1U5ZA

The crystal structure of murine april, ph 8.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
128
Chain Sequence
KHSVLHLVPVNITSDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor
molecule keywords Tumor necrosis factor ligand superfamily member 13
total genus 21
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5zA00
2E7AA 2JG8C 1JTZX 5KC6A 1WCKA 3TYJA 1OSGA 1KD7A 2HEVF 2HEWF 2Q1MA 4QQLA 2JG9B 1C3HA 4QQPA 2R32A 4QQHA 2ZJCA 1U5XA 2JG8B 2WNVA 4MXWB 5L19A 1PK6C 2HEYF 1RJ8A 1XU2A 4TWTA 5L36A 2RE9A 2WNVB 4KG8A 4J6GA 1ALYA 1PK6B 1D4VB 4N90A 3B94A 5HBAA 3K51A 2QE3A 1C28A 1S55A 3TWIA 1PK6A 2R30A 1XU1A 3LKJA 1DU3D 4DOUA 2JG8A 3AB0A 4G3YC 3FC0A 4E4SA 4MXWA 3IT8A 1TNFA 1O91A 3QD6A 2AZ5A 1D0GA 1A8MA 4EN0A 2ZPXA 4NN0A 2WNUA 3B9IA 1D2QA 4MXVA 4KGGA 1KXGA 5KWRA 3ALQA 5BNQA 3B93A 4OULA 2WNUB 2TUNA 2WNVC 3QBQA 3URFA 2QDNA 2RJKA 2Z5WA 3MI8A 2O0OA 2X29A 4E4DX 4HT1T 5CIRA 4OUMA 1U5ZA 4QPYA 4MSVA 3L9JT 4TSVA 3K48A 2OIIA 1I9RA 2KA3A 4RSUA 1JH5A 1GR3A 2JG9C 3V56A 2RJLA 1IQAA 1OQDA 1TNRA 4D7YA 4QQ2A 5KC5A 1OQEA 2R6QA 2JG9A 4F3JA 4G4FA 4QQOA 1DG6A 2TNFA 1U5YA 5TSWA 2WNUC 4OUSA 3ME2A 4GIQA 1RJ7A 3WD5A 2Q8OA 4KGQA 4DB5A
chains in the Genus database with same CATH superfamily
2E7AA 5A1LA 1Y7BA 1VRH3 1WBFA 1KJRA 3L2HA 3WX5A 2IZWA 2OYZA 2VG9A 1V9U3 3EJKA 4S2GA 2PHLA 2ZX2A 3FL7A 4RHV1 3ETPA 1O5LA 1XSQA 1F8VA 1FI2A 2YUEA 4CXWA 2GSYA 1OA4A 1MQTA 2A6ZA 5FXXA 5KHHA 3D4KA 2R0FA 3B3QE 4IEQA 1KEXA 4BMBA 5FXVA 4FPOB 1YHFA 2RS52 3MIGA 3V0AA 1OUSA 4CCKA 3QCWA 3GGLA 5H9PA 1MS8A 3UGHA 4Y1YA 3ENRA 3WF0A 4CP0A 3WNOA 4QT6A 3RNSA 2FD8A 4MXWB 1UXXX 2ZS6B 5J36A 4IGPA 4A45A 2D6KA 1RJ8A 5FYVA 2D6PA 3POSA 2KR2A 3HOBA 4HL0A 4LE4A 3PIGA 2C9KA 5T3NA 4YM3A 4CEWA 1W2OA 3H3ZA 1OD3A 3OTFA 5CFDB 2RJ2A 4N90A 2R061 4Z2AA 3AKRA 1FXZA 5FZAA 1DDLA 4IV1A 4Q4Y3 3I59A 3P3NA 2FZ2A 2L9LA 1RUF2 5C3RA 3ZIWA 1YJLA 3E5XA 1YNAA 3J8F3 1LHVA 5EJ3A 1XU1A 2V72A 4ZXKA 2VCCA 3GBFA 4GMP0 4L8QA 2ZGSA 4OCTA 3ZPYA 3PTYA 1BVP1 2GP3A 3BTXA 4R4XA 4I3GA 3AL5A 1W05A 4XF3A 4QPIC 2X5IA 1VBC3 2VJXA 1PGW1 1HLCA 4Y3OA 4A7KA 4CCNA 1MS4A 1QOTA 2W46A 4J1WA 2C4XA 2WRAA 4DXRA 3LIHA 1I1EA 4JX0A 2WAAA 5CKNA 5JVVA 4N43A 2FBEA 3PNAA 1XXNA 5M0TA 1RUI3 1S2EA 2P34A 5DAVA 3H9AA 2WZPP 1UYZA 3MI8A 3VD7A 2CYFA 3EO6A 1UZZA 4UFHA 3EXUA 3ZXAC 1RGSA 2PYTA 4WVWA 5BNNB 4CDXB 3B00A 4QPYA 1HV1A 4PT6A 3F95A 2G9GA 4KMQA 4CXYA 1LHOA 1KS5A 1NX9A 3LDRA 4YZ3A 3T0BA 1UZWA 4IGQA 4E9KA 4YW7A 5LZ6A 2P4EA 1ZREA 4FFFA 5FKBA 4CXXA 5A3MA 2B8MA 1NYWA 1JOBA 4EN9B 3KWVA 3BTZA 4QGLA 4WM7C 1QMJA 3UJQA 3LZZA 2R6QA 4QX8A 1OI6A 2E7TA 2X8KA 3WF4A 2C0ZA 2DVBA 5FO9B 5A3UA 2DBNA 1P8JA 3MYXA 2WIIB 4HMZA 4LBLA 1X33A 4Q4Y2 3H8RA 1QU0A 2JJ6A 1GYKA 3RRDA 4WM8B 2EIDA 2WQZC 1L7RA 3D82A 4XZUG 5BNPC 1SG3A 3R4SA 1HJGA 5JXJA 2O14A 4XYXA 5CZKA 3MIHA 5I8TA 5LBBA 4Q8KA 1OD5A 1NT0A 4GJZA 3H42B 5FPUA 1XYNA 2WWJA 4MO3M 5A3PA 2VOKA 3BUCA 3E5QA 1RUI1 2WQ4A 1GUIA 4GWIA 1A3KA 4LHLA 5FK7A 3WDUA 3RZMA 1GQPA 3DEMA 1SEFA 1UW8A 1LOGA 5FXWA 2OZJA 5CVRA 3W58A 2R32A 5C8CC 1LHUA 5FWJA 2DVDA 4RGKA 1EPZA 2WO1A 1S0IA 4YW5A 1ND2B 1ZBE2 2P6HA 1JS9A 2KM2A 3GHMA 4OVEA 4R9CA 2BOJA 3LA7A 3LE0A 4CUAA 2VO5A 4LKSA 4Z92B 4COWA 3TEWA 4Y20B 5CAZA 1H6YA 5CYYA 4D3WA 1AR93 3JD73 5HV4A 1Q8PA 2XJQA 4AQSA 4B4QA 1H2NA 5JSPA 4ET7A 1YQ8A 2WN3A 3UGFA 1GV9A 3ZFEB 1FPN3 1OBNA 1QQP2 2QJVA 5FYSA 5FP8A 4MGQA 1S55A 2OX0A 3UV9A 2FCUA 1UYXA 4YVSA 4B1MA 1SLIA 5FY1A 2X09A 1DU3D 1AYN1 4HK9A 2J1EA 5FV3A 1S0CA 4PQ9A 4YFZA 4XBQA 1W6NB 1PVC1 4CCCA 1DLLA 4EJRA 5FY5A 4BMEA 3IWZA 3POWA 3VBOC 1JZ5A 1LU2A 2WSVA 4XFHA 4AQ6A 5AC93 4QX7A 1SHWB 3PUAA 2CU5A 4I30A 5FRAA 2XJTA 3CZJA 3SCFA 3U14A 1VBE3 2A73B 3VDBA 2UY9A 3NRUA 2W92A 1QJU1 2R072 2YHJA 3MIBA 4ZS2A 2WBKA 3W5NA 4CEYB 3O1PA 4C8DA 3S5AA 2D6MA 2XVGA 1KDKA 4GJYA 5C70A 1Y4WA 1UAIA 2VCAA 3WDYA 4DFSA 3I3QA 4F7ZA 1YI7A 1DZQA 1AZDA 1ZRFA 4CDXC 5C9AA 3HNYM 1ULCA 4YW1A 3TBDA 4P5HA 4XUPA 4CDQB 2X29A 3HBKA 3HJRA 2VOTA 5FBZA 5C9AB 5C5TA 4H14A 4MVTA 3LD8A 4IEOA 4LO7A 4N43C 1Q5OA 3AMPA 3KV9A 4YG6A 3GXUA 4IV3B 3GALA 4YM0A 1UU6A 3DGTA 2W47A 2WUHA 3OCPA 3R05A 4IE7A 2GMMA 5JAXA 4GH4A 1BMV1 3POYA 4JGZC 1J83A 1HB2A 3C7EA 3M3IA 4RR3A 1J3QA 5FMCA 4YLZA 3A7QA 2AC1A 3K3OA 2RJLA 1E5RA 2R1BA 4QXCA 5D8AA 3WF3A 1UQXA 4W6XA 1NA1A 2WO2A 5EFUA 4JRAA 3AFKA 3GJBA 3G7DA 3QACA 5BNOC 5A7NA 3VDDA 2HWD1 4UFKA 4CDUB 2WFF3 1LGBA 1IGOA 2BGOA 5D21A 1IKQA 4HPKA 4JDOA 4QQOA 1U5YA 1XNDA 5F5IA 4ARYA 3ZYGA 1B09A 3J7HA 3POEA 5A3NA 3UYJA 3OUIA 5CEHA 3WNNA 1H9WA 1OH4A 3ZFEA 5I91A 2ARCA 1OOPA 2CDOA 1HRV2 3H50A 4PBOA 5I0DA 3CIHA 4IE4A 1PZ8A 5IYYA 1UCXA 4CDWC 5BNOA 3N7LA 3AJYA 3POGA 2QQKA 4FTEA 3E6DA 3LA2A 1JBCA 1JTZX 3KLSA 3IIAA 5A7PA 1OSGA 1HRV3 4ZU4A 3ZKUA 3PMEA 2HEVF 4D6SA 4Y5Z0 3C2UA 4UF0A 4N9HA 2ZZQA 4OQ9A 4SBVA 2VBPA 2VGDA 3ZFGA 4Q0QA 3T09A 5FZDA 2FZ1A 3KHBA 1X9TA 4JZRA 1H2KA 1A8DA 4Q26A 1DQ4A 1PZ7A 3GZUC 1U5XA 5FFOC 5IAVA 3OGGA 3M3OA 1CAXA 1UZ0A 3LCPA 3Q8AA 3CDZB 1JOJA 2JIJA 3ZLIA 1WGPA 5FPAA 2NP0A 2JDNA 4CU6A 3SCHA 5AFEA 5H9QA 5A70A 1QJY3 2OUJA 3R4UA 4J6GA 1NOVA 1COV3 4LKEA 2K9ZA 3GZEA 3VBRA 4JGZB 