1C8M2

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
total genus 59
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m200
4CEWC 3VBOC 1PIV2 2ZZQA 3JBG1 5C4WA 1MQTA 2WS91 1FOD2 1TMF2 4CDWB 4YVWB 1RUH3 3HAGA 1AYN3 4GB32 2WZR2 1HXS2 1QJY2 1HRI2 1R092 2HWD1 1NOVA 4IV3B 1QJU2 1AUYA 2HWC1 4N53B 5BNPA 4RR3A 1D4M2 4NWWA 4AEDA 2MEV1 5L7OA 1PVC3 2FZ1A 1NA1C 1CJDA 1ASJ3 1AR63 3VDDC 5J98B 1AR72 4IV1B 1FMD3 2ZTNA 1HRV2 1ND3B 2DF7A 1RVF1 1H8TB 1EV11 1NY72 1QQP1 2RR11 4WM8A 4PDWB 1RUD3 5D8AA 3J8F2 3TN91 1VBB2 5CFDB 4RQPC 4Y5Z0 1AR82 2R072 2HWE1 1PGW1 4QPIA 3ZFFC 1PIV3 2R061 1VRH2 4RHV2 3VBOB 5DDJ2 1BEV2 1FOD3 1B35A 1TMF3 3ZFEC 1RUH1 1AYN1 4GB33 3JD72 5A32A 1RUE2 1VBA2 5BNOB 2WZR3 1QJY3 1R093 1HRI3 4WM7C 1IHMA 1OOPC 1QJU3 2X5IA 4RS5C 1D4M3 5GKAC 2WWSA 1RUJ2 3DPRA 1PVC1 1TME2 1RMU2 1ASJ1 1AR61 2PLV2 5ABJC 1COV2 2GSYA 3CJIC 1OHFA 1AR73 4RFT0 1FMD1 1HRV3 1NA1B 3VDDB 3VBFA 3NAPA 1BMV2 4EJRA 4CEWA 4QPGC 2IZWA 4FTSA 1NCRC 1RUD1 1E57A 4YVSA 1AR92 2BFUS 3VBRB 3VBUC 3J8F3 1ND3C 5BNNA 3JB8A 2QQPA 1AR83 1NCQA 1H8TC 2VQ0A 3FBMA 2R073 1K5MC 4CDUA 4JGYC 1PIV1 3VBSC 5JZGC 1VRH3 4JGZA 1ND2C 4RHV3 3ZFFB 4LLFA 5DDJ3 5CFCA 4CDXC 4Q4X2 1FOD1 1TMF1 1PO12 4GB31 3JD73 1RUI2 1RUE3 5C9AC 4N43C 1VBA3 3ZFEB 2WZR1 4GH4C 1PO22 1QJY1 1R091 1HRI1 1VBE2 4SBVA 2R063 1QJU1 1VB4A 2WFF2 4WM7B 1OOPB 1D4M1 3IDEA 1RHI2 1RUJ3 4RS5B 5BNOC 1AL22 2PLV3 1COV3 1V9U2 1AR71 5C8CC 5AC92 2HWF2 1HRV1 4RQPA 5ABJB 3CJIB 4Y4YA 4CEYC 1NY71 1OPOA 5K0UC 2XBO2 4QPGB 1AR93 2BPA2 3J8F1 3VBHA 1NCRB 1AR81 2R071 3VBUB 5A33B 1K5MB 3VBRC 1VRH1 3ZFGC 4RHV1 4JGYB 5DDJ1 1C8NA 3VBSB 4Q4X3 1BEV1 4CDWA 5JZGB 4YVWA 2WS92 1C8M2 1MEC2 1PO13 1ND2B 4GMP3 4CDQC 4CDXB 3JD71 1RUI3 1RUE1 1RUG2 1VBA1 1PO23 5A32B 1VBE3 4IV3A 5C9AB 4N43B 4FTEA 2WFF3 4GH4B 4N53A 5C4WC 1MQTC 1RHI3 1RUJ1 1TME1 1RMU1 1AL23 2PLV1 2GH8A 4IV1A 1COV1 1V9U3 1AYM2 1A6CA 5AC93 2HWF3 4Z92B 1ND3A 1HXS3 2Y26A 1H8TA 5C8CB 1BMV1 4PDWA 1R1A2 5BNPC 4RR3C 2XBO3 2HWB2 1M06G 4AEDC 5L7OC 4CEYB 1AR91 1WCDJ 5CFDA 5K0UB 4BCUA 1W39A 2BFUL 1CD3G 1HX6A 1VBD2 3VBOA 4WM8C 5D8AC 4Q4X1 1C8M3 1MEC3 1PO11 4GMP1 1VBB3 3ZFGB 4FTBA 2RS32 2RS52 1RUH2 1RUI1 5BNOA 1RUG3 1PO21 4CDQB 1VBE1 1R082 1VAKA 2WFF1 2ZAHA 1QJX2 1VBC2 1B35C 1BEV3 1RHI1 1RUC2 1ZBA2 2RMU2 1PGL2 5C4WB 1NG0A 1MQTB 1AL21 5ACA2 1V9U1 1AYM3 5AC91 1NA1A 2HWF1 3VDDA 1HXS1 2X5IC 1R1A3 5LK7B 1QJZA 2XBO1 2HWB3 3VBRA 3DPRC 4Q4V2 1RUF2 1X36A 5BNPB 1TME3 4RR3B 1RMU3 1FPN2 4AEDB 5L7OB 1BBT2 2RS12 2RM22 2R042 3VBFC 3NAPC 1GFF2 1VBD3 3ZFFA 1EAH2 4YVSC 1Z7S2 5FMOS 4WM8B 1C8M1 1MEC1 1VBB1 5BNNC 5D8AB 2RS33 1NCQC 4Q4W2 2RS53 3ZFEA 2WLPA 1RUG1 1ZBE2 2FZ2A 1R083 4Q4Y2 4CDUC 4WM7A 4QPIB 1X33A 4JGZC 1OOPA 1F8VA 3JBG2 5CFCC 1QJX3 1VBC3 4RS5A 1RUC3 2RMU3 1ZBA3 4FSJA 2BUKA 3ZXAC 1B35B 5ACA3 1AYM1 5ABJA 3CJIA 5FOJB 1F2NA 2HWD2 1R1A1 2HWC2 2HWB1 4QPGA 3JB4C 2X5IB 4Q4V3 1RUF3 1NCRA 2MEV2 1FPN3 1SMVA 3DPRB 3VBUA 1BBT3 2RS13 2RM23 2R043 5A33A 1K5MA 1RVF2 1VBD1 3VBFB 1POV3 3NAPB 4JGYA 1EV12 4NWVA 1QQP2 3VBSA 1EAH3 5JZGA 4CEWB 1Z7S3 2RR12 1ND2A 3VBHC 4CDXA 4YVSB 2RS31 4Q4W3 3TN92 2RS51 3S6PA 5BNNB 3M8LA 1ZBE3 1NCQB 2HWE2 1R081 4Q4Y3 1PGW2 4N43A 5C9AA 2TBVA 4GH4A 2R062 3JBG3 4CDUB 1QJX1 1VBC1 4CDWC 4YVWC 1RUC1 1ZBA1 2RMU1 2WS93 4JGZB 1PGL1 4GMP0 5CFCB 5ACA1 2BBVA 1AYN2 4QPIC 5C8CA 4IV3C 2XPJA 1DDLA 2HWD3 4N53C 2HWC3 4CEYA 5K0UA 4Q4V1 1RUF1 2MEV3 4IV1C 1PVC2 1FPN1 3LOBA 1BBT1 1ASJ2 1AR62 2RS11 2RM21 1HQNA 2R041 1FMD2 4RQPB 1RVF3 4PDWC 1POV1 1POV0 1RB8G 1EV13 5J96B 1QQP3 1EAH1 1Z7S1 2RR13 3ZFGA 5CFDC 1RUD2 4Q4W1 3TN93 1AL0G 1VB2A 3VBHB 5FMOL 4CDQA 1ZBE1 2HWE3 4Q4Y1
chains in the Genus database with same CATH superfamily
4MGSA 1LHWA 4OI4A 2O8QA 4COZA 2W46A 2ES3A 1Y9MA 2ZX1A 1TNFA 5A3LA 1BK0A 5C4WA 3OEBA 2YU2A 2WRAA 5A70A 1SACA 1WD4A 2X29A 4MADA 1SZBA 5F39A 1YLLA 4GB32 2J7MA 2FQPA 2I07B 3KCYA 5BYNA 2X53S 5KXDA 2ZEZA 5B4XA 4OHYA 2DCZA 2HWD1 1UXZA 3HNBM 3LZZA 5FYTA 1NOVA 1NQDA 3N3HA 4FCAA 4XILA 4UXAA 3AKSA 1AUYA 5LCWL 3OGVA 3DYOA 5FZ7A 3VKNA 5FXWA 1W9YA 1D4M2 3BALA 1WBLA 1BCXA 2MEV1 3H0OA 3WG1A 4AEDA 5L7OA 1C57A 2WO2A 3I3BA 1JI6A 2ZEYA 2DURA 2O1QA 1O8PA 4YRDA 3V65A 1MZEA 3USUA 3RJ2X 3TNQA 4OFGA 1OSGA 4EN8B 1U12A 1HRV2 1FT9A 3KT1A 3MGUA 5FV3A 5GALA 5I0DA 4QKNA 4PI0A 1ND3B 1LOEA 3S7EA 2VL4A 1W6QA 4IGPA 1H8TB 5FZGA 3HN1A 5FYBA 1WD3A 2BBAA 1JOBA 2I2SA 3R4SA 1DLCA 4E4DX 1GZ9A 4WM8A 1LHNA 4W50A 4Y1ZA 3W58A 4A4AA 5A3NA 3C7EA 3WZ1A 1LENA 1Y9QA 2ARAA 3TN91 5CFDB 5IWFA 2XJPA 2GMPA 4XFAA 3VD4A 1LU1A 2VUCA 1J59A 2D98A 3MF9A 3TYJA 2VH9A 2VOWA 5K9YA 2AEZA 3A22A 4DQAA 3MIGA 2BJSA 2OPWA 4OHVA 1UNBA 1VMFA 3ZIXA 5DDJ2 3AZXA 4IGQA 1OVPA 3RI8A 1N47A 1OH4A 1FOD3 1GNHA 4C1XA 1LB2A 4LOSA 3LA7A 4XEZA 4BH9A 1LTEA 3J7NA 2WBKA 1ZRCA 1W0NA 4LBMA 1DBNA 1I5ZA 2PHUA 1VBA2 1OLQA 3VL8A 4XJ8A 2WZR3 1EUTA 4WM7C 1HRI3 5FZ0A 1Y9GA 2BEOA 2FCUA 1SDDB 3THCA 2WZEA 1BXHA 2E7TA 2Y6KA 1QJU3 3GCXA 2GC2A 2X5IA 4QDQA 4RS5C 3IIIA 3E5XA 3SLIA 2ILMA 1S1AA 1VJ2A 2PAMA 1J3PA 3DPRA 1AR61 3T0BA 1COV2 3PUQA 4LUKA 1OA2A 1L7QA 4MVTA 5FUPA 1GBGA 2QQLA 