4XFFA

Cysteine dioxygenase variant - y157f at ph 6.2 with dithionite
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xffA00
3E5XA 4XF4A 4HVQA 1EP0A 1QY4A 4HSLA 4AVAA 1ZZ8A 5FLIA 4XFFA 4F8AA 2XL7A 1UIKA 5J3UA 5CU1A 4E2GA 3MPBA 2GC3A 3H50A 4OFGA 4MH0E 5CADA 2QDRA 4FAHA 2XLFA 1PMIA 1TQ5A 3R6SA 3KGZA 1CX4A 2GU9A 3IBMA 2IXCA 1CAWA 1RC6A 4EWAA 4KL1A 3SCHA 1Q5OA 1YWKA 2XL9A 1ZZ6A 3NL1A 3RYRA 3ETQA 4XETA 3UKNA 4MGKE 1NZCA 5BXXA 3EQEA 3E6BA 3H1YA 4WZCA 2QJVA 5FPZA 1EYBA 2PHDA 4LA2A 4EWDA 2GC1A 3RPQA 5FQ0A 3M3IA 5JAXA 5FDBA 2EAAA 1QXRA 5LEKA 2K0GA 4NVPA 4XFIA 4KWKA 3EHKA 2O8QA 1CAXA 1CAUB 4MGYE 5T3NA 4KWJA 5KHIA 3OCPA 4HZFA 4LEJA 4QM8A 1UIJA 3IDCB 2GH2A 3SCGA 3CLPA 2O1QA 4JVAA 1ZREA 5JCTA 4I02A 4PIXA 3LA2A 3D82A 3EJKA 3IWZA 4QXKA 1LR5A 2VECA 2XGXA 4QMAA 1NE6A 4QGMA 2EA7A 3H3ZA 3ES4A 1X8MA 3KMHA 3MDPA 4A2UA 4LTAA 5I0RA 1I6XA 1O3TA 2UY9A 4D7TA 4GULA 4XFAA 4Q29A 2D93A 4HBNA 1RL3A 4X6QB 2H0VA 4BHPA 2CV6A 5HI0A 2D5FA 4IESA 2GC2A 1FI2A 2PHLA 1O3QA 1LB2A 2Z69A 3N4MA 4LUMA 1CAVB 3FWEA 1XE8A 3HIFA 3IIAA 1DGWA 3NVCA 4BYYA 1DGRA 1OI6A 3KGLA 1XRUA 3PNAA 2PYTA 4IEOA 4WVZA 2N7GA 4MGIE 4UBGA 1ZZCA 1SEFA 3RZZA 2BYVE 1CAUA 2PAMA 4HN0A 1YFUA 2Q1ZB 3I59A 4KWLA 3NJZA 5I8TA 4UBHA 3O14A 2QVSB 2B9UA 4Q0UA 3CL1A 2VPVA 3DN7A 3ES1A 4I09A 4DINB 1DZTA 4PIZA 1J3RA 3CO2A 3ELNA 4YYOA 2P17A 1J59A 1H1MA 4JV4A 3QOPA 4TLFA 4IETA 2KXLA 3OD0A 4QGNA 3LWCA 4IEYA 5I0TA 4EWEA 3BPZA 4FBFA 1J1LA 1YFXA 4P9GA 2Y0OA 2Q4SA 2OZ6A 3S0MA 3E6CC 4Z82A 5EFUA 1QWRA 3JZVA 3LZZA 2H6BA 4XFGA 2PAEA 2B8MA 4AQ6A 1X8EA 3BU7A 2UY8A 3KCCA 5C8WA 4META 3USSA 3IDBB 2V09A 4Z07A 2D40A 4QX5A 4I3PA 3CJXA 4PJYA 4Q0SA 5JSPA 3PLQA 2CAVA 4E2QA 4YSFA 3OF1A 1H1IA 2IXIA 2QNKA 3EO6A 3OTFA 1YFWA 1ZZBA 2MNGA 4UXAA 3H1WA 2XKPA 4HMZA 4QGLA 3M70A 4IEUA 2BNOA 2PFWA 3BALA 4HSJA 4I0AA 5KHGA 1I5ZA 4AXOA 5CVRA 2CAUA 2ZKLA 5JR7B 4E2SA 4N9IA 2Q0AA 3NKTA 3RYPA 4F7ZA 4Q0VA 4IERA 2QCSB 2C0ZA 4R52A 3G7DA 4I2OA 4HVRA 4RD7A 4HVOA 2OZJA 2DCTA 1Y9QA 1O3RA 3CF6E 3FJSA 4EV0A 5EZWA 1YLLA 3BB6A 1VJ2A 4X6RB 2HJIA 4O9EA 3QACA 1WGPA 5KBFA 2E9QA 1UW8A 5J48A 2OA2A 2I45A 3ACLA 3MZHA 3GBFA 3E97A 5J7MA 4XF3A 1HW5A 4HLTA 3E5UA 1VP6A 4J1XA 4K8FA 2F4PA 4I0BA 3ST7A 1RTVA 4LULA 1J3PA 1L3JA 1Q43A 4O9GA 1X7NA 2ZCWA 4IEWA 3FX3A 3DKWA 3RDIA 4JTNA 2IXHA 3U10A 4MUVA 5JSRA 1RUNA 5I8YA 2IXJA 1LKNA 3NW4A 2EVXA 1SQ4A 3FZ3A 5D1IA 5E1RA 4KU7A 4LLOA 3WW1A 1UCXA 1UPIA 2UYBA 1NXMA 4YRDA 2XKOA 4KU8A 5BUVA 1CAWB 2OYZA 3SMHA 4MV2A 1IPKA 3U0ZA 3WW2A 1ZVFA 5E16A 1ZRRA 3E5QA 2B5HA 1YUDA 2PTMA 2PQQA 2OPKA 3DV8A 5AVPA 3FFQA 4AVBA 4JTOA 5F1RA 4MGZE 1XE7A 2BNNA 1ZRCA 2GC0A 1EY2A 3WW3A 5JSOA 5I0UA 2BGCA 3D0JA 3H7JA 3VHRA 4IEVA 3KSCA 3LA7A 5LRRA 1CAVA 1Y3TA 5C6CA 3UKVA 2PAKA 1OMIA 1SFNA 3SCFA 3U11A 5I91A 3HT2A 3S7IA 1CAXB 1DZRA 4IEPA 1WA4A 1O4TA 4ZU5A 1Q3EA 2H6CA 3ZDSA 1U12A 3EBRA 1OD5A 1OFNA 1ZZ7A 1NYWA 4HN1A 4XF9A 1O5UA 2BEOA 5BPXA 5K8SA 3NSTA 4XF0A 1LRHA 3H3UA 5LRSA 3RNSA 1ZZ9A 4IEZA 2CGPA 4MZUA 2IC1A 2ATFA 3HT1A 2D5HA 1GQHA 1O3SA 1G6NA 1ZX5A 2BNMA 4ZU7A 4XFHA 3H8UA 4IEXA 3SXWA 1J58A 1IPJA 1VR3A 2GZWA 3WW4A 5KHKA 2Z2SB 1NE4A 4FAGA 4BIFA 4CYDA 1GQGA 3RYKA 3B02A 2ET1A 4L11A 4YNIA 5I93A 1CGPA 1FT9A 3LOIA 4OLLA 1UD1A 1ZNPA 4MX3A 1V70A 1FXZA 3E6DA 4WBBA 3GYDA 1JUHA 1QXJA 1O5LA 3I59B 3C3VA 4IEQA 4XFCA 2Q30A 2WFPA 3HQXA 4Q0QA 1RGSA 3S7EA 4ONUA 4B29A 3MYXA 4R8HA 1J3QA 3PVBB 1YHFA 3H1MA 2MPFA 3BCWA 1EPZA 5I8SA 1O7FA 2IXLA 1X82A 5LEJA 5FCCA 2XLGA 4EROA 4AQ2A 1PM7A 2MHFA 1YFYA 2HKXA 3CEWA 4BH9A 3TNPB 2GAUA 5KHJA 4LUKA 2WC2A 2FMYA 3D0SA 4XF1A 4XFBA 3LA3A 3SHRA 4L2NA 1ZRDA 2XHKA 4PIYA 2FQPA 3I7DA 2XLAA 4LA3A 4N9HA 3FE5A 3TNQA 5FLJA 4AVCA 4D7SA 4H7LA 5BY5A 3H9AA 4QM9A 3LAGA 2ETEA 5BV6A 2K9ZA 3FHIB 3DL3A 4Q0PA 5I0SA 5FPXA 3I54A 1WLTA 4I01A 2IXKA 4ORFA 2VQAA 1RUOA 3OGJA 4FT8A 4ZU4A 2PA7A 2UYAA 3H7YA 4XEZA 5KHHA 2ET7A 5FQ0B 3ROUA 3UKTA 4YARA 3L2HA 5FLHA 4J1WA 1ZRFA
chains in the Genus database with same CATH superfamily
1I9RA 2WSVA 1AR72 2OT7A 3CHXA 4JGZA 4JRAA 1DDLA 5FYYA 4XYXA 3WY6A 1LENA 3AP7A 5J37A 1ZZ8A 1F31A 1LULA 2RS32 3AZZA 3CNAA 4F8AA 2A5ZA 3FBYA 3UK9A 4YPJA 5LWBA 3KVBA 4E2GA 4PLOA 2GC3A 1W3VA 2PELA 3GGLA 4NO4A 3AMNA 4CCKA 4TTGA 4LHSA 4CEWC 5F3EA 3I2KA 5LK5A 1D0GA 1IG0A 1WW5A 4DRVA 1HRV1 2WDBA 2ZTNA 1DHKB 3OUJA 1GANA 1BBT2 4MO3M 4OHZA 2GU9A 2PLV2 3IBMA 5DAQA 4UFKA 1UZWA 4LT5A 4CXWA 2VNRA 4LJHA 1EUTA 1KQRA 3VZOA 5FY4A 1KGYA 3O7OA 3SCHA 3ZOIA 1Q5OA 5K0UA 2R062 1VMFA 2J7MA 4S2HA 3W58A 5LA0A 2XL9A 1ZZ6A 5FP3A 3C2UA 1H9PA 1V0AA 3NL1A 1AR73 3ETQA 4IUGA 4A44A 3UKNA 4MGKE 1AYM2 2YFZA 3EQEA 3FFZA 3NKGA 4WZCA 3SH5A 4FVVA 3RJ2X 1HB1A 5EYXA 3BTYA 4CCJA 4XIOA 4Z92B 1PMHX 2HWC2 4NHMA 2HWD2 2Q1FA 5AFEA 1RUF1 4G9SB 1BBT3 5HCBA 3WP5A 1JZ3A 2C5DA 5LEKA 3VGIA 1OH4A 5ABJB 1UMIA 3OPWA 1Y7BA 3VV1A 5BNPB 4XBQA 1GYKA 4MGYE 1DG6A 3PVNA 5KHIA 3K4DA 4HZFA 1FATA 5F3IA 1UIJA 3IDCB 2XPJA 1ULDA 2AEZA 2A3WA 2GH2A 2ZX1A 3CLPA 4QPIA 3POYA 5JCTA 4DXTA 5FZGA 1AYM3 4S2DA 2ZX0A 3W5NA 4LHLA 4IV1A 5JLVA 1LR5A 2VECA 1R092 4CUCA 2ZGOA 5KC5A 1QHDA 1FX5A 2WNOA 1Q56A 4QGMA 