1C8M2

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
total genus 59
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m200
1VBE1 1NY71 4CDUB 4WM7B 5BNPB 5C9AC 4CDXC 2TBVA 2HWF3 1PGW2 2X5IB 1QJU3 4N43B 2RS51 2HWC2 1POV0 1GFF2 2XBO3 2FZ1A 1VBD2 1R091 5FMOS 1RUD2 1PO13 4CEWC 5A32A 2WFF3 1RVF3 1X36A 1H8TC 1HXS1 5K0UA 1C8NA 1NCQC 5JZGB 1B35C 1AR73 4RQPC 2QQPA 1VB2A 2WZR1 4GMP3 3ZXAC 5D8AC 3HAGA 2GH8A 1D4M3 4YVWA 1V9U1 1AL21 1K5MC 4Q4V1 1RUI2 2PLV1 1FOD2 2RMU1 1Z7S1 3VBHC 5L7OB 1VBB2 1VBC3 4RS5B 2RM21 1VRH2 1AR81 1TMF2 1TMF3 3JB8A 3JBG2 1ZBA3 1MEC3 3J8F3 1PVC3 3CJIB 3DPRA 2HWC1 1MQTC 2RM22 4QPGA 3VBUC 1H8TA 5K0UC 4CDQB 3VBFB 1CJDA 1B35A 5DDJ1 1RUH2 4YVSB 3J8F2 1HRV1 2RR11 4AEDA 3VDDC 3JBG3 4JGYB 1RUG1 3ZFEB 1NCQA 3ZFGB 1R1A1 2HWD1 3VBRB 1AYM3 2BFUS 1OOPA 1OHFA 1RVF2 4GB31 2WFF2 1V9U2 1RUH1 1HRI1 4JGZC 1RUD3 4WM8A 2PLV2 3M8LA 4QPGC 1FPN3 1CD3G 4WM8B 4QPIA 1QJX1 1RUF2 3DPRC 1ND3C 2R073 1OOPB 3VBOB 4Q4V3 5C4WC 3VBSA 2HWE3 3ZFFB 2FZ2A 4AEDB 2WZR2 4AEDC 1VBE2 1VAKA 1FOD3 1POV1 5C4WB 1A6CA 4Q4Y1 1PO12 1RHI3 3VBFA 1ND3B 3VBUA 1FOD1 1POV3 1PIV1 3VDDA 4WM8C 5AC91 4FSJA 1VBA2 5BNNB 1NA1A 4QPGB 1AR61 5A33A 1AL0G 1AR72 4BCUA 2VQ0A 2XBO1 1VBA3 1FMD2 1TME2 1BMV2 4N53B 5A33B 2RS53 3VBRC 2HWE1 3ZFEC 3S6PA 4NWVA 4JGYC 5LK7B 4RS5A 1AUYA 3VDDB 1AR93 2R071 4GMP0 5L7OA 2RS33 2HWB2 2HWC3 1PVC1 1ASJ1 2RS12 1FMD3 3VBFC 4FTBA 1NA1B 1WCDJ 4NWWA 1RUG3 1AR83 5BNNA 4Y5Z0 3VBSB 3TN92 4GB33 2RR13 3VBUB 1ND3A 1PGL1 2DF7A 1AYM1 1RUJ2 1FPN2 3CJIC 4RQPA 1X33A 1BBT3 3VBSC 1F2NA 5D8AA 1NA1C 5A32B 5ACA2 4Y4YA 2ZZQA 1AYM2 2WZR3 4RS5C 5AC93 2R042 3VBOA 1RMU2 1AR71 1AR63 3VBRA 2BPA2 4N43A 5DDJ2 1Z7S2 4JGYA 1VB4A 1PO22 1NG0A 4N53C 5D8AB 1QQP2 1HRV2 1AYN1 1RHI1 1RUE2 1QJY1 4Q4X1 4RQPB 2RMU3 2PLV3 1B35B 1R1A2 2HWD2 5BNNC 1NCQB 3ZFGA 2RM23 1V9U3 1VBC1 1H8TB 1QJX3 1QJY2 4Q4X2 1ZBA2 4YVSA 2MEV2 1AR62 1E57A 1PGW1 1RUH3 1VBC2 5FMOL 1RUJ1 2ZAHA 1C8M2 1EAH2 1AL22 3JD71 4CDQA 1R1A3 2HWD3 4N43C 1PIV3 3ZFFC 5C8CA 4CDXB 4CDUC 1HRI3 1OOPC 3VBOC 1RUE3 5J96B 4N53A 5CFCB 4PDWC 1R093 2R062 1BBT2 3DPRB 3CJIA 1RB8G 1HXS3 1C8M3 1EAH3 2WS92 4IV3A 4YVWB 2HWF1 2WWSA 4JGZB 1BBT1 4Q4W1 4GH4A 2BUKA 1QJX2 1HX6A 1F8VA 3LOBA 3ZFGC 5C4WA 5BNOB 1SMVA 2RS32 2GSYA 2XPJA 4YVSC 4Q4W2 1RUD1 3ZFFA 5C8CC 1DDLA 1OPOA 1ASJ3 2RR12 1HQNA 1MEC1 3TN93 1ZBA1 2RS31 4Z92B 1AR91 4Q4Y2 4CDQC 5K0UB 3JBG1 4QPIB 1RUC3 4RR3C 4CDUA 5CFDC 1MQTB 1ZBE3 5ACA3 1VBA1 1QQP1 1NY72 4SBVA 1VBD3 3ZFEA 4EJRA 5C9AA 2WS91 1TME3 1NCRA 1BMV1 1VBD1 4CDWB 4FTSA 5L7OC 3VBHB 4CEYB 2HWE2 4PDWA 2HWF2 1K5MB 4Q4Y3 5ACA1 1AR82 1RUG2 2R072 2MEV1 1RVF1 1HXS2 1ASJ2 2R063 4IV1B 1QJU1 1HRI2 5J98B 1ND2B 1PIV2 5JZGC 1VBE3 3TN91 1AL23 1R081 1ZBE2 3NAPB 1EV13 2Y26A 1D4M1 2RS52 4IV1A 1FPN1 4CEWB 4Q4V2 1IHMA 1COV3 1RUF3 1K5MA 3JB4C 1EV11 1R083 4CEYA 3VBHA 4Q4W3 3IDEA 4RFT0 2X5IC 4CDWA 1RMU1 2R041 4RR3A 4WM7C 5BNPC 5C9AB 1PO11 2HWB1 1HRV3 1BEV2 2RS11 1C8M1 1EAH1 1PO21 4RHV3 3NAPC 2WLPA 5DDJ3 5JZGA 1RUE1 5ABJC 1AYN2 1ND2C 1MQTA 1MEC2 1RMU3 1PGL2 1NCRC 1VRH3 3JD73 4IV1C 2WS93 2ZTNA 1BEV3 1R092 1VBB3 3J8F1 1COV1 1RUI3 1TMF1 4CEYC 1W39A 2X5IA 4CDWC 1D4M2 2IZWA 1PVC2 4WM7A 5BNPA 5BNOA 1COV2 3JD72 2MEV3 1Z7S3 1QJZA 4GH4B 1QJY3 4JGZA 4Q4X3 1AYN3 2R061 4IV3C 5ABJA 4RHV2 5CFDB 1TME1 4IV3B 4GMP1 4RR3B 4QPIC 2RMU2 4GH4C 5CFCA 1BEV1 1ND2A 1QQP3 4CDXA 1PO23 4RHV1 1VRH1 1R082 1ZBE1 5C8CB 1NOVA 4CEWA 5FOJB 4LLFA 2WFF1 4GB32 5GKAC 2BFUL 3NAPA 2BBVA 2R043 5BNOC 1M06G 5AC92 2RS13 1EV12 1RUC1 2HWB3 1RUF1 1RHI2 1NCRB 3FBMA 4FTEA 1AR92 5CFDA 1RUI1 1FMD1 5ABJB 2XBO2 4YVWC 1RUJ3 1VBB1 1QJU2 1RUC2 4PDWB 5CFCC
chains in the Genus database with same CATH superfamily
2X09A 4QXHA 5JLVA 1ZRRA 3E5XA 2Z79A 1NY71 4QQOA 4CDUB 4OHZA 4FPCA 3RYRA 3IDCB 4A3XA 4DUVA 5JSOA 5KR7A 4S2FA 4OULA 4TSVA 1QJU3 1QF3A 4N43B 1SBDA 3NO8A 1OUSA 1OH4A 1W0PA 4IW3A 1PHMA 3R6SA 3WNLA 2WT2A 1O8PA 1Y7BA 4FI9A 3FX3A 3OGJA 4LLOA 1JYVA 3I3QA 3RZKA 4E4DX 2VCMA 4BZ4A 4CEWC 4BIFA 1BQPA 4MGKE 1V6LA 1VLNA 4QX0A 3MV01 2JEMA 3P6BA 4JHTA 3SH4A 1YI9A 4MSVA 2MPFA 4CXXA 1C8NA 4YG6A 5GZDA 3LAGA 3VKLA 2C26A 5JSPA 3ZM8A 5JDBA 4M0HA 4LBNA 4XCAA 4Y3OA 4JKKA 2J1VA 3N9LA 2W94A 4W50A 2QQPA 4FP2A 4P9WA 1MVQA 4QQLA 3MYXA 4D7SA 4W6WA 1US3A 2D5HA 2JDMA 2Z5WA 3AMQA 1C4RA 3AP5A 3BIWE 2RVAA 3DUIA 3HAGA 2GH8A 3J7NA 1U0AA 4XHBA 5FZLA 4YGCA 2PFWA 3NV4A 4H2AA 1X9PA 1IPKA 2OZ6A 1S2KA 4JRAA 4JDMA 1IS5A 4A6SA 1XNCA 3O1SA 1W8UA 2BWCA 1VBB2 4Y1UA 4RS5B 4Y5TA 3PUAA 1DLLA 4P08A 5KXCA 4LT5A 2XJPA 1OKOA 3QBQA 1D7PM 4CCLA 1F5JA 1L7LA 3AZWA 4QHBA 4DRVA 2XKPA 3JB8A 4D6QA 3B69A 3ZXFA 1ZBA3 2VY0A 5I0DA 3I3MA 3FHIB 4K7JA 2Q4SA 4OUEA 2WO7A 5LK5A 4ES8A 3DPRA 1NQJA 1Y9GA 5A3WA 2VZRA 2I45A 3I59A 4QPGA 1UOGA 1A8MA 2SLIA 3I7DA 1Y3TA 1WMDA 2GN3A 3MI8A 5K0UC 1UCXA 2E7TA 5DQ0A 2ZX3A 3VBFB 3VDCA 5HBAA 1W8TA 4IESA 5CIRA 2C9KA 2G9FA 3BCWA 3AMPA 3PHMA 1HLCA 5FLIA 3BKZA 3WF0A 2JDHA 1N1VA 3RWNA 5EFUA 5DPNA 2V4VA 1RUH2 1IOAA 3J8F2 3M3CA 2RR11 2WO1A 4L99A 3HVDA 4LEJA 1IS4A 3VDDC 3M7AA 2D6MA 2YY1A 3JBG3 4JGYB 2JG9A 1H2LA 4W65A 3K3OA 