1C8M2

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
total genus 59
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m200
1COV1 1ND2B 3VBHA 4CDXB 1EV11 1F2NA 3JD72 4Y5Z0 2HWD1 1VBC2 1K5MB 1F8VA 1TMF3 4RQPA 5FMOL 3DPRA 1FMD1 4FTSA 4Q4X2 1BMV2 1VBC3 4YVSA 4JGZA 4YVWB 2RS51 3VBUA 5C9AB 4CDQA 5L7OA 3VBFA 4RS5A 1AL21 2R061 2BFUS 4Q4X3 2RM21 4RHV1 5JZGA 1R081 1C8M2 1K5MA 1AL0G 4CEYC 5BNNC 1ZBE2 4PDWC 1Z7S1 3JB8A 4QPIB 1NCQA 1NCRA 3ZFFA 1RUC1 3J8F1 2ZAHA 1HRI2 1R1A3 2BFUL 1VBE1 5CFDA 1MQTC 5DDJ1 1HRI3 3VBOB 1CD3G 1D4M1 2HWF3 1RUG2 4WM8C 1PVC2 3JD71 1AYN1 3TN92 5BNOC 1PVC3 5K0UB 4QPGA 4CDXC 1RVF1 2RMU1 2R072 3ZFGB 5ABJA 4CDWC 2RS31 4IV3B 1RUI1 2R073 2X5IA 4FTEA 3M8LA 3JBG1 5AC93 1AR62 4CEYB 1C8M1 4PDWB 2RS13 5FOJB 1ZBE1 2XBO1 1R092 1AR63 1RUH1 1FPN1 5CFCA 1NY72 4Q4Y2 1R093 4JGYC 3FBMA 2WFF3 2ZZQA 1AYM1 4N53A 2VQ0A 4EJRA 1RUG1 4Q4Y3 1BBT3 5BNNA 1RUJ2 2WS93 3NAPB 1DDLA 2HWB2 1AR71 5BNOB 3TN91 1QJX2 1TMF2 1PO11 5ACA2 2HWE1 1MQTA 1VBA2 1ASJ3 1RUD1 2HWB3 1ND3C 4SBVA 1AR81 1FOD2 4CDWB 5BNPC 1QJX3 4WM8A 5ACA3 4GMP1 1VBA3 1VRH1 4GH4C 2MEV2 4CDUA 1TME2 1FOD3 1VBD2 1RMU2 5K0UC 1AR91 2PLV3 5LK7B 1HXS2 5A32B 1RUF2 3VDDC 2WZR1 3ZFGC 2MEV3 1TME3 1PGW1 1RB8G 1ND2A 1RMU3 1VBD3 1SMVA 1V9U2 4CDXA 4GB33 4AEDC 1HXS3 1RUF3 4IV3C 1R091 4IV1C 2BPA2 4CDWA 1V9U3 4JGYB 1NY71 2RR12 1R1A2 1H8TC 1VB4A 5D8AC 1QJU2 4YVWA 5C8CB 5C9AA 2GH8A 2RR13 2HWF2 1EAH3 1RUJ1 1PO22 4WM7B 1QJU3 3VBSC 1NA1C 1HRV2 2HWB1 4CEWC 1PO23 1VBB3 2R042 1BEV2 4JGYA 1TMF1 1ND3B 4QPIA 5BNPB 1IHMA 3ZFEB 1HRV3 3NAPC 1PGL2 4Z92B 1VBC1 2R043 4N43B 4Q4V2 1BEV3 4RR3B 3VBHC 4GH4B 3LOBA 4Q4X1 1QQP2 1BMV1 4Q4V3 1RMU1 1MEC2 3VDDB 3VBOA 4RQPC 1HXS1 1RUF1 5AC92 4AEDB 1QQP3 4YVSC 1MEC3 4JGZC 2RS12 4IV1B 3VBUC 1COV2 2GSYA 4CDQC 4RS5C 1H8TB 1OHFA 2HWD2 2RR11 2WLPA 5D8AB 5K0UA 1COV3 5JZGC 1R1A1 3HAGA 1OPOA 4Q4W2 2WFF2 3ZFGA 2HWD3 1HRI1 2HWF1 5J98B 2RS52 1BBT2 4Q4W3 2WS92 1NCQC 1NCRC 3VBSB 1AUYA 1AL22 1FMD3 1NA1B 4IV3A 3S6PA 4CEWB 1HX6A 2RM22 5C8CC 2RS53 4CEYA 1ZBA2 4PDWA 1HQNA 5CFDC 1NG0A 1AL23 1CJDA 1R082 2R063 1PVC1 2RM23 4WM7C 1ASJ2 3VBHB 1VAKA 1OOPC 3IDEA 1ZBA3 1Z7S2 4FSJA 2DF7A 1R083 1RHI2 1RUC2 3J8F2 2XPJA 4BCUA 4RQPB 1Z7S3 4CEWA 3DPRB 3ZFEC 2R071 2PLV2 1VB2A 4N43C 1RHI3 1RUC3 4RR3C 4JGZB 3J8F3 5DDJ2 4YVSB 5AC91 4QPGC 4NWVA 5C4WC 3VBUB 1D4M2 1RUE2 4CDQB 3VBFB 3NAPA 4RS5B 4GB32 2RS11 1C8NA 2BUKA 5DDJ3 5ABJC 1AR61 5BNOA 1D4M3 1RUE3 5JZGB 1AYN2 2X5IC 2FZ2A 1QJZA 4Q4W1 1B35C 3JD73 1AYN3 2WFF1 1RVF2 1NCQB 1NCRB 3ZFFB 1EAH2 2RMU2 4Q4Y1 1X36A 1BBT1 2WS91 3VBRC 5CFCC 5A32A 2RS32 1RVF3 5CFDB 2RMU3 1RUI2 5J96B 1VBB2 1ZBA1 3CJIC 3JBG2 1OOPB 4NWWA 2RS33 1GFF2 1ASJ1 1POV3 4N53C 1PIV2 1RUI3 1QJY2 3JBG3 2XBO2 1C8M3 1FPN2 1QJX1 1RUH2 1NOVA 5ACA1 1RHI1 1VBA1 1PIV3 5GKAC 2QQPA 1QJY3 2ZTNA 1FOD1 1ZBE3 5C8CA 2XBO3 4QPGB 5C4WB 1FPN3 1RUH3 2PLV1 2HWC2 1AYM2 4WM7A 2MEV1 1TME1 4RFT0 1RUE1 1VBD1 5ABJB 1OOPA 4GB31 2HWC3 3DPRC 1AYM3 2X5IB 1POV0 4CDUC 2TBVA 1V9U1 1AR72 1RUG3 1ND3A 1B35B 1W39A 5BNPA 5L7OC 3VBFC 3ZFEA 1M06G 1EV12 1PO12 4N43A 2HWE2 4RR3A 1RUD2 1ND2C 1AR73 4GH4A 5C4WA 1AR82 3TN93 3VBRB 1EAH1 1A6CA 5CFCB 1EV13 1PO13 2HWE3 2Y26A 1RUD3 1K5MC 1QJU1 1FMD2 3VDDA 1VRH2 1AR83 3CJIB 1POV1 1AR92 4AEDA 5A33B 3JB4C 1PO21 1VBB1 4GMP3 3ZFFC 2BBVA 4N53B 4YVWC 2R062 2WZR2 4IV1A 1VRH3 1B35A 5C9AC 5BNNB 1PGW2 4RHV2 1AR93 1E57A 1PIV1 1HRV1 1QJY1 2R041 1H8TA 1BEV1 1WCDJ 2WZR3 5D8AA 3VBRA 4RHV3 2FZ1A 1PGL1 4Q4V1 1MQTB 3CJIA 4LLFA 2HWC1 4QPIC 5A33A 4Y4YA 1QQP1 4WM8B 3VBSA 1NA1A 1MEC1 5FMOS 3ZXAC 1VBE2 4GMP0 4CDUB 2IZWA 2WWSA 5L7OB 1X33A 1VBE3 1RUJ3 3VBOC 4FTBA
chains in the Genus database with same CATH superfamily
1CIYA 4UYBA 1ND2B 5T3NA 2ZGUA 3VBHA 1YEWA 5E8AA 2CWSA 1IS6A 4M01A 5A3WA 3KCXA 1SHWB 3LA2A 2HWD1 5FYTA 5H9SA 3AKRA 2ZMNA 1WWYA 1F8VA 5F5QA 4RQPA 2CGPA 3R4UA 4D94A 1SBDA 1O4ZA 4HXCA 5KHGA 2ATFA 3GXUA 4FTSA 1BMV2 4AVAA 2XXZA 3ZSKA 1X8MA 1WW4A 4HL0A 4FFGA 3VUOA 3WXPA 2XR4A 1O5LA 1URXA 2JJ6A 3B7MA 2YU2A 3AXEA 4AHWA 4Q4X3 3MLKA 4LTAA 1XNKA 2RM21 1K42A 5BV6A 3LEGA 3MW3A 4Z07A 1UF2C 3U07A 3TEXA 3T0DA 2ZHNA 2VMGA 3TYJA 4XFIA 3RPQA 5JZGA 3KS7A 4H14A 1GANA 5H9RA 5JSOA 3AZYA 4DY5A 3W21A 4YZ5A 2ZEYA 4N8MA 4ASKA 4TYSA 2BYVE 4YGEA 2GU9A 5L9BA 1W9WA 3RQ0A 3WQ7A 4R9AA 2X10A 1W6NB 1U12A 3ACFA 3FZ3A 4QPIB 2ES3A 4RL7A 1NCQA 1UOJA 3ZFFA 3K75B 3U4XA 2ZABA 1LOGA 3J8F1 2BVBA 1V6OA 2VQUA 1Q56A 2VMIA 4M3CB 4H7LA 4Q0PA 5F32A 4YFWA 2BFUL 5IK5A 5FBZA 5BNNA 1S0FA 2BBAA 3TBDA 1ULDA 2BZDA 3NNMA 1MQTC 4QAWA 3RWNA 4G4FA 4QB6A 1HRI3 4HVRA 3VBOB 4BXFA 4NIDA 1CD3G 2HWF3 2VOKA 3FE5A 4PIZA 3JQWA 4AW7A 1JZ7A 2RDRA 1Z0HA 5FCCA 1NXMA 1OFNA 2A75A 4XAEA 1FV3A 3BVCA 4LUMA 4FVVA 4OI4A 1W8UA 4LUKA 3ZSJA 5F6KA 5LATA 4NPLA 2WL1A 3H8RA 3ZMNA 4XUQA 2QVSB 2Y0IA 5KXEA 4CCNA 4KWLA 3GBFA 3OUHA 4LT5A 4IE5A 2JDMA 4LO4B 5ANQA 1GZ9A 1OA2A 4UFKA 2R072 3I3DA 1H2MA 1UU4A 1IQAA 2I45A 3IDCB 3R6SA 1YXWA 4FXGB 4LXLA 1QNYA 1ZRFA 4BQ1A 1BLZA 3HNYM 2YGLA 1WMEA 4HSLA 2RS31 3VDBA 3PMSA 1J83A 4LBJA 3THTA 1HB3A 3MW4A 1GQPA 1RUI1 4LKFA 4FTEA 3ATGA 