4LKDA

Crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-qrs at 2.31 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title Structure-Based Optimization of the Terminal Tripeptide in Glycopeptide Dendrimer Inhibitors of Pseudomonas aeruginosa Biofilms Targeting LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein/inhibitor
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lkdA00
1GWLA 1W8UA 2LRPA 2Q1FA 4CP9B 1WZXA 3ZYBA 1WCUA 4LJHA 4LKDA 4BQ4A 4BQ2A 2WYFA 1W8WA 1WMXA 2K46A 1W8ZA 2VXJA 4AL9A 2C24A 2O14A 1V0AA 5D21A 1W8TA 4LKFA 3UT0A 4BQ3A 2LROA 1GWKA 4LK6A 1W90A 3ZYFA 4A6SA 4YWAA 4LK7A 4BQ5A 4LKEA 1OH3A 3ZYHA 2KR2A 1GWMA 2JWPA 1L7LA 1HN0A 4YW6A 4CPBA 4YW7A 4CP9A 1OKOA 1W9FA 3ORJA 1UOJA 4CPBD 3F95A
chains in the Genus database with same CATH superfamily
4ARYA 4R9AA 1LHNA 3ON7A 1ZBA2 1W04A 3AM2A 4AW7A 3OGJA 5FY7A 5DDJ1 4I30A 4FO9A 3RG0A 4Z2AA 5E89A 3ZN5A 3R6SA 4RA0A 2TUNA 3AMHA 2XWBB 2OZJA 3N7LA 3G6JB 1RUE1 2LW8A 3ZVXA 3V64A 1XNBA 5FBZA 4CP1A 1PK6C 1IQAA 5ABJC 3MIHA 5KXEA 1W9YA 3MFAA 4Q4Y2 5E88A 2D43A 3NNJA 3CDZB 1NCRC 1UZZA 4PBPA 4QQPA 2W1UA 5KC5A 2BVVA 3CLPA 5B4NA 3OYWB 5F5IA 4CCEA 5FZ3A 4XE9A 1QJY1 4YYOA 1FV2A 5A7QA 3HQXA 4CZSA 1ENSA 1JH5A 5GLWA 1NE6A 1NKGA 3CU7A 3C7OA 4LR4A 5ERLA 5FMBA 4EE2A 4FTSA 2VULA 4AFBA 5LEJA 1LEMA 3E6BA 3G7DA 3SNMA 1PMHX 3DUIA 2Y60A 1UKRA 3LCPA 4KU7A 1CIYA 4D69A 5F7UA 4JRLA 3HT2A 4WVMA 3VBRC 5FY5A 2R30A 3VBFB 4JKLA 3X29B 3DYPA 3ZLIA 2VUCA 4GMP1 2RJ2A 1JZ4A 4FPEA 3LQCA 1K5JA 2AR6A 2XXZA 5F5CA 3B02A 5F6KA 4GJYA 1AX0A 2AZ5A 1AL22 3LPGA 3NW4A 4B29A 1W6MB 3P6BA 1YCIA 2VZSA 2P1BA 1Q8VA 1HRV1 3LEGA 5LK7B 4BIOA 2ZHNA 2BFUL 1YQ6A 2WDBA 1D4M1 4FQZA 3EMRA 1TMF1 3D3AA 1MZ6A 5BNNB 1G8WA 1GQGA 3I2HA 4AFMA 1AYM1 4CUAA 1JMUB 3PU8A 3RZGA 3UJOA 5FYHA 1RHI2 2ZX0A 3NV4A 1KDMA 2W87A 2YBKA 3UNPA 3S7IA 5A1FA 2WZR1 2Y6HA 2ZZQA 1U5XA 5FY8A 1BLZA 4ISQA 1YO8A 2QKDA 4QX2A 4UFMA 3WR0A 2FDFA 4E2GA 1GMMA 1W39A 4GKYA 2RS33 4N90A 4BXFA 5JSRA 4JZRA 4QX5A 2BQPA 1FX5A 4NPRA 1W06A 3RWKX 4Y5Z0 2IXIA 4CU6A 3BKZA 1HV0A 3ES4A 1LHWA 3IMNA 5FYTA 4ZONA 3GHMA 3HR9A 1WMDA 2ZGKA 1W8ZA 5DAQA 1U12A 4AVSA 1OUSA 1SCSA 1G9FA 3RZKA 1AUYA 1CD3G 5D21A 5F3GA 2V09A 3NJXA 4NRPA 2UURA 1FXZA 5FPLA 2XGXA 2N7GA 1VRH1 2FCTA 3I59A 1CPNA 3HN3A 3VBSA 1DGLA 1Z78A 5D8AB 4BU2A 4BK5A 4NAOA 3M3QA 1Q8OA 2VVFA 4H14A 2XQRA 1SBFA 4CPBA 1UOGA 2Q1MA 1J1LA 4P9XA 2VG9A 1YI7A 3I2KA 3KF5A 4GWIA 5L36A 4QPIA 1QJX1 3D4KA 2P5BA 4H3WA 1OQ1A 4GWMA 4K8RB 3PLQA 2VMGA 4LOTA 3U1XA 4M4RA 2ZGNA 3VGIA 1D7PM 3PMSA 2WS92 2NQYA 5A7NA 3TEWA 3ZN6B 1EPZA 2RJKA 3WQ1A 2MEV2 2LROA 3OGSA 3TEYA 2JG9C 2G4IA 2ORZA 2VAUA 5EWSA 3KGLA 5I0RA 3ATGA 3MIFA 3VDAA 1UOBA 2W3JA 5DUVA 1CR7A 3KZ4C 5K8SA 4FPKA 2DVGA 4XJAA 3ZMNA 4GH4B 3B94A 1QXRA 5EIYB 1BBT1 2CYFA 5AVPA 5F32A 2JX9A 4YZ1A 3IZOA 2DTWA 2OKXA 4FFHA 2IXKA 2BEOA 1FT9A 3DPRA 4KNCA 2LM3A 4QDSA 4Z1VA 1GOFA 1SDWA 2XJVA 3HAGA 5T50A 1NXD1 1EUUA 2A1XA 3P5BA 1SEFA 2HWD3 2X5IC 4LHSA 5CVRA 2BV4A 5FY4A 5LB6A 1AXYA 4EZ4A 3BTYA 4P9YA 4CDQA 2DBIA 2HBUA 4HSJA 5A6ZA 4HSLA 4EZHA 4N7UA 4YGDA 4QWNA 1EYBA 4BH9A 2W94A 2YUEA 5LWBA 4CXWA 1WW5A 2H0VA 1DDLA 2PLV3 4IXLA 3NMBA 2EIBA 4YGBA 3IDCB 4HK9A 2E51A 4NWVA 4RR3A 3H9AA 4W6XA 5DPNA 3RGBA 1LAJA 4I01A 2BUKA 2ZTNA 2AGSA 3M3EA 5CKMA 1LOAA 5KHHA 3J7HA 4CRQA 2JE8A 3LEKA 2VZUA 2OXBA 2WC2A 3JZVA 1QJX2 3OPTA 3ZFFB 4BQ3A 2DYCA 3H3ZA 3AMQA 3J9SA 4LEJA 2BNOA 2Y0OA 3I3EA 4AVAA 2P3IA 4IETA 2WZ8A 2YU2A 2PHDA 3R0RA 1RUC3 1H2KA 1YEWA 5JVVA 1NYWA 3B69A 4Q4W1 2P3YA 1HQNA 1VAVA 5JDBA 5FP3A 1LB2A 2LALA 2ET7A 3QH7A 2FDHA 1VP6A 5CG8A 1HJGA 3H1WA 2ZMKA 4RQPA 2R49A 4JHTA 3WEZA 5C3RA 4L2NA 1DGRA 2VOKA 2GALA 3HPNA 4PDWC 5A6QA 5KWRA 1RUOA 4RGGA 2Y6JA 3WDYA 2HWB3 5HCFA 1H2LA 1S2KA 4AFAA 1AR92 4P02B 1OFSA 1DQ5A 4B4PA 3SLIA 3AMPA 3AL6A 4P9GA 5GM0A 3C7FA 1RUF3 3LZZA 4Y1UA 1IS3A 2X8KA 1DGWA 1EAH2 1RMU1 4ZKTB 4H7LA 1MEC1 5EPAA 1LOFA 1OPOA 2RS12 3AC0A 4OHXA 4CCKA 2YGMA 3B9IA 4E2QA 4NR1A 1HXS1 1YI9A 3TB0A 2NM1A 1VR3A 3OOXA 1OA3A 2HYXA 4AAXA 4QMAA 2XJSA 4WM8B 3TNPB 4A45A 4S2HA 1XYPA 3NQHA 3ALQA 1H2MA 3ILRA 5ANNA 4MGZE 1LGCA 1LULA 3IWZA 2HBTA 1LTEA 2IXHA 1UAIA 5EJ3A 1B35B 3GBGA 5DAXA 5FZGA 5LATA 3VHRA 1GICA 5IYYA 4NIIA 5FLJA 1UU5A 4A3XA 1JZ6A 1UZVA 1Y9GA 2QQLA 1FPN3 1MQTC 1H9PA 2GP5A 3MPBA 2AYHA 4HL0A 1L7LA 4OUMA 3RMYA 4QQLA 1X36A 3OYWA 3DGTA 3NKTA 2B8MA 4JDNA 4YW5A 1O91A 3A23A 4Q0UA 5JPNB 5KXDA 3HWJA 4OQ9A 3OD0A 4AVTA 3AYCA 4I0BA 3LIGA 1T6GC 1W8UA 4CEWC 4IV1A 1VPHA 4AGGA 3WF0A 3BIWE 3WVJA 3DKWA 1W0OA 5JZGB 4Y22B 4LPLA 2FDIA 2EAAA 3APBA 1XQNA 4PHZA 3VBFA 1G9CA 1RUH1 5CKNA 1J59A 3VHPA 3W20A 1D2QA 1F5JA 3KVAA 5M0TA 4LO8A 1O3SA 3BOWA 2VOWA 3S30A 2Q5TA 3OGVA 1G6NA 1BEV2 3VDDB 4YZ2A 2WQ4A 1SACA 1KJRA 4XABA 1GBGA 2PTMA 4XAAA 1HB2A 1W6MA 3IKWA 4EROA 2Y6GA 5JLVA 2RR13 5IFTA 4BQ1A 1ZRDA 1OOPC 3BPSA 1OC1A 4O61A 3NAPC 2R061 3AZZA 3CKHA 3NV2A 5DDJ3 4MXVA 5FMDA 5F37A 1LGBA 3QACA 4ASMB 4JAAA 1X8EA 5FUNA 5LA9A 2ZOEB 2XVGA 1RL3A 1UMZA 4QPYA 4S2FA 1ZREA 2AREA 3PU3A 3PIJA 4E8DA 3GBWA 2Q4SA 2A6ZA 2BYVE 1SBDA 1RUE3 1UWWA 2VUAA 3ECQA 2XPJA 1PIV1 2ES3A 3KV9A 4XETA 2K0GA 3ZSJA 3OGGA 1JI6A 4IEZA 2BWCA 2Q0AA 4NN0A 4SBVA 4EN9B 2ZAHA 2P4EA 4DUVA 1IS5A 3OBRA 4DB5A 4NIDA 3EQEA 2R0FA 4RHV2 3ZSLA 1U5YA 1RUI2 2GNDA 2I45A 4AEDB 4DRRA 2AEZA 1QJY3 4AQ2A 2XB6C 4GXLA 1QJEA 1L7RA 1OUXA 2ILMA 3T30A 4Z2WA 4ZZ8A 4D0QA 2PHWA 1LNSA 2BP6A 1X50A 1RC6A 1WBLA 3MUY1 3P3PA 5DUWA 5F39A 1VBA1 3T08A 1C8M1 1REEA 4D94A 1QHDA 4UFHA 5D8AA 3FWEA 3ZFEC 2HJIA 2C26A 3AKRA 1OXCA 3THTA 4BLJA 1IS6A 1S0BA 3NJYA 4LBLA 1UX6A 3C8XA 1W03A 3KCXA 2VOXA 4PLMA 5FOJB 1VRBA 2W46A 3HD8B 2YPDA 4AOCA 5JOYA 1AR73 3LIHA 3O0WA 2W1WA 4LMFA 5IAVA 5LK5A 5A3NA 2D97A 1IS4A 2OPKA 2RMU2 3HOBA 1HRV3 1Z7S1 1H2NA 5JXGA 3A7QA 1KS4A 4INDA 4URTA 3ZN6A 5C8CA 1D4M3 4DIQA 5LBEA 5LZ6A 1RUNA 1BKZA 2EXIA 1TMF3 3VD7A 3K2OA 3W5MA 1C1FA 5EQUA 1AYM3 2GC3A 1SG3A 2VR4A 3AKQA 3AYEA 1W2AX 2RDRA 5CFDC 3JB8A 4AVCA 4IUGA 2WZR3 4IEPA 4DS0A 4GH4A 1UY3A 1O3RA 1K5MC 4YVSB 4UW6A 2DVDA 2PAKA 1PVC2 3ZFGC 3FBMA 1SDDB 1DLCA 2RDNA 1NE4A 4N8MA 5JOWA 4I0AA 4KG8A 5IW0A 1PIV2 4ES9A 2E63A 2WWSA 1CESA 1PZ9A 5A7WB 5C4WA 4UFKA 3I2OA 1HRI2 4NRQA 4CUCA 3Q8EA 2BVBA 2SBAA 3WSOA 3BIEA 1C3HA 4P9JA 1OPMA 2YBPA 3K4ZA 3ZDVA 1W9WA 2CGOA 2W9XA 5IFPA 4MADA 1JXNA 4E4ZA 4FPFA 5IJRA 3IPVB 3NSTA 1VRH3 3WNOA 3NO8A 1JTZX 1LOCA 3UT0A 5AC92 3O1PA 3ZSKA 1ULFA 2XBO2 4BIFA 5KXBA 1AYN1 3DCQA 4QGNA 5CKQA 5CB7A 2ADEA 3LEIA 3I3QA 1O3QA 1JYWA 3LFIA 3FFQA 4FXGB 1MS1A 5D2AA 2FHRA 1QJX3 4WBBA 5L73A 4XQDA 2JDPA 1NCQA 1O59A 3H50A 1NA1C 2OQ7A 5T5PA 5FZDA 4XJWA 1LGNA 5IVFA 2W5FA 5JIAA 3ZFFA 5F3EA 3LA7A 2WQZC 5A6YA 2H0BA 2WL1A 4MHUA 1NCRB 3CZJA 3O1OA 4IEQA 2EICA 1W6PB 1UN1A 2CAUA 1HQLA 5F2WA 1O4ZA 2XLGA 5JOXA 4JDOA 4CEYC 1QEXA 2H6CA 1XPWA 3ASIA 3CO2A 4ONUA 3U78A 4EQVA 1HQWA 2BFUS 2VUJA 3T2OA 3SH4A 5BNOC 2R1DA 1BBT3 4XDQA 4A3ZA 4OLLA 3RYRA 1QOTA 4O7XA 2ZGOA 1V6NA 1S2EA 1XNDA 1US3A 1BMV1 3E5XA 3VBRB 4LO6B 5FPXA 1APNA 1I5ZA 3T0AA 4E8CA 1SZBA 5HPOA 1OBNA 4FOVA 5FZMA 3CBNA 4LKDA 1UCXA 4D7YA 4DMIA 3FL7A 1N47A 2VBDA 1DG6A 4WVWA 2JE9A 3RZLA 2QQOA 5D1IA 2TEPA 4EV0A 1SLTA 2XVKA 3ZYFA 4AHWA 3WP3A 5FXWA 1SFPA 1W6OB 2FCVA 2Z4FA 5DXDA 1I6XA 4RGKA 4CCDA 3LFMA 4HONA 3U4XA 1GNZA 2DURA 4YPJA 5IK4A 1A3KA 2V5YA 3UV9A 1NLSA 3FHAA 3POSA 1E5IA 4FAHA 4B4RA 4E4SA 1SQ4A 2QQIA 5FPZA 2D3RA 4M0NA 5C5TA 1V6IA 5F5QA 1O5UA 5BNPA 1O7FA 2A6XA 3PUQA 1CWPA 4KL1A 1GZTA 2LUWA 5J48A 2RS32 3J26N 4KGQA 3Q8CA 1N3QA 3NWKA 3KT1A 4K21A 3HNMA 4Q2FA 5F8PA 3B00A 4Q4W3 1J3PA 2XLAA 3CMGA 2HWC1 3H7JA 2J1RA 4FOQA 5E1RA 1XNCA 3OGRA 3V0BB 4HOOA 3PUAA 1YFUA 3VBSB 5A3MA 2F4LA 3JUUA 4L0PA 1JZ5A 1ULOA 3GZTB 5JZGA 4J1XA 3SKVA 3KT7A 2VZTA 3KF3A 1RUD1 3M1HA 2OT7A 3E6CC 2VU9A 4K20A 2WNVA 4QPIB 2XR4A 2JB4A 3VDDA 1JZ8A 1JYIA 2GMEA 2PQQA 2VY0A 5FBJA 2VTXJ 4QU1A 5CNAA 3RNSA 4YWAA 3ZXEA 5F3IA 1JBCA 1RMU3 1MEC3 1RIRA 1UY0A 1UNBA 2JXAA 2PMWB 1ZRFA 2B4KA 2V73A 3CJIC 1HN0A 1HXS3 2CNAA 2JG9B 4CSWA 2WZEA 3AVRA 1YQ8A 5LA1A 2R6QA 4FTBA 2BU9A 3AJYA 1SPPB 1YUDA 4META 5GZCA 1G9AA 1DGWX 4B8EA 4WZFA 3AKSA 5K9YA 2JDKA 4IE5A 1WMXA 2WN2A 2P3KA 5LBFA 3ZXKA 2ZKNA 4M00A 2X09A 2WRAA 3N7KA 1HIXA 1PMJX 4EJRA 4GMP0 3OTFA 1IG3A 2WA4A 3I2GA 3K48A 3DPRB 1ENRA 1V9U1 4HFSA 4ISRA 1MZEA 1ND2C 2HYKA 4RFT0 4V1PA 1YQ5A 3M70A 2YB7A 4AEDA 2BRTA 3VL9A 3H0OA 2WT1A 3UYJA 3A21A 4QQHA 3CL1A 1BVVA 4TSVA 4Y4RA 4FBFA 2WYSA 2VNVA 1C5HA 2X5IB 2G9FA 1UIKA 3OBAA 4QPGA 4CDQB 3USUA 5A6XA 1WLDA 3EHKA 3GGLA 3TBDA 1UOFA 2HWD2 3U14A 1OLMA 4LBQD 5I91A 1C28A 1V6KA 2PHRA 5FAXA 5A3UA 2W92A 1LHVA 1BXHA 