2RR13

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rr1300
3JD71 2XBO1 5BNPA 1V9U2 4Q4X1 4CDWA 4QPIB 5K0UA 1R093 3ZFFB 1BEV2 1F2NA 4CDUB 1RMU1 1RUE1 5J98B 2HWB1 2WS91 1GFF2 1D4M2 2R071 1FOD1 2HWF1 1BBT2 1OOPA 1VBA2 3ZFEC 1RUC1 1VBC3 5CFDC 1RHI3 4IV1A 4CDQC 3J8F2 4Y5Z0 5A32B 5FOJB 2BBVA 1TME2 4Q4W3 5K0UC 1C8M3 1R1A1 4N53C 4RFT0 1AR71 4RHV1 1F8VA 1VBD1 4CEYC 5ABJB 1OPOA 5BNPB 1BMV1 4PDWC 5FMOL 1K5MC 5FMOS 4CDWB 1RMU2 1RUE2 5CFCA 2HWB2 2WFF3 2WS92 3TN92 2R063 3NAPB 4RS5C 1EV11 1ZBA1 1OOPB 1PVC3 1PIV2 4IV1B 1Z7S1 5JZGC 1AL0G 1R1A2 5AC93 2ZTNA 1H8TC 1M06G 2FZ2A 1AR72 3VBFC 2HWE1 2RR12 3DPRA 4AEDB 1X33A 1NA1A 2VQ0A 2TBVA 4YVSC 4LLFA 5L7OA 1HRV1 5GKAC 2HWD3 5D8AB 2RS13 1RVF3 4WM7B 5CFCB 1AR91 1RUG1 1PO22 1MEC1 3VBRC 1PGW1 3VDDC 1ZBA2 1FPN2 4JGYC 1VB2A 1AR83 2RMU3 1HRI2 1QJY2 5ACA2 4FTBA 4FTEA 3M8LA 2HWC1 3VBSC 4WM8C 2RM21 1AR61 3DPRB 1B35A 3JBG1 4QPGA 1NA1B 4Q4Y3 1NCQC 1ND2B 1HRV2 2BFUL 1RUH2 1AYN3 4NWWA 1HXS2 2DF7A 4Q4V1 1AR92 1AL23 5BNOA 1RB8G 1RUF1 1COV2 2RS53 5BNNA 1R091 1NOVA 4YVWA 1FMD3 5DDJ3 1POV1 2R043 1AYM1 1QJU2 2HWC2 1X36A 1TMF2 1PO13 1VBC1 1RHI1 3VBUA 4CDXA 2X5IB 3S6PA 1RUD3 1MQTA 2RS33 1RUJ3 4Q4W1 4QPIC 3ZFFC 2MEV2 3ZXAC 4CDUC 1QQP3 2IZWA 1RUI3 3VBHB 1ZBE1 2GSYA 5ABJA 1RUF2 1VBE3 2WWSA 5BNOB 4JGZA 3HAGA 3CJIA 4RQPA 1ASJ2 4GMP1 5C4WA 3JB8A 5BNNB 2WFF1 4YVWB 1AYM2 2R061 1VBB3 1R083 3NAPA 2PLV3 5BNPC 3VBUB 5A33B 4CDXB 1MQTB 5AC91 4CDWC 4GB32 1VRH3 1ZBE2 3JD72 2XBO2 1DDLA 4AEDA 1V9U3 1OOPC 4Q4X2 4IV1C 2HWD1 4JGZB 2RS11 3CJIB 4RQPB 5D8AA 1BEV3 4WM7A 5C4WB 1D4M3 4EJRA 1BBT3 2R072 5LK7B 1FOD2 2HWF2 1VBA3 1AR81 1RUC2 2RMU1 3J8F3 1TME3 1E57A 1NCRA 5CFCC 4RHV2 1NY71 5C9AA 1VBD2 4Q4Y1 1BMV2 1ND2A 4N53B 1AYN1 1WCDJ 1RMU3 1RUE3 2HWB3 2WS93 1ND3A 4CEYB 1AL21 2BUKA 3TN93 2HWF3 2RS51 4PDWB 3DPRC 1EV12 1FMD1 1NA1C 5DDJ1 1PIV3 4N43A 2R041 1Z7S2 1R1A3 5L7OC 1CJDA 1EAH1 1AR73 1PO11 4IV3A 1PGL1 1NCRB 1VB4A 4RS5B 1RUD1 2RR13 2WZR1 1C8NA 2RS31 1RUJ1 2HWE2 2X5IA 5C9AB 4RR3A 5JZGB 3ZFGA 2BPA2 1H8TB 1QQP1 1RUI1 1QJX1 2BFUS 3LOBA 3VBHA 3VBFB 1ND3B 1PO23 1RUG2 1VBE1 1MEC2 1PGW2 1ZBA3 1FPN3 4YVSB 1OHFA 1B35C 1HRI3 4QPGC 1QJY3 5ACA3 4N43B 1EAH2 1VBB1 1NG0A 1CD3G 1R081 4GH4A 2PLV1 4IV3B 5BNOC 5A33A 2RM22 1AR62 3JBG2 4RR3B 4FSJA 1HRV3 5BNNC 1RUH3 4YVWC 1VRH1 1C8M1 1QJX2 3ZFGB 3VBOA 1HXS3 4WM8B 1AR93 4Q4V2 1V9U1 1COV3 3VBUC 4CDXC 3IDEA 1MQTC 1BEV1 5C8CA 1R092 4CEWA 1D4M1 1QJU3 2HWC3 2ZAHA 1SMVA 1AUYA 1TMF3 5ABJC 1VBC2 4GH4B 1RHI2 1PVC1 2XPJA 1TME1 4JGZC 4Q4W2 3CJIC 4RQPC 1C8M2 5C4WC 2MEV3 2WLPA 3VBOB 3ZFEA 5CFDA 1RUF3 4CDQA 3NAPC 2Y26A 1ASJ3 1POV3 4N53A 5C8CB 1RVF1 1AYM3 2WFF2 4CEWB 3TN91 4CEYA 2R062 4PDWA 1K5MA 1PIV1 1PVC2 4AEDC 1A6CA 5AC92 4GB33 5D8AC 1ZBE3 4WM7C 5J96B 2RR11 4RS5A 1POV0 3JD73 2XBO3 3ZFEB 5CFDB 4CDQB 5JZGA 4Q4X3 4GMP3 1H8TA 2HWD2 5K0UB 2RS12 1RVF2 1IHMA 3VBFA 1PO21 1NCRC 1FPN1 2R073 1FOD3 1HX6A 4YVSA 5C9AC 1RUC3 1K5MB 1HRI1 3FBMA 1AR82 1QJY1 5ACA1 2RMU2 1ND2C 1HQNA 2GH8A 3VBRA 3VDDA 4Z92B 1ND3C 4GMP0 4RHV3 4JGYA 1VBD3 1NY72 4Q4Y2 1RUH1 1HXS1 1QJZA 1AYN2 4N43C 3VBSA 4WM8A 2FZ1A 1AL22 1COV1 4IV3C 2RS52 3JB4C 1NCQA 1EV13 2X5IC 4RR3C 1FMD2 5DDJ2 3ZFGC 1Z7S3 1QJU1 2R042 1TMF1 2QQPA 3VBHC 3VBRB 1PO12 3VDDB 1PGL2 1RUD2 2HWE3 2WZR2 4JGYB 2RS32 1RUJ2 4NWVA 4SBVA 2MEV1 5L7OB 1QQP2 1RUI2 2ZZQA 3VBSB 1RUG3 1MEC3 1VBE2 4GH4C 4QPIA 1ASJ1 3ZFFA 1NCQB 4BCUA 4CDUA 1EAH3 3VBOC 1VAKA 1VBB2 1BBT1 2WZR3 1R082 1W39A 1VBA1 2PLV2 5A32A 1B35B 2RM23 4QPGB 3J8F1 1AR63 3JBG3 4FTSA 4GB31 4Y4YA 5C8CC 1QJX3 1VRH2 4CEWC 4Q4V3
chains in the Genus database with same CATH superfamily
2JB8A 4FPYA 1OVPA 1VMJA 4YLZA 4YFZA 3ZXKA 4UFJA 1D2SA 5FUPA 3ALQA 2ATFA 4ZZ8A 5KC6A 1JYVA 5K0UA 1QJEA 1R093 2CNAA 3W58A 4QDQA 2HWB1 2WS91 3AKPA 3KV4A 1CAUA 4LE4A 5LZ6A 1AX1A 2V4VA 4Y26A 1WBFA 2P6CA 4H2AA 2YBPA 3J7NA 4QB2A 1DIWA 1WLTA 2BU9A 3ZFEC 4DFSA 5CFDC 5JOXA 4IV1A 1OFNA 5A32B 1S4CA 5FOJB 1Q5OA 5IVFA 3QD6A 2BBVA 2GNBA 4NHMA 4Y33A 2NP0A 1R1A1 4IE6A 3HQXA 3QLQA 4E4HA 4AI9A 3PUSA 2PHRA 5FYYA 4CEYC 4I2OA 4M4RA 2G19A 2WUHA 2WO7A 3LPFA 3J7LA 2P3JA 1PNGA 4HVOA 4K20A 3I3MA 1QWRA 4ATFA 2C1FA 5FMOL 5FREA 3PU3A 2XVLA 4AI0A 2W2IA 1NKGA 2MNGA 4LUKA 2E33A 4L99A 3THDA 5F37A 1RUE2 1G8WA 4BLIA 5CFCA 5KXBA 2OVUA 4A3XA 3HJRA 4AI2A 3MFAA 2VCBA 5EHDA 3GGLA 4CU6A 2P3IA 5FYCA 4CCEA 1N1SA 2PAEA 4H14A 1X8EA 3ZN6B 1OOPB 1QF3A 2E7TA 5DG2A 3KSCA 2Y38A 3ME2A 4FXKB 1ENXA 4JKLA 1UIJA 4NMIA 1DCSA 4W6XA 1RIRA 2JG8C 2GC2A 3KQ4B 3VBFC 4Y1XA 2IXCA 4XC9A 3VL8A 1ZZ8A 2AH2A 4IDZA 4QPYA 2OKXA 4FO9A 3H8RA 1ZA4A 3OPZA 5FZCA 4NAMA 1JODA 5H9QA 1S0BA 1BVVA 2HWD3 3I54A 5FYIA 4AQTA 3B69A 4WZFA 2AGSA 4AGGA 1GICA 1LODA 1D4VB 3OB8A 1CESA 2NPIA 3GJBA 4AE2A 2AUYA 2YC0A 5A3LA 1PZ7A 1FPN2 4JGYC 4K1ZA 1LGBA 1H1IA 4NAOA 3I59B 1VB2A 4N90A 1BYHA 1HRI2 4KBBA 4HMZA 4W4ZA 3VDAA 4ZZ5A 1LENA 4CCKA 1JTZX 2XVKA 3VBSC 4MXVA 1VAMA 3PLQA 3HR9A 3VKLA 1MS1A 1SFPA 4J1XA 3H1WA 3CDZB 2VOTA 4X6QB 3H8UA 1W8OA 1HRV2 4I0BA 3M70A 2B8MA 3T09A 4NWWA 2EAKA 2DF7A 2OIIA 4YFWA 5DAVA 3A7QA 3VHNA 1AR92 1VMHA 5A80A 