2WNUB

Complex between c1q globular heads and heparan sulfate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
total genus 27
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuB00
2RE9A 4MSVA 4KGQA 1ALYA 2O0OA 2ZJCA 2JG8C 3WD5A 2JG8B 3AB0A 1PK6A 4MXWA 1JH5A 1C3HA 1KD7A 1I9RA 2TUNA 4MXVA 2E7AA 4NN0A 5HBAA 2JG8A 2R30A 4QPYA 5L36A 1TNRA 3ME2A 2R32A 5CIRA 1OQEA 2WNUC 4OUMA 2RJLA 4QQPA 1TNFA 4OULA 5BNQA 3URFA 4KG8A 1O91A 4E4DX 3B94A 4E4SA 2HEWF 1GR3A 3QBQA 4GIQA 4QQHA 5KWRA 1XU1A 2AZ5A 2JG9C 4N90A 4D7YA 1PK6C 3K48A 4DOUA 3FC0A 2RJKA 2Q8OA 1DG6A 2JG9B 2HEVF 1RJ7A 3QD6A 1OQDA 3L9JT 1D4VB 1IQAA 2WNUA 1D2QA 2WNVB 2WNVC 4TWTA 4RSUA 3TYJA 3ALQA 3K51A 1RJ8A 4HT1T 4J6GA 2HEYF 5L19A 4QQ2A 1U5XA 5KC6A 2QE3A 1C28A 3MI8A 2TNFA 4EN0A 4QQOA 2Q1MA 2JG9A 4TSVA 1D0GA 2QDNA 3V56A 1KXGA 4OUSA 3B9IA 1JTZX 3B93A 5TSWA 4F3JA 2OIIA 1U5YA 5KC5A 1U5ZA 1OSGA 1S55A 2R6QA 3IT8A 1DU3D 2ZPXA 4G3YC 2KA3A 2WNVA 2Z5WA 4G4FA 3LKJA 3TWIA 2WNUB 4DB5A 1PK6B 1WCKA 4MXWB 1A8MA 2X29A 1XU2A 4KGGA 4QQLA
chains in the Genus database with same CATH superfamily
4RFRB 2R49A 3IAPA 2ZEYA 4GMP1 5GZEA 2XB6C 4OQ9A 3ZFGC 4CCDA 3Q8CA 2RM23 2C9KA 4L92A 4LA2A 4HOOA 4GKXA 1PVC1 1ASJ3 3T30A 4EN9B 3ZXFA 4IL7A 4NRMA 1NCRA 3AVRA 4MXWA 4ZONA 4AEDC 2J1TA 5FY7A 3OY8A 3VHOA 4E8CA 3KV9A 2ILMA 1QKQA 2C4XA 5F3EA 3WUCA 1I9RA 1W3XA 2OS2A 3N36A 3OBAA 3ZYRA 3MGUA 1Q43A 5FMOL 3POYA 2BDRA 2B4KA 3WNMA 4NUBA 4QPYA 5L36A 3M2MA 3ME2A 5F5AA 2O1QA 4QD2A 3F2ZA 4NHKA 1HQLA 4UW5A 2D3RA 4AF9A 2W92A 5T52A 4CTEA 2I2SA 3DPRB 1OF3A 4PQQA 4BCUA 1PO22 5A3TA 1HRI2 1R091 2FMYA 2BZDA 2PFWA 3G6JB 4L97A 5E1RA 5IJRA 2DFCA 4ZU4A 4XC9A 5DAWA 1SEFA 4AGRA 2YFUA 1UY0A 4IV1A 3WW3A 2Y6HA 2A3WA 2HEWF 3POGA 1GR3A 1ZBE3 5T3NA 3SH3A 3VZLA 5K4LA 4QPGC 1LOEA 5J96B 5FZ7A 3WY6A 4KU8A 4NAMA 3ZXDA 1VBD1 2F4LA 3D82A 4L9BA 1GQPA 1AR81 3ZFGB 1JZ4A 1SQ4A 1W2AX 2PHFA 3GBFA 3SXWA 3J8F1 1C1FA 3J8F2 3VV1A 2VMGA 2W95A 2P1BA 2RJKA 5JDBA 4XEZA 2C1FA 3KV5A 2D6LX 2WFPA 2Z4FA 1HX6A 1OQDA 4B1MA 5FFOC 2MEV2 3DKWA 3ACLA 3I3QA 1N1YA 3U0ZA 4CEYA 2RG4A 1GQGA 3KLSA 2NM1A 1UIJA 4RQPB 1JU4A 1K3IA 4LHNA 4TWTA 2FD8A 5H9SA 4BXFA 4FQZA 2BV4A 1WLCA 4R52A 1HV1A 3MUZ1 2D6MA 4KH9A 5IVYA 3O1OA 1DYKA 3H8OA 1OOPC 2BPA2 1CAXB 3GDBA 1UX6A 4WM8B 5T54A 1ENXA 1R092 5DUWA 5HI0A 3N9OA 5CKMA 2JDHA 5BNPB 1QMJA 3OTFA 2RS32 3GCXA 3IDAA 5FWEA 1QDOA 1UKGA 3W59A 1F4AA 3WZ1A 3ZFGA 4CCOA 3POBA 3T0BA 3ZSJA 2ET7A 1F4HA 4JTOA 4MG2A 1UY4A 1MS9A 3GHNA 3OGRA 4QM9A 1ZM1A 4HVQA 1WMDA 4PDWB 1LHVA 3JQXA 1AR71 2XG3A 4QPGB 5FY5A 1LOGA 3B93A 4LUKA 1VMHA 5HCFA 4BK4A 2W46A 1URXA 3UKVA 1PIV2 3AKPA 5LA9A 3NO8A 1WMFA 2VCMA 1F35A 3I4IA 4NPRA 4BYYA 5ABJA 3WNOA 1LJ7A 3TEYA 2WAOA 5ANQA 1CAXA 4Y20A 2DURA 1RUG3 3KQRA 2YBSA 4DB5A 1NCRB 3NRUA 1C4RA 4MXWB 1ENRA 3ZXLA 1JOBA 5FY9A 2YUEA 4BDVB 1MZEA 3AP5A 1YFWA 1YJKA 3POJA 1A6CA 1LU1A 4OHVA 4QKFA 4Y22A 4CSWA 2LM3A 3K3OA 5FBZA 4C0HA 3UGHA 1E5RA 1UZWA 3KGZA 2WFF1 5FZ1A 1XQNA 3HJRA 4CRQA 1FV2A 4XQDA 1LTEA 3EYPA 1AL21 1D0HA 3O5SA 1RUI2 1UN1A 4XMAA 1D4M1 3MV01 4AI8A 5C4WA 2BWAA 4FP3A 3ACHA 1HRV1 1S2EA 2VZ3A 2JEMA 1WD3A 3U4SA 3LFIA 4TZDA 1FOD2 5C6CA 2WN3A 2GSYA 3SITA 4WM8C 3ILRA 2VE1A 4M4PA 1PNFA 3FE5A 3OGJA 2VCCA 1UOFA 3SKVA 5IAXA 1POV3 4ZS2A 1W90A 1GP5A 4Y1XA 1T6GC 4GH4B 1HQWA 5FYIA 2CYFA 3TAYA 2ETEA 3R4SA 2QQVA 5E16A 3ZXEA 4YFWA 2QQNA 3DN7A 1VJ2A 5FIXA 5FZFA 4NOTA 3AZYA 4OUMA 5ABJB 3VBOB 3NL1A 3QH6A 1MVEA 3OPZA 4FI9A 3NV3A 4XPVA 3OEAA 1X7NA 3I54A 5APAA 3OBZA 5DAXA 4MHUA 2WZPP 4ZPIA 1EV12 1VBE1 3WOGA 3B94A 5JCTA 3JD73 3ZYHA 2FHRA 1IG3A 3B69A 4EN7B 1Z7S3 3GZAA 5JUVA 2JE9A 1J3PA 2RS33 1TVGA 1S0IA 3MIEA 3ZXAC 1LHWA 5CEHA 1OH4A 2RHPA 2WS91 2AZ5A 4IUGA 2RMU2 3LA2A 1NCRC 2PHXA 4HLTA 5FPXA 1DLLA 1MACA 2JECA 2VMIA 2YDEA 5FK8A 3T1LA 4JRAA 5IWFA 1LR5A 1YFXA 4PLNA 1COV3 1QNWA 5IW0A 4NHYA 4DOUA 5IVCA 3PTRB 4CUGA 3OGSA 3WDUA 1IS4A 1RUI1 5J09A 1DGWX 3ZFEC 5CFDC 1X50A 3AXEA 4BU2A 1J1LA 3AP4A 5C3PA 3NQHA 5LA0A 4K6BA 3E5XA 2CY6A 2WZEA 3PUIA 3ACGA 3V65A 3BODA 3HNMA 3Q9OA 1HN0A 3K75B 4ZZ8A 3S0MA 1FOD1 4BA6A 2KXLA 4MV2A 1BVP1 3SISA 1LOCA 4B29A 5A6QA 4P9JA 4P02B 4AEMA 4LKFA 1VBA1 3GJBA 4YW5A 1VBA2 1VR3A 2XONA 4MVTA 3MF9A 2DVGA 3IB3A 3JU9A 3M3OA 2ADEA 3EQEA 5JVVA 3JB4C 5FZOB 2VMCA 2YBPA 3AP9A 3D4KA 2XKOA 2VQTA 1PZ7A 4Q4Y3 1I3HA 4BLIA 2OA2A 2AEYA 2OIIA 3MIBA 1WBFA 3CJIA 5A80A 4CDUB 4DPNA 4OI4A 3BTYA 2YU1A 5FPUA 3K4AA 3LFMA 3M3QA 3MPBA 1Z78A 3GHMA 5A7WB 2G9FA 1HXS2 4FAGA 2ARXA 4G4FA 1S4CA 5F2WA 3E97A 4PT6A 2F4PA 4CE8A 3DPRC 1E5IA 1UO9A 3LA7A 4CDWA 3HBKA 1AR91 1ND3C 3ZN6B 2ZGOA 4PLOA 2K0GA 1REFA 4DS0A 1W8WA 4AI9A 4DXSA 2ZGTA 1QJU2 2WDBA 1W3VA 4NWWA 1OA4A 3OPWA 3TEXA 1EUUA 2ZJCA 3THPA 5AC91 1CIYA 4K9SA 4I02A 3MFCA 2VM9A 1OBNA 2JDZA 4YW2A 2YG0A 1RHI2 5FMOS 3H7YA 4RHV1 3S5AA 3KT7A 4YG3A 1KGYA 2O8OA 2WSUA 1CZSA 2A6XA 2WO3A 4NPMA 3I3EA 4F8AA 2W87A 3P5BA 1DHKB 2GU9A 3GGLA 2D97A 1K5MA 3ZFFC 2VZSA 4O9GA 2RJLA 3KGLA 2D40A 3VBFC 4YW6A 3VBUC 4Z07A 1RVF1 2VBBA 1YWKA 3DCQA 3NWKA 4RYDA 1XSQA 2W47A 1MZ5A 4QKNA 1O4ZA 3QOPA 2HWB1 1H1AA 3FX3A 5FZBA 3IDCB 1O6UA 3OYWB 1W6QB 