4HVRA

X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 34
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvrA01
4HVOA 4KWJA 1CAUA 3U11A 3JZVA 4LULA 5I0SA 1OI6A 3L2HA 4BHPA 3CO2A 5LEKA 3M70A 1RC6A 4AQ2A 2PTMA 1IPKA 5EZWA 3HT1A 3E6DA 4Z82A 3H7JA 2H6CA 5KBFA 4HVRA 1PMIA 1CGPA 4XF1A 4HMZA 1J3QA 5I0UA 2GC1A 4E2GA 4PIXA 5JCTA 4ORFA 2O8QA 2OPKA 3EBRA 2QCSB 4EWAA 1DGRA 4KWKA 3GYDA 4YYOA 1NZCA 1FXZA 3WW3A 2I45A 3UKNA 3HQXA 2XLAA 5LEJA 3NVCA 4B29A 5CADA 2BNMA 4LUMA 2BNOA 2Q0AA 1UIKA 3EHKA 5FLHA 2PHDA 3G7DA 1OFNA 4BH9A 4EROA 2PHLA 4IEOA 2PAMA 1QXRA 2Q30A 5C8WA 3RPQA 2OYZA 1DGWA 5KHKA 1XE7A 3BCWA 4Q0UA 5E1RA 2C0ZA 4HN1A 2Q4SA 3ROUA 4GULA 4EWEA 5K8SA 2IXCA 2MPFA 2BGCA 1ZRCA 4IEXA 4XFIA 4HBNA 3BALA 5I8YA 4MZUA 1YHFA 3RYRA 1Y3TA 3I59B 5FQ0B 4XEZA 3MDPA 4O9GA 3USSA 4WBBA 4Q29A 4A2UA 4AXOA 4PJYA 3NW4A 4L11A 4UBGA 2N7GA 1RUOA 2OA2A 2XKPA 4XFCA 3PLQA 5FLIA 1RGSA 3RNSA 1ZRRA 3NSTA 4I0AA 5FQ0A 4QGNA 4P9GA 3CLPA 1X8MA 1Q43A 1DZTA 1YFYA 3EJKA 4HVQA 3U0ZA 3OD0A 1OMIA 4YSFA 2QVSB 1ZX5A 1YUDA 3DL3A 2IXLA 2GH2A 4JTNA 1VP6A 5FPZA 1V70A 4I3PA 4MGZE 4JTOA 4QGLA 2ZKLA 4IEQA 2QDRA 3TNQA 3OGJA 3IWZA 2PA7A 5I8SA 3SCGA 3LWCA 5JSOA 3KSCA 4IESA 4BIFA 3IBMA 2XGXA 1SEFA 3E97A 2GC3A 1CAUB 2ET1A 2WC2A 4R52A 2O1QA 3EQEA 1ZZ8A 4BYYA 4KL1A 4IEVA 4CYDA 4JV4A 3SMHA 4D7SA 3SCFA 2K0GA 4KWLA 3FHIB 1ZZCA 4J1XA 4AVCA 2ETEA 3VHRA 2D40A 4WVZA 3E5UA 5FDBA 2E9QA 2Q1ZB 1UD1A 5BUVA 1UPIA 4QMAA 3H1WA 4PIYA 4QM8A 5BPXA 4E2SA 4D7TA 3IDCB 1NE4A 2GZWA 3CJXA 4ZU7A 2B8MA 2XL7A 1O3SA 4QGMA 5F1RA 3H7YA 1J1LA 3H3UA 2KXLA 1SFNA 2BNNA 2GU9A 3CF6E 4KU8A 2XL9A 1O3QA 4OFGA 3FJSA 4QXKA 2VQAA 5EFUA 5I93A 3C3VA 1EPZA 1Q3EA 1WLTA 4IEYA 1EP0A 4FBFA 3I7DA 5KHJA 5FCCA 3MZHA 3SHRA 4XF0A 4XFHA 3PNAA 1ZZ7A 3CL1A 3LA3A 3ETQA 4IETA 1QXJA 2UYBA 4L2NA 5FLJA 4ONUA 2MHFA 4I2OA 5LRSA 3LA2A 1X8EA 4UBHA 3LOIA 2BYVE 4NVPA 3E6BA 4XFBA 2MNGA 3UKTA 4HLTA 3FFQA 3ES4A 2GC0A 4Q0SA 1NYWA 4JVAA 4LEJA 1G6NA 3RYPA 3ES1A 3IDBB 5C6CA 2PAKA 4EWDA 5FPXA 2P17A 1ZRDA 3FWEA 3HT2A 3ZDSA 2EAAA 3H3ZA 3R6SA 1EYBA 5AVPA 3ACLA 4F8AA 4OLLA 2QNKA 3HIFA 1YFUA 3CEWA 3H50A 4K8FA 3D82A 1EY2A 1ZZBA 3BU7A 3DV8A 4N9IA 4DINB 4XF3A 3NJZA 5JSPA 3EO6A 4IERA 1DZRA 1ZZ6A 4IEZA 2PFWA 4AQ6A 1I6XA 1U12A 3QACA 3FE5A 2VECA 2VPVA 1CAXA 5J7MA 1FI2A 1O4TA 1O5UA 4QM9A 4FAGA 3BB6A 5D1IA 3SXWA 1QY4A 4MGYE 1YWKA 2WFPA 4IEUA 4XETA 3I54A 2IXIA 3QOPA 2DCTA 3GBFA 3KMHA 3PVBB 4PIZA 4TLFA 1HW5A 4MH0E 3NKTA 3FZ3A 4HZFA 3OTFA 1ZZ9A 4HN0A 2PAEA 1LR5A 4H7LA 1VR3A 4XF4A 3WW4A 1RUNA 3NL1A 3N4MA 3H8UA 1YLLA 2B5HA 2B9UA 3E6CC 1PM7A 3U10A 1GQHA 1Y9QA 1NXMA 4I09A 1GQGA 1H1MA 4KU7A 2Z2SB 1O3RA 3DN7A 3WW2A 2V09A 4XFFA 2OZ6A 4XFGA 2GAUA 3ELNA 4N9HA 1IPJA 4Q0PA 5JAXA 1X82A 4LA3A 4ZU4A 1J3RA 3D0SA 4MGKE 2ATFA 5HI0A 4Q0QA 4RD7A 3MPBA 4AVAA 4XFAA 2D5HA 4I0BA 2D5FA 1RTVA 4FAHA 2OZJA 5KHIA 3LA7A 3E5QA 2IXKA 4MX3A 4IEPA 5CVRA 1FT9A 1H1IA 3M3IA 1VJ2A 4X6QB 3KGZA 2FMYA 2CV6A 4X6RB 1O7FA 1ZRFA 2H6BA 1QWRA 1LKNA 4HSLA 3E5XA 5J48A 1NE6A 1RL3A 3WW1A 5T3NA 4Z07A 2K9ZA 5KHGA 1CX4A 3FX3A 1YFWA 2UYAA 3LAGA 4I02A 1J59A 4MUVA 5CU1A 4I01A 3IIAA 4LUKA 1L3JA 3SCHA 3RZZA 2ZCWA 5E16A 1UIJA 2F4PA 4Q0VA 1XRUA 2PQQA 1CAWB 2QJVA 4O9EA 1TQ5A 4WZCA 3KCCA 2PYTA 3UKVA 1I5ZA 1J58A 1CAXB 1ZVFA 3ST7A 1J3PA 1CAWA 2CAUA 4META 4YRDA 5I91A 2IC1A 1SQ4A 2H0VA 4IEWA 2HJIA 1CAVB 3S7IA 4AVBA 2HKXA 3RDIA 3S0MA 2GC2A 4MV2A 3D0JA 3H9AA 4UXAA 3S7EA 4YNIA 1O5LA 3H1MA 4EV0A 4QX5A 1CAVA 3H1YA 4R8HA 2EVXA 3RYKA 3B02A 3I59A 5BXXA 3BPZA 2D93A 3OCPA 2EA7A 1Q5OA 4LLOA 4YARA 1UCXA 4LTAA 2XLGA 3MYXA 4ZU5A 2UY9A 4XF9A 5JSRA 2CAVA 1WGPA 3LZZA 4F7ZA 2ET7A 3DKWA 2FQPA 3O14A 2IXHA 2UY8A 1O3TA 1X7NA 1WA4A 4E2QA 1JUHA 1LRHA 5BY5A 2Y0OA 5I0TA 2XKOA 5BV6A 4J1WA 2CGPA 4LA2A 2BEOA 4FT8A 3TNPB 1YFXA 2XHKA 2XLFA 5KHHA 3OF1A 4HSJA 5JR7B 1ZNPA 1OD5A 1ZREA 2Z69A 5LRRA 2IXJA 4MGIE 5I8TA 5I0RA 1UW8A 3KGLA 5J3UA 1XE8A 1LB2A
chains in the Genus database with same CATH superfamily
4HVOA 3WNXA 4CCDA 5FK8A 4IDZA 5D8AB 3JZVA 3T1LA 3I3DA 1OI6A 4AI2A 4H14A 3MW2A 1BCXA 3A22A 1NA1C 1RC6A 4JGYA 2P2KA 4MYEA 1O4ZA 2WINB 1IPKA 5EZWA 5EJ3A 3KVAA 5A33A 1AL22 2ERFA 2XUEA 2Z42A 3E6DA 3NV1A 4YPJA 3AXDA 4FPHA 1PO21 4Y5SA 3H7JA 4HKWA 3WUCA 4YVWA 2MEV2 2CDPA 4XQWA 3KS7A 3W59A 4CCJA 1STMA 1MEC3 1UXZA 1RMU3 5JPMB 1BQPA 2VW1A 3LEGA 3JD71 4MXWB 5JCTA 1FOD2 1ASJ1 1CQ9A 1NX9A 2JXAA 3O12A 4LK7A 2YHJA 1RUF2 3NJVA 5L19A 2FZ1A 3BUCA 1N47A 3KV6A 2R042 5JOXA 4M0NA 2JDUA 1W2AX 3AMMA 3BTZA 1RUD1 4ZS2A 2O8QA 4AW7A 2EXKA 2P4EA 5JZGA 3OY8B 1IKQA 4XBQA 1H2LA 2XUMA 5DQ0A 4YYOA 2GNMA 4AEDC 2Z5WA 4OUSA 5A3NA 4XIKA 5CA6A 4YFWA 4M01A 4K1ZA 1LJ7A 4L97A 3UKNA 3HQXA 2XLAA 5LEJA 4YG3A 4EN7B 2CGOA 2JJ6A 2QTWB 2VD7A 2QQNA 2BNOA 1AXYA 1XC6A 1AUYA 2VW2A 4DS0A 2R0HA 1O8SA 1QOTA 3T2QA 4OMCA 4Q4X2 1Z7S1 2B42B 3G6JB 4BQ1A 4EROA 2VNRA 5FXXA 2PAMA 1QXRA 2VOVA 2HWF1 1IPSA 1Y9GA 2JDKA 4R9CA 2W1SA 5C3QA 1LU2A 2A75A 4CCLA 1LOEA 4QQOA 1WCSA 3BCWA 4COVA 2VH9A 4Q0UA 4BWOA 2JG9A 4GALA 1LGBA 5E6HA 3Q8BA 3UT0A 5JOZA 5APAA 2BJSA 1BEV1 1F4AA 3IAQA 5C3PA 4P9WA 2C0ZA 3ACGA 2VM9A 