5GZFA

Galectin-8 n-terminal domain carbohydrate recognition domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-8
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzfA00
3RMXA 3R4SA 3UK9A 4TZDA 2PHFA 2A3YA 5IUQA 2GMPA 5CB7A 2FMDA 4ITCA 2ZGUA 2PHTA 2ENRA 1ZM1A 3ZXKA 4AWDA 1SBDA 1SLTA 3POSA 1R1ZA 1ULFA 3D4KA 2P3KA 5CAZA 3MEPA 5IK5A 4WV8A 3B69A 4ZKTB 3TB0A 1N1YA 3IM0A 1A3KA 4XBQA 5T5PA 1GBGA 4YW2A 3WDVA 1FX5A 1J1TA 1MZ6A 2R1DA 3M2MA 3WG4A 4XBNA 1X50A 1F5FA 3SH3A 1CONA 3FLTA 4XE9A 1UL9A 1Q8QA 4DFSA 1QGLA 4M3CB 4WVVA 3ZXLA 4OZXA 2GN3A 2P34A 4LBQB 3V0AA 1GZCA 1ENSA 3R4UA 1MS1A 2XB6C 4BOWA 3ILNA 1GV9A 4YZ3A 1VAVA 1DLLA 1LJ7A 1LGBA 2C9AA 2Q5TA 3KQRA 1YIFA 2VW1A 3D5OA 2WT2A 1G86A 4RL7A 4XJZA 1YXWA 5T5LA 2R49A 4XJUA 1NLSA 1UKGA 1URXA 1BYHA 3DUIA 1LENA 3UJOA 5KXDA 2D3PA 3NV2A 5FREA 4HL0A 5HCBA 3T2TA 3WDWA 4DPNA 3V0BB 4Y24A 5CBLA 4UW6A 4XILA 2NM1A 3B01A 4YM2A 1QF3A 3N7MA 3ZSLA 1W6OB 4YW5A 2DVDA 3IKWA 1N1VA 4PCRA 4FOQA 1DQ1A 5JLVA 3AK0A 3RSJA 3OY8A 3KM5A 3I4IA 4U36A 2ZHMA 1SACA 2JKBA 4R9AA 1DGLA 4WZFA 3M3OA 1HQWA 1AXZA 1H9WA 2ZGQA 4F83A 4XTMA 1JYCA 4YM0A 1LOFC 1ENRA 1LTEA 2CTVA 4PQ9A 1IKPA 3N7LA 1IKQA 2PHUA 2ZKNA 3N3HA 4YZ1A 3VV1A 2EIGA 1H9PA 1LECA 5DXDA 1WBLA 3WDTA 1LHWA 2GNTA 1GZWA 3PVNA 1C4RA 3N36A 4TYSA 1UN1A 2A6VA 1LODA 4AVTA 4BMEA 4AGRA 4Z8BA 2AH2A 2AYHA 3FFZA 1KDKA 3M3CA 4P9XA 1RITA 2W08A 3BODA 3WV6A 1AJOA 3A4UA 2P37A 5LK5A 1DHKB 4NO4A 4Q2FA 1A78A 2D6PA 3AJYA 4U2AA 4HANA 1LHUA 4Y20A 2ZBJA 3I8TA 2D6OX 4Y1UA 3PJQA 4FPCA 4P9YA 2W52A 1KDMA 2WSVA 3L2YA 1SLBA 3NV1A 2A6ZA 2VUAA 2ZZJA 2AREA 1HKDA 5F9TA 3ENRA 2D3SA 5HCFA 3WCRA 4R9CA 3VKFC 1GSLA 3U4XA 4GXLA 5IK8A 5HCAA 2D43A 5IT6A 3MW2A 3WHTA 2B7YA 1NXD1 4K1YA 1FYUA 3ZXJA 3W59A 1QNWA 1QKQA 2A3XA 4R9DA 1LU2A 1D2SA 3AZXA 3USUA 4RA0A 4DS0A 1N3PA 4YGCA 2YV8A 4M3CE 2GMMA 1ULGA 1BXHA 1CESA 5SV8A 5KXEA 1LOGA 4XMAA 5JOWA 1VALA 4JRAA 2CY6A 1ZA4A 3NWKA 1W6MA 4IQPA 5AVAA 3T1LA 4LBKA 2E7QA 1AZDA 1Q56A 1QDOA 4LBNA 2ZGOA 1N47A 3V0BA 1DQ6A 2C5DA 2YY1A 1V6NA 2YROA 4FPFA 3H0OA 4Y1XA 5H9PA 2GNMA 4FPLA 2D44A 3HN1A 5H9RA 1JYIA 3AX4A 5KXBA 3NV4A 1QOSA 2OUJA 4FPKA 1JXNA 3OY8B 2A6WA 1SFYA 2DVGA 4LBJA 4K1ZA 3BTAA 3V0AB 3M1HA 3AP4A 3RG0A 2DTYA 1C1FA 5KXCA 1AF9A 2DVFA 2XG3A 1ULDA 2LALA 4ISQA 4P14A 2OW4A 3VKOA 2DUQA 2GN7A 3B00A 5CA6A 3OBRA 1UX6A 2A71A 3PVOA 5DUWA 1BQPA 1CQ9A 1GZWB 2G4IA 5T5JA 4YZ5A 1W0OA 1WCSA 1Q8SA 1MR5A 1W0PA 1G9AA 1O4YA 1FAYA 4FQ4A 4CRQA 4L8QA 5EYYA 3RQ0A 4UW4A 1DFQA 2PHRA 4YM1A 2PHXA 1UPSA 4BPZA 3V64A 2A75A 4XHXA 1GNZA 2ZHLA 2DTWA 1H30A 2A7AA 2HYKA 2P3IA 3OYWA 2D6KA 1YYNA 5GZFA 3FLPA 5DUVA 2JD4A 3ZSMA 2A6YA 3CNAA 3VKNA 3GNEA 4FOVA 4CTEA 2CYFA 4AVVA 2W39A 1KRIA 3ZXEA 4LBOA 2KM2A 2DU1A 2D7FA 3ZSJA 1W6NA 1ULEA 1WD3A 3AZYA 2H0BA 1V6LA 5EXOA 4ZXKA 2YZ4A 4DRRA 1SBFA 4NOTA 1LOBA 2ZHKA 1GZ9A 3ILRA 4ATEA 2AUYA 1WW4A 1U0AA 1WW6A 4FPHA 4YZ2A 1AXYA 3AP6A 1DIWA 1DZQA 3JU9A 3USUB 2R1BA 2JJ6A 4GWMA 1WLWA 5L73A 5T55A 1JHNA 2E7TA 3LCPA 1SBEA 4XMIA 5DZEA 1WLCA 2ZGNA 3APBA 4ATFA 3IMNA 1ONAA 2EXKA 4GA9A 3SNMA 4BM8A 1N1TA 4GKXA 5GZCA 4AYUA 2A70A 5GZEA 4YFWA 3RMYA 3SISA 1KJRA 5JVVA 1WBFA 1IS3A 1AX2A 1S0GA 3WOGA 3R05A 2EXJA 1LGCA 2JE9A 3N35A 2EALA 3OBTA 1QOOA 4Q27A 4Y20B 2ZGPA 1IS6A 1PZ8A 3AZVA 1YRZA 3WZ1A 4C1XA 1RIRA 1G9CA 4M01A 3OPZA 4AVSA 5JOXA 4YW1A 3UJQA 1CVNA 2ZACA 1C1LA 1LHOA 4FPYA 2NP0A 1LEDA 3O0XA 2GMEA 1GICA 4Y1VA 1CIWA 2PHWA 2AENA 2YMZA 1KQRA 4DQAA 3VUOA 2EF6A 4FP3A 4XTPA 5GZGA 4BLIA 4YGBA 4ASMB 3ATGA 1B09A 2R0FA 3RS6A 1V00A 1S0JA 1MS4A 2AR6A 5GLVA 4XIOA 1V6IA 3T1MA 1VAMA 5GALA 1SCSA 1S0CA 3BOPA 1WUVA 2W68A 5GM0A 4XXPA 3WUCA 3AYAA 2CNAA 5JOYA 3D6EA 2D6MA 1S0EA 4XDQA 4XOGA 1F9KA 2NN8A 2TEPA 3AXDA 1QU0A 5E8AA 1W6MB 1IS5A 2OVUA 1LOFA 3AYDA 3SH4A 3POYA 2DURA 3M3QA 3SITA 2RHPA 2ZGKA 1SLAA 2CL2A 2NYYA 3OYWB 1LCLA 5GLUA 1BKZA 3POWA 1GANA 1HQLA 1LHNA 1FV2A 2R16A 4XYXA 2NMNA 1DQ5A 1F31A 3O12A 1ENQA 3QLQA 4GKYA 3HR9A 3AFKA 4PBOA 3A0NA 2D6LX 3O0VA 2ZA9A 4Y26A 1LOEA 4YLZA 3O5SA 1BZWA 1JBCA 1G9DA 2ARBA 1S1AA 1W6NB 2A3WA 2P2KA 3Q9OA 1RINA 4JC1A 4M00A 2DUPA 2WT0A 3WNXA 1N3OA 1W6QA 3ASIA 4YG0A 1MS8A 1CR7A 3IN9A 5GZDA 2EAKA 4GWNA 5H9SA 4LBLA 3UL2A 4XXAA 1V6JA 1S0FA 2P3JA 4ISRA 3ZSKA 2I2SA 3AP7A 3SLIA 2ARXA 4Q1RA 4FPEA 1WW7A 1Q8PA 1OQ1A 4Q8LA 4XIKA 5H9QA 3B9CA 4YZ4A 5T5OA 1KJLA 1O4ZA 1EPWA 1Z78A 3TAYA 1MS0A 5T52A 5T54A 1GLHA 3ZVXA 3C2UA 4AGGA 1UMZA 2ZMNA 4CZSA 1DYPA 5DZGA 2UWBA 1CPNA 4BQ1A 1IS4A 1W6PB 2UWCA 2E6VA 3IPVA 2JDZA 3DGTA 3A0KA 1UZZA 2NMOA 2WJSA 4YW3A 1LGNA 1BJQA 4FOYA 1S0BA 2ZAAA 3MPPG 1C57A 1IOAA 1JN2P 4WVWA 2YXSA 4PBPA 4Y1YA 2JE7A 1LESA 2BQPA 1JOJA 1MVQA 2ZGLA 4SLIA 4XJ8A 4AGVA 3AP5A 2ZMLA 4FPGA 2Z42A 4XJAA 2DVAA 1DQ0A 1SLLA 1S0DA 4K20A 1DQ2A 1WLDA 2GNDA 3FLRA 1MZ5A 5BYNA 1QMJA 3VKMA 2DV9A 4I30A 4YG6A 4YM3A 3WHUA 4PF5A 3AXEA 1FV3A 4FPJA 4D69A 1DYKA 2CWMA 2UWAA 2V5YA 1GKBA 4XJWA 4H55A 1MS3A 2ZABA 2ZHNA 4M3CF 1MS5A 1YI7A 1OFSA 3AZWA 3N7JA 2UURA 5E89A 1VLNA 1HDKA 2WLQA 5IK4A 1LU1A 3OGGA 2WKKA 1CN1A 2ERFA 5E88A 4M3CA 3ZPYA 1AXKA 3PMEA 3W58A 3MW4A 4FVVA 1VIWB 4GALA 5F5QA 4BMBA 