5C3QA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and thymine (t)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
b'GSMEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymine dioxygenase
molecule tags Oxidoreductase
source organism Neurospora crassa
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3qA00
2BRTA 2DBNA 1HB3A 1RXGA 2JB8A 2VCMA 1QJEA 1HJGA 1UOBA 1W28A 1W05A 1E5RA 1W3VA 1WA6X 1GP5A 1W03A 1W06A 4XAEA 1W2AX 1OBNA 1W2OA 2VBBA 3ON7A 2WO7A 3ZKYA 3ZOIA 5C3RA 2VBPA 1BLZA 1UNBA 5C3OA 1RXFA 1UOGA 1W9YA 1QIQA 2CSGA 1HB1A 2VBDA 2Y6FA 4BB3A 1UO9A 1IPSA 1ODMA 2BJSA 2Y60A 3OOXA 1QJFA 3ZKUA 1GP6A 5APAA 5C3QA 1HB4A 1UOFA 2JB4A 1GP4A 1E5HA 1E5SA 1W3XA 5C3SA 1ODNA 1OC1A 2DBIA 2VAUA 2VE1A 2IVIB 5C3PA 1W2NA 2IVJA 1E5IA 1BK0A 1W04A 1HJFA 1UZWA 1HB2A 2BU9A 1DCSA 4RGKA
chains in the Genus database with same CATH superfamily
1GOHA 1UMHA 2OQ7A 4A3ZA 2UYBA 2HWC2 3ZYFA 3CZUA 4LIUA 4QHZA 1V6KA 2WO3A 4NJ4A 2YZ4A 4OMDA 1YWKA 5SV5A 1DYKA 4DO0A 1X50A 1UWWA 1VBE1 5HCFA 4EROA 3GF6A 3A7QA 5T5OA 4XCBA 2ZX1A 1LGNA 4PT6A 4CCOA 3AP5A 4UW3A 4AWDA 5GZGA 2NMNA 3K46A 4XF1A 2ARAA 1XB9A 2JDYA 4K3UA 1WUVA 1WMXA 2JENA 4QX7A 1A78A 4XUOA 4AEMA 1X9TA 1AR73 1DU3D 4PLOA 5APAA 1HDKA 4QQPA 4AL9A 1CIWA 1HV0A 1AR81 2DF7A 2W46A 3K51A 4RR3C 2VCMA 4W65A 3IT8A 1RVF3 2B9UA 2HKXA 2XBO3 1CAVA 5EXOA 4P00B 1JZ4A 1STMA 3F2ZA 4YFWA 5H9SA 1TQ5A 3PURA 3SNMA 3EQEA 1W0PA 1PVC3 1ZBA3 1F5JA 1EAH2 4CUAA 3BODA 1O3TA 2WN2A 2MPFA 3M3IA 3VBFC 3ZDSA 1SHWB 2WWSA 4FPFA 1HXS2 3RFRA 4EWAA 3T0AA 5IATA 1H4HA 2GMEA 3NNMA 4CXWA 2KM2A 1HW5A 1YJLA 4ZXKA 3KD4A 2XL9A 4OYUA 1ND3C 2WR9A 2RJ2A 2EVXA 4WM8B 4YGEA 1PO22 4QDSA 5FZMA 3ZYBA 2VH9A 3FLTA 5AVPA 5FXVA 1AR62 1XNBA 4LIVA 5C70A 5JWPA 5IK8A 4KWUA 4UAPA 2RR11 3FZ3A 2Y0IA 3B02A 3VL9A 2A75A 4LO5B 2RVAA 4QQ2A 4GQ7A 4D7YA 2XWJB 1GKBA 5CFCA 1DQ2A 2HWB3 4UFIA 1V9U1 4MOAA 5DMYA 1VALA 4IEWA 1UXXX 2D6PA 3CLPA 1DIWA 4AI3A 5J3UA 1IPJA 2WRAA 4JTOA 1Q8PA 1LRHA 4W50A 5H9PA 2O0OA 2VZ3A 5F2SA 4P5HA 4PJYA 3H8OA 2PXJA 3N9QA 5EHDA 2J1TA 1OPMA 4NHKA 4WM8A 3O1RA 1CWPA 3CQOA 2QQUA 5ACA1 3J7MA 1HRV3 1TNRA 1RJ8A 3KCYA 3U07A 1UKGA 2ZKNA 1N1YA 3S5QA 3C7OA 3AL5A 4HOOA 3VHNA 2HLEA 4MGKE 4Y1VA 2HEVF 2WABA 3N9MA 1F8VA 1D4VB 4RS5C 2XJSA 4PDWA 4BPZA 1AR93 1XU2A 1D0GA 3POYA 3U78A 4WM7C 3BTAA 1NZIA 2X29A 3C7HA 3NQHA 3GCWA 4CEWB 3MIEA 4AFAA 5FZOA 5FZGA 5JI7A 3VB9A 3RS6A 1A8DA 3JB8A 4AI1A 2XUEA 5IVJA 1VB4A 3APBA 3OBRA 1UU4A 4FPHA 1ENRA 3JZVA 1AYM3 4PCRA 1LOAA 2VPVA 5F8PA 2ZGPA 3OUJA 2PAEA 5BXXA 4CCDA 4Z8BA 3E6DA 2A6VA 5CA6A 4FOVA 4OI2A 3RZKA 4MGTA 5FAXA 2WNUA 3POIA 4JDOA 2Y6JA 2VXJA 5B4XA 4JDMA 3W20A 1VBB1 3O1PA 2CAUA 1POV0 3ZKYA 1YFYA 3ON7A 3VBHB 3CL1A 2VNRA 1ZBE1 2XOMA 1TME1 4C90A 2QNKA 3AFGA 4AVSA 1BBT3 2RS53 1QJX1 2VXRA 1A3KA 2P3IA 4LORA 4BISA 3NJZA 3AP9A 1XBFA 2HWC3 4Q4V1 2LS6A 2GP3A 3T4HB 3KV6A 2V09A 1ZRCA 1R081 2D98A 3S6PA 4ATFA 4ASLA 1RHI2 1RTVA 1ULEA 1OH4A 2DCTA 2VQUA 3RMYA 1W0NA 2ATFA 4P9JA 4COYA 2GC0A 1JUIA 1XE0A 1S55A 3Q8CA 4XF3A 3VKOA 3H7YA 3HN1A 3LF7A 2ZACA 1VE0A 3RYRA 4QX5A 1F9KA 3MLKA 3N9OA 4GJYA 5GZCA 1W28A 3DKWA 1OBNA 3D3AA 2J22A 5C4WC 1CPMA 3ETPA 2ADDA 4PLMA 2QQPA 1O91A 1RUC3 4KBBA 2P6CA 2VBDA 1GNHA 4EQVA 2IXIA 1SLLA 3S5AA 4EE2A 1DF0A 1BKZA 1ND2C 2CAVA 3MGUA 3OGVA 5EZWA 2VNGA 4GH4C 3VKFC 4HETA 2HWD1 4R9BA 5C3SA 1P8JA 1RGSA 1G6NA 2PLV1 3DGTA 3M2MA 3KS7A 1MS3A 1RVF2 3WDTA 4YVSA 1DYOA 3Q8AA 1REFA 1REEA 2DU0A 2Q5TA 1XNCA 2ENRA 3M4FA 5GLZA 2CL2A 2VM9A 3SKJE 3WEZA 1SFNA 3WHUA 4AQ6A 1MZ6A 2YY1A 1MR5A 4HZFA 2JG9C 3LA2A 1IPKA 2G9GA 4YGDA 5IVBA 3O1VA 2OKXA 3VN4A 1I1EA 2OPKA 5GZDA 4GA9A 4QXKA 1BK1A 5GLWA 4JGZB 3BPZA 3WV6A 5IW0A 1RL3A 2G4IA 3KQRA 4FFHA 1ZZ9A 2KD7A 2PAMA 3AXDA 1AR63 3BVCA 4J25A 4ONUA 4TLFA 4RS5A 2O8OA 1R1A3 5DXDA 1DQ4A 1ENXA 2EXIA 5FY5A 1M4WA 4UI9L 3WNXA 5FO8B 2BRTA 1H1MA 1WCSA 3K2OA 2JB8A 3FHIB 1LU1A 3C7GA 3MDPA 2BWAA 1W6QB 4IV1A 5EJZB 3TN93 3DPRC 1NOVA 4DUWA 1OQ1A 4CDXB 2ZCWA 4NRMA 1C8NA 3FLPA 4BQ1A 4X6QB 5FR3A 1EV12 4CDQC 3IPVA 1SBFA 4CP9A 3FX3A 3OUIA 4NE9A 1JU4A 5EFUA 4META 4I3PA 2WT2A 3LDBA 4Q4Y1 4CEWA 5KWRA 3X29B 3KB5A 5C9AB 4AVVA 1MEC2 3OG2A 3DUIA 3T30A 1RVF1 5FJKA 5LK5A 5FXXA 4CDWC 1RUF1 1SQ4A 3FLRA 1DZTA 4XUTA 5FLHA 4AI0A 3ZOIA 3ZFEC 2P2KA 2PQQA 4Q0UA 3VL8A 3AZYA 2R063 3EXUA 3T2TA 3UJOA 1D2SA 1VBA2 2RS32 1UZZA 2W2IA 1SCSA 1BEV1 2A6WA 3H0OA 4XILA 4AHXA 2NP0A 3WT3A 3P1IA 3NNLA 3VKMA 3W21A 4Q4Y3 4Q4X3 4ZXEA 5JIAA 3GZEA 3BCWA 5LBCA 1ALYA 4QKBA 1S2BA 2VC9A 1HN1A 2LM3A 2YC0A 4HVOA 1OOPC 2WFF1 5KXCA 1QJZA 2Z2SB 2XH6A 3ZYJB 4L8QA 1B35B 2X53S 2VOTA 4QQLA 1YFWA 1GWKA 2WJSA 4TXWA 1V0AA 1C4RA 3G6JB 3IDCB 2RHPA 4N9IA 2RDNA 1GICA 3CMGA 3KT4A 4X6RB 4DXTA 3PU3A 4AAXA 4CEYC 2UYAA 2XJPA 2FD8A 4XEZA 4YYOA 1Q8VA 1JOPA 1AL23 4GB32 2YU2A 3ZX7A 3SH4A 2Y8KA 1US2A 5FZAA 3VBSB 1OXCA 2VW2A 2VZVA 1UO9A 3ATGA 3POGA 3Q8EA 4IV3C 4LA3A 4KQ7A 2JJ6A 4UYBA 3J26N 3WP6A 4URTA 2FDGA 1OURA 4INDA 3U14A 1W2UA 1W6PB 4Z07A 1D4M3 4I02A 3B7MA 4LO4B 3KSCA 4QPWA 5FUPA 3TEWA 2VW0A 2VVFA 3ETQA 3VBSA 2IZWA 4O9EA 1J83A 3ILNA 2JIGA 2VVDA 1S2KA 4H55A 5GLTA 2VZUA 1IOAA 4Y22A 4LPLA 3NWKA 4C91A 2EIEA 1RC6A 4KG8A 4QKDA 3RJ2X 3VBUA 1HLCA 3O0VA 3CHXA 3LA3A 2ZTNA 4XE9A 5LY2A 1VAVA 4RQPC 1U0AA 2VOWA 5ISLA 3LFMA 5I0UA 5L9VA 1NZCA 1WZXA 4XJZA 2Q8OA 2FDIA 4HSLA 1NX9A 4S2HA 4DUXA 3ZKUA 1LOFA 4MZUA 3LQCA 2HEWF 3SCGA 2YDEA 3VHRA 4XFGA 5JPNB 1US3A 4GULA 4HG6B 4QPGA 3O1SA 4HK9A 3KMHA 1CR7A 4IEQA 4RHV1 4BU2A 2WA3A 4ZS3A 1Q8OA 2H0BA 1JBCA 1UY1A 2OW4A 5A80A 2WNVA 4A7KA 2XJQA 2YB7A 3VHPA 1RUC1 4FTEA 5L7OB 4FFFA 3AK0A 1YI7A 4JGYC 2E7AA 4N53C 3JQXA 5KXEA 3UGGA 3D5OA 4PBOA 2PFWA 4DEQA 4PHZA 4HVQA 1COV2 1TNFA 3M3OA 3M1HA 1SBEA 2ARXA 4FPKA 1W39A 2AGSA 2WLPA 3GJBA 4LHSA 4M0NA 4Q4V3 4K40A 5A6QA 4XJ9A 1ODNA 1FAYA 2WQZC 3TN92 3NRUA 4QHOA 2VZPA 4FT8A 2YROA 4WM7A 3K4AA 4UFJA 4XTMA 4KWJA 4XFCA 3HJRA 4Q4W2 5A1LA 5HPOA 5BNOB 3Q8BA 1UZYA 1EV13 2VCAA 1RUJ2 3HT2A 4YW6A 5I0SA 3EBRA 2FMDA 3MW2A 4BJ0A 2YYOA 1HIXA 2ARBA 2ARCA 3AZWA 2W5FA 3RPQA 1Q43A 4MX3A 3UJQA 1KEXA 2LUWA 4Q26A 5DDJ3 3V64A 1MZFA 1XOYA 4XACA 4NROA 1NA1A 1FX5A 3GXUA 3BUCA 4FQZA 1XNAA 4KGGA 5CU1A 4M01A 5F32A 2GDFA 1JUHA 4K9SA 2YXSA 5FYCA 4R52A 3BU0A 4K1YA 2YHJA 3AMNA 4QU2A 2KXLA 2VGDA 2E63A 4C1WA 4GWJA 3VZNA 4CP2A 3A21A 5L19A 5L9RA 2GN3A 2EAKA 2NLRA 2TBVA 1WBFA 5IAXA 1VBA3 2RS33 1GP5A 1NCQC 1TMF3 2BWCA 1RUE3 3PDQA 1CIYA 4L9BA 5IAVA 3KCXA 3QLQA 1LHUA 5FZ1A 4DXZA 2YGLA 1YEWA 2I74A 1YRZA 2XJRA 3JCIA 1KFUL 3ORJA 3LE0A 2CV6A 1V70A 2R042 3R0RA 1Z7S3 3KWVA 4CUGA 5CISA 4HANA 1JMUB 2ZGRA 3OPZA 2RM21 5FDBA 1W6PA 3K3NA 2WKKA 2VOVA 3CNAA 2EXJA 3S7EA 1I3HA 2GNTA 1APNA 4A45A 1NLRA 3RDIA 5FWEA 2OQ6A 3KV4A 2VY0A 3QH6A 5ABJA 3KV5A 1BEV3 5K8SA 4GALA 1TE1B 1DZQA 4CU6A 4Y22B 4YG3A 4CUCA 5C5TA 3OGSA 2ERFA 1VRH3 2JE9A 4XJWA 2YBSA 3F95A 2X05A 5AC91 1HXS1 3NAPA 1CJDA 2WL1A 1IG0A 1E5HA 1SPPB 2KR2A 2W0XA 3N7MA 1JW6A 4XUNA 3TB0A 4A6SA 1CONA 4H2AA 1ULFA 5BNPA 1IQAA 3ST7A 4FPGA 2XLFA 2O14A 3MI8A 5A3UA 1W6NB 2PHFA 3H1YA 3MF6A 1JYCA 3D0SA 4S2FA 3ZMOA 4YM2A 1FPN1 4E2SA 3PUSA 1JHNA 4NIAA 4P9XA 4QPIC 3I2HA 1VBD1 1YQ2A 3CBNA 1KITA 2DVAA 3A23A 4NN0A 5CFDA 3SCFA 4ZU4A 1UY3A 4ASMB 4WVMA 3MFAA 1LOCA 4QXBA 4U36A 5I91A 5KBFA 1JOJA 1QIQA 1HB1A 3A0NA 3GJAA 1XJAA 3U4SA 5LZ6A 4FFGA 1RMU1 4M3CA 4NAOA 5CG9A 5FK8A 1LHOA 2ZHNA 4Y4RA 1U5ZA 1QXPA 3J7LA 4GKYA 2BGCA 1J59A 2Q8CA 5JOWA 3MIGA 2VZ1A 3J9SA 4HXCA 4IV3A 3BTXA 3LOBA 3AXEA 4ZS2A 5J36A 4YW3A 5JUVA 1NA1C 5FREA 2GH8A 4E4DX 1FOD2 2ZGUA 4OZOA 5BNNB 1G9DA 1LESA 4IERA 1JYXA 1JHJA 2RMU2 2RDRA 4H7LA 2JDNA 3UT0A 1GZTA 2JKBA 3WUCA 4UT5A 2MEV1 3MV01 5IVCA 3CJIC 2CGPA 2NN8A 2XLAA 1XYNA 3TYJA 4A44A 1LAJA 2QQKA 2QTWB 5A3PA 3N7KA 1PVXA 1POV1 1RMU2 1Q8SA 2BGOA 2D6NA 4QDRA 4CUBA 5C8WA 3FWEA 4LA2A 4AHWA 1OD3A 3ACFA 5T52A 1X7NA 3THCA 2GU9A 4NVPA 4CDUB 2CWSA 2IXLA 5F3IA 1WMEA 3DYMA 4IL7A 3HT1A 1FXZA 3TEXA 1EPZA 3K4ZA 3W5NA 2Q30A 2RS12 4XXPA 3HN3A 5AFEA 1H2LA 1JODA 2HBTA 5J37A 1PIV3 1BZWA 1DHKB 5LBEA 3WNNA 3ZXLA 2XUMA 3AB0A 5FCCA 2QDRA 4JGZA 1W03A 1WGPA 4V2VA 3JD73 5FPLA 1EY2A 3TEZA 2R6QA 5A7WB 3BYWA 5T5JA 2HWB2 4PF1A 4XJAA 5C3RA 1QJX2 3V0BB 2R0FA 1TME3 1I9RA 1VIWB 5H9RA 2WNVC 4L0PA 4Y26A 3MLJA 4XFAA 1QQP1 4LBMA 4YW4A 2GH2A 2PYTA 2FCUA 2WQ4A 3WNKA 2RDSA 3WQ0A 3AMPA 2A3XA 2AEZA 3MICA 4OMCA 1RUI2 4OLLA 5F5CA 1J1TA 3D8CA 5FBJA 2QE3A 2A6YA 5FY1A 1SCRA 2EIGA 1GWMA 2ZXQA 2RDQA 5EP9A 1XC6A 5C71A 4RN5A 3ECQA 3VV1A 2XQXA 4ZPIA 3I2OA 3NAPC 5K9YA 4TSVA 1KFXL 3I59A 2Q8DA 1W3VA 4LLFA 3PUHA 3MF9A 2JDAA 2H0VA 1PGW2 3VD5A 2DWRA 2XG3A 3T08A 3GBWA 1YQCA 4B4PA 1NE6A 2JDUA 2VOKA 1FMD2 4YVSC 3NKTA 1UOGA 1HQLA 2BDRA 1Z7S2 3VZKA 1K5MC 1ZBE3 1WA4A 