1C8M2

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
total genus 59
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m200
1ZBA3 3VBFA 3VBUC 1FOD1 1AYN2 2R041 2X5IC 4CDWB 1AR62 3JD72 5AC93 1ZBA2 3ZFFB 4CDUA 4Q4Y1 1QQP3 1RUH3 3ZFEC 1EAH1 1NCRA 4N53A 4WM7C 1D4M3 1PO11 5AC92 2RS13 1CJDA 1TMF1 3IDEA 1QQP2 1RUH2 3VDDB 5BNPB 2HWD1 1ND2C 1X36A 1CD3G 4SBVA 3ZFGC 5C9AB 5CFCC 1D4M2 1EV11 1FPN1 1BEV3 4JGYB 4QPIA 4Q4X3 2XBO2 3TN91 1AL0G 1FMD3 1RUF1 4GH4B 4YVWA 4RS5B 5C4WA 1MQTB 1RUD2 1F2NA 5D8AB 1BEV2 1K5MC 2ZTNA 4Q4X2 2HWC1 4YVSC 1FMD2 4AEDB 2RS51 5K0UC 5ACA3 4IV3C 4GB32 1TME3 1VBA3 1A6CA 1HXS1 3JB8A 1RUE1 5ACA2 1VBC1 1POV0 2BUKA 3DPRB 1QJX3 1ASJ3 4IV1A 1R091 3FBMA 1RMU1 1VBA2 3VBRB 3CJIC 1AR93 1QJZA 4RR3C 4CEYB 1AYN1 3VDDA 2DF7A 3M8LA 4CDXC 1AR61 1VRH1 1NA1C 3NAPC 1ZBA1 1AL23 4WM8A 1RVF3 1AR83 3VBOB 4RHV2 1AR73 5FMOS 1NCRB 4QPGB 1PVC3 1Z7S3 1MQTA 4Z92B 5L7OC 5AC91 1AL22 1RVF2 1AR82 1QQP1 4AEDA 4CEWC 1RUH1 1AR72 2ZAHA 3JBG3 1PVC2 1Z7S2 2FZ1A 1D4M1 1B35B 5BNNC 4QPIB 2RS11 5ABJB 5JZGC 4JGZC 3JB4C 4RQPB 1QJU3 1VB2A 5C4WB 3JBG2 1ZBE3 1VBD3 2HWF2 3VBUB 1BEV1 4Q4X1 1H8TC 1FMD1 3VBRA 4Q4W3 1QJU2 4CDQC 1PGL2 1ZBE2 1VBD2 3JD73 3VBSC 3ZFEB 2RM21 4Q4W2 5ACA1 4WM7B 4NWWA 2HWE3 5BNOC 2BBVA 4IV1B 1TME1 2BFUL 4NWVA 1VBA1 2R073 3ZFGB 5CFCB 3VBOA 5C8CC 1R083 4QPGA 1QJX1 2HWE2 2WFF3 2IZWA 1ASJ1 5CFDC 2XBO3 2R072 3J8F2 2WS93 1DDLA 1R082 1VBB3 1AR91 2PLV3 2WFF2 1POV3 1K5MB 1RUD3 1B35A 1OOPB 4WM8B 1NY72 1W39A 5ABJA 5K0UB 2WS92 1PIV3 4IV3B 2MEV3 4RQPA 5A32B 1VBB2 2WZR3 2PLV2 1NOVA 3VBHC 4CDWC 4GB33 1GFF2 1AL21 1NCQC 3VBUA 1RVF1 1AR81 3ZFFC 1C8M2 1PIV2 2MEV2 1AR71 2X5IA 1PVC1 1Z7S1 2WZR2 1ND3C 4FTBA 2GH8A 3CJIB 3ZFEA 4WM7A 3JBG1 4RR3B 5BNPC 1WCDJ 5C9AC 2RMU3 2RR13 3S6PA 4JGYC 1AUYA 1COV3 4RFT0 3ZXAC 4CDXB 1QJU1 1ND2A 3ZFGA 5CFCA 4GH4C 1PGL1 2ZZQA 1ZBE1 4RS5C 1VBD1 1VBE3 4Y5Z0 2RMU2 2RR12 5D8AC 1COV2 4Q4W1 4RHV3 1VBE2 3JD71 4GMP0 2XPJA 1K5MA 1OOPA 5A33B 4YVSA 2WWSA 5K0UA 1RUI3 1QJY3 4IV3A 1EAH2 5A32A 2HWE1 5BNNB 3DPRC 1RHI3 1TMF2 4JGZB 2R071 1RUI2 4N43C 1QJY2 1HRI3 1RUJ3 1R081 1V9U3 4PDWC 2HWF3 2R063 2WFF1 1E57A 1RHI2 4BCUA 1PGW2 4CEYC 1NY71 3VBFC 2XBO1 1OHFA 2BFUS 2WS91 4CDQB 3CJIA 2HWB3 1HRI2 1RUJ2 5J98B 1V9U2 1VBB1 4RR3A 2PLV1 2R062 1POV1 1RUD1 1SMVA 4CDUC 1PIV1 2HWB2 2MEV1 2X5IB 4CDXA 2WZR1 5BNOB 1NA1A 1NCRC 3NAPA 4N53C 2WLPA 4GB31 2QQPA 1VB4A 2VQ0A 1VBC2 5L7OA 1F8VA 5CFDB 1RB8G 1BBT3 1RUG3 5A33A 4QPIC 4CEWA 3J8F3 1NG0A 1ND2B 4YVWC 5C4WC 4LLFA 5BNNA 1MEC3 5JZGA 4FSJA 1AYM3 1BBT2 1RUG2 2RMU1 1RUC3 2RR11 4JGZA 1BMV2 1COV1 5DDJ3 3VBHB 1VBE1 1MEC2 1NCQB 1VRH2 4YVSB 1AYM2 1H8TA 1RUC2 1C8M3 5DDJ2 4CDQA 4RHV1 1HRV3 1ND3B 1PO23 4Q4V3 1R1A3 3VBSA 4IV1C 1RUI1 1QJY1 1HRV2 4Q4V2 1PO22 5BNOA 1M06G 4FTSA 1R1A2 1HX6A 1RHI1 1PGW1 1X33A 2RS33 2RS12 4GMP3 4FTEA 2GSYA 5C8CA 2FZ2A 1HRI1 1RUJ1 1V9U1 3VDDC 2HWF1 2R061 1IHMA 5CFDA 2RS32 1OOPC 4WM8C 1FOD3 2RM23 2HWB1 2R043 1NA1B 3NAPB 1MQTC 1FOD2 4Q4Y3 5GKAC 2RM22 2R042 4AEDC 3LOBA 1EAH3 5L7OB 1HQNA 3VBHA 4CDWA 1NCQA 1PO13 1TME2 5FOJB 3ZFFA 1TMF3 4CEWB 4N43B 4Q4Y2 4PDWB 2BPA2 2HWD3 1QJX2 1ND3A 1EV13 1ASJ2 1VAKA 3VBFB 1PO12 5JZGB 1FPN3 1BBT1 1RUG1 3TN93 3J8F1 1BMV1 1RUF3 2HWD2 3VBRC 5BNPA 1AR92 5C9AA 5J96B 1EV12 1MEC1 1H8TB 1AYM1 1FPN2 4JGYA 4CDUB 1RUC1 2HWC3 3TN92 2RS53 1RUF2 2TBVA 4GH4A 5DDJ1 4RS5A 4N53B 3VBSB 5D8AA 2HWC2 1HXS3 1C8M1 2RS52 1RUE3 1HRV1 1VBC3 3VBOC 4Q4V1 1PO21 4QPGC 1R1A1 1R093 1RMU3 1C8NA 3HAGA 1HXS2 5C8CB 1RUE2 4YVWB 3DPRA 5LK7B 4Y4YA 2RS31 1R092 1B35C 1OPOA 4GMP1 2Y26A 5ABJC 1RMU2 5FMOL 4EJRA 4N43A 1AYN3 4PDWA 4RQPC 1AR63 1VRH3 4CEYA
chains in the Genus database with same CATH superfamily
2ZGTA 3AKPA 4A6OA 1NQDA 2DFBA 4WZCA 4TLGA 5K7PA 2HYXA 3RYRA 1AYN2 2R041 3WP4A 2ZHNA 3CLPA 5FKBA 3WF3A 2B8MA 1RL3A 1L7QA 3JD72 5CKMA 4JKKA 4WVMA 2WNUB 5EWSA 1O8SA 4FXGB 1JH5A 4BQYA 1UCXA 5A7PA 1QQP3 4QB6A 2DBNA 4LBQA 1SLLA 1O4ZA 1OI6A 1S0DA 1Q43A 2Q1FA 1AX2A 1NCRA 4LHKA 1ZRCA 3BOPA 1GLHA 4AZZA 2RS13 4B29A 3N9NA 2ZABA 4JTNA 2RDQA 3DEMA 3E97A 4PIXA 2W1SA 1H1IA 3U78A 3VDDB 1UIJA 5BNPB 1JI6A 1IOAA 1O5LA 1JZ3A 2G4IA 2IXKA 4SBVA 5FZBA 4DY3A 4COWA 2H6CA 4P00B 4YGCA 4QKFA 1BEV3 2ZHLA 1XSQA 2FDGA 1JMUB 1FMD3 4K8FA 4ZY9A 3SCFA 2QJVA 3VHNA 4FPCA 5SV8A 2RHPA 3ENRA 1CZVA 4BQ4A 1MQTB 1LOBA 3KT4A 2FCVA 4XQ4A 3HWJA 4MADA 5D8AB 2W9XA 4ASKA 4AEDB 2RS51 3KWVA 1A78A 1PM4A 3GZEA 5DZGA 3WY6A 2A3WA 3GJAA 4GIQA 2VAUA 4IE4A 5IVJA 2RJLA 3R4UA 1QY4A 1REDA 5JLVA 2VECA 4GB32 3L2HA 3E5QA 4FPEA 1YO8A 1UYPA 1CIWA 1PK6C 2XDVA 3ZYRA 2EXIA 3PU3A 3Q8CA 1YQCA 3WUDA 3FLPA 1RUE1 4KG0A 3WQ0A 1S2BA 4D94A 1VBC1 4QDQA 1H1MA 3JUUA 1QJX3 4ATFA 5C3SA 1G7YA 1ASJ3 1JUIA 2B9UA 2PHUA 2XL7A 3B01A 3NMBA 5J48A 1R091 5JXHA 3C2UA 4QKBA 3P3NA 4NIDA 1YI7A 1OLMA 4CP0A 4IEPA 1U5ZA 3EHKA 2VVEA 1K3IA 3C7OA 4V2VA 5FYMA 1LODA 2YC0A 3KVAA 1ENSA 3ZXJA 4B1LA 3OUJA 4RR3C 4YARA 2R6QA 3MIEA 5FV3A 3AK0A 2A6WA 2J1UA 4AVAA 2WQ8A 5FZFA 4CCOA 1AYN1 5FY5A 1NXD1 2YBKA 4PBPA 3GZTB 1DYPA 2W1QA 5JMOA 5HI0A 2VZPA 1JOPA 2XJUA 4LPLA 1WCSA 4OUSA 5H9RA 3WCRA 