5GZFA

Galectin-8 n-terminal domain carbohydrate recognition domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-8
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzfA00
4FPFA 1UAIA 1A3KA 3SNMA 3OGGA 3H0OA 4JCKA 5H9SA 1JUIA 5JDBA 4XHXA 3WDXA 2GNBA 5JMCA 1GV9A 2DVFA 3VV1A 1W0OA 2WQZC 3SH5A 1LU1A 2WT0A 3B3QE 3ZXEA 4Y1UA 1ZM1A 1DQ6A 5JVVA 1ULEA 3I4IA 1MZ5A 5EWSA 1GZCA 1W0PA 2WNEA 2PELA 1TEIA 4Q8LA 2OUHA 1DYPA 1KITA 1GZWB 1RINA 1SFYA 2PHTA 4OZXA 3GALA 2E51A 1KQRA 1V6LA 3ILNA 3I8TA 1SLIA 1SLAA 3UK9A 3R4SA 2EXIA 1SLBA 4DRVA 3AP7A 1UPSA 4Y24A 3UL2A 3AP5A 3A0NA 4DRRA 1QOSA 4DQAA 1YYNA 4YGDA 2D3PA 3POWA 1G86A 3DUIA 5F9TA 1J1TA 1FNZA 1GYKA 3MPPG 1WW4A 2LALA 4P14A 4R9BA 4XJ9A 1LHWA 2I2SA 4Q27A 1PZ7A 5IUQA 5T5LA 2A6WA 2GALA 2ZHMA 4FOYA 1LOCA 5DUXA 3V65A 2H0BA 3W58A 1V6KA 2JDZA 5CA6A 4YLZA 3FLRA 3L2YA 4R9AA 3ENRA 2P2KA 1W6OB 3JUUA 2C9AA 4XIOA 3VKOA 5E89A 2ES3A 2B7YA 2DURA 1N3OA 4ISQA 3RMXA 1UN1A 3N35A 1NXD1 1ULCA 2EXJA 1D2SA 2GNMA 2WJSA 3USUB 1LULA 4Q26A 5GJ6A 1QDOA 4YM1A 1Q8VA 3TB0A 3IMNA 4CZSA 4FPKA 4BLJA 1VAVA 3IM0A 1CQ9A 3MEPA 1LGBA 3LCPA 2R0FA 3A4UA 1ULGA 4AGRA 2ZGLA 2JE7A 2A3WA 2AYHA 5EXOA 1SLTA 1GKBA 1QGLA 1W6NB 1JXNA 1MS4A 1SBEA 3NWKA 3AJYA 5H9PA 4ITCA 3N7MA 1IKQA 4FQ4A 2CL2A 1W6QA 1H9PA 4U2AA 5JOYA 2R1DA 5DZEA 1V6NA 2VW0A 1YI7A 2D6MA 4Y20A 1OKQA 1AJOA 4XIKA 3ZYRA 2D43A 4YG3A 3AYEA 1DQ4A 3M1HA 2D44A 3AZWA 3M3CA 4CRQA 3HR9A 2YV8A 1IS4A 3OY8B 3ILFA 1AXKA 5L73A 3WG3A 1CN1A 1V6JA 1AF9A 5KXCA 3FFZA 2P34A 4M3CE 2G4IA 1BKZA 2OUJA 2XB6C 2ZGTA 4WVWA 4TZDA 1DQ0A 3OYWA 1DLLA 2DTYA 1IS3A 1WBFA 4BPZA 1G9DA 1YIFA 3APBA 3TAYA 3FBYA 1V6OA 1FV2A 2ZA9A 3T1LA 4FPHA 2OVUA 1VIWB 4XXAA 2YROA 3ASIA 3LSDA 3PJQA 5DUWA 2W08A 5EYYA 3ZXKA 3N7LA 3BOPA 3KQRA 1ENRA 3AZZA 4XBLA 3WLUA 2A71A 1DQ1A 2RHPA 2JJ6A 1KJLA 3ZXFA 1RITA 1U0AA 2ZBJA 2A70A 1ZA4A 1WD3A 4YGBA 2DUQA 1SBDA 1GLHA 1V6IA 1A8DA 2EXHA 2ZGOA 4M3CA 3FLTA 5HCBA 3RG0A 1LHOA 3AZYA 4BLIA 3V0BA 4LBJA 3BIWE 4YZ4A 3ZPYA 4LBQA 3WNXA 1W6MA 2ZGSA 2ARXA 3RS6A 2JECA 4PF5A 2TEPA 3WOGA 2WT1A 4XHBA 4YM0A 5T54A 3WZ1A 3U4XA 1SLCA 3ZSJA 4IQPA 1S1AA 1JW6A 2JD4A 2R49A 4GXLA 5T50A 4GALA 1GNHA 1LOEA 3ATGA 5DUVA 3QLQA 4FPLA 4Y26A 2Z42A 4K1ZA 2YXSA 2A6ZA 2ZACA 4R9CA 3VKLA 5IT6A 1MVQA 2ENRA 2A6XA 1W6PB 2AR6A 4KBBA 1V6MA 4XBQA 3N36A 1WW7A 1SACA 4UW5A 5KXEA 1JYCA 1LENA 3NV1A 2KM2A 4FOQA 4XJZA 1H30A 4XILA 1AXZA 1LHNA 4DPNA 1F5FA 1AX0A 3MW3A 3V0AA 4Y22A 4XMAA 1DZQA 4XJ8A 1JYIA 5EYXA 1I1EA 4UW6A 4Y20B 1N1SA 1NLSA 2XG3A 3AJZA 5HCAA 3RSJA 5E88A 4BM8A 5GLUA 1AJKA 1V00A 3WDUA 3POSA 3WHTA 4W65A 1FNYA 1CPMA 3SH3A 2AH2A 3AZVA 4YM2A 1MS9A 2E6VA 2UU8A 2W52A 1LHVA 4AVTA 4R9DA 4YZ5A 1CIWA 1G8WA 4JC1A 1YXWA 2CWSA 3OYWB 4WV8A 5IK8A 1R1ZA 2ARBA 1GZ9A 1N1VA 4LBLA 5T5JA 1HLCA 2A7AA 3DGTA 5CAZA 4YFWA 2DVAA 4DFSA 3AX4A 1S0JA 4FVVA 4Y1YA 3D5OA 1QDCA 2DYCA 3ZYPA 3AZXA 3VKNA 1YRZA 4YW3A 2PHXA 5SV8A 5H9QA 3ZVXA 4YG0A 1FAYA 4XMIA 4F83A 4UW3A 3VKFC 4NOTA 2PHUA 1UZZA 2DU1A 3WCSA 4BQ1A 3M3OA 3AXEA 2AENA 3WG2A 4FOWA 1AZDA 4XTMA 3GNEA 2NP0A 2PHWA 3V0BB 1AX1A 4HANA 3PMEA 5DG2A 4DS0A 4LBQB 4XDQA 1W6MB 4FP2A 5AVAA 1DGLA 4BMEA 4D69A 2DVGA 3VKMA 2A6YA 2BQPA 2ZZJA 3AYCA 4FPJA 5FREA 2ERFA 3D6EA 4Q1PA 2D3SA 4ZKTB 1A78A 4K1YA 1LOBA 2SBAA 2NMOA 3SITA 3OPZA 5T52A 4XZPA 4JRAA 1WLDA 2HYKA 4YW1A 3RRDA 1Q8QA 2OW4A 3CNAA 4FPYA 3WCRA 3ZXJA 3WUDA 5GZCA 1QOTA 1LJ7A 3Q9OA 3AXDA 4LBNA 1BYHA 3N3HA 1ENQA 4XJWA 2EF6A 5IK7A 1KJRA 4PCRA 2CYFA 3B69A 4AVVA 5DG1A 4PBOA 2PHRA 3NV2A 5GZFA 3AP6A 2Q5TA 4XJUA 1IS5A 4ZXKA 3POYA 4PBPA 5T5PA 3B01A 1CR7A 5CNAA 1JHNA 4RL7A 4Y22B 3PVEA 2A5ZA 5BYNA 4YZ3A 2AGSA 4XXPA 4NO4A 4PQ9A 2FMDA 1C57A 4LBKA 2PHFA 3INAA 5HCFA 3M2MA 4YM3A 4FPOB 1PZ8A 3IKWA 3OJBA 4YW5A 3UJOA 3WDYA 1GZWA 1IS6A 3W59A 2EAKA 5GZDA 1G7YA 1LOFC 3JU9A 2LTNA 5GM0A 1O4YA 1QU0A 2ZGRA 2GNDA 2VH9A 2P37A 3WV6A 1S0GA 4YGEA 2VY0A 4XYXA 1X50A 4HL0A 3AK0A 1MACA 1S0BA 4GKXA 5JOWA 1SBFA 1MS3A 5E8AA 1DYKA 1G9BA 1GANA 2JKBA 1Q8PA 1JOJA 1QOOA 2ZMKA 3N7JA 4TYSA 3O0XA 4I30A 1Y7BA 2C5DA 2CTVA 1MVEA 2DV9A 1MS8A 3WDTA 4P9WA 2D6LX 3M3EA 4SLIA 2YY1A 1LHUA 5GLWA 2DUOA 4LBOA 3R05A 1C1LA 1KDMA 2GMEA 1HQWA 3HN1A 1WUVA 1LOAA 1UX6A 2V5YA 3ZSKA 2A6VA 1LGNA 1WLCA 2YMZA 4AWDA 2EALA 2ZGNA 2W68A 5IK4A 3D4KA 2ZGUA 1CPNA 3MW4A 1CESA 1LECA 1HKDA 1BQPA 1QNYA 2DVBA 1G9CA 1W6QB 1RIRA 4YGCA 1CVNA 5F5QA 1GBGA 1OFSA 2NZ9A 1N47A 1LGCA 5DXDA 5JOZA 2CNAA 3OBRA 4XBNA 3RQ0A 1MS5A 4Q2FA 1ULDA 2A3XA 1QMJA 5H9RA 2WSUA 2ZHLA 1AX2A 4ATEA 2FHRA 4ISRA 4WVVA 2GMMA 2E53A 1N1TA 1FV3A 1F31A 1PZ9A 1WLWA 4XOGA 2DVDA 1Q8OA 3PVNA 4Z8BA 3HMYA 2D6NA 5GZEA 3T1MA 1BXHA 4UW4A 3NV4A 3OY8A 1Z78A 2E7QA 1UMZA 2GDFA 3IPVA 4C1XA 1LEMA 2VXRA 2GNTA 4Q8KA 1H9WA 5KXBA 1LOGA 1MS1A 1DBNA 1N3PA 1Z0HA 3WUCA 1SCRA 3M3QA 1LEDA 1S0DA 1URXA 3ILRA 4YZ2A 1JBCA 2EXKA 4AVSA 2R1BA 1LU2A 3FUOA 4P9XA 1YO8A 1C4RA 4M3CB 3WG4A 2ZHNA 2ZHKA 2DTWA 2ZGMA 4YW4A 4L8QA 2DU0A 4XJAA 3AP4A 4C1WA 2D7FA 1CONA 3NV3A 1S0IA 4K21A 4M01A 3WVJA 1WW6A 1CJPA 3B00A 5LK5A 4CTEA 1O4ZA 1DQ5A 1IOAA 5GLZA 1G9AA 3ZXLA 1QKQA 2D6PA 1WW5A 2NM1A 1SLLA 1G9FA 1DHKB 1GICA 