2RR13

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rr1300
4CDUC 1AYN3 1QJY3 1ZBA3 2MEV2 5D8AC 2ZAHA 1RUH2 1COV3 2R072 4Q4Y2 5BNOA 1RHI2 4WM8A 5BNOB 1BEV1 2PLV3 2WZR1 4CDWC 4GMP0 1A6CA 1RB8G 5AC93 2TBVA 4Q4W2 3VBOC 1VBE3 1NG0A 4IV3A 3JD72 2WZR3 1SMVA 3VBHA 2RS52 3VBHB 1AYM2 3VBUC 5ABJC 1ZBE2 4JGZA 2BFUS 2RR13 4JGZB 1RUC1 1K5MB 1M06G 1DDLA 4CEYB 1CJDA 4N53C 1HXS2 4RS5C 1R093 1RUG1 3NAPA 1NA1C 1PO21 2R042 1Z7S1 2X5IB 1NCRC 4RHV3 4RQPC 1PO13 1WCDJ 5A32B 1AR92 1MEC1 2WS91 3VDDB 3TN93 1RUI3 1W39A 5C8CB 4SBVA 1BMV2 1MEC3 2VQ0A 2FZ2A 3ZFGC 1RUF2 1VBA3 2HWD1 4QPIC 5DDJ3 4CDUA 1HRI2 5BNNA 5BNNB 5D8AA 2BUKA 1QQP2 2FZ1A 1QJU2 1HQNA 3VBFC 4Y4YA 1RUE3 1QJX3 1RUH1 2ZZQA 2R071 4Q4Y1 4AEDB 3VBOA 1OPOA 1RHI1 2MEV3 1PGW2 1VBE2 2R073 4Q4X2 2R062 1D4M3 2RS51 1AYM1 1TME1 1ZBE1 1NOVA 4N53A 4Q4W3 5JZGB 2BFUL 3JD73 2RS11 4Q4V2 1AYM3 1HXS1 1ZBE3 3DPRA 4JGYC 1NCRA 1H8TB 4RQPA 2R041 5ACA3 2BBVA 4RHV2 3ZFFB 4YVWB 1IHMA 1PO12 4IV1A 1ND3C 4IV1B 2HWC3 3CJIA 1AR91 1PIV3 3TN92 5BNPC 1B35C 1RUI2 4CEWB 2DF7A 3ZFGA 4QPIA 1AR93 1NCQB 4BCUA 4CDXB 5C9AC 1VBA2 5C4WB 1RUF1 1MQTB 2WLPA 1HRI1 4PDWC 1AYN1 5L7OC 1QQP1 1QJU1 1RUF3 1RUE2 3VBSC 1COV1 1HRI3 1FPN3 1PVC3 2PLV1 1QQP3 1QJU3 3LOBA 5AC91 5A33A 5CFDA 5A33B 1VBE1 5CFDB 4YVSA 4YVSB 4Q4X1 1D4M2 5J98B 4WM8B 2HWE2 4GH4A 4WM7C 4GH4B 5FMOS 4CDQA 1X36A 2RR11 4RR3C 1C8M2 4IV3B 1R082 4Q4X3 3VBRA 4Q4V1 3VBRB 2R063 4JGYA 1R091 3ZFEC 4QPGA 4QPGB 4Q4V3 5ACA2 1ND3A 1QJZA 4RHV1 1ND2A 1POV3 1PO11 1NY71 1ND2B 4AEDC 1AR63 2HWC2 3NAPB 1PIV2 1VBC3 4N43C 3ZXAC 3TN91 1RUI1 1OHFA 1ASJ2 5CFCA 4PDWA 1VBA1 5DDJ1 5CFCB 5L7OA 1VB4A 3VBSA 1EAH3 1OOPC 2HWF3 2WFF3 4CDUB 1RUE1 1BBT3 1H8TC 1QJX1 1FPN2 5D8AB 3M8LA 1PVC2 1RMU2 2MEV1 1RUD3 4CDWA 1VBD3 4CDWB 4GB33 3VBOB 1D4M1 4RR3A 3VBUA 4Q4W1 5ABJA 5ABJB 3ZFEA 1C8M1 3JD71 2HWE3 1AL0G 1AR72 4N53B 4RS5A 5K0UC 1C8M3 1R083 1AUYA 1VRH2 5ACA1 1NA1A 3JB8A 1NA1B 3DPRB 1AR62 1EV13 1RVF3 4Y5Z0 1NCRB 2HWC1 4N43A 4RQPB 1VBC2 4GMP1 1HRV2 1PIV1 1FOD2 1HX6A 1R1A3 5BNOC 1F2NA 2HWB3 4GMP3 3CJIB 1ASJ1 1GFF2 4FTSA 4IV3C 1RUC2 1V9U2 1OOPA 3VBHC 3ZFGB 1PGL2 1BMV1 1ASJ3 1EAH2 4QPIB 4JGZC 1K5MC 2XBO3 2HWF2 2WFF2 4CEYC 3JB4C 1BBT2 2RM23 1RUG2 3VBFA 1FPN1 1PO22 3VBFB 1Z7S2 1PVC1 4NWVA 1RMU1 1RUD2 1F8VA 4LLFA 1VBD2 4FSJA 4GB32 2X5IC 1RMU3 5J96B 1PGW1 2Y26A 3VDDC 5K0UA 2R061 5C8CC 4CDQB 1RUJ3 4FTEA 1AR71 1VBB2 4JGYB 1VRH1 1POV1 1EV12 1AR73 1RVF2 5BNNC 1AR61 1FMD2 1ND3B 1VRH3 1VBC1 1HRV1 1R1A2 5BNPA 1FOD1 1B35A 5BNPB 1X33A 2HWB2 1B35B 1C8NA 1HRV3 4FTBA 1BEV3 1TME2 1AR82 1FOD3 3J8F2 1K5MA 5C9AA 2QQPA 5C9AB 1V9U1 4CEYA 2RS12 2WWSA 1PGL1 1EAH1 2XBO2 5JZGC 2HWF1 2RM22 2WFF1 3JBG2 4PDWB 1RUC3 2BPA2 1BBT1 1V9U3 1AL22 5L7OB 3VBSB 2IZWA 3DPRC 2X5IA 1RUD1 1RUG3 1VBD1 4GB31 2RS32 3ZFFC 4YVWC 1PO23 1Z7S3 5A32A 4IV1C 3VDDA 4WM7A 4WM7B 3CJIC 5C8CA 2RMU2 1TMF2 2HWE1 4RR3B 4CEWC 2WS93 1RUJ2 5FMOL 3VBUB 1NCQC 3ZFEB 1VBB1 1R081 4CDXC 1E57A 5C4WC 2ZTNA 1MQTC 2GSYA 1AYN2 1QJY2 1ZBA2 4RS5B 2HWD3 1EV11 1RVF1 1VBB3 1COV2 1POV0 1FMD1 4NWWA 4AEDA 2PLV2 5AC92 1R1A1 1FMD3 1RUH3 4N43B 2HWB1 4Q4Y3 1BEV2 2WZR2 1RHI3 3IDEA 5CFDC 4YVSC 2RR12 1AR81 4WM8C 3J8F1 4GH4C 2GH8A 5JZGA 4CDQC 2XPJA 2XBO1 1R092 2RS53 1TME3 1AR83 2RM21 3JBG1 3J8F3 3S6PA 3VBRC 5GKAC 5FOJB 1OOPB 1AL21 2RS13 1H8TA 4Z92B 1HXS3 3ZFFA 4YVWA 3JBG3 4QPGC 1NY72 4RFT0 1AL23 1CD3G 3FBMA 2RS31 1VAKA 2R043 1ND2C 4EJRA 3NAPC 4CEWA 2RS33 1MEC2 2RMU1 1TMF1 2WS92 1NCQA 4CDXA 1RUJ1 3HAGA 5DDJ2 5C4WA 1MQTA 2RMU3 1TMF3 5K0UB 5CFCC 2HWD2 1QJY1 1ZBA1 1VB2A 1QJX2 5LK7B
chains in the Genus database with same CATH superfamily
4EZ4A 2B42B 2PHDA 5FK7A 4YW5A 4C8DA 3AX4A 3N3HA 2CTVA 5JSPA 3RGBA 1UYPA 2JD4A 2ZAHA 5J48A 3MIDA 3L9JT 3N35A 3MHZA 2GNMA 4AI9A 3BB6A 3MDPA 1HB1A 1BEV1 2WZR1 2A70A 4CDWC 4E8DA 2ZGOA 4C1XA 2P3YA 4LKFA 4NHKA 5HCFA 1JYWA 3G7DA 2NYYA 1VBE3 1NG0A 3JD72 4DRRA 1ZBE2 4AE2A 3AP7A 4G3YC 2VMGA 1C4RA 1O8SA 2XJTA 1K5MB 4Y5SA 3EHKA 2Y6KA 1VJ2A 4OHXA 1PNFA 3LEIA 1YQ2A 1W2NA 4RS5C 1UX6A 2VW1A 2L9LA 3GBGA 4FPGA 1QDCA 2GMMA 5C7GA 4XFIA 3NAPA 5JOZA 2B8MA 5EHDA 1Z7S1 1VP6A 4JC1A 3TYJA 4Q8LA 4GJYA 5F32A 4RHV3 1YYNA 2ZZJA 4XYXA 2XVLA 5IAXA 5ERLA 2QQIA 5JPMB 1WCDJ 4LE3A 1RINA 5A32B 1AR92 1H4GA 1MEC1 4JDNA 3O1OA 3VDDB 4CU6A 1SPPB 3NJYA 3TN93 5I0RA 1W39A 4UF0A 2H6BA 4K8FA 2YC2A 4AHZA 1W6PB 4XVHA 4I3GA 2VNGA 2G9FA 5DAXA 1BMV2 5H9SA 2LUWA 2Y33A 4H7LA 5HPOA 1H4HA 2FZ2A 2VD7A 5KR7A 1RITA 4QPIC 2OT7A 2C5DA 3AFKA 3LWCA 4LK7A 4D7YA 2A75A 5A7QA 5FLJA 3OY8B 1XRUA 1YC61 3ME2A 5AVPA 4LHKA 2W2IA 3VZOA 3S5AA 1K5JA 4LBJA 3U75A 3LFMA 3VBFC 3SCGA 4CP9B 4HANA 1H1AA 1RUE3 3NRUA 1QJX3 1RUH1 1WBLA 4E2GA 1AX0A 3LDRA 4QMAA 1O4TA 2R071 3L2HA 4Q26A 4ZXKA 4AEDB 5A70A 1CAUA 1JHNA 3WF1A 4AI8A 1SBDA 4XUTA 3WQ7A 5LA0A 4OHYA 4LIVA 4FOVA 3USUB 2MEV3 4ASLA 5I0SA 4INDA 4KI5M 1VBE2 5F5IA 5FYCA 5CG8A 4Q27A 3MIGA 5KHIA 4Q4X2 3ZXGA 3IAPA 1PK6B 5HBAA 4A6SA 2C6SA 1DZRA 2DBIA 5LBCA 2SLIA 2Y34A 3LAGA 5LY2A 4N53A 4Q4W3 5AFEA 2RS11 1ZVFA 2VVEA 2PHUA 2XUEA 2PHLA 4KWUA 3WW4A 4CCDA 4Z2AA 3AXDA 5FQ0A 2TNFA 