1O8SA

Structure of cscbm6-3 from clostridium stercorarium in complex with cellobiose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
VGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE ENDO-XYLANASE
publication title Structure and Ligand Binding of Carbohydrate-Binding Module Cscbm6-3 Reveals Similarities with Fucose-Specific Lectins and Galactose-Binding Domains
pubmed doi rcsb
source organism Clostridium stercorarium
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8sA00
3MBWA 4YPJA 4MGQA 2ID4A 3BN6A 2XONA 3SEEA 2VTFA 1JU3A 2JE8A 3IB3A 2VZSA 5LA1A 2J22A 3VDCA 2V5DA 1W9TA 3WF2A 4AG4A 1GNYA 2VCAA 2HLEA 4MOAA 2X05A 1PX3A 2W94A 3A23A 3CDZB 3HJRA 1K3IA 4JKLA 5JXHA 3I2KA 5F7UA 3HNBM 1UY1A 5CYYA 4UOJA 5G04L 1O8PA 3K4DA 4QB2A 1TG7A 3OGSA 3FHAA 1XPWA 3WNMA 4AAXA 1LNSA 1UMHA 4GWJA 1K12A 2W95A 4QB1A 2B4KA 1UY0A 2VL4A 2EIBA 3OGRA 1PMHX 2ORZA 1J84A 4QDSA 3NJXA 4M4PA 4XUQA 3I2IA 4UAPA 1TVGA 2XQXA 1T2XA 3K75B 5G05L 1OT5A 1KEXA 5EJZB 3ACHA 1JZ7A 3P1IA 3I2FA 2ZEZA 2VQTA 2W9XA 3HNYM 4KI5M 4FI9A 4ZZ5A 2QQKA 5C7GA 1OD3A 2W87A 3DYMA 4CUBA 1O59A 4JKKA 2LS6A 4DEQA 2EICA 5HPOA 4QX2A 2RVAA 3VDBA 3C7GA 1JYWA 2WABA 1CIYA 1GOFA 4DEVA 4CUCA 2WN3A 3ACGA 3T0AA 3VD4A 3AC0A 3FHQA 2X09A 1JYXA 2ZEWA 4MADA 1DP0A 4QDQA 1XC6A 2BGPA 2E32A 4DUXA 3ACFA 4CU9A 3GM8A 3OGVA 1CZTA 3ABZA 1UXXX 2DCJA 5IFPA 3PUHA 3C7EA 5DPNA 4ZZ8A 2WBKA 2VQUA 5JR2A 2QQLA 5B4XA 3T08A 3T2QA 5JMOA 2BGOA 3CKHA 3NJVA 4A42A 4HG6B 2YB7A 2W3JA 4E8CA 2QQIA 2J7MA 4ET7A 4E8DA 2W5FA 1NUKA 5CZKA 2ZEYA 4RYDA 4P5YA 3GDBA 1MPXA 4QAWA 3A21A 4MO3M 4GWIA 4OUEA 5EJ1B 1JZ4A 1KGYA 2VMDA 1SHWB 2W1QA 3CMGA 3HNMA 5JXIA 4P02B 2C26A 4D0QA 2XHNA 2VZ1A 2QQNA 4CU7A 1NX9A 3DYOA 1H6YA 1US3A 3VD7A 3A22A 2ORXA 3LQCA 4P00B 1F4AA 4CVUA 3NRUA 3T09A 1GOGA 3LPGA 2BERA 4CU8A 1PX4A 1JZ6A 2E33A 5JUVA 4OMCA 4Z2AA 3VD5A 1PMJX 3MO4A 3ECQA 1UZ0A 1US2A 4LKSA 3F2ZA 3P6BA 1UYXA 2VR4A 3HPNA 3DECA 5DMYA 1JU4A 1W8OA 2B9VA 3IDAA 4A44A 3HOBA 5IFTA 2WO2A 1GMMA 3WNNA 4KMQA 4JKMA 3EB7A 2E31A 3ACIA 3WEZA 4UI9L 2ZEXA 1JZ2A 3THCA 5LA0A 2W1WA 2X10A 4ARXA 2W92A 2BZDA 3MV11 2JD9A 3T2OA 3UESA 2KD7A 4TTGA 4LPLA 1DLCA 2W47A 1K42A 5A1AA 2V4VA 4BK4A 3OEBA 1O8SA 1UWWA 2WAOA 2C9KA 1WKYA 1JI6A 3CZJA 5FUIA 3VD3A 2J1VA 2J1AA 3NQHA 3LE0A 4LQRA 3UETA 4XUNA 3I3BA 3MUY1 3C7HA 2J1EA 3T2PA 1GU3A 2VZ3A 3OG2A 2W1UA 4W4ZA 4DXRA 3C7FA 3I3DA 5I0DA 5JXGA 3W5NA 4A45A 4XZUG 1WCQA 4XVHA 1CX1A 3UNPA 3CIHA 3IAQA 1W9WA 3MV01 1GUIA 2EIDA 3K46A 4M4RA 3WF4A 3I2GA 3K4ZA 2VZPA 2WZEA 1ULOA 2VC9A 3WF0A 3IAPA 2VMFA 3EYPA 3LEGA 2YG0A 1UY4A 3I97A 3D3AA 2Y64A 3MUZ1 4W8JA 3T0DA 2JDAA 2VM9A 1NKGA 3FL7A 4BJ0A 1JYNA 2ZXQA 2E26A 1J83A 3OBAA 4QPWA 4DXTA 2WZ8A 4MGSA 1GQPA 5JXJA 4XUTA 1GOHA 2C4XA 3THDA 3VDAA 1XNTA 3GGLA 1I5PA 1IQDC 2VCBA 4A6OA 3K77A 2HYXA 5LCWL 4RN5A 2WYSA 1NAEA 5IJRA 5EIYB 4ARYA 1UYZA 2WUHA 1D7PM 1UY2A 2YC4A 3SKJE 2YFZA 1OF4A 4PT6A 4TXWA 3ZM8A 1EUUA 2VZRA 4QX0A 4PF1A 3SEPA 1SG3A 4QX3A 1JZ5A 4A4AA 3FN9A 3LEKA 2QBXA 2VO5A 3C8XA 4IUGA 3WNOA 2Z4FA 2QQOA 2YC2A 3C7OA 4JHZA 5B4NA 2QQMA 2W1SA 1JHJA 3T0BA 2VZOA 1ULPA 4JX0A 1JZ3A 1UMIA 1W9SA 2VZVA 1UY3A 2Y6KA 3U37A 4KWUA 2Y8KA 1W0NA 3WNPA 1W99A 1OH4A 3CZUA 2BBAA 1L7RA 3DYPA 4L0PA 2Y6LA 2WQ8A 4XUPA 2WDBA 2CDPA 1JZ8A 3WQBA 4QB6A 2J1UA 3GXUA 2WO3A 3OEAA 1UYYA 4OZOA 2RJ2A 1CZVA 3NNGA 5IYYA 2DDUA 3WF3A 2QQJA 1HN1A 4QDRA 2J1SA 3E1F1 1BHGA 1EUTA 2VOTA 2YFUA 3CQOA 4CU6A 3VD9A 2PQSA 3I3EA 3WNKA 3WSOA 3K4AA 2Y6GA 2R7EB 1CZSA 4QX1A 1R64A 2VMEA 3SKVA 1H6XA 2W46A 5LA2A 4BK5A 5C70A 2EIEA 2WAAA 5DN2A 4A3ZA 2W91A 2VZUA 4GZ9A 4DUVA 1OF3A 2L9LA 1XNAA 4D8MA 1DYOA 3WF1A 4A41A 2VJXA 4OMDA 2J1RA 3LPFA 4LHSA 2XOMA 1RYYA 5J1XA 3PUIA 2LW8A 4BXSV 4W50A 3LEIA 4ZXEA 1L7QA 3W5MA 4DXSA 1SDDB 2VMCA 3HEIA 5C71A 4ZY9A 1UX7A 1YQ2A 2VZTA 1JYVA 3WNLA 3ETPA 2OKXA 3IIIA 5HXMA 5IHRA 3J7HA 3BGAA 2VCCA 1K45A 3I2HA 4OYUA 4PQQA 3OB8A 4XUOA 2JKXA 3A7QA 4XURA 1P8JA 1UXZA 2RV9A 2WO1A 2Y6HA 4DUWA 4CUAA 4P08A 2J1TA 2DCKA 2WN2A 3I2JA 1W8NA 4BDVB 3JXSA 2V72A 2VZQA 1F4HA 2Y6JA 2CDOA 3HN3A 5DQ0A
chains in the Genus database with same CATH superfamily
1UYPA 3MBWA 4YPJA 5I93A 4H3WA 3LSDA 2C1FA 4X8PA 4AI3A 4IE7A 5DZEA 2FD8A 5DDJ2 3SCFA 1IS6A 4YLZA 3USSA 4DXZA 2FMDA 1W2TA 1MS8A 4UBHA 1HDKA 1C8NA 2JE7A 2VZSA 3ZSKA 4CDWC 4NE9A 1W6MB 2J22A 4FFFA 1YQ5A 5H9QA 1RVF3 2HJIA 1RUF1 4META 4LJHA 1W90A 1ST8A 1PK6C 4FOVA 4YGDA 5ABJB 2D3PA 3ZYBA 3TRSB 4NHKA 2HLEA 1GZ9A 5KHIA 2HH9A 2X05A 1RL3A 3V56A 4LR4A 1X8MA 1BVVA 1W2NA 4F83A 1OLMA 3CDZB 3PIGA 4QGMA 3F95A 3EQEA 3LEMA 4Y33A 4AEKA 4K1YA 3VKNA 3I2KA 1W8ZA 1HRV1 4GJZA 4Q4W3 1H1MA 1BMV2 2Y60A 2O8OA 5A6QA 1NY72 1Q3EA 1BQPA 1WLDA 1LU1A 3OGSA 1OFSA 3KCYA 4N7UA 4P9IA 1XPWA 3OD0A 3KQRA 1LNSA 5C9AC 2GC0A 4RQPA 3H3LA 5ANNA 1DFQA 2NM1A 3POEA 4RGKA 4Q8LA 4Q1PA 2W95A 4QX8A 4QB1A 4WM7A 5ERLA 5FMBA 2B4KA 2JWPA 5A6XA 4FTBA 3VKMA 4QDSA 4XILA 1H0BA 2CGOA 3WHTA 2P5BA 3AKTA 1H2NA 4IGQA 4XIKA 2WSVA 5BY5A 2XQXA 2AR6A 4XHBA 5AVAA 2JG8A 1G9FA 1MZEA 1OT5A 3I8TA 5FJKA 3ACHA 1JZ7A 4XXAA 4COWA 3DXUA 1NA1B 1WMFA 1FNYA 2ZEZA 2RS12 1ZRFA 4I0WB 2CV6A 4XBLA 4GXLA 3HNYM 4ZZ5A 1QHDA 2QQKA 3CU7A 1MS3A 5CA6A 5FLHA 1OA4A 4W6XA 1S2BA 4HPKA 3H1WA 4BQ5A 4CUBA 4JKKA 1GYKA 4AI2A 1EYBA 1OUSA 4Q4Y1 4DEQA 2EICA 2JX9A 4YFWA 3WP4A 1XNDA 4BCUA 1U5XA 3VDBA 2EALA 4FO9A 4LXLA 4Q4X2 3RRDA 1EAH1 3JUUA 2UYAA 4CUCA 1DQ2A 2WN3A 3T0AA 2UWBA 4XE9A 2ET7A 3OBTA 1BZWA 2AGSA 2B45X 1D4M3 2PXJA 2VUAA 3I3QA 3LD8A 1XE0A 2ZX1A 3JBG2 4MADA 3KQ4B 2BGPA 4KGGA 2RDNA 4ZU7A 2H0VA 2IXHA 3PVBB 3RVHA 4I0AA 3B02A 3S7EA 1PGW1 2IXCA 1S55A 5A6ZA 2PHTA 1YJKA 1PIV2 1Q8PA 5T3NA 4HL0A 4DNYA 4JGYC 4IV3B 1S0JA 1CGPA 1RUF3 2Q8DA 2R32A 3TEYA 4BIFA 1CZTA 2WIIB 3O14A 2VUJA 4AXOA 2DCJA 4BQ4A 2OT7A 1VALA 1DGLA 2GU9A 2VOWA 5JR7B 2Q1ZB 2AUYA 5FP4A 5DPNA 1RMU2 1AJOA 4HANA 4ZPIA 5BNNB 1C1LA 1WW5A 3T2QA 3I54A 1W0PA 4FPHA 1FV2A 4IEPA 4L92A 3I59B 4IDZA 4MV2A 5D8AC 1OUXA 4AFBA 4DY3A 4Q0VA 4W6YA 4A42A 3U07A 2Y0OA 2YB7A 2W3JA 2ZCWA 2QQIA 4N53C 2GP5A 5IVBA 2Z79A 2B5HA 5EYXA 5FWJA 2OUJA 2W5FA 2IUWA 5CZKA 3ZMOA 4C8DA 1G9DA 1FPN3 4RFT0 4P5YA 3GDBA 4QAWA 1W6PB 4RYDA 1K5MC 5LK5A 5K7PA 2Q1MA 1RXGA 2RM21 2YZ4A 4PDWB 4UFJA 4NIDA 1UAIA 1HLCA 1RITA 2KM2A 5DAWA 1XJAA 1C1FA 1S0GA 2BOJA 3WDUA 2ZHMA 3HNMA 1QJY3 1RUI3 1ULDA 3J8F2 3MIGA 5K0UB 5JXIA 4P9JA 2QQNA 1QMJA 5F5QA 1AYN3 2E7TA 2NQYA 5FRAA 4MXVA 4TWTA 4MVTA 1VPHA 3WP3A 1US3A 1Z0HA 4DFSA 3A22A 2QDRA 2R1BA 2BWAA 4LO7A 2XDVA 2B46X 2P3YA 2XJTA 1T6BX 1UOFA 5EWSA 1MVQA 1GOGA 3VDDC 1GQHA 3NNMA 4QQLA 4XACA 2FHRA 2RR11 1XNKA 1QQP1 2VY0A 1CIWA 2E33A 4K9SA 4BQ1A 2MEV3 3RSJA 4Z2AA 3RNSA 4Q4Y3 1PMJX 3VD5A 3HVDA 2YY1A 4CXWA 2OXBA 4CCMA 3D0SA 4L99A 3F2ZA 2P4EA 4JVAA 1JOBA 1LOBA 1OOPB 3POIA 1EAH3 5FJHA 4OI1A 2DVDA 1V6KA 1UO9A 3OD4A 4CCKA 2WNEA 4BQ2A 4FFIA 1KQRA 5IFTA 5CG8A 1MACA 3FMGA 3O1VA 3EB7A 4MH0E 1CPNA 3ES1A 1AX2A 5FZOB 2VH9A 1XU2A 3OJBA 2A6XA 3THCA 4YSFA 4XCBA 4CCCA 3VKOA 2JDHA 3LF7A 4OI4A 2BZDA 2JD9A 3T2OA 3UESA 4TTGA 1STMA 4LPLA 2D6PA 2W47A 3VBHA 2AC1A 2BJSA 2V4VA 1QWRA 2FCVA 3BOPA 3OEBA 2ZGUA 1JYCA 1VBC3 1IS3A 2ZKLA 5DUVA 4AVCA 1D2SA 3VHNA 4YNIA 5GLVA 3WP6A 2WAOA 3VBRC 1ND3A 4K8RB 4LMFA 1HXS2 2C9KA 2GNBA 2RMU1 5JSPA 1DBNA 1WKYA 1NZIA 1POQA 3CZJA 1XYPA 2VBDA 3MYXA 1W8HA 4MSVA 4Q0QA 5ACA2 4GH4A 3NV4A 4NMIA 3QLQA 4LQRA 4X8NA 5D2AA 4XDQA 2PELA 3DXTA 2D6LX 4LO5B 2J1EA 2MPFA 4XIOA 4JQRA 2X5IC 4AEDA 1DIWA 3POJA 1VBD1 3OYWB 1YUDA 3AZYA 5A7OA 5LB6A 3UYJA 3ZIXA 5EPAA 4NIIA 1GU3A 2VZ3A 3OG2A 4LO6B 4Y24A 5FPAA 4CUGA 3RZKA 2ZGTA 4QXBA 2HKXA 3PMEA 1TZOA 3WG4A 4LO8A 5M0TA 3TEWA 5KXEA 3C7FA 3I3DA 3RZLA 1BBT1 2BEOA 5E8AA 2FDGA 5I0DA 3Q8EA 4YZ4A 3W5NA 4XZUG 3UNPA 3N4MA 1VAKA 3AJYA 1RIRA 4RFRB 1G9BA 4D7TA 2YBPA 4YVWA 3MV01 3MEPA 2HWE1 3VV1A 4AEJA 2EIDA 4M4RA 1W28A 1SLAA 5H9RA 1GP6A 4YARA 4IETA 3K4ZA 4CP2A 1ULOA 3K3OA 2XJUA 3KZ4C 3IAPA 2VMFA 3THPA 3WF0A 3WDXA 5E6HA 3U11A 4FT8A 1BEV2 2JDZA 4O9EA 3MICA 1LU2A 4QXKA 2RR13 3DKWA 3MUZ1 4AGRA 1ZBA2 4W8JA 1BK0A 5FP3A 4LIUA 4AOCA 3O0VA 4CEYA 2JDAA 2VM9A 2YGLA 3FL7A 4WV8A 5FAXA 3LIGA 4OCTA 3ZXAC 2WT2A 4SBVA 1A3KA 1VMHA 5BYNA 4BZ4A 3CJIA 4DXTA 3CNAA 5GZCA 3SXWA 4MGSA 5JXJA 4EWDA 5EV7A 1TEIA 3ITQA 4FQ4A 5KHHA 3ZYHA 4XDOA 4UBGA 4LA2A 3V0AB 1X9PA 4SLIA 2RHPA 5FBZA 4CDUB 5C4WC 4CCEA 2ZBJA 1YWKA 5JMOA 1IQDC 1R093 1V00A 5LATA 4QKDA 1ENRA 3AVSA 4LUKA 1VJ2A 1FV3A 3K77A 3U78A 4AWDA 1COV2 2HYXA 4RHV1 3USUA 5FV3A 3LOBA 1NCQA 2XMLA 2RJLA 2OUHA 1RUE3 4IV1C 4ARYA 4V1PA 5FP9A 4HN0A 3VBSB 3WUDA 1WMEA 5JOYA 3U10A 4D6QA 5FFOC 1D7PM 1UY2A 3RZZA 5F1RA 3ZFEC 1SQ4A 2XUEA 2K2SA 4BM8A 3N35A 1ALYA 2GZWA 3AP7A 3FC0A 1OF4A 1WCDJ 2WFF3 1XBFA 1Q8OA 5A3MA 4OHXA 4Q0UA 2SBAA 4Q0SA 1DDLA 2WL1A 2ENRA 1EUUA 3KMHA 4JDOA 3ZM8A 5GLWA 4QX0A 4OVEA 2JD4A 2A1XA 4PF1A 4AFCA 3E5UA 2GC3A 1SBEA 3BVCA 4M3CB 1VBD3 5DDJ1 4UT5A 3U14A 1URXA 3ES4A 3ILFA 3LEKA 4CZSA 2R1DA 2VO5A 1C57A 2VTXA 2Z4FA 3NVCA 5FZMA 1ZYBA 2H6CA 2O1QA 5AFEA 4ZZ8A 1CESA 1SLCA 4OHVA 1BBT3 2YDEA 4PIZA 4JHZA 5C8CB 2W1SA 1C5HA 2A6VA 2ADEA 3T0BA 4AVSA 4JX0A 1JUIA 4DINB 2VZVA 4NPRA 1QJFA 5I0UA 3WOGA 2VVEA 3FZ3A 1JODA 2VNOA 1MQTC 3KVAA 4GMP3 3K2OA 1VRH3 2Y8KA 3WNPA 5CFDA 4CCNA 3O1TA 3WG2A 2A7AA 1L7RA 3DYPA 2QE3A 4L0PA 4YW6A 1TMF2 2D97A 1BMV1 4NHXA 3PURA 1UL9A 4GB31 2MHFA 4J25A 4XFIA 4GJYA 1OA3A 1PM4A 1QEXA 4YGEA 1FMD2 2GALA 4JHTA 4JRAA 3LCPA 5DAVA 1JZ8A 4UXAA 4CDWB 3M3QA 4QB6A 5LASA 5L7OC 3GXUA 5A6YA 5FYSA 1H2KA 2Y38A 5DZGA 4IV3C 3R4SA 3PMSA 1PK6B 4P14A 3VB9A 1DZQA 5AC93 2ARAA 4WM8A 3BTAA 1IZ3A 4EN6B 1GNZA 1QF3A 4XJ8A 1TNFA 3B9IA 3ZYRA 5IYYA 2DDUA 2OX0A 3WF3A 2QQJA 1CAVB 1RUI2 3J7LA 4LEJA 4ZS3A 5L36A 3I3MA 2PMWB 2WFPA 5FZEA 1Q8SA 3BIWE 1AYN2 2JIJA 3KM5A 3R4UA 4NRMA 4A6SA 4BHPA 1DG6A 3HMYA 5BNNC 4DY5A 5A3PA 3ZX7A 1H8VA 3VL8A 4N9HA 4INDA 2D5HA 3VD9A 1FATA 4RD7A 3UGFA 4OI2A 4CCDA 5CAZA 5L9BA 5LK7B 1QIQA 1AR73 3K4AA 3THTA 1XU1A 2ZA9A 2XPJA 5C9AB 1H2MA 1JOPA 3NL1A 4UW5A 5CU1A 5LA2A 4FPFA 2PLV1 5LEJA 4K40A 3KT7A 4GZ9A 5FZ0A 4EN7B 2A6WA 3ON7A 1TNRA 4CCJA 1YJLA 3CBNA 3QH7A 4NRQA 3WQ7A 4JQTA 1H2LA 1ZBE2 1BXHA 4B1MA 2WNUA 1UD1A 2GMPA 3HT2A 2Y34A 2XOMA 4Y4YA 5J1XA 1J1TA 1SLLA 1UOJA 4W50A 4BH9A 1YI9A 4XQ4A 5J7MA 1M4WA 5BXXA 4MXWA 3PUSA 1L7QA 2JECA 5JZGA 4B8EA 1ULGA 2VMCA 1W9FA 1REFA 4RSUA 2B7YA 2BYVE 2MNGA 3M2MA 1UQXA 1PNFA 3MGUA 4IEVA 3P3PA 4CU9A 2DVGA 1LCLA 3GZEA 3IIIA 3DEMA 3NSTA 2Q8CA 1VBC2 5GZEA 1FOD1 4AI8A 4OYUA 4QT6A 5DUXA 4JDMA 1YLLA 1RXFA 1Y3TA 2FQPA 1W6OA 2JKXA 3ZIWA 2YPJA 1WW7A 4KQ7A 1P8JA 5HCAA 4AVVA 1NOVA 3N9OA 2RG4A 4CUAA 2A71A 2B39A 4NVPA 4P08A 3RS6A 4GB33 4HVRA 4LT5A 4IE0A 1QOSA 2WNOA 2WN2A 