1S55A

Mouse rankl structure at 1.9a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
156
Chain Sequence
AQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 11
publication title Murine RANKL Extra Cellular Domain Homotrimer Structure In Space Groups P212121 And H3 At 1.9 And 2.6 Respectively
rcsb
source organism Mus musculus
total genus 29
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s55A00
3ME2A 2ZJCA 2Q8OA 5KWRA 4QPYA 3QBQA 1OQEA 1A8MA 2KA3A 2WNUC 4OUSA 4GIQA 4QQPA 1D0GA 4MXWB 3V56A 1PK6C 3MI8A 3K51A 4G3YC 1RJ7A 4DB5A 3L9JT 1C3HA 1KD7A 2RE9A 3IT8A 1WCKA 4KG8A 2JG8B 2WNVC 2HEWF 2JG9B 4NN0A 2RJLA 1XU1A 4QQHA 2WNUA 5L36A 4TSVA 1ALYA 5HBAA 2HEYF 1PK6A 3URFA 4J6GA 1OQDA 5TSWA 4MXVA 3B9IA 5KC5A 2JG8C 3TYJA 3FC0A 2R32A 4D7YA 2JG9C 2TUNA 5L19A 3LKJA 4TWTA 4HT1T 2WNVA 1U5ZA 3K48A 4MXWA 1TNRA 4G4FA 1DU3D 2X29A 1D2QA 4KGQA 1I9RA 3B93A 4KGGA 1JTZX 1U5YA 2JG8A 1JH5A 2JG9A 4QQ2A 1IQAA 2AZ5A 4OUMA 2E7AA 3QD6A 4RSUA 4DOUA 1U5XA 1O91A 2O0OA 5CIRA 1XU2A 1S55A 3B94A 3AB0A 2WNVB 1OSGA 4F3JA 2TNFA 4E4DX 3TWIA 3ALQA 5BNQA 2QE3A 4N90A 4OULA 5KC6A 4QQOA 2R30A 4EN0A 1DG6A 2HEVF 2ZPXA 4MSVA 2WNUB 1GR3A 1C28A 1KXGA 2RJKA 3WD5A 2Z5WA 4E4SA 4QQLA 1PK6B 1RJ8A 2QDNA 1D4VB 2R6QA 1TNFA 2OIIA 2Q1MA
chains in the Genus database with same CATH superfamily
2Q8OA 2RDQA 1LHWA 5KHIA 4OQ8A 3QBQA 1W03A 4INDA 4XACA 3MBWA 2ZTNA 5E6HA 5FYHA 5FP3A 4IDZA 5IFPA 5FO7B 2I45A 1UWWA 4P9JA 4RN5A 3WF3A 3ZPYA 4IV1C 5DAPA 1DF0A 3RI8A 1O3QA 3A22A 1R083 3NKGA 4XXAA 1QIQA 5EHDA 3ZFGC 2VTXA 5IVCA 2XDVA 5JR7B 4NPLA 1W2OA 3E97A 3OTFA 3ILFA 2XL9A 5IK5A 3FBYA 1X9PA 2Y60A 5AFEA 1R082 5A6XA 4MO3M 5GZGA 1NA1B 3IPVA 1LGBA 2VZUA 4FPOB 4Q4Y3 1TQ5A 5LASA 1WBFA 4RQPC 4TSVA 4XJAA 5F5AA 3WNPA 3K75B 2VZPA 3AVRA 4IV1A 4YPJA 3VDCA 1OQDA 4Q4Y2 4QGNA 1KDKA 1WLWA 3DPRC 3ZFGA 1RMU3 2JG9C 2VQ0A 1MZEA 2RDSA 3WDXA 4OHXA 1E5IA 3ZOIA 4CDQC 1XXNA 1W8HA 4TZDA 4LIUA 3WDWA 5FWJA 4FTSA 3RYRA 2ET1A 1MQTC 3FJSA 3O1SA 1RMU2 1V6IA 4AHXA 1DU3D 1OFNA 1RL3A 4FPJA 3BTYA 4RQPA 4XCBA 2VZTA 2ZABA 1W06A 3O0WA 2QKDA 4LBQB 4EYUA 4GMP1 4M4RA 3GBGA 4XJZA 2VOXA 1AL21 1VR3A 3DV8A 5FK7A 4K20A 4BOWA 3SNMA 1VRH3 3DPRA 2JG9A 1EV13 2DTWA 1JOBA 4QU2A 3WCRA 1SLAA 4CDQA 1WMEA 3WNOA 3S5QA 2NN8A 1VRH2 4AR2A 2CAVA 5I8SA 1O5UA 4PDWC 3FUQA 2FDHA 1Y9QA 3CJIC 1WBLA 1WUVA 3U4XA 1S55A 5FFOC 4BK4A 2Z42A 1ZBE1 3TB0A 3JCIA 2GH2A 3LEMA 2ZEXA 4ARXA 2XXZA 2VZSA 5JXHA 2BZDA 1BVVA 1EPWA 4AI2A 1QJZA 5LK7B 2PAKA 5FZEA 4MHUA 1L7LA 1QQP3 1UZWA 1IQDC 4E4ZA 2E33A 3GCWA 2WINB 5C9AA 3QOPA 2VE1A 4XAAA 1LHUA 2EVXA 1ZVFA 4Q2FA 3BALA 4NWWA 4IV1B 1RJ8A 1GP6A 3VKLA 1PO21 3BN6A 4CUBA 1AYN1 1UIKA 1D4VB 4AE2A 2CWMA 4FPYA 4YZ3A 1QQP2 2R6QA 5JIAA 1PM7A 4PDWA 4CP2A 3CJIA 3KCYA 4XVHA 1Z0HA 4BK5A 4XUPA 1PX4A 2ZACA 3RQ0A 2ZGNA 3CBNA 4A45A 5FR3A 3H1YA 3MW4A 2VULA 1S0FA 1D0GA 1EYBA 3DL3A 3GNEA 3B00A 4ONUA 1FYUA 1UY0A 3L9JT 2VO5A 1C3HA 3UETA 3VBOC 4BH9A 2DVAA 2ZAHA 3JD71 3AKTA 3K4AA 1NQDA 1AR83 3RSJA 4Z2WA 1DLLA 1WCDJ 3KF3A 3PMEA 4YG0A 4JTOA 5EJZB 4GAZA 1VB4A 5EJ3A 4R4ZA 3AKSA 2J1RA 5JMCA 3DPRB 4LKSA 2JG9B 1XE0A 1AR82 2DYCA 4HPKA 1OI6A 1V6MA 2RS53 3ZFFC 4QB2A 4CDQB 2W2IA 3D82A 1COV1 3FLPA 2RS13 3A7QA 2TBVA 3NMBA 4UFJA 4Q26A 5HBAA 2C9AA 1MZFA 5HXVA 1A3KA 5H9PA 4AHWA 4BWOA 1RUJ3 2RS52 4H7MA 3WX5A 3TOJA 2JB8A 2R1BA 2GMPA 3J7NA 3KMHA 2WR9A 3OBAA 3VBOA 3ZMNA 3HBKA 4AFMA 3KHCA 3HEIA 3M3CA 1BMV1 2RS12 2WFF1 2A6XA 3LEKA 2CAUA 4LE3A 4Q27A 2VMGA 3N9OA 5K0UA 1QDOA 1RUJ2 3HN3A 1XB9A 2QQJA 3AM2A 3IM0A 3N9NA 4Y3OA 5KBFA 3GZTB 1SLCA 1UNBA 3OPZA 1J58A 3ZFFA 1UYPA 2QQKA 5C9AB 1RUG3 2XH6A 4NHKA 4Y5SA 2O8QA 3N9QA 5JZGC 1JZ2A 2XOMA 2FD8A 1RUE1 2B45X 2JENA 1H6YA 2QQUA 2W46A 3ZSMA 1AR61 4QPGC 4CUGA 2HJIA 4D6QA 1JTZX 4PDWB 2WT1A 4QGLA 4Z8BA 3CJIB 3PIJA 2VMHA 1RUG2 4KWLA 3WNLA 1UXZA 1WZXA 3ACHA 4A44A 1TME1 1AX0A 1JOPA 2VNOA 1W8TA 3POFA 5K8SA 2RS33 3KGZA 4IW3A 5CFCC 1PZ9A 2Q8CA 2AR6A 3GBFA 2NZ9A 4XILA 1QY4A 1VBB1 4IEVA 4BA6A 5CIRA 3LOBA 1O6UA 5JLVA 2F4PA 3ZR5A 4UYBA 5C3QA 1RUNA 3AKQA 1BBT2 3HNYM 2RS32 1PNGA 3LB9A 3VUOA 2QQWA 3AP4A 1BLZA 3NV2A 4E4DX 1W0OA 4Y4YA 3POIA 4QPGA 1ONAA 2ZGSA 1LJ7A 5FREA 3THCA 2DVFA 4EV0A 1ST8A 5JMOA 2ZCWA 4BMBA 3ST7A 4QQOA 4NR1A 1YYNA 4HPKB 4EN0A 3M8LA 3VDBA 2VGDA 5IVEA 4BQ1A 2XLAA 5FAXA 5FZ0A 1VB2A 4QX8A 1NE6A 5C8CB 3ZYPA 2G1MA 3KQ4B 4E4HA 5CFCA 1Q8OA 4HVQA 4QQLA 4FPGA 2DVGA 4DRRA 2JKBA 3MFAA 2WWSA 1NQJA 1ODMA 5CVRA 1CIWA 3VBOB 1BCXA 2DCJA 3HPNA 4FAGA 5KWRA 5IVBA 1DGRA 3NJVA 2G19A 2GH8A 2OX0A 4GKXA 5K0UB 3MIFA 1W6QA 5F37A 5JOXA 1HJGA 2C5DA 3V56A 2XHNA 2ZMLA 1XQNA 4IE7A 2H6CA 4LEJA 1ZBE3 2WABA 4YWAA 3ZFFB 4JKKA 4P9XA 5LCWL 2BQPA 3GZUC 2RE9A 5A6QA 5B2GB 1E57A 1XNTA 2RM23 2ZX1A 4Z07A 3AZWA 4TN7A 2DCKA 1VBA3 4BHPA 4MGZE 3T0DA 4LMFA 1YI7A 3FWEA 3KHBA 4NE9A 4PLMA 1TMF3 1ZBE2 4M0NA 1CX1A 4FFHA 1HIXA 3NNMA 4PCRA 4ATEA 2P3JA 4FQ4A 1ULPA 4NN0A 4O9GA 2RM22 3CDZB 3T2OA 4C1WA 1O7FA 4W6YA 1VBA2 1PGW2 1AYN3 3PIGA 3UKTA 2D6LX 1N1SA 1TMF2 3O14A 2J1VA 2WNEA 3IZOA 4AI9A 2QQNA 4P9WA 1K45A 4J6GA 4A42A 3B9IA 3CQOA 3JZVA 2EAKA 4IXLA 4DXRA 2EIDA 3M70A 1ZRCA 1AF9A 2VUJA 3LA7A 1JYTA 4LBKA 