2WNUB

Complex between c1q globular heads and heparan sulfate
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
total genus 27
structure length 132
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuB00
3ME2A 4HT1T 3FC0A 3L9JT 5KC6A 2E7AA 1D0GA 4MXVA 3AB0A 3TWIA 4TSVA 4QQ2A 2Q8OA 2Q1MA 2QDNA 2R32A 2WNVB 3WD5A 1OQEA 4OUMA 4KGQA 1OSGA 4E4DX 3K51A 4J6GA 1RJ8A 1C3HA 4KG8A 5KC5A 4RSUA 1D2QA 4G4FA 5KWRA 2WNVA 1A8MA 2X29A 2RE9A 5CIRA 5TSWA 1TNRA 3B94A 1JTZX 4DOUA 3QD6A 1IQAA 1KD7A 2ZJCA 4QQPA 1JH5A 1XU2A 3IT8A 2JG8B 2JG8C 2R6QA 4EN0A 1D4VB 1PK6B 1DG6A 1KXGA 4QQOA 3TYJA 2JG8A 2WNUB 2QE3A 4TWTA 2Z5WA 1TNFA 5L19A 3MI8A 1PK6A 1DU3D 2JG9C 2ZPXA 4QQLA 2WNUA 2RJLA 5HBAA 3B93A 4MSVA 5BNQA 3ALQA 4KGGA 4QQHA 2O0OA 2AZ5A 4OUSA 2WNUC 3QBQA 1ALYA 1WCKA 3B9IA 1U5XA 1OQDA 2WNVC 5L36A 4D7YA 2OIIA 4NN0A 1XU1A 4OULA 4G3YC 3K48A 3V56A 1RJ7A 1U5YA 4MXWA 3LKJA 2R30A 4F3JA 4E4SA 1C28A 4DB5A 2HEWF 2HEYF 2RJKA 4MXWB 2KA3A 3URFA 1I9RA 1GR3A 4GIQA 1PK6C 2JG9B 2TUNA 1U5ZA 1O91A 2HEVF 4QPYA 2TNFA 1S55A 2JG9A 4N90A
chains in the Genus database with same CATH superfamily
3QH6A 1LR5A 1GV9A 2KD7A 2PHFA 3C7HA 4XUTA 5BNOA 5F7UA 4FSJA 4L8QA 2WN3A 3PVOA 3H42B 3N9QA 2E7AA 2VUCA 4YW1A 2JIJA 3UESA 3WQBA 1PZ8A 4E8CA 3AZWA 3KF5A 1PHMA 1ULDA 1TMF1 2ZMKA 3USUA 5DQ0A 3VBOB 3B5LB 1UMIA 1ZBA3 2XG3A 3K51A 2GC2A 4FPLA 3POWA 2AEYA 1QJY2 2R061 3EJKA 5GLTA 1ZRFA 1LECA 1NT0A 1BVP1 2NN8A 2C9AA 3IBMA 4V2WA 1YQ6A 3HQRA 3KZ4C 2NPIA 1ASJ1 3P6BA 2XKPA 4O61A 4CUCA 1AUYA 1F8VA 4FAGA 1CAWA 1AR62 1Y9MA 3NNGA 3UETA 1UY1A 4XUQA 3GF6A 3WF4A 4N43C 4LHKA 5C8CA 1KD7A 3AYDA 3T2PA 3U10A 2V5DA 4FOYA 4NO4A 3PJYA 1RTVA 3ZLIA 4BMEA 1R081 4BDVB 4AGRA 2W68A 1YQ8A 2ZGRA 2R6QA 1LU2A 2WABA 4GJYA 2XWJB 1HDKA 4PDWB 3N4MA 3A21A 2HYKA 4XYXA 4QWNA 3WEZA 1DQ2A 2YFZA 2DU0A 2HWF2 3MLJA 2PA7A 5LWBA 5H9PA 4GMP0 3S0MA 3HIFA 3RGBA 1F4HA 1OHFA 4KU8A 3RPQA 3ZFEB 4A2UA 5HCAA 1WMDA 4A44A 4Q0VA 5A3MA 5C9AB 5JOYA 4YZ2A 1OURA 5FQ0A 3AP4A 1FV2A 3FWEA 3ZFFC 4B8EA 3NJYA 4K20A 4NRMA 4P9YA 2BOJA 3MIEA 1F35A 1QHDA 1AF9A 5F3GA 4AVTA 3PU3A 5FFOC 1MZFA 5FZ6A 4BK4A 2ZBJA 4AAPA 1CJPA 1YWKA 1JMUB 1QNWA 1QIQA 3I7DA 4EN7B 2O14A 5J3UA 1ALYA 2LALA 4L9BA 2BPA2 2FDFA 3B9IA 1OLME 3S5QA 4XACA 5C8CC 3ZR6A 1WCDJ 1OKOA 2AR6A 4E2SA 3HOBA 5F2SA 3WF2A 5A1FA 2ZX1A 5FYTA 3ZMNA 1JYWA 2E6VA 1W28A 1JHNA 4COYA 3Q8BA 4XC9A 4QGNA 5LBFA 4ES8A 4AI9A 1V00A 1RHI1 2Q0AA 4AW7A 1UWWA 1VLNA 3N9NA 4XETA 1GUIA 1PMJX 3JD72 4CEYB 1DQ4A 4CCMA 4CPBD 1HB3A 1AR72 5K8SA 4F3JA 3LGRA 4NHXA 4E2QA 1RVF2 2GC1A 4E4SA 5F6KA 5FZLA 1H2LA 1W6NA 5AC93 5J09A 3EQEA 4INDA 4XZPA 2RM22 4NWVA 4J1WA 1TME2 3VDDA 3ZIWA 1GP4A 2GMEA 5JR7B 1E57A 4CDXC 1QJY3 2WYFA 4UYBA 4OI1A 3MF9A 1W99A 2JG9B 1VBC1 2WAAA 1GWKA 1DQ0A 4GULA 1OH3A 4P5YA 2IXIA 4Y5TA 4SBVA 3O12A 4R52A 1W90A 5FPLA 4Q4V1 1FNZA 3LIHA 3UNPA 2YU2A 2B46X 2TNFA 1E5SA 1XPWA 3BGAA 3F95A 5D8AB 4R9DA 2LM3A 5L9VA 2C0ZA 3FC0A 3SITA 4OI4A 1RGSA 3M7AA 2R0FA 4Q4W3 1D7PM 4XQDA 3PNAA 2Q8OA 3ZFGA 3CJIB 1RUC2 2ZX3A 3FHIB 3NAPC 4MHUA 2G1MA 3ORJA 4KGQA 4V2VA 4LHNA 4J6GA 1VB2A 4MGKE 3VBSC 1MQTA 2RJ2A 3O14A 5FY5A 1SACA 1W6OA 1V9U1 2ARBA 2CY6A 3U07A 4E8DA 3LOBA 1ENRA 4UW6A 4IW3A 3A22A 1TEIA 2E7QA 1XE7A 2X29A 3J7MA 4HVOA 1BMV1 1JZ5A 3WY6A 1KEXA 5A7WA 2Z79A 2H0VA 4MO3M 4QXCA 4N7UA 1ND3B 1OLMA 5CB7A 3EO6A 5CBLA 2EA7A 5JSRA 2W5FA 4XILA 4L2NA 2R041 1CX4A 1W8TA 5IK4A 5BNPB 3KLSA 2W87A 3VN4A 1GZCA 1VPHA 1G9DA 1O3SA 4HN0A 5FZCA 3T2OA 3WCSA 1SQ4A 4AI1A 1WD3A 1QJX3 4R4ZA 4XFCA 5L19A 3VDBA 4UFIA 1JU4A 1SLTA 3ZOIA 3ZXJA 1AZDA 2JICA 2VTFA 2W91A 1ULFA 1G8WA 2H0BA 3K4AA 1FX5A 4IV3A 1GP5A 2JG9C 3N7KA 5KHHA 3ILNA 2X5IB 1WWYA 1VRH3 1VBA2 3ZDSA 2WZR1 2D98A 5JPMB 4XJ9A 5ABJC 5FZ4A 1R082 3U11A 1BEV2 1LHNA 1YXWA 2CDPA 1HB1A 2HWB1 2FCVA 4YM3A 4HOOA 2I74A 3O1RA 2CAVA 3CNAA 5LA9A 5DMYA 1S0FA 2WSVA 4UFJA 1LHOA 4FCAA 5JXHA 5A3OA 1DLCA 2VOWA 5GLZA 1RHI3 4LBLA 2DCYA 2PELA 1JODA 2W9XA 3THTA 1YJKA 5FUIA 5FZ1A 1RUC3 5A6XA 1UMZA 4Y33A 3U14A 2EXKA 4TZDA 1AR92 4NN0A 4EROA 1RUD3 1UYXA 2JXAA 1CONA 5BPXA 4C90A 3N7JA 3LDRA 3THDA 1UXZA 1SBEA 4DNYA 4OQ8A 1EAH1 2JKXA 4GB31 3OCPA 3JQXA 3WNOA 4UF0A 2D3SA 2LRPA 3ZYHA 3NV1A 1KS4A 4UBHA 3INAA 2DVDA 4OFGA 2FDGA 2VZQA 3BCWA 5GLVA 5FZOA 1FXZA 1DYKA 3A0KA 1C8M2 1LRHA 4FPCA 4YRDA 2WO2A 1DZRA 3I2HA 5EQUA 3RJ2X 1YFYA 3MIDA 3I2FA 5A3TA 2QKDA 3B3QE 4YNIA 5FLIA 1ND2B 4XTPA 5GLWA 4BWOA 1U5ZA 3N9PA 3VBHB 1KRIA 3D4KA 2JJ6A 3GXUA 2VW1A 2B39A 1VBA1 5GALA 3PLQA 4YVWA 3LF7A 3FHAA 4ZZ5A 4FTBA 3ZFGC 2VNGA 3N3HA 4QDRA 1QJEA 1R1A3 4XEZA 2TEPA 1F5JA 1C8NA 3HN3A 2HWC3 1H8TB 2ATFA 2F4LA 3VKMA 1D0GA 3PIGA 1K5MB 2CAUA 5FZGA 3AB0A 3JBG2 3R6SA 4AE2A 4E27A 5IVBA 5EV7A 2JD9A 2ERFA 4AEMA 2HWC2 2CWSA 2A6VA 2Q8EA 2Z2SB 1DZTA 3M8LA 4ZU5A 3UV9A 2YBPA 2K2SA 1CAWB 2OW4A 3E6DA 3A4UA 4ASLA 1Q8VA 1V70A 1C3HA 1FV3A 3KVBA 5KC5A 3T2QA 4RSUA 3WW2A 4CEWC 5J7MA 1JI6A 1QJU2 2CU5A 2WNVA 2JE8A 4TYSA 3VUOA 5CKQA 4Z2WA 2ZHLA 2VZRA 4OQ9A 4ZU7A 5FZ9A 4CDUA 1QQP3 4HVRA 1W2NA 4HONA 4WBBA 2QNKA 4Q4V3 4FPHA 4BK5A 1CAVA 3QD6A 4LXLA 4PDWA 2X10A 4FPJA 1GANA 1N3OA 4LQRA 3ZYJB 4XPVA 