1DQ4A 2JECA 2UU8A 1WW5A 5GLZA 4Q8KA 4FPOB 5EYXA 2D6NA 2LTNA 3LSEA 3M3EA 1Y7BA 4Y22A 1Q8OA 3FUQA 1UZYA 1UAIA 3LSDA 3O0WA 2CWSA 4JCKA 3AYCA 1QNYA 3WCSA 4LBQD 2VU9A 4W65A 1SCRA 4XJ9A 4YW4A 4K21A 1LEMA 5JMCA 2DYCA 3AZZA 3NV3A 2VH9A 4UW5A 3WG2A 4BLJA 3V65A 1JW6A 1XQNA 1YO8A 2E51A 2SLIA 3ZYPA 1ULCA 1G9BA 1SLIA 1DBNA 1GNHA 4Q26A 1KITA 3AP9A 1HLCA 2EXIA 4DRVA 2AGSA 2WT1A 3GALA 1LOAA 2ZGSA 4FP2A 2GNBA 2VW2A 5CNAA 4LBMA 5GJ6A 3SH5A 4YG3A 1GYKA 4MYEA 3WLUA 3OJBA 4XHBA 1W6OA 1FNYA 4C1WA 1A8DA 2D3RA 5GLTA 1Z0HA 2E53A 2VW0A 2WQZC 4LBQA 1AJKA 5DG2A 2DU0A 1FNZA 4P9WA 4YGDA 2ZMKA 3ILFA 1S0IA 1W6QB 2ES3A 4Q1PA 5JOZA 1D0HA 3WDUA 4FQZA 1CJPA 4YFZA 1G9FA 2ZGMA 3INAA 5DUUA 2OUHA 3JUUA 1AX0A 3RRDA 3WG3A 2DUOA 5DZFA 1LHVA 2DVBA 3WDYA 2VY0A 3AJZA 4YGEA 1V6MA 2NZ9A 4R9BA 2SBAA 1AX1A 1Q8VA 1TEIA 2GDFA 4XBLA 4XZPA 1V6KA 5IK7A 1MS9A 3WUDA 1WD4A 3ZXFA 3N7KA 1MACA 2WNEA 1JUIA 1V6OA 2VXRA 1LULA 1I3HA 3WG1A 1N3QA 2EXHA 2A6XA 2ZGTA 1QDCA 3HMYA 3B3QE 2GALA 4FOWA 5GLWA 3ZYRA 4UW3A 3FBYA 3WVJA 1AVBA 2FHRA 1PZ7A 1W6PA 1LOCA 3IPVB 2DWRA 1QOTA 2WSUA 2V73A 2R0HA 3PVEA 1G8WA 3MW3A 5FRAA 5JDBA 1MVEA 5DG1A 3QCWA 4Y1ZA 1CPMA 1OKQA 1PZ9A 3VKLA 2ZGRA 3FUOA 5EWSA 5DUXA 1FATA 1SLCA 3BIWE 2PELA 1G7YA 5T50A 3WDXA 4Y22B 1APNA 1N1SA 1I1EA 2A5ZA 4KBBA 3AYEA
chains in the Genus database with same CATH superfamily
5FYUA 3MUY1 2PHFA 4QPIC 2YPDA 4J25A 2GMPA 4BYYA 5CB7A 2FMDA 2Z69A 5JPMB 2PHTA 2Y0OA 1FXZA 3POJA 3POSA 1S55A 3EB7A 3MDPA 2FQPA 3VBOB 1W8WA 4P5HA 4EZ4A 4IV1B 4M0NA 5CAZA 3MEPA 3B69A 3TB0A 4LOSA 4OCTA 5IVBA 5B2GB 5LBCA 1RVF2 1AR73 2WIIB 4XC9A 3K46A 2FZ1A 3FBMA 1RUI3 3FLTA 1ZBA1 3MV01 1QGLA 1WMFA 1OH3A 2P34A 2PXJA 2PAMA 4SBVA 4OHZA 1ENXA 4RS5B 4B4RA 4NN0A 4PHZA 1YFWA 3V0AA 4HK9A 3ZYJB 3R4UA 2OZ6A 3IIIA 1MS1A 4AFBA 1HJGA 4NWWA 4ZS3A 1GV9A 2ZCWA 1VAVA 3LGRA 2HWC2 1LJ7A 3AMHA 2VZPA 1ST8A 4KWJA 4W8JA 3D5OA 1ZZCA 2WT2A 3D8CA 3MPBA 4RL7A 4DOUA 3MGUA 5FBZA 3TWIA 3ZIXA 1RUE2 1VBD1 1Y3TA 4MGIE 3ZR5A 3IAPA 2CAUA 4KNCA 4GMP3 1IQAA 5KXDA 1NY72 3FHIB 1OVSA 4LULA 5LBBA 3WDWA 5EHDA 3V0BB 1RHI1 2B46X 4UW6A 1YFUA 5F5IA 4XFGA 4AEMA 1F15A 1PM4A 3B01A 4WVMA 3VBHA 1U12A 1KD7A 5K0UA 5C8CA 4NR1A 3T0DA 4HXCA 4M4PA 4RSUA 1DQ1A 2QDRA 5KWRA 2X53S 3AK0A 5KHJA 3ZXAC 2VVDA 4ZHNA 3WQ0A 5A6QA 2JKBA 4R9AA 5LBFA 4B8EA 5J48A 2E32A 1KXGA 3TEXA 3AL6A 4LE3A 4NRMA 4I01A 3O1UA 1LOFC 2JE8A 5ABJB 3I3QA 2QQMA 4LMFA 5FPUA 1D0GA 3N7LA 1IKQA 4HZFA 1MQTC 4D6QA 1LKNA 2VTXJ 2FBEA 2EIGA 2E63A 2IXIA 1XBFA 3CKHA 1B35C 3AMNA 3MIFA 2WA4A 3I3DA 4A2UA 1GZWA 1MPXA 4QDSA 4TN7A 2VMEA 3N36A 2ADEA 2A6VA 4AVTA 3X29B 4P9IA 2MPFA 1YQCA 1CD3G 3ACGA 3FFZA 1KDKA 3KVBA 3M3CA 3NAPB 2W08A 1V9U1 4CUGA 5KC5A 4O7XA 1AJOA 1WMDA 2EICA 1TMF2 5LK5A 2OYZA 1BMV2 1E5HA 3HBKA 1DHKB 4BQ3A 1NCRA 1A78A 2D6PA 4AHZA 4Y20A 2ZBJA 4PLNA 2D6OX 4UT5A 1ALYA 1QIQA 2WSVA 3L2YA 4XFAA 5LEJA 1SLBA 2QQLA 3NV1A 3OOXA 4DUVA 2VUAA 2WS92 4LO5B 1VMFA 3UGFA 4QX8A 1GQPA 4QM8A 4LHNA 1M4WA 2RM23 2P6CA 1XSQA 1OPOA 1US3A 3HPNA 4XFIA 4CCKA 5FKCA 3AVRA 1D4M1 2E33A 3P3NA 3KT1A 4K6BA 1NXD1 4KU7A 4XDPA 3K4ZA 1JUHA 4KQ7A 2VZOA 5DDJ1 5FPVA 4AW7A 4Y3OA 5D8AB 5KC6A 4R9DA 4WVZA 2D5HA 2DBNA 3LA7A 4YGCA 3VBUC 4CCDA 1POV1 1UIKA 5IFPA 2W92A 3ZKUA 2WYFA 1CESA 1TME2 4LKSA 2P1BA 3VB9A 3SC7X 2CY6A 3LPFA 3NWKA 4IQPA 4YW6A 5F3EA 3T1LA 1H2MA 4AEKA 5C33A 4AI0A 4OZOA 5KHIA 1TNRA 2ZAHA 3H1WA 4JRLA 2JDNA 1DQ6A 3V0BA 3RDIA 1V6NA 2XMLA 3H0OA 1ASJ1 1W03A 2IXLA 1W90A 5H9PA 3VN4A 4GMP0 1WMEA 4LITA 3JQXA 3AX4A 5KXBA 2R062 4CDXC 5JXJA 3RYKA 1FOD1 4Q4Y3 3GDBA 2W1SA 4CDUB 2QQUA 4MHRA 4LBJA 4K1ZA 1AR83 4C8DA 1K5MA 2IXJA 4UBGA 4IW3A 2DTYA 1KFUL 1JTZX 3MFCA 4LA3A 1VBD3 4N9HA 1EP0A 5FZ8A 2RVAA 2F17A 1YFYA 2XG3A 3B94A 4ISQA 5FY5A 1OOPA 1QQP1 2DUQA 4E8CA 3T4HB 1EV12 3PVOA 4UFJA 3OB8A 2VZ1A 1GZWB 4MGQA 5AC93 3WP3A 4D6RA 1RVF3 1I6XA 3VDCA 3GXUA 4PLMA 1O4YA 4QGMA 4FQ4A 5EYYA 1O5UA 2VR4A 2Q8OA 1AL21 2HEWF 3C7HA 4BPZA 1COV2 1OA2A 1JZ2A 2XJSA 2ZHLA 1NXMA 1H30A 2A7AA 1E57A 5CU1A 4EZHA 1NCRB 1RUG2 2D6KA 1VBC3 1YYNA 2J1TA 3WP5A 2VZQA 4LUMA 4FXKB 2WZR2 4OHWA 2R042 2LM3A 1BCXA 3THCA 1DGWA 4FOVA 2CYFA 2OT7A 4AVVA 2X29A 4LBOA 3NJVA 3LB9A 2BERA 2VO5A 1WD3A 1W9YA 2QNKA 1CAUB 3F2ZA 2YUEA 4I02A 1SBFA 3HT1A 1OVPA 4UI9L 1IPSA 1GZ9A 5FZDA 4LT5A 4W4ZA 1ASJ3 2XL7A 4CCJA 4FPHA 4E27A 4IGQA 4YZ2A 2HH9A 4L2NA 2H6BA 5CFCB 2Y8KA 2B5HA 1SPPA 3ACIA 1IGOA 5FUIA 3H7JA 4GWMA 5T55A 2BNNA 2C4XA 2E7TA 3BPZA 5A3LA 3KWVA 4CA9A 4XUPA 4ZONA 2RDRA 1PNGA 1US2A 2ZGNA 3DPRC 1O8SA 1GFF2 2EXKA 4BM8A 5K4LA 4N43C 4AYUA 1NCRC 1D2QA 1OD3A 2BV4A 1UY1A 5L9VA 3E5QA 5I93A 1NE4A 1TQ5A 5F3IA 2FD8A 1HB3A 1UD1A 3B93A 2XXZA 5JVVA 4QPWA 1WBFA 4KU8A 3WOGA 4E9KA 3R05A 5LA0A 2WR9A 1PZ8A 5DN2A 1YRZA 4HG6B 4A7ZA 1RIRA 1G9CA 4B4PA 4CEYC 4ZXEA 4XCBA 4MV2A 4MADA 3UJQA 3O7OA 1CVNA 1LB2A 2J1AA 3TNQA 1K5MB 3MHZA 1GICA 2OZJA 4Y1VA 2ET7A 2PHWA 2IVIB 2JDPA 2YMZA 4P00B 4I3GA 4FP3A 4P9LA 4DQAA 5GZGA 4BLIA 4YGBA 4E2SA 4QX2A 2JG9A 1K5JA 3KD4A 4NAOA 1JOPA 1MS4A 1S0JA 4X6QB 4IERA 5FZKA 1RUI1 1SCSA 1S0CA 5GALA 4BQ2A 4HETA 2EVXA 2CNAA 4KH9A 4XOGA 1S0EA 3ZFGA 1Z7S2 2O0OA 