2ZGQA 2ARXA 3I2GA 4CUCA 1BEV1 2DV9A 1JXNA 4QPGB 5AC91 2IXJA 1JI6A 1QJFA 2BUKA 3T2TA 3JD73 4A4AA 2V4AA 1YC61 4IV3C 2B7YA 2C24A 4PLNA 1UY1A 4DS0A 3ZXJA 1FV2A 4YGCA 5HV4A 1S0BA 3RJ2X 1H9WA 4KGQA 5DABA 4FTBA 3M4FA 4RGAA 4XMIA 5LEKA 2JE7A 5HV0A 1YJLA 4YFWA 5CFCB 2DUPA 3I3DA 3OBZA 4BLIA 4BE3A 3JD72 3AZZA 1U5YA 1PO11 3GBWA 2XJRA 4CCOA 1MS3A 1KQRA 4CP1A 2QQMA 1E5RA 3OPWA 3GF6A 4XPVA 3L2YA 4AVTA 3ZXAC 1RHI1 4I3GA 1SG3A 1C1FA 4FCAA 4H7LA 1RUC3 1AYM2 1W6QB 1XNKA 3D8CA 4N9IA 5FWEA 1CAUA 2WIIB 4KU7A 5IUQA 4OLLA 5F2WA 3VZJA 1O91A 4XYXA 2B9UA 1FMD3 2R0HA 2VMFA 1E5SA 2EF6A 1W6MA 3I97A 4IV3A 2JDUA 4ISRA 3X29B 1POV0 1H1MA 2NP0A 4PI2A 1AUYA 4YW3A 5FZHA 1RUC2 1XYNA 1NAEA 3U75A 4K1ZA 5A3NA 3ZYJB 1FMD2 1VP6A 1MR5A 5FJHA 1MS5A 2IWGB 5GZFA 4MGIE 4OULA 1Q8SA 2DBNA 4NPMA 1HB4A 2YDEA 1OBNA 2QZ3A 2VNRA 2VQUA 4Y4RA 3W9AA 1CZSA 1N3QA 2H0BA 4XURA 1ZREA 5FIXA 5C8WA 2C4XA 1AR63 1C28A 4Q4X3 1UO9A 4BQ4A 1NYWA 2BW8A 3RZGA 3DF0A 4XAEA 1IS6A 2QQVA 4PIYA 1MEC3 4L99A 4NAOA 1UZZA 3T4HB 3ME2A 2B39A 5LBBA 1AR62 4YM3A 1U0AA 2P37A 4Q4X2 2WL1A 4ASMB 2KA3A 4LKFA 3O1MA 4DY5A 2YC2A 1RGSA 4R9AA 5T5OA 1HXS3 1W9TA 3ZXLA 5DAVA 1CZVA 1MEC2 1XNBA 4M0HA 3RYPA 3VHNA 1PVXA 3ZSJA 4A6SA 3WP6A 1A34A 1VAMA 3C7EA 5E16A 4BQ5A 4JHZA 4N7UA 2VCMA 1GOFA 3T2PA 4BQWA 1RUD3 2CU5A 2SLIA 3VKFC 1GU3A 3POYA 1HXS2 2YB7A 3Q8AA 4FTEA 1HN1A 4FO9A 2QTWB 3POWA 2F17A 3HN1A 4J25A 5ISLA 1E5HA 2UURA 1W3VA 3WQ0A 5FXWA 4FOYA 4GQ7A 1RUD2 1C8M1 4IEYA 2B42B 4M3CE 2VQAA 4QXHA 4WVZA 2VPVA 5A7WA 1QJX1 3UV9A 2OT7A 4BQYA 3T08A 4W65A 1H0BA 1XNDA 1JZ8A 1V0AA 4XUOA 4BPZA 3U1XA 3TRSB 3RWNA 1LR5A 3VKOA 5F8PA 1YFYA 4IV3B 1W6MB 4MGQA 4H3WA 2OXBA 5LA1A 2HWB3 2ZZJA 4Y24A 5JOZA 1POV1 1ZBA3 2ZGPA 5L19A 4YGBA 3LKJA 1JYWA 2RMU1 4AEJA 5FXVA 4Q4V1 4LK7A 4FXGB 1XYPA 2D40A 2D93A 4HT1T 2HWB2 2HWE1 3TN93 2W47A 3LQCA 2PTMA 3OSDA 1ZBA2 4DUVA 5GKAC 1JMUB 1NZCA 1RXFA 3N36A 3BIWE 5F2SA 2GN3A 4XC9A 2G9FA 4XHXA 3NV3A 4NHMA 4DINB 1IKQA 1I9RA 2A6ZA 3NNFA 3OD4A 3VZLA 3B93A 5FUNA 3VHPA 2SBAA 2VCBA 3B3QE 4CDWC 3TN92 4EWAA 4FXKB 3E6CC 1ZZBA 3HNMA 1HRV2 1YQ5A 1IS5A 1WLTA 2YU1A 2CSGA 4XFFA 3UK9A 4HG6B 1FPN1 1GZTA 2ORXA 3D5OA 4XDOA 5CADA 5LZ6A 1NXMA 2A70A 4RD7A 3W5NA 2VJXA 4AQ6A 1MPXA 1NY71 2DURA 1HX6A 5A1AA 4MG2A 3ZX7A 1T2XA 4LHSA 1REFA 3N7MA 2Y6GA 3QD6A 3K46A 3C7FA 3K77A 4L0PA 5FOJB 2WKKA 3LA3A 4XF4A 1LU1A 3AMPA 4PT6A 4IQPA 4LLFA 1O3RA 5IK7A 3O1OA 2ZMNA 4WBBA 4DRVA 3O1PA 4XHBA 5DZFA 4CDWA 3PUSA 2F6BA 4COYA 4IE4A 5KHGA 1W8UA 1K5MC 4YM1A 4LULA 2XB6C 2VZ3A 3LDRA 4A2UA 2QE3A 1V6NA 2X8KA 2BP6A 3ACFA 4WM7A 1OPMA 2QUOA 1UYYA 1YQ6A 3WDUA 3OGGA 4W4ZA 5A7WB 4RFT0 1D0HA 5LRSA 1AR71 5FY8A 1OUXA 4XBNA 2JIJA 5C3RA 2P3IA 4RL7A 3WXPA 4NVPA 3QLQA 1ZRIA 2XL7A 5FXXA 5T55A 3ZKYA 2XWBB 3QH7A 4YM2A 1HB1A 2WSUA 3IDEA 3SMHA 2WO7A 2ZAAA 1VE0A 2DCYA 3CL1A 1J1TA 1RITA 5F32A 3VLBB 2W5FA 2ZGOA 3ZYRA 4ZKTB 3AK0A 2VW1A 1K5MA 3BPSA 4H55A 4B4RA 4CVUA 1UZ0A 4XUQA 5FY4A 2X05A 2PQSA 2RVAA 1W3XA 1AX1A 3K51A 4E2GA 1OC1A 4MGKE 2D6KA 3H7JA 5FZ6A 2BTVC 1HLCA 4OI2A 4HK9A 3UESA 4IGOA 2G9ZA 3MUY1 5DAXA 3HAGA 1PHMA 3V0AA 1RVF3 4KG8A 5LATA 2DVDA 1LECA 2J42A 3GGLA 3F2ZA 3I3EA 3LPFA 3PUIA 2YGMA 2XGXA 3O1TA 3C2UA 3N9LA 3LE0A 5A6YA 4ISQA 1IZ3A 1KFXL 2XKPA 2EALA 2P3YA 2ZMKA 3A21A 3RFRA 3WF0A 2VTXJ 1CAXA 2BOJA 4MLOA 2JDMA 1W8FA 1FI2A 4QQHA 4CU9A 5I0RA 1RVF2 2NQYA 2ID4A 1SPPB 3WP5A 4BYYA 1C1LA 2QCSB 5DUXA 3CLPA 4JDNA 2QQOA 1GWKA 1G6NA 4CCMA 1LOFC 5ABJC 1A78A 3KD4A 3SXWA 2CGPA 4P9GA 4Y26A 3BPZA 2A73B 1WKYA 4CDWB 5I0DA 2XVGA 1HN0A 2W87A 3N7KA 4LJHA 4WM7B 4MXWA 5FRAA 1OA2A 3FZ3A 3CF6E 5FO8B 1UL9A 4QXKA 1JYNA 2X29A 1ZYBA 2V5DA 1VBC3 1WCSA 1BQPA 2A6WA 3PVOA 5GZEA 3UGHA 5FV3A 1W9SA 4BM8A 4BIOA 1G9BA 4DFSA 2AGSA 2VOKA 1XBFA 1PGL1 2DUQA 4OZXA 3LDBA 3MO4A 4QX3A 3ZYIB 3CNAA 1LOFA 1VBC2 2A3WA 2JX9A 3OOXA 4LIVA 4LKEA 5ABJA 4NRPA 5I8TA 5J36A 4E2QA 2WSVA 2D6NA 3AZXA 1K5MB 1PIV1 2GC3A 2Q5TA 3BVCA 2EXKA 3PLQA 1TE1B 5BY5A 1W8OA 1LEMA 3VBHA 5FKBA 5IAXA 1DGWA 2VW2A 5DXDA 4XABA 2RMU3 1AX2A 1J3RA 1UOGA 5IVVA 3AVSA 4JRLA 4JAAA 4D6RA 1VJ2A 1W0PA 2PHTA 1NCQA 3BODA 3SISA 2RR13 4GD4A 4S2FA 4IUGA 3WY6A 3R05A 1PVC3 3VZMA 3H42B 4WV8A 3V65A 4KWKA 2BFUS 5DAWA 1CJPA 1XYOA 5KHKA 1CAXB 4XF0A 2RR12 1X50A 4NAMA 4Y5TA 4LT5A 3LDKA 1PVC2 1NCRA 1OLRA 2R073 2NYYA 2WLQA 3JXSA 4MX3A 4LNVA 1ZZ8A 2OPKA 5CG9A 2WS91 1FPN3 1H4GA 1ULFA 3HMYA 3VBSC 1V70A 4OI0A 1CGPA 1JYIA 5C71A 2R072 1J1LA 1RUI1 1UD1A 2R043 3LEGA 1R64A 3LF7A 4HKWA 3ZFEC 1FPN2 4OUSA 1WA6X 3JUUA 2UWCA 3B69A 2ZEZA 2CYFA 4MXWB 4OI4A 5FZIA 5B4XA 4HVOA 3WF2A 5JSRA 4Z92B 1N1TA 5FZKA 2CV6A 1DQ6A 2R042 3BGAA 3VHOA 1KGYA 3N7JA 2DFBA 4C0HA 1P8JA 3MF9A 5BXXA 2Q8DA 2EA7A 3TNPB 2UY9A 2WAOA 2WFPA 5B4NA 3C8XA 4XFBA 1ZRDA 3IT8A 2OA2A 3LFMA 3KVBA 4ARYA 1FX5A 4D7TA 1WCKA 2BYVE 3VBSA 3IKWA 1V9U3 1UZVA 2IXIA 3RS6A 1OF3A 2HEWF 4P5YA 3V64A 4ZHNA 4YM0A 3ORJA 2XR4A 2Y6KA 1ENRA 4JV4A 2FDJA 3BKZA 2FZ1A 4NHXA 1DIWA 2R061 4IEWA 2VOVA 5F39A 5FYBA 3ZFEA 3PHMA 4Q0UA 1I3HA 4AOCA 5HXMA 1V9U2 4UOJA 2BOIA 1JODA 3VBHB 2Y33A 1W9YA 3QACA 1SDDB 5DQ0A 4HL0A 5F5IA 1CPMA 2G9GA 3HR9A 3S7IA 1C57A 5IVJA 2R32A 1NCQB 1R091 3OEAA 3TEYA 1LEDA 