2GALA 5FZDA 1B35C 1Q8VA 1TNFA 2A70A 2DCKA 4M3CF 5A3OA 4CP9B 2CWSA 2EIDA 4MZUA 4Q4Y2 1YHFA 4RS5B 3VBRA 3KQRA 4TYSA 4CDUC 2OQ7A 4P02B 4G4FA 1CJPA 4AXOA 4I0WB 3V56A 2PELA 3AM2A 4PJYA 5C3OA 1XNCA 1DIWA 3IB3A 5FLIA 3J8F1 4DNYA 5KC5A 3IMMA 3RNSA 1ZRRA 4I0AA 1AL23 3ZXAC 2OUJA 3OB8A 1POV1 5FQ0A 2TBVA 3U4XA 4YGEA 2OW4A 5K0UC 2D6LX 5T52A 4M4PA 3HN1A 1YFYA 3JB8A 4YW3A 3FL7A 3WP5A 4ITCA 1DBNA 2WYSA 1BK0A 2WR9A 3IM0A 1SCSA 1FOD3 5J37A 2YBPA 4JTNA 4ZKTB 1EPWA 5FPZA 4NIDA 1V70A 2LALA 2QQMA 4I3PA 1G9BA 1UOBA 2QQPA 5IAXA 1LHWA 2XJTA 4FPJA 2ZKLA 2JECA 2R062 3S5QA 4R9DA 3VHNA 4IEQA 3LFMA 1UMZA 2QDRA 4D3WA 4QX1A 4B7EA 5K7PA 1JYTA 2PA7A 5GKAC 5I8SA 5F7UA 5IT6A 1ND2C 1KFXL 3ZO0B 4XDOA 1W9YA 4JHTA 4YVWC 3VBUB 1LOAA 2A3YA 2D3SA 2VGDA 2WRAA 3CZJA 3LIHA 1F15A 1Q56A 1OC1A 4B1LA 1CZVA 2AEZA 5A1LA 1UZVA 1F4HA 1JZ4A 1RJ8A 2P1BA 2GP5A 2YMZA 3PIGA 4AE2A 1OVPA 4GQ7A 1PGL1 4LIVA 4NPLA 4IUGA 4NHMA 3P3PA 4ZXEA 4FPOB 5FMOS 4Q4X3 4UF0B 4CYDA 3CU7A 5A80A 4XOGA 4PHZA 5IW0A 1ZZCA 1RMU1 2RHPA 4AFBA 1UZZA 2VMEA 2VY0A 3BN6A 3HBZA 4LO4B 2HWD2 4GAZA 2ETEA 5EYYA 2C9KA 4Z1VA 5JZGC 2R7EB 4E4HA 5A1AA 5LK7B 1PZ8A 2TEPA 3K4AA 5FP7A 2XH6A 3D4KA 2E9QA 2Q1ZB 3PUIA 1BYHA 4BQ5A 4NR1A 4PIYA 4QX0A 2AYHA 1X50A 2X5IA 3AX4A 3IDCB 2IVJA 3I3QA 3M7AA 4YVSB 1DCSA 4I3GA 4XMAA 3CHXA 4Y4RA 1H8TB 1ZYBA 3MGUA 3RZGA 4K20A 2AR6A 3B9CA 2XL7A 4LBQD 4OQ8A 1VIWB 5L7OB 1JBCA 5FZCA 5KC6A 1BK1A 2HBUA 4NPMA 4CVUA 3MV01 4QU1A 3POGA 1OHFA 3VBFA 3OSDA 4P9IA 3H7YA 5F1RA 1UX6A 1J1LA 1SFNA 5JMOA 2GU9A 1OPOA 3CF6E 3FMGA 3TEZA 1SLIA 2ZGOA 2JDYA 3ZYGA 1W0NA 3VBSB 4CCMA 1OSGA 3I2GA 1VAKA 1MS8A 2JG9C 1CIYA 1WLTA 4FBFA 4IEYA 2VZUA 2ZJCA 3I7DA 4GD4A 2ZGMA 1PK6A 4C0HA 3KCXA 2G19A 4HETA 4ZZ8A 1O6UA 2DUPA 2VOXA 4XFHA 2ZX1A 3CZUA 1US2A 3PNAA 2WWSA 3LA3A 5EWSA 1TMF2 3U14A 1AXZA 1LAJA 3AZWA 3VBRC 1XYPA 3WDYA 4CRQA 1PGW1 5A6QA 1GANA 2CSGA 4UT5A 2LTNA 5FZOB 4BLJA 4CP0A 1OQDA 2Y38A 3MFCA 3IDEA 1AR62 3RMXA 5AC93 2VMFA 2R063 2XMLA 4XQDA 1ZRIA 3WG3A 2WA4A 1XU2A 4AI9A 1G9AA 2VTXJ 1OD3A 4JVAA 3BIEA 3POBA 3MUZ1 4Y20B 1QQP2 3WSOA 3OBZA 2PAKA 5FPXA 1AL21 2ZS6B 4PCRA 1W8ZA 4RA0A 3FWEA 4MGTA 3LCPA 5FUNA 5CG9A 3O0XA 4CDXB 1H9WA 2MEV1 4GB32 4JDNA 1DGLA 3ZDVA 5GZGA 5EPAA 1PVC2 4JDMA 1EYBA 1OT5A 2GNDA 3ACLA 2RE9A 1GZWB 2E7QA 4N43B 1G86A 1AR82 1RHI2 1W06A 2HWD3 3HIFA 2LS6A 1FOD1 1UX7A 1W6MB 2HYXA 2EXJA 4UAPA 1RUF1 3DV8A 4V1PA 1Z78A 2WNVB 3MIGA 3PVNA 2R041 3B01A 1W3VA 2FCTA 3ACIA 4MVTA 3I2OA 3OG2A 4AQ6A 2PFWA 3GCWA 2XJSA 2WO7A 2VUDA 1A78A 2ZGTA 3J7MA 3C7FA 2WT2A 4HFSA 1JOBA 5T5LA 1XPWA 1CAXA 5J7MA 1FI2A 3HVDA 1SBFA 2WNUA 1VBC2 4QB1A 5D1IA 3U78A 3IIIA 3T2TA 1HDKA 1YWKA 4AFCA 3BU0A 2W9XA 5CBLA 2W95A 4UFHA 4D6QA 3VKFC 3I54A 1WCDJ 5C4WB 2ARAA 4Q4X1 2IXIA 2PLV2 5CNAA 2DCTA 5CKQA 5FUPA 3WINE 1UWWA 2BU9A 2X5IC 3B9IA 3K77A 2D6NA 3GJAA 3KMHA 4LNVA 2VU9A 2VULA 3K3NA 1HW5A 2WQ4A 1LECA 2YFZA 1DF0A 1IHMA 1TMF3 2Q8DA 3RI9A 1BJQA 1XXNA 2J1UA 1SG3A 2PAEA 5GJ6A 3IPVB 3OPZA 4XF4A 1MZEA 3VBFC 3RZHA 1ULDA 3R0RA 3PU8A 3RI8A 4CU6A 1ZBE2 1ZBA2 3ME2A 1RUNA 1IKPA 1AR63 4P9XA 3ZFFA 4YW2A 1MACA 4QAWA 3U10A 4Q4Y1 5FZEA 3DGTA 4FPKA 1DG6A 4W6WA 1NXMA 2NYYA 1GQGA 1H1MA 4FPFA 1PK6C 2XPJA 1ENXA 2VE1A 3AFGA 1DQ6A 2WT1A 5A7WB 4CTEA 2GMPA 4QPGA 3VD5A 1FNZA 2NQYA 1NAEA 2W47A 2GAUA 1GWKA 3H0OA 2ZBJA 3LB9A 4QHBA 2BFUL 4DXZA 1JUIA 4GB33 4Q0PA 1JU4A 1MS0A 4XZPA 1RUJ1 2FCUA 4LA3A 1PVC3 3FLTA 5HXMA 2WN2A 4D94A 4MGKE 1F31A 1J84A 1PZ7A 4BMEA 4INDA 4QDQA 1AR83 1RHI3 4Q0QA 4JRLA 4FPGA 4XFAA 1C4RA 4KGQA 3UJQA 1AR72 4XXAA 2W92A 1QJY2 4HPKA 2VMCA 2KA3A 4L99A 4YW6A 3LA7A 2FD8A 3E5QA 5CYYA 1WCKA 3M3IA 4RL7A 4CDQA 5A3LA 4X6QB 3VHOA 3TN92 1F35A 1VBC3 2JKXA 2X05A 4Q4V2 2QQJA 1ZRFA 1V9U2 1NA1B 4XZUG 4OCTA 2ES3A 2XWJB 2FDGA 4ZS3A 3LPGA 1NE6A 4N53B 3HNMA 2PLV3 3I3MA 5T3NA 1GZTA 2A5ZA 2NPIA 1XNDA 5FZKA 3T2PA 4A3XA 4D0QA 4KQ7A 2BERA 5KHGA 3C7HA 1D4VB 3BYWA 3S5AA 1GOHA 4QQHA 3ZFGB 2HWD1 2DTYA 1W2TA 3GZAA 3LAGA 4ZPIA 5FZ1A 4TN7A 5CFDA 3RZKA 4BXSV 5CU1A 2VJXA 4FPCA 2DU0A 2OPWA 4FO9A 2WNUC 1FNYA 2QUOA 3JBG2 5FO7B 3SCHA 5E16A 2JENA 2BWAA 4B8EA 5HPOA 2F4PA 1DHKB 5DAPA 1ZBA3 3ZVXA 1XRUA 1X9TA 3WUDA 2WAOA 5FZ9A 3Q8AA 1AR93 4EQVA 2VVEA 2J1EA 2YGLA 4I30A 1UXXX 2EIBA 1I5ZA 4L8QA 4TTGA 4LBKA 1LENA 3OGRA 1MS1A 1V6JA 2XQXA 1G7YA 1UN1A 2PHRA 2YV8A 3ITQA 4FOWA 4OZXA 5HCFA 2X53S 1HX6A 2ENRA 3ZN6B 4AEMA 4META 1N1YA 1E5IA 1WUVA 5I91A 1GOFA 3KT1A 5FMDA 1MZ6A 2IC1A 3OGVA 1ODNA 1YQ2A 2H0VA 4CUGA 1PHMA 1VMJA 1XNTA 2HJIA 3BPSA 2HKXA 4QX7A 2PHXA 5A7PA 2VZPA 1OLMA 4IE6A 5FZ3A 5G04L 1UNBA 3D0JA 3TYJA 3S7EA 1TMF1 4YNIA 3W58A 3ZFFC 4IGOA 3OYWA 3B3QE 3MLLA 4XAEA 1CAVA 2DUQA 3WNMA 1MS9A 1LOFA 2JDZA 2Y64A 3K4ZA 2EVXA 5D2AA 5JOYA 3RYKA 3B02A 4QPGC 1B35B 2D93A 1WWYA 2RM23 3OCPA 3V65A 1R092 1REFA 4QX8A 1YC61 4RQPC 5A32A 5C71A 2FDHA 2Y6HA 3BTAA 2FZ2A 5KXEA 3RZLA 1BZWA 1V0AA 1S0GA 1LOGA 1QQP1 2DCJA 4CDUB 3VZMA 3TN93 1ZM1A 2WO2A 4ZU5A 4YFZA 2UY9A 4CUCA 5HCAA 4Q4V3 4J25A 4R9BA 5JVVA 3ZFEB 1NCQB 2RDNA 2VNGA 2WZR2 4F7ZA 5BNNB 2FQPA 1O59A 2R071 4HKOA 3S6PA 2IVIB 2VZQA 3VDDB 1DQ4A 1O3TA 4NMIA 3U4SA 