2RR13

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rr1300
4CDUB 1HRV3 1NY71 5L7OA 3VDDB 5BNPB 2WFF2 4JGYC 2MEV3 3VBOB 1FMD1 1NY72 2HWB3 1FPN1 2HWF1 4YVSC 1PO11 3IDEA 4Q4Y1 1ZBA1 5C9AC 1FPN2 2HWF2 5D8AC 1PO12 4CDXA 1E57A 1QQP2 1RVF2 1ZBA2 2IZWA 3ZFFB 3NAPB 3M8LA 4RHV3 1NCRC 3J8F3 2R061 5C8CB 4N53A 1NCQA 2HWC2 1OPOA 1OOPA 1ASJ1 1RUE3 4GH4A 1BBT3 1H8TA 2R043 2RS13 1R1A1 5A33A 1VBB1 2BUKA 2BBVA 1HXS1 3VBHA 1AR71 3FBMA 1R1A2 1CD3G 1VBB2 2GH8A 3VBFB 4CEYA 4WM7C 1HXS2 1K5MB 1PGL2 4IV1A 5CFCB 1MEC1 4JGZA 5DDJ1 1POV1 5ACA1 2WS93 5ABJC 1RUF3 2RS33 4CDWA 3DPRA 1BEV2 2PLV3 5DDJ2 1ND3A 5JZGA 5ACA2 5GKAC 4FTSA 1Z7S1 1QJU3 4JGYB 1AYN2 1Z7S2 4GB32 4YVSB 5J98B 5C4WA 5C9AB 1VBD1 2HWE1 5D8AB 2WFF3 1EAH1 2XBO2 1AL21 1B35A 1VBD2 2HWE2 1MQTA 4N43C 1AR81 1EAH2 1NCRB 1PO21 1AL22 4Q4V1 5AC91 5BNNC 1PO13 1ND2A 1AR82 1QQP3 4PDWA 1RVF3 1ZBA3 4WM8A 1PO22 4AEDA 1ZBE1 5AC92 2DF7A 1VBE1 3VBUA 4CDQC 1QJX1 4RQPC 2Y26A 5BNOC 2HWC3 4RS5A 4RR3A 3ZFEA 5K0UC 1CJDA 1RUJ1 1VRH1 2WWSA 3VBRC 1RUJ2 1VRH2 1HRI1 2RM21 1F2NA 1R1A3 3HAGA 5ABJB 1RUG1 4QPIA 5CFDA 2X5IC 1HXS3 3S6PA 3CJIA 1RUG2 1RUH1 4QPGA 3VBSA 1AUYA 1BEV3 1RUH2 2HWD1 1FMD2 1HX6A 4IV3C 4YVWC 1RUC1 5A32A 2ZTNA 5ACA3 1PIV3 4GMP0 4Q4Y2 2HWD2 1AYN3 1AYM1 1OHFA 4GB33 4N43B 1R081 4LLFA 5FOJB 1SMVA 5BNNB 4Q4W3 1AYM2 2WZR1 3LOBA 4Q4X1 5L7OC 2XBO3 2R062 1R082 1NOVA 1QJZA 1M06G 1AR91 1VBA1 1RUD1 4Y5Z0 2WZR2 1R091 1X33A 4Q4X2 1EAH3 1RUI1 1AR61 1AL23 4CEWA 1RUD2 4CDQB 1ASJ2 4RQPB 1RUI2 4NWWA 4RFT0 1AR62 5BNOB 1TMF1 4CDXC 1VAKA 3ZFGA 1VB2A 5K0UB 2R071 1TME1 1X36A 1VBC3 1AR72 2RS51 1COV1 1GFF2 4CDUA 2R072 3VBRB 1TME2 3VDDA 5BNPA 4N53C 2RS52 1NCQC 1C8M1 1COV2 1RHI3 3VBOA 1OOPC 4Z92B 1MEC2 2X5IB 4GH4C 1C8M2 1RMU3 1H8TC 1EV13 1VRH3 2MEV1 1C8NA 3ZFFA 4GMP3 2HWB1 3NAPA 3VBHC 4NWVA 2MEV2 4IV3B 4YVWB 4CEYC 1RUG3 4IV1C 5C8CA 1POV0 2GSYA 4JGZC 1PVC1 1RUH3 1FMD3 3J8F1 1NA1A 4CDWC 3DPRC 1FPN3 2FZ1A 2HWF3 5CFDB 1ND3C 1PVC2 4Q4Y3 5JZGC 5L7OB 2HWD3 3JBG1 2BFUL 1HQNA 3J8F2 4Q4V2 3JBG2 1RUE1 1ZBE2 1BBT1 1AYM3 3VBFA 2RS11 2WLPA 1K5MA 1VBE2 2R063 1R083 5C4WC 4CDXB 5CFCA 1QJX2 4Q4X3 1B35C 1MQTC 3JD71 4SBVA 1RUD3 1ASJ3 1RUI3 1AR63 1AL0G 1ND2C 4N53B 4PDWC 3JD72 4WM8C 1NCQB 2BFUS 4JGYA 4AEDC 1OOPB 1QJY1 1VBB3 1RUF1 1HRI2 1AR73 2RM22 4GH4B 4YVSA 3VBUC 1QJY2 1H8TB 1QJU1 1RUF2 1WCDJ 5C9AA 5D8AA 2RS53 5A33B 1COV3 3JB4C 1V9U1 3VBHB 4RS5C 4RR3C 1QJU2 1MEC3 1D4M1 1RB8G 3ZFEC 5DDJ3 1POV3 1C8M3 3TN91 1NCRA 4CEYB 1V9U2 1D4M2 4IV1B 4BCUA 1RUC2 2TBVA 4Y4YA 3TN92 1Z7S3 4JGZB 1A6CA 4CDWB 3DPRB 4QPIC 5CFDC 1BMV1 1ND3B 5JZGB 1PGW1 4FSJA 1QQP1 3CJIC 1RVF1 1VBD3 2HWE3 4QPGC 3ZXAC 1BMV2 1PGW2 2RR11 5FMOL 3VBSC 1AR92 1VBA2 1R092 1PVC3 1AR83 4WM7A 2RMU1 4FTBA 2RR12 1PO23 5C4WB 4Q4V3 5AC93 2HWC1 1VB4A 5LK7B 2RMU2 3JBG3 1B35B 5J96B 1TMF2 1ZBE3 1MQTB 5ABJA 1NA1B 1VBE3 1ND2B 4PDWB 4WM8B 1QJX3 1FOD1 4AEDB 2QQPA 2FZ2A 4EJRA 1HRV1 5FMOS 1FOD2 1PGL1 4CEWC 3VBUB 1RUJ3 1NG0A 1HRV2 3JD73 4RS5B 4RR3B 3ZFGC 1HRI3 1BEV1 3ZFEB 1W39A 2RM23 4N43A 2HWB2 1PIV1 1QJY3 5BNNA 4CDUC 1AYN1 1DDLA 3VDDC 3JB8A 5BNPC 1PIV2 4RHV1 4GB31 3VBOC 2ZAHA 4QPIB 4Q4W1 4RHV2 1V9U3 1D4M3 2XBO1 3CJIB 1RUC3 4CDQA 4RQPA 1F8VA 3TN93 4QPGB 4Q4W2 5BNOA 3ZFFC 2VQ0A 3VBSB 3NAPC 5K0UA 2R041 5A32B 1RUE2 1BBT2 3VBRA 2R042 2RS12 2WZR3 5C8CC 1VBC1 1AR93 1VBA3 1NA1C 1R093 2X5IA 2RR13 1VBC2 2WS91 2RMU3 2XPJA 1RHI1 2RS31 1TMF3 2PLV1 2ZZQA 2WS92 1RMU1 2R073 4IV3A 4YVWA 1RHI2 1TME3 4CEWB 2RS32 3VBFC 1EV11 1K5MC 2PLV2 4WM7B 1IHMA 1RMU2 4GMP1 2BPA2 5CFCC 3ZFGB 1EV12 4FTEA 1FOD3 2WFF1
chains in the Genus database with same CATH superfamily
3SKVA 3N9NA 4JKKA 3KM5A 1UZVA 1HRV3 2ZGMA 2F6BA 2CU5A 3LWCA 1PX4A 1QH6A 5FZDA 3WNLA 3VB9A 4JQTA 2DTWA 5FJHA 5KBFA 1FMD1 3QOPA 2FQPA 1G9AA 5HV4A 3NJZA 4XZUG 2HWF1 3KV4A 4K1YA 1AX0A 5J1XA 5IAXA 3PVEA 1YLLA 1CAWA 1ZBA1 3KVBA 4X6QB 5G04L 3H50A 4P9XA 4XEZA 1GWLA 4GULA 1WA4A 2C9KA 1OH4A 5FCCA 5K9YA 1PO12 1DQ5A 4M3CE 5J3UA 1RVF2 3N7KA 3FZ3A 3OJBA 4IEVA 3GZEA 4QB1A 1TVGA 1SLLA 2D44A 3WNXA 3A0NA 3T09A 4LHSA 1W28A 4V1PA 2W95A 4KG0A 2RDSA 4FCAA 1NCRC 4P00B 4S2DA 2XJPA 5AFEA 2VNRA 1QGLA 2WNVA 4AAPA 1ZRIA 4LBQB 2ARBA 3LA2A 2H6BA 1EYBA 1DYOA 2HWC2 1L7RA 2XVKA 3GJAA 1OPOA 2YUEA 1MZEA 1PZ8A 5KR7A 3BPZA 1U5YA 4A41A 4GH4A 4FO9A 1WGPA 1BBT3 4NO4A 2QVSB 2VECA 4RD7A 1S0GA 3O1OA 2RS13 4O61A 5A7OA 2OZ6A 1H0BA 1KITA 1N1YA 1WW7A 4NOTA 3MV01 5F3IA 3ZYJB 2DTYA 4K1ZA 2WC2A 4DPNA 2D6OX 3C8XA 1A78A 1AR71 4FPEA 4DS0A 1R1A2 4HANA 4BXSV 3TEWA 3WUDA 5HPOA 2GC0A 1VBB2 4D0QA 5LZ6A 1OA2A 3VBFB 1O3RA 4CEYA 3V0BB 1JHNA 3AMHA 2GN7A 4OHXA 4IV1A 2XQRA 3I2IA 3OUJA 2DVAA 3OSDA 3OYWB 1HW5A 5EP9A 2ENRA 1MEC1 2OPWA 2VOXA 3N7JA 4MV2A 4UW5A 5DDJ1 2RV9A 5FY9A 5FZ8A 2ES3A 2NN8A 4DUWA 3IN9A 1GBGA 5ACA1 2P3IA 1A3KA 2VMHA 1NQDA 4GJZA 1DGWX 2RS33 3M3CA 4OUSA 1TQ5A 1XE8A 1CAUB 4PI2A 4L8QA 4HBNA 1DU3D 1N3PA 4AR2A 2IXLA 3H3UA 2VZPA 5BXXA 4AI9A 4BE3A 2QQKA 1QDOA 5DG2A 4NMIA 5IVEA 3MUY1 3VZLA 4EN9B 3H1WA 5E6HA 1G9BA 4UFMA 1UIKA 2XVGA 3ZX7A 1B09A 1XU2A 3ACLA 1CQ9A 5A1FA 4TLFA 2B7YA 1RJ8A 1XC6A 