1S55A

Mouse rankl structure at 1.9a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
156
Chain Sequence
AQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor necrosis factor ligand superfamily member 11
publication title Murine RANKL Extra Cellular Domain Homotrimer Structure In Space Groups P212121 And H3 At 1.9 And 2.6 Respectively
rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 29
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s55A00
5KC6A 1TNRA 2HEVF 2QDNA 4J6GA 2JG8C 2TUNA 4DB5A 1IQAA 1KD7A 2WNVA 3URFA 2HEWF 2AZ5A 4QQLA 5KC5A 3B94A 4MXVA 3TWIA 1D2QA 4HT1T 2OIIA 2WNUB 3MI8A 1S55A 4DOUA 4MXWB 1C28A 3K48A 1XU2A 1KXGA 2O0OA 4E4DX 4RSUA 2JG8B 3ALQA 1OSGA 3AB0A 1XU1A 3IT8A 4OUSA 3WD5A 4MXWA 2JG9C 1TNFA 4QQHA 1U5ZA 1C3HA 1U5XA 2JG8A 1WCKA 3B9IA 2X29A 4D7YA 4TWTA 3K51A 4MSVA 2R32A 4QQPA 1I9RA 4G3YC 4QQOA 2JG9B 2R6QA 5L19A 5BNQA 2QE3A 2WNUA 2Z5WA 2Q1MA 3B93A 1O91A 1JH5A 1DU3D 2E7AA 1GR3A 4G4FA 4N90A 4OULA 2JG9A 4NN0A 1PK6C 5L36A 2R30A 3FC0A 3LKJA 2HEYF 3ME2A 4GIQA 4KGQA 1DG6A 4KG8A 3QD6A 5KWRA 2WNVB 1D4VB 1U5YA 1OQEA 3QBQA 4QQ2A 3V56A 5CIRA 1D0GA 4EN0A 2RE9A 2WNVC 4KGGA 4TSVA 1PK6B 1ALYA 3TYJA 2RJKA 2KA3A 1RJ7A 1A8MA 5HBAA 4E4SA 1JTZX 2TNFA 4OUMA 1PK6A 2RJLA 2Q8OA 4F3JA 1RJ8A 1OQDA 2WNUC 2ZPXA 4QPYA 3L9JT 2ZJCA 5TSWA
chains in the Genus database with same CATH superfamily
5KC6A 4L2NA 3E97A 4AZZA 5KXCA 2CDPA 3PIJA 5IVJA 2WFF3 5FKBA 4MHRA 1R082 4UWDA 2AH2A 4A6SA 4YG0A 4E4ZA 4CU7A 4FTEA 1R64A 4S2HA 3SH3A 1L3JA 4P9XA 1I5ZA 4QPIC 5FZDA 4CDXB 1XBFA 2EVXA 2EXKA 1AL22 4QQLA 3HVDA 4QDRA 1QJY3 5BNOA 1CWPA 3ST7A 3LEIA 1KGYA 3ENRA 5BPXA 1W6PA 3UJQA 3WHTA 2WZPP 1D0HA 4PQQA 1JZ8A 3FMGA 3UJOA 4Y24A 5LA0A 2Z4FA 3EXUA 3N9OA 5LB6A 3WEZA 2OQ6A 4E8CA 1G86A 1OOPB 4Z8BA 2R49A 5FPXA 5FYCA 3LA3A 1C57A 2OA2A 1ENSA 2QQLA 3C7FA 1D2SA 1YFXA 1XNBA 3AYEA 3DYOA 4WM8A 4YW5A 1DGLA 2DCZA 1XYNA 3B69A 2ZGMA 4UW5A 3VBUC 4EN9B 1YC61 1DLLA 2YPJA 1C8M3 1BXHA 2ZZQA 3ELNA 3KVAA 4XE9A 1YXWA 4Q0QA 4H3WA 2VMCA 2X8KA 1H2NA 3OG2A 5LASA 3POBA 4LK6A 4ISQA 3NV3A 4D7YA 2X09A 1UZWA 5DAVA 2QQPA 2B9UA 1HQLA 1F4HA 1X8EA 1RUG1 1ZBE1 3RI8A 4CDXA 4BE3A 4Q1RA 4BQ1A 2WO2A 1HQWA 1UOGA 4XURA 4Y22B 2QQWA 2CWMA 4Y33A 1RVF2 2D6PA 3GM8A 4BIOA 5KHGA 3L2HA 3TN91 4J1XA 2WLQA 3MW2A 1LAJA 4I0AA 4FPKA 4HVOA 3USUB 1OOPA 1UZZA 2J7MA 2Y0IA 3OSDA 2YZ4A 5J1XA 1PO11 1WBFA 5A6ZA 1SLLA 4LBQD 4BQ5A 1DZTA 1ULDA 3ZLIA 4AQ6A 5IFPA 4YLZA 2BGOA 4LIVA 4AI1A 4GJYA 4JVAA 3KWVA 2FCVA 1UD1A 3OPTA 2DVFA 3OGSA 5I8SA 3U11A 5C8CB 5HPOA 3T2QA 2RS33 2DU0A 4YRDA 5FY8A 5BNPC 2P3JA 4P02B 1PVC3 5JIAA 1PO23 2DURA 1LHVA 3POSA 2VUCA 1ZA4A 2O14A 4NR1A 3AZXA 4TN7A 1H8TC 1UYXA 5EJ1B 4ZY9A 1SEFA 1NXD1 1S1AA 2PHFA 3FWEA 2GH8A 1V6IA 2D6NA 3VGIA 1ZZ6A 5A3UA 5JZGB 4Y22A 1FMD3 4MYEA 1W0PA 1WMFA 1OLQA 2YPDA 4V2WA 1C1FA 2A6ZA 2E63A 5DZGA 1R1ZA 5FIXA 1JHJA 1UN1A 1BK1A 1W04A 2VCBA 3KCCA 4FPFA 4N53C 4E4HA 3W5MA 1KDMA 3ILFA 2UYBA 1NCQB 3OD0A 1WD4A 4DFSA 4TXWA 4UYBA 4KNCA 3USUA 4COUA 1JMUB 1BCXA 3QH6A 2OPWA 3BIWE 4M3CF 2JECA 3W9AA 2VD7A 2DF7A 1GQGA 1RL3A 3KM5A 3ACHA 2CYFA 1IS5A 4BQWA 1AR71 1EYBA 1KD7A 4GWNA 4URTA 5GZEA 2HYXA 1N1SA 2X5IA 4GB31 1DYPA 1Y43B 3T2OA 3TWIA 3BIEA 1CZVA 5LA1A 5BNNC 1LHUA 1ZBE2 1RUG2 3I54A 1OH3A 3ZYJB 4AVVA 2CL2A 1E57A 3I2JA 4BYYA 4Q4V1 5HI0A 3CQOA 1WGPA 3ZFFB 3K4AA 1T6GC 1Y9MA 4LBQA 3TN92 4A41A 2DUQA 4FFFA 1WW7A 4RSUA 5KXDA 3P6BA 2JE8A 3I2GA 2J42A 1GV9A 3WQBA 2FDHA 1XU1A 3IT8A 3M4FA 1SFNA 1XE7A 3MV11 1Y9QA 2Q30A 3WD5A 4N8MA 3MIEA 2W91A 1DQ4A 2GSYA 1PO12 5JXGA 1NCQA 4XJUA 1DQ5A 1KS4A 1UY2A 3V0AA 3ZO0B 4FBFA 1IS6A 3PNAA 2FDFA 2OZJA 4HKOA 1ZZ8A 4I0WB 4QHBA 3RFRA 2AUYA 3BKZA 4FOVA 2UU8A 4L92A 4XPVA 1MS9A 2QBXA 4MGQA 2HWD1 3PJYA 3Q8BA 2PHTA 5IUQA 1CAXB 1AJOA 1PM7A 5C3OA 4Y5SA 4NPRA 2A3XA 1LHNA 5A6XA 3DGTA 1KITA 5GLUA 2VY0A 4OFGA 1RUI3 3H50A 4C1WA 4CCMA 3H8XA 5FPBA 1E5HA 3PHMA 4LE4A 2Y6KA 1LENA 5CVRA 1GWLA 3T1MA 1FAYA 4LR4A 3FZ3A 4D69A 2QNKA 1W3XA 2BU9A 3AKRA 1H9PA 4JGZB 4IV1C 2JG9A 5FY4A 2H6BA 3ZSLA 1IHMA 4J25A 4A6OA 5F5AA 3ACIA 3OYWB 2GNMA 2VMHA 2BFUS 4NJ4A 4TLFA 3LKJA 5BV6A 5T52A 2Q1ZB 1MZEA 2ATFA 3I3DA 5CFDB 5FK7A 1JN2P 4AI2A 1LECA 1NYWA 1RYYA 2K9ZA 2QUOA 4E2GA 2EICA 2FQPA 4QX7A 5I0TA 3I2DA 2VAUA 2GALA 3WQ1A 1AR72 2OVUA 3VL8A 1F4AA 1NG0A 5F3CA 1YEWA 5IHRA 2IUWA 2QKDA 4GB32 3BTXA 3POEA 1CAXA 1FOD3 1VMFA 1K45A 2TBVA 4FOQA 2ZEWA 1SMVA 2D6KA 4X6RB 5I91A 2IZWA 3GXUA 4Q4V2 1A78A 4XDPA 4AQSA 3FBMA 4YZ1A 5KXEA 3I2HA 2R1DA 5FR3A 3AMMA 1XNDA 5DDJ1 2XL7A 3LDRA 4QM9A 3D6EA 3HAGA 5FZMA 4JGZA 3MLKA 4QGMA 3ASIA 5F1RA 1JYWA 1GOFA 3OYWA 4GMP0 2OS2A 5FUNA 2GDFA 3OBAA 3ES4A 1QH7A 1VAKA 2ZGOA 1FPN3 1WUVA 1AYN1 3AYDA 4NOTA 1O4ZA 2MPFA 2F4LA 3AKQA 3N35A 3FHAA 3H8RA 3I7DA 3QLQA 1F35A 1H2MA 3MHZA 3F2ZA 1S0IA 4SLIA 5DZEA 5FZFA 3N7MA 2XB6C 2HWD2 2WQ8A 3GF6A 1HB4A 1NY71 2H0BA 1D2QA 2RS13 3KV4A 5DAWA 1AYM1 4BWOA 1NUKA 3WLUA 3MI8A 3H3LA 4CUCA 1W0OA 1YIPA 4DNYA 2RDNA 5FQ0B 5IAVA 1ODMA 2FHRA 1LU2A 5CKNA 4XTMA 2AACA 4F7ZA 3HQUA 4GJZA 5HV4A 4M0NA 3G7DA 5DUXA 2YV8A 3GYDA 3IIIA 3KCYA 3OGJA 1W05A 1VBA3 3ORJA 2W47A 1J58A 1ENRA 2PHXA 1ZBA3 4K3UA 4YVWB 