5GZFA

Galectin-8 n-terminal domain carbohydrate recognition domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzfA00
2A6XA 5SV8A 1ULDA 4U2AA 1S0CA 1DFQA 2R0FA 4LBLA 4Y1ZA 1YYNA 1ZM1A 4UW5A 1LOBA 1DQ1A 1WLCA 1OKQA 2EF6A 2WT2A 3MW3A 2WLQA 4Y1XA 1BZWA 4GKXA 4YGCA 3M1HA 3GALA 3OY8A 2PELA 2WSUA 1JOJA 1H9WA 1CPNA 2A6YA 4Y1UA 3WCSA 4XILA 4YG0A 3AZWA 2YXSA 3OBRA 4CTEA 3BIWE 1W6PA 1SLTA 4TYSA 1Q8SA 2GALA 4YFWA 1ULGA 2R16A 4DRRA 1MS8A 1B09A 2XB6C 1LOGA 5AVAA 3SH4A 1ENRA 1LHVA 1Z78A 2R1DA 4XBLA 1CVNA 2P3JA 4BM8A 3AK0A 1WBFA 5JMCA 1GZCA 4LBOA 3A4UA 4I30A 1S0BA 1AXYA 1EPWA 2NZ9A 4Q1PA 3WUCA 1RITA 4WVVA 2GMMA 5DUWA 5H9RA 1GYKA 1SBEA 2W68A 3B3QE 4FOYA 4XE9A 3WDXA 2ZMLA 1BQPA 5CA6A 1CPMA 3ZXKA 5H9QA 4K20A 3UJOA 3RSJA 4K1ZA 5JDBA 2W52A 5T50A 5JLVA 4JCKA 3B69A 2EALA 3JU9A 2ZACA 5H9PA 1V6IA 1MVQA 3HMYA 3AZZA 5IK7A 5CB7A 2DU1A 1JW6A 1F31A 4C1WA 1Q8VA 2DYCA 1YO8A 3T1MA 1DZQA 2AGSA 2GN3A 1GZWB 2ERFA 2AUYA 3BODA 1KJLA 2D3PA 1GNHA 1WBLA 4MYEA 3ZVXA 4FPGA 3PMEA 3AP4A 1V6NA 2VW1A 2A6VA 1MS1A 4XIOA 1AXKA 3ZXEA 4AYUA 5IK4A 3U4XA 2ZHKA 4Y20B 1DHKB 3IMNA 3Q9OA 1JYIA 1V6LA 4FPLA 4YLZA 4P9WA 5DG1A 5GLTA 1AF9A 2DVDA 2LTNA 1QF3A 2CYFA 1DIWA 1CQ9A 1MZ6A 5DG2A 2JD4A 5GZGA 2A7AA 4XYXA 3CNAA 3IN9A 4BMBA 1AZDA 1UAIA 3QLQA 3A0KA 1WUVA 3OJBA 4FP2A 3IPVA 3AP9A 3WLUA 2I2SA 3A0NA 1ULEA 3V0AA 2DU0A 1HKDA 2JE9A 4FPCA 4AWDA 4BLJA 3V0BA 1F5FA 1VAMA 2VW0A 4XXAA 1FNZA 1Q8PA 2A5ZA 3N36A 3VV1A 3OYWA 1ENQA 1RINA 4YG6A 1PZ9A 1QNYA 1ZA4A 4OZXA 4YM2A 2AREA 3R05A 3WZ1A 1HDKA 1LU2A 1MS5A 3WG4A 4GWMA 1G9BA 5T5LA 4XJZA 1W6NB 3MPPG 3VKOA 5T5PA 5T5JA 2D6NA 4FOWA 4R9DA 3SH5A 4LBQB 3VKNA 1KRIA 1AJOA 1DQ2A 1MS4A 1A78A 1HQLA 4YGDA 4D69A 5JOXA 2A6ZA 2ES3A 2WT1A 3KM5A 3SH3A 3FFZA 1NXD1 4U36A 3C2UA 1SCRA 1S0IA 1FV2A 2GNMA 3B01A 4LBKA 3ZPYA 1A3KA 3WDWA 3OBTA 3ATGA 2P3IA 5GALA 3GNEA 3R4UA 4YM1A 3UK9A 3FBYA 1GANA 5IT6A 1S0JA 2R1BA 1DBNA 1KDMA 2A3WA 4NOTA 1S0GA 1QGLA 3W59A 2R49A 4Q2FA 4Y22B 5KXBA 4UW6A 1QDOA 4YW2A 1HLCA 4SLIA 3AJZA 3SISA 3ZXFA 1PZ8A 1W6QB 5KXCA 1Z0HA 2HYKA 1Q8QA 2EXHA 4FQZA 2CY6A 3VUOA 1JN2P 2A70A 4XJUA 1LHWA 4FP3A 1Y7BA 3ASIA 5LK5A 1YXWA 3MEPA 2AH2A 4K1YA 5CNAA 2V73A 1N3QA 2ZGSA 1LOFA 1VALA 5T52A 4M01A 1G9AA 3O0WA 4XJ9A 1GKBA 3DGTA 3UJQA 2ZKNA 4YW5A 4ZXKA 4JC1A 2DUOA 2E53A 3TB0A 2YROA 1FAYA 1AX1A 1BKZA 5T54A 4P9YA 1AXZA 2CTVA 3WUDA 1JHNA 2VXRA 3WCRA 1N47A 1LESA 1SLIA 3IKWA 3WV6A 1TEIA 3ILRA 5JOZA 3ZXJA 5IK5A 4Q8LA 1WD4A 2A6WA 3RS6A 1GBGA 4XMAA 1YIFA 2NMNA 3ZYRA 1G8WA 4M3CB 4HL0A 3AP7A 4XBQA 3AZXA 2D43A 2UURA 1ENSA 2C9AA 1GZWA 4DFSA 1LODA 2D6PA 3N3HA 1QU0A 2E7QA 2YMZA 1OFSA 1R1ZA 1V6MA 2OW4A 3RMYA 4C1XA 4DS0A 2NN8A 1LGNA 2EAKA 1PZ7A 2Z42A 1N3PA 4ATFA 2ZGTA 4Y20A 2WNEA 3N35A 2YY1A 1V6KA 1G9CA 2UU8A 4WV8A 3PJQA 4GXLA 4XBNA 3SNMA 4TZDA 1DGLA 4RL7A 3WOGA 2E51A 4XTMA 4YZ5A 4GALA 3PVEA 4R9AA 1UPSA 2D7FA 4W65A 3WHUA 2ZHMA 3VKFC 4Q1RA 1FYUA 3AX4A 2NM1A 5EWSA 1U0AA 2D6OX 3NV4A 2VH9A 3BTAA 1GICA 1AX2A 3AP5A 5GLZA 4XJAA 4CZSA 1GZ9A 3D5OA 3O12A 1LENA 5DUVA 2KM2A 2WJSA 5DUUA 5E89A 4BQ1A 2D6LX 5IK8A 1W6OB 1HQWA 4FVVA 2G4IA 4XOGA 3AYDA 3DUIA 4AVSA 5KXDA 1KITA 1MR5A 2GNDA 1X50A 2AR6A 5T55A 1W6NA 4YG3A 5F5QA 4GWNA 3IM0A 3WDTA 4BOWA 5E8AA 1DYPA 2VUAA 4XHBA 4FPHA 3WDYA 1IOAA 3LSDA 2D3SA 4FOQA 2PHFA 2ZA9A 1QNWA 3MW2A 4LBQA 2D44A 2VY0A 4FPEA 3USUB 4YFZA 3POWA 3B00A 5GLVA 2DUPA 3ILNA 1CESA 2H0BA 4ITCA 1S1AA 1LOFC 2ZHNA 4LBQD 1Q8OA 3KQRA 1WLDA 4KBBA 1NLSA 2CL2A 2P34A 3BOPA 1J1TA 4FOVA 1ULFA 3I4IA 2VU9A 1LEMA 3D4KA 3O5SA 1S0EA 2GDFA 4FPYA 3ZSLA 4BMEA 1IS3A 2DURA 4PQ9A 3ILFA 4FQ4A 1CIWA 4K21A 3V64A 4ZKTB 2E7TA 5GLUA 2DVBA 1C1LA 2JECA 4Y22A 2CWSA 1WW5A 2A3XA 2ZABA 1LU1A 2ZMKA 1RIRA 3O0VA 4XTPA 4XXPA 2D6KA 3FLPA 1N1TA 2ZMNA 5FRAA 2EXJA 1DQ6A 1W6QA 2A71A 2P37A 1MS3A 1YI7A 3MW4A 3RRDA 3RMXA 1DLLA 2YZ4A 3ENRA 2P3KA 4PCRA 4AGRA 1VAVA 4JRAA 1MZ5A 1H30A 5HCAA 4PBPA 3ZSKA 2EIGA 2DV9A 1DQ0A 1SLAA 5IUQA 4HANA 2ZGUA 1KQRA 3O0XA 5GM0A 1XQNA 2DTYA 4AGGA 4FPOB 1UZYA 3NV3A 1BXHA 2DUQA 1IS6A 1QOOA 2ARXA 5EXOA 1LJ7A 4YW1A 1GV9A 3R4SA 4DRVA 1CN1A 3WNXA 4PF5A 1LECA 5GZCA 1Q56A 1DQ5A 2D3RA 5EYYA 1V6OA 4F83A 3OPZA 1W6MB 1LOEA 4R9CA 4UW4A 1UKGA 1I3HA 2ZBJA 3T2TA 2PHXA 1FATA 5T5OA 2SLIA 4NO4A 3FLTA 4XZPA 3TAYA 2CWMA 1S0DA 4Q27A 2JKBA 1APNA 3AJYA 1QOTA 1LOCA 3LCPA 4ISRA 4XMIA 1C57A 1FX5A 1LCLA 3M3EA 4M3CA 1LGBA 1C4RA 4YM0A 1N1VA 1UZZA 3HN1A 1FNYA 3WG1A 2JDZA 2AENA 4YW4A 2ZGKA 4PBOA 3N7JA 1LOAA 2GMPA 3INAA 1G9DA 4R9BA 3WHTA 1BJQA 2UWAA 4XJWA 2DVAA 2UWCA 5FREA 3M3CA 1JYCA 3OY8B 1KJRA 1UMZA 2ZGPA 4FPKA 4DPNA 2GNBA 3RG0A 2ZGOA 4LBNA 3VKLA 4AVVA 1LTEA 1WCSA 2JE7A 1W6PB 1MS0A 2OUJA 3WG2A 3AXEA 2Q5TA 3PVNA 4GA9A 4YW3A 1DQ4A 2C5DA 4AVTA 3AFKA 3SITA 4YM3A 4AGVA 2NMOA 5GZDA 1SLLA 5GLWA 2WSVA 2B7YA 1UN1A 2XG3A 4M3CF 3FLRA 1D2SA 3NWKA 1JUIA 2WKKA 1LGCA 3M3OA 1WW4A 4XJ8A 5JOYA 1KDKA 4Z8BA 5KXEA 1D0HA 3D6EA 1GLHA 1LHOA 5L73A 4CRQA 1CONA 3JUUA 1SLCA 2ZGRA 4Q26A 3H0OA 1JBCA 1LEDA 1O4YA 2ZGMA 1W6OA 4YZ1A 1AX0A 3PVOA 1N3OA 4Y1VA 3AZVA 2BQPA 1WD3A 1BYHA 1VLNA 1SACA 5DZFA 2ZZJA 4M3CE 3NV2A 3M3QA 4XIKA 