3WP3A

Xylanase 11c from talaromyces cellulolyticus (formerly known as acremonium cellulolyticus)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
190
structure length
190
Chain Sequence
QSITTSQTGTNNGYYYSFWTNGGGEVTYTNGDNGEYSVTWVNCGDFTSGKGWNPANAQTVTYSGEFNTSGNAYLAVYGWTTDPLVEYYILESYGTYNPSSGLTLLGQVTSDGGTYDIYSTQRVDQPSIEGTSTFNQYWSVRTEKRVGGTVTTANHFAAWKALGLEMGTYNYMIVSTEGYESSGSSTITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) GH family 11 xylanase
pubmed doi rcsb
source organism Talaromyces funiculosus
total genus 51
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp3A00
2DFCA 3VZLA 3MFCA 3HD8B 2DCYA 4XQ4A 1XYPA 3RI9A 2C1FA 1QH7A 1AXKA 3AKTA 3WP6A 1UU4A 3AKPA 3WP3A 1IGOA 1XNKA 4HK9A 2BW8A 3WQ7A 1H4HA 3MF9A 2BVVA 3VHPA 1XYNA 1UU5A 1OA2A 1KS5A 1W2UA 1XXNA 3VZNA 3VZKA 2JICA 3MFAA 2VG9A 3AMPA 1XNDA 2VUJA 1C5HA 1UKRA 1H0BA 1XYOA 2B45X 4HKOA 4HK8A 3VHNA 2Z79A 1XNBA 2BWCA 2DCKA 1REDA 1C5IA 5HXVA 1HIXA 1OA3A 3EXUA 3LB9A 2QZ3A 3VHOA 3WT3A 2DCJA 1M4WA 3WP5A 3M4FA 3VL9A 2VGDA 2D97A 1OLQA 1OLRA 4S2HA 3O7OA 2DFBA 3AKQA 4S2GA 4XPVA 1BK1A 1REFA 2QZ2A 4HKLA 3ZSEA 3LGRA 3WQ1A 3VGIA 3MF6A 1UU6A 1PVXA 4XQDA 4XQWA 1T6GC 1NLRA 3AMHA 3WP4A 3VL8A 1BCXA 3AMQA 4IXLA 3AKSA 3WXPA 3B7MA 1REEA 2NQYA 4H7MA 1H8VA 2JEMA 1KS4A 3WX5A 4HKWA 4S2DA 3WQ0A 3AMNA 2D98A 2DCZA 3VLBB 2B46X 2F6BA 1HV1A 1YNAA 1H4GA 1QH6A 4NPRA 3VZOA 1OA4A 1H1AA 1F5JA 3AMMA 1TE1B 2JENA 5K9YA 2NLRA 5EJ3A 2BWAA 2VULA 3RI8A 3WY6A 3VZMA 3AKRA 3B5LB 1BVVA 2B42B 1XNCA 4S2FA 3VZJA 1ENXA 5K7PA 3WR0A 1HV0A
chains in the Genus database with same CATH superfamily
1WW7A 4LHLA 4LKSA 5BNNA 5KHIA 3EMRA 2XOMA 2W39A 2YPJA 1R64A 1N3PA 2ATFA 1JZ2A 1B35B 2RG4A 4BOWA 2HBTA 3FL7A 4O61A 2WNUA 1KFUL 1MS0A 5F5AA 3HNYM 3ME2A 4XXPA 4EWAA 2X29A 3GJAA 3ROUA 1FMD3 1J3RA 1L7QA 2DTYA 3ZSLA 2C26A 3ITQA 1SDWA 1LESA 4OFGA 1EAH1 3AVRA 4OQ9A 2YUEA 1CGPA 4Y1UA 4UBHA 3WP3A 3ZOIA 3VBUC 4A3XA 4TN7A 3RZJA 4AWDA 3LEKA 1WMDA 3QBQA 3WQ7A 4BMEA 1PO12 2NPIA 4WVMA 1ZRCA 1W0NA 2RJ2A 5FZ8A 2W91A 3I2KA 3GZAA 5KC6A 4ZONA 5JZGC 2WJSA 1C3HA 4P14A 5J96B 1O6UA 2Y6JA 5FZCA 3VZNA 4AEDB 2DYCA 3N9QA 4Z2WA 4QX0A 4GD4A 1YIPA 2D6NA 2HEVF 5BPXA 1ZZ6A 1GP5A 2D5FA 1VBA1 4FFIA 4IESA 2BQPA 4W6YA 4CEWB 5FYYA 4N9HA 3H3ZA 1OVSA 2A6VA 5I8SA 4BHPA 4CDWB 4CCEA 4F83A 4PIXA 2B7YA 3TN91 4A2UA 2YG0A 4GB32 1UZYA 1AR92 5FKBA 3BI3A 4QX3A 1YJKA 1GZCA 2JJ6A 2XONA 4EROA 2A3YA 4GWNA 1W0OA 5J98B 1W8ZA 1HIXA 2CDPA 2HEWF 1ODMA 1NQDA 1TME3 1NXMA 2WYSA 3HBZA 3LB9A 5DXDA 3THCA 1GQPA 4EN7B 1DQ2A 1RUH1 2VCAA 2XDVA 4ES9A 3WUDA 1C4RA 2YHJA 2D7FA 4NPMA 1QJY1 3SKJE 4Q4W2 3WHUA 3ZKYA 4ZS3A 5C8WA 3BCWA 2PHTA 3FBMA 4Y26A 1XRUA 2Y6HA 2VMFA 2ZX3A 4A6OA 1ZNPA 2YU2A 4DO0A 5IAXA 1CZVA 2Y38A 3IAPA 3M2MA 2R1BA 2WFF3 4YNIA 3GF6A 4I30A 3BTYA 5JSRA 1AYN3 1W9TA 1K5JA 2J22A 2DVBA 5A7QA 4CDXC 3WNOA 2QVSB 1PNGA 4IW3A 4QKBA 1DLLA 1JYVA 1RUD1 1ZBE3 3MBWA 4K7JA 4Q4V2 5F3GA 3CJXA 2EIDA 2QQLA 4FP2A 3WQ0A 2D98A 4U2AA 2DCZA 1RGSA 4RHV1 1AR72 5A7NA 1UNBA 3NKTA 3T0BA 2R0HA 4E27A 2BRTA 1UY1A 2CWSA 4ATFA 1I9RA 3I3EA 2WNVB 1GANA 4LKEA 1VBC3 1WCKA 1R093 4G9SB 4CYDA 1VPHA 1OHFA 2G4IA 1QJZA 1SPPB 2ZGRA 1NCRB 4CZSA 3PIJA 1ZZ9A 2TNFA 5B4XA 3AP7A 4XACA 5APAA 2J7MA 4BCUA 3Q8EA 1H9PA 1VR3A 5FLJA 3KF3A 2Y6LA 1NLSA 2ZGLA 1HV0A 2YV8A 2PN5A 2VMGA 1NAEA 1YIFA 4GH4A 1RUF1 1UMZA 4QX8A 1XC6A 3ETQA 2WAOA 2C6SA 3JBG3 4CVUA 5K8SA 3ZYBA 1Y9QA 1O4TA 1PX3A 5BUVA 1HJFA 5CNAA 4QMAA 4V2WA 2LS6A 1MS5A 1PMJX 1H9WA 3O1SA 3AM2A 4LITA 1GNYA 3ZX7A 1JYWA 2FBEA 3AKTA 4YZ1A 5FZOA 1MS4A 1CVNA 4IE4A 1LOEA 3OBRA 4K21A 4CSWA 1HXS2 2B5HA 1RXGA 1X9TA 1UOGA 3WLUA 4D7SA 1CAXA 1OT5A 1PGW1 1DU3D 1RINA 2QNKA 3N7JA 4NMIA 1ACCA 2XJSA 2VZUA 5K0UA 2AENA 1RUE1 5IVYA 2BVVA 5FRAA 2HEYF 1WCQA 5DDJ1 4WM8A 2WA4A 1PZ7A 2KR2A 1XXNA 5A32A 3BTZA 4IQPA 4QWNA 1CONA 5T5JA 1T2XA 1W03A 4PDWC 5BNOC 1DQ4A 2JICA 1EYBA 3I2OA 2QQVA 1AL22 2DU1A 1DZRA 1H0BA 1W28A 2AUYA 4AGRA 3I2IA 3VKNA 1K5MC 4I0WB 2X8KA 2A7AA 2BWCA 1AJOA 2HJIA 3OOXA 5L36A 2BGPA 4XW3A 4ZU5A 1ND3B 4GXLA 4E4HA 1DGWX 2VZPA 3N9MA 3T30A 3G6JB 4QDRA 4Y5Z0 2VL4A 1FMD1 1W9SA 1UZWA 3WP5A 2B9UA 3RGBA 4NWWA 1YFUA 1GU3A 5CADA 1J58A 1OF4A 2XLGA 2ZABA 2Y64A 3GCXA 1ST8A 2O8OA 1ULDA 5LBBA 3SNMA 5F8PA 4CP9B 1IS3A 4Y22A 3DYMA 2OX0A 2O1QA 4O9GA 4DEQA 2IVIB 2W9XA 3IDBB 4Y1YA 4EWDA 4PBPA 1BLZA 1EY2A 1HB3A 1NLRA 2DVDA 1YRZA 3LAGA 1ZBA2 4WM7B 1S0JA 3USUB 5KHJA 1S0FA 2YBKA 4UF0A 1JZ4A 2A71A 5FV3A 2R0FA 2G19A 2BJSA 1X8MA 4AR2A 4CCOA 4X6RB 4LR4A 2VZOA 3ZN4A 1MQTB 4Z07A 4FXKB 3PVEA 4IEUA 3B94A 1KEXA 5AC93 2MEV2 1FOD3 2O14A 1JZ3A 3WCSA 2ET7A 5FJHA 4B4RA 2RS53 1PX4A 3ZSMA 4W65A 1HV1A 3A0KA 4UFJA 3WV6A 2WT0A 5CBLA 3AMMA 1BHGA 1Q8SA 2ZHMA 3ON7A 4INDA 4QQLA 3NJXA 1GLHA 3KVBA 1DGRA 2BOIA 2HYXA 1H2NA 1W0PA 3JXSA 3VZMA 4AFAA 5FZFA 1TME1 4PLMA 4ZKTB 1RUG3 2BFUS 1W8HA 3POBA 4IEXA 3VKFC 1NCQC 2GMMA 1LU2A 3AYDA 1H2LA 4NRMA 5IATA 2GU9A 5IFPA 5FO9B 1RUOA 1AR62 1YI9A 2J1EA 5C3QA 4Y1XA 2W08A 3GYDA 2BBVA 1BXHA 3E1F1 3F2ZA 4J25A 4XF3A 5L7OC 2ZJCA 3GBFA 4WVVA 3O1OA 3W20A 3BOPA 5C7GA 3DKWA 3IDEA 3N9PA 1W8OA 3WW1A 2WFF1 4A7ZA 2W3JA 4CEYC 2ZGMA 1SEFA 2FMDA 2X05A 1AYN1 