1H4HA 4XCAA 4QPIB 3RRDA 5FRAA 2E51A 4K1YA 1H2MA 4WM8A 2J1RA 1AR81 1RHI1 2RR12 4J1WA 1LEDA 1XYOA 5FP3A 2VZSA 2RS32 1O4YA 1YFXA 2J42A 2XHKA 2XLFA 2DBNA 5J09A 1YCIA 3CBNA 5BYNA 3OF1A 5JR7B 5IK4A 5JXHA 4FTBA 1N3OA 1AYN1 2XJRA 3JBG3 4HANA 4AQTA 1UQXA 3TOJA 3VBOA 4QKBA 2NP0A 2QQIA 1ULGA 1XE8A 1LB2A 1VBC1 4GXLA 3WQ0A 2ZTNA 5T50A 2V73A 3U11A 1ND2B 4LULA 1SBEA 1FV2A 3L2HA 4K21A 1LGCA 3CO2A 4YVWB 4C90A 3PDQA 5LEKA 4G9SB 4KG8A 1GNYA 5L7OC 4AFMA 3V64A 5ABJA 4Y5Z0 5C8CA 2ZABA 2PLV1 4LO7A 1COV2 3ZXEA 3VL9A 3VZOA 1AZDA 1W8FA 2G9ZA 3NRUA 1JZ5A 1OOPC 4Z92B 1FX5A 4G3YC 1KS4A 1VBE2 3KT7A 1C8M2 3IKWA 3RJRA 1J3QA 1J83A 3KD4A 2GC1A 5JZGB 3AKTA 1JW6A 1FV3A 1WD3A 4PIXA 1AF9A 4UFIA 3FLRA 3POFA 4K9SA 1VALA 4PT6A 1ZBE1 1ZBA1 4TZDA 5FY4A 1SPPA 5AFEA 3N36A 4QXBA 4YGBA 3B69A 1T6GC 3EBRA 4AVSA 2RS52 1EUTA 2VMGA 5FMOL 4KWKA 3GYDA 5J1XA 3OBAA 1R093 1YQCA 1IS5A 2A3WA 3T1MA 1V6LA 1CZTA 2E31A 1YEWA 1PX4A 1DLLA 1ULCA 3MBWA 3SQOA 4W8JA 1T2XA 4B29A 1VAMA 4ASLA 4NPRA 2UWAA 4MO3M 3POJA 3THDA 1HB3A 4NRQA 1LHNA 3HQRA 4Y3OA 1UU6A 1CVNA 2VQ0A 5FAXA 3NAPC 5C3SA 3N35A 2YXSA 1LOFC 4MHUA 5C8WA 3RPQA 2BVBA 2Q8OA 3Q9OA 1W6NB 2RS33 1D0GA 4CPBD 3W5MA 4P14A 2A3XA 2D98A 3B93A 3QLQA 1XJAA 1EAH2 3WDXA 3WR0A 3J7NA 2RDSA 4OVEA 1AR71 2DCYA 3AJZA 4NUBA 2E63A 1QJY1 2Q4SA 5JIAA 4WVMB 1ALYA 1HRV1 2IXCA 2MPFA 2OS2A 2BGCA 3DYPA 5FZ8A 4IEXA 1U5YA 4XFIA 1W2UA 2WO3A 1S0EA 5GZEA 1HXS3 2C4XA 4AR2A 1K5MA 5FOJB 2TUNA 3K4DA 2P3YA 3RYRA 1Y3TA 5F8PA 3TN91 5FQ0B 3A0KA 5DAXA 3SH5A 4WVVA 2E26A 2B39A 1MS3A 2EXIA 4Q4V1 5JDBA 1V9U1 3WLUA 4DB5A 4BXFA 4WM8C 4D6RA 4QQLA 4Y1YA 2JG8A 4IV3B 4KBBA 2QQKA 1OVSA 2JB8A 3VZJA 2BFUS 1PIV2 5FZLA 5JLVA 1R1ZA 1QIQA 4S2DA 2VZVA 4CDWA 1IS3A 1V6NA 3ZSKA 3DYOA 1DYOA 1UYZA 1K3IA 1X8MA 1V6OA 1GP4A 1K45A 3VBOC 1OH4A 2DVAA 2WIIB 1OMIA 5LA9A 5FP8A 5FWEA 1XNBA 3DL3A 3JBG1 1GP5A 4LO5B 1AX0A 1W99A 2XDVA 3GM8A 4BISA 3Q8FA 1VP6A 3O1SA 1H6YA 1E5HA 3POEA 2YGMA 2BQPA 2VXJA 4QGLA 1S0IA 5ABJC 3IZOA 3JCIA 1U5ZA 2NLRA 2RS53 2DVDA 3IWZA 1RJ7A 3TBDA 3SCGA 3HPNA 3MPPG 5TSWA 3KSCA 4JGZB 4B4RA 4IESA 5ANQA 5FYYA 3ZXLA 2FDFA 3DCQA 4EN8B 2XXZA 2ZOEB 4EN9B 3VKNA 4RR3A 1CAUB 4QKFA 1RUI2 2BW8A 4R52A 4LKSA 3GXUA 5IVCA 4KL1A 1XYNA 1OKQA 4HT1T 4JV4A 3SMHA 3ZOIA 2WT0A 4FSJA 2K0GA 3ZKYA 2X5IB 2Y8KA 2I07B 2B46X 3WF2A 1TE1B 3K48A 3USUB 3VHRA 2D40A 2ARBA 4WVZA 4DRRA 2Z79A 1VRBA 1PGSA 2PN5A 4LMFA 4LBQA 5LBBA 2I2SA 4XJ8A 5BUVA 1CJDA 1EAH3 3H1WA 4E2SA 1OPMA 2ILMA 4N7UA 2VZTA 4ZU7A 1WLCA 3I2FA 4GH4A 1YXWA 5CEHA 2XOMA 1R091 5GLWA 5FZFA 1JXNA 1JZ3A 1O3SA 3OUHA 4RHV2 4GWIA 1S4CA 2XWBB 5IFTA 2RJLA 4JRAA 1JZ6A 3TB0A 4QGMA 3VV1A 4H55A 3HBKA 4OUEA 4BQYA 3H3UA 2BWCA 2J1AA 5DXDA 3S30A 3EXUA 5EIYB 5JMCA 1V6KA 5DUUA 4CUBA 2WZR1 3VBHA 1ULFA 3O1OA 1O3QA 5FZ6A 1QOSA 4ET7A 1GU3A 1KQRA 1OLRA 3T0DA 3HEIA 1PIV3 1P8JA 4NE9A 5EFUA 5FY8A 1EPZA 1Q3EA 2CYFA 4LIUA 1EP0A 3WV6A 2ZAAA 5KHJA 4DIQA 3GHNA 4DEQA 2ZXQA 4TSVA 3ZYFA 3MZHA 2RR11 2DFBA 4ZHNA 5C3RA 1FMD1 1ZZ7A 4QU2A 3CL1A 3GBGA 4PI2A 5GALA 1G9FA 4UFKA 3ETQA 4L2NA 1QXJA 2UYBA 2ZHNA 5FLJA 1QKQA 4Q1PA 1WCQA 2YPDA 4I2OA 5LRSA 3LA2A 1X8EA 2Q1FA 1U0AA 2Y26A 3DPRB 4HXCA 3LOIA 3MO4A 3MHZA 4XW3A 1RXFA 1US3A 2VW0A 3SISA 4E4DX 3ZXJA 3UK9A 4NVPA 2YDEA 3MW3A 2BGPA 4XFBA 5CISA 3M3OA 4U36A 2FBEA 5FO9B 2JG8C 5IVEA 1HJFA 2Y33A 5BNOA 1YIFA 5L36A 2CHHA 3RQ0A 2VMIA 5SV8A 2GC0A 2WUHA 5GLTA 4AGGA 1SLTA 1YRZA 2YU1A 4CDWC 4OHWA 2DVBA 3LKJA 1G6NA 4UFLA 1VB4A 3ATGA 4CEWB 2ZGPA 1MS4A 1PO11 1YQ5A 4KMQA 3NWKA 5C6CA 5FYZA 4EWDA 3J7LA 2ZEWA 4KNCA 1COV1 2OIIA 4IV1B 1HIXA 1RUI3 2ZHMA 4BK4A 3HT2A 1LU1A 4D6SA 2CY6A 4PF1A 4LO8A 4QKNA 1NG0A 3H3ZA 3PUHA 1VBE1 3ZX7A 3R6SA 1C8M1 4HKLA 4X8PA 1MQTB 4IW3A 4ATEA 1VB2A 2AH2A 2XJPA 4M3CA 2DVFA 5F5CA 4P9YA 2DUOA 4K8FA 3D82A 1CX1A 5IFPA 1EY2A 4NHXA 3AZXA 4OI1A 4DQAA 3NJXA 2D3RA 4MG2A 4PLOA 1AJOA 2X10A 4RGGA 5DG2A 1RUE3 2RS51 2JD9A 1DZRA 3WP4A 3K46A 2BVVA 4RR3C 1I6XA 2HWB2 3GNEA 1J1TA 1VMHA 5F3EA 4ARYA 4RHV3 3FE5A 2VECA 5DAWA 4XYXA 5IVJA 4QM9A 4FAGA 3BB6A 3M3CA 1QY4A 3NKGA 3HMYA 2IFWA 4LKDA 3ZXKA 1HB2A 1XB9A 5FXZA 2WFPA 5JI7A 1OF3A 5FPBA 4IEUA 1I3HA 1GV9A 1AXKA 3ZYJB 1R1A2 4LBMA 5FZIA 4Q2FA 3ZPOA 4Y22A 4JGYC 2VCAA 4YGDA 3SNMA 5AC92 3EYPA 3PMEA 2VBPA 1YJLA 2VQTA 3FHQA 4EZHA 3VKMA 4GH4C 4R4XA 3N7JA 4PIZA 1AHSA 5C5TA 2PHUA 4MH0E 4FQZA 1Q8PA 4QB6A 3NKTA 3FZ3A 4HZFA 4OULA 3WDWA 1ZZ9A 4HN0A 5FY9A 4COZA 3KWVA 2Q8EA 3GHMA 1V00A 4QT6A 3RGBA 3WW4A 4AQSA 5LA1A 1YLLA 2B5HA 1UY1A 1ZA4A 1JYXA 4PLMA 2JWPA 1PM7A 3APBA 4QPGB 1MEC1 1W6OA 1WCUA 3RVHA 4RQPB 1YO8A 3C8XA 4LHKA 3AB0A 5DDJ2 4CCNA 2GH8A 2ZX0A 2X29A 2R32A 1XU1A 5DZEA 2YUEA 4AI8A 2Z2SB 1O3RA 5FV3A 2A71A 1OXCA 4XUPA 4BB3A 3P3NA 2K46A 2Q8CA 4LE4A 5FIXA 2P6HA 4XFFA 1HB1A 2OZ6A 3AXEA 1PIV1 1GMMA 2P5BA 4XQ4A 3ELNA 4LXLA 4A7ZA 3X29B 4PF5A 1OKOA 3BGAA 1HLCA 3CJIB 2R1BA 4WM7A 5JAXA 4BZ4A 1X82A 3CMGA 5CFCA 2HWE2 4ZU4A 5F5IA 1D2QA 4NRPA 4A7KA 3JB4C 4HPKB 3W5NA 1E5SA 1URXA 5BNOC 3CKHA 1KXGA 3J9SA 3WF3A 5LBEA 1H1AA 4CE8A 1CD3G 5HBAA 4QX2A 1IQDC 3P5BA 1VBB3 1JMUB 5D8AA 5KHIA 1UL9A 4TWTA 2IXKA 2HWB3 3AFKA 2ZEZA 5AVAA 