1JH5A 1SFPA 2FMYA 1JU3A 1ZRIA 5A3WA 1MZ6A 1UOFA 4RL7A 3RSJA 1YQ2A 3S7IA 2P6HA 2GP3A 2GN7A 1S0CA 3OYWA 4N43A 4CDWA 4R8HA 2ZGNA 1CQ9A 4DO0A 2QQVA 4ARXA 4QMAA 5FYMA 3VLBB 4AEJA 5K0UB 4IE5A 4MX3A 5FZHA 3RYRA 3H0OA 4K40A 3D3AA 3M3IA 2RS51 4CPBA 2IUWA 4JDNA 5C33A 1A3KA 1GLHA 1ZNPA 4IXLA 3K3NA 3H3UA 4XFFA 2P3JA 2RDQA 4QQLA 2DCKA 3GALA 2VECA 4FFGA 4HPKB 4JDMA 4Y1VA 4DRRA 2FBEA 3ZN5A 4LUKA 1GWLA 5JMOA 1IGOA 2VZ1A 3GZTB 4S2HA 4FPYA 1XYOA 1AX0A 1GICA 2BU9A 3NVCA 2QQUA 1NCQB 5DXDA 2CNAA 3QBQA 4NHYA 3ST7A 2CGPA 4OLLA 3WF1A 3M1HA 1VRH2 4XXPA 3AL6A 3Q8CA 3WP6A 3OY8A 2D6OX 4LBQA 4H7MA 2XLGA 3PHMA 5FP4A 2HWE1 3T30A 5LA1A 4LBMA 3E6CC 3VBFC 3I2IA 3DYPA 4BHPA 1R083 3LFMA 1QEXA 2DUQA 4BQ4A 2PFWA 5JSPA 3BI3A 3J7LA 4AVSA 2YDEA 1RHI2 5FZIA 5A6QA 1L7RA 2RDNA 2PHLA 3CF6E 1VJ2A 5IUQA 2D6MA 2VAUA 1P8JA 5CFDB 3M2MA 4BXSV 5IK5A 1XNBA 2XDVA 3LPGA 1ULPA 4GQ7A 5E8AA 5FMOS 4GZ9A 4HXCA 2HWF1 4P9XA 4UXAA 1KITA 1CVNA 2DCJA 3B69A 3SCHA 1VBA3 3WUCA 5IVEA 1BXHA 2AREA 1QXPA 4GB33 1AYN1 2ADEA 2GH8A 2YYOA 4YGCA 5EFUA 3TNPB 1QKQA 4GJZA 1NCRB 2VOVA 2RS12 3KGLA 5IFTA 4W50A 3VDDB 5KR7A 2WFF2 1YJLA 1OI6A 3SC7X 4NJ4A 4IV3C 3MUZ1 3VD3A 4XJAA 3ZFGB 4FPEA 4GB32 1S55A 3AL5A 2ZACA 4XBQA 1UF2C 2DBIA 1HQWA 2SLIA 4LE4A 2OQ7A 3M3CA 4IEZA 3ZFEC 4A7ZA 4CCJA 1VBB1 1W6OB 3F2ZA 4W6WA 3BUCA 1R1ZA 3IIAA 4IEXA 3S30A 4XF4A 2GP5A 2A3WA 4GKYA 5FIXA 1NZCA 4HKLA 2PMWB 5F9TA 1O4TA 4KG0A 2L9LA 1NY71 4AF9A 2HWC1 2XXZA 3AKTA 1W2TA 1D2QA 1W6MB 1W8ZA 4LO5B 4N53B 3CJIA 3VGIA 2RMU1 4CZSA 2Q1FA 3VHPA 1PO21 4S2DA 5JOWA 1W8UA 4L92A 1AL21 3HMYA 2GMMA 1Q8SA 3MV11 4QB2A 1EAH2 5FR3A 5JIUA 4Z8BA 4QAWA 2ZJCA 4QX2A 1TME3 1YI9A 3BN6A 3FL7A 1SZBA 5JWPA 3VBRA 4NPMA 2D44A 3J7NA 5I91A 5IATA 4MGSA 1KFXL 3P1IA 2VW2A 1G9AA 3ZYRA 5C7GA 2HWF3 2WYSA 5ANQA 1DQ6A 3HEIA 3T2TA 4AGGA 1X82A 2JG8A 3PURA 4LT5A 5FPBA 4CP9A 4META 4YYOA 4YGEA 3H8XA 1YI7A 4K1YA 4UFHA 3Q8EA 3M3QA 4TXWA 1ZX5A 1S0DA 2BGCA 3ACFA 4CRQA 4JDOA 1LHVA 2QZ2A 3VV1A 2ENRA 3VD5A 3PUQA 1SMVA 2WUHA 2PN5A 2BZDA 4AFMA 4IV3B 3FHQA 4DUWA 3PJQA 4Z82A 1JN2P 3RQ0A 2WWSA 3V65A 3CBNA 3GYDA 1AR93 3JBG1 1HW5A 5I8TA 3SH5A 5IFPA 2NYYA 3J8F2 4WM8A 1RITA 3VBFA 2LTNA 4D7TA 4RFRB 4FOWA 2Y0IA 2B9UA 3VZNA 2HKXA 1LOEA 5IAXA 2WZR3 1KQRA 3AYEA 2ZGLA 3H50A 4ES9A 4KWUA 2J1SA 3IPVB 3IIIA 1CAUA 4XBNA 1X8EA 5LEKA 2WZR2 2PQQA 2ZEXA 3K48A 2DBNA 4RHV3 4MUVA 2CTVA 5A7SA 1CPMA 4IETA 1HN0A 1LOFA 1XBFA 5JZGC 1LULA 1TVGA 3WP3A 4NHKA 1TZOA 4JAAA 4X6QB 4CU9A 1NXD1 4C0BA 4IGPA 4D8MA 2ZGTA 4WZCA 3THPA 4RGGA 1WA6X 2BNOA 5K0UC 2VM9A 1VRH1 1PVXA 3WDVA 1UY4A 3N9LA 1IS3A 4XAAA 5F2WA 1H6XA 1FPN1 2ZHMA 5D21A 5F37A 4CCOA 3D0JA 2J1TA 2VG9A 2DF7A 2WJSA 4AEDA 4UWDA 5CEHA 2MPFA 4Q26A 1TE1B 1K5MA 4NPLA 1OOPA 3NKTA 2JENA 3U75A 1Z78A 3GBFA 3NRUA 2WZEA 3P3PA 1IS5A 4L0PA 2Y6GA 1WKYA 5EP9A 3ECQA 3LSDA 5SV5A 5FZ0A 2Y26A 1EV12 2R043 3OBRA 1FATA 2VQUA 2DVBA 1K3IA 1CIYA 2CYFA 1UU4A 1O59A 5FZEA 1MS3A 3ACIA 4BA6A 3TOJA 2CSGA 2ID4A 1OSGA 3FLRA 1PGSA 1US2A 2EIBA 4HFSA 4M00A 1O7FA 3PMEA 4EQVA 2EALA 4H14A 4YGDA 4NR1A 1QMJA 2HYXA 1OT5A 4AG4A 5F39A 4QDQA 1RUF2 5DG2A 3W58A 1RUF3 5FWJA 1UZVA 1KGYA 1UX6A 2E33A 1HIXA 3SH3A 1JYVA 5IK8A 3RWKX 3KCXA 3T0DA 1O5LA 2E7TA 2WN2A 1M4WA 1PNGA 3MUY1 1O4YA 4EYUA 4QQPA 5E1RA 3KV9A 4AVBA 1NCQC 1XU2A 2VO5A 3IMMA 4D3WA 2QQKA 1R093 3ZN4A 4CA9A 1F9KA 4YGBA 5ACA3 4NIIA 1WLWA 3O7OA 2FDHA 5FCCA 1PK6B 1DDLA 2C24A 3R4SA 1KXGA 5F6LB 1H6YA 2XMLA 3MHZA 1GOHA 1QXJA 2W1UA 1CIWA 4A6OA 2Y33A 4M4PA 3VD7A 2OT7A 3ES4A 2W39A 4CU8A 1PO23 1DYPA 1RUE3 2R071 2IFRA 2ZA9A 4CU6A 3ON7A 2JD4A 3PTRB 3I59B 4EZ4A 2OA2A 3N7LA 3I2OA 4UAPA 3N7MA 1OUXA 1JYTA 1ZYBA 4PBPA 5LBCA 4XABA 3VL8A 1UOGA 4OUEA 1W0PA 2GC0A 5FQ0B 1VBB3 1LOGA 1WLTA 4MLOA 2Y64A 5FBZA 3VKNA 3ZXEA 1FOD1 4N7IA 3SCFA 5LK5A 5LEJA 1VBE3 1ZA4A 2J22A 3AZZA 3POEA 4ZKTB 5F5AA 5L7OB 4P00B 1DGWA 5T5JA 1RUOA 4IEOA 1UIJA 4RHV1 4O9EA 3PUIA 3W21A 3CJIC 1US3A 3NAPB 4UT5A 1OUSA 2BP6A 4Q4Y2 3WUDA 3WXPA 4ASKA 5L36A 1NCQA 5CFDA 4GALA 4COVA 3KT7A 2YC0A 2JWPA 1WMFA 1YIPA 1SCRA 4D0QA 5LCWL 1IG3A 1QY4A 2DFCA 3WX5A 4XFAA 2EAKA 2WO7A 1JOJA 2PAMA 4S2FA 1REFA 3BIEA 2VVEA 4JRAA 2EICA 1MS1A 3ES1A 5JUVA 4A3XA 1SFNA 1G86A 1OD5A 1XNKA 4Y20A 2BUKA 4J1XA 1W3XA 5FYYA 3OGRA 4YW3A 5FYCA 5K9YA 4XDOA 4JGYC 5HV0A 1JYCA 4JCKA 1RXGA 4CEYA 4NWWA 4HN1A 1AXKA 3VZMA 2WDBA 5F32A 4MGTA 4D6QA 3WQ1A 1BYHA 4H2AA 5DDJ3 4AFAA 2RS11 3ZXDA 3AFGA 1SDWA 1W9TA 3WCRA 3C7GA 4I3GA 1GKBA 1URXA 2UYAA 1H4GA 3R0RA 5M0TA 3O0XA 2G9ZA 1EAH3 1IZ3A 2LROA 1CR7A 5GZDA 3KV4A 1XC6A 3OD4A 3OGSA 2Q8DA 1KJLA 5DN2A 3V64A 1PO13 4BYYA 1O8SA 2HWD2 2LUWA 3T1LA 4MXVA 4CCKA 1BEV1 1OH4A 4TSVA 4CP1A 2AUYA 3V0BA 2LS6A 4UW3A 3JD73 3N9OA 5G04L 1UAIA 1LOBA 3AYCA 2BVVA 4N9HA 1RMU3 4AYUA 2HWE2 1HN1A 4AVVA 1GP6A 3AZVA 2XVLA 2ES3A 1VALA 4ZPIA 1X36A 4RR3C 1AJOA 2DCTA 3N35A 4LMFA 3TEWA 5G05L 3WNMA 1OLQA 3BALA 3AP6A 3ZSJA 1UNBA 2W52A 4XQ4A 2JB8A 4N53A 4HG6B 3LZZA 3CU7A 3I3QA 3ITQA 2BGOA 4X8NA 1A34A 1VMFA 4XQWA 5FDBA 4AR2A 1D4M2 1QDOA 1RUJ2 1Y3TA 1NLRA 4IE6A 2J1EA 4NE9A 4DINB 1UY3A 2A7AA 2WZ8A 2QE3A 3ETPA 1O6UA 4JGYB 2WO3A 4MH0E 5LY2A 