1O8SA

Structure of cscbm6-3 from clostridium stercorarium in complex with cellobiose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'VGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ENDO-XYLANASE
publication title Structure and Ligand Binding of Carbohydrate-Binding Module Cscbm6-3 Reveals Similarities with Fucose-Specific Lectins and Galactose-Binding Domains
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8sA00
1JYWA 2YFUA 1EUUA 2W1QA 2VZPA 3OB8A 4QDSA 2VC9A 3NQHA 2E31A 2YG0A 1T2XA 3EB7A 4QPWA 3ACIA 2J1VA 1PX4A 1SDDB 4DUXA 4A41A 2DDUA 1MPXA 5B4NA 3A23A 1I5PA 3AC0A 3THDA 2LW8A 3MV11 2ZEXA 3NJVA 4ZY9A 3I3EA 3WSOA 3I3BA 4MGSA 3T0AA 4MADA 2WN2A 3C7HA 3ZM8A 3HEIA 3T0BA 1GOFA 3WF3A 5DPNA 1P8JA 3A7QA 2Y8KA 1UXXX 4XUNA 3HNBM 4FI9A 3IB3A 2WZ8A 4OYUA 3ACGA 2BBAA 3VDAA 5JXHA 2J1EA 5CYYA 4QX0A 4XUOA 2HLEA 3OGVA 1DYOA 4JKKA 3VD4A 2RVAA 1GU3A 1JZ8A 3OGRA 4GWIA 4PF1A 3CKHA 5IFPA 1UY1A 1UMIA 2Y6LA 4KWUA 1HN1A 2W47A 2J1SA 5LA0A 3J7HA 3P6BA 4DXSA 1CZTA 3T2QA 2QQOA 4QDRA 3OBAA 1H6XA 4QB1A 1YQ2A 4D8MA 3I2IA 4ZZ5A 2ID4A 4DUWA 3WNKA 1DP0A 1JU4A 2Y6HA 3PUHA 4JX0A 3CIHA 4HG6B 4DEQA 2VJXA 2ZEWA 1NX9A 3MUY1 4DUVA 2EICA 4CU7A 2YC4A 3WQBA 3HOBA 3ABZA 3HNYM 3T09A 3DYPA 3CZJA 1CX1A 4IUGA 4RN5A 2ZEYA 1CIYA 1XNTA 3A21A 3I2HA 2YB7A 4LHSA 3EYPA 2Y64A 5DMYA 1UY2A 2JDAA 1US3A 2WAAA 4YPJA 5DQ0A 4CUAA 3WNNA 3OG2A 2W87A 3MBWA 1W9TA 2VMCA 3WNMA 4MO3M 1LNSA 3W5NA 3ETPA 1L7QA 4MGQA 3WNLA 2BERA 1KGYA 1SG3A 1UZ0A 2LS6A 3PUIA 2J1TA 3LPGA 5JXGA 4A45A 1NAEA 3WF2A 3IAQA 4OMCA 1OT5A 4XUTA 1W0NA 3NJXA 1GQPA 3NRUA 1XPWA 2C4XA 3OEAA 3SKVA 2VCCA 2XONA 2Y6GA 4QX3A 2QBXA 5J1XA 4QB6A 1JZ2A 3I3DA 2HYXA 3IIIA 1W9WA 2VZTA 1R64A 2J7MA 4UAPA 2R7EB 3DYOA 2JE8A 2WBKA 3LEGA 2VZQA 3WNOA 1K12A 2VMEA 1GUIA 2BGPA 4BDVB 4XZUG 5JUVA 2VTFA 3UESA 1IQDC 1PX3A 1TVGA 4XUPA 1K45A 5IHRA 1XNAA 4P02B 3ECQA 1K42A 4BK4A 4JKMA 3MUZ1 3SKJE 3DECA 2QQJA 1US2A 2QQIA 3FL7A 3LQCA 4CU9A 2V72A 3LEIA 3K4AA 2J22A 1JU3A 3THCA 4D0QA 1O8PA 1PMJX 3FHAA 4QAWA 1GMMA 4ZZ8A 2VCBA 2WYSA 2EIBA 3W5MA 1CZSA 4P5YA 4TTGA 3T0DA 2VQTA 2W1UA 2C9KA 3C7EA 3FHQA 4LQRA 1UMHA 2J1AA 2W1WA 1JYVA 3NNGA 4UOJA 4E8DA 5EIYB 5JXIA 1JYNA 3I2KA 2QQNA 2OKXA 4ARYA 1W9SA 2CDPA 5C70A 3IDAA 4MOAA 4L0PA 4QB2A 2QQLA 3ACFA 2W91A 1D7PM 1BHGA 4M4RA 1JZ7A 5EJZB 2EIDA 5A1AA 3LE0A 2VM9A 1UWWA 2ORZA 3WEZA 1JHJA 2Z4FA 2RV9A 2Y6JA 3OGSA 2VZVA 5G04L 1GOHA 2ORXA 3CZUA 3VDCA 1UYYA 3WNPA 4BJ0A 5HPOA 3LPFA 2WO1A 3MV01 3D3AA 5CZKA 1ULPA 5JMOA 2J1UA 3WF0A 3CMGA 5DN2A 1JI6A 2X09A 4OZOA 3U37A 4XVHA 3P1IA 4PT6A 2BGOA 4LPLA 5F7UA 2JKXA 2WN3A 2W3JA 2E33A 3GM8A 4M4PA 4OMDA 5HXMA 1W99A 1SHWB 1WKYA 3I97A 1JZ5A 1J84A 2WUHA 3C8XA 3HN3A 4P08A 5G05L 3T2PA 1WCQA 2BZDA 3LEKA 2Y6KA 4GZ9A 3VD3A 4GWJA 3WF1A 2B9VA 2EIEA 3GGLA 4OUEA 1ULOA 2W46A 2VR4A 1UY0A 3C7OA 2XHNA 2L9LA 2W5FA 5C7GA 2ZEZA 4RYDA 4AAXA 2DCKA 3DYMA 1PMHX 4CVUA 5LCWL 3FN9A 4W4ZA 1DLCA 2X05A 1J83A 1KEXA 5IYYA 1GNYA 4ARXA 1OF4A 3VD9A 1L7RA 4A44A 4Z2AA 1F4AA 2E32A 2VZRA 2XQXA 3K46A 4CU8A 5FUIA 3C7GA 1JZ4A 4CU6A 2PQSA 3HPNA 2V4VA 1K3IA 4E8CA 3IAPA 4QDQA 2VMDA 5I0DA 3F2ZA 4XURA 2VCAA 3JXSA 4BK5A 4QX2A 1W8OA 3K77A 3ACHA 2W95A 2QQKA 2VL4A 5EJ1B 4XUQA 4TXWA 3CDZB 3K75B 1OD3A 5LA1A 3I2GA 2WO2A 5B4XA 2J1RA 1RYYA 1O8SA 4ZXEA 5IFTA 1NUKA 4A42A 4A4AA 4A3ZA 3I2JA 5C71A 4UI9L 1GOGA 2X10A 1JZ6A 3CQOA 4KMQA 2VO5A 4BXSV 4JKLA 2VZSA 4W50A 4ET7A 2W1SA 3T08A 2DCJA 2VQUA 4CUBA 3A22A 2XOMA 2VZUA 4CUCA 3OEBA 3WF4A 2YFZA 3HJRA 4DXTA 5IJRA 5JXJA 4AG4A 5LA2A 1EUTA 3BN6A 2YC2A 1CZVA 2E26A 1UYXA 3K4DA 3C7FA 2VZ1A 2VMFA 2W9XA 2JD9A 2WQ8A 1W8NA 2WZEA 5JR2A 1OF3A 3I2FA 2KD7A 2B4KA 2QQMA 1NKGA 4A6OA 2W92A 2ZXQA 1H6YA 3SEPA 1UX7A 1TG7A 1XC6A 2V5DA 3VD7A 3GDBA 2WDBA 3E1F1 1JYXA 2CDOA 4JHZA 2VOTA 3UETA 3VDBA 1UY4A 2WO3A 3MO4A 1F4HA 2WABA 4DXRA 1OH4A 4DEVA 3VD5A 3T2OA 2RJ2A 3HNMA 2WAOA 2VZ3A 2C26A 4LKSA 1UXZA 4W8JA 1JZ3A 4PQQA 2VZOA 3GXUA 3SEEA 1UYZA 3BGAA 3UNPA 1UY3A 3K4ZA 4P00B 4KI5M 4QX1A 1O59A 2W94A
chains in the Genus database with same CATH superfamily
4BIOA 4A6SA 2DVFA 3X29B 1WCKA 2W1QA 3CBNA 3WG4A 5FZ1A 2Q4SA 3KCCA 2E31A 4HL0A 1GQGA 2YG0A 4V1PA 2EVXA 3WDUA 4QQ2A 5TSWA 3QACA 3IBMA 4K8RB 5CU1A 4BLIA 3V65A 4CCEA 2OS2A 1PX4A 5BNNB 1SPPB 3AZWA 4MHRA 4YZ4A 2RS11 1RJ7A 3W59A 3A23A 2ZKLA 3SCFA 4BPZA 3T4HB 1ND3A 2ARCA 3ZPYA 4NJ4A 1QJZA 1SQ4A 1QDCA 4KGQA 2YDEA 1RB8G 1H8TA 1NOVA 3I3BA 4NOTA 4B7EA 3ZIXA 1OOPC 1LOGA 2UWAA 5CADA 4FOVA 3ASIA 2CWMA 3KHBA 4XCAA 2R063 3ZM8A 4GMP0 4JDMA 1QJU1 4U36A 1RC6A 5CISA 5DPNA 1EAH3 1P8JA 3NNJA 4HPKA 4JQTA 1XOYA 4MV2A 4CRQA 1PO21 4TZDA 4GMP3 4HSLA 2XLAA 2FQPA 4XUNA 1K5JA 1SACA 1LKNA 2GMPA 1AX2A 1C1LA 4PLNA 2J1EA 1ZBE2 3AKQA 2WZR1 3P5BA 4QT6A 5CYYA 5AFBA 5IK8A 4LBQD 4QXKA 3MLLA 3IKWA 5T5LA 5FZ3A 5L36A 4JKKA 4E4DX 3VD4A 3W20A 1LRHA 1X33A 4FTSA 4ZS3A 1CR7A 2WKKA 5KC5A 1H2LA 3U4SA 3D82A 3GBGA 4PI0A 4ATEA 5F3EA 4KWUA 3LZZA 4OI1A 4XHBA 4LBMA 1HN1A 2W47A 1T6BX 1UU6A 2OA2A 1GZWA 3J7HA 5DG1A 3P6BA 3VL9A 5IVJA 5IK7A 4YZ2A 5IVVA 1TNRA 1SLCA 3ZYBA 1PNFA 3T2QA 1VLNA 2ZGQA 1O5UA 4LE4A 4Q4V2 5FYYA 1DIWA 5C3QA 2VBPA 2P6CA 1U12A 1W3XA 3GBFA 4JCKA 4XBLA 3KQ4B 4AHYA 4B1MA 1VBC2 5I0UA 1RHI3 5D1IA 2MHFA 1WLWA 4HN1A 4QQPA 1VBD1 3WDYA 2XH6A 4IV3A 4M3CA 4QB1A 2E51A 4AFCA 2JECA 4FPCA 4ZZ5A 5GM0A 4CPBD 3JBG1 1A6CA 4Q26A 3WNKA 4CDUC 2Y6HA 5JWPA 1LHVA 4JX0A 1WMFA 2VJXA 2GALA 3H1WA 4CCCA 4HT1T 5D8AA 4XHXA 2XWJB 1LGCA 4R9CA 3WR0A 1F2NA 5KHIA 2QVSB 1HB4A 4FCAA 1U5YA 5H9RA 3V0AA 2V09A 3T09A 2D97A 1B35A 3ABZA 5IAVA 4IDZA 1XSQA 2Q8OA 1ZBA2 2PXJA 3DKQA 3TYJA 4JQRA 3S5AA 4FPYA 3NL1A 4Q4W1 4Q4X3 3H7JA 5FBZA 1J59A 2YB7A 3DF0A 2BBVA 1X82A 4LEJA 1U5ZA 2Y64A 5DMYA 2WWJA 2A6WA 5DAPA 2JDAA 1US3A 4I02A 4XZPA 2XPJA 2AZ5A 5F8PA 4CUAA 3VBUB 1WLTA 3WNNA 5E88A 4CCJA 1GWLA 1TZOA 1W9TA 4GA9A 2RMU2 5CKMA 3KCXA 3OBRA 1S2KA 4N7IA 4YGCA 1L7QA 4RGGA 3WOGA 5BNNA 3HBKA 1SG3A 1UZ0A 4RR3B 4GXLA 2LS6A 1ZBE3 4EN8B 3PVEA 5A7PA 1MZFA 4PJYA 4AL9A 3LPGA 5JXGA 2D44A 2PLV2 2ET7A 2OZ6A 4QKFA 3ZKUA 4LBKA 4Q8LA 4CP0A 3IAQA 1UOFA 1COV1 5CA6A 3OUHA 4XUTA 1W0NA 3NJXA 2BJSA 2E53A 4W6YA 1HRV2 5FV3A 5KWRA 3I3MA 3OEAA 3BALA 2BNNA 3AMMA 3I7DA 4QB6A 5A3PA 4RD7A 5A7QA 2HYXA 3NAPB 4BYYA 1OI6A 2VZTA 4RGAA 1R64A 3EXUA 1VRBA 1HW5A 2VOKA 4EE2A 3OY8A 2PFWA 3MW3A 4EWAA 1QMJA 4Q4V3 4QKDA 5GZDA 4UAPA 5BV6A 2R7EB 3DYOA 3LDBA 4IW3A 3LEGA 4XQWA 3RMXA 3ZOIA 1VBC3 1W8UA 2VZQA 3GZTB 3WNOA 5C4WC 5EJ3A 1C1FA 2VMEA 2IWGB 4UFHA 5FY9A 4CDXB 3U14A 5KXCA 1QOTA 4Q1RA 5BNPB 2WT0A 2VTFA 3KV4A 5ANQA 3RMYA 1RUH2 4NRQA 5JIAA 1A8MA 4AFAA 1YRZA 4YWAA 1MZ5A 1KJRA 1Z78A 3VKOA 4M01A 3N9NA 4YFZA 3DXUA 4BQYA 5FFOC 1W6MA 4ASMB 3M7AA 5LATA 4P02B 3ECQA 3KZ4C 1K42A 2H6BA 2C1FA 4LTAA 2G19A 2HWB1 3F95A 4PLOA 5JPNB 4NN0A 4YSFA 3Q9OA 2QQJA 2B46X 2QQIA 4HVOA 3OPZA 4JDOA 1ZBA3 1F5JA 1UCXA 3EBRA 2ZPXA 4QHBA 4QX5A 5JSOA 1OLMA 1J3RA 3N7JA 4XFAA 3RJRA 1HX6A 2D93A 2JIGA 1V70A 3THCA 3M3CA 3WQ0A 4GB33 3WP6A 1XYNA 4KQ7A 3MICA 4WVMB 2HEYF 4HN0A 4MXWB 5EXOA 5L19A 5DUXA 2EIBA 1N1YA 1WGPA 1XE8A 2BVVA 4FXGB 4IEQA 1AYN2 3OBZA 2KXLA 3GCWA 3B02A 2HWE2 2RMU3 4H2AA 4DRVA 3T0DA 4OFGA 2BOJA 2ZGNA 5BYNA 4XF1A 1JMUB 4RQPB 4XPVA 1OFNA 2X5IB 1YQCA 3WCRA 3VKMA 3BI3A 1CIWA 5FZHA 4AVAA 5T52A 1V6KA 1WMXA 4QD2A 1AF9A 2PLV3 1CAXA 1XNKA 5FKBA 4E8DA 1PK6A 4COZA 4FOYA 2ENRA 1RMU1 2BUKA 1HRV3 4XFGA 4YG6A 5K9YA 2MEV2 5JZGB 4INDA 3VHPA 5C70A 4IEVA 1YO8A 4NE9A 3ENRA 1JOJA 5FAXA 3EJKA 3ACFA 4OUSA 1RUF3 5FMDA 3L9JT 2W91A 3FJSA 3VBUA 1R082 5HCAA 1BHGA 3Q8EA 3ME2A 1LTEA 3SLIA 2DUPA 1ZA7A 3AMPA 1LU2A 4LO8A 4BXFA 2VM9A 1BBT1 2D3RA 2ORZA 3SXWA 3ATGA 4IEOA 5KHHA 2Y6JA 2ZGPA 4Q4Y2 4Y24A 5FPXA 4AW7A 1QNWA 3CZUA 4AQSA 1WLDA 5A32A 4RR3A 2WO1A 3QH7A 3MV01 2H6CA 2QKDA 3D3AA 5DZFA 2XLGA 5IVYA 1RUH3 1ULPA 5CZKA 5LASA 1FPN2 1X7NA 4Y3OA 2PQQA 3CMGA 3WF0A 1S0FA 1Q56A 4XQDA 5DN2A 4RHV2 1W2OA 5FZKA 2GC0A 2ZZJA 4HSJA 4XVHA 1PIV1 5CIRA 4PT6A 1HXS3 1NCQB 3E6DA 4IE6A 5F5AA 5LBBA 4YW3A 3MEPA 3ZVXA 3PHMA 1Y9QA 2WN3A 3H0OA 3NAPA 2E33A 4FPKA 5H9QA 3AP4A 5HXMA 1WKYA 1FX5A 1JZ5A 3AVRA 3T1MA 1O5LA 3O1SA 3U11A 3T2PA 4LHNA 2A6ZA 2ES3A 3AMNA 3LEKA 4GZ9A 2DURA 3S5QA 5HCFA 3UYJA 3VD3A 1U5XA 2B9VA 3WF1A 2ZX4A 4IE4A 5A33A 1A34A 1ZZ8A 3TB0A 3MIEA 3E6BA 3BU0A 5IVCA 2FDGA 4FFHA 4NIHA 2VR4A 2D6NA 4YG3A 2L9LA 2BQPA 2R6QA 2A75A 3KV6A 4XE9A 3DGTA 4LMFA 3OD4A 2HWE3 4RYDA 2GNBA 5AC91 1E5SA 1K5MB 1FT9A 2DCKA 1FYUA 4AZZA 4CDWC 5KC6A 3I54A 2RS12 3T2TA 1J83A 1DBNA 1KEXA 1CPMA 5IYYA 5FYIA 2G9ZA 1ZA4A 4Q0VA 1OF4A 4LLOA 5FOJB 3D0SA 4XILA 4EWEA 5ACA1 4BWOA 4D6QA 1F4AA 1YWKA 4FFGA 4CU8A 2WWSA 2AACA 2CYFA 1ONAA 2MEV3 3MFAA 2PQSA 1HQLA 4JC1A 4NROA 3ZXEA 4E8CA 1D4M2 1HN0A 1S2EA 3IAPA 2JIJA 5FPLA 4RS5B 1OOPA 4AFBA 1YQ8A 5T5OA 1W28A 1TNFA 1ULGA 1QJU2 3F2ZA 4WVMA 4XURA 5FZDA 5GLVA 4CXXA 3KF5A 4EROA 1GQHA 4L9BA 1R083 4B7KA 4KG0A 1PO22 5BPXA 3PIGA 4PDWB 4MZUA 2RJLA 2ZKNA 5IVBA 3A4UA 4LK6A 1JYCA 1UNBA 4BQ3A 4LUMA 1H8TC 3I59B 2V73A 1FAYA 2WZR2 4AVCA 3LA7A 4HFSA 2WT2A 2UYAA 5EHDA 3LFMA 5LA1A 1H9WA 1PVXA 3LDRA 2BP6A 1FPN3 2P4EA 5EV7A 1YFUA 1KS5A 2CY6A 2J1RA 3K3OA 4RHV3 2B7YA 2GAUA 1LU1A 4P9GA 3O1TA 3I8TA 4ORFA 2DFBA 2WNUB 4NO4A 5FZOB 3WW1A 4CCKA 5ISLA 2GSYA 4QGNA 4CEWB 4ZXEA 1QGLA 2RR11 5ERLA 3U75A 3AZVA 1GKBA 4A4AA 2E9QA 2ZHLA 5FO7B 2VUCA 1S0DA 5KBFA 2FDKA 5JVVA 1U5IA 1DU3D 4NHMA 2R32A 4UI9L 3ZDSA 1BVP1 1W9YA 2EALA 5GJ6A 1JZ6A 2PHRA 1PGSA 4UWDA 4CPBA 1NYWA 1MQTB 1QJEA 1ULEA 1O3RA 1O3QA 1GP5A 1NG0A 3BOPA 2K9ZA 2YMZA 1VBD2 4W50A 5A3UA 4R4ZA 3GZEA 1GWMA 1JS9A 5EZWA 1LOBA 3ALQA 3KMHA 3ZXLA 4OHYA 5HXVA 2XOMA 4N43B 2VZUA 3JBG2 4AI8A 3ZR5A 1KXGA 1RUC1 4P9XA 4CUCA 5A1FA 4OI0A 1SFYA 3HJRA 1LHNA 3ZIWA 4DXTA 5K0UC 4CDUA 3M1HA 2DF7A 4QU1A 1DQ4A 4YZ5A 2UY8A 3BN6A 1J1TA 2RE9A 4FOWA 2YC2A 1AR91 2JEMA 4FVVA 4IQPA 2QFEA 2E26A 1W8HA 3O1MA 4OHVA 5EYXA 2A3WA 2RS13 3IMMA 1G9FA 2VMFA 3RJ2X 3UKTA 2OXBA 3ILFA 3ZXGA 1MS8A 2JD9A 4R9DA 1R1ZA 4WM7C 4BOWA 3U4XA 1BEV1 1OF3A 2VAUA 1LEMA 2B4KA 2TEPA 4Q4W2 4YARA 2JWPA 4JTOA 3ZFGC 5GZCA 2QQMA 1NKGA 1NCRB 5D8AC 2XGXA 4A6OA 1PMIA 3FX3A 3KVBA 1D4M3 1UX7A 3LIGA 4PQ9A 3LIHA 3NMBA 4IL7A 3EMRA 2AGSA 2IFWA 1QJU3 2DWRA 5I91A 4HMZA 2JB4A 2WDBA 5ANNA 5I8SA 3ZMOA 1XSRA 4CP9B 3JD73 3N36A 4IEPA 1RJ8A 3PURA 1S1AA 3UKVA 4Z8BA 2LTNA 1ZM1A 3K48A 4FPOB 1ASJ1 1W04A 1I9RA 1K5MA 2MNGA 3H50A 1AUYA 5E1RA 4AI0A 1AR82 1F4HA 5FLHA 2WLQA 2WZR3 1R1A1 1OH4A 1BXHA 5GLZA 4ZXKA 3VD5A 3T2OA 1Q8SA 5FYSA 1COV2 1AVBA 2AC1A 2XLFA 2ZX0A 1S0JA 4I0AA 3FLPA 4QMAA 4IV1B 4WZCA 1NLRA 5DAXA 4CZSA 4COWA 4LJHA 3GXUA 3SEEA 1UYZA 4R8HA 3BGAA 3O0XA 2VQAA 4XQ4A 2JDPA 1ACCA 2JDZA 