4XFFA

Cysteine dioxygenase variant - y157f at ph 6.2 with dithionite
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xffA00
4IERA 3N4MA 3MPBA 2D5HA 3KSCA 3ACLA 3RYPA 4I02A 1O5UA 5I0RA 4XF3A 3E5XA 3E6BA 3WW4A 2Q4SA 4N9HA 2ETEA 3SMHA 4PJYA 1YLLA 1RTVA 3EHKA 1V70A 2IXIA 1Q5OA 2ET1A 4AVAA 5EFUA 2PYTA 2XKPA 2XL7A 2F4PA 2GC3A 4Q29A 4MGYE 5LRRA 2P17A 4I0AA 1PM7A 1J3RA 1EP0A 2IXKA 3FHIB 3KCCA 4PIYA 5KHJA 2BNMA 1YUDA 2PA7A 3OF1A 4XF0A 2XHKA 5E16A 1O7FA 5C8WA 5I93A 4XFCA 4XF4A 1QY4A 4D7SA 3LA7A 3NVCA 2BYVE 1X8MA 3EQEA 4H7LA 2OZJA 3I59A 1CAUB 1ZRFA 4DINB 4D7TA 4AQ6A 4L11A 4AVBA 1EPZA 5I0SA 3QOPA 3H7YA 3WW2A 3LA2A 4GULA 4HVRA 3FWEA 2HJIA 4QX5A 2QNKA 1SFNA 4UXAA 4JTOA 5FPZA 4MGIE 1VJ2A 1ZX5A 4QMAA 1OI6A 4LLOA 3SXWA 2Q1ZB 4XF1A 4HMZA 1U12A 5KHHA 3I54A 4XETA 2MNGA 5KHIA 1O3TA 3U10A 3RYKA 3CEWA 4XFIA 5T3NA 1G6NA 1CAWB 2XKOA 3USSA 5LEJA 4O9EA 2H6BA 3D0SA 4Q0QA 5FPXA 2ZKLA 4XFFA 5K8SA 2CAVA 3D82A 4KU8A 4RD7A 1UW8A 4JTNA 4MX3A 2IXCA 4J1XA 2BEOA 4E2GA 1SQ4A 2PAKA 1RUOA 2IXJA 4IEVA 1CGPA 3ELNA 5D1IA 4WBBA 4MGKE 2PAEA 2XL9A 1UIKA 4R8HA 1TQ5A 3HT1A 5J7MA 1LRHA 3DKWA 4QGNA 3OTFA 3OGJA 1WLTA 3RPQA 2V09A 3UKNA 1XE7A 1J3PA 2E9QA 1OD5A 1RUNA 1ZRCA 4X6RB 1QXJA 1GQGA 4XFAA 4QM9A 1ZZCA 4R52A 4IEQA 1CAVA 4Z07A 4I09A 5JCTA 2GAUA 5FLHA 5LEKA 2D5FA 2H6CA 1YFYA 2PAMA 1CAXA 3E6DA 1LKNA 2CV6A 5HI0A 2K9ZA 3HT2A 2PFWA 3BCWA 3DV8A 5KHKA 1O3QA 4IEUA 5I0TA 3E97A 4YYOA 4F8AA 2QJVA 3RNSA 3IDCB 4IEZA 1NE4A 3NKTA 4O9GA 2N7GA 1Q3EA 2FQPA 3DN7A 4HZFA 2GC0A 2IC1A 3M3IA 2CAUA 5C6CA 4XF9A 1VR3A 4EWDA 1YWKA 4QM8A 3FZ3A 5CADA 5J3UA 3CL1A 4FAHA 5CU1A 4LULA 5FLIA 4YARA 3IWZA 3M70A 5BXXA 3FX3A 2OYZA 3H50A 1ZZ6A 2C0ZA 1LR5A 2O8QA 1DZTA 2IXHA 4I2OA 4HSLA 3WW3A 3EO6A 1WA4A 2MHFA 3I7DA 3KMHA 4OFGA 1SEFA 4BH9A 3I59B 3SHRA 4MH0E 3TNQA 3E6CC 2UY9A 5FQ0A 1H1IA 2KXLA 3UKVA 4EROA 1YFXA 5CVRA 2Y0OA 2EA7A 5I8SA 1I6XA 3EJKA 1ZZ8A 4JV4A 4AQ2A 2OA2A 1ZRDA 4LA3A 3RZZA 4HVOA 4OLLA 4Q0SA 4FBFA 4KU7A 2PQQA 1YHFA 4N9IA 4QXKA 4IEXA 5JSOA 1O3RA 5KHGA 2B5HA 5EZWA 2VPVA 3D0JA 1X7NA 4XFGA 3RYRA 1DGRA 3ZDSA 2FMYA 4HVQA 4HBNA 1Y3TA 1Y9QA 2Z2SB 3S0MA 1FI2A 3GBFA 3U0ZA 3ETQA 2D40A 3NJZA 3LWCA 1NXMA 4AXOA 1JUHA 1RGSA 2GC1A 3CO2A 3ST7A 2XLFA 4KL1A 1Q43A 5FDBA 4A2UA 3MZHA 1O3SA 4WVZA 3LZZA 4XFBA 4YSFA 2WC2A 3HIFA 3EBRA 1OFNA 3NW4A 2H0VA 3OCPA 2Q30A 3BALA 4J1WA 1YFWA 3H1WA 4EWEA 1DGWA 1ZZBA 2UY8A 1DZRA 3G7DA 3H1YA 1ZNPA 2OZ6A 1I5ZA 2UYAA 2GZWA 2OPKA 3PNAA 4EV0A 3MYXA 4ONUA 3FE5A 1J58A 1FT9A 2BNOA 4L2NA 4E2QA 2XGXA 4E2SA 4KWKA 4I01A 1CAVB 2GU9A 4Q0UA 3RDIA 1ZRRA 4IEWA 3JZVA 1GQHA 4LUMA 1CAXB 1NYWA 3NL1A 4MV2A 4F7ZA 3S7EA 3BB6A 3IIAA 3LAGA 4QGMA 2DCTA 3H3UA 3SCFA 3R6SA 5F1RA 4B29A 3FFQA 3CJXA 3TNPB 1WGPA 2XLGA 3GYDA 2ET7A 3E5UA 1ZZ9A 2UYBA 3O14A 1EYBA 4I3PA 3NSTA 4META 4EWAA 4X6QB 2BNNA 3ES4A 2PHDA 4KWJA 4Z82A 2O1QA 3H3ZA 2CGPA 4FT8A 4CYDA 5KBFA 4LA2A 1XE8A 4ZU5A 4HN0A 1UPIA 5E1RA 4BYYA 3IBMA 4ORFA 4AVCA 3H7JA 5I0UA 4IEYA 3BPZA 2IXLA 2I45A 2B9UA 2GH2A 1ZVFA 2QCSB 3H8UA 3LOIA 5BY5A 5FLJA 1CAUA 4LUKA 4Q0VA 1OMIA 3SCHA 3C3VA 3L2HA 4ZU4A 4YNIA 5BUVA 5FQ0B 3B02A 3ES1A 4IEPA 1X82A 3BU7A 5FCCA 5LRSA 2BGCA 4PIXA 1J1LA 3H1MA 3FJSA 1XRUA 5JR7B 4ZU7A 2WFPA 4BHPA 2Z69A 3LA3A 4Q0PA 1QXRA 3MDPA 4HLTA 4HN1A 3WW1A 4LEJA 2PTMA 3DL3A 4MUVA 2ZCWA 4MZUA 3U11A 4I0BA 3KGLA 1CAWA 3PLQA 1J3QA 1IPJA 2HKXA 4BIFA 2MPFA 3HQXA 5I8YA 1J59A 1CX4A 1QWRA 4IETA 5JSPA 3CF6E 4P9GA 5JSRA 2B8MA 3SCGA 3KGZA 4WZCA 2PHLA 1HW5A 3VHRA 5JAXA 3PVBB 2Q0AA 4FAGA 1O5LA 1RL3A 2EVXA 1EY2A 2K0GA 1IPKA 5AVPA 3UKTA 1VP6A 4LTAA 2EAAA 4HSJA 4JVAA 4KWLA 4XFHA 2XLAA 4UBGA 2VECA 1NE6A 1FXZA 4PIZA 4IESA 1UIJA 1RC6A 2D93A 4IEOA 3QACA 1UCXA 1O4TA 1NZCA 1ZZ7A 3ROUA 1ZREA 1LB2A 5BPXA 2ATFA 2QDRA 1YFUA 2VQAA 1X8EA 3CLPA 4TLFA 1UD1A 1L3JA 3IDBB 4MGZE 5I8TA 1PMIA 5I91A 1H1MA 5BV6A 3OD0A 4K8FA 4YRDA 4QGLA 4NVPA 4XEZA 3H9AA 5J48A 4UBHA 3S7IA 3E5QA 2QVSB 2GC2A
chains in the Genus database with same CATH superfamily
4IERA 3JQWA 4Q27A 3N4MA 3ZYGA 1GWLA 1MEC2 2X5IB 4I02A 4K1ZA 4QB2A 5D2AA 3WY6A 1R1A2 4TWTA 3I2HA 3KQRA 2HWC3 3I2DA 2Q4SA 4W65A 5A70A 2ETEA 5C4WA 2Y60A 2D6LX 3SMHA 4PJYA 1AR63 1CZVA 4P9WA 2XDVA 1ONAA 4Y5SA 1SDDB 2DYCA 1HIXA 1K5JA 1RTVA 1YXWA 1G9AA 2HWE2 3V0BA 2J1UA 4JDMA 2P6HA 3EHKA 1V70A 2RM23 2W1UA 3LPGA 4AVAA 2W08A 5T54A 3TN91 4UW5A 3A21A 3AFGA 1FATA 2PYTA 4NIAA 3UGHA 4BZ4A 5ACA1 1ENSA 2VQTA 2ORZA 4NHYA 4CCCA 2PLV1 5L9BA 5JMCA 1CPNA 3LFIA 4QHZA 1UMHA 1X9TA 3R4DB 4SBVA 2ES3A 1H9PA 3KCCA 3N7JA 5KHJA 4P14A 4UOJA 1YUDA 3OBTA 4UW3A 5AC91 3C7GA 1LOFC 2EXIA 2MEV1 3I8TA 2ADDA 2WQZC 4R4ZA 4E4HA 5I93A 3VLBB 2YBSA 4D7SA 3ZYJB 3QD6A 4HK9A 3NVCA 3BTAA 3O5SA 1GZTA 1WCKA 4QKNA 1OT5A 2C9KA 2OZJA 3I59A 4MLOA 2VBPA 5IJRA 4ASLA 4CEWA 3O1RA 3BTXA 3BVCA 1WD4A 3VKOA 1RUJ3 1GWKA 2HBTA 4AQ6A 2UU8A 3AJYA 3GGLA 3GNEA 4D7TA 3AK0A 1DP0A 1QJU1 3N9PA 4AVBA 2HWB2 4IUGA 1OF3A 3QOPA 1AR82 4LOSA 1ASJ2 1E5RA 2ARCA 2W2IA 1W2AX 1VAVA 4CCKA 4HETA 2VOWA 1COV1 3KT4A 2W1SA 3WCRA 4V2WA 2ARBA 2EIBA 4LO4B 1IPSA 1JODA 3WX5A 3AP5A 1CX1A 2VZVA 4MXVA 5FPZA 4RQPA 3ZFGC 