1MEC1 2HWF2 1QKQA 1SFNA 2QQVA 1XNBA 4BQYA 4JCKA 4N43B 1QXPA 1QU0A 2VQAA 1IS5A 1W8NA 1Q8QA 1XYOA 2PAMA 3I2JA 4BDVB 2I07B 5IW0A 4XCAA 4RR3C 4JGYB 4DO0A 2V72A 2IFWA 4C91A 4XXPA 3H8RA 1RUJ3 2RS31 5FYUA 4GD4A 1TME2 1HQLA 4YZ3A 1UKRA 5A7NA 3LA3A 3T1LA 4D6RA 4MGQA 2ID4A 2ZGKA 3RI8A 3MLLA 1CN1A 1OQEA 2WNVC 4FP2A 2DFCA 4GULA 4IE4A 4JGZC 2JXAA 2GDFA 3IPVB 5FPBA 4GALA 5HI0A 2VTFA 2JE8A 1QXRA 4MGTA 4QPIA 3ZN6A 1Y9GA 5C6CA 5LA1A 2GC2A 2ZHKA 3N7LA 4ISRA 5T5LA 1H30A 3MI8A 4EYUA 5EYYA 4MG2A 1RUG3 1V9U3 2WR9A 5FWEA 1W6QB 1PO23 1B35A 2PHXA 1YFUA 3WF2A 1HJFA 5LEKA 1D0GA 2CU5A 1JHNA 3D5OA 1GNYA 3FUQA 3V64A 4ATEA 5FPLA 3P5BA 1AXZA 3RJ2X 2PHRA 4YRDA 1H4HA 3ROUA 1X8EA 2W94A 1SEFA 3CLPA 2NLRA 3A23A 4FTSA 1UPIA 1A34A 1SLBA 4LTAA 2XBO3 4B29A 4E4SA 2Q8OA 3ZMNA 5JXHA 2HEYF 1NCRA 5F7UA 2UWCA 4AQ6A 4MGIE 3VBOA 5CYYA 4UOJA 5G04L 4EV0A 2WZPP 1O8PA 3K4DA 4G9SB 1TG7A 1LHOA 5CKQA 4FPEA 3ZKYA 4Q4V3 5GLUA 4K8FA 1PO12 2JIGA 2XJPA 4YG0A 5CVRA 2HWC3 1UMHA 1QJU2 3ZXLA 1JH5A 3RWNA 4IEOA 4R9AA 1UY0A 4C1WA 1DQ6A 2A6ZA 1UU6A 3BPSA 4NIGA 3T4HB 5HV0A 4M4PA 3I2IA 1RUE2 1C8M1 3ZN4A 3OUHA 3W20A 4LBOA 5JLVA 2GH2A 5A32B 1Z7S2 4CCLA 4EN9B 5C3PA 2IC1A 1FOD3 1LGCA 3KGLA 4XTPA 5GZDA 3I2FA 3PTYA 2AEYA 4KBZA 1J3QA 2WFF2 2VUCA 3UT0A 5DG1A 2OQ7A 3KV9A 4PHZA 5FXWA 5ACA1 4UW3A 4Y22B 1UMZA 3U0ZA 3WDYA 1OD3A 3DYMA 3RQ0A 5CFCB 3ZDVA 1LGBA 1V0AA 1VLNA 1F15A 4KNCA 4Y4RA 5FZAA 1O59A 2CSGA 2LS6A 3B3QE 3VKFC 2GNMA 4QX2A 2RVAA 3FHIB 2EAKA 1JYWA 1LOAA 2RS33 2QJVA 5CBLA 4CEWC 1GOFA 1G9AA 3VBSC 5FQ0B 3A0KA 2WO7A 2EA7A 3ATGA 1W8TA 2AZ5A 2YROA 3FHQA 2X09A 3K3NA 4ITCA 3VBHC 3VHOA 4BXFA 3IZOA 5ABJA 2ZEWA 4IERA 3BODA 3EMRA 5IVVA 4CXXA 3BB6A 4K21A 3ZLIA 4FOWA 2E32A 1JMUB 1ND3C 5FMCA 5A7PA 4NJ4A 1GZCA 2XJSA 3ACFA 4K20A 5F32A 2DTWA 5FXVA 1W6NB 2C5DA 3WW2A 1KXGA 3PJYA 1ASJ2 3AB0A 3GM8A 4MLOA 1VIWB 3ABZA 4HZFA 2VMHA 2JDUA 2WS93 4TLGA 3W9AA 3GHMA 2Z2SB 5IFPA 3E5QA 3A0NA 2X5IB 3LIHA 3C7EA 1ND2C 3TYJA 4PF5A 5JIAA 1PMIA 2XLAA 4D3WA 4RL7A 1IKQA 1DGWX 2VQUA 4ZU4A 1YFWA 2Q0AA 2HYKA 1U0AA 4J1WA 3H50A 2VBBA 4LA3A 5KHKA 4YG3A 2ZGPA 2A5ZA 1IHMA 4LBQA 5T5JA 3NJVA 5F2WA 2Z42A 1RHI2 4QHOA 2HWB2 3S5QA 4COVA 4E8CA 3M3IA 5AC92 4CCOA 3ZSEA 4AE2A 4AZZA 3GZAA 2XKOA 1RUH1 4LO4B 5GZGA 4NN0A 1AL21 3DPRA 1W8FA 1MPXA 3PLQA 3FBYA 1COV1 2XQRA 4GWIA 3OY8B 4QQHA 1JZ4A 3PU8A 5FZCA 1C8M3 4LOTA 2VMDA 4LHNA 1PZ9A 2VBPA 4YVSC 4BWOA 3J7NA 4P02B 4CEYC 4D0QA 2XHNA 2CWSA 5SV5A 1JW6A 1AR72 1V6LA 4NPMA 4JC1A 1CPMA 2OPKA 1D4VB 3CJIC 1LTEA 3OCPA 3VBFA 4BOWA 3UL2A 3ENRA 3LQCA 2WWUA 5I0SA 5LBEA 1F8VA 5EP9A 1LOEA 5FYZA 1ZZCA 1O5LA 4NRPA 2XKPA 3RPQA 1Q56A 2WT0A 5C4WB 2QFEA 4HN1A 4QKFA 4XFCA 4AI9A 3LPGA 4CU8A 1JZ6A 3POGA 5JUVA 1GWLA 1BCXA 3AL6A 1J58A 1HJGA 4HETA 1GP4A 1CQ9A 4AF9A 3ECQA 1US2A 5FYHA 3IMMA 2IXIA 4LKSA 4XAAA 1AR92 1R1A2 3UJOA 1KD7A 2WA3A 1Q5OA 3P6BA 1CJDA 2CAUA 4KG0A 5F2SA 4IV1B 3CO2A 2VR4A 1JTZX 1WUVA 1RC6A 1W03A 3DECA 4QXCA 4URTA 1LEDA 5T50A 3ZFEB 3O1PA 1EV13 2WO2A 4Q0PA 2RDSA 5E89A 2HWD1 4LORA 5L73A 1POV0 2ZEXA 3DCQA 1AVBA 3K48A 3G7DA 4Q29A 2AH2A 4CPBD 1JZ2A 3V0BB 1O3SA 1Q43A 1ULEA 3PHMA 2PHLA 4ARXA 2KD7A 2VW0A 3I59A 3OF1A 3KV6A 3J26N 4FPJA 3EJKA 3POYA 5IUQA 3U4XA 2DF7A 3MIDA 3W59A 3U1XA 4XJWA 3NV2A 5AFBA 1UU5A 4CRQA 1O8SA 2B8MA 1FMD1 1YQ6A 4N8MA 3CL1A 1E5IA 2D44A 3JD73 3WZ1A 3AMNA 4OULA 5F3GA 2J1VA 4AW7A 2ZGOA 1AF9A 2J1AA 1QNWA 5A7SA 1RUJ2 1J3PA 1CONA 2F17A 4XUNA 3ZN5A 2DCZA 4R9CA 5K0UA 1RUH3 4HOOA 1AL23 3N7KA 5GJ6A 1U5IA 4CDXB 4FP3A 1MQTB 1SCSA 1O91A 2GC1A 4Q26A 5JIUA 2W1UA 4I2OA 3VLBB 4W4ZA 5FUPA 2XVLA 1FT9A 3HBZA 2G9GA 4MGKE 1O3TA 2W0XA 3ZYJB 4Y1YA 1R082 3TNPB 2V5YA 2IXJA 2XJVA 2A73B 3UV9A 5JXGA 2G9FA 1PO22 1CX1A 4NAOA 2Q5TA 1I6XA 3WXPA 1CWPA 3N9MA 1W9WA 2D93A 4N43C 2WZR1 2WYFA 1LAJA 4AGVA 1OA2A 4QMAA 1GUIA 2PAKA 2R062 5L7OB 1NQJA 2RS52 2YMZA 5FY7A 3NO8A 2D6NA 1ZZ9A 2VZPA 1S0IA 5CKMA 2BFUL 3VBUC 5C3OA 1OSGA 3EYPA 4EN8B 4A3XA 2W52A 2YG0A 1F5FA 3AZZA 1IQAA 3HAGA 4RS5C 4DPNA 3H8XA 2Y64A 1RUC2 1N1YA 1OLRA 1VBB1 2DBIA 3FUOA 2QQPA 3T0DA 1GZWA 1DGWA 4ZHNA 1NKGA 4BJ0A 5FZ4A 2ZXQA 1AR61 3MW3A 1D0HA 2E26A 4AFMA 1J83A 1XE7A 1OURA 2QVSB 4DZGA 3JQXA 3VUOA 4M00A 2HWC2 1YRZA 3B9CA 2BP6A 1GQPA 1HRV3 1T6GC 4LBNA 1S0BA 5FZBA 4OHYA 1OPOA 2KA3A 1GOHA 2D3RA 4AI1A 3THDA 4XEZA 3A4UA 3VDAA 4BU2A 5IWFA 1E5RA 4IEYA 4EN0A 2HWD3 1DYKA 3VZMA 1UU4A 3S0MA 3E97A 2R041 4WBBA 1VBE2 2GNTA 2TEPA 4J6GA 1OFNA 2VULA 4FFHA 4NO4A 2WYSA 1AYM2 1C28A 3MIBA 4QPYA 1UYZA 4QKBA 3ZPOA 5A3LA 4S2FA 4XW3A 1A8MA 3RMXA 1NZCA 1PVC1 5KXCA 2WUHA 1SCRA 2AREA 3PDQA 3BKZA 1NE6A 1LULA 1DZTA 2DUOA 4XF0A 1JXNA 1ZVFA 2HWF1 2R071 2YFZA 1U5ZA 3SKJE 5LZ6A 1RUNA 2XG3A 3ACLA 3OYWA 1PGL2 3NW4A 4PT6A 4TYSA 3ZFFA 4QX7A 4TXWA 3JB8A 4HT1T 4I3PA 1G6NA 2QNKA 5FZFA 4AQ2A 1TME1 3ZYGA 2QCSB 2GMEA 4WVMB 1NQDA 1JS9A 4YFZA 4N7IA 4YW4A 4YW1A 2AACA 1JZ5A 4XDPA 2QBXA 4NHLA 1Y9MA 1NT0A 1UZZA 3C8XA 4Y3OA 1HRI2 1Y43B 3NNFA 2ZOEB 2QQOA 3JCIA 5D1IA 4ASKA 5FYMA 2VNVA 1RJ8A 4XFAA 5B4NA 2QQMA 5FK8A 5CFCC 3VGIA 1ULPA 3DF0A 5FZ8A 5J96B 5L9RA 2XHKA 3FLRA 2P37A 1QJX2 2E63A 3ORJA 4AHXA 1UY3A 5BV6A 2YXSA 1GWKA 4KL1A 4AHWA 4RR3B 1OKQA 1DU3D 2YGMA 1Y9QA 3HQUA 1WLCA 2VMIA 4EWEA 4CXYA 1VBB3 2BQPA 2AENA 1U12A 2ZMNA 4QPGA 4XAEA 1HQWA 5HBAA 1AR81 2WNVB 4JGZB 2DURA 3H8UA 1AR63 4PI2A 4XUPA 2XL9A 2WDBA 4E4ZA 4Y1UA 2NMOA 1QJU1 4LBJA 3LA7A 5BPXA 3OEAA 1UYYA 5APAA 2H6BA 3UGHA 2W68A 5DUUA 4W65A 4FSJA 4Y1XA 3NV1A 4XMAA 2D98A 1WBFA 1J1LA 2QTWB 1HN1A 4QDRA 3NKTA 4XZPA 1DYPA 2R043 2ZPXA 3GJAA 2RM23 1SMVA 3AYDA 3GYDA 4J1XA 1HX6A 3E1F1 1NCRC 1BHGA 2VOTA 3N9LA 4CU6A 2C9AA 3OUIA 3VBOC 1RVF2 3WX5A 2GN3A 1PVC3 3AFKA 1DHKB 3IMNA 4UFKA 3WSOA 3IKWA 4Y5SA 3O1UA 4H55A 4YWAA 3AYAA 4QX1A 1R64A 3POSA 4S2GA 2OA2A 1CAWB 3N7MA 2YBSA 1OHFA 3SKVA 3LFIA 1H6XA 2W46A 4BK5A 4OQ9A 5BUVA 1IG3A 1UOGA 1Z78A 3M4FA 2W91A 2VZUA 3T4VA 5IK8A 3TN91 4GAZA 1IPSA 1VBA1 2TNFA 2YU2A 3H42B 4E9KA 1XNAA 4LBMA 1QQP3 4RGAA 4Q4W2 3RG0A 3WF1A 4A41A 1LOFA 4IGOA 3GZTB 4OMDA 2JJ6A 2Q1FA 3LPFA 4LHSA 2DUQA 3OBZA 1JN2P 5FZLA 2YC0A 3ZFGA 2ZX2A 2F4PA 4BQXA 2UWAA 3LEIA 5E88A 4ZXEA 3TEXA 4M01A 4EROA 3AMPA 1R1ZA 3FJSA 2YYOA 3WCRA 5KXDA 4O61A 4Z82A 2EXKA 4QHZA 4ATFA 5FO8B 4V2WA 1ASJ1 2YUEA 3NAPC 4ZY9A 4UF0B 1UX7A 1OC1A 1ZX5A 2D6MA 1RUD1 2VZTA 3GHNA 5BNPC 1O3QA 1DCSA 3WNLA 1OLME 4KGQA 5KWRA 1BKZA 4LUMA 5F6KA 3ZR6A 2LM3A 2IVJA 4H7MA 5BNOA 2VCCA 5IHRA 5DUWA 1K45A 1ULCA 4XUOA 2ATFA 3M3OA 3RMYA 4XQWA 4CDWA 3ZVXA 4CEWB 4F8AA 1JYIA 2RV9A 2WO1A 2JG9C 3SISA 4DUWA 3BTYA 1AR83 1VAVA 1RHI1 2XJQA 2HWB1 3VBHB 4HFSA 2DCKA 1H8TA 2P2KA 3QH6A 5FY0A 4TLFA 2D6OX 3H8OA 4BQWA 2RMU3 3BCWA 1S4CA 1ND3B 3WLUA 4NROA 2O0OA 1LESA 3T1MA 4YW5A 2Q8EA 3HN3A 2JB8A 4FAGA 1YO8A 3H3UA 2GAUA 3ST7A 1GR3A 2SLIA 3BN6A 3ZR5A 1H1AA 1D4M2 1ND2B 4XMIA 5H9SA 1EPZA 3SEEA 4HKLA 3IB3A 4I30A 4TSVA 2CL2A 5FMOS 4WZFA 4IEQA 1ZZ8A 2PQQA 2ZACA 1ZZBA 4Q27A 3VHPA 4GWMA 3R0RA 4LK6A 2V5DA 1W9TA 3RYPA 1RUF2 3VZNA 1O3RA 2F4LA 4MGYE 2Z5WA 1SFPA 4R9BA 1BVP1 1LHVA 4FCAA 1N1TA 1IKPA 2HWE3 1CAUB 1WMXA 3WY6A 1PX3A 1W2UA 3CJXA 5CG9A 5A3OA 2OYZA 4CDXC 3DPRC 2OQ6A 3HBKA 1K3IA 3TN93 3EXUA 3JB4C 1AR91 1R1A1 2ADDA 4HXCA 3NNLA 1ENXA 1VBA3 2HBUA 2ZGSA 4L97A 3ZYIB 1HRV2 4CDQC 5CEHA 1LJ7A 1VE0A 1NY71 2DUPA 3RGBA 3FFZA 4YVSB 3WD5A 4CEYB 2WQ4A 3IBMA 4Y20B 3WNMA 4EZ4A 5FIXA 3WW3A 2J42A 4AAXA 3MF9A 5AVPA 3L2HA 2QZ2A 3CJIB 3EBRA 1ZRCA 1W8WA 2NMNA 3QOPA 4GWJA 4QU2A 1K12A 3VBFC 1FPN2 3L9JT 5IATA 4COYA 4JTNA 4DS0A 2VL4A 1A6CA 2EIBA 3RZHA 1PMHX 3R4DB 4CYDA 1J84A 2ZAHA 3HWJA 3NJXA 2Y26A 4X6RB 5CB7A 4NAMA 2ZABA 2LRPA 1TVGA 2BRTA 2OVUA 1V6JA 1XRUA 4FFGA 1QJY2 1OVSA 2FBEA 3K75B 5G05L 4RHV3 5L19A 4FPCA 5EJZB 4AFAA 3JU9A 5HCBA 2PHDA 3IIAA 4GWNA 1UIJA 2C24A 4YW3A 3WQ0A 3WINE 2RS11 3ZSJA 2KR2A 1X50A 2DVFA 2JEMA 3N36A 2XVKA 3ZXDA 5C7GA 4AQTA 2VECA 2MEV2 4AK3A 4RQPC 3IPVA 1AL0G 3PL0A 4Q4Y2 5HPOA 4WM7C 2ZS6B 1MR5A 2BWCA 4KH9A 2AEZA 3ZYFA 3C7GA 2QDNA 3U4SA 4Q4X1 1IG0A 4QXHA 1OKOA 3WQ1A 4MHUA 4O7XA 1EAH2 1HV0A 5D8AA 4QQ2A 4DEVA 5GM0A 4PLMA 1SPPB 5FMOL 1W6QA 3TBDA 1HQNA 1R081 2CTVA 4N53A 3VD4A 3RZMA 5DDJ3 1ODMA 1N1SA 2EXIA 3UGGA 5B2GB 3JBG1 1DP0A 2OZJA 3DKQA 4XFBA 2JG8C 3VZKA 2P1BA 3SH4A 5JWPA 4LOSA 4ES9A 4DRVA 1F35A 2BGCA 1PGW2 5FDBA 1PIV1 2R061 3JQWA 1XXNA 4AVTA 4DUXA 2RS51 1K5MA 2VXJA 3UKVA 4F3JA 4YZ1A 1J59A 1ZNPA 2DU1A 1GWMA 1OI6A 2P3IA 4N9IA 5GKAC 3OGVA 1YEWA 3IT8A 5D21A 5LRRA 4Y26A 3GBGA 1NLRA 1RMU1 3S57A 1FYUA 2D6KA 2WBKA 3D4KA 3H7YA 4IEUA 1O4ZA 3AZXA 4CP9A 5JR2A 2QQLA 3Q8AA 5B4XA 5BNQA 2BNMA 3MHZA 5C3QA 2A75A 5CFDB 2BGOA 3ETQA 3LWCA 1OQDA 3MPPG 2I2SA 3KWVA 4GMP0 3CKHA 3GZUC 4PLNA 3N7JA 4HG6B 3PIJA 2ZHLA 3IWZA 4UFMA 4R8HA 2YU1A 3VDDA 3H1MA 2J7MA 3MLKA 3AFGA 1LENA 1QJEA 1QY4A 4UWDA 4ET7A 3QCWA 4E8DA 5A32A 1NUKA 2ZEYA 1VBE1 2D7FA 2XXZA 3A21A 5E16A 3VBUB 1S2KA 2RDRA 4GQ7A 3TNQA 3WDWA 1AYM1 4RS5B 3SCHA 4P9YA 1MS4A 4FPKA 4WM8B 4XTMA 1GQGA 2G1MA 1SHWB 3CMGA 3J8F1 5C33A 4Y22A 3Q8FA 2C26A 1DLLA 2VZ1A 1GLHA 5HCHA 3RJRA 1F5JA 3DYOA 1NYWA 3AKSA 1H6YA 2XUMA 3DUIA 5ANQA 2ZGQA 4TN7A 1OPMA 3VD7A 5CKNA 2ORXA 2Y6FA 3E6CC 3RI9A 3PJQA 4GA9A 1WCUA 2GNDA 4CVUA 2FCTA 5FQ0A 2XLGA 4NUBA 1ZZ6A 4E27A 1PX4A 2RR12 1QQP2 3BALA 5I8SA 4NIAA 2LROA 4K6BA 1GICA 2VNGA 3OPWA 3I2OA 3LZZA 2PLV3 5FP8A 4HKWA 2JENA 3AJZA 4O9GA 4QHBA 3VBRA 3D8CA 3J7MA 2Y33A 3H1YA 2E7AA 1WW6A 5JDBA 2IXLA 1OH3A 1UYXA 1W06A 2JDMA 1W6NA 3HPNA 3O5SA 3PU3A 4KWJA 1JU4A 1V6IA 2B9VA 3IDAA 4A44A 5A1LA 3K51A 1KDMA 2DVBA 2WNUB 3JBG3 3WNNA 4KMQA 3KHBA 1WCSA 2HEVF 2X5IA 1NLQA 2V4AA 1R092 4NR1A 4QGNA 4UI9L 3TAYA 3WEZA 1VP6A 2GH8A 1PIV3 4XABA 5FZIA 5IVYA 3FWEA 4MXWB 5F5IA 1PVXA 5LA0A 4HK8A 3NWKA 2W1WA 3ZFFC 2W92A 3MV11 3OPTA 2RDQA 5A33A 5DZFA 2ZGRA 1H1IA 3RFRA 5F37A 5JAXA 1DLCA 4JDNA 5FCCA 5A1AA 5C3SA 4QQOA 2DTYA 4BK4A 2WRAA 1N47A 2AYHA 5K4LA 2EVXA 3MIHA 3MW2A 3N9PA 4MGZE 2E7QA 2VCMA 3HR9A 1M06G 2JDKA 1HXS1 2WC2A 4AR2A 2IFRA 1JI6A 3DL3A 1XQNA 1XYNA 3VD3A 3GBFA 2XR4A 5F3EA 1GNHA 5A7WB 1J3RA 1YC61 1MEC3 5FYVA 3UETA 3I3BA 3FLTA 2OZ6A 3C7HA 1G8WA 3OTFA 1ENSA 1VBD2 4UW6A 5JOWA 3HQRA 2QKDA 4EJRA 1W6MA 2X29A 4QGLA 2VD7A 4CP1A 1FXZA 1MZFA 5FZ1A 5SV8A 1BBT2 3B69A 2G9ZA 1DQ1A 3AM2A 3J8F3 5C4WA 4A45A 5KC5A 5T54A 4XVHA 2BUKA 3HT1A 3WDVA 3CIHA 2TBVA 5FYCA 1REDA 5KBFA 2UYBA 2HWE2 4YM2A 1KRIA 1LKNA 2QUOA 2ZX3A 3IDCB 3LB9A 3OOXA 2WZEA 4U2AA 1UX6A 4LBKA 1VRH2 3B00A 3LEGA 3POWA 1WD3A 1U5YA 1BEV1 4H7LA 1UY4A 3I97A 4GH4C 4IV1A 5K8SA 2WWSA 3V65A 4F7ZA 1ZBA1 5FTTC 4R52A 4AEDC 4BYYA 5FUNA 5FREA 3ZFEA 4IE6A 2VOXA 2ZZQA 5F5CA 4BMBA 2JDNA 2TUNA 4QPWA 1ZREA 1VAMA 4HK9A 3SNMA 2WZ8A 1L3JA 1LEMA 4NWWA 4ZKTB 2BVBA 