1W9SA 4LO7A 1RB8G 3POFA 1IG3A 1RUF1 2HBUA 1T6BX 3LEIA 3MW3A 4IW3A 2RS53 4XDOA 2VJXA 4Y22B 2WNUC 2WO2A 3ACHA 4COZA 1R091 4YVWA 1FMD3 1JS9A 1POV1 2OYZA 5IVEA 1KS4A 4CCNA 3FFQA 4Q0VA 1E5RA 1AYM1 3SQOA 1QJU2 3TEWA 3IB3A 4OHVA 2I45A 3NQHA 3N7LA 3IKWA 2MPFA 4UT5A 5KHGA 3VBUA 5FPLA 4Z82A 2X5IB 4J6GA 1RUD3 3RNSA 1MQTA 1SLTA 1HV0A 1U0AA 2GN7A 4XJAA 5FPAA 2EXKA 3UT0A 4WVWA 2XDVA 2XR4A 2YPDA 3ZN5A 3KB5A 3PTRB 2CAUA 4LBQB 1F4HA 1AXZA 2X10A 5K4LA 3WQ0A 5LWBA 1US2A 3LEGA 4O61A 2WKKA 3MLJA 4QX5A 5CYYA 5FY9A 3ES1A 3CJIA 3JZVA 5LK5A 5LW9A 1W2AX 3M3IA 4CUGA 4LORA 3AKSA 3H1MA 4AF9A 4NRQA 1RC6A 2ZHLA 1SFNA 4Z07A 3I3DA 2VTFA 3WUDA 4S2GA 3BVCA 3LF7A 1OPMA 2WQ8A 3L9JT 3C7EA 3AYAA 5CISA 5A7WA 4FPOB 1O7FA 5BNPC 4CDXB 1JN2P 2BWCA 4XABA 5FYMA 1LKNA 4CDWC 2VVFA 4TLFA 3OY8B 3WW3A 4KI5M 2QE3A 1ZBE2 1WW4A 3WEZA 1NX9A 1O5LA 4D0QA 3P5BA 1BK0A 5CKMA 3E97A 1DDLA 4LBNA 3AKTA 4GWNA 4XJWA 1V9U3 5BXXA 4MH0E 3ZXGA 3GM8A 4Q4X2 2HWD1 2VAUA 3WDYA 2RE9A 3GF6A 1I6XA 3ZYHA 4BMEA 4C0BA 4GALA 4D7YA 2OXBA 4P9IA 1F9KA 5A3WA 4C1WA 2R072 3VZKA 4EJRA 1FOD2 3KLSA 3A23A 3L2YA 4OQ9A 4AOCA 3I59A 3DECA 1W8TA 4YGBA 3GCXA 1F5JA 1X9PA 2SLIA 2W87A 4OMDA 1J58A 1X8MA 4NOTA 1NCRA 1WW6A 3WF0A 3PL0A 1DQ4A 3GHMA 3VDBA 5FZ7A 1SZBA 4E4ZA 2BVBA 3U4XA 1JYXA 1DYPA 3I3QA 2D3RA 4M0NA 4OHXA 1OQDA 4SLIA 4FT8A 1OBNA 1I9RA 3AKQA 5HV4A 4KG0A 3O12A 1N3QA 2VOVA 2WT2A 3TYJA 1UMIA 4JX0A 1GWLA 2WO1A 3PIJA 1OH3A 1OVSA 3I4IA 2QQNA 4CEYB 1CONA 2DTWA 3TN93 4CZSA 2CU5A 2RS51 2R49A 5C71A 4EROA 4RGAA 5LRRA 3I2OA 3DPRC 4EN9B 3HIFA 1FMD1 1NA1C 1W9YA 4DXZA 2IVJA 4I02A 4QQOA 3RSJA 4LUMA 1RXGA 1Z7S2 2ET7A 2W39A 3KF5A 3THCA 3S5QA 3DUIA 1AR73 4IEQA 1UYXA 2WNVC 3ECQA 2Z69A 2DFBA 1RUD1 4V2WA 2WZR1 5LB6A 1C8NA 2DVAA 2JICA 2X5IA 4M00A 2B45X 1NXMA 2IC1A 4XUQA 5F3EA 4B3NA 4DXSA 1G9BA 2BPA2 3BOPA 4P9GA 4FCAA 3O1TA 1QJX1 2EXHA 2PN5A 4CYDA 2BFUS 3VBFB 1XSRA 1PO23 1NLQA 3AVSA 1DZRA 2DYCA 2WN3A 1MEC2 4NROA 2ZACA 1Y9QA 1CQ9A 4QXKA 5CB7A 1OHFA 4P9WA 1AXKA 1W0PA 5EJ1B 5BUVA 2B7YA 1KFUL 2ZA9A 2WABA 4BQ5A 1QJY3 5FWJA 4BU2A 1QDCA 1EAH2 5IAVA 2PFWA 2VZ1A 3ZSEA 3SH4A 1HB2A 2AEYA 4GAZA 4QMAA 4GH4A 2IWGB 5LATA 3E6CC 4B1LA 4NPRA 4C90A 5BNOC 4LHLA 1OLQA 2FCUA 1PHMA 3KS7A 1KJRA 4COVA 1G86A 1RUH3 1BK1A 1ULDA 3ZFGB 4LKDA 1OLMA 5HXVA 1OA3A 5BY5A 3WINE 4OI2A 3UGFA 5E89A 5HXMA 1V9U1 4K6BA 5FR3A 4A7ZA 4YM0A 2B5HA 1SLLA 3GXUA 4XXPA 3URFA 4LA2A 4X8PA 3LKJA 2A6XA 1LU1A 4JTNA 1MVQA 2VZ3A 1YFUA 2D5HA 2ZCWA 3PVNA 3WP3A 4FFIA 3E6BA 4BLJA 5BV6A 2PHFA 2WA4A 4AQ6A 3LPGA 3D6EA 2DU1A 3NV3A 1TMF3 1YC61 1WW7A 4IGOA 2QKDA 3J7MA 2HYKA 3OUJA 2XPJA 2QDNA 5LCWL 4L11A 4S2DA 4JGZC 3E1F1 3TB0A 3M7AA 2UYBA 1DGRN 2XJUA 2D40A 1UXXX 4KWKA 3H7YA 2MEV3 5C4WC 1GOFA 3O1PA 1XYNA 1QU0A 3NJXA 2FDKA 3BPSA 1LOAA 1YEWA 2B39A 5FP8A 1N1TA 3VBOB 3POEA 3ZFEA 5CFDA 5JXIA 5FBJA 1UOBA 4QX7A 2ZMKA 2XLAA 4ET7A 5I8SA 1LOCA 3H3ZA 4XPVA 4D94A 1BXHA 1EY2A 1ZZ7A 4HKWA 2XHKA 1Z0HA 3VV1A 4Q0PA 2VULA 2XLFA 1O4YA 4ASMB 4XFIA 5CU1A 3Q8BA 3TN91 4CEYA 3H8XA 2LROA 4Y24A 1OI6A 3IBMA 4MGKE 4XFHA 2ZKNA 1WLDA 1PVC2 2BGPA 4CCDA 2OQ6A 1A6CA 3K75B 4XAAA 1IQAA 3WP4A 4XACA 3O14A 2YGMA 1LHVA 2GP3A 4GB33 4QQLA 1OURA 1G9AA 4MG2A 3USUA 1J84A 4WM7C 1O59A 3OGRA 4LBQD 3QOPA 4EZHA 2W3JA 3SHRA 4BYYA 1ULCA 2A5ZA 1SDDB 2ZGSA 4HOOA 4R4ZA 4CDQB 2YUEA 2R32A 5FPUA 3OEAA 2PHUA 1MPXA 4QU1A 1HN0A 2BDRA 3AP6A 5LBFA 4LMFA 4P00B 1NE4A 1HQWA 2JG8A 2W68A 3DKWA 1IHMA 3IAPA 1XNAA 3VBFA 1PO21 2D6LX 1ODMA 2YG0A 2DCTA 1XNCA 2P2KA 5A7SA 3K48A 4RD7A 2JDYA 1AJOA 4Z2AA 1VJ2A 5CZKA 4JDMA 3EBRA 3LA2A 1RJ7A 5JOYA 2RJLA 1RL3A 2VVDA 4Y1UA 4XMAA 3FBMA 1DFQA 1QJY1 3KVBA 3MIEA 2RMU2 1E5IA 4ZS3A 1S0FA 4URAA 5DABA 2VXRA 2GH8A 1JOJA 4IEUA 4QM8A 1UY3A 3K4AA 1WLWA 3KGZA 3MIHA 4RHV3 4JGYA 3X29B 1UX7A 4LBJA 5FMCA 4YZ1A 3EHKA 1CZSA 1EUUA 1A3KA 2VL4A 4PBOA 1MR5A 5EXOA 1QXPA 4Q4Y2 1RUH1 3B93A 3EQEA 3DGTA 1JYWA 2P17A 3A21A 2W08A 1PK6C 3LIHA 4QKBA 2VTXA 4N43C 4XDQA 5FZAA 1SLAA 3VBSA 4CUBA 4R52A 3P3PA 1F31A 1MS0A 3N4MA 1KS5A 4DPNA 1I5PA 4V2VA 2VQUA 1ENSA 1AL22 3TEXA 4IV3C 3LB9A 3CEWA 4N9IA 3ZYFA 4BJ0A 3OUHA 4YW6A 2HEWF 4PJYA 2YBSA 1CIYA 1EV13 3AMQA 4RR3C 4YG6A 5FYTA 2MHFA 2FQPA 2V5YA 2KA3A 1H4GA 3VZMA 2VZPA 4AHZA 3BN6A 2VU9A 4YRDA 1TMF1 5FP9A 4AYUA 4QQHA 1TG7A 3S0MA 1GZWB 2CDOA 4XIOA 4BHPA 1W90A 2WNUA 5IFTA 2J1RA 2VCAA 4AQSA 4GULA 5H9RA 2XWBB 1RUJ2 1OH4A 2NQYA 1Q3EA 2MEV1 3B7MA 5HBAA 1U5XA 2JIGA 4YGEA 1SPPA 1QQP2 4MGQA 4XYXA 4EN6B 2BOJA 4OZXA 4WVMB 1WD4A 4HT1T 2Y33A 2NN8A 3HPNA 1LHWA 1WW5A 4B1MA 1C57A 4GIQA 4HKLA 5FZ4A 1UQXA 3V0BA 2WZPP 3WQ1A 4XF1A 2JJ6A 1JZ3A 4J1WA 3AMNA 2ZABA 5C5TA 1WWYA 1XXNA 1UO9A 2Q30A 3M1HA 4FPGA 1NLRA 3Q9OA 3GBFA 2TUNA 4OCTA 2C4XA 1RITA 1R082 3FLRA 5FKBA 1VBA1 1HN1A 3MF9A 5JSPA 5FP3A 2ZX2A 2HJIA 4META 3ZDVA 1AR63 1YI9A 1KDMA 4GB31 5KHJA 4JC1A 5FY5A 5C8CC 1C5IA 2DVDA 1PZ8A 4CEWC 5KHIA 2GNMA 3BYWA 1U12A 2QQIA 1N1YA 2V73A 3OYWB 4PCRA 3B9IA 1XYPA 4OZOA 5BNPA 2V4AA 1UU6A 3RG0A 4XBLA 2PTMA 4CDWA 3OD4A 1BLZA 1NE6A 4I30A 2FCTA 1JZ6A 5GZEA 4CXXA 2FDHA 3KMHA 1N1VA 3ZFFB 1BEV2 2A3WA 2D98A 1RMU1 2W1WA 4GXLA 