5C3QA

Crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and thymine (t)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
GSMEKAAVNEDGLVIPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLPKEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAPDIKESYEIGREDEPGHPNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDSFVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQFIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKSYIEAIPGTYAAESERKYEGINSGKYLVQRLAATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymine dioxygenase
publication title Molecular basis for the substrate specificity and catalytic mechanism of thymine-7-hydroxylase in fungi
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Oxidoreductase
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 5c3qA00
1UOBA 1GP4A 1E5SA 1QIQA 2IVIB 1WA6X 2VBDA 1W2AX 5APAA 3ZKYA 1OBNA 1W03A 1W04A 1UZWA 2VE1A 1UO9A 1GP5A 1QJEA 1GP6A 1HB1A 1DCSA 2VCMA 2Y6FA 1W05A 1W2OA 1UOGA 1ODNA 1QJFA 2Y60A 4RGKA 3ZOIA 1UNBA 1W3VA 1E5HA 4XAEA 3ZKUA 1UOFA 3ON7A 5C3SA 1RXFA 1BLZA 2DBIA 2JB4A 2BRTA 1IPSA 5C3PA 1W28A 5C3OA 2VBBA 1HJFA 2DBNA 3OOXA 4BB3A 1W9YA 2VAUA 1OC1A 5C3QA 1HB4A 1W06A 2BJSA 1RXGA 1ODMA 1HJGA 1HB2A 2JB8A 1HB3A 2CSGA 5C3RA 1W2NA 1BK0A 1E5RA 2VBPA 2IVJA 2WO7A 2BU9A 1W3XA 1E5IA
chains in the Genus database with same CATH superfamily
1H8TC 4ZPIA 4WVMA 3O12A 4PQ9A 3CJIC 5D2AA 2G4IA 4Z8BA 4Q4X1 4UFHA 3SITA 3DGTA 4FI9A 3V56A 3VV1A 2VOXA 4I01A 1NZCA 3SCGA 1MR5A 2IVIB 3VBSA 1Q8PA 2RJKA 4L2NA 3KV6A 1GZTA 1RTVA 3SLIA 2D97A 4NWVA 2NPIA 4I0BA 1A6CA 3CHXA 4EN0A 4KBBA 2X5IB 4R9AA 1YFWA 3WDWA 1XJAA 4COVA 2WQ8A 3X29B 3NV1A 4YGCA 5AC92 4ZXKA 1OT5A 5J37A 1IOAA 1LOCA 3KSCA 1CPMA 4QPWA 1EAH3 3MW3A 3T30A 4AFBA 4N90A 3U4SA 5C71A 2BYVE 4JHTA 3GDBA 3WG4A 3A7QA 4DOUA 3ACLA 4ET7A 1OLRA 4P9IA 1HRV3 1JZ2A 1QXJA 4KMQA 4EN8B 1WCDJ 2QJVA 3LEIA 3K2OA 1URXA 2RS33 2ZOEB 4N43B 5KHHA 1YRZA 2ERFA 1UX6A 4XABA 2D93A 2WNVA 5JI9A 2C26A 1LULA 1RUH2 5AVPA 4IEXA 3WR0A 3LSDA 5FOJB 1PIV2 4QWNA 2DYCA 2HYKA 2XJRA 4NROA 1S4CA 5FZBA 5A32B 4AHXA 3WP5A 1RGSA 4GWIA 4ARXA 1AUYA 4JKMA 4Q4W2 1CZSA 2FDIA 3VDCA 4OHVA 1AYN2 5CYYA 4U2AA 2VPVA 2X09A 1AL21 2C5DA 4JTOA 2P34A 1PZ8A 3JCIA 1UD1A 2AH2A 2YGLA 5LEJA 2VNGA 2XMLA 1H8TB 1UAIA 3N36A 3POJA 4EWEA 3CJIB 5FMOS 3USSA 5KXDA 4ZU4A 5FZ7A 1AR62 1GBGA 2Q1MA 2OVUA 4MG2A 4N7UA 5DAWA 5JXGA 1S1AA 3QD6A 4EJRA 1F31A 5IFTA 1G6NA 4RD7A 1NCQA 2BTVC 3MICA 5K8SA 4F3JA 3VL9A 2HWF2 3C7HA 1LAJA 3Q8FA 2HEWF 1DDLA 4W6WA 5AC93 2F17A 4GZ9A 4A6SA 1A34A 2YXSA 2XBO2 2ES3A 4PBOA 4UFKA 5I93A 1US2A 2Y64A 2QQUA 2VW1A 1LOAA 4YGBA 3P3NA 4CP9A 1ODMA 4LBQD 4D3WA 4OHYA 1UXXX 4QGMA 4D6QA 2NYYA 4LITA 1BXHA 2B45X 1V9U1 1MS0A 1TMF2 1UMIA 2FCUA 2HWB1 2YDEA 3IWZA 4QX7A 3RYPA 2KXLA 4AFDA 3OUJA 1RUH3 4X8PA 1HXS2 1RHI2 4CDUA 1PIV3 2W2IA 5CFCC 4OUSA 3RYRA 2XUEA 5JZGC 2E51A 4Q4W3 3AZVA 4LKSA 4F7ZA 2CWSA 3M70A 1AYN3 4N53C 3KVBA 1NUKA 5EJ3A 5F2WA 3ZFGA 4D7YA 3MEPA 1XPWA 3WQ1A 4RA0A 4OFGA 1ZZCA 5H9PA 3TB0A 5T5OA 3LB9A 4LORA 4XQ4A 3SH5A 1RUC2 4FQZA 4FVVA 3VBRC 4E9KA 5CISA 4V2WA 4BIOA 5JCTA 1F15A 4G9SB 2CDPA 1U5XA 1AR63 4QDRA 1OLQA 5I8YA 3ZXGA 3D6EA 1RUOA 4RYDA 4Q1PA 1OA2A 5CEHA 3OF1A 5FY1A 2P3JA 2HWF3 2K0GA 1O8PA 3HAGA 3J7MA 4HZFA 5IW0A 4YNIA 3T4VA 1IS5A 1NT0A 4Q2FA 3ZR6A 2XBO3 2EAAA 2ZMKA 4XETA 3AVRA 2ARCA 3KT7A 2IZWA 1LOBA 1MQTC 2GNBA 4UW5A 1NXD1 2B4KA 4QHZA 3KM5A 4D0QA 2ID4A 1KJRA 4H3WA 1UPSA 4P9GA 2JDKA 4FOVA 1YQ8A 4Q4X2 3FN9A 1KFUL 4RGAA 2AUYA 4XACA 4KWKA 5JLVA 2WSUA 3B00A 1PZ7A 1C1LA 1FI2A 3ILNA 3LA7A 4LUMA 2JJ6A 1HXS3 2W1QA 1RHI3 4CU6A 1GNZA 2VQAA 3FL7A 2Y34A 1JOJA 3V64A 5BYNA 2H0BA 1UMHA 4Y33A 5CFCB 4DB5A 4YM0A 5JZGB 2WBKA 3N7KA 2XLFA 1V0AA 2PHDA 4N53B 1HQNA 5JSPA 5JMOA 1NX9A 1MZEA 3AZYA 3IIIA 3ON7A 4XOGA 5FMDA 5G05L 2OIIA 3WZ1A 2WYFA 3HQXA 4IE0A 4XJUA 1RUC3 5FPBA 3VN4A 4EN9B 3BI3A 3J8F2 4Q0VA 3T0BA 3VBRB 2VUCA 3RPQA 3HNBM 2LW8A 4Q5OA 1LEDA 4D94A 3VZJA 1GKBA 1QOTA 1HQWA 3WUCA 2VMIA 2JB4A 3MIDA 2ZBJA 5BV6A 5FWJA 3NJYA 1LB2A 1SZBA 5A7QA 5LRRA 2DV9A 2QE3A 3A23A 5EP9A 4F83A 1OQ1A 4JKKA 3BYWA 4YW6A 5BNNA 1W28A 2PMWB 2XJSA 5T50A 3OOXA 1NY71 5I8SA 4OQ9A 3N9LA 3J9SA 5FBZA 1W2UA 5F3EA 3WNXA 1AL22 5A1LA 5FO8B 1RUF1 1IQAA 3DV8A 1MQTB 2R7EB 3FX3A 3THCA 5KHJA 5C4WA 5LY2A 4Q4X3 4AHYA 3DUIA 1VMHA 2CSGA 2PYTA 5GKAC 4XYXA 1XC6A 1GFF2 2VZSA 4GH4A 1VMFA 3KGLA 4P9LA 4XIOA 4LHLA 1H9WA 1QJU1 3ZXEA 4MZUA 1FV3A 3IM0A 4M0HA 2O8QA 3ACIA 4YM1A 4YYOA 5FXWA 2Q8EA 1STMA 2BU9A 1HRI1 2GN7A 3RQ0A 2ZACA 5FZ4A 5A70A 4O7XA 5K0UC 1OF3A 3LA3A 1DQ5A 3ZSKA 4NMIA 1JYIA 1CAVA 4LO6B 4Z1VA 4IGPA 1GZCA 4I30A 5FYZA 1V6LA 3KV5A 4FPOB 3J8F3 1JYWA 1M06G 1DYPA 2D6OX 2WRAA 5H9RA 1GICA 1CAUB 1POV1 1UU5A 4GXLA 3KMHA 3Q8AA 4GWMA 1CN1A 1V9U2 2HWB2 1OH4A 3AL6A 1MEC1 1TG7A 1X36A 4N9IA 4NIIA 3ZPOA 4CCMA 5F1RA 1REDA 1MZFA 3M8LA 3EB7A 4WM8C 3OBZA 1F5JA 1PM7A 3I54A 4A7ZA 4B4QA 1ZVFA 4XF1A 3GZUC 3T4HB 3RZLA 2VNRA 1B09A 3VLBB 1W2AX 5DPNA 3PTYA 4AVTA 2IUWA 1OBNA 1ZZBA 1DZRA 2VTFA 5T54A 1EV11 3IAPA 3JQXA 3THPA 3C7GA 2EF6A 4LJHA 3RI8A 4P00B 3KCCA 3AFGA 1W6QB 2Q1FA 4KG0A 4BU2A 1UZZA 3ZN6A 2DCTA 4I0AA 4I3PA 3OGRA 4QXKA 2R043 1Z78A 2VVDA 1OKQA 2V4VA 4XDPA 4PLMA 1YIFA 2QQLA 5FOBB 3DPRC 5GZDA 5BNPC 4FP2A 2VMFA 2P3YA 1GOHA 4EROA 4RS5A 1K45A 1JS9A 4GD4A 3D5OA 4XFCA 2EIDA 5FO7B 3NSTA 4OI4A 2V72A 3AZWA 4LIVA 1G9FA 1QJFA 2R32A 2XQRA 4URTA 1W0OA 4YGDA 5DDJ1 4HPKB 1W3VA 4C1XA 3VD7A 1PNFA 1XNBA 4NRMA 4OI0A 2D6MA 5K0UB 1L7QA 4G3YC 5KC5A 4IL7A 2X29A 3SC7X 1O3RA 3PVOA 1MS8A 4UF0A 3I2IA 1N1SA 3NNMA 5CFDA 4XUNA 2BOJA 3LEKA 1V9U3 2HWB3 3DECA 4RHV1 5FYSA 1TME1 2OUJA 2VZQA 4QKFA 1AX0A 4ONUA 4S2DA 4E27A 4XHBA 4ES8A 4Y4YA 1QGLA 3A0NA 4WM8B 2A71A 3NQHA 4BQ3A 3DKWA 5DABA 2JECA 3V65A 3RZMA 3BIWE 5LY1A 3R4DB 2ARAA 4JX0A 3WW2A 2QKDA 3U0ZA 2VW2A 1KQRA 3VDDC 4JHZA 1H9PA 4IE6A 2WT1A 1GQHA 1W0NA 4MH0E 4AQ2A 3M4FA 3SKJE 1RUE1 5KC6A 4O9EA 1ZM1A 4ASLA 1LHUA 3MF6A 2BFUL 3KCYA 1W06A 3OPTA 4QPGA 5JR7B 3PLQA 5IVBA 3O1MA 1FX5A 3P3PA 4IERA 2E31A 2J42A 1AX1A 3DPRB 1F4HA 4LO5B 4HONA 4XJWA 1X8EA 5F5IA 2PHRA 4CDXA 1SQ4A 4CXXA 2AACA 3MGUA 3OBTA 1RIRA 4ZONA 2GU9A 1W9FA 5J36A 2VQ0A 5JAXA 3LEMA 1Y9MA 1KJLA 2G19A 3KV4A 1R091 4HKLA 2IVJA 1RINA 4IEUA 4DRVA 1W6NA 4NIDA 1PVXA 1S0DA 4FPHA 4YG3A 1NY72 5DAVA 4GWNA 3WNOA 2GC0A 4GJZA 2D6KA 1XYOA 1Y4WA 2C9AA 2JDHA 2XJQA 3ZYIB 1RUF2 1W8WA 4IEPA 3VBUA 1I5PA 3P1IA 2W3JA 3ZDSA 1O91A 3U4XA 1POV0 3O1RA 2HEVF 3RZJA 5B4XA 4CEYB 1HV1A 4GKYA 4CXWA 2WQZC 3N3HA 4BLIA 1W0PA 4UAPA 3I97A 4Q0UA 1YXWA 5C6CA 4EV0A 3WDXA 4Z82A 3N7MA 2CTVA 4LLOA 1QU0A 2OT7A 3KT1A 2J1EA 4CDWA 3M2MA 1JTZX 1QQP1 2W94A 5ABJC 2OQ6A 4QX2A 1HRI2 4B3NA 3VKLA 1CQ9A 1W99A 3F2ZA 3E6BA 3DYMA 4RSUA 3ZFFC 4ZKTB 2W39A 1ONAA 1UMZA 4K6BA 4NAMA 4UFLA 3VDDB 3WNPA 1C3HA 4L8QA 2WNOA 2EVXA 3CZUA 4K7JA 2RJLA 4NIAA 1NCRA 3WQ0A 5IJRA 2ZZJA 4Q4V2 4OQ8A 3U10A 3H1MA 2UWAA 3BU0A 2QTWB 1MEC2 2A6XA 3PUHA 3K77A 3SQOA 3WNKA 2VVFA 1G86A 3MPBA 3V0AB 5FP9A 1WMDA 4IQPA 3QCWA 5FLHA 4H55A 2BNNA 3R6SA 1CZTA 3N7JA 3VBOC 5DAPA 1KDKA 3ACGA 2YU1A 4OVEA 2R1DA 5FWEA 3WDUA 1OUXA 3MIHA 4LBLA 3ZOIA 1FV2A 4BWOA 1EV12 3C2UA 4DY3A 2WT0A 3O14A 1ZNPA 4COYA 1Q8QA 2VY0A 3FE5A 2I45A 1IQDC 5A7PA 2J7MA 4BK5A 1C1FA 1AF9A 3MLKA 1RUF3 3EYPA 3O5SA 1D2SA 4LO4B 4DUWA 4LE4A 2HWC1 1DU3D 3QH6A 4TSVA 4AEDC 4ZZ8A 5FYUA 1JYNA 1I3HA 1O5LA 3T1MA 5GZGA 1W90A 1AX2A 3WINE 3W5MA 3UT0A 1HW5A 3WP4A 1WMFA 1JHJA 1K12A 4NHXA 1ZYBA 4Q26A 2BRTA 1J83A 1R083 1G9BA 4MGIE 3T0DA 1WLCA 1TEIA 1S2BA 1RUD2 3I2KA 1XU1A 3IDEA 3ZXJA 4CU7A 3OY8A 1HRI3 2R0HA 4QGLA 4B29A 2QQMA 1BHGA 5ABJB 2VMHA 4FFGA 3ZFFB 3U07A 1HV0A 2DVBA 1VR3A 1ZBE3 2A6ZA 2VGDA 5E89A 5F3CA 3HBZA 2ADDA 1POV3 4XDOA 4Q4V3 2DUQA 4YZ3A 2O0OA 2EICA 3NAPC 1GQPA 1MEC3 1QOOA 5FZKA 1TME2 4Y1YA 1UYZA 3WX5A 1PK6C 1LOFC 2XR4A 1DGWX 1OA4A 1IS6A 3K4ZA 4DXRA 4LBQB 1JZ5A 4M3CE 3H3UA 4JGZA 3BTYA 4MGQA 2V73A 4WZFA 2UURA 1BK0A 3H3ZA 3AKSA 1KXGA 4NWWA 3RMXA 1ND2A 2VMEA 3NNJA 3VBOB 3ZO0B 2VW0A 3WNLA 2A5ZA 1QKQA 1RUE2 4IEOA 4PDWA 2XHKA 1JYXA 5FLIA 2WQ4A 5HCBA 1L3JA 4MGTA 2H6CA 5IATA 1H4GA 2VQTA 4XXAA 2XDVA 4AEDB 1VBA1 1YQ2A 4JQTA 2VCCA 4B7EA 1YCIA 2ZGTA 1UOBA 4AVAA 1DYKA 1BJQA 4F8AA 3NKGA 3I3BA 1RUD3 4LHNA 5DUXA 4C0BA 5BY5A 1R092 2WAAA 4Y24A 5LRSA 3B5LB 4Z2AA 2BV4A 3FHIB 4UBHA 4E2QA 5FPAA 5J1XA 2GH8A 2JE8A 3J26N 3GBGA 3WT3A 1Q43A 5A1FA 3AMPA 3S7EA 2GP5A 2BDRA 5C33A 3BPSA 2Q8DA 5LK5A 5D8AC 1NKGA 2AGSA 3HT1A 4YVSA 4I09A 4LT5A 1TME3 4BQ5A 1V6OA 1XNCA 2OKXA 2ORZA 2WO2A 3I4IA 3NAPB 4UW3A 3AJYA 1F9KA 4AFMA 1XNAA 3AP9A 3GHNA 2HBTA 5I0UA 3VDAA 1H30A 1PK6B 1UU4A 2BWAA 4X6QB 5EFUA 5FZEA 2VZ1A 2QQKA 2YBPA 2UY9A 3LAGA 2ORXA 3K3NA 1QQP2 2OW4A 1J1TA 4NO4A 3PURA 4AW7A 5LA9A 1AXYA 3R4SA 