1YFWA 4YGBA 1WCKA 4L2NA 1SDWA 4WBBA 1EUUA 4DXSA 3ZXJA 5AC93 1J3QA 4XW3A 1J84A 4PDWB 1OUXA 1S0JA 2E53A 4W65A 3ZYHA 4D6QA 1DFQA 2RS13 3OB8A 1OD3A 1YQ8A 3I2FA 3EHKA 5FFOC 3RI8A 5BPXA 1RUH1 2XUEA 4LBKA 4R52A 2VBPA 1AX2A 4HFSA 1JZ3A 1HW5A 4QT6A 2OS2A 2OZJA 2ZGPA 2JG8C 1W9TA 4Q4Y2 3S5QA 3U78A 1BJQA 2OQ7A 4LE4A 3PUHA 4ZXEA 1OXCA 2YFZA 1CAWA 2WFF3 4ARYA 4ASLA 1BXHA 3NJYA 3RMYA 2DVDA 4RYDA 5ERLA 4A41A 2F4LA 4N53A 4MXVA 1JTZX 4CVUA 2VMHA 2YFUA 1RUG1 3LFMA 3AYEA 1GNYA 3KVAA 5EV7A 4QX8A 1VAVA 2WS93 2B5HA 4QQPA 2YBSA 1CR7A 3C3VA 3BGAA 3NAPB 1I1EA 5LBBA 2ZXQA 3MW2A 1UY2A 4BQ3A 4DUXA 3I3QA 1DDLA 4IEWA 4CCDA 1W0NA 3ZXDA 4R4ZA 1FNZA 2VMEA 3NJVA 3PVEA 5D1IA 1QJX2 5FUPA 2VUJA 1G8WA 1R1ZA 3ORJA 1VBA2 4JVAA 3GALA 2FDHA 1JOBA 4Y1ZA 4XUNA 4SBVA 3I3BA 2P3IA 2W92A 3AYDA 3T4VA 4CDWB 4KNCA 3RZHA 2J22A 3VZKA 3WW1A 4ISRA 3VZJA 4OHYA 3INAA 3H3ZA 2LM3A 4GMP1 1YI9A 3A0NA 4PQ9A 5JDBA 4CDUA 1TME2 1GZTA 1UW8A 5IK8A 3BODA 1AR91 1WW5A 4HPKA 3TOJA 3FMGA 1L7LA 1IS5A 1YHFA 4I3PA 4BWOA 4B7EA 1VRBA 4MGIE 2HBTA 5DABA 4URTA 2AH2A 1RUF2 3IMNA 4JZRA 2MEV3 2RJKA 2WO7A 1RB8G 3MLJA 3E97A 4QDRA 1VBD3 1FV2A 1RMU3 1V9U2 2A3WA 2JG9B 3WG4A 1L3JA 4OYUA 1HXS3 3ZN4A 4DXZA 4X6RB 3AYCA 1X82A 1Y9GA 3CZJA 4Q2FA 2RDSA 3VHPA 1LEMA 2MPFA 1NY71 3GM8A 5FDBA 2FCUA 1ZM1A 4IEVA 4AEKA 2VTXJ 5FZMA 4YLZA 5JMOA 2WNVB 2XVLA 1QH7A 5D8AC 3MPPG 5JAXA 1QJU2 5C8CB 1LENA 4GQ7A 2FHRA 2Q8CA 2H0BA 2HWF2 1O4TA 1EAH3 1XXNA 4XFFA 2ZX3A 2ZMLA 5CB7A 4AOCA 1WBFA 4N9IA 4NIIA 1PO22 5IVFA 5LCWL 3AK0A 2D6PA 2VW2A 3GZTB 2K2SA 2IXHA 4RGGA 5GLVA 3ZXKA 3UGFA 3MYXA 2CGNA 1REDA 4DUVA 5FZAA 1VMJA 1QDCA 3M1HA 1BZWA 3J7NA 3N7MA 4IEZA 2AEYA 3V0BA 3HQRA 1KJRA 4CCLA 1BEV2 1RJ7A 3MHZA 5JPNB 1SBFA 1IPJA 3UGGA 2YZ4A 4BPZA 4XF3A 2CAVA 1GZWA 5F5AA 4BJ0A 3ZFEB 3NAPC 1LECA 2DCYA 3NV2A 1VBC1 2Q0AA 2Q30A 2HEWF 4N43B 3RYPA 4XHXA 4YW5A 4XFCA 2CU5A 3PU8A 1D2QA 3FHIB 4C0HA 3LOBA 4UBHA 1MS5A 5I91A 2VNGA 3CF6E 4AVVA 3POIA 4Q4V3 2AREA 4QXKA 3VZMA 4NRQA 5FBJA 3VDDB 1XC6A 2QQJA 5L36A 2VZRA 4YGCA 5HCFA 4PLMA 5LWBA 2V4VA 3LD8A 2MHFA 1WCUA 3KCCA 5AC92 1G9CA 2VO5A 3C7EA 4TSVA 4YVSC 4JGZC 5LA9A 3Q8AA 2RS12 2XMLA 4IV1B 2GSYA 1A78A 5CU1A 2OUHA 4RS5C 1C28A 2GC2A 2BTVC 3RFRA 1A3KA 4AG4A 2ERFA 1H8TB 3B3QE 2HWD2 4AE2A 4HVQA 2CDPA 5K0UA 3K46A 3PJQA 1DIWA 1R1A1 3HAGA 5J36A 1OPOA 1QF3A 2A5ZA 4M3CE 1WZXA 3IMMA 2JDZA 3IWZA 3M3OA 4KI5M 1ULFA 4QXBA 4YFZA 2WFF2 3ZFGA 2YPDA 4MX3A 2K46A 5J37A 2NPIA 1QJEA 1HN0A 4XPVA 1JZ8A 4Q4W3 2WS92 2X29A 4Q26A 4QGMA 4AVBA 1FMD3 4MUVA 2W1WA 1NLSA 2B45X 5F2SA 2WNVC 2RM22 3IAPA 1NAEA 4BIOA 5C8CC 2JIGA 1ZVFA 5FZFA 3AFKA 1G86A 4AF9A 4TLGA 4OI2A 5CFDC 4L0PA 1CJDA 1SLAA 1W6OA 1QEXA 2O1QA 1YFUA 3UNPA 4ITCA 3ILRA 3NNJA 1GWKA 3LA3A 3RRDA 4XZUG 3VBHB 2ZPXA 1PMIA 1GWMA 3SXWA 3WF3A 3E6DA 3OBTA 2J7MA 3AL5A 1JODA 4I0BA 4YG6A 5J09A 4S2GA 3O1OA 3RDIA 3J8F2 1HJGA 4Z8BA 1J3PA 2NM1A 4AFMA 2CDOA 1UPSA 4RQPB 4ES9A 2ZEWA 1Z7S3 4CA9A 1JYXA 1MVQA 4CEWA 2J1RA 2OX0A 2AYHA 4MO3M 3ZFEC 1VB2A 3WNNA 4YSFA 2BGCA 4PI0A 4OQ9A 2WQ4A 1RHI3 3PNAA 4N43C 4QQ2A 4CU6A 2ZGSA 1KRIA 4QPGC 2QCSB 4NWVA 5GZFA 2EXJA 2VTFA 3HEIA 1HDKA 1PZ8A 3RVHA 3U75A 3N9MA 1UYYA 4TN7A 1C8NA 1IS4A 1CZTA 5DDJ3 2BU9A 3WNLA 4E4SA 4E8DA 5ABJC 4E2SA 5JMCA 3RZJA 4OCTA 1UMHA 1SBEA 2Y6FA 2FMDA 5JZGB 1UZZA 5F3EA 2VMFA 4DRRA 2V5YA 1VIWB 3FFQA 2FZ2A 3E6CC 1OSGA 2ZOEB 3RG0A 2E9QA 1XYOA 4XIKA 4DO0A 3AKPA 3DYMA 2WR9A 2J1SA 4Q0VA 5FZOA 1MACA 1UPIA 1H30A 1ULGA 2C1FA 2JD4A 4FP2A 1NCQB 3ZFFB 4MGTA 5EJZB 1EAH2 2IVIB 3THDA 3VZLA 3K51A 1C5IA 1VALA 3CJXA 5DAWA 4Y1XA 1HV0A 4CPBD 1H4GA 1GOFA 1RVF3 2RS32 3RYRA 5JXGA 3N9NA 2RMU3 1RUI2 2QQVA 1LKNA 3OBRA 3UKNA 2KA3A 3E5XA 5J96B 2BNOA 3KM5A 2VW1A 5JPMB 3W5NA 5FK8A 4FPJA 2WSVA 4NR1A 2ARAA 3M3QA 4UW3A 3WUCA 1OKOA 4A6SA 4EROA 2WT0A 4Y3OA 1POV3 2VZ3A 2Y64A 3RZKA 4JDNA 1DGRN 4R9BA 2JG8A 1JZ6A 4V2WA 1C8M3 1JOPA 1RUH2 4QGNA 1V6KA 4DNYA 2K9ZA 1NOVA 3C7GA 3RZLA 2JDKA 1PIV3 2QQPA 1QJY3 2BVVA 4OI0A 2EAAA 2R32A 1ZBE3 2VOWA 4ATFA 4A42A 3L2YA 1FPN3 1CAUA 1ZZCA 3AFGA 5FMDA 2F17A 1W2TA 4PBPA 5FO7B 4ASMB 1SACA 1MS1A 4K6BA 3MIEA 5FYCA 3AZVA 1QU0A 1UXXX 1DYPA 2B42B 2R0HA 5I0SA 5IVEA 1OKQA 1BVVA 1OOPA 2RV9A 3ZYJB 5KHIA 4C8DA 1QXJA 1DQ5A 4JTOA 4KGGA 2HWC3 3MPBA 1AYM3 4A4AA 3LA7A 3R0RA 5EJ1B 1IGOA 1UX6A 2TUNA 2IXJA 3UKTA 3QLQA 2DTYA 3LFIA 4XJAA 2PFWA 4P08A 1Z78A 2LALA 4BQ4A 4XE9A 1W8HA 3P5BA 1AR73 2DCKA 3DV8A 5C4WA 3TN93 4JTNA 2EIDA 4BQYA 4Q0UA 2VXRA 4HANA 4I02A 1A6CA 4BXSV 4ZZ5A 2A6VA 1EV13 2AR6A 1PO13 2FDJA 5F3GA 2HWE3 1WMDA 1H9PA 2Y26A 5EHDA 4B29A 1FMD2 3P3NA 4LK6A 2WNEA 1AR92 1MZFA 1VAMA 4UW6A 1RINA 1CAWB 2WO2A 3K3OA 3BPZA 4B3NA 5A33B 2JEMA 1WMFA 5KXCA 4FFHA 5IVCA 5F6LB 5T5JA 3ZFFC 4ZHNA 2BBVA 4N53B 4AR2A 1E5RA 1VRH3 5E89A 5LZ6A 5C9AC 5T52A 1WUVA 4RHV2 3MIHA 5EP9A 1BYHA 3AMPA 4NPMA 3A0KA 1SEFA 3D0SA 1MS8A 1WCDJ 5T5LA 5A6ZA 3W20A 2TEPA 5D8AA 1UOBA 2P3YA 2BQPA 1CPNA 5JR7B 4XC9A 4MG2A 5IUQA 3VV1A 4OHVA 5CADA 3VLBB 1N1TA 3ZPYA 2EICA 1DLLA 3CJIA 4XF0A 3KLSA 3WNKA 3N36A 3Q9OA 4LMFA 4Y24A 1UWWA 3LPFA 4ZS2A 5J48A 2XHKA 1MEC1 4DEVA 5A7SA 3NVCA 2A6YA 1C1FA 1EY2A 