1GYKA 1VBA2 1ZX5A 2ZGTA 3AYCA 1OI6A 1QNWA 2VULA 1RJ8A 1CESA 4BQYA 2GN7A 4FXGB 2WLPA 4XF1A 4HMZA 3VBRB 4V1PA 5BNQA 2RS33 3M3QA 2AZ5A 2MNGA 5KHIA 3THTA 2RE9A 1SZBA 1UZVA 1LOCA 3U10A 4PQQA 3O1MA 3BOPA 4RS5C 1Q8QA 4PT6A 2XQXA 2YZ4A 1JZ8A 2BJSA 1RMU2 4W6XA 3JBG3 1C5IA 1SLTA 1RHI1 4DFSA 2D97A 2CAVA 1W6PA 4KU8A 4L99A 4Z2AA 4CUCA 4RD7A 2A5ZA 4MX3A 4ZONA 3ZYBA 2IXCA 1I1EA 3I97A 3GJAA 2FHRA 1TNFA 2JDZA 1V9U2 4J1XA 3SNMA 1HKDA 4H7MA 4QU1A 2VZPA 3MO4A 5DDJ2 3ZFEC 2BBAA 3KLSA 3Q8AA 5DMYA 5CKMA 1W04A 4EZHA 5A6QA 3BIWE 4LBJA 1XE0A 1PVC1 1QJY1 2XL9A 4QPGB 1UIKA 1TQ5A 5FZFA 3AKPA 1ZBE3 4Q4X3 3ACIA 1DG6A 4IV3A 4NE9A 4FTSA 1K5MC 3RPQA 4GMP0 2V09A 3UKNA 3I2GA 3WG3A 1GKBA 2F17A 3T1MA 3VBUB 2VQUA 3A23A 4AVVA 4OHYA 4X6RB 4RA0A 3HQUA 1C5HA 3B69A 5FKBA 3RFRA 4AQSA 4AFCA 2WZPP 1GQGA 5FPAA 4XFAA 4IXLA 1ZZCA 5HV4A 1QH7A 4LO7A 5L9VA 3K4DA 2ZZJA 4IEQA 1KJLA 1S0EA 4XBQA 4Z07A 4I09A 2GAUA 1ZYBA 5LEKA 1RUE3 4GQ7A 2D7FA 4XOGA 1MQTA 3ZLIA 4CDQC 3ZO0B 4FTEA 2P4EA 4UI9L 3HD8B 2HWF3 5FR3A 2VTXJ 4DIQA 2DVAA 4TSVA 1HRI1 4TZDA 4YG3A 3CNAA 1O3QA 3WNMA 1LJ7A 4IEUA 3I2FA 4F8AA 1P8JA 1T6BX 5DUUA 3RNSA 4B8EA 3LEMA 1LHNA 1OPMA 5A3MA 4DXRA 3HMYA 1Q3EA 2FQPA 4Y24A 3DN7A 2JG8A 1PK6A 3HJRA 5FMOS 5C4WB 1WBLA 3RS6A 5K0UC 5FP9A 4NWVA 4AHXA 3TN92 2J1AA 2CAUA 1XSRA 5C6CA 3V0BB 3ZXJA 3HBZA 3K2OA 1HQLA 1W99A 4EWDA 4QM8A 4B7EA 2PLV2 3FZ3A 4BCUA 5J3UA 4AAPA 1RUC2 3ZYFA 2YC2A 3VD5A 4QX2A 2ZGMA 3DPRC 2EIDA 4IV1C 2BVBA 1POV1 4KMQA 1N3QA 2QE3A 3OY8B 5A32A 3OBAA 2MEV2 4FPFA 4AGVA 1D2QA 3RZKA 2O8QA 2AACA 3D5OA 4PDWC 3UJQA 2GSYA 2BOIA 4HSLA 1XYPA 1WD3A 4N43C 2W1QA 2DFCA 4UFIA 1PMHX 1DQ6A 4AEDC 2R0FA 2CNAA 1ND3A 5FYVA 2ZX2A 3SH5A 1DLLA 1XNBA 3ZXFA 3D3AA 3KMHA 3LQCA 5KXEA 5FOBB 3I59B 3AP4A 4CUAA 4CEWB 1W28A 2WO3A 2A1XA 5IVCA 1H1IA 4YGBA 4XCAA 4QQLA 4EROA 1LESA 1MVEA 2RJKA 4LJHA 5IUQA 3MUY1 1UMZA 4G3YC 4XMIA 2C26A 1I6XA 1K3IA 4MO3M 4NPLA 2V5YA 3RSJA 3DYOA 3J8F3 3ACGA 2WNVA 1JN2P 5A1LA 1ZA7A 3LD8A 4H3WA 4LNVA 5CFCA 1O6UA 2TBVA 2QQOA 4YW7A 4NRQA 4Q0SA 2WNOA 4FBFA 1EV13 3LCPA 4IE7A 4XQ4A 5C3RA 1BCXA 5DG2A 3WG1A 4QXKA 3O1UA 2C1FA 1MS4A 4EN9B 4XJAA 4RQPB 5JSOA 2Q1FA 2VJXA 3UNPA 1OXCA 2RS52 1WA6X 4LORA 4XFGA 2VMIA 5DAWA 5A7WA 1QJX2 3RYRA 4OI4A 3ZDSA 4CDUC 3NJXA 2FDHA 4AFBA 1FAYA 1IG0A 1UYYA 3UYJA 5C9AC 2WO7A 2Z2SB 4LKDA 2HLEA 4LO8A 4XUQA 4AEKA 4RR3B 5E89A 1OLMA 3BU0A 1PX4A 4BQ3A 3UESA 2W5FA 5EJZB 1IS6A 1H1AA 3NO8A 3JUUA 3WP4A 5CG8A 1RGSA 1W6PB 5FFOC 4CDXC 1W9YA 2VW0A 4EJRA 4DNYA 1MZ6A 2G19A 2DVBA 1GBGA 3FUOA 3K75B 3GHNA 5K7PA 3U4XA 4WVZA 1QEXA 2ZMKA 4Y33A 1GZCA 4BQ5A 2Y8KA 1IOAA 1RVF3 4NMIA 1JYWA 2XJVA 3WOGA 1SBFA 4AHZA 4J1WA 1LOFA 1XPWA 3H1WA 5FZ0A 2JIGA 3POEA 4UFHA 2WFF1 4EWEA 5GALA 1R082 1SG3A 2XJUA 5FKCA 4AEJA 2CGNA 5GZFA 5AFBA 2UY8A 1PNFA 2HWD3 1U5IA 2Y38A 3FBYA 3FHAA 4IV3B 4RL7A 1ZNPA 1W2UA 2ZX0A 1I5ZA 3ECQA 2WZ8A 2GZWA 2QQVA 3IDEA 2Q8DA 1IKQA 3CKHA 3FBMA 3P3NA 1GZWA 3PNAA 4YW3A 2ZX3A 3VHPA 3LPFA 5FYBA 5FZKA 3MYXA 3UJOA 4FFHA 3ZXGA 4EV0A 4J6GA 3VDAA 1I5PA 5BNNC 1PHMA 3JQXA 3T2QA 2DVFA 1FT9A 4AK3A 4L2NA 1V6JA 3B7MA 3SH4A 3ZM8A 4DXTA 4EN7B 2JENA 2W68A 3DYMA 2RMU2 1JU4A 4YZ3A 1ZRRA 1W8FA 3POJA 4AHYA 3MUZ1 1GQHA 1NA1C 2WZR1 3WDYA 4FTBA 3ZFGA 3WF2A 4CUGA 2XBO2 4K9SA 5T5PA 4JKMA 2VTXA 4HL0A 3VKFC 3VD4A 4XC9A 1UZYA 4CU6A 3H3UA 3T30A 2JB4A 2DF7A 2VZQA 1WW5A 2JKXA 3NV2A 5AFEA 4ZY9A 2XONA 1F31A 4HXCA 2HYXA 5GLUA 1KRIA 1JZ2A 4B29A 2B46X 2XB6C 4RS5A 3CJXA 2CL2A 4ASKA 1H2MA 1ZBA2 1WGPA 4FOWA 5JOZA 2A3XA 1XU2A 1VPHA 2WS93 2I07B 3A22A 4LK6A 2JG8B 1PK6B 1V6MA 2UYBA 5TSWA 1SCSA 1SFYA 3GHMA 5IAXA 1LHOA 1LOGA 2YXSA 2QBXA 4MGTA 2ZHNA 5IVEA 1POV0 2BNNA 2PHDA 1OVSA 1BKZA 1RUH3 2ZGOA 2O1QA 3OYWA 3ME2A 4Q4V2 4YPJA 1BBT3 1ND2A 2VZ3A 4BISA 5KBFA 3QLQA 2ID4A 3ZFEA 3O1VA 5C71A 5FMDA 3B5LB 4OI2A 1MVQA 3PIJA 1ULGA 4BYYA 1NLRA 1VBC1 1NQJA 4ORFA 5KXDA 1J84A 2Y6HA 3H7JA 1MS1A 1WCQA 5T55A 4MYEA 5A32B 4KGQA 2XUMA 4YVSB 2HEYF 5IVJA 2W39A 4HFSA 4KGGA 1FPN3 2XXZA 3MIBA 1AR93 1ZVFA 3LOIA 3VZJA 5JPMB 1K5MA 3VBOC 2VCCA 5FLJA 1LHVA 4Q8LA 1JMUB 3OB8A 1S2EA 4RHV3 4YM2A 1ND3B 3PIGA 1JYNA 5JMOA 2BWAA 3I3DA 5JDBA 3FMGA 1MEC3 3T2PA 4ZHNA 4Q4X2 1R1A3 3POGA 4JQRA 5CBLA 4XVHA 5T5OA 3ZKYA 5ERLA 4QT6A 2ZZQA 1X82A 4YZ5A 5A6XA 4UWDA 1RUD2 3JU9A 3U4SA 2VUCA 1J1LA 2GH8A 2WNVB 3WEZA 2EICA 4CDQA 1Y9GA 5FZMA 1PGW2 2DBIA 2HWE3 4XJUA 2J1SA 4OZXA 5EYYA 5JR7B 5CFCB 2PQSA 3MICA 4BDVB 4Y1XA 3FUQA 2WL1A 3LA3A 1HQWA 1UX6A 3FC0A 4DRRA 3AKRA 2W87A 3KV6A 4XUOA 2NYYA 3MDPA 4B4RA 4HN1A 2DUOA 4LEJA 4XBNA 2GMPA 2ZCWA 4DPNA 1REFA 1ZA4A 2Y6GA 3PL0A 5A7WB 5EWSA 3U78A 3GALA 5HPOA 1JOBA 1H4HA 5K0UA 2HWF2 4UFKA 4JX0A 4A7YA 2V4VA 4BIFA 2MPFA 3MI8A 3TRSB 4AW7A 2WKKA 1Y43B 1VRH1 2XWJB 1NCQC 2ORXA 4P9GA 4GZ9A 4W50A 2B8MA 4FPEA 4OQ9A 3T0BA 5JSRA 3DPRA 5LBFA 2W95A 3AKSA 1VBD2 4DY5A 4OUEA 1DFQA 2R061 5FJKA 4CRQA 4IV1A 2WYSA 5FP3A 1SFPA 2O14A 1LHUA 2I2SA 1XOYA 3I4IA 4FAGA 2EVXA 1UYZA 2WA3A 2K0GA 1IPKA 1OH4A 2HWB3 5H9SA 3RJRA 2JB8A 4LTAA 3IN9A 1AR83 4LKEA 5H9QA 1ASJ3 4XQWA 2IVIB 4UFMA 3BI3A 4XFHA 1VBE2 3ATGA 4JGZC 2A6XA 4N43A 2BRTA 1B09A 3KWVA 