2YYOA 4Q2FA 3ZMNA 4B8EA 4UI9L 1Y3TA 3PNAA 5BPXA 1GFF2 1HQLA 3D3AA 2HWF1 3FX3A 1BBT2 1V6JA 4IE4A 2Q8EA 5KHKA 4XHBA 3I2HA 1K12A 1VBC3 1DG6A 1RHI3 2ZGUA 3D4KA 3NKTA 4FOYA 4XBQA 4UFKA 3J8F2 1QJFA 1KEXA 1Z78A 3P6BA 2E6VA 4YM2A 3WNLA 2BNMA 3ITQA 1C8M3 4O9EA 1OKQA 2AZ5A 2JDNA 2JECA 1W2NA 2Z2SB 3UL2A 4RFT0 3SXWA 1BJQA 1ZZ6A 4QGMA 4RHV1 3N9LA 1LR5A 4LK7A 4AI8A 3BKZA 3BIEA 1WKYA 2F4PA 3TEZA 4NRMA 3WT3A 4JHTA 3ON7A 2WLQA 3MLLA 1OPOA 1SLIA 2DBNA 3PUQA 1BMV1 4PDWC 3DXTA 5FZFA 2ZGQA 5FY0A 3HBKA 3CJXA 4JDNA 2RDRA 4XIKA 1V00A 2HEYF 3IDBB 3DF0A 2HWB2 2WS92 5ISLA 3V0AB 3PHMA 2VZRA 5DZFA 3MHZA 4B4RA 1I1EA 3NO8A 4RS5C 1EV11 1GNZA 4OI4A 1ZBA1 1OUXA 2XMLA 3C7FA 4Q8KA 3LSEA 2J1AA 4LTAA 4IEWA 4Q1PA 5E8AA 3RMYA 2WT0A 2E53A 3H9AA 4IV1B 3WHTA 3CU7A 2BEOA 3N35A 5FIXA 2G9FA 5JZGC 1R1A2 2OA2A 4ZXKA 5I8TA 4MGIE 1H8TC 4K9SA 4P5HA 3SEPA 2IXLA 4MGYE 5A7NA 1M06G 2FZ2A 3AP4A 2Y0OA 5I8YA 2ENRA 1GZWA 1YQ2A 2L9LA 1CVNA 2RR12 3DPRA 5GLVA 3ZSKA 5IW0A 3ZYJB 1NA1A 5J48A 3KV5A 4KWJA 1J3QA 2KD7A 2VQ0A 1F4AA 1JUIA 5HI0A 3CO2A 2WN2A 3P3NA 5GLUA 1P8JA 3D5OA 3WDUA 5FPXA 5F39A 2X8KA 4LO6B 2RS13 1RVF3 3QCWA 1Q8QA 4WM7B 1OA4A 1C5HA 1WA6X 2WNVA 5L9BA 5CFCB 3H3LA 2XKPA 1Y9GA 3N9MA 3VBRC 1ENQA 3N9PA 3AL5A 5KWRA 1VE0A 3MYXA 3E5UA 1QEXA 1HW5A 5IJRA 5CBLA 3FBYA 1C4RA 5DQ0A 1AR83 3I3EA 5GLWA 2ET1A 5HCAA 1Y4WA 4D3WA 5F2SA 4LO5B 2IUWA 4FTBA 3AC0A 1JW6A 3M8LA 1H1AA 4Q1RA 2QQUA 5FZBA 2HWC1 3WF2A 1A78A 5FWEA 2FDGA 2VGDA 1JZ7A 4LOSA 1AR61 3RZKA 4W65A 3I2FA 2VMDA 5A7PA 5KXDA 4Y1VA 1NCQC 4RA0A 3LA3A 3VKFC 2BFUL 2D7FA 5EV7A 4Y1YA 2F17A 1AYN3 4MZUA 1HXS2 1CAWB 5LA2A 2Y6FA 3HNBM 2ZEWA 5FZ1A 4OHYA 2WQ4A 2YY1A 5E16A 1DBNA 2NYYA 5BNOA 1OUSA 4Y20A 1OSGA 5HCBA 3VGIA 5JMCA 2XL9A 2CGOA 4LKSA 2EA7A 1NOVA 1GNYA 1C1FA 1LU2A 2JE8A 3MEPA 1YI7A 5FZIA 4HVQA 1W3XA 3O1MA 2IFRA 4JRAA 2QQKA 1OQEA 2W1QA 3B01A 1VBC1 1RHI1 4A3ZA 4PIXA 4YW5A 3KHBA 3JXSA 1UL9A 1H2KA 4QPIC 3I2JA 5JOZA 3FLPA 4IEOA 4CDUC 4BQWA 4DZGA 2V72A 2DUPA 1HLCA 4DRRA 4DO0A 2ZHNA 2GSYA 3ACLA 3NNJA 2JB4A 4E8CA 1A34A 1RUF2 2VZTA 4XUPA 3VDCA 1VBE3 2YFZA 2WWSA 4NRPA 3CHXA 1UXZA 1XYOA 4JGZA 4BIFA 4IE0A 1ASJ2 3H7JA 4GMP1 5C4WA 3NKGA 5GALA 4YVWB 3OBZA 3HT2A 4JZRA 1AYM2 3M3CA 1UOFA 5LY2A 3V0AA 5LRSA 3Q8AA 1H9WA 1RXFA 2Q1MA 4IXLA 4AAPA 3ZXLA 5L9RA 1RUOA 4FOQA 5IVCA 2V5DA 4D6RA 4PLMA 3WNKA 1U5YA 3VBUB 3ZR6A 5A33B 2XOMA 5IK7A 5C8WA 4E2SA 1MQTB 5C3OA 3ZYPA 2EIDA 1ZRRA 1B09A 3CZUA 4LOTA 2W46A 5FKCA 2OZ6A 2PHDA 1REDA 1QGLA 3L2HA 3POGA 5GZDA 1YUDA 2B46X 4MUVA 5KXEA 1SLCA 3H1YA 1XB9A 2XBO2 2YXSA 3JD72 1LEMA 1UNBA 1O4ZA 5T3NA 2G9GA 5H9SA 1Y9MA 2Y6JA 4EWAA 2A70A 2RS11 1NQDA 5FXWA 3I2IA 3CJIB 3M3QA 2DBIA 4WM7A 3GBWA 2NZ9A 2VW2A 2FDJA 2FHRA 5IVYA 2V09A 5F3GA 3VN4A 2UU8A 5LK7B 1HKDA 1TNFA 5CA6A 1AR81 3C7OA 1RUC2 2ZEZA 4UFHA 5A7WB 1ST8A 2I07B 1TE1B 2LW8A 3AP5A 1DLLA 4CPBD 1UWWA 1IS4A 1WMFA 3BIWE 1F5FA 1MZFA 3ROUA 4EN8B 3E5QA 1OLRA 5J1XA 2WSUA 3MIGA 1ZZCA 2ZX4A 2XJTA 1OMIA 1W6OA 2NLRA 3Q8FA 5DZGA 1VBD2 1YCIA 2X53S 3CKHA 5FZOA 4NN0A 4QAWA 2YBKA 4LIVA 4YG0A 4ZS2A 3SNMA 1GUIA 4M0HA 3RJRA 1AYN1 1WCDJ 4BZ4A 2ARBA 5T5PA 1RUE3 3MUY1 1CAWA 5F9TA 5JCTA 1ZZ9A 3H3UA 5FXXA 5FYVA 5FV3A 4D8MA 2D43A 4LJHA 4PDWB 4MO3M 3MF6A 5KC5A 1PK6A 3FUOA 4LT5A 4N43A 5JI9A 2WT1A 3BTAA 5SV5A 5L7OC 4KL1A 5FDBA 1ZZBA 1CJDA 4XILA 3SISA 4XEZA 3AYEA 3AXDA 1QH7A 3B02A 3O0VA 1NCRB 1AZDA 1I5ZA 1VB4A 3I2GA 4IV3A 4RS5B 5F6KA 1PGL1 1RTVA 5LASA 3IAQA 4PF1A 2HWE2 2P37A 3NNLA 4KWUA 4RR3A 3SH5A 4CP2A 5JZGB 1L3JA 4LHSA 4LBLA 4A2UA 1WCUA 4BQYA 1H8TB 5DAPA 4NHXA 1G7YA 2VW1A 2PHLA 3RJ2X 3DCQA 1HB4A 1FYUA 1AXYA 2AREA 5JI7A 3WW1A 4RN5A 1J83A 3A0NA 1RUG2 1VBE1 1O3QA 1FI2A 3NNFA 5FP4A 1PGW2 4GKXA 4M3CB 4S2HA 1FPN3 4O65A 3ZKUA 4NHKA 4YARA 1W6MA 5JXGA 2AENA 1B35C 1H30A 1SACA 1DHKB 2R1BA 1HRI3 4QPGC 2R16A 4QGNA 4EWEA 3VHPA 2K2SA 3AZWA 2IXKA 5AVPA 3UKVA 4HETA 4HSJA 3IZOA 3AJZA 3BCWA 1H1MA 4DUVA 1ULPA 1REFA 3PJQA 3RYRA 2X29A 5D2AA 5FAXA 4MADA 2YB7A 1X50A 1IPJA 5EPAA 5GZFA 2XJSA 4P02B 4QU2A 5A3OA 5A6ZA 5A33A 2RM22 3MUZ1 1VAVA 3JBG2 2J1VA 3TNQA 2VUCA 1HRV3 5BNNC 4AW7A 3PDQA 1QJX2 2UWCA 1VR3A 4AEJA 3QH6A 5A3TA 5GZCA 3IWZA 1AR93 4Q4V2 2R0HA 3T4VA 2W95A 1SCRA 2OPKA 4QX8A 3ZO0B 4CCMA 4CCOA 3FLTA 5IT6A 4YPJA 2O8QA 2A7AA 1UZZA 3IDEA 3VZOA 3VZJA 3AYCA 5C8CA 2QFEA 5LBCA 2DVGA 4CEWA 4E27A 1QJU3 5CNAA 3SEEA 5JOWA 2I2SA 2ZAHA 4P5YA 3AZZA 2A6WA 1YIFA 4AFBA 1CAXA 1OF4A 3NW4A 4AI1A 2ZPXA 5ABJC 4GH4B 1JYNA 1LOEA 4NVPA 5IK8A 3ZKYA 1E5HA 3S5AA 4Q4W2 4RQPC 1XRUA 2WR9A 2G1MA 3THPA 5JPNB 2OPWA 4ZU7A 2WNEA 4QWNA 2BZDA 2D6MA 2DWRA 2R6QA 2X05A 5JSRA 4LBOA 3B9CA 1KFXL 3SMHA 4YZ4A 2YHJA 2VR4A 5FK7A 1L7RA 3DYPA 4YW1A 4IE7A 3SITA 4ASLA 3AP7A 1NZCA 2WFF2 5JDBA 3MBWA 4Q5OA 4CCCA 3CZJA 4BMBA 3VZNA 2R062 2ORXA 4NIHA 3JCIA 1CWPA 3KV6A 2ZOEB 4PDWA 3ZSLA 4MGSA 3NRUA 3VB9A 3AMPA 4AEDC 1GV9A 5F8PA 5AC92 5I91A 5FO9B 4O9GA 3ST7A 1XU1A 5D8AC 1ZBE3 3O1SA 1RJ8A 1S2EA 1TNRA 5J96B 4Z2WA 4W6WA 2XJQA 4RS5A 1LOFC 3ILRA 3T1MA 3HEIA 3ZFEB 5CFDB 2WWJA 2XJPA 2DCKA 5JZGA 1SBFA 1UKRA 3K46A 4Q4X3 3UKNA 3PIGA 2VW0A 2VMCA 1H8TA 4TYSA 