1UY1A 5FY0A 4CDUB 3ILFA 4FAGA 4HPKB 1H1AA 3I2KA 5KXBA 4QKNA 1QXRA 2PMWB 1KDKA 4YPJA 2B9UA 2D3RA 4OFGA 2A1XA 1RUJ3 2VVDA 2E51A 1RXGA 3M3CA 1COV1 1R64A 1F2NA 3EXUA 4FOVA 1RUOA 4OUMA 1QKQA 2UU8A 5A70A 2FQPA 2BNMA 2JIJA 4RGKA 1W3XA 3BCWA 1NQJA 1VBC2 3FBYA 4JHZA 4O9EA 2JB4A 1K5MB 3FL7A 3CU7A 1U5ZA 1E5HA 3POFA 4JDMA 4XEZA 1U5IA 5HXMA 3D6EA 1PM7A 5FMOL 4HLTA 2WT1A 3J9SA 3CNAA 4YVSA 2DCZA 1Q8SA 4JGZA 1QOOA 2VZSA 3AB0A 4CUAA 2RS51 5IJRA 4YW2A 3LZZA 5CEHA 5L7OA 1EUTA 4RS5A 2Q8OA 3O1SA 5FY1A 1Q8QA 2JE7A 3AKQA 2P3JA 2HLEA 3EB7A 1UU5A 1DHKB 2NZ9A 3CHXA 4XUTA 3VDAA 3WQ0A 3N35A 3W9AA 1S0CA 3ZPOA 3IBMA 5FZDA 4DEQA 2XJVA 1C8M2 3AP9A 3K3NA 4L8QA 1N3OA 3V0BB 3WDVA 3KGZA 2W9XA 2XWBB 1BKZA 1XE7A 2H0VA 3IDAA 3B69A 4I0AA 3BALA 3N9QA 1ZBE2 3S30A 5GZCA 4FQZA 3WT3A 2PELA 5FP9A 4CU8A 1GICA 3QACA 1YC61 5FR3A 2GMMA 1RUC1 2VCMA 3G7DA 1ULCA 2VOXA 3OOXA 2WKKA 1X7NA 2CNAA 1PMHX 2AACA 4FPEA 1C4RA 4WVVA 1VP6A 5CA6A 3NV3A 1VBE1 2UYBA 2PN5A 5CFDA 3CKHA 3HT1A 1C57A 4QKBA 4J1WA 1H1IA 2CV6A 4XQWA 1XNCA 4R9CA 3NQHA 4COYA 1JBCA 1HN1A 3E1F1 3FN9A 2E63A 3JD71 4RN5A 5BXXA 4UT5A 1AYN1 1HKDA 3KWVA 1IS3A 2X8KA 2EXHA 1Y3TA 2G19A 3D4KA 1NE4A 3L2HA 4P02B 3TN92 1AXYA 1JHNA 3WG2A 1N1VA 4EN9B 4AAXA 1S0DA 4BE3A 2WA4A 2VGDA 1YRZA 2YUEA 4YW3A 5SV8A 5BNOC 4XETA 4QX5A 5K0UB 4LBQD 5GLTA 4QPGA 1UZYA 3MEPA 5AFEA 2ZGKA 2HBUA 4Y26A 3B9IA 3A4UA 5FZLA 4J25A 4YW6A 3ZFGB 2VMDA 1NZIA 1UN1A 5ABJA 1GP5A 3FHQA 2DFCA 1CPMA 3FLTA 3ENRA 5AVAA 2TNFA 2ZBJA 3WLUA 3S5AA 5FKBA 1GOGA 4D7YA 2VTXA 3I59A 3ZKUA 2R073 1ZRIA 1LHVA 4V1PA 1N3PA 1TZOA 1V6LA 3JBG1 5CG8A 4CP9A 4DOUA 2D44A 5I0DA 4O61A 3PDQA 5T54A 1OLQA 4YZ1A 1UL9A 4MXWA 4P9YA 4XVHA 2PHFA 2GMPA 1UY0A 4Q0SA 1W6OB 4IE6A 5IFTA 2VCBA 3VGIA 1IPSA 1UZVA 2XBO1 1R092 2PQSA 2DVFA 3KHBA 2WRAA 2C0ZA 2ZX4A 5FZ7A 4W6YA 2BERA 3MIDA 1LOCA 2PHWA 4XDQA 1LULA 1H4HA 5FO8B 2BJSA 2R1DA 2E31A 5JOYA 3U14A 3WDWA 1YJKA 3B01A 3DF0A 3GGLA 2ZZQA 1Q5OA 2WA3A 4META 1O8SA 2XJQA 4Q4Y3 2VQTA 5M0TA 2DBNA 1BBT3 1N3QA 1RUJ2 1WW7A 4BK5A 2WJSA 4EN8B 1XSRA 3POWA 4MGZE 4OUEA 4A7KA 4XJZA 3ZYPA 5C3RA 2ZHLA 5A3UA 2V4AA 5LA2A 3HN3A 2OYZA 4DXRA 2HWB2 1ZYBA 5FZEA 1DLCA 2ZHMA 1UOFA 1RL3A 2P37A 4EV0A 1STMA 2J1AA 4IEQA 2GC1A 1RUD1 1W8NA 4IEXA 1ND3C 1JYNA 1AR81 3WW2A 4IE7A 1KFUL 1YLLA 4CZSA 5FZOB 1QJX3 5BNPC 4WM8A 5L19A 1HIXA 4MLOA 1VBA3 4KWJA 1W8TA 3OGGA 1T2XA 5E88A 3I49A 4A44A 3AKSA 3T1LA 4BQ5A 3I2OA 1KGYA 5K0UC 5LK7B 1KEXA 3GZUC 2O8OA 4QQLA 1CN1A 3ZFGC 2UY8A 1TME3 1PGW1 3LGRA 4UFLA 3SH3A 1UCXA 1KD7A 4J1XA 1VE0A 4XZPA 2GNBA 2QKDA 4OULA 4CDXA 4NIHA 2VUAA 4LHLA 2ZA9A 4CUGA 1RUF3 3I2JA 3O0WA 4BMEA 1O91A 4UFMA 3ZX7A 4OUSA 2YU1A 4XCAA 2JG8B 1FYUA 1V9U3 3GZEA 3OJBA 4ZXKA 3NJZA 5LK5A 3VKMA 4YM1A 2RR12 1W28A 5FY9A 3VL9A 4KWKA 4WVWA 4XILA 5HV0A 3ACGA 5FWEA 1SPPA 1S0GA 5K8SA 3AMMA 4O9GA 1GSLA 3VKOA 5C9AA 1CAUB 4QHBA 4JAAA 4LBLA 4XF1A 1ULPA 1UKRA 2D93A 4OLLA 5JVVA 1X50A 5JI9A 2Q4SA 3J7MA 2QQNA 3BYWA 4XXAA 3MF6A 4QWNA 1QJU3 3DUIA 4NHXA 4Q1RA 3ZDSA 2DVGA 2H6BA 3ELNA 1S55A 3ON7A 1DP0A 3GCXA 4FFFA 2DBIA 1REEA 2W08A 3VBSC 2AENA 2GDFA 2WINB 4AQ2A 5I8TA 4CEWC 1PO23 1KS4A 1VBB3 3UK9A 4BLJA 4I01A 5DAPA 4JRAA 1W2OA 3HQUA 4JGYA 1TMF1 3W5MA 1ZZ9A 1ONAA 1PHMA 5FMCA 5A3OA 1IHMA 2ZX0A 3K2OA 2VBDA 3MLLA 2ZGRA 4FP3A 1BEV3 5CKMA 3TEYA 1T6BX 3N9OA 3DCQA 3AMQA 3OYWB 2P17A 4AI0A 4Y4RA 4Y1VA 2JDUA 3KZ4C 3I2DA 3P6BA 3PUIA 1UZWA 3KF5A 4L97A 2Q8EA 4DY3A 4E2QA 1ZA7A 4XJ8A 4XYXA 4L92A 1RMU1 4BH9A 1MEC2 3KF3A 1HXS1 1PZ7A 2KD7A 2QQKA 1GMMA 2OUJA 3EBRA 4CUCA 4XIOA 2GAUA 4ZU7A 1I9RA 3JCIA 1AVBA 1XE0A 3VBUC 1COV2 2W1SA 1QOTA 2B8MA 3Q8CA 3X29B 5H9PA 4AHXA 3ZKYA 2Y6GA 4D7TA 2XQRA 2VXJA 4CCMA 4BISA 1JYWA 5C70A 3U4SA 2VZQA 5APAA 4WZCA 5D8AB 1N1SA 2Y8KA 3NO8A 3A22A 3OPWA 3BPSA 1DU3D 2PHTA 4AFDA 4GXLA 3O1MA 3EYPA 1V00A 2R6QA 2VMCA 4FT8A 2FDGA 4IW3A 2HWD3 1PX3A 2Y33A 2RS52 4Y1YA 3EO6A 2BGPA 1BBT2 4NOTA 4NO4A 5FZ9A 4KL1A 5CYYA 2GP5A 3W58A 1WLTA 4IV3A 1OUSA 1O3TA 3WP6A 1CAXB 4KWUA 1YQ6A 1HX6A 4MH0E 4ZS3A 4BLIA 5FYUA 3LAGA 2DVBA 3LCPA 1ZBA2 1NLQA 4BM8A 2ILMA 5FZ6A 1RJ8A 2JDPA 3LDKA 1PVC1 2RM23 4B4QA 1QHDA 1OLMA 4CP0A 5HV4A 2J1VA 1RUNA 4UOJA 3FLRA 4AGGA 1OOPC 3IB3A 1GWLA 1ZNPA 1LRHA 3CIHA 2DF7A 1ODNA 3M2MA 4IESA 1N47A 1MR5A 3HOBA 3IIAA 3K48A 4UW5A 2E7QA 5BYNA 1O3RA 3PURA 4K21A 5BY5A 2IXLA 2YV8A 3K77A 1RUC2 4IXLA 4E8CA 5LY1A 2XPJA 1GP4A 1LGBA 1WLDA 1GKBA 2WN2A 1KJLA 3ZXLA 1ZX5A 5IFPA 3WDTA 4NMIA 4UWDA 5DMYA 1JU4A 3WY6A 2I2SA 4COWA 4YVSB 4JGZB 3J8F3 4PF5A 2EXIA 2VCCA 5C4WC 3LF7A 1RUE2 4B8EA 4RS5B 3DXTA 3POJA 2WQZC 2IXCA 4GAZA 4M00A 2V5DA 4K9SA 4CCKA 2RE9A 4FOWA 5FREA 2DCTA 1AR61 5BNOA 4LJHA 2GNMA 2PHRA 4ZU4A 2DDUA 2XJSA 1AYN2 2VPVA 2HEVF 4C1XA 2YC4A 4LIVA 4OMDA 5HCAA 4K1ZA 2X5IC 3RNSA 5BNQA 3BTYA 2NLRA 2QQLA 1K5JA 3OBZA 4MHUA 4Q4W1 1OI6A 2VC9A 1O7FA 3ITQA 2XWJB 2EIEA 3SISA 1DQ2A 1C5HA 3R4DB 3VHRA 5F9TA 1OMIA 4URAA 2BOIA 1MZEA 1DBNA 4KG8A 4EQVA 1BCXA 3KB5A 1SLIA 3WHTA 5FO9B 4YNIA 1L7RA 3I97A 2F6BA 5LRRA 5A32A 3SKVA 4A2UA 5CFDB 1O59A 1GZCA 1VBB2 3AJZA 3CJIC 3JBG2 4QX7A 2XH6A 2VY0A 1TVGA 1WGPA 3WF1A 2RS33 3LKJA 2KM2A 