1R1A1 2HWD1 3Q8FA 3VBRB 3LFMA 2BFUS 4FCAA 2G19A 4BHPA 1JZ8A 2GNDA 4ARYA 4DFSA 4E2QA 1XB9A 3GCWA 2ZGLA 1RUH1 4AQ6A 1HRI1 3MPBA 4JGZC 4INDA 1W6QB 1AX1A 2VZQA 1H2MA 1OPMA 2Q8OA 3M8LA 5T54A 4QPGC 4QHOA 3IZOA 3UKVA 4UFJA 2VOKA 4EZHA 2BV4A 2QZ3A 4QQ2A 2JIGA 3M3EA 4G4FA 4A7KA 2QQOA 1STMA 4OQ8A 1LOEA 4RYDA 4D8MA 2J1SA 5H9QA 3U78A 1TQ5A 5F5IA 1OOPB 2F17A 3BU7A 4ZXKA 3DN7A 2QJVA 3QD6A 4H55A 4IEOA 4LTAA 2UYAA 1KXGA 3ZFFB 2J22A 4YARA 2W87A 4AI1A 2FZ2A 4M4RA 1IG3A 5DUUA 2VR4A 4LO5B 4G9SB 3Q8AA 5FY9A 1HB2A 2MNGA 5M0TA 3A0KA 1VBE2 1YWKA 3UKNA 4UT5A 1SDWA 3PL0A 3B93A 1N3OA 2D44A 2V5DA 4K1YA 1OQ1A 3MF9A 1E5IA 4Q8LA 2IFRA 1ND3B 2XVKA 5FYIA 3VBUA 2VW0A 2ZGNA 1EY2A 1PIV1 4M3CF 3WQBA 5IYYA 3IMMA 3HQXA 2CU5A 4DIQA 4UF0A 5FY4A 3OB8A 3WW2A 3WOGA 5JOWA 3WDVA 4ASMB 1AL0G 4Z2WA 1AR72 3OD0A 3V0AB 3DCQA 1W6NA 1MZ6A 1UZWA 2GNBA 1O6UA 2VQ0A 2XJTA 4QX5A 4YNIA 3W20A 1EPWA 3AVSA 1BMV2 4N53B 2XOMA 2A71A 2C0ZA 1AXYA 3JQWA 4OHWA 1DCSA 4IE5A 4PI2A 4XUNA 2Y0IA 3UNPA 2JD9A 3I2JA 3RI9A 2JE7A 1JI6A 5A1LA 5L7OA 1ZZ6A 2JG8B 1ODNA 2RS33 1OF3A 3WY6A 1PVC1 4MGYE 3AP4A 2BTVC 4XUPA 2ZEXA 4YG0A 5IFPA 4FPHA 1LOAA 2WNUA 4YLZA 5BNNA 1AR83 2D3RA 4AWDA 4Y5Z0 1OA4A 3K75B 3QOPA 5CBLA 3VBSB 4MXVA 2A70A 2VXJA 3GM8A 4GB33 5I0UA 2RR13 3BTAA 3IPVA 2B7YA 2B9UA 1MS4A 3CL1A 3AXEA 2P5BA 3CHXA 2P34A 5FQ0A 1DGRN 1X33A 1ZZBA 1W2AX 1BBT3 2VQTA 3LKJA 3NW4A 2HH9A 2E9QA 4FPGA 2ZS6B 1GZCA 4NO4A 4W8JA 2ZGRA 1H9WA 3AYCA 3V64A 3Q8CA 4XF1A 4HSLA 4XFBA 1W03A 1V6KA 2DV9A 2YXSA 3ETQA 4XDQA 4O61A 4YFWA 3HR9A 4YW4A 3VLBB 4YSFA 4L2NA 1RMU2 3PVEA 5T5JA 2X8KA 4D69A 4NRQA 2CDOA 3EO6A 2D5FA 4V2WA 1AR63 2R30A 2YGLA 3LDKA 2FDJA 1K5JA 2JDNA 3E1F1 4Y1VA 5FUPA 3OCPA 5LRRA 3ZO0B 5DDJ2 4DRRA 4ZONA 3FWEA 4BQXA 2RJLA 3I3BA 4P9GA 1SCRA 2DBNA 1ULOA 2JKXA 3C7HA 3NJYA 4TYSA 4YM2A 5D8AB 1HRV2 1RUE2 3MDPA 1W6QA 1FV3A 1UMIA 4RQPB 5FV3A 2IVJA 2WO3A 3WDYA 3O1VA 1CAUB 1RTVA 3D6EA 2RDRA 3KVBA 4IE7A 2DFCA 3RMXA 2EAKA 3VD9A 2JG9B 3B02A 5BPXA 1H8TB 1QJX3 5LA1A 4XZPA 3B7MA 3RJ2X 4N8MA 3O1OA 3O0VA 2VZ3A 4M4PA 4YVSA 3ZPOA 2D98A 1PMIA 1S0BA 4LBJA 1JYCA 4OHXA 5FLJA 1PGW1 1NAEA 1XYPA 1RUH3 2HBUA 3KT1A 5FMOL 4QKBA 3FLRA 3FZ3A 1C8M2 1AL22 1VPHA 5FZ7A 4XBNA 3UL2A 1PIV3 5C8CA 4I0AA 4MOAA 2IUWA 3CNAA 3GHMA 3WDXA 1FX5A 4CDXB 2VZSA 1IQAA 1GUIA 3I59B 4BMBA 5A7OA 5J96B 1AVBA 1DYPA 5FBJA 2D7FA 1R093 4AGRA 4QM8A 4CU8A 1RB8G 2J1TA 2YDEA 3LIGA 4HONA 4MVTA 3IDAA 1JOPA 5GLWA 4QKDA 4FBFA 2VTXA 5JXHA 3PNAA 5CG8A 1W8NA 3HNMA 3OPWA 3AKRA 3H3UA 4OMDA 1UOFA 4O7XA 5FYZA 4CCMA 1MS0A 1QIQA 2EIDA 4Q4W1 4GH4A 2B5HA 2ES3A 3HIFA 4UYBA 4QWNA 5FZHA 3VZNA 1W6OA 2Y8KA 1BLZA 3I2GA 1HW5A 5ISLA 1O8SA 2PHXA 1H8VA 4O9EA 4B4QA 4CTEA 4D7YA 4EROA 3K4AA 2EXHA 4DXTA 4I09A 3C2UA 2IXIA 4WBBA 2D97A 4C1XA 1YFUA 1RUD1 2XWJB 4A4AA 5C8CC 5JI7A 1UXXX 2L9LA 1OPOA 1SCSA 2W0XA 1DDLA 1MEC1 1GBGA 2AZ5A 4XF4A 4XTMA 1NLRA 2RS31 3ZXJA 4COVA 2YZ4A 1SZBA 3HBZA 1LNSA 2WNEA 1WD3A 4Z82A 1LU2A 3QH7A 1G9CA 4NAMA 1QHDA 3AYEA 3OUHA 2A3YA 1POQA 1REFA 3LZZA 4XMIA 2ZABA 4TN7A 1N1SA 1NY72 3VD5A 3BTYA 2D40A 2F6BA 3I2FA 1NT0A 1PMJX 4HVRA 3UYJA 3CZJA 4ZU7A 3RZHA 1WCUA 4QQPA 3ZFEA 3BYWA 4QQHA 2AH2A 4ZPIA 1VBD1 4JQRA 4FTSA 4HPKB 3VBHB 4ZXEA 1K42A 4PDWA 3VB9A 2GMMA 4OYUA 5DN2A 3UGFA 4AI0A 1XNAA 2YV8A 1RUG2 1DG6A 3RG0A 3H7JA 1GZWA 3RYKA 1CAXB 1UXZA 1VMFA 1ASJ2 3AFKA 4XE9A 3UGGA 5LA9A 4IV1B 1GR3A 1QJU1 4AFMA 4CUAA 4AI9A 3V0BB 3TAYA 1W6MB 5DUWA 2WYSA 3ZSLA 3ES4A 5B2GB 1ZX5A 1X82A 3SISA 5JZGC 1VBE3 4YZ5A 5FJKA 2WLQA 4DMIA 1EV13 1NLSA 3RVHA 1JYWA 2W08A 4AQTA 1ZZ7A 4LMFA 2YROA 5FZGA 4PI0A 5C3PA 1BZWA 2YU2A 4YGDA 1LR5A 2YU1A 5T50A 3RMYA 1D0HA 2ORZA 5FYMA 4Y1XA 3G6JB 1UYPA 2BOJA 2VVFA 3H7YA 1COV3 4FPLA 5AFEA 2FMYA 4IE6A 1W04A 3JB4C 4LQRA 2JX9A 3KHBA 2O8OA 2NP0A 3W5MA 4RFT0 4CDWA 4BISA 3WHTA 3NL1A 2XL7A 3K4ZA 2TNFA 4JX0A 4LNVA 4WM7C 5LY2A 3J4UH 4E27A 1PO11 2HWB1 5A70A 5C9AB 4FAHA 5CG9A 2LRPA 1JU4A 2UY8A 4XW3A 1BEV2 1Z0HA 5FPBA 2XJRA 1EAH1 4PIXA 1PO21 2V4AA 1ZYBA 3LD8A 3AKSA 4RHV3 4Y20A 5EWSA 5IAXA 5JZGA 1RUE1 1URXA 1AYN2 4UW3A 1MEC2 2RHPA 3OTFA 2AC1A 2E32A 2BNOA 2CAVA 2LROA 3NJZA 4QB1A 1NCRC 5L9BA 4MUVA 2BWAA 2WS93 4FTBA 3ZX7A 5A1AA 1XNBA 3ATGA 4XPVA 3KWVA 4LOSA 2ZGSA 1COV1 1XXNA 2Y60A 5FK8A 3LGRA 2VJXA 4FFFA 4OI4A 3E5UA 4P5YA 1PZ7A 4HK8A 1Y43B 4NIIA 2ZJCA 4IEZA 2DBIA 2QDRA 1AJKA 1JOBA 4NROA 4CDWC 5JOYA 1LENA 3HN1A 3HT2A 5FJHA 4PT6A 4WM7A 4XCBA 3GBWA 1A34A 4FPOB 2VCCA 2MEV3 1CZTA 3JD72 1Z7S3 4UWDA 4CP1A 1UIJA 3WNKA 3MZHA 3RPQA 3NV3A 4JGZA 1JXNA 4Q4X3 4P9JA 1V6MA 3H42B 2CY6A 3C7FA 4IV3C 2XUEA 3B9CA 3KF3A 1CPNA 3MIGA 5CFDB 3NV2A 1UYXA 4AI2A 5JI9A 4IV3B 3SITA 3M3IA 2HEWF 3KV9A 1NQDA 1YI7A 5C7GA 1UQXA 1WA6X 2JWPA 2YYOA 3J7HA 3USUA 4AGVA 3O1MA 1VIWB 1PK6B 4NHLA 2PAKA 1W99A 4UW5A 4AHWA 1XE0A 4FPKA 3WEZA 3RNSA 1DLCA 1G8WA 2ZGQA 4XAEA 5FMCA 3RDIA 4YZ3A 1HN0A 1MVEA 3MF6A 4BQ1A 4YW7A 2QZ2A 4HVQA 1N1TA 2VAUA 5EHDA 2WFF1 5GKAC 3T2QA 4WZFA 3GYDA 3L9JT 2VNGA 3C8XA 5JUVA 5FZ0A 2BW8A 2ZMKA 3NAPA 4RN5A 3THPA 4BPZA 1OLRA 5FPZA 5BY5A 5HV4A 3LEIA 2RS13 5H9PA 4B8EA 5DMYA 1PK6A 3ZN5A 5K9YA 2I07B 4FVVA 2XKOA 1JU3A 