5FBJA 4AEDA 1VALA 4LO5B 4PIZA 4P9LA 4DEQA 1RC6A 5JPNB 5FAXA 4PBOA 2ZMLA 4DRVA 4I0WB 3QACA 4ISRA 1YNAA 1Z78A 3LDBA 1VBA3 1O4TA 2XH6A 3KF5A 3A7QA 5FP8A 2OS2A 1LB2A 4JQTA 3T0DA 1U0AA 3TEXA 1GZWB 2OUJA 2QDRA 3N3HA 4YW2A 1X8EA 3IKWA 2YDEA 3PDQA 1PO22 4XTPA 3O7OA 1OLME 4OHWA 1PMIA 5K4LA 3RGBA 3NV3A 4NN0A 5BV6A 1RUG2 3MFCA 5GJ6A 1OLRA 1NKGA 1RMU3 4BK4A 1S2BA 4QGLA 2ILMA 5CNAA 1LULA 5EJ3A 4AGRA 2QVSB 5EQUA 4N7UA 3ZFGB 1U5XA 3MF6A 2D5HA 3WF0A 3KSCA 3SC7X 4CDUA 2ERFA 1O5UA 1V9U3 3LGRA 3E6BA 5DDJ3 2E33A 2D3SA 2BP6A 5C9AA 2GNTA 4LHKA 5A6ZA 1KFXL 2BBVA 1DZQA 4GKYA 4RS5B 4DY3A 1AYN1 3ZPYA 1YLLA 4CP1A 2FD8A 4EE2A 4LIUA 5GKAC 2DWRA 3HOBA 1Q5OA 5HV0A 2FDKA 1JTZX 1QKQA 2JJ6A 5EFUA 3OPZA 1LGNA 5FY8A 5T50A 4XW3A 4YGEA 2XJPA 2XL7A 3SISA 3OYWB 5GZEA 1HJFA 3X29B 4NRMA 1ND2B 1YC61 1DGLA 4Q29A 4D0QA 4XJ8A 2WT2A 3ZFEB 1FX5A 4LBOA 1KGYA 5LRRA 3WNOA 4CU9A 5HCHA 3PUQA 4HOOA 3POYA 4QDQA 1NY72 3FHIB 1WMFA 4NIIA 5DXDA 4D6SA 2QKDA 4FPOB 2PA7A 3OF1A 4XF0A 2XHKA 3I2KA 4XFCA 3RI8A 5IHRA 4JDNA 4L0PA 3LA7A 2DCJA 3MGUA 1X8MA 2RV9A 2XUEA 3EQEA 4H7LA 3RZLA 1K5MB 1QH6A 5DZFA 5F3CA 3TEWA 2CGOA 1C8M1 4FPJA 5C33A 2FDIA 4OHVA 3LB9A 3BKZA 2OXBA 1DGWX 3RVHA 1AYM2 2D3PA 2VC9A 1EPZA 5BNNA 2BGOA 5I0SA 5J98B 5CFDC 1GMMA 1IQAA 1DQ2A 4LBKA 3LSDA 4Y5TA 4GULA 4UYBA 4LE4A 3GM8A 3MLKA 2X10A 3FWEA 2FMDA 3H42B 1W2TA 2SBAA 3IZOA 1E5HA 2OKXA 5EHDA 1NA1A 1BMV1 2DBNA 3TN93 4UXAA 1UY1A 4CDQB 4JTOA 1AVBA 2QQJA 2VCMA 5FYTA 3W59A 1PIV2 4BQ2A 2PLV3 5FXWA 1VJ2A 4QMAA 1HB2A 1RUC3 3HNMA 4IGPA 1G8WA 4LLOA 5A3OA 4NIGA 4C90A 2Q1ZB 3ZN6A 4ES9A 1U12A 1HB1A 5L7OC 4TYSA 5AC93 5CISA 3DEMA 2MEV3 5FY0A 2VTFA 3CEWA 4XFIA 3RYKA 5T3NA 4INDA 2XKOA 3H8OA 1R091 1VRH2 1LHWA 4KI5M 4Q0QA 3T08A 3MLJA 4CP0A 5FPXA 5K0UB 2Q5TA 3VBFC 1UY3A 1LENA 5K9YA 4E8CA 4Y4RA 1YI9A 4A42A 4N90A 2R30A 5IFTA 1PZ7A 3DPRB 3AZZA 1XNKA 4A3ZA 3K77A 4IV1B 1DCSA 2RR11 4QKBA 3AVSA 4YW5A 3DCQA 3OG2A 3WNPA 1SQ4A 2PMWB 2C24A 1HRV1 1HB4A 3CJIC 4XZPA 3ZPOA 1W6MA 4PF5A 2XVLA 5JR2A 4R8HA 1TME1 1APNA 3HT1A 4FI9A 4IE4A 4UF0A 3UGGA 2A75A 5FXXA 1Q8OA 3VL9A 4AWDA 3VBOA 1OVPA 2EF6A 4N43B 1FMD1 3WP3A 1JW6A 3B93A 3R4UA 4AEDB 3OGJA 3B94A 5JI9A 5FYIA 3LIGA 4AHWA 1WLTA 1HJGA 3IB3A 1LOEA 5E8AA 3PTYA 5GZDA 1OQEA 1S55A 2Q8CA 4B3NA 4XDQA 2R6QA 2E9QA 3IPVA 1D0GA 2RS53 3PUAA 3ETPA 4LBLA 3MIHA 5FO8B 2B42B 1QJX3 3WXPA 2ZAAA 4AQTA 3O1SA 1BEV2 1G7YA 4WM7A 3RJ2X 3PVEA 5LCWL 1MS5A 4X8PA 4RHV2 1S0BA 5DAVA 5JCTA 1YIPA 5FLHA 3C8XA 2H6CA 1Y4WA 4FOQA 1JZ5A 2PAMA 5F8PA 1HDKA 3NJVA 5J1XA 1ULEA 3N9QA 3ZSJA 2JDHA 3E6DA 4BK5A 1OA3A 4ZS3A 4B4PA 5JOXA 3ACFA 3K46A 2VMDA 1BXHA 3I3EA 4LKSA 3H8RA 4XACA 5EIYB 4QXHA 1OKOA 5I0TA 1TE1B 4YYOA 2CY6A 3VHOA 2QQPA 2QJVA 2FCTA 3IDCB 2KA3A 5IATA 4O61A 4OVEA 1KQRA 1NE4A 3SKVA 4O9GA 5KC5A 2N7GA 2VAUA 5C9AB 4KNCA 3KV9A 3J4UH 4BMBA 5JOYA 3KQ4B 5IAVA 1X9PA 3KZ4C 3BODA 1R083 5ABJC 4RYDA 1NCQA 2ZAHA 5LY1A 5DAXA 1VR3A 3NMBA 1YCIA 4Q4Y2 1S0GA 3CL1A 2VCBA 2ZOEB 3N7MA 4XE9A 5FOJB 5CU1A 4TN7A 4LULA 4AEMA 5FLIA 2R16A 5DG1A 1JYCA 1LTEA 1ULPA 4A7ZA 3IWZA 3J9SA 1UZWA 5IK4A 5KR7A 4GIQA 2W1WA 3FX3A 3H50A 3QH7A 3NAPC 3KT1A 2C0ZA 1LR5A 1O8SA 2D98A 2R071 4JGZA 2VL4A 4MADA 5JIUA 2BTVC 3B00A 1UL9A 1SLIA 4UW6A 3W21A 2IXHA 4I2OA 5FREA 1DIWA 3KVBA 4JHTA 3WF4A 2RMU3 3L9JT 2KR2A 2O8OA 1QQP1 2DU0A 2MHFA 4XHXA 5L73A 4BH9A 2XBO3 2NQYA 4N7IA 4MH0E 4XHBA 5FP7A 2WT1A 5CYYA 3VBHC 3UKVA 4R9AA 1MR5A 1DF0A 4BA6A 5CVRA 2YU2A 4XJ9A 4RSUA 3V65A 2BDRA 2EA7A 5BNNB 1V6NA 1BMV2 1HV0A 1YRZA 2ZGRA 1W3XA 1ZBA3 1WMXA 3RZZA 1US3A 1A3KA 1DQ5A 2VZSA 5F5CA 4EN6B 3DYPA 4DEVA 4Q4W1 4Y20B 3OBZA 2JG9C 1H2NA 1NA1B 4KU7A 5FYHA 2BWCA 5LBBA 1C1FA 3N9OA 5F2WA 2E32A 4Y1YA 4ZZ8A 3IM0A 4C0BA 1IG3A 2BOJA 5KHGA 4E4ZA 2YFUA 4Q4V3 2EIEA 2GP3A 1IHMA 1DGRA 4X8NA 5EJ1B 3S30A 2DDUA 3ZN4A 1BJQA 3N9LA 2RDSA 3ZN6B 3U07A 1OH3A 1CR7A 1H2LA 4MSVA 1Y9QA 4CE8A 2ENRA 4OHXA 1CJDA 2EIGA 3S0MA 4AF9A 1B35C 5CG9A 1H6XA 3H0OA 3KT7A 1UOFA 1PGL1 1YO8A 2AC1A 3O0XA 3NJZA 3LWCA 3I3QA 2UURA 2VZRA 2BW8A 1UOBA 4YW4A 1QJEA 1QOTA 2GC1A 3MIDA 1TMF1 3JXSA 5BNPC 5HXMA 1Q43A 4KBZA 2A70A 4GD4A 5HCBA 1HRV2 1WUVA 1RUI2 5KXBA 2KM2A 4YSFA 5CZKA 3KF3A 4FFFA 1MS9A 2SLIA 1G86A 3EBRA 4BQ4A 1PZ8A 2BV4A 2H0VA 3OCPA 1RXFA 1Z7S1 4OHZA 2Q30A 1W6MB 1FMD2 3F95A 3BALA 1VBB1 1YFWA 3U1XA 1RUD3 4PLMA 1DGWA 1YJLA 3VHNA 3SQOA 4EQVA 1ZZBA 3M4FA 5FZ8A 1DZRA 1FOD1 1XQNA 1IKPA 1O8PA 1UXXX 3G7DA 1T2XA 3H1YA 2ZGPA 2HH9A 1NZIA 4M3CA 3VBOB 2HWC1 1AUYA 1O4ZA 2NMNA 4AFMA 1AR61 2OPKA 2OQ7A 1JZ4A 1N1YA 4HKOA 1F2NA 2VNVA 3FN9A 1URXA 4LK7A 1OQDA 5CFDA 1WZXA 3IPVB 3BTYA 4P5YA 1J58A 5F6LB 2R1BA 1JOJA 3V56A 2VOXA 4WM7B 5FYSA 5IVYA 4ZS2A 4AAXA 4E2QA 4FPGA 2PHUA 1UXZA 4BE3A 4KWKA 4I01A 2CDPA 2YBPA 5ISLA 1C28A 1V6OA 2GU9A 2R7EB 4E27A 5J09A 3JZVA 4W8JA 1EAH1 1S0IA 1ULFA 1UPSA 1JU3A 2E51A 3KM5A 2AYHA 4FPLA 1CIWA 4GWNA 4OUMA 5FMBA 3S5QA 3UV9A 3WLUA 4K6BA 3CIHA 1X36A 4F7ZA 1OOPC 3S7EA 1YQ2A 3BB6A 1H4GA 4CCJA 2Q8OA 5LA2A 1A34A 3IIAA 1HQNA 1VBD3 4QGMA 2DCTA 3VGIA 5C3OA 5D8AC 3LIHA 2OPWA 3KV4A 1KXGA 4WV8A 1NXD1 4COVA 5L7OA 4K21A 3R6SA 4LKFA 3ZR5A 4FPKA 