5C3QA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and thymine (t)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
GSMEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3qA00
2VE1A 1W3XA 1E5RA 1W2AX 1UOBA 4XAEA 1ODNA 1RXFA 2Y6FA 1W2OA 1E5SA 1UO9A 5C3PA 1W04A 1E5HA 2DBIA 2DBNA 3OOXA 1QIQA 1QJFA 2VBPA 4RGKA 1UOFA 1W2NA 1E5IA 1W05A 4BB3A 1HB1A 1HJFA 1RXGA 1W06A 1W3VA 2JB4A 2IVIB 1OBNA 1GP5A 2VBBA 1DCSA 1HB4A 1W9YA 2VCMA 1ODMA 1HB3A 2IVJA 2BJSA 2BRTA 1OC1A 5C3OA 1W28A 2JB8A 5C3RA 1GP4A 1QJEA 1BK0A 3ZOIA 1BLZA 2VAUA 2WO7A 2Y60A 2BU9A 1HB2A 2VBDA 5C3SA 5C3QA 1UNBA 3ZKUA 1GP6A 1WA6X 3ON7A 2CSGA 1UOGA 3ZKYA 1IPSA 1W03A 5APAA 1UZWA 1HJGA
chains in the Genus database with same CATH superfamily
5A3PA 2IXKA 4OQ9A 5FYZA 4NHKA 2ZEWA 4XETA 5CZKA 2C5DA 2WAOA 4WM8C 2WR9A 3WNXA 4XABA 2PLV1 1AXYA 2VG9A 1SBEA 4KNCA 1I6XA 2AEYA 1GICA 3DUIA 4GMP0 2PELA 4LR4A 1FAYA 4AVAA 2QUOA 3UKVA 3KD4A 4ASLA 1QOSA 3CJXA 1D7PM 1ALYA 4CDXC 3I2IA 5FYYA 2XXZA 3CLPA 3ZFFA 3GZEA 4H55A 3C7FA 1RVF2 1KD7A 5CFCC 3C7EA 4HKWA 4WZCA 4R52A 4B7KA 4SBVA 3FUOA 3GZAA 1RB8G 3MICA 2VOKA 1CJPA 2XB6C 4NIIA 1E5HA 1A6CA 1UOJA 2GSYA 3EJKA 4XQWA 2DBIA 4CDWB 2ZGKA 4XJZA 5LK5A 4CEYC 4CXWA 4FPJA 4DY3A 3OPTA 4WM7A 4BOWA 2I07B 3M3CA 3E6CC 1G7YA 1R1ZA 5JZGC 5DAWA 4YVSA 1QJFA 1YHFA 3KCXA 3PNAA 1LB2A 2YUEA 1QF3A 3JUUA 1RC6A 1GNHA 3CF6E 2X29A 4BB3A 5TSWA 2Y33A 5A1AA 1RUF2 3M3IA 3U14A 3WG3A 1GWLA 3AVRA 1JXNA 2WZEA 4HETA 3THDA 5A3OA 1ZRCA 2NN8A 4MG2A 2K9ZA 2JD4A 5ISLA 4V2WA 3VBHC 3IDAA 1JYNA 3CIHA 3VD4A 4YM0A 4KWUA 1BBT3 3RMXA 2GN3A 2TNFA 4H2AA 2OUHA 1BKZA 3GBWA 2VCMA 5FYVA 1L3JA 1WBFA 2VXRA 4I2OA 4FAHA 3R0RA 2AREA 3NJYA 1RVF1 3PU3A 4MGQA 3ME2A 2XUEA 3FZ3A 3S5AA 3KT1A 1ULDA 3I8TA 1SDDB 2PHXA 3POSA 4N90A 1YFWA 1FPN2 4BQXA 4PJYA 3MLLA 4N8MA 4LKDA 1JTZX 4W4ZA 5IVBA 2XWBB 1W6MA 2XMLA 1GWKA 3I3BA 3IKWA 1TQ5A 1VRBA 2ERFA 2V4VA 1O3QA 3MW4A 2W1UA 1CIWA 4RQPB 1DLLA 2PQQA 1KJLA 3TWIA 5LA1A 4XILA 3DKWA 3LEMA 5DUXA 2ZMKA 1RUF1 3W21A 2JKXA 2OKXA 3OGVA 3FE5A 1O3RA 3HQRA 5JPNB 3N9QA 4K3UA 2BU9A 4MHUA 1GFF2 1MVQA 5HV4A 4EQVA 1LR5A 2ARBA 3MPPG 2ZX0A 5FKBA 1DG6A 1Q43A 4UYBA 3HOBA 4AW7A 4XC9A 2BERA 2WO1A 2FHRA 3QOPA 3PDQA 3QCWA 1JS9A 2HWC3 1W6MB 4COWA 2FBEA 5FZHA 3R6SA 5L73A 5KHHA 5GZEA 1K5JA 1SHWB 4GH4B 4Y3OA 2WYSA 3K48A 3POWA 4YVWB 4PIZA 1C3HA 3O0XA 3PVNA 1DGRA 2GU9A 2JE9A 4HKOA 4CUBA 3OJBA 3H8OA 2RE9A 3DYPA 4TN7A 2VR4A 4LMFA 4BQ2A 3RI9A 3TYJA 4H7LA 1H8TA 2VQAA 3AYCA 4P5HA 3T09A 4WVVA 1QEXA 1WMFA 3ACGA 4Y26A 3USUB 4UXAA 1WMXA 5BNNB 1RUD2 1JHJA 1VRH3 2ZTNA 4P9LA 1KGYA 2IXLA 2JKBA 3PUIA 1JZ3A 2XKOA 3PLQA 2OW4A 3ZMOA 2TBVA 4CEWB 2ZX1A 2CWMA 4PQQA 4KQ7A 4E4DX 1D4M2 3BGAA 5H9SA 1ACCA 1F8VA 1AL0G 2HWE3 4C91A 5FXZA 2JE7A 2XR4A 1YQ8A 3I59B 2QDNA 4CCKA 3WF3A 1WGPA 4QPYA 4WVMB 4B3NA 2BYVE 1C57A 5FOBB 3O1MA 1V6MA 4YGCA 3R4SA 3WQ1A 4Y1VA 2DUQA 3IPVB 4XDOA 1C5IA 4QQLA 4QX7A 3VGIA 1W2NA 4DXSA 5JR2A 4HONA 1PNGA 3T08A 2W3JA 1XE8A 2RVAA 4ES9A 2RM23 3K2OA 4UI9L 1K3IA 1PVC3 4NHLA 3O12A 4XTMA 3C2UA 2VZVA 1AX1A 2HLEA 3T0AA 2RHPA 2VVFA 2YBSA 5SV8A 3HNMA 1RUD1 2WC2A 3I2JA 4M3CB 4AHXA 4NIDA 3DV8A 4QB1A 5A7NA 2G1MA 2GAUA 5F39A 5EP9A 5E89A 1KDMA 1UKGA 1D4M1 3AFGA 4LBKA 2ZXQA 4LUKA 4A7ZA 4UW4A 3K3NA 2H0BA 1CPMA 2IWGB 3KV5A 2PAEA 2JG9B 3FHAA 3PIJA 4Q5OA 1IG3A 2FDFA 3TEYA 4N53C 1P8JA 5FZOB 4GWMA 1OSGA 3SMHA 3T0DA 2OT7A 2D98A 2BUKA 2JEMA 2QCSB 2UY8A 1RUG2 2JDYA 2V5DA 4PLOA 5FY5A 3GZTB 4EN9B 1PO11 1ZBE2 2WQ8A 1AJOA 3WHUA 4OCTA 3ZYHA 3VBOB 3VHNA 2VNVA 3GBFA 5IFTA 1NA1C 1SLCA 2JJ6A 4OI1A 3ZOIA 5JMOA 2VAUA 4M3CE 1DGLA 1JH5A 1GOHA 1MQTC 1VBD3 3DL3A 5F32A 4DFSA 3RZJA 5ANQA 4AHWA 3H8UA 2LW8A 4HN0A 4IW3A 5CEHA 4LHKA 4E8DA 3POEA 4UFLA 1JW6A 1QJY2 2YC2A 2YMZA 3AVSA 4FFHA 4LLOA 5CFDA 1LEMA 3N9NA 3AFKA 3DXTA 5LEJA 2LALA 1ND2C 4MH0E 4E8CA 1QU0A 1CZTA 4HT1T 4IEPA 4XIKA 4XHXA 3WQ0A 3ROUA 1O3TA 3VZMA 4Q4Y2 2PN5A 5ABJC 3JB4C 5FY4A 2QQWA 3RZLA 1GQHA 1OI6A 5LEKA 3TNPB 1SLLA 1BZWA 1UZWA 5FV3A 2XOMA 1MS5A 3JQWA 3ES1A 2XONA 4WM8B 4JHZA 1FNYA 1W6OB 1R083 1RUG1 3UNPA 2R063 3AXDA 4N9HA 1ZX5A 3NO8A 3L2HA 3JD72 1H1AA 1EV12 4R8HA 3WP5A 3ZVXA 4FPHA 1JU4A 5KHGA 3BIEA 3VBRC 1KFUL 2ATFA 4GD4A 3ZXDA 3MIGA 4XAEA 5EPAA 3JU9A 4OUMA 1B35A 4Y20A 4O9EA 1RXFA 2PHFA 5DXDA 2OZJA 3GCWA 4LOSA 1QJY1 5C3PA 3UT0A 5DZGA 1R092 2CU5A 1J3PA 1H9PA 4QU1A 4HVQA 1NCRA 4YG0A 4CEYB 1GZTA 1JMUB 1W04A 1FATA 1AXZA 1O8SA 2W47A 1KJRA 4FPOB 2CAUA 4Q4Y1 2DYCA 5FUIA 2VQTA 4D7YA 5FO7B 4BH9A 3VLBB 3K75B 2NMNA 1SQ4A 1V9U3 5E1RA 1UL9A 5I0DA 2DCKA 1S0CA 5CNAA 1RUH3 2X09A 2HWB3 2BWAA 3N7JA 2YU2A 1IHMA 1B35B 4FQ4A 3VBUC 3LA7A 2DF7A 3O0VA 1UXZA 2G9FA 1FI2A 3OCPA 1UD1A 1EV11 4FSJA 4YFWA 3B5LB 4AEDA 4FFGA 1W8ZA 3N7LA 1RMU2 1DCSA 4J25A 4Q1RA 3D8CA 2GH2A 4IEUA 2ZGLA 4QPGA 2R073 5L7OC 1ENXA 1YC61 5FZ7A 5KC5A 3JBG3 2JIJA 1I9RA 3CEWA 3ZXKA 1R091 4IEYA 3FLPA 2JDAA 4YW7A 4ZY9A 2W87A 3NJXA 4I02A 1QJU1 2VZ1A 3FBMA 2V4AA 5T54A 5F5AA 3RWKX 4BXFA 3A21A 1GZWA 3TEZA 1YWKA 4FTSA 5FXXA 3ORJA 2W0XA 2MHFA 3TNQA 1PK6C 1AL23 1MEC2 3ABZA 4LE3A 1QH7A 3TN93 3BODA 5FBZA 3WG1A 2L9LA 3ZSLA 1XPWA 2A73B 3D5OA 4XBQA 4CUCA 4O65A 3SHRA 5JI7A 2FCUA 2ZACA 4E4HA 4X6QB 4A4AA 5H9PA 3UJOA 1AR62 4CUGA 2WZ8A 4AK3A 4YSFA 2V73A 5JSOA 4JQTA 2DFCA 3IDEA 4LO8A 2GN7A 3LCPA 4QKNA 3NKTA 4PT6A 4CCEA 1RMU1 4BE3A 2W68A 4BQ4A 1RJ8A 3V64A 4D69A 5C3SA 2VZRA 3HN3A 5IT6A 1HXS2 1CQ9A 3AC0A 3U1XA 1YEWA 1AR82 3BPZA 4MO3M 3MUZ1 2XPJA 5EYYA 2D5HA 2ES3A 4HK9A 3VZKA 1R64A 3O1OA 4FTBA 4CXYA 1REDA 2C1FA 4HSJA 4C1WA 4A42A 3ZMNA 1AYM2 4FXGB 4IETA 2EXIA 3BTAA 4QGLA 1HDKA 5K0UB 5LRSA 1DQ2A 2Y6KA 4R9BA 1WCKA 1RHI3 1LENA 3KMHA 3KLSA 2F4PA 4LBQA 5HCFA 1MEC1 1J1TA 1XU1A 3I54A 3TOJA 1OLQA 1BMV2 3ZSJA 1W3XA 2AR6A 3U11A 3H3ZA 4B4QA 2UY9A 1D4VB 2WABA 4ZXKA 2D6OX 1YLLA 2ZGMA 3AKSA 4LORA 3OTFA 5FZFA 1TNRA 2XVLA 2AYHA 1EP0A 1UPSA 2P3JA 3DYMA 1AR61 4OZOA 2H6CA 1UU5A 5A32B 2Q8EA 1ZA7A 2VZQA 2XQRA 1LCLA 1E57A 1UX7A 2WS93 1GLHA 3FC0A 2WNVC 5T5OA 5SV5A 2E6VA 3APBA 5EV7A 1Z7S3 2I74A 5F5CA 3PL0A 3MIHA 4GJYA 4L2NA 3USSA 1ST8A 1AR81 2QDRA 1V6NA 1QOTA 1UW8A 2RS13 2AUYA 4IXLA 4JDNA 3ZYJB 4AYUA 4IV1A 4M3CF 3G7DA 1EPWA 2XBO3 1G9FA 4QWNA 1AYM1 1W8WA 3IWZA 5BNPB 2BW8A 1RGSA 1JYWA 2NYYA 2XJUA 3MFAA 1NXD1 4QGNA 3U10A 4FPFA 1XBFA 4Y5SA 1EPZA 4DEVA 1BMV1 3RZKA 1QJZA 4LA2A 1QJX3 2JG8A 2PHUA 3POBA 2P3IA 1C8M2 1SBFA 3C3VA 5AVAA 4Q4X3 1POQA 1MR5A 2DCYA 3RJRA 4BMEA 1GMMA 1SFYA 1ODMA 1C28A 4FQZA 2YGLA 3KV4A 1VBA2 2BJSA 4IV1B 1SMVA 3VZOA 3KVBA 1COV2 2XLFA 4N53B 4XJWA 1HRI2 2E51A 2J1RA 3PU8A 4P9JA 3WDYA 4EROA 2ZKNA 2ZCWA 4OVEA 2A6WA 4Q4V3 3CZJA 4AAXA 3RZMA 3NKGA 4NE9A 2DTYA 3V65A 1O4ZA 4N7IA 3LSDA 2E7QA 4R9CA 3ZFEC 2C4XA 3A4UA 2I2SA 1X8MA 4GKYA 2BQPA 4MUVA 2JDZA 3MHZA 2WNUC 1OLMA 2GC0A 1X9TA 4D0QA 4Q0SA 3KHCA 2NZ9A 5K4LA 2ARAA 3ZYIB 5CB7A 4XF1A 2RS32 4JVAA 4CP1A 1AYN3 4CDQA 4S2DA 5T52A 4BIFA 1C8M1 3NVCA 4CRQA 5FZ4A 1EY2A 1YJLA 2VMIA 2WN2A 3LF7A 1CX4A 3I3MA 3SEEA 2HWE2 5ABJB 1CVNA 1OQ1A 4XCAA 4LHSA 2CWSA 3ON7A 1Q8PA 1US3A 2CSGA 2Q0AA 4DQAA 1FMD2 2MPFA 1COV1 1VALA 3LOIA 1UZYA 3WNLA 3ZFFC 1PIV3 1LOFC 3JB8A 1HRI1 4LITA 4AI0A 4EN8B 1HJGA 3SCHA 4JRLA 4XFFA 3ECQA 1S2KA 4D7TA 5C8CA 4QB2A 4M00A 2WSUA 1TG7A 3LIGA 2YDEA 2VE1A 1W6QA 2VOWA 5JUVA 2GNDA 4WM7C 1S0BA 3VBRB 3ZDVA 1ZRDA 3CJIB 2PFWA 4A3ZA 4PLMA 2XJPA 3H0OA 2RJLA 1ZZ7A 2PYTA 1JZ6A 2BVBA 4ASKA 4YPJA 2QQJA 4QDRA 4RS5A 2V5YA 5IFPA 4YW4A 2R043 2QZ3A 3WXPA 3AZVA 4AFBA 4FOQA 3SCFA 3AK0A 1FOD3 4RGGA 2GP5A 4QHOA 3I2DA 2DVAA 2RMU2 3LQCA 4CPBA 1HQWA 1WW4A 1I5PA 4UWDA 1G6NA 2HWE1 4BLJA 5CADA 5C8CB 4DUVA 1GBGA 2DBNA 1VBB3 1GUIA 2Y8KA 5FZEA 1GQPA 1FMD1 3WF0A 1W90A 4YZ2A 2P17A 4GMP1 1QY4A 5DG2A 3AJYA 1QH6A 5FLHA 5FMBA 5CKQA 5L9RA 2ZZJA 4AGRA 4QGMA 5FO8B 1UY1A 4AEJA 3RGBA 4QD2A 3OGSA 4FPGA 3WF4A 4RFRB 3LEGA 1OVPA 1LHWA 2VL4A 2ZPXA 5FYSA 4LJHA 4I3PA 2RM21 3IIAA 4HBNA 4BM8A 1S0EA 3PURA 1PVC1 1ULEA 5A70A 1BXHA 3HJRA 1OURA 1OVSA 5IVCA 5BNOB 5L7OB 3WLUA 4EJRA 3ZFGB 2ZGUA 3AMMA 2VVEA 1HB3A 1NE4A 1XNKA 5FZMA 1RUI3 3FHIB 4LBLA 3AKTA 2FZ1A 1UU4A 5LY2A 1ULGA 1W2UA 2RS53 4FBFA 4XFHA 1JUHA 1EUTA 1H4GA 2A6XA 3AB0A 3DKQA 1PK6B 2VH9A 3CNAA 4QT6A 4U2AA 3SNMA 5JWPA 5JXGA 1M06G 2DV9A 3LSEA 3VDAA 3PJYA 5BV6A 1OOPA 2D3PA 3O0WA 5FTTC 5IHRA 3GJAA 1AR73 2ZJCA 2ET1A 4Y33A 1IG0A 3MDPA 4JAAA 5AFEA 2H0VA 4KG8A 4DO0A 4TWTA 1RUJ3 4K40A 2HBUA 3MFCA 2Y0IA 1PX3A 5FWEA 1VBE2 4GQ7A 5D1IA 1H8TC 2VQ0A 2VY0A 2Y60A 3WNNA 3BOPA 5D8AB 3J26N 3WEZA 1VBD1 3K46A 3L9JT 4COVA 1UPIA 2VULA 1UX6A 5DQ0A 2WAAA 1NLQA 2Q1ZB 4LK6A 2W08A 2O8QA 2Y38A 3ZR5A 3AZWA 5E6HA 3NAPB 5ACA2 4GB33 5F7UA 1W03A 5DZFA 3WW1A 2FQPA 2PLV2 1OXCA 4NROA 5JMCA 3D3AA 4BK5A 4QX1A 