5EJ3A 5GZEA 4FI9A 3OOXA 4QQOA 3OEBA 4XHBA 3E1F1 2A6ZA 2E9QA 1R093 1ASJ3 3MIFA 4LLOA 2L9LA 2ZJCA 4H14A 3BOPA 5CIRA 4IEPA 2HEYF 1SLIA 5FYIA 1W2NA 3E5QA 3J8F1 1DGWX 3Q8FA 3TOJA 3QOPA 4IE0A 4YW7A 3VD9A 3M70A 3RZMA 5JLVA 3BALA 1CQ9A 4MGZE 2K2SA 3ZFFC 5C5UA 4PLNA 4K1ZA 5AVAA 3PVOA 3ZN4A 4RD7A 1GZCA 1R1ZA 3M3EA 3VBOB 4COVA 4PIXA 3WY6A 1PO12 4YFZA 1W9TA 3JQWA 3E5XA 2BOJA 4JKMA 4JDNA 4GXLA 3RWKX 4ZKTB 2HWE3 2PHLA 3IAQA 2G1MA 4IGQA 1UYYA 3B69A 5K0UB 3S0MA 2DV9A 4LT5A 2JB4A 4NOTA 2JG8C 1CD3G 2HH9A 4RA0A 4DS0A 1H8TB 1AR61 2W1QA 2Y26A 4DB5A 1LU2A 1UPIA 1MQTB 3RZLA 3KT7A 4LK7A 4N8MA 2EALA 5IFTA 4IESA 1KGYA 4JVAA 3RMXA 4P9LA 4XBNA 3URFA 2GALA 5FZOB 2GNBA 4UW6A 1OKQA 4KG0A 2W92A 1WBLA 5A6ZA 4FVVA 4Y33A 5FTTC 4XDPA 4XYXA 3DCQA 2D6OX 2EICA 3FN9A 4I0BA 3WG3A 3ZXDA 2KA3A 1MS4A 1ND3A 5FWJA 4F7ZA 5HXVA 1OPOA 3POEA 4CXYA 1OVPA 2RG4A 5FMCA 5JXHA 1KD7A 4LOSA 1W8NA 4UXAA 2J1VA 3IWZA 1UZVA 2FZ1A 2JKXA 3H1MA 3FHQA 2J1SA 2Y6GA 2PHUA 4W6YA 1AR72 5T5PA 1WW5A 1YI9A 3KHCA 2P34A 3LEGA 5C7GA 2RR12 2ZGKA 2Y38A 3B00A 3EB7A 4XIOA 2IWGB 1MEC1 2Q1FA 3B9IA 1W9WA 4EWEA 2WIIB 1QJY3 3HBKA 3ZR5A 1ZRIA 3AVRA 4AEJA 3U0ZA 3P3NA 2Q0AA 4DNYA 1LCLA 1S0IA 4XQWA 4B1LA 2PA7A 3IKWA 4CXXA 3T2OA 1TMF1 4BLJA 1DBNA 2MEV2 1EAH3 5FZCA 1AYN2 2RS13 3PTYA 5A7WA 2E31A 2R071 1R1A2 3RVHA 2D40A 3J7NA 3ZIXA 4QAWA 1DCSA 1XU1A 1J3RA 3THPA 5ACA3 3ZR6A 1RB8G 3N9PA 2BEOA 1PO23 2BNOA 2RM23 2VMGA 3LIHA 4M3CE 4XMAA 1XPWA 1QJY1 3DYOA 3HMYA 2OZ6A 5FO9B 1V00A 3MV11 1UY0A 1VBE2 5FYBA 4NHLA 2BOIA 3ACHA 3NV2A 4LK6A 1C28A 1TVGA 2VULA 4YZ4A 3PMEA 5FZIA 1RUI3 3QD6A 3UETA 4BK5A 1CGPA 3ACIA 5JMOA 5ABJB 4M3CB 1F5FA 3M3QA 4YVWC 1ACCA 4KWLA 4HVRA 1TG7A 4AI8A 5EIYB 5JPMB 2XB6C 3C3VA 1HB4A 3PHMA 3PTRB 2I45A 4L2NA 2R1BA 4NPRA 2ZHKA 2CDOA 2WNOA 5FYMA 2C9AA 3ZN5A 1LEMA 3DKQA 3AC0A 1GSLA 1UF2C 5CFDB 4Z2WA 1QWRA 1OLQA 5IYYA 3TNQA 3ZDVA 2ES3A 3R4SA 5F5AA 4AEKA 4E27A 4DMIA 5DN2A 1ASJ2 2VTXA 4LUMA 2NPIA 4FTBA 1NYWA 5L73A 1GBGA 3L9JT 2HWD2 3ZYGA 5FUIA 1CAWB 2TNFA 4BCUA 3H3UA 1BBT1 1ZZ6A 2RS51 2W9XA 1JH5A 1OF3A 4Q4Y2 5FZ3A 4NIIA 3DYPA 5F3CA 4CDXA 2JICA 1AF9A 1S0GA 2ZAHA 4IEZA 3RQ0A 1RUD2 3ME2A 4O61A 5A32A 1WCKA 3D6EA 3OGRA 5DUWA 1YFXA 1HJGA 2HWE2 3WW3A 1JU3A 1QJU1 4R9AA 2JE8A 3WNMA 3TAYA 1LGCA 1H1IA 4GB33 2D3RA 1QQP2 4GWMA 2P3YA 2Y64A 4K21A 3DN7A 2QQIA 2XHNA 2HWF2 3LB9A 3H42B 4KI5M 3VBHA 4J6GA 4PF5A 4YZ3A 4CCNA 3AM2A 3NL1A 4DINB 2NMOA 1MVEA 2VOXA 1T6GC 4BXFA 5A7QA 3ALQA 1V6MA 1K12A 4FBFA 3AKRA 3VBOA 4Y5Z0 1UX6A 1W2TA 4Y1YA 4MXWA 5C3QA 1F4HA 2C1FA 2ZEZA 1C8M2 3AX4A 1PK6B 2BVVA 4MVTA 4QM9A 3EO6A 2AYHA 3KM5A 3LD8A 3POFA 2E51A 4AQTA 1YXWA 4AFBA 5J96B 4FTSA 3POBA 5I8SA 3VBFA 1OLRA 1XNKA 4FSJA 3PJYA 2GZWA 1RUG3 2D5HA 1RIRA 2D97A 5CVRA 5E89A 1Z7S1 3ELNA 3OD4A 4HKOA 2VZOA 3OCPA 1S0JA 3DPRA 3I2JA 3GDBA 1PVC2 1ZBA2 2ET7A 5FYSA 1JZ5A 2W91A 2ZX0A 1R1A1 4FCAA 5FZHA 1LJ7A 3RRDA 3NNGA 1OSGA 2DURA 3PVBB 4YPJA 3TN91 2EF6A 1Y3TA 3B5LB 4GIQA 4XTPA 1AXKA 4FO9A 5HI0A 4WM7B 2BW8A 2CGNA 4O9GA 4Q27A 1AX1A 4ZU5A 4F83A 4CEWC 2XWBB 5EYXA 5JIUA 2WZPP 3KCCA 3IPVB 5DUXA 5GLUA 4LJHA 5FYZA 3SEEA 3SEPA 1NQJA 3INAA 4Y20B 2ZA9A 2BBAA 3NV4A 5EYYA 3RJRA 4E4HA 1D7PM 2DFCA 4Q4V2 5DAWA 1NQDA 2VMHA 3MW4A 3POSA 4QPYA 4A7YA 5ACA2 3ZFGB 2IUWA 2XJTA 4OI1A 2WNUB 4EZHA 1LODA 1SMVA 1W04A 3OGJA 2VECA 3GM8A 2PHTA 5GLVA 2BU9A 1VBD3 2OZJA 1OH3A 3WVJA 3H50A 3VBHC 4XQDA 5DG1A 3R4DB 1D0HA 3IDAA 3PL0A 4Q8LA 4P9WA 4RGGA 4FXGB 2VG9A 1HRV2 1GQGA 2J1EA 1QDOA 4ET7A 1UMZA 4K20A 3WP5A 1A6CA 4GMP3 5K0UA 1YQ5A 4CZSA 2W39A 3PUQA 4URAA 2E33A 4LITA 2W1SA 5T54A 1ENSA 1CAXB 4YW1A 1F2NA 3HQUA 5C4WA 1DLLA 3USSA 2W52A 4JRLA 2WAOA 1GOGA 5DAVA 4A41A 2B46X 4HT1T 3ZSLA 2GMMA 2VE1A 4IEXA 1W8ZA 1S0CA 1MZEA 2P37A 1HJFA 1CAWA 2AZ5A 2K46A 4P5YA 4AF9A 4NR1A 5C4WB 1MEC3 1ZVFA 1JYVA 1GANA 2ZZQA 1QOSA 1GFF2 5FXWA 3MZHA 2WZEA 4O7XA 1O4YA 4LKFA 4D3WA 1QGLA 3VZLA 1UIJA 5F7UA 1AXYA 1YNAA 4RGAA 2V5DA 1TZOA 4LULA 2VL4A 1XRUA 2UY9A 3WDUA 3AYEA 2R062 2HWB1 4AEDC 1EP0A 5FQ0A 4DIQA 3GZUC 4AQ2A 2OA2A 1BHGA 1JS9A 4DFSA 3ZSJA 4F8AA 3PJQA 4Y1UA 2PN5A 1V6JA 5KHGA 2XLGA 4FOYA 1AL0G 5C3PA 3IB3A 2GC3A 5AC92 1PIV1 4CYDA 5F5QA 4W8JA 1O3QA 3N7JA 2QQJA 2FDKA 5F5IA 4JQTA 2BQPA 2JG9B 3ZYHA 1H0BA 4CTEA 1OQEA 5FPUA 3R4UA 5LATA 4XF9A 2XR4A 5FP3A 4AI2A 2HWF3 1MACA 2WFPA 3WF2A 2VMFA 1KJLA 1SDWA 4TN7A 1UL9A 1PK6A 1W2AX 3LOIA 1BEV2 4Q0SA 5EPAA 2RJKA 5I0TA 1L3JA 1AL22 2QQLA 2F6BA 2OT7A 1MS5A 2J7MA 4IV1C 3AMMA 1ODMA 5FPAA 4EN8B 1NE4A 1DGRA 3NJYA 5FZLA 4CDUA 3W5MA 1QKQA 1JXNA 3THTA 3KV9A 1FMD1 5JOYA 1C8M3 3A0KA 5DUVA 3ZSMA 4BIOA 4MHUA 4QHBA 4I0AA 4FPLA 1ULOA 4BLIA 4LUKA 4OHWA 2GC2A 1ZREA 3HNMA 2BPA2 5FZ6A 3DPRB 1UMIA 1AYM1 4E9KA 4CDXC 1V6NA 2VMDA 1V6IA 1PX4A 4RHV2 5FQ0B 4AK3A 1RUG2 3WDYA 1REDA 3VZMA 3GNEA 4EN7B 2BVBA 5BNNA 4CDQB 2ZZJA 4G9SB 2W3JA 3MUY1 3LPFA 1Y9QA 2JIJA 3FFQA 4CCEA 4RYDA 4LBKA 4DEVA 4NRPA 3JXSA 1POV3 4N9HA 1JYIA 2VCBA 5C9AC 1JTZX 1VAMA 4JRAA 4MXVA 1MVQA 1H2NA 1W8TA 3EYPA 2DBIA 3N7LA 3OY8A 4N43C 5FKCA 3LDKA 3WLUA 5JAXA 1VBC2 1BK0A 2PAKA 2OPWA 3O5SA 4MGIE 2B7YA 1JZ7A 1QH6A 3WDWA 2B42B 2ID4A 4UWDA 5E1RA 1HRI2 4LBLA 1W6MB 1QNWA 3PUAA 2O1QA 1PHMA 2MNGA 4V1PA 3RYKA 1G9AA 5JCTA 1PZ8A 4I01A 4FPJA 4O65A 1YIFA 1OI6A 1S0EA 5BNPB 1VMHA 5A3OA 5FY7A 2Y6HA 4YM0A 2YFUA 3I4IA 5BPXA 4OQ8A 3KGLA 1O6UA 1ZNPA 1NLQA 3CDZB 1OOPB 1Q56A 1SBDA 4RR3A 3WD5A 2OX0A 1KRIA 1AX2A 1B35C 4PDWC 1OUXA 3I3DA 1E5SA 4XJUA 4UBHA 2VTFA 1MS0A 3WP4A 4C1XA 4D94A 2AC1A 3N35A 3O1OA 2FMYA 5I8TA 3OTFA 2B39A 2ZHLA 2PELA 4WZFA 5A6XA 4AEDA 4CEYB 2JD9A 2ZABA 2D7FA 1W8OA 5HXMA 5JDBA 5DZFA 4YGCA 3FMGA 3VBSC 1X9PA 4LBQA 1SPPA 4A6OA 2XDVA 3PVEA 1HN0A 1QXJA 1RUG1 4NPMA 4ARYA 1NCRA 4Y24A 4N7IA 3EHKA 4QX3A 4MG2A 5IVFA 2WZR1 2OUJA 4AHZA 3KHBA 3WF0A 1O59A 5H9QA 2VMEA 2W1UA 4Q29A 3E6CC 2DCYA 2QVSB 2ZGLA 4HK8A 3LSEA 4LBNA 3WQBA 2N7GA 3VDDB 3MFCA 2IVJA 3K75B 3MEPA 1LTEA 2PHDA 5IHRA 5JXGA 4AAPA 4WBBA 1R082 2GN7A 2IFRA 2F4PA 2B4KA 1LNSA 2JEMA 4RQPB 5A1FA 5FMOS 1AL21 4IETA 2XXZA 4UF0A 5FIXA 3IM0A 4FOQA 1W2OA 4BXSV 4Q5OA 1OLME 4XFBA 5LWBA 5K7PA 4QPIA 3ROUA 3UKTA 5AC93 4Y1XA 3KLSA 3H8UA 1PO11 5IVYA 2G9FA 4XBQA 4JV4A 1N1VA 5LK7B 1JYTA 4LBQD 3N3HA 3VBUC 3N9NA 1IHMA 3PUIA 2K9ZA 1GWLA 4RSUA 1J84A 5KC5A 4V2WA 1SLBA 2F17A 3D4KA 5L9BA 4R4XA 1Z0HA 4CVUA 1DQ5A 1CVNA 1WMFA 5FK7A 2X5IC 1BMV2 5FZ7A 4IGPA 3BIWE 4JGYB 4KMQA 4N53B 3HAGA 4ZONA 3L2HA 1L7RA 4OUEA 3AMQA 1NCRB 2C4XA 4XAEA 2Y0OA 2EXHA 2DYCA 4TWTA 4Y20A 4YG0A 1W8FA 1YC61 3CO2A 2DUQA 3SLIA 3HD8B 1EYBA 3U10A 4BQYA 1AR91 2BFUS 4XFHA 4BB3A 2WSVA 1OKOA 2DDUA 3AZZA 1W8HA 1H9WA 1LGBA 2ZX3A 3GHNA 3WHTA 2R073 3JB4C 4IUGA 4GAZA 4YRDA 1Z78A 2LALA 4FPCA 2QKDA 1MPXA 4LKSA 4DY5A 4RHV3 4UF0B 3LA7A 1J3PA 5BNOC 1DFQA 5FZ8A 3WW1A 2VZQA 1RITA 1K5JA 2YPDA 1HQNA 3OY8B 1DGWA 4AYUA 1MS8A 1SACA 5A3MA 2Y33A 4YVWA 1UOBA 2DVBA 4XDOA 1B35A 3RZHA 1PO21 5F39A 5IK7A 4H3WA 3B93A 5C8CB 3WF4A 1QF3A 2BNNA 1X33A 2E53A 3D82A 1CAXA 1PM7A 3AKSA 2RE9A 4WVZA 5FFOC 4CU8A 2VTXJ 1RUI1 4OHYA 2CWMA 1O5UA 4LKDA 1W0OA 4UFMA 3DXUA 3HNBM 4QGNA 4MV2A 4D7TA 1EAH1 1GOFA 2ZGTA 3GYDA 5CFCC 1NY72 3I3EA 4Q2FA 3UL2A 4XUPA 4AE2A 4CSWA 3K48A 1UU6A 4YGBA 5FP8A 5FKBA 3K77A 3U4XA 4EV0A 4IEOA 1NCQB 1XE7A 1M06G 3WNOA 4BQ4A 4C0BA 3ZXJA 3ES4A 4GZ9A 3V0BA 5J7MA 2HJIA 4AFMA 2W94A 1E57A 3OEAA 2ZX4A 3V0AA 1JOBA 2VBPA 1OVSA 1CESA 2SBAA 3S57A 1W8WA 1GMMA 3ZN6B 2EAAA 3W59A 1UU5A 1GQPA 1IS3A 1AUYA 1G86A 2GNDA 1GZWA 1VMFA 2XKPA 3MPBA 3B01A 1UQXA 1H8TA 4J1WA 4XF4A 2WC2A 4OULA 4HPKB 1XNDA 3J8F2 5GJ6A 5LEKA 4ISQA 4ZU7A 1H4GA 5G05L 1FOD1 5I8YA 4NMIA 1LHWA 3LDRA 1K5MA 3NNJA 5SV8A 2UU8A 4XUQA 4QX2A 1NUKA 3MBWA 1F4AA 1PZ9A 3RGBA 5IWFA 3ASIA 2DBNA 1PIV2 3DECA 3WOGA 1ULDA 1X36A 3WX5A 4LBOA 3VDAA 5JSOA 4GB31 4YARA 1UZ0A 3PVNA 3B94A 3ILRA 3JD72 5T3NA 4AHYA 3AP6A 1IS5A 3N36A 5CB7A 2HWF1 4KH9A 4K7JA 5HBAA 1BLZA 1QJX3 1WW6A 3CIHA 2CNAA 2PHXA 2IXKA 1TME2 4IEVA 1YO8A 2ZX2A 1DZRA 5F9TA 3T09A 2PQSA 3UK9A 2XVLA 4QM8A 3GCXA 4LO8A 4MH0E 1RUE2 3IDEA 3RYPA 4SBVA 1R083 3EJKA 5E16A 1PMIA 5T55A 4LNVA 1IKPA 5FMOL 5CBLA 1VBC1 1ULGA 5D1IA 3SMHA 2TEPA 4OHZA 4EYUA 5A7PA 4AVCA 4NPLA 1H6YA 4PIYA 5F2WA 4BH9A 2AREA 2JDZA 1BXHA 1NLSA 4I30A 1QY4A 2ZGQA 4Q0PA 1EV11 1YIPA 5FPBA 3VBRA 4ZY9A 4BWOA 1A34A 2ZGMA 2YG0A 2ZAAA 2G9ZA 3DF0A 4S2DA 5BNQA 2HYXA 4GD4A 1S0FA 3MO4A 4LEJA 4NIHA 1UIKA 2WT0A 2VNOA 1UOFA 4OI0A 1MQTA 4CRQA 4DY3A 4DUVA 1NA1B 2WS91 3IIAA 3MIDA 3AFKA 1YFUA 1WD4A 5BNNC 1RUD3 2R1DA 1RUH3 3ZFEA 3ZYIB 1NT0A 4KNCA 1OFSA 3V56A 2QQMA 4QX8A 3ZXFA 1QXRA 4AR2A 2B9VA 1EPWA 1HV1A 2PHRA 1RUF2 1OA2A 2OS2A 1Y4WA 3T0DA 5FO7B 1SLCA 5FPXA 5C9AA 1DQ1A 4NUBA 5CAZA 4XZUG 2JE7A 5CG8A 1RINA 1GQHA 1ZA4A 1UN1A 4K6BA 4AVBA 