5GZFA

Galectin-8 n-terminal domain carbohydrate recognition domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzfA00
1URXA 5IK8A 3N36A 1LENA 1QMJA 2V73A 5GALA 3WHUA 5E8AA 5KXBA 3R05A 4K20A 1J1TA 1YI7A 1WD4A 1AX1A 3D5OA 3OYWA 2R1DA 3H0OA 4IQPA 1IKPA 4ISRA 4XJ8A 3ZXJA 2E7QA 4K21A 4LBMA 2ES3A 4M3CF 2JDZA 2WNEA 3A0NA 4CRQA 4FOWA 3APBA 2A3WA 2ZGKA 1DHKB 1UZZA 2P2KA 1W6MA 1KDMA 4YW4A 4AYUA 4DRVA 1IS5A 2EXKA 3GALA 4M3CB 3RMXA 3SISA 3I8TA 3AZVA 3R4UA 4XBLA 2ERFA 1QF3A 3MW4A 1CVNA 2DTWA 2NN8A 1RIRA 3WLUA 3NV3A 3WZ1A 1LESA 1Q8PA 3PVNA 2D3RA 2ZMLA 3ASIA 4YZ2A 1SLLA 4AWDA 1SFYA 1ENRA 2ZZJA 5GLVA 2GDFA 1LU2A 5FRAA 1V6LA 2VY0A 4Y1YA 2DWRA 3AX4A 3M3EA 1HLCA 2W68A 1WW6A 1AX0A 4FPCA 2A3XA 5GZFA 1OKQA 2WQZC 3ILRA 5JVVA 5GZDA 4FP3A 3AP7A 3JU9A 2JJ6A 2SLIA 3GNEA 4YG6A 5GLTA 1W6NA 5H9SA 4FOQA 1G9BA 1IS3A 1LTEA 1DQ5A 4Q27A 1Q8SA 1LU1A 4Q8KA 4Q8LA 4ZXKA 5JOWA 3WUDA 3ZPYA 3LCPA 3NV4A 2D3SA 4HANA 3D4KA 3HMYA 2YZ4A 4XJAA 2PHUA 3ATGA 3POSA 1S0IA 5KXCA 2PELA 1LEDA 2A6XA 2ZBJA 3C2UA 1ULGA 2D3PA 2ZGUA 2P37A 4YGCA 4LBQB 3UJOA 5DUXA 1N3OA 3IPVA 4W65A 1F31A 3VV1A 2ZHKA 2E51A 4GKYA 4Y24A 1QDOA 1MZ5A 3WCSA 4FPKA 4XMAA 1APNA 1LCLA 2A5ZA 3AP4A 5DUUA 1U0AA 2ZGSA 1UAIA 1XQNA 4BMEA 1CN1A 2WLQA 5L73A 5KXEA 3AZZA 2AYHA 1JYIA 4XJZA 3WDYA 3LSDA 3VKNA 2AH2A 3MPPG 1UKGA 1SLAA 1UL9A 2RHPA 3M3CA 4F83A 1FNZA 1I3HA 1DFQA 3BIWE 4FPGA 2A3YA 2EXHA 5H9PA 1HQLA 2P34A 1KJRA 1G9FA 2LTNA 2C9AA 4ITCA 4Y22A 3AYCA 4Q26A 3SLIA 4UW4A 2EXJA 2JE7A 2VU9A 1H9PA 2R0FA 3AXDA 1W0OA 5IT6A 1S0CA 2ZKNA 1RITA 2R0HA 2GNMA 1LGBA 3AP6A 1WD3A 2PHRA 4I30A 1ZA4A 3ZSKA 1DBNA 2HYKA 5CA6A 4YM0A 4JC1A 4YM2A 2ZGPA 2VW2A 4BPZA 1EPWA 4P9WA 1TEIA 1MS5A 1ENSA 1VIWB 2NZ9A 4H55A 4XBQA 3SH5A 1YO8A 3OPZA 5T55A 2ZGMA 1KITA 2DUQA 5IUQA 4YG3A 3RRDA 3POWA 1FATA 2AREA 3BODA 5JMCA 4LBNA 1Q8OA 4R9DA 2YROA 1F9KA 3ZVXA 2ARXA 2VH9A 2E53A 2C5DA 1JXNA 3VKFC 1SACA 5AVAA 1S0FA 2ZMKA 1MVQA 5CNAA 1S0JA 1V6KA 4Y26A 3VKLA 1SCSA 5T5OA 2E6VA 1WCSA 5T52A 1DYPA 3W59A 4TZDA 2WT1A 5DG2A 1N3QA 4Z8BA 1ENQA 3ZXKA 3N3HA 3U4XA 5GLUA 5GM0A 3V0BB 2OUJA 5KXDA 1LOBA 1GICA 1QOSA 1W6PB 2PHXA 4FQ4A 1LOCA 1V6JA 1Z0HA 1SBDA 2KM2A 4DFSA 1V6IA 2EALA 2H0BA 4C1WA 1WLCA 4DPNA 5CAZA 1DQ6A 1CPNA 1QOOA 3OY8B 3PMEA 3TB0A 2R1BA 4FPYA 4DRRA 3A0KA 4AVTA 4M01A 4XILA 2NM1A 2G4IA 1WW4A 3UL2A 2R49A 4WV8A 1QU0A 2VUAA 5H9QA 1WBLA 1F5FA 3WOGA 4YZ1A 2GALA 1CPMA 3N7MA 4BLJA 1G86A 1LOFA 1FYUA 3B3QE 1DYKA 2NMOA 2GN7A 3OGGA 4NOTA 4FPFA 3WDUA 4LBOA 2W39A 1WLWA 1D2SA 3I4IA 5EWSA 1LJ7A 4XTMA 2DU1A 2D6MA 3T1MA 4ASMB 3IKWA 3PVEA 1C1FA 2ZAAA 1MS4A 4PBPA 3NV1A 3NV2A 4UW3A 1S0DA 2ZGRA 4XDQA 2DVGA 5EXOA 3KQRA 3OY8A 5IK5A 1GANA 1A8DA 1G8WA 4U2AA 3L2YA 4M3CA 4D69A 3AZWA 4DS0A 1S0EA 2A70A 1AXZA 2YXSA 4UW6A 3IM0A 4YFWA 2GNBA 1AXKA 1QKQA 1CJPA 3O0VA 2YMZA 3N7LA 3V64A 1WBFA 1CQ9A 4PF5A 3ZSMA 1ULDA 2D7FA 4U36A 3ZSLA 1G9CA 4XMIA 5E89A 4BQ1A 3T2TA 4PCRA 3N7KA 1BZWA 1IKQA 1DGLA 2DURA 2R16A 1BXHA 1DQ1A 2WSVA 1A78A 1DQ0A 1LOGA 1W6QB 2YY1A 5DZEA 4BMBA 2D6LX 2A6VA 2BQPA 1UN1A 4XJ9A 4XHBA 2TEPA 2UU8A 1HDKA 1MACA 3AJZA 1GZWB 3NWKA 1QDCA 4Q2FA 1NXD1 4Y1VA 2DVBA 1HKDA 4FPHA 4XXAA 1KRIA 4YW5A 1MZ6A 5GLWA 1CESA 5JOYA 2D6OX 1JYCA 1X50A 1YXWA 1AZDA 2PHWA 2YV8A 4AVVA 4WZFA 1FAYA 5HCBA 5SV8A 1SBFA 2CWSA 2D43A 3BTAA 1LHUA 4NO4A 4XJWA 1UMZA 2VW0A 1V6MA 2JD4A 4XHXA 3WUCA 2AUYA 2GNTA 1FX5A 5LK5A 1LEMA 4P9XA 3WNXA 1JUIA 5T5LA 2GN3A 2DVAA 1LECA 2ZGLA 2WSUA 4Y20B 1GBGA 1LOFC 3INAA 2UURA 1S0BA 4LBQA 1GNHA 2ZHMA 2LALA 3D6EA 3ZXLA 1UPSA 3N7JA 5GJ6A 1W6OB 3OJBA 2GNDA 3FBYA 1GLHA 5FREA 1ULFA 1MS9A 5H9RA 4DQAA 1G9AA 4MYEA 3AXEA 1MS8A 1ULEA 2VW1A 3KM5A 3AZYA 3FUQA 5F5QA 3AYDA 3RQ0A 1JOJA 3MW3A 1MS1A 2D6KA 3M1HA 3UJQA 3N35A 2ZMNA 5GLZA 3WG4A 3O5SA 5DUWA 1N47A 2GMMA 2DUOA 3VUOA 4ZKTB 2WJSA 4XIKA 2EF6A 2OUHA 2NP0A 3M2MA 4RA0A 1BQPA 1ZM1A 2FHRA 1PZ7A 3B00A 3USUB 3VKMA 4CZSA 2I2SA 1YYNA 5DZFA 3WDXA 3OBTA 1LODA 4UW5A 3SNMA 1AXYA 2PHFA 3V0AB 3Q9OA 2GMPA 3V65A 1WUVA 1N1VA 3HR9A 3LSEA 1QNYA 1NLSA 1YRZA 5DUVA 1GZ9A 3RMYA 4XJUA 1SLIA 3IN9A 3OYWB 1LHOA 3ZXEA 2ZGOA 4YZ5A 4KBBA 1D0HA 2WKKA 3AK0A 4CTEA 4GA9A 3B01A 4M3CE 2CL2A 1I1EA 1W6MB 1GKBA 1QNWA 1MVEA 1QGLA 3WG1A 1DIWA 4YW3A 4HL0A 4RL7A 4LBJA 2ARBA 2A6ZA 3HN1A 1SCRA 2ZGTA 1Q8QA 1V00A 1KDKA 1SBEA 4FPJA 2E7TA 3MEPA 4YZ4A 5BYNA 1FV2A 1MR5A 1C4RA 2ZHNA 3QLQA 3B9CA 4PBOA 5HCAA 2FMDA 2NMNA 3BOPA 1HQWA 4BLIA 1AJKA 3AYAA 1GSLA 2D6NA 3B69A 1S0GA 4WVWA 2OVUA 5T5PA 1QOTA 1VALA 1DZQA 3MW2A 3M3OA 2DVDA 3V0BA 1SLBA 2DV9A 1W6PA 4AGGA 1FV3A 1UX6A 1AVBA 3AP9A 3SITA 1WW5A 3UK9A 5JOXA 1BKZA 3O0XA 5HCFA 2ZGNA 2A6WA 1JN2P 2JE9A 3JUUA 3AZXA 4PQ9A 4YFZA 1Q56A 4FVVA 5T5JA 1VAVA 2SBAA 1CIWA 5DG1A 3WG2A 2XB6C 2A6YA 5DXDA 3WDVA 1W6NB 4JCKA 1B09A 2CYFA 1BJQA 3WCRA 1LULA 1GNZA 1S1AA 1V6NA 1W0PA 1LHNA 1WLDA 4FQZA 5CBLA 2PHTA 3AP5A 4P9YA 1AJOA 1Z78A 2ZA9A 4XIOA 1O4YA 4SLIA 5IK7A 1A3KA 1KJLA 2OW4A 1DQ2A 3O0WA 4R9BA 1N1TA 4ISQA 2AR6A 3CNAA 1N3PA 3ILFA 3IPVB 2A71A 3O12A 1SLCA 1C1LA 2D6PA 4AVSA 3SH4A 2ZHLA 1IS4A 2Q5TA 2EAKA 3VKOA 4L8QA 1LHWA 4GKXA 4ATEA 1MS3A 3WHTA 2ZABA 