1LEDA 1RUH3 3ZKYA 3D5OA 2VNRA 5FP8A 3IDBB 3VZLA 4QKDA 1OQDA 4RR3B 1MPXA 3MLLA 3GDBA 3OCPA 1CAUB 4XPVA 1A8MA 2XH6A 1EY2A 2DVAA 4JDMA 4XUPA 3WUCA 2YFUA 1FYUA 2PLV2 4OI4A 3K4DA 5A3OA 3ZYRA 1OHFA 2D98A 5LCWL 4CYDA 3GNEA 4N9IA 2WT0A 2R063 2NYYA 4GWNA 4JX0A 4OVEA 2CSGA 3L2HA 3WP4A 1CZSA 5A70A 4COUA 1H8VA 1W6NB 2C4XA 2JDAA 3VKFC 4XMAA 2QVSB 3U11A 2XJQA 4KU8A 2A3XA 4AQ6A 4MSVA 4XEZA 1SLCA 1YQCA 4O9GA 5J98B 4A7KA 2D6LX 3BTZA 4FPYA 3EJKA 1LHOA 4Q4V1 3GALA 1VB4A 1KQRA 2OPWA 1Q56A 4FI9A 2UY9A 5F6LB 3ZYPA 4EN7B 1TNFA 2ZGQA 4PF5A 5AVAA 4IEXA 1LOEA 3I97A 5CU1A 2Y38A 4YGEA 2GAUA 3BVCA 3WD5A 1J84A 1VMJA 2JE7A 3I4IA 4GALA 3RMXA 1OSGA 4Y26A 4YVWC 5FZCA 1Q43A 3RRDA 3VZOA 1Y4WA 1OD5A 1WW7A 4LKEA 4A2UA 1VAMA 5A7WA 3O7OA 2YDEA 5GKAC 2ZGUA 2BPA2 4BDVB 2VQTA 1F2NA 2YMZA 4W6WA 1YHFA 3GYDA 5EP9A 5JMOA 2HWB2 2VBPA 4UT5A 1QXJA 2X53S 3UKNA 1XE7A 1DQ4A 4KQ7A 1QQP1 1VBA3 2WNUC 2QQVA 1C8M3 1JYCA 1KFXL 3IPVA 5FYZA 4A7ZA 3P3NA 5L9BA 2Y0IA 1RUF2 3WQBA 1YFXA 4CTEA 3HBZA 3LDRA 4CXYA 4BCUA 3C7GA 3QH6A 4XBLA 3EYPA 5HV0A 5FRAA 4HK8A 2D3PA 2HWE1 3MDPA 4LE4A 3CHXA 2DCKA 3OPZA 3ACFA 2R071 4KMQA 2GDFA 1SCRA 1WD4A 1ZRIA 2HKXA 5FV3A 1JUHA 1YYNA 1PK6A 2EALA 3VBHC 5ABJA 4CA9A 1Z7S3 2W39A 3H3UA 5KHKA 5FY9A 5JXIA 1QIQA 1NCRA 3HBKA 4UF0B 1MQTB 1RXGA 1PX4A 2AC1A 2CV6A 1VE0A 2K9ZA 1W6PA 2O8OA 3PVBB 4L8QA 3T2PA 4WZCA 5CG9A 3MIDA 5LRRA 2X05A 1GR3A 3GBFA 4BQ2A 4B1MA 4XFFA 2R0HA 2QUOA 1FPN2 1HJFA 1AR61 2GU9A 3AMNA 4IV1B 4CEWB 1IGOA 1DHKB 4M01A 1AX1A 3FUOA 3MIBA 1BYHA 1VALA 2XONA 1HB4A 1DYPA 4R4XA 5FYVA 3EXUA 3VBRA 1H8TC 2FMDA 4NHMA 1H4GA 5A3TA 3T4VA 1BHGA 2XMLA 4JVAA 4R52A 2D44A 1YFYA 1KFUL 2ZGPA 4UWDA 1A6CA 1AR71 1IKQA 4A6OA 5FREA 2D40A 2PHXA 2Q1FA 2E7AA 3U0ZA 5HCHA 4QGLA 3ZX7A 3GZAA 2JKXA 4IEWA 2YGLA 5IVCA 1DZQA 1QNWA 1ZZCA 1CPMA 1YLLA 4LUMA 4XACA 5FPVA 1CX1A 2OUJA 4R9DA 4XVHA 5CIRA 5EJ1B 2C24A 3N35A 1K45A 1W6OA 4D6SA 1AYN3 2EAKA 1MS3A 2RR12 4SLIA 2QQMA 1STMA 1S0FA 2J22A 1QQP2 2RHPA 4LK6A 1X82A 1GZ9A 3WF1A 2XKPA 4JTOA 1RYYA 2XDVA 5DDJ2 3WP5A 1J58A 4AEKA 1VBE1 1ULEA 3K46A 2EXHA 4NO4A 4M3CE 4D3WA 3SCHA 3AZYA 3SH5A 4QD2A 4ZXEA 4KWUA 1VBB1 4XOGA 1TVGA 3LOIA 2W47A 1RUE2 4AGRA 4DY3A 2QCSB 2FDGA 5SV8A 3J8F1 3FX3A 3ZO0B 1R64A 1N1YA 4JGYC 4KWLA 1O4YA 3VLBB 2R043 5TSWA 4BYYA 1NY71 3VDBA 1QJZA 1JOPA 5GLVA 1DGRN 4I3PA 1OA2A 4XIKA 3URFA 1SLBA 4BOWA 3MZHA 3VKMA 2ZPXA 4Q0VA 1IPKA 1NXMA 1QJY2 3V0BA 3KM5A 2PQSA 2HLEA 2VZ1A 3U75A 1PGL1 4FQ4A 4NPMA 3ZFEB 4C8DA 4UW4A 4AI2A 1UXXX 2ZEWA 3RZJA 3S6PA 2ZHKA 5FZ1A 3ENRA 3THCA 2XJRA 3MLJA 4H2AA 5DN2A 1FOD1 1WLWA 3WF2A 2VCCA 3WCSA 5FOBB 3T0DA 3UL2A 3T1MA 4CDWC 3SMHA 1POV1 1WCDJ 2P2KA 3SEEA 5SV5A 5FZ8A 4X8PA 2WLQA 1E5SA 4C1WA 5C8CB 4QDQA 1ZRRA 1AR72 2P17A 3AX4A 3JCIA 1AR81 2IVJA 2JG9A 1HRV2 3KT4A 1D4M2 3RI8A 4NOTA 5DAPA 5CBLA 1TMF2 3DYMA 2VM9A 1SPPA 2LS6A 4D6RA 4OMCA 2CDOA 4XDOA 1AYM2 3WNXA 3R05A 5C9AC 3H8XA 1BK1A 2BOJA 3I54A 4CDUC 3FLRA 1K5MB 2BNNA 3OPWA 4EN8B 5LA2A 3INAA 2YFZA 3ZFGB 2RE9A 4X8NA 4ZHNA 5H9RA 2WZR2 3LAGA 2O1QA 5C3OA 2ZEZA 5C4WB 4M0HA 4TZDA 3E5UA 3RQ0A 1I5PA 1N1SA 5FZLA 3K3OA 1YQ2A 3AXEA 2I07B 5I8SA 3LWCA 3KHCA 3ILNA 3MBWA 2X5IA 3J8F2 3POYA 4GKXA 2YG0A 3FE5A 4N43C 1XNKA 2HWC3 4R9CA 3WXPA 4ASLA 1WBFA 1JUIA 4AFDA 4FPCA 1V6OA 4QX8A 1RUJ1 1DQ6A 1ND3C 1DZRA 1RUD3 4PLOA 4COWA 3I7DA 1CIWA 4GWJA 1VRH2 4AFCA 1MS8A 1LHUA 3B93A 3QOPA 5GLTA 2BDRA 5FZ4A 2WAAA 5C7GA 1CAUA 3O12A 3J7MA 2E6VA 1NCQB 5FY0A 4BLIA 3W58A 1BZWA 1LKNA 4X6RB 1LR5A 3ILFA 3HNYM 4YW4A 5K0UC 4LBMA 5K0UA 1UY2A 5KHIA 5CFCC 3D8CA 1W6NA 1SFYA 2DVBA 3GM8A 4Z07A 3NKGA 2R16A 3JD71 1UYXA 4OMDA 3RYKA 3SKJE 3VKOA 3K3NA 1OF3A 1H0BA 4UFJA 4CEYB 3K51A 3DECA 2EIDA 4DOUA 2A6YA 4GB31 4AEMA 4PI0A 3AYDA 2X10A 2YZ4A 5DZFA 1C4RA 1W8FA 1G9BA 3JQXA 4ET7A 5AFBA 4OHWA 3VZJA 4PDWA 4HVQA 4RSUA 3TN91 4QXBA 1V9U3 1BBT2 1HDKA 4MHRA 5HI0A 3KCYA 1GUIA 1WA6X 1GWKA 3FZ3A 1V70A 4Q0QA 2A3WA 5FY1A 3PDQA 3A22A 5H9PA 1W2NA 4AF9A 4KGGA 3MO4A 3ZSEA 5FTTC 3M3CA 4NHXA 5APAA 5C71A 2OVUA 3BU7A 4XCBA 3BTAA 2BTVC 4HPKB 1YIFA 1XNAA 1WWYA 4FPJA 4MGSA 5IWFA 5JOZA 1YXWA 4LXLA 5FYUA 3SC7X 5K4LA 3VHNA 3ACLA 2Z79A 2VTXA 1O8PA 1PVXA 3LE0A 3UJQA 4EN6B 4YZ5A 1NG0A 2VO5A 3PMEA 3H8OA 4YARA 4LLOA 3B01A 1W28A 3I2IA 3PVOA 2ZEXA 2RVAA 3ZYHA 2WWUA 5C33A 2ARBA 5BNPB 3DKQA 1NT0A 5IK5A 1GLHA 4FPHA 4UF0A 1MQTA 3OUIA 1OKOA 5DAVA 1X33A 3HQRA 3LA2A 5GLZA 5FK8A 3NL1A 2FBEA 2KA3A 3AVSA 5HXVA 5ISLA 1XSQA 2CWMA 4QX7A 5FKCA 3V56A 3TOJA 3VV1A 4AZZA 2KXLA 3N9QA 1DCSA 4Q4V3 3AKPA 5A80A 3VD5A 4ARXA 3WY6A 4CDXC 2F6BA 1TZOA 2P6CA 4YW1A 2RDSA 3RS6A 4JGZC 5FZOB 4CEWA 3K75B 2ET1A 1VMFA 4UW3A 4E9KA 4F3JA 1TQ5A 4OUSA 4I02A 1MZFA 2WO1A 4Q4W2 4URAA 3PVNA 4XZPA 3WT3A 4S2GA 5C3PA 1PGSA 1PO11 2OW4A 2WR9A 1H6XA 5FUPA 3SQOA 2A6VA 2JDZA 2SLIA 3DV8A 4MVTA 1DU3D 5JPMB 1T2XA 1NZCA 4DY5A 4EWDA 1JYTA 1F35A 2VNGA 2WNVB 4WV8A 4CXXA 1ZBE1 1PGW1 2DVFA 1CAVB 2UWAA 2XG3A 3D0JA 4OULA 2ZA9A 3ZN4A 4QHOA 1AHSA 5BY5A 1J1TA 2B9VA 1XJAA 3ZOIA 4Z92B 2FZ2A 4QM8A 4YM1A 5FZ6A 4IV3C 1QQP3 2B46X 2Q30A 4LULA 1OOPA 2O8QA 4XQ4A 4FOWA 5CISA 2JD9A 1ULDA 1MZ5A 3H3LA 3CJIB 3NAPA 4EWEA 2BBVA 2JDMA 2VXRA 2V5DA 4DZGA 1WLTA 2XHNA 3NV3A 1RMU2 4UAPA 1MEC2 5GZEA 1LESA 3WINE 2XJTA 4AGVA 4QX3A 4P5HA 2HWE3 1HXS2 5IHRA 4QDRA 5FFOC 2R073 5DMYA 4XFHA 1HB3A 1VB2A 1QJFA 1W9SA 3RDIA 4K40A 4ZS2A 1MS5A 4E27A 5C6CA 3OSDA 1IPSA 2WBKA 4LBJA 3WW3A 1GQPA 4Q0PA 2XUMA 1R091 5BNNC 5A7OA 4O9EA 1UXZA 1OT5A 4L92A 1GNYA 4HVRA 3U37A 1QH6A 1JHJA 1AJKA 3MEPA 4OHZA 3PUHA 1H9WA 4H7MA 1F8VA 3LB9A 2WSVA 4WM7C 1AR63 1W3XA 2RV9A 2VZVA 1D0GA 1C57A 3IM0A 4QPGB 4LBOA 3USUB 5ACA1 3AMMA 3CNAA 2PFWA 4MV2A 3GJBA 5EHDA 4LIUA 3ZFEA 5IATA 3ABZA 4RYDA 4A6SA 2CY6A 2RS51 1FNZA 3MGUA 3ROUA 5BUVA 5CA6A 1UX7A 4S2DA 1UIJA 5LY1A 3PL0A 3RZHA 4AWDA 4XF0A 2AENA 4RGAA 2MNGA 1UU4A 3LKJA 2XQXA 3PUIA 2YROA 1W2UA 2PN5A 3IB3A 1RUH2 2VMHA 4BHPA 4CCMA 2XLFA 5FYMA 1H1MA 1DP0A 2VZRA 1W99A 1VJ2A 3HJRA 4QKFA 4DO0A 4XJUA 1XYOA 3PTRB 4D7SA 1MS0A 2ZMNA 4CUGA 2WFPA 3J7LA 3WG1A 3T2QA 5I8YA 3RYPA 3PJYA 5FZBA 5CFDA 2R062 1NX9A 1TE1B 1G86A 4BQYA 2V4AA 4LORA 4UFIA 1VBE3 4QX1A 5JR7B 4YFZA 1AXKA 1Q8PA 3NJZA 2ZJCA 4DUXA 1ASJ1 1CN1A 1K5MA 1Y43B 2DFCA 2IXLA 4OFGA 4CP0A 1VBB3 1US2A 4PI2A 5FJKA 3ZFGA 1D0HA 2HWF1 4RD7A 3J8F3 4HANA 1OLRA 1TNRA 3OBZA 3POJA 2ZS6B 5DQ0A 4QXKA 1A78A 1LOBA 2QQUA 4JHZA 2WYFA 3ZKUA 3C2UA 4YW3A 1R092 2IZWA 5IAXA 3U10A 1JODA 2VZ3A 4XMIA 2RM21 1JHNA 3V65A 2E33A 2WNUB 2WT2A 2VMIA 3VD9A 3GCWA 4ZU7A 2ADDA 3BN6A 4ORFA 4AHXA 5GLUA 1VBA2 5T5JA 1C8M2 1IG0A 4YM0A 3OEBA 1EUTA 2J1UA 1H6YA 4MO3M 4QB2A 2FQPA 3Q9OA 1UYYA 3M8LA 4XBQA 1FOD3 1PZ8A 3N4MA 2DU0A 1M06G 2NP0A 4RS5C 2RS52 1UL9A 3T09A 1NA1A 1PK6B 1POV3 3VBHB 5ABJB 5C3QA 3MFCA 2PHLA 3KV5A 3KLSA 4TYSA 3TRSB 2IVIB 4FFGA 2BNMA 3O1UA 1CJPA 1AR83 1NLRA 1O8SA 1SBEA 2R041 3QBQA 5JXHA 1Z7S2 3FUQA 2WQ8A 3KWVA 3PNAA 4AG4A 1QF3A 2WO2A 4ATEA 5J7MA 1QOOA 2D93A 3IIIA 3K77A 4GD4A 5DZEA 2VW1A 3MW3A 4FAGA 2ZHMA 2D5HA 4CEYA 3ZPYA 4XXAA 2WAOA 5F1RA 5GZDA 4QHBA 1WW6A 2IXJA 3DYOA 3AL5A 1ODNA 3HNBM 3MF6A 5BNOA 3CF6E 2FD8A 1LU1A 1WW4A 1QJU1 4M3CB 1PM7A 4V2VA 2ZGMA 4LO5B 4QKNA 1I3HA 1IHMA 4IESA 1QY4A 4MXWA 5J96B 4BZ4A 2WNOA 1UPSA 4PIYA 3O0VA 2PHUA 1ZZ9A 2ARXA 1UY4A 1SLIA 2WFF1 2ZGLA 1L3JA 4EYUA 1FMD1 2C9KA 1Y7BA 2JDNA 3VBOC 4LBNA 1R1A1 2Q8CA 4DXZA 2K2SA 4G4FA 4TLGA 2DTYA 3S0MA 3M4FA 4HPKA 4XJ9A 2W2IA 1VBD3 2FMYA 2PAMA 4IE4A 4HETA 5G05L 3I2FA 2Y6FA 5T5LA 4F83A 4MZUA 5KBFA 1RUJ3 4B1LA 2A3YA 3JXSA 2ETEA 2OUHA 3VBUC 4LTAA 2DV9A 4CU8A 1SMVA 5JI9A 3SH3A 4WVVA 1B09A 2UY8A 2YBSA 4GIQA 1AYN2 3O1RA 3BB6A 1AX2A 2CHHA 4UFLA 4FP3A 3W59A 1UPIA 1COV1 4W8JA 1KDKA 5C70A 5DZGA 4KBBA 2FDKA 4G9SB 2VC9A 2ZZJA 1RGSA 1UQXA 3MI8A 5I0TA 5I0SA 1RXFA 4CE8A 4YNIA 2Y26A 3DN7A 3HQUA 1ALYA 3W21A 4B4QA 5C8WA 2GNTA 3JD73 1ZRCA 4L99A 2W0XA 3WNLA 1Y3TA 1HB1A 4WM8C 4XCAA 4OI1A 4GQ7A 4MOAA 3N9NA 5CYYA 3RVHA 2R042 2W1SA 1PM4A 4GB33 3RFRA 5FZOA 2FCUA 2DBNA 3FBYA 3MICA 3WF3A 1B35C 2EXJA 4DXRA 4K1ZA 4NPLA 1W8HA 3JBG1 3NVCA 3BYWA 2B5HA 2BJSA 2JECA 3RZMA 5A1AA 1CGPA 1U5ZA 3TN93 5FQ0B 4A42A 5BV6A 5LW9A 4N9HA 2NZ9A 3HIFA 1LJ7A 2W08A 3MIEA 1CAVA 1WLCA 1X8MA 1BMV2 4N53C 4Q1RA 3K4AA 4N53A 2XL9A 2DCTA 4AI3A 1GZWB 4NAMA 2ID4A 2Y6LA 5IVYA 4CDWB 1MS4A 2JIGA 4M4PA 4P9WA 1AJOA 5A33B 3HN1A 3NJVA 1FATA 3PJQA 4PLNA 4R9BA 5GALA 1GV9A 3CJIA 3WV6A 1OA4A 4QAWA 1F4AA 3Q8FA 4LQRA 1R1A2 3KSCA 2CAVA 4WVZA 1UU6A 1GFF2 1V00A 3D82A 3FJSA 1QKQA 3ELNA 3RJRA 2ZGSA 3M7AA 4MGIE 3Q8AA 3AZXA 4ASKA 4U2AA 3H7YA 1O4TA 2JD4A 2XWJB 2BW8A 4D6QA 1VBC1 3N36A 3R4DB 4XFIA 3SITA 5C9AB 4CDUB 4C90A 4CCOA 4NIGA 