4LKDA

Crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-qrs at 2.31 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/inhibitor
molecule keywords PA-I galactophilic lectin
publication title Structure-Based Optimization of the Terminal Tripeptide in Glycopeptide Dendrimer Inhibitors of Pseudomonas aeruginosa Biofilms Targeting LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lkdA00
1L7LA 4BQ3A 3UT0A 2WYFA 4YW6A 4YWAA 1OH3A 1UOJA 2LROA 1GWMA 2JWPA 4BQ4A 4LKFA 2C24A 1W8UA 4LJHA 4A6SA 4YW7A 1W90A 1W8WA 2VXJA 5D21A 2KR2A 4AL9A 2O14A 1OKOA 4LK7A 3ORJA 4CP9A 3F95A 2LRPA 1HN0A 3ZYFA 4CPBD 4LKEA 4LK6A 4BQ2A 1V0AA 1GWKA 3ZYHA 2Q1FA 3ZYBA 1WZXA 1WCUA 1WMXA 4BQ5A 4CP9B 2K46A 1W8TA 4LKDA 1GWLA 1W8ZA 1W9FA 4CPBA
chains in the Genus database with same CATH superfamily
4AEKA 1OFNA 4AI3A 3AVSA 2XGXA 3BODA 2RS52 3HAGA 5KHIA 1F8VA 2GH2A 2PLV2 3TOJA 1G9BA 1XNTA 5F9TA 2PQQA 5LY1A 2D6LX 3WDYA 3JD71 5FXXA 3RYPA 1RUC2 2RDNA 4N43B 5F5IA 3U4SA 4NMIA 3CDZB 3OY8B 4RYDA 4BXFA 5A6YA 5KXDA 1XE7A 3K48A 4AR2A 1GUIA 4QQHA 4C0HA 1OQ1A 1X9TA 4MX3A 1LULA 3FLTA 4NAOA 1D0GA 4P9IA 4DEVA 3TEZA 1OPOA 3FWEA 4XUTA 5FZ0A 4KBBA 1O3RA 4BQ5A 1NCQB 3N7MA 3VZLA 4MSVA 5A32A 5J36A 2R7EB 1N1TA 1QWRA 3B9IA 3OUIA 3EXUA 3AXEA 1R64A 2Y60A 2YDEA 2YYOA 3SCFA 1POV3 4AEDB 4CU8A 1H1AA 1PNGA 1XNAA 4XF3A 4QDSA 1AL21 4N53A 4YNIA 3ACGA 3QH6A 4M3CB 4MO3M 3SCHA 5BUVA 1M06G 3VB9A 3RGBA 2YROA 5I0TA 1V9U1 3CNAA 4IE4A 1AR92 4Q4V1 3CU7A 4UBHA 5BPXA 1J1TA 3ZMNA 5ABJA 3V0BA 1PVC1 4JKLA 1S55A 4LR4A 3U37A 4AVBA 5CFDC 2QDRA 3PVOA 1LGBA 3J7NA 5K8SA 2BWCA 1DQ0A 2QTWB 1GZWA 1OF4A 3OGRA 2XVGA 1JHJA 4XFGA 5FZ4A 5LBEA 1VP6A 2VMFA 4BMBA 4JCKA 2VD7A 1GOHA 1R1ZA 3UNPA 2HKXA 1GFF2 3USUA 3MV01 5I8YA 2QCSB 3KQ4B 1HDKA 1YFYA 1VBD1 5F39A 1UYPA 4M3CF 4L11A 3ZXEA 1H8TB 5IVBA 1QJU1 4FPCA 1BK1A 3VBFB 1CZVA 1AR63 2UWBA 4KWUA 2J1UA 5LB6A 1UOGA 1QH6A 1DYOA 1H9PA 1U5IA 2E9QA 5GLZA 1I6XA 3BKZA 4OHXA 1RUF1 3LOBA 3FE5A 4Q0UA 4FBFA 2X29A 2A70A 1VMJA 1GU3A 3UK9A 3ABZA 3S7IA 1NLRA 3WP6A 4EE2A 2ZGTA 1N1YA 4OHZA 5A3LA 4S2GA 1SLAA 5FAXA 5JR2A 1YQ5A 1GNZA 5GJ6A 5AFEA 4NIIA 2J1VA 4AFBA 4IDZA 1YIPA 2P3KA 3GHNA 2XH6A 4AG4A 4N7IA 3NAPC 4KBZA 2QZ2A 2OUJA 2XUMA 5JZGA 3H50A 5KHGA 5FQ0A 2Z4FA 2WBKA 3LZZA 4LHSA 3ILRA 2WC2A 5BNNB 4XTMA 3ON7A 3KHCA 5EFUA 2ZKNA 3KV5A 4N9HA 3S57A 1PM4A 1ULCA 1A34A 5FZOB 3MGUA 5HXMA 1VBE2 5F1RA 3ROUA 2KM2A 2VUJA 2VNOA 1AYN3 1PVC2 2YC4A 4JDMA 2D6KA 4O9GA 3ZFEB 2DBNA 1HV1A 2X5IB 3MFCA 2OQ6A 4CEYB 3INAA 3NWKA 1DYKA 2RS32 1PMHX 3GCWA 2X53S 4E2GA 4QX7A 4DRVA 4J25A 3LKJA 1NY71 2P6CA 3W21A 1RUJ1 1ZBA1 1ZZ9A 5LW9A 4OI0A 2GMEA 4CCMA 1XBFA 1WA6X 4HETA 4BQ2A 4CUCA 1C1FA 2XUEA 5A70A 4C1XA 1CVNA 1PZ9A 2VZQA 3BN6A 2DURA 3Q8BA 1J3PA 2QQIA 2ZGSA 4MLOA 1O3TA 2JECA 1YJKA 1QJY1 1X33A 3UJOA 1PGW1 2WT0A 1S0GA 5I8TA 3VN4A 4AGGA 4JGZC 1ULDA 2B7YA 4XCBA 4YM2A 2ZMLA 3BI3A 2ETEA 4C1WA 2I74A 4I01A 5K0UA 4MUVA 5F2WA 3WZ1A 4NHKA 4LJHA 5IHRA 1W0NA 1W2NA 3R4SA 3MIFA 3IMNA 1CIYA 2BPA2 4LHNA 5FUNA 2ATFA 5JI7A 3IKWA 2RJLA 2CWMA 4JTOA 1PNFA 4WZFA 1N3OA 3HN1A 3VZNA 5IFTA 3O5SA 3FC0A 1R1A3 3RPQA 4CDXB 1WUVA 4XHXA 2GP5A 2HWB3 4X6RB 3IN9A 4UFJA 1BHGA 1W8TA 4CEWB 1IKPA 3VDDC 3NV2A 2KXLA 2CWSA 1EAH2 1ULEA 4LBMA 2UWCA 5FZ6A 5B2GB 3I3MA 1PK6B 3WP3A 5LEKA 1RB8G 2Q1MA 1Q8SA 2JIJA 3PL0A 4EZ4A 4ZZ5A 1US3A 1NCRC 1F31A 5C3PA 2Q8OA 3VL9A 4Q8LA 5ACA3 1OOPA 1W90A 3ZXGA 3OBZA 1BYHA 3VBHA 4LPLA 5FYUA 2IXHA 3H1YA 4DEQA 4GAZA 2RDQA 4JGYA 1FNZA 2ZXQA 2WFF3 4W65A 3J7MA 3SH5A 4K9SA 4M3CE 2HJIA 1RUD1 2GZWA 3CIHA 3ZN4A 2WT2A 1JOJA 5E16A 3VHPA 1V6KA 3FUQA 4N43C 1NQDA 1X9PA 3GZTB 3GHMA 3I59A 4ONUA 4WM8A 2Z5WA 5CBLA 3L2HA 1AF9A 5FJKA 2WZR3 2OVUA 5H9RA 1SEFA 2VZOA 1ND3B 1US2A 3SITA 3NKTA 1DHKB 2JD4A 1A6CA 3ZFFA 2DCTA 1NCQC 5FZMA 1HQWA 1F15A 4JHTA 2IXLA 2PHTA 3ZXLA 1LEMA 1O4ZA 1EPWA 4AZZA 1YFWA 4DO0A 4LMFA 2WWJA 1R082 2ZKLA 2WNVA 4BOWA 3N7LA 4QPGA 3U07A 5C4WC 5IVCA 5DDJ2 5LATA 2BYVE 3T2PA 1LHOA 2BWAA 3VBOC 5L7OA 4Q4Y3 3QH7A 4PLNA 4AQTA 3ZYJB 4MGYE 2R063 3M7AA 2XHKA 2F6BA 4TZDA 4PDWA 1C3HA 2DCKA 1AXKA 4DXZA 4YFWA 1AR62 2GNDA 4XYXA 3I2DA 1SDDB 2ERFA 5A32B 3OJBA 2EF6A 1WW5A 1ZRDA 2BFUL 2Y34A 3MICA 5CG8A 2A6VA 4COZA 2NLRA 3WNKA 3AJZA 2PYTA 1O3SA 4META 2D6OX 2RV9A 4N53B 4XIKA 1RMU3 1LESA 3RQ0A 2X8KA 2JKXA 3L9JT 1UQXA 4NIGA 3TWIA 5A3PA 1KGYA 2BVVA 3V0BB 4BH9A 5ABJB 5F5AA 3RS6A 3RRDA 3S6PA 3WVJA 1WMXA 3I2GA 3UGHA 5KC5A 4RFT0 1CAWB 4GB32 5FO8B 2D43A 4JKKA 2RDSA 1DZRA 4JX0A 2ENRA 5FY7A 2FZ1A 4HLTA 5J96B 4HKOA 1YYNA 3ZN5A 2VOWA 4M4RA 3ZYIB 1FNYA 1HXS1 3VBFC 2XG3A 2EVXA 4LUMA 2C24A 2Z42A 3DECA 3AC0A 2VQAA 1AR82 2J7MA 4UFIA 1C8M3 4NR1A 1VBB1 3JQWA 1DG6A 5A7NA 5AC93 2ZAAA 1MACA 4IXLA 3VUOA 3ACFA 1WBFA 3FUOA 1AYN2 1XE8A 5IAXA 2VVFA 4M00A 5HCBA 3TN92 1IPKA 2K46A 1MS0A 4CSWA 1SLTA 4YW4A 1RUH1 3RZLA 3ZYPA 3FMGA 1PMIA 1RTVA 3P1IA 2HWC3 1XE0A 2A7AA 5A6ZA 1GP5A 5CISA 1QH7A 3ZYRA 5A33B 3LA7A 5FPZA 4YPJA 5FOBB 1QU0A 3RZMA 3LEIA 1BBT3 3HPNA 1QOOA 5FMCA 3POYA 3EBRA 3MEPA 4ZHNA 2QJVA 5EZWA 2XBO2 4HBNA 1NXD1 5BNNC 1NLSA 3POBA 3OG2A 2BJSA 4FAHA 4D94A 2IXJA 4IEUA 3KGLA 1QGLA 4BMEA 4CP2A 2DVAA 3I3EA 2ARCA 5HI0A 1DP0A 2GN7A 2AZ5A 3M8LA 4FPKA 1PX4A 1GP4A 1SBEA 2HWD3 3C8XA 3G6JB 2VMGA 4S2FA 2R072 4AVTA 3AZVA 4FOVA 4Q4X2 2GNBA 5E6HA 1IG0A 1SDWA 2LROA 3FLRA 4LBJA 1PHMA 1FMD3 1QQP1 2A6YA 3BVCA 4I3PA 5EYYA 5FYHA 1JW6A 4FPOB 3J8F2 4OULA 5L73A 1QY4A 3IPVA 2CGNA 4HZFA 2YY1A 3K4AA 4OI2A 2HWB2 1G9DA 5F3GA 4CE8A 4Z2AA 3DPRC 2Q8EA 1Q8PA 1WLTA 2RMU1 3S5QA 1JOPA 2QE3A 4NRQA 4AWDA 1U0AA 3I3BA 1IQDC 1CZSA 1Y3TA 3WX5A 3ACLA 4I0WB 4D6SA 1ND2B 1GV9A 3IT8A 3BTZA 3DUIA 2K0GA 1XYNA 1CPNA 1MS8A 4ZU5A 3ZYGA 5DZEA 1COV1 3JU9A 3KHBA 2LM3A 2BBVA 2VG9A 4CPBA 1WMFA 4H7MA 5FO9B 2JDKA 1UD1A 2VXRA 2ZX1A 3WW3A 2DFBA 5JPNB 1DQ5A 4QQ2A 1FAYA 2LUWA 4FO9A 3W58A 2FDJA 3ZFGC 2Y38A 1CR7A 3AVRA 2W68A 3O1SA 4IEXA 4CDXC 1NT0A 1SLIA 4CEWC 5IYYA 1MVEA 4RA0A 3PMSA 1VRH3 1QJX1 5K0UB 3WG2A 5B4NA 4D0QA 1HN1A 1PK6C 2WZR2 4LKEA 1JMUB 2VUDA 2W08A 4RL7A 1O6UA 1ZRRA 4UW3A 3LF7A 5FYVA 3ECQA 3ZYBA 4E4HA 3F2ZA 5C8CB 4XHBA 3ES4A 4K7JA 5FJHA 5FREA 5L19A 2XOMA 4LKDA 1ASJ1 1JZ5A 1K45A 2WQZC 3OGSA 4UFMA 2CL2A 4NUBA 4KWKA 3HD8B 3I8TA 4MHUA 3R05A 4P9XA 4HONA 4M0HA 2GC2A 1LOFA 4P5YA 4CUGA 3MDPA 2QQWA 4IEPA 2D44A 5IFPA 4A42A 4XETA 1ZBE1 1PO22 4XPVA 2OIIA 3AMMA 5LBFA 4DUVA 4BIFA 3ALQA 4QMAA 4A44A 1FOD2 4JRLA 5BNOB 2WL1A 4HN0A 1DDLA 2FMYA 1S0DA 2Q30A 4QXCA 4V2WA 1XNCA 4XVHA 4AVVA 2WT1A 1S0IA 1C5HA 3TB0A 1RUE1 1LOAA 3VBHB 4YZ5A 2WN2A 3GJAA 1ND3C 1X8MA 3AYEA 4RHV3 5C9AB 5APAA 1W2AX 4JGYB 4YVWA 2HWF3 2Y0IA 2ZS6B 3CZUA 4Y4RA 4QB1A 4HMZA 2D97A 3SLIA 2CDPA 4U2AA 4MGIE 3AKPA 4NPMA 2LALA 2WZEA 1FPN3 3FHQA 1JXNA 3IAPA 1CAVA 5DAPA 4QHZA 1AYM3 5IK4A 1S0JA 2UY8A 5J1XA 2HWE2 3POSA 5IK5A 2VAUA 4FXGB 1OQDA 3O1PA 2W1SA 4SBVA 2WWUA 3ETQA 3ENRA 5J7MA 4CXWA 1O3QA 4Q4W3 2GSYA 2YG0A 3SXWA 3ZFFB 1V0AA 4DS0A 1UZ0A 2VECA 4YW1A 2GC1A 1ZZCA 2C26A 3EQEA 3ZPOA 3HMYA 4RQPC 2WNVB 1E5SA 2DDUA 3OUJA 4XZUG 4QDQA 1D4M3 3NV4A 5CEHA 1YQ6A 3E5XA 4N53C 5L7OB 2JIGA 4HL0A 2YV8A 4FPYA 1UYYA 2J22A 3I2JA 4P9GA 3U78A 3ASIA 4X8NA 1ZM1A 3JUUA 4IV1A 4PDWB 3VKOA 3A0KA 2RM22 5IUQA 4LBQA 1B09A 1RUI2 4OVEA 3C3VA 5FIXA 4PIZA 2HWC2 5FY8A 3THCA 1NA1C 2RJ2A 3N9OA 4Q1PA 4QKDA 3QBQA 1QJEA 5DAWA 3T1MA 1L3JA 3VHRA 5JOYA 2JDHA 1FX5A 2RS53 3E6CC 1GYKA 3VGIA 3ZO0B 3POIA 4AHWA 3OGJA 3N7JA 4CDQB 1GQHA 2AC1A 2GN3A 3B9CA 4I09A 2JX9A 5T5OA 4URAA 3VBSC 4E9KA 4MVTA 3VZKA 3S0MA 2BOJA 1RUC3 4DY5A 2GH8A 2YXSA 1R093 4FAGA 5A3MA 5CADA 4A7ZA 3VBRA 1X82A 3IDCB 5A1FA 3O7OA 3X29B 3U10A 1PO13 1BEV2 3MUZ1 5FTTC 1QDOA 5H9SA 2XXZA 3CJIA 1UZZA 2FCUA 3UKTA 4NHYA 3NJZA 3E6DA 2QQOA 2WAAA 4ZY9A 4OMDA 3AFGA 1TNRA 1LOCA 1LOGA 1T2XA 2NZ9A 2XQRA 4HXCA 5I0SA 3D3AA 5E8AA 1YUDA 1H0BA 3DN7A 1WCUA 4Q5OA 2CAVA 3O1VA 1XU1A 4QHBA 5L9BA 3WNXA 3LIGA 1O8SA 1KDKA 1AR93 1PIV2 5G04L 3A23A 4PF1A 5A80A 5I93A 3ZDVA 2MEV1 2Y6LA 1CD3G 1S2BA 2ILMA 2R6QA 2XJQA 1AX1A 2XKPA 1W6OA 4E8CA 5CAZA 2ZX4A 2EXJA 4B4RA 2VVDA 3A22A 5BNPA 1CWPA 4X8PA 2RS11 4BE3A 2XLFA 3CZJA 4UWDA 5C3QA 2DTWA 4B8EA 2WS91 1SMVA 4XDPA 4EN0A 1DQ1A 1Z7S3 2VMCA 1HN0A 4OUSA 5EJZB 4COYA 1PVXA 3OUHA 4XOGA 3P6BA 2J1SA 4COWA 3FBMA 3AZYA 1XC6A 4XQDA 2E6VA 5KXEA 1WMDA 3RMXA 3UESA 4BQWA 3O1TA 4RS5C 2OPWA 1VRH2 1EV13 1O4TA 2VGDA 1G7YA 2HBTA 5F8PA 4N7UA 5FY0A 3AZZA 3JB8A 1JZ7A 4AVAA 4B7EA 2JD9A 2IXIA 2XVKA 3I2IA 3M2MA 3C7FA 4BYYA 1ND2C 1AX0A 1GOGA 3A7QA 5FOJB 2B9VA 2VBPA 3B94A 5CKQA 1C4RA 2YU2A 4G4FA 5FYYA 1DFQA 5EWSA 3IPVB 3WQ1A 4XC9A 3AFKA 3HIFA 4ET7A 4XXAA 3VZMA 1YJLA 3WNLA 4QKFA 