3AXDA 5FK8A 5C8CC 4AG4A 4D0QA 2QUOA 4JHZA 3SH4A 4PIZA 1W04A 3SITA 5FY9A 4OUEA 2ZGKA 2CL2A 3WX5A 1LCLA 2Y6GA 5JXHA 3POWA 2R16A 1LHNA 4N53B 1FV2A 3WW3A 3ZSEA 3UNPA 4LIVA 1H4HA 1F31A 3HIFA 1ENQA 3OEAA 3VBFA 4A4AA 1O3SA 4RS5C 2QTWB 5J96B 1ND2B 2O14A 5FOBB 1BZWA 2YDEA 3H8RA 2VOTA 1Y9MA 3DKWA 2X5IC 4QX7A 1S1AA 3LDRA 2A3WA 3OCPA 5FZ1A 3P5BA 4M00A 1VBA1 3WNXA 1NA1C 3T0AA 1ZZ7A 4K8FA 1PK6A 1W6QA 4P08A 4LK6A 1MS8A 1R64A 1OD5A 3GZAA 4FFFA 3BUCA 3W20A 4IE6A 1VR3A 4NMIA 5H9SA 1JI6A 4FTEA 3N9QA 4DXSA 5BNPA 5FQ0A 1V6JA 3JBG2 3K75B 4IETA 4JKKA 3ZSKA 2I2SA 3J8F2 4AZZA 4Y4RA 4Q1RA 4FPEA 1WW7A 1QEXA 2VTXA 4XIKA 1NLRA 1J58A 3B9CA 2RM21 2A73B 5FIXA 1KJLA 4YSFA 3MIHA 2GAUA 3O1RA 1Z78A 3WP4A 3LE0A 4MH0E 5T52A 4BK4A 5ANQA 4EN6B 5T54A 4JV4A 1FPN2 1J1LA 1POV0 2ZMNA 1UY2A 2F4LA 3A22A 3KLSA 5DZGA 3KCXA 1UWWA 4WM7A 1EAH2 3KT4A 1DGRN 1D4VB 1PX3A 2E6VA 3I2IA 2JDZA 4N8MA 3CJXA 4NPLA 4YW3A 1LGNA 1Q3EA 2VD7A 5A1FA 2CV6A 2VNVA 5FZ0A 2ZAAA 3MPPG 5EFUA 4D8MA 1RUD3 1C57A 3ZYHA 3VD9A 3MZHA 4WVWA 2IWGB 1XOYA 4Y1YA 4WM7C 2ATFA 2PMWB 4UF0A 1RUNA 3BN6A 3POFA 5FLHA 4AGVA 4ASLA 2OXBA 1I9RA 3VBOC 2DVAA 1H4GA 4QXCA 2XLAA 3GGLA 5LRSA 3Q8CA 3P6BA 4IEOA 2XUEA 1B35B 5FYVA 2GNDA 5FZIA 2V72A 3ZFFA 3O14A 1DG6A 4NIIA 5F5CA 2R043 1RXFA 2XBO2 2YC4A 3RZMA 3KHCA 3UV9A 5C4WB 1IHMA 2MEV3 4CCCA 4DEVA 4XVHA 2PHDA 3WHUA 1F8VA 5FYBA 1UU5A 3AXEA 4CSWA 5FP3A 1FV3A 4DO0A 1BK0A 2UY8A 2V5YA 3KVAA 5GZEA 3A7QA 4H55A 2ZABA 2FDJA 4IXLA 1YI7A 1UY0A 3N7JA 4YPJA 1BVVA 1HDKA 3ALQA 5FZ6A 1UYZA 4BQ5A 3ELNA 3PJYA 3OGGA 5FYIA 4RHV3 3B02A 5HV4A 3NRUA 2VZ3A 4L97A 3MW4A 4XAAA 2RS33 3K4AA 1UYPA 5DABA 2CGOA 3NJXA 5F5QA 4NPRA 2BW8A 2Y6HA 5C70A 2VQ0A 5GLZA 1OLQA 3NW4A 1KEXA 1GNYA 4FPOB 4GWIA 1SFPA 4YVWB 3OUIA 4RQPB 2D6NA 1AR91 4Y22A 1Q8OA 3FUQA 1F5JA 3O0WA 2VMHA 5E16A 2CAVA 3AYCA 3IIAA 3WCSA 5A70A 4LBQD 1ZX5A 5EJ3A 1SCRA 1MEC2 1PO22 1REEA 3K4DA 4AVCA 3AZZA 2VH9A 1FI2A 1QJX1 4HPKA 4BLJA 1JW6A 1QXJA 2WAOA 1F4HA 2RR11 2ZTNA 5A7NA 1UOJA 2YBKA 4IV1A 3U07A 1UOBA 2QZ2A 3NO8A 2WT1A 4GB31 1OKOA 4G4FA 3SH5A 2MHFA 3SMHA 2X8KA 4YG3A 1YJLA 3ZOIA 4Y5SA 1GYKA 3VBHB 4RFT0 3WP6A 5CKNA 4C1WA 2D3RA 5A1AA 5FZAA 4LBQA 3E6DA 1UOFA 2DU0A 3BVCA 2HBTA 3JCIA 4HK8A 4YGDA 2ZMKA 3IDCB 3ILFA 3QH7A 3T2OA 4RQPC 4FQZA 5FJHA 1Z7S3 2DDUA 4YFZA 1G9FA 4AE2A 4XPVA 4BJ0A 5DZFA 1LHVA 3W5NA 2WFPA 2VY0A 3AJZA 2XR4A 3H3UA 2VC9A 2SBAA 1AX1A 1Q8VA 4RGAA 1V6KA 3J26N 3HQUA 4IEZA 3NL1A 3WUDA 3ZXFA 5LA2A 1JUIA 1XNCA 2CSGA 2WFF1 4LORA 2VXRA 3BI3A 3NAPA 3K3OA 3KCCA 4KWUA 3ZO0B 1I3HA 5K0UC 1DYOA 1QDCA 2XOMA 2LW8A 4AHWA 4C90A 5JXIA 1E5RA 3VD7A 1W9SA 3WVJA 1W6PA 1VBA3 1LOCA 1OUSA 2DWRA 4X8NA 4AAXA 1W8ZA 5LA9A 2BVBA 2EAAA 3UKNA 2X05A 4KG8A 3GHNA 2EA7A 4B29A 2EIDA 1ZBE2 1T6GC 5CFCC 1SFNA 1TZOA 2XHKA 1FATA 2BOJA 3B9IA 3BIWE 3D0JA 5A3MA 1DDLA 1TE1B 5DDJ3 4Y22B 3ZIWA 3C3VA 4EWEA 4KBBA 3AYEA 3RMXA 4MXVA 5JMOA 2FDFA 2B9VA 3BGAA 3OTFA 2OQ6A 5IUQA 3DPRB 3T0BA 4C91A 1TG7A 1ZM1A 3Q8BA 2F4PA 1ZZ8A 1EAH3 4HPKB 3IDEA 1VBB2 4HT1T 1HXS1 4A6OA 4CDWA 5IHRA 3BKZA 4WV8A 4RR3C 2Z4FA 1SHWB 5L7OA 1MQTB 2Z5WA 1A3KA 1V70A 2BJSA 1GBGA 4YW2A 5T5PA 3WY6A 1UO9A 1J1TA 5EIYB 5C6CA 3B5LB 3SH3A 1CONA 1K5MC 1YJKA 4XE9A 5FZ3A 1RUD1 1UL9A 2ZEWA 4BQ4A 5FY0A 4NPMA 1PMHX 4M3CB 2BZDA 4WVVA 3ZXLA 4LBQB 2WFF3 4CEWB 5BUVA 4AVAA 2FMYA 3LEIA 3VL8A 4CDXA 5DAVA 3RZGA 3B7MA 1BEV2 1UYYA 1UY4A 4OFGA 2RMU1 3HN3A 2MEV2 2G19A 2XUMA 2YFZA 2DF7A 1DLLA 3KV4A 2C9AA 3I59B 4XFHA 2ZOEB 3AC0A 4QXKA 3HQRA 4IDZA 2WDBA 2NQYA 3NNJA 5T5LA 2ZJCA 2JIGA 1WWYA 4XJUA 1UKGA 1HX6A 4Y33A 1URXA 4BE3A 5FYYA 1RMU2 3LA3A 4N7UA 2QQNA 5FXWA 1K45A 4IGOA 2WQ4A 2D3PA 3NV2A 5FREA 5HCBA 5I0SA 5FMDA 5CBLA 3ZFEB 5BXXA 2NM1A 1H1IA 4MGSA 4YM2A 2C6SA 4OQ8A 2RV9A 3PIGA 3N7MA 3HVDA 4YW5A 4K40A 2BBAA 1A6CA 3DN7A 4FTSA 4CP0A 5AC91 2ZX4A 1FMD1 2VJXA 4Q5OA 4QPYA 4U36A 4Z92B 5HI0A 2ZHMA 4XFCA 4CCMA 5F3CA 2XDVA 5FYHA 4XAEA 1CWPA 1HQWA 4N90A 3WNKA 2X5IA 1JYCA 2ARCA 4YM0A 3WR0A 1ENRA 3FN9A 4LHSA 5HPOA 1IKPA 2PHUA 4EV0A 1FMD3 1OC1A 3C7OA 3VV1A 4YZ1A 1RUF2 4N7IA 4Q4X1 5LY2A 1GQGA 5SV5A 1W2UA 1WBLA 2VCMA 3KV6A 3WDTA 1JH5A 4CP9B 3PVNA 5M0TA 5J98B 2D97A 1UN1A 4LKDA 1HV0A 4AGRA 4I2OA 2QCSB 4LPLA 4MOAA 4QHBA 2AYHA 1UOGA 1ZBA3 1AHSA 3ZFGC 2GH2A 4EQVA 5BNOC 2VMDA 4FTBA 3A4UA 2P37A 1MQTA 2FDHA 4NO4A 4U2AA 2VPVA 2I45A 5CEHA 4TSVA 4JGYC 3I8TA 3BOWA 4Y1UA 3PJQA 3HOBA 4P9YA 1PO11 4S2DA 1KDMA 1QQP3 2A6ZA 1HN0A 2ZZJA 2W95A 5IFTA 3RJRA 5JSPA 3ENRA 2D3SA 3K3NA 3WCRA 1GSLA 5IK8A 4GB33 4DUXA 2D43A 1AYN2 3ZYIB 2B7YA 4HONA 5FV3A 4GH4C 2R063 1DU3D 2XJRA 1RUH2 4IEYA 1QKQA 1HRV2 2HWD2 3OGVA 4FBFA 1SPPB 1KFXL 2LUWA 4PI0A 4XDOA 4RA0A 4DS0A 3VZNA 4JZRA 1XYNA 4N43A 1HB2A 3S0MA 4COZA 1VBA2 1WMXA 3ZFGB 1LOGA 4XMAA 5JOWA 4JRAA 1R092 3AB0A 2WUHA 1W6MA 1YIPA 4LBKA 1XJAA 5F2SA 4G9SB 1JOBA 5JR2A 2HWF1 2ZGOA 3SKJE 1V9U3 2XQRA 2YY1A 1ZBE3 2YROA 4Y1XA 3WINE 5LK7B 5LA1A 2BTVC 1PGL1 4FPLA 4ORFA 3MF9A 2XJUA 3M7AA 3RI8A 4AFCA 1VRH2 4O61A 3LWCA 5A7OA 2BWCA 2OUJA 1QJZA 2W9XA 4UFMA 1GWMA 1JXNA 1SZBA 2VG9A 3DYPA 5FYZA 3JQWA 2D93A 2DVGA 4K9SA 4LKFA 1W3XA 2ZX0A 2A1XA 2YBPA 2JX9A 