5FXXA 1GOGA 2JG8C 1UZYA 2WABA 3NNGA 3POGA 1ND2A 2D6NA 2JJ6A 4NWWA 1LOGA 5JSPA 2J7MA 4L11A 4TLFA 3DXUA 2WIIB 3IN9A 4BWOA 2WINB 4HKOA 4A4AA 5FYSA 2WO3A 2WNEA 3GXUA 5FO7B 4N43B 1Q3EA 3OJBA 3DEMA 5L9RA 4YGCA 5T55A 2GNMA 5CAZA 3WQ0A 1NLQA 5FLIA 5FP9A 3KD4A 1F4HA 1OLQA 4FPOB 2J1AA 2HWC2 1TME1 5B2GB 1ND3B 1PO13 1CX4A 4IEVA 4XFCA 5EYXA 3NRUA 4R4ZA 1R081 3H1YA 4I3GA 2VZPA 3OY8B 4XJ8A 1OMIA 1ZBE3 1E5RA 3I2JA 5FO9B 1ZBA1 1RUD2 3H8UA 5HV4A 2VOTA 2ZGRA 2ARAA 3ZR6A 3VDCA 5L7OC 4QB6A 4QU2A 5FYIA 5K0UB 3VUOA 2E7TA 3I3MA 1S4CA 2ENRA 1H1AA 1LENA 5CFCB 1MS9A 4W50A 1HKDA 5IVVA 4AVVA 4CCLA 3BTXA 1BQPA 4PIXA 1PO23 4BQ4A 3BU0A 4J6GA 1PX3A 2K46A 3HEIA 1H1IA 4Q4Y1 3WNPA 1AL0G 4C91A 2W95A 4HT1T 1KGYA 2BERA 5FMOL 1DYKA 2AEYA 2DFBA 2AACA 3GHNA 4FFIA 4M3CF 4LE3A 2QQKA 1O6UA 4JQRA 2CDPA 3AXDA 4YVWA 1GSLA 2YC4A 4PDWB 5C3SA 5BPXA 1R093 3B9CA 4FCAA 1WGPA 4Y20B 4Q5OA 4E2SA 3RPQA 1JS9A 1XE8A 4K3UA 4MGQA 2VMFA 1ONAA 5IK7A 5CEHA 4LBQA 1N1TA 1V9U2 1W8NA 1M4WA 2W91A 1WCQA 4W4ZA 5GJ6A 1CAWB 1MACA 3IT8A 2YC0A 4QHZA 1XXNA 5FXZA 5H9SA 3BOPA 2WNUA 3POFA 4QX0A 5LY2A 4AXOA 4YVSC 5ACA3 3ZXAC 4FSJA 2RG4A 3PTYA 3R4UA 5FZ7A 4E4HA 4MG2A 3TNQA 1V0AA 2RS53 3RI9A 5FDBA 1E5HA 1LODA 4DXTA 1T6BX 4B7KA 1V6LA 1AL21 1K3IA 3AP4A 2Y64A 3KVBA 3V0AB 2CWSA 2A71A 3VKNA 1TME2 3H42B 1TG7A 4YG6A 2G9ZA 5FZKA 2VTFA 3SXWA 4LHLA 4QPWA 3VBHA 2A70A 4LOSA 4Y5SA 4CUBA 4DQAA 2C0ZA 3FHQA 4QQ2A 5IVBA 4RN5A 1RHI1 4TWTA 1K42A 3LA3A 1ZA7A 3KB5A 4DRVA 4DXSA 2GH8A 1EV11 2JIJA 3UETA 4R8HA 4Q8KA 1J3QA 1OFNA 2P6HA 1QGLA 2MHFA 2YPJA 4DPNA 3WW1A 4AEJA 4U36A 4YRDA 1KITA 5FWJA 3POIA 3OD4A 4TXWA 2VZOA 3E97A 3I3BA 4NVPA 1XNTA 2JENA 3RWNA 3ZMOA 1OF4A 2QDRA 4CDXB 3BPZA 5A1LA 5JAXA 1JZ3A 1W90A 3T0BA 2NMOA 5I0DA 1ASJ3 1KEXA 2B9UA 2CU5A 4JGZB 2UYBA 5FYYA 4M3CA 4Y1VA 3ACGA 3GZUC 4P14A 2KD7A 4LA3A 5FZ9A 5JCTA 4TTGA 2EVXA 4Q4V2 2HWF3 1W2OA 2DUOA 2G19A 3B7MA 1LU2A 1Y9MA 2ZACA 1H8TA 1UYPA 2XJPA 3ZR5A 1ZYBA 2MPFA 2P34A 1QU0A 3PHMA 1RB8G 3VB9A 3U07A 4N7IA 3UKVA 3WG4A 4LNVA 2PHFA 4PJYA 1K12A 4JV4A 3UKTA 2RM23 2YHJA 2CGPA 4IV3B 1OOPB 2VBBA 4AI1A 3NAPB 3LDKA 1BK0A 1HW5A 3TAYA 1YWKA 4Y3OA 3KV6A 1RITA 4HN0A 4PQ9A 3O0XA 4AK3A 4LUKA 2WLPA 2WJSA 4IE0A 1IZ3A 5J37A 1F15A 3TYJA 5L19A 4XXPA 3AFKA 3M3IA 2WS91 4AHYA 3AZVA 5FMCA 3WNMA 4BISA 4W6YA 3T4HB 3ZXLA 5FZFA 2MEV1 3WLUA 4CPBD 3EB7A 3VN4A 3ITQA 1W8OA 2VZQA 1SLLA 2HWE2 2R072 2HEVF 5A7PA 2NN8A 3AFGA 1Z0HA 5FZ0A 4JGYA 1NZIA 3BALA 1RVF1 2VCBA 4MGTA 4JKKA 4DUWA 4BQXA 4PIZA 5T5OA 5HBAA 2V4VA 4P5YA 4YW2A 3IIAA 2EIEA 2VQ0A 1CQ9A 4MUVA 3UGHA 1FNYA 1IOAA 1EV12 4FXKB 4HKWA 4WM7B 4AHZA 4FOYA 1F5FA 5DG2A 1CZTA 1TEIA 3IDEA 4RFRB 4BQ5A 5J09A 2ZAAA 3AP5A 4LHKA 3WX5A 1QJU3 4DEVA 1W9FA 2IFRA 2DUQA 1AR62 3AP6A 4LKSA 4NHKA 2WN3A 5DUUA 5FPUA 2VE1A 5IK8A 1GKBA 5FQ0A 4OQ8A 3ACHA 4FTEA 1A8DA 1Q8SA 3ZXDA 2NPIA 1JN2P 2VQAA 3GJAA 3KQ4B 1RINA 4IQPA 4A7YA 1URXA 2WFF3 2OZ6A 2VL4A 5IT6A 1FMD3 1GZWA 1ACCA 4ITCA 3ZXGA 1R1A3 4CDWA 4YM2A 5L9VA 2B42B 3A4UA 5A33A 1SHWB 1Y9QA 4XTMA 5DUXA 3VBSC 2YU1A 1XBFA 4IEUA 4IL7A 4K8FA 4YFWA 1ENXA 3POWA 3ZM8A 4JTNA 2Z5WA 3M3OA 1W6QB 5JXJA 2ZX2A 5CFDB 1IPJA 2D5FA 4BXSV 3C7EA 4XYXA 3TEZA 5E8AA 4MX3A 4XFAA 2VUDA 4QPIC 3WHUA 1X7NA 2XJUA 2Y34A 5C9AA 1GANA 1N3PA 4DNYA 4CDUA 1GP6A 3WOGA 1LECA 1COV3 4CP9B 1J83A 1KD7A 2TBVA 2Y8KA 1VBE2 4PF1A 2QZ3A 4XQWA 4L97A 4ZY9A 4LLFA 2ZKLA 4G3YC 1ZA4A 2C6SA 5KHGA 3WG3A 1SFNA 1JZ2A 3J7NA 4GZ9A 3H1MA 1VBB2 1UO9A 5EJZB 4QT6A 5FZEA 3GF6A 3KV4A 1D2SA 2XKOA 5A32A 2HH9A 2J1SA 1UW8A 2PELA 4N43A 3ZYJB 3AJZA 1RVF2 2OA2A 1EP0A 3OB8A 4Y1YA 2Q8EA 3J4UH 1ZZ6A 5CZKA 1VBD1 1P8JA 2D6MA 4KWJA 2QTWB 1NY72 3WDTA 5C5UA 4I09A 1AR91 3POBA 3JBG3 1RUG1 3AKTA 1ND3A 2E31A 3POEA 4PCRA 1ULPA 3BCWA 2VVEA 3DPRC 2ARCA 4BM8A 3OY8A 1EAH1 4Y24A 1YJLA 4AI9A 1PGL2 2QZ2A 3FC0A 5JUVA 3WDVA 4IGOA 4RS5B 2H6BA 2RS11 3Q8BA 4EWAA 2JDHA 1NA1B 3ETPA 2B39A 1C8NA 1W8TA 1OVSA 2ZGTA 4COVA 4CDQC 4OHYA 2YV8A 1FOD2 1W0NA 3JB4C 2IWGB 4OZXA 1YIPA 3CEWA 3I8TA 3FFZA 2XL7A 4X6QB 5CFCA 4Q4X1 4GAZA 5B4XA 3MPPG 1UY1A 1H30A 3KMHA 1ULCA 2Z2SB 4IEOA 4MLOA 3ZYIB 4RR3C 5FWEA 1AR82 2D6KA 4Y33A 1C1LA 3O1MA 4GULA 5BNOB 1VBC3 4QQOA 1W9TA 3WW2A 5A3PA 3C7HA 2F4PA 1OURA 1SLAA 2Q8OA 1R1ZA 1GNHA 4XIOA 1LCLA 1OVPA 3ES1A 3BODA 2CGNA 3RZZA 2YY1A 4MXWB 2B45X 4Y20A 1O3TA 4Y1XA 4OI2A 1ULGA 5BNQA 2RJLA 4BJ0A 2BGPA 1OD3A 5JWPA 3OBTA 1HN1A 4V2WA 5LBBA 1JYNA 3O1VA 3WHTA 2VVDA 3O1TA 4HLTA 1JU4A 1FAYA 3VBOB 3VD4A 2E7QA 2VCAA 4CCCA 1CAWA 3ZIWA 1DQ0A 4NJ4A 4XTPA 1GYKA 1S0JA 2PAEA 4XZUG 3ZIXA 5FYBA 1G7YA 4JQTA 3KHBA 4RQPC 1XU2A 3ACIA 1NOVA 1TME3 4AE2A 1BEV1 2D6OX 3IMMA 3AP9A 4IGPA 1QWRA 2J42A 3DXTA 4QM9A 2QE3A 1VBD2 1R083 3VBUB 4CVUA 1Q8QA 4YG3A 4P9IA 5FIXA 2OX0A 1RUJ2 4ZPIA 1EPWA 5FP4A 1RUG2 4QB1A 3V0AA 2IXCA 1ZBA3 3C3VA 3CJXA 2PHTA 2ZXQA 3UK9A 2JDYA 2GMPA 1HV1A 4B7EA 4CU7A 4XF3A 1V6MA 3B3QE 5FZIA 4E4DX 2EF6A 3BI3A 4GJZA 2UU8A 3A0NA 3WQ7A 1LOFC 3AZWA 4UBGA 4P00B 4XUTA 4AQTA 3IDAA 3WW4A 3OF1A 3GZEA 3JQWA 2F17A 3T3YA 3QCWA 1ZX5A 1QXPA 1AZDA 1F31A 4UXAA 3CIHA 4P08A 3SHRA 1YFWA 3WDUA 3ZYBA 4Q4Y3 1ZNPA 2E53A 2GMMA 2XUEA 3NNLA 4Q4X2 4CDXA 5JSOA 5E16A 3JD72 2DWRA 4XURA 5KC6A 4JGZA 5F9TA 4Q1PA 4RHV1 5HXMA 1S0EA 1RUI1 3L2YA 3A0KA 1JZ7A 3WF4A 2G9GA 2PA7A 3ZSMA 5J3UA 5EXOA 1ZZ7A 3I2DA 2EA7A 4GB32 4MH0E 1QOSA 4IGQA 1S0IA 4YZ4A 2AH2A 5HCBA 1QNYA 3CZUA 4D8MA 1YRZA 5LA0A 1ENQA 1DLLA 2Z42A 4P9LA 2JICA 4N53B 3USSA 4ATFA 3O5SA 1W05A 3TN92 3ZXJA 5J1XA 3VZNA 3O1SA 3MHZA 4IV1C 4IV3A 2NMNA 3TWIA 2EIGA 4XF9A 5GZFA 4BPZA 5FR3A 4LBKA 4KWKA 2Y6KA 4OCTA 5FYCA 3VBFC 3P1IA 3OUHA 2GC2A 5T52A 1PO21 1AL23 1GP4A 4D7TA 4KG0A 2RMU1 4QKBA 2QQJA 3AYAA 1ODMA 2E26A 5F5AA 3SCFA 3E5QA 1QDOA 5FCCA 5FPAA 3FMGA 2WKKA 3NNMA 5FXVA 1RHI3 2JG8B 3CQOA 4PBOA 1UZWA 1UOJA 5FK7A 2AUYA 5BNNA 1EV13 2WA3A 3AP7A 1ND2B 4Y1ZA 3U4SA 3THPA 2IC1A 4KBZA 5FJHA 1UZ0A 3NNFA 1FI2A 4Q8LA 1PVC1 4WM7A 5K7PA 3MW4A 3WNKA 3WP6A 4XILA 4LKFA 2ZX3A 1HRI1 3WZ1A 1XU1A 4XUNA 3VL8A 4JC1A 2IUWA 1L7QA 1UYZA 2VW0A 4XF4A 4H55A 2RDQA 2ERFA 1OKQA 2JWPA 4UBHA 2ORXA 4XFBA 1DF0A 5A7SA 2A6WA 4IE6A 1PO12 5FMOS 5AC91 3LOBA 3D0SA 1KRIA 4BK4A 2BGOA 2XBO1 1PNGA 2JDUA 5L7OB 1UMIA 2QNKA 2VMDA 1ZBE2 1PGW2 2YXSA 2ZHLA 2VNOA 3KQRA 4LJHA 4TN7A 4AQSA 1MR5A 3LGRA 3MV11 2ZX4A 5D8AC 3ZYGA 2CTVA 3LSEA 4ZXKA 3N7MA 3FLTA 2C1FA 2WUHA 3M2MA 2J1EA 1W6QA 4J1WA 1CAXB 4XUQA 5I8TA 3ME2A 4OUEA 3LD8A 4K7JA 4GMP3 3LEMA 4Z82A 3PURA 2WS93 4YSFA 2WWJA 1I9RA 1HX6A 2ZBJA 2MEV3 4CP9A 1PO22 2QBXA 4YM3A 4NIAA 1ZZ8A 2OYZA 4BMBA 4XC9A 4YVWB 3IAQA 5C8CC 3DF0A 3HVDA 1XC6A 2BBAA 1WZXA 3N9LA 4AR2A 1YC61 4QGMA 1RVF3 2OIIA 3E1F1 4Y4YA 1VIWB 1NQJA 1WD3A 3L9JT 4LBQB 5T54A 4AL9A 4LITA 3WCRA 2XHKA 4KH9A 3KCCA 4MGYE 3VHOA 2PXJA 5FPBA 2GC1A 4HN1A 1BJQA 4GH4C 5JMCA 1AF9A 1DQ1A 2V72A 4LK7A 5FKBA 2Z69A 1N1VA 3VD3A 1NQDA 4ZU5A 3LDBA 2ATFA 4YW6A 2W68A 2E32A 4NUBA 1VAKA 5ACA2 5C4WC 3THDA 3N9PA 5BXXA 2PYTA 4LO4B 2NLRA 5CADA 2KM2A 2L9LA 2DF7A 1O5LA 4CU9A 5AFEA 2XOMA 2UYAA 4RS5A 2IFWA 3GCXA 2A7AA 1DYOA 5LASA 2D7FA 2BWAA 2ZCWA 3EO6A 1DQ2A 1ST8A 4IDZA 3W9AA 3BGAA 1W8WA 2R32A 5T3NA 4ZZ5A 1BCXA 2G1MA 1CJDA 3IAPA 4AYUA 4HZFA 2B7YA 2QQWA 5FZAA 2CL2A 3MF9A 2FDJA 1OH3A 4Q0SA 4IW3A 1WCSA 4DFSA 1CVNA 3H8RA 5JI7A 2GN7A 1JW6A 1YJKA 3ST7A 3O14A 3RJ2X 1RJ8A 2DDUA 2Y33A 4GA9A 5FO8B 3OG2A 1NCQC 3T1LA 4HXCA 3MV01 2VQUA 4YZ3A 5KR7A 2ZX1A 3B5LB 2DCJA 2LRPA 2RS31 1UKGA 3ZFFC 1VLNA 3UGGA 1ZM1A 1H8TB 5BYNA 1ASJ2 1XSRA 2DCYA 4OZOA 4QXCA 4PT6A 4JCKA 4KI5M 4AI0A 1U0AA 2VXJA 4YG0A 2O14A 4C0BA 4HVOA 4IEYA 4LIVA 1HLCA 2HWF2 4XDPA 1GQHA 1QDCA 1PNFA 4FP2A 3OUJA 3VBOA 2ZEYA 2BZDA 3LPFA 4EN0A 4Q29A 2YC2A 1NUKA 4FFFA 5I0UA 3RSJA 4PQQA 1KJLA 1AR93 1RUG3 3FN9A 4WVMB 2RM22 2GNBA 1REFA 3VBUA 1JOBA 2TNFA 2VCMA 4HKLA 4NHYA 1EAH3 1G9DA 1XRUA 1QH7A 2JKBA 1JOJA 1ZVFA 3VKLA 2RS13 3NV1A 1IQDC 4LT5A 4XHXA 3IBMA 4JKMA 4CCNA 1GU3A 1AXZA 4NIHA 1I1EA 1OQEA 3ZPOA 4YLZA 2BOIA 1CONA 3KS7A 3LSDA 1QMJA 4XJZA 4O65A 2D3SA 1BVP1 2J1VA 4JGYB 4Q4X3 2E9QA 1GOHA 1GWMA 3TEXA 4Z8BA 4BQWA 2LTNA 1WMEA 5ANQA 1V6JA 2VH9A 4J25A 2WSUA 2OQ6A 1PMIA 3ORJA 3SISA 4WM8A 4MYEA 4QXHA 3S57A 4HMZA 1OH4A 1PZ7A 2VMEA 5LBCA 5LEKA 2W1QA 5A3WA 5J36A 2R7EB 2VGDA 1X9TA 2DU1A 2VJXA 5F2SA 5G04L 1B35A 4CCJA 5I93A 2DCZA 4L9BA 4XAEA 4NMIA 4K6BA 4Y5TA 5BNPC 1H4HA 3EBRA 2GZWA 4XBNA 1GZCA 2VD7A 1MVEA 4I2OA 1QJU2 1JYVA 3N9MA 1U5IA 3N3HA 4JRAA 4F7ZA 1X9PA 4OHVA 5FLHA 2HWD1 3S5QA 2FZ1A 1E57A 4Q27A 3QLQA 4Q26A 2W52A 4ZU4A 4UI9L 2WFF2 3I59B 3R4SA 3UGFA 5LRSA 1FMD2 4OI0A 5JZGC 3D6EA 4Y22A 1BEV3 1OI6A 1XYNA 1WUVA 4BE3A 2PLV1 2VECA 3LF7A 2ZMLA 3VZKA 2WNVC 4A44A 