1HQWA 2OUHA 2WN2A 2JECA 3B94A 3FJSA 2E7TA 3IAQA 2D3SA 1KDKA 5D8AB 5A1LA 1DQ6A 4AGVA 1AL21 2NMOA 2VM9A 4KG8A 4MGKE 1EAH2 1V0AA 4LA3A 2JD9A 4AQTA 2GP5A 4Q4V1 5FZHA 2UWBA 4FXKB 3PUAA 5FY8A 5CADA 3Q9OA 3T1LA 4DXSA 1ND2A 1BZWA 4Z82A 4PDWA 1JH5A 1ZRRA 5AC92 2BNOA 4KWJA 3R0RA 2QQNA 2Q8CA 2WIIB 2W94A 3QD6A 3AVRA 4Y1XA 4Y24A 1GV9A 1W8NA 1W2TA 4QX8A 5DAWA 4NUBA 1WMDA 4RQPC 3UYJA 4R9DA 2Z5WA 1KJRA 3URFA 2XHNA 3AP4A 4OI2A 5BNOC 1WUVA 5SV8A 3SLIA 1DQ4A 4E2GA 5C70A 4RR3A 1WW5A 1QNYA 1H4HA 3NV4A 4Q0PA 4AVCA 4EZHA 2BP6A 4CCCA 3GZUC 4AI1A 1AVBA 4BQ4A 3LEIA 3KQRA 4Y5SA 4X8PA 5JXGA 4NROA 3VBRC 3R4UA 1UXXX 4QGLA 4J6GA 2IWGB 3AZYA 1F2NA 4PIZA 3K48A 5JSRA 1NZIA 2VQAA 1OF4A 3MF9A 1P8JA 1SBDA 1RUG1 4MH0E 4BPZA 2VOWA 3ZXJA 1MVQA 1HXS3 1PX3A 1V00A 1CPNA 1SACA 3RZJA 2VVDA 2BBAA 4HG6B 4OCTA 3QBQA 2EIBA 3FLRA 4MLOA 1FV2A 3MO4A 4AFAA 3U0ZA 4QPGA 1YWKA 3ZYBA 4Y20B 3VLBB 1LECA 4OI1A 3NW4A 5T50A 1QWRA 2BTVC 2WO7A 5FZ9A 4HT1T 4C90A 1RUH2 1US3A 2UYBA 1FMD2 1HX6A 3B7MA 5A32A 1RUC1 2Y33A 2QBXA 2ZTNA 2D93A 2ZHLA 4GMP0 2VOTA 3BTXA 3M3QA 5FPLA 1O91A 2DDUA 4IQPA 1WD4A 2CHHA 5DG1A 2Q30A 3HN3A 4QX3A 1UY1A 1AYM1 2Q1FA 2P6HA 2QZ3A 4NN0A 2NZ9A 4N43B 4YM1A 4XUNA 1XPWA 1GYKA 2O14A 4LLFA 2XWBB 1ZZ6A 3NSTA 2RDRA 4XQDA 4EN6B 2DVBA 2O0OA 2KA3A 4FP3A 2CWSA 4N8MA 5BNNB 4XYXA 3LOBA 5L7OC 3DYPA 1XSRA 3LPFA 4NVPA 4F7ZA 5F5AA 1N3OA 1RIRA 2JD4A 1RUD1 4NIAA 2WZR2 3RZMA 5IVJA 4XJAA 4MGQA 4CPBD 3AL6A 2J42A 1SBFA 3VV1A 3O1RA 3NRUA 4MG2A 4MXVA 5ANQA 4E2QA 1XYNA 4NHLA 4QDSA 5D1IA 2XJSA 1WMEA 1PMJX 3BU7A 5IVCA 1U5ZA 5FJKA 2XJVA 5LEKA 3OCPA 4BK5A 4YW2A 2R32A 2TEPA 3UETA 1UQXA 1AR72 2RS51 3HT2A 3LF7A 2WA4A 3LD8A 1O7FA 3Q8CA 3WP4A 1COV1 1GFF2 4OHZA 1JZ3A 1AXZA 2BGPA 3NNLA 1TME2 3K51A 2JDMA 1DHKB 4Q27A 1BHGA 4IEZA 3ACFA 4TN7A 3SITA 4BOWA 2XWJB 1LB2A 2ZPXA 3WG3A 3WXPA 2VMFA 5F3CA 2P17A 1W06A 2V73A 4Z92B 1MEC2 2RJKA 2OX0A 3NNJA 2X5IB 1OI6A 3LEMA 3MICA 1TE1B 4QDQA 3SQOA 4LO5B 4YWAA 1CX1A 2GH2A 2E51A 4IEQA 1H8TC 4M4PA 2E33A 1XNDA 2W5FA 3WG2A 5F5IA 3U14A 5FWJA 3FMGA 4RN5A 3VBHC 4DUVA 3RJ2X 4NWVA 5JCTA 5F8PA 3SEEA 4AK3A 5C3PA 1W2UA 2UY8A 4YVWB 1T2XA 2W1UA 5IK5A 4JTOA 3MI8A 4XIKA 3EBRA 1ZNPA 3C3VA 1AHSA 4L99A 1W9SA 3AYDA 5IVYA 5LEJA 2YFZA 1DYKA 2G9FA 4LBQA 1UF2C 1HQLA 1GOFA 1PVC1 2ZEXA 1SQ4A 4B7EA 4BB3A 1NA1A 1FPN3 1O4YA 2FZ1A 4UW6A 1E5SA 3KMHA 5JZGC 1J58A 3WT3A 4D7YA 5IK4A 1JW6A 2BFUL 1HQNA 1LHOA 1W0OA 3FBYA 4Q4V2 3ACGA 2AYHA 1ZA4A 1POQA 5CG8A 5H9QA 1VALA 1V6KA 2P3JA 2W68A 3PUQA 3VD3A 1QF3A 2D40A 3CKHA 4CCKA 2UYAA 3AP5A 1G9FA 1NX9A 2RJ2A 2JIJA 1YC61 4P9LA 3VBFA 2WLPA 1L7QA 2BOIA 3V0BA 1IS3A 3PHMA 2R063 1R083 3OUHA 1SFYA 3A23A 3T2TA 3AP9A 4CDXB 2EA7A 4P9WA 1KEXA 2QQVA 4DRRA 1LOFA 3WX5A 4XF0A 2ZA9A 1ULFA 3DF0A 4Q0QA 3ZSEA 1D0HA 3S57A 4YM2A 4QD2A 4XF9A 2CV6A 3JD71 5FBZA 4SBVA 1CAUA 3RS6A 2A7AA 4E4SA 3P1IA 1AR63 5T5JA 1DGLA 4KU7A 2NLRA 4N53B 4DY5A 1NCQB 2BFUS 4RSUA 3WNOA 1XNAA 3BODA 1OOPB 3C7GA 1REFA 4DRVA 4H7MA 1CONA 4M00A 2VZ3A 4OFGA 4UBGA 2VCCA 4I0WB 2VVFA 1QJU1 1REDA 2V4AA 4UFJA 2HKXA 3MGUA 5D8AA 2E7AA 2QUOA 1GNYA 3PURA 3RQ0A 2VL4A 4RS5C 1DBNA 1Q5OA 5FZGA 1R64A 1GZ9A 1V6LA 2D5FA 3MIHA 3PMEA 1S0JA 2ZX4A 2JDAA 2IXIA 4XC9A 1MZFA 2V09A 3V64A 2VOKA 3DKWA 4CCEA 1V9U2 1KS5A 4K7JA 3WDUA 1D4M2 3LDKA 1RUC2 2TBVA 2VQTA 4Y4YA 5C3QA 4AFMA 2Z69A 3TN92 1MS3A 1Z7S3 4JGZB 3I2KA 4YZ1A 4BK4A 5KXDA 4NIHA 3P5BA 1IOAA 1KJLA 2BVVA 2WR9A 4OQ9A 3ZMOA 2WT2A 5FXVA 4Z8BA 4BHPA 2ARCA 1RINA 2Q1MA 3DPRB 4S2HA 3RI8A 4NHYA 1BMV1 2ZMLA 3K46A 2FMDA 5FZKA 3L9JT 2VMCA 1LHVA 2CY6A 5DABA 1QKQA 2BERA 1VBD3 2C26A 2HWE3 2YU1A 4QWNA 5FR3A 3BVCA 3I8TA 2WZPP 3U75A 2RR11 3MBWA 3MLLA 4LOSA 1GR3A 2HBUA 2ZEYA 3WD5A 1NLQA 4BM8A 1LRHA 2GMMA 1AR83 1Z0HA 2QQJA 4PCRA 4WM7A 5EJ1B 3U10A 3ZYIB 4BQ5A 5IT6A 2DFBA 3UESA 3MFAA 1J3QA 1QHDA 4QXCA 1K12A 3BTYA 1JBCA 2BOJA 4GKYA 2RMU2 4IL7A 2J1EA 3WQBA 1B35B 5KHHA 3ES1A 3SH5A 2E63A 3MEPA 3O12A 4IGPA 3ZVXA 3UKTA 1OA4A 1ZX5A 1DGRA 4AHYA 2VTXA 1JZ8A 4ZY9A 3R4SA 4A4AA 1S2KA 2A71A 4AEDB 1FOD1 4YW7A 2I07B 3UGGA 1X9TA 3VHPA 2QQPA 3RZGA 2W1SA 4E4ZA 4Y20A 5DUVA 2OW4A 5FYZA 4FAHA 2ARXA 3FX3A 2E31A 3GJBA 3VBUB 1RUJ3 5FZ1A 1NG0A 5FIXA 1W6PB 1FATA 3T2PA 1HN0A 3WHTA 4QKNA 4BA6A 2B4KA 1DFQA 1YJLA 3V0AB 2NM1A 4LHLA 3B01A 4CA9A 1W8HA 1MACA 4G9SB 3ZFEB 1UU6A 1OA3A 1W39A 4N43A 4CP2A 4WZFA 1YIPA 1ULCA 5JOXA 1H9WA 3D82A 3HNYM 3WF0A 5BNNA 4CDUC 1AYN1 4LULA 3VDDC 1LENA 4PT6A 2HYKA 3ZSLA 3L2HA 4RHV1 2RHPA 4GB31 3UV9A 4J1XA 1PGSA 1UPSA 5IJRA 1JYNA 2B46X 4IE7A 4FPYA 3AC0A 3KT4A 2NMNA 3AZXA 2CDOA 3VHOA 2K46A 3CJIB 3FLPA 5FTTC 1F8VA 1LTEA 4YM3A 3W9AA 1LU2A 2MHFA 3RYKA 3PJYA 3VZNA 2B9UA 1KDMA 3D5OA 1UL9A 3IM0A 3VBSB 1CX4A 2UURA 3NAPC 3TBDA 3CHXA 3ZLIA 2R041 5IVVA 1XNKA 1I5ZA 1LNSA 5IVBA 5FZIA 4FP2A 5JIAA 2A5ZA 1GOHA 1K45A 2J1RA 3C7EA 1NT0A 4Q0UA 5C8CC 2ZHKA 4PF5A 2FDIA 3IT8A 2LS6A 1FNZA 5FZOB 3UJOA 4QGNA 1AR93 4WZCA 1S0IA 2YDEA 2TNFA 2X5IA 4LEJA 4XCBA 5TSWA 3SCHA 1U5XA 1W90A 2A3XA 1AX1A 1WCKA 5GALA 2FCUA 3OBAA 1OLME 1V70A 2XDVA 2WS91 2E53A 1PNFA 1RHI1 3A0KA 3FC0A 2GNBA 1TMF3 2YROA 5JOWA 1UYZA 