4XFFA

Cysteine dioxygenase variant - y157f at ph 6.2 with dithionite
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xffA00
4ZU4A 5FLJA 3SCGA 4BH9A 1CAWA 4IEVA 1LB2A 1ZRFA 3CF6E 2P17A 1O3QA 3C3VA 2D5FA 2CAUA 4AQ6A 4HN0A 3WW2A 4E2GA 1ZZ6A 3UKVA 3B02A 4AXOA 4I02A 4YARA 5K8SA 3H3UA 2UY9A 3H1WA 4XETA 4Z07A 2GC3A 4PIZA 4F8AA 1CAWB 1ZNPA 4RD7A 5I93A 1ZZ9A 4JTNA 2UY8A 1Y3TA 2CAVA 5E16A 3E6CC 2QJVA 4HZFA 4J1WA 2VPVA 3O14A 4MGKE 3HT2A 1FI2A 4XF4A 1OD5A 4LEJA 3CEWA 1O5LA 1QXRA 2ZKLA 3E6DA 3QACA 4PIXA 3EQEA 3DL3A 3IBMA 5KHJA 1TQ5A 4YNIA 3ES1A 5JSPA 4HVOA 5LEKA 2OZJA 3EBRA 5FDBA 1OMIA 3EHKA 4IEXA 1YFXA 1ZZBA 3QOPA 1O3SA 2C0ZA 4I0BA 2UYAA 1U12A 1XE7A 3S0MA 4HVRA 4CYDA 4MGZE 3I7DA 4GULA 4XFBA 3HQXA 4HN1A 2EAAA 4R8HA 2QCSB 3M3IA 1ZX5A 5I0UA 2BNOA 4I3PA 3LWCA 3PNAA 2GC0A 4J1XA 3ELNA 4PJYA 3BB6A 1RC6A 1FT9A 3LA2A 3H50A 2GU9A 3CLPA 4XF1A 3KMHA 1EYBA 3USSA 4AVBA 2B5HA 4P9GA 2Y0OA 4MV2A 5EFUA 4MZUA 4EWAA 1SFNA 5LRSA 2QDRA 2GC1A 3M70A 2IXLA 4Q0VA 3NL1A 5EZWA 3I59A 2O8QA 2XLGA 2ETEA 1RL3A 4Q29A 4MGIE 3OF1A 4I01A 1ZREA 5BPXA 5FLHA 3S7EA 1DZRA 4IEUA 4A2UA 3FE5A 4AQ2A 1H1IA 4HLTA 4E2SA 1NZCA 3GYDA 2BEOA 4EV0A 3PLQA 1YUDA 3I59B 3G7DA 5J3UA 3OCPA 1O4TA 1J59A 2GC2A 4META 3FZ3A 1J58A 4QX5A 4AVAA 2OA2A 1IPJA 1L3JA 1CAXA 1LRHA 5I91A 2N7GA 2Q0AA 3NJZA 4IETA 3D0JA 3IIAA 3OD0A 4KWKA 3MDPA 4QMAA 3N4MA 4YSFA 2B8MA 4LTAA 4I2OA 3LAGA 2GAUA 2K0GA 4N9IA 2EVXA 3SCFA 3SCHA 1X82A 3IDCB 3ETQA 4WZCA 3UKTA 1YFYA 3MYXA 3ROUA 4UXAA 1PMIA 2H6BA 5JAXA 1CAXB 4BYYA 2PQQA 1NXMA 1RUNA 4HSJA 1DGRA 5FQ0A 4WBBA 1UPIA 3E5QA 2IXKA 4I09A 4IEPA 3R6SA 2OZ6A 2BNNA 3OTFA 3LOIA 4IEQA 3HIFA 1UCXA 3D0SA 3RYRA 2FQPA 5I0TA 4LULA 4IERA 2V09A 4LA2A 5J48A 5FQ0B 2IXHA 1OI6A 4IEWA 4XF9A 4XF0A 3RDIA 3RZZA 2BNMA 1ZRCA 4XFFA 4K8FA 5FLIA 1ZZ7A 2HKXA 3NW4A 3L2HA 2XGXA 3SXWA 3WW4A 5I8TA 1Y9QA 2XKOA 4X6RB 1NE4A 1G6NA 2GH2A 2IC1A 4FT8A 2Q1ZB 3E5UA 1QY4A 3H1MA 1I6XA 1O7FA 3WW3A 3LZZA 4TLFA 3LA3A 2XL9A 4WVZA 2PFWA 4Q0SA 5JSOA 1Q43A 1WGPA 2VECA 4FBFA 2XHKA 4BIFA 2E9QA 4BHPA 1QWRA 1J3QA 3D82A 5FPZA 2XLFA 4IEOA 3KSCA 4JVAA 3TNQA 1VR3A 5F1RA 1EY2A 5I8SA 3H8UA 1UIJA 2MPFA 2UYBA 4QM8A 4HMZA 3E5XA 2QVSB 3JZVA 5KHGA 5C8WA 4HSLA 1GQGA 3KGLA 1EPZA 2KXLA 4ONUA 5JSRA 2PTMA 2PAKA 1WA4A 4JTOA 1O5UA 4OFGA 4HBNA 4QGLA 1EP0A 3BCWA 4LUKA 4QGNA 5C6CA 1ZVFA 4XFAA 1ZRRA 4N9HA 2ET7A 4QM9A 1CAVA 2HJIA 3S7IA 1LR5A 5HI0A 1ZRDA 4OLLA 2H6CA 4DINB 3KCCA 1J3RA 1O3TA 4Q0QA 5KHHA 1RUOA 1NE6A 4Q0PA 4IESA 5CADA 5E1RA 1LKNA 3E97A 4IEZA 4XFCA 4KWLA 1ZZCA 3DN7A 1CAVB 4L2NA 4ZU7A 1SEFA 1IPKA 1WLTA 3MZHA 3UKNA 2MNGA 4D7SA 5BXXA 4XF3A 2B9UA 1CGPA 3KGZA 4UBHA 2I45A 2XKPA 3I54A 4IEYA 4MX3A 4PIYA 2MHFA 1YLLA 1J1LA 1RTVA 1HW5A 4R52A 3VHRA 4XFGA 3FX3A 2FMYA 3PVBB 4O9EA 3LA7A 3U11A 3HT1A 4MH0E 3WW1A 1X8EA 2Z69A 2D93A 4L11A 3ST7A 1QXJA 3H7JA 3H3ZA 1FXZA 3FHIB 4LA3A 2BGCA 1V70A 3CO2A 2Z2SB 1VJ2A 3IDBB 5I0RA 5BV6A 3BPZA 1O3RA 4D7TA 2OYZA 2GZWA 2IXCA 2H0VA 1XRUA 4LUMA 3OGJA 2OPKA 2Q30A 1JUHA 1YHFA 4KU8A 3RNSA 1J3PA 5KHKA 2ATFA 2IXIA 4AVCA 3EJKA 4X6QB 3IWZA 1UW8A 1DGWA 3SMHA 5LEJA 2ZCWA 2CV6A 4UBGA 3SHRA 4Z82A 4EROA 4JV4A 1NYWA 2D5HA 5BUVA 4E2QA 3DV8A 1VP6A 3BALA 1Q3EA 4MGYE 1DZTA 3CL1A 5KHIA 1XE8A 4FAHA 5FPXA 4O9GA 1X7NA 5BY5A 1CAUA 3BU7A 3U0ZA 2DCTA 3GBFA 3RYKA 2D40A 1GQHA 4YRDA 1I5ZA 1YFWA 3EO6A 4KWJA 5D1IA 3ZDSA 3U10A 3RPQA 4XFHA 3TNPB 4B29A 1CAUB 2F4PA 2ET1A 2PHLA 3H7YA 3FWEA 1Q5OA 2CGPA 1ZZ8A 4XEZA 3DKWA 4YYOA 4EWDA 2XL7A 4I0AA 4QGMA 4LLOA 2PA7A 5JCTA 5CVRA 2EA7A 4ORFA 2IXJA 4XFIA 3NKTA 1PM7A 5LRRA 4MUVA 4KL1A 1H1MA 3NSTA 5T3NA 3ES4A 1UD1A 4NVPA 2XLAA 4HVQA 3E6BA 4FAGA 5AVPA 3NVCA 3H1YA 4Q0UA 2PAEA 2Q4SA 2O1QA 2PYTA 2WC2A 3ACLA 5CU1A 3MPBA 4QXKA 2QNKA 4KU7A 3RYPA 2K9ZA 3FFQA 5KBFA 2BYVE 1X8MA 2PAMA 4ZU5A 1YWKA 2PHDA 2WFPA 4H7LA 5I8YA 2VQAA 3FJSA 5J7MA 1CX4A 1YFUA 4EWEA 5I0SA 3CJXA 5JR7B 4F7ZA 1RGSA 1OFNA 3H9AA 1SQ4A 5FCCA 1UIKA
chains in the Genus database with same CATH superfamily
4ZU4A 3SCGA 1R081 2EALA 2GNDA 3B9CA 3T08A 1S55A 5IHRA 1OOPA 2NYYA 1LEDA 1H2LA 4NHMA 5L7OB 4Q4V3 1JZ5A 1H1AA 1REDA 1V6OA 2V72A 1F15A 3PTRB 2BOJA 3UESA 1ZRFA 1V6KA 1CIWA 3CF6E 3MF6A 5LCWL 2P17A 5A6XA 1PIV3 3RG0A 3U78A 3C3VA 3BOWA 1AR81 1V6MA 4AQ6A 2TBVA 3AMQA 4BQ2A 2NPIA 2VZRA 3R4SA 4BQ1A 5DMYA 4E2GA 5K9YA 1AR72 2A6YA 1WW7A 4LE3A 3P1IA 2J1TA 3HEIA 2E6VA 3V0BB 1OFSA 2YY1A 4GA9A 4L8QA 1N3OA 1AR73 3H3UA 3ZFGB 5K8SA 3HNMA 3JU9A 5L7OC 2HWE1 2ERFA 4Z07A 3VBSA 3O1SA 1W8NA 4NN0A 2ZGUA 1NCRA 4AI0A 3OOXA 1ZNPA 1M06G 2HYXA 4KG0A 1SDWA 3LF7A 4FPHA 1HX6A 2BVBA 4FPLA 1ZZ9A 3VD7A 3T09A 2YC2A 5I93A 5BNOB 1WBLA 2VMHA 5JXIA 3RZMA 1W2UA 2X5IB 3UK9A 2ZEXA 2RE9A 3TEZA 2DV9A 4LJHA 2VPVA 4OMDA 3U37A 1MS9A 5FAXA 5A3UA 5EYYA 3N7MA 1FI2A 5CEHA 4XURA 5IVCA 2SLIA 2C24A 5FMCA 2ZKLA 3LDRA 1W2TA 5BNOC 2XHNA 1LGCA 2Q8DA 2X5IC 3U4XA 2J7MA 5FZHA 2HWC2 4N43B 4XQ4A 2ZHLA 5DXDA 4H14A 4HVOA 2HWC3 5F9TA 5CNAA 2OZJA 3VDAA 1X9TA 1RVF2 3N36A 2JDUA 4GB32 1KS5A 4ZONA 3BODA 3K2OA 3N9PA 3RI9A 2BGPA 2EICA 4GB33 2YPDA 1SMVA 1O3SA 4N43C 4IGPA 2P2KA 5FUNA 1JW6A 1PX3A 2TUNA 