1FV3A 3N7JA 4DINB 5FUIA 3VDDC 1DFQA 2I74A 3QD6A 3BUCA 2QJVA 4HBNA 1S1AA 4AI8A 3ETQA 3WDWA 2VOVA 5DABA 1PHMA 1MVQA 1XE0A 2OS2A 5JR2A 1WKYA 3F2ZA 1A34A 2C9AA 2JG8A 2Q8DA 2O0OA 4IERA 4MGKE 4CP2A 1COV2 3MYXA 5EYYA 3WG2A 2I2SA 2DUPA 4AVBA 1IKPA 1RUC1 2QQNA 1KS5A 2P3JA 1JU3A 4HG6B 5A32B 4XW3A 1S0CA 2XVLA 3I49A 2A73B 1KXGA 2EXKA 3WUDA 2D6PA 2GC0A 4XUOA 3PVEA 2ZABA 4XF1A 1UD1A 4RHV3 3T2TA 5HCAA 5JIUA 1RUI3 1UF2C 1XB9A 5FZHA 4BMEA 1S55A 5KXCA 5EFUA 5H9QA 2GH2A 1GP5A 2YYOA 3MLKA 4FPLA 2JB8A 2HWB1 3DL3A 3HMYA 4AEDC 3FHIB 1RTVA 1CZVA 1LRHA 3JBG2 4B3NA 2KR2A 1REDA 2R1BA 4ZS3A 1RUF1 3WNNA 4YW7A 5L7OA 1NAEA 4QPGC 4NRMA 3KGZA 5IUQA 5KHJA 4XHBA 3SCGA 4FVVA 3F95A 4W65A 1GWLA 2GN3A 4COYA 1S0GA 3S5AA 1DBNA 2WZPP 4OYUA 1CAXA 1RJ7A 1POQA 1W2TA 3VZMA 3PUSA 1WA4A 3AK0A 5EV7A 4DEQA 1F9KA 1VMHA 2RMU3 4F8AA 5EZWA 2J1TA 1N3OA 4AAPA 1S2BA 3MW2A 4A41A 2GSYA 3OEAA 3S7EA 3FLPA 3AB0A 4UYBA 4BA6A 1J3RA 5A3LA 5F3CA 1W3VA 1DIWA 1Q5OA 1WCKA 4LA2A 5E6HA 3W5NA 4UW5A 3MIGA 2X29A 1UMHA 2A75A 1S0DA 4FPGA 3UESA 1YNAA 4K9SA 1FPN1 1VBC2 5IVEA 1WMFA 3E6DA 2QFEA 2VMCA 1POV0 1W0PA 3PIGA 2A5ZA 1D4VB 2C5DA 3N9OA 1PVC3 2GP3A 1WCUA 2P37A 2WO7A 5DG1A 2Q1ZB 1DZTA 1XOYA 3SEPA 4K1YA 1PIV3 2JEMA 4LHNA 2UWBA 5FP7A 4BB3A 4NROA 5DAWA 1OLME 1RUC2 1HRI3 4YVSA 4C1XA 3HT1A 3MUZ1 1AVBA 3I3DA 5IVJA 2UWCA 4NE9A 4RQPB 4UOJA 5GZGA 2QQPA 3JU9A 4LO7A 4NHLA 2HEYF 2BGCA 3ZXFA 4I0WB 4COZA 1C5IA 1JYXA 1ZZBA 4FT8A 2QDNA 4RL7A 2VPVA 5AC93 3WDXA 4IE7A 4ES8A 2VW2A 3ZDSA 4C0HA 4XFGA 1R082 2XBO3 2HEWF 2RR11
chains in the Genus database with same CATH topology
1GWLA 1W8UA 2LRPA 2Q1FA 4CP9B 1WZXA 3ZYBA 1WCUA 4LJHA 4LKDA 4BQ4A 4BQ2A 2WYFA 1W8WA 1WMXA 2K46A 1W8ZA 2VXJA 4AL9A 2C24A 2O14A 1V0AA 5D21A 1W8TA 4LKFA 3UT0A 4BQ3A 2LROA 1GWKA 4LK6A 1W90A 3ZYFA 4A6SA 4YWAA 4LK7A 4BQ5A 4LKEA 1OH3A 3ZYHA 2KR2A 1GWMA 2JWPA 1L7LA 1HN0A 4YW6A 4CPBA 4YW7A 4CP9A 1OKOA 1W9FA 3ORJA 1UOJA 4CPBD 3F95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWL A;  1W8U A;  2LRP A;  2Q1F A;  4CP9 B;  1WZX A;  3ZYB A;  1WCU A;  4LJH A;  4LKD A;  4BQ4 A;  4BQ2 A;  2WYF A;  1W8W A;  1WMX A;  2K46 A;  1W8Z A;  2VXJ A;  4AL9 A;  2C24 A;  2O14 A;  1V0A A;  5D21 A;  1W8T A;  4LKF A;  3UT0 A;  4BQ3 A;  2LRO A;  1GWK A;  4LK6 A;  1W90 A;  3ZYF A;  4A6S A;  4YWA A;  4LK7 A;  4BQ5 A;  4LKE A;  1OH3 A;  3ZYH A;  2KR2 A;  1GWM A;  2JWP A;  1L7L A;  1HN0 A;  4YW6 A;  4CPB A;  4YW7 A;  4CP9 A;  1OKO A;  1W9F A;  3ORJ A;  1UOJ A;  4CPB D;  3F95 A; 
#chains in the Genus database with same CATH topology
 4ARY A;  4R9A A;  1LHN A;  3ON7 A;  1ZBA 2;  1W04 A;  3AM2 A;  4AW7 A;  3OGJ A;  5FY7 A;  5DDJ 1;  4I30 A;  4FO9 A;  3RG0 A;  4Z2A A;  5E89 A;  3ZN5 A;  3R6S A;  4RA0 A;  2TUN A;  3AMH A;  2XWB B;  2OZJ A;  3N7L A;  3G6J B;  1RUE 1;  2LW8 A;  3ZVX A;  3V64 A;  1XNB A;  5FBZ A;  4CP1 A;  1PK6 C;  1IQA A;  5ABJ C;  3MIH A;  5KXE A;  1W9Y A;  3MFA A;  4Q4Y 2;  5E88 A;  2D43 A;  3NNJ A;  3CDZ B;  1NCR C;  1UZZ A;  4PBP A;  4QQP A;  2W1U A;  5KC5 A;  2BVV A;  3CLP A;  5B4N A;  3OYW B;  5F5I A;  4CCE A;  5FZ3 A;  4XE9 A;  1QJY 1;  4YYO A;  1FV2 A;  5A7Q A;  3HQX A;  4CZS A;  1ENS A;  1JH5 A;  5GLW A;  1NE6 A;  1NKG A;  3CU7 A;  3C7O A;  4LR4 A;  5ERL A;  5FMB A;  4EE2 A;  4FTS A;  2VUL A;  4AFB A;  5LEJ A;  1LEM A;  3E6B A;  3G7D A;  3SNM A;  1PMH X;  3DUI A;  2Y60 A;  1UKR A;  3LCP A;  4KU7 A;  1CIY A;  4D69 A;  5F7U A;  4JRL A;  3HT2 A;  4WVM A;  3VBR C;  5FY5 A;  2R30 A;  3VBF B;  4JKL A;  3X29 B;  3DYP A;  3ZLI A;  2VUC A;  4GMP 1;  2RJ2 A;  1JZ4 A;  4FPE A;  3LQC A;  1K5J A;  2AR6 A;  2XXZ A;  5F5C A;  3B02 A;  5F6K A;  4GJY A;  1AX0 A;  2AZ5 A;  1AL2 2;  3LPG A;  3NW4 A;  4B29 A;  1W6M B;  3P6B A;  1YCI A;  2VZS A;  2P1B A;  1Q8V A;  1HRV 1;  3LEG A;  5LK7 B;  4BIO A;  2ZHN A;  2BFU L;  1YQ6 A;  2WDB A;  1D4M 1;  4FQZ A;  3EMR A;  1TMF 1;  3D3A A;  1MZ6 A;  5BNN B;  1G8W A;  1GQG A;  3I2H A;  4AFM A;  1AYM 1;  4CUA A;  1JMU B;  3PU8 A;  3RZG A;  3UJO A;  5FYH A;  1RHI 2;  2ZX0 A;  3NV4 A;  1KDM A;  2W87 A;  2YBK A;  3UNP A;  3S7I A;  5A1F A;  2WZR 1;  2Y6H A;  2ZZQ A;  1U5X A;  5FY8 A;  1BLZ A;  4ISQ A;  1YO8 A;  2QKD A;  4QX2 A;  4UFM A;  3WR0 A;  2FDF A;  4E2G A;  1GMM A;  1W39 A;  4GKY A;  2RS3 3;  4N90 A;  4BXF A;  5JSR A;  4JZR A;  4QX5 A;  2BQP A;  1FX5 A;  4NPR A;  1W06 A;  3RWK X;  4Y5Z 0;  2IXI A;  4CU6 A;  3BKZ A;  1HV0 A;  3ES4 A;  1LHW A;  3IMN A;  5FYT A;  4ZON A;  3GHM A;  3HR9 A;  1WMD A;  2ZGK A;  1W8Z A;  5DAQ A;  1U12 A;  4AVS A;  1OUS A;  1SCS A;  1G9F A;  3RZK A;  1AUY A;  1CD3 G;  5D21 A;  5F3G A;  2V09 A;  3NJX A;  4NRP A;  2UUR A;  1FXZ A;  5FPL A;  2XGX A;  2N7G A;  1VRH 1;  2FCT A;  3I59 A;  1CPN A;  3HN3 A;  3VBS A;  1DGL A;  1Z78 A;  5D8A B;  4BU2 A;  4BK5 A;  4NAO A;  3M3Q A;  1Q8O A;  2VVF A;  4H14 A;  2XQR A;  1SBF A;  4CPB A;  1UOG A;  2Q1M A;  1J1L A;  4P9X A;  2VG9 A;  1YI7 A;  3I2K A;  3KF5 A;  4GWI A;  5L36 A;  4QPI A;  1QJX 1;  3D4K A;  2P5B A;  4H3W A;  1OQ1 A;  4GWM A;  4K8R B;  3PLQ A;  2VMG A;  4LOT A;  3U1X A;  4M4R A;  2ZGN A;  3VGI A;  1D7P M;  3PMS A;  2WS9 2;  2NQY A;  5A7N A;  3TEW A;  3ZN6 B;  1EPZ A;  2RJK A;  3WQ1 A;  2MEV 2;  2LRO A;  3OGS A;  3TEY A;  2JG9 C;  2G4I A;  2ORZ A;  2VAU A;  5EWS A;  3KGL A;  5I0R A;  3ATG A;  3MIF A;  3VDA A;  1UOB A;  2W3J A;  5DUV A;  1CR7 A;  3KZ4 C;  5K8S A;  4FPK A;  2DVG A;  4XJA A;  3ZMN A;  4GH4 B;  3B94 A;  1QXR A;  5EIY B;  1BBT 1;  2CYF A;  5AVP A;  5F32 A;  2JX9 A;  4YZ1 A;  3IZO A;  2DTW A;  2OKX A;  4FFH A;  2IXK A;  2BEO A;  1FT9 A;  3DPR A;  4KNC A;  2LM3 A;  4QDS A;  4Z1V A;  1GOF A;  1SDW A;  2XJV A;  3HAG A;  5T50 A;  1NXD 1;  1EUU A;  2A1X A;  3P5B A;  1SEF A;  2HWD 3;  2X5I C;  4LHS A;  5CVR A;  2BV4 A;  5FY4 A;  5LB6 A;  1AXY A;  4EZ4 A;  3BTY A;  4P9Y A;  4CDQ A;  2DBI A;  2HBU A;  4HSJ A;  5A6Z A;  4HSL A;  4EZH A;  4N7U A;  4YGD A;  4QWN A;  1EYB A;  4BH9 A;  2W94 A;  2YUE A;  5LWB A;  4CXW A;  1WW5 A;  2H0V A;  1DDL A;  2PLV 3;  4IXL A;  3NMB A;  2EIB A;  4YGB A;  3IDC B;  4HK9 A;  2E51 A;  4NWV A;  4RR3 A;  3H9A A;  4W6X A;  5DPN A;  3RGB A;  1LAJ A;  4I01 A;  2BUK A;  2ZTN A;  2AGS A;  3M3E A;  5CKM A;  1LOA A;  5KHH A;  3J7H A;  4CRQ A;  2JE8 A;  3LEK A;  2VZU A;  2OXB A;  2WC2 A;  3JZV A;  1QJX 2;  3OPT A;  3ZFF B;  4BQ3 A;  2DYC A;  3H3Z A;  3AMQ A;  3J9S A;  4LEJ A;  2BNO A;  2Y0O A;  3I3E A;  4AVA A;  2P3I A;  4IET A;  2WZ8 A;  2YU2 A;  2PHD A;  3R0R A;  1RUC 3;  1H2K A;  1YEW A;  5JVV A;  1NYW A;  3B69 A;  4Q4W 1;  2P3Y A;  1HQN A;  1VAV A;  5JDB A;  5FP3 A;  1LB2 A;  2LAL A;  2ET7 A;  3QH7 A;  2FDH A;  1VP6 A;  5CG8 A;  1HJG A;  3H1W A;  2ZMK A;  4RQP A;  2R49 A;  4JHT A;  3WEZ A;  5C3R A;  4L2N A;  1DGR A;  2VOK A;  2GAL A;  3HPN A;  4PDW C;  5A6Q A;  5KWR A;  1RUO A;  4RGG A;  2Y6J A;  3WDY A;  2HWB 3;  5HCF A;  1H2L A;  1S2K A;  4AFA A;  1AR9 2;  4P02 B;  1OFS A;  1DQ5 A;  4B4P A;  3SLI A;  3AMP A;  3AL6 A;  4P9G A;  5GM0 A;  3C7F A;  1RUF 3;  3LZZ A;  4Y1U A;  1IS3 A;  2X8K A;  1DGW A;  1EAH 2;  1RMU 1;  4ZKT B;  4H7L A;  1MEC 1;  5EPA A;  1LOF A;  1OPO A;  2RS1 2;  3AC0 A;  4OHX A;  4CCK A;  2YGM A;  3B9I A;  4E2Q A;  4NR1 A;  1HXS 1;  1YI9 A;  3TB0 A;  2NM1 A;  1VR3 A;  3OOX A;  1OA3 A;  2HYX A;  4AAX A;  4QMA A;  2XJS A;  4WM8 B;  3TNP B;  4A45 A;  4S2H A;  1XYP A;  3NQH A;  3ALQ A;  1H2M A;  3ILR A;  5ANN A;  4MGZ E;  1LGC A;  1LUL A;  3IWZ A;  2HBT A;  1LTE A;  2IXH A;  1UAI A;  5EJ3 A;  1B35 B;  3GBG A;  5DAX A;  5FZG A;  5LAT A;  3VHR A;  1GIC A;  5IYY A;  4NII A;  5FLJ A;  1UU5 A;  4A3X A;  1JZ6 A;  1UZV A;  1Y9G A;  2QQL A;  1FPN 3;  1MQT C;  1H9P A;  2GP5 A;  3MPB A;  2AYH A;  4HL0 A;  1L7L A;  4OUM A;  3RMY A;  4QQL A;  1X36 A;  3OYW A;  3DGT A;  3NKT A;  2B8M A;  4JDN A;  4YW5 A;  1O91 A;  3A23 A;  4Q0U A;  5JPN B;  5KXD A;  3HWJ A;  4OQ9 A;  3OD0 A;  4AVT A;  3AYC A;  4I0B A;  3LIG A;  1T6G C;  1W8U A;  4CEW C;  4IV1 A;  1VPH A;  4AGG A;  3WF0 A;  3BIW E;  3WVJ A;  3DKW A;  1W0O A;  5JZG B;  4Y22 B;  4LPL A;  2FDI A;  2EAA A;  3APB A;  1XQN A;  4PHZ A;  3VBF A;  1G9C A;  1RUH 1;  5CKN A;  1J59 A;  3VHP A;  3W20 A;  1D2Q A;  1F5J A;  3KVA A;  5M0T A;  4LO8 A;  1O3S A;  3BOW A;  2VOW A;  3S30 A;  2Q5T A;  3OGV A;  1G6N A;  1BEV 2;  3VDD B;  4YZ2 A;  2WQ4 A;  1SAC A;  1KJR A;  4XAB A;  1GBG A;  2PTM A;  4XAA A;  1HB2 A;  1W6M A;  3IKW A;  4ERO A;  2Y6G A;  5JLV A;  2RR1 3;  5IFT A;  4BQ1 A;  