3AK0A 1QNWA 3GDBA 2WBKA 5JSOA 2D6MA 2VZSA 4YVWA 4CEWB 1JUIA 2WQ4A 5FY0A 2X09A 1EV11 3LEGA 5F9TA 4W50A 1K5MC 2C4XA 5T5LA 3RJRA 3ZIXA 4COWA 3WEZA 5DPNA 5JMCA 4P9GA 2BPA2 5A3OA 4W6YA 1VIWB 3BIEA 2DCYA 1HLCA 1QEXA 3V65A 3JQWA 2YC0A 3AZWA 1Y9MA 2W3JA 4OULA 3PMSA 4AQSA 3NJYA 4ATFA 5FWEA 2WFF2 4JGYC 2MEV3 3W59A 5K7PA 5CIRA 3ZXDA 1FX5A 4NHKA 1X50A 4QPWA 2HWB3 5A3PA 5LY2A 4YM0A 2PMWB 4YVSC 1PO11 5DQ0A 1RXFA 1UKRA 4LORA 5LCWL 4LPLA 3BUCA 2KXLA 2VZUA 3UK9A 3H8UA 2XL7A 3ZO0B 2P34A 1FPN2 5T54A 4BQYA 2V72A 3ZXLA 5HI0A 4CDXA 5HXMA 3ZFFB 2BNNA 1BVP1 1BVVA 3OBRA 2AH2A 3M8LA 3N7MA 3OPWA 4KBZA 4S2GA 5CYYA 4ORFA 4CCLA 2YBKA 4OHYA 1K42A 1DF0A 4FXGB 2KD7A 2VAUA 1UMIA 3O1MA 1IS4A 1DLCA 1GANA 4R52A 5LA2A 4N53A 3ZYHA 4O9GA 4D7TA 1NCQA 1GNZA 1Q43A 3IDAA 2ZXQA 4O9EA 5CKMA 4NIIA 2WNUB 1OOPA 5A1AA 4D94A 1LKNA 1ULEA 4LKSA 3T2QA 1ODNA 1RUE3 5FK7A 5IATA 1JYCA 3D6EA 3AZVA 2JWPA 1ENSA 2FDJA 3LFMA 2D6PA 2Y34A 1R1A1 4MGYE 1VBB1 1YRZA 4YNIA 2BUKA 3POGA 1JOJA 2YMZA 1G9DA 3BKZA 4XTMA 4QXKA 2Y6KA 4XPVA 4AF9A 3U1XA 1Q3EA 4CCJA 3MZHA 1CD3G 1URXA 2VG9A 3AMPA 4AAXA 2GH8A 3GHNA 4Q2FA 5E16A 5FO8B 4DOUA 2ERFA 3ZXFA 5GJ6A 3I54A 1JTZX 4PLOA 5JIUA 2JG9C 1F31A 2OS2A 2ZGLA 2BQPA 1GWKA 4K9SA 1HV0A 3K3OA 5CFCB 3AYCA 4JGZA 1S0CA 3POEA 2XGXA 1POV1 3EB7A 4QT6A 5HCBA 3DCQA 2XJRA 5A7WB 4W4ZA 3N9PA 5LATA 2JE7A 4D6SA 2VU9A 4RGKA 3DPRA 3I97A 1YCIA 1DZTA 2JDKA 3D0JA 2PLV3 1PM4A 5FZFA 2VW0A 2ZKLA 4Y26A 1S0BA 4KWLA 3EHKA 3T0BA 3RSJA 5F7UA 2VUCA 4YZ3A 1AYN2 1SCSA 3AJZA 5FMDA 4KWKA 2PAEA 4XJ9A 1Z7S2 1AXYA 4ZXKA 4GB32 3KCYA 1Y7BA 2W91A 2OKXA 5JMOA 1HV1A 3GHMA 4Q8KA 4UFLA 1EAH1 2LW8A 1BJQA 4LKFA 2PHWA 4LUMA 3HEIA 2DURA 5EFUA 2ZABA 1XE7A 1B35A 3CF6E 4MYEA 1VBD2 2HWE2 3LIHA 2KR2A 2ZMNA 2IUWA 4XJUA 1LGNA 1NCRB 1WBLA 2O8QA 3MDPA 5AC91 5FXWA 3SCGA 3TRSB 1UPIA 4YFWA 5JR7B 5J7MA 1AR82 1QQP3 3OGVA 1JYTA 1ZBA3 2EF6A 4IEWA 4AEDA 4ES9A 2DCTA 2P4EA 1C4RA 4MHUA 3WDXA 1ZBE1 3ZM8A 2OZJA 2VXJA 5KC5A 3O1PA 2VMDA 2WZEA 5FQ0B 3ZXEA 5JXIA 1O6UA 1HJFA 5EXOA 3ZPYA 3VBUA 2EALA 2QQMA 1QH7A 1W6PA 3WDWA 2JDHA 4BMEA 5A7QA 2P6CA 4QKFA 1GOGA 2D3RA 4PJYA 3V0AA 1C28A 4GD4A 4LQRA 3ZFEA 4CYDA 5JDBA 4ES8A 4JX0A 1CJDA 4JRAA 2AZ5A 5IYYA 1N3QA 4TSVA 2WWSA 2EIGA 1VLNA 1RUJ2 1WLDA 1VRH2 2IXJA 3K3NA 4LUKA 1H2MA 1E5IA 1GU3A 1HRI1 3POWA 2P37A 4L11A 5FKCA 4AGGA 3O1UA 3BI3A 2W2IA 2C9AA 2GNMA 4IEUA 4P5YA 5FLHA 1YUDA 3ZYRA 4Z1VA 1AJOA 4H55A 5CFDA 2IXKA 5FUPA 3VL9A 4FFHA 4CE8A 2PFWA 3CJIA 3KWVA 4I3GA 5C7GA 1RUH1 4QKDA 4C0BA 5I8YA 5JXHA 2AREA 2IXCA 4CP9B 4D8MA 3VBSA 4AI0A 2E9QA 5JPMB 1BEV3 1O59A 3AMQA 3DKQA 4P5HA 5A3MA 4IV3C 3CDZB 1OPMA 5FY4A 4JHZA 5CNAA 4YW6A 4XILA 5ACA3 1ULPA 3IPVB 5FUNA 4A7KA 2HWD2 2Q4SA 2DCZA 5I91A 4KGGA 3SNMA 4XBLA 4WBBA 1WW4A 3C7HA 3U4XA 3UNPA 5FZOA 2DUPA 4QX5A 4QU1A 4QDRA 2CWMA 4INDA 3KQ4B 3HJRA 5GZEA 4QQPA 3OF1A 1MZ5A 4CU7A 3GCWA 4Q4W3 5L9VA 1VAVA 3O1VA 2WZR1 3ABZA 2XBO3 1W2AX 2XUMA 1HJGA 5FMBA 4BLIA 5FZEA 1M06G 4TXWA 2JIGA 5IUQA 3GM8A 1R091 1X33A 2YYOA 4Q4X2 4UF0B 5LY1A 4M0NA 2R1DA 1AL23 4B1LA 1REEA 4CEWA 3I2JA 2R16A 4IERA 2XUEA 2X53S 4RQPB 2P3YA 2ZGUA 1FXZA 1RUI2 3H8RA 4RL7A 1VPHA 5BNOB 1X8EA 4YGDA 1HB4A 4JV4A 1VB2A 3E1F1 4R8HA 2ZGPA 1TME1 1X36A 1YJKA 4HSLA 1UZWA 1VBC3 3U78A 3I3BA 2Y6GA 4EN8B 3VBRB 4ASMB 2R0FA 4Q0VA 4DEQA 4ET7A 4ZS3A 4N7UA 5I0SA 4XFIA 1WWYA 3WW3A 5A3WA 3H7YA 3NNMA 4XCAA 3VDBA 4KU8A 4HETA 3AKRA 5F6LB 2LROA 3GCXA 4AYUA 2J1UA 2VD7A 4XUPA 1C8M2 1D4VB 1RMU3 1JS9A 3INAA 5T55A 2W39A 1M4WA 4DNYA 4M4RA 3ON7A 4QGMA 4RFRB 5FFOC 1C8NA 3AKSA 4TLGA 3VZJA 2BRTA 1JOBA 1WLWA 2LM3A 3HVDA 3ZFFA 4GMP3 3U11A 3UGFA 3IZOA 3ZR6A 3AMMA 1S2BA 1ZA7A 4YG0A 2DCKA 2MEV2 1OQ1A 2BV4A 2V4VA 4MHRA 4E4HA 4NIDA 3P3NA 5FYCA 2RDQA 4EWDA 3B5LB 1RUG3 5FUIA 1V6NA 1W8UA 1HN1A 4AFBA 4YZ5A 2GZWA 1W6QB 3TNPB 3ECQA 3PDQA 2WNUA 3JZVA 2R6QA 2H6CA 2G9GA 3EXUA 3POFA 5I8TA 3OTFA 4CDWC 3WQ1A 3FHAA 1GUIA 2WO2A 1ND3C 4Q4Y3 3E6BA 4CUGA 5A6QA 5L7OB 4MZUA 1IPJA 1MVEA 1LOBA 4YYOA 1U5IA 3O7OA 1UY3A 2WSVA 1JZ5A 1XJAA 5GLVA 3JBG2 1MS9A 1YQ8A 1ZBE2 1BBT1 5C8WA 4ZHNA 1HDKA 4I0AA 1AYM3 2RS11 3FE5A 4NRMA 4OLLA 3RDIA 3UKNA 3BGAA 1W6OB 2QNKA 5C4WC 4LLOA 3WY6A 3VD9A 4W6WA 3WQ0A 2RE9A 4P02B 5CFCA 5LBFA 2OPKA 3S5AA 3BN6A 5CZKA 4I3PA 4QQHA 2Y6JA 4AEKA 3KB5A 1MQTC 5A7WA 3MW3A 1CAXB 5JLVA 2VH9A 2E26A 3L2YA 4XUTA 1RUD3 1ASJ3 2LUWA 2EIEA 4ZU5A 5T3NA 4WM8C 2XONA 3KZ4C 2G19A 3RZKA 1X7NA 3RNSA 4DFSA 1HRI2 4MX3A 4UAPA 3PL0A 1QJY2 1H8TB 4W8JA 3TNQA 1WCDJ 2RS53 3MIBA 5A33B 2FCVA 1LGBA 3NNFA 1COV3 4P9YA 5FP4A 4HLTA 1IPSA 1V9U1 3VBHB 4P08A 2ZHMA 4EWAA 4XXAA 1D4M1 2QKDA 3ZDVA 3DXTA 1MZ6A 4U2AA 1GP4A 3TN91 3A7QA 1NCRA 4I2OA 5IVFA 2PHTA 2QDNA 2XJQA 5FYYA 4GQ7A 1H6YA 5CA6A 1APNA 1LHWA 2P2KA 3ITQA 1JUHA 4MUVA 4Z2WA 5FRAA 4FQZA 1CZVA 4URAA 2RVAA 4A45A 2WLQA 3THDA 4LT5A 2Y60A 1A6CA 5I93A 5JOZA 1JODA 1PZ7A 5GLTA 5FQ0A 1ZZCA 4QPIC 1G86A 1OSGA 1JZ2A 4FAGA 5JZGB 2F4PA 3EQEA 4IGQA 4FSJA 2ZX2A 3T3YA 2WO3A 4CP0A 5ERLA 2ET7A 2UU8A 1OUXA 1PGW2 2Q8EA 1WLCA 1RYYA 1SG3A 2D6LX 3B02A 4NHXA 2RG4A 2Z42A 5D2AA 4AOCA 3ZIWA 1VMJA 2VW1A 1OLQA 3ST7A 3S0MA 