1CD3G 2WFF3 1QNYA 1JHNA 2BQPA 1F4HA 5FZ9A 3W58A 5ACA2 3WP6A 3DKQA 3ON7A 4F83A 5C70A 1NLSA 1RUJ1 1VBE3 5IFPA 2FZ1A 1ZZ9A 2ZS6B 4YFWA 3VBFA 5EYXA 2F6BA 3O14A 4AGGA 2ZGNA 1MACA 3NSTA 2JDAA 1D4M1 1NCQB 4X6QB 1XBFA 3ES4A 2DCKA 4KWJA 4COUA 2ZMNA 4Z82A 3MV01 5AC92 2Y34A 1LEMA 3H3ZA 1JYXA 2CGPA 3RG0A 3Q8CA 5FXZA 3N7LA 3CJIA 3WD5A 1V6KA 2JICA 5E1RA 3JB4C 3VD3A 5A3TA 3AXDA 1HN1A 5FYYA 1PO23 1C57A 1SPPA 1YI7A 2IXLA 2WZR3 1QJU2 2I45A 1GU3A 1QXPA 1QQP2 1RUG3 2B9UA 3HBKA 2DUPA 3HEIA 4XIOA 3H8UA 2QCSB 1UZ0A 4OCTA 2RS31 2ZEZA 4MXWA 5BY5A 3QBQA 4LUKA 4FPHA 2RS11 5KC6A 1CN1A 3M3EA 4D8MA 5IVVA 3SCHA 1COV2 1VMHA 1QU0A 3AB0A 3JBG1 3LE0A 1L7RA 3P6BA 4A6OA 3AZVA 3B02A 1W2OA 4UAPA 5L19A 4LT5A 4IEPA 3AP9A 4A45A 2DUQA 1REEA 2LTNA 4Q4W2 1YYNA 5FCCA 2JD9A 4FCAA 3AP7A 2BGCA 4HK8A 1N1TA 2Z42A 5F3IA 2XR4A 2K46A 1XRUA 3A4UA 3PUIA 5FWJA 2VOKA 4ZU7A 1LGBA 2B39A 4Q0PA 1H9WA 2GN3A 4AI3A 1IQDC 1RHI2 3HAGA 3QCWA 2PTMA 1OURA 1ZBE1 3WW1A 1IS3A 4MUVA 3L2YA 4LHSA 1XYOA 4UT5A 1Q8SA 3PU3A 4I0BA 3KGLA 1WW7A 3MW2A 3AZYA 2X5IC 3O1TA 3INAA 1CWPA 2BPA2 5EP9A 3P3PA 4FP3A 2HKXA 3WDXA 2J1TA 5ABJA 2YC0A 3D8CA 1RUF1 4G4FA 5FUIA 1MPXA 2PHWA 4UFLA 3C7OA 2ZABA 1XXNA 2P3JA 2VZ1A 4XTMA 5JSPA 1WCSA 3CF6E 5FYZA 1PVC2 1QJY2 1HX6A 4PHZA 4JC1A 1HN0A 3ALQA 4W6YA 1JI6A 4P02B 1OA4A 3PVBB 1VBB2 1EUTA 1AJOA 1AYM3 1O5LA 1RL3A 2WSUA 3K4ZA 3NAPA 1QJZA 3OSDA 1DQ4A 4KWLA 1FOD2 2C5DA 2VQ0A 5E88A 3KV5A 3OBRA 1IS5A 4NOTA 3ZSEA 1IZ3A 3AX4A 2VECA 3LDKA 3VKMA 3Q8FA 3SKJE 1FXZA 4CU8A 3U75A 3EXUA 4IESA 2QFEA 4YM3A 3GJBA 4Q8KA 1AXZA 4AI0A 5D21A 2Y26A 2D43A 2VD7A 2WO2A 4IEOA 4M3CB 2ZGQA 1PIV3 3UL2A 3VBHA 1N1VA 4XIKA 2EXKA 4ATFA 3S6PA 1NCRC 2ATFA 1WMEA 4NHKA 2VQAA 1W8ZA 3CLPA 5CFDB 1DDLA 4PI2A 1K42A 2ZXQA 1HRI2 3IDBB 1EAH2 1LEDA 5I91A 1SLLA 1JH5A 1MQTB 3NNFA 3VUOA 1FNZA 1VRH3 2D6OX 5ANQA 2E7TA 2W3JA 2JG9A 1GSLA 1CJPA 1XNDA 4XEZA 3H9AA 3I2JA 5FXVA 4UBHA 5LA1A 3V0AA 5LATA 1W6OA 2VVEA 2WAOA 4LO6B 4AYUA 3C2UA 3K48A 1G9BA 3MPBA 4IW3A 1LODA 5JUVA 3RYPA 5I0RA 2ADEA 3E5XA 4XF3A 1SLAA 2ARXA 1KJRA 1UYXA 2WZEA 3F2ZA 4HPKA 4C8DA 1C4RA 2QQKA 2JECA 5A1AA 4N9HA 2TEPA 5L7OB 3HN3A 4CCNA 5FPBA 4N53C 4ISQA 2WLQA 1FNYA 1JHJA 2B7YA 4KWUA 4M3CE 2Y6JA 3VBFB 5FZHA 2IXIA 2E7AA 3AFKA 5LWBA 4HKWA 5BNPA 3KCYA 1VRBA 1H0BA 3PURA 2BFUL 5FZAA 3J8F1 1DQ1A 3DUIA 2F4PA 3FL7A 3AMPA 3PVOA 4MGYE 1EV11 2P17A 2VMGA 3CJIB 3KD4A 3KS7A 4LITA 3ILRA 1BEV3 2R49A 1EP0A 2IXKA 2BNMA 2WT0A 3POFA 4CXYA 1Y7BA 4PQ9A 1BYHA 5FYUA 1W8NA 4CPBA 1JXNA 1SPPB 5HCAA 4JRAA 4XF4A 2BYVE 5C8CC 3WQ7A 4GWIA 4CP9A 1WLCA 1C3HA 4L97A 1M4WA 4MXWB 4QX1A 4P9XA 4COZA 3URFA 5IVBA 2YUEA 2JD4A 4L11A 2OX0A 2EXJA 2R32A 4NIDA 2DTWA 1VAKA 3H7YA 5LZ6A 2TUNA 3VBUC 3WQ1A 3Q8EA 3WW2A 4HVRA 4QHBA 3AMMA 2GMMA 2AR6A 4S2FA 1WLWA 3P1IA 1W8OA 3RWNA 4QX5A 4K8RB 1EPWA 3AKTA 1KS4A 2QNKA 4U36A 3NNGA 5A80A 3TEYA 2XPJA 3PTRB 2IUWA 4XXPA 5JOWA 4TLGA 2YB7A 3WHUA 1RVF1 3WR0A 5A7OA 5A7PA 1I3HA 1W0NA 3OD4A 4MGIE 4KQ7A 4Q4Y3 1ZRIA 5D8AA 5FZ3A 2DFBA 2P37A 3SEEA 3K4AA 2QZ3A 2A6YA 4CDWC 4O65A 4ARYA 5JI7A 1W9FA 5CB7A 1GICA 2VXJA 4DOUA 2HWD1 3I54A 4NHMA 4Y1UA 4LLFA 1PO11 1RUF2 1F9KA 2YROA 1G6NA 3MW4A 4LBNA 2W46A 3VD7A 1V0AA 3PVNA 3AYAA 4M4PA 2NP0A 2BGPA 2JDYA 3VB9A 5IK8A 3J7LA 5C5UA 5K8SA 5ABJB 5BYNA 2H0BA 2WYFA 1AR71 1C8M3 1NOVA 2BZDA 2WQ8A 4FSJA 3FFZA 1QOOA 3MPPG 1OHFA 3SEPA 1CZSA 5FJHA 2XVGA 4DUVA 2WFF2 2QZ2A 4PDWA 4FOYA 1KD7A 1PMJX 4BLJA 1Q56A 4H2AA 4FO9A 2PAKA 1YQ5A 1BK1A 4H14A 1RXGA 2IXJA 5FZCA 3ZYPA 1CGPA 5D1IA 3AMHA 3VL8A 4WBBA 4XMAA 5G04L 3ZYRA 2YYOA 2PAEA 3OJBA 4C1WA 2VW1A 5T5JA 4AZZA 4M00A 1LRHA 2VCAA 5JXHA 3JD71 2CWSA 5A7QA 4CPBD 3DKWA 1TG7A 4PBPA 2GNMA 1H8TC 5JWPA 1G9CA 1UOGA 1GWMA 4AVTA 1XE7A 4QQ2A 5DAPA 4NWWA 1J3PA 2WS91 3GZEA 3N9MA 2KD7A 3AL6A 3U14A 4RGGA 3VBHB 5IK7A 3LOBA 2WZR2 5I0DA 1N3OA 1ZRCA 5FZ6A 3ZYHA 4DO0A 1JZ7A 1QXJA 1AXYA 4ZPIA 1R093 1PM4A 3NRUA 4XUTA 4QM9A 1RUH1 4AL9A 4KH9A 3PUHA 2JDNA 4R52A 1CAVA 1BBT1 1BQPA 1H2KA 3RWKX 1TZOA 2D5FA 4YFZA 3CQOA 2AH2A 2WWUA 2J42A 3KB5A 2RJ2A 2JG9B 4URTA 5FZ4A 2TNFA 5APAA 2E31A 3AMQA 1UYPA 2XMLA 3V0AB 2CV6A 3DECA 3ZXDA 4OQ8A 2RR13 1GP5A 2K9ZA 3HT2A 2E53A 4XJZA 1MS3A 1HRV3 3DV8A 3IMMA 1XC6A 3GCXA 1RUI3 4YW6A 3E97A 2XG3A 2WABA 1AR91 4AG4A 4CTEA 5FV3A 4QU2A 3BIEA 2VGDA 1IGOA 1TME3 2X5IA 1UU5A 4IE5A 5F7UA 1NQDA 4CDXA 5A7SA 4HZFA 1FMD3 2WNEA 2C9AA 2IC1A 2RHPA 4O7XA 3VZNA 4MG2A 1S1AA 2D6NA 1RJ7A 2Y0IA 3M3IA 4GMP3 1VBC2 4K7JA 4XQDA 1R1A1 4ZZ5A 3PJYA 4XF9A 4RR3C 2GNDA 5JLVA 5CADA 5BNPB 1XU1A 3UETA 2V5DA 5LW9A 1TEIA 1KFUL 3THCA 5F9TA 3WF1A 2VU9A 4YARA 1BVVA 2B9VA 3A0KA 1V00A 4JKLA 2HEVF 3M70A 2HWE1 5HBAA 1E5IA 5BXXA 1VMJA 4FQ4A 5E6HA 4YM0A 2OYZA 3TOJA 4Q26A 1DZTA 1ULOA 4V2VA 3UK9A 1KEXA 1NG0A 3WT3A 3WW3A 3EO6A 1WA4A 2CSGA 5HXVA 4CA9A 2P2KA 5A3PA 3WF3A 3V64A 1W6QA 2VG9A 5A6YA 1DBNA 2OW4A 4AI8A 3J7MA 3ZFFC 4YW1A 3I7DA 1YIFA 1CQ9A 5JXJA 1LGCA 1KDMA 3E1F1 3IAPA 4JGZB 1NCRA 2LS6A 1DLCA 3M3CA 3SHRA 3TNQA 2UY9A 3E6CC 4CUBA 1NAEA 3WVJA 1BK0A 2KXLA 1TNRA 4Z1VA 1PGSA 4JGYC 5I8SA 3EJKA 4JV4A 2RJLA 3WDTA 1KITA 5H9RA 5ACA3 4OI0A 1GR3A 4Y1VA 