5GZFA

Galectin-8 n-terminal domain carbohydrate recognition domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-8
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzfA00
1KRIA 1IS5A 4BOWA 3AZVA 4YM3A 4DQAA 1UZZA 1ZA4A 3R4UA 1QDOA 3ZPYA 4UW4A 3B01A 4Y22B 2R16A 4XTPA 4Q8KA 1YYNA 4JCKA 1BKZA 1F9KA 1CVNA 2D6KA 5GALA 4IQPA 1YXWA 1WW7A 3ZXEA 1GANA 5CAZA 3ZXKA 2D6MA 3M2MA 4RA0A 1N1VA 2D3SA 3M3CA 1MS1A 1XQNA 3IKWA 4LBLA 4XTMA 1G86A 2V5YA 4Y20B 1X50A 2W39A 1VALA 1I1EA 4P14A 3LCPA 3NV4A 3D4KA 3ZSJA 5FRAA 2KM2A 2P3IA 4AVTA 3RRDA 3AK0A 1RITA 1MVEA 1QOSA 2ZGQA 4FPHA 1GZWA 2YROA 4Y22A 3VKFC 3M3EA 4UW5A 1IS4A 1UZYA 2P2KA 2CWMA 1GICA 1FATA 1WW5A 1LENA 1N3QA 2VH9A 1LGBA 1MS3A 1GBGA 2ZAAA 3FBYA 3UJQA 3UL2A 1CN1A 3MW3A 4FPGA 5DUVA 3D5OA 2ZHNA 4YZ3A 1IS3A 1O4YA 1DLLA 3N7LA 1N3OA 4FOQA 4R9CA 4Y1XA 2CWSA 2D3PA 2PHTA 3WDTA 2JD4A 2ZGRA 2AUYA 5GLVA 4BQ1A 1MS8A 1WLWA 2E6VA 2XG3A 5DZGA 2YXSA 2DU0A 2NMNA 3O0XA 4XYXA 1Q8SA 2JDZA 3IPVB 1SCRA 3I4IA 4PQ9A 4XMAA 3UK9A 3WCRA 2CL2A 2Q5TA 1LU2A 4YG3A 1I3HA 4DRRA 2NMOA 1LHVA 3FLRA 5F5QA 3VKNA 2GMMA 1H9WA 3RSJA 4XHXA 1VIWB 5KXBA 1G9CA 4JC1A 2W52A 4PCRA 1SBEA 1QNWA 3SISA 3LSEA 2E7TA 2ZGMA 4HANA 3ZXLA 4Y1ZA 4Q26A 2P3JA 1SACA 3O0VA 4LBQD 2RHPA 4WVWA 1EPWA 2D6NA 2GN7A 3OYWA 3ATGA 4LBQA 2R1BA 1KJRA 4Q27A 1QNYA 1QOOA 3NWKA 1S0JA 4FOYA 5HCAA 2VUAA 1SLAA 1W0PA 4FOWA 1AJOA 1DYPA 2A75A 2VXRA 2VW1A 5CB7A 4NO4A 3VKLA 3N35A 2PHFA 4XILA 5CNAA 5E89A 1DQ6A 1KITA 1V00A 2DVAA 1S0EA 1UX6A 3PJQA 1FV2A 4OZXA 5T5LA 4R9DA 1LOFC 4YW1A 4YW2A 2DV9A 2Z42A 4ITCA 4CRQA 2NZ9A 2EALA 4YLZA 1DQ0A 2A6ZA 2VW2A 3I8TA 3ASIA 3H0OA 1GYKA 4DPNA 2AREA 3FUOA 3MW2A 4YG6A 1SLTA 1PZ8A 2NYYA 3ILRA 5GM0A 3KQRA 3HN1A 1LOAA 4GALA 3ZSKA 1IOAA 2R0FA 2E51A 3LSDA 1LU1A 2ZHKA 4WZFA 1GZWB 1LEMA 3SITA 4BLIA 2VY0A 3POSA 3SLIA 1F5FA 3DUIA 1WW4A 1AF9A 2WNEA 2D6PA 4AGRA 3N7JA 1N1SA 1S1AA 4YGDA 5IUQA 5KXDA 1LHWA 3W58A 3WUDA 3IMNA 2R0HA 4PBPA 3RMYA 3D6EA 4FPEA 3PVEA 3BTAA 2E53A 1GSLA 5BYNA 2DTWA 1LGNA 2ZMNA 3UJOA 3WDXA 2UWAA 4BMEA 2YY1A 4XJ9A 3USUA 5T54A 1S0FA 3MEPA 2C5DA 1LOCA 2A3YA 2I2SA 2WKKA 1BXHA 3ENRA 4FP2A 1GV9A 4FPFA 2DYCA 5H9QA 4FPJA 3AYAA 3WDUA 1Q8PA 3AP4A 4SLIA 1V6JA 3AFKA 5IT6A 2OUHA 1Y7BA 2ZA9A 3AZXA 4XE9A 2PHUA 1QF3A 1MS9A 4ASMB 3WLUA 3ZSMA 4ZXKA 3M3QA 1PZ7A 5E8AA 2A3WA 1ENSA 3USUB 1VLNA 4XZPA 3OPZA 5JOWA 1W6MB 1BJQA 3VUOA 5H9RA 1LCLA 2A70A 4YGEA 4FQZA 1JN2P 1LHOA 3ZYPA 4ATFA 1CQ9A 4YG0A 4LBQB 2A6VA 5GLUA 1W6QB 1SBDA 2ZGLA 4Y1VA 3ZXFA 4AGGA 4R9BA 3V0AB 4KBBA 5SV8A 4K1YA 1URXA 1UPSA 2ZGOA 1W6NB 2AR6A 3MPPG 4YM0A 1G9AA 4XJ8A 2CYFA 2DU1A 3C2UA 4AGVA 1QGLA 1HKDA 3WVJA 3NV3A 3A4UA 4CZSA 1RINA 4YW5A 3V0BA 4AVVA 2FHRA 1MS4A 4CTEA 1W6OB 1Q8OA 1V6LA 2DUOA 3TAYA 3WDWA 1G9DA 2DWRA 2ZGPA 1OFSA 1AXKA 1IKPA 2D3RA 3IN9A 3OY8B 1Z78A 3A0NA 4K20A 4M3CA 4YW3A 5GJ6A 1KDMA 1DQ2A 2ERFA 2P34A 3AZWA 5LK5A 1YI7A 5JOZA 1N3PA 2OUJA 4XIOA 3V0AA 3ILNA 3MW4A 5DUXA 2OW4A 2ZGNA 5IK7A 1JYIA 1QOTA 2HYKA 1G9FA 1ZM1A 2EF6A 5T52A 1LHNA 3V0BB 3AJZA 4LBOA 3V65A 2C9AA 1WUVA 1Q8QA 2ZZJA 4LBJA 3FFZA 1WBLA 2PHRA 3SNMA 1FNYA 2WT2A 3OYWB 1V6IA 1JOJA 1WLDA 2EXJA 3VV1A 1GKBA 1O4ZA 2ZGTA 1WD4A 3Q9OA 2D6LX 3O12A 4M01A 4XIKA 2DTYA 1AZDA 1SBFA 1WLCA 2DVFA 1HQLA 2ENRA 2AYHA 3AXEA 3AZZA 3N3HA 2B7YA 4WV8A 2WT0A 3POYA 1LOFA 2DVBA 1GNZA 1C1LA 2PELA 2W68A 3O5SA 4XOGA 2YMZA 1WD3A 4YM1A 1S0CA 4GA9A 2R1DA 4Y24A 4H55A 1DIWA 1UMZA 1ONAA 5T55A 1AXYA 1DBNA 1NXD1 3V64A 4FOVA 3PVNA 1ENRA 4MYEA 1LODA 1W6PA 3QCWA 5T50A 4I30A 1LULA 1R1ZA 3CNAA 5T5OA 1CJPA 2EIGA 4FPOB 2DURA 3N36A 4R9AA 2ZGUA 3WV6A 1S0IA 3RS6A 5T5JA 4YFWA 2AENA 1CESA 1MS5A 1S0DA 3N7KA 4FPCA 1G7YA 2A5ZA 2LALA 3HMYA 4PF5A 2DVGA 4XJWA 2EXHA 1MZ6A 2FMDA 1LOEA 5GLZA 3RMXA 3A0KA 1YRZA 5GZEA 5IK4A 1UN1A 3NV1A 5L73A 1ENQA 4GWNA 5F9TA 2WSVA 1DZQA 1W6NA 4DS0A 1AJKA 5E88A 1LEDA 1YIFA 1C4RA 4M3CF 2R49A 3N7MA 3RQ0A 3WHTA 4ZKTB 5KXCA 2YV8A 3WDYA 4Q8LA 1SLIA 1MVQA 3ZYRA 5JLVA 1UAIA 3GALA 2ZHMA 1AVBA 3WHUA 2ZMKA 4XJUA 3FUQA 5EWSA 3POWA 3AZYA 1LJ7A 4K1ZA 4GXLA 1V6OA 4YFZA 2NM1A 2CTVA 3AP5A 4P9XA 5JDBA 1IS6A 1RIRA 3W59A 1S0GA 4NOTA 3SH3A 2D44A 3IPVA 2GNTA 2UWCA 1CPNA 4W65A 4UW6A 1W6QA 4BMBA 4YGBA 4Z8BA 1YO8A 3ZVXA 4F83A 1D2SA 2GNDA 5JOXA 4PBOA 1B09A 1ULGA 3AYDA 3AYEA 1LESA 1W6MA 2P37A 5DUWA 1DHKB 5KXEA 2ZKNA 1A78A 1KJLA 2VW0A 1OKQA 5JVVA 2NP0A 1DQ5A 3WZ1A 2P3KA 1AX0A 1KQRA 1MZ5A 3B69A 1HLCA 1GZ9A 1ULDA 3B3QE 1SLBA 1LECA 1MACA 3AP9A 3OY8A 4GKXA 4M3CB 5GLWA 1QMJA 1MS0A 1LHUA 1FYUA 3ILFA 3PVOA 4P9YA 1CR7A 1KDKA 3APBA 2UU8A 3VKMA 5AVAA 4FPKA 3AP6A 3OJBA 3KM5A 1C1FA 2AGSA 1VAVA 4XHBA 4K21A 2A6XA 1PZ9A 3SH5A 4AWDA 2GALA 4YZ5A 3WDVA 1S0BA 1JHNA 2UURA 1HDKA 2CY6A 3FLPA 3L2YA 1CPMA 1OQ1A 4XJZA 1MR5A 1Z0HA 2TEPA 3PMEA 1AX1A 5H9PA 3OGGA 3WCSA 2D6OX 2EXKA 3IM0A 1UKGA 4XJAA 2VU9A 3U4XA 4GWMA 1LGCA 2D43A 4RL7A 1WCSA 5T5PA 1UL9A 2JE7A 1SLCA 2PHWA 1LOBA 1QKQA 2JJ6A 2WLQA 3B9CA 1C57A 2GMPA 4U36A 4LBNA 1SCSA 4AVSA 5DZFA 5DZEA 1FNZA 1FX5A 4ATEA 1JXNA 3ZXJA 1N1YA 2DUPA 4FQ4A 3R4SA 5DXDA 1A8DA 4FPLA 5GZFA 1W6OA 1FV3A 4XBQA 1JUIA 3ZSLA 4Y1UA 3WOGA 1CIWA 2PHXA 