2WNUB

Complex between c1q globular heads and heparan sulfate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 27
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuB00
4G4FA 2R6QA 3TYJA 4DOUA 4KGGA 2X29A 1U5XA 3K48A 2HEVF 1OQEA 1JTZX 2RJKA 5KC5A 1XU2A 1IQAA 3URFA 1U5ZA 1GR3A 2QE3A 2R32A 4G3YC 1TNFA 2JG9B 1RJ8A 2JG9A 4MXWB 2RJLA 1S55A 1ALYA 3ALQA 4RSUA 1OSGA 2E7AA 2ZPXA 3B9IA 3V56A 3WD5A 3QD6A 1O91A 3MI8A 3B93A 3ME2A 4OUMA 2HEWF 2QDNA 1XU1A 4EN0A 1WCKA 4KGQA 1I9RA 2RE9A 2OIIA 4QQ2A 1D2QA 3K51A 4OUSA 4QQLA 5KC6A 4MXVA 4NN0A 1U5YA 2TUNA 4E4DX 5TSWA 2Z5WA 5HBAA 2WNVC 4KG8A 2WNUC 3FC0A 3B94A 2O0OA 4D7YA 1PK6C 3LKJA 2JG8C 4QQHA 3L9JT 1C28A 2R30A 1D4VB 4HT1T 3QBQA 1PK6A 3IT8A 1TNRA 1OQDA 1C3HA 1A8MA 1JH5A 4F3JA 4J6GA 1KD7A 2ZJCA 5L19A 4TWTA 4GIQA 5KWRA 1DG6A 4N90A 2JG9C 4QPYA 1RJ7A 2Q1MA 2AZ5A 2HEYF 3AB0A 1DU3D 2TNFA 4QQPA 1KXGA 4OULA 4MSVA 4TSVA 2Q8OA 2WNVB 2WNVA 5L36A 4DB5A 2WNUB 2WNUA 5BNQA 4MXWA 4QQOA 5CIRA 1PK6B 4E4SA 1D0GA 2KA3A 2JG8B 2JG8A 3TWIA
chains in the Genus database with same CATH superfamily
3MGUA 3NO8A 5DMYA 5FTTC 1GOGA 1KJRA 2GMMA 2RR12 5FZ6A 2W39A 5HI0A 2R0FA 2W2IA 3T2PA 4CDXC 3WG2A 1AR82 1VBE2 3JQWA 4MV2A 4I0BA 5D21A 1WCSA 1BQPA 3LA3A 5FZ4A 5F7UA 1XYNA 4QT6A 2V4VA 5I8SA 3J8F2 1XB9A 4NAMA 1VBB2 3FBMA 1AL21 5G04L 1NCRB 2ZHMA 4RYDA 2ZXQA 1T6BX 2BWAA 4XQDA 3DN7A 3MICA 4P02B 5E89A 5CU1A 1W0PA 3NW4A 1AX2A 1MEC2 1ND3C 1W6MB 3POJA 2PQSA 3JU9A 1J3PA 1LHUA 2BEOA 4HETA 4PLMA 1YLLA 5JZGB 1GOFA 4XF9A 5IUQA 1YQ5A 4BJ0A 1VPHA 5IK8A 2PAEA 1NZIA 2BTVC 4LPLA 2ES3A 3E5XA 3HNBM 4BQ4A 3J4UH 5DZFA 4OUMA 3SISA 1AYM2 3U11A 3HIFA 5CZKA 1UF2C 1S2KA 3GNEA 4AVTA 2WUHA 4CZSA 4BQ2A 3OGJA 3RS6A 3VUOA 2HWD1 2H0VA 4NR1A 4TLGA 2DWRA 4XJUA 1TVGA 4XJ8A 2H0BA 5IAVA 4Y20B 3AKTA 4CXXA 3TN92 2EA7A 2GMEA 5JOZA 1CGPA 5IVFA 3S5QA 2VUJA 1WCUA 3PLQA 4JZRA 5FPAA 3B7MA 1EAH1 1GP6A 3CMGA 5FZ3A 1OUSA 3AYDA 2YPDA 4FTSA 2W0XA 2I45A 5E1RA 4E8DA 2VAUA 3FLTA 1F4AA 4LKSA 4KQ7A 4OZXA 1PNFA 1RUI1 3DPRA 4NAOA 3B94A 1GP5A 3AVRA 4B1LA 1VJ2A 4LT5A 4KU8A 2A6YA 4NJ4A 5FK7A 4BPZA 1N1VA 4NHMA 1S0JA 3T1LA 2YB7A 2PHTA 2GZWA 1ZBE2 4HT1T 1KJLA 1UPIA 2IVJA 1X9TA 3QBQA 3OBTA 2Y34A 3O7OA 3H1MA 1LCLA 1GZWA 4QX8A 5FZCA 4LKDA 2VM9A 1QJEA 1S2BA 2JICA 4I3PA 1YI7A 1OA2A 1SPPA 5FAXA 1ENXA 2D3RA 5H9QA 5L19A 1QNWA 1EYBA 4NWWA 1N3OA 2CL2A 3HT1A 3LAGA 2ID4A 4M01A 3I3BA 2ETEA 2VQ0A 1TMF1 5A7SA 3NSTA 4W6YA 3T2QA 2PELA 2VW1A 2W1SA 3UK9A 4A3XA 1O59A 1PIV2 1FATA 3AC0A 4JTOA 4MSVA 4AYUA 4AQTA 1O3RA 5FMOL 5C71A 2JD9A 3R4DB 2OZ6A 3N35A 4RQPB 4CDQA 1IPJA 4ZU5A 2D3SA 5FP9A 3DEMA 1RVF1 4DUVA 3B02A 2HWC2 5C4WC 4ZS2A 3WDTA 4CXWA 3EBRA 4GAZA 2LROA 2WBKA 4XFAA 4CCMA 3O1MA 5F5CA 4UFMA 4UXAA 4JQTA 4YVSB 2DUOA 4GWIA 3WZ1A 5T5LA 5T54A 5FKCA 3WLUA 2ENRA 3K48A 4L92A 4C90A 4Q1RA 3SHRA 1JODA 2P6HA 2RV9A 3ZYRA 1LNSA 2D98A 2HEVF 5I0DA 4FVVA 4IGPA 1UY0A 3KVAA 5D8AA 3UNPA 1AX0A 1ZBA1 3BALA 2CWMA 2ZOEB 3URFA 3I2OA 4WM7B 5CKMA 3DECA 3WF2A 3WHUA 2D6PA 4SBVA 4K7JA 4XURA 1F8VA 2ZHKA 1OLMA 2ZGTA 2WZR1 2A6VA 1JUIA 5C9AA 5FXVA 4UW5A 5FYCA 2ZBJA 3V64A 5A6ZA 3TEYA 4IL7A 1W6MA 4XJ9A 2UWBA 4UFKA 5ANNA 3IBMA 4M0NA 1QOOA 1K45A 4ASLA 1NLRA 5JZGA 3RZGA 1BEV1 4H55A 3TEZA 1RMU2 1X8EA 2MEV3 3GZTB 2XWBB 3KQRA 4NPRA 3MI8A 4BLJA 3ZSEA 5A6YA 3GXUA 2ZAHA 5A32A 1W9TA 4AI8A 4YW7A 2VCBA 4H3WA 5T3NA 1QXPA 3DF0A 4KGQA 4F7ZA 2UURA 4AAXA 3AZYA 3E6CC 2HYXA 1HV0A 3QCWA 2DU0A 1WLWA 4FI9A 4HK9A 3WF3A 2QNKA 3WG1A 2OIIA 4QQ2A 4DPNA 1NA1B 4BQXA 4Y20A 3POYA 4BQWA 3WW3A 3UV9A 2RR11 4Q29A 4BQ5A 1VALA 1X33A 4IE6A 2VD7A 1AR81 2RDRA 2RS53 5FJHA 5C6CA 1RYYA 1GQGA 2C9AA 5LEJA 4FOVA 2ADDA 4MVTA 4W50A 5FRAA 2QBXA 1F35A 2UYAA 1G7YA 4YVWA 1OPOA 1REDA 2JB8A 2JE9A 1AF9A 3I59B 4HN1A 1GKBA 3CU7A 2GNMA 3VN4A 3WUDA 4YG6A 1EV11 1QJX2 2C9KA 2D40A 2VMGA 3AP5A 2XBO3 4RHV3 1CWPA 1LGCA 1NE4A 2YFZA 5BYNA 3VD4A 2ZTNA 3I2FA 3C7FA 1MEC1 4QXCA 3WP5A 1AYN2 4YRDA 4DMIA 3ZN6B 2XL9A 2A3YA 2YFUA 3N9OA 2IXKA 2WQ4A 3LEGA 5C3QA 1PO11 2E53A 5JOXA 1STMA 3S6PA 2VY0A 5IVCA 3O1OA 5F6KA 1VMHA 1VB2A 4XACA 4YW2A 2BV4A 4X8PA 2Q8DA 1AYM1 3U0ZA 1RUG2 2BBVA 3Q8BA 4CCNA 4N90A 3U4XA 2XJPA 3D4KA 2W1WA 1RUF2 1XRUA 4HLTA 4XAEA 2PHRA 2AZ5A 5LA9A 2WSUA 5LBCA 2HYKA 3NJYA 4HSJA 1RUH2 4JGYA 4Q27A 5FZ1A 3W21A 2UY8A 4YZ4A 3WF4A 1W06A 2A7AA 1PO22 3HBZA 5D2AA 1UU6A 4CCJA 1APNA 1BBT2 4XMIA 4IXLA 2PHUA 2VCMA 3DKQA 3VZOA 4B29A 1Y9MA 5DG2A 3VBUC 1A3KA 1HQWA 5LK5A 5FY9A 4IEUA 1D0GA 1QJY2 3SCHA 4YSFA 4COVA 2ZGSA 3VHNA 3EMRA 2PAKA 3RI9A 4MLOA 1N1SA 2WFF1 3NNFA 1OLRA 4X6RB 1COV2 2Z4FA 1AJOA 5DZGA 2PHLA 5FZKA 3J26N 1BVP1 1DIWA 3HQRA 3ZFEB 5EZWA 5T5JA 4LO8A 4BQYA 5JXGA 3I2IA 5C8WA 3H9AA 1AR62 1ZBE1 3ZM8A 1JYNA 4JGZC 1DGRN 2R063 5CNAA 2OX0A 3WHTA 5FPZA 5F37A 5DUXA 1SQ4A 1RUC3 4WM7A 4GQ7A 4MOAA 4GJYA 3CJXA 1R083 1AXZA 1CX4A 1L3JA 3WV6A 1WMFA 1V6JA 4HG6B 1K42A 5EJ3A 4BQ3A 3OUJA 4XUNA 1DGLA 1DYOA 3AMHA 3DPRC 4IEWA 4QM8A 2VUAA 4ASMB 1K5MB 1VBC1 1TG7A 1RUD2 4XDOA 4JKKA 3R4SA 2D3PA 4XIKA 3WP3A 3ZX7A 3VZMA 1R64A 3VBRA 3DYPA 4PJYA 1H6YA 3PJQA 3OG2A 1VBD2 2E9QA 3N9MA 3WD5A 3WNKA 5AC91 4QX5A 1RHI2 