2JG8B 2UWCA 4KI5M 4P00B 4CDQA 4MX3A 4AYUA 5BNNC 2WFF3 1C5HA 4MHUA 4AVBA 3LA3A 2BFUL 2V4AA 3D0JA 4YYOA 2IUWA 1UKRA 5F5IA 1O6UA 3OCPA 3S57A 1FXZA 2K46A 4NHLA 2ZX3A 4PDWA 3QBQA 1AYM1 1VBD3 4FP3A 2VC9A 4QDSA 2WNVB 1OURA 3H1YA 5C4WA 3I59A 3KGLA 2P17A 1YFXA 4LR4A 5DG2A 3N7KA 2FMYA 5FRAA 1LGNA 5FCCA 3ES4A 1MS1A 3JBG3 3P3NA 1CPNA 2IFRA 5J96B 2I07B 4I0WB 4NHXA 1BLZA 2Y60A 2BFUS 3B93A 3LOIA 4XJUA 3SMHA 2J1VA 1SFNA 2RS31 4FPLA 3TN91 1BMV1 4O9EA 3SC7X 4YZ1A 1H1IA 5T5JA 4B4RA 3WG2A 4NIAA 2FCVA 1WLCA 2XWBB 3UGGA 5FZOA 2DDUA 2WNUA 1MPXA 4XTMA 2HWB2 4FTBA 4HKWA 5FZ4A 2XL7A 1XYOA 4EN0A 2QQUA 4KG8A 1DZRA 2HEWF 1AXYA 1IHMA 3CEWA 1VBB2 2P3IA 4ZY9A 2X29A 3MW2A 3I3EA 1KDMA 5JCTA 1DGRN 2NLRA 3KGZA 1MQTA 4MGSA 3BU7A 1CN1A 4OI2A 4Q4W3 2YBSA 5D2AA 4LOTA 1X50A 1OLRA 4A7ZA 2D7FA 2QCSB 3T0BA 1XNDA 1VALA 3N35A 4NR1A 2WS91 1G9BA 2HH9A 2B8MA 3WDXA 3DCQA 3SH3A 1LHOA 5FJKA 4HZFA 3POSA 4FI9A 4K7JA 3ZN6B 1D2SA 5AVAA 3L2HA 1QJX3 3KD4A 4K9SA 1N1SA 5JXHA 2ZMLA 3PVNA 4KH9A 2FDFA 1AR83 5H9PA 4XUOA 4Q2FA 3HD8B 2HLEA 1X8MA 1DYOA 4HOOA 5APAA 4EN6B 3RWNA 4L97A 1XE0A 1COV3 1YI7A 2XVKA 3ZYGA 4PF1A 2BPA2 2WRAA 1RMU2 1JTZX 1MACA 2VPVA 2Y6LA 2RDQA 2ZHKA 4UW4A 3VBRB 4AVTA 1OH3A 2J1SA 5LA0A 2PAEA 3CJIB 2H0VA 4PBPA 4Y22B 4DXSA 4NMIA 1REDA 1WMDA 1AX0A 3BCWA 4YW1A 1Z0HA 5A3OA 5HCHA 1LB2A 2VBBA 5F6KA 1CAUA 2JJ6A 3VBOB 5C5TA 4AQTA 2Y6FA 5HCBA 2P3JA 2DCZA 1W6NB 3OBAA 4AI9A 1Q8PA 4CP9A 3QLQA 1AR71 1JXNA 1XB9A 1UU4A 1LCLA 1KQRA 4TWTA 3RI8A 1CWPA 4MGYE 4BQ5A 3I2IA 5FTTC 2DTYA 5FY0A 1JH5A 1POQA 4JGYB 4ZHNA 3PUHA 1NE4A 2Z42A 4HG6B 3WDTA 4BQ4A 2DV9A 3ORJA 1H0BA 3ZYJB 5SV8A 1ZZ6A 4DUVA 4QX8A 4DQAA 1UZZA 5JIUA 5F2SA 4YW7A 4CU7A 3BYWA 3LSEA 2ERFA 1VBA1 3JB8A 3GNEA 4KBBA 4XYXA 5F1RA 2J42A 3WQBA 2HWB3 4QGLA 4Y33A 4YGBA 3CZJA 1C28A 1CX1A 2R072 4PI2A 4RR3C 3LEMA 3RFRA 4IUGA 3AYEA 3T4VA 4AE2A 1MVEA 1VBB3 1GZTA 3AMHA 3SHRA 2ZEYA 3A21A 4GIQA 2VMGA 2VU9A 4LHSA 1NT0A 3GBWA 4XACA 5DZGA 3BIWE 2YXSA 5DDJ1 2P2KA 5DQ0A 4XTPA 5C3SA 3LDKA 3HAGA 4XBQA 3G7DA 1NQDA 3OYWA 2W87A 3PUQA 1Q8QA 1SDWA 3Q8BA 3QOPA 4LBOA 3B9IA 4D6RA 3NAPC 1WW5A 1AR61 2AEYA 3S7IA 3AP6A 1LNSA 4MO3M 3WDVA 3GF6A 4QQOA 1KFXL 2CSGA 5AC92 5FP8A 3GHMA 2IXCA 4LXLA 2W0XA 1YXWA 4AI1A 1BJQA 3OGGA 2AENA 2RG4A 4QXCA 2J1TA 4CDWA 1AJOA 4YW4A 3R6SA 2D6MA 4P5HA 4A45A 4CDXC 4C0BA 1IG3A 2R49A 4X6QB 3KM5A 4QQHA 4A2UA 5BNPC 3NRUA 4EV0A 2C4XA 3B69A 2FZ2A 1IKQA 1RMU3 2QDNA 2KA3A 1V6IA 3APBA 5GZEA 3ON7A 1ENXA 3UJOA 5EP9A 2DTWA 4TYSA 5FPVA 5M0TA 3IIIA 3N9QA 1W9WA 1UPIA 1WBFA 2EXHA 4OZXA 4O9GA 1W90A 1N3OA 5SV5A 2VY0A 3I3QA 2VXJA 4M3CF 2JE8A 2WBKA 4J25A 4NRMA 1ZRCA 3FFZA 4LT5A 1C3HA 2VTXJ 1K12A 1GUIA 5FXZA 4BCUA 1VB2A 1W6PB 1QWRA 2FZ1A 3AZXA 1IPKA 5JUVA 1S0EA 1CD3G 4IESA 1BVVA 1FMD2 4IEUA 5FMOL 1K45A 4D6SA 4R9AA 3M3OA 2W2IA 3GHNA 3KT7A 5FY4A 1C8M1 5FYMA 2MPFA 3E5QA 3OPWA 4CP2A 1OLQA 1FNYA 3HT2A 3SKJE 4AGGA 2ZAHA 1QQP2 1UD1A 4RQPC 1OQDA 3PTRB 4Y22A 1V6JA 3PIJA 2X5IC 4YVWB 2G9GA 3N4MA 5A80A 3LQCA 2R073 1UN1A 3RYKA 2ZX1A 3HT1A 2EXKA 3ITQA 5A7WB 3LEIA 4XMIA 1IS5A 4L99A 5FYTA 3K4AA 5FMOS 3V64A 3RI9A 5FZ0A 1NY71 2DVGA 2YZ4A 4TSVA 1V6OA 2QQVA 1UZYA 1QXPA 1V6NA 2Q1ZB 4XFHA 2E63A 2VCBA 1ND2B 1XRUA 2XKPA 3JQXA 5JZGC 2JDHA 4JGYA 1CZSA 4COYA 3POJA 1RUC2 5LBCA 2VUAA 4XFBA 1WD3A 3ZXFA 4DY5A 4TTGA 3ILNA 2VQTA 5FY8A 5K0UA 5AC93 5LEKA 1HB1A 1DZQA 2C9KA 3J4UH 5A3TA 3FHQA 2D98A 2PA7A 3ZFFB 4AOCA 3NV1A 4BM8A 4P14A 4MSVA 3VBSB 2J1AA 4LORA 3CHXA 2W1WA 1JYVA 2CWSA 4XIOA 4UOJA 2DCYA 5EIYB 5JXIA 3H8RA 1C57A 3AFGA 4L92A 4LIVA 2OKXA 1OMIA 5FZAA 4CUGA 1BEV2 4AEMA 4WM7A 4BLJA 1W9SA 1RUD1 2XXZA 4ISRA 2UY9A 4OQ8A 3ZYIB 4IGOA 4YW5A 4GULA 2DUOA 4QB2A 3FBYA 4LKFA 5LA9A 1D0HA 1NCQC 3NNMA 4NPRA 4Y1UA 4NWWA 2EIDA 2EF6A 5L9RA 1IS6A 1S0CA 1FOD1 1UWWA 1TME2 2R1BA 1XJAA 1JHJA 2Z4FA 2RV9A 2WWUA 3OGSA 4JVAA 4BQ1A 4CCNA 1HQNA 4FPGA 5FP4A 1UYYA 2PHFA 2VNGA 2LALA 2NMNA 3M2MA 4XJWA 1PGW1 1FMD3 2WL1A 3USSA 3H3UA 1QOSA 1WWYA 1NA1B 4UT5A 3LOBA 1E5HA 1O4TA 5A6QA 1W6OB 1X9TA 4Y5Z0 4OZOA 4Q0QA 5J09A 5KXDA 3CL1A 1W2NA 3P1IA 1UIKA 2YBPA 2NM1A 3MIBA 2WSVA 3U1XA 4E2GA 3AFKA 5FZ9A 1QQP3 4LA3A 1K5MC 4KWKA 3ZFGB 1SPPA 1J84A 3POYA 3HN3A 4WV8A 5J98B 1BKZA 3O1OA 4XBNA 5JSRA 2AREA 1U0AA 2BZDA 2HWD2 4MYEA 5EFUA 4CXYA 1WCUA 3B9CA 3QH6A 2LRPA 1AYM2 1YI9A 1JOPA 4EYUA 2JG9B 1ULOA 4Y20B 2GP5A 1RGSA 1ST8A 2GMMA 3MIHA 1RL3A 3ZYFA 1UY0A 3THTA 5FYHA 1V0AA 2PHLA 3ZXKA 2XHNA 2ARAA 4RS5C 1HKDA 4QXHA 2BVBA 1QHDA 2RJKA 2YGLA 2ZEZA 4H7MA 4AAXA 3AXDA 1BMV2 1KRIA 3O12A 3ZSJA 3MF6A 2XR4A 1WA4A 3M3IA 3OGJA 5LCWL 1LHUA 5FREA 4PDWC 2B39A 4W4ZA 1DLCA 1Y3TA 2O1QA 4FOQA 5GKAC 3WUCA 5A1LA 1YFWA 3O1VA 1GNYA 3VKFC 4CTEA 2XL9A 1VE0A 5DUUA 4UBGA 2FCTA 4OUMA 2QZ2A 3ZPOA 4ZU4A 4I3GA 1RUE2 4A44A 5FO8B 4AVSA 4Z2AA 2E32A 2XQXA 5FYZA 1DGRA 1BEV3 2PELA 2FCUA 4RFRB 4DNYA 3C7GA 1PVC2 4CU6A 1V9U1 4PIYA 4XFFA 3HPNA 2XQRA 1REFA 4YW6A 2JDUA 3I4IA 4XDQA 4QDQA 2GZWA 3OUJA 1SBFA 5I0DA 2WNUC 2WS92 4CEWC 4EWDA 4LLFA 5IUQA 2XBO2 5FZBA 4Q1PA 2R0HA 3POIA 3RYRA 1KDKA 3THPA 5FR3A 2NMOA 3MIGA 5JAXA 4Q0PA 5CG8A 2NP0A 3KB5A 2QJVA 2WQ4A 3TNQA 1TME3 4BIFA 5CFCB 4S2FA 2VL4A 1NQJA 5FZ8A 3ELNA 4BMBA 1MQTC 1ENSA 2CNAA 4FPHA 4TXWA 4Q0SA 3VZJA 3ZFFA 2BRTA 5FUPA 1W0OA 2WIIB 4YNIA 3V56A 2GDFA 2A70A 5C3OA 1H4HA 1POV1 3LGRA 2HWC2 4LA2A 5C33A 2ATFA 4HXCA 5K8SA 4N43C 2DU0A 5LBEA 4I30A 1O8SA 1PO11 3CNAA 2ZGTA 3RG0A 1QEXA 4Z07A 1CONA 2UYBA 1N3PA 1Z7S1 1ZREA 1LOAA 3DUIA 2JB8A 2YC0A 4LE3A 1OC1A 4GKYA 4KU8A 4O61A 2OVUA 3J9SA 2C6SA 3PTYA 3CQOA 2RHPA 4TLGA 1VAMA 5K7PA 4JRAA 2HWD3 3MPPG 1VP6A 3E5XA 2Z69A 3T08A 1DQ0A 1AR72 4N53B 4P9YA 2FD8A 1AYM3 2VQUA 5FMCA 1A78A 5A3LA 3A22A 4E4SA 1QKQA 2ET1A 1OVPA 1NCRC 3PMSA 5A3WA 1UOJA 3FWEA 3OEBA 3QCWA 3WF4A 2QQWA 2YFZA 4PHZA 2VOXA 1SZBA 3H7YA 3KV9A 4Q0UA 2UWBA 3KCYA 4YM1A 1XXNA 2RS51 3GJBA 4AG4A 1IOAA 1NA1A 1Q3EA 1S55A 1HRI1 3S30A 4IGQA 1W6OA 1VPHA 1CZVA 3K3NA 3K4DA 1FV2A 1W8WA 2VG9A 3WDWA 1KFUL 2IC1A 3A0NA 4ASKA 2VZ1A 5I93A 5K4LA 1I5ZA 5FZIA 1SBDA 2D40A 1PGL1 4QX7A 3N9OA 3MZHA 1IG0A 2WQ8A 5FBJA 2WZEA 1IS3A 3ZFGA 1GR3A 2BTVC 2FBEA 3DKWA 3I2FA 1RUE3 3WW2A 2PHDA 1J1LA 5T54A 2OIIA 2RDNA 1OUSA 1DQ5A 2HKXA 1CAWB 1H9PA 2Q5TA 2RM22 4P9IA 1PVC3 3NSTA 5AFEA 3ZN4A 3KF3A 3TRSB 3POGA 4IV1C 5GZFA 4XC9A 5DDJ2 2JG9A 2JICA 5E16A 3VD7A 1RITA 2GMEA 2GNDA 2WS93 2JE7A 2JG8C 4NAOA 2GN3A 2XBO3 1I6XA 2CL2A 2ETEA 4BZ4A 3HBZA 1OKQA 3MLJA 2CDOA 1C4RA 4AVVA 1AR62 4JHZA 2VOTA 4FXKB 3MIDA 3OOXA 5FK7A 2DU1A 1YFYA 1F15A 3VZOA 1UY4A 1HDKA 4ES9A 2WABA 4GH4B 4DEVA 2XHKA 2RJ2A 2WNVC 3VB9A 3OTFA 5E8AA 2CTVA 3N9PA 2CU5A 2HWC3 1I3HA 4CDXA 2TBVA 2BNOA 4W8JA 1EAH1 4WVZA 2YU1A 5HV0A 3AZYA 1JZ3A 2ZA9A 2VZOA 4GMP1 5BNPA 1TQ5A 2NQYA 3POFA 5CKNA 5ABJB 4OVEA 1UY3A 3K4ZA 1AYN3 4QX1A 3H8XA 1O59A 3INAA 3TAYA 1J3QA 4U2AA 1O3TA 4O7XA 4MUVA 3NV2A 4V2WA 5E6HA 1LENA 1AXZA 4H14A 5F6LB 5C6CA 1ZYBA 1O4YA 1W6QB 2YFUA 4MGIE 3BUCA 1OQEA 2ZGRA 3ZYPA 1BYHA 3ZYHA 2VZPA 3OB8A 4FFIA 1ZRIA 2VOVA 3BKZA 1AR73 2IVIB 4E4ZA 5CFCA 1KD7A 3WV6A 3O1PA 1AL0G 3EB7A 4QPWA 2VVEA 1AHSA 2I74A 5KR7A 2H0BA 2VVFA 3WX5A 1WA6X 2LROA 3U0ZA 4OHZA 1Q8VA 2PAMA 3IIAA 4GKXA 4MXWA 1RXGA 1RHI1 4L2NA 5A7NA 1KS4A 2C5DA 1I5PA 4IEYA 2O8QA 3O7OA 2XKOA 4QPGB 3THDA 1CX4A 2ZOEB 2P1BA 4RQPA 4Q4Y3 2EXIA 3HQXA 3HVDA 3NJVA 2D3SA 3RPQA 2X5IA 4Y4RA 3WSOA 2ARXA 4I0BA 3RZJA 4BQXA 2HEVF 2RM23 3T0AA 4MADA 1Q5OA 1QNYA 2WN2A 5LEJA 1QJY1 4N53A 3ZX7A 3VBRC 3W58A 5LRRA 5DDJ3 4LUKA 4PBOA 4Z82A 4L11A 5LBFA 3WF3A 1XNCA 3CJIC 3A7QA 3AKPA 2Y8KA 4FPFA 1UXXX 5JZGA 1H8VA 1HV1A 2DVAA 2ADEA 3DEMA 3IB3A 2WZ8A 1AR63 5LRSA 4OYUA 3ACGA 1VRH1 2JDKA 3VBOC 4KU7A 1WW7A 4XFIA 4BMEA 4Q4X1 3POEA 5FZLA 3HN1A 1UZWA 2VECA 5L7OB 3OGVA 4N7UA 5A70A 5L9VA 5FO9B 1NLQA 1GU3A 5C8WA 3OGRA 2GH8A 2WFPA 4JGYC 4CA9A 3CKHA 3J26N 5IFPA 1UMIA 2HBTA 1T6GC 5FXXA 3K51A 3GCXA 3SQOA 2YBKA 1OHFA 1RUD2 1S2BA 2VH9A 1OBNA 4ISQA 3NV4A 2R041 1CVNA 1XYPA 4GD4A 1LOCA 1W06A 4GALA 4IXLA 3AMQA 3AX4A 2ZZQA 2ZMKA 3VBHB 5FPZA 2XDVA 3T30A 3ETQA 1IPSA 4AHWA 1H1MA 1QH7A 1JW6A 1H6XA 1NCQA 4KGGA 1FOD2 3FLRA 1YQ2A 1AL21 2ZTNA 4KWJA 5FYBA 4D8MA 1WD4A 5EYYA 5JOYA 2WZPP 5BNOB 5CFDB 5I0RA 3N9LA 4LULA 4GH4A 2A6XA 2FMDA 4DEQA 1STMA 2ZEWA 3RGBA 5LWBA 1GYKA 2GP3A 4K8FA 2EICA 2PHUA 5FKCA 1PHMA 1MS0A 2JDMA 3MPBA 3E6CC 2VGDA 1AZDA 2P37A 3Q8AA 4MG2A 3C3VA 2YC4A 1PO23 5T5PA 2F17A 3JZVA 4Z2WA 1Y7BA 2VNVA 3LSDA 2B5HA 4WVWA 4QGMA 1W2TA 5LK7B 2W68A 3KVAA 4BU2A 4CCLA 1CIYA 1TEIA 1W6QA 1XNTA 4LHKA 4DINB 1SCRA 3LB9A 1VIWB 3OUIA 5CEHA 3UGFA 1W8TA 3EYPA 4META 2WAAA 1X9PA 2XJTA 3GZUC 5FP7A 3BIEA 4Y1VA 4JGZB 4LBJA 5F3IA 4YVSB 4PF5A 4HANA 3OG2A 3VGIA 1RUG1 2Y0OA 3WNMA 4NIDA 3W5NA 2ZGKA 5J3UA 3ETPA 4RS5A 1ZBA1 1UU5A 2DBIA 1RIRA 3OJBA 4MGQA 4RA0A 2Y33A 4GAZA 1UOGA 4DO0A 4LK7A 1HV0A 1HB3A 1UX6A 3LA2A 4GB31 1LOFC 3WF2A 4AGVA 4OMCA 4QPGA 4CEYB 1R091 3RYPA 2ZABA 3USUB 1XPWA 2VBDA 2OZJA 1YC61 3KSCA 4JRLA 2VCCA 5DAVA 1GICA 2Y6GA 2Q0AA 4QX3A 2QBXA 3H8UA 5J1XA 2RMU1 5LZ6A 1RUD3 5F5CA 3LFIA 4XJ8A 1JZ2A 3MFCA 2A71A 4DIQA 1WCDJ 1QH6A 2J7MA 1DF0A 2Y34A 3GYDA 2Z2SB 4FAGA 4NRPA 4RL7A 4K3UA 1DGWA 3PVOA 4CEWA 1IPJA 2PLV1 1N1TA 4YVWC 2QZ3A 1FOD3 2W52A 3VBFB 4WM8B 1HRV1 4QM8A 3WUDA 1LULA 1LAJA 2ZMNA 4IEWA 4XZUG 1IQDC 1GANA 1PX3A 1TVGA 5L7OA 5FXWA 5IHRA 2CGNA 1ND2C 1RUF1 1XNAA 2XJPA 4XF4A 5IVFA 4BK4A 1S4CA 1PO12 2ZHNA 4N43A 3RZGA 4AR2A 3DECA 4K6BA 1G6NA 1G9CA 5FUNA 4AEDB 4F7ZA 1FNZA 1ZX5A 2FDJA 3W9AA 3FL7A 3ZFFC 1MEC1 4E2SA 1ENRA 1W2UA 3AXEA 4XF9A 4CU9A 3IDEA 3VBSC 5F5QA 3NVCA 2J22A 2AUYA 1JU3A 4D0QA 1O8PA 1URXA 1ULFA 2Q8EA 2XJSA 4CDQB 4D7TA 2C24A 1GMMA 4ZZ8A 4MGTA 2WYSA 5CFDA 4UFIA 1HXS1 4OCTA 2IXHA 1L7LA 1YLLA 4P5YA 1NCRA 3UT0A 2EAKA 1ND3B 2OPWA 4IERA 1RUOA 4H7LA 2RS52 3WG1A 1F35A 3WXPA 2DUQA 1HRI2 5KXBA 2PHTA 4M0NA 2W1UA 4HBNA 2R0FA 3AP7A 3U07A 4LQRA 5A7SA 5KXEA 3VZKA 5I8TA 5EPAA 5JR7B 1UIJA 1UMHA 1ZZCA 4WVVA 5FXVA 4EZHA 2F4PA 3GZAA 5FQ0B 3NNGA 1MS5A 2K2SA 4NVPA 2EA7A 1BBT2 1PGL2 3ZN5A 2JDNA 3WG3A 4JAAA 3CU7A 3I2KA 4DZGA 2JKBA 4HPKB 2ZHMA 4X8PA 1UO9A 3BTAA 1GP4A 3SH5A 3WD5A 2NN8A 4XJAA 4K40A 3SNMA 2CDPA 1NA1C 4DMIA 3TEZA 3IPVB 4G3YC 1GLHA 4B8EA 3IDAA 4ZS2A 3B01A 2LUWA 2XG3A 1HJGA 3MLKA 2NPIA 1ZRFA 1YYNA 3R4SA 2F6BA 3AL6A 2VUJA 4IV1A 4K20A 1PIV2 1A8DA 1NZCA 3T1LA 3MYXA 4M4RA 1S0GA 5IK5A 5FZEA 1J3PA 2JG8A 3M3EA 1TMF1 2PYTA 2D6OX 3LE0A 4IE0A 3WEZA 2XVLA 3FHIB 2HJIA 4XXPA 3RS6A 5DAQA 4C90A 2VZVA 1ZRRA 5G04L 2BDRA 5IVEA 1TE1B 3VDCA 3WNPA 1F8VA 4FSJA 2PTMA 2EIGA 3FE5A 1JBCA 5FPAA 3ZMNA 2SLIA 4AI3A 2JG9C 5CAZA 2J1UA 2R30A 3B7MA 1ZZ9A 4CEYA 1JI6A 1POV3 1ZNPA 5FLIA 2WNVA 3USUA 2P6HA 2X09A 3U37A 4K1YA 4E27A 