1CZTA 5LCWL 3QBQA 2K46A 4O7XA 5D21A 5FZ4A 3Q8EA 3LA3A 5EJ1B 2R062 1LU2A 1NUKA 3LEGA 3V0AA 1YNAA 3HOBA 3MEPA 5FYCA 5GLVA 1GMMA 4RR3A 1CAUB 1YO8A 4I0WB 3BGAA 3EBRA 1ZA7A 2YFZA 4Q0QA 1F5FA 4D7YA 3ZYIB 4CPBA 4NVPA 4TXWA 2J1AA 2HWE2 2XBO3 2Y8KA 4Q1RA 4CDXA 4D7TA 3KHCA 4Y1UA 2YMZA 3HMYA 5T50A 3U78A 2CTVA 1IGOA 2WO2A 2VOWA 4QHZA 1G7YA 1JZ6A 2HBTA 3L9JT 2VMHA 4URTA 1FMD1 4XJWA 1IQAA 3LDBA 3RZZA 3UV9A 4AAPA 1Y9MA 4KNCA 2I74A 4PQ9A 3P1IA 1QQP3 2WBKA 1OQ1A 3W58A 1PGL2 3PLQA 4YARA 2WQ4A 1WW5A 3DV8A 3UK9A 3SKJE 1XPWA 5A6XA 3NJZA 3HBZA 4JGYC 3UESA 2VTXJ 3K4ZA 4FOQA 3VDAA 1OXCA 3EHKA 1VALA 3MI8A 2B46X 4LPLA 2RM21 1GWMA 2OYZA 3AKRA 5ACA1 4JX0A 2QQWA 5EJZB 5GM0A 3LDRA 2RS53 3UGGA 3VDDB 4CCJA 2JG9A 1ZZ7A 4TSVA 4MGSA 1C5IA 5A7NA 3PJYA 3U75A 1PZ9A 3WSOA 2GNBA 1UY1A 3NNJA 1V6JA 4OFGA 2UYBA 4M0NA 4OUSA 3ZM8A 4AFAA 2BFUS 4CP2A 4DFSA 4ZU7A 5E88A 5JXGA 5L7OC 1A3KA 2UY8A 3A22A 4IV3B 5EV7A 5EXOA 4NIGA 3WV6A 1Q8PA 3HT2A 4FXGB 2ZA9A 5KHHA 2VW0A 1JW6A 1RUH2 1TG7A 2R6QA 3AYCA 1TQ5A 3I8TA 3AZWA 5SV5A 1YIFA 4CDQA 1Y3TA 4YFZA 4AVAA 1J84A 3I3MA 1WCKA 3T1MA 1BK1A 4ARYA 5A3PA 1UAIA 1QH7A 5CG9A 1COV2 2E51A 2OW4A 2AGSA 1WW6A 1C8M2 2J1EA 4UAPA 5CNAA 5C5TA 2YHJA 1W9TA 5GLUA 2QQOA 3O12A 3IM0A 2VZ1A 4UW4A 1KRIA 3VLBB 4ET7A 5F37A 1CX1A 5FJHA 3WG3A 3DGTA 2RMU3 4HETA 1DQ0A 1JUHA 1QJX1 1CAWB 5K0UA 1UXZA 5KXCA 3TEWA 2NZ9A 3LPFA 4Q4X2 4JGZA 2ZMLA 4QGLA 4S2FA 1R1A1 2VO5A 5A32A 2RR13 2ARCA 1AYM2 4LXLA 2UWCA 4EN6B 1UYXA 4ASLA 4AQSA 4GH4C 4KBBA 3VHPA 1L3JA 2Q0AA 2R30A 3HN1A 2X53S 1PO23 5LY1A 4BQ4A 4P9GA 1ASJ2 4Y22B 5FXVA 4B8EA 1MPXA 5ANNA 5JR2A 4H14A 3NKTA 5CAZA 3VD4A 4BQ1A 1UX7A 2OUHA 3TBDA 2A75A 3PMEA 4YVWA 5FZAA 1WZXA 2ATFA 5FYBA 2C6SA 3VBFB 1CGPA 2YB7A 2VULA 2WNOA 5EJ3A 1UMHA 1W6OB 4JKLA 3U37A 2GH8A 1OA2A 2WUHA 3OG2A 5FAXA 4QT6A 2E31A 2JG9C 1SLLA 4EZ4A 2ZMKA 5J1XA 1B35C 5AFBA 3VZJA 3O0XA 4Y3OA 1RUH1 2Y38A 2J1RA 4D69A 1MEC2 1AXKA 3WDVA 3PVBB 1ZREA 2FDHA 5A3MA 4QPGA 2HEVF 1ND2C 2ZGQA 3CEWA 4K8RB 5I91A 5FPZA 1JHNA 3BOWA 5FO7B 2PHDA 4YZ2A 5ISLA 4AFMA 2FCVA 3ZIXA 2DVBA 2KM2A 2WNVB 5J37A 3ON7A 4QHOA 3J26N 4XACA 1QGLA 3VBUA 1JYNA 4JAAA 4CCMA 5DAVA 3V0BB 3T4HB 1O3RA 4AFDA 1YEWA 2R16A 1RGSA 3N7LA 4Q0SA 2AREA 2W3JA 3JUUA 4N8MA 2Q1ZB 4A7KA 1DGWA 4GAZA 2WFF3 5L7OA 5FZHA 5KC6A 2JB4A 2VUJA 1FAYA 1PGW2 1UU4A 5D8AC 5FZ9A 4GWIA 4M3CB 4AVBA 2XJPA 4CUAA 2XJTA 1D4M3 1QQP2 3H1MA 2X09A 4IE5A 3N7MA 4K20A 2BBVA 1JZ5A 4MO3M 1AVBA 4R9CA 4UFJA 5CYYA 3MICA 5GZGA 3GCWA 3H8RA 5CG8A 1X9PA 1O4TA 4RHV3 1RUE3 1CWPA 4KI5M 1TE1B 3LDKA 1CQ9A 5F3CA 5FP8A 5LK5A 3N9MA 3ZYBA 5IVFA 4AL9A 3GZEA 1XBFA 3UJOA 3ILFA 3ETPA 4QX3A 1H2MA 2WIIB 2LW8A 4Q4W3 4S2DA 5IK8A 4I0BA 4MYEA 1QOSA 4A3XA 4QM8A 3B01A 3DECA 1LGCA 1PMIA 3N4MA 4IEPA 3LKJA 3RWKX 1W2NA 4HMZA 1BQPA 1W9SA 4MOAA 3AJZA 2EICA 1RXFA 1AZDA 3CF6E 1XU2A 5AVPA 2HWE1 4YVWB 1UNBA 2ARAA 3BTZA 3JD71 2MEV3 4XFGA 4Y1VA 3MIFA 1AR83 3KT4A 5FMBA 2BEOA 4Y20B 1RUC3 4AVCA 3DYOA 5JOXA 4UFMA 1ZRRA 3AX4A 2O0OA 1IHMA 4W8JA 3J4UH 5KHJA 4Z2AA 2NLRA 2XMLA 2ZX3A 4AOCA 1XE0A 4KWLA 3AYAA 3AKSA 3LAGA 5A3UA 1QEXA 2D6KA 1C3HA 4U2AA 4LNVA 3RRDA 2IXKA 1NOVA 4YW4A 4YVWC 3PTYA 2E7AA 2NN8A 1DGRN 2LALA 4XUPA 3OPTA 5FCCA 4XTMA 2AYHA 4HBNA 4CU7A 1V70A 3PHMA 1H9WA 5C9AC 2EIEA 2WRAA 5DAPA 4KG8A 1IKPA 4ZU5A 3WX5A 2A5ZA 1Z0HA 5EHDA 5H9RA 4AHXA 1JYWA 3IMMA 4A3ZA 1RUD1 1WWYA 4COVA 3CL1A 3DUIA 3NNLA 2VH9A 2DVFA 3U11A 1VBB1 5FUNA 3POWA 1VBA3 4KWJA 4AGVA 3RZKA 2GALA 3SCGA 1HXS1 5FRAA 2PTMA 1XNAA 2UYAA 2VOKA 2VVFA 1XNKA 4QPIA 3CMGA 1HN1A 2RMU1 3K48A 4Y1ZA 3H42B 2IXJA 4A41A 4XFFA 1XSRA 2E33A 2NMNA 2P3KA 1QJU3 1UD1A 2YU2A 5FZ8A 3H7JA 2JG9B 2VNOA 4MUVA 1BZWA 1LAJA 5JOWA 2MNGA 4XFAA 4XJZA 4P5HA 5DZFA 5FTTC 2NP0A 1MZFA 2VOTA 4IGOA 3OD4A 4JKKA 3UL2A 3H50A 4CP9B 1KITA 3A4UA 4W6WA 4FXKB 1MS3A 1YFYA 2LRPA 4JHZA 5EFUA 1G8WA 3MIHA 5T5PA 4CP1A 2OXBA 2WFF2 3WDYA 3PJQA 1TMF1 5FZ3A 3MBWA 4LE4A 4CDWC 3TN92 3ACFA 3A0KA 4HSLA 5FYTA 1AXZA 1NQDA 3THCA 3ORJA 4JVAA 4CXYA 3SMHA 2VNRA 1G9AA 1DGRA 1YXWA 4Z8BA 1F9KA 1OUSA 3GZTB 1GWLA 4MGKE 1ZZ9A 1BVVA 4W50A 3WNPA 1HRI1 4FPFA 1RUJ3 2RR11 4BIOA 5F32A 4OUEA 4ORFA 4YYOA 2GNDA 4WM7A 1U5YA 2VTFA 3M3EA 4HSJA 4D0QA 5I8YA 4X6RB 3LGRA 1DQ6A 5ERLA 1AF9A 1DQ5A 1M4WA 1MQTA 1XC6A 3WHUA 1J3QA 5BNPC 5IK5A 1E57A 3AK0A 4XURA 5FY1A 5CFDA 4LR4A 2GP3A 1ND3B 3LEMA 2OPKA 3A0NA 1BEV2 1TME3 2ZGKA 4HN0A 4XOGA 5F5CA 4H55A 2GC3A 1EP0A 3CJIC 5F5IA 4I30A 5EPAA 1CZVA 2E9QA 1RMU1 1LOFC 4EQVA 2F6BA 3OD0A 1GYKA 1SFYA 1UU6A 1VAMA 1OPMA 4LMFA 2OUJA 3FHAA 4XFIA 2RE9A 1F8VA 2AACA 1P8JA 4RR3C 4DEVA 4UFKA 3GF6A 4XQWA 3VD5A 3KSCA 1OI6A 3M70A 1W9YA 2HWD2 4N53C 1ZBA2 4GKYA 1K5JA 4AZZA 4A4AA 4GWNA 3OGVA 3ZFFB 4E2QA 3MYXA 1FPN3 4RGKA 3S30A 4YZ1A 1O5LA 4FTEA 2Y6JA 2B9UA 3O0WA 1TNRA 5BV6A 4NRPA 4A2UA 5FYYA 2AENA 2FDJA 2QQLA 5DZEA 1RUE2 3WVJA 1ZZ6A 2Z79A 5BNQA 1EY2A 1QHDA 2J7MA 2VZTA 1HW5A 1PNGA 2GZWA 2PHLA 1C57A 1RUOA 2Q5TA 4PIXA 2VG9A 3N7JA 4GJYA 5F39A 1OFSA 1W8NA 4LHSA 3WP4A 4AHZA 5C9AB 3DL3A 1GZCA 2HWC3 1G6NA 4YVSC 5F6KA 3VN4A 2GDFA 3AZZA 4CA9A 3AZXA 4PJYA 3AMPA 4BK5A 1DP0A 5C8CB 1OC1A 5SV8A 4IV1C 