2WNUB

Complex between c1q globular heads and heparan sulfate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
b'TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 27
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuB00
4N90A 4OUMA 1D0GA 3V56A 4NN0A 2WNVB 1OQEA 1TNFA 4QQ2A 2QE3A 3L9JT 1ALYA 4KGGA 3URFA 1RJ8A 2HEVF 1DG6A 3MI8A 3TWIA 1U5XA 5L19A 2TUNA 1C28A 1JH5A 1WCKA 4MXWA 2RJKA 2WNUB 1RJ7A 4KGQA 1KD7A 2WNVA 3K48A 1S55A 1DU3D 4KG8A 3FC0A 2E7AA 5KC5A 4OUSA 1XU1A 4RSUA 1IQAA 4QPYA 2QDNA 2R32A 5KC6A 4TSVA 1C3HA 2JG9C 1U5ZA 1U5YA 2WNUA 2ZPXA 3K51A 4MSVA 4QQOA 2RE9A 1D4VB 2Q1MA 1PK6C 3ALQA 4HT1T 4F3JA 2OIIA 5KWRA 4E4DX 4DOUA 3QD6A 5L36A 4QQHA 3B93A 4OULA 4GIQA 4J6GA 2JG8C 3B9IA 1XU2A 1D2QA 1OSGA 4TWTA 2O0OA 2Q8OA 1OQDA 1PK6B 4E4SA 1KXGA 1A8MA 4QQLA 5CIRA 2JG8B 2ZJCA 3AB0A 5BNQA 3B94A 1JTZX 2Z5WA 4QQPA 3QBQA 1GR3A 3LKJA 4G4FA 4MXVA 2KA3A 3IT8A 1I9RA 1PK6A 2JG9B 2TNFA 3TYJA 2WNUC 2HEYF 2AZ5A 4G3YC 2R6QA 1O91A 3WD5A 2JG8A 2HEWF 2R30A 5TSWA 2WNVC 4D7YA 2X29A 4DB5A 2RJLA 3ME2A 4EN0A 1TNRA 5HBAA 4MXWB 2JG9A
chains in the Genus database with same CATH superfamily
2W68A 2E6VA 4E4HA 3D0JA 4JHZA 3NKGA 3V56A 4LBKA 3W20A 1TNFA 5FY0A 1ULGA 2CHHA 4CCDA 4Z2WA 4LBQD 2WYFA 2VVFA 4IV3B 2W1WA 1H2KA 4L11A 4PQQA 3ZN6A 4NHLA 1LOFA 4GQ7A 5EZWA 1DLLA 1W3XA 4D0QA 4HETA 4OHXA 5IVVA 3O1VA 2OZ6A 2XQXA 2A71A 2Z69A 3KQ4B 4HSLA 2ZS6B 3ROUA 1OLRA 2PAMA 5CKQA 3W5MA 2XHKA 1RHI3 1VBB1 4ZS2A 5FYZA 5HPOA 3MIEA 4QPIC 5J09A 2LW8A 1G8WA 2WLQA 1IOAA 2WR9A 3ACFA 1OD5A 2Y26A 1BHGA 3ACLA 4AVVA 2F4PA 4UFJA 1JXNA 3VBRB 1IPKA 1IS6A 2FDKA 4TN7A 4GXLA 4FO9A 2W39A 2MEV1 2R49A 2ZGTA 2V4AA 3AP9A 3GNEA 1MZ6A 2WA4A 4XJUA 2G9ZA 2GH8A 5T55A 3WF0A 4IGOA 2KM2A 4Y1UA 2WA3A 5FY1A 2ES3A 2P34A 2OYZA 1AL0G 4NIDA 3JQXA 1TQ5A 1U5YA 5KHKA 4XURA 4XE9A 4BMBA 2EF6A 2Y0IA 3CL1A 3H1YA 2RE9A 3POIA 4N8MA 4XFGA 1HB4A 2AENA 1PK6C 3JB8A 4ZU7A 1SPPB 1X36A 1AHSA 2DFBA 2J1VA 1UF2C 3E6DA 1V9U1 2HYKA 3JBG3 4OZXA 4P5YA 5G04L 2B7YA 3A23A 3C7HA 4QQHA 4HVRA 2KR2A 3UGHA 2G4IA 1RYYA 2ZEWA 3T08A 2EXJA 4ZS3A 1J1LA 2WO7A 3U75A 2ZKNA 1XNCA 1WLDA 2RR13 4AGRA 4B1MA 1QXJA 2NMNA 2VOKA 2VULA 5AVAA 1O3QA 5C71A 1AXYA 1RUG1 4ZXEA 4E4SA 1KXGA 2PHTA 1Q43A 2HWF2 4NVPA 4YW4A 4P00B 5DABA 5FP4A 1BJQA 2JICA 5CIRA 1JOPA 5JVVA 1ND2B 2ZHLA 3UKNA 1XNBA 4D3WA 4IETA 3AX4A 2Z5WA 3WINE 2QBXA 1W6MB 2J7MA 2DCZA 4HMZA 3J8F1 4Z82A 1AJOA 2XWJB 1W2AX 3A0NA 3JB4C 3JD71 3TB0A 1AL21 4Y20A 1U0AA 5FXZA 3T0DA 1QJY3 2J1SA 5IHRA 1I3HA 3E97A 1CZVA 2JENA 2V5YA 3PVOA 5F32A 3USUB 3POJA 5A33B 1OPMA 4XQWA 5FZBA 1OFSA 4QX3A 4A4AA 1PVC1 2R30A 1ONAA 1K5JA 3P3PA 2Q8DA 3AYCA 4D8MA 2OPWA 4MYEA 4XFHA 1DQ6A 2ZGQA 3HNMA 4IL7A 1VBD3 1VBE3 5FXWA 2Q8CA 4BCUA 2VGDA 1BKZA 1WMXA 1ZNPA 4O9GA 3OBAA 1H8VA 2CGNA 3IMMA 4Q4X3 3ZPYA 3T2PA 3U07A 1PGW1 1H2NA 4OUMA 4OYUA 3AMPA 3H9AA 1DFQA 1R092 1RGSA 3K2OA 5EPAA 1HJGA 4OHVA 4ASKA 1QJX1 5FOJB 3CEWA 3U11A 4AAXA 1TMF2 4KMQA 4X8PA 4C90A 1YUDA 2X5IC 3P6BA 4RA0A 2D6PA 4PBOA 4RR3B 3I3BA 3AC0A 1ODNA 1W06A 5FP8A 3WG3A 1VAMA 2VVEA 3O1PA 2E63A 2IXHA 1O3SA 2BEOA 1TVGA 1FNYA 1V6MA 3RGBA 1WA4A 3AZWA 3CZJA 1R1ZA 4CP0A 1C28A 1XNAA 2GNBA 3G7DA 4GB33 5CFCB 3OBZA 4BQWA 2UWAA 3A21A 3B69A 3A7QA 1RJ7A 2QUOA 4OQ9A 1Q8OA 1XSQA 4HLTA 5I0SA 1SLIA 4I0BA 4LE3A 5K0UB 3VDDB 5JOWA 4RHV1 3N7JA 2GNMA 4KG8A 5DUXA 1UPIA 3PJQA 5FWEA 5EWSA 1RHI2 5FK7A 4A2UA 3BIWE 5FK8A 2D5FA 4BQ5A 1SZBA 3VBSA 2GALA 3OEAA 1V70A 4RQPB 2WT2A 4R9AA 1NCQA 2W3JA 4OFGA 4AFCA 5CADA 1POQA 1LGNA 3I54A 4C91A 4FPLA 1CIYA 1BXHA 2XB6C 4YW3A 2ZMNA 3J26N 4LBQB 4KU7A 5A7WA 4Q0PA 2UURA 3OD0A 4XUQA 5FPAA 4CDUC 2VCMA 4YVSB 5LZ6A 1CPNA 4HN1A 4WM7A 5FPVA 5C9AC 3RJ2X 3MV01 2E31A 3MIGA 3S0MA 1ZX5A 2OT7A 2VNOA 4HBNA 1MS1A 2HWC3 4IW3A 4CPBD 3PHMA 1JOJA 1BEV1 4XF0A 4ZPIA 4FFGA 1XU2A 2JKXA 3I3QA 5KHIA 3W21A 4H55A 4TWTA 2BERA 3JBG2 2Q8OA 1GSLA 3P3NA 3NAPA 1ULDA 2PTMA 3POBA 3USSA 2BPA2 1RIRA 1KDMA 1XBFA 2ZAHA 2J42A 1F4HA 2RR12 5LA9A 3WNOA 1UY4A 1LGBA 2X5IA 4IEVA 4B4PA 4IE4A 1YLLA 3ZFFB 4LTAA 4XUTA 5FP3A 1SLTA 2JECA 2CU5A 2FDHA 3R4UA 1ND3B 4D6SA 1AYM1 4S2GA 4Q4V1 1F4AA 1L3JA 5A6ZA 1REFA 4NIGA 3OEBA 3RVHA 3HN3A 1G6NA 3EO6A 2BU9A 1OKOA 3KF5A 1HQLA 4QPWA 4DY3A 4KWKA 1SBDA 3PTYA 3VHOA 3BVCA 3UJQA 5C3SA 3OBTA 3AK0A 1QJY2 4NOTA 3T4VA 2QKDA 1PO23 2RS33 3I2OA 1QJFA 1WLCA 3RZHA 4PF5A 2EAKA 2E53A 3NJZA 3WQ0A 3AKSA 1GOFA 2YROA 3VDBA 4IXLA 1W3VA 1F5JA 1GV9A 1OQ1A 3HEIA 4LBOA 2NM1A 4QU2A 4N43A 4R4ZA 3H8UA 3OGGA 1HXS3 2J22A 3I3DA 1MEC3 2RS11 3ILFA 4Y5TA 1VBD2 1VBE2 2FZ1A 4IEYA 4KU8A 2VMGA 1T6GC 4CDUA 3LIHA 4CEYA 1SFPA 2CAVA 4JGZA 4RL7A 4XMAA 5EHDA 4Q4X2 2PLV3 4B7EA 1GZCA 3WZ1A 4IERA 1XE0A 2DUQA 3AZZA 5LBEA 2GMMA 3WG1A 3RWNA 1JHJA 5L19A 3B3QE 3FMGA 4HKWA 3ZFGC 5L7OC 1WCKA 4CDXC 3E5XA 3EBRA 3POSA 5GLVA 2BWCA 1QJU3 2Q0AA 1H1IA 3BTAA 3N9PA 1K45A 1V6JA 4LMFA 4AHWA 4I3GA 2Y6FA 3VZNA 4XFCA 4UAPA 1TE1B 5FV3A 5FYSA 1X7NA 2BJSA 4GB32 1VB2A 5E16A 3ZYBA 4IESA 1KS4A 1H9WA 4GAZA 2IFWA 4FOWA 4JDNA 1STMA 3VZLA 5JSRA 2OKXA 5IK5A 1H8TC 4OUEA 5IVFA 2D6OX 3K4DA 1YJLA 2G19A 3KD4A 4XF1A 2Y6GA 5JSPA 5BNOB 1DYPA 1HLCA 