1C8M2

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
total genus 59
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m200
1ZBA1 1MQTB 1AUYA 1RUD3 1PO13 3VBUB 4CDXC 4RR3A 1FOD2 1QJY3 1QJU3 4RS5C 1ZBE2 1AR73 2RMU1 2R061 1PIV1 1VRH3 3VDDA 2VQ0A 1QJX1 5C8CC 4YVWC 1V9U2 1TME3 1QQP2 1RUJ3 1C8M1 1BEV2 1VBA3 1NCRB 3ZFFC 1VB4A 4GMP3 3ZFEC 3M8LA 4RFT0 3TN92 4N53B 5ABJC 4GB32 1BBT3 1SMVA 1HRV3 4N43C 1V9U3 1CJDA 4IV3C 1RHI3 1ND2A 4QPGC 1RUH1 4N43B 2RS33 2XBO1 1PGL1 5ABJA 1NY72 1RUC3 3VBSA 1COV1 2R042 1AR82 2BUKA 2X5IB 2RS32 5BNPB 1TME1 1FPN1 1RUC1 1PIV3 4FTEA 1RHI2 4RS5B 2BFUL 5AC93 3JB8A 5K0UC 3VBRB 1RHI1 4Q4W3 5JZGA 5C8CB 4CDXA 3FBMA 1COV3 4Q4X1 4WM8B 1RUE2 1VRH1 1EV12 1HRV1 4WM7B 1RUE1 4CEWC 1VRH2 2X5IA 4CDXB 1RMU2 1MQTC 2HWD3 4AEDC 4RHV2 1MEC1 3VBRA 1AYM3 1HX6A 2HWC1 1F2NA 3JB4C 1R1A3 4Q4W1 4CDWB 1AL21 5C4WC 4CDUA 5BNOA 2MEV2 4WM8A 3JD71 5AC92 2RMU2 1H8TA 4FSJA 5AC91 1AYN1 3DPRC 2HWF2 5ACA1 4N43A 5GKAC 1VBC2 1X36A 3VBOA 3ZFFB 5BNPA 1BEV1 5CFCC 5BNOB 1AR92 1R083 1AL23 1AR93 1R082 2HWE3 3VBOB 3CJIA 4JGYC 4CEYA 2GH8A 5D8AB 4GB31 1FOD1 1OOPA 4CDQB 4N53C 2WZR1 1VBA1 1VB2A 2HWF3 2WLPA 4QPGB 1ASJ1 2WZR2 2RR12 5ACA3 1ASJ2 2WFF3 1RB8G 1PO21 2XBO2 4JGYA 4CEYC 1PO22 1NY71 5C9AA 2WS93 1QQP1 2RS12 3ZFEB 1K5MB 1HRI1 5DDJ2 4GH4C 4RR3B 3TN91 3DPRA 4Q4Y1 1FMD3 1VBD3 4Q4Y2 3VBUC 1H8TC 1R1A1 2HWD1 1RUD2 1PO12 5C4WA 4YVWB 3NAPB 1VBB2 1PO11 2R071 3CJIC 3ZFGB 4AEDA 2RS51 1RVF1 5CFCA 4GB33 1VAKA 3JBG1 5L7OB 1OOPB 1EAH1 1FPN2 4EJRA 1NA1A 5BNNA 4YVSC 5ABJB 1RUG2 1A6CA 1FMD2 5JZGC 1TMF2 1ND3A 1QJZA 3JD72 1NA1B 2PLV3 1AYN2 1HRV2 1ND3B 5J96B 1NG0A 1RMU1 4PDWC 2GSYA 1D4M3 5BNNB 1X33A 1ASJ3 2ZAHA 1R081 1OHFA 5L7OA 4GMP1 1RUH3 4Q4W2 1ND2C 4Q4X3 2RM23 1PIV2 1QJX2 2RR11 3DPRB 5K0UA 3J8F1 1POV0 4RQPB 5LK7B 1NCQA 1WCDJ 4Q4Y3 5CFDC 1K5MA 3ZFEA 2R063 1VBE3 2HWC3 1HXS3 1C8M2 3J8F2 4Q4V2 5CFDB 1POV3 4Q4V1 4FTSA 1R091 2BBVA 5DDJ1 1R092 1RUF2 1MQTA 3VBHB 1PGW1 3VDDC 1R1A2 1PVC3 4CEWB 1NCQB 1PVC2 4IV1A 3VBSB 4RS5A 1BEV3 1BBT1 1ZBA3 3ZXAC 1B35C 1ZBA2 4QPIB 5FMOL 1Z7S1 3JD73 4CDUC 5C9AB 1HRI2 4JGZA 1C8M3 1HXS2 1DDLA 1NOVA 2WFF1 1R093 1RVF3 3ZFGA 2WFF2 1TMF1 3VBSC 1VBE1 4CDQA 2RMU3 4Q4X2 1B35A 1RUD1 2BFUS 1VBE2 1RUI2 1EV11 4IV1B 1NA1C 2R072 1F8VA 1RVF2 1D4M2 4BCUA 1MEC2 2HWC2 1D4M1 1EAH2 1RUI3 1RUH2 1HRI3 1H8TB 3VDDB 4RQPC 1RUG1 1FMD1 1C8NA 1COV2 2RM22 4RQPA 4Y5Z0 1AR62 4YVWA 1K5MC 5CFDA 5C8CA 1PO23 4QPGA 3JBG3 1VBC1 2RS31 2XBO3 4IV3A 3VBFB 4SBVA 5FOJB 4RHV3 4YVSB 4NWVA 2RR13 1W39A 2R043 5C9AC 5L7OC 1AR72 2FZ2A 1RUF1 1VBB3 3HAGA 3ZFFA 1MEC3 5JZGB 2HWE2 1B35B 1CD3G 3ZFGC 2HWE1 4JGZB 1PVC1 4CEYB 2HWB2 1QJX3 2RS11 3S6PA 1ND3C 4CDWC 2R062 3J8F3 4YVSA 4RR3C 4PDWB 1RUJ1 2HWB3 2BPA2 1BMV1 4IV3B 1HXS1 1QQP3 1RUJ2 1AR63 1ND2B 1BMV2 4LLFA 1Z7S3 4IV1C 2RS53 1V9U1 4WM7C 3NAPA 1E57A 2HWD2 1GFF2 1RMU3 4CDWA 1AL0G 2TBVA 3IDEA 1VBD2 1EAH3 3VBHA 2PLV2 5CFCB 1NCRC 1AR91 1EV13 2PLV1 1RUE3 5DDJ3 2RS52 5A32B 1ZBE1 1Z7S2 1TMF3 4CDUB 5D8AC 2WZR3 5A33B 3JBG2 5C4WB 3VBUA 4GH4B 1VBA2 4WM7A 2X5IC 1NCQC 5A32A 4CEWA 3VBFA 1PGL2 1OPOA 4GH4A 1RUG3 2RM21 1AR61 4Z92B 2MEV3 1RUI1 1ZBE3 1RUC2 1HQNA 4QPIC 4NWWA 1AYM2 4PDWA 5D8AA 4JGYB 2R073 1AYM1 4N53A 5K0UB 4GMP0 1OOPC 1IHMA 4QPIA 3VBHC 3TN93 1VBB1 5FMOS 4FTBA 3CJIB 1M06G 2FZ1A 2R041 5BNPC 2Y26A 1AYN3 1AR81 3VBOC 5BNNC 2QQPA 1RUF3 2HWB1 1TME2 3VBFC 5J98B 4AEDB 2IZWA 1AL22 2WS91 2MEV1 2RS13 4CDQC 1POV1 4Q4V3 3LOBA 2WS92 2ZZQA 5BNOC 2WWSA 1QJU1 1QJY1 4WM8C 1VBC3 2XPJA 1FPN3 1FOD3 1QJY2 1QJU2 1AR71 2DF7A 1NCRA 3VBRC 2HWF1 5ACA2 1PGW2 5A33A 1AR83 2ZTNA 4JGZC 3NAPC 4Y4YA 4RHV1 1BBT2 1VBD1
chains in the Genus database with same CATH superfamily
4HLTA 5LWBA 4H7MA 3T2QA 3D82A 3NKGA 3VBUB 3WDUA 3AMQA 4LBKA 1YIPA 1QJY3 1PM4A 1OLRA 2Y0OA 1PX4A 1HN1A 3AMMA 3ILFA 2OPWA 2R1DA 2JDMA 2RMU1 1ODNA 3PU8A 4NR1A 4XDPA 1VRH3 3E6BA 5GJ6A 5I0TA 1DQ5A 5IVYA 3VDDA 3VZMA 1LULA 5I0DA 3VKNA 1FV2A 5CG9A 1YC61 4P08A 4AZZA 2OQ7A 4QX2A 2UYAA 1GWMA 3AZXA 4NRQA 5IVCA 1Y4WA 1F4HA 3VKOA 1QQP2 3AP4A 1YHFA 2G1MA 4MHUA 1BEV2 3UT0A 1VBA3 1C5HA 3MIDA 5J7MA 2B9UA 1NCRB 4MVTA 2DCYA 1HLCA 1LU1A 4NIIA 3V0BB 4PIZA 5EJ1B 2EXJA 2VBPA 3TN92 5FLJA 3VZKA 3PJQA 1ENRA 3HT1A 3OPTA 3T1MA 5FR3A 3TYJA 3PUQA 4HSJA 3VZOA 1W8WA 4JC1A 3BALA 5I0UA 3I54A 1GNZA 2WWJA 2Z4FA 4IERA 1V9U3 4N43C 5FBZA 3AKSA 1V6JA 2DURA 1RUH1 2VL4A 2X10A 4JX0A 3VB9A 2RS33 2CGOA 2XBO1 2ZX3A 3H8RA 1HJGA 1PGL1 1RUC3 5F3EA 3OBAA 3PUSA 2RDNA 3H7JA 2XVLA 1COV1 3POYA 3SH3A 2R30A 2XR4A 5FZFA 5IT6A 1LOFA 1SFYA 3OBTA 1Y7BA 2WZEA 2NLRA 2GMMA 4SLIA 3ALQA 3D0JA 2BZDA 3IWZA 2BUKA 2AR6A 5I0RA 3MLKA 2JKBA 1FPN1 1PIV3 2BFUL 3AKQA 3P3PA 1AHSA 3AK0A 5AC93 3AKTA 2E51A 4GALA 3AMNA 2VR4A 1S0IA 4BK5A 2P6CA 3OGJA 5JZGA 2H6BA 2PQQA 4CDXA 5LA9A 2UYBA 3FBMA 2J1TA 4OHWA 2C26A 2K46A 3GHNA 3NJXA 3KV4A 4Q4X1 4WM8B 3R6SA 4HKWA 1HRV1 4WM7B 4Q0UA 4DB5A 4ZS2A 4BMEA 4JCKA 3PURA 1ULEA 3IBMA 1QEXA 3BIEA 3VHOA 3WQBA 1JODA 3ZSLA 1AYM3 4XJUA 3MO4A 1NX9A 3LCPA 5E8AA 1R1A3 3DCQA 4BWOA 2FDFA 1TNFA 4GD4A 3ZYPA 1OVPA 2DU1A 5IFTA 3HQXA 4PLMA 