2VG9A 2XLAA 4Y5TA 1NCQC 1IPSA 1KS5A 2PHXA 4PDWB 5M0TA 4XHBA 1SLAA 2D5HA 3OYWA 1ND2C 4MGKE 2GSYA 1QDOA 4CVUA 3B69A 1FMD3 3JBG2 1JYVA 1W8TA 3SEPA 3OTFA 5FP3A 5A3MA 3LB9A 2WRAA 1V6KA 4QX1A 3H3ZA 4CP9B 2BGCA 1J58A 1C8M2 4J1XA 5LA1A 5KR7A 3RZJA 4JHZA 1AHSA 1LHWA 1W6QA 1PGSA 1SZBA 4MXVA 4NRMA 1W2TA 3PJYA 4QM9A 1F2NA 1JU4A 4EN9B 2GP5A 2QZ2A 3ZKYA 4XAAA 4META 2ZACA 4KBBA 5CFCC 5GLWA 4IDZA 4GKYA 3JD72 1H2NA 1CIYA 2A73B 2H6BA 1N3QA 3I59A 4N53A 2WSVA 1S0IA 3H42B 4XQ4A 3LEIA 5FYVA 4A4AA 4P5HA 3BYWA 5IFTA 4TTGA 3Q8AA 3NNJA 3ZN6A 2D6MA 3LEMA 1PK6A 4Y3OA 1E57A 3KM5A 2CHHA 2E33A 3AXEA 2AEYA 5LWBA 1RC6A 2J42A 4EJRA 4AG4A 1H1MA 4AHWA 3ZFFB 1VR3A 4F3JA 3LEKA 1HJGA 3THPA 4CEYB 5AFBA 3JB4C 1NQJA 1YFUA 4RR3B 2ZJCA 1NCRC 1W0OA 2JDHA 1OFSA 3DUIA 2XG3A 4IEXA 1IHMA 1VRH3 2RJ2A 3VDDA 3QLQA 2A6ZA 3NMBA 3VGIA 1LULA 5JXHA 2WZPP 3LSDA 4LBOA 4YWAA 4K1YA 2ZGKA 3OBZA 1W2UA 4LO5B 4OULA 5EWSA 5FP8A 4BMEA 1ASJ3 2QQLA 2NM1A 2FDKA 5JZGC 3WDYA 1UIKA 1IZ3A 2B9VA 4WVMB 4FCAA 4PIZA 1GZCA 1URXA 1XOYA 3HN3A 3J7HA 1XXNA 1Y43B 4M3CB 3RYRA 5FV3A 3TWIA 2YGLA 2XLFA 4FFFA 4G4FA 5L73A 4EWDA 2FQPA 2PMWB 3R05A 5LRRA 4S2GA 3KB5A 4OZOA 2VMCA 2YY1A 1QJX1 4BU2A 2EF6A 4JAAA 3OGGA 3VLBB 3ZDSA 4CSWA 2RS32 3CZJA 4FOQA 3PIGA 1F4HA 4IW3A 4LBQB 3IIAA 1LGNA 2VW2A 3PVEA 5FOBB 4FTBA 2EAKA 2JWPA 4OUEA 3MW4A 4XZUG 2VQTA 4NHKA 3M3IA 1NXMA 3POBA 2J7MA 5ACA2 3VD9A 2W92A 3SH4A 1E5RA 2WAAA 1V6IA 3IMNA 1C4RA 3OOXA 2WYFA 3KT7A 4COUA 2IFWA 2LS6A 1MS3A 4AVSA 1K5MA 3MV11 4ZY9A 4FBFA 2RS12 3UT0A 1VRBA 1K12A 3CQOA 2IXJA 1QJU1 5JWPA 2E7AA 1RUH1 2ZPXA 1WWYA 3WQ7A 4CCDA 2FCTA 1H8VA 4AQ2A 5AFEA 1PVXA 1RL3A 4AEKA 5JAXA 1G86A 1ZZBA 3I2DA 4Q5OA 1QXJA 5FUPA 4BZ4A 2R1BA 4PDWA 2DBNA 2VZPA 2O8QA 1DP0A 4QHBA 5T55A 1JYIA 2EICA 2GC2A 1GNHA 4JX0A 2GU9A 2RE9A 5GM0A 4AWDA 2DVAA 3ATGA 4Q4X3 5CKQA 2EXIA 3SNMA 3UGGA 4CYDA 4UW3A 2XGXA 2A3XA 3T08A 4Z2AA 3VKLA 3DL3A 1AR61 2BGPA 2Z5WA 2PTMA 3I7DA 4AF9A 2VMHA 4PT6A 1EPWA 3PDQA 2BNMA 4RQPC 4Q0QA 4CU7A 1UYZA 3N36A 4J25A 2W46A 1GYKA 3M3CA 3BKZA 1KFXL 3LKJA 4MGTA 3PU8A 5ABJB 3HPNA 2K0GA 1AR93 1D4VB 3CZUA 4WBBA 4XILA 5FYYA 2WN2A 4YVSC 5KHIA 2XJVA 5IW0A 1JW6A 4JDNA 5A3NA 3MV01 1Z78A 2Q4SA 4BXFA 2WT2A 1SDWA 3RDIA 1J84A 1SLTA 2R7EB 4KH9A 4NRPA 3OF1A 4O9EA 1J59A 4LBJA 3O1UA 3F2ZA 1XSRA 4CUGA 3NV4A 2QVSB 4AVAA 1VBD1 4K8RB 3ZFFA 2E7TA 5DDJ2 1UOJA 2E7QA 1O8PA 2OXBA 3I3DA 4CEYA 4WM7C 4RA0A 4RR3A 4Y4RA 2IC1A 2XUMA 2Z69A 2BPA2 1W6NA 5J3UA 5CEHA 3JBG1 2JB4A 4OQ9A 5B4XA 2I07B 3HR9A 2HJIA 2HEYF 1Q8VA 1OFNA 4Y33A 5DUVA 4DXSA 3W5MA 1ZRRA 3Q8CA 4BE3A 4Q26A 4D6QA 3K46A 4B3NA 3UESA 1KXGA 1X82A 1MS8A 4XFIA 2WNVB 5C8CB 2P17A 4E9KA 3A21A 4ISQA 2UYBA 4WVMA 3RFRA 4ARYA 5F3EA 4DEVA 1AL22 4FPEA 3LOIA 4M3CA 3JUUA 4KWJA 1XE8A 3POGA 1JS9A 4JCKA 2Y0OA 5LK7B 3JD71 1CESA 1HW5A 1VE0A 3NQHA 2LM3A 2FCVA 5FZOB 2IVIB 4FP2A 3F95A 1GANA 5K0UB 1NA1C 2BOJA 3OSDA 1S0GA 4L9BA 5F39A 4Z2WA 3IDCB 1MQTA 2GALA 5A3TA 1LRHA 2ZEZA 5LEKA 2ET1A 3LDKA 3VHRA 2C0ZA 3KCCA 5FPLA 3PTYA 1O5LA 3JCIA 3VL9A 1IS3A 5FYMA 2BP6A 2LALA 5IATA 4Z07A 1AUYA 1S55A 2XWJB 4P9IA 3VBHA 2JDZA 2VZTA 1OD5A 2HWD2 1B09A 4FFIA 4RSUA 4L0PA 1UIJA 5J96B 1W2NA 3ZR6A 2ZHNA 4HBNA 3H8RA 1R093 2XBO2 5DXDA 3GHMA 1NLQA 2W87A 2HBTA 3LDBA 4OMDA 2QQKA 1HJFA 2JIJA 4NPLA 2CGNA 4N7UA 4P08A 3ZYFA 2V5YA 2VMEA 5I91A 3I97A 2Y33A 3VD3A 3PMSA 4C1WA 4EN0A 1HDKA 3D8CA 2EAAA 3RGBA 3I3MA 2JDPA 1AXYA 1PGW1 1RUI2 5FXWA 1Y9QA 1I9RA 3AP6A 2VZ3A 1JOBA 2CU5A 4LTAA 4QX7A 3THTA 2GC1A 5A1FA 4CTEA 4HVRA 5CBLA 1RUE3 4HKOA 3KF5A 2YZ4A 4FPGA 2ZGLA 1YIPA 4O65A 5J36A 1CD3G 4E4DX 5TSWA 5DZEA 3AZWA 2DFBA 4L99A 2ZMKA 4XFGA 3ZYPA 5CYYA 2UWCA 2YDEA 4YGCA 4QKNA 2ORXA 5FY8A 5FZFA 5KXCA 2W94A 5LRSA 2FDFA 4LK7A 3W58A 2O0OA 2WZEA 2WQ8A 2ZMLA 2OKXA 4AI3A 4AVBA 1W8FA 3AXDA 2J1RA 3GBGA 3MIDA 4HFSA 5ABJA 2JIGA 4Z1VA 3P1IA 4URAA 1ZA7A 1FNYA 2Q8CA 3B01A 1TMF2 4NHYA 3I2JA 2J1AA 3CJIB 3T09A 2YBKA 3ZFEC 4XCBA 5FCCA 5SV8A 1NE6A 4MG2A 2XH6A 1TNRA 3FLRA 1CZTA 3OGVA 1OLME 4KWKA 2JDYA 1ULFA 1GZ9A 2YYOA 1XNCA 4QKDA 4DUXA 1DQ2A 2IWGB 2ZZJA 1ULCA 3VDBA 1LTEA 4E8CA 2CDOA 3AYAA 1UZVA 4TWTA 4EWEA 5T52A 4GIQA 4Q4V3 4XVHA 5FXXA 2WA4A 3EB7A 1R082 4R8HA 1QWRA 5F9TA 1S0DA 2Y64A 1K5MC 1G9CA 1IKPA 1MZFA 1W9FA 4ES9A 1G9AA 2WNVA 5C8CA 1FAYA 1LAJA 4AFAA 4LIUA 5DUUA 5EYXA 3ROUA 3VDCA 1ULDA 1OD3A 1OURA 1PM4A 4L8QA 3B3QE 1ZBA2 3R4UA 4MHUA 4P9GA 2XKOA 1Q43A 4Z82A 4PDWC 1GFF2 4CEWB 4E4ZA 2R6QA 1YFWA 4LR4A 5A7PA 2HH9A 1UW8A 4OCTA 4Y1ZA 5BUVA 5FZOA 5FY1A 4ORFA 4FAGA 2JXAA 4QX0A 3P5BA 1DYKA 1WCDJ 4XBLA 3TBDA 3ZN5A 1XE0A 3RNSA 3DYOA 4D3WA 2XR4A 1IS6A 5A7WB 3N9LA 1UYYA 1A78A 4UYBA 4PBPA 2BU9A 2GAUA 3T0AA 1W39A 2QE3A 4P00B 2D6OX 3HBKA 3IDEA 4CDQB 1N47A 1SACA 1ZRFA 3GALA 1RITA 1MS4A 3J7LA 1JOJA 4KU7A 2DVBA 4QGLA 4E2GA 4ONUA 3VBSA 1VBA3 2R043 3NAPA 4I0AA 1KDMA 4FT8A 3WY6A 1OSGA 1HV1A 1W28A 2VNVA 4C8DA 3PHMA 2DDUA 1O6UA 1JBCA 4FOWA 3ACLA 4QX3A 3GF6A 1H6XA 1ONAA 2ARXA 2QDNA 5D8AB 4Q8KA 5IWFA 1WCKA 4PI2A 4FQ4A 3ZFFC 1W90A 4AEDB 3ZO0B 4XOGA 2BGOA 1OF4A 3N7LA 2MEV1 3C7EA 4RR3C 2CGPA 1PMJX 1GQPA 2Y6KA 1EV12 1W6PB 3AZVA 4P9YA 4QPIC 