2VCCA 3KV9A 3I3MA 2XGXA 4R9BA 2O0OA 2JKBA 2HWF2 3IPVA 3OY8B 4NUBA 3DPRA 3UL2A 1VRBA 4NPLA 2WYFA 2R072 1ZBE1 2FDKA 4PQQA 4JVAA 3WEZA 4XURA 3DCQA 1LGNA 3POSA 3D0SA 3M7AA 1UX6A 4R9CA 2D40A 3KSCA 2VMDA 3R4UA 5BNPC 3VBFC 4FPHA 4DS0A 2WA3A 4QQHA 1I6XA 2WO2A 4NHYA 5C9AB 2BBAA 2FZ2A 2J1RA 1VBC1 3JQXA 4LORA 1R091 1W2UA 2TEPA 3V0BB 1BVP1 2VOTA 1NY72 1GP4A 2XKPA 5FUNA 4D6RA 4DMIA 3NJYA 1VJ2A 3WNNA 4MG2A 1IPJA 4BQ1A 1JYIA 2DBNA 3AMPA 5L9RA 2IXKA 3GZEA 3KS7A 4P5HA 3ACHA 3WG2A 5GZCA 4LIVA 2R062 4QQ2A 3C7FA 4QB2A 3SC7X 4GWJA 2PMWB 4CCDA 1X82A 2AEZA 5FUPA 4AI3A 1W9WA 2YBSA 3BN6A 2UWAA 3T2PA 3WW3A 3JBG1 2SLIA 2BYVE 3MUY1 2VY0A 4FFGA 2R7EB 1CIYA 1LRHA 2B39A 3DXUA 3FX3A 1GZ9A 4KI5M 4YZ4A 1VBB2 1MEC2 2ORZA 2W1QA 2WQZC 2QZ3A 1GOHA 3WT3A 4IV1A 4OHVA 1GNHA 5DAXA 1WA6X 3KZ4C 4W6XA 4ISQA 4HANA 4Q0QA 4HFSA 2YB7A 4ORFA 3LCPA 5A7WA 3VBOB 1CR7A 2XBO3 1H8TC 3RQ0A 3UJQA 1DGRN 2DURA 2VMCA 4M0NA 2VTXJ 3HOBA 4QGMA 5I93A 5FP3A 1AX1A 3WSOA 3RYPA 5LB6A 3ORJA 3IWZA 3KQ4B 1RB8G 4RS5A 1DDLA 4CP1A 5C5UA 3H8XA 5CG9A 1SLAA 5IK7A 3SEPA 2Q1MA 3ZFGA 4B1MA 2HWB3 2VAUA 3HNBM 2XVGA 3ZXEA 3WINE 1DZTA 5F3CA 3UYJA 1JXNA 2A6ZA 4M3CB 4AAPA 3NAPA 4OI2A 1HJGA 2Z2SB 3CU7A 1DFQA 2I74A 3AJZA 5ACA2 2W92A 1GOFA 3DGTA 5KHKA 1TNFA 1W6MB 1M06G 1H4GA 5J3UA 4FAHA 3WNXA 4LLFA 3V65A 3SLIA 5A33A 3WZ1A 1UXXX 5EJ3A 4Q8KA 5C4WA 2DVGA 1O91A 1ZZ7A 2QE3A 3L9JT 4MGZE 1F15A 4KGQA 3O1PA 2YC2A 4CDQB 3PVOA 4E4ZA 3E6CC 1XNCA 5A6ZA 4FPFA 5K7PA 1SCSA 2D44A 5GLZA 2VC9A 3O5SA 2EXIA 1SLCA 3VDBA 1GQHA 3BU7A 2F4LA 1RUC3 2DCYA 1ULOA 4AFDA 1UAIA 3E5QA 5DQ0A 1LHVA 1BBT2 2YROA 4LLOA 5CISA 5CFCB 4AGVA 2XVKA 2UYAA 3FZ3A 4DXZA 5HCFA 4XAAA 2I07B 4KG8A 5AC91 4JKKA 1FOD1 4GKXA 2FMYA 4BM8A 2P3IA 3MGUA 2RS51 1N3OA 3RVHA 2H6BA 3J7LA 3C3VA 2BW8A 3OD0A 1RUJ2 2VD7A 3I3BA 2JG9A 2K46A 5EFUA 4IEYA 4OHWA 3PJYA 2JKXA 4RQPA 1F2NA 4GB33 1AR93 1OLMA 3RDIA 3E5UA 1OQEA 1CN1A 3KHBA 4AI0A 4LO6B 5ABJB 3C7GA 1IG3A 3FFQA 1RUG1 5GJ6A 3VZKA 4NRQA 3O0WA 3H9AA 5FYZA 4ET7A 4Q4X2 1AF9A 3PJQA 4IV3A 5FY4A 1W90A 1E57A 3UKNA 5BNNB 2DV9A 1VRH3 3ZYHA 5IHRA 3I3DA 1GZTA 3MLKA 3ES1A 3ATGA 2VR4A 2JDZA 3CKHA 4FXGB 2NZ9A 3EBRA 4N43C 4V1PA 4DNYA 4Q4W3 2RR12 2XJQA 2Z42A 1MS3A 2ZX2A 2D6LX 4BQ4A 3J8F2 2CGOA 4UFMA 1TZOA 5F39A 5JVVA 3GM8A 4UW5A 4DZGA 1ZRRA 5LEKA 4NRPA 2CV6A 3LA2A 4KU8A 4P9XA 3M3QA 3POYA 4TYSA 3O1MA 5FAXA 3DEMA 5L9BA 1RL3A 3RMXA 2C9AA 1I5ZA 3J7HA 1S0IA 5A7SA 3WF0A 5CKNA 2Q1FA 3ZO0B 3PUSA 4WVMB 1I1EA 1PVXA 4XQWA 1HW5A 2VE1A 5J48A 5J37A 3LKJA 3S57A 2Q8DA 4BQWA 4EYUA 3KGLA 1AR73 4M0HA 3K48A 3B7MA 3WG1A 5C8CA 4RGAA 2KM2A 2ZKNA 2NQYA 4RA0A 5D8AB 4LK6A 1V6MA 4XUNA 3O1VA 1GP6A 3CEWA 1XU1A 5D21A 5EHDA 4ASLA 2FHRA 2ARAA 5GLWA 2LRPA 1W2AX 5FY9A 5JOWA 5C5TA 2VOKA 4FFFA 1Y9MA 1WMFA 5A1LA 1QHDA 2V5DA 5ERLA 3HNMA 3ZFEB 4B7KA 1W04A 4ASKA 5FMOL 1NKGA 4OLLA 4XBQA 2CGPA 3VD3A 4CDUA 1D0HA 1GV9A 5DN2A 1JBCA 2X10A 4QT6A 4Y4RA 3KCCA 5JR2A 2R042 3NKGA 1C8NA 1O3TA 2PYTA 4JGYA 4DIQA 3ALQA 4GMP3 3K2OA 3LZZA 3ZXJA 2VQUA 2ZGOA 2XBO1 3B93A 3VBHA 4XUQA 3K51A 3KWVA 1U5IA 4PF5A 2DFCA 5FXWA 3VZLA 1N1VA 3C2UA 4BLIA 2XQRA 2C9KA 2I45A 3SHRA 2ID4A 3LWCA 5FKCA 5CA6A 2JE9A 2VMHA 3GGLA 4FO9A 4LO7A 4AK3A 1R1A2 4MGTA 2YZ4A 2RM23 4QHBA 2OUJA 1OURA 3ACFA 4DY3A 4LE4A 3VD4A 4IEQA 1ULCA 1R1ZA 2E7QA 1UOJA 2HWB1 3BODA 3CO2A 3VDCA 1WD3A 4AGGA 4BIOA 4IL7A 2ZXQA 3U11A 1LJ7A 4I02A 5LK5A 3N9OA 1CWPA 1BMV1 1CX4A 1YFWA 5DABA 5F3IA 1IS5A 3VDDB 4EWEA 2XXZA 2UY9A 1BKZA 3WF2A 3WNMA 1AL23 1YFXA 1ZX5A 4LBJA 1PK6C 2BU9A 3T08A 1W2NA 1HRI2 2DUOA 1OFNA 3RJRA 1CAVA 3OGSA 4M00A 5FYSA 2UYBA 4AI1A 5A1AA 5M0TA 2DUQA 4RFT0 5FYTA 3POIA 4NIDA 4FTBA 2JX9A 4L97A 1JUIA 3H42B 5T54A 4AHXA 1VAMA 2LROA 3ACGA 2QBXA 5L73A 3TRSB 4LT5A 5LW9A 5DUWA 4DB5A 1ND3C 1CAWB 1GWKA 2RDNA 3FHIB 2ZGQA 2GAUA 5FTTC 3Q8CA 2D3SA 3JZVA 4YGDA 1ALYA 2W0XA 3AXEA 1CD3G 4FPYA 1E5HA 1UO9A 3VBRA 3O1RA 5FZBA 1RUC1 3GALA 4BPZA 3V56A 3V0AA 1REDA 2E7AA 2RV9A 3MLLA 5DUXA 3SCFA 3VKMA 4LA2A 2EIGA 1ZBA3 1M4WA 4AYUA 1S2BA 5FZOB 2R30A 5DZGA 1OLRA 1ASJ3 3AZZA 3H7JA 4WM7C 2CHHA 1OBNA 3PTRB 5FY0A 4COYA 1REFA 1X7NA 1UKGA 3HQXA 1YYNA 1PO23 5HCBA 5K0UB 2MEV3 3HQUA 1MQTC 2OKXA 3U14A 1PNFA 2LTNA 5C3PA 5FQ0A 4UAPA 4WM8B 2CWMA 1MZ5A 4P9GA 3VL8A 2Y6KA 3VBUA 2WSVA 2TBVA 4GB31 1AR91 4GKYA 2V4VA 1CPNA 4XTMA 1O3SA 5IK4A 2VJXA 3NV3A 1X33A 1D2SA 3T4VA 1DBNA 2GP3A 2MPFA 4WV8A 5FY1A 2JDKA 5FBZA 2Q8OA 1VBE3 2VZQA 2ZHKA 4Q0SA 4S2DA 1T6BX 1YO8A 4MLOA 1R082 3RZLA 1VRH1 4HSJA 4NROA 2ET1A 5KXBA 3JU9A 4XMIA 4JKLA 4QU1A 4QB1A 1AR63 1OA4A 4I0AA 4ONUA 3A21A 4Q4W1 3ZXDA 3OUIA 1PIV2 2JG8C 3FLPA 4KH9A 3CJIB 2XJTA 1OPOA 3OEAA 5DAPA 3U75A 5HBAA 3MW4A 1LOBA 4KWLA 4Y33A 1MZEA 2BOJA 4XFGA 4URAA 2GH2A 1AYM2 1W3VA 2Y34A 4QX2A 4FSJA 5D1IA 3HMYA 2HWF3 4YG0A 3ELNA 1AJKA 4TLFA 4NIAA 1CESA 2IFRA 1W6QA 4ZZ5A 3RFRA 3OCPA 4AW7A 1LOCA 5FK7A 4UF0B 5I0SA 2Y6FA 5JSPA 1X36A 3H1WA 2Z5WA 3C7EA 4XQ4A 3MIDA 4FFHA 1AR71 2WFPA 3MDPA 4AI2A 1GMMA 2ENRA 4P9WA 3ZMOA 4P02B 2G9ZA 1UY4A 2QQOA 4DUXA 5JUVA 4LO8A 3U37A 5DUUA 1HQLA 1ULFA 4QAWA 3CLPA 5C9AC 4BYYA 2Y0IA 4CDXA 2PHFA 2YC4A 2JDUA 1GWMA 2WN2A 4MUVA 4HONA 1Z78A 1VB4A 4COZA 3GHNA 2D5HA 