5T5JA 5IVEA 4CPBA 2F4PA 3VDDB 1UU4A 1KXGA 2ZX0A 3TNPB 3CJXA 1TQ5A 4MHRA 3WUDA 1GV9A 4EJRA 5JXIA 5FZCA 3MUY1 2WZPP 4FTSA 2P1BA 2Y60A 3AMQA 4GWMA 4MLOA 4ZXEA 3T30A 5JOZA 5H9QA 2FDIA 2BW8A 3GBGA 4XCAA 1X82A 5LA9A 5FAXA 2E53A 3QH7A 3LKJA 3J8F3 1MS1A 2W91A 3SC7X 1ND3C 4QGNA 1W6PA 2IXLA 2JXAA 3HVDA 1H8TC 1UWWA 2BGPA 3FBMA 3GF6A 2R073 3OBRA 4QPYA 4TLGA 1W28A 4QGLA 2PHFA 1Y4WA 3OBAA 3D0SA 3KV6A 1ZRRA 4YARA 1PIV1 4M01A 3WW2A 1SBEA 4DXRA 3O0WA 1OKOA 3HWJA 5L9BA 2F4LA 2EXHA 4BXSV 5JVVA 3ZFFB 1G8WA 4QM8A 2WYSA 4G9SB 3U1XA 1JZ3A 2Z4FA 1VMJA 1EPWA 1YNAA 3CHXA 4MGYE 4YG6A 1WMFA 2LROA 2D6OX 3UGFA 1UY4A 3ZMNA 3JD73 4QX1A 1MZ6A 1RUE3 1W9WA 4EWAA 5FJHA 3J7HA 5GLUA 4TSVA 4QX2A 5BXXA 3ZFEB 5C70A 5FQ0A 3V0BA 1ZRDA 3U14A 1R091 1W0PA 3RYRA 5HPOA 5SV5A 1BKZA 3DEMA 2P6HA 3POGA 4IEOA 2R063 2YBSA 1G6NA 1STMA 1S0DA 4UFIA 3APBA 3H8UA 1UOGA 5FTTC 1OOPB 3AP4A 2C26A 3AC0A 2WQ8A 1RHI2 2VBPA 4I3PA 3WF3A 3WF0A 4B7EA 1RUJ3 1UX6A 4Q26A 3RZMA 1MS5A 3WCSA 4UW5A 4YGCA 3N7LA 1ENXA 2ZGSA 3WNLA 4Q5OA 1V9U2 4A44A 2PHTA 5D1IA 5KHIA 1OLME 3ZPOA 2P4EA 4LBOA 1G9DA 3E5QA 3ITQA 5F3GA 3CJIB 1Y7BA 2ZPXA 3ZR5A 1OPOA 4XDQA 3PTYA 1CIWA 2VMIA 2BP6A 4H14A 1OT5A 2DCJA 4AVVA 4UF0A 5LASA 5CISA 5JXGA 5FXZA 2D97A 1UL9A 4J25A 1W0OA 4DINB 3VBHA 1BZWA 1NCRB 4H7MA 4QXCA 1AR81 5F3EA 1JN2P 3WNOA 3VBUB 5GZCA 5IK4A 3FLRA 5FZ9A 2UY8A 4ZPIA 3P6BA 4META 5CKQA 4HN1A 1C1LA 1SBFA 1KEXA 1VRH1 4HG6B 4XF9A 2YROA 1S0FA 1O4YA 3VBSB 4Q4X3 2JE9A 1BK1A 2PHWA 5IVCA 4NIDA 1MEC2 1PO13 1MS4A 4FOWA 1IG3A 4CDQC 4I30A 3FUQA 1B09A 1CIYA 2WT2A 3I2FA 4XZPA 2E7AA 4QQOA 2DBIA 2P3IA 4I0BA 1UU6A 2ORZA 3ZSMA 5A32B 1VBE3 3N4MA 4FPKA 4ES8A 4YWAA 3UJOA 3T09A 1FX5A 2WFF3 1PNGA 1CQ9A 4IEWA 1MQTC 3I4IA 4RN5A 3KGLA 3JQXA 4UFMA 4IEUA 3KQRA 4CCKA 5EJ1B 5C3PA 1S0IA 2GP5A 2VULA 3W59A 1JYIA 1TME1 1LHVA 4SLIA 4K9SA 1AL23 2PLV1 3I2GA 5FYUA 2WO1A 3CO2A 5JMCA 1ND3A 1QHDA 2NMOA 1W06A 1FYUA 3ETQA 1H8TA 3GGLA 4YGBA 5DG1A 5C8CB 4M3CF 4V2WA 3RMXA 1C5HA 3HPNA 5BNPC 4RR3C 4JV4A 2W94A 2KA3A 1QJEA 3POBA 1UYPA 1AR91 5CFDA 3TEWA 2P3YA 3B9CA 2ERFA 4AW7A 5KHKA 5FWJA 3VDBA 4E9KA 4RFRB 1NKGA 2XKPA 3H8OA 2J1AA 1KFUL 2VMFA 4HMZA 1N3PA 4ZY9A 2VTXA 2VW1A 2X09A 5CZKA 1XNCA 3O0XA 4ISRA 4LKEA 4GAZA 3B7MA 4JDNA 3LDRA 4B29A 1E5SA 4OI1A 3E6DA 3ZXKA 3HEIA 1WMXA 1SG3A 1ULDA 2VW0A 2VZUA 2ZXQA 4UI9L 4LBQB 4XBLA 3AKQA 3OBTA 4DO0A 4GMP1 1VBB3 2ZCWA 2VO5A 1RJ7A 4QQHA 4UFLA 4HONA 4JKKA 4JZRA 1CGPA 1W8ZA 5FY7A 5I8SA 4FPYA 2DBNA 3N9MA 1VIWB 2PN5A 1QXJA 3MYXA 1CAVB 1TZOA 4O65A 2W95A 5LK5A 1QJX2 2NM1A 1B35C 1BEV3 3UK9A 1PGL2 4PBOA 2DYCA 1ZZ7A 2R32A 2BZDA 3LDBA 5T5OA 3K3OA 1ALYA 4Q29A 4A7YA 5HCHA 4OI2A 1TNRA 5CEHA 3THDA 1JXNA 3VDDA 3ZVXA 3U07A 4OUSA 1UIJA 5J36A 2ARBA 3IBMA 4AYUA 3AMHA 4NPRA 1O3RA 2WWUA 2AGSA 3WG2A 4NHLA 4Y3OA 5LK7B 2VTFA 2WL1A 2XBO1 3OUJA 1GKBA 3UV9A 1SDWA 4P5HA 2XWJB 2E26A 1RUF2 5CA6A 2AENA 2EIBA 5FP3A 3PVBB 2V4AA 1FPN2 1GOHA 1N1SA 4PHZA 1KFXL 2ADDA 1DZTA 1RC6A 1WW7A 4R9CA 2RS12 2RM22 4CRQA 3AMPA 5DZEA 2IVJA 4N8MA 3OY8B 3WNXA 4AK3A 4CP9B 5DPNA 1I1EA 2CL2A 3LPFA 2OVUA 5DUVA 4DUWA 1UOFA 4FT8A 4LLOA 3ZFFA 2JG8B 3F95A 3PVOA 1UMIA 4QB1A 4MXWB 2CWSA 4WVWA 3VD5A 3ZN5A 4B1MA 2JKXA 1VMHA 2GN7A 2P2KA 5BNNC 5D8AB 2RS33 3C7OA 5G05L 2WN3A 3ZFEA 1ENQA 1RUG1 2OW4A 4AF9A 2FD8A 1ZBE2 2AYHA 2ZA9A 4RGGA 4YW3A 1VRBA 1R083 2IC1A 4FOQA 4PIZA 4Q4Y2 4CDUC 4FXKB 3PHMA 5GJ6A 3NNMA 4R52A 1XB9A 4QMAA 4HBNA 1OOPA 3JBG2 5LBFA 1A3KA 4DXZA 4QX0A 4AEMA 1AXKA 4FSJA 4P9IA 4MOAA 2BUKA 5ACA3 1AYM1 4LBLA 3U10A 4CXYA 2ZX2A 4IDZA 3GJAA 4AI9A 3CJIA 3R4UA 2ZGQA 2FDFA 1V00A 2FMDA 2ZGKA 4AFCA 3K4DA 4GA9A 1GMMA 5FY1A 4QM9A 1EUUA 2QCSB 2QNKA 3S57A 3ON7A 1O8SA 3H3LA 3KCXA 1BQPA 1ULOA 4CCEA 2HWB1 3DXTA 1UF2C 5LATA 5F5QA 1IPJA 1NCRA 1WMEA 4LK6A 3DGTA 5FKCA 4W6WA 3WOGA 3LA2A 1SQ4A 5ANQA 3VBUA 3ME2A 1W2AX 2R043 4QQ2A 1QMJA 2QBXA 3T2PA 3G6JB 2A6XA 2RG4A 4GD4A 3I2HA 2GU9A 3VBFB 1WUVA 4QKFA 2VUAA 2JX9A 2Y38A 4NWVA 3KVAA 3RS6A 1WZXA 4MZUA 3VBSA 3O1VA 4CEWB 3HQRA 2ARXA 2JD4A 2RR12 3LFMA 3B5LB 5FPAA 1JYTA 2JB8A 2O14A 4AHZA 3BCWA 4FPFA 4YVSB 3ZXFA 4S2FA 3ZYHA 2Q8EA 3ECQA 3PUSA 4LMFA 1SLAA 2VBBA 1OLRA 3LPGA 2XKOA 4B8EA 4F3JA 3J26N 4Q1RA 4FP2A 1HV1A 2VMEA 4D0QA 5CADA 2R062 5FO7B 1DZRA 2CGOA 3PUHA 1RUC1 4GULA 2J22A 4AWDA 3PUIA 2JDHA 4YGEA 3JU9A 3BU0A 4ZS3A 1SLBA 1H1MA 3URFA 1LEDA 1LOGA 1AYN2 4ET7A 3T4VA 1Q3EA 2DVAA 3N35A 5C8CA 4S2HA 2XPJA 2WNVC 1DDLA 1WLTA 1REEA 1GZWB 2HWD3 4QHBA 2JE8A 4D7YA 1HW5A 1T6BX 5IFPA 1LR5A 1T6GC 1UAIA 1OA4A 4CVUA 4GJZA 5BPXA 2GZWA 4IW3A 2JDUA 3VDAA 2DVDA 1JU3A 4HZFA 4QKDA 2CU5A 1RITA 4QDRA 4G4FA 5FZMA 2MEV3 1WW4A 4IV1C 1PVC2 4XPVA 1K12A 3ZSJA 5JI7A 3LOBA 1M4WA 1ASJ2 2VW2A 1FMD2 4NIGA 1HQWA 3AZZA 3KWVA 4Y33A 1JZ8A 1F9KA 2OQ7A 4QXKA 5FDBA 4RQPB 1NYWA 3RI9A 1H30A 1D2SA 1LOAA 2Y6LA 3K4ZA 2VZOA 3PNAA 1POV1 4YM2A 2WC2A 2EALA 5C3QA 1RB8G 2JD9A 4LBQA 1EAH1 3N36A 1YFWA 3VZNA 3LEKA 1QJFA 1KDKA 3GBFA 3WQ1A 4ASKA 1QOOA 3TN93 3WDWA 5T55A 3HQXA 4P9JA 2Q1ZB 4FPEA 5C6CA 1DQ5A 3I3EA 2ZEWA 2VBDA 1YI7A 1ULPA 2DVGA 4UFHA 3SXWA 3N7JA 4MGKE 4CEWC 1X9PA 1LOCA 3VBOC 4BIFA 5JXJA 