3C7HA 4S2DA 4AK3A 4BB3A 4E2SA 5C9AB 4I02A 5FLHA 4Q1PA 1DZTA 4QQLA 5J48A 1OPMA 1GWLA 4GWJA 3K4ZA 4LOTA 3TNPB 1ZRIA 2ZX1A 5EP9A 3PUAA 5GZEA 2BZDA 4JHTA 2WO7A 2ZKLA 5DAXA 4NIIA 1PO12 4PF1A 4K21A 3AP7A 3KF3A 3N9NA 2W68A 4UI9L 3EJKA 2BBAA 5FO8B 2PYTA 1HB3A 1JZ2A 4CCKA 4D6SA 4IEZA 5DUWA 1UQXA 4GMP3 3WVJA 2Y0IA 5A32B 1SFNA 3O0XA 2RS51 4PLOA 1H0BA 4LNVA 4DUWA 1WW5A 1W0NA 1BZWA 4N43A 4XJWA 5C3PA 1S0BA 3O14A 2QUOA 5T50A 2VOTA 5HCFA 3E5UA 2GDFA 3CJIA 5EYYA 1D2SA 4IQPA 3OEBA 4YG0A 2BRTA 3KZ4C 5LY1A 1UYPA 1REEA 3TAYA 2Y6LA 4ZHNA 1XSQA 2W52A 3LWCA 4GJZA 4H7MA 2XBO1 4RHV1 2W1QA 2D44A 3KV5A 2QJVA 2ZS6B 5EJZB 1LOAA 4IUGA 1H2KA 4AHXA 3QH7A 4J6GA 1QJZA 3VZNA 2XJQA 5FMDA 4NIAA 1EUTA 4IERA 4BK4A 1WMEA 2WFF2 4QPYA 4YVWB 3RJRA 3VHPA 3RQ0A 3UKNA 1GP4A 2W95A 4GH4A 1NX9A 1XYOA 1UX6A 1H2MA 4NOTA 4NIDA 1S0EA 3AFGA 3RMYA 5L36A 3MO4A 2DCYA 3ZR5A 5FYHA 5GJ6A 1J83A 3EXUA 1YXWA 2EXKA 3DGTA 3NKGA 2DVGA 1U5IA 4R4XA 3WW2A 1I5ZA 4U2AA 4CEWA 4N8MA 4QHZA 4BOWA 5JSOA 2VNRA 4Y1YA 3ACHA 2QQNA 3KLSA 1VBC2 4OI1A 4LBLA 2XVKA 3AYEA 2RHPA 4EN7B 1Q8OA 3A0NA 5A7WA 4JGYB 1LENA 4DQAA 1P8JA 2XKPA 3KV6A 4DS0A 5BNPB 1PNGA 5FZMA 2XVGA 4I3GA 5AC92 3WCRA 1UN1A 4QAWA 2GP3A 1Y3TA 2WO2A 1UAIA 1NUKA 2R061 3PMEA 2N7GA 2WO1A 3WQ0A 1ALYA 4U36A 2CAUA 4R9DA 1V9U3 5FYIA 4OI0A 2YC2A 1RUC1 2FZ2A 1AX1A 1CPMA 1RIRA 5ABJC 1R081 4NO4A 1HRI3 1QGLA 4IEYA 4FO9A 4Q4Y3 4BQ1A 3CLPA 3UETA 3KSCA 5HV4A 4COYA 3P3PA 3WF1A 5I0SA 4C1XA 2QQWA 4XETA 3H50A 4MGYE 3WDXA 3MLLA 4CXYA 3I2HA 5JXIA 3ECQA 2AH2A 4JDOA 4AEDA 1TE1B 2L9LA 1HB2A 1R1A3 2DCJA 1S0CA 1W6PA 4HPKA 1M4WA 2DVFA 5BPXA 2R073 3LD8A 1Q3EA 4B1MA 1GSLA 2LW8A 2X8KA 3USSA 1WA4A 5HV0A 1F9KA 1FMD1 2VR4A 4RFRB 1SCRA 2YC0A 5SV5A 1QKQA 3IM0A 2CDPA 2RG4A 3SEEA 1AR73 1L7LA 2EIBA 1POV3 4AQSA 1I1EA 2WNVC 2WS93 3FHAA 3VBRB 5C8CC 3NV3A 1YFYA 3BCWA 5CB7A 5F5IA 1JXNA 4LHSA 3ZIWA 4JKLA 1UL9A 3BPSA 3S30A 5A3LA 4UW4A 2WL1A 3OYWB 3VBFB 3EHKA 4LBNA 1DFQA 4XQWA 3WQBA 1XC6A 2G1MA 2W5FA 2NLRA 1SEFA 1C1FA 1YCIA 2ZX3A 1ODMA 1HLCA 2A75A 1PVC3 3UYJA 2VQAA 5CFDA 4QDSA 4XXAA 5K0UC 3O12A 4NWVA 4BIFA 4FSJA 4I09A 1W6QB 4LOSA 1QHDA 5H9RA 4QDRA 3VV1A 3M7AA 2G4IA 3MPBA 4BWOA 3BOWA 1V6MA 4EV0A 1DG6A 1XQNA 4MX3A 3IPVA 5A6XA 2R49A 2GH2A 4EROA 1CX1A 1ENQA 1MVEA 1UYXA 1B35A 4N53B 1OOPB 4Y5SA 2YG0A 3LF7A 3HOBA 4IEVA 4AI1A 3H7YA 4EWAA 3S57A 1YI9A 3OD0A 3ZSLA 1G9FA 5DABA 2XMLA 3HMYA 5KXDA 1VRH1 3MF6A 2YXSA 2VECA 3J7MA 1LEDA 3K3OA 2WNUB 4QD2A 4ZZ5A 1VAMA 4FP3A 3ST7A 3RZHA 1MVQA 1PK6B 1CAUB 2NPIA 5L7OB 4NPMA 3WW4A 1LECA 1XBFA 3VHOA 4MGIE 5FYTA 5EIYB 1FXZA 2YBPA 1ASJ1 3GJBA 4MO3M 3MPPG 1DLCA 2X29A 3E1F1 4GZ9A 1K3IA 4WVVA 4QB6A 4XUQA 4DY5A 3GBWA 1H4GA 2ZHLA 4I0WB 1D7PM 3VDDB 2RMU3 3FWEA 2XJTA 3CKHA 4YW6A 3ABZA 1QJU2 1JI6A 1S0FA 1ZVFA 4R9AA 4A6SA 2BVVA 1U0AA 1WW6A 1UZWA 3THCA 1NT0A 2R1DA 3ILNA 4BYYA 5BNPA 4LBMA 4LLFA 1RUE2 2ORZA 4ITCA 1TNFA 3IN9A 4WZFA 4MGZE 4B4RA 3USUB 2EIEA 4Q4W3 1CZVA 2ZEYA 3GCWA 4KWUA 1UOBA 3WNLA 4A45A 3B5LB 5C5UA 1Y4WA 1J3RA 2DV9A 4KWLA 3AL6A 4DY3A 1ZX5A 5HXMA 1QU0A 5JSRA 4D0QA 2DBIA 2IUWA 4OI2A 1SLIA 2KD7A 2XONA 3KV4A 3VBOB 2VVEA 2VTXJ 3W5NA 5F5QA 2J1EA 2Y26A 1KS4A 1XNKA 3KGLA 1O4TA 2P34A 5HXVA 2ZX0A 4LKFA 1D4M3 1ULOA 5DAPA 3FUOA 4C0BA 1QJFA 1QIQA 3D3AA 3O1RA 1WMXA 4Z92B 3DV8A 1GBGA 1QOTA 2ZGRA 3BN6A 1CAWA 4QB2A 5F1RA 1DQ4A 3BU7A 1HB4A 3BUCA 3N3HA 4X6QB 4XC9A 3WX5A 2DUPA 3LCPA 4Q4V2 5BV6A 3ZLIA 3OGSA 1UY2A 4NE9A 4M3CE 4NROA 1Q5OA 4HVQA 1O3TA 1SG3A 4H14A 5HPOA 1MR5A 2JE8A 4EZHA 4Q4X1 2WLQA 4WM8B 5FZEA 5K7PA 4D7SA 4AI2A 4OMCA 2VZOA 3A0KA 1QDCA 4HK8A 2QKDA 2VZQA 4BMBA 1FPN3 5C70A 2YROA 4V2WA 4CEWC 3BGAA 3VBFA 1OXCA 1UWWA 3CHXA 3FJSA 4X8NA 2EALA 3ZPOA 4F8AA 5A33B 3JZVA 2ZGOA 2OQ6A 1SBEA 2HWB3 2UY9A 4QWNA 2A70A 4XTPA 1MZ6A 5F5AA 3LIHA 5BNNA 4V1PA 4QGNA 2VOVA 1FT9A 3N7JA 4UW6A 1W8ZA 1W9SA 4CDWA 4MZUA 4DNYA 2D6LX 3OBRA 1UY3A 1AR91 1YQCA 2A71A 1DYPA 5LBFA 4QPGB 1YWKA 1JYCA 1H9PA 4P5YA 4C0HA 1ZRDA 3IZOA 2QQIA 4OHVA 4CDQC 1SLBA 4R9BA 5AVPA 3VDAA 2D7FA 2OYZA 4CE8A 1OOPA 4HOOA 3WUCA 5FOJB 5FYBA 4H7LA 1QF3A 1ZA4A 4YFZA 3LPFA 3MIGA 3W20A 5APAA 2DCZA 2NP0A 1VBA2 2E31A 2R042 2VMFA 4L97A 1OMIA 1SFYA 2WNUA 1UZYA 2A6WA 2GNTA 4MXWA 2PQQA 3GHNA 4XF3A 1WBFA 1CAUA 4AOCA 1UZ0A 5GZCA 5L7OA 5F32A 3EQEA 3S5AA 3KHBA 3WP6A 3T1MA 3PUIA 5D8AC 4DOUA 4I01A 3RZKA 1BKZA 3INAA 1HRV3 4TLFA 3T2TA 1U5XA 4YFWA 2ZGPA 3ZXFA 4YZ2A 2XJSA 1W6NB 5A7NA 4XFFA 2K2SA 3ZXDA 2ATFA 1MS0A 2OPKA 4IEOA 4AGGA 2BFUL 1EY2A 4IV3B 5C9AC 5FUNA 1JZ8A 4XABA 3R6SA 1VBE3 3DXUA 1MACA 2P3YA 4Y4YA 3PTRB 1BXHA 3A22A 4A3ZA 4DRRA 1YHFA 3J8F3 2JG9B 3USUA 2QQVA 1RINA 1VBB3 2O14A 3RI8A 1PGL2 4CUBA 2K46A 1YJKA 1HXS3 1PGW2 3ELNA 4YM1A 4FPCA 4JDMA 2B5HA 1OC1A 3OUHA 4XHXA 2G9FA 2Q0AA 3M3EA 3PUSA 4CP2A 4CPBD 3U75A 1Q8QA 3VBOA 2BUKA 1LOEA 4UFIA 1DGWX 1F15A 4GULA 3LFIA 2VZSA 3MEPA 3ZPYA 1VIWB 1D0HA 1CPNA 4QKFA 4XZPA 5JOWA 5FYSA 3FBYA 1BK1A 4D69A 1GWMA 3H0OA 3WDVA 3ZSMA 1YC61 4DRVA 1QH7A 1MQTB 3AMMA 1RUNA 1CJDA 4XF0A 1R091 3W59A 3I54A 5E16A 4LBKA 3BTZA 3C8XA 2A5ZA 5EJ1B 5JPMB 3NNGA 1DLLA 3SKJE 3ZKUA 2J1UA 5IFPA 1D2QA 3KWVA 