1U5ZA

The crystal structure of murine april, ph 8.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
128
Chain Sequence
KHSVLHLVPVNITSDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine, hormone/growth factor
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5zA00
4OULA 5KC6A 1OQEA 2X29A 3ME2A 3QBQA 4OUMA 3URFA 4QQ2A 2HEYF 2RE9A 1OSGA 4DB5A 2JG9C 4D7YA 4MXWA 4E4DX 3L9JT 3B93A 1XU1A 3K51A 3AB0A 1RJ8A 3IT8A 1KXGA 2E7AA 3B9IA 4QQPA 1RJ7A 4HT1T 5KC5A 2HEWF 1DU3D 2WNVC 2ZJCA 5TSWA 2KA3A 1D0GA 5BNQA 1PK6A 4OUSA 1TNFA 1DG6A 4TSVA 1I9RA 2RJKA 1TNRA 3LKJA 5L36A 1U5ZA 2JG8B 1S55A 2WNUB 1D4VB 3MI8A 3ALQA 4KG8A 1GR3A 2JG8A 1JTZX 2WNUA 1PK6C 2QE3A 4E4SA 4QQLA 3TYJA 2R6QA 4G4FA 4EN0A 4QQOA 1O91A 3TWIA 4TWTA 2RJLA 3WD5A 1C28A 1JH5A 1D2QA 1KD7A 4GIQA 2JG9B 2Q8OA 4J6GA 2Q1MA 2JG9A 2ZPXA 5HBAA 2TUNA 2O0OA 5L19A 1WCKA 1U5YA 4MSVA 4QQHA 2R30A 4G3YC 4RSUA 2WNVB 3V56A 2HEVF 3K48A 2Z5WA 2WNVA 2QDNA 4MXWB 1U5XA 1IQAA 1OQDA 4F3JA 2R32A 2OIIA 3QD6A 4MXVA 2JG8C 2WNUC 4KGGA 1XU2A 1C3HA 3FC0A 1A8MA 2TNFA 1PK6B 4NN0A 1ALYA 5KWRA 4QPYA 5CIRA 4N90A 2AZ5A 4KGQA 4DOUA 3B94A
chains in the Genus database with same CATH superfamily
2Z79A 2GNTA 3LFIA 4K20A 5FZKA 4GWJA 1WA4A 4BQ1A 4N7IA 1K5JA 2YUEA 4N53B 4N7UA 1YIPA 1PO12 2Q30A 3RNSA 3K4ZA 1UPSA 1N1TA 3LFMA 5A6ZA 5FK7A 1QIQA 4PLOA 1W99A 2VULA 3PL0A 4RR3A 1XC6A 4S2GA 1PVC1 3MICA 3O0WA 3NRUA 5F32A 1D4M1 3TNQA 1F9KA 4FQZA 3VBHC 2VVFA 2OQ7A 2JDZA 1AVBA 2W39A 3ZXKA 3FWEA 1Z78A 3TEZA 1IHMA 1GWLA 1HJFA 5GJ6A 3P1IA 5F3GA 4IEVA 4META 1DG6A 2CGPA 5FZMA 5FYBA 4ATEA 4YLZA 5KXDA 1NX9A 4ET7A 4W4ZA 4YPJA 1ENQA 4AHYA 2BGOA 2RS52 5F1RA 1P8JA 3O1UA 4YFZA 1E5RA 1CX4A 4X6RB 1IGOA 1X33A 3MYXA 5L73A 5C4WB 1Q5OA 3WF3A 4BIFA 5I0SA 3ZFFB 4WM7B 5FYZA 1C8M3 2EVXA 5M0TA 1K5MA 2ZEYA 4TTGA 2A6XA 1WW6A 3VB9A 1XQNA 2P34A 4NOTA 1IPKA 1US2A 1AJKA 1H2LA 3I2GA 5IK4A 2J1VA 4F8AA 1CGPA 1AXKA 5FYHA 2VG9A 4FI9A 2XBO3 1S0CA 1HB3A 2XL9A 1XNKA 1YNAA 1DGLA 2WQ4A 3KT1A 1U0AA 4QDRA 1IS6A 4AI2A 1DLCA 2NM1A 3OG2A 1NT0A 3G7DA 4JCKA 2A3XA 2ZKNA 5FMOL 5HXVA 2ADDA 1RUE1 3ZSKA 3OUHA 1STMA 5GLUA 1ND3C 2VW1A 4M01A 4JGZB 1QF3A 3GJAA 3SCGA 1R093 4QX2A 1S0JA 4XAAA 1ND2C 1G9AA 2ATFA 3K4DA 2WZPP 2C9AA 3HNMA 2HJIA 4IE5A 4GB33 5E16A 3DN7A 3N7MA 4B1MA 4D69A 1MR5A 5FOBB 1KGYA 4GALA 4I0WB 1FPN2 5A7SA 2VUJA 1FX5A 2IWGB 1PNFA 1EV11 1FNYA 1K45A 3MW2A 4FQ4A 4B1LA 3WF4A 4KU7A 1VBC3 2NQYA 2WA4A 5FZ7A 4Y1UA 3ILFA 1WCQA 2XJSA 1HRV2 3U4XA 1A8MA 3ZXJA 4D7SA 1ULGA 1B35B 3ILNA 5FCCA 1CPMA 1J84A 4HVQA 2A6ZA 4LO6B 3PIGA 4LBMA 1VBD3 3EHKA 2X05A 5L9VA 2QQUA 5FLJA 5IVJA 1LENA 1RVF3 4YW3A 5FZBA 3O1OA 5K0UB 3CLPA 3TB0A 1BEV2 1ZBA3 2FQPA 2VBPA 1YJKA 2Z69A 1WLWA 3CDZB 3HT2A 1J3PA 3H1MA 1TVGA 3NJZA 3CJIC 4E2QA 4FAHA 2LRPA 2Y0OA 1RJ8A 3ACGA 1G9BA 1V6IA 3VHNA 1O59A 1WCSA 2OXBA 1SEFA 1I1EA 2P4EA 2WWSA 3N9OA 5A33B 2HEWF 4ZS2A 1MQTB 1QJEA 3ORJA 1C5IA 3NVCA 3VDBA 2JDMA 1CIWA 2EXKA 5BNQA 1D0GA 2QFEA 5C71A 3WF2A 2O8OA 5DDJ1 1AYN2 2PA7A 1ONAA 3POWA 1RUF3 2W87A 1J59A 1RC6A 5BY5A 3ZXEA 4Y3OA 2JE7A 3B02A 2W08A 3ETPA 3T1LA 4PDWC 2Y6LA 3OPZA 1TE1B 2Y60A 2FDHA 4N53A 4XUNA 1H8TB 4P9WA 4NIGA 5FXWA 4YSFA 3D82A 2WFF1 1APNA 1LHUA 1MZ5A 4XE9A 1RUF2 5EV7A 3S7IA 3GZUC 2RM23 2DF7A 3H7JA 3OD0A 1W0NA 2OA2A 4YVSB 1RMU2 1WLTA 5ABJB 1QNWA 2BZDA 4TLFA 2HWC3 4E2SA 2CY6A 1A78A 1W6NB 4Y4YA 3LEIA 5DUWA 1W6QA 4P9GA 1XB9A 3B5LB 4XF0A 4QQOA 2QZ2A 3U1XA 3R05A 2RR13 4XFFA 2L9LA 2RMU3 3O0XA 3N4MA 3JD73 1W39A 2W1WA 4HOOA 4CU7A 2Z42A 2AR6A 4NROA 4K9SA 3ON7A 4SBVA 4COVA 2VH9A 4KBZA 2PFWA 3LQCA 2OYZA 4K8FA 2YGMA 1CX1A 2WSUA 4OMDA 3W5MA 3FBMA 1SCSA 4HKOA 3TNPB 4CTEA 2JG9A 3DGTA 3WW2A 1UQXA 2OUJA 1AR71 1AL22 1LU2A 2B8MA 2UYAA 3SXWA 1OH4A 2JENA 3VUOA 4H7MA 4MHRA 3MUZ1 1ZVFA 1ZA4A 3ZIXA 3HT1A 5HCHA 1AXYA 3ZFFA 3KS7A 4WM7A 4AYUA 3CU7A 1OC1A 3QOPA 3NV1A 3OGSA 1VMHA 4HKWA 5FYTA 4AHWA 1YQ5A 5T5LA 4CCDA 3ATGA 1LESA 4QX0A 1GOFA 4AQ6A 4PJYA 1V9U3 4MXWB 1OLMA 1DIWA 3ZFGB 5J1XA 1HV0A 2ERFA 1IQAA 2BU9A 3H8UA 1O5UA 3VBSB 3OGJA 2J1TA 1FAYA 3H1WA 5T55A 4UYBA 1UOGA 2OIIA 3IM0A 3IIIA 1PGW1 3I2IA 3PU3A 4IV3A 2AUYA 5KXCA 5FY4A 3ES4A 4YGDA 5GLWA 3RZLA 1IS5A 3MIHA 5IVYA 1UY0A 1UYXA 4K1ZA 3H8RA 3THDA 1X8EA 3SCHA 1DP0A 2CAUA 4FOQA 2HWD3 2QVSB 2YV8A 2C4XA 4NHKA 4CUCA 1AR82 4QU2A 3WQ7A 1ST8A 3RWKX 1HXS2 4GJYA 3AM2A 3ME2A 1E57A 1RITA 4IERA 3S6PA 3TAYA 4OCTA 1AR93 3S5QA 1W9YA 2IUWA 4YGBA 5D8AC 1RXFA 1UX7A 2DUOA 4GJZA 1RXGA 4LK6A 2WZ8A 4QB1A 3VBOC 1JYVA 5FY8A 4NRMA 1EUUA 3ZYPA 4YZ2A 2TBVA 2ZMLA 1R082 2WQZC 5FP4A 3H8XA 3JBG1 2BDRA 2DTWA 2O8QA 1QEXA 4M4PA 2ARBA 1JZ4A 2JB8A 3D8CA 1J58A 2YBSA 4DFSA 3PVEA 4YW6A 1SG3A 4XJAA 3RJRA 4BPZA 5LEKA 1UX6A 3AFGA 1B35A 1TNFA 3B3QE 4AHZA 2C1FA 1S0FA 1W6MA 2JICA 2XKOA 4P14A 1W04A 5IAXA 1DQ6A 2XWJB 3ELNA 1H1IA 2PAEA 2B39A 5A70A 1NCRC 4LK7A 4LLFA 2J1UA 2VZOA 5L7OC 4EWEA 1RUC1 5J3UA 3HAGA 3RMYA 2HWC1 1LOAA 2R0HA 4LEJA 3B00A 3ETQA 2MHFA 1U5ZA 4Q5OA 1PIV1 1QOSA 5FP7A 3ZYJB 5GZCA 3ZN5A 2VOWA 5BNPB 2VTXJ 3MI8A 1UU6A 1SLLA 4ZS3A 3V64A 5J48A 4YFWA 4GWIA 4JVAA 4FT8A 5KHHA 4E8CA 1VLNA 2VCCA 3MFAA 3ECQA 4MV2A 3R4UA 