2VL4A 4HPKA 4ZZ8A 2P17A 4EWDA 3RZZA 4V2VA 1X8EA 5FPUA 4P9XA 4AI3A 2QUOA 3ES1A 4XMAA 3ZSEA 2VNOA 1QGLA 4L92A 1XU2A 1UIKA 4Q0QA 1RUJ3 5FPAA 3I2HA 3WW3A 1FXZA 1WKYA 1H2NA 4E8DA 3O0WA 5JOXA 2PTMA 3U0ZA 1LHVA 2OT7A 3AYDA 2GC3A 4PLMA 5F5AA 3ZXGA 1ZRCA 5BNPB 3LPFA 1FYUA 1ULDA 1JTZX 3GBGA 3WF4A 2W5FA 2C4XA 4GAZA 2HWF3 2YBPA 2YC2A 5IAVA 1ZRFA 1M4WA 4DEQA 2RS51 4FT8A 5GLTA 2AR6A 3OEBA 2HWC2 4JQTA 5DAWA 3E6BA 5CZKA 1QWRA 4S2DA 2XBO3 1UWWA 2XGXA 5FK7A 1LULA 4H3WA 2RDSA 3ZR6A 3ZR5A 4K8RB 1QY4A 5FMOS 3TEZA 3KVAA 3FLPA 3NNJA 5GZFA 3U14A 3ROUA 1CONA 5FZOA 4X6QB 1QH6A 3AVRA 4M00A 3SKVA 4NHKA 3OBZA 2ETEA 1BVVA 1HB1A 2R0HA 1OT5A 1NCQC 1GSLA 1ULGA 2E51A 1GOGA 2Y6FA 3MEPA 3WXPA 2GC0A 2VE1A 1AR73 3OD4A 3IAPA 1Q8OA 3PJYA 4B7EA 5I8TA 1WLTA 3GBFA 3HWJA 5GM0A 3AL5A 2ET1A 2XJVA 4RD7A 3HNYM 1H6YA 2DTYA 2IXKA 3K3NA 3N7KA 2WWJA 4RGAA 1JMUB 1S55A 3K4DA 4Y24A 5CEHA 3W58A 4HK9A 1IGOA 1GOFA 1AL21 1UZVA 4Q4V1 5BNQA 4LR4A 1X9TA 3PUHA 3ZSKA 1Z7S1 3VBHC 2P4EA 1X8MA 5FPLA 5LBFA 3MW2A 3KCCA 5DXDA 5FXZA 2RM21 2GDFA 2IXLA 2ZGUA 3UETA 4KH9A 2JE8A 4AL9A 3A0NA 2FDGA 2PN5A 4AW7A 2C9AA 3LEGA 1TMF3 2QBXA 3QACA 4HZFA 2FDHA 3J7LA 3NWKA 2QFEA 3T2PA 5DABA 3CJIB 4K8FA 2HWC1 2RM22 1OC1A 3M70A 5J37A 2VVEA 5FY0A 4YW2A 5KHGA 1EPZA 1H8TA 4UOJA 4CDQB 4X8NA 5I93A 2YBSA 4DY3A 1B35A 1DYOA 2GU9A 3NVCA 2CGNA 1NZIA 1OI6A 1OBNA 5L73A 3Q8EA 3VHPA 5A1FA 4E8CA 3HN3A 4UBGA 3W21A 2XWBB 2ADEA 1TZOA 5D21A 1XSRA 3URFA 5FZDA 5H9RA 3WW4A 3EBRA 3HQUA 3I4IA 4GWIA 2OPKA 1YO8A 2P6CA 3GCXA 4IEPA 3ZFEB 3PVNA 2E63A 2LUWA 2VBPA 1OHFA 4NN0A 1MS3A 2GALA 4GB31 4M3CE 2O1QA 1J83A 1SLLA 2B46X 1CZSA 1RUOA 5LY1A 2VOTA 3ZN6A 2VNVA 5JPMB 4YW3A 4NPRA 1ENQA 3ABZA 2ZHMA 2AEZA 2OQ6A 4W6YA 3ZN6B 1AX2A 4ATFA 3RSJA 3TOJA 1RUF2 1LHUA 2VQAA 1U5ZA 2V73A 2PXJA 4YGBA 1G6NA 4Q4V3 4Y1ZA 1PZ9A 3GDBA 2D6NA 5FZ6A 5IJRA 3OPTA 4AE2A 3RZLA 2A6VA 3POYA 3VBSA 1ENXA 2WQ4A 3ZPYA 1LRHA 3U11A 1XOYA 1JBCA 2Y64A 2ZCWA 3ACHA 1OQDA 3GF6A 3RYPA 2UWBA 1Z78A 3NKGA 4KNCA 2XHKA 1OD5A 2BZDA 4PBPA 1OFSA 2C6SA 2FBEA 1BVP1 1X50A 4Q1PA 4EYUA 4LBQB 1HJGA 3O1RA 1A6CA 5KHJA 1DQ0A 1PO12 4XFAA 4CCOA 1GZ9A 1V70A 3DGTA 5C3SA 5KXDA 4Z8BA 3CIHA 4C90A 4OI1A 2SBAA 4LXLA 2ZGMA 4WV8A 1GLHA 4I30A 5FUIA 3C7OA 3LSEA 1DFQA 3GXUA 1DIWA 3NSTA 3MIHA 1VBA2 2ZHKA 5FMBA 5JXIA 4FSJA 4LO8A 1NA1A 4CYDA 4AEMA 1AR61 2JDYA 2P3YA 3AX4A 1PM7A 1UKRA 3POJA 3WF3A 1NKGA 4B4PA 1B09A 1HDKA 1KDKA 2DVAA 5DG1A 1FMD2 5GZEA 3EMRA 3G7DA 3T09A 3V0AA 1TME2 3DXUA 4Y22A 4ARXA 3WINE 4QHZA 5EJ3A 3MICA 4XETA 2XL9A 4KQ7A 1E5SA 2HWE1 5A7WB 3ZFEC 4E9KA 3USSA 1JYIA 1GV9A 1ZZCA 2A3WA 2BNMA 4ISRA 1XNTA 5FP9A 1CR7A 4JC1A 5FYCA 2R071 3CKHA 2ZKLA 1ULFA 2LTNA 3AYAA 4N9IA 4XVHA 1T6GC 1ZRIA 4FPEA 3PIJA 4WVMA 4ZY9A 3ZYBA 1ASJ1 1L7QA 1VMHA 3K77A 5BV6A 2QQMA 5J1XA 4IEQA 3W59A 3FHQA 4META 2VW1A 3R4DB 3EHKA 2Y6HA 3ILRA 1LAJA 1GMMA 3WQ1A 1QJEA 4LK6A 5IK7A 1NLQA 3MPPG 2DDUA 3VV1A 4DOUA 1AYM1 1PX4A 3GNEA 3CJIC 4RQPA 5I8SA 4RGKA 3IIAA 4PF1A 5FZ1A 3CEWA 3AB0A 2AGSA 3BTZA 1W06A 4GKYA 3GZUC 4XEZA 2WZ8A 4QU2A 5IHRA 3SXWA 4MGTA 1AYM2 1YEWA 3FMGA 5ANNA 4DUWA 5AC93 1WMXA 4CE8A 3OGSA 1E5HA 2DCYA 1ST8A 1CN1A 2R042 2VGDA 3VBOA 3N9QA 1G9AA 2H6BA 3VKNA 4XJ9A 2QNKA 3BPZA 1AR71 3WG1A 2WQZC 3VBRA 4GD4A 4TWTA 3APBA 4L8QA 3U4SA 1CQ9A 5A3PA 4CXYA 1Z7S2 4JGYA 4BQYA 4DUXA 1FAYA 2UURA 2D3SA 3VL8A 2JECA 5EPAA 3ZMOA 4N53C 2XQXA 5HCFA 3K46A 4A41A 1K45A 4A7ZA 1RHI1 4XUQA 3PDQA 3MO4A 3A21A 5FQ0B 5FXVA 2RMU3 5FBZA 3ENRA 4DXRA 4IXLA 4HXCA 2VNRA 2F4LA 1R1A2 2HWD2 4E4HA 4CUCA 4D94A 4CP2A 3ZFGA 5FUNA 4CP0A 1JZ5A 1HQLA 1V9U3 5FPVA 5ANQA 4A6OA 5C5UA 3TWIA 3CF6E 4YWAA 2ZPXA 3SC7X 4O65A 1UF2C 2RV9A 4AEJA 1AR62 4IEXA 5E8AA 5L9RA 3LEKA 4M01A 2QQLA 5B4NA 2CSGA 1TNRA 4R4XA 2JG8A 3ZN4A 1QNWA 1ZM1A 2B4KA 3EJKA 1G86A 3ZFFC 1N1YA 2VU9A 3HNBM 3GZEA 2JXAA 3FUOA 3UGHA 3ZIXA 2J1AA 1OOPC 3H1MA 4N53A 5CFCB 1FNYA 3WSOA 2R062 1BBT2 2Y6LA 3KT7A 2ZX4A 4AEKA 3CO2A 4JTNA 1EAH3 2P2KA 1XBFA 1J58A 4KG8A 4IV3A 3OOXA 4K6BA 1GNZA 2ZX2A 5EP9A 4LUKA 2HWF1 5K4LA 3H8XA 1H9PA 1UD1A 3ZXDA 2A7AA 2ID4A 1C57A 4XYXA 4XFFA 1BBT1 4AZZA 1FV2A 1UPIA 2D6LX 1WLCA 2QTWB 2VMGA 4FPJA 3KV4A 4QDRA 4QX8A 4RL7A 5A7QA 2JB4A 5LZ6A 1HX6A 4AFAA 1SMVA 1YQ6A 3FHAA 2DUOA 3KQRA 2XPJA 1ZNPA 1JHNA 2ZKNA 4Q0SA 1A8DA 1SBEA 4P00B 4TLGA 2WYFA 4Q4W2 1UZZA 3HEIA 3PJQA 4Q0VA 3ZFFA 2AREA 4AVCA 2QQJA 2VOXA 3M1HA 2QQIA 3C7EA 4QX3A 4E4ZA 4ITCA 1CAWB 5CA6A 1PK6C 1OLMA 1IPJA 2E7QA 4Q4Y2 4CDQC 5K0UB 3JBG1 5HCBA 3F95A 2XH6A 3H8RA 1PZ8A 2WR9A 4RR3C 1WCSA 4EQVA 4CDUA 2XDVA 3T30A 2D6KA 4NIAA 3JQXA 3TRSB 3OUIA 1ZBE3 1BK0A 2DYCA 4W4ZA 4GZ9A 3D0SA 2VCAA 2O14A 3VN4A 3I8TA 1T6BX 4KL1A 2VBBA 4YZ1A 4TZDA 5FYUA 1VBD3 1FNZA 4EJRA 1OSGA 4KMQA 2ARBA 3AZXA 2CV6A 4CDWB 3TNQA 4XDOA 1OFNA 1F15A 3PU3A 1BJQA 2VUAA 4BLIA 2V09A 1QOTA 2HWF2 2GNMA 2DVGA 5ACA1 4KWUA 1CX4A 3T4HB 2OUHA 1Q3EA 1HXS2 4K1ZA 5F37A 3WX5A 1W9TA 4PCRA 3BVCA 4I01A 1LOFC 3MFCA 4R4ZA 4AHYA 1RIRA 3HD8B 1GQPA 4AHXA 4ASKA 4MGIE 4QM9A 4UBHA 5T5OA 1OLME 1QOSA 1UZ0A 4YW5A 1ND2B 2PHUA 5FR3A 3N9OA 4Q0PA 4QXKA 1LB2A 4HN1A 5FFOC 1R081 1ZBE2 5KXBA 2Y26A 1D4M1 