4K40A 1W6OA 4I0WB 4DOUA 3SHRA 2D40A 5KHHA 2MEV2 4KNCA 4WM8A 2VOTA 5E6HA 4ATEA 4U36A 1CAUB 5F1RA 1MVEA 2Q0AA 1HV1A 4FSJA 1Q8OA 4FFHA 5AC91 5FO7B 4Q8KA 2AH2A 5ACA1 4IXLA 4TSVA 5JXHA 3D8CA 1W9WA 4N43A 2FDGA 3F95A 2OXBA 1JYWA 2Q8OA 4COVA 1GU3A 1UZZA 3DF0A 2VCMA 3C7GA 4K1YA 3MFCA 2DU0A 5DZFA 5DMYA 2P3KA 2ZHKA 2HWE3 3GNEA 1W04A 3CJIA 3I59A 5FDBA 4DUWA 4LR4A 1CESA 4LO4B 1X50A 1ZZ9A 5F5IA 5FAXA 5IFPA 3UKTA 5J37A 3UGHA 2DTYA 5JLVA 1D0HA 4N53C 1VBA1 1VB2A 2A6YA 1LESA 2HWF3 3KVAA 4M3CF 1ASJ1 1L7QA 3KF5A 2P3YA 4X6QB 5AFEA 5F6LB 2YFZA 2XJUA 3VKMA 3WG4A 1JOJA 1GOFA 4PBPA 3BN6A 1MZFA 4CEYC 3W5MA 5A6YA 2VMGA 1PO22 4MGTA 1NY71 2NPIA 4K20A 1G9FA 3ILNA 1ZA4A 1GZ9A 2ILMA 4FPCA 2GNBA 3GZEA 4IE7A 1PVXA 5FYMA 2QQLA 2RG4A 3V0BA 4QM8A 3C8XA 5DUWA 1F5FA 5EV7A 1QOSA 2OZ6A 3VN4A 1NYWA 3HQRA 5FY7A 5K4LA 1FMD3 4MUVA 1EYBA 2IFWA 3HMYA 2Z42A 4Q0VA 4XJ8A 5FY4A 3CZUA 4DEVA 2ZEWA 5A1LA 2VW2A 1H8TC 4TYSA 1V6LA 1Y43B 2Z2SB 1LB2A 3WF0A 1J59A 3O1SA 1PX3A 1EY2A 5C4WA 4BIFA 5GZCA 4YVWB 3OSDA 4HK9A 3NNFA 3LIGA 2R071 1XYPA 5SV5A 2B7YA 4AEDA 4NROA 5EQUA 1O3TA 2E32A 1LHWA 2OX0A 2VXJA 4CCLA 5L7OB 3N3HA 1ZA7A 3I2GA 3J26N 1H1MA 3VZJA 1W9SA 4R9AA 3MPPG 4XYXA 2RJKA 4XF9A 5CAZA 1VE0A 2A6VA 2ZHMA 3RWKX 5DQ0A 3OUJA 1BVP1 4A41A 4LULA 2XXZA 4I2OA 5BXXA 3N7JA 3ZKYA 1ND3A 2QCSB 2QQNA 4XCBA 4M3CB 2Y8KA 3FMGA 5IVFA 4DUXA 4CU7A 4PQQA 3L2YA 3POFA 4Y26A 1MZ6A 1WCKA 3K3OA 3J4UH 1ZNPA 4WBBA 3CHXA 3VDCA 4E4SA 2R1BA 3GCXA 4XF0A 1W0PA 1NG0A 4AW7A 2NP0A 5F5QA 2P6HA 1NXMA 2GSYA 1D4M3 1JW6A 3LPFA 4XJAA 3ECQA 2WNVB 1UYYA 3LDBA 2VQTA 4GMP1 2VJXA 2A6ZA 3BTAA 4Q0SA 1X9TA 1GZTA 3I2IA 5KXEA 3GALA 1DGRN 1J83A 1W06A 5LZ6A 1KJRA 3NJZA 4AE2A 1CQ9A 2ZHLA 4Y5TA 1JYCA 4FT8A 4LOTA 1IZ3A 2NN8A 4XBLA 5L9BA 3SNMA 3D4KA 4M3CE 5A6XA 3M3EA 1WCQA 5K0UA 3QLQA 5FQ0B 2B45X 3WZ1A 1V6KA 4Q4Y3 1K5MA 4CCEA 5JAXA 5JVVA 3ZFEA 2R063 2KM2A 3BU7A 3ZXEA 3ZXDA 4LORA 3DKWA 2EIEA 3APBA 4FTSA 4L99A 1LEMA 5A6ZA 2PAKA 4B3NA 3AZVA 1NE6A 1WA6X 2JX9A 3C2UA 4UBGA 3UL2A 1OA3A 4A2UA 3ES4A 4XACA 4HOOA 1A34A 3EYPA 4UFJA 2D5FA 1U0AA 1DP0A 2WSUA 2YUEA 1MQTA 3SISA 2D98A 4QPWA 3ZYGA 3NKTA 4XETA 4YGBA 2XLFA 4AFBA 4CEWB 4KBZA 1DYPA 4JKMA 3H1MA 1LODA 3K51A 2O8QA 3WHUA 1UAIA 1ZBA3 2HEYF 3O1RA 4IEPA 5FWJA 4YFZA 3PUIA 1REEA 1YWKA 1LOEA 4QPIB 4UF0B 1OMIA 2PAEA 3WP4A 2B5HA 3JD73 5C3PA 5C9AB 1C4RA 1WD3A 3LA3A 5JMCA 1HXS2 3CZJA 5A6QA 1GNYA 5A7PA 1NQJA 2WA3A 4RN5A 2W52A 4KWJA 1W9YA 3NW4A 5FK7A 3Q9OA 5FZ8A 3R05A 1MACA 4XPVA 3VBSC 2XJQA 2VMFA 3ACHA 1EUTA 4Q4X2 2BFUS 2VMDA 5LASA 1VBE2 1LGBA 1RUI2 4MXWB 2EICA 3WX5A 3N36A 1DQ4A 3MIBA 2FQPA 4PIXA 4DNYA 1N1VA 1YI7A 3ZDVA 3ORJA 4K7JA 1RVF2 2Z5WA 1FV3A 4P9WA 2VXRA 4PCRA 2D6KA 4XBQA 1XBFA 4XFCA 2HWC2 2DUPA 3IT8A 4XOGA 1D0GA 2F4PA 1UO9A 1XRUA 3T30A 3CO2A 3RSJA 1KFXL 1OUXA 2ZGOA 4RQPC 1HIXA 2DCTA 1COV2 1Y9GA 2RM22 1JYXA 4LO6B 1W99A 3LF7A 2VCBA 1W2TA 1F15A 2O14A 2XHKA 2XJVA 3NNMA 4FXKB 1CIYA 1V00A 4NIHA 2FHRA 1G86A 1VBC1 1W6MB 3V0AA 1WLCA 4KWLA 2YC2A 5HXVA 1OSGA 3KGZA 5FOJB 4AFAA 3WXPA 1GWKA 2VZOA 1OD5A 1JUHA 3AM2A 3I59B 2VMHA 4XFIA 5A7WA 3E5XA 5A1AA 3H1WA 1G8WA 1H1IA 5JXIA 3LOIA 1GWLA 4LXLA 4AI0A 2GALA 1W6QB 2VU9A 1AR72 3DXTA 3NRUA 3VKLA 5F37A 5FZ3A 2D6NA 3HWJA 2IFRA 3LB9A 2HWE2 4MXWA 2JDKA 4XCAA 3C7OA 4IEQA 3ZDSA 4FI9A 1PNFA 3N7MA 4GJZA 1QH7A 3POIA 3Q8FA 5KXBA 1EUUA 3S7EA 3H8OA 4AEMA 3HPNA 4CA9A 1UZVA 3NV1A 4W4ZA 4XBNA 4XUPA 4EWEA 5L9VA 5FUIA 4Y1UA 2WNUA 2WL1A 4GWNA 4IE6A 2X29A 4HVQA 3USUA 1CAXA 1SFNA 5HCBA 2A1XA 2VGDA 4CDWC 4Y1YA 3ENRA 1G9BA 1FNYA 2R062 4YRDA 4YVSA 1RJ8A 1UYZA 2AYHA 5JOWA 4PDWB 2BPA2 4JKKA 4FPGA 4OFGA 4W8JA 1QQP3 1IKQA 1ND2B 4YZ3A 5LA2A 4I3GA 4C0HA 2D3PA 1NKGA 2RS53 1V9U1 3V64A 4A6SA 4M4RA 4E8CA 5LBEA 2K0GA 4FPKA 4YZ5A 2E7QA 2JDYA 1GFF2 3PTYA 4JRLA 1AL0G 4AI1A 1SDWA 4QHBA 1EAH3 3GZAA 1ENSA 1ALYA 2QQIA 4IEVA 1AR91 4BPZA 1EV13 1UU4A 5SV8A 4NHYA 2D44A 3BYWA 1RUE3 2RS52 1RITA 2DFBA 3AJZA 3IN9A 3M3IA 4ONUA 3UJQA 3O0XA 4DMIA 5A33B 5FXZA 1OF3A 1SFPA 4OI1A 2JECA 1OQ1A 5FJKA 1ZREA 2P1BA 1DFQA 4Q0PA 2EIBA 2QQKA 1UMIA 5BPXA 5FZOB 1EPWA 1YNAA 4YGDA 1MS3A 5TSWA 4CCOA 5A1FA 3FUQA 3WCRA 5FXXA 2WBKA 1DF0A 2BYVE 2VD7A 4GH4A 2NMOA 2BU9A 1SLLA 3I2KA 3K75B 5FTTC 4F83A 3CIHA 4UYBA 5GM0A 5LY1A 4XDQA 5DUVA 1JHNA 1SBDA 5EJZB 1RINA 1MS8A 3LQCA 2OA2A 2Y33A 4NUBA 4D0QA 4BDVB 3WINE 2GC3A 4NWWA 5LCWL 1W90A 4JGYB 2QTWB 2R073 1LRHA 3QH7A 5FPZA 2GC1A 1OOPC 3O5SA 3KT1A 2DCKA 3RVHA 5FYTA 3HT2A 3KVBA 1SCRA 2J42A 4QX8A 2ZGUA 2BDRA 3RI9A 3B7MA 1ULCA 4FTBA 3BOPA 2DDUA 1OURA 2CAVA 1F35A 2VZ1A 4FPLA 2A75A 4PLOA 5KWRA 5BNPC 2PHRA 3VHPA 2E7TA 4OCTA 3C7HA 5FP3A 3U14A 3UYJA 2QQPA 3TAYA 2HWB1 3VBFC 2CDOA 5J98B 4GXLA 3WW1A 1IS3A 5T3NA 3WNMA 3AZZA 4QXBA 3WDTA 1IQDC 2XUEA 4LA3A 4IE4A 3WQ1A 2P17A 1C5IA 1LOAA 2WS92 5JI7A 4DXTA 2QZ2A 3IIIA 5BNOC 2XL9A 2D5HA 2YMZA 3WW4A 3AZWA 3FFQA 4R4XA 5CB7A 1XYOA 4H2AA 4OUEA 1FPN3 1SDDB 3H3UA 3WDXA 1AR71 4BHPA 4BJ0A 5IVEA 5JOYA 5JWPA 3D0SA 2HWF1 4LHNA 1PGW2 5A3LA 5F3CA 3VD4A 2VPVA 2RDQA 4CCCA 3BUCA 4AVCA 1OQDA 1UU5A 4Q8LA 4KU7A 4QU1A 3T0AA 1VMJA 4MHRA 1BBT2 3H8UA 1VBD1 4I0BA 1LEDA 