1VPHA 2YY1A 3KCCA 2GNBA 2JX9A 4WVWA 1W9FA 1SLBA 1O3SA 4AI8A 4V2VA 3H1YA 1SG3A 1XE0A 3VBFC 1LOCA 1YI7A 4LA3A 4BMBA 2HWB2 3M4FA 1PVXA 1X82A 3ZR6A 3BTXA 5CG9A 5FOJB 5DABA 3VUOA 4JHTA 3ZXAC 4XFAA 4D6RA 2MEV2 4NR1A 4OYUA 1H2KA 2WNVB 4LUMA 3ETPA 3W59A 1VBE1 2QBXA 5C33A 4EN7B 4RHV2 4XUPA 2R072 3A22A 1JYVA 3DEMA 1PMJX 4LTAA 3RRDA 1OD5A 1I5ZA 1VJ2A 4QU2A 4CDWA 2P6HA 3UGGA 5DZEA 5ACA1 1XSRA 2YG0A 2EA7A 2NP0A 5E16A 2P3KA 5IJRA 5HV0A 5JR7B 4Q26A 1FX5A 2WIIB 4LKSA 1PO23 3J7HA 4WVZA 1AL22 5DPNA 2ZX4A 2X53S 4NRPA 1U5XA 3TN92 3S57A 1AX0A 3LDRA 5IAXA 2EXJA 1W06A 3WG2A 2G19A 2A6VA 4MHRA 3VHRA 2HH9A 2C9AA 1PZ7A 2EICA 2HWB1 4NVPA 2ADDA 4P02B 1VB4A 3BVCA 2D6MA 4XURA 3X29B 2A7AA 1W8FA 3ZN5A 4NRMA 1S0IA 1OT5A 2RDSA 2MEV1 1NE6A 1W9YA 3ELNA 3PUQA 5LW9A 4BQ3A 1ND3C 1J84A 2FMYA 4Q8LA 2RDQA 1MS4A 1CAWB 2BEOA 1UYZA 1FV3A 1SFPA 4IGPA 4NO4A 4RHV1 3VN4A 2R071 2BDRA 5GKAC 3RWNA 5G05L 3GCXA 4JZRA 4E4SA 5CFDC 1RUC2 2XH6A 2SBAA 1LECA 3JBG1 4QPWA 5F2SA 2DUOA 2D40A 4XIOA 3J7LA 5FZ8A 1LODA 3KV6A 3AMQA 3ZFEB 4KBZA 4P14A 5FYCA 4Z92B 4PDWC 4J1WA 2W1QA 2X5IB 4AVBA 4RQPA 3ZX7A 1A34A 5DUWA 3QACA 2XJRA 1AL21 4CP2A 5EJ1B 5GLTA 3TN91 3UYJA 1BLZA 1UYXA 1QHDA 2ENRA 3P3NA 3IBMA 2DTWA 5HXVA 3T0BA 2EXKA 3ZSKA 1KFXL 2VTXA 1IZ3A 3RYKA 2ZGRA 5GM0A 4A3XA 3IM0A 5DUUA 4E4ZA 4XXPA 2B9UA 1RUE2 3B69A 3GALA 1U5IA 1OKOA 2Z4FA 1O91A 3LE0A 4Y5Z0 2PAKA 5FPLA 4UFKA 3I2KA 3SC7X 4ASMB 5A7WB 1YQCA 2VZPA 4MXWB 3M3OA 3R05A 4H3WA 4LT5A 3I49A 1SACA 5FUPA 4GH4A 1BK1A 5LA9A 4YVWA 1N1TA 4XTPA 2GH8A 1Q56A 1RUC1 2XHNA 3MUY1 1DYPA 1NCRC 4JX0A 4E2QA 1FXZA 1XYOA 2ORZA 1YFYA 4JV4A 1KRIA 3USUA 1ENRA 2WT0A 1ONAA 5BNNA 4BQ1A 5AC93 3V0BB 2CGOA 1ZYBA 2ZHNA 3EHKA 2QQPA 3VKNA 4LO4B 2ZHKA 1POV3 4NAMA 1WD4A 1Y7BA 4CEWA 2QVSB 2WJSA 1HRV3 3ZSMA 4UFJA 1W2OA 5T5LA 1F31A 3LD8A 4FAGA 1UO9A 4HMZA 1HLCA 1VMHA 2DCJA 2ET7A 3I59A 1RUE1 3FBYA 3WNKA 3GYDA 4EWDA 2NMOA 1DZTA 1NUKA 3B01A 4AEDC 4HPKB 4COUA 2OX0A 4ZZ8A 5I8TA 4W6WA 4WVMA 5HI0A 4YG3A 1PHMA 1IS5A 3SXWA 3DYOA 3OUJA 3I2FA 3IPVA 3ATGA 4Q0PA 5GALA 4GIQA 1UOFA 1E5IA 3WQBA 3S6PA 3NJVA 2GNTA 2XBO1 3N3HA 1LHOA 1NCQB 1XSQA 1V6LA 2EIEA 1Q5OA 4A2UA 4G4FA 5DDJ3 5KWRA 3AP4A 4AOCA 1ZBA2 4LKEA 2IVIB 3J8F2 4DXRA 3O1RA 4GA9A 4M3CA 4RGAA 4B1MA 1W6NA 3P5BA 5J48A 5F5QA 2BNMA 5J96B 5IK7A 2NPIA 1S0GA 4MOAA 1W8UA 1KDKA 2YXSA 5F6LB 1ZA4A 1TME2 2J22A 4A44A 4L0PA 2WZR3 4W65A 3VDDB 4A7KA 4BZ4A 2ILMA 4ZZ5A 5A6QA 3MGUA 4Q0VA 1IKQA 4QX0A 3SH4A 1N1YA 3EQEA 4XF9A 4M0NA 2R0FA 2WQ4A 4IV3C 4Q4X1 4JGZB 4J1XA 3ZN6B 1S0JA 2JG9A 5EWSA 3OGGA 5IWFA 2YZ4A 1PO12 2B7YA 1W28A 5ANNA 2D43A 5C5TA 4FT8A 1H2NA 1EAH3 1OFSA 2C0ZA 4MXVA 4RR3B 5FZOA 5A7PA 1O4TA 1W39A 4OMDA 4D3WA 3F95A 3W5MA 4NPMA 1R1A3 3I2OA 4P00B 1ZZCA 4Q4V1 1W6NB 2VNGA 1GANA 3VBOA 3ENRA 5JSRA 2WFF2 1ZRFA 4CCDA 3UETA 5CAZA 2PQSA 1VMJA 1JBCA 1FNZA 4YYOA 4JDOA 3ZPOA 2BZDA 1QGLA 3KVAA 2CAVA 4Y22B 1ZBA1 5FMOL 5IK4A 3J8F1 3FUQA 1WMDA 3J4UH 5J09A 1HIXA 1QDOA 3AMPA 4N43C 5JPMB 4I30A 3KCYA 4NN0A 2IXCA 3DCQA 3RZZA 4CTEA 3OYWB 1TME1 2QTWB 1LULA 1ASJ2 2Z42A 3ZKUA 1LGNA 2VTXJ 4LBOA 2VMFA 3AMNA 1FOD2 5CBLA 1CESA 1AYN1 1F5FA 2EF6A 3POJA 3VKMA 4JRAA 5AFBA 5I8SA 1S55A 3GM8A 3RQ0A 2HWF3 5C4WB 1CWPA 3PTRB 4JKKA 4ZS3A 4UFHA 5DAQA 1XB9A 1Y3TA 1DF0A 5EZWA 5LA2A 4QX2A 1C1LA 3HAGA 5F5IA 3POFA 2BWCA 3ZO0B 2J7MA 3NV2A 4P9GA 1RUOA 4WM8A 2RR12 1W6OA 2C6SA 3VZNA 1G9AA 1Z78A 3VBFB 1K42A 3T3YA 2F17A 5C9AB 4OHYA 2SLIA 1QDCA 4BHPA 4DUXA 2FCVA 2JECA 2WFF1 2XJSA 2E63A 1MS9A 3HT1A 4PCRA 1TNFA 3O14A 2D6LX 2D3RA 5IVJA 4OMCA 5LBCA 2YV8A 4DRRA 1HV0A 1ODNA 4L11A 1V0AA 2PA7A 5KHKA 4BWOA 1H6YA 4GULA 4K8RB 3H3UA 5H9RA 2VOXA 2WNEA 3ZDSA 2JG8C 4CEYA 1ASJ1 1SCSA 2R041 3MPBA 3O7OA 1FOD1 4M0HA 1A78A 4CU6A 3NMBA 3U75A 4Z8BA 4XZUG 1TE1B 1AX2A 1WUVA 1UZVA 3MLKA 3OG2A 3TB0A 3KWVA 3WDXA 4XOGA 5CISA 4HZFA 5FPUA 4ZU5A 5A6ZA 4HN1A 4FP3A 1V6JA 4NHXA 4QAWA 1GWMA 1VBB1 4YW1A 3PMSA 2RV9A 4N7UA 3I3EA 2VJXA 4BPZA 4BQYA 4CDXB 2RR11 3T2QA 1LOBA 3RYPA 4IGQA 1RXGA 3EXUA 4CP9B 5CFCB 3FX3A 2C9KA 2JB4A 2G4IA 3E5XA 4LQRA 2E7TA 2HWD2 5FZAA 1S0DA 4HG6B 2YROA 4XMAA 2ZZQA 3BU0A 1JZ2A 5LBBA 1HV1A 3PTYA 1QJU2 1DZQA 1ULFA 4AHZA 2D93A 3TEWA 1ND3B 2XUMA 4XVHA 1GU3A 5L19A 5C7GA 5JZGB 4HK8A 4NRQA 4HSLA 4OFGA 3IDCB 4AI2A 1XNBA 2YGMA 1V6OA 5IAVA 2VW1A 3WCRA 4DXTA 1W9WA 3MO4A 3OGRA 4XQDA 5I0TA 1ENSA 3N35A 1RUI1 1AR92 1AZDA 2GP3A 4PDWB 2JDPA 4C90A 1APNA 2RS51 3SISA 3VBHB 1X8EA 5JOZA 4CDUC 4LIUA 4KMQA 1N1VA 1ULPA 4YZ1A 1YI9A 4M4RA 4URAA 2UYAA 4U36A 5FYMA 1PNFA 1XNDA 3M3QA 2Q4SA 4LOTA 4XUQA 3FMGA 4QM9A 3LAGA 2GMEA 2A3YA 2OXBA 2AEZA 4MGZE 2CGNA 4O7XA 1GOFA 2ZEZA 5HXMA 1AR71 5IVEA 2WNOA 4IUGA 4EWEA 5GZFA 4AQ6A 2HWD1 3NV3A 3UKNA 2XGXA 5FZ1A 3KT7A 4FOWA 4AGVA 3N36A 3LA3A 2ZA9A 2J1TA 4FO9A 4CVUA 2VVDA 3Q8EA 1QQP2 1D2SA 5I91A 1VBC3 4RS5C 3VDCA 4DOUA 4IEWA 1A8MA 1HQLA 3ZXEA 2A1XA 1QXPA 2VM9A 1W8TA 1XYNA 4K9SA 4AF9A 1JZ5A 3WDUA 1C1FA 4ZXEA 1ENQA 1OH3A 4CCCA 4BYYA 5K0UA 1AUYA 1PGL2 1AR91 5J1XA 5FPAA 4GB31 4ATEA 3MLJA 3QBQA 5FMOS 4XJ8A 3VDBA 3LIHA 1CPNA 3AP5A 4OHZA 2A6ZA 4LULA 2LROA 1V70A 4JGYC 1SPPB 4AI9A 3CBNA 1O59A 4UF0B 5A6YA 1W2AX 4K6BA 5F8PA 5LB6A 1UOBA 4UBHA 4RD7A 5C6CA 5A32A 1VAKA 3VL8A 2OQ7A 1CAXB 1RIRA 2BFUL 3S30A 3O1UA 2W1SA 4XFBA 4HOOA 4CUAA 5D21A 1JYTA 5B4XA 3O1SA 3OBAA 2JXAA 1UU6A 5FLJA 3LEIA 3V0AB 1QQP1 1DQ4A 3BCWA 1CN1A 1WLDA 3LPFA 5CA6A 2ZMNA 3JZVA 2WO2A 5E88A 2QJVA 3CQOA 3NJZA 1B09A 2LS6A 4DY5A 4DZGA 3KM5A 1LTEA 5KHIA 1ZREA 1FT9A 2VBPA 1VMFA 2ETEA 3PJQA 5BNPA 4DXZA 1CAVB 3OBTA 4IERA 2CTVA 4CA9A 1PGL1 4FPLA 4K8FA 4LO6B 4OQ8A 1H4HA 2R1DA 3KT4A 5FZ0A 2OIIA 5F1RA 2WT1A 1HJFA 1RUF3 1JHNA 1KEXA 2VMCA 4QM8A 4XAAA 2PTMA 4XZPA 1BBT2 5AVPA 5JOYA 1OOPC 2AC1A 2B42B 4JKMA 4K7JA 4L97A 4QDQA 3NSTA 4ONUA 1W9TA 4PI0A 4AVTA 1BCXA 1N3QA 4IV3B 3I3QA 2IVJA 5FPXA 2VO5A 3FLRA 3THCA 1DQ6A 2O0OA 4N53A 4WBBA 1OC1A 3OSDA 5FYBA 3DPRC 3EO6A 3PVOA 4URTA 3AZXA 4YGEA 1HX6A 1UZ0A 1J59A 3KHBA 4XFGA 2XLGA 2HBTA 4OI2A 4SLIA 2EIGA 1FPN3 4KU8A 3VBSC 4YGDA 3WP3A 2Z2SB 2JB8A 4HANA 1AVBA 1J3QA 2CYFA 1BVVA 1NA1A 1EYBA 5F6KA 1H30A 1MZEA 1MQTA 3OPZA 4YLZA 5G04L 3UGHA 1L7LA 3WSOA 1DFQA 1RYYA 2AACA 1WLTA 2OVUA 2WKKA 1WCDJ 2VW2A 4YM3A 2VUJA 2VNRA 4N43B 1BBT1 1DLCA 2O8OA 4YG6A 5JSPA 4DRVA 2W5FA 1DIWA 1HB2A 2ZGQA 1OQDA 4M4PA 5HCHA 3OY8B 1YQ2A 1VAMA 3HR9A 3VB9A 3MZHA 1WA6X 4BA6A 4WV8A 5ABJA 2HWC2 1ZVFA 4MGYE 1H8VA 1LEDA 2DWRA 2CDPA 3WP4A 4OI0A 2LUWA 2WINB 5K8SA 3ETQA 1IPJA 3N9MA 3LOBA 4QPIC 2B45X 1NLRA 1OFNA 3Q8AA 2TUNA 1OA3A 1CX1A 1NA1B 3M3EA 2NLRA 2YU1A 3T4HB 4ZHNA 1MQTB 1WBLA 2E53A 2WRAA 3OF1A 1K5MC 5F3CA 2QE3A 5JLVA 3GBGA 4LIVA 4O61A 5LY1A 5A3TA 2P5BA 5CKMA 4D94A 1VRH2 1XQNA 3VBRA 2D97A 3CJIA 3IT8A 1QMJA 3KF5A 4TSVA 5BPXA 1ND2B 3ASIA 1RUD3 3MYXA 2Z69A 2OYZA 3KB5A 3H50A 2DCZA 1O7FA 1DGWX 2VMGA 2VGDA 2Y6HA 5A6XA 5AC91 3ES4A 3URFA 5DG1A 1YUDA 4EZHA 3ZLIA 1D4M3 2VXJA 4ZONA 2YC4A 3C7HA 1HRV1 3NRUA 2I45A 4IEZA 3B00A 1Y9GA 2VCBA 2HWC1 4MGIE 1BQPA 4XDQA 3U4SA 4C0BA 1MZ5A 1C4RA 1F35A 3E1F1 2W95A 4PI2A 4HVOA 3K4DA 4AQSA 1PM4A 2P3YA 1UYPA 2RM22 1MS3A 4YVSC 1PVC2 3WP6A 2ZGOA 4GAZA 5DMYA 3HQXA 4A7YA 5A1FA 5KXCA 1ZRIA 1IGOA 1OHFA 1XYPA 1YRZA 2J1EA 1WW7A 1XC6A 4LBMA 1VRH1 4W6YA 2YBKA 5EFUA 1YO8A 3WR0A 3AKQA 2KXLA 4A41A 2QQKA 3MW2A 5BNOA 1O4YA 4RQPC 2Y6GA 4ATFA 3T2PA 5L7OA 1LHUA 1AF9A 3PUSA 3BYWA 4CU9A 3ZFGA 3I2GA 2O14A 3AZZA 4PF5A 4Y1UA 1KITA 2WYFA 2QQNA 1NOVA 3D0JA 2VZTA 1KQRA 2UU8A 2WZR1 2ZGTA 3T2OA 2BBVA 3H8XA 1MZFA 2DFBA 2YPDA 5FQ0B 1PK6A 3UK9A 3VBUB 4D8MA 1NLSA 4CDUB 3RZGA 3O1TA 1W6PB 4GWNA 4PIXA 3H8RA 3N7MA 2B9VA 4W8JA 5FFOC 5FUNA 4ET7A 5FWJA 1VLNA 1RUG3 2QQMA 2DDUA 3EYPA 4GH4C 1ZBE3 4C1XA 2VMEA 1VBD2 2YBPA 2ZGSA 3I4IA 4YVWC 5FLIA 1R1A1 4DUWA 3CL1A 1FYUA 3WDTA 2FZ2A 3NNLA 3OGJA 4L92A 4BDVB 5FP7A 4FFFA 5EIYB 5CU1A 5D8AA 4Z2WA 1SLIA 3DXUA 3K3OA 4FPYA 5GLZA 1QJY3 1SDWA 3OBZA 2BGCA 3RDIA 5JDBA 3JCIA 1LOAA 4CU7A 5EJZB 5T5JA 1QNYA 4Q2FA 1OQEA 1WWYA 2DU0A 1U12A 1JU3A 2HEWF 3HD8B 3FWEA 3ZYRA 4CEWC 3BUCA 3NAPA 3ZKYA 1W0PA 2DVDA 2Y64A 4LEJA 4B4RA 3HMYA 1UMHA 4Q4Y3 3DECA 4P5YA 4MX3A 3NV4A 3GZUC 1PZ8A 4GZ9A 3GXUA 5JXIA 1DDLA 1R082 2B4KA 2W52A 2V72A 1RJ7A 2HWF1 3WF1A 2R062 3KS7A 1OLRA 3HBKA 1GNZA 2FCTA 3H3LA 2R30A 3SLIA 1NG0A 1N3OA 1Y43B 2E33A 4P9YA 1HQNA 2KD7A 4MGTA 4RL7A 3ZIXA 1URXA 2FMDA 2OUJA 5C8WA 3JD73 3P1IA 1EV13 2NQYA 3WNMA 5CKNA 3IB3A 1W9SA 3UJQA 4E27A 5F3EA 4IE6A 2QQOA 2JDHA 4KG0A 2WNVA 2CGPA 1J1LA 1WCSA 3PHMA 2DCTA 4P08A 4HVRA 1HW5A 4QQHA 1LKNA 1DGWA 4BIOA 1R093 2ZS6B 1POV0 2ZGPA 3H1MA 3NNGA 2BNNA 4CU8A 2BTVC 4FOVA 5IW0A 3VD3A 3S0MA 1O5LA 3GF6A 4QX5A 2QQVA 3MEPA 1V9U2 4LBJA 2D6NA 5JIUA 3I7DA 3VV1A 5B4NA 1TMF3 5GZGA 