1ULCA 2Y6GA 2WKKA 2UYAA 3UNPA 1U12A 3B3QE 4UFIA 5EJ3A 4HOOA 4NHXA 2RDRA 2CWSA 3ZSMA 4FPOB 4XFBA 1ASJ2 5HV0A 2JDMA 4NR1A 4GKXA 4NROA 2EAAA 2D6PA 3VHNA 4AEMA 5FMOL 2EAKA 3AMMA 3U14A 1K3IA 5A32A 4MLOA 2DBIA 1OT5A 2QQNA 2P37A 2AEYA 4WM8A 4I3PA 1BMV1 2FCUA 3WNPA 5GZCA 2VNOA 2DUQA 2WLQA 1AHSA 1YXWA 2KR2A 4IDZA 4DEQA 4J1XA 5A1LA 4R9CA 1RC6A 1SLAA 5JVVA 2ADEA 4XF1A 1EYBA 2VD7A 2G9GA 3KMHA 2A75A 3PUQA 4Y5Z0 4AGRA 2VOKA 3ZXJA 2CSGA 5AC91 2VUCA 2Y0OA 2GP3A 3USUB 5CG8A 1CZSA 2E31A 5T55A 4MZUA 4QPYA 1R092 1SFNA 3NKGA 2QDRA 2GC1A 3M70A 2IXLA 3NL1A 1RUD1 1UY1A 4L97A 1AYN1 1R093 1QMJA 3HMYA 1UNBA 5FXXA 4AAPA 4Y24A 1ZRIA 3JB8A 5A1AA 4ITCA 1OPMA 4FPCA 4LK7A 3OPTA 1ENQA 1OUSA 5IVJA 3ZYIB 1RHI1 2JDKA 2C1FA 1O6UA 2HWD2 3WX5A 1QHDA 3Q8CA 4YGCA 4YWAA 3S7EA 5FZDA 3PUHA 1NY72 5DAXA 4CUGA 2HWD3 4A2UA 4AQ2A 4D94A 4UW3A 5FREA 2A7AA 4EZHA 2XBO3 1N3PA 1W6NB 3GZEA 3WQ1A 2BEOA 1VRH3 2E53A 4AI3A 1DYPA 5FXVA 3PLQA 1VBD2 3H8XA 4IV3A 3IB3A 4LBNA 1LOFC 4Q4X1 5J3UA 2UWAA 1JODA 3ZIXA 1DQ2A 2RM22 1J59A 1WMFA 3ZFEA 2DFBA 4BIOA 4Y4YA 3VKNA 4TLGA 4META 2D6MA 3FZ3A 1PGW1 1BCXA 2LALA 3LFIA 4RHV2 4MOAA 4QHBA 1OH4A 1STMA 3SITA 1W6MA 3T1LA 1IS3A 3AB0A 4QU2A 2OA2A 4RHV3 3O1UA 3AXDA 4YVSA 3OGGA 1NQJA 4YW5A 1LRHA 4B7KA 2N7GA 4MG2A 5A7QA 1HLCA 2DVAA 4IETA 1RUI2 3PHMA 3FFZA 1W05A 4PT6A 1COV1 2JB8A 3LD8A 2VC9A 3DXUA 1E57A 2B8MA 4YW7A 1WD4A 2VZQA 4JRAA 2R0HA 5JPNB 1C28A 4IGOA 4YFZA 1LOGA 4PI0A 1H4HA 4RQPA 4CP2A 2GH8A 5DUWA 3MYXA 3ROUA 2WLPA 3CZJA 2BDRA 1OOPB 1BEV2 1VMHA 3TEXA 3VN4A 1ZBA2 1NLSA 5LK5A 1WLCA 3ZR5A 2RR11 1RUNA 1ZBA3 1MEC2 1QJY2 4GJZA 4P08A 4A7ZA 1C8M2 4CP0A 1V9U2 2G1MA 1HN0A 2QE3A 1MEC3 1Q8OA 1QJY3 3ECQA 4O65A 1C8M3 4WBBA 4DZGA 1FPN1 1V6LA 5K0UB 1C4RA 4ZZ8A 3N35A 2IXKA 4FOYA 1W6QA 4IEPA 5KXCA 2OZ6A 3AK0A 4XMAA 3VBSB 4QPGA 2YB7A 3T4HB 1JYCA 4DNYA 2JICA 1WA6X 4A6SA 2VBPA 5FPBA 2YGMA 1UCXA 1WKYA 5CG9A 1XNDA 2ARCA 4K21A 4BU2A 4XABA 1BK1A 2V09A 2ZMKA 3S6PA 4CXWA 4XQWA 5K0UC 4GWIA 4K3UA 3UGGA 4CCKA 5FQ0B 2IXHA 3NQHA 2HWF1 4IEWA 1OXCA 1PHMA 1BLZA 1QF3A 1UF2C 2Y6KA 3J7MA 1AXKA 3RDIA 5IVVA 4MXVA 4XFFA 5FLIA 1DGWX 4KH9A 3WNXA 4A7YA 3MIHA 1AXYA 1N47A 3TBDA 3VDDA 2E33A 4C91A 3MUY1 5FWEA 5IVYA 3QLQA 3SXWA 1ONAA 2HBUA 2UURA 4NJ4A 4X6RB 1NE4A 5FYVA 1VBC1 2KM2A 2XQRA 2SBAA 2GSYA 2OUHA 2PHWA 4M01A 1XNTA 2GN7A 2JECA 4XIKA 3LE0A 1VAKA 1O7FA 2OQ7A 1UOJA 5LK7B 3T2TA 3L2YA 1DDLA 3A21A 2QDNA 2ZHKA 3LA3A 4WVZA 3U07A 4D8MA 2PFWA 4AE2A 4Q0SA 1UL9A 2QBXA 5JI9A 1WGPA 4NWWA 4DRVA 2G19A 4FBFA 3J9SA 4LBQD 4RGKA 1QWRA 4NUBA 1MQTA 5HCFA 1TME2 4CE8A 4DOUA 1TNRA 2VUDA 4QHZA 3GJAA 2V4AA 4IEOA 3KSCA 1IZ3A 1TME3 5FOJB 3I2GA 4XZUG 2HWB2 5A32B 4O7XA 4XXPA 4TN7A 4P5YA 3M1HA 4UFKA 4D6RA 2HWB3 2ZX3A 1UWWA 1QOSA 1MR5A 3KCYA 3QD6A 5J09A 3E5XA 1PMHX 5FUPA 3OEAA 2BWAA 5C8WA 1NKGA 4OULA 3KM5A 1GQGA 2WAAA 5JSRA 2QQJA 3O1PA 2PAKA 4IUGA 4ZXEA 1O5UA 3AX4A 2BERA 3IKWA 3KVBA 3ON7A 5C3PA 2JDNA 2W94A 3NJXA 3TOJA 1A34A 3NWKA 1YIFA 3LKJA 2OT7A 3NAPB 3WF0A 5IK7A 5FPUA 3B00A 1KGYA 3VBSC 1ACCA 4HK8A 1QJEA 4CEWB 2P6HA 2DVDA 4GXLA 1JZ6A 1XU2A 1CAVA 4YW3A 4CUBA 1KFXL 1OH3A 1XYOA 3WUCA 1CJDA 1MS1A 3U1XA 2J1UA 3POYA 5HI0A 3NAPC 1DLLA 1PO12 2WQZC 4K1ZA 1J3RA 2VOVA 2ZKNA 2R1BA 3BI3A 1PO13 4CEWC 4PI2A 3ILNA 5E89A 4COWA 2RVAA 4IESA 4K1YA 4FQ4A 4XFCA 5E1RA 5FZIA 1GOFA 1H2NA 2A3WA 1ZZCA 1X33A 1VBA3 5AVAA 5IUQA 3MZHA 3APBA 2JD9A 3C8XA 1HRV2 4XF3A 5BXXA 4BMBA 5A6QA 5CYYA 5CFDB 2VBBA 2KA3A 1M4WA 1HRV3 4UBHA 1W99A 2JWPA 5DDJ1 4CCDA 5B4NA 4K40A 2ZGMA 3H42B 3H3LA 3I54A 1W6MB 1OLMA 1SCRA 4M3CE 1J1LA 4RSUA 3ZDVA 4D6QA 3TEWA 2C6SA 5I0DA 4R52A 3VHRA 2JD4A 5CFDC 4EN9B 1O59A 4CU9A 2VQTA 2RJ2A 3KS7A 4NIDA 2Q8EA 1W8TA 4E4DX 2IWGB 2WZR3 1G9AA 4AHWA 1QH7A 3N9OA 3SH3A 4FXKB 4Z2WA 4L11A 1SDDB 5APAA 3H3ZA 4DQAA 1PVC1 1QJX3 2E26A 1MVEA 3Q9OA 4LA3A 3POFA 1UN1A 4XAAA 5GJ6A 2VL4A 3IDBB 5F3GA 1ENSA 5BV6A 1YI7A 1RUE2 2OYZA 3OUJA 1RUE3 2RS12 3QBQA 2VQUA 1XRUA 4MSVA 2X05A 1NOVA 4D0QA 4PQ9A 2OPKA 3AC0A 1JUHA 2Z5WA 2Y33A 3GDBA 5GZEA 2RS13 5A3LA 5JPMB 4LBQA 3UV9A 1J3PA 5KHKA 2VZSA 4M3CF 4UT5A 1ULGA 2LRPA 4CEYB 2ADDA 2IXIA 4AVCA 1B09A 4GH4B 4X6QB 2YMZA 2V4VA 2EIDA 1U0AA 1DQ0A 2VXRA 5FK7A 1QOTA 4UBGA 4P9WA 3QH6A 1GLHA 4JV4A 1F5FA 1VP6A 3OG2A 4B1LA 3TEYA 1WD3A 3WHTA 3GNEA 4MHRA 4CEYC 2NP0A 3FUOA 4IXLA 3CJIB 4GH4C 5FY9A 1CR7A 4Y1UA 2D44A 4HONA 1S2BA 2WT0A 3HN1A 3V65A 2B46X 4YM2A 4YG0A 5GM0A 3WR0A 1CAUA 3KQ4B 2IVIB 2W3JA 3VDDB 2D6LX 1Z7S2 3VL8A 4CU6A 2C5DA 3U0ZA 4AW7A 2FDGA 2DCTA 1QNWA 2PHXA 1VB4A 4MXWA 3CJIC 2FZ2A 4JGZA 1US2A 1W0OA 2HBTA 4OHXA 2VQ0A 4YRDA 2R061 3RZKA 1VMFA 3WP5A 4CCJA 3MIFA 3BN6A 4JDNA 5JZGA 2IZWA 3RPQA 2ZGLA 3CZUA 3TNPB 4EJRA 1S0DA 1OKQA 2F4PA 4B29A 3HPNA 2NMNA 5AFBA 5GLVA 4RN5A 2CGPA 1CVNA 4XDOA 2AREA 2LUWA 2BV4A 2XVLA 3DKWA 4YYOA 1HN1A 2XL7A 5FYUA 2X10A 4I0AA 4QGMA 2RDQA 1I9RA 4XJZA 2J1SA 3GXUA 2D6KA 3U75A 2JG9A 3J7NA 1FATA 2AR6A 2VOWA 1V6NA 3VZLA 3DGTA 2BOIA 2ZGPA 3ZN6B 4MUVA 4Q8KA 5BNNC 4KL1A 2DTYA 5FKBA 4LOTA 5D2AA 2Q1MA 3ES4A 3NNJA 2RS52 1S0BA 4W4ZA 5T3NA 4AEDB 4V1PA 1XPWA 3E6BA 5IFTA 5ISLA 2XJRA 3OYWA 4OMCA 