4HVRA

X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
b'MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 34
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvrA01
3D82A 1ZRCA 2BNMA 1RUNA 1WLTA 3NVCA 4JVAA 2CAVA 1ZZ7A 5KHHA 3ETQA 2GC1A 3E6DA 3I59A 1YFWA 2BEOA 4QGNA 4N9IA 5CU1A 2H6BA 4YSFA 3OF1A 2QVSB 4I2OA 3EHKA 4Q29A 3MDPA 3OGJA 1YFUA 3NKTA 2QDRA 1ZREA 2IXJA 5BV6A 2MNGA 4HZFA 3FFQA 3PNAA 4IESA 2D93A 3MYXA 1DZTA 3H3ZA 1J3RA 2K0GA 3I7DA 1NE6A 2XL7A 3HIFA 3H50A 1UW8A 2DCTA 2D5FA 4YARA 2ZKLA 4AXOA 5JAXA 3QOPA 3H8UA 3QACA 1X7NA 4KU7A 2P17A 5JR7B 2E9QA 4YRDA 5BXXA 2IXCA 2Q0AA 1YHFA 3CO2A 5KHGA 3FHIB 4EWDA 3IDBB 1QWRA 4XFHA 1OD5A 4Q0QA 4R52A 4H7LA 4HSLA 1O3TA 3M70A 2OZ6A 1CX4A 2OYZA 2F4PA 2UY8A 3LAGA 4KWLA 4P9GA 1YUDA 3R6SA 3ROUA 3E5QA 4PIZA 1EYBA 1PMIA 1XE7A 1OMIA 3FJSA 5FQ0B 1O3QA 4E2GA 5KHIA 3ACLA 2QJVA 1JUHA 4AQ2A 3KGZA 3U0ZA 1UIJA 1X8EA 2BNNA 2BYVE 4MUVA 3BB6A 4FAGA 3NJZA 4TLFA 5FLJA 1DGWA 3ES1A 4I3PA 4JV4A 1RGSA 4HVQA 3OCPA 5CVRA 4UBHA 3GYDA 1ZRRA 1XE8A 3ES4A 4Q0PA 5KBFA 1CAVA 3PVBB 3S0MA 2WFPA 1IPKA 3MPBA 4J1WA 3MZHA 1ZZ6A 3HT1A 4YNIA 5J48A 3BPZA 1DZRA 3C3VA 2ETEA 5I0TA 4Q0UA 2GC3A 5E1RA 3VHRA 2CAUA 4HBNA 4J1XA 1YWKA 2OZJA 2B5HA 2ET7A 2N7GA 4BIFA 1QXJA 3OTFA 4QGLA 3M3IA 4LUMA 4MX3A 4EWEA 5JSOA 3ST7A 4MH0E 2ZCWA 4L11A 2GU9A 4LA3A 2Q30A 5LRRA 5FLHA 5J3UA 4FBFA 4ZU4A 2GC0A 4DINB 4XF0A 2QCSB 1V70A 2Z2SB 3H3UA 3L2HA 1Q5OA 4FT8A 3LA7A 4XFAA 1RTVA 2C0ZA 3HT2A 4O9GA 3JZVA 3UKVA 3E5XA 5K8SA 1CAXA 1RUOA 3D0SA 2H6CA 4ZU7A 4IEOA 5BY5A 1Y3TA 3RDIA 3BCWA 3KCCA 4JTNA 3U10A 5FLIA 4Z82A 4BHPA 5KHKA 4LUKA 3LZZA 1U12A 2UY9A 3NW4A 4BH9A 2VQAA 2EA7A 1O3SA 1ZZBA 4HLTA 1J3QA 2UYBA 3SCFA 5C8WA 4EV0A 2XHKA 4IEXA 3ZDSA 2O8QA 4OFGA 4I01A 4XF9A 4XFGA 1ZNPA 1EY2A 4META 4QM9A 4KWKA 1NYWA 3LA2A 2HKXA 3GBFA 3DV8A 5D1IA 4ZU5A 4EWAA 4BYYA 3I54A 1ZZ9A 1I5ZA 2I45A 3DL3A 1CAWB 5JCTA 2PYTA 1J1LA 5KHJA 1YFXA 3SCGA 5I0SA 3RNSA 4F7ZA 2PQQA 4NVPA 1EPZA 4QGMA 4Z07A 2H0VA 2PHLA 3RPQA 4XF1A 2XLAA 3EQEA 4PIYA 3SCHA 2V09A 3UKTA 1SEFA 4UXAA 5FPXA 1O5UA 4XF4A 4HVRA 4MGZE 1DGRA 5CADA 3O14A 4AVAA 2MHFA 3WW2A 4KU8A 3G7DA 3H1YA 2EAAA 3RYPA 4AVCA 1O4TA 3H7JA 5FCCA 4UBGA 1WGPA 4A2UA 4CYDA 5I8TA 2ET1A 4N9HA 2B9UA 2GC2A 2B8MA 2PAMA 4MZUA 4B29A 2GH2A 4X6QB 1TQ5A 2Q4SA 1ZRDA 1Y9QA 3CLPA 4FAHA 1X8MA 3I59B 4IEUA 1ZZCA 2HJIA 1YLLA 3KSCA 3KMHA 4XFCA 2EVXA 3E5UA 2FQPA 3UKNA 1FXZA 3FE5A 3SMHA 3FX3A 4MGYE 5E16A 3OD0A 3TNQA 3DKWA 4I09A 1ZZ8A 1L3JA 2PAKA 3EBRA 4L2NA 1UCXA 2PFWA 3WW3A 4E2QA 2VPVA 1Q3EA 5FQ0A 3TNPB 4PIXA 4Q0SA 2Z69A 4XF3A 2D40A 1ZRFA 1UIKA 4MV2A 2XLFA 1LRHA 4MGKE 3EO6A 3CF6E 5C6CA 3BU7A 5LRSA 5JSPA 1O3RA 1XRUA 2IXLA 3D0JA 2XL9A 4Q0VA 2BNOA 2GAUA 3H1WA 1VR3A 4RD7A 4HN0A 4QXKA 4QMAA 4X6RB 3USSA 4OLLA 1O5LA 3CEWA 4IEZA 5I0RA 1ZVFA 4HN1A 1RC6A 3IIAA 5AVPA 3S7EA 2Y0OA 1NXMA 4I02A 3BALA 5EZWA 4PJYA 1H1MA 2D5HA 1VJ2A 2PHDA 4JTOA 1SQ4A 3IBMA 3E97A 4HSJA 3SXWA 3E6BA 1CGPA 4XEZA 4LTAA 1FI2A 1J58A 4WZCA 3H1MA 1IPJA 1EP0A 4XFBA 5LEJA 4QM8A 3WW1A 1GQHA 4ORFA 4O9EA 3S7IA 2PAEA 1LKNA 3CL1A 3H7YA 2IXHA 2IXKA 2MPFA 3IWZA 4KL1A 1QY4A 5HI0A 1NZCA 2BGCA 4EROA 1LB2A 4LA2A 2KXLA 3HQXA 2CGPA 2XLGA 3U11A 3NSTA 5BUVA 1H1IA 2PTMA 1CAVB 3RYKA 4WBBA 5I8YA 1RL3A 3ELNA 3LWCA 1CAUB 4IEYA 1J59A 1HW5A 1WA4A 2O1QA 4MGIE 5BPXA 1QXRA 2WC2A 4AQ6A 3LA3A 5LEKA 4AVBA 4KWJA 2VECA 4IERA 3WW4A 2XGXA 2QNKA 4LEJA 1UPIA 2IC1A 4IEPA 5I0UA 3RYRA 5J7MA 3DN7A 3LOIA 1I6XA 2PA7A 3NL1A 1YFYA 3E6CC 4ONUA 5EFUA 3FZ3A 4GULA 2UYAA 2ATFA 1LR5A 4LULA 2FMYA 3KGLA 4IETA 4HMZA 2CV6A 3CJXA 2XKPA 4XETA 4XFIA 2XKOA 4E2SA 3SHRA 1CAWA 4D7TA 5FDBA 1NE4A 1CAXB 3B02A 4K8FA 2OPKA 4HVOA 5I93A 2IXIA 3FWEA 4XFFA 3RZZA 4YYOA 4I0AA 1X82A 5FPZA 1GQGA 4F8AA 1CAUA 5T3NA 1ZX5A 5F1RA 4IEQA 1PM7A 4WVZA 2Q1ZB 1J3PA 1SFNA 5JSRA 3H9AA 3PLQA 1UD1A 1G6NA 5I8SA 1FT9A 1Q43A 4D7SA 2K9ZA 1OI6A 1VP6A 5I91A 4IEWA 1OFNA 2OA2A 4R8HA 3IDCB 2GZWA 3N4MA 4QX5A 3EJKA 1O7FA 4I0BA 4LLOA 4IEVA
chains in the Genus database with same CATH superfamily
3D82A 3NVCA 1STMA 3ZKUA 5A3UA 3GJAA 2CAVA 1JYNA 2DFBA 3POFA 5A33A 1AR61 3AP9A 1RUF3 1K5MC 1SMVA 1BBT1 5IAVA 5ABJA 3ETQA 4QXCA 4N43A 1YFWA 1K42A 4E9KA 1RUC1 1U0AA 4N9IA 3CJIB 4ZKTB 2JKXA 1GZWA 2QVSB 3KT4A 3M3EA 3EHKA 5DZGA 3T1LA 4E4HA 1W9TA 4FVVA 1ULFA 2ZOEB 1W9YA 2WZR2 4HPKA 1HKDA 2QDRA 2WFF1 1IOAA 1OT5A 3SH3A 4B8EA 1CZSA 3RGBA 2MNGA 4HZFA 3VBOB 3ZYIB 4LBLA 1FPN3 3FFQA 1NT0A 3PNAA 1FAYA 3WNKA 2D93A 3WG1A 1C5IA 2XQXA 1APNA 3R0RA 4MXWB 4NE9A 2Y8KA 3OBRA 4P14A 4Y5TA 2FHRA 2VZPA 3I7DA 3O7OA 5F37A 3ZR5A 5KXCA 2XL7A 3WOGA 1PGW2 3LKJA 5G04L 1LEMA 4PBOA 4FXGB 2VMGA 5FYCA 4FP2A 1SLLA 3H50A 3OD4A 4LIUA 2TEPA 1BYHA 2Y60A 2ZAAA 2ZGNA 3ZPYA 4NN0A 1UY3A 4QPIC 4YM3A 3AM2A 5I0DA 4LQRA 2RR11 2D5FA 4LKDA 5IVFA 1AXKA 3TRSB 3VL9A 3WY6A 4DY5A 1O8SA 1DQ0A 4W6XA 1A3KA 2CSGA 2P17A 1S0FA 2E9QA 3DPRA 5JR7B 1W6QB 1UOFA 3RJRA 2VZRA 3PIGA 3AMHA 1W90A 3ZLIA 2JDNA 1NQJA 4UFIA 3RZKA 1O8PA 3KF3A 4EWDA 3O1UA 2QQJA 1AX1A 2CTVA 4Q0QA 3ZM8A 2UWAA 1I1EA 4FO9A 2W39A 1V6OA 1VBE3 1HV1A 2IWGB 3FUQA 1PO11 2ARXA 1HLCA 3C7GA 