2P3IA 2A3YA 2VW1A 1QF3A 1Q8SA 1ULFA 3MW2A 1OQ1A 2JE9A 3WHUA 3N7KA 4RA0A 3SH4A 1LTEA 1LCLA 5GALA 1S0CA 2AREA 3R4UA 2R0HA 2GN7A 1C1FA 2WKKA 1N3QA 1AVBA 1VAMA 1WD4A 2CY6A 3FLPA 3KM5A 1B09A 1GNZA 2A75A 2WT2A 5DUUA 4YZ1A 2GMPA 1W6PA 4AGVA 3O0VA 3BTAA 4Y1XA 4Y1VA 2VW2A 3V0AB 2VU9A 1HDKA 1LESA 3B9CA 5IK5A 1DFQA 1IKPA 1N1YA 1UKGA 2WLQA 2ZAAA 5DZGA 1JN2P 4GWNA 3ZSMA 4H55A 1FATA 5T55A 5GZGA 1DIWA 2ZGQA 5JOXA 2W39A 4FP3A 1XQNA 5FRAA 3SLIA 3AYAA 1UZYA 1EPWA 1SCSA 2UWBA 2YZ4A 2ZABA 1Q56A 3O12A 2P3JA 4M3CF 4FQZA 1QNWA 3QCWA 4FPGA 1FYUA 2R16A 4ATFA 4BMBA 5JLVA 2CWMA 4GKYA 4Y1ZA 1FX5A 1DQ2A 1BZWA 1BJQA 4YW2A 3SISA 1ENSA 1GSLA 1APNA 2V73A 3RMYA 1VALA 3IPVB 4Q1RA 2P3KA 2ZGKA 2UWCA 4FOVA 4U36A 4AYUA 3AFKA 1LODA 2D6OX 1I3HA 1ONAA 5CB7A 3FUQA 3T2TA 2ZMNA 4YFZA 3VUOA 1MZ6A 3BODA 5KXDA 2ZKNA 2EIGA 3AYDA 4LBMA 3V64A 1KDKA 2DUPA 4FPEA 4XE9A 2SLIA 2WSVA 1S0EA 4P9YA 2D3RA 1VLNA 1W6OA 1WCSA 4GWMA 3A0KA 3UJQA 5GLVA 1F9KA 4ASMB 4BOWA 2DWRA 2NN8A 2NMNA 4FPCA 4M00A 5CBLA 1S0FA 1MS0A 4AGGA 2UWAA 3PVOA 1KRIA 5T5OA 2ZMLA 1HQLA 1UL9A 3O0WA 3USUA 2D6KA 3C2UA 4K20A 4LBQD 3WDWA 5GLTA 4XTPA 4GA9A 1LOFA 1D0HA 2GN3A 1WBLA 3IN9A 2E7TA 3WG1A 3OBTA 4YG6A 3WDVA 4MYEA 2UURA 3ZSLA 3AP9A 2ZGPA 2AUYA 3O5SA 1AXYA 2NYYA 1MR5A 1W6NA 3LSEA 2VUAA 5DZFA 4WZFA
chains in the Genus database with same CATH superfamily
1XNAA 3C7GA 3Q8AA 2HWD3 3K4ZA 1GQGA 5FZKA 4XHXA 5LBFA 5JDBA 4OQ8A 1JTZX 4KH9A 5JMCA 2EIEA 2VC9A 5C6CA 1POQA 2QQMA 2WQZC 4TLFA 1GWLA 1RMU3 1FPN1 4AI0A 4R4XA 3ZXEA 1KXGA 1O5UA 2XQXA 1PHMA 1DQ6A 5KHKA 2K9ZA 2PA7A 1W0PA 3F95A 3LB9A 5K9YA 2FBEA 2PELA 4OUMA 3DYOA 1NY71 4UFKA 1HXS2 1DYPA 1RINA 1SFYA 3LOIA 4MXWA 4NN0A 3I3BA 2QQOA 3MICA 4URAA 3R4SA 5C8CB 3KLSA 2W0XA 3HBZA 5F3CA 5CFDA 4EZ4A 4YGDA 3POWA 5FPLA 3VB9A 5F9TA 1J1TA 1GYKA 3VBSC 5DN2A 1XXNA 1TMF2 4KWLA 2BVBA 1PZ7A 2VZ3A 3N9OA 4HSLA 4FBFA 4BJ0A 3VBUB 5JSRA 3ZN4A 5FYBA 1PK6B 2GALA 2IVJA 2ZHMA 1NA1B 3H9AA 1ASJ1 2H0BA 1J84A 4MUVA 2JDZA 5F5AA 2Q8EA 3U37A 5LRRA 5FY4A 2ATFA 5F32A 1RL3A 1JU4A 2A1XA 2VZUA 1HRV2 1W6OB 3MF9A 3RJRA 4AQ6A 5AC91 3VKOA 1OKOA 1SFPA 5E89A 2ES3A 2HWF2 5HXVA 3VBFB 2B7YA 2IXHA 2DURA 1N3OA 2B8MA 1AL22 3AMNA 3S6PA 3NQHA 3ZIXA 1UN1A 1CZTA 1D2SA 5CKQA 2Y6JA 1W03A 2JG9B 2PQSA 3OGRA 1QDOA 4Q0UA 1QHDA 2QZ2A 2H6BA 3ST7A 4NMIA 4Z2AA 2X5IC 4YPJA 3E5XA 2CU5A 3MEPA 3LCPA 1BEV1 4MHUA 5C4WC 3MGUA 2FQPA 3POEA 2JE7A 3D3AA 2GU9A 3VBSA 3WXPA 3KGZA 3ON7A 1C8M2 1EP0A 3EBRA 1SBEA 1PO21 3NWKA 2WO2A 1AR62 3TEYA 2C1FA 3IBMA 1JZ4A 2WFF3 2FDJA 2N7GA 3WEZA 5BXXA 5JOYA 2PFWA 2VUJA 2VW0A 3WF1A 5IAVA 4B4PA 3N9PA 1NCRA 1R1A2 3MF6A 4XIKA 5FQ0B 3M1HA 4XFBA 4FTBA 3BVCA 4B3NA 4CRQA 2YV8A 3MLLA 5FP4A 2VECA 1V6JA 5ACA1 3FFZA 3RJ2X 3ACIA 3BOWA 1LRHA 2G4IA 2ET7A 3D0JA 3KF5A 4WVWA 2ZGTA 4QU1A 5I93A 4FTSA 5IFTA 3OD4A 1IS3A 1WBFA 4CDQC 3IDAA 2J1EA 1ZRDA 1V6OA 2ZA9A 3T1LA 4FPHA 1PM4A 4CDUB 4XXAA 3PJQA 1NCQC 4P02B 2JD9A 1NOVA 3JD72 3ZXKA 3N7LA 3BOPA 1XNDA 4EV0A 3H8XA 4XBLA 4GULA 2W1QA 3I2GA 4NUBA 4PLOA 1AL0G 2JJ6A 3VHOA 1KJLA 1U0AA 3TBDA 3J26N 2IUWA 1ZA4A 1WD3A 2XBO2 1OC1A 4LKEA 2FCTA 1GLHA 4OI4A 4YGBA 3WW3A 4NIDA 3EHKA 4M3CA 1MPXA 1LHOA 4LOTA 1EAH1 4BLIA 4LBJA 3BIWE 4NHYA 4D0QA 3ZPYA 4LBQA 3WNXA 1FI2A 2ZGSA 2TEPA 5DAVA 2XUMA 2VNVA 2WYFA 3O1MA 3VDAA 3UNPA 2VNOA 3ZSJA 1S1AA 2RVAA 4BQ3A 2Y33A 3EB7A 2JDAA 4LIUA 3ATGA 2GC3A 2WNUB 1LR5A 4CDQA 1RUH3 2WZR3 2YXSA 2Z42A 4W6WA 3WP4A 3ZFGB 4SBVA 1CAXB 1PM7A 4JZRA 1MVQA 2ENRA 1VBE2 2A6XA 3I2DA 2AR6A 4GH4B 1H8VA 4HK8A 4IUGA 1XNCA 3HJRA 4XBQA 4BQXA 1H4HA 2KD7A 3N36A 3CZUA 2BGPA 4UW5A 1LENA 1BMV2 1QQP1 4O7XA 1RC6A 2YB7A 4OHWA 4DIQA 1K45A 1AXZA 4G3YC 4XCAA 1KD7A 2BYVE 5ANNA 5FOJB 3MW3A 4Y22A 4CEWC 1DZQA 4W8JA 1OURA 4BH9A 5EYXA 1JYIA 4JX0A 5HCAA 1JU3A 5E88A 4CCKA 5FYYA 4COVA 2VZQA 3POSA 4XZUG 2PAMA 2X10A 4CUAA 1J83A 1HIXA 2AH2A 4G4FA 1JYNA 2W52A 1LHVA 4PI0A 4R9DA 3OG2A 1O5LA 3KD4A 1G8WA 4GB33 1YXWA 1UOFA 5DAXA 1R1ZA 4WZCA 4AF9A 1RUJ2 1N1VA 1U5YA 4LBLA 3H3ZA 4RHV2 2C24A 2XKPA 1MQTB 5CAZA 2DVAA 4EWDA 5FZOA 4FVVA 3MHZA 4DMIA 4CVUA 2DYCA 4JDNA 4RN5A 2EVXA 2GP3A 1YRZA 3BI3A 1US3A 2HWB3 1YC61 2VOWA 2WIIB 3ZVXA 1SG3A 1RTVA 4A3XA 4XACA 2VZVA 3I3QA 4XF3A 4XFFA 3PU8A 1UZZA 4V2VA 4UWDA 3WCSA 1WCKA 4CCCA 3AXEA 3GBWA 1U12A 1XPWA 2HWC1 1UO9A 1X9TA 1JOPA 1AZDA 1RYYA 4FOWA 4LO7A 4JVAA 1CAUB 1RVF3 2TBVA 4QB6A 4CEWA 5ERLA 4YRDA 5F6LB 4HANA 3PMEA 3QH6A 4FFFA 4DS0A 1W6MB 1T2XA 1RUC3 2VE1A 3OGSA 1FT9A 3BYWA 2X53S 3VKMA 2BQPA 3H42B 3AYCA 3HEIA 2WS91 4Q1PA 5FREA 3ZN5A 5LA2A 3T08A 5K0UB 4Q4X3 1X33A 3OPZA 4DUXA 4KI5M 1IQDC 5T52A 5C8CC 1WLDA 2JE8A 5CKMA 1W99A 2O8QA 2OW4A 4FPYA 3ZXJA 2D5FA 5BNPB 3OF1A 1QOTA 3K48A 4BK5A 2VVDA 1BYHA 2BFUS 3ES1A 4LITA 2VBPA 4IGQA 1T6GC 3U07A 5LBCA 4OMDA 3NV2A 4I2OA 3AP6A 3VBOC 1RXFA 1PK6C 3OBZA 3VZLA 3B01A 1YQCA 1JODA 2IFRA 3AB0A 1K42A 4N9IA 3TEXA 4NAOA 3WX5A 5F3GA 5DAPA 3ZFEC 1H4GA 4OI1A 2GH8A 4OHVA 2BNNA 4LORA 2MEV2 3CZJA 2RR13 4PQ9A 5FR3A 5FWEA 2ZX2A 3AKPA 1UYPA 1VPHA 2ZX4A 3G7DA 1PZ8A 2BNOA 4QQLA 1IS6A 2R062 4BHPA 4CPBD 5HBAA 1S55A 5EZWA 5FMBA 3ZDSA 1G7YA 3JU9A 1TQ5A 5BNOC 5C8CA 