1NCRB 4Q1RA 5T55A 3VBOB 4A7KA 3AKQA 2NP0A 5GLZA 2OIIA 5EJ3A 1FX5A 1VRBA 1W3VA 3GGLA 4JAAA 4GKYA 4B7EA 3N9QA 1SLIA 1APNA 3PVEA 4YVWC 2BTVC 2C0ZA 1EP0A 2VCBA 1W04A 4A6OA 1N3QA 5FYTA 5ISLA 5FKBA 4YZ5A 5CISA 1KS4A 1VMFA 4FVVA 1NA1A 2BNOA 4Y1VA 5A7QA 5IJRA 1JBCA 2X8KA 3OPZA 2PA7A 5EIYB 4Z07A 1PGSA 4P9GA 4YYOA 3ELNA 4AQSA 1RUOA 2EXJA 2XVGA 5HV4A 1XSRA 3ILRA 4LULA 1MZ6A 5EXOA 3POBA 1N1VA 1I5ZA 1YQ8A 3LKJA 2X53S 1MQTA 3O12A 3AYCA 5ACA3 2CY6A 1MS9A 2R0FA 3I4IA 3PUQA 2PAEA 2VZRA 3LFMA 3NAPB 4HONA 3SMHA 3O1MA 5FPUA 1HB1A 2NZ9A 1X36A 3AYEA 5T5PA 5BNPB 5CADA 2BDRA 3SEPA 4BA6A 3SH5A 1SG3A 2BFUS 3AKPA 3Q9OA 2Y0IA 1D4M1 1CD3G 3AMHA 3MIFA 5FZ3A 5BNOC 4AEMA 3EO6A 4XPVA 1NCQC 1YHFA 4IUGA 2D43A 5L7OA 3ZO0B 3AZVA 4IV3A 4KWLA 2YC2A 4HBNA 2JG9B 3C7OA 4XQDA 3DGTA 3W21A 4AAPA 1AZDA 5IK7A 3D82A 2JDYA 2NN8A 2IZWA 2VZOA 3BTXA 3MF6A 1JZ3A 5H9PA 2DU0A 1H8TC 4WVWA 3MFAA 4P9LA 3VZJA 5I0RA 3AP4A 5C5TA 3RZJA 1DF0A 1IPKA 4KWUA 1BK1A 5BNNA 3AK0A 4Y1ZA 1X82A 1VB2A 1CAXB 4LKDA 1W99A 3PUAA 5A1FA 1BEV3 3CZUA 2BBAA 4JRLA 4XETA 4IEXA 1TMF1 1ZBA3 1ONAA 2YPDA 4Q5OA 4ONUA 4QM8A 3S7IA 2ETEA 3ZYPA 2Y6LA 3AXDA 4GB32 3BTZA 2W39A 4I09A 2WQ8A 1MS0A 5TSWA 3H3ZA 3WT3A 2PHFA 5GZFA 5IK5A 5KHGA 1VR3A 2OS2A 4RA0A 2J1UA 1W6PA 3MFCA 3B01A 1FPN1 5HCFA 4DB5A 2I74A 4PDWA 3BUCA 4LBQB 5A70A 2CNAA 4DIQA 2P17A 3KV4A 5F5AA 3PTRB 3ILNA 4OZOA 2RJ2A 1QH7A 1DGRN 1CZVA 3NNGA 4R4ZA 3VN4A 1GV9A 1QJY1 1RUI1 4LE3A 1C3HA 2O8QA 3SC7X 3DPRB 1COV3 1AYN1 3NJZA 4HVOA 4JV4A 3UJQA 5FR3A 1WA4A 3IDEA 5LW9A 1UCXA 5FZGA 5J3UA 4JTOA 4XF3A 1L7LA 1QOOA 5CFDC 4CDQB 4ES8A 5KC6A 2YFUA 4XF4A 3POFA 1O4TA 1KDKA 2WLQA 4IL7A 5IAXA 1RUG2 1V9U2 2PQSA 3WNKA 3KCXA 2OW4A 3S30A 2VE1A 4WVMA 3J9SA 4KU8A 2Y6GA 3BU7A 5FYBA 2R30A 1DQ0A 2MEV1 3VBFB 4K1ZA 2LTNA 5C70A 2D3SA 1G7YA 2EIEA 2PLV2 2WAAA 2OPWA 4PLOA 3FLPA 4A3ZA 2XBO2 1OOPA 4YGBA 3ZKUA 5A3WA 3AVRA 1OF3A 2GN7A 5DAQA 4WM8C 1ZBE1 4Y5Z0 5JOXA 1MS5A 5FZHA 4XJAA 2V09A 4L8QA 1YCIA 1QOTA 4LITA 4Q4V2 4XFFA 1REEA 1RYYA 1WZXA 3PUIA 3IM0A 5FZOA 3DV8A 1OD5A 2LW8A 4BXSV 4M0NA 1W9YA 3ZXKA 3FX3A 3O1OA 4RR3A 1HV1A 1E57A 5LA9A 2XH6A 3W5MA 4DXSA 1SDDB 4FXKB 1I1EA 1OVPA 1JUHA 1QXJA 3I49A 4UYBA 1AXKA 1WWYA 1W8UA 5C71A 4NWVA 2DBNA 2BNNA 1YQ2A 2GMMA 5HXVA 1SFYA 1JYTA 2YHJA 2FDFA 2WNVA 4JGZA 1F31A 4NOTA 5JI7A 4CPBA 4RQPB 1LHNA 1RTVA 5HXMA 2PHUA 1QJZA 3J7HA 1VBC1 3BGAA 4WM7B 4BLIA 1FOD2 4EZHA 3GCWA 1RJ7A 2XB6C 3A7QA 5IVJA 2I45A 1NXMA 3BPZA 1ODNA 4MUVA 4XF1A 3SQOA 1KJLA 4YZ2A 5F9TA 3KHCA 1TMF3 1ENQA 3LAGA 4ZONA 2WNUC 4OLLA 3NMBA 4QM9A 2J1TA 2UY9A 3MDPA 3MPBA 1FMD3 2JG8B 1MEC2 2RJKA 2N7GA 2WSUA 5FK7A 4AGGA 4C0HA 4L2NA 4ZS2A 5T52A 5FZKA 3O1SA 2JDPA 4XBQA 1NE4A 3M3EA 4E4DX 3ASIA 2Y6JA 3BOWA 3KV5A 2EAAA 3ZSMA 5JZGC 1Q8VA 2P6HA 5DQ0A 4P5HA 1HW5A 2RS32 5FBJA 3KGZA 1PNGA 3C3VA 2K46A 2ZGLA 5DG2A 5F3IA 4HPKB 4QQPA 4A7YA 4YM1A 1LHWA 1V70A 3SITA 3R05A 2XONA 1OLQA 3LDBA 2A6YA 3GBWA 1JU3A 3UKTA 1C4RA 1CAWA 2F6BA 4AYUA 1IOAA 4HLTA 2BU9A 4ASMB 4AVAA 1N3OA 4PBPA 3VDCA 1A78A 1SBFA 1WLTA 2EF6A 4LK7A 1UN1A 4AG4A 1OXCA 2D5FA 1RGSA 3VZLA 4OUSA 5IK4A 2WS92 2VCAA 1PZ7A 1LHUA 5EHDA 2WZR3 4MOAA 4UFHA 1OBNA 2GSYA 5EFUA 1YFYA 5JCTA 1SLTA 3HJRA 2CYFA 3NKGA 3LA2A 4G3YC 3X29B 1LOGA 2ZZJA 4JKLA 5LY1A 1HB3A 4AVBA 2FZ2A 3HNBM 1UY1A 2ZKNA 4YG6A 4COUA 4OI0A 2ARBA 1ZBE3 4X6QB 3V0AA 3LGRA 2VU9A 1WBLA 1QDCA 4ORFA 4XHXA 4CDUA 1GBGA 2DWRA 1BYHA 2K0GA 3M7AA 2E53A 4QB2A 4XBNA 1GZWB 3HQXA 4UF0A 1JOJA 1KFXL 2UY8A 3FHAA 1PO11 2E51A 3TOJA 5JSOA 2YV8A 3B5LB 4LNVA 2ES3A 2FDIA 1H9WA 4QPIC 1R091 2WWJA 3N3HA 2A3XA 4Q2FA 2ZGMA 1HIXA 1SBDA 2RE9A 4FPOB 1ZM1A 3KT4A 3OGRA 1ACCA 3D6EA 2VNRA 4IESA 2ORZA 5FY5A 2XWBB 1B35C 4CEWA 4D94A 5FZDA 1CVNA 1RUE1 4XUQA 1TQ5A 1D2QA 3VBSA 1C8M2 2NYYA 4Q8KA 4MZUA 4UAPA 5IT6A 3APBA 3M3CA 4YW7A 4JZRA 4BB3A 4R9DA 5FO9B 5GALA 1Z7S1 2VGDA 4D7SA 4BQ3A 1T2XA 3UK9A 1KEXA 3P1IA 4WVVA 5J36A 4IW3A 3ZPYA 2WFF1 3WV6A 5A3UA 4XJUA 1I9RA 2VQTA 1S0EA 2W9XA 4KI5M 2ZGNA 3GJBA 1EPWA 4FI9A 3SCGA 2W87A 2HWF3 2R073 2VW2A 4PIXA 1B09A 2G19A 2R16A 4M3CA 5FY1A 3AP6A 1ND2A 2ARXA 2XL7A 4XJ9A 5LBBA 1IS4A 4OQ8A 2UU8A 3S5AA 3T30A 3ZFFB 2Q4SA 3IN9A 2WABA 1CIYA 1TME3 5C8CA 1DGRA 4BE3A 5J09A 2ZJCA 3IDBB 3ACGA 3I7DA 1BLZA 4GIQA 3AC0A 4QU1A 1S0FA 1DQ4A 2CAVA 5FPZA 5J48A 1JYXA 2KXLA 1EV12 4QDQA 1LRHA 1XC6A 1Y7BA 3AP9A 3EHKA 1PM7A 2E9QA 5E1RA 1CAUA 2D40A 3P3NA 5CIRA 3WCSA 4XYXA 2IVIB 2ARCA 1CR7A 5FYIA 1VB4A 3AX4A 3H0OA 4DQAA 4GMP1 4IEWA 1VRH1 5F6LB 2QQUA 3MW4A 4ZXKA 1GFF2 1UXXX 3O0WA 2BVVA 4E2SA 2WQZC 3PUHA 4YVSA 4I0BA 2R0HA 4Y20A 3WNXA 4ZU5A 4LBLA 4PIYA 3CF6E 3WW1A 5LRSA 5FLJA 3ME2A 5JMCA 5L9VA 3INAA 3FFQA 4D69A 3T08A 5JPNB 1G9CA 2GP3A 3JD72 4E4HA 1SDWA 1BJQA 4BIOA 1UOBA 1Y4WA 3QD6A 1PK6A 5FLIA 2VTXJ 2FZ1A 4S2DA 3W58A 4QPGB 1C5IA 2VOKA 5AC91 4WZCA 5ABJC 4OUMA 1FAYA 5LWBA 1PO13 4IE5A 1X7NA 2ERFA 4B4RA 1CAVA 1RUH2 1QJU3 2ZMLA 3NNJA 4BMEA 1AL22 2VOVA 4Z1VA 1WGPA 3WG3A 3KB5A 4MO3M 3WP5A 3OUJA 2JE9A 1GZTA 1PZ8A 3VHRA 1AUYA 4OUEA 1XB9A 3KCCA 1UZYA 5EJ1B 2ZX4A 1WW4A 1KGYA 3OGJA 4GH4B 3NJYA 4YM0A 3WW4A 1N3PA 4EQVA 2FMYA 4OHZA 1UPSA 2V73A 2W1QA 1O4YA 4AEDB 2BV4A 1W2OA 1Z7S3 1ZRRA 5FPXA 1KS5A 1WA6X 4S2HA 4L11A 4CU7A 1AR71 2DCYA 5C9AA 1NX9A 3ZSLA 1GKBA 5F3CA 3WHUA 3JZVA 4DRRA 1S2EA 4QKNA 3LSEA 4FPLA 1H9PA 4W6WA 4P00B 5C3RA 3PNAA 5DXDA 1UKGA 3TEZA 4QD2A 1F4AA 1ZZ7A 3AL5A 3Q8BA 4G4FA 3NRUA 3T09A 3VL9A 2BERA 1SPPA 3E6DA 4KG8A 3RWKX 5F39A 4YVWB 4OMCA 5FMDA 1MS1A 4K7JA 1W2AX 3KS7A 4MYEA 4Y5TA 3MO4A 2FDHA 1UZ0A 5FZ9A 4OHWA 4C1XA 3M70A 1WCKA 2R49A 2VQ0A 1NA1C 2HBTA 5FPVA 4CE8A 5FOJB 1S0CA 1W8OA 5DMYA 4I02A 3NV3A 3ZOIA 2LUWA 1TE1B 2ET1A 1UW8A 2HEWF 2DV9A 2P6CA 3O0XA 5I8YA 3HOBA 4UW4A 5I91A 3KF5A 1GMMA 3C2UA 3R6SA 4B4PA 4JKMA 2FDJA 4FAHA 5KXBA 2E31A 2HWD2 3ACIA 3ZFGB 4UFIA 3MZHA 4PQ9A 1AXYA 3WG1A 1ZA4A 2JICA 4U36A 3AKRA 4E2QA 3BI3A 2X10A 3D0JA 1HB2A 1ASJ3 4AFDA 1ZA7A 2A3YA 1RUD3 1K42A 1YI7A 2XJRA 2WA4A 4LLOA 2B42B 3T3YA 1UNBA 3L2YA 4FBFA 3O7OA 4FPGA 3G6JB 5BNOB 4N43A 1UWWA 3USUB 1NCQB 2PYTA 2EIGA 4R4XA 2BPA2 2WKKA 4JGYA 4BLJA 3VBUA 1AHSA 4LKFA 5FUIA 1SACA 3FBMA 4GKXA 3HD8B 3TB0A 1RHI3 2PTMA 1FI2A 2HWB3 4RS5A 1RUJ1 3NQHA 3MIEA 4FOYA 3RDIA 3LE0A 5GLTA 1H8TB 3MUY1 4K3UA 2VG9A 3HN1A 2BOIA 1O5UA 4B3NA 1LGNA 3M8LA 1E5SA 2VAUA 3T2PA 3DN7A 4E2GA 4M3CF 4DMIA 1EY2A 5C8WA 4IXLA 3WDTA 2K9ZA 5A3NA 4DXRA 3M1HA 1IPJA 1WD4A 1RUG1 1V9U1 1PO21 1WCQA 4YGCA 1NG0A 5JVVA 3IAQA 2IXKA 4FOQA 2QZ3A 4XOGA 2WZR2 3AMMA 4H2AA 4L9BA 3K46A 3WF4A 3I2GA 4D7YA 2VC9A 5K9YA 2XBO1 4PDWC 2CGNA 2XLFA 5FO7B 5DAPA 1X9TA 3H7JA 1VMJA 1V6MA 1RUC1 3D3AA 4XFHA 1VBB2 4IQPA 5J98B 2CGPA 4QWNA 5K0UC 4LLFA 1JYNA 4IEZA 1AR62 1A8DA 4Q4V1 4A7ZA 3RZGA 5J37A 3OBAA 5IAVA 3ZDSA 1AR93 1R1A3 4XJZA 2HWC1 1UF2C 4HVQA 3BU0A 4XUTA 3MLJA 2WT1A 3H9AA 2C4XA 1XNCA 1XOYA 3E6BA 2CHHA 2LALA 4ISQA 4PJYA 5I8TA 2WINB 3KF3A 4O65A 1YFXA 1XNTA 3AXEA 4XC9A 3TWIA 1QH6A 5FXXA 2ZMKA 1I5PA 5FY9A 2A3WA 2R042 1CX4A 2FCUA 4B7KA 2C6SA 3N9NA 5LCWL 2RM22 2W08A 1F9KA 1GSLA 4RN5A 1OOPC 3BYWA 4PCRA 1X33A 4KWKA 1NAEA 4UFLA 3FE5A 2PHWA 5KR7A 1PVC2 1ULFA 3CHXA 1UZVA 1KITA 3GNEA 1PHMA 4LKEA 5F8PA 5A7WA 5CFCA 4ASLA 2YC4A 5KHJA 1ZRDA 2R072 5JI9A 4BISA 1YNAA 1PGL1 2RS13 1W3XA 1MZ5A 1IGOA 4LE4A 1UIKA 2A70A 4C90A 5EZWA 4OFGA 3URFA 5FY4A 4P9WA 4QX3A 1POV1 5DAXA 4I3GA 3O1RA 4A4AA 3FN9A 1H4GA 3LOIA 4BPZA 3PVNA 4CSWA 4Q4X3 4MX3A 1HRI1 3AP5A 3WUCA 2P34A 4Z92B 1S1AA 3WNOA 1S0DA 2G4IA 1HKDA 4AHYA 1ZRIA 3J4UH 3KSCA 5D8AB 3KVBA 1R083 1JHJA 1LECA 4N53B 3ZXFA 4Z2WA 2WS91 1CJPA 2R6QA 1UMIA 4CTEA 4M3CE 1W9SA 4CA9A 5EQUA 1QJX1 4COZA 2R063 2Y6KA 2RS53 3U37A 4HSJA 2BBVA 1K5MB 3PVOA 3KT1A 3ZXJA 5JZGB 2VMGA 1W0NA 2DVAA 3ZXEA 1OH4A 1W05A 1QDOA 1RUC3 4XFGA 1DQ5A 5FP7A 4AHZA 1F2NA 1KJRA 4LBQD 4KBBA 2EXHA 4P9XA 1AR82 3U75A 1RMU3 2VUDA 3B7MA 1HB4A 3BIEA 5IVEA 3RYKA 1O6UA 4I01A 2CDPA 2FDKA 4CP9B 1LR5A 1W6OB 3WQBA 2RMU2 1MVEA 4NPLA 5FOBB 1V6OA 4FTEA 1LB2A 1QGLA 2O14A 2QQWA 3WVJA 2WO3A 3OY8A 3LDKA 4FXGB 3RYRA 3GCXA 4FQZA 2CWMA 1K5JA 1W39A 1I3HA 4NHMA 4AL9A 3VDDB 3CEWA 2JKBA 2VXRA 3E5XA 4LIVA 3UKNA 1O7FA 2BW8A 1VBE3 3OBRA 1YIFA 4N90A 2NPIA 1V6NA 2ZAAA 2Q30A 2J1SA 3AMQA 4RGGA 1AYM3 2DCTA 4C0BA 2IWGB 1EUTA 3ALQA 3CQOA 3I2DA 4LHLA 1RVF1 3OGGA 4QPGC 5C5UA 4CDUC 1YQCA 1XE8A 3HIFA 3I3EA 1UZWA 2VVDA 1AX1A 1QNYA 2ZHNA 3NAPA 4HMZA 4B1LA 4EWAA 2R7EB 1CZSA 2WJSA 5BNPA 1YIPA 4M0HA 2JB4A 2VMEA 4QPIB 2XWJB 4HSLA 5LY2A 3ZN6B 2PFWA 1GANA 2VW1A 3SLIA 5FZ6A 5DN2A 4IGPA 1GP5A 1YYNA 3KD4A 5FKCA 4WVZA 4H14A 1LODA 4URAA 3TN92 1OQ1A 2W2IA 1NLSA 4HKOA 1B35B 4YW2A 4DUVA 1VBA2 3QACA 2L9LA 4QX5A 5CNAA 4D8MA 2JG9A 4Q4W1 5A3TA 1DYOA 1HN0A 2VJXA 1E5HA 5I0TA 4CP0A 1NXD1 1POV3 2J1RA 2YBKA 2WLPA 4MHRA 4XF9A 1EV11 5DABA 3WR0A 3SHRA 1XSQA 2P3KA 3QBQA 4EE2A 3V0BA 1HRI3 3VZOA 2PN5A 3VBRB 5FZ7A 3AZWA 1OMIA 4NHYA 1W0OA 5LBCA 4PBOA 1CAXA 3HEIA 2P3JA 5FYYA 5FY8A 1AJKA 2XGXA 3S6PA 1JYVA 1RUD2 1RB8G 1DZRA 3ETPA 1QJX3 4B4QA 1LOCA 2OKXA 1WLWA 4V2VA 1KFUL 1WMDA 4LHKA 5FXZA 5LBFA 4RHV2 2DYCA 2VPVA 3I2HA 4PQQA 4NIHA 3OB8A 1AX0A 5JSRA 4D6SA 5JPMB 3GALA 4XURA 5A80A 1UXZA 3ZXGA 3JD71 3B93A 4AI0A 5IVFA 3T2TA 2Z69A 5A33B 5C8CC 4KU7A 4PI0A 1FNZA 2Y6HA 3VKLA 1YXWA 3GF6A 1LOFC 1SZBA 2ILMA 4DOUA 1G86A 3SH3A 3KLSA 2DFBA 2UURA 5JOZA 2B9UA 4OZXA 3ZFGC 4TZDA 2ZX0A 4YM3A 2ZTNA 3Q8CA 1HXS3 2H0BA 3JXSA 4CDXA 4Z8BA 2VVFA 4CDQA 4A2UA 2VZQA 1F4HA 3B94A 2CDOA 3LDRA 3OSDA 4FPYA 5T5OA 5IVCA 2E6VA 1RINA
chains in the Genus database with same CATH topology