1VE0A 1BQPA 1DU3D 1VBB2 4BA6A 5BNPA 2AEZA 3I2DA 2JG8B 2Y6HA 5FPAA 3E1F1 4FI9A 4Q0UA 3V0AA 4QX7A 1H6XA 1SACA 3JBG1 4UF0A 4AEDC 2D98A 4RYDA 4LKSA 5LW9A 5ACA1 2Q4SA 2QQWA 3ACLA 4A3XA 4TTGA 4QXKA 1MS8A 3RYPA 2K9ZA 2IVJA 2JG8C 5J1XA 1LGBA 4YZ5A 5KBFA 5C3SA 1HRI3 2PHDA 2VW2A 2WN2A 4HK9A 5I8YA 2VQAA 3FJSA 1NCQB 1V6IA 4UFMA 5J7MA 2R042 5L7OA 4QT6A 2ZEYA 5JOYA 5IK5A 5I0SA 4OZXA 1UPSA 3WCSA 2PLV1 3J26N 3FBYA 4ZS3A 3V56A 1W3VA 4WVWA 3TAYA 3EMRA 4DIQA 1OFNA 3ZXEA 1GNYA 1VBE1 1N1YA 3J8F2 3LIGA 4OYUA 4WVVA 5FK8A 1NCQC 4YG3A 3THDA 3H8RA 1NAEA 4XE9A 5GALA 1W90A 1LAJA 3T0AA 3I2JA 3PUIA 4BH9A 5G04L 3A0NA 4IEVA 1LB2A 4LO7A 1RUG3 3KWVA 5JWPA 4QKDA 4QQHA 3NO8A 3LEKA 4M4RA 5IJRA 3OPZA 5BNOA 1R1A2 1W8ZA 1QOOA 4HN0A 4K9SA 1CD3G 2X5IA 1FMD1 3WW2A 4INDA 4UWDA 1AR91 1WCSA 2RDSA 1R1A3 1ZZ6A 2BQPA 1WW6A 3PTYA 2UY9A 1MZ6A 2WR9A 2VE1A 4XETA 4JQRA 3RWNA 4IE6A 3MLJA 2AUYA 1RXFA 4DXZA 5BYNA 2ZGNA 4XJ8A 1MZEA 4FPJA 2UWCA 3LDKA 1DQ1A 1RITA 4JTNA 1UZ0A 3DYMA 3M4FA 4N43A 4XC9A 1FOD3 4XXAA 4I0WB 5E16A 4AAXA 1YQ2A 4BXSV 3AL6A 5ANNA 5T5OA 4S2HA 2CHHA 4HZFA 1QJFA 2W08A 2ZGKA 1FV3A 1FYUA 4Z8BA 3ACGA 1UOGA 3WLUA 2QQUA 4IV1B 5CIRA 4LEJA 4B4RA 1O5LA 3HJRA 3E6DA 3D5OA 4EQVA 2HYKA 4P9YA 4MO3M 2JDAA 2WQ4A 3EQEA 5FJHA 3WZ1A 4CU8A 4NIGA 3DUIA 4LBQB 2AACA 1TQ5A 4CXXA 2VY0A 3ES1A 3WNNA 2ZOEB 5FP8A 4IV1C 1W8UA 1OMIA 3WQ0A 1CN1A 2XQXA 4H3WA 4K20A 4IEXA 1YO8A 4AK3A 4C1WA 1YFXA 4DFSA 4XILA 5FYSA 1HJGA 2WN3A 4C0BA 3QOPA 1OF3A 2IFWA 4JKMA 3SC7X 2C0ZA 1RUC1 5A7OA 5IATA 2DCYA 1XNBA 3S0MA 1T6GC 4CYDA 4MGZE 3DKQA 2CGNA 4LXLA 5HXVA 3I7DA 2DUPA 4FOWA 2ARXA 3JXSA 1UQXA 1PGSA 1SFPA 1HXS2 2EXKA 5C9AB 1JZ2A 4N53C 1S4CA 3FLPA 4WV8A 3USUA 3W9AA 1AF9A 2ZGOA 1QQP1 1YEWA 1IQAA 1IGOA 1PGL1 5FZCA 5IVEA 2YU1A 4CCMA 3LGRA 4XHXA 4GIQA 4Q4Y2 1SLCA 3BB6A 4FO9A 1WMDA 5C9AC 2GU9A 4TXWA 2I74A 4AFBA 3USSA 1LOFA 1UKGA 4AVBA 4DO0A 4P9GA 1JS9A 1D4M2 4Y33A 1TVGA 2YV8A 4LITA 4MV2A 4XUOA 4EWAA 1RUH1 4QKNA 4XUPA 1W9TA 5A7PA 5LRSA 3ASIA 1W6NA 4Q0VA 2A3YA 5FY5A 2B45X 1W8WA 2O8QA 2JG9B 1ZA7A 2RDNA 2XLGA 4WVMB 3BVCA 2DVGA 4MGIE 4I01A 5FZGA 5JOXA 1ZREA 4NRPA 1EUUA 4XAEA 1E5RA 4PDWA 2OX0A 1HDKA 3FHQA 3PIGA 3C7EA 3ZYGA 3WSOA 3JD73 1DZRA 5JI7A 4A7KA 4IEUA 1Q8PA 3LIHA 3ZMNA 3JCIA 1H1IA 5EIYB 4HLTA 3HN3A 1S2KA 2JG9C 2WAOA 3ZSEA 2ZAAA 3O1RA 5FMDA 4NRQA 3VKLA 3WDTA 1PNFA 2XJUA 2Q1FA 3VDBA 1SLLA 2W46A 2XJSA 4E9KA 4G9SB 4NAMA 3WV6A 3ZYFA 1J58A 2YUEA 4QX5A 2ZACA 5CISA 1OURA 1GNZA 3BIEA 3CIHA 3IMNA 4OI0A 1VPHA 4AQTA 3WP4A 3ZOIA 5EP9A 1L3JA 1KD7A 1RUJ1 4RR3B 5FP9A 1DIWA 3I3DA 2HWE2 2Q0AA 4BB3A 2EXHA 4ZKTB 5FZFA 2NN8A 3IIAA 2EIEA 3OD0A 4LHKA 3K48A 1VAMA 2HWE3 4AHZA 3OUIA 3GCWA 2Y26A 3MDPA 5LA0A 1PVXA 5BNQA 3N4MA 2KD7A 4YSFA 2VZUA 5A3MA 2XJVA 2GAUA 2K0GA 2QQVA 3LAGA 3SCFA 4RR3C 1GP5A 5K0UA 2JX9A 3IDCB 1UZZA 1JZ7A 1W0PA 3KD4A 1GANA 4AVSA 1PMIA 2LTNA 2I2SA 1NLRA 1CAXB 5LA1A 1X36A 4AQSA 4MGSA 1UOBA 3VGIA 3M7AA 1DCSA 1PZ7A 3RJ2X 5J37A 4CDWB 4QXBA 5J96B 4NIIA 4HSJA 1G7YA 2ORZA 1POV1 1UYYA 5C3OA 1F4HA 3WD5A 4EZ4A 1CONA 5FQ0A 3QCWA 4PBOA 1H8VA 3SNMA 2ZXQA 5A3WA 3R6SA 3VZNA 1W28A 4X8PA 2BNNA 4Q4V1 4LK6A 4CDWC 3K3NA 4YM3A 1N3QA 1PIV1 1GWLA 4UOJA 5I0TA 4EN0A 1KJRA 4ASKA 1C5IA 3THCA 4FFIA 4LNVA 3TN92 4ATEA 1AR71 3CNAA 2QZ2A 5FYCA 2RV9A 3RZZA 2R16A 3TN93 3DEMA 1Z0HA 1Y4WA 4LBKA 1TZOA 2W87A 1RVF3 2HKXA 3OJBA 5TSWA 3ZO0B 3H8OA 1LOAA 3F95A 3L2HA 1JHJA 1V0AA 3RFRA 4Q8LA 2XKOA 3ZX7A 1H6YA 5IWFA 2Q8OA 5HPOA 1BMV2 5DZFA 3WNLA 3K46A 4Q4W2 4DEVA 2VNGA 3KV4A 2TNFA 1NT0A 2VMIA 2YXSA 3ALQA 2X8KA 2ZTNA 5LATA 1GSLA 4Q4W3 1DYOA 1QNYA 3SEPA 4QX0A 4QQOA 2K46A 3H1MA 5F5CA 1ASJ3 5LBBA 3WVJA 1EPWA 3PVOA 3LZZA 3Q8AA 1X50A 2ZJCA 5AC92 2GN3A 1NLQA 1Q43A 1RIRA 2VECA 4CRQA 2JDYA 2XHKA 4ZY9A 2VMGA 2HWC1 2LROA 3WP3A 3AZXA 4AEKA 2AC1A 4XHBA 2VM9A 5FPZA 3LEGA 2XLFA 1XNCA 5FMOS 4ZXKA 3K75B 2FDJA 1EY2A 5I8SA 1W8FA 4GB31 5A33A 3NAPA 5JMCA 3BTAA 2R0FA 3A4UA 1JZ8A 2BBAA 4ASMB 2QQLA 5F32A 5F3EA 5FZLA 4JKLA 3JZVA 4CEWA 3FUQA 3B93A 2WA4A 3KGLA 1G8WA 4RFT0 3OSDA 3KF3A 1QEXA 1GZ9A 4BYYA 4Q4X2 1D0HA 2J1RA 1PZ8A 2ZX2A 5D21A 4R4XA 3ZXKA 3MF9A 2WNVB 1O91A 2VU9A 4QGNA 4GKYA 2JIJA 1ZVFA 1Q8VA 3K4ZA 1VALA 2V5DA 3ACIA 3HAGA 4RFRB 2WYFA 4N9HA 4OHVA 5J98B 3ZPOA 4AOCA 4BK5A 2A3XA 3MEPA 1F8VA 1BKZA 1VAVA 2JXAA 2VW0A 5DQ0A 1VBD3 2C26A 2WNVC 4NPMA 2VH9A 3KT1A 1QDCA 1W9FA 2WS92 4OLLA 1H9WA 2H6CA 4DINB 5CFDA 2RM23 4KBZA 4P14A 3I2OA 2CU5A 4PDWB 3PU8A 4LO4B 2WS93 3MPPG 4FVVA 4EN6B 3PVEA 4FOQA 3WNOA 4W6YA 4HG6B 1LKNA 1R091 2A5ZA 4Q26A 4A4AA 4Q27A 1W2NA 3Q8BA 3S5AA 3DN7A 2ZMLA 3M2MA 1WW5A 4JAAA 4PDWC 1HQLA 2NMOA 1H2KA 1RUI3 2B9UA 3P5BA 4XTMA 3W21A 1CGPA 2E7QA 3KGZA 2HWD1 4D3WA 5L36A 1JBCA 4FTSA 4P9XA 2XJQA 2XBO1 3VLBB 4MX3A 4PIYA 1FPN2 1VRH1 2MHFA 2E7AA 2WNOA 2WT1A 2WQ8A 5H9PA 3AKSA 4Y1ZA 1Q8QA 4QB6A 1K45A 4KWUA 5C4WC 4HKOA 2XONA 1BEV3 2ZEWA 4B4PA 5C8CA 3FX3A 5KR7A 3N9QA 5FYBA 3PVBB 2WSVA 5L9BA 2F4LA 4MH0E 5FPVA 1D0GA 1OF4A 4CCCA 1FX5A 3M3CA 4BQXA 5FBZA 3WEZA 1V9U3 4QQ2A 4RHV1 4LIUA 1D2QA 2HWF2 3LPGA 4CEYA 1TE1B 4GH4A 1V70A 3CO2A 2Z2SB 5GZGA 4YGDA 5FR3A 5I0RA 