4QX1A 3PUHA 4ONUA 1FMD3 3E5QA 3O1OA 4D7SA 5J98B 1S0GA 3CQOA 4YGEA 4XYXA 2XPJA 4LHKA 5FTTC 4HL0A 3AK0A 5DQ0A 3WW2A 2HWD1 1GMMA 4PHZA 1O3RA 3ROUA 5FLHA 3O1RA 1GP5A 2XOMA 1SBFA 1VBC3 1DZRA 2J1RA 2Z79A 3SCFA 2A73B 2B9UA 3KV9A 4NWWA 1DYKA 1PK6A 1RMU1 2Q1MA 2VJXA 3HN3A 1QOOA 1JOJA 3K4AA 4FFGA 4HOOA 4D6QA 3ZLIA 2AACA 1Y7BA 2O14A 4AW7A 3S5AA 1S2EA 4JHTA 1MVEA 1R093 3GBGA 2F4LA 3WDTA 3MUZ1 4AG4A 3ZFEA 4QPYA 2D6LX 4XFIA 4J25A 1UXXX 1U5ZA 1XNKA 1JHJA 3QACA 4NHKA 4JKMA 2VNRA 3U11A 3CHXA 1KDMA 4LOSA 3LKJA 1HQWA 3HN1A 5A6XA 4UFJA 1YQ5A 1LOAA 4AVBA 2VOKA 1ALYA 4XF1A 4ET7A 2A6VA 1LGNA 2GAUA 5BNNB 4B1MA 4FCAA 1NZCA 2E32A 4PT6A 4QHZA 1QJY2 2BOIA 4LKDA 4LO4B 1POV3 1ZVFA 4OUSA 2ZGNA 2W68A 5FYTA 5BNOA 5IK4A 3FWEA 2ZGUA 4AAXA 2WNVB 1CESA 5KR7A 2MNGA 1NX9A 1G9CA 1W6QB 2OT7A 3O7OA 3MIHA 4R8HA 5FZ6A 1VE0A 3TYJA 4CDUC 5F7UA 5A3TA 4YGCA 4I0BA 1GBGA 4MOAA 3RI9A 1N47A 1LGCA 2G9FA 4EN6B 5JOZA 2OQ7A 4J1XA 1X7NA 3GHNA 3RQ0A 3EQEA 1W2UA 2A3XA 1QMJA 5H9RA 2IXCA 2ZHLA 2RMU2 1YCIA 1W2NA 1AX2A 2QVSB 3S0MA 1QJX3 2GMMA 1HB4A 2E53A 1FV3A 1PZ9A 1D4VB 1WLWA 2J42A 1OF4A 3HIFA 4V1PA 2DVDA 1W9TA 3PVNA 5FQ0A 2ZOEB 3T1MA 1E57A 3IDBB 3Q8BA 3SCHA 2ETEA 1X9PA 4LUMA 2E7QA 5FZBA 1UMZA 5DAWA 2ADEA 1NQDA 4YWAA 4BK4A 2XL9A 3T0BA 5FMOL 2VXRA 5KXBA 1GQPA 4Q4W3 4NIGA 1ZBA2 4NROA 3M3QA 4AHZA 3ZFGC 1OHFA 1S0DA 3TNQA 1JYVA 1ENXA 4DXZA 1OXCA 4CDUA 1J58A 2EXKA 1EV12 1OLRA 2WFF1 1I5PA 3FUOA 1C4RA 1YQ6A 4KG0A 2ZHNA 5FYMA 4IE7A 3RPQA 1W3XA 4YARA 1COV3 2DTWA 1PIV3 1OD3A 1L3JA 3KSCA 2DU0A 4LHNA 4XJAA 5DABA 4E9KA 5LWBA 1UY0A 2D7FA 4YNIA 3EXUA 2G19A 2EIDA 5LA0A 1YFWA 3WVJA 1WW6A 1CJPA 2VD7A 5FPZA 3HWJA 3MIDA 4UFMA 2BZDA 1D4M2 2CSGA 4ZXEA 4A6SA 1PGL2 1IOAA 1G6NA 5GLZA 1B35C 3ZXLA 1QKQA 1W8NA 2QQUA 1PVC2 5A3PA 2G1MA 3THPA 1G9FA 4LQRA 2VW1A 2A3YA 3PUAA 4BQYA 1UW8A 1OQ1A 1MZEA 3VDBA 3SH4A 4XF9A 1S0CA 2R0HA 3NMBA 1XNBA 1N3QA 1VAMA 4URTA 4CP9B 4K7JA 4P5YA 4EN0A 3CF6E 1MQTC 2IZWA 2Z69A 3KF3A 2KA3A 4XDOA 2Y6HA 2WT2A 4A7YA 4ZU5A 3V0AB 3BTAA 4JKLA 4X8PA 1TE1B 4Y1XA 2VU9A 2PTMA 1WLTA 3MYXA 5IK5A 1H0BA 4QQPA 4A7ZA 3DF0A 5IW0A 5DZGA 5A7OA 3KMHA 2BPA2 4UI9L 3J7MA 1I9RA 2XJPA 2DCZA 2Y0IA 4Q4Y3 5GZGA 1A34A 2ZGQA 4WVZA 4Y33A 1XQNA 2WWUA 2ZX3A 3AYAA 1UX7A 3SLIA 4M4PA 4AHYA 1DP0A 4CDWB 3DN7A 3MIGA 4IGOA 3CEWA 2YZ4A 3DCQA 1C5HA 3U75A 5J1XA 4L97A 1QNWA 1B35A 1O59A 2XJRA 5FLIA 2C0ZA 3ALQA 2D5HA 3NKTA 3OUJA 5APAA 1DQ2A 4FXKB 3ACGA 2WAAA 5FP9A 3W5MA 5K0UC 1APNA 1PO13 3RMYA 1RUH1 2WZR1 3ELNA 3IPVB 4Q1RA 4D6SA 4FOVA 1V9U2 4U36A 3AFKA 1CX4A 2E31A 5I8SA 4YFZA 3H7YA 4HN1A 5BNPC 3BODA 1W2TA 2XVGA 1MQTA 2NQYA 3AL6A 1WA6X 4AEMA 2D40A 2JDPA 1U5IA 3SMHA 3DXUA 4IERA 2WR9A 4JHZA 3AM2A 4A4AA 3A0KA 2HBUA 4IE4A 4O61A 4BOWA 1QH7A 4W6XA 2NMNA 4UBGA 2YFUA 4M00A 1UCXA 1S0FA 3AVSA 4N53C 2UWAA 1OUSA 1HQLA 3DEMA 4HBNA 1CAUA 2ADDA 3WDWA 3BALA 3C2UA 5HV0A 4NIIA 4I01A 2PAEA 3T2OA 4XFGA 3DKWA 3ITQA 4NR1A 4YG6A 5IJRA 1PMIA 3OEBA 1O3TA 3LD8A 3NW4A 4GB31 2R32A 5A7WB 5K0UA 1SDDB 4NWVA 3HOBA 2AUYA 4H3WA 4HXCA 1GOGA 3VZNA 1AXYA 2NYYA 5E1RA 1W6NA 2VMGA 5DZFA 3SC7X 4FPFA 1UAIA 3PUQA 5BNPA 3OGGA 2MHFA 2HWB1 2WAOA 4JCKA 1JUIA 1RUG3 3AKQA 3KS7A 4IE6A 4NAMA 2DVFA 5F2SA 5F39A 3JB8A 5KC6A 1W0OA 4DUWA 4PQQA 1GZTA 1LU1A 3B3QE 1QJZA 1J3PA 1ULEA 2R042 2VZTA 3POIA 4RR3C 1RVF1 5EWSA 2WNEA 5JUVA 5EP9A 4EN7B 1RUC1 2KR2A 3B9IA 1XE0A 3MLKA 4N53A 4Y3OA 4A3ZA 4CP2A 2IVIB 1KQRA 3WF0A 4M0NA 3I8TA 2EXIA 1SLBA 3HQUA 3QOPA 4Q4X1 3AP7A 1UPSA 5CIRA 5D2AA 5FZ0A 3WNOA 4BB3A 2X09A 4OLLA 1QOSA 2JG8C 2VTXA 1XYOA 4EN8B 4QX2A 1NE6A 2HWE3 2YU1A 1FNZA 1WCQA 3IWZA 3CO2A 2OA2A 4R9BA 4XJ9A 1HRI2 1LHWA 4LLFA 4HT1T 4Q27A 5IUQA 1AR83 5FZCA 1OD5A 3H3UA 4EWAA 2VZ1A 1RB8G 1BBT2 2IFWA 4FOYA 2OYZA 4I0AA 1ZYBA 2DFBA 2I45A 2V09A 5LCWL 2F4PA 2DCJA 2WL1A 3KZ4C 3N9QA 3ENRA 4ZZ5A 2Q8DA 1REFA 3PDQA 4BIOA 4TXWA 3WQ0A 4D6RA 1ND2B 2TNFA 2C9AA 4RS5C 4RR3A 1CD3G 1AUYA 1Q5OA 4HETA 1QEXA 4KBZA 5FZ3A 3UGHA 3OSDA 2RR11 4QKNA 3WP5A 2BGOA 1NE4A 1L7LA 2WA4A 5GJ6A 4CP0A 1AR73 3TB0A 3M4FA 4N7UA 4CZSA 5DPNA 1AYM3 2JG8A 2YYOA 4KGQA 4XABA 2ZCWA 4LXLA 5I8TA 1HJFA 3B02A 4IV3B 1FMD1 3NNGA 2P5BA 1H2LA 4QX0A 2A3WA 5JR7B 4O9GA 1SLTA 5ABJC 3CJXA 3ZKUA 3WQ1A 3MO4A 1JXNA 1MS4A 5FY0A 4A44A 5H9PA 4AXOA 2RS52 3DYPA 1IKQA 3VD3A 5CADA 3ZPOA 4ZZ8A 1VBC1 2VMCA 1R083 5FP3A 1W6QA 3L2HA 5DZEA 1JUHA 1YFUA 1RUI2 2D6MA 4UFLA 1R091 3VGIA 4Y20A 4RS5A 2D43A 4YG3A 1VR3A 2HWD2 1ZZ8A 5JXJA 3BU0A 2JDMA 1AF9A 5KXCA 4WVMA 4RD7A 2P34A 5K4LA 4XC9A 2EICA 5IYYA 3ES4A 3OYWA 4AFBA 1DLLA 4QXBA 2DTYA 4QMAA 1POV1 3IIIA 4BPZA 1OSGA 4QXKA 4HN0A 1W05A 2OVUA 4IGPA 4ES8A 3ASIA 1YUDA 5ABJA 2H0VA 2W08A 5EYYA 1WCUA 4OYUA 1KFUL 1PX4A 2CGOA 2WZPP 1RITA 1X36A 1VBB2 5KHGA 5EJ1B 5FJHA 4G9SB 4C90A 5JXHA 4LK7A 5BNQA 2DUQA 2P17A 1V6IA 4NPRA 2VR4A 3RG0A 3AZYA 3V0BA 1IQAA 3GZUC 4OQ9A 1W9FA 1QJX1 2W94A 4QX3A 2CGNA 5SV5A 1UNBA 4INDA 2VCBA 1UZ0A 4CDWC 2ZTNA 5E6HA 4LE3A 3TWIA 3MI8A 3E1F1 4XHBA 3N4MA 1SLCA 4GD4A 5A3MA 4JGZB 2E63A 3PIGA 1RHI3 2R49A 4GXLA 5G04L 4GALA 1IGOA 5A3NA 1ZRFA 1UU5A 3QLQA 4COYA 3T0DA 4Y26A 3I97A 4K1ZA 2A6ZA 3DPRC 1NYWA 4Q4W1 