4A7YA 2EA7A 5AVAA 3ES4A 2HWC3 3MDPA 2HWD3 3TEWA 5JI9A 3EXUA 4CUAA 3ZIXA 2D97A 4UF0B 5CBLA 2EIEA 4LTAA 5A7WB 1H2NA 4KQ7A 1W9FA 4DS0A 1MACA 3RMYA 3TEZA 5L7OB 5FO7B 1W0OA 1W9YA 2R071 3ALQA 3N9QA 4L9BA 4X6QB 1AYN2 4GJYA 1A34A 2VZOA 2JDUA 3DPRC 2LROA 4YM1A 2DTWA 3K46A 1SBDA 5FRAA 4BQ4A 2BFUL 4FPKA 1HQWA 3H42B 1VBB2 2XOMA 4YGCA 5F5IA 3HR9A 4FCAA 2ZGMA 3N35A 5IVVA 2YBPA 4AL9A 4WVVA 5FZ1A 2E63A 1ULFA 3N7MA 1QQP2 1NCRC 3HIFA 1DGWA 2HWF3 2ZEYA 3NVCA 4FFIA 2ZEZA 4BYYA 1R093 1WUVA 4XTPA 2XUEA 4JC1A 4XHBA 3DF0A 5DDJ2 2E7QA 3D8CA 3P5BA 3SNMA 5JOWA 2N7GA 4QHOA 1RYYA 1V9U2 5CG8A 4D8MA 3HAGA 1W2TA 5FKBA 5FZ4A 4NIAA 1SEFA 2D6KA 3POGA 4HN0A 1YFUA 3AMMA 2B45X 2Q1ZB 4QXBA 1GZWA 2ARCA 2JB8A 3MHZA 4XZUG 2H0BA 1B35B 3WQ1A 4AI1A 5IHRA 1AR61 2WNVA 3AP5A 3RG0A 3U4SA 4UBHA 3O14A 4Q8LA 3E1F1 2B9UA 4WZFA 2W91A 3ES1A 3DN7A 1PK6A 1VBB3 2EIDA 1DZTA 4BK5A 5DPNA 5DAXA 3N3HA 2V5DA 4PIZA 2VMCA 5FZEA 3VBRA 5EQUA 4Y1ZA 4RGKA 4YW1A 1AR71 1QQP3 2DV9A 4IXLA 1J59A 2HBUA 1LOAA 1TME2 3WDVA 5A3UA 1MVEA 2RS31 4BB3A 2ZGPA 2KXLA 4IETA 2YMZA 4QGNA 2Q8OA 2VCBA 1SBEA 1J1LA 1YFXA 5LY1A 3S0MA 2JB4A 3AM2A 5T5PA 3HNBM 3NAPC 1UYYA 3PDQA 4D6QA 2OS2A 1PGL2 1TVGA 4URAA 5JPNB 3KLSA 3GZEA 2PLV1 4WM7B 1DQ5A 2D44A 4XFGA 3TB0A 1LOFC 1MZFA 2LUWA 1X8EA 5T52A 4AQ6A 4MXVA 2VY0A 3NV1A 3DXTA 5C8WA 3W5MA 3WINE 3USSA 2JD4A 4M3CF 2R061 2D7FA 2Y34A 5L73A 1LGCA 4XIKA 1YJKA 4Q4Y3 4PT6A 2V09A 2DCZA 3AP6A 2QQOA 1R1ZA 4PDWB 2VZTA 4Z07A 5JDBA 2A6VA 2FCTA 3MI8A 4LKFA 4BQ5A 3R4UA 1NY72 5C3SA 3IM0A 2AUYA 1JHNA 2AYHA 4I3PA 4PJYA 4HANA 1W6QB 2GNDA 4GALA 4E2QA 2ZKNA 5CFDB 3PUHA 1WMXA 1Y9GA 3AP9A 1K12A 3FN9A 2ZAAA 4AGGA 1Z7S2 1ND2A 1ZZBA 3OTFA 4UXAA 1JYVA 2DWRA 2BBAA 4P9JA 1O91A 5CKNA 5A6QA 2WN3A 3OGRA 1OUSA 3OSDA 3THCA 2BWCA 2YC2A 4M4RA 1NQDA 2VMFA 4IEUA 1C5HA 4IV3C 4E4HA 5LK7B 1AX2A 4I0AA 5KHGA 3MF6A 4W6XA 4Y24A 2W95A 5E8AA 1G9CA 4Y1YA 5CVRA 4D6RA 2UWAA 3AMHA 5FZLA 4PHZA 5F3CA 1U5IA 2P6HA 2Q0AA 1RHI2 4DIQA 4JX0A 1QNYA 2VNVA 1A6CA 3ASIA 2BWAA 1STMA 2X29A 2ZGTA 2JDYA 2NYYA 5C3QA 2Q8DA 5JIAA 3IKWA 3GBWA 3VKNA 4CU6A 3RWKX 3ZYBA 4COUA 1VRH2 4AI9A 5BNOC 2V5YA 4HVRA 4RD7A 4AQTA 5C4WC 4BQ2A 4I2OA 1LOBA 2OZJA 2KM2A 3WNMA 1D7PM 1JODA 1OQEA 3VBFB 4P5HA 4K20A 3FJSA 4LO5B 5C7GA 3BB6A 1AL22 2J1AA 3IMMA 2BPA2 2YROA 2W52A 4IE6A 3LEIA 1AYN1 1US3A 4LR4A 2DUQA 3ATGA 1KDMA 1WGPA 1ZBA3 3QACA 4L0PA 4NAOA 4PLNA 2G9ZA 5DG2A 5KBFA 2WYSA 3JBG1 4OZXA 3B01A 3UT0A 1ND3B 5GALA 4B3NA 1VBB1 1RHI3 4YW7A 4AE2A 3I2JA 1Q8SA 2WZR2 3FLTA 4I0BA 5A6YA 1IS4A 3OD4A 1RXGA 2QFEA 4BU2A 4LULA 1VRH3 3IAPA 1UOFA 5FTTC 2IUWA 3C7GA 3VKMA 5DDJ1 1IGOA 3ZFGB 5I0DA 1V9U1 1X7NA 1SLCA 2ZCWA 2HWE3 4FPYA 4V2WA 5FP9A 3U10A 2VCAA 4AAPA 1QEXA 5F8PA 3ZXLA 1RUNA 2YB7A 1W6NB 2GNBA 1AL23 1COV2 1I3HA 1UMZA 2MEV1 3K4AA 3NNJA 5DQ0A 1RUJ3 2YC0A 3N7JA 2FCVA 4CPBD 1GNZA 3PURA 3X29B 1FPN3 1K5JA 2UYBA 4OHWA 2V4AA 1A3KA 5FY0A 5ACA2 1JZ5A 3WNOA 3VBOC 5JUVA 3O1UA 3J9SA 1AXZA 2DUPA 4E4DX 3INAA 5IVEA 5IFTA 3I3MA 3CU7A 2WZR3 4CEWA 1GNYA 5FZCA 4CEYC 4Y1XA 1WCQA 5DABA 3WNLA 4EN8B 1TME1 4CVUA 1ZRRA 5FOJB 5K0UB 3MGUA 2B5HA 4LO8A 5AVPA 1GFF2 3O1SA 1DF0A 5L9VA 3VHOA 5FZ3A 4CDWB 5JWPA 3K3OA 1OH3A 1XYOA 1RIRA 2CDPA 3TBDA 2QQPA 2PXJA 5FV3A 2YPDA 3QH6A 4AQSA 1RUE2 4PLMA 2ZPXA 1COV3 4UW5A 5JSOA 2JG8B 5I0UA 3D0JA 1PGL1 2YHJA 4ZXKA 4HKOA 4UFHA 1IS3A 2P37A 2OQ7A 5CA6A 1VBA1 4B1LA 2DFCA 3LA7A 5LRRA 1BYHA 2QQVA 1CAVA 3KV4A 2FZ2A 3UKVA 3U11A 1SFNA 1EUUA 4GQ7A 4COWA 5K4LA 1QJU1 3HT2A 4CUGA 1MPXA 1XU2A 3KQ4B 2HH9A 3VDDC 4XJ8A 2YDEA 3VZLA 1DZRA 2WT1A 4AHXA 1NY71 1UN1A 4GH4C 4IEPA 1O4TA 2QUOA 4Y20A 2XJSA 1U12A 3VZJA 2VOTA 5AC92 1GQPA 1E5SA 4GWMA 4LHKA 1VLNA 2ZOEB 2VXRA 3THPA 4HN1A 3VDCA 1Z7S1 5FZFA 1O5UA 1ULGA 2BEOA 2UU8A 1RUE3 4IV1B 2ENRA 5ANQA 1Z78A 4M0NA 1JUIA 2ZEXA 5K8SA 1VBE2 5EXOA 2WNUC 3H8OA 3MW3A 3H3UA 3BVCA 4LBKA 5LBCA 2IWGB 5LRSA 1ZZ9A 2CGPA 4QKBA 2P3KA 4COVA 2WFF1 3AKPA 1FV2A 4XUNA 5A33A 3N9MA 3MF9A 1UQXA 1UY1A 3JXSA 3Q8EA 3D3AA 2RVAA 4URTA 1TZOA 2DCJA 4ASKA 1ZX5A 3KB5A 5D8AC 3K48A 2PHUA 3PUAA 2BP6A 4XFHA 1W6OB 5F9TA 1J58A 1VR3A 2W1UA 5A1FA 1T6GC 1VRH1 5A7SA 5KHKA 1NE4A 4QB6A 4CDXB 5KXBA 1KITA 1DQ2A 3DPRA 2GN3A 2P34A 4DB5A 2WUHA 2UURA 4XQ4A 1U5XA 4BMEA 2RM22 2WLPA 2YU1A 3RYKA 3B02A 1BVP1 4NIIA 1W9WA 4OHVA 4GWNA 2CU5A 1H2LA 2R6QA 3H3LA 4DXZA 2B7YA 3KF5A 4OLLA 2BW8A 1UD1A 3O0XA 1NCRA 4DXRA 4QHZA 3ACHA 2YU2A 1X36A 2R7EB 3MIEA 4WBBA 1KJLA 3KV5A 1GZWB 3HQUA 3B93A 1AR83 3G6JB 1HXS1 1O5LA 2WNVB 4UW3A 3ZSEA 4AOCA 4JQRA 5FZBA 2CY6A 3WP4A 2FDKA 4Q0QA 2LS6A 4W65A 4KBZA 1PK6B 2PHTA 4B29A 3GZTB 4GIQA 4R8HA 3VBRB 4NRPA 4R4ZA 2MPFA 3WHUA 3OBAA 5FMDA 4GB32 3MLKA 1O7FA 1ZBE2 1X82A 5FXZA 5FCCA 2XLGA 3LIGA 5DAWA 4AQ2A 1YI7A 4LIVA 5FJKA 4BH9A 4XZPA 3TNPB 2WWUA 4FPOB 4OUEA 5T5LA 5FFOC 1QKQA 2GAUA 4GWJA 3VBUB 4FTEA 2QKDA 4OQ9A 2AH2A 4IE5A 2VW1A 2WC2A 3AJYA 1U0AA 4W6WA 4JAAA 1TMF1 5ACA1 1WW4A 4L2NA 1APNA 3KT1A 3R05A 2DBIA 4I0WB 4IE0A 2XHKA 5FYCA 4ZXEA 4PCRA 3KT4A 3NAPA 4Y33A 4JDOA 1YRZA 1VBC2 1MZEA 1XSRA 4LA3A 5LA2A 3TNQA 5FLJA 5J36A 2O8OA 5FZKA 4MXWA 3WQ7A 3KHCA 4FQ4A 5BY5A 5EIYB 