4A7YA 4UF0B 4YVWC 3P6BA 4E4HA 3RZLA 4HONA 3VBHB 2VNOA 4DFSA 2WZ8A 1W8WA 3LZZA 4WZCA 3TN93 5JIUA 2VXRA 5A1AA 5DQ0A 4UWDA 3WXPA 4N9HA 4I30A 4FPOB 5CAZA 1PMIA 2CGOA 2WLPA 4WM8A 1OVPA 5IVJA 5FREA 4TZDA 5GZDA 4ARXA 4QXHA 1RUE1 1ST8A 3DCQA 4H2AA 4YZ1A 1F5JA 4PIXA 4QQHA 4P9WA 3WDWA 1C28A 2SBAA 5IVEA 3LOBA 1ENRA 4EQVA 3NJXA 5A33A 3ZXGA 1Y7BA 2F4LA 5C7GA 3CL1A 2RM23 2B42B 4UOJA 2GNBA 1YNAA 4YW5A 2PXJA 4LO4B 4TN7A 1A8MA 1TQ5A 2OA2A 3ZVXA 4JGYC 1OUXA 2A3WA 5JSPA 1H8TA 4QPGA 1CONA 2XOMA 5BNPC 3VKFC 1ZNPA 2VMIA 5FDBA 3ES4A 4JTNA 2ARCA 1S4CA 5ISLA 1H1IA 1RJ7A 5CG8A 5C3RA 1WW7A 3LDRA 4IV1B 5HCBA 1EPZA 2JKBA 2VBDA 3ETPA 1G6NA 1DU3D 4HVOA 3AKRA 1LGBA 3TB0A 4AQ6A 2BQPA 2IFRA 1YQ2A 5FZ8A 2SLIA 1LOFA 2XHKA 4AGVA 4Q4V1 4CP1A 1KITA 1HRI2 1PIV3 3O1SA 5LASA 3VKMA 4Q4Y2 1TEIA 5CISA 5GLTA 5IT6A 3Q8FA 2PHFA 4YW1A 2QQOA 5FXZA 5LW9A 3OPTA 5FZLA 3RSJA 2HWC3 4GB33 2YV8A 4RD7A 2XLGA 4UT5A 2XB6C 3TOJA 5I0UA 5CA6A 4BA6A 1QXRA 2BERA 4AXOA 2Q5TA 1FYUA 3FHQA 1JTZX 3FL7A 4IV3A 5JCTA 2P5BA 1WMDA 3PVNA 5LATA 1KQRA 2R072 5IJRA 4M4RA 4JV4A 1W9YA 2WNEA 4NIGA 3VBRC 2JG9A 3HQXA 1MPXA 5C33A 1AR72 3CDZB 5JR2A 2R0HA 2WS92 1DGWA 4AR2A 3UGFA 1YUDA 3IAQA 3OEAA 1OHFA 3FN9A 4ATEA 1S1AA 1GZTA 2DFCA 2MEV2 2AREA 2JD4A 2ZGMA 3QACA 3TNQA 2C1FA 3B00A 3VBFC 4FXGB 3ZSKA 3TEWA 3CNAA 4AEMA 2XQRA 1T2XA 5FO9B 2V72A 5FBJA 3AKPA 1H4HA 5FKBA 4W65A 4LO6B 2DURA 1VBA1 1W8HA 2R041 2C6SA 2Y6FA 3VD7A 1L7RA 1YJLA 1RMU3 3CEWA 3PURA 4XMAA 5JPNB 5K9YA 3T30A 5FPVA 2G9ZA 2NN8A 3WR0A 2J1SA 5E6HA 2P3KA 1IG0A 1WZXA 2VJXA 3RWKX 3ZXJA 2RS52 4BDVB 5GALA 3PVBB 5FIXA 5GLUA 2WA3A 4UF0A 3D0JA 3RPQA 2EIGA 3MDPA 2V4AA 4A41A 4N53C 1OOPC 1V00A 1REFA 2MHFA 2J1VA 2Z79A 3VBSB 3NAPB 3H1YA 4FPKA 3IB3A 3MBWA 3O1TA 1W6OB 3MYXA 3POWA 2ZAAA 2X09A 4RHV2 5E8AA 2WNUC 3NJVA 4AFCA 4D7YA 1PK6C 2DTYA 3MW2A 4WV8A 3WNMA 4XJZA 5C5TA 5IVYA 3AP9A 3J7NA 3P3NA 4GMP0 4CU6A 1O3SA 2IXCA 1PGL1 5J09A 2ARBA 5LCWL 5EXOA 3ITQA 3VD5A 1BMV2 1MS1A 3U37A 1GU3A 1I3HA 3NNMA 4Q8LA 1LHNA 5LBEA 4GMP1 4YNIA 3VDDC 2ZX4A 1OA4A 3THDA 5LZ6A 3WT3A 1DCSA 1AYN3 4AFBA 1UOFA 2RMU2 3GYDA 1G8WA 4GA9A 2CYFA 1Z7S3 4OHYA 1LHOA 2VTXA 2XVLA 2F6BA 5L9BA 3ACGA 3VZJA 4M4PA 2E51A 2PN5A 1HQNA 1UY1A 2W3JA 3MW3A 1ENSA 1S2EA 2HWF3 2RVAA 1IOAA 1W99A 5A1LA 4IV1A 4KL1A 4Q4W2 1RUG3 2C26A 5JVVA 5D1IA 1FOD3 1XNAA 2QDRA 5FYZA 4O9GA 5FZAA 5C3OA 3QH6A 5FPXA 4HKLA 4N43B 2Q8OA 1RUF3 5A7QA 2WO3A 3VBOC 4DB5A 4ZONA 2JDUA 4AI9A 1N1YA 1PO23 4S2HA 2KA3A 1GQHA 1BBT3 1PMHX 3KHCA 4CCOA 3NKTA 3WNOA 3WSOA 3ETQA 1UY4A 2JDAA 4UAPA 1QJY3 2R062 3H7JA 5LY2A 5JMCA 2HKXA 1QH6A 3LQCA 4FPHA 2ZA9A 2Q1FA 4LJHA 1RUC2 4GWMA 4QPWA 4CCLA 3RWNA 4CDUB 1COV3 3POEA 1FNZA 1YQ6A 4OFGA 3IAPA 3M3QA 4IE7A 4GH4B 4RFT0 4AFDA 1IQAA 3ASIA 4YGBA 1W04A 1J3QA 2B7YA 2ZZQA 2AR6A 3O0WA 4YGDA 3RVHA 3UGHA 3WDUA 4BM8A 4CCEA 1PZ7A 5ERLA 3ON7A 1LHVA 5A7OA 3PL0A 4PIYA 3RRDA 3ALQA 3L2HA 5FLJA 1RUJ3 2R16A 3ZOIA 4FPLA 3ZXKA 4AL9A 5IK7A 2V73A 5JMOA 2OZJA 2VNGA 4P9JA 1W8OA 1MZEA 2O8OA 3B9IA 1VMJA 3UKVA 1FMD2 1RUD3 3I8TA 1JZ6A 4COWA 1OT5A 1V9U1 2HWB2 2OUHA 2VMDA 2Y6JA 5FK8A 4EN8B 1LODA 1PX4A 1XU1A 4S2FA 5FWJA 1V6LA 1HRI1 2AUYA 3HNYM 5I0TA 1RHI3 4Q4Y1 1NQDA 4QPGC 4Y1UA 5AVAA 2EXJA 5G05L 4RGKA 2J1TA 4LBQD 2FD8A 1CR7A 1NCQB 2ZCWA 4IESA 5FZ7A 1UU5A 4V2VA 1LR5A 1UO9A 2MNGA 2D6KA 2DCKA 1QQP3 5FO7B 4OUSA 1W2OA 3C7OA 3U07A 1JU3A 1LEMA 4IE4A 2G19A 2TUNA 2YC4A 1C8M3 4JRLA 1LOFC 1R1A1 1W6OA 5KHKA 1POV0 4ZPIA 3OB8A 4OQ8A 2R071 4XUTA 3FX3A 2WKKA 3O5SA 4B7KA 4QDQA 4XJAA 3SCGA 3WP4A 4IGQA 1AR71 2AYHA 1IQDC 1POV1 4RN5A 2WS91 2XUEA 3SH3A 3IIIA 4BH9A 4XW3A 1NLSA 2ET7A 4CEYC 4E2QA 3LE0A 4GWNA 2MPFA 1UNBA 4YM0A 1ULGA 1US3A 5KHJA 1SDDB 1A8DA 2ZKNA 1GUIA 4HPKB 2PLV3 4RL7A 4XCAA 3VZLA 4MYEA 3HEIA 5FY5A 3SKVA 4IV3C 1VRH2 2B8MA 2VE1A 2P37A 4OHXA 3T3YA 3WNNA 2ZEWA 1PVC1 3PUHA 1K5JA 4Y5Z0 5KWRA 4URTA 3NRUA 5KBFA 3K2OA 2JG9C 3LA2A 1ASJ2 2VQUA 5A70A 4AEJA 5GLVA 1WA6X 4AHZA 3HN1A 1QY4A 1WLTA 2WC2A 3BU0A 3GCXA 3IKWA 2X5IB 1HB1A 4K40A 4AVVA 2D93A 1JMUB 1HXS2 2ZABA 4CA9A 4L2NA 3WEZA 2ZGNA 4RGGA 4PQ9A 1YRZA 3MIEA 1J1LA 5CIRA 2VBPA 2QTWB 3LSEA 5EHDA 5CFDB 1V6OA 4QGMA 2Z2SB 3M1HA 2JG8B 1AVBA 4G9SB 5CVRA 4AAPA 1MQTC 3AL5A 3UL2A 5I93A 1TME3 4KGGA 4ZU4A 3LA7A 3VBUA 5KXBA 2P3JA 3GGLA 3IPVB 2ZMNA 3N9QA 4LULA 4XUOA 4CDUA 1FV3A 1OQEA 3KMHA 4YM3A 1B35B 2QQJA 1BMV1 1A6CA 2JDKA 2WABA 3VBHC 2B46X 3OPZA 2RDNA 3I2KA 4YZ5A 4Q0VA 2PHDA 1GR3A 3E6DA 3J9SA 1IG3A 1ULEA 2RS33 1LOGA 1Q8SA 4A7KA 4MUVA 4DIQA 4LORA 1WBLA 4R52A 5IVBA 2RMU1 4OLLA 1KDKA 2CSGA 4JGZA 1DZRA 4Y22B 1YFXA 3SITA 2YU2A 1JYXA 2HWE3 2IZWA 5J7MA 1OKQA 1OLQA 2VO5A 2TEPA 3FLPA 5ACA3 4N7IA 4DINB 4AE2A 4XDQA 1UX7A 5JR7B 4Q4W1 2DCTA 2C24A 5JIAA 1H30A 2KR2A 1XJAA 3HJRA 2RS13 4XTMA 1W3XA 4K1ZA 1NAEA 1XNTA 2RM22 4UBGA 2BFUS 1MS5A 1ZZ9A 2Q8EA 1SHWB 1ZZ7A 4Q4X2 5KHGA 4LHKA 2V09A 1GNYA 2X53S 1C8NA 4KBZA 1KFUL 5FPUA 2Q30A 3GJAA 1H9WA 1NCQA 1LJ7A 3NJZA 4AI0A 4CUCA 1ND2A 1D4M1 5DN2A 3O1VA 4XUPA 5B2GB 4IV1C 4A7ZA 1ODNA 3AVSA 3NV1A 4R9CA 1Y9GA 3K4AA 3OD4A 1R1ZA 5J37A 1OQ1A 5H9SA 5HCAA 1AR92 3FC0A 3DXTA 4DXRA 3VKOA 1RXFA 