4LO6B 1BMV1 1W8WA 1JYIA 2W68A 3KGZA 1DLCA 5JPNB 1TME2 2NMNA 3CQOA 3V0BB 1O7FA 2H6BA 5H9QA 1QWRA 1RUI1 3SKVA 1LKNA 1PM4A 4HSLA 4Y1ZA 3WQ7A 3WOGA 4Y26A 1RITA 4UW3A 5FZBA 1R1A3 3I2DA 5IJRA 1UY0A 4LORA 3NV3A 1ONAA 2BGOA 4EZ4A 1LNSA 5FYBA 5F3IA 5JIUA 2R30A 3O5SA 4CCEA 3AYCA 4MXWA 2XBO3 1OOPB 1XE0A 4O65A 4QQPA 4XJAA 4A3ZA 5F37A 3R4UA 5F3CA 3ACHA 1W04A 1AL0G 4GKYA 1JHNA 2VBBA 1QF3A 1W9FA 2WJSA 3L2YA 1RXGA 2RJ2A 1A8DA 3IIAA 3N9LA 4OHVA 3OY8A 1L3JA 2O8OA 2YBSA 3WQBA 1UIJA 5C7GA 3M4FA 4Q0VA 1BVP1 2VNOA 4DXSA 4RHV1 4GKXA 1LHUA 4S2HA 2RMU2 4UW6A 1OA2A 2P3IA 1SACA 4BPZA 3I2IA 5DDJ3 1KGYA 5IVBA 1VRH2 4QXCA 5FK7A 1VAVA 3GZTB 1C1LA 1ZVFA 1OBNA 4QX3A 3LOBA 2CAUA 2PMWB 1SLCA 4YM3A 4XJWA 3OYWB 4QQ2A 1CAVB 4AVBA 4AHZA 4EN6B 3H3LA 4A42A 3RDIA 1IGOA 1ND3B 3NAPB 4LE3A 2HWE3 3AYDA 5GLUA 4FI9A 3OGGA 1RYYA 3EMRA 1G9DA 3H1MA 4OMDA 4PDWB 4ES9A 4D8MA 3AP9A 1WLWA 3DYMA 4FOYA 3O0VA 3PMSA 3WG1A 4LJHA 2ZMLA 1UOJA 1GZCA 1M4WA 4XXPA 1QJFA 1ZA7A 2ZAHA 3SKJE 2W39A 4CEYA 4EN0A 3N7MA 4C1WA 1WBLA 1DYKA 5A6XA 2E7TA 3C7EA 5FY5A 1RUC2 3AP6A 3GJBA 3LD8A 3JU9A 3LSDA 1IS4A 2RV9A 5FBJA 2WS92 3FFZA 5CFCC 1TME3 2RDQA 4F83A 5LWBA 1EUUA 1XOYA 1WBFA 3ILNA 4BLIA 5FYVA 2CAVA 3LZZA 4YW7A 4YZ4A 3DKWA 4EE2A 5FWJA 2IXHA 2GN3A 4AI0A 2VOKA 1NZIA 2UY8A 4JZRA 4DY5A 1XBFA 3MI8A 1E5RA 4JHZA 2AREA 1AR92 4E2QA 5CG8A 2HEVF 3DF0A 4YGCA 2Y60A 4BU2A 1W39A 2DV9A 2IWGB 5BY5A 1QJX2 4CU7A 5D8AC 4V2WA 2CGPA 5DUWA 1FYUA 4FT8A 4XABA 3RMYA 5LY2A 2W91A 4OZOA 1OLME 4HSJA 4MHRA 1ZREA 1OD5A 1W03A 1S2KA 4XUNA 5A6YA 2Z69A 5T5PA 5M0TA 3GZEA 5IUQA 2HWB1 2IXJA 5F9TA 5I8TA 5I0RA 1GFF2 2G9GA 3VBUA 4AEJA 5J3UA 3TAYA 3VD7A 4BM8A 4AI1A 2RMU3 3WP6A 1JYWA 1NCRB 3VN4A 3KZ4C 5C70A 1GZ9A 2JDPA 4L9BA 1YI9A 3M70A 2VUCA 3N3HA 2ZKNA 1VRH3 1OQEA 2D6KA 4AQ2A 4W4ZA 3HT1A 2XVLA 5AC91 1IG3A 2DTWA 4Z82A 2VXRA 2R061 2JE7A 2RM22 3K2OA 2H6CA 5DUVA 5KBFA 2ZACA 4HVRA 4AFDA 2G9FA 2VMHA 2HLEA 2VZ3A 1BHGA 4B3NA 5AFBA 2SLIA 4HMZA 5I0UA 4YVSA 1R64A 4CDXA 1N1TA 2WA3A 3HN3A 2JDAA 1H8TA 2FHRA 3N7KA 3QH6A 2RJKA 4AFAA 4KG0A 5A1FA 1JI6A 2GDFA 2JIJA 3KVBA 4DRVA 1I1EA 5DAVA 1BKZA 5SV5A 4FFGA 1UZYA 5BNQA 2Y6GA 3OPWA 2VVFA 2QZ2A 3PVEA 5C33A 5L7OA 1KRIA 1LULA 1WMEA 1HB4A 1UU5A 2EXHA 2OPKA 2QBXA 2QCSB 3ILFA 1DGRA 3KV5A 1PNFA 4L92A 5LA2A 3M3QA 2HEWF 2OX0A 5DDJ1 5FZGA 4NIIA 1X9PA 1V6MA 2QQUA 1NZCA 1FXZA 1QHDA 2CL2A 2CTVA 3K51A 1VPHA 2ZGRA 4LLFA 4UFJA 3ZYIB 5C9AA 3T4HB 3VBSA 1RUC3 4E9KA 2VNVA 2I45A 4EJRA 2JICA 1GWMA 2WS93 3NVCA 1TVGA 1FAYA 5CADA 4IQPA 2RS12 2BNMA 1JH5A 5T5OA 4U2AA 5FO8B 3ZXFA 3KHCA 5B4XA 3INAA 3B7MA 2JX9A 3HNBM 4LK6A 2HWE1 1DYPA 4IEOA 1UYXA 1W2NA 2A6ZA 2Q30A 1V6IA 3MIDA 5F3GA 4AEDB 2OYZA 3AZVA 1LHOA 1QJX3 2QQVA 5GLZA 4CEYC 5FZOA 5KHKA 1XE7A 3P1IA 5FREA 2XR4A 1DZQA 4QDSA 1REDA 1QGLA 2QKDA 2XJQA 4JKKA 1A34A 5T5JA 4YW5A 3C7OA 4HN1A 2YYOA 4EWEA 3PURA 4DUXA 5A7SA 4ASMB 1W9TA 3WQ1A 5CKNA 3BALA 4Y20A 4AL9A 5FYTA 3NMBA 1WZXA 3I59B 1C28A 1TME1 1VBA2 4XEZA 3TEXA 5FKBA 1BBT2 2F4LA 4O9GA 3USSA 4WBBA 4Q29A 4A2UA 4L11A 4QB2A 1W6PB 4E8CA 1W90A 2OA2A 4NHKA 2WAAA 4XFCA 2WZ8A 1RUOA 1PZ9A 2NM1A 4BK5A 1AR61 3NNMA 2CWMA 5IK5A 4LT5A 2YU2A 4AAXA 3R05A 1GZWA 1ULPA 1GWLA 2C1FA 4N43A 4QGNA 5E89A 4YW4A 3BTXA 5J98B 2EIGA 2YC4A 3CNAA 1SDWA 5BNPA 5FP9A 4HL0A 1DZTA 4KGGA 1KD7A 3EJKA 4NIAA 1QJEA 2WNVA 3VBUC 1GR3A 4HVQA 3U0ZA 5GLVA 2QQWA 1KJRA 4KWUA 2QVSB 1ZX5A 2J22A 4CXWA 1YUDA 3WG2A 2AEYA 1UMHA 1IZ3A 4R9AA 1N1VA 1NKGA 1RVF2 4GB31 4X8NA 4MGZE 3LQCA 5FXVA 4JTOA 4YWAA 1PVC1 3PHMA 1ENQA 1PO22 4OHXA 4NO4A 2TNFA 4HOOA 4NJ4A 2WL1A 3TNQA 5K0UB 2WLQA 2DU1A 3VD3A 4GIQA 3WCRA 3JXSA 4XUTA 2AZ5A 1SCRA 1RUH3 5C4WA 4RN5A 3HJRA 2WQZC 2SBAA 3D8CA 2PQSA 1SEFA 4CDQC 3P6BA 1JU3A 3D3AA 5EV7A 2VZRA 4IE4A 2ET1A 4NAMA 2D43A 2RS13 4YVSC 4CDXC 1ASJ2 3PU3A 1H8TC 2YB7A 2O1QA 1ZZ8A 3ALQA 4M4RA 3TEYA 4JGYB 4K3UA 1HXS2 4D7SA 1SFYA 3ZYRA 2E32A 4KWLA 5A33B 5A3TA 4PBOA 3WY6A 4MSVA 4C0BA 4CP1A 4J1XA 1F8VA 3TWIA 3M1HA 2VOWA 4AVCA 1EV12 1TEIA 3IPVA 4H3WA 1MZ5A 4WV8A 4NAOA 4YM1A 3AYAA 2I74A 1GKBA 1HKDA 1IOAA 1S55A 4QMAA 5CFDC 3S57A 4QM8A 5BPXA 1K12A 5C9AC 3FC0A 2Q5TA 4D7TA 3O1PA 1NE4A 3CJXA 2ZPXA 3VBSC 1T6BX 2B8MA 4L0PA 4UW5A 4B4PA 5JWPA 4ISQA 3B94A 3UJOA 2ZEXA 1F2NA 3AYEA 5A7WA 2ZGSA 3D6EA 4XJUA 4GMP3 1RUC1 3PUQA 3AVRA 1VBA3 4ASKA 1QU0A 2VZ1A 1OLQA 2ZGLA 1BBT3 2YPJA 5JI9A 3N9QA 4KU8A 4MOAA 3T30A 5JXGA 4B7KA 4QXKA 2VQAA 3VHPA 5I93A 1AR91 3MIBA 4OI0A 5KR7A 4QKDA 2W46A 1H9PA 1XNKA 3LIGA 3SHRA 4YZ2A 2AENA 4LHNA 1WW7A 4QPYA 1W8OA 3QBQA 3T3YA 4IETA 2PHTA 1F5JA 3ZR6A 4Y24A 4BJ0A 2MHFA 2FDIA 4XACA 4ES8A 2VMDA 3VDBA 4YG6A 4M00A 3H8XA 5IHRA 2VBDA 4FP3A 4AI3A 1UO9A 2V72A 2BYVE 1RVF3 4PQQA 4AAPA 2JG9B 4RGAA 1WW4A 3WF4A 3UKTA 3ZYHA 3ABZA 5L9VA 3MV11 3FFQA 5D21A 1PO23 1YNAA 1UF2C 1D4M2 3OOXA 1NA1A 2YC2A 4Q0SA 5FYCA 5FYIA 5IATA 4FFIA 3NNJA 4CCCA 4FPYA 2FDJA 4COUA 4N53A 3RYPA 2WWJA 5BNPC 3IDBB 1NLSA 2OXBA 4K40A 3VBRB 3VL8A 1CN1A 4C8DA 2WNOA 3V0AA 3JD73 2RM21 5GM0A 5A3WA 4P5YA 1ASJ3 4M3CB 4XJ9A 3O0WA 3ZFGA 1W05A 4IXLA 5ERLA 2Z4FA 1MR5A 4SBVA 1AX1A 4AWDA 3THTA 3VKOA 4OLLA 4LITA 