3K75B 3LDKA 3I3QA 4LBNA 4MADA 4OUSA 3W58A 2X5IB 1FPN2 3Q8FA 1V0AA 3GZTB 5F6LB 2O8QA 4QPWA 3M3IA 2WKKA 1OLME 4H2AA 3TYJA 3PIGA 1VBB3 4UW4A 1V6IA 1XNDA 4CU7A 3OSDA 1SFPA 2W52A 4DRRA 4GMP1 3TWIA 1V6JA 1D4M2 4QM8A 5FPLA 3LD8A 1EV12 4COUA 2B4KA 3I2DA 2ZEYA 1WCUA 1G6NA 4JC1A 3VBSB 5EWSA 1UOFA 4O9EA 3NL1A 2QQKA 3VBOC 4YG3A 1F31A 1QOOA 4LBQD 1O8PA 1K45A 3IPVB 4K1ZA 4Y1ZA 5HXVA 2WIIB 3RRDA 2RM21 4OHXA 4BDVB 2ZGKA 3EYPA 1V6LA 4IE6A 3IM0A 3ZSKA 1ZZ8A 1GYKA 1ZM1A 2W1WA 2R1DA 2WZR3 3OPWA 3WW2A 1VALA 3LOIA 5F2WA 4BU2A 4D7TA 1C8M2 1OSGA 1DQ0A 4XDPA 4DY5A 3C7HA 2PAMA 1G9CA 1AL21 1QOTA 4WZFA 5ACA3 4A3ZA 3W5MA 3NQHA 2NP0A 4YPJA 5A3TA 2JD9A 4QPIB 2W1UA 2BGCA 1NXD1 1SMVA 4NE9A 4NHXA 3POJA 4Z82A 2VOXA 3LA3A 4LUMA 1H8VA 1RUI3 4Q26A 5FYMA 4P9JA 4XUOA 4HMZA 2A75A 1ZVFA 4NR1A 2WNEA 1PHMA 2BZDA 1W3XA 1KQRA 4PDWA 1SDDB 5BNOA 4XZUG 2RS13 4AOCA 2RJLA 2Y6GA 4JQTA 2P1BA 1OKQA 5LBEA 2BWAA 2VULA 3F95A 4OUMA 3ZYFA 1JYCA 4X8PA 1K5MA 1O7FA 1NQJA 1ZBA1 1KD7A 2WLPA 3WQBA 1EP0A 1IKQA 1ASJ1 2B42B 1HDKA 5A7WB 2ZACA 5FP4A 4L8QA 2QQNA 5KWRA 2JDNA 1FXZA 4CU8A 4MV2A 3OBAA 2XWBB 5CFCC 4OVEA 1Q5OA 1PO21 3N7LA 2MEV1 5JMOA 2Y60A 4AG4A 2HWC2 1W2OA 2YXSA 5F3EA 4KWJA 5LWBA 1AVBA 2VZSA 3AFKA 1QF3A 4IGQA 5CFDA 3ZFGB 1YXWA 3AB0A 1RJ7A 4G3YC 5TSWA 1QWRA 2C1FA 4XF4A 4EN8B 4FTEA 4P08A 1QH7A 2RS32 2OPWA 4FPLA 3ZSJA 5HI0A 3OD4A 4JGZC 3MYXA 1ND2B 3BPSA 1LHOA 1E5RA 5A70A 1Q8VA 1LCLA 4V2VA 2WN3A 4MVTA 1U12A 1VBE1 3PMSA 4ZU4A 1MZ6A 3KF5A 4E2QA 1XNKA 5JXJA 1AHSA 3PU8A 5IVEA 5GLTA 5BY5A 4HOOA 1AR61 1L7RA 2E26A 3ASIA 4PQ9A 3ZDSA 1YHFA 4Q8LA 5E8AA 3HPNA 5A6QA 1OOPC 5H9QA 1JUHA 1RXFA 1U5XA 1H30A 2AREA 2PTMA 1KITA 5FZHA 1MS1A 2P3KA 3J8F3 4TSVA 4BB3A 3L2YA 3C8XA 2BFUL 5EJZB 1QJU2 2VG9A 2JDPA 3LDBA 1RHI2 3BUCA 2HWF1 4YM0A 1PZ9A 2IUWA 4JAAA 4E2SA 3VUOA 3W5NA 4BISA 2FCUA 5B2GB 3QOPA 2FCVA 4L92A 4LBKA 1NCQA 4YVSB 4BQYA 3S5QA 2W68A 2Z79A 3D0JA 3JD72 2YYOA 5FZ6A 1PGL2 4LOSA 1F9KA 3EO6A 2XQXA 3H1MA 3FN9A 1CJDA 2GNDA 4CU6A 2ZHLA 2XVLA 3IKWA 1JOBA 1W2TA 5L7OA 4IE0A 2WO1A 3ZYIB 4CEYA 3POFA 1NY71 3HWJA 4YW3A 1A8MA 4UWDA 3MIFA 5D8AC 1LHNA 2KD7A 3URFA 2MNGA 3AP4A 2ZEWA 1EAH2 3P3NA 4W8JA 1NA1B 2E32A 2E51A 1A3KA 1QDCA 4RQPB 3WDXA 4ZS2A 2QUOA 4R8HA 1YJLA 3N9NA 5GLVA 2AYHA 1NE4A 1HN1A 4CA9A 5JXGA 3VD5A 3VBFA 5BNPA 5FO7B 4Q5OA 2VOWA 3MIHA 4IV3B 1YC61 2BERA 3LA7A 3MPPG 1O5LA 2N7GA 2WZEA 4GZ9A 1VBB1 3Q8BA 4H7MA 4MYEA 3T09A 3ZFEC 4FT8A 4DQAA 3VKOA 3OEBA 1YQCA 2IXIA 1RVF2 1ULGA 2R043 4HVQA 5FDBA 1HRV2 3FHQA 1G9BA 1VLNA 2GDFA 2OXBA 1QDOA 2VECA 3UGFA 4MXWB 3S5AA 4MX3A 5IW0A 2A70A 5CFDC 3QH7A 3C7OA 4DUWA 3DL3A 1WMXA 2Q0AA 3OTFA 1LECA 5E88A 2ZKLA 3OYWB 4B3NA 3M3OA 1GFF2 1H1MA 4BWOA 3M3CA 2YU1A 5JPMB 2E31A 1I3HA 4C1XA 2WZR1 4YZ3A 4H7LA 3OPZA 4COVA 2DU0A 4D7YA 2WNOA 1PMHX 3EQEA 5KBFA 2A73B 3AYCA 4NIIA 5C8CB 3LSEA 4IGPA 2NN8A 1VMJA 4JV4A 5EZWA 5ACA1 2OYZA 1XYPA 1H8TA 1KXGA 3VDDC 1COV2 3ZM8A 5FZ0A 1YQ2A 4N53B 5FMBA 5H9PA 4Q0VA 5FXVA 2WINB 5CAZA 1RUI1 2Y26A 1HX6A 2R16A 3ACIA 2OQ7A 1DGWA 1DCSA 1OPMA 1C28A 2E9QA 1JW6A 3O14A 4JKMA 4XFHA 3LFIA 4N7IA 5FYHA 4IEZA 3SH5A 3I54A 1V6KA 1UYPA 5FP8A 1FT9A 1RUD2 3V64A 4AQSA 2WQ4A 3HT2A 4GJZA 3BIEA 2RS11 3OUJA 2GMPA 3MF9A 3OG2A 4CDUB 2BP6A 1UZVA 2V4AA 3BYWA 4RHV2 3QCWA 4KBBA 4A42A 4NJ4A 4Z1VA 5JIUA 1HB1A 5FZDA 2JIJA 4QPGB 2LW8A 1VB2A 2QQIA 3USSA 1UXZA 4XF1A 1AL0G 1APNA 2HYKA 4XJAA 3VB9A 4AVSA 5IUQA 5LA0A 2D3RA 2ZX0A 4LJHA 3J9SA 2VNGA 5CZKA 3WDUA 2UY8A 3OPTA 3FLRA 3LDRA 1JZ5A 4XFIA 3PHMA 1H6XA 1LR5A 3HN3A 3M70A 4CCNA 2JE8A 4R4XA 3IIAA 1OXCA 1US2A 1XNTA 4P5YA 1XBFA 4XETA 4XXAA 5T3NA 3AFGA 3VHOA 1EPZA 5EV7A 4QHZA 2QCSB 2EXHA 2IZWA 4YG6A 1VBD2 2OIIA 4HBNA 3KHCA 1LHUA 1POV0 3D5OA 3H8RA 5IVFA 2VMEA 3WNLA 4E8CA 4AI9A 1V6NA 2PQQA 5FLHA 3ZN6B 2VBPA 3ZFFB 2G9GA 1GSLA 2BNOA 2CSGA 2OT7A 1KDKA 1NOVA 4AEDA 1LNSA 2V73A 3UKVA 1WGPA 3B69A 3PVBB 1XQNA 1SLBA 1OMIA 5A3LA 4AAXA 1PIV3 1RUE2 1SFNA 3N7MA 4ZY9A 3J8F1 5E89A 3R0RA 4KQ7A 5A3OA 4CEWA 5DDJ2 2WBKA 3OB8A 4EN0A 3DUIA 3CJIC 5FY5A 2GP5A 5C70A 1YCIA 1AXZA 2OZJA 2G1MA 1NZIA 1AYM3 1MS9A 1QH6A 1XSRA 4Y1VA 3UJOA 2WC2A 1LULA 3NV1A 1ZZCA 3ZIXA 1A6CA 4XEZA 4N43A 4BXFA 3NV4A 3I2GA 4PLOA 4I09A 5LA1A 5ISLA 4AHYA 1DYPA 1BZWA 1UW8A 1V9U2 2WO7A 3NVCA 4RR3C 3P6BA 1BQPA 1H2MA 3NJZA 3RJ2X 4Y5TA 3T4HB 4RYDA 2ADEA 4LBOA 5F5CA 3MFCA 1ULEA 1SG3A 2P5BA 2D3PA 1IOAA 1NYWA 4EE2A 3SITA 3RI9A 2UURA 4JDMA 5L19A 1O3QA 1ODNA 3I59B 1Q3EA 1KJRA 1FPN3 2K9ZA 2VVEA 4JRAA 1IPSA 4F8AA 2JDYA 3ZXKA 1RJ8A 5JZGB 2YMZA 2X5IC 4CP0A 5L9VA 1X9PA 2GZWA 3SCGA 2H0BA 3T0DA 4XILA 4EZ4A 3HAGA 2R041 4XJUA 5IVVA 3PTYA 4YVWB 1B35C 2D6OX 4DRVA 1IHMA 1GBGA 1D4M3 2Q1ZB 1PMIA 1Q8OA 1JTZX 1XYNA 5GALA 3WVJA 1SPPA 1EV13 1OA2A 3GJBA 3LPFA 2Q8CA 4E4DX 2IC1A 3J7MA 2ZAHA 3TEXA 1K3IA 4XHXA 1W99A 1BK0A 4MGSA 4LNVA 4B29A 1PVC2 4A7YA 5C71A 1PO13 5K4LA 2VUJA 4D3WA 2EF6A 1W6QB 4XUPA 1GZWA 1W8TA 5I0TA 3AC0A 3S7EA 1QY4A 4DINB 2QQWA 1Y7BA 2ZCWA 2AC1A 4FQZA 5F1RA 1JS9A 3O0VA 2RDQA 4AEDC 2HKXA 4HLTA 1X8EA 3LPGA 5T50A 1G8WA 2EA7A 4GQ7A 3RPQA 3SH4A 3JB8A 1JOJA 4HPKB 5HPOA 5JXHA 3RYRA 3ZYJB 4LE3A 4CEWC 2ES3A 4CDWC 4XF9A 5FUIA 4LQRA 4S2HA 4EN9B 4K20A 