1F9KA 1DYPA 4Z1VA 1W8ZA 2QQPA 4W6XA 1OKOA 5F7UA 4M3CB 2JKXA 3J7LA 4YM2A 4HK8A 1XNBA 3GM8A 4M4PA 4OMDA 4YGDA 1W99A 1SHWB 4MLOA 3I97A 4O65A 3VHOA 4URTA 2Q8DA 5EWSA 4QPIB 4UW5A 3POWA 4FT8A 1WCQA 4D94A 1FPN1 4Y5SA 4FTEA 2EIEA 3J7NA 3VBFA 4OUEA 1WZXA 4R9BA 4RHV1 4WM8A 5CKQA 1OSGA 4J6GA 5ACA2 1JN2P 3J8F1 3ILRA 5GZGA 4UF0B 1OFSA 1LGBA 1W8FA 1UAIA 4CE8A 5F9TA 3OSDA 3J7MA 3O1RA 1B35B 2P34A 2VOWA 2W5FA 3PL0A 3KT1A 5C7GA 2RS53 4GJYA 1PMHX 1HRI3 4CVUA 4TN7A 2ZS6B 4BB3A 2YGMA 3K2OA 1X36A 3HR9A 2X05A 1RHI2 5FWJA 1CAVB 3ZN6A 5CFCC 4AEDA 2HWF1 1BBT3 3VD9A 3PUAA 5F39A 4K21A 5A6YA 1DLLA 2VZRA 3K46A 5I0TA 4Z92B 5FUIA 5C9AB 3WP3A 2P3KA 1FI2A 1JZ4A 5FZCA 3ZSLA 2V4VA 2WNEA 2OT7A 3WINE 3KQRA 1B09A 1LODA 3M8LA 3KLSA 4QU2A 1QJY2 4NPMA 1E57A 2AEZA 3HQUA 3SCGA 2VMDA 3UKNA 4IETA 1LR5A 2C0ZA 1Y43B 1Q43A 2BYVE 3JQWA 4B4QA 4CYDA 1EV11 2UU8A 2R1DA 2VCAA 3VBRA 4BK5A 1PIV3 3K77A 3ZFEB 3ACHA 3B3QE 2ZBJA 2ZCWA 1H2NA 2I2SA 1CJPA 2RR12 5I8YA 3CJIA 1JYTA 5B2GB 5FYCA 3TWIA 1UL9A 1VRH2 3WQ7A 2QQKA 3AB0A 2XUMA 4J1WA 5EJ1B 2D6PA 2PAKA 2A3XA 4Q4X2 4ZPIA 3VBOA 1WW4A 2YV8A 2BWAA 3CDZB 1W6NA 3K75B 5IK4A 4N53C 3VUOA 5FQ0A 1D4M1 2K0GA 4NHYA 3KHCA 1PM4A 2WO2A 4WBBA 5LW9A 3DN7A 4OHWA 4HONA 1NE6A 1H4GA 4Y1ZA 4C91A 1RYYA 3CJXA 5F3CA 3OY8B 3RRDA 4DFSA 4X8NA 3ST7A 1WBLA 3JD71 1NUKA 5IFTA 4KNCA 4N90A 3N7LA 5LY2A 4A3ZA 5F37A 1ENQA 3IPVA 4HKLA 1MR5A 2R042 5C71A 5JLVA 2LM3A 1XU2A 2X10A 3E5UA 2WINB 1AR92 3HIFA 3Q8FA 4KMQA 1D0GA 2VO5A 3EO6A 3PMEA 3BPZA 3ZYRA 2VZSA 2YUEA 4UFLA 3SH4A 3CLPA 1XE7A 5JOWA 4RGKA 4XJZA 3WCSA 1XQNA 1DQ6A 3BTZA 1GZ9A 1EPWA 1AL22 1W6MB 2WLPA 3ZXDA 3DPRB 2A7AA 1SEFA 3R4UA 4MXVA 5ACA3 3TEWA 4XAEA 5JSPA 4GJZA 1LEDA 2WFF1 4XDPA 5F3GA 5IJRA 2Z5WA 2N7GA 5LA2A 4QKBA 3JU9A 3FLTA 4XOGA 2BEOA 3AYDA 5A7OA 1UYXA 1M06G 4AQ6A 1NXD1 2A73B 3KV5A 1N1VA 1UF2C 5J7MA 3IZOA 1E5RA 4XMAA 2OYZA 5C3RA 1WUVA 3VZNA 1QIQA 1VB4A 3ZXAC 3AKTA 4HVRA 1W8NA 1ASJ2 2DVDA 1YIPA 4Q27A 5FY1A 4ZONA 3AYAA 4GH4C 4M0HA 5CB7A 4QPIA 1VMFA 2WSUA 1RUJ1 3OD0A 1BQPA 1R1A2 5JI7A 4M00A 4EJRA 1OA3A 4JZRA 2W92A 4F3JA 1H6YA 3B94A 1XU1A 3BODA 4P9WA 1IQAA 4J1XA 3S7EA 4BQ2A 1QJY3 1XC6A 4XF3A 3PNAA 4G9SB 5BNQA 2D6LX 2W08A 4QM9A 5ABJC 3I2OA 3I2DA 3FUOA 4UF0A 3LF7A 3AKSA 1RUG2 2JDYA 5FY5A 4IE7A 2RR13 1JODA 1CAXB 1WMEA 4Q29A 1PK6B 2WJSA 2VMIA 4LO4B 1UW8A 1GZCA 1VRH3 2JX9A 3CO2A 3UV9A 4ATFA 3VDBA 2YY1A 2WO3A 3LAGA 3MO4A 4QPYA 4W65A 5EQUA 5FZFA 4HKOA 3VDDB 1CAVA 4GB32 2IVJA 1BK1A 4YM3A 3RZHA 4PIZA 2E7TA 5T50A 1R092 1LOFA 2VZ3A 3AKRA 4UFMA 4LKSA 1DHKB 1W6PA 3O0VA 2X53S 1ZVFA 4S2DA 5C9AA 1QJX1 1RUC3 2ZX2A 1VBE1 5FOBB 4AF9A 1RVF1 5C8CB 1Q8OA 2R043 3TN92 2RS32 1WW6A 4IE5A 4ITCA 5DAWA 5A32B 1AR81 2W94A 3UK9A 1SLBA 4UW6A 1AR93 1JYWA 1FATA 1RUNA 1D2QA 3VKLA 3ZFEA 5LB6A 4QPGC 1EUUA 1LHWA 1W0PA 1W9FA 4AEJA 5BXXA 1VAKA 4YVWA 3GJAA 3NQHA 4D69A 1AL23 3HQRA 1OQ1A 4NUBA 5A7WA 1T2XA 2YYOA 4WZFA 3S0MA 2B42B 4AGRA 4RSUA 3ACIA 2GC1A 4N9IA 4S2HA 1EP0A 4YM0A 5D21A 3RWKX 1DGWX 1SDDB 2PHXA 1RUF2 4DUXA 4IEXA 4N8MA 4A41A 1ND2A 3VZMA 5B4NA 5CG9A 4H3WA 2RDRA 4CCOA 3SITA 1YEWA 1QJFA 1V00A 3AC0A 4NHKA 2GNMA 5FK8A 2LW8A 3MV11 4HETA 5A33B 2ZEXA 1JHNA 3SISA 3VHRA 1MEC2 3WW4A 1ASJ3 4ONUA 1DGLA 2Q8CA 4EN7B 5L7OC 2ZGUA 5BY5A 5GALA 3VBSA 1F31A 2VNOA 1R1A3 2VW0A 2G1MA 3C7HA 1SCSA 2DYCA 3HEIA 1GV9A 4AEKA 4CCDA 2DCTA 3DPRA 1GOFA 3TEXA 1HXS2 3IT8A 3LD8A 2OUJA 1CGPA 3HNBM 1V6LA 1RUG3 3ES1A 5JI9A 1GBGA 4QHOA 3VBHC 3DL3A 5DUVA 2Y38A 5GLWA 2BBAA 3VDAA 5HBAA 3FZ3A 1VBB1 5A6ZA 1OPOA 1YJKA 3BVCA 1JUHA 1QU0A 1G9AA 1DFQA 2AH2A 3VV1A 4ES8A 4FFFA 4QX0A 1W39A 2OX0A 3EQEA 2UURA 3E97A 3NJYA 5I0SA 1RUI1 4BE3A 1HJFA 2RVAA 1RINA 2YHJA 3H3LA 1OOPB 2OUHA 1YHFA 1QF3A 5BNOC 5CFDC 1ZZBA 1JZ8A 1R093 2BV4A 4GWIA 4LBNA 4NAMA 4DPNA 4E2QA 5DABA 1UY1A 3IWZA 1CESA 5KHGA 4BISA 2VUDA 2XB6C 1W05A 3TNPB 1SLIA 2NYYA 4LBQB 3MW4A 2VE1A 4BH9A 1AX1A 3S6PA 3BOWA 1CZTA 3Q8CA 2YROA 2YPJA 3TN93 2RS33 1OPMA 3QD6A 3WHTA 1H30A 2QQOA 4I2OA 1KITA 4QDRA 5FYVA 1VBA2 1C5IA 2ILMA 2Y0IA 2VCMA 3IMNA 1JYIA 1TMF2 1L3JA 3MDPA 2W39A 1G9DA 4AXOA 5FYUA 4X6RB 3WVJA 4QWNA 4QQLA 3M4FA 2ID4A 1ODMA 4FPEA 4DUWA 1RTVA 4F8AA 1D4VB 1DP0A 1JU4A 1Y9MA 4Y1YA 3CIHA 1PZ7A 3VDDA 4QXBA 3MUY1 1NX9A 3PU8A 4XABA 2OQ6A 3ZSEA 2GH2A 4B1LA 3O0WA 4JGZC 2VXRA 4YVSC 4V2VA 4Y20A 3R0RA 3H42B 4AFMA 5DUWA 4DXZA 2WYFA 1LESA 1H1AA 3U78A 3H1MA 5C3PA 2Q1FA 3JB4C 4Q8KA 2KM2A 2PHWA 4IGPA 2I45A 2VW2A 3HOBA 1YQ5A 1SLTA 3HNYM 1SLAA 4B29A 3PDQA 5FWEA 3DYPA 1HQWA 5C8CA 5CBLA 4QKNA 2OQ7A 4XF0A 4Q5OA 1MEC3 2CAVA 1SMVA 1H2MA 1OUXA 4RN5A 5GLUA 3RQ0A 3I2HA 3WZ1A 2QTWB 4QHZA 3RZMA 2VULA 4XXAA 4CEYC 2R061 4I3PA 4CDUB 3ZSMA 1UY2A 4YFWA 2IXJA 5FPUA 4YPJA 4CSWA 3AL5A 1EYBA 3J8F2 5JOZA 1VJ2A 3MBWA 1H2KA 4FQ4A 1SLLA 2VMCA 2WNOA 2R16A 3FMGA 4YZ3A 3RZZA 4AFDA 1DQ2A 1CJDA 1MS9A 2R071 3ZO0B 4S2GA 2Y26A 2O14A 3WNLA 3UGHA 2BERA 1KGYA 4C1WA 3WT3A 3PUIA 2ZAAA 1I1EA 3T3YA 3ZKYA 3VBFC 1PNGA 1RXFA 5FP3A 4WM8C 3WP4A 1W2AX 5LK5A 1NAEA 1F5FA 3D4KA 3V0BB 1UZVA 1OT5A 4FPJA 2ZJCA 2HWF2 4ZU7A 2XVGA 1BK0A 1J58A 1GQPA 4LO5B 3AVSA 1QXJA 3SKVA 1NXMA 2XONA 4BHPA 4GWMA 1N47A 3I3DA 2BOIA 4G4FA 4FBFA 1O7FA 4OLLA 4LBLA 4LKEA 4A7YA 3W21A 1C8M2 4D7YA 3MIFA 1EV12 3NW4A 3TOJA 4R52A 4AEDC 4XEZA 4DOUA 1VBA3 1BZWA 2PMWB 4UXAA 3BTXA 4MVTA 2WT1A 1YQ6A 1TMF3 2CV6A 2GC3A 3MI8A 4XJ9A 3FFQA 3VKNA 2BGPA 3VLBB 4BDVB 1Y9GA 2CAUA 3UESA 3LKJA 4XUPA 4CP1A 4CDQC 1NY72 2CGOA 4BQWA 1DDLA 5T3NA 4LITA 4CCMA 3PJYA 4JKMA 5IATA 5JMCA 1ND3C 3MUZ1 1S0BA 4LBQA 3JD72 5HI0A 3NO8A 5FIXA 1OA4A 1GWKA 4XIKA 3KWVA 3MGUA 4JV4A 2O0OA 1QXRA 1US2A 5C4WB 4PIXA 2A3YA 3HMYA 4R4XA 2V72A 4XDOA 4DRRA 2EXJA 4EQVA 1FMD1 1O91A 2WA4A 2OPKA 3N7MA 1PMJX 2QDRA 3FHAA 2FDIA 2WC2A 3UJQA 2ZGLA 4QAWA 2XJUA 5A3NA 1AJKA 5CNAA 4EN9B 5IWFA 4AK3A 1LECA 4OI4A 1PZ8A 2F4LA 3RZKA 3W5MA 2TNFA 3J8F3 4UFJA 1CAWA 1UKGA 1QQP1 2WO7A 4LHLA 3P3PA 2WFF2 1LOEA 2QUOA 3AP5A 2Z79A 2G9FA 2XJRA 1ZBE1 3C7EA 4CXWA 2DVBA 2AR6A 2VNRA 3AM2A 2WQZC 3CF6E 2NZ9A 1YCIA 2DFCA 4I01A 4GWNA 2GNTA 4UW3A 5FZGA 3VL8A 1JYNA 2HWF3 1MS3A 2QQNA 3ZLIA 3WNXA 4ARYA 5J36A 2E7QA 2CGPA 2P5BA 1YNAA 4W6WA 4LKDA 2FHRA 3OPTA 4LO6B 1RUJ2 4FP2A 1PGW2 2D5HA 4MGZE 4HVQA 4HLTA 4Y5TA 2X8KA 4MOAA 5FZMA 2KR2A 3NKGA 4L0PA 5GLTA 5FDBA 2QQLA 3AJZA 4Q4V1 1C8M3 1D7PM 1MS4A 3H9AA 1EV13 4IV3C 1VBC1 5EJZB 5ABJA 1JZ7A 3HWJA 1ULCA 3R05A 5A1AA 2XUEA 2A6YA 1IS4A 3EHKA 3FBMA 5A3MA 4A7KA 2B45X 3AYCA 3ROUA 2Q1MA 1JUIA 1SFPA 3DV8A 4QPIC 1GOHA 2ORXA 3KS7A 4COUA 1REEA 2ADDA 4BJ0A 5HPOA 3LPFA 4Y4YA 1PZ9A 4JDNA 3VHNA 3O5SA 3POBA 5JMOA 3H8OA 2YPDA 2BGCA 3V0BA 4YGEA 3NJZA 4AHXA 3G6JB 4I09A 1CAUB 2B9UA 1OXCA 2OW4A 1B35C 3JUUA 2BGOA 2E7AA 1OVSA 2G4IA 3NV3A 4RFT0 4XW3A 4OHXA 4LPLA 4AAPA 1QJX2 4AI2A 1TME1 1VBE2 2RDSA 3SCHA 4LIUA 2W3JA 1RVF2 1SBEA 4Y26A 3I49A 3NWKA 1YUDA 2WUHA 3C8XA 4P08A 5G05L 3L2YA 5BUVA 4H55A 2D6KA 2IXLA 2Y6KA 3FUQA 2JE9A 4E9KA 2VQ0A 3RNSA 3R4DB 1UPSA 4GWJA 3O1UA 4PCRA 3GGLA 5FP9A 2IXKA 5A6XA 3AK0A 1DG6A 1EPZA 2W46A 3IDCB 4KL1A 5FMBA 5C9AC 4D3WA 3M3QA 2P3YA 3BTYA 4FQZA 4LNVA 1VR3A 4M3CE 1G7YA 1QY4A 1NZIA 3C7OA 3N9MA 5CVRA 1V9U2 5FPBA 2D3PA 4N9HA 4DS0A 5FLJA 5IAXA 2O8OA 1UQXA 2E6VA 3DYMA 4P9LA 3RVHA 3ZFEC 4C8DA 1GSLA 3FN9A 3D5OA 5FJHA 3GALA 5AVPA 2HWD1 3PLQA 5IW0A 4ASLA 1AXKA 3FC0A 4ARXA 3IN9A 4JTNA 4MH0E 4MGKE 4NIGA 1ZZ7A 3N3HA 4ZKTB 5DZEA 1UYPA 1L7RA 1G86A 1ODNA 2TUNA 3WQ1A 2CHHA 2VMHA 4E4HA 1V6MA 3BB6A 4NIIA 3OYWB 1PM7A 1A3KA 4SLIA 4URAA 2XJQA 4DB5A 4YG0A 1DCSA 1BCXA 1RUJ3 1K3IA 1E5IA 5F32A 4ZU5A 5J48A 3WY6A 4C1XA 1XBFA 2BU9A 3ZR6A 5JPMB 4TLFA 2JENA 3JXSA 3NNLA 4QX2A 1QOOA 1W8OA 1DYKA 4CDWB 1Z7S2 3B5LB 4GQ7A 4XAAA 5FZ6A 1MVQA 3ZXJA 2W95A 2BNMA 2ZGOA 5DXDA 1FV3A 2QNKA 3A0KA 1Y4WA 1RUE1 3MHZA 5F2WA 3VBHA 4XUQA 3AP9A 3NKTA 1G8WA 3D6EA 2PN5A 4UFKA 4NWVA 5JOXA 2FDHA 1PVC1 1RUH1 5H9SA 1OD3A 3RZLA 1VMHA 3WHUA 1QDOA 4IEZA 1RUI2 1EY2A 2AYHA 2BWCA 3DPRC 3I2GA 4LO7A 4LOSA 5B4XA 4AQ2A 5J37A 4FO9A 1LJ7A 4HK9A 4FAHA 1DZTA 1W3VA 2GC2A 4YLZA 2XBO1 1CQ9A 1M4WA 5BNOA 3O14A 1C8NA 5FZ7A 3NNFA 4NPLA 1JOBA 2XJVA 4A42A 1YIFA 3IM0A 5C5UA 3I2JA 4AWDA 1VBE3 2VW1A 1HLCA 1RVF3 2VD7A 3UL2A 1IZ3A 3B00A 4L8QA 1GOGA 4JHTA 2ARBA 3RSJA 1H8TB 1VMJA 2IZWA 3OBTA 1GNHA 3M70A 4JKLA 4BXSV 2ZACA 4ET7A 2W1SA 2HWC1 3PU3A 3AZZA 2DCJA 1GNZA 5T55A 1UOBA 3LWCA 3WW3A 4CUBA 3LCPA 5HV4A 3WLUA 2DBNA 2SBAA 3MF9A 3ACLA 3AJYA 1AYN1 2HWE1 2A5ZA 1V9U3 4UBHA 5JXJA 1IKPA 3PVBB 2D43A 2JXAA 4AHZA 1HIXA 1EUTA 2C9AA 3VZLA 4P9JA 4C0HA 4JGZA 1YJLA 4YVSA 4KWLA 2V5YA 2IXIA 1WCSA 3C7FA 2HYKA 1KJLA 3PUSA 4SBVA 1PK6C 2W9XA 2QE3A 2JD4A 3D8CA 4D7SA 5E89A 2BW8A 4B4PA 5JR2A 3DXTA 1OA2A 1GFF2 1POV0 3VDDC 2KD7A 1VAVA 2MEV1 1GZWB 3ZDVA 4KBZA 1S0IA 3ZSKA 4F83A 3TEYA 2R062 2ZXQA 3RDIA 3KT4A 3SEPA 1O4ZA 2VTXA 2WA3A 4COVA 1IGOA 1TG7A 1OLME 1HB2A 3VBUC 2V5DA 5K0UB 2ZGMA 4PLMA 5KHKA 1MZ6A 4Y1XA 1EAH2 4XCBA 1R081 2YU2A 3WP5A 4B3NA 3GDBA 2GU9A 2A1XA 3E1F1 1PO13 5LY1A 1W03A 1JYXA 1APNA 1DQ1A 2D5FA 1O3SA 5C8CC 2WR9A 1Z7S3 4K1ZA 4IV3B 2XMLA 4UYBA 2EAAA 5FY7A 5L73A 5L9BA 4Q4Y1 1UMZA 4BA6A 1NLSA 3UETA 2GN7A 4DY3A 3OF1A 4WM7B 4OQ9A 3VN4A 1ZRDA 4DXRA 2RM21 2Q30A 4A3XA 3URFA 3HNMA 2WAOA 3U10A 4XETA 2A6VA 1RUI3 3H3ZA 5D8AB 5JDBA 2C26A 3IDBB 1UXZA 1GP6A 1X8EA 4XFCA 4PQQA 2VVDA 1OD5A 3V0AB 4EZ4A 2ZGSA 3C2UA 3TBDA 3JCIA 3UNPA 1MZEA 3BPSA 1ALYA 5KHJA 1ULDA 4OULA 5IT6A 2HBUA 4YRDA 1N3QA 3PJQA 4YW2A
chains in the Genus database with same CATH topology