4COYA 5I8TA 1O3SA 1ASJ1 1JYXA 4Y5TA 5FZOA 1UOBA 4DXZA 4EN0A 1NUKA 5FO7B 3MDPA 2W91A 5A33A 1H1MA 1MQTA 4Y22B 1SBDA 2XXZA 3TWIA 3VDDC 5FPAA 2RJLA 3WVJA 4X6QB 4OI2A 3VHOA 4FPOB 4A44A 1Z7S3 4CUGA 5CG8A 4GIQA 4ZU4A 1EAH3 4P02B 1WUVA 3Q8CA 1YI7A 3LEMA 2AH2A 1L7QA 3NSTA 5LZ6A 4GD4A 2Q4SA 3DECA 2ZPXA 3VD4A 3SC7X 3S5AA 1R1ZA 3AZZA 4CCNA 4EV0A 1RUOA 1MZEA 2R49A 3GCXA 4FPEA 3H1YA 4URTA 5EJZB 3T08A 1H8TA 4LBKA 5IVBA 5IJRA 5JZGB 2DTYA 1ZRCA 1F2NA 4YYOA 3E5UA 5FDBA 3CMGA 5BPXA 1LRHA 5I0TA 1Y9GA 1UO9A 1GYKA 3PJYA 2GMMA 4XDQA 1DF0A 4IE0A 2B45X 2Z5WA 2WNVA 4XETA 4AZZA 1YIFA 2B9VA 3B69A 2VGDA 5A80A 2ZS6B 2QDNA 3PTRB 4LA3A 2GAUA 4XFGA 2RS33 1W6NA 3C3VA 4BJ0A 2D44A 3ABZA 2A75A 2HWD1 4LTAA 4XQDA 3WG1A 5GLZA 3LIHA 2QUOA 2XG3A 2ZGUA 2VJXA 1V6MA 4H14A 2D6OX 4BWOA 4A4AA 3KT4A 3VD9A 2X5IB 3FFQA 2V4AA 2RS32 1WMXA 3FC0A 1BVVA 3LDRA 4CDXC 1YI9A 5G04L 3NWKA 1PK6B 3KCXA 1W8TA 5HV0A 2VNOA 5D21A 2HH9A 2WDBA 3AFKA 1N3PA 4N90A 2MEV3 2EALA 5CIRA 1NLRA 2W1QA 3UKNA 2NYYA 4FFFA 5F5QA 5J98B 3J8F2 3Q8FA 4TN7A 3ZSEA 5B4NA 5BYNA 3EMRA 4LA2A 1OQEA 4FPCA 5LCWL 3ZVXA 4OUMA 5LEJA 2CDOA 3SISA 1VBE3 4RS5B 2VO5A 1IG3A 4CXWA 2FZ1A 2DCJA 2GALA 3T0AA 4O9EA 2MEV2 1SBFA 1YQ2A 4BQYA 4MXWA 1HX6A 3R4SA 3V0AB 2I74A 1MEC3 1RTVA 2ZEZA 1RUD3 1UD1A 4Q0VA 5JIUA 2RS11 2HWE1 4DXSA 1YQ6A 3RG0A 4HN1A 2ZMNA 1QJU2 4JDMA 3R6SA 1AZDA 1XNDA 2C0ZA 1RUJ1 4BE3A 2EXHA 3FUQA 1ODMA 1QOOA 1VAVA 4XIOA 3ZDSA 2DCYA 1ENXA 4NO4A 4C1XA 2W5FA 1JI6A 2RJKA 2YC4A 4J1WA 5IK5A 1BVP1 4GQ7A 1YFYA 2BUKA 4Q8LA 5CEHA 1U5IA 1W0PA 4XJ8A 5FZ9A 1RHI3 2Y8KA 1V6OA 2PHDA 1GMMA 4RQPB 1OLQA 5A7QA 4BOWA 4CE8A 4JKMA 4ZPIA 2VE1A 3SNMA 5LB6A 4XVHA 1QXRA 3K3NA 2HWF2 4Y24A 4XC9A 1XYNA 4WV8A 5FMCA 4AQSA 4GAZA 1G9DA 4FBFA 5IK7A 3BI3A 2JXAA 4CEWA 2QE3A 1PO21 1VMJA 4HVOA 2AACA 5CG9A 2BFUL 2VBBA 2B4KA 4OMCA 4O65A 4C1WA 3OPWA 2ZGRA 3PUSA 4G4FA 1HB2A 4K40A 4Y5Z0 1T2XA 3WNOA 3ZMOA 2HWB2 2VZQA 4YW5A 2BW8A 4H7LA 1O91A 1W05A 3QH7A 5EFUA 4ISRA 1FOD1 2ORXA 4I0BA 3WDWA 3QACA 3WEZA 2YXSA 3NNGA 4UFLA 2R063 2YBPA 2D98A 4LUKA 4YZ1A 5BNNB 5CFCB 1BMV1 2FHRA 3KCYA 1OBNA 2DWRA 1W3VA 2VZ3A 1YC61 5CZKA 4BDVB 1TQ5A 2DVFA 4PQQA 3B01A 4QPIB 3THPA 4IQPA 5JXIA 2D6NA 4IL7A 2DU1A 4Q27A 3OY8B 1ZZBA 1LJ7A 4CP2A 5AFEA 1W03A 2QQMA 2IC1A 3VGIA 1OKQA 3ZN4A 1REFA 5FPXA 3WR0A 2AGSA 5JLVA 2I45A 5G05L 5A7NA 4NIAA 3RRDA 3RSJA 3VBHA 5FZFA 3AZXA 1XPWA 2J22A 3BYWA 3CHXA 4L2NA 4QGNA 1H2NA 4UF0A 2IZWA 2QQIA 1H2KA 1BK0A 1O4TA 4BQ2A 4XF4A 2XR4A 3ZN6B 5FPUA 2OZ6A 1VRH3 2WT0A 4NHXA 1O8SA 4P9LA 4Y22A 3MUY1 4A6OA 2NP0A 4MXVA 5C8CB 2D40A 2PHWA 2ZEXA 2WNUC 4RHV2 2LW8A 4D8MA 4Q4V3 2J1RA 2E63A 4AQ2A 5I91A 1KJLA 1YLLA 4BK4A 3TN91 2CHHA 3RJ2X 4OQ9A 5LW9A 3BUCA 2FBEA 2JIJA 3KV4A 5K9YA 3NNMA 2WT1A 3RFRA 1MEC1 4LKSA 1DGWA 5J37A 5GZFA 4FFIA 2FMYA 1AL0G 1RB8G 3T2OA 5HCBA 1AR62 1GWKA 3A4UA 3S7EA 1PX3A 3QBQA 5DPNA 4XBQA 4CCEA 1X36A 3DPRC 1NQDA 1MZFA 2V09A 1QJX1 4R52A 2ZGKA 4HN0A 1Q43A 1LHOA 4QDSA 2B42B 2WNOA 1MVQA 1OF3A 3C8XA 2JKXA 3SEPA 4AFCA 4BQWA 4D6RA 1JYIA 1DQ5A 1W9TA 4I01A 1X8MA 4XJZA 5CKMA 5FXVA 1UU4A 2WR9A 5APAA 2PAMA 5FYUA 4LJHA 1GNZA 1OXCA 5LRSA 5KC5A 3NW4A 3N9PA 3U07A 3SKJE 3MF6A 5DN2A 1R64A 1ND3A 2V4VA 1PK6A 2W9XA 3LPGA 4OUSA 4FSJA 2GC0A 1ULEA 1JYNA 3AMNA 4LIVA 2PLV2 4XDPA 4UI9L 3AKQA 1PZ8A 3VL8A 3AJYA 1V6LA 1FNZA 2OPKA 4ISQA 4QX3A 4WVZA 1KITA 5KXEA 2X10A 1S2BA 3WQ1A 1AX0A 3VZJA 1BBT3 1W8NA 1K5MB 2Y6GA 4D6QA 5JR2A 4N43C 1ZRDA 3VBRC 2JE9A 1UU5A 5CISA 4H55A 4W8JA 4S2FA 3WNXA 2C9KA 1VBA2 3D0JA 4GWNA 3MEPA 1RUH1 1XNTA 3UKVA 2DURA 4LO7A 2JD4A 1Q8QA 3GJBA 1R1A1 4XDOA 4Y4RA 1AYM1 1J1LA 3H7YA 3HBKA 4JHZA 5FKBA 4R9DA 3WDXA 1DFQA 3E1F1 2WAOA 3PHMA 3I97A 4CDUB 2N7GA 5EP9A 4A6SA 1JMUB 1FMD2 4JRAA 2LS6A 2R1BA 3AMPA 4B7KA 2B7YA 2D5HA 4L9BA 4DINB 1OVSA 1BKZA 5C9AC 3IB3A 3NNFA 2VZSA 3AYCA 4CDWC 2R16A 3CJIA 3GZEA 4RQPA 5LK5A 4H2AA 1RUG2 2GC1A 4KWUA 1W8FA 1VRH1 3AMHA 1K12A 4MVTA 2UYBA 4LOTA 4XEZA 4CDQC 2GC2A 1G9CA 2EXIA 2Y6HA 3V56A 1DYKA 4AVTA 4FOVA 2LALA 4K8RB 2XLGA 1OOPC 3RMXA 4A42A 3FHAA 4YVWB 4BQXA 5BUVA 5C5UA 5FWJA 4Q26A 1F5FA 5FMOS 1GANA 2WFPA 4B3NA 1E5HA 3I3EA 3SH4A 2FCTA 2Y34A 2YBKA 3VKOA 3LA7A 2NZ9A 3ZR6A 1AJOA 2WA3A 1VJ2A 2P6CA 2NPIA 4L0PA 1TZOA 3ACLA 1BYHA 4P9YA 2WS91 1O6UA 3UYJA 4LT5A 2JG8C 5BNNA 5CFCA 1A34A 1QJY3 1QDCA 1QU0A 5FZAA 4XZPA 3AL5A 3GBWA 1X50A 1W90A 2EA7A 2BYVE 2D5FA 2ZX0A 4GXLA 1OVPA 5FBJA 3WT3A 5AC91 4FPYA 5AFBA 2K2SA 1RIRA 3E6CC 4P9XA 3Q8EA 1DHKB 4QPIA 1NAEA 3LAGA 5IVVA 1ALYA 4AQTA 1JXNA 2GH8A 3OY8A 5C3OA 3NKTA 5JI7A 5FZIA 5F37A 1LHWA 3LE0A 5IT6A 3DYOA 4AI9A 4Q4X2 5KC6A 4BMEA 4ASLA 1JHNA 4GA9A 4U2AA 3V0BB 1COV1 4UBHA 3OUJA 4MUVA 4QQ2A 1F4AA 1DLLA 1HRI2 2O14A 2QTWB 1OD3A 4QHZA 3TBDA 4JQRA 5H9PA 3N7JA 3C7OA 3MLLA 4Y1YA 2D6MA 2QQOA 5FQ0A 4IE7A 2BTVC 2DDUA 4HANA 3ZN6A 2BGPA 5ANNA 1JYTA 5SV8A 1PHMA 3WY6A 1D2SA 5A32B 4NAOA 1YCIA 3B9IA 1F31A 2D3PA 1PO13 4RN5A 4FPLA 4NRQA 1CZTA 4FPKA 3ZR5A 4WM8C 3RYRA 5A7WB 2A6WA 1BBT1 2HLEA 1SFPA 1YUDA 2P3KA 1DYPA 1K42A 2P17A 2RV9A 4IEXA 1ULOA 2P3YA 1Y9MA 2A70A 3UETA 5A3PA 1GP6A 4RFRB 4E4ZA 4IXLA 2GSYA 3HWJA 2JEMA 2XMLA 5FWEA 3T2PA 