1WUVA 1WLTA 4DUWA 2VW0A 5CG9A 2XBO1 3PVEA 2ZPXA 3K51A 2E32A 4J25A 4PCRA 1OLME 4A6OA 2ENRA 4WVZA 2B4KA 4OQ8A 4QQOA 3WNMA 2ZOEB 4AVBA 4LK7A 4LO8A 5FY4A 2XJTA 3ALQA 3ZSEA 4H3WA 1JYIA 3M4FA 4XF9A 1H1AA 1W6OB 2E33A 2PA7A 2ARAA 4I3PA 4QAWA 5FYYA 5GKAC 3IM0A 4IDZA 5H9PA 3E6CC 1HV1A 3V0BB 3BTXA 5CFDC 4BQYA 2JG8C 5FYBA 4GALA 1MS9A 1EYBA 1Q8PA 1RUI3 2XL9A 2XMLA 5FZ6A 5HCBA 1Z78A 1MZFA 1V6NA 1W6PB 1QU0A 2MNGA 1GZTA 3IPVA 2HWC2 3ON7A 2G9FA 3ZXDA 3CZUA 2A5ZA 3CJIB 1E57A 1JU3A 1A8MA 1UOBA 5FJHA 3I59A 1AJKA 4XTPA 1UWWA 2MEV3 3FLTA 2R1DA 1YNAA 4QDRA 2ZJCA 3AB0A 3DF0A 4HKLA 1BVVA 2ET7A 4UW3A 2DCJA 1UZ0A 3KV5A 2R0FA 2QNKA 2NPIA 1VR3A 2RHPA 3ZFGA 4O9EA 4HL0A 3RRDA 5L7OA 1YHFA 1GNZA 4CDXA 1NG0A 1ST8A 3M1HA 5A3NA 4KQ7A 4M01A 5F3EA 2BNMA 1YCIA 2I2SA 3PVNA 1ZA4A 5JI7A 3NV2A 3UJOA 1OOPC 1DYOA 1FAYA 1OA3A 3PIJA 4WM8A 1UAIA 1CONA 1OUSA 1PGL1 4LO5B 2XPJA 4QM8A 1SBFA 5A3UA 2DVFA 2A6WA 4GH4B 3MGUA 5I0RA 5TSWA 1BMV1 1NT0A 2AYHA 1H8TA 1REDA 2HJIA 1Y7BA 2ZHNA 1AR81 1VE0A 1T2XA 2VPVA 3DKQA 4M0HA 2KXLA 3AMHA 3T2OA 4EN0A 2C0ZA 4FPCA 3F2ZA 4XQ4A 1DZRA 3OOXA 1RUG3 1ULFA 4LXLA 4FAHA 3KZ4C 1PO22 2V09A 2RS32 4NRQA 3AYAA 4IEUA 3WW4A 5LA1A 1CR7A 3O0VA 3I2KA 4EJRA 3OB8A 2AEZA 3FHQA 1B35C 2VG9A 2ZEZA 4H2AA 4IE7A 1CAVB 4XUNA 4FPGA 3VBOB 4DRRA 1APNA 3PUIA 4N9HA 1HXS2 5F6KA 2ZGUA 3M2MA 1W8OA 4CU8A 2ZCWA 3LEKA 2JB4A 1MEC2 2R0HA 4YZ1A 1BBT3 2QQMA 5FXVA 2F4LA 2W46A 3J8F3 1G9FA 2XVKA 4FPOB 4AVCA 2JXAA 5CFDA 3CF6E 3DPRB 3HR9A 5FMCA 1OFNA 5JMCA 1NUKA 2PLV2 1W8HA 3O1SA 3LA7A 1WCQA 1PMHX 1QHDA 4P5HA 1DQ4A 3VD7A 4IEXA 2RJKA 1QIQA 5IVYA 4AVSA 1RUOA 2HLEA 3LFIA 2WNVA 1PVC3 2OVUA 2VH9A 3K48A 3AL5A 4CDWC 2OXBA 3KV6A 4JAAA 1BK0A 5T3NA 4A41A 2E7AA 3O5SA 1K5MB 3FFQA 4GJYA 3VBUC 1JMUB 3KGZA 1QJU2 1XYNA 2WQ8A 4LULA 2ZGKA 1BQPA 4NHYA 5IVEA 2RS53 1ZRCA 2IXCA 3IB3A 4COUA 2BOIA 2EXIA 1HRI1 1WW5A 1RUNA 4TSVA 5HCFA 4QPGC 1WW7A 4U2AA 5C33A 3V0AA 3I3EA 5F1RA 4Q2FA 1NAEA 4XZPA 2WZ8A 4MSVA 5EP9A 2BUKA 2E51A 3QH6A 4PT6A 3PUQA 4LBNA 4CXYA 2OIIA 4EN7B 1UMHA 3SHRA 2RMU1 2ZZQA 3IAPA 5HCHA 2NYYA 1CX1A 1K42A 2WZR3 5L36A 3MICA 1SFYA 2H0BA 3BPSA 4GIQA 1LU1A 2W95A 3RZJA 3NV3A 4JTOA 2W1SA 3APBA 3BALA 1XNKA 2UWCA 1PM4A 4YVWA 3WUDA 4RHV3 3VZKA 5FBZA 1B35A 3GGLA 4DQAA 4AEMA 1UY2A 3ZN6B 5D8AC 4Q8KA 1QEXA 1RUI2 5IATA 3VBHC 4HSJA 3ES1A 4LA2A 2GC3A 1SDDB 5A3WA 1HRV1 3A22A 4KI5M 1DGWX 4BLIA 2XLAA 2R16A 1MZ5A 2WAAA 2ZEYA 1F35A 3EB7A 2VOWA 2XG3A 4D94A 2MEV2 4M0NA 4TZDA 1ASJ3 3EQEA 1DQ2A 2Z2SB 4I0AA 3HJRA 4F8AA 1M06G 1WLWA 3GBFA 5F37A 3POYA 3NWKA 1RUC1 1QOTA 3ZOIA 2QDRA 3VBUA 3VD5A 4LQRA 5E88A 1EY2A 3AFKA 5F5CA 3WD5A 1VMFA 3LWCA 4IUGA 4QHZA 3WP3A 5FYHA 3O14A 4EQVA 4FPYA 4BHPA 3KHCA 1BEV3 5FLJA 3NJYA 3KGLA 3RSJA 2RJLA 4YW5A 3H42B 1E5IA 3I2JA 1SCSA 1Y9MA 5EJZB 4AHXA 1FNZA 4NAOA 1PGSA 2AH2A 2VCBA 2J1UA 2ZMKA 3N9QA 1FV2A 4QKBA 3MHZA 5LWBA 4FQ4A 4Y4RA 5H9QA 4QKFA 1D0GA 4PLOA 3H7YA 4ONUA 5E8AA 3H1MA 1S2BA 2QE3A 4NIHA 1RUG2 4YG0A 1SLBA 1ZZCA 2JWPA 4MUVA 3VL8A 3WY6A 3BUCA 4UOJA 5EXOA 2XLGA 1AYM3 1ZBE2 1OH3A 1R081 4Y4YA 4QD2A 1W8WA 2VNRA 3CBNA 4A3ZA 5IJRA 3OPWA 4B7KA 4YARA 2EXKA 3B7MA 2YU2A 3AVRA 4NO4A 5FPXA 1J83A 2VL4A 4TLFA 4XIKA 1BBT2 4JRLA 2Q1ZB 4XBNA 3J8F2 1OXCA 5ACA3 4HVQA 5JXIA 1IPSA 4RS5C 4BU2A 4FBFA 4GWNA 5HXMA 5D8AA 4YSFA 3VBHA 5JZGC 1O3TA 5CB7A 1HJFA 2A70A 4XACA 3UGGA 3CMGA 5FZOB 2RV9A 1HQWA 3MLJA 3DN7A 1LHUA 4H7MA 3ZLIA 5IAXA 3ACHA 2VTXA 5JXHA 3J7HA 1PVC2 4M3CF 3ZN5A 1QNWA 4QPIB 4CCJA 4CVUA 4ZZ8A 4BQXA 1TME1 5JLVA 4CZSA 2RS13 4WVMB 3D3AA 3S57A 2JG9C 4IGQA 4CCKA 2RS52 1G9BA 3NW4A 3CQOA 1UYYA 2PHFA 3MV11 4PDWC 1PGW2 4AK3A 4ARXA 5C5UA 4Y5Z0 3N4MA 1V0AA 1VPHA 4QX0A 4AE2A 4DOUA 1H1MA 2ZACA 4AGGA 1ZRFA 1GWKA 2IVIB 1BZWA 3OD4A 5FZ1A 2EAAA 3B00A 3GCWA 4UFMA 5ERLA 1OQDA 3RZZA 1PK6B 2WZR2 3THCA 2DVDA 3LGRA 5F6LB 3POFA 3S7EA 1GWMA 3AFGA 1CAWA 1WZXA 1S2EA 4NAMA 5A7SA 3LPFA 3KS7A 5FYTA 4Q4W3 1JW6A 3PJYA 3GF6A 1PZ9A 1JYCA 2DDUA 4RHV2 3QACA 5FMDA 5BNQA 3BN6A 5DZGA 5FPBA 3VHRA 5BV6A 5JOZA 1OVSA 2ZGRA 1QJEA 3JUUA 3THPA 4CEYB 1UY1A 3BI3A 2XBO3 4JQTA 4DUXA 4XF3A 5AC93 3TRSB 2VQUA 5DG1A 2ZABA 3MW2A 3VUOA 1YQ2A 4FPJA 4RS5A 2WNUC 4NRMA 5C3QA 1V00A 4YM0A 1OMIA 1AZDA 2FHRA 1ASJ2 1L7RA 1QDOA 3E1F1 3H3UA 1TG7A 2W94A 2WBKA 3S7IA 3DYOA 2AREA 3LA2A 1UIKA 3NNJA 3H3ZA 1ZA7A 4XEZA 2WJSA 3ZYIB 4D7YA 4NPLA 1Q8SA 1UQXA 5FZ9A 5DDJ1 3RQ0A 1TNRA 4FTSA 2O8QA 2UWBA 1C1LA 2OS2A 5HCAA 3ZMOA 4MXWB 2CL2A 2JG9A 4CP2A 1BEV2 3ECQA 3IDBB 4YPJA 3AKPA 3M70A 4JGYB 2DUOA 4AWDA 2XJRA 2A73B 3SISA 1NYWA 1OQEA 2IXJA 4KL1A 3SMHA 1NA1C 4YW7A 1W6QA 2XJPA 4FOQA 3OPTA 5A7OA 1I6XA 1NCRC 5LBFA 3PUSA 4LUKA 3OGSA 2W5FA 1ULPA 2GU9A 3HD8B 1JZ5A 2JDNA 2FMDA 4LHNA 5GLZA 4YG6A 2VMEA 3OGRA 1AYM2 1NXMA 3WCSA 4AAPA 3D0SA 5EJ1B 2YGLA 4LO4B 5CKMA 4E8CA 3PTRB 5GZDA 1CESA 1UZYA 4ZY9A 4NRPA 2VAUA 4W6YA 1AR83 2D3RA 5ACA2 5FQ0B 1G7YA 2GH2A 4FCAA 4CEWA 5J3UA 4PI0A 3ILRA 4Q0SA 1HB3A 4COVA 1IQAA 2BV4A 4K21A 1VRH1 2DCTA 3I97A 2W52A 4F83A 3KF3A 5IVBA 4N53B 1PX3A 3ZXLA 1UY3A 3GHMA 4IV1C 3FHAA 2ET1A 5FRAA 1MQTB 4GA9A 3VLBB 4BIFA 5JPMB 2VZRA 4COWA 3VBFB 2WNUA 4LK6A 1SBEA 1MS8A 