 4XW3A 5T52A 1DQ6A 1VAMA 1S0BA 2W91A 3NVCA 4Y1XA 5I93A 2RS53 4GD4A 3OCPA 2P17A 4YVWC 5F3EA 1ZRIA 2HWE2 1SZBA 4D8MA 4RYDA 2GH8A 1EAH2 1FV2A 5CFCC 1JUIA 1K45A 1POQA 1SCRA 2CL2A 2ZX2A 2HH9A 4R9CA 5FRAA 5K7PA 3QOPA 3R4DB 4CDQC 3OGJA 3JQWA 3EMRA 1H8VA 2Q30A 3V65A 3WUDA 3NNLA 1PIV3 4Q0SA 5FO7B 3U14A 4BQ3A 2WZ8A 2W87A 5FYTA 2ZGPA 3I2IA 5CNAA 4LBKA 3OTFA 3S7EA 2P3JA 1AXZA 1W3XA 1HLCA 4GJZA 2ZGMA 1Y9MA 4MGSA 4NRMA 2ZHLA 3KWVA 4UI9L 3HT2A 3ZYGA 5IHRA 4QQOA 1R081 3B3QE 2JX9A 1KJRA 2VMHA 3M8LA 4NE9A 4WVWA 3LA2A 5F5AA 3H1WA 3RZJA 2AEYA 2PHTA 4MV2A 3W59A 5JI7A 5FZGA 1L7QA 4IE7A 4MGKE 3WF2A 4DS0A 5DUUA 3PIJA 3BALA 4FAHA 3GZAA 2DVBA 3LFIA 3WCSA 4JC1A 1KDKA 1ASJ3 4BQYA 3CIHA 2MEV2 1JZ3A 4L92A 3ZFFA 5EJ1B 1MVQA 4KBBA 4E4HA 1W04A 1GP4A 3RZZA 1UU5A 1TME3 1O5UA 1WWYA 2RDSA 1JTZX 1NE6A 5IT6A 1KXGA 1J3QA 1Y9QA 4OI0A 4D7TA 1BZWA 4Q4X1 1WLTA 2XH6A 4AVSA 2AUYA 5FBZA 1SLCA 1G8WA 4D6QA 4UFHA 2Y6FA 5CBLA 4CTEA 4GB32 3MLLA 1H4GA 3ASIA 3J7LA 5A33A 3FE5A 3MLKA 3B7MA 3I4IA 4W50A 5F39A 1OPOA 4YZ4A 3GCXA 1RUH2 3T1LA 1YFUA 4NIGA 4EQVA 3HD8B 5FZHA 4OUEA 1VE0A 1RJ8A 3H8RA 4XEZA 4UFJA 4P02B 1RUI1 1HW5A 2WYFA 5IK7A 1RUNA 2WR9A 2EA7A 2WN2A 3ZXDA 1GANA 3THDA 5F6KA 2AYHA 4OFGA 4A45A 3LFMA 5JDBA 1WD3A 4BPZA 4A7YA 4URTA 4V1PA 3KQ4B 4OLLA 2P2KA 4LBOA 2VMDA 1ZBE1 1OOPB 1JZ2A 3POWA 2XMLA 3O12A 4JZRA 4Q4Y3 4UFIA 3QD6A 3O0WA 4B29A 2ZKNA 1BJQA 2BBAA 3T4VA 3S5AA 2HWC1 5IJRA 3T4HB 5EV7A 4SBVA 3MEPA 1COV1 1W90A 3WNOA 2BWAA 4AOCA 4NPLA 3CNAA 5T54A 3JXSA 1O4ZA 2VQUA 3R4UA 1Y3TA 2DUQA 3SLIA 4JGYC 2WSVA 3NWKA 5ANNA 1A34A 3A4UA 1R1ZA 5A6YA 1DZTA 1NA1A 3AP6A 1WZXA 1AL22 1PIV2 2Y6KA 3I59B 3IPVA 4PIZA 3H1YA 4QMAA 5FZ4A 1W2NA 1SLTA 4J1WA 5E16A 2ZEYA 3WINE 4XAEA 2ZX4A 4XHBA 5FP4A 2GZWA 2WABA 1H9PA 1JMUB 4M3CE 5FYUA 1NOVA 2C9KA 3OPZA 1CQ9A 1CPNA 4V2VA 4WVMB 1NY71 4PF1A 3WDUA 5LCWL 2WO1A 4CUCA 2P3IA 5DXDA 5FYCA 1LHOA 4LIVA 5J48A 3VBRB 2FDHA 3ZLIA 1AR61 3URFA 3M70A 2RVAA 3B69A 4OVEA 5F3GA 5EJ3A 1SLAA 1ASJ2 2JXAA 3WY6A 2XONA 1V6JA 3SNMA 1H30A 1K12A 2JB4A 1YCIA 5DG1A 1BK0A 1QJY3 4UYBA 1KFUL 3NKTA 5C8WA 1VBE1 1FAYA 3CJIA 3VBOA 4AI0A 4P9GA 1HRI1 2QQNA 2R072 1KGYA 4RFT0 4K20A 4Y3OA 4ZZ8A 4FSJA 2DF7A 1SBDA 3KMHA 