1ASJ1 3SH5A 3KHCA 5A3NA 3OY8A 1RUI3 5LEJA 2P34A 1HQLA 2ZACA 4ZPIA 4W50A 4K8FA 4NUBA 5FRAA 3J4UH 2XBO2 3WV6A 5JWPA 1JZ2A 1HJFA 2NQYA 1J1LA 3LE0A 5A7OA 1S0BA 3VD9A 2WAAA 5ACA1 1RHI1 4XXPA 4Z82A 3R4SA 3HVDA 3OCPA 3SQOA 3T08A 3OD0A 1FOD1 4FAHA 1B09A 4HKLA 4QPGB 2Y60A 4X8NA 1RUH3 2PLV1 1DZQA 4M0NA 4Q8LA 3WVJA 3MICA 1OQ1A 2AZ5A 3GJAA 4AI9A 1RXFA 2P4EA 2R16A 3ACLA 2Q5TA 5A3MA 1SZBA 4H7MA 4U2AA 4WM7A 3O1UA 1ALYA 2YDEA 1T6GC 3ACIA 4HSJA 3POGA 4NRPA 3PLQA 2AUYA 5ABJB 4GB31 5E6HA 1H6XA 2XGXA 1Q8OA 5FXZA 4EZ4A 3I59B 2HYXA 3IPVA 1IOAA 1POV0 2A7AA 3LB9A 3VKFC 3ZMOA 3KV4A 1LESA 1RUG3 5LBCA 5IK7A 1ND3A 4AVTA 1W39A 1W04A 2VD7A 3G6JB 2Z69A 3J7HA 4MGYE 4MXWB 4QHZA 5GLZA 5DAXA 5BNPA 5IVVA 1JOJA 4RR3A 3RZZA 1RUD2 4NE9A 4E9KA 5GM0A 2VZUA 3H1YA 1KQRA 4XJWA 1AR82 2JDYA 3WDXA 4HK9A 1WCSA 2ETEA 2VL4A 4EWEA 3H1MA 2D43A 3N9LA 1FI2A 3ZM8A 5CAZA 5JR2A 3OUIA 3VZNA 3OBAA 3GBWA 5DPNA 3HNMA 5D2AA 3NNFA 1POV1 2PAKA 4R4XA 4OHZA 1G6NA 4GMP3 2YBPA 2IC1A 1RYYA 4YVWC 5GZEA 1B35A 5JI7A 4CCJA 3VD7A 1PGW2 4DXTA 5BNNB 1OD5A 1WLCA 1AR93 1WLWA 1PIV1 1HRV1 1QJY1 2DUOA 4DQAA 2E6VA 5FZ3A 3WW3A 1UIKA 2R041 1JZ4A 1DGLA 4OZOA 2PTMA 3D82A 1I3HA 2O0OA 1OPMA 3VBRA 2V09A 4RHV3 5EIYB 1Y4WA 1OURA 3PHMA 4O7XA 1PGL1 1F9KA 1XNDA 2D6KA 3WINE 3BTXA 5A6XA 5IAVA 3N3HA 2E26A 1Y43B 4LLFA 3HT2A 2HWC1 4KGQA 4XJ9A 1LGCA 1W0OA 5FYVA 1OVPA 2R49A 5F8PA 4WZFA 1JHJA 3IAQA 1QQP1 1YI7A 4WM8B 4Y4YA 3U1XA 3VBSA 2QUOA 5KHKA 1YYNA 4XHBA 3ZXGA 5JUVA 2PAMA 1QJFA 3K4DA 1F15A 2IZWA 5FZCA 1FAYA 1QXPA 3JXSA 1HV1A 4OMCA 1ENRA 4NAMA 4HVOA 3AP5A 3KV9A 3WNMA 1X33A 3OPZA 3PIJA 3AX4A 4PJYA 2VZPA 4N7UA 3ETPA 2WT2A 4CDXB 1CONA 2WC2A 1EV11 4WVZA 4QX1A 1RC6A 2G9ZA 4TTGA 2D6MA 4NROA 2PHDA 5C5UA 2XJRA 4Y5Z0 5FKCA 4CU7A 5FP7A 2VNOA 4D69A 4DINB 1ST8A 4LQRA 2VCAA 5EWSA 1QH6A 2UWAA 5FOBB 3MI8A 2R30A 3DPRA 2UWBA 2VU9A 1A8DA 3H50A 4PT6A 1SPPB 1VBC3 3WF2A 2ZS6B 3VBUA 5C9AB 4ES8A 3O12A 3VBFA 2KXLA 1DGWX 5JOZA 1AL21 2D5HA 2VQAA 4RFRB 2R061 2BFUS 3N4MA 1VJ2A 4CCCA 4B1LA 4IEYA 1I5PA 4DUWA 4LBMA 4EN6B 3CEWA 4XFHA 4AI3A 4DMIA 1R081 3HR9A 4KBZA 4XUPA 1AL0G 4CE8A 3ZXEA 4JKKA 4IERA 4XABA 4CEYC 4HONA 1YQCA 1MS4A 5BNNC 1NT0A 3JB8A 4DFSA 3PVBB 2XJTA 3AVSA 2Y38A 1BK0A 1XB9A 1HB4A 3W59A 2VE1A 2VZVA 2WBKA 2Z2SB 4ISQA 5JSPA 3GJBA 4AEMA 2ET1A 2ZAHA 4Y5TA 5D21A 4A6OA 2PYTA 5IATA 1R1A3 3ILNA 4FPOB 5A7PA 4IGQA 4HETA 1LU1A 1WW6A 1BVP1 1LOFC 1X9PA 4W6WA 3GDBA 3OD4A 4QX2A 3H8OA 3ASIA 1YUDA 3ZO0B 2A6XA 2ZGTA 4AQSA 4YARA 1MS9A 2ZGOA 1D4M1 3V56A 2XLAA 2XONA 1RUG2 1UMIA 4BQXA 2A6WA 3A21A 4JCKA 4WM8C 1W6PA 4FPGA 4QXHA 2ZGMA 2XUMA 3WF4A 2I74A 3H0OA 5A3LA 2FDFA 3LIHA 1PVC2 5I8SA 1DZRA 4I30A 5C3QA 3DYPA 3EQEA 3DN7A 1Y9QA 4FPFA 4ARXA 1MZ6A 2P6CA 3HWJA 4HKWA 4FPHA 4QGLA 4ATEA 4FPLA 4E4HA 2XL7A 2QTWB 1LOEA 2P3KA 1GP6A 2ZJCA 3TNPB 4P9WA 4QU2A 4LITA 4CDXC 4R9DA 5A1FA 2VECA 5FTTC 1NE6A 4N9HA 4QB1A 2DWRA 3K4AA 2WIIB 4GKYA 5EYXA 3BB6A 2YBKA 4M4RA 1ENXA 3ZLIA 1MS0A 3DEMA 1Y7BA 3WDYA 2ORXA 4LHNA 2Y6JA 4IV3B 1Q3EA 2IXIA 2X5IA 2ZX1A 1UQXA 3B5LB 3M8LA 4LE3A 3O5SA 3ZOIA 1AR62 2CL2A 3WQ1A 3TEZA 1W99A 1WD3A 1JUHA 5F39A 1DCSA 2I07B 5L9VA 5JOXA 2WFPA 3H42B 1JYVA 3MV11 4BMBA 4UAPA 5FY5A 3MGUA 3NV4A 3MIGA 3ZN6A 1NY72 4IEOA 2PA7A 3CMGA 5IYYA 4PF1A 1APNA 2W68A 3F95A 2D7FA 5GLWA 1JZ5A 3APBA 1R093 3Q8BA 2ARCA 1MPXA 4JGYC 1XQNA 3LEMA 4BOWA 1LTEA 3FBMA 1NZCA 1CGPA 5A6QA 1SFPA 2DU0A 4OHWA 5EFUA 3MFAA 4EJRA 2XKPA 2VG9A 2DFBA 4LO8A 5A1AA 1IG3A 1VMHA 2VVEA 4ZONA 4QHOA 5A80A 4IL7A 2QQWA 2WWJA 1SCRA 3AMHA 4CXYA 1LNSA 5LA0A 4LO6B 5BNOB 2UYAA 4PBOA 5FLJA 2OA2A 4JC1A 4A7YA 1W9SA 2VZ1A 5DG1A 4AFAA 5ACA2 5GZGA 4BQWA 2WYSA 5L7OC 2SLIA 2HWB3 2ZKNA 3H1WA 1LHWA 4NN0A 1KS5A 4B4PA 1FOD2 3RJRA 4JHTA 2IVJA 1UU6A 3GZAA 1PZ9A 2RDQA 3MF9A 4I3GA 1LB2A 1IG0A 3AP4A 3EMRA 4GH4C 4LULA 2QDNA 4LBQA 4P00B 2BGOA 2WN3A 5CKQA 1Q8PA 4QMAA 5A32B 1GQGA 2OVUA 5KXDA 4QM8A 5CIRA 2IFRA 2WZR1 4HN0A 1XU1A 4L9BA 4XCBA 2GALA 1SMVA 1JS9A 4S2HA 4XBQA 2EIBA 5IVYA 4AEDC 1UIJA 4HKOA 1H6YA 2D5FA 2XHNA 4IV3C 2WWUA 4NAOA 3OY8B 5ANNA 2BPA2 4CDWA 3VL8A 1TNFA 4B7KA 1QOSA 1YO8A 1GZWB 4AHYA 1R1A2 2RG4A 3T2QA 3I7DA 2WNUC 1UD1A 4Y5SA 1VB4A 2A70A 5EZWA 4IE0A 2ARXA 4YVWA 3J7LA 3ZIWA 4YZ3A 1W9FA 4XMAA 4MGQA 2GH8A 2JXAA 1W2NA 2RR13 3ZN5A 3AP7A 3IZOA 4QU1A 3LSDA 5FQ0A 1ZZ7A 2OQ6A 4FO9A 2R7EB 4GWNA 4WM7B 4YYOA 1UYPA 5I0RA 1QY4A 2JKBA 3RMXA 1J59A 4FQ4A 2W46A 4Y1UA 2D3SA 1YIFA 2W91A 3PIGA 1NA1C 1HRV2 3FFZA 4LBOA 2FBEA 2LTNA 3O1PA 1UMZA 2R042 3IPVB 1S1AA 1W0PA 4IDZA 4PIYA 3SEEA 3T2TA 2GC0A 1H2NA 1ND3B 2HEYF 2VJXA 2FDKA 4MYEA 1AXKA 5BNPB 1PMJX 1SFNA 1V70A 1PGL2 4XFBA 2B9VA 4Z92B 3ZYIB 1I5ZA 1L7QA 2PHXA 4RR3B 1CAVA 3UV9A 2XVKA 4DRVA 2P6HA 1U0AA 4PLNA 3ACHA 4S2FA 4CXWA 3T4HB 4F83A 3J26N 1W8FA 3L9JT 3IT8A 3OF1A 4I0WB 4Q4X1 4Z2WA 1DQ0A 1QQP2 2RJLA 5IHRA 1OF3A 2VR4A 1ZZ8A 1ENSA 4GJZA 3T1MA 1ULOA 5FZ0A 5HCHA 1LGNA 3I3MA 3VN4A 1RUF1 3HN1A 1QIQA 4KBBA 3WG1A 4AFCA 5JIUA 3ZSLA 3OEAA 3S0MA 4QQOA 1FXZA 1MEC3 5EYYA 1NUKA 4LLOA 2VNVA 3BN6A 3WW4A 2MNGA 2ORZA 5FY4A 4CDQC 4EYUA 2ZGLA 1VLNA 3KV6A 1AXZA 2QDRA 4XACA 3TB0A 1H9WA 4P9IA 