3KHBA 3ROUA 2K46A 3M1HA 1AL0G 2WO7A 3RG0A 4QQOA 5FDBA 3V56A 5HXMA 5K7PA 4QB1A 3ZFEC 1QJU2 1ULDA 3H9AA 5F7UA 1H2LA 1ULOA 2IFRA 4XUNA 4P14A 5FXVA 4BWOA 2OW4A 2GN7A 4FO9A 3OBRA 2VUDA 4IEVA 2WWJA 1CQ9A 1W2AX 3CF6E 5T5JA 1PIV2 2BEOA 4XUTA 4ZU5A 4BQXA 4CRQA 4H14A 2JWPA 2PHRA 4MHUA 1MZFA 3BYWA 2ETEA 3ACFA 2TBVA 1GNZA 1RXGA 2R071 2ADDA 2P3IA 1ND3A 1BEV3 1GWLA 1ZRDA 4YYOA 2JD4A 2RS53 4WM7B 1I5PA 1OOPC 3E97A 1ZRIA 2W87A 3CNAA 5FY1A 2BBVA 3GNEA 1OURA 4FT8A 4CTEA 4HFSA 1ND2A 2XBO1 3ZR6A 1BBT1 1RC6A 2GZWA 1H2KA 4XCAA 3BTYA 4RGKA 4ZXKA 1ULEA 2F6BA 2H0BA 1YQ2A 3VBSC 4DRRA 3FE5A 2P17A 4NOTA 1LOBA 1OF4A 2RS13 2ZHKA 4E4HA 1AR62 1NA1A 2VXJA 1GOHA 1VB2A 1WW4A 3LQCA 4UF0B 2G1MA 3QBQA 3ZYGA 3C7GA 1BBT3 1DZQA 3M70A 5ACA3 4QHZA 2R1BA 3H42B 2V5DA 3RI9A 1YNAA 1WLWA 5L73A 2RE9A 5F37A 4WBBA 5JI9A 4XMIA 5DPNA 5DZEA 4M0HA 4CDUC 5C4WA 4ATFA 4CCNA 1W2NA 5FCCA 5FMCA 2UYBA 2KD7A 4XF4A 5DAWA 3T09A 5FWJA 4FFHA 1PK6C 2PLV2 2DCJA 2EXJA 2JE9A 4Q27A 3I3EA 2VOXA 4PIXA 5JCTA 1IS6A 2VVEA 3LAGA 2JG9C 4AVSA 5JOXA 5FPBA 1HB4A 1Q43A 3AVSA 3ZN6B 1SMVA 2ZACA 4QDRA 5FZFA 2NP0A 5FP9A 3POIA 4R4ZA 5FMOS 4CDQC 5C9AB 1Y9QA 1CIWA 2VGDA 2AENA 1SDWA 1XB9A 3CQOA 3GBFA 2EF6A 2RDNA 4QD2A 4RQPA 4S2GA 2DBIA 3EMRA 3WQ7A 3ATGA 1W8OA 3WT3A 4ASMB 4ONUA 1S2BA 5FMBA 3L2HA 3E6BA 4FI9A 2AR6A 3CO2A 4XIOA 4ZU4A 1V6IA 3T1MA 3WF4A 5F32A 2WNOA 4OI4A 1D4M2 2WNVC 1VBC1 2Y60A 1B35A 2JKXA 1WUVA 2QBXA 3OPWA 4XXPA 5FP7A 1KS5A 5LASA 5JOYA 5FXXA 1QJEA 3VHNA 4CCEA 1F9KA 3KCYA 1P8JA 5CZKA 3PUAA 3AYDA 2IXKA 1LOFA 2RS31 3I2KA 3POYA 2DURA 3M3QA 4WM8B 4IV3A 3SEPA 2JXAA 4ES8A 3H3LA 3JBG3 1GANA 4IEXA 4B1LA 2NMNA 1DQ5A 3QLQA 2Q1FA 2RJKA 3RGBA 5FZLA 2YC0A 1OXCA 1VBE1 3A0NA 1ZYBA 3O0VA 4LHKA 4PBOA 2I74A 5FZOB 3U14A 4Y26A 3U75A 2HWE2 3FFQA 1JU4A 3S7EA 3W21A 4L9BA 4V2VA 1NCQB 2ARBA 3AKTA 1QY4A 4CEYA 1RUI2 2GH8A 2P2KA 3Q9OA 1RINA 2DUPA 4OUMA 5CFDC 1WKYA 1J3PA 1FPN3 1CZSA 3OD0A 2XKOA 1VJ2A 3NQHA 3IN9A 1RUC3 2HWB1 4L92A 4BIOA 2EAKA 4GWNA 3VBRB 1DZTA 4YVWA 4IV3C 1W39A 4LBLA 4HVRA 2ARAA 1JZ8A 5LBEA 5A7WB 1V9U2 5L36A 3CBNA 4YVWC 1QH6A 3AP7A 4MXWB 1XXNA 1GR3A 4Q8LA 5H9QA 1QWRA 2RS51 2CDPA 1RUE3 4P5YA 1O6UA 1NUKA 3DEMA 4COYA 3K51A 1O4ZA 4QT6A 1EPWA 2WN3A 5F3GA 3TRSB 3FMGA 2C26A 1MS0A 2PQQA 2XWBB 4G3YC 4XURA 1OMIA 1AR71 2WNUC 3C2UA 3PDQA 4AEDA 1JODA 3AKPA 4Q4V2 4RYDA 5EQUA 4CZSA 1QJU3 2UWBA 5FPLA 4BQ1A 5A33B 3JXSA 1H1AA 1W6PB 3UT0A 4Q4X3 1PGW1 2UWCA 3I7DA 3A0KA 3KF5A 4YW7A 2FCUA 3NNLA 2Y38A 3VZMA 2V4AA 1O7FA 3DXTA 4QQ2A 5AFBA 3KF3A 1S0BA 3MF6A 1R1A3 1GUIA 1VAKA 4ZPIA 4XQ4A 1JN2P 1HRI1 1RUJ2 4I3PA 5EV7A 4PBPA 4ARXA 2JE7A 1O3QA 1NT0A 3TOJA 5I0TA 5FXZA 4LNVA 4YARA 1JOJA 2J42A 2ZGLA 4SLIA 4CE8A 3LFIA 4KGGA 2QQOA 4UFHA 4XJAA 5JSRA 3KMHA 1SLLA 1DQ2A 2WABA 5G05L 5L9BA 2YGLA 1EAH1 3OGRA 3RVHA 3FLRA 3HBZA 3VZLA 1V0AA 1JYNA 4QU2A 5BYNA 1PM7A 1QMJA 1H0BA 4YG6A 2ORZA 3N9NA 5FZ7A 4YM3A 3LIGA 1FOD2 3TYJA 4WM8A 3AMMA 5C7GA 1JYXA 4D69A 2FCVA 5IVJA 2VL4A 2VULA 2CWMA 2UWAA 2YU1A 1GKBA 3Q8AA 3ZN5A 1MS3A 1AR63 1WCUA 2ZHNA 3AZWA 4M3CF 5E89A 5FZOA 3HNMA 3CMGA 4BK5A 4QGNA 1F2NA 2WLQA 1OA4A 4AAPA 5IK4A 1UCXA 4DNYA 1JHJA 4AXOA 3RZKA 2WKKA 1CN1A 1RMU1 5E88A 2XJVA 2YGMA 4IUGA 3AKSA 4M3CA 5A32B 3W58A 4XFFA 5A6ZA 3I2OA 1NZIA 4BZ4A 4HN1A 1RHI2 1UZ0A 3PUIA 3IDAA 4CDXB 4GALA 4WM8C 4BMBA 1DQ4A 2UU8A 2Z79A 4PF1A 3PLQA 4NVPA 5JSOA 3GZEA 1XNKA 5C71A 5FO8B 5A7WA 1HW5A 4FFGA 1NOVA 4MXWA 5FZ4A 2VU9A 1PNFA 4K21A 2OS2A 3K2OA 2DYCA 3NV3A 3V65A 2WZR1 1XQNA 1YO8A 2E51A 2SLIA 5C8WA 5JZGA 3WF0A 4HKLA 2L9LA 1G9BA 1DBNA 1GNHA 2H6CA 4Z2WA 3AP9A 4DRVA 2AGSA 3GALA 4HKOA 2ZGSA 3ZFEA 4FP2A 2VW2A 1E5IA 2JG8C 1I1EA 2VNOA 3WLUA 4GJZA 5C8CB 1FNYA 4W6WA 5GLTA 1TME1 1ZZBA 4AEDC 2V09A 4QMAA 4CEWA 5D2AA 1JZ7A 1YLLA 3JD71 5DG2A 1D4M3 4Q4Y2 4N53C 5KR7A 3AL5A 3GM8A 4MGZE 5TSWA 4Q4W2 3I3MA 5JOZA 1S0IA 1QXRA 1LAJA 5J36A 1CX1A 2VM9A 4A3XA 2G9GA 3CZUA 3SCGA 4QPGA 5DUUA 2OUHA 4CUAA 1AX0A 3GBWA 3RRDA 4JGZC 3KT7A 1AR93 3ST7A 1REDA 2ORXA 1BLZA 2DVBA 2X09A 3DL3A 3WDYA 4YGEA 1OPMA 3WNNA 3THDA 4AF9A 4CCOA 2JDHA 4P9GA 5DAPA 5A3TA 4XZPA 5IK7A 1NY71 3IDBB 4BXFA 1WD4A 4OHXA 4AFAA 4M4RA 2TUNA 5DDJ2 4RHV1 5BNNC 3O1TA 2QQVA 2CGNA 3WG1A 4NIHA 1N3QA 3HQXA 2EXHA 4NRPA 4XZUG 5DMYA 5I91A 3KGLA 3G7DA 1COV3 3HMYA 4XFBA 3B3QE 1IPKA 4NAMA 3UGHA 1YCIA 1QH7A 5ACA1 1UU4A 3KB5A 1A34A 2OX0A 2WN2A 2B45X 3IPVB 3SKVA 1C5IA 1EY2A 1QOTA 2WSUA 2VAUA 2WZR3 2V73A 4XF0A 4JTOA 2Y6KA 1OLRA 2R0HA 4BIFA 5FRAA 3NKTA 4JGYA 1MVEA 4LO4B 3VKLA 1CPMA 1OKQA 2MNGA 4Y5TA 1H8TC 3FUOA 4IL7A 5EWSA 5DUXA 4B4QA 4DB5A 1ZREA 2CHHA 1SLCA 1W2TA 4Y5Z0 1NZCA 5T50A 1APNA 1AXZA 2YBSA 4H7LA 2QE3A 4TZDA 1JYVA 1W3VA 3CLPA 3U37A 2JB8A 4ITCA 3ZXKA 1SBDA 4IE4A 4CXXA 2OPWA 1NAEA 3LDKA 4DZGA 4GULA 2ET1A 1I5ZA 2O8QA 1ULFA 1ZZ6A 2BGPA 3D4KA 1O4TA 4AQSA 5A3UA 4LIUA 3K48A 1UZWA 3H8UA 2LROA 5IK5A 3H1YA 2XVGA 3O1MA 2DFBA 3WW2A 2QQPA 1BHGA 1J3RA 3FJSA 3IM0A 4WZCA 4XBQA 4GIQA 3WDVA 4AHYA 4DMIA 3HAGA 5C3OA 1X9PA 1RB8G 3M2MA 3WG4A 1X82A 1X50A 1G6NA 1F5FA 1L3JA 1AL22 3MI8A 1C8NA 3USSA 1Q8QA 2EIBA 2GC2A 4IEUA 5F8PA 2AEYA 2BYVE 2D98A 1NYWA 1ODNA 