1JXNA

Crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
SDDLSFKFKNFSQNGKDLSFQGNASVIETGVLQLNKVGNNLPDETGGIARYIAPIHIWNCNTGELASFITSFSFFMETSANPKAATDGLTFFLAPPDSPLRRAGGYFGLFNDTKCDSSYQTVAVEFDTIGSPVNFWDPGFPHIGIDVNCVKSINAERWNKRYGLNNVANVEIIYEASSKTLTASLTYPSDQTSISVTSIVDLKEILPEWVSVGFSGSTYIGRQATHEVLNWYFTSTFINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examination of the Structural Basis for O(H) Blood Group Specificity by Ulex europaeus Lectin I
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords anti-H(O) lectin I
total genus 58
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jxnA00
1QDOA 4YG3A 2G4IA 5JOWA 1Q8SA 4NO4A 4UW3A 2NN8A 1GNZA 2WJSA 2C9AA 2PHRA 3AZVA 1S0IA 1LOGA 3HN1A 1WLWA 3OY8B 4U2AA 4PBOA 3U4XA 2UWAA 1GNHA 1VIWB 2XG3A 5JOYA 1JXNA 2P3KA 3OGGA 1CONA 1WBFA 4YGCA 1DHKB 3ILRA 4XJUA 2EALA 3W58A 1JBCA 5H9PA 3GALA 4K21A 1KDMA 1JHNA 4DRRA 4HL0A 2GMPA 5F9TA 3AFKA 4FPGA 5FREA 5HCBA 3OBRA 3RSJA 2OUJA 1QNYA 3ZXJA 4DPNA 2BQPA 3WG1A 2CWSA 2FHRA 3BIWE 2P2KA 2AH2A 4P9YA 4Y22A 3VV1A 1AX0A 4FP3A 5EWSA 2CY6A 2DUOA 2VXRA 2YV8A 1ZM1A 4LBLA 1H30A 2DVFA 1AVBA 3JUUA 5DUUA 2ZMLA 4ATFA 2ES3A 3LCPA 3V0BB 2CL2A 1DZQA 4M3CB 3ZSJA 2V5YA 4FPHA 3RMXA 4BM8A 1JW6A 2A3XA 1DQ4A 2VH9A 2A7AA 4YM0A 2JKBA 3VKFC 1FV2A 2W39A 1ONAA 2YZ4A 3A0KA 4XMIA 5L73A 4DS0A 1APNA 1G8WA 4UW6A 4D69A 3QCWA 3M2MA 5T52A 1W6OB 1Y7BA 2A6ZA 4W65A 3SH3A 2NMOA 4XJ9A 5DG2A 4CRQA 5GZCA 3UK9A 4XE9A 1YIFA 2EXIA 3B00A 4Q26A 1BXHA 4XHXA 2LALA 1C57A 5CAZA 2SBAA 1FV3A 3AP7A 4YZ1A 1AX2A 1SLBA 1HLCA 2A75A 4YGBA 3WDTA 3PVNA 1LHNA 4H55A 4AGVA 2JD4A 1QNWA 3AZWA 1WLDA 2DU1A 4SLIA 3ZSKA 2E53A 4ATEA 1GICA 4XIKA 4ZXKA 3WDXA 3AK0A 1JYIA 1BKZA 1GV9A 2A3WA 4ISRA 2NMNA 5IUQA 4U36A 1C1FA 4M00A 1SBEA 2XB6C 1F31A 1NXD1 1WBLA 1Q8OA 3NV2A 3TB0A 3ILNA 1LEMA 2WSUA 1JN2P 1W6MB 5GZDA 1SLIA 1MS3A 4Q27A 4Y22B 4FOYA 4AVVA 4ITCA 4WVWA 3V0AB 2ZGMA 1VAMA 1QU0A 3ZXKA 1SCRA 3VUOA 3MW3A 3KQRA 1WD4A 1LOCA 3AZXA 1LHUA 2JE9A 4FOQA 4PF5A 1LOFA 4GKXA 5E8AA 1CPMA 4CZSA 1CESA 1UPSA 2E51A 1R1ZA 3APBA 3ZXEA 1CIWA 1GZCA 3IPVB 4Y26A 2ZZJA 5CB7A 1OKQA 3TAYA 1LTEA 1W6NB 3D6EA 3W59A 2ZHLA 3UL2A 3N7JA 1WW5A 3RRDA 1G86A 1KJLA 1DBNA 2R0HA 4RA0A 1V6NA 4XYXA 2Z42A 3BODA 1RINA 2R1BA 4YZ4A 1DYKA 5GALA 3VKMA 5JOZA 1Q8QA 1WW4A 2P3JA 5GLVA 1CR7A 2NP0A 2JECA 1YRZA 2B7YA 4YM2A 3B3QE 4AVTA 2ZGQA 1Q8VA 3C2UA 3AZYA 2R49A 3AJZA 1MVEA 3B01A 1LGCA 3AP5A 3WZ1A 2DU0A 3PJQA 1LOFC 1N3QA 1W6NA 3AP4A 3N36A 4GXLA 1N3OA 4Q8LA 2D3RA 2JE7A 2R16A 4Y1XA 1Z0HA 2AGSA 1DQ0A 2PELA 1MS5A 1N1TA 4JCKA 1DFQA 4LBOA 4DRVA 4BLJA 3ASIA 1V6KA 4Q8KA 1YI7A 3WDWA 2DUQA 4Q2FA 3UJOA 2ZGTA 4LBKA 3AP6A 1GANA 2ERFA 3RS6A 4PCRA 1LODA 1ZA4A 4FPKA 5GJ6A 3WHTA 2ZMNA 4ZKTB 1HKDA 1C1LA 1LCLA 1LULA 4JC1A 1A3KA 1LHOA 1W0OA 2D6MA 3N35A 3WG4A 1S0DA 1WUVA 3AXDA 3B69A 5H9RA 4FPEA 5H9QA 3FLTA 2W52A 3FBYA 5DZGA 2WT2A 1V00A 3WG3A 1H9PA 5AVAA 3V64A 2WNEA 4AWDA 2A3YA 1H9WA 3OPZA 3IM0A 2ZHKA 3INAA 4BOWA 1ULFA 4YFWA 2DTYA 4C1WA 4FPYA 2VW2A 3NV4A 5IK7A 5CA6A 5HCAA 4XTMA 2A6VA 4OZXA 1FYUA 2ZHMA 3BTAA 5GZEA 3WVJA 3M3OA 1WCSA 2WSVA 4XZPA 2DURA 1AJKA 1LHVA 2D44A 2P37A 2OVUA 1CPNA 1S0BA 1QKQA 4UW5A 1GKBA 1W6MA 2PHWA 3T2TA 2PHUA 4M3CE 1TEIA 1BYHA 3ENRA 3D4KA 1FATA 3AXEA 4R9AA 2JJ6A 3AYEA 3ILFA 1ENSA 4FOVA 3WDYA 5DUVA 1MS8A 3WOGA 4FP2A 4BQ1A 3O5SA 1N3PA 1GZWA 3O0WA 5EYYA 4BMEA 4FOWA 3IPVA 1YXWA 4P9WA 1G7YA 4PQ9A 2Q5TA 1MR5A 1SBDA 2NYYA 5EYXA 1QGLA 1QOSA 1YO8A 4XXPA 2DUPA 2AREA 4Y1YA 3WUDA 1V6IA 1EPWA 1MS1A 4XMAA 3R4SA 1F9KA 5GLWA 1SBFA 3O0VA 1LU2A 4WZFA 3ATGA 5JDBA 4Z8BA 4R9DA 1DQ6A 2GNMA 2D3SA 1VAVA 4YW5A 1OFSA 3R4UA 5JLVA 3USUA 1I1EA 3FLPA 1AJOA 4Y24A 2GNBA 1AF9A 1GYKA 1A8DA 1LOBA 1W6PB 4P9XA 3IN9A 2ZACA 3NWKA 1A78A 3AP9A 2A6WA 3MPPG 5GZGA 4GKYA 3USUB 5GZFA 1ULDA 3L2YA 1C4RA 3V65A 3AYDA 2GMMA 2ZA9A 4IQPA 2GNDA 2D6KA 1FNYA 1AX1A 2ZGSA 2P3IA 1G9AA 1IKQA 1BJQA 2EAKA 1S0EA 1VLNA 1W6QA 3AYCA 4HANA 5HCFA 4BMBA 3VKNA 4P14A 4R9CA 2EF6A 5DZFA 1G9FA 1HDKA 4F83A 1UN1A 5E88A 1I3HA 1GBGA 1MS9A 2ZGOA 1GZWB 5DG1A 4FPOB 4YZ5A 1MZ5A 1CJPA 1QOOA 1CN1A 2R0FA 3POYA 4XJZA 5KXEA 1BZWA 1QDCA 2DV9A 2ZHNA 1ULGA 1SCSA 3IMNA 3OYWA 4GA9A 2RHPA 1WW6A 4XILA 5IK4A 3BOPA 2A6YA 3V0BA 4CTEA 1FAYA 1LGNA 5GLTA 3GNEA 4GWMA 4YGEA 3WV6A 3JU9A 1IKPA 3ZXFA 4GWNA 1QF3A 2SLIA 3B9CA 5JVVA 1S0GA 5T50A 3IKWA 1B09A 1LEDA 5T54A 3ZPYA 2GN7A 1ULEA 1W6OA 2C5DA 3M1HA 4TZDA 1V6OA 5IK5A 1CQ9A 3M3QA 2V73A 2P34A 4LBNA 4XIOA 1AZDA 3AX4A 3MW2A 1D0HA 2CTVA 2ARXA 2D6LX 2EXKA 2KM2A 3O0XA 5GLUA 1DQ5A 4Y1UA 2A6XA 3RMYA 2WKKA 2WLQA 5JMCA 5DXDA 3N7MA 1DGLA 1HQLA 4Q1RA 3SISA 2DVGA 3QLQA 1V6JA 3A0NA 4Y20B 1Q56A 3KM5A 4C1XA 3POWA 2DVBA 4XBNA 2H0BA 5DUWA 3ZVXA 2E7QA 3UJQA 4XBLA 3WCSA 3FLRA 3N7KA 3ZSMA 2R1DA 4FQ4A 5T5JA 3VKLA 4Y1ZA 1N1YA 2WT1A 2ZMKA 4XXAA 1QMJA 2D6NA 2UWCA 2DVAA 1SLTA 1OQ1A 2ZGLA 3N7LA 4XDQA 1S0FA 5FRAA 3RG0A 2CWMA 1Z78A 1YYNA 1HQWA 1SLLA 2LTNA 1PZ9A 2E6VA 4YW2A 1F5FA 1DLLA 1S1AA 2I2SA 1LOAA 1UKGA 1IS6A 1SLCA 1DYPA 3O12A 4YGDA 1WLCA 1BQPA 3OBTA 1LESA 2GDFA 2GNTA 4L8QA 4KBBA 3M3CA 2EIGA 2YXSA 2WT0A 4XJAA 4XOGA 1JUIA 1O4YA 2A5ZA 4LBQB 4YZ2A 2D7FA 2OUHA 1GZ9A 4YM1A 