3HQXA 5EJ3A 4AVSA 4QB2A 5LA1A 5AVPA 4NJ4A 2X05A 2EXKA 2E33A 3NW4A 4IGPA 1COV3 1PM4A 4UFJA 3TNQA 3I2GA 5J3UA 4KQ7A 3U37A 4YGDA 4XQDA 3C7HA 1K12A 4CTEA 1HRI1 5L9RA 2OT7A 2HWF1 3V65A 1YCIA 2OXBA 5J98B 3SCHA 5FPUA 3N7LA 2AC1A 2UURA 5FAXA 2Q1FA 1NCRC 1KXGA 2LRPA 3VBSB 1AL22 1AUYA 5J1XA 3S6PA 4CEWB 5CNAA 4QQHA 4C90A 2RS53 2YYOA 2V73A 4CEYA 1LJ7A 1HQNA 1NG0A 3AL6A 3P1IA 1R082 3T0BA 4EZHA 1MZ5A 1UX7A 4KG0A 5H9QA 5F5IA 2OZ6A 4WM7C 1UYZA 4XTMA 5FYHA 2CWMA 4PHZA 3SCGA 4LIUA 1VAKA 2GMEA 2PHUA 3IDEA 4XFAA 1ZBA3 5JSRA 2WYFA 4J6GA 2GNDA 4MZUA 1LOFA 3OTFA 5DN2A 1LEDA 4AGRA 1H8VA 1YQ2A 4P9LA 5BUVA 3QH7A 4RD7A 2VVFA 1DQ1A 4Q1PA 4YM0A 5FP3A 3U0ZA 2PHLA 4Y33A 4PI2A 3RWKX 3DPRB 2QQOA 1VMFA 2DYCA 1ZRRA 3D0JA 4MHRA 2HH9A 4LR4A 4D6SA 1RUC3 4RR3C 3SCFA 3LDBA 5AC91 4AI8A 4WVMA 3VBUB 3URFA 1D4M2 3VBFB 4GA9A 2CHHA 2VZOA 4FBFA 4EN7B 2JWPA 2RS11 3SNMA 5C7GA 3M4FA 1W05A 2GN7A 2DCJA 1JN2P 3B93A 1OLME 2E7AA 5KBFA 1RUE3 2CGOA 5HBAA 2A3XA 3AZWA 2HJIA 5FJKA 1CWPA 3WP5A 4RSUA 1W8WA 5LB6A 1LHUA 5F3IA 2W87A 1B35C 3JD73 1AYN3 2WFF1 2XJPA 2DUQA 3C7OA 3FUQA 3HNBM 3E5QA 3B02A 5EPAA 4CXXA 1W3VA 2J1TA 4U36A 3PTRB 1X36A 3PMEA 4BIFA 2WS91 1QNWA 4QXCA 3VBRC 4F3JA 5HI0A 4NVPA 1NXD1 5CFCC 3RZGA 5KHHA 2IUWA 1W8OA 1V6IA 3MIFA 3Q8FA 1JH5A 2XLFA 4M4PA 3H8XA 3S7IA 3GBGA 1POQA 1V6JA 1HQWA 1TE1B 4Q27A 2VAUA 3RS6A 1IPKA 1DQ4A 5FMBA 1OOPB 2IFWA 3LWCA 3WP4A 4BA6A 2YHJA 2DV9A 5C3OA 1PGSA 1W6PB 4K3UA 3A7QA 3LIGA 3WF0A 4IGOA 1JYCA 1SLBA 3MUZ1 3BTZA 3BOPA 3JBG3 3C7FA 4N7IA 2W52A 5FXXA 5LY2A 3NKTA 2H6CA 4N90A 1SDDB 3T30A 2QBXA 4E4ZA 3OEBA 3PUQA 1RGSA 2WO1A 1FNYA 2XKOA 4P5YA 1M4WA 2XBO3 3K4ZA 4DB5A 1IQDC 3H7YA 5C4WB 4K20A 2WZ8A 1GR3A 2Y6HA 1HB1A 1MS3A 4ORFA 2UY9A 1S0IA 1XBFA 2MEV1 5K4LA 3LPGA 3AM2A 2VM9A 1VBD1 1LR5A 5FXVA 1W2UA 1O8PA 5IVBA 1W6QA 4FCAA 3UJOA 5CISA 4XFGA 4XMIA 5A6YA 5T5PA 2QJVA 3DPRC 3JZVA 5F2WA 2X5IB 4YM2A 3I2IA 2QZ3A 2TBVA 3ECQA 3BIWE 2BWCA 3LEKA 4LKSA 5FY7A 3I2HA 2BRTA 3VBFC 1M06G 2WDBA 4P9GA 3VKLA 5HXVA 1S2KA 1DQ6A 1ND2C 1OH3A 4GH4A 3HMYA 2W1UA 3LEIA 5DAVA 3BOWA 4HBNA 5LASA 1S0EA 2VUDA 1EAH1 1GU3A 1MVEA 5FZGA 4AGVA 2WABA 4Y22A 3ZN6B 1OQEA 4MOAA 5CKNA 1RUD3 4EWAA 3BKZA 1GQHA 4CRQA 1UY4A 1LCLA 3KT1A 1OLRA 2EF6A 3CDZB 3U10A 5JCTA 2C5DA 4NIGA 1AR83 5C33A 3CJIB 1RTVA 2EA7A 3WZ1A 1WD4A 4CP2A 4AEDA 1PK6A 2W39A 4TZDA 1Q43A 5CBLA 2CSGA 2ZZJA 3RZMA 2WZR2 3M3EA 1E5SA 2A73B 2WNOA 1TEIA 5A1LA 3OGJA 4OVEA 1G9DA 3CO2A 3S7EA 1E57A 4PQQA 4BDVB 3KMHA 4BQ2A 2VOTA 4FFIA 2WUHA 2YG0A 4HOOA 4ZU5A 3NKGA 2QQUA 2W1QA 4LA3A 1DZTA 2WNUA 3AZXA 5FPVA 3BU7A 3V64A 2QE3A 4PCRA 1JUIA 3UT0A 4AFBA 1A34A 1D4VB 1P8JA 3IN9A 1YQ5A 2D40A 2N7GA 2Q1ZB 3SHRA 3PTYA 3CL1A 4Q4V1 4TLFA 4IE4A 3GHNA 3WHUA 1X9TA 2B7YA 5HPOA 2JB8A 4HT1T 3MFCA 3CQOA 4QPIC 5A33A 2BWAA 2WSUA 2O14A 4H2AA 1NA1A 4UBGA 1S2BA 2RHPA 2XLGA 5FMOS 5LEKA 1VBE2 4GMP0 1BQPA 1YNAA 3H8UA 3MBWA 5FPAA 3WCRA 5IT6A 5JXHA 1JI6A 1G9BA 4LBQB 1D2SA 3POYA 2JD9A 2WWSA 4Q29A 2Y6KA 5IWFA 3VD5A 3THCA 5L7OB 4NHLA 5FWJA 1C1LA 5FYBA 1G9FA 4P9XA 3LOIA 1U5XA 3VBOC 4FTBA 1SLTA 3I4IA 5DZEA 4BB3A 1A8MA 3JD72 1O6UA 3OG2A 1JW6A 2JENA 1HLCA 1LHNA 1UO9A 5ISLA 2ZEXA 4L99A 3ZR5A 2JE9A 1TMF3 2XVGA 3O1RA 1IKQA 4LNVA 5JOWA 5C5TA 1FMD1 1HB2A 1FX5A 4Q4X2 3MIBA 3NMBA 3BIEA 1AZDA 3BU0A 4H55A 1D7PM 3PVOA 3IDBB 4YVWB 1EPZA 1GV9A 4MV2A 5DQ0A 3GHMA 5A7NA 3RJ2X 1F4AA 1OH4A 2OKXA 3WG3A 3USUA 4CDQA 1ENQA 2D97A 4Z1VA 4XQ4A 2Z42A 1RITA 2EIGA 5FQ0B 2IWGB 4XUOA 4AWDA 5K7PA 2C24A 3UGHA 3S57A 4RHV1 3HJRA 1EPWA 2YY1A 4FOQA 1IKPA 3QD6A 2UWCA 5G05L 1K5MA 1NLRA 4RGAA 1XU2A 3JU9A 4XBLA 3GYDA 5FXWA 3HPNA 4XF4A 4SLIA 3RSJA 3O14A 3UETA 3LQCA 3CZUA 2W47A 4PDWC 5CG9A 1Z7S1 2WLQA 1JXNA 4HG6B 5CZKA 5FPXA 1J3RA 4JQTA 1NCRA 4GWIA 1LHOA 4YW4A 1CAVB 1HRI2 4GZ9A 5GALA 5T50A 4Z2AA 3PL0A 2EVXA 3A23A 1EYBA 1V6MA 3UYJA 2ZGQA 5IAXA 2NP0A 1H2KA 3FC0A 5F5CA 5DDJ1 1UYXA 2BNNA 2QQIA 1PNFA 1TNRA 1WCQA 1XNAA 2VOVA 4QPWA 5C8WA 2Y0OA 3VHNA 2B39A 5FZ8A 1DYKA 1REFA 4LHKA 2KR2A 5T55A 3I3EA 3KGLA 3NL1A 1NKGA 3KQRA 1NX9A 3HIFA 4IEUA 1AX0A 3SEPA 3JQXA 1ZRCA 1CZVA 4TXWA 4YRDA 4CP9B 4LK7A 3ZXFA 3NNLA 4NHYA 3WQBA 2ZEZA 1H2LA 4GKXA 4MGSA 1PVC3 4JKLA 4GJYA 2GC3A 1LOBA 3WUDA 5C6CA 2RVAA 3DKWA 3GNEA 4P5HA 3U11A 4BK4A 1RVF1 2G9GA 4ZY9A 4K1YA 4ET7A 2RMU1 4W8JA 4D7SA 4MADA 1D0HA 4CDWC 5DG2A 2QQMA 5FPZA 5DUWA 3ZVXA 2EALA 3AXDA 2YXSA 5FUIA 4FSJA 2D6NA 3KVBA 4TWTA 4HK8A 4CEYB 1C8M1 1ZREA 2YMZA 1BK1A 1Q8VA 3OUJA 2HYKA 5C3SA 5JLVA 2DURA 5K9YA 1XYPA 3UL2A 2ET7A 4CPBA 2R1BA 5TSWA 1DGRA 3USSA 1CZSA 1ZBE1 5FOJB 1AHSA 2JG9C 1O5UA 1AR63 1FPN1 5C3PA 1WMXA 1W06A 1WKYA 2ZGNA 4FI9A 4OZXA 4EN0A 4UW4A 3POSA 4YZ2A 5LW9A 3BUCA 2QNKA 1V0AA 3DKQA 2ZX2A 3WCSA 5CFCA 3R05A 4PLOA 4UF0A 2D6OX 4YW7A 2FDIA 2JDHA 3WNPA 4QKFA 2RJ2A 4QD2A 2XQXA 2J1EA 5JIAA 1E5IA 4H3WA 3CLPA 3KV5A 1AYM1 2QZ2A 2W94A 4LO5B 4NIAA 4EWDA 3KCYA 2VQ0A 5FP8A 3SKJE 4C0BA 4P9JA 2P1BA 2ADEA 2HKXA 3FLPA 4RA0A 2JDAA 4WVMB 3ROUA 4BZ4A 1W6MA 4XOGA 3V0AA 3NSTA 1RIRA 5FP4A 3NNGA 2LUWA 1AR71 2XB6C 3M3IA 4G9SB 1XRUA 5G04L 4DZGA 3SH4A 3TN91 1XJAA 3MO4A 5FJHA 2YROA 2AGSA 2GNTA 1TMF2 