4Z07A 1MQTB 3POGA 4CXYA 1QMJA 3OYWB 4GKYA 1QGLA 2EA7A 2CGPA 1WLDA 4UOJA 4EN0A 1FOD2 3UESA 4RS5C 5FQ0A 1ZBE2 3CNAA 2BOIA 2C9KA 4ZKTB 5EYYA 5M0TA 2R061 1XNTA 5EFUA 3WNOA 5BNQA 2BTVC 4H7LA 4FQZA 1QJX1 5C8CC 2DYCA 5GLTA 3ABZA 2GNMA 1AXYA 3LDRA 2XG3A 1STMA 4PHZA 4UAPA 4YVWC 5KHGA 2C24A 1JZ5A 4M0NA 2VH9A 1TME3 4CCNA 5G04L 4F3JA 4QX5A 5T54A 1XNKA 3EXUA 4K9SA 4R9CA 1YQ5A 2V4VA 2YPDA 1CPNA 3AB0A 5B4XA 4TN7A 1LHVA 4DIQA 3VUOA 3BTZA 1LOBA 3ZXGA 4XAEA 3RG0A 2DVFA 4QB6A 4XFHA 5AFBA 5ABJC 3ZYHA 4CCKA 4CP0A 4AAXA 1UXXX 3LA7A 4ISQA 4AR2A 4RSUA 5DG2A 1JZ8A 1JXNA 3R4DB 1I9RA 2TUNA 3KF3A 2C0ZA 4IV3C 3AZYA 1ND2A 2DVBA 4QPGC 3HN1A 4FOVA 4N43B 3TWIA 2HJIA 3NNGA 4Z82A 4AHZA 4S2HA 5F5CA 3ZR5A 4Z2AA 1JYTA 4YZ4A 4COZA 5EZWA 1DGWX 3IAQA 4KH9A 4HKLA 3LD8A 1WKYA 2QQWA 4BZ4A 4IGPA 3UKVA 1A8DA 2GC0A 4I30A 5F3IA 4XC9A 3FLTA 1MZEA 2RS32 1WW4A 1TME1 5D21A 1RUC1 1ZRRA 2PHDA 5DUUA 3T4HB 2ATFA 5JOXA 4LJHA 1H2KA 2OT7A 4GZ9A 4RS5B 3WF2A 2JJ6A 4P9XA 2IXCA 5K0UC 4V2WA 1DQ0A 1RHI1 3LEMA 3ZYIB 1CZVA 1N3PA 2QNKA 2PHWA 2NMNA 4L0PA 4RGGA 4B4QA 1BK1A 1UOFA 2DVAA 5C8CB 5LEJA 3OD4A 3W9AA 3E6DA 4A7ZA 2LM3A 3S57A 1W3XA 3GCWA 3HEIA 4XE9A 1QIQA 3TEXA 4A6OA 3JZVA 4ET7A 2JIGA 4HONA 1PMHX 1UZ0A 4CEWC 4IE0A 1VRH2 4KU8A 1EP0A 4BE3A 1QXPA 3N7KA 4CDXB 1UPIA 5FZDA 3QOPA 3WEZA 3POSA 4RHV2 1MEC1 2W68A 1BVVA 2D3RA 3T0BA 3KHCA 1F2NA 2VUJA 3JB4C 1UY1A 2W08A 4Q4W1 4DXZA 2VCCA 2VE1A 2R0HA 3D5OA 1TG7A 4CDUA 5JPMB 5BNOA 2EXHA 2ETEA 3GGLA 4V2VA 3WY6A 2X09A 2B39A 5AC92 2RMU2 4FVVA 2VCAA 3H9AA 2KD7A 1KRIA 4AXOA 1CJPA 1N1SA 2IXLA 1HB2A 2V72A 3I2JA 3LPGA 3OGSA 4LK7A 4RA0A 4Y1XA 3ZSMA 4X8PA 1OLMA 3JQWA 4LBQB 1AYN1 3ZVXA 4AVSA 3DPRC 5J09A 1ENXA 2C4XA 3IDCB 3AKPA 3HIFA 5GKAC 3AYEA 2XQRA 3ZO0B 2ZMNA 3ZFFB 4OHZA 3ZIXA 4PLNA 2OKXA 2VOWA 1O91A 5KHKA 1NXD1 1O8SA 4LEJA 3KSCA 4TWTA 1V0AA 3LWCA 1IS6A 5DAVA 2Q30A 4LPLA 2CSGA 1H0BA 1H4GA 5I93A 4ZHNA 4GB31 1OOPA 1QOTA 1W8UA 2WZR1 3AYCA 1JH5A 3T0DA 2D6LX 2XJTA 4FOQA 1W8TA 1WCSA 2CAUA 4Y22A 4XMAA 5C33A 1O4ZA 1V6NA 1PO21 2BGOA 5H9QA 3WT3A 2Y34A 4AVBA 5A7OA 2ET1A 2H0VA 4H14A 4EV0A 3KQRA 5C9AA 3I2OA 4AQ2A 2ENRA 4MZUA 2RS12 2JD4A 4IEXA 1F9KA 4A42A 5J36A 4CVUA 1NAEA 4AI3A 3AFKA 4QHZA 4FCAA 5DDJ2 3FLRA 1LU2A 1UL9A 1WCUA 4D6SA 1G9DA 4XQ4A 3DPRA 3JU9A 3RGBA 1K3IA 3SC7X 3PDQA 4YW3A 4UFIA 4EN6B 1R1A1 3AXDA 3X29B 1ENQA 2XWBB 3AL6A 1NLSA 5FUPA 1UD1A 1LENA 5IAXA 3VD9A 3VL8A 3PIGA 3IDBB 1GICA 2ZMKA 3IPVA 1HN0A 3MDPA 1XXNA 3KT7A 4XW3A 5T5OA 1JZ2A 4W65A 1O3SA 2FCTA 1FATA 3NAPB 2IWGB 2JE7A 3CJIC 5K9YA 4LUMA 3KV5A 1JZ7A 5DAPA 5DPNA 2ET7A 2PHFA 1OVSA 5J3UA 3PUAA 3FBYA 2ZXQA 3FWEA 3I2DA 4GB33 4HPKB 3GBGA 4IEZA 3Q8AA 4XTPA 3SKJE 3JBG1 3IKWA 4QDSA 3SXWA 1OOPB 1O59A 4D69A 2XHNA 4UW4A 4Y33A 3WW3A 4LUKA 1IQAA 5DG1A 1JZ6A 4OHVA 2C1FA 1IKPA 2VUAA 3CMGA 1MS0A 4ATFA 5BNNA 1PHMA 1U5XA 4YVSC 1YUDA 3KLSA 4P9GA 1RUG2 1SLTA 2Q4SA 3DL3A 2VOXA 1FMD2 4XAAA 1TMF2 1LNSA 1WD4A 1QJZA 1AZDA 2IVIB 2XMLA 2XWJB 2Z79A 3JD72 1W05A 3IAPA 2BWAA 4KI5M 1NA1B 3FUOA 2WZ8A 4XF1A 2WAOA 2PLV3 4QWNA 2PHUA 1O3RA 3C7FA 1DBNA 1X9PA 4A3XA 4EZ4A 1WMEA 2ZX0A 4OYUA 1H9PA 4LHKA 2NM1A 1J3RA 3H8XA 1RMU1 3ZYJB 2W1QA 4G3YC 2JE9A 4CYDA 4HN1A 1MVQA 4O65A 3SEEA 2ZGPA 1R081 1OHFA 1W2OA 1Y3TA 4BQ5A 1W2UA 2OIIA 3EB7A 3S5AA 4NIDA 1C57A 1JU3A 1SZBA 1ND2C 2ZZJA 3LA2A 2IXIA 2WO2A 2DCJA 2GP3A 3B01A 4Q4X3 5FZOA 4RGKA 4XFGA 5FYSA 3A0NA 2ARBA 4NVPA 1UCXA 4ARXA 1I1EA 1SLCA 3Q8EA 4XZUG 3IMNA 4RQPB 3JQXA 3TNQA 1NCQA 5LBCA 5CFDC 2EXIA 1UWWA 5T5PA 3T2TA 1VBE3 2HWC3 1C8M2 2VNVA 2YXSA 3MUY1 2DFCA 5IYYA 3D3AA 4PT6A 1POV3 4Q4V1 3U4SA 2VMIA 1R091 4HKOA 4LHLA 1QXJA 3MV01 4COYA 1WW6A 3LEKA 5FMCA 2VC9A 5DDJ1 3O1UA 1DYKA 2A6XA 2BQPA 1KDKA 3WD5A 1D4VB 4Y24A 4I02A 2JG9A 5A70A 3VDBA 3GM8A 3BI3A 2XOMA 4J6GA 4IUGA 3VBHB 2GDFA 5H9RA 4IQPA 3DN7A 3P3NA 5J1XA 1NCQB 1UX7A 2WO3A 3BCWA 4IV1A 4C1XA 4KGQA 3I3DA 1GOHA 4RS5A 4CP1A 2LW8A 2PMWB 2VOKA 2WKKA 3U4XA 1BEV3 5CYYA 3OOXA 4LKEA 3USUB 3CBNA 4WVMB 4GAZA 1ZBA2 4QX1A 4H3WA 5EP9A 5FMOL 3ZOIA 2HKXA 3OEAA 2ZGNA 2YPJA 2VM9A 4DFSA 2JG8C 3OCPA 3UJOA 2QDNA 2WWUA 4LT5A 4TZDA 4CDUC 2EVXA 1HRI2 1YYNA 2RV9A 3OBRA 3I2FA 1CX1A 2V4AA 2QQOA 1AX1A 3MEPA 2EIDA 1W2NA 2YFUA 4BQ2A 1ACCA 2WFF2 3PVEA 4U2AA 1TMF1 2JG8A 5CKNA 1N3OA 3B5LB 2ZACA 4HETA 4JTOA 2RMU3 1HDKA 5G05L 3WP5A 4B7EA 3I2HA 3R4UA 4MGYE 4YWAA 1J3PA 4XUNA 3ZPYA 1UW8A 3THPA 5F6KA 2NYYA 5C70A 2R072 2Q8DA 3ZXJA 3J9SA 1DZQA 3RS6A 3UV9A 1UNBA 3MIEA 5IATA 2VNGA 4CU8A 4QM9A 4NPRA 5IVJA 4P5YA 3A0KA 3H50A 3O12A 1WZXA 1URXA 2YGMA 3ACFA 1UYPA 1Y9QA 3AYDA 3KV9A 2Y64A 3RPQA 4HPKA 1HRI3 1T2XA 3OPWA 3AL5A 2H0BA 2HBTA 1RUG1 1F4AA 1C8NA 4L92A 3C3VA 1ZZ8A 2B8MA 3K2OA 1O4YA 4K1ZA 2X8KA 3A4UA 2GMPA 1JYNA 1L3JA 5DAWA 2P34A 4N7UA 5CFDA 1SQ4A 3JCIA 3OGGA 4QPGA 3ZYFA 1GYKA 2RS31 2XBO3 3POWA 1OT5A 4IV3A 1BLZA 3MGUA 1LJ7A 1OLQA 4EE2A 3RZKA 3N9PA 4MLOA 5FP4A 3RYPA 4PJYA 4NWVA 2VUDA 4XJWA 2PFWA 3EBRA 1W8FA 4QXCA 3B3QE 1ODMA 4QT6A 3VGIA 3FFZA 2K9ZA 4FFGA 1RTVA 1XYNA 4P02B 1VBB3 1GUIA 1ZZCA 1CAWB 1QU0A 1MEC3 1PM7A 3ETQA 4B29A 5C71A 5JZGB 3WQ0A 4O9EA 1B35B 1CD3G 2O0OA 3ZFGC 