1PIV1 3A23A 4TLFA 3UNPA 2VC9A 2EAKA 1EPZA 2I07B 1LCLA 1RUC2 1VRH3 1GZWA 1W39A 2WWJA 3DYMA 5FZ0A 3V64A 1W8FA 4BWOA 1KJRA 1JYXA 3QD6A 3ZSMA 1QDCA 4BZ4A 2ORZA 4XFBA 1D4VB 4J1XA 4IEWA 4HANA 4D8MA 5IK4A 5GKAC 2WJSA 3EMRA 1V9U1 4LBMA 5G04L 4DINB 4QXHA 4R9AA 5H9QA 2ZZQA 2WQ8A 1R1A2 1ZZ8A 1ZBA1 5FPVA 1OVPA 3RJRA 1HKDA 2ZX2A 3WNLA 2IXLA 2YGLA 4PCRA 3Q8FA 2V4AA 4GB31 5GALA 4GMP3 2HWC2 3RDIA 4JDOA 2BQPA 4FTSA 1ZZBA 1GWKA 4EN0A 4XXPA 5F7UA 5FYZA 1W28A 1WKYA 3U14A 3C7HA 3JBG2 1V6LA 3HVDA 4YGEA 3NJXA 4L0PA 3SEEA 4QX5A 4JV4A 1FT9A 3OUJA 3TNQA 4TTGA 4HK8A 1KFUL 2XKPA 2FDGA 3RNSA 3ZX7A 4CEWB 4YSFA 5K9YA 3AM2A 1QJY1 1WMXA 3TN93 4AHYA 4WVWA 1PO11 3QH7A 1DF0A 2B9VA 3VBHA 1DU3D 4L8QA 5CBLA 1ONAA 4Q27A 4SLIA 5DMYA 5IVJA 5JPMB 4QHBA 4WM7C 3ST7A 3D8CA 2Q8EA 2JE8A 1UZZA 5CZKA 4NHMA 3TB0A 3CKHA 3S6PA 1XE8A 5JI9A 4CDUC 2XBO1 4CYDA 3CJIB 4FVVA 1AUYA 1DZQA 2R7EB 5FKBA 3O0VA 5A1LA 4KU7A 4Q1PA 3FN9A 1UZVA 2Y6FA 4CU9A 3BI3A 2G4IA 5FUIA 3VB9A 5LA1A 4LBJA 3GBWA 1H2KA 5LB6A 1ULEA 2X5IC 4IEUA 3VKLA 1OKQA 1ZBE2 4EJRA 2E7QA 3KS7A 4NN0A 4E4ZA 4XF0A 4XW3A 4Q0VA 1O7FA 3OSDA 2BVVA 2D3SA 5BUVA 4DEQA 1VBC3 2JICA 1NLQA 3BU0A 1UZYA 1K45A 2HWF2 4BM8A 1N1TA 3B3QE 3D5OA 4HN1A 4QQPA 4NMIA 3D6EA 2A3YA 4AEKA 4D6QA 1W6NB 1QH6A 1O91A 2RS51 4FPYA 5BNNC 2DV9A 1AR62 4ASMB 3PUAA 4M3CF 4XUTA 1N47A 3MZHA 5DDJ1 3DYPA 4QX2A 1WCUA 2JDKA 1GUIA 1BEV3 1SACA 1TME2 4C90A 1R083 2XBO2 2DCTA 4HPKA 3KMHA 1QF3A 3IIIA 1RUD2 4CVUA 4NHLA 4ZXEA 2WWSA 1RUJ1 4N43C 5FY8A 4E4HA 3OUIA 4NIDA 4I01A 2Q8OA 4EYUA 1JZ7A 2Z42A 4M00A 1ULFA 4PDWA 2W52A 4LLFA 5DABA 3FUQA 1DYPA 1JOPA 4NR1A 1ODNA 1SCRA 1SG3A 1W8ZA 2VXRA 3M1HA 2OVUA 3QLQA 1Q3EA 4QWNA 4WVVA 5A7SA 3WF1A 3MO4A 4JC1A 3THDA 5FOJB 1W6QA 3ZXGA 1NE4A 2J1UA 1JXNA 3MW4A 4HL0A 2AH2A 1HB3A 5DXDA 1RYYA 1OOPB 3K51A 1JOJA 4AW7A 5JAXA 1GNYA 1RMU3 2RS11 2JIGA 4ES9A 4MZUA 2GMPA 3WCRA 4QPIB 5AC92 4DUVA 1GQHA 1CONA 3I2KA 5GLTA 3RZGA 4MX3A 3E6CC 1AL23 1H6XA 2Y26A 1W8UA 2C26A 4RD7A 2VOXA 5FLJA 1O59A 4GXLA 2XOMA 2P34A 1D0GA 2CAVA 2ZGUA 4GJZA 2BRTA 1W9FA 2P5BA 3MW3A 4N7UA 2FZ2A 3O14A 1SFNA 4P00B 4YNIA 1UOBA 1QJY2 3CQOA 4C8DA 2VY0A 1NQJA 3DKQA 3NKGA 4QKBA 4RN5A 2RM22 5JSPA 5EYYA 5GZFA 3U1XA 4M01A 2ZAAA 2G9ZA 1WLWA 2MPFA 4QB6A 2FDIA 4XJAA 2XDVA 4AGGA 4M0HA 3BALA 1NE6A 1OA3A 4XQ4A 5CA6A 5GJ6A 5A32B 3NJVA 5B4XA 3LIHA 1SLAA 1WBLA 4I3PA 4NROA 3ZKUA 2EAAA 4Z1VA 2DYCA 1A8MA 1RUG2 1S0DA 4OI0A 3ZXJA 1JBCA 2SLIA 1W03A 4GD4A 2RS12 3RS6A 1PGSA 4EWDA 5BNOB 5DUXA 2A73B 4XTPA 2ARBA 2IFRA 3CIHA 2PLV1 4BQWA 1GBGA 4R9BA 5IAVA 4PBPA 1IPSA 1UYPA 4XYXA 4AAXA 1S0EA 1JYVA 2BGOA 1PK6A 1NZIA 4A6OA 2NMOA 2XHKA 5LK7B 3FZ3A 2DVDA 2YC4A 2W91A 4COYA 1H4HA 1OF4A 2VGDA 1KJLA 4XMIA 3TN91 4MXVA 4YW7A 2WC2A 4Q4W2 3VBHB 3RZJA 2WYSA 2QJVA 5FYHA 1NX9A 2HJIA 2JX9A 3NAPB 2GP5A 1CJPA 3K46A 4K21A 4RHV2 5FZMA 1EYBA 1RHI1 4E2SA 5LRSA 2X8KA 4OHXA 3ITQA 1VBD2 2YROA 3WT3A 1MS0A 4CP9A 5FUPA 2VAUA 2Q8CA 4AQ6A 2JD4A 3I2IA 2PHRA 3POIA 4GIQA 5FYUA 4ATFA 3PUHA 1RUE1 4PDWC 4YVSB 3PVNA 1GICA 1U12A 3WXPA 1S0JA 2CGNA 1DQ1A 3EJKA 4IEYA 1LENA 2VNGA 2FMDA 4AYUA 1CESA 2VUAA 5C3OA 4MH0E 1GKBA 1G9DA 1XYPA 1NCQC 2EVXA 1SBFA 2OQ6A 1RUG1 2CNAA 5DAQA 1WGPA 2B39A 1WD4A 1UF2C 4NAOA 4P9LA 5FP4A 4UBGA 3U10A 2D44A 2WNEA 4MADA 4AI3A 1JZ3A 2ZCWA 3ZFEB 4C1WA 2DU0A 2H0VA 2XLGA 4UBHA 3GZUC 2DCKA 3MDPA 1AXYA 1RUC1 2R0FA 4LBQA 3LQCA 2KR2A 4EV0A 4QXCA 3J7HA 1QOTA 4K1YA 3B5LB 2ORXA 4WM7B 1QJFA 3LSDA 1JZ8A 1Y43B 1HB2A 1NLSA 5IK7A 2FCTA 3R4DB 4XDPA 1W8HA 1CVNA 1HLCA 2DFBA 1DFQA 4UFIA 3WEZA 4V2WA 1A34A 2HYXA 4JGYB 5JZGA 1W2UA 2BTVC 2VBPA 1YFUA 3GXUA 4LBQD 4A7YA 2XL7A 3IDBB 3LE0A 4Q5OA 1LGBA 1UMZA 4N43A 4FFHA 4HK9A 5GLWA 2P6CA 4J1WA 3W5MA 1GZTA 2UWBA 1VPHA 3WG4A 3VDDC 1JI6A 2UU8A 2BFUL 2EIDA 2ZHMA 4Z82A 3VUOA 2B45X 2NYYA 1RUD3 5DN2A 5HCBA 1O5UA 3IAQA 2B8MA 5FZGA 1YUDA 1PMHX 5CFCC 4DNYA 2PAKA 4INDA 1OHFA 4ISQA 2R063 3WHTA 1HXS3 1FMD3 4LBOA 3D0JA 1AR63 4GALA 3BIWE 1SDWA 4LBLA 1Q56A 2ID4A 4A44A 4AFCA 3CBNA 4IEVA 3J8F3 1HQNA 2R043 4HVRA 4CCNA 3BKZA 2DCZA 1D7PM 1J58A 1NY71 1US3A 1XXNA 1Y4WA 3KD4A 4KGQA 2XWBB 3WD5A 4ZHNA 5F9TA 4OYUA 1SDDB 1V9U2 3SH4A 4HVOA 5A6YA 2Y0IA 5HCHA 1YQ8A 3FMGA 1IS3A 2Y6GA 3WNNA 3TEZA 5IVEA 4Y26A 1ULGA 1LOFA 1JH5A 4MLOA 5FXZA 1TEIA 1VRH1 4UI9L 2VNVA 1V0AA 2WLQA 4PI0A 2B7YA 2OQ7A 5CFDB 5HBAA 5EYXA 1I1EA 4E9KA 4LOTA 4WVMB 2PHWA 2JENA 3VD7A 1OQEA 5DUUA 1F31A 1NT0A 1OUXA 2WNUC 2Z2SB 2QFEA 3BPSA 1IQDC 1QQP1 5FPLA 3OGGA 2NPIA 1G9BA 4C0BA 5BYNA 1ULOA 4WM8A 5FLIA 4DXRA 1WUVA 4LO4B 3LOBA 1XNTA 4XXAA 3ZR6A 5BNNB 1AR82 1U0AA 5CKQA 1D4M2 2BUKA 4BQ3A 3AC0A 3SCHA 1EAH1 1SLTA 1AR73 4DQAA 3RI8A 1O8PA 3C7OA 2BOJA 4Y5Z0 5BXXA 4M4RA 1D2SA 1BBT2 5FYVA 2HH9A 3HD8B 5FP9A 3C7EA 1RTVA 3E5QA 1WLTA 1F2NA 1OH3A 3J7NA 4C1XA 2HWB2 2XLAA 2TBVA 4N43B 3E5UA 5FJKA 3USUB 3PU3A 2J1SA 1VAKA 1J1TA 1ZZCA 4L11A 2G9GA 1LEMA 2QQJA 4BXSV 1H0BA 4RGGA 1TME1 1PVC3 1E5SA 4P9YA 5LY2A 3THTA 3UKTA 3RZLA 1WMEA 4L2NA 1H8VA 2VVEA 2YZ4A 3VL9A 1VRBA 3TRSB 3MLLA 2O8QA 4RSUA 4AWDA 2WO1A 4OZXA 1AR92 4Z2WA 1RITA 4BLJA 2VZUA 3KCCA 3DPRA 1DQ2A 4FPCA 1AX0A 1PO21 4META 