4HVRA

X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 34
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hvrA01
1ZZCA 2PAEA 1CAWB 3U11A 2Z69A 3BALA 4BYYA 4XFGA 3KGLA 3I54A 1GQHA 3H7JA 4HVQA 1LKNA 3H1YA 4IEUA 1V70A 2XKOA 4PJYA 4BIFA 5I0SA 2ZKLA 3E5XA 4UXAA 3FFQA 1O4TA 2Q1ZB 4QXKA 1J3QA 3IBMA 2QDRA 3S0MA 3M70A 2BEOA 3QACA 1RTVA 2XLGA 2XL7A 4IESA 4LA2A 4HBNA 4N9IA 3S7IA 3DL3A 1I5ZA 5KBFA 3ACLA 5F1RA 3GYDA 1QY4A 2Q30A 1ZRRA 2K9ZA 3PLQA 3L2HA 2GC0A 4YSFA 3ST7A 4R52A 3WW4A 4OLLA 1O5UA 4YYOA 4YNIA 5BPXA 2PYTA 4IEQA 3KGZA 4Q0UA 3CO2A 4XEZA 3O14A 1OD5A 5KHKA 1DGWA 4JTOA 4Q0VA 4EWDA 3BB6A 3E6DA 3EJKA 2PFWA 3USSA 1U12A 4BH9A 5J7MA 4WVZA 4H7LA 1FT9A 1DZTA 2Y0OA 4Q0QA 5E16A 1XE7A 1ZREA 3D0SA 4Q29A 1PM7A 3KMHA 4Q0SA 1O7FA 2ET1A 3LZZA 4AQ6A 1ZX5A 2ETEA 4QX5A 2CAUA 3E6CC 2O8QA 3CJXA 2O1QA 4XFIA 5E1RA 3CL1A 3U10A 1UW8A 4MZUA 4J1WA 4IETA 3UKNA 5BXXA 1CAUB 1SQ4A 4FAGA 1XRUA 4KL1A 4WBBA 3DN7A 3MPBA 3H1MA 1Q43A 3H7YA 1JUHA 4HLTA 2P17A 5FPZA 4A2UA 5JSRA 3EHKA 2OPKA 3WW3A 1YHFA 5HI0A 2EAAA 2MHFA 3LA7A 2GH2A 4Z82A 1HW5A 1FXZA 4QM8A 4FAHA 4KU7A 1YFYA 3KSCA 2IC1A 4Q0PA 3IDBB 5JR7B 1L3JA 4ZU7A 3ROUA 3G7DA 1NE4A 4L11A 5BV6A 2PHDA 5T3NA 4P9GA 3IWZA 2HJIA 5JSPA 2VQAA 2XKPA 5KHHA 1ZZ6A 5J48A 2QVSB 5CU1A 1J58A 4ONUA 2GC2A 3MDPA 1EP0A 2ATFA 2IXJA 4HVOA 1NE6A 4OFGA 4DINB 5JAXA 2GAUA 4MX3A 3D82A 1ZRDA 3I59B 4PIZA 4LEJA 2UY8A 5FLJA 4Z07A 1G6NA 2I45A 2VECA 4IEXA 5FCCA 2PAMA 1ZNPA 3CLPA 1OFNA 3C3VA 3HT1A 4BHPA 1J59A 2QCSB 2D40A 1RL3A 4IEPA 2BNOA 3FE5A 4I09A 5EZWA 3PVBB 4PIYA 1EPZA 4D7TA 1X7NA 5FQ0A 2IXIA 3HIFA 4KWLA 3MZHA 3H9AA 4R8HA 2OZ6A 5JCTA 1ZRCA 2BGCA 4ORFA 1O3QA 3DV8A 4QMAA 5K8SA 2PAKA 3CEWA 3OTFA 4XFFA 5KHGA 4MV2A 4XF3A 1X8EA 2WFPA 3KCCA 1VP6A 2D5FA 2MNGA 4I02A 4ZU5A 4MUVA 3IIAA 2UYBA 5FPXA 4L2NA 2UYAA 1CX4A 4UBHA 4EWEA 2FMYA 4XFHA 3RNSA 3M3IA 3H3ZA 3WW2A 1CAWA 1ZZBA 3H1WA 2GU9A 2MPFA 1QWRA 1LR5A 2QNKA 4YRDA 4RD7A 3R6SA 3SCHA 1X8MA 4IEZA 4FT8A 3LAGA 1DZRA 4HN1A 3FHIB 5LRSA 1RUOA 3H50A 2OA2A 4XF1A 1ZZ9A 5LRRA 2PQQA 4META 4WZCA 5BUVA 1NZCA 2VPVA 1SFNA 3SMHA 2DCTA 2B8MA 1EYBA 3EO6A 4HVRA 5I0RA 2CGPA 3FX3A 2BNMA 2V09A 2GC1A 4LULA 2IXCA 2Q4SA 3LOIA 4QM9A 2WC2A 3NL1A 3ZDSA 1VR3A 2ET7A 1CAVA 5I8TA 4XFCA 2XLAA 3ELNA 5EFUA 4QGLA 4I3PA 4E2QA 2H6CA 3RYPA 1ZZ7A 1J3PA 5D1IA 2KXLA 3FWEA 4KU8A 2PA7A 2K0GA 4I2OA 3LWCA 1J3RA 1J1LA 3U0ZA 1RC6A 4HMZA 1O3RA 2D5HA 3TNQA 5FQ0B 3CF6E 2GC3A 4XFBA 1GQGA 3H8UA 4FBFA 1WLTA 4X6QB 3H3UA 1WGPA 3BPZA 5I8YA 4AVCA 3OF1A 1I6XA 2H6BA 1Y9QA 3NKTA 2UY9A 3BCWA 4CYDA 3OGJA 1YFWA 1OI6A 3NVCA 2H0VA 3LA2A 4QGNA 3UKVA 4XF0A 1Q5OA 4JVAA 3I7DA 4HSJA 1RGSA 1VJ2A 5CADA 2F4PA 5JSOA 1WA4A 2EA7A 1UIKA 3MYXA 1Y3TA 1EY2A 1CAUA 1PMIA 3RPQA 3OCPA 4LLOA 4MH0E 5I93A 2QJVA 3TNPB 4XF4A 1FI2A 4EV0A 4N9HA 3UKTA 4O9GA 4XF9A 1X82A 4K8FA 1O3SA 5C6CA 3SXWA 1LRHA 3VHRA 2PHLA 4ZU4A 4EROA 3EQEA 2Z2SB 3RYKA 4JV4A 4MGIE 4E2GA 4IEYA 1O5LA 3JZVA 3NSTA 3E5UA 1QXJA 5AVPA 3EBRA 3DKWA 3OD0A 4LA3A 4TLFA 4AXOA 2OYZA 1NYWA 2ZCWA 3BU7A 1IPKA 2B5HA 2XHKA 4AVAA 1CAXA 4YARA 5FLHA 1CAVB 3E6BA 3ES1A 3RDIA 1YWKA 1Q3EA 4IEVA 4PIXA 1YFXA 1ZZ8A 4XETA 1CGPA 5C8WA 3GBFA 4B29A 3I59A 5LEKA 1H1IA 3D0JA 3PNAA 5KHJA 2OZJA 3FJSA 2Q0AA 5LEJA 3SHRA 5J3UA 1YLLA 1SEFA 4QGMA 1RUNA 4O9EA 5I0TA 2FQPA 3E5QA 5I91A 1DGRA 2EVXA 5FDBA 4GULA 1TQ5A 2CV6A 3RZZA 3SCFA 4I0BA 4I0AA 4XFAA 3E97A 4IEOA 4E2SA 5CVRA 1UPIA 1IPJA 1UD1A 2BNNA 4LUKA 5BY5A 1LB2A 4IEWA 2HKXA 2XLFA 3HQXA 4X6RB 1QXRA 3FZ3A 1O3TA 2PTMA 3ES4A 4D7SA 1UIJA 4MGZE 2B9UA 4EWAA 4KWKA 4KWJA 3SCGA 2XL9A 5KHIA 5I0UA 4LTAA 4AQ2A 5FLIA 4MGKE 3S7EA 1OMIA 2IXHA 3IDCB 4LUMA 5I8SA 4AVBA 2GZWA 2IXLA 3HT2A 4JTNA 2N7GA 1ZRFA 1ZVFA 4F7ZA 1NXMA 3RYRA 4J1XA 4UBGA 1YFUA 3N4MA 2XGXA 2BYVE 3LA3A 1XE8A 4F8AA 4HSLA 4HN0A 1YUDA 4IERA 2E9QA 3NJZA 1CAXB 3WW1A 4HZFA 3ETQA 1UCXA 2C0ZA 1H1MA 2D93A 2IXKA 3B02A 3QOPA 4MGYE 4NVPA 2CAVA 3NW4A 4I01A
chains in the Genus database with same CATH superfamily
4ISQA 2ZX3A 4DRRA 1W6QB 3U11A 5HCBA 4E4ZA 2BPA2 3CU7A 1PHMA 4WM8A 1QDCA 4BYYA 1HXS1 4DEVA 2ZXQA 2JIJA 5GM0A 1LHNA 3P3PA 3I54A 2ZABA 2HWB1 2VMGA 3C7GA 2XMLA 1W6PA 1L7QA 1W2NA 2WS91 1AR83 1PM4A 1ZA4A 2WO7A 1PIV2 2XONA 3WNMA 4AQTA 1O91A 3U07A 1VBD2 5CB7A 3UV9A 3JXSA 1SDWA 1IKQA 5FXVA 3VGIA 4PQQA 4BIFA 2CU5A 1AYN3 2RS52 3KCYA 4Q4Y1 4EN6B 2ZKLA 5ANNA 1WZXA 1OURA 1H4HA 1YEWA 1W06A 3MV11 2Q1ZB 3KF5A 5DPNA 4BQXA 3A4UA 1LHUA 1QOOA 4IXLA 4LKDA 4XBQA 2JG8C 1F4HA 3QACA 2F17A 3KQRA 3ABZA 4LA2A 4N9IA 5IVCA 3KT4A 3DL3A 3KS7A 2VR4A 5JI9A 4AR2A 3ACLA 5KBFA 3GYDA 4Q4X3 3OJBA 3W5NA 1OVPA 5GZGA 3ZYJB 4KI5M 3LKJA 3ZYFA 2DBIA 3ZYGA 4DY5A 4DXSA 5LK5A 4YSFA 2ORXA 5KXBA 2X5IB 4QPYA 1JYTA 2A3YA 4JHZA 2WO2A 3SKJE 5L9VA 1C8M1 2PYTA 3OPWA 4C1WA 3B5LB 4CSWA 3KD4A 4XEZA 3EXUA 3O14A 1OD5A 1W8WA 1DGWA 4W50A 5FYVA 4Q8LA 4JTOA 4AEDA 3JQXA 2SLIA 1CIWA 4FQZA 4YVSC 1N3OA 3CMGA 4FOYA 4QPGC 1KS5A 1C4RA 1L7LA 1W6NA 2ZMLA 4AOCA 3WR0A 4BH9A 5IVJA 2W5FA 3TB0A 4CEYB 3IDEA 4WVZA 5AC93 4QU1A 1CJPA 1FT9A 4LBQA 5FBJA 3C7EA 1LAJA 1UXXX 5E16A 3THPA 1YQ2A 2VZ1A 4CP9A 1ZREA 4MGSA 