4PIZA 1PNFA 4KBZA 3HWJA 4QWNA 4EYUA 1RXGA 2K9ZA 2RS12 2NN8A 2QQIA 2YDEA 2Z79A 3PMSA 1W6NB 4AQSA 4D6QA 1J3RA 1E5SA 2D6NA 1NKGA 3M7AA 4RFRB 1JZ8A 4RFT0 1EP0A 1M4WA 2HBUA 3RYRA 4P02B 2VY0A 3POWA 1QOSA 5CISA 4H14A 2WL1A 3VKOA 4XJAA 3KT4A 4BZ4A 5CBLA 4XIOA 5C9AB 5DQ0A 3RPQA 1IG3A 2VMIA 5FZEA 3WQ7A 2XHNA 1LU2A 2VZVA 3MIBA 2GP5A 1QKQA 3KLSA 1OF4A 1NA1A 1QH7A 3RYPA 3RZLA 1OHFA 1NCRA 1HRI3 3SEEA 2DV9A 3VKFC 1UYPA 2R043 3OCPA 2VCCA 4B3NA 4K8FA 2R7EB 1O8PA 1HX6A 2YG0A 3VHPA 3ZPOA 5JI9A 2UY8A 1OLQA 2YHJA 1QQP2 4Q4W2 1HB2A 2R061 4DINB 4MZUA 1XE8A 1Y43B 4META 2GC0A 4XDOA 3ZFEC 5T54A 1J58A 4ZU4A 2ZXQA 4A3XA 2XGXA 3SITA 3SCHA 2XBO2 4PLNA 5A70A 5AC92 2RMU3 1PO11 4CP9A 4A44A 4LHKA 1ZM1A 2ORXA 2ZKLA 4URTA 1PIV3 5F8PA 3ABZA 4RD7A 3WR0A 5JXJA 1NZIA 3FLRA 1W2UA 1LHVA 2B39A 2ZEXA 1RC6A 4JTNA 2W08A 1F8VA 2VD7A 1ENXA 4BJ0A 5FYUA 4BDVB 4IV1A 4LKFA 2JDUA 3VBSC 2VUDA 1PZ8A 5FP7A 3ZXEA 1WBLA 2IVJA 1J1TA 2JE7A 1NCQC 4R4XA 2ZGSA 3QOPA 5LRSA 1OUXA 1FOD1 2P3KA 4DEVA 2FMYA 3DYMA 1N47A 2WIIB 2YGMA 5T5LA 3MFAA 5DAXA 4LA3A 3O7OA 2W47A 1GP5A 3LDRA 4QXHA 3AKTA 3URFA 3LA3A 4L99A 1BK1A 1OF3A 3KCXA 3KWVA 4UFHA 4GULA 4BOWA 2H0VA 1UOJA 1CZTA 4WM7C 1ZZ8A 5DZFA 4UBHA 5F3GA 1GWLA 1TEIA 3T0BA 4UF0A 2VR4A 4AQTA 1V6IA 2A3XA 5SV5A 3WX5A 2WYSA 3FZ3A 4YZ3A 1RUC3 2WAOA 4MGTA 4S2DA 1KD7A 4MV2A 3ZYJB 2Y6HA 2VW2A 4N7UA 2O1QA 1RVF1 1X8MA 1LJ7A 1N1YA 1C8NA 3NAPC 1PGL2 2LS6A 3MDPA 4OCTA 4IE5A 3HN1A 3GZTB 1VRBA 1WKYA 2GSYA 3TN91 4B1LA 1EV11 3KCYA 4FQZA 4TXWA 5F3IA 3TNPB 1BMV2 2HWB1 4NROA 1AR82 4OI0A 5KC6A 3U14A 1S0GA 1MR5A 4KWJA 3VKNA 3ZFEA 3ASIA 1CGPA 1CQ9A 3Q8AA 4X6RB 2XDVA 3LPGA 4YRDA 3LOBA 3FLPA 2DTYA 2PHUA 2DF7A 1UZVA 3GALA 4BM8A 3IZOA 2B9UA 5J1XA 2ZMLA 1W90A 1OKQA 5C8CC 3ZYFA 2Y64A 3GJAA 1R083 4Z92B 1NY71 2HBTA 2ZX0A 5C5TA 5C70A 5BNPC 4EE2A 4OULA 1POV1 3VDCA 1UD1A 5IK4A 1XNDA 5FKBA 5CYYA 5ABJB 4ZONA 3PMEA 2FDIA 1AR61 4UFLA 3BKZA 4ITCA 4XILA 4M00A 2EIDA 4COYA 3RZGA 4QX2A 2Q1FA 4BQ1A 5JUVA 4N43C 5A32A 1ZREA 4IEZA 4CDQB 2DU1A 3LSEA 4N7IA 5CFDB 2JG8B 1GNHA 3AZVA 3WNXA 5BUVA 3BODA 2HWE1 2YV8A 1XSRA 1GZWB 4JGZC 1QGLA 2WNEA 4LKEA 4M4PA 4D7TA 1QOOA 3SNMA 4OZOA 4FOVA 1AUYA 1LTEA 1DIWA 3OF1A 2XUEA 3B01A 3SCFA 1HRI2 2D5HA 3T1LA 1OH4A 4Q8LA 2E26A 3EMRA 4Q5OA 2R042 4FPKA 3WG4A 3ZSJA 1JZ3A 2ZA9A 2QQWA 1EAH3 4QXKA 1ULCA 4QU1A 3JCIA 4M3CE 2HEYF 2GN3A 3OUHA 3OY8B 4M3CB 1GQPA 2R6QA 3T3YA 2LRPA 3TEYA 2MHFA 1CAXA 5FMOS 4DMIA 4BXSV 1YFYA 5C7GA 1KDKA 1WCSA 1LGCA 1VBA3 1VMHA 2WFPA 3I8TA 4E9KA 4HKOA 3ZYGA 2RMU2 3L2HA 4EWAA 1OOPB 2JB8A 5EJ3A 1NQDA 1PIV2 3WQBA 1TZOA 1VBC1 5HBAA 5DAWA 3O0WA 3NQHA 3NRUA 1O8SA 2XJVA 4DXRA 4LKDA 1OURA 1US2A 1V6OA 4MLOA 3X29B 3WDVA 1GOGA 2GC2A 4AZZA 4PIYA 5IAVA 3WW1A 5C8CA 1W05A 1AX2A 4LO7A 2B45X 5ANQA 2B46X 1GU3A 1HKDA 4WVVA 4CCLA 1AVBA 4X8NA 5DN2A 3DL3A 4IEQA 3W9AA 5BNPA 3MZHA 1SEFA 1U5XA 4ATEA 1I1EA 2WS91 2ZGNA 3H0OA 1Q3EA 3KCCA 1GNYA 2AC1A 1C8M1 5BNNB 1LODA 2BBAA 4EROA 1ZBA1 4XFFA 3RWKX 2YPDA 4UW4A 2D44A 5B4NA 3HIFA 2Y60A 3POEA 5H9SA 3MO4A 3L2YA 1S55A 2C6SA 3C7OA 3WNPA 3MIFA 2JD9A 1W9YA 3PDQA 1S0DA 4IV3A 3M3OA 4A7KA 4A7YA 1ND2C 1RUC2 2WN2A 2VUAA 1XU1A 3MPPG 4I2OA 5FZFA 3ZDSA 2HH9A 3D82A 1J3QA 4LOTA 3LF7A 4OHZA 4E8DA 3ZXKA 4CDWB 2DBNA 3KSCA 3VKMA 4E2QA 5T5JA 3RZMA 2VZ1A 1CAUB 1YI7A 2Q4SA 3JU9A 1DZTA 1UZWA 4D6RA 1D4VB 3IBMA 4IEOA 1UYXA 2A6VA 4OLLA 1RTVA 4AFBA 4F3JA 1S0IA 2X53S 4WM8C 3ST7A 4AI2A 4EV0A 2WO3A 4QPGB 3RMXA 4YFZA 2GMEA 1P8JA 1W9TA 1OBNA 3B9IA 1O59A 3UESA 3LAGA 1R082 1OSGA 4XABA 5FPLA 1CX4A 2QQVA 3KV9A 3PURA 4UWDA 3UETA 1SQ4A 1JYVA 4TTGA 3NNLA 4YZ2A 5HV0A 2PELA 3UKVA 1LR5A 3AP7A 2IFRA 2GN7A 2OZJA 2Z42A 2BP6A 1GUIA 4P9JA 5L9RA 2P3JA 1VRH3 2Y38A 4RN5A 4EWDA 1SLAA 3FBYA 2VO5A 1AXKA 5LK5A 1VJ2A 2JX9A 4QQPA 1MS0A 5IT6A 3NVCA 1PZ7A 4KBBA 2ERFA 1UU6A 4MXVA 3KHBA 1QY4A 3FHIB 1LRHA 4PQ9A 1O4ZA 3HT2A 4JDMA 1UOGA 3U37A 1VBB3 3CIHA 4Y22B 2D6LX 4HPKB 1URXA 4GKXA 4K7JA 3BTZA 3S5QA 5FOBB 5A3TA 2AZ5A 1D4M1 4G3YC 2JKBA 4LIUA 2CYFA 3ZSLA 4XFAA 3IIIA 1JYTA 1ND2A 2ID4A 1A6CA 1EAH2 3ZIXA 2WNVC 3AP4A 4HG6B 4RQPC 1XB9A 1LB2A 1W6MA 3B5LB 3EXUA 4LPLA 1W0PA 3VZMA 2PHXA 2ZGOA 1HN0A 2D3PA 1VBA2 1GP6A 1HB1A 2ZHKA 3GJBA 3OYWA 5FZCA 4XXPA 3NJXA 1Y9QA 1FYUA 5A33A 1JUHA 2Y33A 4P9WA 2Q8EA 2KD7A 3UKTA 3USUA 5FMBA 2ARBA 4R52A 2P5BA 2VXRA 1QF3A 4YVSC 3PIGA 3J7NA 3OGVA 2WT1A 4KNCA 4LO6B 1OD3A 2WO1A 3U4XA 3VGIA 2FCVA 1DG6A 3N7MA 1FATA 1KQRA 2L9LA 3CDZB 3BOWA 5BPXA 3VD9A 4BISA 1V9U3 5EIYB 4MHUA 2CV6A 5LBBA 5SV8A 4HFSA 1RUF1 4O61A 3C3VA 4NIIA 5FMOL 1CJDA 1OC1A 1JH5A 2VQAA 4IE6A 1BCXA 4AEJA 3HNYM 3ZXGA 2RJ2A 5I0TA 1PO13 3AMQA 4FPHA 4JCKA 3E5UA 3I2FA 2WT0A 4V2VA 1NQJA 3FC0A 4YVWC 2G9GA 5FJKA 1S1AA 2A7AA 4BYYA 3HOBA 5KC5A 1IQDC 5FAXA 5GALA 2JIGA 3MYXA 2OW4A 3HT1A 4LJHA 4A7ZA 5C3OA 2J1AA 2QQPA 3O12A 4I09A 1ND3C 2PFWA 2QQJA 3M8LA 4YGDA 5LATA 5JAXA 2FD8A 2IZWA 1TMF1 1ENRA 3MLKA 3I49A 4Y1ZA 2XJSA 4EN8B 3ZX7A 1FOD3 5CFCA 5KR7A 3DEMA 1AF9A 5JZGB 2WQ4A 4BQ2A 4FP3A 2ZGMA 1DHKB 3AJZA 3JD73 3R6SA 1AL23 1R1A1 1VAKA 2ARXA 2QFEA 5K0UA 3VDDA 3DKWA 4OHYA 2BYVE 1FPN1 1N1SA 2PHRA 5C8WA 4ES9A 