3U14A 4BLIA 3POFA 4IESA 2QQLA 4XDQA 5FKBA 3PURA 5GZCA 1AR71 4W8JA 5FZ3A 4CDUA 3SKJE 1OMIA 1YCIA 2AUYA 2PA7A 4LKFA 2DVFA 1VAKA 3LSEA 4YRDA 5F3IA 3T30A 4LO6B 1OUXA 4XUNA 4OUEA 1TME1 2VR4A 4LO4B 1OVPA 2WNEA 3MO4A 3M3IA 5JXIA 2ZX3A 1W0OA 2DCYA 4NWWA 1W8UA 4CVUA 2UWAA 5FZIA 5C8CC 2MNGA 4YVSA 1UF2C 4QU1A 5IVYA 4IUGA 3K75B 1UY4A 1OVSA 1AL23 1NE6A 1UU6A 2W91A 3KGZA 1HB2A 2FDFA 1UPSA 3JZVA 4W4ZA 3T4VA 4OQ9A 1V9U3 1M4WA 3VKFC 1VBE3 4Q4V3 4IEOA 2VOXA 1AYM2 3OTFA 1PVC3 4BQXA 2A6WA 5F3EA 1BKZA 3PU3A 1HRI2 1W2TA 2SBAA 4XJZA 1B35A 1D4VB 1ODNA 2RS33 2XKOA 4WM7B 5GKAC 4AFAA 1LGCA 4NOTA 4L99A 2A71A 1VBC1 4AFDA 5FK7A 2E7QA 1FV2A 4G3YC 2YPDA 4L92A 4LITA 1JODA 1RC6A 5FXWA 4A7KA 5FDBA 4XF4A 4UT5A 3OBTA 4AI1A 3ZSJA 1TZOA 4H14A 4IEVA 1DCSA 1YEWA 3GNEA 4UI9L 5FZ7A 1GQPA 5C9AC 2QFEA 1BMV2 1VJ2A 2HYKA 4AW7A 3B5LB 1YC61 4LO8A 3BYWA 3HT2A 3KZ4C 4IEQA 4UFKA 1VBD3 2XWBB 3GCXA 3RZHA 2ZOEB 1YO8A 1RVF2 2WINB 1EYBA 3GXUA 3VHNA 2Q5TA 2ZACA 1V6NA 1JYIA 1IKQA 1QJU3 4JQRA 4R9DA 3WG4A 3C7HA 4CP1A 2E53A 2SLIA 2QQNA 3ZLIA 5A7OA 3EB7A 3U75A 4QD2A 2RR11 2CNAA 4K6BA 1RUF3 2ES3A 1HB4A 4BA6A 4YVWB 3FZ3A 3ZFFC 1TMF1 3DL3A 5KC6A 4GWJA 1IPSA 4YZ3A 5GZEA 1REFA 2PHFA 1R092 2DCJA 3Q9OA 4A3XA 1EAH3 5DUVA 1W6PA 1MQTC 1VB4A 4XXPA 5LY2A 4PIXA 2OKXA 3WEZA 1PO12 1W9TA 4YGCA 5A7WA 2FMDA 4OHYA 4LLOA 1DU3D 1KEXA 4QPIA 4D6QA 5JOXA 3UGFA 4XE9A 4CCOA 2JXAA 2VCCA 1KD7A 3H3LA 3WQ7A 1WW7A 4Y5TA 1QXPA 2ZABA 4W6XA 4ZXEA 5FCCA 1RUG1 4J1WA 3KQRA 4S2DA 3SCGA 2GMMA 5GALA 2YUEA 4Y20A 4P00B 4CDQC 1W8WA 1K5MA 4Q29A 4AXOA 1QOSA 3VHOA 1JI6A 3ZXAC 2BW8A 1HRV2 4XQWA 1QOTA 2V5YA 4DUXA 4IV1B 1ZYBA 3BTXA 1K12A 4NAMA 4FI9A 5IW0A 4I3GA 1RUJ3 2G4IA 1ZBA3 3M3CA 1WGPA 2XJUA 2XMLA 2IFWA 2R041 5LASA 3SQOA 3HEIA 4RR3A 2IC1A 3WOGA 5JOZA 5EJ3A 5T5JA 1CX4A 2G19A 1Q8QA 1Z7S2 3BU0A 5D8AA 4OZXA 1MEC1 4KWLA 3NNLA 4JC1A 5HCFA 2PXJA 3BOWA 4FTEA 5BY5A 1R083 1XSRA 4GMP3 4CA9A 4Q0PA 3W59A 2ARBA 5DDJ3 1RL3A 3LIHA 3WF2A 5CFCA 1DZQA 1SFPA 3VBRB 1MPXA 2ORXA 3T0DA 4QX5A 4AL9A 1TVGA 1EV12 1W2OA 2P2KA 3ORJA 4HOOA 5C5UA 1WLDA 3VBUA 1W6NA 4FVVA 2WFPA 4R9AA 2EXKA 4UW6A 3T09A 4PBOA 4ZU7A 5K7PA 2QNKA 2BNMA 1D0HA 2GU9A 2RDRA 5FP7A 3AZXA 4B3NA 1DYPA 1WZXA 4AHXA 1C5IA 4TXWA 3SKVA 1V6LA 1N47A 1OKQA 2W46A 3WDXA 3GDBA 1J1LA 3A4UA 3IDBB 1F35A 1E5IA 1RHI1 1VBA1 2QQKA 2VPVA 4UF0B 5JUVA 1ZRFA 3NJYA 5T52A 3I2HA 4BQ3A 3H8XA 1ZRCA 3POJA 2BGPA 4K3UA 1V6OA 2VUAA 3JD72 1GNHA 2WNUA 5FMDA 3PUAA 5EPAA 3UYJA 4MGZE 5J48A 2FCVA 3ILNA 4Y1XA 1X8EA 5CIRA 3O0WA 4ORFA 4GB33 2UYAA 4GH4B 2OUHA 4MGQA 3NSTA 5GLVA 1JZ8A 5FZEA 4EV0A 3TNQA 3VL8A 4XEZA 4CDWA 1U5ZA 2GP3A 1TNFA 3BALA 3C2UA 2VOTA 1LEDA 1GZTA 1QJFA 4OI4A 4NN0A 3WF3A 5HXVA 4FFHA 1OPMA 1POV0 2WJSA 1AL22 5T54A 1AR83 4Z2WA 2JG8C 2DBIA 4LOTA 3B01A 4D6RA 1HLCA 2ZBJA 1PMJX 1V9U2 3N3HA 1ULFA 2VJXA 2PHWA 4INDA 4JHZA 2PHLA 4Q4V2 4Y5Z0 4ZZ8A 1MVQA 5ANNA 4AI9A 4AK3A 3DYPA 5F32A 3SISA 3TN93 2FBEA 3GALA 4ASMB 5TSWA 4CU6A 3H8RA 5JDBA 4LK7A 1AJKA 2IVJA 1UYXA 5FZ1A 5A3WA 2JG9A 4E4SA 3T0AA 4AI0A 4AVCA 4M0NA 3OB8A 4AI2A 1GSLA 2X09A 2V72A 1OSGA 1JBCA 5HCAA 3O1UA 1EUUA 3LSDA 4YW5A 5JIAA 1A78A 3KM5A 1RYYA 4FFGA 4BIOA 3OCPA 1UNBA 2XBO3 4WVZA 3OGGA 4GMP0 1J3QA 1ODMA 2WDBA 1VBD2 4IE5A 2KA3A 4AQ2A 4D69A 4HSJA 2O8OA 4CDUB 4MGTA 1XU2A 3BPZA 4LA2A 1QJU2 3RJ2X 3U0ZA 3DXUA 3LDBA 4LBOA 3ZVXA 3HN3A 1WLWA 4YW7A 2XR4A 2IXKA 5DABA 2AH2A 4B4QA 3WW4A 1PGL1 3IZOA 1E57A 4TSVA 2R073 4WM7C 4Q4X3 1RUF2 4YARA 4YVSB 1W3VA 3LAGA 5BYNA 3J8F3 1EPZA 4XJWA 1A8MA 1OF3A 5FYZA 3N4MA 4DXRA 1E5RA 2EICA 1DQ6A 1L7QA 2K9ZA 4B7KA 1GKBA 1LECA 2ZZQA 5DZGA 4AYUA 5CKMA 1U5XA 1GQGA 1O7FA 1J84A 4BPZA 1B35B 5AVAA 1UOFA 4XACA 2Y6KA 1D7PM 1SFYA 5BXXA 3ZOIA 2B45X 4L97A 3WQBA 1PZ8A 4QPWA 4YGDA 5FR3A 1S1AA 1S0FA 2QQPA 1OLMA 1VRBA 2JB8A 4J1XA 1LENA 1S4CA 5HCHA 1VBB3 4GWIA 1AXZA 1QXRA 4XF9A 4YM0A 2XL7A 1JHNA 4OQ8A 1N1SA 5FPBA 3ZXKA 4I2OA 3WG3A 2VQ0A 2ZEYA 1UO9A 4G9SB 3ZR5A 4EN6B 1NOVA 2O1QA 4XAEA 3RYKA 1WLCA 3O0XA 1DGWX 1Y43B 3AKQA 4MZUA 4NVPA 4IE7A 1NY72 1LNSA 3TNPB 1UIJA 1RUJ2 4IV3B 1ZBA2 3MFAA 5A6XA 5D21A 2ZHLA 2O14A 1OA2A 4QX2A 4HG6B 3GBWA 3OD4A 1HB1A 2RVAA 3KF5A 2CSGA 3R4DB 2EALA 1A8DA 1S2EA 3CEWA 1DBNA 4AEDC 1QJY2 4B29A 1PGW2 1C8NA 4FTBA 1H6XA 2BTVC 3U4XA 2AEYA 4Y3OA 1O5LA 2ZJCA 1IS3A 1W6PB 3TEYA 4XFAA 3WUCA 4EN8B 4OUMA 1PO23 4YM3A 5BNOC 1Z78A 2WO1A 3QACA 5FO7B 4FSJA 3IIAA 1FOD3 1XYOA 2EIDA 1CZTA 2BGCA 2H6CA 2DU1A 3LQCA 5GLUA 3ZIWA 2ZHMA 3WDWA 1DLCA 5I8SA 1PM7A 5B4XA 4GD4A 1QQP3 5C3SA 2VMIA 1GR3A 2Y8KA 2YHJA 4KGGA 3KLSA 4KWJA 3U11A 3W9AA 4BU2A 4IEWA 1PZ7A 5BV6A 1W39A 1CJPA 4OFGA 4Y20B 3WF0A 1U5YA 1K5MB 3NV1A 3MV11 3ZN6A 3CMGA 4H3WA 2J1EA 3H42B 4UBGA 1LKNA 5FZFA 4HPKA 5C71A 1AHSA 3CKHA 3OPWA 5I0RA 2HWE3 3C7GA 2HEVF 2VZTA 1SPPA 5A7PA 1GICA 1T6GC 1RINA 2D6PA 3UT0A 1UZYA 4YWAA 5JI9A 1H8TC 1W6QA 2D5FA 3N36A 4FQ4A 3UL2A 1GZWB 4RR3B 3C7OA 2ZAHA 5LEJA 1ONAA 2AR6A 1VALA 4MGKE 1R1A1 3KCXA 5FUIA 5CG9A 3USUB 5HPOA 1RUD2 3C7EA 3LFMA 2MHFA 5CFDA 3GJBA 1QJZA 1W0PA 3HQXA 1CESA 1S2KA 2DVGA 1K42A 5IJRA 4QX8A 5T55A 4D7SA 3DGTA 1W6NB 3HR9A 3VBUB 4GJYA 2W94A 2WZ8A 3AP9A 4L2NA 2VNGA 4AFCA 2RM23 4EJRA 5LCWL 5ACA1 3BUCA 1L7LA 1RUI3 2VL4A 4GH4C 4CYDA 2XHNA 4XCAA 1UX7A 2IUWA 3VDCA 2GALA 2VTXA 4MGSA 1ASJ3 5IK8A 4XZPA 3H7YA 1DQ2A 3AKSA 4AEJA 4C8DA 2ZGQA 4N8MA 1AUYA 2WFF1 5FYTA 2WNUB 5E1RA 1HJGA 1OD3A 4Y22A 5ISLA 4XILA 1W03A 1W8NA 3UGGA 2V73A 4EWDA 4Z92B 4CU9A 5A7QA 3N9LA 3IDEA 1Y9GA 2OYZA 3ZFEC 3WF4A 4HVQA 5G05L 2X5IC 5CB7A 3O1OA 2OS2A 4CEYC 2CV6A 1BEV3 4IGPA 4NRMA 1IS4A 2CAUA 2YFUA 5JZGB 4CXYA 1JYTA 1I3HA 2ZTNA 4Y26A 2YPJA 1FT9A 5FQ0B 3WY6A 1YXWA 3HT1A 4PLOA 1H1MA 2V4AA 3I7DA 4BQ4A 5FPLA 3BIWE 4FFFA 4PCRA 1UXZA 3IWZA 4YZ1A 4UW5A 1GBGA 2K2SA 4QAWA 1UY2A 4Q4Y1 4BQ1A 2VULA 3RG0A 2VOKA 1Q5OA 3HJRA 2A75A 2R061 1PIV3 3J4UH 3KD4A 4KU7A 5JLVA 4CPBD 2P34A 1X50A 3NAPA 2GC3A 3KCYA 4PLMA 2NMOA 3FLPA 3WNNA 4Z8BA 1TEIA 2A1XA 3PMEA 4P08A 1W8ZA 1KFUL 5KHHA 1DGRA 3UKNA 1HXS2 1GNYA 3ZXDA 5F2SA 2R0FA 3HNYM 4Y1UA 2J1AA 3RYRA 1CJDA 3M1HA 2IWGB 1LHNA 1RMU1 1VBB2 4GQ7A 2D3SA 4CU7A 4YVSC 3J7HA 4NE9A 3RJRA 3AL6A 2VMEA 3DYOA 3WG1A 5FPAA 4ASLA 1NE4A 3HQRA 1NAEA 5CA6A 1HQLA 4K1ZA 4LIUA 3WCRA 4CP9A 1J83A 2F4PA 5K4LA 1W2UA 3AZWA 5FYMA 4MADA 1LU1A 3HVDA 2R1DA 1JYWA 1BCXA 1RUH2 1QNWA 2FZ2A 1HQNA 4HT1T 1I5ZA 3NV3A 2WNOA 4WBBA 1B35C 1VPHA 3Q8CA 2EIGA 3KVBA 5LBCA 1X36A 4Y1VA 3EYPA 3ZM8A 5M0TA 3WINE 1ZNPA 3V65A 1C8M1 5D1IA 4TYSA 1XNDA 2B4KA 2F4LA 2WLQA 3DF0A 4JGZA 3WP5A 5AC91 3D8CA 3P5BA 2NYYA 1ZZ6A 4FPHA 3NRUA 4A6SA 4AVSA 2QDNA 1POQA 4XUPA 2YFZA 3HBZA 2H6BA 2IVIB 4P02B 4E4ZA 1D2QA 2AENA 3N9MA 3Q8FA 4NIHA 4AF9A 1OOPB 1F4AA 2NMNA 1XJAA 1W3XA 2YC0A 4MV2A 5C5TA 1YIFA 3KVAA 3OEAA 4MXWA 1VLNA 3LWCA 4IV3C 1QQP2 3AP4A 1NZIA 4XFCA 4UW4A 1BBT1 3NNJA 1VMFA 3K51A 3VDDA 1N1VA 2WYFA 1Q8VA 2W87A 4AI8A 1RIRA 1GANA 1UU5A 2ADDA 2VZPA 1RUNA 2RMU2 2Z2SB 5EQUA 4YG6A 2XLGA 2DF7A 1NCRA 2C5DA 1J3RA 4XUQA 3I59B 4WM8B 2UY9A 2HWD1 1A3KA 3AP5A 1HRI3 4DFSA 2VW2A 4XF1A 2YU1A 4LNVA 1W6MA 1COV2 4D3WA 2E26A 1FYUA 1GWKA 2RS13 5FBJA 5LA0A 2GC0A 2H0VA 4QGMA 1FMD1 2Y6HA 2B5HA 4QPYA 3NVCA 2WS93 5IVFA 4Y33A 4AHZA 3AYAA 1OI6A 3VKLA 4QPGB 1XSQA 1K5JA 3I2KA 4IE6A 2E31A 4N43A 1CPMA 2W0XA 1AJOA 3D82A 4LO5B 4RD7A 1L7RA 1Y9QA 3PTYA 4Q0QA 1LRHA 4ZS2A 2ZA9A 4A3ZA 1RVF3 1QJX2 5ABJC 2P5BA 2BNOA 5KXBA 4FPGA 3H8UA 2ET7A 4YFZA 1NCQA 2VM9A 2ZEWA 3LEKA 2JEMA 2DUOA 3FHIB 4RN5A 5FYCA 3IB3A 1ASJ2 2JDMA 3SH4A 5FLHA 4YZ4A 5C4WA 5DUUA 3POWA 4EWEA 3R6SA 1V70A 1BVP1 2GNMA 5DG1A 1Y9MA 2EIBA 3E97A 3AMQA 2PAMA 3MPPG 1MS5A 2JE8A 2BRTA 3VBOA 4HK9A 1DZTA 5A1LA 1E5HA 3ZN6B 1LHVA 2BOIA 1XNBA 2XDVA 3HOBA 1ZBE2 4IERA 4DZGA 1AR73 1XNKA 4HPKB 4K20A 3RFRA 4AFMA 3VD9A 3KF3A 3IAQA 3HQUA 4Q26A 4TLFA 3S30A 4OZOA 3BB6A 2DU0A 2PHXA 2R32A 4LBKA 3MIBA 4M01A 4BISA 2O0OA 3N9QA 1RUE2 1SLCA 5A6QA 1LGNA 3ZYFA 3ZSLA 2J1TA 2YC2A 1JU3A 1O4YA 1F5FA 1FV3A 4FOWA 3URFA 5EYXA 4MYEA 1FXZA 3MIEA 1I5PA 2OW4A 3VZOA 2J1RA 2WAOA 1SLBA 1W99A 2TEPA 4PF5A 5H9QA 5CFDB 2NP0A 3GZEA 1SCSA 2V09A 1HIXA 2OXBA 2ZGPA 3OYWA 4IGOA 4JQTA 4WV8A 2VBBA 4AQSA 2AYHA 1HRV3 3WV6A 4Q8KA 2ZGUA 2BV4A 3FBYA 4IEZA 2P3IA 3CQOA 5FY9A 3VBFA 3NO8A 4A7YA 3QOPA 3ATGA 3SEPA 1XPWA 4NIDA 1I9RA 2DCZA 3MW4A 1RXGA 1OLQA 4H55A 4NPRA 4OHVA 2PHDA 2JE7A 4RHV1 4YM1A 2FD8A 2W3JA 1QEXA 4NHXA 4P9JA 5GLWA 4R4XA 5JZGC 3T1LA 4LIVA 2XVLA 3RZGA 1LR5A 2E32A 2D40A 5FZHA 1ZREA 2VO5A 3T0BA 4QQOA 4C90A 4Y22B 2XPJA 1FPN1 2VZVA 2XL9A 3AKRA 4LHKA 2QVSB 1YWKA 3B02A 3PJYA 5J98B 3V64A 1REEA 3I97A 3AXDA 1CAUA 5HV0A 4LEJA 2FDKA 2HBUA 4K8RB 2CHHA 3JBG1 1XOYA 2W5FA 2Q8CA 