1PO13 4ATEA 1N47A 3QACA 1OT5A 2H6BA 5CYYA 2YBPA 5IT6A 1RUE1 1G8WA 2GSYA 1KDKA 3KQ4B 5F6KA 5T50A 2V5YA 4IE4A 1YCIA 1WW4A 3OPTA 1S2EA 2OVUA 2AUYA 3CEWA 4QT6A 4XMIA 4Y3OA 3WQ1A 2BTVC 1Y43B 2XL7A 4JCKA 3IDBB 1KJRA 4UW4A 4EN6B 1E5IA 1Q8QA 2WS92 2RMU1 3RNSA 4E2QA 1O5LA 3I54A 2J1RA 4N7UA 4RGKA 3VBRB 1DGRN 3MHZA 5I93A 2D44A 2ZEWA 3I3MA 3OD0A 3SITA 2ZGSA 5ANQA 4ES8A 5L7OA 2WZ8A 4OHVA 3SHRA 1FATA 2WNVB 4TZDA 2YV8A 4ITCA 2EIBA 1BJQA 4QPGC 1OD5A 1RXFA 3U1XA 1WCUA 5CKNA 2XONA 2WWJA 1LOBA 1MS9A 4Q1RA 5L36A 4JHTA 5D8AB 1W9SA 2WZR3 1RMU3 2CU5A 2X8KA 5FY8A 5JZGB 1FYUA 4YZ2A 2QQWA 4CCLA 3AP7A 1XE8A 4ZZ5A 4QU1A 4AFDA 1RHI1 4XF0A 5FY9A 2DVGA 2YBKA 1ZM1A 2UY8A 4IEYA 2FCTA 2RR13 4YVSB 3WCSA 4EWDA 4B7EA 1RUOA 1F35A 4HLTA 1QJY2 1K5MB 5FZ4A 5FXZA 4AFCA 2XBO1 3UGHA 4Z2AA 1K42A 4IEUA 5C6CA 2C26A 1G9BA 2YFZA 5T5LA 3J4UH 3VHOA 4XVHA 3V65A 2ZMKA 4ASKA 1N3PA 2I2SA 3I2GA 1WD3A 1PVC1 1ZBA1 1AYN3 4BQWA 2WBKA 2VUAA 4KU7A 4DRVA 5LRRA 2ZS6B 2LROA 2YU1A 3ZFFB 1WLWA 3KF5A 3MW3A 2P1BA 1VBD2 4N53A 1OMIA 4XHXA 3HBZA 1QJU3 5FZ0A 1XSQA 2W47A 3BOWA 2WYFA 2R30A 2P3JA 1DQ0A 2RM22 2FCVA 4JZRA 3ZSEA 1H30A 2YC2A 1Y9GA 5JSPA 2VUCA 1ULPA 1XNTA 1OOPA 4RR3B 2ORXA 4FPOB 4LO7A 4PBPA 5C3OA 1ZRFA 4AI9A 3P6BA 3VD4A 5EQUA 1LEDA 2JG8B 3H3ZA 3ZM8A 1NXMA 1ASJ1 2ZEYA 1IPSA 4KWKA 4OCTA 4PI2A 3I2KA 1CX1A 3VKNA 5FZDA 4OUMA 3KF3A 1D4M1 4I2OA 4PIZA 1FMD3 2E26A 1RUNA 1WLDA 2Y34A 4CCJA 3PMSA 1KS5A 3VBFB 5D2AA 5LA2A 1NY71 5JXIA 1T6BX 1R092 2JECA 4U2AA 2WA4A 1UY2A 3T1LA 5FY0A 4COWA 2SLIA 3BN6A 1ND3B 2FHRA 3OUHA 4QXCA 4WM8C 4D7SA 3VDDA 3G7DA 1LENA 4EJRA 3LKJA 2JDKA 1O8PA 3POJA 1RYYA 3UKVA 1VBB2 1UNBA 3JBG1 3D0JA 3AL6A 4R4ZA 4OHXA 5FYUA 4JAAA 2HWD3 2WSUA 4XDQA 1S0DA 2IXJA 4BIFA 2VR4A 3ZFFA 2XVGA 4QB2A 1IS4A 4FOWA 1O4TA 2DTYA 2DUPA 1K45A 1QH7A 1FT9A 2WNEA 2C24A 4CCMA 4NRQA 1C8M1 5F1RA 5F3GA 4XCAA 1BQPA 1MZ5A 2XHKA 5A3LA 3T4VA 3WG1A 3W58A 3MPPG 3WUDA 2WLQA 3LSDA 4OI4A 3C7EA 3WW2A 5LB6A 5HCHA 2QQOA 4JC1A 3JBG3 1SZBA 1U5IA 1D2QA 3WG4A 2A5ZA 4LBJA 1OLMA 4IE5A 1W9YA 3UV9A 5A33B 2DVDA 1LHNA 5I0RA 4XETA 4XXAA 3UESA 4RS5B 4MGSA 3GZTB 2WS93 3ZSKA 3TBDA 1ZZ8A 1WKYA 1H6XA 4ZHNA 4AGVA 3QBQA 3OBTA 2XKOA 3CKHA 1LR5A 3I59B 4W6XA 4XOGA 3NJXA 3T3YA 3USUB 2R7EB 3I8TA 4OUSA 2VNVA 1RUJ1 5CZKA 2Z79A 3O12A 3K3OA 3LIGA 2ORZA 1RUC2 1GR3A 4QXHA 3NVCA 3VZJA 5TSWA 1ENQA 4BOWA 5EV7A 3ZIWA 2CY6A 4YVWB 3P5BA 1GNYA 2WZR2 3PIGA 1DGLA 2E32A 3LEIA 1G9FA 3UGFA 2E6VA 1NAEA 2VUJA 1VB2A 1WLCA 1JZ3A 2D6LX 1JYNA 1V9U2 5LEJA 4LE4A 2BFUL 1HXS3 3I3QA 5CFDC 1H2KA 3ACGA 1CZSA 3ILFA 2WT1A 4QMAA 5FMBA 3WW4A 1CAVB 4XABA 2GAUA 1UZWA 1W6OA 2VVEA 5BV6A 4RQPA 1ND2A 1VRBA 1KQRA 3C7FA 2A1XA 4IE6A 2VW1A 4LR4A 4NHMA 5A7SA 4B3NA 3AYDA 1FPN3 1PM4A 1Y9MA 1ZZCA 1GYKA 3KVBA 1W06A 4DRRA 2HBUA 3WXPA 1AJOA 4ZZ8A 4QGMA 2A3YA 1FV2A 4S2GA 4UFLA 3VD3A 1S1AA 2VMCA 4GKXA 3QCWA 2UWAA 4A7ZA 2LTNA 5B4NA 3C2UA 4OQ9A 4DOUA 5FZFA 2WAAA 1VBE3 5A7NA 1DP0A 3USUA 3AJZA 1PMHX 1Q3EA 3T2PA 2W95A 4H7MA 2JXAA 4NHXA 4Y1ZA 2A6XA 1GZWB 1ND2B 2J1UA 4YWAA 4B29A 5LW9A 4Q8KA 3OPWA 4GH4B 5A32B 5A3TA 2CHHA 1MS1A 5JVVA 2VJXA 3AKQA 1YQ6A 4COUA 4N90A 4DZGA 3BPSA 4YNIA 2W08A 3KZ4C 4B8EA 4XZPA 5A3NA 4KGQA 3SISA 4LMFA 4SLIA 3WF1A 4UFHA 5ANNA 1DDLA 2Q1MA 2ZMLA 4QGLA 4CPBA 1PNGA 5A1AA 1VRH1 1ZZ7A 3HIFA 3LWCA 3WDXA 4CU7A 1G9CA 4YW2A 4AG4A 4BQ3A 1UPSA 4AQSA 3JU9A 3SQOA 2WUHA 5LASA 1PNFA 2GMPA 4A4AA 4XAAA 4JTNA 5E6HA 5FZKA 3CZJA 4JGZC 2X10A 1PK6C 1O3RA 1AX0A 2VU9A 3BKZA 1CN1A 2Z4FA 4CP1A 4IW3A 3SKVA 1X82A 3MUZ1 4CU9A 2QQNA 1VBB3 4Q1PA 1PZ7A 2BP6A 4MUVA 1GZ9A 4TYSA 5IVEA 2P5BA 4OZXA 2QZ2A 3NO8A 1IS6A 2NM1A 2Q1ZB 4Q4X2 4XBLA 4BZ4A 3KVAA 1CPNA 4M4RA 3ZO0B 3VDBA 3AJYA 1VLNA 4CDWA 2JX9A 5CKMA 4C0HA 1QQP3 5HCBA 3SXWA 4NAMA 1XQNA 3HNYM 3NJVA 5KHJA 3TEYA 1L7QA 1UAIA 2A71A 4QX1A 2BBVA 4NHYA 2BGPA 1GUIA 3WP3A 1EUTA 4LBQB 2CYFA 2YGMA 3ENRA 4P9GA 5DZEA 5FLIA 2WFF3 1YUDA 3HQRA 5IK4A 1CAUA 1WW7A 2WYSA 3NSTA 1N1TA 1PGW1 2QCSB 5FYYA 1E5RA 5LY1A 3I97A 3AYAA 5FYVA 3LEMA 1SFYA 3OBZA 1OHFA 1UD1A 1KXGA 1OQDA 4UOJA 3TWIA 4CDWB 2BUKA 5KXBA 3MLLA 3BIEA 1D4M2 1PGSA 3ZFGC 1V6LA 4Z82A 4I09A 3ZFEB 3H8XA 2WNUC 2R072 3NMBA 4BMBA 2WO1A 4PQQA 3NW4A 1N1SA 1UYXA 2C0ZA 3CJIA 3DV8A 3ZPOA 1QHDA 3OGGA 4JQRA 1W90A 1SEFA 5A3WA 2H6CA 2V72A 3JD71 3VD7A 5EJ1B 3AYCA 4K8FA 2VZSA 1LOGA 3U37A 1UCXA 1LOEA 3LCPA 1C5HA 1H9PA 1KDMA 1XYPA 1BVVA 3HR9A 3M7AA 1JZ6A 4DXRA 2B45X 4KBZA 2O8QA 5LA9A 3WG2A 1UKRA 3LZZA 1YYNA 4IGOA 1JZ2A 2YUEA 3WQ7A 4QQHA 4Q0VA 5BUVA 2LRPA 2ZGOA 3NV3A 4AW7A 3FE5A 4NWVA 1W3XA 4IV3B 4BDVB 4X8NA 1FPN2 5D8AA 3RZZA 2DVFA 3ZXKA 1VBC3 3GZAA 4CCKA 2VQTA 2LW8A 4XIKA 5LA0A 4CPBD 1DQ6A 4ARXA 1VP6A 5LBBA 4QB6A 5JOXA 2FZ2A 3FUQA 4YSFA 3BU7A 2D3SA 2UURA 4AEDB 5DDJ1 4B1MA 2JDMA 4AVAA 4Z92B 1AJKA 1UXZA 2VQAA 4G3YC 4PI0A 1OA3A 2IXCA 1IGOA 4FXKB 2ZGNA 3ZXGA 2D3PA 1QJFA 5A7OA 1J58A 1QMJA 1OUSA 2VD7A 3VGIA 3E5UA 5A70A 5DG2A 3GBFA 1ZYBA 4B7KA 4EZ4A 3FJSA 2DCZA 3FHAA 4FPYA 2FDHA 1X8EA 3BTZA 3R05A 1RUJ3 5K4LA 3MIHA 3WR0A 1HQWA 1EUUA 2AACA 2Z42A 1Y7BA 2EA7A 3J7HA 4GWIA 2F4LA 3RI9A 1UW8A 3THDA 2XGXA 1QJEA 4G4FA 5DDJ2 5FP4A 1PX3A 1N3OA 2ADEA 1AR82 2BNMA 1VJ2A 1WA6X 1IQDC 2IXHA 3IAPA 4PQ9A 2DUOA 4P08A 1ZRRA 4HL0A 3IMMA 1U5XA 1QOOA 1W6QA 2PHWA 4IV1B 4MO3M 4FQ4A 4FP3A 3PIJA 1YQ8A 2P4EA 4MGYE 4M4PA 5JR2A 2C9KA 3BTYA 1GLHA 2D5FA 5L7OC 3WF3A 4KL1A 3WNLA 1T2XA 2D6KA 3BB6A 5IK5A 3CU7A 2WN3A 3FBYA 1XXNA 2DTWA 4HKLA 3GBGA 1W6OB 5FLJA 5J98B 1LHVA 2CSGA 3NKGA 1LECA 4HN1A 1IKQA 4EN9B 3WCRA 3NV1A 1ONAA 4FP2A 1F15A 4JHZA 4AVTA 4XFFA 2JDPA 4CDQA 5FOJB 4NWWA 1RJ7A 1HX6A 1TEIA 2FBEA 2XQRA 5FRAA 4BMEA 2RJLA 1VBA1 2RS31 3ZN6A 2R061 4D69A 4EN0A 1WMDA 1LULA 3NNFA 3P3PA 5I0DA 4L11A 4TLGA 4Q4X1 3VLBB 1U12A 4N43B 2GNMA 3SH5A 2D93A 5IUQA 2BERA 2WFF2 4GMP0 5KXDA 5LRSA 2FDJA 4W6WA 5KHIA 5A6YA 3W9AA 2J1AA 3PU8A 1RHI3 4M0HA 3RI8A 2P17A 2HYKA 4DXSA 4ISRA 5DAPA 3LFIA 2AR6A 3AKPA 3H8RA 4WZCA 4JKLA 3O7OA 4CP0A 3L2YA 1UX7A 1SFPA 1VRH2 5BNPC 4ORFA 2QFEA 5JXJA 2WO2A 3AZXA 4QDQA 1O3SA 1DG6A 1U5YA 5D21A 2E7QA 2EIDA 4XJ8A 3O14A 4N43A 4PDWB 4RFT0 3VKLA 1SLTA 4BQXA 4E8DA 1FI2A 3T1MA 3SCHA 1PGL2 1I6XA 1L7LA 4OFGA 2OUHA 4XQ4A 4XURA 1B09A 2GP5A 4L92A 1W8UA 4CE8A 1XYOA 2W68A 3CF6E 5FPZA 1YHFA 4Q0QA 3AKTA 3C8XA 2R0HA 3CJXA 4X8PA 3S30A 4Y5SA 3I3BA 2QJVA 2P3KA 3E97A 3ES1A 4RL7A 5B2GB 3ZXEA 4A2UA 4Q4W1 2JG8A 5FZEA 3WSOA 1ZZBA 1HRI3 1C5IA 2Q4SA 2Z69A 2RV9A 3BGAA 5C8CA 4QX0A 4C8DA 1R64A 4COZA 3UNPA 3VDDC 4QWNA 1O8SA 3SC7X 4Z1VA 5CEHA 5FPVA 2VQ0A 1O7FA 3MIBA 3MYXA 3U11A 1FOD3 3ZVXA 5DABA 4P02B 3GGLA 4BQ2A 1O4ZA 1C3HA 4AGRA 5JI9A 1UYZA 3ZFGA 1POQA 4YM1A 4WV8A 5FY4A 5KHKA 4MYEA 2V4VA 3IZOA 2XMLA 5LBFA 4Y5TA 1W6NA 2V73A 4HONA 4BK4A 3WNPA 3SH3A 3IIIA 4I0WB 4XC9A 4TTGA 3DXTA 5IVVA 2WWUA 1HRI1 4QPIB 5EWSA 4DPNA 5CKQA 5G04L 3HEIA 3M8LA 3VDCA 1OA4A 2CTVA 5FBZA 3ZLIA 3IBMA 5F37A 3VBUB 4LHLA 2EXKA 2QZ3A 1CX4A 1AR71 5DAQA 4XPVA 4QKNA 2DCKA 3GALA 1X8MA 3J8F3 3A4UA 4MADA 4YG6A 5FZBA 5KR7A 3FUOA 3OYWA 1AR83 1CAUB 1CZTA 2X5IB 4BHPA 4D6QA 2PLV2 2V4AA 1PGL1 1QJU2 2OYZA 4W4ZA 1NXD1 5HV4A 1NCRC 2XJUA 4D6RA 2YMZA 4LTAA 5DUUA 2QQVA 4A42A 5IFPA 5JZGA 3AMHA 1TMF2 3I2FA 5DQ0A 4HMZA 1W99A 1BVP1 4LOTA 4CCCA 1H2MA 5FUNA 5BY5A 4BM8A 4NIGA 3RZGA 5GKAC 3T0BA 5JMCA 1WLTA 3CJIB 4QD2A 1S4CA 1ZA7A 2Y60A 1SLAA 3LPGA 1C1LA 2D43A 1QOTA 4MXWB 2NQYA 4MHRA 2R043 2YPJA 2K0GA 1GP4A 2X5IA 3A22A 2TUNA 4QKFA 3T2QA 3I7DA 5J09A 1G7YA 3OF1A 4LE3A 1RUH1 4CDUC 4XFIA 5C8CC 1ULCA 4CA9A 2IFWA 4UBGA 4I3GA 1GNZA 4OVEA 1GU3A 2VUDA 2R49A 2IC1A 2XJVA 4WVWA 5IJRA 1ZBE2 5LA1A 3BI3A 5FJHA 1GV9A 1AVBA 4MLOA 5M0TA 4HSJA 1K3IA 2ZHMA 4WVVA 1XSRA 3IN9A 4YLZA 4DQAA 3KT1A 3KGZA 4MSVA 3HVDA 1VPHA 5CFCB 1NKGA 4LQRA 3OYWB 2R041 3HOBA 3OSDA 5A33A 1OFNA 4CEYA 1WCQA 4YM3A 5C33A 3I2DA 3FBMA 5F3EA 2IVIB 3U75A 1R091 1J1LA 5FV3A 4A3XA 3AVSA 5ERLA 3UYJA 1NCQA 2ETEA 4R9CA 1HB2A 1FV3A 5E88A 5J1XA 1ZRDA 2WQ8A 2C5DA 4E8CA 1AHSA 1FNZA 5JSRA 1H1AA 1W9FA 4FAGA 1ZX5A 1J3QA 1RUF3 1JN2P 4HKWA 4L97A 2DU1A 1QNYA 2DCJA 4GJZA 1SDDB 5DZGA 3JBG2 2A7AA 3NAPB 3AP4A 3JUUA 5J48A 5BYNA 2ZKLA 2W1WA 4LXLA 3WZ1A 5AFBA 4FAHA 4UFKA 3RSJA 4KU8A 3ZPYA 4D8MA 2GC1A 2I07B 3ACLA 1QEXA 2Y6LA 2UWBA 2VO5A 4IE7A 4MGQA 3RG0A 3I49A 3OBAA 5GM0A 2X09A 4QB1A 2B8MA 2E7TA 1COV1 4R9DA 2VAUA 4Y4YA 1BYHA 5FYTA 1VAKA 4K8RB 1FNYA 2YC4A 3K4DA 2NYYA 1NG0A 2WDBA 4WVMB 2ZEXA 1HRV1 2B5HA 1BCXA 2RMU3 4JX0A 2Y6KA 4B4QA 4BE3A 2CGOA 1A8MA 1JI6A 4E4ZA 2WO7A 3O1MA 4GMP1 4AXOA 2OXBA 5GALA 3M3CA 4NIDA 4ES9A 2A3WA 2Y6FA 3VBOC 3EMRA 2XBO2 2WINB 2XPJA 2DFBA 2QBXA 1V9U3 3FL7A 5FZ9A 2FQPA 4HN0A 2BZDA 1COV3 3LAGA 4XW3A 4E2GA 1YLLA 3O0XA 5DPNA 4FPEA 1OC1A 4JGYA 3HWJA 4IXLA 3AZVA 3ZYRA 3IMNA 