3BGAA 1SFYA 3IN9A 3WNMA 4Q4Y1 4BMBA 2EF6A 4XXAA 4Y26A 2HKXA 4JRLA 4MGSA 5FPZA 1GOGA 4ZHNA 4HK8A 3WLUA 2A3WA 3B9CA 4Y20B 3RS6A 5K8SA 1RUE2 2D93A 2UURA 5IW0A 4AEDC 1OPOA 1QNYA 4QM8A 2PHTA 1MS9A 1WBFA 2R042 3AP6A 3AXEA 5KHKA 2VQTA 3K2OA 1OHFA 3FX3A 4OQ8A 4D3WA 1CN1A 1W6QB 1IZ3A 2AEYA 4AI8A 1NY71 4HFSA 3NJVA 5FO9B 3KHCA 2RS53 4PLMA 2GP3A 4GMP0 5EHDA 3N9MA 2QQVA 3PVNA 1ZBE2 5FY7A 3ZFEB 3ZSMA 3NNLA 3FBYA 1C28A 3RYKA 4HVRA 3PIJA 1W3XA 5E1RA 1KD7A 2XJQA 3BIEA 2BPA2 4XJUA 2JG9B 1E5IA 1N1VA 2GMEA 2O1QA 4FCAA 3K3OA 3J9SA 3H42B 5D8AA 1UMIA 1QJFA 1CESA 1VBB2 3RWNA 3IDEA 5HBAA 2VMEA 2WZR1 3VBOA 4Z92B 1YFUA 1N47A 1Z0HA 5FPLA 5E8AA 2R071 3ZMNA 4BH9A 2EIBA 4WVMA 1SQ4A 1URXA 1NCQC 2LTNA 3OYWA 3I49A 2DVBA 2DVDA 3WW3A 1FI2A 1YJLA 3ZXGA 2A6YA 3H3LA 2W0XA 1YQCA 2ZACA 3GNEA 2ES3A 3MIGA 1SLCA 4QXCA 3AP5A 3KGZA 1OMIA 3KV5A 4I0AA 4QX5A 4YNIA 3VLBB 4IV3B 5KHGA 2A6VA 1DGRA 1Y7BA 2VZRA 1DCSA 4Y1ZA 4M4RA 3AC0A 1IPSA 3T2QA 2CDPA 3MIDA 4CDUA 2WLQA 3JB8A 2ZGPA 4IGQA 1HW5A 4EYUA 3M2MA 4R9CA 2QQLA 3OTFA 3ZPOA 3USSA 4JGYB 5DAWA 2G4IA 2W1SA 3NAPB 4N9IA 4HPKB 4FPHA 2WO3A 2Z4FA 4YGCA 1JZ5A 1FPN3 3C7EA 1H9PA 5DDJ2 1GQGA 2W92A 3ZOIA 1PNGA 5CA6A 4ATFA 1J3QA 3LDKA 1O3TA 3VBFB 2YROA 1YHFA 1ZZ8A 2ZGTA 5HCAA 4IGOA 2CAVA 2HEYF 3PJQA 4YVWA 1HRV3 1OF4A 3ZKUA 5FZGA 2D43A 4E4HA 5F9TA 3VDDA 5J7MA 2CGNA 4Q2FA 1NLQA 1UKGA 4DIQA 4ZKTB 3KM5A 5IUQA 2WFF2 2WLPA 2R7EB 4Q0QA 2YFZA 4ZXEA 2J7MA 5LASA 2FDFA 5IAVA 1UL9A 3ZO0B 3KV9A 1YQ8A 2E7AA 3MIFA 1EYBA 1LGCA 1UIKA 1HLCA 1UAIA 4QPGB 3S57A 3GZTB 4AGVA 2QJVA 3GBFA 1W6MB 1BEV3 3ZX7A 5TSWA 3LCPA 4QGLA 5H9QA 2AENA 4AVVA 4CCKA 4KWJA 4BIOA 2JIGA 1A6CA 4TSVA 3N9QA 5D1IA 1POQA 3T2TA 1J83A 4CCCA 4Z1VA 2P3IA 4KU8A 2H6BA 2K9ZA 2VMGA 1OT5A 2RS51 4HBNA 4I09A 4I02A 4XF9A 2H6CA 3V0BA 1O3RA 2YU2A 1M06G 2AREA 2DFCA 2C5DA 3RYPA 1S55A 1VB4A 4XFCA 3FN9A 4AK3A 2LUWA 1AR72 3I59B 3KT7A 5FOJB 5FUPA 3OB8A 1GR3A 1AYN3 1OUXA 3KWVA 5BV6A 1JTZX 1GSLA 1LKNA 2PXJA 3HQRA 5EWSA 2Q1ZB 3U78A 2XGXA 2ZHNA 4IV1B 5FZOB 3WDVA 1UZZA 3ZYFA 4PHZA 3UESA 3AKSA 4ORFA 4QQLA 2A3YA 1QGLA 4HXCA 2X8KA 3D4KA 5A32A 4OHXA 3U0ZA 2XWBB 2WN2A 2RVAA 4MGIE 3TRSB 5HXMA 4TWTA 3C2UA 4L92A 1O7FA 5A7WA 1C8M1 1LNSA 5GALA 2PMWB 3O14A 3Q8AA 4P08A 5IATA 5F6KA 3D0SA 3I3DA 1RMU3 1PGW2 4CU8A 4J6GA 2CNAA 2W95A 2DFBA 4LITA 2F4LA 1EPWA 2PELA 4XUQA 2FDKA 5D2AA 2ET7A 4HSLA 1NA1C 4ZXKA 2XBO1 1CAVB 1KEXA 3IZOA 3N36A 4Y20A 3T30A 2WQ8A 4LBJA 1GOHA 4PQ9A 2WNVB 1ULFA 1LODA 3UK9A 4CCMA 4PF1A 1GZWA 4XUTA 3HBZA 3J7HA 4AFMA 4KH9A 5EYYA 4OI4A 2JX9A 2AC1A 1AL23 3J4UH 3KCCA 1FT9A 4Z82A 4Z07A 3KGLA 3ZFEA 3ZXDA 4IE6A 5A6XA 1YYNA 5C9AB 2IVJA 4FTBA 1R091 5JSOA 3JBG2 5IVFA 3IDBB 4QT6A 4JAAA 1S0DA 4AGRA 4UAPA 2NN8A 1OA3A 4GB31 2TNFA 2ZGNA 1S0EA 4IUGA 5GKAC 1WA6X 2YHJA 1JU3A 4NRPA 1WLCA 1C1LA 2DUPA 4LHLA 4XMIA 1VBC1 1HIXA 1UKRA 3LEGA 3WCRA 4CA9A 2XDVA 4QX8A 4LE4A 3HD8B 3URFA 1W8OA 3AP9A 5F5CA 2VNRA 1RUC2 2IFWA 2Q8EA 4DB5A 4GMP3 3VKMA 1CWPA 4LIUA 4Z2AA 3KF3A 3EQEA 1PIV2 1SZBA 4KL1A 4P5HA 3BN6A 4MGQA 1SDWA 1VBD1 2VR4A 1JU4A 1XU1A 1AR83 3BU7A 1K3IA 3FL7A 2J42A 5F5AA 4BCUA 1HXS3 2W46A 3OBTA 1AX2A 4MZUA 5CB7A 3VBUB 1RVF1 2PQQA 4C91A 2G19A 5ANQA 3IDAA 1ASJ2 3A21A 4B29A 1H2MA 1ZBA1 4NIHA 1S0IA 3SH3A 4QDQA 3MZHA 1IPJA 2PHXA 4JGYA 4QKDA 5H9SA 3BKZA 5EXOA 3NAPA 1KS4A 3MPBA 1G8WA 5HI0A 4HPKA 1AYN1 3D5OA 1R083 1IKQA 3RZGA 3CL1A 3LA3A 1N3QA 3WX5A 1QQP2 4RR3C 2I07B 4PIXA 4DXTA 3VBFA 1JODA 2GH2A 2YG0A 5LA1A 3BOPA 4WVWA 3A0NA 5GLVA 4NPLA 3H50A 4XFIA 3SEEA 3TEWA 3J26N 2XVGA 4CEWB 5GM0A 1SACA 3W59A 1RUF1 4OI0A 2WNUA 3BB6A 4NWWA 1RMU1 4E4SA 5CYYA 4C90A 5IFPA 4NIDA 4QGMA 5FUIA 1OQ1A 1GQPA 3WOGA 5C33A 2C26A 4CP1A 2R1DA 4QMAA 1L7LA 2VQAA 4QPGA 1XNBA 2WBKA 2JB4A 2WSVA 5FLIA 2VAUA 2RM21 4XCBA 5LRRA 1UY1A 2ZHKA 3PMSA 4OHZA 4E8DA 2W3JA 1JUIA 1HN1A 3ZYGA 2VMDA 4GKYA 2D6LX 2B5HA 2W1UA 3ZKYA 3FLTA 4YM2A 4D0QA 4K21A 1TG7A 1NG0A 2RR11 2TUNA 4CEYC 2RMU1 1RINA 2Y33A 3JD71 3ZXLA 3FHQA 3POEA 3L2HA 3G6JB 1XE0A 3VBHB 4G3YC 5DG1A 2CL2A 3I59A 1DQ1A 4NHLA 4UF0B 3BOWA 2RDQA 4XFAA 5GZDA 2PHUA 3OGRA 4IV1A 1OH3A 1WW5A 1JOBA 3O7OA 4NIIA 1WD3A 5FO8B 2VZ1A 4A3ZA 1W28A 2BJSA 4DEQA 5KHIA 2R32A 1POV3 2K0GA 3LSDA 2BWCA 3E5XA 4XFBA 2HWE2 3KHBA 4AEJA 3AMMA 2EAAA 4BM8A 1RL3A 2ZA9A 2WAAA 4LE3A 4N9HA 3T09A 1MS8A 1V9U1 2PHRA 4COZA 5KBFA 3T0DA 4GMP1 1RUJ2 4GH4C 1LOFA 2VTXA 3JXSA 4RD7A 4UT5A 1OFNA 1Q56A 4AVCA 3RZMA 3IMNA 1IQDC 1CAVA 3DYPA 4FTSA 1AR81 3ACIA 3JUUA 4S2HA 1HXS1 3RPQA 3P6BA 4OHYA 2YU1A 1ZZ7A 3MHZA 2Y26A 1LCLA 2SBAA 3IKWA 1PGL2 5GZGA 1LEDA 3WZ1A 1AUYA 5JXJA 3C7FA 5JCTA 2PAKA 1W9FA 2VMCA 5IWFA 4INDA 4KQ7A 4P5YA 4XHBA 3FMGA 5A6QA 5F2WA 3J8F3 1R081 1UW8A 3IT8A 3H3ZA 3MLKA 1KXGA 4YZ4A 3JQWA 1AR91 1PO22 5C9AA 1ND3B 4NJ4A 5BNOC 4AEKA 4HT1T 5DABA 5JXGA 5K7PA 1CAWB 2VC9A 3HN1A 2TEPA 3WHUA 4A7YA 4CDWA 1X82A 4K7JA 3T1MA 4GKXA 4CDQA 4AI0A 4AR2A 1CJDA 4QKBA 1FOD2 1ND2B 3O1SA 2KXLA 1XYPA 1OOPA 1BMV2 5FY0A 1RUNA 5FY1A 2XJRA 5L9BA 3LSEA 2XOMA 5F3EA 3ZYBA 1KQRA 1QJU3 4EZ4A 1TMF2 1GLHA 1CAXB 2CV6A 5FUNA 5FJKA 3ZYRA 1LTEA 2E26A 3CBNA 5JWPA 5DMYA 1G7YA 2VW0A 2JG8A 3HQXA 3W20A 