1XYPA 2BQPA 1DGLA 4Q4W1 5KHKA 2JDAA 4BM8A 4ES8A 4CCEA 1JUHA 3VD4A 4XMIA 4GKXA 3PJQA 2HLEA 5SV8A 3OPTA 4GA9A 5BNNA 2JENA 2PN5A 4QX1A 3WDVA 3LEGA 2VBDA 1JYXA 1SQ4A 3CO2A 3NJXA 3JD73 1D4M1 1DGRN 3MLJA 5FZOA 4EN9B 4BHPA 2JB4A 4A6OA 1RJ8A 3E5QA 2VZUA 1Y7BA 2BERA 1IPJA 5JCTA 1FATA 3FN9A 1Q56A 3KT1A 1Z0HA 3NAPB 1LHUA 2PFWA 4IGQA 2WWSA 2WO3A 4R8HA 4N9IA 5IVJA 5K0UC 2WO7A 4JTNA 1WCQA 4XAAA 3LEMA 4P9WA 1OFSA 1IS5A 1SCRA 3JQXA 4XJUA 2RS51 1LB2A 4OYUA 2PAEA 1G86A 1YLLA 3KS7A 2PLV1 4WVWA 3DPRA 1OLME 3VD5A 4UXAA 3NMBA 1RUG3 2LRPA 3BU7A 3LDRA 5FP3A 1RUC1 2E7TA 2C9AA 3JXSA 1IHMA 4ZS3A 1JYCA 1RGSA 2A3YA 2ARXA 3ME2A 3THDA 3VKMA 4BZ4A 4CP9B 5GZGA 5T5LA 2MEV2 2JDUA 2B46X 2QKDA 1P8JA 1ULOA 2MPFA 4YLZA 3EMRA 3H8OA 2CY6A 2DUPA 3PVNA 4BQYA 1UMIA 2RS12 1UWWA 5I0UA 4LTAA 5FBZA 5JOWA 1OOPC 2WS92 4CUBA 3ZFGA 4AGRA 3AYDA 3WDUA 2XQXA 3VBHC 2FQPA 2D7FA 4ITCA 4ES9A 1LJ7A 4CEWA 1NZCA 1BZWA 4JGYC 3AYCA 4YG3A 4LXLA 5IVEA 1AR91 2Z69A 3ES1A 3K46A 4P9LA 1PK6A 1KXGA 4Y5SA 4QM8A 4F7ZA 3V0AA 3ZXFA 2R0HA 2DTYA 1EP0A 1GWLA 2ZX0A 2P1BA 4Z1VA 1UPIA 4WM8C 4DRRA 1K3IA 4KI5M 4P14A 4KH9A 5LA2A 4URTA 1UOJA 1H9WA 4MXWB 3SC7X 3LD8A 3SMHA 4AGVA 1SFNA 4HFSA 2D6NA 3VDAA 3K4DA 2QQMA 2R49A 1G6NA 3B7MA 5IVVA 2WQ8A 4GULA 2ZMKA 5GLTA 5JSPA 1G9CA 1QKQA 1ENSA 2KR2A 4FT8A 4NO4A 4BK4A 1NQJA 3WHTA 3OF1A 3MF6A 3PNAA 5FYSA 2PHUA 2NPIA 2WNVC 4QPGC 1NYWA 4M4PA 1AR72 1NCRB 1CAVB 2BZDA 2ZGMA 3RWNA 4FPFA 3T4HB 1ZA4A 4QX0A 3D0JA 5L7OC 1LOEA 1UW8A 2CDOA 4R4ZA 1QHDA 3RI9A 5HBAA 2N7GA 1J58A 4KGQA 1ND3A 4UYBA 1W6MB 3ZDSA 2BEOA 1TME2 2PAKA 1Q43A 4PDWC 4AOCA 3VDBA 2YZ4A 3SHRA 3UKVA 4TN7A 3LB9A 2ZGRA 4XQ4A 2VMDA 4FPLA 5AVPA 5FP9A 1QNYA 2DVBA 1AXYA 2UU8A 1OA4A 4XABA 1O91A 1ZZ8A 5KR7A 4HVRA 2NM1A 3LE0A 2QQVA 3H7JA 2FDIA 5C3RA 4LBQB 4MHRA 1YRZA 4GWNA 5DAQA 5F5CA 3WF1A 4BJ0A 2OA2A 2YBKA 3O12A 4ARYA 1VBC2 3APBA 1IGOA 3O0VA 1H8VA 2WA3A 2XWJB 4RQPA 5C4WB 3K2OA 3TAYA 1BXHA 2VUCA 3K77A 2QQUA 4EROA 3T3YA 3DCQA 1JH5A 2Q0AA 3POGA 4LO7A 5DG2A 3VBOB 4PQ9A 2DVDA 4NWVA 2ZEZA 4X6QB 1ZVFA 4BXSV 5CYYA 4UFLA 5L36A 1QJY3 5FZDA 2W92A 1VBE1 1OT5A 3P3PA 4NIAA 2W95A 3CL1A 1UZWA 3TRSB 1GOFA 1CAWA 1Q8OA 3MIDA 5JXJA 5L9VA 1W9YA 4B4PA 5J09A 5H9PA 4O61A 2RS31 2CU5A 1W8OA 2BGOA 1NA1A 4GJZA 5BNQA 5I91A 5JXGA 5JIUA 2E63A 3AJYA 3CJIB 4XTPA 2RR12 3RZKA 1W05A 4FFIA 1NXMA 2ZCWA 5SV5A 4GALA 4EQVA 3LPFA 3VBSA 4AHYA 3WXPA 4B1LA 1TMF2 2PHRA 3B69A 3BOPA 1UN1A 2Y6FA 4Z82A 2CTVA 1YNAA 4O7XA 4JKMA 1ULPA 5C70A 4U36A 1DQ4A 1EY2A 3OYWB 4BK5A 3ZX7A 1BJQA 2KD7A 1I1EA 2OQ7A 2DV9A 1HB3A 4NHMA 4O9EA 2WSVA 4XBLA 1V6JA 4OMCA 5F7UA 1W6OB 2VH9A 1SG3A 3ACIA 5FMOS 5BNPB 5KBFA 5JMOA 5C3OA 5A33A 3POEA 4YYOA 3WR0A 4XFHA 5EXOA 1MS9A 2V4VA 5C33A 1W8FA 2ZHNA 4Q0VA 5C6CA 3B3QE 3K4ZA 3ZSEA 5DUXA 2HEYF 1RUG2 3CBNA 2AREA 4YW6A 2W2IA 3AP6A 1OH3A 4RGAA 2Y26A 3ST7A 4C0BA 2PMWB 3BGAA 1RUD3 5E89A 3RI8A 1YFUA 5LA1A 4JDNA 1EAH1 1H2LA 4QHOA 4CCCA 2JDNA 1WW6A 3LDKA 4Y1ZA 2FDGA 3MYXA 1CAUB 5LK7B 3D5OA 1LODA 4NROA 2WIIB 2ZMNA 3PDQA 4DUWA 4XIOA 3KB5A 2YGLA 1YQ2A 2W1QA 2B8MA 4DMIA 2R042 2A6XA 4LK6A 3UJQA 3I4IA 4QB2A 4XDOA 1OC1A 4MOAA 4RGGA 3RNSA 1OD5A 1POV1 4CCNA 1G9FA 4Q27A 1MEC2 2ZEXA 3LA2A 4A45A 2IFRA 4HKLA 2VCBA 4LHLA 3HNMA 3ZSKA 4RS5A 3U1XA 1G9AA 5FY5A 3H9AA 1OH4A 4FTSA 2E51A 3AB0A 4K1YA 1C1LA 5FZ9A 3N9PA 3MI8A 1C57A 4CRQA 4F3JA 5T5PA 1WBLA 4A2UA 2X10A 3NNMA 1XXNA 1ND2A 2QUOA 5FPXA 5FY4A 3RWKX 1OBNA 1OHFA 4JVAA 2EXIA 4XJ9A 4D7TA 3WNPA 3BIEA 4QQPA 4CXXA 5FYBA 4XFIA 4L9BA 1ENRA 1IZ3A 2UYBA 4XUOA 2EA7A 1RHI2 1VBA2 3DPRB 1UY1A 3KT7A 5FV3A 3WNOA 4IV3A 2D6MA 2LW8A 3OPZA 1ZZBA 2WUHA 1R081 3OBAA 4GMP1 4QB6A 4E2SA 4L0PA 2YB7A 1PGSA 5DDJ1 4RGKA 3UV9A 3AL5A 5FZBA 1H4GA 1QXJA 2NQYA 4CZSA 1LOFC 1UU4A 4FP3A 4FOYA 4FCAA 5JSRA 1PX3A 1YFXA 1UL9A 3RDIA 3R0RA 2A6ZA 1V6MA 3PVBB 4JRAA 4LBNA 1AR61 3MHZA 3Q8AA 2AGSA 2CGOA 1MR5A 2QBXA 5C8CA 3OD0A 1RUOA 2ET1A 1ULGA 3TEWA 1HXS3 3DXTA 3WSOA 1FI2A 1CIWA 2DFCA 2JKBA 1O59A 3PUSA 4OLLA 4XMAA 3EHKA 2Y64A 4XFBA 2OPKA 3ZFGB 2RHPA 4FXKB 5JMCA 3ZIXA 2TUNA 4Q1RA 2XLAA 1XQNA 4LE3A 3DEMA 3O14A 4YVWC 4P9YA 5GM0A 4RSUA 4QXHA 3K3NA 1BK0A 4DY3A 2ZGLA 1UKGA 1KJLA 1SZBA 3V0AB 4GB31 2DUQA 2WLPA 4ATFA 5BNOA 3WDTA 1AZDA 3WLUA 1RUH3 3ZMOA 5FYIA 3NNFA 4ISRA 1OLRA 3ELNA 5J37A 3TYJA 3H3UA 2C6SA 3G7DA 3ZSMA 5FWJA 4Y1YA 4FPEA 5C9AA 4LE4A 4K8FA 4LLFA 5FPVA 2VTXJ 5FY1A 1AR81 3DKWA 3H1MA 5IK7A 2CYFA 4QQLA 3ZR6A 5CNAA 1UMZA 4QT6A 4YGBA 3TBDA 2OX0A 2F17A 4SLIA 1TE1B 3IIIA 4PIYA 3LFIA 4A4AA 1JZ6A 1AYN1 2P17A 5F5QA 3KV4A 2VNRA 4QKBA 4HANA 3VV1A 3I54A 3TN91 3HWJA 4BB3A 4WVVA 4GXLA 2D5HA 4R52A 1LU2A 1QMJA 5K9YA 1PGL2 1YI9A 3QD6A 4IV1C 5A7WB 2ID4A 1WMEA 2VU9A 4DIQA 4FP2A 1VB2A 3THTA 4QPIB 5IAVA 3CF6E 4KMQA 1CGPA 4LULA 4E27A 3RZJA 1WCSA 5EHDA 5IWFA 5FMBA 4CCJA 5FPUA 2XBO1 1OQEA 1S0BA 2XJVA 1O5UA 1MQTA 1WD3A 1ALYA 5JAXA 2RMU3 4H2AA 4OHWA 5KHJA 5FZLA 3QCWA 4FQZA 4IW3A 2GAUA 1F9KA 4WVMA 3VBRC 2QQJA 5I0DA 5GZDA 3JCIA 4YW2A 3MZHA 4DNYA 4LOSA 2R071 1ENXA 3ITQA 1YQCA 2I07B 4JDOA 1COV3 4Q4X1 4UFHA 1VIWB 1LAJA 1KDMA 4RQPB 4ARXA 3CJIC 4ASKA 1HKDA 4K21A 1JU4A 5D8AB 3J8F1 2GDFA 4CDQA 2BU9A 2HWB1 4K40A 4TLGA 5J3UA 5AFBA 5CFCB 1MS3A 4E4DX 1KS4A 2YMZA 2BVBA 4PQQA 1H2MA 5LA9A 5EP9A 1QJX3 1VAMA 1IQAA 1NA1B 3AKTA 3MLLA 4MXVA 3FFZA 4OCTA 4Q2FA 1VAVA 2Q4SA 1LOBA 3KCCA 4CCKA 1GZ9A 1QIQA 2VY0A 1T6BX 2TBVA 4GIQA 1KITA 5DZFA 5DAXA 2R30A 3WW2A 2RJKA 4BCUA 3VBSB 5BNPC 4V2VA 2JDZA 2DYCA 4KNCA 3T2OA 4AAXA 1AL0G 2VTFA 3DV8A 3PU8A 1H30A 1UOBA 3B00A 2P37A 1F2NA 4QXBA 1KQRA 2V5DA 5KXCA 1NG0A 2ZGOA 1ZBE3 3PVEA 2XONA 1D2SA 2AEZA 3E6BA 1WW4A 2VCAA 3SNMA 2C4XA 5IATA 4LUKA 3N35A 4R9CA 2Y6JA 3GZAA 3ILFA 4TTGA 2WZR1 5DPNA 4YSFA 2BBAA 4PT6A 3I2OA 3IBMA 2JE9A 4CDWB 1X7NA 1MS1A 2I45A 4XBQA 1GP6A 1RUE3 1F4HA 3KWVA 4ZXKA 1VMHA 4N90A 2OZJA 1LHWA 1GWMA 4HVOA 5FLIA 5LRSA 1ZX5A 3N7KA 4DINB 2TNFA 4XJAA 2L9LA 1UYZA 5EIYB 4HKWA 2Q8DA 3J7LA 2IZWA 3LGRA 5ERLA 2XJPA 1PO21 2RG4A 3ZPYA 1CQ9A 4IE0A 1FOD1 3WNMA 2RE9A 4PI2A 3K3OA 1JN2P 4CDUC 5DAVA 3LPGA 4GKYA 1CAXA 4AAPA 2P6HA 2JG9B 2D3RA 2X05A 1JZ4A 1YI7A 1IS6A 1SLLA 3JB4C 2Y6GA 3MBWA 4FOQA 1N3QA 3GF6A 3QLQA 5FFOC 3MF9A 2JG8A 4ZKTB 1R1A2 2W9XA 5JSOA 2JDYA 3PHMA 5FXVA 4EZHA 5F3CA 5T50A 2VE1A 2BFUS 2E33A 4RS5B 3M3QA 1NUKA 3PUQA 4QWNA 1CN1A 3OGVA 4QXKA 1Y4WA 2HWE1 1N3PA 3FL7A 2EXHA 3GYDA 5LRRA 2W52A 4B1MA 3HNBM 2ZZJA 2G9FA 4AQ6A 4PHZA 5T3NA 4F8AA 5ACA2 2UURA 3EJKA 2QZ3A 4UAPA 1S0EA 3S7EA 3CHXA 3D6EA 2HYXA 4CCLA 4EN7B 1UAIA 2WKKA 4E8DA 4ZU4A 1VE0A 1TG7A 1URXA 3AX4A 2WFF2 3N9NA 4KL1A 4WZCA 4IL7A 1H2KA 4R9BA 4Y4YA 1H4HA 3LA3A 1RXFA 5FRAA 1GMMA 2W47A 5C7GA 5F37A 3FX3A 3KV9A 1V00A 1QDCA 3ETPA 5JWPA 4RFRB 1W9SA 3B93A 3PUIA 1H6YA 1ENQA 3VKNA 2VNVA 2AACA 3HBKA 4WM7A 1MZ6A 2RM21 3M3OA 2O8QA 1RUI1 3MPBA 3BTYA 2Q1FA 1GLHA 2H0BA 2HWC1 3MUY1 2OZ6A 2W1WA 5DXDA 1AVBA 4PJYA 3WHUA 3VZJA 2WRAA 4JZRA 3Q8EA 2GMPA 3KMHA 2C9KA 4LA3A 4XFFA 1HX6A 5JR7B 1UCXA 1SACA 4KQ7A 3M4FA 2DWRA 4Q4Y2 2G9ZA 5CU1A 4QM9A 5JXHA 1OXCA 3A21A 4DXSA 1GZCA 2R062 4DPNA 2EIEA 4QGLA 4W6WA 3GGLA 4YG0A 1MZ5A 3WQ0A 3NW4A 2MEV3 4ISQA 3RSJA 3WW1A 1APNA 1BEV1 5A7SA 4KG8A 1XB9A 2VQTA 1OURA 2VZSA 1UX6A 1S0CA 4HN1A 4QX3A 3W5NA 3MIHA 3OEBA 1CX1A 3NQHA 1WD4A 1KJRA 3RZZA 1VR3A 3D0SA 2D98A 2JDPA 4ATEA 5FZKA 1W06A 1UKRA 1RMU2 1BVVA 4QPIC 2YBSA 4XJ8A 1LCLA 3NL1A 4A41A 4AEMA 3VD3A 4NPLA 2WN3A 3O1RA 4LBQD 3J26N 2EAKA 3OY8A 2IXCA 3WCSA 3BPSA 1HV0A 3KSCA 1SHWB 2YBPA 2JICA 1PIV1 4MG2A 2VZRA 2ZPXA 4XBNA 2I2SA 1REDA 1K5MC 4I0BA 1KS5A 4E2QA 2JJ6A 3ZXJA 4PI0A 3SEEA 2VC9A 4D8MA 3JBG3 4CP0A 1J59A 2YGMA 2P3JA 1WWYA 2EAAA 4W50A 3MLKA 2VOVA 5DN2A 4Z07A 1ZRIA 5GZFA 3ZKYA 3RMYA 5CZKA 3E1F1 1BQPA 1UY3A 2ORZA 1CONA 2XJTA 4AEDA 1C8M2 3GM8A 4RR3C 2VQUA 1W9FA 2Y33A 4CCDA 4M3CA 4QDRA 5AC92 5FP8A 5D8AC 2VZ1A 1MQTB 3T2TA 4BDVB 1YQ8A 1XRUA 3EO6A 5DUWA 5A3TA 2PELA 2VW0A 3KV6A 4PBPA 4AE2A 2E7AA 1OUSA 1VRH1 2W1UA 5CFCC 2OT7A 4QKNA 4WVMB 5EJ1B 1SPPB 2FCTA 2WZPP 4XW3A 1OA3A 1WA4A 5IT6A 4LKSA 3AMNA 5A3OA 3E5UA 3LOIA 1W6QB 2A3XA 2C1FA 3VBUC 1NKGA 4D7YA 3NNGA 1TME3 1V6IA 3MW3A 3W5MA 1NX9A 4ZPIA 4UOJA 3GZUC 1BBT2 2PLV3 2WABA 4GZ9A 3FFQA 4XF0A 3PTRB 1JTZX 4QU2A 3MW2A 1W8HA 3AM2A 1MS4A 2VMHA 1UY0A 3AMHA 2XB6C 2WNUC 4HSLA 5L9RA 5LWBA 4YZ2A 1IG3A 1NLQA 3M70A 2HWD2 4TWTA 1H8TA 1AX2A 3I3DA 3PLQA 1W04A 2LS6A 3AMPA 1JOBA 1WCDJ 2G1MA 3PUHA 5FP4A 3H0OA 1HJFA 1VBC3 3P3NA 2Z79A 1JUIA 1FMD2 2BP6A 3F95A 4UF0A 5FZAA 4CDWC 4COUA 3NKGA 2HWF1 1LTEA 2HH9A 5FLJA 2D93A 2ZGNA 2ZX2A 3IM0A 2PQSA 4NJ4A 5FK8A 4O65A 5FZGA 5JPMB 5LK5A 4I30A 4IEYA 4Y24A 1IOAA 1WKYA 4KG0A 1JZ3A 1AYM1 3KT4A 4KU8A 