4LKDA

Crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-qrs at 2.31 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title Structure-Based Optimization of the Terminal Tripeptide in Glycopeptide Dendrimer Inhibitors of Pseudomonas aeruginosa Biofilms Targeting LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein/inhibitor
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lkdA00
2O14A 2LRPA 1W8ZA 1UOJA 1V0AA 1HN0A 4YW7A 3UT0A 4AL9A 2JWPA 2LROA 1GWKA 1WCUA 4LJHA 2WYFA 4BQ2A 3ZYFA 4LKDA 1OH3A 1W90A 4LK6A 4CP9B 5D21A 1L7LA 4LKFA 1GWMA 1W8WA 1GWLA 4CPBD 4BQ4A 3F95A 2C24A 1WZXA 4LK7A 1OKOA 3ZYBA 2Q1FA 4YWAA 1WMXA 4BQ5A 4YW6A 4CPBA 2KR2A 2K46A 4A6SA 4CP9A 4LKEA 1W8TA 3ORJA 3ZYHA 4BQ3A 1W9FA 2VXJA 1W8UA
chains in the Genus database with same CATH superfamily
3FBMA 1IPKA 4ITCA 4MHRA 4M01A 1T2XA 5D8AB 3K4DA 3TRSB 5CA6A 1JOJA 1GNZA 4M0HA 3AMMA 1FV3A 3TOJA 2RMU1 2YV8A 4K3UA 1BBT2 2R16A 4XEZA 4JKLA 3UGHA 5FY1A 4WM7B 4NIGA 1GP5A 4BQWA 3JD72 2BFUS 4QDQA 1ULDA 2VOVA 3KVAA 3F95A 3OUHA 4XHBA 4XBNA 4C1WA 2QQPA 3VKNA 4LK7A 1TME3 4CDWA 2VOWA 1QIQA 5I8YA 4FFFA 5A7OA 5C70A 2F6BA 1MACA 4LKEA 2WT0A 2C26A 1ENRA 1UZWA 2ET1A 3LOIA 3VBOC 1SBEA 4KH9A 4B8EA 3WY6A 4AFMA 1PX3A 1DYOA 4QPYA 4RHV3 2YPJA 4CDXA 1JZ8A 2CGNA 3I2GA 4XYXA 2E31A 2W0XA 5JR7B 5D1IA 1NCQC 2W2IA 3PJQA 2D6LX 4Q1PA 3VD7A 2V4VA 3NKGA 3VHOA 4PHZA 4BDVB 4EN7B 2JKBA 5FREA 3RS6A 4D7SA 5A3PA 5GZGA 3O1UA 1SFYA 3APBA 2WR9A 5EXOA 4Z8BA 2ZPXA 4E8DA 3I2IA 2PHWA 1YFXA 4GULA 2A6XA 4I0BA 5T3NA 1JZ2A 3PUSA 5F2WA 4ISRA 4EQVA 5A7SA 1FOD1 3BTXA 3Q8FA 2UU8A 5IVFA 1NAEA 2ZGTA 1W3XA 4Q0UA 2ZGUA 4S2HA 3HT1A 1WUVA 1NA1B 3HBZA 4W8JA 5JXJA 2D43A 4LO4B 3ZKUA 1ULOA 1RJ8A 4XIOA 1FI2A 2HWB3 4W4ZA 3AMNA 3AVSA 3JXSA 4HXCA 1KFXL 3ALQA 4Q4X1 3D6EA 4COZA 1S55A 5FYIA 1CESA 4QXCA 4AVCA 1GQGA 2W9XA 2WN2A 1O4YA 2ZX4A 3ZYIB 1OLME 3T09A 3GHNA 1UPIA 5A7WA 3WCSA 4JRAA 1MS1A 2OQ7A 3ACGA 4YZ4A 1DGWA 2P3YA 3VD3A 3PVEA 1QKQA 5T50A 5C9AB 1QOTA 4XJUA 2BOIA 2VZ1A 4ARYA 5EIYB 4HKOA 4XC9A 4NROA 3AXEA 4OI1A 4Y4YA 5K7PA 2HYXA 1DQ1A 1EAH2 1R64A 2BWCA 3D8CA 2WFF1 2WA4A 5IHRA 4XDPA 3INAA 1NG0A 3T2OA 4D7YA 2XQXA 3R4SA 2BBVA 3H7JA 1Q3EA 2I45A 1POV1 1DQ4A 4XACA 1W3VA 4QPIC 3IKWA 1UNBA 2JDYA 3DCQA 1VALA 1V6IA 3G7DA 4ORFA 5DPNA 5FIXA 2O1QA 1JYXA 1N1SA 3LF7A 3N9MA 4CU9A 3C7OA 3RVHA 1G9DA 5FWJA 1W8HA 2I07B 2WRAA 4QU1A 2HWB2 3SXWA 1ULFA 4DRVA 2XXZA 4BLJA 1XU1A 4ZU7A 1U5ZA 2VUJA 3MIFA 4ZZ8A 2B8MA 1AL21 3JBG1 1VBC3 4GIQA 2CY6A 3ZFGB 3AXDA 4XETA 2JD4A 1Z78A 2BBAA 4YW1A 1MVEA 5J96B 1FNZA 5BNOC 4P02B 5JPMB 5GLVA 1MQTA 1UXZA 3AL6A 3CJXA 3EMRA 5FO8B 2JG8C 3I3DA 2VQUA 3EO6A 1F5JA 4Z2AA 3GHMA 1YQ2A 3D3AA 4HSJA 4R9BA 4L97A 2DTYA 3TYJA 1IHMA 1AYN2 3W58A 4H14A 3EQEA 4N7IA 4NE9A 4U36A 4EYUA 4P00B 3ZFEA 1OQDA 4HSLA 3WCRA 4FQZA 5FBZA 1R093 3IWZA 3THTA 3AL5A 5K0UB 1DGRA 1LTEA 2VUCA 4P5YA 4QHZA 2RM23 2XBO1 4XUQA 5G04L 1OT5A 3AFGA 5KHKA 3I2JA 2VOKA 5FQ0A 2WZPP 1V9U3 4MGTA 1EV13 2ZXQA 3LPGA 4LUKA 5C5UA 2FQPA 4QX2A 2YMZA 2FD8A 1A34A 4XW3A 3ACLA 4DY3A 4P9YA 2YFUA 2XH6A 2IVJA 2ZEWA 3ZFEB 4F8AA 4YZ1A 3QD6A 4LHKA 2ZMNA 3MLKA 1D2QA 1OURA 1QMJA 3TEXA 5FYTA 2XL9A 3SH3A 2DCZA 3SH4A 3TNQA 3VGIA 1VBC2 5FZ3A 1LENA 2J1SA 4W6XA 3WZ1A 1G9FA 1PVC1 4I3PA 2FDFA 5IAXA 2GMPA 4EN9B 5IVEA 5J3UA 2PHRA 4JGZB 3RJRA 3WNNA 1XB9A 5LATA 2W08A 5EQUA 4AQSA 2RG4A 2YB7A 3PLQA 1ZZ8A 3W20A 3I54A 2VJXA 1JBCA 3WSOA 2WNUB 4JGYC 1AR73 2HWC1 2HWF1 3HT2A 4CE8A 4BMEA 3FN9A 5CNAA 3NV4A 3MYXA 3ORJA 4UFHA 1GZWA 4IW3A 1ND2B 4P9XA 4YVSA 3WD5A 1WLCA 1W6PB 5EHDA 3WOGA 4BIOA 4HL0A 1IKPA 5GALA 2RM22 2VE1A 4GQ7A 4N43C 4CCJA 4MYEA 4RQPB 1QXPA 1V9U2 4XFBA 1EV12 1V6JA 3QBQA 5AVPA 4A7ZA 1RMU1 1LHNA 2Y8KA 1H6XA 2ZGLA 3CO2A 3ZN5A 1ZZ7A 2A6ZA 3J9SA 3ZXGA 3M4FA 3OBAA 2QE3A 3O0WA 3FLTA 2LS6A 4XUNA 3AVRA 3MHZA 4QX5A 3OYWB 3TN92 3C3VA 2BEOA 3T2TA 1JHNA 1WZXA 2P3IA 2PHXA 2XVLA 1D4M2 2PA7A 1KJLA 2DU1A 1UX7A 5FY9A 4FPLA 2P1BA 3ILRA 2JDUA 4J1XA 4BH9A 3N7JA 2VCAA 2IFRA 2KD7A 1RUJ1 2Q1MA 1UMZA 4XIKA 4Y22B 4BZ4A 3DXUA 4S2FA 5T54A 2R061 3O1OA 1UN1A 2X10A 5D8AC 1ENQA 1O3QA 1RUF3 5DZEA 3VBSB 4LHSA 2GALA 2EAKA 1TZOA 3WDUA 1SMVA 3R4UA 5KR7A 4DXZA 3OF1A 1NOVA 4IE4A 3QOPA 4LMFA 4YVWB 4XF4A 4WM7C 3LOBA 5AC93 1H2LA 3MGUA 1UPSA 1A8MA 2HYKA 4RS5B 3J7MA 3QLQA 2VC9A 2ARBA 3RNSA 3AP5A 4QM8A 5JVVA 3VBHA 1BCXA 4W65A 5DDJ2 5HCFA 2XPJA 2NYYA 1C3HA 5DUWA 1WWYA 1F2NA 3CJIA 4XQWA 5LK5A 4LT5A 4DINB 3MPBA 3ZYGA 4BHPA 2O8OA 1OUXA 2ATFA 2UY8A 5BNQA 5CFCB 1QXJA 1X33A 2R1DA 4TZDA 1UKRA 4Q0PA 3PU8A 1C5HA 3D5OA 4QGNA 1FT9A 1Y7BA 4BM8A 1G9BA 4HMZA 4NOTA 3VBHB 4L9BA 1YC61 2G4IA 5GJ6A 1LESA 1QF3A 3DKQA 1W99A 4D6RA 1S0EA 4OLLA 3H1YA 3KVBA 4RL7A 5JSOA 4JKMA 4IE5A 5E1RA 4NHKA 1GWMA 1GKBA 1RUF2 1R1A1 3J26N 4CCEA 4CDXC 3LSEA 1CAWB 3B02A 3HIFA 5FY8A 4L0PA 3N36A 3S6PA 3ZYJB 2JE9A 4QGLA 2ZHLA 5JR2A 1HRI3 2E7TA 1OA4A 4AHZA 4ZXKA 1NA1C 5AC92 1OXCA 1M4WA 2FBEA 1H0BA 4PJYA 3ZYHA 1NXD1 4OVEA 1YQ6A 2X09A 4KMQA 4QM9A 3OOXA 2ZZJA 3BN6A 4EWEA 3ZSMA 4BK5A 3RMYA 2QTWB 4NRPA 4XHXA 1AUYA 1PHMA 2IXKA 1UO9A 3GDBA 3DL3A 1ZA7A 4XCAA 3BKZA 1O5UA 4AOCA 1GZCA 3ZPYA 1Q56A 3DV8A 5F8PA 1TNFA 3WXPA 4NVPA 4CA9A 2VUDA 5F39A 3HBKA 1UZZA 4EE2A 4LBJA 1W8WA 1WBFA 1ZM1A 4IEPA 3RZMA 1NUKA 5C9AC 4Q4Y3 4TXWA 5L73A 4LO8A 4B7EA 1CIWA 4COYA 3WG3A 4Z82A 1O8SA 3ZPOA 2J1UA 2J1AA 4OHVA 4R52A 4UW6A 3PTYA 1RUE2 3MUY1 3OGRA 4DRRA 1OA3A 5FBJA 4OHWA 3ZFFA 4AEDB 3PUHA 4LBLA 3B5LB 5FZGA 1HRI2 1REFA 1XYOA 1VIWB 5CBLA 1D0HA 2BQPA 2WZ8A 3VD5A 2YU2A 4DUVA 5I0SA 2WNVB 4URAA 3ZN6A 4AI1A 2GC0A 4HFSA 3WP4A 2GMMA 3C7HA 4NHXA 2Y64A 2JDNA 3WF1A 1CIYA 2OX0A 1FYUA 1IQDC 2BYVE 3D0JA 1W6NB 1OF3A 5DQ0A 3ZFGC 1A6CA 1H1MA 1RUI3 4OI0A 1C5IA 5FPLA 3NJZA 1CX4A 2XMLA 4JKKA 4QWNA 3ZN4A 4A7KA 1X9PA 4GH4B 3I3QA 1VE0A 3ZN6B 1VBD3 2O14A 4BISA 3BB6A 1K5MB 1S1AA 4Q4Y2 3WP5A 1SCSA 4A2UA 2A6YA 1UZ0A 3SC7X 2VAUA 4RGAA 2ZACA 2LM3A 5GZDA 1IKQA 1QJU3 2VO5A 4JZRA 4F83A 4HK8A 2AH2A 5K0UC 2D3RA 1W9YA 1ZBE3 2VG9A 4MSVA 1F5FA 3IAQA 1D2SA 3U0ZA 2WNOA 3VDDA 2VNOA 3IDCB 5FO9B 1J58A 2JDHA 2VZ3A 3GYDA 2YHJA 3MLLA 3KF5A 2RS32 4LBNA 3ZFEC 4ES9A 1E5SA 3OPZA 4QT6A 3USUA 2R1BA 5F1RA 5DAVA 2CNAA 2A3XA 3QCWA 1REDA 4ARXA 1MZ5A 4A4AA 4UWDA 1WA4A 1ZZCA 4CXYA 3ES1A 3ECQA 2B45X 2JG9B 1RUI2 3KV5A 2RS51 1Y9QA 1UL9A 2PLV3 5EJ1B 3FJSA 2ZGSA 1HB2A 1RUC3 4BQYA 4CP9B 1E57A 1WGPA 2WN3A 2XJQA 1ND3B 4JGZC 3VV1A 3UL2A 1L7QA 1VBD2 4EV0A 4ZZ5A 2VMDA 5F2SA 5JWPA 2C0ZA 3POWA 3HQUA 1RUNA 1UU5A 1HIXA 3DUIA 3NO8A 5CKMA 1LOFA 2WNUC 1VBE1 5CZKA 5T55A 2TNFA 2Z79A 3ASIA 4JTOA 1PZ9A 4GB33 1QJU2 3FC0A 1ND2C 3K48A 2ZMLA 2YZ4A 1OMIA 1GFF2 1U0AA 1W8UA 1ZBE2 1JOPA 4RQPC 1SBDA 4QB1A 2E6VA 2D93A 3NNGA 4XTPA 1GQPA 3CLPA 3WVJA 3EHKA 3RJ2X 4AVBA 2IFWA 4LLFA 2WYFA 4TLGA 1XNKA 1H8TB 3MV11 4MVTA 2DBIA 2XJRA 4BB3A 3KQRA 1ZVFA 1HV0A 4GKXA 1PGL2 2XLAA 3T4HB 3VD9A 1XSRA 2A5ZA 1KEXA 3VKFC 1ODMA 2DCTA 3Q8CA 4KWJA 5FKCA 3VHRA 4EJRA 3I7DA 1IPSA 1VAVA 1AVBA 1YCIA 2CDOA 2PLV2 3OD0A 2ID4A 4HBNA 1RUC2 4WVZA 5CFDA 1LHUA 4TYSA 2EALA 5ABJB 1NZCA 3NNFA 3VBSC 2JD9A 1UOJA 3T1MA 1W03A 4I3GA 3P5BA 4QDRA 2XUMA 3WNOA 2DUQA 4YVWC 2PFWA 4GB32 3SMHA 1WD3A 3GBWA 1QOOA 4XJZA 1SBFA 1SPPA 3CIHA 1RUG3 4RS5C 1P8JA 1KFUL 1DG6A 1XYPA 1W6MA 3GZUC 4ASKA 4J6GA 4D94A 3VBOA 4XURA 4DZGA 3THCA 2A3YA 4G9SB 1JZ3A 4AG4A 2XQRA 1NCQA 2Y6GA 4NWWA 4M3CA 4E27A 5CFCC 2NQYA 1AX1A 2CHHA 4CU8A 4YM0A 1AR63 1OLRA 1SPPB 1ZZ9A 2VZOA 4FFHA 5HV4A 2LRPA 4EWAA 3NL1A 2DVDA 1V0AA 3VBHC 2DFBA 4PBPA 1C57A 4CP1A 3NJXA 2PN5A 2E53A 5LBCA 4MXWB 3RFRA 5J36A 2G1MA 3LGRA 2DUOA 4X8PA 1UIKA 4XXPA 4UFLA 3A7QA 2NP0A 1XQNA 2OW4A 2B39A 4IEZA 4FOYA 4NHLA 3BU0A 4D3WA 4HVRA 2OUJA 3RZJA 1ZBA1 1H2NA 5FYYA 5F6KA 3KHCA 1GOGA 1O4ZA 2VVFA 2QNKA 3B7MA 3DYPA 1QGLA 3CZUA 1RUG2 3GBGA 3NV2A 3USSA 1H6YA 4AGRA 1UD1A 3OPWA 4PBOA 2W1QA 1X9TA 3AYEA 1UYZA 2H6CA 3OBTA 3I3MA 1KRIA 3VBUA 2EXJA 1OD3A 5F37A 4QX8A 4B7KA 3C2UA 2ZA9A 4ZHNA 1HV1A 3K51A 5DAXA 1UZYA 1AR62 1WMEA 1VRH3 5CKQA 1GICA 3M7AA 1D0GA 1XBFA 1Y9GA 2W46A 3TEYA 3N7KA 1PZ8A 4MLOA 5FY4A 5L9BA 3P3NA 3BTAA 1CJDA 3VBUB 5GZFA 1WA6X 5K8SA 2XUEA 4QPIA 1F4HA 4YFZA 2FDJA 2DU0A 4Q4X3 1TMF3 2YBSA 3WQ7A 1RXGA 1PZ7A 4AEDC 4NO4A 5CVRA 3OBRA 3OY8A 1PGW1 4XFHA 4LBKA 3N4MA 4CXWA 2WNVC 2DTWA 3M70A 3P1IA 4FQ4A 2R071 2DCYA 2WO2A 5CYYA 5JAXA 1V6LA 2D3SA 5A33A 5KXEA 5BUVA 1QJEA 5BNOA 1CAVB 3IPVB 4A3ZA 1K12A 1O59A 3BOWA 4B1MA 1KXGA 2PQSA 2VOXA 5C3QA 3O1MA 4ZY9A 1OKOA 1GUIA 2WFF3 4IEYA 5JMCA 2RJLA 2EXKA 4FPYA 3VBFB 3H42B 2HWE3 3IMNA 4GH4C 4Q0QA 5DUUA 2AACA 5JZGB 3T2QA 1VRH2 5FY5A 1OPOA 1FOD2 3HPNA 1POV3 4XUOA 5D2AA 4PDWB 1PO11 