1PX3A 4LPLA 4W50A 5GLTA 4BLJA 4Q4V2 2ZA9A 1POV3 3I59B 4CEWC 2GAUA 3MF6A 1QJY2 4QM9A 4AGVA 2HBTA 1PVXA 3B5LB 4CP1A 1AJOA 2VZ3A 4XJZA 3UJOA 2J1UA 5EZWA 5ACA1 3WXPA 3KD4A 5C33A 4LLOA 3BOWA 1RUJ3 1I6XA 4UYBA 3WR0A 2FMDA 4AVBA 3CMGA 1GANA 2O8OA 1W04A 5JIAA 4LUKA 3AC0A 3WNPA 4K7JA 1UKGA 1WMEA 4JQRA 3WINE 1NKGA 2AZ5A 3AX4A 2DVFA 3PUIA 4XAEA 4CEYC 4OI0A 3WDTA 3CQOA 4NN0A 1BMV2 2WKKA 5HCAA 4FTBA 3VUOA 2LW8A 4WVMB 1AXYA 1NZIA 2Y38A 1YO8A 4KWLA 4A44A 3AK0A 2ARXA 4NVPA 2ZAHA 2TUNA 2RR11 4EYUA 3AZZA 1FATA 1MEC3 2YROA 4MADA 4IL7A 3AYDA 1EY2A 5JCTA 3ES1A 1ZZ8A 2VMGA 3AKPA 1LCLA 1N3PA 2NYYA 4XF1A 5C5UA 3O1UA 2BDRA 1W6MA 2XG3A 3DKQA 1H6XA 2R16A 3BI3A 5FYZA 3ZXKA 1MACA 2WDBA 2X5IC 5I8SA 1IKPA 2O8QA 4HG6B 2C9AA 2VQAA 3UKVA 1K5MA 1O6UA 3OJBA 1H1MA 3PUSA 1QJX3 4QQ2A 4ZS3A 3KB5A 3VB9A 2QQNA 3LEGA 4JGYB 4D69A 4ZKTB 1C57A 2WT0A 2WLQA 3VKMA 4AL9A 1K42A 2W91A 1WW7A 2ZACA 2FDGA 1W03A 2OA2A 1ODNA 4F8AA 1ASJ2 2XJSA 4H7LA 4HOOA 4XFCA 1MS9A 1S0BA 3THPA 2JDZA 3W59A 1QQP3 4NIIA 4NHLA 1LTEA 3C7HA 1ULDA 1VMJA 1JZ3A 3VZMA 3KF5A 4KI5M 4COVA 2VZ1A 4BQ1A 5IFPA 3EQEA 4V2VA 4AFBA 3BN6A 4QHBA 5JXIA 2YBSA 4BQ3A 2JDKA 1G9DA 1UZYA 4P9GA 3KV5A 4RR3B 4Y5TA 4NWVA 5KC6A 3ZFGB 5ISLA 1FMD2 3DXTA 4KU8A 4MX3A 4CPBD 1W8HA 5GZCA 2OPWA 3CBNA 4Z8BA 2F4LA 2IXHA 2TEPA 2Q8EA 5I0SA 1JYWA 3TRSB 4C0HA 3S6PA 4XQWA 2QKDA 1TME2 4D94A 2VUJA 5A7SA 5EHDA 2RDSA 4FFGA 3T2OA 4B4RA 1FAYA 3E6BA 5FPXA 2LUWA 4LO5B 3AZYA 2FCTA 2DBIA 1CWPA 3ITQA 1YIPA 4Y33A 2BV4A 4I09A 1SLAA 5FXZA 4FVVA 3IAQA 3U07A 4BQWA 1W2AX 3A22A 1CD3G 1Z78A 3O0VA 4KU7A 4XIKA 3VLBB 2EVXA 4HPKB 3I54A 2ZAAA 4XMIA 1WKYA 2YPJA 1LULA 4NUBA 3WP5A 1H8TA 2ZHLA 1BVVA 1R092 5FZHA 3UKTA 1I5ZA 2G1MA 4LQRA 5JPNB 3MUZ1 2GC2A 1XQNA 2R0HA 2VMHA 3A21A 3FFZA 1RUC2 3ZM8A 3BYWA 1BCXA 3JBG3 4YVSB 4TLGA 1K45A 1HIXA 2GDFA 2JG8A 4RD7A 5KXBA 5BNNA 1AR63 3C7GA 3LFMA 4MXWA 4JGYA 4BQYA 1WW6A 3OYWB 4XTPA 4AVVA 1SLCA 1GICA 2VAUA 3NQHA 4LE3A 3N9QA 5A3OA 5AC91 1FMD1 1DZRA 1YQ5A 2BOIA 3B9IA 2ZXQA 3D5OA 3AP4A 2CDPA 4YGEA 2XGXA 5FZ9A 1BYHA 1W6PB 1WLWA 4LBOA 4LK6A 4NMIA 3MW3A 3LSEA 4OUEA 5IK7A 5HV0A 1WUVA 3FHQA 1KITA 3ZXLA 2QDNA 3K4AA 3FBMA 3RWKX 2XB6C 4Y5SA 3USSA 2JB8A 2XDVA 2C24A 5JR2A 1FOD3 3EYPA 1RXGA 1N47A 4L2NA 2KXLA 5EXOA 4NHMA 2NQYA 4A7YA 4IE5A 4P9JA 5EV7A 2RM21 3HEIA 4RS5A 5JXGA 3JU9A 3DPRA 4CP9A 5FQ0A 4BE3A 1JZ6A 4PI2A 4KBZA 1OQDA 5FMOS 1B35B 1CR7A 1WD3A 1JI6A 4XMAA 1S0GA 1UIKA 2VTXJ 3T08A 1VB4A 3T0DA 4QX5A 2A6VA 4WVZA 4XFGA 5DAWA 2H0VA 3AZWA 3T1MA 2GU9A 4GWJA 5E88A 3USUB 3AJZA 1VP6A 4FXGB 3APBA 4JQTA 4XCAA 1CJPA 5K0UA 1MZ6A 3LA3A 4TYSA 4AEKA 3D0SA 3OBTA 2Q8OA 4KGQA 4PF1A 5GLWA 1SACA 1V6LA 1FOD2 3CO2A 4LOTA 2FMYA 4J25A 2WZR1 4GD4A 1W0NA 5JR7B 2E6VA 4CCJA 4RS5B 3GCXA 3O14A 3ZR6A 1O4TA 1ENSA 2FDIA 3PVBB 4AQ2A 3DV8A 2Y0OA 4IV1C 3G6JB 3CHXA 1F5FA 2P3IA 1VRH1 3GZAA 1BEV2 1W06A 5DZGA 2WWUA 3I2IA 4I0BA 5F3IA 4CU7A 3O1SA 4DY5A 2IVIB 5EJ1B 1YXWA 3ZFFC 3I3DA 4Q0PA 1YI9A 1QJY1 1UOBA 1XRUA 5J96B 1AJKA 1JZ2A 2EICA 1NXD1 1YLLA 2EIBA 5EYXA 3CJIC 5EJZB 1MZEA 5SV5A 4TWTA 2GNMA 5T5LA 2YFZA 5T55A 1QJEA 4DXSA 1CIYA 3INAA 3E1F1 4RGAA 4ASMB 2WO7A 2OS2A 2WLPA 2JICA 5BNOB 1TME3 2HJIA 1CVNA 5HBAA 2YV8A 2WNEA 5F9TA 1IS6A 1QXRA 4LOSA 3ZN4A 5IT6A 3GJAA 1MVQA 3D3AA 2PLV1 2BP6A 3DXUA 2LM3A 3ZYPA 2ERFA 4C0BA 1QIQA 1PGSA 2BBVA 4TLFA 4HKWA 3N9NA 4EQVA 1R083 2Q4SA 5B4XA 3SC7X 2OQ6A 2Y60A 2R063 1RHI1 5FZ7A 3ZVXA 1BEV3 5FYBA 1DIWA 1XSRA 2BGPA 2WS91 1QF3A 4EN0A 1RYYA 1O4YA 4LBQD 3I2KA 2B7YA 2A75A 2PHTA 5E1RA 4GKYA 3UNPA 1S2KA 1HXS2 4ISRA 1X8EA 4K8RB 4L0PA 4A3ZA 5F37A 1ZBA1 2A3WA 4PLMA 3PU8A 4BQ5A 2FCVA 1MS5A 5FUIA 5FCCA 5CISA 4WM8A 3M1HA 1JYCA 5LY2A 2PFWA 4IEPA 5FY4A 4LO4B 5FYYA 3L9JT 4TSVA 1HRV1 1RUD2 4NIHA 1LGNA 3DYMA 1J59A 1XNKA 4UFIA 3AP5A 3AYCA 4LO8A 4XXAA 3VBHA 1GMMA 1HJFA 1VBC2 2DWRA 3A0NA 3IKWA 2G19A 3HQRA 2DFCA 4IE6A 1FNZA 4AEJA 4LT5A 3WNLA 4R9DA 4CU8A 1V9U1 4SLIA 1ND2C 4I3PA 1S0DA 4FFIA 1W99A 3VN4A 2EIGA 3T0AA 4N53A 2GN7A 2W52A 1CX4A 1PX4A 5TSWA 2WFPA 2VQTA 1EYBA 5I0RA 3H0OA 4IGOA 4LA2A 1ND3A 4JKMA 1CGPA 3O1MA 4D6RA 1YRZA 4B3NA 4IV3A 1RJ7A 4Y4YA 4BQ4A 3AKQA 4UBGA 5L9VA 1J3PA 1RUF1 3HVDA 4ATEA 4KQ7A 1PM7A 2VVFA 5HXVA 4IEZA 1CX1A 1OA3A 3ELNA 2GZWA 5FQ0B 1Q8SA 2VMEA 1KRIA 2AUYA 5BUVA 3NNFA 1JZ4A 1CZVA 1ULOA 3MUY1 1C8NA 3AM2A 2UYAA 3BTAA 3RMYA 1J84A 3K77A 4NIAA 1COV2 5FY8A 2NPIA 1SBFA 2LTNA 5KXCA 3X29B 3GZTB 4JAAA 2AACA 4FPCA 2MEV3 4RQPA 1X50A 2A1XA 4QXBA 5FPZA 2DCYA 3N9OA 2VECA 1IS4A 5T5JA 3N3HA 3HN1A 5DZFA 1WMDA 2ZHMA 3TB0A 4QM8A 4UXAA 2RE9A 1PVC2 3N9PA 5A6XA 3DF0A 1BBT3 1UU4A 1NQDA 4LJHA 4M4RA 1W9WA 3LFIA 4URTA 5LBFA 5GM0A 3ROUA 5DPNA 5CFCC 1UX6A 2XR4A 2IC1A 3D0JA 3FZ3A 5BY5A 1XNCA 3MIDA 5A7QA 4FSJA 1R082 2ZX3A 4OFGA 4XCBA 5AC92 5KXDA 1JYTA 2E9QA 2BQPA 1Z7S3 2XKOA 3FE5A 1GLHA 2R062 1BK0A 1UN1A 2JEMA 2WZ8A 2WL1A 5FY0A 4CP2A 2BJSA 2DV9A 2X10A 2CWSA 4GA9A 4EWDA 1MEC2 5I8YA 2RS13 4R9BA 3KV4A 1N1TA 2XONA 1O91A 4RR3C 4H3WA 4IXLA 3DCQA 3QD6A 1QQP1 1D0GA 4B7EA 1H0BA 1IOAA 4K1ZA 5JSRA 1YJKA 1EAH1 2Q5TA 4FPHA 3VZOA 1UOGA 4QX0A 5I0UA 3ILFA 1KXGA 1UMZA 2OZ6A 3PJQA 4TZDA 1I3HA 4OQ8A 3VBSB 