2VO5A 5JZGC 4QX0A 1AJKA 1C8NA 2PQQA 2HWB1 4MVTA 4ZKTB 3EB7A 1AR81 3TBDA 1S2KA 1ASJ1 3NJYA 5FZOA 4IEXA 1DU3D 3LEKA 2YHJA 4JCKA 5FUNA 4D94A 1O3RA 1WWYA 2B5HA 5EZWA 3D0JA 4AI9A 1PO12 5F3GA 5FY1A 1QDOA 5D8AB 4DQAA 5FK8A 5DQ0A 2FMYA 4DS0A 4YG0A 5FP4A 5FPLA 1Y3TA 2ZX4A 4BM8A 1UU6A 2YY1A 3ZX7A 1GNYA 2DCZA 3ZMOA 2R062 4N53A 4BJ0A 3P5BA 1AX1A 3HPNA 1UO9A 4K3UA 2ZKNA 2D6PA 2J7MA 5FO7B 1WW4A 2VBBA 3FLRA 3T1LA 3GBFA 1QJU3 3ETQA 1QQP3 2GP5A 2D40A 3T4HB 2NM1A 4AXOA 1DYOA 5FK7A 1QF3A 2GNBA 3CO2A 3ENRA 1W8HA 2XLFA 2ARAA 5C3SA 2HYKA 3VDCA 1COV3 2VY0A 4A2UA 4B7KA 4DZGA 1OUXA 5B2GB 3LZZA 2NPIA 2WC2A 1RMU1 3POSA 2NZ9A 4PDWB 4WM8C 2J22A 4RGAA 3HIFA 3NW4A 2P34A 2DTYA 3JD72 5FPVA 4Q4W3 5T52A 1E5SA 4KG8A 2VNOA 5DABA 1LECA 4D6QA 5C3QA 3POBA 1S4CA 3VV1A 1V9U1 4YZ4A 5C8CA 4YM1A 3T3YA 4P9JA 4YVSC 1FV2A 3ZMNA 2V4AA 2VNGA 1SMVA 2UYAA 2W47A 2OIIA 5GLWA 4HG6B 4E9KA 4NPMA 2G9FA 1RHI3 4MOAA 2G9GA 2P1BA 3AXEA 2XJTA 4QX8A 4BIOA 2GMEA 2R1DA 3VBUA 4A3XA 1GOGA 2BFUS 3OEBA 2I74A 2BNOA 4GWMA 4GXLA 2VUAA 2Y6FA 4P5HA 4E2SA 3W5NA 3BOWA 3WG2A 1CAVB 4Q0UA 4NIHA 3RDIA 2BERA 4QXBA 1KDKA 4L8QA 4CU7A 4GJZA 2YU1A 4QKFA 3HQRA 5FY9A 2ZHKA 3PMSA 1ALYA 1UKRA 1AYN2 2JDPA 3NL1A 1PVC3 1QJY3 1LOBA 2WNVC 4CDUB 4A4AA 4CDWA 3LAGA 5LA0A 3Q9OA 1GZ9A 2FDJA 4PLOA 2LM3A 3SCFA 3MF9A 4CCDA 4DMIA 3WDVA 4P9YA 2EXHA 1VBB3 3CZUA 3WNNA 4P9IA 4NROA 2XLGA 3GYDA 3M8LA 4PLNA 1FOD3 3MHZA 2ET7A 4CDXB 4HKLA 3FHQA 4XABA 4LHNA 2FCUA 2YBKA 2J1VA 3QH6A 4META 4EWAA 2JKBA 4C0HA 3R0RA 5LBCA 1W03A 4ZU5A 3M2MA 2R041 2OQ6A 1H30A 5FZIA 1Z0HA 2A3YA 2UWBA 4AVSA 1W0PA 2DU1A 4AVCA 2OVUA 2W92A 1C8M2 3KHCA 1ODNA 3ITQA 5I0UA 1NT0A 4IEYA 4AR2A 4CCMA 3OY8A 1HRI3 1RUC1 4E4SA 1EAH3 1W6NA 2YPJA 3C7FA 1D4VB 1SLBA 1POQA 3I49A 3ORJA 3CHXA 3LSEA 3O12A 3O0WA 2YGLA 3VBSC 1H8TA 1VE0A 3FLPA 3MBWA 1CAUA 4Q0VA 4S2HA 3VKLA 4GAZA 1W6QB 2ZPXA 2IFWA 3AKQA 4GB31 1OMIA 2AUYA 3ILNA 3L2HA 2WBKA 5DZEA 4LOTA 2VM9A 1F5FA 4B1MA 5BUVA 1NCRB 2BU9A 3CBNA 4NHLA 4QWNA 4A44A 3ES1A 2WNUC 4QX7A 5A3NA 2YC4A 3W5MA 3U37A 1UF2C 2YMZA 3BU7A 3S57A 4HANA 1A6CA 4XDOA 1O91A 2AENA 3K51A 4PIXA 3WNXA 1SBEA 4NAMA 2EALA 3H1MA 1D4M3 3R4SA 1POV3 3POWA 4E4DX 1DYPA 2ZJCA 3FJSA 1LU1A 3N35A 4Z92B 1AL21 1XNAA 2Z69A 1UY0A 4Y1ZA 1R092 2PHFA 1N3PA 3IMNA 2QQMA 4HLTA 2JE8A 5FZOB 2X8KA 2YV8A 4BB3A 3DL3A 4BXFA 3GBGA 4KBBA 3KVAA 4MZUA 3U11A 1HXS1 1OFSA 2VZUA 1O4YA 5FUPA 1CAWA 5HCFA 1XYNA 3PLQA 1J3QA 1IPJA 1ULDA 1W8UA 4N53B 3ASIA 1JYIA 1J1TA 2RR12 4GKXA 5I8YA 1J59A 2RS13 2RS51 3WDUA 4IETA 2OUHA 2V73A 4RR3A 1QJX1 3MIEA 1US2A 2G1MA 2HEWF 3HNYM 4XUNA 4DUXA 2XHNA 3PMEA 1TME2 4WVVA 3SCGA 2IVJA 3KGZA 5F3EA 2PELA 4A6SA 5FO9B 2FDGA 3MEPA 4WZCA 4LXLA 2PHLA 3KHBA 3VHRA 3S5AA 2JX9A 5JAXA 4L9BA 1OBNA 4G9SB 1MZFA 3APBA 5AVPA 3UT0A 1T6GC 2Y33A 1VP6A 4UF0B 3DXTA 2EAAA 2FCVA 4MGQA 1ND2C 1UY2A 2XLAA 1W0OA 2WO1A 1YQ8A 1W90A 2VUDA 4UBGA 1GOHA 4XPVA 5FY7A 1S0JA 1NE6A 3ZFFA 4OMDA 1UIJA 5C8CB 3CDZB 1FYUA 2D93A 4XYXA 1LAJA 5FIXA 2RM21 2VZOA 4XDPA 4NUBA 4XAAA 3WUDA 2F4LA 3AJZA 3DF0A 1R081 1TVGA 3USUA 3DGTA 4JGYA 4K1YA 3MIGA 3T2TA 3D6EA 1DGRN 3AZXA 3I2OA 4OULA 1UD1A 4QQPA 1L3JA 1RUF3 3HNBM 4MGZE 3NKGA 4R9DA 5I8TA 5JZGA 2Y6KA 4DXZA 2LRPA 3RQ0A 4COWA 3JB8A 4K8FA 4YRDA 1A78A 1E57A 1Y9MA 4C91A 2W0XA 4NVPA 3JCIA 5A7NA 5J48A 1S0FA 4QPIC 3S7IA 4CVUA 4NPRA 3WZ1A 5F5QA 3ZXKA 1H8VA 1F5JA 2GC2A 2PHXA 3MW3A 1D7PM 4QD2A 4URAA 3M3OA 3ACLA 4CP2A 3WCSA 4CDWB 1CVNA 5EPAA 3BUCA 2E7QA 3B9IA 4MHRA 2RMU1 4GH4C 4AOCA 3CMGA 3AM2A 1JBCA 1UWWA 3WW4A 2A6ZA 5A33A 1NX9A 3I3MA 3ZN5A 4CEYC 2XBO1 4JAAA 4RFRB 5M0TA 1R1ZA 5BNOC 2JDMA 1PNGA 2ZGSA 5C3PA 4BWOA 2CYFA 5DPNA 2J1RA 4CEYA 2ET1A 2R072 4S2DA 4UW4A 4FVVA 2R042 5G05L 2XKPA 1ZM1A 1ZBA1 5FZDA 3H8XA 4NAOA 2GC3A 3AYDA 4L92A 4NJ4A 4WM8A 2WQ4A 5DZGA 4ASMB 2G4IA 1WBFA 2LROA 4H55A 2ZEYA 3PHMA 3PJQA 4I0AA 1PM7A 4I30A 1J3RA 1DYKA 2ZGKA 5F5AA 4PIYA 1YQCA 1GNHA 5FRAA 3IAQA 1W2NA 4Q4V1 2VR4A 4LPLA 4QDSA 3ZDVA 5JIAA 4GB32 5E16A 1O7FA 1W6NB 4YVSA 1BHGA 5C8WA 1QY4A 4CCLA 2QUOA 4EN8B 1H8TB 1W06A 3M1HA 2VXRA 1CAUB 3ZVXA 1ZRFA 4DINB 3C7EA 4R4XA 3HN1A 3MFAA 2B4KA 3ZKUA 1F8VA 1JOPA 4ZXEA 2XJSA 2VOTA 5FY5A 1CONA 1WLDA 2CWMA 3LA2A 4Z8BA 2J1EA 1AL22 3WNKA 3HWJA 3VDDC 2HJIA 1WCDJ 2NMOA 4QQHA 1C1LA 5DAQA 5EXOA 3J7NA 2RDQA 1SFNA 4IL7A 4WVWA 4Q4X1 1VBC3 3CZJA 1VMFA 3LEIA 1VIWB 5FBZA 2K2SA 5IYYA 4B4QA 2DURA 4FPCA 4YVWC 5FYMA 1HXS2 3WDWA 1RB8G 1PGL2 1RUD1 2XOMA 5A3UA 3SXWA 3AYEA 3Q8BA 4QPWA 4YLZA 5KHHA 3NV1A 1PGW1 1TMF2 2Y6LA 4XETA 3SITA 1O3TA 3VD9A 2BVVA 5JXGA 2WAAA 3GBWA 3A0NA 3R05A 1CAWB 4C1XA 3USSA 5LEJA 4O9EA 4FPYA 1UX7A 2H6BA 1ODMA 2YFZA 2XQRA 1YQ6A 2YG0A 3AL5A 3D0SA 2ZKLA 5FY4A 1UOJA 4XFFA 2P3YA 3D82A 1UNBA 2WN3A 5GLZA 3GF6A 3W20A 1W39A 1Z7S2 1UW8A 1OLQA 4JTNA 1A8DA 5FZGA 1AXKA 1RUE1 2E63A 3RMXA 4EN0A 1D0HA 4IGQA 3M7AA 4QB6A 3TWIA 1LOAA 2HWF1 1MZ5A 4FFIA 2VOVA 2BEOA 1I9RA 2XVKA 1V6IA 2QQNA 2X05A 4E2GA 5F2SA 5FZLA 2HWC2 4RGKA 4XJWA 1RUOA 4IEVA 3K3OA 3ELNA 3HVDA 4IGOA 4MGKE 1AR62 1R64A 2FDFA 1VBD1 3OGSA 5J7MA 1SCRA 3VDBA 4AE2A 1GQPA 4YWAA 4XAEA 3VBSA 2C6SA 2RM22 2IZWA 