3ZYGA 2IVJA 3HPNA 3O1PA 3H3ZA 3H3LA 4P9IA 4NPLA 4CDUA 2PLV3 4YVSA 4XBQA 4BISA 5A3NA 1RUF2 3CNAA 4WZCA 1DIWA 3VBSC 2Q1FA 2D5FA 2X05A 4DY3A 4UYBA 4UFLA 2EA7A 1XB9A 4COUA 1KXGA 3RQ0A 1UWWA 3TOJA 3PVEA 3K4DA 2RS52 1ZBE1 2L9LA 2VXJA 3WCSA 2VR4A 4JQRA 5J7MA 1PVC2 1QXJA 2OT7A 3POFA 4LO8A 4IQPA 1ENSA 3USUA 5KC5A 1EPWA 3VZMA 5KHIA 5CKNA 4XF4A 4XF1A 5FXWA 4CDWB 3VBUB 3MPPG 3VD9A 4O65A 3UETA 4AR2A 5EQUA 3BTAA 4BQ5A 3ZFEA 5IVBA 4S2GA 1Z7S1 1K5MC 3ZFFA 2VUDA 5FZKA 4QDRA 1T2XA 5FPAA 1RHI3 3SEPA 3TWIA 4IE6A 4XF3A 4IESA 2WT0A 5C3QA 5FY4A 2E63A 2X29A 3AL6A 3C2UA 3T2PA 4IEZA 1X9TA 4XFHA 2XJRA 5C70A 4HKOA 1S2BA 1PMJX 1BBT1 4LTAA 2GN7A 4ITCA 3I2FA 4YG6A 5F5QA 2ZMNA 3VZNA 4Q29A 5D1IA 2A6WA 3PIGA 2JXAA 5FP7A 1V6OA 2BVBA 1YYNA 3C3VA 3C7FA 5LBCA 1ND3A 3WW1A 4TN7A 5C9AA 2P3IA 1BCXA 3Q8BA 4XF9A 2DF7A 3RZHA 3NMBA 5A33B 2P6HA 2TUNA 2ZEZA 1W8TA 2ZEWA 4IE4A 4RS5A 4XE9A 4XILA 1NYWA 1FOD3 3ZSEA 1DZTA 1UZ0A 3B9CA 5C3RA 1MZ6A 2A6VA 2B42B 2PA7A 3LOIA 3NAPC 4O61A 4CEYC 1BMV1 2X5IA 1JODA 2V72A 2HBUA 4ONUA 4GB32 4PIYA 2P4EA 4KWKA 3LCPA 5F6LB 1UPSA 2WYFA 1FI2A 3ZN6A 1AR61 1UXXX 2GNTA 4H3WA 4JGZB 4UF0B 3RYKA 5KHKA 3BUCA 2R1DA 4Z92B 4CU8A 3N7KA 1W2OA 5FZOA 4IE7A 1F15A 3IBMA 2VZPA 3WW2A 5E8AA 4Q4X3 2BYVE 4XHBA 5A7OA 4BQ2A 5L7OB 3VKFC 1KFXL 4B3NA 5F3IA 1OFNA 1QOOA 1ZVFA 5AFEA 3W5NA 1H1IA 1VBE2 2ES3A 2BNNA 3CZUA 3ECQA 4K3UA 2ZGRA 4LJHA 2VOVA 4UW3A 2EXJA 1XNDA 4PI2A 5LBFA 2HWF1 1FXZA 3AYDA 3LB9A 2W2IA 5LASA 2PAEA 1ZYBA 3UKNA 5FP3A 3VBRA 4PHZA 5C7GA 3ZPYA 5F1RA 3RSJA 4Q8LA 4QPWA 4G9SB 3V0AB 2VVDA 2E26A 4DMIA 4TYSA 4XIKA 3HR9A 4HONA 1JYTA 1ACCA 4Q0UA 1PX3A 4CCKA 5A3WA 2XH6A 2VMDA 3VBSA 2QQMA 1ST8A 2R061 2ZGMA 1C8M1 2D98A 2W68A 3VKOA 5AC93 3S57A 2LROA 1XNCA 1UQXA 2MEV1 4HT1T 4Q2FA 4MGQA 4BPZA 4CXXA 1YC61 4CUCA 5EZWA 4AFBA 3SC7X 3D0SA 5D8AB 4YWAA 1NZCA 2W0XA 2YYOA 2JDNA 1V6NA 4FOYA 4N7IA 1OD3A 2YPJA 1MEC1 2W94A 3GYDA 1Q8SA 3JB8A 1STMA 3T0AA 4CDQC 1MS4A 3MV11 2QQUA 1CD3G 3CJXA 4FP2A 1PX4A 2C24A 1TMF2 1OURA 2PHUA 2WT2A 3I59A 3OB8A 3UT0A 5K0UC 1W6MB 1JTZX 4LEJA 1LKNA 5TSWA 4B7EA 4F3JA 4B4QA 2R0HA 4LUMA 5FOBB 5CADA 2WN2A 1ZX5A 4H2AA 5HPOA 1GNZA 2BOIA 5FK7A 1WA6X 2HWB3 1DBNA 1AHSA 4G3YC 4ZZ5A 1BK0A 1L7QA 1OLME 2CU5A 1AX1A 2DVAA 2XGXA 3HT1A 4LKEA 2GC0A 2Z5WA 4RQPA 5DDJ3 5HXVA 4AEJA 4AVVA 1ZRCA 1UPIA 2HWD3 1PK6B 3PURA 1VB4A 3IPVA 2E32A 4UW6A 2CL2A 2ZHLA 1CAWA 3JBG1 4XUOA 5C3SA 2Q8DA 5K0UB 4CEWC 1ZRIA 3FLTA 2XXZA 5IT6A 3ZOIA 4JRLA 5FYSA 1JS9A 2P3JA 2W39A 1O4YA 4GA9A 3WQ1A 1OMIA 2P3YA 4Q8KA 3IMNA 3PVOA 2P2KA 3KF5A 2JWPA 1HV0A 1UYZA 1W6MA 4AVSA 2JG8B 1JYCA 4PF1A 3RI9A 3AB0A 4JCKA 2V4VA 5FR3A 5GZDA 2G1MA 4FPGA 4H7LA 1YRZA 4BQYA 3PU8A 2RVAA 4XCBA 4YM0A 3WDXA 2VD7A 1H8TB 1UCXA 4LK7A 1LNSA 1GLHA 2UY9A 4W4ZA 2JDYA 3M3IA 4QAWA 5I0SA 1HRI3 2J1VA 1S0CA 2VMEA 5FMCA 3VZOA 1SBDA 5FZIA 4N53A 3H9AA 4COZA 2CDPA 2WWUA 4FCAA 4GMP0 5ACA3 1QIQA 2VTXA 5DPNA 4CCEA 1YQ2A 2ZS6B 1IZ3A 2EXIA 4PBOA 1UOJA 1YI7A 3JXSA 4CEYB 5JOZA 2BW8A 4RS5C 3CU7A 3ZVXA 2VZOA 2QKDA 4W6XA 1I5ZA 5LEJA 2BP6A 1N1VA 4HG6B 4YM2A 2YC2A 2WLPA 5FYMA 3RMXA 2ZZJA 3N9NA 1SBEA 3G7DA 1W99A 4Y1YA 2JIJA 3OY8B 3WDTA 4CCCA 2YC0A 4WZFA 5FZLA 4F83A 1DLCA 1PK6C 4FOWA 1GZ9A 5JIUA 2AC1A 1AYN2 3AP7A 4PIZA 4R4ZA 2ZTNA 3V0BA 3AKTA 3R4UA 2CHHA 2OX0A 1PGL1 1NKGA 3K77A 2VJXA 4LHLA 1FX5A 4WV8A 4RS5B 4CP0A 3ACIA 5EWSA 5C8CC 3WP6A 4Y33A 1CN1A 2UURA 5I0UA 5A7WA 3IN9A 3VHRA 4A45A 4K7JA 4JTNA 5DDJ2 3RMYA 3P3PA 4XETA 4PF5A 4X8NA 2Y6LA 5BY5A 3GJAA 4HPKB 2GC1A 2JDPA 1QJX3 2ZKLA 3NW4A 3T09A 5FZCA 1EV11 2ZGPA 1U5XA 1XYNA 3K3NA 4FPEA 1REDA 2R041 2C5DA 3RG0A 1RVF3 4AEDB 3VBSB 4FTBA 1NA1B 2V5YA 4Q4X1 1VP6A 3WNKA 5K7PA 2BNOA 1VBD3 2VU9A 1NCQA 5KR7A 3B9IA 4XIOA 5AVAA 3LPGA 2BNMA 2VCAA 2ZGSA 2HKXA 3X29B 3I2HA 3ZKYA 1W6PA 1O3QA 2HWF3 2GH2A 1OSGA 5C4WB 4CZSA 3ZSLA 1R093 2XUEA 3IT8A 5C33A 1BYHA 2ZAHA 3DXTA 5JMOA 1UW8A 3M7AA 2ZPXA 4AI2A 5KXBA 3I59B 3ZLIA 3QCWA 5LWBA 2WNVA 1Y7BA 1UYYA 2RR12 3HQUA 1PM4A 2R072 1QNYA 2R071 3KT1A 5IYYA 1V6KA 4QB1A 3SHRA 3ABZA 1CR7A 4LKSA 2WZR3 4UF0A 5DG1A 5A3OA 5I8TA 3T3YA 1H8TA 4XJ9A 4QQLA 1RUI3 1OVSA 3LSEA 3FFQA 4BHPA 3NNGA 4C91A 3H8XA 4I2OA 4LO7A 1MVQA 1WW4A 5D8AA 3T08A 4D94A 3MUY1 3R05A 1ALYA 1CAVA 3AFGA 1BJQA 1KDMA 3BPZA 1RUJ2 2A71A 5FQ0B 5A1AA 1VMFA 3RFRA 3B7MA 4QPIC 5JLVA 2E6VA 5JOYA 2D43A 3J7MA 4CDXC 1US2A 2C9AA 4IV1B 4Y5SA 1J83A 3UGFA 5HCAA 5J98B 1KQRA 2QQIA 1UY2A 5LBEA 3OEBA 2R32A 2GMEA 4Q4Y1 3NSTA 5CU1A 5BNOC 4OHZA 1JYIA 2WABA 2XJQA 1V9U3 5JR7B 2IWGB 1FNZA 1CAUA 5A70A 1JU3A 1JN2P 4LQRA 4Q4V1 1RB8G 2IFWA 2CAUA 5L73A 4OMCA 1KS5A 2FCUA 1PO13 3WINE 3HIFA 4FPJA 3U07A 1QY4A 4CCLA 3WG1A 3JBG3 4BB3A 1QXRA 3AMHA 4M3CE 1XRUA 1GOFA 4AHWA 1ZRFA 2CDOA 2YGMA 3J9SA 4H7MA 5KBFA 2AUYA 4AE2A 2DWRA 3ELNA 4OQ8A 1G9FA 1JUIA 5KWRA 2RDQA 2WA4A 2WQZC 1OLMA 3AMMA 1X33A 1AL0G 3T0DA 4N90A 3MLKA 2J42A 2D6PA 1WCDJ 3P3NA 2ZX1A 4ZS3A 3FC0A 3N9PA 2PMWB 1OOPA 4QGNA 2ZBJA 1N1SA 1XNBA 1RJ7A 1SFPA 3AFKA 3ZPOA 3KVAA 1Z7S2 2VZQA 4CU6A 5KXEA 4NWVA 5ABJC 4LIVA 2GAUA 2QQKA 4IE0A 5KHGA 2VZRA 2BWCA 3ZIWA 2Y64A 4N9IA 5A7PA 1X36A 2QTWB 2VECA 3ZDSA 