2WNUB

Complex between c1q globular heads and heparan sulfate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
total genus 27
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuB00
2R6QA 1U5ZA 4D7YA 2X29A 5L36A 2HEYF 3ALQA 3IT8A 4OULA 4J6GA 1RJ7A 2R30A 2RE9A 1S55A 2OIIA 4RSUA 4NN0A 1C3HA 2RJKA 2E7AA 3MI8A 2WNUB 1ALYA 4HT1T 2ZPXA 4OUSA 1U5YA 1DG6A 1WCKA 4MXWB 2Z5WA 4KG8A 3ME2A 3AB0A 5CIRA 4F3JA 4QQLA 1PK6A 3TYJA 2JG8B 4E4SA 4QQOA 3B9IA 3B94A 3K51A 2O0OA 3WD5A 2WNVB 2JG8C 1D0GA 4N90A 2WNVC 4QQHA 1XU1A 4KGQA 1D4VB 4GIQA 4QQ2A 5KC6A 4QPYA 1D2QA 5HBAA 1U5XA 2Q8OA 3QD6A 2WNUA 3FC0A 3QBQA 1TNRA 1DU3D 2TNFA 3B93A 4MXWA 2Q1MA 2R32A 2JG9C 2ZJCA 4DOUA 4OUMA 1GR3A 1XU2A 2JG8A 1JH5A 3LKJA 1TNFA 1KXGA 4G3YC 4TWTA 1OSGA 1JTZX 2TUNA 2QE3A 2WNVA 4EN0A 5BNQA 4DB5A 4G4FA 2KA3A 1I9RA 1A8MA 5L19A 3URFA 1KD7A 4KGGA 3L9JT 2JG9B 4QQPA 1RJ8A 5KWRA 1IQAA 2HEWF 3TWIA 1C28A 5TSWA 1O91A 1PK6B 3V56A 2QDNA 3K48A 5KC5A 2JG9A 2HEVF 4E4DX 2WNUC 1OQDA 1OQEA 1PK6C 2RJLA 4MXVA 4TSVA 4MSVA 2AZ5A
chains in the Genus database with same CATH superfamily
3JZVA 1M4WA 2WRAA 1G6NA 2FZ1A 1YCIA 3FUOA 4DXRA 4PLNA 3OD0A 1BBT3 1NCQB 1UWWA 1FMD3 1ASJ3 2I45A 2WO7A 2ZGTA 2WT1A 3ACFA 3ALQA 3AP4A 2XVLA 5A7OA 5FPXA 4ITCA 3LEIA 5M0TA 1SEFA 2E33A 2MHFA 3WG3A 1A3KA 2DVFA 1HDKA 1S55A 4E8CA 2XPJA 4XDQA 1WMEA 2VQUA 1PM7A 4IV1B 3POWA 4C8DA 4QPIB 2B9UA 2WLQA 5IATA 1EP0A 2Y26A 1WMDA 3VKNA 3KWVA 2AACA 2RR13 1DLCA 2AGSA 5CFDC 2VZ3A 2Q8EA 2Y0IA 5JUVA 1SLIA 3WF4A 3T4VA 1JHJA 3EXUA 4BJ0A 4AGRA 1ENQA 1W99A 1GZWA 3MV11 1YHFA 1H6YA 4QMAA 4RR3B 4QPIA 2HWF3 1NY72 1S1AA 2WO1A 1PNGA 3O0VA 4NUBA 3K4AA 2HWC2 4F83A 4HOOA 1SCRA 4HG6B 3ZXLA 1BYHA 4HVRA 1PGW2 1DGWX 2JKBA 5DUWA 2DF7A 2W5FA 3WD5A 2WNVB 1WWYA 3LA3A 4RR3A 1SACA 1K5JA 4U2AA 4YLZA 3ZXDA 1CGPA 1JYVA 5LW9A 3MPBA 4LEJA 5GLWA 5DAQA 4KGQA 4ZXKA 3TAYA 1OBNA 3S5AA 3BUCA 4LBKA 1C5HA 3IAPA 4R8HA 1CJPA 1OA3A 2OUJA 4ZONA 3NJZA 1RUE2 2D6OX 2UYBA 1LOFA 3CJIB 3HAGA 1UKRA 3VBRB 1ENXA 5FY1A 2PYTA 4YVSC 2PLV1 5KXBA 2JEMA 1QJU2 3Q8EA 5DDJ1 3VLBB 2ATFA 2ADEA 1OFNA 4YW5A 3ZFEA 4ET7A 5FZDA 4OI4A 3BTZA 3CJIA 3RZLA 1UL9A 2PQSA 4OHXA 4URAA 1XNTA 2GU9A 3AZZA 3I2HA 2I74A 3ZSJA 2WT0A 3N9MA 3ITQA 4I0WB 1O4ZA 2BW8A 3AJZA 1DHKB 3O7OA 4FXKB 2KA3A 3ST7A 5EP9A 4Q0SA 3T08A 2RS33 4WM7C 5F7UA 5ERLA 1NZCA 4KGGA 3JXSA 1AYN3 3M8LA 2Y8KA 4CDWC 1PNFA 4KH9A 1UYXA 3PVNA 5LZ6A 3FLTA 5EIYB 3KS7A 4CU6A 4JRLA 3T1MA 2LTNA 4Q0VA 2FCTA 3DXUA 4XQDA 5L73A 3U07A 4BA6A 3LOBA 2W0XA 4E4DX 2V5DA 3LPGA 1ODMA 5FZ3A 1LAJA 3E6DA 2AZ5A 1FOD3 2YU2A 3UT0A 2WWJA 2FHRA 4CSWA 1IS5A 5EHDA 4JHTA 2C9KA 1YI9A 2F17A 4J6GA 4R9DA 5EJ1B 4ZKTB 3LAGA 3OBTA 4EWDA 4NPLA 2BUKA 3W5MA 4CEWC 2G9ZA 5DZFA 1FV3A 3LF7A 4XAAA 3T0DA 1HXS2 1T6BX 2Z2SB 1G9FA 3CZUA 1DYKA 3SCFA 4B1MA 3JBG3 2XJSA 3JD73 1NZIA 3IAQA 2G4IA 3Q8BA 5A3WA 5A3TA 1CWPA 3ZN6B 4RL7A 3NNLA 3RSJA 4A6SA 1GNHA 2ZX0A 3D0SA 1VMFA 4UW4A 4XBNA 1G9BA 4Z92B 2UWCA 1RMU3 4OZXA 2ZS6B 3CDZB 3A22A 4MZUA 3VBFB 1S2BA 3ME2A 4Y5TA 4HPKB 4F8AA 3IIAA 3VHRA 1AR82 4N43B 2RHPA 1RVF3 1PK6A 1I5ZA 2WN3A 5FYUA 3LQCA 2JG8B 4H14A 4CDXB 5JSOA 3POBA 4QGNA 4BE3A 2KM2A 4AAXA 4D94A 5JIUA 3VBSC 4Q4W1 3RGBA 3VDAA 1D7PM 1ULFA 3D82A 3NRUA 3NV2A 4LTAA 4S2DA 1JHNA 5FK7A 2I07B 4BQYA 1BEV2 3EB7A 4OZOA 5I8TA 4QD2A 5C3OA 2VC9A 3UGHA 1AR61 1D0GA 2A7AA 4V2WA 4PDWB 3J8F1 1RUC1 1WLTA 4GULA 4JGYB 2E7QA 5I0UA 1YC61 5A3MA 1ODNA 3KV4A 4HONA 1PIV2 3IBMA 4M0NA 4PHZA 3VV1A 4HK8A 4OUEA 1DQ1A 5C3QA 1O5LA 2VCMA 1SLAA 2BVVA 2EXIA 3MIBA 2Q0AA 2OQ7A 3I3QA 5F3CA 2YC4A 1BBT1 1AX0A 1FMD1 1ASJ1 1V6IA 3JB4C 2EALA 5FPLA 1C4RA 1ND2B 4GWNA 2CGPA 4PBOA 5FPVA 3MUZ1 1XU2A 5C4WC 3LA2A 4CA9A 4IEVA 5IYYA 2WIIB 5IVYA 1LCLA 2IXIA 4XBLA 1ZRCA 3ZN5A 3LEMA 4Y1XA 3PU3A 1ND2A 2WZR3 2F4PA 4AEDC 2ES3A 1LHVA 2JD4A 2BNOA 4LBQB 1V70A 2DWRA 5L19A 1WCDJ 4IEOA 2OZJA 2X8KA 5AC93 2I2SA 4D6SA 4CDQB 2LALA 3AFGA 1IPKA 1IKQA 3NNFA 4M3CE 4NWVA 4MADA 2CGOA 4XAEA 2HWF1 1PZ9A 3GJAA 3EMRA 4QQPA 5HXMA 1AVBA 4FTEA 1XNAA 1Z0HA 3ZKYA 2OS2A 4F7ZA 5I0SA 2XUMA 2BQPA 1DBNA 3AP9A 1DYPA 5F3GA 5FP4A 3WW4A 4D6QA 4IE6A 3MPPG 5F9TA 3N4MA 3LWCA 4XUQA 3WQ7A 1US3A 2XWJB 5JCTA 2ZZQA 3LDKA 4MLOA 1CESA 5FPBA 3C7EA 4Q0PA 3PVOA 4JGZC 3WNLA 1NXMA 2ZGNA 4L11A 1OKOA 1U5ZA 4L2NA 2Q8CA 1HB3A 1VB2A 3WNXA 3MZHA 4MGSA 2VZQA 2W68A 3UKNA 2PLV2 2VR4A 3BTAA 5SV8A 3ACIA 3FJSA 4L9BA 5GM0A 4AI0A 3B5LB 4QXHA 3WP5A 4HKWA 3OTFA 5APAA 3SEEA 4NVPA 4W65A 1UZ0A 4B29A 1V6NA 1VE0A 3LPFA 1D4M2 4OHYA 3WQ1A 5JDBA 1J1TA 2ZX4A 5AFBA 1DZRA 5FWJA 1MQTA 2XJTA 3MDPA 5FZBA 1EY2A 2WNUB 3A21A 3AMQA 2JWPA 2PHDA 3DYOA 2H6CA 4XF9A 1N1TA 2PHWA 1GFF2 4GH4A 2QQJA 4RGKA 4XTMA 1UMZA 5ACA2 3DPRC 1GOFA 4TZDA 2VVEA 4KG8A 1GBGA 1O8SA 1W2TA 1SPPA 3KSCA 3AB0A 3GM8A 4BLIA 2BYVE 3PVEA 4Q4V3 4BB3A 2XBO2 3HBKA 2FD8A 3HIFA 1DGRA 1H8TA 1RHI3 4DXTA 4I0BA 5E88A 2RS31 1E5SA 1ZBE3 5FY5A 1WLDA 1MZFA 2R063 5F5CA 3VKFC 3N7KA 5A1AA 1AYN1 1CVNA 3U4XA 4O9GA 4QAWA 3GZEA 3T3YA 5H9QA 5FUNA 4XURA 4RQPC 2AEYA 5T3NA 3S7EA 5KHKA 2IWGB 1WLCA 2PQQA 2XDVA 3TN91 3VL9A 4AI2A 3B01A 3NJXA 3WUDA 4AVVA 5E8AA 3ZFGB 2XJRA 2ZEWA 