1VB2A 3RI9A 3RS6A 4CEYC 3VBFB 4R9AA 3A22A 1WW6A 4BQYA 3U4XA 2W0XA 2ZKNA 2OW4A 3BOWA 2NYYA 4R4ZA 2ARBA 1NOVA 1K5MC 2WZR3 2BNNA 5FZLA 3VHRA 3WHUA 5DAXA 1ASJ1 3RSJA 1Z0HA 4W50A 2GMPA 5IK4A 1JI6A 5D8AA 4CDWC 2ES3A 3NAPA 3NJVA 4FVVA 5A7WA 2ZX4A 4ONUA 4Y1ZA 2VMGA 3TOJA 2DU1A 4AGGA 4QQPA 4MADA 1GYKA 1KFUL 2PLV1 2LUWA 1DGWA 3T0BA 2HWE1 1IKPA 3Q8FA 4Y1YA 4RGAA 2WQZC 3B93A 1O91A 2Q8CA 3ZFGB 4Z92B 5FQ0A 3VD4A 4JHTA 4P9YA 3U14A 3VDCA 3OBZA 2D98A 3PUIA 2PHLA 4FFIA 4N90A 4YM1A 3CZJA 3I2FA 1CX1A 4QPWA 5FPLA 5I0SA 4FQ4A 3UKTA 5FKCA 3TEZA 3LSEA 4OYUA 1AXZA 1NE6A 2FZ2A 1CONA 1V0AA 3Q8CA 4N43B 3TRSB 1ZM1A 4QHZA 4D6RA 5JMCA 3E6BA 4IE6A 1ZZBA 3VBFA 2YGMA 4LBLA 4QGLA 3WNLA 4OHYA 2VMIA 1BBT1 3RZJA 1AYN2 2XKPA 1MS8A 1AVBA 3HMYA 1JHNA 1F9KA 1V6LA 2VBDA 4B29A 1H0BA 3AZZA 4FO9A 4DUXA 1R093 3WF4A 3IBMA 2ZS6B 3H3ZA 1PMHX 3NW4A 4HG6B 3V64A 1QXPA 3MICA 1NY72 5FJKA 4D0QA 2PHUA 4LEJA 1AYM2 1WCUA 4XTPA 1MACA 4COYA 2WDBA 1HXS1 1ND2B 3FFZA 4JCKA 3BCWA 3VUOA 1PK6A 2Y0OA 1RHI3 2V4VA 4FPOB 4GMP3 3ZFGA 3M2MA 3JQWA 1VRBA 4A7KA 4M4PA 5FXZA 3ZN4A 2CHHA 3K75B 1OQDA 4QPGA 4QPYA 2WAOA 2RS53 2MNGA 2UWAA 4EWEA 3POJA 3CKHA 1XQNA 2GN7A 3MUY1 4BQ4A 2Q0AA 3KS7A 3IM0A 4N43A 1SZBA 4XC9A 2YHJA 4DS0A 3KHCA 4CDUB 3JB4C 1X36A 1ASJ2 2DUOA 1GZTA 2XMLA 3PURA 3T08A 3OTFA 4ISRA 4MVTA 5LA9A 4CPBD 4EJRA 4I2OA 1QJFA 1OD3A 2W95A 2C9KA 3T1LA 1JU4A 1Q8QA 1O3TA 4XETA 2Q8EA 3NVCA 4NIHA 4YGCA 5E1RA 3GBFA 2WQ4A 4NAOA 2GC3A 3A0KA 1LGCA 1NCRC 2PLV2 4D8MA 2JJ6A 1BKZA 3VBHC 2VL4A 2HWE2 3O1PA 5JUVA 1MZFA 4C8DA 3AP5A 5LW9A 4I0BA 1FT9A 1LESA 4AWDA 4COWA 1ND2A 2JXAA 4C1XA 3QOPA 2YBKA 5C3SA 1S4CA 2ZGNA 4M3CE 3W21A 1ODNA 2W68A 1QEXA 3OY8A 1LR5A 4AHZA 3ZMNA 5FZAA 4A45A 4FAHA 4JGYC 1S0DA 1KRIA 2IXJA 4QKNA 1CPNA 4HL0A 4A3ZA 2B39A 3PL0A 1VALA 3WQ0A 1IS3A 1RGSA 3R05A 4QPIA 3PTYA 4H7MA 1BBT2 4UFKA 1YQ2A 2XXZA 2BGPA 3OCPA 2OYZA 4P9WA 3FJSA 2TEPA 1RUF3 4JX0A 4QMAA 4CDUA 2EXIA 1TG7A 5EZWA 5FZHA 2D44A 3FFQA 3ITQA 3OEBA 4YVSC 4JKKA 4LHSA 3WUCA 3JBG3 3O0XA 5FYMA 4B1LA 3H1WA 2J1SA 5IVCA 3KV9A 1HXS2 3VZNA 3GNEA 1K5JA 4XOGA 1OURA 1AHSA 2WSUA 5A3OA 2Y6LA 1NA1B 4YYOA 5LCWL 3J7LA 3HQRA 4O61A 2BV4A 5LWBA 2G19A 3HN1A 1EAH3 3EO6A 3EB7A 4LKEA 1Z7S1 3FHIB 5EJZB 5FBZA 5FP9A 1IQDC 1DIWA 2ZGLA 5HCBA 3MGUA 4NHLA 2WNEA 5GALA 4MGYE 3POIA 1VIWB 3KV5A 1E5IA 1XNKA 1OQEA 1MVEA 4OI0A 3O1SA 2VTFA 3LA7A 3V56A 2V72A 2XL9A 3N9QA 4HANA 1GZ9A 3SKJE 1DZQA 2RE9A 2UY9A 2Z69A 3CMGA 4XFIA 1N3PA 3ATGA 4K7JA 3ZFEC 4AVBA 1GMMA 2JDNA 3SC7X 3ZN6A 1WLDA 1GOHA 1U0AA 4TYSA 4GH4C 5DZFA 5DXDA 3QH7A 5HBAA 3IWZA 4N53B 3IPVB 4QX0A 4MG2A 3N7LA 3DKWA 5DAPA 1UYZA 4XF4A 5A7SA 4I3PA 1W90A 1LOEA 3A0NA 4QX5A 2Y8KA 1W2AX 4IEYA 4S2FA 1CAUB 2ENRA 1JYIA 4LBJA 3P3PA 3SEPA 3HNYM 3ZXEA 2R043 4Q0PA 2WNUC 1H2KA 4L0PA 2DFBA 3FLTA 5KHKA 1NA1A 2ZOEB 3ZKYA 2BOJA 4A2UA 5FLIA 1HV1A 1J84A 2WKKA 1H1AA 1HRV1 2A6YA 1XE8A 3E6DA 1WLWA 2IXLA 2VU9A 4KWKA 4PBOA 4Q4X3 5BNPA 2PQQA 5A7OA 3E1F1 3T2TA 4LUMA 4AI3A 4CDQB 5KC5A 2XJSA 4MX3A 1ZRDA 1H8TA 3FUOA 5FY0A 1NZIA 3VBRB 3EQEA 4FFGA 4UW6A 4XABA 3VZMA 3PVNA 1GQPA 1MEC1 3NNGA 4GAZA 3HBKA 1AR91 4MXWB 3OUJA 5A33B 1OKQA 4PT6A 1EPZA 1PNGA 2R063 5G05L 3V65A 2E7TA 5CG8A 4FAGA 3TAYA 4N53A 4IEWA 4WVMB 5LATA 2WFF1 4XFGA 3WNPA 1ZNPA 4COZA 3O1RA 2YBSA 4XYXA 1XXNA 4LK7A 4OUSA 4H55A 4UF0B 5LK5A 4MV2A 4NPLA 4YG3A 1Y7BA 1TNFA 4Y4RA 5F6LB 1GKBA 3MPBA 5FYTA 1F8VA 2HBTA 3WP6A 1U5XA 1Z7S2 5GLVA 3J26N 1QJY1 1EUUA 5FXXA 1S0FA 1POV0 2WT0A 4YGBA 1ULCA 4Q4Y3 1H6XA 2IFWA 1W6NB 3I97A 4KBBA 5T5PA 5KHHA 3X29B 3N7JA 1OF4A 1OBNA 1J59A 1JOBA 2ZX0A 4QB6A 4CEWC 2BQPA 2W3JA 3RYRA 3KF5A 5A3LA 1YNAA 3HN3A 1VBE3 3ZXFA 4JQRA 1YQCA 5IWFA 3OGGA 2VXRA 1SPPB 2D6LX 3H1MA 3WDXA 4UFJA 4EWAA 2YUEA 1O4YA 4HKLA 1I9RA 2R071 1N1VA 4P14A 4PIXA 3TEXA 4N7IA 4CDQA 5A1LA 1MS1A 3CZUA 3PUSA 4X6QB 4XF1A 5FYBA 3VD3A 3WCRA 4C0BA 5L19A 1XPWA 1REEA 2VMEA 5IVFA 3LGRA 4WM7B 1UQXA 1C8M1 2WA4A 4G4FA 5SV5A 3VHNA 1S0CA 4QU1A 5A1FA 5AC91 2PHDA 4BDVB 2CAUA 1GP5A 4NN0A 4WVMA 1HB3A 2Q1FA 3VD9A 3WNOA 4WVVA 4ZXEA 4A7ZA 2YROA 3DCQA 4BIFA 3VD7A 1RINA 5B4NA 2R7EB 3MBWA 1AXYA 1RMU3 2DVBA 3I4IA 4UF0A 5EFUA 4HLTA 3D82A 1XNAA 1OHFA 4AI0A 2WO1A 1H8VA 1QJX3 1DQ1A 2LROA 4XW3A 4FPJA 1HRV2 2OZ6A 2PYTA 2W1SA 5F6KA 1ZZ9A 1GP4A 3I3QA 4A7YA 1RUJ2 1ZX5A 2DCKA 3LF7A 4GWMA 4Z2WA 4PQ9A 5FWJA 1LOFA 3LDBA 5IATA 2VE1A 2X10A 1ULFA 3VDDC 1ZYBA 1SPPA 1NQDA 5FPVA 4Z82A 3WCSA 4CYDA 2ADDA 4O9GA 1MEC2 2CSGA 4XHXA 3RWKX 1AR92 4CTEA 3AFKA 4PF1A 3HT2A 3ZX7A 2BW8A 2CGPA 1F31A 2C6SA 1IG0A 4HFSA 2JDAA 3HEIA 4K40A 2GNDA 5F5CA 3PIGA 4WM7A 1C4RA 2I2SA 1ENXA 4AFAA 4ET7A 2WFF2 4K20A 1CQ9A 4B7KA 3M3QA 2QQMA 3MW4A 2G9ZA 1SFPA 2RS31 4IV3C 4IW3A 4KG0A 1S0BA 1PVC1 1V6OA 4ZU7A 2P5BA 4XBLA 2AEZA 1QKQA 1QJY2 3GZUC 4BXFA 5AVPA 4BJ0A 1W6PB 4TZDA 4DB5A 1RUOA 3HNMA 5I8TA 1G9BA 1JODA 2BWCA 4I09A 4AVAA 5K9YA 1VBD3 4LMFA 1XJAA 2LW8A 3AYCA 3ZYBA 4DY3A 3UK9A 3TB0A 1N3QA 1QOTA 1UOJA 3RJRA 2VNVA 2R072 4GULA 1QWRA 2WWJA 1RUD3 1OLRA 4LIUA 1G7YA 4IEXA 2Z2SB 2VZQA 1W8NA 2O0OA 3S30A 4CEYB 4QGNA 2XHKA 1C8M2 1GANA 2E32A 3AB0A 4YPJA 5AC92 4PDWC 3UYJA 1POV3 3LFIA 4L8QA 4LE3A 5B4XA 1PX4A 3D8CA 1UZYA 