3H9AA 2W1WA 4QM9A 1GZ9A 4JKMA 4YZ3A 5FJHA 1LOFA 1W9SA 1ZRIA 5C71A 2ETEA 3ACIA 5BV6A 3WP6A 3M1HA 4GB33 1GOHA 1F8VA 4XAAA 3HOBA 2OPWA 3S30A 3O1MA 2E33A 1MVQA 2G9GA 4NAMA 5I0SA 2VQUA 2YY1A 4AK3A 4HPKA 4B4RA 4NHLA 5BNNC 5IJRA 2VCCA 3KM5A 4DY5A 4QAWA 3GCXA 2YXSA 1PNGA 4I01A 4QQHA 3TN91 1ST8A 2AZ5A 3N36A 4DMIA 1W9TA 2ERFA 4A6SA 3NNGA 4XEZA 5KHHA 2FD8A 4A6OA 1R1A2 1OXCA 4Q1RA 5FQ0B 3ROUA 1JYWA 2IVJA 1VBC3 3FMGA 5JVVA 1X9TA 1HDKA 4BXFA 3HBZA 3WCSA 1ZRFA 4J25A 3MLLA 4Z1VA 4R4XA 1BEV2 4LIUA 5AC91 4HSLA 4IV3A 1XNBA 2OUJA 1AX1A 5FLIA 3V65A 4SLIA 4XFFA 2QQUA 2XL7A 3D6EA 5J3UA 1WZXA 1XNAA 2TUNA 2V72A 3IT8A 1JTZX 3O1PA 2Y64A 5LBBA 3UV9A 1VBE1 2E51A 2VMDA 4JDMA 3N7KA 3IMNA 4AEDC 1S4CA 2QDRA 4RSUA 2A6YA 4FPFA 3WT3A 2KA3A 4M01A 2IXCA 3LFIA 5BNOA 1DCSA 1HRV2 3DYMA 5C4WA 1CAWA 1LAJA 2J1EA 4M3CE 5FZOA 2VZQA 4KL1A 1REDA 2JDAA 2Z5WA 1RUG1 1VBD1 1PZ9A 3MPPG 2FZ1A 1DQ6A 1S0EA 1RUI1 3J4UH 4TXWA 3RVHA 4S2FA 2VCMA 5BXXA 1XYPA 1VMHA 2Q5TA 2QJVA 3CJIC 1PHMA 3H1YA 3MBWA 2VU9A 4R9DA 4BCUA 2R16A 5KR7A 2PHDA 4BQXA 1WLDA 2RM21 5BNQA 3NV4A 4K6BA 4LA2A 3WG4A 1OQDA 2CNAA 3RPQA 4H2AA 4Q8KA 4H3WA 2CYFA 2EAAA 4HKLA 3ACFA 3LE0A 3B00A 4ISRA 1HRV3 5FZHA 2O0OA 4KWKA 1CAXA 1GP6A 5T3NA 1V6IA 4KWJA 3OCPA 4LEJA 4AW7A 4RL7A 4E9KA 1BQPA 1MS1A 4QM8A 3VBSC 1POV0 4QWNA 1OLQA 4RS5B 3SCGA 2C6SA 5F5AA 3WSOA 2VNGA 5EP9A 1DBNA 2O1QA 4KMQA 1Y4WA 3WNNA 3BTZA 4AEMA 4CSWA 1GKBA 5F5CA 1HKDA 1W6PA 3ETPA 1R082 3EYPA 2VAUA 4CEWB 4QMAA 2XGXA 1UOBA 2CDOA 3CMGA 3T30A 1NE6A 2LRPA 2Y6LA 1ZBE1 4XHXA 1W8WA 5GKAC 3VBOA 4A41A 3ZVXA 4ITCA 1UY3A 3LDBA 4FFFA 4A42A 4A2UA 5HXMA 5JXIA 4BDVB 5A7PA 1O3TA 4CEYA 2GP5A 2W0XA 2VZUA 3FHQA 4ARYA 4ET7A 1RUF3 4XFAA 4YVSC 2WA4A 1OFSA 1RL3A 1HQLA 3FLRA 5FZIA 2D5FA 4IESA 4FPGA 1OVPA 3VZMA 1PO21 3MUY1 5HCFA 3ON7A 1FI2A 2R072 4AGVA 2PHLA 5F37A 1O3QA 5A7OA 3P6BA 1HRI2 3H0OA 4PBOA 5FY7A 1H4HA 4UFJA 2ZHMA 3KF3A 4LUMA 3I3BA 1CAVB 2WLQA 2RR11 1XU1A 2VQ0A 3WP3A 3FWEA 5K7PA 1JBCA 1QJX2 2P3JA 1W8HA 3MUZ1 2X5IC 5J1XA 2VG9A 4JDNA 3ZR5A 3ZN6A 4YGEA 2K2SA 3T4VA 3KGLA 2GMPA 1RMU1 1F35A 4IEOA 4RQPC 5FMCA 1W0NA 3C7OA 2VQTA 4MGIE 3U78A 1ZZCA 1V6KA 1VRBA 1CAUA 2HEWF 4OVEA 3VDDA 2VUJA 2WZEA 2XHNA 4GH4A 4Q5OA 3I59A 4MHRA 1LU1A 2W1SA 4FTBA 1PMJX 3KD4A 4W8JA 5JI7A 2EIGA 3WF1A 1R1A1 4UW4A 2R073 1AR62 4HFSA 3VLBB 3OY8A 1M4WA 2VPVA 5A70A 2VZSA 4I09A 5JXJA 3VKLA 4DINB 1OA3A 5A33B 4B1MA 2JDKA 5CEHA 5IATA 3QD6A 4JQTA 3UETA 2K46A 2P4EA 2ZA9A 5FK8A 3CO2A 4C0BA 1XE0A 2WNUA 2XJVA 1BEV1 2P17A 4XXAA 4QB2A 1HN1A 2RDNA 4JV4A 3GJBA 1NKGA 1BK1A 3BTXA 2GNTA 3VBHC 3ABZA 4M3CA 2BQPA 3JU9A 3DYPA 2WRAA 4GXLA 4NRMA 1CZSA 2CWMA 4QHBA 5IVJA 4UYBA 1NLQA 4FBFA 2A70A 2QQNA 3FLPA 3K3NA 4AHWA 4DO0A 1WLCA 1S0CA 1VMJA 5E88A 1G7YA 3DPRB 1JHJA 5D8AA 1VB2A 1SDDB 3JZVA 4RFT0 2VR4A 3LZZA 1JZ2A 4XE9A 4RGAA 4OULA 1AR63 2HYKA 5FWEA 2VMHA 3KCCA 2PQSA 2FDJA 2WQ4A 4META 1NCRB 5T5JA 2WL1A 3TWIA 1V6LA 1YIFA 4ATEA 4XXPA 2NM1A 3ZN5A 2JE8A 4XPVA 1HB2A 5FMOS 1F2NA 1W2AX 1H6XA 1C28A 3HBKA 1MS3A 1HQNA 5FXVA 1WBFA 5A3OA 1QOSA 1POV1 3W59A 3CJXA 3PIJA 4Q0SA 4DUVA 1E5HA 5CKQA 1AF9A 2NMNA 4RYDA 5JIUA 1QMJA 2JKBA 4NIGA 1LTEA 5B4NA 5M0TA 2RS33 4DEVA 2QNKA 4LK6A 3B9IA 1DU3D 3AL6A 1YFWA 5IK5A 3ZDVA 3H1WA 1IKPA 3WDWA 4OUSA 4OZOA 4WM8C 1PX4A 4H7MA 2Q8EA 2JWPA 1PIV1 1W06A 1RJ7A 2BNOA 4NHXA 2PFWA 2XVGA 4UFLA 5GLWA 5D2AA 2PLV3 2DVGA 1S0IA 2CSGA 5A80A 5FZAA 3ZN4A 1K42A 1N3OA 3C7FA 4CCMA 3SLIA 2ADDA 2DVAA 2JD9A 3RYPA 2R063 5C8CB 1H2KA 2QCSB 3VL8A 2C0ZA 2J1VA 4FXKB 3NAPB 4TZDA 4R52A 1R081 3USUB 5H9PA 1H8VA 1C8M1 3AZWA 3TAYA 4QXHA 1Y9QA 3ZMNA 1L7RA 1YEWA 3O5SA 5EJ3A 1O3RA 1S0GA 2I07B 1UXXX 4FPHA 3I49A 2XVKA 4LBLA 3RI9A 4EV0A 3RJRA 4QX2A 1VJ2A 2VH9A 3J7HA 3ZYJB 3FC0A 3POIA 5FWJA 3T0BA 1SCRA 5JXHA 5CFCC 4WVMA 1DGWX 4HPKB 3RZHA 2WABA 4O9EA 1XQNA 1N1YA 1RINA 1LNSA 1CESA 1C5IA 2A6WA 2J22A 1MQTA 4GMP0 5EYYA 1HRI1 2WA3A 5C9AB 3GBFA 4Z8BA 3JBG2 5BNNA 1JOPA 1HW5A 3GJAA 4K3UA 4HLTA 5FY9A 1QJX1 3E5UA 2F4PA 4GMP3 1WCSA 1NG0A 3IPVB 5HXVA 2JG9C 3I2IA 3R4SA 5A3NA 2WWSA 3RZKA 4UWDA 4LBOA 1Q43A 4P00B 3WOGA 2NLRA 5IT6A 4FSJA 2F4LA 5J96B 2QQWA 1JN2P 3LEKA 1S2KA 2C9KA 4IEWA 3N9PA 4RHV1 3RDIA 2IXHA 1FAYA 4CXYA 2WBKA 3BTAA 4QPYA 2IXJA 4LHNA 3WHTA 3WR0A 4OI0A 5LA9A 3KCYA 1WBLA 1SLIA 2EVXA 3CQOA 3NW4A 3OYWB 2J1RA 4K40A 3VD9A 2E26A 5KXEA 5FY1A 4Q1PA 2MEV2 4LLOA 2RS12 3WW1A 4A7KA 1UPIA 1AYN3 1JYXA 1NXMA 4LKEA 4YRDA 2JKXA 2R30A 3JBG3 3ZXAC 5LZ6A 4Q4X1 3S57A 4MYEA 5BUVA 3OUHA 1LHWA 1CAWB 4YW3A 2OYZA 2ZABA 3U4XA 2J1UA 4AEDA 4LBQA 5FZOB 4KGGA 2R042 3TEXA 5E16A 4Y5Z0 5A3MA 4F3JA 3E5QA 5FYMA 1UKGA 3BGAA 4QU1A 2PTMA 4AVBA 3LKJA 3FFQA 3UNPA 4D6SA 1UWWA 5DDJ3 2BTVC 4MGZE 1V9U3 4YZ5A 3AC0A 3ZXEA 2BNNA 1DYPA 3WW3A 3GDBA 2OXBA 1JYCA 2E31A 4JHTA 5FREA 2VTFA 3M4FA 1KFXL 2BZDA 1QJZA 2MEV3 5DUUA 3CJIA 4YM0A 3A0KA 2WSUA 1SCSA 4UFIA 1Y3TA 3T0AA 3RFRA 4A45A 4LKDA 5C6CA 1VBA2 3OPZA 1OMIA 5GJ6A 3SCFA 5C5TA 3WUCA 5I91A 5JPMB 4FP3A 4YW4A 3S7IA 3N9OA 4CA9A 1OLRA 2ZEWA 4ISQA 3W20A 1CAXB 1QJU2 3I2HA 4DPNA 1LEDA 2JDHA 4AFAA 4CDQC 3MV01 3VZNA 1KD7A 1ULPA 1WA4A 3SISA 