2ZZQA 3AKPA 4D8MA 4TTGA 1G9FA 4XTMA 4QB2A 3AP7A 4AHYA 2LRPA 1Q56A 2WS91 2Z69A 2OUHA 3LCPA 3OJBA 4LNVA 4X6RB 4Q0SA 1J58A 1TMF2 5FUNA 1SLLA 2V72A 3HAGA 1X8EA 1AXYA 5LW9A 4NOTA 3JZVA 1S2BA 4OMDA 3SEEA 5KHGA 1EYBA 2OXBA 2ZHKA 4XDPA 1I3HA 2D6PA 3IB3A 2BRTA 2OUJA 1QJY2 2QQIA 2VM9A 5GLZA 3ZX7A 3ZKUA 4IV3B 3OEAA 1BVVA 1WGPA 1XNDA 2JEMA 2WJSA 4RYDA 2EICA 3AMMA 4XYXA 3HR9A 2V73A 1SLCA 4I0WB 4M3CB 2VMGA 3MBWA 3WDVA 4DFSA 2GH2A 1Y3TA 3VD3A 3CLPA 5IUQA 2R30A 1D2QA 1H6XA 2FZ1A 3DECA 3RQ0A 3WNPA 1NA1C 1W8OA 1AR63 5ANNA 4DY5A 4YZ3A 3OY8A 1OBNA 1AR72 5D21A 4CP9A 3ACIA 5HV0A 2VMCA 2J1UA 4HL0A 4Y1VA 2CGNA 1F5JA 2DF7A 3B01A 2VNVA 5L36A 5KR7A 2BWAA 2UURA 2JG8A 1QWRA 1QQP1 4MXWA 3THPA 1LOFA 4OLLA 3AFKA 2D3RA 3A0NA 4PDWB 4E4HA 5D8AA 1PK6C 4A2UA 1DHKB 5F3CA 1OVSA 1VBB2 4JQTA 2ZGUA 4RQPC 1AJOA 4QHZA 4A42A 1W8NA 4B4RA 3A0KA 2HWE1 2IFRA 4JTNA 1PGW1 1CAXB 1W99A 2IXCA 1OUSA 4ZONA 3MHZA 3RWNA 4D6SA 2VVEA 1PIV3 5FPLA 3W9AA 3PMSA 1LHUA 5JWPA 3PUAA 1H2NA 1SLIA 3JCIA 4RHV2 2H6CA 3BODA 2YFZA 1IPSA 1BEV2 3S30A 1AVBA 2UU8A 1ULCA 2EF6A 1OD5A 3H7JA 3SH4A 3LQCA 1RUH1 3FUOA 1F15A 2B7YA 1UZWA 4AZZA 2EAKA 2ZEXA 1UMHA 3ATGA 1XNBA 2CTVA 1IS5A 1H2KA 2IXHA 2VCBA 1D0HA 5LA2A 1NXD1 3EYPA 1R093 1KDMA 4W6XA 2WKKA 1S0EA 2ZGLA 2JECA 3RZGA 3OGJA 1EY2A 1YRZA 1MPXA 2OQ6A 3EMRA 4OCTA 4B3NA 1W8WA 3RZHA 4LIVA 4AFMA 5LY2A 4XETA 2TNFA 4KGGA 4XQWA 4A7KA 1J83A 1GQPA 1MACA 5JSOA 5EPAA 5T3NA 5ABJC 2GSYA 1GYKA 4PQQA 1OHFA 4RFT0 4E4SA 3K2OA 4F83A 5LY1A 4BQ3A 4HPKB 4B4QA 4GWNA 3OGRA 3AVSA 4ZU7A 4GWIA 4W4ZA 4LQRA 3VBFA 1V70A 2HH9A 2YYOA 2VMHA 2ZHMA 4IE7A 4E2QA 5A6QA 2Q4SA 2TUNA 4CEWA 2IXKA 3WXPA 5JMOA 2B39A 3FHQA 3KT7A 2VZQA 5IATA 2VZ3A 2WFPA 3VD9A 4YYOA 4FPCA 1RUD1 4MGTA 3K77A 4YVSA 1YJLA 2RVAA 4E27A 3B93A 4XJUA 1DYPA 2AEYA 2QQUA 3L2YA 3MV11 2Y6FA 1Q8SA 1H4GA 1LODA 2GP3A 5A3WA 1AR83 2JDMA 4LOTA 4Q1PA 4Q2FA 4QDSA 1K5MC 3ZXLA 4DEVA 1H2MA 4LHSA 4BJ0A 5FO8B 4XACA 4ATEA 1O4TA 4LKDA 4DXSA 1K3IA 3Q8CA 1JYCA 3J4UH 5JZGC 1VRH3 2XGXA 1O3QA 1AHSA 1ND2C 1CR7A 2MPFA 3RFRA 3MIBA 3T2QA 5I8YA 3BUCA 1XSQA 2QTWB 1OA3A 5FLIA 2IVIB 4R9AA 1VAVA 2RJ2A 3H3ZA 4Y5SA 2ENRA 2IWGB 4XOGA 1GSLA 3ACFA 4GB31 5FP4A 1RUI2 1DGWA 5C9AC 4M0NA 1GZWA 2JWPA 1PO22 1KD7A 3Q8BA 2G1MA 4GH4C 2ETEA 4OUEA 4XCBA 4BQ5A 5L9VA 1PGSA 3V56A 3M70A 3C7GA 1LAJA 1X7NA 3ALQA 4XFHA 4ASLA 1IS4A 4WM7B 5EXOA 2JICA 5FIXA 1GOFA 2Y6HA 1JBCA 3JUUA 1D4M1 5CB7A 1RYYA 3ETPA 2J1EA 3I59B 4RS5B 1LECA 3CKHA 2PLV3 1XOYA 2HEVF 2W52A 3LEMA 3CQOA 2QE3A 2QQKA 1XRUA 3D0JA 2JDZA 3FBYA 2HWF2 1HRV1 3NJZA 3MW2A 4RQPA 5AC92 5IAXA 4LPLA 5EV7A 1H9PA 3OOXA 4AHWA 2K0GA 4Q0UA 4LO5B 1ZZBA 3NKTA 3TOJA 2WABA 2YUEA 5K0UC 3JXSA 2E31A 3OD0A 4B1LA 1X8MA 1XSRA 1W9FA 2P17A 2WNUA 1AR93 4LBQD 2XVKA 5KC6A 1JYXA 3AYAA 1IGOA 5FZDA 2ZHLA 1W9SA 4LA2A 2VVDA 5FMBA 2Y34A 5FR3A 5A33B 4CCJA 1D0GA 5JPMB 4XJAA 4CCMA 4TWTA 1W3XA 2Y0OA 1IQAA 3OYWB 3IWZA 3ZFGC 5FZOB 3SCFA 2Y0IA 5DDJ1 5JDBA 1I6XA 1MS8A 1GNZA 1UZVA 1L7RA 2DDUA 1C8M2 3MW3A 4GMP3 4CSWA 2D5HA 2ID4A 2A3XA 4NRQA 4IEYA 2CYFA 4CUGA 4BLIA 4PF5A 1VBA1 3ZPYA 5JR2A 4IGOA 4IV3A 1CESA 2ARCA 3WNMA 1JHJA 2SBAA 2XUMA 4ZU5A 4AL9A 4CA9A 2ORXA 1G86A 1OFNA 4IQPA 3USSA 5IVBA 4FPJA 3HN3A 3Q8AA 3WW4A 1L7LA 5C3SA 5DXDA 2YC4A 3H42B 1COV1 4IE0A 3HIFA 3IKWA 3LIHA 3M1HA 3N9LA 4FFGA 4W8JA 4AFAA 4Z92B 2QUOA 3FLPA 2W87A 2Y26A 1NZCA 1YYNA 3KQ4B 1GLHA 5H9RA 4N9HA 2Y6JA 3NJYA 4FPGA 1UYXA 2SLIA 3ST7A 1HJFA 4PDWA 5ERLA 1R1A2 4Z2WA 2XBO3 4DPNA 3HNMA 3KCCA 5FREA 1DQ0A 1DGLA 4ASMB 4B4PA 2ADEA 2R1DA 1NE6A 4A6OA 3PIJA 4AEJA 4YLZA 1ZRFA 4BHPA 1O5UA 5EYYA 2ZJCA 4TXWA 1CAXA 5JSPA 5A7WB 1CD3G 5TSWA 2AR6A 4KG8A 5F6KA 2JB4A 1JW6A 1VBD2 3VLBB 4A41A 4EZ4A 1SFYA 1CZTA 3DN7A 4W6YA 4EYUA 4YM3A 4HSJA 3OF1A 4LJHA 2PXJA 1DGRA 1QDCA 4Q8LA 1Q8QA 3OD4A 3ZXEA 5IK7A 1CONA 3ZSKA 1J1TA 1US3A 2OX0A 1LNSA 1GNYA 4XHBA 3ZKYA 4FTBA 1XPWA 4L0PA 4P14A 1LGCA 5CIRA 2RS52 5EJ3A 1RUG3 3DUIA 3QACA 3SH3A 4CDQB 3KV4A 4KU8A 5A6ZA 3I49A 3J7LA 3LD8A 4G3YC 4HETA 2A5ZA 4XXAA 5IK8A 4C1WA 4OQ8A 2ZAHA 1W2OA 4OMCA 1IQDC 3I3DA 2OS2A 1VBC2 3OCPA 4FPOB 5EYXA 1YFXA 1RHI1 1ZBA2 2RMU2 1NG0A 1MQTB 5CNAA 1CJPA 1YC61 2P5BA 2VTXJ 3GCWA 2V5DA 1V9U1 1AYM3 1H2LA 2BGCA 3EB7A 4HPKA 2WINB 4FPLA 3HQUA 3D6EA 1HXS1 3ZYIB 2VD7A 3RMYA 4M4RA 4CCNA 4HVOA 5FKBA 4MGQA 3I2KA 5A3PA 4LULA 5FY9A 2W0XA 1UU5A 1N3QA 4I02A 2HWB3 5A3TA 1XBFA 2QQWA 4Q4V2 3ZN6B 2DCTA 3RRDA 5BUVA 2V09A 2VNGA 5BNPB 4RR3B 1RMU3 2RJLA 3OG2A 1F5FA 1BBT2 5JLVA 3VHRA 2HBUA 3WUCA 4E2GA 3KD4A 2FDKA 3NAPC 3GNEA 3HNYM 4PCRA 1WW5A 5FZ1A 4AXOA 2DUQA 3FLTA 1MR5A 5DAXA 4F8AA 2D3SA 1S0GA 1XU2A 3I2IA 1AX2A 2JG9C 4HLTA 1Z7S2 3NWKA 3ZMOA 1P8JA 3K4AA 4AEKA 3N7MA 1MEC1 4AQSA 3FC0A 3NSTA 4Q4W2 1NCQC 5J1XA 4QHOA 2VECA 2WLPA 2VVFA 1NLSA 1KJLA 1U5IA 4MH0E 3RZJA 1SCSA 3KF5A 1WLDA 3PJYA 4TYSA 4EN7B 2BOJA 1SPPB 2WN2A 1UZYA 4JC1A 4S2DA 4WM7A 5DAWA 1Q8OA 4JGZC 1G9BA 1GU3A 3PMEA 3ZYPA 4O9GA 5CFCC 5FXXA 4AI8A 5K4LA 5KXCA 3I59A 4RS5A 1RUC3 4EN9B 4C8DA 5JIUA 3UESA 1JYNA 3KV9A 5DUUA 4YW1A 2VXJA 1S0BA 2BWCA 3BGAA 1B35B 3LSDA 4PIYA 2YFUA 2JDNA 4HT1T 1LRHA 5IYYA 5FOJB 4XMIA 