1TZOA 2OYZA 5CFCC 1NCQC 4KWLA 4OUEA 1CVNA 1MVQA 4CEYB 1LJ7A 3LSEA 2PMWB 5CA6A 3MF6A 4XUPA 1RXGA 5ERLA 4UF0A 1JU4A 1DG6A 2D6KA 4QX3A 2VUAA 1F9KA 1JUHA 2QJVA 4YGBA 3VBFC 2VBPA 2YV8A 2HWF2 3VBHB 4CUAA 5DPNA 1PMHX 2R062 3B69A 5FYYA 3VBSB 5D8AB 1V6JA 4UI9L 2WQZC 2ZEWA 5LA2A 4BXFA 3MFAA 4P5HA 2K46A 4BISA 1GOHA 5FUNA 2D6LX 5C33A 1RGSA 3N35A 1D0HA 2LS6A 5IYYA 4KWUA 2GALA 1CPNA 4UBHA 4E4ZA 2I74A 2YGLA 4V1PA 2VE1A 2J1RA 2VU9A 1HQWA 5GZDA 1IPKA 3MPBA 5BNPC 3AB0A 4XJAA 2YU2A 4RS5A 3HT1A 4WM8C 4X8NA 1OA2A 2YHJA 4Q4V3 3C3VA 2I07B 2GC3A 3ACHA 4P08A 3I3BA 2VUDA 3VHRA 4PBPA 2BFUS 4JGYC 1QOTA 1BQPA 2Q5TA 1NOVA 2B5HA 5EWSA 5FZKA 1HN1A 2YC0A 1JBCA 4AQTA 1AUYA 4BIFA 3WHUA 4EJRA 1PMJX 4Q2FA 1X36A 2C1FA 2XJUA 4LUMA 4A7YA 4RHV1 3MGUA 1PO22 3O0VA 2RVAA 3PMSA 3ZYGA 4CUGA 2ZCWA 4L11A 3R4SA 5DUUA 2HWC2 1UYPA 3D6EA 5FLHA 5LRRA 3U14A 4AFCA 5FZBA 4EN7B 4ZU4A 3IPVB 3PJYA 2RV9A 4FOVA 1AF9A 2WDBA 1E57A 3BTAA 1SFPA 2GNTA 3LE0A 5FO9B 1UKRA 3LD8A 3PUIA 3ACIA 3ON7A 3KCYA 4WZFA 4XCBA 4LXLA 1MPXA 4FT8A 2A71A 4CU7A 1OA4A 1SBFA 4OVEA 1B09A 4XFAA 5EP9A 4DRRA 4XTPA 1JZ2A 2QQPA 1E5SA 1QU0A 3AVRA 4O9GA 4QPYA 2D6MA 1QJX3 2ZMLA 1CAXA 3OOXA 3SC7X 2EXKA 4A7KA 1GUIA 5IW0A 5CFDC 4LBJA 3GHMA 1UY4A 3HEIA 5FREA 1H2LA 3WV6A 1GR3A 1PGW1 5C4WC 5BY5A 2O0OA 2A70A 2QQVA 3FN9A 1ALYA 2Y6LA 5FRAA 3RDIA 5L7OB 5CEHA 4GB32 2PXJA 1C8NA 1COV2 1OURA 3NKGA 2ILMA 4JRAA 3HNMA 3NJVA 3EB7A 5BNNC 5KHKA 3J9SA 1OQEA 5F3EA 1D4M3 2WKKA 5GZEA 4XQ4A 4IV3A 3THPA 2ZGPA 1VBA1 5FY1A 4CP1A 4KBBA 3WDUA 1O3SA 3NO8A 2IUWA 1MACA 2JG9B 2QTWB 2Y0IA 5C8WA 1S4CA 4IEXA 4OFGA 3RWNA 2ZMKA 2J1SA 2WABA 3RG0A 1EY2A 1SDDB 1SPPB 1IQDC 2C4XA 1H8TB 4QM9A 4JHZA 4K1ZA 1NYWA 4JZRA 5GLZA 2VH9A 4XBNA 5ISLA 4A42A 1KFXL 3ATGA 4OHXA 2WT1A 3GBFA 4GMP3 2RM22 1ENQA 2DVBA 2ZA9A 2XB6C 3Q8AA 4FPHA 1SLBA 4Z8BA 4BYYA 1VB2A 4RYDA 4XJWA 5HXMA 3O1OA 5A7OA 1GYKA 1PVC3 2HWD3 1J1LA 5FXWA 2XBO3 2VTXA 3VL8A 5KHJA 2JDUA 4BB3A 3BN6A 4AAPA 1X9TA 4CDWC 3SCGA 5DAQA 4F7ZA 2X10A 1LHWA 1PZ7A 5C3OA 4TXWA 4B3NA 4NRQA 5L9VA 4DIQA 3ZFFA 1IS3A 1RVF1 5A7WB 5EJZB 4JGZA 3HMYA 3RPQA 4EZHA 4D6SA 2WNOA 1F15A 1RUD2 3SCHA 3KQRA 4E8DA 5IK7A 3OGVA 4IUGA 4UXAA 1JH5A 1H6XA 5J36A 4KNCA 5A3NA 1RINA 5CADA 4JKMA 4UOJA 3WZ1A 4QKNA 1OPMA 2WQ4A 3WW2A 1VBE2 4GJYA 2EAAA 1RUH1 2VVEA 1FOD3 4K6BA 3AL6A 1GFF2 2RJLA 1CZTA 4JCKA 5EQUA 1Z7S3 4IQPA 4UBGA 4A2UA 4P02B 5I8TA 2ET1A 5GALA 4CEWA 1BVVA 2B9UA 2JENA 4AEDB 3LDBA 1LHOA 4N53A 2E63A 4MZUA 4ZY9A 1MEC2 1WMFA 2HBUA 3AKSA 1V6MA 1TQ5A 1HQNA 2VGDA 2W2IA 5A33B 2Q4SA 3OJBA 2ZEXA 1S2EA 2JDPA 1W9SA 1EV12 1AXYA 4L9BA 1Y9QA 3BOWA 5T54A 3V64A 5ABJB 1DIWA 3JB8A 3AJYA 4BMBA 3C8XA 4N43B 4DEVA 3JBG3 3E5UA 1AR71 4YW6A 4CCKA 4EN9B 5KXDA 1HB2A 1GZWB 3FE5A 2BWAA 3SMHA 2MEV2 2BVBA 4MGYE 5F5AA 1HRI1 3GBGA 4MGQA 2ID4A 2ARCA 4HPKB 5L36A 5JXHA 1LHVA 5CKMA 4KGGA 4LMFA 3NAPA 4K8RB 2XMLA 4S2HA 4E2QA 3PURA 1Q3EA 2RS52 1W6NA 5FFOC 5C8CC 2XOMA 3NNMA 5JMOA 1DCSA 4GB31 2XG3A 1COV1 1XOYA 2DV9A 2Z69A 4XF3A 2VCAA 3I49A 3T08A 3ABZA 3HAGA 4XIKA 2OKXA 4IGPA 3PIJA 3S5AA 1Y7BA 1JXNA 5FY8A 4PLMA 3C7EA 3N7MA 2NMNA 3EO6A 2KD7A 1A6CA 3CF6E 3CKHA 3CQOA 3KB5A 3BU7A 1S55A 4JX0A 5FIXA 3I2DA 5LRSA 1NLSA 3PUQA 3VDBA 1XRUA 4GMP0 4CCNA 4RGGA 5FKCA 2XL9A 4DZGA 4Q0VA 2BNOA 2HWE2 5FZEA 5FZDA 4CCMA 5AFBA 4RD7A 5A3MA 3GZEA 4N90A 4QMAA 1GANA 1KXGA 2VZ3A 1QF3A 3UJOA 3TYJA 2GNDA 3N9MA 2WBKA 1OXCA 4FFGA 4UAPA 4B1MA 3VHNA 3DPRB 4IEZA 1TVGA 4YG0A 1REEA 4HFSA 2R073 1UY2A 5I0RA 5A6ZA 1ZVFA 5A7PA 4HN1A 2IFRA 2B4KA 2GP3A 3S7EA 3T2TA 4ARYA 1MZFA 1QOOA 1JZ5A 5L9BA 1X50A 1UY1A 5EZWA 3HJRA 4MYEA 4Y1XA 5A80A 1QJX2 4ZONA 2PHDA 5F3IA 4HSJA 1Q8PA 3THDA 2DURA 1CGPA 4WM7A 4XEZA 1ND3B 1LESA 1TME2 4NIIA 1YQ6A 1NX9A 4UF0B 3HOBA 4WZCA 3H1MA 1IPJA 4CVUA 1GP6A 4BQ5A 4B4QA 3PUHA 1AR63 1XNBA 2GH8A 1GQHA 1JODA 1R093 4YLZA 5FXZA 4COYA 4Y33A 1M4WA 3AZXA 3FLRA 2WUHA 1AJOA 1TE1B 2ZXQA 1LKNA 1BBT3 3LQCA 3RZMA 5FZ3A 5FAXA 4BIOA 1XNTA 3H7YA 2IXKA 1ULPA 1HXS1 3ASIA 4A4AA 2PN5A 2PHWA 2XJTA 4Z92B 5JDBA 1RB8G 3FLPA 1UAIA 3QH7A 2ADEA 2WFF3 2VTXJ 5FZMA 3AL5A 3NSTA 1ODNA 1F35A 3U11A 4CCCA 2B46X 2QE3A 3I2FA 1IG0A 2HEVF 1ASJ2 5A70A 1RL3A 4LORA 4AGGA 3H0OA 4LE4A 3VDDA 4A3ZA 4RL7A 3WDYA 1XYOA 5FYZA 1GP4A 5EHDA 1QXRA 4I30A 1IS4A 2VMEA 1W28A 4JDOA 3I2OA 2VOKA 3LA3A 4U2AA 4N8MA 4A7ZA 3K77A 4KWJA 3OUHA 1NCRA 1WMDA 1GNHA 2VECA 4L8QA 1OKQA 3RJ2X 2X53S 3VBRC 1CX1A 1LULA 1SLCA 3LIGA 4MVTA 4LO8A 5DN2A 1B35C 3T0AA 3WEZA 2RR13 1LHNA 2A6WA 1R083 1DQ5A 1UMIA 1WD3A 4YM2A 4CDXC 3TEZA 2PA7A 1K5MA 5JR2A 2ZAHA 1XU2A 2D3SA 3E6CC 2MEV1 4R4XA 3FZ3A 5LB6A 1LU2A 4XE9A 4AEMA 4LULA 2FMYA 5LK7B 1VBD3 3KGLA 1Z78A 4BJ0A 2NPIA 2CV6A 1W2NA 3CJXA 3ZFGA 2XKPA 2BDRA 2EXIA 3GZTB 4OI1A 3AYDA 1CAWA 3U1XA 3R05A 2GMPA 3MI8A 1CAXB 4XHXA 4HVOA 5JI7A 1G9CA 3S30A 1FOD2 3NQHA 3FWEA 1H6YA 4PT6A 4XMIA 3GALA 5B2GB 4XFFA 1XSRA 2WO2A 2JB8A 4I0AA 3SH4A 4XJ9A 1JOBA 1XPWA 3IN9A 1GQGA 4FXKB 1REDA 4O7XA 2VOXA 1VMJA 4C90A 2GNMA 1V9U2 2HWE1 4LHNA 4HG6B 1FNYA 1OF3A 1V6LA 1VAVA 2W1QA 2WZ8A 3LB9A 1PM7A 2VOVA 4IEQA 4QPIA 3O1MA 2ZGMA 4IV3B 1DU3D 1J3PA 1NUKA 1UX7A 1FNZA 