4LO5B 2W1QA 5GZDA 2D3RA 4DIQA 4L97A 2GNTA 1H2MA 3GCXA 2ATFA 1NKGA 4CCLA 5C3SA 3PVNA 3ZMOA 3LA2A 4H14A 4KQ7A 2YZ4A 2XJVA 1NCRB 3K3OA 3LIHA 3DYPA 5CBLA 1GZ9A 2EIGA 4N8MA 5CA6A 2BDRA 1ULGA 1XRUA 2VQTA 2XMLA 5JAXA 3THTA 3OGJA 1CWPA 2E53A 3LPGA 4Z1VA 4KGGA 4AL9A 1R1A3 2YPJA 4GH4C 5FZLA 4HANA 2YFUA 4EROA 1ODNA 2E63A 3AYDA 3FHAA 1GNZA 1NUKA 4UFLA 3ZSEA 2IXKA 4GXLA 1UOFA 2ET7A 4ES9A 3O1VA 1RUOA 4YW2A 5ACA1 5FYTA 3H7YA 2DU1A 3N9PA 2BGPA 1R1A2 3LEIA 4M01A 1GZWA 4RSUA 1ASJ3 1ULOA 3BOPA 4QM9A 4E8DA 2O0OA 4EQVA 1W2TA 4AFCA 4OZOA 3RJRA 1US2A 3RI9A 4KI5M 1W2AX 2IXHA 3IDAA 1Z7S1 3HOBA 4LUMA 4Q0QA 1TVGA 1ASJ2 2NLRA 2PLV1 4F3JA 3VBSB 3ENRA 2TNFA 4JHTA 5BNQA 2CL2A 2O8OA 1JN2P 4MVTA 4QDSA 2E32A 4GH4A 1Y7BA 2WO2A 3KGLA 4O65A 1UX6A 4AHZA 1G9FA 1JOJA 1PMIA 2KXLA 5K4LA 3ZFEB 3DEMA 5I0SA 2ZGUA 1SEFA 3JU9A 4UWDA 1OD3A 2D6OX 5FMOL 3DXTA 5FY0A 2PHXA 5C9AC 4EWDA 3I4IA 4QU1A 1VBD1 2QDRA 2OZ6A 5L7OA 1W6OA 2ZX3A 2D5HA 5J48A 1Y3TA 2JXAA 1OXCA 1EV12 2D97A 4ET7A 1D4M1 3AKRA 4FT8A 1DQ5A 1F5JA 1UMZA 5CEHA 2ZGRA 4O7XA 1F15A 4FPEA 3EQEA 2WYFA 1QXJA 3VGIA 4NROA 3I2DA 5FDBA 1C5IA 3PTYA 2VZ1A 1GQPA 4YSFA 4DXTA 2ZGTA 1PK6C 3MI8A 4ZU5A 4P9YA 3T2QA 2VZVA 1CVNA 2IVIB 1JZ7A 2BGCA 5E8AA 5GALA 2GSYA 4TLGA 1W6NA 1WD3A 1UIJA 1UMHA 3CHXA 3LGRA 2PHDA 2YPDA 5FLIA 2WZEA 3J9SA 4AGVA 2XLGA 2Q1ZB 1F4HA 2YXSA 4HONA 4GJYA 1L7RA 2I74A 2XLFA 3VDDA 5JXJA 1S0JA 4QMAA 3LD8A 4HSJA 3LOIA 5T54A 4ITCA 5F1RA 1F9KA 4URTA 3EB7A 3I2KA 4L9BA 2NMOA 1GZWB 4FOWA 4HXCA 3LWCA 4O61A 5C8CC 1PK6A 4R9BA 5IYYA 3KLSA 1OQ1A 3RDIA 5EPAA 1O8SA 1UPSA 5C5TA 3HT1A 1JZ3A 1ND2C 1AL0G 1H8VA 2WUHA 1CD3G 4JQRA 3ILRA 1XPWA 1WW4A 1SFYA 3AMNA 4GH4B 3A0KA 5FY1A 1SBFA 2HKXA 2WWJA 4Q1PA 1EAH3 5K0UC 2Y6LA 1FAYA 5KXCA 4QX0A 4Q4W1 3VV1A 3BI3A 4IEOA 4FQZA 3J8F1 2JDZA 3T30A 5FY9A 3WW2A 1OA4A 3K2OA 4GZ9A 4UXAA 5L7OB 1B09A 1W6OB 1EAH2 5C8CA 4PBOA 3KZ4C 1H1IA 4AF9A 2R063 3ILNA 3WDYA 3VL9A 3ZIXA 2PFWA 3I2FA 5LY1A 1IQAA 3H1WA 1GWLA 1ND2A 1V6KA 1ND3C 4RR3A 3ZYFA 1IHMA 1DYOA 5HCBA 2R062 1QJU1 4QD2A 1U5XA 1IPSA 1R093 1VAVA 4QKNA 4P00B 3DKQA 4ZZ8A 2PAMA 2A6VA 4FPLA 3SITA 3P6BA 3WG3A 4JKLA 1W6NB 2FMYA 3NJZA 3LIGA 3E5XA 3GALA 4GB31 3SH3A 1DZRA 1HB3A 5J98B 4A6OA 4YFZA 1OVPA 4CCJA 5FZ7A 2YFZA 5BNOA 2HBUA 5BNNB 4EN7B 4IE0A 4XXPA 4ZU4A 3TWIA 3ALQA 3VD7A 1KS4A 1H2LA 4I2OA 1F2NA 1GP5A 3U4SA 3VDDB 1FOD1 2FCVA 3KT1A 4CTEA 1W99A 5I93A 1YWKA 1CN1A 1UYXA 2W08A 5JI7A 4R4XA 3L2HA 4RS5B 1ND3A 2D7FA 2JKXA 4DUWA 4GALA 5KHHA 1V6JA 5FPXA 4QDRA 2ZZQA 4CDXC 4DQAA 1K5JA 1PK6B 2HLEA 4MV2A 2Y38A 3W20A 3APBA 1Q3EA 3MIEA 4XTPA 3WHTA 3WW4A 4EZ4A 2Y6HA 1BVP1 1UX7A 1OURA 4WVVA 1GICA 2LROA 3IIAA 3VZOA 5A1LA 4B7KA 1HRI1 5KXEA 3AJYA 3EO6A 1W2NA 3VHRA 1TEIA 3WHUA 2BGOA 4I02A 4L92A 4ZU7A 4MGTA 1YEWA 2IVJA 3LAGA 2DUOA 4QQPA 2K46A 1WMFA 3BUCA 3TNQA 2WA4A 1RJ7A 4I0WB 4DB5A 4PF5A 3IDBB 4M4PA 1FXZA 3EMRA 2PLV3 5CKNA 2BJSA 4Q0VA 1AHSA 5LWBA 4AFAA 4GMP3 4YZ4A 5FP8A 4HN1A 4CZSA 2R0FA 4CDXA 3W59A 1AL23 3LSDA 3ACLA 3FFZA 3WG1A 5JXIA 1O3TA 4CEYC 3U37A 3V0BB 2PLV2 1T6GC 3DUIA 3PVBB 2RJLA 1ND2B 4RR3B 3OUHA 1AL22 1GQHA 1UY4A 2UYAA 4QXCA 2A3YA 5T5PA 3WG2A 4CCDA 4XDQA 4LPLA 4PLOA 4QM8A 2AEZA 5IT6A 1EY2A 3ZYHA 5D1IA 3SCFA 4Y1UA 1QJY1 4AI3A 1LOEA 2Y6FA 3FBMA 1QNYA 1GV9A 4N43C 3TYJA 1OH4A 1YHFA 2BFUL 1H6XA 2WN3A 5E1RA 1LOGA 2HWD1 2VCAA 3DN7A 5BNOB 4R52A 5EYYA 3HJRA 2CTVA 2HWC1 4TWTA 3VZNA 3WP4A 1JZ6A 4IGPA 4P9IA 2IUWA 4CEYA 4YW7A 3IAQA 3DCQA 2W91A 2W3JA 1D2QA 1ND3B 1O3SA 1WW7A 1Y9GA 3INAA 2XKOA 2WWUA 3ACIA 3GZAA 1PO23 2XJPA 1SBDA 2WDBA 3NW4A 1GMMA 4ORFA 2HWF1 5FK8A 2ARAA 2R7EB 4N43A 5FLHA 1GOGA 5BNPC 3G7DA 4I0AA 1G9DA 1PO22 4DNYA 4NIDA 1AYN2 2VMDA 4NOTA 5CNAA 5H9RA 4LITA 1LKNA 4AXOA 5FBJA 1DLCA 1NZIA 4XFHA 3RVHA 3BU7A 1GNHA 2N7GA 3ETQA 2RDNA 4AEDB 4UFHA 3SCHA 5DG1A 5A7SA 2W95A 4E2SA 3VKMA 4A3XA 2EIBA 4AAXA 2Q30A 3NNJA 4CDXB 2YBSA 3I8TA 4QPIC 2WNVB 1N3OA 1HQWA 3EHKA 4UW3A 4A3ZA 2ERFA 4UBGA 4Y1XA 3ZR6A 4HLTA 5IHRA 4P08A 2MHFA 2WZR1 2XWJB 5FP9A 5H9SA 1WLCA 3AYEA 5F6LB 4IETA 4YLZA 5BNPA 3ATGA 2HEVF 2AEYA 1IS3A 4L11A 4D94A 1COV3 3S57A 2FDIA 3R4UA 1MZ5A 4G9SB 2AENA 3MICA 4CDUC 1OT5A 4Y22B 4NIGA 5LRRA 3IIIA 3TBDA 5L9VA 4JZRA 1H8TC 1NG0A 2E51A 3USUA 3ZN6A 1YIFA 1TNFA 1COV2 3UJOA 2Z4FA 2E6VA 2WFF3 1CZTA 3AXDA 2ZHMA 3WG4A 2YHJA 5FZ4A 1A8MA 4YG6A 4XBQA 4QPIA 4XOGA 1O4TA 1VMJA 4ZY9A 4BDVB 4CEYB 3MF6A 2WQZC 3ZLIA 2WQ4A 4X8NA 1BMV2 1PGSA 2PHFA 2WFF2 3WUCA 3MW3A 1LOAA 5BUVA 4IERA 2A71A 5G05L 1XNCA 4TTGA 1KD7A 1RUE3 4QWNA 1UYZA 2WNOA 3ES4A 1NLRA 4CDUA 5F7UA 4QPWA 5F3EA 2E31A 5F3CA 3N4MA 1H8TA 2ZA9A 1X8EA 4N43B 4XW3A 4BZ4A 1GWMA 2ETEA 5A3MA 3NNGA 1TME3 1B35C 1RUE2 3AP6A 2BU9A 2YC0A 4XJUA 5FMBA 5C7GA 4EN8B 2DTYA 2Z79A 1Q8VA 3SEEA 3WNNA 3AZYA 2WJSA 3ZM8A 2MEV1 1RUH1 2Y64A 3MV01 1IPJA 1C5HA 1VBB3 1LHNA 2JDYA 2VOTA 4HK8A 4IEUA 2AACA 2Y34A 1UY2A 1TME2 2WC2A 3D0SA 3BTZA 2JG8C 1EUTA 1DBNA 4D7YA 5L9BA 4I01A 5A3OA 1OF4A 5FPAA 1VBB2 5F3GA 4BU2A 1XC6A 1JYXA 4XZUG 5I0UA 5EJ1B 3WF4A 3SQOA 4F7ZA 3SLIA 1S0DA 4UW6A 2WBKA 2YV8A 4NMIA 5BNPB 5DN2A 5FYIA 1B35A 4JDOA 1I5ZA 5FYCA 3KS7A 4GWIA 4CEWA 2VMEA 3ZVXA 5C6CA 4FVVA 2R16A 4FBFA 