3ME2A 2YU1A 5FK7A 1PM7A 4K1ZA 4P9WA 2XVKA 5E8AA 3GJBA 4Q0SA 4G4FA 1O7FA 2D97A 3R4UA 2VUAA 3A7QA 2ETEA 5DUWA 4QX5A 1GOFA 2EIEA 1GMMA 1ND3B 1OD3A 1VMFA 2B39A 3OSDA 4KBZA 1CVNA 2D6MA 4KG8A 2PLV3 1V6IA 3K46A 4GJZA 4LJHA 3ZR5A 1GOGA 3WVJA 2JJ6A 1QH7A 4HPKB 1PX4A 4LHNA 1PNFA 2G19A 4UT5A 1UW8A 2Y6JA 3HBKA 1W9WA 4IETA 5JZGC 3UKNA 5BXXA 3W9AA 4YW3A 3ZYPA 2Y34A 1G9FA 4FAGA 3NAPB 1XRUA 1S0DA 1WA6X 5F2SA 5JIAA 2P3IA 4DPNA 3ZFFB 4FSJA 1JS9A 2BRTA 1JUHA 1MS1A 2P17A 3GGLA 4ZPIA 1OOPC 4A2UA 1Q8SA 4OI4A 3OPZA 4DB5A 3WW3A 2B9VA 1PVC1 4XTMA 2EAAA 3AZZA 4YLZA 4Z82A 5K4LA 1FXZA 3JD71 4KU7A 2PN5A 2HWD1 1ZBA1 3OB8A 1UYXA 2DTWA 3UK9A 4UYBA 3KSCA 4Y5SA 2DUOA 3VHPA 2VW0A 5FYIA 3IDBB 5JR7B 2FZ1A 1HKDA 1L3JA 2ZX2A 3PU8A 1JXNA 3PUSA 4XJWA 5JXIA 4NWVA 2JEMA 3MFCA 1NE4A 4LK6A 2ZPXA 1KJLA 4L11A 1WW5A 3N3HA 1H30A 4WVMA 4OULA 5T3NA 4P9GA 4DFSA 3LIGA 2WYSA 3MO4A 2CY6A 2Y6FA 4P5HA 3D3AA 4CUBA 1PIV1 1TNFA 1DLCA 4CXXA 1VBD1 4LOTA 4WM7B 5KHHA 1RYYA 2DVAA 3WY6A 4BQ5A 5A6ZA 1DIWA 1RUE2 5J48A 3VDBA 2D6NA 3W59A 4YVSA 1MACA 2VOWA 2GC2A 1QF3A 2WJSA 2VNRA 3MDPA 3NV2A 1GYKA 2IXJA 3VDDC 1NE6A 5GALA 1YJLA 1HQWA 1Q56A 3Q8BA 4MX3A 3AJYA 4IL7A 2D98A 3I59B 5BNNB 3J8F2 3BTZA 1H8TC 1TE1B 4FFGA 4FI9A 4LEJA 5FLJA 4YM0A 2VUCA 1JOBA 3DGTA 1UMZA 3HWJA 5DG1A 1YYNA 4FPGA 5HV4A 5A7WA 3KB5A 3FC0A 1J59A 3WD5A 2A6VA 1RHI2 2ZGUA 2QCSB 2GMEA 1DQ5A 3FE5A 5T5OA 4Q4W1 1OC1A 1ND2B 1RUC3 4LHSA 3PVBB 4RHV2 2YROA 1EPZA 5D8AC 1PX3A 1E5SA 3VBOC 4LO6B 2LRPA 3VBRA 1WCKA 4AW7A 3S5AA 3GZUC 2WQZC 1O6UA 1LHVA 1RUG1 2QE3A 4CDXA 2AR6A 3HQRA 3PUAA 3LEKA 4P9JA 1G7YA 5A33A 3BUCA 1BMV2 3NKGA 1UKRA 4R8HA 1RUF2 2OZ6A 2RJKA 1APNA 2EAKA 3DUIA 1COV3 2Z42A 1ZRCA 4ORFA 1DQ1A 1W8ZA 5JVVA 2VZSA 4AHYA 1K5MC 4RR3A 1O3QA 4QMAA 3CDZB 4ARYA 2YBPA 3OTFA 4XXPA 3ZXJA 5JXJA 2AENA 2YC0A 3SH3A 3DPRC 5FIXA 1BBT2 4Y20A 3ZOIA 2WT1A 2WFPA 1BEV2 3OY8A 4FPJA 4AHZA 3ENRA 2AEZA 4LLFA 4HT1T 3MPPG 4AAXA 5FMOL 1E57A 3ZR6A 4ZU5A 5A6YA 1TMF2 2QQUA 3Q9OA 4MUVA 1LOBA 1UU5A 1U5YA 3IIAA 1RMU2 1A34A 1GV9A 3AP7A 3I2FA 2Q5TA 1PK6A 4RYDA 4AI2A 3K2OA 1EAH2 4IGQA 4L2NA 1Q8VA 2UYAA 1SMVA 1SZBA 3AZVA 2DV9A 4EWEA 2NP0A 2X09A 2YDEA 3RNSA 5C3PA 1REEA 4JGZB 4GIQA 1AR93 4JGYB 2I07B 2WDBA 4AGRA 1NQJA 1OLMA 1TEIA 3PL0A 4HKOA 3ZYRA 4QXHA 2RS33 4YRDA 1KRIA 4BK5A 3POBA 5LBCA 5M0TA 4MHRA 1LGNA 2WYFA 4E4DX 3FLRA 4XPVA 5A80A 4A45A 4TN7A 4HN1A 3FHIB 3WX5A 4LO4B 5FO8B 1RUOA 1R1ZA 2XUMA 3H50A 4IDZA 4QQPA 4Y3OA 4XF1A 2BUKA 2WO1A 5DABA 3WF2A 3ACHA 3PIGA 3OGRA 4R4ZA 4E27A 4NAOA 5IK5A 4S2GA 4ET7A 1NZCA 2VPVA 5IWFA 1SFNA 3SMHA 4Z8BA 3BTXA 2B8MA 5FP4A 5I0RA 4UFJA 1AVBA 4N90A 5FPUA 3KF3A 4BLIA 3FLTA 4LULA 1OSGA 2IXCA 3MV01 1AL22 3VBOA 4CRQA 5JOWA 2Q4SA 3PJQA 1CX1A 1FATA 1OA4A 2WC2A 5EPAA 2ZX4A 2C1FA 4TWTA 2P34A 4QX2A 5FR3A 2J1RA 1KXGA 3PDQA 3WUDA 3ZYIB 1NLSA 1GICA 4I3PA 3THTA 1BQPA 5B4NA 1NCQC 1XQNA 1ZZ7A 4BDVB 4D6QA 1J3PA 5D1IA 3O1OA 1S0FA 4UAPA 1UYYA 2WQ4A 3ACFA 4UFLA 2OS2A 3B01A 3ZKYA 1BVVA 1NA1B 3O12A 1CQ9A 5C9AC 3J8F1 1J3RA 2O8OA 1W8FA 3U1XA 2VMHA 1QH6A 4NRPA 4IE4A 1O3RA 3WDWA 2PHFA 2QQPA 1XNAA 3KM5A 3ZPYA 1YI7A 2J22A 2VZQA 3AL6A 1AYM2 4QWNA 5IVBA 1ZBE2 1VBA2 3CF6E 3LEIA 1G9AA 1RHI1 3PIJA 5FUPA 2VCBA 1MS4A 1H2LA 4AGGA 4A3XA 5JMCA 4AK3A 4RHV1 1ODNA 4NN0A 2E7AA 2HWB3 2VBDA 5FPVA 4CEYA 3GZEA 5IAXA 3H3UA 2WS93 5FZ4A 5A1AA 2ERFA 3POWA 2H6BA 4XACA 3GJAA 1MZ5A 1R082 1T6GC 3WNLA 1BMV1 1FNZA 1QJX2 2UY9A 3BCWA 2NZ9A 1FMD1 3V56A 5E88A 4B8EA 1OH3A 3GHNA 2LALA 4LHLA 3NVCA 1ND3A 2E7TA 3PUIA 4OHWA 2NPIA 3I7DA 2W39A 1OPMA 4Q4V1 3OBAA 1N3PA 4PF5A 3LF7A 3TEZA 3ZSMA 1BBT1 2F4PA 5CADA 5FZ9A 4XMAA 1F8VA 1ULEA 4AHWA 5C71A 4BOWA 1BEV1 4JKKA 3MI8A 2WNUC 1W8OA 2VNGA 4QKBA 1Y3TA 1EY2A 5DAQA 5E89A 1PMIA 5DUVA 4CPBA 2XB6C 3TWIA 1UNBA 3NAPA 1N1TA 2EIDA 3POIA 2JG9B 2XHNA 1C5HA 3N7MA 3H42B 3R05A 4MH0E 4L9BA 3UETA 4XF4A 4BQYA 1RMU1 1FI2A 2VG9A 1NUKA 4EV0A 3VUOA 1QDOA 4QX7A 5FBZA 4NUBA 2YXSA 2WKKA 5KC6A 4IV3C 3UKTA 1B35B 1EAH1 1HV0A 3F2ZA 4HKLA 4XF9A 5HCFA 1CPMA 4QPIA 1WMEA 4D0QA 4ZHNA 2RDNA 1RINA 5FZ3A 1RUH2 3LFMA 1OQEA 2YU2A 5ABJB 4RS5B 3JBG2 4E8CA 1UYZA 1V9U2 3T09A 4OMCA 3AKSA 1WW4A 4L8QA 3EBRA 4A4AA 3OD0A 1HJGA 2P3YA 4QQ2A 3V0BB 4DXZA 3V65A 4AXOA 5CFDB 1NYWA 4NHXA 2ZCWA 3BU7A 5LW9A 5F39A 5FZEA 3VBFC 3BKZA 1F15A 1AR62 2W1SA 5H9SA 1JHNA 3LQCA 4P9IA 4XUOA 5FUIA 1K42A 1K3IA 3LIHA 1STMA 4FOWA 5CKMA 1CAVB 3TN93 3RRDA 3MUZ1 2RMU3 2TUNA 2PHRA 4E9KA 5T52A 1LODA 1Q3EA 1YQ5A 4XQ4A 4K8RB 2VZUA 3H3LA 2X8KA 4XETA 1WD4A 1CGPA 5C8WA 1AL21 3GBFA 5F37A 1OXCA 3I59A 5LEKA 3BU0A 1Z78A 1RUI1 1SLTA 5EYYA 4XJAA 1RUJ3 2ARAA 2VH9A 1W28A 2WR9A 5J98B 2OQ6A 2VVFA 3AYCA 1TVGA 3T2PA 3WCSA 2CGNA 4BJ0A 1IS6A 2WIIB 3N35A 5C8CB 2OZJA 5KXDA 3OOXA 1XNDA 2Y6KA 4H55A 4XUNA 1TG7A 4AFAA 1JZ3A 1QOTA 2XJSA 4CDUB 5C4WB 1SCSA 2PMWB 2IFRA 3LSEA 2JD9A 2BOIA 1XYPA 2IWGB 3HN3A 3QH6A 4IE5A 5ACA1 5K0UC 1C1FA 4AVVA 3E5QA 5I91A 3CKHA 1G9BA 1BXHA 2RM22 1AYM1 3MIGA 5FZ8A 1DGRA 4ATEA 1BJQA 1KJRA 1VBA1 1ZBE1 2EVXA 4CCKA 4YZ3A 3NNJA 3RMYA 2XBO3 1CONA 4JC1A 1DQ0A 4XFAA 3MFAA 5JXHA 2LTNA 1QU0A 1UKGA 1WD3A 1OF4A 3AYDA 4HETA 