4H55A 5JZGB 1J3PA 1VPHA 4UF0B 2ADDA 1X36A 3PURA 5GZEA 5AVAA 5IVEA 3A21A 5EYXA 5K9YA 3O1TA 1OPMA 1SQ4A 5D8AC 5L9RA 3S0MA 2OPWA 2R061 4WM7C 3SEEA 2BERA 2EXHA 1K42A 4P9IA 4CXYA 4XF9A 2YU1A 2Q8CA 3DECA 1EPWA 1S0IA 1JN2P 4IV1B 1R083 1RL3A 3VBSC 4ZU7A 5L7OA 3CZUA 3DYPA 3WDTA 4TTGA 2R043 3E5UA 3VZLA 3SMHA 3Q8EA 1MEC2 3B00A 4Q4V1 5HV4A 3UNPA 5C4WB 4MXWA 2WT2A 4MO3M 3LQCA 4L8QA 4YVSA 5FTTC 4E2QA 1RMU1 1ZX5A 1W2OA 2PLV1 3AKSA 5M0TA 1F31A 4PHZA 4FOYA 2QCSB 4E9KA 1RITA 3UGHA 2ZCWA 2JICA 2AC1A 4YVWA 4DB5A 1LHWA 1RHI1 3AP7A 4AW7A 3N3HA 1AR83 1UZVA 3CZJA 5FK8A 1HJFA 1T6GC 4Q4Y2 4QKNA 2NN8A 4CDQA 5JSRA 1BEV1 3I49A 4S2HA 1UY0A 1DGWX 2ORXA 2W08A 3OD0A 4AEDA 1N1VA 4UW6A 2W1WA 1PZ9A 4J25A 2HJIA 2J7MA 5FQ0B 3WNPA 2OA2A 2VMCA 1HRV3 1BYHA 4XUPA 2QTWB 4E2GA 5F2WA 4CU6A 1ACCA 1XNCA 4Q8KA 1JU3A 4XACA 3RI9A 3IZOA 1KJLA 1V9U1 1VAVA 2IFRA 1QY4A 3HEIA 4A6OA 5FP8A 3TEYA 3AVRA 1UYZA 2WN3A 1VBD1 5HCBA 5A7NA 2XWJB 1OLQA 2YROA 4CCEA 3VKNA 4ES9A 4XETA 1W06A 3VBHC 4JQRA 4FPYA 4KG8A 1M06G 1E57A 3LEKA 1R093 2VZQA 2VMGA 3DPRC 4XZUG 3D82A 3OJBA 1D2QA 1WCUA 1W8NA 3ABZA 4MX3A 2VVFA 3T0BA 4LOSA 4MOAA 4PI0A 4PI2A 2X05A 1R1A3 4QDRA 2Q8DA 3AL5A 4Q0VA 1X50A 5FZKA 1F4AA 3GM8A 3HOBA 3ZVXA 1MQTA 2VCCA 5JIAA 1VRBA 4DIQA 3CEWA 1J84A 2XL7A 1KQRA 4P9XA 4GA9A 4D7SA 1FXZA 4YGCA 4JGZB 2JKXA 4ISRA 4BLJA 5C8CB 2KM2A 3T2PA 2W92A 1DLLA 1O8SA 2RMU3 4LO4B 4FOVA 1H2NA 3Q8CA 1YFYA 3KM5A 4KQ7A 4XURA 5FYBA 2PAEA 2EICA 5FYHA 5GLZA 1ND2B 3FMGA 4MXVA 5JPMB 2XXZA 3ACHA 1DQ0A 1QJX2 3ZPYA 3PUIA 4MHRA 2JE8A 4NRPA 2TEPA 1LOEA 2GAUA 2E32A 4QU2A 3R0RA 5JXHA 4KG0A 2ARXA 4OI4A 4A3XA 4BQ4A 5J36A 2ERFA 4AFDA 1PK6C 3NNMA 5CA6A 3GBWA 3VKFC 2BNMA 4QX1A 2OUJA 1W9TA 2P3YA 3VZKA 2VY0A 1ODNA 1ZRRA 1NQJA 2G1MA 2R042 5F32A 1YLLA 2ZA9A 1AR63 1F5JA 3K4DA 3MI8A 1UX7A 3RMYA 1YIFA 3SCHA 3MIBA 3E5QA 4TWTA 4XFAA 3ZXAC 1TMF1 1UKGA 1PVC3 1I9RA 2VCMA 4WVZA 1G9CA 2R30A 4SLIA 1UIJA 1UOBA 3RVHA 2KD7A 3T1MA 4EWEA 1LCLA 3K48A 2O8QA 4ZS2A 1C8M1 4TXWA 2VZ1A 5CKNA 1HRI3 3D6EA 2EXIA 1LR5A 2H6BA 4NO4A 2WS92 1U5IA 1QOOA 3B01A 2YDEA 4PIXA 4YFWA 2P34A 3PHMA 4JGYA 5F5QA 3J8F1 3WNNA 5A3NA 2WFF2 1F8VA 4P5HA 1FNZA 1WLCA 1HRV2 4RR3C 4QPWA 2HWD1 2K9ZA 3J7HA 1S0GA 