2JDUA 4EN0A 4GKYA 1NUKA 3M3OA 4L92A 1OFSA 5ANQA 4P9JA 1Y43B 3OOXA 1FPN1 2R073 3N3HA 1FOD3 2PQSA 4M3CA 3U4SA 2RDSA 4XW3A 4CUCA 5C9AC 1HRI1 2PAMA 5FCCA 2AEZA 1ND2C 5F5QA 1S0JA 3ZPOA 2JX9A 1VRBA 3VBRA 3AVRA 1ND3C 3USUB 1GOGA 3KGLA 1WGPA 3A0KA 4UW3A 4BQ2A 5EWSA 2RDNA 4Y4RA 1NY72 5E88A 2JE7A 2HH9A 4ISQA 4CP0A 1UMZA 2UYAA 3WUCA 2WZ8A 5DXDA 4LULA 2ARCA 1LTEA 3NV1A 4PT6A 4RL7A 4IEPA 1BKZA 1YQ8A 3DN7A 3EB7A 4R9AA 4Q26A 3ETPA 2JG8B 4Q0UA 3N36A 1ZRIA 2C0ZA 3PJYA 5C5UA 3FHQA 4DB5A 2ORZA 4WBBA 3NL1A 1XNDA 3KT4A 4Z8BA 1HIXA 1O6UA 1NCQA 3JU9A 1JUHA 5HPOA 4DOUA 5C3SA 2LUWA 5DDJ2 4BH9A 1Z7S3 1QJU1 2VMIA 2R042 3MI8A 5T5JA 1ZRCA 4K8FA 3VBHC 4E8DA 1XE0A 3KCYA 1OXCA 1AX0A 1PO12 3MW4A 4LIUA 2JENA 4COUA 5AFEA 1G9CA 1GNHA 2ZX0A 4K7JA 2WAOA 2F6BA 1FNZA 4JGYB 5I0RA 5F32A 2RS32 3WX5A 4NIGA 3O7OA 4A4AA 4M3CF 4PF5A 5L7OB 3GCWA 2FDIA 4AVSA 4CUAA 4LHKA 1RUI2 4LR4A 3VD4A 4E2QA 3VBSB 4FPEA 1ZA7A 2ZS6B 4P14A 1ACCA 2AYHA 4D6SA 1MEC3 1V6OA 5FXZA 3W5NA 4QPIA 1DQ2A 1LHUA 3NWKA 4CDUA 2QVSB 3H0OA 1DF0A 1EAH3 4QQPA 3OGJA 4W50A 3SKVA 1REEA 2ES3A 1VBB2 2BYVE 4FVVA 2WZEA 1W39A 4QDSA 2PLV2 3ZXEA 1APNA 1B35B 2WNUB 4BXSV 4CTEA 4QPGB 3LQCA 3WCSA 5F3IA 3PUIA 1W0OA 2Q1ZB 3ELNA 1VRH2 1CPNA 3C7HA 1SPPB 4G4FA 2VMEA 2DTYA 3O1VA 2YMZA 2GMMA 1UMHA 3AYDA 4I0AA 1S0DA 4Q4X1 1UYYA 1H4HA 5F3CA 4XQWA 4TXWA 3H8OA 3WDWA 1Y7BA 2VQTA 4DXTA 3JQXA 3V0BB 3BUCA 1CZTA 1F2NA 1AHSA 5C7GA 4HPKA 5C3PA 1GP4A 2KR2A 5J98B 1NLSA 1JYCA 4QD2A 2PELA 3ZDSA 2VXJA 1D4M2 2R071 3T0DA 3IM0A 4GWIA 1FOD1 3FC0A 3LD8A 5SV8A 4BE3A 3AMMA 2E9QA 3PTYA 5FBZA 4FAHA 5JIAA 1VBA2 1J3RA 3ZXJA 4AEKA 3PURA 3BGAA 2C6SA 2JDZA 1N3PA 4Y5Z0 4AVAA 4DEQA 1TME2 2BNNA 1YQ6A 5K0UC 4V1PA 2DU0A 2R7EB 3G6JB 4GWJA 4XF0A 3ETQA 4UBHA 2LM3A 2CV6A 1AR71 1EYBA 4FPJA 3U78A 2BTVC 3W20A 1F8VA 2RHPA 4RSUA 2WFPA 1MZ5A 4N8MA 5ABJB 1FV3A 2EIEA 4BPZA 3U1XA 5CG9A 2CDPA 5JLVA 2JG9C 2YDEA 4I3GA 5FZ8A 3WW4A 3ZSJA 1DGWX 1WCQA 5BNPB 1K5MC 1G9FA 3JUUA 3KM5A 3THTA 2EF6A 5FMOS 3UYJA 4FAGA 4CDWB 5JR2A 2E31A 1KRIA 4ZHNA 4FPCA 1LESA 3GZEA 3K51A 4MHUA 5FK8A 1RMU2 2VUJA 4NJ4A 5HCHA 5IFPA 1JHNA 2HBTA 4JAAA 4GD4A 2Q8DA 2BBAA 2JDPA 1UY4A 3POYA 2I74A 2Q8CA 1XU2A 3ZYGA 4ZU4A 2VC9A 3IDAA 4OVEA 1UCXA 2E63A 2P1BA 1PVC3 4OI1A 2D6KA 1SFYA 2VNRA 1PIV2 3K3OA 1TQ5A 2JEMA 1Z7S1 4N7UA 3WCRA 1ZREA 4TZDA 1F35A 4H55A 2VM9A 4QX1A 5BYNA 3VHOA 5A6YA 3IPVA 1WZXA 3RWKX 2FMYA 1S0IA 4KGGA 3ASIA 4ONUA 3TRSB 2YGLA 3HMYA 5DZEA 2VY0A 1AVBA 2FMDA 4U2AA 4AEDB 1RUNA 3UJQA 4MLOA 4XFGA 2WYSA 4YVSC 4CE8A 4LLFA 5L7OA 5EJZB 5D8AB 1O8SA 3UGHA 5JPMB 1DU3D 1NZIA 3ACIA 1O91A 2B42B 4OHZA 2IVIB 4Y3OA 1MEC1 1LHNA 4B7KA 2WA3A 3VDDC 3FJSA 4AHXA 1UPIA 1ULEA 1ZBA2 2PQQA 4IERA 5CVRA 5F6LB 5GM0A 4W6YA 3MIFA 2RMU3 3HQRA 3POBA 3K2OA 5ACA2 3MLKA 4FTEA 3GZAA 2Q1FA 3HNMA 2DCJA 2VBPA 2YZ4A 4WM8C 4XF4A 3Q8EA 1T2XA 2HLEA 4AQ2A 2SBAA 2QDRA 5FO7B 1GZTA 3DPRB 1B35A 1YWKA 1YYNA 2DVBA 4NPLA 4QPGA 1NA1B 1FNYA 2YU2A 4Q4Y3 2WJSA 1ND2B 1UAIA 1UKGA 4OMCA 3QH7A 1BCXA 4XJUA 5CKQA 4EWDA 4JCKA 5A3MA 2GALA 4QGLA 1TZOA 2XWJB 2WNVB 2CWSA 1YIPA 2DCZA 1AL23 2WWUA 3M3EA 1COV2 5FMBA 1XBFA 3GZTB 1GYKA 4JDOA 2JE9A 3ORJA 2AC1A 2YV8A 5BNNA 3QBQA 1UU5A 2R30A 3KF3A 1K45A 3LSDA 1AX2A 2E51A 4MYEA 2X09A 4QXCA 1GQGA 5HCFA 4FBFA 1FATA 2OQ7A 2HWC2 1YFXA 3RFRA 2GC1A 1X36A 4TN7A 3J9SA 1UY0A 4WVZA 5BNQA 2C5DA 3AJYA 3ATGA 2JKBA 3SCGA 2ZGOA 1NXD1 4YWAA 2CL2A 1RUJ3 5FFOC 3OGSA 4IESA 5CEHA 4K21A 4H7MA 4BIOA 3ZXAC 4XUTA 5T5LA 3HN1A 2VBDA 1QQP3 3HT1A 4AXOA 1IS3A 1N3OA 2PYTA 2VUAA 3VBHB 1M4WA 1Q56A 4EQVA 3U10A 5ABJA 2WL1A 2BNOA 1ULOA 4INDA 3IMNA 2AR6A 4R9CA 4LO4B 1S1AA 5BNOB 4HN1A 4FP3A 2C24A 4MVTA 3HD8B 4Y20B 4R9BA 1SCSA 3HAGA 2HYXA 4RQPA 5FP7A 3SLIA 3T1LA 4BOWA 5L36A 3JB8A 4F8AA 5JUVA 2Y64A 5I0DA 4XZPA 4BWOA 2QBXA 1W9WA 1XE8A 1PVXA 1OD5A 2VCCA 3AM2A 2FBEA 2P3YA 3UKTA 3RPQA 4LNVA 1IS6A 1R083 2F4LA 3OJBA 1A8MA 2W91A 2ID4A 2CTVA 1POQA 3ZIWA 5JXJA 5L19A 1QOOA 2KM2A 1EPWA 1SG3A 3OBRA 5A1FA 3OBAA 5GLTA 3R4DB 2W52A 4QHBA 5FY1A 1EPZA 2LS6A 3T2TA 1QH6A 5DUVA 3U0ZA 1ZYBA 3O0WA 1S0GA 3NJYA 1ZVFA 3KHCA 4UBGA 2E26A 5IWFA 5A3NA 4AEDA 4LBKA 3MO4A 3ZYBA 1OKOA 1OOPC 5DN2A 2GMPA 3I49A 4JGZB 4QX3A 2C9KA 4LEJA 2A75A 5FYBA 3T2QA 3APBA 1EP0A 3MW2A 1BEV3 5D8AA 3LCPA 2CHHA 3CIHA 4EYUA 5C4WB 2IXJA 3IIIA 2VCMA 2Q8OA 1LOFA 4AHWA 4ARXA 1TEIA 4OUEA 2WC2A 1BBT3 4PQQA 1PM7A 4LQRA 5JXHA 3AFGA 2GN3A 3AXEA 2RMU1 3J8F3 5FZEA 3S57A 2BVVA 1W2OA 2TEPA 4F83A 2HKXA 4OLLA 1E57A 4B4QA 1BQPA 5J7MA 3WW2A 3ZVXA 3ILNA 4GJZA 3LEMA 3EO6A 1N47A 5LA1A 1SQ4A 3O1RA 3GJAA 2Y6HA 3WSOA 1K5JA 5C9AA 1WLCA 3WNNA 4EZ4A 4Q4Y1 3VZLA 2WIIB 1BHGA 1ODNA 5DUUA 1IKQA 2A73B 5FZ6A 1ND2A 4UYBA 2YPJA 2H0VA 2FCVA 4GWMA 4AI3A 4CVUA 2HWB3 2WS93 1ND3A 5E6HA 4FFGA 4XF3A 3RRDA 2FD8A 1AL21 4UW6A 1KITA 2BUKA 1O3TA 5IVBA 1UZWA 4ES8A 5K7PA 3K4ZA 1PMIA 1ZRDA 4YM1A 2Y0IA 1Q8OA 2ERFA 5IAXA 2E32A 1GBGA 1R1A3 4XFCA 2K9ZA 2D6NA 2Z5WA 1XNTA 1WMEA 3AL6A 5FY8A 4AAXA 5J09A 3R05A 4AVTA 4XOGA 3UNPA 4G3YC 2XJVA 2XQRA 2RR13 5LY1A 1FAYA 4X6RB 1RUJ1 1W6OB 3PU8A 2RV9A 4URTA 3ZR5A 2ZXQA 5FZOB 4MHRA 4KWLA 1MZEA 