4RFRB 2GNBA 2RM22 3BPSA 4ORFA 4CA9A 3PLQA 3V0BB 1O7FA 1MS1A 1PIV1 1TVGA 2RV9A 3URFA 5A3WA 4AEDA 2D3SA 4CTEA 5JDBA 1ZBA3 5J1XA 1POV0 4AAPA 4CUCA 4HT1T 2HWE1 4IESA 3RVHA 4GALA 3ZDSA 3BKZA 4AYUA 1BZWA 1VRBA 4JKKA 3UK9A 3J4UH 1D2SA 3R0RA 1A78A 5HCHA 3ZSEA 4QX2A 1GU3A 3D6EA 1F35A 4XXPA 1G6NA 4IEYA 4E8DA 4R8HA 1OH3A 2F6BA 4UW4A 2FQPA 3BGAA 4BPZA 2BNOA 4YZ5A 5FREA 1ZA4A 4XDQA 1D4M1 2XLGA 4YM1A 2XBO3 4CDUC 1ZRRA 4CPBA 3AKTA 4LITA 1GSLA 3ZYRA 4OHXA 4XUTA 4K20A 4XHBA 3IDBB 2UWCA 4JGZA 3O1OA 4TTGA 3WG1A 4XIOA 4G4FA 1NXMA 2SLIA 3RZHA 2HWF1 3JQXA 1W6PA 3WUDA 1TMF2 3ZN6A 2ZABA 5BXXA 4BHPA 1LNSA 2HWB3 1NUKA 1UU5A 4INDA 4XILA 3O5SA 1SFYA 5IK8A 3ZPOA 4DB5A 4W6YA 4P9WA 2ZBJA 3HIFA 1MZFA 3LEIA 3OPZA 3AYAA 1SLLA 4B29A 4OI1A 2IXJA 2E7QA 5T54A 1F4HA 4LBQB 3AZXA 3LDKA 2QQVA 1N1YA 2ARAA 2F17A 3M4FA 1CAVA 1OPOA 2ZKLA 3KVAA 4XBNA 2PAEA 3T1LA 2WT2A 2EXIA 4AR2A 3K4DA 1JZ8A 2IUWA 4J1XA 1QY4A 4AAXA 4AW7A 3VV1A 5JZGC 1MVEA 4IQPA 1YUDA 3ZDVA 4MOAA 3RWNA 4XJWA 2X53S 2YPDA 1T6BX 3VBUA 1A34A 2DF7A 4XTMA 1AR82 1H1AA 2XUMA 3OY8B 1QEXA 1R1ZA 3OGJA 4DMIA 3ETQA 1PK6C 2XBO1 2E53A 1K5MC 1XU2A 4WVMA 2JDMA 4BWOA 1G8WA 4JHTA 1GNYA 2XOMA 4M3CE 1D4VB 1Y9MA 3AVRA 3KSCA 5IW0A 3VBUB 2V73A 4I2OA 4L99A 3I49A 2DU1A 1XE7A 2JENA 4WZCA 2BTVC 3DECA 1QJU3 2JECA 4ZY9A 2VZTA 1W6NA 3VD9A 1J3RA 4AI2A 3KCXA 2HWB1 2R041 4HONA 3CKHA 2QZ3A 3LKJA 2VNGA 4OZOA 3WW3A 4EN6B 2ZGQA 5A7OA 3ORJA 2A3YA 2RS32 3AYEA 1W8TA 3LDBA 4E4SA 1WLTA 1RUC3 1RUI2 1NCQC 2G9ZA 1AX2A 3CEWA 4LTAA 3A23A 3AXDA 4P5YA 1VBD1 1E5SA 1Y3TA 3JBG2 5IAXA 1AYN2 1RUOA 1UYYA 2ZPXA 3H1WA 3KVBA 4XDPA 5GALA 4BISA 1N3QA 4FPLA 2HWC2 4LIUA 4PI0A 4EWAA 3AMNA 3DUIA 3WLUA 1MQTC 4QKNA 2DCZA 2ZGUA 3TEXA 4ARXA 4M00A 1AYM2 1UY4A 3IPVB 5LCWL 3RZZA 4L92A 3I8TA 4K8FA 2W87A 2VNRA 5J48A 2VOVA 3VD4A 3WQ0A 5ABJB 1PMIA 1UY2A 2VUCA 2VXJA 3ZSJA 1WLDA 3LEKA 4CCEA 3RYRA 1AYM3 4BDVB 3S30A 5JZGB 1SPPA 5F2SA 1Y9QA 1VIWB 4W6WA 5G04L 3CJIB 5FZ6A 3MIEA 3NJVA 5LY1A 1HXS1 3ZXFA 4C1WA 3WDXA 1AVBA 3SH5A 3OUHA 5GZDA 4HKLA 4FPJA 3ZXGA 4OHWA 3V56A 5EP9A 3WP3A 2ILMA 5BNPB 2VZVA 4RHV2 3AXEA 4W4ZA 1OHFA 1SPPB 1REEA 2B45X 1RMU1 3EHKA 3WCRA 3LQCA 4WZFA 5C9AC 2IFRA 4FOQA 4XUQA 2LRPA 3M3CA 3N7JA 3MICA 4X6RB 1V70A 2VMIA 1YFUA 3LIGA 3PDQA 4RS5C 3OEAA 4XQ4A 1V6OA 3P5BA 4M0NA 4N53B 2GMEA 2WNUC 1N1VA 2JXAA 3RSJA 1AHSA 1HB3A 1W8NA 5A1AA 4OUSA 4QDSA 4GIQA 2HYKA 1OA2A 4IEVA 4LUMA 5F32A 4XABA 3OBAA 1KQRA 5LK7B 4OYUA 3ON7A 3VD3A 1SLTA 2XLAA 3J8F2 5CADA 4CDWA 4PDWB 3R4DB 4FI9A 3U10A 2WQ8A 2ZHKA 1RUE2 1QH7A 4FT8A 1VR3A 3USUA 4R4ZA 2PAMA 2CHHA 4QQPA 3DL3A 1H8VA 1DGWX 1XE0A 3ZXDA 2A71A 2BEOA 4DEVA 3WDVA 3TN91 5LA0A 1QJZA 4Q4X3 4CDQA 5ABJC 5F3CA 2CSGA 1B35A 4UOJA 4YSFA 1QOOA 2W1QA 4YW3A 2D44A 4NHXA 2OQ7A 2A70A 5DZEA 4C90A 1OKOA 1YCIA 5L19A 5LA1A 4X8PA 4RQPC 4AHZA 1LESA 4X6QB 3IN9A 4PIYA 5GLVA 1CZTA 4IV3C 4QPGB 4AVAA 1GNZA 4KWJA 2PELA 2FHRA 3CF6E 3HT1A 3MV11 1N1SA 4K6BA 3SQOA 5C8CA 4C1XA 5DUXA 4JV4A 1Q56A 3A4UA 1HRI1 2CNAA 3S57A 1DGRN 3WOGA 5FOJB 5IATA 4AI8A 5CB7A 1C28A 1QXJA 5DG2A 4XAAA 2BGCA 4WM7A 2E31A 1QXPA 1QJX2 5DMYA 2P1BA 3POIA 3RZKA 3VKLA 1JYNA 4CRQA 1TNFA 4M4PA 1RUJ1 5FMBA 1RUD1 3NNJA 5A33B 1R093 1PO21 1UMHA 2MHFA 4QMAA 5GLZA 4FP3A 1ASJ1 1RUC1 1SDDB 3RI9A 4BCUA 4CEWB 1AUYA 4AI3A 3IMMA 3NKGA 3OBZA 4BH9A 2AEYA 2A6YA 1TG7A 4GXLA 2ZX0A 2EXHA 4NPRA 1DCSA 1EUTA 3WF2A 5LBCA 3MEPA 3Q9OA 5KXEA 4Q0UA 4Y26A 5K4LA 1N3OA 3AL6A 2V5YA 2XVKA 2F4PA 4ZZ5A 3WDWA 2IVJA 1AR92 1AR61 3JD72 3Q8FA 4B8EA 2D40A 4ZZ8A 4AFMA 1C5IA 5A7WB 4YW6A 1BLZA 1WCUA 1WCSA 2VD7A 2WYSA 5FZBA 5C3SA 2VW0A 1OLMA 1GQHA 3AFGA 4MV2A 5DUWA 4B7KA 2BYVE 4N7IA 1ZYBA 4YVWB 3D8CA 1W28A 2ZGKA 1O4ZA 4GH4B 5T50A 3RS6A 2JG9C 2KD7A 3VKOA 3FLRA 3I7DA 4FPKA 1W2TA 3RYKA 4ES9A 3R6SA 3H1YA 3MFAA 1FOD1 2Z79A 4BK4A 5A3LA 4LBKA 5CU1A 2K2SA 1RUE1 4GMP3 2WZR2 5F39A 1W0PA 3VBSA 3ASIA 1Q3EA 3OGRA 2OT7A 5EIYB 5K8SA 4QHOA 4YGCA 4P14A 3PVEA 1ZRCA 1W9SA 1R091 1CAUA 4LBJA 2WFF2 2HWF3 3ME2A 4MGTA 3GHNA 2BWAA 2VZOA 1VLNA 2ES3A 1RVF2 2LROA 2QCSB 2YXSA 4L97A 1KS4A 4A3XA 1RUG2 4IE0A 2CV6A 4PDWC 1JUHA 2D98A 1KFXL 5B4NA 2RMU2 5FUNA 1BK1A 4OI2A 1Q8QA 2ADDA 1Z0HA 1UMIA 2BZDA 2NMOA 2FDHA 4LULA 2GN3A 2WZEA 1NLQA 4JRLA 1AR71 2W5FA 3WW2A 4A4AA 2D6LX 1O8PA 2W94A 3RJ2X 1GOGA 1QOSA 2Y6HA 3U4XA 4Q4Y1 2ORXA 1OKQA 1JOPA 3O7OA 5FZ1A 3O12A 4AG4A 1NLRA 2WA3A 1S0FA 3SMHA 3ZYIB 2WZR3 2RDNA 3C8XA 3W20A 4AEMA 2Q8DA 3BU7A 5FO7B 5FJHA 3ZN5A 1UY1A 1ZZBA 1O3SA 3FUQA 1WCQA 3B7MA 4E2QA 3BIWE 1C8M3 3POJA 4QWNA 1XC6A 4MHRA 5LRSA 3WNXA 3Q8BA 1XJAA 2ENRA 2RS31 4GQ7A 4I0AA 4GH4C 4E4ZA 2CY6A 3B94A 4RGGA 4FCAA 2ID4A 3VBHB 1SCRA 1C1FA 2QE3A 3I2FA 4NE9A 3LPGA 3LEMA 2QQJA 1JHJA 4XQDA 3TNQA 2VMFA 4K21A 4YZ1A 4JGYC 2JD4A 2RG4A 2I07B 5FZIA 5C3OA 3AB0A 3IZOA 2WFF1 1VAMA 3FC0A 1JUIA 1T6GC 4IV1B 1QJFA 1Q8OA 3ACIA 2QQOA 4HXCA 5DDJ1 3VBUC 2QQPA 4H55A 3C7FA 5IJRA 3VD5A 1L7QA 4W8JA 1RUF3 4MXVA 1C5HA 2AH2A 2R042 2PN5A 2D6OX 1SCSA 5DG1A 1ASJ3 4BQXA 4D0QA 3I2GA 1GBGA 1DYOA 3K3NA 1DYKA 2TBVA 4K40A 4EZ4A 4CU9A 1DQ2A 2BU9A 4DRVA 1ZZ9A 2DFBA 2RMU3 1OQ1A 2VULA 3I3EA 3KF3A 3PUQA 3EMRA 4M01A 3THDA 1JMUB 