1JYWA 2YFUA 1EUUA 2W1QA 2VZPA 3OB8A 4QDSA 2VC9A 3NQHA 2E31A 2YG0A 1T2XA 3EB7A 4QPWA 3ACIA 2J1VA 1PX4A 1SDDB 4DUXA 4A41A 2DDUA 1MPXA 5B4NA 3A23A 1I5PA 3AC0A 3THDA 2LW8A 3MV11 2ZEXA 3NJVA 4ZY9A 3I3EA 3WSOA 3I3BA 4MGSA 3T0AA 4MADA 2WN2A 3C7HA 3ZM8A 3HEIA 3T0BA 1GOFA 3WF3A 5DPNA 1P8JA 3A7QA 2Y8KA 1UXXX 4XUNA 3HNBM 4FI9A 3IB3A 2WZ8A 4OYUA 3ACGA 2BBAA 3VDAA 5JXHA 2J1EA 5CYYA 4QX0A 4XUOA 2HLEA 3OGVA 1DYOA 4JKKA 3VD4A 2RVAA 1GU3A 1JZ8A 3OGRA 4GWIA 4PF1A 3CKHA 5IFPA 1UY1A 1UMIA 2Y6LA 4KWUA 1HN1A 2W47A 2J1SA 5LA0A 3J7HA 3P6BA 4DXSA 1CZTA 3T2QA 2QQOA 4QDRA 3OBAA 1H6XA 4QB1A 1YQ2A 4D8MA 3I2IA 4ZZ5A 2ID4A 4DUWA 3WNKA 1DP0A 1JU4A 2Y6HA 3PUHA 4JX0A 3CIHA 4HG6B 4DEQA 2VJXA 2ZEWA 1NX9A 3MUY1 4DUVA 2EICA 4CU7A 2YC4A 3WQBA 3HOBA 3ABZA 3HNYM 3T09A 3DYPA 3CZJA 1CX1A 4IUGA 4RN5A 2ZEYA 1CIYA 1XNTA 3A21A 3I2HA 2YB7A 4LHSA 3EYPA 2Y64A 5DMYA 1UY2A 2JDAA 1US3A 2WAAA 4YPJA 5DQ0A 4CUAA 3WNNA 3OG2A 2W87A 3MBWA 1W9TA 2VMCA 3WNMA 4MO3M 1LNSA 3W5NA 3ETPA 1L7QA 4MGQA 3WNLA 2BERA 1KGYA 1SG3A 1UZ0A 2LS6A 3PUIA 2J1TA 3LPGA 5JXGA 4A45A 1NAEA 3WF2A 3IAQA 4OMCA 1OT5A 4XUTA 1W0NA 3NJXA 1GQPA 3NRUA 1XPWA 2C4XA 3OEAA 3SKVA 2VCCA 2XONA 2Y6GA 4QX3A 2QBXA 5J1XA 4QB6A 1JZ2A 3I3DA 2HYXA 3IIIA 1W9WA 2VZTA 1R64A 2J7MA 4UAPA 2R7EB 3DYOA 2JE8A 2WBKA 3LEGA 2VZQA 3WNOA 1K12A 2VMEA 1GUIA 2BGPA 4BDVB 4XZUG 5JUVA 2VTFA 3UESA 1IQDC 1PX3A 1TVGA 4XUPA 1K45A 5IHRA 1XNAA 4P02B 3ECQA 1K42A 4BK4A 4JKMA 3MUZ1 3SKJE 3DECA 2QQJA 1US2A 2QQIA 3FL7A 3LQCA 4CU9A 2V72A 3LEIA 3K4AA 2J22A 1JU3A 3THCA 4D0QA 1O8PA 1PMJX 3FHAA 4QAWA 1GMMA 4ZZ8A 2VCBA 2WYSA 2EIBA 3W5MA 1CZSA 4P5YA 4TTGA 3T0DA 2VQTA 2W1UA 2C9KA 3C7EA 3FHQA 4LQRA 1UMHA 2J1AA 2W1WA 1JYVA 3NNGA 4UOJA 4E8DA 5EIYB 5JXIA 1JYNA 3I2KA 2QQNA 2OKXA 4ARYA 1W9SA 2CDPA 5C70A 3IDAA 4MOAA 4L0PA 4QB2A 2QQLA 3ACFA 2W91A 1D7PM 1BHGA 4M4RA 1JZ7A 5EJZB 2EIDA 5A1AA 3LE0A 2VM9A 1UWWA 2ORZA 3WEZA 1JHJA 2Z4FA 2RV9A 2Y6JA 3OGSA 2VZVA 5G04L 1GOHA 2ORXA 3CZUA 3VDCA 1UYYA 3WNPA 4BJ0A 5HPOA 3LPFA 2WO1A 3MV01 3D3AA 5CZKA 1ULPA 5JMOA 2J1UA 3WF0A 3CMGA 5DN2A 1JI6A 2X09A 4OZOA 3U37A 4XVHA 3P1IA 4PT6A 2BGOA 4LPLA 5F7UA 2JKXA 2WN3A 2W3JA 2E33A 3GM8A 4M4PA 4OMDA 5HXMA 1W99A 1SHWB 1WKYA 3I97A 1JZ5A 1J84A 2WUHA 3C8XA 3HN3A 4P08A 5G05L 3T2PA 1WCQA 2BZDA 3LEKA 2Y6KA 4GZ9A 3VD3A 4GWJA 3WF1A 2B9VA 2EIEA 3GGLA 4OUEA 1ULOA 2W46A 2VR4A 1UY0A 3C7OA 2XHNA 2L9LA 2W5FA 5C7GA 2ZEZA 4RYDA 4AAXA 2DCKA 3DYMA 1PMHX 4CVUA 5LCWL 3FN9A 4W4ZA 1DLCA 2X05A 1J83A 1KEXA 5IYYA 1GNYA 4ARXA 1OF4A 3VD9A 1L7RA 4A44A 4Z2AA 1F4AA 2E32A 2VZRA 2XQXA 3K46A 4CU8A 5FUIA 3C7GA 1JZ4A 4CU6A 2PQSA 3HPNA 2V4VA 1K3IA 4E8CA 3IAPA 4QDQA 2VMDA 5I0DA 3F2ZA 4XURA 2VCAA 3JXSA 4BK5A 4QX2A 1W8OA 3K77A 3ACHA 2W95A 2QQKA 2VL4A 5EJ1B 4XUQA 4TXWA 3CDZB 3K75B 1OD3A 5LA1A 3I2GA 2WO2A 5B4XA 2J1RA 1RYYA 1O8SA 4ZXEA 5IFTA 1NUKA 4A42A 4A4AA 4A3ZA 3I2JA 5C71A 4UI9L 1GOGA 2X10A 1JZ6A 3CQOA 4KMQA 2VO5A 4BXSV 4JKLA 2VZSA 4W50A 4ET7A 2W1SA 3T08A 2DCJA 2VQUA 4CUBA 3A22A 2XOMA 2VZUA 4CUCA 3OEBA 3WF4A 2YFZA 3HJRA 4DXTA 5IJRA 5JXJA 4AG4A 5LA2A 1EUTA 3BN6A 2YC2A 1CZVA 2E26A 1UYXA 3K4DA 3C7FA 2VZ1A 2VMFA 2W9XA 2JD9A 2WQ8A 1W8NA 2WZEA 5JR2A 1OF3A 3I2FA 2KD7A 2B4KA 2QQMA 1NKGA 4A6OA 2W92A 2ZXQA 1H6YA 3SEPA 1UX7A 1TG7A 1XC6A 2V5DA 3VD7A 3GDBA 2WDBA 3E1F1 1JYXA 2CDOA 4JHZA 2VOTA 3UETA 3VDBA 1UY4A 2WO3A 3MO4A 1F4HA 2WABA 4DXRA 1OH4A 4DEVA 3VD5A 3T2OA 2RJ2A 3HNMA 2WAOA 2VZ3A 2C26A 4LKSA 1UXZA 4W8JA 1JZ3A 4PQQA 2VZOA 3GXUA 3SEEA 1UYZA 3BGAA 3UNPA 1UY3A 3K4ZA 4P00B 4KI5M 4QX1A 1O59A 2W94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYW A;  2YFU A;  1EUU A;  2W1Q A;  2VZP A;  3OB8 A;  4QDS A;  2VC9 A;  3NQH A;  2E31 A;  2YG0 A;  1T2X A;  3EB7 A;  4QPW A;  3ACI A;  2J1V A;  1PX4 A;  1SDD B;  4DUX A;  4A41 A;  2DDU A;  1MPX A;  5B4N A;  3A23 A;  1I5P A;  3AC0 A;  3THD A;  2LW8 A;  3MV1 1;  2ZEX A;  3NJV A;  4ZY9 A;  3I3E A;  3WSO A;  3I3B A;  4MGS A;  3T0A A;  4MAD A;  2WN2 A;  3C7H A;  3ZM8 A;  3HEI A;  3T0B A;  1GOF A;  3WF3 A;  5DPN A;  1P8J A;  3A7Q A;  2Y8K A;  1UXX X;  4XUN A;  3HNB M;  4FI9 A;  3IB3 A;  2WZ8 A;  4OYU A;  3ACG A;  2BBA A;  3VDA A;  5JXH A;  2J1E A;  5CYY A;  4QX0 A;  4XUO A;  2HLE A;  3OGV A;  1DYO A;  4JKK A;  3VD4 A;  2RVA A;  1GU3 A;  1JZ8 A;  3OGR A;  4GWI A;  4PF1 A;  3CKH A;  5IFP A;  1UY1 A;  1UMI A;  2Y6L A;  4KWU A;  1HN1 A;  2W47 A;  2J1S A;  5LA0 A;  3J7H A;  3P6B A;  4DXS A;  1CZT A;  3T2Q A;  2QQO A;  4QDR A;  3OBA A;  1H6X A;  4QB1 A;  1YQ2 A;  4D8M A;  3I2I A;  4ZZ5 A;  2ID4 A;  4DUW A;  3WNK A;  1DP0 A;  1JU4 A;  2Y6H A;  3PUH A;  4JX0 A;  3CIH A;  4HG6 B;  4DEQ A;  2VJX A;  2ZEW A;  1NX9 A;  3MUY 1;  4DUV A;  2EIC A;  4CU7 A;  2YC4 A;  3WQB A;  3HOB A;  3ABZ A;  3HNY M;  3T09 A;  3DYP A;  3CZJ A;  1CX1 A;  4IUG A;  4RN5 A;  2ZEY A;  1CIY A;  1XNT A;  3A21 A;  3I2H A;  2YB7 A;  4LHS A;  3EYP A;  2Y64 A;  5DMY A;  1UY2 A;  2JDA A;  1US3 A;  2WAA A;  4YPJ A;  5DQ0 A;  4CUA A;  3WNN A;  3OG2 A;  2W87 A;  3MBW A;  1W9T A;  2VMC A;  3WNM A;  4MO3 M;  1LNS A;  3W5N A;  3ETP A;  1L7Q A;  4MGQ A;  3WNL A;  2BER A;  1KGY A;  1SG3 A;  1UZ0 A;  2LS6 A;  3PUI A;  2J1T A;  3LPG A;  5JXG A;  4A45 A;  1NAE A;  3WF2 A;  3IAQ A;  4OMC A;  1OT5 A;  4XUT A;  1W0N A;  3NJX A;  1GQP A;  3NRU A;  1XPW A;  2C4X A;  3OEA A;  3SKV A;  2VCC A;  2XON A;  2Y6G A;  4QX3 A;  2QBX A;  5J1X A;  4QB6 A;  1JZ2 A;  3I3D A;  2HYX A;  3III A;  1W9W A;  2VZT A;  1R64 A;  2J7M A;  4UAP A;  2R7E B;  3DYO A;  2JE8 A;  2WBK A;  3LEG A;  2VZQ A;  3WNO A;  1K12 A;  2VME A;  1GUI A;  2BGP A;  4BDV B;  4XZU G;  5JUV A;  2VTF A;  3UES A;  1IQD C;  1PX3 A;  1TVG A;  4XUP A;  1K45 A;  5IHR A;  1XNA A;  4P02 B;  3ECQ A;  1K42 A;  4BK4 A;  4JKM A;  3MUZ 1;  3SKJ E;  3DEC A;  2QQJ A;  1US2 A;  2QQI A;  3FL7 A;  3LQC A;  4CU9 A;  2V72 A;  3LEI A;  3K4A A;  2J22 A;  1JU3 A;  3THC A;  4D0Q A;  1O8P A;  1PMJ X;  3FHA A;  4QAW A;  1GMM A;  4ZZ8 A;  2VCB A;  2WYS A;  2EIB A;  3W5M A;  1CZS A;  4P5Y A;  4TTG A;  3T0D A;  2VQT A;  2W1U A;  2C9K A;  3C7E A;  3FHQ A;  4LQR A;  1UMH A;  2J1A A;  2W1W A;  1JYV A;  3NNG A;  4UOJ A;  4E8D A;  5EIY B;  5JXI A;  1JYN A;  3I2K A;  2QQN A;  2OKX A;  4ARY A;  1W9S A;  2CDP A;  5C70 A;  3IDA A;  4MOA A;  4L0P A;  4QB2 A;  2QQL A;  3ACF A;  2W91 A;  1D7P M;  1BHG A;  4M4R A;  1JZ7 A;  5EJZ B;  2EID A;  5A1A A;  3LE0 A;  2VM9 A;  1UWW A;  2ORZ A;  3WEZ A;  1JHJ A;  2Z4F A;  2RV9 A;  2Y6J A;  3OGS A;  2VZV A;  5G04 L;  1GOH A;  2ORX A;  3CZU A;  3VDC A;  1UYY A;  3WNP A;  4BJ0 A;  5HPO A;  3LPF A;  2WO1 A;  3MV0 1;  3D3A A;  5CZK A;  1ULP A;  5JMO A;  2J1U A;  3WF0 A;  3CMG A;  5DN2 A;  1JI6 A;  2X09 A;  4OZO A;  3U37 A;  4XVH A;  3P1I A;  4PT6 A;  2BGO A;  4LPL A;  5F7U A;  2JKX A;  2WN3 A;  2W3J A;  2E33 A;  3GM8 A;  4M4P A;  4OMD A;  5HXM A;  1W99 A;  1SHW B;  1WKY A;  3I97 A;  1JZ5 A;  1J84 A;  2WUH A;  3C8X A;  3HN3 A;  4P08 A;  5G05 L;  3T2P A;  1WCQ A;  2BZD A;  3LEK A;  2Y6K A;  4GZ9 A;  3VD3 A;  4GWJ A;  3WF1 A;  2B9V A;  2EIE A;  3GGL A;  4OUE A;  1ULO A;  2W46 A;  2VR4 A;  1UY0 A;  3C7O A;  2XHN A;  2L9L A;  2W5F A;  5C7G A;  2ZEZ A;  4RYD A;  4AAX A;  2DCK A;  3DYM A;  1PMH X;  4CVU A;  5LCW L;  3FN9 A;  4W4Z A;  1DLC A;  2X05 A;  1J83 A;  1KEX A;  5IYY A;  1GNY A;  4ARX A;  1OF4 A;  3VD9 A;  1L7R A;  4A44 A;  4Z2A A;  1F4A A;  2E32 A;  2VZR A;  2XQX A;  3K46 A;  4CU8 A;  5FUI A;  3C7G A;  1JZ4 A;  4CU6 A;  2PQS A;  3HPN A;  2V4V A;  1K3I A;  4E8C A;  3IAP A;  4QDQ A;  2VMD A;  5I0D A;  3F2Z A;  4XUR A;  2VCA A;  3JXS A;  4BK5 A;  4QX2 A;  1W8O A;  3K77 A;  3ACH A;  2W95 A;  2QQK A;  2VL4 A;  5EJ1 B;  4XUQ A;  4TXW A;  3CDZ B;  3K75 B;  1OD3 A;  5LA1 A;  3I2G A;  2WO2 A;  5B4X A;  2J1R A;  1RYY A;  1O8S A;  4ZXE A;  5IFT A;  1NUK A;  4A42 A;  4A4A A;  4A3Z A;  3I2J A;  5C71 A;  4UI9 L;  1GOG A;  2X10 A;  1JZ6 A;  3CQO A;  4KMQ A;  2VO5 A;  4BXS V;  4JKL A;  2VZS A;  4W50 A;  4ET7 A;  2W1S A;  3T08 A;  2DCJ A;  2VQU A;  4CUB A;  3A22 A;  2XOM A;  2VZU A;  4CUC A;  3OEB A;  3WF4 A;  2YFZ A;  3HJR A;  4DXT A;  5IJR A;  5JXJ A;  4AG4 A;  5LA2 A;  1EUT A;  3BN6 A;  2YC2 A;  1CZV A;  2E26 A;  1UYX A;  3K4D A;  3C7F A;  2VZ1 A;  2VMF A;  2W9X A;  2JD9 A;  2WQ8 A;  1W8N A;  2WZE A;  5JR2 A;  1OF3 A;  3I2F A;  2KD7 A;  2B4K A;  2QQM A;  1NKG A;  4A6O A;  2W92 A;  2ZXQ A;  1H6Y A;  3SEP A;  1UX7 A;  1TG7 A;  1XC6 A;  2V5D A;  3VD7 A;  3GDB A;  2WDB A;  3E1F 1;  1JYX A;  2CDO A;  4JHZ A;  2VOT A;  3UET A;  3VDB A;  1UY4 A;  2WO3 A;  3MO4 A;  1F4H A;  2WAB A;  4DXR A;  1OH4 A;  4DEV A;  3VD5 A;  3T2O A;  2RJ2 A;  3HNM A;  2WAO A;  2VZ3 A;  2C26 A;  4LKS A;  1UXZ A;  4W8J A;  1JZ3 A;  4PQQ A;  2VZO A;  3GXU A;  3SEE A;  1UYZ A;  3BGA A;  3UNP A;  1UY3 A;  3K4Z A;  4P00 B;  4KI5 M;  4QX1 A;  1O59 A;  2W94 A; 
#chains in the Genus database with same CATH topology
 4BIO A;  4A6S A;  2DVF A;  3X29 B;  1WCK A;  2W1Q A;  3CBN A;  3WG4 A;  5FZ1 A;  2Q4S A;  3KCC A;  2E31 A;  4HL0 A;  1GQG A;  2YG0 A;  4V1P A;  2EVX A;  3WDU A;  4QQ2 A;  5TSW A;  3QAC A;  3IBM A;  4K8R B;  5CU1 A;  4BLI A;  3V65 A;  4CCE A;  2OS2 A;  1PX4 A;  5BNN B;  1SPP B;  3AZW A;  4MHR A;  4YZ4 A;  2RS1 1;  1RJ7 A;  3W59 A;  3A23 A;  2ZKL A;  3SCF A;  4BPZ A;  3T4H B;  1ND3 A;  2ARC A;  3ZPY A;  4NJ4 A;  1QJZ A;  1SQ4 A;  1QDC A;  4KGQ A;  2YDE A;  1RB8 G;  1H8T A;  1NOV A;  3I3B A;  4NOT A;  4B7E A;  3ZIX A;  1OOP C;  1LOG A;  2UWA A;  5CAD A;  4FOV A;  3ASI A;  2CWM A;  3KHB A;  4XCA A;  2R06 3;  3ZM8 A;  4GMP 0;  4JDM A;  1QJU 1;  4U36 A;  1RC6 A;  5CIS A;  5DPN A;  1EAH 3;  1P8J A;  3NNJ A;  4HPK A;  4JQT A;  1XOY A;  4MV2 A;  4CRQ A;  1PO2 1;  4TZD A;  4GMP 3;  4HSL A;  2XLA A;  2FQP A;  4XUN A;  1K5J A;  1SAC A;  1LKN A;  2GMP A;  1AX2 A;  1C1L A;  4PLN A;  2J1E A;  1ZBE 2;  3AKQ A;  2WZR 1;  3P5B A;  4QT6 A;  5CYY A;  5AFB A;  5IK8 A;  4LBQ D;  4QXK A;  3MLL A;  3IKW A;  5T5L A;  5FZ3 A;  5L36 A;  4JKK A;  4E4D X;  3VD4 A;  3W20 A;  1LRH A;  1X33 A;  4FTS A;  4ZS3 A;  1CR7 A;  2WKK A;  5KC5 A;  1H2L A;  3U4S A;  3D82 A;  3GBG A;  4PI0 A;  4ATE A;  5F3E A;  4KWU A;  3LZZ A;  4OI1 A;  4XHB A;  4LBM A;  1HN1 A;  2W47 A;  1T6B X;  1UU6 A;  2OA2 A;  1GZW A;  3J7H A;  5DG1 A;  3P6B A;  3VL9 A;  5IVJ A;  5IK7 A;  4YZ2 A;  5IVV A;  1TNR A;  1SLC A;  3ZYB A;  1PNF A;  3T2Q A;  1VLN A;  2ZGQ A;  1O5U A;  4LE4 A;  4Q4V 2;  5FYY A;  1DIW A;  5C3Q A;  2VBP A;  2P6C A;  1U12 A;  1W3X A;  3GBF A;  4JCK A;  4XBL A;  3KQ4 B;  4AHY A;  4B1M A;  1VBC 2;  5I0U A;  1RHI 3;  5D1I A;  2MHF A;  1WLW A;  4HN1 A;  4QQP A;  1VBD 1;  3WDY A;  2XH6 A;  4IV3 A;  4M3C A;  4QB1 A;  2E51 A;  4AFC A;  2JEC A;  4FPC A;  4ZZ5 A;  5GM0 A;  4CPB D;  3JBG 1;  1A6C A;  4Q26 A;  3WNK A;  4CDU C;  2Y6H A;  5JWP A;  1LHV A;  4JX0 A;  1WMF A;  2VJX A;  2GAL A;  3H1W A;  4CCC A;  4HT1 T;  5D8A A;  4XHX A;  2XWJ B;  1LGC A;  4R9C A;  3WR0 A;  1F2N A;  5KHI A;  2QVS B;  1HB4 A;  4FCA A;  1U5Y A;  5H9R A;  3V0A A;  2V09 A;  3T09 A;  2D97 A;  1B35 A;  3ABZ A;  5IAV A;  4IDZ A;  1XSQ A;  2Q8O A;  1ZBA 2;  2PXJ A;  3DKQ A;  3TYJ A;  4JQR A;  3S5A A;  4FPY A;  3NL1 A;  4Q4W 1;  4Q4X 3;  3H7J A;  5FBZ A;  1J59 A;  2YB7 A;  3DF0 A;  2BBV A;  1X82 A;  4LEJ A;  1U5Z A;  2Y64 A;  5DMY A;  2WWJ A;  2A6W A;  5DAP A;  2JDA A;  1US3 A;  4I02 A;  4XZP A;  2XPJ A;  2AZ5 A;  5F8P A;  4CUA A;  3VBU B;  1WLT A;  3WNN A;  5E88 A;  4CCJ A;  1GWL A;  1TZO A;  1W9T A;  4GA9 A;  2RMU 2;  5CKM A;  3KCX A;  3OBR A;  1S2K A;  4N7I A;  4YGC A;  1L7Q A;  4RGG A;  3WOG A;  5BNN A;  3HBK A;  1SG3 A;  1UZ0 A;  4RR3 B;  4GXL