1AZDA 5CNAA 5K0UC 3H1WA 3S7IA 3FFZA 3ZXAC 4AOCA 1QU0A 5LCWL 1H8TC 2VCCA 4NO4A 3RWNA 4D0QA 1RXGA 4YW5A 1MQTC 1CZVA 4Q4W3 1W05A 2PTMA 3Q9OA 2MEV3 2CDPA 3OJBA 1HKDA 3QH7A 4P9IA 1PMJX 3H7JA 1UYPA 2ILMA 3POWA 1S0BA 2JD4A 2OIIA 1I5PA 3VUOA 5KHHA 1JYWA 2PLV3 2XVKA 3R6SA 3V0AB 1GP6A 5FP7A 4LO6B 5E8AA 1QDCA 4HBNA 1KS4A 3ABZA 4E4SA 2RS11 5FOBB 2HWC1 1AYN1 1WCDJ 3N4MA 3WINE 1DYPA 1WWYA 1DLCA 5FP9A 1N3QA 1OF4A 3N9LA 4J1XA 3B9CA 4YZ5A 5JOZA 5HCAA 4L99A 1LB2A 3LGRA 4BA6A 4F3JA 2UWCA 1LKNA 2G19A 4BQ5A 2JDHA 3TRSB 4LHNA 2A73B 2J42A 1IG3A 1LOFC 2VBBA 1UOJA 2ZPXA 2W87A 4JKKA 2BV4A 5FYHA 5JR7B 1BMV1 1C1FA 2AEYA 2P6HA 3DEMA 3O1TA 3UKNA 4M00A 2VZRA 1W6MA 1ST8A 4B4RA 5GZFA 2C6SA 2ET1A 3OB8A 4AGGA 3H3LA 4RFRB 1URXA 5KC6A 1VR3A 2Q8EA 3E6BA 1RUD1 1AR92 2BYVE 2FDFA 3VBRC 5CADA 2PMWB 3DL3A 3PNAA 2NZ9A 1YJKA 2MHFA 2JWPA 2R16A 4HFSA 4M3CF 4P9YA 5HV0A 3RZJA 1F31A 3HPNA 2ZBJA 5F6LB 1VMJA 3O0WA 1HB3A 2AENA 2VMIA 2Z5WA 3HQXA 4LHKA 3ZYPA 4AZZA 1H8VA 2VZTA 1AYM2 3ZMNA 2ZMNA 1RUH2 4QPGB 3WDVA 1C57A 1SG3A 5BNOA 4GWNA 2QDNA 3VZOA 3O1UA 2ZOEB 2HWE1 3B3QE 4GH4A 4IDZA 4P14A 4UW5A 3TNPB 4CP9B 4HPKA 5D8AC 3LEKA 1CJPA 4FFIA 4BYYA 1IZ3A 5JZGC 2BJSA 3I2IA 1UY4A 4LKEA 2QUOA 1I5ZA 2AH2A 3H9AA 1Q5OA 3ITQA 3PLQA 4R8HA 4YZ1A 2A70A 1AXZA 1V6OA 5ABJC 3GHMA 3FC0A 5FMDA 1BBT2 2RS52 4D6SA 1JZ8A 2D6MA 2JG9A 5DAXA 4IQPA 2R32A
chains in the Genus database with same CATH topology
2BRTA 2DBNA 1HB3A 1RXGA 2JB8A 2VCMA 1QJEA 1HJGA 1UOBA 1W28A 1W05A 1E5RA 1W3VA 1WA6X 1GP5A 1W03A 1W06A 4XAEA 1W2AX 1OBNA 1W2OA 2VBBA 3ON7A 2WO7A 3ZKYA 3ZOIA 5C3RA 2VBPA 1BLZA 1UNBA 5C3OA 1RXFA 1UOGA 1W9YA 1QIQA 2CSGA 1HB1A 2VBDA 2Y6FA 4BB3A 1UO9A 1IPSA 1ODMA 2BJSA 2Y60A 3OOXA 1QJFA 3ZKUA 1GP6A 5APAA 5C3QA 1HB4A 1UOFA 2JB4A 1GP4A 1E5HA 1E5SA 1W3XA 5C3SA 1ODNA 1OC1A 2DBIA 2VAUA 2VE1A 2IVIB 5C3PA 1W2NA 2IVJA 1E5IA 1BK0A 1W04A 1HJFA 1UZWA 1HB2A 2BU9A 1DCSA 4RGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRT A;  2DBN A;  1HB3 A;  1RXG A;  2JB8 A;  2VCM A;  1QJE A;  1HJG A;  1UOB A;  1W28 A;  1W05 A;  1E5R A;  1W3V A;  1WA6 X;  1GP5 A;  1W03 A;  1W06 A;  4XAE A;  1W2A X;  1OBN A;  1W2O A;  2VBB A;  3ON7 A;  2WO7 A;  3ZKY A;  3ZOI A;  5C3R A;  2VBP A;  1BLZ A;  1UNB A;  5C3O A;  1RXF A;  1UOG A;  1W9Y A;  1QIQ A;  2CSG A;  1HB1 A;  2VBD A;  2Y6F A;  4BB3 A;  1UO9 A;  1IPS A;  1ODM A;  2BJS A;  2Y60 A;  3OOX A;  1QJF A;  3ZKU A;  1GP6 A;  5APA A;  5C3Q A;  1HB4 A;  1UOF A;  2JB4 A;  1GP4 A;  1E5H A;  1E5S A;  1W3X A;  5C3S A;  1ODN A;  1OC1 A;  2DBI A;  2VAU A;  2VE1 A;  2IVI B;  5C3P A;  1W2N A;  2IVJ A;  1E5I A;  1BK0 A;  1W04 A;  1HJF A;  1UZW A;  1HB2 A;  2BU9 A;  1DCS A;  4RGK A; 
#chains in the Genus database with same CATH topology
 1GOH A;  1UMH A;  2OQ7 A;  4A3Z A;  2UYB A;  2HWC 2;  3ZYF A;  3CZU A;  4LIU A;  4QHZ A;  1V6K A;  2WO3 A;  4NJ4 A;  2YZ4 A;  4OMD A;  1YWK A;  5SV5 A;  1DYK A;  4DO0 A;  1X50 A;  1UWW A;  1VBE 1;  5HCF A;  4ERO A;  3GF6 A;  3A7Q A;  5T5O A;  4XCB A;  2ZX1 A;  1LGN A;  4PT6 A;  4CCO A;  3AP5 A;  4UW3 A;  4AWD A;  5GZG A;  2NMN A;  3K46 A;  4XF1 A;  2ARA A;  1XB9 A;  2JDY A;  4K3U A;  1WUV A;  1WMX A;  2JEN A;  4QX7 A;  1A78 A;  4XUO A;  4AEM A;  1X9T A;  1AR7 3;  1DU3 D;  4PLO A;  5APA A;  1HDK A;  4QQP A;  4AL9 A;  1CIW A;  1HV0 A;  1AR8 1;  2DF7 A;  2W46 A;  3K51 A;  4RR3 C;  2VCM A;  4W65 A;  3IT8 A;  1RVF 3;  2B9U A;  2HKX A;  2XBO 3;  1CAV A;  5EXO A;  4P00 B;  1JZ4 A;  1STM A;  3F2Z A;  4YFW A;  5H9S A;  1TQ5 A;  3PUR A;  3SNM A;  3EQE A;  1W0P A;  1PVC 3;  1ZBA 3;  1F5J A;  1EAH 2;  4CUA A;  3BOD A;  1O3T A;  2WN2 A;  2MPF A;  3M3I A;  3VBF C;  3ZDS A;  1SHW B;  2WWS A;  4FPF A;  1HXS 2;  3RFR A;  4EWA A;  3T0A A;  5IAT A;  1H4H A;  2GME A;  3NNM A;  4CXW A;  2KM2 A;  1HW5 A;  1YJL A;  4ZXK A;  3KD4 A;  2XL9 A;  4OYU A;  1ND3 C;  2WR9 A;  2RJ2 A;  2EVX A;  4WM8 B;  4YGE A;  1PO2 2;  4QDS A;  5FZM A;  3ZYB A;  2VH9 A;  3FLT A;  5AVP A;  5FXV A;  1AR6 2;  1XNB A;  4LIV A;  5C70 A;  5JWP A;  5IK8 A;  4KWU A;  4UAP A;  2RR1 1;  3FZ3 A;  2Y0I A;  3B02 A;  3VL9 A;  2A75 A;  4LO5 B;  2RVA A;  4QQ2 A;  4GQ7 A;  4D7Y A;  2XWJ B;  1GKB A;  5CFC A;  1DQ2 A;  2HWB 3;  4UFI A;  1V9U 1;  4MOA A;  5DMY A;  1VAL A;  4IEW A;  1UXX X;  2D6P A;  3CLP A;  1DIW A;  4AI3 A;  5J3U A;  1IPJ A;  2WRA A;  4JTO A;  1Q8P A;  1LRH A;  4W50 A;  5H9P A;  2O0O A;  2VZ3 A;  5F2S A;  4P5H A;  4PJY A;  3H8O A;  2PXJ A;  3N9Q A;  5EHD A;  2J1T A;  1OPM A;  4NHK A;  4WM8 A;  3O1R A;  1CWP A;  3CQO A;  2QQU A;  5ACA 1;  3J7M A;  1HRV 3;  1TNR A;  1RJ8 A;  3KCY A;  3U07 A;  1UKG A;  2ZKN A;  1N1Y A;  3S5Q A;  3C7O A;  3AL5 A;  4HOO A;  3VHN A;  2HLE A;  4MGK E;  4Y1V A;  2HEV F;  2WAB A;  3N9M A;  1F8V A;  1D4V B;  4RS5 C;  2XJS A;  4PDW A;  4BPZ A;  1AR9 3;  1XU2 A;  1D0G A;  3POY A;  3U78 A;  4WM7 C;  3BTA A;  1NZI A;  2X29 A;  3C7H A;  3NQH A;  3GCW A;  4CEW B;  3MIE A;  4AFA A;  5FZO A;  5FZG A;  5JI7 A;  3VB9 A;  3RS6 A;  1A8D A;  3JB8 A;  4AI1 A;  2XUE A;  5IVJ A;  1VB4 A;  3APB A;  3OBR A;  1UU4 A;  4FPH A;  1ENR A;  3JZV A;  1AYM 3;  4PCR A;  1LOA A;  2VPV A;  5F8P A;  2ZGP A;  3OUJ A;  2PAE A;  5BXX A;  4CCD A;  4Z8B A;  3E6D A;  2A6V A;  5CA6 A;  4FOV A;  4OI2 A;  3RZK A;  4MGT A;  5FAX A;  2WNU A;  3POI A;  4JDO A;  2Y6J A;  2VXJ A;  5B4X A;  4JDM A;  3W20 A;  1VBB 1;  3O1P A;  2CAU A;  1POV 0;  3ZKY A;  1YFY A;  3ON7 A;  3VBH B;  3CL1 A;  2VNR A;  1ZBE 1;  2XOM A;  1TME 1;  4C90 A;  2QNK A;  3AFG A;  4AVS A;  1BBT 3;  2RS5 3;  1QJX 1;  2VXR A;  1A3K A;  2P3I A;  4LOR A;  4BIS A;  3NJZ A;  3AP9 A;  1XBF A;  2HWC 3;  4Q4V 1;  2LS6 A;  2GP3 A;  3T4H B;  3KV6 A;  2V09 A;  1ZRC A;  1R08 1;  2D98 A;  3S6P A;  4ATF A;  4ASL A;  1RHI 2;  1RTV A;  1ULE A;  1OH4 A;  2DCT A;  2VQU A;  3RMY A;  1W0N A;  2ATF A;  4P9J A;  4COY A;  2GC0 A;  1JUI A;  1XE0 A;  1S55 A;  3Q8C A;  4XF3 A;  3VKO A;  3H7Y A;  3HN1 A;  3LF7 A;  2ZAC A;  1VE0 A;  3RYR A;  4QX5 A;  1F9K A;  3MLK A;  3N9O A;  4GJY A;  5GZC A;  1W28 A;  3DKW A;  1OBN A;  3D3A A;  2J22 A;  5C4W C;  1CPM A;  3ETP A;  2ADD A;  4PLM A;  2QQP A;  1O91 A;  1RUC 3;  4KBB A;  2P6C A;  2VBD A;  1GNH A;  4EQV A;  2IXI A;  1SLL A;  3S5A A;  4EE2 A;  1DF0 A;  1BKZ A;  1ND2 C;  2CAV A;  3MGU A;  3OGV A;  5EZW A;  2VNG A;  4GH4 C;  3VKF C;  4HET A;  2HWD 1;  4R9B A;  5C3S A;  1P8J A;  1RGS A;  1G6N A;  2PLV 1;  3DGT A;  3M2M A;  3KS7 A;  1MS3 A;  1RVF 2;  3WDT A;  4YVS A;  1DYO A;  3Q8A A;  1REF A;  1REE A;  2DU0 A;  2Q5T A;  1XNC A;  2ENR A;  3M4F A;  5GLZ A;  2CL2 A;  2VM9 A;  3SKJ E;  3WEZ A;  1SFN A;  3WHU A;  4AQ6 A;  1MZ6 A;  2YY1 A;  1MR5 A;  4HZF A;  2JG9 C;  3LA2 A;  1IPK A;  2G9G A;  4YGD A;  5IVB A;  3O1V A;  2OKX A;  3VN4 A;  1I1E A;  2OPK A;  5GZD A;  4GA9 A;  4QXK A;  1BK1 A;  5GLW A;  4JGZ B;  3BPZ A;  3WV6 A;  5IW0 A;  1RL3 A;  2G4I A;  3KQR A;  4FFH A;  1ZZ9 A;  2KD7 A;  2PAM A;  3AXD A;  1AR6 3;  3BVC A;  4J25 A;  4ONU A;  4TLF A;  4RS5 A;  2O8O A;  1R1A 3;  5DXD A;  1DQ4 A;  1ENX A;  2EXI A;  5FY5 A;  1M4W A;  4UI9 L;  3WNX A;  5FO8 B;  2BRT A;  1H1M A;  1WCS A;  3K2O A;  2JB8 A;  3FHI B;  1LU1 A;  3C7G A;  3MDP A;  2BWA A;  1W6Q B;  4IV1 A;  5EJZ B;  3TN9 3;  3DPR C;  1NOV A;  4DUW A;  1OQ1 A;  4CDX B;  2ZCW A;  4NRM A;  1C8N A;  3FLP A;  4BQ1 A;  4X6Q B;  5FR3 A;  1EV1 2;  4CDQ C;  3IPV A;  1SBF A;  4CP9 A;  3FX3 A;  3OUI A;  4NE9 A;  1JU4 A;  5EFU A;  4MET A;  4I3P A;  2WT2 A;  3LDB A;  4Q4Y 1;  4CEW A;  5KWR A;  3X29 B;  3KB5 A;  5C9A B;  4AVV A;  1MEC 2;  3OG2 A;  3DUI A;  3T30 A;  1RVF 1;  5FJK A;  5LK5 A;  5FXX A;  4CDW C;  1RUF 1;  1SQ4 A;  3FLR A;  1DZT A;  4XUT A;  5FLH A;  4AI0 A;  3ZOI A;  3ZFE C;  2P2K A;  2PQQ A;  4Q0U A;  3VL8 A;  3AZY A;  2R06 3;  3EXU A;  3T2T A;  3UJO A;  1D2S A;  1VBA 2;  2RS3 2;  1UZZ A;  2W2I A;  1SCS A;  1BEV 1;  2A6W A;  3H0O A;  4XIL A;  4AHX A;  2NP0 A;  3WT3 A;  3P1I A;  3NNL A;  3VKM A;  3W21 A;  4Q4Y 3;  4Q4X 3;  4ZXE A;  5JIA A;  3GZE A;  3BCW A;  5LBC A;  1ALY A;  4QKB A;  1S2B A;  2VC9 A;  1HN1 A;  2LM3 A;  2YC0 A;  4HVO A;  1OOP C;  2WFF 1;  5KXC A;  1QJZ A;  2Z2S B;  2XH6 A;  3ZYJ B;  4L8Q A;  1B35 B;  2X53 S;  2VOT A;  4QQL A;  1YFW A;  1GWK A;  2WJS A;  4TXW A;  1V0A A;  1C4R A;  3G6J B;  3IDC B;  2RHP A;  4N9I A;  2RDN A;  1GIC A;  3CMG A;  3KT4 A;  4X6R B;  4DXT A;  3PU3 A;  4AAX A;  4CEY C;  2UYA A;  2XJP A;  2FD8 A;  4XEZ A;  4YYO A;  1Q8V A;  1JOP A;  1AL2 3;  4GB3 2;  2YU2 A;  3ZX7 A;  3SH4 A;  2Y8K A;  1US2 A;  5FZA A;  3VBS B;  1OXC