4DY5A 1IG3A 2J1VA 3AFGA 5FXWA 2FDKA 4W6YA 2ZEXA 4D7TA 3WNXA 4CEYB 4CRQA 2OVUA 5DUXA 3WUDA 1UY0A 1F31A 1HKDA 4Y22B 2IXJA 1SLBA 4F7ZA 2NQYA 3LE0A 4S2GA 5KC5A 5EYXA 3HJRA 1CIWA 1H1AA 1QJX3 2RS11 4ZS3A 3PU3A 3S6PA 1ND3C 4AGVA 5FYUA 3VDAA 4WZCA 4LQRA 4BLIA 2JXAA 1XC6A 1WLWA 4XQWA 2EALA 2FMYA 3B02A 5HCFA 3DGTA 4IV3B 1BMV1 3SCHA 3CU7A 2GU9A 1OH4A 3WF3A 4OHYA 1BMV2 4AEKA 4LLFA 1Z7S3 4E8DA 1BCXA 3KZ4C 1JI6A 4EN9B 3THTA 4WM7C 2V5YA 5JR2A 4K8FA 3I49A 4CDWA 2VVDA 4WVZA 5LW9A 3O1OA 1I3HA 2TBVA 3POEA 1WA4A 5FP9A 2E53A 2LS6A 3DV8A 2WNUC 1LHUA 2QQVA 2VVFA 2XL7A 5CFCB 5CG8A 3LSDA 1JYVA 4OZOA 3H42B 1U5ZA 1YRZA 2WINB 2ARAA 4ISRA 4AFCA 5A3UA 5GZEA 1ZBE1 1UOGA 1TMF3 2ZHNA 1HW5A 2JDNA 3EHKA 3EMRA 3OG2A 5D8AC 3JBG2 4CDUB 1CZSA 2HEWF 2MPFA 4GH4B 4KG8A 2W1WA 2X5IC 2L9LA 3AX4A 3THCA 1C1LA 3K48A 3VBFA 1Z0HA 1XB9A 1TZOA 2XLGA 1W8HA 4DQAA 1OPOA 1I5PA 3PL0A 2QFEA 3AC0A 3HR9A 2XGXA 3T08A 1NLRA 5E16A 5JIUA 4YM0A 4QX3A 5C7GA 3KS7A 1AR61 2W2IA 4Z92B 3O0VA 1DG6A 1O6UA 2VZVA 1ZBE3 4LK6A 4CUCA 4Y20B 3H3ZA 4LBMA 1RUC2 3WHTA 1HQNA 4CTEA 3V65A 5GLZA 4IE5A 2JB8A 1AYM2 5C3OA 4PDWA 3ZPOA 2O1QA 5D8AA 4IGQA 2QE3A 3UKNA 3S7IA 2PYTA 1FT9A 2ORZA 4N53A 4GMP0 1W03A 1O5UA 2VW1A 1CAXB 2XVGA 5JR7B 3ACGA 2OUHA 2ZMLA 4YM2A 3ES1A 1G9CA 2DBNA 3TN93 2J1RA 4B4RA 4E4HA 2KXLA 5T55A 1IS4A 1YFWA 3EJKA 4NAOA 1M06G 3SMHA 1SLIA 2R041 2P3IA 2JDUA 5IK4A 1AYN3 3O0WA 3ZYRA 4JHZA 1Q8QA 4S2FA 4CP9B 5IK8A 3B69A 4FBFA 4ARYA 4AEDB 4ZZ8A 4IESA 4AQTA 3DKQA 2VBDA 5A3TA 1IG0A 5JPNB 1K42A 1Q8SA 4DS0A 3NV4A 1DQ6A 2IXHA 4QDQA 1CAVB 4FFIA 2RS13 2YBKA 2WT1A 1E5IA 4IW3A 3NO8A 1QJU1 5LEKA 1VBC3 4INDA 5FK8A 3NV2A 1ULDA 1QJY2 3ZR6A 1OD3A 2K2SA 5A3OA 5C3RA 5FRAA 5A7NA 5JI9A 5FV3A 2JDHA 3RZMA 5JOZA 1AR83 2A73B 2ZTNA 1K5JA 3GBFA 2HYXA 4R9BA 5JXGA 4OI2A 4W6WA 1UMZA 3PJYA 3LIHA 2CWSA 1W6MA 1ZBA1 1R64A 1AUYA 4MYEA 1PO13 4ZXEA 4UFKA 1PMJX 4NN0A 2A7AA 4CDXC 5FZ7A 1QJU3 1REFA 3LFMA 5FZ4A 2ZS6B 4BQ3A 4QKBA 3L2HA 1J1TA 1JTZX 2P3JA 1IS5A 1X8EA 3DXUA 1JYIA 3HNMA 1PIV1 1W9TA 2QBXA 3OYWA 3OPZA 2WQ4A 4YW5A 5FXVA 4FO9A 3RMXA 2D6MA 4AQSA 3DUIA 3BB6A 1UYXA 3PUHA 3HQUA 2A71A 1JU4A 3RMYA 1T6BX 1V70A 5FFOC 4WV8A 1AXKA 2YG0A 3SCFA 2VY0A 4CPBA 2E31A 2YC0A 5HCAA 1V9U2 1CGPA 1UIKA 3N35A 1C8M1 5FMDA 4CUAA 2W91A 3IM0A 4FP2A 1UY3A 1QXRA 3ZMNA 2W87A 1E5HA 3Q8CA 4GMP3 3ZFEC 5JSOA 2XLAA 3M8LA 4AGGA 4RFT0 2PHLA 4LO7A 1MZ5A 3KM5A 1ZZBA 5CKQA 5FY9A 3U11A 1DQ2A 3OF1A 1SMVA 5F2SA 3TRSB 3QBQA 1HRV3 2KR2A 3RI8A 4QX0A 1YQ8A 1CAWA 1KD7A 2E6VA 1RXFA 5GLUA 1WBFA 4M4PA 4I01A 3VD7A 4JRAA 1RUOA 1DLCA 5ABJA 4YFWA 4M00A 1NY72 1XJAA 4KMQA 2N7GA 5IWFA 1RC6A 5ANNA 1HB4A 2Q1ZB 1X7NA 4XABA 4I0AA 1E5SA 1XU2A 2VG9A 5D2AA 3NVCA 1A78A 1VPHA 4OZXA 4QD2A 4QQPA 2VMEA 1AR82 1KS5A 3MW3A 2PXJA 4RGAA 5BNPB 2CYFA 4HZFA 4BMBA 1CR7A 4DPNA 1RHI2 3SH5A 1J58A 2W3JA 4BQ1A 2OUJA 1AJKA 3JB8A 1QHDA 3VBRB 4MXVA 1Q3EA 1W8OA 2RDRA 2BW8A 2UWCA 3BTXA 2DV9A 4OQ8A 1LAJA 2PHTA 5FKBA 5I8YA 4ZZ5A 1NZCA 4LTAA 1COV3 1JUIA 1LGNA 3KB5A 5IW0A 4OMDA 1KEXA 1RUE2 3U75A 1GLHA 4CCMA 5I91A 2V73A 1OA4A 3E5QA 1WW5A 2P37A 2FDHA 1Q5OA 3O1TA 5ANQA 1C3HA 1RMU2 5T52A 1S0EA 1ULFA 4LIUA 2G9ZA 2HWD3 1YFUA 4AEDC 2WAAA 1HX6A 1NT0A 1W2AX 1WWYA 2HWC1 3U10A 4ASLA 4TXWA 4YARA 2WQ8A 4CDWB 1AL21 4LKFA 3HOBA 5C4WC 3O1MA 2Q8CA 2E33A 5IAVA 3I3QA 2VQAA 3MLJA 1KS4A 1CONA 3JD71 2O8OA 2W5FA 3N9MA 4L11A 2YBSA 4JTNA 1HQLA 1H8TA 5FJHA 5FOBB 5JMOA 3HNBM 4Q2FA 4LO5B 3WUCA 2Y6JA 1OC1A 4P9LA 1HB1A 1FYUA 2HWF2 3M3CA 3GHMA 2QVSB 4UW6A 4YSFA 2XJPA 4DRVA 1FXZA 2VZSA 1X36A 2IVJA 3ZIWA 5BNPA 1XQNA 1BEV1 2VO5A 4E2GA 1QNYA 3VL9A 5BNOB 1AR92 1AL23 2QJVA 1AR93 5CIRA 4P9YA 3VBOB 2LROA 3BTYA 1D2QA 4IEWA 1TNRA 4ES9A 3IMMA 4CEYA 2MHFA 1Y9MA 1FOD1 4M3CA 4UW3A 5FZ1A 4QB1A 2GH2A 1US3A 4XMIA 3V56A 5F3GA 1WUVA 3B94A 2WLPA 2XKOA 3LZZA 1WMDA 3RWNA 2YDEA 2WZR2 1SBEA 4WVMA 1IOAA 2OQ6A 1W6NA 5ACA3 1D7PM 3ZN4A 1ASJ2 2RDSA 1LCLA 3AP6A 1QNWA 1UKRA 2XBO2 3J7LA 3LGRA 4QQ2A 3A22A 4BH9A 1XSQA 2Y0IA 4KG0A 5GLVA 4GWMA 4JQRA 5AVAA 1K45A 2WS93 1YIFA 3MUZ1 4J25A 1UQXA 1W28A 3CJXA 3RRDA 2VVEA 1TVGA 2ZGRA 2WABA 5FYIA 5HV4A 5JXJA 1HRI1 3A23A 1GANA 3A7QA 4GH4C 3ETPA 3PNAA 3OUIA 5FY5A 4GULA 4RR3B 2BNMA 3TN91 1V6MA 1QH6A 4QXHA 1J84A 2JEMA 2QQMA 1VBD3 2B9VA 4PIYA 3IDAA 4Q4Y2 3VBUC 4A45A 4MV2A 3ROUA 2QQUA 2PQSA 4TLFA 3RJ2X 1VMHA 5LB6A 5FYYA 1YFYA 1ZRFA 2WJSA 5FUNA 5A3MA 1VBB2 2LALA 1PO11 1BKZA 1LOCA 4OUMA 3JXSA 1S2EA 4JAAA 3ZFGB 4DY3A 3KD4A 1DQ1A 3BIWE 2RS51 1UIJA 2CU5A 4AHYA 1RVF1 3WDWA 5CFCA 4OHXA 5FWEA 5A80A 2HBUA 1DGLA 4FPJA 5K8SA 3RZLA 1WGPA 4Q27A 3FHQA 1EAH1 1FPN2 5F39A 1HB3A 3BU0A 2YGLA 2VULA 1NA1A 5D1IA 4EJRA 2C9AA 4NRMA 4BB3A 1FI2A 2YC4A 2AGSA 1ZX5A 2D93A 3KCXA 4QU2A 1X8MA 4B8EA 4XUQA 5FO9B 2E9QA 2XJRA 5JZGC 2WZPP 2Q8EA 2A3YA 2DUQA 4MGZE 4PI0A 2BGPA 3ITQA 4I09A 4HXCA 3ZMOA 4CCJA 1Q56A 2VTXA 1VMFA 1XE0A 3WF4A 1AYN2 4OMCA 1HRV2 5FPXA 2GMEA 5J96B 4JVAA 5APAA 4XFFA 4B1MA 3K46A 1CWPA 2A70A 1KGYA 2ZBJA 4NMIA 1YQ2A 4PDWC 5FPAA 1SPPB 4OULA 5BNNB 4D94A 1X33A 1GV9A 5CISA 1U5IA 4NIGA 5LBFA 2Y6KA 2GC2A 2TNFA 2VNRA 4LHSA 5DZEA 3WQ7A 5KXCA 1W9FA 