1WBLA 1AJKA 1SLLA 1PX4A 1PO11 3AKTA 3TRSB 4A45A 1JYTA 2HWE1 1MQTA 1ASJ3 2LW8A 3DL3A 3SITA 3C8XA 1GYKA 4YW1A 3ES4A 1KDMA 2BV4A 2WQ8A 5ACA3 2ADDA 3WR0A 4QPYA 3I54A 1IZ3A 1VRH1 2MEV2 4Y20A 1FOD3 1VBD2 1RMU2 5DUXA 4DS0A 1XOYA 3TEWA 4YM3A 1XNBA 2D6LX 2PLV3 3IIIA 1HXS2 4E27A 5A7WA 2CY6A 1JMUB 3VDDC 4MVTA 3WP3A 1W9YA 4F7ZA 4CYDA 1GNZA 1OFSA 2AEZA 2BDRA 1ND2A 1CVNA 4JRLA 4LHSA 3AMNA 4Q8KA 4GB33 3WD5A 1JYIA 4XTPA 4JX0A 1F5FA 2X09A 4HZFA 1R091 4IV1C 3POBA 3FHAA 4OHXA 3MUY1 1XNTA 4JGYB 4FXKB 1DYOA 4YG0A 1GNHA 3WSOA 4P14A 2DUPA 1H8TC 4BHPA 4KMQA 3GF6A 1NYWA 2RDNA 5A3TA 1CX1A 4OI1A 5A7QA 3TWIA 5E16A 2P2KA 4NRMA 5GLUA 3DXUA 1SG3A 2QFEA 2ZCWA 3IKWA 2ZMKA 5FV3A 3OGVA 4COUA 3NV1A 1J58A 4QKDA 1RUJ1 4AI2A 1OC1A 4XJUA 2E7TA 1TG7A 3N7JA 4UFIA 3F2ZA 5FYZA 4D0QA 1UXZA 1W6QB 5HCBA 5JXIA 2W95A 2XJUA 3ETQA 1CJPA 5FLHA 3O0VA 1US2A 2HWB1 4MSVA 5FZ4A 2J1UA 3PU3A 1QDOA 3BTAA 5DZFA 4V2VA 2BOJA 5E1RA 3ZYFA 2CTVA 5SV5A 3T3YA 4LEJA 5F37A 1GLHA 5J7MA 4D8MA 1W6NA 4EE2A 1H0BA 4QPIA 4AI1A 1HRV3 1GOHA 2NYYA 5DUUA 2IXKA 1XE8A 2R043 4Q4V2 4QX3A 4DPNA 3I8TA 1SLCA 3PJYA 5FZKA 2Z4FA 4GH4B 3VBHC 2YPJA 4M3CA 2ZAAA 1UY3A 2FCTA 5GJ6A 2K0GA 4MGKE 4NHKA 5EXOA 4Y22B 3FJSA 2W3JA 3WEZA 1BMV1 1OVSA 5FZ1A 4C91A 3VBOA 4RQPC 1ACCA 3MZHA 1YIPA 1N1YA 4AEDB 1PK6B 1QQP3 5FPLA 1SCSA 3AJYA 5DXDA 1OA4A 5B4XA 5FYIA 3UKVA 4IEPA 1Y9MA 4E4DX 3JUUA 4INDA 1OT5A 4XBNA 4XF9A 5DUVA 3ZYGA 1UKGA 1C3HA 3D8CA 1OHFA 3KSCA 2P5BA 2WNUB 4WV8A 2XOMA 5B4NA 2RR11 2WLPA 3OYWA 4QDQA 4K40A 1K45A 1H1MA 4QDSA 3VKNA 3ZYBA 5JZGC 1AJOA 2OPWA 5FLIA 1LAJA 3O0XA 1I6XA 4JDOA 4Q4W2 3IM0A 1YJLA 1W2AX 2A71A 1UNBA 2A6ZA 3N9PA 5FY8A 4B1MA 3VD3A 5KC6A 2D3PA 3HBKA 3WNXA 3ZDVA 4LOTA 3VD4A 5FYSA 1QWRA 4I2OA 2W5FA 5F7UA 1KITA 1AF9A 4O65A 1NCQC 1ULEA 1NQDA 2PQQA 1NA1B 5DAQA 2D98A 5EQUA 5F1RA 2VUCA 1XYNA 3ST7A 2NMNA 4COVA 1CIWA 2XDVA 1XSQA 3QOPA 1U5YA 5FZBA 2DU1A 2F4PA 4CCOA 3GCWA 4PDWA 2YC2A 1G9AA 3T09A 3QCWA 2ARBA 4AHZA 1AL23 4B4RA 2VW0A 3AP6A 2R063 5KC5A 1CX4A 3ME2A 3KD4A 3TAYA 4LPLA 1FT9A 1ASJ2 3AZZA 4UFHA 4R8HA 2DTWA 3RI9A 3T2OA 1SQ4A 5I0TA 4IUGA 4LKDA 4AYUA 3FX3A 4LKEA 4AEJA 2JDNA 4FPKA 1Z7S2 3ZIXA 1ZZ6A 1R083 2G1MA 1OQDA 3AVRA 2VULA 5I8YA 1DGWA 1YWKA 1PVXA 1RHI2 3ZSEA 1W8ZA 2BW8A 4CSWA 3OSDA 4BCUA 4UI9L 1VR3A 5I0UA 4CUBA 4L11A 2Z5WA 3OPTA 2XG3A 1CAXA 4XDOA 5KR7A 3UJQA 2R071 2PLV2 2ZKLA 2J42A 3D3AA 4ZKTB 5DDJ2 2WO3A 3C2UA 1SFYA 2FCVA 3H7JA 3NWKA 1AX1A 2C26A 2SBAA 4CDQB 1OBNA 1OF4A 1W03A 4JKMA 3NAPA 3USUB 2C9AA 4AAPA 5IK4A 4GB32 5LBFA 3PUAA 2VZTA 3E5UA 3DECA 4LBNA 3H3UA 3NJXA 2BUKA 1YFYA 3THPA 2NMOA 2LROA 2W2IA 5FK7A 2O8QA 4LOSA 3DYOA 1D4M3 2WAOA 1V6NA 3LSEA 3QBQA 2OPKA 2PXJA 3B94A 3BI3A 4ONUA 1VPHA 3O1VA 2C6SA 4LORA 3AC0A 1PK6C 5T5OA 1QGLA 1QJZA 2OW4A 3H9AA 5KWRA 4X6QB 1F35A 2JECA 4A7ZA 1GBGA 3WX5A 1J1TA 1RVF2 1NCRB 2C9KA 4W4ZA 1ZA4A 4QX0A 5FIXA 3EJKA 1BHGA 2RMU2 4Q4Y1 1BBT1 2B4KA 3LDRA 1LU2A 5FPBA 1CESA 1F4HA 3N7KA 3FUOA 4FPCA 5CVRA 3PVNA 3OGRA 3WNOA 4E2GA 1OA3A 2XL9A 1ZRDA 1UOGA 2CYFA 1S2EA 3MDPA 4LA2A 4K8RB 1ZBA1 3SC7X 2JG9A 5LBEA 4YWAA 3SLIA 2ID4A 3VDCA 3ZR6A 4W6XA 5FZIA 2VNRA 4NWWA 1D0GA 1GFF2 1TQ5A 3CBNA 3UESA 2R0FA 1O4YA 4N53C 1PIV2 1QJY2 4A3ZA 3E6BA 1UZ0A 3HD8B 2YB7A 4KU8A 4A3XA 1W90A 2NN8A 4JV4A 3KQ4B 4M0HA 4FOYA 4C1WA 2B46X 4CCEA 1UAIA 1QJX1 1FPN2 2Q8DA 3SMHA 4G3YC 4I09A 1VBA1 1G7YA 4GD4A 4QM9A 5C71A 2OIIA 5GKAC 2WNVA 3B00A 4GULA 2ZTNA 2FMYA 5C8CA 5L73A 1DG6A 2V72A 4K7JA 3MV01 1KFXL 4IQPA 2HWC2 4CP1A 5FUNA 5FZHA 1AYM2 4CU9A 2GP3A 1TME1 2JICA 1RUE1 4RFT0 2WZPP 2A3YA 1WA4A 5AFBA 5KHJA 3DGTA 2E32A 3WOGA 1QMJA 1XPWA 5A3PA 3H3LA 2ENRA 1GUIA 4HMZA 1FATA 4CDUC 2Z79A 2X53S 1V9U1 1AR72 1CQ9A 1F31A 2Y34A 2FD8A 1B35B 2DVAA 3ES1A 3ZFEA 2LS6A 1EV12 1PO12 2JE8A 2HWE2 4N43A 1LOAA 5FYYA 1PNGA 4GIQA 2BEOA 2GN3A 3QH6A 4AZZA 5DZGA 2Q1MA 3O1TA 2G9FA 3VBRB 5FYMA 4JQRA 4Q0QA 5IW0A 4F8AA 5CFCB 4XDPA 4AQTA 3M7AA 4UF0B 1S4CA 1ZZBA 3M70A 3VHOA 1K5MC 1QJU1 3POEA 3T2PA 3VDDA 2GH2A 3ALQA 1VRH2 4IETA 1DF0A 2L9LA 2EAKA 3T0AA 3RGBA 4XAAA 1US3A 3FWEA 3VZOA 3D5OA 4XURA 3WDUA 1JU3A 3JB4C 1PO21 1VBB1 1YFXA 5I93A 5IVJA 2R062 4IV1A 4KH9A 4KU7A 3RYKA 4AL9A 3ABZA 3PUSA 1X8EA 4NPRA 4PIXA 3VB9A 1W6MB 4M3CF 2W0XA 3KT7A 3AYAA 2YGMA 2BP6A 3V0AB 4NHMA 1LODA 5GZDA 5B2GB 5F3CA 1H8TA 1BEV1 3ZYRA 2JKXA 2WZR3 1K3IA 2PAEA 1O3QA 3KT4A 3ZSMA 4AXOA 2FZ1A 4OQ8A 4BU2A 1WA6X 2Y6LA 4AK3A 1MQTB 4YG3A 2YC0A 4S2DA 2WZEA 4D3WA 4GWMA 5LRSA 4GALA 2JX9A 3B9CA 2G4IA 1F5JA 2GZWA 4D6RA 2VH9A 4ZZ8A 4COZA 4DIQA 3Q8EA 2VBBA 3HBZA 3ZXAC 1O3SA 3P3PA 4Y20B 2ZHKA 1ODMA 3O7OA 4HN1A 3NRUA 4AVCA 4AQ6A 4YZ4A 4X8PA 1EP0A 4FPYA 4GWJA 5A7WB 4BYYA 2CAUA 5JXJA 3OGSA 4Q5OA 1VBE3 4LO7A 4UXAA 2C4XA
chains in the Genus database with same CATH topology