5F9TA 1LULA 1QDCA 3ZXLA 1LHNA 3M2MA 4Y26A 1ONAA 2ZHLA 1G86A 1F9KA 2JJ6A 2R0HA 2W08A 2W39A 4RA0A 3QCWA 1JXNA 1V00A 5JOWA 1G7YA 2GN7A 2YV8A 3USUA 4BLIA 1GNZA 3AZYA 3AYEA 4LBMA 1WLWA 5GZEA 4FPJA 2ZGNA 3N7MA 4WZFA 2SBAA 3WDUA 2ZAAA 1VIWB 2WT0A 4YGEA 3ZYPA 1IS4A 3AXDA 5GJ6A 5HCFA 2GMEA 3POYA 5DXDA 1CR7A 2GNTA 4M00A 1QOSA 1A8DA 1OQ1A 2OVUA 5DUXA 2DVFA 1QKQA 3UL2A 3B9CA 3W58A 2WQZC 2P2KA 2EXIA 2ENRA 1AVBA 2RHPA 1CJPA 1W0OA 1SBDA 4YZ3A 3N7KA 2NP0A 2E6VA 4LBJA 1AJKA 2A3YA 3I8TA 3LSEA 2VW2A 5JVVA 3WVJA 1O4ZA 5DZEA 1SFYA 2NYYA 2UWBA 3APBA 3IPVB 4ATEA 1MACA 3AYCA 4IQPA 4WVWA 4Y1YA 2PHTA 4GKYA 3V0AB 4P9XA 2DWRA 2PHUA 4DQAA 5H9SA 3T1LA 3V0BB 3OGGA 3VKMA 3ZSJA 1N1SA 1DYKA 3FUQA 3OYWB 1IS5A 5E88A 2A75A 3WDVA 4BPZA 2EXKA 3ZSMA 2FHRA 2DTWA 5BYNA 4H55A 4FPFA 2OUHA 1W0PA 2PHRA 1WW6A 3RQ0A 2ZGLA 3L2YA 5DZGA 5EYXA 2DVGA 1S0FA 1UX6A 4ISQA 4UW3A 4YZ2A 1WW7A 2PHWA 1ULCA 1W6MA 3AP6A 1UL9A 3POSA 3WG3A 4Q8KA 1C1FA 5CBLA 3NV1A 4XHXA 1LHUA 5GZFA 1N1YA 2V5YA 3V65A 1SCSA 5CAZA 4YZ4A 1FV3A 4YGBA 4L8QA 4ASMB 2CNAA 3HR9A 1IKPA 2D6MA 2LALA 2FMDA 3AYAA 1V6JA 1URXA 3FUOA 3N7LA 2TEPA 1I1EA 3SLIA 1MVEA 1GSLA 5HCBA 1SLBA 2AYHA 1IKQA 1MS9A 1H9PA 2ARBA 4Y24A 1QMJA 1YRZA 1G9FA 4P14A 1SBFA 2ZGQA 4XDQA
chains in the Genus database with same CATH superfamily
3JBG1 2YG0A 1ULDA 4QPIA 1RUC2 1I5ZA 1S0CA 4A6SA 1NKGA 4LBLA 2WZR2 1NA1A 1ZM1A 3CU7A 1DQ1A 2EF6A 1UY1A 2RS51 1T6BX 3PTYA 1C5HA 4COYA 3GALA 5C9AC 2K2SA 1ALYA 2XXZA 2ZAHA 2BGOA 1VBA1 3AZWA 2YXSA 3CQOA 5B4XA 3BIWE 1W6PA 1SLTA 3DCQA 3FX3A 1POV3 2GC2A 3Q8AA 2R063 5C3OA 2BPA2 1BMV1 1HJGA 3LEKA 1B09A 2XUMA 1LOGA 3ZN4A 3SH4A 1ENRA 1W2AX 5FY9A 1CVNA 4BM8A 4JAAA 5JMCA 3ZYBA 4LBOA 3MIFA 4D8MA 2Q1FA 2C9KA 3KV6A 3Q8FA 2Q8DA 2BBVA 3WUCA 1ZRRA 2GH8A 4SBVA 2K46A 4PT6A 5B2GB 2R7EB 2HWB3 5A6YA 1ST8A 1ODMA 2WNVA 1B35C 1PGW2 2EA7A 1GYKA 1Q43A 2W68A 3B3QE 4HKOA 4XE9A 5FPXA 3I3DA 4CU6A 5ANNA 3O1UA 5IHRA 1BBT1 3MLJA 4IUGA 4JCKA 2PQQA 2EALA 1W99A 1RYYA 1V6IA 1MVQA 4Q4W3 1RTVA 3HN3A 1HRI3 3OF1A 1W9WA 5FQ0B 1CAWA 4LPLA 2DU1A 4HVOA 1JW6A 1F2NA 2I07B 3IAPA 3OUHA 1UY4A 1UYXA 3T1MA 1DZQA 1REFA 4AXOA 2AGSA 3VDCA 1EPZA 5FZ3A 5BUVA 1VBC1 5K9YA 2VMIA 5FP7A 1VMJA 3JXSA 2PLV1 1WBLA 3RZLA 2P17A 4GH4B 1V6NA 5EJZB 2Y6KA 2KA3A 4AYUA 3KSCA 1COV2 2OQ7A 3H1WA 3VDDC 3C7GA 4FO9A 1NY71 1X9TA 1M06G 2VZUA 3I2IA 5AC93 5C3SA 1PO11 2DVDA 1RUH2 1ULOA 1UQXA 1QF3A 2LTNA 2WN3A 1IQAA 1H1IA 3LA2A 4WM8B 1CQ9A 3PU3A 1MZ6A 5IFPA 1JYXA 2ZCWA 5LRSA 2BFUS 5FO8B 3MDPA 2A7AA 3ACLA 3M3IA 4NVPA 3S5AA 3N9QA 1NCRB 4GD4A 4L9BA 1UX7A 1YUDA 1WUVA 4HPKB 3ES4A 4FP2A 5JXJA 3KMHA 1ULEA 3BTXA 3OCPA 2J22A 4D7YA 4FPCA 1HKDA 2VNGA 4IGQA 1CIYA 2PTMA 4NHXA 4XF1A 1VPHA 5C3QA 3VV1A 3ZMNA 4GMP1 2YC0A 1ENQA 1JU4A 3I59B 2WO3A 3OYWA 2BGCA 1PZ9A 3HBZA 1R092 4OZXA 2AREA 2ID4A 2WLPA 4OI0A 2ILMA 4GWMA 4RS5C 3O1PA 5T5LA 1FOD3 2VXJA 1REEA 1W6NB 4UFJA 1W9YA 5T5PA 2ADDA 4AFDA 4P00B 1H2KA 1QJX3 5IYYA 3UGFA 1JYWA 4MXWA 4IDZA 2Y34A 2OX0A 1VE0A 5BY5A 3PUIA 5FYCA 3ZKUA 4CDQC 4RHV3 4N53A 3KM5A 4NE9A 3SH3A 3U78A 3FFZA 1IQDC 5ANQA 5A1LA 2GNMA 1S0IA 1CAXB 2IXKA 4NIGA 3OSDA 1IGOA 2ZEWA 3ATGA 3DL3A 3DN7A 4XFAA 2V72A 1HXS2 3D3AA 4IEYA 1AYN1 4D3WA 2VVEA 3I97A 4IW3A 3ON7A 1JZ5A 1T6GC 2HWE3 3HIFA 3IBMA 1DBNA 4Z07A 4YVWA 3VDAA 5HPOA 1QGLA 1FPN1 4XDPA 3HBKA 1R082 4RGAA 2RJLA 2IUWA 4BQXA 3AKQA 4NJ4A 5ABJC 3KB5A 4YPJA 4D6RA 4NIAA 3R6SA 4UFKA 3KZ4C 1W6QB 3K51A 3PU8A 5A3UA 1LB2A 2HYKA 4PLOA 4NIIA 5DDJ1 1DG6A 1HRV3 3FZ3A 3POGA 2PAMA 2Y0IA 5AVPA 4XFIA 2A70A 4CP1A 5C3RA 4CCDA 4PLNA 2VBDA 4B8EA 3NSTA 4IETA 3MGUA 4KG0A 1N3QA 5KHHA 2W95A 5DQ0A 1Q5OA 1G9AA 3O0WA 3RZKA 4OQ9A 1GKBA 3J8F3 3KVAA 4PF1A 1QJU2 4ZXKA 2FDFA 2X5IC 2DUOA 4I0BA 5BNPA 3NJVA 3EB7A 2CGPA 3BALA 4CSWA 2YROA 4Y33A 2VUDA 4EN7B 2WNUC 5DAPA 1AR63 4X8PA 4Z82A 2VXRA 2Y8KA 2X09A 3MLLA 2GC1A 3IKWA 4COVA 5JOZA 1J3RA 1BEV2 4Q8LA 2VTXJ 2E9QA 5FK8A 4UBHA 3RS6A 1GBGA 2RM21 3E6BA 3DYMA 1GP5A 3FN9A 3U10A 5K0UA 5C4WC 4IE5A 1IHMA 1EY2A 1FMD2 1G8WA 3AP7A 2PYTA 2D43A 2UURA 1ENSA 3N9NA 1GZWA 4Z2AA 4IEVA 4TWTA 5BNNC 2YMZA 1OFSA 3RJRA 3ZDVA 2OW4A 4GAZA 1WLTA 5CU1A 1LGNA 2UY9A 2QTWB 4GJYA 5JXHA 1PZ7A 2XJRA 2C26A 3GJAA 3U75A 4HN0A 3KLSA 3ZFEC 1ZVFA 1F35A 2BOIA 3N35A 1V6KA 2XOMA 4DINB 2WL1A 1QQP3 2P3YA 3LAGA 3SNMA 3RDIA 4IE0A 1YHFA 4JGZB 4GALA 1FXZA 4XUNA 3M8LA 3VBOC 3VZJA 2D7FA 3KV9A 5JIAA 4Q1RA 5F32A 2FBEA 1RUF1 2ZJCA 3P1IA 5DAVA 1W06A 4FXGB 3WP5A 4FSJA 3VBSA 5JIUA 4A6OA 2FDIA 3KCXA 5EFUA 2RS13 1GZ9A 3H8UA 4CP2A 4CZSA 4K3UA 5DUVA 3C8XA 2EAAA 2KM2A 2IXHA 2WZR3 2JIJA 1XSRA 2WRAA 4F3JA 5FYHA 4AI8A 4QQOA 3AYDA 3DUIA 4AVSA 4I0WB 4BXFA 5A6XA 1NCQA 2B9VA 1UXZA 2AR6A 5JR7B 4MZUA 4Q0VA 5F3EA 1OH3A 2VUAA 3A23A 2G9FA 4FPHA 4XHBA 2XUEA 3LSDA 1XJAA 1FI2A 4NPMA 1OA3A 3HNYM 4FOQA 4LO6B 2PHFA 5A3WA 2XR4A 1Y9MA 4BIOA 1F5JA 2JG9A 2VY0A 3ACFA 2GP3A 3POWA 3B00A 5GLVA 2YYOA 4ITCA 4L2NA 2XKPA 3CLPA 3FBMA 3HQUA 3KQRA 2VO5A 3SKVA 3MHZA 3JD71 2R6QA 4Q5OA 3HNBM 3VBFA 5BPXA 2YGLA 2P34A 3BOPA 4FFIA 1ULFA 2HWF2 1HQNA 5I91A 2ARAA 4OUSA 3D4KA 2ZX3A 4OULA 3IDEA 1S0EA 3LF7A 1YFUA 4QGLA 4BMEA 