3MBWA 4YPJA 4MGQA 2ID4A 3BN6A 2XONA 3SEEA 2VTFA 1JU3A 2JE8A 3IB3A 2VZSA 5LA1A 2J22A 3VDCA 2V5DA 1W9TA 3WF2A 4AG4A 1GNYA 2VCAA 2HLEA 4MOAA 2X05A 1PX3A 2W94A 3A23A 3CDZB 3HJRA 1K3IA 4JKLA 5JXHA 3I2KA 5F7UA 3HNBM 1UY1A 5CYYA 4UOJA 5G04L 1O8PA 3K4DA 4QB2A 1TG7A 3OGSA 3FHAA 1XPWA 3WNMA 4AAXA 1LNSA 1UMHA 4GWJA 1K12A 2W95A 4QB1A 2B4KA 1UY0A 2VL4A 2EIBA 3OGRA 1PMHX 2ORZA 1J84A 4QDSA 3NJXA 4M4PA 4XUQA 3I2IA 4UAPA 1TVGA 2XQXA 1T2XA 3K75B 5G05L 1OT5A 1KEXA 5EJZB 3ACHA 1JZ7A 3P1IA 3I2FA 2ZEZA 2VQTA 2W9XA 3HNYM 4KI5M 4FI9A 4ZZ5A 2QQKA 5C7GA 1OD3A 2W87A 3DYMA 4CUBA 1O59A 4JKKA 2LS6A 4DEQA 2EICA 5HPOA 4QX2A 2RVAA 3VDBA 3C7GA 1JYWA 2WABA 1CIYA 1GOFA 4DEVA 4CUCA 2WN3A 3ACGA 3T0AA 3VD4A 3AC0A 3FHQA 2X09A 1JYXA 2ZEWA 4MADA 1DP0A 4QDQA 1XC6A 2BGPA 2E32A 4DUXA 3ACFA 4CU9A 3GM8A 3OGVA 1CZTA 3ABZA 1UXXX 2DCJA 5IFPA 3PUHA 3C7EA 5DPNA 4ZZ8A 2WBKA 2VQUA 5JR2A 2QQLA 5B4XA 3T08A 3T2QA 5JMOA 2BGOA 3CKHA 3NJVA 4A42A 4HG6B 2YB7A 2W3JA 4E8CA 2QQIA 2J7MA 4ET7A 4E8DA 2W5FA 1NUKA 5CZKA 2ZEYA 4RYDA 4P5YA 3GDBA 1MPXA 4QAWA 3A21A 4MO3M 4GWIA 4OUEA 5EJ1B 1JZ4A 1KGYA 2VMDA 1SHWB 2W1QA 3CMGA 3HNMA 5JXIA 4P02B 2C26A 4D0QA 2XHNA 2VZ1A 2QQNA 4CU7A 1NX9A 3DYOA 1H6YA 1US3A 3VD7A 3A22A 2ORXA 3LQCA 4P00B 1F4AA 4CVUA 3NRUA 3T09A 1GOGA 3LPGA 2BERA 4CU8A 1PX4A 1JZ6A 2E33A 5JUVA 4OMCA 4Z2AA 3VD5A 1PMJX 3MO4A 3ECQA 1UZ0A 1US2A 4LKSA 3F2ZA 3P6BA 1UYXA 2VR4A 3HPNA 3DECA 5DMYA 1JU4A 1W8OA 2B9VA 3IDAA 4A44A 3HOBA 5IFTA 2WO2A 1GMMA 3WNNA 4KMQA 4JKMA 3EB7A 2E31A 3ACIA 3WEZA 4UI9L 2ZEXA 1JZ2A 3THCA 5LA0A 2W1WA 2X10A 4ARXA 2W92A 2BZDA 3MV11 2JD9A 3T2OA 3UESA 2KD7A 4TTGA 4LPLA 1DLCA 2W47A 1K42A 5A1AA 2V4VA 4BK4A 3OEBA 1O8SA 1UWWA 2WAOA 2C9KA 1WKYA 1JI6A 3CZJA 5FUIA 3VD3A 2J1VA 2J1AA 3NQHA 3LE0A 4LQRA 3UETA 4XUNA 3I3BA 3MUY1 3C7HA 2J1EA 3T2PA 1GU3A 2VZ3A 3OG2A 2W1UA 4W4ZA 4DXRA 3C7FA 3I3DA 5I0DA 5JXGA 3W5NA 4A45A 4XZUG 1WCQA 4XVHA 1CX1A 3UNPA 3CIHA 3IAQA 1W9WA 3MV01 1GUIA 2EIDA 3K46A 4M4RA 3WF4A 3I2GA 3K4ZA 2VZPA 2WZEA 1ULOA 2VC9A 3WF0A 3IAPA 2VMFA 3EYPA 3LEGA 2YG0A 1UY4A 3I97A 3D3AA 2Y64A 3MUZ1 4W8JA 3T0DA 2JDAA 2VM9A 1NKGA 3FL7A 4BJ0A 1JYNA 2ZXQA 2E26A 1J83A 3OBAA 4QPWA 4DXTA 2WZ8A 4MGSA 1GQPA 5JXJA 4XUTA 1GOHA 2C4XA 3THDA 3VDAA 1XNTA 3GGLA 1I5PA 1IQDC 2VCBA 4A6OA 3K77A 2HYXA 5LCWL 4RN5A 2WYSA 1NAEA 5IJRA 5EIYB 4ARYA 1UYZA 2WUHA 1D7PM 1UY2A 2YC4A 3SKJE 2YFZA 1OF4A 4PT6A 4TXWA 3ZM8A 1EUUA 2VZRA 4QX0A 4PF1A 3SEPA 1SG3A 4QX3A 1JZ5A 4A4AA 3FN9A 3LEKA 2QBXA 2VO5A 3C8XA 4IUGA 3WNOA 2Z4FA 2QQOA 2YC2A 3C7OA 4JHZA 5B4NA 2QQMA 2W1SA 1JHJA 3T0BA 2VZOA 1ULPA 4JX0A 1JZ3A 1UMIA 1W9SA 2VZVA 1UY3A 2Y6KA 3U37A 4KWUA 2Y8KA 1W0NA 3WNPA 1W99A 1OH4A 3CZUA 2BBAA 1L7RA 3DYPA 4L0PA 2Y6LA 2WQ8A 4XUPA 2WDBA 2CDPA 1JZ8A 3WQBA 4QB6A 2J1UA 3GXUA 2WO3A 3OEAA 1UYYA 4OZOA 2RJ2A 1CZVA 3NNGA 5IYYA 2DDUA 3WF3A 2QQJA 1HN1A 4QDRA 2J1SA 3E1F1 1BHGA 1EUTA 2VOTA 2YFUA 3CQOA 4CU6A 3VD9A 2PQSA 3I3EA 3WNKA 3WSOA 3K4AA 2Y6GA 2R7EB 1CZSA 4QX1A 1R64A 2VMEA 3SKVA 1H6XA 2W46A 5LA2A 4BK5A 5C70A 2EIEA 2WAAA 5DN2A 4A3ZA 2W91A 2VZUA 4GZ9A 4DUVA 1OF3A 2L9LA 1XNAA 4D8MA 1DYOA 3WF1A 4A41A 2VJXA 4OMDA 2J1RA 3LPFA 4LHSA 2XOMA 1RYYA 5J1XA 3PUIA 2LW8A 4BXSV 4W50A 3LEIA 4ZXEA 1L7QA 3W5MA 4DXSA 1SDDB 2VMCA 3HEIA 5C71A 4ZY9A 1UX7A 1YQ2A 2VZTA 1JYVA 3WNLA 3ETPA 2OKXA 3IIIA 5HXMA 5IHRA 3J7HA 3BGAA 2VCCA 1K45A 3I2HA 4OYUA 4PQQA 3OB8A 4XUOA 2JKXA 3A7QA 4XURA 1P8JA 1UXZA 2RV9A 2WO1A 2Y6HA 4DUWA 4CUAA 4P08A 2J1TA 2DCKA 2WN2A 3I2JA 1W8NA 4BDVB 3JXSA 2V72A 2VZQA 1F4HA 2Y6JA 2CDOA 3HN3A 5DQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBW A;  4YPJ A;  4MGQ A;  2ID4 A;  3BN6 A;  2XON A;  3SEE A;  2VTF A;  1JU3 A;  2JE8 A;  3IB3 A;  2VZS A;  5LA1 A;  2J22 A;  3VDC A;  2V5D A;  1W9T A;  3WF2 A;  4AG4 A;  1GNY A;  2VCA A;  2HLE A;  4MOA A;  2X05 A;  1PX3 A;  2W94 A;  3A23 A;  3CDZ B;  3HJR A;  1K3I A;  4JKL A;  5JXH A;  3I2K A;  5F7U A;  3HNB M;  1UY1 A;  5CYY A;  4UOJ A;  5G04 L;  1O8P A;  3K4D A;  4QB2 A;  1TG7 A;  3OGS A;  3FHA A;  1XPW A;  3WNM A;  4AAX A;  1LNS A;  1UMH A;  4GWJ A;  1K12 A;  2W95 A;  4QB1 A;  2B4K A;  1UY0 A;  2VL4 A;  2EIB A;  3OGR A;  1PMH X;  2ORZ A;  1J84 A;  4QDS A;  3NJX A;  4M4P A;  4XUQ A;  3I2I A;  4UAP A;  1TVG A;  2XQX A;  1T2X A;  3K75 B;  5G05 L;  1OT5 A;  1KEX A;  5EJZ B;  3ACH A;  1JZ7 A;  3P1I A;  3I2F A;  2ZEZ A;  2VQT A;  2W9X A;  3HNY M;  4KI5 M;  4FI9 A;  4ZZ5 A;  2QQK A;  5C7G A;  1OD3 A;  2W87 A;  3DYM A;  4CUB A;  1O59 A;  4JKK A;  2LS6 A;  4DEQ A;  2EIC A;  5HPO A;  4QX2 A;  2RVA A;  3VDB A;  3C7G A;  1JYW A;  2WAB A;  1CIY A;  1GOF A;  4DEV A;  4CUC A;  2WN3 A;  3ACG A;  3T0A A;  3VD4 A;  3AC0 A;  3FHQ A;  2X09 A;  1JYX A;  2ZEW A;  4MAD A;  1DP0 A;  4QDQ A;  1XC6 A;  2BGP A;  2E32 A;  4DUX A;  3ACF A;  4CU9 A;  3GM8 A;  3OGV A;  1CZT A;  3ABZ A;  1UXX X;  2DCJ A;  5IFP A;  3PUH A;  3C7E A;  5DPN A;  4ZZ8 A;  2WBK A;  2VQU A;  5JR2 A;  2QQL A;  5B4X A;  3T08 A;  3T2Q A;  5JMO A;  2BGO A;  3CKH A;  3NJV A;  4A42 A;  4HG6 B;  2YB7 A;  2W3J A;  4E8C A;  2QQI A;  2J7M A;  4ET7 A;  4E8D A;  2W5F A;  1NUK A;  5CZK A;  2ZEY A;  4RYD A;  4P5Y A;  3GDB A;  1MPX A;  4QAW A;  3A21 A;  4MO3 M;  4GWI A;  4OUE A;  5EJ1 B;  1JZ4 A;  1KGY A;  2VMD A;  1SHW B;  2W1Q A;  3CMG A;  3HNM A;  5JXI A;  4P02 B;  2C26 A;  4D0Q A;  2XHN A;  2VZ1 A;  2QQN A;  4CU7 A;  1NX9 A;  3DYO A;  1H6Y A;  1US3 A;  3VD7 A;  3A22 A;  2ORX A;  3LQC A;  4P00 B;  1F4A A;  4CVU A;  3NRU A;  3T09 A;  1GOG A;  3LPG A;  2BER A;  4CU8 A;  1PX4 A;  1JZ6 A;  2E33 A;  5JUV A;  4OMC A;  4Z2A A;  3VD5 A;  1PMJ X;  3MO4 A;  3ECQ A;  1UZ0 A;  1US2 A;  4LKS A;  3F2Z A;  3P6B A;  1UYX A;  2VR4 A;  3HPN A;  3DEC A;  5DMY A;  1JU4 A;  1W8O A;  2B9V A;  3IDA A;  4A44 A;  3HOB A;  5IFT A;  2WO2 A;  1GMM A;  3WNN A;  4KMQ A;  4JKM A;  3EB7 A;  2E31 A;  3ACI A;  3WEZ A;  4UI9 L;  2ZEX A;  1JZ2 A;  3THC A;  5LA0 A;  2W1W A;  2X10 A;  4ARX A;  2W92 A;  2BZD A;  3MV1 1;  2JD9 A;  3T2O A;  3UES A;  2KD7 A;  4TTG A;  4LPL A;  1DLC A;  2W47 A;  1K42 A;  5A1A A;  2V4V A;  4BK4 A;  3OEB A;  1O8S A;  1UWW A;  2WAO A;  2C9K A;  1WKY A;  1JI6 A;  3CZJ A;  5FUI A;  3VD3 A;  2J1V A;  2J1A A;  3NQH A;  3LE0 A;  4LQR A;  3UET A;  4XUN A;  3I3B A;  3MUY 1;  3C7H A;  2J1E A;  3T2P A;  1GU3 A;  2VZ3 A;  3OG2 A;  2W1U A;  4W4Z A;  4DXR A;  3C7F A;  3I3D A;  5I0D A;  5JXG A;  3W5N A;  4A45 A;  4XZU G;  1WCQ A;  4XVH A;  1CX1 A;  3UNP A;  3CIH A;  3IAQ A;  1W9W A;  3MV0 1;  1GUI A;  2EID A;  3K46 A;  4M4R A;  3WF4 A;  3I2G A;  3K4Z A;  2VZP A;  2WZE A;  1ULO A;  2VC9 A;  3WF0 A;  3IAP A;  2VMF A;  3EYP A;  3LEG A;  2YG0 A;  1UY4 A;  3I97 A;  3D3A A;  2Y64 A;  3MUZ 1;  4W8J A;  3T0D A;  2JDA A;  2VM9 A;  1NKG A;  3FL7 A;  4BJ0 A;  1JYN A;  2ZXQ A;  2E26 A;  1J83 A;  3OBA A;  4QPW A;  4DXT A;  2WZ8 A;  4MGS A;  1GQP A;  5JXJ A;  4XUT A;  1GOH A;  2C4X A;  3THD A;  3VDA A;  1XNT A;  3GGL A;  1I5P A;  1IQD C;  2VCB A;  4A6O A;  3K77 A;  2HYX A;  5LCW L;  4RN5 A;  2WYS A;  1NAE A;  5IJR A;  5EIY B;  4ARY A;  1UYZ A;  2WUH A;  1D7P M;  1UY2 A;  2YC4 A;  3SKJ E;  2YFZ A;  1OF4 A;  4PT6 A;  4TXW A;  3ZM8 A;  1EUU A;  2VZR A;  4QX0 A;  4PF1 A;  3SEP A;  1SG3 A;  4QX3 A;  1JZ5 A;  4A4A A;  3FN9 A;  3LEK A;  2QBX A;  2VO5 A;  3C8X A;  4IUG A;  3WNO A;  2Z4F A;  2QQO A;  2YC2 A;  3C7O A;  4JHZ A;  5B4N A;  2QQM A;  2W1S A;  1JHJ A;  3T0B A;  2VZO A;  1ULP A;  4JX0 A;  1JZ3 A;  1UMI A;  1W9S A;  2VZV A;  1UY3 A;  2Y6K A;  3U37 A;  4KWU A;  2Y8K A;  1W0N A;  3WNP A;  1W99 A;  1OH4 A;  3CZU A;  2BBA A;  1L7R A;  3DYP A;  4L0P A;  2Y6L A;  2WQ8 A;  4XUP A;  2WDB A;  2CDP A;  1JZ8 A;  3WQB A;  4QB6 A;  2J1U A;  3GXU A;  2WO3 A;  3OEA A;  1UYY A;  4OZO A;  2RJ2 A;  1CZV A;  3NNG A;  5IYY A;  2DDU A;  3WF3 A;  2QQJ A;  1HN1 A;  4QDR A;  2J1S A;  3E1F 1;  1BHG A;  1EUT A;  2VOT A;  2YFU A;  3CQO A;  4CU6 A;  3VD9 A;  2PQS A;  3I3E A;  3WNK A;  3WSO A;  3K4A A;  2Y6G A;  2R7E B;  1CZS A;  4QX1 A;  1R64 A;  2VME A;  3SKV A;  1H6X A;  2W46 A;  5LA2 A;  4BK5 A;  5C70 A;  2EIE A;  2WAA A;  5DN2 A;  4A3Z A;  2W91 A;  2VZU A;  4GZ9 A;  4DUV A;  1OF3 A;  2L9L A;  1XNA A;  4D8M A;  1DYO A;  3WF1 A;  4A41 A;  2VJX A;  4OMD A;  2J1R A;  3LPF A;  4LHS A;  2XOM A;  1RYY A;  5J1X A;  3PUI A;  2LW8 A;  4BXS V;  4W50 A;  3LEI A;  4ZXE A;  1L7Q A;  3W5M A;  4DXS A;  1SDD B;  2VMC A;  3HEI A;  5C71 A;  4ZY9 A;  1UX7 A;  1YQ2 A;  2VZT A;  1JYV A;  3WNL A;  3ETP A;  2OKX A;  3III A;  5HXM A;  5IHR A;  3J7H A;  3BGA A;  2VCC A;  1K45 A;  3I2H A;  4OYU A;  4PQQ A;  3OB8 A;  4XUO A;  2JKX A;  3A7Q A;  4XUR A;  1P8J A;  1UXZ A;  2RV9 A;  2WO1 A;  2Y6H A;  4DUW A;  4CUA A;  4P08 A;  2J1T A;  2DCK A;  2WN2 A;  3I2J A;  1W8N A;  4BDV B;  3JXS A;  2V72 A;  2VZQ A;  1F4H A;  2Y6J A;  2CDO A;  3HN3 A;  5DQ0 A; 
#chains in the Genus database with same CATH topology
 1UYP A;  3MBW A;  4YPJ A;  5I93 A;  4H3W A;  3LSD A;  2C1F A;  4X8P A;  4AI3 A;  4IE7 A;  5DZE A;  2FD8 A;  5DDJ 2;  3SCF A;  1IS6 A;  4YLZ A;  3USS A;  4DXZ A;  2FMD A;  1W2T A;  1MS8 A;  4UBH A;  1HDK A;  1C8N A;  2JE7 A;  2VZS A;  3ZSK A;  4CDW C;  4NE9 A;  1W6M B;  2J22 A;  4FFF A;  1YQ5 A;  5H9Q A;  1RVF 3;  2HJI A;  1RUF 1;  4MET A;  4LJH A;  1W90 A;  1ST8 A;  1PK6 C;  4FOV A;  4YGD A;  5ABJ B;  2D3P A;  3ZYB A;  3TRS B;  4NHK A;  2HLE A;  1GZ9 A;  5KHI A;  2HH9 A;  2X05 A;  1RL3 A;  3V56 A;  4LR4 A;  1X8M A;  1BVV A;  1W2N A;  4F83 A;  1OLM A;  3CDZ B;  3PIG A;  4QGM A;  3F95 A;  3EQE A;  3LEM A;  4Y33 A;  4AEK A;  4K1Y A;  3VKN A;  3I2K A;  1W8Z A;  1HRV 1;  4GJZ A;  4Q4W 3;  1H1M A;  1BMV 2;  2Y60 A;  2O8O A;  5A6Q A;  1NY7 2;  1Q3E A;  1BQP A;  1WLD A;  1LU1 A;  3OGS A;  1OFS A;  3KCY A;  4N7U A;  4P9I A;  1XPW A;  3OD0 A;  3KQR A;  1LNS A;  5C9A C;  2GC0 A;  4RQP A;  3H3L A;  5ANN A;  1DFQ A;  2NM1 A;  3POE A;  4RGK A;  4Q8L A;  4Q1P A;  2W95 A;  4QX8 A;  4QB1 A;  4WM7 A;  5ERL A;  5FMB A;  2B4K A;  2JWP A;  5A6X A;  4FTB A;  3VKM A;  4QDS A;  4XIL A;  1H0B A;  2CGO A;  3WHT A;  2P5B A;  3AKT A;  1H2N A;  4IGQ A;  4XIK A;  2WSV A;  5BY5 A;  2XQX A;  2AR6 A;  4XHB A;  5AVA A;  2JG8 A;  1G9F A;  1MZE A;  1OT5 A;  3I8T A;  5FJK A;  3ACH A;  1JZ7 A;  4XXA A;  4COW A;  3DXU A;  1NA1 B;  1WMF A;  1FNY A;  2ZEZ A;  2RS1 2;  1ZRF A;  4I0W B;  2CV6 A;  4XBL A;  4GXL A;  3HNY M;  4ZZ5 A;  1QHD A;  2QQK A;  3CU7 A;  1MS3 A;  5CA6 A;  5FLH A;  1OA4 A;  4W6X A;  1S2B A;  4HPK A;  3H1W A;  4BQ5 A;  4CUB A;  4JKK A;  1GYK A;  4AI2 A;  1EYB A;  1OUS A;  4Q4Y 1;  4DEQ A;  2EIC A;  2JX9 A;  4YFW A;  3WP4 A;  1XND A;  4BCU A;  1U5X A;  3VDB A;  2EAL A;  4FO9 A;  4LXL A;  4Q4X 2;  3RRD A;  1EAH 1;  3JUU A;  2UYA A;  4CUC A;  1DQ2 A;  2WN3 A;  3T0A A;  2UWB A;  4XE9 A;  2ET7 A;  3OBT A;  1BZW A;  2AGS A;  2B45 X;  1D4M 3;  2PXJ A;  2VUA A;  3I3Q A;  3LD8 A;  1XE0 A;  2ZX1 A;  3JBG 2;  4MAD A;  3KQ4 B;  2BGP A;  4KGG A;  2RDN A;  4ZU7 A;  2H0V A;  2IXH A;  3PVB B;  3RVH A;  4I0A A;  3B02 A;  3S7E A;  1PGW 1;  2IXC A;  1S55 A;  5A6Z A;  2PHT A;  1YJK A;  1PIV 2;  1Q8P A;  5T3N A;  4HL0 A;  4DNY A;  4JGY C;  4IV3 B;  1S0J A;  1CGP A;  1RUF 3;  2Q8D A;  2R32 A;  3TEY A;  4BIF A;  1CZT A;  2WII B;  3O14 A;  2VUJ A;  4AXO A;  2DCJ A;  4BQ4 A;  2OT7 A;  1VAL A;  1DGL A;  2GU9 A;  2VOW A;  5JR7 B;  2Q1Z B;  2AUY A;  5FP4 A;  5DPN A;  1RMU 2;  1AJO A;  4HAN A;  4ZPI A;  5BNN B;  1C1L A;  1WW5 A;  3T2Q A;  3I54 A;  1W0P A;  4FPH A;  1FV2 A;  4IEP A;  4L92 A;  3I59 B;  4IDZ A;  4MV2 A;  5D8A C;  1OUX A;  4AFB A;  4DY3 A;  4Q0V A;  4W6Y A;  4A42 A;  3U07 