4R4XA 3UGHA 4CUBA 4M0HA 1DQ2A 3MF9A 4XUQA 1VE0A 3M7AA 1AL0G 2UY8A 1WD3A 2RVAA 5F2SA 1UX7A 4UFMA 4QKBA 4RD7A 2FDJA 3GBWA 4XJAA 3WDVA 4QX1A 1RITA 2C0ZA 4AK3A 1Q43A 3O12A 3ON7A 1DBNA 4EV0A 4LKDA 5C8WA 3BTZA 2ZHNA 2XH6A 3CNAA 3R4SA 2AR6A 1EP0A 1W6MA 1HX6A 1G9CA 3GBGA 4GA9A 4FXGB 1YJKA 1JYVA 1C1LA 1UOFA 2B7YA 3GCXA 4FT8A 2A3WA 4Q0UA 2XONA 1CR7A 1TME3 4ASKA 1BLZA 1UMZA 1UZVA 3E5QA 2LM3A 5ERLA 4XCAA 4ARYA 3BU0A 3T2PA 4CEYA 3VN4A 3SCFA 4DRRA 1SLCA 4KWUA 2F17A 1TEIA 5E88A 3WG4A 3WDTA 4EN7B 1O7FA 3LDKA 2RS32 2XKOA 3VDBA 3TNQA 3V0BB 1PVC2 4CU6A 4ES8A 2VQTA 5KWRA 4Q5OA 4CRQA 3MIHA 4CDWA 3KQRA 5JOYA 3WNMA 2D40A 1UPIA 3CIHA 4HK9A 3W20A 1PMIA 4K8RB 5EQUA 2QQNA 1D0GA 3CL1A 4F8AA 3B01A 1ACCA 5C9AB 1GNZA 2PAKA 3SH4A 3JU9A 1VMHA 3VHOA 1RIRA 4PF5A 3SH5A 5KBFA 5KXBA 4ZKTB 2WL1A 2Y26A 3ZVXA 5A3TA 4P9GA 2JDKA 2QQUA 2BVBA 2BPA2 2Q5TA 1SDDB 2Y64A 5LK7B 2E7QA 3S6PA 2JKXA 1ZA7A 2F6BA 5A3PA 5JAXA 1AL23 3AMPA 1GFF2 4DXSA 1SFYA 4M00A 3QACA 4CE8A 1LGBA 3IDBB 5JR2A 2DVGA 2VW1A 4A4AA 2OT7A 3HT1A 1X33A 2X5IB 1YJLA 2YGLA 2W1QA 3HQXA 1O3SA 4ASLA 2QDNA 4HETA 1NQJA 3ZYIB 2BBVA 4LBOA 3HR9A 4DRVA 3T0DA 1LODA 3B7MA 3V0BA 3KV6A 4HN1A 4RR3C 3ZXLA 3OOXA 1ENQA 5IK8A 4LBQB 5JI9A 3IDCB 3VBHB 2E9QA 4JQTA 4D6QA 3I8TA 4YW2A 2XPJA 5H9SA 1AR61 2BGCA 2BTVC 3CO2A 2OIIA 2UWCA 4PHZA 4YW3A 4UBHA 1UXZA 4HVQA 5E16A 5C9AA 3OJBA 2AREA 2DTWA 1HN1A 1DLCA 2ZEZA 3POGA 1N47A 2WAAA 3J7MA 1U5IA 4OI4A 4Q4W3 3LWCA 4E4DX 3V0AB 2VGDA 2WINB 2JE7A 2A1XA 4CP9B 1EV11 2ZX1A 1OPMA 2WWSA 3LAGA 1QF3A 4A3XA 2DUPA 1DP0A 4A44A 4BOWA 4DEVA 1LEMA 3WG1A 5FYHA 2KXLA 2XJPA 5DUWA 1U5ZA 1C3HA 1K42A 1RVF3 2FMDA 3K46A 5IYYA 3R6SA 4LKFA 3ACFA 1BEV1 2E31A 1XE0A 4H14A 4QB1A 5C71A 1QQP3 1JW6A 3M8LA 2RG4A 1CPMA 4Y5Z0 1W99A 4N9IA 3N9NA 4XXPA 2ZAHA 4KU8A 5F3EA 4NRPA 2DVAA 1YYNA 3NKTA 2ORXA 2AGSA 4SBVA 4RS5B 3T4HB 4LO6B 5FO7B 5DPNA 3WOGA 4QQOA 3VBHA 2JG9B 1VBA1 4OLLA 2RMU3 4CSWA 4RHV1 2OX0A 4YSFA 3MUZ1 1JZ5A 1RUH1 4W6WA 1GWKA 1O4TA 1W9TA 5JOXA 2EF6A 2XJVA 3LFMA 4DZGA 1YCIA 3EHKA 3MIBA 3GHNA 2EXHA 2VQAA 1UU6A 4RQPC 2WZR1 2QQOA 4BZ4A 1FNZA 3AC0A 4CP9A 2LRPA 4QX3A 5D21A 1QDOA 1CIYA 1QGLA 2MEV1 3D0JA 4DIQA 4D94A 3ME2A 2FCTA 4GIQA 5FZKA 5A6QA 3UESA 5A32B 1JUIA 5T3NA 3KGZA 1JU3A 4AEDC 3ZFEB 4V2VA 5GZDA 2WABA 2JDZA 5J98B 3O1UA 1H1MA 1QHDA 5CIRA 5C3RA 5F7UA 2K2SA 4FPHA 4KGGA 4TSVA 1KJLA 4YVSA 1LULA 3R4DB 3TYJA 1PX3A 3WX5A 4BMEA 5A3MA 1RJ7A 4JKMA 2HYKA 1AR62 1AX0A 1JYTA 4ZZ8A 5FYVA 4RS5A 3VKMA 1UOBA 4Y20B 4CCEA 4DQAA 3RDIA 2AYHA 3RPQA 3AKSA 3OF1A 1MZ6A 1CAWA 4JAAA 5ACA1 2ZBJA 3ZIXA 3N9MA 1LJ7A 1GWMA 5K7PA 4B4PA 2B8MA 3J8F3 1PZ7A 5FPUA 1EV12 4Q8LA 3SLIA 3CDZB 2XJQA 5CU1A 3U37A 1YFYA 1LOAA 1R091 3UKVA 3WV6A 1W8ZA 1AR81 1G6NA 4EQVA 5LEJA 2C9AA 4EROA 4XFCA 2EIDA 1NLSA 1D4M3 2JG8C 3MIGA 1JOJA 1W2NA 2YG0A 1BEV2 2Z42A 3GZEA 5A32A 4PJYA 3GJBA 2VNGA 2VCCA 3URFA 3ZFEA 1HDKA 3MFAA 2XLGA 3IDEA 4CXXA 4DUVA 3MFCA 1QJZA 4YZ2A 2PHRA 4WZCA 5DQ0A 4EYUA 1JYNA 5IK7A 4OQ9A 1X9TA 1LEDA 1WW5A 3NQHA 3AJZA 5I0RA 1UXXX 4OZOA 2C1FA 1PIV1 1VBA2 2KD7A 2XHNA 4XJ9A 3WNXA 4AFDA 1WMDA 4Q2FA 4RHV2 1PMJX 2ID4A 4G9SB 1RUH2 2NPIA 4X8NA 4Y20A 3MLLA 5FZ3A 1EUTA 2ZCWA 4RYDA 2ET1A 2O1QA 2ZGSA 3LPGA 4NE9A 4E2SA 2C24A 1YQ8A 1V6KA 3O5SA 4XUPA 4PLMA 4IGOA 3RQ0A 2WZR2 1WLTA 2WC2A 4RFRB 4AVCA 4PLOA 4NIIA 3LIGA 3N3HA 5D8AB 1TMF1 4K21A 1SDWA 1V70A 4QQHA 3NAPB 4CCJA 5A7WB 4CEWB 2MEV2 3KLSA 1DHKB 1WKYA 3ZM8A 1OA4A 5APAA 3USSA 5EWSA 2E33A 2JICA 2P3IA 2YB7A 4GZ9A 4HSJA 4XHBA 5GKAC 1EY2A 2P34A 5IK5A 3WDWA 1OPOA 1UYPA 5AFBA 5FOJB 3AP4A 4HBNA 3WP4A 4DPNA 3KT1A 2HWB3 4NVPA 5CADA 5GZGA 3J4UH 4P5YA 2YC2A 4D7SA 4LPLA 2ZGRA 3U10A 1AZDA 2WO7A 1VLNA 1GP6A 4HPKA 1DU3D 1ND3B 3LE0A 5FZBA 3GDBA 3W59A 3ZXKA 5BNOC 5IVBA 4FPGA 5CEHA 4BCUA 5ACA2 1QXJA 1J1TA 5M0TA 5L36A 1ZZCA 5ABJC 4DO0A 5HXMA 2VBPA 2XGXA 3CLPA 3AMQA 2DDUA 2A71A 1G9DA 3SMHA 3VBSC 3UT0A 4KGQA 1R092 4Q4V3 3QD6A 1H9WA 2EAAA 1AR82 4WM8C 4AI8A 4CEWA 3TBDA 4CP2A 1HIXA 1SQ4A 2JE9A 3CJIC 1JS9A 3JBG1 5L7OB 4JDNA 3QBQA 3LB9A 3I59B 2QFEA 3T3YA 5GZCA 1YQ6A 1SLAA 3IZOA 1VAMA 1PK6B 1UZ0A 4OHVA 3VLBB 5A80A 1AX2A 2EAKA 3JB8A 4IEVA 5FPZA 5J37A 4QPGB 1EAH1 4XDQA 5FV3A 5JXJA 3MZHA 1GNYA 1PIV2 4R9BA 4ZPIA 5DDJ2 1QU0A 4JKLA 3LIHA 4CDXC 1QIQA 4NUBA 4LXLA 4FPLA 2Q8OA 1ND3A 3SNMA 2HBUA 3O0VA 4F3JA 1VRH3 2P1BA 4AXOA 2HWD3 2XG3A 5FBJA 3AL5A 5F5IA 2B4KA 5C70A 1GICA 2J22A 2YC0A 1D4VB 3PTRB 5F2WA 3ZSMA 1OD5A 1TMF2 2HWF3 3DXUA 4LJHA 1X9PA 5IW0A 2GAUA 2IXIA 4J6GA 4AL9A 4NIGA 4YGDA 4S2GA 1V9U3 1O6UA 5FP4A 2ETEA 1T2XA 4YARA 2ARAA 1IG3A 2ZX2A 3OGVA 2FDIA 4H2AA 4R8HA 5L7OA 4XBNA 4LA2A 4I3GA 4PLNA 3VDDA 3AZVA 4ARXA 2D3RA 2V4AA 1OVPA 1J3QA 2ZGPA 3I59A 3O14A 3O1MA 5CG9A 3ZXDA 3AYAA 2R041 2WRAA 5FO9B 2VPVA 2W2IA 4UT5A 3OY8B 4JRAA 4Y1UA 1ZREA 3JD73 1XU2A 2DWRA 3DYPA 4IE0A 4A42A 3MYXA 1YIFA 4R9CA 2DCYA 2W1WA 1A34A 5I0DA 4LHNA 3VV1A 4AFMA 4NRMA 4ZONA 5GJ6A 3JXSA 4W65A 1UPSA 4Y26A 2YU1A 5E89A 4KU7A 4QPIB 2P3KA 4Q4X1 2Y34A 2XWBB 4IV3A 5LY1A 4AQTA 3KB5A 4ITCA 4LQRA 4Q1PA 5FMOL 5FZ4A 2SLIA 4INDA 3VZJA 2E53A 1A6CA 4RGGA 2GN3A 5FY9A 2WS93 4XZPA 3UKNA 5K0UC 3OEAA 4K1YA 5AVAA 5JLVA 4PI0A 1STMA 