3T2PA 2O0OA 1AL22 3P6BA 1PZ9A 2YY1A 3JXSA 5CIRA 1DF0A 2UWBA 3UGGA 5FZOA 2HWC1 1DGLA 4RL7A 4UBHA 5K9YA 3S0MA 2R073 3MDPA 5FWEA 5LASA 3VDCA 4HN1A 4EN8B 2ZMNA 1VBA2 1VBA1 1ND3C 2VY0A 3KM5A 3NAPA 1EV13 1DP0A 3VBOB 4WV8A 4UW3A 5JUVA 2ET7A 1TNRA 1JODA 1LEDA 2P5BA 2R49A 3KCYA 5DXDA 2D93A 4O9EA 5D2AA 3EBRA 1CESA 3AZVA 1UNBA 4QD2A 4F3JA 3GBGA 4Y4RA 2WYFA 3V65A 1CPNA 3VBHC 1R1A1 1G9FA 3SEEA 4NRQA 3NAPC 1ZRDA 4NRMA 3E5UA 3KT1A 4XVHA 1ENRA 1T2XA 5FMDA 4AFCA 4KWKA 4IDZA 4TN7A 2YB7A 3HMYA 4QB1A 3WD5A 2P2KA 2VW1A 4ES8A 1CIWA 2DCJA 4MG2A 2C1FA 2ET1A 3J9SA 3ECQA 2JG8C 2W1SA 2QNKA 2K46A 3T4HB 1W8FA 2BNMA 1UF2C 1W6OA 2WSUA 4CDWB 3DPRC 5ERLA 2Q0AA 4UT5A 1EV12 3OD0A 5JOWA 4Q4W2 1RUNA 1X36A 1J58A 1TME1 5FY7A 3RFRA 3HNBM 2VOWA 4JDMA 5FDBA 5DN2A 5DAPA 1PIV3 2ZJCA 3MPPG 2HYXA 4QB6A 4EE2A 1JHNA 5LWBA 2QDRA 3J8F1 4AQTA 3ZMOA 1PGW2 4PJYA 2YDEA 3LB9A 2HEYF 3O1TA 3RQ0A 4Q0SA 5EWSA 2A6XA 3HPNA 2QFEA 2DUQA 3KS7A 2VTXA 4GWMA 3BTYA 1GP6A 5E89A 1OUXA 1AYM1 2YGLA 1C8M1 2D7FA 4YG3A 3BIEA 4AOCA 4YGBA 3PL0A 1W3XA 4C91A 1PK6A 2Y6JA 4Y1ZA 3VKNA 2Y6LA 4QPIB 3T4VA 5JLVA 1IS3A 3RYPA 2IXCA 5IVJA 3B9CA 2JE8A 4M3CB 4NOTA 3MLJA 4A2UA 4NHKA 2HBUA 3FWEA 4DNYA 1KDMA 3PURA 2V4AA 1RMU3 1UKRA 1UPSA 2EXKA 5JXHA 2JE9A 3NWKA 4YZ4A 1R081 4LBNA 2Y8KA 5KHJA 4P9XA 4UAPA 2W39A 2WNUA 1NCRA 4XBLA 4XJUA 1D2QA 3VDAA 2VZUA 4KWUA 3VBSC 4CYDA 1ZZ7A 4HSJA 1BEV1 1GQGA 2CAVA 2PHDA 4UFMA 4PIZA 4PF5A 4FO9A 1RMU2 1RIRA 5BNQA 1AYN3 1E57A 1GP4A 3CNAA 4P9LA 1FX5A 3OB8A 4DQAA 4R52A 1H4GA 4CSWA 3U78A 2WNVC 1CAVB 3I2JA 1X82A 4EWEA 1OF4A 2W0XA 3J7NA 1XYOA 5F5QA 3CU7A 1QWRA 3NSTA 1O59A 1BQPA 2Y6FA 3NJXA 3ACFA 4E4DX 4JKLA 2W2IA 1ND3B 1U5ZA 3WG4A 3NMBA 4GB33 1UX7A 3SXWA 4MSVA 3QH7A 3Q8EA 4CZSA 4WVVA 4NAOA 3MIFA 4Q1PA 4YZ2A 1PMHX 2O1QA 4KBBA 1W8UA 5I93A 2YBPA 4GB32 4RFT0 3WQ7A 1UXZA 5FP3A 1GR3A 1AR62 4XEZA 4META 3ZXJA 4N7UA 1NE4A 1ND2A 1UL9A 4XPVA 3RJRA 4AHYA 4NHYA 1OOPB 2WWSA 1RUG3 2VC9A 2X5IB 3FMGA 4XF4A 1NG0A 2B46X 2ZGNA 2ADEA 3GBWA 3NAPB 3OD4A 5FYHA 5DAXA 4ASLA 4HVRA 4BM8A 4QHZA 2WN2A 3SHRA 1G9BA 1MS3A 3M3EA 4YVWC 3VHOA 3WCSA 2W68A 2WA4A 4QX3A 1RUE3 5LRRA 3KGLA 2BW8A 3PU3A 4LKFA 1VJ2A 4FQ4A 2Q1FA 1S4CA 4P08A 2BBAA 1W0OA 3FHIB 2RVAA 1R64A 1NCQA 3WQBA 2YZ4A 2MEV1 2WNOA 5F6KA 1HQLA 3ZMNA 1S0EA 1WZXA 5G05L 1K3IA 1NZCA 2JE7A 2BRTA 5DUVA 1V6IA 4K1YA 4Q4X2 1J1LA 1W2UA 2Q1MA 2UWAA 3B69A 1UY0A 3ZX7A 4S2DA 4BA6A 4DY3A 5CG8A 4YGDA 3ZSKA 2ZKNA 4AGRA 2ZOEB 1BBT2 1BBT1 2H0BA 1XBFA 4MGYE 1XB9A 2BPA2 1BHGA 3U11A 4LKDA 3VBRB 3LOIA 5C4WA 5FO8B 1D7PM 2NN8A 4XHXA 3H3LA 1WA4A 3LPFA 4XDOA 3W21A 3JUUA 2XPJA 2QUOA 1WBLA 4FPGA 4H2AA 4P00B 4AGGA 3H8UA 4LIVA 3KT4A 3WG3A 3RI8A 4LHSA 2OPKA 4BIOA 3IB3A 4QX1A 2WNVB 4ZHNA 3O1RA 3WZ1A 5FMOL 1ALYA 1PK6B 3OG2A 3KMHA 1IS5A 3ZFFA 4NJ4A 3NVCA 2XHKA 1LGCA 1NCRC 3VHRA 1NY71 1FT9A 1ZM1A 4QPGA 5E16A 3KHCA 5FK8A 3DN7A 5FJKA 2QQLA 4LLFA 3ACLA 4EV0A 2D5FA 3TWIA 2BERA 2ZX4A 3PVOA 4K9SA 5HCFA 5EPAA 3POBA 1BKZA 4L9BA 2VU9A 1G9AA 4DUXA 3HR9A 3ZSMA 2EXJA 3E97A 3SH4A 5FUPA 3WUCA 4JC1A 4U2AA 3I2DA 1IPKA 1A8MA 2RS11 3WW1A 5CFCB 1F9KA 1W9FA 4Y20A 4EZHA 2VM9A 1OMIA 1HQWA 3J7MA 1US2A 4AFAA 4B1LA 1JXNA 4XUNA 2D3RA 5JOYA 2P17A 5KHKA 2YFUA 3RZJA 5JPMB 4LA3A 3L2YA 3VL8A 2WNUB 2GH8A 1IPJA 1L3JA 4QXKA 5J09A 1APNA 3MHZA 3THTA 1D4M3 2EIEA 2RJKA 2Z5WA 3M2MA 2RHPA 1ODMA 2QBXA 2E32A 2LS6A 4CCMA 1S1AA 1W9YA 2Q30A 5I0TA 2XWBB 2RDRA 4ZONA 3ES4A 5C3QA 1EPWA 1LHWA 5A6YA 4QDRA 4XJAA 3MBWA 1BXHA 3BU0A 5IVCA 4AVCA 3PUHA 2OIIA 1GZTA 1PGL1 2Z42A 1W6MB 4UW6A 4AHXA 3MPBA 3UT0A 1UOJA 3GYDA 4IETA 4ONUA 2HKXA 4BXFA 1OLRA 1NCQB 5LB6A 2VR4A 4PQQA 4AFDA 1IQAA 1ZZCA 2VNOA 4FAGA 3WHUA 3NV3A 5T5PA 2XJVA 3NO8A 2WS93 4L11A 5FYUA 5IVYA 2C6SA 5IHRA 4BJ0A 3JB4C 5BNNC 5KC5A 3C3VA 3LGRA 4N8MA 1SLBA 1ZBE3 3S5QA 4AEDB 4HETA 4FAHA 1B35C 2UYBA 5C4WC 1HXS3 1MQTB 4MGSA 1ENXA 4DPNA 2XL7A 2JDAA 4NAMA 1K12A 4O65A 4N9IA 1WMFA 1NLSA 1OLME 5E8AA 5A80A 5HXMA 2WINB 4XUOA 2DVAA 5B2GB 2J22A 1VPHA 5DDJ3 2P3YA 4XJ8A 4QPWA 1WCKA 4FPFA 2DCTA 4XJ9A 3QOPA 2FDFA 2Y6GA 2Y64A 2GALA 2HEWF 3AP6A 1OVSA 4NO4A 4NROA 2J7MA 4Q4V1 4W65A 1CAWB 5FP4A 5FPVA 2B9UA 4UFLA 1LU1A 3GDBA 5IK5A 2XKPA 4DUWA 2EF6A 1IQDC 1COV1 1VBB3 3NL1A 3U37A 2MPFA 4LR4A 1HDKA 3N35A 4DZGA 5A3TA 1WW5A 3KT7A 1SBDA 3IAPA 1WCDJ 2PHUA 3GNEA 3JCIA 3PTRB 3KQ4B 2VL4A 1DGRA 3NV2A 3FJSA 4G9SB 4ITCA 5L36A 3MGUA 4QKDA 1OLQA 1CAXB 1MZ5A 2B4KA 2P3JA 3SLIA 2RDQA 2V4VA 5JZGA 2JB4A 2JKBA 1IG3A 3GM8A 2IXKA 4H7MA 1KGYA 1CPMA 2HWC3 2DVGA 2JX9A 3WSOA 2AREA 5FZMA 4M3CF 1EP0A 2XVLA 1DBNA 1FYUA 3VBFB 1ULGA 2VXRA 3BOPA 3NJZA 4QPIA 5CKQA 1VRH2 2JWPA 3ILRA 4DOUA 5IVBA 4QAWA 5C4WB 1QDOA 3V64A 1MEC1 4Q8LA 5JIUA 1GOHA 1PNFA 3MW2A 5F2WA 2Z69A 1Q8VA 1H9PA 3VL9A 2VZPA 4Z2WA 5GJ6A 3HD8B 4HVQA 1QKQA 2Y0IA 5JOXA 2J1SA 3OOXA 1UYPA 3SITA 4BXSV 3W5MA 3WNKA 1W3VA 3OPTA 2OVUA 4MUVA 4RA0A 4LBQA 5FPLA 2ARBA 2ZEWA 3KGZA 3OGSA 4KH9A 4YNIA 3RZGA 2PLV2 5J3UA 2YMZA 3I4IA 5E6HA 2OXBA 1UO9A 1AR83 3EB7A 3FX3A 4DEQA 1V00A 1LJ7A 4GB31 1LENA 3NKTA 3VZLA 1ZX5A 1NA1B 2DTWA 2BWCA 3JZVA 5IVFA 4NIGA 3IM0A 2JDHA 5D1IA 3OSDA 2BFUL 1CQ9A 4COUA 1M06G 4U36A 