4BQ1A 5BNPA 5KXBA 3DYOA 1MZEA 3AM2A 4ARYA 2XJUA 1Y4WA 4YZ1A 4EWAA 2K46A 1APNA 1WLCA 1BCXA 2YC4A 3T08A 4WM8B 1L7QA 3WVJA 1UX7A 1Y9QA 2ARCA 4URTA 2KXLA 4KGGA 4RGKA 1QOOA 4KWKA 1HQLA 3JB4C 2W47A 4PI2A 4RA0A 4NIGA 3KQRA 4EWEA 4HVQA 4CDUC 2WA3A 4HKWA 4H3WA 5EXOA 3SH4A 4I0BA 2D97A 3T0BA 4CCLA 1XJAA 3AKSA 4E9KA 3UJQA 2X05A 3PVNA 2GMPA 2BJSA 3L2HA 3VHRA 1AR63 1PMHX 1S2KA 2Y34A 4AI3A 1ZREA 2E32A 3W5MA 3ZO0B 1RMU1 1V6JA 2EF6A 3B9CA 3OPTA 3JB8A 2YBKA 3VBFB 2ZTNA 3P3NA 3AJYA 1UIKA 2YXSA 4FT8A 2VE1A 4GMP3 2D93A 3IMNA 1FMD3 2XQXA 1A6CA 3QLQA 4MXWA 2WIIB 3H3LA 4LIVA 1H1MA 4RR3B 2YMZA 4XVHA 2VUJA 4IL7A 3AKRA 5CFCB 1RUI1 2VOXA 2A3YA 2JIGA 3AP7A 2QUOA 2BBAA 3KWVA 2GNTA 5I0SA 1OC1A 1VAVA 2HEYF 3WNKA 5I0RA 4UF0B 4AFDA 1LOFC 2FHRA 1ODMA 2WS93 1GR3A 1PX4A 3WT3A 1Q8OA 1AVBA 3OGGA 3H3ZA 4LKEA 4AZZA 3NL1A 4PJYA 3ZFFB 2ET1A 4NPRA 1O91A 2B9VA 4JRLA 1PZ9A 3K46A 4XF9A 4RN5A 4B3NA 1JZ4A 3ILRA 3DKWA 2HBTA 2QTWB 4Y24A 3RDIA 1S0IA 1RVF1 1W03A 3IDCB 3TWIA 4FPGA 4QGLA 4JVAA 1SLIA 2RM21 3T0AA 1UPSA 1PVC1 5FMOL 1VE0A 4C1XA 1H8VA 2AEZA 1N47A 5L73A 4DQAA 1LODA 1H8TA 5A1AA 4IE0A 5JAXA 1FAYA 4AEKA 5DPNA 3J9SA 4Y1YA 1W6QB 3OGVA 2A6YA 1AXYA 4IE4A 2LW8A 1JZ6A 4R9CA 4BIFA 5A3PA 4R9BA 2R7EB 4RQPC 1Q5OA 4XE9A 1JBCA 4LR4A 2VBBA 4AHZA 3I49A 1EPWA 4FBFA 2WNEA 3DXUA 3BKZA 2NLRA 5HCBA 1JOPA 2B7YA 4PF5A 3NV3A 3SCGA 1S0GA 4CCNA 4YPJA 3WR0A 2NQYA 3ZXAC 3KV5A 1AR83 3HR9A 3I59A 1TMF2 3MFAA 4P14A 3LEGA 4XJWA 3APBA 1JUHA 4ATEA 2FMDA 2R1DA 1NKGA 1D4M1 2WZPP 1H30A 1YQ5A 3SXWA 4O7XA 1QOSA 4JTOA 5GZCA 5HXMA 1AR91 3JBG3 1BQPA 3I3BA 4Y3OA 1LENA 3KT4A 5FZ3A 4BZ4A 1ZZ7A 2W08A 5K0UA 4LO6B 1W8FA 5FXXA 4EN8B 2GH2A 4DIQA 3RZMA 2OUHA 4M3CF 3SMHA 4JQTA 4AAXA 5L7OA 1H0BA 3K75B 2EXHA 4KL1A 4GWNA 4E4HA 4DMIA 1QXRA 3WHTA 2BFUS 2Y38A 3K3OA 5F3EA 2PAKA 3AXEA 3QCWA 1QH6A 5FY8A 2ZXQA 5D8AC 2JKBA 3AKPA 4LA2A 4JGZB 2PHTA 3D82A 5DAWA 3FLTA 1N1TA 1U0AA 2Y6FA 1UL9A 2VQAA 2WO1A 4LORA 2VNOA 5FTTC 1W9WA 3POGA 3HT1A 3I4IA 2ZMNA 2ILMA 3BTAA 4P9IA 3LFIA 3RRDA 1RIRA 2QQJA 1ZZ6A 3MPBA 4Q29A 3OD0A 4LBQB 1IKPA 1OFNA 4XOGA 3MIFA 2BNNA 3LKJA 2PTMA 4WVVA 3ZYFA 2HWB3 1YUDA 1SG3A 2ZGPA 1C28A 3THCA 5LBEA 1TG7A 5CG9A 4ASMB 1S0BA 3PUHA 4FOQA 1Q3EA 3SKJE 1REDA 1VB4A 5LASA 1VAMA 1C4RA 3FN9A 1HXS2 3S6PA 2Y6JA 4MGQA 3AKQA 1RUH1 2RR12 4F83A 3MEPA 4DXTA 1Y7BA 1PVC3 3H7JA 1PO22 2A75A 2GNMA 1NLSA 1RC6A 2VCAA 3R4DB 2RDRA 1CZSA 1VRBA 2PXJA 4X8PA 3TN92 3VHOA 1M06G 2VW0A 3HNBM 1BBT3 4HZFA 3MV01 4OHXA 4HK8A 3DN7A 1R091 2GU9A 5GZFA 4KNCA 4YVWC 3D8CA 4P08A 1F5FA 1BHGA 3JD71 2WNOA 3WSOA 4DS0A 3KB5A 5FOJB 3NNFA 4MHRA 1UPIA 4LJHA 3ZYIB 3ZYPA 3O1VA 1UYZA 1H8TC 2IXJA 3EBRA 4XCBA 3ZYGA 4QPIA 3UGFA 2Z69A 1D4M3 2PHRA 4GWMA 4LKSA 4OI0A 2BDRA 2VMCA 3PL0A 4YARA 3KSCA 3LOIA 2ZCWA 2RS52 3BU7A 4KBZA 2YBSA 1AR81 3AMNA 4EE2A 4YZ5A 1V6OA 2C1FA 4RQPB 1UN1A 1JS9A 5LRSA 1UW8A 2V5YA 2A6XA 3WDWA 1HRV2 1GQPA 1V0AA 1NUKA 3VBRC 4LK6A 4E4ZA 4MV2A 1ZA7A 2ZGOA 5A7OA 2ORZA 1BLZA 2BYVE 2R0HA 4YM1A 1NA1A 3VKFC 2QZ3A 1QF3A 1G9CA 4IV1A 2HH9A 4PI0A 1BMV2 2WL1A 1QJZA 3I2JA 4FFFA 3OTFA 1BK0A 3U78A 2V72A 4DUVA 1WCSA 3IDAA 5IWFA 1DU3D 3PVBB 5C3RA 4LOTA 5C5TA 1HLCA 3N36A 3ZM8A 2VD7A 3B02A 3GCXA 1MVQA 3I2DA 4AHYA 1HV0A 4YW6A 3RG0A 4GH4A 5EJZB 2FZ2A 1DGRN 4BIOA 3O1MA 3ALQA 4QQHA 1RUC1 5FJHA 1HX6A 5LA2A 1K42A 2ZGQA 2Q1ZB 2QDRA 2XR4A 5B4XA 4LBKA 4YVSA 2VGDA 5FZ8A 2AENA 5IHRA 2R1BA 4XF3A 3T3YA 4B1MA 3JQWA 5BV6A 1X50A 5FXWA 1HRI3 1N1SA 1QU0A 1AR82 1OBNA 3ZX7A 1B09A 1RXFA 2YHJA 2RG4A 4Y1ZA 4Y5Z0 2RM23 3HBZA 5DUWA 5FBJA 4F7ZA 4K3UA 2YG0A 1RVF3 1F15A 2WT1A 4G3YC 5HXVA 1J3RA 1C57A 1N3PA 5C71A 1WW5A 2A71A 4XIKA 2F4PA 3HBKA 4BQ2A 3WNNA 4IDZA 4L11A 3BTYA 3NKGA 4Y4YA 4AQ2A 3C7OA 5F3IA 4BJ0A 4DRVA 3Q8AA 1ULOA 5FYIA 1XYPA 2IXHA 3ZXGA 3C2UA 2HEWF 1JZ3A 2BTVC 5FMCA 4LK7A 2A6ZA 1MZ5A 2VXJA 1COV2 4JKKA 2E31A 4BOWA 3R05A 3SNMA 1V6IA 1UMHA 4M3CA 3WG2A 3AMQA 3G7DA 4GXLA 1PK6C 2XVKA 4PQ9A 4AEDC 5C8WA 5CFCA 1GZTA 3KT1A 5BNOB 2C26A 4PLMA 4MOAA 4HKOA 2W92A 4YVSC 2WBKA 2JDHA 2YY1A 3H1YA 3NWKA 4D7SA 4XHBA 2FDIA 3SLIA 2JDUA 2GDFA 4OHVA 3ACHA 3LAGA 4EN9B 4C91A 3RZKA 5LB6A 1WLDA 5KBFA 1FMD1 2WWJA 2DCZA 3E97A 3GHNA 4M4RA 2MHFA 4S2GA 2BERA 4LIUA 4QPGB 1LHWA 1C8M1 1YNAA 3JXSA 4JV4A 4K21A 1W2AX 1AX1A 1PM4A 2HWD3 2YPDA 1U12A 5LY1A 1NY72 2R32A 2VU9A 1DYOA 1A78A 1SCSA 1GZ9A 3CKHA 4E4DX 3WDYA 4WM8C 3ZIXA 2XJTA 3NW4A 2VZUA 5FK7A 5SV8A 4H55A 3LEMA 4NVPA 4Q27A 1A8MA 3RMYA 3MIGA 2XJQA 3TN91 1CPNA 3NQHA 3WQ7A 3USUB 5GKAC 5I8YA 4Q4Y3 3X29B 3ILFA 4O9GA 4RFT0 5FYUA 3TEZA 2AH2A 1ZBE1 4LBNA 1VBE2 2ZHKA 1WW6A 2D43A 3AZYA 1CN1A 4M0NA 5FKBA 1VBB2 2J1RA 2VZSA 2UY8A 4EJRA 5IT6A 3RZHA 1DG6A 1UU5A 1UYYA 2E26A 2Y0OA 4QQOA 1GZWA 5JOXA 2VNRA 5BNNA 3S5AA 3WW1A 2AACA 2AGSA 4MVTA 1IQDC 5B2GB 5FXZA 1YEWA 4WM7A 4CUGA 2EXJA 4AFBA 4KBBA 5BNOC 1AYN3 4Q5OA 4QXHA 1HQNA 4A7KA 1BVVA 5HBAA 2G19A 1MS9A 2DVGA 3WG3A 4XFGA 5ACA2 4AFCA 3RZJA 4EWDA 5ERLA 1ULEA 4TLGA 2VOTA 4FFIA 1VR3A 1IPKA 1DLLA 4BB3A 4UFKA 4C1WA 2GAUA 2HJIA 4BQWA 3G6JB 4YSFA 3O1PA 2PLV3 2P34A 3POBA 2OPKA 3BU0A 1X9PA 1U5XA 5LA0A 2ZAAA 2Q5TA 2N7GA 3I2KA 3NV2A 4QKNA 