3L2YA 2YGLA 1R1A2 4BOWA 1NAEA 4N7UA 4QDSA 5CFDA 3DYMA 3SISA 2W87A 3IPVA 1FOD1 2DBNA 5IW0A 2CTVA 4AFDA 1DU3D 4PT6A 3U37A 1DGLA 2DCKA 3IDEA 2GZWA 2V72A 3KCXA 4MGYE 2JE8A 4AXOA 3I3BA 1HIXA 3GXUA 3FFZA 1NKGA 2R32A 1MZ6A 3E5QA 4G9SB 1W6NA 5IVJA 1GR3A 2A6ZA 2HWD3 4OHZA 4PI0A 1KJLA 3BU7A 3LKJA 4B1LA 1KDKA 2ETEA 3SEPA 5BUVA 5C3SA 3WV6A 1VBE3 3AKSA 3VHPA 5JXJA 3JBG1 3JD71 1TMF3 3BOWA 3JB8A 1GV9A 3SXWA 4AQSA 4DO0A 3IMNA 3NAPA 1ST8A 5J3UA 1ND3C 1AL22 2VZUA 5FZEA 5HXVA 1PO23 2DBIA 2NN8A 4YVSB 4EROA 2O1QA 3PLQA 3VBUC 5LEJA 1OC1A 4HMZA 1RMU1 1PVC3 5GZCA 2ZEXA 2JX9A 5DUVA 2E7TA 5I0TA 1VB4A 4COWA 4BZ4A 2QQKA 4FPKA 2VBPA 1JMUB 3B00A 1QGLA 1RUF2 1X82A 2WJSA 5CAZA 3HEIA 3M1HA 5F39A 3ENRA 3HN3A 5CB7A 4GWMA 4E2GA 1ZRFA 4P5HA 4AI8A 2RS13 5JR2A 3VKOA 3DGTA 2RMU3 2ZZJA 3JUUA 2D40A 5I8SA 1NOVA 1R082 1NYWA 4YFZA 1CZTA 2E6VA 2WZPP 4CCMA 3AVSA 3RDIA 3POEA 4V1PA 1HRI3 2ERFA 3DF0A 4YZ4A 4WM7B 1OHFA 3THTA 2WZ8A 1HRV2 3O0WA 1UY0A 3R4SA 1SLCA 5GLUA 2VO5A 2VNGA 3KD4A 3ZIXA 5J98B 2EXJA 4AK3A 5DAVA 1NA1A 4ASLA 4QGLA 4DQAA 5IK5A 3H1WA 4CDWB 3O1UA 3TEZA 4GJYA 1TME3 4ORFA 4YGEA 4XFCA 5FZ9A 5H9PA 2F4LA 1NCQC 2HWE3 3GJBA 4FPYA 4IE4A 4WM7A 2KD7A 2XJVA 3RYRA 3WHTA 4GALA 4IL7A 4BMBA 3RZGA 1OD3A 3IDCB 3MI8A 5E16A 3AYEA 1ALYA 2OYZA 3VZJA 4EJRA 4LQRA 3HT2A 3PUHA 4QPGC 1QOOA 2GH8A 4LA2A 1W0OA 3VGIA 1QIQA 1VBA3 2IVJA 3U4SA 3U75A 3WEZA 2ENRA 2RR12 2FDFA 2EAKA 4Q5OA 2VNRA 1OLMA 3H50A 4BK4A 4CEWB 5FQ0A 1AYM2 1AXKA 3KCCA 4BQ2A 1AUYA 2D97A 2WQ8A 2WZR1 3B9IA 3MLLA 3PL0A 4UW3A 2DCZA 4RHV2 2OZ6A 4BPZA 5AC91 5CFCC 2NZ9A 1I6XA 4XUPA 5IVFA 1WMXA 3F95A 2WNVC 4QQ2A 5FLJA 3HNBM 5IAXA 2BWCA 1DFQA 2WA3A 2W2IA 5BNOB 1W8TA 1YIFA 1TEIA 4P9XA 3S57A 1QOSA 1APNA 1UN1A 4JAAA 5F6LB 1ENRA 1FPN1 4FAGA 1MEC2 2BVBA 2W1SA 2VZRA 4JQTA 3VB9A 4BQ4A 3VBSB 1PO13 2BPA2 4EN9B 2YU1A 3OGJA 3OG2A 4DY3A 2D93A 3VBOB 1VAMA 5JXHA 1N3QA 3ZSLA 2XJPA 2UWBA 4Z07A 3VBRC 4MG2A 3LE0A 5KBFA 4JTOA 1UYZA 1SMVA 4IEUA 4N53C 3A0NA 4PQ9A 3VBSA 2GNMA 2C1FA 4E9KA 1UZYA 2D44A 1ZA4A 2WA4A 1V0AA 1W6OA 2TUNA 1AXYA 1CAXA 4GA9A 4HN0A 1MS9A 1LHUA 3OUJA 1IZ3A 4MVTA 1ULCA 5HCAA 1OVPA 4PIXA 3ES4A 2PHRA 4QXKA 5FO8B 3FHIB 2GNBA 4H7MA 4BCUA 4DEVA 1X8EA 2XUEA 1CPNA 1GZTA 3RZKA 1RUH1 2HYXA 3KF5A 1TQ5A 1W0NA 2B39A 2XLAA 2XVKA 4AGGA 3KB5A 3UKTA 1XE8A 2WABA 1H9WA 5C4WB 2GP5A 2VZVA 1POV3 4Q4V1 3TWIA 5JMOA 4FO9A 5FZ6A 3OYWA 1OKQA 1QJY1 1E57A 5HCBA 2Q8DA 4LO5B 3VD3A 5B4XA 3HWJA 5BPXA 5FYIA 1RHI1 2FMDA 5JVVA 3K48A 4LE3A 4CZSA 3PHMA 1ZBE1 1QJFA 4PF5A 4AEDB 1Q8VA 4AQ2A 2BNMA 3ZN4A 1F9KA 4JDMA 4ONUA 5ISLA 3AXEA 4MXVA 3VZLA 2A1XA 5D8AC 1W39A 3VD4A 3MF9A 2ZEYA 2R043 2Z42A 1J84A 4YW1A 4D7YA 1VBC1 3W5NA 1PZ8A 5KHGA 3OCPA 3IM0A 1JYXA 2ZGUA 2W39A 5LK5A 4NPMA 2E32A 4ISRA 1SCSA 3O1OA 3LDBA 4Q29A 3JQWA 3WNOA 1YIPA 1H2MA 1N47A 1AR93 1RJ7A 2GC1A 1LEMA 2YBPA 4KU8A 3CLPA 2W95A 1BKZA 2Y6KA 4QB6A 1MZEA 4DNYA 1FX5A 4O7XA 1C8M3 3DYPA 4LIVA 3BTXA 4AFAA 4K21A 2V4AA 4R9BA 1Q8PA 3AZWA 4OHWA 3WR0A 5GKAC 2K0GA 1Z7S2 2ORZA 4NROA 1I3HA 3GHMA 4DFSA 3JD72 4OI2A 4HT1T 1OT5A 4YZ2A 2IUWA 2VZSA 1RUG1 4ZY9A 2ZHKA 5LBCA 3H9AA 3G7DA 1JW6A 1LESA 1PZ7A 3ZMOA 2HWD1 1ZNPA 2QQVA 5ABJC 2DVAA 2HWB3 4FPFA 2MPFA 3KV5A 3RS6A 4BYYA 1UIJA 2A71A 1YJKA 2VBDA 1YO8A 4D3WA 4FFGA 5DDJ3 4DXZA 5C3RA 1A8DA 4JGZA 1BVP1 5FZ1A 3EBRA 1ZZ9A 4M00A 3O1SA 1BJQA 5FKCA 3VBFC 1I5PA 1RVF2 2D3RA 5KHHA 2XQXA 1UAIA 1PO21 3WG4A 3K3OA 4B4QA 4N43C 2VH9A 1LHWA 1QXRA 4E8DA 2JG8C 4CDXC 5GZGA 2D98A 1GU3A 3B7MA 5FPUA 3AYDA 2YFUA 3HNYM 3FFQA 1H0BA 4KI5M 1OMIA 4M4RA 2RDSA 5A6YA 2R49A 3V0BB 2VG9A 1VBB3 3DUIA 1GANA 3HQUA 1NLQA 1WCSA 3WF2A 5KC6A 1EPZA 1W6MA 1N1VA 1D2QA 2A6XA 2RMU1 4O61A 3ZXAC 4KWKA 4BWOA 4BDVB 3WG2A 4RN5A 1SLLA 3FC0A 5FOBB 1SFYA 3DPRA 1HRI1 3LEKA 1V6LA 2PHLA 2ZTNA 4WVZA 3WG1A 3NV3A 4U36A 1W6QA 4A2UA 5GALA 2ZHMA 5A3NA 2DVBA 2YDEA 1REFA 2VD7A 1JI6A 1H4HA 1NE4A 1US2A 3NNJA 5CBLA 3KGZA 5FZGA 2DVGA 1VAVA 1O6UA 2HWE1 5FYSA 1RIRA 4K40A 3WP4A 1HLCA 4XACA 3D5OA 3N7LA 3HN1A 4H2AA 3I59B 5A3OA 3AL5A 2C4XA 3HMYA 3AC0A 1FT9A 4I3PA 4RQPA 1GQPA 3ZDSA 4UBHA 3J26N 4DS0A 3GBFA 1LKNA 2OPWA 3AMMA 3POGA 1MACA 1JZ2A 2WZR2 2IXCA 4IW3A 2J1VA 2GC3A 4XFGA 4YZ1A 1D0HA 1VBA1 3ZM8A 3OJBA 2VTXA 4Y4YA 5LWBA 4LHKA 2LM3A 3W59A 2DCJA 4KQ7A 3WLUA 1S0GA 2XR4A 2ZGPA 3NVCA 4FP3A 4HBNA 3OF1A 4AEMA 5IK8A 2EAAA 4GB33 3RZZA 1NQDA 1LOAA 1DQ4A 1JOJA 4A45A 5TSWA 3MF6A 1I1EA 3ECQA 3SHRA 5FZOB 5LY2A 1Q3EA 2XB6C 4LOSA 1W9WA 3OPWA 4LA3A 2J7MA 3KQ4B 3ZYJB 1JYWA 4DUXA 5FAXA 4LKEA 5K0UC 1KJRA 5JPMB 1CJDA 1W04A 2WAOA 2WS92 1PHMA 5A1FA 4GZ9A 1S0IA 2W9XA 5FZOA 1QWRA 4CCNA 4Y33A 5K7PA 2BBVA 4ATFA 1RUI1 3QLQA 2ZACA 1ND3A 3R05A 3UYJA 2UU8A 1K42A 4XBQA 1AR63 2VUAA 3VBUA 1YFYA 4YW3A 4TXWA 1QQP3 1PO11 4YRDA 5BNPC 1C3HA 4AVAA 4AFBA 1ACCA 1RUJ2 4TN7A 3V0AB 1ULPA 1ZVFA 3S0MA 2B5HA 4IGOA 2D6PA 2RM22 2JKXA 3H1YA 3RWKX 5AFEA 1VAKA 4OI1A 5FZHA 2RJ2A 3AP6A 2O8QA 3THPA 3SKJE 4MHUA 3LA7A 5JR7B 3LDRA 2CDOA 5GZFA 1BXHA 3TYJA 5T5PA 2EIBA 3I8TA 4IEXA 1NT0A 3BN6A 2EIGA 2XHKA 5T50A 3VDCA 1VMJA 1UOJA 2ZMLA 4Q4V2 1UF2C 4META 2O0OA 3AFKA 4K20A 1D2SA 4Y20B 2OVUA 4P02B 