3WP3A

Xylanase 11c from talaromyces cellulolyticus (formerly known as acremonium cellulolyticus)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
190
structure length
190
Chain Sequence
QSITTSQTGTNNGYYYSFWTNGGGEVTYTNGDNGEYSVTWVNCGDFTSGKGWNPANAQTVTYSGEFNTSGNAYLAVYGWTTDPLVEYYILESYGTYNPSSGLTLLGQVTSDGGTYDIYSTQRVDQPSIEGTSTFNQYWSVRTEKRVGGTVTTANHFAAWKALGLEMGTYNYMIVSTEGYESSGSSTITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) GH family 11 xylanase
pubmed doi rcsb
source organism Talaromyces funiculosus
molecule tags Hydrolase
total genus 51
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp3A00
3VHOA 3AMMA 1BCXA 1HIXA 4XPVA 3VZKA 3WX5A 2D97A 3WY6A 1OLQA 1BVVA 4S2DA 2Z79A 3B5LB 2NLRA 3RI8A 1XNDA 2B42B 1OLRA 1H4GA 3VHPA 1AXKA 1XXNA 3AMQA 3WT3A 2DCZA 1UU6A 2BW8A 3VZNA 4HKWA 1H4HA 1REFA 2D98A 1XNCA 3HD8B 4H7MA 4IXLA 3WXPA 1C5HA 1UU4A 3WP3A 1NLRA 3O7OA 2QZ2A 1H0BA 3AKQA 3WP4A 3VZMA 1HV1A 3VZLA 1QH7A 2VULA 4HKOA 2C1FA 3MFCA 3VL8A 3ZSEA 1ENXA 3MFAA 3WP5A 3MF6A 1IGOA 5K9YA 2QZ3A 5K7PA 1OA2A 2NQYA 4S2HA 3AMPA 2VUJA 3LGRA 1KS5A 4HKLA 2BVVA 1XYOA 3RI9A 3AKRA 3VZOA 4HK9A 1F5JA 3VZJA 1XNKA 1OA3A 1REEA 3AKTA 3B7MA 2F6BA 4S2FA 3WR0A 1QH6A 1HV0A 3M4FA 2DCYA 2B45X 1M4WA 1W2UA 4NPRA 1TE1B 2DFBA 3EXUA 1PVXA 5HXVA 1UU5A 2B46X 2VG9A 3AMNA 2VGDA 3WP6A 2JEMA 1UKRA 1H8VA 1BK1A 3AMHA 2BWAA 1KS4A 4XQDA 3MF9A 1REDA 3WQ0A 4XQ4A 2JICA 5EJ3A 1T6GC 3VL9A 3AKPA 3VLBB 3VGIA 1YNAA 4S2GA 3AKSA 1C5IA 2BWCA 1OA4A 4XQWA 1XNBA 2DFCA 2JENA 3WQ1A 2DCJA 3LB9A 4HK8A 2DCKA 3WQ7A 1H1AA 1XYNA 3VHNA 1XYPA
chains in the Genus database with same CATH superfamily
2UU8A 4CCNA 1Y4WA 2UWAA 5A70A 5IAVA 1DU3D 4Q5OA 4CDWB 1TMF2 4R4ZA 2Y60A 4AVVA 5F3IA 3NKGA 2J22A 2Y33A 5FY1A 1KFUL 5D2AA 1WMFA 2ADEA 2RM22 2AREA 4WM8B 2HYXA 2ZGSA 1RUG2 5CISA 3NRUA 3WDVA 1QJU1 5DAXA 4BA6A 2ETEA 4BMEA 2RS51 3MZHA 1PHMA 1AXKA 4NMIA 3OUIA 4KGQA 4I01A 2BW8A 3VZNA 1FX5A 3IIAA 5DABA 3WCRA 2WNEA 3VDAA 5C4WB 1RMU3 2I45A 3UYJA 1ZYBA 2W2IA 2RHPA 1QF3A 4HOOA 1ND3B 4PI2A 1UU4A 4XAAA 4QQOA 2D6LX 4CEYA 2WNOA 3FX3A 5L73A 5IATA 1V00A 2GU9A 2RDNA 3CZJA 1V9U3 4FSJA 1VBA2 4IEVA 4DQAA 2BNNA 4XTPA 4AAXA 1NQJA 3RZZA 3WINE 3LFIA 2ZX2A 4DXRA 3TEYA 4HVRA 3VZLA 1SLTA 3B00A 3NWKA 3HEIA 1LCLA 2WS92 5EQUA 3FL7A 1WMEA 2A73B 1LOCA 1UMZA 1UIKA 2P3YA 2BGCA 2R0FA 2H0BA 4K1YA 4RQPC 1TNFA 1CZVA 2VQAA 2BQPA 5AVPA 5A6ZA 4INDA 1W9TA 1WMXA 5FMBA 2WO7A 1DYOA 4IUGA 5EV7A 1NXD1 2NMOA 2C4XA 3GDBA 2XJQA 5I8SA 4QKBA 2CAVA 3B02A 2WNVC 1NCQB 1KS5A 4KG0A 5JPMB 3L9JT 3AXEA 4Q2FA 5DDJ2 2QE3A 1OURA 3ZIXA 4WVWA 4X8NA 4EQVA 2E32A 4J25A 3VKMA 1G7YA 4N7IA 3UETA 5IVCA 5KR7A 1DQ1A 1QJY1 1ZZBA 2ARCA 1EPZA 3OUHA 1QQP3 1REEA 1NAEA 3AFGA 3AL6A 4W8JA 2ZHLA 4Q4Y2 3CU7A 4DUWA 1JHNA 1LHNA 3VBFB 1CAVA 3FBMA 4PDWB 1W6MA 3HR9A 3ACFA 4W6WA 4XUQA 3RG0A 4UW6A 4FOWA 1QHDA 4XFBA 4XYXA 1Q8VA 1RVF3 3ORJA 5L9VA 3HVDA 4NOTA 4FPJA 4Q4V3 1SPPB 3C7OA 3I4IA 4G3YC 2DUOA 2JEMA 1JODA 2XJTA 3FWEA 1AYM3 1BBT2 4AI1A 5FPUA 1QXPA 3ZR6A 1RUE3 2XHNA 3O1VA 3TBDA 5IHRA 3ZM8A 1VBE2 4QDQA 2JKBA 4K21A 4LBQD 4COZA 1NZCA 1OT5A 5FZGA 2B7YA 4Y4YA 1W6PB 5BNPA 3PU8A 1OOPB 2DBIA 4CUGA 2FDKA 4FOVA 5C3PA 2PXJA 5GZEA 1LHUA 2ZGNA 3QH6A 4BQWA 4P9LA 3I3DA 5IK5A 1CX1A 1COV1 1EUUA 3HBKA 5T52A 4P9WA 5JOWA 3RZHA 4K6BA 5BNNC 2TEPA 1LULA 2W3JA 1GWKA 2Q30A 2OVUA 1PZ7A 1TG7A 3DXTA 2PLV2 4C1XA 4UXAA 1FPN1 1K5MA 4DXTA 2XG3A 1WKYA 3ZIWA 1HIXA 2CV6A 3BOPA 3BGAA 3AZWA 4Y24A 2D3RA 1BVVA 1RUC2 1VE0A 1VPHA 3DV8A 3OGSA 5JIAA 4YM0A 2NLRA 3AFKA 3LF7A 2ZKLA 4ITCA 4OUEA 3VBRB 5HXMA 2EF6A 3BPSA 3HMYA 5JMCA 3OUJA 4ATEA 4W50A 4WM7B 1CAUB 