4HVRA

X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
total genus 34
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvrA01
4IETA 3FHIB 1X7NA 3C3VA 4OLLA 2ATFA 3H1YA 2CAVA 2IXLA 4XFCA 3OCPA 1NXMA 2PAKA 3NJZA 1YFWA 4I0AA 1YUDA 2XL7A 2PHLA 2FMYA 2CAUA 2PFWA 3ES4A 1YLLA 3ETQA 4KWJA 3M70A 3MYXA 2QJVA 3DKWA 2GC3A 4AQ6A 5K8SA 2UY8A 3CO2A 4D7TA 1Q43A 4HSJA 4I09A 2VECA 2Q1ZB 2XLFA 5BPXA 3QACA 5KHKA 2CV6A 2B8MA 4IEQA 3I54A 4I01A 4MV2A 4E2GA 3MZHA 3JZVA 3RPQA 5FQ0B 3OTFA 4E2SA 4XFHA 4MGIE 1CAWB 3E97A 5LRSA 2XKPA 3H9AA 3B02A 4EWEA 1I6XA 5FLHA 4O9EA 3LWCA 1YWKA 3TNQA 3ZDSA 4XF0A 1CX4A 2I45A 1OI6A 5I93A 2XGXA 3FFQA 5CADA 3EBRA 5I91A 3CF6E 3FX3A 4FT8A 3MDPA 2Q0AA 2GC0A 3H7JA 4IEOA 3WW1A 4MX3A 1RL3A 4YYOA 2ETEA 4LLOA 4B29A 2Q30A 2D40A 3E6DA 3H1MA 2QDRA 2GC1A 4XF9A 3EJKA 4MGKE 5KHJA 2KXLA 1ZRCA 4KU8A 3U11A 3LA7A 1NE6A 3L2HA 4TLFA 1ZZ7A 1QXRA 4LA2A 4Q0PA 2HKXA 4AXOA 4HMZA 2K9ZA 1L3JA 3PNAA 4PIZA 5BXXA 1U12A 1H1MA 1UIJA 3RYPA 2P17A 4PIXA 4RD7A 3N4MA 1ZZCA 4I02A 1LRHA 1QY4A 3BCWA 2IXHA 4MGYE 1SQ4A 4IEXA 4EWDA 5FPZA 4BHPA 4HVOA 3OD0A 2ZKLA 5C8WA 1J1LA 1XRUA 3I7DA 5JCTA 4L2NA 5AVPA 1ZRFA 1WGPA 1H1IA 4YNIA 2GH2A 1EPZA 1G6NA 1HW5A 4N9HA 4XF4A 2ET7A 3H1WA 3UKNA 2PYTA 3IIAA 5KHHA 3G7DA 4IEWA 2Q4SA 4Q29A 5FDBA 1PMIA 3E5XA 4Z07A 3BALA 3RYRA 4JV4A 1O4TA 5I0SA 1J3QA 3CLPA 2VPVA 4XFBA 3IWZA 3H3ZA 5LRRA 2MHFA 4LUMA 1WLTA 2CGPA 3I59A 4XEZA 1GQGA 4WZCA 5CVRA 3SHRA 3E5QA 2UYBA 4Q0UA 1XE8A 4WBBA 3GBFA 4I3PA 3R6SA 1IPKA 3S0MA 4HBNA 1LB2A 1VP6A 2PTMA 1VJ2A 3NSTA 4UXAA 1ZRDA 2GC2A 3LOIA 4QGMA 1O5UA 3H8UA 4IEUA 3KGZA 1V70A 2D5FA 1CGPA 4ZU5A 2PAEA 4J1XA 4J1WA 1O3SA 2PHDA 4P9GA 3FJSA 3SCGA 4AVCA 2V09A 4QMAA 5E1RA 1RGSA 2XHKA 3IBMA 3SXWA 4EWAA 4XF1A 2XL9A 1J3RA 1Q3EA 1WA4A 4HN1A 4NVPA 4IEYA 1O3TA 2FQPA 5J3UA 4HVQA 1RUNA 4LUKA 5CU1A 5JR7B 4JTNA 4BIFA 4PJYA 5I8SA 3USSA 1RC6A 3RNSA 4QX5A 4XETA 2WFPA 1YFYA 5EFUA 4I2OA 4HSLA 4JVAA 4Z82A 1ZZ9A 4X6QB 4YARA 1DGWA 1Y3TA 3BPZA 3NL1A 4H7LA 5FLIA 3NW4A 5BV6A 2OYZA 5JSOA 1CAVB 2DCTA 3FZ3A 4DINB 3CL1A 3O14A 3KCCA 2HJIA 4MUVA 5KHIA 2O8QA 1EYBA 1CAWA 4HLTA 2QNKA 2K0GA 3GYDA 5EZWA 4BH9A 3E5UA 1LR5A 4Q0VA 3RZZA 1DZTA 4GULA 4MGZE 4ORFA 1SFNA 3SCFA 1NYWA 4E2QA 2GU9A 3QOPA 1JUHA 2UY9A 1CAXA 3BU7A 3NVCA 2IXIA 5I8TA 1RUOA 3E6BA 2IXCA 2C0ZA 2EAAA 4QGLA 3SMHA 1NZCA 3U0ZA 4K8FA 4FAHA 3FWEA 2Y0OA 2BNOA 1YFXA 1QWRA 3S7EA 5I0RA 2B5HA 4ONUA 2UYAA 4LA3A 4WVZA 4ZU4A 3I59B 2D5HA 4AVBA 4F8AA 1VR3A 2XLAA 3VHRA 3LZZA 4KU7A 4AVAA 3HIFA 3S7IA 1X82A 4QM8A 1UW8A 3NKTA 2OA2A 5F1RA 3EO6A 2GZWA 4IEPA 4IEVA 4LTAA 5J48A 4LULA 4F7ZA 1OFNA 1UD1A 2BEOA 1NE4A 4R8HA 4QGNA 3EHKA 5C6CA 2IC1A 3DV8A 1ZZ6A 4XFIA 2ET1A 2Z2SB 3KSCA 4IEZA 1LKNA 4I0BA 1OMIA 1PM7A 3OF1A 3IDBB 5I8YA 4X6RB 3KMHA 3ST7A 3WW2A 3ES1A 4LEJA 4Q0SA 3WW3A 1UIKA 4OFGA 4PIYA 1YFUA 2PAMA 2QVSB 1ZZ8A 4META 2IXKA 4XFGA 2F4PA 1CAUA 3H7YA 4KWKA 2OZ6A 3H50A 3LA3A 2OPKA 2EVXA 2BNMA 1ZREA 4XFAA 2ZCWA 3EQEA 5KHGA 2XKOA 2H0VA 3IDCB 4YSFA 1ZZBA 5J7MA 3PVBB 4HZFA 5FLJA 1J3PA 5JAXA 4ZU7A 1DGRA 5LEKA 2BYVE 1O3QA 1FXZA 3CJXA 2D93A 1EP0A 2B9UA 5T3NA 3UKVA 3CEWA 3HT1A 3E6CC 3RYKA 4UBGA 1O5LA 3RDIA 3BB6A 3HT2A 4D7SA 5E16A 1ZRRA 1Q5OA 2WC2A 4EV0A 2PA7A 2QCSB 5FPXA 3MPBA 4R52A 3DN7A 1O7FA 4O9GA 1CAXB 2EA7A 1Y9QA 4BYYA 1QXJA 3WW4A 5BUVA 1FI2A 1X8MA 1ZX5A 3D0SA 4N9IA 2XLGA 1X8EA 3DL3A 5I0TA 3OGJA 3TNPB 1O3RA 1UCXA 3H3UA 1FT9A 4XFFA 1UPIA 4AQ2A 3U10A 1GQHA 5FQ0A 3PLQA 1J58A 2H6CA 3KGLA 4JTOA 4Q0QA 4A2UA 5BY5A 3LAGA 1J59A 3D0JA 2GAUA 4HVRA 1SEFA 2Z69A 3LA2A 2E9QA 4IESA 2OZJA 1I5ZA 5JSRA 3M3IA 4UBHA 4KWLA 5JSPA 4FAGA 5D1IA 3ELNA 5KBFA 3HQXA 5FCCA 1OD5A 4HN0A 4QM9A 1YHFA 1IPJA 2MNGA 2O1QA 2H6BA 2VQAA 4L11A 4KL1A 4XF3A 4YRDA 1DZRA 3D82A 2BNNA 4CYDA 3ROUA 4FBFA 4MH0E 5I0UA 1CAVA 4MZUA 1ZNPA 2BGCA 1RTVA 1CAUB 4IERA 1EY2A 3ACLA 3UKTA 5LEJA 1TQ5A 3FE5A 1XE7A 1ZVFA 2IXJA 2PQQA 2MPFA 3SCHA 2N7GA 4QXKA 4EROA 5HI0A
chains in the Genus database with same CATH superfamily
1C57A 1K12A 5FP9A 4UFJA 5DAPA 1ULEA 1X7NA 4QKFA 1US3A 1V6MA 5FR3A 4XFCA 5KXBA 3BKZA 2WS91 3V64A 3NJZA 2NZ9A 1YFWA 3CHXA 3OUHA 3KVBA 1QJEA 4BIOA 5LW9A 4RFRB 4XHXA 2CAUA 5H9SA 4Z8BA 4AEKA 3ES4A 1REFA 2YDEA 5FZ7A 2HEVF 1YLLA 3ETQA 3JU9A 3OGRA 4KWJA 5CKNA 1VRH1 3MEPA 3M70A 3MYXA 5T5PA 4CCNA 3OBAA 4XVHA 4AQ6A 5IFPA 5EJ3A 4GAZA 1A78A 1LOCA 2YUEA 5K8SA 4Q4W2 2RJKA 4Y20A 1C8M1 1WW7A 4D7TA 3A0KA 4KWUA 4QPIB 1ZBA3 1NOVA 1K5MB 1TME2 3KHBA 1Q43A 3ZSMA 4YW4A 2VOWA 3ZIWA 5DMYA 2YV8A 1NA1C 4XJWA 1VALA 3ZFGB 2R0FA 5C3OA 5BPXA 3ZMNA 1U5IA 3OY8A 5DAQA 5F5AA 3I2IA 2YB7A 5KHKA 2JJ6A 1WMFA 2Y60A 2ORZA 3ZN6B 4AVTA 2RR12 4ES9A 4EZ4A 4IV1B 5TSWA 4C90A 1UY1A 2NYYA 3KCXA 3JZVA 2J42A 5CAZA 2QZ2A 4CCJA 5FQ0B 3OTFA 4K6BA 4XFHA 5F5QA 3RMXA 4AEMA 5IVJA 4P08A 1MEC3 1WCQA 1UOBA 4FPOB 1L7LA 4ISQA 3OD4A 1AR62 3HBZA 5IVFA 1JYNA 4NIGA 4CCEA 1MS8A 5CG9A 1LEDA 5BNPB 3A7QA 3LWCA 2K2SA 3KT1A 5HV4A 4GWMA 3ZDSA 4W6YA 4DIQA 5JPMB 3ZXDA 1OI6A 4N90A 4CDWB 2XGXA 3FFQA 3F95A 3AMPA 1HRV3 1V6LA 3K4ZA 4Q26A 1VBB3 4XQ4A 5I91A 1JYIA 3FX3A 5GLZA 4A7KA 1APNA 3AVSA 4E8CA 4LO4B 