1U5ZA

The crystal structure of murine april, ph 8.5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
128
Chain Sequence
b'KHSVLHLVPVNITSDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title The Crystal Structure of A Proliferation-inducing Ligand, APRIL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor
total genus 21
structure length 128
sequence length 137
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1u5zA00
1C28A 4D7YA 3L9JT 4OUMA 1U5ZA 4MXWB 4J6GA 4G4FA 3MI8A 1JH5A 1ALYA 1PK6A 4QPYA 4DOUA 2R32A 1OSGA 1XU1A 4RSUA 5HBAA 4KGGA 4EN0A 4F3JA 1GR3A 1U5XA 1WCKA 2WNVC 4NN0A 3IT8A 2JG8B 2AZ5A 5KWRA 5L36A 4MXVA 1TNRA 4MXWA 2RJLA 3V56A 3B93A 2WNUB 5KC6A 1OQEA 1PK6C 2JG9A 1XU2A 3QD6A 2HEVF 3FC0A 1S55A 2JG9B 1TNFA 4OULA 2JG8A 5CIRA 2TUNA 2ZJCA 2Q1MA 5TSWA 3AB0A 3LKJA 4QQPA 2E7AA 2RE9A 3QBQA 4GIQA 4N90A 3ME2A 1JTZX 2WNUA 3K51A 2X29A 3TWIA 2JG9C 2OIIA 1RJ8A 4QQ2A 4G3YC 3URFA 4KG8A 2O0OA 2JG8C 1D2QA 2Z5WA 4QQHA 3WD5A 2QE3A 2R30A 5BNQA 2KA3A 2R6QA 1RJ7A 2HEWF 5KC5A 2WNUC 4HT1T 4QQLA 2ZPXA 2TNFA 4OUSA 4MSVA 1IQAA 4KGQA 1KD7A 2WNVB 1C3HA 1A8MA 1DU3D 1DG6A 2RJKA 4E4SA 2QDNA 1D4VB 2Q8OA 1KXGA 3B9IA 1PK6B 4TSVA 3K48A 1D0GA 2HEYF 4E4DX 3B94A 5L19A 3ALQA 1I9RA 4TWTA 1OQDA 1O91A 4QQOA 1U5YA 4DB5A 3TYJA 2WNVA
chains in the Genus database with same CATH superfamily
2YU1A 1CPNA 3WUCA 2NP0A 4LKFA 1YJLA 3GALA 1COV3 4YGCA 3IBMA 5LBCA 3AP7A 4HONA 2J1TA 4QD2A 5LRRA 1JOPA 5FJKA 4MHUA 4GALA 3U75A 2WFF3 1EAH2 2Q8CA 1PK6A 2MHFA 1W2NA 1QXRA 1OKOA 5F6KA 5B2GB 4UT5A 1VBD3 1RUH3 4LO4B 5JZGB 3LFIA 1UPSA 2BPA2 4P9YA 3AL6A 5IJRA 4MX3A 1UWWA 3ABZA 1W6NA 3PLQA 3BVCA 3RYRA 2SLIA 5EPAA 5C9AC 4PF1A 3ZR6A 1DGLA 4IV3C 4QX0A 4HOOA 4LT5A 3LEKA 4IDZA 4XACA 1Y3TA 1CWPA 4Y22A 1HLCA 2W3JA 2YHJA 4XIKA 3ZO0B 4DMIA 5FYTA 1ZBE2 1ZNPA 1IS4A 5FKCA 4CDUB 5JSRA 1JUIA 2BERA 3OY8A 2ZABA 2WNEA 3ZXJA 4J25A 2OPKA 3ASIA 4Q2FA 3VL9A 3HVDA 2XLAA 4QX1A 5FXXA 1MS8A 1FPN1 4YG3A 4FXKB 5FZ9A 5BNNA 5F8PA 3BN6A 3KZ4C 2XL7A 3I3EA 4IESA 1D4M2 5CBLA 3RVHA 1CESA 4B4RA 2E7AA 2DVFA 2W52A 4E9KA 1SPPA 1IGOA 1QXJA 4OFGA 4K21A 1H6XA 1OOPB 3TN93 1VAVA 4K40A 3M3IA 3JBG2 3T09A 3I7DA 5LZ6A 3UT0A 1ND2C 4L97A 3VD9A 4MVTA 3ZYJB 3KT1A 2JE8A 3ACFA 5IYYA 5FMOL 1LEMA 2C0ZA 2ZS6B 3T08A 1TG7A 4D7SA 1PIV2 4YVWA 1C1FA 1Z7S1 2ENRA 1Z0HA 1OH4A 2P3JA 4HN0A 5LA1A 5IUQA 3VDDA 5A6ZA 2FCUA 3AJYA 1AL0G 4M4RA 4O65A 4LPLA 1ENRA 3K46A 3MF6A 1BZWA 1I3HA 1OA4A 2B8MA 4EWAA 1ULPA 4NIGA 2VQTA 1RUE2 2CU5A 2A7AA 2Y6HA 4GWJA 1AVBA 1J58A 3ZN5A 2QZ3A 3C2UA 3H7JA 3T2TA 3QH7A 1OMIA 3VKOA 3KCXA 2EIDA 4AQSA 1OLME 3GZEA 4NHMA 1NY71 2JXAA 4D0QA 4KL1A 1NZIA 2XLFA 3PURA 1W8UA 1NOVA 1W6OA 4QAWA 3KB5A 4LEJA 4MLOA 1PX4A 2VXJA 4NHYA 3O1PA 1WA6X 1HB3A 1VIWB 2CY6A 1Q8OA 4UW4A 1YNAA 2GNTA 5EIYB 4GMP3 2ZACA 3A7QA 1NLQA 5ABJA 2JDYA 3UGFA 1G7YA 4RD7A 3PHMA 4QXCA 2HEYF 1HXS3 4NROA 5FZCA 3BGAA 4XHBA 1C8NA 2E51A 3R4UA 4DQAA 1T6GC 4N43C 2WNVA 1C28A 4QPGC 4IXLA 1IPSA 4RS5A 1RVF2 3IZOA 5CYYA 3NWKA 3OGGA 4QKBA 2ZX3A 3GBGA 3PTRB 2B46X 4Y3OA 1BBT2 2WC2A 3IPVA 4RR3B 1W9SA 4MXWB 4QKFA 1WW6A 4XJUA 3MUZ1 4BXFA 2VBBA 3VKFC 2FHRA 2Y33A 4LHKA 1UY2A 1RHI1 4Y5SA 2ZXQA 4AAPA 1R081 4AEJA 1ODNA 1V6MA 2CGNA 2WAAA 2X5IA 3B9CA 2BUKA 5A3TA 2LALA 4KWKA 2D93A 3PJQA 2PFWA 1ULGA 1XE7A 4F3JA 2GC1A 3LDBA 4TZDA 3I97A 1OPMA 3V64A 3NRUA 1JYNA 1YQ8A 2O8QA 4NN0A 4CCCA 4CVUA 5CFCA 1SFPA 5JIAA 2YY1A 3E6CC 1J3PA 5BNOC 3S30A 2WSUA 3WF4A 2R1DA 4INDA 1NCRC 2XONA 3H9AA 5A7PA 2LW8A 1LU2A 3POIA 1HV0A 5FXZA 5IK4A 2WZPP 5FO9B 2VM9A 3AZYA 4DXZA 1W6QA 1OPOA 2WNUB 3MLLA 4HK8A 2VCMA 3CF6E 2QQMA 3NSTA 4HSLA 3FLTA 1LOGA 5JZGA 3C3VA 2HEVF 3O1VA 3MFAA 1C57A 1WCUA 1XNTA 1AR91 1N1YA 1EV13 1QJEA 1QJZA 1RYYA 2G9ZA 2XJVA 1QHDA 1TMF2 2BVVA 2F6BA 2GU9A 2WIIB 1PVXA 2XUMA 4OMDA 4CPBA 3POSA 2YG0A 4CU9A 4FTSA 2J7MA 2VZUA 3ZDVA 3DXUA 1FNZA 3WHTA 5FO7B 1HRV3 3U4SA 1R093 3DXTA 1AUYA 2HBUA 1XC6A 3R6SA 3FHQA 4CDUA 2GNDA 2HWF1 1FPN3 4H14A 4L99A 3HWJA 1KS5A 2O0OA 3IWZA 1MS9A 3KT4A 3WDVA 1H9PA 2NYYA 2YB7A 1LHWA 3ENRA 4MGSA 3CHXA 4OQ9A 5D8AC 4ZS3A 2YZ4A 3LFMA 1XE8A 4AGRA 3SKJE 2W1QA 3UJOA 1PZ9A 2ZA9A 4K1YA 2X53S 4P9LA 3AKRA 4JGZB 3GHMA 5A70A 3FZ3A 2P34A 3PUHA 3R4DB 4I30A 1UD1A 3ZMOA 1OOPA 1OA2A 5GLTA 4BJ0A 1IHMA 3FHIB 4RHV1 4SBVA 4OUSA 2OVUA 1XXNA 5EHDA 5J09A 2CWSA 3J8F1 3ZXKA 1KD7A 2C9AA 2ARAA 2P6CA 4KWUA 3ACLA 2WWJA 3O1MA 4D94A 1WLWA 4GKXA 2B42B 4NRPA 3POJA 1YQ6A 1R64A 4S2FA 2VQUA 1LOFC 3N9PA 3MBWA 1MVEA 4FPFA 3TEYA 1QJX2 4JC1A 2RVAA 4YGDA 2PA7A 4ASMB 2VPVA 3N9MA 1V00A 1UOGA 3NKTA 3RG0A 4IV1B 4PBPA 4LUKA 1IPKA 3LPGA 1QQP1 3CJIA 4ZZ8A 1YFUA 2FQPA 1EP0A 2VMCA 3NL1A 3SLIA 3OBZA 2DYCA 1WBFA 3CEWA 3ROUA 1RUF1 5C4WA 4OUEA 1U5ZA 1O6UA 4OZXA 1W9FA 1ULOA 2XJPA 3MI8A 1VBE2 3J26N 3O1RA 3O1TA 2QCSB 1JH5A 1ALYA 2I74A 2R041 4R9CA 2AH2A 4XHXA 1PO23 3MW4A 1W2UA 1W28A 2O1QA 1M4WA 3RJ2X 2RM22 4EV0A 4PLOA 5F2WA 1OC1A 1NQJA 3INAA 1NUKA 3WT3A 5J48A 1RHI3 4MXWA 1H0BA 3AMMA 2BGOA 4JRLA 4JQTA 1U0AA 2J1SA 2EIEA 1LOEA 1PM7A 5KC6A 5EZWA 5A3LA 2LUWA 3O1UA 2WJSA 1JYWA 3NAPC 3MEPA 2NMOA 3QOPA 3N7JA 3USUB 2BJSA 1NE6A 1CAVB 1E5HA 1OFNA 1Q43A 