5C3QA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and thymine (t)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
GSMEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Oxidoreductase
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3qA00
1UOFA 1W3XA 1HJGA 3ZKYA 1GP4A 4BB3A 1W2OA 1UZWA 2IVJA 5C3QA 1GP6A 2VBDA 2JB8A 2VAUA 2VE1A 1W06A 1W2NA 5C3RA 2JB4A 3ZKUA 2BJSA 1DCSA 2BRTA 1QJFA 1GP5A 1QIQA 1E5IA 1IPSA 1E5SA 1W3VA 1HJFA 1E5HA 1QJEA 1HB1A 5APAA 4XAEA 2BU9A 1W04A 1ODMA 1WA6X 1BK0A 1W05A 2Y6FA 2WO7A 2IVIB 1BLZA 1OBNA 1UO9A 1RXFA 1UNBA 3ON7A 1W03A 1OC1A 1HB2A 1HB3A 2VBPA 2VCMA 3ZOIA 1W9YA 1UOBA 5C3PA 1UOGA 2CSGA 1HB4A 2VBBA 2DBIA 1W2AX 2DBNA 1RXGA 5C3SA 2Y60A 1W28A 1E5RA 4RGKA 5C3OA 3OOXA 1ODNA
chains in the Genus database with same CATH superfamily
1GOFA 1U5XA 5IVJA 1PIV1 1W9FA 3GCXA 2WQZC 3KVAA 5CKMA 3V0AB 3I2HA 4FO9A 2IXLA 1NYWA 4JX0A 4K7JA 4E4DX 3KHBA 5FWJA 1PZ9A 1JYIA 2R16A 1DIWA 4JC1A 1QJY3 3MYXA 4AQTA 2V5YA 2FCTA 1KDKA 3EQEA 3F2ZA 4BIOA 4CDWC 4LT5A 2HWF2 4YGCA 5CFDA 5DDJ2 1J59A 1LENA 3AMHA 5JXIA 2ZKLA 4YW1A 4M4RA 1SBEA 1LHWA 2JB8A 5FYTA 3V0BA 4BQYA 4OHWA 4KWLA 5BPXA 2RJLA 1PVC2 3AB0A 3MW4A 4R4ZA 3LOBA 2G4IA 4KWKA 3POJA 4JHTA 1OQ1A 3WNKA 2JECA 2UYBA 3WP6A 3RVHA 1UZZA 4HMZA 3MPBA 1Y43B 4HFSA 1XNBA 5E6HA 5FLIA 5LEJA 2ZX1A 3ITQA 3WW3A 3BODA 3LPFA 3BPZA 4GALA 5FZ1A 2XWJB 5KHHA 3V65A 1FOD3 1LOFC 2ARCA 5BNNB 1JS9A 1ASJ1 4XQDA 5DAVA 4CDQC 1JU4A 1C8NA 4B29A 5BXXA 1TME3 1HLCA 3AZVA 1OLME 1Q8QA 3GJAA 4LPLA 4CXXA 2RMU3 4JKMA 4RA0A 5JOYA 4I30A 1NX9A 3B3QE 2D3RA 3U11A 3OY8B 5FREA 3RRDA 2ES3A 1QHDA 1W6PB 1WCUA 2PTMA 2XLAA 2DDUA 2HYXA 2VNGA 3WY6A 3EMRA 3I3QA 1UXZA 1XNTA 2ENRA 2H6BA 4Q2FA 4QQ2A 3ZR5A 4CZSA 5FKCA 3WINE 1AZDA 3NNLA 3I2IA 4QDRA 5CYYA 4F83A 1CIWA 3W21A 4PBPA 4FPGA 1CR7A 5F2SA 1LHUA 3QH7A 3K51A 1YJKA 4NVPA 1ZBA3 3VKLA 2WZR2 4W6YA 2CGOA 1GLHA 1LESA 1ND3A 5FWEA 2IVIB 4V2WA 3VL8A 4CTEA 4RS5C 1DBNA 2PHDA 5FZ6A 4RQPC 1RIRA 4Y5TA 1UY4A 3RJRA 3WF2A 5AFEA 4NAMA 4QD2A 1F4HA 4B1LA 4HG6B 4B3NA 4JGZC 1HRI2 2W9XA 2BFUS 4AEDC 1WW5A 4R4XA 3GBGA 5JOWA 2HWE2 4MGQA 3AFKA 4HZFA 4AEJA 1W8UA 5JWPA 3VBFC 5K9YA 5C3PA 1QDOA 2VMEA 4D7TA 1EV12 1QXJA 5M0TA 3V0BB 2XVKA 1C8M3 1AR93 3KCXA 2V4AA 2BP6A 4XQ4A 3ZMNA 3W5NA 1RUNA 1O6UA 4CSWA 3Q8AA 4WVWA 3HBKA 2VL4A 1WCQA 2RR13 4PF1A 1GR3A 1YHFA 5A3LA 3CJXA 3T09A 4QQOA 5GZCA 4INDA 1RXGA 3ZSKA 3J4UH 2LUWA 2RDNA 4GMP3 1RUF2 2EICA 1NE6A 1WLWA 3C7EA 2PHWA 5LB6A 2EVXA 2FZ1A 2QQKA 4OI1A 1GBGA 4X6RB 2XQRA 4EN6B 2E6VA 1ND2B 4TLGA 3M70A 3BB6A 2GC2A 1A78A 1DP0A 2XQXA 3BVCA 5CZKA 1ZVFA 2HWC3 4LJHA 3W5MA 3AZWA 3EYPA 2OW4A 3NNJA 4IEXA 3CDZB 3S30A 5BNOC 2WZEA 1D2QA 3H3LA 4GKYA 5FZ8A 3PUSA 1N47A 5JXHA 2UWCA 3C8XA 1QJY2 3JBG1 2RM23 4NHXA 3PVNA 2P6CA 3CJIC 4NHMA 1V70A 3O1SA 2W91A 2FDHA 3WG3A 3ZYGA 3IDAA 2P2KA 3MW3A 1O3QA 1B09A 1WW4A 4AF9A 1GP6A 3MIBA 3VBHC 5L9RA 4EN9B 3V64A 3VB9A 5IVVA 2VXJA 2JE7A 1OPOA 2WNVA 3CKHA 1YWKA 2Y6GA 4TWTA 1NZIA 3RG0A 3O1RA 2R0HA 1ND3B 3S7EA 1UY0A 3H50A 4IV1A 2QQLA 4PLMA 1W2NA 2YMZA 5ACA1 4XFCA 2QE3A 3C2UA 4RGAA 3ZXJA 1OLMA 4P9IA 4E4SA 4OI2A 1WA4A 2BRTA 3VZLA 3BYWA 1FOD2 1RUE2 4MO3M 3NNMA 3OF1A 4X8PA 4XF3A 4Q8LA 4IGOA 1W2TA 1MPXA 2WN3A 1TME2 4N43A 1Q3EA 2XGXA 4OUSA 2RMU2 1Z7S3 1GNZA 3PLQA 2QZ2A 1VRH3 1LEDA 2R062 2VOTA 4HOOA 4Q0SA 4LHNA 5FLJA 4FTBA 1DYPA 4H7MA 2Y64A 3K2OA 3ETPA 3O0WA 1HJFA 2R073 2RDQA 5C8CA 3WP5A 1AX1A 4Q0PA 4DRVA 4DS0A 1RUOA 1LHVA 3KSCA 3MDPA 4SBVA 4DZGA 3T0BA 1NLRA 1UYPA 1CESA 1W04A 2ID4A 2W46A 5GKAC 4YW7A 2UYAA 1OOPC 3S7IA 4L0PA 3E6CC 1RHI2 1QY4A 5C71A 2VW1A 1MS4A 3E5UA 1RUH1 1S0CA 2XXZA 3MUZ1 1AVBA 4OZXA 5LY2A 3WEZA 1J84A 1URXA 1NQDA 3A4UA 5BYNA 2FDGA 4QAWA 1CJPA 1FATA 4JQRA 2DTWA 4XFFA 3ZFEB 1C57A 4CEYA 1UYZA 1YNAA 4FOQA 1HB2A 3VDAA 3O1UA 1GFF2 2B9UA 2RG4A 3PIJA 3BGAA 2ZHNA 4Y1UA 3WQ1A 5KXCA 1R081 5F39A 2J1TA 1X33A 2VMCA 2WO1A 4FBFA 3H1YA 4GJYA 3OGGA 1CVNA 1LU1A 2KR2A 3B5LB 3N35A 4GH4A 2GC1A 1EYBA 1PO21 2WC2A 4P9YA 1AXKA 5JOZA 2D97A 2WQ4A 3ATGA 4R9AA 1QJX3 3I2GA 3W58A 1JZ2A 2B5HA 3O1TA 1WMDA 2HEYF 4O9EA 3IZOA 4DQAA 2RR12 2RVAA 2XPJA 4FI9A 1BMV1 3LGRA 5GZGA 5A32A 5FMDA 4IV1B 3NL1A 4AHYA 2L9LA 1DLCA 2ZEXA 2Y60A 2BPA2 3SCGA 3HN3A 1JXNA 4QHBA 1AYN1 4GB32 4LQRA 1ZM1A 2Y6HA 4XZPA 1JZ8A 4LK6A 1W6OA 4CCOA 4N43B 3ZIWA 2DVAA 4XJUA 5EZWA 2XHKA 4L99A 1LJ7A 1H1MA 2MEV1 3ZXAC 3AP6A 1HJGA 4CVUA 2WFF1 2VGDA 1GZCA 3MIEA 1Z78A 1N1TA 3NMBA 4ZPIA 1PGW1 2A6ZA 4HETA 2B45X 5EQUA 1UZWA 2X09A 5FTTC 4Z2WA 3BTYA 1YC61 3HNMA 4WV8A 1QGLA 3NKGA 1KXGA 3NQHA 5C8CB 3VDCA 1UPIA 1UL9A 4XXPA 1PGL1 3LDBA 2C6SA 1UY2A 1GQPA 2Q30A 3E5XA 3JD73 3N9LA 4L92A 5KC6A 5LY1A 1GWMA 2FDFA 1KS5A 1TEIA 1IKQA 2MNGA 3UGHA 1V6IA 4JTOA 2FDKA 2XJPA 3CHXA 4S2GA 4QXHA 4JAAA 4KU8A 4XBNA 3I2DA 4Y5SA 3WOGA 3HNBM 2P3KA 5DUXA 1RINA 1ZA7A 5C33A 4ZZ5A 4RL7A 4CXYA 1TE1B 4D6SA 2QQMA 1DZTA 2BBVA 2GMEA 3IAPA 1C28A 5GALA 1DCSA 2DCZA 2Z2SB 5EYXA 5B2GB 1S0IA 3GNEA 4GJZA 4I01A 2JG9C 4LO7A 1QWRA 4QX0A 3M1HA 1Z7S2 1E5IA 1PHMA 2IZWA 3ZYIB 1W8OA 4Y1YA 4G3YC 1VRH2 5F3CA 1W3VA 3RQ0A 1FNZA 3WNMA 5FOJB 2ATFA 1OKOA 5H9QA 2QDNA 3A0NA 1WWYA 2R072 3ZYJB 4B8EA 4R9DA 2GAUA 2JX9A 3GHMA 2VUJA 4LBJA 2Q0AA 3H0OA 4RYDA 5A32B 5HCHA 3THTA 1Q8VA 2Q8CA 1V9U1 3WXPA 4M0NA 4HKOA 3VZMA 1JOBA 4NAOA 5GJ6A 5IYYA 4ASKA 4AVTA 3U78A 2C9AA 1W6OB 1ZZBA 2G1MA 2ZX2A 3L9JT 3ZDVA 1LCLA 2B39A 3FFQA 1TMF1 3PJQA 4PBOA 1H4GA 1PNFA 3OYWB 1DLLA 2DWRA 1QDCA 1SCRA 3ZYRA 5A1LA 1CZTA 3BKZA 3KMHA 4BQ1A 1I5ZA 5DG2A 1DG6A 5IW0A 2P3JA 2H6CA 5DUWA 4QX3A 1UKRA 1ZZCA 1G8WA 5DAXA 5FZMA 1X8MA 3USUA 2W52A 2PAKA 2WS93 3WP3A 3Q8CA 4BCUA 3LA3A 3RZHA 3RZLA 1JHJA 3AK0A 1UU4A 4CDXA 1GZWA 2ZABA 2XWBB 4KH9A 3K4DA 3SISA 4J1XA 1UWWA 5GLZA 4MG2A 4X6QB 1S2BA 4FCAA 2WRAA 3OPWA 3VL9A 1QOOA 2RDSA 4XF1A 4IXLA 4Y4RA 1AR71 4GWNA 4IETA 4Y20A 1CAVA 4OULA 3RZJA 2GNDA 2C9KA 2B8MA 4AR2A 4YPJA 1O5LA 3LDKA 4P9XA 2HWB1 4EWEA 1W8NA 3H8RA 3MFCA 1Y9GA 4HPKB 1YLLA 1GP4A 3AKRA 4H55A 4AYUA 5CKQA 3D8CA 4KGQA 1EUUA 1ULFA 1ZZ8A 4OHVA 1TG7A 3PL0A 5F5IA 1AXZA 1POV0 4XJ9A 3JD72 4XHXA 1SACA 2RS11 4LLOA 4YM0A 3ZFFA 5LZ6A 1BKZA 1SZBA 4Q5OA 3HPNA 2ZMKA 3NRUA 4O65A 3EXUA 4OUMA 2R1BA 5FZHA 3CL1A 4JRAA 3T0DA 4LOSA 4GWMA 5DMYA 5IJRA 4ES8A 4D7SA 1XYOA 3GM8A 3UKTA 3IAQA 4URAA 5FCCA 4UBHA 3CBNA 2R30A 5DG1A 5J98B 2TEPA 4XILA 4OHZA 3W59A 1MEC1 3GGLA 4N9HA 4E8DA 1VB2A 4LBQA 3WW2A 2EALA 1PZ7A 3I3DA 4D3WA 3JBG3 1FMD1 4Y1XA 3WUCA 3ZYBA 1YRZA 1V6OA 1D4VB 3Q8FA 4PT6A 3BCWA 5JZGA 5JDBA 3KGLA 2VOWA 2ZGMA 1QKQA 2YGMA 3K77A 2JDHA 4QDSA 5EHDA 5T50A 1IGOA 2BWAA 1CJDA 3LEIA 4JTNA 5LASA 4AFMA 3BU0A 2CHHA 1XSRA 4Q4X1 3OGRA 4IE5A 4LITA 3TN91 1AF9A 3USUB 4YFZA 5FY5A 2HWD3 3RGBA 3PMEA 1UZ0A 4CDXB 1VRBA 2DCKA 2Q5TA 3H3UA 3WSOA 1W8TA 2VY0A 2NP0A 5ACA3 2HEWF 3KV9A 2WL1A 5C5TA 3I3MA 1ODMA 4LNVA 5I93A 3AKPA 2BOJA 5L19A 4Q1PA 4WM7C 3J8F1 4Y20B 1CAVB 4KG0A 1W6MA 3BPSA 1AHSA 3FBYA 4IERA 4BXSV 4A7KA 1QOTA 2D3PA 2WSUA 1BLZA 2IXIA 3C7HA 4GA9A 3VDDA 2WWUA 1OUXA 2GP5A 3MF6A 1SDDB 4AFAA 3SKJE 4WM8C 4NWWA 1UF2C 3C7GA 1H8TA 2J1EA 4PI2A 3ZXFA 2EXIA 4RFRB 3QOPA 1C3HA 3NKTA 4E4ZA 3A0KA 3GZEA 3WDVA 3WNOA 3LWCA 3ZFFB 1KGYA 2VUAA 2XVLA 4HONA 4XAAA 1XE8A 3SEPA 1QNWA 4LBNA 3TOJA 3JB8A 1G6NA 2WYFA 1H30A 2WS92 4MVTA 4CPBA 3TAYA 5CFDC 4CP9A 1LNSA 1SDWA 3FZ3A 1ULOA 3MIHA 3LEMA 4NE9A 3VUOA 2E31A 4MGSA 1JHNA 5IT6A 1AYM1 1SMVA 3O7OA 2AREA 5KXDA 3CU7A 3WR0A 2GU9A 2CAUA 1W28A 2WFPA 2BGCA 3V56A 4AQSA 2B42B 4CDUC 1NUKA 4A7ZA 1RUD3 1NA1B 1S0EA 4HT1T 2AEZA 4LBQD 4N7IA 5BV6A 3OPTA 2XBO1 2VUDA 3SEEA 3LB9A 2JDAA 2VO5A 4BOWA 1ULGA 1ULPA 4G4FA 1VBA3 2W87A 4QHZA 1X36A 1CAUA 1OI6A 1RUI1 3ZXKA 5ABJC 3DF0A 3UYJA 1PO23 1RMU1 3CIHA 3SH4A 1YFXA 3IT8A 5J1XA 1NCQA 4Q4V1 2NLRA 2QQIA 1W0NA 5CFCA 4AW7A 5IVBA 1LEMA 4K6BA 5KHGA 4Y24A 2UY8A 4Z8BA 3VDBA 4N53A 2X10A 1REFA 5FYCA 3JQXA 4IV3C 1DQ0A 3RFRA 4D6RA 1RJ7A 1I9RA 3PIGA 4K8RB 4QX2A 4ZS2A 1GQGA 1IS6A 2QQVA 1ZZ7A 1AYN3 2QTWB 1J3RA 3FLTA 3P5BA 5FP9A 1VJ2A 1JZ4A 3N7KA 1W6MB 1VP6A 4NRPA 2BNMA 4QPYA 2ZMLA 2DVDA 4XUTA 3OG2A 3VDDB 3JUUA 2MEV3 3RMYA 1O91A 1VBD1 4GIQA 3OTFA 4UFIA 3VBRB 3Q9OA 4BK5A 5JVVA 1XU2A 2FD8A 3NAPC 4GULA 3T2OA 1PO12 1VBB2 5FZBA 2UY9A 3LQCA 4JKLA 2GDFA 4JQTA 1ZRFA 2BFUL 1CPMA 1GKBA 2Z4FA 3I59B 4PIYA 4AVSA 2BZDA 1OSGA 4PCRA 4DUWA 3WP4A 4Q4Y3 3KS7A 1I1EA 5KBFA 4OHXA 1OQDA 2IUWA 3NWKA 1BCXA 4KWJA 4O9GA 2HWD2 1PK6C 4CP9B 4DO0A 4R9CA 3RYRA 4CPBD 4N9IA 4XCAA 2JG8A 5K0UA 3O1VA 3MPPG 3N7JA 2XKPA 1X7NA 4BQWA 4IEQA 3TEWA 2WAOA 1DQ4A 1GANA 4YG3A 2B7YA 4W6WA 4AFCA 5KHKA 3ZVXA 1UYYA 2VTXJ 4NIAA 1FI2A 4RSUA 2XLFA 3P6BA 2WO7A 1LAJA 3HJRA 1FPN2 4FPHA 1AJKA 4QPGC 2OA2A 4LUMA 2ARBA 3UT0A 3MW2A 4ZXKA 2PELA 