1W2TA 1J1TA 1JYXA 1W6NA 3WHTA 1VIWB 1PO21 5CZKA 1YFUA 1QEXA 2YC4A 2W92A 4UF0B 5FZCA 3UT0A 3ZYRA 4H7MA 2XQXA 3A22A 3OD0A 3ZFFC 1VBB1 2J42A 5LWBA 3OJBA 3PURA 1HRV2 1OF3A 2JG9A 1YQ2A 1AJOA 4QPWA 3RPQA 4NHYA 3AKQA 2VQTA 1QXJA 3OBTA 2B39A 2AR6A 3WNLA 2VBDA 5FZOA 1S0DA 2X5IB 3NAPC 1DQ2A 1QH7A 4D7SA 4HPKA 2BOIA 5T5LA 4PBPA 3LAGA 1JMUB 2WYFA 3PU3A 4TN7A 3V0AB 4LEJA 3JQWA 4K9SA 4YVSB 4QB6A 5A1AA 3RDIA 2HLEA 3PUIA 2WWUA 2XJVA 2QUOA 4QHOA 2RS33 4Y1ZA 3SNMA 1R64A 4CDQA 2EAKA 3W21A 2YC2A 5K7PA 2DCTA 4DEQA 2P3KA 2YHJA 1DLCA 3LGRA 3OG2A 4XDPA 1H2KA 1VBD2 1OH3A 4ZS2A 1QOSA 1STMA 3S5QA 1EV12 1FMD2 3DKQA 4JKKA 3GNEA 3O1PA 3VBSB 2OUJA 2WZEA 3JB4C 1LEMA 4NIAA 3RS6A 1YEWA 1JYTA 2Q1ZB 2VNGA 3DKWA 1IKQA 3AKTA 1GLHA 3IMNA 1PVC2 2K46A 2JECA 5A6QA 4LA2A 1Q8SA 1HQLA 3BTYA 3WF4A 1AR92 1G8WA 1Y9GA 3LQCA 3OB8A 2VOTA 2P17A 4XJWA 2Z2SB 1ZZ6A 3TEXA 4B1MA 3A23A 5FZDA 4BQYA 3BTXA 1SEFA 5A7SA 3ROUA 1KITA 1AR81 3CJXA 2RE9A 1O59A 4OHXA 4OHVA 1LU2A 3VHRA 5ABJB 1SDWA 2RJKA 3KB5A 4BMBA 1O3TA 3CEWA 4GWMA 1RHI3 4QQPA 4YW7A 1ZZ7A 5FY9A 3ZXJA 5K0UB 1CQ9A 5FYYA 1BXHA 4FXGB 3FN9A 2R062 2XKOA 2RM21 4B1LA 4BQ2A 2QQPA 1X36A 1RUG1 1WA4A 2PA7A 3S6PA 4COYA 3NL1A 4TSVA 4XXPA 3J26N 5I0DA 1JZ5A 3BIEA 3B9IA 1CWPA 3A7QA 1OD5A 1W8ZA 3OCPA 1JHJA 4QGNA 3ZR5A 3DYOA 1H2LA 2CDOA 5FYZA 2GNBA 2C9KA 4IEQA 4Q4X2 4AI9A 3ZYJB 3KF3A 2DVDA 3AYAA 4FFFA 4MUVA 1QOOA 1PGL2 1DZTA 4QPGB 4XUOA 1CD3G 3RFRA 3JU9A 4NPMA 2PHLA 2EICA 5EYYA 4AG4A 5AFEA 2ZS6B 4MHRA 4DNYA 1OLQA 1W6OA 1VBA1 2Y38A 3BYWA 4GALA 3T1LA 4NO4A 1VRH2 4RGKA 3IKWA 1UZVA 1RUF1 5T5PA 1X8MA 1FV3A 1V6KA 2WS91 5C9AC 5EXOA 2VUAA 3H7JA 4PQQA 5FREA 3SMHA 1HRI3 3H1WA 4H55A 2Z5WA 4CDWA 3O12A 5FYIA 2ORXA 1YIFA 5HPOA 1SQ4A 5K8SA 4QB1A 1HXS3 4XFCA 5FWJA 3WF2A 1TME3 2R6QA 2VL4A 2WBKA 1C5HA 1QY4A 4A45A 1JOPA 1VRBA 4RHV3 2D44A 5FP4A 4LO4B 3KCYA 4MSVA 3MV01 2VUCA 1B35B 2D93A 1R092 5CA6A 4AI2A 4N8MA 3CF6E 1ENRA 4YLZA 5E88A 2WSVA 5C4WA 2ZACA 1H9WA 1I6XA 1OF4A 4QQLA 1ND3A 4R4XA 4Y26A 4EJRA 4YM3A 5LZ6A 4DZGA 3NV4A 4C0HA 1P8JA 3ACIA 4YNIA 2C1FA 3MFCA 3VL8A 1S0GA 2VPVA 4BLIA 2ZTNA 1IGOA 4XW3A 2DVGA 4LE3A 2BERA 4FQZA 4I30A 4AZZA 1VB4A 2BYVE 4LA3A 4DB5A 4MH0E 1NLSA 3FHAA 1Z7S1 5FY8A 4K8FA 4LKDA 2WN3A 4BB3A 3OY8B 2DF7A 5EZWA 3EMRA 1NG0A 1K12A 4QX3A 1WUVA 2WIIB 1OMIA 1TQ5A 3BKZA 3T0AA 3OSDA 1DGRN 1OD3A 5LY1A 5I93A 4JVAA 2NYYA 3M4FA 4ZXEA 1I5ZA 3ES4A 2VZRA 4K20A 3I2IA 5E89A 2DFBA 4DOUA 4IE5A 2CWSA 3H50A 4CEWC 4FPLA 1POV3 3WF1A 2KM2A 5DPNA 4IEPA 4IE7A 2YGMA 4GH4C 5SV8A 4GKXA 1UOGA 2PHRA 4XFHA 3WP6A 2R073 3UV9A 1NKGA 2FZ2A 4YZ1A 2GH8A 2WRAA 2OT7A 3KT7A 3VBFA 3AMHA 5LCWL 4JGZA 1FXZA 2RDRA 1LGNA 3CKHA 3HAGA 1DYKA 5AC92 2J1SA 2V73A 3ZMNA 2HWC2 4Y20B 4Q8KA 3JD71 3ZX7A 1O7FA 1QDCA 5L7OC 1J83A 3IIIA 4LHSA 3AKPA 1SPPA 1YNAA 4QPYA 1F2NA 1CGPA 1C5IA 3ZXKA 3CJIA 2VMEA 5A7OA 4C0BA 1IPSA 2QDNA 4AHXA 3OBAA 1SFNA 1W90A 5ANNA 3ZN4A 3AK0A 3LPFA 2BOJA 2X10A 2HWE2 3AYEA 4JGYB 4YW2A 1W6PA 1OOPA 2VZPA 4JV4A 4CDUB 3KVBA 4LXLA 4WZCA 3LIGA 2ILMA 3NNLA 2WC2A 4Z07A 4NRPA 4YGCA 2VNOA 1WGPA 3OOXA 5FP8A 3RQ0A 5B4NA 1PNGA 2C6SA 1PIV1 4YYOA 5A6XA 3KHCA 3WW1A 4P9JA 4CXYA 1O6UA 1RUJ3 4K40A 1XOYA 2Y6HA 4IE6A 2WT0A 1BEV1 5FUPA 1SBEA 5EHDA 2OUHA 2YBSA 3C2UA 5FXXA 4CCMA 5BUVA 1VMFA 1UZZA 2UY8A 3MW3A 5DN2A 5FZ3A 1AR71 4JHZA 2LALA 4NRMA 3ASIA 4WM7A 1AL22 2XR4A 4N43A 3G7DA 1XU1A 3GBGA 1V70A 4KGGA 1VBD1 3VBHC 2HWF2 4ET7A 5DZFA 3ZDSA 1ULOA 4UW3A 1ZREA 1FMD1 1W8TA 2KA3A 2VW1A 2WLQA 3B3QE 4XF4A 2JG8C 2W5FA 1AXYA 4R9AA 3AYDA 5FMDA 4PIXA 4MV2A 3WNXA 4Y5SA 1SLAA 1BLZA 1KDMA 4FAHA 2PAEA 1C8M1 1QU0A 3U4SA 3F95A 4BQ5A 4AE2A 2RR11 