1A8DA 4XTPA 4DRRA 4IV3C 5FR3A 4RGKA 3I2JA 1CAWB 1SHWB 4NHLA 3DL3A 1LODA 1IHMA 1RUE3 1APNA 2R071 2YBKA 3ELNA 3POYA 4OUMA 1D4VB 3UESA 3V0BA 2Z2SB 1ND3C 2JG9A 2PHFA 2W91A 3AXDA 5GZCA 1VBD1 1V6IA 2FMYA 3K48A 4O65A 2D6PA 3AKTA 5M0TA 5CKMA 4LNVA 3TEXA 4MYEA 4YLZA 3WXPA 2YB7A 3WHUA 2ZX1A 4YZ2A 4OHZA 1BCXA 3ORJA 5IK5A 1SCRA 2WZR1 5EWSA 1WCSA 2WKKA 2YMZA 5HV0A 2E26A 2FDGA 1R093 4RR3A 4ARYA 2EIBA 5A32A 2AREA 1ENSA 1ASJ2 2HLEA 2Y38A 3ZFEA 4BDVB 5F3IA 5DZGA 1W6PB 2GSYA 4HG6B 4FBFA 2WZPP 4WM7A 4H14A 3C7EA 2DCJA 4QPIA 1LOGA 1VBC1 5D21A 2HWC2 2VXJA 4QT6A 4EYUA 3IDBB 5T5JA 5D8AB 4CEWC 4HK8A 3MI8A 3B93A 2H0VA 2ILMA 1HB3A 2A3YA 3MDPA 4R9DA 5IVCA 1QQP3 3KGZA 1VPHA 5FP3A 1LHVA 3B02A 1LGNA 1GZWB 2BNOA 3LDKA 1YQCA 1W6MA 4AAPA 3KQ4B 3OEBA 5FYMA 1QWRA 2IWGB 4IV3B 3BVCA 4LTAA 4CDQC 2W52A 4CCKA 3LFIA 3RZGA 3ZM8A 5F39A 1LTEA 1F4AA 1OKOA 5G04L 3CNAA 3RS6A 1ND3B 2QBXA 3H9AA 4CU9A 4E2GA 2D43A 3ZXAC 3TEZA 4URAA 2VUDA 2FD8A 5IVYA 3ZN4A 4FTEA 5FUPA 5FPZA 1R1A1 2RDNA 2YYOA 1H0BA 4IXLA 2BW8A 4KGQA 3WG3A 3CKHA 5I0TA 1I1EA 2BWCA 5FYCA 5F8PA 1GUIA 2VUJA 3UGFA 3WV6A 3PTRB 5EXOA 2VL4A 2PXJA 3VB9A 1ASJ3 1WD4A 1QDCA 2Z5WA 3MHZA 4PIYA 4JRAA 5BNQA 5ERLA 1EY2A 1L7RA 5DUVA 1UQXA 4DY5A 1KFXL 1CVNA 1Q56A 2BGCA 2RDQA 5A6QA 2N7GA 2HWC3 3NJZA 4E4SA 3URFA 3OD4A 4YG6A 4CPBA 3OGVA 5J48A 3NNLA 1V6JA 1YJLA 2A7AA 4NVPA 4W6YA 2GALA 5FZOB 1UO9A 1VBA2 3ZMOA 1GNHA 5LBEA 4GWJA 1G7YA 3USUB 2VNOA 3OYWA 3QLQA 1RC6A 2ZS6B 5FZ6A 4CEWB 1T6BX 3M3QA 1RUJ1 2JDUA 3LPFA 1Y43B 4LKEA 4MUVA 4AF9A 5IVEA 3AKQA 3D8CA 4BJ0A 4WVWA 1PO22 5FPLA 4AXOA 1S0EA 2VZUA 1YI7A 1VAKA 1RYYA 4XBNA 4CUBA 4EN7B 1JODA 2RHPA 4QHBA 3NMBA 5A7NA 2RDSA 4MXVA 3IIAA 3MYXA 5F5CA 1QEXA 4CDQB 4Q8KA 3GCXA 3FMGA 2JD4A 3ENRA 4LA2A 2X8KA 4WVVA 5FYVA 1AR82 4XTMA 5IK4A 2PQQA 4NR1A 2AC1A 3MFCA 4UOJA 4UFMA 5FZMA 3CL1A 3E6DA 3QBQA 2ZEZA 2QQNA 5E16A 1NE6A 2A70A 2VOTA 3LIHA 3SHRA 1C57A 2BGPA 2WLPA 4BXSV 5FRAA 1CIWA 1OQDA 2JKXA 2UY8A 3H7JA 3VL8A 1UXZA 2DBIA 1DQ6A 3ACHA 5JXJA 3FFQA 1VP6A 2EALA 3DXUA 3VBHC 5JOXA 1ZRDA 1OHFA 5CFCA 1WLDA 1HIXA 3DYPA 2NZ9A 5JZGA 4XEZA 1OFNA 1QDOA 4JDNA 3W9AA 1G9AA 2R072 4BLJA 1CESA 2GMEA 2V4AA 4JRLA 1HJFA 4LEJA 4SBVA 3ZXDA 2BNMA 1FYUA 4WV8A 4E4ZA 2I2SA 2D5FA 2Y6GA 1VBD2 2FZ2A 1W9YA 2Q30A 3B01A 1VBA3 3F95A 3O7OA 4QXHA 1GMMA 4XURA 2Z42A 3VBRA 1OSGA 2Y6KA 5GLWA 4MADA 4NPRA 2W47A 3WP3A 4OULA 3GBWA 1WCKA 3JD71 4FPFA 4R8HA 3WCRA 2WZR2 4DUXA 1T2XA 3IBMA 1S0IA 1OQEA 1GOFA 1LR5A 1JMUB 1PO23 2R16A 4MXWB 3OGGA 1XE0A 2W0XA 3P6BA 4AEJA 3K4AA 3NV4A 3ZPYA 4A4AA 2VC9A 4AI2A 2YV8A 3EO6A 4CU8A 5KR7A 2ZXQA 5KHKA 4AGRA 4L0PA 4DIQA 3DEMA 3K46A 3BU7A 4A7KA 1RITA 3PNAA 4Q27A 1VBC2 4QU2A 3UK9A 1J84A 1H1AA 2Z4FA 5JWPA 3O0XA 5SV8A 5CKQA 1WLTA 1AR83 2HH9A 3UKTA 4S2FA 5FZHA 4BQYA 3TYJA 4BE3A 2VMGA 3HD8B 3PUQA 4XFHA 5JUVA 5CBLA 3S7IA 4FFFA 4YFZA 4QX1A 3AYAA 4YRDA 1WW4A 3GZTB 2RS12 2JDYA 1DGRA 1QHDA 4AQ6A 5LBFA 2ZA9A 3GGLA 4JGYC 4M01A 2XVKA 1DZTA 3HN1A 3FBYA 4FPCA 3AYEA 4FO9A 4NE9A 4Y20B 4XZPA 2KR2A 3VBHB 1PGW1 2ZGQA 3H0OA 3S6PA 5C9AC 1LHNA 1H4HA 1W9WA 4X8NA 2R073 1ULGA 5GLTA 3ZKYA 4BQ1A 5I91A 5GALA 3H7YA 1OVPA 1W6OB 1VBD3 3HVDA 4AFAA 3HBKA 5IAXA 3PU3A 3MV11 4FQ4A 1K5MA 1MACA 2BP6A 2PAMA 3E1F1 3IN9A 1QJX1 2DU0A 2VE1A 3RWNA 1CAUA 5EJZB 4AQSA 1N3QA 2XOMA 4HSLA 3S57A 1R1A2 4H7LA 2VZRA 5CU1A 1DYOA 1W2TA 1GV9A 3PU8A 4Y22B 2WWJA 2WO1A 4PCRA 3O1UA 4PLOA 4I3GA 3KWVA 4JV4A 1OF4A 1SLAA 2XGXA 3M3OA 5JXHA 3IMNA 3U75A 1LRHA 1XYNA 3GF6A 4YSFA 2VD7A 1PHMA 2O8OA 3WUDA 1DF0A 1VBC3 2WNVC 2VOKA 3SEPA 2B46X 1W6QA 4XAEA 4ZY9A 2UU8A 1MZ5A 4QB2A 4XJ9A 5T5PA 3AMHA 4BXFA 1XXNA 1SPPB 2WFPA 3TBDA 4JCKA 3MW2A 5C3SA 2GNDA 4ES9A 3AMQA 1BBT1 1Q8OA 3GM8A 5IWFA 3AVSA 1WCQA 3ZXKA 2FDHA 1RUJ2 2RS13 4N9HA 2TNFA 3ZVXA 3CO2A 2QZ2A 3TAYA 1TMF3 3PVBB 4WVMB 2CAVA 1VB2A 1IPSA 4JGYB 5JSOA 1QH6A 4HPKA 3T2PA 4B8EA 3JU9A 4KNCA 2QNKA 2UWBA 1OVSA 3DCQA 5K0UA 3AKRA 5C9AB 5FZ1A 4LBOA 3HT2A 1IZ3A 3IDAA 1XU2A 3WNMA 3OUIA 1BKZA 2BVBA 1NCQC 1AR71 5A3NA 2W68A 4FPGA 4Q0QA 1YEWA 3ZR5A 4BB3A 1GOGA 5KXBA 1F2NA 4I02A 2ATFA 3AMNA 5LA2A 1OC1A 4PJYA 4RQPC 1R1A3 1J3RA 1X82A 4AVVA 2MNGA 4FXGB 3MLLA 3LDRA 1B35A 1JOBA 4UW6A 4XF3A 3NV3A 5A33A 3BKZA 4KH9A 4WM8A 3S5QA 2ZGLA 3BGAA 3TEYA 4XCAA 3H8RA 1WWYA 2JDNA 4YW1A 4GB31 1IKPA 3ZYJB 5C8CC 2W1SA 5FZFA 1BK1A 1QH7A 5FY7A 1RJ8A 1FMD1 3OPZA 4BH9A 3R4UA 1SDWA 1JZ4A 1SACA 3PMEA 2WNVB 1W3XA 2TBVA 4YFWA 4DXSA 2B9VA 3IMMA 4YVWA 1U5IA 1W9TA 5FZ0A 1Y3TA 3W59A 1YFXA 3M3EA 2BFUS 3ZFGC 3DPRA 5BNPA 4D69A 2MHFA 4JC1A 3JD72 4CP0A 1RUJ3 4GA9A 4FTSA 2B39A 3LFMA 4QKNA 1LKNA 4GAZA 1YIPA 2XL9A 5KXCA 5GJ6A 5FZ8A 2DVAA 1AZDA 1CR7A 3P5BA 3T3YA 5JOZA 1D4M1 4HL0A 4DPNA 1C8M1 1TNRA 5JOYA 1JOPA 1FNZA 4EE2A 5JR2A 3HPNA 2B8MA 4HLTA 5I0DA 1YJKA 2GNMA 4TN7A 2QQOA 1WA6X 4QX5A 4R4XA 4XBQA 3JQWA 2HWE1 1PM4A 1VBE1 2J1UA 4FSJA 2BBAA 4Z92B 5A7WA 3WW1A 1NCQB 4HSJA 2PHUA 4KQ7A 1BMV1 2VZ3A 3MO4A 1RUG1 1OH3A 1X9PA 4CEYA 1CZVA 4LMFA 1W8NA 2J1VA 3POWA 4RQPB 1OPOA 3AXEA 1YYNA 3HIFA 1H8VA 2VNVA 5CZKA 1ULPA 5ISLA 4CP9B 3JB8A 2EXHA 3EMRA 1PGW2 1EPZA 1XRUA 4LXLA 4K1ZA 4UXAA 2WAOA 3RJRA 5C8CB 1UWWA 1S0BA 1NE4A 2AR6A 3I2OA 2RDRA 4HXCA 3HQUA 4C0HA 3AKPA 4RL7A 4P9JA 4CYDA 3ZKUA 5JI7A 4FPJA 2HJIA 1UOFA 5A80A 3RNSA 2J22A 1QJX2 1K3IA 5HV4A 1O3SA 1LESA 2A73B 1AL23 2OPWA 1WKYA 2VM9A 3AYDA 4XUQA 3OTFA 3PL0A 4AAXA 4NPLA 2WWUA 3JD73 1H2NA 4GMP0 4HANA 2B7YA 1FT9A 1SBEA 2ZGPA 4NHMA 3ZFGB 3V0AA 1DIWA 4J25A 4EWAA 4YM3A 4I0WB 1SEFA 2C0ZA 4YZ1A 2W1WA 1ULFA 2WDBA 5FY0A 3ZN5A 4Q0PA 2AYHA 3APBA 5GZEA 2RVAA 2JDMA 3G6JB 2BZDA 2Y6HA 1D0GA 4Y3OA 2WL1A 4QX0A 3FUQA 2WNEA 2D98A 2QUOA 1TVGA 1SLBA 2VUAA 5FMCA 4A42A 3CIHA 4CCEA 5IFPA 3BIEA 3ILFA 1ZZ7A 5FYIA 2VTXA 5C3OA 5BNNC 1DQ2A 5CG8A 5EJ1B 3PVNA 1WCUA 4AL9A 1W8TA 4FPYA 3BPZA 1GWKA 1OPMA 1BBT2 5FY5A 2OPKA 3GJBA 2ZMLA 4L11A 3DYOA 1VJ2A 1ZRFA 1U5ZA 5C4WC 2V09A 2VMCA 1VRH1 2DUOA 4Z07A 5ABJA 3C7OA 4GH4C 4TZDA 2XPJA 3S0MA 2VOVA 3JB4C 2F4PA 3VZOA 2JG8A 1CPNA 3RYKA 1AR72 4HKOA 2YC0A 4HETA 5GZFA 4XPVA 1QJX3 1VBB1 3D4KA 3W20A 3PUIA 1LHWA 3LE0A 3SH3A 1E5IA 3CDZB 1BQPA 4YW2A 2P3IA 5FV3A 4BZ4A 1OOPC 3J7NA 3RVHA 2PELA 3GYDA 3POFA 2VULA 3WP6A 3I3EA 5LEKA 4CTEA 2ZKLA 2L9LA 3VBOA 3NJXA 4FFIA 4GB32 4IEVA 4D8MA 3H8UA 1BEV1 1QIQA 3J7HA 4P5YA 1SFPA 2VZOA 1FMD2 2FZ1A 3OCPA 5LWBA 3RWKX 3VD5A 1DGLA 1GR3A 1UYXA 5F6LB 1JYVA 4QKBA 5FZGA 1US3A 2P37A 3MPPG 3ZYBA 1JUHA 4UI9L 1UOJA 2PHTA 3T09A 4XF9A 4IE7A 1NLQA 5BNNB 4XIKA 4AEDA 4DUVA 3E5UA 1JUIA 1W8FA 2JIJA 1BBT3 2YHJA 4MSVA 5IAVA 5BPXA 2WA3A 2C4XA 3TNPB 2BPA2 5F37A 3ME2A 2HYXA 4NJ4A 2RS51 3ETPA 4A44A 2XH6A 1VALA 1MPXA 2A6YA 1XSRA 1D4M2 2JX9A 2ZJCA 3AJZA 1C8M2 2XJVA 4LA3A 5DN2A 5C4WB 5FREA 3ES1A 3VZMA 1NA1C 1QJU2 1KRIA 3B94A 5CG9A 1XNTA 2XL7A 4GH4B 4QX3A 2HWE2 2E6VA 1VBE2 3IPVA 1AR73 3NL1A 4TXWA 4UFJA 1ODNA 3UGGA 4M4RA 2GC2A 3JBG1 1UPIA 3FZ3A 1LNSA 3ITQA 1LJ7A 1BMV2 4NIHA 1RUG2 2E9QA 3B7MA 5FFOC 3UKVA 3POGA 3NAPA 3ZX7A 4XHXA 4RFT0 1JZ8A 1NAEA 2W95A 3ZYGA 1OOPB 3T2TA 1CAVB 2PAEA 1LOFA 4YGEA 5FDBA 1QNYA 4NIGA 2WT2A 2WJSA 2ZTNA 3E5XA 4GB33 3POBA 2G1MA 5FMBA 4AFCA 2R6QA 3KZ4C 1WBLA 5FQ0B 1CAWA 4M3CB 4XJ8A 1RUI1 3KD4A 2D3SA 2WS91 5CIRA 1GWMA 1FXZA 5AVAA 2YU2A 1UY0A 3K3OA 3O1OA 4ZS3A 3WSOA 4DQAA 2QQJA 2YROA 5CVRA 5KHGA 3ZIWA 3LIGA 5IK8A 4KWUA 4QM9A 4L9BA 4Y4RA 1SLLA 5GM0A 4AGGA 5LA0A 4CPBD 3PJQA 4IV1A 4BQ4A 4UT5A 3BTAA 5A6XA 2YZ4A 3I3QA 5DMYA 4FXKB 1DQ4A 5C3QA 3MBWA 2VR4A 1BYHA 5FXXA 1JZ3A 5IVFA 2ENRA 2H6BA 2IXLA 4FT8A 1D4M3 1DP0A 1UIJA 1UZYA 1C8M3 1HB2A 1Q3EA 2VVEA 2WABA 3IT8A 1HDKA 3POSA 4QPGC 3VBFC 3WG1A 1W6PA 1QJU3 1W2NA 3ES4A 4JKLA 4NHYA 4XUPA 5FYTA 2YY1A 4AGVA 4CDXC 4FAGA 5JDBA 1U0AA 2HWE3 1NA1B 1MS4A 1VBE3 2VZTA 4AI8A 2RE9A 5JOWA 2VTXJ 3AZXA 2JEMA 2D3RA 4LK6A 1FATA 1SMVA 4G4FA 5DDJ2 4M3CF 3T2QA 5F7UA 1V70A 4INDA 1XYPA 1KEXA 4KL1A 4FPLA 3HOBA 2VQUA 5D8AA 1QOSA 4XCBA 4TLFA 5JPMB 3A4UA 1POQA 3B9IA 5LK7B 1WGPA 5F3GA 4AI3A 4A3XA 4B1MA 3VBUC 1KDMA 1ZRIA 5T3NA 4RHV2 1DQ0A 1GZWA 3N9MA 1CX4A 1VRH2 3K75B 2WN2A 4ASKA 4YARA 3VHRA 2UWCA 5FZDA 4AZZA 4BMEA 4IV3A 4QU1A 3Q9OA 3UETA 2WA4A 4KU8A 5L9RA 4YW5A 2Y26A 4LOTA 1EV13 1VBB2 1RMU1 2V5YA 4IDZA 1JBCA 2YUEA 2IC1A 5DUWA 5BNOC 5FTTC 4XBLA 3WF0A 3R0RA 4MO3M 4PBPA 2Q0AA 4QX8A 1G9CA 2C24A 2PN5A 2R49A 2JDAA 3EQEA 4U36A 2B42B 3AM2A 3I2FA 5A7OA 1R1ZA 4CCOA 2GDFA 1UY4A 4D6RA 3OD0A 3ZMNA 2X53S 2CDOA 2DVDA 3FLPA 2E7TA 4K40A 2ZABA 5DG2A 4MGZE 4QPGB 5HPOA 1BEV2 1BVVA 1DGWA 3LOIA 1VE0A 5FZIA 1HRV1 3VBFB 4RN5A 2Q4SA 4NN0A 4CDXB 2WINB 2DTYA 1DZQA 5DQ0A 2RS31 4DFSA 1SLCA 1HX6A 2OZJA 5DDJ3 4BQ2A 3BUCA 1IG0A 4E8DA 3D3AA 4FAHA 4Q4Y1 2GMPA 5A3WA 2PHWA 1PX4A 4KWJA 1KGYA 1M4WA 2GC3A 5I0RA 3OPWA 5A3OA 2ZMNA 4GALA 5TSWA 2RMU1 3AMMA 5FYHA 1EP0A 3USUA 2ZEWA 