2VECA 2BQPA 1DDLA 2YC0A 3VBSA 3V0AA 1WBFA 4MV2A 2VZ3A 1MZFA 3A23A 4FFIA 4FVVA 2R7EB 5A70A 4UFMA 3SKVA 1NCQB 2IWGB 1REEA 4CEWA 2VQUA 5CFCB 4W8JA 4D8MA 2VVDA 2J1AA 5FJHA 2C24A 4QPIA 4GXLA 2VCMA 1APNA 4E2QA 3OBRA 1OVSA 5L73A 4A41A 3K48A 4M0HA 2WYSA 3AP5A 2E53A 2V73A 1WBLA 2Y6LA 3WUDA 1AR63 1JUIA 3ACFA 4UF0B 1POV1 3T0AA 2OUJA 3DXTA 3TRSB 3BALA 1CQ9A 5BNQA 1TNFA 3WQ0A 5FXVA 3AL6A 1O3TA 1TMF3 1K5MC 2CWMA 4HL0A 5KXEA 3OSDA 5C3SA 3MI8A 2DF7A 2F17A 1E5RA 2WNVC 3HOBA 4HK9A 1RUD2 5E8AA 3H7JA 3SC7X 3THDA 4EJRA 2W1UA 3MV01 3PHMA 3D3AA 4AQ6A 5L7OA 4CYDA 3B93A 3M8LA 1J58A 5J37A 2XKOA 1JBCA 2ORZA 3OBTA 1FNYA 3VHOA 5BNNA 5GZFA 1RUC1 1VBA2 3B9CA 1ULEA 2P34A 2G9FA 2IFWA 5DABA 3DV8A 1DZRA 1QJU3 4MGTA 1J1LA 3ZKYA 2P3IA 1X8EA 3ZM8A 3OY8A 2R043 1DF0A 2ZTNA 2VC9A 4UBGA 2G9ZA 1VBE1 3ST7A 4DEQA 4EN7B 5K0UB 1MS1A 3MFAA 1HXS3 1OH3A 1VE0A 4MXWA 3S6PA 1MQTB 1KD7A 2A6VA 3C7OA 2I07B 4JV4A 2P5BA 3DYPA 3POWA 4XBQA 1AR73 2A5ZA 2ARXA 3AJYA 3IDCB 4N90A 5L9VA 3RJ2X 4LORA 2NPIA 5FFOC 2GH8A 1ZBE2 2RJKA 5FRAA 1BK1A 4EZHA 2O8QA 1EAH2 1W9WA 2HWB3 2TBVA 3VBSB 1XQNA 3A21A 1UKGA 3WX5A 1HN1A 2VW0A 3T4HB 3MLKA 1G86A 3WV6A 4UWDA 4UFLA 1D4M1 2J7MA 4CE8A 4FP3A 4CEWB 3PMSA 2J1VA 2HEVF 5FOBB 1OXCA 4QPIB 5FQ0A 3ILFA 4LKEA 4C8DA 2NMNA 4Q4W3 4LULA 1OUSA 1E5SA 4EN8B 4D0QA 4CEYC 4Q4Y2 5IK4A 2ZS6B 1MACA 3FHIB 2JIGA 5DUUA 5EPAA 5F6KA 5FY8A 5FIXA 3SITA 2LW8A 5FV3A 2CY6A 3SXWA 4P9JA 4GH4C 5LA1A 1UX6A 4PDWB 2ZJCA 3KQ4B 1BEV2 1JUHA 4BQ3A 1SBFA 5A3OA 5IWFA 5T54A 1IKPA 3IM0A 2DCYA 1MEC3 2NM1A 5CNAA 1XC6A 5L7OB 3VD4A 2DFCA 1W05A 1SPPB 5FPAA 4PLNA 3J26N 4BHPA 1EPWA 2GMMA 3U07A 1SFNA 5FZ3A 1Q5OA 2DCJA 4P9WA 3E6BA 1Q8OA 4BMBA 1H1IA 1ND2A 1RVF2 3FLRA 2VCBA 4A45A 2HYKA 2I74A 2NN8A 2XJRA 1W03A 1JYWA 5AC93 4Q4X3 1O4ZA 5FAXA 3ZYFA 3DGTA 3TN93 1ZNPA 1HRV3 2WNUB 1RUJ1 2EF6A 1JOPA 1NLSA 4YG0A 3MICA 2UWAA 1WLCA 4LO6B 3I49A 3OJBA 3EO6A 5DQ0A 2OPWA 1CIYA 3ZPYA 3T1MA 4MXWB 2A71A 4RHV1 3N9OA 5IFTA 2YBSA 3TYJA 5A1FA 5FUNA 3AKTA 2TNFA 4NRQA 1PM4A 4IUGA 2OZJA 4HVRA 4CCEA 4Y4YA 4D69A 4PQQA 1Y9MA 1AR62 1H2NA 3J8F3 3PUQA 4MHUA 4KL1A 3EB7A 1C1FA 1LOGA 2P17A 2QQUA 1L7LA 3FHAA 1AR81 4BYYA 1W39A 3TNPB 3S5QA 4XETA 4FAGA 3ZXDA 4AL9A 3WT3A 4IEVA 3E1F1 1CGPA 1ULDA 3ECQA 3HNYM 4C91A 5IAXA 3POIA 4LHSA 3EHKA 1YFWA 2B46X 3QBQA 5FQ0B 3HD8B 1OF4A 3D4KA 3LCPA 1LOBA 2JDPA 5FZIA 4Q8KA 1W0OA 1QJU2 4MX3A 3UESA 4BLJA 2VG9A 2X5IA 1KFXL 2YYOA 4QQPA 3VBUC 4KBBA 1BBT1 4YFWA 1POQA 2R042 1CWPA 4EQVA 3PTRB 1REDA 2PA7A 2RV9A 3GALA 4LIUA 5I0DA 3GZAA 4F3JA 3ES1A 4UW3A 1HXS2 2GMPA 2QBXA 3DPRA 4I02A 4YVSB 1F9KA 5GZEA 3ZFGA 2FDIA 2DFBA 3ZXGA 3AX4A 4XDPA 5C8WA 5DUVA 4NR1A 1AJOA 2LRPA 1S4CA 4FSJA 2AR6A 5L9BA 2XBO3 4YVWC 2J1RA 3R4SA 5A6XA 4YW2A 2VMHA 1ZYBA 4GZ9A 5IUQA 1XXNA 5T5PA 2PFWA 4CUGA 3VKNA 3IDBB 1W9TA 1ZRCA 2JD4A 3R4UA 5C9AC 4I2OA 4IE0A 3ZFEA 2WBKA 2IC1A 4AGRA 3B94A 5LK5A 3O1PA 5J7MA 3M3QA 1GP5A 1W90A 1QQP1 4LBOA 3F95A 4Q4W2 2YBKA 3RWNA 1COV3 1Q56A 4D6QA 4COZA 2SBAA 2OZ6A 4Y1ZA 4RFT0 2W1SA 1QF3A 3WLUA 2D6KA 3WG4A 5CAZA 3ZX7A 4IEYA 3DXUA 2WNEA 1HW5A 1VMFA 3HAGA 2WWJA 2R1DA 5FZ9A 1IS5A 4XIKA 2AC1A 2LROA 4GD4A 1B35B 2AGSA 4RR3B 3AP9A 4MOAA 5CB7A 3RMXA 1NY72 2V72A 4K20A 1WCKA 2BU9A 2WABA 3HWJA 5ERLA 5FY1A 2NZ9A 1RUG3 1C1LA 3J7HA 2CV6A 3ZXLA 3LA7A 3QCWA 4DB5A 1C4RA 2W1WA 4HVOA 4OFGA 4PLOA 4PJYA 2O8OA 5BNPA 4B1MA 4AVBA 2YUEA 3S5AA 2X5IB 5CG9A 2ZEZA 2PLV1 5AC92 4N7UA 3PUHA 2YZ4A 2XL7A 3RZGA 1HRV2 3RPQA 1K12A 1O4YA 1R091 2DYCA 4MUVA 4UAPA 4COVA 1WLDA 3DPRB 4OUEA 3ZFGB 3ALQA 3UKNA 4XJZA 5FXWA 1AX2A 2RS51 3LSDA 1W6NB 1SLCA 1UZYA 3OBAA 1VAVA 3ENRA 3JCIA 3MUY1 5KXBA 4UW4A 3NO8A 4JGYC 1ZBA2 4YLZA 3VKOA 2KM2A 3KF5A 1IS3A 1DQ1A 4QB1A 3RS6A 4OQ8A 3VD5A 2CAVA 1A8MA 1O4TA 3I3EA 2P4EA 5IVFA 2Z79A 1WD4A 3LIGA 4BM8A 5E89A 3J7LA 3K75B 3GYDA 3N9QA 1UW8A 2OT7A 4LO8A 4EE2A 1ODNA 5IAVA 2EIDA 4BQ2A 1O3SA 1GV9A 1LOCA 3ABZA 1NXMA 5FJKA 4BQXA 4E9KA 1QH7A 5IK8A 4ZY9A 4Y22B 1WW6A 4FFGA 5J3UA 1C8M2 3CLPA 1AR92 4V1PA 5JZGC 2ZGOA 1POV3 4EROA 1VMJA 1JTZX 4FAHA 5LCWL 1MZEA 3G6JB 1OVPA 1YQ5A 5J36A 4R9BA 1DQ2A 1SFPA 2AACA 4CDWA 3FUOA 2JDMA 2RS31 4QXBA 3DECA 3K46A 5FXZA 3ZSJA 1RTVA 1SLBA 5JAXA 3ZXEA 2WO2A 2EIGA 4LO5B 2Y38A 3WG1A 3SHRA 2W08A 4XCBA 1QOSA 5F6LB 3DL3A 5HPOA 4XJ8A 4CCJA 4YW3A 2RJ2A 3WF3A 1NCRC 4XDQA 1BVP1 1XYNA 4XE9A 3OD0A 4D7YA 5BNPB 2HWC2 3USSA 1WW7A 4NIGA 3G7DA 1JYCA 3TEYA 2HLEA 3BIWE 1PVXA 3J7MA 2EAAA 4QM8A 3ZKUA 3OYWA 4FTEA 5JCTA 2D6MA 3JU9A 3K3OA 1ZZ6A 4FXGB 4AK3A 2Q1FA 1H2LA 1DGLA 1R1A1 2IXJA 2RM22 4KBZA 5FYYA 2I45A 1VBC3 3OBZA 4PIXA 1COV2 3O12A 1MR5A 5FK8A 4CCCA 3MZHA 3JQWA 2VULA 3D5OA 2QQOA 1LOFA 4NRMA 3WDYA 1H8TC 4NPRA 5GM0A 3ZMOA 1KQRA 1UQXA 3LD8A 2W92A 2Q4SA 4NMIA 5FPXA 3GF6A 2FDJA 4XUPA 4CUCA 4CUAA 3GXUA 3WF4A 1OQEA 1AL21 3UGGA 4A6OA 4C0BA 2DVGA 2V5DA 2BGPA 3O0VA 4YGEA 4ET7A 4CP0A 5CU1A 1W9SA 3GJBA 2OUHA 4ES9A 1YQCA 2VOVA 2YXSA 4FPYA 3CO2A 2LALA 1PIV3 4IGQA 1I5PA 4LKSA 4S2DA 1RUG2 4NHKA 2PMWB 3N9PA 1OKQA 5C7GA 4BDVB 1XE7A 4JDNA 1F31A 4I09A 2SLIA 2CL2A 1N1VA 2JDZA 2P1BA 2Y6FA 2ZHMA 2ZEWA 4XZUG 3H9AA 1Q43A 2OYZA 4J6GA 3T3YA 2HWF1 1V0AA 5DDJ1 3DUIA 2HKXA 4Y1VA 2ZGPA 2RHPA 3I8TA 4RS5A 1UNBA 2YDEA 4HPKA 2CGPA 5JXJA 2CNAA 3W20A 1PVC1 4Y3OA 2W1QA 2ZX4A 4JGZA 3VZOA 1S0BA 4AEDA 3ZSLA 1F35A 2VMGA 1W0PA 3QH6A 5KR7A 5FYMA 1YUDA 5H9PA 2X29A 4CDWB 2PHRA 5LBBA 4K3UA 4E2GA 4LBKA 4COWA 1WGPA 4P00B 5EXOA 3T2PA 5C4WC 3AYAA 3AYEA 5LBCA 4N53C 3VBOC 4OLLA 5JUVA 1ASJ3 2ZGNA 4LOTA 5IVYA 3NJZA 4RD7A 3SMHA 3LE0A 2C0ZA 1FAYA 2B9VA 3MF9A 3ZR6A 4LE3A 1SEFA 3KT1A 2DCTA 5JMOA 3ZYHA 3MIFA 2EXJA 4KG8A 1CAXA 1RUJ3 2Y0OA 1MZ6A 4QWNA 1JZ6A 5FYHA 5FO8B 1GUIA 2AZ5A 1DU3D 3QACA 4EYUA 2VQAA 4GKXA 3ILNA 4CDQB 4A2UA 1ZREA 2VZRA 4Q26A 1J3QA 5LA2A 1N3OA 5JOXA 4U2AA 4JKKA 4XTMA 1W2OA 4MZUA 3TNQA 1QJX2 5D8AC 5A3UA 2WT2A 2WZR1 1JH5A 3CNAA 4JCKA 3CJIA 3GHNA 3T1LA 3P3PA 2VBDA 2CYFA 3WDUA 2JG8C 3DN7A 2A73B 3VBHA 1HRI1 4XF0A 5HV0A 4LHKA 4LEJA 1PM7A 2HWE1 1HIXA 2F6BA 4PF5A 5F8PA 1F15A 4LKDA 1OFNA 3KZ4C 1DQ5A 4Z92B 2Y26A 1GICA 2EAKA 4IEUA 4ZU7A 4RS5B 1BBT3 1EV11 2OVUA 4RQPB 1S2EA 2Y34A 4YW4A 3UETA 1VBC2 5LBEA 1XJAA 4P9GA 1HQNA 3LZZA 4JGZB 4AEDB 4OHYA 5B4NA 1UY1A 5FKBA 3O5SA 4NWVA 1NG0A 1W2UA 2YPJA 4PIZA 2QJVA 3QLQA 4FP2A 5JXGA 2W39A 1VPHA 1BXHA 2XVGA 3VBFB 4HSLA 1RUF1 5CBLA 1Q8PA 3A7QA 5T5JA 1OA4A 3KGZA 1HB1A 4AI2A 1LHOA 3U37A 2ZAHA 1PIV2 3PJYA 1BZWA 4XAEA 3RZZA 5IVCA 3KD4A 3A22A 2ZAAA 3K3NA 2ZGQA 4XF4A 1CD3G 4S2HA 1IPKA 4UFHA 1CAXB 1MS3A 1NA1A 2W68A 4IE7A 4AFDA 4BU2A 1A6CA 5AVAA 4DUVA 3BIEA 1QJY1 1QQP3 1W8WA 2ORXA 3R4DB 4WBBA 5I0SA 1OOPA 3FJSA 4OQ9A 5G05L 1OBNA 1D7PM 5F37A 3E6DA 4OCTA 2D6PA 2G9GA 2WLPA 2VNRA 2VZOA 3AXEA 5A3WA 4BZ4A 2VU9A 4FFFA 5BNNC 1N1YA 4I3GA 1OC1A 2AUYA 5BNOB 3AVRA 3WNXA 1IS4A 1YYNA 4FXKB 4L9BA 3ZOIA 1A34A 1LGNA 3I97A 4WZFA 2ADEA 3CJIB 4LA2A 4QHOA 1HX6A 1PX3A 4AI3A 3POGA 3VD9A 1LOEA 3PNAA 1SLIA 2PN5A 1MS9A 3AFGA 3VBHB 3APBA 1FOD1 1DGRN 1RUE1 2D6OX 2WWSA 2XJUA 1ASJ2 2W94A 3PTYA 3MO4A 1XRUA 4EWDA 2R32A 1KJRA 4QMAA 5FYSA 1TME1 1XNKA 1TVGA 2A75A 2ZCWA 2RMU1 3H7YA 3ORJA 5DXDA 5GZDA 3WDXA 5JLVA 2QKDA 4FPJA 1JYTA 1QEXA 1LODA 4RGKA 3VBRA 4B4RA 1OD3A 2JEMA 1CPNA 2R061 4IQPA 1R093 5F3IA 2JE8A 4XUQA 5I8YA 5F2WA 1V6NA 3WVJA 1XNAA 3IBMA 4MXVA 4COYA 4AGGA 1MS0A 3I59A 4BWOA 5HI0A 1EUTA 5T3NA 2XL9A 3IMMA 5LK7B 1C5HA 4FOWA 1GWLA 3JZVA 2VVEA 3HBZA 2VNOA 5F3GA 2YPDA 1O8PA 2GNBA 4XFIA 3M3IA 3WHUA 5JR7B 1RHI1 4FPKA 2ADDA 1HDKA 1RUH3 2IXHA 4IGPA 3NV2A 5FZAA 1RC6A 2VCCA 2EXHA 4YYOA 2HBUA 1DHKB 3OB8A 2DU0A 1HV0A 4K21A 4CRQA 3U14A 3GZUC 2BVVA 1OOPB 1XSQA 2GZWA 3LEGA 1XB9A 5HXMA 4MGKE 1R083 3CMGA 4UW5A 4AI0A 4A3ZA 1Z0HA 1JYXA 4TN7A 3THPA 2E63A 4K9SA 4SLIA 1ND2C 2OPKA 3AMQA 3FX3A 3SLIA 2A6YA 1VLNA 5FLHA 1UOJA 4DY5A 4NPLA 2RR11 1PGSA 3AYDA 5CVRA 1LRHA 2OIIA 3ZSEA 5IFPA 3I3BA 1OT5A 2JG9A 2RS33 5IVEA 4TTGA 2J1SA 1ZRRA 2GC3A 5A33A 4YZ3A 3SCHA 4GB31 3GBWA 1GNYA 2QCSB 4P9LA 4UF0A 2O0OA 5CKNA 5FY9A 5I0UA 4NPMA 3AZZA 3DKQA 2XJQA 2QFEA 2O1QA 3FL7A 4AI9A 1HQLA 3AMPA 5LBFA 4I0AA 5E1RA 1SLLA 2WFF3 2ZHLA 3EBRA 4IW3A 3ILRA 1JZ3A 4JDOA 1ND3C 3JBG2 3HQXA 2JDUA 3B01A 5KC5A 1X9PA 1W8ZA 2VTFA 4XFHA 1T2XA 3LSEA 2YHJA 3FE5A 1GNHA 4GAZA 2X05A 3BI3A 3SH5A 1LGBA 1UU6A 5FP8A 4XDOA 4A42A 1YO8A 2ZBJA 4BXFA 2GN7A 3LFIA 4JVAA 4ZHNA 2WQ8A 1PMHX 2PHUA 2BNOA 2XOMA 2MPFA 1I3HA 2ZA9A 2OQ7A 4HLTA 5ACA2 1MQTA 4FT8A 4YZ2A 4ZU5A 5DAPA 1UOGA 2ZGTA 5JMCA 1VB4A 5ANNA 3KT4A 4A3XA 1HB4A 1SBDA 2QDRA 4FTSA 5JSPA 3M3EA 3AMNA 3SH3A 3N9MA 2HWF3 5JSOA 1Z7S1 5DDJ3 1IZ3A 1RJ8A 4YNIA 4I0BA 4CU7A 2RDRA 1VRH1 4Z07A 2WINB 1S55A 2WNOA 2VJXA 3ACHA 5JIAA 1AUYA 4FPOB 1ZRDA 4BE3A 1PVC3 3B69A 1SLTA 4XEZA 