3Q8FA 1DP0A 1T2XA 1EY2A 2Y6KA 5FYVA 1C57A 4PF1A 1PM4A 4GWJA 4XUNA 5JI7A 2GAUA 2PQSA 5L9BA 3AP6A 4HKLA 2DVAA 3V0AA 1H8TB 3WCSA 2AH2A 4YVSA 2A71A 1J3RA 4DPNA 5D8AA 3HPNA 4NHKA 3POJA 3ZYFA 2BBVA 5C3SA 3ZSJA 2RS52 2ARBA 3R0RA 3CDZB 1UPIA 3CMGA 4PIZA 1AR61 2HWD1 2R1DA 3H8RA 2XL7A 1LENA 2YMZA 1ZBA2 1DZRA 3WF0A 4JHTA 1E5HA 3SLIA 1GNZA 3PDQA 3HIFA 4HVOA 4Q4W1 5EPAA 2AEZA 4AGGA 1OPOA 4MHUA 5DZGA 1UKRA 3K4DA 3DN7A 2QKDA 2WQ4A 3JBG3 5J36A 1W6MB 3ITQA 2ZA9A 4JTNA 4XQDA 1T6BX 4EWDA 5C5UA 3VD5A 4XJAA 1Z78A 4JX0A 2R0HA 3OGVA 4Y5TA 4AHZA 4QB2A 5CBLA 2YU2A 4QPIA 2Z4FA 4ZU5A 1ALYA 5CFDC 1NQDA 4OYUA 3WNMA 1Q8OA 4QX5A 1VBC1 1K5JA 3KZ4C 3WUDA 5FZ6A 2BWCA 2ZEZA 3O0VA 2HKXA 5GLWA 1UX6A 1R083 3FLTA 1LHOA 5GZGA 2XJSA 5FJKA 4PLMA 1W8UA 3WQ7A 1I9RA 5BNPB 3VHNA 3VHOA 2VQUA 2ET7A 3LZZA 1LOEA 1TEIA 3I8TA 3TNQA 2WZ8A 2HEVF 1QJY2 2YBPA 3KQRA 5DG2A 5FO9B 4NPLA 3M3CA 3FLRA 4CSWA 1IQDC 2JX9A 3PIJA 3VV1A 2RV9A 1K5MB 1RXFA 4LNVA 1MS5A 2FCUA 4YZ4A 5FQ0A 4UBGA 2VMGA 4QPGA 3H8OA 2ZX0A 3I59A 3RNSA 3KT1A 2E33A 3ZDVA 5HI0A 1W9YA 1LOAA 2HEWF 1TZOA 1FV2A 4A6SA 1F8VA 1BZWA 4C1WA 2E63A 3MEPA 4FFIA 4CDXB 1X33A 1FOD3 5CAZA 3J7HA 1QNWA 5A1LA 1GFF2 1JYVA 4R8HA 4LR4A 1ZBE3 4LLFA 4XUTA 1ULPA 4BPZA 5CG8A 2VU9A 3AJYA 3N7LA 4CUBA 4ES9A 4FO9A 2P6CA 2VULA 3E6BA 1ZRDA 3VB9A 1VP6A 4XBLA 5KXCA 2FMDA 2WA4A 3KSCA 2JJ6A 4AFMA 2TNFA 3A21A 3ECQA 4WM8C 4CU9A 3C8XA 1JU3A 1COV2 3H1MA 4LJHA 4YWAA 3V64A 1N1YA 3GYDA 1NT0A 2PYTA 1LOGA 2VO5A 3MF6A 2JE8A 1FNYA 1QNYA 1WLTA 1RL3A 2QZ3A 5GM0A 5ACA3 5EIYB 1FPN2 5I0TA 2X05A 2WZR3 3K3OA 5A3WA 4MGIE 1WBFA 1W2NA 1RUH1 1LNSA 3RZGA 2EXIA 3VBOA 5G05L 2ZGUA 3ZPOA 3K2OA 4B7KA 2FDIA 1D4M1 5F5AA 4O9GA 5BNOA 4LBOA 3B7MA 4E4ZA 5AC91 2XGXA 3PLQA 4PLOA 5A3NA 2HWC1 4RYDA 4LBJA 4O9EA 3IAPA 3NKTA 1H6XA 2E9QA 1PO22 1RXGA 3QACA 5JSPA 5A32A 4I2OA 2B9UA 4W4ZA 1UAIA 1VBB2 2NP0A 2YYOA 4GJZA 5GZFA 4EYUA 4FTEA 1RGSA 1LJ7A 5C33A 2VAUA 1GQPA 3WNOA 3T2QA 4LHNA 3TN93 3ZXEA 4RFRB 4AAPA 3VBUB 1AF9A 1AYN2 1X7NA 2ZAAA 4BH9A 2D6OX 1OUSA 4LBQB 3MF9A 5DAPA 1K45A 1R1A1 4XQ4A 1DBNA 1SLCA 3H42B 4BM8A 1TMF3 2DUQA 2VZOA 3VLBB 3VGIA 4Z8BA 4YVWB 5JXGA 1O3RA 4CXXA 2W95A 1IHMA 1W8WA 5IK7A 2VXRA 1ASJ1 1UOBA 3ZFEC 1V6NA 1UF2C 3MIBA 1V6MA 5D21A 1OPMA 1XSQA 3H8XA 4QWNA 4Z1VA 1F15A 4Q0VA 2ET1A 4Y20A 1Q8PA 4TTGA 3PTRB 4C8DA 1UY4A 1UCXA 5FYMA 4N9IA 5FMOL 4XPVA 3WW2A 3MI8A 2WWSA 3PTYA 5KHIA 2RS11 5T54A 2MEV2 4R9DA 1OBNA 5C3QA 2R7EB 3POBA 4IV1C 4FI9A 4N9HA 4B29A 4QGLA 4RR3A 4YFWA 1XNDA 4OULA 4FTBA 5C8CB 2EIGA 4JGYA 4KU8A 2GC0A 3QCWA 2ZXQA 2DBNA 3KM5A 4CDUA 5B2GB 1GOFA 5SV5A 1RYYA 5F9TA 1V6LA 4AFBA 4GWIA 3B93A 1W6OB 4TLGA 1AHSA 4HVQA 5F32A 4IXLA 1BMV1 5HCHA 1AR82 3TEWA 5JUVA 4YM1A 3IDBB 1O4ZA 1I5PA 5A3TA 2WABA 1H6YA 1Q56A 3D6EA 2KD7A 1ODMA 3WDUA 3LOIA 4LK6A 4NHMA 1U12A 3U11A 1C1FA 2AZ5A 2Y0OA 3OYWA 5FKBA 4CP9B 2BFUS 1QJX1 1AL0G 5DDJ3 2EXKA 1LGBA 3LEMA 4QKFA 5H9RA 5I8TA 1PO11 1SZBA 1WLDA 3MO4A 4LMFA 3ZSEA 4DFSA 4O7XA 5CFCA 1RUI1 3FHIB 3VKFC 4EE2A 2C9AA 2CDPA 5FZKA 3E5UA 3S57A 2VZVA 1XE8A 4K8RB 4P9YA 4LPLA 5IFTA 5J48A 4AQSA 1JZ3A 3VD4A 2YGLA 4KNCA 2ZMLA 1ZBA1 2XBO2 1LOFA 1N1VA 1UXXX 2GMEA 5GZCA 5IVEA 4AEMA 4YZ2A 1HKDA 4EZHA 3AKRA 3VKOA 4D6QA 4HK9A 1GICA 1ZM1A 1FATA 4U2AA 5H9SA 1CJDA 1WCSA 5FDBA 5E1RA 1MQTB 1RUF2 3FUOA 2W39A 1BBT3 2GZWA 3ZFGC 1JZ7A 3BOWA 1H2MA 1LU1A 2X5IC 1AUYA 1QH6A 2W1WA 3WR0A 1VBE3 3VDBA 1X9PA 5DUUA 1H8TA 2JXAA 2WA3A 1PVXA 2JIGA 2JIJA 1W04A 2BRTA 4I3GA 2O8QA 2OZJA 4XF3A 4XF0A 1JZ6A 2E26A 1MVEA 1L3JA 1NOVA 1GNHA 2WT1A 1RUD3 2ZAHA 2FBEA 3M3EA 4Y1XA 5LRSA 2IXJA 3MLLA 4WVZA 2BWAA 2H6BA 3PVBB 5IAXA 1OFNA 2PLV3 1A34A 