1QOTA 4GZ9A 3ZSJA 3IAQA 4M3CA 3VV1A 3HVDA 1UWWA 2BEOA 4X8PA 4ONUA 2CWMA 3WQBA 1ZREA 2VZPA 3BALA 3DCQA 3SMHA 3TYJA 3VBUA 3W21A 4AWDA 4Z8BA 4LKEA 2SLIA 3WSOA 3VKNA 4JQTA 2VOXA 5JR7B 4NPRA 3NNJA 3WD5A 3ZYIB 4N53C 2HWF3 1RUI3 4QXBA 1D2QA 4U36A 4DEVA 1ZZ6A 1HKDA 2P37A 2DU0A 4L97A 5B4XA 1Q8OA 5FZDA 3WHTA 3CJIB 2P3JA 4A41A 1DZTA 2XONA 2I2SA 1LOBA 3TN92 3WDTA 2HWB3 3MFCA 3H9AA 4MG2A 5JPMB 1RUI2 4COUA 3SQOA 5A3MA 4F83A 1Z7S1 1HJGA 3X29B 4Q4W3 5FY9A 1EAH1 3DUIA 4AI1A 1HQWA 3CF6E 5A3TA 4Q1RA 4CCJA 5JOYA 1SLIA 1YFXA 1DGWX 5DAQA 4HETA 1HB1A 5A1LA 2B9UA 4A7KA 4BB3A 4LOSA 1DZQA 1QJX2 4Q4W2 5KXBA 4DMIA 4IGPA 2OT7A 3K46A 4PDWB 3GHMA 4HONA 5A7PA 2XJTA 5FBZA 3OSDA 4BISA 5C4WC 1IS3A 3E6DA 2E53A 4DXRA 3T3YA 1IG0A 3GGLA 2ZGLA 5LATA 2RS31 4WM7C 3ZFFC 5FRAA 2QZ3A 1CJPA 1KDKA 1XJAA 2UY9A 2VZTA 1NYWA 4SLIA 5B2GB 1W8UA 4LBLA 1UNBA 4BQ5A 1HV1A 4YW2A 2VZUA 4R4XA 4WBBA 1Q8SA 1OLME 3GXUA 3VKFC 3AMQA 1H0BA 3R4DB 1VAKA 3N7KA 4YW7A 3HJRA 4RHV3 3AXDA 2XPJA 1NE4A 1NLSA 2BQPA 5FQ0B 4MGTA 2LROA 2RE9A 4LO5B 1BXHA 2DUQA 3GHNA 4ZU5A 1OD5A 2MEV1 4PI2A 4E4DX 3HEIA 3GCWA 4K1YA 3CIHA 2ID4A 2V73A 5FZ6A 4H3WA 3UKTA 1W9WA 1AR63 4ARYA 1DYOA 1VBE1 2WYFA 5FZCA 1RJ7A 5T5JA 1RUH2 1MS0A 1F15A 1PX4A 1S4CA 1DU3D 1MPXA 2OZJA 3F95A 4JGZC 1UY3A 3BTYA 3UGHA 1RUD1 1R1A2 4Q0UA 3VD3A 1AYM2 1BJQA 4BA6A 1W2UA 4XOGA 1ZRRA 2HBTA 5IYYA 5F5IA 4JTNA 4CUBA 1LAJA 4M3CF 3PLQA 3LKJA 3AKPA 4YM0A 3INAA 5T3NA 1W8HA 3VZKA 4LPLA 3DKWA 5J09A 2ZMKA 2G9ZA 4FP2A 1TME2 4LO8A 4PIZA 4BLIA 2HWF1 4ES9A 4BQ4A 3GM8A 3POYA 1ZRIA 2PLV3 1B35C 1WW7A 4UXAA 4RGGA 4MGKE 2VPVA 1RHI1 4E9KA 4F7ZA 5I0UA 2R6QA 4QU1A 2JECA 5BXXA 2XQRA 3WNNA 1F4HA 4DY3A 4R8HA 4QAWA 2HWB1 1CAWA 4CU9A 4BK5A 3MO4A 5FZ8A 2RG4A 1LOGA 2V5YA 5D8AB 5K0UC 1ND2A 1SLBA 1WMEA 2QDRA 2WS92 4XHXA 1UYPA 1KDMA 2VXRA 5LWBA 4ASKA 3VBOB 1VBA3 4KMQA 3OUIA 2WRAA 3FUOA 3OPTA 1V0AA 4WVMB 1CAXA 1WCKA 2IFRA 3OYWB 2ZX2A 1C4RA 2R061 2OW4A 4QB6A 1MQTC 3WW4A 4LO4B 4PLNA 1SLAA 4UOJA 2EIDA 2QCSB 1VPHA 1FMD3 1OI6A 5A3OA 2CSGA 1ZM1A 2WABA 1COV2 1REEA 4XUOA 4OFGA 2GMPA 3WG2A 2BRTA 1NCRB 1OQDA 2Q5TA 4L11A 5EQUA 3M8LA 3ZDVA 4YM3A 5L7OB 1RUG3 3GF6A 2KR2A 2NMOA 4PIYA 2KD7A 2OPWA 4CSWA 5ACA2 5FR3A 2Y6KA 5JPNB 1H8TC 3FHIB 5F7UA 3WUDA 3MBWA 1QJZA 1SMVA 1XU2A 4RHV1 4XW3A 1SBEA 4QM9A 3MGUA 1OPMA 5IVEA 2QKDA 1YEWA 3C7GA 2CTVA 2MNGA 4YVSC 4GWMA 4Q1PA 5ABJC 1O4YA 3OOXA 2RDSA 2KM2A 4P9JA 5F3CA 5LY2A 4IDZA 4KGQA 4RA0A 5E88A 3PU8A 2ZBJA 3QH6A 3I2KA 2ETEA 3WP6A 1NZCA 2E32A 1VMFA 4Q4V1 1PMHX 1SCRA 1AR61 4OZXA 3VDDB 3EYPA 4XBLA 2OKXA 4DNYA 4Q4Y2 1H9WA 1RYYA 4E27A 1ZYBA 5T54A 4GULA 4XCAA 3AZVA 3I8TA 3PUQA 3T0BA 4O9GA 1PVC2 4IEYA 3B93A 1JOJA 1D4M2 4PDWA 1NQJA 4Q4X3 5FMDA 1HN0A 4AL9A 4CCOA 1XXNA 4QQPA 5EJ3A 2EAKA 3ZXFA 2VZVA 3W5NA 3OGGA 1HRI3 4CVUA 4Y5SA 2VVDA 3DKQA 2BVBA 3M3CA 4AEMA 2JDAA 4O7XA 5FZLA 3D6EA 4EROA 4XAEA 2WNEA 5C3RA 4JZRA 3ZFGC 1H8VA 1LR5A 4AAPA 1RGSA 1S2EA 2UU8A 3VBSC 1WMDA 4AVBA 4RL7A 3VDCA 3CJXA 4CXYA 2BP6A 4KBBA 4XZUG 3NMBA 4OZOA 1V6JA 1D0HA 2GNDA 2WZR2 4C8DA 1DQ4A 1O8PA 4DS0A 2R072 4CDXB 2DBNA 3M4FA 4M0HA 1VALA 1CIYA 4BU2A 4QPWA 1VB2A 3N35A 3POSA 1ULCA 3KMHA 4RGKA 2VY0A 3PVOA 1RUE3 2JDUA 2ZAAA 2PHLA 3BTXA 4JX0A 2R043 4UFHA 4EN7B 2W94A 4CP9A 3ROUA 1GZTA 2GDFA 4HKLA 2Q1MA 2YYOA 4Q29A 3GDBA 3BTAA 4LHSA 4PBPA 4M0NA 4COWA 1ZBE3 2G9FA 4NE9A 5A3UA 1GBGA 4PCRA 1LHVA 1W8ZA 1U5YA 5JOZA 3WUCA 1CZVA 1GZWB 3MIEA 5FIXA 2VVEA 4LKFA 3N9LA 1I3HA 4ZZ8A 1UCXA 2XUMA 3IAPA 5FXXA 2BNMA 5FZ0A 4QB2A 2QQJA 3V65A 2D3SA 3AP7A 3IBMA 3POJA 5DUVA 1UOFA 1VBB3 2A1XA 2FMDA 1AXZA 3O0VA 1GU3A 2AYHA 1U5XA 3M3EA 4IEOA 1A8DA 4XURA 4BQ3A 3HNYM 3RZHA 4B7EA 1LOEA 2WO7A 1ZX5A 2E33A 5F3IA 4F3JA 4XF3A 1Q8VA 1EV12 5CU1A 4EWAA 4YM1A 2E51A 4XXPA 1DQ0A 5AVPA 3UJOA 1OURA 5BNPC 4JDOA 1IS4A 5C3QA 1ULPA 4J25A 2Z2SB 3AVSA 2BBAA 4WVVA 5K4LA 2YMZA 2HYXA 2VQUA 1YWKA 5FJHA 2JD9A 1XE7A 1GP4A 2JDPA 2QQWA 4QD2A 3KD4A 1QJY1 4A3XA 4Q4X1 2UWAA 2X29A 1JZ8A 2D7FA 2XUEA 1V70A 4A2UA 2WINB 2W47A 1HRI1 5FYMA 4LKDA 3WF1A 2Y6JA 5DUUA 4CZSA 3U14A 1NKGA 3I2JA 2QQNA 3EO6A 2VCMA 4L8QA 3UGGA 3F2ZA 3ASIA 3L9JT 1NCRA 5C3PA 4WZCA 5L7OA 5I93A 5DDJ3 3AB0A 1XSRA 3NV4A 4DPNA 5JXHA 1XBFA 3IMMA 2WN3A 2Y0IA 5FXZA 4CEYA 1N3OA 1Q8PA 2ZOEB 3C7HA 3IDCB 3R0RA 2G1MA 5JZGC 4EN6B 2J1SA 5ISLA 1YXWA 3AYDA 1FV3A 5IHRA 3NJYA 1S0GA 3O1MA 4KG0A 5A7OA 2P2KA 2WFF3 5ERLA 3L2YA 2E6VA 3N3HA 3OEAA 4YG0A 1C8M2 5KR7A 1QWRA 2XVKA 4QHBA 3RVHA 3LPFA 4FFGA 1TNRA 4AG4A 1PO11 4XTMA 3EXUA 1XYOA 3APBA 5DAPA 1GWMA 1UN1A 5L36A 4FXGB 4XFHA 2WNUB 3NJXA 3POBA 4S2DA 4MOAA 4CP0A 4R9BA 5JUVA 5LK7B 3FFZA 4KG8A 2XBO2 1PMIA 2X5IC 4D94A 5LA0A 2R041 3PDQA 1EY2A 1PK6C 2EIEA 2IXHA 2ZGSA 4QXKA 3RGBA 3TEXA 3WF0A 1OFSA 1YRZA 5EPAA 4DRRA 3PTYA 4NUBA 4IETA 4ZONA 2GP5A 2FD8A 2OQ6A 3N7LA 4AE2A 5EZWA 2ZZQA 3M70A 4GH4A 1CAUA 1VAMA 3DL3A 5FZEA 3CZJA 1ZBE1 3K77A 1POV0 2PHFA 1C57A 3AKTA 4MO3M 2Q8CA 2FDGA 3WQ0A 1AR73 3UGFA 4D6SA 2FCVA 1LGNA 3O1PA 2IXLA 4RS5C 4FFHA 3QCWA 3WP5A 3DPRB 2FCUA 5LA2A 4AF9A 1NOVA 1GZ9A 3OEBA 4UFKA 5A3LA 1MS4A 1JUHA 2VCBA 1R092 1N1SA 2WT2A 1CD3G 4NAMA 4XPVA 1VBB1 3IWZA 