4XHBA 1CZVA 2B7YA 4E2SA 1DHKB 5CVRA 1MS9A 4AZZA 4YG6A 1AR73 1UPIA 3ZXGA 2CHHA 4UOJA 2BNNA 3NJYA 1UOJA 3AM2A 2JDKA 1KQRA 3T2TA 4KWUA 1W0OA 4XBLA 2JX9A 3ZFGB 1EV12 1C57A 3DF0A 1I5PA 3ES4A 3U14A 3ITQA 5A7OA 1QEXA 1JTZX 2EXKA 3QLQA 4ES8A 2B9UA 5ANQA 4EWAA 3WV6A 4HOOA 1SPPB 3VBFA 4BCUA 1UZVA 1XE0A 5I0UA 3WXPA 4LTAA 3GNEA 1UF2C 2WLQA 3BODA 2R043 5DZFA 4NIAA 3GXUA 3CHXA 1QMJA 1H1AA 2DBNA 4JGYA 1W6OA 2AGSA 5CNAA 3WP5A 3IKWA 3AP9A 4AWDA 3IDCB 1MQTA 4YW6A 5A3UA 2Y64A 2R072 4QX1A 5A1LA 3WQ0A 2ES3A 2N7GA 2GP5A 2ZEXA 1ZRFA 5FFOC 5A3MA 2E31A 2VW1A 4BQ3A 1BK1A 1R1A2 2IFWA 4AFBA 4A7YA 2BYVE 4HK8A 4F8AA 3D5OA 1RUG3 1PMHX 2O0OA 5FKCA 5JIUA 1YUDA 1G9DA 1PMJX 4GXLA 4HG6B 3WW1A 2W95A 4LBNA 4UF0B 3PU3A 1W9FA 5HI0A 2D93A 4IGOA 3BIEA 1J84A 1SHWB 1GOHA 4NRMA 4PDWB 4MGYE 1POQA 2CAVA 3NW4A 5CG9A 1S4CA 2VZPA 1AR61 2RS12 4MO3M 2RS32 1BCXA 3GM8A 3BALA 3K51A 1OKQA 1HDKA 4NHKA 1CPNA 3KGLA 2BW8A 2VBBA 1GQHA 3H7JA 3PVEA 5CIRA 4PT6A 4TSVA 1HRI1 3VBUC 3WCRA 4CP2A 3LPGA 1YQ6A 1TZOA 1W2AX 2XKOA 5AFEA 4Z92B 3CJIA 1UU4A 2R7EB 4XCBA 5A7QA 1Y9MA 5IK8A 3E5XA 1D4M1 2FHRA 3HNYM 1W6MA 4UFMA 5FRAA 3BIWE 2YMZA 3FFQA 3SC7X 3HQUA 1NT0A 5IVVA 1CR7A 2ILMA 5A3TA 1A8MA 1QJY2 1E5HA 2QDRA 2YBSA 3S0MA 2WQ8A 3OEAA 4GB33 1MVQA 2BEOA 1XBFA 1POV1 5F5CA 2XLGA 1RXFA 3PJYA 3ZXLA 3SKVA 3S7IA 5F3EA 4MG2A 1GR3A 5IVYA 1I5ZA 5GZEA 2ADEA 3KWVA 2D3PA 2D7FA 2RM21 4XBNA 1ZRRA 1CIYA 1W3XA 3PLQA 4K40A 4RQPB 4R52A 3T30A 1FOD1 1SFYA 1T6BX 4YNIA 3UJQA 3WG1A 3VV1A 1IKPA 1GZTA 4BU2A 1VRH3 1R091 1KITA 3N9MA 2D3SA 2CGOA 4Q0VA 4QXBA 5DAWA 3DCQA 4XVHA 4W6WA 3E6DA 2MEV2 2HYKA 1BZWA 1KGYA 3USSA 2JDAA 4BE3A 2D44A 2J42A 2VQTA 4O65A 1JZ8A 4LT5A 5J7MA 5F3CA 1DFQA 1ASJ3 5CFCC 2GALA 4CU6A 2YGLA 1EV11 2XOMA 1RIRA 4FP2A 4IQPA 5FTTC 3VBHC 2JG9A 4WM8C 2DFBA 4D3WA 2DURA 2Q8DA 1XNKA 5A3LA 1QXPA 4N7IA 1S0EA 2B46X 1B35A 3D0SA 4Q29A 3GDBA 3AKTA 1GP5A 1QNWA 4P02B 1W9YA 5IATA 2ET1A 3LZZA 5FZMA 1UMIA 1ZX5A 4XAEA 1EUUA 4Z2WA 5FP8A 2CAUA 1GLHA 3E6CC 1LOCA 2O8QA 3KV5A 3M3EA 4FFFA 3VKFC 2QDNA 3VBUA 2R071 5E1RA 3CL1A 2ZHKA 3V0BA 3AFGA 4N8MA 3B93A 5BNPC 5L9RA 1R1A1 3MW4A 4Y4YA 4YGDA 2ZHNA 2WFF1 2ZEWA 2PHTA 2XJPA 3OYWA 2HEWF 4Y1YA 2FCTA 3N7JA 4HLTA 3OBTA 2Y6GA 5LA9A 4GMP3 2RE9A 4GWMA 3EHKA 3J7LA 2OPKA 1EUTA 1FMD3 5FY9A 1YHFA 3I3QA 2P5BA 2ZGNA 2IZWA 3LA7A 4K7JA 5IUQA 5L9BA 2Q8CA 3SEPA 1NCRB 3APBA 4QM8A 4RA0A 4CUCA 1PGL2 1O4ZA 2RS11 1FPN2 4COYA 1ENSA 3CNAA 4Q0PA 2BGPA 2E63A 4NR1A 4Q4V3 4LNVA 3ROUA 3G7DA 3HVDA 1PVXA 1XU2A 1OHFA 2P2KA 3T3YA 3X29B 4AYUA 4YZ2A 1YIFA 2JKBA 5BYNA 3POJA 3IWZA 2HJIA 4NIHA 5B2GB 2ZX0A 3HR9A 1T2XA 4H2AA 5JZGB 1S2KA 2VOVA 3WF1A 4FP3A 4SLIA 4BQ4A 2G9FA 5LWBA 3MUY1 4M3CA 4GWNA 2TNFA 3ZXKA 2QVSB 4S2DA 1IOAA 5JOYA 4ONUA 1BLZA 5FREA 1N47A 1OQDA 4GD4A 1LEDA 1SBEA 4D6RA 1VPHA 2A3XA 2VZVA 4OFGA 1H4GA 1QJY1 4N43A 2WA4A 3N9OA 1DDLA 4IV1B 3D82A 5CFCA 1MZFA 4B1MA 2XVLA 2P3JA 2UWBA 4PLMA 5EP9A 2UY8A 3VBHA 2VECA 4WM8B 4COZA 2LS6A 5FCCA 2PAMA 3ZVXA 2WBKA 3M8LA 3AMNA 2CWMA 2LW8A 4YG3A 5FOJB 1WW7A 1MVEA 2D40A 4IEPA 2WNVB 2D6LX 4YW4A 2XH6A 2K46A 2F6BA 2ZGTA 5EZWA 1UO9A 3WQ7A 3V0AA 1XXNA 3MGUA 3WSOA 3U4XA 2VNVA 2XJUA 4XE9A 3DXTA 2Y60A 4U2AA 2ID4A 1X7NA 3B00A 4NAMA 4Y22B 5H9QA 5A32A 5BNPA 3SEEA 5FQ0A 1CWPA 4KWLA 4EN8B 2NM1A 4Z1VA 1RUI3 3EYPA 5AVAA 2P3KA 1HRV2 3I2KA 4N7UA 5T5JA 3VB9A 2HEYF 4CU9A 3ZMNA 3I2DA 4D7YA 5JCTA 4QDSA 2BGCA 3RVHA 3K77A 5FZDA 5J09A 4MLOA 2VO5A 2PAKA 2ZZJA 1V6MA 2DVFA 5IW0A 5FJKA 1Y4WA 3ZXEA 1U5IA 3POYA 4MV2A 2XXZA 5ACA3 1RVF3 3EMRA 4P9XA 1V6NA 4YGBA 3AMMA 4QX0A 1J1TA 1LCLA 2MNGA 3USUB 4I02A 1VE0A 1REFA 3K4AA 3K3NA 4J25A 2JENA 4XUTA 1DF0A 1CD3G 1GFF2 3ZFEC 2VCAA 1RUD3 3IZOA 4S2HA 2UYBA 2CL2A 4Y1ZA 3AMPA 4K3UA 1CX4A 1KEXA 1PGSA 1QGLA 1VBB2 2YBKA 4UBHA 2FMYA 3LSDA 4M3CF 3PUHA 2VM9A 1UYPA 5FAXA 1VBC2 3AZYA 3WW2A 1K5MB 3H1WA 2GU9A 2VULA 4UW4A 5APAA 1LGBA 4TTGA 1LR5A 3QD6A 4O61A 4RD7A 3WNXA 2VMCA 2ZGLA 2ZHMA 2C26A 2PHWA 2FBEA 4LBJA 5F8PA 5J36A 4Q2FA 1HIXA 2WRAA 4XTPA 3VBSB 3N36A 4LPLA 1A78A 3K4DA 1TME3 1DZRA 2VTFA 3IAQA 3H8XA 1FPN1 3Q8EA 5LRSA 2Y6HA 4ZS3A 1QQP3 4KNCA 1S2BA 5LRRA 2PQQA 1G8WA 3VBRC 5FY1A 3ECQA 4FTSA 3ZXDA 3MW3A 4CDXC 4DMIA 2ZGSA 4HVRA 2QTWB 3FBYA 2OUJA 4W4ZA 1CZTA 5FY5A 2CGPA 2WZEA 4WVVA 3A23A 3RWKX 1SLAA 4YFZA 2JDNA 4URTA 4X8PA 2XQRA 3QBQA 4H3WA 5FZ6A 4N53B 3ZDSA 4AI8A 5JMOA 1G9CA 4C91A 4RR3C 4XFCA 3RZHA 3OBRA 4YGEA 4XMIA 1X9TA 4F3JA 4V1PA 2H6CA 2VY0A 3RYPA 1DYOA 1YJKA 2KXLA 3P1IA 3VD3A 2K0GA 2C6SA 1S1AA 1KD7A 1DGLA 4I2OA 4W6XA 1VB4A 5F5QA 3LWCA 5L7OB 1RC6A 3O5SA 1H8VA 2G9ZA 3TEWA 4HMZA 4CXYA 4ZKTB 4XXAA 4COUA 1UZWA 5FXZA 2GNBA 1PK6C 4XUQA 5C3OA 4CDWB 4E8DA 2AREA 1N3QA 2GC3A 2FDHA 4OI1A 4FPEA 4XFBA 5GJ6A 2Q1MA 5GLTA 1PO22 4CDQA 4OHYA 2RS51 1XYNA 3VZMA 1UWWA 1HRI3 1VBE3 3ZFEA 2HWE3 2Z79A 1GZWA 2VC9A 3I2IA 4AI0A 3VL8A 3ZYBA 2YFZA 2YC4A 1GQPA 3I49A 1I6XA 3R4SA 1X33A 2O14A 5L36A 1JZ4A 2HWC2 1Y9QA 4A7KA 1HRV1 4LE3A 3VD4A 1AXYA 1H2KA 4CYDA 3OGJA 1VRH2 4P9YA 1D4M3 1S55A 1OI6A 4GWJA 4IGPA 3KT1A 4K21A 2QQKA 4GJYA 4K9SA 3S5QA 5DG2A 2QQWA 4CEWA 5EIYB 1Q5OA 4JVAA 3H8OA 1E5RA 