2XJQA 4W6XA 5FXVA 1OVPA 1RIRA 5FBJA 3TAYA 1RVF3 5EYYA 1W03A 4DO0A 4HOOA 2JDHA 5FZ1A 1ZA4A 3N3HA 4CRQA 3ORJA 1N3QA 3VBOB 2BNOA 2ZKNA 3QOPA 4LO8A 5A6YA 3SLIA 3BGAA 4QPGB 1Z7S3 2W95A 3PUAA 5F6LB 2B39A 2JXAA 2YMZA 1XYOA 3JU9A 1IZ3A 2JG9B 1AR82 4BA6A 2W91A 2VU9A 1XU1A 3TRSB 2YYOA 2P4EA 1Z0HA 3NO8A 3D4KA 2QQMA 1GQGA 1ZZ8A 2FZ1A 4MGYE 2E7QA 4WBBA 3S7EA 1JYWA 2WN3A 3OPWA 5ABJB 3E6DA 3HT1A 3N4MA 1SZBA 5LA0A 4JGZC 1SBFA 3DKQA 3DXTA 3VKOA 5LY1A 4COYA 5C4WB 2WT1A 5EV7A 3CQOA 1ZBE3 2VOKA 1VBD3 4AR2A 4AFAA 2MPFA 1J84A 1F35A 4YM0A 5T5OA 3FX3A 4LR4A 5K4LA 4AEKA 4FVVA 5J1XA 1H8TC 3UKTA 4QT6A 3VBRA 5GLUA 4EE2A 4QM9A 2BP6A 4QXBA 5FYTA 3PLQA 3P1IA 5FXWA 1IG3A 3HT2A 3SC7X 5A6ZA 1XE0A 2JDKA 4XBLA 4BQ2A 3N9OA 1UY4A 3ZMOA 1LHNA 4NPRA 4AI1A 5F3CA 2R49A 2RM21 4DQAA 4WM7B 1GZ9A 3OCPA 2XQRA 3WHUA 1SBDA 1I3HA 4P9XA 3U37A 2PQQA 3DGTA 3ZN6B 4AEJA 3V0BA 2Z69A 4C1XA 3NJVA 1HQWA 3TBDA 5AVAA 1I1EA 2WFF3 1F5FA 2GNBA 2Q0AA 2VUCA 2VUAA 4QQ2A 3VZKA 4MGIE 5CFDC 1UN1A 2VM9A 2XBO3 1OSGA 1NXMA 1STMA 2ZXQA 2WS93 2R30A 3K46A 3T2PA 4CCEA 2DCKA 2PAEA 3A4UA 3S5AA 4KWJA 1DDLA 3M4FA 1N1SA 1PZ7A 2YBSA 3HMYA 5FYHA 3WX5A 1UF2C 3RRDA 5CA6A 2Y8KA 4WM8B 1LESA 3O5SA 3OJBA 1W39A 1UXZA 4LNVA 3RNSA 4LOTA 5K0UB 3KT7A 5A70A 2VG9A 1ACCA 4IV3B 1CJPA 1QXRA 1BLZA 1ENXA 1ZVFA 2PELA 1VBB2 3PIGA 5C6CA 1ULEA 2Z5WA 5C3OA 3MW3A 2NMOA 1NCQC 2A73B 3LA2A 3ZKUA 1AR81 4XUTA 3ZFFC 3FJSA 2NZ9A 2W1WA 3CF6E 2ZX3A 4NMIA 2X5IA 4MZUA 4UW6A 3BPZA 3BU7A 3RJ2X 3ZXFA 4DINB 4IE0A 3MIBA 1CAVA 1ZZ7A 1UIKA 2OUJA 3SH3A 4A7ZA 3WNOA 2ZACA 3BALA 3FUOA 3UKVA 2ES3A 1XNCA 3AMPA 3ZFEA 4K20A 1Q3EA 3J9SA 4LMFA 3R0RA 2VBDA 2K2SA 4IEZA 1BVVA 2P6HA 4N7IA 4AQ6A 2E7TA 5C9AC 4UWDA 1H2LA 1HKDA 5T52A 2V5YA 3VD4A 4YW2A 2AGSA 4JGYC 2Q8OA 3HJRA 4RFT0 1ZM1A 3H7YA 1ZNPA 4XF1A 3AL6A 5CFCA 5IW0A 4AHXA 1UKRA 1UX7A 1LULA 4GA9A 1VBE3 3WW3A 5F5CA 2AACA 2YFUA 1HB1A 1BHGA 1U12A 4XDQA 4AQ2A 2RMU2 3BIWE 2WINB 1MS1A 3PUHA 1EUUA 1W2UA 4CCMA 1OXCA 1QJEA 2J1AA 2ZGOA 4FPKA 4FI9A 5T55A 2CNAA 2XPJA 2VZUA 4ES8A 2BTVC 4YVSA 4YW1A 2XVKA 3PHMA 2QFEA 5CU1A 2WNOA 1RUI3 1HV1A 2PHLA 2FDJA 4GWMA 2A6YA 2P37A 1UYYA 1EAH2 1FNZA 2ADDA 2BBAA 1U5YA 2GN3A 3RI8A 4DXRA 3K48A 4TZDA 2LALA 2V4VA 5JCTA 3AMQA 2KXLA 3CDZB 4Q2FA 1ULFA 1IQAA 3VN4A 2CHHA 5FZ8A 2BGOA 2XONA 3TEZA 4ASLA 5L19A 3MHZA 3RSJA 4YRDA 3NKGA 4KU7A 1W2AX 4EZHA 5HPOA 4Y20B 4ZS2A 1EUTA 3CMGA 4GKXA 5FWEA 2R063 4Z07A 5JAXA 3ZOIA 3UJOA 1OKQA 4CEYC 2JDNA 2VZQA 2CGOA 2EA7A 1UYXA 3IMMA 2OPWA 3CJIA 2HWB3 4CUCA 1UZ0A 1RUJ2 3SITA 2B9VA 3R4SA 1VBB1 2ZGMA 4JDNA 2FBEA 5H9PA 1POV1 1RUD1 2ET1A 1N3OA 2XVLA 4FO9A 1SMVA 1DGLA 1V00A 3AKRA 4K8RB 5L73A 2A6VA 2BERA 3I3BA 4ARYA 1WW4A 2LROA 2PFWA 3IB3A 5AFBA 3O7OA 4B4RA 4F83A 3ZO0B 3DV8A 3THPA 2IC1A 4N53C 4PF5A 4W4ZA 5JDBA 5DPNA 4M3CE 4Q27A 3CEWA 1SBEA 4ZS3A 3AJZA 4QQHA 2FDKA 5FREA 3SCHA 1ULDA 3NV4A 4R8HA 3ACGA 2KM2A 3WQ7A 1G9DA 2VTFA 1LRHA 5A7WB 2DVFA 2VCMA 3KF5A 5I8SA 4K40A 3PTRB 1F8VA 4XMAA 4XAAA 5FUNA 2ZGRA 2JDZA 4QPIC 3MPPG 4FT8A 1W90A 4H14A 1ULOA 5FZ3A 2QQJA 5FAXA 2LM3A 3MUZ1 4YVWC 3LIGA 4P9GA 5KHIA 3VUOA 1JOJA 1UQXA 4Q0QA 5BNNA 1S0GA 4XHBA 3I7DA 4UF0A 3LCPA 1SCRA 3NW4A 4XZUG 1RUG2 2ZBJA 2RMU1 5F2WA 1RUC3 1OD5A 1XU2A 4YM1A 3ZYBA 4BMEA 1HB2A 3WDVA 2RJKA 3AP4A 2GNDA 3KF3A 3KCXA 2QCSB 3JZVA 3T1MA 3FWEA 5FTTC 3VHPA 3P6BA 5L9VA 2WO7A 4QQLA 2E26A 5F5AA 1VRH2 1D2QA 1S55A 3H0OA 3WP5A 2ET7A 3KQRA 1BVP1 4DXSA 2JIJA 1T6BX 4A6SA 5CB7A 3LAGA 5DDJ2 4RHV1 1XRUA 3EBRA 5EYXA 2FD8A 4DB5A 1MVEA 3O1SA 1ND3B 2VVFA 3O0VA 1R1A3 3NNFA 3CJXA 1GOGA 1V6JA 1QWRA 2J1TA 1NE6A 1WWYA 4Y22B 2R16A 4D6QA 4BM8A 5JPNB 2Q8EA 4AW7A 5FLHA 2ILMA 5JOYA 3ZX7A 2FMYA 2C5DA 1HRV2 2UY8A 3AMHA 3NJXA 3UYJA 4QQOA 1OFNA 4Q4V2 3UESA 1M06G 3LEGA 2IVJA 1TVGA 4LJHA 2XKPA 1X33A 5JIAA 2DCJA 1JYVA 1ZRIA 1JHNA 4JX0A 3U75A 4LBQD 5FO9B 1KEXA 5C8CA 1PGSA 2FZ2A 1RUJ1 2BOIA 4R9AA 1CQ9A 2BWCA 4YGEA 3VDDC 4CTEA 5I8YA 1O6UA 4PIZA 3I2FA 2X53S 1LHWA 1OH3A 2BGCA 2CY6A 3CZUA 4P14A 4I02A 4QX7A 4NROA 2VCCA 5FIXA 1W04A 4CSWA 4OUEA 4LKSA 4QHOA 4GWJA 2WA3A 5GLTA 1NT0A 2R043 2E7AA 1ULCA 4M01A 3F2ZA 2PXJA 1J58A 1Q8OA 1UL9A 1ULGA 1XNDA 3ITQA 4IEXA 2AZ5A 5ANNA 5FY0A 3KHBA 1MQTC 3VL8A 1OPMA 5F3EA 3DYPA 3DYOA 5EIYB 4E8CA 1C1LA 2YB7A 3EXUA 4BB3A 5GKAC 3IPVB 2PHRA 4AEDC 4FFFA 1DCSA 2HLEA 2EIDA 4HXCA 5HXMA 1IG0A 1H1AA 4LBOA 1TME2 2WNUA 2WN2A 4CUGA 4ASMB 1RJ8A 2A7AA 2OZ6A 4JCKA 4INDA 3IAPA 4KI5M 1H9PA 4LO5B 1QMJA 1AHSA 3E5XA 1WCKA 4K1ZA 1PO12 3VBFB 1RUG1 2WR9A 3AC0A 1RC6A 3VKMA 3ZSMA 3DCQA 1ZZ9A 2PHWA 3J8F1 3TB0A 2WAAA 1URXA 2Q30A 4OI4A 3LEKA 1CAWB 5IHRA 2P3JA 4Q0UA 4A4AA 1JYTA 5BNPA 1D0GA 4RGKA 5FZ6A 1LOFA 1AR92 2AEYA 2CWSA 2VBPA 1CZSA 3NJZA 1EV12 3KD4A 3LDRA 3A0NA 3ALQA 2ZGPA 1H8TB 1FPN2 3B5LB 4CDUB 4CYDA 2ZEZA 4LE3A 4UYBA 2W0XA 3GALA 2RS53 1RUF2 5DDJ1 2ATFA 4SLIA 1XNAA 4CP9B 4NHYA 4IE6A 1R1ZA 3IBMA 2Q8DA 4DUVA 4J25A 2ZX1A 4BLIA 1BK1A 5D8AA 3LB9A 5FYZA 3VHRA 2HWC2 2JENA 2YHJA 3UGHA 1JOBA 1RUE3 2OXBA 5A3TA 5LATA 1S0EA 1ENQA 5KXEA 1HRV1 1VBC3 3VBOC 4HLTA 4Q4V1 3ROUA 4QPGC 3VV1A 4XYXA 2ENRA 3FHAA 5C71A 2E33A 2SBAA 3BVCA 4I30A 