3MW2A 1BLZA 1J3QA 2HKXA 3KV4A 1OHFA 2ET7A 3AP7A 2AUYA 3SKJE 1XE0A 5LB6A 2EXHA 3CEWA 5J37A 4Q4X2 4XF3A 5FV3A 1O8PA 3JBG3 1M06G 1J84A 4B3NA 4BXSV 1OC1A 1H1IA 3UKTA 2EIDA 3JCIA 4MOAA 1N3PA 2W47A 2CU5A 2UWAA 4FP3A 2BNMA 4QHBA 2B9VA 1R1ZA 4JDMA 4XILA 4D6SA 5FOJB 1GQHA 2FDIA 1W8ZA 1DHKB 1VMJA 1PIV1 4LE3A 4JDOA 2JG9C 1C28A 1IGOA 4RSUA 2WFF2 2ADEA 4L11A 4EZHA 4YM3A 4H2AA 4AEJA 2E9QA 2VCMA 4JGYA 2XBO3 3BOPA 1DYKA 2RDQA 2VQ0A 5T5JA 4XAEA 1V6OA 4LIVA 4M4PA 5FTTC 1JZ7A 2VL4A 1LODA 4KL1A 4AGGA 1F4AA 1OFNA 4XBQA 4N43A 3AMHA 4NMIA 4PT6A 1D4VB 3DPRB 4YGDA 2KM2A 4LQRA 4Y5SA 3VZKA 2HH9A 4CEWB 1W9WA 2ETEA 4FTEA 2RE9A 3TB0A 4Z2WA 2XVGA 1CGPA 2YGMA 4BQ3A 3LEGA 2YY1A 2FMDA 4XJWA 1AL22 3JBG2 4UF0B 2Q1ZB 2ZGPA 4JCKA 1BVP1 1U5YA 1Z0HA 4YW7A 3THPA 1PVC3 5FOBB 2W1SA 2Z5WA 3VKLA 3S7IA 3MIEA 1YO8A 1UW8A 3PURA 3ZXEA 5FYCA 1H8TC 4OMCA 5FZOA 4DEVA 2BGOA 3AP6A 4GA9A 4WM8A 5A32B 2VMCA 2G9GA 1LU2A 4I01A 4N9HA 3WF2A 2GN3A 2HWF3 2HWC3 3WNPA 5D8AA 1DFQA 2HJIA 1J3PA 3LFMA 4RN5A 2IZWA 2Q1FA 4HZFA 4YW6A 2YPDA 3J7HA 4QPWA 1ZRRA 2XBO2 1DGWX 1N47A 3BALA 5E89A 2WKKA 4XFGA 4WM8B 5ABJC 2BUKA 2ZX1A 4WM7A 1ULGA 2D6KA 1EP0A 2QDNA 2WS91 2DFCA 1RMU3 3L9JT 2ZGKA 5BY5A 4I2OA 2RJ2A 3A21A 2VZPA 3Q8AA 4ISQA 4Y1XA 4IEOA 2ARAA 3FFZA 1DGRN 3ZYFA 5CFDC 3N7MA 4UOJA 4V1PA 3B93A 4LKSA 4LOTA 1QJY1 4XF1A 3ZO0B 1KDKA 3MW4A 2ZHMA 5ACA1 3N9OA 4YZ5A 1PVC2 5FXXA 2XR4A 3ZKYA 1N3QA 1RUJ3 1YI9A 2GU9A 5F3EA 4ZU5A 2A73B 2R063 1UYPA 3ME2A 4B1LA 4MO3M 2BV4A 4IE7A 5FP4A 1BK0A 2JIGA 3LE0A 4EZ4A 5K9YA 3O1VA 4CUGA 2HWF2 2HWC2 3CU7A 3POBA 4LPLA 1YQ8A 4YZ3A 1GOFA 4K20A 2JDAA 2WT2A 1JW6A 2QCSB 5SV5A 2UURA 3SHRA 4D7TA 4OMDA 2XVKA 1LAJA 1NA1A 1ST8A 4IEWA 1DQ6A 4IEUA 4UFJA 1AR81 1EAH3 1RMU2 2DYCA 1S2EA 2VUAA 4A45A 3ZXJA 3WEZA 4COVA 3LSDA 1A8DA 1IOAA 2W5FA 3HOBA 5EWSA 3RMXA 3NNMA 3WUCA 1N3OA 1FXZA 1W8NA 5E16A 1XE7A 2K2SA 3ILFA 2JX9A 3AJZA 3H0OA 3HAGA 5FXZA 3PUIA 2WBKA 4O9GA 3HWJA 3U4SA 4QU2A 4EN6B 5C9AA 1RUJ2 1YRZA 1N1YA 4R9CA 2R062 3FLPA 3TEWA 3N9QA 3S7EA 4IESA 1R1A3 4AI8A 2DVGA 5JLVA 1NX9A 5FYZA 4MGSA 3W9AA 4YFWA 4D8MA 3VZLA 3AP4A 2C9AA 2N7GA 3CF6E 5FK7A 4AI2A 5FY0A 4XDOA 5GKAC 3VBUC 3GCXA 1APNA 4G4FA 4QB6A 2ZAAA 4P9IA 2VW1A 3LDKA 5F32A 1MZFA 1XC6A 2QQUA 4FO9A 1AYN3 1HQLA 4AFBA 4BWOA 5FUIA 5IK7A 3IM0A 2NZ9A 5C5TA 1OLMA 5J1XA 3LA2A 5HCBA 5IVJA 1LOEA 2A6VA 4GXLA 4TSVA 1YNAA 2DBNA 4NHYA 3ZFGA 3Q8BA 3RRDA 1G9CA 4CCMA 5M0TA 4HVOA 5H9QA 4D0QA 4QKBA 4KWLA 1U12A 4Q2FA 5IJRA 1LHWA 1LGBA 3MF9A 3W5MA 2YFZA 4C8DA 1WKYA 1YUDA 1XU2A 2P17A 3T3YA 3VBFC 5JZGC 3WG4A 1R1A2 3WNKA 1ASJ1 1J59A 1O91A 3ETPA 4K21A 2XKPA 5GM0A 3X29B 1H30A 4QHOA 4PDWC 5K0UA 4LORA 3VHNA 1XYNA 5F5QA 4CSWA 2VTXJ 4CYDA 2RDNA 3NVCA 1UU6A 3DEMA 1W0NA 3AYAA 3PHMA 4I0WB 2PQQA 1MZ6A 1AYM1 2ZEXA 3UKVA 2MPFA 4GWNA 3R6SA 2JDMA 2R30A 2D40A 4LBMA 5APAA 2DUPA 2CV6A 4UBGA 2OKXA 4Y33A 2W92A 4N90A 2PAEA 4RR3B 2ZX2A 2VZTA 4LHLA 2DURA 1OVPA 2BFUL 1KD7A 5ANQA 3POJA 1PGSA 2FCUA 2WABA 4CUBA 4E4SA 5JMOA 1W2AX 5JDBA 4OCTA 4QQHA 5KHHA 5BV6A 4YGCA 1CZTA 5LRRA 1AXKA 4JGZA 2WWSA 3KCCA 3MICA 1RHI1 2ERFA 1MS0A 1QJZA 4YW3A 2BJSA 2JDZA 3TN93 1WW7A 1C4RA 1MEC1 4IXLA 1QQP1 2WNUA 3DGTA 2IUWA 1CAXB 1D4M3 4FPOB 5EZWA 2P2KA 1FNYA 4FPJA 1ZA4A 4OI2A 1ND2A 2ZMKA 2VNRA 1W6PA 4BCUA 4YM2A 3EB7A 5C3OA 1COV1 1QJX1 3EJKA 2Y0IA 4B4PA 4CDQB 4RQPA 1J1LA 2X29A 2Y33A 3DPRC 3J7NA 3KGLA 2Q8CA 4CEWC 3SEPA 5JXGA 3KD4A 1SLAA 1FAYA 4MGIE 1HB1A 5A6YA 1SCRA 1WBLA 2P5BA 3FFQA 2BNNA 4QKFA 5DZFA 5DZGA 1NY71 3W21A 3WF3A 2KXLA 1OOPB 1W0OA 1AXZA 2CWMA 5FPVA 2RS53 3LIHA 2BWAA 3OYWA 4K1YA 1MS5A 3DF0A 1X8EA 1UOGA 1VR3A 5DDJ3 1XSQA 2R041 3ITQA 3PIGA 2XG3A 1FPN1 4KU8A 1ZX5A 4XVHA 4LA3A 3TAYA 3WNMA 3O5SA 4IGPA 4Y22A 3QH7A 5D21A 3ZR6A 1LHOA 4QQ2A 5KC6A 4BQXA 1I5ZA 1VBE3 1E5HA 2WQ4A 4GD4A 4UFKA 1HXS1 3EXUA 1N1VA 4COUA 2QUOA 3VBSA 4FOWA 4TN7A 1UQXA 2XOMA 4YVWA 4C1XA 5TSWA 1IG3A 4WM8C 2I74A 4W6WA 4RA0A 1G86A 1MS4A 4KWUA 4RS5A 1XNTA 2WINB 3VDCA 1BXHA 3MIGA 1RVF1 1HN0A 2RVAA 5FYMA 1PMHX 1YFYA 3UGGA 1IQAA 3RWNA 4HVQA 3TEZA 2ZZQA 5FP7A 3KQ4B 4KBZA 3BPSA 5I8SA 3VN4A 1IPJA 5CFCA 5AFEA 1BYHA 4QAWA 2C9KA 2RS52 2PAKA 2WFPA 4AEKA 3POYA 5FZMA 1W2OA 1DCSA 3T4VA 3OPTA 5LW9A 5FZ6A 2J7MA 3BODA 2P6CA 4ET7A 4B4RA 2CWSA 2W94A 1TME1 4LR4A 4OULA 5DXDA 5F3GA 1VBE2 2W95A 3PVOA 5J98B 3ZXKA 1CAWA 3IIIA 4N53B 1LKNA 2FCVA 1UX6A 2JKXA 2D44A 3AMQA 2VR4A 4LBQA 4RHV1 2D7FA 4HG6B 2JB4A 5C3RA 3JUUA 1SDWA 5KBFA 4RYDA 3POIA 2I2SA 3AYCA 4A3XA 2BVBA 3WNLA 3B9CA 1ENXA 1JHJA 1PVXA 1RUE3 3WHUA 3W59A 3UK9A 1MS8A 2GDFA 3RYKA 1UY2A 1CQ9A 3GJBA 4OI4A 1KS4A 1SLTA 4Q0SA 5DAPA 1UIJA 4LBQB 4ZXEA 4GMP1 2FZ1A 5KHJA 4WZFA 3UGFA 3NAPB 1CONA 1VRBA 4K8RB 3JU9A 4OUEA 2RHPA 4NPRA 1XOYA 3BYWA 4V2VA 4AHXA 3JB8A 3NWKA 1BEV1 1K3IA 4AF9A 3AX4A 3AKTA 4FTBA 1PGL1 3ZXAC 1JUHA 2OT7A 3AZZA 3KT7A 2EAAA 3NJYA 3AP9A 2ARXA 4ATFA 3IDAA 4MADA 4AEDA 2ZGNA 4C0BA 2UWBA 2GMEA 4QX3A 2W1WA 3M8LA 4JQRA 2D6NA 3U78A 4FPEA 4JHTA 2B7YA 4CEYB 4IEVA 4FXKB 4NUBA 1NXMA 3BI3A 2WNVA 3IN9A 4FOQA 1Q8SA 1OH4A 3FX3A 1VMHA 4BIFA 1LCLA 2H0VA 4Y1ZA 4LNVA 5EFUA 1MVQA 5FDBA 4YZ2A 3E6CC 1WCKA 1GANA 4S2GA 1W6OB 4AE2A 1W6NA 2YBPA 4BA6A 5FPAA 3UESA 2PHDA 3IDEA 3KM5A 4XF0A 1D7PM 2OQ6A 5F9TA 5IUQA 2Q8EA 4K6BA 1ULCA 3HR9A 2FCTA 4GH4A 4I09A 2RS33 4X6QB 2AC1A 2DCJA 4Q27A 4CTEA 1K5MA 4LHNA 2Q5TA 1H8VA 2VW0A 4NAOA 2OYZA 4DQAA 5LA0A 4QXHA 4NIDA 2W87A 1I5PA 3D0SA 2BVVA 2R7EB 1PK6A 3HD8B 2BTVC 4X6RB 5T5PA 2VMIA 2P37A 3LDBA 1NQDA 4JDNA 3V0BB 3HEIA 4ZKTB 2K9ZA 5FAXA 1QH7A 2VXJA 3NNLA 1CPMA 3E5XA 4C90A 2R073 5BYNA 1GP4A 2VBDA 4IGOA 5F7UA 1W2NA 1RIRA 2OIIA 4YW4A 1YFWA 2XWJB 4YW2A 1PK6B 1AXYA 2DF7A 4NIAA 3RI8A 2LW8A 4RR3C 4FSJA 4CP2A 3GALA 5IVVA 1VPHA 3CNAA 1VBA1 1YQCA 3V64A 1ZZ6A 3UYJA 4XFFA 1R091 1POV0 2JG9A 3SCGA 3VZJA 3ZVXA 5I0UA 1DIWA 4BMBA 2VM9A 1VAMA 3ES4A 4CP9A 3M2MA 1PO13 5SV8A 1ND3A 1W9FA 2C5DA 3H8UA 5FPZA 4E4DX 3WW3A 4HOOA 4R9AA 1A78A 3UJQA 2QQWA 2TEPA 3VL9A 1H2MA 5IVBA 3LEIA 2QZ3A 4UFIA 3RQ0A 3ELNA 3T0BA 3AKSA 1PGW2 4UW5A 1K5JA 1QHDA 1Y3TA 4PI0A 2OZJA 3A0NA 3LDRA 3R05A 4CDQC 1YYNA 4RFT0 1V6NA 3OGVA 4R9DA 2R072 2XKOA 1JZ4A 3BCWA 5LRSA 2ZABA 3LD8A 2VTXA 4DXSA 2IXLA 2DVAA 1H8TA 4YNIA 2R6QA 1PIV3 1OOPC 3AZYA 1GLHA 4IERA 3W5NA 2K0GA 2Y26A 2R0FA 3ZX7A 1SACA 1AR71 2MHFA 5FMDA 4CCDA 2QZ2A 5FYUA 3UT0A 2VCCA 3VZNA 3J7LA 4IEQA 4GKYA 4PLMA 3GXUA 2RDSA 2EXIA 5JUVA 4WVWA 1OSGA 5E88A 5C71A 1PO12 2V4AA 4J1WA 1EY2A 1LULA 1GMMA 4Q4W1 2WWUA 3KZ4C 2A75A 5FYSA 5ABJA 3WLUA 3RZKA 4IV1B 3AK0A 4ONUA 2XHNA 1AR91 5A3NA 3O0VA 4IEXA 2V73A 3N9NA 4JHZA 3NSTA 1PNGA 4AFCA 2XJVA 2MEV1 3I97A 3I2OA 4KGQA 4W6YA 1LNSA 1RJ7A 1BMV2 3SH5A 1FMD1 4C91A 3I2FA 1LHVA 2VZRA 3ZLIA 2VVDA 5EJ3A 2FDHA 1L3JA 4CRQA 1Q8OA 5A3OA 1CR7A 1RUF1 1UY1A 2OA2A 4O7XA 1PIV2 1W90A 2W68A 1W6QA 5B2GB 3ZDVA 2BGCA 3SITA 1JTZX 3M3IA 4HPKB 1I6XA 3GZAA 3PUQA 3CZJA 2DCKA 2Y38A 1RITA 4MXWA 1S2BA 1PNFA 1JYVA 4YM1A 5DG1A 5FZ9A 5KWRA 3H8RA 1I9RA 3U10A 3HQXA 2X5IB 1HJGA 2GNMA 3AJYA 4NJ4A 1W8TA 1UY0A 1W6QB 5A3MA 5GZEA 3K4ZA 4DO0A 4N53C 1JI6A 2H0BA 5IVYA 2RMU3 3U37A 1DQ5A 3K75B 5ACA3 3JZVA 3SQOA 4Y4RA 5JOWA 4XFAA 2IVIB 3H50A 5E6HA 4H7MA 3C7FA 3RZZA 2OUHA 4UXAA 2JXAA 2QQOA 4YARA 1URXA 4K40A 4WV8A 2XHKA 1BZWA 2JJ6A 3NKTA 2Z4FA 2KA3A 3T0AA 3BPZA 3LKJA 5JIUA 3TWIA 1KQRA 4XJ8A 5JXIA 3NAPC 5J48A 5A1AA 4AFDA 4NPLA 4OUMA 3I59B 1UY4A 5HI0A 2D6MA 1RUD1 5FWEA 2OPKA 2WS92 2A3WA 1Y4WA 1A3KA 2ZJCA 5LEJA 2UYBA 4RD7A 1EPZA 4FBFA 3IDBB 3O14A 5IFPA 3UJOA 2E7QA 3VDDB 1NCRB 1OPMA 1FOD3 5L9VA 4QMAA 2RMU2 5I93A 5EV7A 2E26A 1QJY2 5A7PA 1YJKA 3ZIWA 1JU4A 4XQDA 4CEYC 2VPVA 4KG8A 2VCBA 1SLIA 4D6QA 4FAHA 5ACA2 2F17A 2HEWF 2VY0A 3ZMNA 5LWBA 1AF9A 1LRHA 2VBPA 4Y1YA 1S0GA 3WNXA 1B35B 1G9AA 2XL7A 1CAVA 3IPVA 3I3BA 3KT4A 4I0AA 5JCTA 2JDPA 3N9PA 4CU7A 3VHPA 1US2A 2WAAA 3PTRB 1RUH1 1DP0A 2YGLA 5EYXA 5FMBA 3BU7A 2ORXA 3MZHA 3VBFA 4PQQA 2YU1A 3AM2A 3MLJA 4E4HA 5JZGA 3O1SA 2W39A 4E8CA 2WDBA 1O7FA 4OHYA 3K3OA 1KS5A 2EIGA 4PDWA 4C0HA 1UMHA 1F9KA 3ZYBA 3D82A 2ZBJA 4AR2A 5FZFA 5T5LA 1GYKA 3DN7A 3MEPA 2D6OX 1RGSA 1Q43A 2NM1A 4DPNA 5BXXA 5IWFA 1WLWA 1K5MC 1XXNA 4AQTA 4FXGB 5I8TA 3VKMA 1OF4A 5B4XA 4JV4A 4CUAA 3K3NA 1PK6C 3OSDA 4P9GA 3WF0A 2XJTA 4GZ9A 5CAZA 1IS5A 3WQ0A 4JTNA 4RGKA 5ANNA 1NLSA 3SCFA 1EPWA 1WLTA 4JVAA 1AL23 2JEMA 2LALA 3JQWA 2G9ZA 3I8TA 4MXVA 3ACHA 1NLQA 5DN2A 3RZGA 1UY3A 2QFEA 3GM8A 2Y6LA 5LCWL 2E51A 1H4GA 3WP3A 3J8F1 3IBMA 5T52A 3S57A 2RS11 2ZOEB 3A22A 4YG3A 1RYYA 3O1TA 4OZXA 1AYM3 3CDZB 3PMSA 1OLQA 2BDRA 3MW3A 2LUWA 5FUNA 5KXCA 3OJBA 1UYXA 3OGGA 5C4WA 3UETA 3OGJA 3DPRA 4DFSA 3FZ3A 2AZ5A 4SBVA 4FFGA 4PLOA 