5E89A 1XQNA 1VALA 5IK8A 1UL9A 1WW7A 1G9DA 5IT6A 1QOTA 2YMZA 4YFZA 3WUCA 1FNZA 2GMEA 1LHWA 1JYCA 3ZYRA 4YM3A 1AXZA 3VKOA 3SH5A 2NM1A 3SNMA 1IS4A 1W0PA 2WQZC 1RITA 3ZSLA 1LGBA 2GN3A 3RQ0A 4AYUA 3WDUA 1ENQA 3I4IA 4LBQA 1N1SA 5CNAA 4UW4A 2PHXA 2VW1A 2VY0A 5CBLA 1GSLA 1KRIA 1UZZA 2DYCA 3SITA 5KXBA 1KQRA 1IOAA 5T5PA 4YZ3A 1UAIA 5KXCA 4M01A 1V6LA 2ZKNA 3PVOA 4YG6A 1KITA 1X50A 5DUXA 2ZBJA 2DTWA 3WCRA 4DFSA 4AVSA 4XHBA 3ZYPA 2YROA 4LBQD 2YY1A 1UZYA 2VU9A 2ZGKA 1AXYA 2VW0A 2OW4A 3ZXLA 1W6QB 2D6OX 1URXA 2VUAA 5H9SA 1NLSA 1KJRA 4WV8A 3WNXA 2FMDA 2DVDA 3DUIA 4Y20A 1N1VA 2GALA 5EXOA 1AXKA 3V0AA 1D2SA 2PHFA 2D6PA 1O4ZA 3AYAA 2ZGNA 1IS3A 1RIRA 4AGRA 4TYSA 3SH4A 1GLHA 3I8TA 3HR9A 3LSDA 5LK5A 1LECA 4XJWA 4MYEA 1LU1A 2ENRA 4RL7A 3SLIA 4K20A 5BYNA 3D5OA 4XJ8A 4GALA 4FPFA 1Q8PA 5SV8A 3POSA 1S0JA 4M3CF 5T5OA 3WDVA 1KDKA 2CYFA 4LBJA 2AYHA 3PMEA 4YW4A 2ZGRA 3WLUA 5JOXA 5KXDA 1IS5A 1UMZA 3MW4A 1PZ7A 1MVQA 2ZGUA 4PBPA 4ASMB 3WG2A 1UX6A 2AUYA 1LJ7A 3A4UA 1U0AA 3NV1A 1WD3A 2CNAA 4LBMA 1ULCA 4Y1VA 1DQ1A 3OYWB 3M3EA 1LOEA 3LSEA 3R05A 2D43A 1LENA 2W68A 3OY8A 4YW1A 4M3CA 4K1YA 4WVVA 1MZ6A 4FPLA 3CNAA 2EXJA 2ZAAA 4JRAA 1W6PA 3FUOA 2HYKA 5GM0A 1N47A 3AZZA 2A71A 5F5QA 4BLIA 3H0OA 3NV3A 4XTPA 2DWRA 1MACA 2ZABA 2D3PA 1FX5A 4FPJA 2JDZA 3MEPA 1SLAA 2AR6A 4DQAA 3DGTA 1V6MA 3FFZA 4YLZA 1G9CA 3AJYA 3HMYA 1ENRA 1PZ8A 4YG0A 1JOJA 1DIWA 1MS0A 2UURA 4I30A 3OJBA 4R9BA 3WHUA 4BPZA 4NOTA 3N3HA 5DZEA 2EXHA 4FPCA 1S0CA 2TEPA 2NZ9A 5T55A 3PVEA 1SFYA 3T1MA 1J1TA 2W08A 3FUQA 2ARBA 2AENA 4XBQA 2E7TA 3T1LA 4ISQA 1MS4A 5T5LA 4FQZA 1DQ2A 2PHTA 2UWBA 3Q9OA 4YW3A 1SACA 4FVVA 4Q1PA 2A70A 2UU8A 5GLZA 4K1ZA 2ZGPA 4AGGA 1CVNA 1G9BA
chains in the Genus database with same CATH superfamily
4K6BA 2ZX4A 5JOWA 4L2NA 4NO4A 4LKDA 4WM8A 2C0ZA 5C33A 2F4PA 2WJSA 4LKSA 3AZVA 1US2A 5A7QA 3U4XA 1WLWA 4U2AA 3CQOA 2D97A 2ARCA 2UWAA 4ARYA 2JDPA 4OULA 4XJUA 4LKFA 4ET7A 4CXXA 3POGA 2EALA 4P5HA 3JD71 3MFAA 5ANNA 1KDMA 4DRRA 1RGSA 3OOXA 1CIYA 3OBRA 2OUJA 3EYPA 4DPNA 3IAPA 3WG1A 2CWSA 2FHRA 3BIWE 4P9YA 4Y22A 4QU1A 3KQ4B 5EQUA 3BKZA 1DGRN 1VBB1 3ZYIB 2VG9A 2VXRA 4AG4A 1AYM1 2WL1A 1C8M1 1H30A 5CFDB 5FUIA 4Q4X2 1JMUB 2JG8A 4CDUC 3ZSJA 2ZJCA 2V5YA 2X5IC 4FPHA 3RMXA 3WR0A 3ZFEA 4C0HA 2CGPA 3T08A 1DQ4A 5FZOA 2VH9A 4YM0A 1FV2A 2Z79A 1ONAA 3A0KA 4XMIA 2XHKA 1ZREA 3X29B 4EYUA 1APNA 3QCWA 2YBSA 1Y7BA 4AI0A 2A6ZA 4W65A 2B9UA 2WS92 2PLV1 3K51A 2J7MA 3UK9A 3P1IA 2EXIA 3NAPC 3K4DA 4Q26A 3DV8A 4XHXA 2YUEA 3VBHB 4PHZA 2JE8A 2VZVA 1RJ7A 1FV3A 1EY2A 2Q1ZB 4F3JA 4NRMA 1Q3EA 1HLCA 1SLBA 1MEC3 4XUQA 3PVNA 4BDVB 1FMD3 4NAOA 3H3LA 5IAVA 1WLDA 5JXHA 3ZSKA 2PXJA 5FPXA 1GICA 4XIKA 1XYNA 3WDXA 3KMHA 1GWLA 1BKZA 2WS91 1JYIA 4FTSA 4D7SA 2A3WA 3TEXA 4EN8B 3A23A 1O3SA 2JG8B 2BYVE 1QJU1 2XB6C 4ASLA 4EQVA 1NXD1 1HQNA 4AFMA 2EA7A 4Z07A 1UD1A 2BGCA 4HN0A 4JGYA 1RUJ1 1LEMA 4YVWC 5HV0A 3LOBA 5FZAA 4EN9B 4LO8A 3FWEA 2YDEA 5CYYA 5A3LA 2ZGMA 3NNMA 1OPOA 2R042 3VUOA 4COVA 3RI9A 1LHUA 4PF5A 4AFDA 1LOFA 4GKXA 3VL9A 4CZSA 1OLRA 3KGLA 1JU3A 2LUWA 3RZKA 4ZS3A 1GZCA 3B5LB 3IDAA 4Q0PA 1OHFA 2ZZJA 4Y26A 4MGYE 1LTEA 2Y0IA 2F17A 3A7QA 4XFBA 1R64A 3OBZA 3N7JA 3RRDA 5C4WB 2XJPA 4NMIA 2R0HA 3C7HA 2IXIA 3OGSA 5E6HA 2Z42A 3BODA 2R1BA 1DYKA 2K46A 1ZVFA 3HQUA 4QHZA 1C8M3 1CAUB 2PAMA 4MVTA 3HN3A 4Q4W2 2W94A 3B3QE 4AHYA 2ZGQA 3C2UA 4AVTA 5JUVA 4MGZE 1OXCA 1AR81 4SBVA 4HKWA 1QIQA 4G4FA 3RZJA 2WR9A 3AP4A 3BVCA 3S0MA 2Q8OA 4Y5TA 5FO7B 2JDUA 5CG9A 2IVJA 3H7JA 1DQ0A 2BDRA 2PELA 2GC2A 5HXMA 2BW8A 3U37A 1QQP2 3I3BA 4AEDB 3ZIWA 3AVSA 2P4EA 1V6KA 4Q8KA 1R092 4YVSA 2DUQA 4Q2FA 3ACFA 3UJOA 1Z7S3 4QQHA 3THPA 1RUH2 2QQPA 4LPLA 1LODA 4X8PA 4FPKA 1FPN2 1RVF3 1HKDA 1C1LA 2CDOA 2Y38A 2ZMNA 3BGAA 3J4UH 1LHOA 2FCVA 3AL6A 4JC1A 4BA6A 4XDOA 1WA6X 2E33A 3WG4A 1S0DA 1WUVA 2AACA 2Y6FA 5H9QA 3FLTA 1WGPA 5FMBA 2W52A 1K3IA 2YC2A 2JD9A 3GF6A 3TNPB 4GMP3 4YSFA 2FDHA 3RWKX 5DPNA 1BMV1 1NCRB 1W2TA 5CU1A 3WG3A 1V0AA 2FQPA 1VMFA 3LFIA 1OFNA 1H9WA 3M70A 3W5MA 2JDMA 1SZBA 3HBKA 2TUNA 5CA6A 1GUIA 2O8QA 5C3PA 2XH6A 1XE0A 1AR91 2W91A 3I3QA 4XTMA 4IV1A 5DAVA 5JSRA 2ZHMA 5A7SA 4NWWA 3BTXA 5FOJB 3N9OA 2WSVA 4BYYA 4E9KA 1LHVA 3O1TA 2I74A 2EICA 2K9ZA 1CPNA 3BPSA 4UW5A 1GKBA 4CU6A 4ONUA 1TEIA 4A44A 2HWE2 4LTAA 3ZLIA 4P02B 4IW3A 1ODMA 4R9AA 3OTFA 5LY1A 2HWF2 2XJSA 4IV3C 1NT0A 5DUVA 3VD3A 3NL1A 3J8F2 4BQ1A 3PIJA 1N3PA 4RSUA 3AFGA 1XE7A 4QU2A 3U78A 2WZEA 4QXKA 3Q8BA 2W47A 3DKQA 3VZNA 4BH9A 3ON7A 5EYXA 1AR92 1QGLA 2VE1A 2AEZA 4ZHNA 2E31A 2HWB1 4GB31 2WN2A 4Y1YA 3H8OA 3BI3A 3NKTA 4E2SA 5FO9B 2ZEZA 1F9KA 3KCXA 4W6XA 4BQ5A 3O0VA 3ZIXA 5I8YA 1YC61 3HOBA 1T2XA 3VHOA 4JAAA 3MV01 4QPGC 4X6RB 3ME2A 1NUKA 2D3SA 2RDSA 1OFSA 2WINB 1F35A 1RUG1 3FLPA 3USUA 5L9RA 1RUH3 5JIUA 2X53S 4Y24A 3PUIA 2ARAA 4EV0A 3UESA 3IN9A 1A78A 5FUPA 2A6WA 3MPPG 4EROA 2FDIA 2FBEA 1GOFA 3ZFFB 4CUGA 1ULDA 1C4RA 1QJEA 3AYDA 1ZZ8A 1D7PM 1DGWA 2GMMA 3DXTA 3TRSB 5LB6A 4UOJA 4NRPA 3VZMA 2CAUA 1FNYA 3BCWA 5FTTC 1AX1A 1FOD3 2ZGSA 4KGQA 2YU1A 1G9AA 3SCHA 3ZYJB 1RMU1 3WF1A 4GAZA 3ZFFA 1IPKA 1ZZBA 3ZX7A 4A7KA 5DZFA 3L2HA 2Y6HA 4JVAA 2WWSA 5FY5A 4KG0A 5D21A 2VZOA 2G9FA 5DG1A 2D98A 