1V6KA 4KBZA 3CQOA 2D40A 2RG4A 2RS52 2ZX4A 2X05A 3OJBA 5IK7A 1RXFA 3OEAA 4RHV3 1YI9A 2JXAA 3OG2A 3VBUB 3MUZ1 1VRH3 3WOGA 4K9SA 1UKGA 4WVZA 1N3OA 4AI1A 5E88A 3WDVA 1JN2P 1Q8VA 4LIUA 3AZZA 4HT1T 1YLLA 4MLOA 2O1QA 3W58A 1ENXA 5HI0A 2X5IA 2ZHKA 3VZLA 4CUGA 4LHKA 4UFIA 4P14A 4CDQA 1WMEA 1Q8SA 3JBG2 1JW6A 1VBB3 4Q29A 1ZREA 4JAAA 5FJKA 3OB8A 4ATEA 4YPJA 5FY4A 2NN8A 5BXXA 5BNOB 1CIYA 3AFKA 3PVEA 4IETA 4Y5TA 2CL2A 3RI9A 5A3LA 2CYFA 2MPFA 4NRPA 2LS6A 3AP4A 1JXNA 3FHAA 3NWKA 2YGMA 2BJSA 3MLJA 2DWRA 3E5QA 3M1HA 4OI1A 2D44A 4NHKA 5C7GA 1BEV3 4N43A 1QF3A 5HBAA 4AG4A 2BEOA 5J3UA 1JYCA 3QACA 2WS92 5KWRA 2OQ7A 1TZOA 4A7YA 4ZU7A 3WW4A 5FK7A 2A6VA 2PA7A 1PGSA 1RUH1 2R061 4PF1A 1ND2C 3H8XA 1PX3A 5IT6A 1DQ1A 1JI6A 1UL9A 2W1UA 2ZX0A 4ZZ5A 4LBJA 1KS4A 2EIEA 4K3UA 5EYYA 2JICA 2DCKA 3WF3A 2BGOA 2RS53 2VO5A 1G9DA 3LKJA 1YFUA 4GQ7A 3NKTA 1LU1A 1H8TA 1SLIA 4QQLA 4E4HA 3A0KA 3SCFA 3L2HA 4DXTA 3CJIA 1AXKA 1PMIA 4O61A 4DXZA 1D2QA 4XF4A 1Q5OA 4CXYA 4K1YA 2ZHLA 1E5SA 3DN7A 2P17A 2WNUC 3AP6A 1XE7A 3LA2A 3K51A 4W4ZA 2NMNA 2VZVA 1NQJA 2RR11 4BPZA 3JBG3 2DDUA 4QQOA 4D6SA 4L92A 4LO7A 4COUA 3LGRA 4YW7A 2QQWA 4Q8LA 3L2YA 2A6WA 3OY8B 1WZXA 3H50A 4GIQA 1RVF1 3JXSA 4AEMA 3PIJA 1XNDA 2HKXA 1T6GC 2BUKA 2ZEXA 3U78A 1AYM1 3VHPA 3HEIA 3ILRA 4B4PA 4AVCA 4CVUA 1C5HA 1EUUA 3NV2A 4NUBA 5F6KA 1IS3A 4YVSC 3B69A 4QQ2A 2W92A 3UNPA 2ZX2A 3I8TA 4DINB 2ZPXA 4DZGA 3KV9A 5FAXA 1AJOA 2ZAAA 4BM8A 2VU9A 4FOYA 1JZ6A 1OI6A 2VCMA 3LDBA 5L7OC 4COZA 1W05A 2CU5A 2IXKA 4L99A 3NRUA 2JD9A 1O4TA 1W6OA 1W8ZA 1ZA4A 3HNYM 1RMU2 2VOWA 2Y60A 3I59B 1SFNA 4S2HA 3TNQA 5L9BA 3IB3A 1ND2B 1VAMA 4NRQA 1ENQA 2BVVA 1PNGA 5IUQA 5K4LA 5B2GB 5HCFA 4CUAA 3A22A 1AR91 1EYBA 1W8HA 2EAKA 3QOPA 4MGSA 4NOTA 4EQVA 1XE8A 2A75A 3EXUA 5FPXA 5L36A 5K7PA 2JG9C 4BIFA 4MX3A 1WMXA 1JHNA 5J98B 3H8OA 4L97A 3PJYA 5FO9B 5KBFA 4Z2WA 2OZ6A 3AK0A 5FZCA 3ZIXA 4MV2A 4AHWA 2WSVA 2DF7A 1WLWA 2W5FA 3EHKA 2ZHNA 1OLMA 5C3PA 2WNUB 4IE4A 4BISA 3VHOA 3O0WA 1FAYA 4J1WA 3GZAA 4JZRA 4Q4Y2 4RR3C 3MUY1 1UIKA 3ZFEC 3FWEA 3VKFC 1I5ZA 4TYSA 2RMU2 1C4RA 2ARXA 2CV6A 1REEA 5FUNA 4B7KA 1VMJA 4WM7C 5CADA 4QPIC 1J3QA 2VH9A 4N8MA 2VAUA 1JYTA 5C5TA 1NG0A 4R52A 5DUUA 1Y9GA 1HB4A 4UWDA 2UYBA 3LD8A 2YPJA 4JGYA 4YVSB 2XWBB 3ZSJA 3RRDA 3N9PA 2R30A 3JZVA 4E8CA 2IXCA 3BOWA 4GULA 4OMDA 4W50A 4B4RA 5C9AA 5FUIA 5L7OB 3IZOA 4Q0SA 1WUVA 2GP3A 2YFUA 1RMU3 5F9TA 4NPMA 4KU7A 1O3TA 1O4YA 3ZXFA 1V6NA 3C7FA 3ZSEA 1SG3A 2XVGA 4N53A 1XB9A 2XWJB 2FQPA 1H1IA 4HK9A 4Y1XA 2NLRA 4OI2A 2YC4A 3THTA 1R64A 1UW8A 4YZ5A 1IPKA 2E33A 5LA1A 2QQVA 3V0BB 2JG9B 1RL3A 3N4MA 4LLFA 4HVQA 3O1VA 2Q1ZB 3J8F1 3TRSB 2XB6C 5FP4A 4A41A 2RV9A 2FBEA 5J7MA 1BVP1 3I2GA 2DURA 4O9GA 2IXHA 3PUAA 1JU4A 1D0HA 3EBRA 3UJQA 2VZPA 3IAQA 4Q4Y3 4XMAA 3ZYPA 5KXEA 3HN3A 2R062 2DFCA 2XG3A 3WQ7A 5BUVA 2GC1A 4LUKA 5DG1A 2FDJA 3GNEA 4RR3B 4IEQA 2RMU3 3ZFEB 4H7MA 4AVBA 4OMCA 1WBFA 3POEA 4XILA 1J59A 4OYUA 4WZCA 1QMJA 4AHZA 4CZSA 3RSJA 3I49A 1MQTA 4WM7B 1W39A 4QPIB 2CNAA 3L9JT 3B9CA 3E97A 2R041 3OBAA 4C8DA 2NM1A 1QJEA 2V5DA 1OA3A 1O4ZA 1U5YA 4QAWA 5JIAA 1ULOA 2LRPA 3I2DA 4HMZA 1WW7A 2VJXA 2XJPA 1O8SA 4LBKA 2RR12 5CAZA 2QDNA 2E32A 1HN0A 4LBNA 1UYPA 1UOGA 4XW3A 1MS5A 3VBSC 5LATA 1QJY1 4JDMA 4AI9A 1W6MB 1SDDB 3BCWA 5GLVA 2Q5TA 1CAXB 1RVF2 2G9ZA 2FCTA 1MS9A 4RQPA 4LHSA 3VZNA 4R9BA 2QCSB 2VG9A 4C90A 3WW3A 5A7SA 1WD3A 1AYM2 1QNWA 2P4EA 4ISRA 2F4LA 3MIFA 3ZYRA 4QXBA 5JSRA 5FXZA 1UCXA 1W9SA 3TN91 1SCSA 4KWLA 2XKPA 1MS3A 4IUGA 2D7FA 3WVJA 2WZR3 4J1XA 5FKCA 2QZ3A 2DCYA 2LM3A 4KI5M 1BLZA 1CONA 5JIUA 2PAKA 5B4NA 2ZCWA 5LBCA 3BTXA 2R063 3I3MA 3FUOA 4B1LA 4XDQA 1F5FA 3ZSMA 3TWIA 2DVGA 4RFRB 1H6YA 1GANA 3DKQA 4CCCA 2MEV1 2G9GA 1AR92 2Y6LA 1HQLA 5DAQA 3RJ2X 1XQNA 4PHZA 3HWJA 4A45A 5A6YA 2B9UA 3KS7A 4AE2A 1O6UA 2WIIB 5FLJA 3WF2A 4GMP1 3NO8A 3T1LA 3AP7A 3OYWB 2VCAA 4HVRA 2RR13 5LASA 4P9WA 3LQCA 4N7IA 4DEQA 5FP8A 1G8WA 1GQGA 4TLGA 5K9YA 4Y1UA 4AR2A 2AEZA 2J1AA 2G9FA 4ATFA 3BODA 1LCLA 1OURA 5CB7A 5T52A 1RVF3 3U14A 3VBSB 4MHRA 4A2UA 5ACA1 4LK7A 1ZRCA 2Z79A 5EHDA 1YQ5A 3H1YA 3I2HA 1YQ6A 1AYM3 3VZKA 3KHCA 1SFYA 4ASMB 1LECA 3VKMA 1GNYA 5A1AA 4P02B 4FFHA 3UJOA 1S2KA 3Q8BA 5C8CA 5FY9A 1Z7S1 4QGNA 1LU2A 3ZYHA 4W65A 4AEKA 4XQDA 3UL2A 2A3WA 1ZA7A 1NXMA 3GHMA 4FCAA 2ADEA 2LTNA 3U11A 3N9NA 3C8XA 1MVQA 2KD7A 2VBDA 3CF6E 3LZZA 4XFBA 2J1TA 2JIGA 1DLCA 2WWSA 4ZS2A 2QDRA 2WLQA 3LCPA 3AL5A 4LPLA 4Y1ZA 3T2OA 1AR93 4FPEA 4CDUC 2NMOA 1W8UA 3WNNA 1VIWB 3D0SA 3CBNA 4W8JA 1GYKA 1K5MC 4JDOA 2PLV1 3IDCB 4XFAA 2WN3A 4PQQA 3U37A 3BOPA 3WCSA 3ACFA 5FZ9A 5FJHA 1CWPA 4MOAA 4PF5A 5E1RA 5C8WA 1ZRRA 1OUSA 5FMOL 2SLIA 1Y9QA 1ZBA1 2Y6FA 4JVAA 4PI2A 4FOWA 5F5AA 5C5UA 1OLME 2XHNA 3I7DA 2WYSA 2YFZA 5IVVA 4CUCA 1YWKA 4IESA 2F6BA 3CLPA 4CE8A 4K21A 1YUDA 1WW6A 3RFRA 2GAUA 4MHUA 4LOSA 4PIXA 2JE7A 3ETQA 3ST7A 3HQRA 1FPN1 3A21A 4LO8A 4E4DX 2R042 4TWTA 2B5HA 4AK3A 4EZ4A 4CP2A 4XAAA 4C91A 2D6NA 1DHKB 2IFRA 2P6CA 3GJAA 2ZKNA 1WW5A 2CGNA 3LSEA 3UV9A 1R081 3ZXLA 1RUNA 1DBNA 1QJY2 2Y0IA 2XUMA 2JWPA 3VDDA 2DUPA 1COV1 5FZ3A 3O1SA 2CWMA 3H1WA 3PUSA 2IFWA 2DBNA 4AI0A 2C6SA 4CDUB 1OOPA 3GZEA 3MV01 4ZHNA 4TTGA 3H3LA 5L19A 1SBFA 3RGBA 4CP1A 3GCWA 4DMIA 1S0JA 1ZBE1 3TN92 2FMDA 1K5MB 4IW3A 4BQXA 1RXGA 4LULA 1NLRA 4R4ZA 4META 5F2SA 5SV5A 4Q4V1 5FK8A 5FQ0A 5D1IA 3J7LA 4YWAA 2JB8A 4M3CA 1C8NA 1B35C 2X10A 3WQBA 3VDBA 4FP3A 1LHOA 1RB8G 1I6XA 2VXRA 1HN1A 2WO3A 1JH5A 1ST8A 3PHMA 4S2GA 1UX7A 4FPKA 1ULDA 1J1LA 4CA9A 5FPVA 1X33A 2OS2A 2JE9A 3LWCA 2I07B 1J3PA 1IG3A 3ALQA 2MEV2 5EZWA 2ZGRA 4XUOA 1AVBA 3OSDA 4QB6A 5DAXA 2NP0A 1VAVA 2YBSA 3MIBA 1HLCA 4ITCA 3FHQA 1S55A 3TOJA 2P5BA 1F35A 5E6HA 4YVWC 2CGOA 5CA6A 2BOIA 4XFGA 1V6MA 1NYWA 3DF0A 3HR9A 1YC61 4C1WA 1CX1A 4DEVA 1S0FA 1NA1A 4XFIA 2Q8CA 3SNMA 1GP4A 4IGOA 5LW9A 4AYUA 4MGKE 5C70A 1GLHA 1S0CA 2ZAHA 1QJY3 2K46A 4YZ4A 1RUD1 3Q8CA 3FLRA 5EIYB 3ZFFA 2OX0A 3NNFA 1UF2C 4YM2A 5FZAA 3B3QE 3WF4A 5ACA2 4A6OA 3K4DA 3ZYFA 4J6GA 1NQDA 4Y26A 2ZGOA 2YPDA 3PIGA 1W03A 2P2KA 3TN93 5FPUA 1J58A 3VD4A 4Y1VA 3KQRA 2HEYF 1ACCA 2ZGUA 2AENA 2C9KA 2WZ8A 1Z7S2 2XONA 2WFF1 1SLTA 1V00A 4IEWA 4CEYC 3O1PA 2QQIA 4V2VA 4LBQA 1X8MA 2I74A 2DTWA 1B35B 5A33B 3H42B 5HCAA 1TNFA 3WD5A 1X9TA 3WHTA 3OUHA 1MZ6A 5CNAA 4K20A 1F8VA 2WC2A 5H9SA 3HNMA 3KCXA 4QQHA 2JENA 2GZWA 3VKNA 3MZHA 1XOYA 1ZZ6A 4K8FA 2MEV3 4QQPA 3O1TA 4XFFA 5AFEA 2XXZA 3IKWA 4BHPA 2GMMA 1H2MA 4XE9A 3S5AA 4SLIA 4I2OA 1PGL1 2D3PA 3T08A 1NZIA 1UY1A 1YFYA 3KT4A 4M4PA 3ZDVA 2PLV2 5T5LA 4BOWA 1N3PA 5I0SA 4YVWB 1EUTA 4QMAA 3VKOA 4IE5A 5DXDA 1GWLA 4GMP3 3CEWA 1AHSA 3SKVA 1X7NA 5FP7A 2CHHA 5FYYA 3VBFA 2EA7A 2D6LX 2PTMA 4YW3A 3OBRA 2XLGA 2J1SA 4GJYA 4LR4A 4ZU5A 1ZBA2 2A1XA 4OLLA 2OXBA 3CZJA 3I3DA 4XUTA 3KVAA 1OXCA 4RS5C 4XF0A 1X50A 2DVFA 1AJKA 5ACA3 2R0FA 2RM21 3TEWA 3ZSLA 1KITA 5F32A 5E8AA 2ETEA 4PT6A 1LENA 2P3KA 4V1PA 2UYAA 5A3MA 3SH4A 3J4UH 1FPN2 5A7WB 4CCNA 4BYYA 1Z7S3 1UU6A 2K9ZA 3HMYA 4HFSA 1A3KA 3GALA 1PK6A 2PQSA 4OUEA 4OCTA 4XZUG 1H1MA 1O59A 5CFDC 2P1BA 3LPGA 4PIZA 2KM2A 3MF9A 3VGIA 2VCBA 1YNAA 1FMD3 1H2LA 1R082 1S0GA 4ZXEA 3VHNA 4COWA 1E5RA 4MGYE 1PMJX 4QDSA 4XJZA 1COV2 2HWD1 4AQTA 4QDQA 2AEYA 2ZEYA 1QXRA 1FOD1 2WO7A 4IGQA 2OYZA 1EPWA 2E63A 5DZFA 2W08A 2JG8C 3G7DA 5A3TA 1OD3A 3PDQA 5EV7A 2EXIA 2E7AA 4P5HA 2GH2A 1CJPA 2PLV3 4HBNA 4UBGA 4XVHA 5T55A 1ZBE2 4WBBA 4BCUA 3WG2A 2ZX3A 2A3XA 3AYCA 3RZZA 3N9OA 4D7SA 1PZ9A 5IVJA 4ISQA 3AX4A 1O7FA 1PO11 1YO8A 3LEGA 4BA6A 3ZN6B 3SISA 1ZBA3 5L73A 1GU3A 4OHWA 2E7QA 3S30A 5KHIA 1W8OA 1ALYA 5FCCA 2TUNA 1ASJ1 1N47A 1GZ9A 4RS5B 3W5NA 1PVC1 5APAA 4PLNA 5GLUA 2LROA 2XLAA 5JMCA 1IPJA 1RUG3 5FIXA 1FPN3 4BK4A 2PHLA 1UZWA 4OZXA 2FCVA 1TE1B 3CJXA 4JQRA 3SXWA 5A6ZA 4XC9A 4P9XA 3EJKA 5JVVA 5L9VA 4UF0B 1VRBA 3SEEA 3N9QA 4LQRA 1O3QA 1CJDA 4OZOA 3NW4A 4KGGA 4Y5Z0 4M0NA 3SMHA 5AFBA 2GN3A 5CFDB 1GP6A 4CCJA 1HB1A 4HKWA 5DZEA 1DCSA 1L7LA 4CCDA 2BBVA 3U1XA 2XJUA 2ZHMA 1COV3 1MVEA 2YC2A 1W2OA 2ET7A 2JKBA 1UZVA 3FJSA 3QH7A 2P6HA 2DU1A 5ANQA 1N1TA 1ZX5A 2EIGA 4YW4A 1HKDA 4CDWC 2LALA 3M3IA 3THDA 4HN1A 4R9CA 3HJRA 1UY3A 1ND3A 2JG8B 5FXVA 4P9YA 4YG0A 2SBAA 4AWDA 3AP5A 2W87A 1ENRA 2WFF2 2BERA 2JDPA 3RDIA 2D5HA 2PHXA 3NVCA 4Y5SA 2VECA 2DCZA 1OFSA 2Y0OA 4QB1A 4D7TA 1EAH1 2Y6JA 1NCRC 1OMIA 5ANNA 4P08A 5JXIA 2W9XA 2RJ2A 3I59A 4LKFA 2K2SA 3ECQA 3D82A 2XKOA 2ZGSA 2Z69A 4XQWA 4BMBA 1XNKA 4W6XA 1FNYA 3WDTA 3GBFA 3BALA 4E2SA 3O0VA 2IXJA 5FY8A 5FZOA 1PGL2 3PMSA 5J96B 1K42A 1W6NB 3AB0A 3POIA 1LGCA 1JZ7A 4CEWA 4IV1C 2QVSB 2EXKA 1VB4A 3LF7A 1DG6A 1H2KA 3WLUA 5EQUA 4H2AA 3NJVA 2WR9A 2WNUA 3WF1A 1CGPA 3NNGA 1CD3G 5FKBA 3Q8EA 1PMHX 1TQ5A 2O14A 1SBDA 1PO21 5LZ6A 1XSQA 2CAUA 2RM22 3KHBA 3WEZA 1LEMA 1E57A 4JTNA 2LUWA 2Y8KA 1A8MA 3M3CA 3IPVB 4CDWB 2C1FA 4MVTA 3ABZA 