2YGLA 4XBQA 1YQ5A 4GULA 1PO21 2B42B 4HXCA 5FOJB 2CTVA 3BTZA 1A6CA 4LKFA 1EV13 3MYXA 3NAPA 2WT1A 4IV3B 3C7EA 2DCJA 3AFKA 3C7FA 3NQHA 3SH5A 2VZ3A 2BZDA 1R092 4XJUA 1AXKA 4R9BA 1QQP3 1V6OA 3C2UA 4Z07A 3ZIXA 1RUD1 4H14A 2W95A 3ME2A 4CPBA 2QVSB 2WLPA 3IT8A 1I1EA 1DDLA 4GXLA 1DYOA 2J1TA 4AHZA 1SMVA 2BDRA 2C0ZA 1RUF2 4KWJA 4BWOA 2ZBJA 5JUVA 4HOOA 1LOFC 2QZ3A 2VVDA 3ES4A 4BIOA 5GZCA 1BEV3 4Q4W2 3BIWE 2A6XA 5FMOS 1LOAA 5FXXA 2ZKLA 3WP6A 1DZRA 3B93A 4GQ7A 5FJKA 1VP6A 1JYXA 3OBTA 4YZ2A 1JUHA 4CP0A 1CIYA 2RMU2 3A23A 5JPNB 5D8AA 3HWJA 1BMV1 4LBQA 4S2FA 4FTSA 3JD72 4WM7A 2P3KA 5C3QA 2JDMA 5CU1A 2D6KA 1YI7A 5IAVA 4X6QB 4Y1YA 1UF2C 1RUG3 5A33B 4B3NA 2J1VA 2D3PA 4N53C 3DL3A 4XJ8A 2BFUS 1OA3A 4AVAA 2PA7A 3AP5A 1H2MA 1FPN1 2GDFA 4E2SA 4BCUA 2G9FA 2DCTA 2WNVA 5L9VA 3VKLA 1G9DA 1U12A 5FZ3A 1LRHA 3D8CA 1RVF3 4AQTA 3IAQA 4MADA 1LGCA 2XJTA 1AR93 2GC3A 2V4VA 3ZYPA 5HXVA 2CGOA 2Q5TA 2YC4A 2RDRA 3AYEA 3AZYA 3OUJA 4XUTA 5KC6A 3H3ZA 3RSJA 5JI9A 3G7DA 1GZCA 4XFBA 2ZGLA 4HPKB 4UW5A 3KT4A 4Q1PA 1PVC2 1PO13 1WCQA 3TAYA 3CL1A 4D3WA 2AREA 1CAUA 4PIYA 4LKDA 4LMFA 4AVTA 3BOWA 1JHNA 1OH4A 3N9OA 3D3AA 1U5ZA 2DDUA 2JWPA 3E6BA 5KC5A 3A22A 2ZGQA 3QBQA 4EJRA 3GDBA 2JD9A 5KBFA 4IERA 4RSUA 1STMA 3LPFA 5K0UA 2A6ZA 3IAPA 1E5RA 4GWMA 3U07A 4EWDA 4M01A 1NA1B 4TN7A 1UIKA 3SH4A 3RZKA 1XJAA 3DPRA 5C9AA 1LB2A 1IS3A 2HEWF 5LEKA 4WM8C 5FZMA 1EV12 1OFSA 1JOPA 2YV8A 4JKMA 2QQUA 4JV4A 3WG3A 1LESA 4UT5A 3GZTB 1NX9A 2JG9B 1PZ7A 2QNKA 1QQP2 4NHMA 4RQPC 5AVPA 5A3PA 5BNOA 3KGLA 3D0JA 4QKBA 1JYTA 1V6MA 3HNYM 4I0BA 2WWSA 1FOD2 1NZIA 3LGRA 5CAZA 4ASMB 2JG8C 4XMIA 4YW5A 4FFFA 4OZOA 2P4EA 4O9EA 1XE7A 3DGTA 3JBG3 3DF0A 4IGPA 4QD2A 4QDSA 2VR4A 2Q8OA 3ZSKA 2CYFA 4AVCA 4FVVA 1RIRA 1KFXL 3CHXA 4DO0A 5FPLA 1Q8OA 1I3HA 1KITA 2ID4A 2VZSA 2DWRA 3T3YA 2GMPA 3J8F3 2ARAA 3CJIB 4JX0A 4XE9A 5L9BA 5FY8A 1FV3A 2JE9A 4UBGA 3VBOB 3LPGA 1WA4A 1D0GA 1YXWA 2C5DA 3I3MA 4IL7A 2A1XA 3ELNA 1K5MB 2NZ9A 1MS8A 1K5JA 2LW8A 3VKOA 5CFDC 2YZ4A 3UV9A 4GMP3 2OZ6A 2B5HA 4LEJA 5L73A 1LENA 4AAXA 1KD7A 3FBYA 2K0GA 3HR9A 4M3CF 1RUG2 2DURA 4N7UA 1X82A 5GZGA 4BK5A 3IWZA 1YJLA 4MGIE 1JYNA 2MEV1 2DUOA 1V6KA 5BV6A 1VMFA 4EWAA 3LCPA 2AR6A 2X5IA 1ONAA 4N9IA 