4O9EA 4CEWA 4E4ZA 1Q8QA 4AHWA 5FP9A 1OH3A 2VZVA 5IVCA 3C7GA 3Q8EA 2CGOA 3SCHA 1ND3C 1QXRA 1T6GC 4UF0A 4L2NA 4FPCA 2R32A 2WZR1 4Z1VA 4EROA 1Z7S1 1F35A 3UNPA 5LA1A 1DZRA 1AHSA 5FFOC 1QY4A 5FZHA 5LASA 4LO5B 4Q4V1 2VXRA 3H3UA 4AI9A 4BQ1A 5C4WB 4AHYA 2A1XA 5A32A 3MF6A 1C8M1 1RHI3 2XGXA 1T6BX 2QQMA 3EBRA 3O7OA 2ZHNA 1PMIA 4GWIA 5FPBA 3LPFA 5A1LA 3C8XA 1QQP3 2OS2A 4XFIA 1ASJ2 4CCCA 4I30A 1NYWA 4Y24A 4CCOA 2X05A 5BNNB 1WCQA 2OPWA 1COV3 1OQ1A 1QJX3 2CSGA 3PVNA 4LK6A 1JYTA 1JH5A 3PMEA 1OVSA 2QVSB 5FZBA 4IV1C 4HN1A 3SLIA 1YFUA 3OGSA 4NAMA 1AYM2 1TG7A 4RGGA 3VBRA 4Y1UA 2PHTA 3A23A 2D5FA 2QQNA 5I0DA 2PMWB 4LBOA 1H2KA 3OB8A 1LB2A 3PVBB 1VBB1 3MV01 5BPXA 4D69A 3E5QA 3B00A 2Q8DA 4LUMA 1AX2A 2ZHKA 1OD5A 1QEXA 2VZUA 4CPBA 2B5HA 3WDTA 1JN2P 4QPGB 5JIAA 4HK9A 4LITA 2NMNA 2R043 3FHQA 3ZYPA 1FPN3 2IXHA 4IETA 5LBFA 3WW4A 1JZ6A 4H7LA 4QD2A 3VBRB 2QQLA 2VECA 2JWPA 3RI9A 3HMYA 4XJ9A 3U4XA 2VTFA 3R0RA 4R8HA 3CBNA 3E5UA 1V70A 1LR5A 4IQPA 1HXS3 3WF4A 5J09A 1MZEA 1RHI2 4YG6A 1ULEA 4WVMA 3NW4A 1W2UA 4G3YC 1MEC2 1QQP2 4K7JA 1RUG1 2BRTA 5LEKA 3E6DA 3AKPA 3OD4A 4GWJA 4F7ZA 2V09A 4WZCA 4DUWA 1R081 4Y20B 2X5IC 5JXHA 1COV2 1ZYBA 1J83A 1DF0A 1QJX2 1RVF3 1UF2C 2VQAA 4HLTA 4UYBA 3U75A 3GNEA 3H8XA 1GZ9A 1BJQA 3DXTA 4WVMB 2PXJA 4QKNA 2OZ6A 4AZZA 3URFA 2QBXA 1ACCA 3KV6A 3ZXFA 1SLCA 5L7OB 1CAUB 4K1ZA 1AR61 1NY72 3N9LA 1Q8PA 5DUVA 4Q1RA 5FPUA 4Q8LA 1W28A 2NPIA 1EUTA 4N9IA 4A6OA 5AFBA 5J7MA 2J42A 1O4TA 2WZEA 3PUAA 4E2SA 2HWD1 3T0DA 3EYPA 4DXTA 3B94A 4XDQA 2R042 2ZEZA 3MFCA 1FPN2 3RSJA 2YROA 1STMA 2R0HA 2NN8A 1ULPA 3U14A 4KI5M 5C8CA 1JMUB 4V2WA 3ZOIA 1HRV1 5IFTA 1HXS2 5GLWA 4M00A 5G05L 1DZTA 5KXDA 1XPWA 2JENA 4YRDA 2YUEA 2Q8OA 1PO21 1FV2A 2WLQA 3WG2A 5FKBA 1Q8VA 5A6ZA 1WW4A 5CKNA 1BK1A 2D97A 2Q4SA 2WO3A 4XAAA 3WHTA 4AEMA 2CL2A 4CVUA 3KHBA 2RR11 4TWTA 4FAGA 5T5OA 4BU2A 2W91A 4LO6B 3VZOA 4P9JA 4CDWB 4XOGA 5GLUA 5C8CB 2VMEA 4AI0A 1RVF2 4GJZA 2Y6FA 2BERA 2LTNA 4PCRA 2JE8A 4COWA 1SHWB 5CADA 3VDDC 1NCRC 2ZCWA 5IAVA 3WUDA 4E2QA 1QWRA 5B4NA 2A70A 3MIHA 3NV3A 4CXXA 1EUUA 2EF6A 2Q0AA 4FPFA 4K9SA 4CDXB 5IW0A 3BIEA 1JYWA 1VRH1 2BW8A 1TQ5A 2IXCA 1SFNA 3MBWA 4GMP3 1S0DA 5F3CA 4MHUA 4QQPA 1BQPA 3ATGA 2DVFA 1GZTA 1W2TA 1JYNA 3U1XA 1B35C 3T1LA 1CJPA 2VOTA 3OBZA 1TNRA 2JE7A 5LY1A 4QQOA 4FI9A 4LA2A 3WDYA 5DMYA 1BEV3 1TME2 1YIFA 1TMF1 1WCUA 1KDMA 1POQA 1UAIA 3I49A 3KT1A 1TE1B 2HBTA 1OA2A 2ZGQA 3PIJA 4P9LA 3ZSKA 1E5RA 4Y1VA 2O8QA 3DYMA 3KS7A 2VZQA 3SKVA 2QDRA 4CCLA 4DXRA 4DUXA 4RHV2 4ZS3A 4W50A 3GGLA 4UW4A 5FRAA 2Q30A 4CDUA 4AAPA 3S5AA 2CAUA 2P34A 4DIQA 4BE3A 1O5LA 3QACA 1WMXA 4NR1A 5I0TA 1W8FA 2VBBA 2VU9A 1HKDA 3ZR5A 4BXFA 3N3HA 4QX7A 4XUTA 4NPMA 2VGDA 2YDEA 5A7WB 4FOVA 2HWE1 1CN1A 4PIXA 4RR3A 4ATEA 5EJZB 2JIJA 1AL0G 3U11A 1W06A 4CP0A 4CDUB 4AFAA 3MUZ1 3M3CA 1O3SA 2E33A 2PHLA 4SLIA 3WW2A 2VNGA 4AVSA 4Y26A 3NQHA 1UOFA 2VQTA 4XUPA 2UYAA 4XXAA 3T2PA 1K45A 1BEV2 1WLDA 2GNTA 2PHUA 2NLRA 1CAXA 3I2HA 1FATA 3H3LA 4HETA 3LAGA 3RYPA 3POGA 5FP3A 4MGYE 1BHGA 2XDVA 1MR5A 2WO1A 3SISA 4CPBD 3WQBA 4CDQA 1LEDA 3CQOA 3OEAA 4KGGA 4U2AA 1J3RA 1U5IA 4FPGA 3I2DA 2ZTNA 3P6BA 5FZDA 5DAQA 3ZXDA 2DDUA 1VBA3 1UKGA 5E8AA 5LA2A 4XTMA 2GC2A 1OOPA 4P5HA 1YHFA 2J1TA 1MQTB 5H9SA 3AZXA 4QX0A 3IB3A 2WWJA 3AFKA 2A71A 5A1FA 5C4WC 2BPA2 1VB4A 2WQZC 1DDLA 3ZDSA 4META 3POEA 5FZLA 5A3WA 1GSLA 1LOGA 1V00A 2IC1A 3KWVA 4WVVA 5F6LB 3HNBM 2J1EA 3NRUA 4FP2A 4K8FA 1C1LA 5BNPA 1IS4A 5FLJA 2FDGA 4UBHA 1ZRIA 1UXXX 4XFCA 1W05A 5CB7A 2V5DA 1VAKA 5BNNC 3WV6A 4HKWA 1BBT1 3ROUA 4DNYA 4R4XA 5FQ0B 1W04A 2C6SA 1OUSA 4BQ2A 3JD71 1HX6A 1X7NA 1ZNPA 2BP6A 1S2KA 4QX1A 4NIIA 5BNPB 3MIDA 1N1TA 1XE8A 1QJFA 1NZIA 2HLEA 4JC1A 5JOYA 1V6KA 5C6CA 2XJSA 2CAVA 2EVXA 2YXSA 1VMFA 3DKWA 4XABA 1F8VA 1DLCA 4JX0A 5F5CA 1YJLA 4IV3A 3POFA 2ORZA 4QPGC 1VBA2 1ODNA 3AC0A 3HNYM 4Q0VA 1I1EA 1JYIA 2YC0A 3BGAA 1R092 3U07A 3MO4A 4ZPIA 3NJVA 3WDWA 2Y60A 3VBRC 3H8OA 2Y0OA 4PF5A 1BKZA 2P3JA 4KNCA 1YI7A 2WNEA 3H7YA 3ZYRA 4AAXA 4Q4W3 4B29A 5A7QA 4A42A 2QQJA 2ES3A 4F3JA 2Y6KA 2FDKA 2SLIA 1AR93 1HN1A 2DVBA 4IV3B 4YVSB 3MDPA 4UI9L 1DQ0A 1GZWB 3VLBB 2WJSA 3J4UH 3MI8A 2QKDA 1GP6A 3OG2A 4N53A 2MEV3 4YSFA 4XE9A 4IGQA 4MZUA 4XMAA 1FMD3 2ZKLA 3BTZA 2IXIA 4A7YA 2KR2A 3WT3A 2F4LA 4M0NA 4XPVA 5H9RA 5EPAA 4AXOA 1H4HA 2B4KA 1AJOA 2ILMA 5L7OC 1REEA 3HQRA 2LROA 1Q5OA 3FHAA 1SDDB 1RB8G 3WW1A 1XNBA 1AR72 5LY2A 4MUVA 4WBBA 3ST7A 2P6HA 3WINE 4AYUA 3R4DB 4AWDA 4JRLA 4FFIA 3E6BA 3WQ1A 3VD4A 2EA7A 1YQ5A 3NAPA 3AYDA 5FZ0A 2XJPA 3NMBA 1SZBA 3NV1A 4INDA 4BQ4A 2GNBA 4NIHA 2BOJA 4Q4W2 1EAH1 2D98A 3M3EA 5EP9A 5FCCA 2GSYA 5LBEA 1AR92 3PNAA 1C8NA 1DU3D 2NMOA 1GR3A 2C4XA 2Z2SB 3BIWE 3OUIA 4L92A 5A80A 4OUSA 1MS9A 5CISA 4QKDA 2R49A 2MEV2 4CDWC 5C8CC 4CU6A 5CU1A 2FZ2A 3AKQA 1FMD2 3THDA 4CEYA 1QDOA 1KITA 1S0IA 3PU3A 3AB0A 3CJIB 4IL7A 5DAWA 3H9AA 4HKLA 3B01A 2HWB1 5FZEA 1LGCA 2AR6A 4XQ4A 5K4LA 1ZBA3 3FE5A 5C7GA 3I2KA 2ZS6B 5CG9A 1W6OA 2EIBA 4NHMA 1W9SA 3O12A 1GBGA 1IG0A 4NWVA 3WP6A 3E97A 5FYHA 1RXFA 4LULA 4AVVA 3RZHA 1OFSA 4TTGA 5FLIA 2BGPA 1HB3A 1Y9MA 4FPKA 1S0JA 5LBBA 4BQ5A 2ZX3A 1RUD3 3V65A 1IS6A 3PDQA 1DLLA 2IXJA 2AGSA 4OZOA 4QXKA 5FJKA 1ZRFA 3HJRA 1QNWA 5FMCA 3LB9A 1CD3G 1QDCA 1AYN1 2BZDA 3P3PA 4QDSA 4Q29A 2VULA 2QQKA 1SLBA 5FZ1A 3V0BA 2CGPA 4LIUA 5FO7B 3KMHA 1OI6A 4IE6A 4YGBA 4KG0A 1AJKA 4LTAA 5C3PA 1X36A 3ZM8A 2WAOA 1UZVA 2Y6JA 1LEMA 3ZMOA 5FPXA 1DBNA 1JUIA 2D5HA 4LE4A 3OTFA 2D3PA 2Z69A 2ZGOA 2CTVA 5F3IA 4MH0E 5IK8A 4H3WA 1RUH3 1ZBA2 3LEKA 5C8WA 2B9UA 5JOXA 1VBC1 1X50A 2RV9A 2TUNA 1H1AA 4CDUC 3DECA 4LJHA 3M3QA 3BUCA 1JYCA 2DWRA 3RGBA 4MG2A 3QH6A 2ZGMA 1RINA 2AENA 5A7NA 1RUD2 1HJFA 4MX3A 1HB4A 4QQLA 4Y3OA 3DYOA 3OEBA 5L9RA 1GWLA 1OQEA 3KCYA 3H3ZA 3ZSJA 2XJUA 5ISLA 5A6XA 4M4RA 3ZFFB 3A0KA 4LXLA 2BNOA 2WC2A 5FP8A 5CG8A 3ZSLA 2RM21 3B3QE 5C3SA 5L19A 3FMGA 2DV9A 5HXMA 1V9U1 1W39A 3B69A 4QGMA 1EV11 3V56A 2XWBB 4PF1A 2V5YA 1SQ4A 4JQTA 1XNAA 5H9PA 2VMHA 3CHXA 3TN91 4Q26A 1RUH2 3H1MA 5FXWA 1MQTC 1NE6A 2A6WA 3PL0A 1D4M1 5FJHA 1WCDJ 5I91A 2WT1A 4DOUA 1XNCA 1NE4A 2G19A 2QQIA 3AMPA 2GAUA 4Y5Z0 5GZCA 3V0AA 3J8F3 4FCAA 4HT1T 4JAAA 2RS13 4X8NA 4OFGA 1XJAA 2PAMA 3GBFA 3LFIA 1LOCA 2X8KA 4GAZA 5HBAA 1RL3A 4ASMB 3WDXA 1VLNA 4IV1A 4OYUA 4EN0A 1F15A 3VKOA 3VDBA 3KLSA 1IZ3A 1DZQA 4HONA 4I02A 2AEYA 5JI7A 3KB5A 3FWEA 1NKGA 3V0AB 2E63A 2XLGA 4AQ2A 2WZR3 2G9FA 2WSUA 3WX5A 5HV0A 1Z7S3 5CIRA 5JOZA 5DDJ1 1JODA 4RFRB 3M3OA 5BNPC 4MGQA 1WCSA 4Q4V3 3USUB 2HEYF 3POSA 4PIZA 2YC2A 3H1WA 3VZMA 3IIAA 2IWGB 1DGLA 2GC3A 1C8M3 3LCPA 4Q5OA 2C24A 3G6JB 1JS9A 1US3A 1FX5A 2K46A 2YC4A 5GLTA 4HPKA 1VB2A 4Y5TA 1JXNA 5FR3A 1GOHA 1X8MA 3Q9OA 1MPXA 5L36A 4UT5A 2OVUA 2VVEA 1HLCA 1W0PA 4LBQD 2EIEA 1O3TA 2Z42A 2XONA 1GWKA 2GH8A 2J22A 3J8F2 2RS12 2J1RA 2W3JA 5FYBA 3RWKX 3HVDA 4DMIA 2C1FA 1QOSA 1S0CA 4IV3C 3S5QA 2X5IA 2J1VA 5FZ8A 5JSPA 1X82A 4YVSC 1W8OA 2VD7A 3MIBA 1VBB3 2VNVA 3ACFA 3ZXLA 5FK8A 2Y34A 3UV9A 1RUOA 1L7RA 5KC5A 4PIYA 2GNDA 3O0XA 3S30A 3KF3A 5AC91 4XJAA 1TEIA 3LA7A 2JB8A 2WZR2 4PQ9A 2WS93 3MPPG 5KHGA 1UWWA 1Z7S2 2UWCA 3LA3A 4XZPA 1U5XA 3ETQA 4YPJA 1LOAA 3GZEA 4Q4V2 4B4QA 3WDVA 5HXVA 3O1PA 2ADDA 1C8M2 1RC6A 2ZAHA 4M3CE 2B46X 3HN1A 4CCKA 1IS3A 1WMDA 1QJY3 4AK3A 3M1HA 5IT6A 4R4ZA 4BK4A 1O6UA 2HBUA 3RG0A 2PELA 5CEHA 5CFDB 4Q8KA 4AQ6A 1E5IA 2UY9A 1NLRA 3JB4C 1GV9A 1R083 1YEWA 1JU3A 5FMOS 4A44A 2WLPA 3ABZA 3I59A 4P14A 4YLZA 3VDAA 1GNHA 3GZTB 4AVAA 5C33A 5LK7B 2L9LA 5FZKA 4A41A 1PM7A 3A4UA 1CZVA 1WW5A 5A70A 3GJAA 2WL1A 1CZSA 1PMJX 1RUE1 1VP6A 1W9TA 2GZWA 3B9IA 4HN0A 2O0OA 1MS3A 1XRUA 1VBB2 3IAPA 4AVTA 4KU7A 4LEJA 4N7UA 4ZONA 3K4AA 3LQCA 1HRI1 3ILNA 1NCRA 1W6MB 2HEVF 2TBVA 2WYSA 1QH6A 1RTVA 3CMGA 1HDKA 3LZZA 2OXBA 2A7AA 4P08A 4QXBA 3AKRA 5DUXA 3VBOB 3HNMA 2XB6C 3AZWA 2HWD3 4YW5A 3WG1A 3OCPA 4AGVA 4QB2A 3CJIC 1QU0A 4Z92B 5F5IA 5I0RA 3NNJA 2CDPA 3IT8A 1GNYA 1SLLA 1AR83 1NCQB 4M3CB 1I3HA 1DYPA 5A3TA 2ENRA 1HRV3 1B35A 2EICA 1HQWA 2ZKNA 5FXVA 4DB5A 1C1FA 4J25A 4FT8A 3IZOA 4DEQA 5HPOA 3ACIA 1BVVA 4UFMA 1GU3A 2ZGRA 1CVNA 1PO23 4EN8B 3RZLA 4L8QA 5FZIA 1ZREA 2QQVA 2SBAA 4Q4Y1 2MNGA 3I3EA 2RR13 2WO7A 3I4IA 4UW3A 1R082 5FY7A 1AZDA 4L99A 3S0MA 1OBNA 4H55A 4NRQA 2ARCA 3SEEA 3SNMA 2JDKA 2VMGA 2B42B 4BPZA 5IK5A 2WSVA 4LKDA 4O61A 1G7YA 4GMP0 5DG2A 4OHZA 1UMIA 1CX1A 4URTA 1YIPA 2GC1A 3VB9A 1ALYA 4MGKE 5FUPA 4CCNA 5A3LA 1O3RA 3CL1A 3K46A 3D4KA 2HWD2 2RS31 1CPNA 1HW5A 2ZEYA 4CUCA 3ZIXA 4XZUG 5JSRA 3ENRA 1S0FA 1AR82 1SFPA 3RPQA 1UYYA 4FPHA 4YGEA 3FUQA 1HRV2 1UOBA 4EWDA 5A6QA 1RUI1 1H9WA 2RJKA 3C7EA 2E32A 4S2DA 4UAPA 5IK4A 1F31A 2WQ8A 5HCAA 2VZSA 4LLOA 