4FPYA 4L8QA 1H9PA 4C1XA 3OBRA 5IK8A 4FP3A 1WBFA 1G8WA 4GKYA 1SLLA 1V6KA 3AP7A 4UW3A 3OBTA 3FLTA 1VAMA 2AH2A 1JBCA 2A6WA 3AYCA 4ISRA 5DG2A 1LOGA 2GNBA 1QDCA 1QU0A 2OVUA 5GZDA 2A3XA 1J1TA 1LTEA 2WQZC 1DQ1A 2DVDA 4FVVA 5FREA 3VKOA 5GLTA 2GDFA 2WT1A 3DGTA 3WUCA 4YM2A 4XXAA 2A7AA 5EXOA 1W6PB 4HL0A 3HR9A 1DFQA 2ZBJA 1BZWA 1DQ4A 2BQPA 3AX4A 5DUUA 1JW6A 1BQPA 2ARBA 1ULFA 2EAKA 2ZACA 1CONA 1ULCA 2ZMLA 5JOYA 1AX2A 3B00A 4XMIA 1IKQA 4TYSA 5IK5A 1D0HA 2NN8A 1ULEA 3WG2A 4YZ1A 1JYCA 2W08A 3R05A 1W0OA 4XXPA 3T1LA 1N47A 3INAA 5GZGA 5HCFA 4D69A 2ARXA 1BYHA 5CBLA 4LBMA 4AYUA 3WG4A 2H0BA 4M3CE 2LTNA 1Q8VA 4BPZA 1AXZA 2UWBA 3BOPA 3NV2A 4YGCA 4BM8A 1APNA 1HQWA 1F31A 5CA6A 4ISQA 2SBAA 4WVVA 1TEIA 5JMCA 2JE9A 2SLIA 3QLQA 4Q1PA 3GNEA 5HCBA 4U2AA 1Q56A 4DFSA 4YZ2A 3BIWE 2XB6C 4Y1YA 2JKBA 1V6NA 4XBNA 5EYXA 4LBKA 1GNHA 2ES3A 1N1TA 3M3OA 4Q2FA 3M1HA 2D7FA 1GZCA 1DGLA 2G4IA 3JU9A 3JUUA 2A6YA 3SH4A 4C1WA 3RG0A 2ZABA 3T1MA 1WW6A 3TB0A 1DYKA 2WSUA 1GLHA 4JRAA 4YZ4A 2CNAA 2ZGKA 3BODA 1A3KA 5EYYA 2GMEA 4Q1RA 2WJSA 2ZGSA 2EXIA 3WNXA 4BLJA 5GZCA 4TZDA 2JECA 2A71A 2DUQA 3WG3A 4P9WA 1SFYA 2GN3A 3WG1A 1NLSA 4DRVA 1H30A 1U0AA 4M00A 2ZHLA 3O0WA 5H9SA 1G9BA 3T2TA 2V73A 1V6MA 2GNMA 4Y26A 2YZ4A 5DG1A 4XDQA 4XBLA 4YW4A 2E7QA 4Y20A 1FAYA 3AXDA 3AJYA
chains in the Genus database with same CATH superfamily
3GYDA 5A3MA 2RM21 2VM9A 4GIQA 4YM3A 1CAWA 1UZZA 3R4UA 4H7LA 4S2DA 2OIIA 4UW4A 1RUI3 4Y22B 5FXXA 2R16A 5A32B 4JCKA 1F9KA 5CFDB 2XJQA 4EWAA 4BA6A 1HB4A 4AI8A 1GANA 1GQGA 4DUXA 1PGW2 3ZXKA 3RZJA 1N1VA 3CEWA 1BBT3 2VL4A 3IKWA 2V5YA 4RGAA 4QXHA 3LCPA 5DAPA 2KM2A 4AVTA 1AR91 3H8UA 3RRDA 1W8OA 4A7ZA 3VBRB 3VHRA 4AVCA 3K4ZA 4A45A 1GZWA 4E4SA 2YROA 5K0UA 5FJKA 3B02A 3M3EA 4FSJA 5DAVA 2YBSA 1UZYA 2CWMA 2VH9A 1N3QA 3LPGA 2TNFA 4BU2A 2ZAAA 3UL2A 5C8WA 3BTZA 1ZA7A 1F8VA 3MW3A 4D6SA 5DUVA 5F32A 3BKZA 1RUE2 2ZZQA 4W6WA 3UGFA 3U75A 4D0QA 3D3AA 3EO6A 2GC0A 2YYOA 1ZZCA 3UGGA 4HN0A 4JZRA 5C5UA 1JZ2A 3EB7A 4CU7A 4MGTA 3DPRA 1PVC1 4LMFA 3GBGA 2PXJA 5DZGA 4MLOA 2BP6A 2DU0A 2NMNA 2RDQA 1K3IA 1LKNA 5FWEA 3T09A 2YC0A 3IPVB 4YVWC 1JU4A 1KFXL 1SCRA 3I4IA 2Y64A 4XMAA 5FYMA 3J8F3 2Z4FA 3TRSB 2Q8OA 3AKPA 4OYUA 4DRRA 4YSFA 4MUVA 1GWKA 1T6GC 1KEXA 3VKNA 2GMMA 4QDSA 1H9WA 4R4XA 2X05A 2ET1A 4O9GA 5APAA 3VBSA 4AEJA 2HWB1 1RUI1 5KXBA 1RVF1 1XYOA 2VJXA 3LOIA 4PCRA 2Y0IA 1VMJA 1D4VB 1DGWX 1VR3A 2E7TA 4D6QA 2IZWA 2A73B 2H6CA 1JH5A 4Q26A 1SACA 1VB2A 2BTVC 5TSWA 4AAPA 5A7SA 3NWKA 1S0JA 4FOYA 5HCAA 3EJKA 1W8HA 5EV7A 3ITQA 2VUAA 5A3LA 1SLAA 2J1SA 1QH6A 1QY4A 1TMF1 1XNDA 2QQLA 5C9AB 5ACA1 1AJOA 2VXRA 4L2NA 3VKLA 3ST7A 4NMIA 4JGZC 1X9TA 2V4VA 4XILA 3HD8B 1DQ6A 1KITA 1UNBA 1V00A 1JYTA 4I0AA 1AR63 1S0EA 3PUAA 4A44A 3AKQA 4MGKE 3PJQA 4XUOA 2YPJA 4JQRA 4K3UA 4OZXA 4CDWC 1LOFC 2P6HA 3MBWA 3AKTA 3H9AA 2BBAA 5B2GB 2QTWB 1UO9A 2VW2A 3N9NA 4PHZA 4Q0PA 4QPIA 3ASIA 1W8FA 1GYKA 4DZGA 1ENXA 1JOBA 4HKWA 4AI2A 2VC9A 4GALA 2ZEYA 3H3UA 1OUXA 2E51A 4QGLA 3LSDA 1LU1A 3SCFA 2ILMA 3D8CA 1PVC2 5EP9A 4W50A 1ZRFA 1REFA 1XXNA 1LEMA 5C5TA 4NWVA 4A7KA 2E33A 2ZX2A 1VBD1 1AL23 2VY0A 3H3ZA 4K40A 4OMCA 2ZX4A 3U1XA 2CGPA 4G3YC 4DO0A 2WNUB 1H2NA 1S1AA 4YGDA 5KXDA 1W28A 3W58A 2VQTA 5L9BA 5A3UA 4CYDA 2ET7A 2R0HA 4PBPA 3ZN5A 1DF0A 3RMYA 4WBBA 4FPEA 1ZBA2 4Q0SA 3WF0A 3DKQA 3KMHA 3I59A 3OUJA 2DTWA 2ZMNA 3T30A 4BMEA 4W6XA 4FI9A 2RS32 3MEPA 3WQBA 4CUBA 5J36A 5FBJA 3OCPA 3ENRA 1GV9A 2DYCA 1RUC2 4FPJA 3AYAA 2FDIA 1Q8PA 3S0MA 1W90A 3VHPA 1HRV2 1V6JA 2VPVA 4JDMA 1ALYA 4XFFA 5FZMA 1RGSA 1Y7BA 1GQPA 4XE9A 2PHUA 3KT7A 4O65A 1PM4A 3RI9A 3LEIA 5D2AA 4UFMA 4ASMB 3X29B 4BB3A 2X5IB 3P3PA 4NIDA 2Y60A 1WMEA 2WWUA 3N9OA 3M3QA 1OXCA 2XUMA 1PZ7A 2B4KA 1YLLA 3RZLA 5JOWA 1RUNA 3CL1A 1NY71 4V2WA 1US2A 4AQTA 4FQZA 1AYM1 2VMEA 4CCEA 3ZYPA 1CQ9A 3FHAA 3HPNA 1R1A1 2B45X 5DQ0A 5DPNA 5A7OA 4HSJA 4BK4A 4CP1A 5GLUA 1FMD3 2XBO2 2ZGLA 3G6JB 1WCKA 5E1RA 2QQKA 2ZX3A 2JG8B 5FP8A 3VBOA 4WM8A 4IEYA 4YM0A 1W9TA 1CAVA 3O1UA 2CYFA 4G9SB 1XSQA 1OSGA 1QGLA 1HKDA 4Y5TA 5FY5A 4ES9A 1W9YA 4YW5A 4RQPC 4AVVA 2FHRA 4EE2A 3TAYA 3WDWA 2DWRA 2VTFA 4IEZA 1IKPA 3KV4A 4K20A 1QQP3 3A0NA 4M3CA 3BTXA 3IIAA 2VNRA 2R6QA 5GJ6A 5FZ1A 1DQ2A 4AEKA 2ERFA 4QX2A 4P5HA 4WVMB 5C9AC 4OFGA 1N3PA 1COV2 3MIBA 3VB9A 3V0AA 3BU7A 1RXFA 3MW4A 5LY2A 4XF3A 3U78A 4C0HA 2CDOA 3VBFA 1JYIA 2ZKLA 1G6NA 1G9FA 1GOFA 2EF6A 2RS53 2VE1A 4N9IA 2QQIA 2QDRA 5JXJA 4OQ8A 4KGQA 4AFCA 1NLRA 1PMHX 2VVEA 3A23A 3SNMA 2WT2A 3OPTA 1FOD1 3S6PA 1V6IA 1JOJA 1JYWA 4HXCA 3KSCA 2EXJA 3TEZA 1O4ZA 3Q9OA 3I2DA 4IV1B 3O12A 4XIKA 1STMA 3JB8A 3ELNA 2YDEA 3C7FA 1GP6A 2WNVB 1PO23 3M8LA 3VBFB 3C3VA 3FJSA 2TBVA 5CFCB 3POYA 4L11A 3U4SA 2XJRA 3I2IA 1C1LA 3U07A 3U11A 4RS5A 1UU6A 1EAH2 1SEFA 4CUCA 4YM1A 1OBNA 1SG3A 3I49A 4AHWA 2XONA 3HNBM 3LFMA 3ZMNA 3BTYA 2VOTA 3F95A 1RUC1 5IHRA 2ID4A 1ONAA 4TWTA 1BHGA 3R6SA 2HWC1 1VAKA 1CX4A 2VCAA 3ZFGA 3B5LB 4FOVA 4HK9A 4QPGC 1NCRA 3PVNA 2XBO1 3AMMA 1W6PA 1GP4A 1HRI3 4OHVA 1LULA 5IVJA 3VZLA 5FXZA 5FCCA 2IFRA 3ZMOA 2VR4A 1XNTA 3GJBA 5FOBB 3E6BA 3WEZA 5HXMA 2ZGUA 3GBWA 4KWJA 3RS6A 4ORFA 3POIA 3R4DB 1J84A 