1LGNA 5DZGA 2CY6A 3POYA 2DU0A 4Y1XA 3WVJA 4GXLA 3RS6A 4YW1A 2V5YA 4WVVA 4Y1UA 4YZ3A 4XBNA 3FUOA 3IMNA 5EYXA 3AJYA 2DYCA 4XE9A 1MS0A 2CNAA 4LBKA 5F9TA 2NYYA 5T50A 4YGEA 4FOYA 3RG0A 3ENRA 2CWMA 2B7YA 1W6QA 1DQ4A 4K1YA 4Y22B 2WT2A 3QCWA 3PJQA 2P3JA 1N1SA 1FNYA 5T54A 2UWBA 4YM3A 4Y1ZA 2W08A 4XZPA 2ZACA 5JLVA 1OQ1A 4OZXA 4R9AA 1GZWA 1OFSA 1G9DA 1H30A 4TYSA 3W58A 3ZSJA 2GMEA 1SLTA 1V6OA 2ZGQA 4FPLA 5IK4A 3A4UA 1KQRA 5CB7A 1PZ9A 4YGDA 1PZ8A 1CR7A 3R4SA 3SH3A 1N1YA 3DUIA 4BM8A 4BOWA 4YGBA 5E88A 1LOEA 3WV6A 3T1LA 1VLNA 1DLLA 2AGSA 3FFZA 1LOAA 3ZXFA 1JBCA 3TAYA 4ATFA 1IS6A 1O4ZA 2DVFA 3FLTA 1GV9A 1JW6A 1GZCA 3FLRA 1AF9A 3AYEA 4GWNA 4Y20A 4R9CA 3AFKA 1UZYA 1CONA 1WW7A 2UWCA 2Z42A 4XYXA 5GZGA 4XTPA 5GZEA 2AENA 2P3KA 5GZCA 2JECA 3WG3A 1W6OA 3WDTA 1Y7BA 4GALA 4YM1A 4XXPA 2W52A 4FPEA 1GYKA 1VAMA 1IOAA 2D44A 2A75A 5JOZA 1LGCA 4FPOB 3ILNA 1JHNA 1ONAA 1R1ZA 2CTVA 5EYYA 1G7YA 1BYHA 3V0AA 1RINA 3ZYRA 2A7AA 1ULCA 2UWAA 3PVOA 2DTYA 4LBQD 4LBLA 4M00A 1YIFA 2P3IA 2DUPA 2JKBA 3OBRA 4YLZA 2XG3A 3ZYPA 4C1XA 4AGRA 2ENRA 1H9WA 1Q8VA 3M3QA 4FP2A 1LHVA 3USUA 5JDBA 4YW2A 4AGVA 2EXIA 3DGTA 4P14A 4Q1PA 1AX2A 3WDWA 4GWMA 2EIGA 2VXRA 3FLPA 3RSJA 2WT0A 4FOVA 4K1ZA 1C57A 4XOGA 4JRAA 4YG0A 4Q1RA
chains in the Genus database with same CATH superfamily
3TBDA 2XJUA 4I3GA 2DCKA 1ND2A 3VBSB 2PA7A 3WHUA 2Y6KA 2Y6JA 5E8AA 1COV2 3R05A 4LQRA 3B93A 5A80A 1AX1A 4XZUG 3OYWA 4QHOA 4DEQA 1H6YA 2E31A 3H0OA 4RS5B 4XJ8A 4HVQA 2E7QA 2J1TA 3GDBA 4A7YA 2QZ3A 5CYYA 2ZGKA 1B35A 1DHKB 5LBCA 4CDUC 4YSFA 3KQ4B 3WQ1A 3ZFFA 4DRVA 5KHJA 4BIFA 2WZR3 3RMXA 1U5ZA 5FDBA 3CZJA 4XBLA 1RJ8A 2Z4FA 3DECA 2WZR1 2DTWA 2NN8A 3NV3A 3WZ1A 1LESA 2YBPA 1PO23 1Q8PA 4PLOA 3O1VA 2YC2A 1KGYA 1REFA 3WNKA 2ADDA 1QJFA 4YZ2A 2HBUA 1SLLA 4I02A 1PO21 5F5IA 1JYXA 4AWDA 1SFYA 2ILMA 5LY1A 2ZZJA 5GLVA 1YFXA 1UIJA 3MF6A 2CAVA 4AR2A 2YGMA 1FOD3 3VBHB 4GAZA 2V4VA 2BOIA 3GBGA 1FOD1 1XC6A 3M3EA 1X33A 2Q1ZB 4RR3A 1WW6A 4FPCA 2JB4A 3VBRC 1OKQA 3ZM8A 3AP7A 2TUNA 3PMSA 3LEMA 2WO1A 3MFCA 1FMD2 4LK7A 4YG6A 3AVSA 1NAEA 4XUOA 5H9SA 1LTEA 3RYRA 2BGCA 1Q8SA 1LU1A 3WF3A 5JOWA 5C3RA 3WUDA 5A1LA 4DO0A 3LCPA 4PI2A 4XAEA 3R6SA 1FI2A 1YQ2A 4QGLA 4XJAA 3ATGA 1CAVA 1S0IA 2ZBJA 3N9NA 2W2IA 4P08A 2J1UA 1ULGA 3Q8BA 4OUEA 2BJSA 2CU5A 2D3PA 2B5HA 4AVCA 2FMYA 1F35A 2QQPA 2ZHKA 5A3UA 4A6SA 3LDBA 3T4HB 1QDOA 3CHXA 4K8RB 3Q8CA 4L2NA 4XACA 4LKFA 4ZHNA 4LITA 3ALQA 3PUQA 5C7GA 2I74A 4D6RA 1FXZA 1CN1A 1Y9GA 5L9BA 3VHNA 4E4DX 5FK8A 1W9TA 3D0SA 4Q4Y2 3AZZA 2ZEWA 3PHMA 2AYHA 1ZZ7A 1W8WA 2VZRA 3SXWA 1JZ6A 1QWRA 3WDYA 3LSDA 2R042 3VKNA 3BN6A 1LKNA 5LA9A 2DCTA 5FLJA 4F83A 5C4WA 1FNZA 1I3HA 2P6CA 4JDOA 3WNPA 4Q0UA 5H9PA 4NHLA 3TOJA 2WFF1 1YC61 5C5UA 3GCXA 4GH4C 3WQ7A 4LUMA 5FY4A 3N4MA 3J7LA 4TXWA 5FZBA 2RE9A 1H9PA 1H8TB 3AXDA 5J96B 3E5UA 5FYMA 5LEJA 4EWDA 1UF2C 1YCIA 3LWCA 4NRMA 1HRV2 3AL6A 1OFNA 1ENXA 1ZA4A 2IC1A 3CJXA 3EQEA 4I30A 5F2SA 3ZSKA 1VRBA 4JC1A 4YM2A 5LRRA 1C8M1 2VTXJ 1BEV1 4S2GA 4CUCA 1GMMA 1AL21 1EPWA 2OS2A 2NPIA 3C7HA 1ENSA 5FPBA 2NZ9A 1RGSA 5IFPA 4Y3OA 4D6QA 4E8DA 1YQ5A 5C8CC 2RS53 3H50A 2Q30A 4QMAA 2R32A 4YG3A 5A7QA 3ZR6A 1DGRA 3POWA 2G9ZA 1WZXA 4XC9A 2VCAA 3WP3A 2RS51 3BGAA 1O4TA 2C26A 5JMCA 5LZ6A 2W1QA 1RUI3 1Q8OA 4LR4A 1F9KA 2ARXA 2VCBA 2VH9A 1W06A 1RUI1 1UU4A 2RS12 4LKEA 3UKVA 1QQP1 3AKSA 3EJKA 3OG2A 3BYWA 2ZMKA 3F2ZA 3OGJA 1BCXA 2PLV3 2HWF3 2XVKA 1SCSA 1YJLA 3IDBB 4X8PA 1WCSA 4IE6A 3EO6A 3WF4A 1TQ5A 3ZIWA 4EWAA 2PLV1 1VBD3 3VBFA 4A41A 3MUY1 1IGOA 5GM0A 2P6HA 5KXDA 1PGW2 1DGWX 1VBD1 3OEBA 2PHXA 3UGGA 1V6JA 5FZDA 3H8UA 1SBDA 1OVSA 5KC6A 4IXLA 2H0BA 4AAXA 4C1WA 2VL4A 5CAZA 2FDFA 1QOOA 1RUE2 2J22A 3WNOA 2VD7A 2VMFA 4FFIA 4LHKA 2R1BA 4MGZE 3TEYA 4HKWA 1U5YA 2RMU2 4Q4V3 4CEYC 1WW4A 4ZPIA 2UY8A 2WWSA 2VUAA 3TN92 1F5FA 1NUKA 4MG2A 3F95A 3DYMA 4Q4V1 4RQPC 4DXZA 4CU7A 1G86A 1LOFA 4CU6A 2WNVC 3HNBM 4QB6A 1ZRFA 2J7MA 1RHI3 4LBOA 2W39A 4LOSA 1D2SA 3I4IA 4RFT0 3MIHA 1LJ7A 4IE7A 3NJXA 4CA9A 1F4AA 5CU1A 2EIDA 4MHRA 3RZGA 3NKTA 2ZAAA 3GZEA 4PBPA 4RGAA 3NV2A 3VZNA 2XL9A 2XWJB 4KG8A 1S0DA 1RUOA 4D7SA 3KQRA 5IK5A 3OTFA 2LM3A 1A8DA 1XNKA 4U2AA 4M3CA 2XBO2 3LOBA 3AZWA 1BBT3 1PMJX 5C8CA 3RWKX 3VL9A 4JAAA 1VB2A 4YFWA 2GNBA 4URTA 1BBT1 5JZGC 3FJSA 4Q4X2 2BDRA 2VE1A 3V64A 1CQ9A 1HB2A 2CV6A 1JS9A 4U36A 4I0BA 1WKYA 1G9CA 4BK4A 1YEWA 4QGMA 4QHZA 3N7KA 2VULA 1IKQA 3N9PA 3OF1A 3WX5A 2BNOA 2BGPA 2R16A 1BXHA 5KR7A 1W6QB 2Y33A 3ZFEC 3VZJA 5C3QA 1O7FA 2VPVA 1H1MA 2FCVA 2A6VA 5FBJA 4CEWC 2WIIB 1RMU3 2QZ2A 2FCUA 4Q2FA 2W46A 4KU8A 3KD4A 3I2HA 4FPHA 1RMU1 5K7PA 1CIYA 4YW5A 5GLWA 4GZ9A 2D6OX 1ZRIA 4B1MA 2XR4A 2RR13 4CUAA 5A7NA 4HT1T 3WF1A 4L9BA 5CFCC 1NCQB 4AVVA 2J1AA 3H3LA 4YVSB 3BTAA 1LHUA 1OVPA 2OQ6A 1COV3 2VW0A 5FJHA 2JD4A 3I2IA 1JOPA 1GWMA 4W6WA 1COV1 1OC1A 2AUYA 2GC3A 2GNTA 4P9XA 1OA3A 2W5FA 5DAWA 2DVAA 4IV1C 5CVRA 1NKGA 1CAUA 2IVIB 5D8AB 2G9GA 4QHBA 2WSUA 5HPOA 4NUBA 1GBGA 4E4ZA 5HBAA 1SDDB 4Q4W2 3I3EA 2N7GA 4LO5B 5FZ3A 3VBSC 3JCIA 2ZHMA 1SFNA 2LALA 3GCWA 1OQEA 2QQWA 2Z69A 1I5PA 2P1BA 5JWPA 1NYWA 4D8MA 1GQHA 4BIOA 4COWA 3ITQA 1ODMA 1ULEA 