2GC0A 4NWVA 4PQ9A 4NIDA 3ACIA 3KCYA 1LOEA 2HWF3 5C3PA 4MGQA 2JE7A 4YYOA 1OHFA 4B29A 3ITQA 1W2UA 2Q30A 4LOTA 3V0BA 1YJLA 2QDRA 3VKLA 3MBWA 1LNSA 2G19A 4BQYA 5FYSA 1ZBA2 3Q8EA 3B5LB 2F17A 2JDKA 1ZRCA 2ZEZA 2HBTA 1RUF3 4LIUA 4JAAA 2MEV1 2OQ6A 4YM1A 1G9FA 4GB31 4HANA 2R061 5A6ZA 1IKQA 4TLFA 3VBOB 2PLV1 5AFBA 1CN1A 4H14A 3THTA 4Y1YA 4LA2A 3ZXAC 4XMIA 2VQTA 4EN0A 1REDA 2W94A 4ZHNA 4JKLA 2WT2A 4AXOA 1G8WA 4W4ZA 4Y1VA 2ADEA 2K9ZA 1PO11 1UYZA 3HR9A 3U37A 3LCPA 1NLSA 3NNGA 1F35A 1GZWA 2X5IC 1MEC2 2WFF1 1VBA1 3O1TA 1IZ3A 1S2EA 1H1MA 3M1HA 5LBFA 3RYPA 4PIXA 1DP0A 3JCIA 2JE8A 1AXKA 2B9VA 1QF3A 3VD7A 2YZ4A 3FLRA 4LK7A 1LESA 1LRHA 3O1SA 1HRV2 3AP7A 3ZKUA 1GV9A 1ND3A 1VBB2 5E89A 1VMJA 2P4EA 3JQWA 3N7LA 3IDAA 2OPWA 1I3HA 2ILMA 1V00A 3WQ1A 2E26A 4HVOA 5LZ6A 1IS3A 3I7DA 4CUBA 4WVVA 3T1LA 1DU3D 2FDJA 5A3UA 4ZS2A 3RQ0A 3SITA 5JIAA 2BDRA 3MUZ1 4K20A 4DXRA 1HW5A 1VBC3 4IXLA 3ABZA 2V5YA 2RS13 2PN5A 4UW5A 5FUPA 5KHHA 4DNYA 3W59A 4QXCA 1RUF2 2ZX3A 3E5XA 4FTSA 4LOSA 4Q4X2 2UWCA 2VCAA 2W95A 3OYWB 1HV1A 3AYDA 3J7MA 4YZ5A 4G4FA 3PUAA 1UMZA 1R083 1J3QA 3M4FA 3CQOA 1YQCA 4QDSA 2P6HA 4IE0A 3VKOA 5A3MA 4XFBA 3IWZA 4HONA 3H3ZA 4XUOA 4ZY9A 1UMIA 3UJQA 3NRUA 2A6YA 3AP6A 2VMHA 5FO8B 5FZMA 4AVSA 2C5DA 2QDNA 2ZGTA 2WNOA 3AVRA 3B69A 2VL4A 1JODA 1MS3A 2GNTA 5D2AA 2CGPA 2E31A 5LWBA 1SFPA 3NKGA 1AYM1 5CVRA 5HXVA 1H6XA 1Z0HA 3K3NA 1IS5A 2UYBA 2VOXA 5IK7A 4JGZB 3OBRA 1UX7A 4JGYC 1OVSA 4WBBA 3MV11 5EIYB 3USUA 2CWMA 2FCUA 5KR7A 3R6SA 4AFMA 4HBNA 4PQQA 1OBNA 3T09A 1VP6A 2JD9A 3POGA 3I2OA 3OEAA 4IV3A 3NV3A 1PO21 2YU2A 4UXAA 2WO7A 3LOIA 1JYWA 1K3IA 2VC9A 1O5UA 1GYKA 4IEUA 5EQUA 1VBC2 2FD8A 2P3JA 1CIWA 1CGPA 1SCSA 2RS12 2PAEA 3HNBM 2W2IA 4J1XA 5LBBA 5JUVA 2VTXJ 4ASMB 4DMIA 4TZDA 1WLWA 1W2NA 1OLRA 1LENA 4AVCA 2XL9A 1J3RA 3TYJA 1SPPB 1LAJA 3MIDA 2QE3A 1R082 4LBQD 4HN1A 1QGLA 4NVPA 3GZEA 1NCRC 5FZ1A 1SG3A 4M3CB 2FQPA 4GXLA 3ZPOA 3FHAA 1W03A 1W3XA 3H8RA 3UNPA 1HB4A 2W68A 2XJSA 5DABA 2YFUA 3WG1A 4XJ8A 4AHWA 4RHV1 3U4XA 5A1AA 5I8SA 2XB6C 1SLCA 2VW2A 4QQ2A 2SLIA 2I07B 5FPBA 5C4WB 2AR6A 5L7OC 3PURA 4Q5OA 3R4UA 1VAVA 5ERLA 3ZDVA 4I2OA 4QPIA 1FMD1 1ULFA 4DB5A 1DF0A 4Z82A 1H9PA 3LB9A 3ZXEA 1HRI3 2VMDA 1GWLA 1YRZA 3BPZA 1OVPA 1WW4A 5FLIA 2JE9A 2VOVA 4XW3A 4A4AA 4YW7A 3T1MA 3D5OA 3E1F1 2OYZA 1X9TA 2PHTA 5H9RA 1TE1B 2DCTA 4CP9B 3ZFFB 1W9TA 2CHHA 3WQ0A 3I2FA 3CL1A 3ZKYA 4JX0A 2HJIA 4UFMA 3W9AA 3S57A 2B39A 1DYKA 3GBWA 4WV8A 2LM3A 4D69A 4CVUA 2J1TA 3AZXA 4PBPA 2K0GA 4XYXA 3ZOIA 2R30A 3GYDA 4AI9A 4B8EA 1UPSA 3RZZA 1DZTA 4GULA 3ZM8A 4ORFA 1S0JA 1W04A 2E51A 2VH9A 4K1ZA 4ITCA 3RZHA 1J83A 3QOPA 2VBDA 2UY9A 1CAXA 4HOOA 3RGBA 1HKDA 1COV3 1KD7A 3D6EA 4GJZA 4QB1A 2YMZA 5GJ6A 3NV1A 3E6BA 1XNCA 4BXFA 3SLIA 2C0ZA 3JD71 5C5UA 1JOJA 2YY1A 2BNOA 3IZOA 4PF5A 3KV6A 4P02B 1SLAA 1GBGA 2XWBB 3PJQA 3RI8A 2JECA 4LPLA 3SISA 1MQTB 2BUKA 2DUPA 1ALYA 1S0FA 2B5HA 5F8PA 5I0RA 5F39A 4F8AA 2NMOA 4IGQA 5LASA 4XILA 2QQMA 1NX9A 2ZGNA 4C0HA 4CUCA 4P9IA 5FTTC 2QZ3A 1ENRA 3OEBA 3LZZA 4KU7A 3ZX7A 3LFIA 3S7IA 3J8F3 4FOVA 1VBE1 5IK8A 4QM8A 1CONA 1ND3C 3AC0A 4ES8A 4OHYA 5FKCA 3V56A 2WZR1 5F1RA 4IEVA 3RZJA 1VRH2 5A70A 1LHOA 2W3JA 1GSLA 3BN6A 3B00A 5ABJB 5FO9B 4LULA 2P37A 4IGPA 4OI2A 4KMQA 5CA6A 1BBT1 1L7QA 4MXVA 2XBO1 4YVWA 4FOWA 3AX4A 1OLME 4QGNA 3KF3A 4PI2A 1VB4A 2IC1A 2VU9A 2WWSA 4FXGB 1J1TA 2ET1A 2X09A 1LKNA 4I0BA 4YGDA 4CCMA 1WKYA 2XJVA 1PM7A 2VXRA 3OF1A 4HT1T 1UXZA 1W2TA 5I8YA 2QBXA 2WT1A 4JDMA 2UWAA 5FPAA 2OKXA 1COV2 2Y38A 3VZOA 4MHRA 4PF1A 3V0AB 4OHZA 1S55A 4Q0SA 3WF4A 3WW3A 1UIKA 4OFGA 3EXUA 4PIYA 3T30A 5FK8A 4Y4YA 3LD8A 3VLBB 3AKRA 5HBAA 3O1VA 1ZZ8A 1TMF1 4GMP3 4L99A 2HWB3 1EUUA 3WSOA 3VZJA 3K75B 2BBVA 1BMV2 2ORXA 3HN3A 3JB8A 3RS6A 5LK5A 3KQRA 1CQ9A 2DWRA 1DLCA 2OZ6A 4TXWA 4OYUA 4Y22B 3RJRA 3H50A 5C70A 1RITA 3WNMA 2J1RA 3CJIB 1ND2B 2BNMA 3OBTA 4XFAA 2QQOA 2ZCWA 3MF6A 2XJQA 3EQEA 5LBCA 3J8F2 5A3WA 1F15A 3ECQA 3IIIA 3T2PA 2YGLA 2YHJA 5FLJA 2B46X 5FYTA 2ZGQA 5JAXA 5EPAA 3RZMA 3J7LA 1C5HA 1UZVA 3DF0A 4NRMA 2IUWA 4ZU7A 1KS4A 2AC1A 5LEKA 3IAQA 2E6VA 2A5ZA 4NPMA 4IV3C 3RWNA 2RDRA 4CCDA 1W6QA 4PBOA 4QQLA 1BEV1 1GP5A 2B9UA 4AL9A 1V0AA 1JHNA 5T3NA 3UKVA 3CEWA 3HT1A 5DZFA 4B7EA 1AF9A 1ODMA 1OA3A 3A23A 1YYNA 1GWKA 1KDMA 4D94A 2MEV2 3RDIA 4N43B 3WEZA 2WBKA 5FZ6A 4XBLA 1G9AA 1SDDB 1DYPA 5G05L 4E8DA 1RB8G 3Q8CA 2ARCA 3D4KA 4KI5M 3ZR5A 2DBIA 3VBFB 4EN7B 1O7FA 2EA7A 4CXXA 1HJFA 2CYFA 5CYYA 4Y26A 1UYXA 5BUVA 4SBVA 1VE0A 2LRPA 2XLGA 4B4RA 1AJOA 2HWB2 4K3UA 2QUOA 4CDQB 1O3RA 1UCXA 1L7RA 2RS31 4QPWA 3BUCA 4JC1A 1GZ9A 3U10A 2EF6A 1JU3A 2WUHA 1Q8PA 3X29B 4AEDA 1VB2A 5FIXA 1MS1A 4YW1A 5BY5A 5FBJA 1KJRA 1O4YA 1YI9A 3LAGA 4RGKA 1N3PA 5CFCB 1JHJA 1W2AX 1OURA 4IUGA 5C33A 4EQVA 3RSJA 1J59A 4BLIA 4DRVA 4HVRA 3RJ2X 5JXHA 2ARXA 4WM8B 3GBGA 1ULCA 2Z69A 4N7IA 2DU1A 2EIEA 3LA2A 3CIHA 2OZJA 5FYIA 2AYHA 3K2OA 3M3IA 3VDCA 1DQ5A 1H8VA 1UU6A 4QPGA 2R071 4YVSB 5F7UA 3DYOA 1JZ7A 3HN1A 2TEPA 3ZSLA 5D1IA 3HJRA 1F2NA 1HQWA 4UFHA 2ZEXA 3HQXA 2WZPP 5L19A 2J22A 3ME2A 4PI0A 5FCCA 1OD5A 3VBRA 3BI3A 4QM9A 2XUEA 3WY6A 1DBNA 1LGCA 2MNGA 