1PO22 2X53S 3BVCA 4Z07A 1VBD1 2VMFA 5FZAA 4LOSA 4BJ0A 5KHIA 5HCHA 2RR12 2PTMA 1DQ2A 2E7AA 2P4EA 3KGZA 4MV2A 4XBLA 4KBBA 3RYRA 4QPIB 4DS0A 4LKFA 4PI2A 5DABA 4ASLA 4BYYA 1LGNA 1QJU1 2JG8A 3ZFFC 2FMYA 3OY8B 1ASJ3 3MFAA 4N8MA 1PM4A 1PX4A 4PLNA 4YWAA 1G8WA 1ZBE1 1LJ7A 3T08A 3IMMA 4A6SA 3K2OA 5KXBA 1J1TA 1H9PA 4BLIA 5JI9A 2AREA 5A33B 1NT0A 5BNOB 3E1F1 4KWKA 5FZ4A 4BOWA 2FHRA 1UU4A 4M3CF 1ONAA 3GCWA 3UKNA 4AW7A 1K42A 2JG8B 1SEFA 3O1RA 4ZU4A 2XLFA 2YG0A 1WW6A 4E2GA 4E9KA 1Y43B 1TMF2 1LECA 2Y6HA 1ZRDA 1EYBA 1YWKA 3N7LA 2F4PA 5FMOL 1NQJA 2PLV1 3OUJA 2WA3A 4GJYA 5EYYA 1RUC1 3K77A 1JOBA 5BNNA 1BMV1 3L2YA 1OKQA 1WMFA 1XNDA 3RDIA 4P9WA 1AX0A 2BU9A 3TNPB 2W1UA 1CWPA 4LO7A 3T30A 3WR0A 3LEMA 2P3KA 2YYOA 3TBDA 1TVGA 2CYFA 4NRMA 3FLRA 3FHIB 4GB31 1MEC3 4KQ7A 3VUOA 2W52A 1WD4A 4AL9A 1LU1A 4IE0A 4YYOA 1YLLA 1VJ2A 3FL7A 3VL8A 2HWE2 5GLZA 2V72A 4FTSA 1SG3A 4MGZE 1YXWA 4QPGA 3HN3A 1ZRCA 3F2ZA 4TLFA 1ENSA 1B09A 4IDZA 1KJRA 1L7LA 4O65A 4XCBA 4YG0A 3N35A 1HQNA 5ERLA 2PHFA 4DY5A 2WUHA 4HANA 3BTYA 5FYVA 2GN7A 2JECA 4CZSA 3LIGA 1ZZBA 3FUOA 4JGYB 1BBT3 2D6PA 2GP3A 4OQ9A 4XMIA 2PYTA 3AZVA 2AEZA 1UCXA 2ZX0A 2VH9A 5FZ7A 3FBYA 1KGYA 3JD73 1LOFC 2AYHA 5JPNB 1LOBA 3L2HA 3ON7A 5LZ6A 4FVVA 1JZ5A 4OQ8A 3KSCA 4N43B 1G6NA 4Y20A 4OHXA 5FZCA 2H6BA 2VW2A 3LWCA 3PJYA 2YBKA 3JQXA 3CKHA 1S0BA 2QJVA 4GWMA 4NN0A 4ZS2A 5LA9A 4AI3A 2RDRA 5IYYA 5AVAA 5L7OA 1CAUA 5FLHA 2GH2A 2JICA 1V6MA 4ES8A 5A3UA 2GP5A 3KCXA 1QNYA 5FZOB 2WIIB 5F5AA 4IUGA 3KV9A 3ZSEA 5IATA 3GF6A 1S4CA 4GALA 4XF9A
chains in the Genus database with same CATH topology
2O14A 2LRPA 1W8ZA 1UOJA 1V0AA 1HN0A 4YW7A 3UT0A 4AL9A 2JWPA 2LROA 1GWKA 1WCUA 4LJHA 2WYFA 4BQ2A 3ZYFA 4LKDA 1OH3A 1W90A 4LK6A 4CP9B 5D21A 1L7LA 4LKFA 1GWMA 1W8WA 1GWLA 4CPBD 4BQ4A 3F95A 2C24A 1WZXA 4LK7A 1OKOA 3ZYBA 2Q1FA 4YWAA 1WMXA 4BQ5A 4YW6A 4CPBA 2KR2A 2K46A 4A6SA 4CP9A 4LKEA 1W8TA 3ORJA 3ZYHA 4BQ3A 1W9FA 2VXJA 1W8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O14 A;  2LRP A;  1W8Z A;  1UOJ A;  1V0A A;  1HN0 A;  4YW7 A;  3UT0 A;  4AL9 A;  2JWP A;  2LRO A;  1GWK A;  1WCU A;  4LJH A;  2WYF A;  4BQ2 A;  3ZYF A;  4LKD A;  1OH3 A;  1W90 A;  4LK6 A;  4CP9 B;  5D21 A;  1L7L A;  4LKF A;  1GWM A;  1W8W A;  1GWL A;  4CPB D;  4BQ4 A;  3F95 A;  2C24 A;  1WZX A;  4LK7 A;  1OKO A;  3ZYB A;  2Q1F A;  4YWA A;  1WMX A;  4BQ5 A;  4YW6 A;  4CPB A;  2KR2 A;  2K46 A;  4A6S A;  4CP9 A;  4LKE A;  1W8T A;  3ORJ A;  3ZYH A;  4BQ3 A;  1W9F A;  2VXJ A;  1W8U A; 
#chains in the Genus database with same CATH topology
 3FBM A;  1IPK A;  4ITC A;  4MHR A;  4M01 A;  1T2X A;  5D8A B;  3K4D A;  3TRS B;  5CA6 A;  1JOJ A;  1GNZ A;  4M0H A;  3AMM A;  1FV3 A;  3TOJ A;  2RMU 1;  2YV8 A;  4K3U A;  1BBT 2;  2R16 A;  4XEZ A;  4JKL A;  3UGH A;  5FY1 A;  4WM7 B;  4NIG A;  1GP5 A;  4BQW A;  3JD7 2;  2BFU S;  4QDQ A;  1ULD A;  2VOV A;  3KVA A;  3F95 A;  3OUH A;  4XHB A;  4XBN A;  4C1W A;  2QQP A;  3VKN A;  4LK7 A;  1TME 3;  4CDW A;  2VOW A;  1QIQ A;  5I8Y A;  4FFF A;  5A7O A;  5C70 A;  2F6B A;  1MAC A;  4LKE A;  2WT0 A;  2C26 A;  1ENR A;  1UZW A;  2ET1 A;  3LOI A;  3VBO C;  1SBE A;  4KH9 A;  4B8E A;  3WY6 A;  4AFM A;  1PX3 A;  1DYO A;  4QPY A;  4RHV 3;  2YPJ A;  4CDX A;  1JZ8 A;  2CGN A;  3I2G A;  4XYX A;  2E31 A;  2W0X A;  5JR7 B;  5D1I A;  1NCQ C;  2W2I A;  3PJQ A;  2D6L X;  4Q1P A;  3VD7 A;  2V4V A;  3NKG A;  3VHO A;  4PHZ A;  4BDV B;  4EN7 B;  2JKB A;  5FRE A;  3RS6 A;  4D7S A;  5A3P A;  5GZG A;  3O1U A;  1SFY A;  3APB A;  2WR9 A;  5EXO A;  4Z8B A;  2ZPX A;  4E8D A;  3I2I A;  2PHW A;  1YFX A;  4GUL A;  2A6X A;  4I0B A;  5T3N A;  1JZ2 A;  3PUS A;  5F2W A;  4ISR A;  4EQV A;  5A7S A;  1FOD 1;  3BTX A;  3Q8F A;  2UU8 A;  5IVF A;  1NAE A;  2ZGT A;  1W3X A;  4Q0U A;  2ZGU A;  4S2H A;  3HT1 A;  1WUV A;  1NA1 B;  3HBZ A;  4W8J A;  5JXJ A;  2D43 A;  4LO4 B;  3ZKU A;  1ULO A;  1RJ8 A;  4XIO A;  1FI2 A;  2HWB 3;  4W4Z A;  3AMN A;  3AVS A;  3JXS A;  4HXC A;  1KFX L;  3ALQ A;  4Q4X 1;  3D6E A;  4COZ A;  1S55 A;  5FYI A;  1CES A;  4QXC A;  4AVC A;  1GQG A;  2W9X A;  2WN2 A;  1O4Y A;  2ZX4 A;  3ZYI B;  1OLM E;  3T09 A;  3GHN A;  1UPI A;  5A7W A;  3WCS A;  4JRA A;  1MS1 A;  2OQ7 A;  3ACG A;  4YZ4 A;  1DGW A;  2P3Y A;  3VD3 A;  3PVE A;  1QKQ A;  5T50 A;  5C9A B;  1QOT A;  4XJU A;  2BOI A;  2VZ1 A;  4ARY A;  5EIY B;  4HKO A;  4XC9 A;  4NRO A;  3AXE A;  4OI1 A;  4Y4Y A;  5K7P A;  2HYX A;  1DQ1 A;  1EAH 2;  1R64 A;  2BWC A;  3D8C A;  2WFF 1;  2WA4 A;  5IHR A;  4XDP A;  3INA A;  1NG0 A;  3T2O A;  4D7Y A;  2XQX A;  3R4S A;  2BBV A;  3H7J A;  1Q3E A;  2I45 A;  1POV 1;  1DQ4 A;  4XAC A;  1W3V A;  4QPI C;  3IKW A;  1UNB A;  2JDY A;  3DCQ A;  1VAL A;  1V6I A;  3G7D A;  4ORF A;  5DPN A;  5FIX A;  2O1Q A;  1JYX A;  1N1S A;  3LF7 A;  3N9M A;  4CU9 A;  3C7O A;  3RVH A;  1G9D A;  5FWJ A;  1W8H A;  2I07 B;  2WRA A;  4QU1 A;  2HWB 2;  3SXW A;  1ULF A;  4DRV A;  2XXZ A;  4BLJ A;  1XU1 A;  4ZU7 A;  1U5Z A;  2VUJ A;  3MIF A;  4ZZ8 A;  2B8M A;  1AL2 1;  3JBG 1;  1VBC 3;  4GIQ A;  2CY6 A;  3ZFG B;  3AXD A;  4XET A;  2JD4 A;  1Z78 A;  2BBA A;  4YW1 A;  1MVE A;  5J96 B;  1FNZ A;  5BNO C;  4P02 B;  5JPM B;  5GLV A;  1MQT A;  1UXZ A;  3AL6 A;  3CJX A;  3EMR A;  5FO8 B;  2JG8 C;  3I3D A;  2VQU A;  3EO6 A;  1F5J A;  4Z2A A;  3GHM A;  1YQ2 A;  3D3A A;  4HSJ A;  4R9B A;  4L97 A;  2DTY A;  3TYJ A;  1IHM A;  1AYN 2;  3W58 A;  4H14 A;  3EQE A;  4N7I A;  4NE9 A;  4U36 A;  4EYU A;  4P00 B;  3ZFE A;  1OQD A;  4HSL A;  3WCR A;  4FQZ A;  5FBZ A;  1R09 3;  3IWZ A;  3THT A;  3AL5 A;  5K0U B;  1DGR A;  1LTE A;  2VUC A;  4P5Y A;  4QHZ A;  2RM2 3;  2XBO 1;  4XUQ A;  5G04 L;  1OT5 A;  3AFG A;  5KHK A;  3I2J A;  2VOK A;  5FQ0 A;  2WZP P;  1V9U 3;  4MGT A;  1EV1 3;  2ZXQ A;  3LPG A;  4LUK A;  5C5U A;  2FQP A;  4QX2 A;  2YMZ A;  2FD8 A;  1A34 A;  4XW3 A;  3ACL A;  4DY3 A;  4P9Y A;  2YFU A;  2XH6 A;  2IVJ A;  2ZEW A;  3ZFE B;  4F8A A;  4YZ1 A;  3QD6 A;  4LHK A;  2ZMN A;  3MLK A;  1D2Q A;  1OUR A;  1QMJ A;  3TEX A;  5FYT A;  2XL9 A;  3SH3 A;  2DCZ A;  3SH4 A;  3TNQ A;  3VGI A;  1VBC 2;  5FZ3 A;  1LEN A;  2J1S A;  4W6X A;  3WZ1 A;  1G9F A;  1PVC 1;  4I3P A;  2FDF A;  5IAX A;  2GMP A;  4EN9 B;  5IVE A;  5J3U A;  2PHR A;  4JGZ B;  3RJR A;  3WNN A;  1XB9 A;  5LAT A;  2W08 A;  5EQU A;  4AQS A;  2RG4 A;  2YB7 A;  3PLQ A;  1ZZ8 A;  3W20 A;  3I54 A;  2VJX A;  1JBC A;  3WSO A;  2WNU B;  4JGY C;  1AR7 3;  2HWC 1;  2HWF 1;  3HT2 A;  4CE8 A;  4BME A;  3FN9 A;  5CNA A;  3NV4 A;  3MYX A;  3ORJ A;  4UFH A;  1GZW A;  4IW3 A;  1ND2 B;  4P9X A;  4YVS A;  3WD5 A;  1WLC A;  1W6P B;  5EHD A;  3WOG A;  4BIO A;  4HL0 A;  1IKP A;  5GAL A;  2RM2 2;  2VE1 A;  4GQ7 A;  4N43 C;  4CCJ A;  4MYE A;  4RQP B;  1QXP A;  1V9U 2;  4XFB A;  1EV1 2;  1V6J A;  3QBQ A;  5AVP A;  4A7Z A;  1RMU 1;  1LHN A;  2Y8K A;  1H6X A;  2ZGL A;  3CO2 A;  3ZN5 A;  1ZZ7 A;  2A6Z A;  3J9S A;  3ZXG A;  3M4F A;  3OBA A;  2QE3 A;  3O0W A;  3FLT A;  2LS6 A;  4XUN A;  3AVR A;  3MHZ A;  4QX5 A;  3OYW B;  3TN9 2;  3C3V A;  2BEO A;  3T2T A;  1JHN A;  1WZX A;  2P3I A;  2PHX A;  2XVL A;  1D4M 2;  2PA7 A;  1KJL A;  2DU1 A;  1UX7 A;  5FY9 A;  4FPL A;  2P1B A;  3ILR A;  2JDU A;  4J1X A;  4BH9 A;  3N7J A;  2VCA A;  2IFR A;  2KD7 A;  1RUJ 1;  2Q1M A;  1UMZ A;  4XIK A;  4Y22 B;  4BZ4 A;  3DXU A;  4S2F A;  5T54 A;  2R06 1;  3O1O A;  1UN1 A;  2X10 A;  5D8A C;  1ENQ A;  1O3Q A;  1RUF 3;  5DZE A;  3VBS B;  4LHS A;  2GAL A;  2EAK A;  1TZO A;  3WDU A;  1SMV A;  3R4U A;  5KR7 A;  4DXZ A;  3OF1 A;  1NOV A;  4IE4 A;  3QOP A;  4LMF A;  4YVW B;  4XF4 A;  4WM7 C;  3LOB A;  5AC9 3;  1H2L A;  3MGU A;  1UPS A;  1A8M A;  2HYK A;  4RS5 B;  3J7M A;  3QLQ A;  2VC9 A;  2ARB A;  3RNS A;  3AP5 A;  4QM8 A;  5JVV A;  3VBH A;  1BCX A;  4W65 A;  5DDJ 2;  5HCF A;  2XPJ A;  2NYY A;  1C3H A;  5DUW A;  1WWY A;  1F2N A;  3CJI A;  4XQW A;  5LK5 A;  4LT5 A;  4DIN B;  3MPB A;  3ZYG A;  4BHP A;  2O8O A;  1OUX A;  2ATF A;  2UY8 A;  5BNQ A;  5CFC B;  1QXJ A;  1X33 A;  2R1D A;  4TZD A;  1UKR A;  4Q0P A;  3PU8 A;  1C5H A;  3D5O A;  4QGN A;  1FT9 A;  1Y7B A;  4BM8 A;  1G9B A;  4HMZ A;  4NOT A;  3VBH B;  4L9B A;  1YC6 1;  2G4I A;  5GJ6 A;  1LES A;  1QF3 A;  3DKQ A;  1W99 A;  4D6R A;  1S0E A;  4OLL A;  3H1Y A;  3KVB A;  4RL7 A;  5JSO A;  4JKM A;  4IE5 A;  5E1R A;  4NHK A;  1GWM A;  1GKB A;  1RUF 2;  1R1A 1;  3J26 N;  4CCE A;  4CDX C;  3LSE A;  1CAW B;  3B02 A;  3HIF A;  5FY8 A;  4L0P A;  3N36 A;  3S6P A;  3ZYJ B;  2JE9 A;  