3KLSA 2J1RA 1C28A 3ROUA 2GNTA 5AC91 2WFF3 3C3VA 1AR81 1IKQA 1UN1A 5A3PA 2KA3A 2ZGNA 2ARBA 5F5QA 5HCHA 3KF5A 2WUHA 5HXVA 2TEPA 4LBMA 4M00A 1REFA 5FZLA 5IHRA 4DS0A 5L7OA 5FYBA 3CU7A 5JPNB 1NCRB 5LCWL 1GSLA 3BTZA 3GXUA 1RUI2 3BB6A 2HWD2 3FBMA 1FOD2 4XJAA 4NAOA 1UYYA 4JGZC 2OA2A 4X6RB 5FBJA 4ORFA 2FDFA 2ZGMA 1VLNA 3ATGA 1PIV1 5A3UA 4LKDA 5LBBA 4CSWA 2QQPA 1W04A 4QM8A 4Q4W1 4FOQA 1K5JA 2XJTA 4PDWC 1QXPA 3BN6A 3N7LA 1AYN1 3RMYA 2IXIA 5I8TA 1PO12 4IV1B 3VUOA 1GP5A 1H6XA 5J09A 1UKRA 2FHRA 2HBUA 3RZKA 4XMIA 1MS1A 1RJ7A 3FLTA 4MXWA 4EWDA 4IEZA 4HOOA 1I9RA 3INAA 1ULEA 4UYBA 1D7PM 4PI0A 2RM23 1AR61 3ZLIA 1PVC2 4HN0A 3RZHA 1LOEA 4XXPA 3MIEA 1BZWA 1U12A 1XBFA 1AL0G 4UW4A 1UNBA 1N1YA 1E5HA 1YHFA 2ZZQA 2HWF1 3WY6A 2XQXA 2BQPA 4Q1RA 5BNPB 2R1BA 5HXMA 4BQWA 2XBO1 3KB5A 3UGHA 3W21A 5CKNA 3MFAA 4DNYA 1N1VA 1KS5A 3FC0A 1IGOA 4HVOA 4QD2A 2E53A 1UY2A 4A3ZA 2JDZA 4QPYA 1WA4A 1QY4A 1DGRN 2RS11 3M7AA 4OHXA 2ET1A 2Y33A 4Y20A 5H9QA 3VBHA 2FDKA 1P8JA 3VD9A 1RUI3 2HWD3 2WS93 1TMF1 1QJZA 1FOD3 2ZGKA 4KG8A 1ZZ9A 1CAXA 1ZZ8A 1A78A 2EXJA 2QFEA 5EPAA 5LB6A 3ASIA 4FTBA 3MW4A 2X5IC 4JGZB 1HXS1 1RHI1 3AC0A 3CMGA 3R05A 3D0JA 1Z0HA 3N35A 2VBBA 3FFZA 1OD5A 2CY6A 4LE3A 2XVLA 1NOVA 4QKDA 4DO0A 1S2EA 4QHOA 4QXCA 5BNOA 3VD3A 1AXZA 3UKNA 2OUHA 4IEYA 5EYXA 4EN6B 3UYJA 1PO13 3MIGA 4Y22A 1ULCA 2NQYA 1EAH2 3OGSA 4PDWB 1UZ0A 3WDYA 1C5IA 4K8RB 1HJGA 3LOBA 1RUC1 3E6CC 1NLSA 1HRV2 4AOCA 2VMDA 4N43C 5C3RA 1IS4A 2W46A 3JUUA 1PVC3 2RS32 3OGJA 1Y7BA 4RGGA 1JU3A 3SCHA 2VBPA 2CGPA 1DFQA 4CCLA 4GKXA 1LGBA 3T0AA 5IYYA 3DXTA 3KF3A 1SPPA 4EZHA 4AVSA 1O5UA 5GLZA 2PFWA 2YG0A 2Q8OA 4CRQA 1DLLA 2DFBA 1KD7A 2WZEA 2AZ5A 3RG0A
chains in the Genus database with same CATH topology
1UOBA 1GP4A 1E5SA 1QIQA 2IVIB 1WA6X 2VBDA 1W2AX 5APAA 3ZKYA 1OBNA 1W03A 1W04A 1UZWA 2VE1A 1UO9A 1GP5A 1QJEA 1GP6A 1HB1A 1DCSA 2VCMA 2Y6FA 1W05A 1W2OA 1UOGA 1ODNA 1QJFA 2Y60A 4RGKA 3ZOIA 1UNBA 1W3VA 1E5HA 4XAEA 3ZKUA 1UOFA 3ON7A 5C3SA 1RXFA 1BLZA 2DBIA 2JB4A 2BRTA 1IPSA 5C3PA 1W28A 5C3OA 2VBBA 1HJFA 2DBNA 3OOXA 4BB3A 1W9YA 2VAUA 1OC1A 5C3QA 1HB4A 1W06A 2BJSA 1RXGA 1ODMA 1HJGA 1HB2A 2JB8A 1HB3A 2CSGA 5C3RA 1W2NA 1BK0A 1E5RA 2VBPA 2IVJA 2WO7A 2BU9A 1W3XA 1E5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOB A;  1GP4 A;  1E5S A;  1QIQ A;  2IVI B;  1WA6 X;  2VBD A;  1W2A X;  5APA A;  3ZKY A;  1OBN A;  1W03 A;  1W04 A;  1UZW A;  2VE1 A;  1UO9 A;  1GP5 A;  1QJE A;  1GP6 A;  1HB1 A;  1DCS A;  2VCM A;  2Y6F A;  1W05 A;  1W2O A;  1UOG A;  1ODN A;  1QJF A;  2Y60 A;  4RGK A;  3ZOI A;  1UNB A;  1W3V A;  1E5H A;  4XAE A;  3ZKU A;  1UOF A;  3ON7 A;  5C3S A;  1RXF A;  1BLZ A;  2DBI A;  2JB4 A;  2BRT A;  1IPS A;  5C3P A;  1W28 A;  5C3O A;  2VBB A;  1HJF A;  2DBN A;  3OOX A;  4BB3 A;  1W9Y A;  2VAU A;  1OC1 A;  5C3Q A;  1HB4 A;  1W06 A;  2BJS A;  1RXG A;  1ODM A;  1HJG A;  1HB2 A;  2JB8 A;  1HB3 A;  2CSG A;  5C3R A;  1W2N A;  1BK0 A;  1E5R A;  2VBP A;  2IVJ A;  2WO7 A;  2BU9 A;  1W3X A;  1E5I A; 
#chains in the Genus database with same CATH topology
 1H8T C;  4ZPI A;  4WVM A;  3O12 A;  4PQ9 A;  3CJI C;  5D2A A;  2G4I A;  4Z8B A;  4Q4X 1;  4UFH A;  3SIT A;  3DGT A;  4FI9 A;  3V56 A;  3VV1 A;  2VOX A;  4I01 A;  1NZC A;  3SCG A;  1MR5 A;  2IVI B;  3VBS A;  1Q8P A;  2RJK A;  4L2N A;  3KV6 A;  1GZT A;  1RTV A;  3SLI A;  2D97 A;  4NWV A;  2NPI A;  4I0B A;  1A6C A;  3CHX A;  4EN0 A;  4KBB A;  2X5I B;  4R9A A;  1YFW A;  3WDW A;  1XJA A;  4COV A;  2WQ8 A;  3X29 B;  3NV1 A;  4YGC A;  5AC9 2;  4ZXK A;  1OT5 A;  5J37 A;  1IOA A;  1LOC A;  3KSC A;  1CPM A;  4QPW A;  1EAH 3;  3MW3 A;  3T30 A;  4AFB A;  4N90 A;  3U4S A;  5C71 A;  2BYV E;  4JHT A;  3GDB A;  3WG4 A;  3A7Q A;  4DOU A;  3ACL A;  4ET7 A;  1OLR A;  4P9I A;  1HRV 3;  1JZ2 A;  1QXJ A;  4KMQ A;  4EN8 B;  1WCD J;  2QJV A;  3LEI A;  3K2O A;  1URX A;  2RS3 3;  2ZOE B;  4N43 B;  5KHH A;  1YRZ A;  2ERF A;  1UX6 A;  4XAB A;  2D93 A;  2WNV A;  5JI9 A;  2C26 A;  1LUL A;  1RUH 2;  5AVP A;  4IEX A;  3WR0 A;  3LSD A;  5FOJ B;  1PIV 2;  4QWN A;  2DYC A;  2HYK A;  2XJR A;  4NRO A;  1S4C A;  5FZB A;  5A32 B;  4AHX A;  3WP5 A;  1RGS A;  4GWI A;  4ARX A;  1AUY A;  4JKM A;  4Q4W 2;  1CZS A;  2FDI A;  3VDC A;  4OHV A;  1AYN 2;  5CYY A;  4U2A A;  2VPV A;  2X09 A;  1AL2 1;  2C5D A;  4JTO A;  2P34 A;  1PZ8 A;  3JCI A;  1UD1 A;  2AH2 A;  2YGL A;  5LEJ A;  2VNG A;  2XML A;  1H8T B;  1UAI A;  3N36 A;  3POJ A;  4EWE A;  3CJI B;  5FMO S;  3USS A;  5KXD A;  4ZU4 A;  5FZ7 A;  1AR6 2;  1GBG A;  2Q1M A;  2OVU A;  4MG2 A;  4N7U A;  5DAW A;  5JXG A;  1S1A A;  3QD6 A;  4EJR A;  1F31 A;  5IFT A;  1G6N A;  4RD7 A;  1NCQ A;  2BTV C;  3MIC A;  5K8S A;  4F3J A;  3VL9 A;  2HWF 2;  3C7H A;  1LAJ A;  3Q8F A;  2HEW F;  1DDL A;  4W6W A;  5AC9 3;  2F17 A;  4GZ9 A;  4A6S A;  1A34 A;  2YXS A;  2XBO 2;  2ES3 A;  4PBO A;  4UFK A;  5I93 A;  1US2 A;  2Y64 A;  2QQU A;  2VW1 A;  1LOA A;  4YGB A;  3P3N A;  4CP9 A;  1ODM A;  4LBQ D;  4D3W A;  4OHY A;  1UXX X;  4QGM A;  4D6Q A;  2NYY A;  4LIT A;  1BXH A;  2B45 X;  1V9U 1;  1MS0 A;  1TMF 2;  1UMI A;  2FCU A;  2HWB 1;  2YDE A;  3IWZ A;  4QX7 A;  3RYP A;  2KXL A;  4AFD A;  3OUJ A;  1RUH 3;  4X8P A;  1HXS 2;  1RHI 2;  4CDU A;  1PIV 3;  2W2I A;  5CFC C;  4OUS A;  3RYR A;  2XUE A;  5JZG C;  2E51 A;  4Q4W 3;  3AZV A;  4LKS A;  4F7Z A;  2CWS A;  3M70 A;  1AYN 3;  4N53 C;  3KVB A;  1NUK A;  5EJ3 A;  5F2W A;  3ZFG A;  4D7Y A;  3MEP A;  1XPW A;  3WQ1 A;  4RA0 A;  4OFG A;  1ZZC A;  5H9P A;  3TB0 A;  5T5O A;  3LB9 A;  4LOR A;  4XQ4 A;  3SH5 A;  1RUC 2;  4FQZ A;  4FVV A;  3VBR C;  4E9K A;  5CIS A;  4V2W A;  4BIO A;  5JCT A;  1F15 A;  4G9S B;  2CDP A;  1U5X A;  1AR6 3;  4QDR A;  1OLQ A;  5I8Y A;  3ZXG A;  3D6E A;  1RUO A;  4RYD A;  4Q1P A;  1OA2 A;  5CEH A;  3OF1 A;  5FY1 A;  2P3J A;  2HWF 3;  2K0G A;  1O8P A;  3HAG A;  3J7M A;  4HZF A;  5IW0 A;  4YNI A;  3T4V A;  1IS5 A;  1NT0 A;  4Q2F A;  3ZR6 A;  2XBO 3;  2EAA A;  2ZMK A;  4XET A;  3AVR A;  2ARC A;  3KT7 A;  2IZW A;  1LOB A;  1MQT C;  2GNB A;  4UW5 A;  1NXD 1;  2B4K A;  4QHZ A;  3KM5 A;  4D0Q A;  2ID4 A;  1KJR A;  4H3W A;  1UPS A;  4P9G A;  2JDK A;  4FOV A;  1YQ8 A;  4Q4X 2;  3FN9 A;  1KFU L;  4RGA A;  2AUY A;  4XAC A;  4KWK A;  5JLV A;  2WSU A;  3B00 A;  1PZ7 A;  1C1L A;  1FI2 A;  3ILN A;  3LA7 A;  4LUM A;  2JJ6 A;  1HXS 3;  2W1Q A;  1RHI 3;  4CU6 A;  1GNZ A;  2VQA A;  3FL7 A;  2Y34 A;  1JOJ A;  3V64 A;  5BYN A;  2H0B A;  1UMH A;  4Y33 A;  5CFC B;  4DB5 A;  4YM0 A;  5JZG B;  2WBK A;  3N7K A;  2XLF A;  1V0A A;  2PHD A;  4N53 B;  1HQN A;  5JSP A;  5JMO A;  1NX9 A;  1MZE A;  3AZY A;  3III A;  3ON7 A;  4XOG A;  5FMD A;  5G05 L;  2OII A;  3WZ1 A;  2WYF A;  3HQX A;  4IE0 A;  4XJU A;  1RUC 3;  5FPB A;  3VN4 A;  4EN9 B;  3BI3 A;  3J8F 2;  4Q0V A;  3T0B A;  3VBR B;  2VUC A;  3RPQ A;  3HNB M;  2LW8 A;  4Q5O A;  1LED A;  4D94 A;  3VZJ A;  1GKB A;  1QOT A;  1HQW A;  3WUC A;  2VMI A;  2JB4 A;  3MID A;  2ZBJ A;  5BV6 A;  5FWJ A;  3NJY A;  1LB2 A;  1SZB A;  5A7Q A;  5LRR A;  2DV9 A;  2QE3 A;  3A23 A;  5EP9 A;  4F83 A;  1OQ1 A;  4JKK A;  3BYW A;  4YW6 A;  5BNN A;  1W28 A;  2PMW B;  2XJS A;  5T50 A;  3OOX A;  1NY7 1;  5I8S A;  4OQ9 A;  3N9L A;  3J9S A;  5FBZ A;  1W2U A;  5F3E A;  3WNX A;  1AL2 2;  5A1L A;  5FO8 B;  1RUF 1;  1IQA A;  3DV8 A;  1MQT B;  2R7E B;  3FX3 A;  3THC A;  5KHJ A;  5C4W A;  5LY2 A;  4Q4X 3;  4AHY A;  3DUI A;  1VMH A;  2CSG A;  2PYT A;  5GKA C;  4XYX A;  1XC6 A;  1GFF 2;  2VZS A;  4GH4 A;  1VMF A;  3KGL A;  4P9L A;  4XIO A;  4LHL A;  1H9W A;  1QJU 1;  3ZXE A;  4MZU A;  1FV3 A;  3IM0 A;  4M0H A;  2O8Q A;  3ACI A;  4YM1 A;  4YYO A;  5FXW A;  2Q8E A;  1STM A;  2BU9 A;  1HRI 1;  2GN7 A;  3RQ0 A;  2ZAC A;  5FZ4 A;  5A70 A;  4O7X A;  5K0U C;  1OF3 A;  3LA3 A;  1DQ5 A;  3ZSK A;  4NMI A;  1JYI A;  1CAV A;  4LO6 B;  4Z1V A;  4IGP A;  1GZC A;  4I30 A;  5FYZ A;  1V6L A;  3KV5 A;  4FPO B;  3J8F 3;  1JYW A;  1M06 G;  1DYP A;  2D6O X;  2WRA A;  5H9R A;  1GIC A;  1CAU B;  1POV 1;  1UU5 A;  4GXL A;  3KMH A;  3Q8A A;  4GWM A;  1CN1 A;  1V9U 2;  2HWB 2;  1OH4 A;  3AL6 A;  1MEC 1;  1TG7 A;  1X36 A;  4N9I A;  4NII A;  3ZPO A;  4CCM A;  5F1R A;  1RED A;  1MZF A;  3M8L A;  3EB7 A;  4WM8 C;  3OBZ A;  1F5J A;  1PM7 A;  3I54 A;  4A7Z A;  4B4Q A;  1ZVF A;  4XF1 A;  3GZU C;  3T4H B;  3RZL A;  2VNR A;  1B09 A;  3VLB B;  1W2A X;  5DPN A;  3PTY A;  4AVT A;  2IUW A;  1OBN A;  1ZZB A;  1DZR A;  2VTF A;  5T54 A;  1EV1 1;  3IAP A;  3JQX A;  3THP A;  3C7G A;  2EF6 A;  4LJH A;  3RI8 A;  4P00 B;  3KCC A;  3AFG A;  1W6Q B;  2Q1F A;  4KG0 A;  4BU2 A;  1UZZ A;  3ZN6 A;  2DCT A;  4I0A A;  4I3P