2P4EA 2OA2A 2Q8OA 1RUH2 5J7MA 1W05A 1MACA 1R081 3B94A 1WW6A 5L36A 4TTGA 1XNAA 2DVBA 2QFEA 3DF0A 5T50A 4B29A 2R061 1EUUA 4QDSA 4AI1A 3TEXA 2XL7A 4BJ0A 1CGPA 4OUSA 1GKBA 3AP6A 3MIEA 3T30A 1LHVA 3WX5A 3OD0A 3VD5A 2VQUA 1CZVA 1H1MA 1KS4A 5FZGA 3VHOA 5LA0A 3ZYFA 1LAJA 1GP5A 5A3WA 1H9WA 1UWWA 2AENA 2R6QA 3VZJA 4D7SA 5C3RA 3VBOC 1QKQA 1RMU3 4AFMA 2ZHMA 4KU7A 3OD4A 3JBG2 4IE4A 3GHNA 4F8AA 2J1VA 2BOIA 3DPRB 3I3DA 4NPLA 4QXHA 1CAWA 3Q8FA 2ZX3A 2GMPA 3M70A 3M8LA 1UYYA 5LBEA 3S7IA 3KSCA 4AVSA 3HNYM 5FXVA 4TLFA 3ZXGA 4A45A 1HN1A 4AAPA 2ZGNA 4XBLA 4UW3A 5CVRA 4PHZA 3ZFEA 3NV1A 1V9U1 2FDJA 2AH2A 1D2QA 1MEC3 2KA3A 2X5IA 2V09A 3TAYA 1UMZA 2DURA 2ZX2A 1RUH1 4IL7A 2JICA 1G8WA 1GP4A 1XU2A 1YYNA 2PHDA 3O5SA 5T5PA 5J3UA 1JYXA 1OF4A 1BK0A 4I0WB 4OHWA 3SEPA 1OUXA 4NIHA 1STMA 1ZZBA 1F9KA 3I97A 5L9BA 4Y24A 4NHMA 1AR63 5FXWA 4XACA 1RL3A 2Y0OA 5LRRA 2HJIA 2VBDA 4AXOA 4PBPA 4QMAA 1UNBA 4KL1A 4LO7A 2PXJA 5IATA 3E6DA 3QH6A 1YJKA 2RDRA 1HXS3 2D7FA 3H7JA 2GALA 4QPIB 4AQ2A 2VU9A 5A7WA 2JDKA 2VZ3A 1AR83 1LOFA 4MXWA 3UL2A 2RG4A 4YW3A 2WWUA 4G9SB 1Y9MA 1CONA 2QKDA 2WLPA 1K5MB 2JE8A 2WNUB 1VBC1 2XKPA 1RHI2 1AHSA 4HKLA 1IQAA 1OH4A 1AYM3 2RDNA 4K1YA 1IS6A 4KWLA 3Q8BA 2N7GA 5FZ6A 3W20A 4XPVA 3NL1A 2D3SA 2RJKA 5A1LA 2XVGA 3V0BA 4IGOA 4Z1VA 2LTNA 5A3UA 2AGSA 2XHKA 3RG0A 3RZHA 2WS92 3VZLA 2A3WA 2WFPA 2Y6FA 3ZFFB 4FPEA 3E5UA 5ERLA 1L7RA 1HN0A 1B35C 1E5SA 1Z7S2 2FDKA 3PMEA 1N3PA 2RS12 2ZEYA 3CDZB 4NAOA 3CO2A 2A71A 2XL9A 1X36A 4HPKA 2Y34A 2QQUA 5GLWA 3VL9A 4ISRA 1YQ6A 3HN1A 4XW3A 4BQWA 5IVFA 2XBO2 4WM7B 2R7EB 1JI6A 2Z79A 5B2GB 4YVSB 3OB8A 1SBDA 3IZOA 4AE2A 3HVDA 4ES8A 4XF4A 1RHI1 2WDBA 2EAKA 4BCUA 1M4WA 1C5HA 2J1SA 4CZSA 2CL2A 1NXMA 5FZLA 4AG4A 4JTNA 3GDBA 1G9BA 1NCQA 3TBDA 1UZZA 4AR2A 3C7OA 1QJX2 1W3VA 2JDNA 1DQ5A 5BY5A 1IPKA 1NAEA 3B9CA 4Q4W3 4YZ3A 4Q4X2 3HWJA 1SCRA 4FPCA 2E32A 3PVBB 5FY9A 4QX8A 2WS91 1C8M3 1OPOA 3VDDA 1W8HA 4XMIA 4FTEA 3LFMA 4QXKA 3WDWA 2P34A 1BYHA 4QPGC 4EV0A 1TEIA 2XVKA 4ZKTB 1Z7S1 4TYSA 4JGZA 3U07A 3ZN6A 1VBA3 2GZWA 5C70A 5KXDA 3SQOA 1COV3 2RS11 3DGTA 4H14A 4PF1A 4EWAA 3KQRA 4Q4V2 2QNKA 1Y9QA 2JD9A 1HRI3 4RR3A 4TZDA 4ZU4A 3L2YA 3HT2A 4JKLA 4XE9A 1OD3A 2VOVA 4QX3A 1JOBA 3E6BA 3ST7A 4MZUA 5HCBA 3WNPA 2BPA2 2PHLA 1XXNA 3GHMA 2VPVA 5FYHA 2VW0A 3ZN4A 2VECA 4LXLA 1YQ5A 1FPN1 2B46X 3LDBA 5JXJA 5K0UC 4GALA 2XJQA 3ACIA 5LK7B 1QJX1 4Q0UA 1AYN2 2VCAA 4Y22A 1UCXA 3WY6A 1AXKA 2E31A 4B7EA 4EZ4A 3QD6A 5I0SA 3VD9A 2RS33 2D6PA 2R49A 2CNAA 3OYWA 4QKDA 4XXAA 1UIJA 1SFNA 5FREA 3NNJA 3FN9A 4DINB 2EVXA 3BI3A 3FHQA 3QLQA 4XYXA 4F83A 4PLNA 3K4ZA 2VD7A 2W9XA 1PIV2 2J1AA 2WL1A 3JXSA 1IPSA 1A8DA 2A5ZA 2WA4A 2WN3A 5C4WA 2ZABA 1FMD3 2K0GA 3AX4A 1RTVA 2WWJA 4Y1ZA 4P9IA 5FY8A 1TVGA 1YCIA 2IXHA 4GMP3 4CCMA 5I0RA 4C0HA 5LCWL 1J83A 2QZ2A 2YC0A 1BEV3 4NWWA 1REEA 2K2SA 1H8TB 2X10A 3VBFA 5KR7A 1OF3A 5IYYA 2JDMA 2UWAA 5C9AA 1CAUA 1G9CA 2VNOA 4LLFA 2YHJA 2CV6A 3H42B 2VZOA 5HCAA 2AZ5A 4XUOA 3BIWE 1UF2C 2Q5TA 4OUEA 5BNPC 2JWPA 4YZ4A 4Q8KA 5A7SA 4AZZA 2R042 2DVGA 4JCKA 4XHBA 4AVVA 1XOYA 3B93A 3BU7A 3PIGA 2JIGA 3U78A 2EIDA 3VKLA 2FDIA 2NM1A 3O1VA 4XEZA 4INDA 3PUHA 2BNOA 3AYEA 3THTA 1OA2A 3B3QE 5GZCA 5A3LA 4AQTA 4AGGA 1W8NA 3POIA 3LWCA 3E5QA 4HFSA 4XQ4A 4L8QA 1VBB2 2ZEXA 2HKXA 2RMU3 2J1UA 5HPOA 5JI9A 4FP2A 1U5ZA 2R16A 1PIV1 4GKXA 2VTFA 4AL9A 2WBKA 4D6QA 4IDZA 1OPMA 3C7GA 4IV1C 4OI4A 4UW6A 1CAUB 1OUSA 4YWAA 1Q8QA 4LNVA 3OPWA 1U0AA 2WA3A 3AMHA 3K77A 4UFIA 2FDGA 4XCBA 1T6BX 1HB1A 1UY4A 2GC1A 2DUPA 5GLVA 4CDXA 2B39A 2WUHA 1GOGA 5JOXA 3GNEA 1MS1A 3RFRA 2OZ6A 3INAA 5CFCA 4CP9A 4CCJA 3O1PA 3ZSEA 3B9IA 4K21A 1WCQA 2MNGA 4Z82A 4YGBA 5EHDA 2CDOA 3KF3A 3AZYA 1XRUA 1GNYA 1VAVA 2IZWA 2YFUA 2WO3A 1UMIA 1ND3A 1YIPA 1RUI2 2WT2A 2A3XA 4MVTA 1H0BA 4DB5A 5JZGA 5LWBA 5FY7A 2RS52 4RSUA 4N9IA 4XF3A 5C3OA 3KGZA 1LHNA 2F6BA 3AJZA 3U37A 4FPKA 2P6CA 4GWIA 4DPNA 3SKVA 4FOYA 2VOTA 4YW5A 4GXLA 1ZNPA 4PDWA 4LPLA 4UOJA 1X50A 1YXWA 4LBQD 2UYBA 3VBHA 1AR72 1A3KA 3MW3A 1CR7A 1GV9A 2EIBA 3B7MA 3P3PA 4FFIA 4ISQA 4PIYA 4S2HA 2X05A 3ILNA 5FPBA 1S4CA 1GYKA 1RUJ2 4XFCA 3AXEA 5KXBA 5FY1A 2WQZC 4IE7A 3RPQA 3ZXLA 5EYXA 5IVYA 5H9QA 2UWBA 4BXSV 3QH7A 1PZ9A 1QXJA 5FRAA 3GGLA 3PUAA 1ZBE1 3GJBA 1DU3D 1IOAA 3JQXA 1JODA 3SKJE 1Q3EA 2XG3A 4IQPA 1W0OA 1VBE3 5CFDB 3CJIC 2XLAA 3U4XA 1NYWA 5C3QA 3AP7A 4QHZA 3OBRA 5FDBA 4CDQC 4AFDA 3BOWA 3A7QA 3F2ZA 4H7MA 5JVVA 4GB32 5FZBA 4I01A 2F4LA 2YB7A 4ZS2A 5FCCA 5FYTA 5IVVA 1DYOA 1IKPA 3WNOA 4COYA 4PQ9A 4XUTA 4A6SA 3NNFA 3Q8CA 2HYXA 5KBFA 3H7YA 5ACA3 5APAA 4ARYA 4JC1A 4XBNA 4DEQA 4IEVA 3RMYA 3SITA 1NQDA 2PLV3 4B8EA 4YZ5A 1PMIA 4OHXA 4GWJA 2Z5WA 2JENA 2E7AA 5FP8A 4I0BA 4AHYA 2R1BA 4UT5A 5FIXA 3WG4A 5C8CC 1TMF2 4HLTA 5FY0A 1D0HA 4OULA 2HEYF 4IEXA 4R9AA 5F2WA 1BVP1 1SPPA 3HBZA 5FYUA 1RUJ1 2R0HA 4UF0A 4CCLA 3ZIWA 1CZSA 3NWKA 4CSWA 1WCUA 5K7PA 3D0SA 4JDMA 4TXWA 3RI8A 5J36A 1XNCA 3CMGA 1U5YA 4Y20B 4YRDA 5FZ9A 2GNMA 4IESA 2TEPA 3U0ZA 1CAXA 2MEV3 3JD71 3ACFA 5JIAA 2UURA 1Q8SA 2LRPA 1KS5A 2W2IA 5DN2A 3LZZA 5EQUA 4XUNA 3UESA 2VC9A 1NCRB 5FK7A 4XJUA 4YW2A 2C24A 1O5UA 4L9BA 4RHV3 3WD5A 4CCNA 5BNOC 4QKBA 2ORXA 4IE0A 1WMEA 5I0UA 3UV9A 1NKGA 3ZFGC 4B1LA 2BVVA 2P1BA 2LM3A 1QNWA 3KGLA 5A7OA 4X6RB 1QIQA 4YW6A 3J9SA 4B4PA 1PO22 2GC2A 4UW5A 3BKZA 1CAVA 1GZCA 1K45A 1YIFA 5F3IA 3W58A 4BISA 4Q0QA 2XJVA 3WVJA 3IIIA 4JTOA 2OPKA 1TMF1 3CHXA 1MVEA 1X9PA 1F15A 3R4DB 5CG8A 1OBNA 4KBBA 4XJAA 1MZ6A 1JUIA 3V56A 4AEDB 1RVF3 3ZYGA 1UY2A 3OEBA 5DUVA 3ZPYA 1UY3A 2WLQA 2Q1MA 2EAAA 4QPGB 4R9DA 1AJKA 3ZXFA 4IV3A 4EYUA 1KXGA 2P2KA 1IS3A 1PGW2 4Y1YA 3SH5A 3EB7A 1RITA 2PHWA 1H2LA 3OUHA 4FVVA 1VE0A 2YYOA 1DHKB 3UGFA 1NZCA 5BYNA 5D8AC 4IEOA 2ZMLA 4FCAA 3ZM8A 1QOOA 1HKDA 1GZWB 2BGOA 3EMRA 2DU1A 5A3NA 1RUC3 1SLTA 2BV4A 2W92A 2ZKLA 3AYDA 4XJ9A 4NWVA 5GLUA 2VUCA 2EXHA 3B02A 2O1QA 1ZZ9A 1ZZ6A 4XDPA 3N9PA 1PO21 4P9XA 3NAPC 1V6KA 2VUDA 3A0NA 1SEFA 1YFXA 3NNMA 1N1SA 4C8DA 4E2GA 5J37A 2VCCA 1JOJA 1DQ1A 1L7QA 5FZDA 1NQJA 2YFZA 2WO7A 4I3GA 4KH9A 4AFCA 4KGQA 3ACHA 1OKQA 5BNQA 4N43A 1DBNA 3D4KA 3POYA 1ZM1A 2Q1FA 2W39A 4L99A 1JZ7A 5FMDA 1YFUA 2UWCA 3WQ7A 1BJQA 2XJTA 3OY8A 4LE4A 2BOJA 3BN6A 5IK5A 1UN1A 5FPVA 4QB6A 1RUE3 2A75A 1V00A 5CIRA 3VKFC 3WW3A 4CPBD 1PGW1 1W0NA 5CYYA 4UBGA 2VUAA 3AYAA 4MYEA 3WW2A 3CU7A 3LGRA 4YM2A 1TZOA 1W99A 2G9GA 5FJKA 4LHLA 5BUVA 4AI3A 1WA4A 3FJSA 1HXS1 1NY72 4O9GA 4R4ZA 1X7NA 1ULCA 4NOTA 5FP3A 2E26A 4IEQA 2X8KA 4LBQB 2K46A 1XE7A 2GMMA 1DZRA 2ARCA 4NIAA 5AC92 3IMNA 1NT0A 3WZ1A 2DVFA 4ARXA 2Y6LA 5F37A 1ND2A 3S5QA 4DMIA 4DIQA 2OPWA 4DNYA 1JYIA 1HRV2 5GJ6A 2GDFA 1IS4A 3AL6A 4AVCA 1Q8VA 3N9OA 3OUIA 4UAPA 1MS8A 4Q4W2 3LDKA 2IFRA 4MGKE 1F4AA 1F5JA 3IDBB 5LATA 3K51A 3RVHA 5L9VA 5IK8A 2Y6JA 4P9WA 4AEKA 4BQ5A 1K12A 4KWJA 4IE5A 4QHBA 4Y4YA 2Y26A 2KM2A 3MIFA 3T1MA 5FP4A 5FK8A 3UKTA 4QXCA 3FFZA 4NMIA 5A3MA 2ZHLA 3HNBM 3WOGA 5KXEA 2WWSA 3LFIA 4QQPA 1H6XA 2BBAA 4CDWC 3OOXA 1YNAA 1PGSA 3J7MA 3N7KA 1DGRN 5FAXA 2ID4A 1NY71 5GZDA 1H1IA 1VP6A 2ARXA 3Q9OA 4EN0A 5FBJA 2QQIA 4ZPIA 5DDJ2 4Q29A 1W8OA 4Q27A 4QQ2A 4YNIA 3OEAA 4UFMA 3POGA 4Q1PA 3RYRA 4MV2A 1UKRA 1G86A 2WZPP 2JG8B 5DAVA 1POV1 1ZBA3 4LK7A 1WD3A 3J8F3 2WZR2 2X5IC 1T6GC 2OS2A 1HB4A 1ZZ8A 3AKRA 4XF0A 4COZA 4EE2A 1OMIA 5FZKA 5E8AA 3LA2A 2FDHA 1UAIA 2XWJB 2Q8DA 1J58A 1TME3 3NQHA 4Q4W1 4X8NA 3ZXJA 5FR3A 3IAPA 1OA4A 4XFIA 3HEIA 3G6JB 4BK4A 3HPNA 3KQ4B 3LPGA 5M0TA 3N4MA 2W91A 1EAH2 5KHJA 2PAMA 2VMDA 5FO9B 3LB9A 4Y5TA 1PO13 3ZYBA 2W1WA 1LU1A 5FQ0A 2OQ6A 4F3JA 3D82A 3VBUA 4CDUA 1VBA1 1R1A2 1LGBA 1O8PA 2A70A 2ZAHA 2BFUS 4JQRA 4E2SA 1W6PA 1N47A 1WKYA 4MGSA 4LBNA 3T1LA 1MS0A 3FL7A 2XQXA 3MIBA 4Z07A 5HBAA 1G9DA 1BEV2 3MV11 4G3YC 3WUDA 1LNSA 2ZAAA 4META 4NPRA 4S2GA 4J6GA 3THPA 1WW5A 2B8MA 3EBRA 4FXKB 5FP9A 4RFT0 5DDJ1 2WFF3 3PVEA 1XNTA 4I0AA 1LOGA 5T3NA 1LJ7A 1QWRA 5LASA 3AL5A 4Y1XA 4A6OA 4F7ZA 1RINA 4NHYA 3IN9A 4FI9A 3DN7A 2P37A 2HYKA 3RNSA 4CDQB 4YFZA 3WUCA 2H6BA 1DYKA 5A33A 4KI5M 4PBOA 1I3HA 1GP6A 2EALA 2BGPA 3HIFA 3MBWA 1ASJ3 1I1EA 1GSLA 2HWF2 4ZU7A 2RS31 1UOGA 5D2AA 4X8PA 3M2MA 2CHHA 3SCGA 3W9AA 3HQUA 3C8XA 1EAH1 1RUNA 5FKCA 4CYDA 3ACLA 4CXXA 1REFA 3AKPA 1GQGA 1UXXX 2D44A 4AFAA 1FV2A 1W2TA 2D6KA 2PHRA 4V1PA 4DS0A 2PHTA 4JGYA 1W6QB 3BB6A 2RR13 1OLME 1QXRA 1D0GA 4YARA 5I8YA 4QKFA 1BEV1 3FLTA 3J7NA 3VHPA 1E5RA 5IUQA 3V0AA 3MI8A 5C71A 1JOPA 3ZYPA 5BNNC 1SZBA 1V6IA 2A6YA 4S2FA 5A33B 4RS5B 5FJHA 2IXJA 5LZ6A 1NCQC 3WV6A 3ILFA 4BU2A 1J3RA 3D6EA 1F2NA 4KGGA 4Z2AA 4MSVA 3A23A 4WZFA 5JCTA 3RS6A 2J42A 3AP9A 3WF2A 4M01A 1O6UA 1WLWA 3H1WA 1GZ9A 1PM7A 3M1HA 4W6XA 4ORFA 3CZUA 3RJ2X 3T4VA 4GJZA 4AWDA 5JXHA 1UIKA 1X33A 3P6BA 3VDDC 2RJ2A 5J98B 3ALQA 1Z0HA 4JGYB 4CCOA 3A0KA 1JZ4A 4LKFA 5LBFA 2CY6A 2KR2A 2ADEA 2RMU1 1S1AA 4RGKA 2FD8A 4JGZC 3MF6A 1VB2A 1WLCA 2D5FA 1GR3A 3E97A 5FYIA 1UY0A 5JAXA 4QQOA 1DP0A 2G9ZA 3N9LA 1VR3A 3BPSA 3WCSA 2HEVF 4I09A 5EXOA 1MPXA 2ZOEB 4RR3C 3KZ4C 2VZUA 4NIGA 4K1ZA 4OZXA 3IMMA 3WINE 2ZBJA 1BHGA 1IQDC 4QXBA 4MLOA 5F3GA 4TLGA 2HWD3 2VBBA 3M7AA 5BXXA 2W46A 3WW4A 1DQ0A 5JOWA 4KWKA 4E9KA 1QJU3 5A7QA 2IC1A 4Y4RA 1PMHX 3DPRA 1CJDA 2BRTA 2WSVA 5C5UA 5FZCA 2IUWA 3H9AA 3W5NA 1S2BA 5FZIA 3NW4A 5DAPA 5I93A 1JN2P 1T2XA 4ITCA 3BTYA 2JG9C 1H2MA 3AM2A 4HXCA 3VBSA 3LKJA 4RYDA 2Q8CA 3TRSB 2BP6A 4AEMA 2XDVA 1VIWB 3LEKA 1ULOA 1UQXA 1AR93 1US2A 2R32A 3R4UA 5FZ3A 3T2TA 1JZ8A 3BTZA 1LU2A 1OOPB 3VKOA 1CIYA 5A80A 1F4HA 1Y4WA 1LGCA 3BALA 4CE8A 1NX9A 2YPJA 2C26A 5DAXA 3MIDA 5C4WC 1SLAA 2E9QA 3KV9A 1NZIA 4MADA 1QJEA 4CP0A 3WT3A 2B5HA 3MF9A 1S0FA 4BLIA 3FFQA 1S2EA 1CD3G 2VMHA 3IAQA 3K4AA 4RN5A 2GC3A 4NJ4A 5EJ3A 3S7EA 5FMCA 1LOEA 2IFWA 4HL0A 4W50A 5FPZA 4NUBA 1XJAA 3VD7A 4D6SA 3SH3A 3I2HA 1LESA 5C9AC 1LRHA 1JYCA 2QQLA 4LHNA 5F9TA 1WZXA 5T55A 5KC6A 1VBC2 2Q30A 2IXIA 3VBSB 4EN6B 3CKHA 3WDVA 2VZSA 4LO5B 4OHVA 1PX4A 5K9YA 4QPIA 2W94A 1QQP3 2JDUA 2PMWB 1ZRRA 3MV01 3RSJA 3WHTA 4R4XA 4RA0A 3ITQA 4YM1A 1K5MA 3ILRA 2WNUA 4K20A 1Q8OA 4OLLA 1C8NA