2XKPA 1RUH3 2J22A 4Q4W2 4NIAA 2D97A 3MIGA 3GBWA 3NNLA 4J1XA 1LR5A 2AREA 1O7FA 2QDRA 4HL0A 4P9JA 3BODA 3ST7A 5FZ9A 3WNNA 2ERFA 5FZEA 3DPRB 2BWCA 3ON7A 1X82A 4AEJA 3E6CC 2DVDA 1WLTA 1POV0 3FZ3A 3J8F1 4MSVA 1WCDJ 3NWKA 5LK7B 2J1UA 4M0HA 4PF5A 1RUNA 1CPMA 2E26A 5EJ3A 5C5TA 5CFDB 3AP7A 4N9HA 4Y20A 3N7LA 1RJ7A 2BBVA 4Z2WA 3TBDA 2VTFA 1R092 1XE7A 4D6QA 3N9OA 4N8MA 5FZAA 3J7MA 3NNJA 4IEYA 2CWMA 2ZX1A 3FN9A 5LK5A 5FMBA 1AX2A 3VDDC 1NE4A 1V6IA 1PVC3 1FX5A 3MYXA 1H8VA 2P2KA 4RFRB 2IXKA 4XURA 3LEGA 3WG3A 1U5YA 3I3EA 1FAYA 1BBT1 5FZBA 3ZXAC 4OQ9A 1B35C 1SG3A 1LGCA 4YM3A 1O8PA 3CLPA 4V1PA 4FFFA 3U0ZA 1J1LA 1S0FA 5DN2A 3W20A 5JUVA 3LAGA 2ARCA 2ZPXA 1SLAA 1C8M3 1DDLA 2JG8B 1NOVA 1PK6C 1GP5A 1MS1A 3PVNA 3USSA 1MR5A 3MW4A 3B00A 2JDPA 2WFF1 4M01A 1YJLA 2W47A 1VP6A 3WF1A 1QDOA 3VLBB 1RVF3 2E7AA 3ZFGA 5BYNA 4QKDA 3ZSEA 2WYSA 1Q8VA 4DXSA 1B09A 1AVBA 1TEIA 3R0RA 1GOGA 1PGSA 1W0NA 4GA9A 1VIWB 4AHWA 4CDQA 4OI0A 1RUD1 3FC0A 1EV11 4ES8A 2RVAA 4R52A 2D6OX 2FDIA 1NA1C 2WSVA 4COWA 1XPWA 3VHRA 5EIYB 2QZ3A 4UXAA 1KJLA 3GJBA 3M70A 5FYCA 4URAA 2AEYA 2WNOA 4PBOA 5KHJA 4RYDA 4QGNA 2V5DA 4BCUA 3RYRA 5I8SA 1D4M1 2JDZA 3M2MA 2VZ3A 2HH9A 5A7SA 2VZTA 4W6XA 1S55A 1RUI3 4DO0A 2DCZA 2ZX2A 1KXGA 3MV11 3RZZA 5DZGA 3ZM8A 2J1AA 2WQZC 1Q8PA 1GKBA 2IC1A 2RJ2A 3L9JT 4NHKA 4ZONA 3VDDB 3K3NA 1HV0A 4OLLA 3LKJA 4Y5Z0 4BXSV 1AR62 4YVWA 4QGMA 3N9QA 5FO8B 3BOWA 1K5MC 1XE8A 5C8CA 3ELNA 3JBG3 3RNSA 4YW2A 3ILRA 1WMXA 1YI9A 1QOOA 4BLJA 4YVSB 2GNTA 4FXGB 5FLHA 1HQWA 1OFNA 1W39A 2YYOA 4LBNA 5L7OC 4XVHA 4YZ2A 1RUF1 1SPPA 4BQ4A 2AACA 1VAVA 2C6SA 1ZRIA 3E97A 3HAGA 3CDZB 4C1WA 4YLZA 1G7YA 1A8MA 5T5LA 3TB0A 4JGZB 1PVC1 4A4AA 4HG6B 3ZSKA 2ZJCA 3FHAA 2P4EA 2HWB2 2Y6HA 3WG1A 4H55A 4AL9A 1UF2C 3DYPA 4NE9A 3ZYBA 5A3NA 4QDRA 3SH4A 1LKNA 2IUWA 3AP9A 3WNKA 1NQDA 2ZAAA 5C3SA 4X6RB 4D7SA 2ZA9A 3MZHA 5CU1A 3WP6A 2HEVF 4ASKA 4B4PA 1AF9A 3RZJA 2BBAA 4QKFA 3RFRA 3KQ4B 4Y1ZA 5T50A 2YB7A 4LBQA 5BUVA 3J7HA 5DAXA 1HXS1 4CPBD 1DHKB 2UURA 4O61A 3OY8A 2FCVA 3GZUC 3DYOA 4HK8A 5FREA 3SCGA 4EWAA 4TTGA 2BGCA 5C3QA 2ZKNA 4IV1C 3BPZA 5HBAA 4UI9L 1L7RA 2EXKA 2VBBA 1O3QA 3U78A 4CE8A 2JDAA 2ZABA 2HWD2 4NO4A 1N1TA 5HI0A 3IDEA 2JG9C 4RL7A 1UXZA 4FQ4A 4HVOA 2AUYA 2EAAA 1P8JA 3WDVA 1SBFA 4YG3A 5DDJ3 3P6BA 3P5BA 3OB8A 3WV6A 3AJYA 2ZGQA 2RE9A 2G9FA 4CZSA 2GNDA 1VBA2 4E2SA 2RJLA 3K4ZA 3MFAA 1NCQC 3WG2A 5A32A 4XIKA 3K4DA 4XXPA 2A3XA 3FHIB 3B93A 1PGL2 5FZMA 4MG2A 5L19A 4BM8A 5CZKA 5CVRA 2TEPA 2QQJA 4KGGA 5BV6A 4JQTA 4P14A 2QKDA 5KHIA 5CKMA 5F8PA 3WP3A 2FCUA 4YNIA 5FYHA 3EQEA 2EAKA 1RUI1 4DZGA 1LECA 4A3ZA 2VUCA 2CGNA 2W1UA 3M3OA 5AVPA 4AGRA 4P5HA 1S0BA 1UKGA 4XDOA 1AYM1 5JSPA 2I2SA 1IHMA 4BISA 2DBIA 2WT2A 3PMSA 3OBZA 4QKNA 4QPIA 4UF0A 4A7YA 5E89A 4AVTA 1OKOA 4C8DA 1NZIA 3B9IA 3I97A 2LUWA 5JIAA 3OJBA 3THDA 4GKXA 4XFBA 4FAHA 4L2NA 4FPHA 2P5BA 5BNNC 2AENA 1MPXA 1RUF3 3KV6A 3URFA 4G4FA 4A44A 3WNLA 2V09A 1AL22 1IGOA 1EPZA 5EWSA 3H3LA 1POV1 4Q4V3 3ZSJA 2BV4A 3WNPA 2DVGA 1UOJA 2FDJA 1YCIA 3I8TA 4WM8C 3SITA 2VW0A 1REDA 5GZFA 1SHWB 5FP8A 1FOD3 2WT0A 3IB3A 3MI8A 4LNVA 2DF7A 1NCRA 3MHZA 4B1LA 3VBRC 2J1EA 5ACA2 1S2KA 2YU1A 1QJFA 3VKFC 5CADA 5A33A 4JGZC 3FLPA 3NAPC 4YW6A 4YW1A 4MX3A 3MIFA 4CP2A 3M3QA 2AZ5A 4A7KA 5FPLA 3EO6A 2YZ4A 2EF6A 4RHV1 2B4KA 1ULOA 1RUD3 4XJZA 2PAMA 5IVBA 5LRSA 4FAGA 4RR3A 3CL1A 4X8NA 1VR3A 2WNVA 2WUHA 2W9XA 1XU1A 1AR73 1N47A 1QDCA 4L8QA 2ZGLA 4J1WA 1GZWA 2Q5TA 4UBHA 5F32A 3VV1A 4QXKA 1U12A 2VQ0A 3M7AA 4KWUA 3VD3A 5C6CA 2DWRA 3MPBA 1H4HA 2CV6A 1JBCA 3VZNA 4JHTA 3PMEA 1PK6A 3WW2A 4C0BA 2F6BA 1RUJ3 1J3QA 4NAMA 1W6NB 4QHOA 4DEQA 4LKDA 1I6XA 1LOFC 2UY9A 4CUBA 3TEYA 4LLOA 1G6NA 5EXOA 3ZFFC 4XJ9A 4IETA 1VB4A 2E63A 2W95A 3S30A 3R4SA 4YG6A 5F7UA 1GQPA 4IL7A 1C28A 4N53B 1BXHA 3I7DA 4GB32 4UFMA 5EPAA 1BBT3 3GF6A 3DECA 4JZRA 4D7YA 4DRRA 1Q43A 2R6QA 4BK4A 5FZLA 4MGKE 1ZRCA 1CJDA 2EIGA 1RHI3 2UY8A 4E27A 2OS2A 4FPYA 2W92A 4NPMA 2D6PA 5A7WB 3VBSA 1OXCA 4YGEA 1RIRA 4AF9A 1APNA 1ONAA 1NUKA 3HVDA 4P9IA 2R042 3M1HA 4AHXA 1GQHA 2A6WA 2Y6GA 2X5IB 1V6OA 3NSTA 4GWIA 3U07A 2CNAA 5CA6A 1OPMA 1S0CA 5FZCA 3P1IA 3ACIA 5BY5A 3H1YA 4Q4W3 2DTWA 3NV3A 4AOCA 1BJQA 2ORXA 1H2MA 1W6PA 2JB4A 2JIJA 1OFSA 2QUOA 2YHJA 2XJSA 2XH6A 3K4AA 3TEZA 3S5QA 1VRH1 1EV12 3D6EA 4Q26A 3BKZA 2J7MA 4EWDA 1RUE1 3NQHA 2ZX4A 4QQHA 5CNAA 3QD6A 2X5IA 3KCCA 3WDYA 5FCCA 1US2A 1MQTC 5LBBA 4R8HA 2VZQA 3AP5A 4GJYA 4FPEA 5FY0A 1UOBA 2VOVA 2D43A 3VBRA 3W58A 3F2ZA 5JDBA 1UZWA 4FOYA 1YQCA 2B46X 2GAUA 2WDBA 4E2QA 1VRBA 1N1YA 4ITCA 3RQ0A 1S0DA 3POJA 3DEMA 2XONA 5FYVA 3VHNA 4NPLA 1WMFA 4BQYA 2LTNA 4WZFA 4ZY9A 1QY4A 3ZN6A 1ULPA 1JOPA 2Y6LA 4FPOB 1MS5A 4O7XA 2F17A 1GR3A 1VBC2 3G7DA 4Q29A 3AVRA 3BPSA 4I3PA 4MGQA 3VBOA 1S4CA 2YV8A 5E88A 1PZ8A 2XQXA 1DZRA 1OF4A 2WNUB 2BERA 1AX0A 3GXUA 5H9SA 5CFCC 5L36A 1R083 1YQ6A 1W6OB 3WSOA 1R082 4CU6A 1KQRA 4R4ZA 1XOYA 1QJEA 4JGYC 2GH8A 4OI4A 5D8AB 1E5RA 1Z78A 4CDQB 4AI2A 4PQ9A 5F5AA 4QPGB 3KMHA 4WVWA 4XILA 2RR12 5FIXA 3POBA 3CQOA 3KGLA 3QCWA 1ST8A 2WFF3 1RB8G 4XUOA 2I45A 1LOGA 5FZ0A 1ZZ6A 5FY8A 2OW4A 1JS9A 1OQEA 4JGYA 2FMDA 