3VKLA 4KGGA 1GP6A 3MIEA 4OULA 1W6PB 3PLQA 1V6MA 2VUDA 2VAUA 3ZFFB 3J8F3 4JGYC 4M4RA 2VL4A 1WW7A 2XQRA 1SACA 1JYCA 5FZ9A 1H30A 5KHHA 3LA7A 4XILA 4IEUA 4DB5A 3TN93 4QPIC 1COV1 1PIV1 2Y8KA 2BERA 4BQ5A 1RUD2 1AX0A 3V0AA 5F1RA 4XUTA 5L9RA 3OD0A 2OZ6A 1RUNA 4XJ8A 2RS33 5A1LA 1W06A 3CDZB 1CZSA 3AJZA 4L9BA 5C3QA 1O6UA 2ORZA 5A3UA 3LAGA 2YC0A 2D93A 3RZMA 3N9MA 1V00A 2QQWA 1KEXA 2ID4A 4W65A 4CCEA 3G6JB 3SH3A 3OUIA 2UU8A 5IVJA 3A23A 3ZM8A 4AVTA 3IT8A 4B8EA 1CIWA 1OOPB 4JC1A 4LULA 1RUF3 2CWSA 1SQ4A 4WV8A 5IK8A 1W8FA 2VUCA 3NSTA 5T5JA 4ZHNA 1HLCA 4YVSB 1UZWA 1AR92 3DPRA 2Y0OA 4XPVA 1S0JA 4Y1YA 4QD2A 4KNCA 3ACHA 3D5OA 1MEC2 1STMA 3ZYPA 2Y6FA 3AZXA 3VBRB 3VZOA 4JGYA 4HG6B 1DGWX 2VCMA 5SV8A 4MGKE 4YG0A 1O7FA 4XMIA 4A45A 2FD8A 5FKBA 3WNNA 3VKFC 2IWGB 4F83A 1UD1A 4NOTA 2E9QA 4L92A 4QPIA 4AI2A 2AENA 1J3RA 3WG2A 2VCCA 4Q4Y1 2VMIA 4ZS2A 1OPMA 3KT1A 4L2NA 1AX1A 3K77A 5DG2A 1QIQA 2VNGA 1VBA2 1XSRA 4D69A 3O14A 2DVGA 4BE3A 1ZRCA 4FPJA 4ZKTB 4B4RA 4BZ4A 4K1YA 1PNFA 4ZU4A 1OMIA 2SBAA 4N43B 2PHDA 1HB3A 3RZZA 5D21A 3SITA 4XURA 2PLV2 5FZ4A 4TWTA 1PO11 4UAPA 1O8PA 4UYBA 1SPPB 2VZOA 3VHNA 4QXCA 3T2PA 3I2FA 4MG2A 3GZEA 4P9LA 3WUDA 3MFCA 3LFIA 1UY4A 3UETA 3Q9OA 1LJ7A 4HKWA 4UXAA 4XJWA 3N3HA 5FK8A 1ENQA 2LM3A 5FUNA 3WSOA 2XL7A 5J7MA 1LAJA 3NJVA 1H2KA 2VQAA 4IEYA 5DG1A 4AVVA 4BIFA 3X29B 1GUIA 1JOBA 3POYA 2YC2A 1CR7A 1REEA 1HXS3 3WQ7A 2A5ZA 2XJUA 5FO7B 4RGAA 2QKDA 3NVCA 3H7JA 4CE8A 3LE0A 1UMIA 5FY9A 2WN2A 4FFIA 2VQ0A 5ISLA 1AYN3 2ILMA 4MO3M 5FZ8A 3INAA 4GJYA 4AEJA 4DINB 2X5IA 2Y26A 3UJOA 3AMHA 2DCYA 3SQOA 3W59A 2EAKA 5GZDA 2QFEA 2RG4A 5A32A 4ASKA 5F5IA 5F3EA 2RV9A 1TMF3 1WCDJ 1WMFA 5JXIA 3V56A 2LS6A 2X8KA 4IEXA 5FWJA 1GWMA 2VY0A 3I2IA 4IV3C 3KVAA 2ZEXA 4ARYA 1RUG1 4CA9A 1MACA 5JOWA 5FYVA 3S5QA 1HRV3 4MGYE 5BV6A 3FE5A 5BY5A 1MS3A 3NRUA 1G9BA 1GANA 2JKBA 1A6CA 2HWF3 1H1IA 3GJBA 4TYSA 4COWA 3O0XA 4I30A 3FC0A 4HPKA 2HYXA 4BQWA 2YUEA 2DCTA 1TG7A 2DV9A 2NPIA 1RUE2 2K2SA 2YY1A 3GHMA 4YSFA 5IFPA 5JWPA 4QQHA 1KFXL 2DUOA 4FI9A 4Z07A 3ZDVA 1C1LA 2GMEA 4IETA 5JCTA 1WUVA 5CFCC 1UX6A 1NKGA 1IZ3A 3ORJA 1J59A 1WLCA 2VMEA 3GXUA 1NCQA 3BPSA 3TNPB 1OH3A 3HNYM 5LA9A 2HWE1 1RUC2 5KWRA 2RE9A 1C8M3 2B46X 2RJ2A 1AHSA 4TLGA 1AR63 2QQIA 4UFHA 4A6OA 1HKDA 1I6XA 1VJ2A 1AR81 2JEMA 1QNYA 1NG0A 4IV3A 4WM7B 2JENA 1DGRA 3WF4A 3FHAA 1RIRA 3O1UA 1CVNA 1CWPA 3JCIA 4AEDB 1OFSA 2NZ9A 1DZTA 3OBRA 4XBNA 2E7AA 1MS5A 3CJIC 1OLME 1HJGA 1C3HA 1ULDA 1Z7S2 5HI0A 1WMEA 4CXYA 1RUOA 3PL0A 4NE9A 1GOHA 2QUOA 4P9GA 4YW7A 4D7TA 1LB2A 4C91A 2NLRA 4XOGA 4ES9A 4CUCA 2WN3A 3HMYA 3VBHC 4EROA 3FBMA 1BLZA 3URFA 4CEYB 5KBFA 2DDUA 4RFT0 3PUSA 1AR71 5CFCA 3LWCA 4LJHA 1O3QA 3H1MA 1AYM1 4JGZC 2VZSA 5FBJA 4C1XA 4OMCA 3JD73 4Q8KA 5J09A 1H9WA 4Q0SA 2Q8OA 1YQ8A 4AI3A 3D82A 3WUCA 3RVHA 3ACFA 4E27A 2PHLA 3HVDA 5FBZA 4QXHA 3ZSEA 3ILRA 3NAPB 4FO9A 1CZVA 4MGSA 2XBO3 3ZFFC 3E6DA 3LEIA 5A1AA 1R081 5FXWA 3WG4A 3I59B 3RWNA 2ZHKA 3SCGA 4QU2A 5A6YA 2ZGMA 4YW4A 3R4DB 5C7GA 4C1WA 3CJIA 1CONA 1RXGA 1X8MA 5ANQA 4CXXA 4Y5TA 4M01A 5L9VA 3B00A 1EYBA 1VBC2 5FY7A 3LEMA 5FZIA 1JZ6A 3LDRA 2EAAA 3VBHA 4PF1A 3KHCA 1E5RA 4XF4A 4CDXB 1W28A 1UWWA 1QF3A 3E6CC 1Q8SA 4CXWA 4IEPA 3RDIA 1M06G 4BU2A 1VBE3 3JBG2 3OOXA 3WHUA 4JGZA 1LCLA 4BXSV 1PGW2 2AREA 3EO6A 3I2JA 1FOD2 4IESA 3SKJE 2OZJA 1C1FA 2WKKA 3LPFA 2B5HA 3VBUC 3ZMOA 2FDKA 3ZYJB 3POJA 2XXZA 1NA1C 1QXJA 3KQ4B 3FLPA 3KM5A 3VHPA 1B09A 4NIHA 2A75A 2BP6A 4MGIE 1QY4A 4AFAA 1W6PA 4BA6A 4GWIA 1HDKA 4C0BA 3B9CA 2YPDA 2RJLA 3NNFA 1OI6A 1UQXA 4H55A 3ZSMA 1HB2A 3P3NA 4JTOA 3VBFC 2W39A 5FRAA 1CAWB 2EA7A 5FP7A 2YGMA 1SCSA 4QX8A 2HBTA 4Q0QA 2UWBA 2QJVA 3T2QA 5FOBB 2ZABA 1Q56A 2ZS6B 2JG9C 3H50A 1HB1A 4IEWA 4M3CF 3RFRA 3MBWA 3HQRA 4OI2A 4XETA 4FPGA 1IPSA 4JAAA 4HVQA 1WGPA 5FPVA 4Z1VA 5JSPA 5K7PA 1RHI1 1RUJ3 2AZ5A 5IVBA 4RHV3 4HLTA 4YW2A 1BJQA 3T0AA 1ZNPA 2W46A 3K3NA 5DDJ2 3H8RA 2V73A 3MFAA 2HKXA 4D7YA 1ZBE2 3PIJA 4E4SA 2CDOA 2P3KA 5B4XA 2PN5A 4XUNA 1BHGA 1LODA 4CU8A 1I3HA 1ONAA 2J7MA 3J8F1 3KCCA 4PIXA 1C8NA 2ZMNA 3T2TA 3VBUA 3THDA 4A2UA 1ZX5A 3WW4A 1NA1A 2GC0A 2ZKNA 4N8MA 1KDKA 1S4CA 5FDBA 2BUKA 1JZ3A 3MUY1 1S0EA 3TN91 3NNMA 2D3RA 1W6OA 3BTZA 4GWMA 5GLVA 3PURA 5FZEA 2DWRA 2NN8A 4OZOA 2RS31 3VBFA 5JAXA 4FPCA 4OCTA 1FPN2 1SFNA 5FYCA 3ZR6A 1MS0A 2QZ3A 3PVOA 5T5OA 2XVLA 5C3PA 3JZVA 1UL9A 4K20A 4LBQD 1NY72 2JG9A 3BU7A 4XTPA 2VZPA 3UESA 3IN9A 1W90A 3S7IA 3MZHA 1UY2A 5BUVA 4FT8A 1RUF1 4E4HA 5D8AB 3LDBA 4BWOA 2XJVA 2ZGPA 4I3PA 3AFGA 1ULOA 1VRH3 1MR5A 4RYDA 3LSEA 4E2SA 3H8UA 4WZFA 4CCOA 5LEJA 4LPLA 2RJKA 3C8XA 5H9SA 3QH7A 4XUOA 3IAPA 5C5UA 4ZPIA 1GV9A 2IXKA 3VV1A 3I3EA 5BPXA 3SH5A 4BISA 5C33A 4HMZA 5EIYB 1ASJ2 5C71A 4Y1UA 1XYPA 5I8YA 5JVVA 2MEV3 1MZ5A 4Q4V3 3IZOA 2ZPXA 1TEIA 3L9JT 3I49A 1W8UA 2OUHA 4LEJA 4NHXA 1KITA 1GZWB 1SDWA 4Q8LA 3VDCA 2E26A 2PHTA 3WD5A 2R063 5AC92 1VMFA 2L9LA 2VZRA 1V6LA 5FKCA 3I3MA 4IEOA 1SLIA 3B93A 4JV4A 4HONA 4Y24A 1NLRA 3I2HA 2WNUC 1YFYA 3ZYIB 3AP5A 4DRRA 2XONA 4Q5OA 5CU1A 2BTVC 4IEZA 3HNMA 3LDKA 3T4VA 4QDQA 2CAVA 3NL1A 4GH4C 2LALA 1Y9MA 3T3YA 3DKQA 1BEV2 3CL1A 4P5HA 4X6RB 