4AHYA 5SV5A 4XEZA 4C0HA 3CLPA 1JMUB 5A3WA 3O1VA 2EICA 4JGYC 4R9AA 4GJZA 3LSDA 2VCCA 4XTPA 1NCRA 1LOFC 3IN9A 4D6SA 1YQ6A 2IVJA 3FJSA 5I0TA 5C33A 3OD0A 4RHV2 2P6CA 3BIWE 1DGWX 1HV0A 3LOIA 4MGKE 2RE9A 4IV1B 1ZM1A 4IE6A 4LO5B 1SDDB 5FLIA 4XIOA 1JYCA 1SFPA 3CZUA 1W6QB 3K4AA 3RS6A 3WG4A 2ZGSA 5T50A 3WP5A 4AQ6A 2Z42A 1ULCA 1V0AA 3TN92 3ELNA 1HB3A 1MZFA 2ARCA 2FMYA 4OLLA 4QB2A 5TSWA 2DF7A 1JXNA 1ZA7A 4XOGA 2GAUA 4M0NA 1NLSA 1PMIA 1YUDA 1H2MA 2VZRA 1F5FA 3N7JA 4N7IA 4Z2WA 1V6KA 1UZ0A 1UYYA 4BCUA 2I2SA 3RVHA 4QHOA 2D44A 2JG9B 5FZ1A 1MQTB 3AKRA 2KM2A 3OEBA 3J7NA 4HN0A 5FUNA 2VXRA 3GHMA 3POJA 4BE3A 4AVAA 1AYN1 4GXLA 5FYTA 2AEYA 1QQP1 4XF1A 2WT2A 1DYKA 1RUE2 2YC0A 4AEJA 4XCBA 2VQTA 1H9WA 1JODA 2D6PA 1OQDA 3HMYA 3PUIA 1X9PA 2VR4A 5H9PA 1N3OA 4YZ2A 5AFBA 3E97A 5K8SA 4HPKB 4P9WA 2PLV1 4KU7A 5B4NA 4WVWA 4XJZA 4YVSA 2E7AA 3BU7A 4PF5A 4Q0QA 4WM7C 5I91A 2RR11 1G9AA 1N1YA 5FIXA 1R082 2XG3A 3GJBA 4AGRA 2C9KA 2R063 3G6JB 5A7PA 4B7EA 2P2KA 4JAAA 2HEWF 3POGA 4BQ2A 3TEYA 1QU0A 5KXCA 3GF6A 1OQEA 2OZJA 1CESA 1RJ7A 4QPGB 1JW6A 3AP9A 1ND3A 3UJQA 3U37A 4YW4A 4CCOA 1BK1A 4LO7A 1ZRRA 2ORZA 5EFUA 1GZWB 1ND2A 1PO11 1NY71 1POV3 4GWIA 4A42A 1REFA 1AR63 2F4PA 3NAPB 1CX4A 3NQHA 4MX3A 5LBBA 3WNLA 4AEDC 4NHYA 3ZYIB 1UMHA 2UURA 3I59B 4LHLA 3B9CA 2E9QA 3RWNA 3RZKA 4UFKA 1YJKA 1GQGA 4EN6B 3MLJA 3VD4A 2LS6A 1W6NA 3PUQA 3P6BA 5FWEA 1XYNA 2WO7A 1IGOA 2QCSB 1VBA1 4PDWA 4UF0B 5DDJ1 1GV9A 4ISRA 5HCBA 3K75B 3ZKUA 5FYUA 5FYHA 2KD7A 2QTWB 3S7EA 2WFF3 4XZPA 2W1WA 2CL2A 1STMA 2GNTA 1DQ5A 5F3EA 2OPWA 2JG8C 1FX5A 3PMEA 4OCTA 4BPZA 2QQWA 1LESA 1PHMA 4LTAA 3GZAA 1RMU2 2G9ZA 5LBFA 5CA6A 5IK7A 5EWSA 5FY8A 1SDWA 1UU6A 3IPVA 3VB9A 4FFFA 4Y24A 3VD7A 3FN9A 1GICA 2QQOA 3LSEA 4BXFA 3AP4A 1D4M1 4RR3A 1WLDA 2O1QA 3NV4A 1CQ9A 3PLQA 4AG4A 4BB3A 5ABJB 1BCXA 2QQNA 3ZFEA 1W05A 1C8M1 3JD71 3JUUA 3UV9A 3WDUA 2EAKA 4HKLA 5FY1A 4BOWA 2HWE3 2WKKA 3I3QA 4L11A 2GC2A 1ST8A 1W8HA 2VE1A 3PU8A 1AL0G 2DDUA 3V0BA 4N53B 4OFGA 3RZHA 3IT8A 5K0UC 1XOYA 2KR2A 1VMFA 3ILRA 4IGQA 1N47A 1KITA 3WEZA 3VV1A 1XE7A 2TEPA 2AEZA 3IAQA 4DUVA 1HQWA 1VRH2 4LBOA 4BA6A 1QOOA 5JXIA 1NA1B 2P37A 3K2OA 3LQCA 5FXVA 3M3IA 1UAIA 2I07B 2EXHA 2IXIA 2Y6GA 2Y6FA 2Z2SB 3AC0A 3H1MA 1NCRB 2ZA9A 4M0HA 4XQWA 4YLZA 3AB0A 2NMOA 2ILMA 5F3CA 1NE4A 5JOYA 4ZPIA 4BQ4A 3EMRA 3R0RA 2Y38A 4XURA 5T54A 2QKDA 2WLQA 1ZX5A 1JYXA 2HWB3 2W91A 4GMP3 3UGHA 3ZM8A 3DYPA 1ASJ1 3GBWA 1UYXA 4NIGA 4DPNA 1GFF2 4FTSA 1RTVA 3UYJA 5A1FA 3BODA 1RUC2 2B39A 2GP3A 2NPIA 1W8ZA 2YXSA 2ZAAA 1Z0HA 1PGL2 2WYSA 1BMV1 3H7JA 4CUAA 4UXAA 2W1QA 2YGMA 2PYTA 2WFF2 1O5LA 2GC3A 1RGSA 4CEYC 3D5OA 5I8SA 4WZCA 2RM23 4FPLA 3S5QA 1RUG2 4C91A 2P5BA 4CSWA 1RC6A 2VZUA 2NM1A 3VGIA 4YM1A 3MICA 1D2QA 4FP3A 4ZZ5A 2XKPA 2P3KA 4E4SA 2VBPA 1LHUA 1DIWA 3SEEA 4FSJA 4K8RB 5A6ZA 4JDOA 2QZ3A 2N7GA 4CU7A 2J1SA 1V00A 5C70A 2BDRA 1LODA 4AVCA 2ZMNA 4CP1A 4COWA 4I09A 1JN2P 4XBLA 4COZA 2K9ZA 4H3WA 2VY0A 1IS4A 3J7MA 1CAVA 3LA7A 2D93A 2RDRA 3ACLA 4ARXA 3IDCB 1CVNA 1ULDA 4TLGA 5F39A 4AFCA 5GZCA 4FTEA 2OX0A 2XVGA 2GU9A 3KT7A 4L0PA 4PJYA 3MW4A 5FUPA 1LGNA 2Q4SA 1UPIA 1V6OA 1IS3A 1LHVA 1OC1A 3BOPA 2QDRA 3P1IA 4DY3A 3HT1A 1AR73 3ATGA 4XHBA 1JYVA 3FZ3A 3I49A 1RIRA 4XF0A 3W9AA 3TBDA 4QXBA 4FPCA 2WN3A 3I3MA 1ND3B 1I5ZA 4JRAA 3I2DA 1VBC1 2D40A 5G05L 2R32A 4FCAA 1VAVA 1UZWA 4HVRA 5BNPA 1X82A 5CNAA 2HWB2 5DN2A 2HEVF 5FZIA 5JOXA 1N1TA 1FNZA 3POFA 4QGMA 3B01A 1HRV3 2VW0A 4MYEA 1BEV3 2FDGA 5FXZA 1TME2 2P4EA 2QNKA 3FFQA 3LEKA 1FOD3 2VZPA 2WT1A 3ZMOA 2Q8OA 1QKQA 4IW3A 2MNGA 3ZDSA 1JUIA 4DIQA 2CDOA 5GZFA 2BNNA 4WBBA 3W21A 4O61A 4I3PA 2OUHA 1W6NB 3OYWA 4BLIA 2HWF1 1IKPA 2RM22 3K51A 2OIIA 4PDWB 4F7ZA 1DZTA 3FHIB 3MLKA 5IFPA 3I7DA 5FZMA 4Q0VA 1G86A 2ADDA 3ABZA 3FFZA 1TNFA 4IXLA 1HLCA 2GN3A 1OKOA 3MIHA 1UWWA 3U78A 3HN1A 2X10A 4JV4A 3ZFFC 3RMXA 1D7PM 1Z7S3 4YM3A 4FPJA 4A2UA 2GZWA 3IPVB 4CCMA 3B94A 3O1UA 5E88A 1TZOA 4PCRA 3M3EA 2VCMA 2JICA 3ACIA 4FPKA 2RMU2 3LEGA 2C1FA 4RR3B 1J1LA 3AMQA 1GQHA 2WUHA 5EPAA 1WCUA 2JDKA 4FI9A 3VZJA 3ZFEB 1VBB1 4Q5OA 1IOAA 1R081 2BOJA 3SKJE 1LGBA 4CDXC 3I2GA 4YFZA 1XSRA 1XNKA 3HQRA 3I2OA 3P5BA 2WNVA 1W2TA 2ZABA 5G04L 2EAAA 3VKNA 2E32A 1DCSA 1POV0 4NWWA 1MVEA 4JQTA 4QKNA 4BQWA 3RYKA 3I3BA 3SQOA 3HBKA 2OS2A 4NAMA 1GLHA 2ZJCA 1Q56A 4AHWA 1P8JA 3D0SA 1Y9QA 5AC92 1BQPA 1UIJA 1FMD3 1RUH3 2ENRA 4QU1A 1Y7BA 3KGZA 2ID4A 1UY1A 1BEV2 2WZR2 3AZVA 5JIUA 5LA9A 1KS5A 4DXTA 1S0FA 4YVSC 1BLZA 2WJSA 4QXHA 4R9BA 2XGXA 4UFMA 3ZVXA 1CAWB 5JR7B 2GH8A 2VUAA 3DUIA 1QH7A 4KBBA 3N4MA 2XBO1 3D0JA 2VTFA 2NQYA 1AR83 4I02A 3J8F3 4YRDA 5GKAC 1F4HA 4QKBA 1AL21 5IWFA 4XETA 1S55A 1GWKA 2J1EA 2RS13 3ZYBA 3FX3A 3IZOA 4Z92B 3T09A 4YVWA 4NMIA 2ARAA 3KV5A 5L19A 1CD3G 3AZXA 1E5SA 5BNQA 3B9IA 2ZX2A 1ND2C 4X8PA 4MGTA 4HSLA 1EYBA 2RDNA 1O3RA 1O4YA 5KHKA 1ACCA 4P5YA 5F1RA 2RS33 1S0EA 2QQKA 3IWZA 2VNOA 4MLOA 4UW4A 1MEC2 4A3ZA 1W2AX 3IM0A 2VNVA 1J3QA 2EF6A 2IFRA 4QXCA 2V4VA 4LKDA 1RUJ1 1REEA 1NT0A 3BOWA 1DQ0A 3CDZB 4UI9L 5C4WA 4FXKB 3ZOIA 1SLLA 4XACA 1BVVA 3ZKYA 2XLFA 3E6BA 2WDBA 3PTYA 1CAVB 5FZBA 4IQPA 4XHXA 