5I8TA 2TBVA 4HT1T 1WMDA 1AX1A 2AACA 2AGSA 2J1EA 2QZ2A 2JEMA 5C4WC 4RQPA 3RI9A 2YU1A 2D93A 4LBLA 1XYPA 1YIFA 1F31A 4E27A 3OBRA 3K4ZA 4PDWB 1O6UA 3C8XA 2WINB 3VV1A 1N1VA 4AL9A 4JKMA 1NXD1 4W4ZA 5GLTA 2VTFA 4MOAA 4QX8A 3HBZA 1RVF3 4LBQA 3B9CA 2WLPA 3C7EA 3DUIA 2WN3A 4YVSA 1LEDA 2NQYA 1QJX3 3UV9A 3TN93 3ZDVA 3ZM8A 1EV13 2XJUA 3M3EA 1YO8A 4QHBA 1Q56A 4R8HA 4F7ZA 1LOAA 2QTWB 2XONA 1IS5A 3H1WA 4LHSA 4XUOA 3WSOA 3ZSMA 4AOCA 3GZUC 4G4FA 3ILNA 1VRH2 1I9RA 4XHBA 1GLHA 1HW5A 5FLIA 2VMCA 5T52A 2PQQA 4I0WB 3O1RA 3ZN4A 3ZMNA 2VBDA 2Q5TA 4Q0QA 1KS5A 3VB9A 3NNMA 4CCEA 5GZGA 2HWD1 4XAAA 4XC9A 3AP6A 3RNSA 4O7XA 2DFCA 4CUGA 1S0CA 2D43A 1C1FA 1VBB2 4JRAA 3T2TA 3ZFFA 1D0HA 4DIQA 4U36A 1NX9A 1ND3A 3WG2A 1MZEA 3SH4A 3LSDA 2A3YA 2Y34A 4P9GA 3WF2A 5BNOC 3WP5A 1JZ4A 1DGRA 2VOTA 2WC2A 1KGYA 2YYOA 4XFIA 1XC6A 2BOJA 1S4CA 2VMFA 2WABA 2WQZC 1W2TA 2CWMA 2DBIA 2V72A 5JCTA 3RI8A 1A78A 2OPKA 4W6XA 5JDBA 2ZX4A 1KJRA 2HWE3 3VDAA 3R05A 4NPRA 4KGGA 4BB3A 1AYN1 2QQLA 1YWKA 1RITA 3WVJA 4Z1VA 2XL7A 5C4WA 3C7GA 3FL7A 2WKKA 3DGTA 1NE6A 2PAKA 5JOYA 2VW1A 1Z7S1 2WUHA 2VNGA 4ES8A 5JPNB 3BTYA 3O1OA 3GM8A 1DQ1A 1V9U2 1YI9A 5LA2A 5K7PA 2BBVA 3CJIC 1IS3A 3POGA 2BWAA 4QX7A 5AVPA 1DU3D 3UGFA 2EIEA 2CSGA 2YPJA 1PO12 2CTVA 2NP0A 3ZKYA 4O65A 1VBD1 1VBE1 1UZZA 1VBC3 2YMZA 3AKQA 1CZSA 4XVHA 3I7DA 2QDNA 4ZKTB 1IS4A 2XJQA 2DYCA 1X9PA 2LROA 4Q4V3 1V6KA 5GM0A 4LITA 4C8DA 5FYCA 2ILMA 4MGSA 4NHXA 2ZBJA 2EA7A 3K77A 2VQTA 3I2DA 3PUAA 1W8ZA 3N9OA 2CAUA 1UX6A 1IG0A 2QCSB 5AFBA 1O5LA 1FOD2 4UFIA 5F2WA 2WDBA 3KM5A 4GH4C 3JD72 4QHOA 1AL22 4CCCA 5FZ4A 1UW8A 3OSDA 1WWYA 4FFHA 3D4KA 2BGCA 1F15A 1QWRA 2VXJA 1C8M3 3MW3A 3OUIA 4J1WA 5BNOA 5CG8A 1ZBA3 5D21A 3DV8A 3IDCB 1CJPA 5CNAA 4Y20B 4E2GA 3HQUA 2UYBA 5FYMA 3VL9A 3WDUA 4XZUG 5DPNA 3H8XA 1X9TA 3ES4A 1YQ5A 3LFMA 1YC61 1H4HA 1OVPA 1OLMA 1MPXA 3VBOC 3HPNA 1ZZ9A 1DCSA 4YNIA 3ZSKA 4MGQA 1W6OA 3H3LA 3JXSA 1RVF2 2VZSA 2VMHA 3V0BA 4ASMB 3DPRC 1N3QA 1COV1 1JN2P 2WSVA 2X8KA 1QJX2 2YBPA 3TN92 4W65A 3S5AA 1EV12 3U0ZA 3Q9OA 3BGAA 4BLJA 5FZ8A 1W6PA 1GMMA 2UYAA 1DBNA 3F95A 4W8JA 2BZDA 1RUJ1 3CJIA 4YZ4A 2OQ7A 5D2AA 3GZAA 4GWJA 1K5MC 1O91A 3VZJA 4MH0E 1G9DA 1RUE1 5J37A 2ARCA 4MADA 5IW0A 3WQ1A 4AEDC 5LASA 1YQ8A 2N7GA 1SACA 1ZRIA 5ANNA 2EIBA 3ME2A 4DRVA 2W1UA 3KMHA 3LOIA 1LCLA 2ZTNA 4W50A 3WP6A 4CEWC 3K75B 2V73A 3V64A 1AR71 5K8SA 2NLRA 1ZZ7A 2OQ6A 3SH3A 3THDA 3U78A 4YM2A 2W92A 2BVVA 5EQUA 4Y5SA 4XUPA 3WF1A 1OT5A 3A0KA 1SHWB 1FI2A 5E6HA 5FKCA 3WDTA 1FMD1 3T4HB 2VJXA 3IDAA 1LKNA 1DP0A 4GH4A 2RVAA 3WW2A 4CUAA 1DQ5A 3MI8A 4CPBA 2P17A 4FTBA 2ETEA 4YG3A 3VBSB 4DXZA 4BQ4A 1W9WA 2IC1A 5KHJA 1NCQB 1VP6A 3P1IA 5E1RA 5FDBA 5KXBA 2HWE2 2XVLA 5L9VA 4IEPA 4JDOA 2TUNA 4DEQA 3CU7A 1YEWA 1ZZBA 3ZXFA 4DZGA 4QX5A 1UXZA 3OUJA 3BIEA 2OUHA 1UXXX 2LTNA 1D4M3 4KGQA 4MGIE 5A7WB 2Y6KA 1CAVA 3I2IA 4AQ6A 3JQWA 3NV1A 3VBOA 4Z8BA 2P3IA 4GZ9A 4WM7B 1CIWA 1LEMA 2RS31 2I07B 3PUHA 3J7MA 3FFZA 3DYPA 1XYOA 3KVAA 3SKJE 4AI3A 4LT5A 4LNVA 4NHMA 3PVBB 4QPYA 2DUPA 3DPRA 3BCWA 2EVXA 3AXEA 1D7PM 1DDLA 5LEJA 1FX5A 2DVAA 2R32A 1HXS1 2X10A 3E5QA 3PLQA 4K8RB 3MUZ1 5FUNA 1VBC2 3NAPB 5DZEA 1O3RA 4NWWA 3MLLA 3EYPA 1QJZA 4XJ8A 2EXHA 1SFNA 1K5MA 4FXKB 4Q4V2 3INAA 1PM7A 1Y4WA 2X5IB 5CAZA 5IK7A 1RUF3 4S2FA 4AEDA 2W1QA 3NSTA 3TEXA 4HONA 4NJ4A 1SG3A 3RZKA 4MG2A 4DPNA 3AVSA 3R4DB 2SLIA 5LBCA 2P4EA 1H9PA 4BMEA 1YXWA 4MGYE 4NUBA 4DXTA 1UCXA 2QQOA 2JD4A 5C8CB 1MS5A 3ZXAC 4Q29A 1RUH1 2BW8A 2R1BA 2CDPA 1W8TA 4IEWA 1C8M2 2B9VA 4AW7A 2XR4A 3H8RA 2QJVA 1ZBA2 4ORFA 3GBGA 5A3OA 3HAGA 4XPVA 4BH9A 3B94A 4CCMA 1FT9A 1LENA 1W8UA 1H2LA 4UW6A 4FVVA 3MEPA 2D6MA 2ZZJA 4P9LA 1B09A 1R1A3 1RL3A 2D40A 3BB6A 4N43B 4PLMA 4V2WA 2B5HA 1FPN3 1WBFA 3K3NA 4FPEA 4LR4A 2RG4A 2ZX2A 4XOGA 5LY2A 1G9AA 2SBAA 1S2KA 3N9NA 5FFOC 3WNKA 4CDUB 3CLPA 1H6YA 3O1UA 1W99A 3FX3A 4JGZB 5I8YA 1A8DA 2Y0OA 3LE0A 4HANA 4Y1YA 2VC9A 3I2HA 4UYBA 3WF4A 2VTXJ 4ISQA 1RXFA 2RDQA 4LBMA 4COZA 5GLUA 1RUI1 4LLOA 1UMZA 5A3MA 2RM21 1IKPA 3IDEA 2WFF1 2FDGA 4NN0A 4CU7A 4QXBA 1GANA 1ACCA 2VMDA 3TOJA 4QDQA 2O14A 2JDMA 3NNFA 3L9JT 4MVTA 4CUCA 5IYYA 4XJZA 1ALYA 3C7FA 1LAJA 4TYSA 1N1TA 4YGCA 1K3IA 2BVBA 4AYUA 2PAEA 5FY9A 4GMP1 3AZXA 3DXTA 4LOSA 3GDBA 2YY1A 1LHWA 1O5UA 2WRAA 3WV6A 3ETQA 4BXFA 4K9SA 4YGBA 5A6XA 2HWD3 4GWMA 2FQPA 3MIHA 3KT7A 5T5OA 2JE8A 4K1ZA 4XCAA 4XHXA 5F5IA 5FPUA 1JODA 4AI1A 5DAPA 1JYNA 3SCGA 4NPMA 4XETA 1POV0 1D4M2 1GFF2 1HRV3 1W2NA 4OI1A 2DTWA 4XF4A 4PI2A 3K3OA 4I02A 1OI6A 1WD4A 3H50A 4KWLA 3B02A 2QQKA 4CEYC 2BGOA 2X09A 3AXDA 4E2SA 2Y6JA 5JSOA 4XW3A 3VN4A 5CEHA 5HV4A 4OVEA 1O4YA 1ZBE1 1L7QA 2O8OA 5JIAA 2A6YA 3IPVB 2XKOA 4AGVA 2JJ6A 2PMWB 1AYN3 1QXPA 1UOFA 3I59B 4FI9A 1AR91 2DVGA 4DXSA 3NKTA 1ZYBA 5FZOA 1BBT1 1YFXA 4GJZA 1W8FA 1EPZA 1Z7S3 2RDSA 5CVRA 5C3PA 2H6BA 4I01A 1D2SA 3LDKA 1S0EA 4QPIA 4RGAA 2WNOA 3OYWB 1XE7A 3CKHA 3ZFGB 2C9KA 4CUBA 3LEIA 1D2QA 2VZPA 5L7OB 2YZ4A 4CDXB 4WVMA 2UU8A 1RUF2 4IGPA 5FUPA 3M3IA 5F3CA 5I0DA 5F39A 2V5DA 4JGYC 2XLFA 1PMJX 4B29A 3UNPA 4WM8B 5LCWL 3QCWA 1G86A 2FCUA 5ISLA 2YXSA 2K2SA 4R9CA 3WNNA 4QQLA 3N7LA 2RS51 3S30A 5FZKA 