4DY3A 3SMHA 3IN9A 2B9UA 1F2NA 2NN8A 3WP6A 4BQ1A 4DIQA 3H50A 5IVFA 4TLFA 5BY5A 2HWC2 3M3OA 3SKJE 5EFUA 3JB4C 2D6LX 3C7FA 3CF6E 5J3UA 1WCUA 3WD5A 4E4ZA 4NE9A 4DNYA 4EWDA 2XB6C 3MLJA 3O1RA 3NO8A 4WVVA 3RDIA 3WF4A 5A7PA 3T2OA 3VKOA 1JHNA 4KQ7A 4KMQA 5A33A 2CDOA 2W9XA 5JOXA 3WDYA 3ILRA 3OYWA 1RVF2 4NAMA 1KGYA 1POV3 5FZOA 4LBJA 1FXZA 1EV12 1JZ7A 2CAUA 1EAH3 2BNOA 3TRSB 2RE9A 2X10A 3BVCA 2DFBA 1ZYBA 4GQ7A 4BYYA 3M2MA 3U75A 1O59A 5I0UA 2H0BA 3FMGA 3N9NA 4XXPA 5E88A 3S6PA 3WP3A 5BNNB 3POIA 5A3MA 5HCAA 4NRMA 2FCTA 3O1MA 1DG6A 3H3UA 3OPWA 2QDRA 3RZLA 1PMIA 3PURA 1ZZ9A 2W39A 2WAAA 4OULA 4XIKA 4AGRA 1QEXA 1QJX1 1VE0A 3L2HA 4HKOA 5CVRA 4P9LA 4YVWC 4CDWC 2WS93 1PGL1 1YWKA 5F2WA 3WDXA 4FQZA 5L73A 4RSUA 2R7EB 3NV4A 5FYCA 2I45A 3WHTA 3T1LA 2HYXA 2GNMA 2BBVA 1ULFA 1YQ8A 5DZFA 1V6MA 3EXUA 2DCYA 4NHYA 1HKDA 3VUOA 3D3AA 4OZXA 3K48A 1AX1A 3SNMA 2R1BA 1KQRA 1NUKA 4JTOA 4LHKA 1UY0A 3S5QA 4L99A 4LTAA 5J7MA 1HN0A 3VZJA 5HBAA 1NLQA 3ROUA 4N53C 3Q9OA 2G9FA 4AHXA 4Q0PA 2YBKA 5JI9A 5I8TA 2OT7A 1C4RA 1K45A 5FWEA 4H7LA 1W6MB 1ULGA 3WF1A 4AQ2A 1RUF1 2ZGRA 1PNFA 3IMNA 3MIFA 4LO6B 4CU8A 3CMGA 5EIYB 1FPN1 3THTA 2NYYA 3T0AA 1CX1A 2RS11 2GNBA 1HQNA 2RM21 4HSLA 5A7WA 2AACA 2YU1A 4NO4A 5LZ6A 1RINA 5FZ6A 1UQXA 1LJ7A 4XFGA 4CE8A 3POWA 4W65A 5F5AA 3U78A 1TG7A 4QXHA 3AMNA 3OSDA 2Q8DA 4CYDA 4HVQA 1QQP3 2C24A 5B2GB 2ZGPA 4FFFA 1DYKA 3VGIA 3MFAA 2XHKA 3AL6A 1MS0A 2VQTA 2EXJA 3RNSA 5IK5A 2KXLA 1VB2A 1UXXX 2XQRA 2NZ9A 5FMOL 4H55A 4CDQA 4GWJA 1ZBE1 3HBKA 3OGGA 3OB8A 2HWE3 3IDCB 4Q4Y1 3IMMA 4CCLA 2BDRA 3ACHA 4DMIA 4U2AA 2O8OA 2YBPA 4KL1A 1WA4A 1ULEA 1MS9A 4LBKA 4BPZA 2WQZC 4RL7A 3JBG1 5DAPA 5EHDA 5CKNA 5FXVA 2D44A 1MQTA 4NRPA 2D7FA 4UW4A 3SHRA 1FOD2 4Y24A 3WEZA 1XYPA 2FBEA 2WT0A 2LS6A 3WY6A 1EPZA 1RUH3 1FNYA 2VOVA 4CP0A 2JDKA 3LIGA 1Y43B 2HEWF 3AP6A 5CBLA 4YZ2A 3MF6A 3GHNA 3V64A 2WZR2 5FO9B 3LDKA 1LESA 5A7SA 1HRI2 3RSJA 3I54A 1KS5A 4R9BA 5KC5A 1JOJA 1QJU2 4AAXA 2WNVB 2GDFA 3ZN6A 1JZ2A 3O0VA 1F35A 1IZ3A 5FLJA 5BNPA 3I3QA 2C9KA 4RR3A 4XJZA 1FATA 4NMIA 4ARYA 5A7OA 1SHWB 3ABZA 1KJRA 1ACCA 4NR1A 1W2TA 4UT5A 4D69A 3KZ4C 3WNNA 1LHOA 2GAUA 1JYVA 3BI3A 4OHXA 4ZXKA 1TE1B 4IV1B 2ZTNA 3PIGA 1O3TA 3NNLA 3GM8A 2D43A 4ZZ8A 3UL2A 3KB5A 4XHXA 3IZOA 1LU2A 5C3RA 4Y5TA 2B4KA 1NY72 1DLLA 1FAYA 2YY1A 2VQUA 3WV6A 1EP0A 4HXCA 5F5CA 1ZZCA 2RR11 4WVMB 1JZ4A 1DGRN 4MV2A 1RUD3 4IE5A 2P6CA 3KS7A 4MG2A 5CG8A 3J8F2 4M00A 3UKNA 4NROA 4D7TA 3W5MA 2W5FA 4QGMA 2R072 5EZWA 1SPPA 3VV1A 3WDTA 1WKYA 4HOOA 2XVGA 2A6ZA 4KG0A 2VC9A 2R061 1RXFA 1DZQA 2JKBA 4HK9A 1QNYA 4XUPA 5F1RA 5KBFA 3VBOB 1PM4A 2A3YA 4XC9A 4XFCA 5FBZA 1B35A 5CU1A 5IFTA 2BNNA 1HQLA 2NLRA 5FPUA 3FWEA 1AYN1 4GB33 3JD72 3U4SA 4JQRA 5A32A 1RUE2 2RDNA 1RIRA 5AFBA 5BNOB 5A7QA 5DUWA 4I0AA 3WP4A 4NIIA 2Q8CA 5C5UA 2G4IA 3WNKA 3S0MA 3LOIA 4Z07A 1WMDA 2HLEA 1E5IA 3VD7A 5FZBA 1IS3A 2CDPA 4AGVA 1CPMA 1D4M3 5GKAC 2WWSA 3NQHA 4INDA 5FY0A 1RUJ2 3WF2A 1PVC1 3ZM8A 3NRUA 5LWBA 1IKPA 1AZDA 2BU9A 5FZFA 1RMU2 4UAPA 1ASJ1 2XDVA 1XQNA 3I8TA 2D93A 1YI9A 3MDPA 1FMD1 1HRV3 2BV4A 2VPVA 1NA1B 1KS4A 2Y64A 1BMV2 4S2GA 3O1SA 4XQDA 2PAEA 5FY8A 4QPGC 4CCOA 2IZWA 1H4HA 4AGGA 1AF9A 1MZFA 1IS6A 2AUYA 5FMCA 2XXZA 1LGBA 3PL0A 3D8CA 3GYDA 3C3VA 5J37A 2IXJA 1D7PM 2W1SA 5BNNA 2QQPA 2VNOA 2Q8OA 1PK6B 2VQ0A 2C4XA 2PTMA 2PQSA 3T3YA 4JHTA 2Z79A 3R0RA 2P3KA 4LA3A 1XU1A 4CDUA 4JGYC 1GP5A 5GZFA 3OGSA 4XF0A 3AXEA 3AM2A 1W04A 5FYHA 4YZ5A 3WHUA 1UD1A 2DVFA 4QU2A 4KWKA 4LLFA 5DDJ3 3DF0A 4CDXC 4Q4X2 3BN6A 4EWEA 1TMF1 2VXRA 2W1QA 1PO12 4XQ4A 4CTEA 4DOUA 3CZUA 1F4HA 3B02A 3NV2A 4URAA 3G7DA 3LAGA 3MO4A 4AR2A 4NAOA 4N43C 1VBA3 3VZKA 1NX9A 2C0ZA 1QJY1 1CAVA 1VBE2 3TAYA 5FK7A 1LOBA 2WFF2 4IE6A 5E6HA 1W6MA 3FE5A 3UKTA 4DS0A 1PZ9A 2Q0AA 1N3OA 5I91A 4L9BA 4WBBA 1BJQA 2YPJA 4QX7A 2KM2A 3HT2A 4X8PA 2E63A 5FP8A 5BNOC 4H3WA 4R9DA 4HKLA 3O7OA 1AL22 4KWUA 1COV3 4DUVA 1AR71 2IUWA 3AFGA 3FL7A 5DZGA 5F7UA 5ABJB 2PMWB 4JAAA 2LM3A 4EE2A 1YO8A 2W47A 4LIUA 1XNAA 4MUVA 4CEYC 1YEWA 4PLOA 1W6QB 4XJWA 5IVVA 2D3PA 4DRRA 4XFBA 4RD7A 1CAUB 2BPA2 3IT8A 4AFDA 5J48A 1G7YA 1DF0A 1QOTA 3U4XA 1ZZ6A 4JX0A 3M4FA 4MSVA 1GQGA 3DXUA 3NNGA 4AI1A 3E6BA 4BISA 4PLNA 1HDKA 2A73B 1K5MB 4KU7A 5LA1A 3I7DA 3SISA 3PTRB 1SEFA 4RHV1 2G9ZA 1RJ8A 5GLTA 4LXLA 1BEV1 1HN1A 5JZGB 5LRSA 2WS92 3ZR6A 5HCBA 2LUWA 1JZ5A 1ND2B 1PX4A 3QBQA 1H1IA 5FFOC 5F37A 4LR4A 4B7KA 4LEJA 1DQ6A 5FPBA 4QX3A 4CP1A 1H8VA 2VR4A 1YFYA 1OC1A 2W68A 2WNVA 5C9AB 1XNKA 4UOJA 2UYAA 4FTEA 4GH4B 1PHMA 5FY4A 2YGLA 3ZYJB 5C4WC 2EXKA 1XC6A 1OQEA 3CDZB 1NQJA 1RHI3 3Q8EA 2PHLA 4LO8A 1SCRA 4AVTA 4I3GA 4Z2AA 4XIOA 1UY2A 1Z0HA 3ENRA 1U5ZA 1O6UA 4LUMA 3LA3A 2GH8A 2ZABA 4IV1A 4XABA 3M3CA 1V9U3 3QD6A 1A6CA 4PF1A 5FYZA 5FZ4A 5JOYA 1YQCA 5C33A 1HXS3 2ZBJA 5LBCA 3WG3A 3ACLA 2DV9A 5E8AA 2GNDA 2QQNA 4GKXA 4Z1VA 4WVMA 3WLUA 3U37A 3MLKA 4AEDC 2ATFA 5L7OC 2ZMKA 5CG9A 5K0UB 1QU0A 2QQVA 4HN0A 5FRAA 3NJXA 1W39A 3AL5A 2HKXA 2QZ3A 2I74A 5LA0A 2EXIA 2BFUL 3CU7A 3IAQA 1JTZX 5T54A 2PAKA 4YM1A 4QPWA 1T2XA 4XAAA 3NV3A 3TWIA 4HKWA 1LKNA 3WX5A 3VBOA 5F32A 2EA7A 3POSA 4IL7A 4WM8C 1WCSA 