1EV11 2HEWF 3SH5A 4AF9A 1HB4A 4CUAA 1SLBA 2AH2A 4D7TA 3AMPA 1DGRN 1PX4A 1N1SA 2GZWA 2IXCA 4AGVA 4YVWB 2ID4A 4LUMA 3UJQA 3Q8EA 5KWRA 3OGJA 5F8PA 4B4QA 2YBSA 3VKFC 3CJIA 1G9CA 4KU8A 2EIBA 4ET7A 2W5FA 2WZPP 2R6QA 1G86A 2D7FA 5FYZA 3GHMA 4YVWC 1A8MA 2CV6A 3ETPA 1ZBA1 1K5JA 2D5HA 4CXYA 5BUVA 3ZM8A 3AL5A 3OB8A 3CU7A 3O0WA 4J25A 3MFAA 3ZXAC 1MEC1 1QJY1 1C8M1 5KHIA 4IW3A 1JOJA 5CFCA 2WO7A 4O9GA 4XUQA 2FDKA 1X7NA 1UX7A 2WZ8A 5IW0A 4HFSA 1BZWA 1WMEA 3BU7A 2BUKA 4BOWA 2XB6C 2EXIA 4B1MA 2Y6JA 1XXNA 5FY4A 3MI8A 5A3OA 4ARYA 5BNNA 2D40A 4Y4RA 1GQHA 1ST8A 4M0NA 3O0VA 2W9XA 5FZ7A 1YFWA 2W1WA 4CCOA 1WBFA 5D1IA 5CZKA 5GKAC 3ZDSA 3U10A 1AYM2 4FPGA 3ILFA 5HCHA 1KS4A 1BK0A 1W9YA 4W50A 1ULDA 1AYM3 3ZN6A 4COUA 3VKOA 1YQCA 2DU1A 2PHLA 3BPSA 3WNKA 1RXGA 4V2VA 5LA9A 3WF4A 1Q5OA 5F2WA 4FFGA 4AEDA 3IIIA 1XE0A 5CB7A 3I3BA 1D7PM 2R30A 5SV8A 4B3NA 1IQDC 4O61A 2BU9A 4XTPA 1UAIA 2JG8A 2A6ZA 5CVRA 5CBLA 2EA7A 4Q1PA 1NQDA 3NKTA 1I5PA 4KG8A 3GZTB 4CCLA 2VO5A 5A33B 3O1MA 2AZ5A 3IT8A 1YYNA 3LB9A 3NSTA 4LPLA 2YG0A 1JTZX 2XLAA 4HVQA 1GU3A 3AZZA 4JHZA 1RYYA 3MW2A 4XBQA 2VZVA 5AVPA 1DP0A 3AVSA 4QQLA 4GALA 1LEMA 1YCIA 2WFF2 3ZN4A 1GICA 1NCQA 5F2SA 1TME1 1FNYA 1SBDA 2A6VA 2EF6A 5C7GA 2FDFA 5F6KA 3VKMA 3D6EA 2WFF3 3UYJA 1GBGA 2PAEA 1QU0A 4GMP0 2F17A 3IMMA 2Q8CA 3CHXA 2O0OA 2D43A 5ABJA 4P5HA 4QDQA 1CZVA 4IE4A 5IYYA 4QDSA 4RA0A 1U5ZA 4OQ9A 4BPZA 2BYVE 1X8MA 2YFZA 4Y3OA 4DY5A 4XCAA 3B7MA 2VBDA 1T6BX 2VCMA 5IFPA 4OI4A 1CX4A 3VBUA 4FCAA 3DYPA 1ND2B 1YFUA 2G9FA 3AYCA 4EWEA 1MS4A 1F4AA 3ZSJA 3ACFA 3TB0A 1SQ4A 5FZAA 4DXTA 5JXHA 4L0PA 4XJAA 2WRAA 3PUSA 2WYSA 4HKWA 4D6SA 4FTEA 3SISA 1ND2C 2RMU2 1CIYA 2YPJA 4HL0A 4E8CA 1KRIA 2RMU3 3UGHA 4YZ2A 5FV3A 5IVBA 3K4AA 2YROA 1PO11 4MYEA 2RG4A 1XSRA 2D5FA 1ALYA 1MVQA 3MIGA 1MZFA 1UMZA 2RS32 1G9DA 2QTWB 1L7QA 3VZKA 5FO9B 2BPA2 2B4KA 4AXOA 5JUVA 2WJSA 4I02A 2RS33 5T50A 4E4HA 4YARA 1VBA1 4C0HA 5A1FA 4LQRA 1WLWA 3H1WA 2GC3A 4FPEA 4IV1A 4CU7A 5C8CB 4F8AA 4XOGA 2VCBA 1CAWB 4CDUB 4R4ZA 3EB7A 4LMFA 3LEMA 1K5MB 3WG3A 4Y5TA 1Y3TA 5GLUA 2MEV2 3AYAA 5LZ6A 2CAVA 4OZOA 3P6BA 2Y0IA 4GD4A 4QU1A 2DBNA 1OUXA 2QJVA 2MEV3 1GMMA 3O14A 1YIPA 5C8CC 2PXJA 3IAPA 3HT2A 3ORJA 3OGRA 4CDUC 1JYWA 1OD5A 3GJBA 3MIDA 3FLRA 2CWMA 2WZR1 2XMLA 3ZFFB 1K5MC 2HEVF 2WWUA 3CEWA 4N53A 5F6LB 1C57A 2ZAHA 3DL3A 5IAVA 2WINB 1QJX1 2R062 4U2AA 2XG3A 1POQA 3SKVA 5KHJA 1AUYA 3POGA 4YNIA 2PHTA 3AMNA 3K4DA 5LEKA 4HKLA 2BBVA 5DABA 1W6OB 3EBRA 3ZFFC 1RUF2 5C9AA 5FDBA 1ZA4A 2PHUA 1E5SA 4MGQA 4FTBA 3THPA 4XW3A 1ND3A 5EWSA 1RUE1 1RUF3 3ZYHA 4AEJA 3ZYPA 1Z7S3 1ZZBA 3BOPA 3I2IA 4MGTA 3I2FA 2VMEA 2BFUL 2RS11 3FBMA 1DQ5A 1PNGA 1UO9A 2ILMA 4FPYA 4I0BA 1IS5A 3JUUA 4HVRA 4AG4A 2BVVA 1HQWA 4GULA 1XNAA 2WNUB 4GMP3 5CFCB 3O1VA 4CPBD 2R072 4BJ0A 4D7YA 3RJRA 5EPAA 4CP9A 2OUJA 2R073 2QCSB 3M3IA 5H9SA 3EYPA 3MV11 1ZX5A 5I0UA 3N7KA 1WWYA 2CTVA 2XJPA 4ZHNA 4C90A 2BNOA 4CDQB 5FRAA 5BNNB 1V00A 3N3HA 2WNUC 3PNAA 5CFCC 3W20A 4UFHA 4UW4A 2DU0A 2WIIB 2ZX4A 4WVMA 1FT9A 3H50A 3VHPA 3ZVXA 3L9JT 3CLPA 3NV4A 4Y1VA 4N90A 3JBG2 4CDQC 1XB9A 2B5HA 1E5IA 1DQ4A 2H0BA 4DS0A 5ACA2 3RMYA 3NV3A 3JBG3 4KMQA 4P9JA 1IHMA 4QPIB 2Z42A 1CQ9A 5EFUA 1H8TB 4NHLA 2RS53 5F5QA 3U4SA 2P1BA 3AYDA 1Q8SA 5F3IA 3VUOA 3KZ4C 5A3PA 1VBB3 4LBJA 5EZWA 4BM8A 1CX1A 1UYZA 1AVBA 3DF0A 1RL3A 1JI6A 4YG6A 2C4XA 3O12A 3OF1A 1UU5A 4FFHA 4UW5A 4QPIC 4EE2A 1YI9A 3R05A 2VR4A 3KT7A 1H8TC 4XACA 1KDKA 4JGYB 3BGAA 3LFMA 3TRSB 1XC6A 2ZS6B 4X8NA 4AZZA 4E2SA 1NZCA 3I4IA 4B8EA 2XDVA 4RR3A 4I3GA 4AI2A 4LT5A 2F6BA 3AVRA 4LHSA 1YUDA 4XDPA 3I59B 3G7DA 2VMFA 4LHNA 3O1TA 4JQTA 4U36A 4JZRA 2G4IA 4JGYC 1PO22 2R043 2GC2A 4JDOA 3NNGA 5K7PA 2FBEA 5EV7A 5ABJB 5IK4A 1PO23 4V2WA 4KI5M 1S0JA 4AVAA 3AFKA 2YFUA 1NUKA 4NHKA 5L9VA 1AR92 4UFJA 1TNFA 1KITA 3AKTA 1W0NA 3OEBA 5T52A 3VB9A 1LU2A 1IPJA 2UU8A 2JDZA 3J8F3 1CAXA 1SHWB 1NA1B 3JB4C 5DZGA 3S30A 5D8AB 2GNTA 3NJZA 5KXDA 3VBUB 3K51A 3N7JA 3FMGA 3KVAA 3CMGA 5ABJC 1JYVA 3VD4A 4CDWA 2CGOA 1OPOA 1L7LA 5LB6A 1WCKA 3ZSKA 4I2OA 4JDMA 3BUCA 3POJA 4N9IA 4YW4A 1GNHA 1NA1C 4LO6B 3PL0A 1HRI1 1R64A 1X82A 2JEMA 3PDQA 3ETQA 5D8AC 2NQYA 1RMU1 2W1UA 3VBUC 3C7HA 4MADA 1GV9A 1BVP1 4W8JA 2BJSA 1Z78A 3AJYA 1LOEA 4QDRA 2B42B 3PJQA 3ZYRA 5LA2A 1NXMA 4AFMA 1EAH2 3ZYJB 2J1AA 1FNZA 2DVBA 3SEEA 4M0HA 2YBKA 3I2HA 1EAH3 4QB2A 4EN8B 2VZOA 3R4UA 1GP6A 1BVVA 1XOYA 4P9LA 2YYOA 1PM4A 3E5QA 5DG1A 2DYCA 1N1VA 4FP3A 3LOIA 1RUG1 2J1EA 1GUIA 4FFFA 4YGEA 5ERLA 3HIFA 2C9AA 3D0SA 3RYRA 2FQPA 4AFAA 3UL2A 4QXCA 5GLZA 1RUC2 2CDOA 4NOTA 3VD5A 2XVGA 4W6WA 1R1A1 4GQ7A 4DUVA 2Y38A 5JLVA 1RUC3 1DYKA 3DYOA 3ZPYA 1OI6A 3KHCA 4XF9A 3NMBA 4XF0A 1HV0A 1W6PA 2BNMA 3AP6A 5DUUA 2ZGRA 3PIJA 3A0KA 1POV0 3VBOB 3O1OA 3RVHA 2W1SA 2RJKA 3VBRB 3NRUA 4N53B 2XGXA 3NNMA 1QQP2 1URXA 2JB4A 3KQRA 4IGQA 1Y9QA 2EIGA 1PGL2 4CZSA 2WO2A 1FOD1 3D3AA 1NXD1 1HB3A 4A45A 3AP4A 4AGGA 4FT8A 4BMEA 1AJOA 3E5UA 3VBOC 5FYIA 1C1FA 3T4VA 1I6XA 1F31A 1PZ9A 3C7OA 3LSDA 3VBRC 2ZMNA 4YZ1A 3WW3A 4TLFA 1HXS3 1ND3B 1QJU2 3OUHA 1JHNA 1TMF2 1XYPA 2W68A 3KHBA 4QX2A 5IVFA 2DTWA 1OC1A 4A42A 1QJU3 5B4XA 