1ZRD A;  1OOP C;  3BPS A;  1OC1 A;  4O61 A;  3NAP C;  2R06 1;  3AZZ A;  3CKH A;  3NV2 A;  5DDJ 3;  4MXV A;  5FMD A;  5F37 A;  1LGB A;  3QAC A;  4ASM B;  4JAA A;  1X8E A;  5FUN A;  5LA9 A;  2ZOE B;  2XVG A;  1RL3 A;  1UMZ A;  4QPY A;  4S2F A;  1ZRE A;  2ARE A;  3PU3 A;  3PIJ A;  4E8D A;  3GBW A;  2Q4S A;  2A6Z A;  2BYV E;  1SBD A;  1RUE 3;  1UWW A;  2VUA A;  3ECQ A;  2XPJ A;  1PIV 1;  2ES3 A;  3KV9 A;  4XET A;  2K0G A;  3ZSJ A;  3OGG A;  1JI6 A;  4IEZ A;  2BWC A;  2Q0A A;  4NN0 A;  4SBV A;  4EN9 B;  2ZAH A;  2P4E A;  4DUV A;  1IS5 A;  3OBR A;  4DB5 A;  4NID A;  3EQE A;  2R0F A;  4RHV 2;  3ZSL A;  1U5Y A;  1RUI 2;  2GND A;  2I45 A;  4AED B;  4DRR A;  2AEZ A;  1QJY 3;  4AQ2 A;  2XB6 C;  4GXL A;  1QJE A;  1L7R A;  1OUX A;  2ILM A;  3T30 A;  4Z2W A;  4ZZ8 A;  4D0Q A;  2PHW A;  1LNS A;  2BP6 A;  1X50 A;  1RC6 A;  1WBL A;  3MUY 1;  3P3P A;  5DUW A;  5F39 A;  1VBA 1;  3T08 A;  1C8M 1;  1REE A;  4D94 A;  1QHD A;  4UFH A;  5D8A A;  3FWE A;  3ZFE C;  2HJI A;  2C26 A;  3AKR A;  1OXC A;  3THT A;  4BLJ A;  1IS6 A;  1S0B A;  3NJY A;  4LBL A;  1UX6 A;  3C8X A;  1W03 A;  3KCX A;  2VOX A;  4PLM A;  5FOJ B;  1VRB A;  2W46 A;  3HD8 B;  2YPD A;  4AOC A;  5JOY A;  1AR7 3;  3LIH A;  3O0W A;  2W1W A;  4LMF A;  5IAV A;  5LK5 A;  5A3N A;  2D97 A;  1IS4 A;  2OPK A;  2RMU 2;  3HOB A;  1HRV 3;  1Z7S 1;  1H2N A;  5JXG A;  3A7Q A;  1KS4 A;  4IND A;  4URT A;  3ZN6 A;  5C8C A;  1D4M 3;  4DIQ A;  5LBE A;  5LZ6 A;  1RUN A;  1BKZ A;  2EXI A;  1TMF 3;  3VD7 A;  3K2O A;  3W5M A;  1C1F A;  5EQU A;  1AYM 3;  2GC3 A;  1SG3 A;  2VR4 A;  3AKQ A;  3AYE A;  1W2A X;  2RDR A;  5CFD C;  3JB8 A;  4AVC A;  4IUG A;  2WZR 3;  4IEP A;  4DS0 A;  4GH4 A;  1UY3 A;  1O3R A;  1K5M C;  4YVS B;  4UW6 A;  2DVD A;  2PAK A;  1PVC 2;  3ZFG C;  3FBM A;  1SDD B;  1DLC A;  2RDN A;  1NE4 A;  4N8M A;  5JOW A;  4I0A A;  4KG8 A;  5IW0 A;  1PIV 2;  4ES9 A;  2E63 A;  2WWS A;  1CES A;  1PZ9 A;  5A7W B;  5C4W A;  4UFK A;  3I2O A;  1HRI 2;  4NRQ A;  4CUC A;  3Q8E A;  2BVB A;  2SBA A;  3WSO A;  3BIE A;  1C3H A;  4P9J A;  1OPM A;  2YBP A;  3K4Z A;  3ZDV A;  1W9W A;  2CGO A;  2W9X A;  5IFP A;  4MAD A;  1JXN A;  4E4Z A;  4FPF A;  5IJR A;  3IPV B;  3NST A;  1VRH 3;  3WNO A;  3NO8 A;  1JTZ X;  1LOC A;  3UT0 A;  5AC9 2;  3O1P A;  3ZSK A;  1ULF A;  2XBO 2;  4BIF A;  5KXB A;  1AYN 1;  3DCQ A;  4QGN A;  5CKQ A;  5CB7 A;  2ADE A;  3LEI A;  3I3Q A;  1O3Q A;  1JYW A;  3LFI A;  3FFQ A;  4FXG B;  1MS1 A;  5D2A A;  2FHR A;  1QJX 3;  4WBB A;  5L73 A;  4XQD A;  2JDP A;  1NCQ A;  1O59 A;  3H50 A;  1NA1 C;  2OQ7 A;  5T5P A;  5FZD A;  4XJW A;  1LGN A;  5IVF A;  2W5F A;  5JIA A;  3ZFF A;  5F3E A;  3LA7 A;  2WQZ C;  5A6Y A;  2H0B A;  2WL1 A;  4MHU A;  1NCR B;  3CZJ A;  3O1O A;  4IEQ A;  2EIC A;  1W6P B;  1UN1 A;  2CAU A;  1HQL A;  5F2W A;  1O4Z A;  2XLG A;  5JOX A;  4JDO A;  4CEY C;  1QEX A;  2H6C A;  1XPW A;  3ASI A;  3CO2 A;  4ONU A;  3U78 A;  4EQV A;  1HQW A;  2BFU S;  2VUJ A;  3T2O A;  3SH4 A;  5BNO C;  2R1D A;  1BBT 3;  4XDQ A;  4A3Z A;  4OLL A;  3RYR A;  1QOT A;  4O7X A;  2ZGO A;  1V6N A;  1S2E A;  1XND A;  1US3 A;  1BMV 1;  3E5X A;  3VBR B;  4LO6 B;  5FPX A;  1APN A;  1I5Z A;  3T0A A;  4E8C A;  1SZB A;  5HPO A;  1OBN A;  4FOV A;  5FZM A;  3CBN A;  4LKD A;  1UCX A;  4D7Y A;  4DMI A;  3FL7 A;  1N47 A;  2VBD A;  1DG6 A;  4WVW A;  2JE9 A;  3RZL A;  2QQO A;  5D1I A;  2TEP A;  4EV0 A;  1SLT A;  2XVK A;  3ZYF A;  4AHW A;  3WP3 A;  5FXW A;  1SFP A;  1W6O B;  2FCV A;  2Z4F A;  5DXD A;  1I6X A;  4RGK A;  4CCD A;  3LFM A;  4HON A;  3U4X A;  1GNZ A;  2DUR A;  4YPJ A;  5IK4 A;  1A3K A;  2V5Y A;  3UV9 A;  1NLS A;  3FHA A;  3POS A;  1E5I A;  4FAH A;  4B4R A;  4E4S A;  1SQ4 A;  2QQI A;  5FPZ A;  2D3R A;  4M0N A;  5C5T A;  1V6I A;  5F5Q A;  1O5U A;  5BNP A;  1O7F A;  2A6X A;  3PUQ A;  1CWP A;  4KL1 A;  1GZT A;  2LUW A;  5J48 A;  2RS3 2;  3J26 N;  4KGQ A;  3Q8C A;  1N3Q A;  3NWK A;  3KT1 A;  4K21 A;  3HNM A;  4Q2F A;  5F8P A;  3B00 A;  4Q4W 3;  1J3P A;  2XLA A;  3CMG A;  2HWC 1;  3H7J A;  2J1R A;  4FOQ A;  5E1R A;  1XNC A;  3OGR A;  3V0B B;  4HOO A;  3PUA A;  1YFU A;  3VBS B;  5A3M A;  2F4L A;  3JUU A;  4L0P A;  1JZ5 A;  1ULO A;  3GZT B;  5JZG A;  4J1X A;  3SKV A;  3KT7 A;  2VZT A;  3KF3 A;  1RUD 1;  3M1H A;  2OT7 A;  3E6C C;  2VU9 A;  4K20 A;  2WNV A;  4QPI B;  2XR4 A;  2JB4 A;  3VDD A;  1JZ8 A;  1JYI A;  2GME A;  2PQQ A;  2VY0 A;  5FBJ A;  2VTX J;  4QU1 A;  5CNA A;  3RNS A;  4YWA A;  3ZXE A;  5F3I A;  1JBC A;  1RMU 3;  1MEC 3;  1RIR A;  1UY0 A;  1UNB A;  2JXA A;  2PMW B;  1ZRF A;  2B4K A;  2V73 A;  3CJI C;  1HN0 A;  1HXS 3;  2CNA A;  2JG9 B;  4CSW A;  2WZE A;  3AVR A;  1YQ8 A;  5LA1 A;  2R6Q A;  4FTB A;  2BU9 A;  3AJY A;  1SPP B;  1YUD A;  4MET A;  5GZC A;  1G9A A;  1DGW X;  4B8E A;  4WZF A;  3AKS A;  5K9Y A;  2JDK A;  4IE5 A;  1WMX A;  2WN2 A;  2P3K A;  5LBF A;  3ZXK A;  2ZKN A;  4M00 A;  2X09 A;  2WRA A;  3N7K A;  1HIX A;  1PMJ X;  4EJR A;  4GMP 0;  3OTF A;  1IG3 A;  2WA4 A;  3I2G A;  3K48 A;  3DPR B;  1ENR A;  1V9U 1;  4HFS A;  4ISR A;  1MZE A;  1ND2 C;  2HYK A;  4RFT 0;  4V1P A;  1YQ5 A;  3M70 A;  2YB7 A;  4AED A;  2BRT A;  3VL9 A;  3H0O A;  2WT1 A;  3UYJ A;  3A21 A;  4QQH A;  3CL1 A;  1BVV A;  4TSV A;  4Y4R A;  4FBF A;  2WYS A;  2VNV A;  1C5H A;  2X5I B;  2G9F A;  1UIK A;  3OBA A;  4QPG A;  4CDQ B;  3USU A;  5A6X A;  1WLD A;  3EHK A;  3GGL A;  3TBD A;  1UOF A;  2HWD 2;  3U14 A;  1OLM A;  4LBQ D;  5I91 A;  1C28 A;  1V6K A;  2PHR A;  5FAX A;  5A3U A;  2W92 A;  1LHV A;  1BXH A;  1LED A;  1RUH 3;  3ZKY A;  3D5O A;  2VNR A;  5FP8 A;  3IDB B;  3VZL A;  4QKD A;  1OQD A;  4RR3 B;  1MPX A;  3MLL A;  3GDB A;  3OCP A;  1CAU B;  4XPV A;  1A8M A;  2XH6 A;  1EY2 A;  2DVA A;  4JDM A;  4XUP A;  3WUC A;  2YFU A;  1FYU A;  2PLV 2;  4OI4 A;  3K4D A;  5A3O A;  3ZYR A;  1OHF A;  2D98 A;  5LCW L;  4CYD A;  3GNE A;  4N9I A;  2WT0 A;  2R06 3;  2NYY A;  4GWN A;  4JX0 A;  4OVE A;  2CSG A;  3L2H A;  3WP4 A;  1CZS A;  5A70 A;  4COU A;  1H8V A;  1W6N B;  2C4X A;  2JDA A;  3VKF C;  4XMA A;  2QVS B;  3U11 A;  2XJQ A;  4KU8 A;  2A3X A;  4AQ6 A;  4MSV A;  4XEZ A;  1SLC A;  1YQC A;  4O9G A;  5J98 B;  4A7K A;  2D6L X;  3BTZ A;  4FPY A;  3EJK A;  1LHO A;  4Q4V 1;  3GAL A;  1VB4 A;  1KQR A;  2OPW A;  1Q56 A;  4FI9 A;  2UY9 A;  5F6L B;  3ZYP A;  4EN7 B;  1TNF A;  2ZGQ A;  4PF5 A;  5AVA A;  4IEX A;  1LOE A;  3I97 A;  5CU1 A;  2Y38 A;  4YGE A;  2GAU A;  3BVC A;  3WD5 A;  1J84 A;  1VMJ A;  2JE7 A;  3I4I A;  4GAL A;  3RMX A;  1OSG A;  4Y26 A;  4YVW C;  5FZC A;  1Q43 A;  3RRD A;  3VZO A;  1Y4W A;  1OD5 A;  1WW7 A;  4LKE A;  4A2U A;  1VAM A;  5A7W A;  3O7O A;  2YDE A;  5GKA C;  2ZGU A;  2BPA 2;  4BDV B;  2VQT A;  1F2N A;  2YMZ A;  4W6W A;  1YHF A;  3GYD A;  5EP9 A;  5JMO A;  2HWB 2;  2VBP A;  4UT5 A;  1QXJ A;  2X53 S;  3UKN A;  1XE7 A;  1DQ4 A;  4KQ7 A;  1QQP 1;  1VBA 3;  2WNU C;  2QQV A;  1C8M 3;  1JYC A;  1KFX L;  3IPV A;  5FYZ A;  4A7Z A;  3P3N A;  5L9B A;  2Y0I A;  1RUF 2;  3WQB A;  1YFX A;  4CTE A;  3HBZ A;  3LDR A;  4CXY A;  4BCU A;  3C7G A;  3QH6 A;  4XBL A;  3EYP A;  5HV0 A;  5FRA A;  4HK8 A;  2D3P A;  2HWE 1;  3MDP A;  4LE4 A;  3CHX A;  2DCK A;  3OPZ A;  3ACF A;  2R07 1;  4KMQ A;  2GDF A;  1SCR A;  1WD4 A;  1ZRI A;  2HKX A;  5FV3 A;  1JUH A;  1YYN A;  1PK6 A;  2EAL A;  3VBH C;  5ABJ A;  4CA9 A;  1Z7S 3;  2W39 A;  3H3U A;  5KHK A;  5FY9 A;  5JXI A;  1QIQ A;  1NCR A;  3HBK A;  4UF0 B;  1MQT B;  1RXG A;  1PX4 A;  2AC1 A;  2CV6 A;  1VE0 A;  2K9Z A;  1W6P A;  2O8O A;  3PVB B;  4L8Q A;  3T2P A;  4WZC A;  5CG9 A;  3MID A;  5LRR A;  2X05 A;  1GR3 A;  3GBF A;  4BQ2 A;  4B1M A;  4XFF A;  2R0H A;  2QUO A;  1FPN 2;  1HJF A;  1AR6 1;  2GU9 A;  3AMN A;  4IV1 B;  4CEW B;  1IGO A;  1DHK B;  4M01 A;  1AX1 A;  3FUO A;  3MIB A;  1BYH A;  1VAL A;  2XON A;  1HB4 A;  1DYP A;  4R4X A;  5FYV A;  3EXU A;  3VBR A;  1H8T C;  2FMD A;  4NHM A;  1H4G A;  5A3T A;  3T4V A;  1BHG A;  2XML A;  4JVA A;  4R52 A;  2D44 A;  1YFY A;  1KFU L;  2ZGP A;  4UWD A;  1A6C A;  1AR7 1;  1IKQ A;  4A6O A;  5FRE A;  2D40 A;  2PHX A;  2Q1F A;  2E7A A;  3U0Z A;  5HCH A;  4QGL A;  3ZX7 A;  3GZA A;  2JKX A;  4IEW A;  2YGL A;  5IVC A;  1DZQ A;  1QNW A;  1ZZC A;  1CPM A;  1YLL A;  4LUM A;  4XAC A;  5FPV A;  1CX1 A;  2OUJ A;  4R9D A;  4XVH A;  5CIR A;  5EJ1 B;  2C24 A;  3N35 A;  1K45 A;  1W6O A;  4D6S A;  1AYN 3;  2EAK A;  1MS3 A;  2RR1 2;  4SLI A;  2QQM A;  1STM A;  1S0F A;  2J22 A;  