1SFNA 2W0XA 3OYWA 4XCAA 5IFPA 3J7HA 4Q5OA 1RUJ2 1G6NA 2X5IB 5IVJA 1F5JA 5I8SA 1ST8A 3C7OA 4EE2A 1HB4A 1VRH2 1FV2A 2D6PA 4YPJA 2QFEA 4GA9A 3V0AA 4IEWA 3FBYA 3I97A 2HWB2 3SQOA 1OFNA 1H2NA 1NXD1 4CZSA 1REFA 3AKPA 2Q8DA 2BFUL 1WBFA 3VZJA 1UNBA 2VW0A 4R8HA 1QJU1 4TWTA 1BKZA 2AEZA 3IDCB 4UW3A 3KVBA 1SDWA 2B45X 5CFCA 1TME1 1NCQA 1Q8SA 3AP7A 4OHVA 4V2WA 3N4MA 4COWA 1QKQA 4I0BA 3WCSA 1LEDA 2AREA 1G9FA 5FPVA 2BNMA 4HL0A 4JVAA 2RS31 4QU2A 3W5NA 3WINE 2V4VA 3VBFA 5F3CA 2R30A 4OI4A 3SEEA 2AH2A 5LBBA 1GSLA 2BEOA 5CU1A 4DNYA 1KJLA 4YSFA 3OF1A 4L0PA 2YC2A 3FLTA 3ZFFB 4ZHNA 4FPJA 4JGZB 3OGJA 1YFUA 2SBAA 2W92A 2IXJA 4HKOA 1GZTA 5BV6A 1OPOA 3AFGA 4KGQA 1WLCA 1KJRA 3DKQA 2XH6A 4ATEA 1YIPA 3P6BA 4NUBA 3CMGA 3MYXA 1RHI2 3H3ZA 2CNAA 5FY5A 5IUQA 1G9BA 3QH6A 1AR93 3O0XA 5FZ9A 5BNPA 3D5OA 4FQZA 3J8F1 3W5MA 1D4VB 1AR81 2FDFA 2TUNA 4S2GA 4LBQD 5B4NA 3HIFA 4K7JA 4QHOA 5IHRA 4MHRA 4JGYA 4DXRA 2YDEA 4D7YA 2XWJB 4YG3A 4LBQA 2LRPA 4YW5A 5IT6A 4CEWB 1GLHA 4M0NA 1S0CA 1MS9A 2FMDA 1C3HA 1H8VA 1RUG1 2E32A 3WQ7A 1VBA3 1VBC2 4IXLA 4YARA 5F7UA 5JAXA 2YG0A 3QOPA 3H8UA 5FZLA 4Y4YA 3QACA 3NJYA 2D7FA 2WN3A 3POYA 4QQ2A 2WNUB 2JWPA 4PLOA 1US2A 2ZGOA 4YRDA 2IXCA 1G9AA 3BIEA 1YHFA 3RZLA 1A78A 3FHAA 1WUVA 1QWRA 3U4SA 4R52A 1UYXA 1W2OA 5T52A 4FI9A 2EIDA 3M70A 1O3TA 4C1XA 2OZ6A 1CX4A 3WG2A 5FZAA 4XQDA 3GHNA 4XUQA 2F4PA 1IS5A 1OVSA 1S2KA 2XJQA 3LAGA 3R6SA 2W1SA 1LOEA 3ROUA 4AAXA 3POSA 4PIZA 3NAPB 2WA3A 3I2KA 1QJY1 1O3QA 1W6NB 1AX2A 2V5YA 5CFDA 5H9QA 2VMIA 3ACLA 1WBLA 1AJKA 2FDJA 2YPDA 3KGZA 2FZ1A 3PU3A 3U0ZA 1UIJA 1ZBA3 3JD71 5JXGA 5FXVA 5FP7A 3TEYA 2EIGA 1F5FA 2BNNA 5BNNA 3SEPA 2ZBJA 2VMCA 2IFWA 2DWRA 4H7MA 3AYAA 4TLFA 3SISA 2JXAA 1YXWA 1S0DA 5FMDA 2WS92 3ES1A 2BOIA 2PLV2 4FPYA 3TAYA 1BZWA 3OCPA 1Y4WA 1NY71 5HV0A 5GZFA 5K7PA 4U36A 4CUBA 3N7KA 1XE8A 3ES4A 2RE9A 5KBFA 5LATA 1F4AA 1RMU2 5C3PA 2BW8A 5J48A 1SHWB 3BPZA 2VC9A 2ETEA 4A6SA 3O5SA 4Q0UA 2FDKA 1XU1A 2P34A 2CAUA 3AFKA 1DYKA 1YYNA 3BGAA 1DLCA 4HBNA 4YM1A 4BWOA 1SBDA 1YWKA 5A32A 5EXOA 1VLNA 2D97A 4DPNA 5E8AA 3CZUA 4WM7B 2W91A 2VL4A 3M3IA 4Q4X3 1FMD2 1UZWA 4EWEA 2P6HA 1GQPA 2RG4A 4CDWA 2Q30A 2JKBA 1WW5A 4OZOA 2NZ9A 3AZZA 4B7KA 2XONA 2XJVA 2A75A 4DINB 1UL9A 2ZMNA 5KC5A 4CDQC 5GLVA 1WA6X 3H3UA 4JDMA 2VMFA 1DDLA 1XQNA 3K4AA 4QPGB 4TLGA 1AR73 3IAPA 3BTYA 3M4FA 1QIQA 1CD3G 1QOSA 1XYNA 2NM1A 3AZVA 1RHI1 3RVHA 1HRI3 4XXAA 1XNDA 3HT2A 5FZOA 2WR9A 3JZVA 3UKVA 5BNQA 3C2UA 3E5XA 3AKTA 1W6OA 4FPOB 2PHUA 5DDJ2 1RUOA 2ZJCA 3M3OA 5CKNA 5LZ6A 1UZ0A 4BOWA 2WINB 3A4UA 1QH6A 3I2HA 4ARXA 2VZVA 1EPWA 4X8PA 2BERA 1W0PA 3BCWA 3KCCA 2JG8C 3ZN5A 3U10A 4YVWC 4G9SB 3URFA 4DMIA 1CWPA 1CIWA 2XWBB 2R1BA 1WW6A 1OFSA 1FV3A 3VV1A 4LUKA 1BVP1 3WCRA 3SKVA 3WDXA 5FR3A 1GV9A 3CBNA 5ANNA 2VQAA 4NAMA 2PELA 4OMDA 5F8PA 1HB3A 1AYN3 3R4UA 4HLTA 4C91A 1J3QA 3SCFA 1FX5A 3RMYA 2XHKA 5IVVA 3PTRB 5DAWA 2C6SA 2RMU1 5L9RA 2YC4A 4XF9A 1K5MB 5A3PA 1ZNPA 1ZBE2 1XNCA 1F2NA 1RUI1 3MF9A 4Q4W1 2HKXA 4D6QA 1T6GC 3IIIA 3VZNA 4CA9A 4BLIA 2VR4A 3LEIA 4ZPIA 1KGYA 5DG1A 2EF6A 1AYM2 5DAXA 1W6PA 2VBBA 2VULA 3LPFA 2RDRA 5CBLA 3RRDA 4EWAA 3ZFGB 2UURA 3ZXGA 1OBNA 2ZTNA 3B3QE 1CAWB 2YYOA 4Y4RA 5C8CA 1AL21 2PYTA 2CHHA 1QQP2 1NQDA 4M3CE 4IGQA 1JYCA 2DVGA 4JKLA 4YW7A 5FP9A 1ZRIA 4NR1A 1BMV1 3RNSA 3HNYM 2PQQA 4NVPA 3TBDA 2GNBA 1F8VA 4URTA 3K3NA 2Q1MA 1CN1A 3JUUA 4OHYA 4QXBA 5FWEA 4Z07A 3JCIA 4LKEA 4QQOA 2XJRA 1GNYA 3T2QA 3VBHC 2RS12 5JLVA 3EQEA 1HXS3 3OYWB 3VBSC 2AC1A 3ENRA 5HCHA 5ACA1 3UKTA 5FPXA 1O5UA 1DBNA 5A3LA 1IG3A 3JU9A 3SITA 1MQTC 2MHFA 4Q27A 4OUMA 1LENA 4GQ7A 3U37A 5DMYA 3MPPG 3F95A 1RUE2 4L97A 4MXVA 4XAAA 5T5LA 5E89A 3WP3A 4AFAA 3W58A 2BU9A 3M3QA 2P37A 4LLFA 1Q56A 3WNLA 2BUKA 4CYDA 1EAH1 1NCQB 4XUTA 1FMD1 1A34A 3H8RA 3Q8BA 2B8MA 1S0BA 1C57A 4NHXA 4YW3A 2PAMA 4LIVA 1MR5A 4MOAA 3FC0A 3WF2A 5AC91 3DGTA 4JC1A 1H2MA 1N3PA 1LOBA 4RN5A 1QJEA 1TNRA 3OGGA 3WDVA 3VBFB 4AFMA 5JOYA 4FAHA 1HRV2 1OF4A 3RFRA 2A73B 4UW4A 1DGLA 1YQ2A 2Y34A 4GKYA 2HJIA 2A3WA 4IEUA 5A3WA 2VM9A 3ZYRA 3KV6A 1E5RA 5D21A 1W9FA 1JYWA 5JPMB 2R49A 5A7QA 4FPGA 1W8TA 3FX3A 2E31A 2YB7A 4M01A 1MZ5A 1S0JA 5H9SA 2WLPA 5KHHA 5E16A 2FCTA 4IV1C 5DDJ1 3P3PA 5T5JA 1ZZ8A 2PAKA 3EBRA 1OSGA 5BNOA 2CWSA 5FMOS 1W6MA 1ULCA 2PFWA 5JXIA 4M4RA 5DZEA 3W20A 2A6VA 3UJQA 2HLEA 4M0HA 4FFHA 3TNPB 5JOXA 2ZEZA 3WP6A 2WZR1 2G19A 5FBJA 3AC0A 5IAXA 5SV5A 5BNPB 5EJ1B 3B7MA 1N1VA 4GIQA 5KXEA 2J7MA 2R042 4QT6A 1VBB2 1HQLA 1JZ7A 2ORZA 2P3IA 1CR7A 1WMEA 1YI7A 4N7UA 4BQ1A 1UIKA 4XABA 1D2QA 4R4ZA 4P5YA 5FZ6A 5A1FA 1XB9A 1JHNA 2YMZA 3WX5A 3BVCA 1O3RA 2VQ0A 3LDKA 4JGYB 1KEXA 3D0JA 2IXLA 2QQNA 4CTEA 1Z0HA 4LBQB 3VBRA 2OVUA 2QZ2A 4ZXKA 3H1WA 4B1LA 1W8HA 1B35A 1N1YA 4QXKA 4LOSA 4C8DA 3D3AA 1LODA 4X6RB 4B4RA 4ES8A 1O5LA 1CPMA 4BXSV 4CDXA 5FYMA 3CEWA 1W03A 3KD4A 3VZKA 3ZPOA 3NWKA 1ODMA 3VD9A 2JD9A 4XBLA 2JDHA 3TN93 5DAVA 2ZPXA 2Y26A 2VW1A 4XZUG 1GP5A 1RUF2 5FO7B 4AF9A 1VE0A 3M1HA 1H1MA 1IQAA 1H8TC 2CGNA 1NKGA 1QJU3 4IE0A 1V6IA 4GWJA 4NAOA 5KC6A 4QX7A 1EUTA 3E6BA 1PIV3 4K1YA 4LTAA 1FI2A 5CFDB 5J09A 1EP0A 2AR6A 1NA1A 5LEJA 2ZHNA 5GZCA 1R1A3 