A;  2Y0O A;  2YB7 A;  2W3J A;  2ZCW A;  2QQI A;  4N53 C;  2GP5 A;  5IVB A;  2Z79 A;  2B5H A;  5EYX A;  5FWJ A;  2OUJ A;  2W5F A;  2IUW A;  5CZK A;  3ZMO A;  4C8D A;  1G9D A;  1FPN 3;  4RFT 0;  4P5Y A;  3GDB A;  4QAW A;  1W6P B;  4RYD A;  1K5M C;  5LK5 A;  5K7P A;  2Q1M A;  1RXG A;  2RM2 1;  2YZ4 A;  4PDW B;  4UFJ A;  4NID A;  1UAI A;  1HLC A;  1RIT A;  2KM2 A;  5DAW A;  1XJA A;  1C1F A;  1S0G A;  2BOJ A;  3WDU A;  2ZHM A;  3HNM A;  1QJY 3;  1RUI 3;  1ULD A;  3J8F 2;  3MIG A;  5K0U B;  5JXI A;  4P9J A;  2QQN A;  1QMJ A;  5F5Q A;  1AYN 3;  2E7T A;  2NQY A;  5FRA A;  4MXV A;  4TWT A;  4MVT A;  1VPH A;  3WP3 A;  1US3 A;  1Z0H A;  4DFS A;  3A22 A;  2QDR A;  2R1B A;  2BWA A;  4LO7 A;  2XDV A;  2B46 X;  2P3Y A;  2XJT A;  1T6B X;  1UOF A;  5EWS A;  1MVQ A;  1GOG A;  3VDD C;  1GQH A;  3NNM A;  4QQL A;  4XAC A;  2FHR A;  2RR1 1;  1XNK A;  1QQP 1;  2VY0 A;  1CIW A;  2E33 A;  4K9S A;  4BQ1 A;  2MEV 3;  3RSJ A;  4Z2A A;  3RNS A;  4Q4Y 3;  1PMJ X;  3VD5 A;  3HVD A;  2YY1 A;  4CXW A;  2OXB A;  4CCM A;  3D0S A;  4L99 A;  3F2Z A;  2P4E A;  4JVA A;  1JOB A;  1LOB A;  1OOP B;  3POI A;  1EAH 3;  5FJH A;  4OI1 A;  2DVD A;  1V6K A;  1UO9 A;  3OD4 A;  4CCK A;  2WNE A;  4BQ2 A;  4FFI A;  1KQR A;  5IFT A;  5CG8 A;  1MAC A;  3FMG A;  3O1V A;  3EB7 A;  4MH0 E;  1CPN A;  3ES1 A;  1AX2 A;  5FZO B;  2VH9 A;  1XU2 A;  3OJB A;  2A6X A;  3THC A;  4YSF A;  4XCB A;  4CCC A;  3VKO A;  2JDH A;  3LF7 A;  4OI4 A;  2BZD A;  2JD9 A;  3T2O A;  3UES A;  4TTG A;  1STM A;  4LPL A;  2D6P A;  2W47 A;  3VBH A;  2AC1 A;  2BJS A;  2V4V A;  1QWR A;  2FCV A;  3BOP A;  3OEB A;  2ZGU A;  1JYC A;  1VBC 3;  1IS3 A;  2ZKL A;  5DUV A;  4AVC A;  1D2S A;  3VHN A;  4YNI A;  5GLV A;  3WP6 A;  2WAO A;  3VBR C;  1ND3 A;  4K8R B;  4LMF A;  1HXS 2;  2C9K A;  2GNB A;  2RMU 1;  5JSP A;  1DBN A;  1WKY A;  1NZI A;  1POQ A;  3CZJ A;  1XYP A;  2VBD A;  3MYX A;  1W8H A;  4MSV A;  4Q0Q A;  5ACA 2;  4GH4 A;  3NV4 A;  4NMI A;  3QLQ A;  4LQR A;  4X8N A;  5D2A A;  4XDQ A;  2PEL A;  3DXT A;  2D6L X;  4LO5 B;  2J1E A;  2MPF A;  4XIO A;  4JQR A;  2X5I C;  4AED A;  1DIW A;  3POJ A;  1VBD 1;  3OYW B;  1YUD A;  3AZY A;  5A7O A;  5LB6 A;  3UYJ A;  3ZIX A;  5EPA A;  4NII A;  1GU3 A;  2VZ3 A;  3OG2 A;  4LO6 B;  4Y24 A;  5FPA A;  4CUG A;  3RZK A;  2ZGT A;  4QXB A;  2HKX A;  3PME A;  1TZO A;  3WG4 A;  4LO8 A;  5M0T A;  3TEW A;  5KXE A;  3C7F A;  3I3D A;  3RZL A;  1BBT 1;  2BEO A;  5E8A A;  2FDG A;  5I0D A;  3Q8E A;  4YZ4 A;  3W5N A;  4XZU G;  3UNP A;  3N4M A;  1VAK A;  3AJY A;  1RIR A;  4RFR B;  1G9B A;  4D7T A;  2YBP A;  4YVW A;  3MV0 1;  3MEP A;  2HWE 1;  3VV1 A;  4AEJ A;  2EID A;  4M4R A;  1W28 A;  1SLA A;  5H9R A;  1GP6 A;  4YAR A;  4IET A;  3K4Z A;  4CP2 A;  1ULO A;  3K3O A;  2XJU A;  3KZ4 C;  3IAP A;  2VMF A;  3THP A;  3WF0 A;  3WDX A;  5E6H A;  3U11 A;  4FT8 A;  1BEV 2;  2JDZ A;  4O9E A;  3MIC A;  1LU2 A;  4QXK A;  2RR1 3;  3DKW A;  3MUZ 1;  4AGR A;  1ZBA 2;  4W8J A;  1BK0 A;  5FP3 A;  4LIU A;  4AOC A;  3O0V A;  4CEY A;  2JDA A;  2VM9 A;  2YGL A;  3FL7 A;  4WV8 A;  5FAX A;  3LIG A;  4OCT A;  3ZXA C;  2WT2 A;  4SBV A;  1A3K A;  1VMH A;  5BYN A;  4BZ4 A;  3CJI A;  4DXT A;  3CNA A;  5GZC A;  3SXW A;  4MGS A;  5JXJ A;  4EWD A;  5EV7 A;  1TEI A;  3ITQ A;  4FQ4 A;  5KHH A;  3ZYH A;  4XDO A;  4UBG A;  4LA2 A;  3V0A B;  1X9P A;  4SLI A;  2RHP A;  5FBZ A;  4CDU B;  5C4W C;  4CCE A;  2ZBJ A;  1YWK A;  5JMO A;  1IQD C;  1R09 3;  1V00 A;  5LAT A;  4QKD A;  1ENR A;  3AVS A;  4LUK A;  1VJ2 A;  1FV3 A;  3K77 A;  3U78 A;  4AWD A;  1COV 2;  2HYX A;  4RHV 1;  3USU A;  5FV3 A;  3LOB A;  1NCQ A;  2XML A;  2RJL A;  2OUH A;  1RUE 3;  4IV1 C;  4ARY A;  4V1P A;  5FP9 A;  4HN0 A;  3VBS B;  3WUD A;  1WME A;  5JOY A;  3U10 A;  4D6Q A;  5FFO C;  1D7P M;  1UY2 A;  3RZZ A;  5F1R A;  3ZFE C;  1SQ4 A;  2XUE A;  2K2S A;  4BM8 A;  3N35 A;  1ALY A;  2GZW A;  3AP7 A;  3FC0 A;  1OF4 A;  1WCD J;  2WFF 3;  1XBF A;  1Q8O A;  5A3M A;  4OHX A;  4Q0U A;  2SBA A;  4Q0S A;  1DDL A;  2WL1 A;  2ENR A;  1EUU A;  3KMH A;  4JDO A;  3ZM8 A;  5GLW A;  4QX0 A;  4OVE A;  2JD4 A;  2A1X A;  4PF1 A;  4AFC A;  3E5U A;  2GC3 A;  1SBE A;  3BVC A;  4M3C B;  1VBD 3;  5DDJ 1;  4UT5 A;  3U14 A;  1URX A;  3ES4 A;  3ILF A;  3LEK A;  4CZS A;  2R1D A;  2VO5 A;  1C57 A;  2VTX A;  2Z4F A;  3NVC A;  5FZM A;  1ZYB A;  2H6C A;  2O1Q A;  5AFE A;  4ZZ8 A;  1CES A;  1SLC A;  4OHV A;  1BBT 3;  2YDE A;  4PIZ A;  4JHZ A;  5C8C B;  2W1S A;  1C5H A;  2A6V A;  2ADE A;  3T0B A;  4AVS A;  4JX0 A;  1JUI A;  4DIN B;  2VZV A;  4NPR A;  1QJF A;  5I0U A;  3WOG A;  2VVE A;  3FZ3 A;  1JOD A;  2VNO A;  1MQT C;  3KVA A;  4GMP 3;  3K2O A;  1VRH 3;  2Y8K A;  3WNP A;  5CFD A;  4CCN A;  3O1T A;  3WG2 A;  2A7A A;  1L7R A;  3DYP A;  2QE3 A;  4L0P A;  4YW6 A;  1TMF 2;  2D97 A;  1BMV 1;  4NHX A;  3PUR A;  1UL9 A;  4GB3 1;  2MHF A;  4J25 A;  4XFI A;  4GJY A;  1OA3 A;  1PM4 A;  1QEX A;  4YGE A;  1FMD 2;  2GAL A;  4JHT A;  4JRA A;  3LCP A;  5DAV A;  1JZ8 A;  4UXA A;  4CDW B;  3M3Q A;  4QB6 A;  5LAS A;  5L7O C;  3GXU A;  5A6Y A;  5FYS A;  1H2K A;  2Y38 A;  5DZG A;  4IV3 C;  3R4S A;  3PMS A;  1PK6 B;  4P14 A;  3VB9 A;  1DZQ A;  5AC9 3;  2ARA A;  4WM8 A;  3BTA A;  1IZ3 A;  4EN6 B;  1GNZ A;  1QF3 A;  4XJ8 A;  1TNF A;  3B9I A;  3ZYR A;  5IYY A;  2DDU A;  2OX0 A;  3WF3 A;  2QQJ A;  1CAV B;  1RUI 2;  3J7L A;  4LEJ A;  4ZS3 A;  5L36 A;  3I3M A;  2PMW B;  2WFP A;  5FZE A;  1Q8S A;  3BIW E;  1AYN 2;  2JIJ A;  3KM5 A;  3R4U A;  4NRM A;  4A6S A;  4BHP A;  1DG6 A;  3HMY A;  5BNN C;  4DY5 A;  5A3P A;  3ZX7 A;  1H8V A;  3VL8 A;  4N9H A;  4IND A;  2D5H A;  3VD9 A;  1FAT A;  4RD7 A;  3UGF A;  4OI2 A;  4CCD A;  5CAZ A;  5L9B A;  5LK7 B;  1QIQ A;  1AR7 3;  3K4A A;  3THT A;  1XU1 A;  2ZA9 A;  2XPJ A;  5C9A B;  1H2M A;  1JOP A;  3NL1 A;  4UW5 A;  5CU1 A;  5LA2 A;  4FPF A;  2PLV 1;  5LEJ A;  4K40 A;  3KT7 A;  4GZ9 A;  5FZ0 A;  4EN7 B;  2A6W A;  3ON7 A;  1TNR A;  4CCJ A;  1YJL A;  3CBN A;  3QH7 A;  4NRQ A;  3WQ7 A;  4JQT A;  1H2L A;  1ZBE 2;  1BXH A;  4B1M A;  2WNU A;  1UD1 A;  2GMP A;  3HT2 A;  2Y34 A;  2XOM A;  4Y4Y A;  5J1X A;  1J1T A;  1SLL A;  1UOJ A;  4W50 A;  4BH9 A;  1YI9 A;  4XQ4 A;  5J7M A;  1M4W A;  5BXX A;  4MXW A;  3PUS A;  1L7Q A;  2JEC A;  5JZG A;  4B8E A;  1ULG A;  2VMC A;  1W9F A;  1REF A;  4RSU A;  2B7Y A;  2BYV E;  2MNG A;  3M2M A;  1UQX A;  1PNF A;  3MGU A;  4IEV A;  3P3P A;  4CU9 A;  2DVG A;  1LCL A;  3GZE A;  3III A;  3DEM A;  3NST A;  2Q8C A;  1VBC 2;  5GZE A;  1FOD 1;  4AI8 A;  4OYU A;  4QT6 A;  5DUX A;  4JDM A;  1YLL A;  1RXF A;  1Y3T A;  2FQP A;  1W6O A;  2JKX A;  3ZIW A;  2YPJ A;  1WW7 A;  4KQ7 A;  1P8J A;  5HCA A;  4AVV A;  1NOV A;  3N9O A;  2RG4 A;  4CUA A;  2A71 A;  2B39 A;  4NVP A;  4P08 A;  3RS6 A;  4GB3 3;  4HVR A;  4LT5 A;  4IE0 A;  1QOS A;  2WNO A;  2WN2 A;  1MEC 1;  2HWF 2;  1QKQ A;  1SFN A;  2QQV A;  1XNB A;  4BQY A;  4JCK A;  4N43 B;  1QXP A;  1QU0 A;  2VQA A;  1IS5 A;  1W8N A;  1Q8Q A;  1XYO A;  2PAM A;  3I2J A;  4BDV B;  2I07 B;  5IW0 A;  4XCA A;  4RR3 C;  4JGY B;  4DO0 A;  2V72 A;  2IFW A;  4C91 A;  4XXP A;  3H8R A;  1RUJ 3;  2RS3 1;  5FYU A;  4GD4 A;  1TME 2;  1HQL A;  4YZ3 A;  1UKR A;  5A7N A;  3LA3 A;  3T1L A;  4D6R A;  4MGQ A;  2ID4 A;  2ZGK A;  3RI8 A;  3MLL A;  1CN1 A;  1OQE A;  2WNV C;  4FP2 A;  2DFC A;  4GUL A;  4IE4 A;  4JGZ C;  2JXA A;  2GDF A;  3IPV B;  5FPB A;  4GAL A;  5HI0 A;  2VTF A;  2JE8 A;  1QXR A;  4MGT A;  4QPI A;  3ZN6 A;  1Y9G A;  5C6C A;  5LA1 A;  2GC2 A;  2ZHK A;  3N7L A;  4ISR A;  5T5L A;  1H30 A;  3MI8 A;  4EYU A;  5EYY A;  4MG2 A;  1RUG 3;  1V9U 3;  2WR9 A;  5FWE A;  1W6Q B;  1PO2 3;  1B35 A;  2PHX A;  1YFU A;  3WF2 A;  1HJF A;  5LEK A;  1D0G A;  2CU5 A;  1JHN A;  3D5O A;  1GNY A;  3FUQ A;  3V64 A;  4ATE A;  5FPL A;  3P5B A;  1AXZ A;  3RJ2 X;  2PHR A;  4YRD A;  1H4H A;  3ROU A;  1X8E A;  2W94 A;  1SEF A;  3CLP A;  2NLR A;  3A23 A;  4FTS A;  1UPI A;  1A34 A;  1SLB A;  4LTA A;  2XBO 3;  4B29 A;  4E4S A;  2Q8O A;  3ZMN A;  5JXH A;  2HEY F;  1NCR A;  5F7U A;  2UWC A;  4AQ6 A;  4MGI E;  3VBO A;  5CYY A;  4UOJ A;  5G04 L;  4EV0 A;  2WZP P;  1O8P A;  3K4D A;  4G9S B;  1TG7 A;  1LHO A;  5CKQ A;  4FPE A;  3ZKY A;  4Q4V 3;  5GLU A;  4K8F A;  1PO1 2;  2JIG A;  2XJP A;  4YG0 A;  5CVR A;  2HWC 3;  1UMH A;  1QJU 2;  3ZXL A;  1JH5 A;  3RWN A;  4IEO A;  4R9A A;  1UY0 A;  4C1W A;  1DQ6 A;  2A6Z A;  1UU6 A;  3BPS A;  4NIG A;  3T4H B;  5HV0 A;  4M4P A;  3I2I A;  1RUE 2;  1C8M 1;  3ZN4 A;  3OUH A;  3W20 A;  4LBO A;  5JLV A;  2GH2 A;  5A32 B;  1Z7S 2;  4CCL A;  4EN9 B;  5C3P A;  2IC1 A;  1FOD 3;  1LGC A;  3KGL A;  4XTP A;  5GZD A;  3I2F A;  3PTY A;  2AEY A;  4KBZ A;  1J3Q A;  2WFF 2;  2VUC A;  3UT0 A;  5DG1 A;  2OQ7 A;  3KV9 A;  4PHZ A;  5FXW A;  5ACA 1;  4UW3 A;  4Y22 B;  1UMZ A;  3U0Z A;  3WDY A;  1OD3 A;  3DYM A;  3RQ0 A;  5CFC B;  3ZDV A;  1LGB A;  1V0A A;  1VLN A;  1F15 A;  4KNC A;  4Y4R A;  5FZA A;  1O59 A;  2CSG A;  2LS6 A;  3B3Q E;  3VKF C;  2GNM A;  4QX2 A;  2RVA A;  3FHI B;  2EAK A;  1JYW A;  1LOA A;  2RS3 3;  2QJV A;  5CBL A;  4CEW C;  1GOF A;  1G9A A;  3VBS C;  5FQ0 B;  3A0K A;  2WO7 A;  2EA7 A;  3ATG A;  1W8T A;  2AZ5 A;  2YRO A;  3FHQ A;  2X09 A;  3K3N A;  4ITC A;  3VBH C;  3VHO A;  4BXF A;  3IZO A;  5ABJ A;  2ZEW A;  4IER A;  3BOD A;  3EMR A;  5IVV A;  4CXX A;  3BB6 A;  4K21 A;  3ZLI A;  4FOW A;  2E32 A;  1JMU B;  1ND3 C;  5FMC A;  5A7P A;  4NJ4 A;  1GZC A;  2XJS A;  3ACF A;  4K20 A;  5F32 A;  2DTW A;  5FXV A;  1W6N B;  2C5D A;  3WW2 A;  1KXG A;  3PJY A;  1ASJ 2;  3AB0 A;  3GM8 A;  4MLO A;  1VIW B;  3ABZ A;  4HZF A;  2VMH A;  2JDU A;  2WS9 3;  4TLG A;  3W9A A;  3GHM A;  2Z2S B;  5IFP A;  3E5Q A;  3A0N A;  2X5I B;  3LIH A;  3C7E A;  1ND2 C;  3TYJ A;  4PF5 A;  5JIA A;  1PMI A;  2XLA A;  4D3W A;  4RL7 A;  1IKQ A;  1DGW X;  2VQU A;  4ZU4 A;  1YFW A;  2Q0A A;  2HYK A;  1U0A A;  4J1W A;  3H50 A;  2VBB A;  4LA3 A;  5KHK A;  4YG3 A;  2ZGP A;  2A5Z A;  1IHM A;  4LBQ A;  5T5J A;  3NJV A;  5F2W A;  2Z42 A;  1RHI 2;  4QHO A;  2HWB 2;  3S5Q A;  4COV A;  4E8C A;  3M3I A;  5AC9 2;  4CCO A;  3ZSE A;  4AE2 A;  4AZZ A;  3GZA A;  2XKO A;  1RUH 1;  4LO4 B;  5GZG A;  4NN0 A;  1AL2 1;  3DPR A;  1W8F A;  1MPX A;  3PLQ A;  3FBY A;  1COV 1;  2XQR A;  4GWI A;  3OY8 B;  4QQH A;  1JZ4 A;  3PU8 A;  5FZC A;  1C8M 3;  4LOT A;  2VMD A;  4LHN A;  1PZ9 A;  2VBP A;  4YVS C;  4BWO A;  3J7N A;  4P02 B;  4CEY C;  4D0Q A;  