1WLWA 3J7MA 4QM9A 1GOGA 5G04L 2V09A 3MUZ1 5FK7A 1UZWA 2WA3A 3LDKA 4OQ9A 1RVF2 3G6JB 2VU9A 3MW3A 4XFIA 5IVYA 4YVSB 3QH7A 5EZWA 3PTYA 1AR92 1CPMA 1IG3A 1JW6A 1UYPA 3ZM8A 4Z8BA 2IXHA 2P37A 4BJ0A 4YVWB 5F3IA 5A6XA 4GB31 2Y6LA 3BTYA 4TLGA 4CVUA 2Z4FA 1O6UA 1JHJA 2D6LX 2D40A 4IEQA 5CFCB 3OGGA 3MIFA 1PMIA 1YI9A 4QPIA 5FYVA 3M3CA 4IGQA 2ZTNA 5GLWA 4CDQB 5APAA 3T2QA 1S2EA 3RYKA 2DV9A 3MICA 3ZFFC 2DCYA 5FP3A 3FHIB 4LITA 1LEMA 2VTXJ 5C9AC 4RS5C 3THPA 4LLOA 4XFGA 1H6YA 5BXXA 4YM3A 2WQ8A 3OGVA 4CCJA 1URXA 1XNKA 1GSLA 3I2GA 2Z2SB 4YARA 1GQPA 3ILRA 3SQOA 2ES3A 2IWGB 3CJXA 3ROUA 1KRIA 1YJKA 4RN5A 2E7AA 4F8AA 2DUPA 1LU1A 3LDRA 1W0OA 2ET1A 4CCDA 3K3NA 5H9QA 2XVKA 1UD1A 5FY4A 4HT1T 4XAAA 4BQ5A 5CIRA 3AYDA 3W58A 4FFIA 4Q1RA 2DU0A 1KS4A 4FQ4A 1FMD2 3WF3A 3NJVA 3WP4A 1DGRA 3JU9A 4CCOA 2DVAA 1HV0A 3IMNA 4NHXA 5A7PA 3KV6A 1E5SA 1OI6A 1C8NA 4HFSA 4ES8A 4LOTA 3MFAA 2J42A 5T5JA 3MFCA 2VXJA 4QHZA 2G9GA 2VECA 5GLUA 4PLMA 4B4RA 3JBG2 1UU4A 4Y1UA 4KBZA 1GWKA 2ZEWA 5FOBB 1YQ2A 3VHPA 3KT7A 4LO5B 4YG0A 3RS6A 1O5LA 1G9AA 4IQPA 1ZZBA 4CP2A 2K2SA 3B94A 2A73B 4N53A 2WO2A 2ZGTA 1KEXA 4CP9A 4XF1A 1JZ6A 4FP2A 3OPTA 5DQ0A 2RS13 1GU3A 2RM22 3GBFA 5LA1A 3A0NA 4LHLA 3ZXKA 4XIKA 3AB0A 1F4HA 2Z69A 1CAWB 4MHUA 4UW3A 3FUQA 4IE0A 4ISQA 4BDVB 4XUOA 4DQAA 3PJQA 4WV8A 3GJBA 4L99A 2WAAA 3AVSA 1QDOA 4ZONA 1UOGA 3OB8A 4P9LA 4YG6A 5EIYB 3AM2A 4LK7A 3PUHA 1W6OA 2BGOA 3OSDA 4JKLA 2R071 2VMEA 3KB5A 1UQXA 4RHV3 2WC2A 4LKSA 1ZM1A 3WX5A 1VB2A 1YEWA 4BQ2A 1U0AA 3OPWA 3WG4A 4NIHA 2YU2A 1V6IA 5AFBA 1AR72 2LROA 4DUXA 1SFYA 2DBIA 2D6OX 1ST8A 3ZSMA 1GP6A 2HWF3 1CWPA 4W4ZA 1BBT3 1X8EA 5FXZA 4WVVA 3BYWA 4XIOA 4A41A 4BQXA 2OIIA 4JGYB 5IVBA 2IZWA 4K6BA 5FYZA 2NLRA 4LT5A 4LA2A 4RGKA 5J09A 5GZFA 5T5LA 1CZSA 4A44A 4EN9B 1AYN1 1AJOA 3U10A 4WM8A 2V5DA 2NMNA 3KCCA 3EJKA 1XNDA 4IE4A 1A3KA 1PNGA 2OT7A 3E6DA 4OZXA 1FX5A 1LOCA 2D5FA 3MIHA 2HLEA 5DZFA 5GLVA 4L2NA 4HANA 1Y4WA 4B4QA 1AL0G 4R52A 2D3RA 4XXPA 1XPWA 1LHUA 4HLTA 3SCGA 1CONA 1UCXA 3JCIA 1C4RA 3P3NA 1AHSA 4HKLA 1AX0A 5FY0A 3WV6A 2IUWA 5KR7A 5FZ8A 1POV3 3T30A 2PYTA 1MVEA 4INDA 5L7OC 4LULA 1LAJA 4L9BA 2CAVA 2F4PA 5H9PA 2VE1A 3OY8A 3JUUA 4AVBA 1RUJ1 2LTNA 5ABJC 5B4NA 