2G4IA 5C6CA 1URXA 1QQP1 4B29A 2W1SA 3LDBA 3VBHA 2P34A 5FZ9A 3KWVA 4FFFA 2Z79A 4LA3A 4XAEA 4XVHA 2EIGA 4XCAA 4QPWA 1S2KA 1XQNA 4YVSB 4Z1VA 1SLBA 5G04L 2EAAA 3OEBA 4ZKTB 1W8WA 4ZPIA 1PK6B 1UPSA 5A6QA 4N43B 4DS0A 1W6QA 3LWCA 5F5IA 3VKNA 2D44A 1NG0A 5LEJA 1CD3G 1R081 3NNGA 4UF0B 2D6PA 4IV3B 2VMGA 1JH5A 1IPSA 3ABZA 1QOTA 2VZUA 2IFWA 2ZHKA 4RR3B 4XBNA 4FSJA 2W47A 3T08A 3UV9A 1C8M1 3AFKA 4TSVA 1HXS3 1VIWB 4WM8B 1X82A 2FDFA 2VPVA 2PAKA 3SCFA 1XNKA 2O14A 1OA2A 4DUXA 4E4SA 1D2QA 5FPZA 1LGNA 4XJ8A 5DAXA 3OF1A 4CDXC 5J36A 1UD1A 4TWTA 1W04A 1IPKA 1BEV1 2VNOA 4A41A 1W6MB 1R092 2RG4A 2QQOA 4OHWA 1CAVA 4CP1A 3RGBA 1JZ4A 2W5FA 5FOBB 1SMVA 1WMXA 3CBNA 5EYXA 4CU8A 1JYTA 4G9SB 1QMJA 2UWAA 5LBBA 1MS8A 2ZMNA 4GQ7A 5DPNA 3UJOA 3WVJA 5IVJA 4IL7A 1UZYA 3B00A 4IEZA 5D21A 4LITA 1A8DA 1LHOA 3ES4A 4MXWA 3T30A 2ZMLA 2W0XA 4XURA 2J42A 4PI0A 1W9TA 2P3KA 2ZZJA 4XFBA 5FY7A 4LLOA 5FYHA 2EICA 4Q27A 1W03A 3FUQA 2QQJA 2VOXA 1RUF3 4A44A 4JKKA 4QXBA 1CGPA 4ISRA 3BTXA 1QHDA 3NAPC 2CWMA 1OC1A 4PHZA 4QDRA 3POSA 2XB6C 1ASJ3 2DUQA 1POV3 3MFCA 2B9UA 1YNAA 5C8CB 1RVF1 1AYM3 3R6SA 4CEWB 2ADDA 2JD4A 3D0JA 2ZJCA 5I0SA 2BOIA 2ZX3A 1PGSA 1Q43A 1DGWA 2JG9A 1GOHA 2WAAA 4ZY9A 1WCKA 1UIKA 1K5MA 1ULFA 3HN3A 4KU8A 4AFAA 5DMYA 1LAJA 1CAXB 3MV01 5IK5A 2W9XA 2J1EA 2ZGLA 4UWDA 4LKEA 2EXJA 3UETA 3B94A 4M01A 1IOAA 4MGTA 1QXJA 2YFUA 3AK0A 1JU4A 1LCLA 4BK4A 1JZ5A 4QB1A 2YC2A 1RGSA 3R4SA 4NPMA 5GLZA 2RR11 3UGGA 1LECA 4QT6A 4YW4A 3U75A 2J1SA 1POV0 3JD73 2XBO3 4MX3A 5DAQA 3FZ3A 1UY2A 3KZ4C 1SBEA 2D3PA 1YLLA 2N7GA 3CLPA 1UY1A 4CU9A 3RQ0A 1F15A 2HWD2 3BODA 4TTGA 3IT8A 2PHWA 3FL7A 4UXAA 4YZ3A 4X8NA 4K1YA 1X9TA 4WVVA 1HX6A 2QNKA 2ARAA 2QTWB 4YVSA 1GSLA 2RVAA 1RUC3 3LIGA 3E5XA 3WHUA 3D82A 1CR7A 4CA9A 5CG8A 3OG2A 4BXFA 2RJKA 2ZGKA 4RGKA 4L2NA 4UAPA 1QKQA 5A1LA 2CGPA 1KXGA 1QNYA 2WO3A 2BGOA 2WINB 2EXIA 4TLGA 4AEMA 4AK3A 3VDDA 4Z92B 1YO8A 1PNFA 1J59A 4UF0A 1VBD3 5A7OA 3ZYRA 4CSWA 2VOKA 1QOSA 4KU7A 1H8VA 5F7UA 2UURA 4IE5A 1FV2A 5TSWA 4ZONA 4AR2A 1PZ9A 1HXS1 2LTNA 1LB2A 1W99A 3H42B 3CMGA 1J3PA 4WM8A 4JKMA 2D5FA 4UFMA 1W8UA 3MIDA 2YC4A 5JR7B 1ULGA 2BP6A 3WDTA 3ACGA 3DYOA 2RS52 4HXCA 4WV8A 3JB4C 1LJ7A 2Y34A 2OZJA 4QXHA 4I0WB 3WF4A 1HJGA 2PXJA 3ZN4A 1FMD2 1WMDA 4IQPA 3I3BA 3ZFGC 3UESA 3NV4A 3RDIA 3RZLA 4A7KA 1S55A 4AZZA 3ZSMA 4HG6B 3VBRB 2QQPA 2B9VA 3V64A 3B5LB 1RUD2 1L7QA 2HWE3 2WZR2 3AZYA 4NWVA 2ZEXA 3GYDA 3TAYA 5LA9A 1Q8PA 2AACA 3A4UA 2GDFA 4YSFA 3SKJE 5C70A 4HK9A 2UY8A 4Q8LA 1LRHA 4XUNA 4FOWA 5LBEA 5IYYA 1RUG3 2EALA 1IKPA 3NV2A 2Z4FA 2DDUA 1R1ZA 1V6IA 1QIQA 1LULA 4HVRA 4I09A 1ASJ1 4LBMA 4NHYA 2QUOA 3LOIA 2D97A 1NCQB 3UK9A 3B3QE 1GP6A 3DYMA 2PMWB 3USSA 3VBOC 1VAKA 4HL0A 2CY6A 2XQXA 2WZR3 4LKFA 1DP0A 3DEMA 4BB3A 1WA4A 5A32A 3BI3A 1CJPA 4IETA 2RM23 1S2BA 2BGCA 3LA7A 5FO8B 3ILFA 1LEDA 3I97A 3JBG3 4FTSA 2XUEA 1O8PA 4YW3A 4MV2A 1DYKA 1H2MA 4Y4YA 4CRQA 4LK6A 1QJX3 3H50A 4NHLA 3MGUA 3BTZA 3WNPA 1RYYA 4Q4V3 5B2GB 1G9DA 3JD71 2XBO1 3K77A 3LFIA 4D6QA 4IGQA 1T6GC 1V9U2 5C3RA 4YW7A 3OUIA 5KR7A 2QQWA 3D0SA 4YYOA 4C8DA 1O5UA 4JRLA 4QPIB 5CKNA 2J22A 1FX5A 4CDUB 5IVVA 1RUE1 1VMFA 3OGGA 2BW8A 4XHXA 5CAZA 1UOJA 1D0GA 3LZZA 1W06A 2XH6A 3ZOIA 1W05A 2K0GA 3ZN6A 3TEYA 1H2NA 1OOPA 1K3IA 5J37A 1RUC1 1O3RA 3OBTA 4QX2A 5ERLA 4CDQC 2VZOA 4MSVA 2O1QA 4KBZA 4Q4W3 1C3HA 2OT7A 5I0TA 4AFDA 2GC0A 4N53C 2A3XA 2ETEA 3LDRA 1LOGA 1OF3A 5EP9A 4QKNA 1W28A 2WBKA 3F2ZA 3DKQA 1U5IA 1VBD1 5B4XA 2BRTA 2G9ZA 1ZNPA 4R8HA 1MS4A 5FUNA 4COWA 2Y6LA 4JV4A 4YG3A 5FZKA 2PHTA 1UOGA 4BISA 4CXYA 3CL1A 4WZCA 2YROA 2H6CA 5L9VA 5FRAA 4LE3A 3ZX7A 2BQPA 2GAUA 2WFF3 3G7DA 4ES9A 4FQZA 4XMIA 3LEKA 1YFWA 3N7MA 4HPKB 4D69A 2WDBA 3TN92 2R063 2ZGRA 3SH3A 5T54A 5HV0A 4OQ8A 5DG1A 3WDXA 1JYIA 3BU7A 3NAPB 3NJVA 1V6LA 2Q0AA 5F2WA 5FLIA 2VTXJ 1S0EA 1Q8VA 2HEVF 1IG0A 2VECA 1O3SA 2P6HA 2DURA 4GZ9A 3FN9A 1ZM1A 3WNMA 1AL0G 5AC93 2ZTNA 4M3CE 1AR72 2XJRA 3KVAA 1KGYA 3INAA 3ZMOA 4DXRA 2HWE1 3WG2A 1UF2C 2BJSA 1X33A 3WF3A 3ZXDA 1VLNA 2D93A 3RYKA 5JVVA 4BA6A 3AKRA 2TBVA 4PIYA 4ATEA 2BWAA 1HRV1 5GKAC 4HKOA 4AGVA 4AGRA 4L9BA 4HN0A 4NIAA 2W1UA 3N7KA 5G05L 5C3QA 1AR91 1RUG1 2E7QA 1R64A 4A42A 1PO22 1VPHA 4Q29A 5E1RA 1PGW1 2OUJA 1HV1A 2LRPA 2P5BA 4Y22A 2JDKA 2VUDA 3GZUC 1V6KA 3SC7X 2GP5A 4W8JA 3AZXA 5FYSA 3BPZA 1UX6A 5CADA 2WSVA 1QJY2 1W2UA 1MVEA 4UW4A 2ZAAA 5A70A 3ACFA 1QNWA 2ZX1A 5FPVA 3AX4A 4NO4A 4AHYA 4DIQA 4XUOA 1DZQA 3OD0A 1YQCA 4KMQA 1PMJX 3WD5A 3IPVB 1IGOA 1MS9A 2CGNA 4JHZA 4CCJA 3RZJA 3ZLIA 3PVEA 1DGRA 2RM21 4XQ4A 1D7PM 3JBG1 1GLHA 1Q8SA 2NMNA 2GU9A 4DINB 2O8OA 1W6PB 3WY6A 1RUH2 2CSGA 5AVAA 1W6NB 3TBDA 3WQ7A 3O1UA 4LBQA 2JWPA 4Q4V1 5DAWA 5FZDA 5FZHA 4AG4A 3EMRA 2QQLA 5T52A 3I7DA 3SCHA 3ZM8A 3VKOA 1SBDA 3J26N 4HLTA 2A6YA 2P4EA 3ZIXA 4BQ1A 1XE7A 3VUOA 1KQRA 1DQ0A 1G6NA 2JDMA 1H6XA 4XXAA 3GALA 1UU4A 5IHRA 4E4DX 5DDJ3 1OLME 4YZ2A 3U37A 1OQ1A 4XJ9A 4QB6A 1STMA 4HFSA 1JU3A 2R043 5T55A 5T50A 2Y8KA 4FP2A 4H3WA 4XDPA 4FOVA 2NM1A 3WQBA 2QQMA 1TMF2 2XHNA 5H9PA 1GMMA 1PO13 2EIBA 5FY4A 4CDXA 5FZLA 4KNCA 3S6PA 2VH9A 2RS33 1E5SA 4DY3A 4XTMA 4PLNA 