4B29A 1R092 3DXUA 1PVC3 2RMU1 4MOAA 4FTBA 1PO23 2AACA 5E89A 5F6KA 3I7DA 4FOWA 4HFSA 3PUIA 3X29B 4PIXA 3WDVA 3I3MA 2VW2A 3IIIA 2OQ7A 3ILFA 5J96B 5K8SA 1MS1A 1YQ5A 5L19A 1QXRA 4WVMB 4ZS2A 1D2QA 4UFHA 5FYMA 2XH6A 4L0PA 3MIEA 5F5QA 4CCDA 1VBE3 3JXSA 4XMAA 4AXOA 3R4DB 1YI9A 2GU9A 2VZOA 1ZZ8A 1PK6C 5FOBB 3VZMA 1QJX3 2Z2SB 1QY4A 4IEXA 3OGJA 3HQUA 2JDZA 5KXBA 4CP9A 4R9AA 1D0GA 1L3JA 2ZGNA 1OC1A 2MPFA 2BGOA 2VGDA 3B9CA 3F2ZA 1VP6A 1NLSA 2ORZA 3IPVA 2DCJA 3VGIA 4CCNA 1HRV2 3JD73 2PHFA 3RZHA 4QXHA 2QQWA 4XOGA 1W03A 4JKMA 3WDYA 4RS5B 3ZFGC 3OG2A 1SLAA 5F2WA 2VBDA 2RM23 4QX2A 5I0TA 3VKFC 1CJPA 1BK0A 1X8MA 4JCKA 3IBMA 4LJHA 3THPA 1TEIA 3PVNA 4AFCA 1O8SA 4F3JA 5BNPC 1YHFA 1LOGA 1Y3TA 1TNFA 1W6NB 3LQCA 1I5PA 4CRQA 3VBOC 2ZGTA 4UF0A 1WA6X 4CUAA 1YQ2A 5HBAA 3C7OA 4QB2A 4CU9A 4RQPA 3AL5A 2WAAA 2FHRA 4Q4W2 2W47A 4FFFA 1S0FA 5BNOA 3LKJA 3HNBM 2YBSA 4MXWB 1CAVB 4FFIA 3B93A 1US2A 3VHNA 4G4FA 2A73B 2G4IA 4D6QA 1BBT2 3OYWA 5L9RA 1VMFA 1GZTA 1DYPA 3ES4A 4FI9A 2RS12 4OI4A 5H9PA 3VBRA 5J36A 1WMXA 4FQ4A 2OVUA 3N9QA 1QIQA 2CTVA 2YPJA 3P6BA 1ST8A 1VBA3 4COVA 1QDCA 5FY1A 3TEZA 4GWJA 3QCWA 2RR13 4M3CB 1GP6A 4XABA 3T30A 5F37A 5KXCA 4PHZA 1VBC2 4LOTA 3VD7A 3PVOA 2BYVE 1J1LA 2AUYA 3RRDA 4JHTA 1SCRA 2EAKA 2EICA 3MF6A 4JZRA 3USSA 2VCMA 2R7EB 1UYPA 1G7YA 1W3VA 2C1FA 2ZZQA 3LZZA 2R073 3LGRA 4Q1PA 2RS32 1JN2P 3HOBA 1O4ZA 2WDBA 1OLMA 1IHMA 4HOOA 1LOEA 5ISLA 4NRQA 1RMU2 4QU2A 2ZGOA 3SC7X 1W6QA 3OGRA 5IFTA 3OBZA 4DO0A 1UOBA 2EVXA 3VZOA 2PQSA 1OD3A 2R30A 2JDYA 1FOD3 3WNMA 4GWNA 3I59B 3ZYGA 5F32A 2ZAAA 1UIJA 4FT8A 2WFF1 3OPTA 4CDUB 4XE9A 1ZZ7A 2BZDA 5L7OA 4TTGA 4LHNA 4LMFA 3VDDB 2GC3A 3MHZA 1RXGA 1UD1A 4B3NA 1IKPA 2W08A 4LBJA 2DVGA 1NY72 4BU2A 4AZZA 3KHCA 1NXD1 2D6NA 1FPN1 5GZGA 4K8RB 1O3TA 2WRAA 4F8AA 2YB7A 1XRUA 1W6OA 1NE4A 3AXEA 2YGLA 1K5JA 4LIUA 5C9AC 1ACCA 5GLUA 4QMAA 2HYXA 1F9KA 3FFZA 2IZWA 2ZMKA 4DY3A 3NAPB 2YC2A 2EXKA 4M3CF 4XIOA 4H3WA 4G3YC 3N9LA 4AVVA 1XNTA 4FVVA 1O5UA 4RHV3 1W9WA 4NHMA 4CCOA 1CAXA 4YZ4A 2K0GA 3J8F3 4JC1A 2R061 3WP6A 1H1MA 1GKBA 4ARYA 3S7IA 4LO7A 4AI8A 5C8CB 3OD0A 2ZS6B 1KXGA 3KVAA 4FPHA 1I3HA 1R1ZA 4LR4A 4L2NA 5EPAA 3BTZA 3JQXA 1QXJA 2XOMA 4LBNA 5FP3A 1NQJA 4B4RA 4PBPA 2FDHA 2W1QA 5J37A 2Q8OA 4URTA 1H8TA 2R043 4XBQA 4XF3A 3AP7A 1ZREA 5AVPA 5A33A 1BK1A 5FPBA 4BYYA 2BBVA 2VUDA 4DB5A 1F5FA 5KXEA 2ZCWA 3VBHA 3FBMA 1XYOA 3CNAA 4Q29A 1QJFA 5JXJA 4JRLA 5E88A 3WV6A 1JHJA 5DAVA 3N4MA 1DG6A 2W52A 4JDOA 1HXS2 1K5MB 4UI9L 1IS5A 2PAMA 3BPSA 4NPLA 3ILRA 3Q8BA 1O5LA 1W8ZA 3WF3A 4LE4A 4XXPA 1N1TA 1SFNA 1MR5A 2IXHA 2WS93 5ABJC 1RUF3 4NAOA 2BEOA 2ZJCA 4HKLA 2XG3A 1SLCA 3CZUA 5FXXA 1CPMA 5JZGA 1UU5A 4FBFA 5GKAC 3E6CC 1DZQA 1UCXA 1Z7S1 4XETA 1A8MA 3NJXA 4JGYB 2WABA 4YRDA 1DGWA 2B5HA 4FPFA 3OD4A 2IFRA 4YVSB 2WAOA 1H2KA 5J98B 4JAAA 2YFUA 4OVEA 3OGGA 1H2NA 1PHMA 4UFKA 4BH9A 5GM0A 1VBD1 2HWE1 2YV8A 2VUAA 3MIFA 1CVNA 3EJKA 2WQ8A 4YARA 3N9OA 4GIQA 5FPUA 5DAXA 2DU1A 4Q0SA 3LOIA 1HB1A 3NJVA 3RVHA 1VJ2A 1ZVFA 2K9ZA 4CXXA 1AR81 1OQEA 4WVMA 2HJIA 3CZJA 2XKOA 5E1RA 4UBHA 2HEWF 5A7NA 4LBQD 1PO13 3ASIA 2D43A 5FLJA 2Z79A 1RVF3 4LK7A 5I0DA 1PO22 1EPWA 1W9TA 1GP5A 2JICA 3WHUA 3WP5A 3ROUA 2XKPA 2QQUA 2DF7A 3HMYA 3MFCA 2XR4A 1KS4A 4TZDA 4LBKA 4Y22B 1XE0A 4CDQC 4XQ4A 3HN1A 4YGCA 3QLQA 2Y26A 5FZMA 2ATFA 3GNEA 1J1TA 2HWC3 4NPMA 5FZ3A 3WF4A 4RS5A 4A6SA 5K0UC 1H8VA 5F2SA 2CGPA 1ZRFA 3KF3A 1RUJ1 4JVAA 1VRH1 5T5PA 1OD5A 4EV0A 4YW4A 3TAYA 2AEYA 4NPRA 2JG9B 3WZ1A 1C1LA 1VRBA 2VCBA 1KGYA 3GBGA 4Q26A 2D6KA 2R1BA 1W6NA 3IAPA 1R1A3 3KSCA 2VNOA 3P3PA 4LNVA 4YW3A 3H9AA 3WQ7A 2VO5A 3O5SA 4QKBA 1ODMA 4ZZ5A 2A3WA 1JZ7A 3S6PA 1X9PA 2A70A 2JG8C 1F4HA 4IESA 1OT5A 1XYPA 4V2VA 4HK8A 2EXHA 5FZ0A 4YW5A 2ILMA 4UW4A 2SLIA 5CKQA 2QDRA 3DN7A 5A6ZA 1BLZA 1MS8A 2BDRA 3POYA 1YEWA 4AHWA 2A6YA 4MXWA 1OMIA 3ZOIA 4HZFA 1UOGA 1CAVA 1CIYA 4HVOA 2HWD1 2XLGA 3KCXA 3MV11 2AGSA 4IE4A 4I09A 4LITA 1ZRDA 2A1XA 4I0BA 3AVSA 1PIV3 3CO2A 5JI7A 3VZKA 3J9SA 4HKWA 5HCFA 5BPXA 3CEWA 2EXJA 3NO8A 3M4FA 3PLQA 5FYHA 4B7KA 1LEMA 1OHFA 4X8NA 4D7SA 4NE9A 3KGZA 1YXWA 1SBEA 2VTXJ 5ANNA 5FK8A 5FOJB 1SMVA 3PUSA 4OMDA 4M3CA 1NLRA 5EYXA 5GZDA 1XU1A 4Q4X1 2BW8A 4CSWA 1RTVA 3HPNA 2R062 1R082 1SLTA 5LWBA 1GNHA 3V56A 2A6WA 1AR91 2CDPA 4N90A 4XMIA 1AX2A 1EAH3 1RUI1 5E8AA 4BWOA 3WNPA 3W5NA 1H1AA 3H1MA 2AENA 2WYSA 1EY2A 5LA1A 3J7HA 5FXZA 4NWWA 4RFT0 1AR62 5T5OA 3G6JB 2VZQA 1TMF1 3JU9A 5A3TA 1LHNA 1QXPA 4Q5OA 5FMCA 5HCHA 3WF2A 3FUOA 2HH9A 1IQAA 4Y1ZA 5F39A 1ENQA 3I59A 4XF4A 5C6CA 4CDUA 2R072 3JUUA 4H7LA 5FPAA 1S2EA 3VDDA 4QHBA 2WNVC 3I3EA 4MADA 4ASKA 1C8M1 3MUZ1 2L9LA 1FV3A 4J1WA 1SPPB 1VR3A 4ONUA 4WV8A 1H6XA 4GH4C 4COYA 5GLZA 2XVLA 2FD8A 4AHZA 3RG0A 2MEV1 4M01A 3D3AA 4DIQA 5LW9A 2GAUA 2YU2A 2HWB1 3NAPA 1AF9A 3WCSA 4AVBA 5BY5A 4QQ2A 3ZPOA 5B4XA 3BU0A 4IV3B 3APBA 3ETPA 1PMIA 3VDAA 4BIFA 4CEYC 2GDFA 3OOXA 2WKKA 5FPZA 2WT1A 2W1WA 3SISA 1RUNA 4IV1C 3SMHA 5C8CA 1POV0 2B42B 2RDNA 4HK9A 5C5UA 1GZWB 2VZ1A 1RJ7A 2GSYA 1J3RA 1NUKA 1OURA 3WW2A 1JXNA 2PHRA 1RUH3 5FY7A 3IIAA 3USUB 1FMD3 1W9FA 1IKQA 4XFBA 1Z78A 3TEXA 