4QU2A 4I01A 3DEMA 2R061 5CBLA 1X7NA 3AMNA 3JBG2 3P1IA 4EZ4A 4YW1A 2K0GA 1UYYA 3HPNA 3K51A 4MGKE 4MGIE 5JDBA 2C4XA 2L9LA 1VPHA 4IQPA 1YFUA 2XQXA 3VBUB 2VNRA 4XMIA 4YM2A 1Q8PA 4O9EA 4XVHA 5IVYA 3ZR5A 2Z5WA 3S57A 5C8CC 4DY5A 1EAH2 3GALA 5FPAA 1H30A 2W5FA 2B5HA 1WA4A 3VBOC 4OMDA 2VNOA 2BNOA 2PQSA 3DF0A 3C7OA 4Q0SA 5CKMA 4IESA 4QAWA 2QCSB 4CCLA 1MS0A 3NMBA 1SLBA 2D5FA 2WT2A 2X53S 2VECA 4WBBA 4XF3A 4XFAA 3WINE 3O1OA 2PMWB 4K6BA 5JZGC 1AYM3 1GNHA 1W8UA 5FWEA 3M3IA 2C26A 2KM2A 3H9AA 4JDOA 4ZHNA 1Q8VA 3ZN6B 4EZHA 4LHLA 1JZ3A 2ZTNA 2ARXA 3FLRA 1UY4A 4LUKA 2JB4A 5BY5A 1LTEA 4GKYA 4QB2A 4QM8A 3BPZA 4AVSA 3WQ7A 3T09A 5AFEA 2R042 4CU8A 3VBUA 4W4ZA 5I0UA 2CDOA 5FLHA 3H0OA 4B4QA 2XWJB 1O3QA 1CGPA 1UAIA 2J1RA 3WDYA 3I2IA 4CPBA 3OPWA 2ZX3A 4JC1A 3RYKA 1F5FA 4IGPA 1PM4A 2BDRA 5F3GA 3AP6A 4CCOA 5C33A 3R4UA 5C6CA 3ZMOA 5BNPB 1VB4A 2ZGTA 3AM2A 4Q4X2 3DV8A 3MIFA 4AHXA 2ZJCA 5CKQA 1E5RA 5D1IA 5FZIA 5TSWA 1JOPA 2PLV3 2XVLA 3C3VA 3MIDA 4JTNA 3NRUA 4MZUA 4RR3B 3ZFFC 1NLQA 1V6JA 2HWE3 3POWA 1H8TB 1NAEA 1ONAA 1POQA 3QCWA 4NRQA 4XFBA 4AYUA 3E6CC 4FFHA 3ETPA 2B42B 3JCIA 4CUAA 3WZ1A 1HRI3 1UY0A 4NHKA 5FZ7A 4KQ7A 1OFSA 3WVJA 1RC6A 1CJPA 1XC6A 1G9AA 1H2LA 1W2UA 2PXJA 2YXSA 4LO5B 1HB1A 1IKQA 2VUJA 2VVEA 1UCXA 2HWC1 1WCQA 3WW2A 1CVNA 1HLCA 2J1UA 4F83A 4UBGA 2DVDA 2YMZA 1JZ2A 5L9RA 2AENA 1WW4A 2RM23 3C7HA 1BBT3 2XQRA 1W9WA 4FXKB 1WCDJ 3APBA 4IEQA 1AUYA 1HJFA 3WW1A 3HBZA 3ZPYA 3NJZA 3AVSA 3ZR6A 4UW3A 2BJSA 4CXWA 1W8TA 2IXCA 3CJXA 4FI9A 5FZGA 4BM8A 2V09A 1KS5A 2QQKA 2R0HA 3UL2A 1VBD1 1D7PM 1S0JA 3WR0A 5BNNB 4AFCA 4BA6A 2HH9A 3P3NA 1RUC1 3AXDA 4FP3A 4NWVA 1HJGA 1NE4A 2NN8A 2XBO3 3ZIWA 5ISLA 1REFA 1R1A3 3C7GA 4RR3A 5JPMB 1RTVA 4FP2A 4J1WA 4JGZC 3AXEA 2VR4A 5FFOC 2X29A 4YZ4A 5CZKA 1JBCA 3WF1A 1OT5A 2N7GA 3OBRA 4UAPA 4JDMA 4OCTA 5ANNA 4AQ2A 3O7OA 2DV9A 3OUHA 4TWTA 1X50A 4K9SA 1CX4A 5FJHA 3THCA 3U0ZA 2VOTA 2ZEYA 4Y1VA 3UGFA 1POV1 2NMOA 5CFDC 3AP7A 3MPPG 1LOCA 2VZ1A 5GLZA 4QKFA 5JSRA 3SHRA 4DEQA 2D97A 2GC1A 5FZ6A 4JTOA 3SITA 1TE1B 1WA6X 1QDCA 3I3EA 4XIOA 5C5UA 4PIYA 4FQZA 1FX5A 5I8YA 1OKOA 4HXCA 1BVVA 2ZEXA 2WT1A 2ZZJA 2WIIB 3S7EA 3AMHA 1L7LA 3EJKA 3N9LA 5FZ0A 1WLCA 3ZYHA 5FZOB 5GZFA 3EYPA 4AG4A 5HCAA 1AF9A 5JCTA 3LSDA 3WF2A 2ZXQA 5BNNA 3WF0A 3LA2A 3Q8AA 3ZYPA 1PVXA 3FX3A 4XFHA 1N3OA 1V6NA 3RVHA 4QHOA 2VBBA 1TME1 5CA6A 3B5LB 2P3YA 4IV1B 1E5SA 5F5QA 3R0RA 5FUPA 1OA2A 1CESA 3B02A 2ZAAA 3NNJA 5FXWA 3ZYRA 3AP9A 1AJKA 3CHXA 2HWC2 3NO8A 4P9JA 4XEZA 4NROA 3M3EA 1W9FA 3AKPA 2WA3A 4U36A 1S0GA 5HCHA 2IXKA 5HXVA 3P5BA 1Q56A 1JUHA 1K3IA 1MS5A 1YFWA 2VUDA 2NM1A 1QH6A 2ZGQA 5DN2A 2WUHA 1JZ6A 3I2OA 1RJ8A 1OH4A 3LCPA 2E51A 5FLJA 2E6VA 1TNRA 2D43A 4Q27A 1S2BA 1VBD2 1T6BX 4AEDA 3BYWA 3AVRA 1RUC2 3RJ2X 2JDPA 3D3AA 5FCCA 5FZOA 1UU5A 2D3PA 3RZLA 4E9KA 1UKGA 4LKSA 5FZCA 2VQUA 1LB2A 5J3UA 4HOOA 3RMXA 4YVWC 4ZS2A 2QJVA 5DUVA 1GBGA 1FV2A 4Y5TA 2NP0A 4HT1T 4P5HA 4HONA 3ZYGA 4LT5A 4QDQA 2CNAA 4IV1A 4YW7A 3LD8A 3I2KA 1RXGA 4URAA 4C0HA 1PHMA 4BXSV 1YLLA 1JYXA 2QQVA 2CV6A 1DCSA 5CYYA 5EP9A 1CD3G 2CAVA 2J1TA 4XILA 5FZ9A 2ZMLA 1H1IA 2GMEA 1NZCA 2VC9A 3AZWA 2QQJA 1PO21 1VBC3 1UKRA 1COV3 4OUEA 2QTWB 3WP5A 2OQ7A 1QNYA 3C8XA 1HV0A 4B3NA 3BN6A 2EXJA 2JG8A 5LBEA 1DQ6A 1W6MB 3MDPA 1FMD1 5LBCA 1CZSA 1VR3A 4AE2A 5KR7A 2W87A 1LNSA 1MZ5A 4FOWA 1RB8G 5IFTA 3PLQA 3SCHA 3U75A 1KJRA 1ZRFA 4Q4W1 3KSCA 2W52A 5T5JA 1TME2 2VXJA 3SCGA 4N43C 1K12A 4WVZA 1UY3A 3S7IA 3IAPA 4G3YC 3WG2A 4UI9L 3ZDSA 1RUE3 4ZXKA 1ULPA 1BMV1 1O5LA 1SLIA 1YI9A 3NV2A 4R52A 1CN1A 1XSQA 4I30A 1UIJA 5GLWA 2RR13 1J3PA 1JH5A 1VBB3 3UETA 4UW4A 4V1PA 1K5MB 5FYSA 4BHPA 4OULA 5DUUA 4AAXA 2JENA 4Z1VA 3H7JA 4CDWB 5FUIA 1RUJ3 1QQP1 2D3SA 1WMXA 3WP3A 4AW7A 1UW8A 5CAZA 2IFRA 2EIBA 1B35C 1DF0A 4C91A 1ND2C 1XSRA 1DG6A 4P00B 4PBPA 4CP0A 5FK8A 5FMDA 4LLOA 4QX2A 2Q8DA 2RMU1 5A7QA 1OA3A 4NAMA 4QQ2A 1UIKA 3VKFC 2OUJA 1W03A 4XJZA 5BYNA 3VD5A 5FYIA 2WNVC 4ZS3A 2DYCA 3D4KA 3GJAA 2CU5A 3NNMA 5IT6A 3N7KA 1UF2C 1DDLA 3IMNA 4AF9A 5FP7A 1QJU3 2VCAA 4FPEA 4WVWA 5FZ8A 4EN8B 3ZKUA 4QXHA 4QKDA 4CDUC 5CISA 2TNFA 4L99A 2A5ZA 5F37A 4XF0A 1GUIA 3SXWA 1ZRCA 2VOXA 4GWJA 4P9IA 3WG3A 5ABJA 1REDA 2JIJA 3N4MA 3N36A 1K5MA 1PGSA 4Y4YA 2Q4SA 3VKNA 2G4IA 3VBSA 1I1EA 1PO22 4Q29A 3PUHA 3DXTA 3BALA 4HN0A 1Q8SA 1RUI1 2R073 2R0FA 2V5YA 3BVCA 2Y6HA 3FUQA 4JV4A 4LTAA 3CJIA 4RA0A 2RDQA 1LKNA 4FOYA 3RZHA 5KHIA 1FMD2 4QDSA 3BI3A 4GQ7A 1C5HA 2WZEA 2A73B 4MGSA 3VB9A 5FMOS 5H9PA 5AC93 4K1ZA 2HEWF 3NV4A 3MEPA 2PA7A 2IC1A 2VZVA 1MS4A 2VVFA 3B94A 3IDAA 4MXVA 4Q4W2 1R083 3BOPA 5FDBA 2D5HA 3J8F1 1ULEA 4TLGA 3IKWA 3ZXJA 1BMV2 1BHGA 1OVSA 3M1HA 1L7QA 3KZ4C 1IS4A 2ERFA 4KBZA 1KXGA 1SLTA 3KF3A 3RG0A 4AI9A 1KEXA 2Y33A 3ETQA 1P8JA 1M4WA 3ALQA 4YGEA 2AC1A 4RL7A 1D4M1 3WUDA 4AEMA 2VW2A 1DGWX 4XXAA 1W0NA 5K0UB 1FOD1 1QQP2 2WWUA 1RXFA 3I3MA 2PHWA 1G8WA 5FMBA 3DPRC 1NCRB 1HKDA 5CNAA 2P6CA 3RZGA 2BUKA 3ILNA 4XAEA 4LLFA 1BVP1 1NA1C 2RMU2 2C5DA 1LOGA 1LRHA 2CY6A 2GNTA 2ILMA 4LBKA 3ZYFA 4GXLA 3WNNA 2BP6A 4AR2A 4UXAA 3WY6A 2ZACA 4IE7A 2YFZA 4XJ8A 3AZYA 4AVTA 2ADEA 2R6QA 2YYOA 3DL3A 3M70A 3VBOB 3WT3A 4JGYB 1FPN1 1H4GA 3PU8A 4E8DA 4Q8KA 1YWKA 