4MGTA 1IS3A 4LA2A 4LK6A 5J36A 3ZR5A 2D98A 5FZ7A 4K21A 5CG9A 3I54A 3O1RA 2E7TA 2CWSA 5CKMA 2A3XA 1W3VA 4CEYB 2HWD2 4XXPA 1VMHA 1OLMA 2BYVE 1N1TA 4LR4A 4ORFA 4BK5A 2O1QA 3MW4A 1XE0A 1DLLA 1FT9A 2YZ4A 2P3KA 1W05A 4AGRA 1VAVA 4JRAA 1H30A 4RR3C 2AZ5A 4NR1A 2DBIA 3ZSKA 2CGNA 2QQWA 2WO7A 1OXCA 1SLAA 5IUQA 5L9BA 4S2FA 2WFF1 4IE6A 2CGOA 2DTYA 4AGGA 4GH4C 4CPBD 5J96B 1PNFA 5C8WA 1VRH1 4HVQA 2VVDA 1PIV1 4Q4Y2 3VBHB 2TNFA 3LE0A 4FCAA 4AR2A 5EXOA 1XSQA 2YPJA 5L7OB 4BQ5A 1COV3 2XHNA 1GV9A 5KHIA 3WW1A 3HEIA 3LEGA 1ZNPA 1Q56A 3EYPA 3MUY1 3E1F1 2D3RA 3P6BA 4I01A 4LKEA 3CJIB 4WM8C 4EZHA 4TLFA 1V6OA 1W9TA 5A70A 2X29A 1RUH3 4F83A 1W6MB 2PAEA 5FXVA 3CIHA 1I9RA 1I3HA 3MIDA 1NCRC 5T5OA 3FLTA 1VP6A 4IGOA 2CWMA 1LRHA 3KT7A 4QHBA 3TN92 2WINB 1VBE1 3EJKA 2BWCA 3S0MA 3ALQA 3JB8A 1LOCA 3LCPA 3M70A 4JZRA 4AZZA 4K7JA 1FX5A 2JDHA 3M3EA 4M3CA 4YM0A 1C4RA 3EMRA 1UZZA 3DKQA 1AR82 4BQWA 1FNYA 2JDZA 2WQ4A 4YW4A 3KWVA 3MIHA 5AFEA 3GBGA 3PDQA 2VULA 1LOAA 3INAA 4R9BA 1R093 1UU5A 4V2WA 3GF6A 3C7HA 1NQDA 5CKQA 1BJQA 1XOYA 3LOIA 1XNAA 3NKGA 2RS31 1JMUB 1W2OA 1W8UA 4XJWA 5LBEA 1DCSA 3AL6A 3WR0A 4B1MA 1RMU3 1GU3A 4CDUB 2IXLA 4EN0A 4COWA 3UGGA 1PM7A 2YBSA 3HAGA 4KBZA 5KHJA 4MHRA 2Q5TA 4YW3A 4AVTA 2FQPA 1AR72 4K8RB 4X8NA 5EQUA 1SLLA 5GZDA 3TNPB 3OGRA 4LMFA 1UN1A 1VBD1 2XG3A 1CZTA 2VNOA 2Y33A 4DIQA 2VZ1A 4ZS2A 3KT4A 3M3OA 4P9LA 1AL21 4RQPB 1KDKA 4UFIA 4FAGA 2JG8B 3D6EA 4DXRA 1GLHA 5F8PA 1HXS3 4CCJA 5FLJA 1OF3A 3POBA 3WNKA 4OHYA 5C71A 1GQHA 3RNSA 2QQPA 1O4YA 1LEDA 5LASA 1AX0A 2Y6HA 2Q1ZB 5FZLA 4AQTA 3K77A 5I8YA 1PVC2 1R083 1J59A 1N3OA 2HWC2 1V9U1 3Q8EA 4GB33 4XABA 1WD3A 3BB6A 3LDBA 1OD5A 4LNVA 4JTOA 5FKCA 4XFHA 4E27A 5F9TA 1QDCA 2Y64A 3ZXLA 2HEWF 5FMDA 2ZHLA 2JJ6A 2W39A 3TEZA 4BQYA 2XVKA 5FP8A 1UMHA 4ZS3A 5JXIA 1JUHA 3DPRB 4E8DA 1OBNA 2GC3A 1PX3A 3KT1A 1D0GA 1NQJA 2RDQA 3ZM8A 3ZN5A 4COZA 5C70A 3J26N 1TNFA 4WZFA 3I3MA 4JHZA 5D8AA 3ZYIB 2WT0A 1ASJ2 1IS4A 2B5HA 1CR7A 1QJU3 2NLRA 5F5CA 3B93A 2JENA 4FFFA 4JGYB 2PHDA 1QKQA 4D7SA 1XRUA 4IEZA 5FBJA 1CAVB 1XNBA 2WQZC 2YUEA 2FZ2A 4CDXA 1YFYA 1UWWA 3D8CA 2W46A 5CFCB 4FFHA 4CXYA 3AB0A 3PNAA 2Y6JA 2ZXQA 2MHFA 4QPYA 1UY2A 4N90A 3FL7A 3WVJA 1NUKA 3CJXA 1SFYA 2W92A 4A4AA 3APBA 4MHUA 3AYCA 5I93A 2ZX2A 4LE4A 3TEYA 2PHTA 2Q30A 1F8VA 1YLLA 3T30A 2DWRA 5JWPA 3VBUA 1CX4A 1PO22 3T1LA 4HLTA 2PFWA 1ZA7A 3MICA 4EE2A 3FUQA 5E88A 3U07A 3WDVA 4BPZA 4IEWA 3ZSMA 1YNAA 4QDRA 2W1QA 3MLKA 4IE4A 4PIZA 4AK3A 1W0PA 2PHRA 4OUEA 2HBTA 3RQ0A 4AOCA 2E33A 2ZGLA 1YEWA 1IPJA 2K0GA 2O14A 4UW3A 4ISQA 4JGZC 2JXAA 4HT1T 1H2MA 3AP6A 3WNNA 1C1FA 1OKOA 4XHXA 3OGSA 4N8MA 2V5YA 4BXSV 2R071 5G05L 1Z7S1 4LXLA 5I8TA 2D6MA 1WMEA 5IVEA 1RVF2 3AYAA 3ZOIA 1IPSA 1OA4A 2ZS6B 4Y5SA 3SLIA 1C8NA 5E6HA 4Q0SA 2AYHA 2YHJA 3BTZA 3MV01 1MS9A 1VB4A 3T2PA 1LAJA 1SBFA 4MGKE 5SV8A 4C0BA 1H4HA 2JDKA 4QX8A 5FZGA 3ZYJB 4CEWB 1DFQA 2R0FA 5LATA 4UW5A 1LOBA 3AKTA 3MW3A 4WM7A 1BZWA 4GKXA 4YGCA 1OA2A 3OY8A 4JV4A 1TNRA 2WSUA 4URTA 4AI2A 2A6YA 2DDUA 5HCHA 4XILA 4YG0A 3GBFA 4HK9A 4JHTA 2VNRA 4OHXA 3OBRA 2VTXA 1WWYA 2QZ2A 3FFQA 4IERA 3EXUA 1SMVA 1CZSA 3OB8A 4TYSA 1Q8SA 1H8TA 1OUXA 2WYFA 4XDOA 2C6SA 4YFWA 4B1LA 3HQRA 2R16A 3I2DA 3I2OA 1MS8A 3OGJA 4DEVA 3THDA 1LHVA 2R1DA 4ONUA 4N43B 3A4UA 4I30A 1S0BA 1AXYA 2FCVA 2HWF3 2J1RA 4TN7A 4NRPA 3K75B 1RITA 4WVVA 1MEC1 1S4CA 5JSRA 2VMFA 1TME2 4FT8A 4JQTA 1M4WA 3VL9A 5DUWA 3CDZB 5A7WB 1X8EA 3POJA 2Z79A 3RZJA 2QUOA 2JIGA 2YC4A 3WDXA 4CEYC 1AR92 1CPMA 2HWD3 2VZPA 3CZUA 3AMPA 4K20A 4UXAA 5H9QA 3ZXKA 5ACA1 5FFOC 1D4M1 2XQXA 3I7DA 2ZACA 2E31A 2VOKA 4XQDA 5CFDA 1PX4A 3WNOA 3H1MA 3RYRA 3TEWA 1EAH2 3H1YA 5CB7A 4P9GA 4MG2A 4C1WA 4C90A 3T4VA 2GN3A 1ZBE1 3VBHC 1RHI1 2AUYA 5FY7A 1A8MA 4Q4Y3 4EZ4A 5L7OC 1GNHA 5DABA 4MYEA 3BKZA 3HOBA 1ZYBA 1C8M1 1W39A 1MS1A 4XIOA 3ZFFA 1AXKA 1HRV2 2NPIA 3GCXA 4DMIA 3CJIC 2ZHKA 1UKRA 3Q9OA 3K4AA 1V6LA 1XYNA 4YLZA 3OBAA 4QGNA 3RZZA 1CJDA 5GLTA 2VD7A 4IV3A 5J3UA 1MZFA 3CO2A 1RJ7A 3AKPA 1DIWA 2IZWA 4NHYA 2JD4A 3J8F2 3NO8A 3VD3A 4A7ZA 1OOPB 2BVBA 4XYXA 3RFRA 3NQHA 3THPA 1SPPA 1W90A 5JMOA 2XJTA 5LW9A 1XYPA 1DF0A 5J48A 2QQJA 2RMU2 4AFBA 1AR83 2AEZA 3V0AA 4LOTA 4A7YA 4BLJA 1MQTB 4RFT0 1F5FA 1PK6B 1JZ8A 2AC1A 2W1WA 1HV0A 5C8CC 2PMWB 5IW0A 4XACA 3ITQA 3WZ1A 4CDUC 4HKWA 3WG4A 1XNDA 4QB6A 5FZHA 1G9BA 3UNPA 1OVSA 3PTRB 3A21A 4QQ2A 4ZHNA 3DKWA 3NVCA 3AMQA 3KGZA 4AFAA 2GP5A 5T5JA 3ZIWA 1NXMA 4QB2A 5FYYA 3ETPA 4NMIA 4R9DA 4UBGA 4LBQB 4XF3A 1AR73 1AJOA 2MNGA 1MS4A 4QD2A 4OQ8A 2WC2A 5C3PA 1NZCA 4YGDA 3NAPA 4D69A 2MEV1 5JOXA 2JG8C 4NAOA 2QQLA 3ACGA 2VOVA 3C2UA 1SCRA 3RWKX 2ARCA 3ZPYA 4CUCA 3D0SA 4IEUA 2Z4FA 1RUE1 2VMDA 3POFA 3HNMA 1EUTA 5FXZA 2R1BA 1H6XA 3ELNA 4MX3A 1ZZCA 4J25A 4NOTA 4OHVA 1PVC3 1WGPA 2HWC3 3W59A 2R49A 3DYOA 4Q2FA 4Y22B 5FPUA 5FPBA 4XFGA 3GYDA 1QDOA 2XQRA 4IXLA 4MV2A 3ZXFA 5FYVA 5KXCA 1ND2B 4X6QB 1WCKA 2G9GA 1Q8QA 2J1TA 3DPRC 2RR12 3T0AA 1PGL1 2GZWA 3MF9A 1UOJA 3VUOA 4J6GA 1JN2P 5K4LA 4XJUA 1LHWA 4FP3A 4GIQA 4HXCA 1RUD1 3LIHA 3MEPA 1OC1A 4DEQA 2WS91 1LOFA 2UYAA 1ASJ3 1ZZBA 2HH9A 3P5BA 3B94A 5JZGC 5FK7A 2VOTA 2ZKNA 