1TQ5A 4WVZA 4FTBA 2WWSA 4P9JA 1L3JA 1U5IA 4FXGB 4ZXEA 1OH3A 5T5JA 3J7MA 4PDWC 4AFAA 1H1AA 4H3WA 4XUQA 2GN7A 2JG9B 1TNFA 3CQOA 3W20A 1US2A 3ZXAC 3N36A 5J7MA 2A3XA 2UU8A 1QOSA 3NW4A 1JZ4A 2BEOA 4QPIC 4D6QA 1H8TA 2XBO2 3LKJA 1REDA 4KWLA 1IS3A 4NWWA 1DFQA 4YG6A 4MZUA 4IE4A 3D8CA 1F4HA 2WNUA 4JTOA 5BXXA 3LSDA 1W04A 3BPZA 4KH9A 5SV8A 4XC9A 1UOJA 2VTXA 2BDRA 3OD0A 4OCTA 3U1XA 4CPBD 4WM8B 4QHZA 2OIIA 3C7OA 1W9YA 3J7HA 3HT2A 3SISA 2E63A 5C8CA 4Y4YA 2BRTA 2FCVA 3AP5A 4LHSA 4WM7B 4EN7B 5I0RA 1I5ZA 2CWMA 1J84A 4UBHA 4IEVA 2XUEA 4LBOA 2JJ6A 1LAJA 1SLIA 2WL1A 2D6KA 5FZ7A 3KMHA 3VBSA 2D40A 2K0GA 5FPLA 2HEWF 2AEYA 5BNPC 3NJZA 4FPHA 3AK0A 5A3MA 3HD8B 4S2DA 1K5MB 3AM2A 2A5ZA 3LAGA 4BLIA 1BEV3 1SLAA 1BKZA 4B1LA 3C7EA 5JWPA 4OHWA 3U07A 4JKLA 2AACA 3VHRA 3WF0A 1SQ4A 2R0HA 3VL8A 3E6DA 3SH3A 3ZFFB 2IXKA 2P17A 4IUGA 5LBEA 2B39A 1KGYA 2GDFA 3NNLA 4Y1YA 1F31A 3SEPA 2VVFA 2ZAHA 3HAGA 3NJXA 1NKGA 3O7OA 2GALA 3DGTA 1RUD3 2EXIA 5FQ0A 1GMMA 4EROA 1UY4A 3WDXA 1N3QA 2QQOA 5FIXA 5AFBA 5GJ6A 4NHXA 1POV1 1MEC3 3V0BA 1NCQB 2ZEXA 1WMXA 2DCKA 4Q4Y2 2DFBA 3GZTB 3M1HA 5FZ3A 1UY0A 3IDAA 3POWA 4LITA 3D0JA 1HJGA 4QKDA 2BBVA 1UZWA 4H2AA 1WGPA 1UU5A 4LOSA 1AR83 1L7QA 1VALA 3NV2A 5DXDA 5GLZA 3T4VA 4ATFA 3VN4A 3E97A 4GMP0 3MW3A 1GOHA 3DYOA 2VECA 4XDPA 1C5HA 1QQP3 3DKWA 2EA7A 1BYHA 4FFFA 4FO9A 1JI6A 4IV1A 1SG3A 4P5YA 3ACIA 4FT8A 4N9IA 4RQPB 5HI0A 2BGPA 2OQ6A 1GR3A 3DCQA 4MOAA 4RR3C 1STMA 1WCKA 3RI9A 4DXSA 4XIOA 3K3OA 1W0OA 1Z78A 2VW1A 1BK0A 2YC2A 3I2DA 5FZGA 4BOWA 1W05A 4CDQB 2FD8A 2Z69A 1WLCA 1VBA2 2ADEA 4XJWA 4NUBA 3VBUB 2JIGA 3DYMA 1ENQA 4XAEA 4BDVB 1ZBA1 1QKQA 1SCSA 1FYUA 1VRH2 1OQEA 2BV4A 3RMYA 2QQLA 4UW6A 3RZZA 2FDJA 1UZ0A 2DTYA 3DL3A 5FWJA 3AYAA 2YXSA 3CU7A 1REFA 1FOD1 4PCRA 3S5QA 4A6SA 4BK4A 2OS2A 4XFCA 2WT1A 3LOBA 1G9DA 2ZX0A 5EJ1B 3OPZA 4EZ4A 4QQPA 4XDQA 2C5DA 5C3OA 1KJLA 3VZOA 2H6BA 2OKXA 5CG8A 2RG4A 1NAEA 3I2KA 4JHTA 3USUA 4Q4V2 5JR7B 1OKQA 3U4XA 1CAVA 1LRHA 1XNBA 2WFF2 4IEYA 4PI0A 1DQ4A 4KU7A 1HRI2 4G3YC 4A44A 1GP4A 2G19A 2RHPA 2ZOEB 3ZFEB 4XUTA 2R1BA 5DMYA 2EIGA 1OXCA 1FATA 1HB4A 2BNMA 2PLV1 3VKNA 4B7KA 5FV3A 2VTFA 1GOFA 1RUI1 5ACA2 2DU0A 5AC93 1FMD1 3AMHA 1UZZA 4ASKA 1XOYA 3NJYA 4QXBA 2YGMA 2VUDA 4I02A 1UMHA 2PXJA 1QIQA 2KM2A 2WZ8A 2Y64A 4JQRA 4WM8A 1V6NA 5IVYA 3TRSB 3WQ7A 4B4QA 1YQ5A 4KGQA 3OUHA 4WM7A 3MIEA 5FREA 4N9HA 2XVGA 3V0AB 1VBB1 2N7GA 2LRPA 4JGZC 5IVCA 3KV6A 5F3GA 3ECQA 2WAOA 5EWSA 1YUDA 1W6PA 5F5CA 3DPRA 3Q8BA 5FPZA 2NPIA 1LTEA 3SCFA 1J1TA 3ES4A 4Q4X1 4PIZA 4XOGA 4XF3A 1RXFA 1O7FA 1TVGA 2UWBA 4QDQA 3UK9A 3B01A 5FZFA 5DAPA 1QF3A 2RS31 1A8DA 2R49A 2DVGA 2V09A 4XE9A 5LASA 3TN92 4ET7A 5C70A 5L7OB 2ORZA 4QQOA 1OUXA 4R9DA 1VRH1 1AXKA 1AYN2 3VB9A 1UNBA 4W6XA 5LW9A 1GZTA 1ONAA 1GOGA 3JZVA 3ZSKA 2ARCA 1BMV1 2MEV2 4A2UA 5F37A 1KDMA 3O1OA 3W9AA 1C8M3 4J6GA 3OJBA 4G4FA 5LBFA 2XJRA 5LY2A 5DAQA 4BISA 3KVAA 4Y1VA 2CNAA 2JDHA 3HNBM 1POV3 2IUWA 5DZEA 3AJZA 4DEVA 5KHJA 1ASJ3 5CFDC 1OF3A 1COV1 2QDRA 3O14A 3U11A 5DN2A 1PVC3 1XU1A 4RSUA 5CU1A 3GGLA 3VBHA 2V5YA 5E1RA 3ZR5A 4EN0A 1MACA 2YDEA 3RZLA 1LHUA 1NYWA 4XF9A 1QJY2 5FZ6A 3ZYPA 2OT7A 4LBQB 1WW5A 2HWC3 3D5OA 1MZFA 1MQTB 4WVWA 1OT5A 4MXVA 1BVVA 4V2VA 2VOXA 5GZEA 5A7SA 1J59A 5JMOA 3V56A 3ATGA 2FDHA 1VBD1 5HCBA 1RUH1 3I3BA 4XBLA 1DYOA 4XUOA 4Q4W3 5F2SA 3KGLA 1H30A 3F95A 3LA2A 1HQLA 1AR72 2KR2A 2ILMA 5KHGA 4EQVA 4UWDA 2XXZA 4DUVA 2K2SA 4OQ8A 1GYKA 4Y22B 2WKKA 5JOWA 4GULA 1HXS2 4F7ZA 3WQ0A 1ZRIA 1V9U2 1IS5A 2CAVA 3OY8B 2JD9A 5FP4A 5F5AA 1GFF2 1ULCA 4PQ9A 2P6HA 5FY8A 3WG4A 2WABA 3UL2A 3VBUA 4EN9B 2WS92 5DUXA 4N7IA 4A3ZA 5FOBB 2CGPA 4N8MA 1OF4A 4IEOA 2GC3A 2V72A 3PIGA 4BE3A 2J22A 2DURA 2YYOA 3GZAA 3H8UA 2JG9C 5DDJ2 3QACA 1WCQA 5DUWA 1LOBA 3SKVA 2VZOA 2VY0A 3MZHA 1OD3A 1W9WA 1X8EA 4AI2A 5IVJA 5FY7A 1H1MA 1AXYA 1XYOA 1MR5A 1GZ9A 5L9BA 3FL7A 2XGXA 1K12A 2ZGUA 3H3ZA 5D1IA 4YVWB 3THPA 5EV7A 4AHZA 3S57A 1IG0A 2UY8A 4YZ4A 5LB6A 1DHKB 3VUOA 1W39A 3SC7X 3A21A 2FCTA 3T1LA 1FNYA 1NLRA 3J7NA 1SBFA 4QQLA 1OLQA 1RMU3 2JICA 1W99A 3CKHA 3H1WA 5DAVA 5DG1A 3ZFEA 3WQ1A 4X8NA 3ZFGB 1RXGA 1EUTA 2HKXA 3WP6A 3WDTA 1RUI3 4XTMA 1K42A 3IMNA 2YFUA 2W0XA 1S0DA 1DG6A 4IE7A 1CIYA 1DIWA 1K5MC 4LTAA 1W6OB 3PIJA 3WZ1A 4C1XA 3WNLA 3AVRA 3CL1A 2VMDA 5LA2A 4LE4A 5FMDA 3I8TA 3ZFFC 1D0GA 3MIFA 4AG4A 1VLNA 2Y26A 1CONA 1D0HA 2ZGRA 2DCZA 5AVAA 3W5NA 1O91A 1E5IA 3JD73 2J42A 1URXA 3WNMA 3V0AA 4NPMA 4QGLA 3P1IA 3R0RA 3WNKA 1FPN2 3OGRA 4GMP1 1KEXA 3E5UA 5CVRA 4L11A 4CA9A 2BGCA 5T3NA 2VZVA 1HXS1 3HR9A 2XQRA 4NJ4A 1WD3A 1FV2A 4DXRA 1IQDC 2C6SA 1NCQC 3ILFA 3KF3A 4GB33 2R0FA 1BK1A 3USSA 2PQSA 3FFZA 4ES9A 1UL9A 2Y8KA 4W8JA 5L7OA 3A0NA 2QZ2A 2VMGA 1KS4A 2HWE3 2IFRA 3K75B 2BFUS 2D98A 2WN3A 5EJZB 5FUPA 1Z7S2 4ARXA 3ZXLA 4XDOA 5I8TA 2ZGOA 1TNRA 4YGBA 3CZJA 3WDUA 2AENA 5CFCB 4QHBA 4FPLA 3BU7A 4RQPC 5CA6A 2WFPA 1RITA 1YI7A 4XJAA 5FK8A 1MS5A 3OUIA 5EFUA 2C1FA 5I8SA 5A33A 5LY1A 1NY72 1W6QB 3MICA 4FOQA 2PHTA 5C8WA 4CDQC 3M2MA 3AYCA 4LK7A 3UV9A 1POQA 4LBQA 2LROA 4OULA 4YM3A 5FO8B 4LJHA 3ZVXA 1W8HA 1MQTA 1LOAA 3ZPYA 5F9TA 4LKSA 1LECA 4GKYA 4HBNA 1S0CA 4QWNA 4N90A 1S0GA 1UYZA 4AFMA 