1Y3TA 2ET1A 5CA6A 4DY3A 4WM7C 1V6KA 3A21A 4K3UA 1GR3A 2E33A 1CAVB 1OVSA 4HK9A 5FMCA 5FZMA 4C0HA 3L2YA 5FP8A 1PO22 4QHBA 2FMYA 4XVHA 4Y5Z0 1OA2A 4OHXA 1HXS1 4XEZA 1XC6A 4B7KA 4LHLA 3MV01 3ZXGA 4IL7A 2CDPA 2YDEA 2JDNA 5EQUA 1AYN1 5CG8A 3RMXA 2XKOA 1Y4WA 3N35A 1K5MB 3ZIWA 2Y60A 2GNMA 2WJSA 3USUB 3RZLA 1VBD3 2PQQA 1QJY3 3FHQA 4A42A 4CUBA 4H14A 4CU6A 3VL9A 2WNUA 4LUKA 5ACA2 3IM0A 4QM8A 3VHRA 1QJFA 5J36A 1CQ9A 1TMF1 3KGLA 1LGBA 3VZKA 3ZFGA 3A4UA 1CAXA 1L7QA 1ULGA 1VAKA 2VMFA 4GH4A 3OCPA 2AYHA 1UIJA 5EXOA 1H8TB 5LBBA 1GKBA 1JYWA 4AFDA 4QB2A 4EJRA 3AJYA 1HRV1 4A41A 3LIGA 4ORFA 4BQ4A 2FDGA 2CL2A 4GIQA 1YEWA 3NAPC 4KWUA 2RMU3 4W50A 2HWF1 2WZEA 2R073 4OUEA 1U5XA 4NPLA 2ZZQA 1AJOA 3VD4A 3ZXAC 2BGCA 3AYEA 4NPMA 2TUNA 2ARAA 3AZWA 5J48A 1EAH2 2G9ZA 3OY8B 2WWSA 3N9NA 3ILFA 4LA2A 2WBKA 5D1IA 5TSWA 3S7EA 4MXWB 1H1AA 4UOJA 2BRTA 2P3YA 1A8MA 4QGMA 4M3CE 1JI6A 2OUJA 2XB6C 4O65A 3AVRA 1DQ0A 3HBKA 2VVEA 3PU3A 3U14A 4AR2A 5EFUA 3WNKA 5FYHA 1ZBA3 5CFDB 1YIFA 4J6GA 3TAYA 1C8M1 4XF0A 4D8MA 1FV2A 4BCUA 4FAGA 4FAHA 2PYTA 1AR61 5M0TA 2B39A 4IXLA 1VIWB 2LW8A 2RM23 2YROA 1UKRA 5FMDA 1EV13 5CEHA 5DUWA 3ZYFA 1YHFA 2VO5A 3CU7A 3ZOIA 5A1FA 3RI8A 1ENRA 3AZZA 2W1WA 2A71A 5L7OB 1IG0A 2RHPA 4CCJA 2ZBJA 3AKSA 3J9SA 1GP4A 2YBKA 1QQP2 2WO3A 4LTAA 1A8DA 1F4AA 3HNBM 3FLTA 3FZ3A 2DBNA 3I59A 1D4M3 1O3SA 5FUPA 1UPIA 3ETQA 4YZ4A 5I91A 1W6MA 2DFCA 1PVXA 1PVC3 1UU4A 4PF5A 4DXSA 2WT1A 3KB5A 2G9GA 4K8FA 5AFEA 5EPAA 4YM0A 4DXTA 4IQPA 5K8SA 1JW6A 4QX7A 4LT5A 5DAQA 5T50A 1GNHA 2BFUL 3FHIB 1NUKA 4S2HA 4FPLA 5FXVA 4I0WB 3JD71 4MGZE 2XVKA 2ZACA 4YVWB 5IT6A 3OUHA 1DCSA 5A3LA 1HW5A 2VVFA 4F3JA 5KXEA 1H2MA 2VTFA 1J1LA 2WFPA 2XBO1 3NV1A 4S2GA 4NHLA 4XJZA 4AHWA 1DF0A 1P8JA 1EUUA 1F4HA 1LHNA 3RYRA 2MPFA 4AVAA 4RQPB 4CYDA 5L19A 1NCRB 2VOVA 4I02A 1UF2C 1CX1A 1M4WA 2YBPA 2HWC2 2QQNA 4B4QA 5AFBA 3RSJA 4BM8A 4WBBA 1HV1A 2DF7A 1CAWA 3WDUA 3GCXA 4AOCA 1CPMA 3VDDB 1DYOA 1TME3 1MS9A 3AZVA 1W8OA 4YM2A 5BNNC 3FL7A 2JDHA 3PUIA 4YZ5A 3D0SA 2WS92 4LA3A 1W9YA 1VBE1 4IDZA 4RR3B 1V9U3 5L36A 2ARBA 2VGDA 1Y9GA 2Q8CA 5FPBA 3TEWA 3ZYHA 2WNVC 2GZWA 3DGTA 2A7AA 1K3IA 4YFWA 1BMV1 1UXZA 1PX3A 5FZAA 3AX4A 2VBBA 5D8AC 4AAPA 3RZHA 1QDCA 2JWPA 1TNFA 5CVRA 2PHXA 5H9QA 5FPXA 3ZYBA 2BBAA 1YJKA 3QBQA 4GMP0 2DU1A 1W9SA 4BQ1A 2BOJA 3P1IA 2Y38A 3GNEA 1DGWA 1ND3B 3U0ZA 2NP0A 3J7NA 4LBQB 4FP2A 5AVAA 2Y6KA 1DGLA 4BMEA 1QWRA 1ST8A 2A6YA 2ZZJA 4O9EA 2D3SA 1A78A 3AC0A 3P5BA 3I2OA 1RUJ1 3HQXA 4RHV1 5BNNA 1W9WA 2W1UA 3PVBB 1F5JA 4JRAA 4XQ4A 2Y6LA 4YW1A 2JKXA 3KCYA 3RRDA 3WCRA 2WNVA 3M70A 2BVVA 4E2QA 5KC5A 4ARXA 4LBNA 2FCVA 5D8AA 1US2A 2EF6A 2BWCA 4AZZA 1RHI2 2UYBA 1RJ7A 1W8TA 4N90A 3B69A 4PCRA 3O1VA 2PHRA 4WM8B 5C4WB 2R043 3P6BA 4XJUA 3W21A 2AEYA 4PBPA 5T5PA 2QBXA 4GAZA 1RJ8A 4KU7A 5CNAA 3USSA 4RL7A 4DXRA 4Y22B 3NJYA 3J8F2 5B4NA 1RMU2 4XXPA 4AVCA 1D0GA 3DV8A 1GQHA 2PHFA 4IV1B 4LBKA 4ZY9A 5LEKA 2OPKA 3LPGA 4YM3A 1V70A 3MLJA 3OJBA 4YW5A 5LW9A 3OBAA 3WDYA 1GZWA 3SKVA 4QQOA 3BGAA 4KL1A 2RS32 3ZO0B 1JZ8A 1LOFC 4EE2A 5GM0A 1HRI3 1QU0A 5FZLA 1KS4A 4AQ2A 1W04A 3WY6A 3SHRA 2I07B 1VRH1 2W1SA 3WV6A 1BBT3 3WW1A 1S2KA 2B45X 5A7NA 1XRUA 5FZOB 1X50A 4H7LA 1UIKA 1H8TC 2V72A 3KWVA 3BTYA 2HJIA 2ZEYA 4UF0B 1EY2A 1ZREA 5E8AA 2RS13 3FJSA 5LA1A 3AKRA 3LFMA 1Q8PA 4QM9A 3N7JA 1IG3A 2MEV1 3BTXA 3WT3A 2CTVA 4NIAA 4Q4V1 4PDWB 1HQNA 4MVTA 4P9WA 4CEWB 3M3EA 4SLIA 1LNSA 2OIIA 2XUEA 3AMMA 3BB6A 2R061 1REDA 3EJKA 3R0RA 4LBOA 3R05A 1HV0A 1IPJA 4W4ZA 3NKGA 2V5YA 3ZSKA 2YMZA 4MHRA 3UKVA 4AI9A 4AWDA 2WDBA 2W95A 2EALA 2XJTA 3BCWA 2V4VA 2V4AA 4BYYA 4IEVA 4CP9A 4DO0A 4EQVA 4A7KA 2RS53 4HZFA 4Z2WA 1OUXA 4LNVA 2DVBA 4TSVA 2UY8A 2BDRA 1X82A 2JDYA 3C3VA 3FFQA 4AFMA 5DXDA 1RUI3 1E5IA 2ARCA 2J1SA 2C9KA 5A33B 5L7OC 2WFF2 2Q1ZB 3SEEA 1K5JA 2WSUA 3GJAA 3T4HB 1Q3EA 4KG8A 2YHJA 4CDWA 3S57A 4BDVB 2FHRA 1XNTA 4META 1F31A 1JH5A 1L7RA 1E5HA 4Z8BA 1JYXA 1YJLA 1WMDA 1F8VA 2D6NA 4L99A 4UW4A 1VBD1 1QJY1 2B4KA 5J37A 2WZ8A 3OY8A 1Z78A 2YC4A 5LY1A 2LUWA 1VMJA 2GDFA 5A7SA 3IPVA 5I0TA 5JR2A 1AYN2 2GNTA 2Y6GA 1YWKA 2P1BA 1DBNA 5A6QA 4MZUA 4YVWC 1LEDA 2Z5WA 4XQDA 2WRAA 4D94A 1VBB3 4YZ2A 5CKNA 1JBCA 4AVSA 1LU2A 2D97A 1ZZ7A 4P08A 3CLPA 3THTA 2RMU1 4L8QA 3CMGA 2R071 4UFIA 4BXFA 2VM9A 3VBOB 3VBOA 5C3RA 5L7OA 1DDLA 2WC2A 2W5FA 4P00B 2BW8A 4P9IA 2P6HA 4LR4A 4MLOA 4RQPC 1QJU3 3F2ZA 4XQWA 3ZFEB 5EJZB 5LK5A 4B29A 4CTEA 5A70A 3TEZA 1O4ZA 1NCRC 4OVEA 1OLQA 4PI2A 4Y4RA 4C8DA 1G9AA 2BNMA 2FCUA 3KCXA 1GICA 2P3IA 4M0HA 4J1WA 3VDDC 5A7WA 2RDNA 3MW2A 2IXLA 1HN0A 1ZBA1 3N7KA 2J1AA 2K0GA 1LTEA 1YFXA 2Y34A 5BNOB 2B9VA 2C6SA 3H3LA 4FXGB 4F8AA 1AVBA 2RM21 3LGRA 1EV11 1RUH2 1WZXA 2WZR2 2W9XA 2CY6A 4YVWA 4E2GA 2QQLA 4YZ1A 1RUD3 3RZKA 4YW6A 2VW2A 2XLGA 4LKFA 4QQ2A 4IE5A 4QX5A 4YYOA 2FDFA 1IKPA 1N1YA 1ND2C 1UKGA 2YU2A 2ZAAA 1NQJA 3LEGA 1T6BX 4GWNA 4MADA 3TRSB 5IVFA 1FATA 1PGL1 1D4M1 4XW3A 4FP3A 1UZYA 1EPWA 2ZJCA 1PVC1 3IDCB 4RQPA 1ND3C 3SXWA 4CPBA 3O1SA 1WA4A 3O12A 2P3JA 3NJZA 4P9JA 4FQZA 2F6BA 4CCDA 4ATFA 3P3PA 2QTWB 4GKYA 3WQBA 1FX5A 1OFNA 5FCCA 1PMJX 1BZWA 4L11A 4QHOA 4K40A 2J1UA 1AR93 