4JGYC 3ZYFA 2FMYA 2VCCA 3W5MA 3QH6A 3ZLIA 2PA7A 3VZKA 2VC9A 5EZWA 3VB9A 4XUQA 3TOJA 1BKZA 4CCEA 3WP4A 2DCTA 4P9YA 4RD7A 1AXZA 4AAXA 3MIBA 1STMA 3FHIB 5CFCC 3WUDA 5FO9B 5CG8A 2BGPA 3N9MA 2R32A 3NJZA 3WV6A 1TEIA 4HN1A 3ES1A 1RXGA 1WD4A 3JZVA 2A6WA 2AEYA 3U37A 4B3NA 4COUA 3NKTA 5A32B 2NMNA 4YVSA 3ST7A 1JU3A 2XWBB 4J1WA 5IFTA 4HL0A 3AZXA 4F7ZA 1PO23 5I8SA 1LODA 1RUG2 3AM2A 3N3HA 1QU0A 2UY8A 4WVMB 2I74A 4LO7A 2Y6LA 1W8NA 1V6MA 5CZKA 1H1MA 1X36A 2CAUA 1S2KA 1TE1B 1O91A 4A44A 2EAKA 2Q8EA 4Y5TA 4MXVA 4PI0A 3PUHA 3P3PA 1CAUB 4Y20A 2BUKA 4H7LA 2WNEA 3MBWA 3H3ZA 2YY1A 2ZEXA 2B9UA 3GGLA 4QKFA 4ARYA 1QXJA 4CUBA 4GXLA 2C4XA 3WOGA 2E51A 1YFXA 4XTMA 2XLAA 3PVEA 1QJFA 3E5XA 4QX7A 4OMDA 4Q0QA 5A1AA 5FZCA 1C3HA 1RVF3 1HN0A 4XZUG 4OYUA 1P8JA 3NV4A 4LUMA 2VH9A 1IPKA 3N9PA 1GICA 5GLZA 4NHKA 2DCYA 2F4LA 4XJAA 3BUCA 1UF2C 3S7EA 3D5OA 4CEWC 3T3YA 3LDKA 5JAXA 1K5JA 5DAWA 3S5QA 4QPGA 5DUUA 5E89A 5F1RA 4BQ1A 2D6LX 1W6OB 2VZ3A 2XPJA 2BW8A 1PIV3 2W87A 1T2XA 3C3VA 4FVVA 4XOGA 4ZXEA 1X8MA 4Y5Z0 4XAAA 1MR5A 1UZVA 2IFWA 4LTAA 5CVRA 5FPLA 2RDNA 4QM9A 4YG3A 4GWNA 3ZN6A 3A22A 2ET7A 4BOWA 4Q0PA 4UF0A 1HB1A 5E8AA 3WDYA 2XBO2 5J09A 1F4HA 5JI7A 4BB3A 2WR9A 3MW2A 5EHDA 1WA4A 2D44A 1U5ZA 2Z5WA 3USUB 1XNTA 2VJXA 3LGRA 4YFZA 3DXUA 3UKNA 1OQDA 1RMU2 3PL0A 1CESA 1S1AA 1XU2A 1U5IA 1RGSA 1VBE3 4OMCA 4TXWA 5DMYA 1NLSA 1SFPA 4M4PA 4NIDA 1EV11 2CL2A 4DUXA 1W2NA 2IC1A 1TZOA 1TME3 4IESA 1J84A 1LEMA 1VBB1 1VMFA 3P3NA 4DB5A 1OMIA 4UAPA 4BJ0A 1UOFA 4EN8B 1RUJ1 2DURA 3ILFA 4PQ9A 5FWEA 4E4SA 1AR93 1DGWX 1AYM2 2RDRA 3V56A 3V64A 4DY5A 5HV4A 1RUI2 1C1LA 4NRMA 1WW5A 1Q3EA 1LU1A 1HJFA 4XTPA 3T08A 3VBRB 4N7UA 2EXJA 1DQ6A 1UIKA 2A71A 2XVGA 3M4FA 4NUBA 1YI7A 4QX3A 5FYZA 3T4HB 4ES8A 2XWJB 4PCRA 1EAH3 1MZ5A 4XFFA 3ZXGA 3I2KA 1NX9A 4GB32 2EIGA 2XL7A 4PIXA 2DV9A 1DP0A 1DQ0A 1H1AA 3KGLA 3KV5A 3SCGA 4HANA 3MZHA 4BDVB 1XQNA 2Y6GA 4I3PA 5FYIA 4EWDA 5BNOB 1BXHA 1IS6A 1AL0G 2ARXA 2FCUA 4QQHA 5J37A 1GOHA 4Q4V1 1W9SA 1ZBA1 2QQOA 3I2GA 3R4SA 4FI9A 3S30A 1XB9A 4YWAA 4LULA 1O5UA 1W8HA 1WMFA 4JDNA 5LA2A 2Y38A 2CV6A 1R1A2 5LA9A 2WZEA 1LOEA 1OOPC 5FPAA 2PHXA 3IDCB 3NJXA 5FV3A 3TAYA 1ND3A 5IVJA 2FZ1A 3JBG2 4QMAA 1K5MA 2JKBA 1APNA 1GZTA 2JDUA 2VGDA 1QOTA 4ISRA 2JX9A 2RMU3 4XMIA 1YQ2A 1MQTC 5C8CA 1LGBA 1PK6C 4CCKA 4CDWA 2RS52 2AENA 1BHGA 5KWRA 1QY4A 2ZGKA 4NAMA 3SEEA 4RYDA 4LLFA 4OFGA 4BWOA 4DXSA 3N7JA 4FTBA 4QPIB 1CWPA 2VMGA 3KS7A 1YCIA 2P6HA 1G9DA 1XE8A 4YW7A 1VBA2 4CE8A 5FPZA 1NA1B 3RYPA 2JDYA 5JCTA 5FREA 3M3CA 5FZ0A 4LHLA 1UO9A 4PDWA 1BMV2 4NWWA 1KJRA 1YJKA 3ZFGA 1UMZA 2ZGPA 2AACA 3FC0A 4KGGA 2WNOA 4LBNA 5FMOL 2OIIA 4ZU7A 3WW3A 1WCSA 2JDMA 4CU9A 1W6PB 1MS0A 2W94A 5JI9A 3D82A 3PVNA 3Q8BA 4FTSA 4XW3A 1DQ4A 2C5DA 3WF4A 1A34A 3AFKA 3SQOA 2WSVA 2LS6A 1JZ4A 4JDMA 4Q4X1 4JQRA 4CCOA 3NWKA 2PQSA 4DNYA 4IV1A 1LGCA 4EWAA 4EYUA 4Z8BA 3GM8A 3A7QA 4GMP0 2BFUL 3HJRA 5L73A 2KR2A 4QXCA 1BBT2 3HQXA 4UT5A 2ZEYA 2WNVB 3H0OA 2QQNA 3OPWA 4BK4A 1C28A 2IVIB 3PVOA 2VUCA 2W9XA 3O14A 3CF6E 1U5XA 1NG0A 1TMF1 2QQMA 5DZFA 2ZZJA 1ND2C 3H42B 4KH9A 3NV2A 3JQXA 5C9AA 1ODNA 2DFCA 3MYXA 4EQVA 3M2MA 4Y26A 1IG3A 1ONAA 2W08A 4RA0A 1VBC2 2RR13 3SEPA 4E2GA 1QJY1 1ZZ7A 1G7YA 2PLV2 2GN7A 4QGMA 2YV8A 3OOXA 4BLIA 1CAWB 1GNZA 2Q1MA 3AZYA 3E97A 1HB3A 2FDHA 1GOGA 4Z1VA 4DY3A 2VOXA 5GZEA 1DDLA 2ZGNA 1Y9QA 2SBAA 4PJYA 3WDUA 1NY72 2ZAAA 4Y4RA 2VMHA 2R061 1PO12 4UFHA 5HCFA 4CCNA 5FWJA 2GNTA 1RB8G 1I5PA 5A3TA 1O3QA 4LO8A 4ZU5A 1OQ1A 2JDPA 2OVUA 2WAAA 4HKLA 2WN2A 4QX5A 4INDA 3GHMA 1B35A 1NAEA 1O8PA 5DUXA 4XUTA 3RYKA 1HV1A 2D5FA 3UL2A 3B9CA 3NW4A 4R8HA 5FZ9A 2N7GA 2EXIA 3VZNA 4Q0UA 2HWB1 1AVBA 1CJPA 4NPRA 4LO4B 3WF2A 1HN1A 2XJPA 3N7KA 2ORZA 2NP0A 5EJ1B 2A3YA 3LSEA 2JEMA 1KGYA 1TVGA 2UWBA 1GNYA 1MACA 1RUG3 4P9XA 2PHUA 5FDBA 5H9SA 2V4AA 3WY6A 3VKMA 3FMGA 2QVSB 1N1SA 3EHKA 5FMOS 3H50A 4Q4W1 3OYWB 4MH0E 4BU2A 3TWIA 1HRI1 2FHRA 3ZSEA 5FLHA 4CPBA 2VQ0A 3VZOA 1W03A 3PUSA 3WQ1A 1WW6A 2L9LA 5K8SA 3J4UH 1W0NA 5A33A 3GCWA 5DZGA 5HXVA 5EYXA 2DVGA 1S0FA 4J1XA 4YSFA 2XONA 3VDDA 1WW7A 1ULCA 4LIUA 1LHUA 4EN6B 1GQGA 2R041 1BVVA 5A80A 4MXWB 3V65A 2TUNA 4Q29A 4YGBA 4ASMB 2CNAA 1OLQA 1AYN2 2BVVA 4C8DA 4D6QA 5AC91 1MPXA 4N53B 5IAVA 1I1EA 5FKBA 1IKQA 1FPN2 3KF3A 4Y24A 1QMJA 1YRZA 1G9FA 1HX6A 5IT6A 3I2HA 1JZ3A 3WQ0A 2A6XA 5A3OA 5D1IA 3VBOB 1AUYA 3LEMA 3W5NA 5LWBA 5FBZA 4B4RA 4YVWB 2VG9A 5FZOA 3UESA 2WT2A 4L99A 5E1RA 2XJVA 4NN0A 5DDJ2 3S57A 2PELA 1JOJA 1CPNA 2WABA 3KF5A 4Y1UA 4RS5A 1CZVA 3T09A 3WCSA 2XBO3 4PI2A 4CTEA 3ZO0B 3B5LB 2GALA 4XFBA 2WO2A 4AFMA 3K3OA 1ULGA 3ETQA 1MZEA 1VB2A 1FOD1 2XB6C 3E5UA 3MUZ1 4JKMA 1Z78A 4XBLA 5J7MA 1QIQA 1QJX1 1GZCA 4CDQA 4QPWA 3VL8A 4Q1PA 2QE3A 1ZZ9A 4GWIA 2MPFA 5ISLA 2GMMA 2CAVA 5I0SA 4NWVA 3LFIA 4RHV1 5H9RA 3WF1A 1DGWA 1SBEA 4ZONA 5BNPB 1AYM3 3LA3A 4E9KA 2VECA 3VBRC 5FY0A 1RUI3 3VD4A 2ORXA 5CA6A 1H6YA 2RM22 4AEDC 1CD3G 2J1AA 3RGBA 4K1ZA 4NRQA 3RSJA 5T50A 3U1XA 3UJOA 1H0BA 4GZ9A 5JLVA 2PXJA 4KWUA 2HWE1 5ABJA 3JU9A 2E63A 5H9PA 3HMYA 2OPKA 4IEXA 3BTYA 3AZZA 5FZDA 5IK7A 4MO3M 2VAUA 3PUAA 4NHLA 4XPVA 2VQAA 5K0UB 