3NSTA 1CN1A 5KXEA 5KXCA 2DV9A 3CZUA 1SCSA 3IMNA 4GA9A 3GJBA 4Q4W1 1ZBA3 4DOUA 1JOBA 3KGZA 2G9GA 2HWC3 4PDWA 4YGEA 3WV6A 2ZZQA 1UNBA 3UETA 1JZ6A 2SLIA 1DP0A 3B9CA 4F8AA 4IGOA 4NIAA 1YFUA 5T50A 3S57A 1ASJ3 1REFA 4MO3M 5I0RA 4IV1B 1W6OA 2C5DA 3M1HA 5IK5A 2JB8A 1NOVA 2GAUA 3M3QA 5L19A 2OQ6A 3NAPA 3E5QA 1L3JA 1VP6A 1D0HA 4OHXA 5D8AB 5T3NA 4YYOA 3ZDSA 5F6KA 2RDQA 4AI3A 2XVKA 3M4FA 4GQ7A 3JBG3 3KT7A 1V6JA 2ADDA 4AQ6A 4Y5SA 3POWA 1BVVA 1W9TA 2D5HA 3PMSA 4OI4A 3I2JA 4PDWB 3CZJA 3T4VA 2E7QA 3G6JB 1O5LA 4OUSA 5G05L 2YBKA 1RUC2 1QMJA 1RUI3 1W39A 2DVAA 1AR93 1G6NA 2VC9A 3ROUA 1FOD2 1W8TA 5FRAA 4Z92B 3IBMA 1U5ZA 4D6QA 1HRV3 2WYFA 4DY5A 2ZS6B 2ADEA 1DLLA 2PLV2 1S1AA 2I2SA 1LOAA 1UKGA 1W8ZA 2RR13 1DYPA 3O12A 3O7OA 2JG9C 1WLCA 5I8SA 3VDDC 4B7EA 2GNTA 4ES8A 1NQDA 3VBRB 3WW2A 3GZUC 2WT0A 3R0RA 5IATA 1O3RA 4LT5A 4H7LA 3I54A 4K40A 2HWF1 2D7FA 2OUHA 3FMGA 1GZ9A 2VQTA 4CXWA 4CEWC 1FPN3 1VALA 4ZZ8A 3QH6A 4XABA 4AF9A 1KFUL 4ZPIA 4YFZA 1ULPA 1UY3A 4XCAA 5EV7A 5FZGA 1FNZA 3ZR5A 4TSVA 2IFWA 4YM3A 3HAGA 4ZXEA 1AXZA 1LNSA 5JSOA 2NM1A 3MFCA 1W0PA 4OQ9A 1DCSA 4GMP0 1X8EA 4HOOA 3MF6A 1HRI1 3OSDA 1RITA 3ZSLA 1LGBA 3RQ0A 5LA0A 3MICA 5B4NA 4PIYA 3TEZA 1PVC3 3WDUA 1ENQA 3I4IA 3WT3A 4UW4A 2PHXA 3IAQA 3WNMA 1MEC2 2J42A 2VW1A 4AQ2A 1US3A 1TVGA 1PIV1 1PMHX 4CUBA 4DB5A 5CBLA 5LY2A 1SDWA 3RJRA 4WM8C 4CP1A 1IOAA 2OT7A 1SMVA 2Y33A 2XLGA 3PTRB 1UAIA 3C7OA 5T5PA 5LCWL 2WNVA 1YLLA 3J26N 3PLQA 4JGZA 1WA4A 5C8CA 4FTEA 4LEJA 5FAXA 1X50A 1BLZA 3GBWA 5DUXA 2ZBJA 1JYTA 3I2GA 2HJIA 4LBQD 1BVP1 1PGSA 2G19A 5FZOB 2GSYA 2YY1A 3WW3A 1XNBA 3RPQA 4AVCA 2Y0OA 1FT9A 1OA4A 1W6QB 2WQ4A 4P9JA 4L97A 2F6BA 1ZX5A 4NPRA 5F3EA 1SEFA 4CDXB 1GFF2 1N1VA 2GALA 4Q4Y3 5FXXA 1RTVA 1UOBA 1AXKA 1SDDB 3ITQA 1D2SA 3V0AA 4MGTA 3VZOA 1O4ZA 3AMMA 1ND3C 3OEBA 3VBFA 1A34A 3MIGA 2W5FA 1QWRA 3HR9A 1AR82 5GKAC 2L9LA 3ZFEC 3WNKA 4LHNA 4XJWA 5BYNA 1OOPB 1UOFA 2PQQA 4CCCA 4XJ8A 5IW0A 1ZBA1 4AW7A 4GALA 2VM9A 1Q5OA 1Q8PA 1OSGA 5SV8A 1WCKA 1RUD3 1JYNA 1S0JA 1UZVA 2GH2A 2RE9A 3AMNA 2B4KA 1KDKA 1CAWA 3M3IA 4LBJA 4XFIA 3PMEA 1J3QA 2XQXA 3UKVA 3BUCA 2ZGRA 1D4M3 1ZBE3 1IS5A 1ZRRA 2W95A 1W8HA 2WNOA 4PLOA 4NHXA 4NIHA 1MVQA 5CFCB 1OPMA 3VBRA 1WZXA 2PLV3 1CJDA 2JDAA 3D82A 2BBVA 2AUYA 3A4UA 1MQTB 3QH7A 3JB4C 2CNAA 2JDHA 4N9HA 4Q4X1 4CEYC 1XXNA 5FY4A 3M3EA 1ZYBA 4AFCA 3GM8A 1RUF1 1ZBE1 3SXWA 4WVVA 5BNNB 4FPLA 2K2SA 4K3UA 3CNAA 5FYYA 2FD8A 1W6PA 1EV13 2YU2A 3FUOA 4AI8A 3BYWA 5EHDA 3AZZA 3H0OA 3NV3A 4DEQA 4FFGA 4BIOA 3CJXA 1MACA 3VDDB 4IEXA 4E8CA 2JG9B 1XNTA 2LRPA 1UY1A 4DQAA 1V6MA 2P6HA 4HG6B 4LA2A 1AHSA 3VBOB 4JQTA 1QQP1 2PTMA 1GP6A 2VJXA 3VBUB 4EWDA 5JXGA 3WF3A 4Z2WA 2R061 1MS0A 3KHCA 4RR3A 2UURA 1HV0A 3OJBA 5C3SA 3BN6A 4NOTA 3H8XA 1QJX1 4FPCA 1S0CA 2NZ9A 1ST8A 3O1SA 3T1MA 2QDNA 2VZRA 4CPBA 3O1RA 3S6PA 4XBQA 4D6SA 2E7TA 2XJUA 1BK1A 3PIGA 5IAXA 5C3RA 1LB2A 2WFPA 2JKXA 4HKOA 3RI8A 2ZPXA 2XL7A 2X5IA 4CP0A 2UWBA 4I2OA 1DYOA 1SACA 2Q8CA 2RR11 3ZOIA 2UU8A 4XDPA 3PHMA 5ACA1 2ZGPA 4CCDA 4AGGA 2RMU1 4OHWA 4TWTA 4V2VA 3UKNA 4R52A 4AI9A 5KHIA 3HEIA 2NN8A 3OBAA 4XUPA 4FXGB 1PGL1 5FKCA 1PO22 3DCQA 5LASA 3AL5A 1JI6A 1HV1A 2PHRA 1S0IA 2VULA 3NKGA 4IEOA 4KNCA 4PBOA 1AYN2 1GNHA 1CD3G 1I5ZA 1IGOA 1JXNA 3PUSA 2QE3A 5IVCA 3EO6A 2C6SA 1C5IA 4IEUA 3KWVA 3W58A 3TEYA 1AL0G 3TYJA 4S2GA 1RL3A 4OYUA 2GMPA 3I3MA 3AFKA 4FPGA 1O3QA 4BQXA 1IZ3A 2VMDA 4Q4Y2 2IXJA 4DUXA 3BOWA 4UF0A 4CP2A 3VV1A 1AX0A 5LBFA 3WP5A 2XPJA 5EWSA 4YVSB 2DUOA 2YV8A 2DVFA 1AVBA 5FFOC 4PI2A 2VUJA 5DUUA 3KV4A 1EUUA 2ES3A 5IYYA 3LCPA 1PGW1 3P6BA 3V0BB 4M3CB 4I3PA 1JW6A 4P00B 2VZTA 4LOSA 5F32A 1ZRIA 5FV3A 1RUC1 3VKFC 2JKBA 2IXCA 2ZEXA 4RR3B 2OYZA 2W39A 2OPKA 3E5XA 3DYPA 5SV5A 2KD7A 4KH9A 4BHPA 4JGYC 3SCFA 5LZ6A 1H2NA 3ZYFA 4D69A 3LDRA 4A3XA 5A6ZA 2YHJA 1O59A 4B7KA 3M2MA 4CCJA 3SH3A 3H7YA 4NIIA 2NMOA 4XJ9A 5GZCA 4KGGA 4XE9A 4FCAA 3B00A 2WLPA 1BXHA 3VBFC 2LALA 1C57A 1R091 2XXZA 3URFA 2SBAA 5CAZA 3AMPA 1GR3A 2BNOA 1XSQA 4YZ1A 1QH6A 3WDTA 3RZGA 5FZ9A 1LHNA 4H55A 2BEOA 1VRH1 2JD4A 4IGPA 3MO4A 4SLIA 4ATEA 5KBFA 4O65A 1TZOA 1CAVB 2HEWF 1GV9A 4FT8A 5CVRA 3UYJA 2Z4FA 1BBT2 1VMJA 5FPUA 1ULOA 4CDXC 4I3GA 1O4TA 2ET1A 2VOVA 2B9VA 3KCYA 3NV2A 2MPFA 4DNYA 2WNUA 1J58A 1SLIA 5J36A 5IWFA 1X33A 4AVVA 4AQTA 4ITCA 3PL0A 5FWEA 1YJKA 1YQ2A 4Q5OA 3ZN5A 4COZA 3JCIA 1UOGA 3KT1A 3OGVA 1YCIA 1NLRA 4HN1A 2FDGA 5E8AA 1TG7A 1CAVA 2ZKLA 2MEV3 3APBA 3IPVB 4TXWA 5FZIA 1YQ8A 1JUHA 4LA3A 3D6EA 2ZHLA 1O6UA 2FDFA 3VBOC 1WW5A 4CUCA 3LF7A 1KJLA 5CFCC 1DBNA 4XACA 4XYXA 3EQEA 3JD72 4CEYB 1WW4A 2QCSB 5FYSA 4Z2AA 4FO9A 2QJVA 2R6QA 4W6YA 3WF2A 5BNPC 2BERA 1ZA7A 4B3NA 2R063 3MIFA 2B7YA 5IVJA 1Q8VA 3AZYA 5FDBA 4H3WA 2B45X 3RYKA 1AR71 3THDA 4DMIA 3AC0A 3DYOA 1CAUA 1MVEA 3B01A 3AP5A 2VCAA 2QQOA 2VOKA 3PJQA 2XVLA 2XOMA 3HD8B 4RD7A 4EN0A 1NX9A 1ZZ7A 3N36A 4GXLA 4L11A 5FZ8A 2QQUA 3MUY1 2D3RA 2JE7A 3DKWA 1RUG2 1O8SA 2AGSA 2WZR1 2XBO2 5FUNA 4JCKA 4LBOA 1RC6A 4RHV3 2B5HA 2ET7A 3ASIA 4MGKE 3WSOA 1V70A 1U5YA 1YI7A 2WO1A 1UXZA 4CSWA 1Q43A 2ZGTA 1K42A 4LBKA 4MV2A 4Q0VA 1GANA 3V56A 3GYDA 2WFF3 4DO0A 4Q4X3 2VAUA 2WAAA 4QQPA 1PM4A 4NN0A 3AXDA 3N9QA 5H9RA 5C9AA 4C0BA 