3LSDA 4RR3B 3O1MA 4LO5B 3TN93 2VQAA 1RMU3 1A34A 2EXKA 2Y6JA 4N53B 2DVDA 3AL6A 4NAMA 5HCHA 3GZTB 3D82A 3ON7A 1NCQB 3ZXFA 1WCUA 1GICA 1PMHX 4FBFA 1HDKA 1AL21 1RUI1 3TBDA 3U14A 5HCFA 3C7FA 3DYPA 1OH3A 1V9U3 2HH9A 2RM23 4UWDA 3WNLA 4N8MA 4AFDA 3CNAA 4DFSA 4R9BA 3WG2A 1T6BX 2RS53 3UKTA 2C24A 3MLLA 1TQ5A 5A33A 1ZVFA 3VHOA 2PQQA 1QMJA 2DFCA 3LFMA 1LHVA 4FQZA 4OHXA 1ZBE3 4YZ3A 4X8PA 4XUTA 3KT4A 4Y5SA 5B4NA 1GQPA 4IETA 2ARBA 1BLZA 3FHIB 5T54A 2WSVA 1H2KA 1ZA4A 2ATFA 3C3VA 2JDUA 2JG9B 4OLLA 4AGGA 2NP0A 2QQIA 3AKTA 5FZKA 5C9AB 3WNNA 2PAKA 5ACA3 1PM4A 2XL7A 4I0AA 4Q4V3 4RGGA 2P1BA 4YVWC 5IWFA 3I2HA 3THPA 4C1WA 4K9SA 1YC61 3QH7A 4AI2A 1N47A 4YW5A 2BOIA 4JRLA 3TN92 1RMU2 2WNUA 2XJRA 3LEKA 3H8XA 3C7HA 3CO2A 3MFAA 2AH2A 4FOYA 3C7EA 4CCOA 3VBSB 1AYN3 1W8WA 2WKKA 2OQ7A 4OQ9A 3VKNA 5KXEA 3Q8BA 1QEXA 4HSJA 4WM7A 4RS5A 3WHUA 4XUNA 5FJKA 3VD4A 1DZQA 3IKWA 3O1OA 3BTYA 1V9U2 2CV6A 2RM22 1B35A 2XVLA 2ERFA 3LEGA 4J25A 4OVEA 5FY8A 4CDUB 3C7GA 4BJ0A 1JUIA 4JDNA 3K4DA 1D4M1 2RG4A 4HK8A 4MV2A 3LPFA 5IYYA 2RS52 2L9LA 1Z78A 4E2SA 4MGIE 4BOWA 3VZKA 4DXZA 3L2YA 5HI0A 5LRSA 2XKPA 5DPNA 5FYVA 1ZBE2 1PGL1 2EIDA 1H4GA 3QCWA 1UY0A 4M01A 2HEYF 3CDZB 2GNBA 3FMGA 2DBNA 4LE4A 4EWEA 4Q8KA 1AR81 1O59A 4K8RB 4MGSA 4CU9A 1G9DA 2ZHNA 3POIA 1YWKA 4XTPA 3S30A 5LA9A 3IMNA 4E4ZA 1C28A 5I93A 1LODA 2JDZA 2E7QA 5ACA2 1C4RA 1HXS3 1BBT3 2J1SA 3QLQA 5JLVA 2WT0A 5K4LA 3HVDA 5BNOB 1O8SA 2E53A 5FMBA 5FO7B 1YQ2A 1DGLA 1PGW1 3C7OA 3WW1A 3DXTA 2AACA 2ETEA 1UZ0A 5EV7A 2ZZQA 1X36A 3E6DA 5D8AB 1X9PA 1PHMA 1UU4A 3PUSA 4XF9A 3UT0A 5KHJA 2KM2A 1ULDA 1AYN2 2A3XA 3WF2A 1Z7S3 4FQ4A 4KU8A 1PK6B 4ZS3A 2XQXA 1NE6A 3SKJE 2B4KA 1Y7BA 4NPLA 4FFIA 2IFWA 3EMRA 1UMHA 1ZZ7A 1VBD1 2BWCA 3I3BA 4JZRA 3TAYA 3GHNA 5LY2A 1GNYA 5FZ3A 2VVFA 3WDYA 2EXHA 5FZDA 5JDBA 4HMZA 3OUIA 1XNDA 2YXSA 1CD3G 1IOAA 3GJAA 1L3JA 1H0BA 2W91A 4K40A 1D4VB 3PNAA 3POYA 1X50A 4PIZA 5BNNA 4GH4B 1VBE2 2FMDA 3FBYA 4XAEA 4AEDC 4QHZA 4CP0A 4IDZA 2P17A 3PUIA 1LOGA 1UZWA 2WZR2 4RD7A 4Q4W3 5IFTA 4YW6A 1N1TA 2DCZA 5FZ0A 4HPKA 1FOD3 4LK6A 5CG8A 5FZ9A 4PLMA 3WT3A 1D0HA 4FFFA 3VDDA 2OT7A 1FV3A 2V5DA 2IXHA 1PVC3 3VD9A 2DVFA 1HXS2 1BJQA 1AX1A 1BBT2 5FY4A 2R16A 1SQ4A 2RJ2A 2XBO2 1RUC3 4QPGC 3TEYA 1AR93 1IPSA 4CU6A 3OPZA 5JCTA 1H2NA 1W99A 4GWJA 4L2NA 2WQ4A 1BYHA 2OUHA 2X10A 2XQRA 3DKQA 4LBOA 1WGPA 1ZRFA 3VBRC 2GH2A 2AREA 2VUJA 5FP8A 1JYVA 1W6MA 4XF4A 1JZ8A 1XJAA 2CY6A 4QKNA 3IIAA 3ZYJB 3NO8A 2A3WA 1Z7S2 4IEWA 5FDBA 1QJU1 5FY5A 3VBUB 1XBFA 1LULA 3BALA 2JG8A 4FO9A 3RYRA 4DZGA 4MXWB 4NO4A 1ULOA 2QFEA 5I0SA 3NQHA 2E33A 2VPVA 1PNGA 4YVSA 5IAVA 2QQWA 5FK7A 5DZGA 2RHPA 3PIGA 4IW3A 3B9CA 5GALA 3WUDA 5H9PA 2WNVB 2BWAA 4HXCA 1XB9A 2YBKA 3I59A 5AC91 2FDKA 2GH8A 1GQGA 4XQWA 3VZLA 2R0HA 4M3CE 1RUH1 1O8PA 4UYBA 1FOD2 4CZSA 1OPOA 3U75A 3GBFA 2J1UA 2DUQA 3ASIA 3VKMA 1PVC2 2CNAA 2DU0A 1KEXA 1BEV2 4KGGA 1W8ZA 4XDQA 5FMDA 1RUC2 4PDWB 1AR92 3ZFEB 2ID4A 1U5YA 3AMNA 2WNEA 5C3SA 4LHNA 1LB2A 2XHNA 2P3IA 3NSTA 3LDBA 5JOZA 2OXBA 3NJYA 3N9LA 1RUJ3 1ZRDA 2GC2A 2P2KA 2PHUA 4QGMA 5JXJA 3WR0A 3H8UA 4NAOA 3KGZA 4AW7A 2V73A 1HV0A 4CRQA 4J1WA 1O3SA 2YC0A 4P9GA 4WZFA 2WNUC 1IHMA 4XE9A 1FATA 3FLTA 5E1RA 4Y24A 3KT7A 1WW6A 1NY71 1YQ5A 2HBUA 2VMIA 3GZUC 4ISRA 4RS5C 1WA4A 4WM7C 2ZA9A 3NNLA 2RS32 2JIJA 3AZZA 4HETA 2UU8A 4P9WA 1QQP1 1XNBA 4QAWA 2ZEYA 1G7YA 1B35C 4JHTA 2ZHLA 1ZA7A 1QH7A 5CKMA 4E4HA 4QDRA 5GZDA 1D2SA 1O91A 1Y9GA 2OUJA 1RC6A 3D3AA 2VGDA 5J96B 5GZEA 2EIGA 4ZPIA 5A32B 1JTZX 1KXGA 3B3QE 4XETA 2WFPA 4CSWA 5C71A 4Q4Y1 5KC6A 4W6XA 1RUE1 1O6UA 3HBKA 2ZTNA 1W0NA 3VBSA 3POFA 1W8UA 5IVYA 3VN4A 4GWNA 5HXMA 1OLMA 4JQTA 1MS0A 3MIFA 4QXHA 1DGWA 1IS6A 1Q56A 1Y3TA 3NL1A 4FPFA 4H7LA 4Q4X3 3NW4A 1CX1A 1UF2C 2VZUA 4RQPB 4A3ZA 2O8OA 1H8TA 5FZCA 4DXSA 1RUJ2 4NHKA 2CL2A 1POV1 1W6PA 1QNWA 2GN7A 4U36A 4MUVA 4NUBA 3ALQA 3IMMA 4QU1A 2FDFA 1OFSA 2KD7A 1MS9A 1AR71 5T5LA 1EV11 4XJZA 3M3EA 5CBLA 3WUCA 1UN1A 1FPN3 3VD3A 1RUD1 3VBHA 4BH9A 3E5UA 3POWA 2BJSA 4M0HA 3RVHA 3AFGA 5IW0A 2PELA 3VL9A 1XYOA 3ILRA 1GOGA 3TEZA 1REEA 1WD4A 3NNMA 1OA4A 2ZGLA 4OUEA 1YQ8A 1R1A1 2TUNA 3FLPA 3BU7A 1LTEA 2VBBA 5I8TA 1RUOA 2VMFA 4EN8B 2IXCA 1GUIA 3B7MA 4UW3A 3NMBA 1DGRN 1NZCA 1QIQA 3NNFA 4K8FA 1DCSA 4UI9L 5JI9A 3FWEA 2Y0OA 3DPRC 4NIIA 5T5OA 4A6OA 1RHI1 5A3OA 5JZGB 5BNNC 3S7EA 1URXA 2WN3A 4CDXB 3H8OA 4ONUA 3IPVA 4O65A 4WVZA 4ZU4A 3MFCA 4HKWA 4YW3A 4WVMB 4AVBA 1OOPB 4AR2A 1W6NA 2RMU1 2FCVA 3H42B 5FXVA 4BM8A 1GANA 2NMNA 1WZXA 3HIFA 3MIHA 4GALA 4IE7A 1OUXA 1OKOA 5FREA 1V6JA 5CFDC 5A3NA 4B4PA 3VDDC 3NKTA 1AHSA 2OA2A 2WA4A 1MVEA 2ARAA 4W8JA 5IK4A 3AL5A 3NJXA 1B09A 4MOAA 4A6SA 3B01A 1DYOA 4LTAA 2HWC1 3T0BA 4A42A 3DYMA 3THDA 4FTEA 5FY0A 1FV2A 4LBQA 4YPJA 2R041 4GH4A 2VZTA 3BODA 5C6CA 1QJX3 1FPN2 4I0WB 1VLNA 2Z2SB 3KSCA 4FPYA 1PIV1 1VAMA 2WSUA 4ZZ5A 5C8CA 4UT5A 2JG8C 2FHRA 3PHMA 3IDBB 4XIOA 2AENA 3MLJA 1ONAA 1KS5A 5K0UB 5A1LA 1LOBA 4BXSV 3VKFC 1V6IA 4YWAA 5LBEA 1D4M2 1V6NA 2VG9A 1DFQA 1NUKA 3KWVA 3RI9A 4UOJA 2XVKA 1F5JA 2PAMA 1HQLA 1S0IA 2HWD1 4QX2A 5F32A 4FVVA 4META 1GR3A 1OF3A 1XOYA 3LGRA 1RXGA 