1F31A 2W0XA 4S2GA 2JD9A 2OZJA 3NMBA 5FOJB 1GZWB 4HETA 5BNOC 4ASLA 2E7AA 2MEV3 2ERFA 3NRUA 4B29A 1KJLA 3N9LA 4W6WA 2OZ6A 5F2SA 3ZVXA 4FPGA 3PMEA 2EIBA 4QM8A 5A7PA 2O8QA 2OT7A 2QDNA 3ZXEA 5IK4A 3QACA 3U4XA 1OT5A 4XCAA 1J1LA 1JYIA 4GWJA 3SKJE 4G9SB 2PN5A 1AHSA 2X5IA 1R1A3 1YC61 1RUF2 1E5RA 2CYFA 4OHZA 2WNUA 3ABZA 5DG2A 5A7OA 4QU1A 3WXPA 4M0HA 2KXLA 1NT0A 3MV11 3IN9A 5A1FA 3JBG3 4HOOA 2QNKA 3SHRA 1UAIA 3ZKYA 3U14A 4AAPA 1AR61 3OJBA 1BCXA 3IPVA 1X33A 3A0NA 3VBSB 3WLUA 2RS53 4JDOA 4RN5A 4BHPA 2DU0A 2LUWA 4QPIC 2X53S 5C4WA 5A6ZA 3SMHA 3V0BA 1F15A 1VAMA 2C0ZA 2D97A 1FNZA 2A5ZA 2BNMA 2VW0A 3NNJA 4XXAA 1NA1C 3WP6A 3CL1A 3NNLA 3K3NA 1D2QA 4LLOA 1VBA3 5KC5A 4YG6A 4HVRA 5BNNA 3RZGA 2W2IA 3R05A 3DECA 3OGVA 1LU2A 1MS5A 4RFRB 1NCQB 2VZSA 4UWDA 2OYZA 4MGSA 4AQ6A 3C7FA 4XJZA 3ZFEA 1PGSA 3VKOA 1JZ6A 3TNQA 3O1SA 5EIYB 3JD72 4FOWA 3SH5A 3SCHA 1KRIA 2W91A 1DQ2A 5FXWA 2JG9B 1L7QA 3VBOA 4M0NA 3GXUA 2A6ZA 1QQP1 2BERA 5JPNB 1V0AA 3CKHA 2CU5A 5FMCA 3LIGA 4UYBA 1NXD1 2ZX0A 4LBKA 3KQ4B 1FV2A 2BDRA 2PHLA 3J7NA 3VD9A 3VBFB 1X7NA 4KU8A 4AVBA 4LK7A 4B4QA 1OPOA 2BV4A 2WNVC 3LDRA 5FZ1A 4CCMA 5IVFA 3R4UA 1BBT3 2B39A 1JOBA 4YM1A 3FBYA 5C6CA 4AHXA 4XQ4A 1O7FA 1S0GA 1Y9GA 5FO7B 2RS11 4UW6A 4DUWA 1GWMA 2ZTNA 4YW2A 3AJZA 1RUC1 4O9GA 3SISA 1L7RA 4ZZ8A 1U5YA 4LE3A 1Y3TA 2WZR1 1PZ8A 2WFF2 1EP0A 3MFCA 4O61A 1VBC3 3N9OA 1UMIA 2WBKA 2DCJA 1VRH2 2PLV3 1PIV2 5F3GA 1PMJX 3RZHA 3AKRA 3MF6A 4E4HA 4HSJA 4HK8A 5FUPA 2XJSA 1C5IA 1Y7BA 3ASIA 4P08A 5LK5A 1YXWA 4BCUA 2AH2A 5CNAA 4QXBA 5T52A 4M01A 3FJSA 1PO13 1KFXL 3LEIA 4XJ9A 2V09A 3LPGA 4QX1A 3UJQA 3TEXA 1RUOA 3POEA 4JC1A 4XURA 2E53A 3TB0A 5FYSA 4HBNA 3I3BA 1FAYA 3ME2A 1VBE2 2P1BA 5T54A 2GAUA 3EBRA 1XBFA 1YQ5A 1VRBA 4CUGA 3WCRA 1KS4A 1N47A 1LESA 1PGW1 5SV5A 4XF0A 3ZXJA 4BYYA 5IK5A 4GMP3 5A3NA 4XUOA 5C33A 3LQCA 5FQ0A 1GOFA 4XMAA 4LIVA 4YYOA 4OHWA 3ZYRA 1JI6A 2HYXA 4M3CB 5FZ8A 5IJRA 2VCBA 4DFSA 4RR3A 5FP9A 5FY1A 2C9AA 5L36A 3H8OA 2RS32 2D6PA 1UCXA 4AW7A 3K46A 3J7HA 3L9JT 2E7QA 3SXWA 3J7MA 1R1ZA 2C1FA 3ZXDA 1XYOA 4LKSA 4UI9L 3GJBA 3RMYA 4GH4A 3MPBA 2WYSA 3R0RA 1EV13 2Z42A 4ATFA 1SEFA 5TSWA 1VBB3 3OUIA 3THCA 5KHKA 3K2OA 4XF9A 3EO6A 4BQ2A 2UU8A 4WV8A 1UD1A 3PJQA 1L7LA 1NE6A 1DGLA 1UXXX 1VBD2 3MFAA 3PURA 4TZDA 2ZPXA 4WM8A 2XH6A 5FXXA 4R9AA 1AL22 1COV1 1QHDA 1S2EA 5D21A 2UYBA 2Y0OA 4N53C 1FYUA 3AX4A 1AYN3 2NM1A 5EWSA 1NCRA 1U0AA 2BJSA 2XGXA 2WWJA 1RUH1 2D6OX 4HPKA 4K9SA 2CDPA 5FZKA 3WNMA 1S55A 4E2SA 1W8FA 1FPN3 3AP5A 3NL1A 1JYNA 4RSUA 3WD5A 4LHSA 1D7PM 1NLQA 3I3QA 5CKNA 1V9U2 4MGIE 3O12A 1LENA 4YVWC 3WNPA 5JZGA 2B8MA 3AMMA 3I59A 4LHNA 4B4PA 5IK8A 1SQ4A 1HQWA 1TG7A 1H4GA 2G4IA 3CEWA 5DDJ3 1KITA 2GNDA 3GBWA 4LEJA 2OS2A 1W6NA 2WO1A 2BWAA 3LFMA 3IM0A 2QQVA 4HZFA 2WFPA 4TTGA 4IEQA 5IVVA 1R091 5FJKA 5F37A 3UGHA 2D3SA 4MOAA 5FCCA 3H8XA 4I02A 4FPEA 3AKSA 3KCYA 1JHJA 3CHXA 4IL7A 4QXKA 3WQBA 1PMIA 3J7LA 4DOUA 1WLDA 4KBBA 2HBUA 1CAXA 4HG6B 5D8AB 1J1TA 2VZVA 4FOVA 4AL9A 5B4NA 2JDNA 4P5YA 2VU9A 2WWSA 3GZEA 4QB1A 5BNPC 3O5SA 3R4DB 4RQPC 3RVHA 2V5DA 3BN6A 2J42A 4AEDB 2J1UA 2RM23 2DVBA 2JECA 4PHZA 4AI1A 1HXS1 1GR3A 2ZABA 2ZMKA 3OBZA 3O0VA 3W9AA 4CDXB 2D6KA 3FLPA 3UETA 2ZMNA 1O5LA 2HJIA 1W6QA 1ULPA 1JS9A 2H6CA 2HEYF 3RMXA 3VHNA 5K0UC 3ENRA 1R081 4OVEA 1XXNA 1DZTA 2YU2A 5HCAA 1DYOA 3I3EA 4LKDA 2E32A 2QQUA 5FLIA 3GHNA 2ZGUA 1KQRA 1YWKA 2BNNA 2W1UA 5GM0A 3VBUB 3KV4A 4W6YA 3HWJA 2F4PA 1UZYA 2XMLA 2PAKA 3NV3A 1L3JA 2X8KA 4YW1A 5FAXA 1WA6X 2F6BA 3QOPA 4ARXA 3WNXA 4DRVA 4XCBA 2R072 2VVFA 5GZCA 3O1TA 1DQ5A 1Z7S2 5I0TA 3AVRA 1RUF3 5F6KA 4K8FA 3OPZA 1W2TA 2VMEA 3E6CC 5FYBA 1QJU1 1UKGA 5KBFA 1FATA 4A42A 4XZPA 2G19A 4CP9A 1QH7A 5J1XA 1UPIA 4E4ZA 4LOSA 2QBXA 4Q27A 3VBSC 1J58A 4MVTA 4PLMA 5EV7A 1C57A 1LCLA 3NJYA 1QJY3 3KVBA 1UU4A 3OTFA 1N1VA 4FFGA 4C0HA 3WG1A 4IGPA 4BQ3A 2VBPA 1BEV1 3IDAA 1J3PA 4XEZA 3IB3A 4PBOA 1W3XA 1OLME 2ZX4A 1X9PA 3WHTA 1FMD1 1NCQC 1JZ2A 1F4AA 3HPNA 4WM7B 5JSPA 4AHYA 2WWUA 1SDDB 1JYCA 3OY8B 4EV0A 2XLFA 5BXXA 4BA6A 4FPKA 4DPNA 1ZZ8A 5CYYA 3RG0A 4FBFA 1OF4A 1W9FA 2ZGOA 4JGZA 3JD73 2JG9C 1LTEA 2A73B 2OUJA 4N9IA 3WG2A 5FZMA 3AXEA 4V1PA 4GA9A 1H8TB 3H3LA 4XAEA 3SITA 5FZAA 1QH6A 3WSOA 2NMOA 1MEC2 4AGVA 5IVBA 5GLWA 1W8TA 5IVCA 5HV0A 3VBFC 4OI4A 4Y3OA 1D2SA 4XJ8A 1WW4A 2QQKA 4BH9A 3FHQA 1D0HA 3B02A 1LHOA 2K9ZA 5E16A 3LZZA 5CADA 5EPAA 5LEKA 3JUUA 1SLCA 2ZGRA 4GULA 3IDBB 5ACA2 4Q26A 4AHZA 1D4M2 1UYYA 2VQUA 4YZ1A 4CVUA 2Y26A 3OG2A 5ERLA 5F7UA 1ZREA 1R64A 4W50A 3TBDA 3MO4A 1ZRCA 1U12A 3AZVA 4C91A 2H6BA 1SACA 1NOVA 4RR3B 4M3CE 2G9ZA 1JOPA 3NNFA 4XF4A 1X82A 3M3QA 2WFF3 1LULA 5FZ6A 1LHNA 1ZBE2 4AFCA 4WZCA 1RHI2 4PIYA 2R0HA 1VRH3 3AVSA 5CFDB 5JSOA 3NNMA 3LOBA 1JODA 5JOWA 2R30A 3ACIA 5DAXA 4F8AA 1I6XA 1C8M2 2R043 3AYEA 4EJRA 4LO5B 1OLRA 5DAQA 4YRDA 2RJKA 4KWKA 4QAWA 4AI3A 1LR5A 2QJVA 3N7MA 4PQQA 5I0DA 2XDVA 3JCIA 4MUVA 1VAKA 4YGEA 3BIEA 5D2AA 4KI5M 3B9IA 4M00A 3POIA 3ZFFB 1OH4A 1WCDJ 3E6DA 1O3RA 4L11A 1QOSA 2LW8A 1A8DA 2LROA 4N43C 3Q8CA 1WCUA 1O3SA 2LRPA 3BGAA 1IG0A 1US2A 4CP0A 2HWF1 1W28A 5LEJA 2ZKLA 3ZMOA 4IV3B 4CEYA 2P2KA 