2WWJA 4NHXA 5H9PA 3VZLA 2BUKA 3C7HA 4QGNA 3VZMA 3OTFA 1JYVA 4IDZA 4JHZA 4LBQA 3THDA 1W05A 3ZFFB 4DB5A 2W94A 3CU7A 2FBEA 5LB6A 2VMEA 1FV3A 4RFT0 3RRDA 4XUPA 1VBE1 1W3VA 1OD5A 1PO13 1RUNA 3NV4A 2WNUA 1SLCA 3ZSKA 1AX2A 2RDNA 4FXKB 3USUB 1OPOA 2G9ZA 1NUKA 2CDOA 4JGYB 4QHOA 4CXXA 3T09A 2NLRA 2R063 2B45X 2ZEXA 1AR73 5FTTC 2CU5A 1SBDA 3I3BA 3T0AA 2DV9A 1LCLA 1YFYA 5JZGB 3OUJA 1CAXA 2A73B 1BZWA 5AVAA 4UFJA 1WMDA 1OF4A 5LY2A 3WHTA 5CKNA 2W91A 5IT6A 1LKNA 5HI0A 1PO21 1RUJ2 4ES8A 2WN2A 2PFWA 1B35A 3BCWA 5KHKA 2Y64A 1RUG1 2VMCA 3K3NA 4OYUA 1REDA 3GZTB 1GP6A 3IIIA 3VBRC 4Z2WA 4PI0A 4IEZA 1D4M2 1X50A 4B1LA 2RVAA 1UKGA 3NKTA 1HV1A 2Q1MA 4Q5OA 3WP5A 1SDWA 5L9RA 5A33B 1MS8A 1JS9A 3JD73 2OT7A 3FLTA 4A7KA 2QTWB 1GLHA 2GC0A 5JXIA 2A71A 1UN1A 2WINB 5GZCA 1CPMA 2ZACA 5J36A 3H3LA 4AFAA 1UQXA 3MIFA 4M01A 1YWKA 1X33A 1UZZA 2DVGA 2LUWA 3NNJA 4CEYB 5CA6A 5CEHA 1JZ6A 1V6LA 3AZWA 4CSWA 4FAHA 2HBUA 1QJFA 2QQIA 4D3WA 4WM8B 1PVXA 2RS32 3J7HA 2RS12 1U5ZA 5A3WA 1BVP1 2R0HA 2WUHA 4BQ1A 2JDUA 3TAYA 1ZZ6A 1M06G 2Z4FA 4Y22A 3RZHA 4QPGC 2VW2A 3G6JB 1ENRA 3LF7A 3JBG2 4K20A 2ZA9A 1LU2A 2JWPA 2Z5WA 3N7KA 4A41A 3ZXLA 5J37A 1CZTA 2WWSA 2DCYA 5FZBA 3ZYIB 1QOSA 4M0HA 5LASA 4IE6A 1Q8PA 4QPYA 1H6YA 4LBQD 4OFGA 5KWRA 1SEFA 2X09A 3B9CA 4PCRA 1NY71 1AYN3 4OUSA 3WQBA 4D6RA 2V72A 4IE0A 4M3CF 5FQ0A 2D6KA 3TYJA 1YFXA 4FP2A 2QDNA 2VVFA 1Q8VA 2PXJA 2Y0OA 3OGRA 4GA9A 1F35A 4AQ2A 1ZZ8A 4QQOA 2OA2A 4P00B 4LA3A 4TTGA 1ZRDA 4WVMA 1PZ9A 1ZBE2 1OOPA 2P3IA 4OMCA 4XURA 1S0CA 4HVOA 4ARXA 4OLLA 4QPIA 4QB1A 1AYM1 1XSQA 4LR4A 4WM7C 2ZEWA 4RN5A 4QXCA 1SACA 4XXAA 1OD3A 1YHFA 4N9IA 4NO4A 5FZ7A 4R9BA 1U5YA 1VLNA 3SLIA 1L7LA 2VPVA 2WIIB 5FZ1A 3KCXA 1X7NA 4GH4A 4HVQA 5F5IA 3OEAA 4HBNA 2ZX1A 3MV11 1JUIA 4W4ZA 1RITA 2GDFA 2ZTNA 1N1SA 3LDRA 2AGSA 4N8MA 2EAKA 4DXSA 1PIV1 5BNOA 4BMEA 5C4WC 4M4RA 2VVDA 4I3GA 1RUE2 1FI2A 1VAMA 1W8TA 1W9TA 3U0ZA 5F32A 4MGSA 4D69A 4QKDA 4R9CA 1NXMA 3BYWA 1JUHA 3THPA 4AI2A 1F4AA 4CCEA 2WDBA 3ST7A 2VBDA 4KL1A 4KG0A 5JVVA 5FDBA 5CIRA 1D2SA 3NAPB 1WKYA 3MZHA 1O3SA 2ZHMA 4QDRA 4XFBA 4K40A 2P5BA 3B01A 2JIJA 1OFNA 3MLLA 4W6WA 1QDCA 3AVRA 1L7QA 4ZXKA 3WV6A 3BGAA 3OUIA 3GCWA 2ZGUA 2ZGLA 4Y3OA 1ENQA 3W9AA 1XNTA 2L9LA 2PN5A 4WZFA 2JE9A 3VBSB 4AI1A 3NWKA 3OGVA 2OZ6A 3J26N 5CAZA 1UAIA 3NNMA 3WG4A 2DVDA 4LBQB 3LFMA 4CEWC 2AEYA 1GANA 1UMIA 3ABZA 4Q2FA 3NNLA 1QIQA 2W52A 4BLIA 4ONUA 2A6WA 3FE5A 3ILFA 4IQPA 4J25A 4LBMA 4NR1A 3RMYA 5IVFA 2WNUB 1OSGA 4BU2A 3VN4A 2D44A 2PHRA 4SLIA 1PX3A 1W9SA 3VDDA 5GZGA 2XGXA 4XBLA 2VNRA 2NN8A 4JZRA 1W6OB 3EMRA 4IEWA 5SV8A 5FZEA 2RG4A 2CTVA 3AC0A 4LUMA 4Y26A 1FPN1 1CAXB 5F6KA 1NYWA 4YVWA 4FFGA 1BEV1 1GFF2 3OPTA 2IWGB 4MV2A 4XZUG 4ATEA 4NRPA 2ZBJA 4RQPC 3ZSMA 3BN6A 4LHLA 1ACCA 4TXWA 5B4NA 4RHV1 4XILA 3VKNA 4HPKB 1GUIA 3SH3A 3ZOIA 3RZGA 1LNSA 1B35B 3ZXAC 3T2OA 2X53S 1OKQA 3LEGA 5LBEA 5DUWA 5F1RA 1MEC1 3FFQA 3J8F2 3TNPB 1GV9A 4LE3A 1AZDA 2Z79A 2VH9A 2WSVA 5A3LA 2XJRA 1RYYA 3E5UA 1AL0G 5F39A 1DQ0A 2QQUA 3EYPA 1EV12 4ITCA 1A8MA 2QQLA 4GJYA 1EYBA 2WA4A 4I3PA 4Y5Z0 4EZ4A 4BPZA 2C4XA 4P08A 5DN2A 3PUSA 4E8DA 4FT8A 4LQRA 4CYDA 2A3WA 4LA2A 5FWEA 1XE8A 3IDAA 4JKKA 4HN0A 1G9DA 1UPIA 2Q8EA 3IBMA 2X29A 3O0VA 1DHKB 2AEZA 4Q4Y1 1WW6A 3BPZA 3ZSLA 5IWFA 2P6CA 4FQZA 4ET7A 4Y22B 5J96B 5FYCA 3TEZA 3AMNA 3GDBA 2FZ2A 4CZSA 2GH2A 4CP9B 2UWAA 3HR9A 2JDKA 3WNLA 4IV3C 1W8WA 1OA2A 4CCOA 4JDOA 4BOWA 3C3VA 3GZAA 4S2GA 4ZU4A 4YNIA 1MZEA 3B3QE 5FMOL 5LA9A 2D6MA 4AFDA 5FQ0B 3O1PA 1RVF2 4YZ2A 1K12A 5B4XA 3IT8A 5C5TA 2O0OA 2AREA 5LRSA 5GM0A 5T5LA 5ANNA 1N47A 4WVMB 3RI9A 1OUSA 2JEMA 5A1FA 1OOPB 1XNCA 2HWD2 2GALA 2QQWA 4LMFA 2E6VA 1GP4A 1QGLA 2IFRA 1AX0A 2LALA 2VE1A 4QPIB 2WFPA 1MQTC 4BHPA 3WQ0A 2R073 4Y20A 1QXRA 4BQXA 1G9FA 5DUVA 2R043 5GLTA 3UGFA 3VBRA 1W9WA 1UY4A 2ZHLA 3WSOA 1OC1A 3RZJA 1F15A 5IW0A 4BXSV 1AR72 1VBA1 2WRAA 4YGCA 1XB9A 4GH4B 5LK5A 4OI1A 1YJKA 2PHTA 2VUJA 3N9NA 2JE7A 3ZXEA 2YPDA 2YGMA 5C7GA 3RZMA 4Q1PA 4LIVA 4QAWA 5F37A 1OQ1A 1NLQA 2P3KA 2A6VA 3DXUA 2JG8C 1PK6C 1AF9A 1QMJA 3HQXA 5BNOB 2CHHA 1CX4A 1QWRA 4QX3A 3WUCA 2XJQA 5EV7A 4YZ1A 2VMHA 1WCUA 4GB33 3BTZA 2VZTA 2UWCA 2WR9A 4XCBA 4Q1RA 1S0DA 3VZKA 3ACHA 1QHDA 4U2AA 3POIA 1J83A 4Y4YA 4MHUA 1SHWB 3WINE 3OGGA 5DUXA 4FOVA 1VB4A 1HW5A 2A7AA 4CXWA 4DUWA 3PU8A 1HLCA 2Q0AA 1RINA 1AHSA 1EY2A 3VZOA 3TB0A 4HONA 1O59A 3UKTA 2E26A 4HSJA 4QPGA 5FMCA 4JVAA 4JRLA 1GNZA 1EUUA 3N36A 5DDJ1 2WS92 4PF1A 1MS0A 4YGDA 1IS4A 5L36A 1HB3A 2JXAA 1AL23 2W9XA 4D7YA 4YG6A 3ZR6A 1RUI1 1KS5A 1UU4A 5GLVA 1ST8A 4COYA 4EYUA 1GOFA 1ULCA 1RIRA 1RUH2 1XJAA 2D3RA 1ND3C 1BBT2 3NQHA 3D4KA 1UCXA 1NZCA 3I2IA 3OUHA 1HXS3 1ZZ7A 5CKQA 1ENXA 3ROUA 4BQWA 1ZREA 1K45A 3BPSA 4HT1T 5BPXA 4F3JA 3GZUC 4GMP1 4GALA 4OZOA 1BLZA 1YFUA 5LK7B 2VMFA 4TLFA 1TMF3 3OPWA 3O1OA 1H1MA 3T4VA 1STMA 2XWBB 1FPN2 3ZIWA 3OD0A 3VDDB 1AR92 2LW8A 3GXUA 3LKJA 1JZ3A 1VB2A 3OOXA 5CFCC 5FPUA 5IK5A 5SV5A 2WJSA 4GWJA 2RDRA 4M0NA 3ZIXA 1JYTA 1Z7S3 3E5QA 5KXCA 3AP6A 1CIYA 1YEWA 4YVWB
chains in the Genus database with same CATH topology