1RL3A 1X9TA 2R071 4CUBA 5C3OA 3WF1A 1T6GC 4YM3A 1R64A 1UOFA 4FPLA 5HCAA 4KU7A 5EJ1B 3NNGA 1LOAA 3OGVA 3ZFEC 2JG9B 3NJXA 4GQ7A 3R6SA 1V9U3 4AE2A 5IATA 2JWPA 2BV4A 3JB4C 5A33B 2DTYA 3IKWA 3S57A 4XXAA 3PDQA 3AZYA 1RUH2 1LR5A 4LKFA 2QQNA 4PDWA 1F5JA 4XUNA 1WCSA 5CADA 4UFJA 1LHNA 1VAMA 3H1MA 3LIHA 1M06G 2Y6KA 4ISRA 3ZDSA 3PU3A 1KRIA 5FYUA 3O0XA 2Y33A 2AH2A 3KCYA 4MYEA 3WQBA 2W3JA 2JJ6A 4AGVA 4CP2A 1SPPA 4IV1C 1H0BA 2MHFA 5HXVA 4TLFA 1R082 3RSJA 2VOKA 5C3RA 1F4AA 2DURA 3AKSA 2HH9A 2WN2A 4A4AA 1PO22 3BTAA 1JI6A 1UAIA 2B4KA 2BJSA 2ZGUA 4QU1A 5CG8A 1V6KA 1YIPA 1CN1A 2XLGA 4XJAA 4N43C 1EY2A 2VQ0A 2WNUA 3LOIA 5JI7A 2H0VA 3SCFA 3ZSMA 4B7KA 5LEKA 1BMV2 3VZKA 2ZX3A 3LAGA 2CU5A 1IPSA 2Y8KA 3ZN6A 1KFUL 4Y5Z0 2VZ1A 2VZUA 4KQ7A 1AYN2 3NV4A 1DGWX 5C8CC 5L36A 1AX0A 5J09A 1Q8SA 5A3TA 2HWE3 5BUVA 1YQ2A 5A7NA 4WVMA 1U0AA 4XTPA 2FHRA 4CCDA 4Q0UA 2DVBA 4LMFA 2GC0A 3LF7A 2MEV2 3NJYA 2F4LA 2XUEA 2WUHA 1G9CA 1GOGA 2W0XA 2WFF2 2I2SA 1PGW2 2YB7A 1CX1A 4F7ZA 2W2IA 3D82A 3DYMA 3NJVA 2YFUA 5I8SA 4WM7A 1JW6A 3THCA 1PGL2 2WA3A 1L7RA 1I6XA 2RS13 3JD71 1PMJX 1W8HA 4QGMA 1OFSA 2BYVE 2E7TA 3FFZA 4JRLA 4DXZA 4QXCA 2IXKA 1UO9A 2WT1A 2F4PA 4HXCA 4BH9A 5E16A 5EJZB 1RUF3 5T52A 1DGWA 1OLQA 2X8KA 4ZONA 5J96B 2FMYA 4YGBA 4ASMB 4WM8A 2DUOA 2J1UA 4NO4A 2FBEA 2VZPA 2ZOEB 1MS8A 4YVSA 3L2HA 4GWJA 5KHIA 2EA7A 4YZ5A 3BUCA 5LRRA 3WW4A 1BYHA 1JYVA 3H8XA 2D3SA 1FMD3 5FY4A 1J1TA 5A7WA 5A80A 1UCXA 3C3VA 4WZCA 2N7GA 2PHXA 1V00A 2D44A 3PUIA 2OXBA 1G9AA 3FN9A 3LFMA 3WNLA 2PHLA 3H1WA 4FOVA 2ZKNA 4YW5A 4W4ZA 1UU5A 2XDVA 5CIRA 1FX5A 4FPFA 5JI9A 5FBZA 4YZ4A 1BQPA 4CDUA 3I7DA 3OOXA 3K4ZA 3AXDA 5FYZA 1YQ6A 3ZPOA 1IQDC 2XONA 3ZN6B 1KS4A 1V9U2 3NV1A 1G9BA 2YFZA 3URFA 1F5FA 3RYPA 4ZXEA 4FQZA 5ABJA 3HMYA 4CCKA 3R05A 1RUE3 3NV3A 5D2AA 4JHZA 4AG4A 1VMHA 2JD9A 3HQRA 4BQ5A 1XNDA 4DXSA 1G7YA 1WMFA 5FO9B 1B35A 5AFBA 1OH4A 4WVMB 2EXKA 3FMGA 4RR3A 5ANQA 4DY3A 1XYPA 1TMF2 1UIJA 3LEKA 2NMOA 1CZSA 3FBMA 4OYUA 4UFKA 2R063 4IV3A 4NHYA 5CA6A 5DN2A 4ONUA 4KMQA 2P37A 1OF3A 4MGZE 1JZ7A 1IPJA 3UNPA 2ZZQA 4QXKA 4WM7B 5H9RA 3PUAA 2ETEA 3RZMA 1ONAA 4UXAA 4MGYE 4CCLA 2D98A 2XG3A 3ACLA 4DUXA 4QKDA 4DIQA 2WS91 3BTXA 2O14A 4WM8B 2FCUA 4HSJA 1N3QA 4MADA 1QIQA 1RHI3 3NAPA 5A7QA 1SQ4A 4M01A 1GMMA 1AYM3 4TYSA 3TWIA 1Y4WA 2E9QA 1XOYA 2Q1MA 2QNKA 3VZNA 1O8SA 4EZ4A 1W6NA 1RB8G 1MVQA 1VIWB 2BDRA 2OQ6A 3AP4A 5FPZA 5IHRA 2K9ZA 4FQ4A 1AR72 3B00A 3U75A 4ASLA 5A7WB 3J7NA 3WZ1A 1P8JA 5F9TA 3HT1A 1QJEA 5CFDB 5APAA 1PK6A 4AEMA 1UZVA 3GZTB 1WMXA 1NZCA 2HWB2 1SCSA 1RUI3 4HBNA 5FZCA 1ULCA 3U10A 1RMU3 1WA6X 2JIJA 2FQPA 1CZVA 1ZRIA 1O5UA 4Q4V3 4AVAA 2VZTA 4H14A 4LO4B 3MLJA 3POEA 4NHLA 1NT0A 5GLWA 4CDUB 3RZKA 1YIFA 1DYKA 3PVOA 1YFUA 2RS12 2BGOA 4UYBA 1TQ5A 1PZ8A 4M4PA 5HCFA 2P6HA 2D5HA 4QQHA 2WDBA 4QPGA 4BMEA 4Y22A 2ZHKA 2OKXA 5ABJB 4GB33 5EFUA 4IESA 5I0TA 3GCWA 4QB2A 3POFA 5FZDA 5FY7A 3ZIXA 1W9YA 1AXYA 1MZ5A 1VBD3 1DYOA 1MEC2 4IV3B 5CEHA 4CDXC 5EV7A 1DQ6A 1FMD2 1PO11 1VBB1 2X53S 5JSRA 2VQTA 2DBIA 3LPGA 4QU2A 4CXWA 1T6BX 1QJZA 1CX4A 2D6NA 4TSVA 4CCNA 3SQOA 2KD7A 1K5MA 5C70A 4Q4X2 3FHQA 3N36A 4QGNA 3TN92 2VTXA 3SNMA 2HWD1 2FZ2A 1K5JA 5FMOS 3NAPB 1XU1A 4ZS3A 1EP0A 3R0RA 4M3CE 5K4LA 4DNYA 5LRSA 3LDRA 4OI0A 5FZ0A 3WD5A 4JZRA 1HV1A 3PVEA 4LE4A 4ATEA 3PURA 4QKNA 5JPNB 5K7PA 3IIAA 4WVZA 3T2QA 3WNNA 4Z82A 3J8F2 1GZTA 3AP7A 4HK8A 3ZFFC 4FFHA 1VR3A 2IVJA 2BVBA 1UMIA 2Z42A 2BW8A 1FPN1 1PK6B 4YRDA 3IWZA 3WNPA 3RDIA 1H1AA 3HIFA 1UYXA 2D93A 1N1SA 4E4HA 2KXLA 4P5HA 3GBFA 2GSYA 1QXPA 2J22A 5FZ4A 4A6SA 2ZGSA 1GU3A 3AKQA 4XC9A 3CEWA 1F8VA 4P08A 5T55A 1NA1C 3IIIA 1EPZA 2PQSA 5T5LA 2BEOA 4QPGB 3ZO0B 3WW1A 2QQWA 3MIGA 4W50A 5FY0A 2ZPXA 1O7FA 3UKVA 4CP1A 3Q8BA 1LULA 4AI1A 4C1XA 1OURA 3DEMA 3POSA 5D21A 1AYM2 1JYNA 2OX0A 1DGRA 4OI4A 2UURA 2ILMA 4CU8A 5SV8A 4OVEA 5G04L 2VMFA 5DZEA 2WZ8A 3KB5A 1RUD1 1LB2A 5DAWA 2QQPA 1W99A 2IFRA 2QUOA 2XBO2 1QH6A 2VPVA 1E5HA 4UT5A 5FP7A 3CQOA 1RUC3 1VBA1 1K3IA 4P5YA 2VR4A 4DINB 5LA0A 1RUI2 2E32A 3AYCA 1NQJA 3RYKA 1RMU2 2PAMA 1M4WA 1MVEA 4H7LA 4CU9A 1K5MB 1RGSA 3CF6E 4Q4V2 1OLRA 2WNVB 3AL5A 2FMDA 3FUQA 3VDDC 1VBE3 3HEIA 4QX1A 5E88A 3VBRC 4NROA 1L7QA 1V6MA 2NYYA 5DZGA 3KV6A 4CDQA 4XMIA 1NLQA 3ON7A 4XIOA 4B7EA 3OPZA 2QVSB 2ZEYA 3JXSA 4G9SB 4MSVA 1TNRA 1NAEA 1HB3A 1S1AA 2VBPA 4H2AA 5FZGA 1H4HA 5FZEA 3IPVA 3KQRA 3E5QA 1NKGA 1ZBE1 2XH6A 1R1ZA 1VBD2 1FXZA 4ISQA 4EWAA 2D43A 1EAH1 2K46A 4YWAA 2LTNA 2V4VA 2VZVA 2Q8DA 1YEWA 2XJSA 3I2KA 4XMAA 4QDQA 1PNGA 4HN0A 1D4M3 5FP4A 3J9SA 2VVFA 2VUCA 4LBLA 4YZ1A 4KNCA 3M4FA 5HCBA 1H2KA 4DOUA 1SLAA 2CDOA 1H6YA 3VV1A 2XJTA 2WSVA 4KI5M 2ZZJA 4NIIA 1LTEA 4QX8A 2BNNA 4PHZA 2D7FA 1GQHA 4I0WB 4M3CA 4Q4Y1 5FUIA 3VLBB 2YC2A 3KF3A 4RQPA 3C7FA 4GMP0 4LIVA 1STMA 3O1MA 1A3KA 1VALA 4JDMA 4LBMA 1YXWA 4UI9L 1O3RA 2E7QA 3ES4A 4LA3A 3KV4A 3BOPA 5F32A 3N7LA 2JDYA 1BEV1 2AENA 1WCDJ 3I4IA 3ME2A 3OCPA 1NCQC 1W8FA 2BWCA 2K0GA 5CFCC 2JKXA 3VBFA 2XB6C 3FLPA 4P02B 4CEYB 5LA9A 5A3NA 5C5UA 5DPNA 3VBUA 4HVQA 2E7AA 3N7MA 4XOGA 1GOHA 4YGDA 2ERFA 3AVSA 5C6CA 4P14A 1UY3A 5FPVA 4R8HA 2ZMNA 4M00A 4X8NA 3ACGA 1RVF1 5F3EA 5C3QA 2PHFA 4AAPA 2VZSA 3TB0A 4GH4B 2V09A 1FV2A 1WZXA 2Q1ZB 4HN1A 3WF0A 3H8OA 4WVVA 2PQQA 4QKBA 2XJVA 2CGNA 1WMEA 4NN0A 5FZLA 5JR2A 3BOWA 2VMDA 4YM2A 4DMIA 4BLIA 2VE1A 4N8MA 4QX7A 5FZKA 3WQ7A 5A6QA 5FZFA 1QMJA 1IHMA 1UPSA 3IMNA 4YVWA 1US2A 4C90A 3OUIA 4QGLA 4RHV3 4XABA 1IOAA 4FPCA 5A3MA 3N4MA 1CONA 4W6XA 3OEBA 3OUHA 4Y26A 3B7MA 1AR61 2D6LX 2GALA 3KM5A 1WD3A 2YU2A 4Q29A 5C9AA 4KGGA 4LXLA 5BNOA 5F5AA 1IG0A 3D0SA 3IPVB 4ARXA 1GSLA 1AR83 4IE6A 1XNCA 5LW9A 4PI0A 4H3WA 1LKNA 2NQYA 2YU1A 1G9FA 1ST8A 1XE0A 1H8VA 2BOIA 2JDNA 1IG3A 2VMIA 5EP9A 5K0UC 1WUVA 2A1XA 2A70A 3CZUA 2ZGLA 4NOTA 3I2OA 1MQTC 3NVCA 1RUC2 1E57A 4F8AA 2PXJA 4LK7A 5HBAA 4AWDA 4BPZA 4ZZ8A 1QJU1 2VCAA 5FPLA 3UL2A 4M3CB 4BQ4A 1H2MA 2JDKA 3U0ZA 4FPEA 2WO3A 4MLOA 2R041 4A7YA 1VAKA 3P3NA 4NUBA 1LGCA 1QNYA 1VBE2 4LR4A 2GN3A 1HXS1 3OD4A 5FP3A 3VBSC 3VD7A 1Y7BA 1O59A 2VXRA 2WT0A 5A7OA 5F1RA 1OMIA 4C0HA 3NW4A 4NJ4A 3WG2A 3M2MA 1CAWA 1RXFA 3ASIA 4I3PA 4XFAA 4CEWC 3TEZA 1Y3TA 4QPIC 3INAA 1ACCA 1D0HA 1AL0G 3ETQA 2A3WA 4XQWA 4ORFA 1GWKA 3VBUB 3VHRA 3WDWA 4AEKA 4DFSA 3POBA 3T30A 3HVDA 2A3YA 3RI9A 1UOBA 3NSTA 5FZOA 2VOXA 5GLUA 4HANA 5IK5A 5AVPA 5BY5A 4AZZA 1OPMA 2XMLA 1D4M2 1C5IA 4PDWC 5F7UA 1HKDA 4B4QA 4LTAA 1W2AX 1K42A 3BN6A 4XYXA 4Q4W1 4JGYA 2JICA 4YVWB 2DU1A 3KT7A 4QX5A 5L7OC 2VW2A 2WJSA 4O7XA 4XACA 2PYTA 2ZGRA 1NXD1 3MBWA 4DXRA 2YGLA 3M3CA 5C9AB 2CWSA 4HKWA 2VBBA 3VHPA 4Z2AA 5HV4A 1L3JA 3MGUA 1UMHA 3S0MA 1W3XA 2E51A 3DKWA 3EJKA 1NY71 1X82A 3AM2A 2WR9A 4CA9A 1V6LA 2WNUC 2LM3A 3LKJA 5A3PA 1PO13 1VBB3 1U5ZA 3OUJA 4R52A 4AVVA 1S0DA 4MHRA 2DUPA 3MIDA 4XPVA 5IK7A 2VZQA 1OA2A 4U36A 2VNVA 1GYKA 4B4PA 4D94A 4AFBA 5FPUA 1TZOA 3N9NA 4UW6A 2R0FA 2D5FA 1YFYA 2BBAA 3HR9A 4QPWA 2XR4A 2CDPA 2PLV3 3KLSA 4FOYA 4XW3A 3BU7A 5A7SA 3FWEA 3TEXA 3VHNA 5AC91 3FC0A 4K1YA 1HRV1 1MS5A 1HQWA 1RUJ2 1UMZA 4IEPA 4Z1VA 5LWBA 2VAUA 1FV3A 3OGSA 4Y33A 1GZWB 4A44A 1S0FA 5DZFA 5FMCA 4RHV2 3NNFA 3RNSA 1OHFA 3T2TA 4COUA 3DCQA 3WHTA 2ZACA 2RS53 1NCRA 4NIDA 2R6QA 1CAWB 3Q8EA 2XHNA 4AVCA 3IDEA 4XBLA 1YI7A 2WAAA 5K8SA 3KV5A 4J1WA 2JXAA 2YROA 4YM1A 1X50A 3VGIA 1ZBA1 3WDTA 4QT6A 3ZLIA 2Y6JA 4C1WA 4XHBA 1FPN3 2BTVC 1AR82 5H9SA 4XJWA 2K2SA 5FZOB 3AC0A 4EN0A 1D2SA 2LS6A 2P3YA 4ZU4A 4E2SA 2E26A 3LA2A 4YVSC 4MGIE 3PU8A 1PMIA 4XVHA 3VKMA 3MLLA 4IEZA 2WKKA 4TZDA 1JN2P 5LATA 4Q0QA 2GNTA 4JGYB 1ENRA 2W5FA 4BK4A 4L8QA 3IB3A 4LLFA 4IEWA 4DPNA 3UGFA 2C4XA 1BBT2 3O14A 2KA3A 4QM9A 2HBTA 4XFBA 1C8M1 1BK0A 1AR91 3K4AA 2XUMA 2WZPP 4CCMA 3AJZA 4OZOA 3KHCA 1IQAA 1DFQA 5KWRA 4K40A 1V6JA 3ACIA 5F5QA 3TBDA 2J42A 4L2NA 2OS2A 3X29B 3OGJA 4LBQB 5I91A 2DUQA 3IN9A 4GMP1 5FYVA 2Z69A 4ARYA 3UV9A 5FO7B 4DEVA 5JPMB 4E27A 1KEXA 3MHZA 5JZGB 1BJQA 2YC4A 1NE4A 4UOJA 5FBJA 4QQLA 4W65A 1U5YA 2HWC1 3L2YA 5I8TA 2VD7A 2ZX0A 2Z5WA 1B35C 4RN5A 2C5DA 2Q8OA 1ALYA 1G9DA 4RR3C 3M3OA 4EV0A 1GZ9A 1K45A 1QQP2 1R1A3 2RM21 5FZ7A 5C4WA 5GLTA 1J3PA 3VN4A 2C26A 1COV1 3VBOA 2UWBA 4DXTA 2A6WA 1FT9A 1FYUA 2W47A 4PQ9A 2ZXQA 4XURA 3O1OA 1DZQA 1NCRB 1YCIA 2WA4A 3HT2A 3KWVA 4AHWA 4QKFA 4IEOA 1N3PA 5J48A 4BB3A 4RGGA 1KJLA 1KDMA 1HN0A 5EYYA 4OMCA 1AL23 4Q27A 1S0GA 4AHZA 2VH9A 2PHTA 3UJQA 4BISA 3MV11 4L11A 4S2FA 4URTA 2BERA 2X5IC 1ENSA 1US3A 1ZBE3 2YY1A 4META 1RITA 5A7PA 1EAH3 1W6QA 4DRRA 1RUG1 2G19A 1H9PA 2YBPA 3RWKX 1UD1A 3RI8A 3U4XA 1H8TB 1RYYA 4LHLA 3WCRA 3T08A 1S0JA 3DPRC 3ZFGC 2QQJA 5KHJA 2CTVA 2ET1A 5FYIA 1NOVA 1H6XA 5D8AA 5I0RA 4YARA 1UN1A 4YSFA 3KCCA 2R49A 3AZXA 1ZZ9A 4AAXA 4AOCA 2PLV2 3VKFC 4E8CA 1ZX5A 4AI8A 1LECA 