1RUH2 4QWNA 5FZ4A 3SH4A 1TMF3 1F2NA 4COYA 3FHAA 4BHPA 1GYKA 3N9MA 1OQ1A 4JKKA 5DAQA 4Q4Y3 1AL22 1LNSA 1JYNA 1ND3C 1ZBE1 2ZZQA 4JVAA 4CP9B 2WZEA 1SLIA 1NX9A 4AVTA 1VR3A 2OW4A 1AL23 3NV2A 2WNVA 3ZR6A 4TWTA 2UYBA 1W39A 1D4M3 4QM8A 1O4YA 4JCKA 4YPJA 4HMZA 4AI1A 1XSQA 5KHGA 3P3NA 4HSLA 1VRBA 2KXLA 4ONUA 4FPKA 1OLME 4UAPA 1H4GA 1G9BA 2Z79A 3ME2A 1WA4A 1UZVA 2GDFA 3KT4A 4JTOA 4HBNA 4OFGA 1SZBA 1OD3A 1B35B 5FZ9A 1AL0G 5A7NA 3ZN5A 3C7FA 5C3QA 2FMDA 5H9RA 4RS5B 5C6CA 2VZ1A 5E6HA 1BBT2 3M3OA 4XFAA 4YZ3A 1U5IA 2WWSA 5FO8B 2BP6A 1R082 4LR4A 1BBT3 2Y34A 1X9PA 1RUJ2 2LS6A 4GZ9A 2HJIA 1B35C 1F9KA 1JMUB 1R083 4OQ8A 5G05L 3S7IA 1W3XA 1E5HA 1LR5A 2X29A 1ZRDA 1XBFA 3KCXA 4RS5C 5C4WA 4FSJA 1S0GA 2VUJA 4QD2A 4IE5A 2A6WA 3GZUC 4P9IA 2LM3A 1AR82 4PCRA 2Y6LA 5C71A 5FP3A 1NE6A 4LIVA 1GZCA 4XUTA 4Q5OA 1AR83 5CADA 3E97A 4IEZA 1UY4A 3WINE 3Q8FA 3WY6A 2VTFA 4OCTA 4CCNA 2WABA 4GWJA 4L2NA 4ZU7A 4AI9A 4F3JA 1WLTA 2WL1A 4R9AA 3UT0A 5JXJA 5KC5A 3UGFA 5DUXA 5FXZA 1HB2A 1LU1A 3B94A 2MNGA 5M0TA 3URFA 4Y22B 5HCAA 3JD71 4NIAA 1LHUA 4HETA 4LO5B 4XBNA 4XQDA 4K7JA 1AR61 2PHFA 4XCBA 4WM7B 1YLLA 2W92A 5FY0A 1LODA 1RTVA 3B5LB 2D3RA 4M4PA 2AENA 1I3HA 3R0RA 4Q4V2 3DCQA 2XWJB 3SLIA 4YVWA 2FMYA 1PIV2 4YFWA 4E4ZA 3NJYA 3HT1A 3PMEA 1GKBA 3HBKA 3WW1A 4WM7C 1X8EA 1GR3A 2D93A 2Z69A 4FPFA 1QXJA 3H7JA 3ST7A 5A3TA 1DF0A 2WSUA 2JDPA 3V64A 3ZXFA 2WO3A 3FHIB 5JIUA 2BGCA 4S2FA 2ZGQA 3LOBA 1VJ2A 1AJKA 4CDXA 2WBKA 5FOBB 3BPZA 3WDWA 1O3RA 3AMHA 2VW1A 3M8LA 4OHZA 2VNVA 3AKPA 2I07B 1OVPA 1CWPA 2BGOA 3I2KA 2Q30A 2YGLA 4PQQA 1YHFA 1YJLA 1RJ7A 4XJUA 3R4DB 3ZFGC 4RGGA 5KXEA 2ATFA 2LW8A 1U5YA 2OIIA 1XNKA 2O8OA 4G3YC 4BZ4A 1QDOA 1UW8A 1DGWA 5EHDA 1GOHA 1UOFA 4Y26A 3SMHA 1RB8G 2ZCWA 4EN7B 3MFCA 4LKEA 3WT3A 1LCLA 5SV5A 4BQ4A 3VD9A 3RGBA 2VJXA 4EROA 3WNMA 3ACHA 4YZ4A 3DV8A 5LBCA 4E2QA 3WG4A 1KJLA 2VZ3A 4UYBA 3SQOA 1CPMA 2ZEZA 3A7QA 1MS0A 4LOSA 4MGYE 5F5IA 2CNAA 4K8RB 3KV5A 1APNA 3CL1A 4ES8A 4M3CA 5A6ZA 2AYHA 3VBFB 4FAHA 2E32A 3NNFA 5FPXA 2VULA 1W6PB 1IS6A 3P3PA 5BY5A 5IK8A 2D6OX 1G9FA 4GWNA 3RZGA 1O8PA 3MV01 1L7RA 2HH9A 3OBZA 4S2DA 5LY2A 3ZSLA 1W9WA 5IAXA 3FLTA 5AC93 3CQOA 4QPWA 3GBFA 3KB5A 2GNMA 1UMHA 5FKCA 2DFCA 1PK6B 1RUD2 5F39A 3VBFC 1AYN2 3T30A 3EO6A 3OBAA 3WCRA 3HQUA 1RJ8A 1RUD3 1C8NA 3TN91 3TYJA 1AYN3 4NWVA 4CSWA 2WNEA 3I3MA 1W2OA 1RVF1 1ZM1A 1JN2P 3GBWA 4XFHA 1RHI2 2JDHA 4ARXA 5A70A 2C9KA 3H0OA 3H7YA 1REFA 1DFQA 1RHI3 1PK6C 2ES3A 1D4VB 1ZZ8A 4XEZA 2VCCA 2E51A 1GZWA 2Y8KA 2BRTA 5EJ1B 3GZAA 2J1VA 4LLOA 4Q1RA 4Q4W1 1JOBA 5JCTA 4CTEA 4XZPA 4QX3A 2OKXA 1ASJ1 4QX8A 5CA6A 2DVFA 4ZZ5A 4PF1A 4Q4X3 3DPRB 3WG2A 2NM1A 1PGW2 4XJ9A 1CPNA 2FCVA 2R32A 1UD1A 3I97A 4NHYA 3MIEA 4NVPA 2JE8A 5A7WA 2O14A 4FAGA 2ZPXA 3AFGA 3OD4A 5A7SA 5A80A 1W03A 1IOAA 1MZ5A 3IPVB 5FIXA 1KEXA 3POIA 4BCUA 3DPRC 4CP1A 1QIQA 1ND2A 1COV2 2AGSA 3VBHB 1QXPA 1SG3A 1COV3 3W58A 3WF2A 3WQBA 1OA4A 2O1QA 5CU1A 4DXSA 4QQPA 3VL9A 3MPBA 3OY8A 2X53S 2XBO2 1ZYBA 5FFOC 1KFUL 4NPLA 1VRH2 1SPPA 4URTA 5EXOA 3FFQA 3VHOA 3WOGA 1LECA 5EQUA 2VZPA 2YC4A 2WFPA 3ITQA 2VCAA 4S2GA 5FYTA 1GP4A 1MS5A 1AX0A 3VBHC 2RR12 4Y20B 5C4WB 4KGQA 5L19A 1XYNA 4K6BA 2VTXJ 1O4ZA 1J1TA 2RR13 4DB5A 4E27A 1RGSA 4URAA 4GWMA 3VD3A 3VZOA 3BTZA 1NY71 2FHRA 1DLCA 3H9AA 4H55A 5HCBA 1UIKA 4PLMA 5FLJA 4I30A 4CVUA 2X09A 1FPN3 3POSA 1CZTA 1VBD1 1EV12 1IKQA 1LGNA 2GMEA 1XU1A 1LJ7A 4NMIA 3CDZB 1CAWA 1QKQA 1W2AX 2JE9A 2RM21 3KV6A 1EV13 4CDUA 1UY2A 2DDUA 2WS91 1NG0A 2PMWB 1K5MA 2ZX1A 4FXGB 1O3QA 5C5UA 2CAUA 1N1TA 4Q2FA 1UU4A 2Z4FA 3VV1A 3T2PA 2W1QA 3UKVA 3AYEA 3B02A 5JOWA 2GALA 1VMJA 3RRDA 2HWF3 2VVFA 3X29B 2QUOA 1UZYA 2WWJA 4XYXA 1TEIA 1QH6A 2A73B 4PIZA 1RUI1 3ZFFA 2W95A 4AWDA 1SFYA 2ARBA 4QB1A 1YC61 4LBOA 1VBC2 1DHKB 3KV9A 1W8OA 4LE4A 4RD7A 4Y5SA 2P34A 3HWJA 4QX1A 2CDPA 2QKDA 3HR9A 2UY8A 5T5PA 4Z2AA 2VNRA 3PURA 1VBC3 1IKPA 2DUOA 2J22A 2QFEA 3AP9A 3T1MA 3WDXA 4AVVA 1I1EA 2XWBB 3E6CC 3MW3A 1JYTA 1OOPC 4J1WA 5L73A 1W6OA 3UETA 4MGKE 5FUIA 4UFLA 5CKQA 4XF4A 1BEV1 3LDBA 3T0BA 3IAQA 4CDXB 1OA3A 1JYXA 3IZOA 3N9NA 1NCRB 1QXRA 3MW4A 1A6CA 3QACA 4PIXA 2EXJA 5FY7A 3CKHA 4YM0A 3MO4A 1V9U1 1Y9GA 2VVEA 1LOCA 3IBMA 4OHYA 3A23A 4JC1A 2WNUA 5JSPA 4CDXC 3RZLA 2R1DA 3PMSA 1KQRA 2R7EB 4AL9A 3RZJA 1NCRC 1WCQA 3MLLA 3EHKA 1JUIA 3O7OA 5A3NA 1YQ5A 1DGLA 4PF5A 1RINA 3GALA 4CDQA 4F83A 2DF7A 2Y6FA 5GZFA 3POEA 1JXNA 4YM1A 1XE7A 3D8CA 4JRLA 1K12A 2CY6A 4P00B 3RSJA 3HD8B 4JHTA 1S0EA 4GJYA 1W06A 1W9SA 3LQCA 4M3CB 4QHOA 5C70A 3HQXA 4HN1A 4NRMA 5FZOA 1U5XA 1W8HA 2XOMA 5E8AA 5FZ6A 1LTEA 4R8HA 4P02B 1WLDA 4HT1T 3MBWA 4ATFA 3EXUA 3HNYM 4QPIA 4A41A 4IE0A 5FO7B 2W47A 1H8TA 2ZGTA 5FYYA 3B01A 5FP4A 1H9PA 2OQ6A 3LWCA 4M00A 4Y1XA 5B2GB 2GC0A 3JQWA 5FMBA 4BK4A 5JOZA 3PJYA 4TSVA 3ELNA 4KNCA 1UMIA 1HKDA 4PJYA 3C2UA 5LWBA 1SBFA 4XBLA 3LA2A 4YLZA 1IS4A 4WZFA 3GCXA 1H2MA 4JGYA 5FY8A 2B7YA 1JOPA 4WM8B 2P4EA 1GZWB 1MPXA 3DECA 1OSGA 2OVUA 2QQMA 1A78A 3GF6A 3G6JB 4TZDA 2NLRA 2YC0A 4BE3A 2QQPA 3BYWA 3I59A 3FN9A 2XXZA 2ETEA 3IDEA 1AYM1 1P8JA 2QQKA 1S1AA 4Q29A 2ZBJA 3WF1A 3W5NA 2HWB1 4WM8C 5BPXA 1XJAA 