1RUE1 2GN3A 4TXWA 3KQ4B 3ZPOA 4BXSV 4Z1VA 1RUG1 1ENSA 4CPBD 1IG3A 1Y4WA 4B1MA 5B4XA 3M4FA 2JDUA 5FZEA 3AKQA 2DCZA 4BOWA 5CISA 4CU9A 4YZ3A 2P5BA 1O3RA 4HBNA 1LGBA 2RM22 2Q5TA 2BVVA 4NIGA 2VW1A 5FUPA 4YVSB 4QWNA 2XJPA 2ZEYA 4XJZA 3RNSA 5A6XA 3OG2A 3QH6A 4LHLA 4S2FA 3TN92 3DUIA 5C3SA 4RFRB 1LENA 5APAA 5DAXA 3DYOA 2I07B 3UJOA 2R32A 1TME3 1JU3A 1PVC2 4P02B 3T2TA 4Q0SA 2HWC1 2RG4A 4DPNA 4LLFA 1RUC1 4NHMA 2R30A 4E4ZA 5IW0A 5C3RA 4UAPA 4XUQA 4CU8A 1W6OB 3IKWA 4QB6A 4PCRA 3OUHA 1D7PM 4FOQA 4FXGB 4IE0A 3RSJA 1QJY2 3T2PA 5JLVA 5LEKA 2VCAA 3KM5A 3VBSA 2YB7A 3I4IA 4OHYA 1JYTA 1PMIA 3I2GA 2DFCA 1SACA 3S7IA 1DGLA 1AYM1 1UQXA 4WZFA 5KHHA 1NKGA 4CXYA 4AI2A 3OF1A 2ZKNA 3N3HA 4NUBA 2CGPA 1H9PA 4JTNA 1GOGA 4E2QA 3U1XA 2GNTA 4B7KA 1WA4A 4NJ4A 1EV13 4Z8BA 1LODA 5J7MA 5AC92 2AH2A 4P9JA 1IG0A 1AYN3 2B42B 3DYMA 3OPTA 4P9XA 1PGSA 4PIYA 1R1A1 5FO7B 4QKFA 3MLJA 5I8TA 1GU3A 3AKRA 4JVAA 4EN8B 5FPAA 2QFEA 2IUWA 3BIEA 3I97A 2Y34A 4Q2FA 2ZZQA 5F39A 4CDQB 3AJYA 1W9FA 1CJDA 5A7QA 5C5TA 3FHQA 3VDAA 3JD73 2HEVF 3WNOA 5I8YA 1J83A 5L7OC 4FPCA 1JZ6A 4ZZ8A 2W52A 2JDMA 4NE9A 3J9SA 2AREA 1HKDA 2YYOA 3LF7A 2LRPA 4O9EA 1O91A 3U11A 5F9TA 4MVTA 5IJRA 3MICA 3VKFC 3ZXDA 4AVBA 1AUYA 3BALA 5C9AA 3U4XA 1U5YA 4QQPA 3POEA 1H1MA 1C8M2 3OUJA 2JDAA 4DIQA 1U5XA 3SQOA 1NQDA 4R52A 2K9ZA 3NJYA 1UY3A 1D2SA 3AZXA 1RJ8A 2RR12 4QX0A 2XJTA 1HIXA 2JICA 1WCKA 4M3CE 4E4SA 1ULGA 1MZEA 2UY9A 1BXHA 5SV8A 1ACCA 1VALA 5LB6A 4INDA 2E7QA 1AZDA 2VZVA 4LBNA 2JEMA 3WW1A 3MLLA 4B3NA 4EROA 3RZJA 2C5DA 3VBFC 4DXTA 4FPFA 5FTTC 1GMMA 1E5SA 2RS11 5BPXA 1REFA 4I09A 5H9RA 1JYIA 4JHTA 3NV4A 4IEPA 3C7EA 4FPKA 2VCCA 3RYRA 1SFYA 1TVGA 1PO13 5F2WA 3T3YA 3HNBM 3BTAA 2CDOA 3AP4A 3GCXA 1W8NA 4D3WA 2DVFA 1KS4A 1SQ4A 4HMZA 1COV1 3WD5A 4OMCA 4ZZ5A 5F1RA 1IQDC 1XYOA 2LALA 4MUVA 5BNPB 2HWF2 4XF3A 3VKOA 5CA6A 1UX6A 2A71A 5FQ0B 1ZNPA 1BQPA 3M8LA 1Z7S1 2WO3A 2R041 1NG0A 3BU0A 1WCSA 1MR5A 4BCUA 2Y26A 1G9AA 1RVF1 5JI7A 4L8QA 3VZKA 3ZDSA 4C0BA 1YQ6A 1HQNA 2E9QA 2IC1A 4CUBA 2PHXA 1UPSA 1K42A 2KR2A 2A75A 5ABJC 4XHXA 3KGZA 5CYYA 1OH4A 2HYKA 3IT8A 1UKRA 3OYWA 5JZGC 4I0WB 2BGOA 1EPZA 3EBRA 5GZFA 4AEDB 4CDQA 4LTAA 3PHMA 3FLPA 1ZBE1 2WZ8A 2VNRA 4NHXA 5HCHA 2A6YA 1WA6X 1PO21 5K0UB 3BPSA 3N9OA 2QZ3A 2ZX2A 3PURA 4IV1C 4MLOA 2W39A 3S5QA 3ZXEA 1KRIA 4YWAA 1LNSA 4R8HA 2DU1A 4HSLA 2D7FA 3EQEA 4CEYB 2Y0IA 4LLOA 1UYXA 4NIDA 4A42A 2VECA 3RWKX 4H2AA 3TN93 1NCQC 1YFXA 4LUKA 1U0AA 1CAWB 4A3ZA 3J8F1 3LEGA 4W6YA 2C24A 2HBUA 3WF1A 3AP6A 3H3ZA 1DIWA 1W8FA 1HXS2 4GQ7A 4DEQA 1YHFA 4Q0VA 2W1UA 4V2WA 5F6LB 3USUB 2JJ6A 1EUUA 1H6YA 3GBGA 3LD8A 5FLJA 1QJX3 1UZVA 4RN5A 2KA3A 3ZFFC 1XNTA 1U5ZA 5IATA 4MGTA 3LDBA 3APBA 3AMPA 3CIHA 1ONAA 4PLOA 1Y43B 1N1TA 4GKXA 4KWKA 2H0VA 1RUOA 4YFWA 2OA2A 4GMP1 1AR61 4OHVA 4UXAA 3ETPA 1KJRA 3UESA 1IS3A 1QXPA 1UMIA 1XSRA 4IE5A 3OGJA 2JDYA 4KBZA 4L0PA 1BEV1 3N35A 3OBTA 3BTXA 3PMSA 1QOOA 3VZJA 4IEWA 4C1XA 3AZVA 2BRTA 2J7MA 4M01A 1AR82 4OVEA 3OPZA 5A32A 5FFOC 3IBMA 1VBD2 4LA2A 5JIAA 2BWAA 5FY4A 2GMEA 2W1QA 3J7HA 4CDWC 3VUOA 4XTPA 5K8SA 3ZX7A 3ZMNA 3PUQA 2Q8DA 3THTA 3FHAA 1XU2A 2HWE3 2R0FA 2WL1A 3EJKA 2QQJA 5D8AA 3Q8FA 5GLVA 1PX4A 2XHNA 5J09A 3RYPA 5JUVA 2VMFA 3SCFA 3DXUA 4C0HA 3BOPA 5GM0A 3WUCA 3AM2A 4JDOA 2D6MA 4QKBA 4OMDA 2TEPA 5F5AA 5E8AA 1QU0A 4FAHA 3TEWA 3A23A 4PI2A 3RZLA 2OVUA 2XBO3 4BDVB 1VBB3 3WF3A 1JYWA 3ETQA 1YEWA 2RHPA 1SLAA 2NYYA 5BNPC 3OYWB 4K7JA 1HQLA 1C5HA 3O12A 4UFKA 1POQA 2FDIA 4QHOA 2D6LX 4KL1A 3H8OA 4Q0PA 1LOEA 4YLZA 3ZDVA 1QHDA 4J6GA 1CAVB 3E1F1 2GP3A 4EN9B 3KV5A 1W6NB 2HEYF 4JC1A 2WT0A 2Y6JA 3QOPA 3EHKA 4V1PA 3U78A 2VNGA 4BISA 4AEJA 5JPNB 3ASIA 4YG0A 2YPJA 2VVFA 2ZEXA 2RS32 1LRHA 4NHLA 5JXGA 1TMF1 2Y6LA 1YQ8A 3LEMA 1H8TA 2Q8EA 5IAVA 3U10A 5FR3A 3DF0A 2W46A 3ZN4A 4ISRA 4BQYA 1VBE2 1VMJA 3SLIA 3VHOA 4UFIA 4CCLA 2HLEA 4FFIA 1OQ1A 1RUJ3 1C28A 1GOFA 5T3NA 4TWTA 4COWA 2VCBA 3ACHA 4LEJA 4F3JA 1RMU3 3LFMA 3T4VA 3WQ1A 3BTZA 1PO12 1PIV1 2WWSA 2IXCA 1A8MA 4E4DX 1GLHA 4D7YA 3GJAA 3ZVXA 2VZSA 4AGGA 4TLGA 1W28A 1DYPA 4DXRA 5BNOB 5BNNA 5A7PA 3UKTA 4JQTA 3R6SA 2WS93 4CP1A 3IPVA 1JS9A 3DGTA 3CHXA 2NMOA 2WJSA 1FOD3 4W6XA 5EPAA 4JGYB 3HWJA 2J1SA 2QQWA 5FKBA 3VD4A 4X6RB 1IOAA 4AK3A 4QX3A 4BA6A 2DCTA 5J3UA 1FPN1 3LOIA 2BQPA 4GH4B 2JG8B 4PDWA 1MVQA 3URFA 3LKJA 4XJ8A 4QPGB 3AP5A 2Z42A 1RYYA 4OUSA 4MGYE 4MSVA 3RPQA 3KV9A 3MBWA 5JAXA 3TEZA 1S0DA 3DPRA 3RJ2X 1OLMA 1WLDA 1FMD2 1SDDB 2VUCA 4OI1A 2FDGA 1RUF3 5FUNA 2P4EA 4I30A 4CDWB 2GC1A 3W9AA 2B39A 3I49A 4PF5A 2J22A 2Q1ZB 1DYKA 3MFAA 1SG3A 3POGA 4RD7A 5L7OB 4XJWA 1J59A 1MS5A 4COUA 1OFSA 5EJZB 2UURA 1VLNA 2C9KA 4W50A 2WZEA 3P1IA 3ZLIA 1WCQA 2VZUA 4OLLA 2NPIA 1CAVA 1OF3A 2Q8CA 1RGSA 2ERFA 3ZPYA 3H1MA 1AXKA 2O8OA 3NSTA 3K77A 4J1XA 4XEZA 3J7NA 3J7LA 1VIWB 1OQDA 4DY5A 2JECA 3O1VA 1WLTA 4QPGC 5EYXA 5A1LA 5C3PA 2IZWA 2LTNA 2PAEA 1Y7BA 4LO8A 5CG9A 1ZRFA 2JG9B 1H8TB 1UZYA 3BB6A 4YVSA 4QKDA 2CWSA 1ND2C 2VMGA 1H2NA 1QNYA 1QJY1 4W65A 4YW4A 1WZXA 1CAXB 5C9AC 2HWD3 1LEMA 5FBJA 3PL0A 5JMCA 3VDBA 3ABZA 3WG2A 2WQ8A 3JBG1 3H50A 4IE7A 1UXZA 3ZYPA 5IVFA 3S57A 1RUG3 1VBC2 2YG0A 