1GSLA 3VDDA 5FK7A 1BVP1 3JB4C 3NJXA 3HT2A 1ODNA 2W47A 1XB9A 1MEC3 3GYDA 4XAAA 2ZGKA 4GB32 2UWCA 4CP1A 1F2NA 1EPZA 5CYYA 2D6OX 5CB7A 3FUQA 4KWJA 1K12A 3VUOA 1MZ6A 2EIGA 3V64A 4LBMA 4DRVA 1VB4A 5FMOS 1OQDA 2DUPA 2Q0AA 3H1WA 3HAGA 4GZ9A 1AL23 4JQTA 4JTNA 4IW3A 4WM8C 1VLNA 2HWB2 2JIGA 1ND2A 2XWBB 3CBNA 2ZXQA 3K75B 4I3GA 1GNYA 4N7IA 1F9KA 1VBA3 3EYPA 3JQWA 2AC1A 3RYPA 4LE4A 2ZMLA 1RVF2 2PXJA 1ND3A 4MH0E 4EZHA 2D6KA 4AHXA 2PLV3 4GA9A 2GN3A 4GWJA 1TME1 5JPMB 1WKYA 4IV1C 1XJAA 1CJDA 3WG1A 3B7MA 4GQ7A 3OBTA 4XFHA 1RGSA 1V9U1 4MYEA 1PMHX 2V5DA 4Q4X2 2UURA 3J4UH 3ZSLA 3AP9A 2JIJA 1UU6A 1XYNA 2QQPA 3B94A 3I7DA 3PMSA 5IVCA 2VUAA 1R1A3 1A3KA 3SNMA 4K8RB 3H0OA 5JI7A 3M3IA 3M7AA 2HEYF 4PJYA 3IAQA 3WDXA 2GNBA 2WYSA 4ZS3A 2I74A 1ZZCA 2JICA 2WT0A 3E6BA 4WM8A 2WLPA 5FY8A 5KHIA 1ZM1A 5FYZA 1BCXA 3I4IA 1GZCA 3KT7A 3POBA 1O8SA 2GH2A 4V2WA 5FPUA 2HH9A 2VPVA 5JZGB 4PDWC 4OZXA 3GALA 2E51A 2IC1A 4EYUA 1OQEA 1VMHA 1GU3A 3ILNA 4AI8A 2WNOA 1SLAA 3UK9A 1ZZ9A 2RR12 1B35B 3ZKYA 3WP6A 4PIZA 4IV1A 3UL2A 4QPWA 3A0NA 3ABZA 3MDPA 1OA4A 4QKFA 3SEPA 4DY5A 4DQAA 1YYNA 2D3PA 3U1XA 1O91A 4QB1A 1G86A 3UGGA 3DUIA 4OI0A 3MPPG 1WW4A 4P14A 2I2SA 5T5LA 4MX3A 2VOTA 5F5CA 3VD5A 1FMD2 2Q30A 1UOGA 2A6WA 3VZJA 2JDUA 5DUXA 3V65A 1LOCA 1VP6A 1XE7A 2YPJA 3B5LB 5EV7A 4YLZA 2R041 3FLRA 3W58A 5C70A 5HCHA 4R9AA 2P2KA 3ZN6B 5FPAA 2Q1FA 1OH4A 2VTXJ 4UF0A 1RUE3 1UOBA 3JUUA 4W6YA 4XAEA 4XIOA 3W5NA 2X05A 5EJ3A 2WQ8A 1PNGA 4ISQA 1QJEA 1R092 4PDWA 1NXD1 1ULCA 2EXJA 3FX3A 4TN7A 3LEKA 5A3OA 1LULA 1UOJA 3K2OA 4Q26A 2RDSA 1OOPC 1JS9A 1SEFA 2HEWF 4YM1A 1Q8VA 4KWKA 3IMNA 4PIYA 4FPKA 4BLJA 1VAVA 4RGKA 4Y4YA 5AVPA 5FYUA 1WWYA 3R6SA 3O1TA 1HRI1 4YVSC 3IDEA 1ACCA 4R52A 2CAUA 1SMVA 2R0FA 5T3NA 3VZMA 1W39A 4AGRA 1IHMA 2ZGLA 3UYJA 1DLCA 2C26A 1BBT1 5FJKA 1S2BA 1YLLA 3VBRC 3ZFFA 2LRPA 1QGLA 5FXZA 1W6NB 3GGLA 4ITCA 3N7MA 1Z7S3 4FQ4A 4LK6A 2WABA 1H9PA 2RS11 4U2AA 5FYIA 2YG0A 4B1LA 2OPWA 2R1DA 1V6NA 1VRH2 3UGFA 3UT0A 1TNRA 5JIUA 1YI7A 1EUTA 1OKQA 2R30A 3GZAA 5A33A 3ZYRA 3HD8B 1DQ4A 1YI9A 4I09A 5FXXA 5C9AB 2D44A 3M3CA 2F17A 3HR9A 2QDRA 3ZYGA 1IS4A 4Q0VA 5IATA 1AXKA 4N53B 5L73A 1CN1A 1QJX2 1TZOA 2WA3A 4N43C 3WG3A 1BKZA 5J96B 3VD9A 1OOPA 1XU1A 4TZDA 4Q4V2 4TTGA 3T09A 3AMPA 3KV5A 1G9DA 4Q29A 4YVSA 3APBA 3GBFA 5FYSA 4MGQA 3FBYA 1JMUB 1JYTA 4LKSA 1GOFA 1W8ZA 2ORXA 5KHJA 2RS51 3LSDA 5FY5A 4JRLA 3VBRA 1JZ5A 3GCWA 1ZRIA 4Q4W2 4HSJA 3KQRA 3WLUA 1GFF2 2OQ6A 1DQ1A 1RUI1 2WO7A 1YIPA 4HKLA 3ZXFA 2DBIA 4RGGA 1NXMA 2XWJB 2A70A 1KGYA 1SBDA 2ZGOA 1OA3A 1HN1A 2EXHA 5HCBA 4OFGA 2VBDA 4AFCA 1COV2 1PIV2 3U78A 3DECA 4QAWA 4UT5A 3VL8A 1OVPA 2ARXA 1R64A 3BKZA 3THCA 3RS6A 5A7PA 4GMP3 1HX6A 2JECA 4AQSA 4FFHA 1BK1A 3WOGA 3C7OA 3U4XA 2BWAA 5T54A 4N43A 3WZ1A 3RGBA 2W87A 1XBFA 2DCKA 3JBG3 2WWJA 2JD4A 4QPGB 4S2FA 4X8NA 5I0DA 3OB8A 4E4DX 1FOD3 1LOEA 2QDNA 5IVYA 4Y5SA 1WMXA 1SPPA 1YQ2A 4QWNA 5DUVA 2VOXA 2JG8B 4LO6B 4CCMA 5JSOA 5JMOA 3IIAA 3JXSA 2GC1A 1TVGA 4LHSA 4R9CA 5F3IA 3RZJA 3PTRB 3H8OA 1PGSA 1DG6A 4KBBA 3S30A 1VBD2 2VCAA 2JX9A 1VBB1 4D3WA 3ZMNA 5F37A 2KM2A 4FOQA 4DZGA 3QD6A 3VN4A 1NZIA 4L0PA 3H1YA 1XU2A 4DPNA 1F5FA 5CISA 5FZDA 3KT4A 5EHDA 4XMAA 3NNJA 3RZGA 3AMQA 2ZEWA 1I1EA 4UW6A 4Y20B 3M8LA 1N1SA 1NLSA 1QJU1 2JB4A 2XG3A 4RS5B 5LASA 4Q4Y2 3RNSA 1FXZA 3Q8FA 5FZHA 2HEVF 5GLUA 1AJKA 1DU3D 5I0RA 1UYYA 3WHTA 2CV6A 1FNYA 5DDJ3 2R072 4RFRB 4WVMB 2E6VA 4QGLA 2QE3A 2QNKA 1ZBE3 5JI9A 2W3JA 3OYWB 5LZ6A 3UV9A 1GZ9A 1ULPA 2J1VA 2EIBA 1F15A 2Q4SA 3E5UA 2QQJA 4H2AA 2WO1A 4DFSA 1PO12 4LIVA 3PHMA 3BUCA 4B7EA 3VKNA 4AEDC 5ABJB 4YW3A 1RUD1 4NRPA 1FAYA 3OGJA 4UW3A 2VQTA 3RWKX 1NAEA 2PHUA 5F6KA 1ZZ6A 1FPN3 3M3OA 4S2DA 4HKOA 5GKAC 2O8OA 2RM22 5FZ1A 2FDIA 3WNMA 4XTMA 2IXIA 4PLNA 2PHWA 2IXJA 3V0BB 5HXMA 1UYXA 3MV11 1H6YA 4XDQA 3IB3A 5HPOA 1D2QA 4CEYC 3I3DA 2ERFA 3D6EA 5JZGC 3NNLA 1LOBA 3DYMA 3GF6A 2NMOA 4N9HA 2XJSA 1AR91 4E4ZA 5C3SA 1GWKA 1E5SA 3TOJA 4CU9A 4XZPA 1MEC1 2HYKA 4HFSA 4JKKA 1Q8QA 3CNAA 4K9SA 4Z82A 1OPOA 2LROA 5FZGA 4QKBA 2B42B 4WM7A 5GZCA 3K4DA 3KV6A 3AXDA 2AEZA 5IK7A 1W0NA 3CIHA 1KJRA 2CYFA 4AEDA 4XCBA 4PBOA 4MSVA 1ASJ3 1AL21 5JPNB 1UYZA 5GZFA 3GDBA 2Q5TA 4ZXKA 1IS5A 4ASLA 3ETPA 1RUG2 2BV4A 3N9LA 3T30A 4R4ZA 1JHNA 1VBA1 3PTYA 5FUIA 1Y9QA 5I0UA 3PVEA 5BYNA 2ZX1A 4H7MA 4XUPA 4YZ3A 4ZONA 5AC93 2CGPA 3W20A 2AGSA 4NO4A 2FMDA 3I54A 1C57A 5CZKA 4DUVA 5HCFA 1CIYA 2PLV1 3M2MA 1MZFA 2P6CA 2WQ4A 3MPBA 4FPOB 4LO5B 3IKWA 4CEYA 4CDXC 2JB8A 5JZGA 4EWEA 4K6BA 3VLBB 2X29A 4NJ4A 3ECQA 5FLJA 5G05L 2XJQA 2LTNA 2PMWB 1V0AA 3GM8A 1O4YA 1BEV3 1NLQA 2ZGRA 5LRSA 5FY1A 2GNDA 3ACLA 2VH9A 4PLMA 2P37A 1OF3A 1J3QA 1QXRA 3U4SA 3DPRB 5DMYA 3KVBA 1W8HA 1R1A1 3E97A 1TME2 2HWE2 4GJZA 3NAPA 4FTEA 4DEVA 1H2NA 1PO23 3LA2A 4JGYB 1S0BA 2XHNA 4GKXA 1X8EA 5FO8B 1AR82 3KV4A 2JDKA 4NRQA 3CKHA 4QDRA 3ZR5A 3LOBA 2ZMKA 3A22A 4QPIB 3EMRA 4BQ2A 2VMDA 4XDPA 5J3UA 2C5DA 4Z92B 2XLAA 4HVOA 2Y64A 1MS8A 3WF2A 3ZN6A 3J7LA 2XGXA 4QGNA 5FZFA 1LHUA 2ZEZA 5GLWA 3D8CA 4QKDA 4AQTA 4F7ZA 2YFZA 2XR4A 5C9AC 5ACA3 5A3WA 4CDXA 3MIBA 4IEQA 3LF7A 4LMFA 5FV3A 2VULA 1C5IA 2D98A 3GZTB 