2W3JA 3F95A 3OD0A 4P5HA 1UW8A 2YB7A 4JTNA 1SBDA 2BRTA 4KNCA 2ETEA 1AJKA 3OD4A 4TLGA 1SPPB 1JZ7A 3QH7A 2B46X 5AFBA 1O4ZA 1ZX5A 3F2ZA 2HWD1 2NYYA 1QJZA 4Y1YA 2RS33 4GKYA 3V0AB 1POQA 1ACCA 3BOWA 1XNKA 4JX0A 4QKNA 1UOGA 3WW2A 1DLCA 3VBHA 4NHMA 1IS5A 3IAQA 2EXKA 2WUHA 2DTWA 4H55A 3DEMA 2OUHA 5A7QA 5L7OA 2FDJA 3ACHA 3CMGA 4LORA 3WW4A 3L2YA 3FWEA 2OPWA 4DO0A 1OURA 3CJIA 4Q4Y1 1VBD3 2MEV2 1O4TA 1W6MA 3POSA 3IMMA 5LA0A 1AL23 2G1MA 3IIAA 3NV1A 5GZFA 1N1YA 4BZ4A 1SCSA 2YBKA 3IZOA 1RUE2 3O1VA 5FMBA 4B7EA 1DZRA 3NAPB 2FMDA 1OFNA 5FZ4A 1V6JA 2RDSA 2LM3A 5F6LB 1E57A 1OD3A 2TEPA 2YFUA 1MVEA 1GSLA 3N7LA 5HCBA 2OKXA 1RXFA 2ZEZA 3ZR6A 1H9PA 2ARBA 1V9U3 3M7AA 4QHZA 1IZ3A 3TN91 3ROUA 1RJ8A 3WINE 2ZGQA 4LHKA 2VZOA 4XDQA 1XNCA 1SFNA 2QFEA 3WF3A 1OSGA 2DCKA 3LB9A 4U2AA 3VDBA 1J3QA 3KHBA 4Y1ZA 3JB4C 1YYNA 2VNVA 1WLCA 2WQ8A 1OKQA 1AR81 4Y1XA 2WLQA 1YJLA 3M1HA 4K6BA 4KWJA 3QBQA 3VD5A 1PGL2 4CDUA 1H9WA 3X29B 3WT3A 4CU7A 5BV6A 5FP4A 2J1VA 3PVBB 4CUAA 1RUD2 3H7JA 3I2FA 3IIIA 4EROA 3WP3A 2WS92 2Y6FA 2IXJA 3U11A 3K48A 4DRRA 4W8JA 2XVLA 5AVAA 3G7DA 3T0DA 2VQTA 5FJHA 2Y60A 2P3JA 3GZAA 5D8AC 5F5AA 3W21A 3AK0A 1WBFA 5A3PA 5JPMB 1DGRN 4RQPA 5LA1A 2JG8A 2NZ9A 1EPWA 5LZ6A 1AR71 4R4XA 2VE1A 3GDBA 2D40A 1YIPA 1WMDA 1O3TA 4WVZA 2WZPP 4CP9B 1ZRFA 4G3YC 2ZOEB 1YQ6A 5M0TA 2Q4SA 3AMNA 4FOYA 1ZRDA 4UOJA 1KEXA 2ZMLA 1BQPA 4CDXC 1G6NA 2RE9A 1W04A 2XJQA 3FHAA 2XHKA 2W52A 4I3GA 1GUIA 1DGRA 4MGZE 5LBBA 2RJ2A 3B69A 1PVC1 1HB2A 1QXPA 2HWC1 3PIJA 3WQ7A 3UT0A 1GFF2 4H3WA 2W47A 4YVSB 3VBUC 3ZIXA 1Q8VA 2DYCA 3DPRA 4L97A 3VGIA 1YO8A 4FXKB 1KXGA 1US3A 1JYVA 4FTEA 3S7IA 3BODA 2Q8CA 3BCWA 2D3PA 5A3MA 3IT8A 3USSA 2IVJA 5LY1A 3AP4A 3PUQA 2VW1A 2A6VA 1YQCA 2Q8OA 4NPLA 2DF7A 1YI9A 2R073 4Y20B 5FY4A 2RG4A 4AE2A 1DHKB 1K12A 1Z7S3 3IMNA 3K4DA 1ENXA 4JGYA 4FPLA 5F3CA 4P9WA 1ASJ1 1CAVA 2VZRA 5DG1A 1AF9A 4KL1A 1POV1 3TRSB 4AVAA 4N7IA 5LY2A 3AC0A 5CFCA 3BU7A 2F17A 4CA9A 5GZGA 3PHMA 4V2VA 2ZZQA 4HFSA 3CNAA 1RUC3 1XE7A 4BMBA 4XQWA 1AZDA 4ASKA 1W2UA 3QLQA 3A0KA 3LKJA 3AP9A 4LUKA 5A6QA 2I2SA 2VMCA 2VR4A 2B4KA 2JE9A 2VZQA 3DXTA 4ZPIA 4AWDA 1PM4A 1Q8PA 3N36A 4E4DX 4QPGB 1UZ0A 4AQ2A 1RINA 2IXIA 4WM7C 3MIGA 1QNYA 3OEAA 4HMZA 1ZA4A 3PLQA 4IEPA 4R52A 4YM2A 1HDKA 1K3IA 3RJ2X 1PO21 2BTVC 3UYJA 3ZN6B 1K42A 3MPPG 4UF0B 3H9AA 4NIHA 1NYWA 1RC6A 1H8TC 2VCMA 2WAOA 2D6NA 4BIFA 4XFCA 2TBVA 1H2LA 3VKNA 1EV12 1TQ5A 1MEC3 2BOJA 1A78A 3AL5A 1HQLA 4A3XA 1VBB2 2J1SA 2ES3A 2WT1A 4UFMA 5I0UA 1RUJ2 3ZYGA 2YFZA 3CBNA 4U36A 1LNSA 1GWLA 3B01A 4CYDA 1A3KA 2E26A 3WDWA 2XKOA 4CCCA 5A7SA 3OBTA 2BEOA 4JKLA 2P3IA 5FZEA 3GNEA 5GALA 3UKVA 5K7PA 5ACA3 4I2OA 5A7NA 3UK9A 1E5IA 1D4M3 1GANA 1RVF1 3OPTA 1S0JA 4LQRA 4CEWA 1KDMA 3AFGA 4QKDA 1EYBA 1JH5A 3GZUC 2A3WA 3H7YA 3ECQA 4QHOA 3O1MA 3ZYHA 2WIIB 3K4ZA 4MLOA 4OUMA 3AMHA 5FYMA 3G6JB 3W20A 5KXBA 1OUSA 3RWNA 4QXHA 5DPNA 1HLCA 1NLRA 4SLIA 5FP3A 2H0VA 5CFDC 5F5IA 1ZBE3 4KMQA 4BQ4A 4D6SA 1RHI3 2HKXA 3HVDA 2X10A 2P5BA 4QKBA 1GWKA 1Z0HA 2BZDA 2B42B 4W6XA 2EXHA 4FQZA 3TYJA 1C8M3 2CY6A 1JTZX 4Q4V2 4E2QA 1ZBA2 1V70A 3LWCA 3QD6A 4AG4A 3O1OA 3BVCA 4K1YA 4QX2A 4N43A 2V73A 2ZGSA 1E5HA 5LCWL 1VALA 1W8ZA 2D93A 3ZFFC 1PHMA 4A3ZA 4ZZ5A 1WKYA 4URAA 3DGTA 5EJ3A 2O0OA 4TSVA 4YW5A 5A7WA 4QT6A 4G4FA 4QWNA 4META 4IV3C 4ZU4A 1AX1A 1UOBA 5HBAA 1WMXA 4RGKA 1OHFA 2Q0AA 1TME1 2CTVA 2ATFA 4L92A 2VCAA 1BK0A 1JHNA 1W8OA 1WCQA 4KWLA 2VL4A 1SLIA 4AVCA 4D0QA 1UY3A 3ILRA 2BP6A 4O65A 1ND3B 4KGQA 4RGGA 2EVXA 4DXTA 4D94A 1GP6A 1AR91 1GP4A 1K5MB 3U4SA 1YIFA 2CSGA 2OXBA 3KCCA 1QXRA 3SC7X 5IATA 5C8CB 4XBQA 3H3UA 3VHPA 2EIEA 4CDWB 2BNOA 3LD8A 5EP9A 5HXMA 3VHOA 1POV0 4S2DA 1EAH1 4C1XA 4KG8A 2DCZA 2NN8A 4IEOA 4DS0A 4LT5A 4YARA 1N3PA 5F39A 4BE3A 2ZGTA 5FZIA 4MGQA 4PDWB 1G9CA 1D4VB 3ZFGB 1UYPA 4XBNA 4XC9A 4H7MA 1UU6A 3RI8A 4UFLA 4Q4X2 4RL7A 4I09A 1HRV1 4YZ5A 4MGYE 1UPSA 3NAPC 4W65A 3WHUA 1RUE3 3OEBA 1OOPA 4Z92B 2ZHMA 3VKFC 2JKXA 4EWEA 5FZFA 4WBBA 1UY0A 5F2WA 3BTAA 4IV1B 1AX2A 1W8WA 4JRLA 3J8F1 1NE4A 1MQTA 2GU9A 5L9VA 1E5SA 1PK6A 1EUUA 5FY8A 1GQPA 1TMF2 2WJSA 2Z69A 5FUIA 5FIXA 1ZZ6A 2RMU1 4AEKA 5L19A 2BBAA 4N9HA 5LK7B 3EQEA 4CXXA 5KXDA 1QJY2 5FR3A 2ADEA 1X50A 5CEHA 3DV8A 5T55A 3VN4A 5F5QA 3SCFA 4LKFA 4OLLA 3WDTA 1RL3A 5C9AB 1DYPA 1KS5A 1RUD3 4OZOA 5LRRA 1IOAA 1HW5A 2WS93 5J98B 1PNGA 4KQ7A 3T2OA 2VUJA 4IE7A 2ZA9A 1QNWA 4LBQA 3S6PA 5FOBB 3OUJA 1HB4A 2R062 5F3IA 5JZGB 2DUPA 3ILNA 2H0BA 3VZLA 1LOFC 2ZHNA 4LBQD 1Q8OA 1NZIA 1J83A 2JE8A 4YW6A 3VLBB 2DBNA 2BU9A 2YDEA 3I4IA 4D7TA 1BLZA 2HEVF 4A45A 1CGPA 2W5FA 2P4EA 1BEV3 1WZXA 2GDFA 4FPYA 2HWB2 2JB8A 3ZSLA 4DZGA 5LBCA 1JYTA 2ZX1A 4I0AA 1UZWA 4FQ4A 1CIWA 2C24A 5KR7A 1B35B 4ZKTB 3BPZA 1SDWA 5GLUA 3ORJA 3HD8B 4Y22A 1FMD3 1Y4WA 1YQ8A 3KD4A 1QEXA 3B7MA 1RIRA 1QWRA 2A1XA 1S2BA 1UIJA 5FRAA 4QQLA 5FUNA 2P37A 1MS3A 1ND2A 3RRDA 2IFRA 2WDBA 4YVSC 2FDGA 4Q4W2 4YNIA 1REDA 2EIDA 1HRI2 3FE5A 4PBPA 5FPVA 4Y4YA 5LBFA 4S2HA 4X6RB 4ES9A 1KFUL 4OI2A 1UNBA 3O0XA 4CXWA 4XUPA 2WZ8A 4KU7A 1ZRIA 3MI8A 2OA2A 5T3NA 4FPOB 5C5UA 2RR11 4DUVA 2DUQA 1QOOA 3T0BA 2VM9A 1LJ7A 2D5HA 1BVP1 1VR3A 