4I02A 4Y3OA 2QQUA 4QPGB 1V00A 1NCQA 4WZFA 1K12A 4KWLA 1G8WA 1URXA 1XU1A 2R062 5DZEA 3NV4A 1POV1 1WW5A 1SBFA 2ARBA 3M3IA 5DMYA 1MPXA 1LRHA 3WCSA 1COV2 1XBFA 2NP0A 1LOCA 1OFSA 2Q8OA 4JKMA 2VM9A 2D43A 5A33B 2ZHNA 4IV1A 3UL2A 1UY4A 1OPMA 1VBD1 2CSGA 5C5TA 4M3CF 5FUIA 1W06A 3ZFGC 2R041 4CXWA 3AK0A 4FOWA 5CFCB 1IOAA 2VOXA 4AHWA 4BXSV 3CL1A 2WNOA 5AVPA 3P3NA 1RUOA 2WSVA 4GMP0 2R073 1DLLA 3ILNA 4ISQA 1AR91 1QJX2 2JDNA 2VVFA 5A32A 5JAXA 3ZXKA 4QGMA 2B46X 4UT5A 3WINE 1OPOA 2R1BA 1C8M1 3SNMA 2BP6A 5F1RA 4AAPA 1MS3A 3AZYA 1IGOA 3AKQA 1JYNA 1XNBA 1QJZA 2QFEA 3K46A 5FYTA 2WNVA 1VBE2 3I4IA 4PQQA 5D1IA 1TMF2 2BEOA 1W9TA 2DV9A 5C6CA 1AR73 5F5QA 4XJWA 2VECA 3PDQA 3VDDB 4GAZA 4FOVA 5FZLA 4DRRA 4Y1UA 3J9SA 1W9SA 5K4LA 1ZBA1 1JOBA 1BQPA 1UZZA 2HWB1 2VW2A 1PVC2 4N53B 4YG6A 5T54A 5JZGC 1OLME 4QKBA 4LBJA 2ZGLA 3SLIA 5KWRA 3SCHA 2HEWF 1L7RA 4P9YA 2ZHLA 1OI6A 1MS4A 3NKTA 5IFTA 3MW3A 3VBRA 1W6PB 3FHAA 5C5UA 1YQ8A 4FT8A 1WD4A 3OPTA 1VALA 1ZYBA 2RS12 4N53A 4Q2FA 3MIGA 4YW6A 4GWJA 4AYUA 4TSVA 2Q1FA 2R6QA 3HD8B 1VBB1 5DAXA 3WDYA 1Q56A 5A7WB 2JDZA 2YPJA 3LCPA 1AX1A 2VL4A 3WHUA 4PIZA 1LEDA 3E6CC 1TME2 1H1AA 4QX2A 2RJKA 3N9OA 3GHNA 2E7AA 2YBSA 4S2HA 3TN93 2OKXA 4SLIA 3RYKA 1Y4WA 5L36A 5D8AB 2FMYA 4IE7A 1XQNA 5FO7B 4NE9A 1W8FA 4MX3A 2CDPA 1G9AA 1JU3A 1W0PA 5JXGA 1IS3A 3VL8A 3THDA 3RPQA 4CEYC 1KS5A 3V65A 1CIYA 2X5IB 3C3VA 4J1WA 3N7MA 5T5OA 4XMAA 3VHNA 1NXD1 1O3QA 4CP9B 3BPZA 3DL3A 4BQWA 4XIKA 3USUB 3W58A 2NM1A 1CAWB 4HFSA 1CN1A 4ZU5A 1IHMA 1JXNA 3KV6A 1KEXA 4Y24A 3BCWA 4QB2A 5DPNA 3MIHA 2J42A 1ULOA 5IK7A 2ZMNA 2VCAA 1SBDA 4JQRA 5DAWA 5ABJB 1G86A 2WFF2 2XGXA 4GB31 4W50A 5EYYA 2ARAA 5CZKA 5FIXA 2KXLA 5JSRA 2CHHA 3ZDVA 3KMHA 4OFGA 3QH6A 1NG0A 4QX7A 4ARXA 3SC7X 3ORJA 4ZU4A 4IV3B 5BNOC 5CISA 3MUY1 5LBBA 3WY6A 3ZN6A 1V6KA 4LIUA 2GP3A 3AVRA 3WNNA 1BLZA 4J25A 4ZXEA 5C9AB 3C2UA 1REDA 3E1F1 5SV5A 5CYYA 1WKYA 4C0HA 2WINB 2BGCA 3DKWA 4XFHA 3RJ2X 4Q1PA 4EWEA 1Q5OA 2BWAA 2ZJCA 5FP3A 3VBOC 3VBFA 4DOUA 4HPKA 4CVUA 3RVHA 4NHKA 2P4EA 2VAUA 4N43A 1W8HA 4UYBA 5A6ZA 5CVRA 2JG8A 1JH5A 2O8OA 3CKHA 3RQ0A 4CDXA 1QQP1 2QQLA 3RZMA 5LY1A 3ZLIA 3T1LA 4FOQA 1TG7A 1ULDA 1EAH3 1QDCA 1GSLA 5KR7A 3GALA 2Z79A 1H9PA 4YM2A 5BNQA 2A6WA 1WZXA 3IDBB 2FDJA 3WP3A 1I9RA 1SHWB 1W2NA 4KG0A 3ZR5A 3Q8FA 2WO2A 2WQZC 4PDWA 1F4AA 2IXKA 2VGDA 1OOPB 5F2SA 1DP0A 4JGYA 3SQOA 3RWNA 5BXXA 3ZXEA 3OOXA 2PELA 3R4UA 1J3QA 4M01A 5L9BA 2ZKNA 4GWIA 4YW7A 4EWAA 5CEHA 3ZYGA 1IQAA 4FTSA 4HSLA 1YJLA 1L7LA 2SBAA 3JU9A 1H6XA 1S4CA 1RXGA 2VUDA 3H7YA 1RC6A 3AP7A 3HNMA 4QDQA 5FV3A 5FMOL 1OLRA 2HEVF 4UFIA 3PJYA 4WM8C 4FTBA 2A3YA 5LASA 1OQ1A 3I3EA 4YG3A 5C3PA 2PAMA 4TTGA 5D21A 5FYMA 4LKFA 2RV9A 3K77A 3S7IA 1POQA 2X29A 3ZSMA 3C7FA 2RG4A 4DZGA 4EN6B 1J58A 4N9HA 3KVAA 2VY0A 2JECA 4FXGB 1WA4A 4XXAA 1ZX5A 4YPJA 5LA2A 4YW2A 4LHNA 4QX1A 3CU7A 2ET7A 5K9YA 4CTEA 4RSUA 4XJAA 1YFXA 4NN0A 2JDPA 3M3QA 4FPCA 4MOAA 4LBQA 4CCKA 1AZDA 2HKXA 4XFAA 4MV2A 4EN8B 1LHNA 3T2QA 2WNEA 5K0UB 1BMV1 2QCSB 2VOWA 3H8RA 1FPN3 2R071 3GDBA 4CDQA 2C6SA 2DFBA 2W1UA 1BVVA 2OT7A 3HPNA 5C7GA 1K3IA 3KCYA 5FZ7A 4LMFA 1AL0G 2QQMA 2YG0A 3NKGA 4MXWB 5LRSA 2QQNA 4CU8A 2EF6A 4L99A 4IE0A 2G19A 4Z2AA 2CY6A 2HWB2 5K0UA 5F37A 1A6CA 3ZR6A 5DDJ2 5BNPB 3C8XA 3B94A 3T2PA 1L7QA 1AR71 1QF3A 4ES8A 1S0CA 4BIOA 5CKQA 4DEQA 5FRAA 3N9PA 1WBLA 2OXBA 5C70A 4CE8A 2Y64A 4PI2A 4NHYA 1LNSA 2IFWA 2QDRA 1JZ3A 1KS4A 4V2VA 5J7MA 3AZXA 3FL7A 1RUH3 2ZBJA 1S0JA 1HKDA 5EJ3A 3IZOA 1SLBA 1YEWA 1Q8OA 1PMJX 2BV4A 2YFZA 4GJZA 3H0OA 2WNUA 4DIQA 1E5IA 4AHYA 3J7HA 4R52A 3M70A 4NOTA 2JD9A 1H8VA 3S5QA 1QJY3 2VPVA 3N7JA 3WX5A 4H3WA 3X29B 1PX4A 1F4HA 3ZOIA 3OUIA 2P3JA 1UU6A 1GLHA 4JRAA 2WDBA 1EYBA 2AH2A 2FZ2A 1LJ7A 1MVEA 3DECA 1EPWA 3NJYA 5IVVA 2RS53 5EFUA 4FOYA 1VBC3 4JDNA 2ZOEB 1MS0A 5F32A 2O14A 2QE3A 3TOJA 4YARA 4LO4B 4L92A 1XPWA 4C1XA 4QU1A 4CXYA 3UESA 4N8MA 4Q1RA 4AFCA 2JDHA 4QHBA 2D5FA 1GYKA 1UX7A 5T5LA 2DTWA 3L9JT 4BH9A 5HCHA 3OPZA 5HPOA 3P5BA 1FAYA 1QOTA 1F15A 2P34A 1F5JA 2XQRA 3FLPA 4A7ZA 4CUAA 2Y6HA 3ZFGA 4Q26A 3UJQA 1RUG3 1JUHA 3WDUA 4Y4RA 2DCYA 4NRPA 4AHZA 4P9JA 4XMIA 2FBEA 4RS5C 3JCIA 1XC6A 3VZKA 1HQNA 5C8CB 3VBHC 4LLOA 4XFBA 1F2NA 4Y5Z0 5FPZA 1HN1A 5IVEA 1OQEA 5F2WA 1FXZA 1Y9QA 4Q4Y1 2VMHA 4YGBA 3RZJA 4A42A 5FPAA 4I0AA 5JZGB 2VBBA 3UV9A 3IT8A 3ZFFB 4OULA 4SBVA 3M3EA 5IT6A 1SLTA 3BALA 4Q4W2 5KHJA 4Z1VA 1V6JA 2B42B 2XG3A 2W08A 3AX4A 5FMOS 1AR62 2GALA 3SH4A 4YVSA 3J8F2 3LSDA 4W6YA 3OD4A 1RUC2 1WA6X 5EPAA 4WBBA 2ZX3A 1GOHA 2ZPXA 3THCA 1TE1B 1B09A 4P14A 1JYCA 4MGTA 3KGLA 3AXDA 3M4FA 1XYNA 4XIOA 1LB2A 4LBOA 4P08A 2X10A 2XJQA 5IJRA 2E26A 5CIRA 4D0QA 3OEAA 2JDKA 3VKLA 5IVBA 1EAH1 3D8CA 3FUQA 5FZMA 5EZWA 3PUQA 4MH0E 1BBT2 1FMD2 1ASJ2 5GZEA 4HL0A 4UW5A 5J96B 2ZKLA 1XNCA 1X9PA 5KXDA 4CRQA 2P5BA 1PGL1 1JYIA 5JXIA 3IB3A 1C1FA 5L7OC 3IN9A 4FPEA 1YUDA 1CAVB 1VRH1 1Y7BA 2BDRA 3AMHA 3ABZA 1ZZBA 1H2KA 2Y6JA 4CDWA 2CL2A 2FDKA 4INDA 1FV2A 3C7HA 4XUTA 4NHXA 5I8YA 3I97A 1HB2A 4WZCA 1W9FA 4YM1A 3I2GA 4CEYB 1GNYA 1OVSA 3KHCA 3ZKUA 4B4RA 4EZ4A 3P3PA 4K9SA 2R7EB 2WT2A 3AZVA 5FZKA 1QEXA 3LFIA 2RVAA 