4K8FA 1HW5A 1UNBA 5C7GA 5JMOA 1I5PA 1O3RA 3PDQA 5FXVA 5T5OA 3OUIA 3IIAA 3OPZA 5JPNB 5CB7A 4CU9A 3T4VA 2RS11 4MOAA 4ATFA 1H6YA 1Y4WA 4ATEA 1VJ2A 1OLMA 2WYSA 5FZ1A 3GGLA 3IB3A 2IWGB 1F15A 5K0UA 4U2AA 5LRRA 2ZHMA 3HNBM 2HWB1 3RZKA 1RUI2 4YVSB 1XB9A 5F39A 4E2QA 1MPXA 2ORZA 3VZLA 3LOBA 4CP1A 1NCRA 1U5YA 1GZCA 1SBFA 2XUEA 4XF9A 1S2EA 3Q9OA 4LA3A 5EHDA 3WXPA 4BPZA 2G1MA 5T54A 1JXNA 3VKLA 2VG9A 2YU2A 1ZBA1 1QNWA 2YC4A 1CAWB 2YFUA 1ALYA 2VOKA 3H42B 1OF3A 1Y3TA 4GWIA 4XDOA 5C4WC 1MVQA 2A7AA 4L11A 5EYYA 5IJRA 1BK0A 3J8F2 5C8CA 1BQPA 4NHXA 1RUNA 1W9YA 2B46X 2VZUA 4LHKA 3VBOA 4EN6B 4JGYA 4XJWA 4FPYA 2WYFA 3SISA 4FTSA 1ZVFA 4P9LA 5L73A 2JD9A 2EIEA 3AL6A 3DYMA 4CDQC 5K4LA 3LOIA 3WSOA 1D4M2 1MQTC 3VBRC 2ZPXA 2P37A 5JZGA 4O7XA 4ASMB 1UWWA 3WW4A 4AEJA 5JOWA 1FOD2 3CU7A 2BRTA 2YDEA 1GLHA 3THPA 4GH4B 5E8AA 3RZZA 3DKQA 2TUNA 1S0EA 1IQAA 3A23A 3AFGA 2RJ2A 3AX4A 3K77A 5FYYA 3KQ4B 4OMCA 4Y1XA 3OBTA 5FP3A 1L7RA 3GZAA 4AHYA 2HKXA 2BNMA 3J7NA 5C5TA 2VH9A 2H0VA 5FOBB 2WNUB 4IXLA 2CWSA 1VRH1 2PFWA 1C28A 1FPN2 4YW4A 3IN9A 1KFXL 3VZKA 3ZPOA 2JDUA 2A70A 2B45X 2HWF1 1LOFC 1ZBE3 1RUG3 3EBRA 3ILRA 4LULA 4IL7A 3PUAA 1HQNA 2XLFA 1V9U1 2VM9A 1JZ4A 4B1MA 5LRSA 3AJYA 4IDZA 4ZZ5A 3ZFFA 2GZWA 1I3HA 1TVGA 2RS12 3NJXA 4JHZA 3TN93 4BQXA 3RMYA 2GP3A 4WM7C 3AKTA 3B9IA 4W8JA 2HWB2 1FATA 3GCWA 4DXRA 4GH4A 1RHI1 4GMP1 4D3WA 1PO13 3JD71 4JRLA 4MH0E 1W8HA 4BISA 4M01A 3E5XA 4LO7A 4DMIA 1C5IA 4HPKB 4NMIA 4Q26A 2RS51 2AEYA 4BH9A 1O8SA 1ZBA2 4ORFA 4NO4A 4W6XA 4DINB 2ZKLA 3HJRA 4D7TA 1UMIA 1XNCA 4KWJA 1F2NA 2VQ0A 3RZMA 3K3NA 4XCBA 4ZU4A 1PGW1 2WNUA 4YM3A 3ZXAC 5CFCC 3A21A 2Q1MA 3J9SA 5FYZA 1QOSA 2D6MA 1APNA 2E7AA 4IERA 4CCCA 4DXZA 5L9VA 1V00A 2WS91 1US3A 4KMQA 1NLRA 2EIGA 4KI5M 5EV7A 2EALA 1FYUA 3FN9A 4LO4B 4YW6A 3MF6A 2A6XA 1O5UA 1AR63 1W2TA 1W2OA 2ZHKA 3FL7A 3HOBA 2QVSB 1OUSA 2P6HA 1GU3A 2DCTA 4DUWA 4GKXA 2XVKA 3PVEA 1VMJA 4Y3OA 3KGLA 4CUGA 2IVIB 1WWYA 4XIKA 3ZOIA 3BB6A 3B3QE 2D93A 3TEYA 1EV13 5CFDA 2W39A 1U12A 1N1TA 2GC2A 2KA3A 4QXCA 2PAMA 1FNYA 5E6HA 4YM0A 1VRH2 1JTZX 1AR73 5F9TA 3M3CA 3S5AA 3OB8A 3NNFA 1CJDA 3VZOA 1QXRA 4W6YA 4GB33 1BEV3 2GMMA 4XFFA 2HWF2 4GALA 2RJLA 3POFA 1RUF1 1US2A 2G9GA 1M06G 3WNKA 2DTYA 1SBDA 2CGNA 3T0AA 2P17A 4MUVA 1OQ1A 1V9U2 2ARCA 3L9JT 2XJTA 2Y6JA 2W1UA 2W9XA 1W3VA 3HD8B 5JSPA 1LU1A 3S0MA 3RNSA 4XUOA 2QDRA 1AX1A 2HEVF 4OHWA 3VDDB 1BYHA 2IXHA 1C8NA 4HK8A 1W06A 4RHV3 5A7PA 1RUH3 2D7FA 1PGL1 1RHI2 4BQ3A 2CTVA 3H3UA 4IE4A 3JD72 4HVRA 4LO8A 2W94A 5JR7B 4CXYA 1DGRA 2AZ5A 2VZ3A 3ES1A 2RS52 2NMNA 4OZXA 2I74A 4IE5A 2ZMKA 4MLOA 2O8OA 1MR5A 1S55A 2HLEA 2DFCA 3KCXA 2MEV3 4P08A 4IV3B 4YFWA 5FO8B 3K48A 5DABA 1W8OA 1PGW2 1AXKA 2VTXJ 2OKXA 1DGRN 2VZTA 4KH9A 3WF3A 2UURA 1DFQA 1XRUA 4XUNA 4CVUA 1LHWA 3RGBA 2WS92 4YZ5A 1N1YA 1W8WA 4Z2AA 1HRI1 1OOPC 4CZSA 4FPCA 4AFBA 1YO8A 2VZSA 2VJXA 2RDSA 3KT4A 5KHJA 3KMHA 2UWBA 3BGAA 4HSLA 2VZRA 2P2KA 3VL9A 5GLTA 3ZN5A 1NXMA 2WZ8A 2CGOA 1SCSA 1UL9A 5JI7A 4XBQA 4YVWA 3SEEA 3CEWA 4HKWA 5ACA3 1YRZA 4IEUA 5FMCA 3NNLA 2RM21 5EIYB 4PDWB 2R32A 1WBLA 3NKGA 4M4RA 4YG6A 1NT0A 3BTAA 3EMRA 5DG1A 2KR2A 3MW3A 2ZABA 3U78A 1SBEA 1Q5OA 1AR83 4LBNA 1WZXA 1SCRA 2NZ9A 2V73A 3ROUA 4BB3A 1NX9A 3ECQA 4LOTA 2VZPA 2XBO1 3DECA 1R1A1 2J1VA 1B35B 3C7EA 1RUF2 4LBMA 5H9QA 5C9AC 3BU7A 3DUIA 2OUHA 1DZRA 3RRDA 3D5OA 5FZEA 2Z79A 1W28A 5FY5A 4XQWA 4DXTA 2JDHA 3HIFA 1B09A 1PZ8A 2ZHLA 1PIV3 3GHMA 2X05A 4AOCA 4LORA 4XAAA 2WNVB 4XQ4A 5DDJ3 4HMZA 5JSOA 4I02A 4B4RA 4TTGA 5A70A 2WR9A 2XDVA 2HJIA 1PGL2 4MHUA 5EXOA 3PMEA 4EN0A 3ZXGA 5JXHA 4BLIA 3H1YA 4UFIA 2X5IC 1AYN3 2GC0A 3LEGA 1TMF3 2XUMA 3BPSA 4PDWA 2JB8A 1TZOA 1UX6A 2WN3A 4Q4Y1 4C90A 3INAA 3UNPA 2JWPA 4B8EA 2Y6FA 4OI2A 4EE2A 3H8OA 4UFLA 2VTXA 3ACLA 1G9FA 4CCDA 4NPMA 1OMIA 2K46A 1VBE1 2JEMA 3CBNA 2ZGKA 3WW3A 2NQYA 1KDKA 1B35A 4OI1A 1HRI2 4L9BA 1OI6A 5LBBA 5JWPA 4PI2A 3T30A 2VMFA 1NCQC 4PIZA 5DG2A 2BOIA 5J48A 1OXCA 1LHOA 1IPJA 2PELA 3GZTB 1W8FA 5T5LA 2WNVA 1X82A 3JUUA 2BYVE 2ZA9A 3IMMA 1VAVA 3F95A 3OGRA 3A4UA 2J1EA 1FI2A 3NJYA 2WN2A 2RM22 3O0WA 1XYPA 1RMU1 2FZ1A 2WSVA 4S2DA 4GD4A 4DOUA 3N9PA 1ASJ3 2UYAA 1QJX1 2XVGA 1WMEA 4WV8A 2BEOA 1OC1A 3LEMA 3PMSA 2FBEA 3LQCA 3DN7A 1ULOA 2Y6GA 4Q0VA 5DMYA 5BXXA 2VULA 5LEKA 1OSGA 2A75A 4QWNA 5T50A 5K8SA 1IPKA 2XBO2 5D2AA 3H7YA 3CF6E 1R1A2 4RS5C 2VVDA 3SQOA 3TNPB 2I45A 3DPRB 1ZZ7A 5IVVA 2JG9C 5F8PA 2VOVA 1CIWA 2BBAA 5JXIA 1YHFA 4AGVA 4BMBA 4PCRA 1W39A 2MHFA 4KL1A 2BERA 3B00A 1WCKA 2YBPA 3U1XA 2R062 3ZSKA 1SACA 2NLRA 4ZU5A 2P4EA 4B7EA 4LOSA 4WZFA 2V5DA 1ZRIA 5JVVA 1HN0A 2RDRA 5LA2A 2JDYA 4O65A 4YZ3A 4UFHA 2VO5A 2ZMNA 3PJQA 2VOWA 4MGTA 3G6JB 2PAEA 4NHYA 2QQIA 1ZRRA 3RWNA 4IEZA 1VBC1 4NHMA 2Y60A 5IAXA 3VKOA 1COV1 5JIUA 4NIDA 4FCAA 3BTYA 3FBYA 1UMHA 1SG3A 2ZGUA 4Q4Y2 5A3NA 1QOOA 4R9DA 2JX9A 3B9CA 1PZ9A 2XLAA 3PVOA 3ZSJA 1LOBA 4XUTA 1J3RA 1JZ7A 2R1BA 3JQXA 2LTNA 4OHZA 1VBE2 4UOJA 4XMAA 5IVEA 3MV01 2FDKA 2LS6A 1BJQA 2GNBA 2OXBA 1HXS3 3DPRA 1GOGA 1IGOA 1RUD1 2FD8A 1UU4A 4KG8A 5FYUA 1CAVB 4ES9A 3I49A 3PUQA 1VP6A 1RUE1 3ABZA 3NL1A 4META 1FXZA 2RHPA 5C4WB 2JKBA 4QXKA 3THDA 2E26A 2RR11 1VBB1 1CZTA 2SBAA 3K4ZA 