4TLGA 2ZCWA 3TOJA 2Q1FA 3AMHA 1QQP1 1ZYBA 4C91A 3PHMA 4GQ7A 3AYAA 3ZFEB 3T09A 1GBGA 4NHLA 1K5MB 1DU3D 1YEWA 2G9GA 2ZKLA 4ZPIA 5FBJA 1WBLA 3UGFA 4E4DX 5CBLA 3V0AB 2CY6A 1XNAA 4MGIE 3RDIA 4XF4A 3ZLIA 4Q4Y1 1C1FA 2JENA 3U1XA 4YZ1A 2C5DA 3NL1A 2R0FA 5FPVA 3MF6A 2YBPA 2YU2A 1W3VA 5FYZA 4EN7B 1OA2A 4ZU7A 2PTMA 4JDOA 3T1LA 2HWD1 3MW2A 4XHBA 1RUD2 4EYUA 1PO12 4NRPA 3NJYA 5LATA 1HJFA 3HNYM 4CXWA 4FTEA 4LBQD 4META 3FL7A 1WW7A 3PIJA 3KCYA 3AMPA 4Q5OA 4Y3OA 2NZ9A 5FZKA 5LRRA 1GNHA 1SCSA 1IPKA 1VAKA 4LO8A 5ERLA 4JKLA 1IPJA 1CAVA 1YXWA 1RGSA 3BVCA 5B4NA 3NJVA 4LE4A 3OUHA 4AAPA 2XB6C 3QACA 1GZCA 3H7YA 1XNDA 5ABJB 2W94A 4KWKA 2VZPA 4FP3A 1A6CA 3C7EA 4BA6A 1MS9A 5JCTA 2OPKA 2PELA 5A3WA 1UU6A 1UY4A 1ULGA 3ACLA 4LBJA 2WN3A 4IEOA 4JV4A 2D3SA 2BVVA 2HLEA 1DZTA 1BYHA 1GQGA 1ND3B 3ZN6B 3PTRB 1LTEA 1GSLA 1JHJA 1OH3A 1JZ4A 1BK0A 4ZU5A 1CX4A 2BVBA 1S0JA 2WNEA 3PVBB 4PI2A 4Q0QA 1PNGA 4BXFA 1ASJ3 3SQOA 2ZAHA 3VZLA 5KR7A 5L7OA 1H2NA 4XXAA 3FX3A 2VAUA 1OUSA 3HBKA 3GYDA 1LHNA 4HT1T 5GALA 4AVVA 2WO1A 3TNPB 2RM23 1PIV2 5HV0A 2LRPA 2YY1A 4D3WA 4Q1PA 4G9SB 4LBLA 2VZUA 1QJX2 2PHXA 4OVEA 2RR11 3OTFA 4QAWA 4LIVA 4CCDA 3NMBA 5FPBA 5I8TA 1GMMA 4N90A 4UFLA 3AVSA 3MF9A 2WC2A 1H9WA 3ZKUA 5ISLA 5F2WA 3J8F2 5IK7A 4N9IA 1HXS3 1IPSA 2CL2A 4Q4V2 2PA7A 1BQPA 3PLQA 1DYOA 3S0MA 3E1F1 4S2DA 1N3QA 5FLIA 2AEZA 1XNCA 1RL3A 3CEWA 4PF1A 4LA2A 4UW5A 1JOBA 3LFIA 2I07B 1RUF2 4YW4A 1ZVFA 4COUA 4BQXA 2I74A 4YGCA 2YROA 4Q1RA 1QF3A 1W6PB 3M4FA 1CN1A 3OY8B 4AYUA 1PGW1 2G19A 3I3BA 1R1A2 2ZGMA 2W1SA 3LDKA 2WIIB 1DIWA 2KA3A 1PVC2 3GZTB 5GZGA 5JSRA 5A3PA 4LBOA 3VBSB 2UWAA 4WVVA 4FPFA 2ZGSA 2ZGKA 4XQDA 1H6YA 2FBEA 2HYKA 1UY2A 1YFXA 3HBZA 3KT4A 5FPUA 1Z7S1 3T2OA 2OYZA 2BEOA 1ZM1A 4AVAA 2B42B 2ID4A 3BGAA 3PVOA 4JGZA 5L73A 1KDMA 1DGWA 1SACA 3FJSA 3OD0A 4GWJA 2VZRA 3MIHA 1YLLA 3I4IA 1GP6A 1L7LA 1R093 2WA4A 1H2LA 2BRTA 5IJRA 4C90A 5FY1A 1PZ7A 4BU2A 2ADDA 4AI8A 4XFAA 3MBWA 3GJAA 1ZRDA 4AK3A 1VBE1 4LE3A 1A3KA 1B35A 2R7EB 5FKCA 4AFDA 4IV1B 5LY2A 3MLLA 3HN3A 2XVKA 3JUUA 1F5JA 1H6XA 5FZHA 4ZXKA 1CAUA 5KXDA 2SBAA 4XIOA 3N4MA 4LKSA 2XUMA 4JDMA 1F8VA 5DXDA 1G9AA 1H30A 1D4M2 1VAMA 2JG9B 3N9LA 4NHXA 1MEC2 1PK6B 4AG4A 1FNZA 1KFUL 4L9BA 2WR9A 1EAH2 1RUH2 2VNOA 1MS4A 1H8TB 3WLUA 4ZU4A 4K6BA 1GZWB 2BP6A 5C5UA 3RJRA 4QMAA 1FMD1 5CEHA 1W6QA 4RQPA 3O1VA 3O14A 2ZEYA 5EHDA 3T2PA 2BOJA 5GZDA 2H6CA 1PO23 2JKXA 3SKVA 3LEIA 2MNGA 3VBFB 4SBVA 4B7KA 4W50A 3CF6E 5KBFA 4MADA 4DUVA 4RHV3 1JMUB 1W8NA 2Q1MA 4UWDA 5FYBA 2RR13 4LITA 4Y4RA 1R1ZA 3WR0A 2R043 3U37A 1T6GC 4AI9A 1CVNA 2VQUA 5C9AC 5IHRA 3N9NA 5LA0A 5L9RA 4Z8BA 4CSWA 2FZ2A 2R49A 5C8WA 5IK5A 3TEWA 1S2BA 3ZFFA 4MO3M 2ARXA 4HBNA 4QB2A 3ZXFA 4Z1VA 2ADEA 3AKRA 3WVJA 2W0XA 2HWE1 4OUSA 5A7QA 5IVVA 5F9TA 4XF3A 1O5LA 4ORFA 4AQ6A 4NJ4A 3ZN5A 2X53S 2W39A 1W8ZA 5I0SA 3AXEA 4IGOA 5HPOA 3UETA 1XNBA 2PN5A 1UN1A 3SLIA 2R16A 3UNPA 1JZ3A 3K77A 3OGRA 3QH6A 4Y1VA 2WNVC 4YG0A 1I5ZA 2AC1A 2BNNA 3INAA 3J8F3 3ME2A 4MH0E 4RR3C 3LSEA 5DAQA 1RUJ1 2HWB3 2A5ZA 3KWVA 4NHMA 2JICA 4QQLA 2Z69A 1LHOA 1KITA 1RYYA 1RUJ2 4FOWA 2UWBA 2GP5A 1AR63 2VTXJ 3H0OA 3GDBA 1DLLA 4KQ7A 1PZ9A 1W0OA 2GN3A 4QX7A 4CU9A 1O4TA 3IIAA 4E4ZA 1ZZ7A 3DYMA 3NAPA 1E57A 5B2GB 5K7PA 1OLME 1RMU3 3O1PA 3FE5A 1GP4A 3A21A 2WO7A 1VBD2 5E1RA 2WRAA 2RHPA 4UFHA 3G6JB 5FZIA 2PLV2 3VBHA 1NCRC 3VD5A 3W5NA 1M4WA 4XTMA 4O9GA 5T5JA 4EQVA 4EN8B 5LA1A 2PLV1 3UGGA 2ZEZA 4AWDA 1OKQA 3O7OA 4QPYA 5A32B 3I3MA 1Z7S2 3SEPA 2JE8A 2WZR3 5IUQA 4HANA 5C4WB 3VBUA 4AFMA 4BYYA 4QQOA 4WM7A 1BZWA 2VECA 4F8AA 4JDNA 2Y6FA 4BOWA 4CEWA 3MICA 2ZOEB 4LOSA 4EZHA 3RZGA 2CTVA 4IEUA 2R32A 5DABA 2CDPA 2GZWA 4KL1A 2ZGTA 3ZX7A 1S0GA 2X05A 4EROA 3ATGA 2F4LA 1RUG3 2Y60A 2BJSA 3ASIA 2CHHA 1DGRA 2RM21 2WFPA 2Y38A 5KC6A 1JN2P 3B9CA 2MEV3 4KBBA 4BIOA 1QWRA 1UZYA 4HMZA 2XDVA 2W46A 2JWPA 3Q8BA 4GIQA 1POQA 4QPIC 4YYOA 4L97A 5HCHA 1NLQA 4YM1A 1D2SA 1XSRA 2WLQA 4R9DA 2GN7A 4HVRA 4CXXA 3W21A 1PMIA 5K0UB 3OGVA 2J1SA 3ZXKA 5J48A 4MOAA 2A3WA 2D7FA 4LMFA 4RD7A 4D8MA 3RYKA 1VLNA 4BQWA 1K12A 3VBHC 5FP7A 3ZXLA 4IDZA 1SEFA 4XHXA 1S1AA 3T3YA 2OZJA 3IZOA 3E5UA 4DXRA 1VBB1 5FMOS 4YW7A 4K3UA 4URTA 3CJIB 4P00B 2VMCA 4HFSA 2FZ1A 2Y26A 5FZ6A 1AR81 4UT5A 3VBOC 3RZHA 2ES3A 5H9PA 3T4VA 1TME2 3CKHA 1CZTA 4K8RB 3W59A 4NOTA 3WCSA 1QKQA 3WOGA 1VJ2A 1OBNA 2FD8A 2IZWA 3J7NA 4MGSA 4CP9A 1RXGA 2WS91 4D6RA 4CUGA 3OEBA 2MEV1 4CDQC 3UK9A 1VALA 3LOBA 1UX6A 2ZZQA 1UMHA 2WWSA 1OI6A 1QJY1 4XEZA 4XUTA 2XPJA 4DINB 4ASMB 1QJU2 1UPSA 3KHBA 1TQ5A 2WYFA 1DCSA 5HXMA 4QGLA 5GLWA 4HN0A 4E9KA 4Y5SA 4K21A 1AXZA 4HSLA 1YO8A 4Y4YA 1TE1B 3IPVB 4YPJA 4N7IA 2UU8A 2BNOA 2G4IA 5FZGA 1YJKA 1BHGA 4XZPA 2JD9A 2SLIA 1AJOA 2DUOA 2WN2A 3HD8B
chains in the Genus database with same CATH topology