4K3UA 3GZEA 1GKBA 1H8TB 1ENSA 4XTMA 3T1MA 5J7MA 3QLQA 5FREA 4P9XA 4LKSA 2D6KA 3DECA 1YRZA 2R071 2WWJA 3ELNA 4MGKE 4Q4Y1 1NOVA 2YUEA 4PBPA 5LB6A 5A1FA 1PK6A 1CN1A 1PMIA 2JDKA 4P9YA 2YFUA 3N35A 4EN6B 1A3KA 2XOMA 4MO3M 2BGPA 2UY9A 5IVCA 4QKNA 1UX7A 1R1A2 2PYTA 5FZLA 4FXGB 1BYHA 1VB4A 2YC4A 4A45A 2WZR1 2HEWF 1FPN2 1GICA 4DY5A 3O1TA 5IK8A 3AMNA 3WDYA 5FZGA 4DB5A 4Z2AA 4OMCA 2JE9A 1SMVA 2WSUA 1E5RA 4IV3C 1IKQA 4H7LA 1FXZA 2P37A 4N53C 4WV8A 5EYXA 2I45A 1MQTC 3Q8FA 4L0PA 2IXKA 4A6SA 1TME3 1KRIA 1UKRA 2DURA 3VBFC 3ZYRA 2FDFA 3GHNA 3K4AA 4AI0A 1CWPA 4OHWA 5FO8B 2WNVB 3FUQA 1SLLA 4QQ2A 4RGGA 1MACA 2QQUA 2GP3A 2VUCA 3FUOA 1S0JA 2W87A 5IUQA 1LNSA 3LD8A 1LHOA 2P1BA 3P5BA 1COV3 4UBGA 1G9CA 4JQRA 4HZFA 3TWIA 4FSJA 4KG0A 4A42A 1HDKA 3AJYA 3VBRC 2ORZA 4CA9A 2VCAA 1ASJ1 3OTFA 3CJXA 5LRRA 1C5IA 2PHLA 4MXWA 1RUJ3 2PHDA 3RS6A 3V0AB 4CCNA 4JGYA 2BRTA 2HYXA 4CCOA 2CGOA 1KITA 4LIVA 4QDSA 1VIWB 1Y9GA 1H6XA 1RUE3 1VMJA 4HN0A 4Z07A 4HOOA 1ULOA 5A7NA 5A1LA 1OA2A 3NV4A 3DXUA 1RMU1 5FZ0A 3MFCA 2HWD2 4OUSA 2QVSB 5FTTC 4P9IA 4X6QB 5BY5A 1YQCA 1AR73 5G05L 5K9YA 1RUD1 3WCRA 5HI0A 3LZZA 2BTVC 2LUWA 4GD4A 4PF1A 4JVAA 4CU9A 2B42B 1HRV2 1RB8G 4YVWB 1MS3A 3NL1A 3ZKUA 3OGJA 1B35B 1FMD3 3FJSA 4GKYA 4Y1XA 2JDYA 5DG2A 1RINA 2VZUA 2Q1MA 3BYWA 2YB7A 3LB9A 3GCXA 5FLHA 4ISRA 5DMYA 4JHTA 1GQGA 2XWBB 3SEPA 5FQ0A 3GBWA 3FWEA 1LOGA 4C1WA 2VUJA 5BXXA 4QM9A 3B93A 1AYN2 5KHHA 3K46A 4N53A 4QX1A 4OI2A 1MQTA 2Y6LA 5DDJ3 4C0HA 5FIXA 5ACA1 1Z7S2 5FZDA 3VBFA 2VOVA 3ZXJA 1K12A 5KXDA 2F6BA 4FT8A 3TEWA 3ZVXA 5C4WB 4JZRA 4SBVA 3VBUB 1W6NA 3UYJA 1UMIA 2VZOA 4FPFA 5FXXA 3AM2A 3IMNA 4WZFA 2XVGA 3BU0A 3UT0A 4SLIA 3QBQA 5FZHA 3U1XA 3VBRA 4B8EA 4CRQA 1OA4A 5A7QA 4GWIA 3WF3A 3ZYHA 4CE8A 3ZYPA 2FZ2A 5JIUA 2Z4FA 5J48A 3NJVA 5FO7B 4LEJA 4AVAA 5C9AA 3N36A 4EWEA 5JMOA 2XQRA 2W91A 5D1IA 2WZPP 4CXWA 1VALA 3ETPA 1NZCA 2BNNA 5A6YA 1LESA 3SXWA 4OMDA 4AQ2A 5A80A 1HN1A 2ZHMA 3IKWA 1SPPA 4FFFA 1DYKA 4V1PA 3SH5A 4XBLA 4DFSA 1F5FA 1JU4A 1O4TA 1RUH3 2CNAA 2YC0A 1GP4A 2ZX1A 4LUMA 4RR3C 1X8EA 5FYIA 1JYXA 2Y8KA 4IE0A 4DS0A 5B2GB 4N90A 1R64A 3IWZA 4YZ5A 1YYNA 4ZU5A 5D8AB 1QQP1 4Q4W1 5CFCC 3VBHB 2G1MA 4ET7A 5F5QA 1TME2 1SLCA 4S2HA 3HBKA 3U10A 4AFAA 2HEVF 4LORA 5K0UC 3VDDC 4EZ4A 5I0UA 1W9FA 4XAEA 3WXPA 5AC91 4E4ZA 5ABJC 5LEKA 4QGMA 4I30A 4JX0A 1COV2 2XKPA 2C9AA 1V6LA 5FZ3A 1JHNA 1FV3A 2HWF1 3FE5A 1W03A 3LDBA 4HK9A 5I8SA 3H8OA 4QB6A 4CDQC 1RUJ2 1N3PA 2VQ0A 3VZOA 3PNAA 2YBSA 5T50A 4NMIA 3T09A 4FFIA 3KB5A 4FOYA 3TBDA 3ITQA 1RUE2 1UY0A 3ENRA 5JWPA 3TNQA 1XQNA 2RM23 1GBGA 4PIXA 4RYDA 1UL9A 4UT5A 3I2GA 4XDPA 5FZMA 5M0TA 2WWUA 2RDNA 1ENQA 2CWSA 2WFF3 2R063 2OA2A 2GZWA 2W2IA 1NLSA 1AR72 2J1TA 3NMBA 5EYYA 1U5IA 4INDA 1NLQA 3SKVA 1CAWB 3MUY1 5HXVA 3UL2A 4D7SA 4DNYA 1MS4A 1WA6X 1GZ9A 2FBEA 5GJ6A 2C24A 4BA6A 5LW9A 1FMD2 4GMP3 4WZCA 3I4IA 1I5PA 1ULEA 1ODMA 3VD3A 2JIJA 3WNLA 4EZHA 4AG4A 5LA0A 4BIOA 4CP1A 4RR3A 5APAA 1W0NA 3ZFFC 1R091 1N3OA 5FZ7A 2VOXA 4NE9A 2A3WA 1QMJA 4Q1RA 4RS5B 3VHNA 1PX4A 1ZRRA 3JZVA 4K20A 3MW4A 4L9BA 3O0XA 4YM1A 2A75A 3UK9A 4KWUA 2EALA 5F2SA 5CKNA 2YC2A 4NHKA 1LECA 5DDJ2 4MGZE 1LOEA 2GAUA 1SDWA 2YFZA 4MHRA 4M4RA 5I91A 4K1YA 4Q26A 1DLCA 5E89A 1JZ6A 1J3PA 2HKXA 1C5HA 4QB2A 1T6BX 4YW2A 2BFUS 3LKJA 5ABJA 5JOXA 4XBQA 1ZBE3 1PHMA 1DGRN 1XNTA 1MVEA 2BNOA 3IAQA 4WVWA 3RYKA 2JG9B 4ZXKA 2TNFA 3WDWA 1HQNA 4K40A 3WUCA 1AXZA 3WW3A 5BNNC 1AR93 1UPSA 1RHI1 3M3QA 2ADEA 4N9IA 2LALA 3N9LA 2IXLA 2JDAA 5I93A 4CDQA 2ATFA 5IWFA 4YM3A 2PQSA 5FZIA 3ZR6A 1W6QB 2JDPA 2JG8A 1KFXL 1CVNA 2DVBA 3HMYA 4JV4A 4CTEA 3ORJA 1KJLA 3H7JA 4P14A 3W59A 3VD4A 2PHWA 1GZWA 1WCDJ 1UYZA 4Y33A 2JDHA 2P6CA 4JKLA 3AYDA 1JZ7A 1HV0A 1GQHA 2HWB3 3RJRA 2C4XA 5FBJA 3MPBA 1PNGA 2OUJA 2XXZA 1J59A 1Z0HA 2VU9A 1DF0A 3PU8A 4Y3OA 3W5NA 1S0FA 5KBFA 1LHNA 3D6EA 2C5DA 3THTA 4AEDB 2AEYA 2PN5A 2C1FA 1RUH2 3OY8A 2BQPA 4M3CA 4P08A 4YWAA 4FTEA 5A1AA 1YFWA 4XYXA 1CD3G 2R041 4K6BA 1E5HA 4CEWB 1BVP1 2IWGB 2QQNA 4Q4Y3 2R073 4R9BA 4R9DA 5DUUA 3ZO0B 4BWOA 3JBG1 1YIPA 1DZQA 1OOPA 1POV3 1NLRA 4Y26A 3IIAA 1IHMA 4UW5A 4YGEA 2WZEA 5DAVA 5FY8A 2VBPA 2X05A 4FAGA 5C6CA 4QGLA 3WHTA 1AR63 4J1XA 4CSWA 2V4VA 5FO9B 1J84A 2WNUB 1UNBA 2RR11 4DO0A 1Y3TA 1QDCA 2ZGPA 1JZ2A 1PIV1 2AUYA 1QNYA 2E7TA 3D5OA 5FUIA 3CO2A 1W28A 3ACGA 3I3MA 1O7FA 5EFUA 2GNTA 1UN1A 2AR6A 4RGKA 1LULA 5DAQA 1A34A 2W9XA 3RG0A 3J9SA 1JOBA 4BPZA 4AR2A 1C3HA 5BNNA 1H0BA 2VBBA 1PVXA 5FY5A 5IFTA 3PU3A 3TAYA 4AVTA 1NE4A 4AFMA 1ZVFA 1IPJA 1H30A 2RM22 3NO8A 5FWJA 1QJY1 2B8MA 2QZ3A 1NA1B 3Q8BA 4URAA 1OPOA 3WDXA 3O1MA 2WFF2 3AP5A 1UIJA 2R062 3ATGA 4IQPA 3T30A 3WEZA 4XQDA 4BQ3A 5KWRA 1ZZ6A 1NCRB 3QD6A 1W0OA 4ARYA 1WW6A 1X50A 2ZAAA 3ZIWA 5GZCA 1GOHA 3BPZA 3J7LA 4J6GA 3G6JB 5A6QA 4L92A 4W6WA 4Q0UA 4EN9B 1UO9A 5EV7A 2WO2A 4CDWA 2ADDA 1WMEA 4JC1A 5T5PA 1CAUA 3AYEA 4Q4X1 1LOCA 4AF9A 4KH9A 5A3PA 1XXNA 1RMU3 4Q27A 4CP9B 3AZYA 1Q8VA 1X82A 5GLWA 2DU0A 1VLNA 2GC1A 1AX0A 3AMMA 2VZQA 4UXAA 1MVQA 1RUD3 5K4LA 1WD3A 2D97A 4QPGA 1YFUA 2DWRA 4AHYA 1IGOA 5F7UA 3LCPA 3DCQA 5DXDA 2A6ZA 3KV4A 2VM9A 4IV1B 4WBBA 2NMOA 3AL6A 3TEZA 2WS93 