4P08A 4HSJA 2XWBB 2ENRA 1XNTA 3FHAA 3M3OA 4CPBD 1JYVA 4LO7A 2V5DA 2EXHA 2WLPA 4GH4A 1UZZA 4RGAA 1JYCA 1CN1A 3NJVA 5LY1A 5IFTA 2GNTA 1FV3A 4ZS2A 4LLOA 4P5YA 4Y4RA 3PMSA 1UZ0A 1V6JA 3TNPB 4AI9A 4CP0A 1D2SA 2VW2A 4O7XA 1FOD3 4URAA 3W21A 4KBBA 5F3GA 3LB9A 2GSYA 1VBB1 1ULFA 3WOGA 1X82A 1O3SA 1NCRA 2RR12 3G6JB 1QJZA 1R093 3VHRA 4ZU4A 4EROA 3I3EA 3EQEA 4EE2A 3POSA 4E2GA 1VBC1 3KVAA 3NJXA 5DZGA 4ASLA 2VGDA 3E5UA 2XUEA 2WSUA 3KCXA 1PO12 1QJEA 2Y0IA 3RG0A 4UFKA 1JHJA 3LPFA 4TLFA 5FZ7A 2OYZA 1ULDA 4YW1A 2R063 4CUGA 2V73A 1IPKA 4X8NA 3ZKUA 4AVAA 1UY0A 3WZ1A 2V5YA 4YM2A 2HWF2 5L73A 3V64A 3I2HA 3ES1A 3RDIA 4CEYC 3M7AA 3SH4A 1WMDA 1W8TA 1W9SA 3MIBA 2R1DA 5IFPA 5DDJ3 3JCIA 4IV1A 4Q5OA 3RMXA 5C3QA 3IPVB 4DUXA 1W6QA 1LNSA 1MEC2 3MF9A 3PNAA 4KH9A 2WZR2 5JLVA 2JB8A 2YY1A 5CZKA 1ND3C 2FDFA 2WT0A 5FXWA 3WDXA 4B7KA 2GDFA 3FJSA 4XCAA 2WFF3 3WNPA 2VUJA 1U0AA 1F5JA 1SACA 5CYYA 5LEJA 3HBZA 4QHBA 3H8RA 3NV4A 5F5IA 4V2WA 1UMHA 2J7MA 2WNVA 3GCXA 3GF6A 4KG0A 3KV4A 1YLLA 5LA2A 1QJU2 3PTRB 4S2FA 3NO8A 3ETPA 1RUNA 3NAPC 5LASA 5I0TA 3ILNA 1GNZA 3AYAA 1FYUA 5DQ0A 4NHMA 1H2MA 4LBMA 2XJVA 3CZUA 4PBPA 3KHCA 1YC61 2XG3A 5FDBA 5LK7B 4QPIC 4XJ8A 4DUVA 5J96B 3SCFA 2DUPA 1RUE1 4B3NA 1OVSA 1PO21 1Z7S3 3OGGA 1DYPA 1AR82 2TEPA 2A6XA 2ZBJA 1XSQA 4NPMA 1IPJA 4LUKA 5BY5A 4JQTA 4QKDA 4BQWA 1AYN2 3FUQA 5JR2A 1F9KA 2XLFA 2G4IA 1JI6A 4KGQA 1WCSA 2X5IA 2QQLA 3GZTB 4IE0A 3I3DA 5K0UB 4FO9A 2QQVA 3OG2A 4WM7C 4YW5A 2UWAA 4GAZA 4D7SA 1UIJA 4LBKA 3IM0A 1ZM1A 2AACA 4KWKA 3SCGA 1BK0A 4YVWB 2XL9A 3AK0A 1A3KA 1D0HA 2A7AA 1HXS3 1S0CA 4QQHA 4QB2A 3FN9A 1NAEA 1UY2A 2JDMA 4OHZA 1N1SA 4Q4X2 4YM1A 5FLIA 5BNQA 3POGA 4MGKE 3S7EA 4L97A 1SDDB 3I2GA 4NWWA 3PVNA 1NKGA 5F2WA 3SNMA 2IXLA 2RDQA 4Z2AA 4JTNA 3WDYA 1OPOA 1JU3A 1OA3A 1W03A 1ZVFA 4Q4Y3 4XHXA 5DAPA 4J1XA 1RUF1 1W3VA 4UBGA 3RYRA 2RDRA 2XGXA 3WQBA 2E51A 1ENQA 2RR11 3OD4A 2W1QA 4JCKA 5CKQA 2KM2A 2XWJB 2OT7A 4ASKA 2WWSA 2C9AA 1CAXB 1NXD1 1VAKA 3ETQA 1Q8OA 4HPKA 3MEPA 1PO11 3OGVA 4C0BA 1UAIA 3B02A 1WMFA 3GBWA 2Z4FA 1JU4A 2HYXA 3HMYA 4NVPA 5AC92 4LBLA 4YGCA 1JZ5A 1YCIA 1B09A 5FZOB 5FMBA 2W1WA 1TMF1 2Z69A 3MICA 3ZFFA 4N53A 4AQSA 5T5LA 4Q8KA 2BWCA 5DXDA 1HN0A 2ZHLA 1UL9A 4IW3A 1I3HA 1HB1A 1C8M3 4QHOA 4WVWA 1LKNA 2PHUA 5IK7A 1S0JA 2ZGMA 5T55A 3EB7A 2JDZA 3I8TA 4IEUA 2PLV2 4QQOA 4RFT0 3SH5A 4HL0A 5CG8A 3IN9A 1AUYA 1GZ9A 4GMP0 4PJYA 3KHBA 3I4IA 1MEC1 5L7OA 2K2SA 2WZR1 1XSRA 1N1YA 3VHNA 4W8JA 3O1RA 4UXAA 1AJOA 2CDPA 1O4TA 2WWJA 1J3QA 1HB2A 2CDOA 1GZCA 4LO5B 3IBMA 4KQ7A 4BXFA 3M70A 4WM7A 4DRVA 5FY7A 1DG6A 1AZDA 1QJU1 2JWPA 1RTVA 4Q26A 3U37A 3WG3A 5C33A 2I74A 2JXAA 2XL7A 4HBNA 4JGYC 4XYXA 2ZGQA 3ZX7A 3H0OA 1MQTC 2LUWA 2ZEYA 5F1RA 1RB8G 4I3GA 1FAYA 2Q30A 4AI3A 2V4VA 1LTEA 3L2HA 2IUWA 4HXCA 4RGKA 3P6BA 2P1BA 2JICA 5D2AA 2QZ2A 5BNNA 4YZ1A 3WW4A 4OLLA 1O5UA 4YYOA 4AVTA 1GANA 5FP9A 5BPXA 4IEQA 4Q0UA 1IS3A 3CO2A 3OEBA 4A44A 1AR81 1UU6A 1JZ2A 1A6CA 2CSGA 3AMQA 1MZ6A 5KHKA 4QXCA 4OUEA 3BB6A 2WT2A 2OW4A 2VCCA 3AYEA 5F3IA 5F9TA 2HBUA 4LK7A 1ND2A 2ZJCA 5FZGA 3LD8A 2CWSA 1PVC3 3BI3A 3BPSA 1H6YA 2VTXJ 2QQNA 3JD73 3AXDA 2HWD3 1ZBA3 3WDUA 3Q8CA 2Y0OA 3WEZA 2W68A 2BWAA 3AVRA 3D6EA 3U75A 3UL2A 1XE7A 3WNKA 4MXWB 3N9QA 5IVEA 4NIGA 2BBAA 2OXBA 4Q4X1 4AQ6A 4Y24A 3AP5A 3ZN6B 3CJIC 3NNLA 4M4RA 5A3PA 4OUMA 1WLCA 3BN6A 2YUEA 1PIV3 3CJXA 1VBD3 1PNGA 4AFMA 2FCVA 1RUC2 4LR4A 2PELA 4XFIA 4MGQA 4R9AA 2Q8EA 3U10A 4MZUA 3P3NA 2RS53 1R081 5BNOB 3IDAA 4J1WA 4YM3A 1QJX1 3U4SA 3N7LA 1W9TA 1SQ4A 2BFUL 2C5DA 5T5PA 1ENRA 2B42B 3MIEA 4HK9A 2VJXA 2X29A 4GKYA 4WBBA 5FZAA 1W8HA 2YPDA 2RG4A 3H1MA 1RITA 1Q43A 1ULOA 1W0NA 1W8NA 2DF7A 2DFCA 5EWSA 5FYUA 1MR5A 4NMIA 4DOUA 1COV2 3RGBA 1Y43B 2R49A 4OMDA 3ZDVA 3O1PA 2YC2A 4E4SA 2GH2A 4FPOB 5AC91 1W6PB 2I2SA 4OQ8A 3AZXA 1W2OA 4JGZA 3HOBA 4UW3A 1QKQA 2IC1A 2JE7A 2QQJA 4CCDA 3MF6A 4ZU7A 1W0PA 4Q4W3 2WZ8A 2AC1A 2DVGA 2EIGA 3NWKA 4QKFA 2PHDA 4A6OA 3I2OA 5FP7A 2FMDA 4AFCA 1NLRA 3CZJA 4MGTA 5FV3A 4DXTA 2PLV1 1RUH1 3HD8B 2VQAA 2BVVA 3JBG1 2WZPP 1V9U1 5EQUA 3OBZA 2HBTA 3ZO0B 2R1BA 3RZJA 5CU1A 1LJ7A 3M3CA 1J58A 1J83A 4JKLA 2JG9C 1JW6A 1AR92 1EP0A 2D43A 2RVAA 4HVOA 4Q1RA 2C4XA 1US2A 4Y1XA 5FZKA 3MIHA 4B4QA 3ASIA 3MHZA 4DINB 1AXZA 1B35C 3OUIA 2LM3A 4PIZA 4TZDA 4FCAA 4ZZ8A 4L92A 1IZ3A 2VOKA 4Z07A 4BQ2A 5GZCA 1HB4A 1OBNA 1UX7A 1ZNPA 5FJHA 4UI9L 4ES9A 4AEDB 5JOZA 3CLPA 3AKRA 3C3VA 3HT1A 1ZYBA 2FZ2A 2XPJA 4ISRA 4QU2A 2A75A 5CFDC 2BNOA 1NA1A 2Q1FA 4I09A 1YO8A 2H0BA 2OPWA 4IE7A 1OQ1A 3B69A 4A41A 4BPZA 4ZY9A 1LULA 1M06G 2GNDA 2SBAA 4EZHA 3ZMOA 2ZX1A 4BMEA 4LBQB 2EALA 1D2QA 3T08A 3K3OA 4CP9B 4YVWA 3RZKA 3MZHA 4DEQA 3A22A 1UX6A 2WINB 1AX2A 3M2MA 3N9LA 2RHPA 1VLNA 5K8SA 4XAAA 3A0KA 1N1VA 4UWDA 5FKBA 1A8DA 2DYCA 1BKZA 1K12A 5KHGA 2VNOA 3THCA 2XR4A 3RZMA 4QQLA 4Y5Z0 3KCCA 4CDUC 3W20A 5C4WC 5C5TA 1M4WA 4Y1UA 3J7NA 2WNOA 4PLOA 1UY3A 3B94A 4FFHA 3ZSLA 5LCWL 2QQOA 5JPMB 4ATFA 3VD7A 3MLJA 1XNCA 5A1FA 5JDBA 3O0VA 2A6YA 2VMFA 1RUE3 5FPXA 3WP3A 2JG8B 2HWB2 3VKNA 2D3RA 1C8NA 2VZ3A 5GZFA 1YI9A 5JXGA 4N43C 2ARXA 2WS92 3O1MA 3DXUA 3QCWA 2E33A 5HXVA 