4AAXA 2JE8A 4GB32 2R0FA 5A6YA 3AYAA 2DVGA 2CYFA 2HBUA 3ITQA 4MSVA 5FKCA 4QQHA 4B4PA 2R30A 2VQ0A 4P9IA 5T50A 5CFDC 1C8NA 4CDXA 5BNOA 1VBC2 2IVIB 3LB9A 2HEVF 3OCPA 4JV4A 1KRIA 4CU6A 4J1XA 1X7NA 1H1AA 5LBBA 1E5SA 3TOJA 4XBNA 4AVAA 3ACFA 4W65A 5C5TA 2YGLA 2RDRA 4D7TA 4HLTA 1XNAA 4XIKA 5DAVA 1O3QA 2Y64A 4Y33A 1D7PM 1WWYA 3ENRA 1VBD2 4RQPC 3OD4A 3PMEA 1YO8A 5E89A 5F8PA 1F5JA 1WLDA 1JZ3A 2JWPA 1RVF2 3DXUA 1BK1A 2FDJA 4MGZE 4N43B 3UNPA 4UW5A 4FAGA 4HL0A 1ZBA2 5HCFA 3VBRB 3DXTA 4XABA 2OVUA 2ZX4A 4JDNA 5FZ4A 2AEZA 1QY4A 1O5LA 1ENSA 2VNGA 1JZ6A 1ZNPA 2BV4A 1PZ9A 3AKRA 1V00A 3JBG3 5A3NA 3GZAA 1Y4WA 1JZ7A 3A23A 3MV01 2A5ZA 3WNPA 5BNNC 5CFCC 3U37A 2VL4A 4C0BA 3P3NA 2V72A 2VTFA 1N1YA 3DV8A 4FOYA 4YGEA 1FPN1 2BNOA 4IEWA 2VUDA 1JW6A 1XNCA 1REDA 3M3QA 4G9SB 3LDBA 4R9AA 3VD5A 2VM9A 3AK0A 4QPIC 4XJ9A 5E6HA 3BODA 4IEQA 3AYEA 3AZWA 4CDWB 4V1PA 5FP9A 4DUVA 5FZHA 2GU9A 5C3SA 5C6CA 1HRV1 4CDQB 1S2KA 1JBCA 3HN3A 1RUC3 4FVVA 1HQNA 4L99A 1OOPB 3H3UA 1PIV3 2ZJCA 3GALA 4MHUA 4NR1A 5FPVA 1GP5A 4XACA 5T52A 4PF5A 4AFBA 2RM22 3ST7A 5EYXA 3UL2A 2IXCA 2BOIA 1LGBA 5JMCA 1W2NA 5CAZA 3U11A 2BVVA 2XLAA 3NV3A 1Y9QA 2ARCA 4ZU7A 5J36A 2HWC2 1ASJ3 2F4PA 1J1TA 3KB5A 1BEV1 1NE6A 4A45A 1U12A 3FLPA 5C8CC 2JG8B 3VZLA 4XQWA 2RR12 2RMU2 4M3CB 1D4VB 1UYZA 4EWDA 3JD72 4FXKB 3LIGA 3ALQA 4XYXA 4LMFA 3PVBB 3AX4A 3POFA 4LBQB 5C4WA 3I2FA 2Y6FA 1JYWA 1VRBA 2WO1A 2VUAA 3FLRA 3EJKA 1QQP3 3MW4A 1WMFA 3KQ4B 1WGPA 4W6YA 5GZEA 1UY4A 5FK8A 1WCUA 3LOIA 1MS3A 3WDUA 2P5BA 1VE0A 2E7TA 2ZGQA 4LBNA 5CVRA 1DQ2A 1OUSA 3CZUA 1PM4A 1W6OB 3M3OA 4W50A 5FREA 4DQAA 5LY1A 4P00B 4UWDA 5A3WA 3J7NA 1QMJA 4KI5M 1UMZA 1V9U2 1ZZ9A 2DCZA 2O0OA 4FPGA 3WINE 1X9PA 3GYDA 4AW7A 3ZXAC 2GN3A 1B09A 4N8MA 1LOCA 1KFXL 5IVCA 3SCFA 1UZWA 2EIGA 4V2WA 4WM8B 3NO8A 3HNBM 3OBZA 4YZ3A 1QXPA 2C24A 2ZABA 2PQSA 2VCAA 3K48A 4JGZA 4FPFA 3MW3A 2XHKA 5A1FA 4CUAA 2IXIA 5FZ3A 3VD7A 1F8VA 2P1BA 2Q8DA 1QHDA 2HWD2 3KQRA 1H30A 2BFUS 3THCA 4QHOA 4HMZA 4XQ4A 1NZIA 3H0OA 4LORA 3ZLIA 3DPRA 4AEDB 3RZKA 2ZAHA 1Y3TA 4DY5A 1K5MC 2JDKA 1AR92 3OBAA 2E31A 2K46A 3BCWA 2W2IA 3AZYA 1KFUL 1TEIA 4TLGA 1AL21 1L7RA 3SHRA 3JCIA 3S30A 4FP3A 3UV9A 1OLRA 2AZ5A 2RDNA 4V2VA 4CPBD 2RS13 3BIWE 3J7MA 2HWE3 4K3UA 4OULA 2YZ4A 2DYCA 5JMOA 2ZXQA 1CONA 2XVLA 4EN8B 4CDUC 1RUJ3 3LEKA 3MIBA 1NXMA 2ZX3A 3RQ0A 5K0UA 1CQ9A 2CU5A 4XILA 2RS12 3OBRA 2WZEA 1AHSA 1AX1A 3K51A 2D97A 3POGA 2XB6C 2D6KA 2NMNA 3IPVB 4LBQD 1UZ0A 4LXLA 3HPNA 3I2HA 2W68A 4IEPA 4QXHA 5FV3A 2DCKA 3U4SA 4EZHA 1NCQB 2ZEWA 4IESA 5T5PA 4JKKA 2YB7A 3VL9A 3WG3A 4N43A 2KA3A 4YVWC 3GBGA 1PM7A 3VBRA 4CCLA 3DF0A 4TYSA 5C7GA 4YRDA 4BLJA 5CBLA 5KHJA 3RZZA 1Y43B 2DCTA 3ZIWA 2JJ6A 3VZOA 1BZWA 3WNLA 1FXZA 4B4QA 4LBOA 2RHPA 1QQP1 1PO23 2EXJA 1EUTA 2YC0A 3E97A 1W0OA 1AF9A 4TXWA 3LWCA 1GKBA 1SPPB 2YC2A 3FZ3A 1J3RA 2Y38A 1LHNA 1FOD3 4W6XA 4FTEA 1Z7S2 3I2DA 2JDHA 3FE5A 4Q8KA 3LOBA 1EAH2 4A7ZA 2XHNA 3VN4A 4Y1VA 1JZ2A 4MYEA 3IIAA 1W6PB 3MPPG 2X09A 2ZHMA 2GNMA 3I7DA 4YVSA 3POIA 3U75A 1TMF3 1FYUA 1GV9A 2Q1FA 3M7AA 5FYCA 5ABJA 3K75B 2VU9A 4EJRA 3SKVA 1I6XA 1CPNA 5HPOA 4I3PA 4AI3A 1C1FA 1UF2C 1LECA 4BHPA 5CKQA 1BQPA 5DZFA 3I4IA 4CPBA 1FV2A 3CNAA 3VKLA 4TZDA 4XTPA 2Q8OA 4OVEA 1I5PA 4WZFA 5I0RA 2F6BA 1QXJA 2VMHA 2BERA 1QH6A 2XJUA 5H9RA 3HQUA 5FY5A 2ZCWA 1JHJA 5LBCA 5L19A 4UW4A 3ZSLA 2ILMA 4ZZ5A 1XRUA 3T4VA 1W2OA 3HOBA 1H4HA 3KZ4C 3I54A 3JZVA 3RZJA 4LBQA 3VHRA 3RDIA 4K6BA 2BWAA 2OUHA 3OGVA 1GQHA 2BOJA 3TN93 5DUXA 2WKKA 1UY2A 2OX0A 2BNNA 3EBRA 3SLIA 2H0BA 2WWJA 4W6WA 4BZ4A 5JSRA 3AP4A 3J7LA 1UYYA 3ZFGA 5CADA 1ZZCA 4LQRA 5AVAA 3SH5A 3VBSA 2IXKA 2VOKA 1T6GC 4URAA 3NQHA 2VMFA 5JIAA 1XOYA 5FP8A 1C3HA 3K4AA 4LUMA 1W6OA 1VBE2 4NWVA 1C5HA 2A7AA 5C8WA 2P6HA 4PBOA 5DAXA 4AGGA 4AOCA 1QDOA 5DG2A 5CFDB 1QJX3 5KWRA 3H8OA 1MEC2 1POV1 1RUD2 1ZA7A 4BYYA 4DOUA 1W8WA 5L9RA 5FFOC 4JHTA 1CZSA 2GN7A 1GNYA 1LULA 2BBVA 3LD8A 3ZFEC 3LGRA 3Q9OA 2VOVA 2DVAA 4FPJA 1SFNA 2W52A 4LHNA 2ADEA 1IKPA 4WM8A 4UFIA 3VZMA 5IFTA 4I3GA 1OSGA 2XKPA 3OF1A 3WDYA 3M1HA 2JG9C 4DO0A 5JSPA 3LF7A 1PGL1 1W2TA 2ZHLA 4OHVA 4D7YA 1W9SA 4FOWA 4QX7A 3E5QA 1VIWB 1V6KA 2H0VA 2WO2A 3EB7A 1G6NA 3MV11 4DUXA 5FP3A 2ZGOA 3WV6A 1NA1B 3BPSA 4UW6A 1UPIA 2JKBA 1UXZA 1NXD1 2B46X 4AEDA 1RHI2 2GC3A 4XMAA 4DZGA 1A3KA 4Z2WA 2XQXA 1EP0A 1BHGA 4NMIA 2HYKA 2MPFA 4Q0SA 1O4ZA 4EN9B 4OUEA 2YPJA 3J8F1 1H4GA 4QKFA 2XJVA 5A1AA 2V5DA 5F39A 1OA4A 4IV3C 5FYSA 5FYIA 3M3IA 1RUH3 1TMF1 1WW4A 3AL6A 1R1A3 2ZGMA 2LM3A 3A22A 3N9NA 3WCSA 1AYM3 2PN5A 2R062 4IW3A 3CO2A 1CVNA 1MACA 1UZYA 1WCDJ 1YFWA 3USUB 4JGYC 4HZFA 5BNPA 3BPZA 2UWCA 2WUHA 3ILRA 3NAPC 3RI8A 1QJU1 1V6NA 2D6PA 1CR7A 2PYTA 2QBXA 2XLFA 2VUCA 2ZX1A 3IPVA 3I3BA 4CXXA 4MGYE 1I5ZA 4UFMA 4NHYA 3WW1A 4OYUA 1FATA 5C70A 2A73B 3O12A 1PZ7A 3HIFA 1NCQA 3VBFC 4UW3A 1TME3 4CP9B 5FLHA 3S0MA 4B4RA 1UZVA 1XE8A 5CNAA 3O1VA 2ORZA 5LA9A 5I8YA 2UWBA 1SHWB 2OS2A 3I3MA 4AFAA 3I3QA 1QKQA 2VNVA 2VOTA 1HQLA 5HV4A 2F17A 5F6LB 3TEYA 4RYDA 3CQOA 1GFF2 4B8EA 4KWKA 1PMJX 1X9TA 5SV5A 4OHWA 3A7QA 1RUI1 1SPPA 1VRH2 2WL1A 2BGCA 4RFT0 3UJQA 1ZRFA 2XJPA 4O61A 4QPGC 5F2SA 1KJRA 5JOWA 