4D94A 2RR12 2WIIB 3IDBB 4IEZA 5FLHA 4MGYE 4W8JA 1AF9A 2WZPP 1ND3A 4NHKA 3J9SA 3AMHA 2W68A 5CG8A 4M3CA 2WJSA 3H8UA 4LUMA 2ZMNA 5CFDA 3VHOA 3IN9A 4B1LA 2YB7A 2WWUA 2RV9A 1A78A 2I45A 5FZOB 1UL9A 5D8AB 4BA6A 1S0DA 4WM7B 4QM8A 4D6SA 4ZXEA 1JYIA 1UY1A 1QKQA 2Y0OA 1X9PA 1AX2A 3VBSB 4BIFA 3MPBA 2XQRA 2RS12 4AEDC 3O1OA 4NMIA 3BGAA 1QXPA 4QHBA 1O3QA 5DDJ3 4OMCA 5CKQA 1V6NA 4DY5A 4HN0A 3NNFA 1L3JA 1DQ2A 1W03A 3VDBA 3HQRA 4JRAA 4PBOA 3O1UA 5FY7A 3VZOA 2HYXA 2A5ZA 3LIHA 2E26A 4CDWA 4FPCA 1NQDA 2ATFA 4QQHA 2XG3A 3USUB 1GNHA 5JOZA 3RZLA 2A3XA 2D5HA 3TYJA 4S2DA 5J37A 1IQDC 2ZX3A 1DYKA 1G9FA 3FLRA 1DQ1A 1QJX1 5HCFA 1PGL2 3THCA 2I74A 2VCBA 1OFNA 1MZFA 3FFQA 1Z7S1 3SKJE 4YW1A 3K75B 2PAMA 2ENRA 3AKQA 1CAUB 1H1AA 3TNQA 4RS5A 1MQTC 1PM4A 3WQ7A 3ZSEA 5BNNA 5FPVA 3UETA 1GWLA 4HVRA 1OQDA 4COUA 2VZPA 1VBB2 2HWF2 2YPDA 2EVXA 2NYYA 1LU2A 2WZR3 4YW2A 4U36A 3H42B 3MW4A 3CLPA 3N9MA 1LJ7A 1UU6A 2KR2A 5A7QA 3K77A 3HJRA 3VBHB 5JXJA 3OGRA 4MH0E 1ODMA 3TOJA 1O3SA 3DPRB 1QJU2
chains in the Genus database with same CATH topology
3WQ0A 2F6BA 2ZHKA 1QHDA 5KHGA 3AYAA 4AEJA 5FO9B 2D98A 5EYYA 4MYEA 1SCSA 3R6SA 4I30A 1FATA 4LE3A 5J98B 3USSA 1CR7A 2WS91 4HVOA 4W6YA 1F5FA 4H7LA 2XGXA 5JAXA 2WFF1 3OYWB 4B8EA 2YUEA 1W6QB 5A32B 1W2UA 4W6XA 1QXRA 1RINA 4KH9A 4GALA 2ZGUA 4MLOA 3MW2A 2B7YA 2RS52 4UBHA 5HCAA 4QPGC 4GH4C 4GMP0 1ZZ8A 4AI3A 4FTBA 2HWB1 2Y38A 1PK6B 1J58A 2B9UA 3VGIA 2X8KA 1QH6A 4B4PA 1ENQA 4LE4A 3LA3A 3AFGA 1Q56A 1VAKA 3N36A 3WCRA 4AQSA 5JIUA 2EXJA 3VV1A 1H4HA 3WVJA 5T5PA 4Q0UA 5H9SA 1RGSA 2QDRA 2NQYA 4Q4W1 1EP0A 1BK1A 1WCKA 2ZHNA 4AGRA 4FP3A 1BKZA 1RUC1 3NAPC 3MDPA 3KGZA 5FCCA 3H1MA 1LKNA 4XYXA 3JD71 5F1RA 1OQEA 2X29A 1NCQA 4HSLA 1FI2A 4JCKA 4XFFA 2WT0A 4JDNA 4ONUA 4ASLA 3FUOA 4P14A 1TME2 1Q5OA 4RR3B 1ALYA 3AZWA 3ZFEA 3AMPA 1B09A 2WZR2 4ZU5A 3EHKA 2BW8A 3U4XA 1XYNA 1AYM1 3TN91 1H2KA 2KA3A 2UY8A 4K1YA 4FXKB 4XILA 4RD7A 2D7FA 2Z5WA 1DHKB 3WLUA 3VBUA 1KDMA 4HZFA 1Y7BA 2D43A 2ZPXA 3O5SA 3ZO0B 2XVGA 2UYAA 1I5ZA 3LWCA 5ABJA 1F9KA 1IPKA 4JDMA 2WNVC 2UWBA 3N35A 1LECA 2FMDA 2QUOA 2JKBA 1ULDA 1RUE1 4XTPA 1QU0A 1HKDA 1JOJA 1HIXA 1NXMA 4AFMA 5BY5A 2XKPA 1UZZA 3INAA 4Q4X3 4XF3A 3DV8A 4Y4YA 3ZXJA 