4AHYA 1MS8A 4QKBA 3K4ZA 4XFAA 5KXDA 3USUB 1FV3A 3ZN6B 4UF0A 4LA2A 2JG8A 2W1SA 4C91A 5GJ6A 3H8XA 1ULEA 3OPTA 3MDPA 4KNCA 1HV1A 1UN1A 1RUF1 4KBBA 5FMOS 1TZOA 1OLMA 4LBNA 1OOPC 5HI0A 3MUZ1 1AJKA 4QPIB 2OZJA 3A23A 1K42A 2ZHNA 1YFWA 5C3OA 2D5FA 5FYSA 4NWVA 2K9ZA 1FNYA 4B7EA 3OEBA 4MGYE 1KFUL 2C9KA 3Q8CA 2VCCA 3FLTA 1N1YA 4DZGA 4V2WA 2G4IA 3A4UA 3VB9A 4I09A 1VMHA 4YG3A 1GYKA 1YNAA 3THDA 1FT9A 4CDUB 5FYMA 5FZAA 5A7OA 3WV6A 1R1ZA 4D8MA 1OSGA 3DXUA 1H8TB 3KM5A 3OYWB 4FSJA 2GMEA 1HJFA 2I2SA 3ZDSA 4CRQA 3M1HA 2XBO1 2BV4A 2VW0A 4IE6A 1DP0A 2IZWA 4WM7C 5LA9A 2R30A 1AR91 5IATA 2ZPXA 2XHKA 1ENSA 3FL7A 4MSVA 1OOPA 3WF1A 5DUVA 2V73A 3E6BA 2VBBA 3UKNA 1OKOA 5LW9A 3KV5A 2D3SA 1O8PA 2OS2A 3B01A 4BQ3A 5EZWA 4Y1VA 4E4SA 2BBVA 4BISA 3GHMA 1SPPA 2CHHA 1YXWA 4LORA 1KDMA 3UJQA 1BZWA 2OIIA 1HW5A 4HN0A 4QXBA 3SCGA 1S0EA 1VLNA 2GNBA 1W9WA 1BEV3 1G8WA 4OQ9A 1SLBA 5AC93 4Q1RA 1URXA 1YQCA 2D43A 3NNLA 4MUVA 1OMIA 3MLLA 1PNFA 1QHDA 1LGNA 3D4KA 4G3YC 1B35B 1MACA 4YVWA 1BEV2 4WVMA 5EV7A 5AC92 4CEWB 2CDPA 2B46X 3ELNA 5JWPA 3KT7A 4B1MA 3P3NA 2B5HA 4QT6A 1WW6A 2ARCA 1PO13 2QQLA 3MGUA 5J3UA 5L9RA 3GJAA 4SBVA 3ASIA 1ZZ9A 3OB8A 4UF0B 3C7HA 1UU4A 2JG8B 4N9HA 2GMMA 2VUAA 3PMSA 3T0AA 3RZHA 1RHI3 3EYPA 1JHNA 3ON7A 1G86A 5FZ1A 3WLUA 4AFBA 4CXXA 2VOWA 3AMMA 1PO12 1QDCA 3R4DB 5FY7A 3POJA 4XFIA 4B4QA 4QAWA 5J1XA 1RTVA 1XSQA 1LESA 5EWSA 3RZLA 1RINA 2HEYF 2XJTA 3G6JB 4AVCA 3HD8B 4FPHA 4QGMA 1BKZA 2P5BA 1RHI2 5IK8A 3H8RA 2R1DA 4YARA 3CEWA 5FZDA 4AQ2A 4W8JA 3ZO0B 4IEPA 3WNXA 3U11A 2GALA 2VY0A 3SH5A 2E7TA 2ZX0A 4ZZ5A 4YGDA 2GU9A 4JCKA 5A3LA 1S2KA 4FFGA 3NAPB 2VVFA 3WZ1A 4GULA 2QJVA 4Q29A 2ENRA 4HKOA 4Q5OA 3RRDA 1KRIA 4X8PA 2FDKA 2Y8KA 4Z82A 1ZA7A 4META 1OOPB 1IG0A 5FOBB 3ZXFA 4R8HA 1R081 4JGYA 4X6RB 1YQ2A 3NV1A 3OJBA 4LTAA 3VDAA 2WN2A 4E8CA 1SMVA 3AZVA 3GDBA 3JB8A 3I3BA 5JDBA 4XMAA 1UPIA 1WCQA 1UXXX 2W52A 4KWJA 4Y33A 2OYZA 1SFNA 3ZYBA 4CPBD 3BOWA 3D3AA 4OHYA 3RZJA 3JBG1 1NLQA 4QQ2A 3ZKUA 4IESA 1FNZA 3J7HA 1SHWB 2JDNA 4EN9B 1AJOA 1YUDA 4COVA 1X7NA 1CQ9A 5C70A 4DOUA 4K7JA 3FX3A 4YVWB 4I30A 3VBHC 4WVMB 1X33A 3E5QA 2BVVA 1O4YA 2EAAA 1X36A 4CCEA 1Y4WA 1SZBA 2ARBA 1PZ7A 5FUPA 3GM8A 3WSOA 2FQPA 1NCQC 1RMU1 2XJSA 4BCUA 3GHNA 5JIUA 2VUDA 3H3ZA 1C8M3 1OD5A 1JHJA 4IL7A 2WZPP 3RMXA 5EQUA 3MIBA 3VBFC 1QJX3 2XQXA 1APNA 4IEXA 3AL5A 2A5ZA 1JUHA 3JQXA 1GKBA 1SCSA 1WCUA 3D6EA 3LSEA 2ORZA 5FYVA 1F35A 1WD4A 1NCRC 1C8M2 3RGBA 4UBHA 3OG2A 2JIGA 4W6WA 1QJX2 4FPFA 1RUF3 5JVVA 1POV3 5F3IA 5A3PA 2JE9A 5IVYA 1Q8PA 1QGLA 4NPRA 4XZPA 1W05A 4Z2AA 1H9PA 4AWDA 3HBZA 1VRH1 4Q4V3 1Y9MA 4CCNA 4L2NA 2EICA 2HWE3 4AVAA 1NX9A 2VAUA 1RUF2 4PI0A 4AQTA 2X5IC 4XIOA 3NKTA 5BYNA 5C5UA 2RMU2 3VBFA 1J3QA 2PHWA 3CMGA 4Q4V2 2KM2A 1YI9A 4JGYB 5FTTC 2HWE2 1DGWX 1VPHA 1DFQA 2Q4SA 3MW2A 2VNGA 3N9MA 2XBO3 4AAPA 2GNDA 5A32A 4CU6A 4TLFA 4AK3A 4ATFA 3I2HA 3J7LA 3FE5A 1HKDA 3UGGA 3PUQA 4WM8C 1Q56A 2D6PA 1FATA 1PM4A 4ES8A 2XBO2 2C1FA 1LAJA 4NIAA 3VBRC 1QQP1 1SBEA 3OUIA 4OMDA 1CIYA 4GJZA 1W0NA 4NO4A 2X5IA 3UT0A 3VD4A 3TEZA 3ITQA 3KSCA 2JB4A 1N1VA 1NY72 4XQWA 5A3WA 4C1XA 3QH6A 1M06G 1DDLA 2IXLA 2DDUA 3O1RA 3WQ7A 5HPOA 1KS5A 2JDHA 2ZOEB 5FY5A 1OUSA 1UOBA 3EBRA 2RJ2A 5JCTA 2VBDA 3MFCA 4UFKA 1ZA4A 5CKMA 4YZ5A 2V09A 1AR73 4WM8A 1SLLA 3EJKA 3U14A 4FOVA 4IEQA 3I2IA 1G7YA 3KV4A 5FPBA 2GDFA 4RFRB 3VBRA 2BNMA 4W50A 5AVPA 3ZSLA 4B29A 4XFGA 2QNKA 1VALA 2VBPA 1AR81 3OY8A 1JZ4A 4ZONA 5A70A 4BXSV 2XJUA 2GAUA 1AR72 4GKYA 5FYUA 5I0TA 4Q0PA 1OVSA 4Y1ZA 2RHPA 2LRPA 1JH5A 3C7GA 4HBNA 3AMHA 4XJWA 4D0QA 3WW3A 1V6LA 1GLHA 4LK6A 3OUJA 4UFMA 3RMYA 1GANA 3AFKA 1HB2A 5M0TA 1GUIA 4MH0E 2RS51 4CU7A 3HVDA 4MHRA 3BTAA 3MIDA 1G9AA 2FHRA 5GLTA 3VBFB 3RNSA 1JU4A 2RS11 3H3UA 4OHWA 2W0XA 2WZ8A 1H30A 3PU8A 4AG4A 2IFRA 1QU0A 4A41A 2FDGA 2D98A 2ILMA 1W9FA 4S2GA 1RUJ1 5FPUA 5BPXA 1S2BA 3S0MA 5A32B 2YG0A 4YVSB 4AEMA 4AVVA 2BPA2 2PN5A 4WVWA 2ZBJA 5CISA 1VRBA 2JWPA 1O59A 2ZGMA 3CO2A 4FPCA 5ERLA 3P5BA 3POEA 4EJRA 3ABZA 4FFFA 4BJ0A 4LO7A 5FZ9A 5IVFA 1ULDA 2XJQA 1C8NA 1D2SA 1NT0A 1RUG1 2X5IB 3IAPA 1LOCA 4YGEA 3DGTA 1W39A 3TEXA 1L7QA 3JBG3 4HSLA 4COZA 5L7OC 3ZXKA 2ZEWA 2VU9A 4U2AA 4P14A 3J7MA 2ZJCA 4FP2A 5GLVA 2FCUA 3VD3A 4BMEA 3NVCA 1OQEA 2PELA 2WNUC 3RG0A 4M00A 5D2AA 3N7LA 3OBTA 3Q8FA 4OHVA 5FZMA 3JBG2 3T4VA 4LO4B 4PQQA 1A6CA 1EPZA 2PAEA 2XG3A 1BBT1 3B02A 1ACCA 4PF1A 2RS31 1LU2A 2UWBA 4GA9A 4WM8B 1UW8A 2WLPA 2ZKLA 3PDQA 2QVSB 3WVJA 3AXEA 4PIXA 3VBRB 1QH6A 1W6PA 5SV8A 2JECA 2EXJA 3OY8B 3M3OA 2CWSA 1AXYA 2AUYA 5BNNC 4AGGA 4CU8A 1MZ6A 1L3JA 2PHRA 3JQWA 1UKRA 2UU8A 1NXD1 4QKFA 5H9QA 1PGL2 3VDDC 1PIV3 5CZKA 2WNUA 5L36A 4JC1A 4RS5C 5GM0A 1LOBA 4CPBA 2XPJA 3N35A 3DECA 3AKPA 3NSTA 2A6YA 3URFA 1RB8G 5TSWA 5F5QA 3T1MA 1DYPA 4MXVA 4ZPIA 5FZBA 4URAA 5DMYA 1UAIA 1PIV2 2XUMA 3FC0A 4QDQA 4K9SA 4XEZA 3WOGA 4AVSA 1ZZ6A 1LRHA 1DQ2A 2BERA 4CA9A 4K40A 4MZUA 1I6XA 3IN9A 5BNNA 1MQTA 1BK1A 1U5IA 2P6HA 2Q1FA 3CU7A 4LHKA 4QB6A 2FBEA 4G4FA 3FN9A 5C3PA 2CY6A 2VVDA 1YRZA 2WS93 5FKCA 1SLIA 2OPWA 4RS5A 4EWEA 2JJ6A 3HQXA 3U07A 3U10A 2RM21 4BQXA 4C8DA 5LBEA 3IPVB 2DVBA 1VBA1 1PGW1 1V00A 1RUI3 2WRAA 5JUVA 1TMF1 2WS92 