4QPIC 3ZPOA 1QNYA 1STMA 3OEBA 1BZWA 2JB4A 2QBXA 1POV1 2ARAA 2XL9A 2PYTA 5EPAA 5C4WB 1DBNA 3V56A 4MG2A 2VZVA 3AXDA 4JZRA 3MBWA 2XBO3 3MW2A 2XPJA 4Z07A 4CDXB 2XQRA 2WQ8A 3I3MA 5DAPA 5GJ6A 4XDPA 5A80A 3RZLA 3NMBA 4QX8A 4OHWA 3BODA 2R042 3HJRA 5E88A 1VBD2 4OHZA 5A7PA 1EPZA 2RR13 3EB7A 3POYA 4K7JA 4CEYC 1V6NA 2OYZA 1LESA 1RUJ1 4AWDA 5IYYA 1CX1A 3PUAA 4GMP1 4XFBA 3AMHA 1DFQA 2SBAA 5FUPA 4KWJA 1W6NB 2WR9A 1CZVA 2Y6LA 1ZZ9A 3DPRA 1J83A 2RS53 1LOAA 1W8HA 5F1RA 2B4KA 4GD4A 4Q4W2 4XUNA 1BK1A 3IKWA 4QPYA 4RGAA 3NNLA 4ZXEA 1SLBA 1V9U2 2EIGA 2Q30A 4GAZA 4U36A 2BV4A 3OSDA 3WZ1A 5A3LA 1K5JA 2JG9A 1SPPB 2QVSB 1VP6A 1W06A 3ENRA 5FMBA 1GQGA 1ZRRA 3I97A 1OF3A 1V6LA 5KC6A 4ZS3A 2R063 2VMGA 2OVUA 1HV1A 1LEMA 3AMMA 3UJOA 3MW4A 3L2YA 2W1WA 3GGLA 3MZHA 5FYHA 4QD2A 3ZDVA 4FXGB 2C6SA 1ENXA 2JDKA 2XUMA 4OUMA 1O3TA 3HWJA 3PU8A 4IE7A 1COV3 1DQ5A 1UZYA 2NP0A 1ZRDA 2BRTA 3LIGA 5C4WC 1KS5A 1HB4A 4ORFA 4NIAA 3HT2A 3MLKA 2QQPA 4QHZA 3SEEA 5AC91 3VZLA 2XL7A 4GWIA 1WA4A 2RS33 1HXS3 4QB6A 2MNGA 3B94A 2O8QA 3AZXA 4IUGA 4LA3A 4DOUA 5JOZA 1LGBA 2XWBB 1NA1B 2RHPA 5A32A 3KGZA 1ZVFA 4I01A 2O8OA 1GMMA 4Q4X2 5GLUA 2Q8CA 5BXXA 5FMDA 2MEV2 3V0BB 4CUAA 1O3QA 2QCSB 3N9MA 3ACLA 2KR2A 1WUVA 1ZBE3 2YPJA 3SKVA 2CWMA 1Q8PA 4BMBA 5JSOA 1NZIA 2ZKLA 3DL3A 5AVPA 4AHXA 1AL0G 1GNHA 2MEV3 4GH4B 4QGMA 1SBFA 3LQCA 3BTXA 1O4ZA 2YV8A 3POFA 3A0NA 4GKXA 1RMU2 4PF1A 2X53S 3MICA 1MS8A 2VTXJ 4QX5A 1WCUA 2RJLA 2OQ6A 5BNQA 3DCQA 1N1VA 1XNCA 2BEOA 2YROA 2A1XA 1XYNA 2XVGA 5D2AA 1DGRA 1MVEA 2IZWA 1YYNA 4CDQB 2VOKA 2XLAA 5DZEA 3CL1A 1WD4A 4GH4C 5EWSA 2XBO1 3JUUA 1JZ2A 3LA2A 2ZZJA 2WS92 2GSYA 3TB0A 4EV0A 2FDKA 3EHKA 1FOD2 1OQDA 3PMSA 2JDMA 3DEMA 5DG1A 4FAHA 1RYYA 3KHCA 4YVSB 3MGUA 3LD8A 4AL9A 1VAKA 3C7EA 1NX9A 1QJY1 2R062 5DDJ2 3UGHA 1W6PA 4OCTA 1QWRA 3ROUA 1RUNA 1X33A 1FYUA 2UU8A 3HNYM 3HD8B 5APAA 3SISA 5CKNA 4Z92B 3IWZA 1DGLA 1U5YA 5IVVA 3BTZA 4RS5B 5FV3A 4E2GA 3KS7A 3UYJA 2MEV1 4A45A 3DKQA 5T5PA 2WA4A 2CHHA 4N53C 1J59A 1MS4A 2K0GA 2W3JA 3VBHA 1HRV3 2RJKA 2VMFA 1Y43B 4MXWB 1FPN3 2XBO2 4XJZA 4IQPA 1G7YA 1LGCA 1ZBA2 4Q8LA 3W59A 1ZBA1 2NMOA 4IGQA 4K8FA 4XW3A 4CSWA 1J84A 1SDDB 1W9YA 2TUNA 1UO9A 1IKQA 3T4HB 3KF3A 2CL2A 4NRQA 3KQ4B 4QPGA 3WP5A 1PIV1 4L99A 1QJX2 2EIEA 2ZEZA 4LKDA 5DAQA 4CCEA 2WT2A 3B7MA 1HRI1 4M3CE 3OJBA 1FMD2 2P2KA 2VMEA 3VBUA 1WBLA 3ME2A 3AVSA 3J8F1 1AX2A 1COV1 2GC3A 1PGL2 4YVWB 2WQZC 4Q8KA 4BQYA 5CG8A 2WNVB 4Y1XA 4YZ4A 5BY5A 1OQEA 2HWD1 4XBLA 4MYEA 3ACGA 3B01A 1IS6A 2JE7A 5JI9A 5A3NA 5FZ7A 4OHYA 4TLFA 3RI8A 2ADDA 3KD4A 3LSEA 1RUJ3 1IHMA 4JKLA 5LZ6A 3SQOA 3TN93 3RI9A 5AFBA 4OMDA 3NJVA 3KCCA 1RUI3 3V0AB 4UFLA 4I0AA 4XJ8A 5CIRA 4BXFA 3OUHA 2WWUA 1MACA 1IQAA 3LDBA 3H9AA 5FJKA 3AC0A 1QQP2 1H9PA 2CGOA 3R4UA 4I09A 4LO7A 1OFSA 1A8DA 3TEYA 4CDUB 5BNNB 1SLCA 4QPGC 2OXBA 5CU1A 4QXKA 5FP9A 1OOPC 3I8TA 4AGVA 1CAVB 4XIOA 2VCCA 4B1LA 1IG0A 1UOJA 2A6WA 2D40A 2FCUA 1OMIA 2VXRA 2ZABA 1XNAA 4OVEA 1DF0A 4V1PA 4YWAA 1TNFA 4K9SA 5FYZA 4Y1UA 3OPWA 1G6NA 4K1ZA 1RUF1 2VJXA 5DUXA 3DPRC 1PO12 1SEFA 1WBFA 1GZWB 3K4ZA 2VVFA 3ZKUA 4YW5A 4AOCA 5J48A 2XKOA 4RS5C 2X09A 3A23A 3FUQA 4MSVA 1UD1A 2V09A 5C3QA 5GZGA 5IVCA 5J36A 4CUBA 3C8XA 3OY8B 4N9IA 1TME1 5FY9A 3W9AA 4FPOB 4B4QA 5FXVA 5CYYA 3UL2A 3JU9A 2BGPA 3POJA 5C9AC 4OUSA 1VBE1 1VMJA 3EXUA 1XSRA 1AR73 2D3RA 1AR71 2PLV1 3EYPA 4XZUG 2ZOEB 1F31A 5JLVA 4YG6A 1ASJ3 1VBC2 3MLLA 5CNAA 3D0SA 1JZ8A 1OQ1A 5FZMA 5C4WA 2W1QA 1AYM1 5H9SA 3WOGA 2DVAA 3LA7A 3GJAA 4ZONA 2H6CA 4Y5SA 2QJVA 3I2GA 1XU1A 3KCYA 1QDCA 2Y6KA 3I3EA 4OULA 4XF1A 4ITCA 4JGZA 3WHUA 3AP5A 5C3OA 5FY0A 4IV1C 4B7EA 4DEQA 4FTEA 1HKDA 3ZSLA 1GQHA 2PHDA 4LBQD 3QH7A 3VB9A 3VZJA 1RUD2 2VL4A 1I1EA 5T5LA 4ZHNA 2J1AA 1QJU3 1IS4A 2XB6C 5ACA1 2P37A 1KJRA 4M0HA 4GA9A 4CP0A 2JDNA 1V6KA 3K4DA 3BIWE 1YIFA 2OZ6A 2JDYA 2BOIA 3BPSA 1Z7S1 5FZKA 1UXXX 3UKNA 4UBGA 1PGW1 1L7LA 4A6SA 4QKBA 3FBYA 5E89A 3O1TA 1J1LA 1HRV1 4IERA 3E5QA 3W5NA 3RVHA 2G9FA 1WMXA 1NCRA 2WRAA 1QOTA 1MEC1 5DAVA 3DPRB 3AVRA 1GU3A 4Y26A 2YFUA 1H4HA 5FUNA 2DUOA 1ODNA 2GNBA 4Q4X3 1OPMA 5L9RA 4QQ2A 3JCIA 3IAPA 3IAQA 1W6MA 2Q1MA 5KHJA 1OPOA 1Q56A 2YUEA 1LTEA 4P9WA 5T3NA 2OKXA 2EIDA 4NRPA 3E5UA 5A7QA 2GALA 1DIWA 2W1SA 1PZ7A 3SHRA 4ZY9A 1C8M3 3O5SA 4CYDA 1OKQA 4KG8A 2V73A 4P02B 2VY0A 5HPOA 2W94A 5EIYB 2JE9A 5FO9B 1NQDA 5JI7A 5JCTA 1Q8QA 4N8MA 2I07B 4LPLA 5TSWA 5JPNB 2KM2A 1TNRA 1JTZX 4JKMA 3RNSA 3NV4A 2JX9A 1TMF3 1ASJ2 1VBC3 1XOYA 3FUOA 1H1IA 1RUG3 2XHKA 3GJBA 3LEKA 3NNJA 4AQTA 4CXXA 2DU1A 4XFIA 3VKOA 1LJ7A 1ONAA 2JG8B 4Q0QA 4JTNA 1YFXA 2Z4FA 1RUE2 2C5DA 2E51A 3OOXA 4RQPA 3ZN6A 4YZ3A 1QQP1 3ZVXA 4CP2A 3U4XA 5FK8A 4J25A 4CDWC 5JDBA 5FZBA 3TYJA 4BQXA 4RD7A 4KH9A 1PX3A 4IEVA 5FPVA 2UY9A 2EXIA 3WDXA 4TWTA 4DY5A 3OB8A 5CVRA 2WT0A 4QKFA 2DFBA 2UWBA 3MI8A 2GZWA 3WG1A 3POSA 3OGJA 4XJUA 4ET7A 4D94A 1EV13 1Z0HA 4CXWA 4I2OA 1UKGA 1N1YA 2DURA 5J96B 2XJVA 1W04A 4DXSA 2J7MA 5A33A 3PVEA 4CP9B 1S2BA 2DYCA 5EJ3A 3K2OA 3RS6A 1AL22 1D0HA 2YGMA 3HPNA 2AZ5A 3CDZB 4DFSA 3VDCA 5IAVA 5FO7B 1W8WA 1ZZBA 3OPZA 3ZXFA 5FPUA 2C9KA 3U0ZA 4CCCA 1RUE1 1AYM2 3IPVA 1UQXA 5CZKA 