1VBB2 1YC61 2VNVA 3IDEA 1ST8A 1AL23 3KZ4C 5HI0A 4KL1A 1GKBA 4XF9A 3FFQA 1YFYA 1FNYA 3ZOIA 4E8CA 4K3UA 3NV4A 3UETA 3MFCA 4HANA 4PBPA 5JOZA 2A3XA 3U0ZA 3GF6A 4P9IA 5LW9A 4PIXA 1F5JA 3RMXA 1W6QB 5FZ8A 2NZ9A 1OQEA 3I2HA 1VBD2 3PVNA 1LECA 2Q1ZB 2WC2A 3HN3A 3ZYHA 1W2NA 3DYPA 2Z2SB 2XQXA 4GAZA 4MZUA 5EQUA 3SKVA 3DPRB 1DG6A 4CP9B 4ZU5A 5JI7A 3Q8CA 1FPN2 5FLIA 3VHPA 1W39A 2E51A 3WP6A 1QGLA 3PHMA 2J1TA 2ZZJA 3ACHA 3W9AA 1HB4A 4ATFA 4D7SA 2BVVA 1WWYA 2PHWA 2XWJB 1D0HA 4IERA 3P1IA 3SCGA 1LR5A 1AXKA 1PO13 3WVJA 5ANQA 4PLOA 1CN1A 3TN92 1KD7A 1JYXA 3WV6A 1EAH3 3KQRA 4AXOA 1PMJX 1RINA 2VZQA 1QHDA 4JTOA 1W9TA 1PIV2 2QQWA 1MR5A 4NRPA 2JG9B 2WABA 4BU2A 1W6OB 2ZHNA 3H1MA 5FAXA 4AVSA 4JTNA 2J1RA 3ZR5A 3PIJA 4F83A 1YWKA 3H8XA 4AE2A 2RMU1 2W1UA 1O5UA 2PLV3 3ZSLA 5C3PA 1VBB1 5LA9A 2IXLA 2P3KA 2P37A 5F8PA 4YPJA 2H6CA 3WF1A 4BK5A 1NA1C 1HN1A 1AR91 3JD71 1CAUB 2RS53 1ZZ6A 1HRI2 4HKOA 3K4ZA 2VCBA 5FR3A 1FV2A 3N7MA 4I02A 4YFWA 4KG8A 2ZX1A 1K5JA 2Y6KA 4KNCA 3C7OA 5HPOA 5KR7A 4NIDA 2PMWB 1GWLA 1YIFA 5FP9A 4QGNA 2PQQA 2B9VA 2PHRA 3IIIA 1STMA 2HLEA 2XJUA 4LXLA 4XF0A 2B42B 2RS12 3CZUA 4OMDA 4ZU7A 3F2ZA 1PO22 1RVF3 1TMF1 4OZXA 4EN7B 3ATGA 4RQPB 5A1FA 2OKXA 2VZRA 3FLTA 3HNMA 4S2HA 1YYNA 3IT8A 4LNVA 2DURA 3B02A 2NMNA 1QJX1 1DQ5A 5C8WA 4P9YA 1M4WA 2I2SA 3MLKA 1NAEA 4AI9A 3M8LA 1VB2A 1NQJA 2DUPA 2QQUA 3ACGA 3U4SA 5KWRA 3SKJE 1A6CA 3OEBA 2GP5A 3T30A 1LOBA 4D8MA 3ZYFA 3ZYJB 5AVPA 1PVC3 4QU2A 1RITA 4MLOA 4QXHA 1PO12 4DIQA 1G9CA 4DUVA 2WAOA 3MO4A 2R7EB 4RYDA 1SFPA 2JDPA 1RXFA 1RHI3 4NPMA 2CGOA 2EA7A 1LEMA 5J98B 1AR81 3ZN6B 2AEZA 3ZIXA 4I01A 4PLNA 4FXKB 4LK7A 2AGSA 4YW4A 1WW4A 2J42A 4YYOA 1YFWA 1TZOA 4D7TA 4GZ9A 5GKAC 4WM7B 1AL21 2J1VA 1LOAA 3MZHA 3PMSA 4UW5A 2K0GA 1JU4A 4D7YA 1WA6X 4PCRA 1HQNA 1LODA 3OF1A 2YU2A 4MGIE 4A7ZA 3BCWA 1US3A 3WP4A 2DUOA 2VBBA 5FYMA 2Y26A 5KBFA 2HWB2 2C26A 2BVBA 4UF0B 5DABA 3ZYBA 2VVDA 5ANNA 1VBA3 1IG0A 2W9XA 1JU3A 3RPQA 2TNFA 5F5CA 2XXZA 3V0AB 1RUH3 1YQCA 4IEWA 1VMFA 1ENQA 4QU1A 1FMD3 4XOGA 1HB1A 1CZSA 1LB2A 2J1AA 3V0BA 1EUUA 1XOYA 2XH6A 2XMLA 4WM8C 3OYWA 5FPBA 1OXCA 4DRRA 2AYHA 4AEDC 1HX6A 1VBD3 4GWNA 2VMCA 1D4M2 1F4AA 5DQ0A 4JCKA 4PDWA 2XL9A 1R1A3 5ABJA 5L7OC 5FBJA 3O1VA 2DYCA 3SEPA 1CAWA 5F7UA 4FOYA 3ZKYA 1PO11 2W1WA 4MGKE 5F6LB 1C3HA 1REDA 3NW4A 3H8OA 1RL3A 1JN2P 2W08A 3I97A 1LOCA 3IBMA 2AR6A 4HSLA 2V09A 2VUDA 5FYCA 2ZGOA 5F3GA 2VPVA 5FKCA 5A7WA 2JDUA 2YBKA 5L9RA 3VZJA 1JW6A 3AKSA 1F15A 4CCLA 1W8ZA 4QB2A 2PXJA 2RR12 2UU8A 1KJLA 1RHI2 2ZGPA 1PHMA 2CGNA 3FN9A 1W90A 2CAUA 5LEKA 3BPZA 4XFFA 1SQ4A 4JHZA 3S7IA 5CFCA 3O0WA 4LO6B 2FDKA 4CDQC 1OFNA 4LMFA 2YU1A 5H9SA 4FQZA 3I3MA 3E6CC 3FBYA 3K51A 5FZ3A 5APAA 1TQ5A 5FOBB 1IHMA 2PHXA 4IUGA 2VZSA 4D6QA 2A5ZA 4OI4A 1RUG1 3UESA 4FOWA 1RUH1 1I5PA 1LHNA 1SDWA 2CWMA 1LOEA 3AVSA 1ACCA 2VH9A 4MGZE 3AP9A 3OUJA 1OT5A 1YQ2A 5C7GA 5GZEA 3WT3A 5JMCA 5FZ4A 5J37A 2EAAA 1G86A 4YG0A 4LEJA 1GWKA 3DKWA 3UKNA 4RHV3 3TOJA 3ZFGC 5A6ZA 5ACA2 3TAYA 2IWGB 4HFSA 1XPWA 1GZCA 1ULPA 2UY8A 3IMNA 5FZKA 3VZKA 4COZA 2IXIA 4DS0A 5FZEA 1XNTA 4Z07A 3HQUA 4GMP1 1F2NA 5FIXA 5F1RA 1AF9A 4Y22A 2CL2A 1V6JA 2XJPA 2YC4A 3ALQA 3HT2A 4MYEA 3VBFC 5ACA3 3B93A 4ISQA 1VBE2 4DXTA 5AFBA 3JB8A 1IZ3A 2I45A 2QQMA 1V9U2 2GC3A 2ZGLA 3CL1A 1DZTA 3NV1A 3WW4A 5FZOB 3VZNA 3U75A 3OGVA 1SBEA 2W95A 1E5HA 1DLCA 3OBRA 1ZNPA 5FP7A 1QJU2 5CFDA 1WLCA 2VCMA 3RG0A 1GOFA 4MH0E 1V0AA 1IPSA 1DFQA 4M0HA 4Q4W1 3JBG1 1W8OA 1SMVA 3ZO0B 4DXZA 2PAKA 2ZEZA 1KFUL 1FPN1 1V6KA 4JDNA 4Y1UA 3MF9A 1ZBA2 2NLRA 3A0KA 3NNMA 1PO23 4QKFA 1CJDA 2HWE3 5BYNA 5C6CA 2YC2A 1OVPA 5KHGA 3TEYA 4Q29A 2MEV2 5DDJ2 2C5DA 1RUH2 3ILNA 4TXWA 5FZLA 1OOPC 1UOFA 3UL2A 4A6OA 1C4RA 4CUBA 1F31A 5LEJA 3OY8A 2CTVA 2A6WA 2SBAA 3MV01 3NJYA 5DAQA 1C8M2 1C1LA 2VVEA 2WT1A 2XHNA 5LK5A 1V6NA 2JDYA 1AL0G 4S2FA 4EROA 5GLUA 1H1IA 1R1A2 2B39A 2D97A 5K7PA 4R9AA 3MLLA 1LOFC 2HWD2 4PHZA 4CCOA 3LWCA 5IWFA 2NM1A 3M7AA 4UWDA 4B4PA 5K0UB 1Z7S2 1NE6A 2AENA 3K2OA 2HH9A 2YG0A 4HLTA 4YM2A 5IVVA 1U12A 2G4IA 4QQLA 3WNMA 2ZGMA 1O3RA 4DO0A 5FY9A 1H8TC 2WO3A 3QH6A 1SZBA 1POV1 5FLHA 4QQHA 1V6MA 2D5HA 3LF7A 1O8SA 1LKNA 2JG8B 4OHYA 2PQSA 5CBLA 1VAVA 5FZFA 5CKMA 2JKXA 3BALA 2A7AA 1XE8A 3TEZA 1DHKB 2DCKA 3ZXEA 1RUJ2 2ZTNA 5FYTA 3H7YA 2G9FA 1VMHA 1NCRB 4HBNA 4BOWA 3K46A 2XUEA 1ZVFA 3N9MA 2RS51 4A41A 3T2TA 5CG9A 2CGPA 4XZPA 4AF9A 5JI9A 2MNGA 2JD9A 3IDAA 4GKXA 3WQ1A 1X7NA 1DQ1A 1TMF3 4M3CA 2V5DA 3FHAA 4LBMA 5IFTA 2R30A 1QDCA 2JIGA 3AP7A 1OFSA 1POQA 2GH2A 2I74A 2Y33A 4KG0A 4MHUA 4XC9A 3KCCA 3WEZA 1LOFA 1GNHA 4NPLA 1X9PA 4G3YC 1U0AA 2ZGTA 2QTWB 4URAA 1MS0A 1W8WA 1W6QA 4DINB 1RVF1 3J7LA 1DGWA 3NNLA 2EAKA 2PTMA 3O0XA 2D43A 5A32A 2YC0A 4E27A 2GNDA 3N7KA 4QKBA 3VBRC 3HBZA 1GZ9A 4LORA 3ZFEC 1OPMA 2PHFA 2ETEA 2VUAA 4OMCA 2LALA 1REFA 2FDJA 4AHWA 1URXA 1OC1A 4KGGA 5GZGA 2ZEXA 2ATFA 1LRHA 2VOXA 4Y1VA 4HK8A 1PGL2 4E2SA 1AR72 2VE1A 1AXZA 3IPVA 3P3PA 5A32B 2Y34A 4UFJA 5D8AC 2W3JA 4Z82A 1H2LA 3VGIA 2WJSA 4Q1RA 3GCWA 1DQ0A 1AR73 1H8TB 1AX0A 2RM23 2VQUA 3LSDA 1QNWA 4GULA 2GNTA 3WG2A 4AVTA 3K48A 5K0UC 4HZFA 1EAH2 1CONA 1ULEA 5CA6A 4I0WB 1UZVA 5EYYA 