3UKNA 3KHBA 3FJSA 4YW6A 4QXHA 4QXKA 3OBZA 3WW3A 4GD4A 2AC1A 5DXDA 4XIKA 1DFQA 1EPWA 3VBSC 3OPWA 3PJQA 2C24A 4UFMA 1RUC3 1MPXA 2BEOA 3DPRA 1CJPA 2FDGA 4META 5C3OA 2VMCA 4URTA 4JGZB 4HSLA 1DGWA 5F5QA 3E6CC 1S4CA 2RJ2A 1DG6A 4GXLA 1FYUA 2VCMA 5JZGA 2B5HA 1WCDJ 2CY6A 2PHDA 3LDRA 5DZEA 1Z7S2 1OHFA 2OX0A 1XYNA 2E6VA 1US2A 4R52A 2WQZC 3INAA 3U14A 5KWRA 2LW8A 5IT6A 4UFJA 2IUWA 1N1SA 2OQ6A 2Q1MA 1JUHA 2Q8OA 1XSRA 2VZUA 3GCWA 3CJIB 3WG3A 5JSRA 2PHUA 1S55A 3MW2A 4HFSA 5EJZB 2Z69A 2K0GA 3PJYA 5ABJC 3QLQA 1HRV3 1W9SA 3B5LB 4L92A 2CL2A 1H4GA 3N9LA 5IWFA 3WT3A 4J1XA 5K0UC 2VH9A 3SCGA 1NCRA 4LO5B 2RMU3 4D3WA 1UO9A 4KBZA 1REFA 3NNJA 1V9U2 2ZX1A 4MGKE 4MXVA 2A6YA 1MS4A 3Q9OA 1HN0A 2ZBJA 4V1PA 5LEKA 2PFWA 1GZ9A 1S2KA 1ST8A 4IGPA 4MGSA 1RJ7A 2WJSA 2SBAA 2EIDA 2BDRA 3SEEA 5JIUA 3WEZA 3P3NA 5LA9A 5FMCA 5LA0A 4NR1A 1BJQA 2O1QA 5EJ1B 1W28A 2ZCWA 3JD72 4LO7A 3R6SA 3LEKA 4LE4A 4XC9A 1AJKA 4AQ2A 2ENRA 2F4PA 1ACCA 4ZY9A 2QBXA 4OI2A 2CYFA 4FBFA 1EV13 3POEA 4CDXA 3J7MA 4XF1A 4BJ0A 3ZSKA 5L36A 1UYYA 3WG1A 4N43B 1O91A 5FZLA 1PVC3 4RS5A 5KHKA 4FPFA 4XABA 5FYSA 2XVKA 2J1EA 4B8EA 2W1UA 4QQHA 4GB31 4MO3M 1AR93 2XB6C 1JTZX 1S0BA 2V4VA 3TAYA 3NV1A 1IS6A 4CPBD 3MDPA 3I2OA 2WWJA 3APBA 1MZ5A 2WQ8A 1QGLA 4BQ1A 2BP6A 1JOJA 4YFZA 4XJ9A 3PHMA 4P5YA 4IE4A 3ZKYA 2YDEA 1ULCA 3SITA 2BUKA 5CYYA 1AYN1 1HB4A 1PIV2 1XQNA 1B35C 2ZHMA 3DF0A 4JKLA 4E9KA 1O3QA 2JKXA 2GC2A 2VNVA 3S7IA 2R041 3ACHA 4N53A 4N7UA 1QWRA 2YUEA 2V5YA 4MGZE 1BEV2 5CNAA 2CNAA 4I0AA 5D8AB 2R063 2HWB3 3JCIA 3NQHA 4AFCA 1OQ1A 1UW8A 2DU0A 4GIQA 5FV3A 1DQ0A 2GMPA 2GN3A 3ZLIA 3KCCA 4AL9A 1EAH3 1AR72 1HW5A 5F7UA 2EA7A 5IVYA 4EV0A 3H1YA 5L19A 4ZZ8A 5FYCA 4P9IA 2E7QA 5FRAA 4RQPB 5JCTA 4Q4X3 4IEOA 5DG1A 1W8FA 1HN1A 3HBZA 4MADA 5FZFA 1REDA 1W8OA 1H1IA 2MEV1 3OGRA 4AF9A 1O5UA 2WYSA 4L99A 1KRIA 1SLLA 3S0MA 4YW3A 5F37A 4OFGA 5FYHA 1WBLA 2VMIA 2A3YA 2X29A 2CGNA 4XCAA 3AVRA 4YGDA 3T4HB 3AZYA 4Q0QA 1C8M2 1PK6C 2DWRA 5F5CA 5I0RA 2GP3A 2RR12 4FPEA 1VRH3 1MEC1 3PVNA 3VBUA 4DEVA 2EIEA 2UWBA 2WNVB 2G1MA 2OQ7A 5F8PA 4I3PA 4LBQA 5FY0A 3HWJA 4A42A 2EVXA 2NMNA 5CIRA 5F2WA 5CG9A 4QPIB 3FBYA 2D3PA 3HN1A 2VVFA 3HQUA 4BK4A 1IG0A 2GP5A 4YVWA 2A7AA 4YG0A 4MZUA 2LUWA 2BNOA 2D40A 4ONUA 3I2FA 1YC61 5LASA 3EB7A 1W0NA 3K75B 4JZRA 2G19A 5J98B 3TNPB 4BLJA 1GQHA 4HETA 4EROA 2WFF3 2ES3A 3WDTA 3ZMOA 4XCBA 4JDNA 1R093 3LIHA 3DL3A 4Q0UA 1UU6A 3C7HA 1Z0HA 4M3CA 2HWD2 4OUMA 1AR62 1KXGA 1CAXB 3LA3A 5A7PA 2A6VA 4BISA 1RUOA 3UK9A 1GZWA 1OQDA 2YBKA 3I2DA 4I02A 4Q4W2 3WP3A 4AGRA 4CP2A 1CVNA 3ACGA 4XJZA 4E4HA 3V0BA 1S0IA 2LM3A 2XBO1 5FQ0B 5FUNA 4HBNA 1HQNA 3I59B 2CAUA 1ZRFA 2JWPA 1GQGA 4LT5A 2NZ9A 3AB0A 1UY1A 5DAQA 1NE6A 3QOPA 3M8LA 5E6HA 1YI9A 1S0EA 1VBC2 3CQOA 2JDUA 1DZQA 2VCBA 3PL0A 3EQEA 1OVPA 1SDDB 3POSA 4GMP1 4K3UA 4WVMA 2D6NA 3I2GA 4CPBA 1YYNA 2ZZJA 4L0PA 4PI0A 5LW9A 1LODA 2GDFA 1W6QA 1ZZ8A 2J1RA 3WP5A 3AJZA 2ADDA 4AEDA 2ZEYA 4NE9A 3SISA 1DGRA 2A5ZA 2NQYA 4PHZA 3UJQA 4CP9A 1OQEA 3WLUA 3I7DA 3PUSA 4FT8A 1CAWB 4TZDA 3ZXDA 4AWDA 2R49A 1UYZA 2ZGKA 1UMHA 2BJSA 4L11A 3VDCA 1KFXL 5FTTC 4XFIA 4QU2A 3WHUA 4MYEA 3PMEA 2IXCA 3AC0A 1U5ZA 2VVDA 3B01A 4KQ7A 4Y5Z0 4H3WA 1UX7A 1W9WA 2C26A 3J8F3 4HLTA 3X29B 3O0XA 3I3QA 4WVVA 4A6OA 3ES1A 4IETA 1LB2A 2R16A 1YJLA 1W2UA 1BKZA 3VBOB 4CEYC 5J37A 3ZFFB 4XJUA 5C8CC 5IVBA 1ULDA 5JDBA 1MQTA 1UZ0A 2ARAA 1ND2A 3ILRA 5HCFA 2OXBA 5BNOB 2BZDA 4CCCA 2EAAA 2LTNA 2P5BA 3U4XA 2ERFA 5FP3A 3BIWE 1PMJX 2AENA 4OVEA 2PELA 4MXWA 1LRHA 4P5HA 3ILFA 4QGMA 5EP9A 3AP9A 1G6NA 2R1BA 5JOXA 5A32B 5JOZA 2HWE3 5M0TA 3WQ0A 1F31A 1UIJA 2JICA 4Q27A 2X53S 3EBRA 5F3CA 2ZX3A 