3KM5A 1ST8A 4H14A 5FO9B 5F5QA 3CDZB 3RQ0A 1JOJA 3MW3A 1QJY3 3AFGA 3DEMA 3M1HA 1KFXL 2ZMNA 5GLZA 3WG4A 3O5SA 1J1LA 4DXRA 1QJY1 2DUOA 2F6BA 2GMMA 3VUOA 2OUHA 2NP0A 1JZ8A 3B00A 1RTVA 3USUB 5F8PA 3VKMA 2CSGA 4A7KA 3P1IA 3NJYA 3WDXA 4QKFA 3I3MA 2WS92 4UW5A 5DAXA 2Y0OA 4AI2A 2JG8B 1TVGA 1OQDA 3O14A 2W0XA 1AR92 3WP6A 3O1TA 1FMD3 3NMBA 3ZFEA 1ND2B 2QE3A 4UT5A 1T6BX 3VBHC 1QXJA 1UYYA 4GJYA 1MPXA 3KT7A 4ZU5A 1FMD1 4XW3A 1YRZA 2HWB1 3WEZA 2XWBB 1EUUA 3KCCA 1W2AX 1OUXA 3IN9A 3OYWB 4BK5A 2RJLA 2VBPA 4QX0A 2P17A 3URFA 1GNYA 1B35B 2R063 4PF1A 4GA9A 3B01A 1X8MA 4M3CE 4XFBA 5CFCA 3LFIA 4HSJA 3ZFFB 1GKBA 1QNWA 4IEZA 1QGLA 4QDRA 5LATA 3WY6A 4MXWA 4AQTA 2R061 4YW3A 4LBJA 2WL1A 1VBA3 2FDHA 5C6CA 2PMWB 3KHCA 2A6ZA 3AKTA 4PI0A 5IVYA 1VBA1 1V00A 3V56A 3SCHA 3MEPA 1AR82 2IXJA 3D3AA 4XQ4A 4BXFA 5BYNA 1FV2A 1MR5A 3V0AA 1UOFA 3QLQA 4AW7A 5HCAA 1HXS2 4E27A 4BQ5A 4BISA 3AYAA 3CKHA 4JZRA 1O8SA 4MLOA 4BWOA 1S0GA 2OVUA 4PDWA 5T5PA 4G9SB 1VRH2 1QOTA 5IVEA 1DZQA 2R043 3E6BA 4RD7A 5C3PA 5IFTA 4NHMA 3MLJA 1Y3TA 2DV9A 1IG0A 1S2KA 4AGGA 2R041 3AP9A 3U14A 3SITA 4CXWA 2P4EA 1D4M1 3CJIB 1BKZA 3IAPA 3O0XA 1OD3A 4RR3B 2ZX2A 4XVHA 5I91A 1PHMA 2LS6A 1Y43B 4YFZA 4IL7A 4FVVA 1CIWA 4M4RA 3VZMA 3NNMA 2Y0IA 1VMFA 2HLEA 1XNAA 4JCKA 2BYVE 1B09A 1HRV3 1BJQA 3WCRA 2VBDA 1UU5A 3ZN4A 4FQZA 3GJAA 5CBLA 4FTEA 1HRV1 4E2SA 3AP5A 3THCA 2VM9A 3QACA 1Z7S2 5ACA2 4XIOA 1RUC2 1CAVB 3LOIA 3RZLA 4B7KA 4Y5SA 3ACIA 2WZEA 5DMYA 3N9LA 5BNNA 3I3DA 3DPRC 3MDPA 3S7EA 1N3PA 3ILFA 3AKQA 1YIPA 3UKNA 3VBUA 1SLCA 1C1LA 1VE0A 4AVSA 1HN0A 3SH4A 3VKOA 2B4KA 2RS13 1CX4A 4LLOA 5IATA 4QXBA 3VDBA 1JYNA 3WHTA 1RYYA 1LGNA 2ZABA 3JBG3 2RS11 2DU0A 3ACLA 4IEOA 4KWJA 5BUVA 5FXZA 4WVVA 3JBG1 3K4ZA 3VN4A 3AJYA 5FZEA 1MS0A 2Z79A 3NNJA 4LBKA 3U1XA 4S2HA 5C4WB 3WNNA 4NR1A 4K1YA 3IDCB 5A6YA 3QCWA 4INDA 3FE5A 1RUE3 4YM3A 1XU1A 3JD72 2AACA 3KVBA 4OLLA 4Q0PA 3U10A 2RMU3 4IEPA 4QQ2A 3ZDSA 1V6OA 3LB9A 4URAA 4UF0A 1PMIA 1L7LA 3TN93 4COYA 2RMU1 5CKNA 2JICA 1JZ4A 1X9PA 4JHTA 1PZ8A 3NQHA 3R4SA 4K3UA 5LASA 3TN91 5J3UA 3E6CC 4YGBA 1BMV1 4QPGA 2Q8CA 5BNPA 2WAAA 3WV6A 1F5JA 1L3JA 4CE8A 4F7ZA 2E32A 3O1MA 2FDIA 3FFZA 3B7MA 2VJXA 3ACFA 3TAYA 1V0AA 2PQSA 2WC2A 4W8JA 5FAXA 1XB9A 1JW6A 1OHFA 4FTBA 3ORJA 3UKTA 1C5IA 4WZCA 4JKMA 3AL5A 4XURA 4Y20A 3RVHA 4R9CA 3WW3A 4BXSV 2Z42A 1CONA 4XYXA 4DUVA 2C9KA 5A3TA 5GZGA 1PNFA 3LPFA 5JI9A 5GZEA 1WMXA 5FWEA 5A6XA 2AENA 4KQ7A 5GZCA 2JECA 3VHRA 2W52A 4QM8A 5FO7B 4NAOA 1M4WA 4JQRA 5FZ0A 2CDOA 3VBFB 2ET1A 2EICA 5JOZA 1Y9MA 3FFQA 4HETA 5FLIA 1NY71 3M70A 3O1PA 2W1SA 1RXFA 3KV4A 5FWJA 3Q8AA 4LBQD 5F37A 3MICA 4LBLA 5G05L 3SCGA 4C1XA 2XG3A 4PHZA 3BTZA 1Q8VA 4FP2A 4XEZA 1PO11 1W8TA 2JWPA 4P14A 4D3WA 1VBB2 3U0ZA 5FYZA 2Y64A 3WDWA 2IXLA 4Q1RA 3FLPA 1VMJA 5EJ1B 1R093 4FOVA 4K1ZA 2ZXQA 2MNGA 1NT0A 1URXA 4MZUA 3RZMA 4HG6B 1R091 2Y26A 3NNFA 5IK8A 1XXNA 3PLQA 1QMJA 5FZCA 1NA1A 4CPBA 5KXBA 4RYDA 1I9RA 4O65A 5CEHA 3KSCA 1J1TA 1H2KA 1O8PA 1YI7A 3HPNA 2R1DA 2WWUA 4NPRA 3GHNA 2KA3A 4DOUA 5K9YA 2JDZA 2WNEA 3A0NA 4CRQA 4FOWA 3H7JA 3GZAA 2A3WA 3MIBA 3OUHA 4OZOA 5FOBB 3U07A 2ORZA 1KDMA 5FCCA 1DLCA 1NCQC 2EXKA 3GALA 4M3CB 5FY9A 4D7TA 3LEGA 3E97A 3I8TA 4AFMA 5C8CB 5I0SA 4YVSC 5J98B 1RUF2 4HK8A 1WGPA 2ERFA 3MW4A 1CVNA 3OPTA 4L0PA 4N9IA 1RIRA 2VZ1A 4Q0SA 4RFRB 3U78A 2D3RA 2RVAA 5L9VA 3JQWA 3PU3A 5D8AC 3POBA 2GDFA 2QDRA 4AEMA 4NIHA 1ZVFA 1FPN2 1UX7A 2JDPA 3T4VA 4RSUA 1W2OA 5JMOA 1NLQA 1V6LA 1IHMA 3LEIA 2VY0A 3AX4A 1W3XA 1PGL2 4MX3A 1YNAA 1WLTA 3MYXA 2XDVA 1H1IA 3RI9A 4NWVA 3AB0A 4LLFA 4W6YA 3AMPA 5FXVA 2YBKA 5D21A 2WS93 2XJTA 5AVPA 1F2NA 1WCUA 4Q29A 2WS91 5FMDA 4NHKA 5CG8A 4FOQA 1G9BA 1MZFA 4FXKB 4AHZA 1DQ5A 5G04L 4Q8LA 4ZXKA 4DEVA 2D40A 4UOJA 3SKVA 3NV4A 5LBEA 4XUTA 1A8MA 4H7MA 4KG0A 2X5IC 3GBFA 3POSA 5E1RA 2VZUA 1CAUB 3WF0A 2Q4SA 3SCFA 3BTYA 4YGCA 5FPXA 1NXMA 1W03A 3ZX7A 3IPVA 3VD3A 1D2QA 1F31A 3VV1A 4QXHA 3O1SA 1EV12 3DL3A 1ZZCA 4HKOA 4LHSA 1APNA 1LCLA 2A5ZA 4COVA 3A7QA 3IDAA 4OUSA 1AR83 2ZGSA 4CP9A 1UAIA 4DY3A 1ZBE3 4X8NA 3E5QA 4NWWA 1YUDA 3DXUA 2WLQA 5KXEA 1AR81 3KCXA 4S2DA 1ZBE1 3ZFFC 4NIGA 4R4XA 4JDNA 5IHRA 4OQ9A 3POEA 3LKJA 4CUGA 3MPPG 3WP4A 1JZ5A 1UL9A 4LOTA 2ZTNA 3NKGA 1DFQA 2VXJA 1ND3C 3HWJA 2VTFA 2D5FA 3AMMA 1KJRA 1W90A 3D8CA 5J36A 3M7AA 1MQTC 4DMIA 2D98A 4P5YA 4UW4A 4BB3A 2BFUL 2JE7A 2R0FA 5IT6A 2VZ3A 2R0HA 3G6JB 3ZFEB 4I0AA 3AP6A 3TWIA 4G3YC 2K0GA 1DBNA 2WDBA 4AE2A 4WVMA 4YM0A 4JV4A 1E5IA 4OHWA 4P9WA 4RR3C 1TEIA 2J1RA 3VBOA 5AC92 1E5SA 1Z7S3 1XYPA 2ADEA 5ACA3 1ZRCA 4A45A 4P9LA 5IUQA 2DUQA 4XFFA 1UIKA 2JIGA 4MV2A 1Z7S1 3RRDA 1TG7A 5CFCB 4IE0A 4MXWB 4LBNA 3GM8A 3M8LA 2WR9A 3PTYA 4LXLA 4JKKA 1V9U2 2VG9A 1HRI2 5FZ6A 3K3OA 1S0FA 2X5IA 3LA7A 1BVVA 3T2OA 5CNAA 3I2GA 3VKLA 4JGZC 5T5OA 2HWC2 1OMIA 1QJU3 1DYPA 2Y34A 2B9UA 4XFIA 4PDWB 2AZ5A 2WT1A 4Z82A 4Z8BA 1ENQA 1QJU1 3AMHA 2OZ6A 5ERLA 3BIEA 1GICA 1QOSA 4FQ4A 1LOCA 1Z0HA 2I45A 3PTRB 3ZPOA 4DNYA 5JR2A 4DPNA 1Q43A 2XJSA 4BE3A 4EWEA 4K9SA 4CU8A 4NMIA 3VHPA 1SQ4A 3KGZA 2DFCA 4J1XA 2ET7A 3OY8B 4K6BA 4A42A 4ASLA 4ZY9A 3QH6A 2GP3A 3JD73 1TNRA 4FPYA 