A;  2VW2 A;  2VZV A;  1UO9 A;  3ATG A;  3POG A;  3Q8E A;  4IV3 C;  4LA3 A;  4KQ7 A;  2JJ6 A;  4UYB A;  3J26 N;  3WP6 A;  4URT A;  2FDG A;  1OUR A;  4IND A;  3U14 A;  1W2U A;  1W6P B;  4Z07 A;  1D4M 3;  4I02 A;  3B7M A;  4LO4 B;  3KSC A;  4QPW A;  5FUP A;  3TEW A;  2VW0 A;  2VVF A;  3ETQ A;  3VBS A;  2IZW A;  4O9E A;  1J83 A;  3ILN A;  2JIG A;  2VVD A;  1S2K A;  4H55 A;  5GLT A;  2VZU A;  1IOA A;  4Y22 A;  4LPL A;  3NWK A;  4C91 A;  2EIE A;  1RC6 A;  4KG8 A;  4QKD A;  3RJ2 X;  3VBU A;  1HLC A;  3O0V A;  3CHX A;  3LA3 A;  2ZTN A;  4XE9 A;  5LY2 A;  1VAV A;  4RQP C;  1U0A A;  2VOW A;  5ISL A;  3LFM A;  5I0U A;  5L9V A;  1NZC A;  1WZX A;  4XJZ A;  2Q8O A;  2FDI A;  4HSL A;  1NX9 A;  4S2H A;  4DUX A;  3ZKU A;  1LOF A;  4MZU A;  3LQC A;  2HEW F;  3SCG A;  2YDE A;  3VHR A;  4XFG A;  5JPN B;  1US3 A;  4GUL A;  4HG6 B;  4QPG A;  3O1S A;  4HK9 A;  3KMH A;  1CR7 A;  4IEQ A;  4RHV 1;  4BU2 A;  2WA3 A;  4ZS3 A;  1Q8O A;  2H0B A;  1JBC A;  1UY1 A;  2OW4 A;  5A80 A;  2WNV A;  4A7K A;  2XJQ A;  2YB7 A;  3VHP A;  1RUC 1;  4FTE A;  5L7O B;  4FFF A;  3AK0 A;  1YI7 A;  4JGY C;  2E7A A;  4N53 C;  3JQX A;  5KXE A;  3UGG A;  3D5O A;  4PBO A;  2PFW A;  4DEQ A;  4PHZ A;  4HVQ A;  1COV 2;  1TNF A;  3M3O A;  3M1H A;  1SBE A;  2ARX A;  4FPK A;  1W39 A;  2AGS A;  2WLP A;  3GJB A;  4LHS A;  4M0N A;  4Q4V 3;  4K40 A;  5A6Q A;  4XJ9 A;  1ODN A;  1FAY A;  2WQZ C;  3TN9 2;  3NRU A;  4QHO A;  2VZP A;  4FT8 A;  2YRO A;  4WM7 A;  3K4A A;  4UFJ A;  4XTM A;  4KWJ A;  4XFC A;  3HJR A;  4Q4W 2;  5A1L A;  5HPO A;  5BNO B;  3Q8B A;  1UZY A;  1EV1 3;  2VCA A;  1RUJ 2;  3HT2 A;  4YW6 A;  5I0S A;  3EBR A;  2FMD A;  3MW2 A;  4BJ0 A;  2YYO A;  1HIX A;  2ARB A;  2ARC A;  3AZW A;  2W5F A;  3RPQ A;  1Q43 A;  4MX3 A;  3UJQ A;  1KEX A;  2LUW A;  4Q26 A;  5DDJ 3;  3V64 A;  1MZF A;  1XOY A;  4XAC A;  4NRO A;  1NA1 A;  1FX5 A;  3GXU A;  3BUC A;  4FQZ A;  1XNA A;  4KGG A;  5CU1 A;  4M01 A;  5F32 A;  2GDF A;  1JUH A;  4K9S A;  2YXS A;  5FYC A;  4R52 A;  3BU0 A;  4K1Y A;  2YHJ A;  3AMN A;  4QU2 A;  2KXL A;  2VGD A;  2E63 A;  4C1W A;  4GWJ A;  3VZN A;  4CP2 A;  3A21 A;  5L19 A;  5L9R A;  2GN3 A;  2EAK A;  2NLR A;  2TBV A;  1WBF A;  5IAX A;  1VBA 3;  2RS3 3;  1GP5 A;  1NCQ C;  1TMF 3;  2BWC A;  1RUE 3;  3PDQ A;  1CIY A;  4L9B A;  5IAV A;  3KCX A;  3QLQ A;  1LHU A;  5FZ1 A;  4DXZ A;  2YGL A;  1YEW A;  2I74 A;  1YRZ A;  2XJR A;  3JCI A;  1KFU L;  3ORJ A;  3LE0 A;  2CV6 A;  1V70 A;  2R04 2;  3R0R A;  1Z7S 3;  3KWV A;  4CUG A;  5CIS A;  4HAN A;  1JMU B;  2ZGR A;  3OPZ A;  2RM2 1;  5FDB A;  1W6P A;  3K3N A;  2WKK A;  2VOV A;  3CNA A;  2EXJ A;  3S7E A;  1I3H A;  2GNT A;  1APN A;  4A45 A;  1NLR A;  3RDI A;  5FWE A;  2OQ6 A;  3KV4 A;  2VY0 A;  3QH6 A;  5ABJ A;  3KV5 A;  1BEV 3;  5K8S A;  4GAL A;  1TE1 B;  1DZQ A;  4CU6 A;  4Y22 B;  4YG3 A;  4CUC A;  5C5T A;  3OGS A;  2ERF A;  1VRH 3;  2JE9 A;  4XJW A;  2YBS A;  3F95 A;  2X05 A;  5AC9 1;  1HXS 1;  3NAP A;  1CJD A;  2WL1 A;  1IG0 A;  1E5H A;  1SPP B;  2KR2 A;  2W0X A;  3N7M A;  1JW6 A;  4XUN A;  3TB0 A;  4A6S A;  1CON A;  4H2A A;  1ULF A;  5BNP A;  1IQA A;  3ST7 A;  4FPG A;  2XLF A;  2O14 A;  3MI8 A;  5A3U A;  1W6N B;  2PHF A;  3H1Y A;  3MF6 A;  1JYC A;  3D0S A;  4S2F A;  3ZMO A;  4YM2 A;  1FPN 1;  4E2S A;  3PUS A;  1JHN A;  4NIA A;  4P9X A;  4QPI C;  3I2H A;  1VBD 1;  1YQ2 A;  3CBN A;  1KIT A;  2DVA A;  3A23 A;  4NN0 A;  5CFD A;  3SCF A;  4ZU4 A;  1UY3 A;  4ASM B;  4WVM A;  3MFA A;  1LOC A;  4QXB A;  4U36 A;  5I91 A;  5KBF A;  1JOJ A;  1QIQ A;  1HB1 A;  3A0N A;  3GJA A;  1XJA A;  3U4S A;  5LZ6 A;  4FFG A;  1RMU 1;  4M3C A;  4NAO A;  5CG9 A;  5FK8 A;  1LHO A;  2ZHN A;  4Y4R A;  1U5Z A;  1QXP A;  3J7L A;  4GKY A;  2BGC A;  1J59 A;  2Q8C A;  5JOW A;  3MIG A;  2VZ1 A;  3J9S A;  4HXC A;  4IV3 A;  3BTX A;  3LOB A;  3AXE A;  4ZS2 A;  5J36 A;  4YW3 A;  5JUV A;  1NA1 C;  5FRE A;  2GH8 A;  4E4D X;  1FOD 2;  2ZGU A;  4OZO A;  5BNN B;  1G9D A;  1LES A;  4IER A;  1JYX A;  1JHJ A;  2RMU 2;  2RDR A;  4H7L A;  2JDN A;  3UT0 A;  1GZT A;  2JKB A;  3WUC A;  4UT5 A;  2MEV 1;  3MV0 1;  5IVC A;  3CJI C;  2CGP A;  2NN8 A;  2XLA A;  1XYN A;  3TYJ A;  4A44 A;  1LAJ A;  2QQK A;  2QTW B;  5A3P A;  3N7K A;  1PVX A;  1POV 1;  1RMU 2;  1Q8S A;  2BGO A;  2D6N A;  4QDR A;  4CUB A;  5C8W A;  3FWE A;  4LA2 A;  4AHW A;  1OD3 A;  3ACF A;  5T52 A;  1X7N A;  3THC A;  2GU9 A;  4NVP A;  4CDU B;  2CWS A;  2IXL A;  5F3I A;  1WME A;  3DYM A;  4IL7 A;  3HT1 A;  1FXZ A;  3TEX A;  1EPZ A;  3K4Z A;  3W5N A;  2Q30 A;  2RS1 2;  4XXP A;  3HN3 A;  5AFE A;  1H2L A;  1JOD A;  2HBT A;  5J37 A;  1PIV 3;  1BZW A;  1DHK B;  5LBE A;  3WNN A;  3ZXL A;  2XUM A;  3AB0 A;  5FCC A;  2QDR A;  4JGZ A;  1W03 A;  1WGP A;  4V2V A;  3JD7 3;  5FPL A;  1EY2 A;  3TEZ A;  2R6Q A;  5A7W B;  3BYW A;  5T5J A;  2HWB 2;  4PF1 A;  4XJA A;  5C3R A;  1QJX 2;  3V0B B;  2R0F A;  1TME 3;  1I9R A;  1VIW B;  5H9R A;  2WNV C;  4L0P A;  4Y26 A;  3MLJ A;  4XFA A;  1QQP 1;  4LBM A;  4YW4 A;  2GH2 A;  2PYT A;  2FCU A;  2WQ4 A;  3WNK A;  2RDS A;  3WQ0 A;  3AMP A;  2A3X A;  2AEZ A;  3MIC A;  4OMC A;  1RUI 2;  4OLL A;  5F5C A;  1J1T A;  3D8C A;  5FBJ A;  2QE3 A;  2A6Y A;  5FY1 A;  1SCR A;  2EIG A;  1GWM A;  2ZXQ A;  2RDQ A;  5EP9 A;  1XC6 A;  5C71 A;  4RN5 A;  3ECQ A;  3VV1 A;  2XQX A;  4ZPI A;  3I2O A;  3NAP C;  5K9Y A;  4TSV A;  1KFX L;  3I59 A;  2Q8D A;  1W3V A;  4LLF A;  3PUH A;  3MF9 A;  2JDA A;  2H0V A;  1PGW 2;  3VD5 A;  2DWR A;  2XG3 A;  3T08 A;  3GBW A;  1YQC A;  4B4P A;  1NE6 A;  2JDU A;  2VOK A;  1FMD 2;  4YVS C;  3NKT A;  1UOG A;  1HQL A;  2BDR A;  1Z7S 2;  3VZK A;  1K5M C;  1ZBE 3;  1WA4 A;  5EJ3 A;  5GZE A;  4FI9 A;  3OOX A;  4QQO A;  3OEB A;  4XHB A;  3E1F 1;  2A6Z A;  2E9Q A;  1R09 3;  1ASJ 3;  3MIF A;  4LLO A;  2L9L A;  2ZJC A;  4H14 A;  3BOP A;  5CIR A;  4IEP A;  2HEY F;  1SLI A;  5FYI A;  1W2N A;  3E5Q A;  3J8F 1;  1DGW X;  3Q8F A;  3TOJ A;  3QOP A;  4IE0 A;  4YW7 A;  3VD9 A;  3M70 A;  3RZM A;  5JLV A;  3BAL A;  1CQ9 A;  4MGZ E;  2K2S A;  3ZFF C;  5C5U A;  4PLN A;  4K1Z A;  5AVA A;  3PVO A;  3ZN4 A;  4RD7 A;  1GZC A;  1R1Z A;  3M3E A;  3VBO B;  4COV A;  4PIX A;  3WY6 A;  1PO1 2;  4YFZ A;  1W9T A;  3JQW A;  3E5X A;  2BOJ A;  4JKM A;  4JDN A;  4GXL A;  3RWK X;  4ZKT B;  2HWE 3;  2PHL A;  3IAQ A;  2G1M A;  4IGQ A;  1UYY A;  3B69 A;  5K0U B;  3S0M A;  2DV9 A;  4LT5 A;  2JB4 A;  4NOT A;  2JG8 C;  1CD3 G;  2HH9 A;  4RA0 A;  4DS0 A;  1H8T B;  1AR6 1;  2W1Q A;  2Y26 A;  4DB5 A;  1LU2 A;  1UPI A;  1MQT B;  3RZL A;  3KT7 A;  4LK7 A;  4N8M A;  2EAL A;  5IFT A;  4IES A;  1KGY A;  4JVA A;  3RMX A;  4P9L A;  4XBN A;  3URF A;  2GAL A;  5FZO B;  2GNB A;  4UW6 A;  1OKQ A;  4KG0 A;  2W92 A;  1WBL A;  5A6Z A;  4FVV A;  4Y33 A;  5FTT C;  4XDP A;  4XYX A;  3DCQ A;  2D6O X;  2EIC A;  3FN9 A;  4I0B A;  3WG3 A;  3ZXD A;  2KA3 A;  1MS4 A;  1ND3 A;  5FWJ A;  4F7Z A;  5HXV A;  1OPO A;  3POE A;  4CXY A;  1OVP A;  2RG4 A;  5FMC A;  5JXH A;  1KD7 A;  4LOS A;  1W8N A;  4UXA A;  2J1V A;  3IWZ A;  1UZV A;  2FZ1 A;  2JKX A;  3H1M A;  3FHQ A;  2J1S A;  2Y6G A;  2PHU A;  4W6Y A;  1AR7 2;  5T5P A;  1WW5 A;  1YI9 A;  3KHC A;  2P34 A;  3LEG A;  5C7G A;  2RR1 2;  2ZGK A;  2Y38 A;  3B00 A;  3EB7 A;  4XIO A;  2IWG B;  1MEC 1;  2Q1F A;  3B9I A;  1W9W A;  4EWE A;  2WII B;  1QJY 3;  3HBK A;  3ZR5 A;  1ZRI A;  3AVR A;  4AEJ A;  3U0Z A;  3P3N A;  2Q0A A;  4DNY A;  1LCL A;  1S0I A;  4XQW A;  4B1L A;  2PA7 A;  3IKW A;  4CXX A;  3T2O A;  1TMF 1;  4BLJ A;  1DBN A;  2MEV 2;  1EAH 3;  5FZC A;  1AYN 2;  2RS1 3;  3PTY A;  5A7W A;  2E31 A;  2R07 1;  1R1A 2;  3RVH A;  2D40 A;  3J7N A;  3ZIX A;  4QAW A;  1DCS A;  1XU1 A;  1J3R A;  3THP A;  5ACA 3;  3ZR6 A;  1RB8 G;  3N9P A;  2BEO A;  1PO2 3;  2BNO A;  2RM2 3;  2VMG A;  3LIH A;  4M3C E;  4XMA A;  1XPW A;  1QJY 1;  3DYO A;  3HMY A;  2OZ6 A;  5FO9 B;  1V00 A;  3MV1 1;  1UY0 A;  1VBE 2;  5FYB A;  4NHL A;  2BOI A;  3ACH A;  3NV2 A;  4LK6 A;  1C28 A;  1TVG A;  2VUL A;  4YZ4 A;  3PME A;  5FZI A;  1RUI 3;  3QD6 A;  3UET A;  4BK5 A;  1CGP A;  3ACI A;  5JMO A;  5ABJ B;  4M3C B;  1F5F A;  3M3Q A;  4YVW C;  1ACC A;  4KWL A;  4HVR A;  1TG7 A;  4AI8 A;  5EIY B;  5JPM B;  2XB6 C;  3C3V A;  1HB4 A;  3PHM A;  3PTR B;  2I45 A;  4L2N A;  2R1B A;  4NPR A;  2ZHK A;  2CDO A;  2WNO A;  5FYM A;  2C9A A;  3ZN5 A;  1LEM A;  3DKQ A;  3AC0 A;  1GSL A;  1UF2 C;  5CFD B;  4Z2W A;  1QWR A;  1OLQ A;  5IYY A;  3TNQ A;  3ZDV A;  2ES3 A;  3R4S A;  5F5A A;  4AEK A;  4E27 A;  4DMI A;  5DN2 A;  1ASJ 2;  