4IERA 3JQWA 4Q27A 3N4MA 3ZYGA 1MEC2 2X5IB 4I02A 4K1ZA 3WY6A 1R1A2 4TWTA 3KQRA 2HWC3 3I2DA 2Q4SA 4W65A 2ETEA 5C4WA 2D6LX 3SMHA 4PJYA 1AR63 4P9WA 1ONAA 2DYCA 1HIXA 1YXWA 1RTVA 1G9AA 3V0BA 2HWE2 4JDMA 3EHKA 1V70A 2RM23 4AVAA 2W08A 5T54A 3TN91 4UW5A 3AFGA 1FATA 2PYTA 5ACA1 4BZ4A 1ENSA 2PLV1 5JMCA 1CPNA 3R4DB 4SBVA 2ES3A 1H9PA 3KCCA 3N7JA 5KHJA 4P14A 1YUDA 3OBTA 4UW3A 5AC91 1LOFC 2EXIA 2MEV1 3I8TA 2WQZC 4R4ZA 5I93A 3VLBB 4D7SA 3ZYJB 3QD6A 4HK9A 3NVCA 3BTAA 3O5SA 1WCKA 2OZJA 3I59A 4ASLA 4MLOA 4CEWA 1WD4A 3VKOA 1RUJ3 4D7TA 4AQ6A 2UU8A 3AJYA 3GNEA 3AK0A 4AVBA 1QJU1 2HWB2 3QOPA 1AR82 1ASJ2 1VAVA 4HETA 2VOWA 1COV1 3KT4A 3WCRA 2ARBA 4LO4B 3WX5A 3AP5A 4MXVA 5FPZA 4RQPA 3ZFGC 1GYKA 1VBA2 1ZX5A 2ZGTA 3AYCA 1OI6A 1QNWA 2VULA 1RJ8A 1CESA 2GN7A 4FXGB 2WLPA 4XF1A 4HMZA 3VBRB 4V1PA 5BNQA 2RS33 3M3QA 2AZ5A 2MNGA 5KHIA 3THTA 2RE9A 1LOCA 3U10A 3BOPA 4RS5C 1Q8QA 2YZ4A 1RMU2 4W6XA 3JBG3 1C5IA 1SLTA 1RHI1 4DFSA 2D97A 2CAVA 1W6PA 4KU8A 4L99A 4RD7A 2A5ZA 4MX3A 2IXCA 2FHRA 1TNFA 2JDZA 1V9U2 4J1XA 3SNMA 1HKDA 4H7MA 5DDJ2 3ZFEC 3KLSA 3BIWE 4LBJA 1PVC1 1QJY1 2XL9A 4QPGB 1UIKA 1TQ5A 3AKPA 1ZBE3 4Q4X3 1DG6A 4IV3A 4FTSA 1K5MC 3RPQA 4GMP0 2V09A 3UKNA 3WG3A 1GKBA 3T1MA 3VBUB 4AVVA 4OHYA 4X6RB 4RA0A 1C5HA 3B69A 4AQSA 4AFCA 2WZPP 1GQGA 4XFAA 4IXLA 1ZZCA 1QH7A 4LO7A 4IEQA 2ZZJA 4XBQA 1KJLA 1S0EA 4Z07A 4I09A 2GAUA 1ZYBA 5LEKA 1RUE3 4GQ7A 2D7FA 4XOGA 1MQTA 4CDQC 3ZO0B 4FTEA 3HD8B 2HWF3 2DVAA 4TSVA 1HRI1 4TZDA 4YG3A 3CNAA 1O3QA 1LJ7A 4IEUA 4F8AA 5DUUA 3RNSA 4B8EA 1LHNA 1OPMA 5A3MA 3HMYA 1Q3EA 2FQPA 4Y24A 3DN7A 2JG8A 1PK6A 5FMOS 5C4WB 1WBLA 3RS6A 5K0UC 4NWVA 4AHXA 3TN92 2CAUA 5C6CA 3V0BB 3ZXJA 3HBZA 1HQLA 4EWDA 4QM8A 4B7EA 2PLV2 3FZ3A 4BCUA 5J3UA 1RUC2 2ZGMA 3DPRC 4IV1C 2BVBA 1POV1 1N3QA 2QE3A 3OY8B 5A32A 4FPFA 2MEV2 4AGVA 1D2QA 2O8QA 3D5OA 4PDWC 3UJQA 2GSYA 4HSLA 1XYPA 1WD3A 4N43C 2DFCA 1DQ6A 4AEDC 2R0FA 2CNAA 1ND3A 2ZX2A 3SH5A 1DLLA 1XNBA 3ZXFA 3KMHA 5KXEA 5FOBB 3I59B 3AP4A 4CEWB 1H1IA 4YGBA 4QQLA 4EROA 1LESA 1MVEA 2RJKA 5IUQA 4G3YC 1UMZA 4XMIA 1I6XA 2V5YA 3RSJA 3J8F3 2WNVA 1JN2P 4LNVA 4H3WA 5CFCA 2TBVA 4Q0SA 4FBFA 1EV13 3LCPA 4XQ4A 1BCXA 5DG2A 3WG1A 4QXKA 2C1FA 1MS4A 4EN9B 4XJAA 4RQPB 5JSOA 2RS52 4XFGA 3RYRA 2VMIA 3ZDSA 1QJX2 4OI4A 4CDUC 4AFBA 1FAYA 5C9AC 2Z2SB 4LO8A 4AEKA 4RR3B 5E89A 1IS6A 1H1AA 3NO8A 3JUUA 3WP4A 5CG8A 1RGSA 1W6PB 5FFOC 4CDXC 2VW0A 4EJRA 4DNYA 1MZ6A 2DVBA 1GBGA 3FUOA 5K7PA 3GHNA 3U4XA 4WVZA 2ZMKA 1GZCA 1IOAA 1RVF3 2XJVA 3WOGA 1SBFA 4AHZA 4J1WA 1LOFA 3H1WA 4EWEA 2WFF1 5GALA 1R082 2XJUA 4AEJA 2CGNA 5GZFA 5AFBA 2UY8A 2Y38A 1PNFA 1U5IA 2HWD3 3FBYA 4RL7A 4IV3B 1ZNPA 1W2UA 2ZX0A 1I5ZA 3ECQA 2GZWA 3IDEA 1IKQA 3FBMA 3P3NA 1GZWA 3PNAA 4YW3A 2ZX3A 3VHPA 3UJOA 3MYXA 3ZXGA 4EV0A 4J6GA 5BNNC 1PHMA 3JQXA 2DVFA 1FT9A 4AK3A 4L2NA 1V6JA 3B7MA 3SH4A 4EN7B 2JENA 2W68A 2RMU2 4YZ3A 1ZRRA 4AHYA 1GQHA 1NA1C 2WZR1 3WDYA 4FTBA 3ZFGA 2XBO2 4K9SA 5T5PA 4HL0A 3VKFC 1UZYA 3H3UA 5AFEA 2DF7A 1WW5A 3NV2A 1F31A 5GLUA 1KRIA 4B29A 2B46X 2XB6C 4RS5A 3CJXA 2CL2A 5JOZA 1H2MA 1ZBA2 1WGPA 4FOWA 2A3XA 1XU2A 2WS93 2I07B 2JG8B 1PK6B 1V6MA 2UYBA 5TSWA 1SCSA 1SFYA 3GHMA 1LHOA 1LOGA 2YXSA 2ZHNA 1POV0 2BNNA 2PHDA 1BKZA 1RUH3 2ZGOA 2O1QA 3OYWA 3ME2A 4Q4V2 1BBT3 1ND2A 5KBFA 3QLQA 3ZFEA 3B5LB 4OI2A 1MVQA 1ULGA 4BYYA 1NLRA 1VBC1 1NQJA 4ORFA 5KXDA 3H7JA 1MS1A 5T55A 4MYEA 5A32B 4KGQA 2XUMA 4YVSB 2HEYF 2W39A 4HFSA 4KGGA 1FPN3 3MIBA 1AR93 1ZVFA 3LOIA 3VZJA 5JPMB 1K5MA 3VBOC 5FLJA 1LHVA 4Q8LA 4RHV3 4YM2A 1ND3B 2BWAA 5JDBA 3FMGA 1MEC3 4Q4X2 1R1A3 4JQRA 5CBLA 5T5OA 4QT6A 2ZZQA 1X82A 4YZ5A 1RUD2 3JU9A 1J1LA 2GH8A 2WNVB 4CDQA 1PGW2 2HWE3 4XJUA 5CFCB 4OZXA 5EYYA 5JR7B 3MICA 4Y1XA 3FUQA 2WL1A 3LA3A 1HQWA 1UX6A 3FC0A 4DRRA 3AKRA 2NYYA 3MDPA 4B4RA 4HN1A 2DUOA 4LEJA 4XBNA 2GMPA 2ZCWA 4DPNA 1REFA 1ZA4A 5EWSA 3GALA 1H4HA 5K0UA 2HWF2 4A7YA 4BIFA 2MPFA 3MI8A 3TRSB 4AW7A 2WKKA 1Y43B 1VRH1 2XWJB 1NCQC 4P9GA 5JSRA 2B8MA 4FPEA 3DPRA 3AKSA 1VBD2 4DY5A 1DFQA 2R061 4CRQA 4IV1A 1LHUA 2I2SA 3I4IA 4FAGA 2EVXA 5H9SA 2WA3A 2K0GA 1IPKA 2HWB3 3RJRA 4LTAA 3IN9A 1AR83 5H9QA 1ASJ3 4XQWA 4XFHA 1VBE2 3ATGA 4JGZC 2A6XA 4N43A 1B09A 4AEDA 1VALA 4LO5B 4PIZA 4P9LA 1RC6A 5JPNB 5FAXA 4PBOA 2ZMLA 4DRVA 4I0WB 3QACA 4ISRA 1YNAA 1Z78A 1VBA3 1O4TA 2XH6A 1LB2A 1U0AA 1GZWB 2OUJA 2QDRA 3N3HA 4YW2A 1X8EA 3IKWA 2YDEA 1PO22 4XTPA 3O7OA 4OHWA 1PMIA 3NV3A 4NN0A 5BV6A 1RUG2 3MFCA 5GJ6A 1OLRA 1RMU3 1S2BA 4QGLA 2ILMA 5CNAA 1LULA 5EJ3A 4AGRA 2QVSB 4N7UA 3ZFGB 1U5XA 3MF6A 2D5HA 3KSCA 4CDUA 2ERFA 1O5UA 1V9U3 3LGRA 3E6BA 5DDJ3 2D3SA 5C9AA 2GNTA 4LHKA 1KFXL 2BBVA 1DZQA 4GKYA 4RS5B 4DY3A 1AYN1 3ZPYA 1YLLA 4CP1A 5GKAC 2DWRA 1Q5OA 1JTZX 1QKQA 2JJ6A 5EFUA 3OPZA 1LGNA 5T50A 4XW3A 4YGEA 2XJPA 2XL7A 3SISA 3OYWB 5GZEA 3X29B 1ND2B 1DGLA 4Q29A 4XJ8A 2WT2A 3ZFEB 1FX5A 4LBOA 5LRRA 3POYA 1NY72 3FHIB 1WMFA 5DXDA 2QKDA 4FPOB 2PA7A 3OF1A 4XF0A 2XHKA 4XFCA 3RI8A 4JDNA 3LA7A 2DCJA 3MGUA 1X8MA 3EQEA 4H7LA 1K5MB 1QH6A 5DZFA 2CGOA 1C8M1 4FPJA 5C33A 4OHVA 3LB9A 1DGWX 1AYM2 2D3PA 1EPZA 5BNNA 5I0SA 5J98B 5CFDC 1IQAA 1DQ2A 4LBKA 3LSDA 4GULA 4LE4A 3MLKA 3FWEA 2FMDA 2SBAA 1NA1A 1BMV1 