2DDUA 3ZDSA 3ZKYA 1WCDJ 1OLME 1TME3 5A6ZA 3EBRA 5CG9A 1OD5A 1AJKA 2YV8A 3VD4A 2WINB 3AK0A 3AZVA 4XF9A 3ILFA 4PI2A 3VBSA 5BPXA 1W6PB 2LALA 1JYNA 2RS52 5F6LB 1QH7A 5DN2A 3VBOB 1EAH2 4TN7A 1CVNA 1CX1A 5IYYA 3FUQA 1W6MA 3WF0A 1IKQA 1RUC1 1UNBA 3ECQA 3VDBA 3OOXA 5APAA 4CEYB 3UGGA 1VBA3 3RZGA 3AZXA 1AL0G 3MFAA 2ATFA 3R0RA 3WZ1A 1AXKA 3ZFEC 2WFF2 4EJRA 2A73B 2CWSA 1PGW1 2D5HA 3LEGA 3MIDA 1WW7A 3GM8A 2WO3A 2P3YA 1GQHA 1LOCA 1LOEA 1QJU3 1Y43B 2RG4A 3I8TA 4P5YA 3I2OA 1D4VB 4GMP1 3H8UA 3VKFC 1QIQA 4YVSA 4IE4A 3WW4A 3JUUA 4BWOA 2BGPA 1GSLA 2WS92 3KHBA 3M7AA 3VN4A 5EV7A 1Q8PA 4P9LA 4B4PA 1IPSA 1DP0A 2JX9A 4BIFA 2D6MA 1JMUB 1GQGA 1L7LA 2BFUS 1O4ZA 1HB3A 4L11A 4YNIA 5I93A 1Z7S3 2B42B 4FPLA 1CGPA 3A22A 1BVVA 3AMPA 3S5AA 1NCQC 4LE3A 2X5IA 2G4IA 1V70A 4CU8A 3VDDB 3E6DA 4IL7A 2UWCA 3AZYA 2A6ZA 5CISA 1X33A 3GYDA 1GLHA 1JUHA 1B35C 1HV0A 1WD3A 3LCPA 4RQPA 2WFF3 4GH4B 3I59B 2EF6A 4Y4YA 2ZXQA 2JICA 5HCAA 3RWNA 1HXS2 1W39A 4QT6A 4FFHA 3V0BB 4HONA 4Q2FA 1AXYA 2ILMA 1SFYA 2B46X 3NV3A 1OF3A 2QQLA 2WN2A 4A7ZA 4DUWA 3MYXA 2GP3A 4QKFA 4Y1UA 2XMLA 2XJUA 4LKSA 4HKWA 1YCIA 1GZCA 2WNEA 5CZKA 5LB6A 2WNUB 3D5OA 1R64A 2EICA 5I8SA 3HPNA 3PUIA 3GF6A 3O12A 3ITQA 1N3PA 4JGZB 4EROA 1PM7A 4Y4RA 2XJPA 4FTSA 3AYAA 1DQ0A 2HKXA 3CEWA 4HXCA 1PO11 4ATFA 4AVTA 4AHZA 3VUOA 4QPGC 1QU0A 5DAPA 5FZ6A 5KHJA 5CIRA 3PU8A 2FMYA 1ODNA 2RS11 3AKQA 4K7JA 4XF1A 5D8AB 4XTMA 3VBHA 2DF7A 1JXNA 2ZAHA 3NWKA 2WKKA 4WM7C 1ZRDA 4IGPA 4TSVA 1TMF2 5FY8A 2E32A 1HXS3 1MZ5A 4N43C 1GU3A 1T2XA 2XLAA 4RR3C 4PI0A 1U5YA 1JU4A 4YLZA 3OUIA 1I5PA 4YZ2A 4D7SA 2R041 1JH5A 2ZS6B 4Q4V2 1G86A 4PDWC 3J7MA 1SBFA 3HVDA 3LAGA 3U1XA 2W87A 3OJBA 2FHRA 4DOUA 1NLRA 2K9ZA 1WCUA 4C0HA 4EN9B 1A8MA 1PX3A 3J8F2 3B5LB 3I2GA 2XBO2 4Q0PA 5CB7A 5CFDC 5FPXA 3I54A 1F5JA 1XB9A 2DU1A 2IFRA 3ZXKA 2G19A 1MEC1 4Q27A 3ZYIB 2IXKA 4COYA 3J26N 4W4ZA 4TYSA 1RUOA 4E4SA 3WG3A 1OLMA 3TN92 1W8FA 2WIIB 1QDOA 2XJRA 3FL7A 5JZGC 3H7YA 4XILA 3URFA 1GWKA 1CJPA 1W0PA 2ET7A 1HV1A 1TMF3 5ACA3 4LOSA 4YARA 3MIFA 4COZA 2CGNA 2Z42A 4HG6B 4J1WA 1P8JA 3RGBA 3LQCA 4XMAA 3VKOA 3WG1A 4M0HA 4WM8A 2OKXA 4Q4V3 5E6HA 4XF4A 2Y38A 2X10A 1EP0A 2TBVA 3NRUA 4YG6A 1QY4A 4NR1A 4AVAA 5KXDA 3PIGA 1WCKA 3MIBA 1UZZA 4LO6B 5BYNA 2XH6A 5FUIA 2RJ2A 4QPIB 5F39A 4ZZ5A 4D7YA 1GWMA 4ES9A 4GD4A 4OFGA 4YM3A 2RS51 3C8XA 3V0AA 5DZFA 1EAH1 5FAXA 4L99A 5CADA 2DUOA 3GALA 4OHXA 5IFPA 2XLFA 2RHPA 2ZGRA 1TQ5A 1YXWA 4OMDA 3TN93 3KGZA 1CX4A 3HN3A 1UPSA 3I3DA 2A71A 1WLWA 1C57A 1RC6A 2V4VA 1N1SA 2XDVA 3GHNA 4HOOA 1IQDC 4WVMB 4P14A 1JOBA 1VAKA 2BOIA 5CYYA 5C3RA 5IWFA 1MS0A 2FBEA 2A3XA 4XDQA 2ZBJA 1Q8OA 1RUG2 1VBD2 4W50A 4NROA 3RYRA 4YWAA 2LM3A 1OC1A 4LE4A 5CFCA 5BNNB 1DQ4A 1RUI2 3E6BA 5FYIA 1W8NA 5AC93 2WS91 2VVDA 1NXD1 1EYBA 2WZ8A 4EN0A 3POSA 4EWDA 2GC1A 4QQ2A 3ZFGC 3RZMA 2PHXA 1LU2A 1DGRN 3RZLA 1W28A 1K45A 3M3IA 3PTYA 1XNTA 4A3XA 5JAXA 1G9BA 1NA1C 1VBE3 2GSYA 2JG9A 3T2TA 5J09A 1G9AA 1CR7A 4O65A 3FBMA 4NVPA 4XW3A 3B9CA 4XFIA 2AREA 1OOPC 3MV11 1JZ6A 1KFUL 3OGVA 4N7IA 3KWVA 4DRRA 3K77A 3ZYFA 3NQHA 3P3NA 1TEIA 1NAEA 2WWJA 3LPFA 3ZPOA 4D3WA 4ZZ8A 3GHMA 4XUTA 1RUG3 1VBD3 1CD3G 2A3YA 2W47A 4JVAA 1YJLA 2W1QA 2Y26A 1LHNA 5LY2A 4PIXA 4Q26A 1RUI3 2HLEA 3BOPA 3BPSA 3NJVA 3VDAA 3WDUA 2WQZC 1ZM1A 1LGBA 3I2FA 4NRQA 4QXKA 1YQ8A 2ARBA 2ID4A 2UWBA 3OEBA 1B09A 1JYIA 2WYFA 2XG3A 3WQBA 1OQ1A 4XUQA 4Y5SA 1TNRA 1UU5A 3H3ZA 1X8MA 4BM8A 1DYOA 1UU6A 4PF1A 2W2IA 1WW6A 2RM23 1VAMA 3ZSMA 2JDMA 1SLTA 2UY9A 4CDWC 1GMMA 5HV4A 4D7TA 4GZ9A 3SQOA 2Q1MA 1H4GA 4NPRA 2D93A 4GKXA 1JZ4A 2JG8C 2W92A 2H0VA 4NPLA 2CV6A 4BHPA 1EV11 1N1VA 1UY4A 3AJZA 4XOGA 1LB2A 2Z69A 4P9IA 3N4MA 1PO22 3NJYA 3GBGA 3T2OA 1V00A 1N3QA 4Q4W2 4AFMA 1XE8A 4Q4V1 1HN0A 1KJRA 2DBNA 4LORA 4K21A 1UOGA 4ZPIA 2RR12 5EPAA 1PZ7A 1W8ZA 2CL2A 1OI6A 1UMHA 3PNAA 4LO4B 3VZKA 3WDYA 4AAXA 3J8F1 4WVZA 3AYCA 3ZIWA 2C9AA 2VZ1A 2XBO1 4QQPA 1LESA 2ZGNA 4UBGA 1RMU2 1PM4A 1TNFA 1ZBE3 3RZZA 2PAMA 1MQTC 3SH4A 1GOFA 4JKKA 4H55A 4NHYA 3AKTA 3H8XA 4CDQA 5B2GB 1ENXA 1V6OA 2B9VA 2QDNA 4QQLA 1GUIA 4KWLA 3VBSB 1Z0HA 5F3GA 5FOBB 5I8TA 1AX0A 3AYEA 2A1XA 1A8DA 1ND2B 2P2KA 4Q0UA 4CDUC 3CL1A 3I2DA 1TG7A 3JQWA 2HYXA 1PO23 3MW2A 1GZTA 3BODA 5GLTA 1RUH2 3ELNA 2E7TA 4YYOA 2RR13 4JRLA 1E5RA 4UF0A 1H1MA 5A7WA 1Y9MA 3WCRA 4FOVA 4TLFA 4QD2A 3QBQA 1RITA 1UYPA 3OD0A 3ZFEA 5FYSA 1CZVA 1RMU3 2SLIA 3BI3A 2Q4SA 2OZ6A 5FKCA 2ZHKA 3W9AA 4CDXC 2VTXA 3SEEA 4L97A 4P9XA 1QWRA 1UYXA 4CTEA 4I3GA 3T4HB 2H6BA 2WT0A 3KVAA 5GZEA 2B4KA 1NOVA 2WR9A 1JW6A 4AFDA 2ZGSA 4P02B 2X8KA 2JXAA 3JB8A 1M06G 4K1YA 1YI9A 1POQA 1R1A3 1VAVA 2DURA 2D3SA 1FOD1 3IDBB 4P08A 5DMYA 2W94A 3N9LA 1S2BA 5L36A 1NCQA 4QX5A 1IS5A 3BIWE 1D2QA 4QDRA 5JSPA 1BEV3 3APBA 3T1MA 4KWUA 5FYUA 3PLQA 2CAVA 3T1LA 4YSFA 1CWPA 1B35A 5GLUA 3OEAA 1H1IA 4IGQA 4U36A 1BMV2 4YGDA 5FYHA 4EYUA 2XB6C 1HIXA 1XYNA 2BOJA 5L19A 2PN5A 1FMD2 4TLGA 2ZMKA 1PVC1 2VZVA 1QDCA 4XDOA 3IDEA 2QZ2A 5DUXA 5FYVA 1GR3A 1SHWB 2D43A 2JDZA 3KT7A 3LDRA 3K4ZA 1I5ZA 4AXOA 2VUDA 1PIV2 2W9XA 3MIGA 2HEYF 3VBUC 2CAUA 2IVIB 2ZKLA 3PMSA 3MIHA 3OBZA 5GZCA 3UJOA 3NKTA 1G8WA 