1EV13 1I9RA 2WYFA 3SITA 5JXJA 2QNKA 1YFUA 5T54A 3CEWA 3H50A 2EALA 4FXKB 4XUQA 1ZZBA 1H8VA 3MUY1 5C4WC 1W8UA 4N9IA 4RSUA 3WHTA 3NJZA 5HCBA 2OQ6A 3I2JA 5JSPA 1DFQA 4IERA 4MGSA 1JODA 3OPTA 1U12A 4C91A 4QWNA 4DY3A 4CA9A 5A3UA 1Q8SA 3QACA 2Y6KA 1CONA 2VPVA 1DGRN 2ZMNA 1GBGA 1O5UA 3BOWA 1N3PA 1TNRA 3IT8A 4UWDA 2YC0A 5HV4A 2LW8A 4FFHA 1KEXA 1GQPA 5G05L 1QXPA 5FYUA 4XETA 2QFEA 3SEEA 4GWMA 5DPNA 1WKYA 1IG0A 2ZX2A 1XSQA 3R4SA 4GJYA 1NQDA 1UMIA 3ZN5A 5C8CC 3GF6A 2X8KA 2VVDA 4DXTA 4GJZA 3U07A 5KWRA 3PVBB 1NY72 2R16A 3LDKA 4XE9A 1S1AA 2RDRA 4FOQA 3PIJA 1AVBA 5EYXA 4TLFA 2XG3A 3JQWA 3AKPA 3OTFA 1W6OB 4NRMA 2OUHA 4P9JA 2J1TA 5CKMA 2VZOA 3C7GA 1B35A 1LR5A 3VZKA 4DUVA 1VR3A 4XUOA 4A7YA 4YLZA 4F3JA 4LOTA 3SEPA 3TEWA 2GSYA 3N4MA 5FJKA 3H8UA 1JN2P 4M3CE 2B9UA 1Y7BA 4CDUA 3TRSB 1BXHA 4GMP1 4BE3A 1DQ0A 1GQHA 1W6QA 3POSA 3UL2A 3VDAA 5FJHA 3PUSA 5A3MA 1VBA1 2ZGUA 4XBNA 3ZFEA 1D4M3 1NCQA 1UYPA 1YYNA 2ZGNA 3M8LA 1BBT1 3AMQA 4I09A 2C26A 4KU7A 4P08A 5BNNA 5F32A 3DN7A 3VDDA 5CFCB 4XDQA 3MEPA 5FYSA 4QPIA 3VBFB 1R082 4XFGA 1PGW2 1RUE2 2ZZQA 4XAAA 4N9HA 1LCLA 1W8HA 5EP9A 3BVCA 5FZMA 2BUKA 1YI7A 4JCKA 4NWVA 1IPJA 4LBOA 3FBYA 4MXVA 2B45X 1J3RA 1TZOA 4CU9A 2V4AA 2VCBA 1VMFA 1PK6B 2ATFA 4DXRA 4Q5OA 2GP3A 2NMOA 2OT7A 4RD7A 3MPBA 4AG4A 2LUWA 3LPFA 1RVF1 1DGWX 2W5FA 4I0BA 4BQ4A 5FFOC 5HXVA 4A6OA 4N53C 1XSRA 1RTVA 1QEXA 2CU5A 3UETA 1QH7A 4AGVA 3SH4A 4AHYA 4FPLA 3N9NA 1NOVA 1ND2A 3ETPA 4FAHA 2BV4A 4MX3A 2X09A 4IEPA 5ANNA 3GDBA 1FT9A 3ZR5A 3ZFGC 4JKMA 2RS31 4D7YA 3WDVA 4BMBA 2FMYA 4X6RB 1GNHA 4URAA 1K5MC 5FYMA 3PTRB 1S0CA 2B7YA 3LEKA 1KDMA 2B4KA 4UW4A 5DABA 5J48A 4M0HA 5T55A 1HXS1 1ACCA 1E57A 3J26N 4FTEA 4YZ3A 4Z07A 3DXTA 1UAIA 1EV11 1VLNA 2YZ4A 3FX3A 1YFWA 3J7HA 1N1SA 3MF9A 5LBCA 3RFRA 4I02A 2V5YA 3T0BA 3VDCA 2WABA 4MUVA 3MIEA 3ZYBA 3WCSA 3H42B 4Q4W2 3ORJA 4AVTA 4AYUA 2BDRA 4QHOA 3AJYA 3RG0A 1WA6X 3OEAA 5GZDA 5LASA 2P6CA 3N9PA 2GNTA 4LUKA 1LGNA 5LY1A 1OFSA 1SLAA 1CPMA 1S0DA 4GMP0 4ATFA 1TG7A 4FP2A 2GMEA 2P37A 2V4VA 2Y6LA 4MLOA 5IK7A 3D5OA 4CZSA 5K4LA 3O1TA 4Z2WA 1TQ5A 4WZCA 2Y6JA 4IE7A 3B5LB 3VLBB 1ODMA 3UKVA 2VUAA 1UOGA 4FVVA 2K2SA 1HN1A 3AP7A 4JQRA 5GZCA 4W65A 2J1SA 1W0OA 3ECQA 3KQ4B 3HNYM 1CAXB 3ST7A 3UNPA 2WNUB 1J3PA 5A7OA 1CAWA 4H2AA 1S0JA 1VBB2 3WF0A 3KB5A 1R083 4Y1XA 3N7LA 3O1MA 5FP4A 2BTVC 3OBTA 1I5PA 4IEWA 2RVAA 1CESA 3S7IA 1W6NA 1SDDB 1JZ2A 2GC2A 4NOTA 3H9AA 4JX0A 4UXAA 1O5LA 2G4IA 4CEYB 3O7OA 4EV0A 5CAZA 2JB4A 2JEMA 2DURA 2VG9A 2IZWA 1LEMA 2W87A 3BIWE 4FFFA 4WVMA 5F6KA 3ZFEC 5C5UA 3ZXGA 1NCQC 3B00A 3HR9A 2B9VA 3H1YA 4UI9L 4R8HA 5BNNC 1C1FA 5EJZB 1NT0A 5JXIA 3VDDC 3QH7A 1JOJA 1DDLA 1U5XA 3A23A 4QPIC 1JYCA 1REEA 2XBO2 3AKSA 2GN7A 1D4M1 5A70A 2EA7A 2MEV3 5EJ1B 5FPUA 4HK8A 4R4ZA 1RUJ2 2BPA2 4ZXKA 4IV3A 4FXGB 5F39A 3ZFFB 1EAH1 4AHWA 1RUG2 1SBDA 4XF9A 5JSRA 3AP5A 1OA4A 3AKRA 1HV0A 3F95A 3R4DB 2Y6FA 1WD4A 3KV9A 3KV4A 3RWNA 4BQXA 2ET7A 2E7AA 2YROA 3FLPA 3LEIA 2WZPP 3RZJA 3O14A 1RUF3 2C24A 4D69A 3VBHC 4BCUA 1X7NA 1WA4A 2FMDA 2R043 1CPNA 1XQNA 2LROA 2Y0IA 3WNLA 3F2ZA 2BRTA 3IN9A 2NN8A 2Y0OA 1UOFA 2ZX4A 2XKOA 2OKXA 1DU3D 4LA2A 3OJBA 3O1RA 2YG0A 3LEMA 4Q4W3 1JOPA 2QQOA 4CXYA 5KHHA 2FDKA 3HAGA 4LBNA 1JYNA 3LFIA 4JGZA 3ZYPA 1UW8A 2PHWA 3KGLA 5FZ4A 3WP3A 1APNA 2R49A 2F17A 1WMFA 4KWJA 2ZEYA 1UZ0A 4ZZ5A 5DG1A 2JDMA 2WSUA 1CAUA 3EB7A 5I0SA 3VKLA 4BHPA 1GICA 2QE3A 4Z8BA 4S2GA 2QDNA 2ZX3A 4HG6B 4DOUA 4CDQB 2PTMA 4COYA 5I0DA 1RIRA 1Z0HA 1JS9A 4CUAA 3WDTA 2BP6A 1QDCA 1HRI2 3USUA 3A21A 1NY71 1HQWA 3FUOA 4PLNA 1PMIA 1CGPA 3VZNA 3VB9A 4XF1A 3RJ2X 1W9SA 2WDBA 2CGNA 4IGQA 4Q4Y3 4OQ9A 5ACA2 1G8WA 1W9WA 3O1UA 3AL5A 4GWNA 4E2GA 3QD6A 3WZ1A 4YZ5A 3CIHA 4ORFA 1JZ8A 4IL7A 5CFDB 3M2MA 1POV0 4XDPA 5C9AB 3AK0A 2A6WA 1X33A 2WWUA 3MIFA 1KS5A 3ZSEA 3LSEA 4BDVB 4EWAA 1L7RA 4GZ9A 3IMNA 2D7FA 4Q8KA 2JD4A 1FPN2 3PTYA 2Y34A 3ZN4A 3LDBA 1RUJ3 3FBMA 4AGRA 4HK9A 5IVYA 3WW3A 4CCKA 1RUG3 5LW9A 1UZWA 1R081 1RUE1 1C57A 4LUMA 1QOOA 2Q0AA 3AZYA 3NNFA 3K3OA 4QDRA 5FMBA 5GZFA 1UIKA 2D97A 3EHKA 4XURA 5FLHA 4CXXA 2PHDA 3G7DA 1NLQA 4NN0A 2EIEA 1OFNA 1Y4WA 4BH9A 2D3PA 2PHLA 2VL4A 3DPRA 4LKEA 4LPLA 5J36A 1DGWA 2ZA9A 4OUMA 1MVEA 1ST8A 4UFMA 3HOBA 5DUXA 5A6ZA 1LOCA 4ARXA 1NLRA 3KLSA 4OYUA 5E1RA 4IV3C 2D6PA 1AYM2 3HD8B 3ROUA 4GULA 1GP6A 4OI4A 3UGFA 5K8SA 1ZRCA 2R072 4IE5A 4HBNA 4XBLA 1GUIA 2VCCA 2UWCA 4LBLA 4CEWA 4XTMA 3VD9A 1A6CA 5I8YA 4XTPA 1VE0A 2XVKA 1UY3A 3I4IA 3N9OA 4XJZA 2JKBA 2OVUA 4NHYA 3UGHA 2CNAA 3SC7X 4LQRA 4IV1A 3MDPA 5CIRA 3OEBA 4XHXA 5A32B 4BQWA 3FUQA 4CP9A 1Q8OA 3NW4A 4UBGA 2FCVA 2N7GA 2IUWA 2XKPA 4Y33A 3PLQA 4A41A 5BNPB 2DFCA 4XC9A 1RGSA 5FOBB 3NSTA 5EQUA 4RS5A 4UOJA 4TLGA 5L73A 3BTYA 1MQTA 5FZ7A 4CCOA 1AYN2 1HRI3 1CWPA 4P9GA 3W9AA 4MGQA 3WHUA 4O7XA 4JDOA 3CLPA 3AP4A 2LM3A 2ID4A 1O91A 1ENSA 4NROA 4COWA 3POYA 1Q43A 1GOGA 2WLPA 3WXPA 4Q4W1 1Q8QA 2GNBA 4JGZC 1U5IA 4WM7C 3GGLA 3JUUA 5ACA3 1D0HA 3OD0A 2XVGA 4QHZA 5F2SA 4YSFA 3MLJA 1QNWA 4AF9A 3AMNA 2IXLA 4WM8B 1OF4A 1QH6A 4LOSA 5F2WA 2GH2A 2A1XA 2BZDA 2W94A 3T09A 5B2GB 1RB8G 5FY7A 5FPVA 3WNNA 4NIHA 3ILRA 4Y4YA 2P3JA 