2FDKA 2I45A 2RV9A 1C1LA 3O1UA 4KBZA 1GV9A 4IEXA 2F17A 5IFTA 1VLNA 4LULA 1HRV3 2JDMA 2WS92 3I2JA 3NNMA 4JZRA 1RINA 4AQ2A 2IXHA 2BBAA 2WSVA 2QE3A 3AJYA 4HFSA 1YIPA 4DIQA 2TNFA 4OHWA 2GMMA 2V09A 4AI0A 4Q4Y2 1AJOA 2Z69A 3JD72 5IATA 4BOWA 1W6OA 4XAAA 3N35A 4GZ9A 3ZMNA 2D5HA 2WZ8A 1QJZA 2B5HA 4BMBA 3IWZA 5JSOA 3OBTA 5FMDA 5IUQA 1BEV1 2JDUA 4QXKA 4AQTA 1MS1A 1BLZA 5A3LA 3H1WA 4XBNA 2NQYA 3PNAA 1QJX2 3S5QA 1H8TC 3BOPA 4LBNA 2ZXQA 1VBE3 5FO9B 5JMCA 1LRHA 3H8UA 2XVLA 5LEKA 4AVTA 1FMD2 5LA2A 1A8DA 1VBB3 2PYTA 3T2QA 5FBJA 2RS31 1YJLA 2Y0OA 1NAEA 1W06A 3S7IA 3LZZA 2EF6A 4JGYA 3I2OA 5T5OA 5DZGA 3KHBA 1ULCA 3LWCA 1S1AA 5CISA 2WKKA 4XABA 2CGPA 1EV13 4N53B 2RDSA 2RJ2A 1GOHA 1PIV3 4AG4A 2YPDA 4Q26A 4XBLA 1Q8OA 2VW1A 5JWPA 2ZX4A 2Y6KA 3SH5A 2JG8C 4HKWA 4K1ZA 4Y24A 1WLDA 1H6YA 3SLIA 3ASIA 3FWEA 1COV1 1WCSA 3RVHA 3ZMOA 1VIWB 4QB2A 1IPKA 3OJBA 4B1LA 1H4GA 2EIGA 1LESA 2LUWA 3QACA 4P14A 3M3CA 3VBOC 4DY5A 1RVF2 2PLV2 1GP6A 2VCBA 1CAVB 4E2GA 3AMNA 1MQTB 4FFFA 1LHUA 4JQTA 1Q5OA 1LOBA 2ZHNA 4NIHA 2XWJB 3TNPB 2VQ0A 1UOGA 4YM3A 5HV4A 4GB33 1SLIA 1S0FA 3VZKA 4JGZC 2O14A 1GANA 4OULA 5EIYB 2UWAA 1W9WA 2VL4A 2RS13 3PL0A 3WG2A 1RXGA 4YW1A 2W1WA 4V1PA 2DUQA 3WDWA 1DYOA 1LGNA 4I0AA 1R1ZA 4FOVA 4MGYE 4QU1A 1AYM3 4XAEA 4QQHA 1H2NA 4AK3A 1MEC3 2AR6A 1X82A 2HWE3 5FQ0A 3WNXA 1V6IA 4R9DA 4YZ3A 3WQ0A 4A7ZA 1NA1C 3PDQA 2K2SA 3R0RA 2XHNA 4MGIE 2AEZA 1N3QA 4LBQB 1H30A 3WP5A 3ZYJB 4QX8A 1DG6A 2JKBA 1IOAA 4BMEA 1SHWB 2XJVA 3PUQA 1WCQA 5M0TA 2RDNA 3BU7A 5F3GA 5FZEA 2KD7A 4E27A 2LS6A 1NCQB 1CIWA 4R4XA 1D2QA 3KQ4B 4ATEA 4KG0A 3NVCA 1L7RA 1ENQA 1UKRA 1VMJA 2R073 1VBB2 3ZO0B 1V6MA 2Q30A 5B2GB 3FUOA 3L2HA 1VAVA 2EIBA 3E6DA 5E89A 3TYJA 5A6ZA 4A6SA 2D3PA 2BERA 1RJ8A 4XJ8A 3VBRC 4ASKA 4KMQA 5J36A 1LODA 1GOGA 3ES4A 4XVHA 3ZXKA 2C0ZA 5FV3A 4NE9A 5A33A 4LHKA 4NRQA 3M8LA 2DCYA 3M4FA 2JE7A 3ES1A 3NJYA 2FBEA 4F7ZA 4QQOA 3UYJA 3FHQA 2QCSB 2XR4A 5C5UA 3PUSA 1W0PA 1OLQA 4GULA 4XJUA 1AX2A 5T5JA 5JXJA 4DO0A 1FATA 1ZRDA 2DCJA 2OPWA 2BGPA 1ULDA 1AL22 1K12A 2W9XA 3KWVA 4D6RA 2W1SA 3I2DA 1GU3A 4LORA 1FV3A 3SQOA 1YHFA 3WF4A 1U5ZA 3LEKA 3ZN4A 3BYWA 1IS6A 3Q8AA 1YI9A 5L9RA 2ZACA 1XE7A 4NO4A 5A7QA 1V00A 2D93A 2ZHKA 3A21A 1QJU1 4P08A 4FPKA 3GALA 5JZGB 3KZ4C 2HWC1 4JDNA 4HKLA 3O1SA 5IVVA 2XLFA 4XUQA 5KXDA 1BXHA 1KS4A 2W08A 2JJ6A 4AEDA 2DBIA 4Y4YA 3BIEA 3LD8A 1RUNA 2ZGNA 2X5IB 4XUNA 1O3TA 1SCSA 4QKDA 2CSGA 4K8FA 1J3RA 1BHGA 1PGW1 4HZFA 5JIAA 1J59A 3W20A 4EWEA 4WVMA 4IGPA 2A7AA 1TMF3 4XDOA 4SBVA 1CPNA 2ET1A 3FLPA 3VBFA 5A1FA 5FLHA 1KD7A 2WL1A 4YW3A 1NLRA 2A6ZA 4I09A 3HQXA 5G05L 3VBHC 1OPOA 2ZOEB 4OHYA 2SBAA 1ZBA3 2JG8A 1CJDA 2IXCA 3PMSA 4NJ4A 3NNFA 1LEDA 3WQ7A 4LE3A 4D3WA 2QZ2A 5JXIA 2WR9A 4IERA 5CFCA 1F5JA 1BMV2 4W65A 2DUPA 3WF2A 3MFAA 1B09A 3U4XA 2A1XA 1RL3A 3N9LA 3R6SA 2V5DA 2OKXA 1HJGA 4Q4W1 4RL7A 4UT5A 1QJEA 2RDRA 3RYPA 4E4SA 1RUF3 4ZXKA 1T6BX 3HEIA 3ENRA 2H6BA 4D6SA 4UWDA 3O1VA 4JHTA 3WQBA 3MHZA 2QNKA 4WBBA 5C8WA 3INAA 4O9EA 2Y60A 5JXHA 4KWUA 4X6QB 4DZGA 1UMIA 3ETQA 3FHIB 1SZBA 4YGDA 1IS5A 1RC6A 5FZDA 3I7DA 4P9XA 2P17A 1IPJA 1W05A 1W0OA 1Y9QA 1ZNPA 2HWD1 5J48A 4OMDA 1O8SA 1DDLA 1LHNA 2VQUA 2YXSA 1REEA 3BCWA 2JB8A 2CWMA 2WNUA 1NA1A 4DXTA 3S7EA 1YQ6A 4IGQA 4ZKTB 4EZHA 2WNVC 5ACA2 2PXJA 2XVGA 1AYN3 2VW2A 5CFCB 1LULA 3OBRA 3EB7A 4J6GA 3CO2A 4IV3A 4FSJA 3BN6A 3E1F1 1S0BA 1ZA4A 5FY0A 4ZY9A 5I0DA 4RGAA 1R1A3 4BE3A 2ZX0A 3A7QA 3C7GA 3VBRB 2N7GA 4I3GA 3T2OA 3PIJA 3IPVB 1GZWB 5CVRA 5I0RA 5H9PA 2VPVA 1WA4A 2WAAA 4OI2A 1POQA 4DRRA 5BPXA 4KQ7A 4NIIA 1NY72 2DDUA 4XFCA 1WW7A 1PM7A 2IVIB 4CPBD 3CZJA 4JDMA 4CXWA 3AMQA 3MIGA 4LBKA 1HRV2 1S55A 2WS93 5GLZA 2BU9A 3H0OA 4B7KA 4QMAA 4DXZA 4X8PA 3AYEA 3KV4A 3ZYFA 1MS5A 5LATA 5BNOA 2KA3A 2WZR2 3I2GA 3NAPA 2QQPA 2WA3A 2CGOA 3LIGA 2WNUB 3NV2A 1MS8A 2Y33A 4HXCA 1Q8QA 2R1BA 3BB6A 4ARXA 1R081 4M3CA 4FO9A 5FDBA 1DCSA 2VUCA 5FO8B 1SLBA 4OVEA 3I97A 2E53A 1SMVA 2VQAA 3I3DA 1K5MB 4TLGA 5FKCA 5T55A 2P37A 1Q8VA 2A70A 1QWRA 4YRDA 1RUH3 4QX7A 2OZJA 4LO5B 2EXKA 2W5FA 4BQXA 3AZVA 5C71A 1YQ5A 4GWMA 1C5HA 5FZ6A 5I93A 3MIDA 1W6PB 3N3HA 5FPBA 1HDKA 3AVSA 3OYWA 1IKQA 4P9WA 5GZCA 1G9CA 4URAA 1A78A 1LHOA 1AR72 4IEQA 4CDQB 2LTNA 2D7FA 1MQTC 4RFT0 2ZABA 3MW2A 5DQ0A 3HQRA 2YY1A 1DZRA 4JKMA 4EE2A 4LKDA 1I5PA 2ZKNA 2HYKA 5CIRA 3RJ2X 3ZYPA 1TNFA 4EWAA 3FLRA 5HXMA 2IXIA 3URFA 3VKNA 1GP4A 4AI1A 2QZ3A 4BJ0A 1Y9GA 4YLZA 2A3XA 5FXXA 5LBBA 1VB2A 4IV3C 4OLLA 1R64A 3KVBA 2XJSA 3DXUA 3IDEA 2XJUA 4XCAA 1SPPB 2EALA 4GQ7A 4S2HA 3KCXA 2VZVA 4DUWA 4N9HA 1W2TA 2XL9A 1OLRA 4LA3A 1HIXA 1HB1A 1W0NA 2K9ZA 1SLCA 4NHXA 3VD3A 2FQPA 1CPMA 3LF7A 4W6YA 4UFHA 1AR93 3WR0A 1DQ4A 1X8EA 4FFIA 5HV0A 3CLPA 5F2SA 3J7LA 1M06G 3O1MA 2WINB 1UIKA 1R082 3ROUA 4MHRA 3WP3A 3OF1A 4DRVA 2PHTA 2QDRA 5E6HA 4E8DA 1LOAA 3C8XA 2WZR1 2ENRA 3WF3A 3CDZB 5FWJA 1H2LA 4LIUA 4LT5A 1B35A 1GFF2 2YBKA 4RQPC 3ZR5A 2DU1A 1EAH2 2A6YA 5EP9A 3W21A 1NXMA 4IDZA 3ALQA 1ULPA 1S2KA 2HLEA 3B02A 3DF0A 3IKWA 4UOJA 4NIAA 5JZGC 1ND2A 1W6NA 1W04A 1VBC2 3KB5A 5L19A 1S0GA 4LK6A 3ZDVA 4IXLA 1BBT3 4QQ2A 3W9AA 2PELA 3OUHA 3ZN5A 4QU2A 2BJSA 1L7LA 