2Z42A 4QDSA 5FYBA 2J7MA 1RMU1 1Q3EA 2O0OA 1PX3A 4UFKA 3IPVA 4EN0A 3FLPA 1GU3A 5H9PA 1V9U1 3U78A 3VD9A 3LB9A 4PT6A 1JYCA 3LDBA 1RUH2 3AL5A 3AMMA 3AP7A 3IWZA 3T0DA 2D43A 1YCIA 2WNUA 1KDKA 3JB8A 2YC0A 5C7GA 4YG6A 3W9AA 3CHXA 1D4M2 1WCQA 1VLNA 1Q8QA 4XAEA 3NW4A 3VDDA 4P9XA 1DHKB 2RVAA 2W46A 2FCTA 4RL7A 1AL23 3LA2A 4IL7A 3UGFA 1CZTA 1SCRA 3M7AA 2I74A 2HWF3 3C7FA 4LOSA 4A7KA 2HYKA 2WO2A 4RHV2 1A78A 3TRSB 2XWBB 4ZXKA 1NA1C 1RC6A 5LATA 1OUXA 2JD9A 3POIA 3DGTA 3WXPA 4RR3B 3ZSLA 1N3OA 4IV3A 3O7OA 3FFZA 3LSEA 1J59A 3WV6A 5FYTA 4ISRA 5FIXA 2VOKA 1QQP1 3CZUA 3ZN5A 1YFXA 4JTOA 4L2NA 2J1TA 4MLOA 5BNPC 5IVFA 3U0ZA 3C7GA 5A33B 2HJIA 1R1A2 2I07B 1MS8A 2XQRA 3U10A 5AFBA 1YWKA 1UD1A 4XIOA 5JVVA 4HKOA 1W3XA 3SHRA 4FPCA 2WINB 1QJZA 3WOGA 3N7KA 3SH5A 3UGHA 1MR5A 4FPOB 1YQ6A 2AEYA 1ASJ2 1W8HA 1RVF1 5F39A 3T08A 4AI0A 1ENXA 4EWEA 1NE4A 1QJU3 1K5MC 3JQXA 2LROA 2RS53 4GZ9A 4Q4V1 2XUEA 5KHHA 2Q8DA 1XNTA 2GC1A 2JDYA 3KCXA 1AYM1 3OYWB 4SBVA 4MGTA 5FXVA 5A3MA 1RUE1 4DXSA 4XBQA 3AMPA 1VALA 3I54A 2PQQA 2RS12 2BVVA 5FPLA 1Y43B 4JKMA 2W68A 2VC9A 1OKQA 3FZ3A 4LORA 5CFCB 4QDRA 5C9AB 4XZUG 4DRRA 3ABZA 3NSTA 4EN8B 2ZEXA 4SLIA 1GP5A 1J58A 2F6BA 1W3VA 4IEYA 2QQNA 3D4KA 3ZXGA 4DMIA 2GNDA 2J1AA 3A4UA 4U36A 4QT6A 3PUQA 1AX0A 4NIHA 4KU7A 2CHHA 2JG9C 5A7WA 3ZYGA 2WAOA 5JWPA 1VAVA 5FCCA 3LEIA 3NMBA 3RVHA 2VMFA 2WL1A 3ETQA 2P4EA 4E8DA 3M1HA 4WV8A 1MS0A 3POGA 3AMNA 3E97A 1JZ2A 3CIHA 4CZSA 3UL2A 2F17A 4M01A 4AFDA 4FPYA 1BK1A 2TBVA 5CKNA 2E7AA 2IVJA 3D3AA 5C3RA 4CUAA 5KXEA 2H0VA 5BY5A 2QJVA 2DU1A 3KWVA 4X6QB 1QJX2 2O14A 4YSFA 2FDFA 2ID4A 3GJBA 2BGPA 4QX8A 4DUVA 4CDQC 1PO12 5JMOA 2Q5TA 5EWSA 1QJY3 3P3PA 4J1WA 3C3VA 5FJHA 2RG4A 1LKNA 1RUI2 2CSGA 3E6DA 3RYKA 3T2PA 2VBBA 1QDOA 2P37A 1PZ9A 4P00B 4RQPA 5LBCA 5FPZA 3IDCB 3KQ4B 4YM2A 1VMHA 2CGPA 1F5FA 4UFIA 4E2QA 2DCJA 2SLIA 2NN8A 1UYXA 3BPZA 3LD8A 5DAVA 3DPRB 3OPTA 4AXOA 5FZ9A 4ZHNA 2LS6A 4DINB 2D97A 3JXSA 2WNVA 1F9KA 4RN5A 3NV3A 3OBRA 5JZGB 2RS31 5KHGA 3GHNA 3MYXA 2DCZA 1LEDA 4OI0A 4GH4B 4CXWA 4COVA 2OS2A 3N36A 2Y8KA 2Q1FA 3A0KA 4OZOA 1O5LA 2MNGA 3PUAA 4L8QA 3KV9A 2B4KA 1CX4A 4OHZA 1RINA 2HBUA 3K48A 1COV3 1UQXA 2DVFA 1TVGA 1GNYA 3HNBM 3JUUA 5J1XA 1H0BA 3NJVA 1E5SA 4D69A 5F3GA 1NCRB 1V0AA 3WP4A 5JXIA 4FQ4A 5FUIA 5KBFA 2DURA 1FPN3 5L7OB 4ZPIA 1CAXA 5BV6A 2UURA 1S0FA 3L2HA 4LBLA 1SG3A 5FZ7A 3N9PA 4AVAA 2XHKA 5LK7B 5FLHA 4URAA 1H2NA 1A3KA 4CP1A 3Q8BA 2B9VA 3UNPA 2DVBA 4QX2A 5CEHA 5GKAC 2WO3A 3K77A 5I0SA 4E2GA 1HX6A 2ZPXA 4JC1A 1O3SA 2R32A 4A41A 5FZIA 1VJ2A 1PO23 1RHI1 2VUJA 3ZYBA 3RI9A 5BNNA 2P3IA 2WFF1 1QJFA 1YIPA 3BTAA 1XE0A 4XHXA 4Z92B 3NJXA 1VBB3 4F8AA 1F5JA 1PGW1 2DTWA 4QQ2A 3MV11 4KI5M 1S1AA 4RS5B 5FXWA 4CDWC 4LITA 3SKJE 3GM8A 3U75A 1KJRA 2P6HA 1WD4A 5GLZA 3ATGA 1CAWA 4WBBA 4Y1VA 2P34A 2B45X 3HOBA 1GOHA 1URXA 1YQ8A 4UWDA 3J4UH 3RYRA 5A3UA 3WDXA 1UU5A 3HNYM 1UY0A 3WDWA 5KC6A 2GMMA 4N53B 5C4WC 2IXHA 4YG3A 4CE8A 2XOMA 5FY7A 1ND3C 4ZU7A 2JDKA 4UFLA 4YW4A 5J09A 4BYYA 4YARA 1XBFA 3ZFFA 3LPGA 5FZAA 1ZVFA 5JR2A 3RMXA 1LHVA 3DEMA 3CNAA 1HRI1 2OPKA 1ZX5A 2VOVA 1L7RA 2JE9A 4IEUA 4HZFA 4NJ4A 4B7EA 4IEWA 1HLCA 5T5OA 4BQ4A 3FFQA 4M3CF 3BB6A 4AGVA 1HXS1 3SKVA 5A1FA 1DIWA 1TME1 2XLAA 1UL9A 3NAPA 4CU6A 4WZFA 4RHV1 4F3JA 1KQRA 1YRZA 3SEPA 4L9BA 2DFCA 2JENA 1UYPA 1JZ8A 4GB32 1XYPA 2F4LA 4KWJA 1POQA 1E5IA 2VTXJ 4ASKA 3MGUA 3K46A 3W58A 3J8F1 3JZVA 5GZDA 3RGBA 1NCQC 2PHXA 4LBKA 4MOAA 5F6KA 4MX3A 3Q8EA 1DQ5A 3N9NA 2A6ZA 2ZGLA 5GALA 3RI8A 2R042 1JYIA 2FHRA 2IXIA 1H30A 1S0JA 2ZGTA 1UOJA 1X9TA 3S5AA 2XJPA 4JDMA 2Q0AA 2RM23 3RJ2X 2RDSA 2QFEA 1RUG3 2QQKA 2Y0IA 3VBFC 1ZBE2 