4FPJA 1HW5A 2GNTA 2BUKA 2WQ4A 3DYMA 4XURA 3OSDA 5EV7A 2B9UA 1JS9A 4GH4A 1HRI1 3OBRA 4J6GA 4DXTA 2JWPA 3W20A 3NJVA 3BTAA 3MIGA 3I2FA 2CGPA 5FKCA 1WCKA 3TEXA 2RR13 1BLZA 4EYUA 4C91A 3DKQA 1TQ5A 3THPA 4HK8A 4LT5A 2JG9C 4LQRA 1JYNA 2ZHKA 1DF0A 1TMF3 5FWEA 1W28A 3T08A 1SBDA 2B42B 1BMV1 4OI1A 4S2HA 5FXZA 3RVHA 2W39A 4GWMA 2A5ZA 3ZFEA 3PIJA 1KFXL 4CTEA 1RVF1 2X5IA 4DB5A 4YGEA 4CEYA 4ZONA 4W6YA 3UETA 1UIKA 2D3PA 2PTMA 2Y0OA 2VZ3A 1UXXX 3S5AA 1YHFA 1CAXB 4LORA 1EUTA 2HEWF 5ANQA 2J42A 3ZKUA 4BWOA 3FHAA 3USSA 3V56A 3WP4A 2NN8A 2ARAA 4IQPA 2R16A 2P4EA 1W9WA 2JG8B 2VXJA 3FJSA 4IETA 5A3NA 1JZ2A 1O8PA 3IDAA 5F6LB 1DGWA 1H2NA 1JYVA 3PIGA 3VD7A 1KRIA 4Q0SA 4EWAA 5FZ8A 5DMYA 3I49A 1R091 3BCWA 2ZGKA 3LCPA 3M3EA 1U12A 2C0ZA 5KWRA 3I3QA 1RJ7A 5JVVA 3T2QA 1PO11 4LBLA 3D4KA 4CUAA 4NRPA 1MZFA 5F6KA 4YW3A 2VW1A 2R043 2G9GA 2Q1ZB 3AP7A 3CLPA 4RHV2 4DQAA 2A73B 2HWF2 3O1MA 5FUPA 1UMHA 4I0AA 1DIWA 2ADEA 1MEC3 4CDXA 1SBFA 4JGZB 1STMA 4L8QA 5DQ0A 3WD5A 1ACCA 1ZZ7A 1FPN2 3H3ZA 3AK0A 5FZCA 4V1PA 1HRV1 3GBFA 1MZEA 3H1WA 3A0NA 3JBG2 5D2AA 4QGNA 3R4UA 1H1IA 3GBGA 4Q4W2 5C8WA 2WA4A 3ACHA 1F5JA 1RITA 1DLLA 3J9SA 3OOXA 4I02A 4COVA 5A3UA 2XJSA 4P5HA 2WYSA 1C28A 2BDRA 4BLJA 1QF3A 5CVRA 1RHI3 1VBA3 1Z7S1 2XJRA 2B39A 3VDDB 4DOUA 3SH3A 2VCMA 1UZVA 2R1BA 3VLBB 3WT3A 5LZ6A 2WO2A 1D4M2 5A1AA 3CJXA 1OKOA 1ST8A 5E88A 4F83A 4JV4A 3WUDA 4NHLA 2WR9A 4JAAA 4H7LA 2FDHA 2A3WA 3IMMA 1G8WA 2WSUA 1ZA7A 5LBBA 3ZYHA 1EV11 5FMOL 5CKNA 2BNNA 3L2YA 5HV4A 2VVEA 1Q3EA 2LTNA 4MH0E 2FHRA 2P3YA
chains in the Genus database with same CATH topology
1L7LA 4BQ3A 3UT0A 2WYFA 4YW6A 4YWAA 1OH3A 1UOJA 2LROA 1GWMA 2JWPA 4BQ4A 4LKFA 2C24A 1W8UA 4LJHA 4A6SA 4YW7A 1W90A 1W8WA 2VXJA 5D21A 2KR2A 4AL9A 2O14A 1OKOA 4LK7A 3ORJA 4CP9A 3F95A 2LRPA 1HN0A 3ZYFA 4CPBD 4LKEA 4LK6A 4BQ2A 1V0AA 1GWKA 3ZYHA 2Q1FA 3ZYBA 1WZXA 1WCUA 1WMXA 4BQ5A 4CP9B 2K46A 1W8TA 4LKDA 1GWLA 1W8ZA 1W9FA 4CPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7L A;  4BQ3 A;  3UT0 A;  2WYF A;  4YW6 A;  4YWA A;  1OH3 A;  1UOJ A;  2LRO A;  1GWM A;  2JWP A;  4BQ4 A;  4LKF A;  2C24 A;  1W8U A;  4LJH A;  4A6S A;  4YW7 A;  1W90 A;  1W8W A;  2VXJ A;  5D21 A;  2KR2 A;  4AL9 A;  2O14 A;  1OKO A;  4LK7 A;  3ORJ A;  4CP9 A;  3F95 A;  2LRP A;  1HN0 A;  3ZYF A;  4CPB D;  4LKE A;  4LK6 A;  4BQ2 A;  1V0A A;  1GWK A;  3ZYH A;  2Q1F A;  3ZYB A;  1WZX A;  1WCU A;  1WMX A;  4BQ5 A;  4CP9 B;  2K46 A;  1W8T A;  4LKD A;  1GWL A;  1W8Z A;  1W9F A;  4CPB A; 
#chains in the Genus database with same CATH topology
 4AEK A;  1OFN A;  4AI3 A;  3AVS A;  2XGX A;  3BOD A;  2RS5 2;  3HAG A;  5KHI A;  1F8V A;  2GH2 A;  2PLV 2;  3TOJ A;  1G9B A;  1XNT A;  5F9T A;  2PQQ A;  5LY1 A;  2D6L X;  3WDY A;  3JD7 1;  5FXX A;  3RYP A;  1RUC 2;  2RDN A;  4N43 B;  5F5I A;  3U4S A;  4NMI A;  3CDZ B;  3OY8 B;  4RYD A;  4BXF A;  5A6Y A;  5KXD A;  1XE7 A;  3K48 A;  4AR2 A;  1GUI A;  4QQH A;  4C0H A;  1OQ1 A;  1X9T A;  4MX3 A;  1LUL A;  3FLT A;  4NAO A;  1D0G A;  4P9I A;  4DEV A;  3TEZ A;  1OPO A;  3FWE A;  4XUT A;  5FZ0 A;  4KBB A;  1O3R A;  4BQ5 A;  1NCQ B;  3N7M A;  3VZL A;  4MSV A;  5A32 A;  5J36 A;  2R7E B;  1N1T A;  1QWR A;  3B9I A;  3OUI A;  3EXU A;  3AXE A;  1R64 A;  2Y60 A;  2YDE A;  2YYO A;  3SCF A;  1POV 3;  4AED B;  4CU8 A;  1H1A A;  1PNG A;  1XNA A;  4XF3 A;  4QDS A;  1AL2 1;  4N53 A;  4YNI A;  3ACG A;  3QH6 A;  4M3C B;  4MO3 M;  3SCH A;  5BUV A;  1M06 G;  3VB9 A;  3RGB A;  2YRO A;  5I0T A;  1V9U 1;  3CNA A;  4IE4 A;  1AR9 2;  4Q4V 1;  3CU7 A;  4UBH A;  5BPX A;  1J1T A;  3ZMN A;  5ABJ A;  3V0B A;  1PVC 1;  4JKL A;  1S55 A;  4LR4 A;  3U37 A;  4AVB A;  5CFD C;  2QDR A;  3PVO A;  1LGB A;  3J7N A;  5K8S A;  2BWC A;  1DQ0 A;  2QTW B;  1GZW A;  1OF4 A;  3OGR A;  2XVG A;  1JHJ A;  4XFG A;  5FZ4 A;  5LBE A;  1VP6 A;  2VMF A;  4BMB A;  4JCK A;  2VD7 A;  1GOH A;  1R1Z A;  3UNP A;  2HKX A;  1GFF 2;  3USU A;  3MV0 1;  5I8Y A;  2QCS B;  3KQ4 B;  1HDK A;  1YFY A;  1VBD 1;  5F39 A;  1UYP A;  4M3C F;  4L11 A;  3ZXE A;  1H8T B;  5IVB A;  1QJU 1;  4FPC A;  1BK1 A;  3VBF B;  1CZV A;  1AR6 3;  2UWB A;  4KWU A;  2J1U A;  5LB6 A;  1UOG A;  1QH6 A;  1DYO A;  1H9P A;  1U5I A;  2E9Q A;  5GLZ A;  1I6X A;  3BKZ A;  4OHX A;  1RUF 1;  3LOB A;  3FE5 A;  4Q0U A;  4FBF A;  2X29 A;  2A70 A;  1VMJ A;  1GU3 A;  3UK9 A;  3ABZ A;  3S7I A;  1NLR A;  3WP6 A;  4EE2 A;  2ZGT A;  1N1Y A;  4OHZ A;  5A3L A;  4S2G A;  1SLA A;  5FAX A;  5JR2 A;  1YQ5 A;  1GNZ A;  5GJ6 A;  5AFE A;  4NII A;  2J1V A;  4AFB A;  4IDZ A;  1YIP A;  2P3K A;  3GHN A;  2XH6 A;  4AG4 A;  4N7I A;  3NAP C;  4KBZ A;  2QZ2 A;  2OUJ A;  2XUM A;  5JZG A;  3H50 A;  5KHG A;  5FQ0 A;  2Z4F A;  2WBK A;  3LZZ A;  4LHS A;  3ILR A;  2WC2 A;  5BNN B;  4XTM A;  3ON7 A;  3KHC A;  5EFU A;  2ZKN A;  3KV5 A;  4N9H A;  3S57 A;  1PM4 A;  1ULC A;  1A34 A;  5FZO B;  3MGU A;  5HXM A;  1VBE 2;  5F1R A;  3ROU A;  2KM2 A;  2VUJ A;  2VNO A;  1AYN 3;  1PVC 2;  2YC4 A;  4JDM A;  2D6K A;  4O9G A;  3ZFE B;  2DBN A;  1HV1 A;  2X5I B;  3MFC A;  2OQ6 A;  4CEY B;  3INA A;  3NWK A;  1DYK A;  2RS3 2;  1PMH X;  3GCW A;  2X53 S;  4E2G A;  4QX7 A;  4DRV A;  4J25 A;  3LKJ A;  1NY7 1;  2P6C A;  3W21 A;  1RUJ 1;  1ZBA 1;  1ZZ9 A;  5LW9 A;  4OI0 A;  2GME A;  4CCM A;  1XBF A;  1WA6 X;  4HET A;  4BQ2 A;  4CUC A;  1C1F A;  2XUE A;  5A70 A;  4C1X A;  1CVN A;  1PZ9 A;  2VZQ A;  3BN6 A;  2DUR A;  3Q8B A;  1J3P A;  2QQI A;  2ZGS A;  4MLO A;  1O3T A;  2JEC A;  1YJK A;  1QJY 1;  1X33 A;  3UJO A;  1PGW 1;  2WT0 A;  1S0G A;  5I8T A;  3VN4 A;  4AGG A;  4JGZ C;  1ULD A;  2B7Y A;  4XCB A;  4YM2 A;  2ZML A;  3BI3 A;  2ETE A;  4C1W A;  2I74 A;  4I01 A;  5K0U A;  4MUV A;  5F2W A;  3WZ1 A;  4NHK A;  4LJH A;  5IHR A;  1W0N A;  1W2N A;  3R4S A;  3MIF A;  3IMN A;  1CIY A;  2BPA 2;  4LHN A;  5FUN A;  2ATF A;  5JI7 A;  3IKW A;  2RJL A;  2CWM A;  4JTO A;  1PNF A;  4WZF A;  1N3O A;  3HN1 A;  3VZN A;  5IFT A;  3O5S A;  3FC0 A;  1R1A 3;  3RPQ A;  4CDX B;  1WUV A;  4XHX A;  2GP5 A;  2HWB 3;  4X6R B;  3IN9 A;  4UFJ A;  1BHG A;  1W8T A;  4CEW B;  1IKP A;  3VDD C;  3NV2 A;  2KXL A;  2CWS A;  1EAH 2;  1ULE A;  4LBM A;  2UWC A;  5FZ6 A;  5B2G B;  3I3M A;  1PK6 B;  3WP3 A;  5LEK A;  1RB8 G;  2Q1M A;  1Q8S A;  2JIJ A;  3PL0 A;  4EZ4 A;  4ZZ5 A;  1US3 A;  1NCR C;  1F31 A;  5C3P A;  2Q8O A;  3VL9 A;  4Q8L A;  5ACA 3;  1OOP A;  1W90 A;  3ZXG A;  3OBZ A;  1BYH A;  3VBH A;  4LPL A;  5FYU A;  2IXH A;  3H1Y A;  4DEQ A;  4GAZ A;  2RDQ A;  4JGY A;  1FNZ A;  2ZXQ A;  2WFF 3;  4W65 A;  3J7M A;  3SH5 A;  4K9S A;  4M3C E;  2HJI A;  1RUD 1;  2GZW A;  3CIH A;  3ZN4 A;  2WT2 A;  1JOJ A;  5E16 A;  3VHP A;  1V6K A;  3FUQ A;  4N43 C;  1NQD A;  1X9P A;  3GZT B;  3GHM A;  3I59 A;  4ONU A;  4WM8 A;  2Z5W A;  5CBL A;  3L2H A;  1AF9 A;  5FJK A;  2WZR 3;  2OVU A;  5H9R A;  1SEF A;  2VZO A;  1ND3 B;  1US2 A;  3SIT A;  3NKT A;  1DHK B;  2JD4 A;  1A6C A;  3ZFF A;  2DCT A;  1NCQ C;  5FZM A;  1HQW A;  1F15 A;  4JHT A;  2IXL A;  2PHT A;  3ZXL A;  1LEM A;  1O4Z A;  1EPW A;  4AZZ A;  1YFW A;  4DO0 A;  4LMF A;  2WWJ A;  1R08 2;  2ZKL A;  2WNV A;  4BOW A;  3N7L A;  4QPG A;  3U07 A;  5C4W C;  5IVC A;  5DDJ 2;  5LAT A;  2BYV E;  3T2P A;  1LHO A;  2BWA A;  3VBO C;  5L7O A;  4Q4Y 3;  3QH7 A;  4PLN A;  4AQT A;  3ZYJ B;  4MGY E;  2R06 3;  3M7A A;  2XHK A;  2F6B A;  4TZD A;  4PDW A;  1C3H A;  2DCK A;  1AXK A;  4DXZ A;  4YFW A;  1AR6 2;  2GND A;  4XYX A;  3I2D A;  1SDD B;  2ERF A;  5A32 B;  3OJB A;  2EF6 A;  1WW5 A;  1ZRD A;  2BFU L;  2Y34 A;  3MIC A;  5CG8 A;  2A6V A;  4COZ A;  2NLR A;  3WNK A;  3AJZ A;  2PYT A;  1O3S A;  4MET A;  2D6O X;  2RV9 A;  4N53 B;  4XIK A;  1RMU 3;  1LES A;  3RQ0 A;  2X8K A;  2JKX A;  3L9J T;  1UQX A;  4NIG A;  3TWI A;  5A3P A;  1KGY A;  2BVV A;  3V0B B;  4BH9 A;  5ABJ B;  5F5A A;  3RS6 A;  3RRD A;  3S6P A;  3WVJ A;  1WMX A;  3I2G A;  3UGH A;  5KC5 A;  4RFT 0;  1CAW B;  4GB3 2;  5FO8 B;  2D43 A;  4JKK A;  2RDS A;  1DZR A;  4JX0 A;  2ENR A;  5FY7 A;  2FZ1 A;  4HLT A;  5J96 B;  4HKO A;  1YYN A;  3ZN5 A;  2VOW A;  4M4R A;  3ZYI B;  1FNY A;  1HXS 1;  3VBF C;  2XG3 A;  2EVX A;  4LUM A;  2C24 A;  2Z42 A;  3DEC A;  3AC0 A;  2VQA A;  1AR8 2;  2J7M A;  4UFI A;  1C8M 3;  4NR1 A;  1VBB 1;  3JQW A;  1DG6 A;  5A7N A;  5AC9 3;  2ZAA A;  1MAC A;  4IXL A;  3VUO A;  3ACF A;  1WBF A;  3FUO A;  1AYN 2;  1XE8 A;  5IAX A;  2VVF A;  4M00 A;  5HCB A;  3TN9 2;  1IPK A;  2K46 A;  1MS0 A;  4CSW A;  1SLT A;  4YW4 A;  1RUH 1;  3RZL A;  