2E7TA 2PQQA 2DBNA 4FPLA 5IFPA 5I8SA 2QVSB 1SPPA 1XOYA 1OKOA 2H0BA 1ASJ1 2VBDA 2D6NA 2WT1A 5I0TA 5JPNB 1W8OA 5LZ6A 4XZUG 4XHXA 3K2OA 3WW4A 3V56A 3VDBA 1O3SA 3POSA 4RA0A 4YGCA 1APNA 4XZPA 4LOSA 4P5YA 1QU0A 1YCIA 4Q4V3 4FFGA 2R042 3JZVA 2JKXA 3VHNA 1RMU2 4R8HA 3RYRA 2TEPA 4QX1A 2CV6A 3E6BA 1JMUB 5B4NA 1MR5A 1EAH3 1G86A 2DTYA 3L2YA 2CWSA 4IEOA 1PZ8A 3P6BA 1JHJA 2W1UA 1B35B 1AYN1 4K40A 4Q0PA 3VDDA 2JD9A 2ZEXA 4DUXA 2XQXA 3USSA 2BGCA 1C8NA 1RIRA 1VE0A 1RUF1 3MF6A 4KGGA 3SNMA 4EROA 4COWA 2WO7A 2QBXA 2X10A 1AYM1 2QUOA 1ND2B 4FQ4A 4QDQA 1JZ2A 3O1TA 1CX4A 2DUOA 2MHFA 4MSVA 3HAGA 4PLMA 4QGMA 4Y5TA 3UJQA 3AXDA 1C8M3 3GNEA 5DUVA 4B4RA 3FBYA 2IC1A 3FJSA 1QXPA 4OI1A 1DGLA 3IZOA 4CEWA 2DTWA 2XPJA 2PAMA 4IW3A 4FPHA 3EXUA 2W1QA 4YZ5A 3BVCA 2G19A 2Y34A 2PQSA 1OT5A 3NV4A 3VKMA 5BNNA 1FNYA 2XUMA 3OCPA 4YM1A 1IG0A 1EUTA 1PO12 2OZ6A 5C8CA 5T5LA 4GWJA 4MGZE 2PN5A 4QXBA 1QJY3 1N3PA 1YLLA 3RGBA 4OZOA 3VDCA 4QX0A 1H1MA 2J22A 4E4DX 1UU5A 3RZMA 1HB4A 4EN8B 4L99A 3KF3A 3H1YA 5CB7A 2ADDA 5L9VA 5JI7A 3HWJA 4YGBA 3I49A 1LB2A 1FPN2 1KDKA 3NV1A 1E5HA 1GSLA 4WVZA 1VRH2 4J25A 1XU1A 3FL7A 1XYOA 5IHRA 1XJAA 5K8SA 4ISRA 4YPJA 3O7OA 3T4VA 2Q4SA 4BH9A 5JSRA 5J3UA 2XQRA 5D2AA 4QDSA 3F95A 5LRRA 5LW9A 3VBOA 3JCIA 2ERFA 1TZOA 3AKQA 1U5IA 4LO6B 4Q4V2 3VL8A 2XVKA 2IZWA 3HNYM 1POV1 1UL9A 3DEMA 3FBMA 3FFZA 4LITA 3WLUA 3HN3A 3O1RA 1ODMA 3APBA 1H9PA 1HJFA 2VMFA 2YV8A 3B00A 3GBGA 3MLJA 3POEA 4FT8A 3ILNA 1YQCA 3D3AA 1POV0 3ZSKA 4XDQA 3KM5A 4LLOA 3IIAA 2GNMA 1GNHA 3SCFA 4CDXB 1I6XA 2EXHA 1VBC1 2V73A 5L9BA 3RPQA 2HEYF 2ZGLA 3RWNA 3BTXA 1PVXA 4KL1A 4FPOB 4IETA 2IUWA 1C28A 4RR3B 3AL5A 2H6CA 4V2VA 5F8PA 3ATGA 1FPN1 1NG0A 2Q1MA 4BIFA 3N9QA 4B4PA 4MGTA 3H3UA 1BKZA 2QDNA 4Y4RA 3KV6A 3VGIA 3I3BA 3LEIA 3GM8A 4CUBA 4FBFA 1KEXA 1AJKA 2JDAA 3CHXA 1X8MA 1OD5A 4AXOA 3T2TA 4YG0A 4YZ4A 3HNBM 3WUDA 3AP6A 4OCTA 1LECA 4GH4A 5FREA 3WF0A 2FDFA 4U36A 1K42A 1PHMA 4A42A 2D6OX 3EO6A 5DG2A 2FZ1A 5C4WC 4ES8A 4UXAA 2GC2A 3KCYA 4FAHA 1FYUA 2GN3A 3JQWA 1NXD1 1UY3A 5BNPA 1N3OA 4D7SA 3OOXA
chains in the Genus database with same CATH topology
2R49A 5GZEA 4GMP1 2XB6C 3ZFGC 2RM23 4L92A 4LA2A 4GKXA 1PVC1 1ASJ3 4EN9B 3ZXFA 4IL7A 1NCRA 4MXWA 4AEDC 3OY8A 3VHOA 2ILMA 1QKQA 3WUCA 1I9RA 3N36A 3ZYRA 3MGUA 1Q43A 5FMOL 3POYA 4QPYA 5L36A 3M2MA 3ME2A 2O1QA 4QD2A 4NHKA 1HQLA 4UW5A 2D3RA 4AF9A 5T52A 4CTEA 2I2SA 3DPRB 4BCUA 1PO22 1HRI2 1R091 2FMYA 2PFWA 3G6JB 4L97A 5E1RA 2DFCA 4ZU4A 4AGRA 1SEFA 4IV1A 3WW3A 2A3WA 2HEWF 1GR3A 1ZBE3 5T3NA 3SH3A 3VZLA 4QPGC 1LOEA 5J96B 3WY6A 4KU8A 3ZXDA 1VBD1 3D82A 4L9BA 3ZFGB 1AR81 1SQ4A 2PHFA 3GBFA 3SXWA 3J8F1 1C1FA 3J8F2 3VV1A 2VMGA 5JDBA 2RJKA 4XEZA 2C1FA 2D6LX 2WFPA 1HX6A 1OQDA 5FFOC 2MEV2 3DKWA 3ACLA 1N1YA 3U0ZA 4CEYA 1GQGA 3KLSA 2NM1A 1UIJA 4RQPB 4LHNA 4TWTA 5H9SA 4FQZA 4R52A 1WLCA 1HV1A 4KH9A 2D6MA 2BPA2 1DYKA 1OOPC 1CAXB 1UX6A 4WM8B 5T54A 1ENXA 1R092 5DUWA 5HI0A 5BNPB 1QMJA 3OTFA 2RS32 3W59A 5KXDA 1QDOA 1UKGA 3ZFGA 3WZ1A 3ZSJA 2ET7A 4JTOA 1MS9A 3GHNA 4QM9A 1ZM1A 4HVQA 1WMDA 4PDWB 1LHVA 3JQXA 1AR71 2XG3A 4QPGB 1LOGA 3B93A 4LUKA 5HCFA 1URXA 3UKVA 1PIV2 3AKPA 3NO8A 1WMFA 3I4IA 4NPRA 4BYYA 5ABJA 1LJ7A 1CAXA 4Y20A 2DURA 1RUG3 3KQRA 4DB5A 1NCRB 4MXWB 1C4RA 3ZXLA 1ENRA 2YUEA 1MZEA 3AP5A 1YFWA 1YJKA 4OHVA 1A6CA 1LU1A 4Y22A 2LM3A 5FBZA 4C0HA 3KGZA 2WFF1 4CRQA 1XQNA 1FV2A 4XQDA 1LTEA 1AL21 1D0HA 3O5SA 1RUI2 1UN1A 4XMAA 1D4M1 4AI8A 5C4WA 2BWAA 4FP3A 1HRV1 2JEMA 1WD3A 4TZDA 1FOD2 5C6CA 3SITA 2GSYA 4WM8C 3ILRA 1PNFA 3FE5A 3OGJA 1POV3 4Y1XA 1T6GC 4GH4B 1HQWA 3TAYA 2CYFA 2ETEA 3R4SA 5E16A 3ZXEA 4YFWA 3DN7A 1VJ2A 4NOTA 3AZYA 4OUMA 5ABJB 3VBOB 3NL1A 3QH6A 1MVEA 3OPZA 3NV3A 4XPVA 1X7NA 3I54A 2WZPP 1EV12 1VBE1 3WOGA 3B94A 5JCTA 3JD73 2FHRA 3B69A 4EN7B 1Z7S3 3GZAA 2JE9A 1J3PA 2RS33 1S0IA 3MIEA 3ZXAC 1LHWA 2RHPA 2WS91 2AZ5A 2RMU2 3LA2A 1NCRC 2PHXA 4HLTA 5FPXA 2VMIA 1DLLA 1MACA 2JECA 2YDEA 3T1LA 4JRAA 1LR5A 1YFXA 4PLNA 1COV3 1QNWA 3WDUA 1IS4A 1RUI1 1DGWX 3ZFEC 5CFDC 1X50A 3AXEA 1J1LA 3AP4A 4K6BA 3E5XA 2CY6A 3S0MA 3V65A 3BODA 3Q9OA 1FOD1 4BA6A 2KXLA 4MV2A 1BVP1 3SISA 1LOCA 4B29A 4P9JA 4AEMA 1VBA1 4YW5A 1VBA2 1VR3A 4MVTA 3MF9A 2DVGA 3JU9A 3M3OA 3EQEA 5JVVA 3JB4C 3AP9A 3D4KA 2XKOA 1PZ7A 4Q4Y3 1I3HA 4BLIA 2OA2A 2OIIA 4DPNA 3MIBA 1WBFA 3CJIA 4CDUB 4OI4A 3M3QA 3MPBA 1Z78A 3GHMA 2G9FA 1HXS2 4FAGA 2ARXA 4G4FA 3E97A 2F4PA 3DPRC 3LA7A 4CDWA 1AR91 1ND3C 3ZN6B 2ZGOA 4PLOA 2K0GA 1REFA 4DS0A 2ZGTA 1QJU2 4NWWA 1OA4A 2ZJCA 3THPA 5AC91 4K9SA 4I02A 3MFCA 2JDZA 4YW2A 1RHI2 5FMOS 3H7YA 4RHV1 3KT7A 4YG3A 2O8OA 2WSUA 2A6XA 4F8AA 1DHKB 2GU9A 2D97A 1K5MA 3ZFFC 4O9GA 2RJLA 3KGLA 2D40A 3VBFC 3VBUC 4Z07A 1RVF1 3NWKA 1YWKA 1MZ5A 1O4ZA 3QOPA 2HWB1 1H1AA 3FX3A 3IDCB 3OYWB 1W6QB 3QBQA 3LA3A 2R062 1LU2A 3V0AA 1YNAA 3MEPA 5GLVA 4RR3A 1CAUB 1YO8A 4I0WB 3EBRA 4Q0QA 4D7YA 5A33B 1F5FA 3ZYIB 4NVPA 4Q1RA 2HWE2 2XBO3 4CDXA 4D7TA 4Y1UA 2YMZA 3HMYA 5T50A 2CTVA 1IGOA 2VOWA 1G7YA 3L9JT 2VMHA 4URTA 1FMD1 4XJWA 1IQAA 3RZZA 3UV9A 4KNCA 2I74A 4PQ9A 1QQP3 1OQ1A 3W58A 1PGL2 3PLQA 4YARA 2WQ4A 1WW5A 3DV8A 3UK9A 3NJZA 3HBZA 4JGYC 