1VE0A 4F7ZA 1GP5A 3JD72 4JKLA 3V56A 5HV0A 4IERA 3LB9A 1H8TC 4UI9L 4QPGA 4MVTA 3VL9A 4KH9A 1H1AA 1OA2A 1D0HA 1HJFA 1POV3 4HVOA 4WM7A 2DCTA 5JOYA 4UFMA 1C8M2 2QQIA 4MGSA 4QX3A 2RV9A 4N43A 1CIYA 1FMD3 4RR3A 3NO8A 3LSDA 1YQCA 4X6RB 4V1PA 4FP2A 2YG0A 2HJIA 4MG2A 1XNKA 1GOGA 2BU9A 4PDWA 2JECA 5FYZA 3BOWA 5JXGA 4YW2A 4C90A 1PIV3 1DLCA 2GNMA 1UW8A 1PGSA 4PBPA 5J48A 2OIIA 4ASLA 1G9DA 1SPPA 3ZSLA 4CCNA 4EQVA 4E8DA 2I45A 2TEPA 1W6QA 2Y33A 4Y3OA 3WNKA 2B39A 1X50A 2EALA 2JDPA 1LHOA 4XF3A 5CFDA 4AI0A 5J7MA 4Q4W1 1REFA 1D4M1 3KV6A 1VP6A 4J1XA 1C8NA 3I3EA 4K8FA 4KG0A 3ST7A 4AI3A 5IVCA 4QXCA 5G04L 3IZOA 4LO7A 4UAPA 4YG0A 3NV2A 2QQJA 4CUBA 1O6UA 1KXGA 4J6GA 5JZGA 3DUIA 3L2YA 3UESA 3K51A 1R083 4O9GA 4WM8B 3RS6A 1ONAA 1C8M3 2P6CA 4AZZA 2BGOA 2YBKA 1RJ8A 4Y20B 1KEXA 3C7HA 1L7QA 5JSRA 2VMGA 4RHV2 1LKNA 1UAIA 1KRIA 4ZKTB 1UF2C 3FZ3A 2GDFA 1O8SA 5D1IA 5E1RA 4KU7A 3V0AB 4QDSA 1UCXA 2Y0IA 4P9WA 3ACGA 2YPJA 1ASJ1 2XKOA 2D6OX 4QB1A 4XQDA 4BQYA 3PL0A 1F15A 1GWLA 4KU8A 4LBNA 4N8MA 4MLOA 3U37A 1HRI3 1RUH1 3LF7A 4AEKA 5C3OA 3SMHA 1A78A 3ZSKA 3POEA 1HB4A 4MV2A 4Q4X2 4YG3A 2GMEA 3WW2A 3U0ZA 1QJX3 5SV8A 4IQPA 4ZONA 4C1WA 1YUDA 5JMCA 2OPKA 3DV8A 4OI1A 4N53C 2R0FA 5A3PA 5CFCB 1QJY1 5F1RA 1WD4A 1XE7A 4XQWA 3VD5A 3ZXJA 3IB3A 4RHV3 2GC0A 1EY2A 1S1AA 1BKZA 2XWBB 2VZPA 3M3OA 3PMEA 2BGCA 3KV9A 5LBFA 2ZZJA 3RMXA 3U07A 4YVWC 3VHRA 5LA1A 1GNHA 4O7XA 3KSCA 1OHFA 5T5OA 1NT0A 4D94A 3M8LA 4M00A 1GV9A 5HBAA 2PAKA 2JG9B 3ZFGA 4FPJA 2NPIA 1J83A 1HLCA 2VMEA 3HNYM 3AXEA 1UZVA 4NN0A 4Q4X3 1NA1A 3PTRB 5F32A 1MS5A 5A32A 4RS5C 1Q3EA 2H6CA 3WV6A 3ZKUA 1OOPA 1W6NA 3MW4A 1RVF1 1S0JA 2J1SA 2Z79A 2R32A 4AFCA 1UL9A 5AFBA 4KI5M 1ZZ7A 1BMV1 4N7UA 1SLBA 5A3WA 1NYWA 3ZPYA 1JOJA 2O14A 1FMD1 3OGGA 4H14A 5HCHA 5TSWA 4XF0A 4GA9A 3A0NA 4CP0A 4CPBA 1LRHA 4B7EA 3T09A 3RNSA 1C1FA 3I97A 4IEZA 3MO4A 1K5MC 2DTYA 2IC1A 3IAQA 2D6NA 5GLZA 3LOBA 1QGLA 1QOTA 3ORJA 1RUC2 2IZWA 4X8NA 2ES3A 2XJTA 3HWJA 4QX8A 1QOOA 3JD71 4FXGB 1O3SA 1PGW2 1PZ8A 1G6NA 2BNMA 4CDWA 4ZU7A 4PQ9A 1QJEA 4FOWA 4R9AA 1AR91 1LOGA 1IPJA 5A7QA 2GZWA 2JG8A 5FUNA 2Z2SB 4AFBA 4AVVA 4QKNA 3ZR6A 2FDHA 2VUCA 2XXZA 4QQOA 4XUOA 4CE8A 2OX0A 3OGSA 1RUD1 3LSEA 4RFRB 4MXWB 1CPMA 2P5BA 3POBA 2DCKA 4P9YA 2ET1A 2JIJA 2JENA 1UOJA 3DGTA 1OKOA 2RJLA 2YZ4A 3AB0A 1ZNPA 4MX3A 1J1TA 1DZQA 2X09A 2XONA 4LITA 2VW2A 5FY5A 2VBPA 1SLLA 4W6YA 4XJ9A 5H9SA 4CDQB 1RUC3 2AR6A 4KG8A 1WA6X 4XDPA 3ZFFC 3DECA 4IEQA 4XFCA 3CKHA 4JGYC 3ZYRA 4BISA 2GMMA 3IN9A 2VUAA 4A4AA 3WD5A 1RGSA 3S7EA 2D3PA 1LJ7A 1ENSA 3GNEA 4IW3A 3ZO0B 3QCWA 4ONUA 2HWF2 2ZZQA 5JOXA 4OQ8A 2QQKA 2VE1A 1CONA 1YHFA 4CDUA 1XXNA 3PUQA 1OPMA 1W2UA 4GJZA 4Y26A 4AHYA 4NPMA 5CKMA 2D6LX 5DUVA 2MHFA 3MICA 4IV3B 1DFQA 3ZFEB 1KDKA 3ZX7A 3W21A 4LK7A 1XPWA 3JB4C 5D21A 1H0BA 1PO12 1W8TA 1XNCA 4GAZA 5GLVA 5GZDA 3C7EA 3D0SA 2D3RA 3POWA 3LA3A 4BIOA 1D2SA 1W6OA 3RQ0A 2ARXA 4LXLA 2RDQA 1V6NA 4CDXA 3NJXA 5FZ0A 4PIYA 2FQPA 3I7DA 4JHZA 5EWSA 5FPLA 4DNYA 2NP0A 5A1AA 5BNOB 4H7LA 5C4WB 3ZXDA 1DLLA 2GH8A 2W08A 1NCQB 2VZRA 3FHIB 4DEQA 2CTVA 1ZA7A 4ZS3A 3DL3A 4YFWA 1WLTA 3DEMA 3RI8A 4HT1T 1JZ7A 4ORFA 1QNWA 3Q8AA 4RN5A 4EN7B 3VD7A 2VOKA 2VULA 1F9KA 1PO13 2YGMA 5FBJA 3POFA 4FT8A 5H9QA 3WXPA 1MEC2 3KS7A 3B69A 5FZ8A 2Q8CA 2RS13 2QE3A 2W46A 4Q4Y2 3UKTA 4AGRA 1QXPA 1Q8QA 1XJAA 3BYWA 4WV8A 3A23A 5FLHA 3OPTA 3WEZA 5ABJC 3B3QE 4NJ4A 5BNPC 4IE7A 5FZMA 1W03A 2PHRA 3E5XA 4XJUA 4BE3A 4AI2A 4HVQA 1KS4A 2KD7A 2R043 5C8CC 2BV4A 1GBGA 2VM9A 1NZIA 1JU3A 1FYUA 1XBFA 2WZPP 4QPGB 3VBUA 1UIKA 2I2SA 5CU1A 2YYOA 3AP4A 4CP1A 5ANNA 2FMDA 3MPBA 3H50A 4L8QA 1C1LA 1NX9A 2VL4A 4MH0E 4PQQA 5IVBA 1BBT1 4NE9A 3TYJA 1H8TA 3AMQA 3NMBA 2FDFA 4FAHA 1YQ5A 5C33A 1PMIA 4N43B 4OHYA 1MEC3 3R6SA 4RR3B 4EZ4A 2DYCA 3AVSA 4OCTA 2Z4FA 3WNPA 4AEJA 4EWAA 5T50A 3O1VA 3R4DB 4UW6A 5H9RA 3S6PA 5L7OC 1YWKA 3MFCA 1IOAA 3J7LA 2VMIA 5E89A 1UX7A 3IDAA 2VOVA 2FCUA 1AYM1 4XCAA 5FPUA 1SPPB 4D69A 5C9AC 2F17A 1ODMA 4XETA 3HMYA 3ZSJA 3UJQA 3LFMA 1NZCA 2ZHLA 2ZGQA 3RSJA 3HD8B 4BOWA 1N47A 3ME2A 3BUCA 3JQXA 1XOYA 3B94A 2ZX3A 5FPZA 2HWC1 2HWD1 1GICA 5LATA 1TE1B 4FQZA 3TOJA 1H30A 1HJGA 3CZUA 1OKQA 5JZGB 2VGDA 1UY0A 3WDTA 3M3EA 2W68A 3ZMOA 3ZN6B 2RS53 4LLFA 3NNFA 3ZYPA 2WAAA 5FDBA 5FQ0A 1QXRA 2ZACA 1EAH3 1XSQA 2K0GA 4QKDA 1ZBA2 3EHKA 5L9BA 2O8QA 1O8PA 1CAUB 2Y8KA 5FO9B 1BJQA 2L9LA 4TWTA 4CCCA 3AVRA 4U2AA 4Y5TA 3O0VA 3I3QA 3O1TA 5DAVA 2W3JA 1YIPA 1MZ6A 3GXUA 1ZREA 2HWF1 4I02A 3F95A 3OY8B 1R091 4YFZA 3Q8CA 3TEYA 3LA2A 3T2QA 1MS4A 3D82A 4QX7A 2J1TA 3EJKA 3IWZA 1ENRA 4HK8A 4D0QA 2JIGA 5FIXA 2HWE2 1PVXA 2YC4A 1ULEA 2WS93 2ZX4A 3KMHA 4C91A 2ZHNA 1UX6A 1MR5A 3ZLIA 5FPBA 1DQ1A 1I6XA 2ADEA 3THDA 5I0RA 1US2A 4BLIA 2HEVF 2VO5A 1RUJ2 4IGOA 4M3CB 4GULA 5FPVA 5F5QA 1G9FA 2WO2A 4Q29A 4CP9A 1H6YA 5K9YA 1OVSA 4HBNA 4C8DA 3QLQA 4A3ZA 4AG4A 1FPN2 3WF4A 2OW4A 5HI0A 2PMWB 5LCWL 3O1RA 2GC2A 4N53A 2Y60A 4XAEA 2FDGA 2VVFA 3HJRA 4JCKA 1EPWA 1EV12 1H2MA 3HN1A 2ZMLA 1W2OA 5IAVA 4B7KA 1QQP1 1S0DA 4G3YC 1W8UA 4FI9A 2EXJA 3UYJA 3Q8FA 4NMIA 1FV3A 3CIHA 4YVWA 3ILRA 1NLSA 3ZM8A 3PVOA 3AXDA 3IIAA 