3D8CA 2W94A 2ZACA 3HBZA 1HN0A 2RJ2A 2RS33 4R9AA 4AYUA 4Q4Y3 1N3QA 3LF7A 1M06G 1FPN2 1C4RA 3S7IA 4QX2A 4LBMA 3M7AA 3B00A 5FZ8A 2BRTA 2W95A 5BNNB 3OY8A 2IXHA 1C8M3 3PHMA 2ORXA 1UWWA 2HWF1 3N9NA 4TN7A 4URAA 3J7NA 5EYYA 3OBTA 4NHYA 2R061 3LFIA 4EROA 4LA2A 2CYFA 3HQXA 2XLGA 2DVAA 3OGSA 4GH4C 4CCDA 3N9PA 5FYVA 4QHZA 4SLIA 4L99A 4UFJA 5B4XA 4DB5A 5I8YA 4IEYA 5AVAA 1V0AA 4RGAA 1PGSA 4ISQA 1JOJA 1H9PA 1OQDA 1ZA4A 3J8F3 3M2MA 3N7JA 3T2OA 4RGKA 3ZYHA 3ZYPA 4BQ3A 4L92A 3GM8A 4PI2A 4D69A 1H30A 2R1DA 4LO6B 3NV2A 3Q8CA 4IERA 4HT1T 5LA0A 1MZEA 5LW9A 2VCBA 2JDKA 1A8MA 1JHJA 3ZXEA 2I2SA 4NIDA 2WNVC 2WA4A 3RYRA 1CZVA 3UGHA 1DGRN 1YRZA 4Z2AA 1HRV1 1POQA 1CESA 1RUG3 2BOJA 1L7LA 3KWVA 1ENSA 3DYMA 2J1TA 2O14A 4NHMA 1KS5A 2D3RA 1LNSA 5E6HA 1MS1A 4KG0A 1YFYA 4BM8A 1OOPA 1TMF3 4EN6B 4D94A 1J1TA 1I9RA 1PO21 1IS6A 2YGMA 2HWC1 3W59A 4A3XA 1XXNA 4IETA 4HMZA 3AXDA 2Y6FA 4M00A 5IFTA 2ZABA 4XETA 3NV3A 1PM4A 1WD4A 2XKOA 4EN8B 2OUJA 5FPLA 2WAOA 4INDA 2R041 1QNWA 5FDBA 1NE4A 5FPBA 1W6OB 1E5IA 4AHWA 1YJKA 5FMCA 2WZPP 2J1EA 1Y9GA 1SCSA 2IXIA 5FO8B 5JXJA 2DYCA 2V5DA 2ZHLA 4PDWC 4XDPA 1D7PM 4YFWA 4D0QA 2XJPA 3PUSA 3EXUA 5LY1A 4CE8A 2JDYA 3JD73 4YM0A 1CAUA 5T3NA 1ZX5A 3A21A 1C1LA 2SLIA 5JMCA 5K0UC 4EQVA 4UFKA 1UMZA 5JZGC 1D2SA 2B42B 2PHRA 4Q4V2 3KCXA 4XQWA 5JUVA 1UYZA 1ACCA 1N1SA 2Q1FA 3F2ZA 4FOQA 5FUIA 4COUA 3OBAA 5HPOA 1BCXA 1CJPA 4HANA 3LCPA 1WCQA 3ZFEC 5TSWA 4H3WA 4AOCA 1QHDA 1VP6A 4UFHA 5FP3A 4AEKA 1UY0A 2EXHA 2XVLA 5LWBA 2VO5A 1W8NA 5KXBA 1PNFA 3O12A 1OUXA 3ILRA 4GAZA 5T55A 2JEMA 4BMEA 1W6PB 2ZX3A 1QEXA 2Y6KA 3I2GA 5FJHA 5HXVA 4NPRA 4OYUA 4LHKA 4YFZA 2AEYA 3EJKA 1O7FA 3AJZA 5DAPA 3RSJA 5IVYA 4IEVA 1ZRCA 1RUNA 1WLTA 3TEXA 4AWDA 1JYVA 5C8CB 3GCWA 2RM21 2ZGSA 3P1IA 2AGSA 2DUQA 1VRBA 2VUJA 5T5PA 3VD4A 3T0DA 1ZZ7A 1DQ1A 1IGOA 4RQPC 1ND3C 4ZS3A 3WF1A 4BDVB 4BQ4A 4BA6A 4XACA 3RI8A 1BEV3 4QGNA 4Z2WA 1WW7A 2BGPA 1DQ6A 5FYIA 4AQSA 1TG7A 4I2OA 4MHUA 4Q29A 2P6CA 2XJSA 1L7QA 3NKTA 4XAEA 1ZREA 2A6YA 4NIGA 1ZYBA 4JQTA 5IK8A 3K46A 2WWJA 1YIFA 3OB8A 4KQ7A 2A5ZA 3T09A 3WT3A 1D4M2 4S2FA 2ZKNA 4IESA 1YEWA 2BPA2 4IE6A 1PK6C 4MO3M 4UWDA 3Q9OA 4O61A 5FY4A 1RUD1 1YQ5A 1HJFA 1W2UA 1RUC3 3ZN6A 3ZR6A 1NE6A 4COVA 3THCA 3ALQA 3VD3A 1G8WA 3LDRA 5DG2A 4AEJA 3GXUA 3VHPA 1OLME 5FOJB 1PIV2 1DYOA 1QH7A 1VBE1 1DHKB 1NG0A 1UW8A 4QB6A 4AI1A 1R1A2 2YBSA 4XURA 3CU7A 4AXOA 4Q4Y2 4RS5B 4NJ4A 3AP4A 4KU7A 1N3OA 2DBIA 3NV1A 2GSYA 1MEC1 5KHGA 4J25A 3NNJA 5DUXA 1PVC2 2HWD2 4XFHA 2LALA 2XBO2 3CZJA 4H7LA 4CDQA 1UZYA 2OT7A 2FDGA 4WVVA 5A1AA 5CZKA 1RUI3 2W08A 4Q4W3 1UOJA 3OGRA 3QD6A 1EV11 3HWJA 1F31A 2FDHA 2UY8A 2Y6HA 4FPLA 2Y6GA 5BNOB 1YUDA 3AP5A 3KHCA 3GZAA 3E5QA 1W6MB 4LPLA 4E4SA 5FZ4A 5FUPA 1XE7A 3FJSA 4XC9A 3GNEA 3DXUA 1FATA 1HJGA 1AL23 2R0FA 3POBA 4AL9A 3KV5A 1POV1 2JG8A 4XUNA 2BVVA 2AENA 3CIHA 4YVWA 1URXA 5A7SA 2RS51 1TEIA 2XHNA 4MUVA 1GOFA 1MVEA 4FAGA 1UO9A 2GDFA 3NJZA 1PO13 2Y64A 4Q4V1 4W50A 3DECA 3HN3A 4AI0A 4LR4A 1W9WA 3HNBM 5FLJA 3VBRB 2GMEA 4I3PA 3JQXA 4HVQA 5CVRA 1B35B 4QDQA 3VKFC 3GYDA 1ZRRA 3UV9A 1Z7S2 3IMNA 4IV3C 1CAVA 3PVBB 4QQPA 3O0WA 4CDXB 5ACA3 3S0MA 2C9AA 1GWLA 3LEGA 4N7IA 2WFPA 1VAMA 2VW2A 3IB3A 1ULGA 4J1WA 4XYXA 4YWAA 2X5IC 5KWRA 4AI8A 3NV4A 3MZHA 2C5DA 3ILNA 5F6KA 5I0TA 4XILA 3WG3A 4P9IA 4COZA 4QPWA 5E1RA 3WDTA 4CU9A 4D6RA 1VAKA 1XC6A 2JJ6A 5EJ3A 4Y1ZA 4G3YC 2BJSA 4P9YA 3USUA 5C5UA 2JE7A 1JZ4A 3JBG2 3AMPA 3OTFA 4CU8A 1NZIA 4QQLA 4QHBA 3ST7A 4Q8KA 4MH0E 2WSVA 4LA3A 1QJX1 2GU9A 3A22A 1NA1B 4DS0A 5AC93 5J3UA 1YNAA 3WQ0A 1U5ZA 3WF0A 5FYSA 2YU1A 3ZMOA 4AI3A 4R9DA 4QB2A 1ULEA 4XF0A 4Y1VA 3OY8B 1LGBA 3RMXA 4AHZA 1V70A 2NN8A 1RITA 4HOOA 5F6LB 3NNLA 3VBHA 2ZEYA 1Q5OA 3L2HA 1LOAA 2WO3A 5JVVA 1D0GA 5FMOL 3S5QA 3VBSA 3FL7A 4QX1A 4A41A 1HDKA 1RTVA 3MIHA 1ND2C 4RHV3 3ZFFC 2JX9A 1LECA 2WN2A 3RZJA 3WUDA 2H6CA 5FYUA 4ZU7A 3KQ4B 2QBXA 3IAQA 4HXCA 1MQTA 4FPEA 4PHZA 3GF6A 4LO7A 1QDCA 4P9WA 5CIRA 4YVSC 2WZR3 4XJZA 4Y26A 5T50A 5C71A 1L7RA 1WMXA 1H4GA 2VNVA 3BU0A 4ZZ8A 3SH5A 4NPMA 5FLIA 4Z82A 4BHPA 2JD4A 3T3YA 3KM5A 1ASJ1 1SBEA 2BBVA 2R072 4P9JA 1MS5A 3KS7A 5FK8A 3LZZA 2UY9A 1WLDA 3NW4A 5DUWA 3VBUC 3POWA 4OCTA 4MGTA 3MW2A 1ZZBA 4QKBA 2UYBA 4W6WA 3VDCA 4WM8A 4ES9A 3K4ZA 3J7MA 4EV0A 2FDIA 2GP5A 4LKSA 3ZDSA 2O8QA 2HWD1 4AVTA 4GALA 4I01A 1JZ6A 2Y6JA 3AMNA 4NPLA 4XFGA 3RI9A 4LJHA 4C0BA 1OOPB 3PU8A 2ZHMA 4KWKA 3LPGA 2D6NA 3FBMA 5C9AC 3LA2A 4LNVA 1BJQA 3GDBA 2WNUC 4AHYA 2DUPA 4N53B 4Q8LA 3MHZA 3DV8A 4EZ4A 2G1MA 2WSUA 4IV1A 5D1IA 4IL7A 1AR62 1R092 3BIWE 1LOFC 3OPTA 1UN1A 3HQRA 3I54A 3MW4A 3H8XA 1S2BA 1K45A 1ZZ9A 4WVMA 1BBT2 1I5ZA 2I45A 3ECQA 4I3GA 5JCTA 2VZUA 2VNOA 3BUCA 3AVSA 4AI9A 1RUC2 4XPVA 4OI0A 1YFXA 2BZDA 2EXJA 2OXBA 1SFYA 3ZSKA 2J42A 2VZOA 3VKMA 2WFF2 3IDAA 4OMCA 1R1ZA 2KR2A 1OQ1A 3SKJE 3MLKA 5C3QA 3J26N 3V56A 2VD7A 4XDOA 2RJKA 3AKRA 1YCIA 3L2YA 4RR3C 2E33A 5HCBA 3N9LA 1T6BX 1FOD1 3TB0A 4DOUA 2P1BA 4XF1A 3WP4A 1XNKA 5C4WA 3O1PA 4PIYA 1SLTA 2X05A 3WNMA 5AFEA 4LBNA 4XVHA 2HWF3 3ORJA 3I4IA 3LOBA 2PHTA 5C6CA 4BQ2A 1V9U1 2R063 3QBQA 3JQWA 3VZOA 5FY0A 4CDUC 5FTTC 3MIEA 2ZHKA 1WWYA 