4LOTA 1PX3A 3KCXA 4KBZA 5IJRA 5FZOA 1UF2C 1DGLA 4NIIA 5JOYA 4O9EA 4OUMA 5HCFA 4GWMA 3GJBA 4FPKA 2LM3A 2JD9A 1GQGA 2WO1A 2W94A 4RR3C 3W5MA 4LBOA 1MS9A 4DXZA 5K9YA 1RUI2 2ZEYA 1UY3A 3ZPOA 3ZFGB 4N7IA 5GLWA 3HT2A 2WQ8A 3WNMA 1W6PB 1ZM1A 4XQDA 3WQ1A 2ES3A 4KWUA 2Y6JA 3B94A 4HETA 5DUWA 3SC7X 4K6BA 5DDJ1 5BNOC 1ZX5A 3ZXEA 5EYXA 3MEPA 1ENQA 1QXRA 4QB1A 1GP4A 5JXGA 1X9TA 1JZ5A 3PTRB 4IGQA 4JTNA 1XE7A 4RQPB 5FMDA 4D69A 4B8EA 3V0BA 3GYDA 2YBPA 2K2SA 2WNUB 2MNGA 1IKPA 2H6BA 1GR3A 1QMJA 4YNIA 3NV4A 2PXJA 3BU0A 4PBPA 3WD5A 3W21A 2YC4A 1UMIA 3WINE 2J22A 4DMIA 5JPNB 1CONA 4B1LA 1QNWA 4F8AA 5APAA 1AYM1 5I91A 3JB4C 2W39A 2Z2SB 3H1MA 3MLKA 1JYCA 5CYYA 3VN4A 4TXWA 1US3A 1LULA 3ES1A 2EXHA 3U0ZA 3I2OA 4RYDA 2NPIA 4EE2A 1H1AA 1MQTB 1S0CA 4AZZA 4V2VA 1R092 5JSOA 1RUC1 1YLLA 5FLJA 1LTEA 3E6DA 2P1BA 4XTMA 3WQBA 3NJXA 5T3NA 1FMD1 3OCPA 4AEDC 2V4VA 3UNPA 4RA0A 3IMNA 5D8AC 3VKNA 5DZGA 1JUIA 2P17A 2FCTA 3B7MA 3AX4A 4J1XA 1JBCA 3THPA 2B4KA 2WNVC 4OMCA 1MS1A 2YY1A 2DU0A 2YYOA 1QJEA 2PHUA 4P9LA 4HOOA 5FZOB 5FXZA 2HBTA 2D44A 5FZGA 5ACA3 3NQHA 2VZQA 1XU1A 5C4WC 1LB2A 1XSRA 4NRMA 3O1UA 4CXYA 3O0XA 3VL8A 3ZXDA 1W28A 4H2AA 2EXIA 4Q4X1 3SHRA 3MPBA 4QHZA 3I2JA 5ACA2 1Z7S3 1LODA 4W6XA 1QEXA 4AYUA 4AEDA 1MEC1 1CAVA 2FMDA 2OW4A 4J1WA 2VZOA 3FHIB 3H3LA 1LENA 4Y1YA 5D8AA 1BBT3 4CCCA 1I1EA 3ROUA 4L8QA 3S30A 2ZHKA 4C90A 1QKQA 2WNVA 4IE5A 4XFCA 4FOQA 1HXS1 1Z7S2 1Q8QA 4MOAA 4OYUA 5DZEA 4CE8A 4LUKA 1MS4A 3BCWA 1WGPA 2DCTA 4Y20A 3RZMA 2WT2A 2QQPA 2VXJA 4KG0A 3KVAA 4JGZC 2LS6A 4RHV1 5JZGA 1VBD3 4UW5A 5C4WA 4Q0SA 3HQUA 3ZDVA 1RUD1 1KJLA 2IXCA 1WW5A 3S6PA 4HKLA 2A3XA 4QKDA 4RGKA 1F31A 2JE8A 3MYXA 4ASKA 5K7PA 5HCAA 4Y22A 1D4M3 4C0BA 4COWA 1DYKA 1LHOA 4FP3A 3I3QA 5IAVA 3WW1A 1VBD2 4DPNA 4JDMA 1C4RA 4AI1A 2UY8A 4HMZA 4LHNA 4M3CA 4R9CA 1MVEA 2LUWA 2GC2A 4LXLA 3B9CA 3KCCA 2J7MA 2UWAA 1D4M2 4JRAA 3UGFA 3BIEA 4P5HA 3ZYGA 1KEXA 3MLJA 4CSWA 4YW6A 2GNMA 2Q8EA 1GZCA 2HWB1 3AMQA 4JGZA 1G9CA 2O1QA 2VC9A 4AEKA 2OQ7A 3AL6A 1ZBA1 2DFCA 5DG2A 4S2DA 3ECQA 4LKDA 4LO8A 5LK5A 5FJKA 1K12A 3PURA 3SKJE 3RZKA 1U12A 3TN91 1CESA 1CPNA 1I5PA 1KJRA 1HRV1 4BXFA 1A8DA 1HDKA 2B9VA 1SDWA 4HZFA 2J1UA 4FI9A 2F4LA 1W90A 5LBFA 5LBCA 3AP7A 2C26A 2PA7A 2Q0AA 2YUEA 4GWNA 5IFTA 4K21A 4LBLA 5C33A 2YU2A 3S7EA 1H2KA 2Q1MA 1CAVB 2WO3A 3FMGA 4QPYA 3P1IA 1EP0A 5D8AB 2KD7A 5CFDC 2OKXA 2DWRA 2JEMA 2IC1A 2GP5A 1WMDA 1YCIA 3IB3A 3SKVA 4ZS2A 4Q4W3 2X53S 4Y20B 4XUNA 3M7AA 3J8F3 5FYYA 1REEA 2X10A 4LE4A 2YGLA 5DDJ3 3C7OA 4I0BA 4XF9A 5JZGB 3HNBM 5C4WB 2WT0A 1WWYA 1WA4A 3E1F1 5FPZA 1XJAA 3O5SA 1HV0A 2PYTA 5T5LA 1ULCA 1LHVA 3R4SA 4OI1A 3WEZA 4E27A 4NIHA 4Q4W2 1H4HA 4QX1A 4YW5A 5A80A 3J8F2 2LW8A 1IG3A 4MGSA 5GLUA 4OCTA 4YZ1A 1BYHA 1UOJA 5DDJ2 2OUJA 2H0VA 4XJ9A 3H9AA 2ZGLA 1S1AA 4KL1A 4M3CB 3J4UH 3H8UA 5CFDA 5L73A 1QJU3 1OFSA 1YFUA 2W1WA 1S0GA 4QHBA 4YYOA 3VD9A 4XBLA 1AYM3 4QHOA 1MVQA 1IGOA 2QFEA 1ZZ7A 5A6ZA 2RDRA 3O0VA 4GB33 3W58A 1UU5A 2P4EA 3BYWA 3K3NA 1DQ0A 2GZWA 3O12A 1QJU2 3OBRA 4JGZB 3FHQA 2TUNA 5FBZA 4Y5Z0 4EN6B 2WA3A 4I3PA 1S2EA 3T3YA 1OA3A 3GXUA 2TEPA 1BHGA 1QXPA 4GB32 4KU8A 1FOD3 1ZNPA 4YW4A 2OUHA 3K48A 1SLTA 3OYWA 2ZS6B 2WYSA 4CCKA 5FZ3A 4AGRA 3WT3A 2FZ2A 3UL2A 5JPMB 1PZ8A 4GWJA 1STMA 2ZX4A 5KXBA 3POBA 1OHFA 4CEWC 1FOD2 2XQRA 3SH4A 2BEOA 1W8NA 3CJXA 4LR4A 3SEPA 1O4ZA 2P34A 1RVF1 4KH9A 5E88A 4XETA 1S4CA 2DF7A 4DEQA 5EIYB 4ASLA 4XF1A 4BLJA 1HRI3 2XVLA 4NRQA 3CIHA 3WNKA 2B8MA 3J26N 3Q9OA 1MS0A 3VBUC 4K3UA 1DHKB 5A7NA 3MPPG 5A1FA 2GC0A 3WCSA 5J96B 1JYVA 4COUA 2XUEA 1J3PA 2QQIA 2Y26A 4XF3A 1YFXA 1QOSA 1HRI2 3HQRA 1Y43B 1N47A 1IS4A 5G04L 2JDPA 2RG4A 3KWVA 2XONA 4PJYA 4K1YA 2E26A 3B5LB 2A75A 3ACGA 3AB0A 2ZHLA 5FP7A 1RC6A 1BXHA 3KF5A 4N90A 4U36A 3Q8BA 4KMQA 5KC6A 3D0JA 3AP5A 3PVEA 2J1EA 2P2KA 1ENXA 3NAPC 4RHV3 3F95A 3LCPA 3ZSKA 4TYSA 1J83A 4XDPA 5CFDB 4QX2A 4XUTA 3H8OA 3NWKA 4V1PA 3PU3A 2XVKA 3AJZA 3VBUA 1VBC1 1VBE1 4XQ4A 1QJY3 2Z5WA 1RYYA 1W04A 3KV6A 4RHV2 2X09A 1NE4A 1SFPA 4NUBA 1GNYA 2JDKA 2VD7A 2HWD3 2VECA 5DUUA 5ANQA 5ANNA 5LY2A 3WR0A 4CP0A 5LA0A 1YQ8A 2HWC3 3MIHA 1N3PA 1DZTA 2Y0IA 1LNSA 2D6MA 1QJY2 2UYBA 1DQ4A 3OGVA 3I49A 1X82A 1CAUB 2I07B 2W68A 5F5CA 4DEVA 4JKMA 1S0IA 3KV9A 1PMJX 3KQRA 1WMXA 1W8WA 4OVEA 2HWD2 2V72A 1ZZCA 2VNVA 3NAPA 5DAQA 2BWAA 2HWC2 4YVWC 4FAHA 2K0GA 1NLSA 5GZCA 1J59A 2YROA 2HWF3 4LHLA 5FUIA 3PJYA 2RR11 4ZXKA 3AC0A 3I54A 1PVC1 1HRV3 2HH9A 3GZEA 4JVAA 5FZ8A 5T52A 2AC1A 3CZUA 4IEZA 1DZQA 4LBQD 3T0BA 3UKVA 5JOWA 2HWF2 4LBMA 1VMFA 2AYHA 1ALYA 2PQQA 4DUXA 2R071 3POSA 3USSA 2BRTA 1XOYA 3OGRA 3RPQA 1HQLA 1RXGA 3NJYA 1QOOA 2JDAA 4SLIA 4OUEA 5KC5A 1QOTA 3OGSA 4HVRA 2BVBA 2BBAA 1M4WA 3H50A 4UT5A 3E5UA 2VMCA 2HYKA 5FZCA 3VZKA 2R041 2WZR3 5EFUA 4BQ2A 5FO9B 5HCHA 5A33A 1U5ZA 4CUAA 1TNRA 4CXWA 1V6OA 4N53C 3M3QA 1Q43A 1QWRA 2P3KA 3IWZA 3KT4A 2JICA 2GC1A 2WZR2 3VBUB 1D7PM 5FPLA 4JGYC 1K3IA 5E89A 3MHZA 4DY3A 5A3TA 3O7OA 1Z78A 4P02B 2NMNA 1LGCA 4DO0A 3S5AA 1UU6A 3K4DA 1XE8A 5A3UA 3C3VA 1V9U1 4BB3A 1ZRRA 2C6SA 1F5FA 2W1UA 3OD0A 3RWKX 3MIGA 2BNNA 4HFSA 3OF1A 4JX0A 4R9DA 5IW0A 2E7QA 1Q5OA 2OVUA 3N3HA 4EZHA 5CG8A 1DCSA 4AQSA 3M2MA 