1RB8G 3NO8A 3KLSA 5FYYA 1YNAA 4C0BA 2VOVA 5FZ8A 1DQ2A 4IETA 2HWF2 3ZSKA 1LENA 4LBMA 3T30A 2R0HA 4CEYA 4CDUB 3B93A 5FYBA 1RTVA 3AM2A 2WZEA 4YG0A 1IPJA 2D3SA 2Q1MA 4AVSA 3QOPA 1HB1A 4FQZA 4K6BA 1HX6A 3MLJA 3IIIA 4R9CA 2HJIA 4KNCA 4CEWA 5BYNA 1VMHA 1IKPA 1KITA 1U12A 1UD1A 3H3LA 5FP8A 4XZUG 3I3DA 1MS8A 2K46A 2P2KA 2W92A 3I2JA 1RUI3 2QQIA 4NJ4A 3GBWA 4I2OA 1P8JA 3AYAA 2JB4A 1LR5A 4UFKA 1O3TA 1C57A 2Y33A 3N9QA 4QM8A 1FI2A 3RJRA 1KD7A 5AVAA 3E5XA 5A7PA 4XF1A 2VW0A 4LBQD 4Q0UA 1ZRIA 5IUQA 3VDDC 5BNOA 4HVQA 2ZX2A 5FZCA 4J1XA 1PMHX 4YYOA 1C28A 4NIDA 1LGBA 4LHSA 1IPSA 1YQCA 3MICA 4UAPA 1H1IA 3V56A 4PLOA 1ZREA 4YM3A 3VBOA 1SBEA 2JENA 4CP2A 4AR2A 5IFPA 1H30A 1AR83 3DEMA 2HBUA 5CADA 5IVCA 2WWSA 1GNZA 2XLGA 2PA7A 1V9U1 2FDHA 3E5UA 3LGRA 2JDMA 4XF4A 1SG3A 3LSEA 2SLIA 2HEYF 4HLTA 4NHMA 1IG0A 1GZCA 5FZFA 4BIFA 4Q0QA 5FOJB 1OLQA 4DPNA 1QY4A 3K4ZA 1UMHA 1BEV3 4NAOA 1DQ0A 2D6LX 2EIDA 4COUA 2RS32 4HN1A 4BK5A 4WVVA 2CWSA 1UCXA 1HQWA 4CUBA 5A7NA 1AYN2 2W1WA 3PVBB 1DQ5A 2VUJA 4A4AA 4BM8A 5FZAA 3UNPA 1ZZ6A 3HR9A 4WM8B 3ILRA 3J7NA 1PIV3 5LATA 3WW3A 5IHRA 3TN92 1XNKA 3OGVA 1U5YA 5F3EA 4Q4X3 2CAVA 4FBFA 3AMNA 1WCKA 1VBD3 4B3NA 2VOKA 1S0DA 2YC0A 1OURA 3PNAA 5C4WA 4AVTA 2RS51 4COZA 1W8NA 2AEZA 2V73A 3EYPA 3ACLA 2PHFA 1LHOA 1UO9A 1FOD2 2MEV3 3A0KA 4PF1A 4EE2A 1JYTA 1J59A 4AEDA 4BQ1A 4LUKA 4JTNA 4LITA 1VR3A 2X5IC 5F3IA 4AL9A 4CUGA 2D6NA 1GWMA 5J36A 1VP6A 2DCTA 2WQ4A 4AI3A 2JE9A 3JBG2 5L9VA 4LE4A 4XVHA 3T2TA 3INAA 3NMBA 4L0PA 3GYDA 2L9LA 2B4KA 2DU1A 1DGWA 2YC2A 2JIGA 3WW1A 1ZBA3 2GMPA 3MYXA 1RMU2 2W47A 2BZDA 3I49A 4CP0A 4X8PA 1Q8SA 3OY8B 1G9DA 4TLGA 5DXDA 1NY71 1QH7A 1RGSA 2VVDA 2HWC1 4EQVA 3AL6A 2ARXA 2NMOA 3DN7A 4CUCA 1WUVA 4IV3C 1BHGA 4XHBA 1PGW1 1C8NA 4HETA 1DF0A 3NNGA 2K9ZA 5C9AC 1Q8QA 4DY5A 3GZUC 5HCFA 5FUPA 1J83A 1WW7A 1DYOA 2CAUA 5GJ6A 5BV6A 4TWTA 3AMPA 5A6XA 1CIWA 1LOGA 3SKVA 1RITA 3JQXA 2ZGQA 4GKXA 3MBWA 3RI8A 2D6MA 3W21A 1J1LA 4IQPA 4S2FA 1LULA 1EAH2 4XYXA 1RUE1 1JZ8A 1NX9A 3T2OA 3V0BA 1D4M3 3FLRA 3MEPA 4LHLA 5LRRA 5HV4A 1F5FA 4RGGA 1HJFA 1UW8A 5H9RA 5GZDA 1QJU1 5BY5A 1O5UA 1JU4A 4Y22B 1OOPC 4JKLA 1EV13 1G9CA 5J09A 4D7SA 4XUOA 4UFMA 3J7LA 5FO9B 1TZOA 3VUOA 2BU9A 5ACA3 2VMGA 5A3LA 5FBJA 2JICA 2H0VA 3KT7A 4MSVA 4YFWA 1MZ5A 2QNKA 4GMP3 2XH6A 3OEBA 3CZJA 1ZZ7A 2XBO3 1Y9GA 3AKRA 4Z82A 3WXPA 4ASMB 3G6JB 5BNNC 2E53A 3L2HA 4D6RA 1K5MB 2Y60A 1QDOA 2YV8A 4XZPA 2BRTA 2H0BA 3IWZA 3M3OA 4BXFA 3QCWA 2VMDA 4UFJA 5FJKA 3ROUA 5CU1A 5AC92 3I59A 4M0HA 5GLTA 1YI7A 4EV0A 4AI1A 4RS5B 2GMMA 2W52A 3B3QE 4K3UA 3S6PA 3VBHB 3IKWA 5FXWA 3MFAA 3O0XA 3LEGA 4MO3M 4TYSA 1Y43B 1WW4A 2VMIA 4PJYA 5ANNA 1WCQA 2LROA 3SH5A 2G1MA 5LBEA 4K8FA 1GQGA 2QUOA 2IC1A 2WL1A 3HOBA 4MYEA 2YHJA 1S0EA 4BQ3A 4NIHA 1HV0A 3V64A 2NMNA 1FPN2 2OX0A 2YBKA 2WC2A 1QNWA 2EIEA 4OQ9A 1L3JA 5FREA 1JODA 1AXZA 2VZOA 2QZ3A 4F3JA 4QQLA 3WOGA 4QX3A 4FPGA 4XXPA 1E5RA 5D2AA 4QQOA 1OA2A 1MR5A 2DVDA 3K51A 4LPLA 4X6QB 2BOIA 2J1RA 2G9FA 5JI7A 1QJEA 1STMA 1HXS1 2CGNA 1H4GA 1NQJA 1RUD3 4CCJA 3Q8CA 1FNZA 2A73B 2CV6A 4QQHA 2YPDA 3W20A 4Y5SA 1AL23 3HT1A 3S30A 4E2SA 5LBFA 5HV0A 4IE5A 2YGMA 4QXCA 3O1MA 3Q9OA 4UF0B 1U5XA 3DV8A 4E4ZA 4DXSA 3A23A 4YWAA 2IFRA 3I2OA 3KV9A 3QD6A 1RUH2 3O5SA 4P9IA 2CWMA 1UOGA 2AUYA 3OUHA 1RUF3 3V0AA 5CKMA 1AR81 4NPRA 2HLEA 1MQTC 1O8PA 1GP5A 2A5ZA 4RFT0 3VZNA 5CNAA 2J1AA 4JZRA 1GOGA 5L7OB 2AREA 2WO3A 1HW5A 1QJY2 2XOMA 4LXLA 3H3UA 1R083 2JG9C 3H8UA 4XW3A 4IEQA 5FY0A 1BEV1 1UZVA 2QTWB 1N3PA 1RHI2 1KFXL 4IGPA 1V6OA 1CX1A 2BJSA 1NCRC 1QMJA 1ZRDA 1HN0A 1ZBE2 3ACGA 3OB8A 1OSGA 2HH9A 2UWAA 3UKVA 1HRV3 4I01A 5L7OA 4YGCA 4P9WA 2V4VA 1VBC2 4W4ZA 1DCSA 1GP4A 1U5IA 4NR1A 4Y20A 5IWFA 3RMXA 4A6OA 1PIV1 4QKFA 1H8TC 1J3PA 1OXCA 5A3PA 3T09A 2Q1ZB 1Q43A 2NYYA 4QPGA 5EWSA 3A7QA 4RA0A 2VZ1A 4Q4X1 5DZGA 1NUKA 2Q30A 4K1YA 4H55A 1U0AA 1RYYA 2YY1A 4FCAA 2P17A 4MUVA 4UFHA 3UGGA 3APBA 4GD4A 1CZSA 5EQUA 2MEV1 1GZWB 4LR4A 5A33A 1IS6A 1OUXA 2JDUA 4KWUA 1RUG2 3U10A 5CFCA 2AC1A 2BNNA 1QXPA 2HWD2 1ZZCA 1GWKA 2P3KA 3MO4A 1YLLA 3PJQA 4UW6A 4FAHA 4AFMA 1ZRRA 1AYM3 1HB4A 1XNDA 5C8CC 2GC2A 2ZX1A 4LBNA 1UX6A 4R4XA 4RHV3 3LZZA 1GMMA 1JZ5A 4QB1A 5FCCA 1PO22 1XJAA 2A75A 2WFPA 2PHXA 4OHVA 4NMIA 5FMCA 2FDGA 3ZYRA 3ZXJA 4R9AA 2R0FA 2C5DA 2J1TA 3ZFFC 5JPNB 4MGZE 3PTRB 2NQYA 3VDDA 3LOIA 3NAPC 2BERA 4IUGA 3KM5A 5FY9A 1RUNA 4BISA 1PX3A 3EO6A 3MFCA 1GKBA 5K8SA 2YXSA 3BKZA 4UWDA 4C1WA 1PVXA 2PAKA 2EXKA 1MEC3 2RMU2 1X9TA 3WW2A 3ZFEB 1UZWA 1JZ7A 1O7FA 3ZYFA 3VKMA 2GAUA 2KR2A 1VRBA 1HRI2 1CR7A 1W6PA 5EJZB 2GMEA 1X8MA 3J4UH 2FDIA 2XHNA 3H8XA 3WNMA 1FATA 3H1MA 1AJKA 3POIA 4A3ZA 1D4M1 3VN4A 4ARYA 1BK1A 3UGFA 4LKSA 2HWE2 4FPJA 4BQ5A 1KFUL 4X6RB 3NNMA 1C5IA 5FMDA 5A7WA 3TBDA 2E63A 2ZA9A 4KWJA 3T0BA 1UPIA 5FXZA 1EV11 2UYAA 2XL9A 3GCWA 1NA1C 2X05A 4LULA 3I7DA 3H7JA 2IVIB 1KGYA 2XLFA 3RI9A 3POFA 5ACA1 4DUVA 1GUIA 3I2DA 5T52A 1ONAA 1YWKA 4QU2A 1VBA2 2VZTA 4BLJA 1UXZA 3K2OA 1W9YA 2Y6GA 4IEZA 5D8AA 5EXOA 3SMHA 4PLMA 4EN7B 3PUIA 4GMP1 2XBO1 2VTXJ 3H42B 5IAVA 5L9RA 2YROA 4FQ4A 2JDAA 2Y0OA 4NRMA 1PMIA 4OUMA 3O1RA 4CDUC 2WSUA 2WBKA 3O1VA 