A;  3OGR A;  4QXK A;  2R04 3;  1Z78 A;  2VVD A;  1OKQ A;  2V4V A;  4XDP A;  4PLM A;  1YIF A;  2QQL A;  5FOB B;  3DPR C;  5GZD A;  5BNP C;  4FP2 A;  2VMF A;  2P3Y A;  1GOH A;  4ERO A;  4RS5 A;  1K45 A;  1JS9 A;  4GD4 A;  3D5O A;  4XFC A;  2EID A;  5FO7 B;  3NST A;  4OI4 A;  2V72 A;  3AZW A;  4LIV A;  1G9F A;  1QJF A;  2R32 A;  2XQR A;  4URT A;  1W0O A;  4YGD A;  5DDJ 1;  4HPK B;  1W3V A;  4C1X A;  3VD7 A;  1PNF A;  1XNB A;  4NRM A;  4OI0 A;  2D6M A;  5K0U B;  1L7Q A;  4G3Y C;  5KC5 A;  4IL7 A;  2X29 A;  3SC7 X;  1O3R A;  3PVO A;  1MS8 A;  4UF0 A;  3I2I A;  1N1S A;  3NNM A;  5CFD A;  4XUN A;  2BOJ A;  3LEK A;  1V9U 3;  2HWB 3;  3DEC A;  4RHV 1;  5FYS A;  1TME 1;  2OUJ A;  2VZQ A;  4QKF A;  1AX0 A;  4ONU A;  4S2D A;  4E27 A;  4XHB A;  4ES8 A;  4Y4Y A;  1QGL A;  3A0N A;  4WM8 B;  2A71 A;  3NQH A;  4BQ3 A;  3DKW A;  5DAB A;  2JEC A;  3V65 A;  3RZM A;  3BIW E;  5LY1 A;  3R4D B;  2ARA A;  4JX0 A;  3WW2 A;  2QKD A;  3U0Z A;  2VW2 A;  1KQR A;  3VDD C;  4JHZ A;  1H9P A;  4IE6 A;  2WT1 A;  1GQH A;  1W0N A;  4MH0 E;  4AQ2 A;  3M4F A;  3SKJ E;  1RUE 1;  5KC6 A;  4O9E A;  1ZM1 A;  4ASL A;  1LHU A;  3MF6 A;  2BFU L;  3KCY A;  1W06 A;  3OPT A;  4QPG A;  5JR7 B;  3PLQ A;  5IVB A;  3O1M A;  1FX5 A;  3P3P A;  4IER A;  2E31 A;  2J42 A;  1AX1 A;  3DPR B;  1F4H A;  4LO5 B;  4HON A;  4XJW A;  1X8E A;  5F5I A;  2PHR A;  4CDX A;  1SQ4 A;  4CXX A;  2AAC A;  3MGU A;  3OBT A;  1RIR A;  4ZON A;  2GU9 A;  1W9F A;  5J36 A;  2VQ0 A;  5JAX A;  3LEM A;  1Y9M A;  1KJL A;  2G19 A;  3KV4 A;  1R09 1;  4HKL A;  2IVJ A;  1RIN A;  4IEU A;  4DRV A;  1W6N A;  4NID A;  1PVX A;  1S0D A;  4FPH A;  4YG3 A;  1NY7 2;  5DAV A;  4GWN A;  3WNO A;  2GC0 A;  4GJZ A;  2D6K A;  1XYO A;  1Y4W A;  2C9A A;  2JDH A;  2XJQ A;  3ZYI B;  1RUF 2;  1W8W A;  4IEP A;  3VBU A;  1I5P A;  3P1I A;  2W3J A;  3ZDS A;  1O91 A;  3U4X A;  1POV 0;  3O1R A;  2HEV F;  3RZJ A;  5B4X A;  4CEY B;  1HV1 A;  4GKY A;  4CXW A;  2WQZ C;  3N3H A;  4BLI A;  1W0P A;  4UAP A;  3I97 A;  4Q0U A;  1YXW A;  5C6C A;  4EV0 A;  3WDX A;  4Z82 A;  3N7M A;  2CTV A;  4LLO A;  1QU0 A;  2OT7 A;  3KT1 A;  2J1E A;  4CDW A;  3M2M A;  1JTZ X;  1QQP 1;  2W94 A;  5ABJ C;  2OQ6 A;  4QX2 A;  1HRI 2;  4B3N A;  3VKL A;  1CQ9 A;  1W99 A;  3F2Z A;  3E6B A;  3DYM A;  4RSU A;  3ZFF C;  4ZKT B;  2W39 A;  1ONA A;  1UMZ A;  4K6B A;  4NAM A;  4UFL A;  3VDD B;  3WNP A;  1C3H A;  4L8Q A;  2WNO A;  2EVX A;  3CZU A;  4K7J A;  2RJL A;  4NIA A;  1NCR A;  3WQ0 A;  5IJR A;  2ZZJ A;  4Q4V 2;  4OQ8 A;  3U10 A;  3H1M A;  2UWA A;  3BU0 A;  2QTW B;  1MEC 2;  2A6X A;  3PUH A;  3K77 A;  3SQO A;  3WNK A;  2VVF A;  1G86 A;  3MPB A;  3V0A B;  5FP9 A;  1WMD A;  4IQP A;  3QCW A;  5FLH A;  4H55 A;  2BNN A;  3R6S A;  1CZT A;  3N7J A;  3VBO C;  5DAP A;  1KDK A;  3ACG A;  2YU1 A;  4OVE A;  2R1D A;  5FWE A;  3WDU A;  1OUX A;  3MIH A;  4LBL A;  3ZOI A;  1FV2 A;  4BWO A;  1EV1 2;  3C2U A;  4DY3 A;  2WT0 A;  3O14 A;  1ZNP A;  4COY A;  1Q8Q A;  2VY0 A;  3FE5 A;  2I45 A;  1IQD C;  5A7P A;  2J7M A;  4BK5 A;  1C1F A;  1AF9 A;  3MLK A;  1RUF 3;  3EYP A;  3O5S A;  1D2S A;  4LO4 B;  4DUW A;  4LE4 A;  2HWC 1;  1DU3 D;  3QH6 A;  4TSV A;  4AED C;  4ZZ8 A;  5FYU A;  1JYN A;  1I3H A;  1O5L A;  3T1M A;  5GZG A;  1W90 A;  1AX2 A;  3WIN E;  3W5M A;  3UT0 A;  1HW5 A;  3WP4 A;  1WMF A;  1JHJ A;  1K12 A;  4NHX A;  1ZYB A;  4Q26 A;  2BRT A;  1J83 A;  1R08 3;  1G9B A;  4MGI E;  3T0D A;  1WLC A;  1TEI A;  1S2B A;  1RUD 2;  3I2K A;  1XU1 A;  3IDE A;  3ZXJ A;  4CU7 A;  3OY8 A;  1HRI 3;  2R0H A;  4QGL A;  4B29 A;  2QQM A;  1BHG A;  5ABJ B;  2VMH A;  4FFG A;  3ZFF B;  3U07 A;  1HV0 A;  2DVB A;  1VR3 A;  1ZBE 3;  2A6Z A;  2VGD A;  5E89 A;  5F3C A;  3HBZ A;  2ADD A;  1POV 3;  4XDO A;  4Q4V 3;  2DUQ A;  4YZ3 A;  2O0O A;  2EIC A;  3NAP C;  1GQP A;  1MEC 3;  1QOO A;  5FZK A;  1TME 2;  4Y1Y A;  1UYZ A;  3WX5 A;  1PK6 C;  1LOF C;  2XR4 A;  1DGW X;  1OA4 A;  1IS6 A;  3K4Z A;  4DXR A;  4LBQ B;  1JZ5 A;  4M3C E;  3H3U A;  4JGZ A;  3BTY A;  4MGQ A;  2V73 A;  4WZF A;  2UUR A;  1BK0 A;  3H3Z A;  3AKS A;  1KXG A;  4NWW A;  3RMX A;  1ND2 A;  2VME A;  3NNJ A;  3VBO B;  3ZO0 B;  2VW0 A;  3WNL A;  2A5Z A;  1QKQ A;  1RUE 2;  4IEO A;  4PDW A;  2XHK A;  1JYX A;  5FLI A;  2WQ4 A;  5HCB A;  1L3J A;  4MGT A;  2H6C A;  5IAT A;  1H4G A;  2VQT A;  4XXA A;  2XDV A;  4AED B;  1VBA 1;  1YQ2 A;  4JQT A;  2VCC A;  4B7E A;  1YCI A;  2ZGT A;  1UOB A;  4AVA A;  1DYK A;  1BJQ A;  4F8A A;  3NKG A;  3I3B A;  1RUD 3;  4LHN A;  5DUX A;  4C0B A;  5BY5 A;  1R09 2;  2WAA A;  4Y24 A;  5LRS A;  3B5L B;  4Z2A A;  2BV4 A;  3FHI B;  4UBH A;  4E2Q A;  5FPA A;  5J1X A;  2GH8 A;  2JE8 A;  3J26 N;  3GBG A;  3WT3 A;  1Q43 A;  5A1F A;  3AMP A;  3S7E A;  2GP5 A;  2BDR A;  5C33 A;  3BPS A;  2Q8D A;  5LK5 A;  5D8A C;  1NKG A;  2AGS A;  3HT1 A;  4YVS A;  4I09 A;  4LT5 A;  1TME 3;  4BQ5 A;  1V6O A;  1XNC A;  2OKX A;  2ORZ A;  2WO2 A;  3I4I A;  3NAP B;  4UW3 A;  3AJY A;  1F9K A;  4AFM A;  1XNA A;  3AP9 A;  3GHN A;  2HBT A;  5I0U A;  3VDA A;  1H30 A;  1PK6 B;  1UU4 A;  2BWA A;  4X6Q B;  5EFU A;  5FZE A;  2VZ1 A;  2QQK A;  2YBP A;  2UY9 A;  3LAG A;  2ORX A;  3K3N A;  1QQP 2;  2OW4 A;  1J1T A;  4NO4 A;  3PUR A;  4AW7 A;  5LA9 A;  1AXY A;  3R4S A;  1A8D A;  4XTP A;  4DRR A;  4IV3 C;  5FR3 A;  4RGK A;  3I2J A;  1CAW B;  1SHW B;  4NHL A;  3DL3 A;  1LOD A;  1IHM A;  1RUE 3;  1APN A;  2R07 1;  2YBK A;  3ELN A;  3POY A;  4OUM A;  1D4V B;  3UES A;  3V0B A;  2Z2S B;  1ND3 C;  2JG9 A;  2PHF A;  2W91 A;  3AXD A;  5GZC A;  1VBD 1;  1V6I A;  2FMY A;  3K48 A;  4O65 A;  2D6P A;  3AKT A;  5M0T A;  5CKM A;  4LNV A;  3TEX A;  4MYE A;  4YLZ A;  3WXP A;  2YB7 A;  3WHU A;  2ZX1 A;  4YZ2 A;  4OHZ A;  1BCX A;  3ORJ A;  5IK5 A;  1SCR A;  2WZR 1;  5EWS A;  1WCS A;  2WKK A;  2YMZ A;  5HV0 A;  2E26 A;  2FDG A;  1R09 3;  4RR3 A;  4ARY A;  2EIB A;  5A32 A;  2ARE A;  1ENS A;  1ASJ 2;  2HLE A;  2Y38 A;  3ZFE A;  4BDV B;  5F3I A;  5DZG A;  1W6P B;  2GSY A;  4HG6 B;  4FBF A;  2WZP P;  4WM7 A;  4H14 A;  3C7E A;  2DCJ A;  4QPI A;  1LOG A;  1VBC 1;  5D21 A;  2HWC 2;  2VXJ A;  4QT6 A;  4EYU A;  3IDB B;  5T5J A;  5D8A B;  4CEW C;  4HK8 A;  3MI8 A;  3B93 A;  2H0V A;  2ILM A;  1HB3 A;  2A3Y A;  3MDP A;  4R9D A;  5IVC A;  1QQP 3;  3KGZ A;  1VPH A;  5FP3 A;  1LHV A;  3B02 A;  1LGN A;  1GZW B;  2BNO A;  3LDK A;  1YQC A;  1W6M A;  4AAP A;  3KQ4 B;  3OEB A;  5FYM A;  1QWR A;  2IWG B;  4IV3 B;  3BVC A;  4LTA A;  4CDQ C;  2W52 A;  4CCK A;  3LFI A;  3RZG A;  3ZM8 A;  5F39 A;  1LTE A;  1F4A A;  1OKO A;  5G04 L;  3CNA A;  3RS6 A;  1ND3 B;  2QBX A;  3H9A A;  4CU9 A;  4E2G A;  2D43 A;  3ZXA C;  3TEZ A;  4URA A;  2VUD A;  2FD8 A;  5IVY A;  3ZN4 A;  4FTE A;  5FUP A;  5FPZ A;  1R1A 1;  2RDN A;  2YYO A;  1H0B A;  4IXL A;  2BW8 A;  4KGQ A;  3WG3 A;  3CKH A;  5I0T A;  1I1E A;  2BWC A;  5FYC A;  5F8P A;  1GUI A;  2VUJ A;  3UGF A;  3WV6 A;  3PTR B;  5EXO A;  2VL4 A;  2PXJ A;  3VB9 A;  1ASJ 3;  1WD4 A;  1QDC A;  2Z5W A;  3MHZ A;  4PIY A;  4JRA A;  5BNQ A;  5ERL A;  1EY2 A;  1L7R A;  5DUV A;  1UQX A;  4DY5 A;  1KFX L;  1CVN A;  1Q56 A;  2BGC A;  2RDQ A;  5A6Q A;  2N7G A;  2HWC 3;  3NJZ A;  4E4S A;  3URF A;  3OD4 A;  4YG6 A;  4CPB A;  3OGV A;  5J48 A;  3NNL A;  1V6J A;  1YJL A;  2A7A A;  4NVP A;  4W6Y A;  2GAL A;  5FZO B;  1UO9 A;  1VBA 2;  3ZMO A;  1GNH A;  5LBE A;  4GWJ A;  1G7Y A;  3USU B;  2VNO A;  3OYW A;  3QLQ A;  1RC6 A;  2ZS6 B;  5FZ6 A;  4CEW B;  1T6B X;  3M3Q A;  1RUJ 1;  2JDU A;  3LPF A;  1Y43 B;  4LKE A;  4MUV A;  4AF9 A;  5IVE A;  3AKQ A;  3D8C A;  4BJ0 A;  4WVW A;  1PO2 2;  5FPL A;  4AXO A;  1S0E A;  2VZU A;  1YI7 A;  1VAK A;  1RYY A;  4XBN A;  4CUB A;  4EN7 B;  1JOD A;  2RHP A;  4QHB A;  3NMB A;  5A7N A;  2RDS A;  4MXV A;  3IIA A;  3MYX A;  5F5C A;  1QEX A;  4CDQ B;  4Q8K A;  3GCX A;  3FMG A;  2JD4 A;  3ENR A;  4LA2 A;  2X8K A;  4WVV A;  5FYV A;  1AR8 2;  4XTM A;  5IK4 A;  2PQQ A;  4NR1 A;  2AC1 A;  3MFC A;  4UOJ A;  4UFM A;  5FZM A;  3CL1 A;  3E6D A;  3QBQ A;  2ZEZ A;  2QQN A;  5E16 A;  1NE6 A;  2A70 A;  2VOT A;  3LIH A;  3SHR A;  1C57 A;  2BGP A;  2WLP A;  4BXS V;  5FRA A;  1CIW A;  1OQD A;  2JKX A;  2UY8 A;  3H7J A;  3VL8 A;  1UXZ A;  2DBI A;  1DQ6 A;  3ACH A;  5JXJ A;  3FFQ A;  1VP6 A;  2EAL A;  3DXU A;  3VBH C;  5JOX A;  1ZRD A;  1OHF A;  5CFC A;  1WLD A;  1HIX A;  3DYP A;  2NZ9 A;  5JZG A;  4XEZ A;  1OFN A;  1QDO A;  4JDN A;  3W9A A;  1G9A A;  2R07 2;  4BLJ A;  1CES A;  2GME A;  2V4A A;  4JRL A;  1HJF A;  4LEJ A;  4SBV A;  3ZXD A;  2BNM A;  1FYU A;  4WV8 A;  4E4Z A;  2I2S A;  2D5F A;  2Y6G A;  1VBD 