3H8UA 1X8MA 5FY7A 2VMDA 4RQPB 2GH2A 3KVBA 2G9FA 3Q8EA 5LY2A 5L9BA 2WJSA 4M3CB 3BODA 2A3YA 1RMU2 1A8MA 2ET7A 2VZOA 1RUJ1 4L97A 4KWLA 2D6OX 4E4SA 5JOZA 2BWAA 1QJX2 3POYA 4COVA 2BFUL 2EA7A 1MQTB 4D6SA 1Y9GA 3SKVA 4MO3M 4RGKA 5FAXA 4XACA 4AEDB 4IETA 1IOAA 4YWAA 4IEPA 4N9HA 5C3PA 2LALA 3O1VA 3IPVA 3NWKA 5BUVA 3K3OA 1W6QB 1XNTA 2A6WA 2R16A 4NWWA 4AHWA 1SHWB 2OPKA 1Q8OA 1ULGA 3ZSEA 1IZ3A 2FCUA 1CAUA 1YQ5A 5I93A 4QXBA 1I6XA 5LBFA 1QJU1 2DBIA 1CAVA 1YI7A 4OQ8A 1Z78A 2JIGA 5H9RA 1OUXA 3VDAA 2GU9A 1MS3A 5DAQA 1WCSA 1PNFA 5C4WA 4FSJA 5D8AC 2XJUA 2VUAA 3WDUA 3NAPC 4CA9A 5FP8A 5FTTC 2XOMA 4RQPA 4MGZE 2WNOA 1J1LA 1XOYA 2FDGA 5HCFA 1VBC2 2WBKA 3IAQA 4M3CA 1COV2 2PTMA 5J36A 2W92A 4CCNA 3L2YA 5FRAA 1O59A 1QJEA 4AAPA 2JD4A 2JG8B 3UGGA 3VBRA 1MQTA 1QY4A 4RN5A 4BQ2A 4BK4A 2O8QA 1UY1A 1W6OB 4MXWA 5A33A 3VHPA 1A3KA 3TEWA 1A8DA 3LEKA 5G04L 1H4HA 4N7UA 4AGRA 2QZ3A 3ZDVA 1QMJA 1EPWA 1W6QA 4OHXA 1HB2A 1OFNA 1RUD2 3MLJA 1ND3C 5EJ3A 1R081 3S5QA 4RFT0 1DYOA 3PVBB 3D0SA 3LPFA 3VBFC 3THTA 1FV3A 1RUE2 2FMYA 2B9VA 3J7HA 5EYXA 3O1TA 4YFZA 1AL21 1Z7S3 4XZUG 2RR12 1VBB2 3K4DA 5FREA 5SV8A 3ACGA 4LITA 1BZWA 1V6MA 4MSVA 5GM0A 3U4SA 2J1AA 2RV9A 5CFCB 5J7MA 4QD2A 2PN5A 5C3QA 1W6NA 3K2OA 3KHBA 2VCMA 3NSTA 1LGNA 1IPSA 4QX8A 1W9SA 4AEKA 5BNQA 2QE3A 3OD4A 2DBNA 3FHQA 1URXA 4XQDA 5J09A 3M3OA 5L7OC 1YUDA 1DYKA 3A7QA 4EWDA 2DCJA 2QZ2A 1GR3A 5J96B 1GZWB 3U07A 5HV0A 4Z07A 1PK6C 3LZZA 5FY1A 4NIAA 3HWJA 3ZFGC 1UO9A 5A1AA 2R30A 3NV1A 3E5UA 5ANQA 1Q3EA 3FC0A 1XYOA 1W6OA 4QPGC 4QT6A 5T55A 3C2UA 2BVVA 1GQHA 2HEYF 2IVJA 3KD4A 1GSLA 2HWC3 4IEOA 4BU2A 4CCKA 2F4PA 2W08A 5LZ6A 1KQRA 2A6VA 3RYPA 1TQ5A 3FE5A 1OLME 1QJU2 3PU3A 4H7LA 1LCLA 5A3WA 2WFPA 2WO3A 5BNOB 4BLJA 4YNIA 3MO4A 5EPAA 1ST8A 2VW0A 2I07B 2YY1A 2XJRA 2Y38A 3AK0A 4HZFA 1HRV3 2WLPA 2RJKA 4LNVA 5ABJB 3BUCA 1RVF1 2W46A 5CFCA 5B2GB 2BZDA 2H6CA 3VBSB 3JZVA 4IGQA 1JYCA 1RUC3 3UV9A 4E27A 4BK5A 3W58A 3FLPA 1F5JA 4JZRA 4WM8B 5A7NA 4OUMA 3W5NA 2JDMA 1DQ0A 1NKGA 3CJIB 4IUGA 4X8PA 2XR4A 1S2KA 3I3BA 1GZWA 1J83A 1MEC3 1O8PA 5F32A 5A6YA 4FTBA 1AR93 2GP5A 3KT7A 4OVEA 5F3IA
chains in the Genus database with same CATH topology
5KC6A 4L2NA 3E97A 5KXCA 2WFF3 1R082 2AH2A 4YG0A 4E4ZA 4FTEA 4S2HA 3SH3A 1L3JA 4P9XA 1I5ZA 4QPIC 4CDXB 2EVXA 2EXKA 1AL22 4QQLA 1QJY3 5BNOA 3ST7A 3ENRA 5BPXA 1W6PA 3UJQA 3WHTA 2WZPP 1D0HA 3FMGA 3UJOA 4Y24A 3EXUA 4Z8BA 1G86A 1OOPB 5FPXA 2R49A 3LA3A 1C57A 2OA2A 1ENSA 4WM8A 1D2SA 1YFXA 1XNBA 3AYEA 4YW5A 1DGLA 2DCZA 1XYNA 3B69A 2ZGMA 4UW5A 3VBUC 4EN9B 1DLLA 2YPJA 1C8M3 1BXHA 2ZZQA 3ELNA 4XE9A 1YXWA 4Q0QA 4H3WA 2X8KA 1H2NA 4ISQA 3NV3A 4D7YA 2QQPA 2B9UA 1HQLA 1X8EA 1ZBE1 1RUG1 3RI8A 4CDXA 4BE3A 4Q1RA 4BQ1A 1HQWA 4Y22B 2CWMA 1RVF2 2D6PA 4BIOA 5KHGA 3L2HA 3TN91 4J1XA 2WLQA 3MW2A 4I0AA 4FPKA 4HVOA 3USUB 1OOPA 1UZZA 2Y0IA 2YZ4A 1PO11 1WBFA 1SLLA 4LBQD 1DZTA 1ULDA 4AQ6A 4YLZA 4AI1A 4JVAA 1UD1A 3U11A 2DVFA 5I8SA 5C8CB 2RS33 2DU0A 4YRDA 5BNPC 2P3JA 1PVC3 5JIAA 1PO23 2DURA 1LHVA 3POSA 1ZA4A 4NR1A 3AZXA 1H8TC 1SEFA 1NXD1 1S1AA 2PHFA 3FWEA 2GH8A 1V6IA 2D6NA 3VGIA 1ZZ6A 5JZGB 4Y22A 1FMD3 4MYEA 1W0PA 1WMFA 1OLQA 5DZGA 1C1FA 2A6ZA 2E63A 1R1ZA 1UN1A 1BK1A 4N53C 3KCCA 4FPFA 1KDMA 3ILFA 2UYBA 1NCQB 3OD0A 1WD4A 4DFSA 3USUA 4KNCA 4COUA 1BCXA 3QH6A 4M3CF 3BIWE 2JECA 3W9AA 2DF7A 1GQGA 1RL3A 3KM5A 2CYFA 1IS5A 1AR71 1EYBA 1KD7A 4GWNA 4URTA 5GZEA 1N1SA 2X5IA 4GB31 1DYPA 1Y43B 3TWIA 5BNNC 1LHUA 1ZBE2 1RUG2 3I54A 3ZYJB 4AVVA 4BYYA 2CL2A 1E57A 4Q4V1 5HI0A 1WGPA 3ZFFB 1T6GC 4LBQA 3TN92 2DUQA 1WW7A 4RSUA 5KXDA 1GV9A 1XU1A 3IT8A 3M4FA 1SFNA 1XE7A 1Y9QA 2Q30A 3WD5A 3MIEA 1DQ4A 2GSYA 1PO12 1NCQA 4XJUA 1DQ5A 1KS4A 3V0AA 3ZO0B 4FBFA 1IS6A 3PNAA 2OZJA 4HKOA 1ZZ8A 4I0WB 4QHBA 2AUYA 4FOVA 2UU8A 4L92A 4XPVA 1MS9A 2HWD1 3PJYA 2PHTA 5IUQA 1CAXB 1AJOA 1PM7A 4NPRA 2A3XA 1LHNA 3DGTA 1KITA 5GLUA 2VY0A 4OFGA 1RUI3 3H50A 4C1WA 3PHMA 4LE4A 1LENA 5CVRA 3T1MA 1FAYA 4LR4A 3FZ3A 4D69A 2QNKA 3AKRA 1H9PA 4JGZB 4IV1C 2JG9A 3ZSLA 2H6BA 1IHMA 3OYWB 2GNMA 2VMHA 2BFUS 4TLFA 3LKJA 5BV6A 5T52A 2Q1ZB 1MZEA 2ATFA 5CFDB 1JN2P 4AI2A 1LECA 1NYWA 2K9ZA 2QUOA 4E2GA 2FQPA 5I0TA 3I2DA 2GALA 3WQ1A 1AR72 2OVUA 3VL8A 1NG0A 2QKDA 4GB32 1CAXA 1FOD3 2TBVA 4FOQA 1SMVA 2D6KA 4X6RB 5I91A 2IZWA 4Q4V2 1A78A 4AQSA 3FBMA 4YZ1A 5KXEA 2R1DA 3AMMA 1XNDA 5DDJ1 2XL7A 4QM9A 3D6EA 3HAGA 4JGZA 3MLKA 4QGMA 3ASIA 5F1RA 3OYWA 4GMP0 2GDFA 3ES4A 1QH7A 1VAKA 2ZGOA 1FPN3 1WUVA 1AYN1 3AYDA 4NOTA 1O4ZA 2MPFA 3AKQA 3N35A 3I7DA 3QLQA 4SLIA 1H2MA 1S0IA 5DZEA 3N7MA 2XB6C 2HWD2 3GF6A 1NY71 2H0BA 1D2QA 2RS13 4BWOA 1AYM1 3WLUA 3MI8A 1W0OA 1YIPA 4DNYA 5FQ0B 2FHRA 1LU2A 4XTMA 4F7ZA 4M0NA 3G7DA 5DUXA 2YV8A 3GYDA 3KCYA 3OGJA 1VBA3 1J58A 1ENRA 2PHXA 1ZBA3 4K3UA 4YVWB 1VB2A 3RI9A 3RS6A 4CEYC 3VBFB 4R9AA 1WW6A 3U4XA 2W0XA 2ZKNA 2OW4A 3BOWA 2NYYA 4R4ZA 2ARBA 1NOVA 1K5MC 2WZR3 2BNNA 3VHRA 3WHUA 1ASJ1 3RSJA 1Z0HA 2GMPA 5IK4A 5D8AA 4CDWC 2ES3A 3NAPA 4FVVA 2ZX4A 4ONUA 4Y1ZA 2VMGA 3TOJA 2DU1A 4AGGA 4QQPA 1GYKA 1KFUL 2PLV1 2LUWA 1DGWA 2HWE1 1IKPA 4Y1YA 4RGAA 2WQZC 3B93A 1O91A 3ZFGB 4Z92B 5FQ0A 4P9YA 2D98A 2PHLA 4N90A 4YM1A 5I0SA 4FQ4A 3UKTA 3LSEA 1AXZA 