3BTZA 1R092 3OEAA 4K8FA 3WCSA 5B4XA 2UU8A 3UK9A 3ROUA 3QD6A 1JOJA 3I2FA 3ZN4A 4YG6A 1YQ8A 1W06A 1QU0A 2HJIA 4AQ2A 4CU6A 4BJ0A 4NIHA 2ET7A 1BEV3 3B9IA 2RS52 3H42B 1J83A 3GDBA 2BUKA 2JB4A 2D40A 4IDZA 1OA3A 1LU2A 1SG3A 1H9WA 1D0GA 5EWSA 5FYBA 4XUOA 1YI9A 1QJFA 2GP3A 5A6ZA 2AYHA 2Y0IA 2YG0A 4GWIA 1RVF3 3DYOA 2EIEA 1CAUB 3ZYPA 1BVVA 3H8UA 1XBFA 3UJOA 3PVBB 4J25A 5EJ3A 5FUPA 2Q8EA 1SFYA 2QZ3A 1XPWA 4KWUA 4MH0E 5EIYB 5FMBA 3D0JA 2WLQA 1PX4A 1UIKA 5SV5A 3MEPA 3ELNA 5C4WB 1UXXX 2PAEA 4N53B 1QXRA 2GH2A 3VBOB 1BHGA 4L97A 4ITCA 5T5OA 1JZ5A 3ZN5A 3VD3A 3D6EA 4QB6A 2GNMA 5JIUA 2E33A 3T4VA 1QJX1 4Q0VA 5DAQA 5BNPC 5F5CA 1ENQA 2WZR3 4YW6A 2JE9A 3H3ZA 4HKLA 4BA6A 4AHXA 2A6XA 3HQUA 1ZA4A 2IXCA 1Y9QA 3I2JA 5ISLA 1JMUB 2WIIB 3CZJA 5FMOL 1W6QB 2RS32 2JKBA 4M3CF 3N3HA 3M7AA 5FR3A 2C1FA 1ENXA 4XFGA 5GLVA 2RE9A 3VZJA 1HRI3 5FDBA 2JENA 1WKYA 2DVFA 2EIBA 2ZGKA 1JODA 2A3XA 3E97A 4IL7A 4TXWA 5D8AB 5A6YA 3P1IA 1JU3A 4IE4A 5FK7A 5D1IA 3POYA 4BIFA 1YJLA 4V2VA 1WLTA 3W9AA 1EV13 1A8DA 1UX7A 2CSGA 1W6PA 5A1AA 1R1A2 1VBC1 2A7AA 2JG8B 2AEYA 3I54A 4O61A 4OMDA 4AXOA 3KVBA 5CISA 3U4SA 5TSWA 2DBNA 1KITA 1U12A 3AMMA 2VM9A 4Q1RA 4ATFA 4K1ZA 5FPBA 2YV8A 2ARAA 2DV9A 2H0BA 3HN1A 3B02A 2TUNA 1SHWB 1AL22 5FXXA 4XF9A 3U1XA 1OD5A 2FCVA 1F2NA 1U5IA 4ZKTB 1S2KA 4LUKA 2W95A
chains in the Genus database with same CATH topology
1UOFA 1W3XA 1HJGA 3ZKYA 1GP4A 4BB3A 1W2OA 1UZWA 2IVJA 5C3QA 1GP6A 2VBDA 2JB8A 2VAUA 2VE1A 1W06A 1W2NA 5C3RA 2JB4A 3ZKUA 2BJSA 1DCSA 2BRTA 1QJFA 1GP5A 1QIQA 1E5IA 1IPSA 1E5SA 1W3VA 1HJFA 1E5HA 1QJEA 1HB1A 5APAA 4XAEA 2BU9A 1W04A 1ODMA 1WA6X 1BK0A 1W05A 2Y6FA 2WO7A 2IVIB 1BLZA 1OBNA 1UO9A 1RXFA 1UNBA 3ON7A 1W03A 1OC1A 1HB2A 1HB3A 2VBPA 2VCMA 3ZOIA 1W9YA 1UOBA 5C3PA 1UOGA 2CSGA 1HB4A 2VBBA 2DBIA 1W2AX 2DBNA 1RXGA 5C3SA 2Y60A 1W28A 1E5RA 4RGKA 5C3OA 3OOXA 1ODNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOF A;  1W3X A;  1HJG A;  3ZKY A;  1GP4 A;  4BB3 A;  1W2O A;  1UZW A;  2IVJ A;  5C3Q A;  1GP6 A;  2VBD A;  2JB8 A;  2VAU A;  2VE1 A;  1W06 A;  1W2N A;  5C3R A;  2JB4 A;  3ZKU A;  2BJS A;  1DCS A;  2BRT A;  1QJF A;  1GP5 A;  1QIQ A;  1E5I A;  1IPS A;  1E5S A;  1W3V A;  1HJF A;  1E5H A;  1QJE A;  1HB1 A;  5APA A;  4XAE A;  2BU9 A;  1W04 A;  1ODM A;  1WA6 X;  1BK0 A;  1W05 A;  2Y6F A;  2WO7 A;  2IVI B;  1BLZ A;  1OBN A;  1UO9 A;  1RXF A;  1UNB A;  3ON7 A;  1W03 A;  1OC1 A;  1HB2 A;  1HB3 A;  2VBP A;  2VCM A;  3ZOI A;  1W9Y A;  1UOB A;  5C3P A;  1UOG A;  2CSG A;  1HB4 A;  2VBB A;  2DBI A;  1W2A X;  2DBN A;  1RXG A;  5C3S A;  2Y60 A;  1W28 A;  1E5R A;  4RGK A;  5C3O A;  3OOX A;  1ODN A; 
#chains in the Genus database with same CATH topology
 1GOF A;  1U5X A;  5IVJ A;  1PIV 1;  1W9F A;  3GCX A;  2WQZ C;  3KVA A;  5CKM A;  3V0A B;  3I2H A;  4FO9 A;  2IXL A;  1NYW A;  4JX0 A;  4K7J A;  4E4D X;  3KHB A;  5FWJ A;  1PZ9 A;  1JYI A;  2R16 A;  1DIW A;  4JC1 A;  1QJY 3;  3MYX A;  4AQT A;  2V5Y A;  2FCT A;  1KDK A;  3EQE A;  3F2Z A;  4BIO A;  4CDW C;  4LT5 A;  2HWF 2;  4YGC A;  5CFD A;  5DDJ 2;  1J59 A;  1LEN A;  3AMH A;  5JXI A;  2ZKL A;  4YW1 A;  4M4R A;  1SBE A;  1LHW A;  2JB8 A;  5FYT A;  3V0B A;  4BQY A;  4OHW A;  4KWL A;  5BPX A;  2RJL A;  1PVC 2;  3AB0 A;  3MW4 A;  4R4Z A;  3LOB A;  2G4I A;  4KWK A;  3POJ A;  4JHT A;  1OQ1 A;  3WNK A;  2JEC A;  2UYB A;  3WP6 A;  3RVH A;  1UZZ A;  4HMZ A;  3MPB A;  1Y43 B;  4HFS A;  1XNB A;  5E6H A;  5FLI A;  5LEJ A;  2ZX1 A;  3ITQ A;  3WW3 A;  3BOD A;  3LPF A;  3BPZ A;  4GAL A;  5FZ1 A;  2XWJ B;  5KHH A;  3V65 A;  1FOD 3;  1LOF C;  2ARC A;  5BNN B;  1JS9 A;  1ASJ 1;  4XQD A;  5DAV A;  4CDQ C;  1JU4 A;  1C8N A;  4B29 A;  5BXX A;  1TME 3;  1HLC A;  3AZV A;  1OLM E;  1Q8Q A;  3GJA A;  4LPL A;  4CXX A;  2RMU 3;  4JKM A;  4RA0 A;  5JOY A;  4I30 A;  1NX9 A;  3B3Q E;  2D3R A;  3U11 A;  3OY8 B;  5FRE A;  3RRD A;  2ES3 A;  1QHD A;  1W6P B;  1WCU A;  2PTM A;  2XLA A;  2DDU A;  2HYX A;  2VNG A;  3WY6 A;  3EMR A;  3I3Q A;  1UXZ A;  1XNT A;  2ENR A;  2H6B A;  4Q2F A;  4QQ2 A;  3ZR5 A;  4CZS A;  5FKC A;  3WIN E;  1AZD A;  3NNL A;  3I2I A;  4QDR A;  5CYY A;  4F83 A;  1CIW A;  3W21 A;  4PBP A;  4FPG A;  1CR7 A;  5F2S A;  1LHU A;  3QH7 A;  3K51 A;  1YJK A;  4NVP A;  1ZBA 3;  3VKL A;  2WZR 2;  4W6Y A;  2CGO A;  1GLH A;  1LES A;  1ND3 A;  5FWE A;  2IVI B;  4V2W A;  3VL8 A;  4CTE A;  4RS5 C;  1DBN A;  2PHD A;  5FZ6 A;  4RQP C;  1RIR A;  4Y5T A;  1UY4 A;  3RJR A;  3WF2 A;  5AFE A;  4NAM A;  4QD2 A;  1F4H A;  4B1L A;  4HG6 B;  4B3N A;  4JGZ C;  1HRI 2;  2W9X A;  2BFU S;  4AED C;  1WW5 A;  4R4X A;  3GBG A;  5JOW A;  2HWE 2;  4MGQ A;  3AFK A;  4HZF A;  4AEJ A;  1W8U A;  5JWP A;  3VBF C;  5K9Y A;  5C3P A;  1QDO A;  2VME A;  4D7T A;  1EV1 2;  1QXJ A;  5M0T A;  3V0B B;  2XVK A;  1C8M 3;  1AR9 3;  3KCX A;  2V4A A;  2BP6 A;  4XQ4 A;  3ZMN A;  3W5N A;  1RUN A;  1O6U A;  4CSW A;  3Q8A A;  4WVW A;  3HBK A;  2VL4 A;  1WCQ A;  2RR1 3;  4PF1 A;  1GR3 A;  1YHF A;  5A3L A;  3CJX A;  3T09 A;  4QQO A;  5GZC A;  4IND A;  1RXG A;  3ZSK A;  3J4U H;  2LUW A;  2RDN A;  4GMP 3;  1RUF 2;  2EIC A;  1NE6 A;  1WLW A;  3C7E A;  2PHW A;  5LB6 A;  2EVX A;  2FZ1 A;  2QQK A;  4OI1 A;  1GBG A;  4X6R B;  2XQR A;  4EN6 B;  2E6V A;  1ND2 B;  4TLG A;  3M70 A;  3BB6 A;  2GC2 A;  1A78 A;  1DP0 A;  2XQX A;  3BVC A;  5CZK A;  1ZVF A;  2HWC 3;  4LJH A;  3W5M A;  3AZW A;  3EYP A;  2OW4 A;  3NNJ A;  4IEX A;  3CDZ B;  3S30 A;  5BNO C;  2WZE A;  1D2Q A;  3H3L A;  4GKY A;  5FZ8 A;  3PUS A;  1N47 A;  5JXH A;  2UWC A;  3C8X A;  1QJY 2;  3JBG 1;  2RM2 3;  4NHX A;  3PVN A;  2P6C A;  3CJI C;  4NHM A;  1V70 A;  3O1S A;  2W91 A;  2FDH A;  3WG3 A;  3ZYG A;  3IDA A;  2P2K A;  3MW3 A;  1O3Q A;  1B09 A;  1WW4 A;  4AF9 A;  1GP6 A;  3MIB A;  3VBH C;  5L9R A;  4EN9 B;  3V64 A;  3VB9 A;  5IVV A;  2VXJ A;  2JE7 A;  1OPO A;  2WNV A;  3CKH A;  1YWK A;  2Y6G A;  4TWT A;  1NZI A;  3RG0 A;  3O1R A;  2R0H A;  1ND3 B;  3S7E A;  1UY0 A;  3H50 A;  4IV1 A;  2QQL A;  4PLM A;  1W2N A;  2YMZ A;  5ACA 1;  4XFC A;  2QE3 A;  3C2U A;  4RGA A;  3ZXJ A;  1OLM A;  4P9I A;  4E4S A;  4OI2 A;  1WA4 A;  2BRT A;  3VZL A;  3BYW A;  1FOD 2;  1RUE 2;  4MO3 M;  3NNM A;  3OF1 A;  4X8P A;  4XF3 A;  4Q8L A;  4IGO A;  1W2T A;  1MPX A;  2WN3 A;  1TME 2;  4N43 A;  1Q3E A;  2XGX A;  4OUS A;  2RMU 2;  1Z7S 3;  1GNZ A;  3PLQ A;  2QZ2 A;  1VRH 3;  1LED A;  2R06 2;  2VOT A;  4HOO A;  4Q0S A;  4LHN A;  5FLJ A;  4FTB A;  1DYP A;  4H7M A;  2Y64 A;  3K2O A;  3ETP A;  3O0W A;  1HJF A;  2R07 3;  2RDQ A;  5C8C A;  3WP5 A;  1AX1 A;  4Q0P A;  4DRV A;  4DS0 A;  1RUO A;  1LHV A;  3KSC A;  3MDP A;  4SBV A;  4DZG A;  3T0B A;  1NLR A;  1UYP A;  1CES A;  1W04 A;  2ID4 A;  2W46 A;  5GKA C;  4YW7 A;  2UYA A;  1OOP C;  3S7I A;  4L0P A;  3E6C C;  1RHI 2;  1QY4 A;  5C71 A;  2VW1 A;  1MS4 A;  3E5U A;  1RUH 1;  1S0C A;  2XXZ A;  3MUZ 1;  1AVB A;  4OZX A;  5LY2 A;  3WEZ A;  1J84 A;  1URX A;  1NQD A;  3A4U A;  5BYN A;  2FDG A;  4QAW A;  1CJP A;  1FAT A;  4JQR A;  2DTW A;  4XFF A;  3ZFE B;  1C57 A;  4CEY A;  1UYZ A;  1YNA A;  4FOQ A;  1HB2 A;  3VDA A;  3O1U A;  1GFF 2;  2B9U A;  2RG4 A;  3PIJ A;  3BGA A;  2ZHN A;  4Y1U A;  3WQ1 A;  5KXC A;  1R08 1;  5F39 A;  2J1T A;  1X33 A;  2VMC A;  2WO1 A;  4FBF A;  3H1Y A;  4GJY A;  3OGG A;  1CVN A;  1LU1 A;  2KR2 A;  3B5L B;  3N35 A;  4GH4 A;  2GC1 A;  1EYB A;  1PO2 1;  2WC2 A;  4P9Y A;  1AXK A;  5JOZ A;  2D97 A;  2WQ4 A;  3ATG A;  4R9A A;  1QJX 3;  3I2G A;  3W58 A;  1JZ2 A;  2B5H A;  3O1T A;  1WMD A;  2HEY F;  4O9E A;  3IZO A;  4DQA A;  2RR1 2;  2RVA A;  2XPJ A;  4FI9 A;  1BMV 1;  3LGR A;  5GZG A;  5A32 A;  5FMD A;  4IV1 B;  3NL1 A;  4AHY A;  2L9L A;  1DLC A;  2ZEX A;  2Y60 A;  2BPA 2;  3SCG A;  3HN3 A;  1JXN A;  4QHB A;  1AYN 1;  4GB3 2;  4LQR A;  1ZM1 A;  2Y6H A;  4XZP A;  1JZ8 A;  4LK6 A;  1W6O A;  4CCO A;  4N43 B;  3ZIW A;  2DVA A;  4XJU A;  5EZW A;  2XHK A;  4L99 A;  1LJ7 A;  1H1M A;  2MEV 1;  3ZXA C;  3AP6 A;  1HJG A;  4CVU A;  2WFF 1;  2VGD A;  1GZC A;  3MIE A;  1Z78 A;  1N1T A;  3NMB A;  4ZPI A;  1PGW 1;  2A6Z A;  4HET A;  2B45 X;  5EQU A;  1UZW A;  2X09 A;  5FTT C;  4Z2W A;  3BTY A;  1YC6 1;  3HNM A;  4WV8 A;  1QGL A;  3NKG A;  1KXG A;  3NQH A;  5C8C B;  3VDC A;  1UPI A;  1UL9 A;  4XXP A;  1PGL 1;  3LDB A;  2C6S A;  1UY2 A;  1GQP A;  2Q30 A;  3E5X A;  3JD7 3;  3N9L A;  4L92 A;  5KC6 A;  5LY1 A;  1GWM A;  2FDF A;  1KS5 A;  1TEI A;  1IKQ A;  2MNG A;  3UGH A;  1V6I A;  4JTO A;  2FDK A;  2XJP A;  3CHX A;  4S2G A;  4QXH A;  4JAA A;  4KU8 A;  4XBN A;  3I2D A;  4Y5S