2XHN A;  2CWS A;  5SV5 A;  1JW6 A;  1AR7 2;  1V6L A;  4NPM A;  4JC1 A;  1CPM A;  2OPK A;  1D4V B;  3CJI C;  1LTE A;  3OCP A;  3VBF A;  4BOW A;  3UL2 A;  3ENR A;  3LQC A;  2WWU A;  5I0S A;  5LBE A;  1F8V A;  5EP9 A;  1LOE A;  5FYZ A;  1ZZC A;  1O5L A;  4NRP A;  2XKP A;  3RPQ A;  1Q56 A;  2WT0 A;  5C4W B;  2QFE A;  4HN1 A;  4QKF A;  4XFC A;  4AI9 A;  3LPG A;  4CU8 A;  1JZ6 A;  3POG A;  5JUV A;  1GWL A;  1BCX A;  3AL6 A;  1J58 A;  1HJG A;  4HET A;  1GP4 A;  1CQ9 A;  4AF9 A;  3ECQ A;  1US2 A;  5FYH A;  3IMM A;  2IXI A;  4LKS A;  4XAA A;  1AR9 2;  1R1A 2;  3UJO A;  1KD7 A;  2WA3 A;  1Q5O A;  3P6B A;  1CJD A;  2CAU A;  4KG0 A;  5F2S A;  4IV1 B;  3CO2 A;  2VR4 A;  1JTZ X;  1WUV A;  1RC6 A;  1W03 A;  3DEC A;  4QXC A;  4URT A;  1LED A;  5T50 A;  3ZFE B;  3O1P A;  1EV1 3;  2WO2 A;  4Q0P A;  2RDS A;  5E89 A;  2HWD 1;  4LOR A;  5L73 A;  1POV 0;  2ZEX A;  3DCQ A;  1AVB A;  3K48 A;  3G7D A;  4Q29 A;  2AH2 A;  4CPB D;  1JZ2 A;  3V0B B;  1O3S A;  1Q43 A;  1ULE A;  3PHM A;  2PHL A;  4ARX A;  2KD7 A;  2VW0 A;  3I59 A;  3OF1 A;  3KV6 A;  3J26 N;  4FPJ A;  3EJK A;  3POY A;  5IUQ A;  3U4X A;  2DF7 A;  3MID A;  3W59 A;  3U1X A;  4XJW A;  3NV2 A;  5AFB A;  1UU5 A;  4CRQ A;  1O8S A;  2B8M A;  1FMD 1;  1YQ6 A;  4N8M A;  3CL1 A;  1E5I A;  2D44 A;  3JD7 3;  3WZ1 A;  3AMN A;  4OUL A;  5F3G A;  2J1V A;  4AW7 A;  2ZGO A;  1AF9 A;  2J1A A;  1QNW A;  5A7S A;  1RUJ 2;  1J3P A;  1CON A;  2F17 A;  4XUN A;  3ZN5 A;  2DCZ A;  4R9C A;  5K0U A;  1RUH 3;  4HOO A;  1AL2 3;  3N7K A;  5GJ6 A;  1U5I A;  4CDX B;  4FP3 A;  1MQT B;  1SCS A;  1O91 A;  2GC1 A;  4Q26 A;  5JIU A;  2W1U A;  4I2O A;  3VLB B;  4W4Z A;  5FUP A;  2XVL A;  1FT9 A;  3HBZ A;  2G9G A;  4MGK E;  1O3T A;  2W0X A;  3ZYJ B;  4Y1Y A;  1R08 2;  3TNP B;  2V5Y A;  2IXJ A;  2XJV A;  2A73 B;  3UV9 A;  5JXG A;  2G9F A;  1PO2 2;  1CX1 A;  4NAO A;  2Q5T A;  1I6X A;  3WXP A;  1CWP A;  3N9M A;  1W9W A;  2D93 A;  4N43 C;  2WZR 1;  2WYF A;  1LAJ A;  4AGV A;  1OA2 A;  4QMA A;  1GUI A;  2PAK A;  2R06 2;  5L7O B;  1NQJ A;  2RS5 2;  2YMZ A;  5FY7 A;  3NO8 A;  2D6N A;  1ZZ9 A;  2VZP A;  1S0I A;  5CKM A;  2BFU L;  3VBU C;  5C3O A;  1OSG A;  3EYP A;  4EN8 B;  4A3X A;  2W52 A;  2YG0 A;  1F5F A;  3AZZ A;  1IQA A;  3HAG A;  4RS5 C;  4DPN A;  3H8X A;  2Y64 A;  1RUC 2;  1N1Y A;  1OLR A;  1VBB 1;  2DBI A;  3FUO A;  2QQP A;  3T0D A;  1GZW A;  1DGW A;  4ZHN A;  1NKG A;  4BJ0 A;  5FZ4 A;  2ZXQ A;  1AR6 1;  3MW3 A;  1D0H A;  2E26 A;  4AFM A;  1J83 A;  1XE7 A;  1OUR A;  2QVS B;  4DZG A;  3JQX A;  3VUO A;  4M00 A;  2HWC 2;  1YRZ A;  3B9C A;  2BP6 A;  1GQP A;  1HRV 3;  1T6G C;  4LBN A;  1S0B A;  5FZB A;  4OHY A;  1OPO A;  2KA3 A;  1GOH A;  2D3R A;  4AI1 A;  3THD A;  4XEZ A;  3A4U A;  3VDA A;  4BU2 A;  5IWF A;  1E5R A;  4IEY A;  4EN0 A;  2HWD 3;  1DYK A;  3VZM A;  1UU4 A;  3S0M A;  3E97 A;  2R04 1;  4WBB A;  1VBE 2;  2GNT A;  2TEP A;  4J6G A;  1OFN A;  2VUL A;  4FFH A;  4NO4 A;  2WYS A;  1AYM 2;  1C28 A;  3MIB A;  4QPY A;  1UYZ A;  4QKB A;  3ZPO A;  5A3L A;  4S2F A;  4XW3 A;  1A8M A;  3RMX A;  1NZC A;  1PVC 1;  5KXC A;  2WUH A;  1SCR A;  2ARE A;  3PDQ A;  3BKZ A;  1NE6 A;  1LUL A;  1DZT A;  2DUO A;  4XF0 A;  1JXN A;  1ZVF A;  2HWF 1;  2R07 1;  2YFZ A;  1U5Z A;  3SKJ E;  5LZ6 A;  1RUN A;  2XG3 A;  3ACL A;  3OYW A;  1PGL 2;  3NW4 A;  4PT6 A;  4TYS A;  3ZFF A;  4QX7 A;  4TXW A;  3JB8 A;  4HT1 T;  4I3P A;  1G6N A;  2QNK A;  5FZF A;  4AQ2 A;  1TME 1;  3ZYG A;  2QCS B;  2GME A;  4WVM B;  1NQD A;  1JS9 A;  4YFZ A;  4N7I A;  4YW4 A;  4YW1 A;  2AAC A;  1JZ5 A;  4XDP A;  2QBX A;  4NHL A;  1Y9M A;  1NT0 A;  1UZZ A;  3C8X A;  4Y3O A;  1HRI 2;  1Y43 B;  3NNF A;  2ZOE B;  2QQO A;  3JCI A;  5D1I A;  4ASK A;  5FYM A;  2VNV A;  1RJ8 A;  4XFA A;  5B4N A;  2QQM A;  5FK8 A;  5CFC C;  3VGI A;  1ULP A;  3DF0 A;  5FZ8 A;  5J96 B;  5L9R A;  2XHK A;  3FLR A;  2P37 A;  1QJX 2;  2E63 A;  3ORJ A;  4AHX A;  1UY3 A;  5BV6 A;  2YXS A;  1GWK A;  4KL1 A;  4AHW A;  4RR3 B;  1OKQ A;  1DU3 D;  2YGM A;  1Y9Q A;  3HQU A;  1WLC A;  2VMI A;  4EWE A;  4CXY A;  1VBB 3;  2BQP A;  2AEN A;  1U12 A;  2ZMN A;  4QPG A;  4XAE A;  1HQW A;  5HBA A;  1AR8 1;  2WNV B;  4JGZ B;  2DUR A;  3H8U A;  1AR6 3;  4PI2 A;  4XUP A;  2XL9 A;  2WDB A;  4E4Z A;  4Y1U A;  2NMO A;  1QJU 1;  4LBJ A;  3LA7 A;  5BPX A;  3OEA A;  1UYY A;  5APA A;  2H6B A;  3UGH A;  2W68 A;  5DUU A;  4W65 A;  4FSJ A;  4Y1X A;  3NV1 A;  4XMA A;  2D98 A;  1WBF A;  1J1L A;  2QTW B;  1HN1 A;  4QDR A;  3NKT A;  4XZP A;  1DYP A;  2R04 3;  2ZPX A;  3GJA A;  2RM2 3;  1SMV A;  3AYD A;  3GYD A;  4J1X A;  1HX6 A;  3E1F 1;  1NCR C;  1BHG A;  2VOT A;  3N9L A;  4CU6 A;  2C9A A;  3OUI A;  3VBO C;  1RVF 2;  3WX5 A;  2GN3 A;  1PVC 3;  3AFK A;  1DHK B;  3IMN A;  4UFK A;  3WSO A;  3IKW A;  4Y5S A;  3O1U A;  4H55 A;  4YWA A;  3AYA A;  4QX1 A;  1R64 A;  3POS A;  4S2G A;  2OA2 A;  1CAW B;  3N7M A;  2YBS A;  1OHF A;  3SKV A;  3LFI A;  1H6X A;  2W46 A;  4BK5 A;  4OQ9 A;  5BUV A;  1IG3 A;  1UOG A;  1Z78 A;  3M4F A;  2W91 A;  2VZU A;  3T4V A;  5IK8 A;  3TN9 1;  4GAZ A;  1IPS A;  1VBA 1;  2TNF A;  2YU2 A;  3H42 B;  4E9K A;  1XNA A;  4LBM A;  1QQP 3;  4RGA A;  4Q4W 2;  3RG0 A;  3WF1 A;  4A41 A;  1LOF A;  4IGO A;  3GZT B;  4OMD A;  2JJ6 A;  2Q1F A;  3LPF A;  4LHS A;  2DUQ A;  3OBZ A;  1JN2 P;  5FZL A;  2YC0 A;  3ZFG A;  2ZX2 A;  2F4P A;  4BQX A;  2UWA A;  3LEI A;  5E88 A;  4ZXE A;  3TEX A;  4M01 A;  4ERO A;  3AMP A;  1R1Z A;  3FJS A;  2YYO A;  3WCR A;  5KXD A;  4O61 A;  4Z82 A;  2EXK A;  4QHZ A;  4ATF A;  5FO8 B;  4V2W A;  1ASJ 1;  2YUE A;  3NAP C;  4ZY9 A;  4UF0 B;  1UX7 A;  1OC1 A;  1ZX5 A;  2D6M A;  1RUD 1;  2VZT A;  3GHN A;  5BNP C;  1O3Q A;  1DCS A;  3WNL A;  1OLM E;  4KGQ A;  5KWR A;  1BKZ A;  4LUM A;  5F6K A;  3ZR6 A;  2LM3 A;  2IVJ A;  4H7M A;  5BNO A;  2VCC A;  5IHR A;  5DUW A;  1K45 A;  1ULC A;  4XUO A;  2ATF A;  3M3O A;  3RMY A;  4XQW A;  4CDW A;  3ZVX A;  4CEW B;  4F8A A;  1JYI A;  2RV9 A;  2WO1 A;  2JG9 C;  3SIS A;  4DUW A;  3BTY A;  1AR8 3;  1VAV A;  1RHI 1;  2XJQ A;  2HWB 1;  3VBH B;  4HFS A;  2DCK A;  1H8T A;  2P2K A;  3QH6 A;  5FY0 A;  4TLF A;  2D6O X;  3H8O A;  4BQW A;  2RMU 3;  3BCW A;  1S4C A;  1ND3 B;  3WLU A;  4NRO A;  2O0O A;  1LES A;  3T1M A;  4YW5 A;  2Q8E A;  3HN3 A;  2JB8 A;  4FAG A;  1YO8 A;  3H3U A;  2GAU A;  3ST7 A;  1GR3 A;  2SLI A;  3BN6 A;  3ZR5 A;  1H1A A;  1D4M 2;  1ND2 B;  4XMI A;  5H9S A;  1EPZ A;  3SEE A;  4HKL A;  3IB3 A;  4I30 A;  4TSV A;  2CL2 A;  5FMO S;  4WZF A;  4IEQ A;  1ZZ8 A;  2PQQ A;  2ZAC A;  1ZZB A;  4Q27 A;  3VHP A;  4GWM A;  3R0R A;  4LK6 A;  2V5D A;  1W9T A;  3RYP A;  1RUF 2;  3VZN A;  1O3R A;  2F4L A;  4MGY E;  2Z5W A;  1SFP A;  4R9B A;  1BVP 1;  1LHV A;  4FCA A;  1N1T A;  1IKP A;  2HWE 3;  1CAU B;  1WMX A;  3WY6 A;  1PX3 A;  1W2U A;  3CJX A;  5CG9 A;  5A3O A;  2OYZ A;  4CDX C;  3DPR C;  2OQ6 A;  3HBK A;  1K3I A;  3TN9 3;  3EXU A;  3JB4 C;  1AR9 1;  1R1A 1;  2ADD A;  4HXC A;  3NNL A;  1ENX A;  1VBA 3;  2HBU A;  2ZGS A;  4L97 A;  3ZYI B;  1HRV 2;  4CDQ C;  5CEH A;  1LJ7 A;  1VE0 A;  1NY7 1;  2DUP A;  3RGB A;  3FFZ A;  4YVS B;  3WD5 A;  4CEY B;  2WQ4 A;  3IBM A;  4Y20 B;  3WNM A;  4EZ4 A;  5FIX A;  3WW3 A;  2J42 A;  4AAX A;  3MF9 A;  5AVP A;  3L2H A;  2QZ2 A;  3CJI B;  3EBR A;  1ZRC A;  1W8W A;  2NMN A;  3QOP A;  4GWJ A;  4QU2 A;  1K12 A;  3VBF C;  1FPN 2;  3L9J T;  5IAT A;  4COY A;  4JTN A;  4DS0 A;  2VL4 A;  1A6C A;  2EIB A;  3RZH A;  1PMH X;  3R4D B;  4CYD A;  1J84 A;  2ZAH A;  3HWJ A;  3NJX A;  2Y26 A;  4X6R B;  5CB7 A;  4NAM A;  2ZAB A;  2LRP A;  1TVG A;  2BRT A;  2OVU A;  1V6J A;  1XRU A;  4FFG A;  1QJY 2;  1OVS A;  2FBE A;  3K75 B;  5G05 L;  4RHV 3;  5L19 A;  4FPC A;  5EJZ B;  4AFA A;  3JU9 A;  5HCB A;  2PHD A;  3IIA A;  4GWN A;  1UIJ A;  2C24 A;  4YW3 A;  3WQ0 A;  3WIN E;  2RS1 1;  3ZSJ A;  2KR2 A;  1X50 A;  2DVF A;  2JEM A;  3N36 A;  2XVK A;  3ZXD A;  5C7G A;  4AQT A;  2VEC A;  2MEV 2;  4AK3 A;  4RQP C;  3IPV A;  1AL0 G;  3PL0 A;  4Q4Y 2;  5HPO A;  4WM7 C;  2ZS6 B;  1MR5 A;  2BWC A;  4KH9 A;  2AEZ A;  3ZYF A;  3C7G A;  2QDN A;  3U4S A;  4Q4X 1;  1IG0 A;  4QXH A;  1OKO A;  3WQ1 A;  4MHU A;  4O7X A;  1EAH 2;  1HV0 A;  5D8A A;  4QQ2 A;  4DEV A;  5GM0 A;  4PLM A;  1SPP B;  5FMO L;  1W6Q A;  3TBD A;  1HQN A;  1R08 1;  2CTV A;  4N53 A;  3VD4 A;  3RZM A;  5DDJ 3;  1ODM A;  1N1S A;  2EXI A;  3UGG A;  5B2G B;  3JBG 1;  1DP0 A;  2OZJ A;  3DKQ A;  4XFB A;  2JG8 C;  3VZK A;  2P1B A;  3SH4 A;  5JWP A;  4LOS A;  4ES9 A;  4DRV A;  1F35 A;  2BGC A;  1PGW 2;  5FDB A;  1PIV 1;  2R06 1;  3JQW A;  1XXN A;  4AVT A;  4DUX A;  2RS5 1;  1K5M A;  2VXJ A;  3UKV A;  4F3J A;  4YZ1 A;  1J59 A;  1ZNP A;  2DU1 A;  1GWM A;  1OI6 A;  2P3I A;  4N9I A;  5GKA C;  3OGV A;  1YEW A;  3IT8 A;  5D21 A;  5LRR A;  4Y26 A;  3GBG A;  1NLR A;  1RMU 1;  3S57 A;  1FYU A;  2D6K A;  2WBK A;  3D4K A;  3H7Y A;  4IEU A;  1O4Z A;  3AZX A;  4CP9 A;  5JR2 A;  2QQL A;  3Q8A A;  5B4X A;  5BNQ A;  2BNM A;  3MHZ A;  5C3Q A;  2A75 A;  5CFD B;  2BGO A;  3ETQ A;  3LWC A;  1OQD A;  3MPP G;  2I2S A;  3KWV A;  4GMP 0;  3CKH A;  3GZU C;  4PLN A;  3N7J A;  4HG6 B;  3PIJ A;  2ZHL A;  3IWZ A;  4UFM A;  4R8H A;  2YU1 A;  3VDD A;  3H1M A;  2J7M A;  3MLK A;  3AFG A;  1LEN A;  1QJE A;  1QY4 A;  4UWD A;  4ET7 A;  3QCW A;  4E8D A;  5A32 A;  1NUK A;  2ZEY A;  1VBE 1;  2D7F A;  2XXZ A;  3A21 A;  5E16 A;  3VBU B;  1S2K A;  2RDR A;  4GQ7 A;  3TNQ A;  3WDW A;  1AYM 1;  4RS5 B;  3SCH A;  4P9Y A;  1MS4 A;  4FPK A;  4WM8 B;  4XTM A;  1GQG A;  2G1M A;  1SHW B;  3CMG A;  3J8F 1;  5C33 A;  4Y22 A;  3Q8F A;  2C26 A;  1DLL A;  2VZ1 A;  1GLH A;  5HCH A;  3RJR A;  1F5J A;  3DYO A;  1NYW A;  3AKS A;  1H6Y A;  2XUM A;  3DUI A;  5ANQ A;  2ZGQ A;  4TN7 A;  1OPM A;  3VD7 A;  5CKN A;  2ORX A;  2Y6F A;  3E6C C;  3RI9 A;  3PJQ A;  4GA9 A;  1WCU A;  2GND A;  4CVU A;  2FCT A;  5FQ0 A;  2XLG A;  4NUB A;  1ZZ6 A;  4E27 A;  1PX4 A;  2RR1 2;  1QQP 2;  3BAL A;  5I8S A;  4NIA A;  2LRO A;  4K6B A;  1GIC A;  2VNG A;  3OPW A;  3I2O A;  3LZZ A;  2PLV 3;  5FP8 A;  4HKW A;  2JEN A;  3AJZ A;  4O9G A;  4QHB A;  3VBR A;  3D8C A;  3J7M A;  2Y33 A;  3H1Y A;  2E7A A;  1WW6 A;  5JDB A;  2IXL A;  1OH3 A;  1UYX A;  1W06 A;  2JDM A;  1W6N A;  3HPN A;  3O5S A;  3PU3 A;  4KWJ A;  1JU4 A;  1V6I A;  2B9V A;  3IDA A;  4A44 A;  5A1L A;  3K51 A;  1KDM A;  2DVB A;  2WNU B;  3JBG 3;  3WNN A;  4KMQ A;  3KHB A;  1WCS A;  2HEV F;  2X5I A;  1NLQ A;  2V4A A;  1R09 2;  4NR1 A;  4QGN A;  4UI9 L;  3TAY A;  3WEZ A;  1VP6 A;  2GH8 A;  1PIV 3;  4XAB A;  5FZI A;  5IVY A;  3FWE A;  4MXW B;  5F5I A;  1PVX A;  5LA0 A;  4HK8 A;  3NWK A;  2W1W A;  3ZFF C;  2W92 A;  3MV1 1;  3OPT A;  2RDQ A;  5A33 A;  5DZF A;  2ZGR A;  1H1I A;  3RFR A;  5F37 A;  5JAX A;  1DLC A;  4JDN A;  5FCC A;  5A1A A;  5C3S A;  4QQO A;  2DTY A;  4BK4 A;  2WRA A;  1N47 A;  2AYH A;  5K4L A;  2EVX A;  3MIH A;  3MW2 A;  3N9P A;  4MGZ E;  2E7Q A;  2VCM A;  3HR9 A;  1M06 G;  2JDK A;  1HXS 1;  2WC2 A;  4AR2 A;  2IFR A;  1JI6 A;  3DL3 A;  1XQN A;  1XYN A;  3VD3 A;  3GBF A;  2XR4 A;  5F3E A;  1GNH A;  5A7W B;  1J3R A;  1YC6 1;  1MEC 3;  5FYV A;  3UET A;  3I3B A;  3FLT A;  2OZ6 A;  3C7H A;  1G8W A;  3OTF A;  1ENS A;  1VBD 2;  4UW6 A;  5JOW A;  3HQR A;  2QKD A;  4EJR A;  1W6M A;  2X29 A;  4QGL A;  2VD7 A;  4CP1 A;  1FXZ A;  1MZF A;  5FZ1 A;  5SV8 A;  1BBT 2;  3B69 A;  2G9Z A;  1DQ1 A;  3AM2 A;  3J8F 3;  5C4W A;  4A45 A;  5KC5 A;  5T54 A;  4XVH A;  2BUK A;  3HT1 A;  3WDV A;  3CIH A;  2TBV A;  5FYC A;  1RED A;  5KBF A;  2UYB A;  2HWE 2;  4YM2 A;  1KRI A;  1LKN A;  2QUO A;  2ZX3 A;  3IDC B;  3LB9 A;  3OOX A;  2WZE A;  4U2A A;  1UX6 A;  4LBK A;  1VRH 2;  3B00 A;  3LEG A;  3POW A;  1WD3 A;  1U5Y A;  1BEV 1;  4H7L A;  1UY4 A;  3I97 A;  4GH4 C;  4IV1 A;  5K8S A;  2WWS A;  3V65 A;  4F7Z A;  1ZBA 1;  5FTT C;  4R52 A;  4AED C;  4BYY A;  5FUN A;  5FRE A;  3ZFE A;  4IE6 A;  2VOX A;  2ZZQ A;  5F5C A;  4BMB A;  2JDN A;  2TUN A;  4QPW A;  1ZRE A;  1VAM A;  4HK9 A;  3SNM A;  2WZ8 A;  1L3J A;  1LEM A;  4NWW A;  4ZKT B;  2BVB A;  1NCR B;  4Q1R A;  5T55 A;  3VBO B;  4A7K A;  3AKQ A;  2NP0 A;  5GLZ A;  2OII A;  5EJ3 A;  1FX5 A;  1VRB A;  1W3V A;  3GGL A;  4JAA A;  4GKY A;  4B7E A;  3N9Q A;  1SLI A;  1APN A;  3PVE A;  4YVW C;  2BTV C;  2C0Z A;  1EP0 A;  2VCB A;  1W04 A;  4A6O A;  1N3Q A;  5FYT A;  5ISL A;  5FKB A;  4YZ5 A;  5CIS A;  1KS4 A;  1VMF A;  4FVV A;  1NA1 A;  2BNO A;  4Y1V A;  5A7Q A;  5IJR A;  1JBC A;  2X8K A;  3OPZ A;  2PA7 A;  5EIY B;  4Z07 A;  1PGS A;  4P9G A;  4YYO A;  3ELN A;  4AQS A;  1RUO A;  2EXJ A;  2XVG A;  5HV4 A;  1XSR A;  3ILR A;  4LUL A;  1MZ6 A;  5EXO A;  3POB A;  1N1V A;  1I5Z A;  1YQ8 A;  3LKJ A;  2X53 S;  1MQT A;  3O12 A;  3AYC A;  5ACA 3;  2CY6 A;  1MS9 A;  2R0F A;  3I4I A;  3PUQ A;  2PAE A;  2VZR A;  3LFM A;  3NAP B;  4HON A;  3SMH A;  3O1M A;  5FPU A;  1HB1 A;  2NZ9 A;  1X36 A;  3AYE A;  5T5P A;  5BNP B;  5CAD A;  2BDR A;  3SEP A;  4BA6 A;  3SH5 A;  1SG3 A;  2BFU S;  3AKP A;  3Q9O A;  2Y0I A;  1D4M 1;  1CD3 G;  3AMH A;  3MIF A;  5FZ3 A;  5BNO C;  4AEM A;  3EO6 A;  4XPV A;  1NCQ C;  1YHF A;  4IUG A;  2D43 A;  5L7O A;  3ZO0 B;  3AZV A;  4IV3 A;  4KWL A;  2YC2 A;  4HBN A;  2JG9 B;  3C7O A;  4XQD A;  3DGT A;  3W21 A;  4AAP A;  1AZD A;  5IK7 A;  3D82 A;  2JDY A;  2NN8 A;  2IZW A;  2VZO A;  3BTX A;  3MF6 A;  1JZ3 A;  5H9P A;  2DU0 A;  1H8T C;  4WVW A;  3MFA A;  4P9L A;  3VZJ A;  5I0R A;  3AP4 A;  5C5T A;  3RZJ A;  1DF0 A;  1IPK A;  4KWU A;  1BK1 A;  5BNN A;  3AK0 A;  4Y1Z A;  1X82 A;  1VB2 A;  1CAX B;  4LKD A;  1W99 A;  3PUA A;  5A1F A;  1BEV 3;  3CZU A;  2BBA A;  4JRL A;  4XET A;  4IEX A;  1TMF 1;  1ZBA 3;  1ONA A;  2YPD A;  4Q5O A;  4ONU A;  4QM8 A;  3S7I A;  2ETE A;  3ZYP A;  2Y6L A;  3AXD A;  4GB3 2;  3BTZ A;  2W39 A;  4I09 A;  2WQ8 A;  1MS0 A;  5TSW A;  3H3Z A;  3WT3 A;  2PHF A;  5GZF A;  5IK5 A;  5KHG A;  1VR3 A;  2OS2 A;  4RA0 A;  2J1U A;  1W6P A;  3MFC A;  3B01 A;  1FPN 1;  5HCF A;  4DB5 A;  2I74 A;  4PDW A;  3BUC A;  4LBQ B;  5A70 A;  2CNA A;  4DIQ A;  2P17 A;  3KV4 A;  5F5A A;  3PTR B;  3ILN A;  4OZO A;  2RJ2 A;  1QH7 A;  1DGR N;  1CZV A;  3NNG A;  4R4Z A;  3VN4 A;  1GV9 A;  1QJY 1;  1RUI 1;  4LE3 A;  1C3H A;  2O8Q A;  3SC7 X;  3DPR B;  1COV 3;  1AYN 1;  3NJZ A;  4HVO A;  4JV4 A;  3UJQ A;  5FR3 A;  1WA4 A;  3IDE A;  5LW9 A;  1UCX A;  5FZG A;  5J3U A;  4JTO A;  4XF3 A;  1L7L A;  1QOO A;  5CFD C;  4CDQ B;  4ES8 A;  5KC6 A;  2YFU A;  4XF4 A;  3POF A;  1O4T A;  1KDK A;  2WLQ A;  4IL7 A;  5IAX A;  1RUG 2;  1V9U 2;  2PQS A;  3WNK A;  3KCX A;  2OW4 A;  3S30 A;  2VE1 A;  4WVM A;  3J9S A;  4KU8 A;  2Y6G A;  3BU7 A;  5FYB A;  2R30 A;  1DQ0 A;  2MEV 1;  3VBF B;  4K1Z A;  2LTN A;  5C70 A;  2D3S A;  1G7Y A;  2EIE A;  2PLV 2;  2WAA A;  2OPW A;  4PLO A;  3FLP A;  4A3Z A;  2XBO 2;  1OOP A;  4YGB A;  3ZKU A;  5A3W A;  3AVR A;  1OF3 A;  2GN7 A;  5DAQ A;  4WM8 C;  1ZBE 1;  4Y5Z 0;  5JOX A;  1MS5 A;  5FZH A;  4XJA A;  2V09 A;  4L8Q A;  1YCI A;  1QOT A;  4LIT A;  4Q4V 2;  4XFF A;  1REE A;  1RYY A;  1WZX A;  3PUI A;  3IM0 A;  5FZO A;  3DV8 A;  1OD5 A;  2LW8 A;  4BXS V;  4M0N A;  1W9Y A;  3ZXK A;  3FX3 A;  3O1O A;  4RR3 A;  1HV1 A;  1E57 A;  5LA9 A;  2XH6 A;  3W5M A;  4DXS A;  1SDD B;  4FXK B;  1I1E A;  1OVP A;  1JUH A;  1QXJ A;  3I49 A;  4UYB A;  1AXK A;  1WWY A;  1W8U A;  5C71 A;  4NWV A;  2DBN A;  2BNN A;  1YQ2 A;  2GMM A;  5HXV A;  1SFY A;  1JYT A;  2YHJ A;  2FDF A;  2WNV A;  4JGZ A;  1F31 A;  4NOT A;  5JI7 A;  4CPB A;  4RQP B;  1LHN A;  1RTV A;  5HXM A;  2PHU A;  1QJZ A;  3J7H A;  1VBC 1;  3BGA A;  4WM7 B;  4BLI A;  1FOD 2;  4EZH A;  3GCW A;  1RJ7 A;  2XB6 C;  3A7Q A;  5IVJ A;  2I45 A;  1NXM A;  3BPZ A;  1ODN A;  4MUV A;  4XF1 A;  3SQO A;  1KJL A;  4YZ2 A;  5F9T A;  3KHC A;  1TMF 3;  1ENQ A;  3LAG A;  4ZON A;  2WNU C;  4OLL A;  3NMB A;  4QM9 A;  2J1T A;  2UY9 A;  3MDP A;  3MPB A;  1FMD 3;  2JG8 B;  1MEC 2;  2RJK A;  2N7G A;  2WSU A;  5FK7 A;  4AGG A;  4C0H A;  4L2N A;  4ZS2 A;  5T52 A;  5FZK A;  3O1S A;  2JDP A;  4XBQ A;  1NE4 A;  3M3E A;  4E4D X;  3ASI A;  2Y6J A;  3BOW A;  3KV5 A;  2EAA A;  3ZSM A;  5JZG C;  1Q8V A;  2P6H A;  5DQ0 A;  4P5H A;  1HW5 A;  2RS3 2;  5FBJ A;  3KGZ A;  1PNG A;  3C3V A;  2K46 A;  2ZGL A;  5DG2 A;  5F3I A;  4HPK B;  4QQP A;  4A7Y A;  4YM1 A;  1LHW A;  1V70 A;  3SIT A;  3R05 A;  2XON A;  1OLQ A;  3LDB A;  2A6Y A;  3GBW A;  1JU3 A;  3UKT A;  1C4R A;  1CAW A;  2F6B A;  4AYU A;  1IOA A;  4HLT A;  2BU9 A;  4ASM B;  4AVA A;  1N3O A;  4PBP A;  3VDC A;  1A78 A;  1SBF A;  1WLT A;  2EF6 A;  4LK7 A;  1UN1 A;  4AG4 A;  1OXC A;  2D5F A;  1RGS A;  3VZL A;  4OUS A;  5IK4 A;  2WS9 2;  2VCA A;  1PZ7 A;  1LHU A;  5EHD A;  2WZR 3;  4MOA A;  4UFH A;  1OBN A;  2GSY A;  5EFU A;  1YFY A;  5JCT A;  1SLT A;  3HJR A;  2CYF A;  3NKG A;  3LA2 A;  4G3Y C;  3X29 B;  1LOG A;  2ZZJ A;  4JKL A;  5LY1 A;  1HB3 A;  4AVB A;  2FZ2 A;  3HNB M;  1UY1 A;  2ZKN A;  4YG6 A;  4COU A;  4OI0 A;  2ARB A;  1ZBE 3;  4X6Q B;  3V0A A;  3LGR A;  2VU9 A;  1WBL A;  1QDC A;  4ORF A;  4XHX A;  4CDU A;  1GBG A;  2DWR A;  1BYH A;  2K0G A;  3M7A A;  2E53 A;  4QB2 A;  4XBN A;  1GZW B;  3HQX A;  4UF0 A;  1JOJ A;  1KFX L;  2UY8 A;  3FHA A;  1PO1 1;  2E51 A;  3TOJ A;  5JSO A;  2YV8 A;  3B5L B;  4LNV A;  2ES3 A;  2FDI A;  1H9W A;  4QPI C;  1R09 1;  2WWJ A;  3N3H A;  2A3X A;  4Q2F A;  2ZGM A;  1HIX A;  1SBD A;  2RE9 A;  4FPO B;  1ZM1 A;  3KT4 A;  3OGR A;  1ACC A;  3D6E A;  2VNR A;  4IES A;  2ORZ A;  5FY5 A;  2XWB B;  1B35 C;  4CEW A;  4D94 A;  5FZD A;  1CVN A;  1RUE 1;  4XUQ A;  1TQ5 A;  1D2Q A;  3VBS A;  1C8M 2;  2NYY A;  4Q8K A;  4MZU A;  4UAP A;  5IT6 A;  3APB A;  3M3C A;  4YW7 A;  4JZR A;  4BB3 A;  4R9D A;  5FO9 B;  5GAL A;  1Z7S 1;  2VGD A;  4D7S A;  4BQ3 A;  1T2X A;  3UK9 A;  1KEX A;  3P1I A;  4WVV A;  5J36 A;  4IW3 A;  3ZPY A;  2WFF 1;  3WV6 A;  5A3U A;  4XJU A;  1I9R A;  2VQT A;  1S0E A;  2W9X A;  4KI5 M;  2ZGN A;  3GJB A;  1EPW A;  4FI9 A;  3SCG A;  2W87 A;  2HWF 3;  2R07 3;  2VW2 A;  4PIX A;  1B09 A;  2G19 A;  2R16 A;  4M3C A;  5FY1 A;  3AP6 A;  1ND2 A;  2ARX A;  2XL7 A;  4XJ9 A;  5LBB A;  1IS4 A;  4OQ8 A;  2UU8 A;  3S5A A;  3T30 A;  3ZFF B;  2Q4S A;  3IN9 A;  2WAB A;  1CIY A;  1TME 3;  5C8C A;  1DGR A;  4BE3 A;  5J09 A;  2ZJC A;  3IDB B;  3ACG A;  3I7D A;  1BLZ A;  4GIQ A;  3AC0 A;  4QU1 A;  1S0F A;  1DQ4 A;  2CAV A;  5FPZ A;  5J48 A;  1JYX A;  2KXL A;  1EV1 2;  4QDQ A;  1LRH A;  1XC6 A;  1Y7B A;  3AP9 A;  3EHK A;  1PM7 A;  2E9Q A;  5E1R A;  1CAU A;  2D40 A;  3P3N A;  5CIR A;  3WCS A;  4XYX A;  2IVI B;  2ARC A;  1CR7 A;  5FYI A;  1VB4 A;  3AX4 A;  3H0O A;  4DQA A;  4GMP 1;  4IEW A;  1VRH 1;  5F6L B;  2QQU A;  3MW4 A;  4ZXK A;  1GFF 2;  1UXX X;  3O0W A;  2BVV A;  4E2S A;  2WQZ C;  3PUH A;  4YVS A;  4I0B A;  2R0H A;  4Y20 A;  3WNX A;  4ZU5 A;  4LBL A;  4PIY A;  3CF6 E;  3WW1 A;  5LRS A;  5FLJ A;  3ME2 A;  5JMC A;  5L9V A;  3INA A;  3FFQ A;  4D69 A;  3T08 A;  5JPN B;  1G9C A;  2GP3 A;  3JD7 2;  4E4H A;  1SDW A;  1BJQ A;  4BIO A;  1UOB A;  1Y4W A;  3QD6 A;  1PK6 A;  5FLI A;  2VTX J;  2FZ1 A;  4S2D A;  3W58 A;  4QPG B;  1C5I A;  2VOK A;  5AC9 1;  4WZC A;  5ABJ C;  4OUM A;  1FAY A;  5LWB A;  1PO1 3;  4IE5 A;  1X7N A;  2ERF A;  4B4R A;  1CAV A;  1RUH 2;  1QJU 3;  2ZML A;  3NNJ A;  4BME A;  1AL2 2;  2VOV A;  4Z1V A;  1WGP A;  3WG3 A;  3KB5 A;  4MO3 M;  3WP5 A;  3OUJ A;  2JE9 A;  1GZT A;  1PZ8 A;  3VHR A;  1AUY A;  4OUE A;  1XB9 A;  3KCC A;  1UZY A;  5EJ1 B;  2ZX4 A;  1WW4 A;  1KGY A;  3OGJ A;  4GH4 B;  3NJY A;  4YM0 A;  3WW4 A;  1N3P A;  4EQV A;  2FMY A;  4OHZ A;  1UPS A;  2V73 A;  2W1Q A;  1O4Y A;  4AED B;  2BV4 A;  1W2O A;  1Z7S 3;  1ZRR A;  5FPX A;  1KS5 A;  1WA6 X;  4S2H A;  4L11 A;  4CU7 A;  1AR7 1;  2DCY A;  5C9A A;  1NX9 A;  3ZSL A;  1GKB A;  5F3C A;  3WHU A;  3JZV A;  4DRR A;  1S2E A;  4QKN A;  3LSE A;  4FPL A;  1H9P A;  4W6W A;  4P00 B;  5C3R A;  3PNA A;  5DXD A;  1UKG A;  3TEZ A;  4QD2 A;  1F4A A;  1ZZ7 A;  3AL5 A;  3Q8B A;  4G4F A;  3NRU A;  3T09 A;  3VL9 A;  2BER A;  1SPP A;  3E6D A;  4KG8 A;  3RWK X;  5F39 A;  4YVW B;  4OMC A;  5FMD A;  1MS1 A;  4K7J A;  1W2A X;  3KS7 A;  4MYE A;  4Y5T A;  3MO4 A;  2FDH A;  1UZ0 A;  5FZ9 A;  4OHW A;  4C1X A;  3M70 A;  1WCK A;  2R49 A;  2VQ0 A;  1NA1 C;  2HBT A;  5FPV A;  4CE8 A;  5FOJ B;  1S0C A;  1W8O A;  5DMY A;  4I02 A;  3NV3 A;  3ZOI A;  2LUW A;  1TE1 B;  2ET1 A;  1UW8 A;  2HEW F;  2DV9 A;  2P6C A;  3O0X A;  5I8Y A;  3HOB A;  4UW4 A;  5I91 A;  3KF5 A;  1GMM A;  3C2U A;  3R6S A;  4B4P A;  4JKM A;  2FDJ A;  4FAH A;  5KXB A;  2E31 A;  2HWD 2;  3ACI A;  3ZFG B;  4UFI A;  3MZH A;  4PQ9 A;  1AXY A;  3WG1 A;  1ZA4 A;  2JIC A;  4U36 A;  3AKR A;  4E2Q A;  3BI3 A;  2X10 A;  3D0J A;  1HB2 A;  1ASJ 3;  4AFD A;  1ZA7 A;  2A3Y A;  1RUD 3;  1K42 A;  1YI7 A;  2XJR A;  2WA4 A;  4LLO A;  2B42 B;  3T3Y A;  1UNB A;  3L2Y A;  4FBF A;  3O7O A;  