3FLPA 2B9UA 1EV11 2ARXA 3A4UA 4X8PA 4MGIE 2YBPA 3WLUA 3LZZA 2HWD3 3G6JB 3J7LA 3OUJA 2ZTNA 3SH4A 3ZN6A 1PO22 2P3KA 4AI9A 3WHUA 1UW8A 1AHSA 4N7UA 1VBC3 4NHLA 1Y9MA 4ARYA 3VBOC 4JHZA 4PLMA 3P6BA 1OVPA 1S0FA 1HRV1 4XVHA 3ZYBA 4Z1VA 2VNGA 1R091 3UJQA 5J96B 2O14A 1RHI2 5E89A 4BK5A 1WW4A 1E5SA 4AW7A 1JOJA 1R082 3ZSMA 5C71A 1QJU3 2X10A 2DDUA 2WDBA 4XAAA 3ZYRA 4HLTA 3KT7A 3EB7A 1QXPA 4BQ2A 2VQ0A 4Y1UA 3GBWA 1SHWB 2BYVE 2WZR3 4GH4B 5DAXA 2ERFA 2RDSA 1PHMA 4ZONA 3VBRB 5FZ0A 3GZUC 4MADA 4R9BA 2B4KA 1OFSA 3D3AA 4AWDA 3ORJA 3LEGA 5F5IA 1I6XA 1KXGA 2UY9A 3P3PA 1L7LA 1US3A 3UGHA 1I5PA 4K8FA 5DG2A 3R4SA 1AR92 4E2QA 5FZKA 3M3EA 3ZFGA 4QU1A 4F83A 1CX1A 1DYKA 2I2SA 2VH9A 3CJIB 1ENSA 1O4ZA 3C7HA 3ZYFA 5CISA 4FPYA 3T0DA 3WP5A 3KF5A 5HCAA 1ZVFA 1QJFA 4LBMA 1GICA 4ITCA 1DQ5A 2JDPA 1YWKA 3Q8AA 5C4WB 3WOGA 2GZWA 5HPOA 3AFKA 4ZU4A 5FZEA 3GDBA 4D6SA 4K7JA 1UMZA 4WZFA 3JQWA 4YPJA 2HYXA 1CZTA 2HWF2 2QQJA 4CDXC 1NXMA 4FAHA 1XJAA 5K0UB 2RS53 1O3TA 4HPKB 1JZ2A 2ADDA 3OCPA 4XYXA 1A78A 1UU6A 4ASLA 1RUJ3 1ND3B 2DWRA 2MNGA 2WLPA 3E5QA 1Y9QA 1PO21 2QQUA 3H0OA 2YV8A 2BNOA 1POV0 3HIFA 4L92A 1RUG3 4YGEA 3ELNA 2OYZA 5FZ4A 4XFAA 5JI7A 2WA3A 1PK6C 4RHV2 4ZU5A 5G04L 4YYOA 5FYYA 2TBVA 2IFWA 5AVPA 1DGWA 4LA3A 3J8F2 2GH2A 2P4EA 3EJKA 1W8TA 3ZIWA 3WG3A 3GF6A 4CP9A 4LLFA 5LK5A 4RGAA 1FT9A 2ZEWA 4Y24A 4CP1A 1ZZ8A 2OA2A 4OHXA 2EICA 4QB1A 2XH6A 2ARBA 2XWJB 1GSLA 1GZWB 1ZZ6A 1H1IA 3K77A 2EVXA 3LB9A 3AYEA 2A70A 4GIQA 3IN9A 3ME2A 3OPTA 3H8RA 2IXHA 2YFZA 4U2AA 3JB4C 4OI4A 1YYNA 3KWVA 1H8TB 4YVSB 3SCHA 4BQXA 1O8SA 2D5FA 4LBQD 4ZHNA 3NO8A 2HH9A 3PVOA 1QQP2 1H2KA 5IVVA 1V6KA 1S2EA 2IXCA 2NLRA 1W2AX 5DUUA 4D6RA 5FR3A 4IERA 4CUCA 4DIQA 1XNAA 1RUF2 4B1MA 3WV6A 3OSDA 3M70A 5BNNC 3QLQA 1CPMA 3DF0A 2A3WA 4JDMA 5EXOA 5C8CB 2RR13 4HKOA 1GP5A 2VW0A 2R042 2Y0OA 3HNMA 4QM8A 5A3OA 4DXTA 1KRIA 3AP4A 3NNJA 1R1A3 4IE0A 1V6JA 4L9BA 4FP3A 3VBSB 2OW4A 4LBJA 1K5JA 3C7GA 3KD4A 2PELA 4IEWA 3RQ0A 5LEJA 3LGRA 1FV3A 4R4ZA 1A3KA 1CZSA 4JV4A 3NMBA 1R1ZA 3IDEA 1YIFA 2D6OX 4GJZA 4YVWC 5A6QA 4FI9A 4LOTA 1TME3 3HQXA 4DNYA 1WW7A 3H42B 1MS3A 3VDDC 3VGIA 1JYVA 3W59A 1HX6A 1QDOA 1H2LA 1BEV1 1S1AA 3SHRA 5KHKA 1CIWA 3JU9A 3JCIA 3WY6A 3B3QE 3ZXDA 4A42A 3N4MA 1UO9A 3K48A 3POYA 4KG0A 4CCJA 1VRBA 5FQ0B 5K8SA 5L19A 4TWTA 4N53B 5FZHA 1YXWA 4H55A 4E8CA 4DB5A 2W92A 4LO6B 4Y26A 3EXUA 5C33A 4GH4A 1UPIA 2OXBA 1RUD1 1T2XA 3LEMA 3L9JT 5F3CA 4S2GA 3OBRA 4BLJA 3VBRA 1NA1B 2EF6A 1YCIA 5HV0A 3ZDSA 3V0BB 2ZEYA 3HBZA 5A1LA 1H2NA 2ZGQA 1QGLA 2A6YA 3IM0A 4AVSA 4NRQA 3IKWA 4EE2A 1JUHA 1MEC1 3HPNA 3LEIA 3MF9A 3OEBA 3OTFA 2XR4A 4FPOB 4IGOA 4XBNA 5ABJC 2DBIA 1SFNA 3PVEA 3OG2A 4M3CE 5FY0A 4PBOA 2W5FA 4GAZA 4I3PA 4MGKE 3L2YA 1W3XA 1AR81 3F2ZA 3I2OA 5ANNA 1W8FA 4QMAA 2HJIA 1U5XA 5EP9A 4CEWA 2WNVC 4HXCA 4RS5C 4L8QA 2B9VA 1PO13 3E1F1 1JMUB 2XPJA 3WP4A 1QU0A 3KM5A 3IB3A 3VD7A 3SCGA 5IK8A 3BTZA 2QQNA 5BY5A 3H8OA 5IWFA 5HXMA 2ZGNA 2ID4A 3NV4A 4JRAA 3KGZA 4NAOA 4YRDA 3CBNA 4XW3A 5JVVA 2X5IC 4CUGA 5J37A 4W50A 3QD6A 2YUEA 4CDWB 1H2MA 3DV8A 5K0UA 1W8OA 3VKMA 1W0PA 4LO5B 2Y38A 3T0BA 4HPKA 1P8JA 5CFCC 1MZEA 2XVLA 4M4PA 4IL7A 1Y9GA 4JX0A 1ND3A 4Y1XA 4UYBA 1ZRDA 1GLHA 1AXZA 5FPXA 2F4PA 1JODA 3O0WA 1F9KA 1TEIA 5I0UA 1Y4WA 4YFZA 4AHWA 2EAKA 3WXPA 3NVCA 2QVSB 4ZZ5A 2IZWA 2VE1A 5JZGC 1BXHA 2CTVA 3ACGA 3BOWA 4QQ2A 3I2GA 1AL21 3DECA 1YRZA 5GLVA 2W91A 4KG8A 1KJRA 3WCSA 3Q8FA 4RGKA 2PHDA 1OA3A 1PGW1 4C0BA 1ZBE3 3I2HA 2PQQA 2VOVA 3LPFA 4Z07A 5IATA 1PX3A 1LODA 2Z5WA 2ZGPA 3CZUA 4URAA 4I3GA 1GZWA 5BNQA 2R6QA 4F8AA 1F8VA 1UX7A 1CAXB 1W8WA 1QNYA 3UGGA 4AI0A 5GZDA 4HT1T 4YVSA 4CP2A 3B5LB 3MFCA 2FZ1A 2VCCA 1CAWB 2TNFA 3BODA 1D4M3 4GWIA 4CDUC 4GQ7A 2VG9A 4CRQA 4ZKTB 5LWBA 1KQRA 1AR61 5LEKA 1QWRA 1UY1A 2FZ2A 4K8RB 2GN3A 4NPLA 1O5LA 5FZLA 4C90A 1QNWA 5AC91 3JBG3 3MO4A 4CCNA 5FZAA 1GQGA 4RGGA 4K9SA 5JSPA 4CCDA 4WVVA 1ZBA2 1PM4A 4IGQA 4Q26A 1KITA 2RDRA 2A1XA 2VNOA 3NNMA 1PIV3 4AEDB 1OOPC 5IFPA 3H8XA 1W6PB 3NNGA 5T5OA 3DPRB 4WVMB 3WR0A 4CCMA 5C3SA 5J36A 3EBRA 3B7MA 5FAXA 1UX6A 1I9RA 3MV11 1FOD2 3BPSA 5FUIA 2W08A 1SLCA 5F3IA 3S5AA 2E7QA 4AI8A 5FPVA 3W21A 1RUE3 4FP2A 1O59A 2OZ6A 3I2JA 2PYTA 4QX7A 2JECA 2VJXA 3BOPA 1F35A 2GH8A 2ZHKA 4BU2A 2Q0AA 4BA6A 1RUNA 2ZMKA 2PHXA 2VAUA 2YPDA 4A7YA 1B35B 3I3DA 4XTPA 5KHIA 1QH7A 3DN7A 4BHPA 5I0SA 4PQQA 2DCTA 3RGBA 5FP7A 1F2NA 4N53A 3UNPA 4QXKA 3CJIC 1RIRA 5L9RA 1C8M1 3WINE 1YFWA 1ZRFA 4CCKA 1N3PA 4KBBA 1WWYA 2XJTA 1S0EA 1ZZBA 1NA1A 2JG8B 2AZ5A 2PLV2 3VBHB 1SBDA 1EPWA 5C4WC 1ASJ1 5JDBA 1MS1A 3T3YA 1RUI2 5JIUA 1UY3A 2JDZA 2VBPA 1PVC1 2SBAA 1FMD2 5FYMA 3RNSA 4D3WA 3B93A 4D69A 2Q1FA 2WZEA 3WG2A 4AFBA 4R9AA 4META 3C7FA 5KBFA 4LBNA 4EN6B 2P2KA 2W87A 4KI5M 3I4IA 3POFA 4KBZA 1BBT3 2HWC1 3CNAA 1XU2A 5K7PA 4TTGA 4QX2A 1GUIA 1X50A 2VZQA 2Y6GA 3GNEA 1VBB2 1S55A 3P3NA 2VD7A 1L7RA 2D3SA 3EHKA 4Q4W1 4QX5A 5FYZA 2TUNA 4I2OA 5F39A 2PTMA 4I0AA 2PMWB 1UMIA 4IE6A 2PAEA 4FAGA 5FZIA 3V65A 3AMNA 2UWAA 4Q4X2 4J1WA 1OUSA 4MYEA 1PZ7A 3WUDA 1QMJA 4AZZA 1UAIA 1PGL1 4XQWA 1O3QA 2RS32 3MPBA 3TWIA 2JENA 3GYDA 1UCXA 4LHNA 3TBDA 5JUVA 1VAKA 4AOCA 3OGJA 1OLMA 4CDWA 3N35A 4MV2A 