4AFBA 4QQPA 1G8WA 1R64A 1QJY1 3ZDVA 1ZBA1 4N7UA 1LOBA 5FO8B 2VUJA 2XL9A 1EUTA 2SBAA 3INAA 2EXJA 1AYN3 4XF4A 1LHNA 2J1UA 5D8AC 5KXEA 1RUH2 2R0HA 3DL3A 4MADA 4NIHA 4QX7A 2R072 3GZUC 4QX1A 1SBEA 1PMJX 5ANNA 3JCIA 4YW6A 4W6XA 2PLV3 4GMP0 2H6CA 1OF3A 3VBOC 2VOTA 2ZEZA 1KXGA 3RG0A 4K7JA 4EN0A 4E2SA 4NPLA 2UWAA 3S7IA 1SMVA 3H3LA 5FP4A 1CONA 4H14A 2VOKA 4XFAA 5T5OA 4EN7B 1UU4A 3OUIA 4LO6B 2BFUS 2RR13 4JGZB 1RUC1 2Q1FA 2VECA 1PX3A 2CY6A 2D97A 3H9AA 4BDVB 1BXHA 1WKYA 3OYWB 4N9HA 4AOCA 1RUG1 1WGPA 3FUOA 4KH9A 4XUOA 3EYPA 1J3PA 3AK0A 4EWEA 4IDZA 5CG9A 1TNRA 2Y8KA 1S4CA 2VMIA 1DHKB 4FP2A 1WA4A 2XWBB 1GNHA 2DU1A 1PO13 3USSA 1XQNA 5FMDA 4NPMA 4ZS3A 4OUSA 2LW8A 5T5PA 2WS91 3LDBA 1SPPA 2WNUB 3GNEA 2DYCA 2VTXA 2UWBA 3NO8A 2CYFA 3W58A 3TNQA 3J4UH 2WRAA 3B7MA 4OUEA 4SBVA 2WQZC 5IVBA 2Q8DA 1WWYA 1QWRA 4Y33A 3ZFGC 5IUQA 1A8MA 2HWD1 1VBA3 5DDJ3 4CDUA 3DV8A 5M0TA 2TUNA 2UYAA 3H8XA 4A4AA 5IHRA 1BJQA 2WNVB 3PVOA 1QQP2 5BPXA 1HQNA 2D6NA 1VMJA 4YW1A 4CP9A 3AM2A 2OUJA 4IE4A 5IAVA 5E89A 4QX0A 3UJOA 3OSDA 3N7LA 3QH6A 4K3UA 4Q4Y1 2BBAA 1OPOA 2AENA 2WL1A 2DTWA 4Z07A 3USUA 4MG2A 2YMZA 5FBZA 2OA2A 2Q1ZB 1QY4A 4TYSA 5FDBA 5FZFA 1NYWA 1XC6A 2ET1A 2DUOA 4A45A 4YM0A 1PK6A 5I93A 5GLTA 3W59A 4D69A 5CZKA 1D4M3 1OFSA 1CX1A 4BK5A 1AYM1 1TME1 1CR7A 2C24A 2D98A 5A1AA 5IT6A 2VMDA 3OF1A 5KHJA 1S0JA 5BXXA 3JD73 3VD3A 3MF9A 4V2VA 1JOBA 4ET7A 1ZZ9A 3H7YA 1HXS1 5IFTA 1ZBE3 5FMBA 3KGLA 5FUIA 2QQLA 5LK5A 1X7NA 3POYA 4UW5A 2W39A 1WCSA 1Q8SA 3I4IA 3QD6A 2JJ6A 4RQPA 5EQUA 4BQ3A 1FI2A 3MW3A 1F9KA 1VE0A 1KQRA 3HJRA 2BBVA 1MZ5A 4YVWB 4Y4RA 1PO12 4IV1A 1E5HA 1F15A 2IXHA 5DAVA 1VALA 3RFRA 3CJIA 3POIA 2PHWA 3HVDA 1NXD1 2DV9A 5LASA 5BNPC 2JDNA 5FP8A 1RXFA 4LOSA 2QE3A 3NSTA 3KV6A 4LA2A 1PMHX 2Y6JA 4OI0A 3J9SA 1D2SA 1AR93 1OD5A 3KWVA 5J1XA 4LLOA 2Y0OA 1VBA2 2D6LX 2JG9A 5C4WB 1BVP1 1RUF1 3GDBA 4QWNA 4CU9A 3UKVA 3ZX7A 3O1RA 4NRPA 1HRI1 4CCCA 2ES3A 1I5PA 1UF2C 1YFXA 3C2UA 3FBYA 3IMMA 4QM8A 5FFOC 5KWRA 1W6MB 4TZDA 1H8VA 1LU2A 1XNCA 1GR3A 1QJU1 1AXZA 5T5JA 5J7MA 2PAMA 4NN0A 3VHRA 4HPKA 3FLRA 5EXOA 5BY5A 1ULFA 5I8YA 1O8PA 4OZOA 1GZ9A 2WWJA 4HZFA 3PVNA 4LR4A 4MGSA 5FZLA 3LOBA 4N8MA 5AC91 2QQVA 4AVBA 5L9RA 5CFDB 3NNJA 1GWLA 2D5FA 5D2AA 3VKOA 3VDAA 4GKXA 1F31A 3S57A 1D4M2 5J98B 2XOMA 3UGFA 2G1MA 2EXIA 3SCHA 4LK6A 2J1VA 1RYYA 3UKNA 2ARXA 5F2SA 3RDIA 1SACA 4XFGA 3KB5A 5GLWA 3SMHA 1C8M2 4MH0E 3QCWA 4Q4X3 1I6XA 2JDHA 4Q4V1 3VBRB 3SH4A 5DAQA 4IE0A 2VJXA 2XUMA 1LULA 1V6JA 1XBFA 5FBJA 5JCTA 1YQ5A 2B7YA 4QPGA 4DXSA 4YG3A 3DEMA 3AYDA 3B5LB 5C3OA 3BVCA 1NKGA 3HQXA 2AR6A 1QJZA 2PHFA 2ZACA 5H9RA 3VLBB 4KQ7A 1GZWA 1W8TA 1CIYA 2DCJA 1UMZA 3DYOA 4OMDA 3ZMNA 1IPJA 1PVXA 4M01A 1W8UA 3L2YA 2QZ2A 3I59A 4JHZA 2Q30A 2XLGA 1VBC3 4OZXA 2WT0A 3ZR5A 2AGSA 1HQLA 2QJVA 1H6XA 3FHAA 1AF9A 1ASJ2 3S30A 2RJ2A 4GKYA 1LENA 3A7QA 2CGOA 2IC1A 3EJKA 4XUPA 5CFCB 4UWDA 3NW4A 5DUWA 5J09A 2BYVE 1GYKA 3MFCA 4HBNA 4TXWA 2PQQA 3T1MA 3WLUA 3VBSA 3KQ4B 4NHXA 3R6SA 1S0IA 2VULA 5A3PA 2ADEA 2HWF3 1WBFA 4IGPA 4CDUB 1BYHA 3OGRA 5CEHA 1IZ3A 1NUKA 4DINB 1JZ6A 1UYZA 4UFHA 3M8LA 4GZ9A 2WNOA 5FYVA 5FOBB 1UXZA 4BHPA 3CEWA 2R7EB 5J37A 1OBNA 3C7GA 4XF3A 1DP0A 3HOBA 2J1AA 5A3UA 1GU3A 1OLME 1OQ1A 3H42B 2GC1A 4P5HA 4NROA 3R4DB 5ANQA 5ABJA 3ASIA 5EYXA 5IJRA 4B4PA 3VUOA 3N9QA 4HVOA 3LPGA 5JMCA 4LIUA 1SCSA 4L99A 4BK4A 3TAYA 4LT5A 1ULGA 1XPWA 1O7FA 5C3QA 5FYYA 1R083 3ZO0B 1DGLA 3E5XA 1ZZBA 2VC9A 3MIEA 5ACA1 5JXHA 4LBQA 3I2FA 1NA1A 5LZ6A 2HBTA 2VZTA 1YJLA 3WQ1A 3MLLA 3IIIA 1OPMA 3M3CA 5SV8A 3RZMA 2HWC1 4N43A 4UOJA 4RQPB 1VBC2 2W68A 1ZRCA 2O0OA 3K3OA 3T4HB 3IB3A 5GZGA 3WR0A 2ETEA 1HX6A 2E7TA 2AREA 4P02B 3RZZA 5JR2A 2YZ4A 2A6XA 2P3JA 2RVAA 3I8TA 3CJIB 1JU4A 3SH5A 4OMCA 4QPYA 1AXKA 1K45A 1SG3A 2V4AA 2VOWA 5FLHA 2A1XA 3U14A 4AI1A 4AVVA 4AW7A 1SCRA 3KVBA 4OQ9A 3GM8A 1MS4A 1OOPA 4KWKA 3SLIA 3OBZA 3SNMA 5CIRA 2ZGLA 4QHZA 1K5MC 2XBO3 1JU3A 2HWF2 3ILNA 3KF3A 1NZIA 5EJZB 2PA7A 3JB4C 3SISA 1OLMA 4DEQA 4A44A 3HT2A 1H2LA 1SLTA 5HI0A 1PO22 2W08A 4NWVA 2C26A 3O0VA 2K0GA 4E9KA 1AVBA 1F8VA 2YG0A 3ENRA 3VHNA 1L3JA 1W2OA 4IEYA 3AP6A 5HCHA 2FQPA 4PLOA 3FC0A 5JUVA 1PZ9A 4RYDA 1V6IA 3ETQA 3OBTA 1H1IA 4FPEA 1RMU3 4CTEA 3PDQA 4HKWA 1ODMA 4TLFA 4XBNA 4P9GA 2AUYA 2VGDA 3NJZA 4IGOA 2FDHA 5FKCA 4KG8A 3VDDC 2VL4A 2W87A 3KCXA 4QQ2A 2DUQA 3OPWA 2JD9A 3KV9A 4YARA 1N1VA 3ZYPA 4B4QA 1RUJ3 5FYIA 5FY7A 5JI7A 1GANA 2AC1A 3MI8A 1FV3A 1VBB2 5GLZA 3M3QA 4GIQA 4PI0A 2JDZA 4JHTA 1PM7A 1UO9A 2Y6HA 2E26A 2V5YA 4I0AA 1Q8VA 4JKMA 3NKGA 5FYSA 4ASKA 3FMGA 4W65A 3URFA 3RMYA 3WD5A 3ORJA 3CMGA 3H3UA 1HN0A 4LA3A 2JDYA 4WVMA 3I3EA 2JE9A 1CPNA 3WDTA 2JIGA 2JB8A 4Y5TA 1VRH3 2D3PA 4HONA 4K9SA 4AFMA 1YWKA 1O3SA 3WINE 4QPWA 3UKTA 1CZSA 4ES9A 1X33A 2MHFA 1B35B 3LZZA 4JX0A 2PHTA 4NAOA 4BIFA 4OHVA 4OI2A 4CXYA 4RA0A 3BKZA 4BJ0A 2DURA 3Q8AA 3O1PA 3MGUA 4DY5A 4MXVA 3N9LA 4MUVA 2BGOA 2YBKA 1PK6C 4CCNA 3VN4A 1ENQA 1V9U1 5C9AB 4PBOA 2QQPA 2WWSA 4QQLA 1EAH1 2XBO2 2XB6C 3HBZA 3LE0A 1W9SA 3OUJA 4M3CB 4W50A 3KMHA 5FRAA 3BN6A 2ZHNA 1H9PA 1RUC3 3LB9A 1BBT1 2IXLA 1AL22 3DXTA 2YV8A 2BPA2 