2XDVA 3B01A 3G7DA 3C7HA 1RUJ1 2RR12 3I3MA 1PVXA 1RXFA 1RVF3 4AVCA 4KBZA 1R082 3WNPA 1VRH1 2VCCA 3H7JA 5FCCA 3JBG1 1H8TA 2Q8OA 3UL2A 3I3EA 1WCUA 2Q8CA 2CWMA 4N9HA 2HWB1 1PNGA 2GC2A 4FFIA 5HCFA 3ZSMA 1AL0G 5JI9A 2IVIB 3LEKA 4B29A 2HH9A 1CQ9A 1W8FA 1VBD2 2GH2A 4IE7A 4X6QB 2BP6A 4PF1A 1KD7A 3X29B 1ULDA 5FYBA 3ZN4A 3WP5A 3AKQA 3T1MA 2ENRA 1N1TA 3IT8A 5FP8A 3POGA 1MS3A 1RUH3 2RDSA 3WNOA 3KSCA 3VGIA 1YLLA 2YBPA 3KMHA 1HV0A 2D98A 2PHXA 2FQPA 3OUJA 2QDNA 5K4LA 2B7YA 4FOYA 4ASLA 4GZ9A 3OD0A 3JXSA 3DKWA 2HWC3 1I3HA 3JB4C 4RSUA 4AI2A 1L3JA 1WLWA 4L2NA 1UCXA 1WZXA 4GH4A 5IVEA 1JI6A 4WV8A 4IE5A 2BV4A 4QPGC 1W39A 4ITCA 1Q8VA 5FQ0A 1H0BA 2CU5A 3DXTA 4W6YA 2Z42A 4JKKA 4XDQA 1LGCA 3GGLA 3THTA 2FCUA 4YZ2A 2QQLA 4UT5A 4CPBD 3WNNA 4AHXA 3ZN6B 2D40A 1QGLA 1O4YA 2W46A 1J83A 1GBGA 4MV2A 2W1WA 1YO8A 1MZ6A 2VOTA 2QQOA 4QDSA 3CJIC 4CPBA 1O6UA 3ZYBA 5JSPA 4FPKA 2ERFA 1DZQA 3LSDA 4IW3A 2WNVA 4Y3OA 5F32A 3WQBA 1GU3A 2E7TA 2PHFA 1UQXA 3TWIA 3VBOC 3ZO0B 3KF5A 3USSA 4GB33 3VDDB 1COV3 1LOCA 2VY0A 3MEPA 1ZM1A 2OUHA 4JQRA 4LITA 4D3WA 3CHXA 4NWVA 4R9BA 3DYPA 2VBDA 1VBC1 4M4PA 1RC6A 3IIAA 1NCRB 4E4DX 1R091 5FWJA 2WT2A 4A6OA 4CDQB 1V00A 5JIAA 2L9LA 2Y0OA 4BLJA 4RHV2 2E26A 1LGNA 4YZ1A 3UGGA 5A7NA 1VJ2A 4CP2A 1XJAA 4JTOA 3Q8EA 3IBMA 3SXWA 3HQUA 1UZZA 1PZ9A 2DTWA 4AW7A 5FOBB 1J58A 2ZZQA 4YZ4A 1IKPA 4XFBA 4BK5A 3ZFGC 4YZ5A 3MIDA 2RM23 4PDWA 3ZIXA 3ZYFA 4AGVA 5C3RA 4FSJA 2OS2A 2JG8B 4YVWB 2R32A 1C5HA 3VLBB 1JTZX 4C0HA 1ENXA 1ENRA 2P3YA 1PGL2 5FYTA 4KG8A 3CNAA 4LE3A 5CNAA 5K0UA 1AR92 3APBA 3AP6A 3VKOA 5C70A 2J1AA 1W3XA 4KL1A 1QY4A 1S0IA 1XYPA 3RQ0A 1J84A 5HI0A 5JZGA 1GNZA 2IZWA 2AACA 1O91A 1NZCA 1JU3A 1OLQA 2BGCA 2PQSA 4MGSA 4XTMA 1JYXA 4LHLA 4NWWA 5F3GA 4CEYC 3WQ1A 4JHTA 4XZPA 4ASMB 1GWMA 1H1IA 3W21A 4UFMA 1CAVB 1MS0A 1HB1A 2KM2A 3ZFEA 4RFRB 2WS91 3ELNA 1R081 2PLV1 1JOPA 3LWCA 5F9TA 1YQ8A 3PVEA 1VBA2 4P00B 4XMAA 2WWUA 3MUZ1 1RUD3 4FFFA 4QPIB 3GCXA 5JSOA 5FZFA 5FZHA 2WC2A 4A44A 4AQ6A 4CXWA 1JUIA 5D8AC 1YC61 3K75B 4GJZA 1MS8A 1VALA 2WO1A 4AVBA 1VBD1 1RMU1 4BQWA 1DF0A 2X8KA 3I2IA 5GLUA 5F2SA 3BPSA 3USUB 3MFCA 1UPIA 1SLAA 2FCVA 2FD8A 1VMFA 4IEPA 3TEWA 4KMQA 3V0AB 1DP0A 4NIHA 3B94A 4XW3A 2YBKA 1JN2P 3EYPA 2G9FA 3ZMNA 1I6XA 1C28A 2WIIB 2W47A 3B9IA 1YQCA 3I3QA 3I8TA 1H9WA 1ND3A 2LROA 3NL1A 4RQPA 4ATFA 3WG4A 5HBAA 2H0BA 4ONUA 5EFUA 4DRVA 5CFCB 4DXZA 4GULA 2C9KA 1DLLA 2UYAA 2ATFA 1LR5A 1OC1A 1MEC3 2A7AA 3T4VA 3H8OA 5LY2A 3V0BA 1KFUL 5JOZA 5LCWL 4F83A 1ZBA2 5A6XA 1EV13 2J1VA 1W99A 4LOTA 1W8ZA 2ZZJA 3SHRA 4E2SA 4D8MA 2CDOA 4DO0A 4D7TA 1PK6A 2O8OA 5G05L 3B02A 4JRLA 4K8FA 3AX4A 2XR4A 2ZGTA 1RVF2 3ME2A 4OULA 5I93A 1KRIA 2MEV3 1MQTB 3KLSA 2ZGUA 2Z5WA 4YYOA 4EN0A 3B5LB 3U75A 1KQRA 1POV3 2YFZA 5FPZA 4F8AA 3MV01 2VXRA 5HV4A 4B7EA 2X29A 3EMRA 2RS53 4EYUA 5JPNB 3ACFA 3ZXDA 5FV3A 5IJRA 5EYXA 4GKXA 3UGFA 4CP9A 2R7EB 5JSRA 1UF2C 2KA3A 1UD1A 3ZXJA 4CSWA 1IHMA 2NYYA 1Q8QA 2TNFA 3C7FA 2NMOA 1RUH2 3LIHA 2LW8A 3R4DB 4LK6A 3OG2A 4WM8B 4E27A 1UYYA 3QCWA 1FT9A 2XVGA 2WJSA 5F5IA 4RFT0 5K9YA 3PTYA 4NHKA 2EIBA 3PVOA 4D7SA 1OI6A 5J1XA 5L19A 4ZS2A 3MICA 1JYTA 4TYSA 5L7OC 4Q4X2 1T2XA 4BZ4A 5C3SA 1UZVA 2HWE3 5E88A 4HK9A 1LOGA 3DYOA 4Y1UA 3WNXA 1UXZA 4PLNA 2GZWA 1LU1A 2CY6A 2JDZA 4IV1B 1ZBE1 2OQ6A 3W9AA 4QX5A 4AK3A 3UNPA 2ZS6B 2OQ7A 4J6GA 4LLOA 4DY3A 4ZZ5A 4WVMB 1UU4A 2F6BA 2WYFA 5LBCA 3BTZA 2D3PA 2JG9C 1AYM1 1AR72 2QKDA 1BLZA 3AZWA 4Y1YA 4Y22A 2DVFA 3AMMA 4Y24A 5D2AA 5A3OA 5A6YA 2JIGA 4MG2A 1PGL1 1HRI2 1AR91 1IPSA 3IKWA 4QDRA 1AZDA 1UOBA 2GC1A 1G7YA 3A23A 3E6DA 3I59A 4QD2A 1QQP1 1FYUA 3KZ4C 4PQ9A 2H6BA 1K3IA 1ONAA 1TME3 2D6OX 3MDPA 2Z79A 4MSVA 5F1RA 2XUEA 4BQXA 3ZSEA 1K12A 5C4WB 1E5HA 4PCRA 2P4EA 4AFDA 4AE2A 5ANQA 2VNRA 3N7LA 3NJXA 4FCAA 4H14A 1VIWB 4IE4A 1DZTA 3D4KA 1YJLA 2RS11 1J3RA 3QLQA 4M3CF 2K0GA 2ZX1A 2ARAA 4KI5M 2JICA 1S0GA 2RDNA 2X5IA 4NRPA 2YXSA 3SNMA 3GJBA 1AYN2 4G4FA 2VVFA 1AX0A 4O65A 1V6KA 4AR2A 2RHPA 3HBKA 1XBFA 3J4UH 3WSOA 1OD3A 3VZMA 1WCKA 2UWBA 5A6QA 4CCEA 3O1TA 3ZX7A 1R64A 4YW2A 3T0BA 2ARBA 1ASJ3 2DCTA 1RUE1 4CCOA 1NLQA 2DBNA 3L9JT 1RIRA 2ZKLA 3K2OA 5DQ0A 2LUWA 2P3JA 2VZ1A 1X7NA 3K4DA 1GKBA 2OW4A 2YPJA 5DABA 2VZSA 1AR83 2DTYA 4YGCA 5BXXA 5J37A 2Q0AA 5CAZA 3CO2A 3FHIB 4ISRA 3IDBB 4NHLA 2ZX4A 1OD5A 3POJA 3N9QA 5A32B 4M3CA 1UKGA 4Z1VA 1ZBA1 2NP0A 4HSLA 3HR9A 5DUVA 1POV0 2JDMA 2OPWA 2WNEA 2YZ4A 4HK8A 4OQ8A 4ET7A 3ZDVA 3KV9A 4P9GA 1ND2A 4CDWB 5LK5A 4AEDC 1H1AA 2VOWA 4GH4B 4HKLA 4BE3A 5CG9A 4S2DA 5CB7A 5BYNA 1EYBA 1XE0A 1PMIA 1OKOA 1OMIA 2P3KA 5FQ0B 1U5XA 4W4ZA 5CG8A 4K21A 3MLJA 4E2GA 2DVDA 5KHIA 1OH3A 3NRUA 3FMGA 4XBQA 2VJXA 2ZGKA 1HXS2 1UX6A 4YVSA 4AQ2A 1S1AA 5GM0A 1X8EA 2E7AA 2JIJA 3E1F1 4UFLA 4YGEA 5ABJC 5JWPA 2BYVE 4N43C 1NAEA 1W3VA 3BB6A 3OSDA 1GICA 2HYKA 3NNFA 4PF5A 5FZOB 5GLWA 5LASA 3ZXAC 2A3YA 3O1VA 3M3CA 1VBB1 2GN7A 1TNFA 5FXXA 3VBUA 2UWCA 1DGWA 1SACA 1W0NA 1QXPA 2W3JA 2CDPA 3FUOA 4JV4A 3N36A 2VNGA 1QJY3 5DXDA 2WNVB 2V4AA 5FKBA 2OX0A 1UPSA 2R6QA 4NO4A 3T2PA 4CCJA 4Q0PA 4XJUA 1KITA 4Q4X1 4FP3A 1V9U3 4XIOA 4H2AA 5FP4A 1P8JA 1RJ7A 1VB4A 5C9AA 1UMHA 