1QQP 2;  2RHP A;  4LK6 A;  1X82 A;  1GZ9 A;  3WF1 A;  2XKP A;  4JTO A;  1RYY A;  2XDV A;  5DDJ 2;  3WP5 A;  1J58 A;  4AEK A;  1VBE 1;  1ULE A;  3K46 A;  2EXH A;  4NO4 A;  4M3C E;  4D3W A;  3SCH A;  3AZY A;  3SH5 A;  4QD2 A;  4ZXE A;  4KWU A;  1VBB 1;  4XOG A;  1TVG A;  3LOI A;  2W47 A;  1RUE 2;  4AGR A;  4DY3 A;  2QCS B;  2FDG A;  5SV8 A;  3J8F 1;  3FX3 A;  3ZO0 B;  1R64 A;  1N1Y A;  4JGY C;  4KWL A;  1O4Y A;  3VLB B;  2R04 3;  5TSW A;  4BYY A;  1NY7 1;  3VDB A;  1QJZ A;  1JOP A;  5GLV A;  1DGR N;  4I3P A;  1OA2 A;  4XIK A;  3URF A;  1SLB A;  4BOW A;  3MZH A;  3VKM A;  2ZPX A;  4Q0V A;  1IPK A;  1NXM A;  1QJY 2;  3V0B A;  3KM5 A;  2PQS A;  2HLE A;  2VZ1 A;  3U75 A;  1PGL 1;  4FQ4 A;  4NPM A;  3ZFE B;  4C8D A;  4UW4 A;  4AI2 A;  1UXX X;  2ZEW A;  3RZJ A;  3S6P A;  2ZHK A;  5FZ1 A;  3ENR A;  3THC A;  2XJR A;  3MLJ A;  4H2A A;  5DN2 A;  1FOD 1;  1WLW A;  3WF2 A;  2VCC A;  3WCS A;  5FOB B;  3T0D A;  3UL2 A;  3T1M A;  4CDW C;  3SMH A;  1POV 1;  1WCD J;  2P2K A;  3SEE A;  5SV5 A;  5FZ8 A;  4X8P A;  2WLQ A;  1E5S A;  4C1W A;  5C8C B;  4QDQ A;  1ZRR A;  1AR7 2;  2P17 A;  3AX4 A;  3JCI A;  1AR8 1;  2IVJ A;  2JG9 A;  1HRV 2;  3KT4 A;  1D4M 2;  3RI8 A;  4NOT A;  5DAP A;  5CBL A;  1TMF 2;  3DYM A;  2VM9 A;  1SPP A;  2LS6 A;  4D6R A;  4OMC A;  2CDO A;  4XDO A;  1AYM 2;  3WNX A;  3R05 A;  5C9A C;  3H8X A;  1BK1 A;  2BOJ A;  3I54 A;  4CDU C;  3FLR A;  1K5M B;  2BNN A;  3OPW A;  4EN8 B;  5LA2 A;  3INA A;  2YFZ A;  3ZFG B;  2RE9 A;  4X8N A;  4ZHN A;  5H9R A;  2WZR 2;  3LAG A;  2O1Q A;  5C3O A;  2ZEZ A;  5C4W B;  4M0H A;  4TZD A;  3E5U A;  3RQ0 A;  1I5P A;  1N1S A;  5FZL A;  3K3O A;  1YQ2 A;  3AXE A;  2I07 B;  5I8S A;  3LWC A;  3KHC A;  3ILN A;  3MBW A;  2X5I A;  3J8F 2;  3POY A;  4GKX A;  2YG0 A;  3FE5 A;  4N43 C;  1XNK A;  2HWC 3;  4R9C A;  3WXP A;  4ASL A;  1WBF A;  1JUI A;  4AFD A;  4FPC A;  1V6O A;  4QX8 A;  1RUJ 1;  1DQ6 A;  1ND3 C;  1DZR A;  1RUD 3;  4PLO A;  4COW A;  3I7D A;  1CIW A;  4GWJ A;  1VRH 2;  4AFC A;  1MS8 A;  1LHU A;  3B93 A;  3QOP A;  5GLT A;  2BDR A;  5FZ4 A;  2WAA A;  5C7G A;  1CAU A;  3O12 A;  3J7M A;  2E6V A;  1NCQ B;  5FY0 A;  4BLI A;  3W58 A;  1BZW A;  1LKN A;  4X6R B;  1LR5 A;  3ILF A;  3HNY M;  4YW4 A;  5K0U C;  4LBM A;  5K0U A;  1UY2 A;  5KHI A;  5CFC C;  3D8C A;  1W6N A;  1SFY A;  2DVB A;  3GM8 A;  4Z07 A;  3NKG A;  2R16 A;  3JD7 1;  1UYX A;  4OMD A;  3RYK A;  3SKJ E;  3VKO A;  3K3N A;  1OF3 A;  1H0B A;  4UFJ A;  4CEY B;  3K51 A;  3DEC A;  2EID A;  4DOU A;  2A6Y A;  4GB3 1;  4AEM A;  4PI0 A;  3AYD A;  2X10 A;  2YZ4 A;  5DZF A;  1C4R A;  1W8F A;  1G9B A;  3JQX A;  4ET7 A;  5AFB A;  4OHW A;  3VZJ A;  4PDW A;  4HVQ A;  4RSU A;  3TN9 1;  4QXB A;  1V9U 3;  1BBT 2;  1HDK A;  4MHR A;  5HI0 A;  3KCY A;  1GUI A;  1WA6 X;  1GWK A;  3FZ3 A;  1V70 A;  4Q0Q A;  2A3W A;  5FY1 A;  3PDQ A;  3A22 A;  5H9P A;  1W2N A;  4AF9 A;  4KGG A;  3MO4 A;  3ZSE A;  5FTT C;  3M3C A;  4NHX A;  5APA A;  5C71 A;  2OVU A;  3BU7 A;  4XCB A;  3BTA A;  2BTV C;  4HPK B;  1YIF A;  1XNA A;  1WWY A;  4FPJ A;  4MGS A;  5IWF A;  5JOZ A;  1YXW A;  4LXL A;  5FYU A;  3SC7 X;  5K4L A;  3VHN A;  3ACL A;  2Z79 A;  2VTX A;  1O8P A;  1PVX A;  3LE0 A;  3UJQ A;  4EN6 B;  4YZ5 A;  1NG0 A;  2VO5 A;  3PME A;  3H8O A;  4YAR A;  4LLO A;  3B01 A;  1W28 A;  3I2I A;  3PVO A;  2ZEX A;  2RVA A;  3ZYH A;  2WWU A;  5C33 A;  2ARB A;  5BNP B;  3DKQ A;  1NT0 A;  5IK5 A;  1GLH A;  4FPH A;  4UF0 A;  1MQT A;  3OUI A;  1OKO A;  5DAV A;  1X33 A;  3HQR A;  3LA2 A;  5GLZ A;  5FK8 A;  3NL1 A;  2FBE A;  2KA3 A;  3AVS A;  5HXV A;  5ISL A;  1XSQ A;  2CWM A;  4QX7 A;  5FKC A;  3V56 A;  3TOJ A;  3VV1 A;  4AZZ A;  2KXL A;  3N9Q A;  1DCS A;  4Q4V 3;  3AKP A;  5A80 A;  3VD5 A;  4ARX A;  3WY6 A;  4CDX C;  2F6B A;  1TZO A;  2P6C A;  4YW1 A;  2RDS A;  3RS6 A;  4JGZ C;  5FZO B;  4CEW A;  3K75 B;  2ET1 A;  1VMF A;  4UW3 A;  4E9K A;  4F3J A;  1TQ5 A;  4OUS A;  4I02 A;  1MZF A;  2WO1 A;  4Q4W 2;  4URA A;  3PVN A;  4XZP A;  3WT3 A;  4S2G A;  5C3P A;  1PGS A;  1PO1 1;  2OW4 A;  2WR9 A;  1H6X A;  5FUP A;  3SQO A;  2A6V A;  2JDZ A;  2SLI A;  3DV8 A;  4MVT A;  1DU3 D;  5JPM B;  1T2X A;  1NZC A;  4DY5 A;  4EWD A;  1JYT A;  1F35 A;  2VNG A;  2WNV B;  4WV8 A;  4CXX A;  1ZBE 1;  1PGW 1;  2DVF A;  1CAV B;  2UWA A;  2XG3 A;  3D0J A;  4OUL A;  2ZA9 A;  3ZN4 A;  4QHO A;  1AHS A;  5BY5 A;  1J1T A;  2B9V A;  1XJA A;  3ZOI A;  4Z92 B;  2FZ2 A;  4QM8 A;  4YM1 A;  5FZ6 A;  4IV3 C;  1QQP 3;  2B46 X;  2Q30 A;  4LUL A;  1OOP A;  2O8Q A;  4XQ4 A;  4FOW A;  5CIS A;  2JD9 A;  1ULD A;  1MZ5 A;  3H3L A;  3CJI B;  3NAP A;  4EWE A;  2BBV A;  2JDM A;  2VXR A;  2V5D A;  4DZG A;  1WLT A;  2XHN A;  3NV3 A;  1RMU 2;  4UAP A;  1MEC 2;  5GZE A;  1LES A;  3WIN E;  2XJT A;  4AGV A;  4QX3 A;  4P5H A;  2HWE 3;  1HXS 2;  5IHR A;  4QDR A;  5FFO C;  2R07 3;  5DMY A;  4XFH A;  1HB3 A;  1VB2 A;  1QJF A;  1W9S A;  3RDI A;  4K40 A;  4ZS2 A;  1MS5 A;  4E27 A;  5C6C A;  3OSD A;  1IPS A;  2WBK A;  4LBJ A;  3WW3 A;  1GQP A;  4Q0P A;  2XUM A;  1R09 1;  5BNN C;  5A7O A;  4O9E A;  1UXZ A;  1OT5 A;  4L92 A;  1GNY A;  4HVR A;  3U37 A;  1QH6 A;  1JHJ A;  1AJK A;  3MEP A;  4OHZ A;  3PUH A;  1H9W A;  4H7M A;  1F8V A;  3LB9 A;  2WSV A;  4WM7 C;  1AR6 3;  1W3X A;  2RV9 A;  2VZV A;  1D0G A;  1C57 A;  3IM0 A;  4QPG B;  4LBO A;  3USU B;  5ACA 1;  3AMM A;  3CNA A;  2PFW A;  4MV2 A;  3GJB A;  5EHD A;  4LIU A;  3ZFE A;  5IAT A;  3ABZ A;  4RYD A;  4A6S A;  2CY6 A;  2RS5 1;  1FNZ A;  3MGU A;  3ROU A;  5BUV A;  5CA6 A;  1UX7 A;  4S2D A;  1UIJ A;  5LY1 A;  3PL0 A;  3RZH A;  4AWD A;  4XF0 A;  2AEN A;  4RGA A;  2MNG A;  1UU4 A;  3LKJ A;  2XQX A;  3PUI A;  2YRO A;  1W2U A;  2PN5 A;  3IB3 A;  1RUH 2;  2VMH A;  4BHP A;  4CCM A;  2XLF A;  5FYM A;  1H1M A;  1DP0 A;  2VZR A;  1W99 A;  1VJ2 A;  3HJR A;  4QKF A;  4DO0 A;  4XJU A;  1XYO A;  3PTR B;  4D7S A;  1MS0 A;  2ZMN A;  4CUG A;  2WFP A;  3J7L A;  3WG1 A;  3T2Q A;  5I8Y A;  3RYP A;  3PJY A;  5FZB A;  5CFD A;  2R06 2;  1NX9 A;  1TE1 B;  1G86 A;  4BQY A;  2V4A A;  4LOR A;  4UFI A;  1VBE 3;  4QX1 A;  5JR7 B;  4YFZ A;  1AXK A;  1Q8P A;  3NJZ A;  2ZJC A;  4DUX A;  1ASJ 1;  1CN1 A;  1K5M A;  1Y43 B;  2DFC A;  2IXL A;  4OFG A;  4CP0 A;  1VBB 3;  1US2 A;  4PI2 A;  5FJK A;  3ZFG A;  1D0H A;  2HWF 1;  4RD7 A;  3J8F 3;  4HAN A;  1OLR A;  1TNR A;  3OBZ A;  3POJ A;  2ZS6 B;  5DQ0 A;  4QXK A;  1A78 A;  1LOB A;  2QQU A;  4JHZ A;  2WYF A;  3ZKU A;  3C2U A;  4YW3 A;  1R09 2;  2IZW A;  5IAX A;  3U10 A;  1JOD A;  2VZ3 A;  4XMI A;  2RM2 1;  1JHN A;  3V65 A;  2E33 A;  2WNU B;  2WT2 A;  2VMI A;  3VD9 A;  3GCW A;  4ZU7 A;  2ADD A;  3BN6 A;  4ORF A;  4AHX A;  5GLU A;  1VBA 2;  5T5J A;  1C8M 2;  1IG0 A;  4YM0 A;  3OEB A;  1EUT A;  2J1U A;  1H6Y A;  4MO3 M;  4QB2 A;  2FQP A;  3Q9O A;  1UYY A;  3M8L A;  4XBQ A;  1FOD 3;  1PZ8 A;  3N4M A;  2DU0 A;  1M06 G;  2NP0 A;  4RS5 C;  2RS5 2;  1UL9 A;  3T09 A;  1NA1 A;  1PK6 B;  1POV 3;  3VBH B;  5ABJ B;  5C3Q A;  3MFC A;  2PHL A;  3KV5 A;  3KLS A;  4TYS A;  3TRS B;  2IVI B;  4FFG A;  2BNM A;  3O1U A;  1CJP A;  1AR8 3;  1NLR A;  1O8S A;  1SBE A;  2R04 1;  3QBQ A;  5JXH A;  1Z7S 2;  3FUQ A;  2WQ8 A;  3KWV A;  3PNA A;  4AG4 A;  1QF3 A;  2WO2 A;  4ATE A;  5J7M A;  1QOO A;  2D93 A;  3III A;  3K77 A;  4GD4 A;  5DZE A;  2VW1 A;  3MW3 A;  4FAG A;  2ZHM A;  2D5H A;  4CEY A;  3ZPY A;  4XXA A;  2WAO A;  5F1R A;  5GZD A;  4QHB A;  1WW6 A;  2IXJ A;  3DYO A;  3AL5 A;  1ODN A;  3HNB M;  3MF6 A;  5BNO A;  3CF6 E;  2FD8 A;  1LU1 A;  1WW4 A;  1QJU 1;  4M3C B;  1PM7 A;  4V2V A;  2ZGM A;  4LO5 B;  4QKN A;  1I3H A;  1IHM A;  4IES A;  1QY4 A;  4MXW A;  5J96 B;  4BZ4 A;  2WNO A;  1UPS A;  4PIY A;  3O0V A;  2PHU A;  1ZZ9 A;  2ARX A;  1UY4 A;  1SLI A;  2WFF 1;  2ZGL A;  1L3J A;  4EYU A;  1FMD 1;  2C9K A;  1Y7B A;  2JDN A;  3VBO C;  4LBN A;  1R1A 1;  2Q8C A;  4DXZ A;  2K2S A;  4G4F A;  4TLG A;  2DTY A;  3S0M A;  3M4F A;  4HPK A;  4XJ9 A;  2W2I A;  1VBD 3;  2FMY A;  2PAM A;  4IE4 A;  4HET A;  5G05 L;  3I2F A;  2Y6F A;  5T5L A;  4F83 A;  4MZU A;  5KBF A;  1RUJ 3;  4B1L A;  2A3Y A;  3JXS A;  2ETE A;  2OUH A;  3VBU C;  4LTA A;  2DV9 A;  4CU8 A;  1SMV A;  5JI9 A;  3SH3 A;  4WVV A;  1B09 A;  2UY8 A;  2YBS A;  4GIQ A;  1AYN 2;  3O1R A;  3BB6 A;  1AX2 A;  2CHH A;  4UFL A;  4FP3 A;  3W59 A;  1UPI A;  1COV 1;  4W8J A;  1KDK A;  5C70 A;  5DZG A;  4KBB A;  2FDK A;  4G9S B;  2VC9 A;  2ZZJ A;  1RGS A;  1UQX A;  3MI8 A;  