2WS93 1S1AA 1ACCA 2FDIA 1PVXA 4Q4V2 5JZGA 1MZ6A 1VR3A 1JN2P 4YG3A 3ACHA 4QWNA 4BXSV 1US3A 2ARAA 3P3PA 1W6PA 2VW2A 4HSJA 5AC93 4KNCA 5I0DA 4OLLA 1PGSA 2CWSA 4RGAA 4RR3B 1G9FA 4OI1A 1JOPA 4Q4W1 1W2AX 4MH0E 4XF1A 3NL1A 2J1EA 1WZXA 5LBEA 3VHPA 2Q0AA 3ES1A 4KGGA 1LB2A 2VBDA 3U10A 3WNKA 5AC92 4YARA 1COV3 1UXXX 2ZZJA 3LZZA 1DZRA 4AXOA 2EICA 4UFJA 5JVVA 4IV1C 1L3JA 4I30A 2X5IA 4QPYA 4R4ZA 3ZPYA 1GNHA 3JB4C 4LNVA 5FTTC 1H6XA 5I8SA 5ACA3 1DBNA 3B94A 2X53S 1JS9A 3WP4A 4EQVA 2XH6A 5CKNA 1MVEA 2GZWA 1GZCA 3A0KA 1OA2A 1EPZA 1SDDB 1T6BX 2ZTNA 3SITA 4YZ5A 1GICA 2UY8A 1S0BA 4YG6A 3PUIA 4RS5A 3WP3A 4BXFA 2YDEA 3W58A 3CEWA 1KS5A 3VDAA 3OJBA 3AVRA 3NV2A 3I2OA 3LA2A 4CEYB 1LOFC 4ZY9A 3KSCA 3THTA 4DRVA 3V0AA 4NHMA 1SLTA 4AHXA 4QKNA 1HB4A 1UMHA 1F35A 4MADA 3T4HB 2FZ2A 4Y1XA 4PT6A 4HG6B 4Q4Y3 3P5BA 2CGOA 4ITCA 2WNVC 3NKGA 1BBT2 5DXDA 4CRQA 1H6YA 4EE2A 1WKYA 4AVSA 1DGRN 1BLZA 1HDKA 4PI0A 4MX3A 2WWUA 4JTOA 5CFDA 1XSQA 4ES8A 3O1RA 1PVC3 4HK9A 2ET1A 3D3AA 5FPBA 4LULA 3UT0A 1WD4A 1D4M3 1I9RA 3DYMA 2WYSA 1ENRA 1IOAA 3WXPA 5J96B 5FMBA 5DQ0A 3KF5A 4DUWA 2GNBA 2YFUA 4CYDA 2VXJA 2WC2A 3PUAA 4LHKA 2C6SA 3HMYA 4IE4A 4LLOA 4XUPA 4X8NA 4XJWA 3W9AA 2QQPA 3AJZA 1TME1 3BTZA 5T5OA 2NLRA 4GH4B 1CAUB 1NY72 3O1TA 2E7QA 1NA1A 4FO9A 2A71A 4IEUA 2PTMA 4JC1A 1OKOA 2VMIA 1BCXA 2WZR3 3PNAA 4MLOA 2G9GA 2J1AA 5DZGA 1WBLA 5GLTA 3WG4A 4ASMB 1JH5A 2WIIB 2R073 1M4WA 2PLV1 5EJ1B 3PUHA 3ZYHA 1ODNA 3BVCA 3PURA 5FZ1A 4YWAA 3MLJA 1LU1A 1GUIA 3JU9A 3KVAA 1UIJA 5JI9A 3BU0A 3Q8BA 4M3CE 3CKHA 4IEZA 4Q0PA 2RJ2A 2D3RA 3VBUC 1W06A 2DBIA 5BNOB 3B7MA 4RSUA 3KV6A 3KVBA 3ZM8A 4E2GA 2VD7A 3JQXA 2QQKA 1DDLA 1MS1A 2ENRA 3O5SA 1QJY2 4KWLA 1VBA1 2DV9A 2WJSA 2IXJA 3USUA 1QH7A 3RI9A 3DEMA 1VP6A 1G86A 2XL7A 5IK8A 3MF9A 2JDNA 4NPMA 5FYVA 2ZKLA 1MS5A 4JKLA 2ARXA 2VECA 3KLSA 5LBFA 3QD6A 5DZEA 3QLQA 4YW1A 4I2OA 5ACA1 1FMD1 1LEMA 1Q3EA 2YY1A 4M00A 3VZNA 5JOXA 2E9QA 4CEWC 4AFDA 1ULDA 4NVPA 5C8CA 1JYCA 4LR4A 5JAXA 2QNKA 3FJSA 4NN0A 5EIYB 3E6BA 4C0HA 1RUG1 2YPDA 2JDYA 5JDBA 4QX1A 4UBGA 4YW4A 5FAXA 5FYYA 4ARXA 1EV13 3HR9A 1UOJA
chains in the Genus database with same CATH topology
2Z79A 2GNTA 4K20A 1WA4A 4BQ1A 4N7IA 2YUEA 4N53B 4N7UA 1YIPA 1PO12 2Q30A 3RNSA 1UPSA 1N1TA 4PLOA 2VULA 4RR3A 4S2GA 1PVC1 3MICA 3O0WA 1D4M1 3TNQA 1F9KA 4FQZA 3VBHC 2VVFA 2JDZA 1AVBA 2W39A 3ZXKA 3FWEA 1Z78A 1IHMA 5GJ6A 4IEVA 4META 1DG6A 2CGPA 4ATEA 4YLZA 5KXDA 1ENQA 4AHYA 2RS52 5F1RA 4YFZA 1CX4A 4X6RB 1IGOA 1X33A 3MYXA 5L73A 5C4WB 1Q5OA 4BIFA 5I0SA 3ZFFB 4WM7B 1C8M3 2EVXA 1K5MA 2A6XA 1WW6A 1XQNA 2P34A 4NOTA 1IPKA 1AJKA 1H2LA 5IK4A 4F8AA 1CGPA 1AXKA 2VG9A 2XBO3 1S0CA 2XL9A 1XNKA 1YNAA 1DGLA 2WQ4A 3KT1A 1U0AA 4AI2A 1IS6A 2NM1A 3G7DA 4JCKA 2A3XA 2ZKNA 5FMOL 5HXVA 1RUE1 3ZSKA 5GLUA 1ND3C 2VW1A 4M01A 4JGZB 1QF3A 3SCGA 1R093 1S0JA 1ND2C 1G9AA 2ATFA 2WZPP 2C9AA 2HJIA 4GB33 5E16A 3DN7A 3N7MA 4D69A 5FOBB 1MR5A 4GALA 4I0WB 1FPN2 2VUJA 1FX5A 2IWGB 1PNFA 1EV11 1FNYA 3MW2A 4FQ4A 4KU7A 1VBC3 2NQYA 2WA4A 4Y1UA 3ILFA 2XJSA 1HRV2 3U4XA 1A8MA 3ZXJA 4D7SA 1ULGA 1B35B 3ILNA 5FCCA 1CPMA 4HVQA 2A6ZA 4LO6B 4LBMA 1VBD3 3EHKA 5FLJA 1LENA 1RVF3 4YW3A 5K0UB 3CLPA 3TB0A 1BEV2 1ZBA3 2FQPA 2Z69A 1YJKA 1WLWA 3HT2A 1J3PA 3H1MA 3NJZA 3CJIC 4E2QA 4FAHA 2Y0OA 1RJ8A 1G9BA 1V6IA 3VHNA 1WCSA 1SEFA 1I1EA 2WWSA 5A33B 2HEWF 1MQTB 1C5IA 3NVCA 1CIWA 2EXKA 5BNQA 1D0GA 2QFEA 2O8OA 5DDJ1 1AYN2 2PA7A 1ONAA 3POWA 1RUF3 1J59A 1RC6A 5BY5A 3ZXEA 2JE7A 3B02A 2W08A 3T1LA 4PDWC 3OPZA 1TE1B 4N53A 1H8TB 4P9WA 4YSFA 3D82A 2WFF1 1APNA 1LHUA 1MZ5A 4XE9A 1RUF2 5EV7A 3S7IA 3GZUC 2RM23 2DF7A 3H7JA 3OD0A 4YVSB 2OA2A 1RMU2 1WLTA 5ABJB 1QNWA 4TLFA 2HWC3 4E2SA 2CY6A 1A78A 1W6NB 4Y4YA 5DUWA 1W6QA 4P9GA 3B5LB 4XF0A 4QQOA 2QZ2A 3R05A 2RR13 4XFFA 2RMU3 3O0XA 3N4MA 3JD73 1W39A 2Z42A 2AR6A 4K9SA 4SBVA 4COVA 2VH9A 2PFWA 2OYZA 4K8FA 2YGMA 2WSUA 3FBMA 1SCSA 4HKOA 3TNPB 4CTEA 2JG9A 3DGTA 3WW2A 2OUJA 1AR71 1AL22 1LU2A 2B8MA 2UYAA 3SXWA 2JENA 3VUOA 4H7MA 1ZVFA 1ZA4A 3ZIXA 3HT1A 1AXYA 3ZFFA 3KS7A 4WM7A 4AYUA 3CU7A 4AHWA 3QOPA 3NV1A 4HKWA 5T5LA 5J48A 3ATGA 1LESA 4AQ6A 4PJYA 1V9U3 4MXWB 3ZFGB 1DIWA 1HV0A 2ERFA 1IQAA 3H8UA 1O5UA 3VBSB 3OGJA 1FAYA 3H1WA 5T55A 2OIIA 3IM0A 1PGW1 4IV3A 5KXCA 2AUYA 3ES4A 4YGDA 5GLWA 1IS5A 3MIHA 4K1ZA 1X8EA 3SCHA 2CAUA 4FOQA 2HWD3 2QVSB 2YV8A 4NHKA 1AR82 4QU2A 3WQ7A 1HXS2 3AM2A 3ME2A 1E57A 1RITA 4IERA 3S6PA 3TAYA 1AR93 4YGBA 5D8AC 2DUOA 3VBOC 3ZYPA 4YZ2A 2TBVA 2ZMLA 1R082 2WQZC 3JBG1 2DTWA 2O8QA 2ARBA 3D8CA 1J58A 4DFSA 3PVEA 4XJAA 3RJRA 4BPZA 5LEKA 1UX6A 3AFGA 1B35A 1TNFA 3B3QE 4AHZA 2C1FA 1S0FA 1W6MA 2JICA 2XKOA 4P14A 1DQ6A 2XWJB 3ELNA 1H1IA 2PAEA 2B39A 1NCRC 4LLFA 5L7OC 4EWEA 1RUC1 5J3UA 3HAGA 3RMYA 2HWC1 1LOAA 2R0HA 4LEJA 3B00A 3ETQA 2MHFA 1U5ZA 3ZYJB 1PIV1 1QOSA 5GZCA 3ZN5A 2VOWA 5BNPB 3MI8A 1UU6A 1SLLA 3V64A 4YFWA 4JVAA 4FT8A 5KHHA 1VLNA 3MFAA 3ECQA 4MV2A 3R4UA 4COYA 5I8TA 1O3SA 1ASJ1 4DXZA 4EN0A 5FO7B 3MDPA 5A33A 1H1MA 1MQTA 4Y22B 1SBDA 3TWIA 3VDDC 2RJLA 3WVJA 4X6QB 4OI2A 3VHOA 4FPOB 1Z7S3 5CG8A 4GIQA 4ZU4A 1EAH3 1WUVA 1YI7A 2AH2A 3NSTA 2Q4SA 2ZPXA 1RUOA 1R1ZA 3AZZA 