1WCKA 1RINA 2W0XA 2V4VA 3H8OA 4FO9A 4IESA 1NXMA 5FOBB 1AYN2 2PLV2 4CDQA 3WG4A 3H1MA 5E16A 1RB8G 4FTSA 5FZDA 4FQZA 5T50A 2JEMA 4EZHA 2DTYA 4HMZA 3H1WA 4A7YA 4AHWA 2VZOA 4JGZC 4L97A 5IK7A 1R64A 4FP2A 3FX3A 3KM5A 2B8MA 1ZRCA 4QX7A 3W20A 4DXRA 1F4AA 4AI2A 1G9BA 1CAUB 2R30A 1IPSA 1R092 3RZZA 1W6PB 1W8NA 4DB5A 4WM7C 1PVC2 1XQNA 1YO8A 4LEJA 1XNTA 5FY4A 1GOFA 4LULA 2G9GA 3DYMA 3DV8A 3NSTA 3MW3A 4XFHA 1POQA 4YFWA 3RJRA 4PDWC 2AC1A 2P6CA 1H9WA 4KU7A 2R072 1C1LA 1X9TA 2F6BA 1HXS1 2HWE3 2P4EA 3NJXA 5DUVA 2I2SA 5KHGA 4ZS2A 3UKTA 1PGW2 3EMRA 4YFZA 3FLPA 5I0UA 2HBUA 4QT6A 2D3PA 3M3OA 2OUJA 4HL0A 4HT1T 4OMCA 3OBAA 2P3KA 2ZGMA 5L9BA 1RUD1 2W95A 4Q1PA 3VDAA 1OOPB 1H2KA 1XE0A 1O3RA 1JOBA 4JHZA 3ZR5A 3A7QA 3WF0A 4PHZA 1YQCA 3GNEA 2X8KA 1W9SA 3BB6A 2J42A 3CIHA 1DGWX 4UFMA 4BQ3A 3J8F3 2D6NA 3MIBA 3LEIA 2YC2A 1YC61 4I02A 5A7NA 3ZKYA 3T09A 2H6BA 4FOVA 4ISQA 3WINE 4UOJA 1AHSA 5FP8A 5DAXA 3U4SA 3WNLA 2VBDA 4W65A 1OA3A 5FYBA 3B00A 2IXCA 1PIV2 2BNMA 3CZUA 4OYUA 4QKDA 2ZGKA 4R9AA 2K9ZA 3IT8A 2ET7A 1UZ0A 4TTGA 2ZEYA 1PMIA 1LGNA 2WFPA 4DXZA 3T1MA 4JHTA 3MIHA 4NHLA 2WLPA 2VMIA 4BLIA 3OUIA 3AMPA 3USSA 5AVAA 1JXNA 4C0HA 5LK7B 2Z5WA 3NNMA 3LDKA 5FREA 3WQ0A 2IFWA 1PK6A 3OUJA 5CFCC 5LW9A 3O1SA 1DCSA 1NA1C 3C7FA 4LUMA 4NUBA 4MZUA 3VBHC 1WGPA 1HRI2 2ETEA 4JQRA 3BOPA 2ORXA 3BVCA 4BM8A 2WNUA 3VD4A 2BQPA 2D5HA 2ZZQA 3DGTA 1W8OA 1AR61 5L7OC 1W0NA 2UYBA 4K6BA 1GBGA 2O0OA 3NJZA 3T4VA 1RUG1 4WM7B 3NAPA 1ACCA 3VZKA 1PGL1 4BH9A 3VHNA 1LCLA 1HJGA 4WVZA 3UKVA 4FQ4A 3H7YA 4LNVA 5JZGB 3FFZA 3WDTA 1EY2A 4HANA 1NG0A 1W3VA 1N3QA 5EYXA 2BBVA 1V9U3 4ONUA 1CWPA 2XJPA 2G4IA 4LE3A 1T6GC 2Y6HA 1ZM1A 4QX0A 4Q4W1 4P5HA 5T52A 2BWCA 3M3EA 4FXKB 3ZXLA 4CEWB 1MS0A 2VMHA 5FP3A 5T54A 3RZGA 4Y20B 1PNFA 2UWAA 2YGLA 4XHXA 2VVDA 1T2XA 3PIJA 2X5IC 5KHKA 5JXJA 4AQSA 1ULCA 1VMHA 1CAXA 1SLLA 5A6ZA 2W2IA 1ST8A 2QFEA 5LRRA 4ATFA 2DTWA 4HBNA 3TRSB 1CGPA 2WFF3 2XGXA 4YW4A 1O5UA 5JVVA 2JECA 4DZGA 1NQJA 2W46A 3GDBA 3J7HA 1W05A 5FY7A 1EUUA 1YHFA 1WZXA 5FRAA 2IC1A 4CDXA 1JW6A 3URFA 2R49A 2C4XA 1CD3G 1OVPA 2UURA 3KHBA 4FPFA 5F5CA 1Z7S3 4MGZE 2XH6A 4UW5A 4WVMA 4IEYA 3J26N 3AP9A 4COWA 1TQ5A 4Q4Y1 1GWMA 2DUPA 4COZA 4QM8A 3RFRA 4NIHA 4HK9A 3QOPA 5FKCA 1OLRA 4XMIA 4PIXA 2B45X 2WKKA 5A6YA 5HCFA 1UKRA 4PIYA 3CEWA 4XTMA 1GYKA 1UY2A 2A70A 4YM2A 2D6LX 3RYPA 2BWAA 4LO8A 5J37A 4UW4A 4PLNA 1C5IA 3CO2A 4PIZA 4YM0A 3RYKA 1SPPA 1J3QA 2WINB 3HQXA 1HB2A 3IDBB 3ELNA 2WS91 1YFUA 1POV0 2VNVA 1J58A 1T6BX 2EAAA 3VBSA 4ISRA 5AFEA 4NIDA 4BQ5A 2P5BA 5KWRA 2VQTA 1ENSA 2VCBA 2WFF1 1B35A 1NOVA 2ZKNA 1FI2A 3HVDA 3UT0A 1REEA 4URAA 4NMIA 3BYWA 3ZN6B 3WLUA 1EP0A 1BBT2 4NOTA 2QQNA 4Q4V2 2PQSA 2XOMA 2ZMLA 2O1QA 5B4NA 3POIA 5J98B 3LE0A 4Q4X1 2VH9A 5D1IA 2VULA 4JGYA 3WW3A 3DECA 1HJFA 3M4FA 4AQ6A 4COUA 2B5HA 2J1VA 3IM0A 2DDUA 4LBOA 5FLJA 2IVIB 1C1FA 1I6XA 1ENQA 2YB7A 3VBUC 5A32B 2NZ9A 3HNMA 2RVAA 5A33B 1KFUL 3ZYBA 2FQPA 4DEVA 4XDQA 5EYYA 3IZOA 1XSQA 3O1OA 5DDJ1 5IVJA 2QQIA 3NO8A 4QM9A 1S1AA 2ZPXA 5F5IA 2CGNA 1YFWA 2TBVA 3KMHA 4CXYA 3CHXA 3DXTA 4PT6A 3B93A 2V4AA 2OX0A 2ZX2A 4MGYE 5FWEA 4NAOA 1WW4A 2JDAA 4QX1A 4KI5M 5LBBA 3FE5A 4QDSA 4Y22B 1PM7A 3WV6A 4W8JA 1BJQA 4AVCA 4Q0SA 2HWB2 1UY0A 1QH7A 2D6KA 1K5MC 1RUG2 1WCQA 2ARXA 2XJRA 3HAGA 4Y4RA 5K7PA 4YW2A 2WNVC 2FD8A 2XUEA 3AYAA 1NE4A 2QQWA 3GZUC 4D7YA 5FZAA 4DPNA 4MADA 4RR3A 4HLTA 4B4RA 2D7FA 1ND3C 3ZPYA 5I0DA 3CLPA 1ND2C 2R16A 3Q9OA 3LWCA 1R1A2 4HSLA 3S57A 2OPWA 5I8SA 5JXGA 1OVSA 1QJX1 1DQ1A 3AFKA 4A41A 2VZPA 5JR2A 2XJSA 4BLJA 4KMQA 3MPPG 3ZFFA 5JXIA 3HN1A 2WQ4A 1BKZA 4Q1RA 3AK0A 4RS5A 2ZHNA 5C3PA 4K8RB 4PLOA 2Q4SA 2VZTA 5EZWA 1W2UA 3H8RA 5K4LA 4BE3A 4QPWA 3MDPA 1IPJA 1MR5A 3WNXA 2ZX4A 5JIAA 2R073 3U37A 5FZFA 4CVUA 4AK3A 1YLLA 1AJKA 3TAYA 2J1UA 5CA6A 3LPFA 5CADA 3U1XA 2EVXA 1QJFA 1YCIA 4CE8A 4BU2A 1R1A1 4XURA 5KXEA 2VUDA 5KXDA 3VBOA 4LHSA 5E6HA 3L9JT 5DUUA 1W6QA 3OG2A 4FI9A 1VBD1 1J1TA 1NLQA 1MPXA 4GWJA 4C8DA 1DHKB 5ABJB 3VBUB 1G9FA 4JC1A 4NHMA 3OEAA 3ZMOA 5IVYA 3FMGA 1Y9GA 2DVFA 1JYIA 3AJZA 1E5HA 2VBPA 1RJ8A 1LEDA 1PO11 1MS5A 4HSJA 4G4FA 1KDMA 3SEPA 3ZXKA 3FJSA 3RMXA 3O0VA 4D6RA 1ULGA 5FPXA 2RE9A 2VC9A 4CCDA 3VDDC 4HETA 4JX0A 1RL3A 2ZS6B 5FAXA 5LATA 2Y8KA 2A3XA 3OYWB 4N43B 1GSLA 3IN9A 4CDWB 4QU2A 2QQOA 4QU1A 5DABA 4AI8A 3WW4A 3KV6A 5H9RA 3PDQA 3JZVA 4CTEA 2ZAHA 1JYXA 1UYPA 5C70A 3CZJA 3V0AA 2FDJA 2XLFA 2JG8C 1H1AA 1LNSA 2DWRA 5CISA 1S4CA 1GNZA 2RS31 1D4VB 2NMNA 5C8CB 4B4PA 4B7KA 1OA4A 2WAOA 3VZOA 5C6CA 1W39A 1X8MA 2VTXA 3VBOC 2FCTA 2WNUB 4HPKA 3Q8FA 4LLFA 4Q0PA 5EHDA 4WVWA 2F17A 3MFCA 4ZXKA 5FP7A 2RMU2 3FFQA 2RMU3 5KXCA 2E9QA 4UI9L 1CESA 4CU7A 2AYHA 1SHWB 5J1XA 3ABZA 3J4UH 4LHLA 4FPKA 3TBDA 5I0TA 5CAZA 1W0OA 5F8PA 2VZ3A 1MQTC 2QQMA 3VL9A 5GZEA 4O65A 3ZFEA 1JZ7A 4BPZA 3HQUA 5C9AA 2VR4A 1U5IA 1VIWB 2PHWA 4G9SB 4B29A 3O0WA 2VPVA 4MGIE 1H2MA 2WNUC 4AVAA 3FZ3A 3WP4A 5FY1A 3VKLA 1FOD3 5IJRA 3ZSKA 2P1BA 3GZAA 5FLHA 2Z42A 4LO4B 1AXZA 1H2NA 1FPN2 3CQOA 5ANNA 4H7LA 1K45A 4XCAA 3OF1A 4NAMA 5HCHA 5H9QA 3C3VA 3IB3A 5JZGA 3P5BA 4IEQA 4NROA 2P17A 1RUH2 1S0EA 2RR11 4YG3A 1JYNA 5FPZA 4I3PA 