3KGZA 4S2GA 3SCHA 1LTEA 4LITA 1WLDA 3U4XA 1FPN1 4LPLA 3ZVXA 4CEWB 4Q4V2 1LKNA 1Y4WA 3BODA 3OJBA 4QKFA 4XJUA 5FWJA 4CUBA 1O3QA 3WW1A 4KU7A 4M3CA 3FJSA 3IT8A 3JUUA 4JKLA 4EV0A 3O12A 1R083 5FRAA 2A6ZA 3VBHA 3L2HA 4Q4W3 4BYYA 1UX6A 1WZXA 3IDEA 5A3UA 4DEVA 1AX0A 4XJAA 3WQ7A 1O4YA 2GMPA 3SEPA 1PNGA 4QU1A 3WUDA 5BNPC 2QKDA 5I0TA 4CPBA 2RG4A 5A3TA 1HRV3 4NPLA 4A45A 1LOFA 1UKGA 4FP3A 2RS11 1CIWA 2WNVB 1C8M1 1FT9A 1YC61 3H3LA 3NNLA 3OSDA 2WLPA 2ZA9A 1SBFA 5AVPA 3VD3A 5DDJ3 3I2IA 3S7EA 4DXSA 4Q2FA 1O3TA 1KEXA 1CPMA 5ABJC 1ND2C 4LK7A 4XBLA 1GNHA 2Y6KA 3FN9A 5EZWA 4C8DA 4MADA 1RMU3 3R4SA 4CCDA 1PGL2 4I3PA 5FTTC 4HETA 4CU6A 2V72A 2VQUA 2ZTNA 4LO7A 4NAOA 1BEV3 1I3HA 3UJOA 4BMEA 4IL7A 1VBB3 5JAXA 5FZAA 4ZKTB 1LOGA 4I0WB 3HMYA 4EWEA 1KS4A 2DWRA 1TMF1 2UY9A 2ZMLA 4OZOA 4A3ZA 5L19A 4XBQA 4TLFA 4AFCA 1HB4A 5EIYB 1D2SA 1D4M2 2IZWA 5BNPA 1ALYA 2W39A 4GKXA 5IT6A 5F7UA 3MGUA 1COV2 3VD4A 2WA4A 2XVLA 1QJZA 3AJZA 2UWAA 4Q0UA 3CZUA 2K0GA 5C3RA 3RZMA 1O4ZA 1QJY3 1AYN3 2D6OX 2R061 2UYBA 3W9AA 3T3YA 3WHUA 5ABJA 2R6QA 4X6RB 3PUQA 4RHV2 3OGVA 5IVFA 1YIFA 5FZ4A 1TME1 1WW7A 2J1EA 5DZGA 3C7GA 4RR3B 5F3GA 4IE0A 3WP6A 1V0AA 2RMU2 1SLAA 2VMDA 1EUUA 3HT1A 2OUJA 3BGAA 5CFCA 1BEV1 1QKQA 2E33A 2EA7A 4YZ2A 4AXOA 5J09A 5JVVA 1OMIA 1VRH1 5HI0A 5C8CB 5JIAA 2WRAA 5FZ8A 4CEWA 1BHGA 5C6CA 3U37A 1YYNA 4LOTA 3P1IA 1UYYA 1WCKA 2YGMA 4XF9A 1C5IA 4K9SA 5BXXA 3ZLIA 3VKOA 4KWKA 2WAAA 4WVWA 1KRIA 1TNFA 5AC92 2EVXA 1US2A 1DHKB 3VUOA 5KHIA 5I0RA 1EP0A 3FBMA 1NCRB 1F4HA 1W9FA 3IN9A 4OI0A 4FTEA 3M4FA 2RJKA 1RUI1 1S1AA 2WBKA 1V00A 2E53A 3INAA 2VULA 5FCCA 3PUSA 2Q8DA 1ZZ9A 4FPYA 4XF0A 2P37A 3VD7A 4A7YA 1J59A 4BIOA 2EIBA 4GA9A 3EYPA 1Q8SA 2A6WA 4BLJA 1UY2A 3LDBA 1F5FA 2IC1A 3KT4A 2WL1A 4R8HA 4NHYA 4AQ2A 5CU1A 5CFCC 3T1MA 3I3EA 2PELA 2N7GA 4WM7B 5A6ZA 2DCZA 2B39A 2AYHA 4LUMA 4XFGA 3ALQA 5C9AC 4OLLA 1PGW2 2X5IB 1U5IA 3WDTA 3AP6A 4XFHA 4IUGA 1X7NA 2EALA 2VMIA 5T5PA 3SNMA 1POV0 4MGQA 2CYFA 2XG3A 3KLSA 1LEDA 2FZ1A 5T5LA 1QJFA 1MS5A 2O8QA 3NMBA 1WMEA 4CXWA 1RC6A 1S0JA 1SLCA 2WDBA 5F5QA 3VDBA 2WFF3 3N36A 4QAWA 1SDDB 4XUOA 3MLKA 3NNMA 1R1ZA 1RVF3 1VJ2A 1WGPA 1HXS1 5K0UA 3WF2A 1DU3D 1RINA 2BNNA 1EUTA 2P1BA 4FQ4A 4AG4A 5JZGB 3DYPA 4NUBA 2CDPA 3IAQA 3ORJA 4YW6A 4RQPC 1C5HA 4BA6A 2WN3A 4BE3A 4D0QA 5FDBA 3ZDSA 1S0GA 5DUXA 1VB2A 4GMP3 1QDCA 4KGQA 1AHSA 2UWCA 1D4M3 4YVWA 3O1UA 1V9U1 2PHLA 2ATFA 2VZVA 4MHUA 2QQKA 4N9HA 1K5MC 1RUI2 1QXPA 4R52A 4NR1A 3POGA 4J1XA 1VBC3 1LCLA 1OXCA 1TE1B 4MXWB 4AQSA 2VXRA 2VUDA 4B7KA 3GHNA 3MW4A 1KDMA 4K40A 3ZOIA 5EQUA 1VRH2 1AR81 3S5AA 1D0GA 3JBG2 3DV8A 4E2SA 4CCKA 2XVGA 3SH5A 1GANA 3J8F3 2NZ9A 1PVC3 4OI2A 4HSJA 4OUSA 4EZ4A 4JHZA 1WMFA 4HN0A 5DUVA 1QXJA 3IB3A 4GXLA 2Q30A 3NV1A 4YPJA 2W9XA 1OVPA 1J1LA 4YFZA 2NMNA 1CJDA 1O5UA 3LCPA 1JZ7A 1GWLA 1U5YA 4R9DA 2VO5A 3BTXA 3MFAA 5FXXA 4DO0A 2OYZA 3AP9A 2BYVE 1Q43A 2JG8C 3UT0A 1EYBA 3LE0A 1UL9A 3D4KA 3RRDA 3HBKA 5T3NA 1S0DA 4QT6A 4BXFA 3N9PA 2CNAA 4IGOA 4HVOA 1NCQA 5FY1A 5JMCA 1OOPA 1C28A 1RVF2 2CWMA 1LOBA 2ZOEB 3ILNA 1V6NA 2LS6A 1UU4A 2WFF2 3POIA 3PVBB 5FLHA 3S0MA 1Q8VA 2BERA 4BQ3A 4N7IA 3WF1A 5F2SA 3TEWA 1XQNA 4U2AA 3LA3A 1G9DA 4Q1RA 3WUCA 2PHWA 4LORA 1CD3G 5DAVA 3FC0A 5FYYA 1UN1A 5FZFA 3U1XA 1W3XA 1QJX1 1LHOA 2EXJA 4XURA 2Z42A 4Q5OA 4XXAA 2AEYA 5JPNB 3DPRC 1ND3C 1OH3A 3WG4A 3WNNA 4NVPA 4Y1YA 5F1RA 2DVBA 3O0XA 3AKTA 3MHZA 4G3YC 5GLVA 1S2BA 3LWCA 1KJRA 2YHJA 4LA2A 3FFQA 4PLOA 2Y34A 1U5XA 3NKTA 3VZKA 2WFPA 1ZREA 1HV0A 4COWA 3SH3A 1ONAA 3EXUA 1BK1A 2W68A 1O3RA 1YFXA 5FAXA 5E89A 3S7IA 1FOD3 1POV1 3ZIWA 2VECA 4BK4A 1VALA 1W90A 4Q4Y1 4GJZA 2DTWA 1RHI3 4MH0E 2BJSA 2VM9A 3VBFA 2R0FA 3UKTA 1XYNA 2J42A 3D82A 4QPYA 3VDDA 1QU0A 2JG9C 4OMCA 3KD4A 3TNPB 1CZVA 2TUNA 3OY8B 5FWEA 2W3JA 4GWMA 3N7MA 4QPGB 3ITQA 3POSA 4MLOA 5A33A 2A75A 2FCTA 2YFUA 5LBCA 3FBYA 5FO8B 4BH9A 5HCAA 4BCUA 2OW4A 2W1QA 4WVMB 4L11A 3MLJA 1UOBA 3THCA 1VAMA 2WT0A 3RWKX 1O3SA 5FZBA 1MR5A 2RS53 3SHRA 2Y6JA 3LA7A 2XXZA 3R4UA 1HIXA 3KV5A 4RS5A 1F31A 2XQRA 3VDDB 4BOWA 2A5ZA 4OZXA 1SLBA 4P9YA 1HKDA 2HWB2 3D3AA 2HWC3 2VG9A 5EYYA 2VD7A 2JDPA 1OF4A 3LEMA 1AZDA 3MIFA 2CGPA 2CL2A 1SHWB 2WO2A 3VBFC 3WR0A 1LHNA 4NWWA 5F2WA 1RUG3 4XHXA 1C1FA 1HJFA 3U10A 3ZYIB 5DZFA 1T2XA 4ATEA 2OA2A 5IVCA 3TN92 4DB5A 3HPNA 3ZXKA 4QPWA 4Q8KA 1PGL1 2DF7A 4Q27A 1YQ5A 2W1UA 1RUJ2 2Q1ZB 4AGGA 4PIZA 2B42B 2PHTA 1DZQA 3CLPA 3MIBA 3ECQA 1DQ2A 4LBQA 1LOCA 4Y5SA 3VBSC 3WZ1A 1BYHA 2XJQA 3I3DA 5D8AA 2JE9A 1LODA 4AR2A 5JMOA 3JU9A 2VZOA 3VZOA 4Y4YA 3DF0A 3WLUA 1LGCA 3AK0A 5IK4A 4RS5C 2H6CA 4QXBA 2XLAA 4BK5A 3A7QA 3FL7A 4P14A 3AMMA 5K8SA 4F8AA 5AVAA 1OA2A 3PIGA 4YRDA 4B1LA 5A7SA 4XDPA 1YNAA 5LCWL 3IKWA 5KXEA 1DZRA 4QGMA 2PA7A 1OA3A 2VH9A 2VPVA 1PO22 1NG0A 5A3OA 1UW8A 3T08A 2GAUA 1QQP2 3WDUA 5C8WA 1AYN1 4Q4X1 1BKZA 1GU3A 1MZFA 5F5CA 3T0DA 1UMHA 3T0BA 4FFIA 1YJLA 1UNBA 1J3RA 4ORFA 1PGSA 3F2ZA 3POFA 1DP0A 3RS6A 5BNNC 1NCQB 2YC4A 3UV9A 1VBC1 3H9AA 2A73B 4BXSV 3TEYA 1S0EA 4Q4X2 1ZBA2 1A78A 2A3XA 1J3PA 3D5OA 2MEV2 1E57A 2BBAA 2J1RA 2Y0OA 1OD3A 2BP6A 1FATA 2W2IA 2WNOA 3U75A 1SQ4A 2DURA 3I97A 