4EV0A 1MZEA 2R49A 4FPEA 3H1YA 4URTA 1H8TA 4LBKA 5JZGB 2DTYA 1ZRCA 1F2NA 4YYOA 3E5UA 5FDBA 5BPXA 1LRHA 5I0TA 1GYKA 3PJYA 2GMMA 4XDQA 1DF0A 2B45X 2Z5WA 2WNVA 4XETA 1YIFA 3B69A 2VGDA 2ZS6B 2QDNA 4XFGA 4LA3A 2GAUA 2RS33 1W6NA 3C3VA 2D44A 2A75A 2HWD1 4LTAA 4XQDA 3WG1A 5GLZA 2QUOA 2XG3A 2ZGUA 1V6MA 4H14A 2D6OX 4BWOA 3KT4A 2X5IB 3FFQA 2RS32 3FC0A 4CDXC 1BVVA 1YI9A 3NWKA 1PK6B 3KCXA 2VNOA 5JWPA 3AFKA 4N90A 5CIRA 1N3PA 2MEV3 2EALA 4DOUA 1NLRA 3UKNA 3ZSEA 2NYYA 5F5QA 5J98B 5BYNA 3J8F2 4LA2A 1OQEA 4FPCA 3ZVXA 4OUMA 5LEJA 3SISA 1VBE3 4RS5B 2FZ1A 2DCJA 2GALA 4O9EA 2MEV2 1SBFA 4MXWA 1HX6A 3R4SA 3V0AB 2I74A 1MEC3 1RTVA 1RUD3 1UD1A 4Q0VA 5JIUA 2RS11 2HWE1 3RG0A 4HN1A 2ZMNA 1QJU2 4JDMA 3R6SA 1AZDA 1XNDA 2C0ZA 1RUJ1 4BE3A 2EXHA 3FUQA 1QOOA 1VAVA 4XIOA 3ZDSA 2DCYA 1ENXA 4NO4A 4C1XA 2RJKA 4J1WA 5IK5A 1BVP1 4GQ7A 1YFYA 2BUKA 4Q8LA 1U5IA 1W0PA 4XJ8A 1RHI3 1V6OA 2PHDA 4RQPB 4BOWA 1OLQA 3SNMA 1QXRA 4Y24A 2HWF2 1XYNA 4WV8A 5IK7A 4AQSA 1G9DA 4FBFA 2JXAA 4CEWA 2QE3A 1PO21 4HVOA 5CG9A 2BFUL 4C1WA 2ZGRA 4G4FA 4K40A 4Y5Z0 3ZMOA 2HWB2 4YW5A 2BW8A 4H7LA 1O91A 3QH7A 5EFUA 4ISRA 1FOD1 3WDWA 4I0BA 3QACA 2YXSA 5CFCB 2R063 4LUKA 2D98A 4YZ1A 5BNNB 1BMV1 2FHRA 3KCYA 2DWRA 1TQ5A 2DVFA 3B01A 4QPIB 3THPA 4IQPA 2D6NA 4IL7A 2DU1A 4Q27A 3OY8B 1ZZBA 1LJ7A 4CP2A 5AFEA 2IC1A 3VGIA 1OKQA 3ZN4A 1REFA 3WR0A 2AGSA 5JLVA 2I45A 3RRDA 3RSJA 3VBHA 3AZXA 4L2NA 4QGNA 1H2NA 2IZWA 1H2KA 1O4TA 4XF4A 3ZN6B 2OZ6A 1VRH3 2WT0A 4P9LA 4Y22A 2NP0A 4MXVA 5C8CB 2D40A 2PHWA 2WNUC 4RHV2 4Q4V3 2E63A 4AQ2A 5I91A 1KJLA 1YLLA 3TN91 3RJ2X 2FBEA 5K9YA 2WT1A 1MEC1 1DGWA 5J37A 5GZFA 2FMYA 1AL0G 1RB8G 5HCBA 1AR62 3A4UA 3S7EA 3QBQA 4XBQA 1X36A 3DPRC 1NQDA 1MZFA 2V09A 1QJX1 4R52A 2ZGKA 4HN0A 1Q43A 1LHOA 4AFCA 2B42B 1MVQA 1JYIA 1DQ5A 4I01A 4XJZA 1X8MA 1UU4A 2PAMA 1GNZA 5LRSA 5KC5A 3NW4A 3U07A 3MF6A 1ND3A 1PK6A 4OUSA 4FSJA 2GC0A 1ULEA 3AMNA 2PLV2 3AKQA 1PZ8A 3VL8A 3AJYA 1V6LA 1FNZA 2OPKA 4ISQA 4WVZA 1KITA 5KXEA 1S2BA 3WQ1A 1AX0A 3VZJA 1BBT3 1K5MB 4N43C 1ZRDA 3VBRC 2JE9A 1UU5A 4H55A 3WNXA 4S2FA 1VBA2 3D0JA 4GWNA 3MEPA 1RUH1 3UKVA 2DURA 4LO7A 2JD4A 1Q8QA 1R1A1 1AYM1 1J1LA 3H7YA 3WDXA 4R9DA 1DFQA 3PHMA 4CDUB 2N7GA 4JRAA 1FMD2 3AMPA 2R1BA 4B7KA 2B7YA 2D5HA 4L9BA 4DINB 5C9AC 1BKZA 3AYCA 4CDWC 2R16A 3CJIA 4RQPA 5LK5A 1RUG2 2GC1A 1VRH1 3AMHA 4MVTA 4XEZA 2UYBA 4CDQC 1G9CA 2GC2A 2EXIA 4AVTA 3V56A 1DYKA 4FOVA 2LALA 3RMXA 2XLGA 1OOPC 5BUVA 4YVWB 4Q26A 1F5FA 5FMOS 1GANA 2WFPA 4B3NA 3SH4A 3VKOA 3LA7A 2NZ9A 1AJOA 2WA3A 1VJ2A 2NPIA 3ACLA 1BYHA 4P9YA 2WS91 4LT5A 2JG8C 5BNNA 5CFCA 1QJY3 1QDCA 1QU0A 4XZPA 3GBWA 4GXLA 1X50A 2BYVE 2D5FA 2EA7A 2ZX0A 5AC91 5AFBA 3WT3A 4FPYA 2K2SA 1RIRA 3E6CC 4P9XA 1DHKB 4QPIA 3LAGA 1ALYA 4AQTA 1JXNA 2GH8A 3OY8A 3NKTA 5JI7A 1LHWA 5IT6A 4Q4X2 5KC6A 4BMEA 4ASLA 1JHNA 4GA9A 4U2AA 3V0BB 1COV1 4UBHA 4MUVA 4QQ2A 3TBDA 1DLLA 1HRI2 4JQRA 5H9PA 3N7JA 3MLLA 4Y1YA 2D6MA 5FQ0A 2BTVC 4HANA 3ZN6A 5SV8A 1PHMA 3WY6A 1D2SA 5A32B 1YCIA 3B9IA 1F31A 2D3PA 1PO13 4FPLA 4FPKA 4WM8C 2A6WA 1BBT1 1YUDA 2P3KA 1DYPA 2P17A 4IEXA 2A70A 4E4ZA 4IXLA 2GSYA 3HWJA 2JEMA 1SFYA 3IN9A 4Q4Y1 4BMBA 2EF6A 4XXAA 4Y26A 2HKXA 4JRLA 5FPZA 4HK8A 3WLUA 2A3WA 3B9CA 4Y20B 3RS6A 5K8SA 2UURA 1RUE2 2D93A 4AEDC 1OPOA 1QNYA 4QM8A 2PHTA 1MS9A 1WBFA 2R042 3AP6A 3AXEA 5KHKA 1OHFA 3FX3A 4D3WA 1CN1A 1W6QB 1IZ3A 4AI8A 1NY71 4HFSA 5FO9B 2RS53 4PLMA 4GMP0 3PVNA 1ZBE2 3ZFEB 3ZSMA 3FBYA 1C28A 3RYKA 4HVRA 5E1RA 1KD7A 2XJQA 2BPA2 4XJUA 2JG9B 1N1VA 2GMEA 2O1QA 4FCAA 3J9SA 5D8AA 1CESA 1VBB2 3RWNA 3IDEA 5HBAA 2WZR1 3VBOA 4Z92B 1YFUA 1N47A 1Z0HA 5E8AA 2R071 3ZMNA 4BH9A 4WVMA 1SQ4A 1URXA 1NCQC 2LTNA 3OYWA 2DVBA 2DVDA 3WW3A 1FI2A 1YJLA 3ZXGA 2A6YA 2W0XA 2ZACA 3GNEA 2ES3A 3MIGA 1SLCA 3AP5A 3KGZA 1OMIA 4I0AA 4QX5A 3VLBB 4YNIA 4IV3B 5KHGA 2A6VA 1DGRA 1Y7BA 4Y1ZA 3MIDA 4CDUA 2WLQA 3JB8A 2ZGPA 1HW5A 3M2MA 4R9CA 3OTFA 3USSA 4JGYB 2G4IA 3NAPB 4N9IA 4HPKB 4FPHA 4YGCA 1FPN3 1H9PA 5DDJ2 1GQGA 5CA6A 1PNGA 4ATFA 1J3QA 1O3TA 3VBFB 2YROA 1YHFA 1ZZ8A 2ZGTA 5HCAA 2CAVA 2HEYF 3PJQA 4YVWA 1HRV3 2D43A 5F9TA 3VDDA 5J7MA 2CGNA 4Q2FA 1UKGA 4ZKTB 3KM5A 5IUQA 2WFF2 2WLPA 3ZX7A 4Q0QA 1UL9A 3ZO0B 2E7AA 3MIFA 1EYBA 1LGCA 1UIKA 1HLCA 1UAIA 4QPGB 3GZTB 4AGVA 2QJVA 3GBFA 1W6MB 1BEV3 5TSWA 3LCPA 4QGLA 5H9QA 2AENA 4AVVA 4KWJA 4BIOA 1A6CA 4TSVA 5D1IA 3T2TA 4Z1VA 2P3IA 4KU8A 2H6BA 2K9ZA 2VMGA 4I02A 2RS51 4HBNA 4I09A 4XF9A 3V0BA 2H6CA 1O3RA 1M06G 2AREA 2DFCA 2C5DA 3RYPA 1S55A 1VB4A 4XFCA 4AK3A 2LUWA 1AR72 3I59B 3KT7A 5FOJB 1GR3A 1AYN3 5BV6A 1JTZX 1GSLA 1LKNA 5EWSA 2Q1ZB 2XGXA 2ZHNA 4IV1B 3WDVA 1UZZA 3AKSA 4ORFA 4QQLA 2A3YA 1QGLA 5A32A 2X8KA 3D4KA 3U0ZA 4OHXA 2XWBB 4MGIE 3TRSB 4TWTA 3C2UA 4L92A 1O7FA 1C8M1 5GALA 3O14A 5F6KA 3D0SA 1RMU3 1PGW2 4J6GA 2CNAA 2DFBA 1EPWA 2PELA 2ET7A 4HSLA 1NA1C 4ZXKA 2XBO1 1CAVB 3N36A 4Y20A 4LBJA 4PQ9A 2WNVB 1ULFA 1LODA 3UK9A 1GZWA 3HBZA 4AFMA 4KH9A 5EYYA 4OI4A 2JX9A 3J4UH 1AL23 3KCCA 4Z07A 1FT9A 4Z82A 3ZFEA 3KGLA 3ZXDA 1YYNA 5C9AB 4FTBA 1R091 5JSOA 3JBG2 3IDBB 4QT6A 4JAAA 1S0DA 4AGRA 2NN8A 1OA3A 4GB31 2TNFA 2ZGNA 1S0EA 5GKAC 2YHJA 1WLCA 1C1LA 2DUPA 4LHLA 