3IDAA 5EXOA 1UYYA 1Y43B 3OGJA 1FPN3 5CB7A 3LWCA 5JSOA 1ENRA 3VBOB 2AGSA 4BIFA 5KXBA 3Q8CA 3IBMA 1WLDA 4ISRA 2XGXA 3AC0A 1W3XA 4W6XA 3E97A 1NXD1 1PNGA 2GC3A 1VBB1 3DEMA 3KM5A 3ZKUA 1JHJA 5LBFA 5B4NA 2WC2A 2XJUA 1VBD2 3EQEA 1KJLA 4YM0A 2W52A 1UY2A 4LR4A 1QJU2 4BYYA 4IEVA 2ZGKA 2VUJA 2W1WA 4Q8LA 5ABJB 3SCFA 2R1DA 5C8CB 2YFUA 3BOPA 3Q8EA 2XQRA 3FHIB 5L9BA 4P00B 3I2HA 3ZSLA 1GNZA 4E4ZA 3THCA 3U37A 3LE0A 4QD2A 4V2VA 3WT3A 3PJQA 4CSWA 3E5UA 4FQ4A 1YQ8A 5DN2A 5LCWL 5FDBA 2W0XA 2ORXA 4UF0A 1QQP3 1R1A1 1UD1A 3KT4A 1UPIA 4AK3A 2DF7A 1AYM3 2GZWA 4RQPA 1AX2A 1HV1A 4K8RB 5IAVA 4N8MA 4O61A 1PMJX 2KR2A 2R073 2XBO1 3WD5A 1QJZA 1DQ1A 5DZGA 4NWWA 1SPPB 2W3JA 4UYBA 2XB6C 3MF6A 3WNKA 1W28A 1WMDA 2GMMA 4Y5TA 1RUG1 1W0PA 1GYKA 5FY0A 1XNAA 2KXLA 5FY1A 1LHVA 2BNNA 3DPRC 4LHSA 5L9RA 4P5HA 2HWC2 2A6VA 3W20A 3ZM8A 3CJIA 5HCHA 2XL9A 1UPSA 1H30A 4OFGA 3HQUA 3FJSA 1L7QA 4FOVA 2DDUA 2VR4A 3C3VA 2G1MA 1X36A 1AYN3 1HRV2 3M3EA 4JAAA 5F6LB 4NIGA 5ISLA 5FCCA 2WFF2 3NO8A 2WZEA 4XF0A 4YW1A 1RUH2 1D7PM 3K75B 3J4UH 3POWA 1MZFA 3GALA 1K42A 3RWKX 1BVVA 4CEWC 4N7IA 2WKKA 4ONUA 4LKFA 5LB6A 1UU4A 3ZPYA 4UBHA 4BA6A 2ZHLA 1W8TA 3ZIWA 1KITA 5IYYA 2W1QA 3MICA 4SLIA 2EF6A 4PI0A 4IV1C 5LK5A 3KHBA 2ZMKA 3E6BA 1GLHA 3ZSMA 3WNPA 4CPBA 2MNGA 2RG4A 3NNGA 4EYUA 3DECA 5LZ6A 4N90A 1POQA 3CDZB 5FBZA 3V0BA 4HLTA 3V0AB 4NHLA 4RS5C 3ES4A 1MQTC 4A6SA 2O0OA 2VC9A 4S2FA 1NYWA 5FKCA 2D44A 2QZ3A 4LEJA 4AOCA 2EAKA 3ES1A 1K5MB 5A3PA 2E33A 2P17A 3ACFA 4URTA 1HQNA 1HRI1 1ZRDA 1OOPA 4IGPA 3ZDSA 4Q1RA 3NNLA 1VBD3 4E27A 2EAAA 1ZBE3 3KF3A 2BOJA 3E1F1 1QJU3 3W21A 2JG8B 3OD4A 3ZXDA 1NUKA 5AVPA 5ACA1 2L9LA 4F8AA 1N3QA 1C5IA 4CDWB 2HBTA 1OUSA 3JQXA 1OH3A 1SLLA 2KM2A 4A44A 4DZGA 3T0AA 3WEZA 3BU7A 4OHZA 4YM2A 2C9AA 4XCBA 4DINB 4YZ1A 4XF3A 2ARCA 1G9CA 5FPLA 3EO6A 2QQLA 1CR7A 1ZZ6A 4IEZA 1FPN1 1OQ1A 4PQ9A 3ZSJA 3WNOA 1W6MA 4LHLA 1O4TA 1W2OA 4WZFA 5H9RA 1QDOA 5A7NA 5H9PA 3SXWA 1S2BA 3I97A 4MGYE 4CP2A 1YJKA 4JQTA 5EHDA 1SZBA 4GA9A 1A3KA 5DMYA 2HWC3 3VZLA 5FPAA 3ZLIA 1ND3A 3NAPA 1JZ7A 1C8NA 3QOPA 1AR73 3N9MA 2ORZA 2RMU1 5KXDA 1QJY3 3I49A 4RR3B 3GBFA 1HRV3 3A0NA 4PDWA 2W08A 1KFUL 3VUOA 1A8MA 3A7QA 2WFF3 1JYVA 3RS6A 1VRH1 2F6BA 2HH9A 1MS5A 2W2IA 4DEVA 3NQHA 1W6QB 3I3BA 3WG4A 2A6YA 4BQ3A 3DUIA 1AYM1 2A73B 3A4UA 3JD72 4FPEA 4H7LA 3O1VA 4XHBA 1V9U3 2AACA 4AVVA 4AZZA 2HYKA 4ZONA 2AUYA 3SH3A 3NL1A 4FTSA 3BKZA 3GZUC 5FZAA 1D2SA 4LBQB 4Q27A 4CU8A 3VD4A 3E6CC 3CJIC 3PVOA 3VGIA 1C5HA 1RUD2 5KXCA 2R0FA 1H2NA 3IAPA 3LDRA 1WMXA 5F5AA 1LESA 5FTTC 5FYHA 3T08A 1Y9QA 2O14A 1PVXA 4GH4B 2BBAA 3PL0A 3UV9A 3I8TA 1S0FA 1WW6A 3AMPA 1FMD2 1H4GA 4RYDA 3WW2A 1H0BA 2V09A 3NJYA 4XMIA 2ZZJA 3H8OA 3L9JT 4AHXA 3AZZA 1UY4A 3T2OA 4GWJA 4XIOA 1PMHX 3KCYA 5JR2A 2YBKA 4JC1A 2VTXA 4Z2AA 3VBHB 1Z7S2 1KDKA 3U75A 1NQJA 1H6XA 4OI2A 3D0SA 2J1VA 2WS91 2ADDA 2E53A 2D6OX 2HWF2 1F9KA 3MLKA 3UYJA 4A4AA 3C2UA 4BQ2A 5JOWA 2WSVA 3SLIA 2R6QA 2ZHKA 5HI0A 3PUAA 1DQ2A 3FN9A 4AVAA 1OA3A 2P3KA 2VCMA 1PO12 2ARXA 2D5HA 4K6BA 3ZMOA 2LRPA 4E8DA 1BEV2 2D5FA 1IQAA 1GSLA 4H7MA 3WF1A 4BIOA 2H0BA 2DBIA 2JDHA 1NCRA 2ADEA 2OZJA 2JDNA 3QCWA 3ZIXA 1QJX1 1SFPA 1S0BA 3ENRA 3POIA 5LATA 5CVRA 1H1IA 1MVQA 1VJ2A 2V5DA 4XPVA 2Q1MA 4KI5M 3LGRA 1K5JA 2CV6A 5BNOB 1B09A 2A7AA 2IFRA 1H2KA 2W1UA 2CDOA 3I2KA 4J6GA 1HJGA 1RINA 2WQ8A 3U1XA 1VBD1 3E5XA 3J8F2 5A7QA 1QJU1 1RL3A 3WW1A 3LF7A 5HV0A 5E8AA 5F5QA 2PHFA 2K9ZA 2XJVA 5FMCA 1SMVA 5IK8A 3H8RA 1CX4A 4K7JA 2PXJA 2BOIA 2J7MA 4N43C 4Y1VA 3UESA 2UYAA 5FR3A 1J59A 2WBKA 1QNYA 2ZGQA 5DZFA 2XONA 4RGKA 1PX3A 2WO1A 3HWJA 3OUJA 4FCAA 4I01A 2P34A 1SLBA 3WDUA 5K9YA 2WNVC 4C1XA 1ULOA 3RZZA 2ZCWA 2WZR3 1WW5A 1LODA 5IVFA 2VO5A 2NZ9A 3MIHA 4RFRB 2WN3A 5E88A 2WNEA 2UURA 2VQUA 2PQQA 1CAWB 1RUD3 1YIPA 2JE8A 1CZSA 1ND3C 2QJVA 2YY1A 4Y1UA 1SHWB 4O9EA 4A45A 3I3EA 3KCCA 1DQ5A 3AMHA 2UU8A 2PYTA 3DKQA 2E6VA 2RR13 3OUIA 4PDWC 1MPXA 3MFAA 1DP0A 2HWC1 1FMD3 4KBZA 1J58A 1JTZX 4B4QA 4E4SA 1S2EA 4BOWA 5DAQA 5FZHA 2A6XA 4W6YA 4YRDA 1C3HA 5FUIA 1YQ6A 4AEDA 1PGL2 1SQ4A 4W50A 4XVHA 2WFF1 2DCZA 2KD7A 1O8PA 1Z7S3 2AC1A 5CZKA 1RUH1 3S0MA 5FZ0A 4MV2A 1UKRA 1MEC2 4Y22B 2VOTA 3THPA 3ZN6A 1RMU2 4DMIA 2HWF3 3AKQA 2RS11 3FHAA 3WX5A 2JE9A 4QX5A 5J96B 3BI3A 4JKLA 1Y9MA 4DUWA 1PO13 2BBVA 1BEV3 2DWRA 4XILA 3PJYA 1FATA 3I59A 4TXWA 1COV3 3BPZA 5BXXA 2VAUA 4DPNA 3ASIA 4DO0A 3ON7A 2UWBA 4KH9A 1HQLA 1QMJA 4RFT0 1Q5OA 4AEKA 4LLOA 1W6PA 1CIWA 4WVWA 3ZMNA 4YARA 1VBE3 1UCXA 4LTAA 1C8M3 2XLGA 1BLZA 2EICA 3MYXA 2VTFA 3KF5A 5H9SA 5LA0A 4DFSA 3OGSA 2HEYF 1WGPA 3GBWA 4IE0A 4QPWA 5IWFA 3URFA 4ZY9A 5FXWA 1LTEA 3J8F3 3OBRA 3BODA 2JIGA 3AVSA 4OHYA 4PBPA 1OURA 1UKGA 1POV3 2C6SA 2DYCA 3WVJA 1JUHA 1HN0A 1LRHA 1OUXA 3MW4A 4YG0A 5I0TA 1NCRC 3RSJA 1LOBA 1ULEA 3DXUA 2D6MA 3NV2A 4HONA 2C5DA 5BV6A 1BMV2 3NV4A 2BEOA 3AL6A 4WM7B 3TNPB 4B1MA 3RZMA 1IS6A 5JUVA 3UGGA 3GCXA 5IVVA 2XHNA 1ZNPA 5K0UA 4LBJA 4QXHA 3T4VA 1L7LA 1W8NA 4MADA 1F5FA 4MGIE 5LRRA 1AJKA 4Q26A 1M06G 2DVGA 4P9LA
chains in the Genus database with same CATH topology