4S2GA 4AQ2A 1VAKA 4CUCA 1SACA 2GN7A 3MIEA 2D93A 2ZOEB 1JOPA 5BNQA 4FTSA 2ZGSA 3AYAA 4QPIC 3ST7A 3MPBA 4YGCA 5SV5A 3M8LA 4LOTA 4LBQA 4GWMA 3BIWE 1T6GC 3H3LA 3BKZA 3WW4A 4AHZA 3I2JA 4TTGA 4TZDA 2K0GA 1N1SA 3NJVA 5A80A 2CDOA 2BGOA 4YM3A 2WNUB 4XAEA 3MEPA 3K3OA 1PK6A 5F6KA 1ONAA 4ZU7A 5DUVA 5I0RA 3TNQA 1E5SA 1Q43A 4RL7A 5GZDA 1R092 5GLUA 5I8TA 4YW6A 4XDQA 3AMNA 3CMGA 5C33A 2JIGA 4YW2A 2F6BA 4Y20A 4AXOA 2A1XA 3TB0A 4KBZA 3USUA 1S0EA 2GN3A 2WS92 1H1AA 1L7LA 3FUOA 4KMQA 2JXAA 1ND3A 1QNYA 2QQMA 2VBDA 3EJKA 4NWVA 1UMHA 4M3CF 1QQP2 1TNRA 4Q4V3 2RMU2 2HWC3 3CF6E 2P2KA 2VZ1A 1WCDJ 4CXXA 2BTVC 1CX1A 4CP9A 1JZ7A 3JUUA 4CXWA 1FNZA 4NAOA 4LIUA 4UFIA 1SLIA 1QXRA 2A3WA 1Z0HA 2RS33 3AP6A 4CCLA 1AX2A 1W6PA 4LHKA 2CTVA 5KC5A 3S7IA 4KNCA 3UGGA 1Z7S2 3LIHA 3FJSA 4MSVA 2WNVC 4R52A 1HQNA 4WM7A 3RG0A 4A45A 4D6QA 1ND2C 4AEJA 1DIWA 4OMDA 5FPXA 3I8TA 3K46A 1VIWB 2JB8A 4XC9A 1D0GA 1NCRC 1STMA 4L2NA 3P3PA 4ATEA 1RUNA 5F7UA 3AP5A 3FC0A 3E6DA 1MQTA 4BE3A 5GZGA 2NM1A 4E2GA 4D94A 4KGGA 1PIV1 2WABA 3GXUA 2GNBA 4J1XA 3WNKA 1UY0A 1W39A 2JD4A 2VNRA 5FP9A 5LA2A 5KHGA 2W1SA 3I97A 1J59A 2XR4A 4PDWB 5G04L 3ZXFA 4Q0PA 1QJU3 4HK9A 3HQRA 4BK4A 1G7YA 4JHZA 1RHI3 4JTOA 1K42A 1AYM1 4MGKE 1O59A 5JXIA 5KXDA 1NE6A 4YM1A 2P4EA 1CJPA 1U5ZA 3AVSA 4OULA 4DXSA 1K5MB 2H6CA 4KU7A 4YFZA 1LB2A 1CQ9A 2WQ8A 1HXS3 2RJKA 3JD73 5FZLA 1S2KA 4YVSC 3KT1A 1UX7A 4BIFA 2A6XA 2JG8A 3KV4A 3D4KA 1WLTA 5FYCA 5C3OA 2VXRA 3H8OA 1LGBA 3WHTA 2C0ZA 2WDBA 2QJVA 2L9LA 3PUIA 4D0QA 3J26N 4L0PA 4HK8A 3B3QE 3A23A 5A3PA 3ZMNA 1XNBA 5AFEA 3RZHA 1S0CA 1AR82 5IWFA 1ZRDA 3R4DB 4X6QB 1JN2P 3DV8A 1OA3A 3OY8A 5FMDA 2WT2A 1FPN1 5FLIA 3UT0A 3R05A 5HV0A 3BTXA 2XPJA 1ZREA 5FYBA 3ILRA 2PLV2 4EJRA 4K6BA 1F35A 5H9RA 4HKLA 1FYUA 2PHLA 2EVXA 5E6HA 4OHZA 1LAJA 3MIGA 3MHZA 4CCJA 3MF6A 3UNPA 2YPDA 4X8NA 1DQ6A 1Q8QA 2R6QA 3FMGA 5T55A 4GH4B 5C9AA 5FMCA 1FOD2 4YLZA 4MXVA 5FPUA 1RVF3 1CAUA 1D4M1 1HRV3 1W9FA 3RNSA 2XL7A 3WXPA 5I91A 1EV11 4LEJA 3WF1A 1GUIA 2WAAA 4YW7A 4XFBA 1AX0A 2CGNA 2EALA 4ASMB 1UN1A 4OHYA 4HZFA 2P3YA 3K4AA 1LOFC 2EAAA 2PHRA 5LZ6A 3SEEA 5I0DA 3A4UA 4QDSA 1PO11 4HKWA 1JYXA 1YQ5A 5A7OA 1XOYA 1NCQB 3GCWA 2A6WA 3ETPA 1RITA 1SBDA 1U5YA 3VLBB 1AUYA 1US3A 1CAXB 1S0DA 3VZOA 2D6PA 4AFCA 4YARA 2PAEA 4QM9A 1GICA 3N36A 3WF3A 1MZFA 1DLCA 1QJFA 1SHWB 3B5LB 2W2IA 2GSYA 4IEPA 4JHTA 4LTAA 4N8MA 1J83A 2VUCA 4NHKA 3BGAA 3MO4A 4MH0E 4CEYB 1LKNA 1DGLA 5A32B 4DOUA 2FDIA 2PQSA 3HBKA 5FZKA 1COV3 4K8FA 2WL1A 3VBOA 5A6YA 4P00B 5LBFA 3VZJA 1AZDA 4N53C 3PLQA 4UT5A 1F8VA 2DTWA 3POGA 1W06A 3BU0A 3IBMA 2CNAA 2XHKA 2VU9A 2HWD2 2RDSA 1DYOA 5LK7B 3IMNA 2VW2A 4IDZA 1RUD3 5DPNA 5BNPB 2P37A 2PFWA 4RD7A 2ZBJA 3TAYA 4TXWA 4ZHNA 1SLLA 1Y43B 4DUVA 4M3CA 1VMHA 3LE0A 2HH9A 3IDAA 2NYYA 4PIYA 2QQJA 2C4XA 4M01A 1W8NA 2OVUA 4RGKA 1W6MA 2VTXA 5AVPA 3BVCA 3HT1A 4QPGC 2VNOA 4XJZA 2PELA 4PIZA 3FE5A 4Y22B 4XHBA 3TBDA 1QXPA 2VOVA 5FZ4A 5IK5A 1JHJA 2ARXA 2CU5A 1HKDA 3LEGA 3A7QA 1V00A 3TEYA 2VQTA 2J1UA 3FUQA 3PURA 2R073 2OS2A 1PM4A 4Q4V1 5EYYA 4DPNA 2HWC1 3B00A 1YI7A 4H55A 4QDQA 1FV3A 5IVJA 2ZMKA 3BB6A 2OPKA 1NX9A 2FCTA 3ILNA 2IVJA 1F4AA 2IXJA 2RS31 2UU8A 3M3EA 3WD5A 2JDMA 5CG8A 1VBD3 4XYXA 2WO3A 1B09A 4Y3OA 1YEWA 3VHNA 4HETA 2W87A 5KHHA 2DCKA 3WF4A 3ZYRA 5CFCA 2R063 1XSQA 1NZCA 3ZFFC 2VW0A 2EIBA 3T2QA 1DQ5A 3M4FA 2VGDA 3SH3A 2GALA 2ZGNA 4NIHA 1EUUA 4YGBA 5A3UA 2WWJA 3I49A 4DXTA 5CVRA 4NOTA 2JECA 2ZEZA 2QDNA 3MIBA 1Y4WA 4G4FA 4URTA 1QMJA 4Q4Y2 1QJU1 1MEC3 1UU6A 4JGZA 3WOGA 4Y24A 3APBA 1RHI1 3ZXLA 1UWWA 3BPZA 1Q56A 3QD6A 3WP4A 5FZ1A 5LY2A 2AH2A 1TEIA 4XJWA 4B4QA 1JH5A 2VQAA 3Q8AA 2WWSA 4XVHA 3AL6A 3ZXGA 3KMHA 1HXS1 1JU3A 3JD71 4D69A 1PGL1 5C3RA 3T1LA 2AACA 4FPOB 5F5IA 4IE5A 1OOPA 3UV9A 3R6SA 3DPRB 2WZPP 4LXLA 1RTVA 1UZZA 2B46X 3IB3A 1V9U3 2ZS6B 5FPVA 5JI9A 2ZMNA 1XE8A 4NPRA 1F5JA 4XIKA 4LKFA 1HLCA 5LRRA 5SV8A 1OD3A 5F37A 1JZ6A 3THPA 3OGVA 4O7XA 4K9SA 2Q30A 4LUKA 5IK8A 1TQ5A 3JCIA 2RVAA 3AKRA 4D6SA 4FP3A 4L9BA 3T2OA 4E8DA 4XFFA 5AFBA 4I3PA 4Q2FA 5FPBA 4Q1PA 1RYYA 5JDBA 1IG0A 1OH3A 1RUC2 1WW5A 3LQCA 1MS8A 2AZ5A 2HWE2 4MHRA 4B1LA 2VW1A 1NUKA 3HEIA 5HCHA 5JLVA 4QX7A 2KA3A 3KB5A 3J4UH 5J09A 4META 2J1AA 1CIWA 2F17A 2WR9A 3ENRA 3TEWA 1RVF1 3ES4A 5D8AA 1HRV1 4NVPA 1VP6A 3SKVA 1FAYA 4CDQC 4TLGA 4IUGA 2VTFA 1UQXA 1SZBA 4YVWC 4CCCA 1V70A 4LK7A 1MACA 1FI2A 1MPXA 4IV1B 5FP7A 3GBGA 1UU4A 4OCTA 3WP6A 1W8UA 3EB7A 1W6NA 3UESA 3N35A 5FPAA 4XZPA 1YWKA 5CU1A 1BBT3 1PVC3 1SBFA 1ENRA 3IZOA 2GC3A 5LY1A 1WLCA 4MZUA 2JDAA 3ZFEA 4KG0A 2VZTA 1S55A 5IT6A 3NWKA 4AEKA 4CUAA 4N43B 1UU5A 1VRH2 1KS5A 1W05A 2PHUA 2GH8A 4RS5B 3AZYA 1XU2A 5BXXA 1BEV2 5LASA 1VMFA 2EICA 4XBLA 1ZA7A 1QJX2 3SXWA 2D6KA 5FZAA 1RUJ3 5CEHA 1COV1 3NNLA 1WA4A 3MW3A 1UKRA 1UY3A 2IXLA 5FZMA 3NAPB 3RZKA 1LOGA 1D2QA 3POEA 1IKPA 2ZX1A 5E1RA 4BQ3A 5HCAA 3B9CA 5EPAA 4MGQA 5ABJC 4C91A 4Q4X3 5A33B 2XWJB 1GWLA 3EXUA 4UOJA 5C4WB 2GC0A 4U36A 1JZ8A 1FNYA 3MV01 2Y33A 4JX0A 1KFXL 3X29B 1ENSA 5BNNC 2RR13 1YQ6A 3TEZA 1BK1A 3K3NA 4PHZA 2VCBA 2P3JA 3VDDA 4YW4A 1H6YA 3G7DA 2WNUC 4QXHA 1OUSA 2DVAA 3AZXA 2YBPA 1IQDC 3FFZA 5JIAA 1UY2A 1LENA 1TMF2 3UK9A 1G9AA 2JDHA 