1VB2A 4QHBA 5FYUA 1VBB3 2O8OA 2WT2A 1V00A 4OCTA 1VMHA 3C8XA 2Q0AA 5AVAA 2YC0A 5FZLA 1HXS2 2BGOA 3ZR6A 2A3YA 4BOWA 1XOYA 4YFWA 4URAA 4FPYA 1RB8G 4AL9A 5A3UA 5IK7A 1FMD1 4ZY9A 4I02A 3ZSEA 1TE1B 3HBZA 1DU3D 2A6VA 2PHDA 2WAOA 4OZXA 1ZZ9A 5FP7A 1HB1A 3U14A 3BTAA 2Y8KA 3AKTA 1UY2A 2DURA 1AJKA 5FZEA 2V72A 4JGYB 2D44A 4Q0SA 5EZWA 1PMIA 1S0BA 1YI9A 5H9PA 1W6MA 4Y4RA 4M3CE 4A4AA 1POV0 4LITA 3ENRA 4NE9A 2X09A 4MOAA 2I45A 4IL7A 3ZN4A 2W1SA 1ENSA 1MS8A 2X8KA 5FMOL 1RUC3 4IE6A 4M0NA 4BK5A 1H4GA 2LROA 2WZ8A 2UY9A 4OMCA 5CKMA 4FTBA 3H1YA 3ORJA 4P9WA 2QQWA 1MR5A 1SBDA 5DDJ1 4L9BA 1YO8A 4XXPA 2DUPA 1JTZX 3ZYBA 3POJA 5FQ0B 2AREA 4IE4A 1W28A 4E8DA 2YFUA 4JDNA 3ZFFC 4HBNA 4XMAA 1HB3A 2XKOA 3D0JA 1SBFA 4HVRA 4NHLA 5J48A 4MLOA 1QXRA 1TMF1 4Z8BA 1ZRCA 1DQ6A 1GQGA 2GNMA 5K0UA 5JLVA 4CDWC 4M4RA 4D8MA 1I1EA 5A70A 3TN93 4C91A 2XKPA 1UU6A 2RS13 4MXWA 3VBSB 1HRV1 2ZACA 4NIDA 3W9AA 1O7FA 1QJU2 1NA1C 4JZRA 2OXBA 3B94A 3VBFB 2WZPP 5GZFA 3HT2A 4GZ9A 5A3NA 3SEEA 5BNOA 3V65A 4A7ZA 1WCDJ 2HWD2 4RS5C 2GNDA 3ETPA 2JWPA 1VB4A 2RMU3 3KF5A 1XNCA 4QDQA 2IWGB 1OF3A 1UF2C 5FZDA 5HCFA 1W6QA 2HEYF 3AKRA 4OHYA 2WDBA 3THTA 4R9CA 4AHWA 5A33B 3C7FA 1GQPA 4JTNA 4UFHA 1I3HA 1GBGA 1MS9A 1PVC2 2ZGOA 3PURA 4TN7A 2RJ2A 2GP3A 4HZFA 4YZ5A 1MZ5A 5CIRA 4BQ3A 3CHXA 1ULGA 2QQJA 4XQ4A 1WW6A 2RG4A 4XILA 3BOPA 3MUZ1 5A3OA 5GLTA 3EXUA 4I0BA 3JBG1 4QGNA 1D0GA 4GWNA 3GCXA 1DLCA 5JVVA 1VBD1 1AR73 2JENA 3K48A 4AEDC 3N4MA 4CU7A 3FBMA 1L7QA 3LKJA 1LEDA 3AKSA 3MI8A 3DF0A 1HXS3 2JXAA 1ULEA 4XFGA 4TZDA 1V6OA 3H3ZA 2BOJA 4LBNA 5JR7B 1NE6A 1ACCA 3AX4A 4WM7C 1RUE3 3M8LA 2CTVA 2KM2A 2EXKA 5GLUA 1KGYA 4PF1A 1VBD3 5DXDA 2E32A 3MDPA 3T4HB 5J09A 3EJKA 4LK6A 1UQXA 1R1A3 2IVIB 5A6YA 4XF0A 2DVGA 3A0NA 1STMA 4Y20B 4CDXA 5C9AC 4WVMA 2G1MA 1YEWA 1ZRDA 2CHHA 1EP0A 1COV1 3VN4A 3E6BA 3WCSA 3RZLA 2HWF3 5CKNA 1N1YA 3FX3A 4KWLA 4GH4B 3Q8AA 1TNRA 5JAXA 4BQ4A 4M0HA 4CU9A 1OQ1A 4HFSA 2ZGLA 1JZ3A 4KBZA 1S0FA 2B39A 2VZSA 4D7TA 2CWMA 3F95A 3OD4A 3FE5A 1KXGA 4IV3A 1HQWA 5F1RA 5C70A 1H2KA 4Z82A 2WNVB 4YW2A 3FL7A 1P8JA 4JQRA 2PAKA 4YGDA 2CSGA 1SLCA 4QKBA 5FYMA 3AKQA 5LEJA 3UV9A 1BQPA 1RUG3 1LESA 3RVHA 1W05A 4UYBA 1OLME 4KBBA 3M3CA 1VE0A 4XOGA 1O4YA 2OZJA 4OZOA 2FZ2A 2P3YA 4LBQB 1K5JA 2XHNA 1IQAA 2HWB3 4GB33 5FK8A 3J7HA 4CEYA 1FXZA 1XQNA 3E1F1 3H50A 5FOBB 5IK8A 2CGNA 1G9DA 1W8FA 3E6CC 3KSCA 1YQ5A 3KVAA 4XUTA 4BXSV 4JDMA 1OVPA 1JODA 3DPRA 5JSPA 2BWCA 3DPRC 5KC5A 2VNVA 3ZYRA 4DXTA 1TQ5A 3ZN6B 1XNKA 1HB2A 2RM22 3SNMA 1XPWA 5BV6A 1YNAA 2JG9A 2GN3A 5A80A 3CEWA 2HWE1 3VBSC 3ZYGA 4LBQA 5CNAA 3HNMA 4PIZA 4B1LA 2XUEA 4GH4A 1K12A 3N9NA 4JKMA 2WA3A 2RDRA 1KRIA 4CU8A 1L7LA 3IDEA 4LLOA 4QX5A 2B8MA 5F2SA 4ZU4A 3S7IA 5KXBA 5K7PA 1W2AX 2BUKA 1MQTC 2RS11 3PJYA 4JKKA 5F5AA 4YG6A 4E4DX 3O1UA 5ACA2 2CU5A 3HQRA 2JDKA 2VVEA 2WNUC 5A7WA 4AVSA 5FIXA 4OFGA 3ZYPA 1TME2 4DINB 2RS33 2R043 1EPZA 2VBBA 2BTVC 3AB0A 3JQXA 1AXYA 4MXVA 2VW0A 2OW4A 2NPIA 5FY8A 3U11A 1WMDA 3W20A 2W9XA 5ABJC 1URXA 4P9GA 5CFDA 1CZTA 2VUAA 5H9SA 1HRV2 2J22A 1HRI3 1UYPA 2BOIA 2DBNA 3CJIA 4CCLA 4CDQA 4IE7A 2DVDA 3LA3A 4Y20A 4EWEA 4L0PA 5EXOA 3BTYA 1PIV2 4YWAA 4O9EA 4Z1VA 2O14A 1IS3A 2BV4A 2ZGNA 1IG3A 3MYXA 3VD4A 4TYSA 1HN1A 3SH4A 2DCZA 3I2HA 3LSDA 3VBUC 4CA9A 4MYEA 4MUVA 4BU2A 1H6XA 5JOZA 4BZ4A 1GU3A 3LEKA 2IXLA 2RS12 1Z7S1 3POSA 2H6CA 5T5OA 1EV11 1XYPA 4LIUA 3D8CA 4OI0A 3ZFGA 1ENXA 4KL1A 4UFMA 3ES1A 1UMZA 1BCXA 1IPJA 5EFUA 4QDSA 4PBPA 1UMHA 2R30A 2ZGUA 4IDZA 5E16A 3VZLA 1LRHA 1SFNA 1UX6A 1LJ7A 1OT5A 5DDJ3 1JHJA 3TNQA 1WD3A 4DXZA 3OYWB 2X29A 4KU7A 3DEMA 3TN91 1NCRC 4HSLA 3ZXAC 3GJAA 2YB7A 4GH4C 4YVWA 4YW1A 1WCUA 5FY9A 3PVBB 3DXUA 1RVF2 2BGPA 4JRAA 3VBSA 1N47A 2FCUA 2A71A 3WNPA 3O1MA 1AR63 1H2MA 2Y64A 1V9U1 3TOJA 4PIXA 2CDPA 2DWRA 4LLFA 4DY3A 1BBT1 5C5TA 2ZTNA 4FPJA 3NO8A 4DIQA 2ID4A 4MSVA 3O1OA 2JDZA 3MEPA 2AR6A 3BU7A 3ZM8A 2IXKA 3T2OA 1BHGA 1HX6A 4COYA 1E5HA 4NVPA 5C6CA 1NAEA 1COV3 4AI1A 1ENRA 1SPPA 4M4PA 1PZ8A 3U1XA 4ZS2A 4QGLA 1NZCA 4I30A 4R9BA 2QQIA 3J7LA 2J1VA 5CFDC 2EXHA 1CAXA 1RUH1 3M7AA 3KCCA 2RS52 3F2ZA 3I59A 5I91A 1WLTA 3FUQA 4JX0A 1J83A 2ARBA 1MPXA 2VCCA 2AENA 4QX1A 5FZFA 5FKBA 5F7UA 3MGUA 2MEV1 3HIFA 4ISQA 1MS4A 3QBQA 4W6WA 4GMP1 4YW3A 4Q1PA 5DAWA 2VR4A 1DZRA 2QDRA 2Z69A 1G9BA 1D4VB 1W06A 4WVZA 3J7NA 4YG3A 1LAJA 1EUTA 2R062 1OVSA 4KU8A 3H3UA 5LRRA 2A1XA 4AEDA 3EMRA 1M06G 2Y26A 2DFBA 1GNZA 3OY8B 4UWDA 4R8HA 3EB7A 4MGQA 1VIWB 2XG3A 1HB4A 2P3KA 1XNAA 3OGGA 2J1RA 4YGCA 4AEMA 1DHKB 5FZHA 2VBPA 1PO12 4WM7A 1JBCA 2GP5A 3KLSA 2XBO3 3GALA 2IFRA 4K21A 4MH0E 2PA7A 4N53C 4HL0A 2JICA 3DECA 5FREA 3ZXJA 2RDNA 1IHMA 2P2KA 2HEVF 3OCPA 2O0OA 4FP3A 4IV1C 5LATA 2CY6A 3OUJA 5LBEA 3WY6A 3W21A 1W2OA 3Q8CA 3WQBA 1PO21 4DEVA 3JUUA 1UX7A 4ATFA 1DG6A 2YGLA 2ZMLA 3NQHA 1PGL2 1Z7S2 3JD73 4MHUA 3K4AA 1NA1A 5FMDA 2YGMA 4IEZA 4BM8A 3I7DA 4QPYA 4DXRA 1W04A 3LGRA 5FBZA 2BFUS 4KWUA 4EN7B 5JCTA 2YZ4A 5A1LA 4UFLA 5A32B 4QQLA 3ECQA 2ETEA 3JB8A 4QT6A 4QB6A 1GP5A 4B4QA 1G8WA 1H8TC 3MBWA 4UW6A 5A1AA 2Y6GA 1W6OB 3VHNA 5DDJ2 1NZIA 2JDYA 4IUGA 4CRQA 1RUNA 1UIJA 3RWNA 1YIFA 1VBC2 3MZHA 4J1WA 2RJKA 3ZFGB 3AP7A 4FI9A 2QTWB 1E5SA 4IERA 4YGBA 