4HVOA 3WNXA 5D8AB 3JZVA 3T1LA 4AI2A 1OI6A 4H14A 3MW2A 1BCXA 1NA1C 1RC6A 4JGYA 2P2KA 4MYEA 1O4ZA 2WINB 1IPKA 5EZWA 5EJ3A 5A33A 1AL22 2ERFA 2Z42A 3E6DA 3NV1A 3AXDA 4FPHA 1PO21 3H7JA 4HKWA 3WUCA 4YVWA 2MEV2 4XQWA 3KS7A 3W59A 1MEC3 1RMU3 5JPMB 1BQPA 2VW1A 3JD71 4MXWB 5JCTA 1FOD2 1ASJ1 1CQ9A 2JXAA 3O12A 2YHJA 1RUF2 5L19A 2FZ1A 1N47A 5JOXA 2R042 4M0NA 3AMMA 1RUD1 4AW7A 2O8QA 2EXKA 5JZGA 3OY8B 1IKQA 4XBQA 1H2LA 2XUMA 4YYOA 2GNMA 4AEDC 2Z5WA 4OUSA 5CA6A 4XIKA 4YFWA 4M01A 4K1ZA 1LJ7A 4L97A 3UKNA 3HQXA 2XLAA 5LEJA 4YG3A 4EN7B 2CGOA 2JJ6A 2BNOA 1AXYA 1AUYA 2VW2A 4DS0A 2R0HA 1QOTA 4Q4X2 1Z7S1 2B42B 3G6JB 4BQ1A 4EROA 2VNRA 2PAMA 1QXRA 2VOVA 2HWF1 4R9CA 1LU2A 2A75A 1LOEA 4QQOA 1WCSA 3BCWA 4COVA 2VH9A 4Q0UA 4BWOA 2JG9A 4GALA 1LGBA 5JOZA 1BEV1 4P9WA 2C0ZA 2GALA 1B35C 1Q8VA 1TNFA 2A70A 2DCKA 4M3CF 2CWSA 4MZUA 4Q4Y2 1YHFA 4RS5B 3VBRA 3KQRA 4TYSA 4CDUC 4G4FA 1CJPA 4AXOA 4I0WB 3V56A 2PELA 3AM2A 4PJYA 1XNCA 1DIWA 5FLIA 3J8F1 4DNYA 5KC5A 3RNSA 1ZRRA 4I0AA 1AL23 3ZXAC 2OUJA 5FQ0A 1POV1 2TBVA 3U4XA 4YGEA 2OW4A 5K0UC 2D6LX 5T52A 3HN1A 1YFYA 3JB8A 4YW3A 3WP5A 4ITCA 1DBNA 3IM0A 1SCSA 1FOD3 5J37A 4JTNA 4ZKTB 1EPWA 5FPZA 1V70A 2LALA 4I3PA 1G9BA 2QQPA 1LHWA 2XJTA 4FPJA 2ZKLA 2JECA 2R062 3VHNA 4R9DA 4IEQA 4D3WA 1UMZA 2QDRA 5K7PA 4B7EA 2PA7A 5GKAC 5I8SA 5IT6A 1ND2C 1KFXL 3ZO0B 4YVWC 3VBUB 1LOAA 2A3YA 2D3SA 2VGDA 1Q56A 1RJ8A 2YMZA 4AE2A 4GQ7A 1PGL1 4NHMA 3P3PA 4FPOB 5FMOS 4Q4X3 4CYDA 3CU7A 4XOGA 1ZZCA 1RMU1 2RHPA 4AFBA 1UZZA 2VY0A 4LO4B 3HBZA 2HWD2 2ETEA 5EYYA 4Z1VA 5JZGC 5LK7B 1PZ8A 2TEPA 2XH6A 3D4KA 2E9QA 2Q1ZB 1BYHA 4NR1A 4PIYA 2AYHA 1X50A 2X5IA 3AX4A 3IDCB 3M7AA 4YVSB 4CDXB 4I3GA 4XMAA 1H8TB 1ZYBA 3MGUA 4K20A 2AR6A 3B9CA 2XL7A 4LBQD 1VIWB 5L7OB 1JBCA 5KC6A 1BK1A 1OHFA 3VBFA 4P9IA 5F1RA 3H7YA 1UX6A 1J1LA 1SFNA 2GU9A 1OPOA 3CF6E 3FMGA 1SLIA 2ZGOA 3ZYGA 3VBSB 1OSGA 1VAKA 1MS8A 2JG9C 1WLTA 4FBFA 4IEYA 3I7DA 2ZJCA 2ZGMA 1PK6A 4C0HA 3KCXA 4HETA 2DUPA 2VOXA 4XFHA 2ZX1A 3PNAA 2WWSA 3LA3A 5EWSA 1TMF2 1AXZA 3AZWA 3VBRC 1XYPA 3WDYA 4CRQA 1PGW1 1GANA 2LTNA 4BLJA 4CP0A 1OQDA 2Y38A 3MFCA 3IDEA 1AR62 3RMXA 5AC93 2R063 4XQDA 3WG3A 2WA4A 1XU2A 1G9AA 4JVAA 4Y20B 1QQP2 2PAKA 5FPXA 1AL21 2ZS6B 4PCRA 4RA0A 3FWEA 3LCPA 5CG9A 3O0XA 1H9WA 2MEV1 4GB32 4JDNA 1DGLA 5GZGA 1PVC2 4JDMA 1EYBA 2GNDA 3ACLA 2RE9A 1GZWB 2E7QA 4N43B 1G86A 1AR82 1RHI2 2HWD3 3HIFA 1FOD1 1W6MB 2EXJA 1RUF1 3DV8A 4V1PA 1Z78A 2WNVB 3MIGA 3PVNA 2R041 3B01A 4MVTA 4AQ6A 2PFWA 2XJSA 2ZGTA 1A78A 2WT2A 4HFSA 5T5LA 1CAXA 5J7MA 1FI2A 1SBFA 2WNUA 1VBC2 5D1IA 3T2TA 1HDKA 1YWKA 4AFCA 5CBLA 3VKFC 3I54A 1WCDJ 5C4WB 4Q4X1 2IXIA 2PLV2 5CNAA 2DCTA 3WINE 2X5IC 3B9IA 2D6NA 3KMHA 4LNVA 2VU9A 2VULA 1HW5A 2WQ4A 1LECA 1DF0A 1IHMA 1TMF3 3RI9A 1BJQA 1XXNA 2PAEA 5GJ6A 3IPVB 3OPZA 4XF4A 1MZEA 3VBFC 1ULDA 3R0RA 3RI8A 1ZBE2 1ZBA2 3ME2A 1RUNA 1IKPA 1AR63 4P9XA 3ZFFA 4YW2A 1MACA 3U10A 4Q4Y1 3DGTA 4FPKA 1DG6A 4W6WA 1NXMA 2NYYA 1GQGA 1H1MA 4FPFA 1PK6C 2XPJA 1ENXA 3AFGA 1DQ6A 2WT1A 4CTEA 2GMPA 4QPGA 1FNZA 2NQYA 2GAUA 3H0OA 2ZBJA 3LB9A 4QHBA 2BFUL 4DXZA 1JUIA 4GB33 4Q0PA 1MS0A 4XZPA 1RUJ1 4LA3A 1PVC3 3FLTA 4D94A 4MGKE 1F31A 1PZ7A 4BMEA 4INDA 1AR83 1RHI3 4Q0QA 4JRLA 4FPGA 4XFAA 1C4RA 4KGQA 3UJQA 1AR72 4XXAA 1QJY2 4HPKA 4L99A 2KA3A 3LA7A 3E5QA 1WCKA 3M3IA 4RL7A 4CDQA 5A3LA 4X6QB 3VHOA 3TN92 1VBC3 1ZRFA 4Q4V2 1V9U2 1NA1B 2ES3A 2XWJB 4N53B 1NE6A 2PLV3 5T3NA 2A5ZA 2NPIA 1XNDA 4A3XA 4KQ7A 5KHGA 1D4VB 3ZFGB 4QQHA 2HWD1 2DTYA 3LAGA 3GZAA 5CFDA 5CU1A 4FPCA 2DU0A 4FO9A 2WNUC 1FNYA 2QUOA 3JBG2 5FO7B 3SCHA 5E16A 2JENA 2BWAA 4B8EA 2F4PA 1DHKB 1ZBA3 3ZVXA 1XRUA 3WUDA 1AR93 2VVEA 2YGLA 4I30A 1I5ZA 4L8QA 4LBKA 1LENA 1MS1A 1V6JA 1G7YA 1UN1A 2PHRA 2YV8A 4FOWA 4OZXA 5HCFA 2X53S 1HX6A 2ENRA 3ZN6B 4AEMA 4META 1N1YA 1WUVA 5I91A 3KT1A 1MZ6A 2IC1A 2H0VA 1PHMA 2HJIA 2HKXA 2PHXA 3TYJA 3D0JA 3S7EA 1TMF1 4YNIA 3W58A 3ZFFC 3OYWA 3B3QE 3MLLA 1CAVA 2DUQA 1MS9A 1LOFA 2JDZA 5JOYA 2EVXA 3RYKA 3B02A 4QPGC 1B35B 2D93A 2RM23 3OCPA 3V65A 1R092 1REFA 4RQPC 5A32A 3BTAA 2FZ2A 5KXEA 1BZWA 4CDUB 1LOGA 1QQP1 1S0GA 2DCJA 3VZMA 3TN93 1ZM1A 4ZU5A 4YFZA 2UY9A 5HCAA 4Q4V3 3ZFEB 4R9BA 5JVVA 4F7ZA 1NCQB 2VNGA 2WZR2 5BNNB 2FQPA 2R071 4HKOA 3S6PA 3VDDB 1DQ4A 1O3TA 1H4HA 4QPIB 3RRDA 5FRAA 2E51A 4K1YA 1H2MA 4WM8A 1AR81 1RHI1 2RR12 4J1WA 1LEDA 1XYOA 2RS32 1O4YA 1YFXA 2XHKA 2XLFA 5J09A 1YCIA 5BYNA 3OF1A 5JR7B 5IK4A 4FTBA 1N3OA 1AYN1 2XJRA 3JBG3 4HANA 4AQTA 3TOJA 3VBOA 2NP0A 1ULGA 1XE8A 1LB2A 1VBC1 4GXLA 3WQ0A 2ZTNA 5T50A 2V73A 3U11A 1ND2B 4LULA 1SBEA 1FV2A 3L2HA 4K21A 1LGCA 3CO2A 4YVWB 4C90A 5LEKA 4G9SB 4KG8A 4AFMA 3V64A 5ABJA 4Y5Z0 5C8CA 2ZABA 2PLV1 4LO7A 1COV2 3ZXEA 3VL9A 3VZOA 1AZDA 1OOPC 4Z92B 1FX5A 4G3YC 1KS4A 1VBE2 3KT7A 1C8M2 3IKWA 3RJRA 1J3QA 3KD4A 2GC1A 5JZGB 3AKTA 1JW6A 1FV3A 1WD3A 4PIXA 1AF9A 3FLRA 4K9SA 1VALA 1ZBE1 1ZBA1 4TZDA 5AFEA 3N36A 4YGBA 3B69A 1T6GC 3EBRA 4AVSA 2RS52 2VMGA 5FMOL 4KWKA 3GYDA 1R093 1IS5A 2A3WA 3T1MA 1V6LA 1DLLA 1ULCA 4B29A 1VAMA 4ASLA 4NPRA 2UWAA 1LHNA 1UU6A 1CVNA 2VQ0A 5FAXA 3NAPC 3N35A 2YXSA 1LOFC 5C8WA 3RPQA 2BVBA 2Q8OA 3Q9OA 1W6NB 2RS33 1D0GA 4P14A 2A3XA 2D98A 3B93A 3QLQA 