2;  2FZ2 A;  1W9Y A;  2Q30 A;  3B01 A;  1VBA 3;  3F95 A;  3O7O A;  4QXH A;  1GMM A;  4XUR A;  2Z42 A;  3VBR A;  1OSG A;  2Y6K A;  5GLW A;  4MAD A;  4NPR A;  2W47 A;  3WP3 A;  4OUL A;  3GBW A;  1WCK A;  3JD7 1;  4FPF A;  4R8H A;  3WCR A;  2WZR 2;  4DUX A;  1T2X A;  3IBM A;  1S0I A;  1OQE A;  1GOF A;  1LR5 A;  1JMU B;  1PO2 3;  2R16 A;  4MXW B;  3OGG A;  1XE0 A;  2W0X A;  3P6B A;  4AEJ A;  3K4A A;  3NV4 A;  3ZPY A;  4A4A A;  2VC9 A;  4AI2 A;  2YV8 A;  3EO6 A;  4CU8 A;  5KR7 A;  2ZXQ A;  5KHK A;  4AGR A;  4L0P A;  4DIQ A;  3DEM A;  3K46 A;  3BU7 A;  4A7K A;  1RIT A;  3PNA A;  4Q27 A;  1VBC 2;  4QU2 A;  3UK9 A;  1J84 A;  1H1A A;  2Z4F A;  5JWP A;  3O0X A;  5SV8 A;  5CKQ A;  1WLT A;  1AR8 3;  2HH9 A;  3UKT A;  4S2F A;  5FZH A;  4BQY A;  3TYJ A;  4BE3 A;  2VMG A;  3HD8 B;  3PUQ A;  4XFH A;  5JUV A;  5CBL A;  3S7I A;  4FFF A;  4YFZ A;  4QX1 A;  3AYA A;  4YRD A;  1WW4 A;  3GZT B;  2RS1 2;  2JDY A;  1DGR A;  1QHD A;  4AQ6 A;  5LBF A;  2ZA9 A;  3GGL A;  4JGY C;  4M01 A;  2XVK A;  1DZT A;  3HN1 A;  3FBY A;  4FPC A;  3AYE A;  4FO9 A;  4NE9 A;  4Y20 B;  4XZP A;  2KR2 A;  3VBH B;  1PGW 1;  2ZGQ A;  3H0O A;  3S6P A;  5C9A C;  1LHN A;  1H4H A;  1W9W A;  4X8N A;  2R07 3;  1ULG A;  5GLT A;  3ZKY A;  4BQ1 A;  5I91 A;  5GAL A;  3H7Y A;  1OVP A;  1W6O B;  1VBD 3;  3HVD A;  4AFA A;  3HBK A;  5IAX A;  3PU3 A;  3MV1 1;  4FQ4 A;  1K5M A;  1MAC A;  2BP6 A;  2PAM A;  3E1F 1;  3IN9 A;  1QJX 1;  2DU0 A;  2VE1 A;  3RWN A;  1CAU A;  5EJZ B;  4AQS A;  1N3Q A;  2XOM A;  4HSL A;  3S57 A;  1R1A 2;  4H7L A;  2VZR A;  5CU1 A;  1DYO A;  1W2T A;  1GV9 A;  3PU8 A;  4Y22 B;  2WWJ A;  2WO1 A;  4PCR A;  3O1U A;  4PLO A;  4I3G A;  3KWV A;  4JV4 A;  1OF4 A;  1SLA A;  2XGX A;  3M3O A;  5JXH A;  3IMN A;  3U75 A;  1LRH A;  1XYN A;  3GF6 A;  4YSF A;  2VD7 A;  1PHM A;  2O8O A;  3WUD A;  1DF0 A;  1VBC 3;  2WNV C;  2VOK A;  3SEP A;  2B46 X;  1W6Q A;  4XAE A;  4ZY9 A;  2UU8 A;  1MZ5 A;  4QB2 A;  4XJ9 A;  5T5P A;  3AMH A;  4BXF A;  1XXN A;  1SPP B;  2WFP A;  3TBD A;  4JCK A;  3MW2 A;  5C3S A;  2GND A;  4ES9 A;  3AMQ A;  1BBT 1;  1Q8O A;  3GM8 A;  5IWF A;  3AVS A;  1WCQ A;  3ZXK A;  2FDH A;  1RUJ 2;  2RS1 3;  4N9H A;  2TNF A;  3ZVX A;  3CO2 A;  2QZ2 A;  3TAY A;  1TMF 3;  3PVB B;  4WVM B;  2CAV A;  1VB2 A;  1IPS A;  4JGY B;  5JSO A;  1QH6 A;  4HPK A;  3T2P A;  4B8E A;  3JU9 A;  4KNC A;  2QNK A;  2UWB A;  1OVS A;  3DCQ A;  5K0U A;  3AKR A;  5C9A B;  5FZ1 A;  4LBO A;  3HT2 A;  1IZ3 A;  3IDA A;  1XU2 A;  3WNM A;  3OUI A;  1BKZ A;  2BVB A;  1NCQ C;  1AR7 1;  5A3N A;  2W68 A;  4FPG A;  4Q0Q A;  1YEW A;  3ZR5 A;  4BB3 A;  1GOG A;  5KXB A;  1F2N A;  4I02 A;  2ATF A;  3AMN A;  5LA2 A;  1OC1 A;  4PJY A;  4RQP C;  1R1A 3;  1J3R A;  1X82 A;  4AVV A;  2MNG A;  4FXG B;  3MLL A;  3LDR A;  1B35 A;  1JOB A;  4UW6 A;  4XF3 A;  3NV3 A;  5A33 A;  3BKZ A;  4KH9 A;  4WM8 A;  3S5Q A;  2ZGL A;  3BGA A;  3TEY A;  4XCA A;  3H8R A;  1WWY A;  2JDN A;  4YW1 A;  4GB3 1;  1IKP A;  3ZYJ B;  5C8C C;  2W1S A;  5FZF A;  1BK1 A;  1QH7 A;  5FY7 A;  1RJ8 A;  1FMD 1;  3OPZ A;  4BH9 A;  3R4U A;  1SDW A;  1JZ4 A;  1SAC A;  3PME A;  2WNV B;  1W3X A;  2TBV A;  4YFW A;  4DXS A;  2B9V A;  3IMM A;  4YVW A;  1U5I A;  1W9T A;  5FZ0 A;  1Y3T A;  3W59 A;  1YFX A;  3M3E A;  2BFU S;  3ZFG C;  3DPR A;  5BNP A;  4D69 A;  2MHF A;  4JC1 A;  3JD7 2;  4CP0 A;  1RUJ 3;  4GA9 A;  4FTS A;  2B39 A;  3LFM A;  4QKN A;  1LKN A;  4GAZ A;  1YIP A;  2XL9 A;  5KXC A;  5GJ6 A;  5FZ8 A;  2DVA A;  1AZD A;  1CR7 A;  3P5B A;  3T3Y A;  5JOZ A;  1D4M 1;  4HL0 A;  4DPN A;  1C8M 1;  1TNR A;  5JOY A;  1JOP A;  1FNZ A;  4EE2 A;  5JR2 A;  3HPN A;  2B8M A;  4HLT A;  5I0D A;  1YJK A;  2GNM A;  4TN7 A;  2QQO A;  1WA6 X;  4QX5 A;  4R4X A;  4XBQ A;  3JQW A;  2HWE 1;  1PM4 A;  1VBE 1;  2J1U A;  4FSJ A;  2BBA A;  4Z92 B;  5A7W A;  3WW1 A;  1NCQ B;  4HSJ A;  2PHU A;  4KQ7 A;  1BMV 1;  2VZ3 A;  3MO4 A;  1RUG 1;  1OH3 A;  1X9P A;  4CEY A;  1CZV A;  4LMF A;  1W8N A;  2J1V A;  3POW A;  4RQP B;  1OPO A;  3AXE A;  1YYN A;  3HIF A;  1H8V A;  2VNV A;  5CZK A;  1ULP A;  5ISL A;  4CP9 B;  3JB8 A;  2EXH A;  3EMR A;  1PGW 2;  1EPZ A;  1XRU A;  4LXL A;  4K1Z A;  4UXA A;  2WAO A;  3RJR A;  5C8C B;  1UWW A;  1S0B A;  1NE4 A;  2AR6 A;  3I2O A;  2RDR A;  4HXC A;  3HQU A;  4C0H A;  3AKP A;  4RL7 A;  4P9J A;  4CYD A;  3ZKU A;  5JI7 A;  4FPJ A;  2HJI A;  1UOF A;  5A80 A;  3RNS A;  2J22 A;  1QJX 2;  1K3I A;  5HV4 A;  1O3S A;  1LES A;  2A73 B;  1AL2 3;  2OPW A;  1WKY A;  2VM9 A;  3AYD A;  4XUQ A;  3OTF A;  3PL0 A;  4AAX A;  4NPL A;  2WWU A;  3JD7 3;  1H2N A;  4GMP 0;  4HAN A;  2B7Y A;  1FT9 A;  1SBE A;  2ZGP A;  4NHM A;  3ZFG B;  3V0A A;  1DIW A;  4J25 A;  4EWA A;  4YM3 A;  4I0W B;  1SEF A;  2C0Z A;  4YZ1 A;  2W1W A;  1ULF A;  2WDB A;  5FY0 A;  3ZN5 A;  4Q0P A;  2AYH A;  3APB A;  5GZE A;  2RVA A;  2JDM A;  3G6J B;  2BZD A;  2Y6H A;  1D0G A;  4Y3O A;  2WL1 A;  4QX0 A;  3FUQ A;  2WNE A;  2D98 A;  2QUO A;  1TVG A;  1SLB A;  2VUA A;  5FMC A;  4A42 A;  3CIH A;  4CCE A;  5IFP A;  3BIE A;  3ILF A;  1ZZ7 A;  5FYI A;  2VTX A;  5C3O A;  5BNN C;  1DQ2 A;  5CG8 A;  5EJ1 B;  3PVN A;  1WCU A;  4AL9 A;  1W8T A;  4FPY A;  3BPZ A;  1GWK A;  1OPM A;  1BBT 2;  5FY5 A;  2OPK A;  3GJB A;  2ZML A;  4L11 A;  3DYO A;  1VJ2 A;  1ZRF A;  1U5Z A;  5C4W C;  2V09 A;  2VMC A;  1VRH 1;  2DUO A;  4Z07 A;  5ABJ A;  3C7O A;  4GH4 C;  4TZD A;  2XPJ A;  3S0M A;  2VOV A;  3JB4 C;  2F4P A;  3VZO A;  2JG8 A;  1CPN A;  3RYK A;  1AR7 2;  4HKO A;  2YC0 A;  4HET A;  5GZF A;  4XPV A;  1QJX 3;  1VBB 1;  3D4K A;  3W20 A;  3PUI A;  1LHW A;  3LE0 A;  3SH3 A;  1E5I A;  3CDZ B;  1BQP A;  4YW2 A;  2P3I A;  5FV3 A;  4BZ4 A;  1OOP C;  3J7N A;  3RVH A;  2PEL A;  3GYD A;  3POF A;  2VUL A;  3WP6 A;  3I3E A;  5LEK A;  4CTE A;  2ZKL A;  2L9L A;  3VBO A;  3NJX A;  4FFI A;  4GB3 2;  4IEV A;  4D8M A;  3H8U A;  1BEV 1;  1QIQ A;  3J7H A;  4P5Y A;  1SFP A;  2VZO A;  1FMD 2;  2FZ1 A;  3OCP A;  5LWB A;  3RWK X;  3VD5 A;  1DGL A;  1GR3 A;  1UYX A;  5F6L B;  1JYV A;  4QKB A;  5FZG A;  1US3 A;  2P37 A;  3MPP G;  3ZYB A;  1JUH A;  4UI9 L;  1UOJ A;  2PHT A;  3T09 A;  4XF9 A;  4IE7 A;  1NLQ A;  5BNN B;  4XIK A;  4AED A;  4DUV A;  3E5U A;  1JUI A;  1W8F A;  2JIJ A;  1BBT 3;  2YHJ A;  4MSV A;  5IAV A;  5BPX A;  2WA3 A;  2C4X A;  3TNP B;  2BPA 2;  5F37 A;  3ME2 A;  2HYX A;  4NJ4 A;  2RS5 1;  3ETP A;  4A44 A;  2XH6 A;  1VAL A;  1MPX A;  2A6Y A;  1XSR A;  1D4M 2;  2JX9 A;  2ZJC A;  3AJZ A;  1C8M 2;  2XJV A;  4LA3 A;  5DN2 A;  5C4W B;  5FRE A;  3ES1 A;  3VZM A;  1NA1 C;  1QJU 2;  1KRI A;  3B94 A;  5CG9 A;  1XNT A;  2XL7 A;  4GH4 B;  4QX3 A;  2HWE 2;  2E6V A;  1VBE 2;  3IPV A;  1AR7 3;  3NL1 A;  4TXW A;  4UFJ A;  1ODN A;  3UGG A;  4M4R A;  2GC2 A;  3JBG 1;  1UPI A;  3FZ3 A;  1LNS A;  3ITQ A;  1LJ7 A;  1BMV 2;  4NIH A;  1RUG 2;  2E9Q A;  3B7M A;  5FFO C;  3UKV A;  3POG A;  3NAP A;  3ZX7 A;  4XHX A;  4RFT 0;  1JZ8 A;  1NAE A;  2W95 A;  3ZYG A;  1OOP B;  3T2T A;  1CAV B;  2PAE A;  1LOF A;  4YGE A;  5FDB A;  1QNY A;  4NIG A;  2WT2 A;  2WJS A;  2ZTN A;  3E5X A;  4GB3 3;  3POB A;  2G1M A;  5FMB A;  4AFC A;  2R6Q A;  3KZ4 C;  1WBL A;  5FQ0 B;  1CAW A;  4M3C B;  4XJ8 A;  1RUI 1;  3KD4 A;  2D3S A;  2WS9 1;  5CIR A;  1GWM A;  1FXZ A;  5AVA A;  2YU2 A;  1UY0 A;  3K3O A;  3O1O A;  4ZS3 A;  3WSO A;  4DQA A;  2QQJ A;  2YRO A;  5CVR A;  5KHG A;  3ZIW A;  3LIG A;  5IK8 A;  4KWU A;  4QM9 A;  4L9B A;  4Y4R A;  1SLL A;  5GM0 A;  4AGG A;  5LA0 A;  4CPB D;  3PJQ A;  4IV1 A;  4BQ4 A;  4UT5 A;  3BTA A;  5A6X A;  2YZ4 A;  3I3Q A;  5DMY A;  4FXK B;  1DQ4 A;  5C3Q A;  3MBW A;  2VR4 A;  1BYH A;  5FXX A;  1JZ3 A;  5IVF A;  2ENR A;  2H6B A;  2IXL A;  4FT8 A;  1D4M 3;  1DP0 A;  1UIJ A;  1UZY A;  1C8M 3;  1HB2 A;  1Q3E A;  2VVE A;  2WAB A;  3IT8 A;  1HDK A;  3POS A;  4QPG C;  3VBF C;  3WG1 A;  1W6P A;  1QJU 3;  1W2N A;  3ES4 A;  4JKL A;  4NHY A;  4XUP A;  5FYT A;  2YY1 A;  4AGV A;  4CDX C;  4FAG A;  5JDB A;  1U0A A;  2HWE 3;  1NA1 B;  1MS4 A;  1VBE 3;  2VZT A;  4AI8 A;  2RE9 A;  5JOW A;  2VTX J;  3AZX A;  2JEM A;  2D3R A;  4LK6 A;  1FAT A;  1SMV A;  4G4F A;  5DDJ 2;  4M3C F;  3T2Q A;  5F7U A;  1V70 A;  4IND A;  1XYP A;  1KEX A;  4KL1 A;  4FPL A;  3HOB A;  2VQU A;  5D8A A;  1QOS A;  4XCB A;  4TLF A;  5JPM B;  3A4U A;  1POQ A;  3B9I A;  5LK7 B;  1WGP A;  5F3G A;  4AI3 A;  4A3X A;  4B1M A;  3VBU C;  1KDM A;  1ZRI A;  5T3N A;  4RHV 2;  1DQ0 A;  1GZW A;  3N9M A;  1CX4 A;  1VRH 2;  3K75 B;  2WN2 A;  4ASK A;  4YAR A;  3VHR A;  2UWC A;  5FZD A;  4AZZ A;  4BME A;  4IV3 A;  4QU1 A;  3Q9O A;  3UET A;  2WA4 