4LHLA 5DDJ2 5FZBA 5A7WB 1DZQA 5FLHA 1OBNA 3O0XA 3FE5A 3O5SA 1NZIA 3WQ7A 2JKBA 5DDJ3 3WG1A 5DUVA 1CESA 3GYDA 3ZXDA 1NA1A 3HVDA 3OGVA 2JJ6A 4EV0A 2GMMA 4UW6A 5D8AA 5JMOA 3OCPA 2IFRA 1LHVA 1O4TA 4BLIA 5F37A 2JENA 4N8MA 3RWKX 4XUNA 1J84A 2XVKA 1XQNA 4HANA 1IPSA 5FZ8A 5HXMA 4AI8A 1FAYA 2VG9A 1PVC2 3OY8B 4BXFA 2YU2A 4IE7A 5CAZA 1ODNA 2GP5A 3AZWA 4NAOA 2A1XA 1SPPB 4FP2A 1PVC3 1OVSA 2P5BA 3MGUA 4HPKA 1VBA2 1QJZA 1VLNA 5LASA 5I91A 4IV3B 2WFF1 3D0JA 2J42A 3WHUA 4KWKA 3N7LA 1HV1A 4LKDA 3ZFEB 4QMAA 3OGSA 1O8SA 3OBRA 4LTAA 1A8DA 1OLQA 1H30A 3C7GA 5HV4A 2EVXA 3SCHA 5GLWA 2WDBA 4TYSA 1J83A 4IV3C 1YFYA 4WZCA 3UKTA 4Z92B 4E8DA 4UXAA 2H6BA 4YVSB 2VXJA 1LHOA 2GNBA 2XUMA 2ZZJA 3HBZA 3MHZA 1CJPA 4OI1A 3ZFEC 3T2OA 2DCZA 2PQQA 2WZR2 4HXCA 4W65A 4LO8A 1Y9MA 4OI2A 1HRV1 4XJWA 3ZLIA 3ENRA 2VTXA 3ATGA 1EUTA 1Q56A 1DGRA 5JIAA 1QJX2 2ZABA 2R49A 3RS6A 4YVSC 4L92A 1AX1A 1UPIA 3I3EA 4RQPB 1JH5A 4D69A 1UKRA 4I09A 2WA3A 1KDMA 5JR2A 3OTFA 3VBOA 2P3KA 3GM8A 2RMU1 4KBBA 3VBRA 4IEQA 3HNBM 2VUAA 1C1LA 2DCKA 2P3YA 4IERA 1MS3A 4LULA 4BQ3A 3OBTA 5JDBA 4H2AA 3AZYA 1A3KA 2RJLA 3LPFA 4LA2A 4RQPC 1UXZA 4BISA 4GAZA 2W0XA 5J48A 2R063 1S2EA 2RS31 3ZKUA 1T2XA 3MICA 1S0CA 5DG2A 5DZEA 1SCSA 2JIGA 2XPJA 1ZRCA 2K2SA 1W6QB 4K8FA 2GMPA 4OUSA 2D6NA 5FTTC 3RMXA 3TWIA 5J36A 1ZZ7A 2BZDA 1S0IA 4QPGB 3NW4A 3RI8A 4XPVA 2WUHA 3LSEA 2YBPA 1FV2A 4LORA 1WCDJ 3WW4A 5I8TA 3CBNA 1G6NA 2VMCA 4J6GA 4L99A 3T3YA 2GH2A 2IC1A 2Q5TA 3RQ0A 5KXBA 1Y43B 5HBAA 2MEV1 2Q1ZB 1QY4A 1Y7BA 2ZA9A 3T0DA 4QPGC 3INAA 1HJFA 4DXRA 4DUXA 4SLIA 1OLRA 5GLTA 3AXEA 5CKMA 2XL9A 2RHPA 3B69A 5JSOA 1WW4A 3VZJA 4AHXA 2BFUS 4BLJA 5LY1A 3LCPA 5FYMA 2YDEA 4BIFA 4BDVB 2E9QA 3WDUA 1YNAA 4COVA 5E88A 4PBPA 1J3QA 2OPWA 3D82A 3WUDA 2DURA 2ORXA 1GWMA 3NNLA 5FZOB 3TNQA 4CA9A 3VDDC 1B35A 3BKZA 5F1RA 1RUF1 2PHRA 2ZHNA 4DRRA 2PN5A 1Z7S1 1REEA 2XJTA 3H8UA 3K77A 1UIJA 2MPFA 4RS5A 4ISRA 1VB2A 3WDYA 3RZHA 3BTXA 2VZTA 3A22A 3AJZA 5ACA3 1F5JA 2JKXA 4UI9L 5T5JA 2QVSB 5FWJA 5H9QA 2DCJA 2CL2A 1ULEA 2BW8A 2YHJA 4GMP1 1EPZA 5L9RA 3ZXLA 1WCUA 1MQTB 2ZX0A 3M3EA 2PQSA 2PTMA 3J4UH 2P3JA 2TEPA 2R071 4QKBA 2VMDA 4XDQA 4KGGA 3ZXGA 1UY3A 1EP0A 4QGLA 4AHYA 4XVHA 1JU3A 3BCWA 1LENA 3WP6A 3PVNA 4LUKA 2PLV2 4QXHA 4BQ5A 1ODMA 4A6OA 3N9LA 2PLV3 1VBE2 5FXWA 1MQTC 1ZRRA 3PU3A 4QM9A 2A6XA 2ET7A 2Y60A 1VBE3 1GZTA 4OUEA 1OKOA 1HB1A 2CYFA 1OA2A 5FPLA 1K42A 1JYIA 3JQXA 2VGDA 4Y22A 3KCCA 4E4SA 2QQIA 1H0BA 1O3TA 4Q0QA 5KHHA 5C33A 5K4LA 4QAWA 1FMD2 2RS51 4ASLA 4Q0PA 3BU0A 1RUOA 1GFF2 3ABZA 3FL7A 4XIOA 1HRI2 4FQZA 4WM7A 4DMIA 1FMD3 1VBB1 4YW6A 4OUMA 1AR93 1RMU2 3MIBA 4KWLA 5KC6A 2XR4A 1UYXA 5FZ1A 5LBEA 3QH7A 1CAVB 1MACA 1SEFA 1IPKA 1RMU3 2V73A 1ULOA 3UJOA 2OS2A 1WZXA 3W5MA 3UKNA 5DPNA 3I8TA 3ZYBA 4D7SA 3NV1A 1LHNA 3ZMOA 4JX0A 5CKNA 4N7IA 4LKFA 4Y1YA 3ZKYA 1C3HA 1D2SA 3J7LA 4PHZA 2I45A 4PLNA 4L9BA 3THTA 4XMIA 2XKPA 4IEYA 3VDCA 3WF3A 4YGBA 2P6CA 2VOTA 3FC0A 4HPKB 4QKFA 3V0BA 3ZFGA 1HW5A 4SBVA 1UU6A 5A6YA 1RUG2 2D3PA 2D97A 2R041 4MHUA 4XFGA 4LBLA 4EYUA 4DY3A 4NO4A 1PO21 4OHWA 5ANQA 4O9EA 3LA7A 4OVEA 3U11A 4DPNA 2L9LA 3M3QA 4A44A 2FCTA 1FXZA 1LESA 3AKRA 4G4FA 4N7UA 4AYUA 4IL7A 3J8F1 4A3ZA 2W2IA 4B7EA 2FD8A 4CPBA 1LOBA 4RL7A 3K3OA 2NZ9A 3POBA 3WDVA 4ISQA 2G9ZA 5LBFA 3POWA 5DAVA 1ENRA 4H7MA 1BXHA 4NIHA 1UYPA 3KF5A 5DAWA 5F5AA 3AZVA 1GQPA 5FZ0A 1WMXA 5C3RA 1SLTA 2H0VA 5T54A 1OQDA 1FOD2 3LEIA 1YRZA 1YQ8A 3ILRA 3RNSA 4ZS2A 2UWBA 2ZGSA 3KLSA 3VBFA 3AP5A 1F35A 3EJKA 3IWZA 3BIWE 2FDIA 5LEJA 3DXTA 3S57A 1BJQA 3SHRA 3IN9A 4Z82A 1R1ZA 1NYWA 1OHFA 2W91A 3GBGA 2QZ3A 1IG0A 3I49A 1QQP3 5FP7A 1EAH1 3BALA 1PK6A 2B39A 2Y64A 1Q3EA 1ENXA 4CUCA 4R9DA 1W04A 3AP7A 1DZTA 3ZIWA 2V5YA 4COZA 3MLKA 3WXPA 1XE8A 5FJKA 1ZBE2 5JXGA 2ZHMA 4PLOA 5JAXA 1C5HA 5FBJA 1ULPA 1IG3A 1ZBE3 3I3QA 4AFDA 2QQOA 2WT2A 1ULFA 3RYKA 2A70A 1KXGA 2YZ4A 1I5ZA 5EJZB 1RUH3 3SKJE 3AM2A 4KWJA 2B9VA 2VOXA 2ENRA 4KQ7A 5FY1A 5F7UA 1PMJX 1QGLA 1JZ3A 4IQPA 1HIXA 3DPRA 4LLFA 5FZMA 1CAUB 3IM0A 2ET1A 3NJVA 3AKQA 5AFEA 3FWEA 4BWOA 3S5QA 2VVDA 3GHNA 1AX2A 2A71A 4MXWB 4JGZB 4EWDA 1GWKA 5GZDA 3IPVA 4ES9A 2W39A 1JZ4A 2PA7A 1VIWB 3PUAA 4BQWA 2W52A 4RGAA 4ORFA 2IXJA 4XFIA 5JZGB 3BTYA 1PM7A 5F3CA 1HXS1 5DAPA 1DBNA 5DN2A 5LRRA 3OPWA 2D3SA 2WO1A 3F2ZA 3VBHA 2JE7A 2FDHA 1S0FA 2E63A 1H1MA 1QJU1 4JGZC 3T2QA 2XH6A 3HOBA 4FOVA 1TMF1 2ARAA 2BTVC 2OXBA 5FYHA 2HEYF 1HQNA 1US3A 5EYXA 4NE9A 1UXXX 1SBEA 1YQ6A 4Q4Y1 5JZGC 4YW1A 4CCEA 2XUEA 1BYHA 1LULA 3NVCA 1YJKA 3H1YA 1RUJ3 5FZ3A 3IDAA 1AL21 4Y20A 3B9IA 1DQ6A 4ZPIA 4C8DA 3VZMA 2P3IA 5FZKA 2E7TA 3JD72 1UY0A 1UZWA 1D4M1 1AXZA 4DUWA 2WC2A 2PYTA 4NPRA 4W6XA 2QNKA 4KU7A 5FZEA 1AR62 1AZDA 4YW2A 1TG7A 3OYWB 1WUVA 4Z1VA 1AR63 2PAMA 4ZU5A 1YWKA 2IUWA 1GOGA 5BNPB 3D4KA 2FZ1A 3MUZ1 4H7LA 2DWRA 2BWCA 1V6JA 2VAUA 1DG6A 3V0AB 4BQYA 4C1XA 3J7HA 4UF0B 2PELA 1JU4A 1BHGA 3CJXA 3HQRA 5JR7B 2HLEA 4F7ZA 5T5LA 1LHWA 4MVTA 3GGLA 3W59A 1POV3 1OQEA 1UX6A 4R9BA 4AR2A 5C5TA 5IT6A 5BNPC 1BBT1 4AFCA 5FCCA 4LBMA
chains in the Genus database with same CATH topology