3TN93 4UXAA 4CDQB 4JTOA 1AVBA 3W59A 1PIV2 2PLV3 1VJ2A 4QMAA 1RUC3 4LLOA 1G8WA 4C90A 2Q1ZB 3ZN6A 4ES9A 1U12A 5L7OC 4TYSA 5AC93 2MEV3 3RYKA 3CEWA 4XFIA 5T3NA 4INDA 2XKOA 1R091 1VRH2 1LHWA 4Q0QA 4CP0A 5FPXA 3MLJA 5K0UB 2Q5TA 3VBFC 1LENA 5K9YA 1YI9A 4N90A 2R30A 1PZ7A 3DPRB 3AZZA 1XNKA 4IV1B 2RR11 4CEYC 4YW5A 1SQ4A 3CJIC 1HRV1 4XZPA 1W6MA 4PF5A 2XVLA 4R8HA 1TME1 1APNA 3HT1A 2A75A 1Q8OA 3VL9A 4AWDA 3VBOA 2EF6A 4N43B 1FMD1 3WP3A 1JW6A 3B93A 3R4UA 4AEDB 3OGJA 3B94A 5JI9A 4AHWA 1WLTA 5E8AA 1LOEA 5GZDA 3PTYA 1OQEA 1S55A 4B3NA 4XDQA 2R6QA 2E9QA 3IPVA 1D0GA 2RS53 4LBLA 1I1EA 3MIHA 5FO8B 2B42B 1QJX3 3WXPA 2ZAAA 4AQTA 1BEV2 1G7YA 4WM7A 3RJ2X 3PVEA 1MS5A 4X8PA 4RHV2 1S0BA 5JCTA 1YIPA 5FLHA 2H6CA 4FOQA 2PAMA 1HDKA 1ULEA 3ZSJA 3E6DA 1OA3A 4B4PA 5JOXA 1BXHA 5I0TA 4YYOA 1TE1B 3VHOA 2CY6A 2QQPA 2QJVA 3IDCB 2KA3A 4OVEA 1KQRA 1NE4A 5KC5A 4O9GA 2N7GA 5C9AB 4KNCA 3J4UH 4BMBA 5JOYA 3KZ4C 3BODA 1R083 5ABJC 1NCQA 2ZAHA 1VR3A 1YCIA 4Q4Y2 1S0GA 3CL1A 2ZOEB 3N7MA 4XE9A 5FOJB 5CU1A 4LULA 4AEMA 5FLIA 2R16A 5DG1A 1JYCA 1LTEA 4A7ZA 3IWZA 3J9SA 5IK4A 4GIQA 3FX3A 3H50A 3QH7A 3NAPC 3KT1A 2C0ZA 1LR5A 2D98A 2R071 4JGZA 5JIUA 2BTVC 3B00A 1UL9A 1SLIA 4UW6A 2IXHA 4I2OA 5FREA 1DIWA 2RMU3 3L9JT 2O8OA 1QQP1 2DU0A 2MHFA 4XHXA 5L73A 4BH9A 2XBO3 2NQYA 4N7IA 4MH0E 4XHBA 2WT1A 3VBHC 3UKVA 4R9AA 1MR5A 1DF0A 4BA6A 5CVRA 4XJ9A 4RSUA 3V65A 2EA7A 5BNNB 1V6NA 1BMV2 1HV0A 1YRZA 2ZGRA 1ZBA3 3RZZA 1A3KA 1DQ5A 4EN6B 4Q4W1 4Y20B 2JG9C 1H2NA 1NA1B 4KU7A 2BWCA 1C1FA 4Y1YA 3IM0A 4C0BA 5KHGA 4E4ZA 4Q4V3 1IHMA 1DGRA 4X8NA 3S30A 3ZN4A 1BJQA 3ZN6B 3U07A 1CR7A 1H2LA 4MSVA 1Y9QA 2ENRA 4OHXA 1CJDA 2EIGA 3S0MA 4AF9A 1B35C 5CG9A 3H0OA 3KT7A 1PGL1 1YO8A 3O0XA 3NJZA 3LWCA 2UURA 2BW8A 4YW4A 1QOTA 2GC1A 3MIDA 1TMF1 5BNPC 1Q43A 2A70A 5HCBA 1HRV2 1WUVA 1RUI2 5KXBA 2KM2A 4YSFA 1MS9A 2SLIA 1G86A 3EBRA 1PZ8A 2H0VA 3OCPA 1Z7S1 4OHZA 2Q30A 1W6MB 1FMD2 3BALA 1VBB1 1YFWA 1RUD3 4PLMA 1DGWA 1YJLA 3VHNA 1ZZBA 3M4FA 1DZRA 1FOD1 1XQNA 1IKPA 3G7DA 4M3CA 3H1YA 2ZGPA 3VBOB 2HWC1 1AUYA 1O4ZA 2NMNA 4AFMA 1AR61 2OPKA 1N1YA 4HKOA 1F2NA 1URXA 1OQDA 5CFDA 3IPVB 1J58A 5F6LB 2R1BA 1JOJA 3V56A 2VOXA 4WM7B 4E2QA 4FPGA 2PHUA 4BE3A 4KWKA 4I01A 1C28A 1V6OA 2GU9A 4E27A 5J09A 3JZVA 1EAH1 1S0IA 1ULFA 1UPSA 2E51A 3KM5A 4OUMA 2AYHA 4FPLA 1CIWA 4GWNA 3UV9A 3WLUA 4K6BA 1X36A 4F7ZA 1OOPC 3S7EA 3BB6A 1H4GA 2Q8OA 3IIAA 1HQNA 1VBD3 4QGMA 2DCTA 3VGIA 5D8AC 1KXGA 4WV8A 1NXD1 4COVA 5L7OA 4K21A 3R6SA 4FPKA 1CD3G 2WFF3 1QNYA 1JHNA 2BQPA 3W58A 5ACA2 3WP6A 4F83A 1NLSA 1RUJ1 1VBE3 2FZ1A 1ZZ9A 2ZS6B 4YFWA 3VBFA 5EYXA 2F6BA 3O14A 4AGGA 2ZGNA 1MACA 3NSTA 1D4M1 1NCQB 4X6QB 4COUA 3ES4A 2DCKA 4KWJA 2ZMNA 4Z82A 5AC92 1LEMA 3H3ZA 2CGPA 3RG0A 3N7LA 3CJIA 3WD5A 1V6KA 2JICA 5E1RA 3JB4C 3AXDA 1PO23 1C57A 2IXLA 1YI7A 2WZR3 4JGZB 1QJU2 1QXPA 2B9UA 1QQP2 2I45A 1RUG3 4XIOA 2DUPA 3H8UA 2QCSB 2RS31 4MXWA 5BY5A 3QBQA 4LUKA 4FPHA 2RS11 5KC6A 1CN1A 3M3EA 3SCHA 1COV2 1QU0A 3AB0A 3JBG1 3AZVA 3B02A 5L19A 4LT5A 4IEPA 3AP9A 2DUQA 1REEA 2LTNA 4Q4W2 1YYNA 5FCCA 4FCAA 3AP7A 2BGCA 4HK8A 1N1TA 2Z42A 1XRUA 3A4UA 2VOKA 4ZU7A 1LGBA 2B39A 4Q0PA 1H9WA 2GN3A 4AI3A 1RHI2 3HAGA 3QCWA 2PTMA 3WW1A 1ZBE1 1IS3A 4MUVA 3L2YA 1XYOA 1Q8SA 4I0BA 3KGLA 1WW7A 3MW2A 3AZYA 2X5IC 3INAA 2BPA2 3P3PA 4FP3A 2HKXA 3WDXA 5ABJA 2YC0A 3D8CA 1RUF1 4G4FA 2PHWA 2ZABA 1XXNA 2P3JA 4XTMA 5JSPA 1WCSA 3CF6E 1PVC2 1QJY2 1HX6A 4JC1A 3ALQA 4W6YA 1OA4A 3PVBB 1VBB2 2WSUA 1O5LA 1AJOA 1AYM3 1RL3A 3NAPA 1QJZA 1DQ4A 4KWLA 1FOD2 2C5DA 2VQ0A 5E88A 3OBRA 1IS5A 4NOTA 3ZSEA 1IZ3A 3AX4A 2VECA 3VKMA 1FXZA 3EXUA 4IESA 2QFEA 4YM3A 4Q8KA 1AXZA 4AI0A 2Y26A 2D43A 4IEOA 4M3CB 2ZGQA 1PIV3 3UL2A 3VBHA 1N1VA 4XIKA 2EXKA 4ATFA 3S6PA 1NCRC 2ATFA 1WMEA 4NHKA 2VQAA 3CLPA 5CFDB 1DDLA 1HRI2 3IDBB 1EAH2 1LEDA 5I91A 1SLLA 1JH5A 1MQTB 3VUOA 1FNZA 1VRH3 2D6OX 2E7TA 2JG9A 1GSLA 1CJPA 1XNDA 4XEZA 3H9AA 4UBHA 3V0AA 1W6OA 2VVEA 4LO6B 4AYUA 3C2UA 3K48A 1G9BA 3MPBA 1LODA 3RYPA 5I0RA 4XF3A 3E5XA 1SLAA 2ARXA 1KJRA 4HPKA 5L7OB 1C4RA 2JECA 4N9HA 2TEPA 4N53C 4ISQA 2WLQA 1FNYA 2B7YA 4M3CE 3VBFB 2IXIA 2E7AA 3AFKA 4HKWA 5BNPA 3KCYA 1H0BA 2BFUL 3J8F1 1DQ1A 3DUIA 2F4PA 3AMPA 3PVOA 4MGYE 1EV11 2P17A 2VMGA 3CJIB 3KD4A 3KS7A 3ILRA 1BEV3 2R49A 1EP0A 2IXKA 2BNMA 2WT0A 1Y7BA 4PQ9A 1BYHA 5HCAA 1JXNA 4JRAA 4XF4A 2BYVE 5C8CC 3WQ7A 1WLCA 1C3HA 4L97A 1M4WA 4MXWB 4COZA 4P9XA 3URFA 2YUEA 2JD4A 4L11A 2EXJA 2R32A 2DTWA 1VAKA 3H7YA 2TUNA 3VBUC 3WQ1A 3WW2A 4HVRA 4QHBA 3AMMA 2GMMA 2AR6A 4S2FA 1WLWA 3RWNA 4QX5A 1EPWA 3AKTA 1KS4A 2QNKA 4U36A 2XPJA 4XXPA 5JOWA 3WHUA 1RVF1 3WR0A 1I3HA 3OD4A 4MGIE 4KQ7A 4Q4Y3 5D8AA 2DFBA 2P37A 2QZ3A 2A6YA 4CDWC 5JI7A 5CB7A 4DOUA 1GICA 2HWD1 3I54A 4NHMA 4Y1UA 4LLFA 1PO11 1RUF2 1F9KA 2YROA 1G6NA 3MW4A 4LBNA 3PVNA 3AYAA 2NP0A 5IK8A 5K8SA 5ABJB 5BYNA 2H0BA 4FSJA 1AR71 1C8M3 1NOVA 3FFZA 1QOOA 3MPPG 1OHFA 2XVGA 2WFF2 2QZ2A 4PDWA 4FOYA 1KD7A 4BLJA 1Q56A 4FO9A 2PAKA 1BK1A 4H14A 2IXJA 3ZYPA 1CGPA 5D1IA 3AMHA 3VL8A 4WBBA 4XMAA 3ZYRA 2YYOA 2PAEA 3OJBA 4C1WA 2VW1A 5T5JA 4M00A 1LRHA 3JD71 2CWSA 3DKWA 4PBPA 2GNMA 1H8TC 5JWPA 1G9CA