2CWSA 4FPYA 4BLIA 1NY71 5CG9A 1OH4A 2VCCA 5CFCA 1BJQA 1C5IA 1CAWB 4XPVA 2AEZA 2TBVA 1UZZA 3AM2A 4GB32 3SXWA 3C2UA 2Y8KA 2B4KA 3WNPA 1FPN1 1H2LA 3OY8B 4ES8A 2HWB1 2EXHA 3JQXA 2IXHA 3ZYIB 3U1XA 4EE2A 2P3IA 5DDJ3 4ASKA 3K4DA 5L9VA 3AB0A 4QHOA 5A3PA 1NCRA 2X5IA 4LK6A 2WIIB 5DAWA 4YYOA 3POFA 1G9BA 1LESA 2VVDA 5FY0A 1IS4A 2VZ1A 1NOVA 4AZZA 5LA0A 4TXWA 2E32A 5BNNB 5F3GA 2JG8A 5GZGA 1OBNA 1HX6A 4CDWB 2LRPA 1YO8A 3POIA 5JXJA 1GNZA 3EYPA 5FWEA 3V0AB 4RGAA 4LHLA 3WCSA 4J1WA 3NNLA 3V65A 1AL23 2XPJA 2P1BA 3S0MA 1IS5A 2FCUA 4TYSA 1JN2P 1O7FA 4K9SA 3H8XA 3D6EA 3CO2A 4LHNA 2CV6A 3H3LA 3KCXA 3O0VA 3RYKA 1BLZA 5KC5A 1X36A 4K20A 4OHZA 3AZZA 3OPWA 1HRV1 5KXEA 2AC1A 2OQ7A 3K3NA 3NAPC 5FZBA 3VBSC 5JI9A 2ARAA 2XXZA 3FFZA 3POSA 4W6WA 1AL0G 1LB2A 1W3VA 1JHNA 1Q8PA 1WD4A 4MXWB 4Y22A 3FUQA 3BTYA 1R092 4XF1A 3I3EA 4HL0A 3CBNA 1VBE1 3K75B 5FZ9A 3OCPA 3BOPA 1ZREA 3MLJA 4DXTA 4E27A 1NG0A 1MZ5A 3T4HB 3J8F1 4JC1A 3ZSJA 3ZXAC 1VBB1 3GM8A 4YW3A 1NYWA 2FDGA 4LUKA 2HWD3 2XJUA 1HXS1 2AACA 3B93A 2XJRA 3ME2A 4QXBA 1CVNA 5IYYA 3AJYA 4LKEA 3GZUC 3M2MA 3AX4A 3V0BB 4PF5A 1EAH3 1JZ5A 5BNOB 5FBZA 3SCFA 3BPZA 1GOHA 1CAXB 1Z7S2 1ZM1A 2D6NA 3ILFA 5IAXA 3N7KA 2QCSB 4R4ZA 2G9GA 1RUI3 4DO0A 1NKGA 1CN1A 1V6NA 1V70A 3ZYJB 2IXIA 3NWKA 1E5IA 2HWF2 1U5YA 2GN3A 2XHNA 5FPBA 4QU1A 5HBAA 4IE5A 1AJKA 4N43C 1FOD2 1OVSA 1SBDA 3QOPA 2Y38A 3AP4A 3ZXLA 4KNCA 5JI7A 1X9PA 3CJIC 5F2WA 4AW7A 5DG1A 1G9DA 5FYUA 4XFBA 3SH5A 3D82A 1UU4A 4OVEA 2FZ1A 2NQYA 5F6LB 3TN91 4L11A 4LEJA 2OS2A 1J1TA 4RQPA 3RYPA 5FQ0B 1YYNA 4CPBA 1OKOA 2VULA 5BXXA 5JUVA 3NVCA 2OPWA 3PVOA 4CDUC 1TMF3 1C3HA 4RS5B 3MF9A 1XE7A 3OY8A 2CNAA 4YVSA 3LIGA 4GH4C 3KQ4B 3KS7A 4YM2A 2PFWA 3KGZA 2JENA 3UJQA 4LE4A 4YARA 1VMFA 2RM21 1F5FA 2X05A 3WW1A 4ZU7A 2A1XA 1W9WA 5F2SA 3WG4A 4JVAA 1RVF3 4XE9A 5EV7A 3MUZ1 1O8SA 4I2OA 5GKAC 1HIXA 1O3QA 2E26A 3MFAA 3T0DA 1C57A 4QKBA 4TSVA 1XNBA 1RUJ2 2WT0A 3HQUA 1DGRA 1E5SA 2BNNA 2BWCA 3BB6A 4QU2A 4AHYA 4CU9A 2C5DA 1WCQA 3BTXA 5BNQA 2K9ZA 1DQ5A 3NV2A 4D94A 3HWJA 4XFCA 2CAVA 4W6XA 1WD3A 4HXCA 2PAMA 5FY4A 5FR3A 4ATFA 3ILRA 3TYJA 1T6GC 1BHGA 2UWAA 2VU9A 1ZBA3 4ZXKA 4CCCA 3V0AA 2NZ9A 1H8TB 3HT2A 4YPJA 3SLIA 4FPJA 1PIV1 3HVDA 5EPAA 4N9IA 1PZ9A 3WINE 2WZR3 1CAVB 2OW4A 3S7IA 5JOYA 3MIHA 1WGPA 2AENA 2HBUA 1PHMA 4FOYA 1UOGA 3WQ1A 4B4PA 4BK5A 2HWC1 5J1XA 2JEMA 4GB31 2ZX2A 1QQP2 1XYPA 2VL4A 1O5UA 1UKRA 1U12A 3JB8A 2R32A 1W2AX 4LLOA 2Z42A 3UJOA 2QQMA 2GNDA 1NA1A 1BEV3 4KG0A 1RJ8A 2JKXA 4YG3A 2KXLA 2FBEA 2BNOA 3PU3A 4PLNA 1JUHA 4Q2FA 3W9AA 3N9PA 4FTEA 1RXGA 1LKNA 3AKSA 4B7EA 1C1LA 3ZYGA 1DDLA 5FZDA 4JRAA 4HSLA 2J22A 5DAQA 4EYUA 2WT1A 3MLKA 5FP7A 2WDBA 4BISA 2FMDA 3GZAA 3ZFGB 3A23A 3EO6A 2DTWA 4MADA 4AEDC 3APBA 3FHIB 3OJBA 4FQZA 1DBNA 1DQ0A 3T0BA 1WUVA 3LGRA 3D0SA 3ZN4A 5IHRA 1ZZ8A 1GICA 4EZ4A 1VB4A 1CJPA 2RR13 2VBBA 5LA2A 5FMBA 2PLV2 1UXZA 2E6VA 3T4VA 4NIHA 3V0BA 4XFHA 1AR83 2VVFA 2W1UA 3KT1A 2PA7A 1BVVA 4CDXB 5BNOA 2CY6A 3ACIA 4Q0PA 1CAXA 2GC3A 2NYYA 2JJ6A 1JZ7A 2GH8A 5FJKA 1LU2A 2JECA 4LITA 3GZEA 3BODA 1RMU1 5T5OA 3U78A 5F3IA 4NN0A 1EV13 4XDPA 3C7GA 3I4IA 1JOPA 1PX3A 2X5IC 3KCYA 1WLDA 3ZMNA 4YZ3A 4QPIB 4PQQA 1CZSA 1OI6A 1UPSA 2D5FA 4UFLA 2DYCA 3FZ3A 1MEC3 3MZHA 5DPNA 1Z0HA 1I6XA 3C3VA 5A3WA 1KGYA 1ND3B 1SFPA 4A2UA 5CFDC 2C4XA 4FFHA 1HQLA 1PO13 5ANQA 2JG8C 1IGOA 4NMIA 4KMQA 3FFQA 2FMYA 4NHXA 1W8NA 2ILMA 2JX9A 3Q9OA 4K3UA 4ZZ8A 2VOKA 3LPGA 5FQ0A 1BCXA 1AYM3 3JXSA 4QMAA 1TME2 2ADEA 2VUCA 3IT8A 5CKNA 3PUQA 3ZYBA 3N4MA 1OQDA 4LXLA 4RS5A 2EIDA 4ZKTB 1B35C 3S7EA 3M4FA 5FMCA 4XF4A 2W47A 2GN7A 1KD7A 3HAGA 1X50A 3U4SA 4A42A 5FZ0A 1H1AA 3ZFEA 2WAOA 1AZDA 3KV9A 5I8YA 2QQUA 5KHHA 2P4EA 4JQRA 1EUUA 2BDRA 1AYN1 1MS9A 3AZXA 4COZA 4IETA 4XBNA 1Z7S1 2JE7A 3R0RA 3ZDVA 2HWE2 4O61A 2WFF3 2Y6GA 2WYSA 4BIOA 2VOWA 1W8UA 2WFPA 1XPWA 4IEQA 3MIBA 4Y1XA 5EFUA 4XBQA 2HWF1 4QQOA 1QNYA 3AMNA 3M70A 3KD4A 4HKWA 1RUG1 2Y60A 5IK4A 3I3QA 4LUMA 1FOD1 3BI3A 4INDA 4D6RA 2F4PA 1ZBE3 1X7NA 3GDBA 3RG0A 5I8TA 2LTNA 1RUF1 1SLLA 3H8UA 3MIFA 2D97A 2B9UA 1DF0A 4YGEA 3CF6E 1PO21 3U10A 4Y26A 2WWSA 1RTVA 1C5HA 2BVBA 2VC9A 3WG3A 1BBT1 1CAVA 1DZQA 4A44A 3BIWE 2IXLA 1JYWA 1XU2A 3H1WA 1EP0A 3IWZA 1VBC3 4OHWA 4C91A 1RB8G 4LIVA 1QJY1 2GC0A 3AK0A 3T2OA 1U5ZA 4FXKB 3ZMOA 1FV2A 1V9U2 2WJSA 4CP9A 1COV1 2DU1A 3BTAA 4IE0A 5T5PA 3A4UA 2RJLA 5AC93 3TEXA 2WINB 5I0RA 3ES1A 4HN0A 1FX5A 1N1TA 4GD4A 1HN1A 3FMGA 4FAHA 1UMHA 5JLVA 1DQ1A 1ULPA 3ZFGA 2WNOA 4FFGA 5C4WB 1O91A 2B39A 3H3UA 3RJ2X 1RUJ1 5LB6A 1BYHA 1R1A2 4QX2A 4QXKA 1YQ8A 1UMZA 3VB9A 5CADA 1CIWA 1POQA 4PCRA 2ERFA 4PHZA 4CDXA 2GMPA 1WW4A 1RUD1 1SBFA 1WKYA 1YIFA 3OUIA 3K77A 4XXPA 3NL1A 2HLEA 5FZGA 1YEWA 2UU8A 3AMPA 3E6BA 2I2SA 2WWJA 1E5HA 1OH3A 5LBBA 4DXZA 2XL7A 1RHI1 1OF3A 5FZIA 2H6CA 5B4NA 4QPIA 1SMVA 5GZFA 3VZKA 4NRQA 1I5PA 2BOIA 2P6CA 4KG8A 4BXSV 1WLCA 3FE5A 4K6BA 1FI2A 3IMMA 1QQP1 2VUDA 3AFKA 5F8PA 1ND3A 4M0HA 4WVZA 4WVWA 2OVUA 5BNNC 3O1PA 2O1QA 1GWKA 4MGQA 1PVC2 2VW0A 1C8M1 4ISRA 4P14A 3AYCA 4CDWC 2OT7A 2R30A 2YMZA 1O4YA 2F17A 3PIJA 1ACCA 2XQXA 4LE3A 3ACFA 2VZUA 3PNAA 4UFHA 3H8OA 1GLHA 5FLIA 