4K1YA 1R093 4WV8A 4PT6A 1Y4WA 1UZYA 1HXS2 4HVOA 2JG9C 2YXSA 4HN1A 3D6EA 2NLRA 2GAUA 4D8MA 1MZEA 3DKWA 5DAVA 1VJ2A 3MF9A 5DMYA 4QM8A 1UZVA 3U4SA 4AVBA 3RFRA 5ABJC 5FMOL 2A6XA 3AP7A 3TNPB 1AYN3 5LRSA 1GANA 2WZ8A 3PMSA 4LBNA 2K9ZA 2WNVC 1GZWA 5FZMA 1WLDA 2VMIA 4HZFA 2XKOA 3D5OA 4UFHA 1OA3A 4LULA 4YWAA 5CZKA 4Y1ZA 2DVGA 4E4SA 5JSOA 5C3QA 3RZKA 3MLKA 4QX3A 5EHDA 1H0BA 4YG3A 1S2KA 3MO4A 3N9PA 3ZYIB 1DFQA 1ZBA2 1UY3A 2QQUA 3GHNA 2CAUA 3ZFFB 4MHUA 4CCKA 1SLTA 2R32A 2QZ2A 3OD0A 1MZ6A 4B7EA 3NWKA 2B42B 4NIIA 4WM7C 4ZPIA 1RXFA 2D6KA 5IK5A 1UO9A 4XC9A 4O7XA 3UK9A 1PO11 1Y3TA 5DUUA 4Y1YA 1CJDA 1GOFA 3IZOA 1TMF1 3WNNA 3I49A 3MGUA 3EJKA 3HNBM 4G4FA 4EN0A 2EAKA 4TYSA 4FBFA 1XQNA 1YJKA 4AG4A 1ND2C 1X36A 5HBAA 5C9AB 1Q56A 1EV11 3AB0A 3G7DA 1NQJA 2DTWA 2D40A 5F8PA 4FP3A 2NP0A 5L9RA 1FPN1 2EXKA 2I07B 4JGYB 2VPVA 5FDBA 3RI9A 4E9KA 1RUF1 1GICA 2CDPA 1U5IA 3LQCA 2IXHA 4LBJA 5C4WA 3POBA 3WP3A 1A3KA 4JZRA 4O9EA 1JTZX 2J7MA 1UX6A 3WXPA 3I3MA 1JZ8A 2VC9A 3AKSA 3OG2A 3LDKA 4AFCA 3DN7A 4ORFA 3F95A 1LGBA 1NKGA 2YZ4A 2ZTNA 2HWC1 3IWZA 1YQ5A 1QNYA 4GXLA 4HL0A 5K0UC 1SLAA 2AC1A 4M0HA 4LTAA 4IV3C 4DFSA 1G9CA 2ZEWA 3HPNA 4Q1RA 5FZ4A 5IVEA 1C1FA 1I6XA 4XDPA 4XCAA 5E1RA 5FCCA 1DGRA 1HXS1 4ZXEA 4URTA 3W59A 2WKKA 4CU9A 3RWKX 2BUKA 1SFYA 5T5JA 2VCBA 2HH9A 2ERFA 2XJTA 1CPMA 1L7RA 2XUMA 4ZU4A 1VBA2 3M3CA 3O14A 3T4HB 1ST8A 3ZSJA 1NAEA 5C7GA 1GZCA 2E63A 5F7UA 1OFSA 1QJZA 5FZOB 2A5ZA 4CEYB 3H42B 2CAVA 3BTZA 2J1VA 1W6OB 3KLSA 2OPKA 3K51A 4Y5TA 2QDNA 4XAEA 4DMIA 4Q0SA 3L2YA 3I59B 2OS2A 3WDXA 4QXHA 4Y1UA 2LTNA 1YFXA 1W9YA 3THDA 2WDBA 4JQTA 4N9HA 5IWFA 3NQHA 1ZBA1 5KWRA 3O1PA 4WM8A 5JVVA 1AR83 3NV2A 1OQDA 1CWPA 2VZOA 3I54A 4ZZ8A 3H8UA 4XBQA 3ES1A 3OTFA 1N1TA 3NRUA 4Z92B 2DCYA 3TEXA 3VKNA 1W05A 3W58A 1WMDA 1W9TA 2Y60A 3GGLA 3WVJA 1IPKA 4QQPA 4LBKA 2WA4A 4JQRA 3PL0A 1AR72 1ONAA 2ZAHA 3POSA 3W21A 2VE1A 1PVC2 1LCLA 2JE9A 1GYKA 1M4WA 3NKTA 4FPOB 4DOUA 3RZGA 4XFIA 1B35B 1WW7A 3MV11 4QPIB 1RGSA 5JZGC 2VW2A 5KHJA 2IFWA 4G9SB 2WZPP 2UWBA 5FR3A 2EALA 4RQPB 4HSLA 1XC6A 2N7GA 4GQ7A 3FC0A 3U14A 4BXFA 2A75A 1W8TA 2HWF2 3RYPA 4LKDA 2D3RA 2Y6FA 3VBUB 2JKBA 2ARAA 1AX1A 4I09A 2KD7A 4FPHA 5FZLA 5LASA 3D0SA 2F6BA 4N8MA 1DZQA 3U07A 5A1LA 3LIHA 3SXWA 3ZPOA 1CX4A 4DUWA 4QX0A 2XWBB 3E1F1 2NYYA 4NRPA 1PX3A 1W2OA 1PGL2 5FP4A 2W39A 4AHWA 3HD8B 5FBZA 1C5IA 1H4GA 2ZAAA 4LUKA 4BOWA 2CGPA 3FHQA 3WZ1A 3WQBA 1US2A 2VOXA 4C8DA 2Y0OA 4G3YC 1WCUA 2ZMNA 3ABZA 1LNSA 4Q4W2 3RMXA 4C0BA 4AOCA 4EWEA 1YFYA 3VD5A 1SG3A 1WW6A 3FBYA 4NWWA 4XFCA 1AXKA 5IJRA 4H7LA 3S30A 2ZGLA 4GULA 2HKXA 5IYYA 1UYZA 2BFUL 2QQKA 5A6QA 4NWVA 1O59A 1VBA1 3S7IA 4LQRA 4OVEA 3I4IA 4UFJA 3ZFGB 4DNYA 2IXLA 2ZS6B 2LS6A 4HPKB 4PLOA 2A3XA 4MSVA 4F7ZA 2HWE2 3X29B 3GBFA 4RGGA 1EPZA 2LRPA 4XZPA 4BQXA 1JUHA 3ILRA 1WLCA 4FOQA 1WMEA 1ZRRA 1ZX5A 1HB4A 3POIA 5I0TA 4D7SA 1R082 2GC2A 1VBB3 4Y20A 3WQ1A 4B4QA 5LEKA 5DABA 1POV3 1BXHA 1K5MB 1RUD3 5CKNA 1IS5A 2JG8A 1NY72 1UY2A 4UOJA 4PI0A 1QDOA 2OUHA 3N7JA 1FV2A 4M3CF 1UOJA 3KB5A 4A2UA 1O3RA 1MZ5A 4Q29A 1SPPB 2VNOA 5IFPA 2PLV2 1NOVA 4CDWC 4E2SA 3KV5A 2YG0A 3ON7A 1GNYA 2XJVA 1W6QB 4A44A 4QDRA 1PNGA 1A8DA 2O14A 4FPGA 5JXIA 1C8M2 3A22A 2MEV2 5A7NA 1AR71 2WSVA 2XJPA 3T1LA 1IGOA 2EICA 1PVC1 1W8OA 2ZHKA 3SH5A 3WDUA 3WUCA 4QX1A 3V0AA 1ND3C 5E89A 1GQHA 5DAPA 3H8OA 2EXJA 5FQ0B 2ZZJA 4XQDA 3ELNA 3PURA 4L9BA 5HCFA 1OQEA 3ZYJB 5F1RA 1LB2A 1TNRA 2QUOA 5FYCA 2BV4A 3RYKA 3OPZA 4RD7A 3B00A 4BK4A 1UNBA 4KGGA 1EPWA 5IK7A 4O9GA 1W8FA 1CVNA 1BK0A 4XURA 2DURA 2RMU3 1XOYA 3OBAA 4HSJA 4OHVA 3VDAA 5HV4A 1AUYA 4CDXB 2X05A 4UAPA 1PGL1 2ZZQA 4RS5C 5K8SA 3AYEA 4LORA 3OOXA 4XUNA 2F4PA 2AYHA 2RR12 3DL3A 2ARXA 4DZGA 4Q4W1 4A7YA 4RHV3 4CP2A 2ADEA 2QQWA 3T08A 1YUDA 4ZZ5A 5FK7A 4JKMA 2C24A 2CU5A 3JD71 3OY8B 4GMP0 3B7MA 2BVVA 1JBCA 1OOPA 1QXJA 1RJ7A 4L92A 4E4DX 1G8WA 2WWJA 2BDRA 2WSUA 3KHCA 2YBPA 5A32A 5A7QA 3KSCA 4ZU7A 1POQA 2HWE1 2QQIA 3H8XA 3ZM8A 3DPRC 4FQZA 2HEVF 2VY0A 4I0BA 1PK6A 4FQ4A 4XIOA 1U5XA 4EN9B 3DUIA 4TXWA 2PHTA 4BJ0A 2RJ2A 4XABA 2XB6C 1DZRA 3C7EA 3QLQA 3RZJA 4XDOA 1UOGA 3OB8A 2OT7A 1QJY2 3MIGA 1RUJ3 1SEFA 4QU1A 4D7TA 1OURA 1R081 2IVIB 4P02B 4CVUA 3PVEA 4XIKA 5DQ0A 1E57A 2Y38A 1J3RA 1LGCA 1NY71 3VBFC 5EXOA 2WBKA 4Q26A 2YROA 3MIFA 4XW3A 5C3RA 4GJYA 4CDQB 1J1LA 5AVPA 2WNVB 4RR3A 1UPSA 2PLV1 1WCQA 5IFTA 3TEWA 1DZTA 5K9YA 1NLRA 2D5HA 2VZ1A 1G9AA 2SLIA 4CDUC 4D7YA 1PZ8A 3FLTA 4HKOA 4DY5A 4W6WA 2MEV1 2VR4A 3AZZA 1UWWA 5FZ9A 5BNOB 4R52A 1XSRA 5FY1A 3UGGA 2R1DA 2WLPA 5A3OA 1FATA 2DDUA 2X09A 2XOMA 4GB31 4UI9L 3ST7A 4DRVA 1S0BA 1GMMA 1ZREA 1O3SA 1VRBA 2QQPA 1QIQA 4JDMA 5AFEA 4IESA 1AX0A 4GAZA 3RGBA 1D0HA 2VQ0A 2TUNA 4Q0PA 4GZ9A 3RJRA 5JXGA 4XJUA 4BPZA 4KWUA 1RB8G 1RUG3 5A33A 3USUB 1U0AA 4AI2A 3J8F3 5FZKA 1F5JA 1NG0A 1ND2B 1REFA 1GNZA 5KC5A 3IN9A 4HBNA 1IKPA 4LOSA 2WABA 1YXWA 1O4TA 4FSJA 1RINA 2DV9A 3U4XA 2RR11 4YG0A 2OKXA 4JGZA 3JCIA 4GJZA 2W94A 4JTOA 5DDJ3 3H50A 4S2FA 1CAWA 5IVCA 1NX9A 1WW5A 4WVVA 3I3QA 4PLNA 1W2TA 2V09A 3VBHB 1MEC2 3M3EA 2WO2A 2J1RA 4LEJA 4BIFA 3HR9A 2XLAA 1CAXB 1H8TA 4HONA 5DXDA 3IMNA 