5CB7A 2V5YA 4QPYA 3E5QA 2HWF3 2YPDA 1RC6A 1G6NA 2G1MA 4LKDA 4GXLA 4QHZA 2H0BA 2Q5TA 2WA3A 3JBG1 3J8F2 5JPNB 1QOOA 4H2AA 3G7DA 3B9IA 1RUE1 1C1FA 2JEMA 1W6MB 3OY8B 3AM2A 1UY2A 5LASA 1HB3A 4UWDA 5K4LA 4COZA 4EWEA 5A70A 1F15A 3HQXA 1K5MA 3AP6A 1ULDA 2PHUA 5D21A 3ZSJA 1FT9A 3GGLA 2W92A 1T6BX 2HEYF 4PBOA 3VHRA 1O3QA 4E9KA 2Q1ZB 5C3SA 2ZACA 5J09A 3NKTA 1IPKA 3BB6A 4L97A 4MGZE 3IWZA 4CTEA 2Y64A 1GSLA 5FP9A 3K75B 1AL0G 1ND2C 4XFHA 2E7QA 4PDWC 4CVUA 1OH3A 1RITA 3KLSA 4JGYA 5LB6A 3RYPA 4LBOA 3ZSMA 4ZZ8A 3I2DA 4AQ6A 2P3KA 1QJY1 3LIGA 1SHWB 3H3ZA 3PVBB 2IC1A 2BWCA 1J83A 3AMNA 3H7JA 1AR73 5FREA 4YVSA 5CAZA 4CPBA 3ZXGA 5EHDA 1G9CA 3VUOA 4MGTA 4BJ0A 3SEPA 2OUJA 2XLFA 4C1XA 4LXLA 1RUF2 2WNEA 4A2UA 3LDBA 5B4NA 4NAMA 3VN4A 3H8XA 3M1HA 5C71A 3KS7A 1XXNA 5FYIA 2VC9A 3JB4C 4FFGA 3AFGA 1O3SA 4RR3C 1JYWA 3H1YA 3NV1A 1MEC3 3MLJA 2ADEA 3FN9A 5DDJ3 5FZ6A 1RB8G 2B45X 4BIOA 2NPIA 4KNCA 1K3IA 3IDCB 4HXCA 3OUIA 2J22A 4PQ9A 4AGRA 1TNRA 4OHVA 4Y5TA 5G05L 1DGRN 1Q8QA 5CVRA 5BUVA 2WINB 2CL2A 1ZRCA 3THCA 1F5JA 2VR4A 4IE6A 4LKEA 4A7YA 2W87A 5A3LA 3T4HB 4DQAA 4OZOA 5LRSA 2QQIA 2WFPA 4CDWB 4OUEA 1ND3B 2VY0A 3ETQA 3W21A 5IWFA 1PGW1 1YI7A 1UO9A 3GBFA 1QQP1 3LAGA 4Y22A 2C24A 4MVTA 4JTNA 1WCUA 1UYYA 1YFYA 2Y0OA 5A6XA 4AWDA 4QPGC 4JDNA 5I0UA 3OEBA 2BWAA 1O4TA 3Q8FA 4FPOB 3T0AA 3PTRB 5HCAA 4ARXA 1AR92 5A6YA 2J1SA 4BZ4A 1GLHA 1TG7A 1W8FA 2OA2A 3WVJA 4META 5C4WB 4AVSA 3PUHA 4Q4V3 4LO4B 1RGSA 3UT0A 2Y6LA 2YBPA 2JG9A 3FFQA 3SCFA 4CXWA 5DAQA 2JDPA 2Y6HA 1VB4A 3VKMA 3OGSA 3MPBA 2PYTA 4FOVA 3FLTA 1TMF2 1IQDC 1MQTB 5FLIA 4C91A 2R0HA 5FP7A 4W65A 1AJKA 1BCXA 3TOJA 1NA1B 2J1VA 2Y0IA 3AFKA 3LA7A 2PHDA 4ZXEA 5CG9A 4E8CA 2VXRA 3H3LA 1DP0A 4BQ3A 5DXDA 4WM8B 5EZWA 2DBNA 4IGOA 3WG1A 4OHWA 2FZ2A 4EJRA 3AKTA 1C5HA 4UOJA 2PHLA 2VULA 4A42A 4YZ2A 1HRV1 2YG0A 4IDZA 5FZLA 1XBFA 5IK7A 1PGL1 4AI3A 3KF5A 1UOFA 3LFIA 2D98A 4XFFA 2ZEZA 3BALA 3RYRA 5F1RA 1DCSA 1SFPA 3CMGA 5A80A 1OLRA 1C5IA 3PTYA 4AVAA 2FDKA 1BEV1 1Y9GA 4DMIA 1WCSA 2P5BA 1IGOA 2W0XA 2B8MA 3RWNA 1PVXA 2HWB2 1H2LA 2UY9A 4V2WA 5SV5A 1UXZA 2DVDA 4AQ2A 3WR0A 4XVHA 3ZKUA 1ZM1A 1DDLA 4HPKB 3T1MA 3ORJA 1PIV2 5CBLA 3O0XA 3AB0A 2GNTA 3H0OA 2DU0A 1JMUB 2VQUA 5LBEA 2D5HA 2ZAHA 3POBA 4QPIB 3VKLA 1NXMA 1UAIA 4C8DA 4Q4W1 3NVCA 3U37A 1V9U3 1D4M3 2XBO1 3QACA 3GZTB 1RUC3 2DWRA 1CN1A 4B1MA 1CGPA 5T52A 4LA2A 3TN93 4FPGA 4BXFA 2D3PA 3LCPA 3TYJA 1ENXA 1BYHA 2PAKA 2Q8DA 3SH3A 4DUXA 3SHRA 2H0VA 2VQ0A 2I45A 2JDUA 4BISA 2XXZA 3MW2A 5LK5A 5JSPA 1LESA 4Y1UA 2GP3A 2LTNA 1C3HA 1N1VA 1I1EA 4XQWA 1RUE2 3KD4A 4LE3A 4CXYA 1IG3A 2Z4FA 3LPGA 2VE1A 2ZGRA 3SXWA 5LA0A 1AZDA 1EPZA 5CEHA 1UN1A 3A21A 3RZZA 1H30A 2XJTA 4KH9A 3RMYA 2VZVA 4XJ8A 1VBC1 2VZTA 1SPPA 5FPVA 1U12A 2BGCA 3POIA 4ZONA 1UY0A 3POJA 1NA1C 2X29A 2XLAA 2PTMA 4LK6A 4XHXA 5KC6A 4YFZA 5CISA 1PK6B 2A3YA 4R4XA 4IW3A 4Y1VA 5B2GB 3ZXKA 4XTPA 2RMU3 4Y33A 1UMHA 2RS31 3DECA 2BU9A 3O1TA 4AHXA 4UW3A 3LB9A 2VZRA 4A7ZA 3TWIA 3ZKYA 1RMU1 3K4DA 4IV3A 1LODA 2V5DA 3I2HA 3FHQA 5AFBA 2WT0A 3OEAA 3VBFC 4ISRA 2Y8KA 4EN7B 5KHKA 2HBTA 2PLV2 4WM7B 4BQWA 2ORXA 4C0HA 3ZYPA 4Z07A 1QU0A 4GMP1 1GZWA 1LOFC 1KFXL 4XACA 1Q8SA 4HSJA 5FKBA 3ZFGB 4E4DX 3ILNA 1Q56A 3LSDA 4UT5A 1J59A 2JXAA 3USUA 1OKOA 1W9YA 4QQLA 4TYSA 1V6MA 1YFUA 4R4ZA 3H8OA 5FZBA 3GALA 3Q8AA 1NY71 5IAVA 4C1WA 5BNPB 1PZ9A 4GWMA 5EIYB 1UW8A 3PIJA 2DFCA 3ACHA 2FMYA 2JKBA 2PN5A 3DUIA 3VBOB 5JI9A 3I3QA 3J7LA 1A8DA 1LULA 3F95A 1W6MA 3IDEA 1UZZA 3OY8A 4Q4Y1 3PJQA 2RJLA 3EYPA 2VPVA 2XJUA 4Q1RA 3UGHA 3ZN4A 4XAEA 2WN3A 2HWF2 5D8AC 1TZOA 1E57A 2FCTA 1OBNA 1QQP2 3KT7A 1XQNA 1ZBA2 1UYXA 3MIDA 4KWUA 5L9BA 4O7XA 1KFUL 3WINE 3ZYFA 4NJ4A 5FZ7A 4D3WA 4YG3A 2VMGA 3RZLA 4EE2A 1EUTA 2G9ZA 5LBBA 1C57A 4EYUA 1T6GC 2I74A 1RUOA 2LALA 4AE2A 4E27A 1E5HA 1PM7A 3FHIB 4JDMA 2XMLA 5IHRA 4QB6A 2JB8A 4IEYA 3O1SA 3B3QE 3HD8B 5DMYA 5JOYA 3JCIA 3NWKA 1ASJ1 1XB9A 3ALQA 1UU4A 3CU7A 4BLJA 1X82A 3J7MA 2NYYA 1SZBA 1GQHA 4A3ZA 1ALYA 1WLTA 3LSEA 3KHBA 3NQHA 3BTAA 4IUGA 4PQQA 4CUCA 1HXS1 2W9XA 3N9MA 3PU8A 3HBZA 1AXKA 1CR7A 4HN1A 1LEDA 1YYNA 3R05A 3C7FA 1N1SA 2SBAA 1DQ0A 4WM7C 3WNKA 2VVEA 2YY1A 5EYYA 1PGL2 4QAWA 2D7FA 5FYBA 1HB2A 1Y4WA 3O0WA 1JYXA 5C3OA 4W6XA 3I2GA 3OB8A 4AI2A 1I6XA 2A6XA 5I8SA 5FYSA 5FDBA 3DYOA 4H14A 4EN0A 5DZFA 3CIHA 4E2SA 2WO1A 1H4GA 2VMIA 5C5TA 4CDWA 3VD4A 1BEV2 1Q8PA 1OXCA 2ZBJA 4SLIA 4MGSA 5JR2A 3E5XA 5DDJ2 1ND3A 5ACA2 4FTSA 3A22A 4P14A 1QJU3 4BQXA 1WW6A 5DUUA 4N7IA 1G8WA 5IFPA 1STMA 1D2SA 2DVFA 2ARAA 4EZ4A 3UJQA 1QMJA 3GYDA 5BYNA 4CUBA 3T0DA 2XQXA 4ZPIA 5H9SA 3ZSKA 3ME2A 1O8PA 4ISQA 4E8DA 4LTAA 2DUQA 5C4WA 1OVSA 1UKGA 5FBJA 5C9AB 4TWTA 2WFF3 2XBO2 5EQUA 3T4VA 1ENRA 5L73A 1JU4A 5LRRA 1SEFA 2YZ4A 2JX9A 1UX7A 3VKNA 4B8EA 4RA0A 2HEVF 5HXVA 2F4LA 2VTFA 4EROA 1MQTA 4N43C 3U07A 3QH7A 1PO21 2IVJA 4YSFA 4AEJA 1AL22 1UX6A 4QM8A 5GLWA 3HWJA 5JVVA 3WF1A 5BNNC 1KRIA 1KD7A 2E32A 1W8OA 4KL1A 4HKOA 3DEMA 4ZKTB 4D69A 1E5RA 1PNGA 2N7GA 1GWMA 4WM8A 3CL1A 4QX0A 2BVBA 1A34A 1FAYA 2OIIA 5A3UA 4XUOA 1VBE1 4MGIE 1NKGA 2AEZA 4I02A 1OVPA 1SDDB 5IK8A 1QJX1 1FNYA 4XZPA 1UZYA 