A;  4KU8 A;  5L9R A;  4YW5 A;  2Y26 A;  4LOT A;  1EV1 3;  1VBB 2;  1RMU 1;  2V5Y A;  4IDZ A;  1JBC A;  2YUE A;  2IC1 A;  5DUW A;  5BNO C;  5FTT C;  4XBL A;  3WF0 A;  3R0R A;  4MO3 M;  4PBP A;  2Q0A A;  4QX8 A;  1G9C A;  2C24 A;  2PN5 A;  2R49 A;  2JDA A;  3EQE A;  4U36 A;  2B42 B;  3AM2 A;  3I2F A;  5A7O A;  1R1Z A;  4CCO A;  2GDF A;  1UY4 A;  4D6R A;  3OD0 A;  3ZMN A;  2X53 S;  2CDO A;  2DVD A;  3FLP A;  2E7T A;  4K40 A;  2ZAB A;  5DG2 A;  4MGZ E;  4QPG B;  5HPO A;  1BEV 2;  1BVV A;  1DGW A;  3LOI A;  1VE0 A;  5FZI A;  1HRV 1;  3VBF B;  4RN5 A;  2Q4S A;  4NN0 A;  4CDX B;  2WIN B;  2DTY A;  1DZQ A;  5DQ0 A;  2RS3 1;  4DFS A;  1SLC A;  1HX6 A;  2OZJ A;  5DDJ 3;  4BQ2 A;  3BUC A;  1IG0 A;  4E8D A;  3D3A A;  4FAH A;  4Q4Y 1;  2GMP A;  5A3W A;  2PHW A;  1PX4 A;  4KWJ A;  1KGY A;  1M4W A;  2GC3 A;  5I0R A;  3OPW A;  5A3O A;  2ZMN A;  4GAL A;  5TSW A;  2RMU 1;  3AMM A;  5FYH A;  1EP0 A;  3USU A;  2ZEW A;  1V6K A;  4KBZ A;  3CQO A;  2D40 A;  2RG4 A;  2RS5 2;  2ZX4 A;  2X05 A;  3OJB A;  5IK7 A;  1RXF A;  3OEA A;  4RHV 3;  1YI9 A;  2JXA A;  3OG2 A;  3VBU B;  3MUZ 1;  1VRH 3;  3WOG A;  4K9S A;  1UKG A;  4WVZ A;  1N3O A;  4AI1 A;  5E88 A;  3WDV A;  1JN2 P;  1Q8V A;  4LIU A;  3AZZ A;  4HT1 T;  1YLL A;  4MLO A;  2O1Q A;  3W58 A;  1ENX A;  5HI0 A;  2X5I A;  2ZHK A;  3VZL A;  4CUG A;  4LHK A;  4UFI A;  4P14 A;  4CDQ A;  1WME A;  1Q8S A;  3JBG 2;  1JW6 A;  1VBB 3;  4Q29 A;  1ZRE A;  4JAA A;  5FJK A;  3OB8 A;  4ATE A;  4YPJ A;  5FY4 A;  2NN8 A;  5BXX A;  5BNO B;  1CIY A;  3AFK A;  3PVE A;  4IET A;  4Y5T A;  2CL2 A;  3RI9 A;  5A3L A;  2CYF A;  2MPF A;  4NRP A;  2LS6 A;  3AP4 A;  1JXN A;  3FHA A;  3NWK A;  2YGM A;  2BJS A;  3MLJ A;  2DWR A;  3E5Q A;  3M1H A;  4OI1 A;  2D44 A;  4NHK A;  5C7G A;  1BEV 3;  4N43 A;  1QF3 A;  5HBA A;  4AG4 A;  2BEO A;  5J3U A;  1JYC A;  3QAC A;  2WS9 2;  5KWR A;  2OQ7 A;  1TZO A;  4A7Y A;  4ZU7 A;  3WW4 A;  5FK7 A;  2A6V A;  2PA7 A;  1PGS A;  1RUH 1;  2R06 1;  4PF1 A;  1ND2 C;  3H8X A;  1PX3 A;  5IT6 A;  1DQ1 A;  1JI6 A;  1UL9 A;  2W1U A;  2ZX0 A;  4ZZ5 A;  4LBJ A;  1KS4 A;  2EIE A;  4K3U A;  5EYY A;  2JIC A;  2DCK A;  3WF3 A;  2BGO A;  2RS5 3;  2VO5 A;  1G9D A;  3LKJ A;  1YFU A;  4GQ7 A;  3NKT A;  1LU1 A;  1H8T A;  1SLI A;  4QQL A;  4E4H A;  3A0K A;  3SCF A;  3L2H A;  4DXT A;  3CJI A;  1AXK A;  1PMI A;  4O61 A;  4DXZ A;  1D2Q A;  4XF4 A;  1Q5O A;  4CXY A;  4K1Y A;  2ZHL A;  1E5S A;  3DN7 A;  2P17 A;  2WNU C;  3AP6 A;  1XE7 A;  3LA2 A;  3K51 A;  4W4Z A;  2NMN A;  2VZV A;  1NQJ A;  2RR1 1;  4BPZ A;  3JBG 3;  2DDU A;  4QQO A;  4D6S A;  4L92 A;  4LO7 A;  4COU A;  3LGR A;  4YW7 A;  2QQW A;  4Q8L A;  3L2Y A;  2A6W A;  3OY8 B;  1WZX A;  3H50 A;  4GIQ A;  1RVF 1;  3JXS A;  4AEM A;  3PIJ A;  1XND A;  2HKX A;  1T6G C;  2BUK A;  2ZEX A;  3U78 A;  1AYM 1;  3VHP A;  3HEI A;  3ILR A;  4B4P A;  4AVC A;  4CVU A;  1C5H A;  1EUU A;  3NV2 A;  4NUB A;  5F6K A;  1IS3 A;  4YVS C;  3B69 A;  4QQ2 A;  2W92 A;  3UNP A;  2ZX2 A;  3I8T A;  4DIN B;  2ZPX A;  4DZG A;  3KV9 A;  5FAX A;  1AJO A;  2ZAA A;  4BM8 A;  2VU9 A;  4FOY A;  1JZ6 A;  1OI6 A;  2VCM A;  3LDB A;  5L7O C;  4COZ A;  1W05 A;  2CU5 A;  2IXK A;  4L99 A;  3NRU A;  2JD9 A;  1O4T A;  1W6O A;  1W8Z A;  1ZA4 A;  3HNY M;  1RMU 2;  2VOW A;  2Y60 A;  3I59 B;  1SFN A;  4S2H A;  3TNQ A;  5L9B A;  3IB3 A;  1ND2 B;  1VAM A;  4NRQ A;  1ENQ A;  2BVV A;  1PNG A;  5IUQ A;  5K4L A;  5B2G B;  5HCF A;  4CUA A;  3A22 A;  1AR9 1;  1EYB A;  1W8H A;  2EAK A;  3QOP A;  4MGS A;  4NOT A;  4EQV A;  1XE8 A;  2A75 A;  3EXU A;  5FPX A;  5L36 A;  5K7P A;  2JG9 C;  4BIF A;  4MX3 A;  1WMX A;  1JHN A;  5J98 B;  3H8O A;  4L97 A;  3PJY A;  5FO9 B;  5KBF A;  4Z2W A;  2OZ6 A;  3AK0 A;  5FZC A;  3ZIX A;  4MV2 A;  4AHW A;  2WSV A;  2DF7 A;  1WLW A;  2W5F A;  3EHK A;  2ZHN A;  1OLM A;  5C3P A;  2WNU B;  4IE4 A;  4BIS A;  3VHO A;  3O0W A;  1FAY A;  4J1W A;  3GZA A;  4JZR A;  4Q4Y 2;  4RR3 C;  3MUY 1;  1UIK A;  3ZFE C;  3FWE A;  3VKF C;  1I5Z A;  4TYS A;  2RMU 2;  1C4R A;  2ARX A;  2CV6 A;  1REE A;  5FUN A;  4B7K A;  1VMJ A;  4WM7 C;  5CAD A;  4QPI C;  1J3Q A;  2VH9 A;  4N8M A;  2VAU A;  1JYT A;  5C5T A;  1NG0 A;  4R52 A;  5DUU A;  1Y9G A;  1HB4 A;  4UWD A;  2UYB A;  3LD8 A;  2YPJ A;  4JGY A;  4YVS B;  2XWB B;  3ZSJ A;  3RRD A;  3N9P A;  2R30 A;  3JZV A;  4E8C A;  2IXC A;  3BOW A;  4GUL A;  4OMD A;  4W50 A;  4B4R A;  5C9A A;  5FUI A;  5L7O B;  3IZO A;  4Q0S A;  1WUV A;  2GP3 A;  2YFU A;  1RMU 3;  5F9T A;  4NPM A;  4KU7 A;  1O3T A;  1O4Y A;  3ZXF A;  1V6N A;  3C7F A;  3ZSE A;  1SG3 A;  2XVG A;  4N53 A;  1XB9 A;  2XWJ B;  2FQP A;  1H1I A;  4HK9 A;  4Y1X A;  2NLR A;  4OI2 A;  2YC4 A;  3THT A;  1R64 A;  1UW8 A;  4YZ5 A;  1IPK A;  2E33 A;  5LA1 A;  2QQV A;  3V0B B;  2JG9 B;  1RL3 A;  3N4M A;  4LLF A;  4HVQ A;  3O1V A;  2Q1Z B;  3J8F 1;  3TRS B;  2XB6 C;  5FP4 A;  4A41 A;  2RV9 A;  2FBE A;  5J7M A;  1BVP 1;  3I2G A;  2DUR A;  4O9G A;  2IXH A;  3PUA A;  1JU4 A;  1D0H A;  3EBR A;  3UJQ A;  2VZP A;  3IAQ A;  4Q4Y 3;  4XMA A;  3ZYP A;  5KXE A;  3HN3 A;  2R06 2;  2DFC A;  2XG3 A;  3WQ7 A;  5BUV A;  2GC1 A;  4LUK A;  5DG1 A;  2FDJ A;  3GNE A;  4RR3 B;  4IEQ A;  2RMU 3;  3ZFE B;  4H7M A;  4AVB A;  4OMC A;  1WBF A;  3POE A;  4XIL A;  1J59 A;  4OYU A;  4WZC A;  1QMJ A;  4AHZ A;  4CZS A;  3RSJ A;  3I49 A;  1MQT A;  4WM7 B;  1W39 A;  4QPI B;  2CNA A;  3L9J T;  3B9C A;  3E97 A;  2R04 1;  3OBA A;  4C8D A;  2NM1 A;  1QJE A;  2V5D A;  1OA3 A;  1O4Z A;  1U5Y A;  4QAW A;  5JIA A;  1ULO A;  2LRP A;  3I2D A;  4HMZ A;  1WW7 A;  2VJX A;  2XJP A;  1O8S A;  4LBK A;  2RR1 2;  5CAZ A;  2QDN A;  2E32 A;  1HN0 A;  4LBN A;  1UYP A;  1UOG A;  4XW3 A;  1MS5 A;  3VBS C;  5LAT A;  1QJY 1;  4JDM A;  4AI9 A;  1W6M B;  1SDD B;  3BCW A;  5GLV A;  2Q5T A;  1CAX B;  1RVF 2;  2G9Z A;  2FCT A;  1MS9 A;  4RQP A;  4LHS A;  3VZN A;  4R9B A;  2QCS B;  2VG9 A;  4C90 A;  3WW3 A;  5A7S A;  1WD3 A;  1AYM 2;  1QNW A;  2P4E A;  4ISR A;  2F4L A;  3MIF A;  3ZYR A;  4QXB A;  5JSR A;  5FXZ A;  1UCX A;  1W9S A;  3TN9 1;  1SCS A;  4KWL A;  2XKP A;  1MS3 A;  4IUG A;  2D7F A;  3WVJ A;  2WZR 3;  4J1X A;  5FKC A;  2QZ3 A;  2DCY A;  2LM3 A;  4KI5 M;  1BLZ A;  1CON A;  5JIU A;  2PAK A;  5B4N A;  2ZCW A;  5LBC A;  3BTX A;  2R06 3;  3I3M A;  3FUO A;  4B1L A;  4XDQ A;  1F5F A;  3ZSM A;  3TWI A;  2DVG A;  4RFR B;  1H6Y A;  1GAN A;  3DKQ A;  4CCC A;  2MEV 1;  2G9G A;  1AR9 2;  2Y6L A;  1HQL A;  5DAQ A;  3RJ2 X;  1XQN A;  4PHZ A;  3HWJ A;  4A45 A;  5A6Y A;  2B9U A;  3KS7 A;  4AE2 A;  1O6U A;  2WII B;  5FLJ A;  3WF2 A;  4GMP 1;  3NO8 A;  3T1L A;  3AP7 A;  3OYW B;  2VCA A;  4HVR A;  2RR1 3;  5LAS A;  4P9W A;  3LQC A;  4N7I A;  4DEQ A;  5FP8 A;  1G8W A;  1GQG A;  4TLG A;  5K9Y A;  4Y1U A;  4AR2 A;  2AEZ A;  2J1A A;  2G9F A;  4ATF A;  3BOD A;  1LCL A;  1OUR A;  5CB7 A;  5T52 A;  1RVF 3;  3U14 A;  3VBS B;  4MHR A;  4A2U A;  5ACA 1;  4LK7 A;  1ZRC A;  2Z79 A;  5EHD A;  1YQ5 A;  3H1Y A;  3I2H A;  1YQ6 A;  1AYM 3;  3VZK A;  3KHC A;  1SFY A;  4ASM B;  1LEC A;  3VKM A;  1GNY A;  5A1A A;  4P02 B;  4FFH A;  3UJO A;  1S2K A;  3Q8B A;  5C8C A;  5FY9 A;  1Z7S 1;  4QGN A;  1LU2 A;  3ZYH A;  4W65 A;  4AEK A;  4XQD A;  3UL2 A;  2A3W A;  1ZA7 A;  1NXM A;  3GHM A;  4FCA A;  2ADE A;  2LTN A;  3U11 A;  3N9N A;  3C8X A;  1MVQ A;  2KD7 A;  2VBD A;  3CF6 E;  3LZZ A;  4XFB A;  2J1T A;  2JIG A;  1DLC A;  2WWS A;  4ZS2 A;  2QDR A;  2WLQ A;  3LCP A;  3AL5 A;  4LPL A;  4Y1Z A;  3T2O A;  1AR9 3;  4FPE A;  4CDU C;  2NMO A;  1W8U A;  3WNN A;  1VIW B;  3D0S A;  3CBN A;  4W8J A;  1GYK A;  1K5M C;  4JDO A;  2PLV 1;  3IDC B;  4XFA A;  2WN3 A;  4PQQ A;  3U37 A;  3BOP A;  3WCS A;  3ACF A;  5FZ9 A;  5FJH A;  1CWP A;  4MOA A;  4PF5 A;  5E1R A;  5C8W A;  1ZRR A;  1OUS A;  5FMO L;  2SLI A;  1Y9Q A;  1ZBA 1;  2Y6F A;  4JVA A;  4PI2 A;  4FOW A;  5F5A A;  5C5U A;  1OLM E;  2XHN A;  3I7D A;  2WYS A;  2YFZ A;  5IVV A;  4CUC A;  1YWK A;  4IES A;  2F6B A;  3CLP A;  4CE8 A;  4K21 A;  1YUD A;  1WW6 A;  3RFR A;  2GAU A;  4MHU A;  4LOS A;  4PIX A;  2JE7 A;  3ETQ A;  3ST7 A;  3HQR A;  1FPN 1;  3A21 A;  4LO8 A;  4E4D X;  2R04 2;  4TWT A;  2B5H A;  4AK3 A;  4EZ4 A;  4CP2 A;  4XAA A;  4C91 A;  2D6N A;  1DHK B;  2IFR A;  2P6C A;  3GJA A;  2ZKN A;  1WW5 A;  2CGN A;  3LSE A;  3UV9 A;  1R08 1;  3ZXL A;  1RUN A;  1DBN A;  1QJY 2;  2Y0I A;  2XUM A;  2JWP A;  3VDD A;  2DUP A;  1COV 1;  5FZ3 A;  3O1S A;  2CWM A;  3H1W A;  3PUS A;  2IFW A;  2DBN A;  4AI0 A;  2C6S A;  4CDU B;  1OOP A;  3GZE A;  3MV0 1;  4ZHN A;  4TTG A;  3H3L A;  5L19 A;  1SBF A;  3RGB A;  4CP1 