4JQRA 3VBSB 5FIXA 4Q0PA 5A6ZA 1VB2A 3K46A 4LLOA 3WP3A 1AR72 4AEKA 4DOUA 2KXLA 2R7EB 2HLEA 3D4KA 3C7EA 3NO8A 2H6CA 1AYM2 1XSQA 1CPNA 3FMGA 1LECA 3LA3A 3MW4A 3OPTA 1BQPA 3UKNA 3O1PA 1ODMA 2XHKA 2PAKA 3VD7A 3C7FA 2Z4FA 3K51A 3K3OA 5F5QA 3OEAA 3KHBA 4JDOA 2P4EA 4KQ7A 4COZA 2CNAA 3AL5A 4Q2FA 5LATA 1RUE1 1R082 5IVVA 4KU8A 1EAH3 3OPWA 3ME2A 4ATEA 4AI1A 5LK7B 4ZU7A 4WVVA 4ISRA 4XUQA 5LBEA 2BBVA 1N1TA 5LY2A 4XFCA 1UMHA 2OKXA 1Q8OA 3C7HA 5GZEA 2J22A 1BXHA 4AE2A 2XDVA 4CCLA 5C9AA 2X5IB 1H6XA 5IAXA 3NV4A 4HVRA 4JDMA 1SHWB 5JXGA 5I0SA 2WUHA 3DXTA 2OXBA 2VG9A 4E8CA 5A32B 4NRMA 4QPGC 1LEMA 1JZ7A 1Q43A 4FSJA 1NT0A 3BPZA 2QQKA 1LOGA 4MV2A 1MS1A 1UY3A 1OLMA 1N3PA 1Z0HA 5C4WA 4AL9A 1SCRA 1BK0A 1URXA 2C4XA 1QQP3 1Z7S1 2R1BA 4P9XA 2WINB 1YO8A 3MIFA 3Q8EA 3LIHA 4M3CB 2UY9A 3FN9A 5C5TA 1QXPA 3AP4A 1H1MA 3NV3A 2VQUA 3OTFA 1VRBA 3OGVA 4HPKB 1C28A 1S0IA 4K21A 4CUGA 4KMQA 1DQ5A 3LZZA 2QQVA 3WR0A 5C8WA 1POV0 1ZZBA 3POGA 2RS12 4CCNA 1W2AX 3RYKA 2O1QA 2D6PA 3U10A 1WW5A 2NM1A 1SLLA 4CDQB 1DHKB 2Z2SB 2BJSA 2YBSA 2XMLA 5L9BA 1W2OA 5A7QA 5JIAA 1ULFA 5FO9B 1QH6A 2JE9A 2W2IA 5HV4A 4RA0A 1YNAA 3W9AA 4X6QB 1NCQB 4QPGA 5GALA 3R4UA 2GN7A 4COUA 3WNLA 1OBNA 1WD4A 2YGLA 4LO8A 1IPKA 3BN6A 1CGPA 1I5ZA 1GNZA 5FFOC 2GSYA 3AKTA 5DUUA 1XOYA 5IWFA 2GMPA 4AGVA 1UY1A 3O0VA 4E8DA 4Y1VA 3UKTA 4RSUA 1LESA 1DFQA 2WLQA 1Y43B 2O0OA 1JN2P 4DEQA 2HWC3 3HT1A 3IMMA 5T55A 3TN92 1DIWA 5JOXA 2FZ1A 1O4TA 2ZKLA 4MGTA 4GMP1 5IVEA 1K5MC 2XH6A 3POFA 4OHZA 1W8WA 4CSWA 4QDSA 1BVVA 3WINE 3ZX7A 2RDRA 5IHRA 3QCWA 2WS93 2RDQA 1FYUA 2R16A 5FZ7A 3JBG1 4BMBA 4NVPA 5JLVA 2CWMA 2CHHA 4AK3A 4Y1ZA 1PGW1 2GP5A 1FOD1 3SISA 3BIEA 5CFCB 5CG9A 1ENSA 3JQXA 1VALA 2QCSB 1ZA7A 5FAXA 1RUF2 3ZXDA 4AYUA 3A7QA 4NHMA 1F35A 3LQCA 1OT5A 4DNYA 2JXAA 3J7HA 5KXDA 3AYDA 2W92A 5C3OA 2J1TA 4FPEA 4UBHA 4XE9A 2SLIA 1CAVA 2WSVA 2OS2A 5B2GB 4P9YA 4XFAA 5F8PA 2GC2A 2R6QA 3PNAA 2UYAA 1WCSA 4ASMB 3UJQA 2XLFA 2BEOA 2OX0A 3CJIB 4OHYA 3DL3A 5A80A 1LKNA 5CBLA 1D7PM 4AGGA 4CU7A 1KRIA 2VXJA 1K5MA 2K46A 3O0WA 1XE8A 3Q8CA 3USUA 1W3VA 5GLTA 4QT6A 5DDJ1 1LOFA 1D0HA 3I2KA 1JZ2A 1WBLA 2E7TA 1DGRN 1UZVA 4MXVA 3VBHB 3PJYA 4EN9B 1ZBE1 2ZAHA 5E16A 1KS5A 3WDVA 2BU9A 5CFDC 4IE0A 3WF3A 2FDHA 1QJU2 1ZRRA 3WNPA 5F2WA 2FZ2A 3O5SA 2W91A 1H8TA 2ZX0A 1SZBA 2VMHA 5LB6A 3HPNA
chains in the Genus database with same CATH topology
2HWD3 1GQGA 5JDBA 4XHXA 1JTZX 4KH9A 5JMCA 5C6CA 2WQZC 4TLFA 1RMU3 1FPN1 4AI0A 4R4XA 3ZXEA 1KXGA 1O5UA 1PHMA 1DQ6A 5KHKA 2K9ZA 2PA7A 1W0PA 3LB9A 5K9YA 2FBEA 2PELA 4OUMA 1NY71 1HXS2 1DYPA 1RINA 1SFYA 3LOIA 4MXWA 4NN0A 3MICA 3R4SA 5C8CB 3KLSA 2W0XA 3HBZA 5CFDA 4YGDA 3POWA 5F9TA 1J1TA 1GYKA 3VBSC 1XXNA 1TMF2 4KWLA 2BVBA 1PZ7A 4HSLA 4FBFA 3VBUB 5JSRA 3ZN4A 1PK6B 2GALA 2ZHMA 3H9AA 1NA1B 1ASJ1 2H0BA 4MUVA 2JDZA 5LRRA 2ATFA 1RL3A 1HRV2 1W6OB 3MF9A 3RJRA 4AQ6A 5AC91 3VKOA 5E89A 2ES3A 2HWF2 5HXVA 3VBFB 2B7YA 2IXHA 2DURA 1N3OA 2B8MA 1AL22 3AMNA 3S6PA 3ZIXA 1UN1A 1D2SA 2JG9B 1QDOA 4Q0UA 1QHDA 2QZ2A 2H6BA 3ST7A 2X5IC 3E5XA 3MEPA 3LCPA 1BEV1 3MGUA 2FQPA 2JE7A 2GU9A 3VBSA 3WXPA 3KGZA 1C8M2 1EP0A 3EBRA 1SBEA 1PO21 3NWKA 1AR62 2C1FA 3IBMA 2WFF3 2N7GA 5BXXA 5JOYA 2PFWA 2VUJA 2VW0A 4B4PA 1NCRA 1R1A2 3MF6A 4XIKA 5FQ0B 3M1HA 4XFBA 4FTBA 4B3NA 4CRQA 2YV8A 3MLLA 2VECA 1V6JA 5ACA1 3FFZA 3RJ2X 3BOWA 1LRHA 2G4IA 2ET7A 3D0JA 4FTSA 4WVWA 2ZGTA 5I93A 3OD4A 1IS3A 1WBFA 4CDQC 1ZRDA 1V6OA 2ZA9A 3T1LA 4FPHA 4CDUB 4XXAA 3PJQA 1NCQC 1NOVA 3JD72 3ZXKA 3N7LA 3BOPA 1XNDA 4EV0A 4XBLA 4GULA 4PLOA 3VHOA 1AL0G 2JJ6A 1KJLA 1U0AA 3TBDA 3J26N 4OI4A 1ZA4A 1WD3A 2XBO2 4YGBA 3WW3A 1GLHA 3EHKA 4M3CA 1LHOA 4BLIA 1EAH1 4LBJA 3BIWE 3ZPYA 4LBQA 3WNXA 1FI2A 2ZGSA 2TEPA 2XUMA 2VNOA 3ZSJA 1S1AA 3ATGA 2GC3A 2WNUB 1LR5A 4CDQA 1RUH3 2WZR3 2YXSA 2Z42A 4W6WA 3WP4A 3ZFGB 4SBVA 1CAXB 1PM7A 1MVQA 2ENRA 1VBE2 2A6XA 3I2DA 2AR6A 4GH4B 1H8VA 4HK8A 1XNCA 4XBQA 1H4HA 3N36A 4UW5A 1LENA 1BMV2 1QQP1 1RC6A 4OHWA 1AXZA 4G3YC 5FOJB 1KD7A 2BYVE 3MW3A 4Y22A 4CEWC 1DZQA 4BH9A 1JYIA 5EYXA 5HCAA 5E88A 4COVA 3POSA 2PAMA 1HIXA 2AH2A 4G4FA 2W52A 1LHVA 4R9DA 1O5LA 3KD4A 1G8WA 4GB33 1YXWA 1R1ZA 4WZCA 4AF9A 1RUJ2 1N1VA 1U5YA 4LBLA 3H3ZA 4RHV2 2XKPA 1MQTB 5CAZA 2DVAA 4EWDA 4FVVA 4DMIA 2DYCA 4JDNA 2EVXA 1YRZA 2HWB3 2VOWA 2WIIB 3ZVXA 4A3XA 1RTVA 4XFFA 4XF3A 1UZZA 3WCSA 1WCKA 3AXEA 3GBWA 1U12A 2HWC1 4FOWA 4LO7A 1AZDA 4JVAA 1CAUB 1RVF3 2TBVA 4CEWA 4YRDA 5F6LB 4HANA 3PMEA 3QH6A 4DS0A 1W6MB 1RUC3 1FT9A 2X53S 3VKMA 2BQPA 3AYCA 5FREA 2WS91 4Q1PA 3ZN5A 5K0UB 4Q4X3 1X33A 3OPZA 5T52A 5C8CC 1WLDA 2O8QA 2OW4A 4FPYA 3ZXJA 2D5FA 5BNPB 3OF1A 1QOTA 3K48A 2VVDA 1BYHA 2BFUS 3ES1A 1T6GC 3U07A 3NV2A 4I2OA 3AP6A 3VBOC 1PK6C 3VZLA 3B01A 2IFRA 3AB0A 4N9IA 3WX5A 3ZFEC 1H4GA 4OI1A 2GH8A 4OHVA 2BNNA 2MEV2 4PQ9A 2RR13 2ZX2A 3AKPA 2ZX4A 3G7DA 1PZ8A 2BNOA 4QQLA 1IS6A 2R062 4BHPA 5HBAA 1S55A 5EZWA 3ZDSA 1G7YA 3JU9A 1TQ5A 5BNOC 5C8CA 4ONUA 1FMD3 3E5QA 4D7SA 5J98B 1S0GA 4YGEA 4XYXA 2XPJA 4LHKA 5FTTC 4HL0A 3AK0A 3WW2A 2HWD1 1O3RA 3ROUA 5FLHA 1SBFA 1VBC3 1DZRA 2Z79A 5K7PA 3SCFA 2A73B 2B9UA 4NWWA 1DYKA 1PK6A 1RMU1 2Q1MA 4RR3B 