1OURA 4P00B 1FNYA 1Q5OA 2CAUA 3MV11 5FJKA 3T08A 3VBSB 4CRQA 5IVJA 4ISQA 2X5IA 5FP3A 4KMQA 4S2FA 1RUD1 2ZHMA 4HL0A 1ALYA 1REDA 1RUG3 1VBD1 1ULEA 3S0MA 2XR4A 4AI3A 3MZHA 2B9VA 1JBCA 4IV1C 1SQ4A 4AGVA 3BCWA 5BYNA 2HBUA 3CJIC 1L7QA 4J25A 1DU3D 1OA2A 1WMDA 2WN2A 5DG1A 5C8CA 2CWMA 1CGPA 5KC6A 1L7RA 3CBNA 5K9YA 2HJIA 4IUGA 1J3RA 1NLRA 1X50A 2DCKA 2WS93 1RUJ2 3KT1A 3ROUA 1W9YA 5FMOL 4A7ZA 4G4FA 2HYKA 4L9BA 4QKFA 3EBRA 2ZHLA 1W0OA 1W9TA 4NVPA 5EJ1B 5A3NA 2JG9C 5FPLA 1MQTC 3B93A 4XJ8A 2GSYA 1O3TA 4QXKA 1DBNA 1W3XA 1QJY2 4GAZA 1UY3A 1ZBA2 4D6RA 2HWD3 3U1XA 2ARBA 1EV11 1RVF1 1VLNA 3CNAA 4LO8A 3U11A 1COV2 4Y26A 2Q1MA 3OD4A 4ZY9A 2OKXA 4BM8A 5LRSA 4LBQB 2UY9A 4LBMA 2VW2A 3TWIA 2MPFA 1ZZ8A 4BH9A 5FCCA 4CXXA 1W9FA 4N43B 3ES1A 4Q4Y3 4GQ7A 3IIAA 1A8DA 1C3HA 1GP4A 3WQ0A 1F35A 3MF6A 4XTMA 2WO1A 5FPUA 1CAWA 1U12A 3KCCA 3HWJA 1HW5A 3VL8A 5JZGA 5DMYA 3O0WA 4KU8A 1OKQA 2VCBA 3I2HA 5DG2A 2NZ9A 4Y1UA 3U4SA 1RUOA 3BYWA 1WD4A 3WNKA 1R092 4E4HA 1ONAA 1C5IA 1TME3 1ULPA 4KWLA 3JBG1 2W1SA 3FUQA 1AXYA 2ZGKA 3MV01 1OOPB 5FOJB 4WVZA 2YROA 1DQ6A 4K40A 5GJ6A 3VKFC 3VKLA 5E1RA 1PNGA 1HXS3 2VAUA 4AVSA 1ODNA 2CAVA 2EVXA 4QPGC 1I1EA 4YG0A 3ACHA 1EY2A 1XU2A 2RDQA 2WQ4A 3BPSA 4BQ1A 3BU0A 2QDNA 3NAPC 3AL5A 1LNSA 2RG4A 3ZSLA 2YPDA 1AJKA 5T3NA 4WZFA 4CEWA 4K1ZA 3HNBM 1G7YA 4HETA 3VBHA 1TMF1 2WS92 3GCWA 1NCQA 3JU9A 4BLJA 4GD4A 4IEVA 4MGZE 2E51A 5L9VA 3JZVA 3WHTA 4L8QA 4CUGA 2GNDA 3NNLA 2RMU3 4FPHA 2RHPA 1JZ2A 1W03A 1T6GC 3OGGA 4J1WA 2AH2A 2PMWB 2HWD2 1O6UA 1QH6A 5FP7A 4JZRA 3RJRA 3WDYA 2WA3A 3ST7A 3ITQA 2VNRA 3FWEA 3BUCA 2QBXA 1YFWA 4MGYE 2B45X 3LFIA 2JX9A 2DUPA 4L97A 4I0WB 1Q43A 1YEWA 3LA2A 4Q4Y2 4WVMB 3WOGA 3KQRA 2B5HA 4WM8A 5IW0A 5BNOB 2YFZA 5FKBA 2IXJA 1A6CA 3ZSEA 2G19A 5AC93 2VQAA 4BQYA 2OZ6A 1JOJA 4IEQA 5FZEA 3VL9A 4CU8A 4LNVA 1S2EA 1OLQA 3LIHA 3LPFA 1DQ4A 2WZR3 1DGWA 3PVEA 3VBHB 1AYM2 1NXMA 5ABJC 1KEXA 1UCXA 4JGZA 4IEUA 3UNPA 4HVQA 4O7XA 1CJDA 1YQ8A 4YM2A 3ZYJB 3MO4A 3V64A 2D6OX 2VM9A 1W28A 4N53C 2XJVA 1HXS2 3P3PA 3RYPA 4A3XA 2Z5WA 2WABA 3P3NA 1W8NA 2X53S 3WF2A 4EQVA 3OGSA 4ORFA 5CKQA 4DO0A 3TEWA 2ZHKA 3M1HA 5FZ3A 1NA1C 1MVQA 1PO21 4XFHA 4FBFA 3AMNA 2X5IB 3KF5A 2JWPA 1NCRC 2ZEWA 4Q1PA 1OA3A 4F3JA 2W46A 1JI6A 3Q8EA 3AZWA 1S2BA 3CF6E 4H55A 5T52A 5CKMA 3VHOA 4A41A 5J36A 3THPA 2J42A 5C5UA 1DF0A 5JXJA 2WNUA 2Y60A 4CXWA 3AL6A 1RJ8A 5FYMA 5C8CB 2GDFA 2P6HA 2RDSA 4RFRB 5FY9A 5IVEA 1MEC3 1V6MA 1QXJA 1XYOA 3WNXA 2VQ0A 3M3OA 1U5XA 4E8CA 5DAPA 3D8CA 3W5NA 4A7YA 3TB0A 1ENXA 1RUF2 3QACA 4LUMA 2R49A 1GQPA 4COYA 1HRI2 3IKWA 1BKZA 4XXPA 5BNNB 3WP4A 2WSVA 4BQXA 2BUKA 2IWGB 2FZ1A 5DZGA 1QJU2 3AFGA 4B1MA 2Y64A 4IEOA 1HKDA 3T30A 1W06A 1US2A 5FYBA 3WNNA 2YGLA 4AQTA 3A22A 1YIFA 2UYBA 1RHI1 2BQPA 3AKQA 2PAKA 4YGDA 2WBKA 3DKWA 2OW4A 2XJRA 3C7OA 2OYZA 1PGW2 2ZX1A 5FPVA 5F3GA 3WG3A 4CE8A 1AX2A 3LEMA 2R073 4LBLA 1DQ2A 3GZTB 3W5MA 3IBMA 5F5CA 4FXGB 4BXSV 4LBNA 2R0FA 3OGVA 2LROA 1ZZCA 1F5JA 2RS51 1W8WA 4XUNA 2VZVA 2XKOA 1G9FA 1QJEA 2FHRA 5JZGB 1XE0A 2JEMA 4Q4V2 4FPYA 5LA1A 1DG6A 3EO6A 5GM0A 4U2AA 5FP9A 1JZ4A 3ZYFA 1OH3A 3IDBB 1BK0A 2R6QA 4Q0SA 1FV2A 1SLCA 2VMEA 2BVVA 2DFBA 1LOAA 3DGTA 4NJ4A 3MEPA 3HNYM 1W0NA 4ZS2A 3RYRA 3LGRA 1HIXA 2R041 5ACA3 1LU1A 4CUBA 1EP0A 1ZYBA 2HLEA 3MFAA 4AGGA 5CAZA 1IHMA 1YCIA 2UU8A 1WLTA 2YFUA 1ND3C 1DLCA 3H50A 2AYHA 3IDAA 4S2HA 4AEKA 4KNCA 2HWC3 4Q8KA 3D6EA 2WC2A 4KBZA 3HN3A 3MW2A 4Y3OA 1SHWB 5FTTC 1ENRA 1LEDA 1LHWA 3TOJA 2WR9A 4CEWB 4TWTA 3D82A 1OH4A 2W94A 4Y1XA 4MHUA 3T0AA 5JWPA 2B46X 4QPIA 4RGAA 1OI6A 1NCQB 4UAPA 5FZKA 1JZ3A 4IL7A 1HB4A 3PIJA 3T2PA 3KZ4C 5JLVA 2ZGRA 4UFJA 1LJ7A 1YRZA 4L2NA 3AMMA 3C3VA 1IQAA 3MBWA 4PDWC 1W6MA 3AZYA 4Y20B 3WY6A 4ASMB 2OQ6A 2GP5A 1V6NA 1Y9GA 3FLPA 4BMEA 3T0BA 3T1LA 4QKDA 5DUUA 5FZ0A 1COV1 1MS5A 2VZ3A 2E33A 3CIHA 4QX8A 5FAXA 2A6ZA 3RZLA 4HMZA 4LITA 3PU3A 1DYOA 3BTYA 1QQP3 1O4ZA 4DS0A 4XE9A 4AI0A 1WMEA 1ULOA 4META 5CFDA 5A33B 4AAPA 5F7UA 5A7NA 3ZN6A 1MACA 4WM8B 2P17A 4EZHA 3Q8FA 1ZRFA 2DCYA 4GH4B 5FMOS 4URTA 4CDQA 1X36A 5KXBA 2FDIA 3O14A 3N9MA 2G9GA 2PAEA 2XL7A 3POWA 4RR3C 2BVBA 4AQSA 3V65A 1HDKA 3B00A 3HNMA 4OUMA 3VBRA 2VZQA 4P9IA 3EQEA 4JGYA 2Z69A 1R091 3ZFEC 1UPSA 4V1PA 1LOFA 1HN1A 5EIYB 4QB1A 5L9BA 4DEVA 2CDPA 2XQXA 1FT9A 3A4UA 5ACA2 1W0PA 3WP3A 1J1TA 1MS3A 2CSGA 4NUBA 2JE8A 3I2JA 4N90A 4E27A 4TN7A 4O9GA 2HWC2 3ZPYA 4BMBA 2WWUA 1W9WA 1O5UA 3ZN4A 4X8NA 4OYUA 4EROA 4Y22A 4CP2A 1RUI1 3RZGA 1OHFA 5C5TA 4GWJA 1CWPA 4QHBA 5FMCA 2JKXA 1UN1A 3ZSKA 4AYUA 2C9AA 2G4IA 5CBLA 5FPZA 3U10A 4BWOA 5CFCA 1A3KA 1OVSA 3DYMA 1Y43B 5L7OA 2VBBA 4CCLA 1VB4A 1EAH3 2WFPA 3AP5A 3AJZA 3LCPA 4LBKA 3E5QA 4OI4A 4QB6A 4ATEA 3E6DA 4AR2A 5JIAA 5HCAA 1SFYA 1BBT3 2X8KA 1ZZ6A 2Y0IA 2YBPA 4PBPA 4QQHA 5JSRA 3CL1A 2FCUA 3O0XA 1C1FA 4UT5A 2Q0AA 4ZXEA 5KC5A 5A3MA 2PHRA 1GP5A 1LOCA 2FCVA 1RUD3 1NX9A 1EUUA 1VBD3 5FZCA 4CDWB 4UW6A 2LTNA 1SEFA 4MVTA 4QM9A 1UY2A 1VAMA 2EALA 4D7SA 3FL7A 3M2MA 2XQRA 3PUSA 4XBQA 3RPQA 2VUCA 5FO9B 4K1YA 1HJFA 1UNBA 2ORXA 4CCEA 1LOGA 2A71A 3WW1A 1UMIA 3VBUA 3AYAA 5K4LA 5GZDA 2VU9A 3ZXJA 4D3WA 4D94A 