1HQLA 3C7OA 1E5HA 2X5IA 2XONA 2J1EA 1QHDA 2YB7A 4Q4Y3 5GLVA 4YVWC 3CJXA 4YNIA 4CP9A 3USUA 2ZGKA 1JN2P 1CAWA 4IEWA 4QXBA 5LB6A 3NW4A 4UXAA 5DABA 2VJXA 5FK8A 1UOBA 1UY2A 1A8MA 1RUI2 3RFRA 3URFA 1QH6A 3PUSA 4AEJA 1LECA 1R1A1 2CNAA 3HQRA 3I2IA 4AOCA 1TVGA 3RNSA 3WDTA 5ABJA 4HSJA 1RXFA 5JOWA 5FLHA 1WD3A 1WMFA 1PO12 1XRUA 1Z7S3 2PMWB 3BODA 1RJ8A 3MLKA 2ZMKA 3WNKA 1W8UA 1O91A 1W90A 1PK6B 4NIIA 3ETPA 4IV3A 4PBPA 1WBFA 3UK9A 2W46A 1UU5A 1CAUB 2DFCA 1NE6A 5KC5A 4FSJA 4OVEA 5B4NA 2IZWA 5C9AA 4ZZ5A 3BU0A 4URTA 5FTTC 1RUD1 4QKNA 2QJVA 3AP5A 1MS5A 3TB0A 3N35A 5FMBA 1O4YA 1Y3TA 1AL21 1GZ9A 1OA4A 1W8WA 2NLRA 1ENSA 1GWLA 4CCDA 4JDOA 1CAUA 2TBVA 2NPIA 4XILA 2B7YA 5E89A 2PN5A 2RE9A 2XKPA 2W94A 1R093 2A3WA 1VRH3 1RUF1 1WLWA 2FCVA 2WAAA 4BMEA 1SFPA 1X7NA 4PIYA 1MS1A 4EYUA 5A7QA 4E4HA 4UFLA 5JLVA 1OOPA 5A1LA 1BK0A 2GN3A 4OUSA 1UOFA 4AW7A 3EJKA 1R081 2OA2A 2BOJA 3CQOA 3NV1A 4JX0A 4OMDA 4RD7A 5EYXA 5F6KA 5BNNB 4XQ4A 3D0JA 4KMQA 2DUQA 4Q4X2 4OMCA 1VBD2 2GNDA 5HI0A 2VNOA 1HRV1 1JBCA 3O1TA 4Q27A 4B8EA 2R042 3WVJA 4E4SA 1B35C 5I0DA 3CF6E 5LA0A 3VDBA 3R4DB 3CHXA 4XJ8A 2MEV2 1DQ6A 2E9QA 5FJHA 5A80A 1XXNA 5BNNA 4ZS2A 5J48A 1XSRA 1AR92 1LOEA 2XKOA 1QKQA 4XJZA 5E1RA 3B9CA 4AQ6A 5FYZA 1C8M2 2FCUA 1BZWA 4XABA 3BTYA 1CD3G 3LIGA 4ZZ8A 3VHOA 4GIQA 4QT6A 1CONA 2PHTA 2C9AA 4UBGA 1BCXA 4JV4A 4AWDA 3FHQA 3HBZA 2OQ6A 3MGUA 3M7AA 3WNPA 2BTVC 3BPSA 4IESA 2A6YA 4WVMB 3E97A 3CMGA 3OBZA 4A41A 3VD9A 2RR11 4XDOA 1ZBA2 4YW4A 5FR3A 1KDMA 2BGOA 1AYM1 3CNAA 1XOYA 2E31A 1GP6A 1LGNA 2E51A 2ET1A 5FBZA 1XYPA 3KZ4C 4E27A 5I91A 1O3RA 5A3UA 4MXWA 4RHV1 2EA7A 4W6WA 4WVMA 2UY8A 3U1XA 2TEPA 3AKTA 4H7LA 4K1ZA 2ZGRA 2ZGOA 2UURA 3MIDA 1EUTA 1LU2A 1UQXA 1W28A 1OF4A 2WS93 3MIEA 1TNFA 1V9U3 4OCTA 5BNPA 4YGDA 3PMSA 3CBNA 4XQWA 2CYFA 5LK7B 1R64A 2YUEA 1VBB2 1YRZA 2VE1A 4EN0A 4CPBA 4NIAA 4XHXA 3ZXFA 4B4PA 1UMIA 3B69A 3AYCA 1MQTB 2XWBB 1UY3A 4QKDA 3WF3A 1OH4A 3NSTA 1MEC1 3WDVA 3USSA 2HYKA 3AKPA 1CZVA 4CCCA 4GQ7A 4NAMA 1O59A 3A4UA 2JG9B 4GH4B 1RUJ3 5LCWL 1SDDB 4CCEA 1NCRB 5A32B 3M2MA 2VQTA 2RM23 1SPPB 4LKDA 4AVCA 4I30A 4D69A 2P37A 4XOGA 3MIFA 2PHUA 5J1XA 5JWPA 1EV12 1W8ZA 5FXXA 4KBZA 2F6BA 1XYOA 5G04L 2JG9A 3N36A 1H8TB 2QBXA 3BOPA 3WUCA 1NCRA 3CEWA 3E6BA 1W3XA 3SH3A 1W3VA 1ULGA 3MV01 1F8VA 5C71A 2ZEZA 1M06G 2IXJA 4FI9A 4CXXA 5A7SA 3POYA 3WF1A 2B45X 2VCCA 3OGGA 2VULA 1LODA 1LGCA 1LU1A 1XSQA 3UETA 2JDYA 3CIHA 1K5MC 3B02A 3SCGA 4E2QA 1AX2A 3U11A 3NL1A 2W1QA 1H1MA 4K7JA 4L97A 2EVXA 4LOTA 2RDNA 2VXJA 2ZXQA 3WDXA 1COV3 5CFDB 4GB32 4M4PA 3IPVB 1A78A 1DG6A 2R1DA 4CU7A 2P3IA 2Z5WA 1AHSA 3GCXA 2C0ZA 2GH2A 2VQ0A 1W6NB 2HWC3 2WWUA 1A34A 2V5YA 3R0RA 4YM0A 3GBGA 1AJOA 1JZ6A 2K2SA 4KU7A 3PURA 5C8CA 4XCBA 1F31A 3NWKA 3AJYA 4AE2A 1QJX3 4C90A 3NAPB 1GICA 2G9GA 2R16A 2VMEA 3PUAA 1W2UA 2DDUA 2LS6A 2PFWA 3GF6A 4QX8A 3UJOA 2WN2A 4XCAA 5H9SA 3U14A 2DUOA 5JSPA 4K8RB 4N90A 5JZGA 2ZGMA 5GLZA 1QQP2 5DUXA 1Z7S1 1CX4A 1YQ2A 3IDAA 3ZFFA 2UY9A 1RUD2 4ASKA 1D4VB 4YZ3A 2P6CA 4LO6B 1RUE3 2WLPA 3R6SA 2D7FA 4IERA 5EV7A 3GGLA 3D4KA 3I54A 4OYUA 4XPVA 2J1UA 3KVBA 2LRPA 4XFFA 4FPHA 1WW6A 3PIJA 3DKQA 1QJU3 2QZ2A 3ZO0B 3MW2A 3ZPYA 5LA1A 1WGPA 4O65A 3HQXA 4ZU7A 1H2NA 3GNEA 1NLSA 4IEYA 1RVF1 2LW8A 2FQPA 1UPSA 3ZSEA 2TNFA 4FPOB 4N7IA 5FP7A 1S0BA 2VTFA 4LT5A 1R1ZA 3ZYBA 4OLLA 3FN9A 3RZHA 4HVOA 1NA1B 4CCLA 4EZHA 1R091 1HV1A 4L8QA 4G3YC 4XUNA 2WR9A 4DMIA 1IG3A 2J1SA 2ILMA 2P6HA 3GZTB 2AENA 3WT3A 3NJVA 4JKKA 3RYPA 2D6KA 3FE5A 4LBLA 2IXHA 1S2KA 1UYYA 3NQHA 5E6HA 5FYCA 3TRSB 2Y34A 1W05A 1YFUA 2PXJA 1UNBA 1CAVA 1X33A 1ZZ8A 1JOPA 5ANQA 4Y1VA 5CKNA 2XMLA 5FWEA 3Q8AA 4MGKE 2DURA 2YZ4A 4IDZA 4P00B 4AI9A 4XC9A 5B2GB 3RMYA 5KXCA 3ELNA 2QQWA 3WP6A 3N9NA 2OUHA 4YVWB 1BMV2 5CG9A 5FQ0B 2A6VA 5CA6A 2R072 1ZM1A 3WF0A 3LFMA 4IV1C 2QQPA 3T0AA 3QH7A 4QPIC 2C26A 3OSDA 4B7KA 1OQDA 2RJLA 4JC1A 1W8OA 1SQ4A 2YMZA 3FBYA 1QXJA 4CDUA 1UY1A 3PIGA 2JB8A 4YVWA 5LA9A 5JIAA 1FNYA 5IK4A 4OQ8A 4Z8BA 1VJ2A 5FLIA 4AZZA 4RR3C 1HXS3 1AR72 1QNYA 2R30A 4ZPIA 2VZPA 2B8MA 2OIIA 3F2ZA 4RYDA 4YSFA 4Q8KA 2Y38A 2Y6LA 1SDWA 1UXXX 2WFF3 4ZS3A 4AHXA 3WQ0A 1RL3A 2DTYA 2GN7A 2PTMA 4LUMA 4P9LA 3ZXGA 2VUCA 3I3MA 1O3SA 1XE7A 1LOFC 2ID4A 1VIWB 4RGAA 1O4TA 2ZCWA 3WQBA 1W03A 2BBAA 3BVCA 2WS91 3DXTA 2JE7A 3HJRA 1DZQA 2QVSB 2A70A 2XL7A 3N9LA 3ZFEC 5A70A 4LNVA 4LLFA 4CCOA 5FFOC 3M3CA 1DGRN 4O9EA 4A7KA 1GQHA 3CJIC 1W6OB 2VMCA 1CAXB 3CO2A 2VQAA 3ZPOA 2RDRA 4UI9L 3PU8A 5DG2A 2WKKA 3ZIWA 4QDRA 2D5HA 5DQ0A 5FYHA 3OBAA 4LO7A 2ZAAA 1RUJ1 2X53S 1YQ6A 4AG4A 4CPBD 1XB9A 3ON7A 4DRVA 4JHZA 4ES9A 2RM21 1LOBA 2VNVA 4QPYA 5FP9A 5I93A 1JUIA 1T2XA 1JS9A 3OBRA 1RINA 1UKGA 3POJA 4QHOA 5FY8A 5DG1A 5FY7A 1FYUA 3OYWB 1OD5A 1B35B 1S2EA 3ZYIB 2A3XA 3I2KA 1OH3A 2BFUL 3ACHA 4XTPA 4CP1A 3GZAA 4WM8A 2P1BA 2EICA 2WUHA 4AVBA 3HVDA 3W9AA 4IEPA 3ILFA 1TNRA 4FFHA 1G7YA 3U0ZA 4WVWA 3WSOA 4XE9A 3WZ1A 2CU5A 4Y26A 1WCUA 1J3RA 4HZFA 1B35A 1XE0A 2DYCA 2DU0A 5C33A 5JOXA 4IXLA 5F8PA 1NLRA 1KRIA 3J7MA 4NWWA 1KXGA 1N1SA 1YXWA 4LORA 2R061 3WCRA 5FZ4A 4Q4Y2 2YYOA 3D6EA 4ZHNA 5DUUA 4TLFA 1COV1 2D3PA 1DZTA 3K4DA 3POSA 