2IXKA 2KA3A 2JICA 2P3YA 1CAUA 3I2GA 3JBG1 2VJXA 4ZONA 1RUG3 4L97A 5FAXA 3WNXA 4KWKA 5FPVA 1PGL2 3DEMA 3TWIA 4QQHA 1HB1A 3RMYA 5IK5A 1KFUL 3BU0A 3G6JB 3T2TA 3LA3A 3N9QA 4AOCA 2D6MA 4BWOA 3ZYHA 3AKQA 2XJPA 2ZGUA 5FKBA 3WD5A 2IVIB 2TNFA 4ASKA 2DDUA 5A80A 4OI1A 4D0QA 2HWE1 5DZEA 4CP1A 3OJBA 1R091 1SFYA 1LHUA 3NAPB 2D6NA 4C91A 1K5JA 1W0PA 2D93A 2ZZJA 4TLGA 4Z92B 4CEWB 4FCAA 1EP0A 5DDJ3 4BK4A 1OQEA 3RYKA 5EYXA 4UBGA 1QJX2 3ILFA 1MS5A 1G9CA 2GNMA 2JENA 2VZVA 2WL1A 3ZN4A 4GA9A 3HNMA 1ZRRA 3BVCA 2WC2A 2A6VA 2QCSB 4DUXA 1VBD2 4HKLA 4JRAA 5FPXA 4Y5TA 2VQUA 2VNVA 1K5MA 4LXLA 3J26N 5A7WB 2WS93 4FPJA 1UWWA 3WW4A 4W6WA 3ZFGA 4AFCA 1X8MA 1ZX5A 3D0SA 4RYDA 3TEWA 4UFLA 2D6KA 1NT0A 1X8EA 2NPIA 3DL3A 3ZN6A 1ODNA 1W3VA 3SNMA 1RUG2 3H3UA 4IV1A 1VRH3 4XFFA 4NHMA 4GD4A 1RJ7A 1W0OA 1NZIA 3INAA 2FZ2A 4QWNA 1GQHA 5FQ0A 5LA1A 1W6OB 1TNFA 4P5HA 1C8M3 2I2SA 4XABA 3HEIA 4X8NA 1CPMA 2VTFA 4W50A 1E5IA 1Q8QA 2LUWA 1LCLA 3AJYA 2FDIA 5FMOS 5BNPA 1KITA 2VMEA 1MPXA 1ST8A 1LU2A 2I74A 3O7OA 4LHSA 4YZ4A 4CDWA 4FFHA 3OBZA 5F6KA 4AHZA 1H8TC 3AJZA 1I5ZA 5JSRA 2JIGA 5FZHA 1QJY1 5DDJ2 3O1UA 3MIGA 2C6SA 3OPTA 1OUSA 3QH6A 4CU8A 5KBFA 3J7HA 4FFGA 3URFA 5IVBA 2R49A 3ZXGA 1I9RA 5A32A 3KB5A 1AXZA 4PLOA 2XMLA 1ACCA 3FHQA 1IPJA 2O1QA 3VBHC 3MI8A 1K45A 4MYEA 1QOTA 5KC5A 2FBEA 1G9BA 3ACHA 4ET7A 4YM2A 4F83A 4OULA 2Z5WA 4CXWA 5K7PA 2WS92 3BPSA 3DGTA 3GALA 2VZSA 1NA1B 1UOFA 4RQPA 4CPBD 2PQSA 3VBOA 4BQ3A 4B1MA 5LB6A 4GMP0 1QDOA 1HIXA 4MZUA 4K21A 3GJBA 1ZNPA 3NV4A 3WDTA 4JKKA 1MS4A 4IL7A 2R6QA 5HV0A 1ULPA 1ZM1A 1W9SA 4QX7A 5B4XA 1C8M2 1OT5A 1QU0A 3FFZA 1WBLA 4AZZA 3IN9A 1PZ7A 2BW8A 4IQPA 5FWEA 1XE7A 1GNZA 2R1BA 2XJUA 4XBQA 1KQRA 1XNTA 2MEV3 5FYCA 3VHPA 2N7GA 3POEA 4QXKA 5EHDA 4GB33 4EROA 2R063 2JDAA 3OUJA 2PLV3 4H3WA 1DDLA 2WAAA 1P8JA 2VO5A 3AP5A 3H1YA 2CAVA 4C0BA 2E7AA 3I49A 5K9YA 1S2BA 3BOWA 4G3YC 1PO13 1WMDA 2FMYA 1DQ4A 2O0OA 2PFWA 5JMOA 1C5IA 3B94A 5FZFA 2PXJA 1SBFA 2WFF3 1JH5A 5T5JA 4GH4C 5FZIA 1VBA3 2VBPA 4KG8A 2QJVA 5GLVA 2ZAAA 3MUY1 2F6BA 2AZ5A 2ZXQA 2D3RA 1UO9A 4NN0A 5C8CC 4QQOA 1RINA 4AVVA 2UY8A 2AGSA 3WDWA 5FYMA 2IZWA 3ZIXA 4I09A 2Z79A 3OYWA 2WQZC 1US2A 2Q1ZB 1GLHA 3OGVA 1D0GA 1SZBA 2CGNA 4DO0A 3WG4A 4AE2A 4D3WA 1RHI3 4IEQA 4DEQA 3R0RA 1HB3A 1GKBA 3ZO0B 1ASJ1 4P00B 4Q1RA 4E2GA 4Q4Y2 2CGOA 3RPQA 3WDXA 4COVA 1WMEA 1IG3A 5JWPA 2Q1FA 2PHRA 4D8MA 2X5IB 3E97A 4YM0A 5DAVA 1YQ6A 3AKSA 4GZ9A 2ADDA 3H9AA 3B02A 4ATEA 4GB32 4D7YA 2R062 3K48A 3ATGA 4JGZA 4FXKB 1O4ZA 5FLHA 2CDOA 2PLV2 3BYWA 2D98A 3FBMA 1U5XA 4LKDA 5E88A 5K0UA 3TNQA 4OZOA 2CU5A 2I45A 3KF5A 1Q8SA 5HCBA 3EBRA 3NJVA 4NRQA 5EYYA 2A71A 1UY2A 3MW2A 1TME1 4XTMA 3VZNA 3CF6E 3GCXA 1PO12 4EYUA 3ZR6A 3MDPA 5LA0A 5A6XA 4XOGA 1XC6A 2G1MA 2W1WA 2WFF2 4IEOA 4M3CF 1JW6A 1VBA2 4K7JA 3GHMA 5E6HA 4E27A 4IE6A 4L8QA 3JB4C 2RR11 4MX3A 1PIV3 3AK0A 4XC9A 2Q8OA 1AYM3 3OG2A 4NHYA 3VV1A 2BBAA 3H1MA 2GC1A 4FPHA 4Y3OA 1T2XA 2DVGA 4QPIC 4CU7A 3CZUA 4MO3M 3D8CA 3WP4A 1FNZA 1K5MC 1HQNA 1AR61 2JKXA 5FZBA 1Q8OA 5IJRA 3U07A 1SPPA 2VMCA 2GDFA 3ZFGC 3T0DA 3L2HA 2V4AA 4LR4A 4R4XA 2QQVA 1RHI2 4XMAA 4S2HA 4KGQA 2WO2A 1NAEA 4M3CA 1PO23 3AFKA 3TRSB 3AM2A 2BPA2 3NV2A 5A7PA 2YGMA 3PIJA 4IV1C 4Q0PA 3WDUA 1CPNA 1XE0A 2BU9A 2RMU2 4LBJA 3PU3A 4RGAA 4NJ4A 2ZMKA 3AMHA 4EN6B 3ETPA 3I3QA 4NHLA 4BB3A 1J84A 5EJZB 3U4SA 3AP9A 4BQWA 5C4WA 2ZX1A 1U12A 4EE2A 1S4CA 3N4MA 1ZZCA 5BNPC 2UWBA 4JGYB 2Q8EA 5A3LA 4H7MA 4LO7A 3ZYIB 2HWC2 1ZBA1 2WLQA 4CDWC 3AB0A 3SQOA 5GZCA 2D3PA 2W39A 4IEXA 4EWDA 3A4UA 5EWSA 4RHV3 2RVAA 4CP9A 3AYCA 2R7EB 2ZKLA 4LKFA 1J1LA 1XRUA 4P5YA 3ZFFA 3M3QA 5C8WA 5A7NA 1JS9A 1PIV2 4SLIA 1AYM2 5AVPA 2YROA 2NLRA 4YNIA 4Q8LA 1EPZA 3UV9A 3JUUA 4C8DA 1UKGA 5LA2A 4BMBA 1FMD3 2ET7A 2VE1A 3H1WA 2PYTA 2WJSA 3RG0A 2RDNA 1STMA 2PHWA 3G7DA 4Y20B 5DAXA 1W8OA 2Q4SA 1MEC1 4LKSA 1IS4A 1HN1A 2QQJA 4P9JA 4Z07A 4AQSA 5CEHA 4GKXA 5FP3A 1BK0A 1JU4A 4YZ1A 3MICA 3VBOC 1T6GC 4YFWA 2J1AA 1PO22 3HD8B 3HQRA 3KVAA 1NCRB 3AZYA 5A6YA 3CLPA 2VTXA 3BTZA 3W58A 1OKQA 1HRV1 2XONA 4QDQA 3S6PA 1VBB1 5FYBA 1EPWA 2OW4A 5LRRA 4BK5A 4XXAA 2MHFA 4CEYB 4COWA 1HN0A 1ZRIA 4LUMA 4S2FA 1MQTA 2JB8A 2Y34A 5GLTA 4CE8A 2HWF1 3PJYA 3WCRA 2WA3A 3ZYRA 4WZCA 1MZFA 3TEXA 1LJ7A 5J37A 2WINB 3MF9A 5L7OB 3E5QA 1NXD1 1R092 4EN9B 2ES3A 3J9SA 3PVOA 2PHFA 2R1DA 3PUHA 4FTBA 2VVDA 3OSDA 4I3PA 4QD2A 1W9FA 2BTVC 2ZMNA 1RUF1 5KXDA 1NA1A 3I2DA 2VY0A 4YG3A 4BA6A 3J7NA 1IPKA 2WLPA 3JD73 1BQPA 4RHV2 2W9XA 2VXJA 2PTMA 2XUMA 1ENSA 2HYKA 1E5SA 4YLZA 3SKVA 4BQXA 1PZ8A 4CXYA 1FMD2 5EJ1B 2JKBA 5CISA 3FUOA 2PHDA 4QT6A 3FJSA 3SCGA 4P9YA 1VBE3 3N7JA 4QMAA 1W2OA 2CDPA 2XHKA 3IBMA 4QX3A 4UW4A 4XF1A 2V72A 2WZR3 2VMGA 5FJHA 5L9BA 2WO3A 3N7KA 2W5FA 5F5IA 3M7AA 4COZA 4LQRA 3WF0A 3V0AA 1Y4WA 2GMEA 2DUOA 1JZ4A 1KRIA 5J3UA 1UKRA 3WP3A 1RUNA 3S5QA 1TNRA 2XBO3 2YBSA 3W21A 3SC7X 4U2AA 2XJTA 2Y6HA 5CU1A 2ZX0A 3CKHA 1FYUA 2Y26A 4Y22A 1GZWB 1SACA 2A75A 1ZYBA 3PL0A 2CSGA 3K51A 1YI7A 3MPPG 5GLUA 1XYNA 4CA9A 3CJIA 1W8FA 4QX5A 1ND2A 3DCQA 1A8MA 2LTNA 1YFYA 2VCMA 5EFUA 4F3JA 2WR9A 4JGZC 2RS11 1RYYA 3Q8AA 5E8AA 1H9WA 4AI8A 5C5TA 