1PO11 1ZBE2 2H0VA 3FX3A 3KS7A 1H8TC 2A5ZA 4GZ9A 2RMU1 4M4PA 2EXHA 2W5FA 5LEKA 4P02B 5HI0A 1YRZA 1JYNA 3ZYIB 4COUA 1QJY3 2WAAA 2WNUA 2ZEWA 4EN8B 5IK4A 2B9VA 5L73A 1GFF2 4Q4W2 3IDBB 4OULA 1IZ3A 3NW4A 3WNKA 2D98A 3K48A 2WSVA 1XU2A 4WZCA 5FP4A 4DUVA 1AJKA 4N43B 1LEDA 2WFF2 2VCCA 4NIGA 4QX1A 3CU7A 5AC92 1SLIA 1FPN3 4ZY9A 2RS33 1YFXA 5JLVA 1UAIA 4AE2A 1AVBA 2ZPXA 3JXSA 3ON7A 2IC1A 3FUQA 3LB9A 5EWSA 3AZYA 2O1QA 4XQDA 1OQEA 1EV11 1V6OA 4INDA 4W8JA 3SHRA 5JDBA 2CV6A 5FZCA 1IS6A 3WP4A 1W8UA 4HONA 2D44A 4B1LA 3Q8BA 3VZNA 4BXFA 4DUWA 2GNTA 5J96B 5LRSA 1H1MA 4UW6A 4B4PA 5IFPA 2Q8EA 1DGRA 5L36A 3J4UH 4HETA 4MADA 1DU3D 3WP3A 2XUEA 1JHJA 1AR71 1VE0A 1LESA 2P37A 1REEA 2YGLA 3AYDA 5ABJB 2BGOA 3RZGA 1DHKB 5I0TA 1IPKA 2O8QA 2B8MA 3N9LA 4AEDC 3WF4A 3NNFA 2XGXA 3TWIA 2MEV2 3WZ1A 1AX0A 1MZ5A 3B69A 4AF9A 5JZGA 1AYN1 1C8M3 1GZ9A 2R071 1ULDA 4IGOA 3B3QE 2WS91 4ASLA 1SLBA 4FBFA 2K46A 1UX7A 3HQUA 4M3CB 5JI9A 1MS0A 1LHUA 1FYUA 5JXGA 3ZFFC 2Y33A 1X82A 1CR7A 1W2UA 1GMMA 1RUD3 1W99A 4FAGA 5JPMB 4ZS3A 2AGSA 1GR3A 4XHBA 4AWDA 4AQSA 1PZ9A 1UMHA 1BK0A 1EV13 1W8WA 2GALA 2YG0A 3JD71 4MXWB 3THPA 4AI9A 1JHNA 1FOD3 4NE9A 4COYA 1OQ1A 1CZSA 3WCSA 2YHJA 1EPZA 2Y6LA 3AMQA 4L9BA 3U4XA 2YBKA 4PDWB 4X6QB 3BI3A 3DV8A 1D4M2 1UL9A 2RS51 4NROA 4BH9A 3EQEA 2PHWA 1J3RA 5BNOB 4M0HA 3KCYA 3Q8AA 3B9CA 5A3OA 5C33A 2HJIA 4U36A 3HNMA 1FNZA 4ATEA 1NG0A 4LKFA 1N1YA 4HFSA 3SQOA 1V9U3 3OTFA 4BQ3A 1RMU2 4CEWC 2GH8A 4FPLA 1SPPA 3JQWA 3VBHC 1FV3A 4XBQA 1JUIA 4JHTA 2PLV2 5I91A 3WOGA 3ACFA 4FPYA 1WCQA 1H9PA 2RJ2A 5F3CA 5ANNA 3FFQA 4KU8A 1WBFA 4ZU5A 3TNPB 4GQ7A 5FWJA 3FLTA 3IMMA 2HH9A 1HRI1 2VQUA 1MQTB 4XFCA 2A6WA 4ISRA 4PI0A 3RZZA 4CEYB 3LEMA 3E6DA 2O14A 4NRPA 5L9RA 2W94A 1OVSA 2D93A 1KXGA 2OVUA 3NAPB 5ACA2 1QJX3 2A3XA 3WNNA 1J1TA 2CHHA 3LPFA 1UIKA 3PLQA 4GH4B 5FREA 1QXRA 3WUCA 4I0BA 4XUPA 4QDQA 4YM2A 4LUKA 2A7AA 5EXOA 1NQJA 1E5SA 1XNAA 3WQ7A 3IBMA 3SXWA 3Q8CA 2GH2A 4ZZ5A 5FP3A 2K2SA 3ALQA 3AX4A 3KVBA 2ARBA 2EAKA 4Q4W3 1CONA 2A1XA 3JCIA 3LA2A 1Q43A 1ULCA 1CAUB 4OMDA 5L7OC 1DDLA 3DPRC 1FT9A 2WN2A 4XMIA 1QJU3 3KB5A 5IK5A 2UYAA 2KD7A 3WG2A 4PI2A 2W08A 4Z07A 4LTAA 1XC6A 3LFIA 4DY3A 1K45A 1POV3 1N47A 4LA2A 4QX0A 2ARXA 5C7GA 2WZR2 3ZFGB 5J1XA 4Q0QA 4Y5SA 1ZREA 1O6UA 1OA2A 3AMPA 4XABA 3MUZ1 4ONUA 4RD7A 3CZUA 4QKDA 4P08A 5CA6A 5KC6A 2VZOA 1O8SA 3N4MA 4NR1A 2Y6HA 1QQP1 1AL21 2OT7A 2JE9A 1MPXA 3I59B 3K77A 3QLQA 4XDOA 4Q1PA 5I0DA 4UF0B 3HOBA 1J1LA 3H7JA 1QJX1 4U2AA 5HCBA 4DXTA 5BUVA 4MVTA 3IZOA 1Y9QA 2XB6C 3KF5A 3CKHA 2JENA 4UFIA 2QQPA 5A33B 3HBZA 4XDPA 3CO2A 2FZ2A 4FAHA 2W0XA 3M3OA 4CP0A 1L7QA 2XXZA 5FMCA 3UV9A 2Y26A 1DGLA 2VULA 4EN9B 1OH4A 2J1EA 4GB32 3T2PA 1VBB1 1TNRA 3T4HB 2D5FA 3RG0A 2ZABA 4EWEA 3ZX7A 4ZHNA 1AYM3 3S5QA 5BNPA 1KD7A 4H3WA 3BODA 4ES8A 4HZFA 3K75B 3WNMA 5JR7B 3WD5A 1JZ7A 1DZTA 5LBFA 4CCNA 5GZCA 1BBT2 2MPFA 2DBIA 2F6BA 2DUQA 4P9WA 5JSOA 2VZTA 5HCHA 1H30A 1CAXA 3MF9A 1C5HA 4B7KA 2VUCA 2ZHLA 4M00A 3CMGA 5H9SA 5BNOA 1COV3 1G9BA 3H8RA 2MHFA 2WL1A 3UETA 4LITA 4L97A 3ZN6A 4XBLA 3GHMA 4YW4A 4CDQB 2EICA 4MG2A 5LBBA 4MO3M 2FBEA 5FQ0B 4CU6A 1JODA 4BOWA 5ERLA 4TN7A 1TVGA 4DQAA 2FDGA 2HWF2 3KT4A 3ZPYA 1NAEA 1BCXA 2WA3A 4Q8KA 5BNNB 2HWB3 1BKZA 5A3WA 3J9SA 4B3NA 4UAPA 2X10A 4A2UA 3NO8A 2D6KA 1GQHA 1H0BA 1T2XA 1WW7A 3ZXEA 5KHJA 1S2EA 5FPBA 1R091 4LHNA 1AYN3 1C8M1 2R073 2D3SA 3ZSEA 1JOPA 1MS1A 1YC61 3O1OA 3OBZA 4QGNA 3VD9A 4MXWA 4P14A 5FYCA 3D4KA 1PX4A 3WNPA 3D0SA 5FRAA 5IVFA 3GZEA 4QQOA 1NKGA 2PLV3 2RR11 5BNNA 1QOSA 2ZGQA 5HV0A 3VKFC 5FZ6A 4GULA 2P3YA 3OG2A 5HV4A 5FZ4A 2J42A 2X09A 2Q30A 3LDKA 4QAWA 4WVZA 4EN0A 1LGBA 2KR2A 2JE8A 2JB8A 4E27A 1ASJ2 3THCA 1BLZA 2UY8A 4Y3OA 2RG4A 2ZHNA 4NHLA 1ZZ9A 1QQP2 2C26A 4CUGA 1N3OA 4Y1XA 3E6CC 3WDTA 1VPHA 1V70A 1R082 2ZX0A 2JD4A 2ZGRA 2AUYA 5GLVA 1MS8A 2E6VA 2RDNA 1ZZ6A 5ACA3 4XYXA 3O0XA 2JDZA 1UXZA 4J1WA 3UK9A 2P4EA 4KI5M 2CL2A 1OA4A 4MHRA 2CU5A 1OLME 4QHZA 1L7LA 2Q5TA 4YG3A 2ZXQA 5FYVA 5KHHA 1F5JA 1UOJA 1A34A 1PMIA 3VD5A 2CGOA 1YHFA 2IXHA 1RUG1 2QZ3A 3CQOA 3FC0A 4XHXA 3B7MA 2RMU3 2B42B 3CHXA 1VIWB 4Z82A 3U0ZA 4S2HA 1G9CA 2W52A 4RR3C 1QNWA 1UWWA 2OX0A 3TEXA 1TZOA 3POFA 1HB2A 2ZGMA 3ETQA 4HANA 4RHV1 1Y3TA 3WW1A 1H8VA 1WCDJ 1BEV2 2RM23 2P3JA 4JRLA 4LBQD 4HVOA 4WVWA 3H1MA 3OYWA 5A7WA 3ZYFA 4N53A 3ATGA 4UYBA 5A7QA 1U5YA 4B29A 1KJRA 4OUEA 1HJFA 3NJXA 3KZ4C 3P1IA 4OQ9A 2OPKA 3MF6A 4BXSV 1WMXA 1XPWA 3I2FA 3I2HA 5JIAA 1RUC3 2VCMA 5F3GA 1ZRDA 1UZ0A 5LW9A 2XKPA 5BPXA 2C4XA 2A75A 3NKGA 5DAQA 1AR82 2O0OA 1EY2A 3K46A 5CNAA 3GF6A 5FLIA 1RHI2 3EMRA 3HIFA 4CCJA 3ZYBA 4KQ7A 1UX6A 4UI9L 2XJTA 5FPXA 1ACCA 3KQ4B 1M06G 5T5LA 1PO21 4YW1A 2IFWA 2WFF3 5FMOS 3HJRA 1OH3A 4CRQA 3NQHA 5IJRA 4YLZA 1DQ0A 3ZXDA 4OHXA 5DDJ1 5FYHA 1ZBA1 3H0OA 2IVIB 3PU3A 4DPNA 1DCSA 4CP2A 4YG6A 3FUOA 3MW2A 5GM0A 1YI9A 2NYYA 2VOVA 1SPPB 3HNYM 3ILRA 3KQRA 1LOAA 4O61A 2UY9A 4M4RA 1IOAA 2QJVA 1W03A 4OUMA 3SEPA 4WZFA 1JI6A 1JMUB 2DCKA 3O7OA 2GZWA 1UU4A 2DBNA 3MGUA 3UESA 3AC0A 1XJAA 1YUDA 2C0ZA 1F5FA 2VZ3A 1WW4A 5BV6A 4XFIA 2WNEA 2FZ1A 1C5IA 5FXWA 3VGIA 3ZLIA 4BDVB 4AGRA 2LUWA 1N1SA 5FYTA 