2EIBA 1PK6A 4PDWC 4PIYA 5E8AA 3TOJA 4JGZC 2MHFA 1JW6A 3RZLA 2V4AA 2QQLA 5BNQA 4LIVA 2D6PA 4M3CB 5FPXA 4QM8A 1W0OA 4A7ZA 5FXZA 1HV1A 2WFPA 4HONA 4N90A 1C8NA 5FZ1A 3W5NA 1GZWB 4FPHA 2VZTA 4GULA 5FOJB 1L7QA 1IS5A 3EHKA 1VBA3 3HNMA 1LHWA 3KT4A 2G9GA 2J1VA 1D7PM 1POV1 3H8UA 5FZEA 3V0BB 1QOTA 4D0QA 3O1MA 1MEC2 3VUOA 1RUF3 5I8YA 2ZGPA 3E5QA 5JOYA 2WS93 1OOPC 3B69A 3BVCA 4XHBA 3SQOA 2R071 4Q0PA 5A33A 4HXCA 5HBAA 5KHJA 5JXHA 4P14A 4LTAA 1OA2A 5LEJA 2IXKA 1GZTA 3I3MA 1AXZA 2CU5A 2CWMA 4Y1YA 2DDUA 1RTVA 2E7TA 1KJLA 4MGQA 3T09A 1WCUA 1ZRRA 3H3LA 3R4DB 1XYOA 4WVMB 3ST7A 2W9XA 3WZ1A 5FZ8A 2IZWA 3T2TA 1W6QB 5LA1A 2KXLA 4EN6B 4MG2A 3N9QA 5E16A 2XH6A 4AEDB 1J3QA 4XFFA 2ZJCA 5JPNB 1F4HA 2VVEA 4KH9A 1D2SA 4K7JA 2I2SA 2YZ4A 4XDOA 1N3QA 1QMJA 4M4PA 4PBOA 3DCQA 1HV0A 1Q43A 4IGOA 5KXDA 3ZYHA 1M4WA 3IB3A 3VBRC 1RIRA 1N1TA 2BFUL 2C0ZA 5C9AA 1CIWA 3D8CA 1OLMA 2QQUA 2ZZQA 4Q4Y3 1WZXA 3OTFA 4WM7C 2B46X 3IMMA 4N43C 4X6RB 4OQ8A 1PMHX 5APAA 1DDLA 1HDKA 4CP0A 2W08A 1NYWA 1SCSA 4KWLA 2JE7A 1F35A 3NNGA 4CTEA 4MVTA 5A7QA 4BZ4A 3KD4A 4NHLA 4ZKTB 1CR7A 4JCKA 3RYPA 1JYNA 1Z7S3 1RUJ1 2XUMA 2PAKA 1ND2B 5A3PA 5DQ0A 3FMGA 4IQPA 1UXZA 3TYJA 1R1ZA 5FLJA 3PIGA 2UYBA 3MLKA 4S2GA 3ZYIB 4MXWB 5FPBA 1RUNA 4M4RA 1IS4A 1CPMA 5A80A 4L97A 1MACA 1ONAA 3I3EA 3M2MA 4LULA 5LBBA 3KLSA 3K4ZA 5CU1A 4YVSC 1IG3A 4ISQA 3PVEA 3MIHA 3WQ1A 1HJGA 5D8AC 2DCKA 2JDHA 4UBHA 3THTA 3ELNA 5C8CA 2A6WA 2JB4A 3ZN6B 3K3NA 2ZGRA 1EP0A 1VAKA 4BHPA 2GSYA 3F2ZA 3IPVB 3MBWA 3RRDA 5FWEA 1GP4A 1E57A 4XF9A 3NVCA 5FAXA 4XURA 2E53A 2XDVA 3ZO0B 1H9PA 4UYBA 1U5XA 3AMQA 1XJAA 3LSDA 4NVPA 2VJXA 4XVHA 4ZS3A 4AEKA 2WNUB 2YB7A 1BVP1 1PNFA 3JD73 4HKWA 1ZRCA 4AI8A 2D98A 2KR2A 4FXKB 1QJEA 5FZHA 4RA0A 3VDDB 3HD8B 1ZA4A 1JZ4A 2WAAA 4QX7A 1NLRA 3RWKX 5KC5A 5ERLA 3ZXFA 3TEZA 3R4SA 4QD2A 4HG6B 4JQRA 4CEWA 4AK3A 1UZWA 1CZSA 4XBNA 4QPIC 3FUQA 3H3ZA 4GH4A 3R05A 4O65A 1WA6X 5C5TA 3O5SA 3UKVA 1HB2A 1LGCA 2BPA2 5IW0A 5BYNA 3I97A 4IV3B 3O1RA 5JI9A 1YQ5A 3ZFEB 1H1MA 3GZTB 1RMU2 2ZHKA 3P1IA 4XMAA 3D5OA 1YQCA 4UW4A 3AVSA 1DYPA 2VE1A 3FC0A 3THCA 3IAQA 3LFMA 4OI4A 1OI6A 2WO1A 4O61A 1PIV3 3WW4A 1XNAA 2IWGB 4M00A 5L7OA 2VTXA 1S0CA 1D0GA 1OLME 2ZHNA 3JBG1 1QKQA 1NLQA 2W0XA 4S2HA 4PJYA 1NA1A 1BEV3 1OXCA 4IV1B 4ZZ5A 4V2WA 3PUHA 3E1F1 1EUTA 1KEXA 1WMDA 3AP4A 2HEYF 5FZ0A 1VR3A 2N7GA 1AR73 3BU7A 2BVBA 3GHMA 3VZJA 4YRDA 2WUHA 4GAZA 4QPGC 4ASLA 1JH5A 3AZZA 5CB7A 4B4QA 3CBNA 2A3WA 1VBD3 5F2SA 1R081 5FFOC 3ZSMA 1FMD3 2OIIA 1RUD2 3SC7X 3W59A 4Z2AA 4LO8A 1W2OA 4K1ZA 4NPRA 3LDKA 1GWMA 4UI9L 1W39A 4AVCA 1UPSA 2QQIA 4RSUA 4FCAA 2VG9A 4A3XA 3USUA 3LA7A 1F4AA 5FOBB 2ZGOA 3N7JA 1C8M3 2FQPA 2YPJA 4IGQA 4BE3A 1BMV2 2PAMA 2RR13 3M3QA 4FOQA 1QQP2 1OSGA 1JBCA 2FMYA 4OZXA 5FPVA 3USSA 3VKLA 3AZXA 1X50A 4A2UA 4D7TA 1GR3A 4XEZA 5A7WB 4Q26A 1UNBA 3WG4A 3GF6A 4NN0A 4UOJA 3WX5A 3VL9A 5IK8A 4E8CA 3U07A 4F83A 3KGLA 1RVF2 1UY2A 1YUDA 3EYPA 5LB6A 3VBHA 4AHWA 3BI3A 3MIDA 4Q4V2 3H3UA 3HT2A 1JUIA 1X8EA 2JG8A 4Y4RA 1AYM2 3OGJA 1YI7A 1WW5A 4LIUA 1RUE2 3VBOC 1FOD1 4IEZA 2D5HA 2VZQA 1AR63 2HWD3 1ZBE1 1JI6A 3D0SA 2E31A 3UGGA 3AXDA 2YPDA 1A6CA 4OI1A 5BNOC 1RJ8A 2WT2A 1DGLA 4KG8A 3FHQA 4GKYA 3ZFGB 4Q4W3 3POYA 5L9RA 2RMU2 1XC6A 3GXUA 3WG2A 4BXSV 1U5YA 4Y22B 1A8MA 4P08A 5FBZA 1IQAA 5F1RA 2B42B 1OLRA 1BK0A 4Q1PA 3VHPA 1MS3A 1AX2A 1C3HA 2WLPA 4LKEA 4Q1RA 3BUCA 1N47A 5ACA1 1GP6A 5H9QA 5CKQA 2WZR1 4FPGA 5I91A 1NXMA 2QQVA 1VBC3 3GZEA 5KXBA 1K42A 5BXXA 2JB8A 3MW4A 3OGGA 4BQ3A 4HSJA 3SH4A 1MS9A 2WR9A 2BNMA 3I49A 2DTYA 3MIGA 3VZMA 3A0NA 1Y3TA 4Y33A 5JAXA 4FTSA 4LQRA 3AM2A 4NRQA 3AYCA 4GMP0 3O1SA 2BV4A 2W94A 