2OPKA 5B4XA 4QXKA 2VVEA 4XILA 4AVTA 4DRRA 2R49A 4WV8A 1WBLA 1US3A 2IFRA 2GALA 1CPMA 3N7MA 1ND3A 1ZZBA 3NSTA 4LNVA 4BLJA 5C4WC 5FXXA 4LULA 2XHKA 4XFGA 1MQTA 2RDQA 3B3QE 1DYKA 3OGGA 5APAA 4NOTA 4NIAA 1K5JA 4FPFA 1OF3A 3WDUA 3DCQA 3ZIXA 3H3UA 4XTMA 1XE0A 2YC0A 3MHZA 1PX4A 3CQOA 3UV9A 4ZU4A 4ASMB 3IKWA 1PMHX 2C4XA 3AKPA 5FPLA 1JTZX 4CCDA 1XBFA 1MS4A 2R072 3VBUB 2O0OA 4XDQA 2JDHA 1AYN2 2DVGA 3HT1A 1GANA 1W9YA 1XNTA 3L2YA 1XRUA 2EVXA 1STMA 5K0UA 1TE1B 4A6OA 1S0EA 2A70A 4ZONA 4UW6A 1OBNA 3IM0A 5A32A 1HB1A 1AXKA 1QKQA 3H7YA 5D2AA 2X10A 1DGWA 3O0VA 5DN2A 3ZXGA 2P5BA 5BV6A 3ZSMA 4IERA 4YW7A 4PCRA 3K4DA 1BZWA 2BOJA 1OLME 2WSVA 3OUIA 4XUQA 2YY1A 4BQ2A 3WNMA 1TME2 1YLLA 2D6LX 4JGZA 1XJAA 2XKPA 4XF3A 3T3YA 3VHOA 2RJKA 1UN1A 1C28A 3H9AA 4XJ9A 3SEEA 2UU8A 5CADA 1OSGA 2GH2A 4AFAA 4X6RB 4Y1VA 2DVBA 2DBNA 3VBFC 2JIJA 4RGGA 1KRIA 1QHDA 1BHGA 1UOJA 1MZ6A 4UF0B 4BDVB 1T6GC 2NLRA 3D0JA 5KHKA 1X50A 2RDNA 1AL0G 1AZDA 3C3VA 3B5LB 3ZYBA 2PHWA 5FR3A 4WVZA 3N9MA 2CWSA 4QPYA 4QPGB 4UAPA 4CSWA 1VAKA 1AUYA 5BNPB 3DXTA 4AEDA 2Y6LA 5F39A 5A7WA 3ZFGC 4CXYA 4YRDA 5A1FA 1WWYA 2HKXA 5LK5A 5T5LA 4LHLA 5FJKA 3KV9A 1W2UA 4CDXA 5JR7B 4Y20B 1LOFC 3CIHA 1VMHA 4RHV2 5FQ0A 3R4DB 1US2A 3POIA 3FWEA 4Y33A 1JH5A 3N7JA 4QKBA 3VD5A 5FREA 2BV4A 3DPRB 1MS9A 1WMDA 2DBIA 2XLGA 4XUNA 1G9AA 3VD4A 3AXEA 3T08A 4KNCA 3NO8A 2QQVA 1R1A2 1E57A 1IG3A 5M0TA 3ZDVA 4ZS2A 1MS1A 1W8HA 3GF6A 3TEXA 2D97A 1FPN3 2BP6A 1IQDC 1ACCA 2WYFA 1YHFA 3UJQA 1CX1A 1HIXA 2ZS6B 5DUWA 4YWAA 5F6KA 1FPN1 3M2MA 4CZSA 1ZM1A 2BZDA 3KWVA 1W9SA 1PNGA 4AVBA 4LA3A 4DY5A 2QJVA 3POJA 4FFGA 2JKXA 3K2OA 4LIUA 1GP5A 1J84A 3MIFA 5FZKA 1AXYA 1QH7A 4M4PA 2EA7A 2WO3A 1KFUL 4LA2A 5FOJB 3Q9OA 3V65A 4JVAA 4D6SA 1HB4A 1NA1B 3A21A 4CUBA 1H2LA 3KF5A 1QNYA 4BJ0A 5JSOA 5IJRA 1GZ9A 1W8ZA 4AHYA 4BQ3A 1W0NA 4XJUA 2HWF1 5FY7A 3W5MA 3NNLA 4MGKE 5JXGA 4E4SA 4A7ZA 4LUKA 2W1WA 2W1UA 4YNIA 5JPNB 3H8RA 3J9SA 2R7EB 4ORFA 5FZMA 1ZRRA 2IWGB 3WF2A 2BVVA 3IZOA 3MFAA 4QKNA 3UGHA 3ABZA 3CZUA 1EV13 2LROA 3NJVA 3ZFGA 1SCRA 1Q8QA 1KDKA 1WMEA 4FPJA 4YZ4A 4KMQA 1CAXA 1DU3D 3B9CA 4UYBA 2FMDA 2NMNA 4HMZA 5KHIA 1AJKA 2D6NA 3B69A 3H8XA 1ZNPA 3MBWA 4L92A 4QU2A 1VBC3 3AM2A 4MVTA 3MW2A 2DVDA 3B9IA 2WFPA 3V0BA 3I2KA 1VBC1 1C8NA 1RHI1 3FN9A 5I0UA 4XABA 1AVBA 5JOXA 2GH8A 5FTTC 4HZFA 5A3OA 3OD4A 2XLAA 2ZGNA 2A73B 3ZKUA 4PQ9A 1DG6A 2HWE3 2OQ7A 1UNBA 2SBAA 3I2FA 2K46A 2RDRA 5DXDA 4IETA 2HWE1 4PJYA 2XVLA 4LMFA 4ZS3A 1WCDJ 2YBSA 1UO9A 2XJQA 4NPLA 5F3CA 1V6NA 1OF4A 1O3QA 4R4ZA 2ZA9A 3VZKA 1O4YA 5AC93 4SLIA 1NQDA 5JSRA 3CMGA 5KC5A 1KJLA 1HJFA 1S2EA 4LT5A 4BYYA 1EYBA 2QQIA 5AC91 1XSRA 1N1TA 1RUG2 3CNAA 4XCBA 5FMBA 1UY2A 2IZWA 2ZPXA 3IPVB 1RUJ2 4K7JA 1RUD3 3LF7A 2ZHLA 3B94A 1YQ6A 5J37A 2EAKA 1GOHA 4GKXA 1HRI3 1RUD1 4ATEA 4QQOA 3Q8EA 1MS3A 5F6LB 4AI0A 5DZGA 4CP9B 1HRI1 3POYA 4MGYE 4Y1XA 5HV4A 4JRLA 4GXLA 3WVJA 2Q8EA 3RS6A 4YW1A 2V5YA 2HWC3 4PT6A 4QM9A 5A3PA 3FUOA 3IMNA 2RR11 3ZYHA 2DYCA 1JYTA 2XXZA 5F9TA 3HNMA 3MLKA 1OH4A 3T0BA 5IVBA 5C3OA 2JEMA 3KMHA 4GMP3 1RL3A 1DQ4A 2VGDA 3PJQA 5A3WA 3I2OA 1FNYA 2G19A 2ZX4A 3CEWA 2VCCA 2W08A 4Y1ZA 1UXXX 2QQLA 4GQ7A 4MGQA 2XJPA 4XZPA 2ID4A 3ZO0B 2BBVA 3X29B 4R9AA 1CGPA 1GZWA 3H42B 4PDWC 3ZKYA 1H30A 3ZSJA 2BFUS 2GMEA 1SLTA 3A4UA 1KQRA 5IYYA 3ETPA 1XYOA 4WVMB 1DDLA 5FBZA 4YGDA 1LAJA 1N1YA 2IUWA 3DUIA 4NAMA 3VBOB 4AI9A 5AFEA 3L2HA 1LOEA 3W21A 4UBHA 1VLNA 2WA4A 2AGSA 2J1SA 1LOAA 3C7FA 3ZXFA 4N7UA 3CU7A 4KI5M 5FPZA 3HEIA 1IS6A 2DVFA 1GZCA 2RS32 3FLRA 4LPLA 1GWLA 2V5DA 1AYN3 5FZLA 4XF0A 3UESA 1GP4A 1WW7A 2C24A 3T2QA 3ZYIB 5LEKA 3K4AA 4Z2AA 3E1F1 1W05A 1UOBA 2X5IB 3EB7A 1AYN1 3JB8A 4W6XA 1C5HA 1W6OA 1XNCA 1Y7BA 4GALA 3KV6A 4IGOA 4YM1A 4XXPA 3WG3A 5BNNC 1NX9A 1IOAA 1S2BA 1GR3A 3LFMA 1POQA 1MEC2 3VDDA 3VBUC 3ILNA 1HN1A 1OOPC 3W20A 1DZTA 2Z5WA 3FL7A 1CZVA 1G7YA 2WBKA 1BYHA 1VBE2 3PUAA 5A3LA 1RINA 3PU8A 3ZYRA 1ULCA 2A7AA 4M00A 3PVOA 2DTYA 5F5AA 3IMMA 5JI7A 1UXZA 1YIFA 1ZZ6A 2P3IA 3ZYPA 5CZKA 5KHHA 4AGRA 1TME3 2ENRA 5C33A 1H9WA 2B9VA 2VVDA 5JDBA 2CGOA 2W94A 3HN3A 4AGVA 1TME1 1HV0A 1XYNA 1IPSA 1W8UA 5J09A 1AX2A 1V70A 4GWMA 1SHWB 1VB4A 5FYHA 3HIFA 5LB6A 3EBRA 4YVWC 2X05A 1EY2A 1ND3B 4XOGA 4JRAA 2XLFA 2KR2A 4IEYA 4QXCA 3EXUA 2CAUA 1MQTB 2W91A 3N36A 1CD3G 1LENA 2V73A 4NROA 5BNQA 2WUHA 1NE4A 1TMF2 4K20A 2Q1FA 4Q4Y3 5F3IA 5EIYB 4OHYA 3D5OA 5CG9A 1WD4A 2WN2A 4PLMA 2XJVA 4ISRA 3U75A 3ZXJA 2VZPA 4Q4Y1 4LBMA 3ON7A 4W4ZA 4OI2A 1PM4A 1UWWA 3APBA 1UZZA 3MIEA 2HEWF 2YGLA 4E2GA 4AYUA 1W6MA 4YW4A 4RHV3 3B02A 4AI8A 1IS5A 4IE5A 4GD4A 1RUH2 1YFYA 5K0UB 3SISA 1OD5A 5L7OA 1SEFA 4QPGC 4RHV1 5BNPC 3T09A 1IQAA 1DCSA 1QF3A 5A32B 2VECA 3H1WA 2BGOA 3VD7A 3O1OA 1ZBA2 4WM7A 5ABJA 5J7MA 2ZMLA 2HJIA 2XUEA 1JUHA 3RZJA 1XSQA 1R1A3 5I0DA 4G4FA 2PN5A 2PYTA 4K40A 4O61A 3WD5A 4JDMA 4IW3A 4JGZB 5FYYA 4MUVA 4Y1YA 2DWRA 2NQYA 5FYSA 2DCZA 3IB3A 4BQYA 4IEQA 1OOPA 5JVVA 3OD0A 4FP3A 1W8NA 3USSA 3JU9A 2JJ6A 3BKZA 3C7OA 1QH6A 2ZKLA 5GLTA 1W6NA 2R30A 1IS3A 1JU4A 5BNOC 2ZAHA 4Q27A 4Q8KA 2JENA 4QPIA 4N43C 1PK6A 4OMDA 4AEDB 1I5ZA 1K45A 1U12A 4HANA 5A7WB 5IVCA 