5JOZA 4FP2A 4MGQA 4XJUA 3PMEA 3PTYA 3BIEA 4A3XA 5CG8A 1K45A 1W2OA 2VU9A 3QACA 3VD5A 4FFIA 2QKDA 4QPWA 2ADDA 5F5IA 3KHBA 1T6GC 2H6BA 4QM9A 3VD7A 2W3JA 3O14A 2IXLA 1IQDC 4LK6A 1QU0A 4OI0A 1LTEA 2MNGA 4HK9A 4BQXA 3TEWA 3H8OA 3FMGA 4JGZB 2GSYA 1EUUA 1QJX1 3OY8A 4XF3A 1S0FA 4LJHA 2QDNA 3I2FA 2BGPA 3MHZA 1AF9A 5T55A 3T4HB 3ATGA 4XJ9A 4AEKA 5KHIA 1PK6C 3TNQA 4JVAA 4BHPA 4QX0A 3MW4A 1V6MA 2PLV3 2GDFA 1UU4A 4HXCA 4HKOA 1HJGA 1VBE1 1VPHA 4D7TA 1TMF1 2V09A 4QWNA 1UYPA 2C24A 2VMFA 1SZBA 4LO8A 2N7GA 3ETQA 4C91A 5DAPA 1REEA 2VOTA 3KT1A 3O1PA 1W6MB 2J22A 4GXLA 2GC0A 1PVC1 2JIJA 3DCQA 1PGL2 4QX5A 3P6BA 1H2LA 5FY4A 3TEYA 4FFFA 1ZA7A 1R092 4ATEA 4JCKA 1VRH2 3OGSA 3FX3A 4M3CB 2XVGA 2Z4FA 1N3OA 1YFWA 2X09A 3DPRB 3LD8A 3ZYPA 2AYHA 4HANA 4XF0A 3BYWA 3ES1A 5LEKA 1W2AX 1W6QB 2RS11 2Q4SA 2VCBA 3FBMA 4PDWC 3VZOA 2EXHA 1KQRA 3N3HA 1Y9MA 2ZGSA 4JGYC 4Y22A 1UIKA 4P9GA 2ARCA 4RFRB 4M3CA 4BU2A 1DIWA 3FWEA 4P5YA 2QQOA 3D3AA 4A7YA 2RDQA 3O12A 4LK7A 4WV8A 4Z2WA 4D8MA 2ZAHA 3RG0A 1SFNA 4A44A 5C8WA 4Q8LA 3ZMNA 4Y1ZA 3KQRA 4NRQA 4AQTA 3RRDA 4KL1A 1YYNA 4RQPB 1TME1 5G05L 3BGAA 4XEZA 2OW4A 3IMMA 5DN2A 1YQ5A 4XDPA 1K5MA 1ND2C 2Y6FA 3H3ZA 4AGVA 1N1YA 4NHLA 3EQEA 4XFIA 1PM4A 5T5JA 1C1LA 1OUSA 3ASIA 2VW1A 4X8NA 5FYVA 3WDWA 5HBAA 4NIGA 1R1A3 1POV0 4XETA 4RS5A 5A6QA 4DINB 1IS4A 2B9VA 3VBHA 3VZMA 3KF3A 4NO4A 2W91A 3K3NA 2LUWA 5I0RA 4PCRA 1VLNA 3QBQA 2VXRA 3ZX7A 4I3GA 4FVVA 1ULEA 5FKBA 4COVA 4I09A 2Z69A 3TEXA 4CDQC 1MVQA 4HKLA 3ZVXA 5FXVA 5FDBA 1JZ4A 3BIWE 3SITA 2XXZA 5JMCA 1ND3B 4Y1YA 2PAEA 2GNTA 1JTZX 1DDLA 3P1IA 3VBUB 3U78A 2BFUS 2OPKA 2ORXA 2WFF1 3OGRA 3ZYHA 4W8JA 1V9U2 4QHZA 4R4ZA 4YZ5A 1PGSA 2JJ6A 4FPLA 1CQ9A 4DB5A 1OF3A 4G4FA 5JI9A 3C7GA 4Q4W3 5FZ0A 4CYDA 2WYSA 3BB6A 4COYA 1X50A 2XJUA 2AR6A 1F35A 4CU9A 4N9IA 4W6XA 5J37A 3BI3A 4S2GA 3J8F3 2HBTA 4KBBA 1RUC3 2WYFA 3FZ3A 4MHRA 1X36A 4UF0A 1CPMA 5F5AA 5FZIA 5KXEA 4B7EA 4GH4C 4MGIE 3LIHA 4UOJA 2P3YA 1Z78A 3K75B 2ZABA 4IGQA 5JOYA 3EHKA 3KT4A 3TNPB 2Q5TA 2JXAA 4GKYA 2WNUC 3LB9A 4AF9A 4DUWA 2RS52 2DUPA
chains in the Genus database with same CATH topology
3JZVA 1M4WA 1G6NA 2FZ1A 1YCIA 3FUOA 4PLNA 3OD0A 1BBT3 1NCQB 2I45A 1FMD3 1ASJ3 2ZGTA 3ALQA 3AP4A 2WT1A 3D0SA 4MYEA 5FPXA 2XVLA 4ITCA 1SEFA 2MHFA 3WG3A 1A3KA 2DVFA 1HDKA 1S55A 2XPJA 4XDQA 1WMEA 1PM7A 4IV1B 3POWA 4QPIB 2B9UA 2WLQA 1EP0A 2Y26A 1WMDA 3VKNA 2RR13 2AGSA 5CFDC 2Y0IA 1SLIA 3EXUA 4AGRA 1ENQA 1GZWA 5A32B 1YHFA 4QMAA 4RR3B 4HVQA 4QPIA 2HWF3 1NY72 1S1AA 1PNGA 3O0VA 2HWC2 4F83A 1SCRA 3ZXLA 1BYHA 4HVRA 1PGW2 1DGWX 2JKBA 5DUWA 2DF7A 3WD5A 2WNVB 3LA3A 4RR3A 1SACA 4U2AA 4YLZA 3ZXDA 1CGPA 3MPBA 4LEJA 5GLWA 4KGQA 4ZXKA 3TAYA 4LBKA 1C5HA 4R8HA 1CJPA 1OA3A 2OUJA 3NJZA 1RUE2 2D6OX 2UYBA 1LOFA 3CJIB 3HAGA 1UKRA 3VBRB 1ENXA 2PYTA 4YVSC 2PLV1 5KXBA 2JEMA 1QJU2 5DDJ1 3VLBB 2ATFA 1OFNA 4YW5A 3ZFEA 4OI4A 3CJIA 1UL9A 4OHXA 2GU9A 3AZZA 2I74A 3ZSJA 2WT0A 4I0WB 1O4ZA 2BW8A 3AJZA 1DHKB 3O7OA 4FXKB 2KA3A 3ST7A 4Q0SA 2RS33 4WM7C 1NZCA 4KGGA 1AYN3 3M8LA 4CDWC 1PNFA 4KH9A 3PVNA 3FLTA 3KS7A 4JRLA 3T1MA 2LTNA 4Q0VA 3U07A 4XQDA 5L73A 4BA6A 3LOBA 2W0XA 4E4DX 3E6DA 2AZ5A 1FOD3 2FHRA 1IS5A 1YI9A 4R9DA 4J6GA 4ZKTB 3LAGA 3OBTA 4EWDA 2BUKA 4CEWC 5DZFA 1FV3A 1HXS2 2Z2SB 1G9FA 1DYKA 3SCFA 3JBG3 2XJSA 3JD73 2G4IA 3ZN6B 4RL7A 3RSJA 1GNHA 2ZX0A 4UW4A 4XBNA 1G9BA 4Z92B 2UWCA 1RMU3 4OZXA 2ZS6B 4MZUA 3VBFB 1S2BA 3ME2A 4HPKB 4F8AA 3IIAA 3VHRA 1AR82 4N43B 2RHPA 1RVF3 1PK6A 1I5ZA 2JG8B 4H14A 4CDXB 5JSOA 4QGNA 4BE3A 2KM2A 5JIUA 4D94A 3VBSC 4Q4W1 1ULFA 3D82A 4S2DA 3NV2A 4LTAA 1JHNA 2I07B 1BEV2 5I8TA 4QD2A 1AR61 1D0GA 2A7AA 4PDWB 3J8F1 1RUC1 1WLTA 4GULA 4JGYB 2E7QA 5I0UA 5A3MA 1PIV2 3IBMA 4M0NA 3VV1A 4HK8A 1DQ1A 1O5LA 1SLAA 2BVVA 2EXIA 3MIBA 2Q0AA 1BBT1 1AX0A 1FMD1 1ASJ1 1V6IA 3JB4C 2EALA 1C4RA 1ND2B 4GWNA 2CGPA 4PBOA 1XU2A 5C4WC 3LA2A 4IEVA 2WIIB 1LCLA 2IXIA 4XBLA 1ZRCA 3ZN5A 4Y1XA 1ND2A 2WZR3 2F4PA 4AEDC 2ES3A 1LHVA 2JD4A 2BNOA 4LBQB 1V70A 2DWRA 5L19A 1WCDJ 4IEOA 2OZJA 2X8KA 5AC93 2I2SA 4CDQB 2LALA 3AFGA 1IPKA 1IKQA 4M3CE 4NWVA 2CGOA 2HWF1 1PZ9A 4QQPA 1AVBA 4FTEA 1Z0HA 4F7ZA 5I0SA 2XUMA 2BQPA 1DBNA 3AP9A 1DYPA 3WW4A 5F9TA 3MPPG 3N4MA 3LWCA 3WQ7A 2XWJB 5JCTA 2ZZQA 4MLOA 1CESA 4Q0PA 3PVOA 4JGZC 1NXMA 2ZGNA 4L11A 1U5ZA 4L2NA 3WNXA 1VB2A 3UKNA 2W68A 2PLV2 3BTAA 5SV8A 3FJSA 4L9BA 5GM0A 4AI0A 3B5LB 3WP5A 4HKWA 3OTFA 4NVPA 4W65A 4B29A 1V6NA 4OHYA 1D4M2 3WQ1A 5JDBA 1J1TA 2ZX4A 5AFBA 1DZRA 1MQTA 2XJTA 3MDPA 1EY2A 2WNUB 3AMQA 2PHDA 2H6CA 4XF9A 1N1TA 2PHWA 1GFF2 4GH4A 4XTMA 1UMZA 5ACA2 3DPRC 2VVEA 4KG8A 1GBGA 3KSCA 3AB0A 4BLIA 2BYVE 3PVEA 4Q4V3 2XBO2 3HIFA 1DGRA 1H8TA 1RHI3 4I0BA 5E88A 2RS31 1ZBE3 1WLDA 1MZFA 2R063 3VKFC 3N7KA 1AYN1 1CVNA 3U4XA 4O9GA 5H9QA 4RQPC 5T3NA 3S7EA 5KHKA 2IWGB 1WLCA 2PQQA 3TN91 3VL9A 4AI2A 3B01A 3WUDA 4AVVA 5E8AA 3ZFGB 2XJRA 3L2YA 2YGLA 1R1A2 4BOWA 4N7UA 5CFDA 3SISA 3IPVA 1FOD1 2CTVA 4AFDA 1DU3D 1DGLA 2DCKA 3IDEA 2GZWA 3KCXA 4MGYE 4AXOA 1HIXA 3FFZA 2R32A 1MZ6A 3E5QA 4G9SB 1W6NA 1GR3A 2A6ZA 2HWD3 4OHZA 1KJLA 3BU7A 3LKJA 1KDKA 2ETEA 5BUVA 3WV6A 1VBE3 3AKSA 3VHPA 3JBG1 