5FYTA 2A75A 2WO2A 1YIPA 3RYRA 4R4ZA 1QNWA 1WKYA 2DU1A 1ALYA 1UYXA 2E53A 4YRDA 4ZXKA 2DCTA 1I9RA 4AOCA 4XURA 1EAH1 2HWC2 5L36A 1PGW2 1RXFA 4U36A 2E7AA 1C1FA 4OMDA 5L9VA 1DGWX 4S2HA 4YARA 1WBLA 1Q8OA 3TB0A 4CCEA 5DAXA 1AR72 4ORFA 3ILNA 3POBA 2WSUA 3J8F3 1JN2P 5FYHA 5GZDA 3SHRA 3T0AA 4LUKA 4B29A 4Q27A 1GP4A 5KHJA 1LKNA 4WVWA 3V0AB 4Y5Z0 3POIA 3ZXKA 2XDVA 4EN6B 4NHMA 1VBA2 4W4ZA 5BNNC 3KQRA 1WD4A 1LOCA 1XE8A 3OG2A 2AC1A 1J59A 3A22A 2X5IB 3LIHA 1OI6A 3OGJA 4D0QA 1OOPA 1R1ZA 4O61A 4HVQA 1CIWA 4HETA 2JIGA 2RVAA 3H42B 2VCMA 5EJ1B 3S5QA 5CB7A 1OKQA 1W6NB 2WA4A 2FZ1A 3W59A 3WQ0A 1JYVA 2W87A 3UL2A 5K0UB 1ND3A 3P5BA 1U5IA 2QQLA 1G86A 1ZRFA 4RA0A 2VGDA 4XUOA 3VKMA 1RINA 4YZ4A 1H1IA 2D40A 2VVDA 4OHZA 4HLTA 1Q8QA 2HWC1 2XJRA 4N43A 5A1FA 1PO23 2FMYA 3K75B 1CR7A 2PN5A 5GLVA 1VAKA 4LKEA 1UZWA 1X36A 1IG0A 2JECA 2TNFA 2VBDA 3T0BA 3VBRC 5I8TA 4QPWA 3NW4A 2YPDA 4MGIE 2BP6A 2R49A 3AJZA 3MHZA 4NAMA 1V9U3 1O5UA 3VHRA 1N3QA 1W6NA 5HXVA 4Q29A 1MZFA 4CDQC 2VMFA 3WX5A 3CJIC 2H0VA 1J1LA 1N3OA 2R16A 4LORA 5C4WA 2GZWA 3UGHA 4FBFA 5JXJA 5LA9A 1DFQA 5FPBA 1RHI2 4QPIB 5JWPA 4BLJA 4LHKA 5FZ3A 4DXSA 4I09A 4JV4A 5FR3A 2VOWA 3ZXDA 2VMEA 1PVC1 4XEZA 1WMXA 3AKPA 2VO5A 2XUMA 4PCRA 1ZA4A 5GJ6A 3WHTA 4BQWA 5HBAA 4ZKTB 1LULA 5JDBA 4JHTA 1A3KA 1W0OA 4QKDA 4ASKA 2XJTA 3B69A 3U75A 4FPEA 3GXUA 3LE0A 4ARXA 5FP4A 1NKGA 4NHKA 3UGGA 2CAVA 1H9PA 4XF9A 5F3GA 1VRH3 1YJLA 2QVSB 4AHZA 4CDWB 4HVOA 3GBFA 1T6GC 2VZQA 4QX2A 3O1PA 3OPZA 5FYBA 2ZHKA 4C1WA 1X8MA 5IFPA 3WQ7A 2HLEA 4NIGA 4V2WA 4JRLA 2B42B 2HH9A 4JTOA 2BBAA 3PU3A 5GZEA 4AEJA 3M3OA 5BNOB 2K0GA 4XZPA 4MG2A 4QM8A 1ND2B 3LEGA 1VBD2 1BBT3 1QJFA 3MPBA 2OVUA 1K5MC 1QEXA 5I0UA 1OD3A 2QQKA 3I2DA 2PHWA 3T2TA 5JZGC 4P9LA 2X05A 1X9TA 1FATA 5IVVA 2BU9A 2J1TA 5A3PA 3KS7A 4FOVA 5A3WA 3CKHA 3WOGA 3LFMA 5AC93 3ZMOA 4LMFA 1GZWA 3O0WA 3WD5A 5F3CA 5EYYA 1CWPA 4BMEA 5FY7A 5I0SA 5L7OA 3PTYA 2RS51 1QHDA 3GZAA 1AYN3 2Q5TA 2Q8EA 3LAGA 1MZEA 5F2WA 3U07A 3DL3A 1RYYA 1YUDA 2WWUA 2VUCA 3VZKA 4Q4V2 1PO13 5L7OB 3R4SA 5GLWA 4LE4A 4QX0A 3VD7A 1JZ4A 3ZMNA 2WIIB 2HWD1 1Y9QA 1VAVA 4YW5A 3R4UA 4JHZA 1H8TB 4QKNA 1AJOA 1NY71 1AF9A 4COWA 1JS9A 3OF1A 1LOBA 1W6PB 4P9XA 3RJ2X 4LO7A 1H2LA 5GZGA 2BZDA 1RVF1 3KT4A 3USUB 5A3MA 5IHRA 1TME1 2Y6LA 2XLAA 5D8AC 1W8NA 4J25A 4XFFA 5FZ4A 1VRH2 3U4SA 2ZA9A 4IQPA 4JKLA 4Q4Y1 2D6KA 2MHFA 2FCTA 2P3IA 4H2AA 3RZZA 1IKQA 2EAKA 4N9IA 1UIKA 1VLNA 3AYCA 1RHI1 3K3NA 4HANA 4CCNA 3VKNA 2ATFA 1UYZA 1G9FA 3KVBA 1RHI3 4RHV2 4NRQA 3SKVA 5E88A 3ZN6A 3WF4A 2GC1A 4RFT0 1L7RA 4CP9B 3R4DB 5J3UA 4LUMA 4FPOB 1SQ4A 1EV12 1QOOA 2YPJA 2R0FA 4XJZA 1BZWA 1QDCA 3OYWA 5IK4A 5FYZA 2RHPA 1EYBA 1J3PA 5DAPA 2WZR3 2A6YA 3FHIB 3P3PA 1PX4A 2WFF2 4AQSA 5FO8B 1W9WA 4GWMA 3TEWA 2RM21 4CDWA 4E4SA 2BRTA 1IKPA 3GCWA 3QACA 2PQSA 3ZXFA 1QF3A 5I0TA 3WF0A 1S0GA 3IKWA 1W03A 4YVSC 1B09A 2YFZA 4TLGA 3H8RA 3BPZA 3JQWA 2GN7A 2R071 3MIHA 3CF6E 3IZOA 1UXXX 1PK6A 4XFAA 1CQ9A 1D2QA 2QQMA 2P34A 2V73A 4MXWB 1AZDA 3P3NA 1QXJA 5LA1A 1W2NA 3E6DA 4CDUB 5ISLA 4BWOA 2D6LX 3O0XA 1H0BA 1W0NA 2WBKA 4HXCA 1DQ5A 4A2UA 1RMU2 2RJLA 1VBA1 2A6XA 4LR4A 3RMYA 5F37A 5JMCA 5CADA 4GIQA 5FPZA 1DGLA 1UPIA 3AMHA 4Q1RA 4QPGA 3T2PA 4CVUA 1RUJ3 4CDQB 4E27A 1Q56A 3K3OA 4C1XA 3I2KA 5CKQA 2DVBA 4JDOA 2VCBA 1UZ0A 2Y34A 4OUMA 1H6YA 5DUWA 4LK7A 4QPIC 2C9KA 3FLRA 3GHNA 4FQ4A 5T5JA 3VKLA 2ZMKA 1CZVA 1TMF2 2VMGA 4B8EA 2D6NA 2C4XA 5BUVA 1W8WA 1BMV2 3RNSA 4AXOA 4FFHA 4OI1A 3N7LA 4XDQA 1YWKA 1VR3A 4Q0QA 4UFIA 1YYNA 4WM8B 2LTNA 1SLLA 2E6VA 1F5JA 1PZ9A 2UY8A 3WQ1A 2BJSA 1XB9A 1R081 5J96B 4RR3C 1YQCA 3CLPA 3FFQA 1F2NA 2KA3A 5FJHA 3DPRB 4L8QA 3VDCA 5FP9A 2EIEA 5C5UA 4QX3A 3TN92 1UMIA 2EIGA 5LA2A 4XJAA 1W8OA 3MIDA 3L9JT 1R093 5FYCA 2W2IA 1UYYA 4XC9A 5FP3A 4DUWA 3ES4A 4QMAA 4YZ2A 4H7MA 4N43B 3ST7A 3SEPA 4BISA 4O9GA 4WZCA 4UXAA 3IIIA 3THCA 3FC0A 4EJRA 1WW7A 1U12A 2V4VA 1DF0A 2YMZA 3G7DA 5F5CA 5FZMA 1GZTA 3WUCA 1W3XA 2OZ6A 3VDBA 2RS31 5J7MA 2GMEA 3UNPA 2XR4A 1S2BA 1VBB2 4HSJA 5LW9A 1RUF2 4A6OA 2ZAHA 5JR2A 2RMU2 5C4WC 2WQZC 3BIEA 1AUYA 1KFXL 3N9LA 2G9ZA 4PDWC 5HPOA 5HV4A 3CL1A 5BNPB 4AYUA 1HW5A 2VPVA 5FPLA 1W9FA 1N1SA 4LQRA 2UYBA 4G9SB 1W90A 3ZDVA 2RS53 3VD5A 1RXGA 3D3AA 4IE0A 2XONA 5FP8A 2XWJB 4AZZA 2VD7A 5BNPA 3KF3A 3O1VA 3PNAA 4XF1A 2DYCA 1UCXA 1I6XA 5JXIA 2XVGA 5FZ7A 2VMHA 4HPKA 4M01A 1OH3A 3PVOA 1OQEA 4JGZC 4C90A 3CDZB 5C8CC 3W5NA 4AVBA 1SPPB 4DFSA 1HXS1 1OURA 2WO7A 2BFUL 2XMLA 3E5UA 2YROA 3HJRA 4OHVA 4CCMA 1UZYA 2VU9A 2Q8DA 2ZGKA 4MGSA 2XQRA 5FY0A 5M0TA 4IEQA 3ZXLA 2D6OX 1F15A 2XBO1 4XQDA 4E4ZA 4PQQA 4B1MA 4NPMA 4BQ2A 3LEMA 1NLSA 3JXSA 1KJRA 2YC4A 3PUQA 1W9YA 4YW6A 3WNXA 1OQDA 3DUIA 3NNFA 2RR12 4AHXA 1X82A 3PU8A 4XFCA 5EJZB 5K9YA 2D6PA 2D5FA 4I01A 5IVYA 5J98B 3SMHA 1GLHA 5FLHA 4AGRA 4COUA 1B35B 1LECA 2PMWB 3OPTA 4XCBA 3JBG2 4RL7A 5AFEA 2WC2A 3CMGA 3D5OA 1POV3 2HWB2 4GB32 5DQ0A 3NAPB 2VQUA 3LD8A 1S55A 4BK4A 4CEWA 5KR7A 3NJXA 4M3CF 4NR1A 3WDVA 1A8MA 1D4M1 3UKTA 1OH4A 3HVDA 2CYFA 5KHHA 3FHQA 2AYHA 3CIHA 3RZMA 3MLKA 5KXDA 4W8JA 2GH8A 1YFXA 1XSRA 1XNDA 2RM23 2QZ3A 1PZ7A 2JG8C 1S2EA 4P9IA 4CPBD 5FYVA 3IT8A 2WS93 5FY1A 3KHBA 4LBMA 1ULCA 5FPVA 1DGRA 