2NMNA 1PMJX 1W05A 3WINE 3WQBA 2WO3A 3H8XA 2ZHNA 3DCQA 4IXLA 1GOGA 3IAPA 1MEC3 5EP9A 1UPSA 2B9VA 3WG4A 3ZFGB 3O1UA 1NT0A 1U5YA 3EJKA 4P9GA 2RS32 3O1PA 1RUH2 1RUI1 3GBWA 3I2JA 5BNOA 2OA2A 5GZDA 4IUGA 5FYYA 5A1AA 4Y20B 1PO21 2XUEA 2R0HA 1GWKA 2C9AA 1R082 3VL9A 3ZLIA 1VAKA 3NMBA 5HV4A 4YZ1A 1FNZA 2WSVA 4AOCA 2A70A 4BLJA 3I97A 5AFEA 2H0VA 3H1WA 1H6YA 5F9TA 2JENA 5DUXA 1E5HA 4JKLA 1QNWA 3J9SA 1AXZA 5ACA2 1KRIA 5AC91 3FFZA 1NA1A 2HWF1 3KVBA 1OF4A 4JCKA 4EN6B 3GXUA 3VN4A 2VZRA 4Y26A 5C71A 3ZOIA 3MIDA 2X5IC 2DVBA 3D82A 5C8WA 3P1IA 1QH7A 5KHHA 1QJZA 2MNGA 3JQWA 2Q1MA 5FZHA 3ACGA 3DPRC 3ILNA 1E5RA 2WLQA 1UY1A 3N9OA 1X36A 4IEXA 3BTZA 1TME3 4ONUA 4FPHA 4DZGA 1OLMA 2FMYA 4L2NA 1PK6A 4FBFA 3C2UA 2XJSA 2R042 1SLTA 4QAWA 4NIAA 3H1MA 2XOMA 3KGZA 1PX3A 4KWJA 5GLVA 4CUAA 1OF3A 5IAVA 1XXNA 2ZS6B 4XW3A 4CCCA 5HCFA 2J1RA 1CZSA 3AKTA 2ZX3A 4XE9A 4E2SA 2VY0A 1W8FA 1PM7A 2UWAA 3WP5A 4BK5A 4COWA 3AB0A 4KBZA 5FMOS 3GZUC 1C8M1 2JIGA 4OYUA 1S2EA 4JRLA 5T52A 3KHBA 5JOWA 4UBHA 5C5TA 5LBEA 2DTYA 2PFWA 4GALA 4GJYA 1CPNA 2PA7A 4P9WA 4CUBA 3Q8FA 2D5FA 3M3QA 2AREA 4UFJA 2D6MA 2WDBA 4LHNA 4QPIB 3T4HB 2ZMNA 1POQA 2BGOA 1QJX3 2QQMA 2V4VA 3VKFC 2Z2SB 1JU4A 1X50A 3QLQA 3ZDSA 3AK0A 4JVAA 4K8RB 1JMUB 1OQ1A 4COVA 1OURA 3LFIA 2KR2A 2F17A 4UW3A 3WW3A 4NN0A 5ABJA 3UT0A 1AJKA 1OPMA 5FLHA 1JODA 3NNJA 2XMLA 5APAA 4A7ZA 3EO6A 2FDGA 5JR7B 2HWD2 2OIIA 2VZ1A 5KWRA 4M3CA 5J09A 3O1TA 1R1A1 1HLCA 1XE0A 1HV0A 5IT6A 3B00A 1CAUA 1W3VA 4R8HA 5JAXA 5C3OA 1RUF3 5T50A 4BWOA 4AI0A 1S0JA 2MEV2 1CAWB 1FPN3 1QY4A 2RDRA 4L97A 3BKZA 1JUHA 4QD2A 2RS13 1UPIA 2RM23 4XURA 1ENSA 1QXPA 2YC2A 5DABA 1K42A 3WQ0A 4YW5A 2PHRA 3VZMA 4QX8A 2E9QA 1K5MA 2VJXA 4A45A 2NPIA 1LEMA 3N9PA 4FQ4A 5ISLA 1VBD1 5A1LA 3NAPB 4AI2A 3PVEA 4AVAA 1MVQA 2VOXA 2GALA 4JRAA 3PU8A 3FN9A 5JZGA 1YJKA 3O14A 4MHUA 4PT6A 4EZHA 4IEVA 1ND2A 3VBHC 2W3JA 2JDPA 3O5SA 1W6NB 2JG9B 4XBQA 3TN92 3WT3A 2RS51 1DQ1A 3I3MA 4TN7A 3POFA 2LW8A 2LALA 3M8LA 1ZBE3 1IOAA 1ZNPA 2GMEA 1NCQB 2WUHA 3H1YA 2XJVA 4Q4Y3 4XUQA 5C9AA 5KHJA 2TBVA 4GH4A 4QT6A 4YFZA 1ZM1A 2ZAAA 4FFHA 2GNTA 4I01A 4Q27A 3MPBA 3JBG3 4R4ZA 5FK8A 2ZKNA 3AXDA 1VBC1 3AKRA 2WSUA 4XUOA 3FJSA 3MPPG 2FDHA 1ZBA1 2RMU1 4JGZB 1GWMA 3PVNA 4XAEA 4YM0A 4O9EA 5FZAA 5CFCB 1UY3A 1S55A 1W8TA 1HJGA 3DL3A 5E16A 4PJYA 5E89A 2AZ5A 4NHMA 4V1PA 4AI3A 4FI9A 5AVAA 3KV5A 2PHDA 4QPIC 1WCKA 2A1XA 5EWSA 5M0TA 1JUIA 3AZWA 4J1XA 4NHKA 3ELNA 1A34A 5LRRA 4BK4A 5FMDA 2BNMA 3UGGA 3E6CC 4BMEA 3J7MA 4YW4A 1RGSA 2GC3A 4ORFA 2QDNA 4JDOA 5K0UA 3RZKA 4Q4V1 3K46A 3KF3A 4KH9A 2WZ8A 2XJUA 4GXLA 3H7YA 1VLNA 5FBJA 1BBT1 1AR62 3OPTA 1J1LA 2VMDA 3VZLA 4K1YA 5FPVA 1UKGA 2A3WA 1Q43A 3HBZA 4ITCA 4AVCA 1RUOA 4QB6A 2G9GA 2L9LA 4LKFA 2HEYF 4E8CA 3C8XA 2PYTA 5FPZA 5GM0A 4BQ2A 4LO7A 1POV0 1PZ8A 5F5IA 2BQPA 4YZ4A 4D6QA 1Z7S1 2RR13 3ZFGA 5CFDC 4FFIA 4KGQA 1V6KA 5CAZA 2N7GA 5A6YA 2OZ6A 2E32A 4Q4W1 4QU1A 4NIHA 1AL0G 1MVEA 4YG3A 3EBRA 3CZJA 4Y20A 3MFCA 3DYMA 4D7SA 1A78A 5FYIA 3T1MA 2JDYA 3MUZ1 3QH6A 3AYEA 3C7HA 4K40A 1PIV2 4AQTA 4N7UA 3O1OA 3NJVA 3VHNA 1JOPA 1GP6A 2DTWA 2H6BA 4X6QB 1H0BA 5FZLA 1Q5OA 3AJYA 3BIEA 3B9IA 4XF1A 2XLAA 2A7AA 1QH6A 5F2SA 3ZXGA 4CDWB 5L19A 4YVWB 2RDQA 4CXWA 1NAEA 1AYN3 3ASIA 4P5YA 3OTFA 3WSOA 1JS9A 4P02B 2XR4A 5IVYA 4BE3A 1YHFA 4QXBA 3BTAA 1HXS2 1O4ZA 1NZIA 1R092 3BPZA 2Y8KA 5F6LB 3PU3A 1JZ6A 4GIQA 3QCWA 1C28A 1LGNA 2HWC1 4Y1XA 5FZIA 2RHPA 1OQDA 2Y33A 4N53B 4K6BA 2VZPA 1NXMA 2G19A 4UW6A 4NWWA 4LE4A 1S2KA 1JYWA 4KI5M 4ZHNA 1PVC3 3AZYA 2YXSA 1OI6A 2BTVC 1UOBA 4AQ6A 1CJDA 1ASJ3 2ZZJA 3E97A 3VDDC 1N1YA 3NKGA 3F2ZA 5J98B 5JIAA 4FAGA 1FMD3 1MZ5A 5FYVA 5IVJA 5FPXA 3MIEA 4IE4A 4XZUG 2WT1A 4AG4A 1PVXA 1RVF1 2AH2A 3CL1A 2VNRA 1EV11 4GKYA 1CVNA 2B8MA 2VCCA 4ATFA 4BQ4A 3MW4A 3MEPA 2CV6A 5FUIA 5T5LA 5FJKA 4Y5Z0 1AR82 1UZZA 1DQ4A 3NL1A 4WV8A 1V6IA 3ZYBA 4AVBA 4QPIA 1CZVA 5A3OA 3ZFFC 1QGLA 2YC0A 4BIOA 3UNPA 1VRH2 4YFWA 3U11A 4NJ4A 2VU9A 3BYWA 1V6LA 4BQWA 4M3CE 4MGZE 4BZ4A 3GDBA 1TMF3 2R6QA 3LF7A 1US2A 3R6SA 2RDSA 3RJRA 3ZFEC 1I5PA 1ZA7A 2B5HA 1Q8VA 2W1UA 1DGWX 4QQLA 2J42A 3ZDVA 1UYZA 3A7QA 2DU1A 3NV1A 4XTPA 1QJY3 1ST8A 2HJIA 3SQOA 1IHMA 3VHPA 3X29B 5JPNB 1OOPC 1REDA 2VOKA 4RGAA 5IJRA 4KBBA 3S7IA 1VAMA 5IW0A 1O7FA 1F4AA 3AP5A 1J3RA 3PJQA 3ORJA 4XDOA 1CAWA 2WNOA 3DKWA 4JDMA 2EIDA 1DFQA 4ZZ5A 3ZYRA 5DQ0A 2E33A 3E1F1 1TME2 4Y1YA 1WA6X 2PLV2 1QKQA 3POYA 1J84A 1JH5A 3CJIC 3R4DB 1AR73 2CNAA 3UGHA 2Q5TA 2VUJA 4P00B 3FHAA 1W90A 1VALA 2YDEA 3BTYA 3S5AA 3NAPA 1LCLA 1AX0A 3B3QE 2W08A 2RV9A 3GALA 1NCRC 3A4UA 1F31A 3O12A 1W6NA 5K7PA 2JG9A 1E57A 5G04L 1AR92 1H9WA 2BFUS 3GZTB 4J6GA 1L3JA 2W92A 5A7NA 3CBNA 3D4KA 4OQ9A 3VBUC 2B46X 5HI0A 1BVP1 4K20A 1U5XA 3JB8A 4X8NA 1NCQA 1ODNA 1XE8A 3K51A 1DYOA 3QOPA 2BOIA 1QF3A 3NVCA 4EV0A 4DUXA 1WLCA 3SCGA 1D4VB 2WNEA 3ZXJA 3I2DA 1I9RA 3GZEA 3AVRA 3VBSC 2XJQA 2TEPA 2O0OA 2Q30A 3RG0A 2ZOEB 4JGZA 1KITA 2J1VA 2VE1A 4RHV3 1PMHX 3KT4A 5CFCA 1FOD1 1DCSA 1TVGA 2Y6GA 3HD8B 3PLQA 4M0HA 4LHLA 2D40A 3ZN4A 4O7XA 4XMAA 1HB1A 1C1FA 2J1SA 4UBGA 5FZ8A 2VG9A 1K5JA 4IERA 1G9AA 2YHJA 1O3SA 1W8HA 2WZR1 1QIQA 