4NIDA 1EAH2 4GIQA 2B39A 4D7YA 2YZ4A 2Y38A 3ST7A 4YVWA 2PHUA 4HONA 5FMOS 1UQXA 5KXCA 2PELA 4MXVA 2A6XA 4CDXB 4ARYA 4EJRA 5EPAA 2ZGUA 1KXGA 1PGW1 2P37A 5FQ0B 4L11A 3SMHA 5HXMA 1NA1C 5ISLA 2IXIA 2VOXA 5KHGA 4Y24A 5A33A 1MZ5A 1XNBA 3WCSA 1CWPA 4FPKA 1RUE1 1LR5A 1ZYBA 3CL1A 3HNYM 2KXLA 4DUWA 3AP4A 3K48A 2O8QA 1U0AA 5ANQA 1EPZA 1GZTA 1XQNA 2XGXA 4BMEA 1AYM2 2VOVA 3H1MA 1UW8A 1KD7A 5FLHA 2A1XA 4Q0VA 4AI3A 3BPZA 3MV11 4XJZA 1IPJA 3WR0A 1CZTA 2YU1A 3ZR5A 4EV0A 3OSDA 4EZHA 1LRHA 1JHJA 2Y6HA 3OB8A 4H3WA 1UKGA 2BEOA 2RHPA 2CGNA 3I2DA 3BIWE 5EP9A 1E5RA 2JXAA 5DAQA 4CCNA 4F3JA 2LTNA 1G9FA 4GJZA 4Y22A 5DDJ2 1EP0A 1K5MA 3AYCA 2OPWA 4I0WB 4Q26A 3TNQA 1OPMA 2EXJA 2VMDA 3LDRA 4J1WA 2B45X 3LIHA 3A22A 3J7NA 4JGYA 1RITA 2GC0A 2XBO3 2EIBA 4FCAA 3POFA 1K3IA 1WD3A 2PHRA 2XBO1 5CA6A 3ZYFA 2RV9A 1F4HA 2ZGPA 4Q4X3 4GWJA 1BVP1 4BPZA 1ZREA 1M06G 2OA2A 4UFJA 1MS5A 5FXWA 3SH5A 2GZWA 5LA1A 2XPJA 4Q4X1 3OPZA 5T55A 4KWLA 2ZGMA 2FZ2A 4KBZA 5FK7A 3I3QA 4CCKA 3O7OA 3PUSA 3MIGA 2E7AA 3PUIA 1RUG3 1PX3A 5BNOA 5HCHA 2W87A 4R9DA 4S2FA 1RUJ3 4N43A 1UD1A 3O1UA 2E53A 1JXNA 2ZEXA 3VKFC 1SACA 5AVAA 2UYAA 3ZFGB 4IGPA 1RUJ1 4NHYA 2QQMA 5IAVA 4UBGA 3ZMOA 4DXSA 1CAXB 2K9ZA 4QU1A 4WM8A 3QOPA 4QX8A 1V6KA 2F4LA 2P3YA 1D7PM 1J3RA 5T52A 4PQQA 1W8OA 3IIAA 3W59A 5A3MA 3FX3A 3TEZA 4ZZ5A 1N3QA 2YUEA 4OCTA 5K4LA 2JDAA 2VMIA 2AC1A 3V0BB 1LOBA 3NW4A 5FZ7A 2RJ2A 4DFSA 1V6IA 2EALA 1TZOA 4GB32 3GJBA 4B4QA 1DQ6A 2BBAA 3QD6A 4KGQA 2WNUC 4L99A 4NIIA 5IVVA 2GAUA 4Q4W3 4CCLA 2CHHA 5I8SA 1UYXA 3P6BA 2G4IA 1AR62 4KWKA 2QFEA 2PHDA 3UL2A 2VZSA 4Q4W1 4YZ1A 3WOGA 3THDA 2OT7A 1OH3A 3J7HA 3HD8B 4P5HA 2YC4A 1REDA 4HLTA 5FPUA 2NMOA 1CZSA 3DYOA 3J8F2 2BUKA 4Y4YA 2D6MA 2VNRA 2WFF2 1JZ3A 1UPIA 1PVXA 2VZTA 4BQ4A 4CP2A 3PVEA 4AF9A 4AL9A 4C0HA 4OULA 1C1FA 2ETEA 4IDZA 1DGRN 3NV1A 4XUPA 3WINE 3K77A 4UW3A 2Q8OA 2ZGRA 4XF1A 2LUWA 2QQUA 5FYCA 3JZVA 3VBOC 4D69A 1UY0A 4O9GA 4DS0A 1C8M2 2YXSA 1BEV2 2F4PA 1D4VB 4QWNA 2WZ8A 5FKBA 1AL22 4B8EA 5B4NA 3IT8A 1AR93 3IWZA 2QBXA 4JX0A 4JKLA 4Z2WA 2YMZA 1WBFA 4PF5A 1AR91 1MEC3 2VTXA 3ZSLA 2HEYF 4C0BA 4AEKA 3KGLA 4QX3A 2RS52 3T2TA 5B2GB 2E26A 1W99A 1MEC1 1VBE3 2HH9A 2DURA 3RYPA 1DQ1A 3KT4A 4LKDA 1DQ0A 1QQP2 2BQPA 1W2NA 2VR4A 4XHBA 5LBFA 2TEPA 4LEJA 1HDKA 2YU2A 3AJZA 1GZWB 4IE4A 4QB2A 3MO4A 3BB6A 4XXAA 3VZOA 1HX6A 2CGPA 3ELNA 3LA2A 3UNPA 3DYPA 3PVBB 5JOYA 1XU2A 3C7EA 1JYCA 2BWCA 3P3NA 4LKSA 1PVC2 3LPGA 4N7IA 4Y4RA 4LHNA 4EN8B 3RJ2X 4ET7A 2YV8A 4IV3C 1VBD2 2WNUA 4PLNA 4WZFA 1FAYA 1HXS3 4CDQA 5SV8A 3LZZA 2D43A 1QJX2 4FT8A 1UMZA 1TMF3 2ZX3A 3QBQA 1HXS1 1V6MA 2WLPA 4XHXA 1VRH3 4QQHA 3OBZA 3WUCA 3ZN5A 4DB5A 4HFSA 1HJGA 1LEMA 5HV0A 2W9XA 3GGLA 2GN3A 4BH9A 1VRH1 1HB3A 4CDWA 1LECA 1A6CA 2ZGLA 1O3TA 2C6SA 3INAA 1NCRA 4YYOA 2UURA 5JIAA 1YI9A 2RM22 2VUCA 3HOBA 4LBQA 1GNHA 4YW6A 1OLMA 2K2SA 4Q4V2 1W39A 3ZXLA 5FP7A 3GHMA 3RGBA 3U11A 1QXRA 1W6OB 1SG3A 1X7NA 2GNDA 2E33A 1ZX5A 2HBTA 1X36A 1F15A 4PIYA 2VMHA 3TNPB 5C8WA 5C71A 3WQ0A 2AEYA 3FUQA 1JZ2A 1H4HA 2DFBA 2Y8KA 2ZX0A 5FO8B 4ZU7A 1YJKA 5GKAC 3NJZA 2D6KA 3RFRA 1P8JA 1RUC3 5K0UC 5CFDC 2WJSA 5KBFA 5ACA1 3SEPA 4MGSA 2XQXA 1SDWA 2FHRA 1RUC1 2ARAA 3WW1A 4B3NA 3MGUA 4EN7B 4QPWA 3DV8A 4NRPA 1RB8G 1IPKA 1YYNA 5JXJA 4AG4A 1OLQA 3ZN6A 3AMNA 4CXXA 1DP0A 5IVJA 3WW4A 3U37A 2J1VA 2XH6A 3E5XA 2GSYA 4IEVA 2OZJA 2XJRA 1GOFA 5K8SA 4CCOA 3V0AB 4OI0A 2YPJA 5DAPA 1N1VA 3LSEA 4XCAA 1ALYA 3NAPC 1JU3A 3H1YA 1NLSA 5CIRA 5DUVA 3CF6E 3OPWA 4JTOA 2UYBA 4IUGA 1SLIA 4LO7A 3WT3A 4CCMA 4B4RA 4I2OA 5FZGA 3ZXEA 2ZGOA 4GMP0 2JDMA 4YZ5A 1EAH3 1JYVA 3LDKA 4CTEA 3T0AA 3RPQA 4QGNA 1EAH1 1UMHA 1I1EA 2CL2A 2ZEYA 5F32A 1W6MB 3VGIA 4IV3A 2VAUA 3I49A 1DIWA 5FUNA 4HL0A 3AKRA 2ARBA 5L7OB 3KLSA 2IVJA 4Y5Z0 4HOOA 4CCJA 1H2NA 1GQGA 4AEDC 5FYVA 4LO6B 2E7TA 3BCWA 1YFUA 3JD71 4WM7B 5ABJB 2MEV2 4PBOA 5C9AA 1NG0A 1OPOA 4BLIA 1AYM3 3KHBA 3VZLA 4CDXC 1GSLA 4WVWA 4CYDA 4EN0A 1AYM1 1VR3A 1A34A 1QY4A 3TRSB 1XOYA 4B4PA 5EHDA 4MADA 2Y6FA 4UFHA 4BCUA 2BPA2 1W6PA 2GP5A 4I3PA 1UX6A 3MPBA 4TN7A 5BNNB 1OXCA 3UK9A 3KZ4C 1QJZA 1WW5A 2ATFA 3BVCA 3K46A 3ME2A 5HCFA 5DDJ3 4ARXA 1OOPB 5JAXA 4LO8A 1EUTA 3JUUA 3SC7X 3UGFA 3CBNA 1Q56A 2BRTA 4XFAA 5DDJ1 5DG1A 1RVF2 2A6YA 5F3EA 4UWDA 4MGIE 5CFDA 3WDVA 3VD9A 1W6NB 4QAWA 2CYFA 3G7DA 4QPIB 2H6CA 1GNZA 1PK6B 2VMCA 1LHNA 3EYPA 4O9EA 4E2QA 1QJY2 2RG4A 2V4AA 1AJOA 1Z78A 1GQPA 4NVPA 4P9YA 3LAGA 5FV3A 5LCWL 3RZHA 4N53A 5IK7A 2B8MA 4YVWB 2EAAA 5FZIA 4UFLA 1T2XA 5FY8A 1DQ2A 2VMGA 4R9BA 4LORA 4AFCA 2JDKA 2KD7A 4META 3NNGA 3CJIA 3NAPA 2A71A 3O12A 4TSVA 4UFKA 4HPKA 5A33B 1IS4A 4KL1A 4N90A 2Q0AA 4ASKA 4EYUA 3I3BA 4L8QA 4V2VA 1D0GA 1VBB3 2HWB2 2QQNA 3BUCA 1GOGA 3ES1A 1O6UA 4QX2A 2IXKA 1VBB1 1G6NA 1XE7A 3AVRA 2PAEA 4Y1UA 2GC2A 5JXHA 2IXCA 4X6QB 5A70A 3P5BA 4XQWA 3THPA 4CCCA 1UY3A 2CNAA 4LE4A 5T50A 3EHKA 4XF9A 3L9JT 2R062 5FMOL 4ES9A 2EIEA 2VUJA 2CWMA 2B7YA 4Y22B 4GB33 2WT2A 1K5MB 2P3JA 1N1SA 2WO2A 1VBA2 5T54A 5L36A 4A3ZA 3GYDA 1H1AA 4GB31 3HJRA 4OZXA 1QIQA 4JGYB 1X82A 4XAAA 3W58A 2WO7A 2FD8A 1PGSA 2ZGQA 4FPLA 1AR63 4EZ4A 4O7XA 1RUF3 5IAXA 5CB7A 4CDUA 