chains in the Genus database with same CATH topology
2VE1A 1W3XA 1E5RA 1W2AX 1UOBA 4XAEA 1ODNA 1RXFA 2Y6FA 1W2OA 1E5SA 1UO9A 5C3PA 1W04A 1E5HA 2DBIA 2DBNA 3OOXA 1QIQA 1QJFA 2VBPA 4RGKA 1UOFA 1W2NA 1E5IA 1W05A 4BB3A 1HB1A 1HJFA 1RXGA 1W06A 1W3VA 2JB4A 2IVIB 1OBNA 1GP5A 2VBBA 1DCSA 1HB4A 1W9YA 2VCMA 1ODMA 1HB3A 2IVJA 2BJSA 2BRTA 1OC1A 5C3OA 1W28A 2JB8A 5C3RA 1GP4A 1QJEA 1BK0A 3ZOIA 1BLZA 2VAUA 2WO7A 2Y60A 2BU9A 1HB2A 2VBDA 5C3SA 5C3QA 1UNBA 3ZKUA 1GP6A 1WA6X 3ON7A 2CSGA 1UOGA 3ZKYA 1IPSA 1W03A 5APAA 1UZWA 1HJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE1 A;  1W3X A;  1E5R A;  1W2A X;  1UOB A;  4XAE A;  1ODN A;  1RXF A;  2Y6F A;  1W2O A;  1E5S A;  1UO9 A;  5C3P A;  1W04 A;  1E5H A;  2DBI A;  2DBN A;  3OOX A;  1QIQ A;  1QJF A;  2VBP A;  4RGK A;  1UOF A;  1W2N A;  1E5I A;  1W05 A;  4BB3 A;  1HB1 A;  1HJF A;  1RXG A;  1W06 A;  1W3V A;  2JB4 A;  2IVI B;  1OBN A;  1GP5 A;  2VBB A;  1DCS A;  1HB4 A;  1W9Y A;  2VCM A;  1ODM A;  1HB3 A;  2IVJ A;  2BJS A;  2BRT A;  1OC1 A;  5C3O A;  1W28 A;  2JB8 A;  5C3R A;  1GP4 A;  1QJE A;  1BK0 A;  3ZOI A;  1BLZ A;  2VAU A;  2WO7 A;  2Y60 A;  2BU9 A;  1HB2 A;  2VBD A;  5C3S A;  5C3Q A;  1UNB A;  3ZKU A;  1GP6 A;  1WA6 X;  3ON7 A;  2CSG A;  1UOG A;  3ZKY A;  1IPS A;  1W03 A;  5APA A;  1UZW A;  1HJG A; 
#chains in the Genus database with same CATH topology
 5A3P A;  2IXK A;  4OQ9 A;  5FYZ A;  4NHK A;  2ZEW A;  4XET A;  5CZK A;  2C5D A;  2WAO A;  4WM8 C;  2WR9 A;  3WNX A;  4XAB A;  2PLV 1;  1AXY A;  2VG9 A;  1SBE A;  4KNC A;  1I6X A;  2AEY A;  1GIC A;  3DUI A;  4GMP 0;  2PEL A;  4LR4 A;  1FAY A;  4AVA A;  2QUO A;  3UKV A;  3KD4 A;  4ASL A;  1QOS A;  3CJX A;  1D7P M;  1ALY A;  4CDX C;  3I2I A;  5FYY A;  2XXZ A;  3CLP A;  3ZFF A;  3GZE A;  4H55 A;  3C7F A;  1RVF 2;  1KD7 A;  5CFC C;  3C7E A;  4HKW A;  4WZC A;  4R52 A;  4B7K A;  4SBV A;  3FUO A;  3GZA A;  1RB8 G;  3MIC A;  2VOK A;  1CJP A;  2XB6 C;  4NII A;  1E5H A;  1A6C A;  1UOJ A;  2GSY A;  3EJK A;  4XQW A;  2DBI A;  4CDW B;  2ZGK A;  4XJZ A;  5LK5 A;  4CEY C;  4CXW A;  4FPJ A;  4DY3 A;  3OPT A;  4WM7 A;  4BOW A;  2I07 B;  3M3C A;  3E6C C;  1G7Y A;  1R1Z A;  5JZG C;  5DAW A;  4YVS A;  1QJF A;  1YHF A;  3KCX A;  3PNA A;  1LB2 A;  2YUE A;  1QF3 A;  3JUU A;  1RC6 A;  1GNH A;  3CF6 E;  2X29 A;  4BB3 A;  5TSW A;  2Y33 A;  5A1A A;  1RUF 2;  3M3I A;  3U14 A;  3WG3 A;  1GWL A;  3AVR A;  1JXN A;  2WZE A;  4HET A;  3THD A;  5A3O A;  1ZRC A;  2NN8 A;  4MG2 A;  2K9Z A;  2JD4 A;  5ISL A;  4V2W A;  3VBH C;  3IDA A;  1JYN A;  3CIH A;  3VD4 A;  4YM0 A;  4KWU A;  1BBT 3;  3RMX A;  2GN3 A;  2TNF A;  4H2A A;  2OUH A;  1BKZ A;  3GBW A;  2VCM A;  5FYV A;  1L3J A;  1WBF A;  2VXR A;  4I2O A;  4FAH A;  3R0R A;  2ARE A;  3NJY A;  1RVF 1;  3PU3 A;  4MGQ A;  3ME2 A;  2XUE A;  3FZ3 A;  3S5A A;  3KT1 A;  1ULD A;  3I8T A;  1SDD B;  2PHX A;  3POS A;  4N90 A;  1YFW A;  1FPN 2;  4BQX A;  4PJY A;  3MLL A;  4N8M A;  4LKD A;  1JTZ X;  4W4Z A;  5IVB A;  2XWB B;  1W6M A;  2XML A;  1GWK A;  3I3B A;  3IKW A;  1TQ5 A;  1VRB A;  2ERF A;  2V4V A;  1O3Q A;  3MW4 A;  2W1U A;  1CIW A;  4RQP B;  1DLL A;  2PQQ A;  1KJL A;  3TWI A;  5LA1 A;  4XIL A;  3DKW A;  3LEM A;  5DUX A;  2ZMK A;  1RUF 1;  3W21 A;  2JKX A;  2OKX A;  3OGV A;  3FE5 A;  1O3R A;  3HQR A;  5JPN B;  3N9Q A;  4K3U A;  2BU9 A;  4MHU A;  1GFF 2;  1MVQ A;  5HV4 A;  4EQV A;  1LR5 A;  2ARB A;  3MPP G;  2ZX0 A;  5FKB A;  1DG6 A;  1Q43 A;  4UYB A;  3HOB A;  4AW7 A;  4XC9 A;  2BER A;  2WO1 A;  2FHR A;  3QOP A;  3PDQ A;  3QCW A;  1JS9 A;  2HWC 3;  1W6M B;  4COW A;  2FBE A;  5FZH A;  3R6S A;  5L73 A;  5KHH A;  5GZE A;  1K5J A;  1SHW B;  4GH4 B;  4Y3O A;  2WYS A;  3K48 A;  3POW A;  4YVW B;  4PIZ A;  1C3H A;  3O0X A;  3PVN A;  1DGR A;  2GU9 A;  2JE9 A;  4HKO A;  4CUB A;  3OJB A;  3H8O A;  2RE9 A;  3DYP A;  4TN7 A;  2VR4 A;  4LMF A;  4BQ2 A;  3RI9 A;  3TYJ A;  4H7L A;  1H8T A;  2VQA A;  3AYC A;  4P5H A;  3T09 A;  4WVV A;  1QEX A;  1WMF A;  3ACG A;  4Y26 A;  3USU B;  4UXA A;  1WMX A;  5BNN B;  1RUD 2;  1JHJ A;  1VRH 3;  2ZTN A;  4P9L A;  1KGY A;  2IXL A;  2JKB A;  3PUI A;  1JZ3 A;  2XKO A;  3PLQ A;  2OW4 A;  3ZMO A;  2TBV A;  4CEW B;  2ZX1 A;  2CWM A;  4PQQ A;  4KQ7 A;  4E4D X;  1D4M 2;  3BGA A;  5H9S A;  1ACC A;  1F8V A;  1AL0 G;  2HWE 3;  4C91 A;  5FXZ A;  2JE7 A;  2XR4 A;  1YQ8 A;  3I59 B;  2QDN A;  4CCK A;  3WF3 A;  1WGP A;  4QPY A;  4WVM B;  4B3N A;  2BYV E;  1C57 A;  5FOB B;  3O1M A;  1V6M A;  4YGC A;  3R4S A;  3WQ1 A;  4Y1V A;  2DUQ A;  3IPV B;  4XDO A;  1C5I A;  4QQL A;  4QX7 A;  3VGI A;  1W2N A;  4DXS A;  5JR2 A;  4HON A;  1PNG A;  3T08 A;  2W3J A;  1XE8 A;  2RVA A;  4ES9 A;  2RM2 3;  3K2O A;  4UI9 L;  1K3I A;  1PVC 3;  4NHL A;  3O12 A;  4XTM A;  3C2U A;  2VZV A;  1AX1 A;  2HLE A;  3T0A A;  2RHP A;  2VVF A;  2YBS A;  5SV8 A;  3HNM A;  1RUD 1;  2WC2 A;  3I2J A;  4M3C B;  4AHX A;  4NID A;  3DV8 A;  4QB1 A;  5A7N A;  2G1M A;  2GAU A;  5F39 A;  5EP9 A;  5E89 A;  1KDM A;  1UKG A;  1D4M 1;  3AFG A;  4LBK A;  2ZXQ A;  4LUK A;  4A7Z A;  4UW4 A;  3K3N A;  2H0B A;  1CPM A;  2IWG B;  3KV5 A;  2PAE A;  2JG9 B;  3FHA A;  3PIJ A;  4Q5O A;  1IG3 A;  2FDF A;  3TEY A;  4N53 C;  1P8J A;  5FZO B;  4GWM A;  1OSG A;  3SMH A;  3T0D A;  2OT7 A;  2D98 A;  2BUK A;  2JEM A;  2QCS B;  2UY8 A;  1RUG 2;  2JDY A;  2V5D A;  4PLO A;  5FY5 A;  3GZT B;  4EN9 B;  1PO1 1;  1ZBE 2;  2WQ8 A;  1AJO A;  3WHU A;  4OCT A;  3ZYH A;  3VBO B;  3VHN A;  2VNV A;  3GBF A;  5IFT A;  1NA1 C;  1SLC A;  2JJ6 A;  4OI1 A;  3ZOI A;  5JMO A;  2VAU A;  4M3C E;  1DGL A;  1JH5 A;  1GOH A;  1MQT C;  1VBD 3;  3DL3 A;  5F32 A;  4DFS A;  3RZJ A;  5ANQ A;  4AHW A;  3H8U A;  2LW8 A;  4HN0 A;  4IW3 A;  5CEH A;  4LHK A;  4E8D A;  3POE A;  4UFL A;  1JW6 A;  1QJY 2;  2YC2 A;  2YMZ A;  3AVS A;  4FFH A;  4LLO A;  5CFD A;  1LEM A;  3N9N A;  3AFK A;  3DXT A;  5LEJ A;  2LAL A;  1ND2 C;  4MH0 E;  4E8C A;  1QU0 A;  1CZT A;  4HT1 T;  4IEP A;  4XIK A;  4XHX A;  3WQ0 A;  3ROU A;  1O3T A;  3VZM A;  4Q4Y 2;  2PN5 A;  5ABJ C;  3JB4 C;  5FY4 A;  2QQW A;  3RZL A;  1GQH A;  1OI6 A;  5LEK A;  3TNP B;  1SLL A;  1BZW A;  1UZW A;  5FV3 A;  2XOM A;  1MS5 A;  3JQW A;  3ES1 A;  2XON A;  4WM8 B;  4JHZ A;  1FNY A;  1W6O B;  1R08 3;  1RUG 1;  3UNP A;  2R06 3;  3AXD A;  4N9H A;  1ZX5 A;  3NO8 A;  3L2H A;  3JD7 2;  1H1A A;  1EV1 2;  4R8H A;  3WP5 A;  3ZVX A;  4FPH A;  1JU4 A;  5KHG A;  3BIE A;  3VBR C;  1KFU L;  2ATF A;  4GD4 A;  3ZXD A;  3MIG A;  4XAE A;  5EPA A;  3JU9 A;  4OUM A;  1B35 A;  4Y20 A;  4O9E A;  1RXF A;  2PHF A;  5DXD A;  2OZJ A;  3GCW A;  4LOS A;  1QJY 1;  5C3P A;  3UT0 A;  5DZG A;  1R09 2;  2CU5 A;  1J3P A;  1H9P A;  4QU1 A;  4HVQ A;  1NCR A;  4YG0 A;  4CEY B;  1GZT A;  1JMU B;  1W04 A;  1FAT A;  1AXZ A;  1O8S A;  2W47 A;  1KJR A;  4FPO B;  2CAU A;  4Q4Y 1;  2DYC A;  5FUI A;  2VQT A;  4D7Y A;  5FO7 B;  4BH9 A;  3VLB B;  3K75 B;  2NMN A;  1SQ4 A;  1V9U 3;  5E1R A;  1UL9 A;  5I0D A;  2DCK A;  1S0C A;  5CNA A;  1RUH 3;  2X09 A;  2HWB 3;  2BWA A;  3N7J A;  2YU2 A;  1IHM A;  1B35 B;  4FQ4 A;  3VBU C;  3LA7 A;  2DF7 A;  3O0V A;  1UXZ A;  2G9F A;  1FI2 A;  3OCP A;  1UD1 A;  1EV1 1;  4FSJ A;  4YFW A;  3B5L B;  4AED A;  4FFG A;  1W8Z A;  3N7L A;  1RMU 2;  1DCS A;  4J25 