4D94A 2HBTA 2VECA 5FLIA 2OA2A 2XPJA 1FAYA 2QNKA 4UT5A 4OHYA 4Q0SA 3N3HA 5JSOA 3MFAA 1D0HA 2W1QA 3DYPA 1GWLA 3ALQA 2L9LA 3WF3A 3ZXAC 1GUIA 5CFDA 5CADA 3RSJA 3CL1A 1S2BA 3TN91 1APNA 4KMQA 3SCHA 1NY71 2XWJB 2JDPA 1GSLA 4LK7A 4RR3C 2RJLA 5DUWA 4H7LA 5C6CA 3KV4A 2VMHA 4JGYC 4LKFA 4YGBA 1TMF1 1CPNA 1GOGA 1W03A 2P1BA 3BALA 4I0WB 1XNKA 3J7LA 4H2AA 4RFT0 4JAAA 4NIIA 4CDUC 4CUCA 1OA3A 3N9OA 3BTZA 2HWB2 2RS32 4A44A 2GNTA 4HL0A 4QHBA 5J3UA 2VOWA 1EAH2 4DY3A 4FFGA 2ZGQA 2ZGMA 2XXZA 2DCYA 5BNNB 2HH9A 2P3JA 1GKBA 3O1UA 3Q8CA 1YJKA 4YZ5A 4XFGA 3RZMA 2A6XA 2YV8A 1PM7A 4ATFA 4MGYE 2VGDA 2D6MA 2W47A 4NIGA 1EYBA 2H6CA 2XLGA 1O8PA 4NROA 2VCCA 4B4PA 1NX9A 2WZPP 4E27A 1SLBA 4CCEA 1MZ6A 2MPFA 3OF1A 2YROA 2A70A 4J6GA 3MIFA 2OPWA 1RUH3 3IZOA 1MZFA 1T6GC 2EXHA 5CFCC 2Y26A 3I2HA 2X8KA 4KWUA 1D4M3 2FDHA 1AVBA 4JRLA 3VD7A 3AKSA 5AC93 1LOFC 1ODNA 1WLWA 4YW5A 4F7ZA 1G9FA 1QIQA 2HWC3 1ULFA 2UYAA 4XTMA 2G9ZA 4WM8A 2FCVA 4HN0A 1LR5A 3K51A 1SFYA 4CU8A 4G9SB 1RHI2 3M3IA 2A1XA 4HK8A 4CCLA 2DV9A 1OVSA 3ME2A 4C90A 1WLCA 1Y9QA 5FY5A 1BYHA 1U5IA 1W2AX 1UOFA 2WFF2 5FK8A 4NIDA 5JR7B 2Y6GA 3NAPB 2XL9A 1PGW2 4NUBA 2YG0A 5DDJ1 1E5RA 5ANQA 3VZKA 4BCUA 1LAJA 1H8TC 3IDEA 3M70A 4QX0A 1K3IA 5AVAA 1FNZA 4QHZA 3M3OA 5IK4A 3KGZA 2A75A 1GBGA 4FVVA 4Q4Y1 5G04L 1R1A3 1V6OA 4IERA 4LBNA 2RDQA 4NWWA 2NM1A 2XONA 4EN7B 3Q8AA 3ZN6A 1H4HA 1VAMA 2WDBA 1L7LA 2V5DA 4M3CE 1LOBA 4PQ9A 2XVGA 1JN2P 2ZKNA 3C7EA 5IYYA 1G9DA 1O8SA 2QQMA 3VKNA 5DUXA 3N4MA 1ASJ3 4TXWA 1HQWA 4OUSA 1VMJA 1C1LA 2A3XA 5C71A 4EWAA 2W52A 2VQ0A 2UY9A 2Y6JA 3KV6A 2R30A 4LHKA 3MPPG 3HT1A 1BBT1 1WWYA 2VY0A 1RB8G 5IJRA 4QMAA 1HRI2 2IXLA 3DPRC 1YXWA 2CGOA 1CIYA 3G6JB 1VBE1 2LRPA 3N7MA 2RS13 1PK6B 5FO7B 3MICA 1UWWA 5J96B 2VNRA 1HXS2 3KS7A 1NCQA 1TME2 1IPKA 1HB3A 3NV2A 2AGSA 5FYUA 1O4YA 5B4XA 5FO8B 5JZGC 5A3OA 1WW6A 4BIOA 3PMSA 3GCXA 3KV5A 2DYCA 4QXCA 4UFHA 4ARYA 2DUPA 2EXJA 1ENSA 2VZ3A 1RUD1 1DGWX 1V6IA 2K2SA 5K9YA 3WNKA 1IOAA 1UKGA 1CN1A 3AP5A 5EFUA 4JRAA 2GNMA 3I3BA 2YY1A 3ZFEA 1G9AA 3WNNA 2PLV1 4QU1A 3QH7A 4AW7A 3J8F2 2Q8CA 2OW4A 3BODA 4PDWA 1YHFA 2OKXA 3VN4A 3LKJA 3URFA 3VZOA 2QTWB 4P02B 2YXSA 2OZ6A 1NCRC 2IFWA 4NWVA 1RUC1 5K4LA 3WD5A 2OYZA 1ZNPA 4LO6B 1U0AA 4LLOA 1FI2A 4S2FA 5FKCA 4A3ZA 5JLVA 1XU2A 3T4VA 4ES8A 2D7FA 4LUMA 4IV1A 2Q4SA 5J7MA 5ISLA 1QJX3 2VCAA 5FPAA 5D1IA 1W06A 1US3A 1CESA 3EXUA 3P6BA 2FD8A 1PO13 2IFRA 1GZCA 4X8PA 4CCJA 4CYDA 1G86A 1PGSA 4D7YA 1ULGA 1RUI3 4BOWA 5FZBA 4RGAA 1XPWA 5GJ6A 2AACA 4ZU4A 3DECA 4XACA 3EJKA 4DRVA 3MLJA 1HRV1 4BQXA 4BU2A 1OKOA 2Y34A 3K4AA 1W05A 2VXJA 3W5MA 1ZBA3 2VW2A 3KF5A 1UZYA 3GALA 4CDXC 2VUDA 4QKDA 3H9AA 4D8MA 4OQ9A 3RZJA 1DCSA 4FP2A 2RMU1 5LBFA 2ZMKA 3AX4A 5IVJA 4D6RA 4ZONA 4EN9B 1XRUA 2YFZA 2ZEWA 1G9CA 4RS5C 1SHWB 2G9FA 3T30A 4M0HA 3T3YA 1UY3A 3ZXLA 1TNRA 1DQ4A 2Q8EA 3POWA 2R072 4RD7A 5A7NA 4DUXA 1I1EA 1B09A 2O8OA 4CCKA 4UAPA 4ASMB 3BCWA 2V72A 3N9MA 1XNBA 3GJAA 3HN3A 3CO2A 1KD7A 5FP9A 3ZPYA 3VBRA 4E4SA 5F3EA 3O1TA 5A6YA 4QKNA 3PVOA 4AR2A 1BCXA 1GV9A 3GBFA 2VW0A 2D6KA 1CAUA 5T3NA 5IUQA 4RGGA 2JDZA 5FP7A 4CVUA 4N53C 3SXWA 4UF0A 1YFYA 1MVQA 4S2DA 1EV11 2Z79A 3EO6A 4AEJA 4QAWA 3O1OA 2W91A 4CEYB 1UN1A 1J3PA 5FY4A 1NZIA 5LA2A 3NO8A 3S7EA 1PVC1 4ARXA 1OFSA 4E2SA 3MUY1 5FBJA 3NJZA 4LUKA 3TWIA 5IFPA 5CKMA 2FDJA 3U37A 1W8NA 5HV4A 4I0BA 3ZFGA 4HMZA 3J7NA 4Z82A 2X5IA 5LK5A 1W9FA 2P2KA 1AR91 2JD4A 4R9BA 1Q5OA 3HQXA 4LBMA 4Y22A 4NAOA 2NPIA 1SBFA 5C70A 1OC1A 4V2VA 1AZDA 3T0BA 3ON7A 1YLLA 3V65A 2K9ZA 4FFHA 4AFAA 1RUJ2 2ARXA 1X82A 4HN1A 3CLPA 4BDVB 1QJU2 5LRRA 4DIQA 2CTVA 4NAMA 5GLUA 4BWOA 2AYHA 4OMDA 4GA9A 3VBUC 1LECA 