3RYKA 4A7YA 5IWFA 3IBMA 4AI8A 4N53A 1J84A 3AYCA 5T50A 1AVBA 2ADEA 2MPFA 4D3WA 3ZXGA 3WP3A 3POGA 4AW7A 5LEJA 4D7SA 1AXZA 4ZXEA 2D3PA 1VIWB 3I59A 4ZS3A 5F9TA 3IMMA 5CU1A 5J37A 5I8YA 3NO8A 1JS9A 2VXRA 2QBXA 2LALA 1EUUA 3QCWA 5FZFA 2JD4A 2OQ6A 2VUCA 5DPNA 4XIKA 1DG6A 2GP3A 2BNOA 2CGOA 2WAAA 2MEV3 1POQA 1RUH3 2DCZA 2BWCA 2Y0OA 2ZX2A 4UFIA 5F6KA 3RZZA 4CP9A 4Q4Y1 4WZCA 3HWJA 4K8RB 3WDTA 2QDNA 2P6CA 2RV9A 5LA2A 3U78A 2YBKA 2YMZA 1YIPA 2Z69A 1CAWA 1GFF2 1R1A1 1RUH2 2MEV2 4YRDA 2PHLA 2IFWA 5FMCA 3I3MA 3M3IA 4A7ZA 3FLRA 4LOSA 2LTNA 1UKGA 4GIQA 3TEWA 3ETPA 3R0RA 5A33B 3R6SA 4QX5A 2CGNA 5FP4A 2VH9A 1RIRA 2A1XA 2KR2A 4B3NA 4CYDA 5EP9A 4Q8KA 1ASJ1 1KITA 2C0ZA 2V5YA 3PUAA 2ZXQA 3Q8EA 5FQ0A 4QX7A 1DGRN 5IK4A 3PL0A 2AH2A 1NOVA 4A7KA 4MYEA 1W2UA 5KHJA 2VTFA 4JQTA 4LO6B 4YVSC 2E9QA 1OLME 4DXSA 4S2HA 1VBE3 1REDA 2J1SA 2DBIA 3UYJA 3FUOA 5GLZA 3DYMA 2VVEA 4PIZA 1QF3A 1EV11 2W9XA 1UQXA 1W8ZA 1YO8A 4XE9A 3ZN5A 5EXOA 4MADA 5J09A 4LBJA 1IPKA 4N53B 2VR4A 3PNAA 5AVAA 3ZIWA 1UCXA 1VBE2 1T6BX 5JSPA 5AFBA 1F4AA 3CKHA 4BIFA 3NL1A 1NA1C 2J1TA 2W92A 3WUDA 3AFGA 3IDCB 1DQ1A 5SV5A 5CAZA 1GSLA 3I59B 2CDOA 4XCAA 3I7DA 3AP9A 3LFIA 4OFGA 4YW1A 4AFDA 4PHZA 3PUHA 4PQ9A 5J7MA 1GBGA 2GN7A 3NRUA 1AR93 2QZ2A 4NHLA 4YVSA 4NJ4A 5CB7A 1ZRFA 1GOHA 2ZGKA 1SACA 4M3CF 5JI9A 1SQ4A 4CP9B 4F83A 4LA3A 2PMWB 2HYXA 5FYZA 3T1LA 1CR7A 1OKQA 1H2NA 2VG9A 2ZKNA 3VD5A 5KR7A 3PJQA 3V0AB 1AR92 1IOAA 3DKWA 3AYAA 1UZYA 3CZJA 5LB6A 1LCLA 3LZZA 2FDFA 1CAWB 4RGGA 2AREA 2O14A 4WZFA 1NA1A 4LQRA 4OHZA 2EIEA 4AVBA 2AZ5A 3P3PA 5A7QA 3M3EA 2CNAA 4D6SA 2E7AA 5JR2A 1F8VA 4UW4A 5CKQA 4AI0A 2NM1A 1BK0A 4UI9L 4K8FA 5FPVA 1BJQA 4Q8LA 1XU2A 5FQ0B 2J1AA 5A7PA 1SCRA 1HQNA 1TG7A 1WLDA 2ADDA 3A0NA 2A7AA 4LLOA 1OPOA 1OH3A 5T5JA 3WDVA 1X8MA 1JW6A 1PMHX 3BTXA 3KB5A 3FFQA 4FFIA 1CX4A 3BB6A 2L9LA 4NHYA 1CJDA 1JU3A 1YJKA 4UAPA 1EAH1 4B4PA 3MZHA 3H0OA 5BV6A 3T09A 4YZ2A 1O5LA 3MV11 3EXUA 3HIFA 1KXGA 1QH7A 2RJKA 1VAKA 1OLQA 2VZRA 3DYOA 4GMP0 2R49A 4LBQA 2VL4A 2VMIA 4X6QB 3ZN4A 2VM9A 5ABJB 4E9KA 5FCCA 3TAYA 1XNAA 4XJ8A 1AZDA 5D21A 1AXKA
chains in the Genus database with same CATH topology
2Q8OA 5KHIA 1LHWA 3QBQA 4INDA 2ZTNA 5FO7B 2I45A 4P9JA 3ZPYA 4IV1C 1DF0A 3RI8A 1O3QA 3NKGA 1R083 4XXAA 3ZFGC 5JR7B 3E97A 3OTFA 3ILFA 2XL9A 5IK5A 3FBYA 5AFEA 1R082 5GZGA 1NA1B 3IPVA 1LGBA 4FPOB 4Q4Y3 1TQ5A 1WBFA 4RQPC 4TSVA 4XJAA 4IV1A 1OQDA 4Q4Y2 4QGNA 1KDKA 1WLWA 3DPRC 3ZFGA 1RMU3 2JG9C 2VQ0A 1MZEA 3WDXA 4OHXA 4CDQC 1XXNA 4TZDA 3WDWA 4FTSA 3RYRA 2ET1A 1MQTC 3FJSA 1RMU2 1V6IA 4AHXA 1DU3D 1OFNA 1RL3A 4FPJA 4RQPA 2ZABA 3O0WA 2QKDA 4LBQB 4GMP1 3GBGA 4XJZA 2VOXA 1AL21 1VR3A 3DV8A 4BOWA 4K20A 3SNMA 1VRH3 3DPRA 2JG9A 1EV13 2DTWA 4QU2A 3WCRA 1SLAA 4CDQA 1WMEA 2NN8A 1VRH2 2CAVA 5I8SA 1O5UA 4PDWC 3FUQA 1Y9QA 3CJIC 1WBLA 1WUVA 3U4XA 1S55A 5FFOC 2Z42A 1ZBE1 3TB0A 3JCIA 2GH2A 1BVVA 1EPWA 4AI2A 1QJZA 5LK7B 2PAKA 1QQP3 4E4ZA 2WINB 5C9AA 3QOPA 1LHUA 2EVXA 1ZVFA 4Q2FA 3BALA 4NWWA 4IV1B 1RJ8A 3VKLA 1PO21 1AYN1 1UIKA 1D4VB 4AE2A 2CWMA 4FPYA 4YZ3A 1QQP2 2R6QA 5JIAA 1PM7A 4PDWA 4CP2A 3CJIA 3KCYA 1Z0HA 3RQ0A 2ZACA 2ZGNA 3H1YA 3MW4A 2VULA 1S0FA 1D0GA 1EYBA 3DL3A 3GNEA 3B00A 4ONUA 1FYUA 3L9JT 3VBOC 1C3HA 4BH9A 2DVAA 2ZAHA 3JD71 3AKTA 1NQDA 1AR83 3RSJA 4Z2WA 1DLLA 1WCDJ 3PMEA 4YG0A 4JTOA 1VB4A 5EJ3A 4R4ZA 3AKSA 5JMCA 3DPRB 2JG9B 1AR82 2DYCA 4HPKA 1OI6A 1V6MA 2RS53 3ZFFC 4CDQB 3D82A 1COV1 3FLPA 2RS13 2TBVA 4Q26A 5HBAA 2C9AA 1MZFA 5HXVA 1A3KA 5H9PA 4AHWA 4BWOA 1RUJ3 2RS52 4H7MA 3WX5A 3TOJA 2R1BA 2GMPA 3KMHA 3VBOA 4AFMA 3ZMNA 3M3CA 1BMV1 2RS12 2WFF1 2A6XA 2CAUA 4LE3A 4Q27A 2VMGA 5K0UA 1QDOA 1RUJ2 3AM2A 3IM0A 5KBFA 3GZTB 1SLCA 3OPZA 1J58A 3ZFFA 5C9AB 1RUG3 2XH6A 4NHKA 2O8QA 5JZGC 1RUE1 2B45X 2JENA 3ZSMA 1AR61 4QPGC 2HJIA 1JTZX 4PDWB 2WT1A 4QGLA 4Z8BA 3CJIB 4KWLA 2VMHA 1RUG2 1TME1 1AX0A 2VNOA 5K8SA 2RS33 3KGZA 5CFCC 1PZ9A 2AR6A 3GBFA 2NZ9A 4XILA 1QY4A 1VBB1 4IEVA 4BA6A 5CIRA 3LOBA 5JLVA 2F4PA 1RUNA 3AKQA 1BBT2 2RS32 1PNGA 3LB9A 3VUOA 3AP4A 3NV2A 4E4DX 1W0OA 4Y4YA 5FREA 4QPGA 1ONAA 2ZGSA 1LJ7A 4EV0A 2DVFA 2ZCWA 4BMBA 3ST7A 4QQOA 4NR1A 1YYNA 4HPKB 4EN0A 3M8LA 2VGDA 4BQ1A 2XLAA 5FAXA 1VB2A 1NE6A 5C8CB 3ZYPA 5CFCA 1Q8OA 4HVQA 4QQLA 4FPGA 2DVGA 4DRRA 2JKBA 3MFAA 2WWSA 1NQJA 5CVRA 1CIWA 3VBOB 1BCXA 2DCJA 4FAGA 5KWRA 1DGRA 2GH8A 4GKXA 5K0UB 3MIFA 1W6QA 5JOXA 2C5DA 3V56A 2ZMLA 1XQNA 2H6CA 4LEJA 1ZBE3 3ZFFB 4P9XA 2BQPA 3GZUC 2RE9A 5B2GB 1E57A 2RM23 2ZX1A 4Z07A 3AZWA 4BHPA 2DCKA 1VBA3 4MGZE 1YI7A 3FWEA 4PLMA 1TMF3 1ZBE2 4M0NA 1HIXA 4PCRA 4ATEA 2P3JA 4FQ4A 4NN0A 4O9GA 2RM22 4C1WA 1O7FA 4W6YA 1VBA2 1PGW2 1AYN3 3UKTA 2D6LX 1N1SA 1TMF2 3O14A 2WNEA 4P9WA 4J6GA 3B9IA 4IXLA 3JZVA 2EAKA 3M70A 1ZRCA 1AF9A 2VUJA 3LA7A 4LBKA 2ZGQA 2ARXA 1BEV1 2DV9A 1JXNA 4QPGB 5AC91 2IXJA 2BUKA 3T2TA 3JD73 4IV3C 4PLNA 2B7YA 4DS0A 3ZXJA 1FV2A 4YGCA 1S0BA 3RJ2X 1H9WA 4KGQA 4FTBA 3M4FA 4RGAA 4XMIA 5LEKA 2JE7A 1YJLA 4YFWA 5CFCB 2DUPA 4BLIA 4BE3A 3JD72 3AZZA 1U5YA 1PO11 3GBWA 2XJRA 1MS3A 1KQRA 4CP1A 3GF6A 4XPVA 3L2YA 4AVTA 3ZXAC 1RHI1 4I3GA 1C1FA 4FCAA 4H7LA 1RUC3 1AYM2 1W6QB 1XNKA 3D8CA 4N9IA 1CAUA 2WIIB 4KU7A 