A;  4Q1R A;  3D8C A;  2GH2 A;  4IEU A;  2ZGL A;  4QPG A;  2R07 3;  5L7O C;  1ENX A;  1YC6 1;  5FZ7 A;  5KC5 A;  3JBG 3;  2JIJ A;  1I9R A;  3CEW A;  3ZXK A;  1R09 1;  4IEY A;  3FLP A;  2JDA A;  4YW7 A;  4ZY9 A;  2W87 A;  3NJX A;  4I02 A;  1QJU 1;  2VZ1 A;  3FBM A;  2V4A A;  5T54 A;  5F5A A;  3RWK X;  4BXF A;  3A21 A;  1GZW A;  3TEZ A;  1YWK A;  4FTS A;  5FXX A;  3ORJ A;  2W0X A;  2MHF A;  3TNQ A;  1PK6 C;  1AL2 3;  1MEC 2;  3ABZ A;  4LE3 A;  1QH7 A;  3TN9 3;  3BOD A;  5FBZ A;  3WG1 A;  2L9L A;  3ZSL A;  1XPW A;  2A73 B;  3D5O A;  4XBQ A;  4CUC A;  4O65 A;  3SHR A;  5JI7 A;  2FCU A;  2ZAC A;  4E4H A;  4X6Q B;  4A4A A;  5H9P A;  3UJO A;  1AR6 2;  4CUG A;  2WZ8 A;  4AK3 A;  4YSF A;  2V73 A;  5JSO A;  4JQT A;  2DFC A;  3IDE A;  4LO8 A;  2GN7 A;  3LCP A;  4QKN A;  3NKT A;  4PT6 A;  4CCE A;  1RMU 1;  4BE3 A;  2W68 A;  4BQ4 A;  1RJ8 A;  3V64 A;  4D69 A;  5C3S A;  2VZR A;  3HN3 A;  5IT6 A;  1HXS 2;  1CQ9 A;  3AC0 A;  3U1X A;  1YEW A;  1AR8 2;  3BPZ A;  4MO3 M;  3MUZ 1;  2XPJ A;  5EYY A;  2D5H A;  2ES3 A;  4HK9 A;  3VZK A;  1R64 A;  3O1O A;  4FTB A;  4CXY A;  1RED A;  2C1F A;  4HSJ A;  4C1W A;  4A42 A;  3ZMN A;  1AYM 2;  4FXG B;  4IET A;  2EXI A;  3BTA A;  4QGL A;  1HDK A;  5K0U B;  5LRS A;  1DQ2 A;  2Y6K A;  4R9B A;  1WCK A;  1RHI 3;  1LEN A;  3KMH A;  3KLS A;  2F4P A;  4LBQ A;  5HCF A;  1MEC 1;  1J1T A;  1XU1 A;  3I54 A;  3TOJ A;  1OLQ A;  1BMV 2;  3ZSJ A;  1W3X A;  2AR6 A;  3U11 A;  3H3Z A;  4B4Q A;  2UY9 A;  1D4V B;  2WAB A;  4ZXK A;  2D6O X;  1YLL A;  2ZGM A;  3AKS A;  4LOR A;  3OTF A;  5FZF A;  1TNR A;  2XVL A;  2AYH A;  1EP0 A;  1UPS A;  2P3J A;  3DYM A;  1AR6 1;  4OZO A;  2H6C A;  1UU5 A;  5A32 B;  2Q8E A;  1ZA7 A;  2VZQ A;  2XQR A;  1LCL A;  1E57 A;  1UX7 A;  2WS9 3;  1GLH A;  3FC0 A;  2WNV C;  5T5O A;  5SV5 A;  2E6V A;  3APB A;  5EV7 A;  1Z7S 3;  2I74 A;  5F5C A;  3PL0 A;  3MIH A;  4GJY A;  4L2N A;  3USS A;  1ST8 A;  1AR8 1;  2QDR A;  1V6N A;  1QOT A;  1UW8 A;  2RS1 3;  2AUY A;  4IXL A;  4JDN A;  3ZYJ B;  4AYU A;  4IV1 A;  4M3C F;  3G7D A;  1EPW A;  2XBO 3;  1G9F A;  4QWN A;  1AYM 1;  1W8W A;  3IWZ A;  5BNP B;  2BW8 A;  1RGS A;  1JYW A;  2NYY A;  2XJU A;  3MFA A;  1NXD 1;  4QGN A;  3U10 A;  4FPF A;  1XBF A;  4Y5S A;  1EPZ A;  4DEV A;  1BMV 1;  3RZK A;  1QJZ A;  4LA2 A;  1QJX 3;  2JG8 A;  2PHU A;  3POB A;  2P3I A;  1C8M 2;  1SBF A;  3C3V A;  5AVA A;  4Q4X 3;  1POQ A;  1MR5 A;  2DCY A;  3RJR A;  4BME A;  1GMM A;  1SFY A;  1ODM A;  1C28 A;  4FQZ A;  2YGL A;  3KV4 A;  1VBA 2;  2BJS A;  4IV1 B;  1SMV A;  3VZO A;  3KVB A;  1COV 2;  2XLF A;  4N53 B;  4XJW A;  1HRI 2;  2E51 A;  2J1R A;  3PU8 A;  4P9J A;  3WDY A;  4ERO A;  2ZKN A;  2ZCW A;  4OVE A;  2A6W A;  4Q4V 3;  3CZJ A;  4AAX A;  3RZM A;  3NKG A;  4NE9 A;  2DTY A;  3V65 A;  1O4Z A;  4N7I A;  3LSD A;  2E7Q A;  4R9C A;  3ZFE C;  2C4X A;  3A4U A;  2I2S A;  1X8M A;  4GKY A;  2BQP A;  4MUV A;  2JDZ A;  3MHZ A;  2WNU C;  1OLM A;  2GC0 A;  1X9T A;  4D0Q A;  4Q0S A;  3KHC A;  2NZ9 A;  5K4L A;  2ARA A;  3ZYI B;  5CB7 A;  4XF1 A;  2RS3 2;  4JVA A;  4CP1 A;  1AYN 3;  4CDQ A;  4S2D A;  5T52 A;  4BIF A;  1C8M 1;  3NVC A;  4CRQ A;  5FZ4 A;  1EY2 A;  1YJL A;  2VMI A;  2WN2 A;  3LF7 A;  1CX4 A;  3I3M A;  3SEE A;  2HWE 2;  5ABJ B;  1CVN A;  1OQ1 A;  4XCA A;  4LHS A;  2CWS A;  3ON7 A;  1Q8P A;  1US3 A;  2CSG A;  2Q0A A;  4DQA A;  1FMD 2;  2MPF A;  1COV 1;  1VAL A;  3LOI A;  1UZY A;  3WNL A;  3ZFF C;  1PIV 3;  1LOF C;  3JB8 A;  1HRI 1;  4LIT A;  4AI0 A;  4EN8 B;  1HJG A;  3SCH A;  4JRL A;  4XFF A;  3ECQ A;  1S2K A;  4D7T A;  5C8C A;  4QB2 A;  4M00 A;  2WSU A;  1TG7 A;  3LIG A;  2YDE A;  2VE1 A;  1W6Q A;  2VOW A;  5JUV A;  2GND A;  4WM7 C;  1S0B A;  3VBR B;  3ZDV A;  1ZRD A;  3CJI B;  2PFW A;  4A3Z A;  4PLM A;  2XJP A;  3H0O A;  2RJL A;  1ZZ7 A;  2PYT A;  1JZ6 A;  2BVB A;  4ASK A;  4YPJ A;  2QQJ A;  4QDR A;  4RS5 A;  2V5Y A;  5IFP A;  4YW4 A;  2R04 3;  2QZ3 A;  3WXP A;  3AZV A;  4AFB A;  4FOQ A;  3SCF A;  3AK0 A;  1FOD 3;  4RGG A;  2GP5 A;  4QHO A;  3I2D A;  2DVA A;  2RMU 2;  3LQC A;  4CPB A;  1HQW A;  1WW4 A;  1I5P A;  4UWD A;  1G6N A;  2HWE 1;  4BLJ A;  5CAD A;  5C8C B;  4DUV A;  1GBG A;  2DBN A;  1VBB 3;  1GUI A;  2Y8K A;  5FZE A;  1GQP A;  1FMD 1;  3WF0 A;  1W90 A;  4YZ2 A;  2P17 A;  4GMP 1;  1QY4 A;  5DG2 A;  3AJY A;  1QH6 A;  5FLH A;  5FMB A;  5CKQ A;  5L9R A;  2ZZJ A;  4AGR A;  4QGM A;  5FO8 B;  1UY1 A;  4AEJ A;  3RGB A;  4QD2 A;  3OGS A;  4FPG A;  3WF4 A;  4RFR B;  3LEG A;  1OVP A;  1LHW A;  2VL4 A;  2ZPX A;  5FYS A;  4LJH A;  4I3P A;  2RM2 1;  3IIA A;  4HBN A;  4BM8 A;  1S0E A;  3PUR A;  1PVC 1;  1ULE A;  5A70 A;  1BXH A;  3HJR A;  1OUR A;  1OVS A;  5IVC A;  5BNO B;  5L7O B;  3WLU A;  4EJR A;  3ZFG B;  2ZGU A;  3AMM A;  2VVE A;  1HB3 A;  1NE4 A;  1XNK A;  5FZM A;  1RUI 3;  3FHI B;  4LBL A;  3AKT A;  2FZ1 A;  1UU4 A;  5LY2 A;  1ULG A;  1W2U A;  2RS5 3;  4FBF A;  4XFH A;  1JUH A;  1EUT A;  1H4G A;  2A6X A;  3AB0 A;  3DKQ A;  1PK6 B;  2VH9 A;  3CNA A;  4QT6 A;  4U2A A;  3SNM A;  5JWP A;  5JXG A;  1M06 G;  2DV9 A;  3LSE A;  3VDA A;  3PJY A;  5BV6 A;  1OOP A;  2D3P A;  3O0W A;  5FTT C;  5IHR A;  3GJA A;  1AR7 3;  2ZJC A;  2ET1 A;  4Y33 A;  1IG0 A;  3MDP A;  4JAA A;  5AFE A;  2H0V A;  4KG8 A;  4DO0 A;  4TWT A;  1RUJ 3;  4K40 A;  2HBU A;  3MFC A;  2Y0I A;  1PX3 A;  5FWE A;  1VBE 2;  4GQ7 A;  5D1I A;  1H8T C;  2VQ0 A;  2VY0 A;  2Y60 A;  3WNN A;  3BOP A;  5D8A B;  3J26 N;  3WEZ A;  1VBD 1;  3K46 A;  3L9J T;  4COV A;  1UPI A;  2VUL A;  1UX6 A;  5DQ0 A;  2WAA A;  1NLQ A;  2Q1Z B;  4LK6 A;  2W08 A;  2O8Q A;  2Y38 A;  3ZR5 A;  3AZW A;  5E6H A;  3NAP B;  5ACA 2;  4GB3 3;  5F7U A;  1W03 A;  5DZF A;  3WW1 A;  2FQP A;  2PLV 2;  1OXC A;  4NRO A;  5JMC A;  3D3A A;  4BK5 A;  4QX1 A;  1VPH A;  2YY1 A;  3KCC A;  2GNB A;  2JX9 A;  4WVW A;  1W9F A;  1SLB A;  1O3S A;  4AI8 A;  4V2V A;  3H1Y A;  1SG3 A;  1XE0 A;  3VBF C;  1LOC A;  1YI7 A;  4LA3 A;  4BMB A;  2HWB 2;  3M4F A;  1PVX A;  1X82 A;  3ZR6 A;  3BTX A;  5CG9 A;  5FOJ B;  5DAB A;  3VUO A;  4JHT A;  3ZXA C;  4XFA A;  4D6R A;  2MEV 2;  4NR1 A;  4OYU A;  1H2K A;  2WNV B;  4LUM A;  3ETP A;  3W59 A;  1VBE 1;  2QBX A;  5C33 A;  4EN7 B;  4RHV 2;  4XUP A;  2R07 2;  3A22 A;  1JYV A;  3DEM A;  1PMJ X;  4LTA A;  3RRD A;  1OD5 A;  1I5Z A;  1VJ2 A;  4QU2 A;  4CDW A;  2P6H A;  3UGG A;  5DZE A;  5ACA 1;  1XSR A;  2YG0 A;  2EA7 A;  2NP0 A;  5E16 A;  2P3K A;  5IJR A;  5HV0 A;  5JR7 B;  4Q26 A;  1FX5 A;  2WII B;  4LKS A;  1PO2 3;  3J7H A;  4WVZ A;  1AL2 2;  5DPN A;  2ZX4 A;  2X53 S;  4NRP A;  1U5X A;  3TN9 2;  3S57 A;  1AX0 A;  3LDR A;  5IAX A;  2EXJ A;  1W06 A;  3WG2 A;  2G19 A;  2A6V A;  4MHR A;  3VHR A;  2HH9 A;  2C9A A;  1PZ7 A;  2EIC A;  2HWB 1;  4NVP A;  2ADD A;  4P02 B;  1VB4 A;  3BVC A;  2D6M A;  4XUR A;  3X29 B;  2A7A A;  1W8F A;  3ZN5 A;  4NRM A;  1S0I A;  1OT5 A;  2RDS A;  2MEV 1;  1NE6 A;  1W9Y A;  3ELN A;  3PUQ A;  5LW9 A;  4BQ3 A;  1ND3 C;  1J84 A;  2FMY A;  4Q8L A;  2RDQ A;  1MS4 A;  1CAW B;  2BEO A;  1UYZ A;  1FV3 A;  1SFP A;  4IGP A;  4NO4 A;  4RHV 1;  3VN4 A;  2R07 1;  2BDR A;  5GKA C;  3RWN A;  5G05 L;  3GCX A;  4JZR A;  4E4S A;  5CFD C;  1RUC 2;  2XH6 A;  2SBA A;  1LEC A;  3JBG 1;  4QPW A;  5F2S A;  2DUO A;  2D40 A;  4XIO A;  3J7L A;  5FZ8 A;  1LOD A;  3KV6 A;  3AMQ A;  3ZFE B;  4KBZ A;  4P14 A;  5FYC A;  4Z92 B;  4PDW C;  4J1W A;  2W1Q A;  2X5I B;  4AVB A;  4RQP A;  3ZX7 A;  1A34 A;  5DUW A;  3QAC A;  2XJR A;  1AL2 1;  4CP2 A;  5EJ1 B;  5GLT A;  3TN9 1;  3UYJ A;  1BLZ A;  1UYX A;  1QHD A;  2ENR A;  3P3N A;  3IBM A;  2DTW A;  5HXV A;  3T0B A;  2EXK A;  3ZSK A;  1KFX L;  2VTX A;  1IZ3 A;  3RYK A;  2ZGR A;  5GM0 A;  4A3X A;  3IM0 A;  5DUU A;  4E4Z A;  4XXP A;  2B9U A;  1RUE 2;  3B69 A;  3GAL A;  1U5I A;  1OKO A;  2Z4F A;  1O91 A;  3LE0 A;  4Y5Z 0;  2PAK A;  5FPL A;  4UFK A;  3I2K A;  3SC7 X;  4ASM B;  5A7W B;  1YQC A;  2VZP A;  4MXW B;  3M3O A;  3R05 A;  4H3W A;  4LT5 A;  3I49 A;  1SAC A;  5FUP A;  4GH4 A;  1BK1 A;  5LA9 A;  4YVW A;  1N1T A;  4XTP A;  2GH8 A;  1Q56 A;  1RUC 1;  2XHN A;  3MUY 1;  1DYP A;  1NCR C;  4JX0 A;  4E2Q A;  1FXZ A;  1XYO A;  2ORZ A;  1YFY A;  4JV4 A;  1KRI A;  3USU A;  1ENR A;  2WT0 A;  1ONA A;  5BNN A;  4BQ1 A;  5AC9 3;  3V0B B;  2CGO A;  1ZYB A;  2ZHN A;  3EHK A;  2QQP A;  3VKN A;  4LO4 B;  2ZHK A;  1POV 3;  4NAM A;  1WD4 A;  1Y7B A;  4CEW A;  2QVS B;  2WJS A;  1HRV 3;  3ZSM A;  4UFJ A;  1W2O A;  5T5L A;  1F31 A;  3LD8 A;  4FAG A;  1UO9 A;  4HMZ A;  1HLC A;  