A;  2LS6 A;  1ZBE 3;  4EN8 B;  3PVE A;  5A7P A;  1MZF A;  4PJY A;  4AL9 A;  3LPG A;  5JXG A;  2D44 A;  2PLV 2;  2ET7 A;  2OZ6 A;  4QKF A;  3ZKU A;  4LBK A;  4Q8L A;  4CP0 A;  3IAQ A;  1UOF A;  1COV 1;  5CA6 A;  3OUH A;  4XUT A;  1W0N A;  3NJX A;  2BJS A;  2E53 A;  4W6Y A;  1HRV 2;  5FV3 A;  5KWR A;  3I3M A;  3OEA A;  3BAL A;  2BNN A;  3AMM A;  3I7D A;  4QB6 A;  5A3P A;  4RD7 A;  5A7Q A;  2HYX A;  3NAP B;  4BYY A;  1OI6 A;  2VZT A;  4RGA A;  1R64 A;  3EXU A;  1VRB A;  1HW5 A;  2VOK A;  4EE2 A;  3OY8 A;  2PFW A;  3MW3 A;  4EWA A;  1QMJ A;  4Q4V 3;  4QKD A;  5GZD A;  4UAP A;  5BV6 A;  2R7E B;  3DYO A;  3LDB A;  4IW3 A;  3LEG A;  4XQW A;  3RMX A;  3ZOI A;  1VBC 3;  1W8U A;  2VZQ A;  3GZT B;  3WNO A;  5C4W C;  5EJ3 A;  1C1F A;  2VME A;  2IWG B;  4UFH A;  5FY9 A;  4CDX B;  3U14 A;  5KXC A;  1QOT A;  4Q1R A;  5BNP B;  2WT0 A;  2VTF A;  3KV4 A;  5ANQ A;  3RMY A;  1RUH 2;  4NRQ A;  5JIA A;  1A8M A;  4AFA A;  1YRZ A;  4YWA A;  1MZ5 A;  1KJR A;  1Z78 A;  3VKO A;  4M01 A;  3N9N A;  4YFZ A;  3DXU A;  4BQY A;  5FFO C;  1W6M A;  4ASM B;  3M7A A;  5LAT A;  4P02 B;  3ECQ A;  3KZ4 C;  1K42 A;  2H6B A;  2C1F A;  4LTA A;  2G19 A;  2HWB 1;  3F95 A;  4PLO A;  5JPN B;  4NN0 A;  4YSF A;  3Q9O A;  2QQJ A;  2B46 X;  2QQI A;  4HVO A;  3OPZ A;  4JDO A;  1ZBA 3;  1F5J A;  1UCX A;  3EBR A;  2ZPX A;  4QHB A;  4QX5 A;  5JSO A;  1OLM A;  1J3R A;  3N7J A;  4XFA A;  3RJR A;  1HX6 A;  2D93 A;  2JIG A;  1V70 A;  3THC A;  3M3C A;  3WQ0 A;  4GB3 3;  3WP6 A;  1XYN A;  4KQ7 A;  3MIC A;  4WVM B;  2HEY F;  4HN0 A;  4MXW B;  5EXO A;  5L19 A;  5DUX A;  2EIB A;  1N1Y A;  1WGP A;  1XE8 A;  2BVV A;  4FXG B;  4IEQ A;  1AYN 2;  3OBZ A;  2KXL A;  3GCW A;  3B02 A;  2HWE 2;  2RMU 3;  4H2A A;  4DRV A;  3T0D A;  4OFG A;  2BOJ A;  2ZGN A;  5BYN A;  4XF1 A;  1JMU B;  4RQP B;  4XPV A;  1OFN A;  2X5I B;  1YQC A;  3WCR A;  3VKM A;  3BI3 A;  1CIW A;  5FZH A;  4AVA A;  5T52 A;  1V6K A;  1WMX A;  4QD2 A;  1AF9 A;  2PLV 3;  1CAX A;  1XNK A;  5FKB A;  4E8D A;  1PK6 A;  4COZ A;  4FOY A;  2ENR A;  1RMU 1;  2BUK A;  1HRV 3;  4XFG A;  4YG6 A;  5K9Y A;  2MEV 2;  5JZG B;  4IND A;  3VHP A;  5C70 A;  4IEV A;  1YO8 A;  4NE9 A;  3ENR A;  1JOJ A;  5FAX A;  3EJK A;  3ACF A;  4OUS A;  1RUF 3;  5FMD A;  3L9J T;  2W91 A;  3FJS A;  3VBU A;  1R08 2;  5HCA A;  1BHG A;  3Q8E A;  3ME2 A;  1LTE A;  3SLI A;  2DUP A;  1ZA7 A;  3AMP A;  1LU2 A;  4LO8 A;  4BXF A;  2VM9 A;  1BBT 1;  2D3R A;  2ORZ A;  3SXW A;  3ATG A;  4IEO A;  5KHH A;  2Y6J A;  2ZGP A;  4Q4Y 2;  4Y24 A;  5FPX A;  4AW7 A;  1QNW A;  3CZU A;  4AQS A;  1WLD A;  5A32 A;  4RR3 A;  2WO1 A;  3QH7 A;  3MV0 1;  2H6C A;  2QKD A;  3D3A A;  5DZF A;  2XLG A;  5IVY A;  1RUH 3;  1ULP A;  5CZK A;  5LAS A;  1FPN 2;  1X7N A;  4Y3O A;  2PQQ A;  3CMG A;  3WF0 A;  1S0F A;  1Q56 A;  4XQD A;  5DN2 A;  4RHV 2;  1W2O A;  5FZK A;  2GC0 A;  2ZZJ A;  4HSJ A;  4XVH A;  1PIV 1;  5CIR A;  4PT6 A;  1HXS 3;  1NCQ B;  3E6D A;  4IE6 A;  5F5A A;  5LBB A;  4YW3 A;  3MEP A;  3ZVX A;  3PHM A;  1Y9Q A;  2WN3 A;  3H0O A;  3NAP A;  2E33 A;  4FPK A;  5H9Q A;  3AP4 A;  5HXM A;  1WKY A;  1FX5 A;  1JZ5 A;  3AVR A;  3T1M A;  1O5L A;  3O1S A;  3U11 A;  3T2P A;  4LHN A;  2A6Z A;  2ES3 A;  3AMN A;  3LEK A;  4GZ9 A;  2DUR A;  3S5Q A;  5HCF A;  3UYJ A;  3VD3 A;  1U5X A;  2B9V A;  3WF1 A;  2ZX4 A;  4IE4 A;  5A33 A;  1A34 A;  1ZZ8 A;  3TB0 A;  3MIE A;  3E6B A;  3BU0 A;  5IVC A;  2FDG A;  4FFH A;  4NIH A;  2VR4 A;  2D6N A;  4YG3 A;  2L9L A;  2BQP A;  2R6Q A;  2A75 A;  3KV6 A;  4XE9 A;  3DGT A;  4LMF A;  3OD4 A;  2HWE 3;  4RYD A;  2GNB A;  5AC9 1;  1E5S A;  1K5M B;  1FT9 A;  2DCK A;  1FYU A;  4AZZ A;  4CDW C;  5KC6 A;  3I54 A;  2RS1 2;  3T2T A;  1J83 A;  1DBN A;  1KEX A;  1CPM A;  5IYY A;  5FYI A;  2G9Z A;  1ZA4 A;  4Q0V A;  1OF4 A;  4LLO A;  5FOJ B;  3D0S A;  4XIL A;  4EWE A;  5ACA 1;  4BWO A;  4D6Q A;  1F4A A;  1YWK A;  4FFG A;  4CU8 A;  2WWS A;  2AAC A;  2CYF A;  1ONA A;  2MEV 3;  3MFA A;  2PQS A;  1HQL A;  4JC1 A;  4NRO A;  3ZXE A;  4E8C A;  1D4M 2;  1HN0 A;  1S2E A;  3IAP A;  2JIJ A;  5FPL A;  4RS5 B;  1OOP A;  4AFB A;  1YQ8 A;  5T5O A;  1W28 A;  1TNF A;  1ULG A;  1QJU 2;  3F2Z A;  4WVM A;  4XUR A;  5FZD A;  5GLV A;  4CXX A;  3KF5 A;  4ERO A;  1GQH A;  4L9B A;  1R08 3;  4B7K A;  4KG0 A;  1PO2 2;  5BPX A;  3PIG A;  4PDW B;  4MZU A;  2RJL A;  2ZKN A;  5IVB A;  3A4U A;  4LK6 A;  1JYC A;  1UNB A;  4BQ3 A;  4LUM A;  1H8T C;  3I59 B;  2V73 A;  1FAY A;  2WZR 2;  4AVC A;  3LA7 A;  4HFS A;  2WT2 A;  2UYA A;  5EHD A;  3LFM A;  5LA1 A;  1H9W A;  1PVX A;  3LDR A;  2BP6 A;  1FPN 3;  2P4E A;  5EV7 A;  1YFU A;  1KS5 A;  2CY6 A;  2J1R A;  3K3O A;  4RHV 3;  2B7Y A;  2GAU A;  1LU1 A;  4P9G A;  3O1T A;  3I8T A;  4ORF A;  2DFB A;  2WNU B;  4NO4 A;  5FZO B;  3WW1 A;  4CCK A;  5ISL A;  2GSY A;  4QGN A;  4CEW B;  4ZXE A;  1QGL A;  2RR1 1;  5ERL A;  3U75 A;  3AZV A;  1GKB A;  4A4A A;  2E9Q A;  2ZHL A;  5FO7 B;  2VUC A;  1S0D A;  5KBF A;  2FDK A;  5JVV A;  1U5I A;  1DU3 D;  4NHM A;  2R32 A;  4UI9 L;  3ZDS A;  1BVP 1;  1W9Y A;  2EAL A;  5GJ6 A;  1JZ6 A;  2PHR A;  1PGS A;  4UWD A;  4CPB A;  1NYW A;  1MQT B;  1QJE A;  1ULE A;  1O3R A;  1O3Q A;  1GP5 A;  1NG0 A;  3BOP A;  2K9Z A;  2YMZ A;  1VBD 2;  4W50 A;  5A3U A;  4R4Z A;  3GZE A;  1GWM A;  1JS9 A;  5EZW A;  1LOB A;  3ALQ A;  3KMH A;  3ZXL A;  4OHY A;  5HXV A;  2XOM A;  4N43 B;  2VZU A;  3JBG 2;  4AI8 A;  3ZR5 A;  1KXG A;  1RUC 1;  4P9X A;  4CUC A;  5A1F A;  4OI0 A;  1SFY A;  3HJR A;  1LHN A;  3ZIW A;  4DXT A;  5K0U C;  4CDU A;  3M1H A;  2DF7 A;  4QU1 A;  1DQ4 A;  4YZ5 A;  2UY8 A;  3BN6 A;  1J1T A;  2RE9 A;  4FOW A;  2YC2 A;  1AR9 1;  2JEM A;  4FVV A;  4IQP A;  2QFE A;  2E26 A;  1W8H A;  3O1M A;  4OHV A;  5EYX A;  2A3W A;  2RS1 3;  3IMM A;  1G9F A;  2VMF A;  3RJ2 X;  3UKT A;  2OXB A;  3ILF A;  3ZXG A;  1MS8 A;  2JD9 A;  4R9D A;  1R1Z A;  4WM7 C;  4BOW A;  3U4X A;  1BEV 1;  1OF3 A;  2VAU A;  1LEM A;  2B4K A;  2TEP A;  4Q4W 2;  4YAR A;  2JWP A;  4JTO A;  3ZFG C;  5GZC A;  2QQM A;  1NKG A;  1NCR B;  5D8A C;  2XGX A;  4A6O A;  1PMI A;  3FX3 A;  3KVB A;  1D4M 3;  1UX7 A;  3LIG A;  4PQ9 A;  3LIH A;  3NMB A;  4IL7 A;  3EMR A;  2AGS A;  2IFW A;  1QJU 3;  2DWR A;  5I91 A;  4HMZ A;  2JB4 A;  2WDB A;  5ANN A;  5I8S A;  3ZMO A;  1XSR A;  4CP9 B;  3JD7 3;  3N36 A;  4IEP A;  1RJ8 A;  3PUR A;  1S1A A;  3UKV A;  4Z8B A;  2LTN A;  1ZM1 A;  3K48 A;  4FPO B;  1ASJ 1;  1W04 A;  1I9R A;  1K5M A;  2MNG A;  3H50 A;  1AUY A;  5E1R A;  4AI0 A;  1AR8 2;  1F4H A;  5FLH A;  2WLQ A;  2WZR 3;  1R1A 1;  1OH4 A;  1BXH A;  5GLZ A;  4ZXK A;  3VD5 A;  3T2O A;  1Q8S A;  5FYS A;  1COV 2;  1AVB A;  2AC1 A;  2XLF A;  2ZX0 A;  1S0J A;  4I0A A;  3FLP A;  4QMA A;  4IV1 B;  4WZC A;  1NLR A;  5DAX A;  4CZS A;  4COW A;  4LJH A;  3GXU A;  3SEE A;  1UYZ A;  4R8H A;  3BGA A;  3O0X A;  2VQA A;  4XQ4 A;  2JDP A;  1ACC A;  2JDZ A;  2JG8 B;  2UWC A;  4KI5 M;  4P00 B;  4CDQ A;  4MX3 A;  4AYU A;  5BNN C;  2WFF 3;  1C5H A;  4MHU A;  4AVB A;  3LA3 A;  2BFU L;  2V4A A;  3D0J A;  4YYO A;  2IUW A;  1UKR A;  5F5I A;  1O6U A;  3OCP A;  3S57 A;  1FXZ A;  2K46 A;  4NHL A;  2ZX3 A;  4PDW A;  3QBQ A;  1AYM 1;  1VBD 3;  4FP3 A;  2VC9 A;  4QDS A;  2WNV B;  1OUR A;  3H1Y A;  5C4W A;  3I59 A;  3KGL A;  2P17 A;  1YFX A;  4LR4 A;  5DG2 A;  3N7K A;  2FMY A;  5FRA A;  1LGN A;  5FCC A;  3ES4 A;  1MS1 A;  3JBG 3;  3P3N A;  1CPN A;  2IFR A;  5J96 B;  2I07 B;  4I0W B;  4NHX A;  1BLZ A;  2Y60 A;  2BFU S;  3B93 A;  3LOI A;  4XJU A;  3SMH A;  2J1V A;  1SFN A;  2RS3 1;  4FPL A;  3TN9 1;  1BMV 1;  4O9E A;  3SC7 X;  4YZ1 A;  1H1I A;  5T5J A;  4B4R A;  3WG2 A;  4NIA A;  2FCV A;  1WLC A;  2XWB B;  3UGG A;  5FZO A;  2DDU A;  2WNU A;  1MPX A;  4XTM A;  2HWB 2;  4FTB A;  4HKW A;  5FZ4 A;  2XL7 A;  1XYO A;  4EN0 A;  2QQU A;  4KG8 A;  1DZR A;  2HEW F;  1AXY A;  1IHM A;  3CEW A;  1VBB 2;  2P3I A;  4ZY9 A;  2X29 A;  3MW2 A;  3I3E A;  1KDM A;  5JCT A;  1DGR N;  2NLR A;  3KGZ A;  1MQT A;  4MGS A;  3BU7 A;  1CN1 A;  4OI2 A;  4Q4W 3;  2YBS A;  5D2A A;  4LOT A;  1X50 A;  1OLR A;  4A7Z A;  2D7F A;  2QCS B;  3T0B A;  1XND A;  1VAL A;  3N35 A;  4NR1 A;  2WS9 1;  1G9B A;  2HH9 A;  2B8M A;  3WDX A;  3DCQ A;  3SH3 A;  1LHO A;  5FJK A;  4HZF A;  3POS A;  4FI9 A;  4K7J A;  3ZN6 B;  1D2S A;  5AVA A;  3L2H A;  1QJX 3;  3KD4 A;  4K9S A;  1N1S A;  5JXH A;  2ZML A;  3PVN A;  4KH9 A;  2FDF A;  1AR8 3;  5H9P A;  4XUO A;  4Q2F A;  3HD8 B;  2HLE A;  1X8M A;  1DYO A;  4HOO A;  5APA A;  4EN6 B;  3RWN A;  4L97 A;  1XE0 A;  1COV 3;  1YI7 A;  2XVK A;  3ZYG A;  4PF1 A;  2BPA 2;  2WRA A;  1RMU 2;  1JTZ X;  1MAC A;  2VPV A;  2Y6L A;  2RDQ A;  2ZHK A;  4UW4 A;  3VBR B;  4AVT A;  1OH3 A;  2J1S A;  5LA0 A;  2PAE A;  3CJI B;  2H0V A;  4PBP A;  4Y22 B;  4DXS A;  4NMI A;  1RED A;  1WMD A;  1AX0 A;  3BCW A;  4YW1 A;  1Z0H A;  5A3O A;  5HCH A;  1LB2 A;  2VBB A;  5F6K A;  1CAU A;  2JJ6 A;  3VBO B;  5C5T A;  4AQT A;  2Y6F A;  5HCB A;  2P3J A;  2DCZ A;  1W6N B;  3OBA A;  4AI9 A;  1Q8P A;  4CP9 A;  3QLQ A;  1AR7 1;  1JXN A;  1XB9 A;  1UU4 A;  1LCL A;  1KQR A;  4TWT A;  3RI8 A;  1CWP A;  4MGY E;  4BQ5 A;  3I2I A;  5FTT C;  2DTY A;  5FY0 A;  1JH5 A;  1POQ A;  4JGY B;  4ZHN A;  3PUH A;  1NE4 A;  2Z42 A;  4HG6 B;  3WDT A;  4BQ4 A;  2DV9 A;  3ORJ A;  1H0B A;  3ZYJ B;  5SV8 A;  1ZZ6 A;  4DUV A;  4QX8 A;  4DQA A;  1UZZ A;  5JIU A;  5F2S A;  4YW7 A;  4CU7 A;  3BYW A;  3LSE A;  2ERF A;  1VBA 1;  3JB8 A;  3GNE A;  4KBB A;  4XYX A;  5F1R A;  2J42 A;  3WQB A;  2HWB 3;  4QGL A;  4Y33 A;  4YGB A;  3CZJ A;  1C28 A;  1CX1 A;  2R07 2;  4PI2 A;  4RR3 C;  3LEM A;  3RFR A;  4IUG A;  3AYE A;  3T4V A;  4AE2 A;  1MVE A;  1VBB 3;  1GZT A;  3AMH A;  3SHR A;  2ZEY A;  3A21 A;  4GIQ A;  2VMG A;  2VU9 A;  4LHS A;  1NT0 A;  3GBW A;  4XAC A;  5DZG A;  3BIW E;  2YXS A;  5DDJ 1;  2P2K A;  5DQ0 A;  4XTP A;  5C3S A;  3LDK A;  3HAG A;  4XBQ A;  3G7D A;  1NQD A;  3OYW A;  2W87 A;  3PUQ A;  1Q8Q A;  1SDW A;  3Q8B A;  3QOP A;  4LBO A;  3B9I A;  4D6R A;  3NAP C;  1WW5 A;  1AR6 1;  2AEY A;  3S7I A;  3AP6 A;  1LNS A;  4MO3 M;  3WDV A;  3GF6 A;  4QQO A;  1KFX L;  2CSG A;  5AC9 2;  5FP8 A;  3GHM A;  2IXC A;  4LXL A;  2W0X A;  1YXW A;  4AI1 A;  1BJQ A;  3OGG A;  2AEN A;  2RG4 A;  4QXC A;  2J1T A;  4CDW A;  1AJO A;  4YW4 A;  3R6S A;  2D6M A;  4P5H A;  4A45 A;  4CDX C;  4C0B A;  1IG3 A;  2R49 A;  4X6Q B;  3KM5 A;  4QQH A;  4A2U A;  5BNP C;  3NRU A;  4EV0 A;  2C4X