1ZZ6A 4YNIA 5IVCA 1PZ8A 2VMDA 1DZRA 2WNUA 2Q8EA 1RUJ3 2WYSA 1JMUB 1W0OA 1ULOA 3WHTA 1LOFA 2OZJA 4J1XA 1VRH3 1CIYA 2ET7A 3UT0A 2QQWA 2N7GA 1PX4A 1W2AX 2VZQA 1QXJA 3WXPA 4QGLA 4IDZA 4LK7A 4YW1A 2HWB3 1RUF1 3DCQA 4MX3A 1OHFA 3ZKYA 2W9XA 3PL0A 2CL2A 4JAAA 3MV11 2WRAA 4CRQA 4PDWB 4FBFA 3DPRC 4R9CA 5CYYA 2QQUA 1GZCA 2P2KA 2EIEA 1G9DA 2VAUA 2GC0A 3U07A 4RR3A 2HYXA 1UU5A 4CUCA 1C1FA 2QCSB 4K20A 3FFZA 2Z2SB 3P5BA 5K0UB 1U5IA 3VKNA 4BCUA 5IK5A 3LA7A 5IVBA 5JZGB 4B4PA 1FPN1 3KHBA 3POEA 2YY1A 1W8OA 1KDMA 2C0ZA 2D44A 4GWIA 4DUXA 3A0KA 5K8SA 1AYN1 1W8WA 3D0SA 5LBEA 4FTBA 4DXTA 4CDUA 2LM3A 2F4LA 4AG4A 1CJDA 3O1RA 2ZGQA 4IEOA 3ZFEB 2OIIA 5M0TA 1Y3TA 1DFQA 4WVWA 2YROA 4RA0A 3PJQA 4JTNA 5LA1A 5FY7A 3T4HB 2W1UA 1OVPA 2J1UA 4P9XA 3MLLA 5EPAA 3ZXFA 1V6NA 3H42B 5C5TA 4FTSA 4DXSA 1Y43B 1RHI3 3J7LA 4UW5A 1U12A 4BH9A 4XUOA 3DEMA 4Q26A 2VTFA 3CDZB 3TN92 2EA7A 5JOWA 3IZOA 1LAJA 1QDOA 2A6ZA 3WD5A 1QJZA 1QJU2 4BK4A 3ZOIA 4TTGA 2WQ8A 3KV4A 4RQPB 4Q1RA 3BKZA 4GWNA 4META 3AYCA 5FZGA 4LBOA 4CXXA 4AFBA 5FZIA 4RS5C 4FTEA 1EUUA 1W04A 2DCZA 3A7QA 2WL1A 1VBC3 2XXZA 4Y20A 5H9RA 3VDAA 2RS32 3V0BB 5FJKA 1GWKA 4ZU5A 2DFCA 2B39A 4LO4B 2CGOA 3DL3A 3U4XA 3BTXA 4W8JA 4QPGA 2FBEA 2RMU3 2WZEA 1C8M2 3O1SA 3OPWA 1UOGA 1PK6B 1JW6A 2ADDA 4W65A 4MADA 1UU6A 2K2SA 3M8LA 5BNOC 5GZGA 5J96B 2GN3A 2F17A 2HBTA 2W68A 5I0SA 1GOGA 1NLRA 2HEYF 2Y38A 4QAWA 3ZXKA 1LCLA 1EPZA 2JE8A 1JZ3A 1RYYA 5FPUA 3CJIA 4QGMA 4NOTA 3FHQA 2H0VA 2VZTA 2PHLA 4AGRA 2XLAA 2DUOA 3IMMA 4CP9B 3J8F2 5FY9A 1LHUA 3VBOA 1AR82 2V09A 4LBKA 4QWNA 4YW4A 1SEFA 5F2WA 4E8CA 2A3XA 4XF4A 4HVRA 4MGZE 3ZYJB 1DGRA 3K51A 3ETPA 4MXWA 1OLRA 3O14A 4AVAA 1BK1A 4HKWA 2ES3A 2WO7A 4P9LA 2E53A 4KU8A 3U78A 3BOPA 2E7QA 4TZDA 2WS93 3H1YA 2PLV3 3RYPA 1RUG2 4LT5A 1O4TA 1W2TA 3POIA 2GMMA 4MLOA 2BTVC 3N3HA 1WGPA 1W8UA 1TMF2 3NMBA 2YUEA 1WW4A 1JZ8A 4K40A 2WT0A 1KS4A 5FK7A 5EIYB 3GZUC 2QQIA 2WLQA 3HVDA 3ZIWA 1RMU3 2VG9A 4OUSA 1G86A 4HETA 1MS4A 2JE9A 2UU8A 3BODA 3VUOA 2WWSA 4OZXA 3LEMA 2ZX2A 3B9CA 2DDUA 4LHSA 1AVBA 4Y22B 5EV7A 1W6QA 1ZRDA 4DFSA 2BGOA 1GMMA 4ASKA 3CLPA 3HD8B 3N9OA 5A1LA 3RZHA 1S0EA 1X8MA 2JDAA 3PVNA 2JB4A 4A45A 3I59B 2X09A 1ZZCA 4FPFA 4PQQA 2BBAA 4XFCA 2EVXA 1NA1C 1FXZA 3UKNA 2QQMA 1QJY2 1EAH3 1ZA7A 1IZ3A 3IDEA 3G6JB 1FMD3 4SBVA 4ZXEA 4QKFA 2VXJA 3TNQA 4F3JA 4YG6A 3RS6A 4I09A 2D43A 2Z4FA 4CEYA 3ITQA 4V2VA 2A6XA 2LTNA 3WW3A 3JD72 3KT1A 4C1WA 2DU0A 2VPVA 1I5PA 3OPZA 1VPHA 1W05A 4PIXA 2VCMA 2C26A 4Q0SA 2EAKA 3WUCA 4DEQA 2AYHA 2ZX0A 4NRMA 3ZSLA 4KH9A 1OUSA 5JIUA 4TSVA 1ZRFA 1SG3A 1D4M1 2XLFA 2XUMA 1NY72 1LRHA 5D8AA 4MGKE 3I2JA 4NMIA 3TN91 1WKYA 1RJ8A 4OI2A 4BQYA 5DDJ3 1QNYA 4JGZC 5CISA 1XSQA 3OEAA 1US3A 3RZGA 3TOJA 4FOWA 1BXHA 3VD7A 2GAUA 1VR3A 4HN0A 3AXEA 2R16A 4Q1PA 3I3DA 4OLLA 1PIV1 4QX8A 4GWMA 4LKFA 2DCJA 1VMHA 2R0HA 2C24A 2RDQA 3DUIA 4DQAA 3HN1A 3ZXLA 1W06A 3PUAA 3VN4A 5IK4A 1R1A1 4GMP1 4JDNA 1X33A 4Q4Y1 4YZ3A 5AVPA 2AZ5A 3AK0A 4M3CB 1N47A 5GLTA 2NQYA 1NXMA 4I02A 3VZLA 3BALA 3WF3A 1KDKA 4PJYA 1OOPC 2QZ3A 2VUCA 1A8DA 2D5HA 2VMHA 5T5OA 1C8M1 1SQ4A 3SLIA 1PVC1 4CEWC 3E97A 1ND2B 1BEV2 2XBO1 5FBZA 1ZBE3 4N53C 4UW6A 1DGWX 5SV8A 3DF0A 1BHGA 4XJ8A 4YGDA 4QM8A 1OA3A 1AYM3 1PHMA 3IPVA 4YVSB 3WW1A 4DUVA 3S57A 3S6PA 5IWFA 4DUWA 4ORFA 4CXYA 2G9GA 4O9EA 2BQPA 2PAEA 3CL1A 3UYJA 4QQHA 1JS9A 3K48A 4GXLA 1QQP3 2MPFA 3IWZA 1H4HA 2VVDA 3VBUB 3LGRA 5GKAC 1LB2A 2KXLA 1O4ZA 4BPZA 3OBZA 1Q8OA 2CGPA 4PI0A 4XOGA 2A1XA 3VB9A 3NAPC 3BYWA 2PTMA 1AXZA 1DYPA 5H9PA 2DCKA 5BUVA 1OLMA 5KR7A 1Y9MA 2VQTA 3ACGA 3MIFA 2W5FA 5J98B 3RYKA 3ZVXA 4WBBA 3WDWA 1CAUB 1OH4A 5L7OA 1J59A 1QJFA 2TBVA 2B9VA 2RS13 4NROA 4NIAA 3VHOA 5C9AB 1HW5A 1TMF1 1WA4A 1Z7S1 1U5YA 2O1QA 4MGIE 5FZ0A 5BPXA 5L73A 3UETA 5F5QA 1LTEA 4OHWA 3AZYA 5LEKA 3ILFA 2RMU2 4QKDA 3HPNA 2E6VA 4UYBA 2AUYA 3UESA 2FZ2A 3IM0A 3WW4A 2XGXA 2QNKA 3INAA 4LEJA 1YI9A 2JECA 3P3NA 1H2KA 3H3LA 2IC1A 3MW3A 2JG9A 1PX3A 3MIGA 3WF4A 4CU6A 1O59A 3Q8FA 2XVKA 1RUI2 3PDQA 4Q4W2 2XQRA 5I0UA 3K3OA 4AVVA 1RUE3 4AVSA 2ZGRA 2YFUA 1GZ9A 4BU2A 2G9ZA 2J22A 5J7MA 5FYHA 3DN7A 1SCRA 1HIXA 2V72A 2NLRA 3LOIA 5DZFA 4CCLA 2HEWF 2EALA 1SPPA 2W87A 5LA9A 3WR0A 3KVAA 5LBFA 4GD4A 3T30A 4RR3B 1AL22 1QMJA 3VKLA 1K5JA 5GJ6A 1WCDJ 3KT7A 4K3UA 4LO5B 1CONA 2Y33A 2W52A 3MUY1 1BMV2 4FPCA 3AMQA 4XFIA 2V73A 4XHBA 5C7GA 5F5CA 1HRV3 5HCAA 1PO12 2VQUA 4WM7C 4FQ4A 1UXXX 2QUOA 1DQ4A 2OPKA 2IVJA 1X9PA 5FZ7A 4CDUB 1SZBA 1IKQA 4OQ9A 3OEBA 5IATA 2DCYA 3RZZA 2XPJA 1HX6A 1PO23 1XNAA 4I0WB 4QXHA 5FZCA 4AZZA 5F39A 4CP0A 1X82A 3RWKX 4Y5SA 3GBWA 3MO4A 4QX0A 5ACA2 2EICA 5A7WA 4H55A 3PMEA 4QU1A 2E51A 2BWCA 5FMBA 2P5BA 4WVZA 1JYIA 2Q1ZB 2DF7A 4Y5Z0 1F4HA 3UK9A 3H9AA 3PLQA 2R043 1VBB3 3OUIA 3B93A 2DU1A 2R071 4K9SA 3VD5A 4HONA 1Q43A 4IGOA 5APAA 1WCSA 2K9ZA 2WAAA 5FZ1A 3WLUA 1EAH2 2G4IA 2QQKA 5I91A 3BI3A 3MBWA 3VDDC 4XXPA 2OA2A 3AYEA 5FPAA 3ZSJA 2ZGLA 1DQ2A 3WVJA 5AC92 1BEV1 1BK0A 3MIBA 4QB1A 4Y20B 3V65A 5A3TA 5CKQA 3LFMA 4OHZA 1AHSA 1NCRC 1SLIA 4AEDA 3A0NA 3NNGA
chains in the Genus database with same CATH topology