1DQ1A 1ODNA 2P17A 5D2AA 5KHKA 5F6LB 5ABJA 1LOEA 3LSEA 3USSA 3HNYM 3RFRA 4PLMA 1LENA 1T6BX 2W68A 3OY8A 1Y43B 4K1YA 3WEZA 2EIBA 1W9SA 2EXJA 3QOPA 1OKOA 3VBHA 3CU7A 4XVHA 1IPSA 4A6SA 1OA2A 1JZ5A 5F5QA 4BLIA 4N53B 4XTPA 5FZ6A 1C5HA 3NMBA 2ORZA 4N7UA 3KV5A 4QDRA 1FX5A 1Y9MA 1SLAA 1RUF3 4Q0UA 4R4XA 2YYOA 3AMQA 3AJYA 1OOPC 4AI2A 3LQCA 1PMJX 1VRBA 4XQWA 4YG0A 2Y6JA 3MF9A 2ZX3A 5KHGA 5DZEA 1XU2A 3D0SA 4GWJA 2ORXA 1NLQA 2TEPA 3J7MA 4ZONA 3PVEA 1SFYA 2OQ7A 3K77A 5JPNB 1J1TA 2W08A 1CX4A 1UY4A 4FXKB 1WMEA 4B4RA 4BE3A 1NG0A 1FOD1 5A6XA 4UF0B 3T1LA 4RS5B 1H1AA 2IZWA 5T5LA 1DQ2A 2AEYA 2I07B 2HWE3 4FVVA 1JOPA 1CAWB 2A70A 1K45A 3KB5A 2WFF1 4L92A 4MADA 1QJX3 4K1ZA 4Y3OA 5GLZA 3WXPA 1CVNA 5EIYB 1QDOA 2XJVA 2G4IA 1Q8SA 3OGRA 4UW3A 4UFJA 5ACA3 3OD0A 1XYOA 3B02A 5CZKA 2RS32 5DAQA 2VTFA 1C8M2 4XW3A 5FMCA 2C9AA 3RYPA 5IVFA 1LOGA 3HN1A 2CGOA 4RQPC 3POFA 1TMF3 2GC0A 5JOYA 4WBBA 5BPXA 1VBA3 1CONA 1KD7A 1WBFA 4N43C 3ILRA 4Q4V3 4QAWA 1NA1B 3PUHA 5FBJA 3ZXGA 4A45A 3VB9A 1QY4A 2JX9A 2H6BA 4AFBA 4XF4A 1JHNA 1LR5A 5FXZA 4CYDA 2Z2SB 2XJQA 5F9TA 3H1MA 4QXBA 5HCBA 4O7XA 5A6QA 3RSJA 3C7EA 1QNYA 2BQPA 4BCUA 1HN0A 4LHLA 4YPJA 2AH2A 3VBOA 2WNUB 3FN9A 2VECA 2XL9A 4TTGA 1CGPA 3T2QA 4AK3A 1ZM1A 4LBLA 5DABA 2J1EA 1QJU3 5TSWA 4QPIA 1Y9GA 2XLFA 3NVCA 4IEPA 1XJAA 4WM7B 3BTZA 3ELNA 5BNQA 2CL2A 1DZQA 2HBTA 1KS4A 4I0WB 5K4LA 4INDA 3VBUA 2A3XA 2EIDA 5I93A 5KC6A 2A7AA 4Y33A 3E97A 4NROA 4S2FA 4A3ZA 1NCRA 4IEVA 3TBDA 1REDA 5K0UC 4DUVA 5L73A 1B35C 4LXLA 5J37A 3WW1A 4DS0A 5C9AB 2Y6KA 1I5PA 1JYXA 4KG8A 1FPN1 4X8NA 5T52A 4AFAA 4AEKA 5DG2A 1OLMA 3VHPA 5C3OA 2Y60A 5A3TA 1YQ6A 3VLBB 3WP3A 1C8NA 1AX2A 2J1UA 3MIBA 4META 4AGVA 4LO5B 3UT0A 3AZWA 2ZX1A 1IQDC 4BXFA 3AK0A 4ISRA 2NMNA 5IUQA 1QJX2 2R072 2VZPA 2XWBB 4HT1T 5FXVA 4M00A 1SBEA 3ACHA 4J6GA 1JYWA 1F31A 1E57A 3EHKA 1OBNA 3T3YA 3GDBA 1W6MB 3MLLA 2DFCA 4Y22B 1MS3A 3HNBM 5IFTA 4FOYA 5C3QA 3B7MA 1Y4WA 2ZCWA 4QWNA 1VAMA 1QU0A 4ES9A 2BVVA 1SCRA 3Q8EA 2ZX0A 3MW3A 2BPA2 3RDIA 4BJ0A 3AZXA 1PO11 4FOQA 2JE9A 1J3RA 4H14A 1CPMA 2R7EB 5J1XA 1CESA 1PNGA 1U5XA 2AZ5A 2E51A 1UPSA 2W46A 2WUHA 5FYIA 3ZXEA 4QQOA 3UGFA 4RQPA 2QFEA 3PDQA 3TAYA 2VL4A 3VZJA 3NJVA 1PIV3 3LWCA 3VL8A 3LPFA 2Z5WA 1BK0A 2MNGA 4CUAA 2W1UA 4MHRA 5BY5A 3IWZA 5D8AA 1V6NA 2WNVC 1W2UA 4KMQA 1OD5A 1TNFA 5GALA 1XC6A 1DDLA 4RGGA 2ILMA 2P3JA 4LE3A 5ERLA 2NP0A 5C8WA 1YRZA 4YM2A 1NQJA 2WYSA 4D6RA 2QBXA 1ND2C 3IB3A 3K46A 1KEXA 1LGCA 3WZ1A 5LK7B 2DU0A 3Q8FA 1LOFC 3I3DA 1D4M2 5LWBA 1Y3TA 1AL23 1QJY2 2VVFA 1SFPA 4URTA 4Q8LA 2FDJA 4Y1XA 1Z0HA 1YHFA 2ZX2A 4F7ZA 2VOTA 1MS5A 1N1TA 4DRVA 5FWJA 4GD4A 4BB3A 3OB8A 3WNOA 3ZYHA 3HQXA 1GQHA 3ACLA 3WDWA 4LNVA 5A33A 4QKFA 3AP6A 1VPHA 3PUAA 1RJ8A 2ERFA 2V4AA 4GJYA 4QD2A 3RS6A 3IMMA 3TWIA 4E2GA 1LCLA 3VD9A 2D6MA 2DCJA 2R073 3N35A 4QX8A 1NCQC 4GULA 3KV6A 1F4AA 5L7OC 2C1FA 1PK6C 3FBYA 5DZGA 5BNOC 1W8UA 3B93A 3FZ3A 4KI5M 5KWRA 3WINE 4X6QB 4LHSA 3V64A 1UKRA 1ND3B 3OEAA 2VUDA 4IE5A 4LIVA 2WNEA 1X7NA 1YFWA 4AWDA 2JDNA 3I2OA 3CO2A 3NNGA 1E5RA 1VBC3 2WWJA 3IM0A 3INAA 5ANQA 1ULFA 2DTYA 3HPNA 2EVXA 4QM9A 4ZU5A 5D1IA 2VW2A 3NV4A 3MLJA 5HCAA 2N7GA 3RGBA 1AYN1 1FYUA 1CX1A 3FHAA 1RUE2 2Q1FA 2IC1A 4UT5A 3WVJA 1UU4A 1WCSA 2DCKA 5JI7A 4D94A 1RUOA 1ASJ1 4QB2A 1PNFA 2P37A 1RUI1 3LDBA 4XF3A 1QKQA 4OVEA 2ZXQA 3JZVA 2PHUA 1KS5A 5BXXA 1BYHA 1REEA 2NLRA 1SG3A 3D4KA 1J84A 1GWKA 3AXEA 3IDBB 2JJ6A 3AYEA 4QB1A 3ILFA 1UW8A 3WDYA 1O3TA 4FP2A 4UFKA 1HIXA 5A32A 1RUI2 3O5SA 5IVBA 3J9SA 3ZFGC 4C8DA 1UOJA 4FOWA 4K7JA 4XAAA 1OA3A 3IPVA 5HI0A 1YXWA 1RUE1 4HK8A 1G7YA 4PQ9A 3LDKA 4HMZA 4XAEA 1UWWA 2NYYA 5F5IA 1QOSA 3LA2A 2O1QA 5JIAA 1SHWB 4A42A 4NHYA 1W3VA 3WUDA 1S2KA 1EPWA 1MS1A 1V6IA 2MEV2 3GZTB 3K2OA 4IEYA 3MIEA 1RMU3 2VNGA 1QQP3 4QX7A 1GWMA 1LU2A 1AR83 3ATGA 4WZFA 5FZ1A 3S5AA 4R9DA 5B4XA 2WN3A 4MZUA 3NNJA 4KWJA 1FI2A 2GNBA 3CBNA 1GYKA 3SKJE 2VNRA 1A8DA 1AR61 1RUD2 2P1BA 3NJZA 4OQ8A 3NWKA 1C28A 2OKXA 3AP9A 4N8MA 4A7YA 4CDUA 4GKYA 2PYTA 1AYM2 1H8TA 2W3JA 1QXPA 2PFWA 4LULA 4Q4W3 4FSJA 1ZBE2 3L2YA 3ZKUA 5FLIA 5DMYA 1O91A 4FAGA 3GGLA 3ZO0B 4K8FA 4D7YA 3I3EA 1V9U2 2CV6A 2WABA 1BJQA 2C24A 4UBHA 2PHLA 3GZEA 1S0EA 2VMCA 4HONA 1JZ2A 2JIJA 2KXLA 4L99A 3H9AA 4Q4V1 3ZKYA 1VBE3 4P14A 2GC3A 3OUHA 4XZUG 4BMBA 2KR2A 4EE2A 1CZSA 2EF6A 2XGXA 4QXHA 5LBBA 1HDKA 2EAAA 2VZ1A 4F83A 1UN1A 2VTXA 2YG0A 4IV3B 2C26A 4LO4B 3QD6A 1GZWB 1H8VA 4BQYA 2DCYA 5LRSA 1CJPA 2LS6A 3C3VA 1H4HA 4FFIA 3POYA 5F39A 2ZHNA 1NYWA 4MX3A 5CEHA 3HT1A 5C71A 4CP9A 3V0BA 4AAPA 4CTEA 4S2DA 1FAYA 1LGNA 4HPKB 3GNEA 4GJZA 3CJIB 4E4HA 2QNKA 2TBVA 1WWYA 1AL21 3JU9A 4K9SA 3LEIA 4IESA 5FJKA 4EZHA 2X10A 3NNLA 5A7NA 1TME3 3ACGA 4RYDA 4QPGB 3WW4A 2W1WA 1HJGA 4RHV1 4PT6A 5T54A 2VQ0A 3ZPYA 2JB4A 2PAEA 2WRAA 5AFBA 4AR2A 4ZZ5A 3HWJA 1EAH2 3LA7A 4XIOA 5EP9A 1DZTA 1ZNPA 3I97A 3MW2A 1MQTA 2OPWA 2ARXA 2VZ3A 4PI0A 4Y1UA 1PK6B 1BEV3 1H1MA 2WKKA 2WLQA 2NQYA 2Q30A 5JMOA 3N7MA 1ND2A 3R6SA 1HQLA 4OUEA 4CXYA 2OIIA 5K8SA 1BEV1 3SISA 3QLQA 4LO6B 4J1XA 3SQOA 2VMIA 1PVXA 3KM5A 1GNYA 4XBNA 3S30A 2H0BA 2V5DA 2E26A 3ZVXA 4QQ2A 5AC92 3UJQA 1AYM3 2HKXA 2R041 3IDCB 3KD4A 3N7KA 2R1DA 4XBLA 2E9QA 4PLNA 4QHOA 