1CN1A 2R042 4MSVA 2VBBA 4PF5A 4AI0A 1LECA 5A33B 4H2AA 3DF0A 2XLGA 5FYUA 5EYYA 3VDDB 4AEMA 2O8OA 4AF9A 5AC92 2QZ3A 3U0ZA 4MADA 5JUVA 4QX0A 4R9CA 4UW4A 2ZBJA 3T2TA 4A2UA 2SLIA 4JKKA 4NO4A 2JICA 5A3LA 1H2NA 1S0DA 4CU8A 3RPQA 4HONA 3ZDSA 3AJYA 4ET7A 2VTFA 5A32A 4L0PA 3E5QA 5I0RA 4AHWA 3HN1A 2IXCA 3H8RA 3O7OA 4DXZA 1SG3A 4QPGC 2W1SA 4LITA 3WF0A 2B45X 3LPFA 4WVMA 4FAHA 2RV9A 5DN2A 2GMPA 2VPVA 2JDAA 3D0JA 1CX1A 1H8VA 3I2JA 5FZOB 2KD7A 4P9JA 5JR2A 3VD7A 1LKNA 3T2QA 1VJ2A 1CAUA 2UWAA 3ZX7A 5L9RA 1RUG1 2DVAA 2UWCA 4QDQA 5KHGA 5CISA 1FOD2 2QKDA 2YBPA 2J1EA 3MIEA 2GNBA 4RS5B 4QDSA 2J7MA 3PIGA 3VKLA 4AVVA 4EN9B 2JE7A 1QJX2 2EICA 2ET1A 1O8SA 1A6CA 4AQSA 3VHRA 4YM3A 4GQ7A 2FDKA 4CCLA 2B7YA 2GC0A 3PJYA 4M3CF 1RUJ3 4RHV2 3FLRA 2P6CA 4QQPA 5C7GA 1JUIA 2WKKA 4QU2A 5JOYA 4CDQB 4B7KA 5HI0A 5KXEA 1PMHX 4XETA 1PVXA 3BU0A 4AI9A 4CRQA 2QCSB 3C7OA 1CONA 1XC6A 2OQ6A 3BI3A 2CDOA 3C7EA 1JBCA 2HWE2 2ZGMA 1W6OA 3IWZA 1UYZA 4BISA 2V4VA 4Y1VA 2BQPA 2YPDA 5C5TA 1BYHA 2FD8A 1VLNA 5KC6A 4P02B 5CIRA 4XIKA 2IWGB 1XPWA 5ABJB 5FYTA 1G86A 1F9KA 5FTTC 5APAA 3UKTA 3QCWA 1JXNA 1V00A 2X05A 2YC2A 2FCTA 3USUA 4LA3A 4Q4V3 4O7XA 1ZBA3 4A41A 4LBMA 1WLWA 3JQWA 5IWFA 1RUNA 4LJHA 2XBO1 2JB4A 4P9IA 4FPJA 3KHCA 3URFA 3CZJA 5LB6A 1SZBA 2WA4A 3N4MA 1VIWB 1XU1A 2Z2SB 3ZYPA 3AXDA 1OPMA 5GJ6A 5BNQA 2GMEA 3BYWA 3POYA 5DXDA 4W4ZA 1RMU1 3TN93 3J9SA 1OQEA 2XL9A 3ZXAC 2DVFA 2X5IB 2VOWA 4JVAA 5IAXA 3W58A 4Z2WA 2JWPA 3VBRA 1OI6A 3GZTB 3WX5A 1ND3C 1AR62 2CHHA 4AEJA 2WNUB 2ENRA 1DU3D 2RHPA 1O6UA 3WNLA 1SHWB 4AEDA 1K5MC 1W0OA 1HIXA 3DYPA 4M4RA 2YU1A 4YZ3A 3WEZA 1AYM1 2E6VA 4LBJA 1QJEA 2GSYA 3RZMA 3HT2A 3I8TA 5JVVA 1RUI1 2VW2A 5GKAC 4CDWC 5DZEA 1YFWA 3IPVB 4GJZA 2HLEA 4IQPA 4WVWA 4ATEA 4DQAA 5C4WB 3V0BB 4K40A 3ZPOA 3OGGA 3ZSJA 2VZTA 2YGMA 4HSLA 1DYKA 3HT1A 4H14A 3RI9A 5BNOA 4OCTA 2A75A 5JDBA 4R4ZA 2WA3A 5BYNA 4GB31 2I45A 4FPFA 4OI1A 2GH2A 4A7KA 5BNNB 4PDWC 5JXGA 1BK1A 1OVPA 2NQYA 3ZFGC 1O59A 1Y43B 2XJUA 1UX6A 3ZFEB 4YZ2A 2RVAA 1QQP2 4Q4X3 4XVHA 2PHWA 2QDRA 3WG3A 4Q8KA 1UL9A 5CBLA 3I49A 3PMSA 3NNGA 5CAZA 4E8CA 5IVYA 4YZ4A 3LA7A 1FV3A 3BPSA 5FY5A 4L8QA 5FZBA 4ZY9A 3HR9A 3THTA 1IKPA 4IV1C 1R1A1 2LALA 2QQIA 2DFBA 5G04L 1URXA 3FUOA 3VZMA 1K45A 1SLBA 3UV9A 1GMMA 4NROA 1KD7A 4O9EA 2RS12 4P14A 3L2HA 1TMF3
chains in the Genus database with same CATH topology
3JBG1 1ULDA 4QPIA 1RUC2 1I5ZA 1S0CA 4LBLA 2WZR2 1NA1A 1ZM1A 3CU7A 1DQ1A 2EF6A 2RS51 3PTYA 1C5HA 4COYA 3GALA 5C9AC 2K2SA 1ALYA 2ZAHA 1VBA1 3AZWA 2YXSA 3BIWE 1W6PA 1SLTA 3FX3A 1POV3 2GC2A 2R063 2BPA2 1BMV1 1B09A 2XUMA 1LOGA 3ZN4A 3SH4A 1ENRA 1CVNA 4BM8A 4JAAA 5JMCA 4LBOA 3MIFA 2BBVA 3WUCA 1ZRRA 2GH8A 4SBVA 5B2GB 2HWB3 2WNVA 1B35C 1PGW2 2EA7A 1GYKA 1Q43A 2W68A 3B3QE 4HKOA 4XE9A 5FPXA 1BBT1 3MLJA 4JCKA 2PQQA 2EALA 1V6IA 1MVQA 4Q4W3 1RTVA 1HRI3 3OF1A 5FQ0B 1CAWA 2DU1A 4HVOA 1JW6A 1F2NA 2I07B 4AXOA 3T1MA 1DZQA 1REFA 2AGSA 1EPZA 5BUVA 1VBC1 5K9YA 2VMIA 2PLV1 1WBLA 2P17A 4GH4B 1V6NA 2KA3A 4AYUA 3KSCA 1COV2 3H1WA 3VDDC 4FO9A 1NY71 1M06G 5AC93 1PO11 2DVDA 1RUH2 2LTNA 3LA2A 1QF3A 1IQAA 1H1IA 4WM8B 1CQ9A 1MZ6A 2ZCWA 5LRSA 2BFUS 5FO8B 3MDPA 2A7AA 3ACLA 3M3IA 4NVPA 1NCRB 4L9BA 1YUDA 1WUVA 4HPKB 3ES4A 4FP2A 3KMHA 1ULEA 3OCPA 4D7YA 4FPCA 1HKDA 2VNGA 4XF1A 2PTMA 3VV1A 3ZMNA 4GMP1 2YC0A 1ENQA 3OYWA 3I59B 2BGCA 1PZ9A 3HBZA 1R092 4OZXA 2AREA 4OI0A 2WLPA 2ILMA 4GWMA 4RS5C 5T5LA 1FOD3 1REEA 1W6NB 4AFDA 5T5PA 1H2KA 1QJX3 4MXWA 5BY5A 4CDQC 4RHV3 4N53A 3KM5A 3SH3A 3FFZA 2GNMA 1S0IA 1CAXB 2IXKA 1IGOA 3ATGA 3DL3A 3DN7A 4XFAA 1HXS2 4IEYA 1AYN1 4D3WA 2VVEA 1T6GC 2HWE3 3HIFA 3IBMA 1DBNA 4Z07A 4YVWA 1QGLA 1FPN1 1R082 4RGAA 2RJLA 3AKQA 5ABJC 3KB5A 3R6SA 3KZ4C 1W6QB 3K51A 1LB2A 2HYKA 4PLOA 5DDJ1 1DG6A 1HRV3 3FZ3A 2PAMA 2Y0IA 5AVPA 4XFIA 2A70A 4CP1A 4PLNA 4B8EA 3NSTA 4IETA 3MGUA 4KG0A 1N3QA 5KHHA 1Q5OA 1G9AA 3O0WA 1GKBA 3J8F3 1QJU2 4ZXKA 2X5IC 2DUOA 4I0BA 5BNPA 2CGPA 3BALA 2YROA 4EN7B 2WNUC 1AR63 4X8PA 4Z82A 2VXRA 3MLLA 2GC1A 3IKWA 4COVA 5JOZA 1J3RA 1BEV2 4Q8LA 2E9QA 4UBHA 3RS6A 1GBGA 2RM21 3E6BA 3U10A 5K0UA 5C4WC 1IHMA 1EY2A 1FMD2 1G8WA 3AP7A 2PYTA 2D43A 2UURA 1ENSA 1GZWA 4IEVA 4TWTA 5BNNC 2YMZA 1OFSA 3RJRA 2OW4A 5CU1A 1WLTA 1LGNA 2UY9A 1PZ7A 2XJRA 4HN0A 3KLSA 3ZFEC 1ZVFA 3N35A 1V6KA 4DINB 2WL1A 1QQP3 3LAGA 3SNMA 3RDIA 1YHFA 4JGZB 4GALA 1FXZA 3VBOC 3M8LA 3VZJA 2D7FA 5JIAA 4Q1RA 2FBEA 1RUF1 2ZJCA 4FXGB 3WP5A 4FSJA 3VBSA 5JIUA 3KCXA 5EFUA 2RS13 1GZ9A 3H8UA 4CP2A 4CZSA 4K3UA 5DUVA 2EAAA 2KM2A 2IXHA 2WZR3 4F3JA 4AI8A 4QQOA 3AYDA 3DUIA 4AVSA 4I0WB 1NCQA 5JR7B 2AR6A 4MZUA 4Q0VA 2VUAA 4XHBA 2G9FA 4FPHA 3LSDA 1FI2A 1OA3A 4FOQA 4LO6B 2PHFA 4BIOA 1F5JA 2JG9A 2VY0A 3POWA 3B00A 5GLVA 2YYOA 4ITCA 4L2NA 2XKPA 3CLPA 3FBMA 3KQRA 3JD71 2R6QA 3VBFA 5BPXA 2YGLA 2P34A 3BOPA 1ULFA 2HWF2 1HQNA 5I91A 4OUSA 3D4KA 2ZX3A 4OULA 3IDEA 1S0EA 1YFUA 4QGLA 4BMEA 1IS3A 4LA2A 5J36A 2D98A 4K21A 5CG9A 3I54A 2E7TA 2CWSA 2A3XA 4CEYB 2HWD2 4XXPA 2BYVE 1N1TA 4LR4A 4ORFA 2O1QA 3MW4A 1DLLA 1FT9A 2YZ4A 2P3KA 4AGRA 1VAVA 4JRAA 1H30A 4RR3C 2AZ5A 4NR1A 3ZSKA 2CGNA 1SLAA 5IUQA 4S2FA 2WFF1 