4QGL A;  2ZHL A;  5JR2 A;  1HRI 3;  2E7T A;  1OA4 A;  4AHZ A;  4ZXK A;  1NA1 C;  5AC9 2;  1OXC A;  1M4W A;  2FBE A;  1H0B A;  4PJY A;  3ZYH A;  1NXD 1;  4OVE A;  1YQ6 A;  2X09 A;  4KMQ A;  4QM9 A;  3OOX A;  2ZZJ A;  3BN6 A;  4EWE A;  3ZSM A;  4BK5 A;  3RMY A;  2QTW B;  4NRP A;  4XHX A;  1AUY A;  1PHM A;  2IXK A;  1UO9 A;  3GDB A;  3DL3 A;  1ZA7 A;  4XCA A;  3BKZ A;  1O5U A;  4AOC A;  1GZC A;  3ZPY A;  1Q56 A;  3DV8 A;  5F8P A;  1TNF A;  3WXP A;  4NVP A;  4CA9 A;  2VUD A;  5F39 A;  3HBK A;  1UZZ A;  4EE2 A;  4LBJ A;  1W8W A;  1WBF A;  1ZM1 A;  4IEP A;  3RZM A;  1NUK A;  5C9A C;  4Q4Y 3;  4TXW A;  5L73 A;  4LO8 A;  4B7E A;  1CIW A;  4COY A;  3WG3 A;  4Z82 A;  1O8S A;  3ZPO A;  2J1U A;  2J1A A;  4OHV A;  4R52 A;  4UW6 A;  3PTY A;  1RUE 2;  3MUY 1;  3OGR A;  4DRR A;  1OA3 A;  5FBJ A;  4OHW A;  3ZFF A;  4AED B;  3PUH A;  4LBL A;  3B5L B;  5FZG A;  1HRI 2;  1REF A;  1XYO A;  1VIW B;  5CBL A;  1D0H A;  2BQP A;  2WZ8 A;  3VD5 A;  2YU2 A;  4DUV A;  5I0S A;  2WNV B;  4URA A;  3ZN6 A;  4AI1 A;  2GC0 A;  4HFS A;  3WP4 A;  2GMM A;  3C7H A;  4NHX A;  2Y64 A;  2JDN A;  3WF1 A;  1CIY A;  2OX0 A;  1FYU A;  1IQD C;  2BYV E;  3D0J A;  1W6N B;  1OF3 A;  5DQ0 A;  3ZFG C;  1A6C A;  1H1M A;  1RUI 3;  4OI0 A;  1C5I A;  5FPL A;  3NJZ A;  1CX4 A;  2XML A;  4JKK A;  4QWN A;  3ZN4 A;  4A7K A;  1X9P A;  4GH4 B;  3I3Q A;  1VE0 A;  3ZN6 B;  1VBD 3;  2O14 A;  4BIS A;  3BB6 A;  1K5M B;  1S1A A;  4Q4Y 2;  3WP5 A;  1SCS A;  4A2U A;  2A6Y A;  1UZ0 A;  3SC7 X;  2VAU A;  4RGA A;  2ZAC A;  2LM3 A;  5GZD A;  1IKQ A;  1QJU 3;  2VO5 A;  4JZR A;  4F83 A;  4HK8 A;  2AH2 A;  5K0U C;  2D3R A;  1W9Y A;  1ZBE 3;  2VG9 A;  4MSV A;  1F5F A;  3IAQ A;  1D2S A;  3U0Z A;  2WNO A;  3VDD A;  2VNO A;  3IDC B;  5FO9 B;  1J58 A;  2JDH A;  2VZ3 A;  3GYD A;  2YHJ A;  3MLL A;  3KF5 A;  2RS3 2;  4LBN A;  3ZFE C;  4ES9 A;  1E5S A;  3OPZ A;  4QT6 A;  3USU A;  2R1B A;  5F1R A;  5DAV A;  2CNA A;  2A3X A;  3QCW A;  1RED A;  4ARX A;  1MZ5 A;  4A4A A;  4UWD A;  1WA4 A;  1ZZC A;  4CXY A;  3ES1 A;  3ECQ A;  2B45 X;  2JG9 B;  1RUI 2;  3KV5 A;  2RS5 1;  1Y9Q A;  1UL9 A;  2PLV 3;  5EJ1 B;  3FJS A;  2ZGS A;  1HB2 A;  1RUC 3;  4BQY A;  4CP9 B;  1E57 A;  1WGP A;  2WN3 A;  2XJQ A;  1ND3 B;  4JGZ C;  3VV1 A;  3UL2 A;  1L7Q A;  1VBD 2;  4EV0 A;  4ZZ5 A;  2VMD A;  5F2S A;  5JWP A;  2C0Z A;  3POW A;  3HQU A;  1RUN A;  1UU5 A;  1HIX A;  3DUI A;  3NO8 A;  5CKM A;  1LOF A;  2WNU C;  1VBE 1;  5CZK A;  5T55 A;  2TNF A;  2Z79 A;  3ASI A;  4JTO A;  1PZ9 A;  4GB3 3;  1QJU 2;  3FC0 A;  1ND2 C;  3K48 A;  2ZML A;  2YZ4 A;  1OMI A;  1GFF 2;  1U0A A;  1W8U A;  1ZBE 2;  1JOP A;  4RQP C;  1SBD A;  4QB1 A;  2E6V A;  2D93 A;  3NNG A;  4XTP A;  1GQP A;  3CLP A;  3WVJ A;  3EHK A;  3RJ2 X;  4AVB A;  2IFW A;  4LLF A;  2WYF A;  4TLG A;  1XNK A;  1H8T B;  3MV1 1;  4MVT A;  2DBI A;  2XJR A;  4BB3 A;  3KQR A;  1ZVF A;  1HV0 A;  4GKX A;  1PGL 2;  2XLA A;  3T4H B;  3VD9 A;  1XSR A;  2A5Z A;  1KEX A;  3VKF C;  1ODM A;  2DCT A;  3Q8C A;  4KWJ A;  5FKC A;  3VHR A;  4EJR A;  3I7D A;  1IPS A;  1VAV A;  1AVB A;  1YCI A;  2CDO A;  2PLV 2;  3OD0 A;  2ID4 A;  4HBN A;  1RUC 2;  4WVZ A;  5CFD A;  1LHU A;  4TYS A;  2EAL A;  5ABJ B;  1NZC A;  3NNF A;  3VBS C;  2JD9 A;  1UOJ A;  3T1M A;  1W03 A;  4I3G A;  3P5B A;  4QDR A;  2XUM A;  3WNO A;  2DUQ A;  4YVW C;  2PFW A;  4GB3 2;  3SMH A;  1WD3 A;  3GBW A;  1QOO A;  4XJZ A;  1SBF A;  1SPP A;  3CIH A;  1RUG 3;  4RS5 C;  1P8J A;  1KFU L;  1DG6 A;  1XYP A;  1W6M A;  3GZU C;  4ASK A;  4J6G A;  4D94 A;  3VBO A;  4XUR A;  4DZG A;  3THC A;  2A3Y A;  4G9S B;  1JZ3 A;  4AG4 A;  2XQR A;  1NCQ A;  2Y6G A;  4NWW A;  4M3C A;  4E27 A;  5CFC C;  2NQY A;  1AX1 A;  2CHH A;  4CU8 A;  4YM0 A;  1AR6 3;  1OLR A;  1SPP B;  1ZZ9 A;  2VZO A;  4FFH A;  5HV4 A;  2LRP A;  4EWA A;  3NL1 A;  2DVD A;  1V0A A;  3VBH C;  2DFB A;  4PBP A;  1C57 A;  4CP1 A;  3NJX A;  2PN5 A;  2E53 A;  5LBC A;  4MXW B;  3RFR A;  5J36 A;  2G1M A;  3LGR A;  2DUO A;  4X8P A;  1UIK A;  4XXP A;  4UFL A;  3A7Q A;  2NP0 A;  1XQN A;  2OW4 A;  2B39 A;  4IEZ A;  4FOY A;  4NHL A;  3BU0 A;  4D3W A;  4HVR A;  2OUJ A;  3RZJ A;  1ZBA 1;  1H2N A;  5FYY A;  5F6K A;  3KHC A;  1GOG A;  1O4Z A;  2VVF A;  2QNK A;  3B7M A;  3DYP A;  1QGL A;  3CZU A;  1RUG 2;  3GBG A;  3NV2 A;  3USS A;  1H6Y A;  4AGR A;  1UD1 A;  3OPW A;  4PBO A;  2W1Q A;  1X9T A;  3AYE A;  1UYZ A;  2H6C A;  3OBT A;  3I3M A;  1KRI A;  3VBU A;  2EXJ A;  1OD3 A;  5F37 A;  4QX8 A;  4B7K A;  3C2U A;  2ZA9 A;  4ZHN A;  1HV1 A;  3K51 A;  5DAX A;  1UZY A;  1AR6 2;  1WME A;  1VRH 3;  5CKQ A;  1GIC A;  3M7A A;  1D0G A;  1XBF A;  1Y9G A;  2W46 A;  3TEY A;  3N7K A;  1PZ8 A;  4MLO A;  5FY4 A;  5L9B A;  3P3N A;  3BTA A;  1CJD A;  3VBU B;  5GZF A;  1WA6 X;  5K8S A;  2XUE A;  4QPI A;  1F4H A;  4YFZ A;  2FDJ A;  2DU0 A;  4Q4X 3;  1TMF 3;  2YBS A;  3WQ7 A;  1RXG A;  1PZ7 A;  4AED C;  4NO4 A;  5CVR A;  3OBR A;  3OY8 A;  1PGW 1;  4XFH A;  4LBK A;  3N4M A;  4CXW A;  2WNV C;  2DTW A;  3M70 A;  3P1I A;  4FQ4 A;  2R07 1;  2DCY A;  2WO2 A;  5CYY A;  5JAX A;  1V6L A;  2D3S A;  5A33 A;  5KXE A;  5BUV A;  1QJE A;  5BNO A;  1CAV B;  3IPV B;  4A3Z A;  1K12 A;  1O59 A;  3BOW A;  4B1M A;  1KXG A;  2PQS A;  2VOX A;  5C3Q A;  3O1M A;  4ZY9 A;  1OKO A;  1GUI A;  2WFF 3;  4IEY A;  5JMC A;  2RJL A;  2EXK A;  4FPY A;  3VBF B;  3H42 B;  2HWE 3;  3IMN A;  4GH4 C;  4Q0Q A;  5DUU A;  2AAC A;  5JZG B;  3T2Q A;  1VRH 2;  5FY5 A;  1OPO A;  1FOD 2;  3HPN A;  1POV 3;  4XUO A;  5D2A A;  4PDW B;  1PO1 1;  3MW2 A;  1BLZ A;  1J3Q A;  2HKX A;  3KV4 A;  1OHF A;  2ET7 A;  3AP7 A;  2AUY A;  3SKJ E;  1XE0 A;  5LB6 A;  2EXH A;  3CEW A;  5J37 A;  4Q4X 2;  4XF3 A;  5FV3 A;  1O8P A;  3JBG 3;  1M06 G;  1J84 A;  4B3N A;  4BXS V;  1OC1 A;  1H1I A;  3UKT A;  2EID A;  3JCI A;  4MOA A;  1N3P A;  2W47 A;  2CU5 A;  2UWA A;  4FP3 A;  2BNM A;  4QHB A;  2B9V A;  1R1Z A;  4JDM A;  4XIL A;  4D6S A;  5FOJ B;  1GQH A;  2FDI A;  1W8Z A;  1DHK B;  1VMJ A;  1PIV 1;  4LE3 A;  4JDO A;  2JG9 C;  1C28 A;  1IGO A;  4RSU A;  2WFF 2;  2ADE A;  4L11 A;  4EZH A;  4YM3 A;  4H2A A;  4AEJ A;  2E9Q A;  2VCM A;  4JGY A;  2XBO 3;  3BOP A;  1DYK A;  2RDQ A;  2VQ0 A;  5T5J A;  4XAE A;  1V6O A;  4LIV A;  4M4P A;  5FTT C;  1JZ7 A;  2VL4 A;  1LOD A;  4KL1 A;  4AGG A;  1F4A A;  1OFN A;  4XBQ A;  4N43 A;  3AMH A;  4NMI A;  4PT6 A;  1D4V B;  3DPR B;  4YGD A;  2KM2 A;  4LQR A;  4Y5S A;  3VZK A;  2HH9 A;  4CEW B;  1W9W A;  2ETE A;  4FTE A;  2RE9 A;  3TB0 A;  4Z2W A;  2XVG A;  1CGP A;  2YGM A;  4BQ3 A;  3LEG A;  2YY1 A;  2FMD A;  4XJW A;  1AL2 2;  3JBG 2;  4UF0 B;  2Q1Z B;  2ZGP A;  4JCK A;  1BVP 1;  1U5Y A;  1Z0H A;  4YW7 A;  3THP A;  1PVC 3;  5FOB B;  2W1S A;  2Z5W A;  3VKL A;  3S7I A;  3MIE A;  1YO8 A;  1UW8 A;  3PUR A;  3ZXE A;  5FYC A;  1H8T C;  4OMC A;  5FZO A;  4DEV A;  2BGO A;  3AP6 A;  4GA9 A;  4WM8 A;  5A32 B;  2VMC A;  2G9G A;  1LU2 A;  4I01 A;  4N9H A;  3WF2 A;  2GN3 A;  2HWF 3;  2HWC 3;  3WNP A;  5D8A A;  1DFQ A;  2HJI A;  1J3P A;  3LFM A;  4RN5 A;  2IZW A;  2Q1F A;  4HZF A;  4YW6 A;  2YPD A;  3J7H A;  4QPW A;  1ZRR A;  2XBO 2;  1DGW X;  1N47 A;  3BAL A;  5E89 A;  2WKK A;  4XFG A;  4WM8 B;  5ABJ C;  2BUK A;  2ZX1 A;  4WM7 A;  1ULG A;  2D6K A;  1EP0 A;  2QDN A;  2WS9 1;  2DFC A;  1RMU 3;  3L9J T;  2ZGK A;  5BY5 A;  4I2O A;  2RJ2 A;  3A21 A;  2VZP A;  3Q8A A;  4ISQ A;  4Y1X A;  4IEO A;  2ARA A;  3FFZ A;  1DGR N;  3ZYF A;  5CFD C;  3N7M A;  4UOJ A;  4V1P A;  3B93 A;  4LKS A;  4LOT A;  1QJY 1;  4XF1 A;  3ZO0 B;  1KDK A;  3MW4 A;  2ZHM A;  5ACA 1;  3N9O A;  4YZ5 A;  1PVC 2;  5FXX A;  2XR4 A;  3ZKY A;  1N3Q A;  1RUJ 3;  1YI9 A;  2GU9 A;  5F3E A;  4ZU5 A;  2A73 B;  2R06 3;  1UYP A;  3ME2 A;  4B1L A;  4MO3 M;  2BV4 A;  4IE7 A;  5FP4 A;  1BK0 A;  2JIG A;  3LE0 A;  4EZ4 A;  5K9Y A;  3O1V A;  4CUG A;  2HWF 2;  2HWC 2;  3CU7 A;  3POB A;  4LPL A;  1YQ8 A;  4YZ3 A;  1GOF A;  4K20 A;  2JDA A;  2WT2 A;  1JW6 A;  2QCS B;  5SV5 A;  2UUR A;  3SHR A;  4D7T A;  4OMD A;  2XVK A;  1LAJ A;  1NA1 A;  1ST8 A;  4IEW A;  1DQ6 A;  4IEU A;  4UFJ A;  1AR8 1;  1EAH 3;  1RMU 2;  2DYC A;  1S2E A;  2VUA A;  4A45 A;  3ZXJ A;  3WEZ A;  4COV A;  3LSD A;  1A8D A;  1IOA A;  2W5F A;  3HOB A;  5EWS A;  3RMX A;  3NNM A;  3WUC A;  1N3O A;  1FXZ A;  1W8N A;  5E16 A;  1XE7 A;  2K2S A;  3ILF A;  2JX9 A;  3AJZ A;  3H0O A;  3HAG A;  5FXZ A;  3PUI A;  2WBK A;  4O9G A;  3HWJ A;  3U4S A;  4QU2 A;  4EN6 B;  5C9A A;  