3VBOA 1QOOA 1JOJA 1Y7BA 4AW7A 1MVEA 1R093 3GBGA 3WDTA 4AG4A 3ZFEA 4QPYA 2D6LX 4XFIA 1U5ZA 1XNKA 3QACA 4NHKA 3U11A 2VNRA 1KDMA 3LKJA 1HQWA 3HN1A 1LOAA 4AVBA 2VOKA 1ALYA 4XF1A 2A6VA 1LGNA 2GAUA 5BNNB 4FCAA 1NZCA 1QJY2 4LO4B 5BNOA 4OUSA 1POV3 1ZVFA 2ZGNA 2W68A 5IK4A 3FWEA 2ZGUA 2WNVB 1CESA 2MNGA 1G9CA 1W6QB 3O7OA 3TYJA 3MIHA 4R8HA 4CDUC 4YGCA 4I0BA 1GBGA 3RI9A 1N47A 1LGCA 2G9FA 4EN6B 5JOZA 4J1XA 1X7NA 3GHNA 3RQ0A 3EQEA 1W2UA 2A3XA 1QMJA 5H9RA 2IXCA 2ZHLA 2RMU2 1YCIA 2QVSB 1AX2A 3S0MA 1QJX3 2GMMA 2E53A 1FV3A 1PZ9A 1D4VB 1WLWA 4V1PA 3HIFA 2DVDA 3PVNA 5FQ0A 2ZOEB 3T1MA 1E57A 3IDBB 3SCHA 2ETEA 4LUMA 2E7QA 1UMZA 1NQDA 2XL9A 5FMOL 2VXRA 5KXBA 4Q4W3 1ZBA2 4AHZA 3M3QA 3ZFGC 1OHFA 1S0DA 3TNQA 1ENXA 4DXZA 4CDUA 1J58A 2EXKA 1EV12 1OLRA 2WFF1 3FUOA 4KG0A 1C4RA 3RPQA 4YARA 2ZHNA 1COV3 2DTWA 1PIV3 1L3JA 3KSCA 2DU0A 4LHNA 4XJAA 4E9KA 2D7FA 4YNIA 3EXUA 1YFWA 3WVJA 1WW6A 1CJPA 5FPZA 3HWJA 3MIDA 1PGL2 1D4M2 1IOAA 1G6NA 5GLZA 1B35C 3ZXLA 1QKQA 1PVC2 3THPA 1G9FA 2VW1A 2A3YA 1UW8A 1OQ1A 1MZEA 3SH4A 4XF9A 1S0CA 2R0HA 1XNBA 1N3QA 1VAMA 4URTA 4K7JA 4EN0A 3CF6E 1MQTC 2IZWA 2Z69A 4A7YA 2KA3A 2WT2A 4ZU5A 3V0AB 3BTAA 4Y1XA 4X8PA 1TE1B 2VU9A 2PTMA 1WLTA 3MYXA 5IK5A 1H0BA 4QQPA 4A7ZA 3DF0A 5DZGA 3KMHA 2BPA2 1I9RA 2XJPA 2DCZA 2Y0IA 4Q4Y3 5GZGA 2ZGQA 4WVZA 1XQNA 2ZX3A 3SLIA 3AYAA 4CDWB 4AHYA 3DN7A 3MIGA 3CEWA 2YZ4A 1C5HA 4L97A 1QNWA 1B35A 2XJRA 5FLIA 2C0ZA 3ALQA 2D5HA 3NKTA 1DQ2A 4FXKB 5K0UC 1APNA 1PO13 3RMYA 1RUH1 2WZR1 3ELNA 3IPVB 4Q1RA 4FOVA 1V9U2 4U36A 3AFKA 1CX4A 5I8SA 4YFZA 3H7YA 4HN1A 5BNPC 3BODA 2XVGA 1MQTA 2NQYA 4AEMA 2D40A 1U5IA 3SMHA 4IERA 3AM2A 3A0KA 4BOWA 1QH7A 4W6XA 2NMNA 4UBGA 4M00A 1UCXA 1S0FA 4N53C 2UWAA 1HQLA 4HBNA 1CAUA 3WDWA 3BALA 3C2UA 4I01A 2PAEA 4XFGA 3DKWA 4NR1A 4YG6A 1PMIA 1O3TA 3NW4A 4GB31 2R32A 5K0UA 4NWVA 2AUYA 4H3WA 3VZNA 1AXYA 2NYYA 5E1RA 1W6NA 2VMGA 5DZFA 4FPFA 1UAIA 5BNPA 3OGGA 2MHFA 2HWB1 4JCKA 1JUIA 1RUG3 3AKQA 3KS7A 2DVFA 5KC6A 3JB8A 1W0OA 1LU1A 3B3QE 1QJZA 1J3PA 1ULEA 2R042 5EWSA 4RR3C 1RVF1 2WNEA 4EN7B 1RUC1 3B9IA 3MLKA 4N53A 4CP2A 1KQRA 4M0NA 3I8TA 2EXIA 1SLBA 3QOPA 4Q4X1 5CIRA 3AP7A 1UPSA 4DRVA 4OLLA 1QOSA 2JG8C 1XYOA 4EN8B 1NE6A 2HWE3 1FNZA 3IWZA 3CO2A 2OA2A 4R9BA 4XJ9A 1HRI2 1LHWA 4LLFA 4HT1T 4Q27A 5IUQA 1AR83 1OD5A 3H3UA 4EWAA 1RB8G 1BBT2 2IFWA 4FOYA 2OYZA 4I0AA 1ZYBA 2DFBA 2I45A 2V09A 2F4PA 2DCJA 2WL1A 3KZ4C 3ENRA 1REFA 4BIOA 3WQ0A 1ND2B 2TNFA 2C9AA 4RS5C 4RR3A 1CD3G 1AUYA 1Q5OA 4HETA 2RR11 3WP5A 1NE4A 2WA4A 5GJ6A 4CP0A 1AR73 3TB0A 3M4FA 4N7UA 4CZSA 1AYM3 2JG8A 2YYOA 4KGQA 5I8TA 2ZCWA 3B02A 4IV3B 1FMD1 1H2LA 2A3WA 5JR7B 4O9GA 1SLTA 5ABJC 3CJXA 3WQ1A 1JXNA 1MS4A 5H9PA 4AXOA 2RS52 1IKQA 5CADA 1VBC1 1R083 1W6QA 3L2HA 5DZEA 1JUHA 1YFUA 1RUI2 2D6MA 3VGIA 1R091 4Y20A 4RS5A 2D43A 4YG3A 1VR3A 2HWD2 1ZZ8A 1AF9A 5KXCA 4WVMA 4RD7A 2P34A 3ES4A 3OYWA 4AFBA 1DLLA 2DTYA 4QMAA 1POV1 4BPZA 1OSGA 4QXKA 4HN0A 2OVUA 4ES8A 3ASIA 1YUDA 5ABJA 2H0VA 2W08A 5EYYA 1KFUL 2CGOA 2WZPP 1RITA 1X36A 1VBB2 5KHGA 4G9SB 4C90A 5BNQA 2DUQA 2P17A 1V6IA 4NPRA 3RG0A 3AZYA 3V0BA 1IQAA 3GZUC 1QJX1 2CGNA 5SV5A 4INDA 4CDWC 2ZTNA 4LE3A 3TWIA 3MI8A 4XHBA 3N4MA 1SLCA 5A3MA 4JGZB 2E63A 1RHI3 2R49A 4GXLA 4GALA 1IGOA 1ZRFA 1UU5A 3QLQA 4COYA 4Y26A 4K1ZA 2A6ZA 3DPRC 1NYWA 4Q4W1 3VKLA 4KGGA 3MIEA 4OULA 1W6PB 3PLQA 1V6MA 3ZFFB 3J8F3 4JGYC 1WW7A 1SACA 1JYCA 1H30A 5KHHA 3LA7A 4XILA 4IEUA 4DB5A 3TN93 4QPIC 1COV1 1PIV1 1RUD2 1AX0A 3V0AA 5F1RA 3OD0A 2OZ6A 1RUNA 4XJ8A 2RS33 3AJZA 4L9BA 3LAGA 2YC0A 2D93A 1V00A 4W65A 3G6JB 3SH3A 2UU8A 4B8EA 4AVTA 3IT8A 1CIWA 1OOPB 4JC1A 4LULA 1RUF3 2CWSA 1SQ4A 4WV8A 5IK8A 5T5JA 1HLCA 4YVSB 1AR92 3DPRA 2Y0OA 4XPVA 1S0JA 4Y1YA 4QD2A 4KNCA 3D5OA 1MEC2 3ZYPA 3AZXA 3VBRB 3VZOA 4JGYA 1DGWX 5SV8A 4MGKE 4YG0A 1O7FA 4XMIA 4F83A 3VKFC 2IWGB 1UD1A 4NOTA 2E9QA 4L92A 4QPIA 4AI2A 2AENA 1J3RA 3WG2A 4Q4Y1 2VMIA 1OPMA 3KT1A 4L2NA 1AX1A 5DG2A 2VNGA 1VBA2 4D69A 3O14A 2DVGA 4BE3A 1ZRCA 4FPJA 4ZKTB 4B4RA 4BZ4A 4K1YA 1PNFA 4ZU4A 1OMIA 2SBAA 4N43B 2PHDA 3RZZA 3SITA 2PLV2 4TWTA 1PO11 3VHNA 4P9LA 3WUDA 3MFCA 3Q9OA 1LJ7A 4HKWA 4UXAA 4XJWA 3N3HA 5J7MA 1ENQA 2LM3A 2XL7A 1H2KA 2VQAA 4IEYA 5DG1A 4AVVA 4BIFA 3X29B 3POYA 1CR7A 1REEA 1HXS3 3WQ7A 2A5ZA 2XJUA 5FO7B 4RGAA 2QKDA 3NVCA 3H7JA 2VQ0A 1AYN3 2ILMA 3INAA 4AEJA 4DINB 2X5IA 2Y26A 3UJOA 3AMHA 2DCYA 3W59A 2EAKA 5GZDA 2QFEA 5A32A 1TMF3 1WCDJ 1WMFA 3V56A 2X8KA 4IEXA 2VY0A 4IV3C 1RUG1 1MACA 5JOWA 1HRV3 4MGYE 5BV6A 3FE5A 5BY5A 1MS3A 1G9BA 1GANA 2JKBA 1A6CA 2HWF3 1H1IA 4TYSA 4COWA 3O0XA 4I30A 3FC0A 4HPKA 2YUEA 2DCTA 2DV9A 2NPIA 1RUE2 2K2SA 2YY1A 3GHMA 4YSFA 5JWPA 4QQHA 1KFXL 2DUOA 4Z07A 1C1LA 2GMEA 4IETA 5JCTA 1WUVA 5CFCC 1UX6A 1IZ3A 1J59A 1WLCA 1NCQA 3TNPB 5KWRA 2HWE1 1RUC2 2RE9A 1C8M3 2B46X 1AHSA 1AR63 1HKDA 1I6XA 1VJ2A 1AR81 2JEMA 1QNYA 1NG0A 4IV3A 4WM7B 2JENA 1DGRA 1RIRA 1CVNA 3JCIA 4AEDB 1OFSA 2NZ9A 1DZTA 3OBRA 4XBNA 2E7AA 1MS5A 3CJIC 1ULDA 1Z7S2 1C3HA 1RUOA 1WMEA 2QUOA 4P9GA 4D7TA 1LB2A 4C91A 2NLRA 4XOGA 4ES9A 3HMYA 3VBHC 4EROA 3FBMA 3URFA 4CEYB 5KBFA 4RFT0 1AR71 5CFCA 3LWCA 1O3QA 3H1MA 1AYM