4OI4A 2R071 2WS93 2CAVA 1Y9GA 1RMU2 3N4MA 1QQP3 2SBAA 2RMU3 3CBNA 1GZWB 3ECQA 1CAWA 4ZZ8A 3PU3A 4XMAA 5BYNA 4OMCA 3SQOA 1WWYA 2X09A 4QXKA 1I5PA 4OQ8A 2CL2A 2OA2A 3KT4A 5LA9A 1VAVA 1S0BA 1VBD1 2YGMA 4N9IA 4UYBA 4YRDA 3KV5A 4XJ8A 4CCMA 3B9IA 3PUHA 2ZZJA 5T5LA 5JOZA 1PZ8A 1TE1B 5K9YA 5HXMA 1Z7S3 4FI9A 1D7PM 3DN7A 3ZYPA 2JG9B 3CZJA 4LHSA 2R061 1HQWA 2YY1A 4LO4B 4BQ2A 3KCYA 3T1MA 3AK0A 5JWPA 5JPNB 4EQVA 1OFSA 1F5FA 4P9IA 5GZEA 2D43A 3T2TA 1RC6A 1W6OA 3NRUA 1W8FA 2RM22 4IEOA 4LBQB 1O4ZA 1A8DA 3H7YA 4IEVA 4XF0A 3H3UA 5F5QA 2DDUA 5LATA 5F9TA 1MEC1 2W5FA 4PI0A 3HD8B 5IVBA 4GIQA 3PDQA 4K3UA 5FYIA 1MVEA 2XHNA 2Z4FA 3DXTA 4QHOA 3OBTA 4BMBA 1PK6B 1VBA2 1Q8PA 3INAA 1QJEA 1AXKA 2EXKA 4CPBD 4PT6A 4M4PA 3TN92 1WBFA 5DG2A 1MR5A 4M3CE 3ILFA 4AL9A 1UCXA 2FQPA 4LMFA 4Y20B 4AFMA 3N3HA 2VZ3A 1WD4A 1R1A3 2ZA9A 3I4IA 5KXEA 5FOBB 1V9U1 4PCRA 4EZHA 1UOBA 3N9LA 3CJIA 3VHPA 4QX1A 1RUH2 3AXDA 2FDHA 2LALA 1BYHA 3LFMA 2BDRA 4HVOA 2HLEA 2V09A 4XCBA 5FJKA 1QJY2 3OGRA 4I2OA 1AR83 4AVVA 3W21A 3WNPA 4LBLA 1W6PB 5FXZA 1JU4A 2XJRA 4QKFA 3W9AA 1HRI3 1J3PA 4CRQA 3CQOA 4E9KA 1OF3A 1NG0A 4RN5A 1XYOA 1C1FA 1Y3TA 2PLV3 4ARXA 4CUGA 2EXJA 5GM0A 2B45X 3RZGA 2UWBA 1ASJ2 5C3SA 1LGCA 3TOJA 4LO5B 4RR3A 1IS6A 2FZ1A 3AL5A 1DHKB 1PO22 2WT1A 1DZQA 1W8WA 3ZXAC 1OQDA 2ILMA 4LBMA 2DCJA 3NSTA 5FZEA 2XUMA 2R49A 3RSJA 4GH4C 1YQ8A 1S1AA 1OLQA 4BZ4A 2VPVA 3ZYGA 4BJ0A 4AVTA 1XE7A 5A1FA 2GNTA 2XB6C 1CZTA 1GR3A 1UL9A 3GBWA 3LGRA 4JGYB 2E6VA 3WQ1A 3ZSEA 4UI9L 1BBT1 1PVC1 3U07A 2X5IA 4GJYA 4B7EA 4XQDA 1H1IA 3AYEA 2IXCA 4MO3M 1VBE2 5G05L 1DYKA 3QLQA 4P9YA 3VBHB 3AMHA 3CZUA 4ZPIA 4A44A 4YZ5A 3AMQA 2QTWB 1N47A 3H8UA 4Q1RA 4L11A 1G9DA 5FOJB 2WWUA 1B35A 4K1YA 5CB7A 1QEXA 2JG8B 3KT7A 1DP0A 4XABA 4CU9A 5JR7B 2V72A 1RUF2 3IN9A 3RMYA 3NNGA 3ZR6A 5K0UC 1OQ1A 1RUJ1 2B8MA 2ZZQA 4A41A 1QIQA 4PJYA 5I8YA 3WG4A 4ZXEA 4NIGA 3J7NA 1FX5A 1P8JA 4RGGA 4WM8C 4P9LA 2J42A 4XDOA 3VBSA 4Z8BA 5J7MA 4CP2A 1YNAA 4ES8A 4XCAA 3KM5A 2VCMA 3P1IA 5A7PA 3ZN5A 5IYYA 1PM7A 4YGEA 5B4NA 2FD8A 4NHLA 3ACLA 2NLRA 3EHKA 2Q4SA 3UGHA 4Q4X1 1FV2A 2HWD3 2XLFA 1R083 1CAVB 3NNFA 1IQAA 2EAKA 4YW1A 1PGW2 4YW5A 5JCTA 2GC1A 4RFRB 4I01A 3KV6A 4W6WA 1N1YA 1UYZA 2RR11 4JCKA 4R4ZA 3O1UA 1XE0A 4QGNA 2JE7A 4IGOA 3H0OA 1D4VB 5IJRA 3H50A 4W50A 4L99A 4CDWA 1G86A 2ZGTA 1SCRA 1CAUB 1EPWA 1YFYA 4C0HA 1LODA 2J1VA 4GWIA 4J6GA 3KQRA 4QPIA 3VBRB 1F4HA 2PA7A 3PUQA 2BUKA 2WS91 2W95A 3V0AB 2ZMLA 5EQUA 5A3MA 2PXJA 2VUDA 3IT8A 3NNMA 4XOGA 3TNPB 3DECA 2CYFA 4JRLA 1QQP1 2VZRA 3NO8A 3MUZ1 2RMU1 3AKPA 4XFCA 1AXYA 4OYUA 4Y4YA 4H14A 3FHAA 2Q8EA 2BPA2 1WLDA 2YFZA 2VMIA 4AVAA 4IEWA 1JMUB 1IGOA 4BXSV 1POV3 2G9FA 1LU1A 1MVQA 2QFEA 3PUAA 3O0XA 3WDWA 2DVFA 3KVAA 4Z92B 1H4HA 1LEMA 1FMD2 2P6CA 5FQ0B 2GMEA 5A6XA 5J36A 1Z7S1 2OQ6A 4ARYA 4DXRA 4JDOA 2WLQA 4K40A 3VBUB 4YM2A 5EIYB 4B4PA 1X50A 5LRSA 3PL0A 4MGIE 1KDMA 2VXJA 4Y5SA 3ZKUA 2YGLA 2XG3A 3NMBA 4J1WA 5BV6A 3MZHA 3U4XA 1QKQA 4HN0A 1UIKA 3AJYA 2JB4A 1WW4A 2F4PA 3JQWA 4XIOA 4AQ6A 2AGSA 4HKOA 4Q29A 1JYTA 2WZR2 2VVFA 1YUDA 2XKOA 3W59A 2B9VA 3DKQA 4Q4Y3 2K2SA 4I0BA 5JOYA 1ZA4A 3KCXA 3O1TA 1GOGA 4UBGA 5CKMA 2WNVA 5FK8A 5JSOA 2KXLA 1ND2A 2J1TA 2MHFA 3BALA 3VL9A 3VDAA 4YSFA 1GKBA 2D97A 2ZGUA 1TG7A 3IMMA 1NCRA 4DFSA 2BEOA 5GKAC 4OI0A 2QZ2A 1S4CA 2HBUA 3OGJA 3VBSC 2YDEA 2Y0OA 2XJPA 1HN0A 5FZGA 1R1A1 4QPYA 3DYOA 4Q0UA 1RUI2 2EIEA 1TME2 3DPRC 1BCXA 5T5OA 1OH4A 2ZPXA 3AKSA 1J84A 2V5YA 2ZTNA 3BOWA 2FDFA 1WMEA 1EUTA 2QKDA 4F3JA 3PMEA 1C8M3 2FDGA 4WVWA 3LIGA 4FQ4A 2RS12 2LUWA 1QGLA 1QOSA 2E7TA 1AR81 2W94A 3CL1A 4HL0A 4BH9A 4A4AA 5EP9A 3U0ZA 5ANQA 1KS4A 2JEMA 2TUNA 2UWCA 5A3NA 4CUBA 2PHDA 4COWA 1TVGA 4GULA 1HRI1 4BK5A 4UW6A 4YVSA 3OJBA 2W47A 4XUTA 5DG1A 2WFF2 4CDXB 2HWE3 2PLV1 3VHRA 1BJQA 4LA3A 1SLTA 5DAWA 3NNJA 4LPLA 3AZWA 3VV1A 1AYN2 4C90A 1JYNA 4QKNA 5C6CA 5FREA 1C57A 2E33A 4SLIA 4ZXKA 3RI8A 5KXCA 3RZZA 4UFLA 1ZBE2 1VE0A 2IXHA 3N7KA 3ZR5A 3MICA 3KLSA 3RWKX 4HXCA 1URXA 2P34A 4MOAA 5EYXA 3LOBA 1ZYBA 1ZZBA 5H9SA 4YFWA 3NV2A 4HN1A 1UMIA 3DYPA 3SISA 5DMYA 1IPKA 4CCKA 4JGZB 4AF9A 3WR0A 5FIXA 1NA1A 3WCRA 3WDYA 1O5UA 2A6YA 1VBC2 2A5ZA 4UXAA 4N7UA 4IV1C 2YC0A 1E5IA 2QQUA 3GNEA 5DAQA 5JI7A 1JHNA 5T5PA 3VKLA 5FR3A 5LEJA 4AE2A 5FZ7A 2PAKA 5FYUA 4FOQA 3LF7A 3ZIWA 4DEVA 2GC2A 1UYXA 4FVVA 2ZHNA 3SCHA 4CE8A 2ARBA 4YZ2A 1OOPB 1FATA 4SBVA 5LBCA 1OKOA 2Q5TA 3LEMA 2XUEA 1BEV3 1V6OA 3JBG2 3GDBA 1QJX3 1L3JA 3GHMA 1LHWA 4HT1T 4Q27A 1N3QA 4RS5C 4MXWA 4QQPA 1LOFA 5DZEA 3Q9OA 4YYOA 3VD7A 4OZOA 4K8RB 3ZFGC 3T0AA 2YFUA 1DQ1A 3UETA 3OGGA 3OYWA 1WBLA 1J1LA 2DF7A 3THTA 3HN1A 4HSLA 4PLNA 2P17A 2DBIA 2ZAAA 3NAPC 4UW3A 2HWD1 4HG6B 1R081 4OZXA 3KD4A 3LSDA 3FLTA 1WZXA 5CYYA 2NMOA 3MFAA 4GMP0 3K4ZA 1WLWA 2WSUA 2WZ8A 3CIHA 4F7ZA 5CKQA 3POWA 4ISRA 4XE9A 5C4WC 2VQ0A 4FPJA 3RZMA 5FPZA 4XFAA 3MV11 3ZDVA 4FOYA 1UPSA 3HIFA 4GALA 3SMHA 4KWKA 1HB2A 5BNOB 2OZ6A 4LULA 3WDTA 1ENQA 4ITCA 2WUHA 5EXOA 1C5IA 1XNAA 1YLLA 4N53A 4FPCA 1CZSA 1TMF3 1XPWA 5F32A 3B01A 4FBFA 3KGZA 2ZGPA 4HVRA 5T52A 4W4ZA 1W6NB 4XPVA 4LHNA 2DFBA 2OUHA 3IDCB 4FOVA 2RDRA 2P6HA 1RMU3 3M1HA 1GNZA 2GNMA 2J1SA 1NT0A 2ZEXA 5FY8A 2R32A 1POV1 