1RUJ 2;  1YRZ A;  1N1Y A;  4R9C A;  2R06 2;  3FLP A;  3TEW A;  3N9Q A;  3S7E A;  4IES A;  1R1A 3;  4AI8 A;  2DVG A;  5JLV A;  1NX9 A;  5FYZ A;  4MGS A;  3W9A A;  4YFW A;  4D8M A;  3VZL A;  3AP4 A;  2C9A A;  2N7G A;  3CF6 E;  5FK7 A;  4AI2 A;  5FY0 A;  4XDO A;  5GKA C;  3VBU C;  3GCX A;  1APN A;  4G4F A;  4QB6 A;  2ZAA A;  4P9I A;  2VW1 A;  3LDK A;  5F32 A;  1MZF A;  1XC6 A;  2QQU A;  4FO9 A;  1AYN 3;  1HQL A;  4AFB A;  4BWO A;  5FUI A;  5IK7 A;  3IM0 A;  2NZ9 A;  5C5T A;  1OLM A;  5J1X A;  3LA2 A;  5HCB A;  5IVJ A;  1LOE A;  2A6V A;  4GXL A;  4TSV A;  1YNA A;  2DBN A;  4NHY A;  3ZFG A;  3Q8B A;  3RRD A;  1G9C A;  4CCM A;  5M0T A;  4HVO A;  5H9Q A;  4D0Q A;  4QKB A;  4KWL A;  1U12 A;  4Q2F A;  5IJR A;  1LHW A;  1LGB A;  3MF9 A;  3W5M A;  2YFZ A;  4C8D A;  1WKY A;  1YUD A;  1XU2 A;  2P17 A;  3T3Y A;  3VBF C;  5JZG C;  3WG4 A;  1R1A 2;  3WNK A;  1ASJ 1;  1J59 A;  1O91 A;  3ETP A;  4K21 A;  2XKP A;  5GM0 A;  3X29 B;  1H30 A;  4QHO A;  4PDW C;  5K0U A;  4LOR A;  3VHN A;  1XYN A;  5F5Q A;  4CSW A;  2VTX J;  4CYD A;  2RDN A;  3NVC A;  1UU6 A;  3DEM A;  1W0N A;  3AYA A;  3PHM A;  4I0W B;  2PQQ A;  1MZ6 A;  1AYM 1;  2ZEX A;  3UKV A;  2MPF A;  4GWN A;  3R6S A;  2JDM A;  2R30 A;  2D40 A;  4LBM A;  5APA A;  2DUP A;  2CV6 A;  4UBG A;  2OKX A;  4Y33 A;  2W92 A;  4N90 A;  2PAE A;  4RR3 B;  2ZX2 A;  2VZT A;  4LHL A;  2DUR A;  1OVP A;  2BFU L;  1KD7 A;  5ANQ A;  3POJ A;  1PGS A;  2FCU A;  2WAB A;  4CUB A;  4E4S A;  5JMO A;  1W2A X;  5JDB A;  4OCT A;  4QQH A;  5KHH A;  5BV6 A;  4YGC A;  1CZT A;  5LRR A;  1AXK A;  4JGZ A;  2WWS A;  3KCC A;  3MIC A;  1RHI 1;  2ERF A;  1MS0 A;  1QJZ A;  4YW3 A;  2BJS A;  2JDZ A;  3TN9 3;  1WW7 A;  1C4R A;  1MEC 1;  4IXL A;  1QQP 1;  2WNU A;  3DGT A;  2IUW A;  1CAX B;  1D4M 3;  4FPO B;  5EZW A;  2P2K A;  1FNY A;  4FPJ A;  1ZA4 A;  4OI2 A;  1ND2 A;  2ZMK A;  2VNR A;  1W6P A;  4BCU A;  4YM2 A;  3EB7 A;  5C3O A;  1COV 1;  1QJX 1;  3EJK A;  2Y0I A;  4B4P A;  4CDQ B;  4RQP A;  1J1L A;  2X29 A;  2Y33 A;  3DPR C;  3J7N A;  3KGL A;  2Q8C A;  4CEW C;  3SEP A;  5JXG A;  3KD4 A;  1SLA A;  1FAY A;  4MGI E;  1HB1 A;  5A6Y A;  1SCR A;  1WBL A;  2P5B A;  3FFQ A;  2BNN A;  4QKF A;  5DZF A;  5DZG A;  1NY7 1;  3W21 A;  3WF3 A;  2KXL A;  1OOP B;  1W0O A;  1AXZ A;  2CWM A;  5FPV A;  2RS5 3;  3LIH A;  2BWA A;  3OYW A;  4K1Y A;  1MS5 A;  3DF0 A;  1X8E A;  1UOG A;  1VR3 A;  5DDJ 3;  1XSQ A;  2R04 1;  3ITQ A;  3PIG A;  2XG3 A;  1FPN 1;  4KU8 A;  1ZX5 A;  4XVH A;  4LA3 A;  3TAY A;  3WNM A;  3O5S A;  4IGP A;  4Y22 A;  3QH7 A;  5D21 A;  3ZR6 A;  1LHO A;  4QQ2 A;  5KC6 A;  4BQX A;  1I5Z A;  1VBE 3;  1E5H A;  2WQ4 A;  4GD4 A;  4UFK A;  1HXS 1;  3EXU A;  1N1V A;  4COU A;  2QUO A;  3VBS A;  4FOW A;  4TN7 A;  1UQX A;  2XOM A;  4YVW A;  4C1X A;  5TSW A;  1IG3 A;  4WM8 C;  2I74 A;  4W6W A;  4RA0 A;  1G86 A;  1MS4 A;  4KWU A;  4RS5 A;  1XNT A;  2WIN B;  3VDC A;  1BXH A;  3MIG A;  1RVF 1;  1HN0 A;  2RVA A;  5FYM A;  1PMH X;  1YFY A;  3UGG A;  1IQA A;  3RWN A;  4HVQ A;  3TEZ A;  2ZZQ A;  5FP7 A;  3KQ4 B;  4KBZ A;  3BPS A;  5I8S A;  3VN4 A;  1IPJ A;  5CFC A;  5AFE A;  1BYH A;  4QAW A;  2C9K A;  2RS5 2;  2PAK A;  2WFP A;  4AEK A;  3POY A;  5FZM A;  1W2O A;  1DCS A;  3T4V A;  3OPT A;  5LW9 A;  5FZ6 A;  2J7M A;  3BOD A;  2P6C A;  4ET7 A;  4B4R A;  2CWS A;  2W94 A;  1TME 1;  4LR4 A;  4OUL A;  5DXD A;  5F3G A;  1VBE 2;  2W95 A;  3PVO A;  5J98 B;  3ZXK A;  1CAW A;  3III A;  4N53 B;  1LKN A;  2FCV A;  1UX6 A;  2JKX A;  2D44 A;  3AMQ A;  2VR4 A;  4LBQ A;  4RHV 1;  2D7F A;  4HG6 B;  2JB4 A;  5C3R A;  3JUU A;  1SDW A;  5KBF A;  4RYD A;  3POI A;  2I2S A;  3AYC A;  4A3X A;  2BVB A;  3WNL A;  3B9C A;  1ENX A;  1JHJ A;  1PVX A;  1RUE 3;  3WHU A;  3W59 A;  3UK9 A;  1MS8 A;  2GDF A;  3RYK A;  1UY2 A;  1CQ9 A;  3GJB A;  4OI4 A;  1KS4 A;  1SLT A;  4Q0S A;  5DAP A;  1UIJ A;  4LBQ B;  4ZXE A;  4GMP 1;  2FZ1 A;  5KHJ A;  4WZF A;  3UGF A;  3NAP B;  1CON A;  1VRB A;  4K8R B;  3JU9 A;  4OUE A;  2RHP A;  4NPR A;  1XOY A;  3BYW A;  4V2V A;  4AHX A;  3JB8 A;  3NWK A;  1BEV 1;  1K3I A;  4AF9 A;  3AX4 A;  3AKT A;  4FTB A;  1PGL 1;  3ZXA C;  1JUH A;  2OT7 A;  3AZZ A;  3KT7 A;  2EAA A;  3NJY A;  3AP9 A;  2ARX A;  4ATF A;  3IDA A;  4MAD A;  4AED A;  2ZGN A;  4C0B A;  2UWB A;  2GME A;  4QX3 A;  2W1W A;  3M8L A;  4JQR A;  2D6N A;  3U78 A;  4FPE A;  4JHT A;  2B7Y A;  4CEY B;  4IEV A;  4FXK B;  4NUB A;  1NXM A;  3BI3 A;  2WNV A;  3IN9 A;  4FOQ A;  1Q8S A;  1OH4 A;  3FX3 A;  1VMH A;  4BIF A;  1LCL A;  2H0V A;  4Y1Z A;  4LNV A;  5EFU A;  1MVQ A;  5FDB A;  4YZ2 A;  3E6C C;  1WCK A;  1GAN A;  4S2G A;  1W6O B;  4AE2 A;  1W6N A;  2YBP A;  4BA6 A;  5FPA A;  3UES A;  2PHD A;  3IDE A;  3KM5 A;  4XF0 A;  1D7P M;  2OQ6 A;  5F9T A;  5IUQ A;  2Q8E A;  4K6B A;  1ULC A;  3HR9 A;  2FCT A;  4GH4 A;  4I09 A;  2RS3 3;  4X6Q B;  2AC1 A;  2DCJ A;  4Q27 A;  4CTE A;  1K5M A;  4LHN A;  2Q5T A;  1H8V A;  2VW0 A;  4NAO A;  2OYZ A;  4DQA A;  5LA0 A;  4QXH A;  4NID A;  2W87 A;  1I5P A;  3D0S A;  2BVV A;  2R7E B;  1PK6 A;  3HD8 B;  2BTV C;  4X6R B;  5T5P A;  2VMI A;  2P37 A;  3LDB A;  1NQD A;  4JDN A;  3V0B B;  3HEI A;  4ZKT B;  2K9Z A;  5FAX A;  1QH7 A;  2VXJ A;  3NNL A;  1CPM A;  3E5X A;  4C90 A;  2R07 3;  5BYN A;  1GP4 A;  2VBD A;  4IGO A;  5F7U A;  1W2N A;  1RIR A;  2OII A;  4YW4 A;  1YFW A;  2XWJ B;  4YW2 A;  1PK6 B;  1AXY A;  2DF7 A;  4NIA A;  3RI8 A;  2LW8 A;  4RR3 C;  4FSJ A;  4CP2 A;  3GAL A;  5IVV A;  1VPH A;  3CNA A;  1VBA 1;  1YQC A;  3V64 A;  1ZZ6 A;  3UYJ A;  4XFF A;  1R09 1;  1POV 0;  2JG9 A;  3SCG A;  3VZJ A;  3ZVX A;  5I0U A;  1DIW A;  4BMB A;  2VM9 A;  1VAM A;  3ES4 A;  4CP9 A;  3M2M A;  1PO1 3;  5SV8 A;  1ND3 A;  1W9F A;  2C5D A;  3H8U A;  5FPZ A;  4E4D X;  3WW3 A;  4HOO A;  4R9A A;  1A78 A;  3UJQ A;  2QQW A;  2TEP A;  3VL9 A;  1H2M A;  5IVB A;  3LEI A;  2QZ3 A;  4UFI A;  3RQ0 A;  3ELN A;  3T0B A;  3AKS A;  1PGW 2;  4UW5 A;  1K5J A;  1QHD A;  1Y3T A;  4PI0 A;  2OZJ A;  3A0N A;  3LDR A;  3R05 A;  4CDQ C;  1YYN A;  4RFT 0;  1V6N A;  3OGV A;  4R9D A;  2R07 2;  2XKO A;  1JZ4 A;  3BCW A;  5LRS A;  2ZAB A;  3LD8 A;  2VTX A;  4DXS A;  2IXL A;  2DVA A;  1H8T A;  4YNI A;  2R6Q A;  1PIV 3;  1OOP C;  3AZY A;  1GLH A;  4IER A;  3W5N A;  2K0G A;  2Y26 A;  2R0F A;  3ZX7 A;  1SAC A;  1AR7 1;  2MHF A;  5FMD A;  4CCD A;  2QZ2 A;  5FYU A;  3UT0 A;  2VCC A;  3VZN A;  3J7L A;  4IEQ A;  4GKY A;  4PLM A;  3GXU A;  2RDS A;  2EXI A;  5JUV A;  4WVW A;  1OSG A;  5E88 A;  5C71 A;  1PO1 2;  2V4A A;  4J1W A;  1EY2 A;  1LUL A;  1GMM A;  4Q4W 1;  2WWU A;  3KZ4 C;  2A75 A;  5FYS A;  5ABJ A;  3WLU A;  3RZK A;  4IV1 B;  3AK0 A;  4ONU A;  2XHN A;  1AR9 1;  5A3N A;  3O0V A;  4IEX A;  2V73 A;  3N9N A;  4JHZ A;  3NST A;  1PNG A;  4AFC A;  2XJV A;  2MEV 1;  3I97 A;  3I2O A;  4KGQ A;  4W6Y A;  1LNS A;  1RJ7 A;  1BMV 2;  3SH5 A;  1FMD 1;  4C91 A;  3I2F A;  1LHV A;  2VZR A;  3ZLI A;  2VVD A;  5EJ3 A;  2FDH A;  1L3J A;  4CRQ A;  1Q8O A;  5A3O A;  1CR7 A;  1RUF 1;  1UY1 A;  2OA2 A;  4O7X A;  1PIV 2;  1W90 A;  2W68 A;  1W6Q A;  5B2G B;  3ZDV A;  2BGC A;  3SIT A;  1JTZ X;  3M3I A;  4HPK B;  1I6X A;  3GZA A;  3PUQ A;  3CZJ A;  2DCK A;  2Y38 A;  1RIT A;  4MXW A;  1S2B A;  1PNF A;  1JYV A;  4YM1 A;  5DG1 A;  5FZ9 A;  5KWR A;  3H8R A;  1I9R A;  3U10 A;  3HQX A;  2X5I B;  1HJG A;  2GNM A;  3AJY A;  4NJ4 A;  1W8T A;  1UY0 A;  1W6Q B;  5A3M A;  5GZE A;  3K4Z A;  4DO0 A;  4N53 C;  1JI6 A;  2H0B A;  5IVY A;  2RMU 3;  3U37 A;  1DQ5 A;  3K75 B;  5ACA 3;  3JZV A;  3SQO A;  4Y4R A;  5JOW A;  4XFA A;  2IVI B;  3H50 A;  5E6H A;  4H7M A;  3C7F A;  3RZZ A;  2OUH A;  4UXA A;  2JXA A;  2QQO A;  4YAR A;  1URX A;  4K40 A;  4WV8 A;  2XHK A;  1BZW A;  2JJ6 A;  3NKT A;  2Z4F A;  2KA3 A;  3T0A A;  3BPZ A;  3LKJ A;  5JIU A;  3TWI A;  1KQR A;  4XJ8 A;  5JXI A;  3NAP C;  5J48 A;  5A1A A;  4AFD A;  4NPL A;  4OUM A;  3I59 B;  1UY4 A;  5HI0 A;  2D6M A;  1RUD 1;  5FWE A;  2OPK A;  2WS9 2;  2A3W A;  1Y4W A;  1A3K A;  2ZJC A;  5LEJ A;  2UYB A;  4RD7 A;  1EPZ A;  4FBF A;  3IDB B;  3O14 A;  5IFP A;  3UJO A;  2E7Q A;  3VDD B;  1NCR B;  1OPM A;  1FOD 3;  5L9V A;  4QMA A;  2RMU 2;  5I93 A;  5EV7 A;  2E26 A;  1QJY 2;  5A7P A;  1YJK A;  3ZIW A;  1JU4 A;  4XQD A;  4CEY C;  2VPV A;  4KG8 A;  2VCB A;  1SLI A;  4D6Q A;  4FAH A;  5ACA 2;  2F17 A;  2HEW F;  2VY0 A;  3ZMN A;  5LWB A;  1AF9 A;  1LRH A;  2VBP A;  4Y1Y A;  1S0G A;  3WNX A;  1B35 B;  1G9A A;  