4FPG A;  3G6J B;  5BNO B;  4N43 A;  1UWW A;  3USU B;  1NCQ B;  2PYT A;  2EIG A;  4R4X A;  2BPA 2;  2WKK A;  4JGY A;  4BLJ A;  3VBU A;  1AHS A;  4LKF A;  5FUI A;  1SAC A;  3FBM A;  4GKX A;  3HD8 B;  3TB0 A;  1RHI 3;  2PTM A;  1FI2 A;  2HWB 3;  4RS5 A;  1RUJ 1;  3NQH A;  3MIE A;  4FOY A;  3RDI A;  3LE0 A;  5GLT A;  1H8T B;  3MUY 1;  4K3U A;  2VG9 A;  3HN1 A;  2BOI A;  1O5U A;  4B3N A;  1LGN A;  3M8L A;  1E5S A;  2VAU A;  3T2P A;  3DN7 A;  4E2G A;  4M3C F;  4DMI A;  1EY2 A;  5C8W A;  4IXL A;  3WDT A;  2K9Z A;  5A3N A;  4DXR A;  3M1H A;  1IPJ A;  1WD4 A;  1RUG 1;  1V9U 1;  1PO2 1;  1WCQ A;  4YGC A;  1NG0 A;  5JVV A;  3IAQ A;  2IXK A;  4FOQ A;  2QZ3 A;  4XOG A;  2WZR 2;  3AMM A;  4H2A A;  4L9B A;  3K46 A;  3WF4 A;  3I2G A;  4D7Y A;  2VC9 A;  5K9Y A;  2XBO 1;  4PDW C;  2CGN A;  2XLF A;  5FO7 B;  5DAP A;  1X9T A;  3H7J A;  1VMJ A;  1V6M A;  1RUC 1;  3D3A A;  4XFH A;  1VBB 2;  4IQP A;  5J98 B;  2CGP A;  4QWN A;  5K0U C;  4LLF A;  1JYN A;  4IEZ A;  1AR6 2;  1A8D A;  4Q4V 1;  4A7Z A;  3RZG A;  5J37 A;  3OBA A;  5IAV A;  3ZDS A;  1AR9 3;  1R1A 3;  4XJZ A;  2HWC 1;  1UF2 C;  4HVQ A;  3BU0 A;  4XUT A;  3MLJ A;  2WT1 A;  3H9A A;  2C4X A;  1XNC A;  1XOY A;  3E6B A;  2CHH A;  2LAL A;  4ISQ A;  4PJY A;  5I8T A;  2WIN B;  3KF3 A;  4O65 A;  1YFX A;  1XNT A;  3AXE A;  4XC9 A;  3TWI A;  1QH6 A;  5FXX A;  2ZMK A;  1I5P A;  5FY9 A;  2A3W A;  2R04 2;  1CX4 A;  2FCU A;  4B7K A;  2C6S A;  3N9N A;  5LCW L;  2RM2 2;  2W08 A;  1F9K A;  1GSL A;  4RN5 A;  1OOP C;  3BYW A;  4PCR A;  1X33 A;  4KWK A;  1NAE A;  4UFL A;  3FE5 A;  2PHW A;  5KR7 A;  1PVC 2;  1ULF A;  3CHX A;  1UZV A;  1KIT A;  3GNE A;  1PHM A;  4LKE A;  5F8P A;  5A7W A;  5CFC A;  4ASL A;  2YC4 A;  5KHJ A;  1ZRD A;  2R07 2;  5JI9 A;  4BIS A;  1YNA A;  1PGL 1;  2RS1 3;  1W3X A;  1MZ5 A;  1IGO A;  4LE4 A;  1UIK A;  2A70 A;  4C90 A;  5EZW A;  4OFG A;  3URF A;  5FY4 A;  4P9W A;  4QX3 A;  1POV 1;  5DAX A;  4I3G A;  3O1R A;  4A4A A;  3FN9 A;  1H4G A;  3LOI A;  4BPZ A;  3PVN A;  4CSW A;  4Q4X 3;  4MX3 A;  1HRI 1;  3AP5 A;  3WUC A;  2P34 A;  4Z92 B;  1S1A A;  3WNO A;  1S0D A;  2G4I A;  1HKD A;  4AHY A;  1ZRI A;  3J4U H;  3KSC A;  5D8A B;  3KVB A;  1R08 3;  1JHJ A;  1LEC A;  4N53 B;  3ZXF A;  4Z2W A;  2WS9 1;  1CJP A;  2R6Q A;  1UMI A;  4CTE A;  4M3C E;  1W9S A;  4CA9 A;  5EQU A;  1QJX 1;  4COZ A;  2R06 3;  2Y6K A;  2RS5 3;  3U37 A;  4HSJ A;  2BBV A;  1K5M B;  3PVO A;  3KT1 A;  3ZXJ A;  5JZG B;  2VMG A;  1W0N A;  2DVA A;  3ZXE A;  1OH4 A;  1W05 A;  1QDO A;  1RUC 3;  4XFG A;  1DQ5 A;  5FP7 A;  4AHZ A;  1F2N A;  1KJR A;  4LBQ D;  4KBB A;  2EXH A;  4P9X A;  1AR8 2;  3U75 A;  1RMU 3;  2VUD A;  3B7M A;  1HB4 A;  3BIE A;  5IVE A;  3RYK A;  1O6U A;  4I01 A;  2CDP A;  2FDK A;  4CP9 B;  1LR5 A;  1W6O B;  3WQB A;  2RMU 2;  1MVE A;  4NPL A;  5FOB B;  1V6O A;  4FTE A;  1LB2 A;  1QGL A;  2O14 A;  2QQW A;  3WVJ A;  2WO3 A;  3OY8 A;  3LDK A;  4FXG B;  3RYR A;  3GCX A;  4FQZ A;  2CWM A;  1K5J A;  1W39 A;  1I3H A;  4NHM A;  4AL9 A;  3VDD B;  3CEW A;  2JKB A;  2VXR A;  3E5X A;  4LIV A;  3UKN A;  1O7F A;  2BW8 A;  1VBE 3;  3OBR A;  1YIF A;  4N90 A;  2NPI A;  1V6N A;  2ZAA A;  2Q30 A;  2J1S A;  3AMQ A;  4RGG A;  1AYM 3;  2DCT A;  4C0B A;  2IWG B;  1EUT A;  3ALQ A;  3CQO A;  3I2D A;  4LHL A;  1RVF 1;  3OGG A;  4QPG C;  5C5U A;  4CDU C;  1YQC A;  1XE8 A;  3HIF A;  3I3E A;  1UZW A;  2VVD A;  1AX1 A;  1QNY A;  2ZHN A;  3NAP A;  4HMZ A;  4B1L A;  4EWA A;  2R7E B;  1CZS A;  2WJS A;  5BNP A;  1YIP A;  4M0H A;  2JB4 A;  2VME A;  4QPI B;  2XWJ B;  4HSL A;  5LY2 A;  3ZN6 B;  2PFW A;  1GAN A;  2VW1 A;  3SLI A;  5FZ6 A;  5DN2 A;  4IGP A;  1GP5 A;  1YYN A;  3KD4 A;  5FKC A;  4WVZ A;  4H14 A;  1LOD A;  4URA A;  3TN9 2;  1OQ1 A;  2W2I A;  1NLS A;  4HKO A;  1B35 B;  4YW2 A;  4DUV A;  1VBA 2;  3QAC A;  2L9L A;  4QX5 A;  5CNA A;  4D8M A;  2JG9 A;  4Q4W 1;  5A3T A;  1DYO A;  1HN0 A;  2VJX A;  1E5H A;  5I0T A;  4CP0 A;  1NXD 1;  1POV 3;  2J1R A;  2YBK A;  2WLP A;  4MHR A;  4XF9 A;  1EV1 1;  5DAB A;  3WR0 A;  3SHR A;  1XSQ A;  2P3K A;  3QBQ A;  4EE2 A;  3V0B A;  1HRI 3;  3VZO A;  2PN5 A;  3VBR B;  5FZ7 A;  3AZW A;  1OMI A;  4NHY A;  1W0O A;  5LBC A;  4PBO A;  1CAX A;  3HEI A;  2P3J A;  5FYY A;  5FY8 A;  1AJK A;  2XGX A;  3S6P A;  1JYV A;  1RUD 2;  1RB8 G;  1DZR A;  3ETP A;  1QJX 3;  4B4Q A;  1LOC A;  2OKX A;  1WLW A;  4V2V A;  1KFU L;  1WMD A;  4LHK A;  5FXZ A;  5LBF A;  4RHV 2;  2DYC A;  2VPV A;  3I2H A;  4PQQ A;  4NIH A;  3OB8 A;  1AX0 A;  5JSR A;  4D6S A;  5JPM B;  3GAL A;  4XUR A;  5A80 A;  1UXZ A;  3ZXG A;  3JD7 1;  3B93 A;  4AI0 A;  5IVF A;  3T2T A;  2Z69 A;  5A33 B;  5C8C C;  4KU7 A;  4PI0 A;  1FNZ A;  2Y6H A;  3VKL A;  1YXW A;  3GF6 A;  1LOF C;  1SZB A;  2ILM A;  4DOU A;  1G86 A;  3SH3 A;  3KLS A;  2DFB A;  2UUR A;  5JOZ A;  2B9U A;  4OZX A;  3ZFG C;  4TZD A;  2ZX0 A;  4YM3 A;  2ZTN A;  3Q8C A;  1HXS 3;  2H0B A;  3JXS A;  4CDX A;  4Z8B A;  2VVF A;  4CDQ A;  4A2U A;  2VZQ A;  1F4H A;  3B94 A;  2CDO A;  3LDR A;  3OSD A;  4FPY A;  5T5O A;  5IVC A;  2E6V A;  1RIN A; 
#chains in the Genus database with same CATH homology
 3MBW A;  4YPJ A;  4MGQ A;  2ID4 A;  3BN6 A;  2XON A;  3SEE A;  2VTF A;  1JU3 A;  2JE8 A;  3IB3 A;  2VZS A;  5LA1 A;  2J22 A;  3VDC A;  2V5D A;  1W9T A;  3WF2 A;  4AG4 A;  1GNY A;  2VCA A;  2HLE A;  4MOA A;  2X05 A;  1PX3 A;  2W94 A;  3A23 A;  3CDZ B;  3HJR A;  1K3I A;  4JKL A;  5JXH A;  3I2K A;  5F7U A;  3HNB M;  1UY1 A;  5CYY A;  4UOJ A;  5G04 L;  1O8P A;  3K4D A;  4QB2 A;  1TG7 A;  3OGS A;  3FHA A;  1XPW A;  3WNM A;  4AAX A;  1LNS A;  1UMH A;  4GWJ A;  1K12 A;  2W95 A;  4QB1 A;  2B4K A;  1UY0 A;  2VL4 A;  2EIB A;  3OGR A;  1PMH X;  2ORZ A;  1J84 A;  4QDS A;  3NJX A;  4M4P A;  4XUQ A;  3I2I A;  4UAP A;  1TVG A;  2XQX A;  1T2X A;  3K75 B;  5G05 L;  1OT5 A;  1KEX A;  5EJZ B;  3ACH A;  1JZ7 A;  3P1I A;  3I2F A;  2ZEZ A;  2VQT A;  2W9X A;  3HNY M;  4KI5 M;  4FI9 A;  4ZZ5 A;  2QQK A;  5C7G A;  1OD3 A;  2W87 A;  3DYM A;  4CUB A;  1O59 A;  4JKK A;  2LS6 A;  4DEQ A;  2EIC A;  5HPO A;  4QX2 A;  2RVA A;  3VDB A;  3C7G A;  1JYW A;  2WAB A;  1CIY A;  1GOF A;  4DEV A;  4CUC A;  2WN3 A;  3ACG A;  3T0A A;  3VD4 A;  3AC0 A;  3FHQ A;  2X09 A;  1JYX A;  2ZEW A;  4MAD A;  1DP0 A;  4QDQ A;  1XC6 A;  2BGP A;  2E32 A;  4DUX A;  3ACF A;  4CU9 A;  3GM8 A;  3OGV A;  1CZT A;  3ABZ A;  1UXX X;  2DCJ A;  5IFP A;  3PUH A;  3C7E A;  5DPN A;  4ZZ8 A;  2WBK A;  2VQU A;  5JR2 A;  2QQL A;  5B4X A;  3T08 A;  3T2Q A;  5JMO A;  2BGO A;  3CKH A;  3NJV A;  4A42 A;  4HG6 B;  2YB7 A;  2W3J A;  4E8C A;  2QQI A;  2J7M A;  4ET7 A;  4E8D A;  2W5F A;  1NUK A;  5CZK A;  2ZEY A;  4RYD A;  4P5Y A;  3GDB A;  1MPX A;  4QAW A;  3A21 A;  4MO3 M;  4GWI A;  4OUE A;  5EJ1 B;  1JZ4 A;  1KGY A;  2VMD A;  1SHW B;  2W1Q A;  3CMG A;  3HNM A;  5JXI A;  4P02 B;  2C26 A;  4D0Q A;  2XHN A;  2VZ1 A;  2QQN A;  4CU7 A;  1NX9 A;  3DYO A;  1H6Y A;  1US3 A;  3VD7 A;  3A22 A;  2ORX A;  3LQC A;  4P00 B;  1F4A A;  4CVU A;  3NRU A;  3T09 A;  1GOG A;  3LPG A;  2BER A;  4CU8 A;  1PX4 A;  1JZ6 A;  2E33 A;  5JUV A;  4OMC A;  4Z2A A;  3VD5 A;  1PMJ X;  3MO4 A;  3ECQ A;  1UZ0 A;  1US2 A;  4LKS A;  3F2Z A;  3P6B A;  1UYX A;  2VR4 A;  3HPN A;  3DEC A;  5DMY A;  1JU4 A;  1W8O A;  2B9V A;  3IDA A;  4A44 A;  3HOB A;  5IFT A;  2WO2 A;  1GMM A;  3WNN A;  4KMQ A;  4JKM A;  3EB7 A;  2E31 A;  3ACI A;  3WEZ A;  4UI9 L;  2ZEX A;  1JZ2 A;  3THC A;  5LA0 A;  2W1W A;  2X10 A;  4ARX A;  2W92 A;  2BZD A;  3MV1 1;  2JD9 A;  3T2O A;  3UES A;  2KD7 A;  4TTG A;  4LPL A;  1DLC A;  2W47 A;  1K42 A;  5A1A A;  2V4V A;  4BK4 A;  3OEB A;  1O8S A;  1UWW A;  2WAO A;  2C9K A;  1WKY A;  1JI6 A;  3CZJ A;  5FUI A;  3VD3 A;  2J1V A;  2J1A A;  3NQH A;  3LE0 A;  4LQR A;  3UET A;  4XUN A;  3I3B A;  3MUY 1;  3C7H A;  2J1E A;  3T2P A;  1GU3 A;  2VZ3 A;  3OG2 A;  2W1U A;  4W4Z A;  4DXR A;  3C7F A;  3I3D A;  5I0D A;  5JXG A;  3W5N A;  4A45 A;  4XZU G;  1WCQ A;  4XVH A;  1CX1 A;  3UNP A;  3CIH A;  3IAQ A;  1W9W A;  3MV0 1;  1GUI A;  2EID A;  3K46 A;  4M4R A;  3WF4 A;  3I2G A;  3K4Z A;  2VZP A;  2WZE A;  1ULO A;  2VC9 A;  3WF0 A;  3IAP A;  2VMF A;  3EYP A;  3LEG A;  2YG0 A;  1UY4 A;  3I97 A;  3D3A A;  2Y64 A;  3MUZ 1;  4W8J A;  3T0D A;  2JDA A;  2VM9 A;  1NKG A;  3FL7 A;  4BJ0 A;  1JYN A;  2ZXQ A;  2E26 A;  1J83 A;  3OBA A;  4QPW A;  4DXT A;  2WZ8 A;  4MGS A;  1GQP A;  5JXJ A;  4XUT A;  1GOH A;  2C4X A;  3THD A;  3VDA A;  1XNT A;  3GGL A;  1I5P A;  1IQD C;  2VCB A;  4A6O A;  3K77 A;  2HYX A;  5LCW L;  4RN5 A;  2WYS A;  1NAE A;  5IJR A;  5EIY B;  4ARY A;  1UYZ A;  2WUH A;  1D7P M;  1UY2 A;  2YC4 A;  3SKJ E;  2YFZ A;  1OF4 A;  4PT6 A;  4TXW A;  3ZM8 A;  1EUU A;  2VZR A;  4QX0 A;  4PF1 A;  3SEP A;  1SG3 A;  4QX3 A;  1JZ5 A;  4A4A A;  3FN9 A;  3LEK A;  2QBX A;  2VO5 A;  3C8X A;  4IUG A;  3WNO A;  2Z4F A;  2QQO A;  2YC2 A;  3C7O A;  4JHZ A;  5B4N A;  2QQM A;  2W1S A;  1JHJ A;  3T0B A;  2VZO A;  1ULP A;  4JX0 A;  1JZ3 A;  1UMI A;  1W9S A;  2VZV A;  1UY3 A;  2Y6K A;  3U37 A;  4KWU A;  2Y8K A;  1W0N A;  3WNP A;  1W99 A;  1OH4 A;  3CZU A;  2BBA A;  1L7R A;  3DYP A;  4L0P A;  2Y6L A;  2WQ8 A;  4XUP A;  2WDB A;  2CDP A;  1JZ8 A;  3WQB A;  4QB6 A;  2J1U A;  3GXU A;  2WO3 A;  3OEA A;  1UYY A;  4OZO A;  2RJ2 A;  1CZV A;  3NNG A;  5IYY A;  2DDU A;  3WF3 A;  2QQJ A;  1HN1 A;  4QDR A;  2J1S A;  3E1F 1;  1BHG A;  1EUT A;  2VOT A;  2YFU A;  3CQO A;  4CU6 A;  3VD9 A;  2PQS A;  3I3E A;  3WNK A;  3WSO A;  3K4A A;  2Y6G A;  2R7E B;  1CZS A;  4QX1 A;  1R64 A;  2VME A;  3SKV A;  1H6X A;  2W46 A;  5LA2 A;  4BK5 A;  5C70 A;  2EIE A;  2WAA A;  5DN2 A;  4A3Z A;  2W91 A;  2VZU A;  4GZ9 A;  4DUV A;  1OF3 A;  2L9L A;  1XNA A;  4D8M A;  1DYO A;  3WF1 A;  4A41 A;  2VJX A;  4OMD A;  2J1R A;  3LPF A;  4LHS A;  2XOM A;  1RYY A;  5J1X A;  3PUI A;  2LW8 A;  4BXS V;  4W50 A;  3LEI A;  4ZXE A;  1L7Q A;  3W5M A;  4DXS A;  1SDD B;  2VMC A;  3HEI A;  5C71 A;  4ZY9 A;  1UX7 A;  1YQ2 A;  2VZT A;  1JYV A;  3WNL A;  3ETP A;  2OKX A;  3III A;  5HXM A;  5IHR A;  3J7H A;  3BGA A;  2VCC A;  1K45 A;  3I2H A;  4OYU A;  4PQQ A;  3OB8 A;  4XUO A;  2JKX A;  3A7Q A;  4XUR A;  1P8J A;  1UXZ A;  2RV9 A;  2WO1 A;  2Y6H A;  4DUW A;  4CUA A;  4P08 A;  2J1T A;  2DCK A;  2WN2 A;  3I2J A;  1W8N A;  4BDV B;  3JXS A;  2V72 A;  2VZQ A;  1F4H A;  2Y6J A;  2CDO A;  3HN3 A;  5DQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...