5FZAA 1W28A 2LRPA 1AR61 2VNGA 3BU0A 1CR7A 1RUF1 1O5LA 3ROUA 2G1MA 4BM8A 3J8F3 5E88A 2ZCWA 2FBEA 4IGQA 1D4M2 3M4FA 1DLLA 2WFF3 1NQJA 2JG9C 3J8F1 3K3NA 4AHWA 1JBCA 4P9IA 5BNOB 4ONUA 5FZ9A 4ATFA 1KEXA 1O4ZA 3FLTA 1GV9A 4N43B 4AQSA 3PDQA 3AYEA 5JXIA 1W8FA 4UFIA 1UZYA 1HQNA 2J42A 3KB5A 4V1PA 1PGL1 1KS4A 2VNOA 2P3KA 1POV0 2OIIA 3OGRA 3OGSA 1C8M3 4P9GA 1BEV3 4WM8B 3WDTA 1AL23 4Q0QA 4IEXA 1VAMA 5T3NA 3I59A 4AK3A 3MZHA 5E16A 5FYBA 2A75A 3VBRA 1O59A 1LGCA 5DPNA 1R1ZA 3ES4A 3K75B 3QH7A 1UYZA 5EYYA 4FAGA 4QX5A 3H3ZA 2GU9A 5FZOA 4CU9A 4W50A 2XKOA 3OBRA 3BPSA 2XVGA 3M3IA 3N9QA 1LNSA 1QQP3 2O14A 1YWKA 5FUIA 1LHVA 3CLPA 3DGTA 3DF0A 1BK0A 5FZHA 4ZXEA 4Q1PA 1AR72 2TNFA 2VXRA 3RSJA 3JBG2 3I7DA 2QKDA 4BU2A 4XMIA 4YG0A 4R8HA 1PVC3 4MOAA 2FDKA 1EV11 5FP9A 1VJ2A 3S5AA 2W92A 4F8AA 1PVC1 5GALA 2ZEZA 1QJX3 5IVFA 5FYUA 5FMCA 4B29A 2JB8A 4JTNA 4IQPA 1IKPA 1O5UA 1QJX1 4TWTA 3UYJA 2CDPA 4K21A 2ES3A 4M3CF 5A1AA 5A7SA 2JX9A 4IESA 2P2KA 3ZYJB 2X8KA 3ECQA 2RM23 3BALA 5C5TA 2MPFA 4TTGA 3AZVA 3R4UA 3S57A 4QQLA 2O1QA 1J3PA 2JG9A 2B42B 2IXHA 2RM21 3FHQA 5L9RA 3WLUA 1ODNA 5CKQA 3LD8A 1BMV2 2XHNA 3GXUA 1DZRA 1OA4A 1UZVA 1PIV2 4E8CA 3PVNA 4GH4A 3ASIA 5FP8A 2QQKA 2WNOA 5EFUA 5EJZB 2WQ4A 1ENRA 1FT9A 4K8FA 4AI1A 3JXSA 1LU2A 5FRAA 3LIGA 3RWNA 4OI4A 4ZZ8A 1WCQA 3H8OA 2QVSB 1HLCA 2W68A 1AX0A 1UZ0A 3VDCA 2A3XA 5GZFA 2L9LA 2WQZC 3VDDC 3ILRA 5GZDA 1V9U3 3LQCA 2LW8A 4KWUA 1H0BA 2SLIA 3GNEA 3WNLA 3ACGA 4HVOA 1Q5OA 1V9U1 2G9FA 3HT2A 3C8XA 2XUMA 2WNUB 1NY72 3PURA 1Y9QA 4HSLA 5F2WA 4CDQB 4HXCA 3R0RA 1AHSA 3ZPYA 5KWRA 1Y4WA 1NZIA 5ANNA 2D3SA 2VBBA 4M0NA 3D4KA 2HWC1 5C3SA 3HMYA 5FPVA 4QX1A 1LEDA 4CDWB 3C2UA 1H8VA 1PO12 1X8EA 3HBZA 3I97A 4E9KA 2VCMA 4JQTA 1NCRB 2BWAA 4LBQB 3S5QA 5DUXA 3UJOA 1N3OA 4W65A 3S30A 4Z07A 4GMP1 3LE0A 2PXJA 2E51A 4GKYA 1R092 4WBBA 3I2JA 4RN5A 4XMAA 3VLBB 4XFCA 5DUUA 3I54A 5FY0A 1X9TA 2MEV3 2W95A 3DKWA 5L73A 1NZCA 3W9AA 1ZZ9A 4XFHA 4GWIA 2MEV1 1JYIA 2JDUA 2VQTA 2WZPP 4LO4B 4LIVA 5E6HA 3WP5A 4CEYA 5EQUA 4FFHA 3LEKA 2AH2A 2YPDA 2XL7A 4H7LA 5HI0A 5L7OC 3VDAA 1J59A 1SLAA 1CAWA 2XONA 3M3CA 4RQPA 4FPGA 5FYTA 4C91A 2A3YA 2EXHA 2WNVA 1DF0A 1HQLA 2P34A 4WM7C 4QKDA 5ABJC 2C9AA 4ITCA 2R073 4Q5OA 3SLIA 3ZN6B 3WQBA 3IAQA 3ZXDA 2VU9A 2Z2SB 2R071 1W0OA 1S0CA 2ZKNA 1ZA7A 2GNMA 1LGBA 1RVF3 4IEUA 4RS5C 2H6BA 5A6ZA 4LJHA 4DZGA 4P00B 2FZ1A 2HYKA 1RVF1 1UOGA 4PIZA 1REEA 5JCTA 2VW2A 3PL0A 3D82A 2V72A 1VIWB 2ARCA 4H55A 4XBQA 2QUOA 1SZBA 1YO8A 2V09A 4OHVA 5F3GA 4YPJA 4BQXA 1KITA 1SPPA 4MHUA 3BTXA 5JZGA 2JDNA 3PIGA 1FATA 2AREA 3VB9A 4IV3B 1R082 3BODA 2QQJA 2JDYA 3HAGA 2YROA 2HWD2 3ZVXA 2C5DA 4QPIC 4AZZA 1PK6C 5A7PA 1O3RA 3VL8A 2WWJA 2AEZA 4EN6B 1WA4A 2XQRA 3ZXAC 2HWB3 5FKCA 1MVQA 5C9AB 1S0JA 4Y26A 3E6DA 1O3SA 3MUZ1 4CEWA 3W5NA 2E6VA 4A4AA 4NRQA 5BXXA 4TZDA 1UY1A 5FY1A 5DG2A 1S4CA 3ZXKA 5LK7B 3N3HA 3U4XA 1OA2A 5EZWA 4GULA 2BW8A 5GLUA 2OUJA 1GP6A 3SKJE 2OX0A 1W6PB 1NE6A 1R64A 2PTMA 5FUPA 1BLZA 2H0VA 2VOKA 2KM2A 1WLCA 2YYOA 2PFWA 1CPNA 4AXOA 1JODA 5J48A 3PMEA 3RNSA 3TB0A 4MO3M 4FAHA 4OUMA 4B1LA 2VZVA 3A0KA 3AMQA 5FY5A 4M01A 3OOXA 4RGKA 4A2UA 3KCYA 2NM1A 5CFDB 3GZUC 1QU0A 2TBVA 1ZBE2 5H9QA 4IV1A 1J83A 2OKXA 5LBBA 2QNKA 1FYUA 4OHXA 3PJYA 3VBSA 3POGA 2GN7A 1K5MC 3Q8FA 2PHLA 4N53B 1ASJ2 5FPAA 1WLWA 5EWSA 2WN3A 5CKMA 1GFF2 2DU1A 3LA3A 1D4M3 3T1MA 4JGYC 4RS5A 1R1A1 3NVCA 3HQRA 4KH9A 3NAPB 2BNMA 4HPKB 2BNNA 5EXOA 4D94A 4FO9A 3OY8A 5I8YA 1G8WA 1NOVA 3MV01 4HBNA 3T2PA 1XNDA 1J3QA 3OBAA 4CPBD 1AXZA 3KV5A 3PUHA 1WCKA 3HQUA 3SQOA 3MF9A 2VQAA 5LWBA 2DDUA 2E9QA 1CJPA 2QCSB 4TLGA 4B7EA 1ULPA 3N7LA 1H2MA 2VOWA 1POV3 1ULDA 2D7FA 1JI6A 3WSOA 5E89A 4LE3A 4BQ1A 1POV1 5FZFA 3ZYGA 1DGLA 1H8TC 3ZLIA 4Z92B 4COUA 1A78A 1LOGA 2FCTA 5DZEA 3VBHA 5SV5A 4KGGA 4BMBA 4CP0A 5I93A 2WYSA 3IDEA 4WM8C 1E5HA 1W9FA 4FFFA 5F5CA 3T30A 4C90A 2E63A 1MACA 4OHZA 2FDJA 3NWKA 1QDCA 2Q8DA 1NXD1 1DYOA 1HKDA 2WAOA 1AR73 2VQUA 1CESA 4CDUB 5A3NA 4E4HA 1YXWA 4JHZA 1VP6A 1AR71 1QJU2 1QXPA 2OXBA 2Q1MA 5IW0A 4OI1A 4C8DA 5L19A 4DUXA 5HCBA 4QD2A 1ULOA 1SBFA 5LA0A 4M0HA 4NO4A 4OFGA 4XJWA 2YG0A 1ZRDA 2QTWB 3DKQA 5F7UA 3PNAA 1FX5A 3LGRA 3WNXA 4AFDA 1JUIA 2WINB 2ZOEB 2W47A 2MHFA 1S0BA 3N9OA 2WZR2 4HVRA 3TYJA 3RZKA 4UXAA 1BK1A 1ZZ8A 3D6EA 2D5HA 5D1IA 1UPSA 5GJ6A 4AHXA 3OJBA 3OCPA 1W04A 3FBYA 1GLHA 2BVBA 2PAMA 1PO22 1ULFA 3I59B 5H9RA 4DQAA 4MH0E 5LW9A 4MYEA 1PIV3 3JQXA 1MS8A 1SMVA 2VW1A 1I6XA 3AZYA 3RZZA 4QX7A 3VBRB 1OURA 2WABA 3ZMNA 4N8MA 5FFOC 4AVAA 3AYDA 5FYIA 1PIV1 3O1RA 1HV1A 1FOD2 1K12A 2YFZA 1L7QA 3ETQA 3N35A 5FZOB 3RDIA 2W3JA 1N47A 3BOWA 4J25A 4ZKTB 4XIKA 2EF6A 5FP3A 4RA0A 1BQPA 1PZ7A 1VPHA 2VO5A 4ES8A 1GUIA 4LK6A 2I2SA 4BA6A 2YDEA 5DZFA 5FZ8A 3RI8A 2RDSA 3OBTA 1LODA 1U5XA 1CJDA 4AAPA 4EE2A 1C3HA 1RUG1 2VZQA 3SNMA 1H8TA 5AFBA 1L7RA 3ZSEA 2PHFA 4EROA 3DPRA 4P02B 2YHJA 1QEXA 1F8VA 2DCYA 2GMPA 1WUVA 3HR9A 5LA2A 4UFMA 3RMYA 3NL1A 1LHOA 1S55A 1RJ7A 2C0ZA 5I8TA 3S0MA 4KBBA 1D0HA 2O8OA 2WKKA 2ZJCA 3AK0A 5HXVA 3U4SA 2JD9A 1UU6A 4QDSA 2X53S 3S7IA 1YQCA 4BZ4A 1PO13 1W3VA 1MVEA 3OUJA 3WG1A 3HVDA 2PAKA 4XDPA 4RL7A 