2K2SA 2IXJA 1PMHX 1VBC2 3K2OA 4GJYA 4CCNA 1GP4A 2ZAHA 4XJWA 3LIHA 3UK9A 2NM1A 1YRZA 2WINB 3AKQA 4BU2A 3WP5A 4GWNA 4YM3A 3BPSA 1NZCA 2VZUA 4HFSA 4C91A 4FOYA 4WZCA 1CAVA 1S4CA 5FOBB 4ASLA 3B9IA 3DYMA 1RUE3 2Q1MA 4FO9A 4JDOA 5JIUA 5JXJA 1TVGA 3E5QA 3CJIA 3P5BA 1HXS3 4LKFA 3THDA 3USUB 1C8M3 1W6NB 5F6LB 1F4AA 1WUVA 1BXHA 2WS92 3SQOA 1LGBA 5E6HA 4YVWB 2BRTA 2H0BA 5FYTA 4FFHA 4ES9A 2GZWA 3BN6A 1MPXA 1PX3A 3SEEA 1NUKA 1WW4A 3DKWA 1VAVA 1LJ7A 4LKDA 2AACA 3O5SA 5IW0A 2G9ZA 3SCFA 2WWSA 4QX1A 2K46A 2W91A 4JGZB 3AMNA 1WA4A 2ZMNA 1APNA 3WG3A 4GIQA 1QJX2 2XHNA 1F8VA 3EB7A 1V6OA 2G9GA 2PAMA 1H0BA 4LBOA 5C4WA 5BNOB 4NIGA 4I3GA 1K12A 3AC0A 3OYWA 1DYKA 2ENRA 3HJRA 1SFYA 1JODA 5CISA 2VMHA 4YVSC 3QCWA 1IQDC 5DAXA 5LB6A 3IWZA 2BU9A 3WNMA 4L97A 2D3PA 5FMDA 1S2EA 2RR12 3M3OA 4LO4B 1UY1A 3TN93 1ZBA1 4IERA 3LQCA 4COZA 1CX1A 5A7NA 2VCBA 1AR91 1LGNA 5EJZB 4QPIB 2PHFA 1DZTA 2IXHA 1VE0A 1RUC3 2ORXA 1H30A 1LESA 4URAA 4H7LA 5LWBA 1XRUA 4RFRB 4AYUA 5CFDC 1MQTB 4TXWA 2NQYA 5C3QA 4CSWA 4YW1A 2KA3A 4Y20B 1UPSA 2JIJA 2KD7A 4P9LA 5FP8A 5FZEA 1QQP1 5IK8A 4A2UA 4LULA 2ZBJA 5BUVA 4SBVA 2BQPA 3KGLA 3ZSJA 2E31A 4B29A 4ZZ5A 5C9AA 2Q8EA 4IGQA 2WS91 3KB5A 4O9GA 1BMV1 4XAAA 2Z2SB 2JDKA 3LDRA 3MV11 4FFGA 3SLIA 5EJ1B 4Y4RA 2HWE2 4J6GA 3LOIA 1KD7A 5DG2A 1OVSA 1N3PA 1SPPA 3O1PA 4Q4Y3 1AR82 5J48A 2R072 2GC2A 2A6YA 4TTGA 1UY0A 3VL9A 1KITA 2VTFA 1Y9QA 2R063 2EIGA 3WV6A 4UFMA 1HRI2 2RE9A 3N7JA 5J98B 3OPZA 2GN7A 1O7FA 2HEVF 2FQPA 4QXCA 1UAIA 3FUQA 3TN91 1RXFA 2BPA2 1JZ4A 2OPWA 5FZCA 2VZTA 1V6IA 3NAPB 2P6HA 2RDNA 3NJVA 4LBMA 2RS52 1LHWA 3CU7A 3RQ0A 1GKBA 2E26A 2BEOA 2YB7A 1GP5A 1YQCA 4IV1A 1CVNA 2Z4FA 4WVVA 3RZJA 5A6QA 2H0VA 3RFRA 3M2MA 4GALA 1IHMA 1P8JA 1GWMA 1UU5A 4HBNA 4XF3A 1GOHA 1K5MA 4JTOA 3VHRA 1V6JA 5I91A 1XE7A 3BB6A 3AKPA 3AMHA 4CP9B 3POWA 4E2GA 3ZYGA 4NOTA 2R041 4RR3A 4YG3A 1MZ5A 1QMJA 3VGIA 2ZHLA 3MUZ1 3RGBA 1JHJA 2PQSA 4MV2A 2R1DA 3GALA 4NJ4A 2YPDA 5A6XA 5GLZA 2UU8A 4GULA 2XJSA 5F39A 4AVSA 3DL3A 2VTXJ 2ZZJA 3OUJA 5GLUA 5CFDA 2VZ1A 1CGPA 1SFNA 5D1IA 4IV1C 2ZX0A 1JYXA 3J26N 2OVUA 3KHCA 1U12A 2WSVA 2RDQA 1R092 2BVVA 3OBRA 5CVRA 2P3JA 3T0AA 3ZYHA 1OLQA 3KV6A 3BI3A 2WNVA 2X05A 5IATA 4NIDA 1LECA 5E1RA 1O5LA 4DZGA 4BQ5A 4F7ZA 2AUYA 4HOOA 2A6XA 1O59A 5FO7B 1W39A 4NE9A 2R49A 4HMZA 4KWLA 1W2NA 4OUMA 2W1SA 4AVBA 3UJQA 5L9VA 3AM2A 3H1WA 5IK5A 1PVC2 4IDZA 3ACLA 4NRMA 1UO9A 1JOJA 4L9BA 5DAPA 4XOGA 1W6OB 3EQEA 3V65A 2WQ8A 2B45X 2FHRA 2PAEA 4GH4B 2DVDA 1W2OA 2Q5TA 1C3HA 2VZPA 3B00A 4QGNA 4UFHA 5FYBA 3KCXA 1PM4A 1RITA 4OHYA 2W92A 1K3IA 4ET7A 4GMP1 4JV4A 4QKNA 5FP4A 2ZGKA 5KC6A 3UESA 5JCTA 3ACGA 2WN2A 1NE4A 1ODMA 3ZKUA 2DVFA 1WBFA 4FQZA 1AF9A 1GNYA 5HXVA 1QQP3 4LE3A 4F3JA 1H4GA 4IEYA 3ETPA 4CDXA 3D8CA 2AENA 4D6SA 4EN7B 1PO23 3GGLA 4R9CA 1HQWA 4RHV1 1R082 1ZBE1 5GZCA 4EN6B 5KBFA 2XLFA 1NOVA 3RI8A 5APAA 2FDKA 1IZ3A 4NPMA 1W8ZA 4NIHA 1ULPA 4MGZE 5KWRA 2FMDA 2VW2A 4IE4A 3SMHA 1YCIA 2HKXA 4KI5M 2WJSA 2BBVA 4XACA 1VR3A 5T52A 1M06G 1G7YA 2ARCA 3T1LA 2CAUA 2D93A 1I5PA 1ENRA 5TSWA 1RUC1 4CU7A 1RUF1 3V0BA 4Z1VA 5B4XA 1S0CA 1AR92 5IVJA 2PYTA 1REEA 4LHNA 1W9WA 1FI2A 2BDRA 3FFZA 4UFIA 1R64A 1GZWB 5C3OA 1CAUA 3WCSA 2EIEA 3I2KA 5J36A 5J7MA 4HANA 4M0NA 1QJU2 4HT1T 1QDOA 4PJYA 5KC5A 1IKPA 1UZYA 2VOWA 4PDWB 5FY8A 4B4RA 1VBE1 5CAZA 1E5RA 3N4MA 4CDXC 2TBVA 1G9FA 1WD4A 4BDVB 2W1WA 4AVTA 5H9SA 2P3IA 3IM0A 1IS6A 4BQ2A 1H4HA 1ZA4A 4UAPA 1SACA 3DEMA 1RXGA 2JD4A 1GFF2 1VRBA 4Z07A 1GP6A 1LU1A 1VBD2 3PTRB 2P3KA 4QDSA 2DCKA 1R091 2E6VA 2JICA 2CTVA 2FDIA 1UMZA 3OG2A 1RUD2 1PO13 4FXGB 3T2OA 3H3ZA 5CYYA 4ZS3A 5A32A 1KFUL 2WUHA 3C3VA 2XB6C 3OYWB 4OFGA 1X36A 1H8TC 1YHFA 2YG0A 3DYOA 5KHHA 3DKQA 4XIOA 5C5TA 2R1BA 3IDBB 3ME2A 5C71A 5E88A 1B35C 2BGCA 1CAWA 2DUQA 3IIIA 4K3UA 4NRPA 3ZMNA 5IVEA 3KF5A 3KCYA 3ZYRA 3PURA 3E6CC 1JS9A 1LEMA 2QQWA 2WZR1 5CNAA 3ZXAC 5D8AC 1QNYA 4AF9A 4XIKA 2NPIA 2JDUA 2WSUA 4GWJA 4XZUG 4JRLA 2QQUA 4KBBA 4UI9L 1RJ8A 1XU1A 3ASIA 1W0NA 2PHRA 2KXLA 1DQ4A 2W95A 3B5LB 4N90A 4NHXA 2Y6GA 3WNXA 4FOVA 4I2OA 1I6XA 2PLV1 1FOD2 3A4UA 4YYOA 2RMU1 3WCRA 5L7OB 4PHZA 1HB3A 4AOCA 1YXWA 5LASA 4JCKA 3HOBA 4RSUA 1O91A 4F83A 3AP7A 5AFBA 5IUQA 1F35A 1GQGA 1TMF2 1JUHA 5SV8A 2YPJA 2C5DA 3N35A 2JKBA 3AFGA 3AL6A 5FKCA 3MIEA 1W6PA 2J7MA 5FZIA 1MEC3 5IVYA 3T4VA 3VKMA 4DPNA 3OF1A 5CKNA 5LEJA 2JB8A 4B1MA 1GICA 3LA2A 2CHHA 1MQTC 4NHMA 1W8FA 3VBUC 4UF0B 1JYTA 4AFBA 1OUXA 2NLRA 1IS3A 3V56A 4AFDA 3N9MA 2IVIB 4QGLA 1XPWA 4CUGA 1CESA 5FZMA 3OBAA 4XQ4A 2NN8A 1H1IA 5DDJ1 2VMCA 2XR4A 4MO3M 4XTPA 2GMEA 1KFXL 1MS1A 1SPPB 1QXRA 5JR2A 1W9SA 1ULCA 4YVSB 4AK3A 2BOIA 1HRV1 1HN1A 3MIDA 2Q8CA 5HV0A 5LBEA 1Q5OA 1J84A 3KZ4C 2QVSB 2A1XA 4AEDA 4CVUA 4OCTA 2VOVA 2HYKA 4XQWA 3FE5A 1ZRDA 1RUG1 3OGRA 2B9VA 2GP5A 3ZFGB 1AYM3 2ZAAA 2R16A 3I2OA 1VP6A 1YLLA 2WC2A 4KU8A 1V9U2 4LHSA 3O14A 1RUD3 2NYYA 4WM8A 1ZZ8A 1HV1A 2PLV2 2XLGA 1NYWA 5A3MA 2WNUC 5LATA 4HG6B 3JCIA 4CCJA 1FPN3 2Y33A 4FXKB 3WP3A 1OQEA 2IFWA 4WM8B 2TEPA 4P9IA 4QPIA 4WVZA 4Q26A 2GC1A 1CIYA 1KQRA 1UY3A 2Z69A 2R073 2WZEA 4JKMA 5FREA 4EE2A 3VBOB 4URTA 1Q8PA 2DU1A 