3ZSMA 4Y1ZA 2WT1A 1OUSA 1A6CA 4XXAA 4RGKA 5L9BA 2UWCA 4UBGA 5FMOS 3AM2A 1SLTA 4EZ4A 4XUNA 4XETA 3N9MA 5JPMB 3ALQA 2W1QA 2WO3A 4QXCA 3RG0A 1Z78A 1POV1 5EJ3A 3SC7X 1HRI2 2F4LA 1NCQB 1VBE2 1F5FA 2W0XA 4BIFA 1IS6A 1NY72 3OPWA 3OBTA 2GDFA 1PHMA 2VOXA 5CFCA 3N9PA 3O14A 2YXSA 1QJZA 4QGMA 1JUIA 3LPGA 2A5ZA 2D93A 2R32A 4OLLA 2WZR2 1JU4A 4YM1A 4EWAA 5E89A 3DN7A 3I2IA 2IXHA 1JZ7A 2FDKA 1UL9A 1S4CA 3S7EA 3RZHA 1QJY1 4ZU7A 5IT6A 1QOTA 3SCGA 5BNNA 1X9PA 2HWD3 4N7IA 1JH5A 3MV11 5A7WB 3I49A 3AVRA 1LHWA 3NJYA 1JYCA 5F3IA 1ASJ2 5FZBA 1GOHA 3U0ZA 1WCQA 3VKOA 3GBGA 4AAXA 3SH5A 1R082 1IS4A 5IJRA 5CISA 1EAH3 4JGZB 5C8CB 3A21A 1UU5A 4CCKA 5JZGA 5FZCA 2HBUA 2P5BA 2E63A 2LW8A 2QUOA 3ACIA 2IUWA 3DYMA 2VY0A 1GSLA 5FZKA 1WMFA 1XU1A 3BB6A 1UZZA 5FPAA 4IETA 3POEA 5DN2A 3SITA 1KQRA 1RUJ2 2VXJA 1ZZCA 3NRUA 4K8RB 2JEMA 4PJYA 1NCQA 2QZ2A 4YZ3A 5CG8A 1RUD1 1V6LA 2ZKNA 1AR62 1KITA 2QKDA 1O8PA 3WCRA 2DTWA 4UI9L 2Q4SA 4XHBA 1OLQA 3EBRA 2ZEWA 5FZ0A 4P08A 3K4ZA 5HCHA 1COV2 1OC1A 3T09A 1UY0A 2J1SA 4CE8A 2VQAA 4B4PA 2DF7A 4GWIA 4AE2A 1QH7A 4Y4YA 1VBC1 2A73B 1XRUA 5E1RA 3LZZA 4CEWB 3WP6A 4DZGA 1JZ8A 1BEV2 4RFRB 2OS2A 2FMDA 4WV8A 4KQ7A 1GMMA 2PHFA 4RN5A 1F4HA 3AYAA 1RIRA 1MEC1 4YVWB 4YNIA 5JI9A 1OUXA 3I8TA 5A7OA 5LK5A 4FFFA 5C7GA 2BNNA 1W99A 1R1A2 5FLJA 5B2GB 1LU1A 2ENRA 4A41A 3SLIA 4K20A 1F8VA 3LIGA 2WQ8A 2BVBA 3ETQA 2J1AA 5FXWA 4FPFA 4FAHA 2GU9A 1PM7A 1B35A 1HJFA 4P5YA 4YW7A 1VJ2A 3VBHC 2OA2A 3J8F1 4D3WA 4OI2A 4YW4A 1UO9A 2VZUA 4I0AA 3WLUA 5JOXA 4IXLA 1AL22 1QJY3 5G04L 5APAA 2OX0A 1K5MB 3H1WA 3MW4A 4E2QA 2W92A 5JZGB 1R083 4ASMB 5IVEA 2B46X 1YFYA 2UYAA 4WVMB 3WG2A 5FQ0A 3NV1A 1U0AA 3B9IA 4N53A 5FK7A 1R1A1 2VNOA 3ABZA 4IGQA 4Y1VA 1POQA 2BWAA 4UAPA 5LEKA 3I2FA 3LB9A 3R05A 2BNMA 2RV9A 5EPAA 2D43A 1C3HA 3WNLA 1OF4A 5AVPA 3LOIA 1M4WA 4IEWA 1OMIA 4M3CA 1MZ6A 1CAXB 3VDDA 5AC91 3GHMA 4LJHA 2ZAAA 4NPLA 3ZPOA 5ABJB 3KV9A 1FMD2 2HYKA 5GM0A 4RGAA 1K5MA 2LM3A 2Q1MA 1ZBA2 2QQVA 2ZABA 4HK9A 1NXMA 2D3PA 4N90A 3VGIA 2DDUA 4KWKA 5I0DA 5FCCA 4RS5A 3DGTA 2ZOEB 3FFZA 5LBCA 4YLZA 3VDAA 3T30A 1G9CA 3HMYA 3T0DA 4G3YC 3ZFEB 3I59B 2DBIA 3KZ4C 4XPVA 4CCOA 2VTXJ 3BU0A 1JOJA 1DIWA 3C7GA 4AVAA 4BPZA 3WHUA 5A7PA 2HYXA 3N3HA 4XFHA 4NUBA 3H8UA 3WNNA 1PX3A 1VBE1 5T55A 1ZZ6A 2ZEYA 1GOGA 3FJSA 1NE4A 4V1PA 4RQPB 3WP4A 5F8PA 3IIAA 3OUIA 4NWVA 3U10A 1E5IA 2V09A 2YBPA 4FQZA 4NJ4A 4TLFA 2PHTA 3Q9OA 4LOTA 4HKLA 4W50A 2P6CA 2QQNA 1XBFA 3BALA
chains in the Genus database with same CATH topology
4K6BA 2ZX4A 5JOWA 4L2NA 4NO4A 4WM8A 2C0ZA 5C33A 2F4PA 2WJSA 3AZVA 3U4XA 1WLWA 4U2AA 2D97A 2UWAA 4OULA 4XJUA 2EALA 4P5HA 3JD71 3MFAA 1KDMA 4DRRA 1RGSA 3OBRA 2OUJA 4DPNA 3WG1A 2CWSA 2FHRA 3BIWE 4P9YA 4Y22A 1DGRN 1VBB1 3ZYIB 2VG9A 2VXRA 4AG4A 1AYM1 2WL1A 1C8M1 1H30A 5CFDB 4Q4X2 2JG8A 4CDUC 3ZSJA 2ZJCA 2V5YA 2X5IC 4FPHA 3RMXA 3WR0A 3ZFEA 4C0HA 2CGPA 1DQ4A 2VH9A 4YM0A 1FV2A 2Z79A 1ONAA 3A0KA 4XMIA 2XHKA 1ZREA 3X29B 1APNA 3QCWA 1Y7BA 4AI0A 2A6ZA 4W65A 2B9UA 2WS92 2PLV1 3K51A 3UK9A 2EXIA 3NAPC 3VBHB 4Q26A 3DV8A 4XHXA 2YUEA 1RJ7A 1FV3A 1EY2A 2Q1ZB 4F3JA 1Q3EA 1HLCA 1SLBA 1MEC3 3PVNA 1FMD3 1WLDA 3ZSKA 5FPXA 1GICA 4XIKA 1XYNA 3WDXA 3KMHA 1JYIA 1BKZA 2WS91 4FTSA 4D7SA 2A3WA 4EN8B 1O3SA 2JG8B 2BYVE 1QJU1 2XB6C 4ASLA 1NXD1 1HQNA 4AFMA 2EA7A 4Z07A 1UD1A 2BGCA 4HN0A 4JGYA 1RUJ1 1LEMA 4YVWC 3LOBA 4EN9B 4LO8A 3FWEA 2YDEA 5A3LA 2ZGMA 1OPOA 2R042 3VUOA 4COVA 3RI9A 1LHUA 4PF5A 4AFDA 1LOFA 4GKXA 3VL9A 4CZSA 1OLRA 3KGLA 2LUWA 1GZCA 3B5LB 4Q0PA 1OHFA 2ZZJA 4Y26A 4MGYE 1LTEA 2Y0IA 4XFBA 3N7JA 3RRDA 5C4WB 2XJPA 2R0HA 2IXIA 2Z42A 3BODA 2R1BA 1DYKA 1ZVFA 1C8M3 1CAUB 2PAMA 4MVTA 4Q4W2 4AHYA 3B3QE 4AVTA 2ZGQA 3C2UA 4MGZE 1AR81 4SBVA 4HKWA 4G4FA 3AP4A 3S0MA 2Q8OA 5FO7B 5CG9A 3H7JA 1DQ0A 2PELA 2GC2A 2BW8A 1QQP2 4AEDB 3ZIWA 1V6KA 4Q8KA 1R092 4YVSA 2DUQA 4Q2FA 3UJOA 1Z7S3 4QQHA 3THPA 1RUH2 2QQPA 1LODA 4X8PA 4FPKA 1FPN2 1RVF3 1HKDA 1C1LA 2Y38A 2ZMNA 3J4UH 4JC1A 4BA6A 1LHOA 3WG4A 1S0DA 1WUVA 5H9QA 3FLTA 1WGPA 2W52A 3GF6A 3TNPB 4GMP3 4YSFA 1BMV1 1NCRB 5CU1A 3WG3A 2FQPA 1OFNA 1H9WA 3M70A 2TUNA 5CA6A 2O8QA 2XH6A 4XTMA 1AR91 5JSRA 4IV1A 2ZHMA 4NWWA 5FOJB 2WSVA 4BYYA 4E9KA 1LHVA 2I74A 2K9ZA 1CPNA 4UW5A 1GKBA 4ONUA 1TEIA 2HWE2 4LTAA 4R9AA 3OTFA 2HWF2 2XJSA 4IV3C 5DUVA 3NL1A 3J8F2 4BQ1A 1N3PA 4RSUA 3AFGA 1XE7A 4QU2A 4QXKA 3VZNA 4BH9A 5EYXA 1AR92 1QGLA 2HWB1 4GB31 4Y1YA 3NKTA 4E2SA 5FO9B 1F9KA 3KCXA 4W6XA 3O0VA 3ZIXA 5I8YA 3VHOA 4JAAA 4X6RB 4QPGC 3ME2A 2D3SA 2WINB 1OFSA 1RUG1 3USUA 3FLPA 5JIUA 1RUH3 2X53S 4Y24A 4EV0A 3IN9A 1A78A 2A6WA 3MPPG 4EROA 2FBEA 3ZFFB 1ULDA 1C4RA 3AYDA 1ZZ8A 1DGWA 2GMMA 3TRSB 3VZMA 2CAUA 1FNYA 3BCWA 5FTTC 1AX1A 1FOD3 2ZGSA 4KGQA 1G9AA 3SCHA 3ZYJB 1RMU1 3ZFFA 1IPKA 1ZZBA 3ZX7A 4A7KA 5DZFA 3L2HA 4JVAA 2WWSA 4KG0A 2G9FA 5DG1A 2D98A 3NSTA 1CN1A 5KXEA 5KXCA 2DV9A 1SCSA 3IMNA 4GA9A 4Q4W1 1ZBA3 4DOUA 3KGZA 2G9GA 2HWC3 4PDWA 4YGEA 3WV6A 2ZZQA 2SLIA 3B9CA 4F8AA 1YFUA 5T50A 1ASJ3 1REFA 5I0RA 4IV1B 1W6OA 2C5DA 3M1HA 5IK5A 1NOVA 2GAUA 3M3QA 5L19A 3NAPA 3E5QA 1L3JA 1VP6A 1D0HA 4OHXA 5D8AB 5T3NA 4YYOA 3ZDSA 5F6KA 4AI3A 2XVKA 3M4FA 4GQ7A 3JBG3 3KT7A 1V6JA 4AQ6A 3POWA 