4QGMA 2YYOA 4AI1A 5H9RA 3ABZA 4A42A 3NNGA 3IDCB 1H2MA 3JQWA 1LAJA 1K5MB 5IUQA 2R1DA 4Q0VA 2YGMA 4Y1XA 1ONAA 1Z7S1 3LAGA 4XURA 1U5IA 2RS33 1ZRIA 1GP5A 4V1PA 5BPXA 1H4HA 2JG9A 3BVCA 1O3TA 1BJQA 3ST7A 3VBFA 2Q8CA 4FBFA 3SH3A 5LATA 1GZWB 1PNGA 1UD1A 4QDQA 1Y43B 4IW3A 4Y22B 4CEYA 3T3YA 4HVOA 4ZPIA 4YVWA 3HWJA 5A6QA 2VMDA 1QH6A 1VE0A 4FOVA 4XW3A 4AWDA 1WMXA 4Q4X1 5C8CB 1SFNA 5T52A 2DU0A 1PM4A 3TNPB 4CCDA 4CVUA 2UURA 1S2BA 4HN0A 1ZBE1 4NWWA 2GC1A 3H7JA 3TYJA 4CE8A 1DQ6A 2RR13 1GZWA 5FZGA 1FV3A 2BUKA 1YEWA 1ULFA 1G7YA 1S0JA 3KV6A 4YVSC 5F3EA 3VHNA 4AK3A 3M3QA 1EV11 3N4MA 1TEIA 2P6CA 2ZCWA 3QLQA 1UPIA 1XYPA 5AVAA 4XE9A 2HWF2 3MW4A 1TE1B 5CNAA 2OW4A 1JZ7A 1O3QA 3BODA 2H6BA 5JWPA 1HRI3 2E33A 2N7GA 5SV8A 5FZ0A 3BB6A 2HWD3 2QZ2A 4OLLA 2WNVA 4AI0A 3HAGA 2EALA 1UWWA 3AMQA 2R043 5J7MA 1UIJA 5L7OB 3K75B 3RGBA 3VDDB 4CDUA 2PA7A 4YWAA 5IVEA 1VALA 3M70A 4XFIA 2ZMLA 1JYVA 5HCBA 2ORZA 4OHVA 5JSOA 4JVAA 2WR9A 1YQ6A 3FLPA 4OHZA 5KHIA 1RUD3 3J26N 4V2WA 5D8AB 1E5IA 1RB8G 3PJYA 1HV0A 4X8NA 4XFBA 4NR1A 1JYIA 4FTSA 4COYA 4XETA 5LBEA 1GFF2 1OURA 2R071 1WD4A 4IEUA 5L7OA 1ZA7A 3VBOA 1L7LA 2BNNA 3LOBA 2WS92 4E2GA 1VBC1 5IK4A 2DDUA 4LHKA 5BV6A 1NY72 3N36A 3AMMA 4CDXA 4BYYA 2E26A 1RTVA 1VBE1 5C71A 1Y9GA 2GMPA 4Q2FA 1HW5A 2ZEYA 4AZZA 4E4HA 3N9LA 2XBO2 3HQXA 2B5HA 2VTFA 3B01A 4P02B 4FFHA 5GZFA 3OPWA 2D6NA 4IEXA 1GWMA 4N43B 2Z4FA 5LA2A 3SNMA 5F5AA 3DYOA 1XNAA 4YRDA 3VKFC 4Z1VA 3RDIA 1QNYA 4Y24A 3WY6A 4BIFA 4Q27A 3AMHA 1MPXA 2VBDA 4N53C 2VQ0A 1AX1A 4OULA 5L73A 1OF3A 4WBBA 4ASKA 1X8MA 3CJIA 3QBQA 3RZLA 1DYPA 2XQRA 2D3PA 1H30A 3U1XA 3CJXA 2ZGRA 5T5OA 4XACA 4RN5A 1UY3A 2HWE2 2VW2A 4XFAA 2GC0A 4OUMA 1J1TA 1HN0A 4BZ4A 1XNBA 4FPEA 1HKDA 5FTTC 4O61A 2QQIA 5CFDC 1I9RA 4LHNA 5FYIA 2KA3A 3H3UA 4BB3A 4RSUA 4YW2A 1JH5A 4FPYA 4Q4W3 2OUHA 3SISA 3VDDC 5A33A 3I3BA 4BLIA 2X05A 2QVSB 3CLPA 3S7EA 1Q43A 3POFA 4A6SA 4CUGA 5L9BA 1VAKA 3WHTA 4YARA 2ZMKA 3FUOA 3ZFFB 5BNPA 1YFXA 2XLFA 4FP2A 3THCA 1RC6A 4BQ2A 4Q5OA 5FLJA 5JMOA 4O9GA 2DTYA 4Q4V3 5FZCA 2E63A 2XJRA 2IFWA 4ZXEA 3I2OA 2BFUS 4QPGC 5DUUA 4UI9L 3T2QA 4O7XA 3TN93
chains in the Genus database with same CATH topology
2E7AA 1Y7BA 1VRH3 1WBFA 1KJRA 3L2HA 3WX5A 2IZWA 2OYZA 2VG9A 1V9U3 3EJKA 4S2GA 2PHLA 2ZX2A 4RHV1 1O5LA 1F8VA 1FI2A 2YUEA 2GSYA 1OA4A 1MQTA 2A6ZA 5KHHA 3D4KA 2R0FA 3B3QE 4IEQA 4BMBA 4FPOB 1YHFA 2RS52 3MIGA 3V0AA 3QCWA 5H9PA 1MS8A 4Y1YA 3ENRA 4CP0A 4QT6A 3RNSA 4MXWB 2ZS6B 5J36A 2D6KA 1RJ8A 2D6PA 3POSA 4HL0A 4LE4A 4YM3A 5T3NA 4CEWA 3H3ZA 3OTFA 5CFDB 4N90A 2R061 3AKRA 1FXZA 1DDLA 4IV1A 4Q4Y3 3I59A 3P3NA 2FZ2A 1RUF2 3ZIWA 1YJLA 3E5XA 1YNAA 3J8F3 1LHVA 5EJ3A 1XU1A 4ZXKA 3GBFA 4L8QA 4GMP0 3ZPYA 2ZGSA 3PTYA 1BVP1 4R4XA 4I3GA 4XF3A 4QPIC 2X5IA 1VBC3 1PGW1 1HLCA 4A7KA 1MS4A 1QOTA 4J1WA 1I1EA 5JVVA 4N43A 2FBEA 3PNAA 1XXNA 1RUI3 2P34A 3H9AA 2WZPP 3ZXAC 3MI8A 2CYFA 3EO6A 1UZZA 3EXUA 1RGSA 2PYTA 4WVWA 5BNNB 4CDXB 3B00A 4QPYA 1HV1A 2G9GA 1LHOA 1KS5A 4YZ3A 4E9KA 1ZREA 5A3MA 2B8MA 1NYWA 4EN9B 4QGLA 4WM7C 1QMJA 3UJQA 3LZZA 2R6QA 1OI6A 2E7TA 2X8KA 2C0ZA 2DVBA 5FO9B 3MYXA 2WIIB 4HMZA 4LBLA 1X33A 4Q4Y2 1QU0A 2JJ6A 1GYKA 3RRDA 4WM8B 2WQZC 3D82A 5BNPC 3R4SA 4XYXA 3MIHA 5I8TA 4Q8KA 1OD5A 1XYNA 2VOKA 3E5QA 1RUI1 2WQ4A 1A3KA 4LHLA 3WDUA 1SEFA 1UW8A 1LOGA 2OZJA 5CVRA 3W58A 2R32A 5C8CC 1LHUA 2DVDA 1EPZA 4YW5A 1S0IA 1ND2B 1ZBE2 2KM2A 4R9CA 3GHMA 4OVEA 3LA7A 4Z92B 4COWA 4Y20B 5CAZA 4D3WA 1AR93 3JD73 1Q8PA 2XJQA 4AQSA 4B4QA 1H2NA 5JSPA 1GV9A 3ZFEB 1FPN3 1QQP2 2QJVA 1S55A 3UV9A 4YVSA 1SLIA 1DU3D 1AYN1 4HK9A 1S0CA 4PQ9A 4YFZA 4XBQA 1W6NB 1PVC1 1DLLA 4EJRA 4BMEA 3IWZA 3POWA 3VBOC 1LU2A 2WSVA 4XFHA 4AQ6A 5AC93 4I30A 5FRAA 2XJTA 3SCFA 1VBE3 2A73B 2UY9A 1QJU1 2R072 2YHJA 3MIBA 4CEYB 2D6MA 2XVGA 1KDKA 1UAIA 3WDYA 4DFSA 4F7ZA 1YI7A 1DZQA 1AZDA 1ZRFA 4CDXC 5C9AA 3TBDA 1ULCA 4YW1A 4CDQB 4P5HA 2X29A 5FBZA 5C9AB 4H14A 4MVTA 4IEOA 4LO7A 4N43C 1Q5OA 3AMPA 4YG6A 4IV3B 3GALA 4YM0A 1UU6A 3DGTA 3OCPA 3R05A 5JAXA 2GMMA 4GH4A 1BMV1 3POYA 4JGZC 3M3IA 4RR3A 1J3QA 4YLZA 2RJLA 2R1BA 5D8AA 4W6XA 1NA1A 5EFUA 4JRAA 3AFKA 3G7DA 3QACA 5BNOC 3VDDA 2HWD1 4CDUB 2WFF3 1LGBA 1IGOA 1IKQA 4HPKA 4JDOA 4QQOA 1U5YA 1XNDA 3ZYGA 1B09A 3ZFEA 1H9WA 5I91A 1OOPA 3H50A 1HRV2 4PBOA 1PZ8A 1UCXA 4CDWC 5BNOA 3N7LA 3AJYA 4FTEA 3E6DA 3LA2A 1JBCA 1JTZX 3KLSA 3IIAA 1OSGA 1HRV3 4ZU4A 3PMEA 2HEVF 4Y5Z0 3C2UA 4N9HA 2ZZQA 4SBVA 2VGDA 3ZFGA 4Q0QA 2FZ1A 1H2KA 1A8DA 4Q26A 1DQ4A 1PZ7A 3GZUC 1U5XA 5FFOC 3OGGA 3M3OA 1CAXA 3LCPA 1JOJA 1WGPA 2NP0A 3SCHA 5AFEA 5H9QA 1QJY3 2OUJA 3R4UA 4J6GA 1NOVA 1COV3 2K9ZA 3VBRA 4BLJA 4JGZB 5GLTA 4Q4V2 2ZA9A 1POV3 3I59B 4CEWC 2GAUA 3MF6A 1QJY2 4QM9A 4AGVA 3B5LB 1PVXA 4CP1A 1AJOA 4XJZA 3UJOA 5EZWA 5ACA1 3WXPA 3KD4A 5C33A 4LLOA 3BOWA 1RUJ3 1I6XA 3WR0A 2FMDA 4AVBA 1GANA 2O8OA 5JIAA 4LUKA 4K7JA 1UKGA 1WMEA 4JQRA 3WINE 2AZ5A 3AX4A 2DVFA 4CEYC 4OI0A 3WDTA 4NN0A 1BMV2 2WKKA 5HCAA 4FTBA 3VUOA 4WVMB 1AXYA 2Y38A 1YO8A 4KWLA 3AK0A 2ARXA 4NVPA 2ZAHA 2TUNA 2RR11 3AZZA 1FATA 1MEC3 2YROA 4IL7A 3AYDA 1EY2A 5JCTA 3ES1A 1ZZ8A 2VMGA 3AKPA 1LCLA 1N3PA 2NYYA 4XF1A 1W6MA 2XG3A 2R16A 3ZXKA 