1HRI1 2E7QA 4FAHA 4SBVA 4K21A 1QJU1 1VB4A 3CEWA 2PELA 4CPBD 1Q8PA 3E5UA 2P34A 2A6WA 5H9SA 4IEPA 1G9CA 1QDOA 1URXA 3IDEA 4I09A 4Y22B 4ARXA 3SITA 2XHNA 3VZOA 2R16A 3DYPA 1NLRA 3MI8A 1VR3A 1OXCA 2BERA 3BOPA 4YG0A 4A6SA 5JXHA 3OUIA 5AVPA 3VKMA 5C8CC 1X9TA 4OZOA 4HK8A 2ZGNA 3T2TA 3A23A 3IM0A 4FXGB 2AC1A 2ZMLA 1UZ0A 1QXRA 2P37A 4Y4YA 4BA6A 3OUHA 1XE7A 1WW6A 2OZJA 1YIPA 1NY71 4XVHA 4F7ZA 5FOBB 2XBO2 3W21A 1REFA 1GQHA 4QPGB 3VB9A 1OFSA 2WR9A 3J8F1 2WA3A 3AZVA 4LE3A 1V6NA 4UYBA 5F3IA 4OVEA 5L9RA 2VUDA 3FFQA 2GC1A 4N7IA 1ZREA 3L9JT 1IG0A 2R071 4Z82A 4MXVA 4CXXA 4FO9A 4BOWA 3T0DA 4XF4A 4C91A 3B94A 1DQ2A 1R64A 3HT1A 3RPQA 2VZSA 3VBRC 4CDUB 4KNCA 3RYPA 2OPKA 4JGYB 1YQ6A 3WVJA 1C8NA 4BQXA 1CWPA 4CDWA 4NUBA 4YVWA 4MX3A 2B45X 1UCXA 1DP0A 1HB2A 2XLFA 2R0FA 3ILFA 5K8SA 4CDXB 2K2SA 1GANA 1N1VA 2JE7A 2YG0A 3JD71 1R1ZA 1RUI3 4AFBA 4BXFA 1RUE1 1YQ5A 4L92A 5I0TA 4C90A 1RUG2 2WYFA 4KWLA 1PO23 2QVSB 3AYCA 3WW1A 1NE4A 4QWNA 4K7JA 4ZU4A 5JUVA 4N43B 1UYYA 2W1WA 2P3JA 4N53A 5KXEA 2E51A 4L11A 1CX4A 1DU3D 2F6BA 2XQXA 2A6VA 2XJRA 1RUJ1 2X8KA 3RGBA 3SEPA 1RMU1 2GMMA 2YMZA 2K46A 1AYM2 1WCQA 2QKDA 3AX4A 5AC93 2HWF3 2J1TA 2BVVA 2OKXA 1ZVFA 4YNIA 2ZGMA 4CZSA 4C0HA 5HXMA 5GZEA 1LULA 1BMV1 1O91A 1YCIA 5B4NA 4LT5A 1BHGA 4XBNA 2KD7A 3EHKA 4FVVA 4UWDA 4AE2A 5FP7A 2HWB2 2ZGOA 1M06G 5SV8A 4GZ9A 1RTVA 4CEYB 1WCDJ 1N1TA 4Y1UA 1RXGA 5CYYA 5FZKA 4BCUA 2C5DA 4CU7A 4D94A 5I0SA 3U0ZA 2DUPA 1TEIA 3GHMA 1QOSA 1ODMA 4Q0QA 1A8MA 1UN1A 4BMBA 3INAA 5A1FA 4AVSA 1HX6A 5JSRA 5FYMA 4QKBA 1XJAA 2WA4A 1XNTA 1W6OB 2JG8C 2XONA 4QQPA 1ZX5A 4MGIE 1W2NA 3P5BA 1GZTA 1WBFA 5BV6A 1LOFC 2QZ2A 3K75B 3N9QA 5D8AC 5DMYA 4CU6A 2NQYA 4Q4X1 4CCDA 2WO7A 4YW2A 3IDBB 1C8M3 2Z42A 1PO11 4NPMA 4YW6A 4ZKTB 3GJBA 2W2IA 2XWBB 3IIAA 4YW7A 3V0AB 3TEYA 2YV8A 4MO3M 3IPVB 3ZIWA 2FDJA 3MZHA 2VZTA 4P08A 1GWLA 3K3NA 5I93A 2FCVA 1IPKA 4D3WA 1VBE1 2QFEA 3AP9A 2YGMA 2DUOA 2K9ZA 3WDUA 3DV8A 4WZCA 2ET7A 4COYA 2D6NA 2WFF1 1OD3A 2V5YA 3ES1A 1XYOA 1H1AA 1UKRA 4COUA 5JCTA 1RUC2 3OBZA 5C4WB 2HYKA 5H9PA 3P3NA 1AL21 2XL9A 5F8PA 1UW8A 3VDCA 1FI2A 3H9AA 4XUTA 1RL3A 4DB5A 4EN0A 3N7KA 4TZDA 1SFNA 4R4XA 4XF3A 2OYZA 5DG2A 2E6VA 1SBDA 4D6RA 2IFWA 1W2UA 4A3XA 5KXBA 2VZVA 3KLSA 4LKSA 1R1A3 3MV01 3VBRA 5BNQA 1APNA 1GZCA 2PHXA 3TB0A 4BQYA 2WIIB 1FV2A 1MS3A 3FX3A 4NVPA 3WQ7A 2WNUB 5FY5A 3IDAA 4AEDB 4EROA 5I0RA 2EVXA 5L7OB 3SH5A 5DAQA 2JIJA 2UWBA 5EJZB 3OPZA 4HVRA 2A6YA 2JJ6A 4PIXA 1GFF2 3USUB 3VBFC 3I2OA 2Q1FA 2Z5WA 1S4CA 3FZ3A 4IETA 3M3IA 1VBD3 2A75A 4K8FA 3CNAA 1O5LA 2EAAA 1EAH2 4YVSC 3TEXA 3ZO0B 4PI2A 5GZGA 2BVBA 2CAVA 4WM8B 1VBB1 3P3PA 1VPHA 1ZRIA 2CSGA 4JHZA 5A6XA 4XUNA 2RS53 3LGRA 3MIHA 4AAPA 2NP0A 1V6OA 4LK7A 2VGDA 1ZZ8A 5C7GA 2ZGTA 3WR0A 4DXTA 1U0AA 1GUIA 3BIWE 2FZ2A 3LEIA 4IEQA 3A21A 2EIEA 3UETA 4Y4RA 2CGPA 3LEGA 4EQVA 3KHCA 1J3QA 1X33A 2PQQA 1F8VA 4DRVA 2DU0A 2UWCA 4Y22A 3SCHA 1VBC3 3BOWA 3BTXA 3ES4A 4LITA 5LB6A 4I2OA 1C5IA 1ZBA3 1V0AA 2DFCA 2RMU3 3B69A 1OH3A 4P9YA 3HOBA 2QJVA 4PQ9A 3M3EA 1XYNA 3CIHA 3NW4A 2YB7A 2BYVE 5D2AA 2VAUA 3T08A 3POEA 2YPDA 3ZXAC 4BB3A 4BU2A 4J1WA 1W9TA 1ONAA 5FCCA 4U36A 3VHOA 1DIWA 2DCKA 2QQJA 4HFSA 3EQEA 4N90A 4LO4B 3DKQA 2DWRA 3BPSA 5FYSA 1YIFA 4CU9A 2CWMA 3MICA 2C1FA 4QPGA 2X5IB 4Q4V3 1WWYA 1PZ7A 2JDAA 3AJZA 1VP6A 2XLGA 4PBPA 5DN2A 3TBDA 4BDVB 3UYJA 2VOTA 3LWCA 2XJTA 1SMVA 3DPRB 4WVZA 4UFKA 1BBT3 1HB4A 2XH6A 3LE0A 4YGDA 1HB3A 5LBBA 2IXIA 2VCAA 5CKMA 4FP3A 4WZFA 4XJ9A 5HXVA 4URTA 4RA0A 1OMIA 3UJQA 1YXWA 1S0CA 1ZA4A 4JGYA 3SKVA 1W8UA 2XG3A 1QQP2 4M4PA 1Z7S3 2WNUC 4O61A 4XFIA 4Z8BA 2GN3A 4OHWA 4CDXA 4LBNA 3ZYGA 1BLZA 3FHIB 2RS31 4Q4W3 5EQUA 3AYDA 3MLLA 4FOYA 3POJA 3RYKA 1W6PB 1A8DA 1ENRA 5T5PA 2HWE2 1R081 1PGW2 4N43A 4V2VA 2CY6A 4Q0VA 4OI0A 1YUDA 2QQOA 3KM5A 4XFFA 5LEKA 1C3HA 2B42B 2ZKLA 2RJKA 2X05A 2D6KA 3RWKX 4QX5A 4ZS2A 4C0BA 1FV3A 2WAOA 1UIKA 3NNFA 2WQ4A 4H2AA 5LEJA 4GMP0 3R05A 2XL7A 4BM8A 4DEQA 4CP2A 4E8DA 4P9XA 5ACA1 4FOVA 2MHFA 2GC0A 3KMHA 1V6JA 2ZX4A 4IEZA 4LORA 3HMYA 4HANA 1W03A 1BYHA 5A80A 4OUMA 4MYEA 4IV3C 4CUCA 4K1ZA 2YZ4A 5FQ0B 4IESA 1UOJA 3ZSEA 4ISQA 5FZEA 3V0BB 2A71A 3GZAA 1OKQA 3TEZA 2XVLA 4K3UA 2HWC3 4CEYA 2R49A 3RVHA 3D5OA 5DAVA 3ZSLA 2VCMA 3RZZA 1IKQA 3BB6A 1UO9A 2VQAA 3W5NA 2FHRA 3BU7A 2UY9A 3M7AA 1SFPA 3ZYFA 2R041 5IHRA 1HIXA 2LTNA 5GLWA 4A3ZA 2UYBA 4PLMA 1W6OA 3KSCA 5FP9A 4N9IA 1Z78A 4OHZA 3LSEA 1GR3A 4L8QA 1RVF3 3WCRA 5A3UA 1GICA 4PDWC 2ZACA 4ES9A 4Q8KA 1EV13 1YFUA 5J96B 1CN1A 3H8RA 1GP4A 1UX7A 2C6SA 4NPLA 3VKLA 3LB9A 4JKMA 1RUD2 3ZXDA 4YSFA 3V0AA 4UF0B 5E1RA 3VBRB 3UKVA 3IPVA 4RGKA 5FZ3A 3HJRA 3W20A 3PDQA 1UMZA 3VBHB 2WWJA 4NHXA 2HBTA 1OUXA 1YQ2A 2EIGA 1WLWA 4YPJA 1RUNA 2ET1A 2CHHA
chains in the Genus database with same CATH topology