3U75A 3ENRA 2W5FA 1DGRA 1IHMA 1IS6A 1XRUA 3HNMA 2PYTA 1YNAA 3LIHA 4QX1A 1NA1B 4E27A 1SACA 3LPGA 4NIHA 2ZGUA 5A32B 5SV5A 1VIWB 2GN7A 5JOZA 1VALA 1OOPB 1AUYA 1SFPA 3KCXA 4MSVA 2BYVE 2JEMA 3PUSA 2VJXA 3GZAA 5FZ7A 2WT2A 2NZ9A 3SKVA 1IG3A 5JR2A 2E53A 4RS5A 4B8EA 4E8CA 2A7AA 3NJZA 3LGRA 4HL0A 3P1IA 1S0FA 3KQRA 2WAOA 2QVSB 3AYDA 4NHKA 1S0BA 4NUBA 4CCLA 3O1OA 3SEPA 4Q4Y1 4AF9A 3GZUC 4CCEA 5HPOA 1EV13 2VBBA 5T55A 3GCWA 1J3RA 2YUEA 3AFGA 4KBBA 4GKYA 1NQJA 4FFGA 2WO7A 3N9NA 2AENA 3WLUA 2C24A 3QOPA 1K5MA 1FNZA 5FYBA 1CN1A 1ULOA 3LWCA 4CU7A 4IEYA 2I74A 5I0TA 4EWEA 2Y6HA 3NNMA 1C4RA 3BPZA 1MS9A 4P9GA 2Y0OA 2C26A 3J8F3 4CP2A 3E6CC 5FZ9A 1W8OA 1UKRA 2XBO3 3PVEA 4Z82A 3BIEA 1O59A 1UZ0A 5EFUA 2DU0A 4XMIA 5FP7A 3K2OA 3DCQA 4OMCA 1OPOA 1T6BX 2XVLA 2PAEA 5KC6A 5L9RA 1XNDA 2B8MA 3BU7A 3VBFC 2UY8A 2GALA 4K1ZA 1XC6A 3L9JT 4NWWA 3T3YA 4K8RB 3VHNA 5DUWA 2AGSA 1ENQA 1I1EA 2D40A 3UGHA 2F6BA 3PU3A 1JI6A 1FOD2 2ARAA 5LBEA 5IVFA 2ZGLA 4RGGA 3OB8A 2HWB2 5GM0A 1ND3C 3J7NA 1AZDA 2JE7A 1MQTB 5J98B 4Y22A 2WO1A 3K75B 2BERA 4MHUA 1W04A 1ZA4A 3WDXA 3VB9A 3OF1A 4INDA 4DFSA 1WWYA 4YZ1A 3ZFFA 4E4ZA 2IXIA 3DKQA 2VBDA 3A7QA 3EO6A 1WMDA 4JGYA 5FZDA 2MNGA 4F83A 4DUXA 2HBTA 2XKPA 3O0WA 5FPAA 4CDUB 1OD3A 3AFKA 2D98A 1ALYA 4HMZA 4Z2WA 1E57A 4JGZC 4QGLA 4XURA 1ZBA1 2Y6KA 3M70A 3WQ0A 4YZ4A 1PVC2 4RA0A 4HSJA 3BALA 1AR82 4UT5A 2XJQA 3HQRA 4FO9A 4BK4A 5GZGA 2JDNA 3FUOA 1AJOA 1RHI1 4BQ1A 1LODA 4ARXA 1VPHA 1HX6A 5JR7B 2X53S 4E2SA 4N9IA 3T08A 5A3TA 4UOJA 4BXSV 1FOD3 3A21A 4Q0VA 2RMU2 1KS5A 3WX5A 4ZHNA 3IIIA 2HWB3 3JCIA 1LHUA 1QF3A 2NQYA 1RB8G 1OURA 4LBQD 4AWDA 4LBJA 3G7DA 4EZHA 3N7LA 2HWE1 1SDWA 3WF3A 4LMFA 4AEDB 3A4UA 4LBQB 5K0UC 5IVYA 2NMOA 1AL21 5A3LA 3CF6E 3D4KA 1DGLA 3UL2A 4BQ3A 1RUJ1 1YLLA 5EZWA 3LEMA 5F6KA 4QDQA 1PVC3 5DZGA 3UGFA 1FPN1 4IDZA 2JJ6A 3SKJE 4FOQA 2ZMNA 2E9QA 4BQWA 5IK8A 2SBAA 1SLAA 4MOAA 3T2PA 2OA2A 1Q8VA 3ACLA 3Q8BA 4HETA 2DVDA 4DXSA 5KXCA 2WZR1 3E97A 3MZHA 1UU4A 4BMBA 2RMU3 3M3CA 3HEIA 3CJIB 5ISLA 3PJQA 2BJSA 2RDRA 4LPLA 1RTVA 1D4M2 1J3PA 3Q9OA 1L3JA 2VZ3A 1V6MA 4XBLA 4BLJA 1DYKA 1SG3A 1IQAA 2RE9A 4LQRA 4AYUA 1U5ZA 3DKWA 3FX3A 2WQ8A 2YBSA 1COV1 4JTNA 2DVBA 4MUVA 3OG2A 3AKRA 4XACA 5ABJA 2XUMA 1JS9A 2RDSA 4FPCA 1LCLA 4YW6A 5BNPA 5I8YA 1FNYA 4QPIC 1YO8A 4YM2A 1N1TA 1LECA 1SQ4A 4XJAA 1ZYBA 5IK4A 2VNOA 2TNFA 4NWVA 5C8CA 2VC9A 5CAZA 1F4AA 2C4XA 4IV1C 4DQAA 1H8TB 2ORXA 3NNLA 3F2ZA 1URXA 2DCYA 3USUA 4YGBA 1MS8A 1X9PA 3THTA 3V64A 4BZ4A 2W39A 1W6MB 1ASJ2 1UY2A 3AL5A 2PHWA 2X05A 3AX4A 2EXKA 3EB7A 1IPKA 1W3XA 4Y1VA 2P1BA 1UZYA 1ZVFA 2WJSA 1D4M3 4Q4W3 5B4XA 5A1LA 4DZGA 2ZJCA 3BU0A 4ZY9A 4ZS2A 5T54A 3TRSB 2PQQA 2Y6FA 2CHHA 1RUE1 4JTOA 2YFUA 3OBTA 5C5UA 1IZ3A 5L7OA 4YVSB 4R9BA 1ZRCA 1OT5A 3CZJA 1QJY2 4LBMA 1LHVA 3H7JA 5C9AA 4CXXA 2AC1A 2Y6GA 2BDRA 4IEVA 5EJZB 5FXWA 4BA6A 4MGTA 2Y6JA 1YQ6A 5C3PA 3IPVA 4K9SA 2YGLA 2OUHA 2P3IA 4XVHA 3I4IA 4B4QA 4XJWA 2EIBA 3M2MA 3LD8A 1ASJ3 2X5IB 1YYNA 1YQ2A 2BVBA 2ZGKA 1BLZA 1RUH3 2HWB1 4RQPB 3PHMA 4ZU5A 3DXUA 3VD3A 1H9WA 2BRTA 2WNVC 3EMRA 2V73A 4OUMA 3U14A 3WF2A 4AVSA 3OYWA 5A6XA 5KWRA 3ZYGA 3AKSA 2G9FA 1OFNA 3ZXFA 2OVUA 4BPZA 3B7MA 1PK6C 5FXXA 1RVF2 4EE2A 4YW5A 1CIWA 5F2WA 2QBXA 3MLJA 1QJY3 5IK7A 3OBRA 3VBRC 4QPWA 3NSTA 4AR2A 1CZTA 5LASA 2BUKA 1OUXA 4V2VA 1OSGA 4C1XA 5FP4A 1K3IA 2C1FA 1AR81 3PJYA 4MZUA 2AEYA 5GZFA 4X8PA 2LTNA 3HT1A 4CP9B 1ULCA 5JMOA 5EHDA 1OBNA 1ACCA 1GP4A 4QU2A 3BKZA 1JYTA 2RMU1 4N53B 4ASMB 5EJ1B 3BN6A 3SH3A 4SBVA 5FUPA 3VBHB 2E7AA 4XUPA 1O4YA 4N90A 4FPEA 4IEXA 1W05A 3SXWA 1LEMA 1PNFA 5F7UA 1REEA 2DFBA 2A75A 1AR92 1NUKA 1YC61 5ERLA 4YVWB 1RVF3 4KGQA 4O61A 4FAGA 4XJZA 2A6XA 1CQ9A 2ORZA 1RXFA 4CYDA 4CRQA 4CCOA 4S2GA 5FMOL 1RUD2 4XABA 1RUF2 2D6PA 1FT9A 4DY3A 3LOIA 5FK7A 1BCXA 4NIDA 2LW8A 4CZSA 1FXZA 4OYUA 4L92A 1E5IA 5G05L 2VOWA 3QH7A 2ZX2A 4MADA 1QXJA 3CDZB 3C3VA 2JE9A 2XWJB 2EXIA 1JZ8A 1OA4A 1ND2C 2J42A 2Q30A 2WFPA 3WG2A 3HQXA 5FYTA 3JD73 2PHFA 4LNVA 3ZXGA 2QZ3A 4FOYA 1BK0A 1S2EA 2VVEA 1J3QA 1VB4A 3PVBB 2E6VA 4GB31 4HK9A 1AR93 3S5QA 4BJ0A 3DYOA 3H1MA 3BCWA 1AVBA 1EPZA 2KR2A 5FBZA 2VW0A 3WVJA 2QTWB 2R1DA 2IXLA 1AHSA 5LEJA 2DVFA 1CJDA 1K5MB 1F5FA 1RUD3 2EXHA 1WKYA 1YFYA 3VHPA 4CU9A 2R0HA 1OF4A 2AACA 2VXJA 5DXDA 1QH6A 2XR4A 3WNXA 1BHGA 1V6JA 5FO8B 1W90A 2EAKA 5IW0A 4LUKA 4I30A 1W99A 2BVVA 4XFBA 3RRDA 1S55A 3SHRA 4CCDA 1VBC1 4LOTA 2CGOA 3RZJA 3FHAA 5C70A 2FDIA 1C3HA 1UYZA 2VOXA 1BZWA 4N9HA 5LW9A 3FE5A 4AVCA 4KNCA 4GWIA 1J84A 1SZBA 5FP8A 5IUQA 4ES8A 5IAXA 4XCBA 1UO9A 4XBNA 3VBFA 3P3PA 5DZEA 4JZRA 2IFWA 5A7NA 4Z2AA 2VD7A 1WMFA 2NN8A 2R49A 2R1BA 3KZ4C 1UXZA 4EN6B 4Y22B 5FR3A 5FMBA 4PF5A 1BXHA 3MEPA 4OI4A 1DIWA 2XQRA 4M4PA 1SMVA 3ZFFB 3T0DA 1LGNA 2RJKA 1W2NA 4MGQA 2G1MA 4JGYB 1CPNA 1ND3A 2VQAA 4WVWA 3OGJA 3SITA 2VTXJ 4AI8A 3V0BA 3H8RA 4ZU4A 3SC7X 5DG1A 2PA7A 2QQMA 2UYAA 3LDKA 4R9CA 3ILNA 3POJA 3WUDA 4QX0A 4XC9A 4OI2A 3M3QA 4G4FA 3L2HA 2OQ6A 2XQXA 1WMEA 3ZYHA 2BBVA 3CBNA 5F2SA 5CNAA 1F4HA 4NOTA 1QJFA
chains in the Genus database with same CATH topology