4FPFA 1GMMA 4HZFA 3SMHA 2PHWA 1KEXA 3LFMA 3G7DA 1JZ3A 1NXD1 1IKQA 4BHPA 2A6XA 3WOGA 4M3CF 3ZYHA 1RUOA 4MHRA 1JHJA 3Q8EA 2PLV1 2NMOA 4B8EA 2WR9A 3ZXEA 4LBQA 5DAVA 5L7OC 3D5OA 4QQPA 3VL8A 1PM7A 1ZYBA 4LO7A 5GLZA 3I49A 2QQPA 2DVDA 2WWUA 5FMOS 3ZIXA 4A6OA 1QJX3 2OUJA 4UBHA 1VP6A 4YW4A 2BJSA 4E4SA 5A6QA 1M06G 2FDJA 3M3OA 4O7XA 4CRQA 1HN0A 2BYVE 2DF7A 2VOXA 4LA2A 4CUAA 5FUIA 1CQ9A 1PZ8A 3WF0A 4MH0E 1A34A 4QB1A 3MUY1 4IEPA 4XEZA 5BNOC 4YLZA 4M00A 4P9LA 1EAH2 5F3CA 4Y24A 1L7QA 4Q0UA 4AVCA 2RJKA 2YPJA 3KVBA 1VLNA 4B4QA 1TZOA 1TME1 2W08A 4IGOA 5C3SA 2YBSA 3MFCA 3OBAA 4GKXA 1RGSA 3RZZA 4GXLA 4G3YC 4K8FA 4XIOA 3SC7X 3RZMA 1QJU3 1N3PA 1RUH3 3E5QA 3U14A 2VH9A 3SQOA 2FDIA 4W4ZA 5E88A 4AFMA 4UFJA 4ZXEA 1LOCA 4OI4A 3RMXA 1QMJA 2YUEA 5BY5A 5IK5A 2RS31 2VPVA 3E97A 4LMFA 5JDBA 5H9PA 1DHKB 2X10A 1D4M2 1W05A 3IDAA 1GV9A 1UXXX 3V56A 3VBUB 3QD6A 4W8JA 2HWE1 2YHJA 2V5DA 2ZGUA 5C4WA 1UCXA 4LA3A 5ACA1 2Y6HA 3L2YA 2HEWF 3AMQA 1HKDA 2WN3A 2ZEXA 4HANA 3B9CA 2QFEA 1LOBA 4RS5C 2BW8A 2VXJA 4MGSA 4OYUA 2VGDA 2WQZC 2AGSA 1AR63 4Y1VA 4D8MA 1AXKA 1Q56A 2RS11 1SCSA 2E63A 1BK0A 4P9XA 3ENRA 1NY72 2P2KA 3I2GA 4WM8C 4JGZB 1OA3A 2RDQA 3K51A 2W91A 1IPKA 4PI0A 3CIHA 1JZ4A 3AKQA 5KC6A 2RDSA 1RVF2 3GBFA 4NVPA 2VZVA 5FY7A 4EN6B 2D43A 2W9XA 3WNXA 1FPN2 1F31A 3DPRB 1X8MA 1UKGA 3OGRA 4D7TA 4NUBA 5J98B 4CU8A 4ZS3A 5FZHA 4Z8BA 2ZGQA 4PBOA 5A80A 3X29B 1ZRCA 1VAVA 3L9JT 2NMNA 2VZRA 3BVCA 4SLIA 4NHLA 1VBD3 5EQUA 3HD8B 2XDVA 3G6JB 2Q1ZB 4DZGA 1W03A 1H8TC 2VCAA 1DQ6A 3M8LA 1GZWB 2B45X 2VTFA 1V0AA 3DKWA 1QEXA 3KT4A 5FP4A 3ORJA 2I74A 3JBG3 5K4LA 2YGMA 5K8SA 1ND2B 4DEQA 1JH5A 4ET7A 3HNMA 2FDHA 2WZR2 1SPPB 4JKMA 2QZ3A 3MHZA 4KI5M 1KRIA 2FHRA 3DYMA 4F83A 4LQRA 1QOSA 1VAKA 3UKTA 5HCHA 3IDBB 1JYTA 5K0UA 2JDMA 4AGRA 2JDNA 1UMIA 3BIEA 2Q1MA 3N7MA 1BEV2 4XYXA 2EVXA 2TNFA 2CTVA 3AJZA 1LU1A 1O4ZA 3VKNA 4CP0A 3A7QA 3TRSB 4HMZA 3JD73 2DUQA 1XNDA 5CFCB 1UD1A 1ZZ6A 5DDJ1 5L9RA 3ZFGC 5FFOC 1ZZCA 5IVVA 1NZCA 2LUWA 5A3OA 1HRV2 4Q0SA 4BCUA 5A3UA 4GALA 2KM2A 1US2A 1SLCA 2YU1A
chains in the Genus database with same CATH topology
3MGUA 3NO8A 5FTTC 1KJRA 2GMMA 2RR12 2W39A 5HI0A 2R0FA 4CDXC 3WG2A 1AR82 1VBE2 3JQWA 4MV2A 4I0BA 1WCSA 1BQPA 3LA3A 1XYNA 4QT6A 5I8SA 3J8F2 1VBB2 3FBMA 1AL21 1NCRB 2ZHMA 2BWAA 4XQDA 3DN7A 3MICA 5E89A 5CU1A 1W0PA 3NW4A 1AX2A 1MEC2 1ND3C 1W6MB 3JU9A 1J3PA 1LHUA 2BEOA 4HETA 4PLMA 1YLLA 5JZGB 4XF9A 5IUQA 5IK8A 2PAEA 2BTVC 2ES3A 3E5XA 3J4UH 5DZFA 4OUMA 3SISA 1AYM2 3U11A 3HIFA 1UF2C 1S2KA 3GNEA 4AVTA 4CZSA 3OGJA 3RS6A 3VUOA 2HWD1 2H0VA 4NR1A 4XJUA 2DWRA 4XJ8A 3WDUA 2H0BA 4Y20B 3AKTA 3TN92 2EA7A 2GMEA 1CGPA 2VUJA 3PLQA 3B7MA 1EAH1 3AYDA 4FTSA 2W0XA 2I45A 5E1RA 3FLTA 4KQ7A 4OZXA 1PNFA 1RUI1 3DPRA 3B94A 1VJ2A 4LT5A 4KU8A 2A6YA 4BPZA 1N1VA 4NHMA 1S0JA 2PHTA 2GZWA 1ZBE2 4HT1T 1KJLA 1UPIA 3QBQA 3OBTA 3O7OA 3H1MA 1LCLA 1GZWA 4I3PA 1S2BA 2JICA 1YI7A 1OA2A 5FAXA 1ENXA 2D3RA 5H9QA 5L19A 1QNWA 1EYBA 4NWWA 1N3OA 2CL2A 3HT1A 3LAGA 4M01A 2ETEA 2VQ0A 1TMF1 3NSTA 4W6YA 2PELA 2VW1A 3UK9A 4A3XA 1PIV2 1FATA 4JTOA 4MSVA 4AYUA 4AQTA 1O3RA 5FMOL 3R4DB 4RQPB 2OZ6A 3N35A 4CDQA 1IPJA 4ZU5A 2D3SA 1RVF1 3B02A 2HWC2 5C4WC 3WDTA 3EBRA 4XFAA 4UXAA 4YVSB 2DUOA 3WZ1A 5T5LA 5T54A 3WLUA 2ENRA 3K48A 4L92A 4C90A 4Q1RA 3SHRA 3ZYRA 2D98A 2HEVF 4FVVA 5D8AA 1AX0A 1ZBA1 3BALA 2CWMA 2ZOEB 3URFA 4WM7B 3WHUA 2D6PA 4SBVA 4K7JA 1F8VA 2ZHKA 2ZGTA 2WZR1 2A6VA 1JUIA 5C9AA 4UW5A 2ZBJA 3V64A 4IL7A 1W6MA 4XJ9A 2UWBA 3IBMA 4M0NA 1QOOA 4ASLA 5JZGA 1NLRA 1BEV1 4H55A 1RMU2 1X8EA 2MEV3 3GZTB 2XWBB 3KQRA 4NPRA 3MI8A 4BLJA 3ZSEA 2ZAHA 5A32A 4AI8A 4H3WA 5T3NA 1QXPA 3DF0A 4KGQA 4F7ZA 2UURA 3AZYA 3E6CC 1HV0A 3QCWA 2DU0A 1WLWA 4HK9A 2QNKA 3WG1A 2OIIA 4QQ2A 4DPNA 1NA1B 4Y20A 3POYA 3WW3A 3UV9A 2RR11 4Q29A 1VALA 1X33A 1AR81 2RS53 5C6CA 1GQGA 2C9AA 5LEJA 4FOVA 4MVTA 5FRAA 2UYAA 1G7YA 4YVWA 1OPOA 1REDA 3I59B 2JE9A 1AF9A 4HN1A 1GKBA 3CU7A 2GNMA 3VN4A 3WUDA 4YG6A 1EV11 1QJX2 2D40A 2VMGA 3AP5A 2XBO3 4RHV3 1LGCA 1NE4A 5BYNA 2ZTNA 3WP5A 1MEC1 1AYN2 4YRDA 4DMIA 3ZN6B 2XL9A 2A3YA 2IXKA 2WQ4A 1PO11 2E53A 5JOXA 3S6PA 2VY0A 5F6KA 1VB2A 4YW2A 3U0ZA 4X8PA 2BBVA 1AYM1 1RUG2 4N90A 3U4XA 2XJPA 3D4KA 1RUF2 1XRUA 4HLTA 4ASMB 2PHRA 2AZ5A 2WSUA 2HYKA 4HSJA 1RUH2 4JGYA 4Q27A 2UY8A 4YZ4A 2A7AA 1PO22 3HBZA 1UU6A 1APNA 1BBT2 4XMIA 4IXLA 2PHUA 3VZOA 4B29A 5DG2A 3VBUC 1A3KA 1HQWA 5LK5A 4YSFA 4IEUA 1D0GA 1QJY2 3SCHA 4COVA 2ZGSA 3VHNA 2PAKA 3RI9A 4MLOA 1N1SA 2WFF1 4X6RB 1OLRA 5DZGA 1COV2 1AJOA 2PHLA 3J26N 1BVP1 1DIWA 3ZFEB 5EZWA 5T5JA 4LO8A 5C8WA 3H9AA 1AR62 1ZBE1 4JGZC 1DGRN 2R063 5CNAA 3WHTA 5FPZA 5DUXA 1SQ4A 1RUC3 4WM7A 4GQ7A 3CJXA 1R083 1AXZA 1CX4A 1L3JA 3WV6A 1WMFA 1V6JA 5EJ3A 1DGLA 3AMHA 3DPRC 4IEWA 4QM8A 2VUAA 1K5MB 1VBC1 1RUD2 3R4SA 2D3PA 4XIKA 3WP3A 3ZX7A 3VZMA 3VBRA 4PJYA 3PJQA 3WD5A 1VBD2 2E9QA 5AC91 4QX5A 1RHI2 2VG9A 2XLAA 1NCQC 1KS5A 2PHXA 4PDWB 4XHBA 1SLAA 2D5HA 3OYWA 1ND2C 4MGKE 2GSYA 1QDOA 3B69A 1FMD3 3JBG2 3OTFA 5A3MA 3LB9A 1V6KA 3H3ZA 2BGCA 1J58A 1C8M2 4J1XA 1AHSA 1LHWA 1W6QA 1PGSA 4MXVA 3PJYA 4QM9A 1F2NA 4EN9B 2QZ2A 4META 