4FOQA 3EHKA 1VALA 3MI8A 2B46X 2RM21 2OYZA 3AKRA 5ACA1 3VDDB 5GM0A 2RS53 2JG9A 1ZZ7A 4TSVA 1C5IA 3PJYA 1PZ9A 2GNBA 4OFGA 1V6JA 2UYBA 4M0NA 4OUSA 4AFAA 2BFUS 4CP2A 4DFSA 4ZU7A 5E88A 5L7OC 1A3KA 2UY8A 4IV3B 5EV7A 5EXOA 3WV6A 1Q8PA 3HT2A 4FXGB 2ZA9A 5KHHA 2VW0A 1JW6A 1RUH2 2R6QA 3AYCA 1TQ5A 3I8TA 3AZWA 5SV5A 1YIFA 4CDQA 1Y3TA 4YFZA 4AVAA 1WCKA 3T1MA 1BK1A 1UAIA 1QH7A 5CG9A 1COV2 2E51A 2OW4A 2AGSA 1WW6A 1C8M2 5CNAA 2YHJA 5GLUA 3O12A 3IM0A 4UW4A 1KRIA 3VLBB 3WG3A 3DGTA 2RMU3 4HETA 1DQ0A 1JUHA 1QJX1 1CAWB 5K0UA 5KXCA 2NZ9A 4Q4X2 4QGLA 4JGZA 2ZMLA 4S2FA 1R1A1 5A32A 2RR13 1AYM2 2UWCA 4EN6B 4ASLA 4AQSA 4GH4C 4KBBA 3VHPA 1L3JA 2Q0AA 2R30A 3HN1A 2X53S 1PO23 4P9GA 1ASJ2 4Y22B 4B8EA 4H14A 3NKTA 5CAZA 4BQ1A 3TBDA 2OUHA 2A75A 3PMEA 4YVWA 2ATFA 3VBFB 1CGPA 5EJ3A 2VULA 1W6OB 2GH8A 1OA2A 5FAXA 4QT6A 2JG9C 1SLLA 2ZMKA 1B35C 5AFBA 3VZJA 3O0XA 1RUH1 2Y38A 4D69A 1MEC2 1AXKA 3WDVA 3PVBB 1ZREA 5A3MA 4QPGA 2HEVF 1ND2C 2ZGQA 3CEWA 5I91A 5FPZA 1JHNA 3BOWA 5FO7B 2PHDA 4YZ2A 4AFMA 3ZIXA 2DVBA 2KM2A 2WNVB 5J37A 3J26N 3V0BB 1QGLA 3VBUA 4JAAA 1O3RA 4AFDA 2R16A 1RGSA 3N7LA 4Q0SA 2AREA 3JUUA 2Q1ZB 4A7KA 1DGWA 5L7OA 2WFF3 5KC6A 2VUJA 1FAYA 1PGW2 1UU4A 5D8AC 4AVBA 4M3CB 2XJPA 2XJTA 1D4M3 1QQP2 3H1MA 3N7MA 4K20A 2BBVA 4R9CA 1AVBA 3MICA 5GZGA 5CG8A 4RHV3 1O4TA 1RUE3 1TE1B 1CQ9A 5LK5A 3UJOA 3ILFA 1H2MA 2WIIB 4Q4W3 4S2DA 5IK8A 4I0BA 4MYEA 1QOSA 4A3XA 4QM8A 3B01A 1LGCA 1PMIA 3N4MA 4IEPA 3LKJA 4HMZA 1BQPA 3AJZA 1AZDA 3CF6E 1XU2A 5AVPA 2HWE1 4YVWB 3JD71 2MEV3 4XFGA 4Y1VA 3MIFA 1AR83 3KT4A 2BEOA 4Y20B 1RUC3 4AVCA 5JOXA 1ZRRA 3AX4A 2O0OA 1IHMA 3J4UH 5KHJA 2NLRA 2ZX3A 4KWLA 3AYAA 3AKSA 3LAGA 2D6KA 1C3HA 4U2AA 4LNVA 3RRDA 2IXKA 1NOVA 4YW4A 4YVWC 3PTYA 2E7AA 2NN8A 1DGRN 2LALA 5FCCA 4XTMA 2AYHA 4HBNA 1V70A 3PHMA 1H9WA 5C9AC 4KG8A 1IKPA 4ZU5A 3WX5A 2A5ZA 1Z0HA 4AHXA 5H9RA 1RUD1 4COVA 3CL1A 3DUIA 2VH9A 2DVFA 3U11A 1VBB1 4AGVA 3POWA 1VBA3 4KWJA 2GALA 3SCGA 1HXS1 5FRAA 2PTMA 2VVFA 2UYAA 2VOKA 1XNKA 4QPIA 2RMU1 3K48A 4Y1ZA 2IXJA 4XFFA 2NMNA 2P3KA 1QJU3 1UD1A 3H7JA 2JG9B 2VNOA 4MUVA 1BZWA 5JOWA 2MNGA 4XFAA 4XJZA 4P5HA 5DZFA 5FTTC 2NP0A 1MZFA 3OD4A 3UL2A 3H50A 1KITA 3A4UA 4W6WA 4FXKB 1MS3A 1YFYA 5T5PA 5EFUA 1G8WA 3MIHA 4CP1A 2WFF2 3WDYA 3PJQA 1TMF1 4LE4A 4CDWC 3TN92 3A0KA 4HSLA 1AXZA 1NQDA 4JVAA 3SMHA 2VNRA 1G9AA 1DGRA 1YXWA 4Z8BA 1F9KA 4MGKE 3GZTB 1ZZ9A 1BVVA 1HRI1 4FPFA 1RUJ3 2RR11 4BIOA 4ORFA 4YYOA 2GNDA 4WM7A 1U5YA 3M3EA 4HSJA 5I8YA 4X6RB 3LGRA 1DQ6A 1AF9A 1DQ5A 1M4WA 1MQTA 3WHUA 1J3QA 5BNPC 5IK5A 1E57A 3AK0A 5CFDA 4LR4A 1ND3B 2OPKA 3A0NA 1BEV2 1TME3 2ZGKA 4HN0A 4XOGA 4H55A 2GC3A 1EP0A 3CJIC 4I30A 2E9QA 1RMU1 1LOFC 2F6BA 3OD0A 1GYKA 1SFYA 1UU6A 1VAMA 1OPMA 2OUJA 4XFIA 2RE9A 1F8VA 4RR3C 3GF6A 4XQWA 3KSCA 1OI6A 3M70A 2HWD2 4N53C 1ZBA2 4GKYA 4GWNA 3ZFFB 4E2QA 3MYXA 1FPN3 3S30A 4YZ1A 1O5LA 4FTEA 2B9UA 3O0WA 1TNRA 5BV6A 4A2UA 2AENA 5DZEA 3WVJA 1RUE2 1ZZ6A 2Z79A 5BNQA 1EY2A 1QHDA 1HW5A 1PNGA 2GZWA 2PHLA 1C57A 1RUOA 2Q5TA 4PIXA 2VG9A 3N7JA 1OFSA 4AHZA 3WP4A 5C9AB 3DL3A 1GZCA 2HWC3 1G6NA 4YVSC 5F6KA 3VN4A 2GDFA 3AZZA 3AZXA 4PJYA 3AMPA 5C8CB 5SV8A 4IV1C 1PIV1 4TLFA 2EAKA 1EPZA 2I07B 1LCLA 1RUC2 1VRH3 1GZWA 1W39A 4DOUA 3V64A 4BWOA 1KJRA 3QD6A 3ZSMA 1QDCA 4BZ4A 4XFBA 1D4VB 4J1XA 4IEWA 4HANA 5IK4A 5GKAC 2WJSA 4LBMA 1V9U1 4DINB 4R9AA 5H9QA 2ZZQA 1R1A2 1ZZ8A 1ZBA1 3RJRA 1HKDA 2ZX2A 2IXLA 2YGLA 4PCRA 4GB31 5GALA 4GMP3 2HWC2 3RDIA 4JDOA 2BQPA 4FTSA 1ZZBA 4EN0A 4XXPA 3JBG2 1V6LA 4YGEA 4QX5A 4JV4A 1FT9A 3TNQA 4HK8A 1KFUL 2XKPA 3RNSA 3ZX7A 4CEWB 4YSFA 5K9YA 3AM2A 1QJY1 3TN93 4AHYA 4WVWA 1PO11 3QH7A 1DF0A 3VBHA 1DU3D 4L8QA 5CBLA 1ONAA 4Q27A 4SLIA 5JPMB 4QHBA 4WM7C 3ST7A 3D8CA 1UZZA 4NHMA 3TB0A 3S6PA 1XE8A 5JI9A 4CDUC 2XBO1 4CYDA 3CJIB 4FVVA 1AUYA 1DZQA 3O0VA 4KU7A 4Q1PA 2G4IA 4LBJA 3GBWA 1H2KA 1ULEA 2X5IC 4IEUA 3VKLA 1OKQA 1ZBE2 4EJRA 2E7QA 3KS7A 4NN0A 4E4ZA 4XF0A 4XW3A 4Q0VA 1O7FA 2BVVA 2D3SA 5BUVA 1VBC3 2JICA 1UZYA 2HWF2 4BM8A 1N1TA 3B3QE 3D5OA 4HN1A 4QQPA 3D6EA 2A3YA 4AEKA 1W6NB 1QH6A 1O91A 2RS51 4FPYA 5BNNC 2DV9A 1AR62 4ASMB 4M3CF 1N47A 3MZHA 5DDJ1 1BEV3 1SACA 1TME2 4C90A 1R083 2XBO2 2DCTA 4HPKA 3KMHA 1QF3A 1RUD2 4NHLA 2WWSA 1RUJ1 4N43C 4I01A 2Q8OA 2Z42A 4M00A 1ULFA 4PDWA 2W52A 4LLFA 3FUQA 1DYPA 4NR1A 1SCRA 2VXRA 3M1HA 2OVUA 3QLQA 1Q3EA 4WVVA 4JC1A 5FOJB 1W6QA 3ZXGA 1NE4A 3MW4A 1JXNA 4HL0A 2AH2A 5DXDA 1OOPB 3K51A 1JOJA 4AW7A 5JAXA 1RMU3 2RS11 4ES9A 4MZUA 2GMPA 3WCRA 4QPIB 5AC92 1GQHA 1CONA 5GLTA 4MX3A 3E6CC 1AL23 2Y26A 4RD7A 5FLJA 2VOXA 4GXLA 2P34A 1D0GA 2CAVA 2ZGUA 4N7UA 3MW3A 2FZ2A 3O14A 1SFNA 4YNIA 1QJY2 2VY0A 1NQJA 3NKGA 5JSPA 2RM22 5EYYA 5GZFA 4M01A 2ZAAA 1WLWA 2MPFA 4XJAA 4AGGA 4M0HA 3BALA 1NE6A 1OA3A 4XQ4A 5CA6A 5GJ6A 5A32B 1SLAA 1WBLA 4I3PA 2EAAA 4Z1VA 2DYCA 1A8MA 1RUG2 1S0DA 4OI0A 3ZXJA 1JBCA 2SLIA 3RS6A 2RS12 4EWDA 1PGSA 5BNOB 5DUXA 2A73B 4XTPA 2ARBA 2IFRA 2PLV1 1GBGA 4R9BA 4PBPA 4XYXA 1S0EA 1PK6A 2NMOA 2XHKA 5LK7B 3FZ3A 2DVDA 4COYA 1H4HA 2VGDA 1KJLA 4XMIA 3TN91 4MXVA 2WC2A 4Q4W2 3VBHB 2QJVA 2HJIA 2JX9A 3NAPB 4K21A 1CJPA 4RHV2 1EYBA 1RHI1 4E2SA 5LRSA 