2XL7 A;  1CAV A;  3IPV A;  3I3B A;  3KT4 A;  4I0A A;  5JCT A;  2JDP A;  3N9P A;  4CU7 A;  3VHP A;  1US2 A;  2WAA A;  3PTR B;  1RUH 1;  1DP0 A;  2YGL A;  5EYX A;  5FMB A;  3BU7 A;  2ORX A;  3MZH A;  3VBF A;  4PQQ A;  2YU1 A;  3AM2 A;  3MLJ A;  4E4H A;  5JZG A;  3O1S A;  2W39 A;  4E8C A;  2WDB A;  1O7F A;  4OHY A;  3K3O A;  1KS5 A;  2EIG A;  4PDW A;  4C0H A;  1UMH A;  1F9K A;  3ZYB A;  3D82 A;  2ZBJ A;  4AR2 A;  5FZF A;  5T5L A;  1GYK A;  3DN7 A;  3MEP A;  2D6O X;  1RGS A;  1Q43 A;  2NM1 A;  4DPN A;  5BXX A;  5IWF A;  1WLW A;  1K5M C;  1XXN A;  4AQT A;  4FXG B;  5I8T A;  3VKM A;  1OF4 A;  5B4X A;  4JV4 A;  4CUA A;  3K3N A;  1PK6 C;  3OSD A;  4P9G A;  3WF0 A;  2XJT A;  4GZ9 A;  5CAZ A;  1IS5 A;  3WQ0 A;  4JTN A;  4RGK A;  5ANN A;  1NLS A;  3SCF A;  1EPW A;  1WLT A;  4JVA A;  1AL2 3;  2JEM A;  2LAL A;  3JQW A;  2G9Z A;  3I8T A;  4MXV A;  3ACH A;  1NLQ A;  5DN2 A;  3RZG A;  1UY3 A;  2QFE A;  3GM8 A;  2Y6L A;  5LCW L;  2E51 A;  1H4G A;  3WP3 A;  3J8F 1;  3IBM A;  5T52 A;  3S57 A;  2RS1 1;  2ZOE B;  3A22 A;  4YG3 A;  1RYY A;  3O1T A;  4OZX A;  1AYM 3;  3CDZ B;  3PMS A;  1OLQ A;  2BDR A;  3MW3 A;  2LUW A;  5FUN A;  5KXC A;  3OJB A;  1UYX A;  3OGG A;  5C4W A;  3UET A;  3OGJ A;  3DPR A;  4DFS A;  3FZ3 A;  2AZ5 A;  4SBV A;  4FFG A;  4PLO A;  4O9E A;  4CEW A;  4E4Z A;  1Q8Q A;  4AHW A;  5FP9 A;  1OH3 A;  2VZV A;  5IVC A;  3C7G A;  3Q8E A;  2CGO A;  3SCH A;  1ND3 C;  1QXR A;  1T6G C;  4UF0 A;  4L2N A;  4FPC A;  2R32 A;  2WZR 1;  4Z1V A;  4ERO A;  1Z7S 1;  1F35 A;  3UNP A;  5LA1 A;  1DZR A;  1AHS A;  5FFO C;  1QY4 A;  5FZH A;  5LAS A;  4LO5 B;  4Q4V 1;  2VXR A;  3H3U A;  4AI9 A;  4BQ1 A;  5C4W B;  4AHY A;  2A1X A;  5A32 A;  3MF6 A;  1C8M 1;  1RHI 3;  2XGX A;  1T6B X;  2QQM A;  3EBR A;  3O7O A;  2ZHN A;  1PMI A;  4GWI A;  5FPB A;  3LPF A;  5A1L A;  3C8X A;  1QQP 3;  2OS2 A;  4XFI A;  1ASJ 2;  4CCC A;  4I30 A;  1NYW A;  4Y24 A;  4CCO A;  2X05 A;  5BNN B;  1WCQ A;  2OPW A;  1COV 3;  1OQ1 A;  1QJX 3;  2CSG A;  3PVN A;  4LK6 A;  1JYT A;  1JH5 A;  3PME A;  1OVS A;  2QVS B;  5FZB A;  4IV1 C;  4HN1 A;  3SLI A;  1YFU A;  3OGS A;  4NAM A;  1AYM 2;  1TG7 A;  4RGG A;  3VBR A;  4Y1U A;  2PHT A;  3A23 A;  2D5F A;  2QQN A;  5I0D A;  2PMW B;  4LBO A;  1H2K A;  3OB8 A;  1LB2 A;  3PVB B;  1VBB 1;  3MV0 1;  5BPX A;  4D69 A;  3E5Q A;  3B00 A;  2Q8D A;  4LUM A;  1AX2 A;  2ZHK A;  1OD5 A;  1QEX A;  2VZU A;  4CPB A;  2B5H A;  3WDT A;  1JN2 P;  4QPG B;  5JIA A;  4HK9 A;  4LIT A;  2NMN A;  2R04 3;  3FHQ A;  3ZYP A;  1FPN 3;  2IXH A;  4IET A;  5LBF A;  3WW4 A;  1JZ6 A;  4H7L A;  4QD2 A;  3VBR B;  2QQL A;  2VEC A;  2JWP A;  3RI9 A;  3HMY A;  4XJ9 A;  3U4X A;  2VTF A;  3R0R A;  4R8H A;  3CBN A;  3E5U A;  1V70 A;  1LR5 A;  4IQP A;  1HXS 3;  3WF4 A;  5J09 A;  1MZE A;  1RHI 2;  4YG6 A;  1ULE A;  4WVM A;  3NW4 A;  1W2U A;  4G3Y C;  1MEC 2;  1QQP 2;  4K7J A;  1RUG 1;  2BRT A;  5LEK A;  3E6D A;  3AKP A;  3OD4 A;  4GWJ A;  4F7Z A;  2V09 A;  4WZC A;  4DUW A;  1R08 1;  4Y20 B;  2X5I C;  5JXH A;  1COV 2;  1ZYB A;  1J83 A;  1DF0 A;  1QJX 2;  1RVF 3;  1UF2 C;  2VQA A;  4HLT A;  4UYB A;  3U75 A;  3GNE A;  3H8X A;  1GZ9 A;  1BJQ A;  3DXT A;  4WVM B;  2PXJ A;  4QKN A;  2OZ6 A;  4AZZ A;  3URF A;  2QBX A;  1ACC A;  3KV6 A;  3ZXF A;  1SLC A;  5L7O B;  1CAU B;  4K1Z A;  1AR6 1;  1NY7 2;  3N9L A;  1Q8P A;  5DUV A;  4Q1R A;  5FPU A;  4Q8L A;  1W28 A;  2NPI A;  1EUT A;  4N9I A;  4A6O A;  5AFB A;  5J7M A;  2J42 A;  1O4T A;  2WZE A;  3PUA A;  4E2S A;  2HWD 1;  3T0D A;  3EYP A;  4DXT A;  3B94 A;  4XDQ A;  2R04 2;  2ZEZ A;  3MFC A;  1FPN 2;  3RSJ A;  2YRO A;  1STM A;  2R0H A;  2NN8 A;  1ULP A;  3U14 A;  4KI5 M;  5C8C A;  1JMU B;  4V2W A;  3ZOI A;  1HRV 1;  5IFT A;  1HXS 2;  5GLW A;  4M00 A;  5G05 L;  1DZT A;  5KXD A;  1XPW A;  2JEN A;  4YRD A;  2YUE A;  2Q8O A;  1PO2 1;  1FV2 A;  2WLQ A;  3WG2 A;  5FKB A;  1Q8V A;  5A6Z A;  1WW4 A;  5CKN A;  1BK1 A;  2D97 A;  2Q4S A;  2WO3 A;  4XAA A;  3WHT A;  4AEM A;  2CL2 A;  4CVU A;  3KHB A;  2RR1 1;  4TWT A;  4FAG A;  5T5O A;  4BU2 A;  2W91 A;  4LO6 B;  3VZO A;  4P9J A;  4CDW B;  4XOG A;  5GLU A;  5C8C B;  2VME A;  4AI0 A;  1RVF 2;  4GJZ A;  2Y6F A;  2BER A;  2LTN A;  4PCR A;  2JE8 A;  4COW A;  1SHW B;  5CAD A;  3VDD C;  1NCR C;  2ZCW A;  5IAV A;  3WUD A;  4E2Q A;  1QWR A;  5B4N A;  2A70 A;  3MIH A;  3NV3 A;  4CXX A;  1EUU A;  2EF6 A;  2Q0A A;  4FPF A;  4K9S A;  4CDX B;  5IW0 A;  3BIE A;  1JYW A;  1VRH 1;  2BW8 A;  1TQ5 A;  2IXC A;  1SFN A;  3MBW A;  4GMP 3;  1S0D A;  5F3C A;  4MHU A;  4QQP A;  1BQP A;  3ATG A;  2DVF A;  1GZT A;  1W2T A;  1JYN A;  3U1X A;  1B35 C;  3T1L A;  1CJP A;  2VOT A;  3OBZ A;  1TNR A;  2JE7 A;  5LY1 A;  4QQO A;  4FI9 A;  4LA2 A;  3WDY A;  5DMY A;  1BEV 3;  1TME 2;  1YIF A;  1TMF 1;  1WCU A;  1KDM A;  1POQ A;  1UAI A;  3I49 A;  3KT1 A;  1TE1 B;  2HBT A;  1OA2 A;  2ZGQ A;  3PIJ A;  4P9L A;  3ZSK A;  1E5R A;  4Y1V A;  2O8Q A;  3DYM A;  3KS7 A;  2VZQ A;  3SKV A;  2QDR A;  4CCL A;  4DXR A;  4DUX A;  4RHV 2;  4ZS3 A;  4W50 A;  3GGL A;  4UW4 A;  5FRA A;  2Q30 A;  4CDU A;  4AAP A;  3S5A A;  2CAU A;  2P34 A;  4DIQ A;  4BE3 A;  1O5L A;  3QAC A;  1WMX A;  4NR1 A;  5I0T A;  1W8F A;  2VBB A;  2VU9 A;  1HKD A;  3ZR5 A;  4BXF A;  3N3H A;  4QX7 A;  4XUT A;  4NPM A;  2VGD A;  2YDE A;  5A7W B;  4FOV A;  2HWE 1;  1CN1 A;  4PIX A;  4RR3 A;  4ATE A;  5EJZ B;  2JIJ A;  1AL0 G;  3U11 A;  1W06 A;  4CP0 A;  4CDU B;  4AFA A;  3MUZ 1;  3M3C A;  1O3S A;  2E33 A;  2PHL A;  4SLI A;  3WW2 A;  2VNG A;  4AVS A;  4Y26 A;  3NQH A;  1UOF A;  2VQT A;  4XUP A;  2UYA A;  4XXA A;  3T2P A;  1K45 A;  1BEV 2;  1WLD A;  2GNT A;  2PHU A;  2NLR A;  1CAX A;  3I2H A;  1FAT A;  3H3L A;  4HET A;  3LAG A;  3RYP A;  3POG A;  5FP3 A;  4MGY E;  1BHG A;  2XDV A;  1MR5 A;  2WO1 A;  3SIS A;  4CPB D;  3WQB A;  4CDQ A;  1LED A;  3CQO A;  3OEA A;  4KGG A;  4U2A A;  1J3R A;  1U5I A;  4FPG A;  3I2D A;  2ZTN A;  3P6B A;  5FZD A;  5DAQ A;  3ZXD A;  2DDU A;  1VBA 3;  1UKG A;  5E8A A;  5LA2 A;  4XTM A;  2GC2 A;  1OOP A;  4P5H A;  1YHF A;  2J1T A;  1MQT B;  5H9S A;  3AZX A;  4QX0 A;  3IB3 A;  2WWJ A;  3AFK A;  2A71 A;  5A1F A;  5C4W C;  2BPA 2;  1VB4 A;  2WQZ C;  1DDL A;  3ZDS A;  4MET A;  3POE A;  5FZL A;  5A3W A;  1GSL A;  1LOG A;  1V00 A;  2IC1 A;  3KWV A;  4WVV A;  5F6L B;  3HNB M;  2J1E A;  3NRU A;  4FP2 A;  4K8F A;  1C1L A;  5BNP A;  1IS4 A;  5FLJ A;  2FDG A;  4UBH A;  1ZRI A;  1UXX X;  4XFC A;  1W05 A;  5CB7 A;  2V5D A;  1VAK A;  5BNN C;  3WV6 A;  4HKW A;  1BBT 1;  3ROU A;  4DNY A;  4R4X A;  5FQ0 B;  1W04 A;  2C6S A;  1OUS A;  4BQ2 A;  3JD7 1;  1HX6 A;  1X7N A;  1ZNP A;  2BP6 A;  1S2K A;  4QX1 A;  4NII A;  5BNP B;  3MID A;  1N1T A;  1XE8 A;  1QJF A;  1NZI A;  2HLE A;  4JC1 A;  5JOY A;  1V6K A;  5C6C A;  2XJS A;  2CAV A;  2EVX A;  2YXS A;  1VMF A;  3DKW A;  4XAB A;  1F8V A;  1DLC A;  4JX0 A;  5F5C A;  1YJL A;  4IV3 A;  3POF A;  2ORZ A;  4QPG C;  1VBA 2;  1ODN A;  3AC0 A;  3HNY M;  4Q0V A;  1I1E A;  1JYI A;  2YC0 A;  3BGA A;  1R09 2;  3U07 A;  3MO4 A;  4ZPI A;  3NJV A;  3WDW A;  2Y60 A;  3VBR C;  3H8O A;  2Y0O A;  4PF5 A;  1BKZ A;  2P3J A;  4KNC A;  1YI7 A;  2WNE A;  3H7Y A;  3ZYR A;  4AAX A;  4Q4W 3;  4B29 A;  5A7Q A;  4A42 A;  2QQJ A;  2ES3 A;  4F3J A;  2Y6K A;  2FDK A;  2SLI A;  1AR9 3;  1HN1 A;  2DVB A;  4IV3 B;  4YVS B;  3MDP A;  4UI9 L;  1DQ0 A;  1GZW B;  3VLB B;  2WJS A;  3J4U H;  3MI8 A;  2QKD A;  1GP6 A;  3OG2 A;  4N53 A;  2MEV 3;  4YSF A;  4XE9 A;  4IGQ A;  4MZU A;  4XMA A;  1FMD 3;  2ZKL A;  3BTZ A;  2IXI A;  4A7Y A;  2KR2 A;  3WT3 A;  2F4L A;  4M0N A;  4XPV A;  5H9R A;  5EPA A;  4AXO A;  1H4H A;  2B4K A;  1AJO A;  2ILM A;  5L7O C;  1REE A;  3HQR A;  2LRO A;  1Q5O A;  3FHA A;  1SDD B;  1RB8 G;  3WW1 A;  1XNB A;  1AR7 2;  5LY2 A;  4MUV A;  4WBB A;  3ST7 A;  2P6H A;  3WIN E;  4AYU A;  3R4D B;  4AWD A;  4JRL A;  4FFI A;  3E6B A;  3WQ1 A;  3VD4 A;  2EA7 A;  1YQ5 A;  3NAP A;  3AYD A;  5FZ0 A;  2XJP A;  3NMB A;  1SZB A;  3NV1 A;  4IND A;  4BQ4 A;  2GNB A;  4NIH A;  2BOJ A;  4Q4W 2;  1EAH 1;  2D98 A;  3M3E A;  5EP9 A;  5FCC A;  2GSY A;  5LBE A;  1AR9 2;  3PNA A;  1C8N A;  1DU3 D;  2NMO A;  1GR3 A;  2C4X A;  2Z2S B;  3BIW E;  3OUI A;  4L92 A;  5A80 A;  4OUS A;  1MS9 A;  5CIS A;  4QKD A;  2R49 A;  2MEV 2;  4CDW C;  5C8C C;  4CU6 A;  5CU1 A;  2FZ2 A;  3AKQ A;  1FMD 2;  3THD A;  4CEY A;  1QDO A;  1KIT A;  1S0I A;  3PU3 A;  3AB0 A;  3CJI B;  4IL7 A;  5DAW