5CU1A 4A6OA 4GKXA 1ZYBA 2IVIB 4FOYA 4XAAA 3I4IA 1UZ0A 3NNGA 2FDFA 5FYUA 4AFDA 4N9HA 2QCSB 2VUJA 4Y4RA 3S5QA 3TEYA 4BQ2A 3SH4A 4XF1A 3H42B 2YHJA 3SKJE 2ZGSA 4HPKA 3WCRA 4CP1A 4DZGA 2OQ6A 3ZN5A 2A6VA 2RM21 1YQCA 3ZN6B 2EAAA 4B4QA 3HAGA 4BDVB 2A75A 2ZX0A 5ABJB 2JE8A 4QPIA 3NKGA 2I2SA 2X5IC 2CNAA 5EWSA 3T2OA 4HVQA 4IETA 3GXUA 2F17A 4ATEA 2QFEA 5LA9A 1IZ3A 5KHIA 1RUG2 3D0SA 1QOTA 2ET1A 2MNGA 3MYXA 3T08A 2K2SA 3POSA 1AUYA 1QOSA 4YG6A 4YVWC 3LE0A 2VNVA 3GF6A 4FPCA 1EP0A 4B4PA 4YPJA 4Q4Y2 4OQ8A 4N9IA 2X05A 3VDCA 1H9PA 3WDTA 1OKQA 1AYN3 2JE9A 3THTA 4XURA 1JU3A 1ZZ9A 4NIGA 3R6SA 5BV6A 4LO6B 2P1BA 4GB33 2D97A 4P9IA 1DZRA 1R081 1WCQA 2BNMA 3UL2A 1JZ6A 5F3GA 4I01A 1AYM2 3BIWE 1S0EA 4IEOA 1PK6A 4GA9A 2CGOA 3I2FA 1NOVA 1QJZA 5DUWA 4JKLA 4QXBA 1VBA1 4Y5Z0 2CAVA 3EO6A 4XW3A 2Y38A 3J4UH 1AR61 2WNOA 1YQ6A 5AVAA 1RUD2 2NQYA 3AYEA 1ASJ2 2ZX3A 4GZ9A 4CDQB 2PHXA 1CESA 4Q8LA 1NE6A 4AEMA 2YXSA 4CDXC 1W2NA 2ZEWA 1VAKA 2BJSA 3PIGA 4I30A 3ZFGA 4CU8A 5APAA 2QE3A 1LR5A 2WWJA 3PNAA 3B00A 2O1QA 2R071 4KMQA 5JAXA 5K0UB 4KGQA 3CJXA 4JQRA 2DUOA 4DXRA 1LOCA 2AC1A 2Y6FA 3DL3A 5EV7A 5KHJA 4XFGA 2DYCA 3U4SA 4HMZA 3J26N 5BNPA 1EUUA 2VBBA 2FBEA 3IDBB 2RS52 3FWEA 4N53C 3WNNA 1NCQC 1RL3A 3DV8A 4MO3M 1COV2 1J3PA 5DAPA 3I2OA 1RHI3 2Q0AA 3NMBA 1OOPC 3VBOA 5C3RA 5FYTA 2ZGQA 3HIFA 4OUMA 3M3EA 4QM9A 4GAZA 2JG8B 1N47A 1XOYA 4BQ1A 5FZ4A 4IXLA 2QQLA 4FOQA 1H1IA 1W2OA 4LIVA 1EV13 1Q8OA 1VRH3 2OXBA 4HL0A 3D8CA 1ONAA 3ZMNA 2QJVA 2B39A 2W46A 3ENRA 1KQRA 2CYFA 1W3XA 4NR1A 4R9BA 3AX4A 1CIWA 1HIXA 4KQ7A 3GZAA 1SLIA 3RFRA 5L36A 2ZKNA 2AR6A 4QQOA 2XB6C 3CQOA 1WBFA 4XUQA 3AKQA 3BYWA 1V6IA 3S7EA 3K77A 4NRPA 1GICA 4XJZA 1NYWA 4RGGA 1UOJA 4JGZC 1GQPA 1MS5A 1J84A 2GALA 1GQGA 2ZX1A 3M2MA 3J8F1 3O14A 3AKPA 3WW4A 2VJXA 5A7SA 3DPRC 4CZSA 5FO9B 4OYUA 1BKZA 1IG0A 5A3NA 5CFDB 3W5MA 3OBTA 1PVC2 1W05A 3BOPA 3E97A 2HWD3 1W8WA 4FPKA 4HN0A 1L7LA 2X10A 4DINB 3HBKA 1DQ1A 4PF1A 5A7PA 4K20A 3WUCA 4YGBA 5EJ3A 5FO7B 3HT1A 1DLLA 3FUQA 2TUNA 3J7NA 3D4KA 4LBLA 1NZCA 1OQDA 1CAWB 3DGTA 3KCCA 3WSOA 1VBE2 3QH6A 5FZAA 5FAXA 1DIWA 4FPJA 5H9RA 2EXIA 1QJX2 3NL1A 1Y9QA 3VKOA 3HQRA 4Q4X3 4UFIA 3WP3A 1B35C 2R49A 4QX7A 2GC1A 1HKDA 2WWUA 3N35A 4HONA 2WQZC 3I49A 1RUI3 1UMZA 1D7PM 1MS0A 5FYVA 2WNVB 1W04A 1LGCA 3JD72 4R9CA 4AEDC 4ITCA 4K3UA 3NV2A 1VBB3 4IE0A 1RUF1 2ADDA 2C6SA 1CZTA 2ZOEB 2WUHA 2RM22 3EMRA 4GH4B 4J25A 4Y1YA 3HR9A 2CSGA 3WLUA 2CGNA 3WOGA 3VBUC 3MPPG 1XSQA 1JOPA 1FYUA 4AW7A 1I9RA 3K4ZA 2LRPA 3M3OA 5C9AA 5HV0A 3IMMA 2GMEA 3MW4A 3BOWA 4LBMA 4XDOA 1ULGA 1F35A 2JDNA 1YO8A 4O65A 1QJU2 5C33A 3ZFEC 1LHUA 1XNBA 2WL1A 5FPXA 1POV3 1SLBA 2QZ2A 1C8M3 4CEYB 1JYVA 3E6DA 3KGLA 4HVRA 3W58A 4IV1B 4ZU4A 4BCUA 2NP0A 4GJYA 3MLKA 3KV9A 4KI5M 5I0RA 2IFWA 4RGAA 2J1TA 1V6JA 3TB0A 3IB3A 3W20A 3VD5A 2VNGA 4BMBA 1FI2A 5CFDC 4IE5A 2HLEA 1VAMA 3ACIA 4AL9A 1JZ4A 3S30A 3CJIC 1RVF1 3ZXAC 1BMV2 1QJEA 4Z2AA 5J48A 4DXTA 5FMOL 1BXHA 3VBSC 2JKXA 3C2UA 4L92A 5KHGA 2UWCA 5M0TA 1VBA2 2WSUA 1W0PA 4OI0A 2J7MA 3RWKX 4D6RA 2DBIA 2RR12 1WMFA 3AZZA 1UWWA 2GMPA 3B69A 3GBWA 4XFAA 2GC2A 4YGEA 2ETEA 3BCWA 2HWC1 3OPZA 3Q8EA 5DN2A 5AC93 4Y3OA 4FPLA 5LK7B 3AYAA 1YIFA 5LBCA 3JBG3 2E6VA 4K6BA 3ZN6A 1ZBE3 4CU6A 1ZZBA 3MIGA 3DYMA 2YC4A 5ABJA 2WJSA 1S1AA 2QTWB 3O0VA 3NV3A 3RMXA 2YGMA 4PLMA 4OMCA 2XHKA 2ZHNA 1ND2B 4CCMA 4KBBA 4PDWB 3A4UA 1GMMA 2CAUA 2JENA 3ATGA 3N7LA 1W0NA 1WKYA 4U36A 4WVZA 5F3EA 1OFNA 2OYZA 4XDPA 4XHBA 5FMOS 1FOD2 4DXZA 4OZXA 5BNQA 3UKVA 4CEWC 2VOVA 4K8FA 1S55A 1SDWA 3CLPA 4P9JA 4S2FA 4A3XA 1OF3A 4PIYA 2PELA 3RI9A 2KM2A 5CKNA 1Y43B 1W8TA 4IEPA 2VMEA 4RR3B 4YLZA 3ZDSA 1LJ7A 1HRI3 2FDGA 5FV3A 1YFWA 4GALA 3ELNA 2QQOA 1LU1A 4LHKA 1PIV1 4XDQA 4YW1A 2C5DA 1QJY3 2GN3A 2GNDA 4K21A 4ZU7A 4GWIA 1MS4A 4LO8A 3KT1A 3JB8A 4K40A 1PMHX 3AJYA 4PI0A 4MSVA 5GZFA 2WYFA 3IKWA 2PA7A 3LEKA 4ASLA 2PXJA 1OFSA 4X6RB 1LAJA 4RHV2 1UY4A 2JB4A 3M70A 4PLNA 1NAEA 1VMHA 1WZXA 2JJ6A 3FL7A 1JYIA 3M3IA 3AXDA 1XNCA 4CDQA 3RPQA 3I3DA 3LDRA 1DQ2A 5DZEA 1GZCA 4QPGB 2C0ZA 3CBNA 1F4AA 2WZ8A 1MPXA 1ULOA 2XL9A 3ZFFC 4XFCA 2VCAA 5K0UA 5A32B 2PQQA 4COUA 1BQPA 2J1AA 2ZGKA 1S4CA 4QHOA 1Q8VA 4EQVA 1VE0A 2VBPA 1IS6A 2ID4A 2UWAA 2A6ZA 2R042 2WZR3 4M0HA 1U0AA 1S0DA 4A44A 5FZCA 5GZCA 1YFXA 2WNUC 4RYDA 3E5UA 3ZR5A 5DZGA 1R093 3K2OA 4QX1A 2ZZJA 2JG8A 3K4AA 4DEVA 1OUSA 5JUVA 3LA3A 1WD3A 4WVVA 4AG4A 5DUXA 3N36A 4UXAA 3KV6A 4F83A 2EIDA 2XPJA 2X8KA 4UYBA 3HNMA 3VL8A 2DV9A 1JI6A 3PU3A 2PLV1 5KWRA 4XBNA 3WG4A 4XJWA 1CZSA 2WS92 4AVTA 1RHI2 1TME3 5FP8A 1CWPA 1YNAA 1UNBA 5EJZB 3RGBA 2OT7A 3IMNA 5IW0A 3WW1A 2B9VA 3KV5A 5CFCC 4L9BA 4WVWA 1LOAA 5F5CA 5FY5A 1EV12 5JWPA 1LCLA 1V6OA 3N3HA 4FTEA 3M7AA 2O8OA 1W99A
chains in the Genus database with same CATH topology