4ZU4A 3SCGA 1R081 2EALA 2GNDA 3B9CA 1S55A 1OOPA 2NYYA 1LEDA 1H2LA 4NHMA 5L7OB 4Q4V3 1H1AA 1REDA 1V6OA 1ZRFA 1V6KA 1CIWA 3CF6E 3MF6A 2P17A 1PIV3 3RG0A 3C3VA 3BOWA 1AR81 1V6MA 4AQ6A 2TBVA 3AMQA 5K9YA 2NPIA 3R4SA 4BQ1A 4E2GA 1AR72 2A6YA 1WW7A 4LE3A 2E6VA 3V0BB 1OFSA 2YY1A 4GA9A 4L8QA 1N3OA 1AR73 3H3UA 3ZFGB 5K8SA 5L7OC 3JU9A 2HWE1 2ERFA 4Z07A 3VBSA 4NN0A 2ZGUA 1NCRA 4AI0A 1ZNPA 1M06G 4KG0A 1SDWA 4FPHA 1HX6A 2BVBA 4FPLA 1ZZ9A 5I93A 5BNOB 1WBLA 2VMHA 1W2UA 2X5IB 3UK9A 2RE9A 2DV9A 2VPVA 1MS9A 5FAXA 5EYYA 3N7MA 1FI2A 2SLIA 2ZKLA 5BNOC 1LGCA 2X5IC 3U4XA 2HWC2 4N43B 4XQ4A 2ZHLA 5DXDA 4H14A 4HVOA 2HWC3 5F9TA 5CNAA 2OZJA 1RVF2 3N36A 4GB32 1KS5A 3BODA 3RI9A 4GB33 1SMVA 1O3SA 4N43C 2P2KA 2TUNA 1JW6A 1ULCA 2WKKA 2UYAA 1U12A 3B3QE 5EJ3A 2CWSA 3ZSMA 4FPOB 4XFBA 1ASJ2 4NR1A 4GKXA 2EAAA 2D6PA 3VHNA 4AEMA 5FMOL 2EAKA 3AMMA 5A32A 4MLOA 2P37A 4WM8A 4I3PA 1BMV1 5GZCA 2VNOA 2DUQA 2WLQA 1AHSA 1YXWA 4J1XA 4R9CA 1RC6A 1SLAA 5JVVA 4XF1A 1EYBA 3KMHA 2G9GA 2A75A 4Y5Z0 4AGRA 2VOKA 3ZXJA 5AC91 2Y0OA 3USUB 5CG8A 5T55A 4MZUA 4QPYA 1R092 1SFNA 3NKGA 2QDRA 2GC1A 3M70A 2IXLA 3NL1A 1RUD1 4L97A 1AYN1 1R093 1QMJA 3HMYA 4Y24A 3JB8A 4ITCA 1OPMA 4FPCA 1ENQA 3ZYIB 1RHI1 2C1FA 2HWD2 3WX5A 1QHDA 4YGCA 3S7EA 1NY72 2HWD3 4A2UA 4AQ2A 4D94A 4UW3A 5FREA 2A7AA 2XBO3 1N3PA 1W6NB 3WQ1A 2BEOA 1VRH3 2E53A 4AI3A 1DYPA 3PLQA 1VBD2 4IV3A 4LBNA 4Q4X1 1LOFC 5J3UA 2UWAA 3ZIXA 1DQ2A 2RM22 1J59A 1WMFA 3ZFEA 2DFBA 4BIOA 4Y4YA 3VKNA 4META 2D6MA 3FZ3A 1PGW1 1BCXA 2LALA 4RHV2 4QHBA 3SITA 1W6MA 3T1LA 1IS3A 3AB0A 4QU2A 2OA2A 4RHV3 3AXDA 4YVSA 3OGGA 1NQJA 4YW5A 1LRHA 4B7KA 2N7GA 1HLCA 2DVAA 4IETA 1RUI2 3PHMA 3FFZA 1COV1 1E57A 2B8MA 1WD4A 4JRAA 2R0HA 5JPNB 1C28A 4YFZA 1LOGA 4CP2A 1H4HA 4RQPA 2GH8A 5DUWA 3MYXA 3ROUA 2WLPA 1OOPB 1BEV2 3VN4A 1ZBA2 1NLSA 5LK5A 1WLCA 2RR11 1RUNA 1ZBA3 1MEC2 1QJY2 4A7ZA 4CP0A 1C8M2 1V9U2 2QE3A 1MEC3 1Q8OA 1QJY3 3ECQA 4WBBA 1C8M3 4DZGA 1FPN1 1V6LA 5K0UB 1C4RA 3N35A 2IXKA 4FOYA 1W6QA 4IEPA 5KXCA 2OZ6A 3AK0A 4XMAA 3VBSB 4QPGA 4DNYA 1JYCA 2JICA 2YGMA 1UCXA 5CG9A 1XNDA 4K21A 3S6PA 1BK1A 2V09A 2ZMKA 5K0UC 4XQWA 4K3UA 5FQ0B 2IXHA 2HWF1 4IEWA 3VBSC 1PHMA 1QF3A 1UF2C 1AXKA 3RDIA 4MXVA 4XFFA 5FLIA 1DGWX 4KH9A 3WNXA 4A7YA 3MIHA 1AXYA 1N47A 3TBDA 3VDDA 4C91A 3QLQA 3SXWA 1ONAA 2UURA 4X6RB 1NE4A 1VBC1 2KM2A 2SBAA 2GSYA 2OUHA 2PHWA 4M01A 2GN7A 2JECA 4XIKA 1VAKA 1O7FA 5LK7B 3T2TA 3L2YA 1DDLA 3LA3A 2QDNA 2ZHKA 4WVZA 3U07A 2PFWA 4AE2A 4Q0SA 1UL9A 5JI9A 1WGPA 4NWWA 4DRVA 4FBFA 3J9SA 4LBQD 1QWRA 1MQTA 5HCFA 1TME2 4DOUA 1TNRA 4IEOA 3KSCA 1IZ3A 1TME3 5FOJB 2HWB2 5A32B 4XXPA 3M1HA 2HWB3 2ZX3A 1QOSA 1MR5A 3KCYA 3QD6A 5J09A 3E5XA 2BWAA 5C8WA 4OULA 3KM5A 1GQGA 5JSRA 2PAKA 1O5UA 3AX4A 3IKWA 3TOJA 3NWKA 1YIFA 3LKJA 3NAPB 5IK7A 3B00A 4HK8A 4CEWB 2DVDA 4GXLA 1XU2A 1CAVA 4YW3A 1KFXL 1XYOA 3WUCA 1CJDA 1MS1A 3POYA 5HI0A 3NAPC 1DLLA 2WQZC 1PO12 4K1ZA 1J3RA 2VOVA 2ZKNA 2R1BA 1PO13 4CEWC 3ILNA 5E89A 4COWA 4IESA 4K1YA 4FQ4A 4XFCA 5E1RA 1H2NA 2A3WA 1ZZCA 1X33A 1VBA3 5AVAA 5IUQA 3MZHA 3APBA 4BMBA 1HRV2 4XF3A 5BXXA 5CFDB 2KA3A 1M4WA 1HRV3 4UBHA 5DDJ1 4K40A 2ZGMA 3I54A 1W6MB 1SCRA 4M3CE 1J1LA 4RSUA 4R52A 3VHRA 2JD4A 5CFDC 4EN9B 3KS7A 4E4DX 2IWGB 2WZR3 1G9AA 4AHWA 1QH7A 3SH3A 4FXKB 4Z2WA 4L11A 3H3ZA 4DQAA 1PVC1 1QJX3 1MVEA 3Q9OA 4LA3A 1UN1A 5GJ6A 3IDBB 1ENSA 5BV6A 1YI7A 1RUE2 2OYZA 1RUE3 2RS12 3QBQA 4MSVA 1XRUA 1NOVA 4PQ9A 2OPKA 5A3LA 1JUHA 2Z5WA 5GZEA 5JPMB 2RS13 4LBQA 3UV9A 1J3PA 5KHKA 4M3CF 1ULGA 4CEYB 2IXIA 4AVCA 1B09A 4GH4B 4X6QB 2YMZA 1U0AA 1DQ0A 2VXRA 1QOTA 4UBGA 4P9WA 3QH6A 1GLHA 4JV4A 1F5FA 1VP6A 1WD3A 3WHTA 3GNEA 4CEYC 2NP0A 3FUOA 4IXLA 3CJIB 4GH4C 1CR7A 4Y1UA 2D44A 1S2BA 2WT0A 3HN1A 3V65A 2B46X 4YM2A 4YG0A 5GM0A 3WR0A 1CAUA 3VDDB 2D6LX 1Z7S2 3VL8A 2C5DA 3U0ZA 4AW7A 2DCTA 1QNWA 2PHXA 1VB4A 4MXWA 3CJIC 2FZ2A 4JGZA 1W0OA 4YRDA 4OHXA 2VQ0A 2R061 3WP5A 3MIFA 4JDNA 5JZGA 2IZWA 3RPQA 2ZGLA 3TNPB 4EJRA 1S0DA 1OKQA 2F4PA 4B29A 2NMNA 5AFBA 5GLVA 2CGPA 1CVNA 2AREA 2LUWA 2XVLA 3DKWA 4YYOA 2XL7A 4I0AA 4QGMA 1I9RA 4XJZA 2D6KA 2JG9A 1FATA 2AR6A 2VOWA 1V6NA 3VZLA 3DGTA 2ZGPA 3ZN6B 4MUVA 4Q8KA 5BNNC 4KL1A 2DTYA 5T3NA 2Q1MA 3ES4A 2RS52 1S0BA 4AEDB 4V1PA 3E6BA 2XJRA 3OYWA 1BQPA 1DU3D 1VBB2 4BA6A 5BNPA 3I2DA 2JG8B 4Q0UA 3V0AA 1SACA 3JBG1 4AEDC 2D98A 5ACA1 2Q4SA 3ACLA 4A3XA 4QXKA 1MS8A 3RYPA 2K9ZA 2JG8C 1LGBA 4YZ5A 5KBFA 1HRI3 2PHDA 2VW2A 4HK9A 5I8YA 2VQAA 3FJSA 1NCQB 1V6IA 5L7OA 5J7MA 2R042 4QT6A 5JOYA 5IK5A 5I0SA 4OZXA 1UPSA 3WCSA 2PLV1 3J26N 3FBYA 3V56A 4WVWA 3TAYA 1OFNA 3ZXEA 1VBE1 1N1YA 3J8F2 4WVVA 1NCQC 4YG3A 4XE9A 5GALA 4BH9A 3A0NA 4IEVA 1LB2A 4LO7A 1RUG3 5JWPA 4QQHA 3NO8A 3OPZA 5BNOA 1R1A2 1QOOA 4HN0A 4K9SA 1CD3G 2X5IA 1FMD1 3WW2A 4INDA 1AR91 1WCSA 1R1A3 1ZZ6A 2BQPA 1WW6A 3PTYA 2UY9A 1MZ6A 4XETA 3RWNA 4JQRA 3MLJA 2AUYA 4DXZA 5BYNA 2ZGNA 4XJ8A 1MZEA 4FPJA 2UWCA 1DQ1A 1RITA 4JTNA 3M4FA 4N43A 4XXAA 4B4QA 1FOD3 4I0WB 5E16A 5T5OA 4S2HA 4HZFA 2W08A 2ZGKA 1FV3A 1FYUA 4Z8BA 3WLUA 4IV1B 5CIRA 4LEJA 4B4RA 1O5LA 3E6DA 3D5OA 2HYKA 4P9YA 2WQ4A 3EQEA 3WZ1A 3DUIA 4LBQB 1TQ5A 2VY0A 3ES1A 2ZOEB 4IV1C 1OMIA 3WQ0A 1CN1A 4K20A 