1B35C 4N53B 4NWVA 4DPNA 4MSVA 4XBNA 1IQAA 3QACA 1HXS1 1C1LA 3VL8A 2E63A 3HT1A 3WNXA 1FOD1 4Y20A 2AH2A 2O8OA 5K0UC 1RUI3 1FYUA 1DFQA 1GBGA 1GZWB 1JH5A 2VVEA 3KQRA 4YM2A 3ZYIB 2XJQA 1W6MA 5KXDA 1S2BA 2C9AA 5AC91 5JLVA 1W6OB 1VBA1 3WUCA 3ZSLA 3WD5A 1ZBE3 4NHLA 1UN1A 3X29B 2VQAA 3POYA 5BNOC 1V00A 4LBMA 5KHJA 1TNFA 4XQDA 2HWC3 2RS31 4L11A 5AFEA 3THTA 2ZAHA 1COV3 2XLAA 3QCWA 3ES1A 1QJY2 4YG3A 3B9IA 5E8AA 4AI2A 2CV6A 1MS1A 3HAGA 3MPPG 5F9TA 2BQPA 3RYRA 4F83A 3DKWA 4WM8B 4XOGA 4MVTA 2JECA 4RQPB 3E97A 2BVBA 1REEA 1POV0 2W0XA 1WD4A 1RUC3 4NN0A 2VH9A 1N3OA 1R082 4NWWA 1BVVA 3NL1A 2JG8B 2VOWA 4OI1A 2DU1A 2WSUA 3QLQA 2X5IC 4MGZE 4UW4A 3OY8B 4Y22A 4YZ5A 1CAXA 4JDOA 1REFA 3LOIA 4K21A 1ZZ7A 2D97A 2E9QA 2LUWA 2ZS6B 3EXUA 4QPYA 4QPGA 4GH4A 5GZDA 1CX4A 1WBLA 1AR82 1VBE3 2H6CA 2OVUA 1VRH1 4M3CB 3VZMA 5CFDB 3B5LB 1EYBA 3IDEA 4Q4X2 5J3UA 1D4M1 4Z2WA 4COYA 4W65A 4ZU4A 3VDDC 4QPIC 4C90A 3S7IA 2XBO1 1FMD1 2R063 5A3LA 4WZFA 4YGDA 3LAGA 4YZ1A 4CZSA 4AWDA 1VB4A 1LGBA 4F7ZA 2G4IA 3HIFA 3ATGA 3WDYA 3V0AA 4Q4V3 1VLNA 1GLHA 3KD4A 5JMCA 5DZEA 3DUIA 4JTOA 1RMU3 2PLV3 2AENA 5ACA1 4NOTA 1J1TA 1RHI3 1R1A2 4AFBA 4ATFA 3HBZA 5DZGA 1RUE3 4DZGA 4H3WA 2JEMA 1EPZA 2YYOA 1OMIA 4IETA 5EFUA 3GNEA 4IEPA 3ZFFB 3M4FA 4XJAA 5C9AB 3M3QA 4RS5B 2PELA 5CVRA 1X33A 3FLPA 4OHZA 3GF6A 4XMAA 1GQHA 1COV2 3R05A 1EY2A 1VBC1 1HXS3 1IZ3A 1UAIA 1V9U3 2MHFA 2ILMA 3ALQA 2DTWA 1VBD3 4N43C 4TYSA 1QF3A 2WLQA 3WW1A 3S30A 4QQPA 1IPJA 2QQPA 3T2TA 1ZRDA 4GKYA 4GIQA 1VIWB 2IFWA 2BNNA 3TWIA 4N90A 4YNIA 1WCDJ 2XPJA 1CJDA 1Q8VA 4EROA 4KWLA 2W52A 4PLOA 2GNBA 1NY72 3K51A 1ZBA1 3ZFGC 1WLDA 3PVBB 1AR62 3NSTA 2QDNA 1SLBA 3JZVA 2RS33 1X7NA 4K9SA 1UX6A 3M7AA 1DG6A 1XQNA 1B35A 2CWMA 3WHTA 5C33A 1VBE2 4Y24A 1HDKA 1HRI2 1ZYBA 1U5XA 1QGLA 1GV9A 4R4XA 4Q0QA 4FPHA 2CGNA 4HVQA 1A8DA 2GNDA 4B7KA 2R062 4QQ2A 4BQ1A 1CESA 1ENSA 1DGWA 3IPVB 4O9GA 1UPSA 1LOGA 2RR11 3A0KA 3MZHA 1O91A 1TE1B 2IXCA 4Q4V2 3APBA 5I8YA 4KNCA 2HWE1 1OSGA 4AGGA 1RMU2 1TMF3 1O7FA 2PLV2 4QXKA 1EAH1 5EWSA 3VZJA 3AXEA 1WMDA 1MZ5A 2PAKA 1JYCA 1AXYA 1SACA 2CY6A 3I8TA 3VHNA 1RHI2 2ARBA 4XZPA 2Q1ZB 1BXHA 1VRH3 4TLFA 5BNPC 3W9AA 1C8M3 5I0SA 2VQ0A 2BNOA 4DY3A 1O3TA 4UXAA 5KHKA 