A;  3GCW A;  4DMI A;  1S0J A;  1ZBE 1;  3TN9 2;  2FMD A;  1K5M B;  4IW3 A;  4BQX A;  1RXG A;  4LUL A;  1NLR A;  4R4Z A;  4MET A;  5F2S A;  5SV5 A;  4Q4V 1;  5FK8 A;  5FQ0 A;  5D1I A;  3J7L A;  4YWA A;  2JB8 A;  4M3C A;  1C8N A;  1B35 C;  2X10 A;  3WQB A;  3VDB A;  4FP3 A;  1LHO A;  1RB8 G;  1I6X A;  2VXR A;  1HN1 A;  2WO3 A;  1JH5 A;  1ST8 A;  3PHM A;  4S2G A;  1UX7 A;  4FPK A;  1ULD A;  1J1L A;  4CA9 A;  5FPV A;  1X33 A;  2OS2 A;  2JE9 A;  3LWC A;  2I07 B;  1J3P A;  1IG3 A;  3ALQ A;  2MEV 2;  5EZW A;  2ZGR A;  4XUO A;  1AVB A;  3OSD A;  4QB6 A;  5DAX A;  2NP0 A;  1VAV A;  2YBS A;  3MIB A;  1HLC A;  4ITC A;  3FHQ A;  1S55 A;  3TOJ A;  2P5B A;  1F35 A;  5E6H A;  4YVW C;  2CGO A;  5CA6 A;  2BOI A;  4XFG A;  1V6M A;  1NYW A;  3DF0 A;  3HR9 A;  1YC6 1;  4C1W A;  1CX1 A;  4DEV A;  1S0F A;  1NA1 A;  4XFI A;  2Q8C A;  3SNM A;  1GP4 A;  4IGO A;  5LW9 A;  4AYU A;  4MGK E;  5C70 A;  1GLH A;  1S0C A;  2ZAH A;  1QJY 3;  2K46 A;  4YZ4 A;  1RUD 1;  3Q8C A;  3FLR A;  5EIY B;  3ZFF A;  2OX0 A;  3NNF A;  1UF2 C;  4YM2 A;  5FZA A;  3B3Q E;  3WF4 A;  5ACA 2;  4A6O A;  3K4D A;  3ZYF A;  4J6G A;  1NQD A;  4Y26 A;  2ZGO A;  2YPD A;  3PIG A;  1W03 A;  2P2K A;  3TN9 3;  5FPU A;  1J58 A;  3VD4 A;  4Y1V A;  3KQR A;  2HEY F;  1ACC A;  2ZGU A;  2AEN A;  2C9K A;  2WZ8 A;  1Z7S 2;  2XON A;  2WFF 1;  1SLT A;  1V00 A;  4IEW A;  4CEY C;  3O1P A;  2QQI A;  4V2V A;  4LBQ A;  1X8M A;  2I74 A;  2DTW A;  1B35 B;  5A33 B;  3H42 B;  5HCA A;  1TNF A;  3WD5 A;  1X9T A;  3WHT A;  3OUH A;  1MZ6 A;  5CNA A;  4K20 A;  1F8V A;  2WC2 A;  5H9S A;  3HNM A;  3KCX A;  4QQH A;  2JEN A;  2GZW A;  3VKN A;  3MZH A;  1XOY A;  1ZZ6 A;  4K8F A;  2MEV 3;  4QQP A;  3O1T A;  4XFF A;  5AFE A;  2XXZ A;  3IKW A;  4BHP A;  2GMM A;  1H2M A;  4XE9 A;  3S5A A;  4SLI A;  4I2O A;  1PGL 1;  2D3P A;  3T08 A;  1NZI A;  1UY1 A;  1YFY A;  3KT4 A;  4M4P A;  3ZDV A;  2PLV 2;  5T5L A;  4BOW A;  1N3P A;  5I0S A;  4YVW B;  1EUT A;  4QMA A;  3VKO A;  4IE5 A;  5DXD A;  1GWL A;  4GMP 3;  3CEW A;  1AHS A;  3SKV A;  1X7N A;  5FP7 A;  2CHH A;  5FYY A;  3VBF A;  2EA7 A;  2D6L X;  2PTM A;  4YW3 A;  3OBR A;  2XLG A;  2J1S A;  4GJY A;  4LR4 A;  4ZU5 A;  1ZBA 2;  2A1X A;  4OLL A;  2OXB A;  3CZJ A;  3I3D A;  4XUT A;  3KVA A;  1OXC A;  4RS5 C;  4XF0 A;  1X50 A;  2DVF A;  1AJK A;  5ACA 3;  2R0F A;  2RM2 1;  3TEW A;  3ZSL A;  1KIT A;  5F32 A;  5E8A A;  2ETE A;  4PT6 A;  1LEN A;  2P3K A;  4V1P A;  2UYA A;  5A3M A;  3SH4 A;  3J4U H;  1FPN 2;  5A7W B;  4CCN A;  4BYY A;  1Z7S 3;  1UU6 A;  2K9Z A;  3HMY A;  4HFS A;  1A3K A;  3GAL A;  1PK6 A;  2PQS A;  4OUE A;  4OCT A;  4XZU G;  1H1M A;  1O59 A;  5CFD C;  2P1B A;  3LPG A;  4PIZ A;  2KM2 A;  3MF9 A;  3VGI A;  2VCB A;  1YNA A;  1FMD 3;  1H2L A;  1R08 2;  1S0G A;  4ZXE A;  3VHN A;  4COW A;  1E5R A;  4MGY E;  1PMJ X;  4QDS A;  4XJZ A;  1COV 2;  2HWD 1;  4AQT A;  4QDQ A;  2AEY A;  2ZEY A;  1QXR A;  1FOD 1;  2WO7 A;  4IGQ A;  2OYZ A;  1EPW A;  2E63 A;  5DZF A;  2W08 A;  2JG8 C;  3G7D A;  5A3T A;  1OD3 A;  3PDQ A;  5EV7 A;  2EXI A;  2E7A A;  4P5H A;  2GH2 A;  1CJP A;  2PLV 3;  4HBN A;  4UBG A;  4XVH A;  5T55 A;  1ZBE 2;  4WBB A;  4BCU A;  3WG2 A;  2ZX3 A;  2A3X A;  3AYC A;  3RZZ A;  3N9O A;  4D7S A;  1PZ9 A;  5IVJ A;  4ISQ A;  3AX4 A;  1O7F A;  1PO1 1;  1YO8 A;  3LEG A;  4BA6 A;  3ZN6 B;  3SIS A;  1ZBA 3;  5L73 A;  1GU3 A;  4OHW A;  2E7Q A;  3S30 A;  5KHI A;  1W8O A;  1ALY A;  5FCC A;  2TUN A;  1ASJ 1;  1N47 A;  1GZ9 A;  4RS5 B;  3W5N A;  1PVC 1;  5APA A;  4PLN A;  5GLU A;  2LRO A;  2XLA A;  5JMC A;  1IPJ A;  1RUG 3;  5FIX A;  1FPN 3;  4BK4 A;  2PHL A;  1UZW A;  4OZX A;  2FCV A;  1TE1 B;  3CJX A;  4JQR A;  3SXW A;  5A6Z A;  4XC9 A;  4P9X A;  3EJK A;  5JVV A;  5L9V A;  4UF0 B;  1VRB A;  3SEE A;  3N9Q A;  4LQR A;  1O3Q A;  1CJD A;  4OZO A;  3NW4 A;  4KGG A;  4Y5Z 0;  4M0N A;  3SMH A;  5AFB A;  2GN3 A;  5CFD B;  1GP6 A;  4CCJ A;  1HB1 A;  4HKW A;  5DZE A;  1DCS A;  1L7L A;  4CCD A;  2BBV A;  3U1X A;  2XJU A;  2ZHM A;  1COV 3;  1MVE A;  2YC2 A;  1W2O A;  2ET7 A;  2JKB A;  1UZV A;  3FJS A;  3QH7 A;  2P6H A;  2DU1 A;  5ANQ A;  1N1T A;  1ZX5 A;  2EIG A;  4YW4 A;  1HKD A;  4CDW C;  2LAL A;  3M3I A;  3THD A;  4HN1 A;  4R9C A;  3HJR A;  1UY3 A;  1ND3 A;  2JG8 B;  5FXV A;  4P9Y A;  4YG0 A;  2SBA A;  4AWD A;  3AP5 A;  2W87 A;  1ENR A;  2WFF 2;  2BER A;  2JDP A;  3RDI A;  2D5H A;  2PHX A;  3NVC A;  4Y5S A;  2VEC A;  2DCZ A;  1OFS A;  2Y0O A;  4QB1 A;  4D7T A;  1EAH 1;  2Y6J A;  1NCR C;  1OMI A;  5ANN A;  4P08 A;  5JXI A;  2W9X A;  2RJ2 A;  3I59 A;  4LKF A;  2K2S A;  3ECQ A;  3D82 A;  2XKO A;  2ZGS A;  2Z69 A;  4XQW A;  4BMB A;  1XNK A;  4W6X A;  1FNY A;  3WDT A;  3GBF A;  3BAL A;  4E2S A;  3O0V A;  2IXJ A;  5FY8 A;  5FZO A;  1PGL 2;  3PMS A;  5J96 B;  1K42 A;  1W6N B;  3AB0 A;  3POI A;  1LGC A;  1JZ7 A;  4CEW A;  4IV1 C;  2QVS B;  2EXK A;  1VB4 A;  3LF7 A;  1DG6 A;  1H2K A;  3WLU A;  5EQU A;  4H2A A;  3NJV A;  2WR9 A;  2WNU A;  3WF1 A;  1CGP A;  3NNG A;  1CD3 G;  5FKB A;  3Q8E A;  1PMH X;  1TQ5 A;  2O14 A;  1SBD A;  1PO2 1;  5LZ6 A;  1XSQ A;  2CAU A;  2RM2 2;  3KHB A;  3WEZ A;  1LEM A;  1E57 A;  4JTN A;  2LUW A;  2Y8K A;  1A8M A;  3M3C A;  3IPV B;  4CDW B;  2C1F A;  4MVT A;  3ABZ A;  3KLS A;  2J1R A;  1C28 A;  3ROU A;  2GNT A;  5AC9 1;  2WFF 3;  3C3V A;  1AR8 1;  1IKQ A;  1UN1 A;  5A3P A;  2KA3 A;  2ZGN A;  2ARB A;  5F5Q A;  5HCH A;  3KF5 A;  2WUH A;  5HXV A;  2TEP A;  4LBM A;  4M00 A;  1REF A;  5FZL A;  5IHR A;  4DS0 A;  5L7O A;  5FYB A;  3CU7 A;  5JPN B;  1NCR B;  5LCW L;  1GSL A;  3BTZ A;  3GXU A;  1RUI 2;  3BB6 A;  2HWD 2;  3FBM A;  1FOD 2;  4XJA A;  4NAO A;  1UYY A;  4JGZ C;  2OA2 A;  4X6R B;  5FBJ A;  4ORF A;  2FDF A;  2ZGM A;  1VLN A;  3ATG A;  1PIV 1;  5A3U A;  4LKD A;  5LBB A;  4CSW A;  2QQP A;  1W04 A;  4QM8 A;  4Q4W 1;  4FOQ A;  1K5J A;  2XJT A;  4PDW C;  1QXP A;  3BN6 A;  3N7L A;  1AYN 1;  3RMY A;  2IXI A;  5I8T A;  1PO1 2;  4IV1 B;  3VUO A;  1GP5 A;  1H6X A;  5J09 A;  1UKR A;  2FHR A;  2HBU A;  3RZK A;  4XMI A;  1MS1 A;  1RJ7 A;  3FLT A;  4MXW A;  4EWD A;  4IEZ A;  4HOO A;  1I9R A;  3INA A;  1ULE A;  4UYB A;  1D7P M;  4PI0 A;  2RM2 3;  1AR6 1;  3ZLI A;  1PVC 2;  4HN0 A;  3RZH A;  1LOE A;  4XXP A;  3MIE A;  1BZW A;  1U12 A;  1XBF A;  1AL0 G;  4UW4 A;  1UNB A;  1N1Y A;  1E5H A;  1YHF A;  2ZZQ A;  2HWF 1;  3WY6 A;  2XQX A;  2BQP A;  4Q1R A;  5BNP B;  2R1B A;  5HXM A;  4BQW A;  2XBO 1;  3KB5 A;  3UGH A;  3W21 A;  5CKN A;  3MFA A;  4DNY A;  1N1V A;  1KS5 A;  3FC0 A;  1IGO A;  4HVO A;  4QD2 A;  2E53 A;  1UY2 A;  4A3Z A;  2JDZ A;  4QPY A;  1WA4 A;  1QY4 A;  1DGR N;  2RS1 1;  3M7A A;  4OHX A;  2ET1 A;  2Y33 A;  4Y20 A;  5H9Q A;  3VBH A;  2FDK A;  1P8J A;  3VD9 A;  1RUI 3;  2HWD 3;  2WS9 3;  1TMF 1;  1QJZ A;  1FOD 3;  2ZGK A;  4KG8 A;  1ZZ9 A;  1CAX A;  1ZZ8 A;  1A78 A;  2EXJ A;  2QFE A;  5EPA A;  5LB6 A;  3ASI A;  4FTB A;  3MW4 A;  2X5I C;  4JGZ B;  1HXS 1;  1RHI 1;  3AC0 A;  3CMG A;  3R05 A;  3D0J A;  1Z0H A;  3N35 A;  2VBB A;  3FFZ A;  1OD5 A;  2CY6 A;  4LE3 A;  2XVL A;  1NOV A;  4QKD A;  4DO0 A;  1S2E A;  4QHO A;  4QXC A;  5BNO A;  3VD3 A;  1AXZ A;  3UKN A;  2OUH A;  4IEY A;  5EYX A;  4EN6 B;  3UYJ A;  1PO1 3;  3MIG A;  4Y22 A;  1ULC A;  2NQY A;  1EAH 2;  3OGS A;  4PDW B;  1UZ0 A;  3WDY A;  1C5I A;  4K8R B;  1HJG A;  3LOB A;  1RUC 1;  3E6C C;  1NLS A;  1HRV 2;  4AOC A;  2VMD A;  4N43 C;  5C3R A;  1IS4 A;  2W46 A;  3JUU A;  1PVC 3;  2RS3 2;  3OGJ A;  1Y7B A;  4RGG A;  1JU3 A;  3SCH A;  2VBP A;  2CGP A;  1DFQ A;  4CCL A;  4GKX A;  1LGB A;  3T0A A;  5IYY A;  3DXT A;  3KF3 A;  1SPP A;  4EZH A;  4AVS A;  1O5U A;  5GLZ A;  2PFW A;  2YG0 A;  2Q8O A;  4CRQ A;  1DLL A;  2DFB A;  1KD7 A;  2WZE A;  2AZ5 A;  3RG0 A; 
#chains in the Genus database with same CATH homology
 1UOB A;  1GP4 A;  1E5S A;  1QIQ A;  2IVI B;  1WA6 X;  2VBD A;  1W2A X;  5APA A;  3ZKY A;  1OBN A;  1W03 A;  1W04 A;  1UZW A;  2VE1 A;  1UO9 A;  1GP5 A;  1QJE A;  1GP6 A;  1HB1 A;  1DCS A;  2VCM A;  2Y6F A;  1W05 A;  1W2O A;  1UOG A;  1ODN A;  1QJF A;  2Y60 A;  4RGK A;  3ZOI A;  1UNB A;  1W3V A;  1E5H A;  4XAE A;  3ZKU A;  1UOF A;  3ON7 A;  5C3S A;  1RXF A;  1BLZ A;  2DBI A;  2JB4 A;  2BRT A;  1IPS A;  5C3P A;  1W28 A;  5C3O A;  2VBB A;  1HJF A;  2DBN A;  3OOX A;  4BB3 A;  1W9Y A;  2VAU A;  1OC1 A;  5C3Q A;  1HB4 A;  1W06 A;  2BJS A;  1RXG A;  1ODM A;  1HJG A;  1HB2 A;  2JB8 A;  1HB3 A;  2CSG A;  5C3R A;  1W2N A;  1BK0 A;  1E5R A;  2VBP A;  2IVJ A;  2WO7 A;  2BU9 A;  1W3X A;  1E5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...