3KM5A 1HRV3 2ZGMA 2F6BA 3LWCA 1QH6A 2DTWA 5KBFA 1FMD1 3QOPA 2FQPA 1G9AA 3NJZA 2HWF1 4K1YA 1AX0A 3PVEA 1YLLA 1CAWA 1ZBA1 4X6QB 3H50A 4P9XA 4XEZA 4GULA 1WA4A 5FCCA 5K9YA 1PO12 1DQ5A 4M3CE 5J3UA 1RVF2 3N7KA 3FZ3A 3OJBA 4IEVA 1SLLA 2D44A 3WNXA 3A0NA 4V1PA 4KG0A 4FCAA 1NCRC 4S2DA 2XJPA 5AFEA 2VNRA 1QGLA 2WNVA 4LBQB 2ARBA 3LA2A 2H6BA 1EYBA 2HWC2 2XVKA 1OPOA 2YUEA 1MZEA 1PZ8A 3BPZA 1U5YA 4GH4A 4FO9A 1WGPA 1BBT3 4NO4A 2QVSB 2VECA 4RD7A 1S0GA 2RS13 2OZ6A 1H0BA 1KITA 1N1YA 1WW7A 4NOTA 3ZYJB 2DTYA 4K1ZA 2WC2A 4DPNA 2D6OX 4FPEA 1A78A 1AR71 4DS0A 1R1A2 4HANA 3WUDA 2GC0A 1VBB2 1O3RA 1OA2A 3VBFB 4CEYA 3V0BB 1JHNA 3AMHA 2GN7A 4OHXA 4IV1A 2DVAA 3OYWB 1HW5A 2ENRA 1MEC1 2VOXA 3N7JA 4MV2A 4UW5A 5DDJ1 2ES3A 2NN8A 5ACA1 3IN9A 1GBGA 2P3IA 1A3KA 2VMHA 1NQDA 1DGWX 2RS33 3M3CA 4OUSA 1TQ5A 1XE8A 1CAUB 4L8QA 4HBNA 1DU3D 1N3PA 2IXLA 3H3UA 5BXXA 4BE3A 1QDOA 5DG2A 3VZLA 4EN9B 3H1WA 1G9BA 1UIKA 2XVGA 3ZX7A 1B09A 1XU2A 3ACLA 1CQ9A 4TLFA 2B7YA 1RJ8A 2OUHA 1HQWA 3FJSA 2JECA 3B94A 5D8AB 2E7TA 2D3SA 1KDKA 1DQ6A 4AGVA 1AL21 2NMOA 4KG8A 4MGKE 1EAH2 4LA3A 4AQTA 4Q4V1 2UWBA 4FXKB 5CADA 3Q9OA 3T1LA 1ND2A 1BZWA 4Z82A 4PDWA 1JH5A 1ZRRA 5AC92 2BNOA 4KWJA 3R0RA 2WIIB 3QD6A 4Y1XA 4Y24A 1GV9A 1WMDA 4RQPC 4R9DA 2Z5WA 1KJRA 3URFA 3AP4A 4OI2A 5BNOC 1WUVA 5SV8A 3SLIA 1DQ4A 4E2GA 4RR3A 1WW5A 1QNYA 1H4HA 3NV4A 4Q0PA 4AVCA 3GZUC 4AI1A 1AVBA 3KQRA 4X8PA 3VBRC 3R4UA 4QGLA 4J6GA 2IWGB 3AZYA 1F2NA 4PIZA 3K48A 5JSRA 2VQAA 3MF9A 1SBDA 1RUG1 4MH0E 4BPZA 2VOWA 3ZXJA 1MVQA 1HXS3 1V00A 1CPNA 1SACA 2VVDA 3QBQA 4MLOA 3FLRA 1FV2A 4AFAA 3U0ZA 4QPGA 1YWKA 4Y20B 3VLBB 1LECA 4OI1A 3NW4A 5T50A 1QWRA 2BTVC 4HT1T 4C90A 1RUH2 2UYBA 1FMD2 1HX6A 3B7MA 5A32A 1RUC1 2ZTNA 2D93A 2ZHLA 4GMP0 3M3QA 1O91A 4IQPA 1WD4A 5DG1A 2Q30A 1AYM1 4NN0A 2QZ3A 4YM1A 2NZ9A 4N43B 1GYKA 4LLFA 2XWBB 1ZZ6A 3NSTA 4XQDA 4EN6B 2DVBA 2O0OA 2KA3A 4FP3A 2CWSA 5BNNB 4XYXA 3LOBA 5L7OC 4NVPA 4F7ZA 1N3OA 1RIRA 2JD4A 1RUD1 2WZR2 4XJAA 1SBFA 3VV1A 4MXVA 4E2QA 1XYNA 4NHLA 5D1IA 2XJSA 1WMEA 3BU7A 1U5ZA 2XJVA 5LEKA 3OCPA 4YW2A 2R32A 2TEPA 1AR72 2RS51 3HT2A 5JSPA 2WA4A 1O7FA 3WP4A 1COV1 1GFF2 4OHZA 1AXZA 1TME2 3K51A 1DHKB 4Q27A 4IEZA 3SITA 4BOWA 1LB2A 2XWJB 2ZPXA 3WG3A 3WXPA 2P17A 2V73A 4Z92B 1MEC2 2RJKA 2X5IB 1OI6A 3MICA 1TE1B 4LO5B 2GH2A 2E51A 4IEQA 1H8TC 1XNDA 3WG2A 3FMGA 3VBHC 3RJ2X 4NWVA 5JCTA 4AK3A 1W2UA 2UY8A 4YVWB 5IK5A 4JTOA 3MI8A 4XIKA 3EBRA 1ZNPA 3C3VA 1AHSA 4L99A 5LEJA 3AYDA 1DYKA 2G9FA 4LBQA 1UF2C 1HQLA 1PVC1 1SQ4A 4B7EA 1NA1A 1FPN3 1O4YA 2FZ1A 4UW6A 3KMHA 5JZGC 1J58A 3WT3A 4D7YA 5IK4A 1JW6A 2BFUL 1HQNA 1LHOA 1W0OA 3FBYA 4Q4V2 2AYHA 1ZA4A 5CG8A 5H9QA 1VALA 1V6KA 2P3JA 2W68A 1QF3A 2D40A 2UYAA 3AP5A 1G9FA 4P9LA 3VBFA 2WLPA 3V0BA 1IS3A 3PHMA 2R063 1R083 1SFYA 4CDXB 3T2TA 3AP9A 2EA7A 4P9WA 4DRRA 1LOFA 3WX5A 4XF0A 2ZA9A 1ULFA 3DF0A 4Q0QA 3ZSEA 1D0HA 4YM2A 4XF9A 2CV6A 3JD71 5FBZA 4SBVA 1CAUA 3RS6A 2A7AA 4E4SA 1AR63 5T5JA 1DGLA 4KU7A 2NLRA 4N53B 4DY5A 1NCQB 2BFUS 4RSUA 3BODA 1OOPB 1REFA 4DRVA 4H7MA 1CONA 4M00A 4OFGA 4UBGA 4I0WB 2VVFA 1QJU1 1REDA 2HKXA 3MGUA 5D8AA 2E7AA 2QUOA 3RQ0A 4RS5C 1DBNA 1Q5OA 1GZ9A 1V6LA 2D5FA 3MIHA 3PMEA 1S0JA 2ZX4A 2IXIA 1MZFA 2V09A 3V64A 2VOKA 3DKWA 1V9U2 1KS5A 4K7JA 3WDUA 1D4M2 1RUC2 2TBVA 4Y4YA 4AFMA 2Z69A 3TN92 1MS3A 1Z7S3 4JGZB 4YZ1A 5KXDA 1IOAA 1KJLA 2BVVA 3ZMOA 4Z8BA 2WT2A 4BHPA 1RINA 2Q1MA 3DPRB 4S2HA 3RI8A 1BMV1 2ZMLA 2FMDA 3L9JT 1LHVA 2CY6A 1QKQA 1VBD3 2HWE3 3I8TA 2WZPP 2RR11 3MLLA 1GR3A 3WD5A 4BM8A 1LRHA 2GMMA 1AR83 1Z0HA 4PCRA 4WM7A 3U10A 3ZYIB 5IT6A 2DFBA 3MFAA 1J3QA 1QHDA 1JBCA 4GKYA 2RMU2 4IL7A 1B35B 5KHHA 3ES1A 3SH5A 2E63A 3MEPA 3O12A 3ZVXA 3UKTA 1OA4A 1ZX5A 1DGRA 4AHYA 3R4SA 1S2KA 2A71A 4AEDB 1FOD1 2QQPA 2I07B 3VHPA 4E4ZA 4Y20A 5DUVA 2OW4A 4FAHA 2ARXA 3FX3A 3VBUB 1RUJ3 3WHTA 1NG0A 1W6PB 1FATA 4BA6A 1DFQA 1YJLA 3V0AB 2NM1A 4LHLA 3B01A 1MACA 4G9SB 3ZFEB 1UU6A 1OA3A 1W39A 4N43A 4CP2A 4WZFA 1YIPA 1ULCA 5JOXA 1H9WA 3D82A 5BNNA 4CDUC 1AYN1 4LULA 3VDDC 1LENA 2HYKA 3ZSLA 3L2HA 4RHV1 2RHPA 4GB31 3UV9A 4J1XA 1PGSA 1UPSA 2B46X 4FPYA 3KT4A 2NMNA 3AZXA 3VHOA 3CJIB 3FLPA 5FTTC 1F8VA 1LTEA 4YM3A 3W9AA 1LU2A 2MHFA 3RYKA 3PJYA 3VZNA 2B9UA 1KDMA 3D5OA 1UL9A 3IM0A 3VBSB 1CX4A 2UURA 3NAPC 3TBDA 2R041 1XNKA 1I5ZA 4FP2A 5JIAA 2A5ZA 4Q0UA 5C8CC 2ZHKA 4PF5A 3IT8A 1FNZA 3UJOA 4QGNA 1AR93 4WZCA 1S0IA 2YDEA 2TNFA 2X5IA 4LEJA 5TSWA 3SCHA 5BUVA 1U5XA 2A3XA 1AX1A 1WCKA 5GALA 1V70A 2WS91 2E53A 1PNFA 1RHI1 3A0KA 3FC0A 2GNBA 1TMF3 2YROA 5JOWA 3AK0A 1QNWA 5JSOA 2D6MA 4YVWA 4CEWB 1JUIA 2WQ4A 1EV11 5F9TA 1K5MC 5T5LA 3RJRA 3ZIXA 4COWA 5JMCA 4P9GA 2BPA2 4W6YA 1VIWB 2DCYA 1HLCA 3V65A 3JQWA 2YC0A 3AZWA 4OULA 3PMSA 4AQSA 4ATFA 2WFF2 4JGYC 2MEV3 3W59A 5K7PA 5CIRA 3ZXDA 1FX5A 4NHKA 1X50A 2HWB3 4YM0A 4YVSC 1PO11 1UKRA 2KXLA 3UK9A 3H8UA 2XL7A 3ZO0B 2P34A 1FPN2 5T54A 5HI0A 3ZXLA 4CDXA 3ZFFB 2BNNA 1BVP1 1BVVA 3OBRA 2AH2A 3M8LA 3N7MA 4OHYA 4S2GA 4ORFA 1DF0A 4FXGB 1IS4A 1GANA 4R52A 4D7TA 4N53A 4O9GA 1NCQA 1GNZA 1Q43A 4O9EA 2WNUB 1OOPA 4D94A 1LKNA 1ULEA 1RUE3 1JYCA 3D6EA 3AZVA 1ENSA 2D6PA 1R1A1 4MGYE 1VBB1 1YRZA 4YNIA 2BUKA 1G9DA 1JOJA 2YMZA 4XTMA 4QXKA 4AF9A 4XPVA 1Q3EA 3MZHA 1CD3G 1URXA 2VG9A 3AMPA 2GH8A 3GHNA 4Q2FA 5E16A 5FO8B 4DOUA 2ERFA 3ZXFA 5GJ6A 3I54A 1JTZX 4PLOA 5JIUA 2JG9C 1F31A 2ZGLA 4K9SA 2BQPA 5CFCB 1HV0A 3AYCA 4JGZA 1S0CA 2XGXA 1POV1 4QT6A 5HCBA 2XJRA 2JE7A 2VU9A 3DPRA 1YCIA 1DZTA 3D0JA 2PLV3 