3BKZA 1F15A 2VNVA 1WD4A 2W95A 5T50A 4EWDA 4LO7A 4JZRA 2QUOA 5FLHA 1BMV2 3O5SA 4U36A 3U14A 4AHXA 4XZUG 2VC9A 4FPJA 1H8TC 2QE3A 1NLSA 4JGYA 1X33A 2IC1A 1SCRA 5DQ0A 1YEWA 2VUCA 2XVKA 1TMF3 2WNUC 3FJSA 4GWMA 2FMYA 1AL23 1F5FA 2K46A 1COV2 1HJFA 4A3XA 4BYYA 5F5QA 4HETA 2VCAA 5C3RA 3MLKA 3RPQA 3BTAA 1X7NA 1C3HA 2GNBA 2ZCWA 3CLPA 5ERLA 3ZXEA 1W6MB 4Q1RA 1DF0A 3KCYA 2VNRA 3GCWA 4I09A 3AZXA 4IV3B 1VBD2 1QEXA 3W58A 1RUH2 2VCBA 3VZJA 2Y6JA 2W94A 3VDAA 4Z8BA 4K6BA 1CAXA 1J83A 1RMU1 3THTA 4CEYA 4DINB 3I3QA 2D3PA 2G9FA 2JDNA 1AR63 3B9IA 3S0MA 1DGRN 3RSJA 2F17A 2WA4A 1CAWA 1LGBA 1X9TA 2WQZC 3ALQA 3FBYA 1LEDA 4HKLA 4XETA 4BXSV 3W5MA 1O3RA 4BQYA 3AL5A 2VZRA 4AQTA 2EALA 1M06G 4LIVA 1HB2A 5FXWA 1MPXA 1NQDA 3N9QA 1VAMA 1XSRA 2RDQA 1H6YA 1ZRCA 2WNOA 1XE0A 1ENXA 4CXXA 2WT2A 1UU4A 1X8MA 1WBLA 2VULA 4O9GA 2A71A 1LULA 3JD71 3N9LA 4M01A 3HMYA 4AEDA 3OYWA 1UXXX 2R32A 4WVMA 1CX4A 4FVVA 4PIXA 4Q0PA 1CJPA 2VZTA 1ND2B 3VBFA 2BNNA 1JZ8A 3TEZA 2JD4A 4XMAA 5JCTA 4XEZA 5IVBA 2AGSA 3T1MA 1QJX3 4XUPA 4K3UA 5CADA 1CQ9A 2XWBB 3AMPA 3PVNA 4GB31 1T6BX 2YROA 4BH9A 2RJLA 2B45X 2Y6LA 5GLWA 3WW1A 5IAXA 5IT6A 1NXD1 3BIWE 3VDBA 2UYAA 2HWE1 2H0VA 4QB6A 2A75A 3FFQA 1B35A 1LCLA 1NX9A 4W6WA 4XF1A 5GALA 1BJQA 4Q8KA 1JHJA 3MHZA 4IV1C 1AX2A 3ZYIB 2DU1A 2L9LA 5APAA 5FY1A 4WZCA 2VQAA 2KD7A 1VBE3 4JCKA 4GD4A 2GSYA 3HT1A 2EXHA 3GJBA 4UFKA 2JG8A 5CIRA 3VZLA 5A33B 3J4UH 3LA3A 2PHFA 4ISRA 2A6ZA 2WWUA 5EYXA 5C7GA 5A3UA 1JN2P 3IIAA 1EPZA 5ISLA 4Q5OA 4YSFA 3ILRA 2RE9A 2J1VA 4EZHA 2RM23 2J1AA 1G6NA 2WBKA 3WNXA 2E32A 3FLRA 4XF0A 4GXLA 2DFCA 1OURA 2BOJA 2J1EA 3N9OA 4A6OA 5D21A 2LTNA 2YBKA 5KXDA 1C5IA 5F1RA 3H1YA 1OLRA 5JPMB 3OGSA 4N43B 1YIPA 2RS11 3KQRA 1S0BA 3CJXA 4QPGB 3VV1A 3GJAA 3PNAA 3U0ZA 5FPUA 1D2QA 5E16A 3ZN6B 4AXOA 4M3CA 2A6WA 4XABA 1GANA 1F4AA 2D3RA 4YM2A 2R30A 2JB4A 1GQHA 2YGLA 2H6CA 2VVDA 1H4GA 2WUHA 1CD3G 2HWD1 3WF1A 1JBCA 4UOJA 4WBBA 5J1XA 5FYCA 1VBC1 2PHUA 3PVBB 2PHLA 2ZMNA 2XBO3 1MZ5A 2F4LA 4HVOA 4KQ7A 5JXJA 5A7WA 2ZX4A 4PI2A 3ETPA 3RZJA 5I8YA 3THDA 3LIGA 4DY5A 2K9ZA 1QJU1 2UWCA 4FFGA 2BFUL 5LK7B 3EQEA 4E2SA 3S7IA 1UYXA 2QDNA 5HV4A 2WQ4A 4HVRA 4X6QB 5JR2A 1YI9A 2WZR1 3M4FA 4XPVA 4BIOA 4QDSA 4E4DX 3KV4A 1S0JA 3B94A 4WM8C 3VZMA 3SMHA 3SNMA 5IFTA 1S4CA 4WM7C 1JU4A 1HN0A 2VUJA 3C8XA 1OQ1A 2Q8DA 5DAWA 1V6LA 4CXWA 2FDGA 2D6PA 2D97A 3DKQA 1W6MA 4LIUA 2B7YA 4OUMA 1V6IA 4AI1A 5C9AA 4IV3A 1N47A 1GV9A 2BW8A 2BP6A 3DPRC 3BALA 1IPJA 4BQ3A 4CU8A 1EV12 1VMFA 1RUC1 2V5DA 4OYUA 1LOCA 4XQDA 2P1BA 3MLJA 3JB8A 1UKRA 3T2OA 2FDKA 2VGDA 3RWKX 3VBOA 3AVSA 3UKVA 3MYXA 1APNA 3K2OA 4YARA 4QM9A 5FRAA 1TE1B 1UYPA 1YQCA 2BWCA 1NE4A 4QGNA 1HRV2 5T5PA 1R092 4PLNA 1SEFA 3H7YA 3HEIA 4UFLA 5D8AB 5ANQA 3AFGA 1SACA 3EYPA 4SLIA 4AHYA 1W90A 4Q4Y3 3MUY1 1HN1A 2CSGA 2RS51 3N7LA 4DFSA 4YZ3A 1JYCA 1ND2A 2ORXA 5L73A 1GU3A 1OBNA 4C0HA 3VBHC 2VU9A 1RUJ1 3WF2A 2R061 1IKQA 4C91A 3RS6A 2DVBA 4LKDA 5FZDA 2GP5A 1RUG1 4QXHA 2D43A 2Q1MA 5C6CA 2DCJA 3AB0A 5H9QA 4CP9B 1LENA 2RMU1 2NZ9A 1YLLA 2ZAAA 3JQXA 1YFXA 3N7KA 4ZY9A 1KDKA 2V4VA 2X29A 3BTYA 4IEQA 3ES1A 1VBA3 4AR2A 1UXZA 1GQPA 5FZ8A 3PUAA 2BWAA 3WP3A 1XSQA 4DRRA 1JOBA 1O4TA 2D6LX 3GM8A 4Y5Z0 5FYBA 4XFHA 4AYUA 4CYDA 5M0TA 1G86A 2JDKA 1AJKA 5KXEA 5GKAC 4YZ1A 2P3YA 4NWVA 1VB4A 2IXIA 3PDQA 1W2TA 1W03A 3M8LA 5F6LB 1O4YA 5E8AA 1GBGA 2RDNA 3APBA 4LUMA 3VBUC 5T52A 1O5UA 1CJDA 3NV3A 5JAXA 3TOJA 1W8NA 4Z82A 1E57A 1AF9A 4COZA 1SFYA 2RS13 4IEPA 4JDOA 1DGWX 4FOWA 4R4XA 1N1VA 1Q5OA 2VMFA 3I49A 4N43A 5GLUA 3BU0A 3H3UA 2RR11 4UF0A 4QPGA 1Q56A 1Q8PA 4Q4V3 3ZXGA 2GNMA 1HV1A 3OBAA 4XCBA 1DLLA 1R1A1 4NPRA 1AJOA 1LB2A 3ZXFA 3MPPG 4Q8LA 2DF7A 2VZPA 2CDOA 1HDKA 4I0WB 5KXBA 4E4SA 1HRI3 2R071 2WYSA 4PT6A 1CAUA 1RTVA 2C4XA 4GJYA 1GWMA 4JKMA 3E6BA 1LGCA 3NAPB 4RYDA 3VD4A 2NQYA 3I54A 3WNPA 3JUUA 4ONUA 2XQXA 3FUOA 5C5TA 1TME1 3CMGA 3U10A 1MS4A 5H9SA 3VHNA 3BB6A 3M3CA 4PDWB 3Q8CA 1E5RA 5IAVA 3ZMNA 5ACA3 3WEZA 3ZFEC 1W06A 3LF7A 4FPCA 4XFGA 4UI9L 3KS7A 1XBFA 3AZVA 1AYM1 4Y20A 5BNOA 4MG2A 3WG1A 5DABA 3N9NA 4QPIB 4O9EA 1NCRA 3AC0A 1JU3A 1W3VA 3WCRA 3ZYGA 1LHOA 4A7KA 4IEUA 4UXAA 1V70A 2E9QA 4AFDA 1YFYA 4COVA 2EXKA 4D7TA 1LJ7A 3DYPA 2UURA 4KGGA 4DPNA 1JZ6A 2P37A 3WW4A 2X05A 4LMFA 2XHNA 3ZPOA 1W0NA 1W2OA 3ILNA 1BQPA 4MGZE 4GA9A 3AKPA 3AP9A 5E6HA 1B09A 5L36A 1RUC3 1XNCA 3FHAA 4YG0A 2ZGLA 3AZZA 5CNAA 4CEWB 3B02A 1JZ7A 1RUOA 1AYN3 3A23A 3LE0A 5GM0A 5BNPB 2GC0A 3LIHA 5JLVA 5A6XA 4CE8A 2MEV3 1WZXA 2ES3A 1PO11 2E6VA 3T2PA 3K4ZA 3X29B 2ZGKA 5L7OC 1MS0A 4TYSA 5DZFA 1ZZ9A 5JOYA 2HWB1 5FLIA 5FZOA 4S2HA 1G9CA 1PMJX 2OPWA 1SLBA 5FY4A 4DRVA 4TN7A 1UF2C 5JOXA 1BCXA 1RL3A 2VOKA 5D8AA 1SLLA 3POGA 1X36A 2DBNA 1BEV2 1QOTA 1WLDA 4JKKA 1GWKA 1GZCA 1QJY3 4Q0SA 5FBZA 4Q29A 5FY5A 4OLLA 1ODMA 4BM8A 1A34A 2IXLA 2R063 1EAH1 2HYKA 4FPEA 1Q8QA 5EQUA 4B7EA 5K9YA 3ITQA 4JDNA 1RUD2 2A3YA 2XL9A 4IE5A 2QQKA 3IIIA 4YW1A 1AR73 5KHHA 2RMU3 2Q8EA 3D0SA 3OOXA 3ZKUA 5IK5A 5LRSA 2EXJA 1UOFA 1MQTC 2XMLA 3AMQA 1GKBA 3IAQA 4JVAA 3UETA 4CU7A 5BV6A 5L9VA 1JHNA 4Z2WA 4P5HA 3BTXA 1LOFA 1EY2A 4P00B 4M0NA 1MEC2 1UIKA 4X6RB 1SZBA 3AKSA 1HB1A 5CB7A 4QX3A 2ZZJA 