4HLTA 4H7MA 3D82A 3NKGA 3VBUB 3WDUA 3AMQA 4LBKA 1YIPA 1QJY3 1OLRA 2Y0OA 3AMMA 3ILFA 2R1DA 2RMU1 5GJ6A 4NR1A 5I0TA 1VRH3 3E6BA 3VDDA 1DQ5A 3VZMA 1LULA 3VKNA 1FV2A 5CG9A 2UYAA 3AZXA 3VKOA 1QQP2 3AP4A 1YHFA 1BEV2 1VBA3 1C5HA 3MIDA 5J7MA 2B9UA 1NCRB 4MVTA 2DCYA 1HLCA 1LU1A 3V0BB 4PIZA 2EXJA 3TN92 5FLJA 3VZKA 3PJQA 1ENRA 3HT1A 3TYJA 4HSJA 3VZOA 4JC1A 3BALA 5I0UA 3I54A 1GNZA 4IERA 4N43C 5FBZA 1V9U3 3AKSA 1V6JA 2DURA 1RUH1 2RS33 2CGOA 2XBO1 2ZX3A 1PGL1 1RUC3 3H7JA 2XVLA 1COV1 3POYA 3SH3A 2R30A 5IT6A 1LOFA 1SFYA 3OBTA 1Y7BA 2NLRA 2GMMA 4SLIA 3ALQA 3D0JA 3IWZA 2BUKA 2AR6A 5I0RA 3MLKA 2JKBA 1FPN1 1PIV3 2BFUL 3AKQA 3P3PA 1AHSA 3AK0A 5AC93 3AKTA 2E51A 4GALA 3AMNA 1S0IA 3OGJA 5JZGA 2H6BA 2PQQA 4CDXA 2UYBA 3FBMA 4OHWA 3GHNA 4Q4X1 4WM8B 3R6SA 4HKWA 1HRV1 4WM7B 4Q0UA 4DB5A 4BMEA 4JCKA 1ULEA 3IBMA 3VHOA 3ZSLA 1AYM3 4XJUA 3LCPA 5E8AA 1R1A3 4BWOA 1TNFA 3ZYPA 2DU1A 3HQXA 4PLMA 4K40A 1W6OA 4I0WB 4DOUA 3SHRA 2D40A 5KHHA 2MEV2 4KNCA 4WM8A 4ATEA 4U36A 1CAUB 5F1RA 1MVEA 2Q0AA 1HV1A 4FSJA 1Q8OA 5AC91 5FO7B 4Q8KA 2AH2A 5ACA1 4IXLA 4TSVA 3D8CA 4N43A 2Q8OA 4COVA 1UZZA 3DF0A 4K1YA 3MFCA 2DU0A 5DZFA 2P3KA 2ZHKA 2HWE3 3GNEA 3CJIA 3I59A 5FDBA 4LR4A 1CESA 4LO4B 1X50A 1ZZ9A 5FAXA 3UKTA 5J37A 5JLVA 2DTYA 1D0HA 4N53C 1VBA1 1VB2A 2A6YA 1LESA 2HWF3 4M3CF 1ASJ1 5AFEA 4X6QB 5F6LB 3VKMA 2XJUA 3WG4A 1JOJA 4PBPA 1MZFA 4CEYC 2VMGA 1PO22 1NY71 2NPIA 4K20A 1G9FA 3ILNA 1ZA4A 1GZ9A 2ILMA 4FPCA 2GNBA 1PVXA 3V0BA 4QM8A 5DUWA 1F5FA 5EV7A 1QOSA 2OZ6A 3VN4A 1NYWA 1FMD3 4MUVA 1EYBA 2IFWA 3HMYA 2Z42A 4Q0VA 4XJ8A 2VW2A 1H8TC 4TYSA 1V6LA 1Y43B 2Z2SB 1LB2A 1J59A 1EY2A 5C4WA 4BIFA 5GZCA 4YVWB 4HK9A 2R071 1XYPA 5SV5A 2B7YA 4AEDA 1O3TA 1LHWA 5L7OB 3N3HA 3J26N 1H1MA 3VZJA 4R9AA 3MPPG 4XYXA 2RJKA 4XF9A 5CAZA 2A6VA 2ZHMA 1BVP1 4LULA 4I2OA 5BXXA 3N7JA 1ND3A 2QCSB 4M3CB 3FMGA 3L2YA 4Y26A 1MZ6A 1WCKA 4E4SA 3J4UH 1ZNPA 4WBBA 2R1BA 4XF0A 1W0PA 1NG0A 4AW7A 2NP0A 5F5QA 1NXMA 2GSYA 1D4M3 1JW6A 4XJAA 3ECQA 2WNVB 4GMP1 2A6ZA 3BTAA 4Q0SA 5KXEA 3GALA 1DGRN 1KJRA 3NJZA 4AE2A 1CQ9A 2ZHLA 1JYCA 4FT8A 1IZ3A 2NN8A 4XBLA 3SNMA 3D4KA 4M3CE 3M3EA 5K0UA 3QLQA 5FQ0B 2B45X 3WZ1A 1V6KA 4Q4Y3 1K5MA 5JAXA 5JVVA 3ZFEA 2R063 2KM2A 3BU7A 3ZXEA 3ZXDA 3DKWA 3APBA 4FTSA 4L99A 1LEMA 2PAKA 4B3NA 3AZVA 1NE6A 2JX9A 3C2UA 4UBGA 3UL2A 1OA3A 4A2UA 3ES4A 2D5FA 1U0AA 2WSUA 2YUEA 1MQTA 3SISA 2D98A 3ZYGA 3NKTA 4XETA 4YGBA 2XLFA 4AFBA 4CEWB 1DYPA 3H1MA 1LODA 3K51A 2O8QA 3WHUA 1UAIA 1ZBA3 2HEYF 4IEPA 4YFZA 1REEA 1YWKA 1LOEA 4QPIB 1OMIA 2PAEA 3WP4A 2B5HA 3JD73 5C9AB 1C4RA 1WD3A 3LA3A 5JMCA 1HXS2 1NQJA 2WA3A 2W52A 4KWJA 3NW4A 3Q9OA 3R05A 1MACA 4XPVA 3VBSC 2XJQA 4Q4X2 2BFUS 3WX5A 1VBE2 1LGBA 1RUI2 4MXWB 3N36A 1DQ4A 3MIBA 2FQPA 4PIXA 4DNYA 1N1VA 1YI7A 4K7JA 2Z5WA 1RVF2 1FV3A 4P9WA 2VXRA 4PCRA 2D6KA 4XBQA 4XFCA 2HWC2 2DUPA 3IT8A 4XOGA 1D0GA 2F4PA 1XRUA 3CO2A 3RSJA 1KFXL 4RQPC 2ZGOA 1HIXA 2DCTA 1COV2 2RM22 4LO6B 2XHKA 4FXKB 2XJVA 1V00A 2FHRA 1G86A 1VBC1 1W6MB 3V0AA 1WLCA 4KWLA 5HXVA 1OSGA 3KGZA 5FOJB 4AFAA 3WXPA 3I59B 3AM2A 1OD5A 1JUHA 4XFIA 2VMHA 3E5XA 3H1WA 1G8WA 1H1IA 3LOIA 4AI0A 2GALA 1W6QB 2VU9A 1AR72 3VKLA 2D6NA 3HWJA 2IFRA 3LB9A 2HWE2 4MXWA 4IEQA 3ZDSA 1PNFA 3N7MA 1QH7A 5KXBA 3S7EA 4AEMA 3NV1A 4XBNA 4EWEA 4Y1UA 2WNUA 2WL1A 4GWNA 2X29A 4HVQA 3USUA 1CAXA 1SFNA 5HCBA 4CDWC 2VGDA 4Y1YA 3ENRA 1G9BA 1FNYA 2R062 4YRDA 4YVSA 1RJ8A 5JOWA 2AYHA 4PDWB 2BPA2 4FPGA 4OFGA 1QQP3 1IKQA 1ND2B 4YZ3A 4I3GA 4C0HA 2D3PA 2RS53 1V9U1 3V64A 2K0GA 4FPKA 4YZ5A 2E7QA 3PTYA 1GFF2 4JRLA 1AL0G 4AI1A 1SDWA 4QHBA 1EAH3 3GZAA 1ENSA 1ALYA 4IEVA 1AR91 4BPZA 1EV13 1UU4A 5SV8A 2D44A 1RUE3 2RS52 1RITA 2DFBA 3AJZA 3IN9A 3M3IA 4ONUA 3UJQA 3O0XA 4DMIA 5A33B 4OI1A 2JECA 1OQ1A 1ZREA 1DFQA 4Q0PA 5BPXA 1EPWA 1YNAA 4YGDA 1MS3A 5TSWA 3FUQA 3WCRA 4GH4A 1DF0A 2BYVE 2NMOA 1SLLA 5FTTC 4F83A 5GM0A 4XDQA 5DUVA 1JHNA 1SBDA 1RINA 1MS8A 2OA2A 3WINE 2GC3A 4NWWA 4JGYB 2R073 1LRHA 3QH7A 5FPZA 2GC1A 1OOPC 3O5SA 3KT1A 2DCKA 3HT2A 1SCRA 2ZGUA 3RI9A 3B7MA 1ULCA 4FTBA 3BOPA 2CAVA 4FPLA 2A75A 4PLOA 5KWRA 5BNPC 2PHRA 3VHPA 2E7TA 2QQPA 3TAYA 2HWB1 3VBFC 3WW1A 5J98B 4GXLA 1IS3A 5T3NA 3AZZA 3WDTA 4LA3A 3WQ1A 2P17A 1C5IA 1LOAA 2WS92 5JI7A 2QZ2A 5BNOC 2XL9A 2D5HA 2YMZA 3WW4A 3AZWA 3FFQA 4R4XA 5CB7A 1XYOA 1FPN3 3H3UA 3WDXA 1AR71 4BHPA 5JOYA 5JWPA 3D0SA 2HWF1 4LHNA 1PGW2 5A3LA 2VPVA 4AVCA 1OQDA 1UU5A 4Q8LA 4KU7A 1BBT2 3H8UA 1VBD1 4I0BA 1LEDA 4Z07A 1MQTB 1QMJA 3OYWB 4GKYA 1QGLA 2EA7A 2CGPA 1WLDA 4EN0A 1FOD2 4RS5C 5FQ0A 1ZBE2 3CNAA 4ZKTB 5EYYA 2R061 5EFUA 5BNQA 2BTVC 4H7LA 4FQZA 1QJX1 5C8CC 2DYCA 5GLTA 2GNMA 1AXYA 2XG3A 4YVWC 5KHGA 4M0NA 2VH9A 1TME3 4F3JA 4QX5A 5T54A 1XNKA 3EXUA 4K9SA 4R9CA 3AB0A 1CPNA 1LHVA 3VUOA 1LOBA 3ZXGA 3RG0A 2DVFA 5AFBA 4XFHA 5ABJC 4CP0A 3LA7A 4ISQA 4RSUA 5DG2A 1JXNA 3R4DB 1I9RA 2TUNA 2C0ZA 4IV3C 3AZYA 1ND2A 2DVBA 4QPGC 3HN1A 4FOVA 4N43B 3TWIA 2HJIA 4Z82A 4AHZA 4S2HA 4YZ4A 4COZA 5EZWA 1DGWX 4KH9A 4HKLA 4BZ4A 3UKVA 1A8DA 2GC0A 4I30A 3FLTA 1MZEA 2RS32 1WW4A 1TME1 1RUC1 1ZRRA 2PHDA 5DUUA 4FTEA 2ATFA 5JOXA 1H2KA 4RS5B 2JJ6A 4P9XA 2IXCA 5K0UC 1DQ0A 1RHI1 3ZYIB 1N3PA 2QNKA 2PHWA 2NMNA 4RGGA 4B4QA 5LEJA 1BK1A 5C8CB 2DVAA 3OD4A 3W9AA 3E6DA 4A7ZA 2LM3A 4XE9A 3JZVA 4CEWC 1VRH2 4KU8A 1EP0A 4BE3A 1QXPA 3N7KA 4CDXB 1UPIA 3QOPA 3POSA 4RHV2 1MEC1 2W68A 1BVVA 2D3RA 1F2NA 2VUJA 3JB4C 2W08A 4Q4W1 4DXZA 3D5OA 2R0HA 4CDUA 5JPMB 5BNOA 2EXHA 2ETEA 3WY6A 2B39A 5AC92 2RMU2 4FVVA 