1MACA 2X5IC 5I8SA 1IKPA 2O8QA 2C9AA 2VQAA 3UKVA 1K5MA 3OJBA 1H1MA 1QJX3 4QQ2A 3KB5A 4JGYB 4D69A 4ZKTB 1C57A 2WT0A 2WLQA 3VKMA 2ZACA 1WW7A 2OA2A 4F8AA 1ASJ2 2XJSA 4H7LA 4XFCA 1MS9A 1S0BA 3THPA 2JDZA 3W59A 1QQP3 4NHLA 1LTEA 1ULDA 3VZMA 4COVA 4BQ1A 3EQEA 4AFBA 4QHBA 1G9DA 1UZYA 4P9GA 4RR3B 4NWVA 5KC6A 3ZFGB 1FMD2 4KU8A 4MX3A 5GZCA 4Z8BA 2IXHA 2TEPA 5I0SA 3TRSB 4C0HA 3S6PA 4XQWA 2QKDA 1TME2 4D94A 2VUJA 4B4RA 1FAYA 3E6BA 2LUWA 4LO5B 3AZYA 1YIPA 4I09A 1SLAA 4FVVA 3U07A 1CD3G 1Z78A 3O0VA 4KU7A 4XIKA 3VLBB 2EVXA 4HPKB 3I54A 2ZAAA 4XMIA 2YPJA 1LULA 3WP5A 1H8TA 2ZHLA 1BVVA 1R092 3UKTA 1I5ZA 5JPNB 2GC2A 1XQNA 2R0HA 2VMHA 3FFZA 1RUC2 1BCXA 3JBG3 4YVSB 2GDFA 1HIXA 2JG8A 4RD7A 5KXBA 5BNNA 1AR63 4MXWA 4JGYA 1WW6A 3OYWB 4XTPA 4AVVA 1SLCA 1GICA 4LE3A 5AC91 1FMD1 1DZRA 3B9IA 3D5OA 3AP4A 4YGEA 2XGXA 1BYHA 1W6PB 1WLWA 4LBOA 5IK7A 3MW3A 3LSEA 1WUVA 1KITA 3ZXLA 2QDNA 3FBMA 2XB6C 3USSA 1FOD3 1N47A 4L2NA 2KXLA 5EXOA 4NHMA 2NQYA 4A7YA 4P9JA 5EV7A 2RM21 4RS5A 3JU9A 3DPRA 5FQ0A 4BE3A 1OQDA 5FMOS 1B35B 1CR7A 1WD3A 4XMAA 1S0GA 1UIKA 1VB4A 4QX5A 2A6VA 4WVZA 4XFGA 2H0VA 3AZWA 3T1MA 2GU9A 3USUB 5E88A 3AJZA 1VP6A 4FXGB 3APBA 1CJPA 5K0UA 1MZ6A 3LA3A 4TYSA 4AEKA 3D0SA 3OBTA 2Q8OA 4KGQA 5GLWA 1SACA 1V6LA 1FOD2 3CO2A 2FMYA 2WZR1 5JR7B 2E6VA 4RS5B 3O14A 1O4TA 1ENSA 3PVBB 4AQ2A 3DV8A 2Y0OA 4IV1C 3G6JB 1F5FA 2P3IA 1VRH1 3GZAA 1BEV2 5DZGA 4I0BA 4DY5A 3ZFFC 1YXWA 4Q0PA 1YI9A 1QJY1 1XRUA 5J96B 1AJKA 1NXD1 1YLLA 5EYXA 3CJIC 1MZEA 5SV5A 4TWTA 2GNMA 5T5LA 5T55A 4RGAA 3INAA 4ASMB 2WLPA 2JICA 5BNOB 1TME3 2HJIA 1CVNA 5HBAA 2YV8A 2WNEA 5F9TA 1IS6A 1QXRA 3ZN4A 5IT6A 1MVQA 2PLV1 2LM3A 3ZYPA 2ERFA 4C0BA 1PGSA 2BBVA 4TLFA 4HKWA 1R083 2Q4SA 2R063 1RHI1 3ZVXA 1BEV3 1DIWA 2WS91 1QF3A 4EN0A 1O4YA 4LBQD 2B7YA 2A75A 2PHTA 5E1RA 4GKYA 1S2KA 1HXS2 4ISRA 1X8EA 1ZBA1 2A3WA 4PLMA 1MS5A 5FCCA 4WM8A 3M1HA 1JYCA 2PFWA 4IEPA 4LO4B 3L9JT 4TSVA 1HRV1 1RUD2 1LGNA 1J59A 1XNKA 3AP5A 3AYCA 4LO8A 4XXAA 3VBHA 1VBC2 2DWRA 3A0NA 3IKWA 2DFCA 1FNZA 4AEJA 4LT5A 4R9DA 1V9U1 4SLIA 1ND2C 4I3PA 1S0DA 3VN4A 2EIGA 4N53A 2GN7A 2W52A 1CX4A 5TSWA 2WFPA 1EYBA 5I0RA 3H0OA 4LA2A 1ND3A 1CGPA 1YRZA 4B3NA 4IV3A 1RJ7A 4Y4YA 3AKQA 4UBGA 1J3PA 1RUF1 4ATEA 4KQ7A 1PM7A 2VVFA 5HXVA 4IEZA 1OA3A 3ELNA 2GZWA 5FQ0B 1Q8SA 1KRIA 2AUYA 5BUVA 1C8NA 3AM2A 2UYAA 3BTAA 3RMYA 1COV2 2NPIA 1SBFA 2LTNA 5KXCA 3X29B 3GZTB 4JAAA 4FPCA 2MEV3 4RQPA 1X50A 5FPZA 2DCYA 2VECA 1IS4A 5T5JA 3N3HA 3HN1A 5DZFA 1WMDA 2ZHMA 3TB0A 4QM8A 4UXAA 2RE9A 1PVC2 3DF0A 1BBT3 1UU4A 1NQDA 4URTA 5GM0A 3ROUA 5CFCC 1UX6A 3FZ3A 2IC1A 3D0JA 5BY5A 1XNCA 3MIDA 4FSJA 1R082 2ZX3A 4OFGA 5KXDA 5AC92 2E9QA 1Z7S3 2BQPA 2XKOA 3FE5A 1GLHA 2R062 1UN1A 4CP2A 2JEMA 2WL1A 2DV9A 4GA9A 2CWSA 4EWDA 1MEC2 5I8YA 2RS13 4R9BA 1N1TA 1O91A 4RR3C 4H3WA 4IXLA 3QD6A 1QQP1 1D0GA 4B7EA 1H0BA 1IOAA 4K1ZA 5JSRA 1YJKA 1EAH1 2Q5TA 4FPHA 3VZOA 5I0UA 3ILFA 1KXGA 1UMZA 2OZ6A 3PJQA 4TZDA 1I3HA 3VBSB 2GNBA 2RM22 4ORFA 3PLQA 3V0BB 1O7FA 1MS1A 1PIV1 3URFA 4CTEA 4AEDA 2D3SA 5JDBA 1ZBA3 1POV0 4HT1T 2HWE1 4IESA 4GALA 3ZDSA 4AYUA 1BZWA 3UK9A 3J4UH 1D2SA 3R0RA 1A78A 3ZSEA 3D6EA 4XXPA 1G6NA 4IEYA 4R8HA 2F6BA 4UW4A 2FQPA 4BPZA 4YZ5A 2BNOA 5FREA 1ZA4A 4XDQA 1D4M1 2XLGA 4YM1A 2XBO3 4CDUC 1ZRRA 3AKTA 1GSLA 3ZYRA 4OHXA 4K20A 4XHBA 3IDBB 2UWCA 4JGZA 3WG1A 4XIOA 4G4FA 1NXMA 2SLIA 2HWF1 3JQXA 1W6PA 3WUDA 1TMF2 3ZN6A 2ZABA 5BXXA 4BHPA 2HWB3 4INDA 1UU5A 4XILA 3O5SA 1SFYA 5IK8A 4DB5A 4W6YA 4P9WA 2ZBJA 3HIFA 1MZFA 3OPZA 3AYAA 1SLLA 4B29A 4OI1A 2IXJA 2E7QA 5T54A 4LBQB 3AZXA 1N1YA 3T1LA 3M4FA 1CAVA 1OPOA 2ZKLA 4XBNA 2PAEA 2WT2A 2EXIA 4J1XA 1QY4A 4AW7A 3VV1A 5JZGC 1MVEA 4IQPA 1YUDA 3RWNA 4XJWA 2X53S 3VBUA 2DF7A 4XTMA 1AR82 1H1AA 2XUMA 3OY8B 1R1ZA 3OGJA 4DMIA 3ETQA 1PK6C 2XBO1 2E53A 1K5MC 1XU2A 4WVMA 4BWOA 1G8WA 4M3CE 1D4VB 3KSCA 3VBUB 2V73A 4I2OA 4L99A 2DU1A 1XE7A 2JENA 4WZCA 2BTVC 1QJU3 2JECA 1W6NA 1J3RA 4AI2A 3KCXA 2HWB1 2R041 2QZ3A 3LKJA 2VNGA 3WW3A 4EN6B 2ZGQA 2A3YA 2RS32 3AYEA 4E4SA 1WLTA 1RUC3 1RUI2 1NCQC 3CEWA 1AX2A 4LTAA 3AXDA 1VBD1 1Y3TA 3JBG2 1AYN2 1RUOA 5GALA 2ZPXA 3H1WA 1N3QA 4FPLA 2HWC2 4EWAA 3AMNA 3DUIA 3WLUA 1MQTC 2DCZA 2ZGUA 4M00A 1AYM2 3IPVB 3RZZA 4L92A 3I8TA 4K8FA 5J48A 2VNRA 2VOVA 3WQ0A 5ABJB 1PMIA 3ZSJA 1WLDA 3RYRA 1AYM3 3S30A 5JZGB 1Y9QA 1VIWB 4W6WA 3CJIB 3MIEA 1HXS1 3ZXFA 4C1WA 3WDXA 1AVBA 3SH5A 5GZDA 4HKLA 4FPJA 3ZXGA 4OHWA 3V56A 3WP3A 2ILMA 3ZFFA 4RHV2 3AXEA 5BNPB 1OHFA 2B45X 1REEA 1RMU1 3EHKA 3WCRA 4WZFA 5C9AC 2IFRA 4FOQA 3M3CA 3N7JA 3MICA 4X6RB 1V70A 2VMIA 1YFUA 4RS5C 4XQ4A 1V6OA 4M0NA 4N53B 2GMEA 2WNUC 1N1VA 2JXAA 3RSJA 1AHSA 4OUSA 4GIQA 2HYKA 1OA2A 4IEVA 4LUMA 1KQRA 5LK7B 1SLTA 2XLAA 3J8F2 5CADA 4CDWA 4PDWB 3R4DB 3U10A 2ZHKA 1RUE2 1QH7A 4FT8A 1VR3A 3USUA 4R4ZA 2PAMA 4QQPA 3DL3A 1H8VA 1DGWX 3ZXDA 2A71A 2BEOA 3WDVA 3TN91 1QJZA 4Q4X3 4CDQA 5ABJC 1B35A 4YSFA 1QOOA 4YW3A 2D44A 2A70A 5DZEA 4C90A 1YCIA 5L19A 4X8PA 4RQPC 4AHZA 1LESA 4X6QB 3IN9A 4PIYA 5GLVA 4IV3C 4AVAA 4QPGB 1GNZA 4KWJA 2PELA 2FHRA 3CF6E 3HT1A 1N1SA 4K6BA 5C8CA 4C1XA 5DUXA 4JV4A 1Q56A 3A4UA 1HRI1 2CNAA 1DGRN 3WOGA 5FOJB 4AI8A 5CB7A 1C28A 