2VW0A 2ZKLA 4Y26A 1S0BA 4KWLA 3EHKA 3RSJA 4YZ3A 1AYN2 1SCSA 3AJZA 4KWKA 2PAEA 4XJ9A 1Z7S2 1AXYA 4ZXKA 4GB32 3KCYA 1Y7BA 1HV1A 3GHMA 4Q8KA 1EAH1 1BJQA 4LUMA 2PHWA 2DURA 5EFUA 2ZABA 1XE7A 1B35A 3CF6E 4MYEA 1VBD2 2HWE2 2ZMNA 4XJUA 1LGNA 1NCRB 1WBLA 2O8QA 3MDPA 5AC91 3SCGA 3TRSB 1UPIA 4YFWA 5JR7B 5J7MA 1AR82 1QQP3 1ZBA3 2EF6A 4IEWA 4AEDA 4ES9A 2DCTA 1C4RA 3WDXA 1ZBE1 2OZJA 5KC5A 5FQ0B 3ZXEA 5EXOA 3ZPYA 3VBUA 2EALA 1QH7A 1W6PA 3WDWA 4BMEA 2D3RA 4PJYA 3V0AA 1C28A 3ZFEA 4CYDA 5JDBA 4ES8A 1CJDA 4JRAA 2AZ5A 1N3QA 4TSVA 2WWSA 2EIGA 1VLNA 1RUJ2 1WLDA 1VRH2 2IXJA 4LUKA 1H2MA 1HRI1 4L11A 3POWA 2P37A 4AGGA 3ZYRA 2C9AA 2GNMA 4IEUA 5FLHA 1YUDA 4Z1VA 1AJOA 4H55A 5CFDA 2IXKA 3VL9A 2PFWA 3CJIA 4I3GA 1RUH1 4C0BA 5I8YA 2AREA 2IXCA 3VBSA 4AI0A 2E9QA 5JPMB 1BEV3 3AMQA 4P5HA 5A3MA 4IV3C 1OPMA 5CNAA 4XILA 5ACA3 3IPVB 4A7KA 2HWD2 2Q4SA 2DCZA 5I91A 4KGGA 3SNMA 4XBLA 4WBBA 1WW4A 3U4XA 2DUPA 4QX5A 2CWMA 4INDA 5GZEA 4QQPA 3OF1A 1MZ5A 4Q4W3 1VAVA 2WZR1 2XBO3 2XUMA 4BLIA 1M06G 5IUQA 1R091 1X33A 2YYOA 4Q4X2 4M0NA 2R1DA 1AL23 4CEWA 1REEA 2R16A 4IERA 2X53S 4RQPB 2ZGUA 1FXZA 1RUI2 4RL7A 5BNOB 1X8EA 4YGDA 4JV4A 1VB2A 4R8HA 2ZGPA 1TME1 1X36A 1YJKA 4HSLA 1VBC3 4EN8B 3VBRB 4ASMB 2R0FA 4Q0VA 5I0SA 4N7UA 4XFIA 3WW3A 3H7YA 4KU8A 4HETA 3AKRA 5F6LB 4AYUA 1C8M2 1D4VB 1RMU3 3INAA 5T55A 2W39A 1M4WA 4DNYA 4QGMA 5FFOC 1C8NA 3AKSA 3VZJA 1WLWA 2LM3A 3ZFFA 4GMP3 3U11A 3AMMA 1S2BA 4YG0A 2DCKA 2MEV2 1OQ1A 3P3NA 4EWDA 3B5LB 1RUG3 1V6NA 4AFBA 4YZ5A 2GZWA 1W6QB 3TNPB 3ECQA 2WNUA 3JZVA 2R6QA 2H6CA 2G9GA 3EXUA 5I8TA 3OTFA 4CDWC 3WQ1A 1ND3C 4Q4Y3 3E6BA 5L7OB 4MZUA 1IPJA 1MVEA 1LOBA 4YYOA 1U5IA 3O7OA 2WSVA 5GLVA 3JBG2 1MS9A 1ZBE2 1BBT1 5C8WA 1HDKA 4I0AA 1AYM3 2RS11 3FE5A 3RDIA 4OLLA 3UKNA 1W6OB 2QNKA 5C4WC 4LLOA 3WY6A 4W6WA 3WQ0A 2RE9A 5CFCA 2OPKA 4I3PA 4QQHA 4AEKA 3KB5A 1MQTC 5JLVA 3MW3A 1CAXB 2VH9A 3L2YA 1RUD3 1ASJ3 2LUWA 4ZU5A 5T3NA 4WM8C 3KZ4C 1X7NA 3RNSA 4DFSA 1HRI2 4MX3A 1QJY2 1H8TB 3TNQA 1WCDJ 2RS53 3MIBA 5A33B 1LGBA 1COV3 4P9YA 4HLTA 1V9U1 3VBHB 2ZHMA 4EWAA 4XXAA 1D4M1 2QKDA 1MZ6A 4U2AA 3TN91 1NCRA 4I2OA 2PHTA 2QDNA 2XJQA 4GQ7A 5CA6A 1APNA 1LHWA 2P2KA 1JUHA 4MUVA 4Z2WA 5FRAA 4FQZA 2WLQA 4LT5A 5JOZA 1A6CA 5I93A 1PZ7A 5GLTA 5FQ0A 1ZZCA 4QPIC 1G86A 1OSGA 4FAGA 5JZGB 2F4PA 3EQEA 4FSJA 2ZX2A 4CP0A 2ET7A 2UU8A 1PGW2 1WLCA 2D6LX 3B02A 2Z42A 3ZIWA 2VW1A 1OLQA 3ST7A 3S0MA 4B29A 1R092 1PVC3 2RMU1 4FTBA 1PO23 5F6KA 5E89A 3I7DA 4FOWA 4HFSA 3X29B 4PIXA 3WDVA 2VW2A 3ILFA 5J96B 5K8SA 1MS1A 5L19A 1QXRA 4WVMB 1D2QA 2XH6A 3MIEA 5F5QA 1VBE3 4XMAA 4AXOA 3R4DB 1YI9A 2GU9A 5FOBB 1ZZ8A 1PK6C 3VZMA 1QJX3 2Z2SB 1QY4A 4IEXA 3OGJA 2JDZA 5KXBA 4R9AA 1D0GA 1L3JA 2ZGNA 2MPFA 2VGDA 3B9CA 1VP6A 1NLSA 3IPVA 2DCJA 3VGIA 1HRV2 3JD73 2PHFA 4XOGA 3WDYA 4RS5B 3ZFGC 1SLAA 2RM23 5I0TA 3VKFC 1CJPA 1X8MA 4JCKA 3IBMA 3THPA 1TEIA 3PVNA 4AFCA 4F3JA 5BNPC 1YHFA 1LOGA 1Y3TA 1TNFA 1W6NB 4CRQA 3VBOC 2ZGTA 5HBAA 4RQPA 2FHRA 4Q4W2 1S0FA 5BNOA 3LKJA 4MXWB 1CAVB 3B93A 3VHNA 4G4FA 2A73B 2G4IA 1BBT2 3OYWA 1DYPA 3ES4A 5H9PA 3VBRA 2RS12 4OI4A 5J36A 4FQ4A 2OVUA 2CTVA 2YPJA 1VBA3 4COVA 1QDCA 3QCWA 2RR13 4M3CB 5KXCA 1VBC2 3PVOA 2BYVE 1J1LA 2AUYA 3RRDA 1SCRA 2EAKA 3MF6A 3USSA 1G7YA 2C1FA 3LZZA 2ZZQA 2R073 3LGRA 4Q1PA 2RS32 1JN2P 1O4ZA 1IHMA 1LOEA 1RMU2 4QU2A 2ZGOA 1W6QA 2EVXA 3VZOA 2R30A 1FOD3 4GWNA 3I59B 3ZYGA 2ZAAA 1UIJA 4FT8A 2WFF1 4CDUB 4XE9A 1ZZ7A 5L7OA 4LHNA 3VDDB 2GC3A 1UD1A 4B3NA 1IKPA 2W08A 4LBJA 2DVGA 1NY72 1NXD1 2D6NA 1FPN1 5GZGA 1O3TA 4F8AA 1XRUA 1W6OA 1NE4A 3AXEA 2YGLA 5C9AC 5GLUA 4QMAA 3FFZA 1F9KA 2IZWA 2ZMKA 4DY3A 3NAPB 2EXKA 4M3CF 4XIOA 4H3WA 4G3YC 4AVVA 4FVVA 1O5UA 4RHV3 4NHMA 1CAXA 4YZ4A 2K0GA 3J8F3 4JC1A 2R061 3WP6A 1H1MA 1GKBA 3S7IA 4LO7A 4AI8A 5C8CB 3OD0A 2ZS6B 1KXGA 4FPHA 1I3HA 1R1ZA 4LR4A 4L2NA 3JQXA 1QXJA 4LBNA 1NQJA 4B4RA 4PBPA 5J37A 2Q8OA 4URTA 1H8TA 2R043 4XBQA 4XF3A 3AP7A 1ZREA 5AVPA 5A33A 1BK1A 4BYYA 2BBVA 4DB5A 1F5FA 5KXEA 2ZCWA 3VBHA 3FBMA 1XYOA 3CNAA 4Q29A 4JRLA 5E88A 3WV6A 3N4MA 1DG6A 2W52A 4JDOA 1HXS2 1K5MB 1IS5A 2PAMA 3ILRA 1O5LA 4LE4A 4XXPA 1N1TA 1SFNA 1MR5A 2IXHA 2WS93 5ABJC 1RUF3 2BEOA 2ZJCA 4HKLA 2XG3A 1SLCA 1CPMA 5JZGA 1UU5A 4FBFA 5GKAC 3E6CC 1DZQA 1UCXA 1Z7S1 4XETA 1A8MA 4JGYB 4YRDA 1DGWA 2B5HA 4FPFA 3OD4A 2IFRA 4YVSB 1H2KA 5J98B 4JAAA 4OVEA 3OGGA 1H2NA 1PHMA 4BH9A 5GM0A 1VBD1 2HWE1 2YV8A 2VUAA 3MIFA 1CVNA 3EJKA 4YARA 4GIQA 2DU1A 4Q0SA 3LOIA 1VJ2A 1ZVFA 2K9ZA 1AR81 1OQEA 4WVMA 2HJIA 2XKOA 5E1RA 4UBHA 2HEWF 4LBQD 1PO13 3ASIA 2D43A 5FLJA 2Z79A 1RVF3 1PO22 1EPWA 3WHUA 2JICA 3WP5A 3ROUA 2XKPA 3HMYA 2DF7A 3MFCA 1KS4A 4TZDA 4LBKA 4Y22B 4CDQC 4XQ4A 3HN1A 4YGCA 3QLQA 2Y26A 2ATFA 3GNEA 1J1TA 2HWC3 4RS5A 5K0UC 1H8VA 2CGPA 1ZRFA 1RUJ1 4JVAA 1VRH1 5T5PA 1OD5A 4EV0A 4YW4A 3TAYA 4NPRA 2JG9B 3WZ1A 1C1LA 3GBGA 4Q26A 2D6KA 2R1BA 1W6NA 3P3PA 1R1A3 3KSCA 2VNOA 4LNVA 4YW3A 3H9AA 3WQ7A 3O5SA 2A3WA 3S6PA 2A70A 2JG8C 4IESA 1XYPA 4HK8A 2EXHA 4YW5A 2ILMA 4UW4A 2SLIA 2QDRA 3DN7A 1MS8A 3POYA 4AHWA 2A6YA 4MXWA 1OMIA 4HZFA 1CAVA 4HVOA 2HWD1 2XLGA 3KCXA 2AGSA 1ZRDA 4I09A 4I0BA