3H9AA 1KRIA 4AXOA 1CJPA 1N1SA 2IXLA 4AVTA 4Y1XA 5BY5A 3ZSMA 4RA0A 4X8PA 3JQWA 4AVSA 4LBQB 1AYN1 3ZVXA 3DPRC 5J09A 1ENXA 3IDCB 3AKPA 3HIFA 5GKAC 3AYEA 3ZO0B 2ZMNA 3ZFFB 4OHZA 3ZIXA 4PLNA 2VOWA 1O91A 5KHKA 1NXD1 4LEJA 3KSCA 4TWTA 3LWCA 1IS6A 2Q30A 1H0BA 1H4GA 5I93A 4GB31 1OOPA 1QOTA 2WZR1 3AYCA 1JH5A 2D6LX 2XJTA 4FOQA 1WCSA 2CAUA 4Y22A 4XMAA 5C33A 1O4ZA 1V6NA 1PO21 5H9QA 3WT3A 4AVBA 2ET1A 2H0VA 4H14A 4EV0A 3KQRA 5C9AA 4AQ2A 2ENRA 4MZUA 2RS12 2JD4A 4IEXA 1F9KA 5J36A 4AI3A 3AFKA 4FCAA 5DDJ2 3FLRA 1LU2A 1UL9A 1G9DA 4XQ4A 3DPRA 3JU9A 4YW3A 4EN6B 1R1A1 3AXDA 3X29B 1ENQA 2XWBB 1NLSA 1UD1A 1LENA 3VL8A 3IDBB 1GICA 2ZMKA 3IPVA 3MDPA 4XW3A 1XXNA 3KT7A 5T5OA 1O3SA 4W65A 1FATA 3NAPB 2IWGB 2JE7A 3CJIC 5K9YA 4LUMA 2ET7A 2PHFA 5J3UA 3FBYA 3FWEA 3I2DA 4GB33 4HPKB 3GBGA 4IEZA 4XTPA 3JBG1 3IKWA 3SXWA 1OOPB 4D69A 4UW4A 3WW3A 4LUKA 1IQAA 5DG1A 4OHVA 2C1FA 1IKPA 2VUAA 4ATFA 1MS0A 5BNNA 1PHMA 1U5XA 4YVSC 1YUDA 3KLSA 4P9GA 1RUG2 1SLTA 2Q4SA 3DL3A 2VOXA 1FMD2 4TZDA 1TMF2 1WD4A 2XWJB 1QJZA 1AZDA 3JD72 2Z79A 2BWAA 1NA1B 3FUOA 4XF1A 2PLV3 2PHUA 1O3RA 1DBNA 4A3XA 1WMEA 2ZX0A 1H9PA 4LHKA 2NM1A 1J3RA 1RMU1 3ZYJB 4G3YC 2JE9A 4CYDA 4HN1A 1MVQA 2ZGPA 1R081 1OHFA 1Y3TA 1W2UA 2OIIA 1C57A 2ZZJA 1ND2C 3LA2A 2IXIA 2DCJA 3B01A 4Q4X3 4XFGA 3A0NA 2ARBA 4NVPA 1UCXA 1I1EA 1SLCA 3IMNA 4RQPB 3JQXA 3TNQA 1NCQA 5CFDC 2EXIA 5T5PA 3T2TA 1VBE3 2HWC3 1C8M2 2YXSA 2DFCA 1POV3 4Q4V1 2VMIA 1R091 4HKOA 4LHLA 1QXJA 4COYA 1WW6A 5DDJ1 1DYKA 2A6XA 2BQPA 1KDKA 3WD5A 1D4VB 4Y24A 4I02A 2JG9A 4J6GA 3VBHB 2GDFA 5H9RA 4IQPA 3DN7A 3P3NA 1NCQB 4IV1A 3BCWA 4C1XA 4KGQA 4RS5A 4CP1A 2VOKA 2WKKA 3U4XA 1BEV3 3USUB 4WVMB 1ZBA2 4H3WA 5FMOL 2HKXA 2ZGNA 2YPJA 4DFSA 2JG8C 3OCPA 3UJOA 2QDNA 4LT5A 4CDUC 2EVXA 1HRI2 1YYNA 3OBRA 1AX1A 3MEPA 2WFF2 3PVEA 4U2AA 1TMF1 2JG8A 1N3OA 3B5LB 2ZACA 4HETA 4JTOA 2RMU3 1HDKA 3WP5A 4B7EA 3R4UA 4MGYE 1J3PA 3ZPYA 1UW8A 3THPA 5F6KA 2NYYA 2R072 3ZXJA 3J9SA 1DZQA 3RS6A 3UV9A 3MIEA 2VNGA 4QM9A 4NPRA 3A0KA 3H50A 3O12A 1URXA 2YGMA 3AYDA 1Y9QA 3RPQA 4HPKA 1HRI3 2H0BA 1RUG1 1C8NA 4L92A 3C3VA 1ZZ8A 2B8MA 1O4YA 4K1ZA 3A4UA 2X8KA 2GMPA 1L3JA 2P34A 4N7UA 5CFDA 1SQ4A 3JCIA 3OGGA 4QPGA 1GYKA 2RS31 2XBO3 3POWA 4IV3A 3MGUA 1LJ7A 1OLQA 4MLOA 3RYPA 4PJYA 4NWVA 4XJWA 2PFWA 3EBRA 3B3QE 4QT6A 3VGIA 3FFZA 2K9ZA 1RTVA 1XYNA 1VBB3 1ZZCA 1CAWB 1QU0A 1MEC3 1PM7A 3ETQA 4B29A 5JZGB 3WQ0A 4O9EA 1B35B 1CD3G 2O0OA 3ZFGC 4DY5A 3AFGA 4W6YA 4D7TA 3WNXA 4CEYB 4CRQA 2OVUA 5DUXA 3WUDA 1F31A 1HKDA 4Y22B 2IXJA 1SLBA 4F7ZA 2NQYA 4S2GA 5KC5A 5EYXA 1CIWA 1H1AA 1QJX3 2RS11 3S6PA 1ND3C 4AGVA 4WZCA 4BLIA 2JXAA 1WLWA 4XQWA 2EALA 2FMYA 3B02A 5HCFA 3DGTA 4IV3B 1BMV1 3SCHA 3CU7A 2GU9A 4OHYA 1BMV2 4AEKA 4LLFA 1Z7S3 1BCXA 3KZ4C 4EN9B 3THTA 4WM7C 2V5YA 4K8FA 4CDWA 2VVDA 4WVZA 1I3HA 2TBVA 1WA4A 2E53A 3DV8A 2WNUC 2XL7A 1LHUA 2VVFA 5CFCB 5CG8A 3LSDA 1U5ZA 1YRZA 2WINB 4ISRA 4AFCA 5GZEA 1ZBE1 1TMF3 2ZHNA 1HW5A 3EHKA 5D8AC 4CDUB 3JBG2 2HEWF 2MPFA 4GH4B 4KG8A 2X5IC 3AX4A 1C1LA 3K48A 3VBFA 1Z0HA 2XLGA 4DQAA 1OPOA 2QFEA 3HR9A 2XGXA 1NLRA 5E16A 5JIUA 4YM0A 3KS7A 1AR61 4Z92B 3O0VA 1DG6A 1ZBE3 4Y20B 3H3ZA 4LBMA 1RUC2 3WHTA 1HQNA 4CTEA 3V65A 5GLZA 1AYM2 4PDWA 2O1QA 5D8AA 2QE3A 3UKNA 3S7IA 2PYTA 1FT9A 4N53A 4GMP0 1O5UA 2VW1A 1CAXB 2XVGA 5JR7B 2OUHA 2ZMLA 4YM2A 3ES1A 1G9CA 3TN93 4B4RA 2KXLA 5T55A 1IS4A 1YFWA 3EJKA 1M06G 3SMHA 1SLIA 2R041 2P3IA 5IK4A 1AYN3 3O0WA 3ZYRA 4S2FA 1Q8QA 5IK8A 3B69A 4FBFA 4AEDB 4IESA 4AQTA 5JPNB 1Q8SA 4DS0A 3NV4A 1DQ6A 2IXHA 1CAVB 2RS13 2WT1A 3NO8A 1QJU1 5LEKA 1VBC3 4INDA 3NV2A 1ULDA 1QJY2 2K2SA 5FRAA 5JI9A 5JOZA 1AR83 2A73B 2ZTNA 3GBFA 4R9BA 4OI2A 4W6WA 1UMZA 3PJYA 2CWSA 1W6MA 1ZBA1 1AUYA 4MYEA 1PO13 4NN0A 2A7AA 4CDXC 1QJU3 1REFA 2ZS6B 3L2HA 1J1TA 1JTZX 2P3JA 1IS5A 1X8EA 1JYIA 1PIV1 3OYWA 3OPZA 4YW5A 3RMXA 2WQ4A 4AQSA 4FO9A 2D6MA 3DUIA 3BB6A 2A71A 3RMYA 1V70A 5FFOC 4WV8A 1AXKA 3SCFA 2VY0A 2YC0A 5HCAA 1V9U2 1CGPA 1UIKA 3N35A 1C8M1 3IM0A 4FP2A 1QXRA 3ZMNA 4GMP3 3ZFEC 5JSOA 2XLAA 3M8LA 4AGGA 4RFT0 2PHLA 4LO7A 1MZ5A 3KM5A 1ZZBA 3U11A 1DQ2A 3OF1A 1SMVA 3TRSB 3QBQA 1HRV3 3RI8A 1CAWA 1KD7A 2E6VA 5GLUA 1WBFA 4I01A 4JRAA 1RUOA 5ABJA 4YFWA 4M00A 1NY72 2N7GA 1RC6A 2Q1ZB 1X7NA 4I0AA 2VG9A 1XU2A 3NVCA 1A78A 4OZXA 4QD2A 4QQPA 1AR82 1KS5A 3MW3A 4RGAA 5BNPB 2CYFA 4HZFA 4BMBA 1CR7A 4DPNA 1RHI2 3SH5A 1J58A 4BQ1A 2OUJA 1AJKA 3JB8A 1QHDA 3VBRB 4MXVA 1Q3EA 2BW8A 2UWCA 2DV9A 2PHTA 5I8YA 1NZCA 4LTAA 1COV3 1JUIA 1LGNA 3KB5A 1RUE2 1GLHA 5I91A 2V73A 1OA4A 3E5QA 1WW5A 2P37A 1Q5OA 1C3HA 1RMU2 5T52A 1S0EA 1ULFA 2HWD3 1YFUA 4AEDC 1HX6A 2HWC1 3U10A 4ASLA 4YARA 4CDWB 1AL21 5C4WC 2VQAA 3MLJA 1KS4A 1CONA 3JD71 2O8OA 4L11A 4JTNA 1HQLA 1H8TA 5FOBB 4Q2FA 4LO5B 3WUCA 4P9LA 1FYUA 2HWF2 3M3CA 3GHMA 2QVSB 4UW6A 4YSFA 2XJPA 4DRVA 1FXZA 1X36A 3ZIWA 5BNPA 1XQNA 1BEV1 4E2GA 1QNYA 3VL9A 5BNOB 1AR92 1AL23 2QJVA 1AR93 5CIRA 4P9YA 3VBOB 1D2QA 4IEWA 1TNRA 4ES9A 4CEYA 2MHFA 1FOD1 4M3CA 4UW3A 2GH2A 4XMIA 3V56A 1WUVA 3B94A 2WLPA 2XKOA 3LZZA 1WMDA 3RWNA 2YDEA 2WZR2 1SBEA 4WVMA 1IOAA 1W6NA 5ACA3 3ZN4A 1ASJ2 3AP6A 1LCLA 1QNWA 1UKRA 2XB