1LAJA 4EN6B 4YW7A 4RYDA 3WDUA 4U2AA 1RJ7A 1XXNA 5FYVA 5T55A 1NYWA 2I45A 4IEUA 1GNYA 4XUOA 4CEWA 4KQ7A 3MF6A 4WZFA 2B42B 2Y60A 4FVVA 4PQQA 4WVMB 5FO8B 1POV3 2IXKA 4P9JA 2KA3A 1CAXB 1SFYA 1LB2A 1I9RA 4RHV2 4GIQA 2XONA 3E5XA 4A3ZA 4D69A 1OF4A 3CMGA 4YLZA 3WF3A 5AC92 2PHUA 1GOGA 5F5QA 2HEVF 2RV9A 1UU6A 2P3YA 4P9LA 1SBDA 2ZGUA 3E1F1 3H8UA 5HI0A 1NCRC 1I5ZA 3ZSEA 1MEC2 3GZEA 1MEC3 1XE8A 2IXLA 1EUTA 1FT9A 2GNDA 5HV4A 4DUXA 5JMCA 1V6MA 5FYSA 2ZEWA 4QPIB 3OBTA 1LOCA 5BNPC 3BOWA 1ZZ8A 1NAEA 5ISLA 4XAEA 2XHNA 2DV9A 5D8AA 1ZZCA 2QDNA 3ATGA 1EV11 3UGGA 3WD5A 3M70A 1B35B 4W6YA 1I5PA 4BCUA 3AX4A 4PCRA 1W9FA 3VD9A 5A1LA 5KHIA 3GHMA 4I0WB 4QX3A 3O1UA 1J3PA 2VCMA 3E6BA 1ND3A 4A42A 4BISA 1XB9A 4F8AA 2ZX0A 3DUIA 3D5OA 4Q2FA 3VBRB 1I3HA 2P3IA 2PHXA 4LBJA 2A5ZA 2JDZA 1E5IA 1PIV3 1MQTB 4QXBA 3VBSB 2D5FA 2GN3A 1DP0A 2QQLA 3I54A 2IWGB 4LKFA 4OZOA 4DY3A 4XF0A 5A3UA 3LB9A 5GM0A 5I93A 1B35C 1GFF2 1RUH3 1XRUA 2CDOA 2RS32 3MYXA 4P9GA 4YG0A 4LOSA 3QACA 3K77A 4Z2AA 4FFHA 4EN0A 1D2SA 5BUVA 1LU1A 2FZ1A 3PTYA 4WV8A 3TNQA 1CZTA 4FP3A 5A7WB 3S7EA 1LHUA 4OZXA 5EJ1B 3BPZA 1Q43A 2UWCA 4LTAA 1E5RA 5DZFA 1W2OA 2X5IA 4I30A 3I3DA 2OZJA 4W6XA 3GBWA 4LITA 2WSUA 3FBMA 3ZSMA 4Y22A 1SLAA 1O8PA 4IGOA 4KWLA 4R4XA 3DF0A 4IV1B 4M01A 1ZBE2 1CJDA 1UZWA 1XNDA 1L3JA 3GM8A 4W4ZA 3TEXA 4ZU4A 1JHJA 1UCXA 4XUPA 2BVBA 5F3CA 2WC2A 1BEV3 4CDQC 1OD3A 4ZZ8A 2CV6A 1UZZA 1S0JA 2YZ4A 5IVFA 5CFDC 2VMDA 2YU1A 2A73B 4LLOA 5C3SA 5BYNA 2ZGSA 2D6PA 1YRZA 3IDEA 5IW0A 1FNYA 5T5OA 1X7NA 2HLEA 1OXCA 3KVAA 1WMEA 4TN7A 3RWNA 1S2EA 1C5HA 3PUSA 4QB1A 3ETQA 1VBD3 2OS2A 3MO4A 2OIIA 3WNPA 2NM1A 3GBGA 4X6RB 3LCPA 1DZQA 2RS13 5C5UA 3UK9A 1WW7A 5FZOB 1QJU1 4QHOA 5FPAA 5A70A 4AI0A 1BBT1 4D6SA 1F2NA 3ASIA 2IVJA 3D6EA 4IEWA 4QHBA 4M3CB 4SLIA 2VQ0A 1RUI2 3LA3A 1ND2A 2E63A 1K12A 1JUIA 4AEDB 1IOAA 4XMAA 2PAEA 2VUAA 1EYBA 3GCWA 2JDPA 1QGLA 1UOBA 1OA2A 2RDSA 2BFUL 4PBOA 4XXAA 4OI2A 1AYM3 3OBZA 4IEPA 4Z1VA 5BNNC 1LKNA 1Z7S2 1KDKA 2BW8A 5CKMA 4AXOA 2E53A 1AL23 5DZGA 4Q0UA 4A4AA 1NE6A 3CJXA 2WLQA 4N90A 5ABJA
chains in the Genus database with same CATH topology
3QH6A 1LR5A 1GV9A 2PHFA 5BNOA 4FSJA 4L8QA 3PVOA 2E7AA 4YW1A 1PZ8A 3AZWA 1PHMA 1ULDA 1TMF1 2ZMKA 3USUA 3VBOB 3B5LB 1ZBA3 2XG3A 3K51A 2GC2A 4FPLA 3POWA 1QJY2 2R061 3EJKA 5GLTA 1ZRFA 1LECA 1BVP1 2NN8A 2C9AA 3IBMA 3KZ4C 2NPIA 1ASJ1 2XKPA 1AUYA 1F8VA 4FAGA 1CAWA 1AR62 3GF6A 4N43C 4LHKA 5C8CA 1KD7A 3AYDA 3U10A 4FOYA 4NO4A 3PJYA 1RTVA 4BMEA 1R081 4AGRA 2W68A 2ZGRA 2R6QA 1LU2A 2XWJB 1HDKA 4PDWB 3N4MA 2HYKA 4XYXA 1DQ2A 2DU0A 2HWF2 3MLJA 2PA7A 5H9PA 4GMP0 3S0MA 3HIFA 3RPQA 1OHFA 4KU8A 3ZFEB 4A2UA 5HCAA 1WMDA 4Q0VA 5A3MA 5C9AB 5JOYA 4YZ2A 5FQ0A 3AP4A 1FV2A 3FWEA 3ZFFC 4B8EA 4K20A 4P9YA 3MIEA 1QHDA 1AF9A 4AVTA 5FFOC 1MZFA 2ZBJA 1CJPA 1YWKA 1QNWA 3I7DA 4EN7B 5J3UA 1ALYA 2LALA 4L9BA 2BPA2 3B9IA 5C8CC 1WCDJ 2AR6A 4E2SA 2ZX1A 3ZMNA 2E6VA 1JHNA 4COYA 4QGNA 4ES8A 1V00A 1RHI1 2Q0AA 4AW7A 1VLNA 4XETA 4CEYB 3JD72 1DQ4A 1AR72 5K8SA 4F3JA 3LGRA 4E2QA 1RVF2 2GC1A 4E4SA 5F6KA 1H2LA 1W6NA 5AC93 5J09A 3EQEA 4INDA 4XZPA 2RM22 4NWVA 4J1WA 1TME2 3VDDA 3ZIWA 2GMEA 4CYDA 5JR7B 1E57A 4CDXC 1QJY3 4OI1A 3MF9A 2JG9B 1VBC1 1DQ0A 4GULA 2IXIA 4SBVA 3O12A 4R52A 4Q4V1 1FNZA 2B46X 2TNFA 5D8AB 4R9DA 2LM3A 2C0ZA 3FC0A 3SITA 4OI4A 1RGSA 3M7AA 2R0FA 4Q4W3 4XQDA 3PNAA 2Q8OA 3ZFGA 3CJIB 1RUC2 2ZX3A 3FHIB 3NAPC 4KGQA 4LHNA 4J6GA 1VB2A 4MGKE 3VBSC 1MQTA 3O14A 1SACA 1W6OA 1V9U1 2ARBA 2CY6A 3U07A 3LOBA 1ENRA 4UW6A 1TEIA 2E7QA 1XE7A 2X29A 4HVOA 1BMV1 3WY6A 2Z79A 2H0VA 4N7UA 1ND3B 5CB7A 3EO6A 5CBLA 2EA7A 5JSRA 4XILA 4L2NA 2R041 1CX4A 5IK4A 5BNPB 3KLSA 3VN4A 1GZCA 1G9DA 1O3SA 4HN0A 3WCSA 1SQ4A 4AI1A 1WD3A 1QJX3 4R4ZA 4XFCA 5L19A 1SLTA 3ZXJA 1AZDA 2JICA 4IV3A 1ULFA 1G8WA 2H0BA 1FX5A 2JG9C 3N7KA 5KHHA 3ILNA 2X5IB 1VRH3 1VBA2 3ZDSA 2WZR1 2D98A 5JPMB 4XJ9A 5ABJC 1R082 3U11A 1BEV2 1LHNA 1YXWA 2HWB1 4YM3A 2I74A 2CAVA 3CNAA 1S0FA 2WSVA 1LHOA 4FCAA 2VOWA 5GLZA 1RHI3 4LBLA 2DCYA 2PELA 3THTA 1YJKA 1RUC3 1UMZA 2EXKA 4TZDA 1AR92 4NN0A 4EROA 1RUD3 2JXAA 5BPXA 1CONA 4C90A 3N7JA 1SBEA 4DNYA 1EAH1 4GB31 3OCPA 3JQXA 2D3SA 3NV1A 1KS4A 4UBHA 3INAA 2DVDA 4OFGA 3BCWA 5GLVA 1FXZA 1DYKA 3A0KA 1C8M2 1LRHA 4FPCA 4YRDA 1DZRA 3RJ2X 1YFYA 3MIDA 2QKDA 3B3QE 4YNIA 5FLIA 1ND2B 4XTPA 5GLWA 4BWOA 1U5ZA 3VBHB 1KRIA 3D4KA 2JJ6A 2VW1A 2B39A 1VBA1 5GALA 3PLQA 4YVWA 4FTBA 3ZFGC 2VNGA 3N3HA 4XEZA 1R1A3 2TEPA 1F5JA 1C8NA 2HWC3 1H8TB 2ATFA 3VKMA 1D0GA 4E27A 1K5MB 2CAUA 4AE2A 3AB0A 3JBG2 3R6SA 5EV7A 2ERFA 4AEMA 2HWC2 2CWSA 2A6VA 2Z2SB 1DZTA 3M8LA 4ZU5A 3UV9A 2K2SA 1CAWB 2OW4A 3E6DA 3A4UA 4ASLA 1Q8VA 1V70A 1C3HA 1FV3A 5KC5A 4RSUA 3WW2A 4CEWC 5J7MA 1QJU2 2WNVA 3VUOA 4TYSA 4Z2WA 2ZHLA 4ZU7A 4CDUA 1QQP3 4HVRA 4WBBA 2QNKA 4Q4V3 4FPHA 1CAVA 3QD6A 4PDWA 4FPJA 1GANA 1N3OA 3ZYJB 4XPVA 1JH5A 2FMYA 3RSJA 1MZ6A 4RL7A 3S7IA 2GN7A 1S0CA 3OYWA 4N43A 4CDWA 4R8HA 2ZGNA 1CQ9A 4QMAA 3VLBB 4AEJA 5K0UB 4MX3A 3RYRA 3H0OA 4K40A 3M3IA 2RS51 4JDNA 5C33A 1A3KA 1GLHA 1ZNPA 4IXLA 4XFFA 3H3UA 2P3JA 4QQLA 4Y1VA 2DCKA 3GALA 2VECA 4HPKB 4JDMA 4EN9B 4DRRA 2FBEA 