1BEV2 1FT9A 1MR5A 1NLRA 1QJZA 5FFOC 2XJSA 1LTEA 4X8PA 1ND3C 1DZQA 1W6PA 2HWD3 2JDZA 1YRZA 3RRDA 2PHUA 4BMBA 5JSPA 1HQNA 1PO23 3GBGA 4X8NA 1NXD1 1QOTA 4C1WA 2E7TA 1O4YA 3FX3A 2RHPA 1H8TC 1HQWA 3E6CC 2N7GA 2DVFA 3NV3A 4IESA 4F3JA 2YHJA 4IEYA 1IHMA 3WDXA 1PVXA 5L7OB 2SBAA 1RUD3 4Q8LA 4K1ZA 4Y26A 5ABJB 3TBDA 4XJ9A 3I2DA 2R1BA 2B45X 3BB6A 5GALA 4MXWB 1VBB1 2D6PA 4HKOA 3WDWA 4PCRA 4Q26A 4DRVA 2V5YA 1S0JA 1Z78A 3LSEA 1ENRA 4CDWC 1W39A 1Q8QA 2I07B 2UURA 1PO12 3I59A 1QJU1 2GMEA 4PDWC 3VDDA 1RUH1 2VXRA 4I2OA 4AEDB 2R32A 3VBFA 4R4ZA 5BNNC 1NLSA 4QGLA 1CAVA 4XHXA 5L36A 4DOUA 3HMYA 2A75A 4G3YC 3VBRA 5I8SA 1FPN3 4Y20B 3V56A 3EBRA 2A3WA 4C91A 2AZ5A 2NPIA 1O4TA 2GH2A 4OHYA 2HEYF 3ZX7A 3NV1A 5GJ6A 1PHMA 4ZKTB 3L2HA 3J26N 3MIEA 1H0BA 5DUXA 4BH9A 2GNMA 2IXKA 3AZXA 5JZGA 3WP5A 1MQTB 2WINB 1HQLA 2ETEA 2GC1A 2XJVA 4EN6B 3O0VA 1WMFA 5SV8A 2PHWA 3WR0A 1AL21 1PIV1 3UKVA 2JE7A 3J8F2 4N43A 4AI1A 4AFAA 4Q2FA 1PO22 1DQ4A 1ENXA 2EXKA 5H9RA 1REDA 1GICA 2PHFA 3VZNA 1GQGA 5JOXA 1OHFA 4CDXC 1HV1A 3AMMA 4R9DA 4XF4A 1ASJ1 2HWE3 4KU7A 2Q0AA 3ZFGA 4KWKA 3SISA 3MLJA 1EAH3 3SH3A 1RUD2 4YZ3A 4E4SA 4HSJA 3N4MA 3FWEA 1S0FA 4AF9A 1TME1 2XB6C 1H1IA 3M3OA 4S2GA 4A7KA 5FQ0A 4KGGA 2E7QA 2R0HA 1ULCA 4LBNA 4EN7B 2ZX0A 3FLTA 1X8MA 4QPGB 4GH4B 1AX1A 1IGOA 2I2SA 3ILFA 2PQQA 4W6WA 5KHIA 2VNRA 4HK8A 5A3MA 4QT6A 2VW1A 1H9WA 4AEMA 3LOBA 3PNAA 1U5YA 5FDBA 3UJQA 3V0BA 1NCQC 1BMV2 1MS5A 3RG0A 5FO8B 2E6VA 5FLIA 3AKPA 4I02A 2DVGA 1ZVFA 1MEC1 4G4FA 3RPQA 2Z42A 4AGVA 1ZRFA 4FQZA 4JVAA 3ZFEC 2MEV3 4CYDA 2B8MA 1FPN2 2QKDA 3AP4A 2GMMA 2OW4A 3FZ3A 3NAPB 3V0AB 4CDUC 1ZNPA 3AXDA 1AUYA 2ZGKA 4Q4Y1 3VBUC 5I8TA 5BNPA 2Q4SA 4FO9A 3ZXGA 4GB33 3WHUA 1ND2A 1DIWA 1YWKA 3O7OA 2ZAAA 2WNEA 1RUH3 2NM1A 4Y1ZA 4COVA 3GALA 4ORFA 2VMIA 3PJYA 2D6NA 2Y0IA 2XKOA 1PGSA 2SLIA 3AK0A 3AMNA 3U11A 1G9BA 4DINB 1NCRC 4LBQB 1H8TA 5FMOL 2YMZA 2X53S 3D0SA 2D3SA 1ULFA 2EIGA 4META 1SFNA 2DVDA 4Y1VA 4A2UA 4C1XA 4C0HA 3ZN5A 1IS6A 2H0BA 2WNVB 4AHWA 2A6YA 3QH6A 3KT1A 1NYWA 2DYCA 2BFUL 2GC2A 1QJY1 2Y26A 4FPKA 4GWNA 1PNFA 4JTNA 5FAXA 2DCKA 4RHV2 2WNUC 4PDWA 2WKKA 3WW4A 2JD4A 2MPFA 1V70A 1IS5A 3D5OA 3CO2A 1NG0A 1AL23 1GKBA 3AP9A 5GLTA 1B35B 4M00A 