5A1FA 3VZOA 2Y38A 1OVPA 2GAUA 4N7IA 5FY0A 3OPWA 1AR72 4LLOA 1LGNA 3MUY1 3H1YA 1XE8A 2ORZA 3ZN4A 4RHV3 4XUTA 1R64A 3CIHA 5FZAA 3RWNA 4DOUA 3USUA 5T54A 2VZ1A 2C5DA 2R043 1PK6A 2I2SA 4LIVA 1US3A 5JSRA 2XMLA 3AP4A 1VP6A 2RJKA 1RUF1 1HN0A 3L2HA 1UQXA 3H1WA 5K0UC 3T2OA 5IW0A 2PA7A 1PIV2 3QOPA 1TME1 1YJKA 4QWNA 3RFRA 4ZXKA 3ZSMA 4LKSA 4PIYA 4GWJA 3OD0A 3USUB 2FDJA 1VLNA 3OPZA 1V0AA 1O59A 1FXZA 1LCLA 2XL7A 1JN2P 3RJ2X 4ZS2A 3VLBB 2RS52 4UFJA 4YG0A 4LBQB 5FKBA 4BWOA 5J48A 2RDRA 1HV1A 1RUE3 4IEPA 3V56A 3V0AB 4HKOA 2OA2A 2E26A 5SV8A 2TUNA 5C4WA 3MPPG 2AR6A 2VG9A 5A80A 4QHOA 3GM8A 2LROA 3C2UA 4AGVA 1AR81 2Y6FA 4CXWA 1U5XA 1NA1A 1MZEA 2VNGA 4RGGA 4NHKA 3ZFFA 1Q8OA 2DUOA 2ZCWA 3I54A 1G9DA 5JZGB 4HBNA 1OPOA 2XVLA 1F4HA 5LB6A 5FZ8A 2VUJA 2YC2A 5IFTA 3AZWA 1VRH1 3EXUA 3VBOB 1YI7A 5F3EA 5F3IA 4PLNA 2HWD1 2JB4A 2J22A 4NIAA 4CCMA 2Z79A 2JWPA 1EAH1 1LRHA 5T52A 1LHNA 3V0BB 4CDXB 3V65A 1O3RA 1WUVA 5FLHA 3MIHA 3OUHA 1Q8QA 1X33A 1YFUA 5LA0A 1JU3A 1ZBE3 1RXGA 2PHRA 2V4AA 2AZ5A 2RMU2 4P9IA 1AR83 3OYWB 2HWE3 3WNOA 1WA6X 2YPDA 4XAEA 1UOGA 3VV1A 1BEV1 1GKBA 5AC93 1WD4A 1DP0A 3TNQA 1HJGA 5JIUA 5I8YA 3CLPA 2I07B 3OD4A 3RGBA 1JZ8A 1COV1 1Y9MA 2Q1MA 3R0RA 2AYHA 3AXEA 4MGZE 1O5UA 1DGWA 2WT0A 3SKVA 1AR61 1LOFA 2G19A 4GH4C 1RUI2 3PUQA 2YMZA 3RYRA 4E8CA 4QD2A 2VTXJ 4BQ4A 3BIEA 4Y24A 4J1XA 1GU3A 2E63A 4QPIC 5F5AA 4ARYA 3H8XA 1VBE2 5CFDA 5T55A 4DINB 4QPWA 1TME3 3QACA 3WW4A 1GOGA 1VBB3 2GC2A 2DFBA 3OOXA 4MYEA 1LODA 2EIDA 2WZEA 2XH6A 5T50A 3T4VA 4CEYA 5FZ7A 4NHMA 5F6LB 3WY6A 3CNAA 1SDDB 1CJPA 2G1MA 3GJAA 4DMIA 2DURA 2HWB2 5A1AA 2O8OA 4NRMA 1MEC3 5T5JA 4YFWA 1Q3EA 1IGOA 2AENA 5EJZB 1MS5A 1S0DA 3BUCA 1Y9GA 1J3PA 2QQOA 3N7KA 2LALA 4FPCA 3HMYA 4LKDA 1C28A 3OGRA 4IV3B 4XJWA 3A7QA 5GLZA 3VDDA 1AYN2 2R072 4XF9A 5L7OA 1ULOA 5GZEA 5I0SA 3NV1A 3DYPA 2ARCA 1ENQA 1IPJA 4QM9A 2JIGA 4KG0A 3DYOA 5E88A 1YIFA 4M3CF 3WHTA 3C8XA 5FQ0A 1D4M3 2G9GA 2AEYA 3QBQA 4Q8LA 1MVQA 1U12A 3MLKA 1WA4A 3NJYA 4I01A 2ZHMA 2FD8A 3KV6A 4PIXA 1RJ8A 4RHV2 4KG8A 2ZMKA 1UYXA 3VBUA 5J37A 4K1ZA 3ZFEB 3DXUA 4GH4A 4GXLA 2NM1A 4LHKA 1W2NA 1RIRA 2HWC2 3ZIWA 5AVPA 1QJU1 1S0GA 4P00B 5FP9A 3SH3A 3PHMA 5KR7A 3IPVA 3ACGA 3I7DA 3KD4A 1NZIA 3GDBA 1CPNA 4NN0A 4W65A 1CWPA 2J1UA 1ND2B 3FE5A 3VD4A 1YO8A 4F83A 1D2SA 2GNDA 5KC5A 4EN7B 4IV3C 4PBOA 1ULGA 3AKRA 3AYEA 4IEUA 2PAKA 5DUWA 4AW7A 4CDUC 4CEYC 3TYJA 3BALA 2ZKNA 4JVAA 1A78A 1KJLA 3DKWA 3VBOC 1OKQA 5AFBA 2RR12 4BQXA 5EHDA 2P3KA 1PM7A 2C9KA 3AP9A 4RQPA 3KGLA 4IUGA 1KDKA 2UU8A 2K0GA 1ASJ1 4E4ZA 1CAXB 2V72A 4A41A 3VBRC 1R092 5F5IA 2VZUA 3AP6A 4AK3A 4UXAA 4BIOA 1XBFA 3FL7A 1Z7S2 4ZU7A 2X8KA 5FZBA 4K21A 1KGYA 4K9SA 2BGPA 4CDQA 3WDVA 5FP7A 1VBC3 4GD4A 2CY6A 4YRDA 1CPMA 1Z0HA 5J98B 2DDUA 3IM0A 4RSUA 2YFUA 4DXRA 4GWMA 4OHWA 5T5PA 1H1AA 2FDFA 1RUH3 1X7NA 4LE4A 4AVAA 3UYJA 3EBRA 5L19A 1EP0A 1H4HA 4LO7A 2WABA 1Q5OA 2WN3A 4LBNA 3ZOIA 4LR4A 4XCBA 5DZFA 1FX5A 2VZRA 3P5BA 2VBPA 3HVDA 2DUPA 4I02A 4P9JA 1X8MA 4PIZA 1TMF2 4CXXA 2P1BA 3RI8A 4WM7B 1OI6A 3ZSLA 2BWCA 2W9XA 4IV3A 4PQQA 4AFAA 1W9SA 4C1XA 4L8QA 4CDUA 4XACA 5IK8A 2JIJA 1GP5A 4FP3A 1G8WA 1SLLA 1Y43B 4UW3A 3TBDA 5FOJB 4AHZA 4EQVA 2HEVF 4A7YA 5HBAA 1Z7S3 1VAMA 2AH2A 4XEZA 2VOWA 4QKFA 2WA4A 3AYCA 1E5IA 1RUD1 3T3YA 1QJFA 2VZSA 3MO4A 1LOGA 4H14A 4HN1A 3ME2A 4QU2A 3MV01 3NKTA 2GNBA 1NCQA 3D82A 1AL22 5FPZA 2WZR3 1O8PA 2BV4A 4UBHA 1K5MA 3CJIB 4PDWC 5FUNA 5GZDA 2OKXA 1UOBA 2VBDA 2EVXA 4C0BA 5F5CA 4H2AA 5BY5A 1SQ4A 3ZKUA 4QU1A 5JXHA 2GDFA 3ZDSA 4CDQC 3HT2A 3WQ1A 2E7AA 4HL0A 3AL5A 3HR9A 3BU0A 1DFQA 2J1RA 3E97A 2F17A 1DQ4A 2V5DA 4CUAA 1XOYA 2W46A 3AMNA 5A6QA 2QQJA 2B5HA 2ZMLA 1Z7S1 2JG9C 2WWSA 4AFDA 2G9ZA 4RFT0 1D0HA 4LO4B 3SEEA 3HWJA 4YZ1A 4PT6A 3R05A 3WINE 1NLQA 4M0NA 4AQ6A 3KF3A 3U10A 2JG8C 2XJUA 4ZU4A 3OUIA 3RZKA 3INAA 1QJZA 4RR3B 1BYHA 4GAZA 1PHMA 1FPN1 1H2MA 1VBA1 3VHOA 3VZKA 5CBLA 3PIJA 5ABJC 5J3UA 2FDHA 4XF0A 4CCOA 2QQVA 2DFCA 2I74A 2LTNA 1Q8VA 2R7EB 1AXZA 3RPQA 3BOPA 3NV2A 4QXKA 4BPZA 1APNA 1HQWA 2D5HA 4QXBA 1W9WA 2SBAA 5C4WB 4WVVA 1OLQA 1TEIA 1CAVB 1ZX5A 5GKAC 5A1LA 5FZOA 3HEIA 3URFA 3RYPA 2JG9B 2VECA 2VUDA 4ZPIA 4DY5A 3O1VA 4DFSA 1D2QA 3BIWE 2XJSA 4PDWA 4IEQA 4LBKA 1HV0A 4KU7A 4URAA 1GNHA 5L9VA 3J26N 2W1UA 2D7FA 2XR4A 3DXTA 4Q2FA 4W6YA 5SV5A 1GZCA 5CEHA 1E5RA 3W5MA 1XRUA 1OF4A 3JU9A 3KGZA 2JDMA 2YU2A 3BGAA 3AVRA 4Q4Y2 3SH4A 3N9PA 2HWC3 5K4LA 2BNNA 4GMP1 3RJRA 3C7GA 1GLHA 1A6CA 5DMYA 4PF1A 4BQ2A 4EZ4A 4YZ4A 2JG9A 1RUJ3 1IQDC 2CNAA 1A3KA 4IE4A 3RWKX 5LZ6A 5A32A 2ATFA 2X5IC 3WNXA 2EXIA 4LA3A 4OLLA 4UWDA 2BDRA 2A71A 1EYBA 4UOJA 2GN3A 5ANQA 3NNMA 5FZDA 4ZONA 2YU1A 3O1PA 1YIPA 3IT8A 1UKRA 3PTRB 4QKBA 5D8AA 2V73A 2GNMA 2YZ4A 5EPAA 1NE6A 1K42A 2DF7A 1RL3A 1J83A 4LOSA 3AJYA 3RYKA 1IS5A 1B35B 4DIQA 3GZAA 4O9EA 1R083 1ZA4A 2Q1FA 1QDOA 4UBGA 1W8ZA 5I0UA 1JZ4A 1RMU3 1W3XA 3B01A 3HBKA 4DXSA 4XFGA 1FOD2 1QH7A 3WW2A 2Q4SA 2WS92 1OF3A 4XQWA 4ET7A 4UFKA 4V1PA 5GALA 4IQPA 1YXWA 4EYUA 1POV0 1UY1A 1HIXA 2B9UA 2K9ZA 2D6MA 3BB6A 3DL3A 4RA0A 3T0AA 4Z92B 2Z2SB 3MIFA 1XQNA 3GGLA 1H6YA 1PK6C 1G86A 4LBLA 4Q0UA 4Q4V1 4QQPA 1VALA 