5KC5A 2B45X 2MPFA 5FO9B 1QWRA 2E7QA 1W8UA 4YWAA 3WF0A 2JECA 2W52A 3J8F3 3R6SA 4OUSA 2W91A 5H9PA 3VZJA 3C7HA 1COV1 5JI7A 4WVMB 4W65A 3ZM8A 3ATGA 3LAGA 3TBDA 4JDOA 1OLRA 2CTVA 1JMUB 2J1EA 4RL7A 4YZ5A 1H6XA 2UU8A 3JB8A 4RS5A 5ABJA 3FHQA 1RHI3 2OA2A 1ZZ9A 1LOFC 4OHXA 1BVP1 4YVSB 2ZOEB 2ARBA 2V72A 3VD9A 3ZSKA 4QPGB 1D7PM 4RHV3 4B4RA 4BQ1A 2DCTA 5CFDA 4MSVA 3FX3A 5A6XA 2BNMA 2JE9A 3LFIA 3T0DA 2V09A 4CXWA 3MLLA 3UNPA 2BU9A 4QM9A 4BWOA 5KWRA 2BP6A 5GLVA 1WBFA 1CAVA 1ACCA 2NMOA 5I8TA 1DQ6A 5JWPA 2XLAA 1RUF3 3UJOA 3ELNA 5EFUA 2G1MA 1C5IA 2BBVA 4I0WB 5A7WB 4QGLA 1AR91 2W9XA 3FWEA 4KU8A 4EQVA 1QJFA 2RS31 2Q8OA 1R64A 4LITA 3WUCA 5L19A 2P37A 3POFA 4G9SB 3WP4A 1BBT3 5CBLA 3WHUA 4NROA 3C2UA 3VBRB 1BEV3 4D6SA 1YIPA 2OKXA 3ZN4A 5C8CA 3TNQA 3S6PA 3DYOA 1D0GA 2C24A 4CDXB 5FP3A 5A7SA 4CDUA 2A1XA 5C4WA 1TMF3 3RSJA 3ZLIA 5A33B 4B1LA 4M0HA 3TN92 4PDWC 1RMU3 2RMU2 5CEHA 2W1UA 5FYSA 1CZSA 1IG3A 1JH5A 5EYXA 1GQGA 1C3HA 1EAH3 2A73B 1E5IA 5IAVA 4RR3B 4XQWA 5C3RA 1OOPB 4QX8A 4K6BA 4X6QB 4AEKA 4LKSA 1WGPA 1K45A 2W2IA 3C7FA 3JU9A 2A6WA 4LMFA 3TEYA 1ENXA 4JDMA 2ZEZA 4QT6A 1RUJ2 4MXWA 1JODA 3K48A 4NHLA 4NPLA 3OY8B 4XDPA 1O8PA 4ZXEA 1DU3D 4UW6A 1RJ7A 2GMMA 3ZIWA 1YFWA 3IAPA 3WLUA 1HB3A 3AL5A 2DDUA 3I2JA 4QDRA 1XU1A 3WNNA 3WF3A 4QGNA 1MS3A 5SV8A 5CISA 2VVEA 2YHJA 4XC9A 5F6KA 1H9PA 1RGSA 2EIBA 2TBVA 4D69A 1VJ2A 4NE9A 1KS4A 3CBNA 1WA4A 3SLIA 1W2UA 3LDRA 1ULGA 2QQMA 3O0XA 3NNFA 3MYXA 1LOFA 1O8SA 3ZFGA 4AGVA 3OCPA 2BJSA 1ULPA 1Y7BA 2JDPA 2YG0A 2QJVA 2R0HA 5FPBA 1AL23 1JUIA 2XBO2 3VDDB 3VDCA 2MEV1 1SPPA 3BOPA 1FV2A 5DN2A 3BVCA 4O9GA 1O4YA 4DXRA 5IK4A 4CZSA 1H8TB 2A3WA 4K8FA 5C6CA 1LRHA 1W90A 5GLWA 2PHLA 3KV6A 2KD7A 5DZEA 4RQPC 1FX5A 2Z2SB 1AR72 4MGIE 1G86A 1O5LA 3JZVA 3LEMA 3NSTA 4IEYA 3RI9A 3ORJA 4B7EA 1QXJA 4FOQA 5AVPA 3ZIXA 1SLBA 4CCJA 2UWCA 4DY3A 4LA3A 2ZZQA 3LCPA 3WINE 2B5HA 2VD7A 3I97A 5D8AB 5FZCA 1AYM3 3VBOB 4AI1A 5IHRA 3GALA 4PBOA 1ZBE3 1VBA3 2BQPA 4A7ZA 4CDQC 5FLHA 1CJDA 4UF0A 2EXIA 3E6BA 1YQ8A 1YWKA 1H0BA 1WUVA 4FPHA 2R042 1KDKA 2G9GA 4IEVA 4PDWA 4PIXA 2DCJA 2NN8A 1FNYA 1F35A 1SG3A 4HANA 1ZZ8A 3I3MA 5LBBA 4Q4W2 1LU1A 1H1IA 3VLBB 2GMPA 1SBFA 1R083 1IHMA 1V6KA 3DPRB 1LEMA 1QJX3 2AUYA 4CEWC 1RUG2 2Q0AA 1PGL1 2BFUS 3T4HB 4D8MA 3SHRA 4C8DA 3WQ1A 2E26A 2VXJA 3DKQA 3WP6A 3ZSEA 5J3UA 1UOFA 2A6ZA 4FVVA 3DYPA 4GH4C 1SEFA 4M0NA 5HBAA 3KVBA 2QUOA 3FUOA 1GP6A 1GWLA 4O9EA 2DUQA 1UOGA 2A5ZA 2FQPA 4JRAA 3RI8A 1I9RA 1K5JA 2KR2A 2VUDA 2BV4A 5DUXA 3FMGA 3RS6A 3O1UA 3ALQA 4YZ4A 5G05L 4ASMB 1O59A 4YFWA 3TN91 5LZ6A 2RMU1 1NCRC 4CCCA 4I0BA 4IUGA 1AL0G 2P6HA 2XJQA 4I0AA 3E97A 1V0AA 1KFUL 4XZUG 5EXOA 1KFXL 2DCYA 4G3YC 5FPAA 5FYBA 3WHTA 4EN9B 3BTYA 3O1SA 4MYEA 4BA6A 1RUH3 5JOXA 3JBG3 1V9U3 5FZ0A 1RUJ1 4RQPA 3ZXAC 3JUUA 4IEWA 1SLIA 1AXKA 1UY1A 1NX9A 4LBOA 5IVFA 2EXJA 3NMBA 3FZ3A 2Y33A 1O3TA 1XYOA 4AF9A 2PTMA 2ORZA 3LGRA 3L2YA 1AR63 4L0PA 4MGZE 5FZHA 4GB32 4KWJA 1DGWX 4D94A 5LBEA 2PQSA 4INDA 5KHIA 3UGHA 4LXLA 3VKMA 2HH9A 4NO4A 2JG8A 4QPIB 4XZPA 4AQ2A 1ALYA 1VAVA 1WCQA 2VMIA 4IV1C 1GBGA 1ONAA 4CCOA 1OMIA 3THDA 1JBCA 3R0RA 4FFIA 4A6SA 1NCQB 2X10A 2XBO1 3VKOA 3TEXA 4AVBA 3HT2A 5EV7A 3T0BA 2AEYA 3MBWA 3MIFA 1ODMA 3T4VA 4F7ZA 1YFUA 5C9AB 2DWRA 4BK4A 2KA3A 5A7NA 3LA3A 3GBGA 5DMYA 3HNBM 1RXGA 1XE8A 5GLZA 3FFZA 2CYFA 2WNVC 4NPRA 2D6KA 3A0NA 3N7KA 3LDKA 4FOVA 4HSLA 1AR71 2DCKA 2E9QA 5D21A 3NJZA 4BM8A 4UFHA 4HZFA 4XQDA 2ZGPA 2VQUA 3ZN5A 4TXWA 4JHTA 4C90A 1POV3 2IXKA 4JKMA 1Q8QA 2J1SA 4QPGA 2W46A 1ASJ2 3CIHA 1OT5A 1MS8A 5FY0A 1S0GA 1XJAA 4FTBA 2JDUA 2W0XA 4ZONA 5E6HA 2YFUA 2JDHA 2FDGA 4XJ9A 2BERA 1ZZCA 2PAEA 2RM23 3UT0A 1CAWB 3ACIA 5IJRA 2Y8KA 5A3WA 4LKFA 5FYZA 4XFGA 5HV0A 3K4ZA 2ZMNA 2IVJA 4GZ9A 2R041 3Q8AA 1LENA 3T2QA 4HVQA 2QQIA 1IQDC 3H1YA 1ULCA 2R0FA 2WN3A 2ZGRA 1V70A 3PTYA 4M4PA 4COWA 3SITA 4WV8A 5IYYA 1DQ4A 2X5IC 3UESA 4IE6A 1DCSA 1OLME 5I0SA 3OPTA 4QAWA 1IS5A 1WMXA 2WSVA 1PGW2 3J26N 3N9PA 4NJ4A 4FXKB 4QPWA 5FUNA 3WDTA 1WWYA 5DAVA 2ZGOA 4QXKA 1EV13 5JZGA 2WNUB 3UYJA 1X9PA 4AAPA 4QB6A 3MLKA 1AF9A 1V00A 2XJRA 1F4AA 5H9RA 1F5FA 3PMEA 5EJZB 1FMD2 1UY4A 4IESA 4CU7A 5FMCA 1OOPA 1OA2A 2C9KA 3LE0A 5FOBB 2DVDA 1QY4A 2ZKNA 3HNMA 4IV3B 2R16A 2BOJA 5GZDA 4LKEA 1Y9GA 2K9ZA 4Q4V2 2JDYA 2GC0A 1JOJA 3VBSC 3ST7A 1PZ9A 4Q27A 2R073 2VE1A 2F4LA 4HFSA 1DZQA 3NV1A 4P00B 4XURA 3TAYA 2XQXA 3KGZA 3AXEA 1R1A3 4LHKA 2A71A 2WA3A 3O1TA 2J1VA 2QFEA 4EWDA 2AYHA 3EJKA 3VBFB 1WLWA 3UGFA 2J1TA 4XILA 2PFWA 2RDSA 1ST8A 3RJRA 3TYJA 3LOBA 5FWEA 1JYWA 1U12A 4CUAA 5FO7B 3C7OA 3WDVA 4DO0A 5FZFA 2ZGKA 1GWKA 5HCAA 1AHSA 1W6OB 4AEJA 3TRSB 3ZFFC 4H7LA 4H7MA 4N53C 1F2NA 2JIGA 1DZTA 1MQTB 4Y22A 3ZXFA 2RS13 3O0WA 4AE2A 4Q0QA 3VDDA 4GB31 4FPLA 4GA9A 2OUHA 3U78A 3AC0A 2YB7A 1SLLA 3J9SA 3KMHA 2GN7A 1JOPA 1H8TA 1QHDA 5FPLA 2WL1A 4CE8A 1S0IA 1VMJA 2P6CA 5L7OC 3JB4C 3C8XA 2JKXA 3VDAA 4A42A 2O1QA 3NV3A 1NY72 1REDA 1HJFA 2R32A 1W05A 4NHYA 2HWC1 2ARCA 5C5UA 3J4UH 4XOGA 5A7PA 1QIQA 4CA9A 5DAXA 4K20A 4CDWC 1VRH1 1YNAA 4OYUA 1CAUB 5FYYA 2B4KA 5D8AA 4AHXA 4TLGA 1Q8PA 2QBXA 4HKWA 3PHMA 3Q8FA 4KL1A 3USUA 3ZYHA 