3U78A 1ZRFA 4NO4A 5IAVA 5ANNA 4JZRA 1CPMA 4WBBA 3E6BA 3OBZA 5E16A 5LCWL 4AHWA 5FZ3A 1POQA 2I2SA 4QPGA 1JODA 2BV4A 2XJUA 3D6EA 1REEA 3A0NA 3ZLIA 3JB4C 3OF1A 5CFDB 3HR9A 2CY6A 3P5BA 1EAH3 4FCAA 4NHMA 4QKDA 4AFBA 3AX4A 4FPGA 3WX5A 3L2HA 1H2KA 1U0AA 3CNAA 2JG9C 5DAVA 3ZPOA 5J1XA 1NA1C 5D2AA 4IE7A 4RQPC 5FZ9A 4AVBA 3WUCA 3ZVXA 4BLJA 3RYKA 4BQXA 2DCTA 1HB4A 2JWPA 4CXYA 1O4YA 1UPIA 2JENA 5EJ1B 3VN4A 4XBNA 2H0VA 4JQRA 4Q4Y1 4XJ9A 3WY6A 3PVNA 2RE9A 4Z2AA 4IV3C 5AC92 1BVVA 2ORXA 3D82A 4QB6A 5GZFA 3GZUC 4MHUA 3V0BA 4EN6B 5FY7A 3AP9A 1LOAA 4QQOA 3U1XA 1KJLA 2RS52 1VBA3 4FPKA 3RS6A 1WKYA 2BNMA 1SBEA 1XJAA 4S2FA 4AQTA 4E4SA 3ZN6A 3ZFFA 3PNAA 2VBBA 4NN0A 3THDA 1XB9A 5I0UA 3TN93 3WG3A 2WRAA 1OI6A 2VM9A 1QU0A 3MLJA 4MGYE 5FCCA 3WDVA 3S0MA 1KRIA 4PBOA 1QNWA 1RUG2 2VO5A 2XH6A 1S2EA 4QXCA 1UYYA 2BVBA 1C8M1 1K12A 1RIRA 5FZIA 1UF2C 1RUH3 2RHPA 3A22A 3K4DA 2X53S 5L7OB 1NLQA 4C1WA 3MW2A 1QJY3 1N1TA 2W46A 4BQ5A 3MI8A 4WZCA 2FDJA 4EV0A 3H1YA 3QACA 3OUHA 5C8CC 2D6MA 2HWE1 2LM3A 1J3QA 1PGSA 2ARCA 4RSUA 4BA6A 4AZZA 3I7DA 4CPBA 4A7KA 1QXJA 3S6PA 5HV4A 2C5DA 1UIJA 1UD1A 1WCSA 4GA9A 1IZ3A 1J1TA 1WUVA 2VZVA 1W6OB 3I2HA 5A3WA 1IS4A 5JOXA 3VBFB 1O3RA 4AVCA 3U4SA 2DUPA 4FOWA 3IIIA 2QDRA 4AEMA 1C5HA 4LKDA 4N90A 4C0BA 2XJVA 4RHV3 3D3AA 3LEIA 5FWJA 4QXBA 4CDUC 3HVDA 2VH9A 3B02A 3CDZB 3FBYA 4QX5A 3I59A 4GAZA 5FMOS 4FAGA 1UZ0A 2ADDA 3R4SA 4I3GA 4C8DA 4JGYC 3HJRA 3AZVA 5JZGA 1C1LA 3IAQA 4JTNA 2E63A 4B8EA 1OD5A 2BNNA 3T3YA 3VBHC 5FWEA 3E5XA 3AKQA 3O7OA 4KL1A 3UKTA 4CDQA 4FPEA 1A78A 1SQ4A 2IFWA 4TWTA 3VD9A 4YVWA 2XL9A 1BEV1 1RUF3 1QJX1 1SFYA 3VGIA 2PHXA 1DF0A 1WW6A 2CAUA 4O65A 1ULPA 4OI1A 4XTPA 2QQPA 2AR6A 1JI6A 4QD2A 2PHWA 4IXLA 1S0GA 4QGLA 2Y8KA 3CHXA 4R9AA 3RWNA 2OW4A 1ZRIA 1H8TB 1O8SA 5CIRA 3BTAA 5IVCA 3QH6A 4WVZA 2XBO2 4NAMA 4CTEA 2AEYA 5AVAA 1A34A 4M4RA 2XMLA 4UFHA 5JMCA 4OUEA 5KR7A 2A3XA 3FWEA 3O12A 5DZFA 4IETA 4D8MA 2Z69A 3ZPYA 1OC1A 4RR3B 5FFOC 2DWRA 1RUE3 2VUAA 2IWGB 2C24A 2NMNA 3K77A 1DG6A 4KWUA 4PF1A 1OUXA 4HPKA 2HWB2 2ERFA 5DDJ3 5JAXA 2VNVA 1LTEA 4QU2A 3DF0A 4H3WA 1LEDA 2E53A 2ZX4A 4R9DA 5FYVA 1TMF1 4JDNA 5IFTA 1KGYA 1G9FA 1BMV2 3E97A 3ABZA 1GQGA 3I2FA 4IERA 3NW4A 4PI2A 4A6SA 5ABJA 5FO8B 5F2SA 3VBRC 4UFKA 5FBJA 1W9YA 1ENXA 1RMU1 2VVDA 2ETEA 4YWAA 5FXXA 3D8CA 3S30A 2XLAA 1OVPA 3U10A 4AI8A
chains in the Genus database with same CATH topology
1WW7A 4LHLA 5KHIA 5BNNA 2W39A 2YPJA 1N3PA 2ATFA 1B35B 4BOWA 2WNUA 1KFUL 1MS0A 3ME2A 4XXPA 4EWAA 2X29A 3ROUA 1FMD3 1J3RA 2DTYA 3ZSLA 4OFGA 1SDWA 1LESA 1EAH1 2YUEA 1CGPA 4Y1UA 4UBHA 3WP3A 3VBUC 4A3XA 4AWDA 1WMDA 3QBQA 3WQ7A 4BMEA 1PO12 2NPIA 4WVMA 1ZRCA 3GZAA 5KC6A 5JZGC 2WJSA 1C3HA 4P14A 5J96B 3VZNA 4AEDB 2DYCA 4Z2WA 1YIPA 2D6NA 2HEVF 5BPXA 1ZZ6A 2D5FA 1VBA1 4IESA 4W6YA 2BQPA 4CEWB 4N9HA 3H3ZA 4CDWB 2A6VA 5I8SA 4BHPA 4F83A 4PIXA 2B7YA 3TN91 4A2UA 4GB32 1UZYA 1AR92 1YJKA 1GZCA 2JJ6A 4EROA 2A3YA 4GWNA 1W0OA 5J98B 1HIXA 3LB9A 2HEWF 1TME3 1NQDA 3HBZA 1NXMA 5DXDA 4EN7B 1DQ2A 1RUH1 4ES9A 3WUDA 1C4RA 2YHJA 2D7FA 1QJY1 4Q4W2 3WHUA 5C8WA 3BCWA 2PHTA 3FBMA 4Y26A 1XRUA 2ZX3A 1ZNPA 2Y38A 3M2MA 4YNIA 2R1BA 2WFF3 3GF6A 4I30A 5JSRA 1AYN3 4CDXC 2DVBA 2QVSB 1PNGA 1DLLA 1RUD1 1ZBE3 4K7JA 4Q4V2 3CJXA 4FP2A 3WQ0A 2D98A 4U2AA 2DCZA 1RGSA 4RHV1 1AR72 3NKTA 4E27A 2R0HA 2CWSA 4ATFA 1I9RA 2WNVB 1GANA 1VBC3 1WCKA 1R093 4G9SB 4CYDA 1OHFA 2G4IA 1QJZA 2ZGRA 1NCRB 4CZSA 1ZZ9A 2TNFA 3AP7A 4BCUA 1H9PA 1VR3A 5FLJA 1NLSA 2ZGLA 1HV0A 2YV8A 2PN5A 2VMGA 1YIFA 4GH4A 1RUF1 1UMZA 3ETQA 3JBG3 5K8SA 1Y9QA 1O4TA 5BUVA 5CNAA 4QMAA 1MS5A 1H9WA 3AM2A 3ZX7A 2FBEA 3AKTA 4YZ1A 1MS4A 1CVNA 1LOEA 3OBRA 4K21A 1HXS2 2B5HA 3WLUA 4D7SA 1CAXA 2QNKA 1PGW1 1DU3D 1RINA 3N7JA 2XJSA 5K0UA 2AENA 1RUE1 2BVVA 5FRAA 2HEYF 5DDJ1 4WM8A 2WA4A 1PZ7A 1XXNA 5A32A 4IQPA 5T5JA 1CONA 4PDWC 5BNOC 1DQ4A 2JICA 1EYBA 1AL22 2DU1A 1DZRA 1H0BA 2AUYA 4AGRA 3VKNA 1K5MC 4I0WB 2X8KA 2A7AA 2BWCA 1AJOA 2HJIA 5L36A 4XW3A 4ZU5A 1ND3B 4GXLA 1DGWX 3G6JB 4Y5Z0 1FMD1 3WP5A 2B9UA 4NWWA 1YFUA 5CADA 1J58A 2XLGA 2ZABA 3SNMA 2O8OA 1ULDA 1IS3A 4Y22A 4O9GA 2O1QA 3IDBB 4Y1YA 4EWDA 4PBPA 1EY2A 1NLRA 1YRZA 2DVDA 3LAGA 4WM7B 1ZBA2 3USUB 1S0JA 5KHJA 1S0FA 2A71A 2R0FA 1X8MA 4X6RB 4LR4A 3ZN4A 1MQTB 4Z07A 4FXKB 3PVEA 4IEUA 3B94A 5AC93 2MEV2 1FOD3 3WCSA 2ET7A 4B4RA 2RS53 3ZSMA 4W65A 1HV1A 3A0KA 3WV6A 2WT0A 5CBLA 3AMMA 1Q8SA 2ZHMA 4INDA 4QQLA 1GLHA 1DGRA 1H2NA 1W0PA 3VZMA 4AFAA 1TME1 4PLMA 4ZKTB 1RUG3 2BFUS 4IEXA 3VKFC 1NCQC 2GMMA 1LU2A 3AYDA 1H2LA 2GU9A 1RUOA 5FO9B 1AR62 1YI9A 4Y1XA 2W08A 3GYDA 2BBVA 1BXHA 4XF3A 5L7OC 2ZJCA 3GBFA 4WVVA 3BOPA 3DKWA 3IDEA 3WW1A 2WFF1 4A7ZA 4CEYC 2ZGMA 1SEFA 2FMDA 1AYN1 2XGXA 4R9BA 2O0OA 2JKBA 2HWF2 3IPVA 3OY8B 3UL2A 3DPRA 2R072 1ZBE1 4JVAA 1LGNA 3POSA 3D0SA 3M7AA 1UX6A 4R9CA 2D40A 3KSCA 3R4UA 5BNPC 3VBFC 4FPHA 4DS0A 2WA3A 4QQHA 1I6XA 5C9AB 2FZ2A 1VBC1 3JQXA 3V0BB 1R091 1W2UA 2TEPA 1BVP1 1NY72 2XKPA 4DMIA 1VJ2A 1IPJA 4BQ1A 1JYIA 3AMPA 5GZCA 2IXKA 3KS7A 3WG2A 4P5HA 2R062 4QQ2A 1X82A 4AI3A 3WW3A 2UWAA 3JBG1 2SLIA 2BYVE 2VY0A 1LRHA 2B39A 3FX3A 1GZ9A 4YZ4A 1VBB2 1MEC2 2WQZC 2QZ3A 3WT3A 4IV1A 4OHVA 1GNHA 3KZ4C 4W6XA 