1I9RA 2WSVA 1AR72 4JGZA 4JRAA 1DDLA 4XYXA 3WY6A 1LENA 3AP7A 5J37A 1ZZ8A 1F31A 1LULA 2RS32 3AZZA 3CNAA 4F8AA 2A5ZA 3FBYA 3UK9A 4E2GA 4PLOA 2GC3A 2PELA 4NO4A 3AMNA 4CEWC 5LK5A 1D0GA 4DRVA 1WW5A 1HRV1 2ZTNA 1DHKB 1GANA 1BBT2 4OHZA 2GU9A 2PLV2 3IBMA 2VNRA 1KQRA 3VZOA 3O7OA 3SCHA 1Q5OA 5K0UA 2R062 4S2HA 3W58A 2XL9A 1ZZ6A 3C2UA 1H9PA 3NL1A 1AR73 3ETQA 3UKNA 4MGKE 1AYM2 3EQEA 3FFZA 3NKGA 4WZCA 3SH5A 4FVVA 3RJ2X 5EYXA 4XIOA 4Z92B 2HWC2 4NHMA 2HWD2 5AFEA 1RUF1 4G9SB 1BBT3 5HCBA 3WP5A 5LEKA 2C5DA 3VGIA 5ABJB 1Y7BA 3VV1A 5BNPB 4XBQA 1GYKA 4MGYE 1DG6A 3PVNA 5KHIA 4HZFA 1FATA 1UIJA 3IDCB 2XPJA 1ULDA 2A3WA 2GH2A 2ZX1A 3CLPA 4QPIA 3POYA 5JCTA 1AYM3 4S2DA 2ZX0A 4LHLA 4IV1A 5JLVA 1LR5A 2VECA 1R092 2ZGOA 5KC5A 1QHDA 1FX5A 1Q56A 4QGMA 4A7YA 2EA7A 5AVAA 3ES4A 2HWC3 3MDPA 2HWD3 5JI9A 3EXUA 3ZIXA 2D97A 5CBLA 4LTAA 1H2NA 4KQ7A 4DS0A 1MACA 3RMYA 5L7OB 5FO7B 1W0OA 2R071 3ALQA 4L9BA 4X6QB 1AYN2 3DPRC 4YM1A 2DTWA 1SBDA 5FRAA 2BFUL 4FPKA 1HQWA 1VBB2 4YGCA 3HR9A 4FCAA 2ZGMA 3N35A 4WVVA 2E63A 1ULFA 3N7MA 1QQP2 1NCRC 3HIFA 1DGWA 2HWF3 3NVCA 4BYYA 1R093 1WUVA 4XTPA 4JC1A 4XHBA 3DF0A 5DDJ2 2E7QA 3D8CA 3SNMA 5JOWA 2N7GA 1V9U2 5CG8A 3HAGA 1SEFA 2D6KA 4HN0A 1YFUA 3AMMA 2B45X 2Q1ZB 1GZWA 2H0BA 1B35B 3WQ1A 4AI1A 1AR61 2WNVA 3AP5A 3RG0A 4UBHA 3O14A 4Q8LA 2B9UA 4WZFA 3ES1A 3DN7A 1PK6A 1VBB3 1DZTA 3N3HA 4PIZA 3VBRA 4Y1ZA 4YW1A 1AR71 1QQP3 2DV9A 4IXLA 1J59A 1LOAA 1TME2 3WDVA 1MVEA 2RS31 2ZGPA 2KXLA 4IETA 2YMZA 4QGNA 2Q8OA 1SBEA 1J1LA 1YFXA 3S0MA 3AM2A 5T5PA 3NAPC 1PGL2 5JPNB 3KLSA 4WM7B 2PLV1 4XFGA 1DQ5A 2D44A 3TB0A 1LOFC 1MZFA 2LUWA 1X8EA 5T52A 4AQ6A 4MXVA 2VY0A 3NV1A 5C8WA 3WINE 3USSA 2JD4A 4M3CF 2R061 2D7FA 5L73A 1LGCA 4XIKA 1YJKA 4Q4Y3 2V09A 2DCZA 3AP6A 1R1ZA 4PDWB 4Z07A 5JDBA 2A6VA 3MI8A 3R4UA 1NY72 3IM0A 2AUYA 1JHNA 2AYHA 4I3PA 4PJYA 4HANA 1W6QB 2GNDA 4GALA 4E2QA 2ZKNA 5CFDB 3AP9A 2ZAAA 4AGGA 1Z7S2 1ND2A 1ZZBA 3OTFA 4UXAA 2DWRA 4P9JA 1O91A 2BWCA 1NQDA 4IEUA 1C5HA 4IV3C 5LK7B 1AX2A 4I0AA 5KHGA 3MF6A 4W6XA 4Y24A 5E8AA 1G9CA 4Y1YA 5CVRA 2UWAA 3AMHA 1U5IA 2Q0AA 1RHI2 1QNYA 1A6CA 3ASIA 2BWAA 2X29A 2ZGTA 2NYYA 5JIAA 3IKWA 3GBWA 3VKNA 4COUA 1VRH2 5BNOC 2V5YA 4HVRA 4RD7A 4AQTA 5C4WC 4I2OA 1LOBA 2OZJA 2KM2A 1OQEA 3VBFB 4P5HA 4K20A 3FJSA 4LO5B 3BB6A 1AL22 2BPA2 2YROA 2W52A 1AYN1 4LR4A 2DUQA 3ATGA 1KDMA 1WGPA 1ZBA3 3QACA 5DG2A 4PLNA 5KBFA 4OZXA 3JBG1 3B01A 1ND3B 5GALA 4B3NA 1VBB1 1RHI3 4AE2A 1Q8SA 2WZR2 3FLTA 4I0BA 1IS4A 3OD4A 2QFEA 4LULA 1VRH3 5FTTC 3VKMA 5DDJ1 1IGOA 3ZFGB 1V9U1 1X7NA 1SLCA 2ZCWA 2HWE3 4FPYA 3U10A 3ZXLA 1RUNA 1W6NB 2GNBA 1AL23 1COV2 1I3HA 1UMZA 2MEV1 1RUJ3 2YC0A 3N7JA 1GNZA 3X29B 1FPN3 4OHWA 2UYBA 5ACA2 1A3KA 3VBOC 3J9SA 1AXZA 2DUPA 4E4DX 3INAA 3CU7A 2WZR3 4CEWA 4CEYC 4Y1XA 4EN8B 5K0UB 5FOJB 1TME1 1ZRRA 3MGUA 2B5HA 4LO8A 5AVPA 1GFF2 1DF0A 3VHOA 4CDWB 5JWPA 1XYOA 1RIRA 2QQPA 3TBDA 3QH6A 4AQSA 1RUE2 4PLMA 2ZPXA 1COV3 4UW5A 5JSOA 2JG8B 5I0UA 3D0JA 1PGL1 2YHJA 4ZXKA 4HKOA 1IS3A 2P37A 5CA6A 1VBA1 2DFCA 3LA7A 5LRRA 1BYHA 1CAVA 2FZ2A 3UKVA 3U11A 1SFNA 4GQ7A 4COWA 1QJU1 3HT2A 1XU2A 3VDDC 4XJ8A 2YDEA 3VZLA 1DZRA 2WT1A 4AHXA 1NY71 1UN1A 4GH4C 4IEPA 1O4TA 2QUOA 4Y20A 2XJSA 1U12A 3VZJA 5AC92 4GWMA 4LHKA 1VLNA 2ZOEB 2VXRA 3THPA 4HN1A 1Z7S1 1O5UA 1ULGA 2UU8A 2BEOA 1RUE3 4IV1B 2ENRA 5K8SA 1Z78A 4M0NA 1JUIA 1VBE2 5EXOA 2WNUC 3MW3A 3H3UA 4LBKA 2IWGB 5LRSA 1ZZ9A 2CGPA 2P3KA 4COVA 2WFF1 3AKPA 1FV2A 5A33A 3MF9A 4URTA 2DCJA 1ZX5A 3KB5A 5D8AC 3K48A 2PHUA 4XFHA 1W6OB 5F9TA 1J58A 1VR3A 5KHKA 1T6GC 1VRH1 1NE4A 4CDXB 5KXBA 1KITA 1DQ2A 3DPRA 2GN3A 2P34A 4DB5A 2UURA 4XQ4A 1U5XA 4BMEA 2RM22 2WLPA 3RYKA 3B02A 1BVP1 4OHVA 4GWNA 1H2LA 2R6QA 4DXZA 2B7YA 4OLLA 2BW8A 1UD1A 3O0XA 1NCRA 1X36A 3MIEA 4WBBA 1KJLA 1GZWB 3B93A 1AR83 3G6JB 1HXS1 1O5LA 2WNVB 4UW3A 3ZSEA 4JQRA 2CY6A 3WP4A 4Q0QA 4W65A 1PK6B 2PHTA 4B29A 3GZTB 4GIQA 4R8HA 3VBRB 4R4ZA 2MPFA 3WHUA 4GB32 3MLKA 1O7FA 1ZBE2 1X82A 5FCCA 2XLGA 4AQ2A 1YI7A 4BH9A 4XZPA 3TNPB 4FPOB 5T5LA 5FFOC 1QKQA 2GAUA 3VBUB 4FTEA 2QKDA 2AH2A 2VW1A 2WC2A 3AJYA 1U0AA 4W6WA 4JAAA 1TMF1 5ACA1 1WW4A 4L2NA 1APNA 3KT1A 3R05A 4I0WB 2XHKA 4PCRA 3KT4A 3NAPA 4JDOA 1YRZA 1VBC2 1MZEA 4LA3A 3TNQA 5J36A 5FLJA 2O8OA 4MXWA 3WQ7A 4FQ4A 5BY5A 3H9AA 4QM9A 1GZ9A 4YZ3A 1LOFA 2ETEA 5BV6A 3WP6A 3M1HA 4GB33 1F8VA 3S30A 1MVQA 2G9GA 5I0SA 2YY1A 4AK3A 4HPKA 4B4RA 4NHLA 5BNNC 3KM5A 4DY5A 4I01A 2YXSA 1PNGA 4QQHA 3TN91 2AZ5A 3N36A 4DMIA 2ERFA 4XEZA 5KHHA 1R1A2 5FQ0B 4Q1RA 3ROUA 1VBC3 3FMGA 5JVVA 1HDKA 3HBZA 3WCSA 1ZRFA 3MLLA 4Z1VA 4R4XA 1BEV2 5AC91 4HSLA 4IV3A 1XNBA 2OUJA 1AX1A 5FLIA 3V65A 4SLIA 4XFFA 2XL7A 3D6EA 5J3UA 2TUNA 3IT8A 1JTZX 3UV9A 1VBE1 2E51A 4JDMA 3N7KA 3IMNA 4AEDC 2QDRA 4RSUA 2A6YA 4FPFA 3WT3A 2KA3A 4M01A 2IXCA 5BNOA 1HRV2 5C4WA 1CAWA 4M3CE 4KL1A 1REDA 2Z5WA 1RUG1 1VBD1 1PZ9A 3MPPG 2FZ1A 1DQ6A 1S0EA 1RUI1 3J4UH 4S2FA 5BXXA 1XYPA 2Q5TA 3H1YA 2QJVA 3CJIC 1PHMA 4R9DA 2VU9A 4BCUA 2R16A 2PHDA 1WLDA 2RM21 5BNQA 3NV4A 4K6BA 4LA2A 3WG4A 1OQDA 2CNAA 3RPQA 4Q8KA 4H3WA 2CYFA 2EAAA 4HKLA 3B00A 4ISRA 1HRV3 2O0OA 4KWKA 1CAXA 5T3NA 1V6IA 4KWJA 3OCPA 4LEJA 4AW7A 4RL7A 4E9KA 1BQPA 1MS1A 4QM8A 3VBSC 1POV0 4RS5B 1OLQA 3SCGA 2VNGA 1DBNA 2O1QA 4AEMA 1GKBA 1HKDA 1W6PA 1R082 4CEWB 4QMAA 2XGXA 1NE6A 4XHXA 1ZBE1 3VBOA 5GKAC 3ZVXA 4ITCA 4A2UA 1O3TA 4CEYA 2W0XA 1RUF3 4XFAA 4YVSC 2WA4A 1OFSA 1RL3A 1HQLA 3FLRA 2D5FA 4IESA 4FPGA 3VZMA 1PO21 5HCFA 4AGVA 1FI2A 2R072 2PHLA 1O3QA 1HRI2 3H0OA 4PBOA 1H4HA 2ZHMA 4LUMA 1CAVB 2WLQA 2RR11 1XU1A 2VQ0A 3WP3A 3FWEA 5K7PA 1JBCA 1QJX2 2P3JA 2X5IC 2VG9A 4JDNA 3ZN6A 4YGEA 2K2SA 3KGLA 2GMPA 1RMU1 4IEOA 4RQPC 4MGIE 1ZZCA 1V6KA 1CAUA 2HEWF 4OVEA 3VDDA 2VUJA 4GH4A 3I59A 1LU1A 4FTBA 3KD4A 5JI7A 2EIGA 1R1A1 4UW4A 2R073 1AR62 4HFSA 3VLBB 3OY8A 1M4WA 2VPVA 4I09A 3VKLA 4DINB 1OA3A 5A33B 3QD6A 2ZA9A 3CO2A 4C0BA 2WNUA 2XJVA 1BEV1 2P17A 4XXAA 4JV4A 1BK1A 2GNTA 3VBHC 4M3CA 2BQPA 3JU9A 4GXLA 2CWMA 4QHBA 4FBFA 2A70A 3FLPA 4AHWA 1WLCA 1S0CA 5E88A 1G7YA 3DPRB 5D8AA 1VB2A 3JZVA 4RFT0 3LZZA 4XE9A 4RGAA 4OULA 1AR63 2HYKA 2VMHA 3KCCA 2WQ4A 4META 1NCRB 5T5JA 2WL1A 3TWIA 1V6LA 1YIFA 4ATEA 4XXPA 2NM1A 3ZN5A 4XPVA 5FMOS 1F2NA 1C28A 1MS3A 1HQNA 1WBFA 1QOSA 1POV1 3W59A 3CJXA 4Q0SA 1AF9A 2NMNA 5JIUA 1QMJA 2JKBA 1LTEA 2RS33 2QNKA 3B9IA 1DU3D 1YFWA 5IK5A 3H1WA 1IKPA 3WDWA 4OUSA 4WM8C 4H7MA 1PIV1 1RJ7A 2BNOA 5GLWA 2PFWA 2XVGA 2PLV3 2DVGA 1S0IA 3ZN4A 1N3OA 3SLIA 2DVAA 3RYPA 2R063 5C8CB 1H2KA 2QCSB 3VL8A 2C0ZA 4FXKB 3NAPB 4TZDA 4R52A 1R081 3USUB 5H9PA 1H8VA 1C8M1 3AZWA 3TAYA 1Y9QA 3ZMNA 3O5SA 5EJ3A 1O3RA 1S0GA 2I07B 4FPHA 2XVKA 4LBLA 3RI9A 4EV0A 3RJRA 1VJ2A 2VH9A 3ZYJB 3FC0A 1SCRA 5CFCC 4WVMA 1DGWX 4HPKB 4O9EA 1XQNA 1N1YA 1RINA 1CESA 1C5IA 2A6WA 1MQTA 4GMP0 5EYYA 1HRI1 2WA3A 5C9AB 3GBFA 4Z8BA 3JBG2 5BNNA 1HW5A 4K3UA 4HLTA 1QJX1 3E5UA 2F4PA 4GMP3 1WCSA 1NG0A 3IPVB 5HXVA 2JG9C 3R4SA 2WWSA 4LBOA 1Q43A 3WOGA 5IT6A 2NLRA 4FSJA 5J96B 1JN2P 1S2KA 4IEWA 4RHV1 3RDIA 2IXHA 1FAYA 3BTAA 4QPYA 2IXJA 4LHNA 3WHTA 3WR0A 4OI0A 3KCYA 1WBLA 1SLIA 2EVXA 3NW4A 3OYWB 4K40A 5KXEA 4Q1PA 2MEV2 4LLOA 2RS12 3WW1A 4A7KA 1UPIA 1AYN3 1NXMA 4YRDA 2R30A 3JBG3 3ZXAC 4Q4X1 4MYEA 5BUVA 1LHWA 1CAWB 4YW3A 2OYZA 2ZABA 3U4XA 4AEDA 4LBQA 4KGGA 2R042 5E16A 4Y5Z0 5A3MA 4F3JA 3E5QA 1UKGA 2PTMA 4AVBA 3LKJA 3FFQA 5DDJ3 2BTVC 4MGZE 1V9U3 4YZ5A 3ZXEA 2BNNA 1DYPA 3WW3A 1JYCA 5FREA 3M4FA 1KFXL 1QJZA 2MEV3 5DUUA 3CJIA 4YM0A 3A0KA 2WSUA 1SCSA 1Y3TA 5C6CA 1VBA2 3OPZA 1OMIA 5GJ6A 3SCFA 5I91A 3WUCA 5JPMB 4FP3A 4YW4A 3S7IA 1OLRA 4ISQA 1CAXB 1QJU2 4DPNA 1LEDA 4AFAA 4CDQC 3VZNA 1KD7A 1WA4A 3SISA 3ZDSA 1WCDJ 1TME3 3EBRA 5CG9A 1OD5A 1AJKA 2YV8A 2WINB 3AK0A 3AZVA 4XF9A 3ILFA 3VBSA 5BPXA 1W6PB 2LALA 2RS52 5F6LB 1QH7A 3VBOB 1EAH2 1CVNA 3FUQA 1W6MA 1IKQA 1RUC1 3ECQA 4CEYB 1VBA3 3AZXA 1AL0G 3MFAA 2ATFA 3R0RA 3WZ1A 1AXKA 3ZFEC 2WFF2 4EJRA 2A73B 2CWSA 1PGW1 2D5HA 3MIDA 1WW7A 1GQHA 1LOCA 1LOEA 1QJU3 1Y43B 3I8TA 1D4VB 4GMP1 3H8UA 3VKFC 4YVSA 3WW4A 3JUUA 4BWOA 1GSLA 2WS92 3M7AA 3VN4A 5EV7A 1Q8PA 4P9LA 4B4PA 4BIFA 2JX9A 2D6MA 1GQGA 2BFUS 1O4ZA 4L11A 4YNIA 1CGPA 5I93A 1Z7S3 2B42B 4FPLA 1BVVA 3AMPA 1NCQC 4LE3A 2X5IA 2G4IA 1V70A 3VDDB 3E6DA 4IL7A 2UWCA 3AZYA 2A6ZA 1X33A 3GYDA 1GLHA 1JUHA 1B35C 1HV0A 1WD3A 3LCPA 4RQPA 2WFF3 4GH4B 3I59B 2EF6A 4Y4YA 2JICA 5HCAA 3RWNA 1HXS2 1W39A 4QT6A 3V0BB 4Q2FA 1AXYA 2ILMA 1SFYA 2B46X 3NV3A 4A7ZA 3MYXA 4Y1UA 2XJUA 4HKWA 1YCIA 1GZCA 2WNEA 2WNUB 3D5OA 5I8SA 3GF6A 3O12A 1N3PA 4JGZB 4EROA 1PM7A 2XJPA 4FTSA 3AYAA 1DQ0A 2HKXA 3CEWA 1PO11 4ATFA 4AVTA 4AHZA 3VUOA 4QPGC 1QU0A 5KHJA 5CIRA 2FMYA 2RS11 4K7JA 3AKQA 4XF1A 5D8AB 3VBHA 4XTMA 2DF7A 1JXNA 2ZAHA 3NWKA 2WKKA 4WM7C 1ZRDA 4TSVA 1TMF2 1HXS3 1MZ5A 4N43C 2XLAA 4RR3C 1U5YA 4YLZA 4YZ2A 4D7SA 2R041 1JH5A 2ZS6B 4Q4V2 1G86A 4PDWC 1SBFA 3LAGA 4DOUA 3OJBA 2FHRA 1NLRA 2K9ZA 4C0HA 4EN9B 1A8MA 3J8F2 3B5LB 2XBO2 4Q0PA 5CB7A 5CFDC 5FPXA 3I54A 1F5JA 2DU1A 2IFRA 3ZXKA 1MEC1 4Q27A 3ZYIB 2IXKA 4COYA 3J26N 4TYSA 1RUOA 4E4SA 3WG3A 3TN92 2WIIB 1QDOA 2XJRA 5JZGC 3H7YA 4XILA 3URFA 1W0PA 1CJPA 2ET7A 1HV1A 1TMF3 5ACA3 4YARA 3MIFA 4COZA 2CGNA 2Z42A 4J1WA 4XMAA 3VKOA 3WG1A 4M0HA 4WM8A 4Q4V3 4XF4A 2Y38A 1EP0A 2TBVA 4YG6A 1QY4A 4NR1A 4AVAA 5KXDA 1WCKA 3MIBA 1UZZA 4LO6B 5BYNA 2XH6A 4QPIB 4D7YA 4ES9A 4YM3A 4OFGA 2RS51 3V0AA 5DZFA 1EAH1 5FAXA 4L99A 5CADA 2DUOA 3GALA 4OHXA 2XLFA 2RHPA 2ZGRA 1TQ5A 1YXWA 3TN93 3KGZA 1CX4A 1UPSA 2A71A 1WLWA 1C57A 1RC6A 1N1SA 3GHNA 4WVMB 4P14A 1VAKA 1MS0A 2FBEA 2A3XA 4XDQA 2ZBJA 1Q8OA 1RUG2 1VBD2 3RYRA 2LM3A 4LE4A 5CFCA 5BNNB 1DQ4A 1RUI2 3E6BA 5AC93 2WS91 2VVDA 1NXD1 1EYBA 4EN0A 3POSA 4EWDA 2GC1A 4QQ2A 3ZFGC 2PHXA 1LU2A 1DGRN 1G9BA 3M3IA 3PTYA 4A3XA 5JAXA 1NA1C 1VBE3 2GSYA 2JG9A 3T2TA 5J09A 1G9AA 1CR7A 3FBMA 4NVPA 4XW3A 3B9CA 4XFIA 2AREA 1OOPC 1KFUL 4N7IA 4DRRA 3P3NA 1TEIA 4D3WA 3GHMA 1RUG3 1VBD3 1CD3G 2A3YA 4JVAA 1YJLA 2Y26A 1LHNA 4PIXA 4Q26A 1RUI3 3BOPA 3WDUA 2WQZC 1ZM1A 1LGBA 5J98B 4QXKA 2ARBA 2UWBA 1B09A 1JYIA 2XG3A 1OQ1A 1TNRA 1UU5A 3H3ZA 1X8MA 4BM8A 1UU6A 1WW6A 2RM23 1VAMA 3ZSMA 1SLTA 2UY9A 4CDWC 4D7TA 2Q1MA 1H4GA 4NPRA 2D93A 4GKXA 2JG8C 2H0VA 4BHPA 2CV6A 1EV11 1N1VA 3AJZA 4XOGA 1LB2A 2Z69A 4P9IA 3N4MA 1PO22 3GBGA 1V00A 1N3QA 4Q4W2 4AFMA 1XE8A 4Q4V1 1KJRA 4K21A 2RR12 1PZ7A