3ZN5A 4LUKA 1IGOA 3GZTB 4S2HA 4FPYA 1XYOA 1AX0A 1GICA 3NVCA 1NCQB 5DXDA 2CNAA 3QBQA 3ST7A 2CGPA 4OLLA 3M1HA 1VRH2 4XXPA 3WP6A 3OY8A 2D6OX 4LBQA 4H7MA 2XLGA 3PHMA 2HWE1 4LBMA 3E6CC 3VBFC 4BHPA 1R083 5JSPA 2DUQA 2PFWA 4AVSA 2YDEA 1RHI2 2PHLA 3CF6E 1VJ2A 5IUQA 2D6MA 5CFDB 3M2MA 5IK5A 1XNBA 4GQ7A 5E8AA 5FMOS 2HWF1 4P9XA 4UXAA 1KITA 1CVNA 2DCJA 3B69A 3SCHA 1VBA3 3WUCA 1BXHA 2AREA 1QXPA 4GB33 1AYN1 2GH8A 2YYOA 4YGCA 5EFUA 3TNPB 1QKQA 1NCRB 2VOVA 2RS12 3KGLA 3VDDB 2WFF2 1YJLA 1OI6A 4IV3C 4XJAA 3ZFGB 4FPEA 4GB32 1S55A 2ZACA 4XBQA 1UF2C 2SLIA 1HQWA 4LE4A 3M3CA 4IEZA 3ZFEC 4A7ZA 1VBB1 1W6OB 4W6WA 1R1ZA 3IIAA 4IEXA 3S30A 4XF4A 4GKYA 2A3WA 5F9TA 1NZCA 4HKLA 1O4TA 4KG0A 1NY71 4AF9A 2HWC1 3AKTA 1D2QA 1W6MB 4LO5B 4N53B 3CJIA 3VGIA 2RMU1 4CZSA 3VHPA 1PO21 4S2DA 5JOWA 4L92A 1AL21 3HMYA 2GMMA 1Q8SA 5JIUA 1EAH2 4Z8BA 2ZJCA 1TME3 1YI9A 5JWPA 3VBRA 2D44A 5I91A 1KFXL 2VW2A 1G9AA 3ZYRA 2HWF3 1DQ6A 3T2TA 4AGGA 1X82A 2JG8A 4LT5A 4META 4YYOA 4YGEA 1YI7A 4K1YA 3M3QA 1ZX5A 1S0DA 2BGCA 4CRQA 4JDOA 1LHVA 2QZ2A 3VV1A 2ENRA 1SMVA 2PN5A 4AFMA 4IV3B 3PJQA 4Z82A 1JN2P 3RQ0A 2WWSA 3V65A 5I8TA 3GYDA 1AR93 3JBG1 1HW5A 3SH5A 2NYYA 3J8F2 4WM8A 1RITA 3VBFA 2LTNA 4D7TA 4FOWA 2Y0IA 2B9UA 3VZNA 2HKXA 1LOEA 2WZR3 1KQRA 3AYEA 2ZGLA 3H50A 4ES9A 3IPVB 1CAUA 4XBNA 1X8EA 5LEKA 2WZR2 2PQQA 3K48A 4RHV3 4MUVA 2CTVA 1CPMA 4IETA 5JZGC 1LOFA 1LULA 3WP3A 4NHKA 4JAAA 4X6QB 1NXD1 4C0BA 2ZGTA 4WZCA 3THPA 4RGGA 2BNOA 5K0UC 1VRH1 1PVXA 3WDVA 1IS3A 1FPN1 2ZHMA 3D0JA 2VG9A 2DF7A 2WJSA 4AEDA 2MPFA 4Q26A 1TE1B 1K5MA 1OOPA 3NKTA 2JENA 1Z78A 3GBFA 3P3PA 1IS5A 3ECQA 3LSDA 5SV5A 2Y26A 1EV12 2R043 3OBRA 1FATA 2DVBA 2CYFA 1UU4A 1MS3A 4BA6A 3TOJA 1OSGA 3FLRA 1PGSA 4M00A 4HFSA 1O7FA 3PMEA 2EALA 4H14A 4YGDA 4NR1A 1QMJA 4AG4A 1RUF2 5DG2A 3W58A 1RUF3 3SH3A 1UX6A 1HIXA 5IK8A 3KCXA 1O5LA 2E7TA 1M4WA 1PNGA 1O4YA 4QQPA 5E1RA 4AVBA 1NCQC 1XU2A 4D3WA 1R093 3ZN4A 1F9KA 4YGBA 5ACA3 1WLWA 3O7OA 5FCCA 1PK6B 1DDLA 3R4SA 1KXGA 5F6LB 1QXJA 1CIWA 3ES4A 2W39A 1PO23 1DYPA 1RUE3 2R071 2IFRA 2ZA9A 2JD4A 3I59B 2OA2A 3N7LA 3N7MA 1ZYBA 4PBPA 3VL8A 1W0PA 2GC0A 5FQ0B 1VBB3 1LOGA 1WLTA 4MLOA 5FBZA 3VKNA 3ZXEA 1FOD1 4N7IA 3SCFA 5LK5A 5LEJA 1VBE3 1ZA4A 3AZZA 4ZKTB 1RUOA 5L7OB 5T5JA 1DGWA 4IEOA 1UIJA 4RHV1 4O9EA 3WXPA 3CJIC 3NAPB 3WUDA 5L36A 4Q4Y2 1NCQA 5CFDA 4GALA 4COVA 3KT7A 2YC0A 1WMFA 1YIPA 1SCRA 1QY4A 2DFCA 3WX5A 4XFAA 2EAKA 1JOJA 2PAMA 4S2FA 1REFA 2VVEA 4JRAA 1MS1A 3ES1A 4A3XA 1SFNA 1G86A 1OD5A 1XNKA 4Y20A 2BUKA 4J1XA 4YW3A 5K9YA 4JGYC 1JYCA 4JCKA 4CEYA 4NWWA 4HN1A 1AXKA 3VZMA 3WQ1A 1BYHA 5DDJ3 4AFAA 2RS11 3ZXDA 3AFGA 1SDWA 3WCRA 4I3GA 1GKBA 1URXA 2UYAA 1H4GA 3R0RA 3O0XA 1EAH3 1IZ3A 1CR7A 5GZDA 3OD4A 1KJLA 3V64A 4BYYA 1PO13 2LUWA 2HWD2 3T1LA 4MXVA 1BEV1 4TSVA 4CP1A 2AUYA 4UW3A 3JD73 1UAIA 1LOBA 3AYCA 2BVVA 4N9HA 1RMU3 4AYUA 2HWE2 4AVVA 3AZVA 2XVLA 2ES3A 1VALA 1X36A 4RR3C 1AJOA 2DCTA 3N35A 1OLQA 3BALA 3AP6A 3ZSJA 2W52A 4XQ4A 4N53A 3LZZA 3CU7A 4X8NA 4XQWA 5FDBA 1D4M2 1QDOA 1RUJ2 1Y3TA 1NLRA 4DINB 2A7AA 4JGYB 2QE3A 4MH0E 4BQ1A 5KXBA 5BNPA 1MZEA 3AM2A 2XJUA 4YZ1A 4EWAA 1APNA 1WLCA 1BCXA 4WM8B 3WVJA 1Y9QA 4URTA 2KXLA 4KGGA 1QOOA 4KWKA 1HQLA 3JB4C 4RA0A 3KQRA 4EWEA 4HVQA 4CDUC 2WA3A 4HKWA 4H3WA 5EXOA 3SH4A 4I0BA 2D97A 3AKSA 4E9KA 3UJQA 3PVNA 2GMPA 3L2HA 3VHRA 1AR63 1S2KA 4AI3A 1ZREA 3ZO0B 1RMU1 1V6JA 2EF6A 3B9CA 3JB8A 3VBFB 2ZTNA 3P3NA 3AJYA 1UIKA 2YXSA 4FT8A 4GMP3 2D93A 3IMNA 1FMD3 1A6CA 3QLQA 4MXWA 2WIIB 1H1MA 4RR3B 2YMZA 2VUJA 4IL7A 3AKRA 5CFCB 1RUI1 2VOXA 2A3YA 3AP7A 2QUOA 5I0SA 2GNTA 1VAVA 2HEYF 5I0RA 4AFDA 1LOFC 2FHRA 2WS93 1GR3A 3WT3A 1Q8OA 1AVBA 3OGGA 3H3ZA 3NL1A 4PJYA 3ZFFB 2ET1A 4NPRA 1O91A 4JRLA 1PZ9A 4XF9A 4B3NA 3ILRA 3DKWA 4Y24A 3RDIA 1S0IA 1RVF1 3IDCB 3TWIA 4FPGA 4QGLA 4JVAA 1SLIA 2RM21 1UPSA 1PVC1 5FMOL 4C1XA 1H8VA 1N47A 5L73A 4DQAA 1LODA 1H8TA 5JAXA 1FAYA 4AEKA 3J9SA 4Y1YA 1W6QB 2A6YA 1AXYA 4R9CA 4BIFA 4R9BA 4RQPC 1Q5OA 4XE9A 1JBCA 4LR4A 4AHZA 1EPWA 4FBFA 2WNEA 2NLRA 5HCBA 2B7YA 4PF5A 3NV3A 3SCGA 1S0GA 3WR0A 2NQYA 3ZXAC 1AR83 3HR9A 3I59A 1TMF2 3MFAA 4P14A 4XJWA 3APBA 1JUHA 4ATEA 2FMDA 2R1DA 1D4M1 2WZPP 1H30A 1QOSA 4JTOA 5GZCA 1AR91 3JBG3 1BQPA 1LENA 3KT4A 4BZ4A 1ZZ7A 2W08A 5K0UA 4LO6B 4EN8B 2GH2A 2OUHA 4M3CF 3SMHA 5L7OA 1H0BA 2EXHA 4KL1A 4GWNA 4DMIA 1QXRA 3WHTA 2BFUS 2Y38A 2PAKA 3AXEA 3QCWA 1QH6A 5D8AC 2JKBA 3AKPA 4LA2A 4JGZB 2PHTA 3D82A 3FLTA 1N1TA 1U0AA 1UL9A 2VQAA 2VNOA 5FTTC 3HT1A 3I4IA 2ZMNA 2ILMA 3BTAA 4P9IA 3RRDA 1RIRA 1ZZ6A 3MPBA 4Q29A 3OD0A 4LBQB 1IKPA 1OFNA 4XOGA 3MIFA 2BNNA 3LKJA 2PTMA 4WVVA 2HWB3 1YUDA 2ZGPA 1C28A 5CG9A 4ASMB 1S0BA 4FOQA 1Q3EA 1REDA 1VB4A 1VAMA 1C4RA 1HXS2 3S6PA 3AKQA 1RUH1 2RR12 4F83A 3MEPA 1Y7BA 1PVC3 3H7JA 1PO22 2A75A 2GNMA 1NLSA 1RC6A 3R4DB 4X8PA 3SXWA 3TN92 3VHOA 1M06G 2VW0A 1BBT3 4HZFA 4OHXA 4HK8A 3DN7A 1R091 2GU9A 5GZFA 4KNCA 4YVWC 3D8CA 1F5FA 3JD71 4DS0A 3KB5A 5FOJB 1UPIA 3ZYIB 3ZYPA 1H8TC 2IXJA 3EBRA 3ZYGA 4QPIA 2Z69A 1D4M3 2PHRA 4GWMA 4OI0A 4YARA 3KSCA 3LOIA 2ZCWA 2RS52 3BU7A 1AR81 3AMNA 4YZ5A 1V6OA 2C1FA 4RQPB 1UN1A 5LRSA 1UW8A 2V5YA 2A6XA 