A;  3B69 A;  2FZ2 A;  1IKQ A;  1RMU 3;  2QDN A;  2KA3 A;  1V6I A;  3APB A;  5GZE A;  3ON7 A;  1ENX A;  3UJO A;  5EP9 A;  2DTW A;  4TYS A;  5FPV A;  5M0T A;  3III A;  3N9Q A;  1W9W A;  1UPI A;  1WBF A;  2EXH A;  4OZX A;  4O9G A;  1W90 A;  1N3O A;  5SV5 A;  2VY0 A;  3I3Q A;  2VXJ A;  4M3C F;  2JE8 A;  2WBK A;  4J25 A;  4NRM A;  1ZRC A;  3FFZ A;  4LT5 A;  1C3H A;  2VTX J;  1K12 A;  1GUI A;  5FXZ A;  4BCU A;  1VB2 A;  1W6P B;  1QWR A;  2FZ1 A;  3AZX A;  1IPK A;  5JUV A;  1S0E A;  1CD3 G;  4IES A;  1BVV A;  1FMD 2;  4IEU A;  5FMO L;  1K45 A;  4D6S A;  4R9A A;  3M3O A;  2W2I A;  3GHN A;  3KT7 A;  5FY4 A;  1C8M 1;  5FYM A;  2MPF A;  3E5Q A;  3OPW A;  4CP2 A;  1OLQ A;  1FNY A;  3HT2 A;  3SKJ E;  4AGG A;  2ZAH A;  1QQP 2;  1UD1 A;  4RQP C;  1OQD A;  3PTR B;  4Y22 A;  1V6J A;  3PIJ A;  2X5I C;  4YVW B;  2G9G A;  3N4M A;  5A80 A;  3LQC A;  2R07 3;  1UN1 A;  3RYK A;  2ZX1 A;  3HT1 A;  2EXK A;  3ITQ A;  5A7W B;  3LEI A;  4XMI A;  1IS5 A;  4L99 A;  5FYT A;  3K4A A;  5FMO S;  3V64 A;  3RI9 A;  5FZ0 A;  1NY7 1;  2DVG A;  2YZ4 A;  4TSV A;  1V6O A;  2QQV A;  1UZY A;  1QXP A;  1V6N A;  2Q1Z B;  4XFH A;  2E63 A;  2VCB A;  1ND2 B;  1XRU A;  2XKP A;  3JQX A;  5JZG C;  2JDH A;  4JGY A;  1CZS A;  4COY A;  3POJ A;  1RUC 2;  5LBC A;  2VUA A;  4XFB A;  1WD3 A;  3ZXF A;  4DY5 A;  4TTG A;  3ILN A;  2VQT A;  5FY8 A;  5K0U A;  5AC9 3;  5LEK A;  1HB1 A;  1DZQ A;  2C9K A;  3J4U H;  5A3T A;  3FHQ A;  2D98 A;  2PA7 A;  3ZFF B;  4AOC A;  3NV1 A;  4BM8 A;  4P14 A;  4MSV A;  3VBS B;  2J1A A;  4LOR A;  3CHX A;  2W1W A;  1JYV A;  2CWS A;  4XIO A;  4UOJ A;  2DCY A;  5EIY B;  5JXI A;  3H8R A;  1C57 A;  3AFG A;  4L92 A;  4LIV A;  2OKX A;  1OMI A;  5FZA A;  4CUG A;  1BEV 2;  4AEM A;  4WM7 A;  4BLJ A;  1W9S A;  1RUD 1;  2XXZ A;  4ISR A;  2UY9 A;  4OQ8 A;  3ZYI B;  4IGO A;  4YW5 A;  4GUL A;  2DUO A;  4QB2 A;  3FBY A;  4LKF A;  5LA9 A;  1D0H A;  1NCQ C;  3NNM A;  4NPR A;  4Y1U A;  4NWW A;  2EID A;  2EF6 A;  5L9R A;  1IS6 A;  1S0C A;  1FOD 1;  1UWW A;  1TME 2;  2R1B A;  1XJA A;  1JHJ A;  2Z4F A;  2RV9 A;  2WWU A;  3OGS A;  4JVA A;  4BQ1 A;  4CCN A;  1HQN A;  4FPG A;  5FP4 A;  1UYY A;  2PHF A;  2VNG A;  2LAL A;  2NMN A;  3M2M A;  4XJW A;  1PGW 1;  1FMD 3;  2WL1 A;  3USS A;  3H3U A;  1QOS A;  1WWY A;  1NA1 B;  4UT5 A;  3LOB A;  1E5H A;  1O4T A;  5A6Q A;  1W6O B;  1X9T A;  4Y5Z 0;  4OZO A;  4Q0Q A;  5J09 A;  5KXD A;  3CL1 A;  1W2N A;  3P1I A;  1UIK A;  2YBP A;  2NM1 A;  3MIB A;  2WSV A;  3U1X A;  4E2G A;  3AFK A;  5FZ9 A;  1QQP 3;  4LA3 A;  1K5M C;  4KWK A;  3ZFG B;  1SPP A;  1J84 A;  3POY A;  3HN3 A;  4WV8 A;  5J98 B;  1BKZ A;  3O1O A;  4XBN A;  5JSR A;  2ARE A;  1U0A A;  2BZD A;  2HWD 2;  4MYE A;  5EFU A;  4CXY A;  1WCU A;  3B9C A;  3QH6 A;  2LRP A;  1AYM 2;  1YI9 A;  1JOP A;  4EYU A;  2JG9 B;  1ULO A;  4Y20 B;  2GP5 A;  1RGS A;  1ST8 A;  2GMM A;  3MIH A;  1RL3 A;  3ZYF A;  1UY0 A;  3THT A;  5FYH A;  1V0A A;  2PHL A;  3ZXK A;  2XHN A;  2ARA A;  4RS5 C;  1HKD A;  4QXH A;  2BVB A;  1QHD A;  2RJK A;  2YGL A;  2ZEZ A;  4H7M A;  4AAX A;  3AXD A;  1BMV 2;  1KRI A;  3O12 A;  3ZSJ A;  3MF6 A;  2XR4 A;  1WA4 A;  3M3I A;  3OGJ A;  5LCW L;  1LHU A;  5FRE A;  4PDW C;  2B39 A;  4W4Z A;  1DLC A;  1Y3T A;  2O1Q A;  4FOQ A;  5GKA C;  3WUC A;  5A1L A;  1YFW A;  3O1V A;  1GNY A;  3VKF C;  4CTE A;  2XL9 A;  1VE0 A;  5DUU A;  4UBG A;  2FCT A;  4OUM A;  2QZ2 A;  3ZPO A;  4ZU4 A;  4I3G A;  1RUE 2;  4A44 A;  5FO8 B;  4AVS A;  4Z2A A;  2E32 A;  2XQX A;  5FYZ A;  1DGR A;  1BEV 3;  2PEL A;  2FCU A;  4RFR B;  4DNY A;  3C7G A;  1PVC 2;  4CU6 A;  1V9U 1;  4PIY A;  4XFF A;  3HPN A;  2XQR A;  1REF A;  4YW6 A;  2JDU A;  3I4I A;  4XDQ A;  4QDQ A;  2GZW A;  3OUJ A;  1SBF A;  5I0D A;  2WNU C;  2WS9 2;  4CEW C;  4EWD A;  4LLF A;  5IUQ A;  2XBO 2;  5FZB A;  4Q1P A;  2R0H A;  3POI A;  3RYR A;  1KDK A;  3THP A;  5FR3 A;  2NMO A;  3MIG A;  5JAX A;  4Q0P A;  5CG8 A;  2NP0 A;  3KB5 A;  2QJV A;  2WQ4 A;  3TNQ A;  1TME 3;  4BIF A;  5CFC B;  4S2F A;  2VL4 A;  1NQJ A;  5FZ8 A;  3ELN A;  4BMB A;  1MQT C;  1ENS A;  2CNA A;  4FPH A;  4TXW A;  4Q0S A;  3VZJ A;  3ZFF A;  2BRT A;  5FUP A;  1W0O A;  2WII B;  4YNI A;  3V56 A;  2GDF A;  2A70 A;  5C3O A;  1H4H A;  1POV 1;  3LGR A;  2HWC 2;  4LA2 A;  5C33 A;  2ATF A;  4HXC A;  5K8S A;  4N43 C;  2DU0 A;  5LBE A;  4I30 A;  1O8S A;  1PO1 1;  3CNA A;  2ZGT A;  3RG0 A;  1QEX A;  4Z07 A;  1CON A;  2UYB A;  1N3P A;  1Z7S 1;  1ZRE A;  1LOA A;  3DUI A;  2JB8 A;  2YC0 A;  4LE3 A;  1OC1 A;  4GKY A;  4KU8 A;  4O61 A;  2OVU A;  3J9S A;  2C6S A;  3PTY A;  3CQO A;  2RHP A;  4TLG A;  1VAM A;  5K7P A;  4JRA A;  2HWD 3;  3MPP G;  1VP6 A;  3E5X A;  2Z69 A;  3T08 A;  1DQ0 A;  1AR7 2;  4N53 B;  4P9Y A;  2FD8 A;  1AYM 3;  2VQU A;  5FMC A;  1A78 A;  5A3L A;  3A22 A;  4E4S A;  1QKQ A;  2ET1 A;  1OVP A;  1NCR C;  3PMS A;  5A3W A;  1UOJ A;  3FWE A;  3OEB A;  3QCW A;  3WF4 A;  2QQW A;  2YFZ A;  4PHZ A;  2VOX A;  1SZB A;  3H7Y A;  3KV9 A;  4Q0U A;  2UWB A;  3KCY A;  4YM1 A;  1XXN A;  2RS5 1;  3GJB A;  4AG4 A;  1IOA A;  1NA1 A;  1Q3E A;  1S55 A;  1HRI 1;  3S30 A;  4IGQ A;  1W6O A;  1VPH A;  1CZV A;  3K3N A;  3K4D A;  1FV2 A;  1W8W A;  2VG9 A;  3WDW A;  1KFU L;  2IC1 A;  3A0N A;  4ASK A;  2VZ1 A;  5I93 A;  5K4L A;  1I5Z A;  5FZI A;  1SBD A;  2D40 A;  1PGL 1;  4QX7 A;  3N9O A;  3MZH A;  1IG0 A;  2WQ8 A;  5FBJ A;  2WZE A;  1IS3 A;  3ZFG A;  1GR3 A;  2BTV C;  2FBE A;  3DKW A;  3I2F A;  1RUE 3;  3WW2 A;  2PHD A;  1J1L A;  5T54 A;  2OII A;  2RDN A;  1OUS A;  1DQ5 A;  2HKX A;  1CAW B;  1H9P A;  2Q5T A;  2RM2 2;  4P9I A;  1PVC 3;  3NST A;  5AFE A;  3ZN4 A;  3KF3 A;  3TRS B;  3POG A;  4IV1 C;  5GZF A;  4XC9 A;  5DDJ 2;  2JG9 A;  2JIC A;  5E16 A;  3VD7 A;  1RIT A;  2GME A;  2GND A;  2WS9 3;  2JE7 A;  2JG8 C;  4NAO A;  2GN3 A;  2XBO 3;  1I6X A;  2CL2 A;  2ETE A;  4BZ4 A;  3HBZ A;  1OKQ A;  3MLJ A;  2CDO A;  1C4R A;  4AVV A;  1AR6 2;  4JHZ A;  2VOT A;  4FXK B;  3MID A;  3OOX A;  5FK7 A;  2DU1 A;  1YFY A;  1F15 A;  3VZO A;  1UY4 A;  1HDK A;  4ES9 A;  2WAB A;  4GH4 B;  4DEV A;  2XHK A;  2RJ2 A;  2WNV C;  3VB9 A;  3OTF A;  5E8A A;  2CTV A;  3N9P A;  2CU5 A;  2HWC 3;  1I3H A;  4CDX A;  2TBV A;  2BNO A;  4W8J A;  1EAH 1;  4WVZ A;  2YU1 A;  5HV0 A;  3AZY A;  1JZ3 A;  2ZA9 A;  2VZO A;  4GMP 1;  5BNP A;  1TQ5 A;  2NQY A;  3POF A;  5CKN A;  5ABJ B;  4OVE A;  1UY3 A;  3K4Z A;  1AYN 3;  4QX1 A;  3H8X A;  1O59 A;  3INA A;  3TAY A;  1J3Q A;  4U2A A;  1O3T A;  4O7X A;  4MUV A;  3NV2 A;  4V2W A;  5E6H A;  1LEN A;  1AXZ A;  4H14 A;  5F6L B;  5C6C A;  1ZYB A;  1O4Y A;  1W6Q B;  2YFU A;  4MGI E;  3BUC A;  1OQE A;  2ZGR A;  3ZYP A;  1BYH A;  3ZYH A;  2VZP A;  3OB8 A;  4FFI A;  1ZRI A;  2VOV A;  3BKZ A;  1AR7 3;  2IVI B;  4E4Z A;  5CFC A;  1KD7 A;  3WV6 A;  3O1P A;  1AL0 G;  3EB7 A;  4QPW A;  2VVE A;  1AHS A;  2I74 A;  5KR7 A;  2H0B A;  2VVF A;  3WX5 A;  1WA6 X;  2LRO A;  3U0Z A;  4OHZ A;  1Q8V A;  2PAM A;  3IIA A;  4GKX A;  4MXW A;  1RXG A;  1RHI 1;  4L2N A;  5A7N A;  1KS4 A;  2C5D A;  1I5P A;  4IEY A;  2O8Q A;  3O7O A;  2XKO A;  4QPG B;  3THD A;  1CX4 A;  2ZOE B;  2P1B A;  4RQP A;  4Q4Y 3;  2EXI A;  3HQX A;  3HVD A;  3NJV A;  2D3S A;  3RPQ A;  2X5I A;  4Y4R A;  3WSO A;  2ARX A;  4I0B A;  3RZJ A;  4BQX A;  2HEV F;  2RM2 3;  3T0A A;  4MAD A;  1Q5O A;  1QNY A;  2WN2 A;  5LEJ A;  1QJY 1;  4N53 A;  3ZX7 A;  3VBR C;  3W58 A;  5LRR A;  5DDJ 3;  4LUK A;  4PBO A;  4Z82 A;  4L11 A;  5LBF A;  3WF3 A;  1XNC A;  3CJI C;  3A7Q A;  3AKP A;  2Y8K A;  4FPF A;  1UXX X;  5JZG A;  1H8V A;  1HV1 A;  2DVA A;  2ADE A;  3DEM A;  3IB3 A;  2WZ8 A;  1AR6 3;  5LRS A;  4OYU A;  3ACG A;  1VRH 1;  2JDK A;  3VBO C;  4KU7 A;  1WW7 A;  4XFI A;  4BME A;  4Q4X 1;  3POE A;  5FZL A;  3HN1 A;  1UZW A;  2VEC A;  5L7O B;  3OGV A;  4N7U A;  5A70 A;  5L9V A;  5FO9 B;  1NLQ A;  1GU3 A;  5C8W A;  3OGR A;  2GH8 A;  2WFP A;  4JGY C;  4CA9 A;  3CKH A;  3J26 N;  5IFP A;  1UMI A;  2HBT A;  1T6G C;  5FXX A;  3K51 A;  3GCX A;  3SQO A;  2YBK A;  1OHF A;  1RUD 2;  1S2B A;  2VH9 A;  1OBN A;  4ISQ A;  3NV4 A;  2R04 1;  1CVN A;  1XYP A;  4GD4 A;  1LOC A;  1W06 A;  4GAL A;  4IXL A;  3AMQ A;  3AX4 A;  2ZZQ A;  2ZMK A;  3VBH B;  5FPZ A;  2XDV A;  3T30 A;  3ETQ A;  1IPS A;  4AHW A;  1H1M A;  1QH7 A;  1JW6 A;  1H6X A;  1NCQ A;  4KGG A;  1FOD 2;  3FLR A;  1YQ2 A;  1AL2 1;  2ZTN A;  4KWJ A;  5FYB A;  4D8M A;  1WD4 A;  5EYY A;  5JOY A;  2WZP P;  5BNO B;  5CFD B;  5I0R A;  3N9L A;  4LUL A;  4GH4 A;  2A6X A;  2FMD A;  4DEQ A;  1STM A;  2ZEW A;  3RGB A;  5LWB A;  1GYK A;  2GP3 A;  4K8F A;  2EIC A;  2PHU A;  5FKC A;  1PHM A;  1MS0 A;  2JDM A;  3MPB A;  3E6C C;  2VGD A;  1AZD A;  2P37 A;  3Q8A A;  4MG2 A;  3C3V A;  2YC4 A;  1PO2 3;  5T5P A;  2F17 A;  3JZV A;  4Z2W A;  1Y7B A;  2VNV A;  3LSD A;  2B5H A;  4WVW A;  4QGM A;  1W2T A;  5LK7 B;  2W68 A;  3KVA A;  4BU2 A;  4CCL A;  1CIY A;  1TEI A;  1W6Q A;  1XNT A;  4LHK A;  4DIN B;  1SCR A;  3LB9 A;  1VIW B;  3OUI A;  5CEH A;  3UGF A;  1W8T A;  3EYP A;  4MET A;  2WAA A;  1X9P A;  2XJT A;  3GZU C;  5FP7 A;  3BIE A;  4Y1V A;  4JGZ B;  4LBJ A;  5F3I A;  4YVS B;  4PF5 A;  4HAN A;  3OG2 A;  3VGI A;  1RUG 1;  2Y0O A;  3WNM A;  4NID A;  3W5N A;  2ZGK A;  5J3U A;  3ETP A;  4RS5 A;  1ZBA 1;  1UU5 A;  2DBI A;  1RIR A;  3OJB A;  4MGQ A;  4RA0 A;  2Y33 A;  4GAZ A;  1UOG A;  4DO0 A;  4LK7 A;  1HV0 A;  1HB3 A;  1UX6 A;  3LA2 A;  4GB3 1;  1LOF C;  3WF2 A;  4AGV A;  4OMC A;  4QPG A;  4CEY B;  1R09 1;  3RYP A;  2ZAB A;  3USU B;  1XPW A;  2VBD A;  2OZJ A;  1YC6 1;  3KSC A;  4JRL A;  2VCC A;  5DAV A;  1GIC A;  2Y6G A;  2Q0A A;  4QX3 A;  2QBX A;  3H8U A;  5J1X A;  2RMU 1;  5LZ6 A;  1RUD 3;  5F5C A;  3LFI A;  4XJ8 A;  1JZ2 A;  3MFC A;  2A71 A;  4DIQ A;  1WCD J;  1QH6 A;  2J7M A;  1DF0 A;  2Y34 A;  3GYD A;  2Z2S B;  4FAG A;  4NRP A;  4RL7 A;  4K3U A;  1DGW A;  3PVO A;  4CEW A;  1IPJ A;  2PLV 1;  1N1T A;  4YVW C;  2QZ3 A;  1FOD 3;  2W52 A;  3VBF B;  4WM8 B;  1HRV 1;  4QM8 A;  3WUD A;  1LUL A;  1LAJ A;  2ZMN A;  4IEW A;  4XZU G;  1IQD C;  1GAN A;  1PX3 A;  1TVG A;  5L7O A;  5FXW A;  5IHR A;  2CGN A;  1ND2 C;  1RUF 1;  1XNA A;  2XJP A;  4XF4 A;  5IVF A;  4BK4 A;  1S4C A;  1PO1 2;  2ZHN A;  4N43 A;  3RZG A;  4AR2 A;  3DEC A;  4K6B A;  1G6N A;  1G9C A;  5FUN A;  4AED B;  4F7Z A;  1FNZ A;  1ZX5 A;  2FDJ A;  3W9A A;  3FL7 A;  3ZFF C;  1MEC 1;  4E2S A;  1ENR A;  1W2U A;  3AXE A;  4XF9 A;  4CU9 A;  