3H3LA 2QUOA 3JZVA 3NV4A 1NY72 2BFUL 2P3IA 2HBTA 2QQWA 3O1RA 1W3VA 3KHBA 4FPHA 4GWIA 2R062 4BHPA 4GMP3 4Y22A 4IE5A 3B9IA 3VL9A 4AZZA 2ZS6B 3LA3A 4AI1A 4UW5A 1IS4A 2P2KA 3SCGA 1FATA 1WW5A 3VDBA 1XNCA 1XE7A 5C6CA 1CGPA 1XE0A 2VNOA 1ND3B 1FMD1 3D5OA 4YZ3A 3N7LA 4JKLA 1DLLA 2WIIB 2G9FA 4QQ2A 1QJY2 4YW7A 4TLFA 2CWSA 2D3PA 3FWEA 2PHTA 3THTA 5K9YA 3LOBA 3MZHA 1NT0A 2BOIA 4QPGB 2AC1A 4FFGA 1WLWA 2XG3A 4XPVA 1MQTC 1O3TA 1V9U1 5BNQA 3J7LA 2VMDA 2YXSA 2WYFA 1VBE1 1Q8SA 4ZXEA 1W9FA 4BJ0A 1H1IA 1BMV1 4LE3A 3W20A 1I3HA 2VMGA 2NMOA 1LHVA 2FQPA 3I2JA 5F5QA 3SMHA 1AR62 4HMZA 3MLLA 2WO3A 2IVJA 4P9LA 1BVP1 2PAEA 4UFHA 4GJZA 1S4CA 2AEZA 3SISA 1R081 3W5NA 4CPBA 3ZXLA 4Y1ZA 2QNKA 5CYYA 4K6BA 1PGSA 3O0VA 3I97A 2UYBA 2D6NA 2GN7A 2ZEZA 2GSYA 4NHYA 3HAGA 5FV3A 2R1BA 3WF1A 4Z2WA 3IDAA 4IGPA 5D8AB 1QNYA 1QOOA 4GMP0 4A3XA 4Q5OA 4AFBA 3MLJA 2BZDA 2FDKA 1NYWA 1ZZ8A 3NJZA 1I5PA 1W0PA 5JCTA 1RUG2 1VBD3 4FOWA 3AM2A 4LO6B 4TSVA 2VW1A 5CB7A 2EIEA 2QFEA 4NO4A 3N35A 5E89A 5JAXA 4CP9B 3GZTB 4CDWB 2DVAA 2IXCA 4XW3A 1VRBA 1GOHA 3JBG1 5FZFA 4LORA 4BCUA 5EIYB 3OB8A 2E31A 2BBVA 4YW2A 2JDNA 2E32A 3DEMA 4BK5A 1S2KA 2NZ9A 4JDNA 4B7EA 1BMV2 3I8TA 2A6ZA 2JDHA 1YQ8A 5FO9B 2PTMA 5FK8A 1UY4A 2IXIA 3ZSKA 2Z69A 1AR92 3GCWA 3HN1A 3WW3A 2R042 2R0FA 1T6BX 3J7NA 3PUHA 2ZHKA 1V9U2 1QXJA 5FPUA 1PK6B 3SITA 4YW6A 3ZM8A 4CEWB 3POJA 4BLIA 4DXZA 5FZKA 2Q0AA 3P6BA 1O3SA 2W95A 2BVVA 2D6PA 4QQLA 1OURA 4OUSA 4JHZA 3VZMA 5K8SA 4AI3A 3IMNA 1QJY1 2PQQA 3M70A 5LBEA 5FUPA 4D94A 3D6EA 5D1IA 3PVEA 4KGGA 4XC9A 3ZO0B 4COVA 1GSLA 1HW5A 3FHIB 3UJOA 3RDIA 3WDXA 2UWAA 2RM22 3D0JA 2HEWF 4XJ9A 3TN93 5I8TA 2WQ8A 5LWBA 1BXHA 4R4ZA 4L99A 1PNFA 5H9QA 1HQNA 1TQ5A 3VBFC 4DEVA 5IT6A 1YJLA 3AMHA 3PUIA 4IERA 1ASJ3 2MNGA 5I93A 2WZ8A 3GBFA 4FFFA 2PN5A 4JGYB 1QF3A 1O91A 3ZN6B 4D8MA 3VBUC 4Z1VA 1RJ7A 3OEBA 1PGW1 4JTNA 3PU8A 3UT0A 5IVCA 4IE0A 3MDPA 5C3QA 1BK1A 3RNSA 1ENSA 4XZPA 1SFPA 1W6MB 1BJQA 4J25A 2MEV1 5H9RA 2A70A 4XURA 1LHOA 1JZ3A 3NJVA 2BEOA 3T08A 4E9KA 5FO8B 2QVSB 2RE9A 2A6VA 4Y1VA 4AGGA 4R9BA 2DCJA 4PLMA 3FHQA 2ZGOA 4LK7A 4BQ5A 4AL9A 1NE4A 3EHKA 4XJ8A 1UIJA 3JD72 2DU1A 3ZR6A 4N90A 3WF3A 3UGHA 2XQXA 5JMOA 1H2LA 2CGNA 2Y34A 1W6OB 4CTEA 1V6LA 1NCRC 2W1SA 2ZGPA 4B8EA 1DLCA 1SZBA 1AXKA 2D3RA 3IN9A 3OY8B 1D4M1 1Z78A 5CIRA 5I8SA 3H8OA 3OEAA 4MXVA 2P34A 3HN3A 4AEDB 5JWPA 5LK5A 1RUF2 5A6YA 3ILNA 5DUXA 1GZTA 3CBNA 2XJVA 4IE6A 5CZKA 5JI7A 3RVHA 1CAUA 5IK7A 1H8TA 4QHBA 1OLRA 2HYKA 1ZM1A 1A8MA 4FO9A 3AJZA 4LUMA 4LBOA 1D0GA 2ADDA 4CCDA 4E4DX 5CU1A 2BFUS 3FFZA 1WMFA 3K51A 1MEC2 5C71A 4SBVA 4EZHA 4I2OA 3H42B 1WLDA 4R8HA 4LOTA 1FPN2 3MV11 1H4GA 1OQDA 2D6LX 2WO7A 4JGYC 4CDUB 4EJRA 1C3HA 2FCVA 2Y6GA 1AZDA 1SBFA 1WLCA 2DVFA 2CSGA 2XDVA 3OGSA 1HQLA 1VRH2 4AHYA 2ENRA 1NCRB 4YNIA 4AQ2A 3N3HA 1IQAA 4QB6A 3GXUA 2W68A 1GNZA 2PELA 4XOGA 4LT5A 1UPIA 3O5SA 4NVPA 5F39A 1S0CA 2JICA 4WM8C 4GA9A 4OI1A 3PNAA 2YBPA 5C3SA 2XJPA 4MZUA 4BQWA 1QEXA 3ZYGA 1UMZA 4HLTA 1AXYA 1DBNA 4YVSA 1HRV1 1P8JA 1NCQC 2BGCA 4GJYA 4C91A 3LQCA 1ENRA 3QCWA 5A6XA 4I30A 4LO8A 3P3NA 3ZYHA 3PL0A 2GP5A 4AAXA 4FPOB 5JSPA 3N36A 4LULA 4R9AA 2YB7A 2HWE1 2BVBA 1DG6A 1S0IA 1F2NA 1UD1A 5FMBA 3WV6A 5F37A 5J7MA 1CESA 2VAUA 5J09A 3VBUB 2HWF1 1RYYA 1G7YA 1OOPA 4MGIE 2RR13 4IEOA 2DVGA 1MZ6A 2FMDA 3RMXA 5DABA 1F15A 4MV2A 3A0KA 3S57A 5BXXA 3ZDVA 1EAH3 4CVUA 5CG8A 3GCXA 5HXVA 4GB33 2I45A 4KWLA 4LQRA 5DAWA 4GWNA 1YWKA 1OKOA 2ARAA 4DS0A 4ZKTB 4JGYA 3ACIA 3RQ0A 5DDJ2 1DGRN 1C8M2 5FZ3A 1AUYA 3WDYA 2RS11 4CXYA 1OC1A 3GALA 3T2QA 3K4AA 2D97A 2OPWA 4NHXA 4XJUA 1MEC1 3POWA 1LJ7A 3LIGA 4CCLA 5FZ0A 2ZAHA 1UY2A 3AP5A 5DN2A 4EV0A 1ZRCA 1ND3C 1HXS1 1ZZ7A 1PO22 1ZVFA 3W59A 2CAVA 4NOTA 4E2GA 4F8AA 2VVFA 1YFYA 5FJHA 1ODMA 1FI2A 2Y6KA 2QDNA 1HRI2 4JKMA 2XQRA 4KWUA 3VDAA 2PFWA 4IETA 4YGBA 3VBHA 1WGPA 2PYTA 3LDBA 3MI8A 1B09A 3VN4A 3VD7A 2JDKA 4X8PA 5KXEA 4FXGB 3ORJA 4J6GA 3ZKYA 4HPKB 2VOXA 4AEMA 1UCXA 5FO7B 5FYYA 5JVVA 1UXXX 1OUSA 5HPOA 1TMF3 2QKDA 2ZTNA 1NUKA 3POEA 4DNYA 1HLCA 5A3PA 2GP3A 2WZPP 4FTSA 4NWWA 1LECA 3OY8A 4XFAA 4LHLA 5GLWA 1QMJA 1OOPC 3ILFA 2VCBA 4P9YA 3ROUA 1HB3A 4KH9A 3APBA 4XQ4A 4XUNA 1WLTA 3VKMA 4S2GA 4FPKA 5KBFA 4A6SA 1BEV3 1OA3A 4C8DA 3KM5A 2BYVE 1HXS3 1C1FA 1WMDA 5CVRA 1VAVA 4E2QA 2A6XA 1OHFA 3M4FA 3FMGA 2JX9A 3SH5A 2R041 3VD3A 5CKNA 3LE0A 1YFWA 2UURA 1HDKA 1ZBE1 3L2YA 2DCZA 3LKJA 2D40A 5A70A 1TNFA 4XJZA 1MR5A 1OMIA 1UOFA 1RC6A 2W91A 2D6OX 3OGGA 4LPLA 5D8AC 1UKGA 5A7NA 5CFCC 1YNAA 2XHKA 1O3QA 4RL7A 2D43A 3I2KA 1TE1B 5EZWA 4JQTA 2BW8A 2HBUA 4I0WB 4RGKA 2XOMA 1SLCA 5G04L 2HWD3 4ASKA 2JJ6A 3JB4C 2WLQA 4C90A 1X9PA 2ZEXA 3G7DA 4K7JA 1C57A 4QPIB 2GMPA 1SCSA 3LD8A 2XHNA 2VMCA 2GC1A 2AACA 4RFRB 4QX8A 1JXNA 4FQ4A 1PVC3 3EYPA 1J3QA 2BUKA 2WBKA 1OD5A 4RS5B 1A8DA 5DXDA 3POGA 5GZFA 5FDBA 2HWF3 1W6OA 4NAOA 4AHXA 1JZ6A 1XNKA 4D3WA 5F8PA 4CU8A 4Y1UA 5KHKA 3O1MA 3OGVA 1WWYA 4HK8A 4MGYE 1UF2C 1ZBA3 4LO5B 1V6KA 3AP7A 3OBTA 5FYZA 4MHUA 5M0TA 4QX3A 2WFPA 2PMWB 2BNMA 5FYIA 2WLPA 4QMAA 2NPIA 5FXVA 1JBCA 5T3NA 3SCHA 3I2GA 3U14A 3U37A 2HWD2 5CFDC 2ADEA 2VZVA 2LS6A 2VTXA 1QU0A 2C1FA 