A;  3WOG A;  3HNB M;  2P3K A;  5DUX A;  1RIN A;  1ZA7 A;  5C33 A;  4ZZ5 A;  4RL7 A;  4CXY A;  1TE1 B;  4D6S A;  2QQM A;  1DZT A;  2BBV A;  2GME A;  3IAP A;  1C28 A;  5GAL A;  1DCS A;  2DCZ A;  2Z2S B;  5EYX A;  5B2G B;  1S0I A;  3GNE A;  4GJZ A;  4I01 A;  2JG9 C;  4LO7 A;  1QWR A;  4QX0 A;  3M1H A;  1Z7S 2;  1E5I A;  1PHM A;  2IZW A;  3ZYI B;  1W8O A;  4Y1Y A;  4G3Y C;  1VRH 2;  5F3C A;  1W3V A;  3RQ0 A;  1FNZ A;  3WNM A;  5FOJ B;  2ATF A;  1OKO A;  5H9Q A;  2QDN A;  3A0N A;  1WWY A;  2R07 2;  3ZYJ B;  4B8E A;  4R9D A;  2GAU A;  2JX9 A;  3GHM A;  2VUJ A;  4LBJ A;  2Q0A A;  3H0O A;  4RYD A;  5A32 B;  5HCH A;  3THT A;  1Q8V A;  2Q8C A;  1V9U 1;  3WXP A;  4M0N A;  4HKO A;  3VZM A;  1JOB A;  4NAO A;  5GJ6 A;  5IYY A;  4ASK A;  4AVT A;  3U78 A;  2C9A A;  1W6O B;  1ZZB A;  2G1M A;  2ZX2 A;  3L9J T;  3ZDV A;  1LCL A;  2B39 A;  3FFQ A;  1TMF 1;  3PJQ A;  4PBO A;  1H4G A;  1PNF A;  3OYW B;  1DLL A;  2DWR A;  1QDC A;  1SCR A;  3ZYR A;  5A1L A;  1CZT A;  3BKZ A;  3KMH A;  4BQ1 A;  1I5Z A;  5DG2 A;  1DG6 A;  5IW0 A;  2P3J A;  2H6C A;  5DUW A;  4QX3 A;  1UKR A;  1ZZC A;  1G8W A;  5DAX A;  5FZM A;  1X8M A;  3USU A;  2W52 A;  2PAK A;  2WS9 3;  3WP3 A;  3Q8C A;  4BCU A;  3LA3 A;  3RZH A;  3RZL A;  1JHJ A;  3AK0 A;  1UU4 A;  4CDX A;  1GZW A;  2ZAB A;  2XWB B;  4KH9 A;  3K4D A;  3SIS A;  4J1X A;  1UWW A;  5GLZ A;  4MG2 A;  4X6Q B;  1S2B A;  4FCA A;  2WRA A;  3OPW A;  3VL9 A;  1QOO A;  2RDS A;  4XF1 A;  4IXL A;  4Y4R A;  1AR7 1;  4GWN A;  4IET A;  4Y20 A;  1CAV A;  4OUL A;  3RZJ A;  2GND A;  2C9K A;  2B8M A;  4AR2 A;  4YPJ A;  1O5L A;  3LDK A;  4P9X A;  2HWB 1;  4EWE A;  1W8N A;  3H8R A;  3MFC A;  1Y9G A;  4HPK B;  1YLL A;  1GP4 A;  3AKR A;  4H55 A;  4AYU A;  5CKQ A;  3D8C A;  4KGQ A;  1EUU A;  1ULF A;  1ZZ8 A;  4OHV A;  1TG7 A;  3PL0 A;  5F5I A;  1AXZ A;  1POV 0;  4XJ9 A;  3JD7 2;  4XHX A;  1SAC A;  2RS1 1;  4LLO A;  4YM0 A;  3ZFF A;  5LZ6 A;  1BKZ A;  1SZB A;  4Q5O A;  3HPN A;  2ZMK A;  3NRU A;  4O65 A;  3EXU A;  4OUM A;  2R1B A;  5FZH A;  3CL1 A;  4JRA A;  3T0D A;  4LOS A;  4GWM A;  5DMY A;  5IJR A;  4ES8 A;  4D7S A;  1XYO A;  3GM8 A;  3UKT A;  3IAQ A;  4URA A;  5FCC A;  4UBH A;  3CBN A;  2R30 A;  5DG1 A;  5J98 B;  2TEP A;  4XIL A;  4OHZ A;  3W59 A;  1MEC 1;  3GGL A;  4N9H A;  4E8D A;  1VB2 A;  4LBQ A;  3WW2 A;  2EAL A;  1PZ7 A;  3I3D A;  4D3W A;  3JBG 3;  1FMD 1;  4Y1X A;  3WUC A;  3ZYB A;  1YRZ A;  1V6O A;  1D4V B;  3Q8F A;  4PT6 A;  3BCW A;  5JZG A;  5JDB A;  3KGL A;  2VOW A;  2ZGM A;  1QKQ A;  2YGM A;  3K77 A;  2JDH A;  4QDS A;  5EHD A;  5T50 A;  1IGO A;  2BWA A;  1CJD A;  3LEI A;  4JTN A;  5LAS A;  4AFM A;  3BU0 A;  2CHH A;  1XSR A;  4Q4X 1;  3OGR A;  4IE5 A;  4LIT A;  3TN9 1;  1AF9 A;  3USU B;  4YFZ A;  5FY5 A;  2HWD 3;  3RGB A;  3PME A;  1UZ0 A;  4CDX B;  1VRB A;  2DCK A;  2Q5T A;  3H3U A;  3WSO A;  1W8T A;  2VY0 A;  2NP0 A;  5ACA 3;  2HEW F;  3KV9 A;  2WL1 A;  5C5T A;  3I3M A;  1ODM A;  4LNV A;  5I93 A;  3AKP A;  2BOJ A;  5L19 A;  4Q1P A;  4WM7 C;  3J8F 1;  4Y20 B;  1CAV B;  4KG0 A;  1W6M A;  3BPS A;  1AHS A;  3FBY A;  4IER A;  4BXS V;  4A7K A;  1QOT A;  2D3P A;  2WSU A;  1BLZ A;  2IXI A;  3C7H A;  4GA9 A;  3VDD A;  2WWU A;  1OUX A;  2GP5 A;  3MF6 A;  1SDD B;  4AFA A;  3SKJ E;  4WM8 C;  4NWW A;  1UF2 C;  3C7G A;  1H8T A;  2J1E A;  4PI2 A;  3ZXF A;  2EXI A;  4RFR B;  3QOP A;  1C3H A;  3NKT A;  4E4Z A;  3A0K A;  3GZE A;  3WDV A;  3WNO A;  3LWC A;  3ZFF B;  1KGY A;  2VUA A;  2XVL A;  4HON A;  4XAA A;  1XE8 A;  3SEP A;  1QNW A;  4LBN A;  3TOJ A;  3JB8 A;  1G6N A;  2WYF A;  1H30 A;  2WS9 2;  4MVT A;  4CPB A;  3TAY A;  5CFD C;  4CP9 A;  1LNS A;  1SDW A;  3FZ3 A;  1ULO A;  3MIH A;  3LEM A;  4NE9 A;  3VUO A;  2E31 A;  4MGS A;  1JHN A;  5IT6 A;  1AYM 1;  1SMV A;  3O7O A;  2ARE A;  5KXD A;  3CU7 A;  3WR0 A;  2GU9 A;  2CAU A;  1W28 A;  2WFP A;  2BGC A;  3V56 A;  4AQS A;  2B42 B;  4CDU C;  1NUK A;  4A7Z A;  1RUD 3;  1NA1 B;  1S0E A;  4HT1 T;  2AEZ A;  4LBQ D;  4N7I A;  5BV6 A;  3OPT A;  2XBO 1;  2VUD A;  3SEE A;  3LB9 A;  2JDA A;  2VO5 A;  4BOW A;  1ULG A;  1ULP A;  4G4F A;  1VBA 3;  2W87 A;  4QHZ A;  1X36 A;  1CAU A;  1OI6 A;  1RUI 1;  3ZXK A;  5ABJ C;  3DF0 A;  3UYJ A;  1PO2 3;  1RMU 1;  3CIH A;  3SH4 A;  1YFX A;  3IT8 A;  5J1X A;  1NCQ A;  4Q4V 1;  2NLR A;  2QQI A;  1W0N A;  5CFC A;  4AW7 A;  5IVB A;  1LEM A;  4K6B A;  5KHG A;  4Y24 A;  2UY8 A;  4Z8B A;  3VDB A;  4N53 A;  2X10 A;  1REF A;  5FYC A;  3JQX A;  4IV3 C;  1DQ0 A;  3RFR A;  4D6R A;  1RJ7 A;  1I9R A;  3PIG A;  4K8R B;  4QX2 A;  4ZS2 A;  1GQG A;  1IS6 A;  2QQV A;  1ZZ7 A;  1AYN 3;  2QTW B;  1J3R A;  3FLT A;  3P5B A;  5FP9 A;  1VJ2 A;  1JZ4 A;  3N7K A;  1W6M B;  1VP6 A;  4NRP A;  2BNM A;  4QPY A;  2ZML A;  2DVD A;  4XUT A;  3OG2 A;  3VDD B;  3JUU A;  2MEV 3;  3RMY A;  1O91 A;  1VBD 1;  4GIQ A;  3OTF A;  4UFI A;  3VBR B;  3Q9O A;  4BK5 A;  5JVV A;  1XU2 A;  2FD8 A;  3NAP C;  4GUL A;  3T2O A;  1PO1 2;  1VBB 2;  5FZB A;  2UY9 A;  3LQC A;  4JKL A;  2GDF A;  4JQT A;  1ZRF A;  2BFU L;  1CPM A;  1GKB A;  2Z4F A;  3I59 B;  4PIY A;  4AVS A;  2BZD A;  1OSG A;  4PCR A;  4DUW A;  3WP4 A;  4Q4Y 3;  3KS7 A;  1I1E A;  5KBF A;  4OHX A;  1OQD A;  2IUW A;  3NWK A;  1BCX A;  4KWJ A;  4O9G A;  2HWD 2;  1PK6 C;  4CP9 B;  4DO0 A;  4R9C A;  3RYR A;  4CPB D;  4N9I A;  4XCA A;  2JG8 A;  5K0U A;  3O1V A;  3MPP G;  3N7J A;  2XKP A;  1X7N A;  4BQW A;  4IEQ A;  3TEW A;  2WAO A;  1DQ4 A;  1GAN A;  4YG3 A;  2B7Y A;  4W6W A;  4AFC A;  5KHK A;  3ZVX A;  1UYY A;  2VTX J;  4NIA A;  1FI2 A;  4RSU A;  2XLF A;  3P6B A;  2WO7 A;  1LAJ A;  3HJR A;  1FPN 2;  4FPH A;  1AJK A;  4QPG C;  2OA2 A;  4LUM A;  2ARB A;  3UT0 A;  3MW2 A;  4ZXK A;  2PEL A;  2VEC A;  2BQP A;  1DDL A;  2YC0 A;  3VBS A;  3V0A A;  1WBF A;  4MV2 A;  2VZ3 A;  1MZF A;  3A23 A;  4FFI A;  4FVV A;  2R7E B;  5A70 A;  4UFM A;  3SKV A;  1NCQ B;  2IWG B;  1REE A;  4CEW A;  2VQU A;  5CFC B;  4W8J A;  4D8M A;  2VVD A;  2J1A A;  5FJH A;  2C24 A;  4QPI A;  4GXL A;  2VCM A;  1APN A;  4E2Q A;  3OBR A;  1OVS A;  5L73 A;  4A41 A;  3K48 A;  4M0H A;  2WYS A;  3AP5 A;  2E53 A;  2V73 A;  1WBL A;  2Y6L A;  3WUD A;  1AR6 3;  1JUI A;  3ACF A;  4UF0 B;  1POV 1;  3T0A A;  2OUJ A;  3DXT A;  3TRS B;  3BAL A;  1CQ9 A;  5BNQ A;  1TNF A;  3WQ0 A;  5FXV A;  3AL6 A;  1O3T A;  1TMF 3;  1K5M C;  2CWM A;  4HL0 A;  5KXE A;  3OSD A;  5C3S A;  3MI8 A;  2DF7 A;  2F17 A;  1E5R A;  2WNV C;  3HOB A;  4HK9 A;  1RUD 2;  5E8A A;  3H7J A;  3SC7 X;  3THD A;  4EJR A;  2W1U A;  3MV0 1;  3PHM A;  3D3A A;  4AQ6 A;  5L7O A;  4CYD A;  3B93 A;  3M8L A;  1J58 A;  5J37 A;  2XKO A;  1JBC A;  2ORZ A;  3OBT A;  1FNY A;  3VHO A;  5BNN A;  5GZF A;  1RUC 1;  1VBA 2;  3B9C A;  1ULE A;  2P34 A;  2G9F A;  2IFW A;  5DAB A;  3DV8 A;  1DZR A;  1QJU 3;  4MGT A;  1J1L A;  3ZKY A;  2P3I A;  1X8E A;  3ZM8 A;  3OY8 A;  2R04 3;  1DF0 A;  2ZTN A;  2VC9 A;  4UBG A;  2G9Z A;  1VBE 1;  3ST7 A;  4DEQ A;  4EN7 B;  5K0U B;  1MS1 A;  3MFA A;  1HXS 3;  1OH3 A;  1VE0 A;  4MXW A;  3S6P A;  1MQT B;  1KD7 A;  2A6V A;  3C7O A;  2I07 B;  4JV4 A;  2P5B A;  3DYP A;  3POW A;  4XBQ A;  1AR7 3;  2A5Z A;  2ARX A;  3AJY A;  3IDC B;  4N90 A;  5L9V A;  3RJ2 X;  4LOR A;  2NPI A;  5FFO C;  2GH8 A;  1ZBE 2;  2RJK A;  5FRA A;  1BK1 A;  4EZH A;  2O8Q A;  1EAH 2;  1W9W A;  2HWB 3;  2TBV A;  3VBS B;  1XQN A;  3A21 A;  1UKG A;  3WX5 A;  1HN1 A;  2VW0 A;  3T4H B;  3MLK A;  1G86 A;  3WV6 A;  4UWD A;  4UFL A;  1D4M 1;  2J7M A;  4CE8 A;  4FP3 A;  4CEW B;  3PMS A;  2J1V A;  2HEV F;  5FOB B;  1OXC A;  4QPI B;  5FQ0 A;  3ILF A;  4LKE A;  4C8D A;  2NMN A;  4Q4W 3;  4LUL A;  1OUS A;  1E5S A;  4EN8 B;  4D0Q A;  4CEY C;  4Q4Y 2;  5IK4 A;  2ZS6 B;  1MAC A;  3FHI B;  2JIG A;  5DUU A;  5EPA A;  5F6K A;  5FY8 A;  5FIX A;  3SIT A;  2LW8 A;  5FV3 A;  2CY6 A;  3SXW A;  4P9J A;  4GH4 C;  5LA1 A;  1UX6 A;  4PDW B;  2ZJC A;  3KQ4 B;  1BEV 2;  1JUH A;  4BQ3 A;  1SBF A;  5A3O A;  5IWF A;  5T54 A;  1IKP A;  3IM0 A;  2DCY A;  1MEC 3;  2NM1 A;  5CNA A;  1XC6 A;  5L7O B;  3VD4 A;  2DFC A;  1W05 A;  1SPP B;  5FPA A;  4PLN A;  3J26 N;  4BHP A;  1EPW A;  2GMM A;  3U07 A;  1SFN A;  5FZ3 A;  1Q5O A;  2DCJ A;  4P9W A;  3E6B A;  1Q8O A;  4BMB A;  1H1I A;  1ND2 A;  1RVF 2;  3FLR A;  2VCB A;  4A45 A;  2HYK A;  2I74 A;  2NN8 A;  2XJR A;  1W03 A;  1JYW A;  5AC9 3;  4Q4X 3;  1O4Z A;  5FAX A;  3ZYF A;  3DGT A;  3TN9 3;  1ZNP A;  1HRV 3;  2WNU B;  1RUJ 1;  2EF6 A;  1JOP A;  1NLS A;  4YG0 A;  3MIC A;  2UWA A;  1WLC A;  4LO6 B;  3I49 A;  