4AEKA 4LQRA 5FYUA 1A6CA 1V9U3 1S2KA 1IG3A 2HBTA 1PZ8A 1LKNA 4Q0UA 1AR82 1VJ2A 1PMIA 3PU8A 4DZGA 1ZBE1 2ZPXA 4AVVA 3VHPA 3AXEA 1OHFA 4MSVA 4AFCA 1U12A 2WS93 2XLGA 3MW2A 4BMEA 1WMFA 2WSVA 1VMHA 4M0HA 4XCAA 5IW0A 4CZSA 3HN3A 3TNPB 3VZKA 5DDJ3 5AFEA 1FAYA 2RJKA 2TEPA 4FSJA 1BVP1 5FYIA 2GAUA 2VR4A 2WO1A 2Y34A 1D4M1 2Z4FA 4V1PA 1LHNA 5E88A 2CV6A 1G8WA 2BQPA 2LM3A 2WYFA 5BPXA 4MGYE 3VKLA 1DYPA 3HBKA 2Q8OA 5FMOS 2WO3A 3QCWA 1YO8A 4EJRA 3JBG1 4XFFA 3OF1A 5J98B 5FPBA 3HQUA 3AKTA 4AAXA 2RV9A 2WLQA 1O3SA 4XF4A 4D7YA 3QH6A 3LQCA 1N1SA 3UESA 2R073 1J1LA 1PIV1 1UQXA 2VO5A 1JZ5A 4W65A 2Y6FA 4LULA 4D8MA 3O1SA 4YW2A 5HCHA 3IDCB 2OUJA 1OI6A 2JX9A 2FDFA 4P02B 5DUVA 2P3IA 3RDIA 3RYKA 4EWEA 2W9XA 5CKQA 1W9TA 4MH0E 3NAPA 4QPYA 4A4AA 1RUE1 1WMDA 4DOUA 5JSOA 4FTEA 2DCYA 3KHBA 4DUXA 1HKDA 1AL22 3HJRA 5HBAA 4O61A 1JYIA 4YW3A 3POBA 3M3QA 5FOJB 4PDWA 1AYM3 4UAPA 4NR1A 3VLBB 4AVTA 5FDBA 1WCSA 3ZFGC 3WVJA 1PGW2 1ZREA 2ET1A 2VZ1A 2O8OA 2D6NA 2VUAA 4MGQA 3MV01 5A7OA 3ZN4A 5A7NA 5BYNA 4QPIA 3UKTA 3JXSA 1DQ1A 1WMEA 2ZKNA 4LBLA 3KLSA 4KU8A 4BWOA 1J3QA 2C26A 4GWNA 3AKQA 2WT0A 3P5BA 4OVEA 1ZA4A 3T0AA 5FCCA 1OVSA 2R16A 3KV9A 4NIHA 4UFHA 1AR62 1UIJA 5T54A 3FC0A 3TNQA 3FMGA 3S6PA 3U37A 4JTNA 4CCOA 3HOBA 4PF5A 5AC92 1XYNA 1CVNA 2GP3A 1Q8VA 1RVF1 5FZMA 2VVEA 3ON7A 3POEA 2DTWA 1KFXL 1LU1A 2ZKLA 1BBT1 1HQNA 2VMEA 1JXNA 3FBMA 4CUBA 2IWGB 1RGSA 3RZMA 1CZVA 2QFEA 5BNPA 5C9AB 1Z7S3 4KNCA 3K51A 3VDCA 4JAAA 2HWB3 1JZ3A 2ZZQA 3TEWA 4B8EA 4OI0A 1RJ8A 4IEZA 4NO4A 1WKYA 2ET7A 5LA0A 3M3OA 3FUQA 2C24A 1X9PA 2VXRA 3RZHA 3RI8A 4AE2A 2W2IA 4P9IA 1PNFA 5FZ1A 1WA4A 4CP0A 3FN9A 4AVAA 4QKNA 3ST7A 1EAH3 1ZM1A 3LA7A 2QQIA 1MVQA 5KC5A 1K3IA 1ZX5A 3GHNA 4COWA 4HL0A 4R52A 1Q3EA 5CFDB 4IEXA 1S2BA 5CEHA 3A0KA 2A6XA 4JGYB 5FUNA 1DP0A 5FY9A 1SDDB 1C8M2 3K4AA 5I0DA 2XJUA 1QY4A 4A41A 1H9WA 1RB8G 4AQ2A 2VOTA 4UBGA 4HG6B 2NMNA 3TEXA 1A8MA 1TMF1 1ASJ2 2JDAA 3RFRA 4XFIA 3ZSLA 5JMCA 1IS6A 1PVC2 1XNDA 3K4DA 4DUWA 4FFHA 4AQ6A 3WX5A 1LHVA 3OPWA 4I01A 3OEAA 3BYWA 2YU2A 2YMZA 4LK6A 4FQZA 4CCLA 1JYTA 1XB9A 2HWC2 5H9RA 4XXAA 3ZM8A 4XURA 3O0XA 2B5HA 3PUSA 2PHRA 2AYHA 2W1UA 2VZ3A 4CEYB 5LBBA 2ZMLA 3S7EA 2JE9A 2ZHLA 4RR3A 4OI1A 1O8PA 3NJVA 4AK3A 1SMVA 2YC0A 4DO0A 4Q4W2 1WLTA 1R083 3RZGA 4Y5TA 3PL0A 1ACCA 5A1FA 2ZHNA 3MIBA 3SQOA 4TXWA 4M3CF 4BMBA 1G9BA 2JKBA 1PGL2 2VZSA 1XRUA 3VZNA 4TLGA 2WINB 4ZU7A 2YPJA 5JXGA 2I45A 1HW5A 1UOBA 1QH6A 4EN8B 2IVJA 2EIBA 1LR5A 3KVBA 4YM1A 3OYWB 3AZWA 4GH4C 1J3RA 5CAZA 5FTTC 2XKPA 3VBFB 1V6OA 4XBQA 1MZ6A 3VBRC 2JE7A 3NV1A 3A22A 4AVBA 1AR93 2W47A 4LBKA 3PU3A 3PUQA 4LKEA 4UFMA 4YWAA 2WN2A 2CYFA 3PMSA 5B4XA 2Q5TA 1QJX1 4OHZA 1DQ0A 4XJZA 2XG3A 3VHOA 3WW3A 4KWJA 3GCXA 5F3EA 5FZBA 4BQ4A 3WDWA 4BQ5A 1PNGA 4LXLA 3WF3A 4A7ZA 4FOYA 3PTYA 4CEWC 2WQ8A 1DZRA 4L2NA 2A6VA 3N7MA 3PUIA 2PHWA 2QQWA 2ZJCA 3LOIA 4QDRA 2DVAA 5JI9A 2HWF3 3VD3A 2Y6KA 1RMU2 2A73B 1RINA 5FLJA 2X09A 4XXPA 2JIJA 1JTZX 4HKWA 2Q30A 4QPWA 1WCDJ 2ATFA 1VBE1 3RJRA 2Q1ZB 5LA9A 1IOAA 1RC6A 3T4HB 2VL4A 5K4LA 4ZS2A 2E53A 4Z92B 1RVF3 2ZX1A 4GZ9A 4NRMA 2YC4A 5G05L 3D4KA 4HFSA 3URFA 4CCEA 4E2GA 5K0UC 4FFIA 2JDMA 2RM21 1XYPA 4LR4A 1EUUA 3THCA 2QQVA 4JGZA 4RHV3 1DLCA 1EYBA 4AGVA 2W1SA 1UZYA 1YHFA 1ND3C 4QQHA 3MIHA 4WV8A 2XOMA 3WD5A 4DEQA 1JYXA 3J8F3 1VMJA 2UYBA 4MO3M 2JB8A 2MPFA 3JD72 3MDPA 2PAKA 4PHZA 4YW4A 2BVBA 4M3CB 4Q1PA 2WRAA 3SEEA 3ZOIA 1AX0A 4E4HA 5C3QA 1JW6A 4R8HA 5FMBA 3LDRA 5FP8A 4NIAA 3B69A 4Y4RA 3OB8A 4TLFA 4YM0A 3ACHA 4B4PA 5C5UA 4Q27A 2DVDA 1UYYA 2DUPA 2QTWB 4GB32 2X8KA 4LE3A 4YFWA 3GBFA 5A7WB 4LA2A 1YJKA 3T30A 4P9GA 1G9FA 2D7FA 5JXIA 4H7MA 2HWE2 2XBO1 2W68A 4FPGA 4NOTA 1NT0A 1ZRRA 5DPNA 5B4NA 4PJYA 1N3OA 1RUF3 3O0VA 5CFDA 4NAMA 1FXZA 4YVSC 4BB3A 3EMRA 2VBDA 4XILA 4RN5A 3WNOA 4IQPA 5FXVA 3WW2A 5C3PA 2D44A 2E31A 1OQDA 5JXHA 4UFIA 1ZZ7A 1U5YA 2R043 3EO6A 3ZIXA 4ORFA 4BPZA 1IZ3A 3BCWA 1YC61 3RMXA 3UYJA 3ZYHA 3LD8A 4C1WA 4CXYA 5C8CC 5FWEA 3I59B 2ZEZA 1UZVA 3TAYA 1K45A 4OI2A 5LATA 4CUAA 4J1XA 3RYPA 3CDZB 1Q8SA 2AR6A 3VBSC 4UFJA 1OSGA 2JEMA 4NE9A 2HLEA 2QNKA 4P9XA 3G7DA 5HCFA 4ATEA 3AXDA 4ZPIA 2XJSA 2RS12 2E7TA 4HANA 4AL9A 5CG9A 2ZHMA 3FWEA 4YW6A 2DUOA 2FDIA 1CN1A 1REEA 5FMCA 1QOOA 4K1ZA 1W8ZA 4HK9A 4XQ4A 4NMIA 3VBOB 2Z42A 4Y33A 5FP3A 4MHRA 4W6YA 4Z2AA 4AF9A 5CKMA 3O12A 4B29A 2HWD2 2J1RA 4HMZA 3ETQA 3WSOA 3KV5A 2EAAA 4P9WA 4A45A 4OHYA 4BCUA 5J3UA 1JS9A 3BIEA 1VBC2 1XQNA 2JWPA 2E26A 4COUA 2JG9A 4H7LA 1VR3A 3R05A 4QGMA 5GZFA 4N53C 1ULFA 4LLOA 5FBJA 1NZCA 2DUQA 1AX1A 5BUVA 3IAPA 5A32B 1AZDA 1SDWA 5A80A 4URTA 5LCWL 2ZGSA 4Q4Y1 1KFUL 3H50A 3ZX7A 1QJU2 1D2SA 1NA1C 4QU2A 2R7EB 1LGNA 5TSWA 4HSJA 4PIYA 4AGGA 2JDUA 1BLZA 2VOWA 2AC1A 1HQWA 3QBQA 3FE5A 2WZR2 3E5XA 4IGPA 1S0IA 4FPKA 1QDCA 1SLTA 4MGTA 1UN1A 3D6EA 1GNZA 3AX4A 5HXVA 1ULDA 4HVQA 3U78A 1CR7A 1GNHA 2WO7A 5A3WA 2AEZA 5JPNB 5FPAA 3ZLIA 3KSCA 2QQPA 2KXLA 4V2WA 2CGOA 1C1LA 2QJVA 4OMCA 3DUIA 4AEMA 4E27A 5H9PA 1DCSA 4IETA 1NG0A 2OUHA 1K5MA 3LDKA 1RUC2 1VBA1 5I91A 4RFT0 2XB6C 4E4ZA 1DZQA 4KMQA 2BOIA 4Q0QA 5FJHA 3KCCA 3ZFFA 3ZSJA 3CIHA 4LO8A 4CDXB 2VMIA 5D2AA 2Y60A 5T5LA 4CDWC 1IQAA 2WO2A 3I3MA 