2ZACA 4KBBA 5CFCC 5GLWA 4GKYA 3JD72 1H2NA 2A73B 2H6BA 3I59A 1N3QA 4N53A 2WSVA 1S0IA 4XQ4A 4P5HA 3ZN6A 2D6MA 1PK6A 1E57A 3KM5A 3AXEA 1RC6A 4EJRA 4AG4A 1H1MA 4AHWA 3ZFFB 1VR3A 4F3JA 3THPA 4CEYB 5AFBA 3JB4C 1NQJA 1YFUA 4RR3B 2ZJCA 1NCRC 1W0OA 1OFSA 3DUIA 2XG3A 4IEXA 1IHMA 1VRH3 3VDDA 3QLQA 2A6ZA 3VGIA 1LULA 2WZPP 3LSDA 4LBOA 4K1YA 2ZGKA 1W2UA 4LO5B 4OULA 5EWSA 4BMEA 1ASJ3 2NM1A 5JZGC 3WDYA 1UIKA 1IZ3A 4WVMB 4FCAA 4PIZA 1GZCA 1URXA 1XXNA 1Y43B 4M3CB 3RYRA 3TWIA 2YGLA 2XLFA 4G4FA 5L73A 4EWDA 2FQPA 3R05A 5LRRA 4S2GA 3KB5A 2YY1A 1QJX1 2EF6A 4JAAA 3OGGA 3VLBB 3ZDSA 2RS32 4FOQA 4LBQB 3IIAA 1LGNA 2VW2A 3PVEA 5FOBB 4FTBA 2EAKA 3MW4A 4NHKA 3M3IA 1NXMA 5ACA2 3SH4A 1V6IA 3IMNA 1C4RA 3KT7A 4COUA 2IFWA 1MS3A 4AVSA 1K5MA 4FBFA 2RS12 2IXJA 1QJU1 5JWPA 2E7AA 1RUH1 2ZPXA 3WQ7A 1H8VA 4AQ2A 5AFEA 1PVXA 1RL3A 4AEKA 5JAXA 1G86A 1ZZBA 3I2DA 1QXJA 4BZ4A 2R1BA 4PDWA 2O8QA 4QHBA 5T55A 1JYIA 2GC2A 1GNHA 2GU9A 2RE9A 5GM0A 4AWDA 2DVAA 3ATGA 4Q4X3 2EXIA 3SNMA 4CYDA 4UW3A 2XGXA 2A3XA 3VKLA 3DL3A 1AR61 2Z5WA 2PTMA 3I7DA 4AF9A 2VMHA 4RQPC 1EPWA 2BNMA 4Q0QA 3N36A 1GYKA 3M3CA 1KFXL 3LKJA 5ABJB 2K0GA 1AR93 1D4VB 4WBBA 4XILA 5KHIA 4YVSC 2XJVA 1JW6A 4JDNA 1Z78A 2Q4SA 2WT2A 1SDWA 3RDIA 1SLTA 4KH9A 4O9EA 3OF1A 1J59A 4LBJA 3NV4A 2QVSB 4AVAA 1VBD1 3ZFFA 2E7TA 5DDJ2 2E7QA 4CEYA 4WM7C 4RA0A 4RR3A 2IC1A 2XUMA 2Z69A 2BPA2 1W6NA 5J3UA 3JBG1 2I07B 3HR9A 2HJIA 2HEYF 1Q8VA 1OFNA 5DUVA 1ZRRA 4BE3A 4Q26A 4B3NA 1KXGA 1X82A 1MS8A 4XFIA 2WNVB 5C8CB 2P17A 4E9KA 4ISQA 2UYBA 4WVMA 1AL22 4FPEA 3LOIA 4M3CA 3JUUA 4KWJA 1XE8A 4JCKA 2Y0OA 5LK7B 3JD71 1CESA 1HW5A 2LM3A 4FP2A 1GANA 5K0UB 1NA1C 1S0GA 4L9BA 4Z2WA 3IDCB 1MQTA 2GALA 1LRHA 5LEKA 2ET1A 3VHRA 2C0ZA 3KCCA 3PTYA 1O5LA 3JCIA 3VL9A 1IS3A 2LALA 4Z07A 1AUYA 1S55A 2XWJB 4P9IA 3VBHA 2JDZA 1OD5A 2HWD2 1B09A 4RSUA 1UIJA 5J96B 2ZHNA 4HBNA 1R093 2XBO2 5DXDA 3GHMA 2CGNA 4N7UA 2V5YA 5I91A 4C1WA 3PMSA 4EN0A 1HDKA 3D8CA 2EAAA 1AXYA 1PGW1 1RUI2 1Y9QA 1I9RA 3AP6A 4LTAA 3THTA 2GC1A 4CTEA 4HVRA 5CBLA 1RUE3 4HKOA 4FPGA 2YZ4A 2ZGLA 1YIPA 5J36A 1CD3G 4E4DX 5TSWA 5DZEA 3AZWA 2DFBA 4L99A 2ZMKA 4XFGA 3ZYPA 2UWCA 2YDEA 4YGCA 5LRSA 5KXCA 3W58A 2O0OA 4AI3A 2ZMLA 4AVBA 3AXDA 3GBGA 3MIDA 4HFSA 5ABJA 4Z1VA 1FNYA 3B01A 1TMF2 3CJIB 3ZFEC 5FCCA 5SV8A 1NE6A 2XH6A 1TNRA 3FLRA 4KWKA 1ULFA 1GZ9A 2YYOA 1XNCA 1DQ2A 2IWGB 2ZZJA 1ULCA 1LTEA 3AYAA 4TWTA 4EWEA 5T52A 4GIQA 4Q4V3 2WA4A 1R082 4R8HA 1QWRA 5F9TA 1S0DA 1K5MC 1G9CA 1IKPA 1MZFA 4ES9A 1G9AA 2WNVA 5C8CA 1FAYA 4AFAA 5DUUA 5EYXA 3ROUA 1ULDA 4L8QA 3B3QE 1ZBA2 3R4UA 4P9GA 2XKOA 1Q43A 4Z82A 4PDWC 1GFF2 4CEWB 4E4ZA 2R6QA 1YFWA 4LR4A 1UW8A 4Y1ZA 5BUVA 4ORFA 4FAGA 2JXAA 3ZN5A 1DYKA 1WCDJ 4XBLA 3TBDA 3RNSA 4D3WA 1IS6A 1A78A 4PBPA 2GAUA 1W39A 2QE3A 2D6OX 3IDEA 4CDQB 1N47A 1SACA 1ZRFA 3GALA 1RITA 1MS4A 1JOJA 4KU7A 2DVBA 4QGLA 4E2GA 4ONUA 3VBSA 1VBA3 2R043 3NAPA 4I0AA 1KDMA 4FT8A 3WY6A 1OSGA 1HV1A 3PHMA 1JBCA 4FOWA 3ACLA 3GF6A 1ONAA 2ARXA 2QDNA 5D8AB 4Q8KA 1WCKA 4FQ4A 3ZFFC 4AEDB 3ZO0B 4XOGA 3N7LA 2MEV1 4RR3C 2CGPA 1EV12 1W6PB 3AZVA 4P9YA 4QPIC 4S2DA 4AK3A 4E2SA 5C9AB 4I02A 5FLHA 4Q1PA 1DZTA 4QQLA 5J48A 1OPMA 3TNPB 2ZX1A 5GZEA 2ZKLA 1PO12 4K21A 3AP7A 5FO8B 2W68A 3EJKA 2PYTA 4IEZA 5DUWA 4GMP3 3WVJA 2Y0IA 5A32B 1SFNA 3O0XA 2RS51 4PLOA 1H0BA 4LNVA 1WW5A 4N43A 1BZWA 4XJWA 1S0BA 3O14A 2QUOA 5T50A 5HCFA 3E5UA 2GDFA 3CJIA 5EYYA 1D2SA 4IQPA 4YG0A 3KZ4C 1REEA 3TAYA 2W52A 3LWCA 4H7MA 2XBO1 4RHV1 2D44A 2QJVA 2ZS6B 1LOAA 1H2KA 4AHXA 3QH7A 4J6GA 1QJZA 3VZNA 2XJQA 4IERA 1WMEA 2WFF2 4QPYA 4YVWB 3RJRA 3VHPA 3RQ0A 3UKNA 4GH4A 1XYOA 1UX6A 1H2MA 4NOTA 1S0EA 3AFGA 3RMYA 5L36A 2DCYA 5GJ6A 3EXUA 1YXWA 2EXKA 3DGTA 3NKGA 2DVGA 1U5IA 4R4XA 3WW2A 1I5ZA 4U2AA 4CEWA 4BOWA 5JSOA 2VNRA 4Y1YA 3KLSA 1VBC2 4OI1A 4LBLA 2XVKA 3AYEA 2RHPA 4EN7B 1Q8OA 3A0NA 4JGYB 1LENA 4DQAA 2XKPA 4DS0A 5BNPB 1PNGA 2XVGA 4I3GA 5AC92 3WCRA 1UN1A 1Y3TA 1UAIA 2R061 3PMEA 2N7GA 3WQ0A 1ALYA 4U36A 2CAUA 4R9DA 1V9U3 4OI0A 2FZ2A 1RUC1 1AX1A 1CPMA 1RIRA 5ABJC 1R081 4NO4A 1HRI3 1QGLA 4IEYA 4FO9A 4Q4Y3 4BQ1A 3CLPA 3KSCA 4COYA 3P3PA 5I0SA 4C1XA 4XETA 3H50A 4MGYE 3WDXA 3MLLA 3ECQA 2AH2A 4JDOA 4AEDA 1TE1B 1R1A3 2DCJA 1S0CA 1W6PA 4HPKA 1M4WA 2DVFA 5BPXA 2R073 1Q3EA 1GSLA 2X8KA 3USSA 1WA4A 1F9KA 1FMD1 1SCRA 2YC0A 5SV5A 1QKQA 3IM0A 1AR73 4AQSA 1I1EA 1POV3 2WNVC 2WS93 3VBRB 5C8CC 3NV3A 1YFYA 3BCWA 5CB7A 1JXNA 3ZIWA 3S30A 1UL9A 5A3LA 4UW4A 2WL1A 3OYWB 3VBFB 3EHKA 4LBNA 1DFQA 4XQWA 2NLRA 1SEFA 1C1FA 1YCIA 2ZX3A 1HLCA 2A75A 1PVC3 2VQAA 5CFDA 4XXAA 5K0UC 3O12A 4NWVA 4BIFA 4FSJA 4I09A 1W6QB 1QHDA 5H9RA 3VV1A 3M7AA 2G4IA 3MPBA 4BWOA 3BOWA 1V6MA 4EV0A 1DG6A 1XQNA 4MX3A 3IPVA 2R49A 2GH2A 4EROA 1ENQA 1MVEA 4N53B 1B35A 1OOPB 4IEVA 4AI1A 3H7YA 4EWAA 1YI9A 3OD0A 3ZSLA 1G9FA 3HMYA 5KXDA 1VRH1 3MF6A 2YXSA 2VECA 4QD2A 1LEDA 2WNUB 1VAMA 4FP3A 3ST7A 1MVQA 1PK6B 1CAUB 2NPIA 5L7OB 3WW4A 1LECA 3VHOA 4MGIE 1FXZA 1ASJ1 3MPPG 2X29A 4WVVA 4DY5A 3GBWA 1H4GA 2ZHLA 4I0WB 3VDDB 2RMU3 3FWEA 2XJTA 1QJU2 1S0FA 1ZVFA 4R9AA 2BVVA 1U0AA 1WW6A 2R1DA 3ILNA 4BYYA 5BNPA 4LBMA 4LLFA 1RUE2 4ITCA 1TNFA 3IN9A 