1LHWA 4OI4A 2O8QA 4COZA 2ES3A 2ZX1A 1TNFA 5A3LA 5C4WA 1SACA 1WD4A 2X29A 1YLLA 4GB32 2FQPA 2I07B 3KCYA 5BYNA 2X53S 5KXDA 4OHYA 2DCZA 2HWD1 3LZZA 1NOVA 1NQDA 3N3HA 4FCAA 4XILA 4UXAA 3AKSA 1AUYA 3VKNA 1D4M2 3BALA 1WBLA 1BCXA 2MEV1 3H0OA 3WG1A 4AEDA 5L7OA 1C57A 4YRDA 3V65A 2DURA 2O1QA 1MZEA 3USUA 3RJ2X 3TNQA 4OFGA 1OSGA 4EN8B 1U12A 1HRV2 1FT9A 3KT1A 3MGUA 5GALA 1ND3B 1LOEA 3S7EA 1W6QA 1H8TB 3HN1A 1WD3A 2I2SA 3R4SA 4E4DX 1GZ9A 4WM8A 1LHNA 3W58A 4Y1ZA 3WZ1A 1LENA 1Y9QA 3TN91 5CFDB 2XJPA 2GMPA 4XFAA 1LU1A 1J59A 2D98A 3MF9A 3TYJA 2VH9A 2VOWA 5K9YA 4DQAA 3MIGA 4OHVA 3ZIXA 5DDJ2 3AZXA 3RI8A 1N47A 1FOD3 1GNHA 4C1XA 1LB2A 3LA7A 4XEZA 4BH9A 1LTEA 1ZRCA 4LBMA 1DBNA 1I5ZA 2PHUA 1VBA2 1OLQA 3VL8A 4XJ8A 2WZR3 4WM7C 1HRI3 2BEOA 1BXHA 2E7TA 1QJU3 2GC2A 2X5IA 4RS5C 3E5XA 3SLIA 2ILMA 1S1AA 1VJ2A 2PAMA 1J3PA 3DPRA 1AR61 1COV2 4LUKA 1OA2A 4MVTA 1GBGA 5T5JA 2F4PA 3VDDB 1UU4A 1KXGA 2ZX0A 3TNPB 3CJXA 1TQ5A 3WUDA 1GV9A 4EJRA 2WZPP 4FTSA 3AMQA 4MLOA 4GWMA 5JOZA 5H9QA 2BW8A 3GBGA 1X82A 5FAXA 2E53A 3QH7A 3LKJA 3J8F3 1MS1A 1ND3C 4QGNA 1W6PA 2IXLA 2JXAA 1H8TC 3FBMA 3OBRA 3GF6A 2R073 4QPYA 4QGLA 2PHFA 3D0SA 1ZRRA 4YARA 1PIV1 4M01A 3WW2A 1SBEA 3O0WA 3HWJA 2EXHA 5JVVA 3ZFFB 1G8WA 4QM8A 4G9SB 1YNAA 1EPWA 4MGYE 4YG6A 1WMFA 2D6OX 3ZMNA 3JD73 1MZ6A 1RUE3 4EWAA 5FQ0A 5BXXA 5GLUA 4TSVA 3ZFEB 1ZRDA 3V0BA 1R091 1W0PA 3RYRA 5SV5A 1BKZA 4IEOA 2R063 1G6NA 1S0DA 3APBA 3H8UA 5FTTC 1OOPB 3AP4A 1RHI2 4I3PA 4B7EA 1RUJ3 1UX6A 4Q26A 1MS5A 3WCSA 4UW5A 4YGCA 3N7LA 1ENXA 2ZGSA 1V9U2 2PHTA 5D1IA 5KHIA 4LBOA 1G9DA 3E5QA 3CJIB 1Y7BA 2ZPXA 1OPOA 4XDQA 3PTYA 1CIWA 2VMIA 4AVVA 4H14A 2DCJA 2D97A 1UL9A 1W0OA 4DINB 3VBHA 1BZWA 1NCRB 4H7MA 1AR81 1JN2P 3VBUB 5GZCA 5IK4A 3FLRA 2UY8A 4META 4HN1A 1C1LA 1SBFA 1VRH1 4XF9A 2YROA 1S0FA 1O4YA 3VBSB 4Q4X3 2JE9A 1BK1A 2PHWA 1MEC2 1PO13 1MS4A 4FOWA 4CDQC 4I30A 3FUQA 1B09A 2WT2A 4XZPA 2E7AA 4QQOA 2P3IA 4I0BA 1UU6A 3ZSMA 5A32B 1VBE3 3N4MA 4FPKA 4ES8A 3UJOA 1FX5A 2WFF3 1PNGA 1CQ9A 4IEWA 1MQTC 3I4IA 3KGLA 3JQXA 4IEUA 3KQRA 1S0IA 2VULA 3W59A 1JYIA 1TME1 1LHVA 4SLIA 4K9SA 1AL23 2PLV1 3CO2A 5JMCA 1ND3A 1QHDA 2NMOA 1FYUA 3ETQA 1H8TA 5DG1A 4YGBA 5C8CB 4M3CF 3RMXA 1C5HA 5BNPC 4RR3C 4JV4A 2KA3A 1AR91 5CFDA 3B9CA 2ERFA 4AW7A 5KHKA 4E9KA 2XKPA 1KFUL 4HMZA 1N3PA 2VW1A 1XNCA 3O0XA 4ISRA 3B7MA 4JDNA 4OI1A 3E6DA 3ZXKA 2VW0A 1ULDA 4LBQB 4XBLA 3AKQA 3OBTA 4GMP1 1VBB3 2ZCWA 1RJ7A 4QQHA 1CGPA 5I8SA 4FPYA 1VIWB 2PN5A 1QXJA 3MYXA 1CAVB 5LK5A 1QJX2 2NM1A 1B35C 1BEV3 3UK9A 1PGL2 4PBOA 2DYCA 1ZZ7A 2R32A 4A7YA 5T5OA 4Q29A 1ALYA 4OI2A 1TNRA 1JXNA 3VDDA 3ZVXA 3U07A 4OUSA 1UIJA 5J36A 2ARBA 3IBMA 4AYUA 3AMHA 4NPRA 1O3RA 3WG2A 2AGSA 4NHLA 5LK7B 2XBO1 2WL1A 1GKBA 3UV9A 1SDWA 4P5HA 2XWJB 5CA6A 1RUF2 2AENA 3PVBB 1FPN2 1N1SA 1KFXL 1DZTA 1RC6A 1WW7A 4R9CA 2RS12 2RM22 4CRQA 3AMPA 5DZEA 3OY8B 3WNXA 4AK3A 1I1EA 2CL2A 2OVUA 5DUVA 4FT8A 4LLOA 3ZFFA 2JG8B 3PVOA 4MXWB 2CWSA 4WVWA 3ZN5A 2GN7A 2P2KA 5BNNC 5D8AB 2RS33 3ZFEA 1ENQA 1RUG1 2OW4A 4AF9A 1ZBE2 2AYHA 2ZA9A 4RGGA 4YW3A 4PIZA 1R083 2IC1A 4FOQA 4Q4Y2 4CDUC 4FXKB 3PHMA 5GJ6A 4R52A 4QMAA 4HBNA 1OOPA 3JBG2 1A3KA 4DXZA 4AEMA 1AXKA 4FSJA 4P9IA 2BUKA 5ACA3 1AYM1 4LBLA 3U10A 2ZX2A 3CJIA 3R4UA 2ZGQA 1V00A 2FMDA 2ZGKA 4AFCA 4GA9A 4QM9A 2QCSB 2QNKA 3KCXA 1BQPA 2HWB1 1UF2C 5F5QA 1IPJA 1NCRA 1WMEA 3DGTA 3WOGA 4W6WA 3LA2A 1SQ4A 3VBUA 3ME2A 2R043 4QQ2A 1QMJA 3G6JB 2A6XA 2GU9A 3VBFB 1WUVA 2VUAA 2Y38A 2JX9A 4NWVA 3RS6A 3VBSA 4MZUA 4CEWB 2ARXA 2JD4A 2RR12 3B5LB 4AHZA 3BCWA 4FPFA 4YVSB 3ZXFA 4S2FA 3ECQA 1SLAA 1OLRA 4B8EA 2XKOA 4F3JA 3J26N 4Q1RA 4FP2A 1HV1A 5CADA 2R062 5FO7B 1DZRA 2CGOA 1RUC1 4GULA 4AWDA 4YGEA 3JU9A 1SLBA 1H1MA 3URFA 1LEDA 1LOGA 1AYN2 5C8CA 1Q3EA 2DVAA 3N35A 2XPJA 4S2HA 2WNVC 1DDLA 1WLTA 1REEA 1GZWB 2HWD3 4QHBA 4D7YA 1HW5A 1LR5A 1T6GC 1UAIA 1OA4A 5BPXA 2GZWA 2DVDA 4HZFA 1RITA 4G4FA 2MEV3 1WW4A 4IV1C 1PVC2 4XPVA 3ZSJA 5JI7A 3LOBA 1M4WA 1ASJ2 2VW2A 1FMD2 1HQWA 3AZZA 1F9KA 4QXKA 5FDBA 4RQPB 1NYWA 3RI9A 1H30A 1D2SA 1LOAA 3PNAA 4YM2A 1POV1 2WC2A 2EALA 1RB8G 4LBQA 1EAH1 3N36A 1YFWA 3VZNA 1KDKA 3GBFA 3WQ1A 1QOOA 3TN93 3WDWA 5T55A 3HQXA 4P9JA 2Q1ZB 4FPEA 5C6CA 1DQ5A 1YI7A 2DVGA 3SXWA 3N7JA 4MGKE 4CEWC 1LOCA 3VBOC 4BIFA 2ZZQA 3AKPA 1G9FA 4XTMA 3AP7A 4AHYA 1Q56A 2WS91 2Z69A 2OUHA 3LCPA 3OJBA 4LNVA 4X6RB 4Q0SA 1J58A 1TMF2 1SLLA 3HAGA 1X8EA 1AXYA 4NOTA 3JZVA 1S2BA 5KHGA 1EYBA 2ZHKA 1I3HA 2D6PA 2OUJA 1QJY2 3ZX7A 5GLZA 4IV3B 2WJSA 1BVVA 1WGPA 1XNDA 2JEMA 4XYXA 3AMMA 3HR9A 2V73A 1SLCA 4I0WB 4M3CB 2VMGA 3WDVA 4DFSA 2GH2A 1Y3TA 3CLPA 5IUQA 2R30A 1D2QA 2FZ1A 3RQ0A 1NA1C 1AR63 4DY5A 4YZ3A 3OY8A 1AR72 4HL0A 4Y1VA 2CGNA 1F5JA 2DF7A 3B01A 5L36A 2BWAA 2UURA 2JG8A 1QWRA 1QQP1 4MXWA 3THPA 1LOFA 4OLLA 3AFKA 2D3RA 3A0NA 4PDWB 5D8AA 1PK6C 4A2UA 1DHKB 1VBB2 2ZGUA 4RQPC 1AJOA 4B4RA 3A0KA 2HWE1 2IFRA 4JTNA 1PGW1 1CAXB 2IXCA 3RWNA 2VVEA 1PIV3 3W9AA 3PMSA 1LHUA 5JWPA 1H2NA 1SLIA 3JCIA 4RHV2 2H6CA 3BODA 1BEV2 3S30A 1AVBA 2UU8A 1ULCA 2EF6A 1OD5A 3H7JA 3SH4A 1RUH1 3FUOA 2B7YA 2EAKA 3ATGA 1XNBA 2CTVA 1IS5A 1H2KA 2IXHA 1D0HA 1NXD1 1R093 1KDMA 4W6XA 2WKKA 1S0EA 2ZGLA 2JECA 3OGJA 1EY2A 1YRZA 4B3NA 4AFMA 4XETA 2TNFA 4KGGA 4XQWA 4A7KA 1MACA 5JSOA 5T3NA 5ABJC 2GSYA 1GYKA 4RFT0 1OHFA 4E4SA 4F83A 4HPKB 4B4QA 4GWNA 4ZU7A 3VBFA 1V70A 2YYOA 2VMHA 2ZHMA 4E2QA 2Q4SA 2TUNA 4CEWA 2IXKA 3WXPA 2B39A 3KT7A 2WFPA 4YYOA 4FPCA 1RUD1 4YVSA 1YJLA 4E27A 3B93A 4XJUA 1DYPA 3L2YA 