1NE6A 2FZ2A 1CONA 4N43B 3TRSB 1ZM1A 5JMCA 3E6BA 3VBFA 1ZZBA 2YGMA 4LBLA 4QGLA 4OHYA 2VMIA 1BBT1 1AYN2 2XKPA 1MS8A 1AVBA 3HMYA 1JHNA 1F9KA 1V6LA 4B29A 1H0BA 3AZZA 4FO9A 1R093 3IBMA 2ZS6B 3H3ZA 3NW4A 3V64A 1QXPA 3MICA 1NY72 2PHUA 4LEJA 1AYM2 4XTPA 1MACA 4COYA 1HXS1 1ND2B 3FFZA 4JCKA 3BCWA 3VUOA 1PK6A 2Y0OA 1RHI3 4FPOB 4GMP3 3ZFGA 3M2MA 3JQWA 4A7KA 3ZN4A 1OQDA 4QPGA 4QPYA 2RS53 2MNGA 2UWAA 4EWEA 1XQNA 2GN7A 2Q0AA 3KS7A 3IM0A 4N43A 2YHJA 4DS0A 4CDUB 3JB4C 1X36A 1ASJ2 2DUOA 3OTFA 4ISRA 4MVTA 4EJRA 4I2OA 3T1LA 1Q8QA 1O3TA 4XETA 3NVCA 4YGCA 5E1RA 3GBFA 2WQ4A 2GC3A 3A0KA 1LGCA 1NCRC 2PLV2 2JJ6A 1BKZA 3VBHC 2HWE2 1MZFA 3AP5A 4I0BA 1FT9A 1LESA 4AWDA 4COWA 1ND2A 2JXAA 4C1XA 3QOPA 2ZGNA 4M3CE 2W68A 3OY8A 1LR5A 4AHZA 3ZMNA 4FAHA 4JGYC 1S0DA 1KRIA 2IXJA 1CPNA 4HL0A 2B39A 1VALA 3WQ0A 1IS3A 1RGSA 3R05A 4QPIA 3PTYA 4H7MA 1BBT2 3OCPA 2OYZA 4P9WA 3FJSA 2TEPA 1RUF3 4QMAA 4CDUA 2EXIA 5EZWA 2D44A 3FFQA 4YVSC 3WUCA 3JBG3 3O0XA 3H1WA 1HXS2 3VZNA 3GNEA 4XOGA 1AHSA 2WSUA 1NA1B 4YYOA 3HN1A 1EAH3 3EO6A 1Z7S1 3FHIB 5FBZA 1DIWA 2ZGLA 5HCBA 3MGUA 4NHLA 2WNEA 5GALA 4MGYE 1VIWB 4OI0A 1OQEA 1XNKA 1MVEA 3LA7A 3V56A 2XL9A 4HANA 1GZ9A 1DZQA 2RE9A 2UY9A 2Z69A 4XFIA 4AVBA 1N3PA 3ATGA 4K7JA 3ZFEC 3ZN6A 1WLDA 1U0AA 4TYSA 4GH4C 5DZFA 5DXDA 3QH7A 5HBAA 3IWZA 4N53B 3IPVB 3N7LA 3DKWA 4XF4A 4I3PA 4QX5A 1LOEA 3A0NA 1JYIA 4IEYA 4S2FA 1CAUB 2ENRA 4LBJA 3P3PA 3ZXEA 2R043 4Q0PA 2WNUC 1H2KA 2DFBA 3FLTA 5KHKA 1NA1A 2ZOEB 4A2UA 5FLIA 1HV1A 2WKKA 1H1AA 1HRV1 2A6YA 1XE8A 3E6DA 1WLWA 2IXLA 2VU9A 4KWKA 4PBOA 4Q4X3 5BNPA 2PQQA 3T2TA 4LUMA 4AI3A 4CDQB 5KC5A 2XJSA 4MX3A 1ZRDA 1H8TA 3FUOA 3VBRB 3EQEA 4UW6A 3VZMA 3PVNA 1MEC1 1AR91 4MXWB 5A33B 1OKQA 1EPZA 1PNGA 2R063 5CG8A 3V65A 2E7TA 4FAGA 3TAYA 4N53A 4IEWA 4WVMB 2WFF1 4XFGA 1ZNPA 4COZA 4XYXA 1XXNA 4OUSA 4H55A 5LK5A 4MV2A 4YG3A 1Y7BA 1TNFA 5F6LB 1F8VA 1GKBA 3MPBA 3WP6A 1U5XA 1Z7S2 5GLVA 3J26N 1QJY1 1S0FA 1POV0 2WT0A 4YGBA 1ULCA 4Q4Y3 2IFWA 4KBBA 1W6NB 5T5PA 3X29B 5KHHA 3N7JA 1J59A 2ZX0A 4CEWC 2BQPA 3RYRA 5A3LA 1YNAA 1VBE3 3ZXFA 4JQRA 3OGGA 2VXRA 2D6LX 3H1MA 3WDXA 4EWAA 2YUEA 1O4YA 4HKLA 1I9RA 2R071 1N1VA 4P14A 4PIXA 4CDQA 4N7IA 1MS1A 4C0BA 4X6QB 4XF1A 5L19A 3WCRA 1REEA 3LGRA 4WM7B 1C8M1 2WA4A 4G4FA 5SV5A 3VHNA 1S0CA 5AC91 2PHDA 2CAUA 4NN0A 4WVMA 4WVVA 4A7ZA 2YROA 4BIFA 1RINA 1AXYA 1RMU3 2DVBA 3I4IA 5EFUA 4HLTA 3D82A 1OHFA 4AI0A 1H8VA 1QJX3 1DQ1A 4XW3A 4FPJA 1HRV2 2OZ6A 2PYTA 5F6KA 1ZZ9A 4A7YA 1RUJ2 1ZX5A 2DCKA 4GWMA 4Z2WA 4PQ9A 1LOFA 3VDDC 1ULFA 1ZYBA 3WCSA 1NQDA 4CYDA 4Z82A 4O9GA 1MEC2 4XHXA 1AR92 4CTEA 3AFKA 3HT2A 3ZX7A 2BW8A 2CGPA 1F31A 4HFSA 4K40A 2GNDA 4WM7A 1C4RA 2I2SA 1ENXA 4AFAA 2WFF2 4K20A 1CQ9A 4B7KA 3M3QA 3MW4A 2RS31 4IV3C 4KG0A 1S0BA 1PVC1 1V6OA 4ZU7A 4XBLA 1QKQA 1QJY2 3GZUC 5AVPA 1W6PB 4TZDA 4DB5A 1RUOA 5I8TA 1G9BA 2BWCA 4I09A 4AVAA 1VBD3 3AYCA 4DY3A 3UK9A 3TB0A 1N3QA 1QOTA 3RJRA 2R072 4GULA 1QWRA 1RUD3 1OLRA 1G7YA 4IEXA 2Z2SB 2O0OA 3S30A 4CEYB 4QGNA 2XHKA 1C8M2 1GANA 3AB0A 5AC92 4PDWC 1POV3 4L8QA 4LE3A 3D8CA 1UZYA 4R4XA 4M0HA 1DQ2A 3MF9A 3M7AA 1AL0G 2UY8A 1WD3A 4RD7A 3GBWA 4XJAA 3WDVA 1RITA 2C0ZA 4AK3A 1Q43A 3O12A 1DBNA 4EV0A 5C8WA 2ZHNA 2XH6A 3CNAA 3R4SA 2AR6A 1EP0A 1W6MA 1HX6A 1G9CA 3GBGA 4GA9A 4FXGB 1YJKA 1C1LA 2B7YA 4FT8A 4Q0UA 2A3WA 1CR7A 1TME3 1UMZA 3E5QA 2LM3A 4CEYA 3VN4A 3SCFA 4DRRA 1SLCA 1TEIA 5E88A 3WG4A 3WDTA 4EN7B 1O7FA 2RS32 2XKOA 3TNQA 3V0BB 1PVC2 4ES8A 5KWRA 4CRQA 3MIHA 4CDWA 3KQRA 5JOYA 2D40A 1UPIA 4HK9A 1PMIA 3CL1A 1D0GA 4F8AA 3B01A 5C9AB 1GNZA 2PAKA 3SH4A 3JU9A 5KXBA 3VHOA 1RIRA 4PF5A 3SH5A 5KBFA 4ZKTB 2WL1A 2Y26A 3ZVXA 4P9GA 2BVBA 2BPA2 2Q5TA 5LK7B 2E7QA 3S6PA 2F6BA 5JAXA 1AL23 3AMPA 1GFF2 1SFYA 4M00A 3QACA 1LGBA 3IDBB 2DVGA 2VW1A 3HT1A 1X33A 2X5IB 1YJLA 2YGLA 3HQXA 1O3SA 4ASLA 2QDNA 4HETA 1NQJA 3ZYIB 2BBVA 4LBOA 3HR9A 4DRVA 1LODA 3B7MA 3V0BA 4HN1A 4RR3C 3ZXLA 1ENQA 5IK8A 4LBQB 5JI9A 3IDCB 3VBHB 2E9QA 3I8TA 4YW2A 2XPJA 5H9SA 1AR61 2BGCA 2BTVC 3CO2A 2OIIA 2UWCA 4YW3A 4UBHA 4HVQA 5E16A 5C9AA 3OJBA 2AREA 2DTWA 1N47A 1U5IA 4OI4A 4Q4W3 3LWCA 4E4DX 3V0AB 2VGDA 2WINB 2JE7A 1EV11 2ZX1A 1OPMA 2WWSA 3LAGA 1QF3A 4A3XA 2DUPA 4BOWA 5K9YA 1LEMA 3WG1A 2KXLA 2XJPA 5DUWA 1U5ZA 1C3HA 1RVF3 2FMDA 3R6SA 1BEV1 4H14A 1QQP3 1JW6A 3M8LA 1CPMA 4Y5Z0 4N9IA 4XXPA 2ZAHA 4KU8A 2DVAA 1YYNA 3NKTA 3WOGA 2AGSA 4SBVA 4RS5B 4LO6B 5FO7B 4QQOA 3VBHA 2JG9B 1VBA1 4OLLA 2RMU3 4RHV1 4YSFA 1RUH1 4W6WA 1O4TA 5JOXA 2EF6A 2XJVA 4DZGA 1YCIA 3EHKA 3MIBA 3GHNA 2EXHA 2VQAA 1UU6A 4RQPC 2WZR1 4BZ4A 1FNZA 1QDOA 1QGLA 3D0JA 2MEV1 4D94A 3ME2A 4GIQA 5A32B 1JUIA 5T3NA 3KGZA 4AEDC 3ZFEB 5GZDA 2JDZA 5J98B 1H1MA 1QHDA 5CIRA 2K2SA 4FPHA 4KGGA 4TSVA 1KJLA 4YVSA 1LULA 3R4DB 3TYJA 3WX5A 4BMEA 5A3MA 1RJ7A 1AR62 2HYKA 1AX0A 4RS5A 3VKMA 4Y20B 4DQAA 3RDIA 2AYHA 3RPQA 3AKSA 3OF1A 1MZ6A 1CAWA 4JAAA 5ACA1 2ZBJA 3ZIXA 1LJ7A 5K7PA 4B4PA 2B8MA 3J8F3 1PZ7A 1EV12 4Q8LA 3SLIA 2XJQA 5CU1A 1YFYA 1LOAA 1R091 3UKVA 3WV6A 1AR81 1G6NA 5LEJA 2C9AA 4EROA 4XFCA 1NLSA 1D4M3 2JG8C 3MIGA 1JOJA 1BEV2 2Z42A 5A32A 4PJYA 2VNGA 3URFA 3ZFEA 1HDKA 3MFAA 2XLGA 3IDEA 4YZ2A 3MFCA 1QJZA 2PHRA 4WZCA 5IK7A 1LEDA 1WW5A 