3WDXA 1EAH2 3WR0A 4OVEA 1AR71 2DCYA 3AJZA 2E63A 1QJY1 2Q4SA 5JIAA 4WVMB 1ALYA 1HRV1 2IXCA 2MPFA 2BGCA 4IEXA 1U5YA 4XFIA 1W2UA 5GZEA 1S0EA 1HXS3 1K5MA 5FOJB 2TUNA 3RYRA 1Y3TA 3TN91 5FQ0B 3A0KA 3SH5A 4WVVA 2B39A 1MS3A 2EXIA 4Q4V1 5JDBA 1V9U1 3WLUA 4DB5A 4WM8C 4QQLA 4Y1YA 2JG8A 4IV3B 4KBBA 3VZJA 2BFUS 1PIV2 5JLVA 1R1ZA 4S2DA 4CDWA 1IS3A 1V6NA 3ZSKA 1X8MA 1V6OA 3VBOC 2DVAA 2WIIB 1OMIA 1XNBA 3DL3A 3JBG1 4LO5B 1AX0A 1VP6A 2YGMA 2BQPA 4QGLA 1S0IA 5ABJC 3JCIA 1U5ZA 2NLRA 2RS53 2DVDA 3IWZA 1RJ7A 3TBDA 3SCGA 3MPPG 5TSWA 3KSCA 4JGZB 4B4RA 4IESA 3ZXLA 4EN8B 2ZOEB 4EN9B 3VKNA 4RR3A 1CAUB 1RUI2 2BW8A 4R52A 4KL1A 1XYNA 1OKQA 4HT1T 4JV4A 3SMHA 2WT0A 4FSJA 2K0GA 2X5IB 2I07B 2B46X 1TE1B 3K48A 3USUB 3VHRA 2D40A 2ARBA 4WVZA 4DRRA 2Z79A 1PGSA 2PN5A 4LBQA 2I2SA 4XJ8A 5BUVA 1CJDA 1EAH3 3H1WA 4E2SA 1OPMA 2ILMA 4N7UA 4ZU7A 1WLCA 4GH4A 1YXWA 5GLWA 1R091 1JXNA 1O3SA 4RHV2 2XWBB 2RJLA 4JRAA 3TB0A 4QGMA 3VV1A 4H55A 3H3UA 2BWCA 5DXDA 3S30A 5JMCA 3EXUA 1V6KA 5DUUA 2WZR1 3VBHA 1ULFA 1O3QA 1QOSA 1KQRA 1OLRA 1PIV3 5EFUA 1EPZA 1Q3EA 2CYFA 1EP0A 3WV6A 2ZAAA 5KHJA 3GHNA 4TSVA 3MZHA 2RR11 2DFBA 1FMD1 1ZZ7A 4QU2A 3CL1A 3GBGA 5GALA 1G9FA 3ETQA 4L2NA 1QXJA 2UYBA 2ZHNA 5FLJA 1QKQA 4Q1PA 4I2OA 5LRSA 3LA2A 1X8EA 2Y26A 1U0AA 3DPRB 3LOIA 4XW3A 3SISA 2VW0A 4E4DX 3ZXJA 3UK9A 4NVPA 2YDEA 3MW3A 4XFBA 3M3OA 4U36A 2FBEA 5FO9B 2JG8C 5BNOA 1YIFA 5L36A 3RQ0A 2VMIA 5SV8A 2GC0A 5GLTA 4AGGA 1SLTA 1YRZA 4CDWC 4OHWA 2DVBA 3LKJA 1G6NA 1VB4A 3ATGA 4CEWB 2ZGPA 1MS4A 1PO11 3NWKA 5C6CA 4EWDA 4KNCA 1COV1 2OIIA 4IV1B 1HIXA 1RUI3 2ZHMA 3HT2A 1LU1A 2CY6A 4LO8A 1NG0A 3H3ZA 1VBE1 3ZX7A 3R6SA 1C8M1 4HKLA 4X8PA 1MQTB 4ATEA 1VB2A 2AH2A 2XJPA 4M3CA 2DVFA 4P9YA 2DUOA 4K8FA 3D82A 1EY2A 3AZXA 4OI1A 4DQAA 2D3RA 4PLOA 1AJOA 4RGGA 5DG2A 1RUE3 2RS51 1DZRA 3WP4A 2BVVA 4RR3C 1I6XA 2HWB2 3GNEA 1J1TA 4RHV3 3FE5A 2VECA 4XYXA 4QM9A 4FAGA 3BB6A 3M3CA 1QY4A 3NKGA 3HMYA 2IFWA 3ZXKA 2WFPA 5JI7A 4IEUA 1I3HA 1GV9A 1AXKA 3ZYJB 1R1A2 4LBMA 4Q2FA 4Y22A 4JGYC 4YGDA 3SNMA 5AC92 3PMEA 1YJLA 3VKMA 4GH4C 4R4XA 3N7JA 4PIZA 1AHSA 2PHUA 4MH0E 4FQZA 1Q8PA 3NKTA 3FZ3A 4HZFA 4OULA 3WDWA 1ZZ9A 4HN0A 4COZA 3GHMA 1V00A 4QT6A 3WW4A 4AQSA 1YLLA 2B5HA 1ZA4A 4PLMA 1PM7A 3APBA 4QPGB 1MEC1 1W6OA 4RQPB 1YO8A 4LHKA 3AB0A 5DDJ2 2GH8A 2ZX0A 2X29A 2R32A 1XU1A 5DZEA 2YUEA 4AI8A 2Z2SB 1O3RA 2A71A 3P3NA 4LE4A 4XFFA 2OZ6A 3AXEA 1PIV1 4XQ4A 3ELNA 4A7ZA 3X29B 4PF5A 1HLCA 3CJIB 2R1BA 4WM7A 5JAXA 4BZ4A 1X82A 5CFCA 2HWE2 4ZU4A 1D2QA 4A7KA 3JB4C 4HPKB 1URXA 5BNOC 1KXGA 3J9SA 1H1AA 1CD3G 5HBAA 1VBB3 5D8AA 5KHIA 1UL9A 4TWTA 2IXKA 2HWB3 3AFKA 5AVAA 4LO6B 1BMV1 1JYIA 2W68A 3KGZA 5JPNB 1TME2 2NMNA 3V0BB 1O7FA 2H6BA 5H9QA 1QWRA 1RUI1 1LKNA 4HSLA 4Y1ZA 3WQ7A 3WOGA 4Y26A 1RITA 4UW3A 1R1A3 3I2DA 3NV3A 1ONAA 5JIUA 2R30A 3O5SA 3AYCA 4MXWA 2XBO3 1OOPB 4QQPA 4XJAA 3R4UA 1AL0G 4GKYA 1JHNA 3L2YA 1QF3A 2WJSA 4OHVA 1A8DA 3IIAA 3OY8A 1L3JA 2O8OA 1UIJA 3M4FA 4Q0VA 1BVP1 2VNOA 4RHV1 4GKXA 1LHUA 4S2HA 2RMU2 4UW6A 1OA2A 2P3IA 1SACA 4BPZA 5DDJ3 1VRH2 1VAVA 3GZTB 1C1LA 1ZVFA 3LOBA 2CAUA 1SLCA 4YM3A 4XJWA 3OYWB 4QQ2A 1CAVB 4AVBA 4AHZA 4EN6B 3RDIA 1IGOA 1ND3B 3NAPB 4LE3A 2HWE3 3AYDA 5GLUA 3OGGA 1G9DA 3H1MA 4PDWB 4ES9A 3AP9A 1WLWA 4FOYA 3O0VA 3PMSA 3WG1A 2ZMLA 1GZCA 1M4WA 4XXPA 4CEYA 2ZAHA 2W39A 4EN0A 3N7MA 4C1WA 1WBLA 1DYKA 2E7TA 1RUC2 3AP6A 3LSDA 3JU9A 1IS4A 2WS92 3FFZA 5CFCC 1TME3 4F83A 1WBFA 3ILNA 4BLIA 2CAVA 3LZZA 4YZ4A 3DKWA 2IXHA 2GN3A 4AI0A 2VOKA 4DY5A 2UY8A 3MI8A 5CG8A 2AREA 1AR92 4E2QA 2HEVF 3DF0A 4YGCA 1W39A 2DV9A 2IWGB 5BY5A 1QJX2 5D8AC 2CGPA 5DUWA 1FYUA 4FT8A 3RMYA 4HSJA 1ZREA 1OD5A 1S2KA 2Z69A 5T5PA 5IUQA 2HWB1 2IXJA 5F9TA 5I8TA 5I0RA 1GFF2 2G9GA 3VBUA 4AEJA 5J3UA 3TAYA 4BM8A 4AI1A 2RMU3 3WP6A 1NCRB 3VN4A 3KZ4C 1GZ9A 4L9BA 1YI9A 3M70A 3N3HA 2ZKNA 1VRH3 1OQEA 2D6KA 4AQ2A 3HT1A 2XVLA 5AC91 2DTWA 4Z82A 2VXRA 2R061 2JE7A 2RM22 2H6CA 5DUVA 5KBFA 2ZACA 4HVRA 4AFDA 2G9FA 2VMHA 4B3NA 5AFBA 2SLIA 4HMZA 5I0UA 4YVSA 4CDXA 1N1TA 2WA3A 4AFAA 1H8TA 2FHRA 3N7KA 3QH6A 2RJKA 4KG0A 2GDFA 1I1EA 4DRVA 1BKZA 5SV5A 1UZYA 5BNQA 2VVFA 2QZ2A 3PVEA 5C33A 5L7OA 1KRIA 1LULA 1WMEA 1UU5A 2EXHA 2OPKA 3ILFA 2QCSB 1DGRA 1PNFA 4L92A 3M3QA 2HEWF 5DDJ1 1V6MA 1NZCA 1FXZA 1QHDA 2CL2A 2CTVA 3K51A 2ZGRA 4LLFA 3ZYIB 5C9AA 3VBSA 1RUC3 4E9KA 2I45A 4EJRA 2JICA 2WS93 3NVCA 1FAYA 5CADA 4IQPA 2RS12 2BNMA 1JH5A 5T5OA 4U2AA 5FO8B 3ZXFA 3INAA 3B7MA 2JX9A 2HWE1 1DYPA 4IEOA 2A6ZA 2Q30A 1V6IA 3MIDA 4AEDB 2OYZA 3AZVA 1LHOA 1QJX3 5GLZA 4CEYC 5KHKA 1XE7A 5FREA 1DZQA 1REDA 1QGLA 2QKDA 2XJQA 5T5JA 4YW5A 4HN1A 2YYOA 4EWEA 4ASMB 3WQ1A 3BALA 4Y20A 3I59B 1C28A 1TME1 1VBA2 4XEZA 1BBT2 4O9GA 3USSA 4WBBA 4Q29A 4A2UA 4L11A 1W6PB 1RUOA 2OA2A 4NHKA 4XFCA 1PZ9A 2NM1A 1AR61 5IK5A 2CWMA 4LT5A 3R05A 1GZWA 2C1FA 4N43A 4QGNA 5E89A 4YW4A 5J98B 2EIGA 3CNAA 1SDWA 5BNPA 4HL0A 1DZTA 4KGGA 1KD7A 3EJKA 4HVQA 2WNVA 3VBUC 1GR3A 3U0ZA 5GLVA 1KJRA 2QVSB 1ZX5A 1YUDA 3WG2A 1IZ3A 4R9AA 1N1VA 1RVF2 4GB31 4X8NA 4MGZE 4JTOA 1PVC1 3PHMA 1ENQA 1PO22 4OHXA 4NO4A 2TNFA 3TNQA 2WL1A 5K0UB 2WLQA 2DU1A 3WCRA 4GIQA 2AZ5A 1SCRA