1GYKA 1RB8G 3MGUA 4OI2A 4IV3A 3ENRA 2TNFA 3TNPB 1BBT2 5I91A 4OHVA 2PHRA 2DTYA 3VLBB 4AHYA 3PVOA 3L2YA 2R041 2VULA 3VN4A 4FAGA 4XQ4A 5K0UB 1WCSA 1C5IA 2YC0A 4IEVA 1MS4A 4XQWA 1N3QA 1CJPA 1ZRCA 1YFXA 1CGPA 3LSDA 1AR81 4FPJA 3MF6A 4FXGB 1TQ5A 1ZREA 4CEYC 2R073 5JOYA 2PFWA 2BYVE 5BNOB 2VW0A 4I01A 5IUQA 2O0OA 3ZXFA 4NVPA 1HRV1 3AX4A 4WZCA 1ULEA 2ZGRA 5E89A 2VG9A 4AVVA 2ZGOA 1LODA 2OUHA 1MS9A 3ZXEA 1MEC3 3H7JA 4YYOA 1QNYA 1W6PB 4BHPA 1AYN3 1R091 4CDXA 2XJRA 4LBLA 4BYYA 5I0RA 2GNTA 5KXEA 1R1A1 2IC1A 4YGBA 3ZMNA 3OD4A 4HPKA 4J6GA 1RUF1 4N7IA 4COZA 4CEWC 5DDJ2 2X5IB 3IDCB 4AG4A 4AQ6A 4RA0A 1YNAA 4K8FA 4ITCA 1WGPA 2GSYA 3ZIWA 3C3VA 4R8HA 1RUJ3 3JB8A 2FHRA 2RMU1 2R1DA 3LA7A 1W6NA 1LHVA 1PGW2 4KL1A 2QJVA 2XLGA 4N9HA 2BBVA 3VDDB 2JJ6A 4QPIB 4G9SB 2A70A 2ZABA 4ATEA 1LULA 4X6RB 4HK9A 1MZ6A 3B02A 3VBFB 2XUMA 1CAVB 2EALA 3FBMA 2IXIA 2JG9A 4KGQA 2IXLA 4LO7A 4M0HA 2WL1A 5EXOA 1N1SA 4CDUA 5T5OA 4YGEA 2YXSA 1PVC1 3M2MA 3AMQA 1OA2A 5BPXA 1WW7A 2FMYA 1Q8PA 4YFZA 1HX6A 2EAKA 3BTAA 3WG2A 3ETQA 1NZCA 3WXPA 5TSWA 1CD3G 2HKXA 3ZYJB 1K5MA 1QJX3 1LGNA 2GU9A 4HL0A 4P9JA 2VGDA 4EN8B 5FREA 1Z7S3 4D7YA 2D6MA 3TRSB 2WFPA 3N7MA 3JB4C 1NCRA 1OQ1A 1OA4A 4N43B 1EV11 1XU1A 4IEOA 4AHXA 3RDIA 2XWBB 3KCYA 5KXCA 1AYN2 2FBEA 2ZGSA 1QQP1 3O14A 2XLFA 1UZYA 4I3PA 1XYPA 2ZHMA 4JAAA 2V73A 4NR1A 2Q1MA 4M0NA 1WW4A 3ZFGB 3TB0A 5CFCA 2FQPA 1PM7A 2WS93 1YUDA 3HQXA 1C57A 2HYKA 2WNUA 3AJZA 3BPZA 4JRLA 3S6PA 4RGGA 4LHKA 2WFF3 3J4UH 3PLQA 3SXWA 1RUJ2 1RC6A 2C1FA 1W0PA 4D69A 2TUNA 2BUKA 2DCZA 2YGMA 1DU3D 2VOVA 4XF0A 3UL2A 1Y43B 1RUG1 1FNYA 1G6NA 3R4SA 4AI8A 5JSOA 2A6WA 4OULA 3GYDA 1SLLA 2HWB3 2QE3A 5L19A 3V0BB 4I3GA 2ZMKA 1ZZ6A 2O1QA 3RQ0A 2JENA 3WOGA 1J3RA 2A6VA 1RVF1 2VOXA 1RUF3 1AR91 1CN1A 1PZ8A 4AXOA 5GKAC 3AKTA 4FPGA 1O3RA 2Z79A 1QWRA 3VHRA 2XL9A 4Q4W3 4CEYA 3FC0A 4RL7A 5LRRA 3RNSA 1BQPA 4C0BA 1C3HA 3I54A 2OYZA 5IK8A 1PO11 2VNOA 5E1RA 1XXNA 5BNPB 1OOPC 2CAUA 3JD73 2XHKA 1C5HA 1YIPA 3WQ1A 4YW4A 3SCFA 4LUKA 5CADA 3WG1A 1Z7S2 4HETA 4IEWA 3KS7A 4YM1A 1IOAA 4XDQA 5B2GB 1ND3B 4CRQA 3ST7A 1CAWA 3RJ2X 3SITA 4AQ2A 3OF1A 1ZZCA 1XNBA 4PF5A 4B7EA 3N7LA 2ZMLA 1AYM3 3TN93 1H8TB 4AEKA 5CG9A 5IK4A 4P9WA 4CEWA 4Y5Z0