1QJY3 1RUI2 2W94A 1WW6A 3DN7A 2WAOA 3H7YA 3AX4A 5FPZA 5JSRA 4MXVA 2AH2A 3F95A 1GSLA 1IQAA 4GALA 5A6QA 3AJZA 2MHFA 1ASJ1 1U5XA 1XC6A 2ZTNA 4P9LA 4NIDA 1HW5A 4FAHA 5CAZA 2Y26A 1SFPA 5ERLA 4C1XA 1JZ7A 4OZOA 4U36A 1YFYA 2NMNA 1WKYA 3NNGA 3NRUA 3PUQA 5BNNC 3INAA 1GKBA 1K5MA 5HCHA 4LO8A 3CJIB 3BGAA 3MW2A 5T54A 1HQLA 4QD2A 5ACA2 1RVF2 3TOJA 3DPRA 4FPKA 4GQ7A 1W6MB 4M01A 3ACGA 3VBSA 5BV6A 2DCZA 4XJUA 2L9LA 1I1EA 5F6LB 2PHXA 3VHOA 2DVBA 5EJ3A 5JSPA 2W3JA 5KXCA 1GP4A 1ND2C 5LA1A 2XKPA 4NRQA 5FY4A 1RUD2 1ZZ6A 2MEV3 4F83A 3O7OA 4XIKA 1W2TA 2YYOA 2J1UA 4RFRB 2DU0A 1PGW1 3NNMA 3PVOA 2ATFA 2J1AA 3AB0A 4OZXA 4EJRA 1WCDJ 5JUVA 5FYMA 5JAXA 1VB2A 2GAUA 1YRZA 3FL7A 1IGOA 1F31A 1ZRDA 2HWF1 4JRLA 1DYKA 4GMP1 3MPBA 1UOBA 1G6NA 1PZ7A 2I45A 2P4EA 3GZAA 4IEXA 3HEIA 3KQ4B 3KZ4C 4OI2A 1HN1A 1OKOA 1TME2 1OFNA 1SLCA 4BHPA 2VMEA 5DUUA 2W47A 1QQP2 1RL3A 2VVDA 2X53S 5HPOA 5J1XA 3UGGA 3RWNA 4CP1A 2X05A 4PIYA 5LB6A 2EF6A 3MIDA 1LOAA 4MADA 2AZ5A 2OX0A 4XDQA 4D7TA 1LOEA 2QKDA 5I0DA 1TNRA 4CDWA 4FPYA 2IXIA 2UURA 3HIFA 3GHMA 4LIVA 1XPWA 3H9AA 3S57A 2HLEA 3RJ2X 1OH4A 4JGZC 4JX0A 1OLQA 4MHUA 4CCMA 3DV8A 3ZPOA 4H14A 2VAUA 3CEWA 2Z5WA 3GCWA 4XFFA 3VBUB 1FPN3 1NCQA 5FWJA 3T1LA 5F32A 2YZ4A 3URFA 3RZLA 2BDRA 4XF3A 4DS0A 1X8EA 4JQRA 1RJ8A 3W58A 3WF4A 2OIIA 3L9JT 5C9AA 1VP6A 3OGSA 2W87A 4GWIA 2D5FA 3O1VA 3OYWB 3VL9A 4DZGA 3IT8A 4ZXKA 1QNYA 4R4XA 1XOYA 3T0AA 1H2NA 1OUSA 4MVTA 1NY71 1AYN1 1GU3A 2WO3A 4ARXA 5FMDA 1HRI2 1VBE2 2HWE2 1EPWA 3ILFA 4XFHA 2GH8A 3WG4A 1YXWA 5KR7A 3M3IA 1GNHA 1XNBA 4QDQA 3H3ZA 4QHZA 1AX0A 1CAWA 1S0BA 1ZZBA 3D8CA 3RQ0A 4Y33A 1U5ZA 1HQNA 2QNKA 3OUJA 2Y6LA 1D4M2 3AP6A 3VZNA 1L7RA 3HN1A 3SCHA 1X8MA 4IEZA 4FT8A 4BXSV 5A3NA 5FK8A 3VZOA 4YPJA 2JD4A 1OF3A 5GKAC 3HJRA 1NA1C 3ILRA 4NIIA 2FCUA 2LROA 3AMHA 4M3CB 2D6OX 4UFIA 4I30A 4EN0A 4META 2W92A 4WZCA 2FDKA 1RVF1 1JYNA 2VZOA 5BUVA 5FZLA 2WWUA 3EO6A 1EYBA 5CA6A 1LECA 4OHVA 1DLLA 4YVWC 2GC1A 1VRBA 2WNUA 4N43B 1ZRIA 3KLSA 5T50A 5CFCB 1IS4A 2ZS6B 3LOIA 3S30A 1C1LA 4OVEA 1FOD2 3NL1A 4PI0A 1RUD1 4B4PA 3VBHB 4DQAA 1VR3A 2ET7A 2DTYA 1HRV3 5JPNB 2BGOA 1GWMA 1GNYA 1R092 1VMHA 2ZAAA 4IV3A 4E2QA 2A70A 1WCUA 5G04L 1IG0A 4CCEA 5J37A 5K7PA 2RJ2A 2PA7A 4JDNA 3IPVA 1BYHA 4DNYA 4OQ9A 2BTVC 2VBPA 3T2OA 3V0AB 2R6QA 4ZZ5A 1J1LA 3U0ZA 2GNMA 3J7MA 4FQ4A 4K1YA 4CTEA 2R062 1NZIA 2ZMKA 5A3OA 2D5HA 1AJKA 2WAAA 4SBVA 4AL9A 3DEMA 4R9CA 3W5MA 4NOTA 1TME1 1UXZA 5BNPB 4WZFA 5FQ0B 5A32B 4AEMA 5KXEA 3M1HA 2RV9A 1QQP1 5F5AA 4EZ4A 3B3QE 4LIUA 1X50A 3POEA 4UW5A 3H8UA 4FBFA 1LOGA 3J7HA 2YV8A 1WLTA 5ISLA 3VKLA 1VBB3 4QX3A 2VMDA 5DDJ2 3BYWA 3BPZA 5F7UA 2XDVA 4AVCA 1HX6A 3OF1A 5I8YA 4AG4A 1VBC3 3AVSA 3OUHA 2WABA 1V6LA 2XJTA 3CQOA 2ADDA 3DYMA 3NKTA 1VIWB 3E1F1 4FPFA 1MPXA 1UPSA 1ZA7A 4KMQA 4P14A 4BISA 1LU2A 2WFF2 2VTXA 5ABJC 4RS5C 1KDMA 2YPJA 2H0VA 3LA2A 5LATA 2E6VA 3FLPA 3UKVA 4Y26A 4XF0A 2R30A 5SV5A 2VOXA 2E32A 4BLJA 4EYUA 5JSOA 1W6NB 2EA7A 2VU9A 4CCNA 1S2EA 1UIKA 3M4FA 3HAGA 3RPQA 3A21A 1CAUA 4JAAA 2V4AA 5K0UA 4LQRA 1MS5A 3KT7A 3BOWA 4YW2A 5I93A 2WUHA 4XIOA 4BZ4A 2VCMA 4CCLA 1UN1A 5B4XA 3ON7A 3WNOA 4CU8A 5K9YA 1JYIA 4N9HA 4GKXA 3AKPA 2WN2A 1Z7S2 3K75B 3AFKA 2VOTA 5FYTA 4BIOA 1VBE1 4FXGB 2HWE1 4XW3A 3SXWA 5FMOS 4BB3A 3RYKA 1MS0A 4JV4A 4OCTA 2JB4A 4PQ9A 5FYCA 3VZLA 4FPCA 2D6PA 4RSUA 5TSWA 3DKWA 4YG0A 2BVBA 4Y1VA 5EJ1B 5C8CC 4PF1A 4A3ZA 3LDBA 1MZEA 2HEVF 4LE4A 4MOAA 2XVGA 3RFRA 4ITCA 5FXXA 5C3SA 4COVA 1WLDA 2RJLA 2OVUA 1BHGA 1X36A 2XHKA 2QZ3A 3AP4A 4LOSA 5LA0A 1VAMA 4FTEA 3B9CA 1CAXA 4YARA 1DQ2A 1W39A 1HXS2 1RUC1 3DECA 4KGGA 5FZ1A 4J6GA 4C0HA 1PO23 4Y5TA 1NOVA 4PCRA 3BTAA 5FZOA 1YFXA 3I3BA 1XB9A 4B29A 3VN4A 1DP0A 1POV0 3D0JA 3PURA 1Z0HA 4L99A 2HWC3 4Q4Y2 4R9BA 2PXJA 2OQ7A 1LHWA 5KHJA 5FYHA 2VZRA 1QOSA 1NG0A 3KV9A 3VD5A 1DGRN 4DIQA 4M00A 1V6OA 2NQYA 1UZYA 5BNOC 1JN2P 5IT6A 4W6YA 2FD8A 4QGMA 3ZFGC 4CDQB 4LBQD 4AFDA 2VL4A 3D4KA 2R061 5LY2A 3WG2A 3ZFEB 3HPNA 4CVUA 1W04A 1GZWB 3M3QA 4RGGA 1SCRA 2E53A 2VZTA 5EHDA 1LHOA 4QB1A 4Q1PA 3IMMA 4GULA 2ZAHA 4OI0A 1LGCA 1TQ5A 2NYYA 1W99A 2CV6A 3RZZA 3SISA 2FDJA 1C8M2 4M3CE 1VALA 4RN5A 4IEOA 3R4DB 4XDOA 4PI2A 1D4VB 2RR13 3QH7A 5DDJ1 4XUPA 4CEWB 2DU1A 4TYSA 1P8JA 4QKNA 1YQCA 4E4HA 1UD1A 4BMBA 2EICA 5FZIA 4XABA 1JYXA 1LB2A 4JZRA 2GN3A 2HKXA 5CKNA 5AFBA 1JZ6A 3HQXA 4X6RB 4GH4B 1PO13 1HLCA 2IVIB 1QXRA 3JQWA 3N9NA 1OUXA 5HXMA 1HV1A 2NLRA 4R9DA 1SBDA 1NLQA 5FY8A 3SQOA 2HWF3 3WT3A 1H9WA 4LORA 3ZSJA 5FZBA 2W08A 4XJZA 3VZKA 4AVSA 2GP3A 1IPSA 1DBNA 1AX1A 1NQDA 3FBMA 4YW7A 1WBLA 2ZACA 3IB3A 3B7MA 1LESA 2IXHA 1CESA 3AKQA 1URXA 4LUMA 5I8SA 2BZDA 5GLUA 3T1MA 2GZWA 2FDIA 2ZA9A 2WNEA 1MEC3 4Y20B 4AEDC 5C70A 2WZR3 1US3A 1NXMA 1Z7S1 3IIIA 3N4MA 3AZWA 2Y38A 3RZGA 2VXRA 3IMNA 4EN7B 2YGMA 3NQHA 3ZN6A 4HN0A 2JE8A 4IERA 1PZ8A 5A70A 4HONA 1OFSA 1UCXA 4PHZA 2C0ZA 1H1MA 3LEGA 1PK6B 5C7GA 1C28A 1QJU3 1PVC2 3QOPA 4V2VA 1GUIA 4PLNA 5LBFA 5BNOA 1UQXA 4DUWA 3B9IA 3JD72 2HWD2 1ZBA2 2VQ0A 4I01A 2CNAA 3P5BA
chains in the Genus database with same CATH topology