5IAXA 4A44A 3WNOA 3KV4A 3MIEA 3P5BA 3LIHA 4ASLA 3M2MA 4X6QB 4EZHA 1QJY2 2BVBA 4L9BA 2GMMA 1ND3B 3JD72 5T52A 5FYHA 3KZ4C 4PCRA 1TMF3 2ZGPA 2A70A 2QQKA 3FN9A 3NWKA 5FUIA 3T3YA 5BV6A 1F4HA 5F2SA 3GNEA 1LHWA 4DY5A 1CWPA 1CAVB 3UGHA 1R081 1CR7A 2JWPA 4DS0A 1D2QA 1EUTA 5FMOL 4DINB 3O14A 2NM1A 3KCCA 3WV6A 1ENXA 2YPDA 5A3TA 3IAPA 2B7YA 5KHIA 2VM9A 4FPKA 5CIRA 2EAKA 4LE3A 4MG2A 1EYBA 2WN2A 4QKBA 4A45A 2GN3A 2JD4A 4NOTA 1HX6A 1BCXA 1GP4A 4P9XA 4N43A 5FZAA 2QNKA 3LEMA 3T2QA 4QB6A 1LR5A 2BQPA 3POJA 4XJ9A 3UJOA 4S2DA 4NR1A 1NYWA 1XPWA 4HL0A 3U78A 3W20A 2GU9A 3VBFA 2VAUA 5J36A 5F2WA 1JUHA 4HFSA 5JOXA 3NVCA 1ASJ3 5APAA 2IXIA 1I1EA 1DIWA 1R1ZA 4GJYA 1BEV3 2W1QA 2EAAA 1SLBA 1CJPA 3K4AA 2B42B 4QGLA 3LQCA 1MZ5A 2ZEWA 4CDQA 3KS7A 2C9KA 4XJAA 1H6YA 4MHUA 5FZGA 1QWRA 3MGUA 1JYCA 2FDGA 4Z2AA 1A8DA 3LIGA 1VIWB 1PVXA 3PVEA 2UYAA 2Y0IA 3NNJA 2D5HA 5C4WC 1VR3A 3WP5A 3I3MA 3ZYFA 5FP4A 4AVAA 1W90A 5F9TA 4AHXA 2DURA 4Y4RA 5EP9A 5F3EA 3USUB 5CFCA 4KBBA 1TMF2 4DQAA 4WM8A 2DFBA 2GZWA 3T08A 1SLIA 2RS33 2Q8CA 1GU3A 5FY1A 4ZZ8A 2LALA 3ZFFC 5FP7A 3RRDA 1UAIA 4AF9A 1GNHA 1GP6A 1WWYA 2VW1A 3WF1A 4ARYA 1OFNA 4F7ZA 1E5RA 1UD1A 2BEOA 1QJZA 2OVUA 1VMHA 4R8HA 1SBEA 5J98B 3HQUA 3EHKA 1DGWX 5GZFA 2Y6KA 3AKPA 4OHVA 2WYFA 3JQXA 3DV8A 1ZZ6A 2D6LX 2PMWB 3PMSA 4I30A 4CCKA 4MGTA 4RR3A 1WBFA 1OMIA 3LF7A 4H55A 1V6KA 2D44A 1RJ8A 4N53A 3IM0A 1QOOA 4X6RB 3KMHA 3ST7A 4D6RA 5AFEA 3WW2A 3ES1A 1ASJ2 1AX2A 3N3HA 1DLLA 1NCQA 3M3CA 4KQ7A 2ZPXA 4M00A 1HRI1 5A1FA 2R073 2VOTA 3AYAA 1OA2A 1YFUA 2DTWA 2QVSB 1Y9MA 3UETA 4Z2WA 3IDEA 4XFGA 2F4PA 5FZOB 5DQ0A 4NPRA 1MQTC 5A7SA 4BQ2A 1FX5A 2FCTA 1H30A 4AK3A 1X33A 4KNCA 5DUUA 2EVXA 1U0AA 2W0XA 3P3NA 2IWGB 4XAAA 1UY3A 3V65A 4H2AA 2XKOA 4MLOA 3A22A 3IDCB 5J7MA 1BKZA 3TOJA 4QKDA 3PVBB 5FOJB 4HZFA 2JDMA 4OMDA 3WQBA 5BYNA 2XWJB 3AP4A 1LU1A 3ZLIA 1BVP1 3ZXJA 1AL23 3CBNA 5D21A 1EAH1 1RUI3 2Y8KA 2GNDA 1NCRA 2JG9A 1DGRA 2RDSA 2ZAHA 5FYZA 4QX0A 2BYVE 5C9AA 1O3QA 1COV1 5ABJC 1YXWA 2BVVA 1R64A 5DUWA 2JEMA 4LJHA 4CEYA 1IQDC 2P5BA 3E6CC 3SH3A 2R32A 4NMIA 4E4DX 4PT6A 1BMV1 5FYUA 4AEJA 1O5LA 4ZXKA 3BB6A 4D7SA 3WZ1A 5E16A 4OUMA 1UXXX 1KGYA 5L7OA 2A6WA 1OSGA 1GFF2 2YU1A 2ZX4A 5LATA 4EV0A 2PA7A 2Q5TA 1QJFA 3MPBA 5GLWA 4R52A 3B93A 3J8F1 1CAXB 1GZTA 2FZ1A 4O9GA 4V2VA 2EIBA 3VL8A 4BYYA 1QXJA 2R072 5JVVA 3IB3A 4E9KA 1WCDJ 5JMCA 5JXGA 2VULA 5DN2A 4RSUA 4CDUA 5I0TA 4XHBA 2WDBA 1BHGA 3WLUA 3OGJA 3N9PA 2YBPA 4OQ8A 1YJKA 1JBCA 1UQXA 1UPIA 5IVCA 1JZ3A 3PLQA 1W39A 5CNAA 2D6PA 3CJIC 1DQ1A 1J58A 1ND2C 3ACFA 3KGLA 4XIKA 3DXUA 5T50A 4A3XA 2G4IA 3LDRA 3WOGA 2HYXA 3T4VA 4MVTA 1AL22 1UZYA 1RUI2 2DYCA 3MW4A 3ZSJA 1N1SA 1NQDA 4XXPA 3SEPA 3MO4A 4IESA 3WP6A 1D4M3 4UFKA 4NROA 4FPGA 2WWJA 4KWLA 4M4PA 5JSPA 2C26A 1UY4A 5BNOA 4FAGA 1UNBA 4GMP1 2HWB1 2D7FA 4YVWB 2D43A 4YG6A 4ATFA 1WCSA 5F3GA 2WAOA 3F2ZA 1PMJX 4N43C 2X29A 1LOAA 5FUNA 2W87A 1VMFA 2G9ZA 1AR83 1YHFA 5D8AA 3VHNA 1LHNA 3K3OA 3KQ4B 2H6BA 2QQUA 4LHLA 4LMFA 4B7KA 1UYPA 3I3DA 3EYPA 3WCSA 2LW8A 3FC0A 1NKGA 3VBFC 3UGFA 1PK6A 4UF0B 4XACA 2BNNA 3WINE 1W8HA 3SH5A 3APBA 3QD6A 1CAVA 2P6CA 2ZMLA 3GM8A 2BGCA 4CDQC 2HWF2 3UGGA 3W5NA 4XUQA 1EY2A 2JDHA 4LHKA 4BMEA 2YFZA 3ACLA 1HJGA 1S0DA 5KXCA 2IXJA 4Y1XA 2F4LA 1Y43B 2MPFA 2RJLA 2Y6LA 4OZXA 1SDWA 3KLSA 4MADA 3T0AA 3ENRA 3IT8A 1XXNA 1CVNA 3ACGA 2GSYA 4XDOA 5EXOA 5CFCC 4LNVA 4Q1PA 2VUDA 1VBD3 3GCWA 1LECA 3KV5A 4WM8C 3BIEA 1OQDA 1CZTA 1YIPA 1YNAA 4RN5A 2IXLA 3OCPA 1NXMA 4LBKA 4FPEA 4YVSC 1YUDA 1W6QB 2PHLA 2DF7A 3RZKA 5FXZA 5ANQA 3ZXLA 2XPJA 4QB2A 4Z1VA 1JZ5A 1AR82 2VVEA 2GC3A 3DKWA 4C1XA 4RR3C 2WQ8A 3WVJA 4QX1A 1YCIA 3SH4A 4N53C 2H0BA 1N1YA 3VBUA 5FXXA 1F4AA 3H3LA 4AYUA 1NCQC 3PMEA 5FZEA 5GZGA 2VECA 4MXWA 2ZHKA 4DPNA 2XLFA 2BGOA 5ABJA 4LLFA 1AJKA 3QACA 4JHZA 1MACA 2LROA 1GZCA 1WW5A 1PGW2 2B8MA 2JB4A 1UOGA 3I54A 2JX9A 4A41A 4AHYA 3PU8A 4I01A 4TTGA 3FUQA 3UL2A 2P3KA 4BE3A 3MZHA 3Q8FA 5IUQA 3OB8A 4YW2A 4YGEA 3UYJA 2ZKNA 5FZLA 2P34A 4XPVA 1BVVA 3KD4A 2WNVA 3R4SA 1NG0A 1CAWB 4JGYA 2Y6GA 2QTWB 1GOFA 2ZOEB 3DUIA 3WG3A 1QJU3 5JPNB 4AEDB 1XSQA 1CIYA 1I6XA 1E5HA 2GP5A 4A7ZA 2ZACA 2AEYA 4O9EA 3UESA 4FSJA 4R9CA 1OH4A 3TN91 1RMU1 4OI0A 4XF0A 3WDVA 1CX4A 1DHKB 5J1XA 2JG9C 5CADA 4PDWA 1JXNA 5C9AC 1OXCA 3ZFEA 5L36A 4XDPA 4FT8A 5A6QA 4QPGB 5FFOC 2RDQA 2Q0AA 3QBQA 4CEYC 3POSA 5FZOA 4LO6B 3T2OA 3H7JA 3VD5A 5A3PA 3SEEA 1V9U1 2RM21 4CPBA 1UL9A 5AC93 4BDVB 1RL3A 1TG7A 2VNGA 4LLOA 1CESA 4LKEA 4XQDA 5F6LB 2BFUS 3VBRB 1POQA 2D40A 1RUH3 4RFT0 4BLJA 3VZMA 2RS51 2VQ0A 5DG2A 3EJKA 4MGKE 3ZMOA 4P9LA 5T55A 2Q1MA 4XURA 1NLRA 4E4SA 2KXLA 3VBSC 3U11A 2VNOA 1ZBE1 5BNQA 1LGBA 3OOXA 1MR5A 3LKJA 3FL7A 2J1EA 4AI1A 4B1LA 3LA7A 4BZ4A 3HNYM 2QQLA 5FOBB 2X8KA 3O0VA 1QKQA 1QXRA 4CDUC 1W8NA 3H0OA 3LSEA 2G9FA 1UYYA 5CB7A 1QNYA 2HKXA 2IFRA 5ACA1 3THCA 2JDNA 4UAPA 4K1YA 1XNKA 3RFRA 1UX6A 4Q4V1 1XNAA 5A33B 1QJU2 3MLKA 5BXXA 5C3QA 2W08A 2DVBA 3KHCA 1OQ1A 2JDPA 1H2MA 4R9DA 5JOWA 1AVBA 3BGAA 1UIJA 4DUWA 2GP3A 4AI3A 1JN2P 5DUVA 1EAH3 4I02A 1C8NA 3ORJA 5CKQA 3AZWA 2CTVA 3W5MA 5M0TA 4IE5A 5C3RA 3POBA 1QQP3 1E57A 1N3QA 