1VMH A;  2DCJ A;  2ET7 A;  3I59 A;  1RUE 1;  3FBY A;  3WNK A;  3GYD A;  4EWD A;  2NMO A;  1DZT A;  1NUK A;  3B01 A;  4AED C;  4HPK B;  4COU A;  2OX0 A;  4ZZ8 A;  5I8T A;  4W6W A;  4WVM A;  5HI0 A;  4YG3 A;  1PHM A;  1IS5 A;  3SXW A;  3DYO A;  3OUJ A;  3I2F A;  3IPV A;  3ATG A;  4Q0P A;  5GAL A;  4GIQ A;  1UOF A;  1E5I A;  3WQB A;  3S6P A;  3NJV A;  2GNT A;  2XBO 1;  3N3H A;  1LHO A;  1NCQ B;  1XSQ A;  1V6L A;  2EIE A;  1Q5O A;  4A2U A;  4G4F A;  5DDJ 3;  5KWR A;  3AP4 A;  4AOC A;  1ZBA 2;  4LKE A;  2IVI B;  3J8F 2;  4DXR A;  3O1R A;  4GA9 A;  4M3C A;  4RGA A;  4B1M A;  1W6N A;  3P5B A;  5J48 A;  5F5Q A;  2BNM A;  5J96 B;  5IK7 A;  2NPI A;  1S0G A;  4MOA A;  1W8U A;  1KDK A;  2YXS A;  5F6L B;  1ZA4 A;  1TME 2;  2J22 A;  4A44 A;  4L0P A;  2WZR 3;  4W65 A;  3VDD B;  4A7K A;  4BZ4 A;  2ILM A;  4ZZ5 A;  5A6Q A;  3MGU A;  4Q0V A;  1IKQ A;  4QX0 A;  3SH4 A;  1N1Y A;  3EQE A;  4XF9 A;  4M0N A;  2R0F A;  2WQ4 A;  4IV3 C;  4Q4X 1;  4JGZ B;  4J1X A;  3ZN6 B;  1S0J A;  2JG9 A;  5EWS A;  3OGG A;  5IWF A;  2YZ4 A;  1PO1 2;  2B7Y A;  1W28 A;  5ANN A;  2D43 A;  5C5T A;  4FT8 A;  1H2N A;  1EAH 3;  1OFS A;  2C0Z A;  4MXV A;  4RR3 B;  5FZO A;  5A7P A;  1O4T A;  1W39 A;  4OMD A;  4D3W A;  3F95 A;  3W5M A;  4NPM A;  1R1A 3;  3I2O A;  4P00 B;  1ZZC A;  4Q4V 1;  1W6N B;  2VNG A;  1GAN A;  3VBO A;  3ENR A;  5JSR A;  2WFF 2;  1ZRF A;  4CCD A;  3UET A;  5CAZ A;  2PQS A;  1VMJ A;  1JBC A;  1FNZ A;  4YYO A;  4JDO A;  3ZPO A;  2BZD A;  1QGL A;  3KVA A;  2CAV A;  4Y22 B;  1ZBA 1;  5FMO L;  5IK4 A;  3J8F 1;  3FUQ A;  1WMD A;  3J4U H;  5J09 A;  1HIX A;  1QDO A;  3AMP A;  4N43 C;  5JPM B;  4I30 A;  3KCY A;  4NN0 A;  2IXC A;  3DCQ A;  3RZZ A;  4CTE A;  3OYW B;  1TME 1;  2QTW B;  1LUL A;  1ASJ 2;  2Z42 A;  3ZKU A;  1LGN A;  2VTX J;  4LBO A;  2VMF A;  3AMN A;  1FOD 2;  5CBL A;  1CES A;  1AYN 1;  1F5F A;  2EF6 A;  3POJ A;  3VKM A;  4JRA A;  5AFB A;  5I8S A;  1S55 A;  3GM8 A;  3RQ0 A;  2HWF 3;  5C4W B;  1CWP A;  3PTR B;  4JKK A;  4ZS3 A;  4UFH A;  5DAQ A;  1XB9 A;  1Y3T A;  1DF0 A;  5EZW A;  5LA2 A;  4QX2 A;  1C1L A;  3HAG A;  5F5I A;  3POF A;  2BWC A;  3ZO0 B;  2J7M A;  3NV2 A;  4P9G A;  1RUO A;  4WM8 A;  2RR1 2;  1W6O A;  2C6S A;  3VZN A;  1G9A A;  1Z78 A;  3VBF B;  1K42 A;  3T3Y A;  2F17 A;  5C9A B;  4OHY A;  2SLI A;  1QDC A;  4BHP A;  4DUX A;  2FCV A;  2JEC A;  2WFF 1;  2XJS A;  2E63 A;  1MS9 A;  3HT1 A;  4PCR A;  1TNF A;  3O14 A;  2D6L X;  2D3R A;  5IVJ A;  4OMC A;  5LBC A;  2YV8 A;  4DRR A;  1HV0 A;  1ODN A;  4L11 A;  1V0A A;  2PA7 A;  5KHK A;  4BWO A;  1H6Y A;  4GUL A;  4K8R B;  3H3U A;  5H9R A;  2VOX A;  2WNE A;  3ZDS A;  2JG8 C;  4CEY A;  1ASJ 1;  1SCS A;  2R04 1;  3MPB A;  3O7O A;  1FOD 1;  4M0H A;  1A78 A;  4CU6 A;  3NMB A;  3U75 A;  4Z8B A;  4XZU G;  1TE1 B;  1AX2 A;  1WUV A;  1UZV A;  3MLK A;  3OG2 A;  3TB0 A;  3KWV A;  3WDX A;  4XOG A;  5CIS A;  4HZF A;  5FPU A;  4ZU5 A;  5A6Z A;  4HN1 A;  4FP3 A;  1V6J A;  4NHX A;  4QAW A;  1GWM A;  1VBB 1;  4YW1 A;  3PMS A;  2RV9 A;  4N7U A;  3I3E A;  2VJX A;  4BPZ A;  4BQY A;  4CDX B;  2RR1 1;  3T2Q A;  1LOB A;  3RYP A;  4IGQ A;  1RXG A;  3EXU A;  4CP9 B;  5CFC B;  3FX3 A;  2C9K A;  2JB4 A;  2G4I A;  3E5X A;  4LQR A;  2E7T A;  2HWD 2;  5FZA A;  1S0D A;  4HG6 B;  2YRO A;  4XMA A;  2ZZQ A;  3BU0 A;  1JZ2 A;  5LBB A;  1HV1 A;  3PTY A;  1QJU 2;  1DZQ A;  1ULF A;  4AHZ A;  2D93 A;  3TEW A;  1ND3 B;  2XUM A;  4XVH A;  1GU3 A;  5L19 A;  5C7G A;  5JZG B;  4HK8 A;  4NRQ A;  4HSL A;  4OFG A;  3IDC B;  4AI2 A;  1XNB A;  2YGM A;  1V6O A;  5IAV A;  2VW1 A;  3WCR A;  4DXT A;  1W9W A;  3MO4 A;  3OGR A;  4XQD A;  5I0T A;  1ENS A;  3N35 A;  1RUI 1;  1AR9 2;  1AZD A;  2GP3 A;  4PDW B;  2JDP A;  4C90 A;  1APN A;  2RS5 1;  3SIS A;  3VBH B;  1X8E A;  5JOZ A;  4CDU C;  4LIU A;  4KMQ A;  1N1V A;  1ULP A;  4YZ1 A;  1YI9 A;  4M4R A;  4URA A;  2UYA A;  4U36 A;  5FYM A;  1PNF A;  1XND A;  3M3Q A;  2Q4S A;  4LOT A;  4XUQ A;  3FMG A;  4QM9 A;  3LAG A;  2GME A;  2A3Y A;  2OXB A;  2AEZ A;  4MGZ E;  2CGN A;  4O7X A;  1GOF A;  2ZEZ A;  5HXM A;  1AR7 1;  5IVE A;  2WNO A;  4IUG A;  4EWE A;  5GZF A;  4AQ6 A;  2HWD 1;  3NV3 A;  3UKN A;  2XGX A;  5FZ1 A;  3KT7 A;  4FOW A;  4AGV A;  3N36 A;  3LA3 A;  2ZA9 A;  2J1T A;  4FO9 A;  4CVU A;  2VVD A;  3Q8E A;  1QQP 2;  1D2S A;  5I91 A;  1VBC 3;  4RS5 C;  3VDC A;  4DOU A;  4IEW A;  1A8M A;  1HQL A;  3ZXE A;  2A1X A;  1QXP A;  2VM9 A;  1W8T A;  1XYN A;  4K9S A;  4AF9 A;  1JZ5 A;  3WDU A;  1C1F A;  4ZXE A;  1ENQ A;  1OH3 A;  4CCC A;  4BYY A;  5K0U A;  1AUY A;  1PGL 2;  1AR9 1;  5J1X A;  5FPA A;  4GB3 1;  4ATE A;  3MLJ A;  3QBQ A;  5FMO S;  4XJ8 A;  3VDB A;  3LIH A;  1CPN A;  3AP5 A;  4OHZ A;  2A6Z A;  4LUL A;  2LRO A;  1V70 A;  4JGY C;  1SPP B;  4AI9 A;  3CBN A;  1O59 A;  4UF0 B;  5A6Y A;  1W2A X;  4K6B A;  5F8P A;  5LB6 A;  1UOB A;  4UBH A;  4RD7 A;  5C6C A;  5A32 A;  1VAK A;  3VL8 A;  2OQ7 A;  1CAX B;  1RIR A;  2BFU L;  3S30 A;  3O1U A;  2W1S A;  4XFB A;  4HOO A;  4CUA A;  5D21 A;  1JYT A;  5B4X A;  3O1S A;  3OBA A;  2JXA A;  1UU6 A;  5FLJ A;  3LEI A;  3V0A B;  1QQP 1;  1DQ4 A;  3BCW A;  1CN1 A;  1WLD A;  3LPF A;  5CA6 A;  2ZMN A;  3JZV A;  2WO2 A;  5E88 A;  2QJV A;  3CQO A;  3NJZ A;  1B09 A;  2LS6 A;  4DY5 A;  4DZG A;  3KM5 A;  1LTE A;  5KHI A;  1ZRE A;  1FT9 A;  2VBP A;  1VMF A;  2ETE A;  3PJQ A;  5BNP A;  4DXZ A;  1CAV B;  3OBT A;  4IER A;  2CTV A;  4CA9 A;  1PGL 1;  4FPL A;  4K8F A;  4LO6 B;  4OQ8 A;  1H4H A;  2R1D A;  3KT4 A;  5FZ0 A;  2OII A;  5F1R A;  2WT1 A;  1HJF A;  1RUF 3;  1JHN A;  1KEX A;  2VMC A;  4QM8 A;  4XAA A;  2PTM A;  4XZP A;  1BBT 2;  5AVP A;  5JOY A;  1OOP C;  2AC1 A;  2B42 B;  4JKM A;  4K7J A;  4L97 A;  4QDQ A;  3NST A;  4ONU A;  1W9T A;  4PI0 A;  4AVT A;  1BCX A;  1N3Q A;  4IV3 B;  3I3Q A;  2IVJ A;  5FPX A;  2VO5 A;  3FLR A;  3THC A;  1DQ6 A;  2O0O A;  4N53 A;  4WBB A;  1OC1 A;  3OSD A;  5FYB A;  3DPR C;  3EO6 A;  3PVO A;  4URT A;  3AZX A;  4YGE A;  1HX6 A;  1UZ0 A;  1J59 A;  3KHB A;  4XFG A;  2XLG A;  2HBT A;  4OI2 A;  4SLI A;  2EIG A;  1FPN 3;  4KU8 A;  3VBS C;  4YGD A;  3WP3 A;  2Z2S B;  2JB8 A;  4HAN A;  1AVB A;  1J3Q A;  2CYF A;  1BVV A;  1NA1 A;  1EYB A;  5F6K A;  1H30 A;  1MZE A;  1MQT A;  3OPZ A;  4YLZ A;  5G04 L;  3UGH A;  1L7L A;  3WSO A;  1DFQ A;  1RYY A;  2AAC A;  1WLT A;  2OVU A;  2WKK A;  1WCD J;  2VW2 A;  4YM3 A;  2VUJ A;  2VNR A;  4N43 B;  1BBT 1;  1DLC A;  2O8O A;  4YG6 A;  5JSP A;  4DRV A;  2W5F A;  1DIW A;  1HB2 A;  2ZGQ A;  1OQD A;  4M4P A;  5HCH A;  3OY8 B;  1YQ2 A;  1VAM A;  3HR9 A;  3VB9 A;  3MZH A;  1WA6 X;  4BA6 A;  4WV8 A;  5ABJ A;  2HWC 2;  1ZVF A;  4MGY E;  1H8V A;  1LED A;  2DWR A;  2CDP A;  3WP4 A;  4OI0 A;  2LUW A;  2WIN B;  5K8S A;  3ETQ A;  1IPJ A;  3N9M A;  3LOB A;  4QPI C;  2B45 X;  1NLR A;  1OFN A;  3Q8A A;  2TUN A;  1OA3 A;  1CX1 A;  1NA1 B;  3M3E A;  2NLR A;  2YU1 A;  3T4H B;  4ZHN A;  1MQT B;  1WBL A;  2E53 A;  2WRA A;  3OF1 A;  1K5M C;  5F3C A;  2QE3 A;  5JLV A;  3GBG A;  4LIV A;  4O61 A;  5LY1 A;  5A3T A;  2P5B A;  5CKM A;  4D94 A;  1VRH 2;  1XQN A;  3VBR A;  2D97 A;  3CJI A;  3IT8 A;  1QMJ A;  3KF5 A;  4TSV A;  5BPX A;  1ND2 B;  3ASI A;  1RUD 3;  3MYX A;  2Z69 A;  2OYZ A;  3KB5 A;  3H50 A;  2DCZ A;  1O7F A;  1DGW X;  2VMG A;  2VGD A;  2Y6H A;  5A6X A;  5AC9 1;  3ES4 A;  3URF A;  5DG1 A;  1YUD A;  4EZH A;  3ZLI A;  1D4M 3;  2VXJ A;  4ZON A;  2YC4 A;  3C7H A;  1HRV 1;  3NRU A;  2I45 A;  4IEZ A;  3B00 A;  1Y9G A;  2VCB A;  2HWC 1;  4MGI E;  1BQP A;  4XDQ A;  3U4S A;  4C0B A;  1MZ5 A;  1C4R A;  1F35 A;  3E1F 1;  2W95 A;  4PI2 A;  4HVO A;  3K4D A;  4AQS A;  1PM4 A;  2P3Y A;  1UYP A;  2RM2 2;  1MS3 A;  4YVS C;  1PVC 2;  3WP6 A;  2ZGO A;  4GAZ A;  5DMY A;  3HQX A;  4A7Y A;  5A1F A;  5KXC A;  1ZRI A;  1IGO A;  1OHF A;  1XYP A;  1YRZ A;  2J1E A;  1WW7 A;  1XC6 A;  4LBM A;  1VRH 1;  4W6Y A;  2YBK A;  5EFU A;  1YO8 A;  3WR0 A;  3AKQ A;  2KXL A;  4A41 A;  2QQK A;  3MW2 A;  5BNO A;  1O4Y A;  4RQP C;  2Y6G A;  4ATF A;  3T2P A;  5L7O A;  1LHU A;  1AF9 A;  3PUS A;  3BYW A;  4CU9 A;  3ZFG A;  3I2G A;  2O14 A;  3AZZ A;  4PF5 A;  4Y1U A;  1KIT A;  2WYF A;  2QQN A;  1NOV A;  3D0J A;  2VZT A;  1KQR A;  2UU8 A;  2WZR 1;  2ZGT A;  3T2O A;  2BBV A;  3H8X A;  1MZF A;  2DFB A;  2YPD A;  5FQ0 B;  1PK6 A;  3UK9 A;  3VBU B;  4D8M A;  1NLS A;  4CDU B;  3RZG A;  3O1T A;  1W6P B;  4GWN A;  4PIX A;  3H8R A;  3N7M A;  2B9V A;  4W8J A;  5FFO C;  5FUN A;  4ET7 A;  5FWJ A;  1VLN A;  1RUG 3;  2QQM A;  2DDU