1ND2B 5T3NA 2ZGUA 3VBHA 5E8AA 2CWSA 1IS6A 4M01A 3KCXA 3LA2A 2HWD1 5H9SA 3AKRA 2ZMNA 1F8VA 5F5QA 4RQPA 2CGPA 3R4UA 4D94A 1SBDA 1O4ZA 5KHGA 2ATFA 4FTSA 1BMV2 4AVAA 3ZSKA 1X8MA 1WW4A 4HL0A 3VUOA 3WXPA 1O5LA 1URXA 2JJ6A 3B7MA 3AXEA 4AHWA 4Q4X3 3MLKA 4LTAA 1XNKA 2RM21 5BV6A 3MW3A 4Z07A 1UF2C 3U07A 2ZHNA 2VMGA 3TYJA 4XFIA 3RPQA 5JZGA 3KS7A 4H14A 1GANA 5H9RA 5JSOA 3AZYA 4DY5A 4YZ5A 4TYSA 2BYVE 4YGEA 2GU9A 3RQ0A 3WQ7A 4R9AA 1W6NB 1U12A 4QPIB 3FZ3A 2ES3A 4RL7A 1NCQA 3ZFFA 3U4XA 2ZABA 1LOGA 3J8F1 2BVBA 1V6OA 1Q56A 2VMIA 4M3CB 4H7LA 4Q0PA 4YFWA 2BFUL 5IK5A 5FBZA 1S0FA 3TBDA 1ULDA 1MQTC 3RWNA 4G4FA 1HRI3 4HVRA 3VBOB 1CD3G 2HWF3 2VOKA 3FE5A 4PIZA 3JQWA 4AW7A 1Z0HA 5FCCA 1NXMA 1OFNA 2A75A 1FV3A 4LUMA 4FVVA 4OI4A 4LUKA 3ZSJA 5F6KA 2WL1A 3ZMNA 2QVSB 2Y0IA 5KXEA 4KWLA 3GBFA 4LT5A 4LO4B 1GZ9A 1OA2A 2R072 3R6SA 1H2MA 1UU4A 1IQAA 2I45A 3IDCB 1YXWA 4FXGB 1QNYA 1ZRFA 4BQ1A 2YGLA 1WMEA 4HSLA 2RS31 3PMSA 4LBJA 3THTA 3MW4A 1RUI1 4FTEA 3ATGA 1YFWA 4YGBA 1WCKA 4L2NA 1SDWA 4WBBA 5AC93 3ZXJA 1J3QA 4XW3A 4PDWB 1S0JA 2E53A 4W65A 1DFQA 2RS13 3EHKA 5FFOC 3RI8A 5BPXA 1RUH1 4LBKA 4R52A 1AX2A 4HFSA 1HW5A 4QT6A 2OZJA 2ZGPA 2JG8C 4Q4Y2 1BJQA 4LE4A 1CAWA 2WFF3 4ASLA 1BXHA 3RMYA 2DVDA 4N53A 4MXVA 1JTZX 2VMHA 1RUG1 3AYEA 5EV7A 1VAVA 2WS93 2B5HA 4QQPA 3C3VA 1CR7A 3NAPB 1I1EA 3MW2A 1DDLA 4IEWA 3ZXDA 4R4ZA 1FNZA 3PVEA 5D1IA 1QJX2 2VUJA 1G8WA 1R1ZA 1VBA2 4JVAA 3GALA 4Y1ZA 4SBVA 2P3IA 3AYDA 4CDWB 4KNCA 3VZKA 3WW1A 4ISRA 3VZJA 4OHYA 3INAA 3H3ZA 2LM3A 4GMP1 1YI9A 3A0NA 4PQ9A 5JDBA 4CDUA 1TME2 1UW8A 5IK8A 3BODA 1AR91 1WW5A 4HPKA 3TOJA 3FMGA 1IS5A 1YHFA 4I3PA 4BWOA 4B7EA 4MGIE 4URTA 2AH2A 1RUF2 3IMNA 2MEV3 2RJKA 1RB8G 3MLJA 3E97A 1VBD3 1FV2A 1RMU3 1V9U2 2A3WA 2JG9B 3WG4A 1L3JA 1HXS3 3ZN4A 4DXZA 4X6RB 3AYCA 1X82A 4Q2FA 3VHPA 1LEMA 2MPFA 1NY71 5FDBA 1ZM1A 4IEVA 4AEKA 4YLZA 2WNVB 2XVLA 1QH7A 5D8AC 3MPPG 5JAXA 1QJU2 5C8CB 1LENA 4GQ7A 2FHRA 2H0BA 2HWF2 1O4TA 1EAH3 1XXNA 4XFFA 2ZX3A 2ZMLA 5CB7A 1WBFA 4N9IA 1PO22 3AK0A 2D6PA 2VW2A 3GZTB 2K2SA 2IXHA 4RGGA 5GLVA 3ZXKA 3MYXA 2CGNA 1REDA 1QDCA 3M1HA 1BZWA 3N7MA 4IEZA 3V0BA 1KJRA 5JPNB 1BEV2 1RJ7A 1SBFA 1IPJA 4BPZA 2YZ4A 4XF3A 2CAVA 1GZWA 3ZFEB 3NAPC 1LECA 2DCYA 3NV2A 1VBC1 2Q0AA 2Q30A 2HEWF 4N43B 3RYPA 4XHXA 4YW5A 4XFCA 1D2QA 3FHIB 4C0HA 3LOBA 4UBHA 1MS5A 5I91A 2VNGA 3CF6E 4AVVA 4Q4V3 2AREA 4QXKA 3VZMA 3VDDB 5L36A 4YGCA 5HCFA 4PLMA 2MHFA 3KCCA 5AC92 1G9CA 4TSVA 4YVSC 4JGZC 2RS12 4IV1B 2GSYA 1A78A 5CU1A 2OUHA 4RS5C 1C28A 2GC2A 2BTVC 1A3KA 4AG4A 2ERFA 1H8TB 3B3QE 2HWD2 4AE2A 4HVQA 5K0UA 3PJQA 1DIWA 1R1A1 3HAGA 5J36A 1OPOA 1QF3A 2A5ZA 4M3CE 2JDZA 3IWZA 3M3OA 1ULFA 4YFZA 2WFF2 3ZFGA 4MX3A 5J37A 2NPIA 4XPVA 4Q4W3 2X29A 2WS92 4Q26A 4QGMA 4AVBA 1FMD3 4MUVA 1NLSA 2B45X 2WNVC 2RM22 4BIOA 5C8CC 1ZVFA 3AFKA 1G86A 4AF9A 4OI2A 5CFDC 1CJDA 1SLAA 1W6OA 2O1QA 1YFUA 4ITCA 3ILRA 3LA3A 3RRDA 3VBHB 2ZPXA 1PMIA 3SXWA 3E6DA 3OBTA 4I0BA 4YG6A 5J09A 4S2GA 3RDIA 3J8F2 4Z8BA 1J3PA 2NM1A 4AFMA 1UPSA 4RQPB 4ES9A 1Z7S3 1MVQA 4CEWA 3ZFEC 4YSFA 2AYHA 1VB2A 2BGCA 2WQ4A 1RHI3 3PNAA 4N43C 4QQ2A 1KRIA 2ZGSA 4QPGC 2QCSB 4NWVA 5GZFA 2EXJA 1HDKA 1PZ8A 1C8NA 1IS4A 5DDJ3 4E4SA 5ABJC 4E2SA 5JMCA 1SBEA 5JZGB 2FMDA 1UZZA 4DRRA 2V5YA 1VIWB 3FFQA 2FZ2A 3E6CC 1OSGA 2ZOEB 3RG0A 2E9QA 1XYOA 4XIKA 3AKPA 4Q0VA 1MACA 1UPIA 1H30A 1ULGA 2C1FA 2JD4A 4FP2A 1NCQB 3ZFFB 1EAH2 3VZLA 3K51A 1C5IA 1VALA 3CJXA 4Y1XA 1HV0A 1H4GA 2RS32 1RVF3 3RYRA 2RMU3 1RUI2 1LKNA 3OBRA 3UKNA 2KA3A 3E5XA 5J96B 2BNOA 3KM5A 2VW1A 5JPMB 4FPJA 2WSVA 4NR1A 4UW3A 3M3QA 3WUCA 4EROA 2WT0A 1POV3 4JDNA 1DGRN 4R9BA 2JG8A 1C8M3 1RUH2 4QGNA 4DNYA 1V6KA 2K9ZA 1NOVA 1PIV3 2QQPA 1QJY3 2BVVA 4OI0A 2EAAA 2R32A 1ZBE3 2VOWA 4ATFA 3L2YA 1FPN3 1CAUA 1ZZCA 3AFGA 5FO7B 4PBPA 4ASMB 1SACA 1MS1A 4K6BA 3MIEA 3AZVA 1QU0A 2R0HA 1DYPA 2B42B 5I0SA 1OKQA 1BVVA 1OOPA 3ZYJB 5KHIA 1QXJA 1DQ5A 4JTOA 4KGGA 2HWC3 3MPBA 1AYM3 3LA7A 3R0RA 1IGOA 1UX6A 2TUNA 2IXJA 3UKTA 3QLQA 2DTYA 4XJAA 2PFWA 1Z78A 2LALA 4XE9A 1AR73 2DCKA 3DV8A 5C4WA 3TN93 4JTNA 4Q0UA 2VXRA 4HANA 4I02A 1A6CA 2A6VA 1EV13 2AR6A 1PO13 2Y26A 1WMDA 1H9PA 2HWE3 4B29A 1FMD2 3P3NA 2WNEA 1AR92 1MZFA 1VAMA 4UW6A 1RINA 1CAWB 4B3NA 3BPZA 5A33B 5KXCA 2JEMA 1WMFA 5F6LB 5T5JA 3ZFFC 2BBVA 4N53B 1VRH3 5E89A 5C9AC 5T52A 1WUVA 4RHV2 3MIHA 1BYHA 3AMPA 3A0KA 1SEFA 3D0SA 1MS8A 1WCDJ 5T5LA 2TEPA 5D8AA 2BQPA 1CPNA 5JR7B 5IUQA 3VV1A 4OHVA 5CADA 3VLBB 1N1TA 3ZPYA 1DLLA 3CJIA 4XF0A 3KLSA 3N36A 3Q9OA 4Y24A 5J48A 2XHKA 1MEC1 3NVCA 2A6YA 1C1FA 1EY2A 4CDUB 3ILFA 4FAGA 4HPKB 1H1AA 5KXBA 1QXRA 1KDKA 2B9UA 2D3RA 4OFGA 1RUJ3 2VVDA 2E51A 3M3CA 1COV1 1F2NA 3EXUA 4FOVA 1RUOA 4OUMA 1QKQA 2UU8A 2FQPA 2BNMA 3BCWA 1NQJA 1VBC2 3FBYA 4O9EA 1K5MB 3CU7A 1U5ZA 4XEZA 4JDMA 1U5IA 3D6EA 1PM7A 5FMOL 4HLTA 2WT1A 3J9SA 3CNAA 4YVSA 2DCZA 1Q8SA 4JGZA 1QOOA 3AB0A 2RS51 4YW2A 3LZZA 5L7OA 4RS5A 2Q8OA 1Q8QA 2JE7A 3AKQA 2P3JA 1UU5A 1DHKB 2NZ9A 3WQ0A 3N35A 3W9AA 1S0CA 3IBMA 2XJVA 1C8M2 3AP9A 4L8QA 1N3OA 3V0BB 3WDVA 3KGZA 2XWBB 1BKZA 1XE7A 2H0VA 3B69A 4I0AA 3BALA 1ZBE2 3S30A 5GZCA 4FQZA 3WT3A 2PELA 1GICA 3QACA 2GMMA 1RUC1 3G7DA 1ULCA 2VOXA 2WKKA 1X7NA 2CNAA 4FPEA 1C4RA 4WVVA 1VP6A 5CA6A 3NV3A 1VBE1 2UYBA 2PN5A 5CFDA 3HT1A 1C57A 4J1WA 1H1IA 2CV6A 4XQWA 1XNCA 4R9CA 4COYA 1JBCA 2E63A 3JD71 5BXXA 1AYN1 1HKDA 1IS3A 2X8KA 2EXHA 1Y3TA 3D4KA 1NE4A 3L2HA 3TN92 1AXYA 1JHNA 3WG2A 1N1VA 4EN9B 1S0DA 4BE3A 2WA4A 2VGDA 1YRZA 2YUEA 4YW3A 