1LOBA 4Q4W1 1VP6A 3OY8A 5FXVA 3ZFFC 5JSOA 2MEV2 2PHXA 5ANNA 5APAA 3LE0A 2IZWA 1RUI3 5EJ3A 1ZBE1 1WUVA 3WDVA 4GJYA 4B7EA 5DUWA 4MGZE 4AL9A 1XOYA 1PX3A 2ZKLA 5A3PA 1X7NA 5EIYB 4P9LA 1DQ6A 5FQ0B 3VLBB 4AFCA 3MPBA 2OX0A 2OUHA 3F95A 1XSQA 5K9YA 4A7YA 3W59A 5BNNB 2WFF1 3ENRA 2GH2A 4HONA 2VOWA 3V56A 1CPMA 1ENRA 2R061 4CXWA 1YXWA 4OUMA 1JXNA 1VBB3 4JVAA 3PMSA 3NAPA 2PLV3 1HB3A 2TNFA 2Y6KA 3MZHA 3TNPB 5A1AA 5AC91 3KD4A 2QZ2A 4UOJA 4BK5A 1UW8A 5FZMA 3LAGA 1KJLA 2WQZC 4GB32 1SDWA 1VRH3 3GDBA 2Y60A 1W8ZA 1W8HA 5C33A 3T0BA 3NSTA 4N9HA 2A6VA 3MDPA 3BOWA 5JIUA 2VD7A 2D3SA 5L73A 2VZSA 1YHFA 5FYUA 3O1OA 3NJZA 4NR1A 4IV1C 4P9XA 4XZUG 3WV6A 2E7AA 3A22A 2QQVA 1GKBA 4RQPB 3LFMA 3T3YA 4XQDA 3WP5A 4B4PA 5AFBA 1IS5A 4FPHA 3PUAA 2VG9A 4K8RB 4PBPA 5EQUA 3PUHA 3EJKA 3BALA 1D4M3 4DEVA 5F5CA 1US3A 3Q8CA 3U14A 2HWF2 1VBA3 5M0TA 1NT0A 4UFIA 4I01A 3WG4A 2WYFA 1MACA 1QDOA 4F3JA 1TME3 3OGVA 3KCXA 4FFHA 2XG3A 2IXHA 2ZHMA 4N7IA 4A6SA 4HZFA 5EZWA 4BDVB 3IN9A 5CFCC 3VL9A 2A71A 3JQWA 4EV0A 4RHV2 3TWIA 1NY71 3C2UA 1JZ2A 1C1LA 1U5ZA 1O4TA 4UFLA 2XVGA 4F7ZA 2J1UA 1IQDC 3RS6A 4AVCA 3LGRA 1BMV2 4IGPA 1W6PA 4YM3A 1KDKA 4N53B 2EVXA 3W9AA 3WF1A 1W8FA 1RMU3 1W6NA 3C7GA 3PVOA 2RDQA 3LDKA 2JIJA 2XKOA 4XJZA 4OULA 2YU1A 3MV11 2VNVA 4XFFA 1JI6A 3T2PA 2HWF3 4PQ9A 5A6XA 1L7LA 2QCSB 5B4NA 3HOBA 3EXUA 3KV9A 3HVDA 1EV12 2VZVA 5DDJ1 1PIV3 1W3VA 4DRVA 3AZVA 1AF9A 3CNAA 4BM8A 2R041 2A1XA 2KXLA 1H6YA 2GZWA 4OI0A 4NIIA 3DV8A 2C26A 5FZ0A 4C91A 1EAH1 5IATA 1PO11 3MPPG 1GQPA 3M2MA 3OCPA 2ARXA 4D7SA 5KXCA 1GANA 2RS31 3FWEA 2VBBA 5C9AB 2ILMA 4YGCA 3VD5A 3V65A 3OTFA 2J1TA 1CZVA 3ZFGA 2BV4A 3J7HA 4K40A 4OUSA 4P08A 4AWDA 1RUI1 4ASKA 3POIA 3W21A 1W8NA 4JTOA 4C0HA 5K8SA 3RZGA 1ZRFA 3LOBA 5EYYA 4FPKA 4BQ3A 4HK8A 2XUMA 2A3YA 1ND3B 4R4XA 4RYDA 1DGLA 2OS2A 1ZBA3 3DXUA 3RMXA 1RINA 5FQ0A 1GZCA 3NNMA 1MS5A 4LPLA 1QY4A 1I3HA 2ZGTA 3IIAA 3VD3A 5ACA3 2GMEA 4PLOA 1QXRA 3OPTA 2Y6GA 4Q0QA 1OT5A 4Q0SA 1NQJA 1VBB1 2IXIA 2PLV1 4H7LA 4A45A 3N9QA 2BERA 5T5OA 5J3UA 3WNXA 3HNYM 1AR62 2A6ZA 3K4DA 1GR3A 2VE1A 4YVWC 1VRH1 2W92A 2GNTA 3VBOA 3HWJA 4HANA 4YW2A 1D0HA 1NAEA 4CP9B 4L0PA 3RZMA 4EE2A 1ALYA 5FMDA 1COV3 3KT1A 3ZXFA 1OD3A 1UYPA 3S7IA 3VBUC 2XGXA 1JBCA 1MQTC 3U11A 1CN1A 1VALA 1HB1A 1WD3A 5FZGA 3E6DA 4M4PA 4LXLA 3WG1A 5A3UA 2J7MA 1SEFA 4OYUA 1GQHA 1D4M1 2DCYA 4I3PA 5LA0A 1DQ5A 2K46A 2HWC3 3GHNA 5GJ6A 4BQ4A 1W6QB 3RZHA 1AUYA 1SHWB 1GZ9A 4FPFA 3IMMA 3FFZA 2XLGA 4COYA 1JZ8A 1VBC2 1H9PA 1RHI2 1PVC1 2LALA 1TME1 4S2FA 5F5AA 5EFUA 4YZ5A 1KD7A 1AJKA 1W9FA 2OW4A 4XF9A 3CJIC 4YNIA 1BZWA 1C8M2 3BB6A 2O0OA 3ZYIB 2H0BA 2WLPA 2WNOA 1V70A 2JXAA 4UW5A 2JDHA 3PVBB 3WR0A 1UN1A 3U07A 5D1IA 4FPLA 1LGCA 2JDAA 4CDQA 3S7EA 5FLJA 2DFCA 2R1DA 4GA9A 2Y26A 3PMEA 4AFMA 4N53A 4P9YA 4KH9A 1GWKA 4QHZA 3T4HB 4NUBA 1XNBA 1XJAA 3AP9A 3CQOA 3J4UH 4KG8A 1S0CA 3R4UA 1CIWA 1CAVB 1EUTA 1HDKA 1PMHX 4L8QA 5IUQA 3FHIB 1DZTA 2ZBJA 3K3NA 4LO8A 4XE9A 3I2KA 2W94A 2PA7A 1V0AA 2XXZA 1H2LA 1PIV1 3T2OA 1JOBA 3FE5A 5FYZA 3R0RA 2QJVA 2ADEA 5CIRA 4A6OA 3WLUA 1C28A 1GP5A 4QHOA 3VD9A 1V6NA 1FT9A 4JQRA 4O7XA 4MXWB 1JHJA 3BTYA 1LNSA 4RFRB 3DL3A 5FLHA 3OPWA 4DQAA 4LHNA 2NMOA 2DUOA 3RVHA 1YJKA 2C9AA 2ZGPA 4ORFA 4OFGA 1BVP1 4CU7A 4DNYA 4GMP3 1YRZA 3RI8A 4XTPA 5FZ3A 5K0UB 2RS12 1RVF2 3S30A 4ITCA 3O0XA 3RYPA 2VO5A 4CCLA 1CAUB 3C8XA 1NCRC 4AVBA 1CX4A 4R9DA 3O5SA 1H0BA 4AVVA 4QQ2A 1JOPA 2JG9B 4U36A 3WXPA 1K5MB 1AR82 5ACA1 3AMHA 1UYZA 1MS3A 2VVEA 1HQNA 4KQ7A 4ZXEA 3WOGA 4DMIA 4DUWA 2RJ2A 5FJKA 2UY9A 1WBLA 1XPWA 1PM4A 4D7TA 2JKXA 4GMP0 4BQXA 1ONAA 2VZQA 4C1XA 5JMOA 3BU0A 2D6OX 1V6MA 5F1RA 1ZX5A 2ZEYA 3FHAA 2DVFA 3M4FA 3NMBA 4E9KA 5GZGA 4FI9A 3HQUA 1XC6A 1MZ6A 2VQAA 3QACA 3AB0A 4JQTA 1QJZA 1AYN2 1GWMA 2ZGMA 4WVMA 2FZ1A 3VHRA 1DQ1A 3WG3A 1W0NA 3N9NA 5FJHA 3EYPA 3VD7A 1UZ0A 4CP9A 5KBFA 1COV1 1DLCA 4IEVA 1HJFA 5FUIA 4PIZA 4J25A 4K3UA 2Q5TA 1JMUB 4HSLA 1J1TA 2B4KA 2X5IC 4ARYA 2VMHA 3KT7A 5JWPA 4QM9A 1J1LA 4RGGA 4QKDA 3C3VA 4IUGA 4ZU5A 4KGQA 4IEYA 1IZ3A 3I2DA 3POJA 3RZZA 3VKMA 3W5MA 1TVGA 3GNEA 3ZPYA 3OSDA 3VDDB 1PGL2 4L97A 4XFAA 1K42A 4IEXA 4Y5TA 3TOJA 1FXZA 2CAVA 4XCBA 2VMFA 4CPBA 1YJLA 3I8TA 3MICA 4QKFA 2JD9A 2H6BA 2XL7A 4SBVA 3GBGA 3IDCB 2XONA 3N7JA 3T0AA 2ZZQA 3N9OA 3OYWA 5FPBA 5FTTC 2CYFA 2GC3A 4Y1ZA 4E2GA 2UWBA 2GNDA 1UZVA 3RWNA 5IK4A 3NVCA 1VBE2 1DYOA 4GH4C 3CF6E 4NE9A 4PI2A 2QZ3A 5I0UA 1YFYA 2Q4SA 1NYWA 3ZFFA 4BCUA 3KQRA 4XETA 2VNGA 4DY5A 3D8CA 5LEKA 3MIBA 3P1IA 1W2TA 3POWA 1WCSA 4YGDA 4Y5SA 1CX1A 4MOAA 2ZGNA 1BBT1 2DV9A 4FXGB 3FMGA 1GU3A 4NIDA 5DUXA 4FQ4A 1YQ5A 4EN7B 2Z42A 3J8F1 3WP6A 3RI9A 5JAXA 3HBZA 2R0FA 3WZ1A 3WNOA 4HBNA 3KCCA 2WRAA 5KHHA 5I93A 5A7QA 4QX0A 1PX4A
chains in the Genus database with same CATH topology