3JD71 1TMF3 3BOWA 3JB8A 1GV9A 3SXWA 4AQSA 3IMNA 3NAPA 5J3UA 1ND3C 1AL22 5HXVA 1PO23 2NN8A 4YVSB 4EROA 2O1QA 3PLQA 3VBUC 5LEJA 4HMZA 1RMU1 1PVC3 5GZCA 5DUVA 2JX9A 2E7TA 5I0TA 1VB4A 4COWA 4BZ4A 4FPKA 3B00A 1QGLA 1RUF2 1X82A 2WJSA 5CAZA 1ZRFA 3M1HA 3ENRA 5CB7A 4GWMA 4E2GA 4P5HA 4AI8A 2RS13 3VKOA 3DGTA 2RMU3 2ZZJA 3JUUA 2D40A 5I8SA 1NOVA 1R082 1NYWA 4YFZA 2E6VA 2WZPP 3RDIA 4V1PA 1HRI3 2ERFA 3DF0A 4YZ4A 4WM7B 1OHFA 3THTA 3O0WA 1HRV2 5GLUA 3R4SA 1SLCA 2VNGA 3KD4A 3ZIXA 5J98B 2EXJA 4AK3A 4ASLA 1NA1A 4DQAA 4QGLA 5IK5A 3H1WA 4CDWB 4ORFA 1TME3 4YGEA 5H9PA 4XFCA 1NCQC 2HWE3 4FPYA 4WM7A 2XJVA 3RYRA 3WHTA 4GALA 4IL7A 4BMBA 3IDCB 3MI8A 5E16A 3AYEA 1ALYA 2OYZA 3VZJA 4EJRA 3HT2A 4QPGC 1QOOA 2GH8A 4LA2A 1W0OA 3VGIA 1VBA3 2ENRA 2RR12 2EAKA 2VNRA 3H50A 4CEWB 5FQ0A 1AYM2 1AXKA 3KCCA 1AUYA 2D97A 3MLLA 2WZR1 3B9IA 4UW3A 2DCZA 4RHV2 2OZ6A 4BPZA 5AC91 5CFCC 2NZ9A 1I6XA 2WNVC 4QQ2A 5FLJA 2BWCA 1DFQA 2WA3A 5BNOB 1YIFA 1TEIA 4P9XA 1QOSA 1APNA 1UN1A 4JAAA 5F6LB 1ENRA 1FPN1 4FAGA 1MEC2 2BVBA 3VBSB 1PO13 2BPA2 4EN9B 3OGJA 4DY3A 2D93A 3VBOB 1VAMA 1N3QA 3ZSLA 2XJPA 2UWBA 4Z07A 3VBRC 5KBFA 4JTOA 1SMVA 4IEUA 4N53C 3A0NA 4PQ9A 3VBSA 2GNMA 2C1FA 4E9KA 1UZYA 2D44A 1ZA4A 2WA4A 1W6OA 2TUNA 1AXYA 1CAXA 4GA9A 4HN0A 1MS9A 1LHUA 1IZ3A 4MVTA 1ULCA 5HCAA 5FO8B 4PIXA 3ES4A 2PHRA 4QXKA 3FHIB 2GNBA 4H7MA 4BCUA 1X8EA 1CPNA 1RUH1 1TQ5A 2B39A 2XLAA 2XVKA 4AGGA 3KB5A 3UKTA 1XE8A 1H9WA 5C4WB 1POV3 4Q4V1 3TWIA 4FO9A 3OYWA 1OKQA 1QJY1 1E57A 5HCBA 4LO5B 3HWJA 5BPXA 1RHI1 2FMDA 5JVVA 3K48A 4LE3A 4CZSA 3PHMA 1ZBE1 4PF5A 4AEDB 1Q8VA 4AQ2A 2BNMA 3ZN4A 1F9KA 4JDMA 4ONUA 3AXEA 4MXVA 3VZLA 5D8AC 1W39A 3MF9A 4YW1A 2R043 2Z42A 4D7YA 1VBC1 1PZ8A 5KHGA 3OCPA 3IM0A 2ZGUA 2W39A 5LK5A 4ISRA 1SCSA 4Q29A 3JQWA 1YIPA 1H2MA 1N47A 1AR93 1RJ7A 2GC1A 1LEMA 4KU8A 4DNYA 3CLPA 1BKZA 1MZEA 1FX5A 1C8M3 4AFAA 4K21A 4R9BA 1Q8PA 3AZWA 4OHWA 3WR0A 5GKAC 2K0GA 1Z7S2 1I3HA 3GHMA 4DFSA 3JD72 4OI2A 4HT1T 4YZ2A 1RUG1 2ZHKA 3H9AA 3G7DA 1JW6A 1LESA 1PZ7A 3ZMOA 2HWD1 1ZNPA 5ABJC 2DVAA 2HWB3 4FPFA 2MPFA 4BYYA 3RS6A 1UIJA 2A71A 1YJKA 1YO8A 4D3WA 5DDJ3 4DXZA 1A8DA 4JGZA 1BVP1 3EBRA 1ZZ9A 4M00A 1BJQA 3VBFC 1RVF2 2D3RA 5KHHA 1UAIA 1PO21 3WG4A 4B4QA 4N43C 2VH9A 1LHWA 1QXRA 5GZGA 2JG8C 4CDXC 2D98A 3B7MA 3AYDA 3FFQA 1H0BA 1OMIA 2R49A 3V0BB 2VG9A 1VBB3 3DUIA 1GANA 1WCSA 5KC6A 1EPZA 1W6MA 1N1VA 1D2QA 2A6XA 2RMU1 3ZXAC 4KWKA 4BWOA 3WG2A 1SLLA 3FC0A 5FOBB 1SFYA 3DPRA 1HRI1 1V6LA 2PHLA 2ZTNA 4WVZA 3WG1A 3NV3A 4U36A 1W6QA 4A2UA 5GALA 2ZHMA 2DVBA 2YDEA 1REFA 5CBLA 1H4HA 1NE4A 3KGZA 2DVGA 1VAVA 2HWE1 3WP4A 1RIRA 4K40A 1HLCA 3D5OA 3N7LA 3HN1A 3I59B 3HMYA 1FT9A 4I3PA 4RQPA 3ZDSA 4UBHA 3J26N 4DS0A 3GBFA 1LKNA 3AMMA 1MACA 2WZR2 2IXCA 2GC3A 4XFGA 4YZ1A 1D0HA 1VBA1 3OJBA 4Y4YA 4LHKA 2LM3A 3W59A 2DCJA 4KQ7A 3WLUA 1S0GA 4FP3A 2ZGPA 3NVCA 4HBNA 4AEMA 3OF1A 5IK8A 2EAAA 4GB33 3RZZA 1NQDA 1LOAA 1DQ4A 1JOJA 1I1EA 5TSWA 3MF6A 3ECQA 3SHRA 1Q3EA 2XB6C 4LA3A 3ZYJB 5FAXA 5K0UC 1KJRA 5JPMB 1CJDA 2WS92 1PHMA 1S0IA 5K7PA 1QWRA 2BBVA 4ATFA 1RUI1 3QLQA 2ZACA 1ND3A 3R05A 2UU8A 4XBQA 1AR63 2VUAA 3VBUA 1YFYA 4YW3A 1QQP3 1PO11 4YRDA 5BNPC 1C3HA 4AVAA 4AFBA 1RUJ2 3V0AB 1ZVFA 3S0MA 2B5HA 5AFEA 2D6PA 2RM22 3H1YA 1VAKA 4OI1A 3AP6A 2O8QA 3THPA 3LA7A 5JR7B 5GZFA 1BXHA 3TYJA 5T5PA 3I8TA 4IEXA 2EIGA 2XHKA 5T50A 2ZMLA 4Q4V2 1UF2C 4META 2O0OA 3AFKA 4K20A 1D2SA 4Y20B 2OVUA 4I02A 4QPGB 1V00A 1NCQA 4WZFA 4KWLA 2R062 1G8WA 1URXA 1XU1A 5DZEA 3NV4A 1POV1 1WW5A 1SBFA 2ARBA 3M3IA 1LRHA 3WCSA 1COV2 2NP0A 1LOCA 1OFSA 2Q8OA 5A33B 2D43A 2ZHNA 4IV1A 3UL2A 1OPMA 1VBD1 4M3CF 3ZFGC 5CFCB 2R041 3AK0A 4FOWA 1IOAA 2VOXA 4AHWA 3CL1A 5AVPA 3P3NA 1RUOA 2WSVA 4GMP0 2R073 1DLLA 3ILNA 4ISQA 1AR91 1QJX2 5A32A 2VVFA 5JAXA 3ZXKA 4QGMA 2B46X 3WINE 1OPOA 2R1BA 1C8M1 3SNMA 5F1RA 1MS3A 3AZYA 1IGOA 3AKQA 1XNBA 1QJZA 2QFEA 2WNVA 1VBE2 3I4IA 5D1IA 1TMF2 2BEOA 2DV9A 5C6CA 1AR73 5F5QA 4XJWA 2VECA 3VDDB 4FOVA 4DRRA 4Y1UA 3J9SA 1ZBA1 2HWB1 1BQPA 1UZZA 2VW2A 5T54A 1PVC2 4N53B 4YG6A 5JZGC 4LBJA 2ZGLA 3SLIA 5KWRA 3SCHA 2HEWF 4P9YA 2ZHLA 1OI6A 1MS4A 3NKTA 3MW3A 3VBRA 1W6PB 4FT8A 1WD4A 1VALA 1ZYBA 2RS12 4N53A 4Q2FA 3MIGA 4AYUA 4TSVA 2R6QA 3HD8B 1VBB1 3WDYA 1Q56A 2JDZA 2YPJA 3LCPA 1AX1A 3WHUA 4PIZA 1LEDA 3E6CC 1TME2 1H1AA 2RJKA 3GHNA 2E7AA 4S2HA 3TN93 4SLIA 3RYKA 5L36A 5D8AB 2FMYA 1XQNA 5FO7B 4MX3A 1G9AA 1W0PA 1IS3A 3VL8A 3RPQA 4CEYC 1KS5A 3V65A 2X5IB 3C3VA 4J1WA 3N7MA 5T5OA 4XMAA 3VHNA 1NXD1 1O3QA 3BPZA 3DL3A 4XIKA 3USUB 3W58A 2NM1A 1CAWB 4HFSA 1CN1A 4ZU5A 1IHMA 1JXNA 4Y24A 3BCWA 3MIHA 5IK7A 2ZMNA 1SBDA 4JQRA 5ABJB 1G86A 2WFF2 2XGXA 4GB31 5EYYA 2KXLA 5JSRA 3KMHA 4OFGA 3QH6A 1NG0A 4ZU4A 4IV3B 5BNOC 3WY6A 3ZN6A 1V6KA 5C9AB 3C2UA 1REDA 5SV5A 4C0HA 2WINB 2BGCA 3DKWA 4XFHA 3RJ2X 4Q1PA 4EWEA 1Q5OA 2BWAA 2ZJCA 3VBFA 3VBOC 4DOUA 4HPKA 4NHKA 4N43A 5CVRA 2JG8A 1JH5A 2O8OA 4CDXA 3RQ0A 1QQP1 3T1LA 4FOQA 1ULDA 1EAH3 1QDCA 1GSLA 3GALA 2Z79A 1H9PA 4YM2A 5BNQA 2A6WA 3IDBB 3WP3A 1I9RA 4KG0A 2WQZC 4PDWA 2IXKA 2VGDA 1OOPB 4JGYA 3RWNA 5BXXA 3ZXEA 2PELA 3R4UA 1J3QA 4M01A 4EWAA 2ZKNA 3ZYGA 1IQAA 4FTSA 