2ZHNA 5C4WC 4C1WA 1REDA 2HWE3 4LKEA 1JW6A 2GP3A 2OS2A 4AEDB 1MS9A 5F3IA 5FY7A 1JH5A 4QDQA 2ILMA 5JOZA 4BJ0A 5FY5A 2C1FA 2WZR2 4AEDC 2VVDA 1TG7A 1VAKA 5GZGA 5HPOA 2LW8A 3H8UA 4AHZA 4LA3A 5C4WB 5F9TA 1SEFA 5FYHA 5CADA 2BGOA 3X29B 1KGYA 3LPGA 3IPVB 4J1WA 3ZKYA 2JDZA 1FOD1 1POV3 2ZEWA 3TEXA 4COYA 5E16A 4LKSA 4WM8C 3AJYA 3KS7A 5AC91 5IVVA 4UFKA 3ILFA 3BOPA 3I54A 5A7WA 5BNNB 2OXBA 1OURA 3I49A 2BVBA 1YJKA 2WNUB 4Y22B 3KQ4B 1DGRA 4PLNA 2HLEA 2DFBA 1GZTA 2XBO1 1W6PB 1VBA3 4UW4A 1W05A 3GJAA 2EXKA 4BWOA 1YQ2A 5A33B 4J25A 5D2AA 4PIYA 2ZGTA 1ZVFA 3OY8A 4XFIA 3VBRC 2K9ZA 2YFZA 3S6PA 4Z2AA 4NWVA 4JGYC 5LK7B 1AUYA 2YMZA 3B94A 4PBOA 1AR93 1XYOA 4GMP0 1CJPA 4ONUA 3MBWA 3PTYA 2OZJA 4UW6A 3P3PA 5IWFA 1GYKA 5LRSA 4MG2A 2YC0A 4JAAA 2DCTA 4ZU4A 4A42A 4AI8A 2RS12 3BOWA 1FMD3 2DCJA 3LFIA 1NA1B 1WCDJ 4FPFA 3N7LA 5F8PA 5LA0A 1NE6A 2LALA 2WKKA 4E4SA 3PMSA 4LBKA 2ZX1A 5FIXA 3O7OA 3O1TA 5SV5A 1BCXA 2KR2A 1ND3A 4QX2A 5FP3A 3VBUB 3S30A 2WT1A 5EXOA 2D6PA 1FPN2 1IKQA 1XSQA 4H14A 4DS0A 2VC9A 1YQ8A 5ERLA 3QH6A 2DU0A 4C0BA 1F2NA 3NNFA 1C1LA 1NA1C 5A32B 5LBBA 1N3QA 2OKXA 1Y9MA 2GNTA 5KHKA 5ACA2 5I0SA 2ERFA 2ZZQA 3JZVA 1RJ7A 1D4VB 2B8MA 2WZR3 3VDAA 5I8YA 4Q29A 5L36A 3LSDA 1QEXA 3WNPA 4JDNA 5CKQA 2Q1FA 3H0OA 4QB6A 4CU9A 1D2QA 2YBKA 2XMLA 4LHLA 3NQHA 1WWYA 4N43A 5FZ3A 4OQ9A 1DQ5A 1RL3A 1XE8A 1W2UA 1VB4A 5FZKA 3T2TA 2VMFA 3WP4A 2ET7A 5FPXA 3Q8BA 5CB7A 4MHRA 1QJY1 4C0HA 3IMNA 4AVVA 2PLV3 1B35B 3PLQA 3TBDA 5FZ9A 3POBA 2RM23 4L0PA 3H50A 4XILA 4HL0A 5K7PA 5F32A 4JVAA 2J1UA 2WAOA 1QJY2 3BUCA 3JXSA 2JDAA 2V5YA 5GJ6A 2WIIB 5DZEA 2R32A 3S5QA 2W47A 4CPBD 1ENSA 2CWSA 1W8HA 4HKOA 3K48A 1H2KA 4MX3A 4IETA 1RUJ1 1EAH2 2XONA 3JD71 2W46A 4CDQA 1R1A3 2HWD3 4N43C 4YZ4A 3W5NA 4I0BA 4MXWA 4DQAA 4EN0A 5G04L 3E6DA 1SLTA 4CDUC 1HRI3 3VBOC 5C70A 5JR7B 1NXMA 4YGEA 1PNFA 2O0OA 4PDWC 3DPRB 4XJ8A 2RJ2A 5A80A 2LM3A 3ZDVA 1WW6A 2QCSB 2ZACA 4D3WA 4CA9A 3KMHA 3OBTA 1DGWA 1UOJA 5J3UA 2PQQA 4AAXA 1IG0A 5A3LA 2EXIA 1JZ6A 4DY5A 4U36A 5JWPA 1Q56A 3PMEA 2Q0AA 2NMOA 4FAGA 1Q8QA 3LF7A 4R9AA 3KM5A 2PMWB 2WZPP 4S2HA 3GZTB 2QDNA 2BUKA 1WW5A 3NJXA 3MW3A 4PQQA 2YUEA 3ZFGC 3LOBA 1QOOA 2RS32 1NXD1 1ULEA 2GSYA 4KBZA 1QH7A 3ZYFA 3AXDA 3DXTA 5A3NA 3NNGA 3SCGA 3CQOA 1N47A 4QD2A 1ASJ3 4XJZA 4IEUA 1HQNA 1S0FA 4EN8B 5A6YA 1SFPA 1NX9A 1KS5A 1SLIA 2OQ7A 4MZUA 5A7PA 4IQPA 4Z92B 3CJXA 5FO9B 1I1EA 3S57A 4LBLA 3PUIA 1GQHA 3WVJA 5EYXA 1DBNA 4XABA 2MHFA 3MUY1 5FZOB 5IFTA 1YIPA 2HBTA 4BQWA 4XQDA 1G9BA 5ACA3 1VBA1 4EWAA 2QE3A 5JSRA 1TEIA 2JENA 3H8OA 2FD8A 4KG0A 3AZYA 4DXZA 5HCHA 4SLIA 4XFCA 5HXMA 2HEYF 2VBDA 3VHOA 2VUJA 2HJIA 2ADDA 1O4TA 3ZSMA 3BU0A 3AZVA 5F3CA 1TME3 1NCRA 2FCVA 4R9BA 3OGGA 3J9SA 4ZHNA 5L7OC 4CP9A 1W3VA 3PU8A 1DF0A 4CEYB 3M3QA 1JZ3A 2JJ6A 2CGOA 3L2YA 5FYVA 5IVBA 1UY4A 1K5MB 2C24A 4XXPA 3VKFC 3LB9A 3WNOA 1W2TA 4D7TA 1UYZA 1AXKA 3PVOA 1RUNA 4H7MA 2MEV1 2ZGPA 1RVF1 4K21A 4LJHA 3GZAA 1VMJA 3ZXLA 1W8OA 2BGPA 3VZLA 4CRQA 1W28A 4LE4A 1PVXA 4IEWA 3WQ0A 4AVAA 4JZRA 1DGLA 3KSCA 1JUIA 4LIVA 1SG3A 2GH2A 3MLLA 1MZEA 1PIV2 4XUTA 5C33A 3H1YA 1WLWA 2X29A 1AL23 2ARAA 2ZEZA 3D0JA 4W6XA 4EN9B 3OEAA 4B3NA 2PHDA 2WABA 3FLTA 3ON7A 3THTA 2ZXQA 4X8PA 5BYNA 2I74A 3TYJA 1JYNA 3CBNA 4PF5A 3A23A 4BB3A 1RUF3 2IWGB 4YM0A 3B3QE 1S0IA 5DAQA 1EV11 2G4IA 2QQNA 4LHKA 4MGSA 4UXAA 3ZYPA 4CEYA 2R7EB 3J7MA 2OX0A 3NRUA 1ZA7A 2X5IC 4OHVA 1RMU1 5G05L 1W0OA 4A44A 1JN2P 1UU6A 4IEVA 4YM1A 1GWKA 1RGSA 3N3HA 3ACIA 1RYYA 2E7AA 4PQ9A 1W8WA 3VHNA 3VZJA 4HKWA 1AJOA 2ARXA 4QX7A 4RGGA 4ZS2A 5LW9A 1XJAA 2VUCA 2OIIA 3NAPC 1MACA 3K51A 3RZGA 2FDFA 5FYSA 5LA2A 4IGPA 1MQTA 2FCUA 4BQ4A 1I5ZA 1F9KA 1A3KA 1VRH3 1J3QA 3HQRA 1DGWX 1H6XA 3JD73 1MS8A 2XUMA 1YFWA 4KGGA 5EV7A 4AAPA 1YUDA 3P3NA 2EAAA 4HKLA 4K20A 4QB2A 1H1MA 3J8F1 2XJUA 3BALA 3ST7A 4I02A 4QMAA 2KM2A 3ELNA 4NMIA 1L7RA 3A22A 1RUI3 2ZGOA 4CEYC 2DUPA 4KWJA 2VMEA 3QLQA 1H1AA 4P5HA 2X5IA 4P02B 4COUA 5BNOA 5GALA 2EICA 2WA3A 4Y33A 2X10A 3TB0A 4FOQA 1DQ1A 1DQ6A 2G1MA 2Y38A 5F3EA 4M3CB 4RA0A 1J1TA 4DINB 3WG2A 3R05A 3E97A 4ISQA 1XNKA 3N9NA 3WDWA 2D43A 4HLTA 2W52A 4QPIC 4BM8A 4GH4C 4LO6B 4FOWA 1JZ2A 3VZMA 3IBMA 5FKBA 5FP7A 5LEKA 1ND2A 5FXWA 1W9YA 1CAVB 3ZXEA 3R0RA 4ZU5A 2HYXA 3DECA 1W6MA 4CCCA 1XC6A 4OVEA 2WWUA 1L3JA 1CWPA 5FOJB 4LBQD 1IPSA 4GB32 4LLFA 5JXGA 2QQVA 2ZEYA 3I2DA 4UFLA 1CAXA 2F4PA 4CCEA 3WT3A 3ACFA 2BFUL 1YFYA 3B01A 1ACCA 2R043 5BNOC 3Q9OA 3POEA 4D6RA 3AZZA 3WD5A 4N7UA 1EV12 4V1PA 2HWB3 3RJRA 3SKJE 4DNYA 1RHI2 4Y26A 3CDZB 4LIUA 4XC9A 3U07A 5F6KA 2IXCA 1FMD1 5ABJB 2XBO2 1WCQA 5T55A 1I9RA 2EF6A 4YVWC 3GJBA 4MYEA 1OKQA 1KJLA 4GQ7A 2X53S 2I2SA 1WBLA 1VBB1 1XNDA 3CMGA 4CZSA 2WNVC 3ZYJB 3BIEA 1UX7A 1RUC2 5CKMA 1AXZA
chains in the Genus database with same CATH topology