3WW2A 4CDQC 4A3XA 4D0QA 4NHXA 2JG9B 3HN1A 4NJ4A 2ZGTA 4BQWA 4H2AA 1SBEA 4MSVA 4Y5TA 2R6QA 3FC0A 1MZEA 1H4GA 3FHIB 2ZHNA 5JUVA 1C4RA 4GH4B 4QQPA 3WXPA 3BOPA 5EV7A 1HQWA 4QT6A 4CDWC 4EN9B 3J4UH 5DQ0A 2WA3A 1NCRC 3NRUA 5A7OA 1J58A 1QJEA 2C1FA 1VALA 1XE8A 5FP4A 5JPMB 5JIUA 3M3OA 1OUSA 2I07B 1SLBA 4DXTA 1OI6A 3PIJA 3SHRA 3ZOIA 1FV3A 3BU7A 1W2TA 2BERA 1H6XA 1OLRA 2PQQA 5FIXA 1TNFA 2A6WA 2RS33 3MLLA 4R52A 4A44A 1JN2P 2JE9A 3AZXA 2FDGA 5T5JA 5F1RA 1VAVA 1WMFA 3WG2A 2RS31 2XB6C 1GU3A 2D93A 2VUDA 3ACHA 4FXGB 2B46X 3UETA 5LRSA 1Q3EA 4J6GA 4FI9A 2QQOA 1LULA 2Y60A 1S1AA 2VC9A 3RJRA 1W0PA 1UKRA 1WLDA 3P3PA 2VZOA 2PHTA 3TEWA 2IFWA 1W9WA 3EMRA 1HW5A 1JMUB 2HEVF 2ORXA 3IBMA 4CCEA 1YFWA 1A3KA 2DCJA 3KF3A 3FBMA 1SFPA 3HBKA 2OW4A 3O0WA 1K42A 2VOTA 4IEWA 4ISQA 1JYWA 2AR6A 2WQ8A 3C7GA 4MGTA 1R083 1RUI2 1VBE1 2D6PA 4AQ6A 2HWD3 3GZTB 4OVEA 2BU9A 4EQVA 5DAVA 4AEJA 1R081 5CISA 1PM7A 2Q5TA 4FSJA 4NPMA 1LHWA 2HWD1 1YQ8A 4AFBA 4HN1A 2PLV2 2CY6A 2HWF2 2X09A 4I01A 2OYZA 4COZA 4LTAA 5C70A 4YZ3A 4XBNA 5EYXA 4SBVA 4YARA 3THTA 4XE9A 3J26N 4CEYB 3FZ3A 2YB7A 2NYYA 3KT1A 4YGEA 1CAWB 4FOYA 3OEAA 4RQPB 1IZ3A 4QDQA 2JG8C 3RG0A 3ENRA 2WNVB 1TMF1 4XDOA 4CP1A 4FBFA 1O91A 1W6QA 4AQ2A 5C9AC 1ND2C 4FTSA 1NLRA 1LB2A 2Y6GA 2UWBA 3KVAA 5IWFA 5LY2A 3BI3A 2VVFA 2ZACA 3J7MA 5JLVA 1OQ1A 1JOBA 1OFSA 4V2WA 1G9DA 1RUH3 4TYSA 2ZZQA 1OKOA 3CO2A 4TLFA 5IK4A 3KS7A 5I0RA 4Z1VA 1RUH1 1B35C 2YFUA 4NE9A 1PZ9A 1ZBA3 3SH3A 3UT0A 3T0DA 3FHAA 1NCQA 4DIQA 3VDDB 1VBC2 4BOWA 1RHI2 3FMGA 1ZBA1 4PIXA 4XF4A 1ASJ3 3A23A 4YVSA 1SPPB 5I0TA 4QB1A 3T1LA 5JZGB 1GWKA 1ASJ1 3K51A 4OMCA 1UZWA 1JZ7A 5TSWA 4NN0A 5FZ4A 2GC1A 2HYXA 5D8AA 1AF9A 2HWE2 4GWNA 1RXGA 1OT5A 3AFKA 4XQDA 3GBWA 2UWCA 4OQ8A 4XTPA 1BBT2 3HQXA 1RUNA 3AC0A 5DABA 2XOMA 4N53C 2WRAA 2VNVA 5BPXA 2DF7A 2JE8A 4CEWB 4FPEA 1UY4A 1GYKA 3MI8A 2D44A 1KS5A 3CJIC 3JB4C 2VMEA 4OYUA 3MIDA 4FPOB 4P9JA 4BHPA 1JHNA 1ONAA 4HK9A 4KU7A 4L97A 4AOCA 2CTVA 2VQ0A 1XPWA 4XPVA 2F17A 3S6PA 4CVUA 1UYPA 2FQPA 2UWAA 4DINB 1UCXA 4N9HA 4YLZA 2DUPA 2JKBA 3DN7A 3IIIA 3OGVA 4HN0A 5FZ1A 1RC6A 1RUD2 2J1EA 1RMU2 3M3QA 4UI9L 3USUA 2X29A 4YW2A 2EXIA 2BTVC 1UMIA 5JSPA 5BY5A 2ZX1A 1WA6X 1U5IA 5A6QA 4XETA 2EIGA 3RYKA 4HKLA 2WT0A 4I09A 4IV1B 2QDNA 2JG8A 1C57A 5EJ3A 5J1XA 2RR12 2XMLA 2UY9A
chains in the Genus database with same CATH topology
3TBDA 2XJUA 4I3GA 2DCKA 1ND2A 3VBSB 2PA7A 3WHUA 5E8AA 1COV2 3R05A 3B93A 1AX1A 3OYWA 4RS5B 3H0OA 4XJ8A 4HVQA 2E7QA 4A7YA 2QZ3A 2ZGKA 1B35A 1DHKB 4CDUC 4YSFA 3WQ1A 3ZFFA 4DRVA 5KHJA 4BIFA 2WZR3 3RMXA 1U5ZA 5FDBA 4XBLA 1RJ8A 2WZR1 2DTWA 2NN8A 3NV3A 3WZ1A 1LESA 1PO23 1Q8PA 4PLOA 1REFA 4YZ2A 1SLLA 4I02A 1PO21 4AWDA 1SFYA 2ILMA 2ZZJA 5GLVA 1YFXA 1UIJA 3MF6A 2CAVA 2YGMA 1FOD3 3VBHB 3GBGA 1FOD1 3M3EA 1X33A 2Q1ZB 4RR3A 1WW6A 4FPCA 3VBRC 1OKQA 3AP7A 2TUNA 3PMSA 3MFCA 1FMD2 4YG6A 5H9SA 1LTEA 3RYRA 2BGCA 1Q8SA 1LU1A 5JOWA 3WUDA 3LCPA 3R6SA 1FI2A 4QGLA 4XJAA 3ATGA 1CAVA 1S0IA 2ZBJA 1ULGA 2D3PA 2B5HA 4AVCA 2FMYA 2QQPA 2ZHKA 1QDOA 4L2NA 3ALQA 2I74A 1FXZA 1CN1A 3VHNA 4E4DX 3D0SA 4Q4Y2 3AZZA 3PHMA 2AYHA 1ZZ7A 3SXWA 1QWRA 3WDYA 3LSDA 2R042 3VKNA 1LKNA 2DCTA 5FLJA 4F83A 5C4WA 1FNZA 1I3HA 4JDOA 4Q0UA 5H9PA 4NHLA 3TOJA 2WFF1 4GH4C 3WQ7A 4LUMA 3N4MA 2RE9A 1H9PA 1H8TB 3AXDA 5J96B 3E5UA 5LEJA 4EWDA 1UF2C 1YCIA 3LWCA 1HRV2 3EQEA 1OFNA 1ENXA 1ZA4A 2IC1A 3CJXA 4I30A 3ZSKA 4YM2A 4JC1A 5LRRA 1C8M1 1BEV1 4S2GA 1AL21 1EPWA 2NPIA 1ENSA 2NZ9A 1RGSA 5C8CC 2RS53 3H50A 2Q30A 4QMAA 2R32A 4YG3A 1DGRA 3POWA 3WP3A 2RS51 1O4TA 5JMCA 1RUI3 1Q8OA 4LR4A 1F9KA 2ARXA 2VH9A 1RUI1 1UU4A 2RS12 3UKVA 1QQP1 3AKSA 3EJKA 2ZMKA 3OGJA 1BCXA 2PLV3 2HWF3 2XVKA 1SCSA 1YJLA 3IDBB 4X8PA 1WCSA 3EO6A 3ZIWA 1TQ5A 4EWAA 2PLV1 1VBD3 3VBFA 1IGOA 5GM0A 5KXDA 1PGW2 1DGWX 1VBD1 2PHXA 1V6JA 3H8UA 1SBDA 5KC6A 4IXLA 2H0BA 4C1WA 5CAZA 1QOOA 1RUE2 4LHKA 2R1BA 4MGZE 4HKWA 1U5YA 2RMU2 4Q4V3 4CEYC 1WW4A 2UY8A 2WWSA 2VUAA 3TN92 1F5FA 4Q4V1 4RQPC 4DXZA 1G86A 1LOFA 2WNVC 1ZRFA 1RHI3 4LBOA 2W39A 4RFT0 1D2SA 3I4IA 3MIHA 1LJ7A 5CU1A 3NKTA 2ZAAA 4PBPA 4RGAA 3VZNA 3NV2A 2XL9A 2XWJB 4KG8A 1S0DA 1RUOA 4D7SA 3KQRA 5IK5A 3OTFA 2LM3A 1A8DA 1XNKA 4U2AA 4M3CA 2XBO2 3LOBA 3AZWA 1BBT3 5C8CA 3VL9A 4JAAA 1VB2A 4YFWA 2GNBA 4URTA 1BBT1 5JZGC 3FJSA 4Q4X2 3V64A 1CQ9A 2CV6A 4U36A 4I0BA 1G9CA 4QGMA 3N7KA 2VULA 1IKQA 3OF1A 3WX5A 2BNOA 2R16A 1BXHA 1W6QB 3ZFEC 3VZJA 1O7FA 2VPVA 1H1MA 2A6VA 4CEWC 2WIIB 1RMU3 2QZ2A 4Q2FA 4KU8A 3KD4A 4FPHA 1RMU1 5K7PA 4YW5A 5GLWA 2D6OX 2RR13 4HT1T 4L9BA 5CFCC 1NCQB 4AVVA 4YVSB 3BTAA 1LHUA 1COV3 2VW0A 2JD4A 4W6WA 1COV1 2AUYA 2GC3A 2GNTA 4P9XA 1OA3A 2DVAA 4IV1C 5CVRA 1CAUA 5D8AB 2G9GA 4QHBA 2WSUA 4E4ZA 1GBGA 5HBAA 4Q4W2 2N7GA 4LO5B 3VBSC 3JCIA 2ZHMA 1SFNA 2LALA 1OQEA 2Z69A 5JWPA 1NYWA 1GQHA 4BIOA 4COWA 1ULEA 3KM5A 4H14A 5FO9B 5F5QA 3RQ0A 1JOJA 3MW3A 1QJY3 3AFGA 3M1HA 1KFXL 2ZMNA 5GLZA 3WG4A 3O5SA 1J1LA 1QJY1 2DUOA 2F6BA 2GMMA 3VUOA 2OUHA 2NP0A 3B00A 1RTVA 3USUB 3VKMA 4A7KA 3WDXA 2WS92 4UW5A 2Y0OA 4AI2A 2JG8B 1OQDA 3O14A 2W0XA 1AR92 3WP6A 1FMD3 3ZFEA 1ND2B 2QE3A 3VBHC 1QXJA 4ZU5A 3KT7A 