3WDWA 1HRV2 3VBRC 4E4ZA 4MV2A 2ZGOA 2BYVE 2R0HA 4YM1A 1NA1A 3VKFC 2QZ3A 1QF3A 1G9CA 4IV1A 1BMV2 2WL1A 1QJZA 3OTFA 1WCSA 1DU3D 3PVBB 1HLCA 3N36A 3B02A 1MVQA 3I2DA 4AHYA 1HV0A 3RG0A 4GH4A 2FZ2A 1DGRN 4BIOA 3ALQA 4QQHA 1RUC1 1HX6A 2ZGQA 2Q1ZB 2QDRA 4LBKA 4YVSA 2VGDA 2AENA 2R1BA 4XF3A 3JQWA 5BV6A 1X50A 1HRI3 1N1SA 1QU0A 1AR82 3ZX7A 1B09A 2YHJA 4Y1ZA 4Y5Z0 2RM23 3HBZA 5DUWA 4F7ZA 4K3UA 1RVF3 2WT1A 4G3YC 5HXVA 1J3RA 1C57A 1N3PA 1WW5A 2A71A 4XIKA 2F4PA 4L11A 3NKGA 4Y4YA 4AQ2A 4DRVA 1XYPA 2IXHA 3ZXGA 3C2UA 2HEWF 2BTVC 2A6ZA 1MZ5A 1COV2 4BOWA 3R05A 3SNMA 1V6IA 4M3CA 3WG2A 3AMQA 3G7DA 4GXLA 1PK6C 2XVKA 4PQ9A 4AEDC 5C8WA 5CFCA 3KT1A 5BNOB 4PLMA 4HKOA 4YVSC 4D7SA 2YY1A 3H1YA 3NWKA 4XHBA 3SLIA 2GDFA 4OHVA 3LAGA 4C91A 1WLDA 5KBFA 1FMD1 3E97A 2DCZA 3GHNA 2MHFA 4S2GA 4QPGB 1LHWA 1C8M1 1YNAA 4JV4A 4K21A 1AX1A 2HWD3 1U12A 1NY72 2R32A 2VU9A 1A78A 1SCSA 1GZ9A 4E4DX 3WDYA 4WM8C 3ZIXA 2XJTA 3NW4A 5SV8A 4H55A 4NVPA 4Q27A 1A8MA 3RMYA 3MIGA 2XJQA 3TN91 1CPNA 3WQ7A 5I8YA 3USUB 5GKAC 4Q4Y3 3X29B 3ILFA 4O9GA 4RFT0 2AH2A 1ZBE1 4LBNA 1VBE2 2ZHKA 1WW6A 2D43A 3AZYA 1CN1A 4M0NA 1VBB2 2UY8A 4EJRA 5IT6A 1DG6A 1UU5A 2Y0OA 4QQOA 1GZWA 5JOXA 2VNRA 5BNNA 3WW1A 2AGSA 4MVTA 5B2GB 4WM7A 2EXJA 4AFBA 4KBBA 5BNOC 1AYN3 1HQNA 4A7KA 1BVVA 5HBAA 1MS9A 2DVGA 3WG3A 4XFGA 5ACA2 4AFCA 4EWDA 1ULEA 1VR3A 1IPKA 1DLLA 4C1WA 2GAUA 2HJIA 4YSFA 3G6JB 2PLV3 2P34A 2OPKA 1U5XA 2ZAAA 2Q5TA 2N7GA 3NV2A 4QPIC 1QNYA 1BZWA 1POV1 2XL9A 2PYTA 5C4WB 1DBNA 3V56A 3AXDA 3MW2A 2XBO3 2XPJA 4Z07A 4CDXB 5GJ6A 4OHWA 3BODA 2R042 5E88A 1VBD2 4OHZA 1EPZA 2RR13 4K7JA 3POYA 4CEYC 1V6NA 2OYZA 1LESA 1RUJ1 4AWDA 4GMP1 4XFBA 3AMHA 1DFQA 2SBAA 4KWJA 1W6NB 1ZZ9A 3DPRA 2RS53 1LOAA 5F1RA 4Q4W2 1BK1A 3IKWA 4QPYA 4RGAA 1SLBA 1V9U2 2EIGA 2Q30A 4U36A 3WZ1A 5A3LA 2JG9A 2QVSB 1VP6A 3ENRA 1GQGA 1ZRRA 1V6LA 5KC6A 3UJOA 2R063 2VMGA 1HV1A 1LEMA 2OVUA 3AMMA 3MW4A 3L2YA 3MZHA 4QD2A 4FXGB 1ENXA 2XUMA 4OUMA 1O3TA 3HWJA 1COV3 1DQ5A 1UZYA 2NP0A 1ZRDA 5C4WC 1KS5A 4ORFA 3HT2A 3MLKA 2QQPA 5AC91 3VZLA 2XL7A 1WA4A 2RS33 1HXS3 2MNGA 3B94A 2O8QA 3AZXA 4LA3A 4DOUA 5JOZA 1LGBA 2XWBB 1NA1B 2RHPA 5A32A 3KGZA 1ZVFA 4I01A 2O8OA 4Q4X2 5GLUA 5BXXA 2MEV2 3V0BB 1O3QA 2QCSB 3ACLA 1WUVA 1ZBE3 2YPJA 2CWMA 1Q8PA 4BMBA 5JSOA 2ZKLA 3DL3A 4AHXA 5AVPA 1AL0G 1GNHA 2MEV3 4GH4B 4QGMA 1SBFA 1O4ZA 2YV8A 3A0NA 4GKXA 1RMU2 2X53S 3MICA 1MS8A 4QX5A 2RJLA 5BNQA 1N1VA 1XNCA 2BEOA 2YROA 1XYNA 2XVGA 1DGRA 1MVEA 2IZWA 1YYNA 4CDQB 2VOKA 2XLAA 5DZEA 3CL1A 1WD4A 4GH4C 5EWSA 2XBO1 3JUUA 3LA2A 2ZZJA 2WS92 2GSYA 3TB0A 4EV0A 3EHKA 1FOD2 1OQDA 3PMSA 5DG1A 4FAHA 4YVSB 3MGUA 1VAKA 5DDJ2 1QJY1 2R062 1W6PA 1QWRA 3ROUA 1RUNA 1X33A 1FYUA 2UU8A 4Z92B 3HD8B 3SISA 3IWZA 1DGLA 1U5YA 4RS5B 4E2GA 3KS7A 2MEV1 5T5PA 2WA4A 4N53C 1J59A 1MS4A 2K0GA 3VBHA 1HRV3 2RJKA 1Y43B 4MXWB 1FPN3 2XBO2 4XJZA 4IQPA 1G7YA 1LGCA 1ZBA2 4Q8LA 3W59A 1ZBA1 2NMOA 4K8FA 4XW3A 2TUNA 1IKQA 2CL2A 4QPGA 3WP5A 1PIV1 4L99A 1QJX2 2WT2A 3B7MA 1HRI1 4M3CE 3OJBA 1FMD2 2P2KA 3VBUA 1WBLA 3ME2A 3J8F1 1AX2A 1COV1 2GC3A 1PGL2 4YVWB 2WQZC 4Q8KA 5CG8A 2WNVB 4Y1XA 4YZ4A 5BY5A 1OQEA 2HWD1 4XBLA 4MYEA 3B01A 5JI9A 1IS6A 2JE7A 4OHYA 4TLFA 3RI8A 3KD4A 3LSEA 1RUJ3 1IHMA 3TN93 3RI9A 5AFBA 3KCCA 1RUI3 3V0AB 4I0AA 4XJ8A 5CIRA 1MACA 1IQAA 3H9AA 1QQP2 1H9PA 2CGOA 3R4UA 4I09A 4LO7A 1OFSA 1A8DA 4CDUB 5BNNB 1SLCA 4QPGC 5CU1A 4QXKA 1OOPC 3I8TA 4AGVA 1CAVB 4XIOA 2A6WA 2D40A 4OVEA 1OMIA 2VXRA 2ZABA 4V1PA 1DF0A 1TNFA 4K9SA 4Y1UA 4K1ZA 1G6NA 1RUF1 5DUXA 3DPRC 1PO12 1SEFA 1WBFA 1GZWB 5J48A 2VVFA 4YW5A 2XKOA 4RS5C 3FUQA 4MSVA 1UD1A 2V09A 5GZGA 5J36A 3OY8B 4N9IA 1TME1 3W9AA 4FPOB 4B4QA 3UL2A 3JU9A 5C9AC 4OUSA 1VBE1 3EXUA 1AR73 2D3RA 1AR71 2PLV1 5JLVA 2ZOEB 1F31A 4YG6A 1ASJ3 1VBC2 3MLLA 5CNAA 3D0SA 1OQ1A 5C4WA 1AYM1 5H9SA 3WOGA 2DVAA 3LA7A 2H6CA 2QJVA 1XU1A 3KCYA 1QDCA 4OULA 4XF1A 4ITCA 4JGZA 3WHUA 3AP5A 4IV1C 4B7EA 4FTEA 1HKDA 3ZSLA 1GQHA 2PHDA 4LBQD 3QH7A 3VZJA 1RUD2 1I1EA 5T5LA 2XB6C 1QJU3 1IS4A 5ACA1 2P37A 1KJRA 4M0HA 4GA9A 4CP0A 1V6KA 3BIWE 1YIFA 2OZ6A 1Z7S1 3UKNA 4UBGA 1PGW1 3FBYA 5E89A 1J1LA 1HRV1 4IERA 3E5QA 2G9FA 1NCRA 1QOTA 1MEC1 3DPRB 4Y26A 1H4HA 2DUOA 2GNBA 4Q4X3 1OPMA 4QQ2A 3JCIA 5KHJA 1W6MA 2Q1MA 1OPOA 1Q56A 2YUEA 1LTEA 4P9WA 5T3NA 3E5UA 2GALA 1DIWA 1PZ7A 3SHRA 1C8M3 3O5SA 1OKQA 4KG8A 2V73A 2VY0A 2JE9A 5FO9B 1NQDA 5JI7A 5JCTA 1Q8QA 2I07B 5TSWA 5JPNB 2KM2A 1TNRA 1JTZX 3RNSA 3NV4A 2JX9A 1TMF3 1ASJ2 1VBC3 3V0BA 3FUOA 1H1IA 1RUG3 2XHKA 4AQTA 2DU1A 4XFIA 3VKOA 1LJ7A 1ONAA 2JG8B 4Q0QA 4JTNA 1YFXA 1RUE2 2C5DA 2E51A 4RQPA 3ZN6A 4YZ3A 1QQP1 3ZVXA 4CP2A 3U4XA 4CDWC 5JDBA 3TYJA 4RD7A 4KH9A 4IEVA 2UY9A 2EXIA 3WDXA 4TWTA 4DY5A 5CVRA 2WT0A 2DFBA 2UWBA 3MI8A 2GZWA 3WG1A 3POSA 3OGJA 4XJUA 4D94A 1EV13 1Z0HA 4I2OA 1UKGA 1N1YA 2DURA 5J96B 2XJVA 5A33A 3PVEA 1S2BA 2DYCA 5EJ3A 3RS6A 1AL22 1D0HA 2YGMA 2AZ5A 4DFSA 5FO7B 1ZZBA 3OPZA 3ZXFA 3U0ZA 1RUE1 1AYM2 3IPVA 1WCKA 1RINA 2W0XA 4FO9A 4IESA 1NXMA 5FOBB 1AYN2 2PLV2 4CDQA 3WG4A 3H1MA 5E16A 1RB8G 4FTSA 4FQZA 5T50A 2JEMA 2DTYA 4HMZA 3H1WA 4A7YA 4AHWA 4JGZC 4L97A 5IK7A 4FP2A 3FX3A 3KM5A 2B8MA