3V0AA 3J7LA 1QOSA 2IUWA 3MIFA 3OG2A 1OT5A 4LE4A 4YNIA 2Z4FA 3AMPA 2DBNA 4D7TA 2HYXA 1GKBA 3WXPA 4TSVA 2BJSA 1OD3A 1C8M3 2PN5A 4HN1A 3DF0A 3D4KA 1AUYA 4DOUA 5HV4A 3JB8A 4XC9A 5FK8A 1QGLA 2O14A 4IERA 4JTOA 1EV13 1RVF3 4Y5Z0 5FZGA 2PXJA 2Q8EA 4E2QA 4A7KA 2WQ8A 1QIQA 3POSA 4DNYA 3EB7A 3H3ZA 3B02A 4GMP1 1PIV1 3U07A 2HH9A 3NWKA 1N1SA 2VO5A 1UOFA 3ZXEA 1WW6A 4D8MA 3K4DA 4MV2A 4EV0A 1ZRIA 1TQ5A 1GP6A 2DFCA 2OXBA 4MHRA 3R4UA 3KLSA 1LR5A 1KS4A 4U36A 2J22A 2VVDA 1KDMA 5CYYA 1V9U2 4XFBA 4OQ8A 1ASJ3 1EAH2 1UW8A 4LQRA 4QPIB 4JGZC 2JG8A 2ZGNA 5IYYA 2JDUA 3JQXA 1WMFA 1G9BA 4MZUA 3WHUA 1BBT2 3OGJA 4FVVA 3ON7A 4W6WA 3APBA 1KJLA 2XWJB 1FYUA 3C8XA 3RJ2X 4CZSA 3OEAA 2BRTA 3OBAA 1FPN1 2F4LA 3N36A 1PX4A 3VBFB 2RJKA 3ECQA 1PVC1 1UIKA 1RUD2 4M3CE 4LLFA 1VBD2 5FZ8A 3WNMA 3OB8A 4Z1VA 1KDKA 1UXXX 4B4RA 4KGQA 5J96B 1Y4WA 1PGW1 2JE7A 5I0UA 5K7PA 4NE9A 1Z78A 4B3NA 5H9QA 2Y26A 2WNUC 3WCRA 3ZN6B 5LRRA 5IATA 2EIBA 2EA7A 5CU1A 5K0UA 3IMNA 3BPZA 3VD9A 4CDQB 3ES4A 3C7HA 4ZHNA 2ZGUA 4X6QB 1AR71 4Z8BA 3ZR6A 1UKGA 3H1YA 1JYIA 2HKXA 3MIBA 3MPPG 4JGYB 1JYNA 1JH5A 4BZ4A 5LATA 1EV12 1RVF2 1QJFA 2ATFA 1V70A 5A7SA 2WNVC 1XNBA 5JAXA 3HPNA 2FD8A 2ZXQA 1JTZX 4FFGA 4M4PA 4S2DA 5CADA 2UY8A 1HRV1 3ZLIA 4GALA 1ZA4A 4YGBA 5DQ0A 3WUDA 1K12A 4E4ZA 3WDWA 5LA2A 1FOD1 1B35A 2BOIA 4IE7A 1OA4A 3H0OA 4JTNA 4NPRA 1UU5A 5GLVA 3UT0A 1C8NA 4Y1ZA 2JECA 4Y22B 4A6OA 4XQDA 4BISA 1IS6A 3WZ1A 5C9AA 4XJ9A 4CEYA 1WCKA 1IG3A 4P08A 1YFUA 3WW2A 1H2KA 1SZBA 2BNMA 2H0BA 2YU1A 3KD4A 1UZVA 3PVBB 4M3CA 2UWCA 1W6OA 5F5AA 4NHMA 1LTEA 5JOWA 3JBG2 1HB2A 4FFHA 5FZ9A 4W4ZA 2YHJA 2WZPP 5L7OB 1SLAA 3NL1A 4YG6A 5A7WA 1DZQA 2IZWA 2Y6LA 4O65A 5EP9A 4I2OA 2P3IA 2BEOA 4JRLA 1CAXB 2I45A 1U5YA 1KD7A 3OUHA 4GB31 3AVSA 4YVWC 1PO23 1O3QA 3PJYA 1IPSA 1W90A 2ZPXA 1QNWA 1WW4A 1X8MA 2FBEA 3FLTA 2DVFA 2PHXA 2E63A 3CQOA 4WM7B 3M7AA 4XABA 3WG2A 1KJRA 4Y1YA 4OVEA 4AZZA 4WV8A 1TMF2 4IETA 4XIKA 1U5ZA 4P9XA 3VD5A 1FXZA 3NNGA 3VBUB 1SLIA 3ETPA 4XW3A 5C8WA 1E57A 5C4WC 5C3RA 4FPOB 4GWNA 1KGYA 4PQQA 2FDJA 4D0QA 1QF3A 3QH7A 3HD8B 2OPKA 2W95A 4HFSA 4UFLA 1Q3EA 1VBB3 1YIPA 2GMPA 2XHKA 2FCTA 1FMD1 4Q29A 2WINB 2QUOA 3VDBA 3NMBA 2ZOEB 5GLUA 1W04A 5JMOA 4BU2A 5FY4A 3PHMA 1R1A1 4P9LA 2VMHA 3BI3A 2W3JA 3TNPB 2ZX0A 5FZHA 3WSOA 1RHI3 1AHSA 2XVKA 3IDEA 4MXWB 1PGSA 4YW7A 1NLQA 2CWSA 4YW2A 3T2TA 4I01A 5CFDC 3DN7A 1AR81 4LHSA 4UBHA 1X9TA 3J8F1 3MUY1 1LECA 4CYDA 4CDQC 2VZSA 5B4XA 1U0AA 2XPJA 3M4FA 1C1LA 2RS53 4LKSA 3WNOA 3WDXA 4MGQA 3VBRC 1S0CA 3OOXA 2BTVC 3SH3A 1ZREA 1ENSA 1H8TA 1OF4A 2VOXA 2JG8B 2VMCA 1GZCA 5AVAA 5L7OC 3WF3A 3ZFFA 3ZYRA 1LB2A 2X09A 1JZ7A 1QHDA 4RFT0 1AL23 1UOJA 5JPNB 5LWBA 1XNAA 3F2ZA 4YWAA 2RS31 4NIIA 1U5IA 1VAKA 2K2SA 1GNZA 2R043 4EJRA 1GUIA 2EIGA 2OQ7A 3LKJA 5F6KA 1XXNA 5LEJA 3J26N 3DCQA 2BZDA 2YY1A 3AKTA 4XF9A 1UZZA 2ZMLA 2CGPA 2W92A 3GZEA 5LEKA 2W0XA 5FZ6A 4CDXA 3A21A 1I3HA 3B3QE 4OHWA 1DQ1A 3WVJA 2D3RA 4RGKA 3O1MA 4FFIA 4FOWA 4AQ2A 2O8OA 2AZ5A 5K0UB 4YYOA 5CFCC 3H8UA 4Y1VA 3CJXA 1HJGA 4W6YA 4JVAA 3O1SA 4YGEA 1QJX2 3KT4A 1DLLA 3PUAA 4AHXA 5DPNA 3KVAA 4CDUC 2XH6A 4DQAA 4L92A 3NV2A 1VIWB 2E53A 1QJY3 3NV1A 1ZBA3 2MEV2 4ES8A 2ET7A 1A78A 1CIWA 4YGCA 1COV3 2ZEYA 5BV6A 5BNOA 1RHI2 4AXOA 3E6CC 4HLTA 2PQSA 3NVCA 4QX5A 2XLAA 1RB8G 2TBVA 4Q4W2 4XJAA 4R9DA 5CISA 3GYDA 1GOFA 3OTFA 4IV3A 4Q2FA 5FXWA 1PM4A 2ZS6B 4M00A 2VZOA 1MR5A 2WAOA 2A6YA 2RS52 3A23A 3NNMA 4IESA 4UBGA 1W2UA 3VBUC 3I54A 5HV0A 1H0BA 4HK9A 4EWAA 4ATFA 3BTZA 1DDLA 3ZIWA 1M06G 2BP6A 4CEYB 2QQUA 1LRHA 4HG6B 1C57A 1FATA 3KV4A 5F37A 3SCFA 5KBFA 1W6OB 4LOTA 5F2WA 2WNEA 1R093 2DWRA 4XQ4A 5DUVA 3WCSA 3SITA 3K46A 1VMHA 2JDMA 4AI2A 5JVVA 5A7WB 2R042 1CZVA 1S1AA 4RSUA 1OXCA 5FREA 5JI9A 1S2KA 5F8PA 1WD3A 5FJHA 4V2WA 1LEMA 4P9YA 2E6VA 4RQPC 1W8OA 3NNFA 3BIEA 5A80A 1S0DA 2D43A 2RV9A 4QAWA 1L7LA 1POQA 3AKSA 2PELA 3D3AA 4AWDA 1GOHA 2O8QA 2ZEXA 3WF4A 1MS9A 1RUI3 3ZXDA 4XMAA 1AR62 2R1BA 1LAJA 2X29A 3Q9OA 1DYPA 1DGRA 2VPVA 4IEZA 4IEPA 2BWCA 2V5DA 4K21A 5D21A 4EWDA 1G9DA 4EN9B 3ZYHA 2NP0A 5JSOA 3R4SA 5BNNA 4B8EA 3WP6A 1E5IA 1VRBA 2C0ZA 4LPLA 5D8AA 1SBFA 2W9XA 3UK9A 5JDBA 3KSCA 3UETA 3UL2A 2D6MA 1J58A 3HQUA 1ZRDA 4Y4YA 1ZZ7A 4PLMA 1DGRN 3FE5A 3NJVA 1J83A 3PNAA 2WSUA 4LO4B 2ZZQA 5DZEA 4NIAA 2VTXJ 1MPXA 3VBOA 1CAUB 1V6LA 1WZXA 2WA4A 4AEMA 2E7QA 4NIDA 2V72A 2DU0A 2JIJA 1LKNA 3Q8CA 1IS5A 4HK8A 3GCXA 2BNOA 2XMLA 2WO3A 3AZZA 4PLNA 5IVYA 2R062 2F6BA 3RNSA 5LB6A 4IE5A 4CCJA 1ZBE1 1NOVA 3MUZ1 5FXXA 3ZXFA 1GSLA 1QXRA 3PMSA 4KG0A 1LGCA 4ZONA 5E16A 2BFUL 5IVVA 1H6YA 3WX5A 3T2OA 4Q0UA 4JDMA 2A3YA 4KL1A 3CKHA 1AYM3 2JENA 4GULA 5FQ0B 3SEPA 5C71A 2ZGTA 2ZKLA 3DPRA 1BHGA 2VOVA 2VG9A 4J1XA 5ISLA 3R05A 1W99A 4K6BA 1QDOA 2VCAA 2WAAA 5FY5A 1H8TB 4R8HA 3DKQA 4EE2A 1IPKA 4HKOA 4J6GA 1S0BA 2W1UA 2GNBA 4X6RB 4XCAA 3ZFFB 1YI9A 1G9CA 1VR3A 2DVDA 4QD2A 2PTMA 4PIZA 2PFWA 2XDVA 4BIOA 4D6QA 4CVUA 4QX3A 1XNTA 4XUQA 4YPJA 4XDOA 2AACA 4QGNA 1AR91 1PIV3 4KWJA 2W5FA 5CB7A 1B35C 1RUI2 5EZWA 4CPBA 5B2GB 1JS9A 1UKRA 1UL9A 2IVIB 4MO3M 3WF0A 4B7KA 5C6CA 3VZNA 4URAA 3ZFGA 2GC0A 4AFAA 3WQBA 