2VTX A;  4LUM A;  2NPI A;  4FTB A;  1NYW A;  5L73 A;  1GBG A;  3L9J T;  2HWD 2;  3ZYG A;  5FUI A;  1CAW B;  2TNF A;  4BCU A;  3H3U A;  1BBT 1;  1ZZ6 A;  2RS5 1;  2W9X A;  1JH5 A;  1OF3 A;  4Q4Y 2;  5FZ3 A;  4NII A;  3DYP A;  5F3C A;  4CDX A;  2JIC A;  1AF9 A;  1S0G A;  2ZAH A;  4IEZ A;  3RQ0 A;  1RUD 2;  3ME2 A;  4O61 A;  5A32 A;  1WCK A;  3D6E A;  3OGR A;  5DUW A;  1YFX A;  1HJG A;  2HWE 2;  3WW3 A;  1JU3 A;  1QJU 1;  4R9A A;  2JE8 A;  3WNM A;  3TAY A;  1LGC A;  1H1I A;  4GB3 3;  2D3R A;  1QQP 2;  4GWM A;  2P3Y A;  2Y64 A;  4K21 A;  3DN7 A;  2QQI A;  2XHN A;  2HWF 2;  3LB9 A;  3H42 B;  4KI5 M;  3VBH A;  4J6G A;  4PF5 A;  4YZ3 A;  4CCN A;  3AM2 A;  3NL1 A;  4DIN B;  2NMO A;  1MVE A;  2VOX A;  1T6G C;  4BXF A;  5A7Q A;  3ALQ A;  1V6M A;  1K12 A;  4FBF A;  3AKR A;  3VBO A;  4Y5Z 0;  1UX6 A;  1W2T A;  4Y1Y A;  4MXW A;  5C3Q A;  1F4H A;  2C1F A;  2ZEZ A;  1C8M 2;  3AX4 A;  1PK6 B;  2BVV A;  4MVT A;  4QM9 A;  3EO6 A;  2AYH A;  3KM5 A;  3LD8 A;  3POF A;  2E51 A;  4AQT A;  1YXW A;  4AFB A;  5J96 B;  4FTS A;  3POB A;  5I8S A;  3VBF A;  1OLR A;  1XNK A;  4FSJ A;  3PJY A;  2GZW A;  1RUG 3;  2D5H A;  1RIR A;  2D97 A;  5CVR A;  5E89 A;  1Z7S 1;  3ELN A;  3OD4 A;  4HKO A;  2VZO A;  3OCP A;  1S0J A;  3DPR A;  3I2J A;  3GDB A;  1PVC 2;  1ZBA 2;  2ET7 A;  5FYS A;  1JZ5 A;  2W91 A;  2ZX0 A;  1R1A 1;  4FCA A;  5FZH A;  1LJ7 A;  3RRD A;  3NNG A;  1OSG A;  2DUR A;  3PVB B;  4YPJ A;  3TN9 1;  2EF6 A;  1Y3T A;  3B5L B;  4GIQ A;  4XTP A;  1AXK A;  4FO9 A;  5HI0 A;  4WM7 B;  2BW8 A;  2CGN A;  4O9G A;  4Q27 A;  1AX1 A;  4ZU5 A;  4F83 A;  4CEW C;  2XWB B;  5EYX A;  5JIU A;  2WZP P;  3KCC A;  3IPV B;  5DUX A;  5GLU A;  4LJH A;  5FYZ A;  3SEE A;  3SEP A;  1NQJ A;  3INA A;  4Y20 B;  2ZA9 A;  2BBA A;  3NV4 A;  5EYY A;  3RJR A;  4E4H A;  1D7P M;  2DFC A;  4Q4V 2;  5DAW A;  1NQD A;  2VMH A;  3MW4 A;  3POS A;  4QPY A;  4A7Y A;  5ACA 2;  3ZFG B;  2IUW A;  2XJT A;  4OI1 A;  2WNU B;  4EZH A;  1LOD A;  1SMV A;  1W04 A;  3OGJ A;  2VEC A;  3GM8 A;  2PHT A;  5GLV A;  2BU9 A;  1VBD 3;  2OZJ A;  1OH3 A;  3WVJ A;  3H50 A;  3VBH C;  4XQD A;  5DG1 A;  3R4D B;  1D0H A;  3IDA A;  3PL0 A;  4Q8L A;  4P9W A;  4RGG A;  4FXG B;  2VG9 A;  1HRV 2;  1GQG A;  2J1E A;  1QDO A;  4ET7 A;  1UMZ A;  4K20 A;  3WP5 A;  1A6C A;  4GMP 3;  5K0U A;  1YQ5 A;  4CZS A;  2W39 A;  3PUQ A;  4URA A;  2E33 A;  4LIT A;  2W1S A;  5T54 A;  1ENS A;  1CAX B;  4YW1 A;  1F2N A;  3HQU A;  5C4W A;  1DLL A;  3USS A;  2W52 A;  4JRL A;  2WAO A;  1GOG A;  5DAV A;  4A41 A;  2B46 X;  4HT1 T;  3ZSL A;  2GMM A;  2VE1 A;  4IEX A;  1W8Z A;  1S0C A;  1MZE A;  2P37 A;  1HJF A;  1CAW A;  2AZ5 A;  2K46 A;  4P5Y A;  4AF9 A;  4NR1 A;  5C4W B;  1MEC 3;  1ZVF A;  1JYV A;  1GAN A;  2ZZQ A;  1QOS A;  1GFF 2;  5FXW A;  3MZH A;  2WZE A;  4O7X A;  1O4Y A;  4LKF A;  4D3W A;  1QGL A;  3VZL A;  1UIJ A;  5F7U A;  1AXY A;  1YNA A;  4RGA A;  2V5D A;  1TZO A;  4LUL A;  2VL4 A;  1XRU A;  2UY9 A;  3WDU A;  3AYE A;  2R06 2;  2HWB 1;  4AED C;  1EP0 A;  5FQ0 A;  4DIQ A;  3GZU C;  4AQ2 A;  2OA2 A;  1BHG A;  1JS9 A;  4DFS A;  3ZSJ A;  4F8A A;  3PJQ A;  4Y1U A;  2PN5 A;  1V6J A;  5KHG A;  2XLG A;  4FOY A;  1AL0 G;  5C3P A;  3IB3 A;  2GC3 A;  5AC9 2;  1PIV 1;  4CYD A;  5F5Q A;  4W8J A;  1O3Q A;  3N7J A;  2QQJ A;  2FDK A;  5F5I A;  4JQT A;  2BQP A;  2JG9 B;  3ZYH A;  1H0B A;  4CTE A;  1OQE A;  5FPU A;  3R4U A;  5LAT A;  4XF9 A;  2XR4 A;  5FP3 A;  4AI2 A;  2HWF 3;  1MAC A;  2WFP A;  3WF2 A;  2VMF A;  1KJL A;  1SDW A;  4TN7 A;  1UL9 A;  1PK6 A;  1W2A X;  3LOI A;  1BEV 2;  4Q0S A;  5EPA A;  2RJK A;  5I0T A;  1L3J A;  1AL2 2;  2QQL A;  2F6B A;  2OT7 A;  1MS5 A;  2J7M A;  4IV1 C;  3AMM A;  1ODM A;  5FPA A;  4EN8 B;  1NE4 A;  1DGR A;  3NJY A;  5FZL A;  4CDU A;  3W5M A;  1QKQ A;  1JXN A;  3THT A;  3KV9 A;  1FMD 1;  5JOY A;  1C8M 3;  3A0K A;  5DUV A;  3ZSM A;  4BIO A;  4MHU A;  4QHB A;  4I0A A;  4FPL A;  1ULO A;  4BLI A;  4LUK A;  4OHW A;  2GC2 A;  1ZRE A;  3HNM A;  2BPA 2;  5FZ6 A;  3DPR B;  1UMI A;  1AYM 1;  4E9K A;  4CDX C;  1V6N A;  2VMD A;  1V6I A;  1PX4 A;  4RHV 2;  5FQ0 B;  4AK3 A;  1RUG 2;  3WDY A;  1RED A;  3VZM A;  3GNE A;  4EN7 B;  2BVB A;  5BNN A;  4CDQ B;  2ZZJ A;  4G9S B;  2W3J A;  3MUY 1;  3LPF A;  1Y9Q A;  2JIJ A;  3FFQ A;  4CCE A;  4RYD A;  4LBK A;  4DEV A;  4NRP A;  3JXS A;  1POV 3;  4N9H A;  1JYI A;  2VCB A;  5C9A C;  1JTZ X;  1VAM A;  4JRA A;  4MXV A;  1MVQ A;  1H2N A;  1W8T A;  3EYP A;  2DBI A;  3N7L A;  3OY8 A;  4N43 C;  5FKC A;  3LDK A;  3WLU A;  5JAX A;  1VBC 2;  1BK0 A;  2PAK A;  2OPW A;  3O5S A;  4MGI E;  2B7Y A;  1JZ7 A;  1QH6 A;  3WDW A;  2B42 B;  2ID4 A;  4UWD A;  5E1R A;  1HRI 2;  4LBL A;  1W6M B;  1QNW A;  3PUA A;  2O1Q A;  1PHM A;  2MNG A;  4V1P A;  3RYK A;  1G9A A;  5JCT A;  1PZ8 A;  4I01 A;  4FPJ A;  4O65 A;  1YIF A;  1OI6 A;  1S0E A;  5BNP B;  1VMH A;  5A3O A;  5FY7 A;  2Y6H A;  4YM0 A;  2YFU A;  3I4I A;  5BPX A;  4OQ8 A;  3KGL A;  1O6U A;  1ZNP A;  1NLQ A;  3CDZ B;  1OOP B;  1Q56 A;  1SBD A;  4RR3 A;  3WD5 A;  2OX0 A;  1KRI A;  1AX2 A;  1B35 C;  4PDW C;  1OUX A;  3I3D A;  1E5S A;  4XJU A;  4UBH A;  2VTF A;  1MS0 A;  3WP4 A;  4C1X A;  4D94 A;  2AC1 A;  3N35 A;  3O1O A;  2FMY A;  5I8T A;  3OTF A;  2B39 A;  2ZHL A;  2PEL A;  4WZF A;  5A6X A;  4AED A;  4CEY B;  2JD9 A;  2ZAB A;  2D7F A;  1W8O A;  5HXM A;  5JDB A;  5DZF A;  4YGC A;  3FMG A;  3VBS C;  1X9P A;  4LBQ A;  1SPP A;  4A6O A;  2XDV A;  3PVE A;  1HN0 A;  1QXJ A;  1RUG 1;  4NPM A;  4ARY A;  1NCR A;  4Y24 A;  4N7I A;  3EHK A;  4QX3 A;  4MG2 A;  5IVF A;  2WZR 1;  2OUJ A;  4AHZ A;  3KHB A;  3WF0 A;  1O59 A;  5H9Q A;  2VME A;  2W1U A;  4Q29 A;  3E6C C;  2DCY A;  2QVS B;  2ZGL A;  4HK8 A;  3LSE A;  4LBN A;  3WQB A;  2N7G A;  3VDD B;  3MFC A;  2IVJ A;  3K75 B;  3MEP A;  1LTE A;  2PHD A;  5IHR A;  5JXG A;  4AAP A;  4WBB A;  1R08 2;  2GN7 A;  2IFR A;  2F4P A;  2B4K A;  1LNS A;  2JEM A;  4RQP B;  5A1F A;  5FMO S;  1AL2 1;  4IET A;  2XXZ A;  4UF0 A;  5FIX A;  3IM0 A;  4FOQ A;  1W2O A;  4BXS V;  4Q5O A;  1OLM E;  4XFB A;  5LWB A;  5K7P A;  4QPI A;  3ROU A;  3UKT A;  5AC9 3;  4Y1X A;  3KLS A;  3H8U A;  1PO1 1;  5IVY A;  2G9F A;  4XBQ A;  4JV4 A;  1N1V A;  5LK7 B;  1JYT A;  4LBQ D;  3N3H A;  3VBU C;  3N9N A;  1IHM A;  3PUI A;  2K9Z A;  1GWL A;  4RSU A;  1J84 A;  5KC5 A;  4V2W A;  1SLB A;  2F17 A;  3D4K A;  5L9B A;  4R4X A;  1Z0H A;  4CVU A;  1DQ5 A;  1CVN A;  1WMF A;  5FK7 A;  2X5I C;  1BMV 2;  5FZ7 A;  4IGP A;  3BIW E;  4JGY B;  4KMQ A;  4N53 B;  3HAG A;  4ZON A;  3L2H A;  1L7R A;  4OUE A;  3AMQ A;  1NCR B;  2C4X A;  4XAE A;  2Y0O A;  2EXH A;  2DYC A;  4TWT A;  4Y20 A;  4YG0 A;  1W8F A;  1YC6 1;  3CO2 A;  2DUQ A;  3SLI A;  3HD8 B;  1EYB A;  3U10 A;  4BQY A;  1AR9 1;  2BFU S;  4XFH A;  4BB3 A;  2WSV A;  1OKO A;  2DDU A;  3AZZ A;  1W8H A;  1H9W A;  1LGB A;  2ZX3 A;  3GHN A;  3WHT A;  2R07 3;  3JB4 C;  4IUG A;  4GAZ A;  4YRD A;  1Z78 A;  2LAL A;  4FPC A;  2QKD A;  1MPX A;  4LKS A;  4DY5 A;  4RHV 3;  4UF0 B;  3LA7 A;  1J3P A;  5BNO C;  1DFQ A;  5FZ8 A;  3WW1 A;  2VZQ A;  1RIT A;  1K5J A;  2YPD A;  1HQN A;  3OY8 B;  1DGW A;  4AYU A;  1MS8 A;  1SAC A;  5A3M A;  2Y33 A;  4YVW A;  1UOB A;  2DVB A;  4XDO A;  1B35 A;  3RZH A;  1PO2 1;  5F39 A;  5IK7 A;  4H3W A;  3B93 A;  5C8C B;  3WF4 A;  1QF3 A;  2BNN A;  1X33 A;  2E53 A;  3D82 A;  1CAX A;  1PM7 A;  3AKS A;  2RE9 A;  4WVZ A;  5FFO C;  4CU8 A;  2VTX J;  1RUI 1;  4OHY A;  2CWM A;  1O5U A;  4LKD A;  1W0O A;  4UFM A;  3DXU A;  3HNB M;  4QGN A;  4MV2 A;  4D7T A;  1EAH 1;  1GOF A;  2ZGT A;  3GYD A;  5CFC C;  1NY7 2;  3I3E A;  4Q2F A;  3UL2 A;  4XUP A;  4AE2 A;  4CSW A;  3K48 A;  1UU6 A;  4YGB A;  5FP8 A;  5FKB A;  3K77 A;  3U4X A;  4EV0 A;  4IEO A;  1NCQ B;  1XE7 A;  1M06 G;  3WNO A;  4BQ4 A;  4C0B A;  3ZXJ A;  3ES4 A;  4GZ9 A;  3V0B A;  5J7M A;  2HJI A;  4AFM A;  2W94 A;  1E57 A;  3OEA A;  2ZX4 A;  3V0A A;  1JOB A;  2VBP A;  1OVS A;  1CES A;  2SBA A;  3S57 A;  1W8W A;  1GMM A;  3ZN6 B;  2EAA A;  3W59 A;  1UU5 A;  1GQP A;  1IS3 A;  1AUY A;  1G86 A;  2GND A;  1GZW A;  1VMF A;  2XKP A;  3MPB A;  3B01 A;  1UQX A;  1H8T A;  4J1W A;  4XF4 A;  2WC2 A;  4OUL A;  4HPK B;  1XND A;  3J8F 2;  5GJ6 A;  5LEK A;  4ISQ A;  4ZU7 A;  1H4G A;  5G05 L;  1FOD 1;  5I8Y A;  4NMI A;  1LHW A;  3LDR A;  1K5M A;  3NNJ A;  5SV8 A;  2UU8 A;  4XUQ A;  4QX2 A;  1NUK A;  3MBW A;  1F4A A;  1PZ9 A;  3RGB A;  5IWF A;  3ASI A;  2DBN A;  1PIV 2;  3DEC A;  3WOG A;  1ULD A;  1X36 A;  3WX5 A;  4LBO A;  3VDA A;  5JSO A;  4GB3 