4ISQA 2ZX3A 4DRRA 1W6QB 3U11A 5HCBA 4E4ZA 2BPA2 3CU7A 1PHMA 4WM8A 1QDCA 4BYYA 1HXS1 5GM0A 1LHNA 3P3PA 3I54A 2ZABA 2HWB1 2VMGA 1W6PA 2WS91 1AR83 1ZA4A 1PIV2 4AQTA 1O91A 3U07A 1VBD2 5CB7A 3UV9A 1SDWA 1IKQA 3VGIA 4BIFA 2RS52 1AYN3 3KCYA 4Q4Y1 4EN6B 2ZKLA 1H4HA 2Q1ZB 3A4UA 1LHUA 1QOOA 4IXLA 4XBQA 2JG8C 3QACA 3KQRA 4LA2A 4N9IA 3KT4A 3DL3A 3KS7A 5JI9A 5KBFA 3ACLA 3GYDA 4Q4X3 3OJBA 5GZGA 3ZYJB 3LKJA 3ZYGA 4DY5A 5KXBA 4YSFA 5LK5A 2X5IB 4QPYA 2A3YA 1C8M1 2PYTA 4C1WA 3B5LB 3KD4A 4XEZA 3EXUA 3O14A 1OD5A 4AEDA 1DGWA 4B3NA 4Q8LA 4JTOA 3JQXA 2SLIA 1CIWA 4FQZA 4YVSC 1N3OA 4FOYA 4QPGC 1KS5A 1C4RA 1W6NA 2ZMLA 3WR0A 4BH9A 3TB0A 4CEYB 3IDEA 4WVZA 5AC93 1CJPA 1FT9A 4LBQA 3THPA 5E16A 1ZREA 3ME2A 1PM7A 4K1ZA 4P9WA 2XVKA 5E8AA 4Q0SA 4G4FA 1O7FA 2D97A 3R4UA 2VUAA 2ETEA 5DUWA 4QX5A 1ND3B 2B39A 4KG8A 1CVNA 2D6MA 2PLV3 1V6IA 3WVJA 2JJ6A 1QH7A 4HPKB 4LHNA 1PNFA 1UW8A 4IETA 5JZGC 3UKNA 5BXXA 3W9AA 3ZYPA 1G9FA 4FAGA 3NAPB 1XRUA 1S0DA 5JIAA 2P3IA 4DPNA 3ZFFB 4FSJA 5B2GB 1JUHA 1MS1A 2P17A 4A2UA 1OOPC 1Q8SA 4OI4A 3OPZA 4DB5A 3WW3A 1PVC1 4XTMA 2EAAA 3AZZA 4YLZA 4Z82A 1FXZA 3JD71 4KU7A 2PN5A 2HWD1 1ZBA1 3UK9A 2DTWA 3KSCA 2DUOA 3VHPA 2VW0A 3IDBB 5JR7B 2FZ1A 1HKDA 1L3JA 2ZX2A 4XJWA 1JXNA 4NWVA 2JEMA 3MFCA 1NE4A 2ZPXA 1KJLA 4L11A 1WW5A 3N3HA 1H30A 4WVMA 4OULA 5T3NA 4P9GA 4DFSA 4P5HA 2CY6A 1PIV1 1TNFA 1VBD1 4WM7B 5KHHA 2DVAA 3WY6A 1DIWA 1RUE2 5J48A 2D6NA 3W59A 4YVSA 1MACA 2VOWA 2GC2A 1QF3A 2WJSA 2VNRA 3MDPA 3NV2A 1GYKA 2IXJA 3VDDC 1NE6A 5GALA 1YJLA 1HQWA 1Q56A 4MX3A 3AJYA 4IL7A 2D98A 3I59B 5BNNB 3J8F2 1H8TC 1TE1B 4LEJA 5FLJA 4YM0A 3DGTA 1UMZA 3HWJA 5DG1A 1YYNA 4FPGA 3KB5A 3FC0A 1J59A 3WD5A 2A6VA 1RHI2 2ZGUA 2QCSB 2GMEA 1DQ5A 3FE5A 5T5OA 4Q4W1 1ND2B 1RUC3 3PVBB 4RHV2 2YROA 1EPZA 5D8AC 3VBOC 4LO6B 3VBRA 1WCKA 4AW7A 3GZUC 2WQZC 1LHVA 1RUG1 2QE3A 4CDXA 2AR6A 4P9JA 1G7YA 5A33A 1BMV2 3NKGA 1UKRA 4R8HA 1RUF2 2OZ6A 2RJKA 1APNA 2EAKA 3DUIA 1COV3 2Z42A 1ZRCA 4ORFA 1DQ1A 5JVVA 4AHYA 1O3QA 1K5MC 4RR3A 4QMAA 3OTFA 4XXPA 3ZXJA 2AENA 2YC0A 3SH3A 3DPRC 1BBT2 4Y20A 2WT1A 2WFPA 1BEV2 3OY8A 4FPJA 4AHZA 3ENRA 4LLFA 4HT1T 3MPPG 5FMOL 1E57A 4ZU5A 1TMF2 3Q9OA 4MUVA 1LOBA 1UU5A 1U5YA 3IIAA 1RMU2 1GV9A 3AP7A 2Q5TA 1PK6A 4AI2A 1EAH2 4L2NA 2UYAA 1Q8VA 1SMVA 3AZVA 2NP0A 2DV9A 4EWEA 2YDEA 3RNSA 1REEA 4JGZB 4GIQA 1AR93 4JGYB 2I07B 4AGRA 1NQJA 1TEIA 4HKOA 3ZYRA 2RS33 4YRDA 1KRIA 1LGNA 4E4DX 3FLRA 4XPVA 5FO8B 3WX5A 4HN1A 3FHIB 4LO4B 1RUOA 1R1ZA 2XUMA 3H50A 4QQPA 4XF1A 2BUKA 4R4ZA 5IK5A 4E27A 4S2GA 1NZCA 2VPVA 4Z8BA 1SFNA 3SMHA 2B8MA 5I0RA 1AVBA 4N90A 4BLIA 3FLTA 4LULA 1OSGA 2IXCA 3VBOA 1AL22 4CRQA 5JOWA 2Q4SA 3PJQA 1FATA 1OA4A 2WC2A 2ZX4A 2C1FA 4TWTA 2P34A 1KXGA 3WUDA 3ZYIB 1NLSA 1GICA 4I3PA 3THTA 1BQPA 1NCQC 1XQNA 1ZZ7A 1J3PA 5D1IA 1S0FA 2WQ4A 3B01A 1BVVA 1NA1B 3O12A 1CQ9A 5C9AC 3J8F1 1J3RA 2O8OA 2VMHA 1QH6A 1O3RA 3WDWA 2PHFA 2QQPA 3KM5A 3ZPYA 1YI7A 1AYM2 1ZBE2 1VBA2 3CF6E 1G9AA 1RHI1 1MS4A 1H2LA 4AGGA 4A3XA 5JMCA 4AK3A 4RHV1 4NN0A 2E7AA 2HWB3 4CEYA 3H3UA 2WS93 2ERFA 3POWA 2H6BA 1MZ5A 1R082 1T6GC 1BMV1 1FNZA 1QJX2 2UY9A 3BCWA 2NZ9A 1FMD1 3V56A 5E88A 4B8EA 3GHNA 2LALA 4LHLA 3NVCA 1ND3A 2E7TA 4OHWA 2NPIA 3I7DA 2W39A 1OPMA 4Q4V1 1N3PA 4PF5A 3ZSMA 1BBT1 2F4PA 5CADA 4XMAA 1F8VA 1ULEA 4AHWA 4BOWA 1BEV1 3MI8A 2WNUC 2VNGA 1Y3TA 1EY2A 5E89A 1PMIA 5DUVA 2XB6C 3TWIA 3NAPA 1N1TA 3R05A 4MH0E 2JG9B 4YW3A 1C5HA 3N7MA 4L9BA 4XF4A 1RMU1 1FI2A 2VG9A 4EV0A 3VUOA 1QDOA 5FBZA 2YXSA 2WKKA 5KC6A 4IV3C 3UKTA 1B35B 1EAH1 1HV0A 4XF9A 4HKLA 5HCFA 1CPMA 4QPIA 1WMEA 1RINA 1RUH2 1OQEA 5ABJB 4RS5B 3JBG2 1V9U2 3AKSA 1WW4A 4L8QA 3EBRA 3OD0A 3V0BB 4QQ2A 4DXZA 3V65A 4AXOA 5CFDB 1NYWA 2ZCWA 3BU7A 3VBFC 1AR62 5H9SA 1JHNA 4P9IA 4FOWA 1CAVB 3TN93 3RRDA 2RMU3 2TUNA 2PHRA 4E9KA 5T52A 1LODA 1Q3EA 4XQ4A 2X8KA 4XETA 1WD4A 1CGPA 5C8WA 1AL21 3GBFA 3I59A 5LEKA 1Z78A 1RUI1 1SLTA 5EYYA 4XJAA 1RUJ3 2VH9A 5J98B 2VVFA 3AYCA 5KXDA 3WCSA 2CGNA 1IS6A 2WIIB 3N35A 5C8CB 2OZJA 1XNDA 4H55A 4AFAA 1QOTA 2XJSA 4CDUB 5C4WB 1SCSA 2IFRA 3LSEA 1XYPA 2IWGB 3QH6A 5ACA1 5K0UC 1C1FA 4AVVA 3E5QA 5I91A 1G9BA 1BXHA 2RM22 1AYM1 3MIGA 1DGRA 4ATEA 1BJQA 1KJRA 1VBA1 1ZBE1 2EVXA 4YZ3A 3RMYA 2XBO3 1CONA 4JC1A 1DQ0A 4XFAA 3MFAA 2LTNA 1QU0A 1UKGA 1WD3A 4HETA 3AYDA 4XHBA 4E2SA 2B7YA 1DHKB 5CVRA 1MS9A 4YG6A 1AR73 1UPIA 3ZXGA 2BNNA 3AM2A 1KQRA 3T2TA 1W0OA 4XBLA 2JX9A 3ZFGB 1EV12 1C57A 3DF0A 3ES4A 1JTZX 2EXKA 3QLQA 4ES8A 2B9UA 4EWAA 3WV6A 3VBFA 4BCUA 5I0UA 3WXPA 4LTAA 3GNEA 1UF2C 2WLQA 3BODA 2R043 5DZFA 1QMJA 1H1AA 4JGYA 1W6OA 2AGSA 5CNAA 3WP5A 3IKWA 3AP9A 4AWDA 3IDCB 1MQTA 2R072 3WQ0A 2ES3A 2N7GA 1ZRFA 5FFOC 5A3MA 2VW1A 1BK1A 1R1A2 2IFWA 4AFBA 4A7YA 2BYVE 4HK8A 4F8AA 3D5OA 1RUG3 2O0OA 5JIUA 1YUDA 1G9DA 4GXLA 3WW1A 4LBNA 2D93A 4PDWB 4MGYE 2CAVA 3NW4A 5CG9A 1AR61 2RS12 2RS32 1BCXA 3BALA 3K51A 1OKQA 1HDKA 4NHKA 1CPNA 3KGLA 2BW8A 1GQHA 3H7JA 3PVEA 5CIRA 4TSVA 1HRI1 3VBUC 3WCRA 4CP2A 2XKOA 5AFEA 4Z92B 3CJIA 1UU4A 5IK8A 3E5XA 1D4M1 2FHRA 1W6MA 5FRAA 3BIWE 2YMZA 3FFQA 1CR7A 2ILMA 1A8MA 1QJY2 2QDRA 3S0MA 4GB33 1MVQA 2BEOA 1POV1 2XLGA 3ZXLA 3PJYA 3S7IA 1GR3A 1I5ZA 5GZEA 2D3PA 2D7FA 2RM21 4XBNA 