1QY4A 1PX4A 1AYN1 1C1FA 1POV0 2DTYA 3BCWA 3Q9OA 2E63A 4JQRA 4MGYE 2E32A 5JR2A 1JYXA 4NE9A 1RVF1 5FZ4A 3U1XA 4GWIA 4NWWA 1LGNA 1QOSA 5FPZA 4BHPA 5BNOC 3GGLA 4FP3A 1AUYA 2BOJA 3OD0A 2A1XA 2C1FA 4UFIA 4LITA 4CTEA 3ZSEA 3RZLA 5AC92 1F9KA 1H1IA 4DXTA 1IGOA 1RUH2 4Q4Y3 1G6NA 2ZGOA 1RUE3 3CMGA 4DOUA 5D8AC 4N9HA 2QQPA 3UKNA 4I3GA 2WNUB 5IATA 1SLTA 2A3YA 4Q29A 4FOQA 1QH6A 4LT5A 1PMIA 1HRI2 2OX0A 3AYEA 1PK6C 3WNPA 4PHZA 5A7QA 4EJRA 4JV4A 5LY1A 4WM7B 4RS5B 4HKOA 2XG3A 2WIIB 2J7MA 1O4TA 1I5PA 3P6BA 2WYSA 4LBMA 3O0XA 1POV3 1RXFA 4WVWA 1B35B 2J1VA 3WQ7A 1WUVA 2KR2A 1HXS1 3ZSKA 2RE9A 4OI4A 5DXDA 1G86A 3L9JT 3MW3A 4DEVA 2XH6A 1AR73 2C4XA 5DG1A 1EV13 3ZYGA 4BU2A 5C7GA 3ZVXA 3GZAA 4QHBA 4AFAA 5JZGA 3AMQA 4CDXA 1WLTA 1OLQA 3J4UH 1JZ2A 1RUD3 4AQTA 5KWRA 1A6CA 4XEZA 4WVMA 1OOPA 5JIUA 1QXPA 1NY72 3SHRA 4CCCA 3VUOA 3A0NA 1EAH2 3O1PA 4Q0UA 4BQ1A 5J09A 1XE8A 1WA6X 1R1A3 3K46A 4NIAA 4D6QA 1QQP2 4HG6B 1MZ6A 4XCBA 5I0DA 2UURA 4UF0A 1Z7S1 1GWMA 5L9RA 1XQNA 2XOMA 2VZ3A 3CU7A 3S0MA 3BTAA 5CZKA 4IE4A 4JDOA 3OGGA 5A7OA 1VJ2A 4Y5Z0 2Q8DA 1KFXL 3R4DB 4TSVA 5JI7A 1JMUB 2OS2A 2ZGSA 3M3OA 4M4RA 1IKPA 3ZYBA 3GF6A 4TWTA 3AZVA 4QXBA 1RUE2 1V70A 1SHWB 3HPNA 2D5FA 2D3SA 2RMU3 4URTA 4ZU5A 4A7YA 4URAA 2ENRA 3I97A 3O0WA 2WWUA 1W05A 3BIWE 3HMYA 2YC2A 2V09A 2K46A 3VBUC 3AMMA 1RGSA 1WCKA 4AWDA 5FWJA 3SXWA 5FY9A 2X05A 5FV3A 4EWAA 1SMVA 1UOJA 1Q3EA 4OUSA 4Q4W1 5FBZA 3VGIA 3N9OA 1A3KA 3WX5A 1LOFA 4FI9A 3CZJA 1FOD1 4YGBA 4IEYA 1O3TA 4G9SB 1U5ZA 1RIRA 2HWC3 2ZS6B 4GKYA 2A6XA 2BGPA 2Z42A 2ZGKA 4YGCA 3ZXKA 1PVC1 4HVQA 1MZEA 2YG0A 5FPUA 1AR72 1RUC1 4LUKA 1EV12 2W1SA 1AR91 2R043 3DPRB 4JTNA 4W65A 4XBNA 5JR7B 4PJYA 3PDQA 4BIFA 4HK9A 3USSA 2WNVC 1RUD2 3A21A 2Y64A 4LBLA 2NN8A 5BNNB 1AZDA 4M0NA 1OPMA 2VCBA 1CZVA 1H1AA 2W46A 3N35A 1FNYA 1F5FA 1BK1A 1S1AA 2QKDA 3RNSA 4ZKTB 5B2GB 5F3CA 4HSLA 4AI0A 4UW6A 1R1A2 3TB0A 4Y33A 4AGVA 4JVAA 4O7XA 1ZZ9A 4HPKB 5CFDB 5F3IA 4JKMA 5FY7A 3VDDB 2DCKA 4YARA 4L92A 3RZGA 2HWD3 4PDWC 1HB2A 2EXIA 3ZFEC 3R05A 2XVGA 3NAPA 4TYSA 3JBG3 5JSOA 3FZ3A 3S5AA 4KBZA 2ZHMA 4BQ5A 2D6OX 2A73B 1S2KA 1IQAA 2E7TA 4CEWA 5IT6A 1BXHA 4NIHA 3BOPA 4XUPA 1XU2A 2O8QA 2W47A 5FPLA 2BERA 2VR4A 1CAWA 2Y6FA 4INDA 1W6MB 4HLTA 4P14A 2X53S 2VD7A 4IGOA 1OD3A 4D6SA 1XU1A 5DAWA 5EZWA 4Q0VA 4AAXA 3KM5A 4B3NA 4CUAA 2VUCA 3PVNA 4GIQA 4MGZE 1SFNA 3SCFA 1YO8A 2HWE3 1YIFA 2JG8B 4FPCA 4COUA 4E2QA 1R093 4Y1ZA 3UK9A 5A7WA 3N36A 1SLLA 4XJUA 1TVGA 4GQ7A 2EICA 4JCKA 2VW0A 2VCCA 4QQPA 5G04L 3I4IA 5FRAA 4BQ4A 3SMHA 3U0ZA 4YFZA 1SBDA 4S2GA 4R4ZA 4FAHA 2R042 5LCWL 5GM0A 3JXSA 1BZWA 1YFXA 1GOHA 3WHTA 4OHWA 3I2KA 2ZGRA 2A7AA 2A6ZA 1RUJ1 4QHOA 2QQNA 1W6OA 4LA3A 4NHXA 5H9QA 1W9WA 3I59B 1H2LA 1KDKA 3N9MA 2XLAA 3I3EA 3VHRA 3WNKA 3VDAA 1C1LA 1X82A 1M06G 1DG6A 1UW8A 4ZXEA 2HWD2 1ULGA 3PUQA 4RQPC 2SBAA 3EO6A 3JBG2 3HWJA 4IEPA 3OY8B 5J48A 1NQJA 5HCAA 1JZ6A 5L9VA 5DUXA 2Y33A 1NE4A 1TZOA 2CWSA 4RL7A 5FYYA 1YEWA 5JXIA 4FP2A 4XFIA 4LIVA 4IEZA 1VPHA 5ANNA 1N3OA 4V1PA 1QHDA 4XZUG 4DRRA 2HWE2 1F31A 3MV01 1H4HA 4XCAA 2YPJA 3LDKA 3PTRB 1M4WA 3DECA 4YZ2A 3BTXA 2C9AA 3P3PA 3C8XA 1CJDA 4RA0A 1JOBA 4LEJA 5F37A 2WO1A 1QJY3 4J6GA 4Q4X1 5JOYA 1S0EA 3EB7A 1FAYA 1XSRA 1DQ6A 3H7YA 5JZGC 3C2UA 3M8LA 2G9GA 4Y1UA 3VB9A 4FPLA 4CDXC 2BZDA 2BP6A 2PHXA 5IVEA 2OPKA 1OOPC 5HPOA 3V0BB 2FDHA 2Z4FA 1ZREA 3PTYA 3AXDA 5KHGA 1ENQA 1UZZA 2H0VA 4BCUA 4YSFA 1ZZBA 1FPN1 3MIBA 3I2JA 1J3PA 1WMXA 2WRAA 4YG0A 1RVF3 2W92A 1PNFA 2DCJA 1C3HA 1WLDA 3ZPYA 1S0BA 1H8TB 3LEIA 4LORA 1FXZA 2JXAA 3CJXA 2ZBJA 1OF4A 2ZGMA 4LBNA 4TN7A 3O5SA 1W6PB 2VZPA 2VUAA 1JOPA 3WXPA 2ZABA 3K77A 4QPYA 2EALA 2DCYA 4CUGA 5LK7B 2NQYA 2V4VA 1MVQA 2D97A 1D7PM 3HT2A 2JDYA 4KH9A 4Q27A 3HOBA 4YM3A 3VBHB 2GMPA 1Q5OA 5SV8A 1VBC1 5IHRA 1KJLA 1W8TA 5FXWA 2BV4A 4DY3A 1DQ0A 3GXUA 1QDCA 1W9YA 2VZ1A 4ARXA 3DN7A 4AG4A 1PZ9A 5K0UC 1JYTA 1LOFC 1TEIA 3ZYPA 1JI6A 1Y9QA 2BFUL 2DV9A 3N7MA 1FI2A 4N9IA 3AXEA 4AAPA 2AEZA 4Q4V2 1PGSA 1OC1A 2TBVA 3TNPB 4PLNA 2EXJA 1FT9A 1W28A 2LS6A 2WABA 3OGSA 4AQ2A 3O12A 1V6OA 1AXYA 4NRPA 3IPVB 4MSVA 2X5IA 3ILNA 3RWKX 2W52A 1K42A 4V2WA 1W6NB 1HLCA 2VNRA 2H6CA 2VZRA 3T4HB 1F8VA 4JTOA 1VRBA 4Q0QA 1QJX1 4A2UA 2HLEA 2YC4A 5GKAC 1NLQA 1RVF2 1PX3A 2XDVA 3O1RA 1Q8VA 1XYPA 2DVAA 2XR4A 2HEWF 1UU5A 3D0JA 2GAUA 4BISA 2VZQA 2YYOA 3NAPC 4XZPA 1SEFA 2E9QA 2ZJCA 4UBHA 4N7UA 3LOBA 1LEMA 4CEWC 1AL0G 2GALA 3DPRA 3LPGA 4LBQB 4CP2A 3ELNA 5SV5A 4B4QA 1RUG1 4OCTA 4HN0A 3B9IA 1VAKA 2WZEA 2BRTA 2XXZA 5C8CB 4L0PA 3GDBA 4QX8A 4L11A 1CZSA 4KL1A 4XF3A 4YRDA 1DZRA 2ZX2A 5CFDA 3WF3A 3MHZA 1S0CA 4KG0A 1TME3 3N9NA 4CYDA 2WZ8A 3ROUA 3OPWA 4DUVA 4MH0E 5I0UA 1GMMA 1W06A 2VZOA 5ISLA 4QU2A 5FZ8A 4R9AA 1N1VA 4COYA 1RTVA 2OIIA 1CAUB 2RR13 1S0GA 4IV3B 4AGRA 2O14A 4IERA 4AFBA 5L73A 3VDBA 5FMCA 5IVVA 1DQ2A 5DDJ1 5F5CA 3ZN5A 5LEJA 4Q2FA 1WD3A 3P1IA 1SCRA 2IVJA 3FE5A 3LE0A 3HAGA 3KV9A 2W1UA 2RV9A 4CCLA 1AX0A 4BPZA 4O61A 1IG0A 3SCHA 2B45X 1WLCA 1AR63 4LO8A 2VOKA 2AUYA 3I8TA 4OMCA 5AVAA
chains in the Genus database with same CATH topology