3OJB A;  3EO6 A;  5DQ0 A;  2OPW A;  1CIY A;  3ZPY A;  3T1M A;  4MXW B;  2A71 A;  4RHV 1;  3N9O A;  5IFT A;  2YBS A;  3TYJ A;  5A1F A;  5FUN A;  3AKT A;  2TNF A;  4NRQ A;  1PM4 A;  4IUG A;  2OZJ A;  4HVR A;  4CCE A;  4Y4Y A;  4D69 A;  4PQQ A;  1Y9M A;  1AR6 2;  1H2N A;  3J8F 3;  3PUQ A;  4MHU A;  4KL1 A;  3EB7 A;  1C1F A;  1LOG A;  2P17 A;  2QQU A;  1L7L A;  3FHA A;  1AR8 1;  4BYY A;  1W39 A;  3TNP B;  3S5Q A;  4XET A;  4FAG A;  3ZXD A;  4AL9 A;  3WT3 A;  4IEV A;  3E1F 1;  1CGP A;  1ULD A;  3ECQ A;  3HNY M;  4C91 A;  5IAX A;  3POI A;  4LHS A;  3EHK A;  1YFW A;  2B46 X;  3QBQ A;  5FQ0 B;  3HD8 B;  1OF4 A;  3D4K A;  3LCP A;  1LOB A;  2JDP A;  5FZI A;  4Q8K A;  1W0O A;  1QJU 2;  4MX3 A;  3UES A;  4BLJ A;  2VG9 A;  2X5I A;  1KFX L;  2YYO A;  4QQP A;  3VBU C;  4KBB A;  1BBT 1;  4YFW A;  1POQ A;  2R04 2;  1CWP A;  4EQV A;  3PTR B;  1RED A;  2PA7 A;  2RV9 A;  3GAL A;  4LIU A;  5I0D A;  3GZA A;  4F3J A;  3ES1 A;  4UW3 A;  1HXS 2;  2GMP A;  2QBX A;  3DPR A;  4I02 A;  4YVS B;  1F9K A;  5GZE A;  3ZFG A;  2FDI A;  2DFB A;  3ZXG A;  3AX4 A;  4XDP A;  5C8W A;  5DUV A;  4NR1 A;  1AJO A;  2LRP A;  1S4C A;  4FSJ A;  2AR6 A;  5L9B A;  2XBO 3;  4YVW C;  2J1R A;  3R4S A;  5A6X A;  4YW2 A;  2VMH A;  1ZYB A;  4GZ9 A;  5IUQ A;  1XXN A;  5T5P A;  2PFW A;  4CUG A;  3VKN A;  3IDB B;  1W9T A;  1ZRC A;  2JD4 A;  3R4U A;  5C9A C;  4I2O A;  4IE0 A;  3ZFE A;  2WBK A;  2IC1 A;  4AGR A;  3B94 A;  5LK5 A;  3O1P A;  5J7M A;  3M3Q A;  1GP5 A;  1W90 A;  1QQP 1;  4LBO A;  3F95 A;  4Q4W 2;  2YBK A;  3RWN A;  1COV 3;  1Q56 A;  4D6Q A;  4COZ A;  2SBA A;  2OZ6 A;  4Y1Z A;  4RFT 0;  2W1S A;  1QF3 A;  3WLU A;  2D6K A;  3WG4 A;  5CAZ A;  3ZX7 A;  4IEY A;  3DXU A;  2WNE A;  1HW5 A;  1VMF A;  3HAG A;  2WWJ A;  2R1D A;  5FZ9 A;  1IS5 A;  4XIK A;  2AC1 A;  2LRO A;  4GD4 A;  1B35 B;  2AGS A;  4RR3 B;  3AP9 A;  4MOA A;  5CB7 A;  3RMX A;  1NY7 2;  2V72 A;  4K20 A;  1WCK A;  2BU9 A;  2WAB A;  3HWJ A;  5ERL A;  5FY1 A;  2NZ9 A;  1RUG 3;  1C1L A;  3J7H A;  2CV6 A;  3ZXL A;  3LA7 A;  3QCW A;  4DB5 A;  1C4R A;  2W1W A;  4HVO A;  4OFG A;  4PLO A;  4PJY A;  2O8O A;  5BNP A;  4B1M A;  4AVB A;  2YUE A;  3S5A A;  2X5I B;  5CG9 A;  2ZEZ A;  2PLV 1;  5AC9 2;  4N7U A;  3PUH A;  2YZ4 A;  2XL7 A;  3RZG A;  1HRV 2;  3RPQ A;  1K12 A;  1O4Y A;  1R09 1;  2DYC A;  4MUV A;  4UAP A;  4COV A;  1WLD A;  3DPR B;  4OUE A;  3ZFG B;  3ALQ A;  3UKN A;  4XJZ A;  5FXW A;  1AX2 A;  2RS5 1;  3LSD A;  1W6N B;  1SLC A;  1UZY A;  3OBA A;  1VAV A;  3ENR A;  3JCI A;  3MUY 1;  5KXB A;  4UW4 A;  3NO8 A;  4JGY C;  1ZBA 2;  4YLZ A;  3VKO A;  2KM2 A;  3KF5 A;  1IS3 A;  1DQ1 A;  4QB1 A;  3RS6 A;  4OQ8 A;  3VD5 A;  2CAV A;  1A8M A;  1O4T A;  3I3E A;  2P4E A;  5IVF A;  2Z79 A;  1WD4 A;  3LIG A;  4BM8 A;  5E89 A;  3J7L A;  3K75 B;  3GYD A;  3N9Q A;  1UW8 A;  2OT7 A;  4LO8 A;  4EE2 A;  1ODN A;  5IAV A;  2EID A;  4BQ2 A;  1O3S A;  1GV9 A;  1LOC A;  3ABZ A;  1NXM A;  5FJK A;  4BQX A;  4E9K A;  1QH7 A;  5IK8 A;  4ZY9 A;  4Y22 B;  1WW6 A;  4FFG A;  5J3U A;  1C8M 2;  3CLP A;  1AR9 2;  4V1P A;  5JZG C;  2ZGO A;  1POV 3;  4ERO A;  1VMJ A;  1JTZ X;  4FAH A;  5LCW L;  1MZE A;  3G6J B;  1OVP A;  1YQ5 A;  5J36 A;  4R9B A;  1DQ2 A;  1SFP A;  2AAC A;  4CDW A;  3FUO A;  2JDM A;  2RS3 1;  4QXB A;  3DEC A;  3K46 A;  5FXZ A;  3ZSJ A;  1RTV A;  1SLB A;  5JAX A;  3ZXE A;  2WO2 A;  2EIG A;  4LO5 B;  2Y38 A;  3WG1 A;  3SHR A;  2W08 A;  4XCB A;  1QOS A;  5F6L B;  3DL3 A;  5HPO A;  4XJ8 A;  4CCJ A;  4YW3 A;  2RJ2 A;  3WF3 A;  1NCR C;  4XDQ A;  1BVP 1;  1XYN A;  4XE9 A;  3OD0 A;  4D7Y A;  5BNP B;  2HWC 2;  3USS A;  1WW7 A;  4NIG A;  3G7D A;  1JYC A;  3TEY A;  2HLE A;  3BIW E;  1PVX A;  3J7M A;  2EAA A;  4QM8 A;  3ZKU A;  3OYW A;  4FTE A;  5JCT A;  2D6M A;  3JU9 A;  3K3O A;  1ZZ6 A;  4FXG B;  4AK3 A;  2Q1F A;  1H2L A;  1DGL A;  1R1A 1;  2IXJ A;  2RM2 2;  4KBZ A;  5FYY A;  2I45 A;  1VBC 3;  3OBZ A;  4PIX A;  1COV 2;  3O12 A;  1MR5 A;  5FK8 A;  4CCC A;  3MZH A;  3JQW A;  2VUL A;  3D5O A;  2QQO A;  1LOF A;  4NRM A;  3WDY A;  1H8T C;  4NPR A;  5GM0 A;  3ZMO A;  1KQR A;  1UQX A;  3LD8 A;  2W92 A;  2Q4S A;  4NMI A;  5FPX A;  3GF6 A;  2FDJ A;  4XUP A;  4CUC A;  4CUA A;  3GXU A;  3WF4 A;  1OQE A;  1AL2 1;  3UGG A;  4A6O A;  4C0B A;  2DVG A;  2V5D A;  2BGP A;  3O0V A;  4YGE A;  4ET7 A;  4CP0 A;  5CU1 A;  1W9S A;  3GJB A;  2OUH A;  4ES9 A;  1YQC A;  2VOV A;  2YXS A;  4FPY A;  3CO2 A;  2LAL A;  1PIV 3;  4IGQ A;  1I5P A;  4LKS A;  4S2D A;  1RUG 2;  4NHK A;  2PMW B;  3N9P A;  1OKQ A;  5C7G A;  4BDV B;  1XE7 A;  4JDN A;  1F31 A;  4I09 A;  2SLI A;  2CL2 A;  1N1V A;  2JDZ A;  2P1B A;  2Y6F A;  2ZHM A;  2ZEW A;  4XZU G;  3H9A A;  1Q43 A;  2OYZ A;  4J6G A;  3T3Y A;  2HWF 1;  1V0A A;  5DDJ 1;  3DUI A;  2HKX A;  4Y1V A;  2ZGP A;  2RHP A;  3I8T A;  4RS5 A;  1UNB A;  2YDE A;  4HPK A;  2CGP A;  5JXJ A;  2CNA A;  3W20 A;  1PVC 1;  4Y3O A;  2W1Q A;  2ZX4 A;  4JGZ A;  3VZO A;  1S0B A;  4AED A;  3ZSL A;  1F35 A;  2VMG A;  1W0P A;  3QH6 A;  5KR7 A;  5FYM A;  1YUD A;  5H9P A;  2X29 A;  4CDW B;  2PHR A;  5LBB A;  4K3U A;  4E2G A;  4LBK A;  4COW A;  1WGP A;  4P00 B;  5EXO A;  3T2P A;  5C4W C;  3AYA A;  3AYE A;  5LBC A;  4N53 C;  3VBO C;  4OLL A;  5JUV A;  1ASJ 3;  2ZGN A;  4LOT A;  5IVY A;  3NJZ A;  4RD7 A;  3SMH A;  3LE0 A;  2C0Z A;  1FAY A;  2B9V A;  3MF9 A;  3ZR6 A;  4LE3 A;  1SEF A;  3KT1 A;  2DCT A;  5JMO A;  3ZYH A;  3MIF A;  2EXJ A;  4KG8 A;  1CAX A;  1RUJ 3;  2Y0O A;  1MZ6 A;  4QWN A;  1JZ6 A;  5FYH A;  5FO8 B;  1GUI A;  2AZ5 A;  1DU3 D;  3QAC A;  4EYU A;  2VQA A;  4GKX A;  3ILN A;  4CDQ B;  4A2U A;  1ZRE A;  2VZR A;  4Q26 A;  1J3Q A;  5LA2 A;  1N3O A;  5JOX A;  4U2A A;  4JKK A;  4XTM A;  1W2O A;  4MZU A;  3TNQ A;  1QJX 2;  5D8A C;  5A3U A;  2WT2 A;  2WZR 1;  1JH5 A;  3CNA A;  4JCK A;  3CJI A;  3GHN A;  3T1L A;  3P3P A;  2VBD A;  2CYF A;  3WDU A;  2JG8 C;  3DN7 A;  2A73 B;  3VBH A;  1HRI 1;  4XF0 A;  5HV0 A;  4LHK A;  4LEJ A;  1PM7 A;  2HWE 1;  1HIX A;  2F6B A;  4PF5 A;  5F8P A;  1F15 A;  4LKD A;  1OFN A;  3KZ4 C;  1DQ5 A;  4Z92 B;  2Y26 A;  1GIC A;  2EAK A;  4IEU A;  4ZU7 A;  4RS5 B;  1BBT 3;  1EV1 1;  2OVU A;  4RQP B;  1S2E A;  2Y34 A;  4YW4 A;  3UET A;  1VBC 2;  5LBE A;  1XJA A;  4P9G A;  1HQN A;  3LZZ A;  4JGZ B;  4AED B;  4OHY A;  5B4N A;  1UY1 A;  5FKB A;  3O5S A;  4NWV A;  1NG0 A;  1W2U A;  2YPJ A;  4PIZ A;  2QJV A;  3QLQ A;  4FP2 A;  5JXG A;  2W39 A;  1VPH A;  1BXH A;  2XVG A;  3VBF B;  4HSL A;  1RUF 1;  5CBL A;  1Q8P A;  3A7Q A;  5T5J A;  1OA4 A;  3KGZ A;  1HB1 A;  4AI2 A;  1LHO A;  3U37 A;  2ZAH A;  1PIV 2;  3PJY A;  1BZW A;  4XAE A;  3RZZ A;  5IVC A;  3KD4 A;  3A22 A;  2ZAA A;  3K3N A;  2ZGQ A;  4XF4 A;  1CD3 G;  4S2H A;  1IPK A;  4UFH A;  1CAX B;  1MS3 A;  1NA1 A;  2W68 A;  4IE7 A;  4AFD A;  4BU2 A;  1A6C A;  5AVA A;  4DUV A;  3BIE A;  1QJY 1;  1QQP 3;  1W8W A;  2ORX A;  3R4D B;  4WBB A;  5I0S A;  1OOP A;  3FJS A;  4OQ9 A;  5G05 L;  1OBN A;  1D7P M;  5F37 A;  3E6D A;  4OCT A;  2D6P A;  2G9G A;  2WLP A;  2VNR A;  2VZO A;  3AXE A;  5A3W A;  4BZ4 A;  2VU9 A;  4FFF A;  5BNN C;  1N1Y A;  4I3G A;  1OC1 A;  2AUY A;  5BNO B;  3AVR A;  3WNX A;  1IS4 A;  1YYN A;  4FXK B;  4L9B A;  3ZOI A;  1A34 A;  1LGN A;  3I97 A;  4WZF A;  2ADE A;  3CJI B;  4LA2 A;  4QHO A;  1HX6 A;  1PX3 A;  4AI3 A;  3POG A;  3VD9 A;  1LOE A;  3PNA A;  1SLI A;  2PN5 A;  1MS9 A;  3AFG A;  3VBH B;  3APB A;  1FOD 1;  1DGR N;  1RUE 1;  2D6O X;  2WWS A;  2XJU A;  1ASJ 2;  2W94 A;  3PTY A;  3MO4 A;  1XRU A;  4EWD A;  2R32 A;  1KJR A;  4QMA A;  5FYS A;  1TME 1;  1XNK A;  1TVG A;  2A75 A;  2ZCW A;  2RMU 1;  3H7Y A;  3ORJ A;  5DXD A;  5GZD A;  3WDX A;  5JLV A;  2QKD A;  4FPJ A;  1JYT A;  1QEX A;  1LOD A;  4RGK A;  3VBR A;  4B4R A;  1OD3 A;  2JEM A;  1CPN A;  2R06 1;  4IQP A;  1R09 3;  5F3I A;  2JE8 A;  4XUQ A;  5I8Y A;  5F2W A;  1V6N A;  3WVJ A;  1XNA A;  3IBM A;  4MXV A;  4COY A;  4AGG A;  1MS0 A;  3I59 A;  4BWO A;  5HI0 A;  1EUT A;  5T3N A;  2XL9 A;  3IMM A;  5LK7 B;  1C5H A;  4FOW A;  1GWL A;  3JZV A;  2VVE A;  3HBZ A;  2VNO A;  5F3G A;  2YPD A;  1O8P A;  2GNB A;  4XFI A;  3M3I A;  3WHU A;  5JR7 B;  1RHI 1;  4FPK A;  2ADD A;  1HDK A;  1RUH 3;  2IXH A;  4IGP A;  3NV2 A;  5FZA A;  1RC6 A;  2VCC A;  2EXH A;  4YYO A;  2HBU A;  1DHK B;  3OB8 A;  2DU0 A;  1HV0 A;  4K21 A;  4CRQ A;  3U14 A;  3GZU C;  2BVV A;  1OOP B;  1XSQ A;  2GZW A;  3LEG A;  1XB9 A;  5HXM A;  4MGK E;  1R08 3;  3CMG A;  4UW5 A;  4AI0 A;  4A3Z A;  1Z0H A;  1JYX A;  4TN7 A;  3THP