3VDCA 3WG2A 1VAVA 3QD6A 3BPSA 3L9JT 1HRV3 3AYDA 4CP9A 5CAZA 4Q4V3 3GBWA 4CXXA 2WRAA 5C3PA 4Y1XA 2JKXA 4IV1C 2GN7A 2RE9A 3BODA 4QD2A 2K46A 1QJY1 5JI7A 1LHUA 1TZOA 1VMHA 2KA3A 4LIVA 2E9QA 5L9BA 5J09A 4E4ZA 3GCXA 4LO7A 1FAYA 1IS6A 4I0WB 4NO4A 1X7NA 2RS12 2NQYA 2WNEA 1GP5A 4BMBA 5DZFA 2BJSA 4QKDA 4BH9A 4FTEA 4PIYA 1HN0A 2PHXA 3M3OA 3C8XA 3P3PA 2C6SA 3WNKA 1L3JA 1UKGA 1Y9GA 2ARCA 1IHMA 4M3CB 4MGKE 2UWCA 2RVAA 4CE8A 5CFDA 4D6SA 2GNMA 4S2HA 5KR7A 1OMIA 4EYUA 1S0FA 5FZGA 2IWGB 5FLIA 3PUQA 2XL9A 2BU9A 4U2AA 3HQRA 1W99A 5A80A 1UZZA 1FT9A 3WW4A 3ZYFA 1J1TA 4RSUA 1TE1B 4JVAA 5CISA 2E31A 2O8OA 3HBKA 3PUSA 4AXOA 1W2NA 1WGPA 1GV9A 2EVXA 2VJXA 3I2KA 1NCQA 1FV3A 1PO13 2VZVA 3W20A 4KWLA 2WAOA 5F5QA 4HANA 3ZFFA 1TMF3 4TN7A 1HJFA 3BYWA 4N43B 3AX4A 4YGBA 4PDWB 4D0QA 4XUOA 4OHWA 4CXWA 3CKHA 1QJX2 2TNFA 1EV13 1KXGA 4OZXA 1HQLA 2ID4A 1ASJ2 1SQ4A 1VAKA 5BPXA 5JMCA 4M00A 5T54A 5JZGB 1FPN3 1LECA 2WFPA 4RFRB 1ODMA 4YW4A 5GZCA 1W6NA 1RUF3 1Q8VA 4YG6A 5FXXA 2DUOA 4DRRA 3LA3A 1DP0A 2YPJA 4KBBA 2AR6A 3SHRA 3ZVXA 2HEYF 4JC1A 2VGDA 1MEC1 5C9AA 3QCWA 1IPSA 3AVRA 3MIHA 5DN2A 3BCWA 4JGYA 5J36A 2PYTA 2HWC3 3TN92 4MG2A 3AZWA 2VMDA 4LBQB 1DLLA 2VXJA 4I3GA 1LOAA 4J1WA 4AWDA 3ZXGA 1ZRDA 3VHOA 2OQ6A 3OSDA 4URAA 4YW7A 5DUVA 5JR2A 1HXS3 4MO3M 4OUMA 3WDYA 5FMBA 1DU3D 1WZXA 1DLCA 4N90A 4BISA 1JZ2A 1O91A 4JDOA 5LBBA 3E6BA 1OA2A 3CBNA 3N35A 5FXZA 2DVAA 4IE5A 1C8NA 2AUYA 3E6CC 4YYOA 3FLRA 2QQOA 1YFWA 4YNIA 1GWKA 2WYFA 2XG3A 1IQDC 3G6JB 4BE3A 5LK7B 3MI8A 1B35C 1OPOA 2ETEA 3VZOA 4ZHNA 2B45X 3T4VA 1QJFA 3CIHA 4MYEA 4DXTA 1ULPA 2R0HA 3OGSA 4RQPC 1S4CA 4UW5A 4J6GA 2WLQA 1OBNA 1EP0A 4CEYA 2Y0IA 5DAXA 1ZBA3 2VO5A 2BNNA 1GQPA 2BGPA 3BTAA 3VBUC 3RZZA 5BUVA 1B09A 1DHKB 3ZN4A 4AAPA 2WL1A 4NPLA 2B46X 2C26A 4UT5A 1W6MA 2W3JA 2O0OA 4FOVA 2Q5TA 4CDWB 3RDIA 4X6RB 4B1MA 1GKBA 3B69A 4D69A 5A1AA 2ZPXA 2PQSA 4NJ4A 1AZDA 2P3IA 2Z79A 3FFQA 4AFDA 1EAH1 2VOWA 4NE9A 3KGLA 2XHNA 4N53A 5H9SA 4D3WA 2C1FA 1LU1A 2FDIA 5AC92 4XFHA 3LF7A 1K45A 2B5HA 4IGPA 4OQ8A 4M0NA 5LEJA 4KU8A 1RUH2 1D4VB 1XPWA 3ZFGC 1CD3G 3OYWA 2F4LA 3POWA 2XMLA 1D4M2 2VUJA 1QOSA 2BOJA 2JEMA 1DQ4A 3AKTA 4QPIA 4C91A 2XXZA 2XBO2 3TN91 1AL0G 1FI2A 2RDNA 4JHZA 3TYJA 1VLNA 3WSOA 2DCZA 3GCWA 4YVWA 4RS5B 3LFIA 3ZSLA 1K42A 4AQTA 4GD4A 4GWIA 1MZFA 2G9FA 2ARBA 3LSEA 3PVBB 1K5MC 5H9QA 4Q4X2 2BQPA 4PHZA 3OUIA 4UW4A 2PHFA 2YU1A 1OUSA 4IEVA 1UMHA 1UU6A 5LRRA 1H6YA 2E32A 2EF6A 3DECA 4LIUA 4P9JA 4XJWA 4XQWA 3J7NA 2ZEYA 1W8ZA 2CL2A 1W8UA 1VBA3 1A6CA 4P5YA 4MUVA 1ZYBA 4XFAA 1JYIA 4F8AA 5ACA2 3I2HA 4CCJA 4O61A 3I2JA 3MV01 3DPRB 2JDMA 2RG4A 5A7OA 4IGQA 2VMEA 1BYHA 1CAUB 4ONUA 4CA9A 3A0KA 3Q9OA 3USSA 3ZMNA 1SDWA 3VBRB 4H3WA 4HVQA 3GF6A 3FN9A 2Q8CA 3ETQA 1O3TA 5JR7B 1WKYA 3QH6A 4OMCA 4LKFA 2EXHA 4KBZA 1VPHA 4NIGA 3WF2A 3GDBA 1OLME 4Y4RA 4KG8A 3VDDA 2DF7A 3B94A 3OUHA 4CDXC 2VNVA 5LA2A 3A23A 1VRH1 1NA1C 1N47A 3NAPC 5C8WA 2NN8A 2R7EB 4JAAA 3ILNA 2Y6JA 4Q8KA 3I2GA 1QOOA 2EIGA 1G86A 3OBRA 3V0BB 1NYWA 1AR73 5FMOS 1D7PM 5FYIA 5C5UA 4H55A 1PVC3 1DQ1A 3M1HA 1SPPA 4XXPA 5F5IA 4I01A 1PMHX 1HN1A 1MQTA 2JX9A 4EN7B 5L7OC 3T3YA 5AC91 4AVTA 4V1PA 1AL22 1PZ9A 1W6QA 4XXAA 5DG1A 5D2AA 4ZKTB 4AEDA 2W47A 4CEWC 1RUH1 2ZGKA 1CPNA 3ETPA 5FPBA 1OLRA 2IFRA 4R9DA 4HG6B 5F3IA 1D4M1 3R6SA 5FZHA 1IS3A 1ZRFA 1MS8A 3WNMA 5LBFA 1DYKA 3BN6A 3JB4C 4FPJA 2D5FA 5A3MA 4Q0VA 3GXUA 1VB2A 2P6CA 3JBG2 4QDSA 4S2GA 4LO6B 3H7JA 4LA3A 1ZA7A 2ORXA 5FPUA 4Q4X1 2WIIB 3ZXEA 1LHOA 1VMJA 1MACA 4HK8A 1C57A 4Q4W3 1QJU2 2JDPA 1R64A 3EO6A 2IXJA 4CDQC 5DAWA 4YZ4A 2C9AA 1W0OA 3J7HA 4ISRA 5FMDA 1N1YA 4D6RA 3JD73 4NHLA 3LPGA 3LWCA 3VBSC 4BHPA 3GHMA 1UOFA 3QACA 4YFZA 4EV0A 3N36A 4K3UA 5GLVA 3VZMA 3J26N 3ZFEB 4OLLA 4LBLA 3WHTA 2Y33A 1A34A 5ACA1 4AHYA 2DU1A 1S0CA 2H0VA 5EFUA 3ECQA 4A3XA 2HWE3 1DGWA 4L2NA 5BNOC 1SFPA 2Z4FA 3PU8A 4IV1B 1TME1 5F39A 1GNHA 3M3QA 3MBWA 4CUAA 1RUNA 2HJIA 3NJYA 2A6ZA 4OULA 1J59A 4Y24A 3LPFA 5CFCB 3I97A 5EQUA 3LOIA 3VBOA 3CL1A 1R083 3J7LA 4BLJA 3AVSA 4QPGA 3KM5A 2VTXJ 3AZXA 2E6VA 3W9AA 3AYAA 3ZR6A 2V73A 1YJLA 4FCAA 1IKQA 2Z42A 4C1WA 4OI2A 3UL2A 3AYCA 2W68A 3LD8A 2JG9A 2R072 3K4ZA 2XHKA 4XTPA 3K75B 1UW8A 1DBNA 5FRAA 2H0BA 3EYPA 3M70A 5FY4A 5HCBA 2G19A 2P2KA 3ZYHA 4V2WA 5FPZA 4N7UA 1AR91 2PLV3 1WMFA 2HBTA 4GKYA 4CCLA 1PVXA 3FE5A 3POFA 5ABJA 3ZPYA 1BZWA 1LOGA 3AXEA 2V72A 5E88A 5CEHA 3LE0A 2MEV3 3ATGA 3AKQA 4OYUA 3S0MA 3Q8FA 4GWNA 4L0PA 4R4ZA 2WNVA 5FLJA 2GMPA 2UU8A 4HETA 5FMCA 4WVWA 3VBHC 4DEVA 4GB33 3UV9A 1K12A 1AL21 3FHIB 3VLBB 3EQEA 2HBUA 4QU2A 4HKWA 4CXYA 1PIV2 3U11A 4AI8A 5A7SA 1C4RA 4Q8LA 2QZ3A 2WZR2 3LSDA 5IUQA 1A8MA 2YFZA 1LEMA 3HBZA 2GH8A 2UYAA 3KCYA 5EJ1B 4HN0A 2YY1A 3CJIB 3PIJA 4YW5A 4I3PA 4WM7A 1V6MA 2J22A 3JBG1 3GM8A 4XUPA 3ACFA 1MR5A 1WCDJ 3S5QA 5ISLA 1OT5A 1KS4A 1W8NA 3UJQA 5LW9A 2RR13 1XNBA 2DVDA 3KQ4B 3QBQA 1NE4A 1QJU1 1ND2A 3H3LA 3ZXAC 4GH4C 3ZN6A 4AL9A 1E5SA 2P3KA 4EN8B 3N7LA 2ZMLA 2CTVA 4ITCA 1TNFA 3IT8A 3VD3A 1S2EA 2BWAA 1COV2 1WBFA 2C9KA 2GZWA 5FZAA 1JS9A 1WLTA 4M4RA 1F4AA 5BNQA 1LHVA 1XNKA 4KGQA 3OBZA 2QE3A 2YGLA 2QBXA 1XXNA 4COUA 1OUXA 