3RRDA 4DY3A 4QT6A 4QB2A 4XZPA 3NNFA 4LHLA 5FYVA 3ZSEA 4YNIA 3BI3A 5FKBA 5JOZA 2I07B 1LNSA 3Q8EA 4XMIA 1DQ6A 4ISQA 3L2HA 2OX0A 4UF0B 4DS0A 1DGRA 4JGYC 5SV5A 1D4VB 1VE0A 3MIGA 1H8VA 1TZOA 4RA0A 2RS52 1VP6A 2AUYA 4G9SB 5EYYA 1NCQA 2C9KA 1PK6B 4TSVA 2D6MA 2VMHA 4FCAA 1XPWA 4Q4V1 2WR9A 1RUJ2 4CTEA 2CL2A 1CAUB 2R062 1Y7BA 4IW3A 2WFF1 4K20A 3RWNA 1GWLA 2J1UA 4OZOA 4Q0VA 5DZGA 4COYA 3TYJA 1RUG2 1HRI1 3TB0A 1W6NB 1PGSA 2D5HA 1D7PM 4NIIA 4E8DA 2OZJA 2GMPA 2YBSA 2JKXA 2RMU2 1XNKA 1X82A 4LORA 3VD5A 3UKNA 4RQPA 4BIFA 3NQHA 4CEYC 4FBFA 5IK7A 5ACA1 3DEMA 2OQ7A 3HNYM 4Y20B 1V0AA 5BNOB 2VW2A 1NCRB 3WQBA 3Q9OA 2AREA 4YLZA 4HZFA 2Z79A 4FQ4A 1VPHA 5IVEA 1ZBA3 2QBXA 2Y0IA 3SXWA 4XJ8A 4CDQA 3WNNA 4XUNA 1SBEA 2G4IA 2G9GA 1C4RA 3PMEA 4P14A 3LWCA 3GXUA 2V4AA 3IT8A 1VB2A 3SH5A 5KWRA 2GC2A 3MIDA 5A6YA 2ZGTA 1H4HA 1BHGA 4M00A 4C8DA 5BNNB 3I59A 1FOD3 4ZXKA 4BQ1A 3H1MA 1LESA 4YW7A 4YZ2A 1SPPB 2BZDA 3FX3A 3MGUA 4AEDC 2W1WA 3BUCA 5I0TA 4NIDA 3M7AA 2BTVC 4Y1ZA 5GZCA 2PAMA 3PJYA 2XKOA 3VBFC 1DDLA 1UKGA 2IVIB 2RR12 3CO2A 5FYSA 1WUVA 3TN91 5CZKA 1HIXA 2DV9A 4ES8A 5FYHA 4FOVA 2Q4SA 1IKPA 2QKDA 2XJQA 4QX8A 4BQWA 5A3NA 1AYN1 1R1A2 4UW3A 2XHKA 3OBTA 1GP6A 3VDDB 2GMMA 5FK7A 5I93A 2MEV1 2R072 4YW5A 1I1EA 5FZOB 5CKNA 1F5JA 1YQ2A 4CSWA 5IHRA 2Z2SB 1B35C 3I2FA 2PLV3 1TME2 3J9SA 1G9AA 3IDBB 2ZBJA 3K3NA 3B00A 4AVCA 4B3NA 3LSEA 3AYDA 2NM1A 2W39A 1FMD3 3ZKYA 5A32A 2V73A 3SITA 5F32A 1FI2A 5T55A 3OGVA 3KHCA 2ZX2A 1QJY1 2ZGMA 1AYM2 2JG8C 4AI3A 2GMEA 2FMDA 4RL7A 4W4ZA 1ZZCA 1OD5A 3IMMA 1ZYBA 2KA3A 5A3PA 5A1AA 1VBB3 1RJ7A 2G1MA 3KQ4B 2IXJA 2BBAA 1ULEA 2BU9A 5A7QA 4BZ4A 4XFBA 2CAUA 5ABJB 1PMHX 2PN5A 4CU6A 3HN1A 1AR71 4UW5A 4P08A 2CHHA 4XJ9A 4I0BA 4EYUA 3OD4A 2E33A 4Q4X3 5FP9A 1DBNA 2WNVB 1Y43B 3AP6A 4NVPA 4LNVA 4RS5B 3T2QA 4YZ5A 5GZGA 2VTXJ 4MUVA 2RS33 3I2IA 1DU3D 1ST8A 5F7UA 3HQRA 1V9U1 2W46A 2P5BA 3IPVB 1CGPA 2CDPA 2XDVA 1VRH3 3LCPA 4RFRB 2NN8A 2LS6A 2RJ2A 1DQ2A 3N3HA 4QHOA 4O7XA 1FX5A 2WS91 2ETEA 1DZTA 4HN1A 4NHKA 2FBEA 5EJ3A 1ZA7A 1GNYA 5FFOC 1PO12 5KXCA 4L0PA 2X5IB 5IVFA 3RZKA 4OHVA 4CDXA 1N1TA 5KR7A 5DDJ1 3WDYA 2HWB2 3NKGA 2H0BA 3D82A 3H3LA
chains in the Genus database with same CATH topology
1CPNA 3WUCA 2NP0A 1YJLA 3GALA 1COV3 4YGCA 3IBMA 3AP7A 4QD2A 5LRRA 4GALA 2WFF3 1EAH2 1PK6A 2MHFA 1QXRA 5F6KA 5B2GB 1VBD3 1RUH3 4LO4B 5JZGB 1UPSA 2BPA2 4P9YA 4MX3A 1W6NA 3PLQA 3RYRA 2SLIA 5C9AC 1DGLA 4IV3C 4LT5A 1Y3TA 4Y22A 1HLCA 2YHJA 4XIKA 3ZO0B 4DMIA 1ZBE2 1ZNPA 1IS4A 5JSRA 4CDUB 1JUIA 3OY8A 2ZABA 2WNEA 3ZXJA 2OPKA 3ASIA 4Q2FA 3VL9A 2XLAA 1MS8A 1FPN1 4YG3A 4FXKB 5BNNA 3KZ4C 4IESA 2XL7A 5CBLA 1D4M2 1CESA 4B4RA 2E7AA 2DVFA 2W52A 4E9KA 1IGOA 1QXJA 4OFGA 4K21A 1OOPB 3TN93 1VAVA 4K40A 3M3IA 3JBG2 3I7DA 1ND2C 4L97A 4MVTA 3ZYJB 3KT1A 5FMOL 1LEMA 2C0ZA 2ZS6B 4D7SA 1PIV2 4YVWA 1C1FA 1Z7S1 2ENRA 1Z0HA 2P3JA 4HN0A 5IUQA 3VDDA 3AJYA 1AL0G 1ENRA 3MF6A 1BZWA 1I3HA 1OA4A 2B8MA 4EWAA 1RUE2 2A7AA 1AVBA 1J58A 3ZN5A 2QZ3A 3C2UA 3H7JA 3T2TA 3QH7A 1OMIA 3VKOA 3KCXA 4AQSA 4NHMA 1NY71 2JXAA 4KL1A 2XLFA 1NOVA 1W6OA 3KB5A 4LEJA 4MLOA 1VIWB 2CY6A 1Q8OA 4UW4A 1YNAA 2GNTA 4GMP3 2ZACA 5ABJA 1G7YA 4RD7A 3PHMA 2HEYF 1HXS3 4XHBA 4DQAA 1C8NA 2E51A 3R4UA 1T6GC 4N43C 2WNVA 1C28A 4QPGC 4IXLA 4RS5A 1RVF2 3NWKA 3OGGA 2ZX3A 3GBGA 2B46X 1BBT2 2WC2A 3IPVA 4RR3B 4MXWB 1WW6A 4XJUA 3VKFC 2FHRA 4LHKA 1RHI1 1R081 4AEJA 1V6MA 2CGNA 3B9CA 2X5IA 2BUKA 2LALA 4KWKA 2D93A 3PJQA 2PFWA 1ULGA 1XE7A 4F3JA 2GC1A 4TZDA 1OPMA 3V64A 2O8QA 4NN0A 5CFCA 5JIAA 2YY1A 3E6CC 1J3PA 5BNOC 3S30A 2WSUA 2R1DA 4INDA 1NCRC 3H9AA 1LU2A 1HV0A 5IK4A 2WZPP 5FO9B 3AZYA 4DXZA 1W6QA 1OPOA 2WNUB 3MLLA 4HK8A 3CF6E 3NSTA 4HSLA 3FLTA 1LOGA 5JZGA 3C3VA 2HEVF 3MFAA 1C57A 1AR91 1N1YA 1EV13 2XJVA 1QJZA 1QHDA 1TMF2 2BVVA 2F6BA 2GU9A 2XUMA 1PVXA 2WIIB 3POSA 4FTSA 1FNZA 3WHTA 5FO7B 1HRV3 1R093 1AUYA 3R6SA 4CDUA 2GNDA 2HWF1 1FPN3 4H14A 4L99A 3HWJA 1KS5A 2O0OA 3IWZA 1MS9A 3KT4A 3WDVA 1H9PA 2NYYA 3ENRA 1LHWA 5D8AC 2YZ4A 1XE8A 4AGRA 3UJOA 1PZ9A 2ZA9A 4K1YA 2X53S 4P9LA 3AKRA 4JGZB 3GHMA 3FZ3A 2P34A 3R4DB 4I30A 3ZMOA 1UD1A 1OOPA 1OA2A 5GLTA 1IHMA 3FHIB 4RHV1 4SBVA 4OUSA 2OVUA 1XXNA 5J09A 2CWSA 3J8F1 3ZXKA 1KD7A 2C9AA 3ACLA 4D94A 1WLWA 4GKXA 2B42B 4S2FA 1LOFC 1MVEA 4FPFA 1QJX2 4JC1A 4YGDA 2PA7A 4ASMB 2VPVA 1V00A 3RG0A 3NKTA 4IV1B 4PBPA 4LUKA 1IPKA 1QQP1 3CJIA 1YFUA 2FQPA 1EP0A 3NL1A 3SLIA 2DYCA 1WBFA 3CEWA 3ROUA 1RUF1 5C4WA 1U5ZA 4OZXA 2XJPA 3MI8A 1VBE2 3J26N 2QCSB 1JH5A 1ALYA 2I74A 2R041 4R9CA 2AH2A 4XHXA 1PO23 3MW4A 1W2UA 2O1QA 1M4WA 3RJ2X 2RM22 4EV0A 4PLOA 1NQJA 3INAA 3WT3A 5J48A 1RHI3 4MXWA 1H0BA 3AMMA 4JRLA 1U0AA 1LOEA 1PM7A 5KC6A 5EZWA 5A3LA 2LUWA 2WJSA 3NAPC 3MEPA 2NMOA 3QOPA 3N7JA 3USUB 1NE6A 1CAVB 1Q43A 4WVZA 1OFNA 1TQ5A 4FTBA 2WWSA 4P9JA 1L3JA 1U5IA 4FXGB 5T5JA 4PDWC 4AFAA 1H1AA 4H3WA 2GN7A 2JG9B 1TNFA 3ZXAC 3N36A 5J7MA 2A3XA 2UU8A 1QOSA 3NW4A 2BEOA 4QPIC 1H8TA 2XBO2 3LKJA 1REDA 4KWLA 1IS3A 4NWWA 1DFQA 4YG6A 4MZUA 3D8CA 2WNUA 4JTOA 5BXXA 3LSDA 5SV8A 3BPZA 4KH9A 3OD0A 4WM8B 2OIIA 3HT2A 3SISA 2E63A 5C8CA 4Y4YA 4WM7B 3AP5A 4EN7B 5I0RA 1I5ZA 2CWMA 4UBHA 4IEVA 4LBOA 2JJ6A 