4WZFA 4MGZE 4B4RA 3USUB 4Q4W3 3B5LB 1J3RA 2DV9A 4KWLA 4DY3A 1ZX5A 1QU0A 5JSRA 4OI2A 1SLIA 3VBOB 2VVEA 5F5QA 2Y26A 1KS4A 1XNKA 3KGLA 1O4TA 2P34A 5HXVA 2ZX0A 1D4M3 3FUOA 4C0BA 4Z92B 3DV8A 1GBGA 1QOTA 2ZGRA 1CAWA 5F1RA 1DQ4A 3BU7A 3N3HA 4X6QB 3WX5A 2DUPA 3LCPA 4Q4V2 5BV6A 4M3CE 1Q5OA 4HVQA 1O3TA 4H14A 1MR5A 4Q4X1 2WLQA 4WM8B 5K7PA 4D7SA 4AI2A 3A0KA 1QDCA 4HK8A 2QKDA 4BMBA 1FPN3 2YROA 4CEWC 3VBFA 4X8NA 3FJSA 2EALA 4F8AA 5A33B 3JZVA 2ZGOA 1SBEA 2HWB3 2UY9A 2A70A 4XTPA 1MZ6A 5BNNA 4V1PA 4QGNA 2VOVA 1FT9A 3N7JA 4UW6A 4CDWA 4DNYA 4MZUA 2D6LX 3OBRA 1AR91 2A71A 1DYPA 4QPGB 1YWKA 1JYCA 1H9PA 4C0HA 1ZRDA 4OHVA 4CDQC 1SLBA 4R9BA 5AVPA 2D7FA 2OYZA 1OOPA 3WUCA 5FOJB 4H7LA 1QF3A 1ZA4A 4YFZA 3MIGA 2DCZA 2NP0A 1VBA2 2R042 4L97A 1OMIA 1SFYA 2WNUA 1UZYA 2A6WA 2GNTA 4MXWA 2PQQA 3GHNA 4XF3A 1WBFA 1CAUA 5GZCA 5L7OA 3EQEA 3WP6A 3T1MA 5D8AC 4DOUA 4I01A 1BKZA 3INAA 1HRV3 4TLFA 3T2TA 1U5XA 4YFWA 2ZGPA 3ZXFA 4YZ2A 2XJSA 1W6NB 4XFFA 2K2SA 3ZXDA 2ATFA 1MS0A 2OPKA 4IEOA 4AGGA 2BFUL 1EY2A 4IV3B 5C9AC 3R6SA 1VBE3 1MACA 4Y4YA 1BXHA 4DRRA 1YHFA 3J8F3 2JG9B 3USUA 1RINA 1VBB3 3RI8A 1PGL2 4YM1A 1YJKA 1HXS3 1PGW2 3ELNA 4FPCA 4JDMA 2B5HA 4XHXA 2G9FA 2Q0AA 3M3EA 4CP2A 1Q8QA 3VBOA 2BUKA 1LOEA 1DGWX 4GULA 3ZPYA 3MEPA 1VIWB 1D0HA 1CPNA 4XZPA 5JOWA 3FBYA 1BK1A 4D69A 3H0OA 3WDVA 3ZSMA 4DRVA 1QH7A 1MQTB 3AMMA 1RUNA 1CJDA 4XF0A 1R091 3W59A 3I54A 5E16A 4LBKA 2A5ZA 5JPMB 1DLLA 1D2QA 4A7YA 4YVWC 3VBHB 2VNOA 4DFSA 3LZZA 3TN93 4WZCA 5JIUA 2VXRA 3WXPA 4N9HA 4I30A 4FPOB 5CAZA 1PMIA 2CGOA 2WLPA 4WM8A 5FREA 4TZDA 5GZDA 1RUE1 4YZ1A 1F5JA 4PIXA 4QQHA 4P9WA 3WDWA 1C28A 2SBAA 3LOBA 1ENRA 5A33A 3ZXGA 1Y7BA 3CL1A 2RM23 2B42B 2GNBA 1YNAA 4YW5A 4LO4B 1A8MA 1TQ5A 2OA2A 3ZVXA 4JGYC 2A3WA 5JSPA 1H8TA 4QPGA 1CONA 5BNPC 3VKFC 1ZNPA 2VMIA 5FDBA 3ES4A 4JTNA 1H1IA 1RJ7A 5CG8A 1WW7A 4IV1B 5HCBA 1EPZA 2JKBA 3TB0A 4HVOA 1G6NA 1DU3D 3AKRA 1LGBA 4AQ6A 2BQPA 2IFRA 2SLIA 1LOFA 2XHKA 4AGVA 4Q4V1 4CP1A 1KITA 1HRI2 1PIV3 3VKMA 4Q4Y2 1TEIA 5GLTA 5IT6A 2PHFA 4YW1A 3RSJA 2HWC3 4GB33 2YV8A 4RD7A 2XLGA 2XB6C 3TOJA 5I0UA 5CA6A 4BA6A 1QXRA 4AXOA 2Q5TA 1FYUA 4IV3A 1JTZX 5JCTA 3PVNA 1WMDA 1KQRA 2R072 4JV4A 2WNEA 3VBRC 2JG9A 3HQXA 5C33A 1AR72 2R0HA 2WS92 1DGWA 1YUDA 4ATEA 1OHFA 1S1AA 2DFCA 2MEV2 3QACA 2AREA 2JD4A 2ZGMA 3TNQA 2C1FA 3B00A 3VBFC 4FXGB 3ZSKA 3CNAA 4AEMA 5FO9B 3AKPA 1H4HA 4W65A 4LO6B 2DURA 1VBA1 2R041 1YJLA 1RMU3 3CEWA 4XMAA 5JPNB 5K9YA 2NN8A 3WR0A 2P3KA 3ZXJA 2RS52 5GALA 3PVBB 5GLUA 2WA3A 3RPQA 3D0JA 2EIGA 3MDPA 4N53C 1OOPC 1V00A 1REFA 2MHFA 2Z79A 3VBSB 3NAPB 3H1YA 4FPKA 1W6OB 3MYXA 3POWA 2ZAAA 5E8AA 4RHV2 2WNUC 4AFCA 4D7YA 1PK6C 2DTYA 3MW2A 4WV8A 4XJZA 3AP9A 3P3NA 4GMP0 1O3SA 2IXCA 1PGL1 5J09A 2ARBA 5EXOA 1BMV2 1MS1A 1I3HA 4Q8LA 1LHNA 4GMP1 4YNIA 3VDDC 2ZX4A 1OA4A 3WT3A 1AYN3 4AFBA 2RMU2 3GYDA 1G8WA 4GA9A 2CYFA 1Z7S3 4OHYA 1LHOA 2XVLA 2F6BA 3VZJA 2E51A 2PN5A 1HQNA 3MW3A 1ENSA 2HWF3 1IOAA 4IV1A 4KL1A 4Q4W2 1RUG3 5JVVA 5D1IA 1FOD3 2QDRA 5FPXA 4O9GA 3QH6A 4HKLA 4N43B 2Q8OA 1RUF3 3VBOC 4DB5A 1N1YA 1PO23 4S2HA 2KA3A 1GQHA 1BBT3 3NKTA 3ETQA 1QJY3 2R062 3H7JA 5JMCA 2HKXA 1QH6A 4FPHA 2ZA9A 1RUC2 4GWMA 3RWNA 4CDUB 1COV3 1FNZA 4OFGA 3M3QA 4GH4B 4RFT0 4AFDA 1IQAA 3ASIA 4YGBA 1J3QA 2B7YA 2ZZQA 2AR6A 3O0WA 4YGDA 4BM8A 1PZ7A 1LHVA 3RRDA 4PIYA 3ALQA 3L2HA 5FLJA 1RUJ3 2R16A 5IK7A 4FPLA 3ZXKA 2V73A 2OZJA 2VNGA 4P9JA 1MZEA 2O8OA 3B9IA 3UKVA 1FMD2 1RUD3 3I8TA 4COWA 2HWB2 1V9U1 2OUHA 4EN8B 1LODA 1XU1A 4S2FA 1V6LA 1HRI1 2AUYA 5I0TA 1RHI3 4Q4Y1 1NQDA 4QPGC 4Y1UA 5AVAA 2EXJA 4LBQD 1CR7A 1NCQB 2ZCWA 4IESA 1UU5A 1LR5A 2MNGA 2D6KA 2DCKA 1QQP3 5FO7B 4OUSA 3U07A 1LEMA 2TUNA 1C8M3 4JRLA 1LOFC 1R1A1 1W6OA 5KHKA 1POV0 2R071 3FX3A 2WKKA 3O5SA 4B7KA 4XJAA 3SCGA 3WP4A 1AR71 2AYHA 1POV1 2WS91 3SH3A 4BH9A 4XW3A 1NLSA 2ET7A 4CEYC 4E2QA 4GWNA 2MPFA 4YM0A 5KHJA 1ULGA 1A8DA 2ZKNA 4HPKB 2PLV3 4RL7A 3VZLA 4MYEA 4IV3C 1VRH2 2B8MA 2P37A 4OHXA 1PVC1 4Y5Z0 5KWRA 4URTA 5KBFA 2JG9C 3LA2A 1ASJ2 4AEJA 5GLVA 4AHZA 3HN1A 1QY4A 1WLTA 2WC2A 4K40A 3IKWA 2X5IB 4AVVA 2D93A 1HXS2 2ZABA 4L2NA 2ZGNA 4RGGA 4PQ9A 1YRZA 3MIEA 1J1LA 5CIRA 3LSEA 5CFDB 1V6OA 4QGMA 2Z2SB 3M1HA 2JG8B 1AVBA 4G9SB 5CVRA 1MQTC 3UL2A 5I93A 1TME3 4KGGA 4ZU4A 3LA7A 3VBUA 5KXBA 2P3JA 3IPVB 4CDUA 2ZMNA 4LULA 1FV3A 1OQEA 3KMHA 4YM3A 1B35B 1BMV1 1A6CA 3VBHC 2B46X 3OPZA 4YZ5A 4Q0VA 2PHDA 1GR3A 3E6DA 3J9SA 1ULEA 2RS33 1LOGA 1Q8SA 4MUVA 4R52A 1WBLA 2RMU1 4OLLA 1KDKA 4JGZA 1DZRA 4Y22B 1YFXA 3SITA 2HWE3 2IZWA 5J7MA 1OKQA 1OLQA 3FLPA 2TEPA 5ACA3 4N7IA 4DINB 4AE2A 4XDQA 5JR7B 4Q4W1 2DCTA 5JIAA 1H30A 2RS13 4XTMA 4K1ZA 2RM22 4UBGA 2BFUS 1MS5A 1ZZ9A 5KHGA 1ZZ7A 4Q4X2 4LHKA 2V09A 2X53S 1C8NA 1KFUL 2Q30A 1H9WA 1NCQA 1LJ7A 3NJZA 4AI0A 1ND2A 1D4M1 5B2GB 4IV1C 4A7ZA 3NV1A 4R9CA 3OD4A 1R1ZA 5J37A 1OQ1A 5H9SA 5HCAA 1AR92 3FC0A 3VKOA 2CWSA 4FPYA 4BLIA 1NY71 5CG9A 5CFCA 1BJQA 1C5IA 1CAWB 4XPVA 2TBVA 1UZZA 3AM2A 4GB32 3SXWA 3C2UA 1FPN1 1H2LA 3OY8B 4ES8A 2HWB1 2EXHA 3JQXA 2IXHA 3ZYIB 2P3IA 5DDJ3 3AB0A 1NCRA 2X5IA 2WIIB 4YYOA 1G9BA 1LESA 2VVDA 1IS4A 1NOVA 5BNNB 2JG8A 5GZGA 1HX6A 4CDWB