3D82A 3NVCA 2CAVA 2DFBA 5A33A 1AR61 3AP9A 1RUF3 1K5MC 1SMVA 1BBT1 5ABJA 3ETQA 4N43A 1YFWA 4E9KA 1RUC1 1U0AA 4N9IA 3CJIB 4ZKTB 1GZWA 2QVSB 3KT4A 3M3EA 3EHKA 5DZGA 3T1LA 4FVVA 1ULFA 2ZOEB 2WZR2 4HPKA 1HKDA 2QDRA 2WFF1 1IOAA 4B8EA 3SH3A 2MNGA 4HZFA 3VBOB 3ZYIB 4LBLA 1FPN3 3FFQA 3PNAA 1FAYA 2D93A 3WG1A 1C5IA 4MXWB 1APNA 3R0RA 3OBRA 4P14A 2FHRA 3I7DA 3O7OA 5KXCA 2XL7A 3WOGA 1PGW2 3LKJA 1LEMA 4PBOA 4FXGB 2VMGA 4FP2A 1SLLA 3H50A 3OD4A 2TEPA 1BYHA 2ZAAA 2ZGNA 3ZPYA 4NN0A 4QPIC 4YM3A 3AM2A 2RR11 2D5FA 1AXKA 3TRSB 3VL9A 3WY6A 4DY5A 4W6XA 1DQ0A 1A3KA 2P17A 5JR7B 1S0FA 2E9QA 3DPRA 1W6QB 3RJRA 3AMHA 1NQJA 4EWDA 4Q0QA 1AX1A 2CTVA 2UWAA 1I1EA 4FO9A 2W39A 1V6OA 1VBE3 1HV1A 2IWGB 3FUQA 1PO11 2ARXA 1HLCA 2OYZA 5CFCC 1NCQC 4KWLA 1CVNA 1MVQA 4CEYB 1LJ7A 3LSEA 5CA6A 3MF6A 1DG6A 2D6KA 2VUAA 1F9KA 1JUHA 2QJVA 4YGBA 3VBFC 2YV8A 2HWF2 3VBHB 2R062 3B69A 3VBSB 5D8AB 1V6JA 2WQZC 3MFAA 4P5HA 2D6LX 5C33A 1RGSA 3N35A 1D0HA 2GALA 1CPNA 4UBHA 4E4ZA 2I74A 2YGLA 4V1PA 2VU9A 1HQWA 5GZDA 1IPKA 3MPBA 5BNPC 3AB0A 4XJAA 4RS5A 3HT1A 4WM8C 4X8NA 1OA2A 2YHJA 4Q4V3 3C3VA 2I07B 2GC3A 3VHRA 4PBPA 2BFUS 4JGYC 1QOTA 1BQPA 2Q5TA 1NOVA 2B5HA 5EWSA 2YC0A 4AQTA 1JBCA 1AUYA 4BIFA 3WHUA 4EJRA 4Q2FA 1X36A 2C1FA 2XJUA 4LUMA 4A7YA 4RHV1 3MGUA 1PO22 3O0VA 3PMSA 3ZYGA 5JSOA 2ZCWA 4L11A 3R4SA 5DUUA 2HWC2 3D6EA 5LRRA 5FLHA 4AFCA 4EN7B 4ZU4A 3IPVB 3PJYA 4FOVA 1AF9A 1E57A 3BTAA 2GNTA 5FO9B 1UKRA 3KCYA 4WZFA 4FT8A 2A71A 1OA4A 1SBFA 4OVEA 1B09A 4XFAA 4DRRA 4XTPA 2QQPA 1QU0A 4O9GA 4QPYA 2D6MA 1QJX3 2ZMLA 1CAXA 2EXKA 4A7KA 5CFDC 4LBJA 3GHMA 5FREA 5C4WC 3WV6A 1H2LA 1GR3A 1PGW1 5BY5A 2O0OA 2A70A 5L7OB 3RDIA 1ALYA 5FRAA 4GB32 1C8NA 1COV2 3NKGA 2ILMA 4JRAA 5BNNC 5KHKA 3J9SA 1OQEA 1D4M3 2WKKA 5GZEA 4XQ4A 4IV3A 3THPA 2ZGPA 1VBA1 4CP1A 4KBBA 3WDUA 1O3SA 3NO8A 1MACA 2JG9B 2Y0IA 5C8WA 4IEXA 4OFGA 3RWNA 2ZMKA 3RG0A 1EY2A 4QM9A 1H8TB 4K1ZA 1NYWA 5GLZA 2VH9A 4XBNA 1KFXL 3ATGA 4OHXA 2WT1A 3GBFA 4GMP3 2RM22 1ENQA 2DVBA 2ZA9A 2XB6C 4FPHA 1SLBA 4Z8BA 4BYYA 1VB2A 4XJWA 1GYKA 1PVC3 2HWD3 1J1LA 2XBO3 3VL8A 5KHJA 4CDWC 3SCGA 4F7ZA 1LHWA 1PZ7A 4B3NA 3ZFFA 1IS3A 1RVF1 4JGZA 3HMYA 3RPQA 1RUD2 3SCHA 3KQRA 5IK7A 4UXAA 1JH5A 5J36A 4KNCA 1RINA 5CADA 3WZ1A 1OPMA 2WQ4A 3WW2A 1VBE2 2EAAA 1RUH1 2VVEA 1FOD3 4K6BA 1GFF2 2RJLA 4JCKA 1Z7S3 4IQPA 4UBGA 4A2UA 5I8TA 2ET1A 5GALA 4CEWA 1BVVA 2B9UA 2JENA 4AEDB 1LHOA 4N53A 2E63A 4MZUA 1MEC2 1WMFA 3AKSA 1V6MA 1TQ5A 1HQNA 2VGDA 5A33B 2Q4SA 3OJBA 1EV12 1AXYA 4L9BA 1Y9QA 3BOWA 5T54A 3V64A 5ABJB 1DIWA 3JB8A 3AJYA 4BMBA 4N43B 3JBG3 3E5UA 1AR71 4EN9B 5KXDA 1GZWB 3FE5A 2BWAA 3SMHA 2MEV2 2BVBA 4MGYE 5L36A 1HRI1 3GBGA 4HPKB 1LHVA 4KGGA 4S2HA 3NAPA 4E2QA 1Q3EA 2RS52 1W6NA 5FFOC 5C8CC 4GB31 2XG3A 1COV1 2DV9A 2Z69A 4XF3A 4XIKA 3HAGA 1Y7BA 1JXNA 4PLMA 3N7MA 2NMNA 3EO6A 3CF6E 1A6CA 3KB5A 5C6CA 3BU7A 1S55A 5LRSA 3I2DA 1NLSA 1XRUA 4GMP0 4RGGA 2XL9A 4DZGA 4Q0VA 2BNOA 2HWE2 5AFBA 4RD7A 5A3MA 4N90A 4QMAA 1GANA 1KXGA 1QF3A 3UJOA 3TYJA 2GNDA 3VHNA 3DPRB 4IEZA 4YG0A 1REEA 4HFSA 2R073 5I0RA 1ZVFA 4HN1A 2IFRA 3S7EA 3T2TA 1MZFA 1QOOA 1X50A 5EZWA 4Y1XA 4MYEA 1QJX2 2PHDA 4HSJA 1Q8PA 2DURA 1CGPA 4WM7A 4XEZA 1ND3B 1LESA 1TME2 4WZCA 3H1MA 1IPJA 4B4QA 1AR63 1XNBA 2GH8A 1GQHA 1R093 4YLZA 4COYA 1M4WA 3AZXA 3FLRA 1AJOA 1TE1B 1LKNA 1BBT3 5FAXA 4BIOA 3H7YA 2IXKA 3ASIA 1HXS1 2PN5A 2PHWA 2XJTA 4Z92B 5JDBA 1RB8G 3FLPA 1UAIA 3QH7A 2WFF3 3U11A 3NSTA 2B46X 2QE3A 2HEVF 1ASJ2 1RL3A 4AGGA 3H0OA 4LE4A 3VDDA 4RL7A 3WDYA 1XYOA 1QXRA 4I30A 1IS4A 4JDOA 2VOKA 3LA3A 4U2AA 4A7ZA 4KWJA 1NCRA 1WMDA 1GNHA 2VECA 4L8QA 1OKQA 3RJ2X 2X53S 3VBRC 1LULA 1SLCA 4MVTA 4LO8A 1B35C 2RR13 1LHNA 2A6WA 1R083 1DQ5A 1WD3A 4YM2A 4CDXC 2PA7A 1K5MA 2ZAHA 1XU2A 2D3SA 3E6CC 2MEV1 4R4XA 3FZ3A 1LU2A 4XE9A 4AEMA 4LULA 2FMYA 5LK7B 1VBD3 3KGLA 1Z78A 2NPIA 2CV6A 3CJXA 3ZFGA 2XKPA 3GZTB 2EXIA 4OI1A 3AYDA 1CAWA 3R05A 2GMPA 3MI8A 1CAXB 4XHXA 4HVOA 5JI7A 1G9CA 3S30A 1FOD2 3FWEA 4XMIA 3GALA 5B2GB 4XFFA 4I0AA 3SH4A 4XJ9A 3IN9A 1GQGA 4FXKB 1REDA 4C90A 2VOXA 2GNMA 1V9U2 2HWE1 4LHNA 5F1RA 1FNYA 1V6LA 1VAVA 3LB9A 4IEQA 1PM7A 2VOVA 4QPIA 2ZGMA 4IV3B 1DU3D 1J3PA 1FNZA 1SFNA 2W0XA 3OYWA 1RUJ2 1G6NA 2X5IB 1F5JA 5I8SA 1VRH2 1FV2A 2D6PA 2QFEA 4GA9A 3V0AA 4IEWA 3FBYA 2HWB2 1OFNA 1H2NA 1NXD1 4CZSA 1REFA 3AKPA 2BFUL 1WBFA 3VZJA 2VW0A 4R8HA 1QJU1 4TWTA 1BKZA 3IDCB 4UW3A 1SDWA 2B45X 5CFCA 1TME1 1NCQA 1Q8SA 3AP7A 4OHVA 3N4MA 4COWA 1QKQA 4I0BA 3WCSA 1LEDA 2AREA 1G9FA 2BNMA 4HL0A 4JVAA 2RS31 4QU2A 3WINE 3VBFA 2R30A 4OI4A 2AH2A 1GSLA 2BEOA 5CU1A 4DNYA 1KJLA 4YSFA 3OF1A 3FLTA 3ZFFB 4FPJA 4JGZB 3OGJA 1YFUA 2SBAA 2IXJA 4HKOA 5BV6A 1OPOA 3AFGA 4KGQA 1WLCA 1KJRA 2XH6A 4ATEA 1YIPA 3MYXA 1RHI2 3H3ZA 2CNAA 5IUQA 1G9BA 3QH6A 1AR93 3O0XA 5BNPA 3D5OA 4FQZA 3J8F1 1D4VB 1AR81 2TUNA 4S2GA 4LBQD 3HIFA 4K7JA 4JGYA 2YDEA 4D7YA 2XWJB 4YG3A 4LBQA 4YW5A 5IT6A 4CEWB 1GLHA 4M0NA 1S0CA 1MS9A 1C3HA 1H8VA 1RUG1 2FMDA 4YARA 3WQ7A 1VBA3 1VBC2 4IXLA 5JAXA 3QOPA 3H8UA 4Y4YA 3QACA 2D7FA 3POYA 4QQ2A 2WNUB 4PLOA 2ZGOA 4YRDA 1G9AA 2IXCA 1YHFA 1A78A 1WUVA 1QWRA 4R52A 5T52A 1O3TA 3M70A 4C1XA 2OZ6A 1CX4A 3WG2A 4XQDA 3GHNA 2F4PA 