5SV8A 5BNOC 4XETA 4QX5A 5K0UB 4LBQD 5GLTA 4QPGA 1UZYA 3MEPA 5AFEA 2ZGKA 4Y26A 3B9IA 3A4UA 3ZFGB 1UN1A 5ABJA 2DFCA 1CPMA 3FLTA 3ENRA 5AVAA 2TNFA 2ZBJA 3WLUA 4D7YA 3I59A 2R073 1LHVA 4V1PA 1N3PA 5CG8A 1V6LA 3JBG1 4DOUA 2D44A 5T54A 4YZ1A 1OLQA 1UL9A 4MXWA 4P9YA 2PHFA 2GMPA 4Q0SA 1W6OB 3VGIA 2XBO1 1R092 2DVFA 2C0ZA 2ZX4A 4W6YA 3MIDA 1LOCA 2PHWA 4XDQA 1LULA 1H4HA 5FO8B 2R1DA 5JOYA 3WDWA 1YJKA 3B01A 3DF0A 2ZZQA 1Q5OA 2WA3A 4META 2XJQA 4Q4Y3 1BBT3 1N3QA 1RUJ2 1WW7A 4EN8B 2WJSA 5BNNA 3POWA 4A7KA 4MGZE 4XJZA 3ZYPA 2ZHLA 2OYZA 2HWB2 1ZYBA 2ZHMA 1RL3A 2P37A 4EV0A 4IEQA 2GC1A 1RUD1 4IEXA 1ND3C 1AR81 3WW2A 1KFUL 1YLLA 4CZSA 5BNPC 1QJX3 4WM8A 5L19A 1HIXA 4MLOA 1VBA3 4KWJA 3OGGA 5E88A 3AKSA 3T1LA 5K0UC 5LK7B 3GZUC 2O8OA 4QQLA 1CN1A 3ZFGC 2UY8A 1TME3 1PGW1 3LGRA 3SH3A 1UCXA 1KD7A 4J1XA 4XZPA 4CDXA 2GNBA 2QKDA 4OULA 2VUAA 4LHLA 2ZA9A 1RUF3 3O0WA 4BMEA 1O91A 3ZX7A 4OUSA 2JG8B 1FYUA 1V9U3 3OJBA 4ZXKA 3NJZA 5LK5A 3VKMA 4YM1A 2RR12 3VL9A 4KWKA 4WVWA 4XILA 1S0GA 5K8SA 3AMMA 4O9GA 1GSLA 3VKOA 5C9AA 1CAUB 4QHBA 4JAAA 4LBLA 4XF1A 1UKRA 2D93A 4OLLA 5JVVA 1X50A 5JI9A 2Q4SA 4XXAA 3MF6A 1QJU3 3DUIA 4Q1RA 3ZDSA 2DVGA 2H6BA 3ELNA 1S55A 4AQ2A 1REEA 2W08A 3VBSC 2AENA 2GDFA 2WINB 5I8TA 4CEWC 1PO23 1KS4A 1VBB3 3UK9A 4BLJA 4I01A 4JRAA 4JGYA 1TMF1 1ZZ9A 1ONAA 1PHMA 1IHMA 2ZX0A 3MLLA 2ZGRA 4FP3A 1BEV3 3AMQA 3OYWB 2P17A 4AI0A 4Y1VA 3KZ4C 3I2DA 4L97A 4DY3A 4E2QA 4XJ8A 4XYXA 4L92A 1RMU1 4BH9A 1MEC2 1HXS1 1PZ7A 2OUJA 3EBRA 4XIOA 2GAUA 4ZU7A 1I9RA 3JCIA 1AVBA 3VBUC 1COV2 1QOTA 2B8MA 3X29B 5H9PA 4AHXA 4D7TA 4WZCA 5D8AB 1N1SA 3NO8A 1DU3D 2PHTA 4AFDA 4GXLA 1V00A 2R6QA 4FT8A 2HWD3 2RS52 4Y1YA 3EO6A 1BBT2 4NOTA 4NO4A 4KL1A 3W58A 1WLTA 4IV3A 1O3TA 3WP6A 1CAXB 1HX6A 4MH0E 4BLIA 3LAGA 2DVBA 3LCPA 1ZBA2 4BM8A 2ILMA 1RJ8A 4B4QA 1PVC1 2RM23 1QHDA 4CP0A 1RUNA 3FLRA 4AGGA 1OOPC 1ZNPA 1LRHA 3M2MA 2DF7A 4FSJA 4IESA 1N47A 1MR5A 3IIAA 3K48A 4UW5A 1O3RA 2E7QA 5BYNA 4K21A 5BY5A 2IXLA 2YV8A 1RUC2 4IXLA 2XPJA 1LGBA 1WLDA 1GKBA 1KJLA 3ZXLA 1ZX5A 3WDTA 3WY6A 2I2SA 4COWA 4YVSB 4JGZB 3J8F3 4PF5A 2EXIA 5C4WC 1RUE2 4B8EA 4RS5B 2WQZC 2IXCA 4M00A 4K9SA 2RE9A 4FOWA 5FREA 2DCTA 1AR61 5BNOA 2GNMA 2PHRA 4ZU4A 2XJSA 1AYN2 2VPVA 2HEVF 4C1XA 5HCAA 4K1ZA 2X5IC 3RNSA 5BNQA 2NLRA 4Q4W1 1OI6A 1O7FA 2XWJB 3SISA 1DQ2A 1C5HA 3R4DB 3VHRA 5F9TA 1OMIA 1MZEA 1DBNA 4KG8A 1BCXA 3KB5A 1SLIA 3WHTA 5FO9B 4YNIA 2F6BA 5LRRA 5A32A 4A2UA 5CFDB 1GZCA 1VBB2 3AJZA 3CJIC 3JBG2 2XH6A 2VY0A 1WGPA 2RS33 3LKJA 2KM2A 1ASJ1 3SH5A 3OY8A 1RUI3 5LEJA 2P34A 1HQLA 2ZACA 5FRAA 4K8FA 3J4UH 2XBO2 3WV6A 5JWPA 2NQYA 1J1LA 1S0BA 5ACA1 1RHI1 4XXPA 4Z82A 3R4SA 3OCPA 3OD0A 1FOD1 4FAHA 1B09A 4HKLA 4QPGB 4X8NA 1RUH3 2PLV1 1DZQA 4M0NA 4Q8LA 3WVJA 3MICA 1OQ1A 2AZ5A 5A3MA 2R16A 3ACLA 2Q5TA 4U2AA 4H7MA 4WM7A 1ALYA 2YDEA 1T6GC 4HSJA 5ABJB 3PLQA 2AUYA 4GB31 2XGXA 1Q8OA 3I59B 3IPVA 1IOAA 1POV0 2A7AA 3LB9A 3VKFC 3ZMOA 1LESA 1RUG3 5IK7A 1ND3A 4AVTA 1W39A 3G6JB 4MGYE 2Z69A 5BNPA 5L7OC 4MXWB 5GLZA 1JOJA 4RR3A 3RZZA 1RUD2 4E9KA 5GM0A 3H1YA 1KQRA 4XJWA 1AR82 3WDXA 4HK9A 1WCSA 2ETEA 4EWEA 3H1MA 2D43A 1FI2A 5CAZA 3VZNA 3GBWA 1POV1 2PAKA 4R4XA 4OHZA 1G6NA 4GMP3 2IC1A 4YVWC 5GZEA 1B35A 5JI7A 5BNNB 1PGW2 1OD5A 1WLCA 1AR93 1WLWA 1PIV1 1HRV1 1QJY1 2DUOA 4DQAA 2E6VA 3WW3A 1UIKA 2R041 1DGLA 2PTMA 3D82A 1I3HA 2O0OA 1OPMA 3VBRA 2V09A 4RHV3 3PHMA 1PGL1 1F9KA 1XNDA 2D6KA 3WINE 3N3HA 1Y43B 4LLFA 3HT2A 2HWC1 4KGQA 4XJ9A 1LGCA 1W0OA 2R49A 4WZFA 4Y4YA 1QQP1 1YI7A 4WM8B 3VBSA 2QUOA 5KHKA 1YYNA 4XHBA 3ZXGA 2PAMA 2IZWA 1FAYA 1QXPA 1HV1A 1ENRA 4HVOA 3AP5A 1X33A 3OPZA 3AX4A 4PJYA 4N7UA 2WT2A 4CDXB 1CONA 2WC2A 1EV11 4WVZA 1RC6A 2D6MA 2PHDA 2XJRA 4Y5Z0 4D69A 2VNOA 4DINB 5FOBB 5EWSA 1QH6A 2UWAA 3MI8A 2R30A 3DPRA 2UWBA 2VU9A 1A8DA 3H50A 1VBC3 2ZS6B 3VBUA 5C9AB 4ES8A 3O12A 3VBFA 2KXLA 1DGWX 5JOZA 1AL21 2D5HA 2VQAA 3N4MA 2R061 2BFUS 1VJ2A 4IEYA 4LBMA 4EN6B 3CEWA 4XFHA 4AI3A 4DMIA 1R081 3HR9A 1AL0G 3ZXEA 4IERA 4CEYC 1MS4A 5BNNC 3JB8A 4DFSA 3PVBB 2XJTA 2Y38A 3W59A 5JSPA 2Z2SB 4ISQA 4AEMA 2ET1A 2ZAHA 2PYTA 1R1A3 3ILNA 4FPOB 4HETA 1LU1A 1WW6A 1BVP1 1LOFC 4W6WA 4XOGA 3OD4A 3ASIA 1YUDA 3ZO0B 2A6XA 2ZGTA 4AQSA 4YARA 1MS9A 2ZGOA 1D4M1 2XLAA 1RUG2 2A6WA 4JCKA 4WM8C 1W6PA 4FPGA 5A3LA 2ZGMA 2XUMA 2I74A 3H0OA 1PVC2 5I8SA 1DZRA 4I30A 3EQEA 3DN7A 1Y9QA 4FPFA 1MZ6A 4HKWA 3HWJA 4QGLA 4FPHA 4ATEA 4FPLA 2XL7A 1LOEA 2P3KA 2ZJCA 3TNPB 4P9WA 4QU2A 4CDXC 4R9DA 2VECA 5FTTC 1NE6A 4N9HA 2DWRA 2WIIB 4GKYA 5EYXA 3BB6A 1ENXA 1MS0A 1Y7BA 3WDYA 4LHNA 4IV3B 1Q3EA 2IXIA 2X5IA 2ZX1A 3B5LB 3M8LA 4LE3A 3O5SA 1AR62 2CL2A 3WQ1A 1WD3A 1JUHA 2I07B 5JOXA 2WFPA 4BMBA 3MGUA 3NV4A 3MIGA 3ZN6A 1NY72 4IEOA 2PA7A 1APNA 2W68A 5GLWA 2D7FA 3APBA 1R093 4JGYC 1XQNA 4BOWA 1LTEA 3FBMA 1NZCA 1CGPA 2DU0A 4OHWA 5EFUA 3MFAA 4EJRA 2XKPA 2VG9A 2DFBA 4LO8A 2VVEA 4IL7A 1SCRA 3AMHA 4LO6B 5BNOB 2UYAA 4PBOA 5FLJA 2OA2A 4JC1A 4A7YA 5DG1A 5ACA2 4AFAA 5GZGA 2SLIA 2HWB3 2ZKNA 3H1WA 1LHWA 4NN0A 1KS5A 4B4PA 1FOD2 3RJRA 1UU6A 3GZAA 1PZ9A 3MF9A 4I3GA 1LB2A 3AP4A 4GH4C 4LULA 2QDNA 4LBQA 1Q8PA 4QMAA 5A32B 1GQGA 2OVUA 5KXDA