3ZYP A;  3FMG A;  1PMI A;  1RTV A;  3P1I A;  2HWC 3;  1XE0 A;  2A7A A;  5A6Z A;  1GP5 A;  5CIS A;  1QH7 A;  3ZYR A;  5A33 B;  3LA7 A;  5FPZ A;  4YPJ A;  5FOB B;  1QU0 A;  3RZM A;  3LEI A;  1BBT 3;  3HPN A;  1QOO A;  5FMC A;  3POY A;  3EBR A;  3MEP A;  4ZHN A;  2QJV A;  5EZW A;  2XBO 2;  4HBN A;  1NXD 1;  5BNN C;  1NLS A;  3POB A;  3OG2 A;  2BJS A;  4FAH A;  4D94 A;  2IXJ A;  4IEU A;  3KGL A;  1QGL A;  4BME A;  4CP2 A;  2DVA A;  3I3E A;  2ARC A;  5HI0 A;  1DP0 A;  2GN7 A;  2AZ5 A;  3M8L A;  4FPK A;  1PX4 A;  1GP4 A;  1SBE A;  2HWD 3;  3C8X A;  3G6J B;  2VMG A;  4S2F A;  2R07 2;  4AVT A;  3AZV A;  4FOV A;  4Q4X 2;  2GNB A;  5E6H A;  1IG0 A;  1SDW A;  2LRO A;  3FLR A;  4LBJ A;  1PHM A;  1FMD 3;  1QQP 1;  2A6Y A;  3BVC A;  4I3P A;  5EYY A;  5FYH A;  1JW6 A;  4FPO B;  3J8F 2;  4OUL A;  5L73 A;  1QY4 A;  3IPV A;  2CGN A;  4HZF A;  2YY1 A;  3K4A A;  4OI2 A;  2HWB 2;  1G9D A;  5F3G A;  4CE8 A;  4Z2A A;  3DPR C;  2Q8E A;  1Q8P A;  1WLT A;  2RMU 1;  3S5Q A;  1JOP A;  2QE3 A;  4NRQ A;  4AWD A;  1U0A A;  3I3B A;  1IQD C;  1CZS A;  1Y3T A;  3WX5 A;  3ACL A;  4I0W B;  4D6S A;  1ND2 B;  1GV9 A;  3IT8 A;  3BTZ A;  3DUI A;  2K0G A;  1XYN A;  1CPN A;  1MS8 A;  4ZU5 A;  3ZYG A;  5DZE A;  1COV 1;  3JU9 A;  3KHB A;  2LM3 A;  2BBV A;  2VG9 A;  4CPB A;  1WMF A;  4H7M A;  5FO9 B;  2JDK A;  1UD1 A;  2VXR A;  2ZX1 A;  3WW3 A;  2DFB A;  5JPN B;  1DQ5 A;  4QQ2 A;  1FAY A;  2LUW A;  4FO9 A;  3W58 A;  2FDJ A;  3ZFG C;  2Y38 A;  1CR7 A;  3AVR A;  2W68 A;  3O1S A;  4IEX A;  4CDX C;  1NT0 A;  1SLI A;  4CEW C;  5IYY A;  1MVE A;  4RA0 A;  3PMS A;  1VRH 3;  1QJX 1;  5K0U B;  3WG2 A;  5B4N A;  4D0Q A;  1HN1 A;  1PK6 C;  2WZR 2;  4LKE A;  1JMU B;  2VUD A;  2W08 A;  4RL7 A;  1O6U A;  1ZRR A;  4UW3 A;  3LF7 A;  5FYV A;  3ECQ A;  3ZYB A;  4E4H A;  3F2Z A;  5C8C B;  4XHB A;  3ES4 A;  4K7J A;  5FJH A;  5FRE A;  5L19 A;  2XOM A;  4LKD A;  1ASJ 1;  1JZ5 A;  1K45 A;  2WQZ C;  3OGS A;  4UFM A;  2CL2 A;  4NUB A;  4KWK A;  3HD8 B;  3I8T A;  4MHU A;  3R05 A;  4P9X A;  4HON A;  4M0H A;  2GC2 A;  1LOF A;  4P5Y A;  4CUG A;  3MDP A;  2QQW A;  4IEP A;  2D44 A;  5IFP A;  4A42 A;  4XET A;  1ZBE 1;  1PO2 2;  4XPV A;  2OII A;  3AMM A;  5LBF A;  4DUV A;  4BIF A;  3ALQ A;  4QMA A;  4A44 A;  1FOD 2;  4JRL A;  5BNO B;  2WL1 A;  4HN0 A;  1DDL A;  2FMY A;  1S0D A;  2Q30 A;  4QXC A;  4V2W A;  1XNC A;  4XVH A;  4AVV A;  2WT1 A;  1S0I A;  1C5H A;  3TB0 A;  1RUE 1;  1LOA A;  3VBH B;  4YZ5 A;  2WN2 A;  3GJA A;  1ND3 C;  1X8M A;  3AYE A;  4RHV 3;  5C9A B;  5APA A;  1W2A X;  4JGY B;  4YVW A;  2HWF 3;  2Y0I A;  2ZS6 B;  3CZU A;  4Y4R A;  4QB1 A;  4HMZ A;  2D97 A;  3SLI A;  2CDP A;  4U2A A;  4MGI E;  3AKP A;  4NPM A;  2LAL A;  2WZE A;  1FPN 3;  3FHQ A;  1JXN A;  3IAP A;  1CAV A;  5DAP A;  4QHZ A;  1AYM 3;  5IK4 A;  1S0J A;  2UY8 A;  5J1X A;  2HWE 2;  3POS A;  5IK5 A;  2VAU A;  4FXG B;  1OQD A;  3O1P A;  2W1S A;  4SBV A;  2WWU A;  3ETQ A;  3ENR A;  5J7M A;  4CXW A;  1O3Q A;  4Q4W 3;  2GSY A;  2YG0 A;  3SXW A;  3ZFF B;  1V0A A;  4DS0 A;  1UZ0 A;  2VEC A;  4YW1 A;  2GC1 A;  1ZZC A;  2C26 A;  3EQE A;  3ZPO A;  3HMY A;  4RQP C;  2WNV B;  1E5S A;  2DDU A;  3OUJ A;  4XZU G;  4QDQ A;  1D4M 3;  3NV4 A;  5CEH A;  1YQ6 A;  3E5X A;  4N53 C;  5L7O B;  2JIG A;  4HL0 A;  2YV8 A;  4FPY A;  1UYY A;  2J22 A;  3I2J A;  4P9G A;  3U78 A;  3ASI A;  4X8N A;  1ZM1 A;  3JUU A;  4IV1 A;  4PDW B;  3VKO A;  3A0K A;  2RM2 2;  5IUQ A;  4LBQ A;  1B09 A;  1RUI 2;  4OVE A;  3C3V A;  5FIX A;  4PIZ A;  2HWC 2;  5FY8 A;  3THC A;  1NA1 C;  2RJ2 A;  3N9O A;  4Q1P A;  4QKD A;  3QBQ A;  1QJE A;  5DAW A;  3T1M A;  1L3J A;  3VHR A;  5JOY A;  2JDH A;  1FX5 A;  2RS5 3;  3E6C C;  1GYK A;  3VGI A;  3ZO0 B;  3POI A;  4AHW A;  3OGJ A;  3N7J A;  4CDQ B;  1GQH A;  2AC1 A;  2GN3 A;  3B9C A;  4I09 A;  2JX9 A;  5T5O A;  4URA A;  3VBS C;  4E9K A;  4MVT A;  3VZK A;  3S0M A;  2BOJ A;  1RUC 3;  4DY5 A;  2GH8 A;  2YXS A;  1R09 3;  4FAG A;  5A3M A;  5CAD A;  4A7Z A;  3VBR A;  1X82 A;  3IDC B;  5A1F A;  3O7O A;  3X29 B;  3U10 A;  1PO1 3;  1BEV 2;  3MUZ 1;  5FTT C;  1QDO A;  5H9S A;  2XXZ A;  3CJI A;  1UZZ A;  2FCU A;  3UKT A;  4NHY A;  3NJZ A;  3E6D A;  2QQO A;  2WAA A;  4ZY9 A;  4OMD A;  3AFG A;  1TNR A;  1LOC A;  1LOG A;  1T2X A;  2NZ9 A;  2XQR A;  4HXC A;  5I0S A;  3D3A A;  5E8A A;  1YUD A;  1H0B A;  3DN7 A;  1WCU A;  4Q5O A;  2CAV A;  3O1V A;  1XU1 A;  4QHB A;  5L9B A;  3WNX A;  3LIG A;  1O8S A;  1KDK A;  1AR9 3;  1PIV 2;  5G04 L;  3A23 A;  4PF1 A;  5A80 A;  5I93 A;  3ZDV A;  2MEV 1;  2Y6L A;  1CD3 G;  1S2B A;  2ILM A;  2R6Q A;  2XJQ A;  1AX1 A;  2XKP A;  1W6O A;  4E8C A;  5CAZ A;  2ZX4 A;  2EXJ A;  4B4R A;  2VVD A;  3A22 A;  5BNP A;  1CWP A;  4X8P A;  2RS1 1;  4BE3 A;  2XLF A;  3CZJ A;  4UWD A;  5C3Q A;  2DTW A;  4B8E A;  2WS9 1;  1SMV A;  4XDP A;  4EN0 A;  1DQ1 A;  1Z7S 3;  2VMC A;  1HN0 A;  4OUS A;  5EJZ B;  4COY A;  1PVX A;  3OUH A;  4XOG A;  3P6B A;  2J1S A;  4COW A;  3FBM A;  3AZY A;  1XC6 A;  4XQD A;  2E6V A;  5KXE A;  1WMD A;  3RMX A;  3UES A;  4BQW A;  3O1T A;  4RS5 C;  2OPW A;  1VRH 2;  1EV1 3;  1O4T A;  2VGD A;  1G7Y A;  2HBT A;  5F8P A;  4N7U A;  5FY0 A;  3AZZ A;  3JB8 A;  1JZ7 A;  4AVA A;  4B7E A;  2JD9 A;  2IXI A;  2XVK A;  3I2I A;  3M2M A;  3C7F A;  4BYY A;  1ND2 C;  1AX0 A;  1GOG A;  3A7Q A;  5FOJ B;  2B9V A;  2VBP A;  3B94 A;  5CKQ A;  1C4R A;  2YU2 A;  4G4F A;  5FYY A;  1DFQ A;  5EWS A;  3IPV B;  3WQ1 A;  4XC9 A;  3AFK A;  3HIF A;  4ET7 A;  4XXA A;  3VZM A;  1YJL A;  3WNL A;  4QKF A;  3U14 A;  4BLI A;  3POF A;  4IES A;  2QQL A;  4XDQ A;  5FKB A;  3PUR A;  5GZC A;  1AR7 1;  4W8J A;  5FZ3 A;  4CDU A;  3SKJ E;  1OMI A;  1YCI A;  2AUY A;  2PA7 A;  4LKF A;  2DVF A;  1VAK A;  3LSE A;  4YRD A;  5F3I A;  3T30 A;  4LO6 B;  1OUX A;  4XUN A;  4OUE A;  1TME 1;  2VR4 A;  4LO4 B;  1OVP A;  2WNE A;  3MO4 A;  3M3I A;  5JXI A;  2ZX3 A;  1W0O A;  2DCY A;  4NWW A;  1W8U A;  4CVU A;  2UWA A;  5FZI A;  5C8C C;  2MNG A;  4YVS A;  1UF2 C;  4QU1 A;  5IVY A;  4IUG A;  3K75 B;  1UY4 A;  1OVS A;  1AL2 3;  1NE6 A;  1UU6 A;  2W91 A;  3KGZ A;  1HB2 A;  2FDF A;  1UPS A;  3JZV A;  4W4Z A;  3T4V A;  4OQ9 A;  1V9U 3;  1M4W A;  3VKF C;  1VBE 3;  4Q4V 3;  4IEO A;  2VOX A;  1AYM 2;  3OTF A;  1PVC 3;  4BQX A;  2A6W A;  5F3E A;  1BKZ A;  3PU3 A;  1HRI 2;  1W2T A;  2SBA A;  4XJZ A;  1B35 A;  1D4V B;  1ODN A;  2RS3 3;  2XKO A;  4WM7 B;  5GKA C;  4AFA A;  1LGC A;  4NOT A;  4L99 A;  2A71 A;  1VBC 1;  4AFD A;  5FK7 A;  2E7Q A;  1FV2 A;  4G3Y C;  2YPD A;  4L92 A;  4LIT A;  1JOD A;  1RC6 A;  5FXW A;  4A7K A;  5FDB A;  4XF4 A;  4UT5 A;  3OBT A;  4AI1 A;  3ZSJ A;  1TZO A;  4H14 A;  4IEV A;  1DCS A;  1YEW A;  3GNE A;  4UI9 L;  5FZ7 A;  1GQP A;  5C9A C;  2QFE A;  1BMV 2;  1VJ2 A;  2HYK A;  4AW7 A;  3B5L B;  1YC6 1;  4LO8 A;  3BYW A;  3HT2 A;  3KZ4 C;  4IEQ A;  4UFK A;  1VBD 3;  2XWB B;  3GCX A;  3RZH A;  2ZOE B;  1YO8 A;  1RVF 2;  2WIN B;  1EYB A;  3GXU A;  3VHN A;  2Q5T A;  2ZAC A;  1V6N A;  1JYI A;  1IKQ A;  1QJU 3;  4JQR A;  4R9D A;  3WG4 A;  3C7H A;  4CP1 A;  2E53 A;  2SLI A;  2QQN A;  3ZLI A;  5A7O A;  3EB7 A;  3U75 A;  4QD2 A;  2RR1 1;  2CNA A;  4K6B A;  1RUF 3;  2ES3 A;  1HB4 A;  4BA6 A;  4YVW B;  3FZ3 A;  3ZFF C;  1TMF 1;  3DL3 A;  5KC6 A;  4GWJ A;  1IPS A;  4YZ3 A;  5GZE A;  1REF A;  2PHF A;  1R09 2;  2DCJ A;  3Q9O A;  4A3X A;  1EAH 3;  5DUV A;  1W6P A;  1MQT C;  1VB4 A;  4XXP A;  5LY2 A;  4PIX A;  2OKX A;  3WEZ A;  1PO1 2;  1W9T A;  4YGC A;  5A7W A;  2FMD A;  4OHY A;  4LLO A;  1DU3 D;  1KEX A;  4QPI A;  4D6Q A;  5JOX A;  3UGF A;  4XE9 A;  4CCO A;  2JXA A;  2VCC A;  1KD7 A;  3H3L A;  3WQ7 A;  1WW7 A;  4Y5T A;  1QXP A;  2ZAB A;  4W6X A;  4ZXE A;  5FCC A;  1RUG 1;  4J1W A;  3KQR A;  4S2D A;  3SCG A;  2GMM A;  5GAL A;  2YUE A;  4Y20 A;  4P00 B;  4CDQ C;  1W8W A;  1K5M A;  4Q29 A;  4AXO A;  1QOS A;  3VHO A;  1JI6 A;  3ZXA C;  2BW8 A;  1HRV 2;  4XQW A;  1QOT A;  2V5Y A;  4DUX A;  4IV1 B;  1ZYB A;  3BTX A;  1K12 A;  4NAM A;  4FI9 A;  5IW0 A;  4I3G A;  1RUJ 3;  2G4I A;  1ZBA 3;  3M3C A;  1WGP A;  2XJU A;  2XML A;  2IFW A;  2R04 1;  5LAS A;  3SQO A;  3HEI A;  4RR3 A;  2IC1 A;  3WOG A;  5JOZ A;  5EJ3 A;  5T5J A;  1CX4 A;  2G19 A;  1Q8Q A;  1Z7S 2;  3BU0 A;  5D8A A;  4OZX A;  1MEC 1;  4KWL A;  3NNL A;  4JC1 A;  5HCF A;  2PXJ A;  3BOW A;  4FTE A;  5BY5 A;  1R08 3;  1XSR A;  4GMP 3;  4CA9 A;  4Q0P A;  3W59 A;  2ARB A;  5DDJ 3;  1RL3 A;  3LIH A;  3WF2 A;  