2EXKA 1XNDA 3SHRA 4CDXB 5C9AC 3K48A 4UYBA 5EJ3A 2WLPA 5APAA 4Y20A 5L73A 5DXDA 4PQ9A 3E1F1 1N3PA 4H2AA 4AK3A 4AF9A 5I0DA 2R30A 5IVCA 1RUF3 3VBSC 3K4ZA 1J84A 1HRI3 1JYTA 1MS0A 1RXGA 5LCWL 4NR1A 4QU2A 4OHZA 4PIYA 3THDA 1FPN3 3MPBA 1EPWA 1PVC3 1QJU3 1NZCA 3V56A 1QOTA 2W52A 3GALA 4COVA 2YC4A 4NRMA 1WLWA 3AYCA 4PT6A 2A6WA 5A33A 5FY0A 1RUNA 1MS1A 1O59A 1VBE1 3H1WA 3ILFA 1Q8OA 5BUVA 2F17A 1S0GA 1ZNPA 4YVSB 4H7MA 4Q4X1 5FYZA 2HWE2 4GH4A 3POEA 3RI8A 2KA3A 1CN1A 4YZ3A 2HEYF 5FZOA 3C7EA 3N9NA 2JXAA 1E5RA 4IV3B 2WZEA 1SLBA 3NV3A 2BGCA 3EXUA 3ACFA 3DXUA 5IK8A 4YZ1A 4LBQD 1GMMA 3WT3A 3T0DA 2J7MA 4K20A 4RGGA 4JCKA 2EIDA 4Q4V3 1XJAA 4C1WA 1N3QA 3GJAA 3KHCA 4CA9A 4UFIA 2NMNA 1CPMA 4RHV1 4XILA 2BWAA 1ND2B 4C90A 4P9JA 4QDSA 1B09A 1GZTA 1C28A 2LM3A 5A6YA 5KHHA 1PIV2 1SFNA 2XONA 4KGGA 4N43C 4QX2A 3TN91 3ZXAC 3ZXLA 3WW3A 2P1BA 2QQJA 5D1IA 2BV4A 3RSJA 4QQOA 1YHFA 2LRPA 4R52A 3U0ZA 4ONUA 5DABA 2VH9A 4FT8A 2A3WA 3GBFA 3DECA 1LHOA 3KHBA 3RWKX 5JXGA 4XJUA 3LF7A 3BALA 4S2GA 1XSQA 4Z82A 4COUA 4N9IA 2DCZA 1X8EA 3CO2A 3BTAA 1VPHA 5A7OA 4DFSA 1CJPA 2Q5TA 4YZ5A 4LULA 2GMEA 1OOPC 2DTYA 4XDPA 1OMIA 2RJLA 1YO8A 1M4WA 3K77A 1G6NA 1RUE1 1H8TC 1QJX1 4ARYA 5FPXA 1LCLA 1FPN2 3N9OA 4IEWA 5D8AB 1PVC2 1RL3A 2V73A 1YXWA 2B9UA 3ZIXA 4W8JA 2MEV1 2YUEA 2V09A 4CDWA 4PF1A 2IFWA 1Q8QA 2OVUA 1I9RA 3GHNA 3FHQA 4GB33 4I0BA 3WUCA 4AFDA 4QDQA 4AVTA 2XXZA 4CP0A 4DB5A 3VBOB 4C0BA 2J1RA 4JKLA 1UD1A 4XDQA 2IXCA 2GALA 3THCA 2QFEA 4Q4W1 1OVPA 1KFUL 1QXPA 4PHZA 4YFWA 3KCYA 4AAXA 4ZU4A 3KM5A 4NOTA 3JQWA 2XHNA 2P34A 4Q0PA 3THTA 5C3PA 1CZTA 3ZPOA 1JZ5A 1AR72 2XJSA 4RS5A 3T3YA 1URXA 3V0BB 4RN5A 2BW8A 1MS8A 5A6XA 4XXAA 4UW3A 2CU5A 3WDVA 3VZKA 2D6KA 3X29B 4ZU7A 5KXDA 1W3VA 3WNPA 2R1DA 1PZ7A 4DMIA 4HSJA 3DPRB 5LBEA 3NKTA 2YU2A 4LJHA 3RI9A 4EN8B 1TEIA 2QQMA 3QLQA 4QT6A 4YW3A 1HRV2 3N9PA 1WW7A 5E6HA 1QNYA 1YI7A 3BGAA 1D4VB 1FOD2 1GWMA 1TE1B 2VQUA 3O1TA 1R1A3 5BNOC 4R9CA 1F2NA 2XJPA 3JXSA 5A3OA 1J59A 3J7HA 5FZDA 4NO4A 4RD7A 4HXCA 3I2IA 4G9SB 5F3IA 2X05A 1OUSA 4FOYA 4IV3C 4CCKA 1O91A 2DVGA 1GOGA 3VBHC 3ZFGB 4I30A 3VDCA 4IEXA 1JZ8A 1OSGA 3VZMA 2I74A 3O12A 1AZDA 3SKVA 1UY4A 3VBFA 3I97A 1Z7S2 2C4XA 3AJYA 1OFNA 2CV6A 3AMHA 3E5UA 3NJXA 4LHNA 4FQZA 1R1ZA 1RMU1 1UOGA 4O9EA 2FMDA 3GGLA 4SLIA 3PURA 4GB32 4MOAA 1XB9A 4PIXA 2X5IC 2XJQA 3C7FA 3CU7A 5CKNA 1OLRA 4ZZ8A 4XZUG 1HV1A 2JB4A 3I2KA 5CVRA 2ZGQA 1YQCA 1EPZA 2QVSB 4Q1RA 3V0AB 4EYUA 3OCPA 1H1MA 2J1TA 3TEZA 2VXJA 3A0KA 4R4ZA 2R061 1PZ8A 3ZXKA 5C8CC 1T6BX 1Y3TA 2YPJA 4M3CF 5F9TA 5FZOB 4XAEA 1IQDC 3RRDA 3W20A 2DCTA 2DVAA 3VHPA 5IK5A 1TG7A 3AYEA 1QEXA 1GBGA 2FDKA 1AX1A 2LALA 1VRH1 4XAAA 4FAHA 5F6LB 5FPBA 4XFFA 1POV1 5BNNC 1NAEA 2BERA 5FZ7A 4NRQA 5A1LA 2D3SA 3POBA 1AR61 4XFCA 5KHGA 1FMD2 5LW9A 2ZX4A 1WA6X 4AL9A 3PL0A 4F8AA 1JHJA 1F4AA 2ERFA 2D5HA 4WVVA 1R1A2 2B4KA 5DAWA 4LMFA 1D0GA 1US3A 5A3LA 5BNPB 2A6VA 3OBRA 2E31A 5FZ4A 2KXLA 4ITCA 1UY0A 4FTBA 2NN8A 3A0NA 4E4DX 5A6QA 1AR82 1D0HA 2ZGMA 4PI2A 1T2XA 3J8F2 1K5MA 4MSVA 2EIEA 1XU1A 4FPFA 2RS12 1PGL1 1MZEA 2JDAA 4XPVA 4P14A 4RL7A 5JZGC 2WFF1 1WUVA 3LDKA 1TVGA 3LA3A 4MGIE 1WLCA 1NQDA 3H8RA 1V9U3 2FDFA 4NHLA 4M4RA 2R16A 2ZBJA 4CUCA 2BGPA 1WMXA 3LIGA 5GALA 2H0VA 3AKPA 3WG1A 2VUDA 2VBDA 2YB7A 3DPRC 3QBQA 2VVFA 1CAXA 3PUHA 4GWMA 4CPBD 5I8TA 2JDPA 5A3TA 4OULA 2RS32 2ZCWA 4ZU5A 5A32A 4DUWA 4JKKA 3CZJA 4DUXA 3ZYGA 5HXMA 3VDDA 4WM7A 5LY1A 2A73B 4XMIA 1NE6A 1UZYA 5DUXA 1W6PA 3BTXA 3H8OA 2A3XA 2K46A 5J3UA 3PJQA 4YSFA 1APNA 2HWE1 2CNAA 1K3IA 4LEJA 4CEWC 1Q8PA 4HOOA 5C3SA 2WIIB 3TRSB 1IKQA 2ZGPA 3OJBA 3WV6A 2WO2A 1NCQC 3CHXA 2YDEA 4JQRA 3HEIA 1H2NA 4GA9A 3OY8A 1UQXA 3ZSJA 4B29A 2ZTNA 4R4XA 3PIGA 4QGLA 1AYN2 4RS5B 3I3DA 1C5HA 5F5QA 4LKEA 4ZKTB 5EV7A 3K3NA 2JKBA 1YLLA 4AEDA 5E8AA 5FV3A 4LUKA 2PLV2 5HXVA 4TTGA 2A5ZA 3VKMA 3ALQA 3TEXA 1A34A 1Y9MA 2VZ1A 1YNAA 3T4VA 2HWB1 3ZN5A 5FWJA 2ZKNA 1KFXL 1DFQA 4FO9A 2ZMKA 3ACGA 4MXWA 3OPTA 3KS7A 5IK4A 1W8FA 1H30A 3RQ0A 1QMJA 4DXZA 3UGGA 2NLRA 3UESA 3AVRA 5T55A 5DZFA 2RR12 4BQ5A 1K42A 4WM8C 4YZ4A 3VZLA 1WCQA 4GH4C 4B1LA 1FAYA 3SXWA 3QOPA 1XE8A 2WYFA 3F95A 5GZEA 3ZSMA 3Q8BA 1IG0A 2RM21 1WW5A 3SC7X 1JOPA 2D7FA 3HIFA 4FOQA 1NQJA 3S6PA 4FQ4A 3RZJA 1UOBA 3PTRB 1XYPA 2YYOA 4HT1T 2Z79A 2W47A 1AJOA 3JBG3 2A7AA 4QDRA 2CGNA 1BZWA 1MZ6A 1NY72 2VMFA 1JUHA 2WZ8A 3FBMA 1UX7A 1W6QA 3T2QA 5FR3A 4FAGA 1GNYA 4DRVA 2ZX3A 2CHHA 2GH2A 1LOEA 4F83A 3M70A 4LXLA 3OPZA 4DXRA 4BYYA 3HR9A 3O7OA 1OUXA 5FO7B 3GXUA 1KRIA 2RMU1 3B69A 5EYYA 2IXKA 1YFYA 3AXEA 3LD8A 4XJWA 3N7MA 5FZAA 5FPAA 3HAGA 3O5SA 2DVBA 2XJUA 5DDJ2 1MQTA 2Q8CA 5L36A 5IVFA 1TMF3 4OI1A 2GN7A 3U4XA 2BU9A 2YBSA 4LORA 3MYXA 1VB2A 3N7KA 4DZGA 5T5LA 5LK7B
chains in the Genus database with same CATH topology