A;  3H9A A;  4HKL A;  3B01 A;  2HWB 1;  5FZE A;  1LGC A;  2AR6 A;  4XQ4 A;  5K4L A;  1ZBA 3;  3FE5 A;  5C7G A;  3I2K A;  2ZS6 B;  5CG9 A;  1W6O A;  2EIB A;  4NHM A;  1W9S A;  3O12 A;  1GBG A;  1IG0 A;  4NWV A;  3WP6 A;  3E97 A;  5FYH A;  1RXF A;  4LUL A;  4AVV A;  3RZH A;  1OFS A;  4TTG A;  5FLI A;  2BGP A;  1HB3 A;  1Y9M A;  4FPK A;  1S0J A;  5LBB A;  4BQ5 A;  2ZX3 A;  1RUD 3;  3V65 A;  1IS6 A;  3PDQ A;  1DLL A;  2IXJ A;  2AGS A;  4OZO A;  4QXK A;  5FJK A;  1ZRF A;  3HJR A;  1QNW A;  5FMC A;  3LB9 A;  1CD3 G;  1QDC A;  1AYN 1;  2BZD A;  3P3P A;  4QDS A;  4Q29 A;  2VUL A;  2QQK A;  1SLB A;  5FZ1 A;  3V0B A;  2CGP A;  4LIU A;  5FO7 B;  3KMH A;  1OI6 A;  4IE6 A;  4YGB A;  4KG0 A;  1AJK A;  4LTA A;  5C3P A;  1X36 A;  3ZM8 A;  2WAO A;  1UZV A;  2Y6J A;  1LEM A;  3ZMO A;  5FPX A;  1DBN A;  1JUI A;  2D5H A;  4LE4 A;  3OTF A;  2D3P A;  2Z69 A;  2ZGO A;  2CTV A;  5F3I A;  4MH0 E;  5IK8 A;  4H3W A;  1RUH 3;  1ZBA 2;  3LEK A;  5C8W A;  2B9U A;  5JOX A;  1VBC 1;  1X50 A;  2RV9 A;  2TUN A;  1H1A A;  4CDU C;  3DEC A;  4LJH A;  3M3Q A;  3BUC A;  1JYC A;  2DWR A;  3RGB A;  4MG2 A;  3QH6 A;  2ZGM A;  1RIN A;  2AEN A;  5A7N A;  1RUD 2;  1HJF A;  4MX3 A;  1HB4 A;  4QQL A;  4Y3O A;  3DYO A;  3OEB A;  5L9R A;  1GWL A;  1OQE A;  3KCY A;  3H3Z A;  3ZSJ A;  2XJU A;  5ISL A;  5A6X A;  4M4R A;  3ZFF B;  3A0K A;  4LXL A;  2BNO A;  2WC2 A;  5FP8 A;  5CG8 A;  3ZSL A;  2RM2 1;  3B3Q E;  5C3S A;  5L19 A;  3FMG A;  2DV9 A;  5HXM A;  1V9U 1;  1W39 A;  3B69 A;  4QGM A;  1EV1 1;  3V56 A;  2XWB B;  4PF1 A;  2V5Y A;  1SQ4 A;  4JQT A;  1XNA A;  5H9P A;  2VMH A;  3CHX A;  3TN9 1;  4Q26 A;  1RUH 2;  3H1M A;  5FXW A;  1MQT C;  1NE6 A;  2A6W A;  3PL0 A;  1D4M 1;  5FJH A;  1WCD J;  5I91 A;  2WT1 A;  4DOU A;  1XNC A;  1NE4 A;  2G19 A;  2QQI A;  3AMP A;  2GAU A;  4Y5Z 0;  5GZC A;  3V0A A;  3J8F 3;  4FCA A;  4HT1 T;  4JAA A;  2RS1 3;  4X8N A;  4OFG A;  1XJA A;  2PAM A;  3GBF A;  3LFI A;  1LOC A;  2X8K A;  4GAZ A;  5HBA A;  1RL3 A;  4ASM B;  3WDX A;  1VLN A;  4IV1 A;  4OYU A;  4EN0 A;  1F15 A;  3VKO A;  3VDB A;  3KLS A;  1IZ3 A;  1DZQ A;  4HON A;  4I02 A;  2AEY A;  5JI7 A;  3KB5 A;  3FWE A;  1NKG A;  3V0A B;  2E63 A;  2XLG A;  4AQ2 A;  2WZR 3;  2G9F A;  2WSU A;  3WX5 A;  5HV0 A;  1Z7S 3;  5CIR A;  5JOZ A;  5DDJ 1;  1JOD A;  4RFR B;  3M3O A;  5BNP C;  4MGQ A;  1WCS A;  4Q4V 3;  3USU B;  2HEY F;  3POS A;  4PIZ A;  2YC2 A;  3H1W A;  3VZM A;  3IIA A;  2IWG B;  1DGL A;  2GC3 A;  1C8M 3;  3LCP A;  4Q5O A;  2C24 A;  3G6J B;  1JS9 A;  1US3 A;  1FX5 A;  2K46 A;  2YC4 A;  5GLT A;  4HPK A;  1VB2 A;  4Y5T A;  1JXN A;  5FR3 A;  1GOH A;  1X8M A;  3Q9O A;  1MPX A;  5L36 A;  4UT5 A;  2OVU A;  2VVE A;  1HLC A;  1W0P A;  4LBQ D;  2EIE A;  1O3T A;  2Z42 A;  2XON A;  1GWK A;  2GH8 A;  2J22 A;  3J8F 2;  2RS1 2;  2J1R A;  2W3J A;  5FYB A;  3RWK X;  3HVD A;  4DMI A;  2C1F A;  1QOS A;  1S0C A;  4IV3 C;  3S5Q A;  2X5I A;  2J1V A;  5FZ8 A;  5JSP A;  1X82 A;  4YVS C;  1W8O A;  2VD7 A;  3MIB A;  1VBB 3;  2VNV A;  3ACF A;  3ZXL A;  5FK8 A;  2Y34 A;  3UV9 A;  1RUO A;  1L7R A;  5KC5 A;  4PIY A;  2GND A;  3O0X A;  3S30 A;  3KF3 A;  5AC9 1;  4XJA A;  1TEI A;  3LA7 A;  2JB8 A;  2WZR 2;  4PQ9 A;  2WS9 3;  3MPP G;  5KHG A;  1UWW A;  1Z7S 2;  2UWC A;  3LA3 A;  4XZP A;  1U5X A;  3ETQ A;  4YPJ A;  1LOA A;  3GZE A;  4Q4V 2;  4B4Q A;  3WDV A;  5HXV A;  3O1P A;  2ADD A;  1C8M 2;  1RC6 A;  2ZAH A;  4M3C E;  2B46 X;  3HN1 A;  4CCK A;  1IS3 A;  1WMD A;  1QJY 3;  4AK3 A;  3M1H A;  5IT6 A;  4R4Z A;  4BK4 A;  1O6U A;  2HBU A;  3RG0 A;  2PEL A;  5CEH A;  5CFD B;  4Q8K A;  4AQ6 A;  1E5I A;  2UY9 A;  1NLR A;  3JB4 C;  1GV9 A;  1R08 3;  1YEW A;  1JU3 A;  5FMO S;  4A44 A;  2WLP A;  3ABZ A;  3I59 A;  4P14 A;  4YLZ A;  3VDA A;  1GNH A;  3GZT B;  4AVA A;  5C33 A;  5LK7 B;  2L9L A;  5FZK A;  4A41 A;  1PM7 A;  3A4U A;  1CZV A;  1WW5 A;  5A70 A;  3GJA A;  2WL1 A;  1CZS A;  1PMJ X;  1RUE 1;  1VP6 A;  1W9T A;  2GZW A;  3B9I A;  4HN0 A;  2O0O A;  1MS3 A;  1XRU A;  1VBB 2;  3IAP A;  4AVT A;  4KU7 A;  4LEJ A;  4N7U A;  4ZON A;  3K4A A;  3LQC A;  1HRI 1;  3ILN A;  1NCR A;  1W6M B;  2HEV F;  2TBV A;  2WYS A;  1QH6 A;  1RTV A;  3CMG A;  1HDK A;  3LZZ A;  2OXB A;  2A7A A;  4P08 A;  4QXB A;  3AKR A;  5DUX A;  3VBO B;  3HNM A;  2XB6 C;  3AZW A;  2HWD 3;  4YW5 A;  3WG1 A;  3OCP A;  4AGV A;  4QB2 A;  3CJI C;  1QU0 A;  4Z92 B;  5F5I A;  5I0R A;  3NNJ A;  2CDP A;  3IT8 A;  1GNY A;  1SLL A;  1AR8 3;  1NCQ B;  4M3C B;  1I3H A;  1DYP A;  5A3T A;  2ENR A;  1HRV 3;  1B35 A;  2EIC A;  1HQW A;  2ZKN A;  5FXV A;  4DB5 A;  1C1F A;  4J25 A;  4FT8 A;  3IZO A;  4DEQ A;  5HPO A;  3ACI A;  1BVV A;  4UFM A;  1GU3 A;  2ZGR A;  1CVN A;  1PO2 3;  4EN8 B;  3RZL A;  4L8Q A;  5FZI A;  1ZRE A;  2QQV A;  2SBA A;  4Q4Y 1;  2MNG A;  3I3E A;  2RR1 3;  2WO7 A;  3I4I A;  4UW3 A;  1R08 2;  5FY7 A;  1AZD A;  4L99 A;  3S0M A;  1OBN A;  4H55 A;  4NRQ A;  2ARC A;  3SEE A;  3SNM A;  2JDK A;  2VMG A;  2B42 B;  4BPZ A;  5IK5 A;  2WSV A;  4LKD A;  4O61 A;  1G7Y A;  4GMP 0;  5DG2 A;  4OHZ A;  1UMI A;  1CX1 A;  4URT A;  1YIP A;  2GC1 A;  3VB9 A;  1ALY A;  4MGK E;  5FUP A;  4CCN A;  5A3L A;  1O3R A;  3CL1 A;  3K46 A;  3D4K A;  2HWD 2;  2RS3 1;  1CPN A;  1HW5 A;  2ZEY A;  4CUC A;  3ZIX A;  4XZU G;  5JSR A;  3ENR A;  1S0F A;  1AR8 2;  1SFP A;  3RPQ A;  1UYY A;  4FPH A;  4YGE A;  3FUQ A;  1HRV 2;  1UOB A;  4EWD A;  5A6Q A;  1RUI 1;  1H9W A;  2RJK A;  3C7E A;  2E32 A;  4S2D A;  4UAP A;  5IK4 A;  1F31 A;  2WQ8 A;  5HCA A;  2VZS A;  4LLO A;  1PO2 2;  2X53 S;  3BVC A;  4Z07 A;  1VBD 1;  2VMF A;  5FZA A;  4LOS A;  4BJ0 A;  5KHI A;  5HCH A;  2RR1 2;  2PTM A;  1DQ2 A;  2E7A A;  2P4E A;  3KGZ A;  4MV2 A;  4XBL A;  4KBB A;  3RYR A;  4QPI B;  4DS0 A;  4LKF A;  4PI2 A;  5DAB A;  4ASL A;  4BYY A;  1LGN A;  1QJU 1;  2JG8 A;  3ZFF C;  2FMY A;  3OY8 B;  1ASJ 3;  3MFA A;  4N8M A;  1PM4 A;  1PX4 A;  4PLN A;  4YWA A;  1G8W A;  1ZBE 1;  1LJ7 A;  3T08 A;  3IMM A;  4A6S A;  3K2O A;  5KXB A;  1J1T A;  1H9P A;  4BLI A;  5JI9 A;  2ARE A;  5A33 B;  1NT0 A;  5BNO B;  3E1F 1;  4KWK A;  5FZ4 A;  4BOW A;  2FHR A;  1UU4 A;  4M3C F;  1ONA A;  3GCW A;  3UKN A;  4AW7 A;  1K42 A;  2JG8 B;  1SEF A;  3O1R A;  4ZU4 A;  2XLF A;  2YG0 A;  1WW6 A;  4E2G A;  4E9K A;  1Y43 B;  1TMF 2;  1LEC A;  2Y6H A;  1ZRD A;  1EYB A;  1YWK A;  3N7L A;  2F4P A;  5FMO L;  1NQJ A;  2PLV 1;  3OUJ A;  2WA3 A;  4GJY A;  5EYY A;  1RUC 1;  3K77 A;  1JOB A;  5BNN A;  1BMV 1;  3L2Y A;  1OKQ A;  1WMF A;  1XND A;  3RDI A;  4P9W A;  1AX0 A;  2BU9 A;  3TNP B;  2W1U A;  1CWP A;  4LO7 A;  3T30 A;  3WR0 A;  3LEM A;  2P3K A;  2YYO A;  3TBD A;  1TVG A;  2CYF A;  4NRM A;  3FLR A;  3FHI B;  4GB3 1;  1MEC 3;  4KQ7 A;  3VUO A;  2W52 A;  1WD4 A;  4AL9 A;  1LU1 A;  4IE0 A;  4YYO A;  1YLL A;  1VJ2 A;  3FL7 A;  3VL8 A;  2HWE 2;  5GLZ A;  2V72 A;  4FTS A;  1SG3 A;  4MGZ E;  1YXW A;  4QPG A;  3HN3 A;  1ZRC A;  3F2Z A;  4TLF A;  1ENS A;  1B09 A;  4IDZ A;  1KJR A;  1L7L A;  4O65 A;  4XCB A;  4YG0 A;  3N35 A;  1HQN A;  5ERL A;  2PHF A;  4DY5 A;  2WUH A;  4HAN A;  3BTY A;  5FYV A;  2GN7 A;  2JEC A;  4CZS A;  3LIG A;  1ZZB A;  3FUO A;  4JGY B;  1BBT 3;  2D6P A;  2GP3 A;  4OQ9 A;  4XMI A;  2PYT A;  3AZV A;  2AEZ A;  1UCX A;  2ZX0 A;  2VH9 A;  5FZ7 A;  3FBY A;  1KGY A;  3JD7 3;  1LOF C;  2AYH A;  5JPN B;  1LOB A;  3L2H A;  3ON7 A;  5LZ6 A;  4FVV A;  1JZ5 A;  4OQ8 A;  3KSC A;  4N43 B;  1G6N A;  4Y20 A;  4OHX A;  5FZC A;  2H6B A;  2VW2 A;  3LWC A;  3PJY A;  2YBK A;  3JQX A;  3CKH A;  1S0B A;  2QJV A;  4GWM A;  4NN0 A;  4ZS2 A;  5LA9 A;  4AI3 A;  2RDR A;  5IYY A;  5AVA A;  5L7O A;  1CAU A;  5FLH A;  2GH2 A;  2JIC A;  1V6M A;  4ES8 A;  5A3U A;  2GP5 A;  3KCX A;  1QNY A;  5FZO B;  2WII B;  5F5A A;  4IUG A;  3KV9 A;  3ZSE A;  5IAT A;  3GF6 A;  1S4C A;  4GAL A;  4XF9 A; 
#chains in the Genus database with same CATH homology
 2O14 A;  2LRP A;  1W8Z A;  1UOJ A;  1V0A A;  1HN0 A;  4YW7 A;  3UT0 A;  4AL9 A;  2JWP A;  2LRO A;  1GWK A;  1WCU A;  4LJH A;  2WYF A;  4BQ2 A;  3ZYF A;  4LKD A;  1OH3 A;  1W90 A;  4LK6 A;  4CP9 B;  5D21 A;  1L7L A;  4LKF A;  1GWM A;  1W8W A;  1GWL A;  4CPB D;  4BQ4 A;  3F95 A;  2C24 A;  1WZX A;  4LK7 A;  1OKO A;  3ZYB A;  2Q1F A;  4YWA A;  1WMX A;  4BQ5 A;  4YW6 A;  4CPB A;  2KR2 A;  2K46 A;  4A6S A;  4CP9 A;  4LKE A;  1W8T A;  3ORJ A;  3ZYH A;  4BQ3 A;  1W9F A;  2VXJ A;  1W8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...