A;  2E63 A;  4K9S A;  4SLI A;  1ND2 C;  2OPK A;  3AMQ A;  3FX3 A;  3SLI A;  2A6Y A;  1VLN A;  5FLH A;  1UOJ A;  4DY5 A;  4NPL A;  2RR1 1;  1PGS A;  3AYD A;  5CVR A;  1LRH A;  2OII A;  3ZSE A;  5IFP A;  3I3B A;  1OT5 A;  2JG9 A;  2RS3 3;  5IVE A;  4TTG A;  2J1S A;  1ZRR A;  2GC3 A;  5A33 A;  4YZ3 A;  3SCH A;  4GB3 1;  3GBW A;  1GNY A;  2QCS B;  4P9L A;  4UF0 A;  2O0O A;  5CKN A;  5FY9 A;  5I0U A;  4NPM A;  3AZZ A;  3DKQ A;  2XJQ A;  2QFE A;  2O1Q A;  3FL7 A;  4AI9 A;  1HQL A;  3AMP A;  5LBF A;  4I0A A;  5E1R A;  1SLL A;  2WFF 3;  2ZHL A;  3EBR A;  4IW3 A;  3ILR A;  1JZ3 A;  4JDO A;  1ND3 C;  3JBG 2;  3HQX A;  2JDU A;  3B01 A;  5KC5 A;  1X9P A;  1W8Z A;  2VTF A;  4XFH A;  1T2X A;  3LSE A;  2YHJ A;  3FE5 A;  1GNH A;  4GAZ A;  2X05 A;  3BI3 A;  3SH5 A;  1LGB A;  1UU6 A;  5FP8 A;  4XDO A;  4A42 A;  1YO8 A;  2ZBJ A;  4BXF A;  2GN7 A;  3LFI A;  4JVA A;  4ZHN A;  2WQ8 A;  1PMH X;  2PHU A;  2BNO A;  2XOM A;  2MPF A;  1I3H A;  2ZA9 A;  2OQ7 A;  4HLT A;  5ACA 2;  1MQT A;  4FT8 A;  4YZ2 A;  4ZU5 A;  5DAP A;  1UOG A;  2ZGT A;  5JMC A;  1VB4 A;  5ANN A;  3KT4 A;  4A3X A;  1HB4 A;  1SBD A;  2QDR A;  4FTS A;  5JSP A;  3M3E A;  3AMN A;  3SH3 A;  3N9M A;  2HWF 3;  5JSO A;  1Z7S 1;  5DDJ 3;  1IZ3 A;  1RJ8 A;  4YNI A;  4I0B A;  4CU7 A;  2RDR A;  1VRH 1;  4Z07 A;  2WIN B;  1S55 A;  2WNO A;  2VJX A;  3ACH A;  5JIA A;  1AUY A;  4FPO B;  1ZRD A;  4BE3 A;  1PVC 3;  3B69 A;  1SLT A;  4XEZ A;  1RL3 A;  1X9T A;  2R07 1;  4CUB A;  5C3O A;  3WF1 A;  1T6G C;  4YM3 A;  1R64 A;  1UOF A;  4FPL A;  5HCA A;  4KU7 A;  5EJ1 B;  3NNG A;  1LOA A;  3OGV A;  3ZFE C;  2JG9 B;  3NJX A;  4GQ7 A;  3R6S A;  1V9U 3;  4AE2 A;  5IAT A;  2JWP A;  2BV4 A;  3JB4 C;  5A33 B;  2DTY A;  3IKW A;  3S57 A;  4XXA A;  3PDQ A;  3AZY A;  1RUH 2;  1LR5 A;  4LKF A;  2QQN A;  4PDW A;  1F5J A;  4XUN A;  1WCS A;  5CAD A;  4UFJ A;  1LHN A;  1VAM A;  3H1M A;  3LIH A;  1M06 G;  2Y6K A;  4ISR A;  3ZDS A;  3PU3 A;  1KRI A;  5FYU A;  3O0X A;  2Y33 A;  2AH2 A;  3KCY A;  4MYE A;  3WQB A;  2W3J A;  2JJ6 A;  4AGV A;  4CP2 A;  1SPP A;  4IV1 C;  1H0B A;  2MHF A;  5HXV A;  4TLF A;  1R08 2;  3RSJ A;  2VOK A;  5C3R A;  1F4A A;  2DUR A;  3AKS A;  2HH9 A;  2WN2 A;  4A4A A;  1PO2 2;  3BTA A;  1JI6 A;  1UAI A;  2B4K A;  2BJS A;  2ZGU A;  4QU1 A;  5CG8 A;  1V6K A;  1YIP A;  1CN1 A;  2XLG A;  4XJA A;  4N43 C;  1EY2 A;  2VQ0 A;  2WNU A;  3LOI A;  5JI7 A;  2H0V A;  3SCF A;  3ZSM A;  4B7K A;  5LEK A;  1BMV 2;  3VZK A;  2ZX3 A;  3LAG A;  2CU5 A;  1IPS A;  2Y8K A;  3ZN6 A;  1KFU L;  4Y5Z 0;  2VZ1 A;  2VZU A;  4KQ7 A;  1AYN 2;  3NV4 A;  1DGW X;  5C8C C;  5L36 A;  1AX0 A;  5J09 A;  1Q8S A;  5A3T A;  2HWE 3;  5BUV A;  1YQ2 A;  5A7N A;  4WVM A;  1U0A A;  4XTP A;  2FHR A;  4CCD A;  4Q0U A;  2DVB A;  4LMF A;  2GC0 A;  3LF7 A;  2MEV 2;  3NJY A;  2F4L A;  2XUE A;  2WUH A;  1G9C A;  1GOG A;  2W0X A;  2WFF 2;  2I2S A;  1PGW 2;  2YB7 A;  1CX1 A;  4F7Z A;  2W2I A;  3D82 A;  3DYM A;  3NJV A;  2YFU A;  5I8S A;  4WM7 A;  1JW6 A;  3THC A;  1PGL 2;  2WA3 A;  1L7R A;  1I6X A;  2RS1 3;  3JD7 1;  1PMJ X;  1W8H A;  4QGM A;  1OFS A;  2BYV E;  2E7T A;  3FFZ A;  4JRL A;  4DXZ A;  4QXC A;  2IXK A;  1UO9 A;  2WT1 A;  2F4P A;  4HXC A;  4BH9 A;  5E16 A;  5EJZ B;  1RUF 3;  5T52 A;  1DGW A;  1OLQ A;  2X8K A;  4ZON A;  5J96 B;  2FMY A;  4YGB A;  4ASM B;  4WM8 A;  2DUO A;  2J1U A;  4NO4 A;  2FBE A;  2VZP A;  2ZOE B;  1MS8 A;  4YVS A;  3L2H A;  4GWJ A;  5KHI A;  2EA7 A;  4YZ5 A;  3BUC A;  5LRR A;  3WW4 A;  1BYH A;  1JYV A;  3H8X A;  2D3S A;  1FMD 3;  5FY4 A;  1J1T A;  5A7W A;  5A80 A;  1UCX A;  3C3V A;  4WZC A;  2N7G A;  2PHX A;  1V00 A;  2D44 A;  3PUI A;  2OXB A;  1G9A A;  3FN9 A;  3LFM A;  3WNL A;  2PHL A;  3H1W A;  4FOV A;  2ZKN A;  4YW5 A;  4W4Z A;  1UU5 A;  2XDV A;  5CIR A;  1FX5 A;  4FPF A;  5JI9 A;  5FBZ A;  4YZ4 A;  1BQP A;  4CDU A;  3I7D A;  3OOX A;  3K4Z A;  3AXD A;  5FYZ A;  1YQ6 A;  3ZPO A;  1IQD C;  2XON A;  3ZN6 B;  1KS4 A;  1V9U 2;  3NV1 A;  1G9B A;  2YFZ A;  3URF A;  1F5F A;  3RYP A;  4ZXE A;  4FQZ A;  5ABJ A;  3HMY A;  4CCK A;  3R05 A;  1RUE 3;  3NV3 A;  5D2A A;  4JHZ A;  4AG4 A;  1VMH A;  2JD9 A;  3HQR A;  4BQ5 A;  1XND A;  4DXS A;  1G7Y A;  1WMF A;  5FO9 B;  1B35 A;  5AFB A;  1OH4 A;  4WVM B;  2EXK A;  3FMG A;  4RR3 A;  5ANQ A;  4DY3 A;  1XYP A;  1TMF 2;  1UIJ A;  3LEK A;  2NMO A;  1CZS A;  3FBM A;  4OYU A;  4UFK A;  2R06 3;  4IV3 A;  4NHY A;  5CA6 A;  5DN2 A;  4ONU A;  4KMQ A;  2P37 A;  1OF3 A;  4MGZ E;  1JZ7 A;  1IPJ A;  3UNP A;  2ZZQ A;  4QXK A;  4WM7 B;  5H9R A;  3PUA A;  2ETE A;  3RZM A;  1ONA A;  4UXA A;  4MGY E;  4CCL A;  2D98 A;  2XG3 A;  3ACL A;  4DUX A;  4QKD A;  4DIQ A;  2WS9 1;  3BTX A;  2O14 A;  4WM8 B;  2FCU A;  4HSJ A;  1N3Q A;  4MAD A;  1QIQ A;  1RHI 3;  3NAP A;  5A7Q A;  1SQ4 A;  4M01 A;  1GMM A;  1AYM 3;  4TYS A;  3TWI A;  1Y4W A;  2E9Q A;  1XOY A;  2Q1M A;  2QNK A;  3VZN A;  1O8S A;  4EZ4 A;  1W6N A;  1RB8 G;  1MVQ A;  1VIW B;  2BDR A;  2OQ6 A;  3AP4 A;  5FPZ A;  5IHR A;  2K9Z A;  4FQ4 A;  1AR7 2;  3B00 A;  3U75 A;  4ASL A;  5A7W B;  3J7N A;  3WZ1 A;  1P8J A;  5F9T A;  3HT1 A;  1QJE A;  5CFD B;  5APA A;  1PK6 A;  4AEM A;  1UZV A;  3GZT B;  1WMX A;  1NZC A;  2HWB 2;  1SCS A;  1RUI 3;  4HBN A;  5FZC A;  1ULC A;  3U10 A;  1RMU 3;  1WA6 X;  2JIJ A;  2FQP A;  1CZV A;  1ZRI A;  1O5U A;  4Q4V 3;  4AVA A;  2VZT A;  4H14 A;  4LO4 B;  3MLJ A;  3POE A;  4NHL A;  1NT0 A;  5GLW A;  4CDU B;  3RZK A;  1YIF A;  1DYK A;  3PVO A;  1YFU A;  2RS1 2;  2BGO A;  4UYB A;  1TQ5 A;  1PZ8 A;  4M4P A;  5HCF A;  2P6H A;  2D5H A;  4QQH A;  2WDB A;  4QPG A;  4BME A;  4Y22 A;  2ZHK A;  2OKX A;  5ABJ B;  4GB3 3;  5EFU A;  4IES A;  5I0T A;  3GCW A;  4QB2 A;  3POF A;  5FZD A;  5FY7 A;  3ZIX A;  1W9Y A;  1AXY A;  1MZ5 A;  1VBD 3;  1DYO A;  1MEC 2;  4IV3 B;  5CEH A;  4CDX C;  5EV7 A;  1DQ6 A;  1FMD 2;  1PO1 1;  1VBB 1;  2X53 S;  5JSR A;  2VQT A;  2DBI A;  3LPG A;  4QU2 A;  4CXW A;  1T6B X;  1QJZ A;  1CX4 A;  2D6N A;  4TSV A;  4CCN A;  3SQO A;  2KD7 A;  1K5M A;  5C70 A;  4Q4X 2;  3FHQ A;  3N36 A;  4QGN A;  3TN9 2;  2VTX A;  3SNM A;  2HWD 1;  2FZ2 A;  1K5J A;  5FMO S;  3NAP B;  1XU1 A;  4ZS3 A;  1EP0 A;  3R0R A;  4M3C E;  5K4L A;  4DNY A;  5LRS A;  3LDR A;  4OI0 A;  5FZ0 A;  3WD5 A;  4JZR A;  1HV1 A;  3PVE A;  4LE4 A;  4ATE A;  3PUR A;  4QKN A;  5JPN B;  5K7P A;  3IIA A;  4WVZ A;  3T2Q A;  3WNN A;  4Z82 A;  3J8F 2;  1GZT A;  3AP7 A;  4HK8 A;  3ZFF C;  4FFH A;  1VR3 A;  2IVJ A;  2BVB A;  1UMI A;  2Z42 A;  2BW8 A;  1FPN 1;  1PK6 B;  4YRD A;  3IWZ A;  3WNP A;  3RDI A;  1H1A A;  3HIF A;  1UYX A;  2D93 A;  1N1S A;  4E4H A;  2KXL A;  4P5H A;  3GBF A;  2GSY A;  1QXP A;  2J22 A;  5FZ4 A;  4A6S A;  2ZGS A;  1GU3 A;  3AKQ A;  4XC9 A;  3CEW A;  1F8V A;  4P08 A;  5T55 A;  1NA1 C;  3III A;  1EPZ A;  2PQS A;  5T5L A;  2BEO A;  4QPG B;  3ZO0 B;  3WW1 A;  2QQW A;  3MIG A;  4W50 A;  5FY0 A;  2ZPX A;  1O7F A;  3UKV A;  4CP1 A;  3Q8B A;  1LUL A;  4AI1 A;  4C1X A;  1OUR A;  3DEM A;  3POS A;  5D21 A;  1AYM 2;  1JYN A;  2OX0 A;  1DGR A;  4OI4 A;  2UUR A;  2ILM A;  4CU8 A;  5SV8 A;  4OVE A;  5G04 L;  2VMF A;  5DZE A;  2WZ8 A;  3KB5 A;  1RUD 1;  1LB2 A;  5DAW A;  2QQP A;  1W99 A;  2IFR A;  2QUO A;  2XBO 2;  1QH6 A;  2VPV A;  1E5H A;  4UT5 A;  5FP7 A;  3CQO A;  1RUC 3;  1VBA 1;  1K3I A;  4P5Y A;  2VR4 A;  4DIN B;  5LA0 A;  1RUI 2;  2E32 A;  3AYC A;  1NQJ A;  3RYK A;  1RMU 2;  2PAM A;  1M4W A;  1MVE A;  4H7L A;  4CU9 A;  1K5M B;  1RGS A;  3CF6 E;  4Q4V 2;  1OLR A;  2WNV B;  3AL5 A;  2FMD A;  3FUQ A;  3VDD C;  1VBE 3;  3HEI A;  4QX1 A;  5E88 A;  3VBR C;  4NRO A;  1L7Q A;  1V6M A;  2NYY A;  5DZG A;  3KV6 A;  4CDQ A;  4XMI A;  1NLQ A;  3ON7 A;  4XIO A;  4B7E A;  3OPZ A;  2QVS B;  2ZEY A;  3JXS A;  4G9S B;  4MSV A;  1TNR A;  1NAE A;  1HB3 A;  1S1A A;  2VBP A;  4H2A A;  5FZG A;  1H4H A;  5FZE A;  3IPV A;  3KQR A;  3E5Q A;  1NKG A;  1ZBE 1;  2XH6 A;  1R1Z A;  1VBD 2;  1FXZ A;  4ISQ A;  4EWA A;  2D43 A;  1EAH 1;  2K46 A;  4YWA A;  2LTN A;  2V4V A;  2VZV A;  2Q8D A;  1YEW A;  2XJS A;  3I2K A;  4XMA A;  4QDQ A;  1PNG A;  4HN0 A;  1D4M 3;  5FP4 A;  3J9S A;  2VVF A;  2VUC A;  4LBL A;  4YZ1 A;  4KNC A;  3M4F A;  5HCB A;  1H2K A;  4DOU A;  1SLA A;  2CDO A;  1H6Y A;  3VV1 A;  2XJT A;  2WSV A;  4KI5 M;  2ZZJ A;  4NII A;  1LTE A;  4QX8 A;  2BNN A;  4PHZ A;  2D7F A;  1GQH A;  4I0W B;  4M3C A;  4Q4Y 1;  5FUI A;  3VLB B;  2YC2 A;  3KF3 A;  4RQP A;  3C7F A;  4GMP 0;  4LIV A;  1STM A;  3O1M A;  1A3K A;  1VAL A;  4JDM A;  4LBM A;  