3IDE A;  3VBS C;  5F5Q A;  3NVC A;  2J22 A;  2AUY A;  1JU3 A;  4D0Q A;  1O8P A;  1URX A;  1ULF A;  2Q8E A;  2XJS A;  4CDQ B;  4D7T A;  2C24 A;  1GMM A;  4ZZ8 A;  4MGT A;  2WYS A;  5CFD A;  4UFI A;  1HXS 1;  4OCT A;  2IXH A;  1L7L A;  1YLL A;  4P5Y A;  1NCR A;  3UT0 A;  2EAK A;  1ND3 B;  2OPW A;  4IER A;  1RUO A;  4H7L A;  2RS5 2;  3WG1 A;  1F35 A;  3WXP A;  2DUQ A;  1HRI 2;  5KXB A;  2PHT A;  4M0N A;  2W1U A;  4HBN A;  2R0F A;  3AP7 A;  3U07 A;  4LQR A;  5A7S A;  5KXE A;  3VZK A;  5I8T A;  5EPA A;  5JR7 B;  1UIJ A;  1UMH A;  1ZZC A;  4WVV A;  5FXV A;  4EZH A;  2F4P A;  3GZA A;  5FQ0 B;  3NNG A;  1MS5 A;  2K2S A;  4NVP A;  2EA7 A;  1BBT 2;  1PGL 2;  3ZN5 A;  2JDN A;  3WG3 A;  4JAA A;  3CU7 A;  3I2K A;  4DZG A;  2JKB A;  4HPK B;  2ZHM A;  4X8P A;  1UO9 A;  3BTA A;  1GP4 A;  3SH5 A;  3WD5 A;  2NN8 A;  4XJA A;  4K40 A;  3SNM A;  2CDP A;  1NA1 C;  4DMI A;  3TEZ A;  3IPV B;  4G3Y C;  1GLH A;  4B8E A;  3IDA A;  4ZS2 A;  3B01 A;  2LUW A;  2XG3 A;  1HJG A;  3MLK A;  2NPI A;  1ZRF A;  1YYN A;  3R4S A;  2F6B A;  3AL6 A;  2VUJ A;  4IV1 A;  4K20 A;  1PIV 2;  1A8D A;  1NZC A;  3T1L A;  3MYX A;  4M4R A;  1S0G A;  5IK5 A;  5FZE A;  1J3P A;  2JG8 A;  3M3E A;  1TMF 1;  2PYT A;  2D6O X;  3LE0 A;  4IE0 A;  3WEZ A;  2XVL A;  3FHI B;  2HJI A;  4XXP A;  3RS6 A;  5DAQ A;  4C90 A;  2VZV A;  1ZRR A;  5G04 L;  2BDR A;  5IVE A;  1TE1 B;  3VDC A;  3WNP A;  1F8V A;  4FSJ A;  2PTM A;  2EIG A;  3FE5 A;  1JBC A;  5FPA A;  3ZMN A;  2SLI A;  4AI3 A;  2JG9 C;  5CAZ A;  2J1U A;  2R30 A;  3B7M A;  1ZZ9 A;  4CEY A;  1JI6 A;  1POV 3;  1ZNP A;  5FLI A;  2WNV A;  3USU A;  2P6H A;  2X09 A;  3U37 A;  4K1Y A;  4E27 A;  1F9K A;  1DYP A;  4Z1V A;  1W8Z A;  2QQP A;  4W6X A;  1OKO A;  5F7U A;  4M3C B;  2JKX A;  3J7L A;  4YM2 A;  4HK8 A;  1XNB A;  3GM8 A;  4M4P A;  4OMD A;  4YGD A;  1W99 A;  1SHW B;  4MLO A;  3I97 A;  4O65 A;  3VHO A;  4URT A;  2Q8D A;  5EWS A;  4QPI B;  4UW5 A;  3POW A;  4FT8 A;  1WCQ A;  4D94 A;  1FPN 1;  4Y5S A;  4FTE A;  2EIE A;  3J7N A;  3VBF A;  4OUE A;  1WZX A;  4R9B A;  4RHV 1;  4WM8 A;  5CKQ A;  1OSG A;  4J6G A;  5ACA 2;  1JN2 P;  3J8F 1;  3ILR A;  5GZG A;  4UF0 B;  1OFS A;  1LGB A;  1W8F A;  1UAI A;  4CE8 A;  5F9T A;  3OSD A;  3J7M A;  3O1R A;  1B35 B;  2P34 A;  2VOW A;  2W5F A;  3PL0 A;  3KT1 A;  5C7G A;  2RS5 3;  4GJY A;  1PMH X;  1HRI 3;  4CVU A;  4TN7 A;  2ZS6 B;  4BB3 A;  2YGM A;  3K2O A;  1X36 A;  3HR9 A;  2X05 A;  1RHI 2;  5FWJ A;  1CAV B;  3ZN6 A;  5CFC C;  4AED A;  2HWF 1;  1BBT 3;  3VD9 A;  3PUA A;  5F39 A;  4K21 A;  5A6Y A;  1DLL A;  2VZR A;  3K46 A;  5I0T A;  4Z92 B;  5FUI A;  5C9A B;  3WP3 A;  2P3K A;  1FI2 A;  1JZ4 A;  5FZC A;  3ZSL A;  2V4V A;  2WNE A;  2OT7 A;  3WIN E;  3KQR A;  1B09 A;  1LOD A;  3M8L A;  3KLS A;  4QU2 A;  1QJY 2;  4NPM A;  1E57 A;  2AEZ A;  3HQU A;  3SCG A;  2VMD A;  3UKN A;  4IET A;  1LR5 A;  2C0Z A;  1Y43 B;  1Q43 A;  2BYV E;  3JQW A;  4B4Q A;  4CYD A;  1EV1 1;  2UU8 A;  2R1D A;  2VCA A;  3VBR A;  4BK5 A;  1PIV 3;  3K77 A;  3ZFE B;  3ACH A;  3B3Q E;  2ZBJ A;  2ZCW A;  1H2N A;  2I2S A;  1CJP A;  2RR1 2;  5I8Y A;  3CJI A;  1JYT A;  5B2G B;  5FYC A;  3TWI A;  1UL9 A;  1VRH 2;  3WQ7 A;  2QQK A;  3AB0 A;  2XUM A;  4J1W A;  5EJ1 B;  2D6P A;  2PAK A;  2A3X A;  4Q4X 2;  4ZPI A;  3VBO A;  1WW4 A;  2YV8 A;  2BWA A;  3CDZ B;  1W6N A;  3K75 B;  5IK4 A;  4N53 C;  3VUO A;  5FQ0 A;  1D4M 1;  2K0G A;  4NHY A;  3KHC A;  1PM4 A;  2WO2 A;  4WBB A;  5LW9 A;  3DN7 A;  4OHW A;  4HON A;  1NE6 A;  1H4G A;  4Y1Z A;  4C91 A;  1RYY A;  3CJX A;  5F3C A;  3OY8 B;  3RRD A;  4DFS A;  4X8N A;  3ST7 A;  1WBL A;  3JD7 1;  1NUK A;  5IFT A;  4KNC A;  4N90 A;  3N7L A;  5LY2 A;  4A3Z A;  5F37 A;  1ENQ A;  3IPV A;  4HKL A;  1MR5 A;  2R04 2;  5C71 A;  5JLV A;  2LM3 A;  1XU2 A;  2X10 A;  3E5U A;  2WIN B;  1AR9 2;  3HIF A;  3Q8F A;  4KMQ A;  1D0G A;  2VO5 A;  3EO6 A;  3PME A;  3BPZ A;  3ZYR A;  2VZS A;  2YUE A;  4UFL A;  3SH4 A;  3CLP A;  1XE7 A;  5JOW A;  4RGK A;  4XJZ A;  3WCS A;  1XQN A;  1DQ6 A;  3BTZ A;  1GZ9 A;  1EPW A;  1AL2 2;  1W6M B;  2WLP A;  3ZXD A;  3DPR B;  2A7A A;  1SEF A;  3R4U A;  4MXV A;  5ACA 3;  3TEW A;  4XAE A;  5JSP A;  4GJZ A;  1LED A;  2WFF 1;  4XDP A;  5F3G A;  5IJR A;  2Z5W A;  2N7G A;  5LA2 A;  4QKB A;  3JU9 A;  3FLT A;  4XOG A;  2BEO A;  3AYD A;  5A7O A;  1UYX A;  1M06 G;  4AQ6 A;  1NXD 1;  2A73 B;  3KV5 A;  1N1V A;  1UF2 C;  5J7M A;  3IZO A;  1E5R A;  4XMA A;  2OYZ A;  5C3R A;  1WUV A;  3VZN A;  1QIQ A;  1VB4 A;  3ZXA C;  3AKT A;  4HVR A;  1W8N A;  1ASJ 2;  2DVD A;  1YIP A;  4Q27 A;  5FY1 A;  4ZON A;  3AYA A;  4GH4 C;  4M0H A;  5CB7 A;  4QPI A;  1VMF A;  2WSU A;  1RUJ 1;  3OD0 A;  1BQP A;  1R1A 2;  5JI7 A;  4M00 A;  4EJR A;  1OA3 A;  4JZR A;  2W92 A;  4F3J A;  1H6Y A;  3B94 A;  1XU1 A;  3BOD A;  4P9W A;  1IQA A;  4J1X A;  3S7E A;  4BQ2 A;  1QJY 3;  1XC6 A;  4XF3 A;  3PNA A;  4G9S B;  5BNQ A;  2D6L X;  2W08 A;  4QM9 A;  5ABJ C;  3I2O A;  3I2D A;  3FUO A;  4UF0 A;  3LF7 A;  3AKS A;  1RUG 2;  2JDY A;  5FY5 A;  4IE7 A;  2RR1 3;  1JOD A;  1CAX B;  1WME A;  4Q29 A;  1PK6 B;  2WJS A;  2VMI A;  4LO4 B;  1UW8 A;  1GZC A;  1VRH 3;  2JX9 A;  3CO2 A;  3UV9 A;  4ATF A;  3VDB A;  2YY1 A;  2WO3 A;  3LAG A;  3MO4 A;  4QPY A;  4W65 A;  5EQU A;  5FZF A;  4HKO A;  3VDD B;  1CAV A;  4GB3 2;  2IVJ A;  1BK1 A;  4YM3 A;  3RZH A;  4PIZ A;  2E7T A;  5T50 A;  1R09 2;  1LOF A;  2VZ3 A;  3AKR A;  4UFM A;  4LKS A;  1DHK B;  1W6P A;  3O0V A;  2X53 S;  1ZVF A;  4S2D A;  5C9A A;  1QJX 1;  1RUC 3;  2ZX2 A;  1VBE 1;  5FOB B;  4AF9 A;  1RVF 1;  5C8C B;  1Q8O A;  2R04 3;  3TN9 2;  2RS3 2;  1WW6 A;  4IE5 A;  4ITC A;  5DAW A;  5A32 B;  1AR8 1;  2W94 A;  3UK9 A;  1SLB A;  4UW6 A;  1AR9 3;  1JYW A;  1FAT A;  1RUN A;  1D2Q A;  3VKL A;  3ZFE A;  5LB6 A;  4QPG C;  1EUU A;  1LHW A;  1W0P A;  1W9F A;  4AEJ A;  5BXX A;  1VAK A;  4YVW A;  3GJA A;  3NQH A;  4D69 A;  1AL2 3;  3HQR A;  1OQ1 A;  4NUB A;  5A7W A;  1T2X A;  2YYO A;  4WZF A;  3S0M A;  2B42 B;  4AGR A;  4RSU A;  3ACI A;  2GC1 A;  4N9I A;  4S2H A;  1EP0 A;  4YM0 A;  5D21 A;  3RWK X;  1DGW X;  1SDD B;  2PHX A;  1RUF 2;  4DUX A;  4IEX A;  4N8M A;  4A41 A;  1ND2 A;  3VZM A;  5B4N A;  5CG9 A;  4H3W A;  2RDR A;  4CCO A;  3SIT A;  1YEW A;  1QJF A;  1V00 A;  3AC0 A;  4NHK A;  2GNM A;  5FK8 A;  2LW8 A;  3MV1 1;  4HET A;  5A33 B;  2ZEX A;  1JHN A;  3SIS A;  3VHR A;  1MEC 2;  3WW4 A;  1ASJ 3;  4ONU A;  1DGL A;  2Q8C A;  4EN7 B;  5L7O C;  2ZGU A;  5BY5 A;  5GAL A;  3VBS A;  1F31 A;  2VNO A;  1R1A 3;  2VW0 A;  2G1M A;  3C7H A;  1SCS A;  2DYC A;  3HEI A;  1GV9 A;  4AEK A;  4CCD A;  2DCT A;  3DPR A;  1GOF A;  3TEX A;  1HXS 2;  3IT8 A;  3LD8 A;  2OUJ A;  1CGP A;  3HNB M;  1V6L A;  1RUG 3;  3ES1 A;  5JI9 A;  1GBG A;  4QHO A;  3VBH C;  3DL3 A;  5DUV A;  2Y38 A;  5GLW A;  2BBA A;  3VDA A;  5HBA A;  3FZ3 A;  1VBB 1;  5A6Z A;  1OPO A;  1YJK A;  3BVC A;  1JUH A;  1QU0 A;  1G9A A;  1DFQ A;  2AH2 A;  3VV1 A;  4ES8 A;  4FFF A;  4QX0 A;  1W39 A;  2OX0 A;  3EQE A;  2UUR A;  3E97 A;  3NJY A;  5I0S A;  1RUI 1;  4BE3 A;  1HJF A;  2RVA A;  1RIN A;  2YHJ A;  3H3L A;  1OOP B;  2OUH A;  1YHF A;  1QF3 A;  5BNO C;  5CFD C;  1ZZB A;  1JZ8 A;  1R09 3;  2BV4 A;  4GWI A;  4LBN A;  4NAM A;  4DPN A;  4E2Q A;  5DAB A;  1UY1 A;  3IWZ A;  1CES A;  5KHG A;  4BIS A;  2VUD A;  2XB6 C;  1W05 A;  3TNP B;  1SLI A;  2NYY A;  4LBQ B;  3MW4 A;  2VE1 A;  4BH9 A;  1AX1 A;  3S6P A;  3BOW A;  1CZT A;  3Q8C A;  2YRO A;  2YPJ A;  3TN9 3;  2RS3 3;  1OPM A;  3QD6 A;  3WHT A;  1H30 A;  2QQO A;  4I2O A;  1KIT A;  4QDR A;  5FYV A;  1VBA 2;  1C5I A;  2ILM A;  2Y0I A;  2VCM A;  3IMN A;  1JYI A;  1TMF 2;  1L3J A;  3MDP A;  2W39 A;  1G9D A;  4AXO A;  5FYU A;  4X6R B;  3WVJ A;  4QWN A;  4QQL A;  3M4F A;  2ID4 A;  1ODM A;  4FPE A;  4DUW A;  1RTV A;  4F8A A;  1D4V B;  1DP0 A;  1JU4 A;  1Y9M A;  4Y1Y A;  3CIH A;  1PZ7 A;  3VDD A;  4QXB A;  3MUY 1;  1NX9 A;  3PU8 A;  4XAB A;  2OQ6 A;  3ZSE A;  2GH2 A;  4B1L A;  3O0W A;  4JGZ C;  2VXR A;  4YVS C;  4V2V A;  4Y20 A;  3R0R A;  3H42 B;  4AFM A;  5DUW A;  4DXZ A;  2WYF A;  1LES A;  1H1A A;  3U78 A;  3H1M A;  5C3P A;  2Q1F A;  3JB4 C;  4Q8K A;  2KM2 A;  2PHW A;  4IGP A;  2I45 A;  2VW2 A;  3HOB A;  1YQ5 A;  1SLT A;  3HNY M;  1SLA A;  4B29 A;  3PDQ A;  5FWE A;  3DYP A;  1HQW A;  5C8C A;  5CBL A;  4QKN A;  2OQ7 A;  4XF0 A;  4Q5O A;  1MEC 3;  2CAV A;  1SMV A;  1H2M A;  1OUX A;  4RN5 A;  5GLU A;  3RQ0 A;  3I2H A;  3WZ1 A;  2QTW B;  4QHZ A;  3RZM A;  2VUL A;  4XXA A;  4CEY C;  2R06 1;  4I3P A;  4CDU B;  3ZSM A;  1UY2 A;  4YFW A;  2IXJ A;  5FPU A;  4YPJ A;  4CSW A;  3AL5 A;  1EYB A;  3J8F 2;  5JOZ A;  1VJ2 A;  3MBW A;  1H2K A;  4FQ4 A;  1SLL A;  2VMC A;  2WNO A;  2R16 A;  3FMG A;  4YZ3 A;  3RZZ A;  4AFD A;  1DQ2 A;  1CJD A;  1MS9 A;  2R07 1;  3ZO0 B;  4S2G A;  2Y26 A;  2O14 A;  3WNL A;  3UGH A;  2BER A;  1KGY A;  4C1W A;  3WT3 A;  3PUI A;  2ZAA A;  1I1E A;  3T3Y A;  3ZKY A;  3VBF C;  1PNG A;  1RXF A;  5FP3 A;  4WM8 C;  3WP4 A;  1W2A X;  5LK5 A;  1NAE A;  1F5F A;  3D4K A;  3V0B B;  1UZV A;  1OT5 A;  4FPJ A;  2ZJC A;  2HWF 2;  4ZU7 A;  2XVG A;  1BK0 A;  1J58 A;  1GQP A;  4LO5 B;  3AVS A;  1QXJ A;  3SKV A;  1NXM A;  2XON A;  4BHP A;  4GWM A;  1N47 A;  3I3D A;  2BOI A;  4G4F A;  4FBF A;  1O7F A;  4OLL A;  4LBL A;  4LKE A;  4A7Y A;  3W21 A;  1C8M 2;  4D7Y A;  3MIF A;  1EV1 2;  3NW4 A;  3TOJ A;  4R52 A;  4AED C;  4XEZ A;  4DOU A;  1VBA 3;  1BZW A;  2PMW B;  4UXA A;  3BTX A;  4MVT A;  2WT1 A;  1YQ6 A;  1TMF 3;  2CV6 A;  2GC3 A;  3MI8 A;  4XJ9 A;  3FFQ A;  3VKN A;  2BGP A;  3VLB B;  4BDV B;  1Y9G A;  2CAU A;  3UES A;  3LKJ A;  4XUP A;  4CP1 A;  4CDQ C;  1NY7 2;  2CGO A;  4BQW A;  1DDL A;  5T3N A;  4LIT A;  4CCM A;  3PJY A;  4JKM A;  5IAT A;  5JMC A;  1ND3 C;  3MUZ 1;  1S0B A;  4LBQ A;  3JD7 2;  5HI0 A;  3NO8 A;  5FIX A;  1OA4 A;  1GWK A;  4XIK A;  3KWV A;  3MGU A;  4JV4 A;  2O0O A;  1QXR A;  1US2 A;  5C4W B;  4PIX A;  2A3Y A;  3HMY A;  4R4X A;  2V72 A;  4XDO A;  4DRR A;  2EXJ A;  4EQV A;  1FMD 1;  1O91 A;  2WA4 A;  2OPK A;  3N7M A;  1PMJ X;  2QDR A;  3FHA A;  2FDI A;  2WC2 A;  3UJQ A;  2ZGL A;  4QAW A;  2XJU A;  5A3N A;  1AJK A;  5CNA A;  4EN9 B;  5IWF A;  4AK3 A;  1LEC A;  4OI4 A;  1PZ8 A;  2F4L A;  3RZK A;  3W5M A;  2TNF A;  3J8F 3;  4UFJ A;  1CAW A;  1UKG A;  1QQP 1;  2WO7 A;  4LHL A;  3P3P A;  2WFF 2;  1LOE A;  2QUO A;  3AP5 A;  2Z79 A;  2G9F A;  2XJR A;  1ZBE 1;  