1QXJA 5DG2A 2BGCA 4WM7A 1QXPA 1QJX2 3VKLA 4CRQA 1TNFA 1RUJ1 1RUD1 5A33B 1R093 1PO21 2MHFA 4QMAA 5GLZA 3RI9A 4FP3A 1ASJ1 1RUC1 4CEWB 4BCUA 1AUYA 4AI3A 3NKGA 4BH9A 2A6YA 4GXLA 2ZX0A 2EXHA 4NPRA 3MEPA 3Q9OA 5KXEA 4Q0UA 4Y26A 1N3OA 2V5YA 2XVKA 2F4PA 1AR92 1AR61 3JD72 4B8EA 2D40A 4AFMA 1C5IA 1WCSA 2VW0A 1GQHA 3AFGA 4MV2A 5DUWA 4B7KA 2BYVE 4N7IA 1ZYBA 4YVWB 3D8CA 2ZGKA 1O4ZA 4GH4B 5T50A 3RS6A 2JG9C 3VKOA 3FLRA 3I7DA 4FPKA 4ES9A 3RYKA 3R6SA 3H1YA 3MFAA 1FOD1 2Z79A 5A3LA 4LBKA 5CU1A 2K2SA 1RUE1 4GMP3 2WZR2 1W0PA 3VBSA 3ASIA 1Q3EA 5K8SA 4YGCA 4P14A 3PVEA 1ZRCA 4LBJA 1R091 1CAUA 2WFF2 2HWF3 3ME2A 3GHNA 2BWAA 4L97A 1VLNA 2QCSB 1RVF2 2YXSA 2ES3A 4A3XA 1KS4A 1RUG2 4PDWC 2CV6A 1JUHA 2D98A 1KFXL 2RMU2 1BK1A 4OI2A 1Q8QA 1Z0HA 2NMOA 4LULA 2GN3A 4JRLA 1AR71 3WW2A 2D6LX 3RJ2X 1QOSA 3U4XA 4Q4Y1 1OKQA 3O7OA 3O12A 4AG4A 1NLRA 2WA3A 1S0FA 3SMHA 3ZYIB 2WZR3 4AEMA 3BU7A 5FO7B 3ZN5A 1ZZBA 1O3SA 3FUQA 3B7MA 4E2QA 3BIWE 1C8M3 5LRSA 3WNXA 2ENRA 2RS31 4GQ7A 4I0AA 4GH4C 4E4ZA 2CY6A 3B94A 4RGGA 4FCAA 3VBHB 1SCRA 1C1FA 2QE3A 4XQDA 3TNQA 4K21A 4YZ1A 4JGYC 2JD4A 2I07B 3AB0A 2WFF1 1VAMA 3FC0A 1JUIA 1T6GC 4IV1B 1Q8OA 5DDJ1 2QQPA 3VBUC 4H55A 1RUF3 4MXVA 1C5HA 2AH2A 2R042 2PN5A 2D6OX 1SCSA 5DG1A 1ASJ3 1GBGA 1DYKA 2TBVA 4K40A 1DQ2A 4DRVA 1ZZ9A 2DFBA 2RMU3 1OQ1A 2VULA 4M01A 2O0OA 1AL22 1PZ9A 2YY1A 5CIRA 1DF0A 2UWBA 2HWC1 1DGLA 4RL7A 4UBHA 5K9YA 3S0MA 2R073 3MDPA 4HN1A 4EN8B 2ZMNA 1VBA2 1VBA1 1ND3C 2VY0A 3KM5A 3NAPA 1EV13 3VBOB 4WV8A 4UW3A 2ET7A 1TNRA 1LEDA 2R49A 3KCYA 5DXDA 2D93A 4O9EA 3EBRA 1CESA 3AZVA 4QD2A 4F3JA 3GBGA 3V65A 3VBHC 1CPNA 1R1A1 1G9FA 1ZRDA 3NAPC 3E5UA 3KT1A 1ENRA 4AFCA 4KWKA 3HMYA 3WD5A 2P2KA 2VW1A 4ES8A 1CIWA 2DCJA 2C1FA 2ET1A 3J9SA 3ECQA 2JG8C 2QNKA 2BNMA 1UF2C 1W6OA 2WSUA 4CDWB 3DPRC 2Q0AA 1EV12 3OD0A 5JOWA 4Q4W2 1RUNA 1X36A 1J58A 1TME1 5FDBA 2VOWA 4JDMA 1PIV3 2ZJCA 3MPPG 1JHNA 2QDRA 3J8F1 4AQTA 3ZMOA 1PGW2 4PJYA 2YDEA 3LB9A 2HEYF 3RQ0A 4Q0SA 5EWSA 2A6XA 3KS7A 2QFEA 2DUQA 4GWMA 5E89A 1AYM1 2YGLA 1C8M1 2D7FA 4YG3A 4YGBA 4C91A 1PK6A 4Y1ZA 3VKNA 5JLVA 4QPIB 1IS3A 3RYPA 2IXCA 3B9CA 4M3CB 4NOTA 3MLJA 4A2UA 4NHKA 3FWEA 4DNYA 1KDMA 1RMU3 1UKRA 1UPSA 2EXKA 2JE9A 3NWKA 4YZ4A 1R081 4LBNA 5KHJA 4P9XA 4XBLA 2W39A 2WNUA 1NCRA 4XJUA 1D2QA 4CYDA 3VBSC 1ZZ7A 4HSJA 1BEV1 1GQGA 2CAVA 2PHDA 4PIZA 4PF5A 4FO9A 1RMU2 1RIRA 5BNQA 1AYN3 1E57A 3CNAA 4P9LA 1FX5A 4DQAA 4R52A 1H4GA 2WNVC 1CAVB 1X82A 4EWEA 2W0XA 1XYOA 5F5QA 3CU7A 1QWRA 3NSTA 1BQPA 4E4DX 1ND3B 1U5ZA 3WG4A 4GB33 3SXWA 4MSVA 3QH7A 4CZSA 4WVVA 3MIFA 4Q1PA 4YZ2A 2O1QA 4KBBA 5I93A 4RFT0 4GB32 3WQ7A 1AR62 1GR3A 4XEZA 4META 3ZXJA 4N7UA 1NE4A 1ND2A 1UL9A 4XPVA 3RJRA 4AHYA 1OOPB 2WWSA 1RUG3 2X5IB 3FMGA 4XF4A 1NG0A 2B46X 2ZGNA 3GBWA 3NAPB 3OD4A 4ASLA 4HVRA 4BM8A 3SHRA 1G9BA 1MS3A 3M3EA 4YVWC 3VHOA 3WCSA 2W68A 2WA4A 5LRRA 1RUE3 3KGLA 2BW8A 1VJ2A 4FQ4A 1W0OA 3FHIB 1NCQA 2YZ4A 2MEV1 5F6KA 1HQLA 3ZMNA 1S0EA 1NZCA 2JE7A 5DUVA 1V6IA 4K1YA 4Q4X2 1J1LA 1W2UA 2Q1MA 2UWAA 3B69A 4BA6A 3ZX7A 4S2DA 5CG8A 4DY3A 4YGDA 3ZSKA 2ZKNA 4AGRA 2ZOEB 1BBT2 1BBT1 2H0BA 4MGYE 2BPA2 3U11A 3VBRB 3LOIA 5C4WA 5FO8B 2NN8A 4XHXA 1WA4A 3JUUA 2XPJA 2QUOA 1WBLA 4FPGA 4AGGA 3H8UA 3KT4A 3WG3A 3RI8A 2OPKA 4BIOA 2WNVB 3WZ1A 5FMOL 1ALYA 1PK6B 3KMHA 1IS5A 3NVCA 2XHKA 1LGCA 1NCRC 3VHRA 1NY71 1FT9A 1ZM1A 4QPGA 5E16A 3DN7A 4LLFA 3ACLA 4EV0A 2D5FA 3TWIA 2ZX4A 3PVOA 4K9SA 5HCFA 1BKZA 4L9BA 2VU9A 1G9AA 3HR9A 3ZSMA 2EXJA 3E97A 3SH4A 3WUCA 4JC1A 4U2AA 3I2DA 1IPKA 1A8MA 2RS11 3WW1A 5CFCB 1F9KA 4Y20A 1OMIA 1HQWA 4AFAA 1JXNA 2D3RA 5JOYA 2P17A 5KHKA 5JPMB 4LA3A 3L2YA 3VL8A 2WNUB 2GH8A 1IPJA 1L3JA 4QXKA 5J09A 1APNA 3THTA 1D4M3 2RJKA 2Z5WA 3M2MA 2RHPA 1S1AA 2Q30A 5I0TA 2XWBB 3ES4A 1EPWA 1LHWA 4XJAA 1BXHA 4AVCA 2OIIA 1PGL1 2Z42A 1W6MB 4UW6A 4AHXA 3MPBA 4IETA 3GYDA 4ONUA 2HKXA 1OLRA 1NCQB 4AFDA 4FAGA 1IQAA 1ZZCA 2VNOA 3WHUA 3NV3A 5T5PA 2XJVA 3NO8A 2WS93 4L11A 5BNNC 3JB4C 5KC5A 3C3VA 3LGRA 1SLBA 1ZBE3 4AEDB 4FAHA 4HETA 1B35C 2UYBA 5C4WC 1HXS3 1MQTB 1ENXA 4DPNA 2XL7A 4N9IA 1WMFA 1NLSA 5E8AA 2WINB 2DVAA 5B2GB 5DDJ3 4XJ8A 1WCKA 4FPFA 2DCTA 4XJ9A 3QOPA 4NO4A 2GALA 2HEWF 3AP6A 4Q4V1 4W65A 1CAWB 2B9UA 1LU1A 5IK5A 2XKPA 2EF6A 1COV1 1VBB3 3NL1A 2MPFA 4LR4A 1HDKA 3N35A 4DZGA 1WW5A 3KT7A 1SBDA 1WCDJ 2PHUA 3GNEA 3JCIA 1DGRA 3NV2A 3FJSA 4G9SB 4ITCA 5L36A 3MGUA 1OLQA 1CAXB 1MZ5A 2P3JA 3SLIA 5JZGA 2JKBA 2IXKA 4H7MA 2JX9A 1CPMA 2HWC3 2DVGA 2AREA 4M3CF 1EP0A 2XVLA 1DBNA 1FYUA 3VBFB 1ULGA 2VXRA 3BOPA 3NJZA 4QPIA 1VRH2 3ILRA 4DOUA 5C4WB 1QDOA 3V64A 1MEC1 4Q8LA 5JIUA 1PNFA 3MW2A 2Z69A 1Q8VA 1H9PA 3VL9A 5GJ6A 3HD8B 4HVQA 1QKQA 2Y0IA 5JOXA 3SITA 2OVUA 4MUVA 4RA0A 4LBQA 2ARBA 3KGZA 4KH9A 4YNIA 2PLV2 5J3UA 2YMZA 3I4IA 1AR83 3FX3A 1V00A 1LJ7A 4GB31 1LENA 3NKTA 3VZLA 1ZX5A 1NA1B 2DTWA 2BWCA 3JZVA 3IM0A 5D1IA 2BFUL 1CQ9A 4COUA 1M06G 4U36A 1VBB2 3IDEA 1AL23 3KZ4C 5HI0A 4KL1A 1GKBA 4XF9A 3FFQA 1YFYA 1FNYA 4K3UA 3NV4A 3MFCA 4HANA 4PBPA 5JOZA 2A3XA 3U0ZA 3GF6A 4P9IA 4PIXA 1F5JA 3RMXA 1W6QB 2NZ9A 1OQEA 1VBD2 3PVNA 1LECA 2Q1ZB 2WC2A 2Z2SB 4MZUA 3DPRB 1DG6A 4ZU5A 5JI7A 1FPN2 5FLIA 3VHPA 1W39A