5IUQA 4OLLA 3VZJA 1O91A 4XYXA 2B9UA 1FMD3 2R0HA 4ISRA 3X29B 2EF6A 1W6MA 4IV3A 1POV0 1H1MA 2NP0A 1AUYA 4YW3A 1RUC2 1XYNA 4K1ZA 3ZYJB 1FMD2 1VP6A 1MR5A 1MS5A 2IWGB 5GZFA 4MGIE 4OULA 1Q8SA 2YDEA 2QZ3A 2VNRA 3W9AA 1ZREA 1N3QA 2H0BA 5C8WA 1AR63 1C28A 4Q4X3 1NYWA 2BW8A 3DF0A 1IS6A 4PIYA 1MEC3 4L99A 1UZZA 3ME2A 2B39A 1AR62 4YM3A 1U0AA 2P37A 4Q4X2 2WL1A 4ASMB 2KA3A 4DY5A 1RGSA 4R9AA 5T5OA 1HXS3 3ZXLA 1MEC2 4M0HA 1XNBA 3RYPA 3VHNA 3ZSJA 1PVXA 3WP6A 1VAMA 5E16A 4N7UA 1RUD3 2SLIA 3VKFC 3POYA 1HXS2 4FTEA 4FO9A 3POWA 3HN1A 2UURA 3WQ0A 4FOYA 4GQ7A 1RUD2 1C8M1 4IEYA 2B42B 4M3CE 2VQAA 4WVZA 2VPVA 1QJX1 3UV9A 4W65A 1H0BA 1XNDA 4BPZA 3TRSB 3RWNA 1LR5A 3VKOA 1YFYA 4IV3B 1W6MB 4H3WA 2HWB3 2ZZJA 4Y24A 5JOZA 1POV1 1ZBA3 2ZGPA 5L19A 4YGBA 3LKJA 2RMU1 4AEJA 4Q4V1 4FXGB 1XYPA 2D40A 2D93A 4HT1T 2HWB2 2HWE1 3TN93 2PTMA 1ZBA2 5GKAC 1NZCA 3N36A 3BIWE 2GN3A 2G9FA 4XHXA 3NV3A 4NHMA 4DINB 1IKQA 1I9RA 2A6ZA 3OD4A 3VZLA 4CDWC 3B93A 3VHPA 2SBAA 3B3QE 4EWAA 3TN92 4FXKB 3E6CC 1ZZBA 1HRV2 1IS5A 1WLTA 3UK9A 4XFFA 1FPN1 3D5OA 5CADA 1NXMA 2A70A 4RD7A 4AQ6A 1NY71 2DURA 1HX6A 3ZX7A 1REFA 3N7MA 3QD6A 5FOJB 2WKKA 3LA3A 4XF4A 1LU1A 3AMPA 4IQPA 4LLFA 1O3RA 5IK7A 2ZMNA 4WBBA 4DRVA 4XHBA 5DZFA 4CDWA 2F6BA 4COYA 1K5MC 4YM1A 4LULA 2XB6C 4A2UA 2QE3A 1V6NA 2X8KA 4WM7A 1OPMA 2QUOA 3WDUA 3OGGA 5LRSA 4RFT0 1D0HA 1AR71 4XBNA 2P3IA 4RL7A 3WXPA 4NVPA 3QLQA 2XL7A 5T55A 2XWBB 3QH7A 4YM2A 2WSUA 3IDEA 3SMHA 2ZAAA 2DCYA 3CL1A 1J1TA 1RITA 3VLBB 2ZGOA 3ZYRA 4ZKTB 3AK0A 2VW1A 1K5MA 4H55A 4B4RA 4E2GA 3K51A 1AX1A 4MGKE 2D6KA 3H7JA 2BTVC 1HLCA 4OI2A 4HK9A 3HAGA 1PHMA 3V0AA 1RVF3 4KG8A 2DVDA 1LECA 4E2QA 5JWPA 2YGMA 2XGXA 3C2UA 4ISQA 1IZ3A 1KFXL 2XKPA 2EALA 2ZMKA 1CAXA 4MLOA 4QQHA 1FI2A 5I0RA 1RVF2 2NQYA 3WP5A 4BYYA 1C1LA 2QCSB 5DUXA 3CLPA 4JDNA 1G6NA 1LOFC 5ABJC 1A78A 3KD4A 3SXWA 2CGPA 4P9GA 4Y26A 3BPZA 2A73B 4CDWB 2XVGA 3N7KA 4WM7B 4MXWA 5FRAA 1OA2A 3FZ3A 3CF6E 5FO8B 1UL9A 4QXKA 2X29A 1ZYBA 1VBC3 1WCSA 1BQPA 2A6WA 3PVOA 5GZEA 4BM8A 4BIOA 1G9BA 4DFSA 2AGSA 2VOKA 1PGL1 2DUQA 4OZXA 3ZYIB 3CNAA 1LOFA 1VBC2 2A3WA 2JX9A 5ABJA 5I8TA 5J36A 2WSVA 2D6NA 3AZXA 1K5MB 1PIV1 2GC3A 2Q5TA 2EXKA 3PLQA 1TE1B 5BY5A 1LEMA 3VBHA 1DGWA 2VW2A 5DXDA 2RMU3 1AX2A 1J3RA 4JRLA 4JAAA 1VJ2A 1W0PA 2PHTA 1NCQA 3BODA 3SISA 2RR13 4S2FA 3WY6A 3R05A 1PVC3 3VZMA 4WV8A 3V65A 4KWKA 2BFUS 1CJPA 1XYOA 5KHKA 1CAXB 4XF0A 2RR12 1X50A 4LT5A 1PVC2 1NCRA 1OLRA 2R073 2NYYA 2WLQA 4MX3A 4LNVA 1ZZ8A 2OPKA 5CG9A 2WS91 1FPN3 1H4GA 1ULFA 3HMYA 3VBSC 1V70A 4OI0A 1CGPA 1JYIA 2R072 1J1LA 1RUI1 1UD1A 2R043 4HKWA 3ZFEC 1FPN2 4OUSA 3JUUA 2UWCA 3B69A 2CYFA 4MXWB 4OI4A 4Z92B 4HVOA 5JSRA 1N1TA 2CV6A 1DQ6A 2R042 3VHOA 3N7JA 2DFBA 4C0HA 3MF9A 5BXXA 3TNPB 2EA7A 2UY9A 2WFPA 4XFBA 1ZRDA 3IT8A 2OA2A 1FX5A 4D7TA 1WCKA 2BYVE 3VBSA 3IKWA 1V9U3 2IXIA 3RS6A 2HEWF 3V64A 4YM0A 1ENRA 4JV4A 2FZ1A 3ZFEA 1DIWA 2R061 4IEWA 2VOVA 3PHMA 4Q0UA 1I3HA 1V9U2 3VBHB 3QACA 4HL0A 1CPMA 2G9GA 3HR9A 3S7IA 1C57A 2R32A 1NCQB 1R091 1LEDA 4LO5B 5GZDA 2D3RA 4L97A 2GNTA 1H2MA 2ATFA 3PVNA 3ZMOA 3LA2A 4H14A 4KQ7A 2YZ4A 2XJVA 1NCRB 5CBLA 1GZ9A 2EIGA 5CA6A 1ULGA 1XRUA 5JAXA 3THTA 3OGJA 2E53A 4Z1VA 4KGGA 1R1A3 2YPJA 4GH4C 4HANA 4EROA 2E63A 3AYDA 1GNZA 3ZSEA 2IXKA 4GXLA 4ES9A 2ET7A 1RUOA 4YW2A 5ACA1 3H7YA 2DU1A 1R1A2 4M01A 1GZWA 4RSUA 1ASJ3 3BOPA 4QM9A 2O0OA 4AFCA 3RJRA 3RI9A 2IXHA 1Z7S1 4LUMA 4Q0QA 1ASJ2 2NLRA 2PLV1 4F3JA 3VBSB 3ENRA 2TNFA 5BNQA 2CL2A 2O8OA 1JN2P 4MVTA 4GH4A 1Y7BA 4AHZA 3KGLA 1UX6A 1G9FA 1JOJA 1PMIA 2KXLA 3ZFEB 5I0SA 2ZGUA 1SEFA 3JU9A 2D6OX 5FMOL 2PHXA 5C9AC 4EWDA 3I4IA 1VBD1 2QDRA 2OZ6A 5L7OA 1W6OA 2ZX3A 2D5HA 5J48A 1Y3TA 2JXAA 1EV12 2D97A 1D4M1 3AKRA 4FT8A 1DQ5A 1F5JA 1UMZA 2ZGRA 4FPEA 3VGIA 3EQEA 5FDBA 1QXJA 3I2DA 1C5IA 3PTYA 4YSFA 2ZGTA 1PK6C 3MI8A 4ZU5A 4P9YA 1CVNA 2BGCA 5E8AA 5GALA 2GSYA 1W6NA 1WD3A 1UIJA 5FLIA 3LGRA 2PHDA 3J9SA 4AGVA 2XLGA 2Q1ZB 2YXSA 2I74A 2XLFA 3VDDA 1S0JA 4QMAA 4HSJA 3LOIA 5T54A 4ITCA 5F1RA 1F9KA 4URTA 4L9BA 2NMOA 1GZWB 4FOWA 3LWCA 5C8CC 1PK6A 4R9BA 3KLSA 1OQ1A 3RDIA 1UPSA 3HT1A 1ND2C 1AL0G 1H8VA 1CD3G 4JQRA 3ILRA 3AMNA 1WW4A 1SFYA 4GH4B 3A0KA 1SBFA 2HKXA 4Q1PA 5K0UC 1EAH3 1FAYA 5KXCA 4Q4W1 3VV1A 4IEOA 4FQZA 3J8F1 2JDZA 3WW2A 1OA4A 4UXAA 5L7OB 1B09A 1W6OB 1EAH2 5C8CA 4PBOA 3KZ4C 1H1IA 4AF9A 2R063 3ILNA 3WDYA 3VL9A 3ZIXA 2PFWA 1IQAA 3H1WA 1ND2A 1V6KA 1ND3C 4RR3A 1IHMA 5HCBA 2R062 1QJU1 4QD2A 1U5XA 1R093 1VAVA 2PAMA 2A6VA 4FPLA 3SITA 3WG3A 1W6NB 2FMYA 3NJZA 3E5XA 3GALA 4GB31 3SH3A 1DZRA 5J98B 4YFZA 5BNOA 5BNNB 4EN7B 4XXPA 4ZU4A 3TWIA 3ALQA 1KS4A 1H2LA 4I2OA 1F2NA 3VDDB 5I93A 1FOD1 4CTEA 3KT1A 1YWKA 1CN1A 2W08A 5JI7A 4R4XA 3L2HA 4RS5B 1ND3A 2D7FA 4GALA 5KHHA 1V6JA 5FPXA 4CDXC 2ZZQA 4DQAA 1PK6B 4MV2A 2Y38A 3APBA 1Q3EA 3MIEA 4XTPA 3WHTA 3WW4A 1BVP1 4WVVA 1GICA 3IIAA 3VZOA 4B7KA 1HRI1 5KXEA 3AJYA 3EO6A 3VHRA 1TEIA 3WHUA 4I02A 4ZU7A 4L92A 3LAGA 4QQPA 2DUOA 1WMFA 3TNQA 2WA4A 1RJ7A 4I0WB 4DB5A 4PF5A 3IDBB 1FXZA 2PLV3 4Q0VA 1AHSA 4AFAA 4GMP3 4YZ4A 4HN1A 4CZSA 2R0FA 4CDXA 3W59A 1AL23 3LSDA 3ACLA 3FFZA 3WG1A 1O3TA 4CEYC 3V0BB 2PLV2 1T6GC 3DUIA 3PVBB 2RJLA 1ND2B 4RR3B 1AL22 