5CFC A;  1DZQ A;  1SFP A;  3VBR B;  1MPX A;  2ORX A;  3T0D A;  4QX5 A;  4AL9 A;  1TVG A;  1EV1 2;  1W2O A;  2P2K A;  3ORJ A;  4HOO A;  5C5U A;  1WLD A;  3VBU A;  1W6N A;  4FVV A;  2WFP A;  4R9A A;  2EXK A;  4UW6 A;  3T09 A;  4PBO A;  4ZU7 A;  5K7P A;  2QNK A;  2BNM A;  1D0H A;  2GU9 A;  2RDR A;  5FP7 A;  3AZX A;  4B3N A;  1DYP A;  1WZX A;  4AHX A;  1C5I A;  4TXW A;  3SKV A;  1V6L A;  1N47 A;  1OKQ A;  2W46 A;  3WDX A;  3GDB A;  1J1L A;  3A4U A;  3IDB B;  1F35 A;  1E5I A;  1RHI 1;  1VBA 1;  2QQK A;  2VPV A;  4UF0 B;  5JUV A;  1ZRF A;  3NJY A;  5T52 A;  3I2H A;  4BQ3 A;  3H8X A;  1ZRC A;  3POJ A;  2BGP A;  4K3U A;  1V6O A;  2VUA A;  3JD7 2;  1GNH A;  2WNU A;  5FMD A;  3PUA A;  5EPA A;  3UYJ A;  4MGZ E;  5J48 A;  2FCV A;  3ILN A;  4Y1X A;  1X8E A;  5CIR A;  3O0W A;  4ORF A;  4GB3 3;  2UYA A;  4GH4 B;  2OUH A;  4MGQ A;  3NST A;  5GLV A;  1JZ8 A;  5FZE A;  4EV0 A;  3TNQ A;  3VL8 A;  4XEZ A;  4CDW A;  1U5Z A;  2GP3 A;  1TNF A;  3BAL A;  3C2U A;  2VOT A;  1LED A;  1GZT A;  1QJF A;  4OI4 A;  4NN0 A;  3WF3 A;  5HXV A;  4FFH A;  1OPM A;  1POV 0;  2WJS A;  1AL2 2;  5T54 A;  1AR8 3;  4Z2W A;  2JG8 C;  2DBI A;  4LOT A;  3B01 A;  4D6R A;  1HLC A;  2ZBJ A;  1PMJ X;  1V9U 2;  3N3H A;  1ULF A;  2VJX A;  2PHW A;  4IND A;  4JHZ A;  2PHL A;  4Q4V 2;  4Y5Z 0;  4ZZ8 A;  1MVQ A;  5ANN A;  4AI9 A;  4AK3 A;  3DYP A;  5F32 A;  3SIS A;  3TN9 3;  2FBE A;  3GAL A;  4ASM B;  5TSW A;  4CU6 A;  3H8R A;  5JDB A;  4LK7 A;  1AJK A;  2IVJ A;  1UYX A;  5FZ1 A;  5A3W A;  2JG9 A;  4E4S A;  3T0A A;  4AI0 A;  4AVC A;  4M0N A;  3OB8 A;  4AI2 A;  1GSL A;  2X09 A;  2V72 A;  1OSG A;  1JBC A;  5HCA A;  3O1U A;  1EUU A;  3LSD A;  4YW5 A;  5JIA A;  1A78 A;  3KM5 A;  1RYY A;  4FFG A;  4BIO A;  3OCP A;  1UNB A;  2XBO 3;  4WVZ A;  3OGG A;  4GMP 0;  1J3Q A;  1ODM A;  2WDB A;  1VBD 2;  4IE5 A;  2KA3 A;  4AQ2 A;  4D69 A;  4HSJ A;  2O8O A;  4CDU B;  4MGT A;  1XU2 A;  3BPZ A;  4LA2 A;  1QJU 2;  3RJ2 X;  3U0Z A;  3DXU A;  3LDB A;  4LBO A;  3ZVX A;  3HN3 A;  1WLW A;  4YW7 A;  2XR4 A;  2IXK A;  5DAB A;  2AH2 A;  4B4Q A;  3WW4 A;  1PGL 1;  3IZO A;  1E57 A;  4TSV A;  2R07 3;  4WM7 C;  4Q4X 3;  1RUF 2;  4YAR A;  4YVS B;  1W3V A;  3LAG A;  5BYN A;  3J8F 3;  1EPZ A;  4XJW A;  1A8M A;  1OF3 A;  5FYZ A;  3N4M A;  4DXR A;  1E5R A;  2EIC A;  1DQ6 A;  1L7Q A;  2K9Z A;  4B7K A;  1GKB A;  1LEC A;  2ZZQ A;  5DZG A;  4AYU A;  5CKM A;  1U5X A;  1GQG A;  1O7F A;  1J84 A;  4BPZ A;  1B35 B;  5AVA A;  1UOF A;  4XAC A;  2Y6K A;  1D7P M;  1SFY A;  5BXX A;  3ZOI A;  2B45 X;  4L97 A;  3WQB A;  1PZ8 A;  4QPW A;  4YGD A;  5FR3 A;  1S1A A;  1S0F A;  2QQP A;  1OLM A;  1VRB A;  2JB8 A;  4J1X A;  1LEN A;  1S4C A;  5HCH A;  1VBB 3;  4GWI A;  1AXZ A;  1QXR A;  4XF9 A;  4YM0 A;  2XL7 A;  1JHN A;  4OQ8 A;  1N1S A;  5FPB A;  3ZXK A;  4I2O A;  3WG3 A;  2VQ0 A;  2ZEY A;  1UO9 A;  4G9S B;  3ZR5 A;  4EN6 B;  1NOV A;  2O1Q A;  4XAE A;  3RYK A;  1WLC A;  3O0X A;  1DGW X;  1Y43 B;  3AKQ A;  4MZU A;  4NVP A;  4IE7 A;  1NY7 2;  1LNS A;  3TNP B;  1UIJ A;  1RUJ 2;  4IV3 B;  1ZBA 2;  3MFA A;  5A6X A;  5D21 A;  2ZHL A;  2O14 A;  1OA2 A;  4QX2 A;  4HG6 B;  3GBW A;  3OD4 A;  1HB1 A;  2RVA A;  3KF5 A;  2CSG A;  3R4D B;  2EAL A;  1A8D A;  1S2E A;  3CEW A;  1DBN A;  4AED C;  1QJY 2;  4B29 A;  1PGW 2;  1C8N A;  4FTB A;  1H6X A;  2BTV C;  3U4X A;  2AEY A;  4Y3O A;  1O5L A;  2ZJC A;  1IS3 A;  1W6P B;  3TEY A;  4XFA A;  3WUC A;  4EN8 B;  4OUM A;  1PO2 3;  4YM3 A;  5BNO C;  1Z78 A;  2WO1 A;  3QAC A;  5FO7 B;  4FSJ A;  3IIA A;  1FOD 3;  1XYO A;  2EID A;  1CZT A;  2BGC A;  2H6C A;  2DU1 A;  3LQC A;  5GLU A;  3ZIW A;  2ZHM A;  3WDW A;  1DLC A;  5I8S A;  1PM7 A;  5B4X A;  4GD4 A;  1QQP 3;  5C3S A;  2VMI A;  1GR3 A;  2Y8K A;  2YHJ A;  4KGG A;  3KLS A;  4KWJ A;  3U11 A;  3W9A A;  4BU2 A;  4IEW A;  1PZ7 A;  5BV6 A;  1W39 A;  1CJP A;  4OFG A;  4Y20 B;  3WF0 A;  1U5Y A;  1K5M B;  3NV1 A;  3MV1 1;  3ZN6 A;  3CMG A;  4H3W A;  2J1E A;  3H42 B;  4UBG A;  1LKN A;  5FZF A;  4HPK A;  5C71 A;  1AHS A;  3CKH A;  3OPW A;  5I0R A;  2HWE 3;  3C7G A;  2HEV F;  2VZT A;  1SPP A;  5A7P A;  1GIC A;  1T6G C;  1RIN A;  2D6P A;  3UT0 A;  1UZY A;  4YWA A;  5JI9 A;  1H8T C;  1W6Q A;  2D5F A;  3N36 A;  4FQ4 A;  3UL2 A;  1GZW B;  4RR3 B;  3C7O A;  2ZAH A;  5LEJ A;  1ONA A;  2AR6 A;  1VAL A;  4MGK E;  1R1A 1;  3KCX A;  5FUI A;  5CG9 A;  3USU B;  5HPO A;  1RUD 2;  3C7E A;  3LFM A;  2MHF A;  5CFD A;  3GJB A;  1QJZ A;  1W0P A;  3HQX A;  1CES A;  1S2K A;  2DVG A;  1K42 A;  5IJR A;  4QX8 A;  5T55 A;  4D7S A;  3DGT A;  1W6N B;  3HR9 A;  3VBU B;  4GJY A;  2W94 A;  2WZ8 A;  3AP9 A;  4L2N A;  2VNG A;  4AFC A;  2RM2 3;  4EJR A;  5LCW L;  5ACA 1;  3BUC A;  1L7L A;  1RUI 3;  2VL4 A;  4GH4 C;  4CYD A;  2XHN A;  4XCA A;  1UX7 A;  2IUW A;  3VDC A;  2GAL A;  2VTX A;  4MGS A;  1ASJ 3;  5IK8 A;  4XZP A;  3H7Y A;  1DQ2 A;  3AKS A;  4AEJ A;  4C8D A;  2ZGQ A;  4N8M A;  1AUY A;  2WFF 1;  5FYT A;  2WNU B;  5E1R A;  1HJG A;  1OD3 A;  4Y22 A;  5ISL A;  4XIL A;  1W03 A;  1W8N A;  3UGG A;  2V73 A;  4EWD A;  4Z92 B;  4CU9 A;  5A7Q A;  3N9L A;  3IDE A;  1Y9G A;  2OYZ A;  3ZFE C;  3WF4 A;  4HVQ A;  5G05 L;  2X5I C;  5CB7 A;  3O1O A;  2OS2 A;  4CEY C;  2CV6 A;  1BEV 3;  4IGP A;  4NRM A;  1IS4 A;  2CAU A;  2YFU A;  5JZG B;  4CXY A;  1JYT A;  1I3H A;  2ZTN A;  4Y26 A;  2YPJ A;  1FT9 A;  5FQ0 B;  3WY6 A;  1YXW A;  3HT1 A;  4PLO A;  1H1M A;  2V4A A;  3I7D A;  4BQ4 A;  5FPL A;  3BIW E;  4FFF A;  4PCR A;  1UXZ A;  3IWZ A;  4YZ1 A;  4UW5 A;  1GBG A;  2K2S A;  4QAW A;  1UY2 A;  4Q4Y 1;  4BQ1 A;  2VUL A;  3RG0 A;  2VOK A;  1Q5O A;  3HJR A;  2A75 A;  2R06 1;  1PIV 3;  3J4U H;  3KD4 A;  4KU7 A;  5JLV A;  4CPB D;  2P34 A;  1X50 A;  3NAP A;  2GC3 A;  3KCY A;  4PLM A;  2NMO A;  3FLP A;  3WNN A;  4Z8B A;  1TEI A;  2A1X A;  3PME A;  4P08 A;  1W8Z A;  1KFU L;  5KHH A;  1DGR A;  3UKN A;  1HXS 2;  1GNY A;  3ZXD A;  5F2S A;  2R0F A;  3HNY M;  4Y1U A;  2J1A A;  3RYR A;  1CJD A;  3M1H A;  2IWG B;  1LHN A;  1RMU 1;  1VBB 2;  4GQ7 A;  2D3S A;  4CU7 A;  4YVS C;  3J7H A;  4NE9 A;  3RJR A;  3AL6 A;  2VME A;  3DYO A;  3WG1 A;  5FPA A;  4ASL A;  1NE4 A;  3HQR A;  1NAE A;  5CA6 A;  1HQL A;  4K1Z A;  4LIU A;  3WCR A;  4CP9 A;  1J83 A;  2F4P A;  5K4L A;  1W2U A;  3AZW A;  5FYM A;  4MAD A;  1LU1 A;  3HVD A;  2R1D A;  1JYW A;  1BCX A;  1RUH 2;  1QNW A;  2FZ2 A;  1HQN A;  4HT1 T;  1I5Z A;  3NV3 A;  2WNO A;  4WBB A;  1B35 C;  1VPH A;  3Q8C A;  2EIG A;  3KVB A;  5LBC A;  1X36 A;  4Y1V A;  3EYP A;  3ZM8 A;  5M0T A;  3WIN E;  1ZNP A;  3V65 A;  1C8M 1;  5D1I A;  4TYS A;  1XND A;  2B4K A;  2F4L A;  2WLQ A;  3DF0 A;  4JGZ A;  3WP5 A;  5AC9 1;  3D8C A;  3P5B A;  2NYY A;  1ZZ6 A;  4FPH A;  3NRU A;  4A6S A;  4AVS A;  2QDN A;  1POQ A;  4XUP A;  2YFZ A;  3HBZ A;  2H6B A;  2IVI B;  4P02 B;  4E4Z A;  1D2Q A;  2AEN A;  3N9M A;  3Q8F A;  4NIH A;  4AF9 A;  1OOP B;  1F4A A;  2NMN A;  1XJA A;  1W3X A;  2YC0 A;  4MV2 A;  5C5T A;  1YIF A;  3KVA A;  3OEA A;  4MXW A;  1VLN A;  3LWC A;  4IV3 C;  1QQP 2;  3AP4 A;  1NZI A;  4XFC A;  4UW4 A;  1BBT 1;  3NNJ A;  1VMF A;  3K51 A;  3VDD A;  1N1V A;  2WYF A;  1Q8V A;  2W87 A;  4AI8 A;  1RIR A;  1GAN A;  1UU5 A;  2ADD A;  2VZP A;  1RUN A;  2RMU 2;  2Z2S B;  5EQU A;  4YG6 A;  2XLG A;  2DF7 A;  1NCR A;  2C5D A;  1J3R A;  4XUQ A;  3I59 B;  4WM8 B;  2UY9 A;  2HWD 1;  1A3K A;  3AP5 A;  1HRI 3;  4DFS A;  2VW2 A;  4XF1 A;  2YU1 A;  4LNV A;  1W6M A;  1COV 2;  4D3W A;  2E26 A;  1FYU A;  1GWK A;  2RS1 3;  5FBJ A;  5LA0 A;  2GC0 A;  2H0V A;  4QGM A;  1FMD 1;  2Y6H A;  2B5H A;  4QPY A;  3NVC A;  2WS9 3;  5IVF A;  4Y33 A;  4AHZ A;  3AYA A;  1OI6 A;  3VKL A;  4QPG B;  1XSQ A;  1K5J A;  3I2K A;  4IE6 A;  2E31 A;  4N43 A;  1CPM A;  2W0X A;  1AJO A;  3D82 A;  4LO5 B;  4RD7 A;  1L7R A;  1Y9Q A;  3PTY A;  4Q0Q A;  1LRH A;  4ZS2 A;  2ZA9 A;  4A3Z A;  1RVF 3;  1QJX 2;  5ABJ C;  2P5B A;  2BNO A;  5KXB A;  4FPG A;  3H8U A;  2ET7 A;  4YFZ A;  1NCQ A;  2VM9 A;  2ZEW A;  3LEK A;  2JEM A;  2DUO A;  3FHI B;  4RN5 A;  5FYC A;  3IB3 A;  1ASJ 2;  2JDM A;  3SH4 A;  5FLH A;  4YZ4 A;  5C4W A;  5DUU A;  3POW A;  4EWE A;  3R6S A;  1V70 A;  1BVP 1;  2GNM A;  5DG1 A;  1Y9M A;  2EIB A;  3E97 A;  3AMQ A;  2PAM A;  3MPP G;  1MS5 A;  2JE8 A;  2BRT A;  3VBO A;  4HK9 A;  1DZT A;  5A1L A;  1E5H A;  3ZN6 B;  1LHV A;  2BOI A;  1XNB A;  2XDV A;  3HOB A;  1ZBE 2;  4IER A;  4DZG A;  1AR7 3;  1XNK A;  4HPK B;  4K20 A;  3RFR A;  4AFM A;  