1FMD1 4XW3A 1YRZA 2HWB1 2XWBB 3KCCA 3IN9A 3OYWB 2RJLA 2P17A 3URFA 1B35B 2R063 4XFBA 4GA9A 3B01A 1X8MA 4M3CE 5CFCA 3ZFFB 4HSJA 1GKBA 1QNWA 4IEZA 1QGLA 4AQTA 3WY6A 4MXWA 2R061 4YW3A 4LBJA 2WL1A 1VBA3 5C6CA 2A6ZA 3AKTA 1VBA1 1V00A 3V56A 3SCHA 3MEPA 1AR82 2IXJA 4XQ4A 5BYNA 1FV2A 1MR5A 3V0AA 3QLQA 4AW7A 5HCAA 1HXS2 4E27A 3AYAA 4MLOA 4BWOA 1S0GA 2OVUA 4PDWA 5T5PA 4G9SB 1VRH2 1QOTA 1DZQA 2R043 3E6BA 4RD7A 4NHMA 3MLJA 1Y3TA 2DV9A 1S2KA 4AGGA 2R041 3AP9A 3SITA 1D4M1 3CJIB 1BKZA 3O0XA 4RR3B 5I91A 2ZX2A 1PHMA 1Y43B 4YFZA 4IL7A 4FVVA 1CIWA 3VZMA 2Y0IA 4JCKA 2BYVE 1B09A 1HRV3 1BJQA 3WCRA 1UU5A 3ZN4A 4FQZA 5CBLA 4FTEA 1HRV1 4E2SA 3AP5A 3QACA 1Z7S2 5ACA2 4XIOA 1RUC2 1CAVB 3LOIA 4B7KA 5BNNA 3DPRC 3MDPA 3S7EA 1N3PA 3ILFA 3AKQA 1YIPA 3UKNA 3VBUA 1SLCA 1C1LA 4AVSA 3SH4A 3VKOA 2RS13 1CX4A 4LLOA 3WHTA 2ZABA 1LGNA 3JBG3 2RS11 2DU0A 3ACLA 4IEOA 4KWJA 5BUVA 4WVVA 3JBG1 3VN4A 3AJYA 1MS0A 2Z79A 4LBKA 4S2HA 5C4WB 4NR1A 4K1YA 3IDCB 3QCWA 4INDA 3FE5A 1RUE3 4YM3A 1XU1A 3JD72 4OLLA 4Q0PA 3U10A 2RMU3 4IEPA 4QQ2A 3ZDSA 1V6OA 3LB9A 1PMIA 3TN93 4COYA 2RMU1 2JICA 1PZ8A 3R4SA 4K3UA 3TN91 5J3UA 3E6CC 4YGBA 1BMV1 4QPGA 5BNPA 3WV6A 1F5JA 1L3JA 4F7ZA 3FFZA 3B7MA 3TAYA 2WC2A 5FAXA 1JW6A 1OHFA 4FTBA 3UKTA 1C5IA 4WZCA 3WW3A 4Y20A 4R9CA 2Z42A 1CONA 4XYXA 5GZGA 5JI9A 1PNFA 5GZEA 2AENA 4KQ7A 5GZCA 2JECA 3VHRA 2W52A 4QM8A 5FO7B 1M4WA 4JQRA 3VBFB 2ET1A 5JOZA 3FFQA 4HETA 5FLIA 1NY71 3M70A 4LBQD 3MICA 4LBLA 3SCGA 4C1XA 2XG3A 1Q8VA 4FP2A 4XEZA 1PO11 4P14A 4D3WA 1VBB2 3WDWA 2IXLA 3FLPA 1R093 4FOVA 4K1ZA 2MNGA 1URXA 4MZUA 1R091 2Y26A 5IK8A 1XXNA 3PLQA 1QMJA 1NA1A 5KXBA 1I9RA 3KSCA 1J1TA 1H2KA 1YI7A 2R1DA 4NPRA 3GHNA 2KA3A 4DOUA 5K9YA 2JDZA 2WNEA 3A0NA 4CRQA 4FOWA 3H7JA 3GZAA 2A3WA 3MIBA 5FOBB 3U07A 1KDMA 5FCCA 1NCQC 2EXKA 3GALA 4M3CB 4D7TA 3E97A 3I8TA 4AFMA 5C8CB 5I0SA 4YVSC 5J98B 1RUF2 4HK8A 1WGPA 2ERFA 3MW4A 1CVNA 4N9IA 4Q0SA 1RIRA 2D3RA 3JQWA 5D8AC 2GDFA 2QDRA 4AEMA 1ZVFA 1FPN2 4RSUA 1V6LA 1IHMA 2VY0A 3AX4A 1PGL2 4MX3A 1YNAA 1WLTA 3MYXA 1H1IA 3RI9A 4NWVA 3AB0A 4LLFA 4W6YA 3AMPA 2WS93 2XJTA 5AVPA 1F2NA 4Q29A 2WS91 4NHKA 5CG8A 4FOQA 1G9BA 1MZFA 4FXKB 4AHZA 1DQ5A 4Q8LA 4ZXKA 2D40A 3NV4A 1A8MA 4H7MA 4KG0A 2X5IC 3GBFA 3POSA 5E1RA 1CAUB 2Q4SA 3SCFA 4YGCA 5FPXA 1NXMA 3ZX7A 3IPVA 1D2QA 1F31A 3VV1A 1EV12 3DL3A 1ZZCA 4HKOA 1LCLA 1APNA 2A5ZA 4COVA 4OUSA 1AR83 2ZGSA 1UAIA 4DY3A 1ZBE3 4X8NA 3E5QA 4NWWA 1YUDA 2WLQA 5KXEA 1AR81 3KCXA 4S2DA 1ZBE1 3ZFFC 4R4XA 4JDNA 3LKJA 3MPPG 3WP4A 1UL9A 2ZTNA 3NKGA 1DFQA 1ND3C 3HWJA 2D5FA 3AMMA 1KJRA 3D8CA 5J36A 3M7AA 1MQTC 4DMIA 2D98A 4UW4A 2BFUL 2JE7A 2R0FA 5IT6A 2R0HA 3G6JB 3ZFEB 4I0AA 3AP6A 3TWIA 4G3YC 2K0GA 1DBNA 4AE2A 4WVMA 4YM0A 4JV4A 4OHWA 4P9WA 4RR3C 1TEIA 3VBOA 5AC92 1Z7S3 5ACA3 1XYPA 1ZRCA 4P9LA 5IUQA 2DUQA 4XFFA 1UIKA 4MV2A 1Z7S1 3RRDA 5CFCB 4MXWB 4LBNA 3M8LA 3PTYA 1V9U2 2VG9A 1HRI2 1S0FA 2X5IA 3LA7A 1BVVA 5CNAA 3VKLA 4JGZC 5T5OA 2HWC2 1OMIA 1QJU3 1DYPA 4XFIA 2B9UA 4PDWB 2AZ5A 2WT1A 4Z82A 4Z8BA 1ENQA 1QJU1 3AMHA 2OZ6A 1GICA 1QOSA 4FQ4A 1LOCA 1Z0HA 2I45A 4DNYA 4DPNA 1Q43A 2XJSA 4BE3A 4EWEA 4K9SA 3VHPA 1SQ4A 3KGZA 2DFCA 4J1XA 2ET7A 3OY8B 4K6BA 4ASLA 3QH6A 3JD73 4FPYA 1TNRA 4DRRA 2OPKA 4AVTA 4QXKA 2VVEA 4XILA 2R49A 4WV8A 1WBLA 2IFRA 2GALA 1CPMA 3N7MA 1ND3A 1ZZBA 3NSTA 4LNVA 4BLJA 5C4WC 4LULA 2XHKA 4XFGA 1MQTA 3B3QE 1DYKA 3OGGA 4NOTA 4FPFA 3WDUA 3ZIXA 3H3UA 4XTMA 2YC0A 3UV9A 4ZU4A 4ASMB 3IKWA 3AKPA 1JTZX 1MS4A 2R072 3VBUB 2O0OA 4XDQA 1AYN2 2DVGA 3HT1A 1GANA 3L2YA 1XRUA 2EVXA 5K0UA 1TE1B 1S0EA 2A70A 4UW6A 3IM0A 5A32A 1AXKA 1QKQA 3H7YA 1DGWA 3O0VA 3ZXGA 5BV6A 3ZSMA 4IERA 4PCRA 1BZWA 2WSVA 2YY1A 1TME2 1YLLA 2D6LX 4JGZA 2XKPA 4XF3A 3VHOA 2RJKA 1UN1A 1C28A 3H9AA 4XJ9A 2UU8A 5CADA 1OSGA 2GH2A 4AFAA 4X6RB 4Y1VA 2DVBA 3VBFC 4RGGA 1KRIA 1QHDA 1MZ6A 5KHKA 1T6GC 2NLRA 3D0JA 1X50A 3C3VA 1AL0G 1AZDA 3B5LB 2PHWA 4WVZA 4QPYA 2CWSA 4QPGB 5BNPB 1VAKA 1AUYA 4AEDA 3ZFGC 4YRDA 5LK5A 2HKXA 5T5LA 4LHLA 1W2UA 4CDXA 5JR7B 4Y20B 1LOFC 4RHV2 5FQ0A 3R4DB 3FWEA 1JH5A 3N7JA 5FREA 3DPRB 1MS9A 1WMDA 2XLGA 1G9AA 3AXEA 4KNCA 3NO8A 1R1A2 1E57A 1MS1A 3GF6A 2D97A 1FPN3 3UJQA 1YHFA 1HIXA 2ZS6B 5DUWA 5F6KA 1FPN1 3M2MA 4CZSA 1ZM1A 1PNGA 4AVBA 4LA3A 4DY5A 2QJVA 3MIFA 1AXYA 1QH7A 2EA7A 1KFUL 4LA2A 5FOJB 3Q9OA 3V65A 4JVAA 1NA1B 1H2LA 1QNYA 5JSOA 1GZ9A 4AHYA 4XJUA 2HWF1 4MGKE 4E4SA 4A7ZA 4LUKA 4YNIA 5JPNB 3J9SA 4ORFA 1ZRRA 2IWGB 2BVVA 3MFAA 1EV13 3ZFGA 1SCRA 1Q8QA 1KDKA 1WMEA 4FPJA 4YZ4A 1CAXA 1DU3D 3B9CA 2FMDA 2NMNA 4HMZA 5KHIA 1AJKA 2D6NA 3B69A 1ZNPA 4L92A 4QU2A 1VBC3 3AM2A 4MVTA 3MW2A 2DVDA 3B9IA 2WFPA 3V0BA 1VBC1 1C8NA 1RHI1 5I0UA 1AVBA 5JOXA 2GH8A 5FTTC 4HZFA 3OD4A 2XLAA 2ZGNA 2A73B 4PQ9A 1DG6A 2HWE3 2SBAA 5DXDA 4IETA 2HWE1 4PJYA 2XVLA 1WCDJ 2XJQA 1V6NA 1O3QA 4R4ZA 2ZA9A 3VZKA 1O4YA 5AC93 4SLIA 1NQDA 5JSRA 5KC5A 1KJLA 4LT5A 4BYYA 1EYBA 5AC91 1N1TA 1RUG2 3CNAA 2IZWA 2ZPXA 3IPVB 1RUJ2 4K7JA 1RUD3 2ZHLA 3B94A 5J37A 2EAKA 4GKXA 1HRI3 1RUD1 4ATEA 4QQOA 4AI0A 1MS3A 5F6LB 5DZGA 1HRI1 3POYA 4MGYE 4Y1XA 4JRLA 4GXLA 3WVJA 3RS6A 4YW1A 2V5YA 2HWC3 4QM9A 3FUOA