2X8KA 4OHXA 1VBD2 2YROA 3WT3A 1MS0A 4AQ6A 2JD4A 4ATFA 2PHRA 4GIQA 1RUE1 4PDWC 4YVSB 3PVNA 1GICA 1U12A 3WXPA 1S0JA 2CGNA 1DQ1A 3EJKA 4IEYA 1LENA 2VNGA 2FMDA 4AYUA 1CESA 2VUAA 4MH0E 1GKBA 1G9DA 1XYPA 1NCQC 2EVXA 1SBFA 1RUG1 2CNAA 1WGPA 2B39A 1WD4A 1UF2C 4P9LA 4UBGA 3U10A 2D44A 2WNEA 4AI3A 2ZCWA 3ZFEB 4C1WA 2DU0A 2H0VA 2XLGA 4UBHA 3GZUC 2DCKA 3MDPA 1AXYA 1RUC1 2R0FA 4LBQA 4EV0A 1QOTA 4K1YA 3B5LB 4WM7B 3LSDA 1Y43B 1NLSA 5IK7A 3R4DB 1CVNA 1HLCA 2DFBA 1DFQA 4JGYB 5JZGA 1W2UA 2BTVC 4A7YA 1YFUA 4LBQD 2XL7A 3IDBB 1LGBA 1UMZA 4N43A 4HK9A 5GLWA 4J1WA 2UWBA 3WG4A 3VDDC 2UU8A 2BFUL 2ZHMA 4Z82A 3VUOA 2B45X 2NYYA 1RUD3 5HCBA 1O5UA 2B8MA 1YUDA 5CFCC 4DNYA 2PAKA 4INDA 1OHFA 4ISQA 2R063 3WHTA 1HXS3 1FMD3 4LBOA 3D0JA 1AR63 4GALA 3BIWE 1SDWA 4LBLA 1Q56A 4AFCA 4IEVA 3J8F3 1HQNA 2R043 4HVRA 2DCZA 4KGQA 1J58A 1NY71 1XXNA 3KD4A 3WD5A 2XWBB 5F9TA 1V9U2 3SH4A 4HVOA 2Y0IA 3FMGA 1IS3A 4Y26A 1ULGA 1LOFA 1JH5A 4MLOA 1TEIA 1VRH1 2WLQA 2B7YA 5CFDB 5HBAA 5EYXA 1I1EA 4E9KA 4WVMB 2PHWA 2JENA 1OQEA 5DUUA 1F31A 2WNUC 2Z2SB 2QFEA 1QQP1 3OGGA 2NPIA 1G9BA 4C0BA 5BYNA 4WM8A 5FLIA 1WUVA 4LO4B 3LOBA 4XXAA 5BNNB 1AR82 1U0AA 1D4M2 2BUKA 3SCHA 1EAH1 1SLTA 1AR73 4DQAA 3RI8A 5BXXA 4Y5Z0 1D2SA 1BBT2 3HD8B 1RTVA 3E5QA 1WLTA 1F2NA 4C1XA 2HWB2 2XLAA 2TBVA 4N43B 3E5UA 3USUB 1VAKA 1J1TA 1ZZCA 4L11A 2G9GA 1LEMA 1H0BA 4RGGA 1TME1 1PVC3 4P9YA 3THTA 3UKTA 1WMEA 4L2NA 1H8VA 2VVEA 2YZ4A 3VL9A 3TRSB 3MLLA 2O8QA 4RSUA 4AWDA 4Z2WA 4OZXA 1AR92 1RITA 4BLJA 3KCCA 3DPRA 1DQ2A 4FPCA 1AX0A 1PO21 4META 3ZYGA 3H3ZA 4P9IA 4CDUA 2PLV3 4YVSA 4XBQA 1RUF2 3CNAA 4WZCA 1DIWA 3VBSC 2D5FA 4DY3A 2EA7A 4COUA 1KXGA 3RQ0A 3TOJA 3PVEA 2RS52 1ZBE1 3WCSA 4JQRA 5J7MA 1PVC2 1QXJA 4LO8A 4IQPA 1ENSA 3USUA 5KC5A 1EPWA 3VZMA 5KHIA 4XF4A 4XF1A 4CDWB 3VBUB 3MPPG 3BTAA 3ZFEA 4S2GA 1Z7S1 1K5MC 3ZFFA 1RHI3 3TWIA 4XF3A 4IESA 2WT0A 2E63A 2X29A 3C2UA 5J09A 4IEZA 4XFHA 2XJRA 4HKOA 1S2BA 1BBT1 4LTAA 2GN7A 4ITCA 4YG6A 5F5QA 2ZMNA 3VZNA 4Q29A 5D1IA 2A6WA 2JXAA 1V6OA 2BVBA 1YYNA 3C3VA 1ND3A 3WW1A 5C9AA 2P3IA 1BCXA 4XF9A 2DF7A 2TUNA 4XE9A 4XILA 4RS5A 1NYWA 1FOD3 3ZSEA 1DZTA 3B9CA 1MZ6A 2A6VA 2B42B 2PA7A 3LOIA 3NAPC 4CEYC 1BMV1 2X5IA 4ONUA 4GB32 4PIYA 4KWKA 3LCPA 5F6LB 1UPSA 1FI2A 3ZN6A 1AR61 4H3WA 2GNTA 4JGZB 3RYKA 5KHKA 2R1DA 4Z92B 3N7KA 3IBMA 3WW2A 5E8AA 4Q4X3 2BYVE 4XHBA 5L7OB 3VKFC 1KFXL 4B3NA 1OFNA 1QOOA 1ZVFA 5AFEA 1H1IA 1VBE2 2ES3A 2BNNA 3ECQA 4K3UA 4UW3A 2ZGRA 2VOVA 2EXJA 1XNDA 1FXZA 2HWF1 3AYDA 3LB9A 2PAEA 1ZYBA 3UKNA 3VBRA 3ZPYA 5F1RA 3RSJA 4Q8LA 4G9SB 3V0AB 2VVDA 4DMIA 4TYSA 4XIKA 3HR9A 4Q0UA 2XH6A 3VBSA 2ZGMA 2R061 1C8M1 2D98A 2W68A 3VKOA 5AC93 4HT1T 1XNCA 2MEV1 4Q2FA 4BPZA 5EZWA 4AFBA 3D0SA 5D8AB 1NZCA 2W0XA 2YYOA 1V6NA 4FOYA 4N7IA 2YPJA 1MEC1 3GYDA 1Q8SA 3JB8A 4CDQC 1MS4A 1CD3G 3CJXA 4FP2A 3I59A 2PHUA 1TMF2 2WT2A 5K0UC 1W6MB 1JTZX 4LEJA 1LKNA 5TSWA 4B7EA 4F3JA 4B4QA 2R0HA 4LUMA 5FOBB 5CADA 1ZX5A 1GNZA 2HWB3 1DBNA 1AHSA 4G3YC 2DVAA 1AX1A 2XGXA 3HT1A 4RQPA 5HXVA 2GC0A 2Z5WA 5DDJ3 4AVVA 1ZRCA 4AEJA 1UPIA 2HWD3 1PK6B 1VB4A 3IPVA 4UW6A 2CL2A 2ZHLA 1CAWA 3JBG1 5K0UB 4CEWC 3FLTA 5IT6A 4JRLA 4Q8KA 2P3JA 2W39A 1O4YA 4GA9A 3WQ1A 1OMIA 3IMNA 3PVOA 2P2KA 1HV0A 1W6MA 4AVSA 2JG8B 1JYCA 3RI9A 3AB0A 4JCKA 5GZDA 4FPGA 4H7LA 1YRZA 4YM0A 3WDXA 1H8TB 1UCXA 1GLHA 2UY9A 3M3IA 5I0SA 1HRI3 1S0CA 3VZOA 1SBDA 4N53A 3H9AA 4COZA 4FCAA 4GMP0 5ACA3 2ZS6B 1IZ3A 2EXIA 4PBOA 1YI7A 4CEYB 5JOZA 2BW8A 4RS5C 3CU7A 3ZVXA 2QKDA 4W6XA 1I5ZA 5LEJA 1N1VA 4YM2A 2WLPA 3RMXA 2ZZJA 1SBEA 3G7DA 4Y1YA 3OY8B 3WDTA 2YC0A 4WZFA 4F83A 1PK6C 4FOWA 1GZ9A 5JIUA 3AP7A 1AYN2 4PIZA 4R4ZA 2ZTNA 3V0BA 3AKTA 3R4UA 1PGL1 4LHLA 1FX5A 4WV8A 4RS5B 4CP0A 5EWSA 5C8CC 3WP6A 1CN1A 2UURA 5I0UA 3VHRA 3IN9A 4K7JA 4JTNA 5DDJ2 3RMYA 3P3PA 4XETA 4PF5A 4X8NA 5BY5A 4HPKB 2GC1A 1QJX3 2ZKLA 3NW4A 1EV11 2ZGPA 1U5XA 1XYNA 4FPEA 1REDA 2R041 2C5DA 3RG0A 1RVF3 4AEDB 3VBSB 4FTBA 1NA1B 2V5YA 4Q4X1 1VP6A 5K7PA 2BNOA 1VBD3 2VU9A 1NCQA 3B9IA 4XIOA 5AVAA 2BNMA 2ZGSA 3X29B 2HKXA 1W6PA 1O3QA 2HWF3 2GH2A 1OSGA 5C4WB 4CZSA 3ZSLA 1R093 3IT8A 5C33A 1BYHA 2ZAHA 1UW8A 3M7AA 2ZPXA 4AI2A 5KXBA 3I59B 3QCWA 2WNVA 1Y7BA 3KT1A 2RR12 2R072 1QNYA 2R071 1V6KA 3SHRA 1CR7A 2WZR3 5DG1A 5I8TA 1H8TA 4XJ9A 4QQLA 1RUI3 3LSEA 3FFQA 4BHPA 4C91A 4I2OA 4LO7A 1MVQA 1WW4A 5D8AA 4D94A 3R05A 1ALYA 1CAVA 3AFGA 1BJQA 1KDMA 3BPZA 1RUJ2 2A71A 5FQ0B 3B7MA 4QPIC 5JLVA 2E6VA 5JOYA 2D43A 4CDXC 2C9AA 4IV1B 5HCAA 5J98B 1KQRA 2R32A 2GMEA 4Q4Y1 3NSTA 5CU1A 5BNOC 4OHZA 1JYIA 2XJQA 1V9U3 5JR7B 1FNZA 1CAUA 2IWGB 1RB8G 4Q4V1 1JN2P 2IFWA 2CAUA 5L73A 1KS5A 3WINE 1PO13 3HIFA 4FPJA 3U07A 1QY4A 3WG1A 3JBG3 1QXRA 3AMHA 4M3CE 1XRUA 4AHWA 1ZRFA 2YGMA 3J9SA 4H7MA 5KBFA 2AUYA 4AE2A 2DWRA 3ELNA 1G9FA 1JUIA 5KWRA 2WA4A 2WQZC 3AMMA 1X33A 1AL0G 4N90A 3MLKA 2D6PA 1WCDJ 3P3NA 2ZX1A 3FC0A 1OOPA 4QGNA 2ZBJA 1N1SA 1XNBA 1RJ7A 3AFKA 1Z7S2 5KXEA 4NWVA 5ABJC 2GAUA 5KHGA 2BWCA 3ZIWA 4N9IA 1X36A 2VECA 3ZDSA 2I45A 1C1LA 1GV9A 4IEXA 1VLNA 4LULA 1HRV3 2WS92 1RINA 4AQ2A 2IXHA 2WSVA 2QE3A 3AJYA 4HFSA 1YIPA 2TNFA 4OHWA 2GMMA 2V09A 4AI0A 4Q4Y2 1AJOA