5JLVA 1ZRRA 3E5XA 2Z79A 1NY71 4QQOA 4CDUB 4OHZA 4FPCA 3RYRA 3IDCB 4A3XA 5JSOA 4S2FA 4OULA 4TSVA 1QJU3 1QF3A 4N43B 1SBDA 3NO8A 1W0PA 3R6SA 1PHMA 2WT2A 1Y7BA 3FX3A 3OGJA 4LLOA 4E4DX 4BZ4A 4CEWC 4BIFA 1BQPA 4MGKE 1V6LA 1VLNA 2JEMA 3SH4A 1YI9A 4MSVA 2MPFA 1C8NA 4YG6A 5GZDA 3LAGA 3VKLA 5JSPA 5JDBA 4M0HA 4LBNA 2QQPA 4FP2A 4P9WA 1MVQA 4QQLA 3MYXA 4D7SA 4W6WA 2D5HA 4QQPA 2Z5WA 3AMQA 3AP5A 1C4RA 3HAGA 3BIWE 3DUIA 2GH8A 1U0AA 4XHBA 4YGCA 2PFWA 3NV4A 1IPKA 2OZ6A 1S2KA 4JRAA 4JDMA 1IS5A 1XNCA 2BWCA 1VBB2 4Y1UA 4RS5B 1DLLA 4LT5A 5KXCA 2XJPA 3QBQA 1F5JA 3AZWA 4QHBA 4DRVA 2XKPA 3JB8A 3B69A 3ZXFA 1ZBA3 2VY0A 3FHIB 4K7JA 2Q4SA 5LK5A 4ES8A 3DPRA 1NQJA 2I45A 3I59A 4QPGA 1A8MA 2SLIA 3I7DA 1Y3TA 1WMDA 2GN3A 3MI8A 5K0UC 1UCXA 2E7TA 5HBAA 2ZX3A 3VBFB 4IESA 5CIRA 2G9FA 3BCWA 3AMPA 3PHMA 1HLCA 5FLIA 1N1VA 3RWNA 5EFUA 1RUH2 1IOAA 3J8F2 3M3CA 2RR11 4L99A 4LEJA 1IS4A 3VDDC 3M7AA 2D6MA 2YY1A 3JBG3 4JGYB 2JG9A 1H2LA 4W65A 1R1A1 2HWD1 3VBRB 4FCAA 2BFUS 4BHPA 2GNDA 4DFSA 4E2QA 2ZGLA 1RUH1 4AQ6A 1HRI1 3MPBA 4JGZC 4INDA 1W6QB 1AX1A 1H2MA 1OPMA 2Q8OA 3M8LA 5T54A 4QPGC 3UKVA 2VOKA 2QZ3A 4QQ2A 3M3EA 4G4FA 4A7KA 1LOEA 5H9QA 1TQ5A 1OOPB 3BU7A 4ZXKA 3DN7A 2QJVA 3QD6A 4H55A 4IEOA 4LTAA 2UYAA 1KXGA 3ZFFB 4YARA 4AI1A 2FZ2A 5DUUA 4LO5B 4G9SB 2MNGA 3A0KA 1VBE2 1YWKA 3UKNA 1SDWA 3B93A 1N3OA 2D44A 4K1YA 1OQ1A 3MF9A 4Q8LA 2IFRA 1ND3B 2XVKA 3VBUA 2VW0A 2ZGNA 1EY2A 1PIV1 4M3CF 3HQXA 3WW2A 3WOGA 5JOWA 3WDVA 4ASMB 1AL0G 4Z2WA 1AR72 3OD0A 3V0AB 1W6NA 1MZ6A 2GNBA 2VQ0A 2XJTA 4QX5A 4YNIA 1EPWA 1BMV2 4N53B 2A71A 2C0ZA 1AXYA 3JQWA 4OHWA 2Y0IA 3RI9A 2JE7A 5L7OA 1ZZ6A 2JG8B 2RS33 3WY6A 1PVC1 4MGYE 3AP4A 2BTVC 4YG0A 4FPHA 1LOAA 2WNUA 4YLZA 5BNNA 1AR83 2D3RA 4AWDA 4Y5Z0 1OA4A 3QOPA 5CBLA 3VBSB 4MXVA 2A70A 5I0UA 4GB33 2RR13 3BTAA 3IPVA 2B7YA 2B9UA 1MS4A 3CL1A 3AXEA 2P34A 5FQ0A 1DGRN 1X33A 1ZZBA 1BBT3 3LKJA 3NW4A 2E9QA 4FPGA 2ZS6B 1GZCA 4NO4A 2ZGRA 1H9WA 3AYCA 3V64A 4XF1A 4HSLA 4XFBA 1V6KA 2DV9A 2YXSA 3ETQA 4XDQA 4YFWA 4YW4A 3HR9A 3VLBB 4YSFA 4L2NA 1RMU2 3PVEA 5T5JA 2X8KA 4D69A 3EO6A 2D5FA 1AR63 2R30A 2YGLA 2BPA2 3ZO0B 4DRRA 4Y1VA 5LRRA 3OCPA 5DDJ2 3FWEA 2RJLA 4P9GA 1SCRA 4TYSA 4YM2A 5D8AB 1HRV2 1RUE2 3MDPA 1W6QA 1FV3A 4RQPB 3WDYA 1CAUB 1RTVA 3D6EA 2DFCA 3RMXA 2EAKA 2JG9B 3B02A 5BPXA 1H8TB 1QJX3 4XZPA 3B7MA 3RJ2X 3O0VA 4YVSA 2D98A 1PMIA 1S0BA 4LBJA 1JYCA 4OHXA 5FLJA 1PGW1 1XYPA 1RUH3 3KT1A 5FMOL 3FLRA 3FZ3A 1C8M2 1AL22 3UL2A 4XBNA 5C8CA 1PIV3 4I0AA 3CNAA 3GHMA 3WDXA 1FX5A 4CDXB 1IQAA 3I59B 4BMBA 5J96B 1AVBA 1DYPA 2D7FA 1R093 4AGRA 4QM8A 1RB8G 2YDEA 4MVTA 4FBFA 5GLWA 3PNAA 5CG8A 3AKRA 3H3UA 1MS0A 4Q4W1 4GH4A 2B5HA 2ES3A 3HIFA 3VZNA 1W6OA 1HW5A 2PHXA 1H8VA 4O9EA 4B4QA 4CTEA 4D7YA 4EROA 2EXHA 4I09A 3C2UA 2IXIA 4WBBA 2D97A 4C1XA 1YFUA 1RUD1 2XWJB 5C8CC 5JI7A 1DDLA 1OPOA 1SCSA 2W0XA 1MEC1 1GBGA 2AZ5A 4XF4A 4XTMA 1NLRA 2RS31 3ZXJA 4COVA 2YZ4A 3HBZA 2WNEA 1WD3A 4Z82A 1LU2A 3QH7A 1G9CA 1QHDA 3AYEA 2A3YA 1REFA 3LZZA 4XMIA 2ZABA 1N1SA 1NY72 2D40A 2F6BA 4HVRA 4ZU7A 3ZFEA 4QQHA 2AH2A 1VBD1 4JQRA 4FTSA 4HPKB 3VBHB 4PDWA 2GMMA 4AI0A 2YV8A 1RUG2 1DG6A 3RG0A 3H7JA 1GZWA 3RYKA 1CAXB 1ASJ2 3AFKA 4XE9A 4IV1B 1GR3A 1QJU1 4AFMA 3V0BB 3TAYA 1W6MB 5DUWA 3ZSLA 3ES4A 5B2GB 1ZX5A 1X82A 3SISA 5JZGC 1VBE3 2WLQA 4DMIA 1EV13 1NLSA 2W08A 4AQTA 1ZZ7A 2YROA 1BZWA 4YGDA 1LR5A 5T50A 3RMYA 1D0HA 4Y1XA 3G6JB 2VVFA 3H7YA 1COV3 4FPLA 5AFEA 2FMYA 3JB4C 2JX9A 2O8OA 2NP0A 4RFT0 4CDWA 3WHTA 3NL1A 2XL7A 2TNFA 4LNVA 4WM7C 5C9AB 3J4UH 4E27A 1PO11 2HWB1 4FAHA 5CG9A 4XW3A 2UY8A 1BEV2 1Z0HA 2XJRA 1EAH1 4PIXA 1PO21 4RHV3 1ZYBA 3AKSA 4Y20A 5EWSA 5JZGA 1RUE1 1URXA 1AYN2 4UW3A 1MEC2 2RHPA 3OTFA 2BNOA 2CAVA 3NJZA 1NCRC 4MUVA 2BWAA 2WS93 3ZX7A 1XNBA 3ATGA 4XPVA 2ZGSA 1COV1 1XXNA 3LGRA 4OI4A 3E5UA 1PZ7A 4HK8A 1Y43B 2ZJCA 4IEZA 2QDRA 1AJKA 4CDWC 5JOYA 1LENA 3HN1A 3HT2A 4WM7A 3GBWA 4FPOB 3JD72 2MEV3 4CP1A 1Z7S3 1UIJA 3MZHA 3RPQA 3NV3A 4JGZA 1JXNA 4Q4X3 4P9JA 1V6MA 2CY6A 4IV3C 3B9CA 1CPNA 3MIGA 5CFDB 3NV2A 4AI2A 5JI9A 4IV3B 3SITA 3M3IA 2HEWF 1NQDA 1YI7A 3USUA 2YYOA 4AGVA 1VIWB 1PK6B 4NHLA 2PAKA 4UW5A 4AHWA 4FPKA 3RNSA 1G8WA 2ZGQA 4YZ3A 1MVEA 3MF6A 4BQ1A 2QZ2A 4HVQA 1N1TA 2WFF1 5GKAC 4WZFA 3GYDA 3L9JT 2VNGA 3THPA 2BW8A 2ZMKA 3NAPA 4BPZA 1OLRA 5FPZA 5BY5A 2RS13 5H9PA 1PK6A 3ZN5A 5K9YA 2I07B 4FVVA 2XKOA 4HPKA 2P17A 4EWDA 3RZZA 1X8EA 4P9XA 4AI3A 2QUOA 3ES1A 4XMAA 3ZSEA 2VNOA 1QGLA 4L92A 1XU2A 1UIKA 4Q0QA 1RUJ3 3WW3A 1FXZA 1H2NA 3O0WA 5JOXA 2PTMA 3U0ZA 1LHVA 3AYDA 2GC3A 4PLMA 3ZXGA 1ZRCA 5BNPB 1FYUA 1ULDA 1JTZX 3GBGA 1ZRFA 2HWF3 1M4WA 2RS51 4FT8A 5GLTA 2AR6A 2HWC2 3E6BA 1QWRA 4S2DA 2XBO3 2XGXA 1LULA 4H3WA 1QY4A 5FMOS 3FLPA 5GZFA 3ROUA 1CONA 4X6QB 1QH6A 4M00A 4NHKA 2ETEA 1BVVA 2R0HA 3WXPA 1NCQC 1GSLA 1ULGA 2E51A 3MEPA 2GC0A 3OD4A 1AR73 5I8TA 3PJYA 1Q8OA 4B7EA 1WLTA 3GBFA 3HWJA 5GM0A 2ET1A 2XJVA 4RD7A 2DTYA 2IXKA 4RGAA 3N7KA 4Y24A 1S55A 3W58A 4HK9A 1IGOA 1AL21 4Q4V1 5BNQA 4LR4A 3ZSKA 1Z7S1 3VBHC 1X8MA 3MW2A 3KCCA 5DXDA 2RM21 2GDFA 2IXLA 2ZGUA 4KH9A 3A0NA 2PN5A 4AW7A 2C9AA 1TMF3 3QACA 4HZFA 3NWKA 2QFEA 3CJIB 4K8FA 2HWC1 2RM22 3M70A 5J37A 2VVEA 4YW2A 5KHGA 1EPZA 1H8TA 4CDQB 4X8NA 5I93A 4DY3A 1B35A 2GU9A 3NVCA 2CGNA 1OI6A 5L73A 3VHPA 4UBGA 2XWBB 3URFA 5H9RA 3WW4A 3EBRA 3I4IA 2OPKA 1YO8A 4IEPA 3ZFEB 3PVNA 2E63A 2LUWA 1OHFA 4NN0A 1MS3A 2GALA 4GB31 4M3CE 2O1QA 1SLLA 2B46X 1RUOA 3ZN6A 4YW3A 4NPRA 1ENQA 2ZHMA 4W6YA 3ZN6B 1AX2A 4ATFA 