1SLIA 2WL1A 2D6KA 3KMHA 3VBSA 2D40A 2K0GA 2HEWF 5BNPC 3NJZA 4FPHA 3AK0A 5A3MA 3HD8B 4S2DA 1K5MB 3AM2A 2A5ZA 3LAGA 4BLIA 1BEV3 1SLAA 1BKZA 5JWPA 4OHWA 3U07A 3VHRA 1SQ4A 2R0HA 3VL8A 3E6DA 3SH3A 3ZFFB 2IXKA 2P17A 2B39A 2GDFA 4Y1YA 1F31A 2VVFA 2ZAHA 3HAGA 3O7OA 2GALA 3DGTA 1RUD3 2EXIA 5FQ0A 4EROA 3WDXA 1N3QA 5AFBA 5GJ6A 1POV1 1MEC3 3V0BA 1NCQB 2DCKA 4Q4Y2 2DFBA 3GZTB 3M1HA 3POWA 3D0JA 2BBVA 1WGPA 1UU5A 5DXDA 1AR83 3NV2A 1VALA 5GLZA 4ATFA 3VN4A 3E97A 4GMP0 3MW3A 2VECA 1C5HA 1QQP3 3DKWA 2EA7A 1BYHA 4FO9A 4IV1A 4FT8A 4N9IA 4RQPB 5HI0A 1GR3A 4RR3C 1WCKA 3RI9A 4XIOA 1W0OA 1Z78A 2VW1A 3I2DA 4BOWA 4CDQB 2Z69A 1WLCA 1VBA2 4XJWA 3VBUB 1ENQA 1ZBA1 1QKQA 1SCSA 1FYUA 1VRH2 1OQEA 3RMYA 4UW6A 3RZZA 2DTYA 3DL3A 3AYAA 2YXSA 3CU7A 1REFA 1FOD1 4PCRA 4XFCA 2WT1A 3LOBA 1G9DA 2ZX0A 3OPZA 4QQPA 4XDQA 2C5DA 1KJLA 3VZOA 2H6BA 5CG8A 3USUA 4Q4V2 1OKQA 3U4XA 1CAVA 1LRHA 1XNBA 2WFF2 4IEYA 1DQ4A 4KU7A 1HRI2 4G3YC 2RHPA 2ZOEB 3ZFEB 2R1BA 2EIGA 1FATA 2BNMA 2PLV1 3VKNA 4B7KA 1RUI1 5ACA2 2DU0A 5AC93 1FMD1 3AMHA 1UZZA 2YGMA 4I02A 4JQRA 4WM8A 2KM2A 3TRSB 3WQ7A 1V6NA 4B4QA 4KGQA 4WM7A 3MIEA 5FREA 4N9HA 2XVGA 3V0AB 1VBB1 2N7GA 4JGZC 3ECQA 5EWSA 1YUDA 1W6PA 3DPRA 5FPZA 2NPIA 1LTEA 3SCFA 1J1TA 3ES4A 4Q4X1 4PIZA 4XOGA 4XF3A 2UWBA 1O7FA 3UK9A 3B01A 1QF3A 2RS31 1A8DA 2R49A 2DVGA 2V09A 4XE9A 5L7OB 3TN92 4QQOA 4R9DA 1VRH1 1AXKA 1AYN2 4W6XA 1ONAA 3JZVA 3ZSKA 1BMV1 2MEV2 4A2UA 1KDMA 3W9AA 1C8M3 4J6GA 3OJBA 4G4FA 2XJRA 4Y1VA 2CNAA 1POV3 5DZEA 3AJZA 5KHJA 1ASJ3 5CFDC 1COV1 2QDRA 3O14A 3U11A 1PVC3 1XU1A 4RSUA 5CU1A 3VBHA 2V5YA 5E1RA 4EN0A 1MACA 2YDEA 1LHUA 1NYWA 4XF9A 1QJY2 3ZYPA 4LBQB 1WW5A 2HWC3 3D5OA 1MZFA 1MQTB 4WVWA 4MXVA 1BVVA 2VOXA 5GZEA 1J59A 3V56A 3ATGA 1VBD1 5HCBA 1RUH1 4XBLA 4Q4W3 3KGLA 1H30A 3LA2A 1HQLA 1AR72 2ILMA 5KHGA 2K2SA 1GYKA 4Y22B 2WKKA 5JOWA 4GULA 1HXS2 4F7ZA 3WQ0A 1V9U2 1IS5A 2CAVA 3OY8B 1GFF2 1ULCA 4PQ9A 3WG4A 3UL2A 3VBUA 4EN9B 5FOBB 2WS92 5DUXA 4N7IA 2CGPA 4IEOA 2GC3A 4BE3A 2DURA 2YYOA 3GZAA 3H8UA 2JG9C 5DDJ2 3QACA 5DUWA 1LOBA 2VY0A 3MZHA 1X8EA 4AI2A 1H1MA 1AXYA 1XYOA 1MR5A 1GZ9A 2XGXA 2ZGUA 5D1IA 3H3ZA 4YVWB 4AHZA 3THPA 5EV7A 2UY8A 4YZ4A 1DHKB 3VUOA 1W39A 3T1LA 1FNYA 1NLRA 4QQLA 1SBFA 1OLQA 1RMU3 2JICA 3H1WA 5DG1A 3ZFEA 3WQ1A 4X8NA 3ZFGB 2HKXA 3WP6A 3WDTA 1RUI3 4XTMA 3IMNA 2W0XA 1S0DA 1DG6A 1DIWA 1K5MC 4LTAA 1W6OB 3WZ1A 4C1XA 3CL1A 4LE4A 3I8TA 3ZFFC 1D0GA 3MIFA 4AG4A 1VLNA 2Y26A 1CONA 1D0HA 2ZGRA 2DCZA 5AVAA 1O91A 3JD73 1URXA 3V0AA 4QGLA 3R0RA 1FPN2 4GMP1 3E5UA 5CVRA 4L11A 2BGCA 5T3NA 1HXS1 3HR9A 1WD3A 1FV2A 1NCQC 3ILFA 4GB33 2R0FA 1BK1A 3USSA 3FFZA 4ES9A 1UL9A 5L7OA 3A0NA 2QZ2A 2VMGA 1KS4A 2HWE3 2IFRA 2BFUS 2D98A 1Z7S2 3ZXLA 5I8TA 2ZGOA 1TNRA 4YGBA 3WDUA 2AENA 5CFCB 4QHBA 4FPLA 3BU7A 4RQPC 5CA6A 2WFPA 1RITA 1YI7A 4XJAA 1MS5A 5EFUA 2C1FA 5I8SA 5A33A 1NY72 1W6QB 3MICA 4FOQA 2PHTA 5C8WA 4CDQC 3M2MA 3AYCA 3UV9A 4LBQA 4OULA 4YM3A 5FO8B 3ZVXA 1MQTA 1LOAA 3ZPYA 5F9TA 1LECA 4GKYA 4HBNA 1S0CA 4N90A 1S0GA 4AFMA 3FLPA 2B9UA 1EV11 2ARXA 3A4UA 4X8PA 4MGIE 3WLUA 3LZZA 2HWD3 3G6JB 3SH4A 3ZN6A 2ZTNA 1PO22 2P3KA 3WHUA 1UW8A 1AHSA 4N7UA 1VBC3 4NHLA 3VBOC 4PLMA 4Z1VA 1S0FA 1HRV1 2VNGA 1R091 3UJQA 5J96B 1RHI2 5E89A 1WW4A 4AW7A 1JOJA 1R082 3ZSMA 1QJU3 3ZYRA 4HLTA 3KT7A 1QXPA 2VQ0A 4Y1UA 3GBWA 2BYVE 2WZR3 4GH4B 2ERFA 1PHMA 3VBRB 3GZUC 4R9BA 1OFSA 4AWDA 1I6XA 1KXGA 2UY9A 3P3PA 4K8FA 5DG2A 3R4SA 1AR92 4E2QA 3M3EA 3ZFGA 4F83A 1DYKA 2I2SA 2VH9A 3CJIB 1ENSA 1O4ZA 4FPYA 3WP5A 5HCAA 1ZVFA 4LBMA 1GICA 4ITCA 1DQ5A 1YWKA 5C4WB 3WOGA 2GZWA 3AFKA 4ZU4A 4K7JA 1UMZA 4WZFA 3JQWA 4CDXC 2HWF2 1NXMA 4FAHA 5K0UB 2RS53 1O3TA 4HPKB 3OCPA 4XYXA 1A78A 1UU6A 4ASLA 1RUJ3 1ND3B 2DWRA 2MNGA 2WLPA 3E5QA 1Y9QA 1PO21 3H0OA 2YV8A 2BNOA 1POV0 3HIFA 4L92A 1RUG3 4YGEA 3ELNA 2OYZA 4XFAA 5JI7A 2WA3A 1PK6C 4RHV2 4ZU5A 4YYOA 2TBVA 2IFWA 5AVPA 1DGWA 4LA3A 3J8F2 2GH2A 3EJKA 3ZIWA 3WG3A 3GF6A 4LLFA 5LK5A 4RGAA 1FT9A 4Y24A 4CP1A 1ZZ8A 2OA2A 4OHXA 2XH6A 2ARBA 2XWJB 1GSLA 1GZWB 1ZZ6A 1H1IA 2EVXA 3LB9A 3AYEA 2A70A 4GIQA 3IN9A 3ME2A 2IXHA 4U2AA 3JB4C 4OI4A 1YYNA 3SCHA 1H8TB 4YVSB 2D5FA 4LBQD 3NO8A 3PVOA 1QQP2 1H2KA 1V6KA 2IXCA 2NLRA 5DUUA 4IERA 1RUF2 3WV6A 3M70A 5BNNC 3QLQA 1CPMA 3DF0A 2A3WA 4JDMA 5EXOA 5C8CB 2RR13 4HKOA 2VW0A 2R042 2Y0OA 4QM8A 1KRIA 3AP4A 1R1A3 1V6JA 4L9BA 4FP3A 3VBSB 2OW4A 4LBJA 3KD4A 4IEWA 5LEJA 2PELA 3RQ0A 3LGRA 1FV3A 4R4ZA 1A3KA 4JV4A 1R1ZA 3IDEA 1YIFA 2D6OX 4YVWC 1TME3 3HQXA 4DNYA 1WW7A 1MS3A 3VDDC 3VGIA 3W59A 1HX6A 1QDOA 1H2LA 1BEV1 1S1AA 3SHRA 5KHKA 1CIWA 3JU9A 3JCIA 3WY6A 3B3QE 3ZXDA 3N4MA 3K48A 3POYA 4KG0A 5FQ0B 5K8SA 5L19A 4TWTA 4N53B 1YXWA 4H55A 4DB5A 4LO6B 4Y26A 3EXUA 5C33A 4GH4A 1UPIA 1RUD1 3L9JT 4S2GA 3OBRA 4BLJA 3VBRA 1NA1B 2EF6A 1YCIA 3ZDSA 3V0BB 3HBZA 1H2NA 2ZGQA 1QGLA 2A6YA 3IM0A 4AVSA 3IKWA 1JUHA 1MEC1 3MF9A 4FPOB 3OTFA 4XBNA 5ABJC 3PVEA 1SFNA 4M3CE 4PBOA 4I3PA 4MGKE 3L2YA 1AR81 4QMAA 2HJIA 1U5XA 4CEWA 2WNVC 4RS5C 4L8QA 1PO13 2XPJA 3WP4A 1QU0A 3KM5A 3SCGA 5IK8A 5BY5A 2ZGNA 3NV4A 4JRAA 4YRDA 3KGZA 5JVVA 5J37A 4XW3A 2X5IC 3QD6A 2YUEA 4CDWB 1H2MA 3DV8A 5K0UA 3VKMA 1W0PA 4LO5B 2Y38A 