4XMIA 1VBC1 1HIXA 1UKRA 3WCRA 4LE4A 3HD8B 3URFA 3AP9A 2VNRA 1RUC2 2IFWA 4DB5A 4GMP3 3VKMA 3EQEA 1PIV2 4KL1A 4P5HA 1SDWA 1VBD1 3BU7A 1XU1A 1AR83 4BCUA 1HXS3 3OBTA 4MZUA 1AX2A 5CB7A 3VBUB 1RVF1 2PQQA 4C91A 1ASJ2 4B29A 1H2MA 1ZBA1 1S0IA 3SH3A 3MZHA 1IPJA 2PHXA 4JGYA 5H9SA 5EXOA 3NAPA 1KS4A 3MPBA 1G8WA 5HI0A 4HPKA 1AYN1 3D5OA 1R083 1IKQA 3CL1A 3LA3A 1N3QA 3WX5A 1QQP2 4RR3C 2I07B 4PIXA 3VBFA 2GH2A 3BOPA 4WVWA 3A0NA 5GLVA 3H50A 4XFIA 3J26N 2XVGA 4CEWB 5GM0A 1SACA 3W59A 1RUF1 4OI0A 2WNUA 3BB6A 4NWWA 1RMU1 4E4SA 4C90A 4QGMA 1OQ1A 3WOGA 5C33A 4CP1A 2R1DA 4QMAA 2VQAA 4QPGA 1XNBA 2WSVA 5FLIA 2RM21 5LRRA 4OHZA 2ZHKA 3PMSA 1JUIA 3ZYGA 4GKYA 2D6LX 2B5HA 3FLTA 4YM2A 4K21A 1NG0A 2RR11 2TUNA 4CEYC 2RMU1 1RINA 3JD71 3ZXLA 3L2HA 3G6JB 3VBHB 4G3YC 5DG1A 2CL2A 3I59A 1DQ1A 4NHLA 3BOWA 5GZDA 4XFAA 2PHUA 4IV1A 1WW5A 3O7OA 1WD3A 5FO8B 5KHIA 2R32A 1POV3 2K0GA 3LSDA 2BWCA 3E5XA 4XFBA 2HWE2 4AEJA 3AMMA 2EAAA 4BM8A 1RL3A 2ZA9A 4LE3A 4N9HA 1MS8A 1V9U1 2PHRA 4COZA 5KBFA 4GMP1 1RUJ2 4GH4C 1LOFA 4RD7A 4AVCA 1OFNA 1Q56A 3IMNA 4FTSA 1CAVA 1AR81 3JUUA 4S2HA 1HXS1 3RPQA 4OHYA 1ZZ7A 2Y26A 1LCLA 2SBAA 3IKWA 1PGL2 5GZGA 1LEDA 3WZ1A 1AUYA 5JCTA 2PAKA 4INDA 4KQ7A 4XHBA 3FMGA 3J8F3 1R081 1UW8A 3IT8A 3H3ZA 3MLKA 1KXGA 4YZ4A 3JQWA 1AR91 1PO22 5C9AA 1ND3B 5BNOC 4AEKA 4HT1T 5K7PA 1CAWB 3HN1A 3WHUA 2TEPA 4A7YA 4CDWA 1X82A 4K7JA 3T1MA 4GKXA 4CDQA 4AI0A 1CJDA 1FOD2 1ND2B 2KXLA 1XYPA 1OOPA 1BMV2 1RUNA 2XJRA 3LSEA 1KQRA 1QJU3 1TMF2 1GLHA 1CAXB 2CV6A 3ZYRA 1LTEA 1G7YA 2VW0A 2JG8A 3HQXA 1QOTA 3ZSJA 4M3CA 3VV1A 2BEOA 4X8PA 4ONUA 2CWMA 1ZREA 3BALA 3SMHA 3TYJA 3VBUA 4AWDA 4Z8BA 2SLIA 3VKNA 2VOXA 5JR7B 4NPRA 3ZYIB 3WD5A 4N53C 2HWF3 1RUI3 1D2QA 4U36A 1ZZ6A 1HKDA 2P37A 2DU0A 4L97A 1Q8OA 3WHTA 3CJIB 2P3JA 1DZTA 3WDTA 1LOBA 2I2SA 3TN92 2HWB3 3MFCA 3H9AA 5JPMB 1RUI2 4COUA 5A3MA 4F83A 1Z7S1 3X29B 4Q4W3 1EAH1 3DUIA 4AI1A 1HQWA 3CF6E 4Q1RA 5JOYA 1SLIA 1YFXA 1DGWX 4HETA 2B9UA 4A7KA 1DZQA 1QJX2 4Q4W2 5KXBA 4DMIA 4PDWB 3GHMA 2XJTA 5FBZA 5C4WC 1IS3A 3E6DA 2E53A 2ZGLA 2RS31 4WM7C 3ZFFC 5FRAA 2QZ3A 1CJPA 1KDKA 2UY9A 4SLIA 1NYWA 5B2GB 4LBLA 1HV1A 4YW2A 4R4XA 4WBBA 1Q8SA 3VKFC 3AMQA 1H0BA 3R4DB 1VAKA 3N7KA 4RHV3 2XPJA 3AXDA 1NE4A 1NLSA 2BQPA 5FQ0B 2RE9A 4LO5B 1BXHA 2DUQA 3GHNA 4ZU5A 1OD5A 2MEV1 4E4DX 4K1YA 2V73A 4H3WA 3UKTA 1AR63 1VBE1 1RJ7A 5T5JA 1RUH2 1MS0A 1DU3D 2OZJA 4JGZC 1RUD1 1R1A2 4Q0UA 1AYM2 1BJQA 4BA6A 1W2UA 4XOGA 1ZRRA 4JTNA 4M3CF 3PLQA 3LKJA 3AKPA 4YM0A 3INAA 5T3NA 3VZKA 3DKWA 5J09A 2ZMKA 4FP2A 1TME2 4LO8A 4PIZA 4BLIA 2HWF1 4ES9A 3POYA 2PLV3 1B35C 1WW7A 4UXAA 4RGGA 4MGKE 2VPVA 1RHI1 4E9KA 4F7ZA 5I0UA 2R6QA 5BXXA 2JECA 4DY3A 4R8HA 2HWB1 1CAWA 1LOGA 2V5YA 5D8AB 5K0UC 1ND2A 1SLBA 1WMEA 2QDRA 2WS92 4XHXA 1KDMA 2VXRA 3VBOB 1VBA3 3FUOA 4WVMB 1CAXA 1WCKA 2IFRA 3OYWB 2ZX2A 1C4RA 2R061 2OW4A 1MQTC 3WW4A 4LO4B 4PLNA 1SLAA 2QCSB 1FMD3 1OI6A 1ZM1A 1COV2 1REEA 4OFGA 2GMPA 3WG2A 1NCRB 1OQDA 2Q5TA 4L11A 3M8LA 5L7OB 4YM3A 1RUG3 3GF6A 2NMOA 4PIYA 5ACA2 5JPNB 1H8TC 3FHIB 3WUDA 4RHV1 1QJZA 1SMVA 1XU2A 4XW3A 1SBEA 4QM9A 3MGUA 1OPMA 2QKDA 2CTVA 2MNGA 4YVSC 4GWMA 4Q1PA 5ABJC 1O4YA 2KM2A 4P9JA 5E88A 4KGQA 4RA0A 2ZBJA 3QH6A 2ETEA 3WP6A 1NZCA 4Q4V1 1SCRA 1AR61 4OZXA 3VDDB 4XBLA 4DNYA 4Q4Y2 1H9WA 4E27A 1ZYBA 5T54A 4GULA 3AZVA 3I8TA 4O9GA 1PVC2 4IEYA 3B93A 1JOJA 1D4M2 4PDWA 1NQJA 4Q4X3 1XXNA 4QQPA 5EJ3A 2EAKA 3ZXFA 3OGGA 1HRI3 2VVDA 3M3CA 2BVBA 4AEMA 3D6EA 4EROA 2WNEA 3ZFGC 1H8VA 1LR5A 1RGSA 2UU8A 3VBSC 1WMDA 4AVBA 4RL7A 3CJXA 4KBBA 1V6JA 1D0HA 2GNDA 2WZR2 1DQ4A 4DS0A 2R072 4CDXB 3M4FA 4M0HA 1VALA 1VB2A 3N35A 3POSA 1ULCA 3KMHA 2VY0A 3PVOA 1RUE3 2ZAAA 2PHLA 2R043 4EN7B 3ROUA 2GDFA 4HKLA 2Q1MA 2YYOA 4Q29A 3BTAA 4PBPA 4M0NA 4COWA 1ZBE3 2G9FA 1GBGA 4PCRA 1LHVA 1U5YA 5JOZA 3WUCA 1GZWB 3MIEA 2VVEA 1I3HA 1UCXA 2XUMA 2BNMA 3V65A 2D3SA 3AP7A 3IBMA 5DUVA 5FPXA 1VBB3 2FMDA 3O0VA 1AXZA 3RYRA 2AYHA 4IEOA 1U5XA 3M3EA 1A8DA 4B7EA 1LOEA 1ZX5A 4F3JA 4XF3A 1Q8VA 1EV12 5CU1A 4EWAA 4YM1A 2E51A 4XXPA 1DQ0A 5AVPA 3UJOA 5BNPC 4JDOA 1IS4A 2Z2SB 4WVVA 2YMZA 1YWKA 1XE7A 4QD2A 3KD4A 1QJY1 4A3XA 4Q4X1 2UWAA 2X29A 2D7FA 1V70A 4A2UA 2WINB 1HRI1 5DUUA 4CZSA 3EO6A 4L8QA 3ASIA 3L9JT 1NCRA 4WZCA 5L7OA 5I93A 5DDJ3 3AB0A 4DPNA 3NV4A 2Y0IA 4CEYA 1N3OA 1Q8PA 2ZOEB 3IDCB 3R0RA 5JZGC 4EN6B 1YXWA 3AYDA 1FV3A 1S0GA 4KG0A 2P2KA 2WFF3 3L2YA 2E6VA 3N3HA 4YG0A 1C8M2 1QWRA 2XVKA 4QHBA 1TNRA 4AG4A 1PO11 4XTMA 3EXUA 1XYOA 3APBA 1UN1A 5L36A 4FXGB 4XFHA 2WNUB 4S2DA 4CP0A 4R9BA 5LK7B 3FFZA 4KG8A 2XBO2 1PMIA 2X5IC 4D94A 2R041 1EY2A 1PK6C 2IXHA 2ZGSA 4QXKA 4BHPA 1OFSA 1YRZA 4DRRA 3PTYA 4IETA 3N7LA 4AE2A 5EZWA 2ZZQA 3M70A 4GH4A 1CAUA 1VAMA 3DL3A 1ZBE1 1POV0 2PHFA 1C57A 3AKTA 3WQ0A 1AR73 1LGNA 2IXLA 4RS5C 3QCWA 3WP5A 3DPRB 4AF9A 1NOVA 1GZ9A 5A3LA 1MS4A 1JUHA 1R092 1N1SA 2WT2A 1CD3G 4XPVA 1VBB1 3IWZA 4GB32 2R0FA 3AYAA 2DVGA 2CYFA 4MSVA 4QQHA 4B4PA 2R30A 2VQ0A 4P9IA 5T50A 5CFDC 1C8NA 4CDXA 5BNOA 1VBC2 3LB9A 3OCPA 2HEVF 4JV4A 1KRIA 4J1XA 1X7NA 1H1AA 3TOJA 4XBNA 4AVAA 4W65A 2YGLA 4D7TA 4HLTA 4XIKA 1O3QA 3ENRA 4RQPC 1VBD2 3OD4A 3PMEA 1YO8A 5E89A 1F5JA