1Q8SA 1H4GA 1LODA 1AR83 4Q1PA 4Q2FA 1K5MC 3ZXLA 1H2MA 4ATEA 1O4TA 1JYCA 3J4UH 5JZGC 1VRH3 2XGXA 1O3QA 1AHSA 1ND2C 1CR7A 2MPFA 5I8YA 3MIBA 5FLIA 1OA3A 4R9AA 1VAVA 3H3ZA 2ENRA 2IWGB 4XOGA 1GSLA 4GB31 1RUI2 1DGWA 5C9AC 4M0NA 1GZWA 4GH4C 1PO22 1KD7A 2ETEA 1PGSA 3V56A 3M70A 1X7NA 3ALQA 4XFHA 4ASLA 1IS4A 4WM7B 5EXOA 2JICA 3JUUA 1JBCA 5CB7A 1D4M1 3I59B 4RS5B 1LECA 2PLV3 2HEVF 2W52A 2QE3A 3FBYA 1XRUA 3D0JA 2JDZA 5AC92 2HWF2 1HRV1 3NJZA 3MW2A 4RQPA 5EV7A 4AHWA 1H9PA 2K0GA 4Q0UA 4LO5B 1ZZBA 3NKTA 3TOJA 2YUEA 5K0UC 3OD0A 1X8MA 2P17A 2WNUA 1AR93 4LBQD 2XVKA 5KC6A 3AYAA 1IGOA 2ZHLA 4LA2A 2VVDA 5A33B 1D0GA 5JPMB 4XJAA 4TWTA 2Y0OA 1IQAA 3OYWB 3IWZA 3ZFGC 3SCFA 2Y0IA 5DDJ1 5JDBA 1I6XA 1MS8A 1GNZA 3MW3A 1C8M2 4GMP3 2D5HA 2A3XA 4IEYA 2CYFA 4BLIA 4PF5A 1VBA1 3ZPYA 4IV3A 1CESA 2SBAA 2XUMA 4ZU5A 4IQPA 1G86A 1OFNA 3USSA 4FPJA 3WW4A 5DXDA 1COV1 3HIFA 3IKWA 3M1HA 4AFAA 4Z92B 2QUOA 3FLPA 2Y26A 1NZCA 1YYNA 1GLHA 5H9RA 4N9HA 4FPGA 2SLIA 3ST7A 4PDWA 1R1A2 4Z2WA 2XBO3 4DPNA 3KCCA 5FREA 1DQ0A 1DGLA 4ASMB 4B4PA 2R1DA 1NE6A 1ZRFA 4AEJA 4YLZA 4BHPA 1O5UA 5EYYA 2ZJCA 5JSPA 1CAXA 1CD3G 5TSWA 2AR6A 4KG8A 5F6KA 1JW6A 1VBD2 3VLBB 1SFYA 3DN7A 4W6YA 4YM3A 4HSJA 3OF1A 4Q8LA 1DGRA 1QDCA 3ZXEA 1Q8QA 3OD4A 5IK7A 1CONA 3ZSKA 1J1TA 4FTBA 4XHBA 4P14A 1LGCA 5CIRA 2RS52 5EJ3A 1RUG3 3DUIA 3QACA 3SH3A 4CDQB 4KU8A 4G3YC 4HETA 2A5ZA 4XXAA 5IK8A 4C1WA 2ZAHA 3OCPA 4FPOB 1VBC2 5EYXA 1YFXA 1RHI1 1ZBA2 2RMU2 1NG0A 1MQTB 5CNAA 1CJPA 1V9U1 1AYM3 1H2LA 2BGCA 4HPKA 2WINB 4FPLA 3D6EA 1HXS1 3ZYIB 3RMYA 4HVOA 4LULA 2W0XA 1UU5A 1N3QA 4I02A 2HWB3 4Q4V2 3ZN6B 2DCTA 3RRDA 5BUVA 2V09A 2VNGA 5BNPB 4RR3B 1RMU3 2RJLA 1F5FA 1BBT2 5JLVA 3VHRA 4E2GA 3WUCA 3KD4A 3NAPC 3GNEA 4PCRA 1WW5A 4AXOA 2DUQA 3FLTA 1MR5A 4F8AA 2D3SA 1S0GA 1XU2A 1AX2A 2JG9C 4HLTA 1Z7S2 3NWKA 3ZMOA 4AEKA 3N7MA 1MEC1 4AQSA 3FC0A 3NSTA 4Q4W2 1NCQC 2VECA 2WLPA 2VVFA 1NLSA 1KJLA 1U5IA 4MH0E 1SCSA 3PJYA 1WLDA 4TYSA 4EN7B 4JC1A 4S2DA 1UZYA 4WM7A 1Q8OA 4JGZC 1G9BA 3PMEA 3ZYPA 4O9GA 5CFCC 4AI8A 5KXCA 3I59A 4RS5A 1RUC3 4EN9B 5JIUA 5DUUA 4YW1A 1S0BA 2BWCA 1B35B 3LSDA 4PIYA 4HT1T 1LRHA 5FOJB 4XMIA 4DY3A 3SMHA 3IN9A 2B9UA 1F2NA 2NN8A 3WP6A 4BQ1A 3H50A 4TLFA 5BY5A 2HWC2 3M3OA 5EFUA 3JB4C 2D6LX 3CF6E 5J3UA 3WD5A 4E4ZA 4DNYA 4EWDA 2XB6C 3MLJA 3NO8A 4WVVA 3RDIA 3VKOA 1JHNA 4KQ7A 5A33A 5JOXA 3WDYA 3ILRA 3OYWA 1RVF2 1POV3 4LBJA 1FXZA 1EV12 2CAUA 1EAH3 2BNOA 3TRSB 2RE9A 4GQ7A 4BYYA 2DFBA 1ZYBA 3M2MA 5I0UA 2H0BA 3FMGA 4XXPA 5E88A 3S6PA 3WP3A 5BNNB 5A3MA 5HCAA 1DG6A 3H3UA 2QDRA 1PMIA 4CDUB 1ZZ9A 2W39A 4OULA 4XIKA 4AGRA 5CVRA 1QJX1 4HKOA 3L2HA 4CDWC 4P9LA 4YVWC 2WS93 1PGL1 1YWKA 3WDXA 4FQZA 5L73A 4RSUA 3NV4A 2I45A 3WHTA 3T1LA 2BBVA 2GNMA 1ULFA 5DZFA 1V6MA 3EXUA 2DCYA 1HKDA 3VUOA 4OZXA 3K48A 1AX1A 3SNMA 2R1BA 1KQRA 4JTOA 4LHKA 5J7MA 4L99A 4LTAA 3VZJA 5HBAA 3ROUA 4N53C 3Q9OA 2G9FA 4AHXA 4Q0PA 5JI9A 5I8TA 1C4RA 4H7LA 1W6MB 1ULGA 4AQ2A 1RUF1 2ZGRA 1PNFA 3IMNA 3MIFA 4LO6B 1FPN1 3THTA 2NYYA 2RS11 2GNBA 1HQNA 2RM21 4HSLA 4NO4A 1RINA 1LJ7A 4XFGA 3POWA 4W65A 3AMNA 4HVQA 4CYDA 1QQP3 5B2GB 2ZGPA 1DYKA 3VGIA 3MFAA 2XHKA 1MS0A 2EXJA 3RNSA 5IK5A 2KXLA 1VB2A 5FMOL 2NZ9A 4CDQA 4H55A 1ZBE1 3OGGA 2HWE3 3IDCB 4Q4Y1 4DMIA 4U2AA 2O8OA 4KL1A 1WA4A 1ULEA 1MS9A 4LBKA 4BPZA 2WQZC 4RL7A 3JBG1 2D44A 1MQTA 2D7FA 4UW4A 3SHRA 1FOD2 4Y24A 1XYPA 2FBEA 2WT0A 3WY6A 1EPZA 1RUH3 1FNYA 2VOVA 4CP0A 1Y43B 2HEWF 3AP6A 5CBLA 4YZ2A 3MF6A 3GHNA 3V64A 2WZR2 5FO9B 1LESA 3RSJA 1HRI2 3I54A 1KS5A 4R9BA 5KC5A 1JOJA 1QJU2 2WNVB 2GDFA 3ZN6A 3O0VA 5FLJA 1IZ3A 5BNPA 4RR3A 4XJZA 1FATA 4D69A 1KJRA 4NR1A 3KZ4C 1LHOA 2GAUA 4OHXA 4ZXKA 1TE1B 4IV1B 2ZTNA 1O3TA 2D43A 3UL2A 3KB5A 4XHXA 1LU2A 1NY72 1DLLA 1FAYA 2YY1A 3WV6A 1EP0A 1ZZCA 2RR11 4WVMB 1DGRN 4MV2A 1RUD3 3KS7A 5CG8A 3J8F2 4M00A 3UKNA 4D7TA 4QGMA 2R072 5EZWA 3VV1A 3WDTA 2XVGA 2A6ZA 4KG0A 2R061 1DZQA 2JKBA 4HK9A 1QNYA 5F1RA 5KBFA 3VBOB 2A3YA 4XFCA 5FBZA 1B35A 5CU1A 2BNNA 1HQLA 2NLRA 3FWEA 1AYN1 4GB33 3JD72 5A32A 4JQRA 1RUE2 1RIRA 5AFBA 5BNOB 5DUWA 4I0AA 3WP4A 2G4IA 3S0MA 3LOIA 4Z07A 1WMDA 1IS3A 4AGVA 1CPMA 1D4M3 5GKAC 2WWSA 4INDA 1RUJ2 1PVC1 1IKPA 1AZDA 1RMU2 1ASJ1 1XQNA 3I8TA 2D93A 1YI9A 3MDPA 1FMD1 1HRV3 2VPVA 1NA1B 1KS4A 1BMV2 4S2GA 4XQDA 2PAEA 4QPGC 2IZWA 1H4HA 4AGGA 1AF9A 1MZFA 1IS6A 2AUYA 1LGBA 3D8CA 3GYDA 3C3VA 5J37A 2IXJA 5BNNA 2QQPA 2VNOA 2Q8OA 1PK6B 2VQ0A 2PTMA 2Z79A 3R0RA 2P3KA 4LA3A 1XU1A 4CDUA 4JGYC 5GZFA 4XF0A 3AXEA 3AM2A 4YZ5A 3WHUA 1UD1A 2DVFA 4QU2A 4KWKA 4LLFA 5DDJ3 3DF0A 4CDXC 4Q4X2 4EWEA 1TMF1 2VXRA 4XQ4A 1PO12 4CTEA 4DOUA 3B02A 3NV2A 3G7DA 3LAGA 4N43C 1VBA3 3VZKA 2C0ZA 1QJY1 1CAVA 1VBE2 3TAYA 1LOBA 2WFF2 1W6MA 3FE5A 3UKTA 4DS0A 1PZ9A 2Q0AA 1N3OA 5I91A 4L9BA 4WBBA 1BJQA 2YPJA 2KM2A 3HT2A 4X8PA 2E63A 5BNOC 4H3WA 4R9DA 4HKLA 3O7OA 1AL22 1COV3 1AR71 3AFGA 5DZGA 5ABJB 4JAAA 2LM3A 1YO8A 4MUVA 4CEYC 4PLOA 1W6QB 4XJWA 2D3PA 4DRRA 4XFBA 4RD7A 1CAUB 2BPA2 3IT8A 4AFDA 5J48A 1G7YA 1DF0A 1QOTA 3U4XA 1ZZ6A 3M4FA 4MSVA 1GQGA 4AI1A 3E6BA 4PLNA 1HDKA 2A73B 1K5MB 4KU7A 3I7DA 3SISA 4RHV1 1SEFA 5GLTA 1RJ8A 1BEV1 5JZGB