1;  4YAR A;  1UZ0 A;  3PVN A;  3B94 A;  3ILR A;  3JD7 2;  5T3N A;  4AHY A;  3AP6 A;  1IS5 A;  3N36 A;  5CB7 A;  2HWF 1;  4KH9 A;  4K7J A;  5HBA A;  1BLZ A;  1QJX 3;  1WW6 A;  3CIH A;  2CNA A;  2PHX A;  2IXK A;  1TME 2;  4IEV A;  1YO8 A;  2ZX2 A;  1DZR A;  5F9T A;  3T09 A;  2PQS A;  3UK9 A;  2XVL A;  4QM8 A;  3GCX A;  4LO8 A;  4MH0 E;  1RUE 2;  3IDE A;  3RYP A;  4SBV A;  1R08 3;  3EJK A;  5E16 A;  1PMI A;  5T55 A;  4LNV A;  1IKP A;  5FMO L;  5CBL A;  1VBC 1;  1ULG A;  5D1I A;  3SMH A;  2TEP A;  4OHZ A;  4EYU A;  5A7P A;  4AVC A;  4NPL A;  1H6Y A;  4PIY A;  5F2W A;  4BH9 A;  2ARE A;  2JDZ A;  1BXH A;  1NLS A;  4I30 A;  1QY4 A;  2ZGQ A;  4Q0P A;  1EV1 1;  1YIP A;  5FPB A;  3VBR A;  4ZY9 A;  4BWO A;  1A34 A;  2ZGM A;  2YG0 A;  2ZAA A;  2G9Z A;  3DF0 A;  4S2D A;  5BNQ A;  2HYX A;  4GD4 A;  1S0F A;  3MO4 A;  4LEJ A;  4NIH A;  1UIK A;  2WT0 A;  2VNO A;  1UOF A;  4OI0 A;  1MQT A;  4CRQ A;  4DY3 A;  4DUV A;  1NA1 B;  2WS9 1;  3IIA A;  3MID A;  3AFK A;  1YFU A;  1WD4 A;  5BNN C;  1RUD 3;  2R1D A;  1RUH 3;  3ZFE A;  3ZYI B;  1NT0 A;  4KNC A;  1OFS A;  3V56 A;  2QQM A;  4QX8 A;  3ZXF A;  1QXR A;  4AR2 A;  2B9V A;  1EPW A;  1HV1 A;  2PHR A;  1RUF 2;  1OA2 A;  2OS2 A;  1Y4W A;  3T0D A;  5FO7 B;  1SLC A;  5FPX A;  5C9A A;  1DQ1 A;  4NUB A;  5CAZ A;  4XZU G;  2JE7 A;  5CG8 A;  1RIN A;  1GQH A;  1ZA4 A;  1UN1 A;  4K6B A;  4AVB A;  1PO1 3;  4ATE A;  1N47 A;  3QAC A;  1OT5 A;  2H6B A;  5CYY A;  2YBP A;  5IT6 A;  1RUE 1;  1G8W A;  2GSY A;  1KDK A;  3KQ4 B;  5F6K A;  5T50 A;  2V5Y A;  4IE4 A;  1YCI A;  1WW4 A;  3OPT A;  1S2E A;  2OVU A;  2AUY A;  3CEW A;  4QT6 A;  4XMI A;  4Y3O A;  3WQ1 A;  2BTV C;  1Y43 B;  2XL7 A;  4JCK A;  3IDB B;  1KJR A;  4UW4 A;  4EN6 B;  1E5I A;  1Q8Q A;  2WS9 2;  2RMU 1;  3RNS A;  4E2Q A;  1O5L A;  3I54 A;  2J1R A;  4N7U A;  4RGK A;  3VBR B;  1DGR N;  3MHZ A;  5I93 A;  2D44 A;  2ZEW A;  3I3M A;  3OD0 A;  3SIT A;  2ZGS A;  5ANQ A;  4ES8 A;  5L7O A;  2WZ8 A;  4OHV A;  3SHR A;  1FAT A;  2WNV B;  4TZD A;  2YV8 A;  4ITC A;  2EIB A;  1BJQ A;  4QPG C;  1OD5 A;  1RXF A;  3U1X A;  1WCU A;  5CKN A;  2XON A;  2WWJ A;  1LOB A;  1MS9 A;  4Q1R A;  5L36 A;  4JHT A;  5D8A B;  1W9S A;  2WZR 3;  1RMU 3;  2CU5 A;  2X8K A;  5FY8 A;  5JZG B;  1FYU A;  4YZ2 A;  2QQW A;  4CCL A;  3AP7 A;  1XE8 A;  4ZZ5 A;  4QU1 A;  4AFD A;  1RHI 1;  4XF0 A;  5FY9 A;  2DVG A;  2YBK A;  1ZM1 A;  2UY8 A;  4IEY A;  2FCT A;  2RR1 3;  4YVS B;  3WCS A;  4EWD A;  4B7E A;  1RUO A;  1F35 A;  4HLT A;  1QJY 2;  1K5M B;  5FZ4 A;  5FXZ A;  4AFC A;  2XBO 1;  3UGH A;  4Z2A A;  1K42 A;  4IEU A;  5C6C A;  2C26 A;  1G9B A;  2YFZ A;  5T5L A;  3J4U H;  3VHO A;  4XVH A;  3V65 A;  2ZMK A;  4ASK A;  1N3P A;  2I2S A;  3I2G A;  1WD3 A;  1PVC 1;  1ZBA 1;  1AYN 3;  4BQW A;  2WBK A;  2VUA A;  4KU7 A;  4DRV A;  5LRR A;  2ZS6 B;  2LRO A;  2YU1 A;  3ZFF B;  1WLW A;  3KF5 A;  3MW3 A;  2P1B A;  1VBD 2;  4N53 A;  1OMI A;  4XHX A;  3HBZ A;  1QJU 3;  5FZ0 A;  1XSQ A;  2W47 A;  3BOW A;  2WYF A;  2R30 A;  2P3J A;  1DQ0 A;  2RM2 2;  2FCV A;  4JZR A;  3ZSE A;  1H30 A;  2YC2 A;  1Y9G A;  5JSP A;  2VUC A;  1ULP A;  1XNT A;  1OOP A;  4RR3 B;  2ORX A;  4FPO B;  4LO7 A;  4PBP A;  5C3O A;  1ZRF A;  4AI9 A;  3P6B A;  3VD4 A;  5EQU A;  1LED A;  2JG8 B;  3H3Z A;  3ZM8 A;  1NXM A;  1ASJ 1;  2ZEY A;  1IPS A;  4KWK A;  4OCT A;  4PI2 A;  3I2K A;  1CX1 A;  3VKN A;  5FZD A;  4OUM A;  3KF3 A;  1D4M 1;  4I2O A;  4PIZ A;  1FMD 3;  2E26 A;  1RUN A;  1WLD A;  2Y34 A;  4CCJ A;  3PMS A;  1KS5 A;  3VBF B;  5D2A A;  5LA2 A;  1NY7 1;  5JXI A;  1T6B X;  1R09 2;  2JEC A;  4U2A A;  2WA4 A;  1UY2 A;  3T1L A;  5FY0 A;  4COW A;  2SLI A;  3BN6 A;  1ND3 B;  2FHR A;  3OUH A;  4QXC A;  4WM8 C;  4D7S A;  3VDD A;  3G7D A;  1LEN A;  4EJR A;  3LKJ A;  2JDK A;  1O8P A;  3POJ A;  1RYY A;  3UKV A;  1VBB 2;  1UNB A;  3JBG 1;  3D0J A;  3AL6 A;  4R4Z A;  4OHX A;  5FYU A;  4JAA A;  2HWD 3;  2WSU A;  4XDQ A;  1S0D A;  2IXJ A;  4BIF A;  2VR4 A;  3ZFF A;  2XVG A;  4QB2 A;  1IS4 A;  4FOW A;  1O4T A;  2DTY A;  2DUP A;  1K45 A;  1QH7 A;  1FT9 A;  2WNE A;  2C24 A;  4CCM A;  4NRQ A;  1C8M 1;  5F1R A;  5F3G A;  4XCA A;  1BQP A;  1MZ5 A;  2XHK A;  5A3L A;  3T4V A;  3WG1 A;  3W58 A;  3MPP G;  3WUD A;  2WLQ A;  3LSD A;  4OI4 A;  3C7E A;  3WW2 A;  5LB6 A;  5HCH A;  2QQO A;  4JC1 A;  3JBG 3;  1SZB A;  1U5I A;  1D2Q A;  3WG4 A;  2A5Z A;  4LBJ A;  1OLM A;  4IE5 A;  1W9Y A;  3UV9 A;  5A33 B;  2DVD A;  1LHN A;  5I0R A;  4XET A;  4XXA A;  3UES A;  4RS5 B;  4MGS A;  3GZT B;  2WS9 3;  3ZSK A;  3TBD A;  1ZZ8 A;  1WKY A;  1H6X A;  4ZHN A;  4AGV A;  3QBQ A;  3OBT A;  2XKO A;  3CKH A;  1LR5 A;  3I59 B;  4W6X A;  4XOG A;  3NJX A;  3T3Y A;  3USU B;  2R7E B;  3I8T A;  4OUS A;  2VNV A;  1RUJ 1;  5CZK A;  2Z79 A;  3O12 A;  3K3O A;  3LIG A;  2ORZ A;  1RUC 2;  1GR3 A;  4QXH A;  3NVC A;  3VZJ A;  5TSW A;  1ENQ A;  4BOW A;  5EV7 A;  3ZIW A;  2CY6 A;  4YVW B;  3P5B A;  1GNY A;  2WZR 2;  3PIG A;  1DGL A;  2E32 A;  3LEI A;  1G9F A;  3UGF A;  2E6V A;  1NAE A;  2VUJ A;  1VB2 A;  1WLC A;  1JZ3 A;  2D6L X;  1JYN A;  1V9U 2;  5LEJ A;  4LE4 A;  2BFU L;  1HXS 3;  3I3Q A;  5CFD C;  1H2K A;  3ACG A;  1CZS A;  3ILF A;  2WT1 A;  4QMA A;  5FMB A;  3WW4 A;  1CAV B;  4XAB A;  2GAU A;  1UZW A;  1W6O A;  2VVE A;  5BV6 A;  4RQP A;  1ND2 A;  1VRB A;  1KQR A;  3C7F A;  2A1X A;  4IE6 A;  2VW1 A;  4LR4 A;  4NHM A;  5A7S A;  4B3N A;  3AYD A;  1FPN 3;  1PM4 A;  1Y9M A;  1ZZC A;  1GYK A;  3KVB A;  1W06 A;  4DRR A;  2HBU A;  3WXP A;  1AJO A;  4ZZ8 A;  4QGM A;  2A3Y A;  1FV2 A;  4S2G A;  4UFL A;  3VD3 A;  1S1A A;  2VMC A;  4GKX A;  3QCW A;  2UWA A;  4A7Z A;  2LTN A;  5B4N A;  3C2U A;  4OQ9 A;  4DOU A;  5FZF A;  2WAA A;  1VBE 3;  5A7N A;  1DP0 A;  3USU A;  3AJZ A;  1PMH X;  1Q3E A;  3T2P A;  2W95 A;  4H7M A;  2JXA A;  4NHX A;  4Y1Z A;  2A6X A;  1GZW B;  1ND2 B;  2J1U A;  4YWA A;  4B29 A;  5LW9 A;  4Q8K A;  3OPW A;  4GH4 B;  5A32 B;  5A3T A;  2CHH A;  1MS1 A;  5JVV A;  2VJX A;  3AKQ A;  1YQ6 A;  4COU A;  4N90 A;  4DZG A;  3BPS A;  4YNI A;  2W08 A;  3KZ4 C;  4B8E A;  4XZP A;  5A3N A;  4KGQ A;  3SIS A;  4LMF A;  4SLI A;  3WF1 A;  4UFH A;  5ANN A;  1DDL A;  2Q1M A;  2ZML A;  4QGL A;  4CPB A;  1PNG A;  5A1A A;  1VRH 1;  1ZZ7 A;  3HIF A;  3LWC A;  3WDX A;  4CU7 A;  1G9C A;  4YW2 A;  4AG4 A;  4BQ3 A;  1UPS A;  4AQS A;  3JU9 A;  3SQO A;  2WUH A;  5LAS A;  1PNF A;  2GMP A;  4A4A A;  4XAA A;  4JTN A;  5E6H A;  5FZK A;  3CZJ A;  4JGZ C;  2X10 A;  1PK6 C;  1O3R A;  1AX0 A;  2VU9 A;  3BKZ A;  1CN1 A;  2Z4F A;  4CP1 A;  4IW3 A;  3SKV A;  1X82 A;  3MUZ 1;  4CU9 A;  2QQN A;  1VBB 3;  4Q1P A;  1PZ7 A;  2BP6 A;  4MUV A;  1GZ9 A;  4TYS A;  5IVE A;  2P5B A;  4OZX A;  2QZ2 A;  3NO8 A;  1IS6 A;  2NM1 A;  2Q1Z B;  4Q4X 2;  4XBL A;  4BZ4 A;  3KVA A;  1CPN A;  4M4R A;  3ZO0 B;  3VDB A;  3AJY A;  1VLN A;  4CDW A;  2JX9 A;  5CKM A;  4C0H A;  1QQP 3;  5HCB A;  3SXW A;  4NAM A;  1XQN A;  3HNY M;  3NJV A;  5KHJ A;  3TEY A;  1L7Q A;  1UAI A;  2A71 A;  4QX1 A;  2BBV A;  4NHY A;  2BGP A;  1GUI A;  3WP3 A;  1EUT A;  4LBQ B;  2CYF A;  2YGM A;  3ENR A;  4P9G A;  5DZE A;  5FLI A;  2WFF 3;  1YUD A;  3HQR A;  5IK4 A;  1CAU A;  1WW7 A;  2WYS A;  3NST A;  1N1T A;  1PGW 1;  2QCS B;  5FYY A;  1E5R A;  5LY1 A;  3I97 A;  3AYA A;  5FYV A;  3LEM A;  1SFY A;  3OBZ A;  1OHF A;  1UD1 A;  1KXG A;  1OQD A;  4UOJ A;  3TWI A;  4CDW B;  2BUK A;  5KXB A;  3MLL A;  3BIE A;  1D4M 2;  1PGS A;  3ZFG C;  1V6L A;  4Z82 A;  4I09 A;  3ZFE B;  3H8X A;  2WNU C;  2R07 2;  3NMB A;  4BMB A;  2WO1 A;  4PQQ A;  3NW4 A;  1N1S A;  1UYX A;  2C0Z A;  3CJI A;  3DV8 A;  3ZPO A;  1QHD A;  3OGG A;  4JQR A;  1W90 A;  1SEF A;  5A3W A;  2H6C A;  2V72 A;  3JD7 1;  3VD7 A;  5EJ1 B;  3AYC A;  4K8F A;  2VZS A;  1LOG A;  3U37 A;  1UCX A;  1LOE A;  3LCP A;  1C5H A;  1H9P A;  1KDM A;  1XYP A;  1BVV A;  3HR9 A;  3M7A A;  1JZ6 A;  4DXR A;  2B45 X;  4KBZ A;  2O8Q A;  5LA9 A;  3WG2 A;  1UKR A;  3LZZ A;  1YYN A;  4IGO A;  1JZ2 A;  2YUE A;  3WQ7 A;  4QQH A;  4Q0V A;  5BUV A;  2LRP A;  2ZGO A;  3NV3 A;  4AW7 A;  3FE5 A;  4NWV A;  1W3X A;  4IV3 B;  4BDV B;  4X8N A;  1FPN 2;  5D8A A;  3RZZ A;  2DVF A;  3ZXK A;  1VBC 3;  3GZA A;  4CCK A;  2VQT A;  2LW8 A;  4XIK A;  5LA0 A;  4CPB D;  1DQ6 A;  4ARX A;  1VP6 A;  5LBB A;  4QB6 A;  5JOX A;  2FZ2 A;  3FUQ A;  4YSF A;  3BU7 A;  2D3S A;  2UUR A;  4AED B;  5DDJ 1;  4B1M A;  2JDM A;  4AVA A;  4Z92 B;  1AJK A;  1UXZ A;  2VQA A;  4G3Y C;  4PI0 A;  1OA3 A;  2IXC A;  1IGO A;  4FXK B;  2ZGN A;  3ZXG A;  2D3P A;  