A;  3EYP A;  4GH4 C;  1ZBE 3;  4C1X A;  2VME A;  1VBD 2;  2YBP A;  2ZGS A;  3I4I A;  4YVW C;  5FLI A;  1R1A 1;  4DUW A;  3CL1 A;  1FYU A;  3WDT A;  2FZ2 A;  3NNL A;  3OGJ A;  4L92 A;  4BDV B;  5FP7 A;  4FFF A;  5EIY B;  5CU1 A;  5D8A A;  4Z2W A;  1SLI A;  3DXU A;  3K3O A;  4FPY A;  5GLZ A;  1QJY 3;  1SDW A;  3OBZ A;  2BGC A;  3RDI A;  5JDB A;  3JCI A;  1LOA A;  4CU7 A;  5EJZ B;  5T5J A;  1QNY A;  4Q2F A;  1OQE A;  1WWY A;  2DU0 A;  1U12 A;  1JU3 A;  2HEW F;  3HD8 B;  3FWE A;  3ZYR A;  4CEW C;  3BUC A;  3NAP A;  3ZKY A;  1W0P A;  2DVD A;  2Y64 A;  4LEJ A;  4B4R A;  3HMY A;  1UMH A;  4Q4Y 3;  3DEC A;  4P5Y A;  4MX3 A;  3NV4 A;  3GZU C;  1PZ8 A;  4GZ9 A;  3GXU A;  5JXI A;  1DDL A;  1R08 2;  2B4K A;  2W52 A;  2V72 A;  1RJ7 A;  2HWF 1;  3WF1 A;  2R06 2;  3KS7 A;  1OLR A;  3HBK A;  1GNZ A;  2FCT A;  3H3L A;  2R30 A;  3SLI A;  1NG0 A;  1N3O A;  1Y43 B;  2E33 A;  4P9Y A;  1HQN A;  2KD7 A;  4MGT A;  4RL7 A;  3ZIX A;  1URX A;  2FMD A;  2OUJ A;  5C8W A;  3JD7 3;  3P1I A;  1EV1 3;  2NQY A;  3WNM A;  5CKN A;  3IB3 A;  1W9S A;  3UJQ A;  4E27 A;  5F3E A;  4IE6 A;  2QQO A;  2JDH A;  4KG0 A;  2WNV A;  2CGP A;  1J1L A;  1WCS A;  3PHM A;  2DCT A;  4P08 A;  4HVR A;  1HW5 A;  4QQH A;  1LKN A;  1DGW A;  4BIO A;  1R09 3;  2ZS6 B;  1POV 0;  2ZGP A;  3H1M A;  3NNG A;  2BNN A;  4CU8 A;  2BTV C;  4FOV A;  5IW0 A;  3VD3 A;  3S0M A;  1O5L A;  3GF6 A;  4QX5 A;  2QQV A;  3MEP A;  1V9U 2;  4LBJ A;  2D6N A;  5JIU A;  3I7D A;  3VV1 A;  5B4N A;  1TMF 3;  5GZG A;  2P4E A;  2OA2 A;  2Q8O A;  1RUH 2;  5J7M A;  1W05 A;  1MAC A;  1R08 1;  3B94 A;  1WW6 A;  5L36 A;  4TTG A;  1XNA A;  2DVB A;  2QFE A;  3DF0 A;  5T50 A;  4B29 A;  2R06 1;  1EUU A;  4QDS A;  4AI1 A;  3TEX A;  2XL7 A;  4BJ0 A;  1CGP A;  4OUS A;  1GKB A;  3AP6 A;  3MIE A;  3T30 A;  1LHV A;  3WX5 A;  3OD0 A;  3VD5 A;  2VQU A;  1CZV A;  1H1M A;  1KS4 A;  5FZG A;  3VHO A;  5LA0 A;  3ZYF A;  1LAJ A;  1GP5 A;  5A3W A;  1H9W A;  1UWW A;  2AEN A;  2R6Q A;  3VZJ A;  4D7S A;  5C3R A;  3VBO C;  1QKQ A;  1RMU 3;  4AFM A;  2ZHM A;  4KU7 A;  3OD4 A;  3JBG 2;  4IE4 A;  3GHN A;  4F8A A;  2J1V A;  2BOI A;  3DPR B;  3I3D A;  4NPL A;  4QXH A;  1CAW A;  3Q8F A;  2ZX3 A;  2GMP A;  3M70 A;  3M8L A;  1UYY A;  5LBE A;  3S7I A;  3KSC A;  4AVS A;  3HNY M;  5FXV A;  4TLF A;  3ZXG A;  4A45 A;  1HN1 A;  4AAP A;  2ZGN A;  4XBL A;  4UW3 A;  5CVR A;  4PHZ A;  3ZFE A;  3NV1 A;  1V9U 1;  2FDJ A;  2AH2 A;  1D2Q A;  1MEC 3;  2KA3 A;  2X5I A;  2V09 A;  3TAY A;  1UMZ A;  2DUR A;  2ZX2 A;  1RUH 1;  4IL7 A;  2JIC A;  1G8W A;  1GP4 A;  1XU2 A;  1YYN A;  2PHD A;  3O5S A;  5T5P A;  5J3U A;  1JYX A;  1OF4 A;  1BK0 A;  4I0W B;  4OHW A;  3SEP A;  1OUX A;  4NIH A;  1STM A;  1ZZB A;  1F9K A;  3I97 A;  5L9B A;  4Y24 A;  4NHM A;  1AR6 3;  5FXW A;  4XAC A;  1RL3 A;  2Y0O A;  5LRR A;  2HJI A;  2VBD A;  4AXO A;  4PBP A;  4QMA A;  1UNB A;  4KL1 A;  4LO7 A;  2PXJ A;  5IAT A;  3E6D A;  3QH6 A;  1YJK A;  2RDR A;  1HXS 3;  2D7F A;  3H7J A;  2GAL A;  4QPI B;  4AQ2 A;  2VU9 A;  5A7W A;  2JDK A;  2VZ3 A;  1AR8 3;  1LOF A;  4MXW A;  3UL2 A;  2RG4 A;  4YW3 A;  2WWU A;  4G9S B;  1Y9M A;  1CON A;  2QKD A;  2WLP A;  1K5M B;  2JE8 A;  2WNU B;  1VBC 1;  2XKP A;  1RHI 2;  1AHS A;  4HKL A;  1IQA A;  1OH4 A;  1AYM 3;  2RDN A;  4K1Y A;  1IS6 A;  4KWL A;  3Q8B A;  2N7G A;  5FZ6 A;  3W20 A;  4XPV A;  3NL1 A;  2D3S A;  2RJK A;  5A1L A;  2XVG A;  3V0B A;  4IGO A;  4Z1V A;  2LTN A;  5A3U A;  2AGS A;  2XHK A;  3RG0 A;  3RZH A;  2WS9 2;  3VZL A;  2A3W A;  2WFP A;  2Y6F A;  3ZFF B;  4FPE A;  3E5U A;  5ERL A;  1L7R A;  1HN0 A;  1B35 C;  1E5S A;  1Z7S 2;  2FDK A;  3PME A;  1N3P A;  2RS1 2;  2ZEY A;  3CDZ B;  4NAO A;  3CO2 A;  2A71 A;  2XL9 A;  1X36 A;  4HPK A;  2Y34 A;  2QQU A;  5GLW A;  3VL9 A;  4ISR A;  1YQ6 A;  3HN1 A;  4XW3 A;  4BQW A;  5IVF A;  2XBO 2;  4WM7 B;  2R7E B;  1JI6 A;  2Z79 A;  5B2G B;  4YVS B;  3OB8 A;  1SBD A;  3IZO A;  4AE2 A;  3HVD A;  4ES8 A;  4XF4 A;  1RHI 1;  2WDB A;  2EAK A;  4BCU A;  1M4W A;  1C5H A;  2J1S A;  4CZS A;  2CL2 A;  1NXM A;  5FZL A;  4AG4 A;  4JTN A;  3GDB A;  1G9B A;  1NCQ A;  3TBD A;  1UZZ A;  4AR2 A;  3C7O A;  1QJX 2;  1W3V A;  2JDN A;  1DQ5 A;  5BY5 A;  1IPK A;  1NAE A;  3B9C A;  4Q4W 3;  4YZ3 A;  4Q4X 2;  3HWJ A;  1SCR A;  4FPC A;  2E32 A;  3PVB B;  5FY9 A;  4QX8 A;  2WS9 1;  1C8M 3;  1OPO A;  3VDD A;  1W8H A;  4XMI A;  4FTE A;  3LFM A;  4QXK A;  3WDW A;  2P34 A;  1BYH A;  4QPG C;  4EV0 A;  1TEI A;  2XVK A;  4ZKT B;  1Z7S 1;  4TYS A;  4JGZ A;  3U07 A;  3ZN6 A;  1VBA 3;  2GZW A;  5C70 A;  5KXD A;  3SQO A;  1COV 3;  2RS1 1;  3DGT A;  4H14 A;  4PF1 A;  4EWA A;  3KQR A;  4Q4V 2;  2QNK A;  1Y9Q A;  2JD9 A;  1HRI 3;  4RR3 A;  4TZD A;  4ZU4 A;  3L2Y A;  3HT2 A;  4JKL A;  4XE9 A;  1OD3 A;  2VOV A;  4QX3 A;  1JOB A;  3E6B A;  3ST7 A;  4MZU A;  5HCB A;  3WNP A;  2BPA 2;  2PHL A;  1XXN A;  3GHM A;  2VPV A;  5FYH A;  2VW0 A;  3ZN4 A;  2VEC A;  4LXL A;  1YQ5 A;  1FPN 1;  2B46 X;  3LDB A;  5JXJ A;  5K0U C;  4GAL A;  2XJQ A;  3ACI A;  5LK7 B;  1QJX 1;  4Q0U A;  1AYN 2;  2VCA A;  4Y22 A;  1UCX A;  3WY6 A;  1AXK A;  2E31 A;  4B7E A;  4EZ4 A;  3QD6 A;  5I0S A;  3VD9 A;  2RS3 3;  2D6P A;  2R49 A;  2CNA A;  3OYW A;  4QKD A;  4XXA A;  1UIJ A;  1SFN A;  5FRE A;  3NNJ A;  3FN9 A;  4DIN B;  2EVX A;  3BI3 A;  3FHQ A;  3QLQ A;  4XYX A;  4F83 A;  4PLN A;  3K4Z A;  2VD7 A;  2W9X A;  1PIV 2;  2J1A A;  2WL1 A;  3JXS A;  1IPS A;  1A8D A;  2A5Z A;  2WA4 A;  2WN3 A;  5C4W A;  2ZAB A;  1FMD 3;  2K0G A;  3AX4 A;  1RTV A;  2WWJ A;  4Y1Z A;  4P9I A;  5FY8 A;  1TVG A;  1YCI A;  2IXH A;  4GMP 3;  4CCM A;  5I0R A;  4C0H A;  5LCW L;  1J83 A;  2QZ2 A;  2YC0 A;  1BEV 3;  4NWW A;  1REE A;  2K2S A;  1H8T B;  2X10 A;  3VBF A;  5KR7 A;  1OF3 A;  5IYY A;  2JDM A;  2UWA A;  5C9A A;  1CAU A;  1G9C A;  2VNO A;  4LLF A;  2YHJ A;  2CV6 A;  3H42 B;  2VZO A;  5HCA A;  2AZ5 A;  4XUO A;  3BIW E;  1UF2 C;  2Q5T A;  4OUE A;  5BNP C;  2JWP A;  4YZ4 A;  4Q8K A;  5A7S A;  4AZZ A;  2R04 2;  2DVG A;  4JCK A;  4XHB A;  4AVV A;  1XOY A;  3B93 A;  3BU7 A;  3PIG A;  2JIG A;  3U78 A;  2EID A;  3VKL A;  2FDI A;  2NM1 A;  3O1V A;  4XEZ A;  4IND A;  3PUH A;  2BNO A;  3AYE A;  3THT A;  1OA2 A;  3B3Q E;  5GZC A;  5A3L A;  4AQT A;  4AGG A;  1W8N A;  3POI A;  3LWC A;  3E5Q A;  4HFS A;  4XQ4 A;  4L8Q A;  1VBB 2;  2ZEX A;  2HKX A;  2RMU 3;  2J1U A;  5HPO A;  5JI9 A;  4FP2 A;  1U5Z A;  2R16 A;  1PIV 1;  4GKX A;  2VTF A;  4AL9 A;  2WBK A;  4D6Q A;  4IDZ A;  1OPM A;  3C7G A;  4IV1 C;  4OI4 A;  4UW6 A;  1CAU B;  1OUS A;  4YWA A;  1Q8Q A;  4LNV A;  3OPW A;  1U0A A;  2WA3 A;  3AMH A;  3K77 A;  4UFI A;  2FDG A;  4XCB A;  1T6B X;  1HB1 A;  1UY4 A;  2GC1 A;  2DUP A;  5GLV A;  4CDX A;  2B39 A;  2WUH A;  1GOG A;  5JOX A;  3GNE A;  1MS1 A;  3RFR A;  2OZ6 A;  3INA A;  5CFC A;  4CP9 A;  4CCJ A;  3O1P A;  3ZSE A;  3B9I A;  4K21 A;  1WCQ A;  2MNG A;  4Z82 A;  4YGB A;  5EHD A;  2CDO A;  3KF3 A;  3AZY A;  1XRU A;  1GNY A;  1VAV A;  2IZW A;  2YFU A;  2WO3 A;  1UMI A;  1ND3 A;  1YIP A;  1RUI 2;  2WT2 A;  2A3X A;  4MVT A;  1H0B A;  4DB5 A;  5JZG A;  5LWB A;  5FY7 A;  2RS5 2;  4RSU A;  4N9I A;  4XF3 A;  5C3O A;  3KGZ A;  1LHN A;  2F6B A;  3AJZ A;  3U37 A;  4FPK A;  2P6C A;  4GWI A;  4DPN A;  3SKV A;  4FOY A;  2VOT A;  4YW5 A;  4GXL A;  1ZNP A;  4PDW A;  4LPL A;  4UOJ A;  1X50 A;  1YXW A;  4LBQ D;  2UYB A;  3VBH A;  1AR7 2;  1A3K A;  3MW3 A;  1CR7 A;  1GV9 A;  2EIB A;  3B7M A;  3P3P A;  4FFI A;  4ISQ A;  4PIY A;  4S2H A;  2X05 A;  3ILN A;  5FPB A;  1S4C A;  1GYK A;  1RUJ 2;  4XFC A;  3AXE A;  5KXB A;  5FY1 A;  2WQZ C;  4IE7 A;  3RPQ A;  3ZXL A;  5EYX A;  5IVY A;  5H9Q A;  2UWB A;  4BXS V;  3QH7 A;  1PZ9 A;  1QXJ A;  5FRA A;  3GGL A;  3PUA A;  1ZBE 1;  3GJB A;  1DU3 D;  1IOA A;  3JQX A;  1JOD A;  3SKJ E;  1Q3E A;  2XG3 A;  4IQP A;  1W0O A;  1VBE 3;  5CFD B;  3CJI C;  2XLA A;  3U4X A;  1NYW A;  5C3Q A;  3AP7 A;  4QHZ A;  3OBR A;  5FDB A;  4CDQ C;  4AFD A;  3BOW A;  3A7Q A;  3F2Z A;  4H7M A;  5JVV A;  4GB3 2;  5FZB A;  4I01 A;  2F4L A;  2YB7 A;  4ZS2 A;  5FCC A;  5FYT A;  5IVV A;  1DYO A;  1IKP A;  3WNO A;  4COY A;  4PQ9 A;  4XUT A;  4A6S A;  3NNF A;  3Q8C A;  2HYX A;  5KBF A;  3H7Y A;  5ACA 3;  5APA A;  4ARY A;  4JC1 A;  4XBN A;  4DEQ A;  4IEV A;  3RMY A;  3SIT A;  1NQD A;  2PLV 3;  4B8E A;  4YZ5 A;  1PMI A;  4OHX A;  4GWJ A;  2Z5W A;  2JEN A;  2E7A A;  5FP8 A;  4I0B A;  4AHY A;  2R1B A;  4UT5 A;  5FIX A;  3WG4 A;  5C8C C;  1TMF 2;  4HLT A;  5FY0 A;  1D0H A;  4OUL A;  