5I0T A;  5I0S A;  1RXF A;  4CE8 A;  4YNI A;  2Y26 A;  3DN7 A;  3HQU A;  1ALY A;  3W21 A;  4B4Q A;  5C8W A;  2GNT A;  3JD7 3;  1ZRC A;  4L99 A;  2W0X A;  3WNL A;  1Y3T A;  1HB1 A;  4WM8 C;  4XCA A;  4OI1 A;  4GQ7 A;  4MOA A;  3N9N A;  5CYY A;  3RVH A;  2R04 2;  2W1S A;  1PM4 A;  4GB3 3;  3RFR A;  5FZO A;  2FCU A;  2DBN A;  3FBY A;  3MIC A;  3WF3 A;  1B35 C;  2EXJ A;  4DXR A;  4K1Z A;  4NPL A;  1W8H A;  3JBG 1;  3NVC A;  3BYW A;  2B5H A;  2BJS A;  2JEC A;  3RZM A;  5A1A A;  1CGP A;  1U5Z A;  3TN9 3;  5FQ0 B;  4A42 A;  5BV6 A;  5LW9 A;  4N9H A;  2NZ9 A;  3HIF A;  1LJ7 A;  2W08 A;  3MIE A;  1CAV A;  1WLC A;  1X8M A;  1BMV 2;  4N53 C;  4Q1R A;  3K4A A;  4N53 A;  2XL9 A;  2DCT A;  4AI3 A;  1GZW B;  4NAM A;  2ID4 A;  2Y6L A;  5IVY A;  4CDW B;  1MS4 A;  2JIG A;  4M4P A;  4P9W A;  1AJO A;  5A33 B;  3HN1 A;  3NJV A;  1FAT A;  3PJQ A;  4PLN A;  4R9B A;  5GAL A;  1GV9 A;  3CJI A;  3WV6 A;  1OA4 A;  4QAW A;  1F4A A;  3Q8F A;  4LQR A;  1R1A 2;  3KSC A;  2CAV A;  4WVZ A;  1UU6 A;  1GFF 2;  1V00 A;  3D82 A;  3FJS A;  1QKQ A;  3ELN A;  3RJR A;  2ZGS A;  3M7A A;  4MGI E;  3Q8A A;  3AZX A;  4ASK A;  4U2A A;  3H7Y A;  1O4T A;  2JD4 A;  2XWJ B;  2BW8 A;  4D6Q A;  1VBC 1;  3N36 A;  3R4D B;  4XFI A;  3SIT A;  5C9A B;  4CDU B;  4C90 A;  4CCO A;  4NIG A;  5FXX A;  1GOG A;  2JG8 C;  1UZY A;  2WAB A;  3NNG A;  3POG A;  1ND2 A;  2D6N A;  2JJ6 A;  4NWW A;  1LOG A;  5JSP A;  2J7M A;  4L11 A;  4TLF A;  3DXU A;  2WII B;  3IN9 A;  4BWO A;  2WIN B;  4HKO A;  4A4A A;  5FYS A;  2WO3 A;  2WNE A;  3GXU A;  5FO7 B;  4N43 B;  1Q3E A;  3OJB A;  3DEM A;  5L9R A;  4YGC A;  5T55 A;  2GNM A;  5CAZ A;  3WQ0 A;  1NLQ A;  5FLI A;  5FP9 A;  3KD4 A;  1F4H A;  1OLQ A;  4FPO B;  2J1A A;  2HWC 2;  1TME 1;  5B2G B;  1ND3 B;  1PO1 3;  1CX4 A;  4IEV A;  4XFC A;  5EYX A;  3NRU A;  4R4Z A;  1R08 1;  3H1Y A;  4I3G A;  2VZP A;  3OY8 B;  4XJ8 A;  1OMI A;  1ZBE 3;  1E5R A;  3I2J A;  5FO9 B;  1ZBA 1;  1RUD 2;  3H8U A;  5HV4 A;  2VOT A;  2ZGR A;  2ARA A;  3ZR6 A;  3VDC A;  5L7O C;  4QB6 A;  4QU2 A;  5FYI A;  5K0U B;  3VUO A;  2E7T A;  3I3M A;  1S4C A;  2ENR A;  1H1A A;  1LEN A;  5CFC B;  1MS9 A;  4W50 A;  1HKD A;  5IVV A;  4AVV A;  4CCL A;  3BTX A;  1BQP A;  4PIX A;  1PO2 3;  4BQ4 A;  3BU0 A;  4J6G A;  1PX3 A;  2K46 A;  3HEI A;  1H1I A;  4Q4Y 1;  3WNP A;  1AL0 G;  4C91 A;  2W95 A;  4HT1 T;  1KGY A;  2BER A;  5FMO L;  1DYK A;  2AEY A;  2DFB A;  2AAC A;  3GHN A;  4FFI A;  4M3C F;  4LE3 A;  2QQK A;  1O6U A;  4JQR A;  2CDP A;  3AXD A;  4YVW A;  1GSL A;  2YC4 A;  4PDW B;  5C3S A;  5BPX A;  1R09 3;  3B9C A;  4FCA A;  1WGP A;  4Y20 B;  4Q5O A;  4E2S A;  3RPQ A;  1JS9 A;  1XE8 A;  4K3U A;  4MGQ A;  2VMF A;  1ONA A;  5IK7 A;  5CEH A;  4LBQ A;  1N1T A;  1V9U 2;  1W8N A;  1M4W A;  2W91 A;  1WCQ A;  4W4Z A;  5GJ6 A;  1CAW B;  1MAC A;  3IT8 A;  2YC0 A;  4QHZ A;  1XXN A;  5FXZ A;  5H9S A;  3BOP A;  2WNU A;  3POF A;  4QX0 A;  5LY2 A;  4AXO A;  4YVS C;  5ACA 3;  3ZXA C;  4FSJ A;  2RG4 A;  3PTY A;  3R4U A;  5FZ7 A;  4E4H A;  4MG2 A;  3TNQ A;  1V0A A;  2RS5 3;  3RI9 A;  5FDB A;  1E5H A;  1LOD A;  4DXT A;  1T6B X;  4B7K A;  1V6L A;  1AL2 1;  1K3I A;  3AP4 A;  2Y64 A;  3KVB A;  3V0A B;  2CWS A;  2A71 A;  3VKN A;  1TME 2;  3H42 B;  1TG7 A;  4YG6 A;  2G9Z A;  5FZK A;  2VTF A;  3SXW A;  4LHL A;  4QPW A;  3VBH A;  2A70 A;  4LOS A;  4Y5S A;  4CUB A;  4DQA A;  2C0Z A;  3FHQ A;  4QQ2 A;  5IVB A;  4RN5 A;  1RHI 1;  4TWT A;  1K42 A;  3LA3 A;  1ZA7 A;  3KB5 A;  4DRV A;  4DXS A;  2GH8 A;  1EV1 1;  2JIJ A;  3UET A;  4R8H A;  4Q8K A;  1J3Q A;  1OFN A;  2P6H A;  1QGL A;  2MHF A;  2YPJ A;  4DPN A;  3WW1 A;  4AEJ A;  4U36 A;  4YRD A;  1KIT A;  5FWJ A;  3POI A;  3OD4 A;  4TXW A;  2VZO A;  3E97 A;  3I3B A;  4NVP A;  1XNT A;  2JEN A;  3RWN A;  3ZMO A;  1OF4 A;  2QDR A;  4CDX B;  3BPZ A;  5A1L A;  5JAX A;  1JZ3 A;  1W90 A;  3T0B A;  2NMO A;  5I0D A;  1ASJ 3;  1KEX A;  2B9U A;  2CU5 A;  4JGZ B;  2UYB A;  5FYY A;  4M3C A;  4Y1V A;  3ACG A;  3GZU C;  4P14 A;  2KD7 A;  4LA3 A;  5FZ9 A;  5JCT A;  4TTG A;  2EVX A;  4Q4V 2;  2HWF 3;  1W2O A;  2DUO A;  2G19 A;  3B7M A;  1LU2 A;  1Y9M A;  2ZAC A;  1H8T A;  1UYP A;  2XJP A;  3ZR5 A;  1ZYB A;  2MPF A;  2P34 A;  1QU0 A;  3PHM A;  1RB8 G;  3VB9 A;  3U07 A;  4N7I A;  3UKV A;  3WG4 A;  4LNV A;  2PHF A;  4PJY A;  1K12 A;  4JV4 A;  3UKT A;  2RM2 3;  2YHJ A;  2CGP A;  4IV3 B;  1OOP B;  2VBB A;  4AI1 A;  3NAP B;  3LDK A;  1BK0 A;  1HW5 A;  3TAY A;  1YWK A;  4Y3O A;  3KV6 A;  1RIT A;  4HN0 A;  4PQ9 A;  3O0X A;  4AK3 A;  4LUK A;  2WLP A;  2WJS A;  4IE0 A;  1IZ3 A;  5J37 A;  1F15 A;  3TYJ A;  5L19 A;  4XXP A;  3AFK A;  3M3I A;  2WS9 1;  4AHY A;  3AZV A;  5FMC A;  3WNM A;  4BIS A;  4W6Y A;  3T4H B;  3ZXL A;  5FZF A;  2MEV 1;  3WLU A;  4CPB D;  3EB7 A;  3VN4 A;  3ITQ A;  1W8O A;  2VZQ A;  1SLL A;  2HWE 2;  2R07 2;  2HEV F;  5A7P A;  2NN8 A;  3AFG A;  1Z0H A;  5FZ0 A;  4JGY A;  1NZI A;  3BAL A;  1RVF 1;  2VCB A;  4MGT A;  4JKK A;  4DUW A;  4BQX A;  4PIZ A;  5T5O A;  5HBA A;  2V4V A;  4P5Y A;  4YW2 A;  3IIA A;  2EIE A;  2VQ0 A;  1CQ9 A;  4MUV A;  3UGH A;  1FNY A;  1IOA A;  1EV1 2;  4FXK B;  4HKW A;  4WM7 B;  4AHZ A;  4FOY A;  1F5F A;  5DG2 A;  1CZT A;  1TEI A;  3IDE A;  4RFR B;  4BQ5 A;  5J09 A;  2ZAA A;  3AP5 A;  4LHK A;  3WX5 A;  1QJU 3;  4DEV A;  1W9F A;  2IFR A;  2DUQ A;  1AR6 2;  3AP6 A;  4LKS A;  4NHK A;  2WN3 A;  5DUU A;  5FPU A;  2VE1 A;  5IK8 A;  1GKB A;  5FQ0 A;  4OQ8 A;  3ACH A;  4FTE A;  1A8D A;  1Q8S A;  3ZXD A;  2NPI A;  1JN2 P;  2VQA A;  3GJA A;  3KQ4 B;  1RIN A;  4IQP A;  4A7Y A;  1URX A;  2WFF 3;  2OZ6 A;  2VL4 A;  5IT6 A;  1FMD 3;  1GZW A;  1ACC A;  4ITC A;  3ZXG A;  1R1A 3;  4CDW A;  4YM2 A;  5L9V A;  2B42 B;  3A4U A;  5A33 A;  1SHW B;  1Y9Q A;  4XTM A;  5DUX A;  3VBS C;  2YU1 A;  1XBF A;  4IEU A;  4IL7 A;  4K8F A;  4YFW A;  1ENX A;  3POW A;  3ZM8 A;  4JTN A;  2Z5W A;  3M3O A;  1W6Q B;  5JXJ A;  2ZX2 A;  5CFD B;  1IPJ A;  2D5F A;  4BXS V;  3C7E A;  4XYX A;  3TEZ A;  5E8A A;  4MX3 A;  4XFA A;  2VUD A;  4QPI C;  3WHU A;  1X7N A;  2XJU A;  2Y34 A;  5C9A A;  1GAN A;  1N3P A;  4DNY A;  4CDU A;  1GP6 A;  3WOG A;  1LEC A;  1COV 3;  4CP9 B;  1J83 A;  1KD7 A;  2TBV A;  2Y8K A;  1VBE 2;  4PF1 A;  2QZ3 A;  4XQW A;  4L97 A;  4ZY9 A;  4LLF A;  2ZKL A;  4G3Y C;  1ZA4 A;  2C6S A;  5KHG A;  3WG3 A;  1SFN A;  1JZ2 A;  3J7N A;  4GZ9 A;  3H1M A;  1VBB 2;  1UO9 A;  5EJZ B;  4QT6 A;  5FZE A;  3GF6 A;  3KV4 A;  1D2S A;  2XKO A;  5A32 A;  2HH9 A;  2J1S A;  1UW8 A;  2PEL A;  4N43 A;  3ZYJ B;  3AJZ A;  1RVF 2;  2OA2 A;  1EP0 A;  3OB8 A;  4Y1Y A;  2Q8E A;  3J4U H;  1ZZ6 A;  5CZK A;  1VBD 1;  1P8J A;  2D6M A;  4KWJ A;  2QTW B;  1NY7 2;  3WDT A;  5C5U A;  4I09 A;  1AR9 1;  3POB A;  3JBG 3;  1RUG 1;  3AKT A;  1ND3 A;  2E31 A;  3POE A;  4PCR A;  1ULP A;  3BCW A;  2VVE A;  3DPR C;  2ARC A;  4BM8 A;  3OY8 A;  1EAH 1;  4Y24 A;  1YJL A;  4AI9 A;  1PGL 2;  2QZ2 A;  3FC0 A;  5JUV A;  3WDV A;  4IGO A;  4RS5 B;  2H6B A;  2RS1 1;  3Q8B A;  4EWA A;  2JDH A;  1NA1 B;  3ETP A;  2B39 A;  1C8N A;  1W8T A;  1OVS A;  2ZGT A;  4COV A;  4CDQ C;  4OHY A;  2YV8 A;  1FOD 2;  1W0N A;  3JB4 C;  2IWG B;  4OZX A;  1YIP A;  3CEW A;  3I8T A;  3FFZ A;  2XL7 A;  4X6Q B;  5CFC A;  4Q4X 1;  4GAZ A;  5B4X A;  3MPP G;  1UY1 A;  1H30 A;  3KMH A;  1ULC A;  2Z2S B;  4IEO A;  4MLO A;  3ZYI B;  4RR3 C;  5FWE A;  1AR8 2;  2D6K A;  4Y33 A;  1C1L A;  3O1M A;  4GUL A;  5BNO B;  1VBC 3;  4QQO A;  1W9T A;  3WW2 A;  5A3P A;  3C7H A;  2F4P A;  1OUR A;  1SLA A;  2Q8O A;  1R1Z A;  1GNH A;  4XIO A;  1LCL A;  1OVP A;  3ES1 A;  3BOD A;  2CGN A;  3RZZ A;  2YY1 A;  4MXW B;  2B45 X;  4Y20 A;  1O3T A;  4Y1X A;  4OI2 A;  1ULG A;  5BNQ A;  2RJL A;  4BJ0 A;  2BGP A;  1OD3 A;  5JWP A;  3OBT A;  1HN1 A;  4V2W A;  5LBB A;  1JYN A;  3O1V A;  3WHT A;  2VVD A;  3O1T A;  4HLT A;  1JU4 A;  1FAY A;  3VBO B;  3VD4 A;  2E7Q A;  2VCA A;  4CCC A;  1CAW A;  3ZIW A;  1DQ0 A;  4NJ4 A;  4XTP A;  1GYK A;  1S0J A;  2PAE A;  4XZU G;  3ZIX A;  5FYB A;  1G7Y A;  4JQT A;  3KHB A;  4RQP C;  1XU2 A;  3ACI A;  1NOV A;  1TME 3;  4AE2 A;  1BEV 1;  2D6O X;  3IMM A;  3AP9 A;  4IGP A;  1QWR A;  2J42 A;  3DXT A;  4QM9 A;  2QE3 A;  1VBD 2;  1R08 3;  3VBU B;  4CVU A;  1Q8Q A;  4YG3 A;  4P9I A;  5FIX A;  2OX0 A;  1RUJ 2;  4ZPI A;  1EPW A;  5FP4 A;  1RUG 2;  4QB1 A;  3V0A A;  2IXC A;  1ZBA 3;  3C3V A;  3CJX A;  2PHT A;  2ZXQ A;  3UK9 A;  2JDY A;  2GMP A;  1HV1 A;  4B7E A;  