4H3WA 4IEXA 1YO8A 4AK3A 4C1WA 1YFXA 4DFSA 4XILA 4C0BA 3QOPA 2IFWA 2C0ZA 1RUC1 2DCYA 1XNBA 3S0MA 1T6GC 4CYDA 4MGZE 2CGNA 5HXVA 3I7DA 2DUPA 4FOWA 2ARXA 1PGSA 1HXS2 2EXKA 5C9AB 4N53C 3FLPA 4WV8A 3USUA 3W9AA 1AF9A 2ZGOA 1QQP1 1IQAA 1IGOA 1PGL1 3LGRA 4XHXA 4GIQA 4Q4Y2 1SLCA 3BB6A 4FO9A 1WMDA 5C9AC 2GU9A 2I74A 4AFBA 3USSA 1LOFA 1UKGA 4AVBA 4P9GA 1D4M2 2YV8A 4MV2A 4EWAA 1RUH1 5LRSA 3ASIA 1W6NA 4Q0VA 2A3YA 2B45X 2O8QA 2JG9B 2XLGA 4WVMB 2DVGA 4MGIE 4I01A 1ZREA 5JOXA 4PDWA 1HDKA 3ZYGA 3JD73 1DZRA 5JI7A 4A7KA 4IEUA 1Q8PA 3ZMNA 3JCIA 1H1IA 4HLTA 1S2KA 2JG9C 3ZSEA 2ZAAA 3VKLA 3WDTA 1PNFA 2XJUA 1SLLA 2XJSA 4E9KA 4G9SB 3WV6A 1J58A 2YUEA 4QX5A 2ZACA 1GNZA 3IMNA 4OI0A 4AQTA 3WP4A 1L3JA 1KD7A 1RUJ1 4RR3B 1DIWA 2HWE2 2Q0AA 2EXHA 4ZKTB 2NN8A 3IIAA 4LHKA 3OD0A 3K48A 1VAMA 2HWE3 4AHZA 2Y26A 3MDPA 1PVXA 5BNQA 3N4MA 4YSFA 5A3MA 2XJVA 2GAUA 2K0GA 3LAGA 3SCFA 4RR3C 5K0UA 2JX9A 3IDCB 1UZZA 1W0PA 3KD4A 1GANA 4AVSA 1PMIA 2LTNA 2I2SA 1NLRA 1CAXB 1X36A 4AQSA 3VGIA 3M7AA 1PZ7A 3RJ2X 5J37A 4CDWB 5J96B 4HSJA 1G7YA 1POV1 3WD5A 1CONA 5FQ0A 3QCWA 4PBOA 1H8VA 3SNMA 3VZNA 3R6SA 4X8PA 2BNNA 4Q4V1 4CDWC 4YM3A 1N3QA 1PIV1 5I0TA 4EN0A 1KJRA 1C5IA 4LNVA 3TN92 4ATEA 1AR71 3CNAA 2QZ2A 3RZZA 2R16A 3TN93 1Z0HA 4LBKA 3ZO0B 1RVF3 2HKXA 3OJBA 5TSWA 1LOAA 3L2HA 4Q8LA 2XKOA 3ZX7A 1BMV2 2Q8OA 5DZFA 4Q4W2 2VNGA 2TNFA 2VMIA 2YXSA 3ALQA 2X8KA 2ZTNA 1GSLA 4Q4W3 1QNYA 4QQOA 3H1MA 1ASJ3 3WVJA 1EPWA 3PVOA 3LZZA 1X50A 2ZJCA 5AC92 2GN3A 1Q43A 1RIRA 2VECA 4CRQA 2XHKA 2VMGA 2HWC1 3WP3A 3AZXA 4AEKA 4XHBA 5FPZA 2XLFA 1XNCA 5FMOS 4ZXKA 1EY2A 5I8SA 4GB31 5A33A 3NAPA 5JMCA 3BTAA 2R0FA 3A4UA 4ASMB 3JZVA 4CEWA 3FUQA 3B93A 2WA4A 3KGLA 1G8WA 4RFT0 1GZ9A 4Q4X2 1D0HA 1PZ8A 2ZX2A 4R4XA 3ZXKA 3MF9A 2WNVB 1O91A 2VU9A 4QGNA 4GKYA 1ZVFA 1Q8VA 1VALA 3HAGA 5J98B 4OHVA 4N9HA 2A3XA 3MEPA 1F8VA 1BKZA 1VAVA 2JXAA 2VW0A 1VBD3 2WNVC 2VH9A 3KT1A 1QDCA 2WS92 4OLLA 1H9WA 2H6CA 4DINB 5CFDA 2RM23 4P14A 4PDWB 4LO4B 2WS93 3MPPG 4FVVA 4EN6B 3PVEA 4FOQA 4W6YA 1LKNA 1R091 2A5ZA 4Q26A 4Q27A 3DN7A 2ZMLA 3M2MA 1WW5A 4JAAA 4PDWC 1HQLA 2NMOA 1H2KA 1RUI3 2B9UA 4XTMA 1CGPA 2E7QA 3KGZA 2HWD1 4D3WA 5L36A 1JBCA 4FTSA 4P9XA 2XJQA 2XBO1 3VLBB 4MX3A 4PIYA 1FPN2 1VRH1 2MHFA 2E7AA 2WT1A 5H9PA 3AKSA 4Y1ZA 1Q8QA 5C4WC 4HKOA 4B4PA 1BEV3 5C8CA 3FX3A 3PVBB 2WSVA 4MH0E 1D0GA 1FX5A 3M3CA 5FBZA 1V9U3 4QQ2A 4RHV1 1D2QA 2HWF2 4CEYA 1TE1B 4GH4A 1V70A 3CO2A 2Z2SB 5GZGA 4YGDA 5I0RA 1EV11 2HEWF 3SH5A 4AF9A 1SLBA 2AH2A 4D7TA 3AMPA 1DGRN 1N1SA 2GZWA 2IXCA 4AGVA 4YVWB 4LUMA 3UJQA 5KWRA 3OGJA 3VKFC 3CJIA 1G9CA 4KU8A 2WZPP 2R6QA 1G86A 2D7FA 3GHMA 4YVWC 1A8MA 2CV6A 1ZBA1 2D5HA 5BUVA 3CU7A 3O0WA 3ZXAC 3MFAA 1MEC1 1QJY1 1C8M1 5KHIA 5CFCA 1JOJA 4O9GA 1X7NA 4HFSA 1BZWA 1WMEA 3BU7A 2BUKA 4BOWA 2XB6C 2EXIA 1XXNA 3MI8A 5BNNA 2D40A 1GQHA 4M0NA 3O0VA 1YFWA 1WBFA 5D1IA 5GKAC 3ZDSA 3U10A 1AYM2 4FPGA 3ILFA 1KS4A 1ULDA 1AYM3 3ZN6A 4COUA 3VKOA 2PHLA 2DU1A 1Q5OA 4AEDA 5CB7A 2R30A 5SV8A 4B3NA 4XTPA 1UAIA 2JG8A 2A6ZA 5CVRA 5CBLA 2EA7A 4Q1PA 1NQDA 3NKTA 4KG8A 3GZTB 5A33B 2AZ5A 3IT8A 1YYNA 3LB9A 3NSTA 1JTZX 2XLAA 4HVQA 3AZZA 3MW2A 4XBQA 5AVPA 4QQLA 4GALA 1LEMA 1YCIA 2WFF2 3ZN4A 1GICA 1NCQA 1TME1 1FNYA 1SBDA 2A6VA 2EF6A 5F6KA 3VKMA 3D6EA 2WFF3 1GBGA 2PAEA 1QU0A 4GMP0 2O0OA 2D43A 5ABJA 4P5HA 4RA0A 1U5ZA 4BPZA 2BYVE 1X8MA 4DY5A 3B7MA 4OI4A 1CX4A 3VBUA 4FCAA 1ND2B 1YFUA 2G9FA 3AYCA 4EWEA 1MS4A 3ZSJA 3TB0A 1SQ4A 4XJAA 4HKWA 4FTEA 3SISA 1ND2C 2RMU2 2YPJA 4HL0A 1KRIA 2RMU3 4YZ2A 2YROA 1PO11 4MYEA 2D5FA 1ALYA 1MVQA 3MIGA 1MZFA 1UMZA 2RS32 1G9DA 3VZKA 5FO9B 2BPA2 4AXOA 2WJSA 4I02A 2RS33 5T50A 4YARA 1VBA1 4C0HA 1WLWA 3H1WA 2GC3A 4FPEA 4IV1A 5C8CB 4F8AA 4XOGA 1CAWB 4CDUB 4R4ZA 1K5MB 3WG3A 1Y3TA 5GLUA 2MEV2 3AYAA 2CAVA 2Y0IA 2QJVA 2MEV3 3O14A 1YIPA 5C8CC 3HT2A 4CDUC 1OD5A 3MIDA 3FLRA 2CWMA 2WZR1 3ZFFB 1K5MC 2HEVF 4N53A 3CEWA 5F6LB 1C57A 2ZAHA 3DL3A 2WINB 1QJX1 2R062 4U2AA 2XG3A 5KHJA 1AUYA 4YNIA 2PHTA 3AMNA 5LEKA 4HKLA 2BBVA 1W6OB 3EBRA 3ZFFC 1RUF2 5C9AA 5FDBA 1ZA4A 2PHUA 4FTBA 3THPA 4XW3A 1ND3A 5EWSA 1RUE1 1RUF3 4AEJA 3ZYPA 1Z7S3 1ZZBA 3BOPA 3FBMA 2BFUL 2RS11 5EV7A 1DQ5A 1PNGA 2ILMA 4FPYA 4I0BA 1IS5A 3JUUA 4HVRA 4AG4A 2BVVA 1HQWA 4GULA 2WNUB 4GMP3 5CFCB 2R072 4D7YA 3RJRA 2OUJA 2R073 2QCSB 3M3IA 5H9SA 1ZX5A 5I0UA 3N7KA 2CTVA 2XJPA 4C90A 2BNOA 4CDQB 5FRAA 5BNNB 1V00A 3N3HA 2WNUC 3PNAA 5CFCC 4UW4A 2DU0A 2WIIB 2ZX4A 4WVMA 1FT9A 3H50A 3VHPA 3ZVXA 3L9JT 3CLPA 3NV4A 4Y1VA 4N90A 3JBG2 4CDQC 2B5HA 1DQ4A 2H0BA 4DS0A 5ACA2 3RMYA 3NV3A 3JBG3 4P9JA 4QPIB 1IHMA 2Z42A 1CQ9A 5EFUA 1H8TB 4NHLA 2RS53 5F5QA 3AYDA 1Q8SA 3VUOA 3KZ4C 1VBB3 4LBJA 5EZWA 4BM8A 1AVBA 3DF0A 1RL3A 4YG6A 3O12A 3OF1A 1UU5A 4UW5A 4QPIC 1YI9A 3R05A 3KT7A 1H8TC 1KDKA 4JGYB 3TRSB 2ZS6B 4X8NA 4E2SA 1NZCA 3I4IA 4B8EA 4RR3A 4I3GA 4AI2A 4LT5A 2F6BA 1YUDA 3I59B 3G7DA 4LHNA 4U36A 2G4IA 4JGYC 1PO22 2R043 2GC2A 4JDOA 5K7PA 2FBEA 5ABJB 5IK4A 1PO23 1S0JA 4AVAA 3AFKA 4NHKA 1AR92 1TNFA 1KITA 3AKTA 5T52A 1LU2A 1IPJA 2UU8A 2JDZA 3J8F3 1CAXA 1NA1B 3JB4C 5DZGA 3S30A 5D8AB 2GNTA 3NJZA 5KXDA 3VBUB 3K51A 3N7JA 3FMGA