5I0RA 3AJZA 2C1FA 1PIV1 1VBA2 4AFDA 4XJ9A 3WNXA 1WMDA 4Q2FA 4RHV2 4G9SB 1RUH2 2NPIA 4X8NA 4Y20A 3MLLA 2ZCWA 2ET1A 2O1QA 2ZGSA 4E2SA 1V6KA 3O5SA 4PLMA 3RQ0A 2WZR2 1WLTA 2WC2A 4AVCA 4PLOA 3N3HA 5D8AB 1TMF1 4K21A 1SDWA 1V70A 4QQHA 3NAPB 4CEWB 2MEV2 3KLSA 1DHKB 1OA4A 3USSA 5EWSA 2JICA 2P3IA 4HSJA 4XHBA 5GKAC 1EY2A 2P34A 5IK5A 3WDWA 1OPOA 5AFBA 5FOJB 3AP4A 4HBNA 3WP4A 4DPNA 3KT1A 2HWB3 4NVPA 5CADA 5GZGA 3J4UH 4D7SA 2ZGRA 3U10A 1AZDA 1VLNA 4HPKA 1DU3D 1ND3B 3W59A 3ZXKA 5BNOC 4FPGA 4BCUA 5ACA2 1QXJA 1J1TA 5L36A 1ZZCA 5ABJC 2XGXA 3CLPA 3AMQA 1G9DA 2A71A 3SMHA 3VBSC 4KGQA 1R092 4Q4V3 3QD6A 1H9WA 2EAAA 1AR82 4WM8C 4AI8A 4CEWA 3TBDA 4CP2A 1HIXA 1SQ4A 2JE9A 3CJIC 3JBG1 5L7OB 4JDNA 3QBQA 3LB9A 3I59B 2QFEA 5GZCA 1SLAA 1VAMA 1PK6B 4OHVA 3VLBB 1AX2A 2EAKA 3JB8A 4IEVA 5FPZA 5J37A 4QPGB 1EAH1 4XDQA 3MZHA 1PIV2 4R9BA 5DDJ2 1QU0A 4CDXC 4FPLA 2Q8OA 1ND3A 3SNMA 3O0VA 4F3JA 1VRH3 4AXOA 2HWD3 2XG3A 2YC0A 1GICA 1D4VB 3ZSMA 1OD5A 1TMF2 2HWF3 2GAUA 2IXIA 4J6GA 4YGDA 4S2GA 1V9U3 2ETEA 4YARA 2ZX2A 4R8HA 5L7OA 4XBNA 4LA2A 4I3GA 4PLNA 3VDDA 3AZVA 2D3RA 3I59A 1J3QA 2ZGPA 3O14A 5CG9A 3ZXDA 3AYAA 2R041 5FO9B 2VPVA 1ZREA 3OY8B 4JRAA 4Y1UA 3JD73 1XU2A 2DWRA 3MYXA 1YIFA 4R9CA 2DCYA 4LHNA 3VV1A 4AFMA 5GJ6A 4W65A 1UPSA 4Y26A 5E89A 4KU7A 4QPIB 2P3KA 4Q4X1 4IV3A 2XWBB 4AQTA 3KB5A 4ITCA 4Q1PA 5FMOL 2SLIA 4INDA 3VZJA 2E53A 1A6CA 4RGGA 2GN3A 5K0UC 2WS93 4XZPA 3UKNA 4K1YA 5AVAA 5JLVA 4QU2A 4I01A 2R061 5CBLA 1X7NA 3AMNA 3JBG2 4YW1A 2K0GA 4MGKE 3K51A 4MGIE 5JDBA 4IQPA 1YFUA 3VBUB 2VNRA 4XMIA 4YM2A 1Q8PA 4O9EA 2Z5WA 5C8CC 4DY5A 1EAH2 3GALA 1H30A 2B5HA 1WA4A 3VBOC 2VNOA 2BNOA 3DF0A 4Q0SA 4IESA 2QCSB 1MS0A 1SLBA 2D5FA 2WT2A 2X53S 2VECA 4WBBA 4XF3A 4XFAA 3WINE 4K6BA 5JZGC 1AYM3 1GNHA 3M3IA 2KM2A 3H9AA 4JDOA 1Q8VA 3ZN6B 4LHLA 2ZTNA 2ARXA 3FLRA 4LUKA 5BY5A 1LTEA 4GKYA 4QM8A 3BPZA 4AVSA 3WQ7A 5AFEA 2R042 3VBUA 5I0UA 4B4QA 5FLHA 3H0OA 1CGPA 2XWJB 1O3QA 1UAIA 3WDYA 2ZX3A 4JC1A 3RYKA 1F5FA 3AP6A 5C33A 3R4UA 5C6CA 3ZMOA 5BNPB 1VB4A 2ZGTA 3AM2A 4Q4X2 3DV8A 3MIFA 4AHXA 2ZJCA 5TSWA 5D1IA 2PLV3 2XVLA 3C3VA 3MIDA 4JTNA 4MZUA 4RR3B 3ZFFC 1V6JA 2HWE3 3POWA 1H8TB 1ONAA 3QCWA 4XFBA 4AYUA 3E6CC 2B42B 3JCIA 3WZ1A 1HRI3 4NHKA 4KQ7A 1OFSA 3WVJA 1RC6A 1CJPA 1G9AA 1H2LA 1W2UA 2YXSA 4LO5B 1IKQA 2VVEA 2VUJA 1UCXA 2HWC1 3WW2A 1CVNA 1HLCA 4F83A 4UBGA 2DVDA 2YMZA 2AENA 1WW4A 2RM23 1BBT3 4IEQA 4FXKB 1WCDJ 3APBA 3WW1A 1AUYA 3ZPYA 3HBZA 3NJZA 4UW3A 2IXCA 3CJXA 4BM8A 2V09A 1KS5A 2R0HA 3UL2A 1VBD1 1S0JA 3WR0A 5BNNB 4AFCA 4BA6A 3P3NA 4FP3A 1RUC1 3AXDA 4NWVA 2NN8A 1NE4A 2XBO3 3ZIWA 1REFA 1R1A3 4RR3A 5JPMB 1RTVA 4FP2A 4J1WA 4JGZC 3AXEA 5FFOC 2X29A 4YZ4A 1JBCA 3OBRA 2N7GA 4AQ2A 4JDMA 3O7OA 2DV9A 4TWTA 1X50A 4K9SA 1CX4A 3U0ZA 4Y1VA 1POV1 2NMOA 5CFDC 3AP7A 3MPPG 1LOCA 5GLZA 5JSRA 3SHRA 2D97A 2GC1A 4JTOA 3SITA 1TE1B 1QDCA 4XIOA 4PIYA 4FQZA 1FX5A 5I8YA 1BVVA 2WT1A 2ZZJA 2WIIB 3S7EA 3AMHA 3EJKA 1WLCA 5GZFA 4AG4A 5HCAA 1AF9A 5JCTA 3LSDA 5BNNA 3LA2A 3ZYPA 1PVXA 3FX3A 4XFHA 1N3OA 1V6NA 1TME1 5CA6A 3B5LB 4IV1B 5F5QA 3R0RA 1OA2A 1CESA 3B02A 2ZAAA 3ZYRA 3AP9A 1AJKA 2HWC2 3NO8A 4P9JA 4XEZA 3M3EA 3AKPA 2WA3A 4U36A 1S0GA 2IXKA 5HXVA 1Q56A 1JUHA 2ZGQA 1MS5A 1YFWA 2NM1A 1QH6A 1RJ8A 3LCPA 2E51A 5FLJA 2E6VA 1TNRA 2D43A 4Q27A 1S2BA 1VBD2 4AEDA 1RUC2 3RJ2X 5FCCA 1UU5A 2D3PA 4E9KA 1UKGA 1LB2A 5J3UA 3RMXA 4YVWC 2QJVA 5DUVA 1GBGA 1FV2A 2NP0A 4HT1T 4P5HA 3ZYGA 4LT5A 2CNAA 4IV1A 4C0HA 1PHMA 1YLLA 2CV6A 1CD3G 2CAVA 4XILA 2ZMLA 1H1IA 2GMEA 1NZCA 3AZWA 1PO21 1VBC3 1UKRA 1COV3 3WP5A 1QNYA 1HV0A 4B3NA 2EXJA 2JG8A 1DQ6A 1W6MB 3MDPA 1FMD1 1VR3A 4AE2A 1MZ5A 4FOWA 1RB8G 3PLQA 3SCHA 1KJRA 1ZRFA 4Q4W1 3KSCA 2W52A 5T5JA 1TME2 3SCGA 4N43C 4WVZA 3S7IA 3WG2A 4G3YC 3ZDSA 1RUE3 4ZXKA 1BMV1 1O5LA 1SLIA 1YI9A 3NV2A 4R52A 1CN1A 4I30A 5GLWA 1UIJA 2RR13 1J3PA 1JH5A 1VBB3 4UW4A 4V1PA 1K5MB 4BHPA 4OULA 5DUUA 2JENA 4Z1VA 3H7JA 4CDWB 1RUJ3 1QQP1 2D3SA 3WP3A 4AW7A 1UW8A 5CAZA 2IFRA 1B35C 1DF0A 4C91A 1ND2C 1DG6A 4PBPA 4CP0A 4LLOA 2RMU1 1OA3A 4QQ2A 3VKFC 1UIKA 2OUJA 4XJZA 5BYNA 2WNVC 2DYCA 3D4KA 5IT6A 3N7KA 1UF2C 1DDLA 3IMNA 4AF9A 1QJU3 4FPEA 4WVWA 4EN8B 4CDUC 2TNFA 4L99A 2A5ZA 4XF0A 3SXWA 1ZRCA 2VOXA 4P9IA 5ABJA 3WG3A 1REDA 3N4MA 3N36A 1K5MA 1PGSA 4Y4YA 2Q4SA 3VKNA 2G4IA 3VBSA 1I1EA 1PO22 4Q29A 3BALA 4HN0A 2R073 1Q8SA 2V5YA 1RUI1 2R0FA 3FUQA 4JV4A 4LTAA 3CJIA 4RA0A 1LKNA 4FOYA 5KHIA 1FMD2 4GQ7A 1C5HA 2A73B 5FMOS 5H9PA 5AC93 4K1ZA 2HEWF 3NV4A 3MEPA 2PA7A 2IC1A 1MS4A 2VVFA 3B94A 4MXVA 4Q4W2 1R083 3BOPA 5FDBA 2D5HA 3J8F1 1ULEA 3IKWA 3ZXJA 1BMV2 3M1HA 3KZ4C 1IS4A 2ERFA 1KXGA 1SLTA 3RG0A 3ETQA 1M4WA 3ALQA 4YGEA 4RL7A 1D4M1 3WUDA 4AEMA 2VW2A 1DGWX 4XXAA 5K0UB 1FOD1 1QQP2 2PHWA 1G8WA 3DPRC 1NCRB 1HKDA 5CNAA 2BUKA 3ILNA 4LLFA 1BVP1 1NA1C 2RMU2 2C5DA 1LOGA 1LRHA 2CY6A 2GNTA 2ILMA 4LBKA 4GXLA 4UXAA 3WY6A 2ZACA 4XJ8A 3AZYA 4AVTA 2R6QA 2YYOA 3DL3A 3M70A 3VBOB 3WT3A 4JGYB 1FPN1 1H4GA 4Q8KA 1YWKA 4K8FA 1HW5A 1O3RA 5T5OA 3IIAA 3OPZA 5JPNB 5CB7A 2RS11 4ATFA 4ATEA 1VJ2A 2IWGB 5K0UA 4U2AA 5LRRA 2ZHMA 2HWB1 1RUI2 4YVSB 4E2QA 3VZLA 3LOBA 4CP1A 1NCRA 1GZCA 1SBFA 1U5YA 4XF9A 3WXPA 3Q9OA 4LA3A