4HSLA 1YJLA 2SBAA 3JU9A 3H7YA 1RC6A 3AP7A 5FMOL 1OLRA 2HEVF 3PJYA 4WM8C 2A3YA 1OQ1A 4YG3A 2PAMA 3S7IA 2X29A 3ZSMA 4EN6B 4DZGA 1J58A 4N9HA 2VY0A 2JECA 4FXGB 1WA4A 4XXAA 1ZX5A 4YW2A 4LHNA 3CU7A 2ET7A 5K9YA 4CTEA 4RSUA 4XJAA 1YFXA 4NN0A 3M3QA 4FPCA 4LBQA 1AZDA 2HKXA 4XFAA 4MV2A 4EN8B 1LHNA 2WNEA 5K0UB 1BMV1 2QCSB 2VOWA 1FPN3 2R071 4CDQA 4TZDA 2DFBA 1BVVA 3KCYA 4MXWB 1AL0G 3NKGA 5LRSA 2EF6A 4L99A 2CY6A 2HWB2 5K0UA 1A6CA 5DDJ2 5BNPB 3B94A 1AR71 1QF3A 4ES8A 1S0CA 4BIOA 5FRAA 1WBLA 2IFWA 2QDRA 1KS4A 5J7MA 3AZXA 1RUH3 2ZBJA 1S0JA 1HKDA 5EJ3A 1SLBA 1Q8OA 3H0OA 2WNUA 4AHYA 4R52A 3M70A 4NOTA 1H8VA 3WX5A 1QJY3 2VPVA 3N7JA 4H3WA 3X29B 2P3JA 1UU6A 1GLHA 4JRAA 1EYBA 2AH2A 2FZ2A 1LJ7A 1MVEA 1EPWA 2RS53 5EFUA 4FOYA 1VBC3 4JDNA 2ZOEB 1MS0A 3TOJA 2QE3A 4YARA 4LO4B 4L92A 4C1XA 4Q1RA 4AFCA 4QHBA 2D5FA 1GYKA 5T5LA 2DTWA 3L9JT 4BH9A 3OPZA 1FAYA 1QOTA 2P34A 1F5JA 3FLPA 4A7ZA 3ZFGA 4Q26A 3UJQA 1RUG3 1JUHA 3WDUA 4AHZA 2DCYA 4P9JA 4XMIA 2FBEA 4RS5C 3JCIA 3VZKA 1HQNA 5C8CB 3VBHC 4LLOA 4XFBA 1F2NA 4Y5Z0 5FPZA 1OQEA 1FXZA 1Y9QA 4Q4Y1 2VMHA 4YGBA 4I0AA 5JZGB 3UV9A 3IT8A 3ZFFB 4OULA 4SBVA 3M3EA 5IT6A 1SLTA 3BALA 4Q4W2 5KHJA 4Z1VA 1V6JA 2B42B 2XG3A 2W08A 3AX4A 5FMOS 1AR62 2GALA 3SH4A 4YVSA 3J8F2 3LSDA 4W6YA 3OD4A 1RUC2 4WBBA 2ZX3A 2ZPXA 1TE1B 1B09A 4P14A 1JYCA 3KGLA 3AXDA 3M4FA 1XYNA 4XIOA 1LB2A 4LBOA 2XJQA 5CIRA 3VKLA 1EAH1 3D8CA 3FUQA 5EZWA 4MH0E 1BBT2 1FMD2 1ASJ2 5GZEA 4HL0A 4UW5A 5J96B 2ZKLA 1XNCA 5KXDA 4CRQA 1PGL1 1JYIA 1C1FA 5L7OC 3IN9A 4FPEA 1YUDA 1CAVB 1VRH1 1Y7BA 3AMHA 4CDWA 1ZZBA 1H2KA 2CL2A 4INDA 1FV2A 5I8YA 4WZCA 4YM1A 4CEYB 4B4RA 3P3PA 4K9SA 2WT2A 3AZVA 1RB8G 3NO8A 3KLSA 1YNAA 4C0BA 2VOVA 1DQ2A 4IETA 2HWF2 3ZSKA 1LENA 4LBMA 4CDUB 2R0HA 4CEYA 3B93A 1RTVA 3AM2A 4YG0A 1IPJA 2D3SA 2Q1MA 4AVSA 3QOPA 4FQZA 4K6BA 1HX6A 3MLJA 4R9CA 2HJIA 4KNCA 4CEWA 5BYNA 1IKPA 1KITA 1U12A 1UD1A 1MS8A 2P2KA 1RUI3 3GBWA 4I2OA 3AYAA 1LR5A 1O3TA 1C57A 4QM8A 1FI2A 3RJRA 1KD7A 5AVAA 3E5XA 4XF1A 2VW0A 4LBQD 4Q0UA 5IUQA 3VDDC 5BNOA 2ZX2A 4J1XA 4YYOA 1C28A 1LGBA 3MICA 1H1IA 3V56A 4PLOA 1ZREA 4YM3A 3VBOA 1SBEA 2JENA 4CP2A 1H30A 1AR83 5CADA 2WWSA 1GNZA 2XLGA 2PA7A 1V9U1 3E5UA 3LGRA 4XF4A 3LSEA 2SLIA 2HEYF 4HLTA 4NHMA 1GZCA 4BIFA 4Q0QA 5FOJB 1OLQA 4DPNA 1QY4A 1BEV3 1DQ0A 2D6LX 4COUA 2RS32 4HN1A 4WVVA 2CWSA 1UCXA 1HQWA 1AYN2 3PVBB 1DQ5A 2VUJA 4BM8A 1ZZ6A 3HR9A 4WM8B 3ILRA 1PIV3 3WW3A 3TN92 1XNKA 1U5YA 4Q4X3 2CAVA 4FBFA 3AMNA 1WCKA 1VBD3 4B3NA 2VOKA 1S0DA 2YC0A 5C4WA 3PNAA 4AVTA 4COZA 2RS51 2V73A 3ACLA 2PHFA 1LHOA 1FOD2 2MEV3 3A0KA 1J59A 4AEDA 4BQ1A 4LUKA 4JTNA 1VR3A 2X5IC 2D6NA 5J36A 1VP6A 2DCTA 2WQ4A 4AI3A 2JE9A 3JBG2 4LE4A 3T2TA 3INAA 3GYDA 2DU1A 1DGWA 3WW1A 1ZBA3 2GMPA 3MYXA 1RMU2 4CP0A 4X8PA 1Q8SA 3OY8B 1G9DA 5DXDA 1NY71 1QH7A 1RGSA 2VVDA 2HWC1 2ARXA 2NMOA 3DN7A 1WUVA 4IV3C 4XHBA 1PGW1 1C8NA 4HETA 1DF0A 2K9ZA 5C9AC 1Q8QA 4DY5A 3GZUC 5HCFA 5GJ6A 1WW7A 2CAUA 5BV6A 4TWTA 3AMPA 1CIWA 1LOGA 1RITA 3JQXA 2ZGQA 4GKXA 3RI8A 2D6MA 1J1LA 4IQPA 4S2FA 1LULA 1EAH2 4XYXA 1RUE1 3V0BA 1D4M3 3FLRA 3MEPA 4LHLA 5LRRA 1F5FA 4RGGA 1UW8A 5H9RA 5GZDA 1QJU1 5BY5A 1O5UA 4Y22B 1OOPC 1EV13 1G9CA 5J09A 4D7SA 5FO9B 3VUOA 5ACA3 2VMGA 5A3LA 2JICA 2H0VA 3KT7A 4MSVA 4YFWA 1MZ5A 2QNKA 4GMP3 2XH6A 1ZZ7A 2XBO3 3AKRA 4Z82A 3WXPA 4ASMB 5BNNC 3G6JB 2E53A 3L2HA 1K5MB 1QDOA 2YV8A 4XZPA 2H0BA 3IWZA 3M3OA 3QCWA 3ROUA 5CU1A 5AC92 3I59A 4M0HA 5GLTA 1YI7A 4EV0A 4AI1A 4RS5B 2GMMA 2W52A 3B3QE 4K3UA 3S6PA 3VBHB 3IKWA 3MFAA 3O0XA 4TYSA 1Y43B 1WW4A 2VMIA 4PJYA 3SH5A 4K8FA 1GQGA 2QUOA 2IC1A 2WL1A 2YHJA 1S0EA 1HV0A 3V64A 2NMNA 1FPN2 2WC2A 1QNWA 1L3JA 5FREA 1AXZA 4F3JA 2QZ3A 4QQLA 3WOGA 4FPGA 4XXPA 4QQOA 1OA2A 1MR5A 2DVDA 3K51A 4X6QB 2G9FA 5JI7A 2CGNA 1HXS1 1H4GA 1NQJA 1RUD3 1FNZA 2A73B 2CV6A 4QQHA 1AL23 3HT1A 3S30A 4E2SA 2YGMA 3Q9OA 1U5XA 3DV8A 4E4ZA 2IFRA 3QD6A 1RUH2 3O5SA 4P9IA 2CWMA 3MZHA 2AUYA 1RUF3 3V0AA 1AR81 4NPRA 1MQTC 2A5ZA 4RFT0 3VZNA 5CNAA 5L7OB 2AREA 1HW5A 1QJY2 4XW3A 4FTBA 3H3UA 1R083 2JG9C 3H8UA 4IEQA 1BEV1 1N3PA 1RHI2 1KFXL 1V6OA 1NCRC 1QMJA 1ZRDA 1ZBE2 1OSGA 2UWAA 3UKVA 1HRV3 4I01A 5L7OA 4YGCA 4P9WA 1VBC2 3RMXA 1U5IA 4NR1A 4Y20A 1PIV1 1H8TC 1J3PA 2Q1ZB 1Q43A 2NYYA 4QPGA 5EWSA 4RA0A 4Q4X1 5DZGA 2Q30A 4K1YA 4H55A 1U0AA 2YY1A 4MUVA 4FCAA 2P17A 3APBA 2MEV1 1GZWB 4LR4A 5A33A 1IS6A 1RUG2 3U10A 5CFCA 2BNNA 1QXPA 2HWD2 1ZZCA 2P3KA 1YLLA 3PJQA 4UW6A 4FAHA 4AFMA 1ZRRA 1AYM3 1XNDA 5C8CC 2GC2A 2ZX1A 4LBNA 1UX6A 4R4XA 4RHV3 3LZZA 5FCCA 1PO22 2A75A 2WFPA 4OHVA 2PHXA 3ZYRA 3ZXJA 4R9AA 2R0FA 2C5DA 3ZFFC 5JPNB 4MGZE 2NQYA 3VDDA 3LOIA 3NAPC 3KM5A 1RUNA 3EO6A 3MFCA 1GKBA 5K8SA 2YXSA 4C1WA 1PVXA 2PAKA 2EXKA 1MEC3 2RMU2 3WW2A 3ZFEB 1O7FA 3VKMA 2GAUA 1HRI2 1CR7A 1W6PA 2GMEA 1X8MA 3J4UH 1FATA 3H1MA 1AJKA 1D4M1 3VN4A 1BK1A 2HWE2 4FPJA 1KFUL 4X6RB 1C5IA 3TBDA 2E63A 2ZA9A 4KWJA 1UPIA 1EV11 2UYAA 2XL9A 1NA1C 4LULA 3I7DA 3H7JA 2XLFA 3RI9A 5ACA1 5T52A 3I2DA 1ONAA 1YWKA 4QU2A 1VBA2 4BLJA 4IEZA 5D8AA 5EXOA 3SMHA 4PLMA 4EN7B 4GMP1 2XBO1 2YROA 4FQ4A 4OUMA 2Y0OA 1PMIA 4CDUC 2WSUA 1HQLA 2X5IA 5GLVA 1QHDA 4Q4Y3 4YVWC