1YXW A;  4UI9 L;  1O3R A;  2E7Q A;  3ES4 A;  4LA3 A;  3KV4 A;  3BOP A;  5F32 A;  3N7L A;  2JDY A;  1BEV 1;  2AEN A;  1WCD J;  3I4I A;  3ME2 A;  3OCP A;  1NCQ C;  1W8F A;  2BWC A;  2K0G A;  5CFC C;  2JKX A;  3VBF A;  2XB6 C;  3FLP A;  4P02 B;  4CEY B;  5LA9 A;  5A3N A;  5C5U A;  5DPN A;  3VBU A;  4HVQ A;  2E7A A;  3N7M A;  4XOG A;  1GOH A;  4YGD A;  2ERF A;  3AVS A;  5C6C A;  4P14 A;  1UY3 A;  5FPV A;  4R8H A;  2ZMN A;  4M00 A;  4X8N A;  3ACG A;  1RVF 1;  5F3E A;  5C3Q A;  2PHF A;  4AAP A;  2VZS A;  3TB0 A;  4GH4 B;  2V09 A;  1FV2 A;  1WZX A;  2Q1Z B;  4HN1 A;  3WF0 A;  3H8O A;  4WVV A;  2PQQ A;  4QKB A;  2XJV A;  2CGN A;  1WME A;  4NN0 A;  5FZL A;  5JR2 A;  3BOW A;  2VMD A;  4YM2 A;  4DMI A;  4BLI A;  2VE1 A;  4N8M A;  4QX7 A;  5FZK A;  3WQ7 A;  5A6Q A;  5FZF A;  1QMJ A;  1IHM A;  1UPS A;  3IMN A;  4YVW A;  1US2 A;  4C90 A;  3OUI A;  4QGL A;  4RHV 3;  4XAB A;  1IOA A;  4FPC A;  5A3M A;  3N4M A;  1CON A;  4W6X A;  3OEB A;  3OUH A;  4Y26 A;  3B7M A;  1AR6 1;  2D6L X;  2GAL A;  3KM5 A;  1WD3 A;  2YU2 A;  4Q29 A;  5C9A A;  4KGG A;  4LXL A;  5BNO A;  5F5A A;  1IG0 A;  3D0S A;  3IPV B;  4ARX A;  1GSL A;  1AR8 3;  4IE6 A;  1XNC A;  5LW9 A;  4PI0 A;  4H3W A;  1LKN A;  2NQY A;  2YU1 A;  1G9F A;  1ST8 A;  1XE0 A;  1H8V A;  2BOI A;  2JDN A;  1IG3 A;  2VMI A;  5EP9 A;  5K0U C;  1WUV A;  2A1X A;  2A70 A;  3CZU A;  2ZGL A;  4NOT A;  3I2O A;  1MQT C;  3NVC A;  1RUC 2;  1E57 A;  4F8A A;  2PXJ A;  4LK7 A;  5HBA A;  4AWD A;  4BPZ A;  4ZZ8 A;  1QJU 1;  2VCA A;  5FPL A;  3UL2 A;  4M3C B;  4BQ4 A;  1H2M A;  2JDK A;  3U0Z A;  4FPE A;  2WO3 A;  4MLO A;  2R04 1;  4A7Y A;  1VAK A;  3P3N A;  4NUB A;  1LGC A;  1QNY A;  1VBE 2;  4LR4 A;  2GN3 A;  1HXS 1;  3OD4 A;  5FP3 A;  3VBS C;  3VD7 A;  1Y7B A;  1O59 A;  2VXR A;  2WT0 A;  5A7O A;  5F1R A;  1OMI A;  4C0H A;  3NW4 A;  4NJ4 A;  3WG2 A;  3M2M A;  1CAW A;  1RXF A;  3ASI A;  4I3P A;  4XFA A;  4CEW C;  3TEZ A;  1Y3T A;  4QPI C;  3INA A;  1ACC A;  1D0H A;  1AL0 G;  3ETQ A;  2A3W A;  4XQW A;  4ORF A;  1GWK A;  3VBU B;  3VHR A;  3WDW A;  4AEK A;  4DFS A;  3POB A;  3T30 A;  3HVD A;  2A3Y A;  3RI9 A;  1UOB A;  3NST A;  5FZO A;  2VOX A;  5GLU A;  4HAN A;  5IK5 A;  5AVP A;  5BY5 A;  4AZZ A;  1OPM A;  2XML A;  1D4M 2;  1C5I A;  4PDW C;  5F7U A;  1HKD A;  4B4Q A;  4LTA A;  1W2A X;  1K42 A;  3BN6 A;  4XYX A;  4Q4W 1;  4JGY A;  2JIC A;  4YVW B;  2DU1 A;  3KT7 A;  4QX5 A;  5L7O C;  2VW2 A;  2WJS A;  4O7X A;  4XAC A;  2PYT A;  2ZGR A;  1NXD 1;  3MBW A;  4DXR A;  2YGL A;  3M3C A;  5C9A B;  2CWS A;  4HKW A;  2VBB A;  3VHP A;  4Z2A A;  5HV4 A;  1L3J A;  3MGU A;  1UMH A;  3S0M A;  1W3X A;  2E51 A;  3DKW A;  3EJK A;  1NY7 1;  1X82 A;  3AM2 A;  2WR9 A;  4CA9 A;  1V6L A;  2WNU C;  2LM3 A;  3LKJ A;  5A3P A;  1PO1 3;  1VBB 3;  1U5Z A;  3OUJ A;  4R52 A;  4AVV A;  1S0D A;  4MHR A;  2DUP A;  3MID A;  4XPV A;  5IK7 A;  2VZQ A;  1OA2 A;  4U36 A;  2VNV A;  1GYK A;  4B4P A;  4D94 A;  4AFB A;  5FPU A;  1TZO A;  3N9N A;  4UW6 A;  2R0F A;  2D5F A;  1YFY A;  2BBA A;  3HR9 A;  4QPW A;  2XR4 A;  2CDP A;  2PLV 3;  3KLS A;  4FOY A;  4XW3 A;  3BU7 A;  5A7S A;  3FWE A;  3TEX A;  3VHN A;  5AC9 1;  3FC0 A;  4K1Y A;  1HRV 1;  1MS5 A;  1HQW A;  1RUJ 2;  1UMZ A;  4IEP A;  4Z1V A;  5LWB A;  2VAU A;  1FV3 A;  3OGS A;  4Y33 A;  1GZW B;  4A44 A;  1S0F A;  5DZF A;  5FMC A;  4RHV 2;  3NNF A;  3RNS A;  1OHF A;  3T2T A;  4COU A;  3DCQ A;  3WHT A;  2ZAC A;  2RS5 3;  1NCR A;  4NID A;  2R6Q A;  1CAW B;  3Q8E A;  2XHN A;  4AVC A;  3IDE A;  4XBL A;  1YI7 A;  2WAA A;  5K8S A;  3KV5 A;  4J1W A;  2JXA A;  2YRO A;  4YM1 A;  1X50 A;  3VGI A;  1ZBA 1;  3WDT A;  4QT6 A;  3ZLI A;  2Y6J A;  4C1W A;  4XHB A;  1FPN 3;  2BTV C;  1AR8 2;  5H9S A;  4XJW A;  2K2S A;  5FZO B;  3AC0 A;  4EN0 A;  1D2S A;  2LS6 A;  2P3Y A;  4ZU4 A;  4E2S A;  2E26 A;  3LA2 A;  4YVS C;  4MGI E;  3PU8 A;  1PMI A;  4XVH A;  3VKM A;  3MLL A;  4IEZ A;  2WKK A;  4TZD A;  1JN2 P;  5LAT A;  4Q0Q A;  2GNT A;  4JGY B;  1ENR A;  2W5F A;  4BK4 A;  4L8Q A;  3IB3 A;  4LLF A;  4IEW A;  4DPN A;  3UGF A;  2C4X A;  1BBT 2;  3O14 A;  2KA3 A;  4QM9 A;  2HBT A;  4XFB A;  1C8M 1;  1BK0 A;  1AR9 1;  3K4A A;  2XUM A;  2WZP P;  4CCM A;  3AJZ A;  4OZO A;  3KHC A;  1IQA A;  1DFQ A;  5KWR A;  4K40 A;  1V6J A;  3ACI A;  5F5Q A;  3TBD A;  2J42 A;  4L2N A;  2OS2 A;  3X29 B;  3OGJ A;  4LBQ B;  5I91 A;  2DUQ A;  3IN9 A;  4GMP 1;  5FYV A;  2Z69 A;  4ARY A;  3UV9 A;  5FO7 B;  4DEV A;  5JPM B;  4E27 A;  1KEX A;  3MHZ A;  5JZG B;  1BJQ A;  2YC4 A;  1NE4 A;  4UOJ A;  5FBJ A;  4QQL A;  4W65 A;  1U5Y A;  2HWC 1;  3L2Y A;  5I8T A;  2VD7 A;  2ZX0 A;  2Z5W A;  1B35 C;  4RN5 A;  2C5D A;  2Q8O A;  1ALY A;  1G9D A;  4RR3 C;  3M3O A;  4EV0 A;  1GZ9 A;  1K45 A;  1QQP 2;  1R1A 3;  2RM2 1;  5FZ7 A;  5C4W A;  5GLT A;  1J3P A;  3VN4 A;  2C26 A;  1COV 1;  3VBO A;  2UWB A;  4DXT A;  2A6W A;  1FT9 A;  1FYU A;  2W47 A;  4PQ9 A;  2ZXQ A;  4XUR A;  3O1O A;  1DZQ A;  1NCR B;  1YCI A;  2WA4 A;  3HT2 A;  3KWV A;  4AHW A;  4QKF A;  4IEO A;  1N3P A;  5J48 A;  4BB3 A;  4RGG A;  1KJL A;  1KDM A;  1HN0 A;  5EYY A;  4OMC A;  1AL2 3;  4Q27 A;  1S0G A;  4AHZ A;  2VH9 A;  2PHT A;  3UJQ A;  4BIS A;  3MV1 1;  4L11 A;  4S2F A;  4URT A;  2BER A;  2X5I C;  1ENS A;  1US3 A;  1ZBE 3;  2YY1 A;  4MET A;  1RIT A;  5A7P A;  1EAH 3;  1W6Q A;  4DRR A;  1RUG 1;  2G19 A;  1H9P A;  2YBP A;  3RWK X;  1UD1 A;  3RI8 A;  3U4X A;  1H8T B;  1RYY A;  4LHL A;  3WCR A;  3T08 A;  1S0J A;  3DPR C;  3ZFG C;  2QQJ A;  5KHJ A;  2CTV A;  2ET1 A;  5FYI A;  1NOV A;  1H6X A;  5D8A A;  5I0R A;  4YAR A;  1UN1 A;  4YSF A;  3KCC A;  2R49 A;  3AZX A;  1ZZ9 A;  4AAX A;  4AOC A;  2PLV 2;  3VKF C;  4E8C A;  1ZX5 A;  4AI8 A;  1LEC A;  3BTZ A;  1R09 2;  3OEA A;  4K8F A;  3WCS A;  5B4X A;  2UU8 A;  3UK9 A;  3ROU A;  3QD6 A;  1JOJ A;  3I2F A;  3ZN4 A;  4YG6 A;  1YQ8 A;  1W06 A;  1QU0 A;  2HJI A;  4AQ2 A;  4CU6 A;  4BJ0 A;  4NIH A;  2ET7 A;  1BEV 3;  3B9I A;  2RS5 2;  3H42 B;  1J83 A;  3GDB A;  2BUK A;  2JB4 A;  2D40 A;  4IDZ A;  1OA3 A;  1LU2 A;  1SG3 A;  1H9W A;  1D0G A;  5EWS A;  5FYB A;  4XUO A;  1YI9 A;  1QJF A;  2GP3 A;  5A6Z A;  2AYH A;  2Y0I A;  2YG0 A;  4GWI A;  1RVF 3;  3DYO A;  2EIE A;  1CAU B;  3ZYP A;  1BVV A;  3H8U A;  1XBF A;  3UJO A;  3PVB B;  4J25 A;  5EJ3 A;  5FUP A;  2Q8E A;  1SFY A;  2QZ3 A;  1XPW A;  4KWU A;  4MH0 E;  5EIY B;  5FMB A;  3D0J A;  2WLQ A;  1PX4 A;  1UIK A;  5SV5 A;  3MEP A;  3ELN A;  5C4W B;  1UXX X;  2PAE A;  4N53 B;  1QXR A;  2GH2 A;  3VBO B;  1BHG A;  4L97 A;  4ITC A;  5T5O A;  1JZ5 A;  3ZN5 A;  3VD3 A;  3D6E A;  4QB6 A;  2GNM A;  5JIU A;  2E33 A;  3T4V A;  1QJX 1;  4Q0V A;  5DAQ A;  5BNP C;  5F5C A;  1ENQ A;  2WZR 3;  4YW6 A;  2JE9 A;  3H3Z A;  4HKL A;  4BA6 A;  4AHX A;  2A6X A;  3HQU A;  1ZA4 A;  2IXC A;  1Y9Q A;  3I2J A;  5ISL A;  1JMU B;  2WII B;  3CZJ A;  5FMO L;  1W6Q B;  2RS3 2;  2JKB A;  4M3C F;  3N3H A;  3M7A A;  5FR3 A;  2C1F A;  1ENX A;  4XFG A;  5GLV A;  2RE9 A;  3VZJ A;  1HRI 3;  5FDB A;  2JEN A;  1WKY A;  2DVF A;  2EIB A;  2ZGK A;  1JOD A;  2A3X A;  3E97 A;  4IL7 A;  4TXW A;  5D8A B;  5A6Y A;  3P1I A;  1JU3 A;  4IE4 A;  5FK7 A;  5D1I A;  3POY A;  4BIF A;  1YJL A;  4V2V A;  1WLT A;  3W9A A;  1EV1 3;  1A8D A;  1UX7 A;  2CSG A;  1W6P A;  5A1A A;  1R1A 2;  1VBC 1;  2A7A A;  2JG8 B;  2AEY A;  3I54 A;  4O61 A;  4OMD A;  4AXO A;  3KVB A;  5CIS A;  3U4S A;  5TSW A;  2DBN A;  1KIT A;  1U12 A;  3AMM A;  2VM9 A;  4Q1R A;  4ATF A;  4K1Z A;  5FPB A;  2YV8 A;  2ARA A;  2DV9 A;  2H0B A;  3HN1 A;  3B02 A;  2TUN A;  1SHW B;  1AL2 2;  5FXX A;  4XF9 A;  3U1X A;  1OD5 A;  2FCV A;  1F2N A;  1U5I A;  4ZKT B;  1S2K A;  4LUK A;  2W95 A; 
#chains in the Genus database with same CATH homology
 1UOF A;  1W3X A;  1HJG A;  3ZKY A;  1GP4 A;  4BB3 A;  1W2O A;  1UZW A;  2IVJ A;  5C3Q A;  1GP6 A;  2VBD A;  2JB8 A;  2VAU A;  2VE1 A;  1W06 A;  1W2N A;  5C3R A;  2JB4 A;  3ZKU A;  2BJS A;  1DCS A;  2BRT A;  1QJF A;  1GP5 A;  1QIQ A;  1E5I A;  1IPS A;  1E5S A;  1W3V A;  1HJF A;  1E5H A;  1QJE A;  1HB1 A;  5APA A;  4XAE A;  2BU9 A;  1W04 A;  1ODM A;  1WA6 X;  1BK0 A;  1W05 A;  2Y6F A;  2WO7 A;  2IVI B;  1BLZ A;  1OBN A;  1UO9 A;  1RXF A;  1UNB A;  3ON7 A;  1W03 A;  1OC1 A;  1HB2 A;  1HB3 A;  2VBP A;  2VCM A;  3ZOI A;  1W9Y A;  1UOB A;  5C3P A;  1UOG A;  2CSG A;  1HB4 A;  2VBB A;  2DBI A;  1W2A X;  2DBN A;  1RXG A;  5C3S A;  2Y60 A;  1W28 A;  1E5R A;  4RGK A;  5C3O A;  3OOX A;  1ODN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...