3H3UA 4UXAA 3HQXA 3KVBA 2WWSA 1HDKA 5K0UA 4YPJA 5I93A 3ZXDA 5IVVA 3O0WA 4F3JA 1QJY3 4IV3A 1GP4A 2L9LA 2W1UA 4W50A 5KHKA 5BNNB 3FZ3A 3PMEA 4NRMA 3U0ZA 4MXVA 1MS3A 3SISA 3C7FA 4Y3OA 2VMHA 4AVSA 2R071 2MHFA 4PF1A 2C4XA 5FZ7A 1REEA 4MV2A 4N43C 2B7YA 2UURA 3WR0A 2OVUA 1QDCA 4PDWC 2UWAA 5C33A 1GBGA 4RYDA 2CV6A 4BCUA 1RHI2 3Q8BA 1E5IA 1PGW2 4NIHA 1J3PA 3H9AA 1FXZA 1HW5A 2BFUS 3H1WA 4XF9A 4MGZE 3I8TA 3PVNA 1HRI2 2OQ7A 5J98B 1CZTA 3V56A 1V9U2 2GP3A 3K2OA 1KDMA 4IEQA 4IL7A 4Y33A 4DXZA 3UNPA 1QF3A 4KL1A 1F4HA 3B02A 4NHMA 2E51A 4IEUA 4IEWA 1MPXA 4QGNA 1PIV1 4AF9A 5J37A 5DZEA 4O65A 2WZR1 2BNMA 1J3QA 1FYUA 1NCRC 3AZVA 3J4UH 5LK5A 3ZYGA 4RA0A 2VL4A 2GC0A 4XEZA 4AVCA 4EZ4A 2WT0A 2WC2A 2IXCA 1XBFA 2K0GA 4QX2A 5CYYA 3SKVA 1O5UA 1VBC2 3WCSA 4OHZA 4FPLA 1UXXX 1H2MA 3FFZA 5T50A 3KV4A 4FOYA 5LA1A 3WINE 2JJ6A 5JOZA 3ZDVA 3CO2A 1HIXA 2XJRA 4IQPA 4Y26A 3BU0A 2QKDA 3AFGA 1MEC3 5ERLA 2VTXA 4UFMA 2NMNA 1WBLA 4NAMA 5GLWA 4IEOA 5JZGA 1BBT2 1I9RA 3GYDA 4QPWA 1LOCA 3C7GA 2ZX4A 3NNLA 1COV1 4RGAA 2JDAA 3I2IA 5CIRA 3LDBA 4BU2A 1F31A 3CU7A 4UFKA 3NSTA 5CNAA 4Y5SA 2EIBA 1AYM2 2D7FA 1FNYA 2XR4A 4XTMA 3ILFA 5FJKA 5GZGA 4AI3A 5A3LA 3ZDSA 5BY5A 2D3SA 2VZRA 4OI1A 2VBBA 3NNJA 4U36A 4NIAA 3A7QA 3M2MA 1W0NA 2YU2A 1X50A 4YZ5A 5EJZB 5FPLA 1V6LA 4XJZA 1PO22 1PHMA 3ASIA 4META 1HX6A 3PJYA 4MXWB 2C0ZA 1AF9A 1OVSA 1PGW1 1RHI1 4HVRA 2JDYA 4EQVA 4A41A 2VOTA 3MW2A 4OQ9A 5I0SA 1OF4A 2W5FA 2XQXA 3N9QA 4PCRA 1HRI1 1UY0A 4LK6A 4OHXA 5T5LA 1JZ6A 1V9U1 4E2QA 1ODNA 5A7WA 3JQXA 2HWF1 4P9YA 3RZLA 4Z2WA 3ZXKA 2Y64A 1D2SA 2RS32 3OGRA 1LKNA 1YIPA 1OOPC 3VZNA 2BRTA 4XJAA 4ISQA 2ZGSA 1JZ5A 1JU3A 1NA1B 3NAPB 1W9WA 5GZDA 4HKLA 3E5UA 4J1XA 3IDBB 3R4DB 1XE7A 4LUMA 3CNAA 3K3NA 1ALYA 1UAIA 1FOD2 3B93A 2A71A 1S0JA 3MFCA 4P9IA 2RM22 2PAMA 3GNEA 5JSPA 3T0DA 3RPQA 3LOBA 1EAH3 4XBNA 5L7OB 3M7AA 4CDWA 1UU5A 4YSFA 2VD7A 3MW4A 3HIFA 3NL1A 1LTEA 3BTYA 4ATEA 1OD3A 1YQ2A 4CEWB 1AXZA 4Q4Y2 4L99A 1Q5OA 2P1BA 3RVHA 3DYMA 1PNFA 1MS9A 4XUQA 5CBLA 2I74A 1HJGA 1BQPA 1NLQA 1GZWB 1ND3A 2IUWA 1SLBA 3ZSKA 1YIFA 1BBT1 4BQWA 1X8EA 2VULA 4LHSA 4AGGA 4Z8BA 4PBOA 3TN93 2R0FA 4Y22A 3ZR5A 4AGVA 4MLOA 5CG9A 2V5DA 3RZHA 4E27A 1PM7A 2HWD2 3VBRC 1JW6A 3IIIA 3MEPA 1V6IA 3U10A 5J96B 3K4AA 4QXCA 3ZKYA 5FZ0A 5GJ6A 1AYM1 5I0RA 4QGMA 5E8AA 4EWAA 5D21A 1Y43B 3NV1A 4LITA 1JYCA 2LUWA 2TBVA 3TNQA 3VL9A 4AI0A 4RS5A 1YRZA 3RWNA 3VBSB 2A70A 4NAOA 5FY8A 1V0AA 5FO7B 2UY9A 3O12A 5A6XA 3O1UA 2CDOA 3P5BA 4LHLA 2VW1A 4QX5A 1C8M1 1OLQA 3IM0A 4E8DA 3AJYA 3K3OA 5LB6A 1PO21 1Z78A 4HT1T 2VXRA 3CZJA 5BXXA 3WOGA 4Q1PA 4P5HA 1XNTA 2JIGA 1S0IA 4CU6A 2ZX0A 2NPIA 4CCDA 3VKLA 3IPVA 2RV9A 2QQLA 4L8QA 4MX3A 3DPRA 3TWIA 3O0XA 2W87A 5F32A 1SACA 1V70A 1VALA 4FPYA 2RS31 2BEOA 3OGJA 4JV4A 1DQ6A 1CAUA 4GMP1 4B4PA 1RMU2 4UFLA 4EJRA 4KWKA 1EYBA 4DEQA 3RZMA 2O1QA 4HFSA 4H7MA 4YLZA 1WLWA 1Y9MA 1YCIA 1VRH3 1KRIA 5FY7A 4OI0A 5CKQA 1T6GC 3VBFA 2JECA 2GALA 3WW2A 1FOD1 2WO3A 5FZDA 5JSRA 3WNPA 5JI9A 2X10A 4CU8A 1YWKA 4CP1A 4PI2A 5DAQA 2X5IC 4TSVA 4LK7A 4XACA 3I2DA 5FPXA 1MS5A 2WUHA 2Y34A 4K7JA 5GALA 1AR62 5AC93 4K21A 2CYFA 2O8QA 4AVVA 1RYYA 3WG4A 3B9IA 4A3ZA 5FOBB 4CDUA 2PN5A 4Q4Y1 2J1EA 1W9SA 1H8VA 1WMXA 1RUH3 3ZFEC 3FMGA 2XGXA 4QAWA 3O1RA 1G9FA 3H3ZA 3KGZA 4NRQA 4IW3A 1JZ4A 1D4M3 1GSLA 1TQ5A 2DU0A 1L7LA 4LHNA 4ES9A 1RITA 1HV0A 2PA7A 4L11A 2Z2SB 5G04L 4C90A 4OHYA 4FAGA 3IDEA 1QQP2 3KT1A 3ZN5A 2HWD1 3UKNA 5KHHA 5CFCC 5IAXA 3AFKA 5LCWL 1MS0A 1SHWB 3AL5A 3N9MA 3ES4A 4JRLA 4Q5OA 3BIEA 3FL7A 1ENRA 1UU4A 4Q4X3 2D44A 3WV6A 2YDEA 4X8PA 3RQ0A 1G6NA 1SLCA 1OQ1A 4YZ3A 2Q1ZB 1W6PB 1QH7A 2CGNA 4GH4B 4QMAA 3ACHA 2DCTA 4AI9A 4XETA 1KFUL 1AVBA 3H1MA 4TWTA 1SDDB 2BZDA 5EP9A 5HXVA 4AK3A 5C5TA 1RUD2 1F2NA 5HCAA 5I0UA 1BEV2 2BW8A 5DUXA 5EZWA 1LOEA 2CWMA 2QQNA 2AENA 1YYNA 1FMD2 2BYVE 4YVSC 5KBFA 5BYNA 1FX5A 5ACA3 4FXKB 2AEZA 3LEMA 1NZCA 1LEDA 1QH6A 2AREA 1TME3 1YEWA 3CHXA 3IIAA 3ACIA 4IEYA 4BQ1A 1O8PA 3JB8A 3MIDA 2Q1MA 2KR2A 2FMDA 1QNWA 1SCSA 1POV0 2YGMA 4PQQA 2D43A 4QWNA 1UY1A 3AP5A 4CPBA 4YW3A 4XVHA 5F37A 4X6QB 4IV1A 2VMCA 1MS4A 3FBMA 1RMU1 2GNTA 4AQSA 1DGWX 4IXLA 3T09A 5CADA 3RMYA 1CONA 3CJIC 1DGRN 1UZWA 4A7KA 2PMWB 3N7KA 1AR93 1H2NA 2D93A 1LJ7A 3OGVA 4XHXA 4AHZA 2OIIA 3I3EA 2VVDA 2BVBA 2DVBA 3AMMA 1J83A 1DYOA 1ZZ6A 1LU2A 5I91A 1WA4A 4L97A 4I2OA 3PJQA 3M8LA 3BKZA 1F9KA 2JE8A 2XLGA 1W3VA 3IDCB 1QXPA 4FOWA 4UFIA 2WQ4A 1AR61 4WVMB 5CVRA 5DG2A 5A3UA 5KXBA 1ZZCA 2VOVA 1AL23 4UW3A 4LO4B 2VMFA 2W92A 4LE4A 2A3YA 1QGLA 5FKCA 3T2OA 5F3GA 1DQ5A 4NHXA 4RHV2 4B8EA 1NCRB 4DS0A 2IXIA 3WP6A 4COZA 3OD4A 4CU7A 1RVF2 4QB1A 1I5PA 1QQP1 2A1XA 4Z1VA 1XYPA 4IERA 5LA9A 4NR1A 3JBG3 1Z7S2 1C3HA 2XVGA 3OPTA 4NPMA 3WG1A 2JG8B 5BNNC 3PUIA 2RS11 2G9ZA 4FFGA 5JUVA 3D3AA 1UD1A 3VDBA 4YGDA 4FP2A 1QJU3 3SCGA 3D8CA 4YFWA 3ZSEA 3MF6A 3D0JA 3EB7A 4ARXA 1CX1A 4KMQA 4QHBA 1BEV1 3Q8EA 3HN3A 1UMZA 2QTWB 1FMD1 3ZLIA 5FO8B 1YQ6A 4DIQA 3K4DA 2JD9A 2VNGA 2WT2A 3VKFC 4NHKA 1VIWB 5IAVA 4AFMA 1ZBE2 1US3A 1VBD2 5FZCA 4E4HA 3POEA 3V0AB 5FZOA 1QOTA 3J7MA 5FP3A 5IATA 1W6OA 2NM1A 2Y6LA 3POJA 1KQRA 1Q8QA 2OW4A 3N7MA 