4ASLA 1QXRA 3IT8A 4XXAA 1W8NA 3WOGA 4QT6A 1VAVA 1IZ3A 1Q8QA 3TYJA 2CGPA 4HXCA 1X33A 2ZX3A 4GB31 4QXCA 5H9RA 1KFUL 3E6BA 5J98B 5CU1A 2VVDA 4LBJA 1JI6A 1S0BA 2Q30A 2LM3A 1W9SA 3KT1A 2A6XA 4YFWA 4AI9A 1AR92 1DGLA 1UU5A 2X29A 1WMFA 4YW1A 2EICA 1Q5OA 4DUVA 2JDZA 2P6HA 3OPZA 5FPZA 5F9TA 1U12A 2GNDA 4XJWA 4AHZA 4HVOA 4QMAA 4UF0B 3OJBA 2D98A 4XCBA 2OX0A 4XDQA 1JS9A 2DCYA 5FCCA 3WLUA 4Y22A 2BFUL 4HPKA 2WWSA 4HK8A 5GZFA 1BLZA 4C0BA 1XOYA 1W2OA 2E7QA 4ATFA 1UKGA 2HWB2 1JBCA 1XPWA 1EPWA 2MPFA 3Q8CA 2BDRA 3WHUA 1QH6A 3D8CA 1RJ8A 3KVBA 1W04A 4NIAA 4NR1A 4XMIA 4QKDA 5DUVA 4BK5A 4C1XA 3LEGA 3T0AA 4BE3A 1WW4A 2A1XA 4B4QA 4CXXA 2HWC1 3LQCA 2D7FA 3MF6A 2W0XA 1EAH1 5FP9A 4LE4A 1NY72 2R072 3CNAA 4Q4Y2 1LOBA 4YYOA 3ZFEB 5CA6A 3W58A 5J96B 5JR2A 1I5ZA 5GZEA 3AKRA 4L2NA 2VECA 4CU6A 1XJAA 1EUTA 2XUMA 5KHGA 1AR62 4LHLA 2TEPA 3R0RA 1VBA1 3FBMA 3WT3A 3HQXA 4RSUA 4PHZA 3V65A 3N9MA 1DGWA 3FN9A 5LK7B 1F2NA 4L97A 4TLGA 3PL0A 5B4XA 3SLIA 3SC7X 2XH6A 1XRUA 1WCUA 3EHKA 1REEA 1H2MA 5LY1A 2VZ3A 1GYKA 1QQP3 1U5ZA 4LLFA 5FY7A 1C4RA 2P2KA 4G9SB 4OI4A 5A32B 3MBWA 3HVDA 5JR7B 1KEXA 5KXCA 5C3RA 2CY6A 4E4DX 2H6CA 2VE1A 3C2UA 5KXEA 2DCKA 3MF9A 4AFDA 5F5AA 4JKKA 1LOFC 4Y1VA 4AEKA 3BU7A 2VNVA 3GXUA 2K46A 1PO21 2C26A 3N3HA 2NZ9A 1UU4A 2HWF3 3Q8EA 5FZAA 3GYDA 2O0OA 4BK4A 3EJKA 1EUUA 2D3SA 4MX3A 3S6PA 2YBKA 1H4GA 5JZGA 3KQRA 3RMYA 5FYVA 2EIGA 1C57A 4UI9L 3HQRA 2P3YA 4YW6A 5CZKA 3CHXA 3SQOA 2K0GA 2GDFA 2RDRA 2IUWA 1MEC1 3BOPA 4B4RA 5DUWA 3RDIA 4AXOA 4AI8A 4ZZ5A 3LEMA 3A4UA 1CAXB 3HNBM 2VZTA 1L7LA 5AFEA 4Q1PA 5A7PA 1F9KA 2CDOA 3NNGA 2PLV1 4YLZA 1JTZX 4L8QA 4QB1A 1RMU2 3VKLA 1CPMA 1GR3A 2I74A 1WGPA 4Y24A 3J4UH 3M3CA 4PDWA 2E9QA 2KA3A 4UFKA 1RUD2 3ZR5A 4CYDA 3T2QA 2J1RA 3WP4A 5FR3A 2IXIA 5J36A 3MIDA 3QH7A 1QJU1 1DQ0A 2WS92 4ZHNA 2GMPA 2FDJA 1YJKA 4PJYA 3RFRA 2F17A 1W39A 1SCRA 2PXJA 1HIXA 3ACIA 5BNPB 1ZRDA 1JUIA 3LIGA 4FP2A 3OG2A 2FCTA 4GMP0 5BYNA 1R093 4NWVA 5JXGA 5L9BA 3IN9A 1JYWA 1US3A 2ZGLA 4XFBA 4D69A 3R4SA 3U4SA 5A3LA 5IVJA 4XJ9A 1TMF3 5L73A 5IFPA 3N7KA 4Q0VA 1YQ6A 4QGNA
chains in the Genus database with same CATH topology
2W68A 2E6VA 3D0JA 3NKGA 3V56A 4LBKA 1TNFA 1ULGA 4Z2WA 4LBQD 2VVFA 4IV3B 1H2KA 4L11A 3ZN6A 4NHLA 1LOFA 4GQ7A 5EZWA 1DLLA 4HETA 4OHXA 2OZ6A 2A71A 2Z69A 4HSLA 3ROUA 2ZS6B 1OLRA 2PAMA 2XHKA 1RHI3 1VBB1 5J09A 3MIEA 4QPIC 2WLQA 1G8WA 1IOAA 1OD5A 2Y26A 3ACLA 4AVVA 2F4PA 1JXNA 3VBRB 1IPKA 1IS6A 4GXLA 4FO9A 2W39A 2MEV1 2R49A 2ZGTA 3AP9A 3GNEA 1MZ6A 2WA4A 4XJUA 2GH8A 5T55A 4Y1UA 2KM2A 2WA3A 2OYZA 2ES3A 2P34A 1AL0G 3JQXA 1TQ5A 1U5YA 5KHKA 4XE9A 4BMBA 2EF6A 2Y0IA 3CL1A 3H1YA 2RE9A 4XFGA 2AENA 1PK6C 3JB8A 4ZU7A 1X36A 1AHSA 2DFBA 1UF2C 3E6DA 1V9U1 2HYKA 3JBG3 4OZXA 2B7YA 4QQHA 4HVRA 2G4IA 2EXJA 1J1LA 2ZKNA 1XNCA 1WLDA 2RR13 4AGRA 1QXJA 2NMNA 2VOKA 2VULA 5AVAA 1O3QA 1AXYA 1RUG1 4E4SA 1KXGA 2PHTA 1Q43A 2HWF2 4NVPA 4YW4A 1BJQA 2JICA 5CIRA 5JVVA 1ND2B 2ZHLA 3UKNA 1XNBA 4D3WA 4IETA 3AX4A 2Z5WA 3WINE 1W6MB 2DCZA 4HMZA 3J8F1 4Z82A 1AJOA 2XWJB 3A0NA 3JB4C 3JD71 3TB0A 1AL21 4Y20A 1U0AA 1QJY3 1I3HA 3E97A 2JENA 2V5YA 3PVOA 3USUB 5A33B 1OPMA 4XQWA 1OFSA 1PVC1 2R30A 1ONAA 3P3PA 3AYCA 4MYEA 4XFHA 1DQ6A 2ZGQA 4IL7A 1VBD3 1VBE3 4BCUA 2VGDA 1BKZA 1ZNPA 4O9GA 1H8VA 2CGNA 3ZPYA 4Q4X3 3U07A 1PGW1 1H2NA 4OUMA 3AMPA 3H9AA 1DFQA 1R092 1RGSA 4OHVA 1QJX1 5FOJB 3CEWA 3U11A 1TMF2 4X8PA 4C90A 1YUDA 2X5IC 4RA0A 2D6PA 4PBOA 4RR3B 3WG3A 1VAMA 2VVEA 2E63A 2IXHA 1O3SA 2BEOA 1V6MA 1FNYA 1WA4A 3AZWA 1R1ZA 4CP0A 1C28A 2GNBA 3G7DA 4GB33 5CFCB 2UWAA 3B69A 1RJ7A 2QUOA 1Q8OA 4HLTA 5I0SA 1SLIA 4I0BA 4LE3A 5K0UB 3VDDB 5JOWA 4RHV1 3N7JA 2GNMA 4KG8A 5DUXA 1UPIA 3PJQA 5EWSA 1RHI2 4A2UA 3BIWE 2D5FA 3VBSA 2GALA 1V70A 4RQPB 2WT2A 4R9AA 1NCQA 4OFGA 5CADA 4AFCA 1LGNA 3I54A 4C91A 4FPLA 1BXHA 2XB6C 4YW3A 2ZMNA 3J26N 4LBQB 4KU7A 4Q0PA 2UURA 3OD0A 4CDUC 4YVSB 1CPNA 4HN1A 4WM7A 5C9AC 3RJ2X 3MIGA 3S0MA 1ZX5A 2VNOA 4HBNA 1MS1A 2HWC3 3PHMA 1JOJA 1BEV1 4XF0A 1XU2A 5KHIA 4H55A 4TWTA 3JBG2 2Q8OA 1GSLA 3P3NA 3NAPA 1ULDA 2PTMA 3USSA 2BPA2 1RIRA 1KDMA 2ZAHA 2RR12 2X5IA 1LGBA 4IEVA 4B4PA 1YLLA 3ZFFB 4LTAA 1SLTA 2JECA 3R4UA 1ND3B 1AYM1 4S2GA 4Q4V1 1L3JA 1REFA 1G6NA 3EO6A 1HQLA 4DY3A 4KWKA 1SBDA 3PTYA 3VHOA 3UJQA 3OBTA 3AK0A 1QJY2 4NOTA 2QKDA 1PO23 2RS33 1WLCA 4PF5A 2EAKA 2E53A 3NJZA 3WQ0A 3AKSA 2YROA 4IXLA 4LBOA 1F5JA 1OQ1A 4QU2A 2NM1A 4R4ZA 4N43A 3H8UA 3OGGA 1HXS3 2RS11 1MEC3 3ILFA 1VBD2 1VBE2 2FZ1A 4IEYA 4KU8A 2VMGA 1T6GC 4CDUA 4CEYA 2CAVA 4RL7A 4JGZA 4XMAA 4Q4X2 2PLV3 4B7EA 1GZCA 3WZ1A 4IERA 2DUQA 3AZZA 2GMMA 3WG1A 3RWNA 5L19A 3B3QE 3FMGA 4HKWA 3ZFGC 5L7OC 1WCKA 4CDXC 3E5XA 3EBRA 3POSA 5GLVA 2BWCA 1QJU3 2Q0AA 1H1IA 3BTAA 1V6JA 4AHWA 4I3GA 3VZNA 4XFCA 1TE1B 1X7NA 5E16A 4GB32 1VB2A 4IESA 1KS4A 1H9WA 3VZLA 2IFWA 4FOWA 4JDNA 5JSRA 1H8TC 2D6OX 1YJLA 3KD4A 4XF1A 5JSPA 5BNOB 1DYPA 1HLCA 1WUVA 1WLTA 2VW0A 5CG9A 2XBO1 3PVEA 2ZPXA 3K51A 4PCRA 2ENRA 4WVZA 4QQOA 2ZOEB 4AVBA 4LO8A 2XJTA 3ALQA 3ZSEA 4H3WA 1JYIA 3M4FA 4XF9A 1H1AA 1W6OB 2PA7A 4I3PA 5GKAC 3E6CC 3IM0A 5H9PA 1HV1A 3V0BB 5CFDC 2JG8C 4GALA 1MS9A 1EYBA 1Q8PA 