1ZRRA 3PLQA 4K40A 4RQPB 4R52A 1FOD1 1SFYA 4YNIA 3UJQA 3WG1A 3VV1A 1IKPA 1VRH3 1R091 1KITA 2D3SA 2CGOA 4Q0VA 4W6WA 3E6DA 2MEV2 2HYKA 1BZWA 3USSA 4BE3A 2D44A 4LT5A 5J7MA 1DFQA 1ASJ3 5CFCC 2GALA 2YGLA 1EV11 1RIRA 4FP2A 4IQPA 5FTTC 3VBHC 2JG9A 4WM8C 2DFBA 4D3WA 2DURA 1XNKA 5A3LA 1QXPA 4N7IA 1S0EA 2B46X 1B35A 3D0SA 4Q29A 3AKTA 1QNWA 2ET1A 3LZZA 1ZX5A 4Z2WA 2CAUA 1GLHA 3E6CC 1LOCA 2O8QA 3M3EA 3VKFC 2QDNA 3VBUA 2R071 5E1RA 3CL1A 2ZHKA 3V0BA 3AFGA 3B93A 5BNPC 1R1A1 3MW4A 4Y4YA 4YGDA 2ZHNA 2WFF1 2PHTA 2XJPA 3OYWA 2HEWF 4Y1YA 3N7JA 4HLTA 3OBTA 4GMP3 2RE9A 4GWMA 3EHKA 2OPKA 1FMD3 1YHFA 5HI0A 2ZGNA 3LA7A 2IZWA 4K7JA 5IUQA 1NCRB 3APBA 4QM8A 4RA0A 1PGL2 1O4ZA 2RS11 1FPN2 4COYA 1ENSA 3CNAA 4Q0PA 2E63A 4NR1A 4Q4V3 4LNVA 3ROUA 3G7DA 1PVXA 1XU2A 1OHFA 2P2KA 3X29B 4AYUA 4YZ2A 1YIFA 2JKBA 5BYNA 3IWZA 2HJIA 2ZX0A 3HR9A 5JZGB 1S2KA 2VOVA 4FP3A 4SLIA 2G9FA 4M3CA 4GWNA 2TNFA 3ZXKA 2QVSB 4S2DA 1IOAA 5JOYA 4ONUA 5FREA 1N47A 1OQDA 1LEDA 1SBEA 2A3XA 4OFGA 1H4GA 1QJY1 4N43A 2WA4A 1DDLA 4IV1B 3D82A 5CFCA 1MZFA 2XVLA 2P3JA 2UWBA 4PLMA 2UY8A 3VBHA 2VECA 4COZA 3ZVXA 5FCCA 2PAMA 3M8LA 3AMNA 2CWMA 4YG3A 5FOJB 1WW7A 1MVEA 2D40A 4IEPA 2WNVB 2D6LX 4YW4A 2XH6A 2ZGTA 2F6BA 5EZWA 3WQ7A 3V0AA 1XXNA 3MGUA 3U4XA 2XJUA 4XE9A 4U2AA 4Y22B 1X7NA 3B00A 5H9QA 5A32A 5BNPA 5FQ0A 4KWLA 4EN8B 2NM1A 4Z1VA 1RUI3 5AVAA 2P3KA 1HRV2 4N7UA 5T5JA 2HEYF 5JCTA 3ZMNA 3I2DA 4D7YA 2BGCA 5J09A 4MLOA 2PAKA 2ZZJA 1V6MA 2DVFA 3ZXEA 1U5IA 3POYA 4MV2A 5ACA3 1RVF3 4P9XA 1V6NA 4YGBA 3AMMA 1J1TA 1LCLA 2MNGA 3USUB 4I02A 1REFA 2JENA 1DF0A 1CD3G 1GFF2 3ZFEC 1RUD3 4S2HA 2UYBA 2CL2A 4Y1ZA 3AMPA 4K3UA 1CX4A 1PGSA 1QGLA 1VBB2 4UBHA 2FMYA 3LSDA 4M3CF 5FAXA 1VBC2 3AZYA 3WW2A 1K5MB 3H1WA 2GU9A 2VULA 4UW4A 1LGBA 1LR5A 3QD6A 4RD7A 3WNXA 2ZGLA 2ZHMA 5J36A 2PHWA 2FBEA 4LBJA 4Q2FA 1HIXA 4XTPA 3VBSB 3N36A 1A78A 1TME3 1DZRA 1FPN1 5LRSA 1QQP3 4KNCA 1S2BA 5LRRA 2PQQA 1G8WA 3VBRC 3ECQA 4FTSA 3ZXDA 3MW3A 4CDXC 4DMIA 2ZGSA 4HVRA 3FBYA 2OUJA 2CGPA 4WVVA 1SLAA 4YFZA 4URTA 4X8PA 3QBQA 4H3WA 1G9CA 3ZDSA 4N53B 4AI8A 4C91A 4RR3C 4XFCA 3OBRA 4YGEA 4XMIA 4F3JA 4V1PA 2H6CA 2VY0A 3RYPA 1YJKA 2KXLA 2K0GA 1S1AA 1KD7A 1DGLA 4I2OA 4W6XA 1VB4A 5F5QA 3LWCA 5L7OB 1RC6A 3O5SA 1H8VA 4HMZA 4ZKTB 4XXAA 4COUA 2GNBA 1PK6C 4CDWB 2AREA 1N3QA 2GC3A 4OI1A 4FPEA 4XFBA 5GJ6A 2Q1MA 5GLTA 1PO22 4CDQA 4OHYA 2RS51 1XYNA 3VZMA 1HRI3 1VBE3 3ZFEA 2HWE3 2Z79A 1GZWA 4AI0A 3VL8A 1I6XA 3R4SA 1X33A 5L36A 2HWC2 1Y9QA 4A7KA 1HRV1 4LE3A 1AXYA 1H2KA 4CYDA 3OGJA 1VRH2 4P9YA 1D4M3 1S55A 1OI6A 3KT1A 4K21A 4K9SA 5DG2A 4CEWA 1Q5OA 4JVAA 4HSJA 2XWBB 2ENRA 3M3OA 4LO7A 2EXHA 2WLPA 4GH4A 1UZZA 4RGAA 1JYCA 1CN1A 2GNTA 1FV3A 4LLOA 3PMSA 3TNPB 1V6JA 4CP0A 1D2SA 2VW2A 1FOD3 4KBBA 3LB9A 2GSYA 1VBB1 1ULFA 3WOGA 1X82A 1O3SA 1NCRA 2RR12 3G6JB 1QJZA 1R093 3VHRA 4ZU4A 4EROA 3EQEA 3POSA 4E2GA 1VBC1 4ASLA 5DZGA 2VGDA 3E5UA 2WSUA 3KCXA 1PO12 2Y0IA 3RG0A 4TLFA 2OYZA 1ULDA 4YW1A 2R063 2V73A 1IPKA 4X8NA 4AVAA 3WZ1A 2V5YA 4YM2A 2HWF2 5L73A 3V64A 3ES1A 3RDIA 4CEYC 3M7AA 3SH4A 1WMDA 3MIBA 2R1DA 5DDJ3 3JCIA 4IV1A 3RMXA 3IPVB 1W6QA 1MEC2 3MF9A 3PNAA 4KH9A 2WZR2 5JLVA 2YY1A 1ND3C 2WT0A 3WDXA 4B7KA 2GDFA 3FJSA 2WFF3 2VUJA 1U0AA 1F5JA 1SACA 5LEJA 3HBZA 4QHBA 3NV4A 2WNVA 3GF6A 4KG0A 1YLLA 1QJU2 4S2FA 3NO8A 1RUNA 3NAPC 5I0TA 3ILNA 1GNZA 3AYAA 1FYUA 4NHMA 1H2MA 4LBMA 2XJVA 4PBPA 2XG3A 5FDBA 5LK7B 4QPIC 4XJ8A 5J96B 3SCFA 2DUPA 1RUE1 1PO21 1Z7S3 3OGGA 1DYPA 1AR82 2TEPA 2A6XA 2ZBJA 1IPJA 4LUKA 5BY5A 1AYN2 3FUQA 1F9KA 2XLFA 2G4IA 4KGQA 1WCSA 2X5IA 3GZTB 5K0UB 4FO9A 4WM7C 4YW5A 2UWAA 4D7SA 1UIJA 4LBKA 3IM0A 1ZM1A 4KWKA 3SCGA 4YVWB 2XL9A 3AK0A 1A3KA 1D0HA 2A7AA 1HXS3 1S0CA 4QQHA 4OHZA 1N1SA 4Q4X2 4YM1A 5FLIA 5BNQA 4MGKE 3S7EA 4L97A 4NWWA 3PVNA 3SNMA 2IXLA 4JTNA 3WDYA 1OPOA 1OA3A 1ZVFA 4Q4Y3 4XHXA 3RYRA 4J1XA 1RUF1 4UBGA 2XGXA 2E51A 1ENQA 2RR11 3OD4A 4JCKA 2KM2A 2XWJB 2WWSA 2C9AA 1CAXB 1NXD1 1VAKA 3ETQA 1Q8OA 4HPKA 3MEPA 1PO11 4C0BA 1UAIA 3B02A 1WMFA 3GBWA 3HMYA 5AC92 4NVPA 4LBLA 4YGCA 1YCIA 1B09A 1TMF1 2Z69A 3MICA 3ZFFA 4N53A 4AQSA 5T5LA 4Q8KA 2BWCA 5DXDA 2ZHLA 1UL9A 1I3HA 4WVWA 1C8M3 1LKNA 2PHUA 5IK7A 1S0JA 2ZGMA 5T55A 4RFT0 2JDZA 3I8TA 4IEUA 2PLV2 4QQOA 3SH5A 4HL0A 5CG8A 3IN9A 1AUYA 1GZ9A 4GMP0 4PJYA 3I4IA 1MEC1 5L7OA 2K2SA 2WZR1 1N1YA 3VHNA 4UXAA 1AJOA 1O4TA 1J3QA 1GZCA 4LO5B 3IBMA 4KQ7A 3M70A 4WM7A 4DRVA 5C33A 1DG6A 1AZDA 1QJU1 4Q26A 1RTVA 3WG3A 2I74A 2JXAA 2XL7A 4HBNA 4JGYC 4XYXA 2ZGQA 3ZX7A 3H0OA 1MQTC 2LUWA 5F1RA 1RB8G 4I3GA 1FAYA 2Q30A 4AI3A 1LTEA 3L2HA 2JICA 5BNNA 2QZ2A 4YZ1A 3WW4A 4OLLA 1O5UA 4YYOA 4AVTA 1GANA 5BPXA 4IEQA 4Q0UA 1IS3A 3CO2A 1AR81 1UU6A 1A6CA 3AMQA 5KHKA 1MZ6A 3BB6A 2WT2A 2OW4A 3AYEA 5F9TA 1ND2A 2ZJCA 2CWSA 1PVC3 3JD73 3AXDA 2HWD3 1ZBA3 3WDUA 2Y0OA 2W68A 2BWAA 3D6EA 3UL2A 1XE7A 4MXWB 4Q4X1 4AQ6A 4Y24A 3AP5A 3ZN6B 3CJIC 4OUMA 1WLCA 2YUEA 1PIV3 3CJXA 1VBD3 1PNGA 4AFMA 1RUC2 4LR4A 2PELA 4XFIA 4R9AA 3U10A 4MZUA 3P3NA 2RS53 1R081 5BNOB 4J1WA 4YM3A 1QJX1 3N7LA 5T5PA 1SQ4A 2BFUL 2C5DA 1ENRA 2B42B 3MIEA 4HK9A 2X29A 4GKYA 4WBBA 3MPBA 4WM8B 3H1MA 1RITA