1RTVA 1VAMA 3WF4A 1AXYA 1IS4A 4NUBA 2PHDA 3I59A 2FDFA 4MGTA 3OF1A 4OMDA 5IVBA 1XJAA 2BBVA 2GP5A 4FFIA 4FAHA 4W8JA 5FY9A 1HB3A 1NLSA 2D6MA 4XF3A 2R073 2Y6GA 2B4KA 5FP8A 1SFNA 1YI9A 4ZU5A 1T2XA 3OBTA 3JXSA 4PQ9A 5L36A 5C8CC 1KDKA 4BQ5A 4CZSA 1DIWA 1JODA 1QJX1 1X9PA 2D97A 2IZWA 1ASJ1 3POGA 2GMEA 2ZGUA 1CIYA 1CN1A 4YM2A 2XWJB 3MPBA 3MYXA 4LA2A 1CGPA 1QKQA 3GJBA 3J8F2 5F2SA 2JD4A 1OH4A 1N1VA 1W28A 2X29A 1XB9A 1JYNA 2RDSA 2ZMKA 1SLIA 3QH7A 5HV0A 1VE0A 3T30A 2WFF2 2VMGA 3W5NA 3MUY1 1B35A 1OOPB 3EMRA 5IVYA 3O1OA 5JOXA 1BJQA 1C5HA 3OEBA 1CR7A 4MVTA 4XFBA 1E5HA 2WS92 1PIV3 5B4XA 1Q8SA 2DWRA 2XUEA 1AJKA 1V6OA 4OFGA 4RQPA 3HOBA 3PVOA 1YHFA 2VZTA 5A32B 4IUGA 2WZR3 3H8RA 4C0HA 1PK6B 3URFA 1GFF2 1GWLA 2P3YA 2PTMA 4IE7A 1C28A 1RVF1 2WNUC 3LEIA 3VBUA 1PMJX 4XOGA 3BTXA 3VZJA 2D6OX 3AMNA 2HEWF 4QKNA 4EROA 5B4NA 5E6HA 1Z7S1 1AJOA 1V6KA 1OF3A 4TLFA 2ZKLA 2LW8A 3VD7A 4FTBA 2ZEXA 4RN5A 2DUPA 1P8JA 3VGIA 4IGOA 3GBGA 3LFMA 1OKOA 2VQTA 5JWPA 2VZSA 5JXJA 4RR3B 1TEIA 5BNPC 1PMIA 3R05A 1LOFC 2J1SA 5GM0A 1S1AA 4N9IA 5J7MA 3S6PA 3C3VA 1OC1A 1COV3 1F15A 2P17A 5FZEA 3ZFGA 3KV9A 4HPKA 1WD3A 1ZBE1 1BCXA 1VBD1 2OX0A 5GZEA 4QPYA 1GZTA 3ME2A 4XJ8A 2JICA 4Y5Z0 1KFXL 4LKEA 5DUWA 2CSGA 1QHDA 2AH2A 1GUIA 2Y6KA 1JHJA 1YFUA 2I45A 4KH9A 4RL7A 1XE8A 2VH9A 4P9WA 5D8AC 2G9GA 4AYUA 1O7FA 5FFOC 3WF0A 5IK8A 1GR3A 3HN1A 2EIEA 2DFCA 2RDRA 3N9LA 2J42A 1VBE2 3ZYPA 4FFHA 5FPAA 2F17A 1K5MA 4WVZA 4Y1VA 5A33B 4LBMA 2GDFA 3ZIWA 5C70A 5I8TA 2WJSA 4UBHA 4ZONA 3AXDA 5A3PA 4BQ3A 2D6PA 4LT5A 3UT0A 3SMHA 1VMFA 5FZIA 2ZX2A 5LBCA 1RHI3 2YUEA 5GZFA 4S2DA 4BIOA 1TMF2 2V4AA 4JGZB 4AE2A 2OZJA 1RUI2 1HRI3 3NNMA 4ZXKA 1V9U3 5FK8A 2HWF3 2OA2A 3HNMA 2WFF1 3SEPA 2VCAA 1LR5A 5FP7A 2JDUA 4MXWA 3VZLA 3H1YA 3MFAA 2DTYA 1GP6A 3A21A 3JQWA 2XBO1 1OHFA 2EAAA 5FQ0A 5KHGA 2WS91 3KV6A 5IK4A 2Q4SA 3FUQA 4FPFA 5E16A 5KXDA 2W08A 2UYBA 2R062 1GU3A 3TEYA 3S57A 1DQ2A 2E53A 2VNRA 1JXNA 1G9BA 3IAQA 1W06A 2YC2A 3HQUA 4LLOA 5FWJA 2JWPA 3Q8AA 4GALA 4MGQA 5TSWA 2Y6HA 3KMHA 1DG6A 2HWB2 2PAKA 2X5IB 4NOTA 4CDXA 3WNXA 4CCNA 5I0DA 1NA1A 3NAPA 1KITA 1CAVB 1RUOA 2VZ3A 4P9LA 5A3WA 5LWBA 3O1VA 3TOJA 2W2IA 5KXCA 5FUPA 1VB4A 3DXUA 1TG7A 4QHZA 3UGFA 3U1XA 3T2TA 4B7KA 2ZGNA 5G05L 4NN0A 3ZXLA 1XYNA 4XE9A 4AGRA 5L7OA 3BI3A 4E2GA 4LXLA 5CFDB 5CG8A 3OY8A 1BBT3 4A42A 3NNGA 1NUKA 3PNAA 3WT3A 1H6XA 3HNYM 4CEWA 4QB2A 4ET7A 1W8HA 2XLFA 2JB4A 5LY2A 1N3PA 5C4WC 4LLFA 4PJYA 3PTYA 5T5PA 2D98A 3KS7A 3MZHA 3SEEA 2VQAA 5SV5A 1AYM3 3OGGA 4H2AA 3APBA 2D6LX 2XH6A 3D82A 4NVPA 4W6YA 3W5MA 3O1MA 1LENA 2I2SA 1BMV2 1PX4A 3WG3A 3AM2A 4W65A 2GU9A 2DBIA 4MH0E 4BZ4A 5FYUA 5FP9A 3NVCA 1VBE1 1VR3A 1NCQB 3T0AA 2DUQA 2FHRA 4OZOA 4YVSB 3BUCA 1RUC2 2D3PA 3LGRA 1C8M3 1WD4A 5J3UA 2H6BA 4CDQA 4R9CA 4K9SA 2ZJCA 4QXKA 1BKZA 1PO23 4KQ7A 3VBSA 1IPJA 5JOWA 5M0TA 4COVA 4EWDA 1YQ8A 3ZIXA 2YPDA 1W6NB 5EJ3A 1RUI1 4XJ9A 1Y9QA 1CESA 3SQOA 3WW1A 4M4PA 2OYZA 5BNOA 1WA6X 1KGYA 1I5ZA 1R1A2 3GZAA 4FTSA 1W0PA 2RS33 1JU4A 3V64A 4BYYA 5HCHA 4QX8A 4GMP3 4XFGA 1W8WA 2ZGQA 3WDWA 2P34A 1YLLA 4MGSA 2GH2A 2GSYA 4XILA 5FYSA 3THTA 2TEPA 2ZOEB 4CCCA 3IKWA 1GOHA 2R061 2ZHMA 1LGNA 5F6KA 4TTGA 1DQ0A 2FQPA 3V65A 2ZA9A 2MNGA 4WM8C 4XFFA 2QQVA 1FOD3 5FYYA 3USUA 4A45A 3M3IA 4XCBA 3I3DA 1V6NA 2RM23 2HWB1 3K77A 1UMIA 5FYBA 3T2QA 1H9WA 4IETA 2QVSB 1OA4A 2QDRA 5A3NA 4OCTA 2JE7A 3AP6A 3VD9A 3GZUC 1HLCA 3RG0A 5KC6A 4Q4Y3 3SNMA 3O1TA 2R042 4BXSV 1KS5A 3BOWA 4WZFA 2D6NA 3VB9A 1HQNA 1K5JA 2WWUA 2QNKA 4YW6A 3VBHA 1KD7A 4YZ1A 5B2GB 1RXGA 4KNCA 4P08A 5FOJB 1CAXA 1X82A 4R4XA 1H2KA 1QU0A 2W52A 3AZYA 4BDVB 2FCUA 1NZIA 4DUXA 4HK9A 4Z2AA 1X8MA 2DYCA 2GC1A 4JKLA 2BPA2 2HWD3 2WO1A 5BV6A 1YNAA 2FCTA 1VP6A 1W9FA 4XPVA 3SH4A 5T3NA 1H4HA 1KJLA 3OEAA 4K6BA 4UF0B 4BWOA 5A1FA 2ZCWA 3B3QE 1DF0A 4UBGA 3UETA 4I0AA 4JHTA 1BMV1 2WYSA 1EY2A 5LBEA 1W6MB 3WD5A 1WUVA 3LZZA 4MOAA 4CPBD 3LKJA 1O4YA 4Z82A 2W46A 3HVDA 5D1IA 5FJHA 1KJRA 3RS6A 4DPNA 3MICA 1ZZBA 5FUIA 1GWMA 3PDQA 1RUC1 3NV3A 4MHRA 3WLUA 1H30A 3ACLA 4JRAA 3THCA 1W6PA 4GH4A 1APNA 4X8NA 1X9TA 3SKJE 2WQZC 4N53B 1Q8PA 5ANQA 5EPAA 4CUBA 3T0BA 4EN6B 3B9CA 3KCCA 4M3CA 4XF0A 5LZ6A 2HYKA 2P5BA 4R9BA 3C7HA 5GLZA 1JYXA 4XF4A 3MLLA 2FDHA 2RS52 1UPIA 3KZ4C 1E5RA 2R1BA 5IT6A 3WEZA 1LAJA 2XJSA 5FYVA 4YM3A 3OYWB 5JIUA 2GMMA 1UOBA 1R1A1 1QEXA 2WZEA 3AP9A 3LA7A 1MVQA 4XMIA 3WNLA 1Y7BA 5F9TA 5IVFA 2YV8A 2GC3A 2VQUA 4HMZA 1RMU3 3HAGA 5FPVA 5APAA 1RUE2 2YC4A 2VUDA 4YVWB 4B3NA 4BK5A 5C8CB 3MDPA 4PLMA 4AAXA 1YC61 2ORZA 3WF1A 1W3XA 4Y4YA 3BB6A 3WDTA 5JPMB 3MLJA 1R092 1JN2P 2JG8C 2VW0A 3DF0A 1JZ7A 1O3QA 2Y26A 2G1MA 3INAA 4N43A 4QGLA 4AEMA 3POYA 4PDWA 3I2OA 3HEIA 4YZ2A 2X8KA 4IDZA 3IDAA 1AR63 4AFBA 2JB8A
chains in the Genus database with same CATH topology