2CGOA 2DTYA 4AGGA 4GH4C 5J96B 1PNFA 5C8WA 1VRH1 4HVQA 2VVDA 1PIV1 4Q4Y2 3VBHB 2TNFA 4FCAA 5EXOA 2YPJA 5L7OB 1COV3 1GV9A 5KHIA 3WW1A 1ZNPA 1Q56A 2D3RA 4I01A 3CJIB 4WM8C 4TLFA 1V6OA 2X29A 1RUH3 4F83A 1W6MB 2PAEA 1I9RA 1I3HA 3MIDA 1NCRC 5T5OA 3FLTA 1VP6A 3TN92 2CWMA 1LRHA 3KT7A 4QHBA 2WINB 1VBE1 3EJKA 2BWCA 3S0MA 3ALQA 3JB8A 1LOCA 3LCPA 3M70A 4K7JA 1FX5A 3M3EA 4M3CA 4YM0A 1C4RA 1UZZA 1AR82 1FNYA 2JDZA 2WQ4A 4YW4A 3MIHA 5AFEA 3GBGA 2VULA 1LOAA 3INAA 4R9BA 1R093 1UU5A 3GF6A 1NQDA 1BJQA 3LOIA 3NKGA 2RS31 4XJWA 3WR0A 1RMU3 4CDUB 2IXLA 4EN0A 4COWA 1PM7A 3HAGA 5KHJA 2Q5TA 4YW3A 4AVTA 2FQPA 1AR72 4X8NA 5GZDA 1SLLA 3TNPB 1UN1A 1VBD1 2XG3A 2VNOA 3KT4A 3M3OA 4P9LA 1AL21 4RQPB 1KDKA 4FAGA 2JG8B 3D6EA 1GLHA 1HXS3 5FLJA 4OHYA 1GQHA 3RNSA 2QQPA 1O4YA 1LEDA 1AX0A 2Q1ZB 4AQTA 5I8YA 1PVC2 1R083 1J59A 1N3OA 2HWC2 1V9U1 4GB33 1WD3A 3BB6A 4E27A 1OD5A 4LNVA 4JTOA 4XFHA 5F9TA 1QDCA 3ZXLA 2HEWF 2ZHLA 2JJ6A 2W39A 2XVKA 1JUHA 3DPRB 2GC3A 3KT1A 1D0GA 1NQJA 3ZN5A 4COZA 3J26N 1TNFA 4WZFA 5D8AA 3ZYIB 2WT0A 1ASJ2 1IS4A 2B5HA 1CR7A 1QJU3 2NLRA 3B93A 2JENA 4JGYB 2PHDA 1QKQA 4D7SA 1XRUA 4IEZA 1CAVB 1XNBA 2WQZC 2YUEA 2FZ2A 4CDXA 1YFYA 3D8CA 5CFCB 3AB0A 3PNAA 4QPYA 2MHFA 4N90A 3WVJA 3CJXA 1SFYA 3APBA 5I93A 3AYCA 2ZX2A 4LE4A 2PHTA 2Q30A 1F8VA 1YLLA 5JWPA 2DWRA 3VBUA 1CX4A 1PO22 3T1LA 4HLTA 2PFWA 3MICA 3FUQA 5E88A 3U07A 3WDVA 4BPZA 4IEWA 3ZSMA 1YNAA 3MLKA 4AK3A 4PIZA 1W0PA 2PHRA 3RQ0A 2ZGLA 1IPJA 2K0GA 4UW3A 4ISQA 4JGZC 2JXAA 4HT1T 1H2MA 3AP6A 1C1FA 4XHXA 2V5YA 2R071 1Z7S1 5I8TA 2D6MA 1WMEA 1RVF2 3AYAA 1OA4A 2ZS6B 3SLIA 1C8NA 4Q0SA 2AYHA 2YHJA 1MS9A 1VB4A 1SBFA 4MGKE 5SV8A 4C0BA 1H4HA 3ZYJB 4CEWB 1DFQA 2R0FA 4UW5A 1LOBA 3AKTA 3MW3A 4WM7A 1BZWA 4GKXA 4YGCA 1OA2A 3OY8A 4JV4A 1TNRA 2WSUA 4URTA 4AI2A 2A6YA 4XILA 4YG0A 3GBFA 4HK9A 2VNRA 4OHXA 3OBRA 2QZ2A 3FFQA 4IERA 3EXUA 1SMVA 4TYSA 1Q8SA 1H8TA 4YFWA 3I2DA 2R16A 1MS8A 3OGJA 1LHVA 2R1DA 4ONUA 4N43B 3A4UA 4I30A 1S0BA 1AXYA 2HWF3 1RITA 4WVVA 1MEC1 5JSRA 1TME2 4FT8A 1M4WA 3VL9A 5DUWA 1X8EA 2Z79A 2QUOA 3WDXA 4CEYC 1AR92 1CPMA 2HWD3 4UXAA 4K20A 3AMPA 5H9QA 3ZXKA 5ACA1 5FFOC 1D4M1 3I7DA 2ZACA 4XQDA 2VOKA 5CFDA 3H1MA 3RYRA 1EAH2 3H1YA 5CB7A 4P9GA 4C1WA 4C90A 2GN3A 1ZBE1 3VBHC 1RHI1 2AUYA 1A8MA 4Q4Y3 5L7OC 1GNHA 4MYEA 1ZYBA 1C8M1 1W39A 1MS1A 4XIOA 3ZFFA 1AXKA 1HRV2 2NPIA 4DMIA 3CJIC 2ZHKA 1UKRA 3Q9OA 1V6LA 1XYNA 4YLZA 4QGNA 3RZZA 1CJDA 5GLTA 4IV3A 5J3UA 1MZFA 3CO2A 1RJ7A 3AKPA 1DIWA 2IZWA 2JD4A 3J8F2 3NO8A 4A7ZA 1OOPB 2BVBA 4XYXA 3THPA 2XJTA 1XYPA 1DF0A 5J48A 2RMU2 4AFBA 1AR83 3V0AA 4A7YA 4BLJA 1MQTB 4RFT0 1F5FA 1PK6B 1HV0A 5C8CC 3WZ1A 4CDUC 4HKWA 3WG4A 1XNDA 1G9BA 4QQ2A 3DKWA 3NVCA 3AMQA 3KGZA 4AFAA 5T5JA 3ZIWA 1NXMA 4XF3A 4XFGA 4R9DA 4UBGA 4LBQB 1AR73 1AJOA 2MNGA 1MS4A 4QD2A 2WC2A 1NZCA 4YGDA 3NAPA 4D69A 2MEV1 5JOXA 2JG8C 2VOVA 3C2UA 1SCRA 3ZPYA 3D0SA 4IEUA 1RUE1 2R1BA 3ELNA 4MX3A 1ZZCA 4NOTA 4OHVA 1PVC3 1WGPA 2HWC3 3W59A 2R49A 4Q2FA 4Y22B 3GYDA 1QDOA 4IXLA 4MV2A 3ZXFA 5KXCA 1ND2B 4X6QB 1WCKA 2G9GA 1Q8QA 3DPRC 2RR12 1PGL1 2GZWA 3MF9A 3VUOA 4J6GA 1JN2P 4XJUA 1LHWA 4FP3A 4GIQA 1RUD1 3MEPA 2WS91 1LOFA 2UYAA 1ASJ3 1ZZBA 5JZGC 3B94A 2ZKNA 4JGYC 2FMYA 3QH6A 2PA7A 3VZKA 5EZWA 3TOJA 1BKZA 3WP4A 2DCTA 4P9YA 4RD7A 1AXZA 5CFCC 3MIBA 5FO9B 3FHIB 5CG8A 3WUDA 2R32A 3NJZA 3WV6A 1TEIA 4HN1A 3ES1A 1WD4A 3JZVA 2A6WA 4B3NA 4COUA 3NKTA 5A32B 2NMNA 4YVSA 3ST7A 2XWBB 4J1WA 4HL0A 3AZXA 4F7ZA 1PO23 5I8SA 1LODA 1RUG2 3AM2A 3N3HA 1QU0A 2UY8A 4WVMB 2I74A 4LO7A 1V6MA 1H1MA 1X36A 2CAUA 1S2KA 1TE1B 1O91A 2EAKA 4MXVA 3P3PA 1CAUB 4Y20A 2BUKA 4H7LA 2WNEA 3H3ZA 2YY1A 2B9UA 1QXJA 4GXLA 3WOGA 2E51A 1YFXA 4XTMA 2XLAA 3PVEA 3E5XA 4Q0QA 1C3HA 1RVF3 3NV4A 4LUMA 2VH9A 1IPKA 1GICA 5GLZA 4NHKA 2DCYA 4XJAA 1UF2C 3S7EA 3D5OA 4CEWC 5JAXA 4QPGA 5DUUA 5E89A 5F1RA 4BQ1A 2D6LX 1W6OB 2XPJA 2BW8A 1PIV3 3C3VA 4FVVA 4XOGA 1X8MA 4Y5Z0 1MR5A 2IFWA 4LTAA 5CVRA 4QM9A 4YG3A 3ZN6A 4GWNA 2ET7A 4BOWA 4Q0PA 5E8AA 3WDYA 2XBO2 5J09A 5JI7A 3MW2A 1WA4A 2D44A 1U5ZA 2Z5WA 3USUB 4YFZA 3LGRA 3UKNA 1OQDA 1RMU2 1CESA 1S1AA 1XU2A 1U5IA 1RGSA 1VBE3 1NLSA 1EV11 2CL2A 2IC1A 1TME3 4IESA 1VBB1 1LEMA 3P3NA 4DB5A 1OMIA 4EN8B 1RUJ1 2DURA 3ILFA 4PQ9A 4E4SA 1AR93 1DGWX 1AYM2 3V56A 3V64A 4DY5A 1RUI2 1C1LA 1WW5A 1Q3EA 1LU1A 3VBRB 4XTPA 4N7UA 2EXJA 1DQ6A 1UIKA 2A71A 2XVGA 3M4FA 4AEDB 1YI7A 4ES8A 2XWJB 4PCRA 1EAH3 1MZ5A 4XFFA 4GB32 2EIGA 2XL7A 4PIXA 2DV9A 1H1AA 1DQ0A 3KGLA 3SCGA 3MZHA 4HANA 1XQNA 4I3PA 4EWDA 5BNOB 1BXHA 1IS6A 1AL0G 2ARXA 5J37A 4QQHA 4Q4V1 1ZBA1 3R4SA 3S30A 4LULA 1O5UA 4JDNA 1WMFA 2Y38A 2CV6A 1R1A2 1LOEA 1OOPC 2PHXA 3IDCB 3TAYA 1ND3A 2FZ1A 3JBG2 4QMAA 1K5MA 2JKBA 1APNA 2VGDA 1QOTA 4ISRA 2JX9A 2RMU3 4XMIA 1MQTC 5C8CA 1LGBA 1PK6C 4CDWA 2RS52 2AENA 5KWRA 1QY4A 2ZGKA 4BWOA 4LLFA 4OFGA 3N7JA 4FTBA 4QPIB 2VMGA 3KS7A 1YCIA 1G9DA 1XE8A 1VBA2 5FPZA 1NA1B 3RYPA 5JCTA 5FREA 3M3CA 4LHLA 4PDWA 1BMV2 4NWWA 1KJRA 1YJKA 3ZFGA 1UMZA 2ZGPA 3FC0A 4KGGA 4LBNA 2OIIA 4ZU7A 3WW3A 1WCSA 1W6PB 1MS0A 5JI9A 3D82A 3PVNA 4FTSA 4XW3A 1DQ4A 2C5DA 3AFKA 2WSVA 4JDMA 4Q4X1 4JQRA 3NWKA 4DNYA