1IS5A 1S2KA 2XJQA 3LAGA 3R6SA 3ROUA 1LOEA 3POSA 4PIZA 3NAPB 2WA3A 1QJY1 1O3QA 1W6NB 1AX2A 2V5YA 5CFDA 5H9QA 2VMIA 3ACLA 1WBLA 1AJKA 3KGZA 2FZ1A 3U0ZA 1UIJA 1ZBA3 3JD71 2EIGA 1F5FA 2BNNA 5BNNA 2ZBJA 2IFWA 2DWRA 4H7MA 3AYAA 4TLFA 3SISA 2JXAA 1YXWA 1S0DA 2WS92 3ES1A 2PLV2 4FPYA 3TAYA 1BZWA 3OCPA 1NY71 5GZFA 5K7PA 4U36A 3N7KA 1XE8A 3ES4A 2RE9A 5KBFA 1RMU2 2BW8A 5J48A 3BPZA 2ETEA 3O5SA 4Q0UA 1XU1A 2P34A 2CAUA 3AFKA 1DYKA 1YYNA 4HBNA 4BWOA 4YM1A 1SBDA 1YWKA 5A32A 5EXOA 1VLNA 2D97A 4DPNA 5E8AA 4WM7B 3M3IA 4Q4X3 1FMD2 4EWEA 4CDWA 2Q30A 2JKBA 1WW5A 2NZ9A 3AZZA 4B7KA 2XJVA 2A75A 4DINB 1UL9A 2ZMNA 5KC5A 4CDQC 5GLVA 1DDLA 3H3UA 4JDMA 1XQNA 4QPGB 1AR73 3M4FA 1CD3G 1QOSA 1XYNA 2NM1A 3AZVA 1RHI1 1HRI3 4XXAA 1XNDA 3HT2A 3UKVA 3JZVA 5BNQA 3C2UA 3E5XA 3AKTA 1W6OA 4FPOB 2PHUA 5DDJ2 1RUOA 2ZJCA 3M3OA 4BOWA 2WINB 3A4UA 1QH6A 1EPWA 4X8PA 1W0PA 3BCWA 3KCCA 2JG8C 3ZN5A 3U10A 4YVWC 4G9SB 3URFA 4DMIA 1CIWA 2XWBB 2R1BA 1WW6A 1OFSA 1FV3A 3VV1A 4LUKA 1BVP1 3WCRA 3WDXA 1GV9A 2VQAA 2PELA 1AYN3 3R4UA 4HLTA 4C91A 1J3QA 3SCFA 1FX5A 3RMYA 2XHKA 2RMU1 4XF9A 1K5MB 1ZNPA 1ZBE2 1XNCA 1F2NA 1RUI1 3MF9A 4Q4W1 2HKXA 1T6GC 3VZNA 4BLIA 5DG1A 2EF6A 1AYM2 1W6PA 2VULA 5CBLA 3RRDA 4EWAA 3ZFGB 2UURA 3ZXGA 2ZTNA 3B3QE 1CAWB 2YYOA 5C8CA 1AL21 2PYTA 4M3CE 1QQP2 1NQDA 1JYCA 2DVGA 4NR1A 1BMV1 3RNSA 2PQQA 4NVPA 3TBDA 2GNBA 1F8VA 4URTA 2Q1MA 1CN1A 3JUUA 4OHYA 4Z07A 3JCIA 4QQOA 2XJRA 3VBHC 2RS12 5JLVA 3EQEA 1HXS3 3OYWB 3VBSC 3ENRA 5ACA1 3UKTA 5FPXA 1O5UA 1DBNA 5A3LA 3JU9A 3SITA 1MQTC 2MHFA 4Q27A 4OUMA 1LENA 4GQ7A 3MPPG 1RUE2 4L97A 4MXVA 5T5LA 5E89A 3WP3A 4AFAA 3W58A 3M3QA 2P37A 4LLFA 1Q56A 2BUKA 4CYDA 1EAH1 1NCQB 1FMD1 2B8MA 1S0BA 1C57A 4YW3A 2PAMA 1MR5A 3FC0A 5AC91 3DGTA 4JC1A 1H2MA 1N3PA 1LOBA 1TNRA 3OGGA 3WDVA 3VBFB 4AFMA 5JOYA 4FAHA 1HRV2 2A73B 4UW4A 1DGLA 4GKYA 2HJIA 2A3WA 4IEUA 3ZYRA 5JPMB 2R49A 4FPGA 3FX3A 4M01A 1MZ5A 1S0JA 5H9SA 2WLPA 5E16A 4IV1C 5DDJ1 3P3PA 5T5JA 1ZZ8A 2PAKA 3EBRA 1OSGA 5BNOA 2CWSA 5FMOS 1W6MA 1ULCA 2PFWA 5DZEA 2A6VA 3UJQA 4M0HA 3TNPB 5JOXA 3WP6A 2WZR1 5SV5A 5BNPB 5KXEA 3B7MA 1N1VA 4GIQA 2R042 4QT6A 1VBB2 1HQLA 2P3IA 1CR7A 1WMEA 1YI7A 4N7UA 4BQ1A 1UIKA 1D2QA 4R4ZA 1JHNA 2YMZA 3WX5A 1O3RA 2VQ0A 4JGYB 3D0JA 2IXLA 4CTEA 1Z0HA 4LBQB 3VBRA 2OVUA 2QZ2A 4ZXKA 3H1WA 1B35A 1N1YA 4QXKA 1LODA 4X6RB 4B4RA 4ES8A 1O5LA 1CPMA 4CDXA 3CEWA 3KD4A 3VZKA 3NWKA 4XBLA 3TN93 2ZPXA 2Y26A 2VW1A 1RUF2 5FO7B 4AF9A 3M1HA 1H1MA 1IQAA 1H8TC 2CGNA 1QJU3 1V6IA 5KC6A 3E6BA 1PIV3 4K1YA 4LTAA 1FI2A 5CFDB 5J09A 1EP0A 2AR6A 1NA1A 5LEJA 2ZHNA 5GZCA 1R1A3 3D8CA 2ZACA 3HBZA 4R9AA 4AYUA 2RS33 4Q4Y3 1N3QA 1M06G 1FPN2 1C4RA 3S7IA 4LBMA 3M7AA 3B00A 5BNNB 3OY8A 2IXHA 1C8M3 3PHMA 2HWF1 5EYYA 3OBTA 4EROA 2R061 4LA2A 2CYFA 3HQXA 2XLGA 2DVAA 4GH4C 4SLIA 4L99A 4DB5A 5I8YA 4IEYA 5AVAA 4RGAA 1PGSA 4ISQA 1JOJA 1H9PA 1OQDA 1ZA4A 3J8F3 3M2MA 3N7JA 3ZYPA 4L92A 4D69A 1H30A 2R1DA 4LO6B 3NV2A 4IERA 4HT1T 1MZEA 1A8MA 3ZXEA 2I2SA 2WNVC 2WA4A 3RYRA 1DGRN 1YRZA 1HRV1 1CESA 1RUG3 1ENSA 4NHMA 1KS5A 2D3RA 1MS1A 4KG0A 1YFYA 4BM8A 1OOPA 1TMF3 4EN6B 4D94A 1J1TA 1I9RA 1PO21 1IS6A 2YGMA 2HWC1 3W59A 4A3XA 1XXNA 4IETA 4HMZA 3AXDA 4M00A 2ZABA 4XETA 3NV3A 4EN8B 1WD4A 2XKOA 2OUJA 4INDA 2R041 1QNWA 5FDBA 1NE4A 4AHWA 1W6OB 1YJKA 2WZPP 1SCSA 2IXIA 5FO8B 2DYCA 2ZHLA 4PDWC 4YFWA 2XJPA 3EXUA 3JD73 4YM0A 1CAUA 5T3NA 1ZX5A 1C1LA 2SLIA 5JMCA 5K0UC 1UMZA 5JZGC 1D2SA 2B42B 2PHRA 4Q4V2 3KCXA 4XQWA 1N1SA 4FOQA 4COUA 1BCXA 1CJPA 4HANA 3LCPA 3ZFEC 5TSWA 4H3WA 1QHDA 1VP6A 4AEKA 2EXHA 2XVLA 5KXBA 1PNFA 3O12A 3ILRA 5T55A 2JEMA 4BMEA 1W6PB 2ZX3A 4YFZA 5HXVA 4NPRA 4LHKA 3EJKA 1O7FA 3AJZA 3RSJA 4IEVA 1ZRCA 1RUNA 1WLTA 4AWDA 5C8CB 2RM21 2ZGSA 2AGSA 2DUQA 2VUJA 5T5PA 1ZZ7A 1DQ1A 1IGOA 4RQPC 1ND3C 4BA6A 3RI8A 1BEV3 4QGNA 4Z2WA 1WW7A 1DQ6A 4AQSA 4I2OA 4Q29A 2XJSA 3NKTA 1ZREA 2A6YA 1ZYBA 5IK8A 4KQ7A 1YIFA 3WT3A 2A5ZA 1D4M2 4S2FA 2ZKNA 4IESA 2BPA2 1PK6C 3Q9OA 1RUD1 1W2UA 1RUC3 3ZN6A 1NE6A 4COVA 3ALQA 1G8WA 5DG2A 4AEJA 3VHPA 5FOJB 1PIV2 1QH7A 1VBE1 1DHKB 1NG0A 1UW8A 4AI1A 1R1A2 3CU7A 4AXOA 4Q4Y2 4RS5B 3AP4A 4KU7A 1N3OA 3NV1A 2GSYA 1MEC1 5KHGA 5DUXA 1PVC2 2HWD2 4XFHA 2LALA 2XBO2 4H7LA 4CDQA 1UZYA 4WVVA 1RUI3 2W08A 4Q4W3 3QD6A 1EV11 3HWJA 1F31A 2UY8A 4FPLA 5BNOB 1YUDA 3AP5A 3GZAA 3E5QA 1W6MB 4E4SA 1XE7A 3FJSA 3GNEA 1FATA 1AL23 2R0FA 1POV1 2JG8A 2BVVA 2AENA 4YVWA 1URXA 2RS51 1TEIA 4MUVA 1MVEA 4FAGA 2GDFA 3NJZA 1PO13 4Q4V1 4AI0A 4LR4A 5FLJA 3VBRB 2GMEA 4I3PA 3JQXA 4HVQA 5CVRA 1B35B 3VKFC 3GYDA 1ZRRA 3UV9A 1Z7S2 3IMNA 4IV3C 1CAVA 3PVBB 4QQPA 3O0WA 4CDXB 5ACA3 3S0MA 2C9AA 4N7IA 2WFPA 1VAMA 2VW2A 4XYXA 1ULGA 4J1WA 5KWRA 3MZHA 2X5IC 4AI8A 3NV4A 2C5DA 3ILNA 5F6KA 5I0TA 4XILA 3WG3A 4P9IA 4COZA 5E1RA 3WDTA 1VAKA 2JJ6A 5EJ3A 4Y1ZA 4G3YC 4P9YA 3USUA 2JE7A 3JBG2 3AMPA 3OTFA 4QQLA 4QHBA 3ST7A 4Q8KA 4MH0E 2WSVA 4LA3A 1QJX1 2GU9A 1NA1B 4DS0A 5AC93 5J3UA 1YNAA 3WQ0A 1U5ZA 3ZMOA 4AI3A 4R9DA 1ULEA 4XF0A 4Y1VA 3OY8B 1LGBA 3RMXA 4AHZA 1V70A 2NN8A 1RITA 5F6LB 3VBHA 3L2HA 1Q5OA 1LOAA 5JVVA 1D0GA 5FMOL 3VBSA 1HDKA 1RTVA 3MIHA 1ND2C 4RHV3 3ZFFC 2JX9A