4ISQA 4HANA 4Q0QA 4HFSA 4ORFA 3LCPA 3VBOB 1CR7A 2XBO3 1H8TC 3RQ0A 3UJQA 1DGRN 2DURA 4M0NA 4QGMA 5I93A 1AX1A 3RYPA 3IWZA 1RB8G 4RS5A 1DDLA 4CP1A 5CG9A 1SLAA 5IK7A 2Q1MA 3ZFGA 2HWB3 3ZXEA 2XVGA 3WINE 1DZTA 1JXNA 2A6ZA 4M3CB 3NAPA 4OI2A 3CU7A 2Z2SB 1DFQA 2I74A 3AJZA 5ACA2 3DGTA 5KHKA 1M06G 1TNFA 1W6MB 1H4GA 5J3UA 4FAHA 3WNXA 4LLFA 3V65A 3SLIA 5A33A 3WZ1A 5EJ3A 4Q8KA 5C4WA 2DVGA 1O91A 1ZZ7A 2QE3A 3L9JT 4MGZE 4KGQA 4CDQB 3PVOA 4E4ZA 3E6CC 1XNCA 4FPFA 5K7PA 1SCSA 2D44A 5GLZA 3O5SA 2EXIA 1SLCA 1GQHA 3BU7A 1RUC3 2DCYA 4AFDA 1UAIA 3E5QA 1LHVA 1BBT2 2YROA 4LLOA 5CFCB 4AGVA 2XVKA 2UYAA 3FZ3A 4DXZA 5HCFA 2I07B 4KG8A 5AC91 1FOD1 4GKXA 2FMYA 4BM8A 2P3IA 3MGUA 2RS51 1N3OA 2H6BA 3C3VA 2BW8A 3OD0A 1RUJ2 2JG9A 5EFUA 4IEYA 4OHWA 3PJYA 4RQPA 1F2NA 4GB33 1AR93 3RDIA 3E5UA 1OQEA 1CN1A 4AI0A 4LO6B 5ABJB 3FFQA 1RUG1 5GJ6A 3VZKA 3O0WA 3H9AA 4Q4X2 1AF9A 3PJQA 4IV3A 1E57A 3UKNA 5BNNB 2DV9A 1VRH3 3MLKA 3ES1A 3ATGA 2JDZA 4FXGB 4DNYA 2NZ9A 3EBRA 4N43C 4V1PA 4Q4W3 2RR12 2XJQA 2Z42A 1MS3A 2ZX2A 2D6LX 3J8F2 2CGOA 5JVVA 4UW5A 4DZGA 1ZRRA 5LEKA 2CV6A 3LA2A 4KU8A 4P9XA 3M3QA 3POYA 4TYSA 5FAXA 1RL3A 3RMXA 2C9AA 1I5ZA 1S0IA 3ZO0B 4WVMB 1I1EA 1PVXA 4XQWA 1HW5A 5J48A 5J37A 3LKJA 3KGLA 1AR73 4M0HA 3K48A 3B7MA 3WG1A 5C8CA 4RGAA 2KM2A 2ZKNA 2NQYA 4RA0A 5D8AB 1V6MA 3CEWA 4ASLA 1XU1A 2FHRA 5GLWA 5JOWA 2VOKA 1WMFA 1QHDA 3ZFEB 4B7KA 5FMOL 4OLLA 4XBQA 2CGPA 4CDUA 1D0HA 1GV9A 1JBCA 4QT6A 3KCCA 2R042 3NKGA 1C8NA 1O3TA 2PYTA 4JGYA 3ALQA 4GMP3 3LZZA 3ZXJA 2ZGOA 2XBO1 3B93A 3VBHA 3K51A 1U5IA 4PF5A 2DFCA 3VZLA 1N1VA 3C2UA 4BLIA 2I45A 3SHRA 3LWCA 5CA6A 2JE9A 2VMHA 4FO9A 4LO7A 4AK3A 1R1A2 2YZ4A 2RM23 4QHBA 2OUJA 4DY3A 4LE4A 4IEQA 1ULCA 1R1ZA 2E7QA 2HWB1 3BODA 4AGGA 3CO2A 4BIOA 1WD3A 4IL7A 3U11A 1LJ7A 4I02A 5LK5A 1BMV1 1CX4A 1YFWA 3VDDB 1IS5A 4EWEA 2UY9A 1BKZA 1AL23 1YFXA 1ZX5A 4LBJA 1PK6C 1HRI2 2DUOA 1OFNA 3RJRA 1CAVA 4M00A 2UYBA 4AI1A 2DUQA 4RFT0 4FTBA 2JX9A 4L97A 1JUIA 4AHXA 5T54A 1VAMA 5L73A 3TRSB 4LT5A 5DUWA 4DB5A 1ND3C 1CAWB 3FHIB 2ZGQA 2GAUA 5FTTC 2D3SA 3JZVA 4YGDA 1ALYA 2W0XA 3AXEA 1CD3G 4FPYA 3VBRA 1RUC1 3GALA 4BPZA 3V56A 3V0AA 1REDA 2E7AA 3MLLA 5DUXA 3SCFA 3VKMA 4LA2A 2EIGA 1ZBA3 1M4WA 4AYUA 1S2BA 2R30A 5DZGA 1OLRA 1ASJ3 3AZZA 3H7JA 4WM7C 4COYA 1REFA 1X7NA 1UKGA 3HQXA 1YYNA 1PO23 5HCBA 5K0UB 2MEV3 1MQTC 1PNFA 2LTNA 5FQ0A 4WM8B 2CWMA 1MZ5A 4P9GA 3VL8A 3VBUA 2WSVA 2TBVA 4GB31 1AR91 4GKYA 1CPNA 4XTMA 1O3SA 5IK4A 3NV3A 1X33A 1D2SA 1DBNA 2MPFA 4WV8A 5FBZA 2Q8OA 1VBE3 2ZHKA 4Q0SA 4S2DA 1YO8A 4MLOA 1R082 1VRH1 4HSJA 5KXBA 2ET1A 3JU9A 4XMIA 1AR63 1OA4A 4I0AA 4ONUA 4Q4W1 3ZXDA 1PIV2 2JG8C 3FLPA 4KH9A 3CJIB 2XJTA 1OPOA 5HBAA 3MW4A 1LOBA 4KWLA 1MZEA 4XFGA 2GH2A 1AYM2 4FSJA 5D1IA 3HMYA 2HWF3 4YG0A 3ELNA 1AJKA 4TLFA 1CESA 2IFRA 1W6QA 3OCPA 4AW7A 1LOCA 5I0SA 5JSPA 1X36A 3H1WA 2Z5WA 4XQ4A 3MIDA 1AR71 2WFPA 3MDPA 4AI2A 2ENRA 4P9WA 4LO8A 5DUUA 1HQLA 1ULFA 3CLPA 5C9AC 4BYYA 2Y0IA 4CDXA 2PHFA 4MUVA 1Z78A 1VB4A 4COZA 3GHNA 2D5HA 4OUSA 3W58A 4LBNA 2X5IB 1FPN2 3GZTB 5F6LB 2O8QA 3M3IA 2WKKA 3TYJA 1VBB3 4UW4A 1V6IA 1XNDA 2W52A 4DRRA 4GMP1 3TWIA 1V6JA 1D4M2 4QM8A 1EV12 4COUA 3I2DA 1G6NA 4JC1A 3VBSB 5EWSA 4O9EA 3NL1A 3VBOC 4YG3A 1F31A 1QOOA 4LBQD 5HXVA 3IPVB 4Y1ZA 4K1ZA 3ZMOA 3RRDA 2WIIB 2RM21 4OHXA 2ZGKA 1V6LA 3IM0A 3ZSKA 1ZZ8A 1GYKA 1ZM1A 2R1DA 2WZR3 3WW2A 1VALA 3LOIA 4D7TA 1C8M2 1OSGA 1DQ0A 4DY5A 2PAMA 1G9CA 1AL21 1QOTA 4WZFA 5ACA3 2NP0A 4QPIB 2BGCA 1NXD1 1SMVA 4Z82A 2VOXA 3LA3A 4LUMA 1H8VA 1RUI3 4Q26A 4P9JA 4HMZA 2A75A 1ZVFA 4NR1A 2WNEA 1PHMA 1KQRA 4PDWA 5BNOA 2RS13 2RJLA 1OKQA 2BWAA 2VULA 4OUMA 1JYCA 4X8PA 1K5MA 1O7FA 1NQJA 1ZBA1 1KD7A 2WLPA 1EP0A 1IKQA 1ASJ1 2B42B 1HDKA 2ZACA 4L8QA 5KWRA 1FXZA 4MV2A 2XWBB 5CFCC 4OVEA 1Q5OA 1PO21 3N7LA 2MEV1 4AG4A 2HWC2 2YXSA 4KWJA 1AVBA 3AFKA 1QF3A 5CFDA 3ZFGB 1YXWA 3AB0A 1RJ7A 4G3YC 5TSWA 1QWRA 2C1FA 4XF4A 4EN8B 4FTEA 1QH7A 2RS32 4FPLA 5HI0A 3ZSJA 3OD4A 4JGZC 3MYXA 1ND2B 1LHOA 1Q8VA 1LCLA 4MVTA 1U12A 1VBE1 3PMSA 4ZU4A 1MZ6A 4E2QA 1XNKA 1AHSA 5GLTA 5BY5A 1AR61 3ASIA 4PQ9A 3ZDSA 1YHFA 4Q8LA 5E8AA 1OOPC 5H9QA 1JUHA 1U5XA 2PTMA 1H30A 2AREA 1KITA 1MS1A 2P3KA 3J8F3 4TSVA 3L2YA 2BFUL 1QJU2 2VG9A 1RHI2 2HWF1 4YM0A 1PZ9A 4JAAA 4E2SA 3VUOA 5B2GB 3QOPA 4L92A 4YVSB 4LBKA 1NCQA 2W68A 2Z79A 3D0JA 3JD72 2YYOA 1PGL2 1F9KA 3EO6A 3H1MA 1CJDA 2GNDA 2ZHLA 2XVLA 3IKWA 5L7OA 3ZYIB 4CEYA 1NY71 3HWJA 4YW3A 1A8MA 3MIFA 5D8AC 1LHNA 3URFA 2MNGA 3AP4A 3P3NA 1EAH2 1NA1B 2E51A 1A3KA 1QDCA 4RQPB 3WDXA 2QUOA 4R8HA 1YJLA 5GLVA 2AYHA 1NE4A 5BNPA 3VBFA 5FO7B 2VOWA 3MIHA 4IV3B 3LA7A 3MPPG 1O5LA 2N7GA 4H7MA 4MYEA 1VBB1 3ZFEC 4AQ6A 4FT8A 4DQAA 3VKOA 2IXIA 2R043 1RVF2 1ULGA 5FDBA 4HVQA 1HRV2 1G9BA 1VLNA 2GDFA 1QDOA 2VECA 4MXWB 4MX3A 2A70A 5CFDC 3QH7A 3DL3A 2Q0AA 3OTFA 1LECA 5E88A 2ZKLA 3OYWB 4B3NA 3M3OA 1GFF2 1H1MA 4BWOA 3M3CA 5JPMB 1I3HA 4C1XA 2WZR1 4YZ3A 4H7LA 3OPZA 4COVA 2DU0A 4D7YA 3EQEA 5KBFA 2A73B 3AYCA 5C8CB 3LSEA 5ACA1 2NN8A 4JV4A 5EZWA 2OYZA 1XYPA 1H8TA 1KXGA 3VDDC 1COV2 4N53B 5H9PA 4Q0VA 2WINB 5CAZA 1RUI1 2Y26A 1HX6A 2R16A 3O14A 1DGWA 1OPMA 1C28A 2E9QA 1JW6A 4XFHA 4N7IA 3SH5A 4IEZA 3V64A 3I54A 