2ZGTA 3AKPA 1NQDA 2DFBA 4WZCA 5K7PA 3RYRA 1AYN2 2R041 3WP4A 2ZHNA 3CLPA 2B8MA 1RL3A 3JD72 4WVMA 2WNUB 5EWSA 4FXGB 1JH5A 1UCXA 1QQP3 4LBQA 1SLLA 1O4ZA 1OI6A 1S0DA 1Q43A 1AX2A 1NCRA 4LHKA 1ZRCA 3BOPA 1GLHA 2RS13 4B29A 2ZABA 4JTNA 3E97A 4PIXA 1H1IA 3VDDB 1UIJA 5BNPB 1IOAA 1O5LA 2G4IA 2IXKA 4SBVA 4DY3A 4COWA 2H6CA 4YGCA 1BEV3 2ZHLA 1FMD3 4K8FA 3SCFA 2QJVA 3VHNA 4FPCA 5SV8A 2RHPA 3ENRA 1MQTB 1LOBA 3KT4A 4XQ4A 3HWJA 5D8AB 4AEDB 2RS51 1A78A 5DZGA 3WY6A 2A3WA 4GIQA 2RJLA 3R4UA 1QY4A 1REDA 5JLVA 2VECA 4GB32 3L2HA 3E5QA 4FPEA 1YO8A 3ZYRA 1CIWA 1PK6C 2EXIA 3WUDA 3FLPA 1RUE1 4KG0A 3WQ0A 1S2BA 4D94A 1VBC1 1H1MA 3JUUA 1QJX3 4ATFA 1G7YA 1ASJ3 1JUIA 2B9UA 2PHUA 2XL7A 3B01A 5J48A 1R091 3C2UA 3P3NA 1YI7A 4CP0A 4IEPA 1U5ZA 3EHKA 2VVEA 1LODA 2YC0A 3ZXJA 1ENSA 4RR3C 4YARA 2R6QA 3MIEA 3AK0A 2A6WA 4AVAA 1AYN1 1NXD1 4PBPA 3GZTB 1DYPA 5HI0A 5H9RA 2XJUA 1WCSA 4OUSA 3WCRA 2XJQA 4W6XA 1RIRA 3TAYA 1RVF3 5EYYA 4CRQA 1ZA4A 3N3HA 1N3QA 3VBOB 2BNOA 2ZKNA 3QOPA 4LO8A 3SLIA 4QPGB 1Z7S3 5F6LB 2B39A 2JXAA 2YMZA 1XYOA 3JU9A 1IZ3A 2JG9B 1AR82 4BA6A 2VU9A 1XU1A 3TRSB 2YYOA 1Z0HA 3NO8A 3D4KA 1GQGA 1ZZ8A 2FZ1A 4MGYE 2E7QA 4WBBA 3S7EA 5ABJB 3E6DA 3HT1A 3N4MA 4JGZC 1SBFA 3VKOA 4COYA 5C4WB 2WT1A 5EV7A 1ZBE3 2VOKA 1VBD3 4AFAA 2MPFA 4YM0A 5T5OA 3FX3A 4LR4A 4AEKA 4FVVA 1H8TC 3UKTA 4QT6A 3VBRA 5GLUA 4QM9A 3PLQA 3HT2A 4XBLA 3ZMOA 1LHNA 4NPRA 4AI1A 2R49A 2RM21 4DQAA 4WM7B 1GZ9A 3OCPA 3WHUA 1SBDA 1I3HA 4P9XA 2PQQA 3DGTA 3ZN6B 4AEJA 3V0BA 2Z69A 4C1XA 1HQWA 3TBDA 5AVAA 1I1EA 2WFF3 1F5FA 2GNBA 2Q0AA 2VUAA 4QQ2A 3VZKA 4MGIE 5CFDC 1UN1A 2XBO3 1OSGA 1NXMA 2WS93 2R30A 2DCKA 2PAEA 3A4UA 4KWJA 1DDLA 3M4FA 1N1SA 1PZ7A 3HMYA 3WX5A 1UF2C 3RRDA 5CA6A 4WM8B 1LESA 3O5SA 3OJBA 1W39A 4LNVA 3RNSA 5K0UB 3KT7A 2VG9A 4IV3B 1CJPA 1QXRA 1ENXA 1ZVFA 2PELA 1VBB2 5C6CA 1ULEA 2Z5WA 3MW3A 2NMOA 1NCQC 2A73B 3LA2A 1AR81 3ZFFC 3FJSA 2NZ9A 3CF6E 2ZX3A 2X5IA 4MZUA 4UW6A 3BPZA 3BU7A 3RJ2X 3ZXFA 4DINB 3MIBA 1CAVA 1ZZ7A 1UIKA 2OUJA 3SH3A 4A7ZA 2ZACA 3BALA 3FUOA 3UKVA 2ES3A 1XNCA 3AMPA 3ZFEA 4K20A 1Q3EA 3J9SA 3R0RA 2K2SA 4IEZA 1BVVA 4N7IA 4AQ6A 2E7TA 5C9AC 1H2LA 1HKDA 5T52A 2V5YA 4YW2A 2AGSA 4JGYC 2Q8OA 4RFT0 1ZM1A 3H7YA 1ZNPA 4XF1A 5CFCA 4AHXA 1UKRA 1LULA 4GA9A 1VBE3 3WW3A 1U12A 4AQ2A 4XDQA 2RMU2 3BIWE 2WINB 1MS1A 1W2UA 2ZGOA 4FPKA 5T55A 2CNAA 2XPJA 4ES8A 2BTVC 4YVSA 4YW1A 2XVKA 3PHMA 2QFEA 5CU1A 4GWMA 1RUI3 1HV1A 2PHLA 2A6YA 2P37A 1EAH2 1FNZA 2GN3A 3RI8A 1U5YA 3K48A 4TZDA 2LALA 5JCTA 3AMQA 2KXLA 4Q2FA 3VN4A 1ULFA 1IQAA 4ASLA 5L19A 3RSJA 4YRDA 3NKGA 4KU7A 4Y20B 4GKXA 2R063 4Z07A 5JAXA 3UJOA 1OKQA 4CEYC 2CGOA 2EA7A 3CJIA 2HWB3 1RUJ2 3SITA 3R4SA 1VBB1 2ZGMA 4JDNA 2FBEA 5H9PA 1POV1 1RUD1 2ET1A 1N3OA 2XVLA 4FO9A 1SMVA 1DGLA 1V00A 3AKRA 5L73A 2A6VA 1WW4A 2PFWA 5AFBA 3O7OA 4B4RA 4F83A 3ZO0B 3DV8A 3THPA 2IC1A 4N53C 4PF5A 5JDBA 4M3CE 4Q27A 3CEWA 1SBEA 3AJZA 4QQHA 5FREA 3SCHA 1ULDA 3NV4A 4R8HA 2KM2A 3WQ7A 1G9DA 1LRHA 2DVFA 5I8SA 4K40A 1F8VA 4XMAA 2ZGRA 2JDZA 4QPIC 3MPPG 4FT8A 4H14A 5FAXA 2LM3A 4YVWC 3VUOA 4P9GA 5KHIA 1JOJA 4Q0QA 5BNNA 1S0GA 4XHBA 3I7DA 3LCPA 1SCRA 3NW4A 1RUG2 2ZBJA 2RMU1 4BMEA 1RUC3 1OD5A 1XU2A 4YM1A 3WDVA 2RJKA 3AP4A 2GNDA 3KCXA 2QCSB 3JZVA 3T1MA 3FWEA 5FTTC 3VHPA 4QQLA 3WP5A 1VRH2 1D2QA 1S55A 3H0OA 2ET7A 3KQRA 1BVP1 5CB7A 3LAGA 5DDJ2 4RHV1 1XRUA 3EBRA 5EYXA 4DB5A 1MVEA 1ND3B 2VVFA 3O0VA 1R1A3 3CJXA 1V6JA 1QWRA 1NE6A 4Y22B 2R16A 4BM8A 5JPNB 4AW7A 5FLHA 2ILMA 5JOYA 3ZX7A 2FMYA 2C5DA 1HRV2 2UY8A 3AMHA 4QQOA 1OFNA 4Q4V2 1M06G 2XKPA 1X33A 5JIAA 2DCJA 1JHNA 5FO9B 4LBQD 5C8CA 1PGSA 2FZ2A 1RUJ1 4R9AA 1CQ9A 2BWCA 4YGEA 3VDDC 4CTEA 5I8YA 4PIZA 2X53S 1LHWA 2BGCA 2CY6A 4P14A 4I02A 2WA3A 5GLTA 2R043 2E7AA 1ULCA 4M01A 1J58A 1Q8OA 1UL9A 1ULGA 1XNDA 4IEXA 2AZ5A 1MQTC 3VL8A 1OPMA 1C1LA 3EXUA 5GKAC 3IPVB 2PHRA 4AEDC 1H1AA 4LBOA 1TME2 2WNUA 4ASMB 1RJ8A 2A7AA 2OZ6A 4JCKA 4INDA 4LO5B 1H9PA 1QMJA 1AHSA 3E5XA 1WCKA 4K1ZA 1PO12 3VBFB 1RUG1 1RC6A 3VKMA 3ZSMA 3J8F1 1ZZ9A 2PHWA 3ZXDA 3TB0A 1URXA 2Q30A 4OI4A 1CAWB 2P3JA 4Q0UA 5BNPA 1D0GA 1LOFA 1AR92 2CWSA 3NJZA 1EV12 3KD4A 3A0NA 3ALQA 2ZGPA 1H8TB 1FPN2 3B5LB 4CDUB 4CYDA 4LE3A 2W0XA 3GALA 2RS53 1RUF2 5DDJ1 2ATFA 4SLIA 1R1ZA 3IBMA 2ZX1A 4BLIA 1BK1A 5D8AA 3LB9A 3VHRA 2HWC2 2JENA 2YHJA 1RUE3 1S0EA 1ENQA 5KXEA 1HRV1 1VBC3 3VBOC 4HLTA 4Q4V1 3ROUA 4QPGC 3VV1A 4XYXA 2ENRA 2SBAA 4K1YA 4I30A 1R093 4WV8A 1UZYA 1HXS2 4HVOA 2JG9C 2YXSA 4HN1A 3D6EA 2NLRA 2GAUA 1MZEA 3DKWA 1VJ2A 3MF9A 4QM8A 4AVBA 5ABJC 5FMOL 2A6XA 3AP7A 3TNPB 1AYN3 5LRSA 1GANA 3PMSA 4LBNA 2K9ZA 2WNVC 1GZWA 1WLDA 2VMIA 4HZFA 2XKOA 3D5OA 1OA3A 4LULA 4Y1ZA 2DVGA 4E4SA 5JSOA 3MLKA 1H0BA 4YG3A 1S2KA 3ZYIB 1DFQA 1ZBA2 3GHNA 2CAUA 3ZFFB 1SLTA 2R32A 2QZ2A 3OD0A 1MZ6A 4B7EA 3NWKA 2B42B 4WM7C 5IK5A 2D6KA 3UK9A 1PO11 1Y3TA 5DUUA 4Y1YA 1CJDA 1TMF1 3MGUA 3EJKA 4G4FA 4EN0A 2EAKA 4TYSA 4FBFA 1XQNA 1YJKA 4AG4A 1ND2C 1X36A 5HBAA 5C9AB 1Q56A 1EV11 3AB0A 3G7DA 1NQJA 2DTWA 2D40A 4FP3A 2NP0A 1FPN1 2EXKA 2I07B 4JGYB 2VPVA 5FDBA 3RI9A 4E9KA 1RUF1 1GICA 1U5IA 2IXHA 4LBJA 5C4WA 3WP3A 1A3KA 4O9EA 1JTZX 1UX6A 3WXPA 3AKSA 4AFCA 3DN7A 4ORFA 1LGBA 2ZTNA 2YZ4A 2HWC1 3IWZA 1QNYA 4GXLA 4HL0A 5K0UC 1SLAA 4DFSA 4M0HA 4LTAA 4IV3C 1G9CA 4Q1RA 1C1FA 1I6XA 5E1RA 5FCCA 1DGRA 1HXS1 3W59A 4URTA 2WKKA 2BUKA 1SFYA 5T5JA 2ERFA 2XJTA 1CPMA 2XUMA 4ZU4A 1VBA2 3M3CA 3O14A 3ZSJA 1GZCA 2E63A 1OFSA 1QJZA 2A5ZA 4CEYB 2CAVA 1W6OB 3KLSA 2OPKA 3K51A 2QDNA 