1GQHA 2UYAA 3WG2A 2A3YA 5T5PA 4XDQA 4PLOA 4QM8A 5IT6A 1EY2A 5D1IA 3SCFA 4Y1UA 1QJY1 4AI3A 1LOEA 3FBMA 1QNYA 1GV9A 4N43C 3TYJA 1YHFA 2BFUL 5E1RA 5BNOB 1LOGA 2HWD1 3DN7A 4R52A 5EYYA 2CTVA 2HWC1 4TWTA 3VZNA 3WP4A 4P9IA 4CEYA 1O3SA 1D2QA 1ND3B 1WW7A 3INAA 2XKOA 3GZAA 1PO23 2XJPA 1SBDA 3NW4A 4ORFA 2HWF1 4N43A 5FLHA 5BNPC 3G7DA 4I0AA 1G9DA 1PO22 4DNYA 1AYN2 4NOTA 5CNAA 5H9RA 1LKNA 4AXOA 4XFHA 3BU7A 1GNHA 2N7GA 3ETQA 4AEDB 3SCHA 5DG1A 4E2SA 3VKMA 4A3XA 2Q30A 4CDXB 3I8TA 4QPIC 2WNVB 1N3OA 1HQWA 3EHKA 4UW3A 2ERFA 4UBGA 4Y1XA 4HLTA 2MHFA 2WZR1 2XWJB 5H9SA 1WLCA 3AYEA 5F6LB 4IETA 4YLZA 5BNPA 3ATGA 2HEVF 1IS3A 4L11A 4D94A 1COV3 3R4UA 1MZ5A 4G9SB 2AENA 3MICA 4CDUC 4Y22B 5LRRA 3TBDA 1H8TC 1NG0A 2E51A 3USUA 3ZN6A 1YIFA 1TNFA 1COV2 3UJOA 2E6VA 2WFF3 3AXDA 2ZHMA 3WG4A 2YHJA 1A8MA 4YG6A 4XBQA 4QPIA 4XOGA 1O4TA 4CEYB 3MF6A 2WQZC 2WQ4A 4X8NA 1BMV2 1PGSA 2PHFA 2WFF2 3WUCA 3MW3A 1LOAA 5BUVA 4IERA 2A71A 1XNCA 1KD7A 1RUE3 3ES4A 1NLRA 4CDUA 3N4MA 1H8TA 2ZA9A 1X8EA 4N43B 4XW3A 4BZ4A 2ETEA 5A3MA 1TME3 1B35C 1RUE2 3AP6A 2YC0A 4XJUA 4EN8B 2DTYA 2Z79A 1Q8VA 3AZYA 2WJSA 2MEV1 1RUH1 5KHGA 4HK8A 1IPJA 1C5HA 1VBB3 1LHNA 4IEUA 1TME2 2WC2A 3D0SA 2JG8C 1DBNA 4D7YA 4I01A 1VBB2 5I0UA 4F7ZA 3SLIA 1S0DA 4UW6A 2YV8A 5BNPB 1B35A 4JDOA 1I5ZA 3KS7A 4CEWA 3ZVXA 5C6CA 4FVVA 2R16A 4FBFA 4AHYA 1MS8A 4XFAA 5KXDA 3USUB 1FV3A 3ZN6B 4LA2A 2JG8A 4C91A 5GJ6A 1ULEA 3MDPA 4KNCA 1HV1A 1UN1A 1RUF1 4KBBA 5FMOS 4LBNA 5HI0A 1OOPC 1AJKA 4QPIB 2OZJA 2ZHNA 1YFWA 2D5FA 4NWVA 2K9ZA 1FNYA 4B7EA 4MGYE 1KFUL 3FLTA 1N1YA 4DZGA 2G4IA 3A4UA 4I09A 4YG3A 1GYKA 1YNAA 1FT9A 4CDUB 3WV6A 1R1ZA 1OSGA 1H8TB 3KM5A 3OYWB 4FSJA 2GMEA 2I2SA 3ZDSA 4CRQA 3M1HA 2XBO1 2VW0A 2IZWA 4WM7C 2R30A 1AR91 2ZPXA 2XHKA 1ENSA 4MSVA 1OOPA 5DUVA 2V73A 3E6BA 3UKNA 2D3SA 2BBVA 3B01A 5EZWA 4Y1VA 4E4SA 3GHMA 1YXWA 1KDMA 3UJQA 1BZWA 2OIIA 1HW5A 4HN0A 3SCGA 1S0EA 1VLNA 2GNBA 1BEV3 1G8WA 1SLBA 5AC93 4Q1RA 1URXA 2D43A 4MUVA 1OMIA 3MLLA 1PNFA 1QHDA 1LGNA 3D4KA 4G3YC 1B35B 1MACA 4YVWA 1BEV2 4WVMA 5EV7A 5AC92 4CEWB 2B46X 3ELNA 3KT7A 3P3NA 2B5HA 4QT6A 1WW6A 3MGUA 1PO13 5J3UA 4SBVA 3ASIA 1ZZ9A 1UU4A 2JG8B 4N9HA 2GMMA 2VUAA 3PMSA 1RHI3 1JHNA 1G86A 4AFBA 3WLUA 2VOWA 3AMMA 1PO12 1QDCA 3R4DB 4XFIA 4B4QA 1RTVA 5EWSA 1LESA 1RINA 2HEYF 2XJTA 3G6JB 4AVCA 3HD8B 4FPHA 4QGMA 1BKZA 1RHI2 5IK8A 2R1DA 4YARA 3CEWA 4AQ2A 3ZO0B 4IEPA 3WNXA 3U11A 2GALA 2VY0A 3SH5A 2E7TA 2ZX0A 4YGDA 2GU9A 4JCKA 5A3LA 1S2KA 3NAPB 2VVFA 3WZ1A 4GULA 2QJVA 4Q29A 2ENRA 4HKOA 3RRDA 1KRIA 4X8PA 4Z82A 4META 1OOPB 5FOBB 3ZXFA 4R8HA 1R081 4JGYA 4X6RB 3OJBA 3NV1A 4LTAA 1SMVA 3AZVA 3JB8A 5JDBA 4XMAA 1UPIA 4KWJA 2W52A 2OYZA 1SFNA 3BOWA 4OHYA 3JBG1 4QQ2A 4IESA 1FNZA 4EN9B 1AJOA 1YUDA 4COVA 1X7NA 1CQ9A 4DOUA 4K7JA 3FX3A 4YVWB 4I30A 3VBHC 4WVMB 1X33A 3E5QA 2BVVA 1O4YA 2EAAA 1X36A 2ARBA 1PZ7A 2FQPA 1NCQC 1RMU1 2XJSA 4BCUA 3GHNA 5JIUA 3H3ZA 1C8M3 1OD5A 4IL7A 2WZPP 3RMXA 3MIBA 3VBFC 1QJX3 1APNA 4IEXA 2A5ZA 1JUHA 3JQXA 1GKBA 1SCSA 3D6EA 3LSEA 1WD4A 1NCRC 1C8M2 4UBHA 4W6WA 1QJX2 4FPFA 1RUF3 5JVVA 1POV3 2JE9A 1Q8PA 1QGLA 4NPRA 4XZPA 1H9PA 4AWDA 3HBZA 1VRH1 4Q4V3 4L2NA 2HWE3 4AVAA 1RUF2 4AQTA 2X5IC 4XIOA 3NKTA 5BYNA 2RMU2 3VBFA 1J3QA 2PHWA 4Q4V2 2KM2A 1YI9A 4JGYB 5FTTC 2HWE2 1DGWX 1DFQA 2Q4SA 3MW2A 2VNGA 2XBO3 2GNDA 5A32A 4TLFA 4AK3A 4ATFA 3FE5A 1HKDA 4WM8C 1Q56A 2D6PA 1FATA 4ES8A 2XBO2 2C1FA 3VBRC 1QQP1 1SBEA 4NO4A 2X5IA 3KSCA 1N1VA 1NY72 4XQWA 4C1XA 3QH6A 1M06G 1DDLA 2IXLA 3WQ7A 1KS5A 2ZOEB 3EBRA 5JCTA 3MFCA 1ZA4A 4YZ5A 2V09A 1AR73 4WM8A 1SLLA 3EJKA 4FOVA 4IEQA 1G7YA 2GDFA 3VBRA 4B29A 2BNMA 3ZSLA 5AVPA 4XFGA 2QNKA 1VALA 1AR81 3OY8A 2XJUA 2GAUA 1AR72 4GKYA 5I0TA 4Q0PA 4Y1ZA 2RHPA 1JH5A 4HBNA 3AMHA 4XJWA 3WW3A 1V6LA 1GLHA 3RMYA 1GANA 3AFKA 4MH0E 2RS51 3BTAA 3MIDA 1G9AA 2FHRA 5GLTA 3VBFB 3RNSA 2RS11 3H3UA 4OHWA 2W0XA 4AG4A 1H30A 2IFRA 1QU0A 2D98A 2ILMA 4S2GA 1RUJ1 5BPXA 1S2BA 3S0MA 5A32B 4YVSB 4AEMA 2BPA2 2PN5A 4WVWA 2ZBJA 2ZGMA 3CO2A 4FPCA 4EJRA 4LO7A 1ULDA 2XJQA 1C8NA 1D2SA 1RUG1 2X5IB 4YGEA 1LOCA 3DGTA 1W39A 3JBG3 4HSLA 4COZA 5L7OC 3ZXKA 2VU9A 4U2AA 4P14A 5GLVA 2ZJCA 4FP2A 4BMEA 3NVCA 1OQEA 2PELA 2WNUC 3RG0A 4M00A 3N7LA 3OBTA 4OHVA 3JBG2 4LO4B 1A6CA 1EPZA 2PAEA 2XG3A 1BBT1 3B02A 2RS31 1LU2A 2UWBA 4GA9A 4WM8B 1UW8A 2WLPA 2ZKLA 2QVSB 3WVJA 3AXEA 4PIXA 3VBRB 1QH6A 1W6PA 5SV8A 2JECA 2EXJA 3OY8B 3M3OA 2CWSA 1AXYA 2AUYA 5BNNC 4AGGA 1MZ6A 1L3JA 2PHRA 3JQWA 1UKRA 2UU8A 1NXD1 5H9QA 1PGL2 3VDDC 1PIV3 2WNUA 5L36A 4JC1A 4RS5C 5GM0A 1LOBA 2XPJA 3N35A 3AKPA 3NSTA 2A6YA 3URFA 1RB8G 5TSWA 5F5QA 3T1MA 1DYPA 4MXVA 1UAIA 1PIV2 2XUMA 3FC0A 4K9SA 4XEZA 3WOGA 4AVSA 1ZZ6A 1LRHA 1DQ2A 4K40A 4MZUA 1I6XA 3IN9A 5BNNA 1MQTA 1BK1A 1U5IA 3CU7A 4LHKA 2FBEA 4G4FA 2CY6A 2VVDA 1YRZA 2WS93 1SLIA 4RS5A 4EWEA 2JJ6A 3HQXA 3U07A 3U10A 2RM21 3IPVB 2DVBA 1VBA1 1PGW1 1V00A 1RUI3 1TMF1 2WS92 3KCXA 1UF2C 1DGLA 5JOYA 4O9EA 4OUMA 5HCFA 4GWMA 4FPKA 2LM3A 1GQGA 4RR3C 4LBOA 1MS9A 4DXZA 5K9YA 1RUI2 3ZFGB 4N7IA 5GLWA 3HT2A 1W6PB 1ZM1A 4XQDA 3WQ1A 2ES3A 3B94A 4HETA 5DUWA 5BNOC 4K6BA 5DDJ1 1ZX5A 3ZXEA 5EYXA 3MEPA 1ENQA 1QXRA 4JTNA 1XE7A 4RQPB 4D69A