3VD9 A;  3KF3 A;  3IAQ A;  3HQU A;  4Q26 A;  4TLF A;  3S30 A;  4OZO A;  3BB6 A;  2DU0 A;  2PHX A;  2R32 A;  4LBK A;  3MIB A;  4M01 A;  4BIS A;  2O0O A;  3N9Q A;  1RUE 2;  1SLC A;  5A6Q A;  1LGN A;  3ZYF A;  3ZSL A;  2J1T A;  2YC2 A;  1JU3 A;  1O4Y A;  1F5F A;  1FV3 A;  4FOW A;  3URF A;  5EYX A;  4MYE A;  1FXZ A;  3MIE A;  1I5P A;  2OW4 A;  3VZO A;  2J1R A;  2WAO A;  1SLB A;  1W99 A;  2TEP A;  4PF5 A;  5H9Q A;  5CFD B;  2NP0 A;  3GZE A;  1SCS A;  2V09 A;  1HIX A;  2OXB A;  2ZGP A;  3OYW A;  4IGO A;  4JQT A;  4WV8 A;  2VBB A;  4AQS A;  2AYH A;  1HRV 3;  3WV6 A;  4Q8K A;  2ZGU A;  2BV4 A;  3FBY A;  4IEZ A;  2P3I A;  3CQO A;  5FY9 A;  3VBF A;  3NO8 A;  4A7Y A;  3QOP A;  3ATG A;  3SEP A;  1XPW A;  4NID A;  1I9R A;  2DCZ A;  3MW4 A;  1RXG A;  1OLQ A;  4H55 A;  4NPR A;  4OHV A;  2PHD A;  2JE7 A;  4RHV 1;  4YM1 A;  2FD8 A;  2W3J A;  1QEX A;  4NHX A;  4P9J A;  5GLW A;  4R4X A;  5JZG C;  3T1L A;  4LIV A;  2XVL A;  3RZG A;  1LR5 A;  2E32 A;  2D40 A;  5FZH A;  1ZRE A;  2VO5 A;  3T0B A;  4QQO A;  4C90 A;  4Y22 B;  2XPJ A;  1FPN 1;  2VZV A;  2XL9 A;  3AKR A;  4LHK A;  2QVS B;  1YWK A;  3B02 A;  3PJY A;  5J98 B;  3V64 A;  1REE A;  3I97 A;  3AXD A;  1CAU A;  5HV0 A;  4LEJ A;  2FDK A;  2HBU A;  4K8R B;  2CHH A;  3JBG 1;  1XOY A;  2W5F A;  2Q8C A;  1XYP A;  2BQP A;  1DGL A;  4Q4W 1;  5KHK A;  2JDA A;  4BM8 A;  4ES8 A;  4CCE A;  1JUH A;  3VD4 A;  4XMI A;  4GKX A;  3PJQ A;  2HLE A;  5SV8 A;  3OPT A;  4GA9 A;  5BNN A;  2JEN A;  2PN5 A;  4QX1 A;  3WDV A;  3LEG A;  2VBD A;  1JYX A;  1SQ4 A;  3CO2 A;  3NJX A;  3JD7 3;  1D4M 1;  1DGR N;  3MLJ A;  5FZO A;  4EN9 B;  4BHP A;  2JB4 A;  4A6O A;  1RJ8 A;  3E5Q A;  2VZU A;  1Y7B A;  2BER A;  1IPJ A;  5JCT A;  1FAT A;  3FN9 A;  1Q56 A;  3KT1 A;  1Z0H A;  3NAP B;  1LHU A;  2PFW A;  4IGQ A;  2WWS A;  2WO3 A;  4R8H A;  4N9I A;  5IVJ A;  5K0U C;  2WO7 A;  4JTN A;  1WCQ A;  4XAA A;  3LEM A;  4P9W A;  1OFS A;  1IS5 A;  1SCR A;  3JQX A;  4XJU A;  2RS5 1;  1LB2 A;  4OYU A;  2PAE A;  1G86 A;  1YLL A;  3KS7 A;  2PLV 1;  4WVW A;  3DPR A;  1OLM E;  3VD5 A;  4UXA A;  3NMB A;  1RUG 3;  2LRP A;  3BU7 A;  3LDR A;  5FP3 A;  1RUC 1;  2E7T A;  2C9A A;  3JXS A;  1IHM A;  4ZS3 A;  1JYC A;  1RGS A;  2A3Y A;  2ARX A;  3ME2 A;  3THD A;  3VKM A;  4BZ4 A;  4CP9 B;  5GZG A;  5T5L A;  2MEV 2;  2JDU A;  2B46 X;  2QKD A;  1P8J A;  1ULO A;  2MPF A;  4YLZ A;  3EMR A;  3H8O A;  2CY6 A;  2DUP A;  3PVN A;  4BQY A;  1UMI A;  2RS1 2;  1UWW A;  5I0U A;  4LTA A;  5FBZ A;  5JOW A;  1OOP C;  2WS9 2;  4CUB A;  3ZFG A;  4AGR A;  3AYD A;  3WDU A;  2XQX A;  3VBH C;  2FQP A;  2D7F A;  4ITC A;  4ES9 A;  1LJ7 A;  4CEW A;  1NZC A;  1BZW A;  4JGY C;  3AYC A;  4YG3 A;  4LXL A;  5IVE A;  1AR9 1;  2Z69 A;  3ES1 A;  3K46 A;  4P9L A;  1PK6 A;  1KXG A;  4Y5S A;  4QM8 A;  4F7Z A;  3V0A A;  3ZXF A;  2R0H A;  2DTY A;  1EP0 A;  1GWL A;  2ZX0 A;  2P1B A;  4Z1V A;  1UPI A;  4WM8 C;  4DRR A;  1K3I A;  4KI5 M;  4P14 A;  4KH9 A;  5LA2 A;  4URT A;  1UOJ A;  1H9W A;  4MXW B;  3SC7 X;  3LD8 A;  3SMH A;  4AGV A;  1SFN A;  4HFS A;  2D6N A;  3VDA A;  3K4D A;  2QQM A;  2R49 A;  1G6N A;  3B7M A;  5IVV A;  2WQ8 A;  4GUL A;  2ZMK A;  5GLT A;  5JSP A;  1G9C A;  1QKQ A;  1ENS A;  2KR2 A;  4FT8 A;  4NO4 A;  4BK4 A;  1NQJ A;  3WHT A;  3OF1 A;  3MF6 A;  3PNA A;  5FYS A;  2PHU A;  2NPI A;  2WNV C;  4QPG C;  1NYW A;  4M4P A;  1AR7 2;  1NCR B;  1CAV B;  2BZD A;  2ZGM A;  3RWN A;  4FPF A;  3T4H B;  1ZA4 A;  4QX0 A;  3D0J A;  5L7O C;  1LOE A;  1UW8 A;  2CDO A;  4R4Z A;  1QHD A;  3RI9 A;  5HBA A;  2N7G A;  1J58 A;  4KGQ A;  1ND3 A;  4UYB A;  1W6M B;  3ZDS A;  2BEO A;  1TME 2;  2PAK A;  1Q43 A;  4PDW C;  4AOC A;  3VDB A;  2YZ4 A;  3SHR A;  3UKV A;  4TN7 A;  3LB9 A;  2ZGR A;  4XQ4 A;  2VMD A;  4FPL A;  5AVP A;  5FP9 A;  1QNY A;  2DVB A;  1AXY A;  2UU8 A;  1OA4 A;  4XAB A;  1O91 A;  1ZZ8 A;  5KR7 A;  4HVR A;  2NM1 A;  3LE0 A;  2QQV A;  3H7J A;  2FDI A;  5C3R A;  4LBQ B;  4MHR A;  1YRZ A;  4GWN A;  5DAQ A;  5F5C A;  3WF1 A;  4BJ0 A;  2OA2 A;  2YBK A;  3O12 A;  4ARY A;  1VBC 2;  3APB A;  1IGO A;  3O0V A;  1H8V A;  2WA3 A;  2XWJ B;  4RQP A;  5C4W B;  3K2O A;  3TAY A;  1BXH A;  2VUC A;  3K77 A;  2QQU A;  4ERO A;  3T3Y A;  3DCQ A;  1JH5 A;  2Q0A A;  3POG A;  4LO7 A;  5DG2 A;  3VBO B;  4PQ9 A;  2DVD A;  4NWV A;  2ZEZ A;  4X6Q B;  1ZVF A;  4BXS V;  5CYY A;  4UFL A;  5L36 A;  1QJY 3;  5FZD A;  2W92 A;  1VBE 1;  1OT5 A;  3P3P A;  4NIA A;  2W95 A;  3CL1 A;  1UZW A;  3TRS B;  1GOF A;  1CAW A;  1Q8O A;  3MID A;  5JXJ A;  5L9V A;  1W9Y A;  4B4P A;  5J09 A;  5H9P A;  4O61 A;  2RS3 1;  2CU5 A;  1W8O A;  2BGO A;  1NA1 A;  4GJZ A;  5BNQ A;  5I91 A;  5JXG A;  5JIU A;  2E63 A;  3AJY A;  3CJI B;  4XTP A;  2RR1 2;  3RZK A;  1W05 A;  4FFI A;  1NXM A;  2ZCW A;  5SV5 A;  4GAL A;  4EQV A;  3LPF A;  3VBS A;  4AHY A;  3WXP A;  4B1L A;  1TMF 2;  2PHR A;  3B69 A;  3BOP A;  1UN1 A;  2Y6F A;  4Z82 A;  2CTV A;  1YNA A;  4O7X A;  4JKM A;  1ULP A;  5C70 A;  4U36 A;  1DQ4 A;  1EY2 A;  3OYW B;  4BK5 A;  3ZX7 A;  1BJQ A;  2KD7 A;  1I1E A;  2OQ7 A;  2DV9 A;  1HB3 A;  4NHM A;  4O9E A;  2WSV A;  4XBL A;  1V6J A;  4OMC A;  5F7U A;  1W6O B;  2VH9 A;  1SG3 A;  3ACI A;  5FMO S;  5BNP B;  5KBF A;  5JMO A;  5C3O A;  5A33 A;  3POE A;  4YYO A;  3WR0 A;  4XFH A;  5EXO A;  1MS9 A;  2V4V A;  5C33 A;  1W8F A;  2ZHN A;  4Q0V A;  5C6C A;  3B3Q E;  3K4Z A;  3ZSE A;  5DUX A;  2HEY F;  1RUG 2;  3CBN A;  2ARE A;  4YW6 A;  2W2I A;  3AP6 A;  1OH3 A;  4RGA A;  2Y26 A;  3ST7 A;  4C0B A;  2PMW B;  3BGA A;  1RUD 3;  5E89 A;  3RI8 A;  1YFU A;  5LA1 A;  4JDN A;  1EAH 1;  1H2L A;  4QHO A;  4CCC A;  2JDN A;  1WW6 A;  3LDK A;  4Y1Z A;  2FDG A;  3MYX A;  1CAU B;  5LK7 B;  3D5O A;  1LOD A;  4NRO A;  2WII B;  2ZMN A;  3PDQ A;  4DUW A;  4XIO A;  3KB5 A;  2YGL A;  1YQ2 A;  2W1Q A;  2B8M A;  4DMI A;  2R04 2;  2A6X A;  4LK6 A;  3UJQ A;  3I4I A;  4QB2 A;  4XDO A;  1OC1 A;  4MOA A;  4RGG A;  3RNS A;  1OD5 A;  1POV 1;  4CCN A;  1G9F A;  4Q27 A;  1MEC 2;  2ZEX A;  3LA2 A;  4A45 A;  2IFR A;  4HKL A;  2VCB A;  4LHL A;  3HNM A;  3ZSK A;  4RS5 A;  3U1X A;  1G9A A;  5FY5 A;  3H9A A;  1OH4 A;  4FTS A;  2E51 A;  3AB0 A;  4K1Y A;  1C1L A;  5FZ9 A;  3N9P A;  3MI8 A;  1C57 A;  4CRQ A;  4F3J A;  5T5P A;  1WBL A;  4A2U A;  2X10 A;  3NNM A;  1XXN A;  1ND2 A;  2QUO A;  5FPX A;  5FY4 A;  3RWK X;  1OBN A;  1OHF A;  4JVA A;  2EXI A;  4XJ9 A;  4D7T A;  3WNP A;  3BIE A;  4QQP A;  4CXX A;  5FYB A;  4XFI A;  4L9B A;  1ENR A;  1IZ3 A;  2UYB A;  4XUO A;  2EA7 A;  1RHI 2;  1VBA 2;  3DPR B;  1UY1 A;  3KT7 A;  5FV3 A;  3WNO A;  4IV3 A;  2D6M A;  2LW8 A;  3OPZ A;  1ZZB A;  2WUH A;  1R08 1;  3OBA A;  4GMP 1;  4QB6 A;  4E2S A;  4L0P A;  2YB7 A;  1PGS A;  5DDJ 1;  4RGK A;  3UV9 A;  3AL5 A;  5FZB A;  1H4G A;  1QXJ A;  2NQY A;  4CZS A;  1LOF C;  1UU4 A;  4FP3 A;  4FOY A;  4FCA A;  5JSR A;  1PX3 A;  1YFX A;  1UL9 A;  3RDI A;  3R0R A;  2A6Z A;  1V6M A;  3PVB B;  4JRA A;  4LBN A;  1AR6 1;  3MHZ A;  3Q8A A;  2AGS A;  2CGO A;  1MR5 A;  2QBX A;  5C8C A;  3OD0 A;  1RUO A;  2ET1 A;  1ULG A;  3TEW A;  1HXS 3;  3DXT A;  3WSO A;  1FI2 A;  1CIW A;  2DFC A;  2JKB A;  1O59 A;  3PUS A;  4OLL A;  4XMA A;  3EHK A;  2Y64 A;  4XFB A;  2OPK A;  3ZFG B;  2RHP A;  4FXK B;  5JMC A;  3ZIX A;  2TUN A;  4Q1R A;  2XLA A;  1XQN A;  4LE3 A;  3DEM A;  3O14 A;  4YVW C;  4P9Y A;  5GM0 A;  4RSU A;  4QXH A;  3K3N A;  1BK0 A;  4DY3 A;  2ZGL A;  1UKG A;  1KJL A;  1SZB A;  3V0A B;  4GB3 1;  2DUQ A;  2WLP A;  4ATF A;  5BNO A;  3WDT A;  1AZD A;  3WLU A;  1RUH 3;  3ZMO A;  5FYI A;  3NNF A;  4ISR A;  1OLR A;  3ELN A;  5J37 A;  3TYJ A;  3H3U A;  2C6S A;  3G7D A;  3ZSM A;  5FWJ A;  4Y1Y A;  4FPE A;  5C9A A;  4LE4 A;  4K8F A;  4LLF A;  5FPV A;  2VTX J;  5FY1 A;  1AR8 1;  3DKW A;  3H1M A;  5IK7 A;  2CYF A;  4QQL A;  3ZR6 A;  5CNA A;  1UMZ A;  4QT6 A;  4YGB A;  3TBD A;  2OX0 A;  2F17 A;  4SLI A;  1TE1 B;  3III A;  4PIY A;  3LFI A;  4A4A A;  1JZ6 A;  1AYN 1;  2P17 A;  5F5Q A;  3KV4 A;  2VNR A;  4QKB A;  4HAN A;  3VV1 A;  3I54 A;  3TN9 1;  3HWJ A;  4BB3 A;  4WVV A;  4GXL A;  2D5H A;  4R52 A;  1LU2 A;  1QMJ A;  5K9Y A;  1PGL 2;  1YI9 A;  3QD6 A;  4IV1 C;  5A7W B;  2ID4 A;  1WME A;  2VU9 A;  4DIQ A;  4FP2 A;  1VB2 A;  3THT A;  4QPI B;  5IAV A;  3CF6 E;  4KMQ A;  1CGP A;  4LUL A;  4E27 A;  3RZJ A;  1WCS A;  5EHD A;  5IWF A;  5FMB A;  4CCJ A;  5FPU A;  2XBO 1;  1OQE A;  1S0B A;  2XJV A;  1O5U A;  1MQT A;  1WD3 A;  1ALY