1SLIA 3VHRA 3ECQA 1AR92 2EXIA 4META 4NIAA 5CNAA 2GNBA 3UGGA 4D7SA 1GP4A 1STMA 2JDKA 4LBMA 5GJ6A 3VBFB 3OJBA 4XHBA 5CKQA 2R073 1A8DA 1Z0HA 2E53A 2WQZC 3IMMA 3GF6A 2QVSB 3IWZA 3VBSB 1O3TA 2PQSA 1H6XA 2O1QA 4CUCA 5A3PA 1ASJ2 3AFGA 3LZZA 5FMOL 2VE1A 1FNZA 2ES3A 1XE7A 1W8HA 4QQHA 1CJPA 4UYBA 5FP4A 5IWFA 3JUUA 4ZY9A 1XNDA 4D94A 1ZZ9A 2VOKA 1V6MA 2NZ9A 5CFDB 3LOBA 4BU2A 4R9BA 4UWDA 2PFWA 2GDFA 1GQHA 3NNMA 4XBLA 1X7NA 5BNQA 1IZ3A 1MS9A 1R081 4HVOA 4BB3A 2W2IA 1MACA 2WNEA 2VQTA 3UETA 1LULA 5FOJB 4QX5A 5C3QA 4QGLA 4LO6B 5ANNA 4F8AA 4OI2A 2A6XA 4RR3B 5FYSA 5GLWA 3ZYRA 1W2OA 3I2HA 3PVBB 1W05A 2P3YA 4XETA 3VD3A 2FHRA 4NRQA 4A41A 2P6HA 4FCAA 3RWNA 1PMJX 3NJZA 3J7MA 2TNFA 3PVEA 1G8WA 2BFUS 5D21A 4AI9A 3A21A 5JDBA 4Y1ZA 1PZ9A 5FK7A 3T30A 4QKNA 3ZMOA 2PELA 5FPXA 1G7YA 1F4AA 3WDXA 4Z82A 1VE0A 2E7AA 1N1SA 5IYYA 4R4XA 3R4SA 1MEC3 3UK9A 5IAXA 5L19A 1RJ7A 2A3YA 1BBT2 4NROA 2ZGUA 2ENRA 2B8MA 4N43B 4AI1A 4AWDA 4OYUA 2W47A 1SLTA 3NVCA 1R1ZA 3H7YA 5FYMA 2P3KA 2XLGA 3OGSA 1MEC1 3UKVA 4Q0UA 1DGRA 2WINB 2B9UA 1XYPA 2ZS6B 2VZRA 2ZKLA 4LXLA 1XE8A 5FP8A 2RMU2 4ZKTB 1N1YA 3ON7A 3CJIC 5IVCA 3NKGA 4Q0QA 1FX5A 2R1DA 1MZ6A 4ES9A 2OPKA 4XBNA 3E5UA 2AZ5A 2RJ2A 3I2JA 4PDWC 3VGIA 4DFSA 2J1VA 4J1WA 4JQRA 3EXUA 4OZXA 3MIGA 3MYXA 1OFNA 2ZEZA 2Y6FA 4CP2A 2XL9A 1GZCA 3WF2A 1UX7A 2Q1MA 2PYTA 2Q0AA 1EV11 3HJRA 2XB6C 5LWBA 1YI9A 5EZWA 3H8XA 2HWD1 1VRBA 2B4KA 3NNFA 3ILNA 3LA2A 4FAGA 3JB4C 1OI6A 3G6JB 2ZX1A 4N9IA 5FZHA 1LR5A 1ULPA 4ARYA 3KQRA 1YIFA 2RJLA 2VQUA 4H7MA 1H8VA 3O1PA 2IFWA 5CFDA 1G86A 3KS7A 1YXWA 2R49A 1NLSA 1ZRCA 5JWPA 1PVXA 5E6HA 1BYHA 3LIHA 5A3OA 5DAQA 3SXWA 5FLIA 1CX4A 5E1RA 2MEV1 3WXPA 4HL0A 4XW3A 2JIJA 3OEBA 4QDQA 1ND3B 4Y24A 5I0DA 4QX1A 2W91A 1POV3 1M06G 4XILA 2BPA2 2PHLA 2VMIA 1QF3A 3VBUB 3ZSLA 5C4WC 2BOIA 4HKWA 2DVDA 4DXZA 1N1VA 2W5FA 3I2FA 2WO1A 5JR7B 1VRH3 3OY8A 2VBBA 4EN7B 1C3HA 2WNVA 3GZUC 1ODMA 2WLPA 4KGQA 4S2HA 3TN91 4OULA 3M3OA 2ZGQA 1H9WA 1NA1B 4F83A 4XTMA 4AFDA 3N9MA 1CAWA 1KGYA 3JD72 1LTEA 2CTVA 4PQ9A 4JGZA 5IVYA 4CYDA 2Z2SB 1HN1A 3BU7A 1LECA 5DXDA 4DINB 1LHWA 2WS91 3T2QA 1C4RA 3NNGA 3OBAA 4TYSA 4XACA 3DCQA 4BMEA 2OIIA 3I2DA 1XE0A 2G9FA 2XWJB 3KZ4C 4YNIA 4YRDA 4AI3A 4CU7A 3VBOA 1C8M3 2VMCA 5HBAA 1T2XA 4A7YA 1RITA 3WV6A 3BODA 1ND3C 3MLKA 2RR13 1UW8A 3HD8B 2BGCA 3DV8A 2GC0A 4RHV2 4HANA 1LHUA 1OQEA 2AEZA 3ZYBA 3MIBA 3ITQA 1OLME 3WNPA 4LKEA 1UXXX 4YVSC 3ES1A 4Q4V3 1HB1A 3WSOA 2JD9A 2RS52 5FY7A 5J1XA 2XONA 4L99A 1QJFA 2ZX3A 5HCFA 1X36A 3S6PA 4R9CA 2HWB3 5EJ1B 1CGPA 4F7ZA 1UNBA 4GXLA 1OT5A 1AYM3 5HCAA 5IT6A 3PTYA 1BVP1 1OHFA 1R1A2 2ZXQA 3MW2A 4HN0A 3WHTA 3LEKA 5K9YA 4K1YA 3RFRA 2PN5A 1FYUA 2GU9A 3W59A 3ZXJA 1QNWA 4QPIA 4AL9A 3WEZA 2A3XA 1LU2A 3USUA 5FJKA 2J1EA 1N3PA 2GSYA 2YV8A 3MUZ1 4UOJA 2GMMA 5KXEA 3D82A 1UIJA 5AVAA 1ZA4A 2E31A 2HWF3 2WBKA 3Q8EA 3L9JT 1Q56A 1QDOA 1L7LA 1N47A 3BCWA 5D1IA 1QJU1 2X10A 3IZOA 4LR4A 1RTVA 2GNMA 4QU1A 4WVMB 2D44A 2VOVA 3HN1A 4AOCA 3VZOA 4GJYA 1QOSA 2NLRA 1JZ5A 1TNFA 2V4VA 4A7KA 3OY8B 1NCQA 2A6WA 2J1UA 2WNVB 1EYBA 3FL7A 4IGPA 4CU6A 3WQBA 5LCWL 4RS5A 2OKXA 4X8PA 3JB8A 5I8SA 3V0AB 1YWKA 2XJQA 5LATA 3W5MA 1C1FA 1ZRRA 3D3AA 1AF9A 4XQDA 2Q30A 5ABJA 1K12A 3MIEA 5A7SA 5KXCA 1PGL2 3VBRA 1PGW2 4JGZB 4QB2A 4HSJA 4XF1A 3I59A 3B00A 1W99A 2ZPXA 4XABA 5DUWA 2J1RA 4AI8A 5FZBA 3R4DB 2G4IA 4YZ5A 1HRI2 1RUJ1 1W0OA 1Q8SA 1W0PA 1ZBA2 2W3JA 1GZTA 4JAAA 1RL3A 1FAYA 4HOOA 3THPA 5LY1A 3GJBA 1YQ5A 3ACLA 1DP0A 3RQ0A 4UW4A 2FZ2A 1DFQA 1X8MA 4PJYA 2BNMA 4YM1A 5HXVA 1SEFA 3CJIA 4DUWA 1W8TA 2HYXA 2R7EB 3V64A 1HXS3 2DTWA 2XVKA 4JKLA 1ZVFA 3CU7A 3E5XA 1QJX2 2VUJA 2RDSA 1YUDA 2WNUA 5DUVA 5BNOA 5BNNB 4ZS2A 3VKNA 2N7GA 3VBHC 2PA7A 2XQXA 3GZTB 5BV6A 4MX3A 4LQRA 5FYCA 2KM2A 5LZ6A 4GB32 3ZSJA 1FT9A 1W6NA 3AZYA 2WWUA 4PQQA 5EXOA 1V6LA 2YZ4A 1W0NA 2BU9A 3ILRA 2X5IB 4ATEA 4GH4A 5CIRA 2AUYA 1HRV3 3U4SA 4PDWB 1WW6A 4NHKA 1AXYA 4QPIB 1DZRA 5ISLA 1W8UA 3JU9A 1CZTA 3N9LA 2GC3A 4TTGA 3MO4A 5FWEA 5L9RA 1JHNA 4IEQA 2YC2A 1R093 2XVLA 3LCPA 1RUH1 1SBEA 4JDNA 1X9TA 4CP9A 1HRV1 3S30A 2W1WA 4EJRA 1XNBA 2WA3A 1WLCA 4ZU7A 3DKQA 1OSGA 1WGPA 3IMNA 1XPWA 3IAQA 4GA9A 2BNOA 4Q4V1 3SNMA 5GZCA 5F6KA 5FZGA 4D7TA 2A70A 1JZ4A 3U0ZA 2PTMA 3QACA 3RMYA 1NX9A 1JZ3A 3SISA 3WNMA 1AX2A 1S0GA 2RDQA 3FC0A 3VHPA 5KHKA 1LGCA 2BFUL 4Y20B 2EALA 3WZ1A 2WFF2 5AFEA 1W9WA 2ZGPA 2D40A 4XF9A 3RZHA 1S2KA 4GWJA 4Y4YA 2DCKA 1U5IA 5FZMA 3JZVA 4AQTA 3LPGA 2WO2A 1RUF1 4Q4X2 4YW1A 1HV1A 2QJVA 2QQKA 1XRUA 3PIJA 1C1LA 1LHOA 4FPYA 4URTA 1LEDA 3O0XA 4LOTA 4EWAA 2HJIA 4O65A 3QD6A 5CKMA 1KQRA 2QQIA 3SCHA 1T6BX 2JG8A 4KI5M 1L7RA 1B09A 4UBHA 2CU5A 2R6QA 2XKPA 3KSCA 3HT2A 3RS6A 3VBRC 1V00A 1BMV1 1PIV3 2UYAA 1NLQA 4LO7A 5ERLA 4Q4Y1 1VAMA 3CEWA 3EO6A 1C8M1 5EP9A 1CAXA 3GYDA 1NE6A 4A44A 4RGGA 2AACA 2W68A 3R0RA 4HVQA 3AYAA 5I0UA 3D6EA 4XDQA 1AR81 5BY5A 3I3BA 2NN8A 3GCWA 5JZGB 4KWLA 3CJIB 3WNLA 1W6MB 1IS5A 1WCDJ 4ASKA 5D8AC 2YFUA 3SHRA 5CADA 5GLUA 5KBFA 1UU6A 1BKZA 3VDDC 2HWB2 4XYXA 1VBE3 1AYM2 2WNUB 4GKYA 4KG0A 3HR9A 3AFKA 5G04L 4L11A 3SEEA 3S5AA 2ZA9A 2Y33A 1VB4A 3O5SA 5JIUA 1JBCA 1G9DA 3ZSMA 