3RSJA 3TOJA 1RUF2 1LHUA 2VQAA 1U5ZA 2V73A 4YGBA 1G6NA 4Q4V3 4Y1ZA 1PZ9A 4AE2A 2D6NA 2A6VA 3POYA 3VBSA 1ENXA 2WQ4A 3ZPYA 1LRHA 3U11A 1JBCA 2ZCWA 3GF6A 1OQDA 3RYPA 2UWBA 1Z78A 3NKGA 4KNCA 2XHKA 1OD5A 4PBPA 1OFSA 2FBEA 1BVP1 1X50A 4Q1PA 4LBQB 1A6CA 5KHJA 1DQ0A 1PO12 4XFAA 1GZ9A 1V70A 3DGTA 4Z8BA 4C90A 4OI1A 2SBAA 2ZGMA 4WV8A 1GLHA 4I30A 3LSEA 1DFQA 3NSTA 1DIWA 4FSJA 3MIHA 1VBA2 2ZHKA 4LO8A 1NA1A 4AEMA 1AR61 3AX4A 1PM7A 1UKRA 4B4PA 5KXDA 1B09A 1HDKA 1KDKA 2DVAA 5DG1A 1FMD2 5GZEA 3V0AA 3G7DA 1TME2 4Y22A 3WINE 5EJ3A 3MICA 4XETA 2XL9A 4KQ7A 2HWE1 4E9KA 3ZFEC 3USSA 1JYIA 1GV9A 1ZZCA 2A3WA 2BNMA 4ISRA 1CR7A 4JC1A 2R071 2ZKLA 1ULFA 2LTNA 3AYAA 4N9IA 1T6GC 4FPEA 4WVMA 5BV6A 1ASJ1 4IEQA 3W59A 4META 2VW1A 3R4DB 3EHKA 3ILRA 3WQ1A 5IK7A 3MPPG 3VV1A 4DOUA 1AYM1 3GNEA 3CJIC 4RQPA 5I8SA 3IIAA 3CEWA 3AB0A 2AGSA 4GKYA 3GZUC 4XEZA 4QU2A 3SXWA 1AYM2 3FMGA 5AC93 2DCYA 2R042 1G9AA 1CN1A 2VGDA 3VBOA 2H6BA 3VKNA 4XJ9A 2QNKA 3BPZA 1AR71 3WG1A 2WQZC 3VBRA 4TWTA 3APBA 4L8QA 1CQ9A 1Z7S2 4JGYA 1FAYA 2UURA 2D3SA 3VL8A 2JECA 3ZMOA 4N53C 5HCFA 4A7ZA 1RHI1 5FQ0B 2RMU3 5FBZA 3ENRA 4IXLA 2VNRA 1R1A2 2HWD2 4D94A 4CP2A 3ZFGA 4CP0A 1HQLA 1V9U3 3TWIA 3CF6E 2ZPXA 1UF2C 1AR62 4IEXA 5E8AA 4M01A 1TNRA 4R4XA 2JG8A 3ZN4A 1QNWA 1ZM1A 3EJKA 1G86A 3ZFFC 1N1YA 2VU9A 2JXAA 3FUOA 3ZIXA 1OOPC 3H1MA 4N53A 5CFCB 1FNYA 4AEKA 2R062 1BBT2 3KT7A 2ZX4A 3CO2A 4JTNA 1EAH3 2P2KA 1J58A 4KG8A 4IV3A 4K6BA 1GNZA 2ZX2A 4LUKA 2HWF1 1H9PA 1UD1A 3ZXDA 2A7AA 4XYXA 1C57A 4XFFA 1BBT1 1FV2A 1UPIA 2D6LX 1WLCA 2VMGA 4FPJA 4RL7A 4B8EA 1HX6A 4AFAA 1SMVA 2DUOA 3KQRA 2XPJA 1ZNPA 1JHNA 2ZKNA 4Q0SA 1A8DA 1SBEA 4Q4W2 1UZZA 4Q0VA 3PJQA 3ZFFA 2AREA 4AVCA 2VOXA 3M1HA 4E4ZA 4ITCA 1CAWB 5CA6A 1PK6C 2E7QA 1IPJA 4Q4Y2 4CDQC 5K0UB 3JBG1 5HCBA 2XH6A 1PZ8A 4RR3C 1WCSA 4CDUA 2D6KA 3JQXA 3TRSB 1ZBE3 2DYCA 3D0SA 3VN4A 3I8TA 4KL1A 4YZ1A 4TZDA 1VBD3 1FNZA 4EJRA 1OSGA 2ARBA 3AZXA 2CV6A 4CDWB 3TNQA 1OFNA 1BJQA 2VUAA 4BLIA 2V09A 1QOTA 2HWF2 2DVGA 2GNMA 5ACA1 1CX4A 2OUHA 1Q3EA 1HXS2 4K1ZA 3WX5A 4PCRA 4I01A 1LOFC 3MFCA 4R4ZA 4AHYA 1RIRA 3HD8B 4AHXA 4MGIE 4QM9A 4UBHA 5T5OA 1QOSA 4YW5A 1ND2B 2PHUA 4Q0PA 4QXKA 1LB2A 4HN1A 5FFOC 1R081 1ZBE2 5KXBA 2Y26A 1D4M1 3KGZA 4S2GA 3SCHA 1LTEA 1WLDA 3U4XA 1FPN1 3ZVXA 4CEWB 4Q4V2 1LKNA 3BODA 3OJBA 4XJUA 1O3QA 3WW1A 4KU7A 4M3CA 3FJSA 3IT8A 3JUUA 4EV0A 3O12A 1R083 5FRAA 2A6ZA 3VBHA 3L2HA 4Q4W3 4BYYA 1UX6A 3IDEA 1AX0A 4XJAA 3WQ7A 1O4YA 2GMPA 3WUDA 1PNGA 5BNPC 2QKDA 5I0TA 1HRV3 1LOFA 1UKGA 4FP3A 2RS11 1CIWA 2WNVB 1C8M1 1FT9A 3RDIA 2WLPA 2ZA9A 1SBFA 5AVPA 5DDJ3 3S7EA 1O3TA 4Q2FA 1CPMA 5ABJC 1ND2C 4XBLA 1GNHA 5EZWA 1RMU3 3R4SA 1PGL2 4I3PA 5FTTC 4HETA 2ZTNA 4LO7A 3UJOA 1BEV3 1I3HA 4BMEA 4IL7A 1VBB3 5JAXA 4ZKTB 1LOGA 4I0WB 3HMYA 4EWEA 1KS4A 2DWRA 1TMF1 2UY9A 2ZMLA 5L19A 4XBQA 4TLFA 4AFCA 1D2SA 1D4M2 2IZWA 5BNPA 1ALYA 2W39A 4GKXA 5IT6A 3MGUA 1COV2 2WA4A 2XVLA 1QJZA 3AJZA 2UWAA 4Q0UA 2K0GA 1O4ZA 1QJY3 1AYN3 2D6OX 2R061 2UYBA 3W9AA 3WHUA 5ABJA 2R6QA 4X6RB 4RHV2 1YIFA 1TME1 1WW7A 5DZGA 4RR3B 3WP6A 2RMU2 1SLAA 3HT1A 2OUJA 5CFCA 1BEV1 1QKQA 2EA7A 4YZ2A 4AXOA 5J09A 5JVVA 1OMIA 1VRH1 5HI0A 5C8CB 5JIAA 4CEWA 5C6CA 1YYNA 1WCKA 2YGMA 4XF9A 1C5IA 4K9SA 5BXXA 3VKOA 4KWKA 4WVWA 1KRIA 1TNFA 5AC92 2EVXA 1DHKB 3VUOA 5KHIA 5I0RA 1EP0A 3FBMA 1NCRB 3IN9A 4OI0A 4FTEA 3M4FA 2RJKA 1RUI1 1S1AA 5FCCA 1V00A 2E53A 3INAA 2VULA 5CFDA 1J59A 1ZZ9A 4FPYA 4XF0A 2P37A 4A7YA 4BIOA 4GA9A 1Q8SA 2A6WA 4BLJA 1F5FA 2IC1A 3KT4A 2WL1A 4R8HA 5CFCC 4AQ2A 5CU1A 3T1MA 2PELA 2N7GA 4WM7B 5C9AC 2DCZA 2B39A 2AYHA 4LUMA 4XFGA 3ALQA 4OLLA 1PGW2 2X5IB 1U5IA 3WDTA 3AP6A 4XFHA 1X7NA 2EALA 2VMIA 5T5PA 3SNMA 1POV0 2CYFA 2XG3A 3KLSA 1LEDA 2FZ1A 5T5LA 1MS5A 2O8QA 1WMEA 1RC6A 1S0JA 1SLCA 5F5QA 2WFF3 3N36A 3MLKA 1R1ZA 1RVF3 1VJ2A 1WGPA 1HXS1 5K0UA 1DU3D 1RINA 2BNNA 4FQ4A 4AG4A 5JZGB 4RQPC 1C5HA 4BA6A 4BE3A 5FDBA 3ZDSA 1S0GA 5DUXA 1VB2A 4GMP3 1QDCA 4KGQA 1AHSA 2UWCA 1D4M3 4YVWA 1V9U1 2PHLA 2ATFA 4N9HA 1K5MC 1RUI2 1QXPA 4R52A 4NR1A 4J1XA 1VBC3 1LCLA 1TE1B 4MXWB 4AQSA 2VXRA 4B7KA 3GHNA 3MW4A 1KDMA 4K40A 1VRH2 1AR81 1D0GA 3JBG2 3DV8A 4E2SA 2XVGA 3SH5A 1GANA 3J8F3 2NZ9A 1PVC3 4OI2A 4HSJA 4OUSA 1WMFA 4HN0A 5DUVA 1QXJA 4GXLA 2Q30A 3NV1A 1J1LA 4YFZA 2NMNA 1CJDA 1O5UA 3LCPA 1U5YA 4R9DA 3MFAA 2OYZA 3AP9A 2BYVE 1Q43A 2JG8C 1EYBA 3RRDA 1UL9A 3D4KA 5T3NA 1S0DA 4QT6A 2CNAA 4HVOA 1NCQA 5JMCA 1OOPA 1C28A 1RVF2 2ZOEB 2CWMA 1LOBA 3ILNA 1V6NA 2WFF2 1UU4A 3PVBB 5FLHA 3S0MA 1Q8VA 4N7IA 1XQNA 4U2AA 3LA3A 1G9DA 4Q1RA 3WUCA 2PHWA 1CD3G 3FC0A 1UN1A 1QJX1 1LHOA 2EXJA 2Z42A 5JPNB 4XXAA 3DPRC 1ND3C 3WG4A 4NVPA 4Y1YA 5F1RA 2DVBA 3O0XA 3AKTA 4G3YC 5GLVA 1S2BA 3LWCA 1KJRA 2YHJA 4LA2A 3FFQA 4PLOA 3NKTA 1U5XA 3VZKA 1ZREA 2WFPA 1HV0A 4COWA 3SH3A 1ONAA 3EXUA 1BK1A 2W68A 1O3RA 1YFXA 5FAXA 5E89A 3S7IA 1FOD3 1POV1 3ZIWA 2VECA 1VALA 4Q4Y1 2DTWA 1RHI3 4MH0E 3VBFA 2R0FA 3UKTA 1XYNA 3D82A 4QPYA 3VDDA 1QU0A 2JG9C 3KD4A 3TNPB 2TUNA 3OY8B 4QPGB 4GWMA 3N7MA 5A33A 3POSA 4MLOA 5FO8B 2A75A 3FBYA 4BH9A 5HCAA 4BCUA 2OW4A 4WVMB 4L11A 3MLJA 1O3SA 1VAMA 2WT0A 1MR5A 2RS53 3SHRA 3LA