2B42B 2PHDA 4YW5A 3AX4A 3N3HA 2CTVA 5JSPA 2JD4A 2ZAHA 5J48A 3MIDA 3L9JT 3N35A 2GNMA 3BB6A 3MDPA 1BEV1 2WZR1 2A70A 4CDWC 2ZGOA 4C1XA 4NHKA 5HCFA 3G7DA 2NYYA 1VBE3 1NG0A 3JD72 4DRRA 1ZBE2 4AE2A 3AP7A 4G3YC 2VMGA 1C4RA 2XJTA 5H9QA 1K5MB 3EHKA 1VJ2A 4OHXA 1PNFA 4RS5C 1UX6A 2VW1A 3GBGA 4FPGA 1QDCA 2GMMA 4XFIA 3NAPA 5JOZA 2B8MA 1Z7S1 1VP6A 4JC1A 3TYJA 4Q8LA 4RHV3 1YYNA 2ZZJA 4XYXA 2XVLA 5JPMB 1WCDJ 4LE3A 1RINA 5A32B 1AR92 1H4GA 1MEC1 4JDNA 3VDDB 5I0RA 3TN93 1W39A 2H6BA 4K8FA 4AHZA 1W6PB 4I3GA 2VNGA 2G9FA 1BMV2 5H9SA 2LUWA 4H7LA 2FZ2A 1H4HA 1RITA 4QPIC 3LWCA 2C5DA 3AFKA 4D7YA 2A75A 5FLJA 3OY8B 1XRUA 3ME2A 5AVPA 4LHKA 3VZOA 4LBJA 3VBFC 3SCGA 4HANA 1H1AA 1RUE3 1QJX3 1RUH1 1WBLA 4E2GA 1AX0A 4QMAA 1O4TA 2R071 3L2HA 4Q26A 4ZXKA 4AEDB 1CAUA 1JHNA 4AI8A 1SBDA 4OHYA 3WQ7A 4FOVA 3USUB 2MEV3 4ASLA 5I0SA 4INDA 1VBE2 5CG8A 4Q27A 3MIGA 5KHIA 4Q4X2 3ZXGA 1PK6B 5HBAA 1DZRA 2SLIA 3LAGA 4N53A 4Q4W3 5AFEA 2RS11 1ZVFA 2VVEA 2PHUA 3WW4A 2PHLA 5FQ0A 3AXDA 2TNFA 4AHYA 5SV5A 4XEZA 4C0HA 3CLPA 4R9AA 4JGYC 4XTPA 3LSDA 1NCRA 1LOFC 3IN9A 5I0TA 3FJSA 5C33A 3OD0A 4RHV2 3BIWE 3LOIA 1DGWX 1HV0A 4MGKE 2RE9A 4IV1B 1ZM1A 4LO5B 5FLIA 4XIOA 1JYCA 1W6QB 3RS6A 3WG4A 2ZGSA 5T50A 3WP5A 4AQ6A 2Z42A 1ULCA 3TN92 3ELNA 4OLLA 1MZFA 2FMYA 5TSWA 2DF7A 1JXNA 4XOGA 2GAUA 4M0NA 1NLSA 1PMIA 1YUDA 1H2MA 1F5FA 3N7JA 4N7IA 4Z2WA 1V6KA 4BCUA 2I2SA 2D44A 2JG9B 1MQTB 3AKRA 2KM2A 4HN0A 2VXRA 3GHMA 4BE3A 4AVAA 1AYN1 4GXLA 5L7OC 4XF1A 1QQP1 2WT2A 1DYKA 1RUE2 2YC0A 4AEJA 1H9WA 2D6PA 1OQDA 3HMYA 5H9PA 1N3OA 4YZ2A 5AFBA 3E97A 5K8SA 4HPKB 4P9WA 2PLV1 4KU7A 4WVWA 4XJZA 4YVSA 2E7AA 3BU7A 4PF5A 4Q0QA 4WM7C 5I91A 2RR11 1G9AA 1N1YA 1R082 2XG3A 4AGRA 2R063 4B7EA 3G6JB 2P2KA 4JAAA 2HEWF 1QU0A 5KXCA 3GF6A 1OQEA 2OZJA 1CESA 1RJ7A 4QPGB 1JW6A 3AP9A 1ND3A 3UJQA 4YW4A 1BK1A 4LO7A 1ZRRA 5EFUA 1GZWB 1ND2A 1PO11 1NY71 1POV3 1REFA 1AR63 2F4PA 3NAPB 1CX4A 4MX3A 4AEDC 3ZYIB 3I59B 2UURA 4LHLA 3B9CA 2E9QA 3RWNA 1YJKA 1GQGA 4EN6B 3MLJA 1W6NA 1XYNA 1IGOA 2QCSB 1VBA1 4PDWA 5DDJ1 5HCBA 1GV9A 4ISRA 3WCSA 3S7EA 2WFF3 4XZPA 2CL2A 2GNTA 1DQ5A 2JG8C 1FX5A 3PMEA 4BPZA 1LESA 1PHMA 4LTAA 3GZAA 1RMU2 5IK7A 5CA6A 5EWSA 1SDWA 1UU6A 3IPVA 4Y24A 1GICA 3LSEA 3AP4A 1D4M1 4RR3A 1WLDA 2O1QA 3NV4A 1CQ9A 3PLQA 4AG4A 5ABJB 1BCXA 3ZFEA 1C8M1 3JD71 3JUUA 3UV9A 3WDUA 2EAKA 4HKLA 4BOWA 2HWE3 2WKKA 4L11A 2GC2A 1AL0G 3V0BA 4N53B 4OFGA 3IT8A 5K0UC 3ILRA 1N47A 1KITA 3VV1A 1XE7A 2TEPA 1HQWA 1VRH2 4LBOA 4BA6A 1QOOA 1NA1B 2P37A 3M3IA 1UAIA 2I07B 2EXHA 2IXIA 2Z2SB 3H1MA 1AR62 1NCRB 2ZA9A 4M0HA 4XQWA 4YLZA 3AB0A 2NMOA 2ILMA 1NE4A 5JOYA 3R0RA 2Y38A 5T54A 2QKDA 2WLQA 1ZX5A 2HWB3 4GMP3 3GBWA 1ASJ1 4DPNA 1GFF2 4FTSA 1RTVA 3BODA 1RUC2 2B39A 2NPIA 2YXSA 2ZAAA 1Z0HA 1PGL2 1BMV1 3H7JA 4UXAA 2YGMA 2PYTA 2WFF2 1O5LA 2GC3A 1RGSA 4CEYC 3D5OA 5I8SA 4WZCA 2RM23 4FPLA 4C91A 1RUG2 1RC6A 2NM1A 3VGIA 4YM1A 3MICA 1D2QA 4FP3A 2XKPA 2P3KA 4E4SA 1LHUA 1DIWA 4FSJA 4JDOA 2QZ3A 2N7GA 1V00A 1LODA 4AVCA 2ZMNA 4CP1A 4COWA 4I09A 1JN2P 4XBLA 4COZA 2K9ZA 4H3WA 2VY0A 1IS4A 1CAVA 3LA7A 2D93A 3ACLA 3IDCB 1CVNA 1ULDA 4AFCA 4FTEA 5GZCA 2XVGA 4PJYA 2GU9A 3KT7A 3MW4A 1LGNA 2Q4SA 1UPIA 1V6OA 1IS3A 1LHVA 3BOPA 2QDRA 4DY3A 3HT1A 1AR73 3ATGA 4XHBA 3FZ3A 1RIRA 4XF0A 3W9AA 3TBDA 4FPCA 1ND3B 1I5ZA 4JRAA 3I2DA 1VBC1 2D40A 2R32A 4FCAA 1VAVA 4HVRA 5BNPA 1X82A 5CNAA 2HWB2 2HEVF 5JOXA 1N1TA 1FNZA 4QGMA 3B01A 1HRV3 2VW0A 4MYEA 1BEV3 1TME2 2QNKA 3FFQA 1FOD3 3ZMOA 2WT1A 2Q8OA 1QKQA 2MNGA 3ZDSA 1JUIA 5GZFA 2BNNA 4WBBA 4I3PA 2OUHA 1W6NB 3OYWA 4BLIA 2HWF1 1IKPA 2RM22 3K51A 2OIIA 4PDWB 4F7ZA 1DZTA 3FHIB 3MLKA 3I7DA 4Q0VA 1G86A 3FFZA 1TNFA 4IXLA 1HLCA 2GN3A 3MIHA 3ZFFC 3HN1A 4JV4A 3RMXA 1Z7S3 4YM3A 4FPJA 4A2UA 2GZWA 3IPVB 3B94A 5E88A 4PCRA 3M3EA 2JICA 4FPKA 2RMU2 2C1FA 4RR3B 1J1LA 3AMQA 1GQHA 3VZJA 3ZFEB 1VBB1 1IOAA 1R081 4CDXC 1LGBA 4YFZA 1XNKA 2WNVA 2ZABA 2EAAA 3VKNA 1POV0 4NWWA 1MVEA 3RYKA 1GLHA 2ZJCA 1Q56A 4AHWA 3D0SA 1Y9QA 5AC92 1BQPA 1UIJA 1FMD3 1RUH3 2ENRA 1Y7BA 3KGZA 1BEV2 2WZR2 3AZVA 5JIUA 1KS5A 1S0FA 4YVSC 2WJSA 4R9BA 2XGXA 3ZVXA 1CAWB 5JR7B 2GH8A 2VUAA 3DUIA 1QH7A 4KBBA 3N4MA 2XBO1 3D0JA 2NQYA 1AR83 4I02A 3J8F3 4YRDA 5GKAC 1AL21 4XETA 1S55A 2RS13 3FX3A 4Z92B 4YVWA 5L19A 1CD3G 3AZXA 5BNQA 3B9IA 2ZX2A 1ND2C 4X8PA 4HSLA 1EYBA 1O3RA 1O4YA 5KHKA 5F1RA 2RS33 1S0EA 3IWZA 2VNOA 4MLOA 4UW4A 1MEC2 3IM0A 1J3QA 2EF6A 2IFRA 1RUJ1 1REEA 3BOWA 1DQ0A 5C4WA 4FXKB 1SLLA 1BVVA 2XLFA 3E6BA 3PTYA 1CAVB 4IQPA 4XHXA 4AFBA 4QQPA 1G8WA 1QJY1 1ZBA1 4N7UA 1LOBA 5FO8B 2VUJA 2XL9A 2SBAA 3INAA 2EXJA 1AYN3 4XF4A 1LHNA 5D8AC 5KXEA 1RUH2 2R0HA 3DL3A 2R072 3GZUC 1SBEA 3JCIA 4W6XA 2PLV3 4GMP0 2H6CA 3VBOC 1KXGA 3RG0A 4K7JA 4EN0A 4E2SA 3S7IA 2UWAA 1SMVA 1CONA 4H14A 2VOKA 4XFAA 5T5OA 4EN7B 1UU4A 4LO6B 2BFUS 2RR13 4JGZB 1RUC1 2VECA 2CY6A 2D97A 3H9AA 1BXHA 3OYWB 4N9HA 1RUG1 1WGPA 3FUOA 4KH9A 1J3PA 3AK0A 4EWEA 5CG9A 1TNRA 2VMIA 1DHKB 4FP2A 1WA4A 2XWBB 1GNHA 2DU1A 1PO13 3USSA 1XQNA 4OUSA 5T5PA 2WS91 2WNUB 3GNEA 2DYCA 2UWBA 3NO8A 2CYFA 3W58A 3TNQA 3J4UH 3B7MA 4SBVA 2WQZC 1QWRA 3ZFGC 5IUQA 1A8MA 2HWD1 1VBA3 5DDJ3 4CDUA 3DV8A 2TUNA 2UYAA 1BJQA 2WNVB 3PVOA 1QQP2 5BPXA 1HQNA 2D6NA 4YW1A 3AM2A 2OUJA 5E89A 3UJOA 3N7LA 3QH6A 4K3UA 4Q4Y1 1OPOA 2AENA 2WL1A 2DTWA 4Z07A 3USUA 2YMZA 5FBZA 2OA2A 2Q1ZB 1QY4A 4TYSA 5FDBA 1NYWA 2ET1A 2DUOA 4YM0A 1PK6A 5I93A 5GLTA 3W59A 4D69A 1D4M3 1OFSA 1AYM1 1TME1 1CR7A 2D98A 