4FPYA 4YLZA 4YFZA 3ZXKA 1D2SA 3ALQA 2ATFA 5KC6A 5K0UA 1R093 2CNAA 3W58A 2HWB1 2WS91 3AKPA 1CAUA 4LE4A 1AX1A 4Y26A 1WBFA 3ZFEC 1DIWA 1WLTA 4DFSA 5CFDC 5JOXA 4IV1A 1OFNA 5A32B 5FOJB 2BBVA 1Q5OA 3QD6A 2GNBA 4NHMA 2NP0A 1R1A1 3HQXA 3QLQA 4I2OA 2PHRA 4CEYC 2P3JA 1PNGA 4HVOA 4K20A 1QWRA 4ATFA 2C1FA 5FMOL 5FREA 2XVLA 4AI0A 2MNGA 4LUKA 4L99A 1RUE2 1G8WA 4BLIA 5CFCA 5KXBA 2OVUA 4A3XA 4AI2A 3MFAA 2P3IA 1N1SA 2PAEA 4H14A 1X8EA 3ZN6B 1OOPB 1QF3A 2E7TA 5DG2A 3KSCA 3ME2A 4FXKB 1ENXA 1UIJA 4W6XA 1RIRA 2JG8C 2GC2A 3VBFC 4Y1XA 2IXCA 3VL8A 1ZZ8A 2AH2A 4QPYA 4FO9A 1ZA4A 3OPZA 5H9QA 1S0BA 1BVVA 2HWD3 3I54A 4AQTA 3B69A 4WZFA 2AGSA 4AGGA 1GICA 1LODA 1D4VB 5A3LA 1CESA 2NPIA 4AE2A 2AUYA 2YC0A 1PZ7A 1FPN2 4JGYC 4K1ZA 1LGBA 1H1IA 3I59B 1VB2A 4N90A 1BYHA 1HRI2 4KBBA 4HMZA 1LENA 1JTZX 2XVKA 3VBSC 4MXVA 1VAMA 3PLQA 3HR9A 3VKLA 1MS1A 4J1XA 3H1WA 4X6QB 3H8UA 1HRV2 4I0BA 3M70A 2B8MA 4NWWA 2EAKA 2DF7A 2OIIA 4YFWA 3VHNA 1AR92 4LO7A 1RB8G 1RUF1 3MW3A 2RS53 4Y22B 2WNUC 4COZA 1R091 4YVWA 1FMD3 1POV1 2OYZA 1KS4A 3FFQA 4Q0VA 1AYM1 1QJU2 4OHVA 2I45A 3N7LA 3IKWA 2MPFA 5KHGA 3VBUA 4Z82A 2X5IB 4J6GA 1RUD3 3RNSA 1MQTA 1SLTA 1HV0A 1U0AA 2GN7A 4XJAA 2EXKA 4WVWA 3ZN5A 3KB5A 2CAUA 4LBQB 1AXZA 3WQ0A 2WKKA 3MLJA 4QX5A 3ES1A 3CJIA 3JZVA 5LK5A 3M3IA 3AKSA 3H1MA 4AF9A 1RC6A 2ZHLA 1SFNA 4Z07A 3WUDA 4S2GA 1OPMA 3L9JT 3AYAA 4FPOB 1O7FA 5BNPC 4CDXB 1JN2P 2BWCA 1LKNA 4CDWC 2VVFA 4TLFA 3OY8B 3WW3A 2QE3A 1ZBE2 1WW4A 1O5LA 3E97A 1DDLA 4LBNA 3AKTA 4GWNA 4XJWA 1V9U3 5BXXA 4MH0E 3ZXGA 4Q4X2 2HWD1 3WDYA 2RE9A 3GF6A 1I6XA 4BMEA 4C0BA 4GALA 4D7YA 4P9IA 1F9KA 4C1WA 4EJRA 2R072 3VZKA 1FOD2 3KLSA 3L2YA 3I59A 4YGBA 1F5JA 2SLIA 1J58A 1X8MA 4NOTA 1NCRA 1WW6A 1DQ4A 3GHMA 3U4XA 4E4ZA 2BVBA 1DYPA 4M0NA 2D3RA 4OHXA 1OQDA 4SLIA 4FT8A 1I9RA 3AKQA 4KG0A 3O12A 1N3QA 2VOVA 2WT2A 3TYJA 3I4IA 4CEYB 1CONA 2DTWA 3TN93 4CZSA 2RS51 2R49A 4EROA 4RGAA 5LRRA 3DPRC 4EN9B 3HIFA 1FMD1 1NA1C 4DXZA 4I02A 4QQOA 3RSJA 4LUMA 1Z7S2 2ET7A 2W39A 3DUIA 1AR73 4IEQA 2WNVC 3ECQA 2Z69A 2DFBA 1RUD1 2WZR1 1C8NA 2DVAA 2JICA 2X5IA 4M00A 2B45X 1NXMA 2IC1A 4B3NA 1G9BA 2BPA2 3BOPA 4P9GA 4FCAA 1QJX1 2EXHA 2PN5A 4CYDA 2BFUS 3VBFB 1PO23 1DZRA 2DYCA 1MEC2 2ZACA 1Y9QA 1CQ9A 4QXKA 5CB7A 1OHFA 4P9WA 1AXKA 1W0PA 5BUVA 2B7YA 1KFUL 2ZA9A 1QJY3 1QDCA 1EAH2 2PFWA 3ZSEA 3SH4A 4QMAA 4GH4A 2IWGB 3E6CC 4NPRA 4C90A 5BNOC 4LHLA 1OLQA 1PHMA 3KS7A 1KJRA 4COVA 1G86A 1RUH3 1BK1A 1ULDA 3ZFGB 5HXVA 1OA3A 5BY5A 3WINE 4OI2A 5E89A 1V9U1 4K6BA 4A7ZA 4YM0A 2B5HA 1SLLA 4XXPA 3URFA 4LA2A 4X8PA 3LKJA 2A6XA 1LU1A 4JTNA 1MVQA 2ZCWA 1YFUA 2D5HA 3PVNA 3WP3A 5BV6A 3E6BA 4BLJA 2PHFA 2WA4A 4AQ6A 3D6EA 2DU1A 3NV3A 1TMF3 1WW7A 2QKDA 2HYKA 2XPJA 2QDNA 4L11A 4S2DA 4JGZC 3TB0A 3M7AA 2UYBA 1DGRN 2XJUA 2D40A 4KWKA 3H7YA 2MEV3 5C4WC 1XYNA 1QU0A 1LOAA 2B39A 3VBOB 1N1TA 3ZFEA 5CFDA 2ZMKA 2XLAA 5I8SA 1LOCA 3H3ZA 4XPVA 4D94A 1BXHA 1EY2A 1ZZ7A 4HKWA 2XHKA 1Z0HA 3VV1A 4Q0PA 2VULA 2XLFA 1O4YA 4ASMB 4XFIA 5CU1A 3TN91 4CEYA 4Y24A 1OI6A 3IBMA 4MGKE 4XFHA 2ZKNA 1WLDA 1PVC2 1A6CA 1IQAA 3WP4A 3O14A 2YGMA 1LHVA 4QQLA 4GB33 1G9AA 3USUA 4WM7C 4LBQD 3QOPA 3SHRA 4BYYA 1ULCA 2A5ZA 2ZGSA 4R4ZA 4CDQB 2YUEA 2R32A 2PHUA 3AP6A 1NE4A 1HQWA 2JG8A 2W68A 3DKWA 1IHMA 3VBFA 1PO21 2D6LX 2DCTA 1XNCA 2P2KA 3K48A 4RD7A 1AJOA 1VJ2A 4JDMA 3EBRA 3LA2A 1RJ7A 5JOYA 2RJLA 1RL3A 2VVDA 4Y1UA 4XMAA 3FBMA 1DFQA 1QJY1 3MIEA 2RMU2 1S0FA 2VXRA 2GH8A 1JOJA 4IEUA 4QM8A 1WLWA 3KGZA 3MIHA 4RHV3 4JGYA 3X29B 4LBJA 4YZ1A 3EHKA 1A3KA 4PBOA 1MR5A 5EXOA 1QXPA 4Q4Y2 1RUH1 3B93A 3EQEA 3DGTA 2P17A 2W08A 1PK6C 4N43C 4XDQA 1SLAA 3VBSA 4R52A 3P3PA 1F31A 1MS0A 3N4MA 1KS5A 4DPNA 1ENSA 1AL22 4IV3C 3LB9A 3CEWA 4N9IA 2HEWF 4PJYA 1EV13 3AMQA 4RR3C 4YG6A 2MHFA 2FQPA 2V5YA 2KA3A 1H4GA 3VZMA 4AHZA 2VU9A 4YRDA 1TMF1 4AYUA 4QQHA 3S0MA 1GZWB 4XIOA 4BHPA 2WNUA 4AQSA 4GULA 5H9RA 2XWBB 1RUJ2 2NQYA 1Q3EA 2MEV1 3B7MA 5HBAA 1U5XA 4YGEA 1QQP2 4XYXA 4EN6B 4OZXA 4WVMB 1WD4A 4HT1T 2NN8A 1LHWA 1WW5A 1C57A 4GIQA 4HKLA 3V0BA 2WZPP 3WQ1A 4XF1A 2JJ6A 4J1WA 3AMNA 2ZABA 1XXNA 2Q30A 3M1HA 4FPGA 1NLRA 3Q9OA 3GBFA 2TUNA 1RITA 1R082 3FLRA 1VBA1 3MF9A 5JSPA 2ZX2A 2HJIA 4META 1AR63 1YI9A 1KDMA 4GB31 5KHJA 4JC1A 5C8CC 1C5IA 2DVDA 1PZ8A 4CEWC 5KHIA 2GNMA 1U12A 1N1YA 2V73A 3OYWB 4PCRA 3B9IA 1XYPA 5BNPA 3RG0A 1UU6A 4XBLA 2PTMA 4CDWA 3OD4A 1NE6A 4I30A 5GZEA 3KMHA 1N1VA 3ZFFB 1BEV2 2A3WA 2D98A 1RMU1 4GXLA 3ZMNA 2YYOA 4Q2FA 4B8EA 1Y3TA 3PNAA 5BPXA 1GFF2 1HQLA 5KHKA 2HWF1 3FX3A 1BBT2 1V6JA 4XHBA 1VBC3 1DG6A 1RHI3 2ZGUA 3D4KA 3NKTA 4FOYA 4XBQA 3J8F2 1Z78A 2E6VA 4YM2A 2BNMA 1C8M3 4O9EA 1OKQA 2AZ5A 2CGPA 2JECA 2Z2SB 3UL2A 4RFT0 3SXWA 1BJQA 1ZZ6A 4QGMA 4RHV1 4AI8A 1LR5A 2F4PA 3WT3A 2WLQA 3MLLA 1OPOA 1SLIA 1BMV1 4PDWC 2ZGQA 3CJXA 4JDNA 4XIKA 1V00A 2HEYF 3IDBB 3DF0A 2HWB2 2WS92 3V0AB 3PHMA 5DZFA 4B4RA 1I1EA 3NO8A 4RS5C 1EV11 1GNZA 4OI4A 1ZBA1 4Q8KA 3LSEA 4LTAA 4Q1PA 4IEWA 5E8AA 3RMYA 2WT0A 2E53A 3H9AA 4IV1B 3WHTA 3CU7A 2BEOA 3N35A 5JZGC 2G9FA 1ZRCA 1R1A2 2OA2A 4ZXKA 5I8TA 4MGIE 1H8TC 4K9SA 4P5HA 1M06G 2IXLA 4MGYE 2FZ2A 3AP4A 2Y0OA 5I8YA 2ENRA 1GZWA 2RR12 3ZSKA 1CVNA 3DPRA 5GLVA 3ZYJB 5J48A 1NA1A 4KWJA 1J3QA 2VQ0A 1JUIA 5HI0A 3CO2A 3P3NA 3WDUA 5GLUA 3D5OA 5FPXA 2X8KA 4LO6B 2RS13 1RVF3 3QCWA 1Q8QA 4WM7B 1OA4A 1C5HA 2WNVA 5CFCB 2XKPA 3VBRC 1ENQA 5KWRA 3MYXA 3E5UA 1HW5A 5CBLA 3FBYA 1C4RA 1AR83 5GLWA 2ET1A 5HCAA 4D3WA 4LO5B 4FTBA 1JW6A 3M8LA 1H1AA 4Q1RA 2HWC1 