1QJF A;  5A7O A;  1J58 A;  1QMJ A;  1OUS A;  2VD7 A;  3VGI A;  3E5U A;  5A70 A;  5DG2 A;  3GBF A;  1ZYB A;  4B7K A;  4EZ4 A;  3FJS A;  2DCZ A;  3FHA A;  4FPY A;  2FDH A;  1X8E A;  3BTZ A;  3R05 A;  1RUJ 3;  5K4L A;  3MIH A;  3WR0 A;  1HQW A;  1EUU A;  2AAC A;  2Z42 A;  1Y7B A;  2EA7 A;  3J7H A;  4GWI A;  2F4L A;  3RI9 A;  1UW8 A;  3THD A;  2XGX A;  1QJE A;  4G4F A;  5DDJ 2;  5FP4 A;  1PX3 A;  1N3O A;  2ADE A;  1AR8 2;  2BNM A;  1VJ2 A;  1WA6 X;  1IQD C;  2IXH A;  3IAP A;  4PQ9 A;  2DUO A;  4P08 A;  1ZRR A;  4HL0 A;  3IMM A;  1U5X A;  1QOO A;  1W6Q A;  2PHW A;  4IV1 B;  4MO3 M;  4FQ4 A;  4FP3 A;  3PIJ A;  1YQ8 A;  2P4E A;  4MGY E;  4M4P A;  5JR2 A;  2C9K A;  3BTY A;  1GLH A;  2D5F A;  5L7O C;  3WF3 A;  4KL1 A;  3WNL A;  1T2X A;  2D6K A;  3BB6 A;  5IK5 A;  3CU7 A;  2WN3 A;  3FBY A;  1XXN A;  2DTW A;  4HKL A;  3GBG A;  1W6O B;  5FLJ A;  5J98 B;  1LHV A;  2CSG A;  3NKG A;  1LEC A;  4HN1 A;  1IKQ A;  4EN9 B;  3WCR A;  3NV1 A;  1ONA A;  4FP2 A;  1F15 A;  4JHZ A;  4AVT A;  4XFF A;  2JDP A;  4CDQ A;  5FOJ B;  4NWW A;  1RJ7 A;  1HX6 A;  1TEI A;  2FBE A;  2XQR A;  5FRA A;  4BME A;  2RJL A;  1VBA 1;  2RS3 1;  3ZN6 A;  2R06 1;  4D69 A;  4EN0 A;  1WMD A;  1LUL A;  3NNF A;  3P3P A;  5I0D A;  4L11 A;  4TLG A;  4Q4X 1;  3VLB B;  1U12 A;  4N43 B;  2GNM A;  3SH5 A;  2D93 A;  5IUQ A;  2BER A;  2WFF 2;  4GMP 0;  5KXD A;  5LRS A;  2FDJ A;  4W6W A;  5KHI A;  5A6Y A;  3W9A A;  2J1A A;  3PU8 A;  1RHI 3;  4M0H A;  3RI8 A;  2P17 A;  2HYK A;  4DXS A;  4ISR A;  5DAP A;  3LFI A;  2AR6 A;  3AKP A;  3H8R A;  4WZC A;  4JKL A;  3O7O A;  4CP0 A;  3L2Y A;  1UX7 A;  1SFP A;  1VRH 2;  5BNP C;  4ORF A;  2QFE A;  5JXJ A;  2WO2 A;  3AZX A;  4QDQ A;  1O3S A;  1DG6 A;  1U5Y A;  5D21 A;  2E7Q A;  2EID A;  4XJ8 A;  3O14 A;  4N43 A;  4PDW B;  4RFT 0;  3VKL A;  1SLT A;  4BQX A;  4E8D A;  1FI2 A;  3T1M A;  3SCH A;  1PGL 2;  1I6X A;  1L7L A;  4OFG A;  2OUH A;  4XQ4 A;  4XUR A;  1B09 A;  2GP5 A;  4L92 A;  1W8U A;  4CE8 A;  1XYO A;  2W68 A;  3CF6 E;  5FPZ A;  1YHF A;  4Q0Q A;  3AKT A;  3C8X A;  2R0H A;  3CJX A;  4X8P A;  3S30 A;  4Y5S A;  3I3B A;  2QJV A;  2P3K A;  3E97 A;  3ES1 A;  4RL7 A;  5B2G B;  3ZXE A;  4A2U A;  4Q4W 1;  2JG8 A;  5FZE A;  3WSO A;  1ZZB A;  1HRI 3;  1C5I A;  2Q4S A;  2Z69 A;  2RV9 A;  3BGA A;  5C8C A;  4QX0 A;  4C8D A;  1R64 A;  4COZ A;  3UNP A;  3VDD C;  4QWN A;  1O8S A;  3SC7 X;  4Z1V A;  5CEH A;  5FPV A;  2VQ0 A;  1O7F A;  3MIB A;  3MYX A;  3U11 A;  1FOD 3;  3ZVX A;  5DAB A;  4P02 B;  3GGL A;  4BQ2 A;  1O4Z A;  1C3H A;  4AGR A;  5JI9 A;  1UYZ A;  3ZFG A;  1POQ A;  4YM1 A;  4WV8 A;  5FY4 A;  5KHK A;  4MYE A;  2V4V A;  3IZO A;  2XML A;  5LBF A;  4Y5T A;  1W6N A;  2V73 A;  4HON A;  4BK4 A;  3WNP A;  3SH3 A;  3III A;  4I0W B;  4XC9 A;  4TTG A;  3DXT A;  5IVV A;  2WWU A;  1HRI 1;  4QPI B;  5EWS A;  4DPN A;  5CKQ A;  5G04 L;  3HEI A;  3M8L A;  3VDC A;  1OA4 A;  2CTV A;  5FBZ A;  3ZLI A;  3IBM A;  5F37 A;  3VBU B;  4LHL A;  2EXK A;  2QZ3 A;  1CX4 A;  1AR7 1;  5DAQ A;  4XPV A;  4QKN A;  2DCK A;  3GAL A;  1X8M A;  3J8F 3;  3A4U A;  4MAD A;  4YG6 A;  5FZB A;  5KR7 A;  3FUO A;  3OYW A;  1AR8 3;  1CAU B;  1CZT A;  2X5I B;  4BHP A;  4D6Q A;  2PLV 2;  2V4A A;  1PGL 1;  1QJU 2;  2OYZ A;  4W4Z A;  1NXD 1;  5HV4 A;  1NCR C;  2XJU A;  4D6R A;  2YMZ A;  4LTA A;  5DUU A;  2QQV A;  4A42 A;  5IFP A;  5JZG A;  3AMH A;  1TMF 2;  3I2F A;  5DQ0 A;  4HMZ A;  1W99 A;  1BVP 1;  4LOT A;  4CCC A;  1H2M A;  5FUN A;  5BY5 A;  4BM8 A;  4NIG A;  3RZG A;  5GKA C;  3T0B A;  5JMC A;  1WLT A;  3CJI B;  4QD2 A;  1S4C A;  1ZA7 A;  2Y60 A;  1SLA A;  3LPG A;  1C1L A;  2D43 A;  1QOT A;  4MXW B;  2NQY A;  4MHR A;  2R04 3;  2YPJ A;  2K0G A;  1GP4 A;  2X5I A;  3A22 A;  2TUN A;  4QKF A;  3T2Q A;  3I7D A;  5J09 A;  1G7Y A;  3OF1 A;  4LE3 A;  1RUH 1;  4CDU C;  4XFI A;  5C8C C;  1ULC A;  4CA9 A;  2IFW A;  4UBG A;  4I3G A;  1GNZ A;  4OVE A;  1GU3 A;  2VUD A;  2R49 A;  2IC1 A;  2XJV A;  4WVW A;  5IJR A;  1ZBE 2;  5LA1 A;  3BI3 A;  5FJH A;  1GV9 A;  1AVB A;  4MLO A;  5M0T A;  4HSJ A;  1K3I A;  2ZHM A;  4WVV A;  1XSR A;  3IN9 A;  4YLZ A;  4DQA A;  3KT1 A;  3KGZ A;  4MSV A;  3HVD A;  1VPH A;  5CFC B;  1NKG A;  4LQR A;  3OYW B;  2R04 1;  3HOB A;  3OSD A;  5A33 A;  1OFN A;  4CEY A;  1WCQ A;  4YM3 A;  5C33 A;  3I2D A;  3FBM A;  5F3E A;  2IVI B;  3U75 A;  1R09 1;  1J1L A;  5FV3 A;  4A3X A;  3AVS A;  5ERL A;  3UYJ A;  1NCQ A;  2ETE A;  4R9C A;  1HB2 A;  1FV3 A;  5E88 A;  5J1X A;  1ZRD A;  2WQ8 A;  2C5D A;  4E8C A;  1AHS A;  1FNZ A;  5JSR A;  1H1A A;  1W9F A;  4FAG A;  1ZX5 A;  1J3Q A;  1RUF 3;  1JN2 P;  4HKW A;  4L97 A;  2DU1 A;  1QNY A;  2DCJ A;  4GJZ A;  1SDD B;  5DZG A;  3JBG 2;  2A7A A;  3NAP B;  3AP4 A;  3JUU A;  5J48 A;  5BYN A;  2ZKL A;  2W1W A;  4LXL A;  3WZ1 A;  5AFB A;  4FAH A;  4UFK A;  3RSJ A;  4KU8 A;  3ZPY A;  4D8M A;  2GC1 A;  2I07 B;  3ACL A;  1QEX A;  2Y6L A;  2UWB A;  2VO5 A;  4IE7 A;  4MGQ A;  3RG0 A;  3I49 A;  3OBA A;  5GM0 A;  2X09 A;  4QB1 A;  2B8M A;  2E7T A;  1COV 1;  4R9D A;  2VAU A;  4Y4Y A;  1BYH A;  5FYT A;  1VAK A;  4K8R B;  1FNY A;  2YC4 A;  3K4D A;  2NYY A;  1NG0 A;  2WDB A;  4WVM B;  2ZEX A;  1HRV 1;  2B5H A;  1BCX A;  2RMU 3;  4JX0 A;  2Y6K A;  4B4Q A;  4BE3 A;  2CGO A;  1A8M A;  1JI6 A;  4E4Z A;  2WO7 A;  3O1M A;  4GMP 1;  4AXO A;  2OXB A;  5GAL A;  3M3C A;  4NID A;  4ES9 A;  2A3W A;  2Y6F A;  3VBO C;  3EMR A;  2XBO 2;  2WIN B;  2XPJ A;  2DFB A;  2QBX A;  1V9U 3;  3FL7 A;  5FZ9 A;  2FQP A;  4HN0 A;  2BZD A;  1COV 3;  3LAG A;  4XW3 A;  4E2G A;  1YLL A;  3O0X A;  5DPN A;  4FPE A;  1OC1 A;  4JGY A;  3HWJ A;  4IXL A;  3AZV A;  3ZYR A;  3IMN A;  1AZD A;  5CNA A;  5K0U C;  3H1W A;  3S7I A;  3FFZ A;  3ZXA C;  4AOC A;  1QU0 A;  5LCW L;  1H8T C;  2VCC A;  4NO4 A;  3RWN A;  4D0Q A;  1RXG A;  4YW5 A;  1MQT C;  1CZV A;  4Q4W 3;  1W05 A;  2PTM A;  3Q9O A;  2MEV 3;  2CDP A;  3OJB A;  1HKD A;  3QH7 A;  4P9I A;  1PMJ X;  3H7J A;  1UYP A;  2ILM A;  3POW A;  1S0B A;  2JD4 A;  2OII A;  1I5P A;  3VUO A;  5KHH A;  1JYW A;  2PLV 3;  2XVK A;  3R6S A;  3V0A B;  1GP6 A;  5FP7 A;  4LO6 B;  5E8A A;  1QDC A;  4HBN A;  1KS4 A;  3ABZ A;  4E4S A;  2RS1 1;  5FOB B;  2HWC 1;  1AYN 1;  1WCD J;  3N4M A;  3WIN E;  1DYP A;  1WWY A;  1DLC A;  5FP9 A;  1N3Q A;  1OF4 A;  3N9L A;  4J1X A;  3B9C A;  4YZ5 A;  5JOZ A;  5HCA A;  4L99 A;  1LB2 A;  3LGR A;  4BA6 A;  4F3J A;  2UWC A;  1LKN A;  2G19 A;  4BQ5 A;  2JDH A;  3TRS B;  4LHN A;  2A73 B;  2J42 A;  1IG3 A;  1LOF C;  2VBB A;  1UOJ A;  2ZPX A;  2W87 A;  4JKK A;  2BV4 A;  5FYH A;  5JR7 B;  1BMV 1;  1C1F A;  2AEY A;  2P6H A;  3DEM A;  3O1T A;  3UKN A;  4M00 A;  2VZR A;  1W6M A;  1ST8 A;  4B4R A;  5GZF A;  2C6S A;  2ET1 A;  3OB8 A;  4AGG A;  3H3L A;  4RFR B;  1URX A;  5KC6 A;  1VR3 A;  2Q8E A;  3E6B A;  1RUD 1;  1AR9 2;  2BYV E;  2FDF A;  3VBR C;  5CAD A;  2PMW B;  3DL3 A;  3PNA A;  2NZ9 A;  1YJK A;  2MHF A;  2JWP A;  2R16 A;  4HFS A;  4M3C F;  4P9Y A;  5HV0 A;  3RZJ A;  1F31 A;  3HPN A;  2ZBJ A;  5F6L B;  1VMJ A;  3O0W A;  1HB3 A;  2AEN A;  2VMI A;  2Z5W A;  3HQX A;  4LHK A;  3ZYP A;  4AZZ A;  1H8V A;  2VZT A;  1AYM 2;  3ZMN A;  2ZMN A;  1RUH 2;  4QPG B;  3WDV A;  1C57 A;  1SG3 A;  5BNO A;  4GWN A;  2QDN A;  3VZO A;  3O1U A;  2ZOE B;  2HWE 1;  3B3Q E;  4GH4 A;  4IDZ A;  4P14 A;  4UW5 A;  3TNP B;  4CP9 B;  4HPK A;  5D8A C;  3LEK A;  1CJP A;  4FFI A;  4BYY A;  1IZ3 A;  5JZG C;  2BJS A;  3I2I A;  1UY4 A;  4LKE A;  2QUO A;  1I5Z A;  2AH2 A;  3H9A A;  1Q5O A;  3ITQ A;  3PLQ A;  4R8H A;  4YZ1 A;  2A70 A;  1AXZ A;  1V6O A;  5ABJ C;  3GHM A;  3FC0 A;  5FMD A;  1BBT 2;  2RS5 2;  4D6S A;  1JZ8 A;  2D6M A;  2JG9 A;  5DAX A;  4IQP A;  2R32 A; 
#chains in the Genus database with same CATH homology
 2BRT A;  2DBN A;  1HB3 A;  1RXG A;  2JB8 A;  2VCM A;  1QJE A;  1HJG A;  1UOB A;  1W28 A;  1W05 A;  1E5R A;  1W3V A;  1WA6 X;  1GP5 A;  1W03 A;  1W06 A;  4XAE A;  1W2A X;  1OBN A;  1W2O A;  2VBB A;  3ON7 A;  2WO7 A;  3ZKY A;  3ZOI A;  5C3R A;  2VBP A;  1BLZ A;  1UNB A;  5C3O A;  1RXF A;  1UOG A;  1W9Y A;  1QIQ A;  2CSG A;  1HB1 A;  2VBD A;  2Y6F A;  4BB3 A;  1UO9 A;  1IPS A;  1ODM A;  2BJS A;  2Y60 A;  3OOX A;  1QJF A;  3ZKU A;  1GP6 A;  5APA A;  5C3Q A;  1HB4 A;  1UOF A;  2JB4 A;  1GP4 A;  1E5H A;  1E5S A;  1W3X A;  5C3S A;  1ODN A;  1OC1 A;  2DBI A;  2VAU A;  2VE1 A;  2IVI B;  5C3P A;  1W2N A;  2IVJ A;  1E5I A;  1BK0 A;  1W04 A;  1HJF A;  1UZW A;  1HB2 A;  2BU9 A;  1DCS A;  4RGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...