5IT6A 3OF1A 5KHJA 1S0JA 5BXXA 3JD73 3MF9A 1ZZ9A 3H7YA 1HXS1 1ZBE3 3KGLA 5LK5A 1X7NA 3POYA 4UW5A 2W39A 1WCSA 1Q8SA 3I4IA 3QD6A 2JJ6A 4RQPA 1FI2A 3MW3A 1F9KA 2BBVA 1KQRA 1MZ5A 4YVWB 1PO12 4IV1A 2IXHA 1VALA 3CJIA 2PHWA 1NXD1 2DV9A 5BNPC 2QE3A 3NSTA 4LA2A 4OI0A 3J9SA 1D2SA 1AR93 1OD5A 4LLOA 2Y0OA 1VBA2 2D6LX 2JG9A 5C4WB 1BVP1 1RUF1 3UKVA 3ZX7A 1HRI1 2ES3A 3FBYA 1UF2C 1YFXA 3C2UA 5FFOC 4QM8A 5KWRA 1W6MB 4TZDA 1H8VA 1LU2A 1XNCA 1GR3A 1QJU1 1AXZA 5T5JA 5J7MA 2PAMA 4NN0A 3VHRA 4HPKA 3FLRA 5EXOA 5BY5A 1ULFA 5I8YA 1GZ9A 4HZFA 4LR4A 3PVNA 3LOBA 5AC91 4AVBA 5CFDB 2D5FA 3VKOA 4GKXA 1F31A 1D4M2 5J98B 3SCHA 2EXIA 3UKNA 2ARXA 3RDIA 1SACA 4XFGA 3KB5A 5GLWA 3SMHA 1C8M2 4MH0E 3QCWA 4Q4X3 1I6XA 4Q4V1 3VBRB 3SH4A 2XUMA 1LULA 1V6JA 5JCTA 2B7YA 4QPGA 4YG3A 3AYDA 3B5LB 5H9RA 3HQXA 2AR6A 1QJZA 2PHFA 2ZACA 3VLBB 4KQ7A 1GZWA 2DCJA 3ZMNA 1UMZA 1IPJA 1PVXA 4M01A 3L2YA 2QZ2A 3I59A 2Q30A 2XLGA 1VBC3 4OZXA 2WT0A 2AGSA 1HQLA 2QJVA 1AF9A 1ASJ2 3S30A 4GKYA 1LENA 2CGOA 2IC1A 3EJKA 5CFCB 5DUWA 3NW4A 5J09A 2BYVE 1GYKA 3MFCA 4HBNA 2PQQA 3T1MA 3WLUA 3VBSA 3R6SA 1S0IA 2VULA 2HWF3 1WBFA 4CDUB 1BYHA 1IZ3A 4DINB 3M8LA 5FOBB 4BHPA 3CEWA 5J37A 4XF3A 1OQ1A 2GC1A 4P5HA 3R4DB 5ABJA 3ASIA 5EYXA 4B4PA 3VUOA 4HVOA 5JMCA 1SCSA 4L99A 3TAYA 4LT5A 1ULGA 1O7FA 3ZO0B 1R083 1DGLA 3E5XA 1ZZBA 3MIEA 5ACA1 4LBQA 1NA1A 1YJLA 3WQ1A 3MLLA 3M3CA 1OPMA 5SV8A 2HWC1 4N43A 4RQPB 1VBC2 2W68A 1ZRCA 2O0OA 5GZGA 3WR0A 2ETEA 1HX6A 2E7TA 2AREA 3RZZA 2YZ4A 2A6XA 2P3JA 3I8TA 3CJIB 3SH5A 4QPYA 1AXKA 2VOWA 5FLHA 4AI1A 4AVVA 4AW7A 1SCRA 1MS4A 1OOPA 4KWKA 3SLIA 3SNMA 5CIRA 2ZGLA 1K5MC 2XBO3 2HWF2 3ILNA 2PA7A 3JB4C 3SISA 3HT2A 1H2LA 1SLTA 5HI0A 1PO22 2W08A 4NWVA 3O0VA 2K0GA 4E9KA 1AVBA 1F8VA 3ENRA 3VHNA 1L3JA 4IEYA 3AP6A 2FQPA 4PLOA 3FC0A 1PZ9A 1V6IA 3ETQA 3OBTA 1H1IA 4FPEA 1RMU3 4CTEA 4HKWA 4TLFA 4XBNA 4P9GA 2AUYA 2VGDA 3NJZA 4KG8A 3VDDC 4QQ2A 3KCXA 2DUQA 4YARA 1N1VA 3ZYPA 4B4QA 1RUJ3 5JI7A 1GANA 3MI8A 1FV3A 1VBB2 5GLZA 3M3QA 4GIQA 2JDZA 1PM7A 2V5YA 4I0AA 1Q8VA 3NKGA 3FMGA 4W65A 3URFA 3RMYA 3WD5A 4LA3A 3H3UA 4WVMA 2JE9A 1CPNA 3WDTA 1VRH3 2D3PA 4K9SA 1O3SA 4AFMA 1YWKA 3WINE 3UKTA 4ES9A 1X33A 2MHFA 1B35B 3LZZA 2PHTA 4BIFA 4OHVA 4OI2A 4RA0A 2DURA 3MGUA 4DY5A 4MXVA 4MUVA 1PK6C 2QQPA 3VN4A 1ENQA 1V9U1 5C9AB 4PBOA 2WWSA 4QQLA 1EAH1 2XBO2 2XB6C 3HBZA 4M3CB 3KMHA 5FRAA 2ZHNA 1H9PA 1RUC3 3LB9A 1BBT1 2IXLA 1AL22 2BPA2 2YV8A 1FNYA 1Q5OA 2CAUA 3VBSB 4CRQA 4ISQA 2X5IA 4S2FA 1RUD1 2ZHMA 4HL0A 1ALYA 1REDA 1RUG3 1VBD1 1ULEA 3S0MA 4AI3A 3MZHA 1JBCA 4IV1C 1SQ4A 4AGVA 3BCWA 5BYNA 3CJIC 5C8CA 1DU3D 1OA2A 1WMDA 1CGPA 5DG1A 2CWMA 5KC6A 5K9YA 2HJIA 1J3RA 1NLRA 1X50A 2DCKA 2WS93 1RUJ2 3KT1A 3ROUA 5FMOL 4A7ZA 4G4FA 2HYKA 4L9BA 3EBRA 2ZHLA 1W0OA 4NVPA 2JG9C 1MQTC 3B93A 4XJ8A 2GSYA 1O3TA 4QXKA 1DBNA 1QJY2 1ZBA2 2HWD3 2ARBA 1EV11 1RVF1 1VLNA 3CNAA 4LO8A 3U11A 1COV2 4Y26A 2Q1MA 3OD4A 5LRSA 4BM8A 4LBQB 2UY9A 4LBMA 2VW2A 3TWIA 2MPFA 1ZZ8A 4BH9A 5FCCA 4N43B 3ES1A 4Q4Y3 4GQ7A 3IIAA 1A8DA 1C3HA 3WQ0A 3MF6A 4XTMA 1CAWA 1U12A 3KCCA 3HWJA 1HW5A 3VL8A 5JZGA 3O0WA 4KU8A 1OKQA 5DG2A 2NZ9A 4Y1UA 1RUOA 1WD4A 1R092 1ONAA 1C5IA 1TME3 4KWLA 3JBG1 3FUQA 1AXYA 2ZGKA 5FOJB 1OOPB 4WVZA 2YROA 1DQ6A 4K40A 5GJ6A 3VKFC 3VKLA 5E1RA 1PNGA 1HXS3 4AVSA 2CAVA 2EVXA 4QPGC 1I1EA 4YG0A 1EY2A 1XU2A 2WQ4A 4BQ1A 2QDNA 3NAPC 3ZSLA 5T3NA 1AJKA 4WZFA 4CEWA 4K1ZA 1G7YA 4HETA 1TMF1 2WS92 1NCQA 3JU9A 4BLJA 4IEVA 4MGZE 2E51A 3JZVA 3WHTA 4L8QA 2GNDA 2RMU3 4FPHA 2RHPA 1T6GC 3OGGA 4J1WA 2AH2A 2HWD2 1QH6A 3RJRA 3WDYA 2WA3A 3ST7A 2VNRA 3FWEA 1YFWA 4MGYE 2B45X 2JX9A 2DUPA 4L97A 4I0WB 1Q43A 3LA2A 4Q4Y2 4WVMB 3WOGA 3KQRA 2B5HA 4WM8A 5BNOB 2IXJA 1A6CA 3ZSEA 5AC93 2VQAA 2OZ6A 1JOJA 4IEQA 3VL9A 4LNVA 1OLQA 1DQ4A 2WZR3 1DGWA 3PVEA 3VBHB 1AYM2 1NXMA 5ABJC 1UCXA 4JGZA 4IEUA 4HVQA 1CJDA 4YM2A 3ZYJB 3V64A 2D6OX 4N53C 2XJVA 1HXS2 3P3PA 3RYPA 4A3XA 2Z5WA 3P3NA 2X53S 4ORFA 2ZHKA 3M1HA 1NA1C 1MVQA 1PO21 4XFHA 4FBFA 3AMNA 2X5IB 1NCRC 4Q1PA 1OA3A 4F3JA 5T52A 4H55A 3AZWA 1S2BA 3CF6E 3VHOA 5J36A 3THPA 1DF0A 2WNUA 1RJ8A 5C8CB 2GDFA 1MEC3 1V6MA 1QXJA 1XYOA 3WNXA 2VQ0A 3M3OA 1U5XA 3D8CA 4A7YA 3TB0A 1ENXA 1RUF2 3QACA 4LUMA 2R49A 4COYA 1HRI2 3IKWA 1BKZA 4XXPA 5BNNB 3WP4A 2WSVA 2BUKA 2IWGB 2FZ1A 5DZGA 1QJU2 3AFGA 4IEOA 1HKDA 2YGLA 4AQTA 1YIFA 2UYBA 1RHI1 2BQPA 3AKQA 2PAKA 4YGDA 3DKWA 2OYZA 2OW4A 2XJRA 1PGW2 2ZX1A 3WG3A 1AX2A 2R073 4LBLA 1DQ2A 3GZTB 3IBMA 4FXGB 4LBNA 2R0FA 1ZZCA 1F5JA 2RS51 2XKOA 1G9FA 2FHRA 5JZGB 2JEMA 4Q4V2 4FPYA 1DG6A 3EO6A 5GM0A 4U2AA 3IDBB 2R6QA 4Q0SA 1FV2A 1SLCA 2BVVA 2DFBA 1LOAA 3DGTA 3RYRA 3MEPA 3LGRA 1HIXA 2R041 5ACA3 1LU1A 5CAZA 1EP0A 1ZYBA 3MFAA 4AGGA 1IHMA 1YCIA 2UU8A 1WLTA 3H50A 1ND3C 2AYHA 4S2HA 4AEKA 4KNCA 2HWC3 4Q8KA 3D6EA 2WC2A 3MW2A 5FTTC 1ENRA 1LEDA 1LHWA 3TOJA 4CEWB 4TWTA 3D82A 4Y1XA 5JWPA 2B46X 4QPIA 4RGAA 1OI6A 1NCQB 4IL7A 3KZ4C 5JLVA 2ZGRA 1LJ7A 1YRZA 4L2NA 3AMMA 3C3VA 1IQAA 4PDWC 4Y20B 1W6MA 3AZYA 3WY6A 4ASMB 1V6NA 3FLPA 4BMEA 3T1LA 5DUUA 1COV1 1MS5A 5FAXA 2A6ZA 4HMZA 1QQP3 1O4ZA 4DS0A 4XE9A 4AI0A 1WMEA 4META 5CFDA