5FO9B 2DCYA 2RS12 4CDUA 1AL23 5A3NA 3T08A 5CVRA 1N3OA 3UYJA 1EUTA 4H3WA 1Y9GA 3ES4A 3PTRB 1CR7A 1RHI3 5GZDA 1YC61 3VDDA 5ACA2 1UF2C 5I0RA 2BDRA 3CDZB 3UL2A 2OQ7A 1OOPB 3C8XA 4XXAA 4LK7A 2HWE1 1S0FA 1VMHA 1HJFA 2P3JA 3OBZA 2BUKA 3PUHA 2WZPP 1XNAA 2ARXA 2K0GA 1S2EA 2R061 1R083 4AQ6A 5LW9A 4JDMA 1Q8PA 2VBPA 4NWVA 1VRH1 4YZ4A 4BHPA 5T5OA 3O1OA 4D6SA 4HLTA 3EYPA 5FAXA 3I54A 3TAYA 2VOWA 1L7QA 2AC1A 3ZKYA 2C1FA 4COVA 2PLV3 1X33A 2E26A 5HV0A 2LS6A 3AMQA 4RR3A 1AYN1 1UMZA 1PVC3 4AQ2A 2XPJA 2WRAA 3NAPC 1QQP2 1CPNA 2YU2A 1IS4A 1O59A 4GD4A 4CXWA 1UZZA 4OI0A 2W94A 4A45A 3ZYFA 5KHGA 2PLV1 3POBA 5A80A 1BJQA 3J8F3 4FOYA 1XU1A 5A6YA 1CAUA 1HRI3 5J37A 5IVVA 3HEIA 3MV11 4MG2A 2YXSA 3FZ3A 2G9ZA 1RUH3 1DF0A 3OSDA 1AR72 1GP6A 1DLCA 1LESA 2Y64A 3DECA 4GZ9A 4Q4W3 2IVJA 1J3QA 4QM9A 2ZMLA 4FPGA 1OBNA 3C7FA 1VBB1 5CFCA 1DQ0A 2WC2A 4K20A 4E2GA 4CPBA 3RZZA 1OUXA 1BK1A 1UMHA 1MZ5A 3F95A 3VKMA 3IB3A 2DV9A 4EN0A 3ORJA 2HWC3 2VZTA 2EIEA 2WYSA 4KMQA 4AHXA 4FPJA 1RUD2 5FY8A 3ZXGA 2ILMA 1O8PA 2VBDA 4JX0A 5GKAC 4FSJA 1ZA7A 2IXHA 4QXBA 3MIDA 1LU1A 3ZM8A 1GWKA 4K8RB 2ID4A 4EE2A 4EWDA 3PMEA 4MGKE 1DCSA 1RUC2 1XC6A 3ZN6A 4LJHA 4Z2AA 4FVVA 3PNAA 4CVUA 4QAWA 1WW5A 3VDDB 4Q8KA 1X8EA 3LSEA 2R072 3M3EA 5DQ0A 1CIYA 4MO3M 1UAIA 3LSDA 2Q4SA 4O9GA 4JCKA 4AFMA 5FZCA 5CG8A 3TEYA 1CZVA 3PU8A 4XJ9A 2GP5A 1W9TA 4UW5A 2WAAA 1J84A 2QDNA 2QKDA 3VL9A 5FPZA 1ULCA 2JENA 4Q4W1 4UFLA 3WW4A 4Q26A 4Q29A 1KITA 1VP6A 1HLCA 4IV3B 4AR2A 1IPJA 2HKXA 1LOAA 4N53A 4PT6A 3D0SA 4MZUA 4IESA 2PAKA 4MYEA 4XQWA 3HNYM 1R091 1W6OA 2JB4A 2VW0A 2C0ZA 2D5FA 3FWEA 4I0BA 1AJKA 1S4CA 4A6SA 4ET7A 1UPIA 1PO23 1TMF3 4P9WA 2W0XA 1PK6B 1W6QB 4Q1PA 2YHJA 4CEWC 3O1SA 1D0HA 3TNPB 3WDUA 4K3UA 3VD5A 2ZGMA 3INAA 1O5LA 3WG3A 3CL1A 4EYUA 2DUOA 3N9PA 2XH6A 5FZ9A 5IVEA 2BP6A 2FCTA 3ZFFB 2VTFA 1TEIA 1PVC1 3PU3A 4B7EA 4NHYA 2FDKA 3ME2A 3FX3A 3N7KA 3NMBA 3E6CC 3J4UH 2K2SA 1V6OA 3TBDA 3N4MA 4DY3A 3GHMA 4E8DA 4QQLA 2ZGTA 4BQWA 4URAA 4OQ9A 2XLFA 2GALA 4FOWA 4BH9A 4UW3A 4JKMA 3FBYA 1AVBA 4QXHA 3OD4A 1K3IA 4GAZA 5A33A 1JMUB 1OA3A 1PZ7A 3VBUA 1NQJA 4XUOA 5B4NA 1PHMA 3M3IA 5C5UA 5FYTA 5AVPA 1GP5A 1DGWX 3P3PA 1R082 3CZJA 3QCWA 1QJY3 5DG1A 4Z07A 3VLBB 2RMU3 2ZGRA 3PUSA 1Q5OA 4I0AA 1VPHA 2XGXA 1F35A 5A3WA 4TLFA 4LE4A 2VQAA 1W06A 3MW3A 5LRRA 2A5ZA 2KXLA
chains in the Genus database with same CATH topology
2PHFA 4QPIC 2GMPA 4BYYA 5CB7A 2FMDA 2Z69A 5JPMB 2PHTA 2Y0OA 1FXZA 3POSA 1S55A 3MDPA 2FQPA 3VBOB 4P5HA 4IV1B 4M0NA 5CAZA 3MEPA 3B69A 3TB0A 5B2GB 1RVF2 1AR73 2WIIB 2FZ1A 3FBMA 1RUI3 3FLTA 1ZBA1 1QGLA 1WMFA 2P34A 4OHZA 4SBVA 2PAMA 4B4RA 1ENXA 4RS5B 4NN0A 1YFWA 3V0AA 4HK9A 3ZYJB 3R4UA 2OZ6A 1MS1A 4AFBA 4NWWA 1GV9A 2ZCWA 1VAVA 3LGRA 2HWC2 1LJ7A 3AMHA 4KWJA 3D5OA 1ZZCA 2WT2A 3D8CA 3MPBA 4RL7A 4DOUA 3MGUA 5FBZA 3TWIA 3ZIXA 1RUE2 1VBD1 1Y3TA 4MGIE 2CAUA 4KNCA 4GMP3 1IQAA 5KXDA 1NY72 3FHIB 4LULA 3WDWA 3V0BB 1RHI1 2B46X 4UW6A 1YFUA 4XFGA 4AEMA 3B01A 4WVMA 3VBHA 1U12A 1KD7A 5K0UA 5C8CA 4NR1A 4RSUA 1DQ1A 2QDRA 5KWRA 2X53S 3AK0A 5KHJA 3ZXAC 2VVDA 3WQ0A 2JKBA 4R9AA 4B8EA 5J48A 1KXGA 4LE3A 4I01A 1LOFC 5ABJB 1D0GA 3N7LA 1IKQA 4HZFA 1MQTC 1LKNA 2FBEA 2EIGA 2E63A 2IXIA 1B35C 3AMNA 3MIFA 2WA4A 4A2UA 1GZWA 3N36A 2A6VA 4AVTA 3X29B 4P9IA 2MPFA 1CD3G 3M3CA 3FFZA 1KDKA 3NAPB 2W08A 1V9U1 5KC5A 1AJOA 1WMDA 1BMV2 1TMF2 5LK5A 2OYZA 1DHKB 1NCRA 1A78A 2D6PA 4AHZA 4Y20A 2ZBJA 4PLNA 2D6OX 1ALYA 3L2YA 2WSVA 2A5ZA 4XFAA 5LEJA 1SLBA 3NV1A 2VUAA 2WS92 4LO5B 4QM8A 4LHNA 1M4WA 2RM23 1OPOA 4XFIA 1D4M1 4KU7A 3P3NA 3KT1A 4K6BA 1NXD1 1JUHA 4KQ7A 5DDJ1 4AW7A 5D8AB 5KC6A 4R9DA 4WVZA 2D5HA 3LA7A 4YGCA 3VBUC 1POV1 1UIKA 1CESA 1TME2 2CY6A 4IQPA 3NWKA 3T1LA 4AEKA 5C33A 1H2MA 4AI0A 5KHIA 1TNRA 2ZAHA 3H1WA 4JRLA 3V0BA 1DQ6A 3RDIA 1V6NA 3H0OA 1ASJ1 5H9PA 2IXLA 3VN4A 4GMP0 1WMEA 3JQXA 3AX4A 5KXBA 2R062 4CDXC 3RYKA 1FOD1 4Q4Y3 4CDUB 4LBJA 4K1ZA 1AR83 1K5MA 2IXJA 4UBGA 2DTYA 1KFUL 1JTZX 3MFCA 4LA3A 1VBD3 4N9HA 1EP0A 2XG3A 1YFYA 3B94A 4ISQA 1OOPA 1QQP1 2DUQA 1EV12 3PVOA 1GZWB 5AC93 3WP3A 1RVF3 1I6XA 4PLMA 1O4YA 4QGMA 4FQ4A 5EYYA 1O5UA 2Q8OA 1AL21 2HEWF 4BPZA 1COV2 1OA2A 2XJSA 2ZHLA 1NXMA 1H30A 2A7AA 1E57A 5CU1A 1NCRB 1RUG2 2D6KA 1VBC3 1YYNA 3WP5A 4LUMA 4FXKB 2WZR2 4OHWA 2R042 2LM3A 1BCXA 1DGWA 4FOVA 2CYFA 4AVVA 2X29A 4LBOA 3LB9A 1WD3A 2QNKA 1CAUB 2YUEA 4I02A 1SBFA 3HT1A 4LT5A 1GZ9A 1ASJ3 2XL7A 4FPHA 4E27A 4YZ2A 4L2NA 2H6BA 5CFCB 2B5HA 1IGOA 3H7JA 4GWMA 5T55A 2BNNA 2E7TA 3BPZA 5A3LA 1PNGA 2ZGNA 3DPRC 1GFF2 2EXKA 4BM8A 4N43C 4AYUA 1NCRC 1D2QA 3E5QA 5I93A 1NE4A 1TQ5A 1UD1A 3B93A 5JVVA 1WBFA 4KU8A 3WOGA 4E9KA 3R05A 1PZ8A 1YRZA 4A7ZA 1G9CA 1RIRA 4B4PA 4CEYC 4MV2A 3UJQA 3O7OA 1CVNA 1LB2A 3TNQA 1K5MB 1GICA 2OZJA 4Y1VA 2ET7A 2PHWA 4DQAA 2YMZA 4P9LA 4I3GA 4FP3A 5GZGA 4BLIA 4YGBA 4E2SA 2JG9A 3KD4A 1S0JA 1MS4A 4X6QB 4IERA 1RUI1 1SCSA 1S0CA 5GALA 4HETA 2EVXA 2CNAA 4KH9A 4XOGA 1S0EA 3ZFGA 1Z7S2 2O0OA 3AXDA 5C8CC 4AG4A 2QUOA 3SH4A 4PIZA 3SITA 2ZGKA 2CL2A 3WX5A 1LCLA 3POWA 2R16A 1LHNA 4N53B 1FV2A 3WW3A 3ZSEA 1H4HA 1F31A 3HIFA 1ENQA 3VBFA 1O3SA 4RS5C 5J96B 1ND2B 5FOBB 1BZWA 