4CU7 A;  4XF3 A;  1V6M A;  3B3Q E;  5FZI A;  4E4D X;  2EF6 A;  3BI3 A;  4GJZ A;  2UU8 A;  3A0N A;  3WQ7 A;  1LOF C;  3AZW A;  4UBG A;  4P00 B;  4XUT A;  4AQT A;  3IDA A;  3WW4 A;  3OF1 A;  3GZE A;  3JQW A;  2F17 A;  3T3Y A;  3QCW A;  1ZX5 A;  1QXP A;  1AZD A;  1F31 A;  4UXA A;  3CIH A;  4P08 A;  3SHR A;  1YFW A;  3WDU A;  3ZYB A;  4Q4Y 3;  1ZNP A;  2E53 A;  2GMM A;  2XUE A;  3NNL A;  4Q4X 2;  4CDX A;  5JSO A;  5E16 A;  3JD7 2;  2DWR A;  4XUR A;  5KC6 A;  4JGZ A;  5F9T A;  4Q1P A;  4RHV 1;  5HXM A;  1S0E A;  1RUI 1;  3L2Y A;  3A0K A;  1JZ7 A;  3WF4 A;  2G9G A;  2PA7 A;  3ZSM A;  5J3U A;  5EXO A;  1ZZ7 A;  3I2D A;  2EA7 A;  4GB3 2;  4MH0 E;  1QOS A;  4IGQ A;  1S0I A;  4YZ4 A;  2AH2 A;  5HCB A;  1QNY A;  3CZU A;  4D8M A;  1YRZ A;  5LA0 A;  1ENQ A;  1DLL A;  2Z42 A;  4P9L A;  2JIC A;  4N53 B;  3USS A;  4ATF A;  3O5S A;  1W05 A;  3TN9 2;  3ZXJ A;  5J1X A;  3VZN A;  3O1S A;  3MHZ A;  4IV1 C;  4IV3 A;  2NMN A;  3TWI A;  2EIG A;  4XF9 A;  5GZF A;  4BPZ A;  5FR3 A;  4LBK A;  4KWK A;  2Y6K A;  4OCT A;  5FYC A;  3VBF C;  3P1I A;  3OUH A;  2GC2 A;  5T52 A;  1PO2 1;  1AL2 3;  1GP4 A;  4D7T A;  4KG0 A;  2RMU 1;  4QKB A;  2QQJ A;  3AYA A;  1ODM A;  2E26 A;  5F5A A;  3SCF A;  3E5Q A;  1QDO A;  5FCC A;  5FPA A;  3FMG A;  2WKK A;  3NNM A;  5FXV A;  1RHI 3;  2JG8 B;  3CQO A;  4PBO A;  1UZW A;  1UOJ A;  5FK7 A;  2AUY A;  5BNN A;  1EV1 3;  2WA3 A;  3AP7 A;  1ND2 B;  4Y1Z A;  3U4S A;  3THP A;  2IC1 A;  4KBZ A;  5FJH A;  1UZ0 A;  3NNF A;  1FI2 A;  4Q8L A;  1PVC 1;  4WM7 A;  5K7P A;  3MW4 A;  3WNK A;  3WP6 A;  4XIL A;  4LKF A;  2ZX3 A;  1HRI 1;  3WZ1 A;  1XU1 A;  4XUN A;  3VL8 A;  4JC1 A;  2IUW A;  1L7Q A;  1UYZ A;  2VW0 A;  4XF4 A;  4H55 A;  2RDQ A;  2ERF A;  1OKQ A;  2JWP A;  4UBH A;  2ORX A;  4XFB A;  1DF0 A;  5A7S A;  2A6W A;  4IE6 A;  1PO1 2;  5FMO S;  5AC9 1;  3LOB A;  3D0S A;  1KRI A;  4BK4 A;  2BGO A;  2XBO 1;  1PNG A;  2JDU A;  5L7O B;  1UMI A;  2QNK A;  2VMD A;  1ZBE 2;  1PGW 2;  2YXS A;  2ZHL A;  2VNO A;  3KQR A;  4LJH A;  4TN7 A;  4AQS A;  1MR5 A;  3LGR A;  3MV1 1;  2ZX4 A;  5D8A C;  3ZYG A;  2CTV A;  3LSE A;  4ZXK A;  3N7M A;  3FLT A;  2C1F A;  2WUH A;  3M2M A;  2J1E A;  1W6Q A;  4J1W A;  1CAX B;  4XUQ A;  5I8T A;  3ME2 A;  4OUE A;  3LD8 A;  4K7J A;  4GMP 3;  3LEM A;  4Z82 A;  3PUR A;  2WS9 3;  4YSF A;  2WWJ A;  1I9R A;  1HX6 A;  2ZBJ A;  2MEV 3;  4CP9 A;  1PO2 2;  2QBX A;  4YM3 A;  4NIA A;  1ZZ8 A;  2OYZ A;  4BMB A;  4XC9 A;  4YVW B;  3IAQ A;  5C8C C;  3DF0 A;  3HVD A;  1XC6 A;  2BBA A;  1WZX A;  3N9L A;  4AR2 A;  1YC6 1;  4QGM A;  1RVF 3;  2OII A;  3E1F 1;  4Y4Y A;  1VIW B;  1NQJ A;  1WD3 A;  3L9J T;  4LBQ B;  5T54 A;  4AL9 A;  4LIT A;  3WCR A;  2XHK A;  4KH9 A;  3KCC A;  4MGY E;  3VHO A;  2PXJ A;  5FPB A;  2GC1 A;  4HN1 A;  1BJQ A;  4GH4 C;  5JMC A;  1AF9 A;  1DQ1 A;  2V72 A;  4LK7 A;  5FKB A;  2Z69 A;  1N1V A;  3VD3 A;  1NQD A;  4ZU5 A;  3LDB A;  2ATF A;  4YW6 A;  2W68 A;  2E32 A;  4NUB A;  1VAK A;  5ACA 2;  5C4W C;  3THD A;  3N9P A;  5BXX A;  2PYT A;  4LO4 B;  2NLR A;  5CAD A;  2KM2 A;  2L9L A;  2DF7 A;  1O5L A;  4CU9 A;  5AFE A;  2XOM A;  2UYA A;  4RS5 A;  2IFW A;  3GCX A;  2A7A A;  1DYO A;  5LAS A;  2D7F A;  2BWA A;  2ZCW A;  3EO6 A;  1DQ2 A;  1ST8 A;  4IDZ A;  3W9A A;  3BGA A;  1W8W A;  2R32 A;  5T3N A;  4ZZ5 A;  1BCX A;  2G1M A;  1CJD A;  3IAP A;  4AYU A;  4HZF A;  2B7Y A;  2QQW A;  5FZA A;  2CL2 A;  3MF9 A;  2FDJ A;  1OH3 A;  4Q0S A;  4IW3 A;  1WCS A;  4DFS A;  1CVN A;  3H8R A;  5JI7 A;  2GN7 A;  1JW6 A;  1YJK A;  3ST7 A;  3O14 A;  3RJ2 X;  1RJ8 A;  2DDU A;  2Y33 A;  4GA9 A;  5FO8 B;  3OG2 A;  1NCQ C;  3T1L A;  4HXC A;  3MV0 1;  2VQU A;  4YZ3 A;  5KR7 A;  2ZX1 A;  3B5L B;  2DCJ A;  2LRP A;  2RS3 1;  1UKG A;  3ZFF C;  1VLN A;  3UGG A;  1ZM1 A;  1H8T B;  5BYN A;  1ASJ 2;  1XSR A;  2DCY A;  4OZO A;  4QXC A;  4PT6 A;  4JCK A;  4KI5 M;  4AI0 A;  1U0A A;  2VXJ A;  4YG0 A;  2O14 A;  4C0B A;  4HVO A;  4IEY A;  4LIV A;  1HLC A;  2HWF 2;  4XDP A;  1GQH A;  1QDC A;  1PNF A;  4FP2 A;  3OUJ A;  3VBO A;  2ZEY A;  2BZD A;  3LPF A;  4EN0 A;  4Q29 A;  2YC2 A;  1NUK A;  4FFF A;  5I0U A;  3RSJ A;  4PQQ A;  1KJL A;  1AR9 3;  1RUG 3;  3FN9 A;  4WVM B;  2RM2 2;  2GNB A;  1REF A;  3VBU A;  1JOB A;  2TNF A;  2VCM A;  4HKL A;  4NHY A;  1EAH 3;  1G9D A;  1XRU A;  1QH7 A;  2JKB A;  1JOJ A;  1ZVF A;  3VKL A;  2RS1 3;  3NV1 A;  1IQD C;  4LT5 A;  4XHX A;  3IBM A;  4JKM A;  4CCN A;  1GU3 A;  1AXZ A;  4NIH A;  1I1E A;  1OQE A;  3ZPO A;  4YLZ A;  2BOI A;  1CON A;  3KS7 A;  3LSD A;  1QMJ A;  4XJZ A;  4O65 A;  2D3S A;  1BVP 1;  2J1V A;  4JGY B;  4Q4X 3;  2E9Q A;  1GOH A;  1GWM A;  3TEX A;  4Z8B A;  4BQW A;  2LTN A;  1WME A;  5ANQ A;  1V6J A;  2VH9 A;  4J25 A;  2WSU A;  2OQ6 A;  1PMI A;  3ORJ A;  3SIS A;  4WM8 A;  4MYE A;  4QXH A;  3S57 A;  4HMZ A;  1OH4 A;  1PZ7 A;  2VME A;  5LBC A;  5LEK A;  2W1Q A;  5A3W A;  5J36 A;  2R7E B;  2VGD A;  1X9T A;  2DU1 A;  2VJX A;  5F2S A;  5G04 L;  1B35 A;  4CCJ A;  5I93 A;  2DCZ A;  4L9B A;  4XAE A;  4NMI A;  4K6B A;  4Y5T A;  5BNP C;  1H4H A;  3EBR A;  2GZW A;  4XBN A;  1GZC A;  2VD7 A;  1MVE A;  4I2O A;  1QJU 2;  1JYV A;  3N9M A;  1U5I A;  3N3H A;  4JRA A;  4F7Z A;  1X9P A;  4OHV A;  5FLH A;  2HWD 1;  3S5Q A;  2FZ1 A;  1E57 A;  4Q27 A;  3QLQ A;  4Q26 A;  2W52 A;  4ZU4 A;  4UI9 L;  2WFF 2;  3I59 B;  3R4S A;  3UGF A;  5LRS A;  1FMD 2;  4OI0 A;  5JZG C;  3D6E A;  4Y22 A;  1BEV 3;  1OI6 A;  1XYN A;  1WUV A;  4BE3 A;  2PLV 1;  2VEC A;  3LF7 A;  2ZML A;  3VZK A;  2WNV C;  4A44 A;  1FV3 A;  3N7J A;  4DIN B;  5FUI A;  3VDD C;  1DFQ A;  2I74 A;  3QD6 A;  3BUC A;  2QJV A;  4HBN A;  1S1A A;  4AI8 A;  3ETQ A;  3WDW A;  2VOV A;  5DAB A;  1PHM A;  1MVQ A;  1XE0 A;  2OS2 A;  5JR2 A;  1WKY A;  3F2Z A;  1A34 A;  2C9A A;  2JG8 A;  2Q8D A;  2O0O A;  4IER A;  4MGK E;  4CP2 A;  1COV 2;  3MYX A;  5EYY A;  3WG2 A;  2I2S A;  2DUP A;  4AVB A;  1IKP A;  1RUC 1;  2QQN A;  1KS5 A;  2P3J A;  1JU3 A;  4HG6 B;  5A32 B;  4XW3 A;  1S0C A;  2XVL A;  3I49 A;  2A73 B;  1KXG A;  2EXK A;  3WUD A;  2D6P A;  2GC0 A;  4XUO A;  3PVE A;  2ZAB A;  4XF1 A;  1UD1 A;  4RHV 3;  3T2T A;  5HCA A;  5JIU A;  1RUI 3;  1UF2 C;  1XB9 A;  5FZH A;  4BME A;  1S55 A;  5KXC A;  5EFU A;  5H9Q A;  2GH2 A;  1GP5 A;  2YYO A;  3MLK A;  4FPL A;  2JB8 A;  2HWB 1;  3DL3 A;  3HMY A;  4AED C;  3FHI B;  1RTV A;  1CZV A;  1LRH A;  3JBG 2;  4B3N A;  2KR2 A;  1RED A;  2R1B A;  4ZS3 A;  1RUF 1;  3WNN A;  4YW7 A;  5L7O A;  1NAE A;  4QPG C;  4NRM A;  3KGZ A;  5IUQ A;  5KHJ A;  4XHB A;  3SCG A;  4FVV A;  3F95 A;  4W65 A;  1GWL A;  2GN3 A;  4COY A;  1S0G A;  3S5A A;  1DBN A;  2WZP P;  4OYU A;  1CAX A;  1RJ7 A;  1POQ A;  1W2T A;  3VZM A;  3PUS A;  1WA4 A;  3AK0 A;  5EV7 A;  4DEQ A;  1F9K A;  1VMH A;  2RMU 3;  4F8A A;  5EZW A;  2J1T A;  1N3O A;  4AAP A;  1S2B A;  3MW2 A;  4A41 A;  2GSY A;  3OEA A;  3S7E A;  3FLP A;  3AB0 A;  4UYB A;  4BA6 A;  1J3R A;  5A3L A;  5F3C A;  1W3V A;  1DIW A;  1Q5O A;  1WCK A;  4LA2 A;  5E6H A;  3W5N A;  4UW5 A;  3MIG A;  2X29 A;  1UMH A;  2A75 A;  1S0D A;  4FPG A;  3UES A;  1YNA A;  4K9S A;  1FPN 1;  1VBC 2;  5IVE A;  1WMF A;  3E6D A;  2QFE A;  2VMC A;  1POV 0;  1W0P A;  3PIG A;  2A5Z A;  1D4V B;  2C5D A;  3N9O A;  1PVC 3;  2GP3 A;  1WCU A;  2P37 A;  2WO7 A;  5DG1 A;  2Q1Z B;  1DZT A;  1XOY A;  3SEP A;  4K1Y A;  1PIV 3;  2JEM A;  4LHN A;  2UWB A;  5FP7 A;  4BB3 A;  4NRO A;  5DAW A;  1OLM E;  1RUC 2;  1HRI 3;  4YVS A;  4C1X A;  3HT1 A;  3MUZ 1;  1AVB A;  3I3D A;  5IVJ A;  2UWC A;  4NE9 A;  4RQP B;  4UOJ A;  5GZG A;  2QQP A;  3JU9 A;  4LO7 A;  4NHL A;  2HEY F;  2BGC A;  3ZXF A;  4I0W B;  4COZ A;  1C5I A;  1JYX A;  1ZZB A;  4FT8 A;  2QDN A;  4RL7 A;  2VPV A;  5AC9 3;  3WDX A;  4IE7 A;  4ES8 A;  2VW2 A;  3ZDS A;  4C0H A;  4XFG A;  1R08 2;  2XBO 3;  2HEW F;  2RR1 1; 
#chains in the Genus database with same CATH homology
 1GWL A;  1W8U A;  2LRP A;  2Q1F A;  4CP9 B;  1WZX A;  3ZYB A;  1WCU A;  4LJH A;  4LKD A;  4BQ4 A;  4BQ2 A;  2WYF A;  1W8W A;  1WMX A;  2K46 A;  1W8Z A;  2VXJ A;  4AL9 A;  2C24 A;  2O14 A;  1V0A A;  5D21 A;  1W8T A;  4LKF A;  3UT0 A;  4BQ3 A;  2LRO A;  1GWK A;  4LK6 A;  1W90 A;  3ZYF A;  4A6S A;  4YWA A;  4LK7 A;  4BQ5 A;  4LKE A;  1OH3 A;  3ZYH A;  2KR2 A;  1GWM A;  2JWP A;  1L7L A;  1HN0 A;  4YW6 A;  4CPB A;  4YW7 A;  4CP9 A;  1OKO A;  1W9F A;  3ORJ A;  1UOJ A;  4CPB D;  3F95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...