A;  5JAX A;  2RMU 3;  4H2A A;  4OHW A;  5KHJ A;  5FZL A;  3QCW A;  4FQZ A;  4IW3 A;  2GAU A;  1F9K A;  4WVM A;  3VBR C;  2QQJ A;  5I0D A;  5GZD A;  3JCI A;  4YW2 A;  3MZH A;  4DNY A;  4LOS A;  2R07 1;  1ENX A;  3ITQ A;  1YQC A;  2I07 B;  4JDO A;  1COV 3;  4Q4X 1;  4UFH A;  1VIW B;  1LAJ A;  1KDM A;  4RQP B;  4ARX A;  3CJI C;  4ASK A;  1HKD A;  4K21 A;  1JU4 A;  5D8A B;  3J8F 1;  2GDF A;  4CDQ A;  2BU9 A;  2HWB 1;  4K40 A;  4TLG A;  5J3U A;  5AFB A;  5CFC B;  1MS3 A;  4E4D X;  1KS4 A;  2YMZ A;  2BVB A;  4PQQ A;  1H2M A;  5LA9 A;  5EP9 A;  1QJX 3;  1VAM A;  1IQA A;  1NA1 B;  3AKT A;  3MLL A;  4MXV A;  3FFZ A;  4OCT A;  4Q2F A;  1VAV A;  2Q4S A;  1LOB A;  3KCC A;  4CCK A;  1GZ9 A;  1QIQ A;  2VY0 A;  1T6B X;  2TBV A;  4GIQ A;  1KIT A;  5DZF A;  5DAX A;  2R30 A;  3WW2 A;  2RJK A;  4BCU A;  3VBS B;  5BNP C;  4V2V A;  2JDZ A;  2DYC A;  4KNC A;  3T2O A;  4AAX A;  1AL0 G;  2VTF A;  3DV8 A;  3PU8 A;  1H30 A;  1UOB A;  3B00 A;  2P37 A;  1F2N A;  4QXB A;  1KQR A;  2V5D A;  5KXC A;  1NG0 A;  2ZGO A;  1ZBE 3;  3PVE A;  2XON A;  1D2S A;  2AEZ A;  3E6B A;  1WW4 A;  2VCA A;  3SNM A;  2C4X A;  5IAT A;  4LUK A;  3N35 A;  4R9C A;  2Y6J A;  3GZA A;  3ILF A;  4TTG A;  2WZR 1;  5DPN A;  4YSF A;  2BBA A;  4PT6 A;  3I2O A;  3IBM A;  2JE9 A;  4CDW B;  1X7N A;  1MS1 A;  2I45 A;  4XBQ A;  1GP6 A;  1RUE 3;  1F4H A;  3KWV A;  4ZXK A;  1VMH A;  4N90 A;  2OZJ A;  1LHW A;  1GWM A;  4HVO A;  5FLI A;  5LRS A;  1ZX5 A;  3N7K A;  4DIN B;  2TNF A;  4XJA A;  2L9L A;  1UYZ A;  5EIY B;  4HKW A;  2Q8D A;  3J7L A;  2IZW A;  3LGR A;  5ERL A;  2XJP A;  1PO2 1;  2RG4 A;  3ZPY A;  1CQ9 A;  4IE0 A;  1FOD 1;  3WNM A;  2RE9 A;  4PI2 A;  3K3O A;  1JN2 P;  4CDU C;  5DAV A;  3LPG A;  4GKY A;  1CAX A;  4AAP A;  2P6H A;  2JG9 B;  2D3R A;  2X05 A;  1JZ4 A;  1YI7 A;  1IS6 A;  1SLL A;  3JB4 C;  2Y6G A;  3MBW A;  4FOQ A;  1N3Q A;  3GF6 A;  3QLQ A;  5FFO C;  3MF9 A;  2JG8 A;  4ZKT B;  1R1A 2;  2W9X A;  5JSO A;  2JDY A;  3PHM A;  5FXV A;  4EZH A;  5F3C A;  5T50 A;  2VE1 A;  2BFU S;  2E33 A;  4RS5 B;  3M3Q A;  1NUK A;  3PUQ A;  4QWN A;  1CN1 A;  3OGV A;  4QXK A;  1Y4W A;  2HWE 1;  1N3P A;  3FL7 A;  2EXH A;  3GYD A;  5LRR A;  2W52 A;  4B1M A;  3HNB M;  2ZZJ A;  2G9F A;  4AQ6 A;  4PHZ A;  5T3N A;  4F8A A;  5ACA 2;  2UUR A;  3EJK A;  2QZ3 A;  4UAP A;  1S0E A;  3S7E A;  3CHX A;  3D6E A;  2HYX A;  4CCL A;  4EN7 B;  1UAI A;  2WKK A;  4E8D A;  4ZU4 A;  1VE0 A;  1TG7 A;  1URX A;  3AX4 A;  2WFF 2;  3N9N A;  4KL1 A;  4WZC A;  4IL7 A;  1H2K A;  4R9B A;  4Y4Y A;  1H4H A;  3LA3 A;  1RXF A;  5FRA A;  1GMM A;  2W47 A;  5C7G A;  5F37 A;  3FX3 A;  3KV9 A;  1V00 A;  1QDC A;  3ETP A;  5JWP A;  4RFR B;  1W9S A;  3B93 A;  3PUI A;  1H6Y A;  1ENQ A;  3VKN A;  2VNV A;  2AAC A;  3HBK A;  4WM7 A;  1MZ6 A;  2RM2 1;  3M3O A;  2O8Q A;  1RUI 1;  3MPB A;  3BTY A;  2Q1F A;  1GLH A;  2H0B A;  2HWC 1;  3MUY 1;  2OZ6 A;  2W1W A;  5DXD A;  1AVB A;  4PJY A;  3WHU A;  3VZJ A;  2WRA A;  4JZR A;  3Q8E A;  2GMP A;  3KMH A;  2C9K A;  4LA3 A;  4XFF A;  1HX6 A;  5JR7 B;  1UCX A;  1SAC A;  4KQ7 A;  3M4F A;  2DWR A;  4Q4Y 2;  2G9Z A;  5CU1 A;  4QM9 A;  5JXH A;  1OXC A;  3A21 A;  4DXS A;  1GZC A;  2R06 2;  4DPN A;  2EIE A;  4QGL A;  4W6W A;  3GGL A;  4YG0 A;  1MZ5 A;  3WQ0 A;  3NW4 A;  2MEV 3;  4ISQ A;  3RSJ A;  3WW1 A;  1APN A;  1BEV 1;  5A7S A;  4KG8 A;  1XB9 A;  2VQT A;  1OUR A;  2VZS A;  1UX6 A;  1S0C A;  4HN1 A;  4QX3 A;  3W5N A;  3MIH A;  3OEB A;  1CX1 A;  3NQH A;  1WD4 A;  1KJR A;  3RZZ A;  1VR3 A;  3D0S A;  2D98 A;  2JDP A;  4ATE A;  5FZK A;  1W06 A;  1UKR A;  1RMU 2;  1BVV A;  4QPI C;  2YBS A;  4XJ8 A;  1LCL A;  3NL1 A;  4A41 A;  4AEM A;  3VD3 A;  4NPL A;  2WN3 A;  3O1R A;  4LBQ D;  3J26 N;  2EAK A;  3OY8 A;  2IXC A;  3WCS A;  3BPS A;  1HV0 A;  3KSC A;  1SHW B;  2YBP A;  2JIC A;  1PIV 1;  4MG2 A;  2VZR A;  2ZPX A;  4XBN A;  2I2S A;  1RED A;  1K5M C;  4I0B A;  1KS5 A;  4E2Q A;  2JJ6 A;  3ZXJ A;  4PI0 A;  3SEE A;  2VC9 A;  4D8M A;  3JBG 3;  4CP0 A;  1J59 A;  2YGM A;  2P3J A;  1WWY A;  2EAA A;  4W50 A;  3MLK A;  2VOV A;  5DN2 A;  4Z07 A;  1ZRI A;  5GZF A;  3ZKY A;  3RMY A;  5CZK A;  3E1F 1;  1BQP A;  1UY3 A;  2ORZ A;  1CON A;  2XJT A;  4AED A;  1C8M 2;  3GM8 A;  4RR3 C;  2VQU A;  1W9F A;  2Y33 A;  4CCD A;  4M3C A;  4QDR A;  5AC9 2;  5FP8 A;  5D8A C;  2VZ1 A;  1MQT B;  3T2T A;  4BDV B;  1YQ8 A;  1XRU A;  3EO6 A;  5DUW A;  5A3T A;  2PEL A;  2VW0 A;  3KV6 A;  4PBP A;  4AE2 A;  2E7A A;  1OUS A;  1VRH 1;  2W1U A;  5CFC C;  2OT7 A;  4QKN A;  4WVM B;  5EJ1 B;  1SPP B;  2FCT A;  2WZP P;  4XW3 A;  1OA3 A;  1WA4 A;  5IT6 A;  4LKS A;  3AMN A;  5A3O A;  3E5U A;  3LOI A;  1W6Q B;  2A3X A;  2C1F A;  3VBU C;  1NKG A;  4D7Y A;  3NNG A;  1TME 3;  1V6I A;  3MW3 A;  3W5M A;  1NX9 A;  4ZPI A;  4UOJ A;  3GZU C;  1BBT 2;  2PLV 3;  2WAB A;  4GZ9 A;  3FFQ A;  4XF0 A;  3PTR B;  1JTZ X;  4QU2 A;  3MW2 A;  1W8H A;  3AM2 A;  1MS4 A;  2VMH A;  1UY0 A;  3AMH A;  2XB6 C;  2WNU C;  4HSL A;  5L9R A;  5LWB A;  4YZ2 A;  1IG3 A;  1NLQ A;  3M70 A;  2HWD 2;  4TWT A;  1H8T A;  1AX2 A;  3I3D A;  3PLQ A;  1W04 A;  2LS6 A;  3AMP A;  1JOB A;  1WCD J;  2G1M A;  3PUH A;  5FP4 A;  3H0O A;  1HJF A;  1VBC 3;  3P3N A;  2Z79 A;  1JUI A;  1FMD 2;  2BP6 A;  3F95 A;  4UF0 A;  5FZA A;  4CDW C;  4COU A;  3NKG A;  2HWF 1;  1LTE A;  2HH9 A;  5FLJ A;  2D93 A;  2ZGN A;  2ZX2 A;  3IM0 A;  2PQS A;  4NJ4 A;  5FK8 A;  4O65 A;  5FZG A;  5JPM B;  5LK5 A;  4I30 A;  4IEY A;  4Y24 A;  1IOA A;  1WKY A;  4KG0 A;  1JZ3 A;  1AYM 1;  3KT4 A;  4KU8 A;  4FPJ A;  1HW5 A;  2GNT A;  2BUK A;  2WQ4 A;  3DYM A;  4XUR A;  3OSD A;  5EV7 A;  2B9U A;  1JS9 A;  4GH4 A;  1HRI 1;  3OBR A;  4J6G A;  4DXT A;  2JWP A;  3W20 A;  3NJV A;  3BTA A;  3MIG A;  3I2F A;  2CGP A;  5FKC A;  1WCK A;  3TEX A;  2RR1 3;  1BLZ A;  4EYU A;  4C91 A;  3DKQ A;  1TQ5 A;  3THP A;  4HK8 A;  4LT5 A;  2JG9 C;  4LQR A;  1JYN A;  2ZHK A;  1DF0 A;  1TMF 3;  5FWE A;  1W28 A;  3T08 A;  1SBD A;  2B42 B;  1BMV 1;  4OI1 A;  4S2H A;  5FXZ A;  3RVH A;  2W39 A;  4GWM A;  2A5Z A;  3ZFE A;  3PIJ A;  1KFX L;  4CTE A;  1RVF 1;  2X5I A;  4DB5 A;  4YGE A;  4CEY A;  4ZON A;  4W6Y A;  3UET A;  1UIK A;  2D3P A;  2PTM A;  2Y0O A;  2VZ3 A;  1UXX X;  3S5A A;  1YHF A;  1CAX B;  4LOR A;  1EUT A;  2HEW F;  5ANQ A;  2J42 A;  3ZKU A;  4BWO A;  3FHA A;  3USS A;  3V56 A;  3WP4 A;  2NN8 A;  2ARA A;  4IQP A;  2R16 A;  2P4E A;  1W9W A;  2JG8 B;  2VXJ A;  3FJS A;  4IET A;  5A3N A;  1JZ2 A;  1O8P A;  3IDA A;  5F6L B;  1DGW A;  1H2N A;  1JYV A;  3PIG A;  3VD7 A;  1KRI A;  4Q0S A;  4EWA A;  5FZ8 A;  5DMY A;  3I49 A;  1R09 1;  3BCW A;  2ZGK A;  3LCP A;  3M3E A;  1U12 A;  2C0Z A;  5KWR A;  3I3Q A;  1RJ7 A;  5JVV A;  3T2Q A;  1PO1 1;  4LBL A;  3D4K A;  4CUA A;  4NRP A;  1MZF A;  5F6K A;  4YW3 A;  2VW1 A;  2R04 3;  2G9G A;  2Q1Z B;  3AP7 A;  3CLP A;  4RHV 2;  4DQA A;  2A73 B;  2HWF 2;  3O1M A;  5FUP A;  1UMH A;  4I0A A;  1DIW A;  2ADE A;  1MEC 3;  4CDX A;  1SBF A;  4JGZ B;  1STM A;  4L8Q A;  5DQ0 A;  3WD5 A;  1ACC A;  1ZZ7 A;  1FPN 2;  3H3Z A;  3AK0 A;  5FZC A;  4V1P A;  1HRV 1;  3GBF A;  1MZE A;  3H1W A;  3A0N A;  3JBG 2;  5D2A A;  4QGN A;  3R4U A;  1H1I A;  3GBG A;  4Q4W 2;  5C8W A;  2WA4 A;  3ACH A;  1F5J A;  1RIT A;  1DLL A;  3J9S A;  3OOX A;  4I02 A;  4COV A;  5A3U A;  2XJS A;  4P5H A;  2WYS A;  1C28 A;  2BDR A;  4BLJ A;  1QF3 A;  5CVR A;  1RHI 3;  1VBA 3;  1Z7S 1;  2XJR A;  2B39 A;  3VDD B;  4DOU A;  3SH3 A;  2VCM A;  1UZV A;  2R1B A;  3VLB B;  3WT3 A;  5LZ6 A;  2WO2 A;  1D4M 2;  5A1A A;  3CJX A;  1OKO A;  1ST8 A;  5E88 A;  4F83 A;  4JV4 A;  3WUD A;  4NHL A;  2WR9 A;  4JAA A;  4H7L A;  2FDH A;  2A3W A;  3IMM A;  1G8W A;  2WSU A;  1ZA7 A;  5LBB A;  3ZYH A;  1EV1 1;  5FMO L;  5CKN A;  2BNN A;  3L2Y A;  5HV4 A;  2VVE A;  1Q3E A;  2LTN A;  4MH0 E;  2FHR A;  2P3Y A; 
#chains in the Genus database with same CATH homology
 1L7L A;  4BQ3 A;  3UT0 A;  2WYF A;  4YW6 A;  4YWA A;  1OH3 A;  1UOJ A;  2LRO A;  1GWM A;  2JWP A;  4BQ4 A;  4LKF A;  2C24 A;  1W8U A;  4LJH A;  4A6S A;  4YW7 A;  1W90 A;  1W8W A;  2VXJ A;  5D21 A;  2KR2 A;  4AL9 A;  2O14 A;  1OKO A;  4LK7 A;  3ORJ A;  4CP9 A;  3F95 A;  2LRP A;  1HN0 A;  3ZYF A;  4CPB D;  4LKE A;  4LK6 A;  4BQ2 A;  1V0A A;  1GWK A;  3ZYH A;  2Q1F A;  3ZYB A;  1WZX A;  1WCU A;  1WMX A;  4BQ5 A;  4CP9 B;  2K46 A;  1W8T A;  4LKD A;  1GWL A;  1W8Z A;  1W9F A;  4CPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...