1C57A 1ULEA 1X7NA 1V6MA 4XFCA 5KXBA 2WS91 3V64A 3NJZA 2NZ9A 1YFWA 4BIOA 4XHXA 2CAUA 5H9SA 4Z8BA 4AEKA 3ES4A 1REFA 2YDEA 2HEVF 1YLLA 3ETQA 3JU9A 4KWJA 1VRH1 3MEPA 3M70A 3MYXA 5T5PA 4AQ6A 5EJ3A 1A78A 1LOCA 2YUEA 5K8SA 4Q4W2 2RJKA 4Y20A 1C8M1 1WW7A 4D7TA 3A0KA 4QPIB 1ZBA3 1NOVA 1K5MB 1TME2 1Q43A 3ZSMA 4YW4A 2VOWA 3ZIWA 2YV8A 1NA1C 4XJWA 1VALA 3ZFGB 2R0FA 5BPXA 3ZMNA 1U5IA 3OY8A 5KHKA 2JJ6A 1WMFA 3ZN6B 4AVTA 2RR12 4ES9A 4IV1B 5TSWA 4C90A 2NYYA 3KCXA 3JZVA 5CAZA 2QZ2A 5FQ0B 3OTFA 4K6BA 4XFHA 5F5QA 3RMXA 4AEMA 1MEC3 4FPOB 4ISQA 3OD4A 1AR62 3HBZA 1MS8A 5CG9A 1LEDA 5BNPB 3LWCA 2K2SA 3KT1A 4GWMA 3ZDSA 4W6YA 5JPMB 3ZXDA 1OI6A 4N90A 4CDWB 2XGXA 3FFQA 3AMPA 1HRV3 1V6LA 4Q26A 4XQ4A 1VBB3 5I91A 1JYIA 3FX3A 5GLZA 4A7KA 1APNA 4LO4B 2GC0A 4NWVA 4PQ9A 3KCYA 1LOEA 2HWF3 2JE7A 4YYOA 1OHFA 4B29A 3V0BA 1W2UA 2Q30A 1YJLA 2QDRA 3VKLA 1ZBA2 3B5LB 1ZRCA 1RUF3 4JAAA 2MEV1 4YM1A 1G9FA 4GB31 4HANA 2R061 1IKQA 4TLFA 3VBOB 2PLV1 5AFBA 1CN1A 4H14A 3THTA 4Y1YA 4LA2A 3ZXAC 4XMIA 4EN0A 1REDA 4AXOA 2WT2A 1G8WA 4Y1VA 2K9ZA 1PO11 3HR9A 3LCPA 1NLSA 1GZWA 2X5IC 1MEC2 2WFF1 1VBA1 1IZ3A 1H1MA 3M1HA 3RYPA 4PIXA 3JCIA 1AXKA 1QF3A 2YZ4A 3FLRA 1LESA 1LRHA 1HRV2 3AP7A 1GV9A 1ND3A 1VBB2 5E89A 3JQWA 3N7LA 1I3HA 2ILMA 1V00A 3WQ1A 4HVOA 1IS3A 3I7DA 4WVVA 3T1LA 1DU3D 3RQ0A 3SITA 5JIAA 4K20A 1HW5A 1VBC3 4IXLA 2V5YA 2RS13 2PN5A 4UW5A 5KHHA 4DNYA 3W59A 1RUF2 2ZX3A 3E5XA 4FTSA 4Q4X2 2UWCA 3OYWB 1HV1A 3AYDA 4YZ5A 4G4FA 1UMZA 1R083 1J3QA 3M4FA 3VKOA 5A3MA 4XFBA 3IWZA 3H3ZA 3UJQA 2A6YA 3AP6A 2VMHA 5FO8B 4AVSA 2C5DA 2QDNA 2ZGTA 3B69A 1MS3A 2GNTA 2CGPA 3NKGA 1AYM1 5CVRA 5HXVA 5IK7A 1Z0HA 1IS5A 2UYBA 2VOXA 4JGZB 3OBRA 4JGYC 4WBBA 3USUA 2CWMA 3R6SA 4AFMA 4HBNA 1VP6A 4IV3A 3NV3A 1PO21 4UXAA 3LOIA 1O5UA 1GYKA 4IEUA 1VBC2 2P3JA 1CIWA 1CGPA 1SCSA 2RS12 2PAEA 4J1XA 4ASMB 4DMIA 4TZDA 1WLWA 4AVCA 1OLRA 1LENA 2XL9A 1J3RA 3TYJA 3MIDA 2QE3A 1R082 4LBQD 4HN1A 1QGLA 4NVPA 1NCRC 4M3CB 2FQPA 4GXLA 2W68A 2XJSA 3WG1A 4XJ8A 4AHWA 4RHV1 3U4XA 5I8SA 2XB6C 1SLCA 2VW2A 4QQ2A 2SLIA 2I07B 5C4WB 2AR6A 5L7OC 4I2OA 3R4UA 1VAVA 4QPIA 1FMD1 1ULFA 4DB5A 1DF0A 4Z82A 1H9PA 3LB9A 3ZXEA 1HRI3 1YRZA 3BPZA 1WW4A 5FLIA 2JE9A 2VOVA 4XW3A 3T1MA 3D5OA 2OYZA 2PHTA 5H9RA 1TE1B 2DCTA 3ZFFB 3WQ0A 3CL1A 2HJIA 3W9AA 2B39A 1DYKA 3GBWA 4WV8A 2LM3A 4D69A 3AZXA 4PBPA 2K0GA 4XYXA 2R30A 3GYDA 4B8EA 1UPSA 3RZZA 1DZTA 4GULA 4ORFA 1S0JA 2E51A 2VH9A 4K1ZA 4ITCA 3QOPA 2UY9A 1CAXA 1HKDA 1COV3 1KD7A 3D6EA 2YMZA 5GJ6A 3NV1A 3E6BA 1XNCA 2C0ZA 3JD71 1JOJA 2YY1A 2BNOA 4PF5A 3SLIA 1SLAA 1GBGA 2XWBB 3PJQA 3RI8A 2JECA 3SISA 1MQTB 2BUKA 2DUPA 1ALYA 1S0FA 2B5HA 5I0RA 4F8AA 2NMOA 4C0HA 4XILA 2ZGNA 4P9IA 5FTTC 2QZ3A 1ENRA 3LZZA 4KU7A 3ZX7A 3S7IA 3J8F3 4FOVA 1VBE1 5IK8A 4QM8A 1CONA 1ND3C 4ES8A 4OHYA 3V56A 2WZR1 5F1RA 4IEVA 1VRH2 1LHOA 1GSLA 5ABJB 3B00A 5FO9B 4LULA 2P37A 4OI2A 5CA6A 1BBT1 4MXVA 4YVWA 2XBO1 4FOWA 3AX4A 4QGNA 1VB4A 2IC1A 2VU9A 2WWSA 4FXGB 1J1TA 2ET1A 1LKNA 4I0BA 4YGDA 2XJVA 1PM7A 2VXRA 3OF1A 4HT1T 5I8YA 2WT1A 4JDMA 2UWAA 1COV2 2Y38A 3VZOA 3V0AB 4OHZA 1S55A 4Q0SA 3WW3A 1UIKA 4OFGA 3EXUA 4PIYA 5HBAA 4Y4YA 3VLBB 3AKRA 1ZZ8A 1TMF1 4GMP3 4L99A 2HWB3 3VZJA 2BBVA 1BMV2 3JB8A 3RS6A 5LK5A 3KQRA 1CQ9A 2DWRA 2OZ6A 3RJRA 4Y22B 3H50A 1RITA 3CJIB 1ND2B 2BNMA 3OBTA 4XFAA 2ZCWA 3MF6A 2XJQA 3EQEA 3J8F2 3ECQA 2YGLA 2YHJA 5FLJA 2B46X 5JAXA 2ZGQA 1C5HA 3DF0A 4ZU7A 1KS4A 5LEKA 2E6VA 2A5ZA 4IV3C 3RWNA 1W6QA 4PBOA 4QQLA 1BEV1 2B9UA 1JHNA 5T3NA 3UKVA 3CEWA 3HT1A 5DZFA 4B7EA 1AF9A 1OA3A 1YYNA 1KDMA 4D94A 2MEV2 3RDIA 4N43B 1G9AA 4XBLA 1DYPA 1RB8G 3D4KA 4EN7B 3VBFB 1O7FA 2EA7A 2CYFA 4Y26A 5BUVA 4SBVA 2XLGA 4B4RA 1AJOA 2HWB2 4K3UA 2QUOA 4CDQB 1O3RA 1UCXA 2RS31 4JC1A 1GZ9A 3U10A 2EF6A 1Q8PA 3X29B 4AEDA 1VB2A 1MS1A 4YW1A 5BY5A 1KJRA 1O4YA 1YI9A 3LAGA 1N3PA 5CFCB 5C33A 3RSJA 1J59A 4BLIA 4DRVA 4HVRA 3RJ2X 2ARXA 4WM8B 3GBGA 1ULCA 2Z69A 4N7IA 2DU1A 3LA2A 2OZJA 2AYHA 3M3IA 1DQ5A 1H8VA 1UU6A 4QPGA 2R071 4YVSB 3HN1A 2TEPA 3ZSLA 5D1IA 1F2NA 1HQWA 5L19A 3HQXA 2WZPP 3ME2A 5FCCA 1OD5A 3VBRA 4QM9A 3WY6A 1DBNA 1LGCA 2MNGA 3LSDA 4RR3B 4LO5B 3TN93 2VQAA 1RMU3 2EXKA 4N53B 2DVDA 3GZTB 3D82A 1NCQB 3ZXFA 4FBFA 1GICA 1HDKA 1AL21 1RUI1 3TBDA 5HCFA 1V9U3 2RM23 4AFDA 3CNAA 4DFSA 4R9BA 3WG2A 2RS53 3UKTA 3MLLA 1TQ5A 5A33A 1ZVFA 3VHOA 2PQQA 1QMJA 2DFCA 4FQZA 1LHVA 4OHXA 1ZBE3 4YZ3A 4X8PA 3KT4A 4IETA 2ARBA 3FHIB 5T54A 2WSVA 1H2KA 1ZA4A 2ATFA 3C3VA 2JG9B 4OLLA 4AGGA 2NP0A 3AKTA 5C9AB 2PAKA 5ACA3 4I0AA 2XL7A 4Q4V3 4RGGA 4YVWC 3THPA 4C1WA 4K9SA 3QH7A 4AI2A 1N47A 4YW5A 4JRLA 3TN92 1RMU2 2WNUA 2XJRA 3CO2A 4FOYA 3MFAA 2AH2A 3VBSB 1AYN3 2WKKA 5KXEA 3VKNA 4HSJA 4WM7A 4RS5A 3WHUA 1DZQA 3IKWA 1V9U2 2CV6A 2RM22 1B35A 2XVLA 2ERFA 4CDUB 4OVEA 5ABJA 1JUIA 4JDNA 4MV2A 1D4M1 4HK8A 2RS52 1Z78A 4E2SA 4MGIE 4BOWA 3VZKA 4DXZA 3L2YA 5HI0A 5LRSA 2XKPA 1ZBE2 1PGL1 3QCWA 1H4GA 4R4ZA 4M01A 2HEYF 4Q8KA 2GNBA 3FMGA 4LE4A 4EWEA 1AR81 1G9DA 2ZHNA 1YWKA 4XTPA 3S30A 3IMNA 4E4ZA 1C28A 5I93A 1LODA 2JDZA 2E7QA 5ACA2 1C4RA 1HXS3 1BBT3 3QLQA 5JLVA 2WT0A 5BNOB 2E53A 5FO7B 1DGLA 1PGW1 3WW1A 2ETEA 5EV7A 2ZZQA 1X36A 3E6DA 5D8AB 1PHMA 1UU4A 4XF9A 