3LEGA 3PDQA 4IESA 3S30A 3M7AA 4CCCA 4LLFA 1LTEA 5FMDA 3M3IA 1AYM2 2X53S 1VJ2A 3DGTA 3ECQA 3K3OA 4QXCA 5GLTA 1BBT1 4JAAA 1W6PB 1ZRIA 5FMOL 3S7IA 2LW8A 1JTZX 2ZBJA 1BZWA 5A7PA 2BQPA 3BPSA 3ACHA 1JW6A 4OCTA 3F2ZA 2EIBA 5BNPC 2ZACA 1ZNPA 4NAMA 5FZIA 5JOYA 4AVBA 3B00A 3DN7A 3WNLA 3LF7A 1OFNA 4TYSA 4IEXA 5FR3A 1ULEA 2HEYF 3HQRA 2Z5WA 5JPNB 2XLGA 3JBG2 1GNYA 4HG6B 4IXLA 5GZGA 3A22A 2BWAA 3ZFEA 4O7XA 4CEWA 1J58A 4IW3A 3IAPA 2RVAA 3QD6A 1RUG3 1VBD2 3CDZB 4YPJA 2H0BA 3VBSC 4BZ4A 4M3CE 5EJ3A 3ABZA 2UWBA 2Y6JA 4BM8A 1F31A 1UW8A 4ISQA 4FXKB 4EWDA 5JMCA 4KWKA 3KT1A 3MYXA 4YVWB 2SLIA 3J7HA 3AVSA 2EA7A 3ZFFB 3GNEA 3DYMA 4NUBA 4HT1T 1Q56A 5BNPB 4HOOA 4YZ2A 3MPBA 4CA9A 4XVHA 4A6OA 5DDJ3 1W2TA 5EYXA 3JD73 4E4HA 1VBA2 2ES3A 2IUWA 4X8NA 2QCSB 4P5YA 2VQAA 3JUUA 1IHMA 4FFHA 4C1WA 1WW6A 3TB0A 1DYKA 2WS93 2PAMA 2WSUA 3CF6E 5FZOB 5IYYA 4JRAA 4CDXA 4CDWA 2PLV1 4AR2A 5JUVA 2VMIA 3NMBA 3K2OA 1KFUL 4LEJA 2QQNA 2GMEA 5EYYA 2P17A 1VBC2 1H2KA 3I3MA 4Q1RA 2WJSA 2ZGSA 3FZ3A 4BLJA 4TZDA 2YUEA 5LASA 2JECA 1CX1A 4Q4X3 3WG3A 3KCCA 4HVRA 1R093 3WG1A 4NPMA 4DRVA 4XFHA 1U0AA 3NNGA 2KXLA 1OPMA 4CSWA 2VBBA 4NPRA 4Y4RA 3ES1A 4OI4A 3T2TA 2HYXA 3W21A 4D6RA 3VBHB 4N43A 2OXBA 3MIGA 4XDQA 4R52A 4IEWA 1IG0A 4K8RB 2LRPA 3AXDA 5F9TA 3TEWA 1KRIA 3FN9A 3AZVA 4S2FA 3I3QA 4Y4YA 3TN91 5IATA 3NNLA 4FTBA 2VMHA 4FCAA 5CKMA 3NRUA 5E16A 3DECA 1VMFA 2OQ7A 3MICA 3O1TA 4XTPA 1DYOA 1YYNA 2VVDA 2H6BA 5A6ZA 4B4QA 5A3TA 1CVNA 2XWBB 1EUUA 2LM3A 2R32A 1PIV1 2JDUA 5FIXA 5CAZA 3WX5A 3M2MA 1RUH2 1O7FA 2QQUA 3ZR5A 3IIIA 3M3CA 4Q4Y1 4Y20B 1X50A 2W39A 5LBCA 1I1EA 4D7TA 3ZSJA 1PGL2 2QZ2A 2R30A 3AK0A 1RITA 1MVEA 5EFUA 1L7RA 2C24A 1W06A 5FY1A 3KCXA 4CE8A 2GU9A 4BYYA 4CDXC 3WR0A 4I09A 4XF1A 3BYWA 1GICA 1PVXA 1LENA 3LIHA 3ZXAC 1C8NA 3POBA 1MS3A 1GBGA 3FBYA 4QGMA 2Q1ZB 1B35C 2VD7A 3UJQA 1CN1A 4FPGA 3UKTA 4IGQA 1IS3A 1O4YA 4A42A 1ODNA 2XBO3 5FFOC 4FOQA 4R9CA 3T0DA 3MIDA 3Q8EA 4IE7A 5C8CB 1RUOA 2WNVC 4BIFA 3MHZA 1SHWB 4BQ1A 1D7PM 1F35A 1RHI3 5B4XA 2ZJCA 4Q29A 2HKXA 4OI0A 3IB3A 3WCRA 2NLRA 1U5IA 4PQ9A 1W0NA 2JG8A 4META 4GB31 4QM8A 1LU2A 1S55A 2ORXA 4F7ZA 3FLRA 1ND2A 3CJXA 3RSJA 5DAXA 5ABJA 5FY9A 3JQXA 2PHLA 4Z2AA 1NA1B 4KBZA 4JC1A 3AB0A 1GWLA 4AG4A 1SBEA 5C9AA 2J1VA 3E5XA 1UMIA 4ARXA 3LSEA 2FCUA 2IXLA 2R061 1WCUA 3E5QA 3WQ0A 3LZZA 4HKLA 2RHPA 2W47A 2OQ6A 1EPWA 1W2AX 3LA7A 4LBQA 4N9HA 4Q4W1 4Q27A 4FTEA 2VQ0A 1HRV3 1H8TB 3J8F2 1XNBA 1I9RA 1RTVA 2DCYA 3PUSA 3QH7A 1B35A 3LDRA 1S2BA 1DYPA 1CAWB 1PO12 1NX9A 3PTYA 2PHFA 2XVGA 2W87A 4KL1A 1RUJ1 1LAJA 5F2WA 3IDEA 3VDDB 3ACLA 5JR2A 3ZPOA 1FV2A 3I3DA 2PQSA 1J59A 1ZZBA 4R9DA 4JX0A 1JZ5A 4JKKA 2DV9A 4N53B 2XL9A 2Z42A 3OGJA 4ITCA 2P6CA 3OF1A 1YQ6A 5A3NA 2EALA 2J7MA 5FZHA 3UKNA 2FCTA 4NRQA 5LA1A 5IVYA 5FAXA 2AREA 1K5JA 4CPBD 1SLTA 1PZ8A 4XCAA 4YVSC 5F6KA 4NIIA 3ZFGC 4EROA 4X6RB 3SKJE 1ND2C 4WM7A 1GZWB 3CZJA 2RDSA 4ZZ8A 1TG7A 4RR3A 3POSA 4IDZA 3SLIA 2RJLA 3DUIA 5ISLA 5FPLA 3GZUC 1AF9A 2JDAA 1XYNA 5C70A 1XB9A 3N7JA 5IUQA 1POQA 3CJIC 1LHWA 1M4WA 3MIEA 3WUDA 1NA1C 4E2SA 4Q4X2 3Q8FA 5FUIA 4N53C 4COWA 2BOJA 2KA3A 1W2OA 2WRAA 2E53A 3BTAA 1POV1 3QH6A 5BYNA 2YFZA 2JKXA 4B1MA 2VXJA 2YY1A 4N7UA 1LB2A 2IWGB 2NQYA 2YGMA 1S0FA 3E1F1 4FT8A 5LY1A 1LOCA 2A3YA 2F4PA 2WKKA 1CZTA 4FPFA 4FP2A 4LKEA 1QJU2 4PJYA 5FYBA 5A33A 3NNJA 1CD3G 3WDUA 4SLIA 3HT1A 4W4ZA 1JUHA 3AFKA 4MGSA 4JV4A 1MZFA 2OUHA 3BVCA 2ZA9A 3AZXA 3GHNA 1LR5A 1UY0A 1MS9A 3NVCA 2BPA2 1UYYA 5K7PA 3WLUA 1XU1A 1AL0G 2MEV3 2W3JA 3LAGA 5E8AA 1Y4WA 2A3WA 5KHIA 2VNVA 2HLEA 4P9GA 3VUOA 1NXMA 5I0RA 4CU9A 1RHI1 1WZXA 2DCTA 4IL7A 5FK7A 4YGEA 1QIQA 1F4AA 1AR73 4ATFA 2L9LA 4IEVA 2JDYA 4MH0E 1U5ZA 3C7OA 1PMJX 4LJHA 1W6QB 1SBDA 3ZXFA 1MQTA 3PURA 4KBBA 3USSA 4K1YA 1URXA 1VBB2 1UPSA 1G9AA 1W6NB 1WKYA 2XVKA 5LA9A 5LRRA 1SFNA 4YVWA 4BISA 3VDCA 1UYZA 5JZGC 1YQ2A 3WVJA 1K5MB 3CJIA 3A4UA 3LWCA 3NV3A 1RINA 4OZOA 4CZSA 3KHCA 3DPRB 3V0BA 1MS4A 5AFEA 2WUHA 1W8NA 1JS9A 4NJ4A 1OFSA 2RS31 4LHSA 3PJYA 5F7UA 4YW3A 3TOJA 1KDMA 3B93A 3RZHA 5JOZA 4WM8B 2OUJA 2BNOA 4XIOA 5LCWL 2OW4A 1ST8A 2ZGNA 4MOAA 1JYVA 3PVBB 4HVQA 1E5HA 1FMD2 1QOTA 1VMHA 3AFGA 4LXLA 5CKQA 2C9AA 3KVAA 2ZZJA 4LBJA 4XZUG 1WBLA 5IWFA 1FNYA 1PO13 3OBAA 3IDCB 1NQDA 4LK6A 4WVMA 3WP6A 4NIHA 2C6SA 2B46X 3C7EA 2ZGTA 5E6HA 1CZVA 5EQUA 2WO1A 1R1A2 4JGZA 4M01A 4UFLA 5F1RA 2DTYA 2XPJA 5FPVA 3HQXA 5JXIA 2F4LA 2VZPA 4QX5A 1QJEA 3A21A 1IG3A 3AZZA 2B7YA 4WV8A 1NOVA 2WDBA 3J8F1 4Y5Z0 2DVBA 3JBG3 4CP9A 3AKSA 1IPSA 1YQ5A 1WD3A 3BOWA 5C4WC 3RZMA 3N9MA 2XLAA 2R1DA 5IAVA 4H55A 3MFCA 3UNPA 1DIWA 2IXJA 2P5BA 2BJSA 5LA2A 3KV5A 4I3GA 5KWRA 2WZR1 1NXD1 3V64A 3PIGA 4BQYA 4BE3A 1R1ZA 2JD9A 5T5OA 5FY7A 4D7YA 3L9JT 2EIGA 2RS12 3ES4A 4OHYA 2OZ6A 2OZJA 2BERA 4XAAA 1ULPA 4K8FA 1QJX2 3DF0A 2W2IA 4PF5A 5EJ1B 1EV12 1OD3A 4YVSB 5LATA 5K0UB 1LOEA 1AR93 1HXS2 4DEQA 2XLFA 1UN1A 2WYSA 3NSTA 5IVEA 3C7HA 3MFAA 4L92A 1YEWA 4QB2A 1DZQA 5FKCA 2OYZA 1QXPA 3THDA 5FPAA 1W6NA 1VBE3 3WP5A 5KXCA 1C4RA 1XSRA 2R49A 3N7MA 4N8MA 5C8CA 2YV8A 1HX6A 1NCQB 3ZFEC 2V09A 3ZYRA 3IAQA 4Q4V2 3NAPA 4AI0A 2HWE2 1CIYA 4RYDA 3E5UA 3WHUA 