1RUI3 2XL9A 5HCBA 1Z78A 1MZFA 1V6NA 1W6PB 1QU0A 2MNGA 3IPVA 2HWC2 2G9FA 3ZXDA 2A5ZA 3CJIB 1E57A 1A8MA 3I59A 1AJKA 4XTPA 2MEV3 3FLTA 2R1DA 1YNAA 2ZJCA 3AB0A 3DF0A 4HKLA 1BVVA 2ET7A 4UW3A 2DCJA 2R0FA 2QNKA 2NPIA 1VR3A 2RHPA 3ZFGA 4O9EA 4HL0A 3RRDA 5L7OA 1YHFA 1GNZA 4CDXA 1NG0A 3M1HA 4KQ7A 4M01A 2BNMA 1YCIA 2I2SA 3PVNA 1ZA4A 5JI7A 3NV2A 3UJOA 1OOPC 1OA3A 1FAYA 4WM8A 1UAIA 1CONA 1PGL1 4LO5B 2XPJA 4QM8A 1SBFA 2DVFA 2A6WA 4GH4B 3MGUA 5I0RA 5TSWA 1BMV1 2AYHA 1H8TA 1REDA 1Y7BA 2HJIA 2ZHNA 1AR81 2VPVA 4M0HA 2KXLA 3AMHA 4EN0A 2C0ZA 4FPCA 4XQ4A 1DZRA 1RUG3 1ULFA 4FAHA 3KZ4C 1PO22 2V09A 2RS32 3WW4A 3AYAA 4IEUA 1CR7A 3O0VA 4EJRA 1B35C 2VG9A 1CAVB 4FPGA 3VBOB 4DRRA 1APNA 4N9HA 1HXS2 5F6KA 2ZGUA 3M2MA 2ZCWA 1MEC2 2R0HA 4YZ1A 1BBT3 4AVCA 3J8F3 1G9FA 2XVKA 4FPOB 2JXAA 5CFDA 3CF6E 3DPRB 3HR9A 5JMCA 1OFNA 2PLV2 3LA7A 4P5HA 1QHDA 1DQ4A 4IEXA 2RJKA 4AVSA 1RUOA 2WNVA 1PVC3 2OVUA 2VH9A 3K48A 4CDWC 5T3NA 4JAAA 2E7AA 3O5SA 1K5MB 3FFQA 3VBUC 3KGZA 1QJU2 1XYNA 4LULA 2ZGKA 1BQPA 2RS53 1ZRCA 2IXCA 4COUA 2EXIA 1HRI1 1WW5A 1RUNA 4TSVA 5HCFA 4QPGC 1WW7A 4U2AA 5C33A 3V0AA 5F1RA 4Q2FA 4XZPA 4MSVA 2BUKA 2E51A 3QH6A 4LBNA 2OIIA 4EN7B 3SHRA 2RMU1 2ZZQA 2NYYA 2WZR3 5L36A 3MICA 1SFYA 2H0BA 4GIQA 1LU1A 3NV3A 4JTOA 3APBA 3BALA 1XNKA 2UWCA 4YVWA 3WUDA 4RHV3 3VZKA 5FBZA 1B35A 4DQAA 4AEMA 3ZN6B 5D8AC 4Q8KA 1RUI2 3VBHC 4HSJA 3ES1A 4LA2A 2GC3A 1HRV1 1DGWX 4BLIA 2XLAA 2R16A 1MZ5A 2VOWA 2XG3A 4D94A 2MEV2 4M0NA 4TZDA 1ASJ3 3EQEA 1DQ2A 2Z2SB 4I0AA 4F8AA 1M06G 1WLWA 3GBFA 3POYA 3NWKA 1RUC1 1QOTA 2QDRA 3VBUA 5E88A 1EY2A 3AFKA 3WD5A 3WP3A 3LWCA 3O14A 4FPYA 4BHPA 1BEV3 5FLJA 3RSJA 3KGLA 2RJLA 4YW5A 1SCSA 4AHXA 1FNZA 1PGSA 2AH2A 2ZMKA 1FV2A 4FQ4A 5H9QA 1D0GA 4PLOA 3H7YA 4ONUA 5E8AA 3H1MA 1S2BA 2QE3A 1RUG2 4YG0A 1SLBA 1ZZCA 3VL8A 4MUVA 3WY6A 5EXOA 2XLGA 1AYM3 1ZBE2 1R081 4Y4YA 4QD2A 2VNRA 4B7KA 4YARA 2EXKA 3B7MA 4NO4A 5FPXA 4TLFA 4XIKA 1BBT2 4JRLA 2Q1ZB 4XBNA 3J8F2 5ACA3 4HVQA 4RS5C 4FBFA 4GWNA 5D8AA 4YSFA 3VBHA 5JZGC 1O3TA 5CB7A 2A70A 1HQWA 3MLJA 3DN7A 1LHUA 4H7MA 4M3CF 1PVC2 3ZN5A 1QNWA 4QPIB 1TME1 5JLVA 4CZSA 2RS13 4WVMB 2JG9C 2RS52 1G9BA 3NW4A 2PHFA 4PDWC 1PGW2 4AK3A 4Y5Z0 3N4MA 4AE2A 4DOUA 1H1MA 2ZACA 4AGGA 1ZRFA 1BZWA 3OD4A 2EAAA 3B00A 3RZZA 1OQDA 1PK6B 2WZR2 2DVDA 3LGRA 5F6LB 3S7EA 3AFGA 1CAWA 3KS7A 4Q4W3 1JW6A 3PJYA 3GF6A 1PZ9A 1JYCA 4RHV2 5BNQA 3QACA 5DZGA 3VHRA 5BV6A 5JOZA 2ZGRA 3JUUA 4CEYB 3THPA 2XBO3 4XF3A 5AC93 3TRSB 5DG1A 2ZABA 3MW2A 3VUOA 4FPJA 4RS5A 2WNUC 1V00A 4YM0A 1OMIA 1AZDA 2FHRA 1ASJ2 1QDOA 3H3UA 3S7IA 2AREA 3LA2A 1UIKA 4XEZA 3H3ZA 3ZYIB 4D7YA 2WJSA 1Q8SA 5DDJ1 3RQ0A 1TNRA 4FTSA 2O8QA 2UWBA 1C1LA 5HCAA 3ZMOA 4MXWB 2CL2A 2JG9A 4CP2A 1BEV2 3ECQA 3IDBB 3AKPA 3M70A 4JGYB 2DUOA 4AWDA 2XJRA 2A73B 3SISA 1NYWA 1OQEA 2IXJA 4KL1A 3SMHA 1NA1C 1W6QA 2XJPA 4FOQA 1I6XA 1NCRC 4LUKA 2GU9A 3HD8B 2FMDA 4LHNA 5GLZA 4YG6A 1AYM2 1NXMA 3WCSA 3D0SA 2YGLA 4LO4B 5GZDA 1CESA 1UZYA 4W6YA 1AR83 2D3RA 5ACA2 5FQ0B 1G7YA 2GH2A 4FCAA 4CEWA 5J3UA 3ILRA 4Q0SA 4COVA 1IQAA 4K21A 1VRH1 2DCTA 4F83A 2W52A 4N53B 3ZXLA 3GHMA 4IV1C 3VLBB 5FRAA 2ET1A 4BIFA 1MQTB 4GA9A 5JPMB 4COWA 3VBFB 2WNUA 1SBEA 1MS8A 4PIZA 1PNFA 3HWJA 2K9ZA 2RS12 2NN8A 2YDEA 2Z79A 3PMSA 4AQSA 1W6NB 1J3RA 2D6NA 3M7AA 4RFT0 1EP0A 1M4WA 3RYRA 2VY0A 3POWA 1QOSA 4H14A 2WL1A 3VKOA 4XJAA 3KT4A 4BZ4A 5CBLA 4XIOA 5C9AB 3RPQA 3WQ7A 2VMIA 1LU2A 3KLSA 3MIBA 1QKQA 1QH7A 1NA1A 3RYPA 1OHFA 1NCRA 1HRI3 2DV9A 3VKFC 2R043 3OCPA 4B3NA 4K8FA 1HX6A 3VHPA 5JI9A 2UY8A 1OLQA 2YHJA 1QQP2 4Q4W2 2R061 4DINB 4MZUA 1XE8A 1Y43B 4META 2GC0A 3ZFEC 5T54A 1J58A 4ZU4A 4A3XA 2XGXA 3SITA 3SCHA 2XBO2 4PLNA 5AC92 2RMU3 1PO11 4LHKA 1ZM1A 2ZKLA 4URTA 1PIV3 4RD7A 3WR0A 3FLRA 1W2UA 1LHVA 2B39A 1RC6A 4JTNA 2W08A 1F8VA 1ENXA 4IV1A 3VBSC 1PZ8A 3ZXEA 1WBLA 1J1TA 2JE7A 1NCQC 4R4XA 2ZGSA 3QOPA 5LRSA 1FOD1 2P3KA 2FMYA 1N47A 2WIIB 2YGMA 5T5LA 3MFAA 4LA3A 3O7OA 3AKTA 3URFA 3LA3A 4L99A 1BK1A 3KCXA 4GULA 4BOWA 2H0VA 4WM7C 1ZZ8A 5DZFA 4UBHA 1TEIA 4AQTA 1V6IA 2A3XA 5SV5A 3WX5A 3FZ3A 4YZ3A 1RUC3 4S2DA 1KD7A 4MV2A 3ZYJB 2VW2A 4N7UA 2O1QA 1RVF1 1X8MA 1LJ7A 1N1YA 1C8NA 3NAPC 1PGL2 3MDPA 3HN1A 3GZTB 2GSYA 3TN91 1EV11 3KCYA 4FQZA 3TNPB 1BMV2 2HWB1 4OI0A 1AR82 5KC6A 1S0GA 1MR5A 4KWJA 3VKNA 3ZFEA 3ASIA 1CGPA 1CQ9A 4X6RB 4YRDA 3LOBA 3FLPA 2DTYA 2PHUA 2DF7A 3GALA 4BM8A 2B9UA 2ZMLA 5C8CC 1OKQA 1R083 4Z92B 1NY71 2ZX0A 5BNPC 4OULA 1POV1 1UD1A 5IK4A 1XNDA 5ABJB 3PMEA 1AR61 4ITCA 4XILA 4M00A 4COYA 4BQ1A 4N43C 5A32A 1ZREA 4IEZA 4CDQB 2DU1A 3LSEA 4N7IA 5CFDB 2JG8B 1GNHA 3AZVA 3WNXA 5BUVA 3BODA 2HWE1 2YV8A 1GZWB 4JGZC 1QGLA 2WNEA 4D7TA 1QOOA 3SNMA 4FOVA 1AUYA 1LTEA 1DIWA 3OF1A 3SCFA 3B01A 3T1LA 1HRI2 2D5HA 4Q8LA 3WG4A 3ZSJA 2R042 4FPKA 2ZA9A 4QXKA 1EAH3 1ULCA 3JCIA 4M3CE 2HEYF 2GN3A 3OY8B 4M3CB 2R6QA 2MHFA 1CAXA 5FMOS 4DMIA 1YFYA 1KDKA 1WCSA 1LGCA 1VBA3 2WFPA 3I8TA 4E9KA 4HKOA 3ZYGA 2RMU2 3L2HA 4EWAA 1OOPB 5EJ3A 1NQDA 1PIV2 5HBAA 1VBC1 3O0WA 2XJVA 4MLOA 1V6OA 3X29B 3WDVA 2GC2A 4PIYA 3WW1A 5C8CA 1AX2A 4LO7A 2B45X 2B46X 4WVVA 1HKDA 1AVBA 4X8NA 3MZHA 3DL3A 4IEQA 3W9AA 5BNPA 1SEFA 