1A78A 2VGDA 1AR61 4W65A 5KXDA 4Y1VA 1NCQC 4RA0A 3LA3A 3VKFC 2BFUL 2D7FA 5EV7A 4Y1YA 1AYN3 4MZUA 1HXS2 1CAWB 4OHYA 2WQ4A 2YY1A 5E16A 1DBNA 2NYYA 5BNOA 4Y20A 1OSGA 5HCBA 3VGIA 5JMCA 2XL9A 2CGOA 2EA7A 1NOVA 1C1FA 1LU2A 3MEPA 1YI7A 4HVQA 2IFRA 4JRAA 3B01A 1OQEA 1VBC1 1RHI1 4PIXA 4YW5A 1UL9A 1H2KA 4QPIC 5JOZA 3FLPA 4IEOA 4CDUC 4DZGA 2DUPA 1HLCA 4DRRA 2ZHNA 2GSYA 3ACLA 1RUF2 1VBE3 2WWSA 4BIFA 1XYOA 4JGZA 1ASJ2 3H7JA 4GMP1 5C4WA 3NKGA 5GALA 4YVWB 3HT2A 1AYM2 3M3CA 3V0AA 5LRSA 1H9WA 4IXLA 2Q1MA 3ZXLA 1RUOA 4FOQA 4PLMA 1U5YA 3VBUB 5A33B 5IK7A 5C8WA 4E2SA 1MQTB 3ZYPA 1ZRRA 1B09A 2OZ6A 2PHDA 1REDA 1QGLA 3L2HA 5GZDA 1YUDA 2B46X 4MUVA 5KXEA 1SLCA 3H1YA 2YXSA 2XBO2 3JD72 1LEMA 5T3NA 1O4ZA 2G9GA 5H9SA 4EWAA 2A70A 2RS11 1NQDA 3CJIB 3M3QA 4WM7A 3GBWA 2NZ9A 2VW2A 2FHRA 2V09A 3VN4A 2UU8A 5LK7B 1HKDA 1TNFA 5CA6A 1AR81 1RUC2 2I07B 1TE1B 3AP5A 1DLLA 1WMFA 1IS4A 3ROUA 3BIWE 1F5FA 1MZFA 4EN8B 3E5QA 1OLRA 2WSUA 3MIGA 1ZZCA 2ZX4A 2XJTA 1OMIA 1W6OA 2NLRA 5DZGA 1VBD2 1YCIA 2X53S 4NN0A 4YG0A 3SNMA 4M0HA 3RJRA 1AYN1 1WCDJ 4BZ4A 2ARBA 5T5PA 1RUE3 1CAWA 5F9TA 5JCTA 1ZZ9A 3H3UA 2D43A 4PDWB 3MF6A 5KC5A 1PK6A 3FUOA 4LT5A 4N43A 5JI9A 2WT1A 3BTAA 5SV5A 5L7OC 4KL1A 5FDBA 1ZZBA 1CJDA 4XILA 3SISA 4XEZA 3AYEA 3AXDA 1QH7A 3B02A 3O0VA 1NCRB 1AZDA 1I5ZA 1VB4A 4IV3A 4RS5B 5F6KA 1PGL1 1RTVA 2HWE2 2P37A 4RR3A 3SH5A 4CP2A 5JZGB 1L3JA 4LBLA 4A2UA 1H8TB 1G7YA 2VW1A 2PHLA 3RJ2X 1FYUA 1AXYA 2AREA 5JI7A 3WW1A 3A0NA 1RUG2 1VBE1 1O3QA 1FI2A 1PGW2 4GKXA 4M3CB 4S2HA 1FPN3 4NHKA 4YARA 1W6MA 2AENA 1B35C 1H30A 1SACA 1DHKB 2R1BA 1HRI3 4QPGC 2R16A 4QGNA 4EWEA 3VHPA 2K2SA 3AZWA 2IXKA 5AVPA 3UKVA 4HETA 4HSJA 3AJZA 3BCWA 1H1MA 1REFA 3PJQA 3RYRA 2X29A 5FAXA 1X50A 1IPJA 5GZFA 2XJSA 4QU2A 5A33A 2RM22 1VAVA 3JBG2 3TNQA 1HRV3 5BNNC 4AW7A 1QJX2 2UWCA 1VR3A 4AEJA 3QH6A 5GZCA 3IWZA 1AR93 4Q4V2 2R0HA 3ZO0B 1SCRA 2OPKA 3FLTA 5IT6A 2O8QA 2A7AA 1UZZA 3IDEA 3VZOA 3VZJA 3AYCA 5C8CA 2QFEA 2DVGA 4CEWA 4E27A 1QJU3 5CNAA 5JOWA 2I2SA 2ZAHA 3AZZA 2A6WA 1YIFA 4AFBA 1CAXA 3NW4A 4AI1A 5ABJC 2ZPXA 4GH4B 1LOEA 4NVPA 5IK8A 4Q4W2 4RQPC 1XRUA 3THPA 5JPNB 4ZU7A 2WNEA 2R6QA 2D6MA 2DWRA 5JSRA 4LBOA 3B9CA 1KFXL 3SMHA 4YZ4A 2YHJA 4YW1A 3SITA 4ASLA 3AP7A 1NZCA 2WFF2 5JDBA 4BMBA 3VZNA 2R062 3JCIA 2ZOEB 4PDWA 3ZSLA 3AMPA 4AEDC 1GV9A 5AC92 5I91A 5FO9B 4O9GA 3ST7A 1XU1A 5D8AC 1ZBE3 1RJ8A 1TNRA 5J96B 4Z2WA 4W6WA 2XJQA 4RS5A 1LOFC 3ILRA 3T1MA 3ZFEB 5CFDB 2XJPA 2DCKA 5JZGA 1SBFA 1UKRA 4Q4X3 3UKNA 2VW0A 1H8TA 4TYSA 4EN0A 4GKYA 3M3OA 4L92A 1OFSA 4P9JA 1Y43B 1FPN1 2R073 3N3HA 1FOD3 4M3CA 4XW3A 5C9AC 1HRI1 2PAMA 5FCCA 1ND2C 5F5QA 1S0JA 2JX9A 3VBRA 1ND3C 3USUB 3KGLA 1WGPA 3A0KA 4UW3A 5EWSA 1NY72 5E88A 2JE7A 4ISQA 4CP0A 1UMZA 2UYAA 3WUCA 5DXDA 4LULA 1LTEA 3NV1A 4RL7A 4IEPA 1BKZA 3DN7A 4R9AA 4Q26A 2JG8B 4Q0UA 3N36A 2C0ZA 3PJYA 4DB5A 4WBBA 3NL1A 1XNDA 3KT4A 4Z8BA 1HIXA 1NCQA 3JU9A 1JUHA 4DOUA 2LUWA 5DDJ2 4BH9A 1Z7S3 1QJU1 2VMIA 2R042 3MI8A 5T5JA 4K8FA 3VBHC 3KCYA 3MW4A 4COUA 1AX0A 1PO12 1G9CA 5AFEA 2JENA 1GNHA 2ZX0A 4K7JA 4JGYB 2F6BA 1FNZA 5I0RA 3WX5A 2RS32 3O7OA 4M3CF 4PF5A 5L7OB 4AVSA 4LHKA 1RUI2 4LR4A 4E2QA 3VBSB 4FPEA 2ZS6B 4P14A 2AYHA 1MEC3 1V6OA 4QPIA 1DQ2A 1LHUA 3NWKA 4CDUA 2QVSB 3H0OA 1DF0A 1EAH3 4QQPA 3OGJA 1REEA 2ES3A 1VBB2 2BYVE 4FVVA 1W39A 2PLV2 3ZXEA 1APNA 1B35B 2WNUB 4CTEA 4QPGB 3WCSA 1W0OA 2Q1ZB 3ELNA 1VRH2 1CPNA 4G4FA 2DTYA 2YMZA 2GMMA 3AYDA 4I0AA 1S0DA 4Q4X1 1H4HA 4XQWA 3WDWA 1Y7BA 3V0BB 3JQXA 1F2NA 1AHSA 4HPKA 5J98B 1NLSA 1JYCA 4QD2A 2PELA 3ZDSA 1D4M2 2R071 3IM0A 5SV8A 1FOD1 3FC0A 4BE3A 3AMMA 2E9QA 3PTYA 5FBZA 4FAHA 5JIAA 1VBA2 1J3RA 3ZXJA 4AEKA 2JDZA 1N3PA 4Y5Z0 4AVAA 1TME2 2BNNA 5K0UC 4V1PA 2DU0A 3G6JB 4XF0A 3ETQA 4UBHA 2LM3A 2CV6A 1AR71 1EYBA 4FPJA 2BTVC 1F8VA 2RHPA 4RSUA 2WFPA 1MZ5A 5ABJB 1FV3A 4BPZA 5CG9A 5JLVA 2JG9C 2YDEA 4I3GA 5BNPB 3WW4A 3ZSJA 1DGWX 1K5MC 1G9FA 3JUUA 3KM5A 3THTA 2EF6A 5FMOS 1KRIA 4FAGA 4CDWB 4FPCA 1LESA 3K51A 1RMU2 2VUJA 1JHNA 4JAAA 3POYA 2I74A 1XU2A 3ZYGA 4ZU4A 4OVEA 1UCXA 2E63A 1PVC3 4OI1A 2D6KA 1SFYA 2VNRA 1PIV2 1TQ5A 2JEMA 1Z7S1 4N7UA 3WCRA 1ZREA 4TZDA 4H55A 5BYNA 3VHOA 3IPVA 2FMYA 1S0IA 4KGGA 3ASIA 4ONUA 3TRSB 2YGLA 3HMYA 5DZEA 2VY0A 1AVBA 2FMDA 4U2AA 4AEDB 1RUNA 3UJQA 4MLOA 4XFGA 4YVSC 4LLFA 5L7OA 5D8AB 5JPMB 1DU3D 1O91A 2B42B 4OHZA 1MEC1 1LHNA 4B7KA 2WA3A 3VDDC 3FJSA 4AHXA 1UPIA 1ULEA 1ZBA2 2PQQA 4IERA 5CVRA 5F6LB 5GM0A 4W6YA 3MIFA 2RMU3 5ACA2 3MLKA 4FTEA 3GZAA 2DCJA 2YZ4A 4WM8C 4XF4A 4AQ2A 2SBAA 2QDRA 5FO7B 3DPRB 1B35A 1YWKA 1YYNA 2DVBA 4QPGA 1NA1B 1FNYA 4Q4Y3 2WJSA 1ND2B 1UAIA 1UKGA 4XJUA 3QH7A 1BCXA 4EWDA 4JCKA 5A3MA 2GALA 4QGLA 2XWJB 2WNVB 2CWSA 1YIPA 2DCZA 1AL23 3M3EA 1COV2 4JDOA 3GZTB 1GYKA 2JE9A 5BNNA 2YV8A 3QBQA 1UU5A 2R30A 3LSDA 1AX2A 2E51A 4MYEA 5HCFA 1GQGA 4FBFA 1FATA 2HWC2 1YFXA 2GC1A 1X36A 3J9SA 4WVZA 5BNQA 2C5DA 3AJYA 3ATGA 2JKBA 3SCGA 2ZGOA 1NXD1 2CL2A 1RUJ3 5FFOC 4IESA 4K21A 4H7MA 4BIOA 3ZXAC 5T5LA 3HN1A 1QQP3 3HT1A 4AXOA 1IS3A 1N3OA 2PYTA 2VUAA 3VBHB 1M4WA 1Q56A 3U10A 5ABJA 2WL1A 2BNOA 4INDA 3IMNA 2AR6A 4R9CA 4LO4B 1S1AA