3C7E A;  4CXW A;  2DVB A;  2AR6 A;  2VNR A;  3AM2 A;  2WQZ C;  3CF6 E;  2NZ9 A;  1YCI A;  2DFC A;  4I01 A;  4GWN A;  2GNT A;  4UW3 A;  5FZG A;  3VL8 A;  1JYN A;  2HWF 3;  1MS3 A;  2QQN A;  3ZLI A;  3WNX A;  4ARY A;  5J36 A;  2E7Q A;  2CGP A;  2P5B A;  1YNA A;  4W6W A;  4LKD A;  2FHR A;  3OPT A;  4LO6 B;  1RUJ 2;  4FP2 A;  1PGW 2;  2D5H A;  4MGZ E;  4HVQ A;  4HLT A;  4Y5T A;  2X8K A;  4MOA A;  5FZM A;  2KR2 A;  3NKG A;  4L0P A;  5GLT A;  5FDB A;  2QQL A;  3AJZ A;  4Q4V 1;  1C8M 3;  1D7P M;  1MS4 A;  3H9A A;  1EV1 3;  4IV3 C;  1VBC 1;  5EJZ B;  5ABJ A;  1JZ7 A;  3HWJ A;  1ULC A;  3R05 A;  5A1A A;  2XUE A;  2A6Y A;  1IS4 A;  3EHK A;  3FBM A;  5A3M A;  4A7K A;  2B45 X;  3AYC A;  3ROU A;  2Q1M A;  1JUI A;  1SFP A;  3DV8 A;  4QPI C;  1GOH A;  2ORX A;  3KS7 A;  4COU A;  1REE A;  2ADD A;  4BJ0 A;  5HPO A;  3LPF A;  4Y4Y A;  1PZ9 A;  4JDN A;  3VHN A;  3O5S A;  3POB A;  5JMO A;  3H8O A;  2YPD A;  2BGC A;  3V0B A;  4YGE A;  3NJZ A;  4AHX A;  3G6J B;  4I09 A;  1CAU B;  2B9U A;  1OXC A;  2OW4 A;  1B35 C;  3JUU A;  2BGO A;  2E7A A;  1OVS A;  2G4I A;  3NV3 A;  4RFT 0;  4XW3 A;  4OHX A;  4LPL A;  4AAP A;  1QJX 2;  4AI2 A;  1TME 1;  1VBE 2;  2RDS A;  3SCH A;  4LIU A;  2W3J A;  1RVF 2;  1SBE A;  4Y26 A;  3I49 A;  3NWK A;  1YUD A;  2WUH A;  3C8X A;  4P08 A;  5G05 L;  3L2Y A;  5BUV A;  4H55 A;  2D6K A;  2IXL A;  2Y6K A;  3FUQ A;  2JE9 A;  4E9K A;  2VQ0 A;  3RNS A;  3R4D B;  1UPS A;  4GWJ A;  3O1U A;  4PCR A;  3GGL A;  5FP9 A;  2IXK A;  5A6X A;  3AK0 A;  1DG6 A;  1EPZ A;  2W46 A;  3IDC B;  4KL1 A;  5FMB A;  5C9A C;  4D3W A;  3M3Q A;  2P3Y A;  3BTY A;  4FQZ A;  4LNV A;  1VR3 A;  4M3C E;  1G7Y A;  1QY4 A;  1NZI A;  3C7O A;  3N9M A;  5CVR A;  1V9U 2;  5FPB A;  2D3P A;  4N9H A;  4DS0 A;  5FLJ A;  5IAX A;  2O8O A;  1UQX A;  2E6V A;  3DYM A;  4P9L A;  3RVH A;  3ZFE C;  4C8D A;  1GSL A;  3FN9 A;  3D5O A;  5FJH A;  3GAL A;  5AVP A;  2HWD 1;  3PLQ A;  5IW0 A;  4ASL A;  1AXK A;  3FC0 A;  4ARX A;  3IN9 A;  4JTN A;  4MH0 E;  4MGK E;  4NIG A;  1ZZ7 A;  3N3H A;  4ZKT B;  5DZE A;  1UYP A;  1L7R A;  1G86 A;  1ODN A;  2TUN A;  3WQ1 A;  2CHH A;  2VMH A;  4E4H A;  1V6M A;  3BB6 A;  4NII A;  3OYW B;  1PM7 A;  1A3K A;  4SLI A;  4URA A;  2XJQ A;  4DB5 A;  4YG0 A;  1DCS A;  1BCX A;  1RUJ 3;  1K3I A;  1E5I A;  5F32 A;  4ZU5 A;  5J48 A;  3WY6 A;  4C1X A;  1XBF A;  2BU9 A;  3ZR6 A;  5JPM B;  4TLF A;  2JEN A;  3JXS A;  3NNL A;  4QX2 A;  1QOO A;  1W8O A;  1DYK A;  4CDW B;  1Z7S 2;  3B5L B;  4GQ7 A;  4XAA A;  5FZ6 A;  1MVQ A;  3ZXJ A;  2W95 A;  2BNM A;  2ZGO A;  5DXD A;  1FV3 A;  2QNK A;  3A0K A;  1Y4W A;  1RUE 1;  3MHZ A;  5F2W A;  3VBH A;  4XUQ A;  3AP9 A;  3NKT A;  1G8W A;  3D6E A;  2PN5 A;  4UFK A;  4NWV A;  5JOX A;  2FDH A;  1PVC 1;  1RUH 1;  5H9S A;  1OD3 A;  3RZL A;  1VMH A;  3WHU A;  1QDO A;  4IEZ A;  1RUI 2;  1EY2 A;  2AYH A;  2BWC A;  3DPR C;  3I2G A;  4LO7 A;  4LOS A;  5B4X A;  4AQ2 A;  5J37 A;  4FO9 A;  1LJ7 A;  4HK9 A;  4FAH A;  1DZT A;  1W3V A;  2GC2 A;  4YLZ A;  2XBO 1;  1CQ9 A;  1M4W A;  5BNO A;  3O14 A;  1C8N A;  5FZ7 A;  3NNF A;  4NPL A;  1JOB A;  2XJV A;  4A42 A;  1YIF A;  3IM0 A;  5C5U A;  3I2J A;  4AWD A;  1VBE 3;  2VW1 A;  1HLC A;  1RVF 3;  2VD7 A;  3UL2 A;  1IZ3 A;  3B00 A;  4L8Q A;  1GOG A;  4JHT A;  2ARB A;  3RSJ A;  1H8T B;  1VMJ A;  2IZW A;  3OBT A;  1GNH A;  3M70 A;  4JKL A;  4BXS V;  2ZAC A;  4ET7 A;  2W1S A;  2HWC 1;  3PU3 A;  3AZZ A;  2DCJ A;  1GNZ A;  5T55 A;  1UOB A;  3LWC A;  3WW3 A;  4CUB A;  3LCP A;  5HV4 A;  3WLU A;  2DBN A;  2SBA A;  3MF9 A;  3ACL A;  3AJY A;  1AYN 1;  2HWE 1;  2A5Z A;  1V9U 3;  4UBH A;  5JXJ A;  1IKP A;  3PVB B;  2D43 A;  2JXA A;  4AHZ A;  1HIX A;  1EUT A;  2C9A A;  3VZL A;  4P9J A;  4C0H A;  4JGZ A;  1YJL A;  4YVS A;  4KWL A;  2V5Y A;  2IXI A;  1WCS A;  3C7F A;  2HYK A;  1KJL A;  3PUS A;  4SBV A;  1PK6 C;  2W9X A;  2QE3 A;  2JD4 A;  3D8C A;  4D7S A;  5E89 A;  2BW8 A;  4B4P A;  5JR2 A;  3DXT A;  1OA2 A;  1GFF 2;  1POV 0;  3VDD C;  2KD7 A;  1VAV A;  2MEV 1;  1GZW B;  3ZDV A;  4KBZ A;  1S0I A;  3ZSK A;  4F83 A;  3TEY A;  2R06 2;  2ZXQ A;  3RDI A;  3KT4 A;  3SEP A;  1O4Z A;  2VTX A;  2WA3 A;  4COV A;  1IGO A;  1TG7 A;  1OLM E;  1HB2 A;  3VBU C;  2V5D A;  5K0U B;  2ZGM A;  4PLM A;  5KHK A;  1MZ6 A;  4Y1X A;  1EAH 2;  4XCB A;  1R08 1;  2YU2 A;  3WP5 A;  4B3N A;  3GDB A;  2GU9 A;  2A1X A;  3E1F 1;  1PO1 3;  5LY1 A;  1W03 A;  1JYX A;  1APN A;  1DQ1 A;  2D5F A;  1O3S A;  5C8C C;  2WR9 A;  1Z7S 3;  4K1Z A;  4IV3 B;  2XML A;  4UYB A;  2EAA A;  5FY7 A;  5L73 A;  5L9B A;  4Q4Y 1;  1UMZ A;  4BA6 A;  1NLS A;  3UET A;  2GN7 A;  4DY3 A;  3OF1 A;  4WM7 B;  4OQ9 A;  3VN4 A;  1ZRD A;  4DXR A;  2RM2 1;  2Q30 A;  4A3X A;  3URF A;  3HNM A;  2WAO A;  3U10 A;  4XET A;  2A6V A;  1RUI 3;  3H3Z A;  5D8A B;  5JDB A;  2C26 A;  3IDB B;  1UXZ A;  1GP6 A;  1X8E A;  4XFC A;  4PQQ A;  2VVD A;  1OD5 A;  3V0A B;  4EZ4 A;  2ZGS A;  3C2U A;  3TBD A;  3JCI A;  3UNP A;  1MZE A;  3BPS A;  1ALY A;  5KHJ A;  1ULD A;  4OUL A;  5IT6 A;  2HBU A;  4YRD A;  1N3Q A;  3PJQ A;  4YW2 A; 
#chains in the Genus database with same CATH homology
 1JYW A;  2YFU A;  1EUU A;  2W1Q A;  2VZP A;  3OB8 A;  4QDS A;  2VC9 A;  3NQH A;  2E31 A;  2YG0 A;  1T2X A;  3EB7 A;  4QPW A;  3ACI A;  2J1V A;  1PX4 A;  1SDD B;  4DUX A;  4A41 A;  2DDU A;  1MPX A;  5B4N A;  3A23 A;  1I5P A;  3AC0 A;  3THD A;  2LW8 A;  3MV1 1;  2ZEX A;  3NJV A;  4ZY9 A;  3I3E A;  3WSO A;  3I3B A;  4MGS A;  3T0A A;  4MAD A;  2WN2 A;  3C7H A;  3ZM8 A;  3HEI A;  3T0B A;  1GOF A;  3WF3 A;  5DPN A;  1P8J A;  3A7Q A;  2Y8K A;  1UXX X;  4XUN A;  3HNB M;  4FI9 A;  3IB3 A;  2WZ8 A;  4OYU A;  3ACG A;  2BBA A;  3VDA A;  5JXH A;  2J1E A;  5CYY A;  4QX0 A;  4XUO A;  2HLE A;  3OGV A;  1DYO A;  4JKK A;  3VD4 A;  2RVA A;  1GU3 A;  1JZ8 A;  3OGR A;  4GWI A;  4PF1 A;  3CKH A;  5IFP A;  1UY1 A;  1UMI A;  2Y6L A;  4KWU A;  1HN1 A;  2W47 A;  2J1S A;  5LA0 A;  3J7H A;  3P6B A;  4DXS A;  1CZT A;  3T2Q A;  2QQO A;  4QDR A;  3OBA A;  1H6X A;  4QB1 A;  1YQ2 A;  4D8M A;  3I2I A;  4ZZ5 A;  2ID4 A;  4DUW A;  3WNK A;  1DP0 A;  1JU4 A;  2Y6H A;  3PUH A;  4JX0 A;  3CIH A;  4HG6 B;  4DEQ A;  2VJX A;  2ZEW A;  1NX9 A;  3MUY 1;  4DUV A;  2EIC A;  4CU7 A;  2YC4 A;  3WQB A;  3HOB A;  3ABZ A;  3HNY M;  3T09 A;  3DYP A;  3CZJ A;  1CX1 A;  4IUG A;  4RN5 A;  2ZEY A;  1CIY A;  1XNT A;  3A21 A;  3I2H A;  2YB7 A;  4LHS A;  3EYP A;  2Y64 A;  5DMY A;  1UY2 A;  2JDA A;  1US3 A;  2WAA A;  4YPJ A;  5DQ0 A;  4CUA A;  3WNN A;  3OG2 A;  2W87 A;  3MBW A;  1W9T A;  2VMC A;  3WNM A;  4MO3 M;  1LNS A;  3W5N A;  3ETP A;  1L7Q A;  4MGQ A;  3WNL A;  2BER A;  1KGY A;  1SG3 A;  1UZ0 A;  2LS6 A;  3PUI A;  2J1T A;  3LPG A;  5JXG A;  4A45 A;  1NAE A;  3WF2 A;  3IAQ A;  4OMC A;  1OT5 A;  4XUT A;  1W0N A;  3NJX A;  1GQP A;  3NRU A;  1XPW A;  2C4X A;  3OEA A;  3SKV A;  2VCC A;  2XON A;  2Y6G A;  4QX3 A;  2QBX A;  5J1X A;  4QB6 A;  1JZ2 A;  3I3D A;  2HYX A;  3III A;  1W9W A;  2VZT A;  1R64 A;  2J7M A;  4UAP A;  2R7E B;  3DYO A;  2JE8 A;  2WBK A;  3LEG A;  2VZQ A;  3WNO A;  1K12 A;  2VME A;  1GUI A;  2BGP A;  4BDV B;  4XZU G;  5JUV A;  2VTF A;  3UES A;  1IQD C;  1PX3 A;  1TVG A;  4XUP A;  1K45 A;  5IHR A;  1XNA A;  4P02 B;  3ECQ A;  1K42 A;  4BK4 A;  4JKM A;  3MUZ 1;  3SKJ E;  3DEC A;  2QQJ A;  1US2 A;  2QQI A;  3FL7 A;  3LQC A;  4CU9 A;  2V72 A;  3LEI A;  3K4A A;  2J22 A;  1JU3 A;  3THC A;  4D0Q A;  1O8P A;  1PMJ X;  3FHA A;  4QAW A;  1GMM A;  4ZZ8 A;  2VCB A;  2WYS A;  2EIB A;  3W5M A;  1CZS A;  4P5Y A;  4TTG A;  3T0D A;  2VQT A;  2W1U A;  2C9K A;  3C7E A;  3FHQ A;  4LQR A;  1UMH A;  2J1A A;  2W1W A;  1JYV A;  3NNG A;  4UOJ A;  4E8D A;  5EIY B;  5JXI A;  1JYN A;  3I2K A;  2QQN A;  2OKX A;  4ARY A;  1W9S A;  2CDP A;  5C70 A;  3IDA A;  4MOA A;  4L0P A;  4QB2 A;  2QQL A;  3ACF A;  2W91 A;  1D7P M;  1BHG A;  4M4R A;  1JZ7 A;  5EJZ B;  2EID A;  5A1A A;  3LE0 A;  2VM9 A;  1UWW A;  2ORZ A;  3WEZ A;  1JHJ A;  2Z4F A;  2RV9 A;  2Y6J A;  3OGS A;  2VZV A;  5G04 L;  1GOH A;  2ORX A;  3CZU A;  3VDC A;  1UYY A;  3WNP A;  4BJ0 A;  5HPO A;  3LPF A;  2WO1 A;  3MV0 1;  3D3A A;  5CZK A;  1ULP A;  5JMO A;  2J1U A;  3WF0 A;  3CMG A;  5DN2 A;  1JI6 A;  2X09 A;  4OZO A;  3U37 A;  4XVH A;  3P1I A;  4PT6 A;  2BGO A;  4LPL A;  5F7U A;  2JKX A;  2WN3 A;  2W3J A;  2E33 A;  3GM8 A;  4M4P A;  4OMD A;  5HXM A;  1W99 A;  1SHW B;  1WKY A;  3I97 A;  1JZ5 A;  1J84 A;  2WUH A;  3C8X A;  3HN3 A;  4P08 A;  5G05 L;  3T2P A;  1WCQ A;  2BZD A;  3LEK A;  2Y6K A;  4GZ9 A;  3VD3 A;  4GWJ A;  3WF1 A;  2B9V A;  2EIE A;  3GGL A;  4OUE A;  1ULO A;  2W46 A;  2VR4 A;  1UY0 A;  3C7O A;  2XHN A;  2L9L A;  2W5F A;  5C7G A;  2ZEZ A;  4RYD A;  4AAX A;  2DCK A;  3DYM A;  1PMH X;  4CVU A;  5LCW L;  3FN9 A;  4W4Z A;  1DLC A;  2X05 A;  1J83 A;  1KEX A;  5IYY A;  1GNY A;  4ARX A;  1OF4 A;  3VD9 A;  1L7R A;  4A44 A;  4Z2A A;  1F4A A;  2E32 A;  2VZR A;  2XQX A;  3K46 A;  4CU8 A;  5FUI A;  3C7G A;  1JZ4 A;  4CU6 A;  2PQS A;  3HPN A;  2V4V A;  1K3I A;  4E8C A;  3IAP A;  4QDQ A;  2VMD A;  5I0D A;  3F2Z A;  4XUR A;  2VCA A;  3JXS A;  4BK5 A;  4QX2 A;  1W8O A;  3K77 A;  3ACH A;  2W95 A;  2QQK A;  2VL4 A;  5EJ1 B;  4XUQ A;  4TXW A;  3CDZ B;  3K75 B;  1OD3 A;  5LA1 A;  3I2G A;  2WO2 A;  5B4X A;  2J1R A;  1RYY A;  1O8S A;  4ZXE A;  5IFT A;  1NUK A;  4A42 A;  4A4A A;  4A3Z A;  3I2J A;  5C71 A;  4UI9 L;  1GOG A;  2X10 A;  1JZ6 A;  3CQO A;  4KMQ A;  2VO5 A;  4BXS V;  4JKL A;  2VZS A;  4W50 A;  4ET7 A;  2W1S A;  3T08 A;  2DCJ A;  2VQU A;  4CUB A;  3A22 A;  2XOM A;  2VZU A;  4CUC A;  3OEB A;  3WF4 A;  2YFZ A;  3HJR A;  4DXT A;  5IJR A;  5JXJ A;  4AG4 A;  5LA2 A;  1EUT A;  3BN6 A;  2YC2 A;  1CZV A;  2E26 A;  1UYX A;  3K4D A;  3C7F A;  2VZ1 A;  2VMF A;  2W9X A;  2JD9 A;  2WQ8 A;  1W8N A;  2WZE A;  5JR2 A;  1OF3 A;  3I2F A;  2KD7 A;  2B4K A;  2QQM A;  1NKG A;  4A6O A;  2W92 A;  2ZXQ A;  1H6Y A;  3SEP A;  1UX7 A;  1TG7 A;  1XC6 A;  2V5D A;  3VD7 A;  3GDB A;  2WDB A;  3E1F 1;  1JYX A;  2CDO A;  4JHZ A;  2VOT A;  3UET A;  3VDB A;  1UY4 A;  2WO3 A;  3MO4 A;  1F4H A;  2WAB A;  4DXR A;  1OH4 A;  4DEV A;  3VD5 A;  3T2O A;  2RJ2 A;  3HNM A;  2WAO A;  2VZ3 A;  2C26 A;  4LKS A;  1UXZ A;  4W8J A;  1JZ3 A;  4PQQ A;  2VZO A;  3GXU A;  3SEE A;  1UYZ A;  3BGA A;  3UNP A;  1UY3 A;  3K4Z A;  4P00 B;  4KI5 M;  4QX1 A;  1O59 A;  2W94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...