4HPKA 5CFCC 1MZEA 2XVLA 4IL7A 1ND3A 4Y1XA 1ZRDA 1GLHA 1AXZA 5FPXA 2F4PA 3O0WA 1F9KA 1TEIA 5I0UA 4YFZA 4AHWA 2EAKA 3WXPA 3NVCA 2QVSB 2IZWA 5JZGC 1BXHA 2CTVA 3BOWA 4QQ2A 1AL21 1YRZA 5GLVA 4KG8A 1KJRA 3WCSA 2PHDA 1OA3A 1PGW1 4C0BA 1ZBE3 2PQQA 2VOVA 4Z07A 1LODA 2Z5WA 2ZGPA 4I3GA 1GZWA 5BNQA 2R6QA 4F8AA 1F8VA 1CAXB 1QNYA 4AI0A 5GZDA 4HT1T 4YVSA 4CP2A 3B5LB 3MFCA 2FZ1A 1CAWB 2TNFA 3BODA 1D4M3 4CDUC 4ZKTB 4GQ7A 2VG9A 4CRQA 1KQRA 1AR61 5LEKA 1QWRA 2FZ2A 2GN3A 1O5LA 4C90A 1QNWA 5AC91 3JBG3 1GQGA 4RGGA 4K9SA 5JSPA 4WVVA 1ZBA2 4Q26A 2VNOA 1KITA 1PIV3 4AEDB 1OOPC 1W6PB 5T5OA 3DPRB 4WVMB 3WR0A 5J36A 3EBRA 3B7MA 5FAXA 1UX6A 1I9RA 1FOD2 2W08A 1SLCA 2E7QA 4AI8A 1RUE3 4FP2A 2OZ6A 2PYTA 2JECA 3BOPA 2GH8A 2ZHKA 2Q0AA 4BA6A 1RUNA 2ZMKA 2PHXA 4A7YA 1B35B 4XTPA 5KHIA 1QH7A 3DN7A 4BHPA 5I0SA 2DCTA 1F2NA 4N53A 4QXKA 3CJIC 1RIRA 1C8M1 3WINE 1YFWA 1ZRFA 1N3PA 4KBBA 2XJTA 1S0EA 1ZZBA 1NA1A 2JG8B 2AZ5A 2PLV2 3VBHB 1SBDA 1EPWA 5C4WC 1ASJ1 5JDBA 1MS1A 1RUI2 5JIUA 2JDZA 3RNSA 1PVC1 2SBAA 1FMD2 4D3WA 4D69A 3B93A 3WG2A 4AFBA 4R9AA 4META 5KBFA 4LBNA 4EN6B 2P2KA 3I4IA 1BBT3 2HWC1 3CNAA 1XU2A 5K7PA 1X50A 3GNEA 3P3NA 1VBB2 1S55A 2D3SA 3EHKA 4Q4W1 4QX5A 2TUNA 4I2OA 2PTMA 4I0AA 2PAEA 4FAGA 3V65A 3AMNA 2UWAA 4Q4X2 4J1WA 4MYEA 3WUDA 1PZ7A 1QMJA 1PGL1 1UAIA 4XQWA 1O3QA 2RS32 3MPBA 3TWIA 2JENA 3GYDA 1UCXA 4LHNA 3TBDA 1VAKA 3OGJA 4CDWA 3N35A 4MV2A 1WD4A 5T50A 4EWDA 4LO7A 5FLHA 2QUOA 1BMV2 3O5SA 4U36A 4AHXA 4FPJA 1H8TC 2QE3A 1NLSA 4JGYA 1X33A 2IC1A 1SCRA 2XVKA 1TMF3 2WNUC 3FJSA 4GWMA 2FMYA 1AL23 1F5FA 4BYYA 1COV2 4A3XA 5F5QA 4HETA 3MLKA 3RPQA 3BTAA 1X7NA 1C3HA 2GNBA 2ZCWA 3CLPA 3ZXEA 1W6MB 4Q1RA 1DF0A 3KCYA 2VNRA 4I09A 3W58A 3AZXA 4IV3B 1VBD2 3VZJA 4BPZA 1RUH2 5C9AB 4Z8BA 4K6BA 1CAXA 1RMU1 3THTA 4CEYA 4DINB 2D3PA 2G9FA 1AR63 3B9IA 3S0MA 1DGRN 3RSJA 2WA4A 1CAWA 1LGBA 2WQZC 3ALQA 4HKLA 3FBYA 1LEDA 4XETA 1O3RA 4AQTA 2EALA 1M06G 1NQDA 1VAMA 1ZRCA 1ENXA 2WT2A 1UU4A 1X8MA 1WBLA 2VULA 4O9GA 2A71A 1LULA 3JD71 4M01A 4AEDA 3HMYA 3OYWA 2R32A 4WVMA 1CX4A 4FVVA 4PIXA 4Q0PA 1CJPA 3VBFA 1ND2B 2BNNA 2JD4A 4XMAA 5JCTA 4XEZA 2AGSA 3T1MA 1QJX3 4K3UA 5CADA 1CQ9A 2XWBB 3AMPA 3PVNA 4GB31 2YROA 4BH9A 2RJLA 2B45X 5GLWA 3WW1A 5IT6A 1NXD1 3BIWE 2UYAA 2HWE1 2H0VA 2A75A 3FFQA 1B35A 1LCLA 4W6WA 4XF1A 5GALA 1BJQA 4Q8KA 4IV1C 1AX2A 3ZYIB 2DU1A 4WZCA 2VQAA 1VBE3 4JCKA 2GSYA 3HT1A 2EXHA 2JG8A 5CIRA 3VZLA 5A33B 3J4UH 3LA3A 2PHFA 4ISRA 2A6ZA 5EYXA 1JN2P 3IIAA 1EPZA 4YSFA 3ILRA 2RE9A 2RM23 1G6NA 3WNXA 3FLRA 4XF0A 4GXLA 2DFCA 5KXDA 2LTNA 1C5IA 5F1RA 3H1YA 1OLRA 5JPMB 4N43B 1YIPA 2RS11 3KQRA 1S0BA 3CJXA 4QPGB 3VV1A 3PNAA 3U0ZA 1D2QA 5E16A 3ZN6B 4AXOA 4M3CA 2A6WA 1GANA 2D3RA 4YM2A 2R30A 2YGLA 1GQHA 2H6CA 2VVDA 1H4GA 1CD3G 2HWD1 1JBCA 4WBBA 1VBC1 2PHUA 3PVBB 2PHLA 2ZMNA 2XBO3 1MZ5A 4HVOA 4KQ7A 2ZX4A 5I8YA 4DY5A 2K9ZA 1QJU1 2UWCA 2BFUL 5LK7B 3EQEA 4E2SA 3S7IA 2QDNA 2WQ4A 4HVRA 4X6QB 1YI9A 2WZR1 3M4FA 4XPVA 4BIOA 4E4DX 4WM8C 1S0JA 3B94A 3VZMA 3SMHA 3SNMA 4WM7C 2VUJA 1OQ1A 1V6LA 2D6PA 2D97A 1W6MA 4OUMA 2B7YA 4AI1A 1V6IA 5C9AA 4IV3A 1N47A 1GV9A 2BW8A 3DPRC 3BALA 1IPJA 1EV12 4XQDA 1RUC1 1LOCA 3MLJA 3JB8A 1UKRA 2VGDA 3VBOA 3UKVA 3MYXA 1APNA 4YARA 4QM9A 5FRAA 1TE1B 2BWCA 1NE4A 4QGNA 1HRV2 5T5PA 1R092 4PLNA 1SEFA 3H7YA 5D8AB 3AFGA 1SACA 4SLIA 4AHYA 4Q4Y3 2RS51 3N7LA 4DFSA 4YZ3A 1JYCA 1ND2A 5L73A 4C0HA 3VBHC 2VU9A 1RUJ1 2R061 1IKQA 4C91A 3RS6A 2DVBA 1RUG1 2D43A 2Q1MA 5C6CA 2DCJA 3AB0A 5H9QA 1LENA 2RMU1 2NZ9A 1YLLA 2ZAAA 3JQXA 1YFXA 3N7KA 1KDKA 2X29A 4IEQA 3ES1A 1VBA3 2BWAA 3WP3A 4DRRA 1O4TA 2D6LX 4Y5Z0 4AYUA 4XFHA 4CYDA 1G86A 1AJKA 5KXEA 5GKAC 4YZ1A 4NWVA 1VB4A 2IXIA 3M8LA 5F6LB 1O4YA 5E8AA 1GBGA 3APBA 4LUMA 3VBUC 5T52A 1O5UA 1CJDA 3NV3A 5JAXA 3TOJA 4Z82A 1E57A 1AF9A 4COZA 1SFYA 2RS13 4IEPA 4JDOA 1DGWX 4FOWA 4R4XA 1N1VA 1Q5OA 4N43A 5GLUA 3H3UA 2RR11 4QPGA 1Q56A 1Q8PA 4Q4V3 3ZXGA 2GNMA 1HV1A 1DLLA 1R1A1 4NPRA 1AJOA 1LB2A 3ZXFA 3MPPG 4Q8LA 2DF7A 1HDKA 4I0WB 5KXBA 4E4SA 1HRI3 2R071 1CAUA 1RTVA 3E6BA 1LGCA 3NAPB 2NQYA 3I54A 3JUUA 4ONUA 3FUOA 1TME1 3U10A 1MS4A 5H9SA 3VHNA 3BB6A 3M3CA 4PDWB 3ZMNA 5ACA3 3ZFEC 4FPCA 4XFGA 3KS7A 3AZVA 1AYM1 4Y20A 5BNOA 3WG1A 4QPIB 4O9EA 1NCRA 3WCRA 3ZYGA 1LHOA 4A7KA 4IEUA 4UXAA 1V70A 2E9QA 4AFDA 1YFYA 4COVA 2EXKA 4D7TA 1LJ7A 2UURA 4KGGA 4DPNA 2P37A 3WW4A 3ILNA 1BQPA 4MGZE 4GA9A 3AKPA 3AP9A 1B09A 5L36A 1RUC3 1XNCA 4YG0A 2ZGLA 3AZZA 5CNAA 4CEWB 3B02A 1RUOA 1AYN3 5BNPB 5GM0A 2GC0A 5JLVA 2MEV3 2ES3A 1PO11 2E6VA 3X29B 2ZGKA 5L7OC 1MS0A 4TYSA 5DZFA 1ZZ9A 5JOYA 2HWB1 5FLIA 1G9CA 4S2HA 1SLBA 4DRVA 1UF2C 5JOXA 1BCXA 1RL3A 2VOKA 5D8AA 1SLLA 1X36A 1BEV2 1QOTA 1WLDA 1GZCA 1QJY3 4Q0SA 5FBZA 4Q29A 4BM8A 4OLLA 2IXLA 2R063 1EAH1 2HYKA 4FPEA 1Q8QA 4B7EA 5K9YA 4JDNA 1RUD2 2A3YA 2XL9A 4YW1A 1AR73 5KHHA 2RMU3 5IK5A 3D0SA 5LRSA 2EXJA 4JVAA 1MQTC 3AMQA 5BV6A 1GKBA 1JHNA 4Z2WA 4P5HA 1LOFA 1EY2A 4M0NA 1MEC2 1UIKA 4X6RB 3AKSA 5CB7A 2ZZJA 4AEKA 1A6CA 1V9U3 1S2KA 1PZ8A 1LKNA 4Q0UA 1AR82 1VJ2A 1PMIA 4DZGA 1ZBE1 2ZPXA 4AVVA 3VHPA 3AXEA 1OHFA 4MSVA 4AFCA 1U12A 2WS93 2XLGA 3MW2A 4BMEA 1WMFA 2WSVA 4M0HA 4CZSA 3TNPB 3VZKA <