2HEY F;  4IEX A;  4R9A A;  5F2W A;  1BVP 1;  1SPP A;  3HBZ A;  5FYU A;  1RUJ 1;  2R0H A;  4UF0 A;  4CCL A;  3ZIW A;  1CZS A;  3NWK A;  4CSW A;  1WCU A;  5K7P A;  3D0S A;  4JDM A;  4TXW A;  3RI8 A;  5J36 A;  1XNC A;  3CMG A;  1U5Y A;  4Y20 B;  4YRD A;  5FZ9 A;  2GNM A;  4IES A;  2TEP A;  3U0Z A;  1CAX A;  2MEV 3;  3JD7 1;  3ACF A;  5JIA A;  2UUR A;  1Q8S A;  2LRP A;  1KS5 A;  2W2I A;  5DN2 A;  3LZZ A;  5EQU A;  4XUN A;  3UES A;  2VC9 A;  1NCR B;  5FK7 A;  4XJU A;  4YW2 A;  2C24 A;  1O5U A;  4L9B A;  4RHV 3;  3WD5 A;  4CCN A;  5BNO C;  4QKB A;  2ORX A;  4IE0 A;  1WME A;  5I0U A;  3UV9 A;  1NKG A;  3ZFG C;  4B1L A;  2BVV A;  2P1B A;  2LM3 A;  1QNW A;  3KGL A;  5A7O A;  4X6R B;  1QIQ A;  4YW6 A;  3J9S A;  4B4P A;  1PO2 2;  2GC2 A;  4UW5 A;  3BKZ A;  1CAV A;  1GZC A;  1K45 A;  1YIF A;  5F3I A;  3W58 A;  4BIS A;  4Q0Q A;  2XJV A;  3WVJ A;  3III A;  4JTO A;  2OPK A;  1TMF 1;  3CHX A;  1MVE A;  1X9P A;  1F15 A;  3R4D B;  5CG8 A;  1OBN A;  4KBB A;  4XJA A;  1MZ6 A;  1JUI A;  3V56 A;  4AED B;  1RVF 3;  3ZYG A;  1UY2 A;  3OEB A;  5DUV A;  3ZPY A;  1UY3 A;  2WLQ A;  2Q1M A;  2EAA A;  4QPG B;  4R9D A;  1AJK A;  3ZXF A;  4IV3 A;  4EYU A;  1KXG A;  2P2K A;  1IS3 A;  1PGW 2;  4Y1Y A;  3SH5 A;  3EB7 A;  1RIT A;  2PHW A;  1H2L A;  3OUH A;  4FVV A;  1VE0 A;  2YYO A;  1DHK B;  3UGF A;  1NZC A;  5BYN A;  5D8A C;  4IEO A;  2ZML A;  4FCA A;  3ZM8 A;  1QOO A;  1HKD A;  1GZW B;  2BGO A;  3EMR A;  2DU1 A;  5A3N A;  1RUC 3;  1SLT A;  2BV4 A;  2W92 A;  2ZKL A;  3AYD A;  4XJ9 A;  4NWV A;  5GLU A;  2VUC A;  2EXH A;  3B02 A;  2O1Q A;  1ZZ9 A;  1ZZ6 A;  4XDP A;  3N9P A;  1PO2 1;  4P9X A;  3NAP C;  1V6K A;  2VUD A;  3A0N A;  1SEF A;  1YFX A;  3NNM A;  1N1S A;  4C8D A;  4E2G A;  5J37 A;  2VCC A;  1JOJ A;  1DQ1 A;  1L7Q A;  5FZD A;  1NQJ A;  2YFZ A;  2WO7 A;  4I3G A;  4KH9 A;  4AFC A;  4KGQ A;  3ACH A;  1OKQ A;  5BNQ A;  4N43 A;  1DBN A;  3D4K A;  3POY A;  1ZM1 A;  2Q1F A;  2W39 A;  4L99 A;  1JZ7 A;  5FMD A;  1YFU A;  2UWC A;  3WQ7 A;  1BJQ A;  2XJT A;  3OY8 A;  4LE4 A;  2BOJ A;  3BN6 A;  5IK5 A;  1UN1 A;  5FPV A;  4QB6 A;  1RUE 3;  2A75 A;  1V00 A;  5CIR A;  3VKF C;  3WW3 A;  4CPB D;  1PGW 1;  1W0N A;  5CYY A;  4UBG A;  2VUA A;  3AYA A;  4MYE A;  3WW2 A;  3CU7 A;  3LGR A;  4YM2 A;  1TZO A;  1W99 A;  2G9G A;  5FJK A;  4LHL A;  5BUV A;  4AI3 A;  1WA4 A;  3FJS A;  1HXS 1;  1NY7 2;  4O9G A;  4R4Z A;  1X7N A;  1ULC A;  4NOT A;  5FP3 A;  2E26 A;  4IEQ A;  2X8K A;  4LBQ B;  2K46 A;  1XE7 A;  2GMM A;  1DZR A;  2ARC A;  4NIA A;  5AC9 2;  3IMN A;  1NT0 A;  3WZ1 A;  2DVF A;  4ARX A;  2Y6L A;  5F37 A;  1ND2 A;  3S5Q A;  4DMI A;  4DIQ A;  2OPW A;  4DNY A;  1JYI A;  1HRV 2;  5GJ6 A;  2GDF A;  1IS4 A;  3AL6 A;  4AVC A;  1Q8V A;  3N9O A;  3OUI A;  4UAP A;  1MS8 A;  4Q4W 2;  3LDK A;  2IFR A;  4MGK E;  1F4A A;  1F5J A;  3IDB B;  5LAT A;  3K51 A;  3RVH A;  5L9V A;  5IK8 A;  2Y6J A;  4P9W A;  4AEK A;  4BQ5 A;  1K12 A;  4KWJ A;  4IE5 A;  4QHB A;  4Y4Y A;  2Y26 A;  2KM2 A;  3MIF A;  3T1M A;  5FP4 A;  5FK8 A;  3UKT A;  4QXC A;  3FFZ A;  4NMI A;  5A3M A;  2ZHL A;  3HNB M;  3WOG A;  5KXE A;  2WWS A;  3LFI A;  4QQP A;  1H6X A;  2BBA A;  4CDW C;  3OOX A;  1YNA A;  1PGS A;  3J7M A;  3N7K A;  1DGR N;  5FAX A;  2ID4 A;  1NY7 1;  5GZD A;  1H1I A;  1VP6 A;  2ARX A;  3Q9O A;  4EN0 A;  5FBJ A;  2QQI A;  4ZPI A;  5DDJ 2;  4Q29 A;  1W8O A;  4Q27 A;  4QQ2 A;  4YNI A;  3OEA A;  4UFM A;  3POG A;  4Q1P A;  3RYR A;  4MV2 A;  1UKR A;  1G86 A;  2WZP P;  2JG8 B;  5DAV A;  1POV 1;  1ZBA 3;  4LK7 A;  1WD3 A;  3J8F 3;  2WZR 2;  2X5I C;  1T6G C;  2OS2 A;  1HB4 A;  1ZZ8 A;  3AKR A;  4XF0 A;  4COZ A;  4EE2 A;  1OMI A;  5FZK A;  5E8A A;  3LA2 A;  2FDH A;  1UAI A;  2XWJ B;  2Q8D A;  1J58 A;  1TME 3;  3NQH A;  4Q4W 1;  4X8N A;  3ZXJ A;  5FR3 A;  3IAP A;  1OA4 A;  4XFI A;  3HEI A;  3G6J B;  4BK4 A;  3HPN A;  3KQ4 B;  3LPG A;  5M0T A;  3N4M A;  2W91 A;  1EAH 2;  5KHJ A;  2PAM A;  2VMD A;  5FO9 B;  3LB9 A;  4Y5T A;  1PO1 3;  3ZYB A;  2W1W A;  1LU1 A;  5FQ0 A;  2OQ6 A;  4F3J A;  3D82 A;  3VBU A;  4CDU A;  1VBA 1;  1R1A 2;  1LGB A;  1O8P A;  2A70 A;  2ZAH A;  2BFU S;  4JQR A;  4E2S A;  1W6P A;  1N47 A;  1WKY A;  4MGS A;  4LBN A;  3T1L A;  1MS0 A;  3FL7 A;  2XQX A;  3MIB A;  4Z07 A;  5HBA A;  1G9D A;  1BEV 2;  3MV1 1;  4G3Y C;  3WUD A;  1LNS A;  2ZAA A;  4MET A;  4NPR A;  4S2G A;  4J6G A;  3THP A;  1WW5 A;  2B8M A;  3EBR A;  4FXK B;  5FP9 A;  4RFT 0;  5DDJ 1;  2WFF 3;  3PVE A;  1XNT A;  4I0A A;  1LOG A;  5T3N A;  1LJ7 A;  1QWR A;  5LAS A;  3AL5 A;  4Y1X A;  4A6O A;  4F7Z A;  1RIN A;  4NHY A;  3IN9 A;  4FI9 A;  3DN7 A;  2P37 A;  2HYK A;  3RNS A;  4CDQ B;  4YFZ A;  3WUC A;  2H6B A;  1DYK A;  5A33 A;  4KI5 M;  4PBO A;  1I3H A;  1GP6 A;  2EAL A;  2BGP A;  3HIF A;  3MBW A;  1ASJ 3;  1I1E A;  1GSL A;  2HWF 2;  4ZU7 A;  2RS3 1;  1UOG A;  5D2A A;  4X8P A;  3M2M A;  2CHH A;  3SCG A;  3W9A A;  3HQU A;  3C8X A;  1EAH 1;  1RUN A;  5FKC A;  4CYD A;  3ACL A;  4CXX A;  1REF A;  3AKP A;  1GQG A;  1UXX X;  2D44 A;  4AFA A;  1FV2 A;  1W2T A;  2D6K A;  2PHR A;  4V1P A;  4DS0 A;  2PHT A;  4JGY A;  1W6Q B;  3BB6 A;  2RR1 3;  1OLM E;  1QXR A;  1D0G A;  4YAR A;  5I8Y A;  4QKF A;  1BEV 1;  3FLT A;  3J7N A;  3VHP A;  1E5R A;  5IUQ A;  3V0A A;  3MI8 A;  5C71 A;  1JOP A;  3ZYP A;  5BNN C;  1SZB A;  1V6I A;  2A6Y A;  4S2F A;  5A33 B;  4RS5 B;  5FJH A;  2IXJ A;  5LZ6 A;  1NCQ C;  3WV6 A;  3ILF A;  4BU2 A;  1J3R A;  3D6E A;  1F2N A;  4KGG A;  4Z2A A;  4MSV A;  3A23 A;  4WZF A;  5JCT A;  3RS6 A;  2J42 A;  3AP9 A;  3WF2 A;  4M01 A;  1O6U A;  1WLW A;  3H1W A;  1GZ9 A;  1PM7 A;  3M1H A;  4W6X A;  4ORF A;  3CZU A;  3RJ2 X;  3T4V A;  4GJZ A;  4AWD A;  5JXH A;  1UIK A;  1X33 A;  3P6B A;  3VDD C;  2RJ2 A;  5J98 B;  3ALQ A;  1Z0H A;  4JGY B;  4CCO A;  3A0K A;  1JZ4 A;  4LKF A;  5LBF A;  2CY6 A;  2KR2 A;  2ADE A;  2RMU 1;  1S1A A;  4RGK A;  2FD8 A;  4JGZ C;  3MF6 A;  1VB2 A;  1WLC A;  2D5F A;  1GR3 A;  3E97 A;  5FYI A;  1UY0 A;  5JAX A;  4QQO A;  1DP0 A;  2G9Z A;  3N9L A;  1VR3 A;  3BPS A;  3WCS A;  2HEV F;  4I09 A;  5EXO A;  1MPX A;  2ZOE B;  4RR3 C;  3KZ4 C;  2VZU A;  4NIG A;  4K1Z A;  4OZX A;  3IMM A;  3WIN E;  2ZBJ A;  1BHG A;  1IQD C;  4QXB A;  4MLO A;  5F3G A;  4TLG A;  2HWD 3;  2VBB A;  3M7A A;  5BXX A;  2W46 A;  3WW4 A;  1DQ0 A;  5JOW A;  4KWK A;  4E9K A;  1QJU 3;  5A7Q A;  2IC1 A;  4Y4R A;  1PMH X;  3DPR A;  1CJD A;  2BRT A;  2WSV A;  5C5U A;  5FZC A;  2IUW A;  3H9A A;  3W5N A;  1S2B A;  5FZI A;  3NW4 A;  5DAP A;  5I93 A;  1JN2 P;  1T2X A;  4ITC A;  3BTY A;  2JG9 C;  1H2M A;  3AM2 A;  4HXC A;  3VBS A;  3LKJ A;  4RYD A;  2Q8C A;  3TRS B;  2BP6 A;  4AEM A;  2XDV A;  1VIW B;  3LEK A;  1ULO A;  1UQX A;  1AR9 3;  1US2 A;  2R32 A;  3R4U A;  5FZ3 A;  3T2T A;  1JZ8 A;  3BTZ A;  1LU2 A;  1OOP B;  3VKO A;  1CIY A;  5A80 A;  1F4H A;  1Y4W A;  1LGC A;  3BAL A;  4CE8 A;  1NX9 A;  2YPJ A;  2C26 A;  5DAX A;  3MID A;  5C4W C;  1SLA A;  2E9Q A;  3KV9 A;  1NZI A;  4MAD A;  1QJE A;  4CP0 A;  3WT3 A;  2B5H A;  3MF9 A;  1S0F A;  4BLI A;  3FFQ A;  1S2E A;  1CD3 G;  2VMH A;  3IAQ A;  3K4A A;  4RN5 A;  2GC3 A;  4NJ4 A;  5EJ3 A;  3S7E A;  5FMC A;  1LOE A;  2IFW A;  4HL0 A;  4W50 A;  5FPZ A;  4NUB A;  1XJA A;  3VD7 A;  4D6S A;  3SH3 A;  3I2H A;  1LES A;  5C9A C;  1LRH A;  1JYC A;  2QQL A;  4LHN A;  5F9T A;  1WZX A;  5T55 A;  5KC6 A;  1VBC 2;  2Q30 A;  2IXI A;  3VBS B;  4EN6 B;  3CKH A;  3WDV A;  2VZS A;  4LO5 B;  4OHV A;  1PX4 A;  5K9Y A;  4QPI A;  2W94 A;  1QQP 3;  2JDU A;  2PMW B;  1ZRR A;  3MV0 1;  3RSJ A;  3WHT A;  4R4X A;  4RA0 A;  3ITQ A;  4YM1 A;  1K5M A;  3ILR A;  2WNU A;  4K20 A;  1Q8O A;  4OLL A;  1C8N A; 
#chains in the Genus database with same CATH homology
 2VE1 A;  1W3X A;  1E5R A;  1W2A X;  1UOB A;  4XAE A;  1ODN A;  1RXF A;  2Y6F A;  1W2O A;  1E5S A;  1UO9 A;  5C3P A;  1W04 A;  1E5H A;  2DBI A;  2DBN A;  3OOX A;  1QIQ A;  1QJF A;  2VBP A;  4RGK A;  1UOF A;  1W2N A;  1E5I A;  1W05 A;  4BB3 A;  1HB1 A;  1HJF A;  1RXG A;  1W06 A;  1W3V A;  2JB4 A;  2IVI B;  1OBN A;  1GP5 A;  2VBB A;  1DCS A;  1HB4 A;  1W9Y A;  2VCM A;  1ODM A;  1HB3 A;  2IVJ A;  2BJS A;  2BRT A;  1OC1 A;  5C3O A;  1W28 A;  2JB8 A;  5C3R A;  1GP4 A;  1QJE A;  1BK0 A;  3ZOI A;  1BLZ A;  2VAU A;  2WO7 A;  2Y60 A;  2BU9 A;  1HB2 A;  2VBD A;  5C3S A;  5C3Q A;  1UNB A;  3ZKU A;  1GP6 A;  1WA6 X;  3ON7 A;  2CSG A;  1UOG A;  3ZKY A;  1IPS A;  1W03 A;  5APA A;  1UZW A;  1HJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...