1V6KA 1FT9A 1RUD2 4AQSA 2WQ4A 3HT2A 2RS11 2GMPA 3MF9A 4CDUB 4RHV2 3QCWA 4KBBA 4Z1VA 5JIUA 4QPGB 1VB2A 3USSA 4XF1A 1AL0G 1APNA 2HYKA 4XJAA 4AVSA 5IUQA 2D3RA 2ZX0A 3J9SA 2VNGA 3WDUA 2UY8A 3FLRA 4XFIA 3PHMA 1LR5A 3M70A 4R4XA 3IIAA 4XETA 4XXAA 5T3NA 3VHOA 3AFGA 1EPZA 5EV7A 2QCSB 2EXHA 2IZWA 4YG6A 1VBD2 2OIIA 4HBNA 1LHUA 1POV0 3D5OA 1V6NA 2PQQA 5FLHA 3ZN6B 3ZFFB 2G9GA 1GSLA 2BNOA 1KDKA 1NOVA 4AEDA 2V73A 3UKVA 1WGPA 3B69A 3PVBB 1XQNA 1SLBA 1OMIA 5A3LA 1PIV3 1RUE2 1SFNA 3N7MA 3J8F1 5E89A 3R0RA 4KQ7A 4CEWA 5DDJ2 4EN0A 3DUIA 3CJIC 1YCIA 1AXZA 2OZJA 1AYM3 1MS9A 1QH6A 4Y1VA 3UJOA 2WC2A 1LULA 3NV1A 1ZZCA 3ZIXA 1A6CA 4XEZA 4N43A 3NV4A 4PLOA 4I09A 4AHYA 1DYPA 1BZWA 1UW8A 1V9U2 3NVCA 4RR3C 1BQPA 1H2MA 3NJZA 3RJ2X 4LBOA 3MFCA 1ULEA 2D3PA 1IOAA 1NYWA 5L19A 3SITA 3RI9A 2UURA 4JDMA 1O3QA 3I59B 1Q3EA 1KJRA 1FPN3 2K9ZA 2VVEA 4JRAA 4F8AA 3ZXKA 1RJ8A 5JZGB 2YMZA 2X5IC 4CP0A 2GZWA 3SCGA 2H0BA 4XILA 3HAGA 2R041 4XJUA 3PTYA 4YVWB 1B35C 2D6OX 4DRVA 1IHMA 1GBGA 1D4M3 2Q1ZB 1PMIA 1Q8OA 1JTZX 1XYNA 5GALA 3WVJA 1EV13 1OA2A 4E4DX 2IC1A 2ZAHA 4XHXA 4LNVA 4B29A 1PVC2 4A7YA 1PO13 2VUJA 4D3WA 2EF6A 1W6QB 1GZWA 5I0TA 4DINB 3S7EA 1QY4A 1Y7BA 2ZCWA 4FQZA 5F1RA 3O0VA 4AEDC 2HKXA 4HLTA 1X8EA 5T50A 1G8WA 2EA7A 4GQ7A 3RPQA 3SH4A 3JB8A 1JOJA 4HPKB 3RYRA 3ZYJB 4LE3A 4CEWC 2ES3A 4CDWC 4XF9A 4S2HA 4EN9B 4K20A 4S2GA 4AQ2A 1VAKA 1SACA 2GN7A 3MIEA 2D93A 2ZOEB 5BNQA 4FTSA 2ZGSA 3AYAA 4QPIC 3ST7A 3MPBA 4YGCA 5SV5A 3M8LA 4LBQA 4GWMA 3BIWE 1T6GC 3WW4A 4AHZA 4TZDA 2K0GA 1N1SA 4YM3A 2WNUB 3MEPA 1PK6A 5F6KA 1ONAA 4ZU7A 5DUVA 5I0RA 3TNQA 1Q43A 4RL7A 5GZDA 1R092 5GLUA 5I8TA 4XDQA 3AMNA 5C33A 4YW2A 2F6BA 4Y20A 4AXOA 3TB0A 3USUA 1S0EA 2GN3A 2WS92 1H1AA 3FUOA 2JXAA 1ND3A 1QNYA 3EJKA 4NWVA 4M3CF 1QQP2 1TNRA 4Q4V3 2RMU2 2HWC3 3CF6E 2P2KA 1WCDJ 2BTVC 3JUUA 1FNZA 1SLIA 1QXRA 2A3WA 1Z0HA 2RS33 3AP6A 1AX2A 1W6PA 4LHKA 2CTVA 5KC5A 3S7IA 4KNCA 1Z7S2 4MSVA 3FJSA 4R52A 2WNVC 4WM7A 1HQNA 3RG0A 1ND2C 4AEJA 1DIWA 5FPXA 3I8TA 1VIWB 1D0GA 1NCRC 4L2NA 1RUNA 3P3PA 4ATEA 3AP5A 3FC0A 3E6DA 1MQTA 4BE3A 5GZGA 2NM1A 4E2GA 4D94A 4KGGA 1PIV1 4J1XA 2GNBA 1W39A 2JD4A 2VNRA 5KHGA 1J59A 4PDWB 3ZXFA 4Q0PA 1QJU3 4HK9A 1G7YA 4JTOA 1RHI3 1AYM1 4MGKE 5KXDA 1NE6A 4YM1A 1CJPA 1U5ZA 4OULA 1K5MB 2H6CA 4KU7A 4YFZA 1LB2A 1CQ9A 1HXS3 2RJKA 3JD73 1S2KA 4YVSC 3KT1A 4BIFA 2A6XA 2JG8A 3D4KA 1WLTA 2VXRA 1LGBA 3WHTA 2C0ZA 2QJVA 3J26N 4HK8A 3B3QE 3ZMNA 1XNBA 5AFEA 1S0CA 1AR82 1ZRDA 3R4DB 4X6QB 1JN2P 3DV8A 1OA3A 3OY8A 2WT2A 1FPN1 5FLIA 3R05A 2XPJA 1ZREA 3ILRA 2PLV2 4EJRA 4K6BA 5H9RA 4HKLA 1FYUA 2PHLA 2EVXA 4OHZA 3MIGA 3MF6A 4X8NA 1DQ6A 1Q8QA 2R6QA 3FMGA 5T55A 4GH4B 5C9AA 1FOD2 4YLZA 4MXVA 1RVF3 1CAUA 1D4M1 1HRV3 3RNSA 3WXPA 2XL7A 5I91A 1EV11 4LEJA 4XFBA 1AX0A 2CGNA 2EALA 4ASMB 1UN1A 4OHYA 4HZFA 1LOFC 2EAAA 2PHRA 3A4UA 1PO11 4HKWA 1NCQB 2A6WA 1RITA 1SBDA 1U5YA 3VLBB 1AUYA 1CAXB 1S0DA 3VZOA 2D6PA 4AFCA 4YARA 2PAEA 4QM9A 1GICA 3N36A 1MZFA 3B5LB 4LTAA 4NHKA 2GSYA 4IEPA 4MH0E 4CEYB 1LKNA 1DGLA 5A32B 4DOUA 1COV3 4K8FA 2WL1A 3VBOA 3VZJA 1AZDA 4N53C 3PLQA 1F8VA 2DTWA 3IBMA 2CNAA 2XHKA 2VU9A 2HWD2 5LK7B 3IMNA 2VW2A 1RUD3 5BNPB 2P37A 2PFWA 4RD7A 2ZBJA 3TAYA 1SLLA 1Y43B 4M3CA 2NYYA 4PIYA 4M01A 2OVUA 1W6MA 5AVPA 3HT1A 4QPGC 2VNOA 4XJZA 2PELA 4PIZA 3FE5A 4Y22B 4XHBA 3TBDA 1QXPA 2VOVA 5IK5A 2ARXA 1HKDA 1V00A 3FUQA 2R073 5EYYA 4Q4V1 4DPNA 2HWC1 3B00A 1YI7A 4H55A 1FV3A 2ZMKA 3BB6A 2OPKA 3ILNA 2IXJA 2RS31 2UU8A 3M3EA 3WD5A 5CG8A 1VBD3 4XYXA 1B09A 3VHNA 4HETA 5KHHA 2DCKA 3ZYRA 5CFCA 2R063 1NZCA 3ZFFC 2VW0A 1DQ5A 3M4FA 2VGDA 3SH3A 2GALA 2ZGNA 4YGBA 5CVRA 4NOTA 2JECA 3MIBA 2QDNA 4URTA 4G4FA 1QMJA 4Q4Y2 1QJU1 1MEC3 1UU6A 4JGZA 3WOGA 4Y24A 3APBA 1RHI1 3ZXLA 3BPZA 1Q56A 3QD6A 3WP4A 2AH2A 1TEIA 4XJWA 4B4QA 1JH5A 2VQAA 2WWSA 3ZXGA 4D69A 3KMHA 1HXS1 3JD71 1PGL1 3T1LA 4FPOB 1OOPA 3UV9A 3R6SA 3DPRB 2WZPP 1RTVA 1UZZA 2B46X 1V9U3 2ZS6B 5JI9A 2ZMNA 1XE8A 4NPRA 1F5JA 4XIKA 5SV8A 1HLCA 5LRRA 3THPA 4K9SA 2Q30A 4LUKA 5IK8A 1TQ5A 3JCIA 3AKRA 4FP3A 4L9BA 4XFFA 5AFBA 4I3PA 4Q2FA 5JDBA 4Q1PA 1RUC2 1WW5A 1MS8A 2AZ5A 2HWE2 2VW1A 5JLVA 2KA3A 3KB5A 3J4UH 5J09A 4META 1CIWA 3ENRA 1RVF1 3ES4A 5D8AA 1HRV1 4NVPA 1VP6A 4CDQC 1FAYA 4YVWC 1V70A 1MACA 1FI2A 4IV1B 3GBGA 1UU4A 3WP6A 1W6NA 3N35A 4XZPA 1YWKA 5CU1A 1BBT3 1PVC3 1SBFA 1ENRA 2GC3A 1WLCA 4MZUA 3ZFEA 4KG0A 1S55A 5IT6A 3NWKA 4AEKA 4N43B 1UU5A 1VRH2 1KS5A 2PHUA 2GH8A 4RS5B 3AZYA 1XU2A 5BXXA 1BEV2 4XBLA 3SXWA 1QJX2 2D6KA 1RUJ3 1COV1 1WA4A 3MW3A 1UKRA 2IXLA 3NAPB 1LOGA 1D2QA 1IKPA 2ZX1A 5E1RA 5HCAA 3B9CA 5ABJC 4C91A 4Q4X3 5A33B 2XWJB 3EXUA 5C4WB 2GC0A 4U36A 1FNYA 5BNNC 1KFXL 3X29B 1ENSA 2RR13 1BK1A 2P3JA 3VDDA 4YW4A 3G7DA 2WNUC 2DVAA 3AZXA 3FFZA 5JIAA 1LENA 1TMF2 3UK9A 1G9AA 4OI4A 2R071 2WS93 2CAVA 1RMU2 3N4MA 1QQP3 2SBAA 2RMU3 1GZWB 3ECQA 1CAWA 4XMAA 5BYNA 4QXKA 2CL2A 2OA2A 3KT4A 1VAVA 1S0BA 1VBD1 2YGMA 4N9IA 4YRDA 4XJ8A 3B9IA 5T5LA 2ZZJA 5JOZA 1PZ8A 1TE1B 5K9YA 1Z7S3 3DN7A 3ZYPA 2JG9B 2R061 1HQWA 2YY1A 4LO4B 3KCYA 3T1MA 3AK0A 5JWPA 5JPNB 1OFSA 1F5FA 4P9IA 5GZEA 2D43A 3T2TA 1RC6A 1W6OA 2RM22 4IEOA 4LBQB 1O4ZA 1A8DA 3H7YA 4IEVA 4XF0A 3H3UA 5F5QA