1BVVA 2D5HA 3PMSA 4OI4A 4PDWB 2E7QA 3G6JB 1O5LA 4OUSA 1RUC2 1QMJA 1RUI3 1W39A 2DVAA 1AR93 1G6NA 3ROUA 1FOD2 5FRAA 4Z92B 3IBMA 1U5ZA 1HRV3 4DY5A 2ZS6B 1DLLA 2PLV2 1S1AA 2I2SA 1LOAA 1UKGA 3O7OA 2RR13 1DYPA 3O12A 3VDDC 2JG9C 1WLCA 5I8SA 4B7EA 2GNTA 4ES8A 1NQDA 3VBRB 3WW2A 3GZUC 2WT0A 3R0RA 1O3RA 4LT5A 4H7LA 3I54A 4K40A 2HWF1 2D7FA 2OUHA 3FMGA 1GZ9A 4CEWC 1FPN3 1VALA 3QH6A 4AF9A 1KFUL 4YFZA 5EV7A 1FNZA 4TSVA 2IFWA 4YM3A 3HAGA 1AXZA 5JSOA 2NM1A 3MFCA 1W0PA 4GMP0 1X8EA 3MF6A 1HRI1 1RITA 3ZSLA 1LGBA 3RQ0A 3MICA 4PIYA 1PVC3 3WDUA 1ENQA 3I4IA 3WT3A 4UW4A 2PHXA 1MEC2 2VW1A 4AQ2A 1PIV1 4DB5A 5CBLA 1SDWA 3RJRA 4WM8C 4CP1A 1IOAA 1SMVA 5T5PA 2XLGA 1UAIA 2WNVA 1YLLA 3J26N 3PLQA 4JGZA 1WA4A 5C8CA 4FTEA 4LEJA 5FAXA 1X50A 5DUXA 3GBWA 2ZBJA 2HJIA 4LBQD 1BVP1 1PGSA 3WW3A 2GSYA 2YY1A 1XNBA 3RPQA 4AVCA 2Y0OA 1FT9A 1OA4A 1W6QB 2WQ4A 4P9JA 4L97A 1ZX5A 2F6BA 4NPRA 1SEFA 4CDXB 1GFF2 1N1VA 2GALA 4Q4Y3 1RTVA 1AXKA 3V0AA 1D2SA 3VZOA 1O4ZA 3AMMA 1ND3C 3VBFA 3MIGA 3HR9A 1QWRA 1AR82 5GKAC 3ZFEC 4LHNA 4XJWA 5BYNA 1OOPB 2PQQA 4XJ8A 4AW7A 1ZBA1 4GALA 1Q5OA 1Q8PA 1OSGA 5SV8A 1WCKA 1RUD3 1S0JA 2GH2A 2RE9A 3AMNA 4XFIA 1KDKA 1CAWA 3M3IA 4LBJA 3UKVA 3PMEA 1J3QA 2ZGRA 1D4M3 1ZBE3 1IS5A 1ZRRA 4PLOA 1MVQA 5CFCB 1OPMA 3VBRA 2PLV3 2BBVA 3D82A 1CJDA 2AUYA 3A4UA 1MQTB 3QH7A 3JB4C 2CNAA 4N9HA 4Q4X1 4CEYC 1XXNA 3M3EA 1ZYBA 4AFCA 1RUF1 1ZBE1 3SXWA 4WVVA 5BNNB 4FPLA 2K2SA 4K3UA 3CNAA 1W6PA 1EV13 3FUOA 4AI8A 3AZZA 3H0OA 3NV3A 4BIOA 3CJXA 1MACA 3VDDB 4IEXA 2JG9B 4DQAA 1V6MA 4LA2A 1AHSA 3VBOB 1QQP1 2PTMA 3VBUB 4EWDA 4Z2WA 2R061 1MS0A 4RR3A 2UURA 1HV0A 3OJBA 4NOTA 1QJX1 4FPCA 1S0CA 2NZ9A 3T1MA 2QDNA 3S6PA 4XBQA 2E7TA 2XJUA 1BK1A 1LB2A 2WFPA 4HKOA 3RI8A 2ZPXA 2XL7A 2X5IA 4CP0A 2UWBA 4I2OA 1SACA 2RR11 2UU8A 3PHMA 5ACA1 2ZGPA 4AGGA 2RMU1 4OHWA 4TWTA 3UKNA 4R52A 5KHIA 2NN8A 1PGL1 4FXGB 1PO22 1HV1A 2PHRA 2VULA 1S0IA 3NKGA 4IEOA 4KNCA 4PBOA 1AYN2 1GNHA 1CD3G 1I5ZA 1IGOA 1JXNA 2QE3A 3EO6A 1C5IA 4IEUA 3W58A 1AL0G 3TYJA 4S2GA 1RL3A 2GMPA 3AFKA 4FPGA 1O3QA 1IZ3A 4Q4Y2 2IXJA 3BOWA 4CP2A 3VV1A 1AX0A 3WP5A 2XPJA 5EWSA 4YVSB 2DUOA 2YV8A 2DVFA 1AVBA 5FFOC 2VUJA 5DUUA 2ES3A 3LCPA 1PGW1 3V0BB 4M3CB 4I3PA 1JW6A 3VKFC 1RUC1 2JKBA 2IXCA 4RR3B 2OYZA 2W39A 2OPKA 3E5XA 5SV5A 4KH9A 4BHPA 4JGYC 3SCFA 1H2NA 4D69A 4A3XA 2YHJA 4B7KA 3M2MA 3SH3A 3H7YA 2NMOA 4XJ9A 5GZCA 4KGGA 4XE9A 4FCAA 3B00A 2WLPA 1BXHA 3VBFC 2LALA 1C57A 1R091 3URFA 2SBAA 5CAZA 3AMPA 1GR3A 2BNOA 4YZ1A 1QH6A 3WDTA 1LHNA 4H55A 2BEOA 1VRH1 2JD4A 4SLIA 4ATEA 5KBFA 1CAVB 2HEWF 1GV9A 4FT8A 5CVRA 1BBT2 4CDXC 4I3GA 1O4TA 2ET1A 2VOVA 3KCYA 3NV2A 2MPFA 4DNYA 2WNUA 1J58A 1SLIA 5J36A 1X33A 4AVVA 4AQTA 4ITCA 1YJKA 3ZN5A 4COZA 3JCIA 3KT1A 1YCIA 1NLRA 4HN1A 5E8AA 1CAVA 2ZKLA 2MEV3 3APBA 3IPVB 1JUHA 4LA3A 3D6EA 2ZHLA 3VBOC 1WW5A 1KJLA 5CFCC 1DBNA 4XYXA 3EQEA 3JD72 4CEYB 1WW4A 2QCSB 4FO9A 2R6QA 2QJVA 4W6YA 5BNPC 4B3NA 2R063 3MIFA 2B7YA 1Q8VA 3AZYA 5FDBA 4H3WA 2B45X 3RYKA 1AR71 4DMIA 1CAUA 1MVEA 3B01A 3AP5A 3PJQA 2VOKA 2XVLA 3HD8B 4RD7A 4EN0A 1ZZ7A 3N36A 4L11A 4GXLA 2D3RA 2JE7A 3DKWA 1RUG2 2AGSA 2WZR1 2XBO2 4JCKA 4LBOA 1RC6A 4RHV3 2B5HA 2ET7A 3ASIA 4MGKE 1V70A 1U5YA 1YI7A 1Q43A 2ZGTA 4LBKA 4MV2A 4Q0VA 1GANA 3V56A 3GYDA 2WFF3 4Q4X3 4QQPA 4NN0A 3AXDA 5H9RA 5C9AA 4C0BA 1VB2A 4QHBA 1VBB3 2O8OA 2WT2A 1V00A 2Q0AA 5AVAA 2YC0A 1HXS2 2A3YA 4BOWA 4YFWA 4FPYA 1RB8G 5IK7A 1FMD1 4I02A 3ZSEA 1TE1B 3HBZA 1DU3D 2A6VA 2PHDA 4OZXA 1ZZ9A 3BTAA 3AKTA 2DURA 1AJKA 5EZWA 4JGYB 2D44A 4Q0SA 1PMIA 1S0BA 1YI9A 1W6MA 4M3CE 1POV0 3ENRA 2I45A 4IL7A 3ZN4A 1ENSA 1MS8A 2X8KA 5FMOL 1RUC3 4M0NA 1H4GA 2UY9A 4FTBA 3H1YA 4P9WA 1MR5A 1SBDA 5DDJ1 4L9BA 1YO8A 4XXPA 2DUPA 1JTZX 5FQ0B 2AREA 4JDNA 3ZFFC 4HBNA 4XMAA 2XKOA 3D0JA 1SBFA 4HVRA 4NHLA 5J48A 4MLOA 1QXRA 1TMF1 4Z8BA 1ZRCA 1DQ6A 1GQGA 2GNMA 5K0UA 5JLVA 4CDWC 1I1EA 3TN93 4C91A 2XKPA 1UU6A 2RS13 4MXWA 3VBSB 1HRV1 2ZACA 3W9AA 1O7FA 1QJU2 1NA1C 3VBFB 3B94A 2WZPP 5GZFA 3HT2A 5BNOA 3V65A 4A7ZA 1WCDJ 2HWD2 4RS5C 2GNDA 1VB4A 2RMU3 1XNCA 2IWGB 1UF2C 5HCFA 1W6QA 2HEYF 3AKRA 4OHYA 3THTA 4R9CA 4AHWA 5A33B 4JTNA 1I3HA 1GBGA 1MS9A 1PVC2 2ZGOA 4HZFA 4YZ5A 1MZ5A 5CIRA 1ULGA 4XQ4A 1WW6A 4XILA 3BOPA 5GLTA 3EXUA 4I0BA 3JBG1 4QGNA 1D0GA 4GWNA 5JVVA 1VBD1 1AR73 2JENA 3K48A 4AEDC 3N4MA 3FBMA 3LKJA 1LEDA 3AKSA 3MI8A 3DF0A 1HXS3 2JXAA 1ULEA 4XFGA 4TZDA 1V6OA 3H3ZA 4LBNA 5JR7B 1NE6A 3AX4A 4WM7C 1RUE3 3M8LA 2CTVA 2KM2A 2EXKA 5GLUA 1VBD3 5DXDA 3MDPA 5J09A 3EJKA 1R1A3 4XF0A 2DVGA 3A0NA 4Y20B 4CDXA 5C9AC 4WVMA 1ZRDA 1EP0A 1COV1 3VN4A 3E6BA 3WCSA 2HWF3 1N1YA 3FX3A 4KWLA 4GH4B 1TNRA 5JAXA 4M0HA 1OQ1A 4HFSA 2ZGLA 4D7TA 1S0FA 2B39A 2CWMA 4IV3A 3OD4A 3FE5A 1KXGA 1HQWA 5F1RA 1H2KA 4Z82A 2WNVB 4YW2A 4JQRA 2PAKA 4YGDA 5LEJA 1SLCA 3AKQA 3UV9A 1BQPA 1RUG3 1LESA 4KBBA 3M3CA 4XOGA 1O4YA 2OZJA 2FZ2A 4LBQB 1IQAA 2HWB3 4GB33 4CEYA 1FXZA 1XQNA 3H50A 5FOBB 5IK8A 2CGNA 1G9DA 3E6CC 3KSCA 4JDMA 3DPRA 5JSPA 2BWCA 3DPRC 5KC5A 3ZYRA 1TQ5A 3ZN6B 1XNKA 2RM22 3SNMA 5BV6A 1YNAA 2JG9A 2GN3A 3CEWA 2HWE1 3VBSC 3ZYGA 4LBQA 5CNAA 4PIZA 4GH4A 2WA3A 1KRIA 3IDEA 4LLOA 4QX5A 2B8MA 4ZU4A 3S7IA 5KXBA 5K7PA 2BUKA 1MQTC 2RS11 3PJYA