2YDEA 3DKWA 2X5IC 1S1AA 2A3WA 3OCPA 4M00A 1VBA1 3WNXA 1NA1C 1ZZ7A 4K8FA 1PK6A 1W6QA 1MS8A 3GZAA 1OD5A 4FTEA 1VR3A 5H9SA 5BNPA 5FQ0A 1V6JA 3JBG2 4IETA 3ZSKA 2I2SA 3J8F2 4Q1RA 4FPEA 1WW7A 4XIKA 1NLRA 1J58A 3B9CA 2RM21 2A73B 1KJLA 4YSFA 3MIHA 2GAUA 1Z78A 3WP4A 4MH0E 5T52A 4EN6B 5T54A 4JV4A 1FPN2 1J1LA 1POV0 2ZMNA 3KLSA 5DZGA 3KCXA 4WM7A 1EAH2 3KT4A 1DGRN 1D4VB 2E6VA 2JDZA 3CJXA 4YW3A 1LGNA 1Q3EA 2CV6A 2ZAAA 3MPPG 5EFUA 1RUD3 1C57A 3MZHA 4WVWA 2IWGB 4Y1YA 4WM7C 2ATFA 1RUNA 5FLHA 4AGVA 4ASLA 3VBOC 1I9RA 2DVAA 1H4GA 2XLAA 5LRSA 4IEOA 1B35B 2GNDA 3ZFFA 3O14A 1DG6A 2R043 2XBO2 3UV9A 5C4WB 1IHMA 2MEV3 2PHDA 3WHUA 1F8VA 1UU5A 3AXEA 1FV3A 2UY8A 2V5YA 5GZEA 4H55A 2ZABA 4IXLA 1YI7A 3N7JA 1BVVA 1HDKA 3ALQA 3ELNA 3PJYA 3OGGA 4RHV3 3B02A 4L97A 3MW4A 2RS33 2CGOA 5F5QA 4NPRA 2BW8A 2VQ0A 5GLZA 1OLQA 3NW4A 4FPOB 4YVWB 4RQPB 2D6NA 1AR91 4Y22A 1Q8OA 3FUQA 1F5JA 3O0WA 2VMHA 5E16A 2CAVA 3AYCA 3IIAA 3WCSA 4LBQD 1ZX5A 5EJ3A 1SCRA 1MEC2 1PO22 1REEA 4AVCA 3AZZA 2VH9A 1FI2A 1QJX1 4HPKA 4BLJA 1JW6A 1QXJA 2RR11 2ZTNA 3U07A 4IV1A 2QZ2A 3NO8A 2WT1A 4GB31 4G4FA 3SH5A 2MHFA 3SMHA 2X8KA 4YG3A 1YJLA 1GYKA 3VBHB 4RFT0 3WP6A 4C1WA 2D3RA 4LBQA 3E6DA 2DU0A 3JCIA 4HK8A 4YGDA 2ZMKA 3IDCB 3ILFA 3QH7A 4RQPC 4FQZA 1Z7S3 4YFZA 1G9FA 4AE2A 4XPVA 5DZFA 1LHVA 2WFPA 2VY0A 3AJZA 3H3UA 2SBAA 1AX1A 1Q8VA 4RGAA 1V6KA 3J26N 4IEZA 3NL1A 3WUDA 3ZXFA 1JUIA 1XNCA 2WFF1 2VXRA 3NAPA 3ZO0B 3KCCA 1I3HA 5K0UC 1QDCA 4AHWA 4C90A 3WVJA 1W6PA 1VBA3 1LOCA 2DWRA 4X8NA 2BVBA 2EAAA 3UKNA 4KG8A 3GHNA 2EA7A 4B29A 1ZBE2 1T6GC 5CFCC 1SFNA 2XHKA 3B9IA 1FATA 3BIWE 3D0JA 5A3MA 1DDLA 1TE1B 5DDJ3 4Y22B 3ZIWA 3C3VA 4EWEA 4KBBA 3AYEA 3RMXA 4MXVA 3OTFA 5IUQA 3DPRB 4C91A 1ZM1A 2F4PA 1ZZ8A 1EAH3 4HPKB 3IDEA 1VBB2 4HT1T 1HXS1 4CDWA 4WV8A 4RR3C 5L7OA 1MQTB 2Z5WA 1A3KA 1V70A 5T5PA 1GBGA 4YW2A 3WY6A 1J1TA 5C6CA 3B5LB 3SH3A 1CONA 1K5MC 1YJKA 4XE9A 1RUD1 1UL9A 4CEWB 4M3CB 4WVVA 3ZXLA 4LBQB 2WFF3 5BUVA 4AVAA 2FMYA 3VL8A 4CDXA 3B7MA 1BEV2 4OFGA 2RMU1 2MEV2 2XUMA 2DF7A 1DLLA 2C9AA 3I59B 4XFHA 2ZOEB 4QXKA 2NQYA 5T5LA 2ZJCA 4XJUA 1UKGA 1HX6A 1URXA 4BE3A 1RMU2 3LA3A 4N7UA 2WQ4A 2D3PA 3NV2A 5FREA 5HCBA 5I0SA 5CBLA 3ZFEB 5BXXA 2NM1A 1H1IA 4YM2A 3N7MA 4YW5A 4K40A 1A6CA 3DN7A 4FTSA 4CP0A 5AC91 2ZX4A 1FMD1 4U36A 4QPYA 4Z92B 5HI0A 2ZHMA 4XFCA 1HQWA 4N90A 2X5IA 1JYCA 4YM0A 3WR0A 1ENRA 1IKPA 2PHUA 4EV0A 1FMD3 4YZ1A 3VV1A 1RUF2 4N7IA 4Q4X1 5SV5A 1GQGA 1W2UA 1WBLA 3WDTA 1JH5A 3PVNA 5J98B 2D97A 1UN1A 1HV0A 4AGRA 4I2OA 2QCSB 4QHBA 2AYHA 1ZBA3 1AHSA 3ZFGC 2GH2A 5BNOC 4FTBA 3A4UA 2P37A 1MQTA 4NO4A 4U2AA 2VPVA 2I45A 4TSVA 4JGYC 3I8TA 3BOWA 4Y1UA 3PJQA 4P9YA 1PO11 4S2DA 1KDMA 1QQP3 2A6ZA 2ZZJA 3RJRA 5JSPA 3ENRA 2D3SA 3WCRA 1GSLA 5IK8A 4GB33 2D43A 1AYN2 3ZYIB 2B7YA 4GH4C 2R063 1DU3D 2XJRA 1RUH2 4IEYA 1QKQA 1HRV2 2HWD2 4FBFA 1KFXL 2LUWA 4RA0A 4DS0A 3VZNA 1XYNA 4N43A 3S0MA 4COZA 1VBA2 3ZFGB 1LOGA 4XMAA 5JOWA 4JRAA 1R092 3AB0A 1W6MA 1YIPA 4LBKA 4G9SB 2HWF1 2ZGOA 1V9U3 2YY1A 1ZBE3 2YROA 4Y1XA 3WINE 5LK7B 1PGL1 2BTVC 4FPLA 4ORFA 3MF9A 2XJUA 3M7AA 3RI8A 4AFCA 1VRH2 3LWCA 2BWCA 2OUJA 1QJZA 1JXNA 2VG9A 3JQWA 2D93A 2DVGA 4K9SA 2ZX0A 2JX9A 3ROUA 3M1HA 1AL0G 3RG0A 4QQOA 5FDBA 3V56A 5K7PA 3ZFEC 1QJU2 1ULDA 3H9AA 1H2LA 2IFRA 4P14A 4BWOA 2OW4A 2GN7A 4FO9A 3OBRA 4IEVA 1CQ9A 3CF6E 5T5JA 1PIV2 2BEOA 4ZU5A 4CRQA 4H14A 2PHRA 1MZFA 2ETEA 2TBVA 1GNZA 2R071 2P3IA 1ND3A 1BEV3 1ZRDA 4YYOA 2JD4A 2RS53 4WM7B 1OOPC 3E97A 3ZSMA 2BBVA 3CNAA 3GNEA 4FT8A 4CTEA 4HFSA 1ND2A 2XBO1 1BBT1 1RC6A 2GZWA 1H2KA 4ZXKA 1ULEA 2F6BA 2H0BA 3VBSC 4DRRA 3FE5A 2P17A 4NOTA 1LOBA 2RS13 2ZHKA 1AR62 1NA1A 1VB2A 1WW4A 3ZYGA 3QBQA 1BBT3 1DZQA 3M70A 5ACA3 2R1BA 3RI9A 1YNAA 1WLWA 5L73A 2RE9A 5JI9A 4WBBA 4XMIA 5DZEA 4M0HA 4CDUC 5C4WA 4ATFA 5FCCA 2UYBA 4XF4A 1PK6C 2PLV2 2DCJA 2EXJA 2JE9A 4Q27A 2VOXA 4PIXA 5JCTA 1IS6A 2VVEA 3LAGA 2JG9C 4AVSA 5JOXA 1Q43A 3ZN6B 1SMVA 2ZACA 2NP0A 4R4ZA 5FMOS 4CDQC 5C9AB 1Y9QA 1CIWA 2VGDA 2AENA 1SDWA 3GBFA 2EF6A 4QD2A 4RQPA 4S2GA 3WT3A 3WQ7A 3ATGA 4ASMB 4ONUA 1S2BA 3L2HA 3E6BA 2AR6A 3CO2A 4XIOA 4ZU4A 1V6IA 3T1MA 4OI4A 1D4M2 2WNVC 1VBC1 1B35A 1WUVA 4XXPA 1KS5A 5JOYA 3VHNA 1F9KA 3KCYA 3AYDA 2IXKA 1LOFA 2RS31 3POYA 2DURA 3M3QA 4WM8B 4IV3A 2JXAA 4ES8A 3JBG3 1GANA 4IEXA 2NMNA 1DQ5A 3QLQA 2RJKA 2YC0A 1VBE1 4PBOA 3A0NA 1ZYBA 3O0VA 4LHKA 2I74A 4Y26A 2HWE2 3FFQA 3S7EA 4L9BA 1NCQB 2ARBA 3AKTA 1QY4A 4CEYA 1RUI2 2GH8A 2P2KA 3Q9OA 1RINA 2DUPA 4OUMA 5CFDC 1J3PA 1FPN3 3OD0A 2XKOA 1VJ2A 4L92A 3IN9A 1RUC3 2HWB1 4BIOA 2EAKA 4GWNA 3VBRB 1DZTA 4YVWA 4IV3C 1W39A 4LBLA 4HVRA 1V9U2 5L36A 4YVWC 1QH6A 3AP7A 4MXWB 1XXNA 1GR3A 4Q8LA 5H9QA 1QWRA 2RS51 1RUE3 4COYA 3K51A 1O4ZA 4QT6A 1EPWA 3TRSB 3FMGA 2XWBB 1MS0A 2PQQA 4G3YC 1OMIA 1AR71 2WNUC 3C2UA 4AEDA 3AKPA 4Q4V2 4CZSA 1QJU3 2UWBA 5A33B 4BQ1A 1H1AA 1W6PB 4Q4X3 1PGW1 2UWCA 3I7DA 3A0KA 2Y38A 3VZMA 1O7FA 4QQ2A 5AFBA 1S0BA 3MF6A 1R1A3 1VAKA 4XQ4A 1JN2P 1HRI1 1RUJ2 4I3PA 5EV7A 4PBPA 1O3QA 2JE7A 3TOJA 5I0TA 4LNVA 4YARA 1JOJA 2ZGLA 4SLIA 4KGGA 4XJAA 5JSRA 3KMHA 1SLLA 1DQ2A 2YGLA 1EAH1 3FLRA 3HBZA 3VZLA 4QU2A 5BYNA 1PM7A