1U5XA 4ATEA 1I1EA 2WS91 2ZGNA 3H0OA 1Q3EA 3KCCA 1C8M1 5BNNB 1LODA 4EROA 1ZBA1 4XFFA 4UW4A 2D44A 3HIFA 5H9SA 3L2YA 1S55A 3MIFA 1S0DA 4IV3A 3M3OA 4A7KA 4A7YA 1ND2C 1RUC2 2VUAA 1XU1A 3MPPG 4I2OA 3ZDSA 3D82A 1J3QA 4OHZA 3ZXKA 4CDWB 3KSCA 3VKMA 4E2QA 5T5JA 1CAUB 1YI7A 2Q4SA 3JU9A 1DZTA 1D4VB 3IBMA 4IEOA 2A6VA 4OLLA 4AFBA 1RTVA 4F3JA 1S0IA 2X53S 4WM8C 3ST7A 4AI2A 4EV0A 4QPGB 3RMXA 4YFZA 2GMEA 3B9IA 3LAGA 1R082 1OSGA 1CX4A 1SQ4A 4YZ2A 2PELA 3UKVA 1LR5A 3AP7A 2IFRA 2GN7A 2OZJA 2Z42A 4P9JA 2P3JA 1VRH3 2Y38A 4EWDA 1SLAA 3FBYA 1AXKA 5LK5A 1VJ2A 2JX9A 4QQPA 1MS0A 5IT6A 3NVCA 1PZ7A 4KBBA 2ERFA 1UU6A 4MXVA 1QY4A 3FHIB 1LRHA 4PQ9A 1O4ZA 3HT2A 4JDMA 1VBB3 4Y22B 2D6LX 4HPKB 1URXA 4GKXA 4K7JA 5FOBB 2AZ5A 1D4M1 4G3YC 2JKBA 3ZSLA 2CYFA 4XFAA 1ND2A 1A6CA 1EAH2 3ZIXA 2WNVC 3AP4A 4RQPC 1LB2A 1W6MA 3B5LB 3EXUA 1W0PA 3VZMA 2PHXA 2ZGOA 2D3PA 1VBA2 2ZHKA 3OYWA 4XXPA 1Y9QA 1FYUA 5A33A 1JUHA 3USUA 4P9WA 3UKTA 2ARBA 4R52A 2VXRA 1QF3A 4YVSC 4KNCA 4LO6B 2WT1A 3U4XA 3VGIA 1DG6A 3N7MA 1FATA 1KQRA 5BPXA 3BOWA 1V9U3 2CV6A 5SV8A 4HFSA 1RUF1 3C3VA 5FMOL 1CJDA 1JH5A 2VQAA 4AEJA 1BCXA 3ZXGA 5I0TA 1PO13 3AMQA 4FPHA 4JCKA 3E5UA 2WT0A 1NQJA 3FC0A 4YVWC 2G9GA 4BYYA 1S1AA 2A7AA 5KC5A 5FAXA 5GALA 3MYXA 2OW4A 3HT1A 4A7ZA 2QQPA 3O12A 4I09A 1ND3C 2PFWA 5JAXA 3M8LA 4YGDA 2IZWA 1TMF1 1ENRA 3MLKA 4Y1ZA 2XJSA 4EN8B 3ZX7A 1FOD3 5CFCA 5JZGB 1AF9A 2WQ4A 4FP3A 2ZGMA 1DHKB 3AJZA 3JD73 3R6SA 1AL23 1R1A1 1VAKA 2ARXA 2QFEA 5K0UA 3VDDA 3DKWA 4OHYA 2BYVE 1FPN1 1N1SA 2PHRA 5C8WA 4ES9A 5I8TA 2TBVA 4HT1T 1WMDA 1AX1A 2AGSA 2QZ2A 2JEMA 5C4WC 4RQPA 3RI9A 2D93A 4LBLA 1XYPA 1YIFA 1F31A 4E27A 3OBRA 4PDWB 2WINB 3VV1A 1N1VA 1NXD1 5GLTA 3HBZA 1RVF3 4LBQA 3B9CA 2WLPA 3DUIA 4YVSA 1LEDA 2NQYA 1QJX3 3UV9A 3TN93 1EV13 2XJUA 3M3EA 1YO8A 4QHBA 1Q56A 4R8HA 4F7ZA 1LOAA 3H1WA 1IS5A 3ZSMA 3GZUC 4G4FA 3ILNA 1VRH2 1I9RA 4XHBA 1GLHA 1HW5A 5FLIA 5T52A 2PQQA 4I0WB 3ZN4A 3ZMNA 4Q0QA 2Q5TA 1KS5A 5GZGA 2HWD1 3AP6A 3RNSA 2DFCA 1S0CA 2D43A 1C1FA 1VBB2 4JRAA 3T2TA 3ZFFA 1D0HA 4U36A 1ND3A 3WG2A 1MZEA 3SH4A 3LSDA 2A3YA 4P9GA 5BNOC 3WP5A 1DGRA 2WC2A 2YYOA 4XFIA 2WQZC 2CWMA 5JCTA 3RI8A 1A78A 2OPKA 4W6XA 5JDBA 2ZX4A 1KJRA 2HWE3 3R05A 4NPRA 4KGGA 1AYN1 1YWKA 1RITA 3WVJA 2XL7A 5C4WA 2WKKA 3DGTA 1NE6A 2PAKA 5JOYA 2VW1A 1Z7S1 2VNGA 4ES8A 5JPNB 1DQ1A 1V9U2 1YI9A 5K7PA 2BBVA 3CJIC 1IS3A 2BWAA 5AVPA 1DU3D 2YPJA 1PO12 2CTVA 2NP0A 1VBD1 1VBE1 1UZZA 1VBC3 2YMZA 3AKQA 3I7DA 2QDNA 4ZKTB 1IS4A 2XJQA 2DYCA 4Q4V3 1V6KA 5GM0A 2ILMA 2ZBJA 2EA7A 3I2DA 2CAUA 1UX6A 2QCSB 5AFBA 1O5LA 1FOD2 3KM5A 4GH4C 3JD72 1AL22 1UW8A 3D4KA 2BGCA 4J1WA 1QWRA 3MW3A 1C8M3 5BNOA 5CG8A 1ZBA3 3DV8A 3IDCB 1CJPA 5CNAA 4Y20B 4E2GA 2UYBA 3VL9A 3WDUA 3ES4A 1H4HA 3VBOC 1ZZ9A 4YNIA 3ZSKA 1W6OA 1RVF2 2VMHA 3V0BA 4ASMB 3DPRC 1N3QA 1COV1 1JN2P 2WSVA 2X8KA 1QJX2 3TN92 4W65A 1EV12 3U0ZA 3Q9OA 4BLJA 1W6PA 2UYAA 1DBNA 1RUJ1 3CJIA 4YZ4A 3GZAA 1K5MC 1O91A 3VZJA 4MH0E 1G9DA 1RUE1 5J37A 3WQ1A 4AEDC 2N7GA 1SACA 3ME2A 4DRVA 3KMHA 3LOIA 1LCLA 2ZTNA 3WP6A 4CEWC 3V64A 2V73A 1AR71 5K8SA 2NLRA 1ZZ7A 3SH3A 4YM2A 2BVVA 3A0KA 1FI2A 3WDTA 1FMD1 4GH4A 1LKNA 3WW2A 1DQ5A 3MI8A 4FTBA 2P17A 2ETEA 4YG3A 3VBSB 4DXZA 2IC1A 5KHJA 1NCQB 1VP6A 5E1RA 5FDBA 5KXBA 2HWE2 2XVLA 4IEPA 4JDOA 2TUNA 3CU7A 1ZZBA 3ZXFA 4DZGA 4QX5A 2OUHA 2LTNA 1D4M3 4KGQA 4MGIE 1CAVA 4AQ6A 3JQWA 3NV1A 3VBOA 4Z8BA 2P3IA 4WM7B 1CIWA 1LEMA 2RS31 2I07B 3FFZA 1XYOA 4AI3A 4LT5A 4LNVA 4NHMA 3PVBB 4QPYA 2DUPA 3DPRA 3BCWA 2EVXA 3AXEA 1DDLA 5LEJA 1FX5A 2DVAA 2R32A 1HXS1 3E5QA 3PLQA 1VBC2 3NAPB 5DZEA 1O3RA 4NWWA 3MLLA 1QJZA 4XJ8A 2EXHA 1SFNA 1K5MA 4FXKB 4Q4V2 3INAA 1PM7A 2X5IB 5CAZA 5IK7A 1RUF3 4S2FA 4AEDA 3NSTA 4DPNA 3R4DB 2SLIA 1H9PA 4BMEA 1YXWA 4MGYE 1UCXA 2JD4A 5C8CB 1MS5A 3ZXAC 4Q29A 1RUH1 2BW8A 2R1BA 4IEWA 4AW7A 1C8M2 2QJVA 1ZBA2 4ORFA 3GBGA 3HAGA 4XPVA 4BH9A 3B94A 1FT9A 1LENA 1H2LA 4UW6A 4FVVA 3MEPA 2D6MA 2ZZJA 4P9LA 1B09A 1R1A3 1RL3A 2D40A 3BB6A 4N43B 4PLMA 2B5HA 1FPN3 1WBFA 4FPEA 4LR4A 1G9AA 2ZX2A 4XOGA 2SBAA 1S2KA 5FFOC 4CDUB 3CLPA 3FX3A 4JGZB 5I8YA 1A8DA 2Y0OA 4HANA 4Y1YA 4ISQA 4LBMA 4COZA 5GLUA 1RUI1 4LLOA 1UMZA 5A3MA 2RM21 1IKPA 3IDEA 2WFF1 4NN0A 1GANA 3TOJA 3L9JT 4MVTA 4XJZA 1ALYA 4TYSA 1N1TA 4YGCA 2BVBA 4AYUA 2PAEA 4GMP1 3AZXA 2YY1A 1LHWA 1O5UA 3WV6A 3ETQA 4K9SA 4YGBA 2HWD3 4GWMA 2FQPA 3MIHA 3KT7A 5T5OA 4K1ZA 4XHXA 4AI1A 3SCGA 4XETA 1POV0 1D4M2 1GFF2 1HRV3 4OI1A 2DTWA 4XF4A 4I02A 1OI6A 1WD4A 3H50A 4KWLA 3B02A 4CEYC 3AXDA 4E2SA 5JSOA 4XW3A 3VN4A 4OVEA 1O4YA 1ZBE1 2O8OA 5JIAA 2A6YA 3IPVB 2XKOA 4AGVA 2JJ6A 1AYN3 1QXPA 3I59B 1AR91 2DVGA 3NKTA 1ZYBA 1BBT1 1YFXA 1EPZA 1Z7S3 5CVRA 2H6BA 4I01A 1D2SA 4QPIA 1S0EA 4RGAA 3OYWB 1XE7A 3ZFGB 5L7OB 1D2QA 2YZ4A 4CDXB 4WVMA 2UU8A 1RUF2 3M3IA 4JGYC 2XLFA 4B29A 4WM8B 3QCWA 1G86A 2YXSA 2K2SA 4R9CA 4QQLA 3N7LA 2RS51 3S30A 4K3UA 1GKBA 1H8TB 1ENSA 4XTMA 3T1MA 5J7MA 3QLQA 5FREA 4P9XA 2D6KA 1YRZA 2R071 3ELNA 4Q4Y1 4MGKE 1NOVA 2YUEA 4PBPA 1PK6A 1CN1A 1PMIA 4P9YA 3N35A 4EN6B 1A3KA 2UY9A 1R1A2 2PYTA 4FXGB 1BYHA 1VB4A 2WZR1 2HEWF 1FPN2 1GICA 4DY5A 5IK8A 3AMNA 3WDYA 4DB5A 2JE9A 1SMVA