5KHJA 2KM2A 1ULDA 1AYN2 2A3XA 1Z7S3 4FQ4A 4KU8A 1PK6B 1NE6A 1Y7BA 2IFWA 3TAYA 1ZZ7A 2BWCA 1VBD1 3GHNA 2VVFA 3WDYA 2EXHA 5JDBA 4HMZA 1XNDA 2YXSA 1CD3G 1IOAA 4K40A 1L3JA 1H0BA 1D4VB 3PNAA 3POYA 1X50A 4PIZA 5BNNA 4GH4B 1VBE2 2FMDA 3FBYA 4AEDC 4CP0A 2P17A 1LOGA 2WZR2 4RD7A 4Q4W3 1N1TA 2DCZA 4HPKA 1FOD3 5CG8A 4PLMA 3WT3A 1D0HA 3VDDA 1FV3A 2IXHA 1PVC3 2DVFA 1HXS2 1BJQA 1AX1A 1BBT2 2R16A 1SQ4A 2XBO2 1RUC3 4QPGC 1AR93 3OPZA 5JCTA 1H2NA 4L2NA 2WQ4A 1BYHA 2OUHA 4LBOA 1ZRFA 1WGPA 3VBRC 2GH2A 2AREA 2VUJA 1W6MA 4XF4A 2CY6A 3IIAA 3ZYJB 3NO8A 2A3WA 1Z7S2 4IEWA 5FDBA 1QJU1 3VBUB 5FOBB 4FO9A 1LULA 3BALA 2JG8A 3RYRA 4DZGA 4MXWB 4NO4A 2QFEA 5I0SA 2VPVA 1PNGA 4YVSA 5DZGA 2RHPA 5GALA 3B9CA 3WUDA 5H9PA 2WNVB 2BWAA 3I59A 5AC91 2GH8A 1GQGA 4XQWA 3VZLA 2R0HA 4M3CE 1RUH1 1FOD2 4CZSA 1OPOA 3GBFA 2DUQA 3ASIA 3VKMA 1PVC2 2CNAA 2DU0A 4KGGA 1BEV2 4XDQA 1RUC2 4PDWB 1AR92 3ZFEB 1U5YA 3AMNA 2WNEA 1LB2A 4LHNA 2P3IA 3NSTA 5JOZA 1RUJ3 1ZRDA 2GC2A 2P2KA 2PHUA 4QGMA 3WR0A 3H8UA 3KGZA 4AW7A 2V73A 1HV0A 4CRQA 4J1WA 1O3SA 2YC0A 4P9GA 4WZFA 2WNUC 1IHMA 4XE9A 1FATA 3FLTA 5E1RA 4Y24A 3KT7A 1WW6A 1NY71 4ISRA 2VMIA 3GZUC 4RS5C 4WM7C 1WA4A 2ZA9A 2RS32 3AZZA 4HETA 2UU8A 4P9WA 1QQP1 1XNBA 1G7YA 1B35C 2ZHLA 1QH7A 5GZDA 1D2SA 1O91A 2OUJA 1RC6A 2VGDA 5J96B 5GZEA 2EIGA 5A32B 1JTZX 1KXGA 3B3QE 4XETA 2WFPA 4Q4Y1 5KC6A 4W6XA 1RUE1 2ZTNA 3VBSA 3VN4A 4GWNA 1MS0A 3MIFA 1DGWA 1IS6A 1Q56A 1Y3TA 3NL1A 4FPFA 4H7LA 4Q4X3 3NW4A 1UF2C 4RQPB 2O8OA 1H8TA 1RUJ2 4NHKA 2CL2A 1POV1 1W6PA 1QNWA 2GN7A 4U36A 4MUVA 3ALQA 1OFSA 5T5LA 1MS9A 1AR71 1EV11 4XJZA 3M3EA 5CBLA 3WUCA 1UN1A 1FPN3 1RUD1 3VBHA 4BH9A 3E5UA 3POWA 4M0HA 3AFGA 2PELA 3VL9A 1XYOA 3ILRA 1REEA 1WD4A 1OA4A 2ZGLA 1R1A1 2TUNA 3FLPA 3BU7A 1LTEA 5I8TA 1RUOA 4EN8B 2IXCA 3B7MA 4UW3A 1DGRN 1NZCA 4K8FA 5JI9A 3FWEA 2Y0OA 3DPRC 5T5OA 1RHI1 5JZGB 5BNNC 3S7EA 1URXA 4CDXB 4ONUA 3IPVA 4WVZA 4ZU4A 3MFCA 4HKWA 4YW3A 4WVMB 4AVBA 1OOPB 1W6NA 2RMU1 4BM8A 1GANA 2NMNA 3HIFA 3MIHA 5FREA 4GALA 1V6JA 5CFDC 4B4PA 3VDDC 3NKTA 1AHSA 2OA2A 2WA4A 1MVEA 5IK4A 1B09A 3B01A 4LTAA 2HWC1 4FTEA 1FV2A 4LBQA 2R041 4GH4A 3BODA 5C6CA 1QJX3 1FPN2 4I0WB 1VLNA 2Z2SB 3KSCA 4FPYA 1PIV1 1VAMA 2WSUA 5C8CA 2JG8C 2FHRA 3PHMA 3IDBB 4XIOA 2AENA 3MLJA 1ONAA 1KS5A 5K0UB 1LOBA 3VKFC 1V6IA 1D4M2 1V6NA 2VG9A 1DFQA 3RI9A 2XVKA 1F5JA 2PAMA 1HQLA 1S0IA 2HWD1 4FVVA 4META 1GR3A 3LGRA 2KA3A 2IXKA 3JBG1 2JICA 5DUVA 1CAUA 5FAXA 1PGL2 1RUG3 4L97A 3WNXA 4KWKA 3TWIA 4QQHA 3RMYA 5IK5A 1KFUL 3G6JB 3T2TA 3LA3A 2D6MA 4BWOA 3AKQA 2XJPA 2ZGUA 3WD5A 2TNFA 4OI1A 2HWE1 5DZEA 4CP1A 3OJBA 1R091 1SFYA 1LHUA 3NAPB 2D6NA 4C91A 1W0PA 2D93A 2ZZJA 4Z92B 4CEWB 4FCAA 1EP0A 5DDJ3 1OQEA 3RYKA 5EYXA 4UBGA 1QJX2 3ILFA 1MS5A 1G9CA 2GNMA 2JENA 2WL1A 4GA9A 1ZRRA 2WC2A 2A6VA 2QCSB 1VBD2 4HKLA 4JRAA 5FPXA 1K5MA 3J26N 2WS93 4FPJA 3WW4A 3ZFGA 4W6WA 4AFCA 1X8MA 1ZX5A 3D0SA 2D6KA 2NPIA 1X8EA 3ZN6A 3DL3A 3SNMA 1RUG2 3H3UA 4IV1A 1VRH3 4XFFA 4NHMA 1RJ7A 1W0OA 3INAA 2FZ2A 1GQHA 5FQ0A 1W6OB 1TNFA 4P5HA 1C8M3 2I2SA 4X8NA 1CPMA 1Q8QA 2LUWA 1LCLA 3AJYA 5FMOS 5BNPA 1KITA 1LU2A 2I74A 3O7OA 4YZ4A 4CDWA 5F6KA 4AHZA 1H8TC 3AJZA 1I5ZA 5JSRA 1QJY1 5DDJ2 3MIGA 3QH6A 5KBFA 3URFA 2R49A 3ZXGA 1I9RA 5A32A 3KB5A 1AXZA 4PLOA 1IPJA 2O1QA 3VBHC 3MI8A 4MYEA 1QOTA 5KC5A 2FBEA 1G9BA 4YM2A 4F83A 4OULA 2Z5WA 5K7PA 2WS92 3DGTA 3GALA 1NA1B 4RQPA 3VBOA 4GMP0 1QDOA 1HIXA 4MZUA 4K21A 1ZNPA 3NV4A 3WDTA 1MS4A 4IL7A 2R6QA 1ZM1A 1C8M2 3FFZA 1QU0A 1WBLA 3IN9A 1PZ7A 2BW8A 4IQPA 1XE7A 1GNZA 2R1BA 2XJUA 4XBQA 1KQRA 2MEV3 3VHPA 2N7GA 4QXKA 4GB33 4EROA 2R063 2PLV3 4H3WA 1DDLA 3AP5A 3H1YA 2CAVA 4C0BA 2E7AA 5K9YA 1S2BA 3BOWA 4G3YC 1PO13 1WMDA 2FMYA 1DQ4A 2O0OA 2PFWA 1C5IA 3B94A 1SBFA 2WFF3 1JH5A 5T5JA 4GH4C 1VBA3 4KG8A 2QJVA 5GLVA 2ZAAA 2F6BA 2AZ5A 2D3RA 4NN0A 5C8CC 4QQOA 1RINA 4AVVA 2UY8A 2AGSA 3WDWA 2IZWA 3ZIXA 4I09A 2Z79A 3OYWA 2WQZC 2Q1ZB 1GLHA 1D0GA 2CGNA 3WG4A 4AE2A 4D3WA 1RHI3 4IEQA 3R0RA 3ZO0B 1GKBA 1ASJ1 4Q1RA 4E2GA 4Q4Y2 2CGOA 3RPQA 3WDXA 4COVA 1WMEA 5JWPA 2PHRA 2X5IB 3E97A 4YM0A 3AKSA 3H9AA 3B02A 4ATEA 4GB32 4D7YA 2R062 3K48A 3ATGA 4JGZA 4FXKB 1O4ZA 5FLHA 3FBMA 2PLV2 2D98A 1U5XA 5K0UA 5E88A 3TNQA 2I45A 1Q8SA 5HCBA 3EBRA 3VZNA 4A7ZA 5EYYA 2A71A 3MW2A 4XTMA 1TME1 3CF6E 1PO12 3MDPA 4XOGA 2WFF2 4E9KA 4IEOA 4M3CF 1JW6A 1VBA2 4K7JA 3GHMA 4E27A 4L8QA 3JB4C 2RR11 4MX3A 1PIV3 3AK0A 2Q8OA 1AYM3 3VV1A 3H1MA 2GC1A 4FPHA 2DVGA 4QPIC 3D8CA 3WP4A 1FNZA 1K5MC 1HQNA 1AR61 3U07A 1Q8OA 2GDFA 3ZFGC 3L2HA 4LR4A 4R4XA 1RHI2 4XMAA 4S2HA 4KGQA 4M3CA 1PO23 3AFKA 3TRSB 3AM2A 2BPA2 3NV2A 2YGMA 4IV1C 4Q0PA 3WDUA 1CPNA 2RMU2 4LBJA 4RGAA 2ZMKA 3AMHA 4EN6B 4NHLA 3AP9A 5C4WA 2ZX1A 1U12A 3N4MA 1ZZCA 5BNPC 2UWBA 4JGYB 5A3LA 4H7MA 4LO7A 3ZYIB 2HWC2 2WLQA 1ZBA1 4CDWC 3AB0A 5GZCA 2D3PA 2W39A 4IEXA 4EWDA 3A4UA 5EWSA 4RHV3 3AYCA 2ZKLA 3ZFFA 5C8WA 1J1LA 1XRUA 3M3QA 1PIV2 4SLIA 1AYM2 5AVPA 2YROA 2NLRA 4YNIA 4Q8LA 1EPZA 3UV9A 3JUUA 1UKGA 4BMBA 1FMD3 2ET7A 3H1WA 2PYTA 2WJSA 3RG0A 3G7DA 4Y20B 2PHWA 2Q4SA 1MEC1 1IS4A 4AQSA 4P9JA 4Z07A 4GKXA 4YZ1A 3MICA 3VBOC 1T6GC 4YFWA 1PO22