4DMIA 4Q0SA 3L2YA 3I59B 3WDXA 4Y1UA 2LTNA 1YFXA 4N9HA 5KWRA 1ZBA1 4WM8A 5JVVA 1AR83 3NV2A 1OQDA 3I54A 3H8UA 4XBQA 3ES1A 3OTFA 1N1TA 4Z92B 2DCYA 3VKNA 3WVJA 3W58A 1WMDA 1IPKA 4QQPA 4LBKA 2WA4A 4JQRA 1AR72 1ONAA 2ZAHA 3POSA 1PVC2 1LCLA 2JE9A 1GYKA 1M4WA 3NKTA 4FPOB 4DOUA 4XFIA 1B35B 1WW7A 4QPIB 1RGSA 5JZGC 2VW2A 2IFWA 4G9SB 2WZPP 2UWBA 2EALA 4RQPB 4HSLA 2N7GA 4GQ7A 3FC0A 2A75A 2HWF2 3RYPA 2D3RA 3VBUB 2JKBA 1AX1A 4I09A 4FPHA 3D0SA 2F6BA 3U07A 1DZQA 3SXWA 1CX4A 2XWBB 2NYYA 1PGL2 2W39A 4AHWA 3HD8B 5FBZA 1C5IA 1H4GA 2ZAAA 4LUKA 4BOWA 2CGPA 3WZ1A 2VOXA 2Y0OA 4G3YC 2ZMNA 4Q4W2 3RMXA 4C0BA 4EWEA 1YFYA 3S30A 1WW6A 3FBYA 4NWWA 4XFCA 1AXKA 4H7LA 2ZGLA 4GULA 2HKXA 2BFUL 4NWVA 1VBA1 3S7IA 4OVEA 3I4IA 4DNYA 3ZFGB 2IXLA 2ZS6B 4HPKB 4PLOA 2A3XA 4MSVA 4F7ZA 2HWE2 3X29B 3GBFA 4RGGA 1EPZA 4XZPA 1JUHA 3ILRA 1WLCA 4FOQA 1WMEA 1ZRRA 1ZX5A 5I0TA 4D7SA 1R082 2GC2A 1VBB3 4Y20A 3WQ1A 4B4QA 5LEKA 1POV3 1BXHA 1K5MB 1RUD3 1IS5A 2JG8A 1NY72 1QDOA 2OUHA 3N7JA 1FV2A 4M3CF 3KB5A 4A2UA 1O3RA 1MZ5A 4Q29A 2VNOA 2PLV2 1NOVA 4CDWC 4E2SA 2XJVA 1W6QB 1PNGA 1A8DA 4FPGA 1C8M2 2MEV2 1AR71 2WSVA 2XJPA 3T1LA 1IGOA 1PVC1 2ZHKA 3WUCA 3SH5A 3WDUA 3V0AA 1ND3C 5E89A 1GQHA 2EXJA 5FQ0B 2ZZJA 4XQDA 3ELNA 4L9BA 5HCFA 3ZYJB 1OQEA 5F1RA 1LB2A 1TNRA 2QUOA 3RYKA 3OPZA 4RD7A 3B00A 5IK7A 4KGGA 1EPWA 4O9GA 1CVNA 2DURA 2RMU3 4HSJA 4OHVA 1AUYA 4CDXB 1PGL1 2ZZQA 4RS5C 5K8SA 3AYEA 2F4PA 2AYHA 2RR12 3DL3A 2ARXA 4DZGA 4Q4W1 4A7YA 4RHV3 4CP2A 1YUDA 3JD71 3OY8B 4GMP0 3B7MA 2BVVA 1JBCA 1OOPA 1QXJA 1RJ7A 4L92A 4E4DX 1G8WA 2WSUA 5A32A 3KSCA 4ZU7A 2HWE1 3DPRC 4FQZA 2HEVF 2VY0A 4I0BA 1PK6A 4FQ4A 4XIOA 1U5XA 4EN9B 3DUIA 2PHTA 2XB6C 1DZRA 3QLQA 1QJY2 3MIGA 1RUJ3 1SEFA 1R081 3PVEA 4XIKA 1E57A 2Y38A 1J3RA 1LGCA 1NY71 3VBFC 5EXOA 4Q26A 2YROA 3MIFA 4XW3A 4CDQB 1J1LA 5AVPA 2WNVB 4RR3A 1UPSA 2PLV1 1DZTA 5K9YA 1NLRA 2D5HA 1G9AA 2SLIA 4CDUC 4D7YA 1PZ8A 3FLTA 4HKOA 4DY5A 4W6WA 2MEV1 3AZZA 5BNOB 4R52A 2R1DA 2WLPA 4DRVA 1FATA 4GB31 3ST7A 1S0BA 1ZREA 1O3SA 2QQPA 4JDMA 5AFEA 4IESA 1AX0A 1D0HA 2VQ0A 2TUNA 4Q0PA 3RJRA 4XJUA 4BPZA 1RB8G 1RUG3 5A33A 3USUB 1U0AA 4AI2A 3J8F3 1F5JA 1NG0A 1ND2B 1REFA 1GNZA 5KC5A 3IN9A 4HBNA 1IKPA 1YXWA 1O4TA 4FSJA 1RINA 2DV9A 3U4XA 2RR11 4YG0A 4JGZA 3JCIA 4JTOA 5DDJ3 3H50A 4S2FA 1CAWA 1WW5A 4WVVA 4PLNA 2V09A 3VBHB 1MEC2 3M3EA 4LEJA 4BIFA 3HR9A 2XLAA 1CAXB 1H8TA 5DXDA 3IMNA 3WG2A 1VAVA 3QD6A 3L9JT 1HRV3 3AYDA 5CAZA 4Q4V3 3GBWA 4Y1XA 4IV1C 2GN7A 2RE9A 3BODA 4QD2A 1QJY1 5JI7A 1LHUA 2KA3A 2E9QA 5J09A 4E4ZA 4LO7A 1FAYA 1IS6A 4I0WB 4NO4A 1X7NA 2RS12 2NQYA 2WNEA 4BMBA 5DZFA 4BH9A 4FTEA 4PIYA 2PHXA 3M3OA 3P3PA 1L3JA 1UKGA 4M3CB 1IHMA 4MGKE 2UWCA 5CFDA 2GNMA 4S2HA 1OMIA 1S0FA 2IWGB 5FLIA 2XL9A 4U2AA 1UZZA 1FT9A 3WW4A 1J1TA 4RSUA 1TE1B 4JVAA 2O8OA 4AXOA 1WGPA 1GV9A 2EVXA 1NCQA 1FV3A 1PO13 4KWLA 5F5QA 4HANA 3ZFFA 1TMF3 4N43B 3AX4A 4YGBA 4PDWB 4OHWA 1QJX2 2TNFA 1EV13 1KXGA 4OZXA 1HQLA 5JMCA 1ASJ2 1SQ4A 1VAKA 5BPXA 5JZGB 4M00A 5T54A 1FPN3 1LECA 2WFPA 4YW4A 5GZCA 1W6NA 1RUF3 1Q8VA 4YG6A 2DUOA 4DRRA 3LA3A 3SHRA 2YPJA 4KBBA 2AR6A 3ZVXA 5C9AA 2HEYF 4JC1A 2VGDA 1MEC1 3QCWA 3MIHA 3BCWA 4JGYA 5J36A 2PYTA 2HWC3 3TN92 3AZWA 4LBQB 1DLLA 4I3GA 1LOAA 4J1WA 4AWDA 3ZXGA 1ZRDA 3VHOA 5DUVA 1HXS3 4OUMA 3WDYA 1DU3D 4N90A 1O91A 4JDOA 3E6BA 1OA2A 3N35A 2DVAA 1C8NA 2AUYA 3E6CC 4YYOA 3FLRA 1YFWA 4YNIA 2XG3A 3G6JB 4BE3A 5LK7B 3MI8A 1B35C 1OPOA 2ETEA 3VZOA 2B45X 4MYEA 2R0HA 4RQPC 4UW5A 4J6GA 2WLQA 1EP0A 4CEYA 2Y0IA 1ZBA3 2BNNA 3BTAA 3VBUC 3RZZA 5BUVA 1B09A 1DHKB 3ZN4A 2WL1A 2B46X 1W6MA 2O0OA 4FOVA 2Q5TA 4CDWB 3RDIA 4X6RB 4D69A 1GKBA 3B69A 2ZPXA 1AZDA 2P3IA 2Z79A 3FFQA 4AFDA 1EAH1 2VOWA 3KGLA 4N53A 5H9SA 4D3WA 2C1FA 1LU1A 5AC92 4XFHA 2B5HA 4M0NA 5LEJA 4KU8A 1RUH2 1D4VB 3ZFGC 1CD3G 3OYWA 3POWA 1D4M2 2VUJA 1QOSA 2JEMA 1DQ4A 3AKTA 4QPIA 4C91A 2XBO2 3TN91 1AL0G 1FI2A 3TYJA 1VLNA 2DCZA 4YVWA 4RS5B 3ZSLA 4AQTA 1MZFA 2G9FA 2ARBA 3LSEA 3PVBB 1K5MC 5H9QA 4Q4X2 2BQPA 4UW4A 2PHFA 4IEVA 1UU6A 5LRRA 2EF6A 4XJWA 4P9JA 4XQWA 2CL2A 1VBA3 1A6CA 4MUVA 1ZYBA 4XFAA 1JYIA 4F8AA 5ACA2 3DPRB 1BYHA 1CAUB 4ONUA 3A0KA 3Q9OA 3USSA 3ZMNA 1SDWA 3VBRB 4H3WA 4HVQA 3GF6A 3ETQA 1O3TA 5JR7B 3QH6A 2EXHA 4KG8A 3VDDA 2DF7A 3B94A 4CDXC 1VRH1 1NA1C 1N47A 3NAPC 5C8WA 2NN8A 4JAAA 3ILNA 4Q8KA 1QOOA 2EIGA 1G86A 3OBRA 3V0BB 1NYWA 1AR73 5FMOS 4H55A 1PVC3 1DQ1A 3M1HA 4XXPA 4I01A 2JX9A 1MQTA 4EN7B 5L7OC 5AC91 4AVTA 4V1PA 1AL22 1PZ9A 1W6QA 4XXAA 4ZKTB 4AEDA 4CEWC 1RUH1 2ZGKA 1CPNA 1OLRA 2IFRA 4R9DA 1D4M1 3R6SA 1IS3A 1ZRFA 1MS8A 1DYKA 3JB4C 4FPJA 2D5FA 5A3MA 4Q0VA 1VB2A 3JBG2 4S2GA 4LO6B 3H7JA 4LA3A 4Q4X1 2WIIB 3ZXEA 1LHOA 1MACA 4HK8A 1C57A 4Q4W3 1QJU2 3EO6A 2IXJA 4CDQC 4YZ4A 2C9AA 1W0OA 4ISRA 1N1YA 3JD73 4NHLA 3LWCA 3VBSC 4BHPA 3GHMA 3QACA 4YFZA 4EV0A 3N36A 4K3UA 5GLVA 3VZMA 3J26N 3ZFEB 4OLLA 4LBLA 3WHTA 5ACA1 4AHYA 2DU1A 1S0CA 2H0VA 5EFUA 3ECQA 4A3XA 2HWE3 1DGWA 4L2NA 5BNOC 4IV1B 1TME1 1GNHA 3M3QA 1RUNA 2HJIA 2A6ZA 4OULA 1J59A 4Y24A 5CFCB 3VBOA 3LOIA 3CL1A 1R083 4BLJA 4QPGA 3KM5A 3AZXA 2E6VA 3W9AA 3AYAA 2V73A 1YJLA 4FCAA 1IKQA 2Z42A