4MX3A 2Q8CA 4JTOA 4PLOA 1VBC1 1HB1A 4LNVA 2J1AA 4OI2A 4YFZA 1E57A 2CTVA 4P9XA 4RN5A 3ZIXA 4L0PA 2WO2A 4QX7A 2W92A 3WT3A 1QHDA 1VB4A 2WAOA 1REDA 2UWCA 2N7GA 1W6QA 5C3OA 4BMBA 2X29A 4Z8BA 5FYSA 3ZXGA 3H7YA 3ZVXA 1L3JA 5JOXA 3PMSA 4MGQA 1TME2 4MSVA 4UF0A 1I5ZA 1W6MA 1XYPA 4IV1C 2FMYA 3I3BA 2VW0A 2NP0A 1O5LA 4G4FA 1DQ5A 5FY4A 1NZCA 2JXAA 4Q4V3 1KQRA 5FZEA 3BPZA 4A3ZA 4UT5A 2Y0OA 1LNSA 1MACA 4GKXA 3PVOA 5A7WB 4YYOA 3KV9A 2VZQA 3VDDC 1K5MC 4QPYA 2IXKA 3ETPA 3TEYA 4JDOA 3H50A 5AVAA 3OJBA 3I2OA 2QBXA 2JDPA 1W04A 5FBZA 5C3RA 1RMU1 2R063 5AC91 1O4TA 3WXPA 4YZ5A 1PGL1 1S0BA 2ETEA 1SDWA 2Q8DA 3FLPA 4QKNA 1YCIA 4HPKA 1GUIA 1UYPA 2TEPA 5BNOC 3PMEA 5C8CC 1AX1A 5FZGA 5H9PA 2VGDA 1BVVA 1W39A 2EXKA 4XJAA 4AFMA 2VU9A 1X8EA 4RQPB 1UY3A 5IAXA 3NAPC 1LGCA 4N43C 1WCSA 2B39A 4YWAA 2JE7A 1AHSA 1LOBA 1QKQA 4JGZB 3VHNA 4Y33A 5CADA 2QE3A 3K4DA 5FY8A 2CAUA 4LIUA 4QQHA 1VRH3 5DZEA 4AVSA 5KHGA 4QB1A 3S7EA 3VBSB 4OVEA 3ZXJA 4E8DA 5B4NA 4TTGA 3R4SA 2ZOEB 1OOPB 4KMQA 2PHDA 1I6XA 1CIWA 4QT6A 2PHXA 4IV1A 3OBRA 4RS5C 1OT5A 2Y8KA 1KS5A 3FBMA 5IVBA 1PNGA 4GKYA 5FZ9A 1K12A 2WR9A 4FFIA 4XUQA 1H6XA 1RB8G 3SC7X 3AL6A 1RUE1 1R1A3 1ZRRA 5DG2A 3WSOA 5BNNC 1QDCA 4QPGA 4NPLA 1X36A 1GWMA 3O14A 1DZRA 5FYUA 3VBRA 4AOCA 2WQZC 2WC2A 1DQ1A 1SMVA 2DVDA 3NL1A 4FVVA 4I3PA 3VZJA 3VKOA 2WT1A 4Q4Y3 4XXAA 1YQCA 2W1QA 4DB5A 5FZLA 1KS4A 1PIV3 1UZVA 5DUUA 2EAAA 2WNVA 1BQPA 1ULFA 1W8TA 2XKOA 4XETA 3O1SA 4HSLA 1VBA3 3WF2A 4XFBA 4D7SA 1AX2A 2WINB 2WNUC 1IKQA 3OSDA 1HN1A 3DCQA 5C3PA 2NN8A 2X5IA 4URTA 1UZWA 2WWJA 3ZYJB 3VL8A 1JYCA 5G05L 1RUJ2 1W0OA 2E9QA 4XXPA 4A4AA 3W9AA 3T1LA 4F3JA 2VOKA 5HCFA 1RVF3 2RV9A 3BN6A 3K3NA 4KNCA 3UKVA 4D69A 4LBMA 2RS13 1EUTA 2YC4A 3KLSA 4TLGA 3J7MA 4AYUA 4EN6B 5CG9A 3WG4A 2VO5A 4CCKA 2J1TA 3I3EA 4V2VA 3KWVA 1CJDA 4YGCA 2BRTA 4Q4X1 1ND3A 2ZX1A 4Q0VA 3S5AA 5FTTC 2W1WA 5F2SA 5D21A 1OLMA 4TXWA 5CISA 2VMFA 4XTMA 4Y1YA 2JKBA 1V6NA 4XBNA 4YARA 1JYXA 3LEKA 4QDRA 1N1TA 3BCWA 3LGRA 3T0BA 4AEDA 3M1HA 5FLJA 1PX3A 1W05A 2QQMA 2G4IA 2CDPA 2WNOA 2WFF1 2A6YA 3T1MA 2GC3A 3TN92 4AXOA 4H7MA 4XF4A 2JEMA 2OS2A 1RVF2 2ZGKA 2XWJB 1QWRA 1ZYBA 5LEJA 1UU5A 5LK7B 5L7OB 4COZA 1SFYA 2BU9A 3B94A 1NLSA 4OHZA 5IVVA 3O0WA 1RUD2 4B4RA 1RUH1 1RUF3 2WQ4A 4Y26A 1V6MA 5CFCA 3IWZA 5DG1A 4WM7C 2E7QA 4Y20A 3N9QA 1FAYA
chains in the Genus database with same CATH topology
3GYDA 5A3MA 2RM21 4GIQA 4YM3A 1CAWA 1UZZA 3R4UA 4H7LA 4S2DA 2OIIA 4UW4A 1RUI3 4Y22B 2R16A 5A32B 4JCKA 1F9KA 5CFDB 2XJQA 4EWAA 4BA6A 4AI8A 1GANA 1GQGA 1PGW2 3ZXKA 1N1VA 3CEWA 1BBT3 3IKWA 2V5YA 4RGAA 3LCPA 2KM2A 4AVTA 1AR91 3H8UA 3RRDA 4A7ZA 3VBRB 3VHRA 4AVCA 1GZWA 4E4SA 2YROA 5K0UA 3B02A 3M3EA 4FSJA 1UZYA 2CWMA 2VH9A 1N3QA 2TNFA 2ZAAA 3UL2A 5C8WA 1F8VA 3MW3A 5DUVA 1RUE2 2ZZQA 4W6WA 3EO6A 2GC0A 2YYOA 1ZZCA 4HN0A 3DPRA 1PVC1 3GBGA 5DZGA 4I2OA 4MLOA 2DU0A 2NMNA 1LKNA 2YC0A 3IPVB 4YVWC 1KFXL 1SCRA 3I4IA 4XMAA 3J8F3 3TRSB 2Q8OA 3AKPA 4DRRA 4YSFA 4MUVA 1T6GC 3VKNA 2GMMA 1H9WA 4R4XA 2ET1A 4O9GA 3VBSA 4AEJA 2HWB1 1RUI1 5KXBA 1RVF1 1XYOA 3LOIA 4PCRA 2Y0IA 1D4VB 1DGWX 1VR3A 2E7TA 2IZWA 2A73B 2H6CA 1JH5A 4Q26A 1SACA 1VB2A 2BTVC 5TSWA 3NWKA 1S0JA 4FOYA 5HCAA 3EJKA 5EV7A 2VUAA 5A3LA 1SLAA 1QH6A 1QY4A 1TMF1 1XNDA 5C9AB 5ACA1 1AJOA 2VXRA 4L2NA 3VKLA 3ST7A 4JGZC 4XILA 3HD8B 1DQ6A 1KITA 1V00A 4I0AA 1AR63 1S0EA 3AKQA 4MGKE 3PJQA 2YPJA 4JQRA 4K3UA 4OZXA 4CDWC 1LOFC 3AKTA 3H9AA 5B2GB 2VW2A 4Q0PA 4QPIA 3ASIA 1GYKA 4DZGA 1ENXA 4HKWA 4AI2A 4GALA 3H3UA 2E51A 4QGLA 3LSDA 1LU1A 3SCFA 2ILMA 3D8CA 1PVC2 1ZRFA 1REFA 1XXNA 1LEMA 4NWVA 4A7KA 2ZX2A 1VBD1 1AL23 2VY0A 3H3ZA 4K40A 2ZX4A 2CGPA 4G3YC 2WNUB 1H2NA 1S1AA 4YGDA 5KXDA 3W58A 4CYDA 2ET7A 2R0HA 4PBPA 3ZN5A 1DF0A 3RMYA 4WBBA 4FPEA 1ZBA2 4Q0SA 3KMHA 3I59A 2DTWA 2ZMNA 4BMEA 4W6XA 2RS32 3MEPA 5J36A 3OCPA 3ENRA 1GV9A 2DYCA 1RUC2 4FPJA 3AYAA 1Q8PA 3S0MA 3VHPA 1HRV2 1V6JA 2VPVA 4JDMA 1ALYA 4XFFA 1RGSA 1Y7BA 4XE9A 2PHUA 3KT7A 3RI9A 4ASMB 3X29B 2X5IB 3P3PA 1WMEA 3M3QA 2XUMA 1PZ7A 1YLLA 5JOWA 1RUNA 3CL1A 1NY71 4AQTA 4FQZA 1AYM1 3ZYPA 1CQ9A 1R1A1 2B45X 4HSJA 4CP1A 5GLUA 1FMD3 2XBO2 2ZGLA 3G6JB 1WCKA 5E1RA 2ZX3A 2JG8B 3VBOA 4WM8A 4IEYA 4YM0A 1CAVA 2CYFA 4G9SB 1OSGA 1QGLA 1HKDA 4ES9A 4YW5A 4RQPC 4AVVA 2FHRA 3TAYA 3WDWA 2DWRA 4IEZA 1IKPA 4K20A 1QQP3 3A0NA 4M3CA 3IIAA 2VNRA 2R6QA 5GJ6A 1DQ2A 4AEKA 2ERFA 4WVMB 4P5HA 5C9AC 4OFGA 1N3PA 1COV2 3MIBA 3V0AA 3BU7A 3MW4A 4XF3A 1JYIA 4C0HA 3VBFA 2ZKLA 1G6NA 1G9FA 2EF6A 2RS53 4N9IA 2QDRA 4KGQA 4AFCA 1NLRA 2VVEA 3SNMA 2WT2A 1FOD1 3S6PA 1V6IA 1JOJA 3KSCA 2EXJA 1O4ZA 3Q9OA 3I2DA 4IV1B 3O12A 4XIKA 3JB8A 3ELNA 2YDEA 2WNVB 1PO23 3M8LA 3VBFB 3C3VA 3FJSA 2TBVA 5CFCB 3POYA 4L11A 2XJRA 3U07A 1C1LA 3U11A 4RS5A 1UU6A 1EAH2 1SEFA 4YM1A 4AHWA 3ZMNA 1RUC1 1ONAA 4TWTA 3R6SA 2HWC1 1VAKA 1CX4A 3ZFGA 3B5LB 4FOVA 4HK9A 4QPGC 1NCRA 3PVNA 2XBO1 3AMMA 1W6PA 1HRI3 4OHVA 1LULA 3VZLA 5FCCA 2IFRA 3ZMOA 5FOBB 3E6BA 2ZGUA 3GBWA 4KWJA 3RS6A 4ORFA 3R4DB 1PO11 1ZBE2 2H0VA 3FX3A 3KS7A 1H8TC 2A5ZA 2RMU1 2EXHA 5LEKA 5HI0A 1YRZA 3ZYIB 4COUA 1QJY3 2WNUA 5IK4A 4EN8B 5L73A 1GFF2 4Q4W2 3IDBB 4OULA 1IZ3A 3NW4A 2D98A 3K48A 2WSVA 1XU2A 4WZCA 1AJKA 4N43B 1LEDA 2WFF2 3CU7A 5AC92 1SLIA 1FPN3 2RS33 1YFXA 5JLVA 1UAIA 4AE2A 1AVBA 2ZPXA 2IC1A 3FUQA 3LB9A 5EWSA 3AZYA 2O1QA 4XQDA 1OQEA 1EV11 1V6OA 4INDA 3SHRA 5JDBA 2CV6A 1IS6A 3WP4A 2D44A 5J96B 5LRSA 3VZNA 2GNTA 1H1MA 4UW6A 4B4PA 1DGRA 5L36A 3J4UH 4HETA 1DU3D 3WP3A 3AYDA 2YGLA 1AR71 1LESA 2P37A 1REEA 5ABJB 1DHKB 5I0TA 1IPKA 2O8QA 2B8MA 4AEDC 2XGXA 3TWIA 2MEV2 3WZ1A 1AX0A 1MZ5A 3B69A 4AF9A 5JZGA 1AYN1 1C8M3 1GZ9A 2R071 1ULDA 4ASLA 3B3QE 2WS91 4FBFA 1SLBA 5JI9A 4M3CB 1MS0A 1LHUA 1FYUA 3ZFFC 1X82A 1CR7A 1W2UA 1RUD3 4FAGA 5JPMB 2AGSA 1GR3A 4XHBA 4AWDA 4AQSA 1PZ9A 1EV13 2GALA 3JD71 4MXWB 3THPA 1JHNA 1FOD3 4COYA 1OQ1A 3WCSA 2YHJA 1EPZA 3AMQA 4L9BA 3U4XA 4X6QB 4PDWB 3DV8A 1D4M2 1UL9A 2RS51 4BH9A 5BNOB 3EQEA 2PHWA 1J3RA 4M0HA 3KCYA 3B9CA 5C33A 2HJIA 4U36A 1FNZA 4ATEA 1NG0A 1N1YA 4HFSA 1V9U3 3OTFA 4CEWC 1RMU2 2GH8A 4FPLA 3JQWA 3VBHC 1FV3A 4XBQA 1JUIA 2PLV2 5I91A 3WOGA 4FPYA 1H9PA 3FFQA 4KU8A 1WBFA 4ZU5A 3TNPB 4GQ7A 3FLTA 1HRI1 1MQTB 4XFCA 2A6WA 4ISRA 3RZZA 4CEYB 3E6DA 2D93A 1KXGA 2OVUA 3NAPB 5ACA2 1QJX3 2A3XA 1J1TA 3PLQA 1UIKA 4GH4B 5FREA 1QXRA 3WUCA 4I0BA 4YM2A 4LUKA 2A7AA 5EXOA 1NQJA 3WQ7A 3IBMA 3SXWA 2GH2A 2K2SA 3ALQA 3AX4A 2ARBA 2EAKA 4Q4W3 1CONA 1DDLA 3JCIA 3LA2A 1Q43A 1ULCA 1CAUB 5L7OC 3DPRC 1FT9A 4XMIA 1QJU3 3KB5A 5IK5A 2UYAA 3WG2A 2W08A 4Z07A 4LTAA 4DY3A 1POV3 1N47A 4LA2A 2ARXA 2WZR2 3ZFGB 4Q0QA 1ZREA 1OA2A 3AMPA 4ONUA 4RD7A 5CA6A 5KC6A 3N4MA 4NR1A 1QQP1 1AL21 2JE9A 3I59B 3QLQA 4Q1PA 1J1LA 3H7JA 1QJX1 4U2AA 5HCBA 5BUVA 4MVTA 1Y9QA 2XB6C 2JENA 2QQPA 5A33B 3HBZA 3CO2A 2FZ2A 4FAHA 2W0XA 3M3OA 4CP0A 3UV9A 2Y26A 1DGLA 2VULA 4EN9B 4GB32 1VBB1 1TNRA 2D5FA 3RG0A 2ZABA 4EWEA 3ZX7A 1AYM3 5BNPA 1KD7A 4H3WA 3BODA 4ES8A 4HZFA 5JR7B 3WD5A 1DZTA 5GZCA 1BBT2 2MPFA 2F6BA 2DUQA 4P9WA 5JSOA 1H30A 1CAXA 3MF9A 1C5HA 4B7KA 4M00A 2ZHLA 5H9SA 5BNOA 1COV3 1G9BA 2MHFA 2WL1A 4L97A 3ZN6A 4XBLA 3GHMA 4YW4A 4CDQB 2FBEA 5FQ0B 4BOWA 4DQAA 2HWF2 3KT4A 3ZPYA 1BCXA 2WA3A 4Q8KA 5BNNB 2HWB3 1BKZA 3J9SA 4B3NA 4A2UA 3NO8A 2D6KA 1GQHA 1H0BA 1WW7A 3ZXEA 5KHJA 1R091 4LHNA 1AYN3 1C8M1 2R073 2D3SA 3ZSEA 1MS1A 4QGNA 4MXWA 4P14A 3D4KA 3D0SA 5FRAA 4QQOA 2PLV3 2RR11 5BNNA 1QOSA 2ZGQA 3VKFC 4GULA 4WVZA 2Q30A 4EN0A 1LGBA 4E27A 1ASJ2 2UY8A 2ZHNA 4NHLA 1ZZ9A 1QQP2 1N3OA 4Y1XA 3WDTA 1V70A 1R082 2ZX0A 2JD4A 2ZGRA 2AUYA 5GLVA 1MS8A 2E6VA 1ZZ6A 5ACA3 4XYXA 3O0XA 2JDZA 4J1WA 3UK9A 2CL2A 1OA4A 2Q5TA 4YG3A 5KHHA 1F5JA 1PMIA 2CGOA 1YHFA 2IXHA 1RUG1 2QZ3A 3FC0A 4XHXA 3B7MA 2RMU3 2B42B 4Z82A 1VIWB 3U0ZA 4S2HA 1G9CA 2W52A 4RR3C 1QNWA 4HANA 2ZGMA 3ETQA 4RHV1 1Y3TA 3WW1A 1H8VA 1WCDJ 1BEV2 2RM23 2P3JA 4JRLA 4LBQD 4HVOA 4WVWA 3H1MA 3OYWA 4N53A 3ATGA 4B29A 1U5YA 1KJRA 3KZ4C 2OPKA 3MF6A 5JIAA 1RUC3 1ZRDA 2XKPA 5BPXA 2A75A 3NKGA 1AR82 2O0OA 1EY2A 5CNAA 3GF6A 5FLIA 1RHI2 3HIFA 4KQ7A 1UX6A 2XJTA 1M06G 5T5LA 1PO21 4YW1A 2IFWA 2WFF3 5FMOS 4CRQA 4YLZA 1DQ0A 3ZXDA 4OHXA 5DDJ1 1ZBA1 3H0OA 4DPNA 4CP2A 4YG6A 3FUOA 3MW2A 5GM0A 1YI9A 2NYYA 2VOVA 3ILRA 3KQRA 1LOAA 2UY9A 1IOAA 2QJVA 4OUMA 4WZFA 2DCKA 3O7OA 2GZWA 1UU4A 3MGUA 1YUDA 2C0ZA 1F5FA 5BV6A 1WW4A 4XFIA 2WNEA 2FZ1A 1C5IA 3VGIA 4AGRA 2LUWA 1N1SA 3VZOA 2Y38A 2GAUA 4N7IA 1AR72 4LLOA 1LGNA 3H1YA 1XE8A 3ZN4A 4DOUA 4RHV3 3RWNA 3USUA 5T54A 2C5DA 2R043 1PK6A 2I2SA 5JSRA 3AP4A 1VP6A 2RJKA 1RUF1 3L2HA 3H1WA 5K0UC 2PA7A 1PIV2 3QOPA 1TME1 1YJKA 3ZSMA 4ZXKA 4PIYA 3OD0A 3USUB 1VLNA 3OPZA 1FXZA 1LCLA 2XL7A 1JN2P 3RJ2X 3VLBB 2RS52 4YG0A 4LBQB 4BWOA 5J48A 1HV1A 1RUE3 4IEPA 3V56A 3V0AB 4HKOA 2OA2A 5SV8A 2TUNA 5C4WA 3MPPG 2AR6A 2VG9A 3C2UA 4AGVA 1AR81 1U5XA 1NA1A 1MZEA 2VNGA 4RGGA 4NHKA 3ZFFA 1Q8OA 2DUOA 2ZCWA 3I54A 1G9DA 5JZGB 4HBNA 1OPOA 2XVLA 2VUJA 3AZWA 1VRH1 3EXUA 3VBOB 1YI7A 4PLNA 2HWD1 2Z79A 1EAH1 1LRHA 5T52A 1LHNA 3V0BB 4CDXB 3V65A 1O3RA 1WUVA 5FLHA 3MIHA 1Q8QA 1X33A 1YFUA 1ZBE3 2PHRA 2AZ5A 2RMU2 4P9IA 1AR83 3OYWB 2HWE3 3VV1A 5AC93 1BEV1 1GKBA 1WD4A 3TNQA 5JIUA 5I8YA 3CLPA 2I07B 3OD4A 1COV1 2Q1MA 3R0RA 2AYHA 3AXEA 4MGZE 1O5UA 1DGWA 2WT0A 1AR61 1LOFA 4GH4C 1RUI2 2YMZA 3RYRA 4QD2A 4Y24A 4J1XA 2E63A 4QPIC 1VBE2 5CFDA 5T55A 4DINB 1TME3 3QACA 3WW4A 1VBB3 2GC2A 2DFBA 4MYEA 1LODA 2XH6A 5T50A 4CEYA 4NHMA 5F6LB 3WY6A 3CNAA 1CJPA 4DMIA 2DURA 2HWB2 2O8OA 1MEC3 5T5JA 4YFWA 1Q3EA 1IGOA 2AENA 1MS5A 1S0DA 1J3PA 3N7KA 4FPCA 2LALA 3HMYA 1C28A 4IV3B 4XJWA 5GLZA 3VDDA 1AYN2 2R072 4XF9A 5L7OA 5GZEA 5I0SA 3NV1A 1ENQA 1IPJA 4QM9A 4KG0A 5E88A 1YIFA 4M3CF 3WHTA 5FQ0A 1D4M3 2G9GA 4Q8LA 3QBQA 1MVQA 1U12A 3MLKA 1WA4A 4I01A 2ZHMA 4PIXA 1RJ8A 4RHV2 4KG8A 2ZMKA 3VBUA 5J37A 4K1ZA 3ZFEB 4GH4A 4GXLA 2NM1A 4LHKA 1RIRA 2HWC2 3ZIWA 5AVPA 1QJU1 1S0GA 3SH3A 3PHMA 3IPVA 3I7DA 3KD4A 4NN0A 1CPNA 4W65A 1ND2B 3FE5A 1YO8A 4F83A 1D2SA 2GNDA 5KC5A 4EN7B 4IV3C 4PBOA 1ULGA 3AKRA 3AYEA 4IEUA 2PAKA 5DUWA 4AW7A 4CDUC 4CEYC 3TYJA 3BALA 2ZKNA 4JVAA 1A78A 1KJLA 3DKWA 3VBOC 1OKQA 5AFBA 2RR12 2P3KA 1PM7A 3AP9A 4RQPA 3KGLA 1KDKA 2UU8A 2K0GA 1ASJ1 4E4ZA 1CAXB 3VBRC 1R092 4AK3A 3AP6A 4BIOA 4UXAA 1Z7S2 4ZU7A 2X8KA 4K21A 4K9SA 4CDQA 3WDVA 1VBC3