1PX4A 4IW3A 5DUVA 5GLTA 3WNPA 2PHWA 3RZKA 4XUPA 4CCDA 2C5DA 2R061 3PNAA 2HWB1 4CEWB 3O14A 2VM9A 2V09A 1D4VB 1VB2A 4FPKA 1SLIA 1EAH1 4M0NA 5A3LA 4XZPA 5FZMA 3NNFA 3VBSA 4YVWC 4XDQA 2XJUA 3LCPA 4ORFA 3ACLA 4A4AA 4Q4X1 3U1XA 4DO0A 2VBPA 3ILNA 5CVRA 1CAVB 1DF0A 1JU4A 2EALA 1RITA 3BN6A 4GQ7A 4OLLA 4R9CA 2W87A 3FE5A 4P9GA 3HQRA 4YZ3A 1PGL1 3IT8A 2BGOA 2ZOEB 5DMYA 5HV0A 3N35A 4FP3A 3UJOA 2G4IA 2QCSB 1V6JA 2TUNA 2PN5A 2VZ1A 1IPJA 1S2EA 3OEAA 1VRH1 5F5IA 4D6SA 1NA1B 1ULEA 2Y6FA 3UESA 3D0JA 4AVBA 2Y64A 4AHYA 1FT9A 5ABJA 4W65A 1Y7BA 4LKSA 1IS3A 4PLNA 2JDNA 2PHFA 3S30A 2VD7A 3WDYA 1SBDA 4Y3OA 3THDA 3WVJA 3IM0A 4AI3A 5HXVA 1CONA 4KWKA 2J1UA 5K0UA 3OPZA 1HB1A 2FZ1A 2PHTA 1HJFA 2WSUA 4XETA 1LTEA 1JOBA 1ZZ9A 1ZA7A 1H8VA 2B8MA 2QQJA 2VTFA 3DUIA 1J84A 2YFUA 4PCRA 4UW5A 4DY5A 3J9SA 3ZKUA 4XE9A 5HCBA 4GB33 2BU9A 4GJYA 4OCTA 1ENQA 4XILA 3LOBA 1R091 2D3SA 5LY2A 3L2YA 3T2OA 3VD3A 3OD4A 3ENRA 4KL1A 3USUB 3V56A 4EZ4A 4CCOA 4AQTA 4GWNA 3LEGA 1YO8A 5T5JA 4AEDC 2XMLA 1AYN3 1PMIA 1ZRIA 1IZ3A 4BXFA 2R043 1PZ8A 4XQWA 1LESA 2QQWA 4B3NA 3JBG2 4E4DX 1GYKA 2ZMNA 1AX1A 3MHZA 3DXUA 2VMDA 1H1AA 1C28A 3QBQA 1NUKA 4QM9A 3VBHB 1W6NB 4AOCA 3WY6A 3B94A 3GZAA 4XMIA 1JS9A 1GANA 2JG8B 1ZZCA 4XFAA 5LBEA 1R082 2IVIB 3E5XA 4OMCA 2JG9B 1BHGA 5DAWA 3GZUC 1SFPA 1XXNA 2MEV3 1KGYA 4LHLA 1MQTC 3MPBA 1ND2C 3RWNA 4TWTA 3BU0A 4IESA 1B35A 4LOTA 4DXZA 5FZOB 1JXNA 1XNCA 1SMVA 2GN7A 4XOGA 3KVAA 4G4FA 2QDRA 3ZOIA 3SH3A 5FK7A 4IEXA 3WQBA 3GGLA 4HPKB 4JQTA 1MEC3 3ZYPA 4FOYA 4CA9A 1SACA 3NNMA 2QZ2A 2ORZA 4QX1A 3LE0A 3W20A 3P5BA 4Q29A 1MS1A 1MZEA 4CDQB 4CRQA 4AVTA 1AR83 3POFA 1POV0 4IE0A 2XLFA 3QD6A 1N3PA 4IDZA 4NHXA 1GMMA 5EYXA 4DS0A 4HANA 4AYUA 4A7YA 1WW4A 1C4RA 3IN9A 3OY8A 3OEBA 2ZABA 4Y1UA 1J1LA 2VOXA 3IBMA 4YGEA 1JYWA 3MIEA 1IKPA 1FOD2 2X09A 3UKTA 2WNUC 2PMWB 2E51A 2GC3A 2XVLA 5BPXA 2JDAA 4CU7A 1D2QA 3WSOA 3VDDC 2W1SA 5F6LB 1W0PA 2HWE1 4Q8LA 5FZ4A 2WN2A 4FAGA 1M06G 4OHWA 5HCAA 3LWCA 2XJRA 4QXBA 4W6YA 4PF5A 5IVVA 3TB0A 4H14A 1WD3A 4AQ6A 2XKPA 2Y6LA 4YPJA 5CFDB 1WCKA 2XBO3 4KBBA 5C8WA 2VR4A 3CJIC 4AVSA 4HT1T 3ZVXA 1XB9A 5ACA2 3AZVA 1QXRA 3IDAA 4IV3C 2PTMA 2WZR2 4TLFA 1TE1B 2D5FA 3RJRA 4B4RA 5FMOS 2YU1A 2WKKA 2JDMA 3WUCA 4GMP3 4TYSA 3SCFA 3DYMA 1O4TA 2QVSB 2UWCA 3I2KA 1OH4A 5T50A 1G9BA 3HJRA 3T1MA 1W99A 4XXAA 3H7YA 3NJYA 1KS4A 4BK5A 2BTVC 4JDOA 4COWA 2IC1A 2GH2A 1YFWA 1AL21 2VZSA 4XJ8A 5FR3A 5T55A 2ATFA 2GALA 1WW7A 1I3HA 3B9CA 5TSWA 2HWF1 5EJ3A 4BIFA 2QQOA 3KMHA 4YW1A 3THPA 4C91A 1UMIA 4I09A 4Z2WA 1Y9MA 2ZX4A 5JXJA 3R4UA 3O0WA 3ETPA 3D82A 4W6XA 3GBWA 5I0UA 1OA4A 1DLLA 1BQPA 1XE7A 3TN92 3RMYA 1DQ6A 5GLVA 2BBAA 1NY72 1A8DA 2AUYA 4COUA 3MUZ1 3H0OA 3I2JA
chains in the Genus database with same CATH topology
2UU8A 2UWAA 1DU3D 4CDWB 1TMF2 4R4ZA 4AVVA 3NKGA 1KFUL 1WMFA 2RM22 2AREA 4WM8B 2ZGSA 1RUG2 3WDVA 1QJU1 4BA6A 2ETEA 4BMEA 2RS51 3MZHA 1PHMA 1AXKA 4KGQA 4I01A 2BW8A 3VZNA 1FX5A 3IIAA 3WCRA 2WNEA 5C4WB 1RMU3 2I45A 1ZYBA 2RHPA 1QF3A 1ND3B 1UU4A 4QQOA 2D6LX 4CEYA 3FX3A 5L73A 1V00A 2GU9A 1V9U3 4FSJA 1VBA2 4IEVA 4DQAA 2BNNA 4XTPA 1NQJA 3RZZA 3WINE 2ZX2A 4HVRA 3VZLA 1SLTA 3B00A 3NWKA 1LCLA 2WS92 1WMEA 2A73B 1LOCA 1UMZA 1UIKA 4RQPC 2BGCA 2R0FA 2H0BA 4K1YA 1TNFA 2VQAA 5AVPA 2BQPA 4INDA 5EV7A 1NXD1 2NMOA 2XJQA 5I8SA 2CAVA 3B02A 2WNVC 1NCQB 1KS5A 4KG0A 5JPMB 3L9JT 3AXEA 4Q2FA 5DDJ2 2QE3A 3ZIXA 4WVWA 4X8NA 3VKMA 1G7YA 4N7IA 1DQ1A 1QJY1 1ZZBA 1EPZA 1QQP3 1REEA 3AFGA 2ZHLA 4Q4Y2 3CU7A 1JHNA 1LHNA 3VBFB 1CAVA 3FBMA 4PDWB 1W6MA 3HR9A 4W6WA 3RG0A 4UW6A 4FOWA 1QHDA 4XFBA 4XYXA 1Q8VA 1RVF3 4NOTA 4FPJA 4Q4V3 3I4IA 4G3YC 2DUOA 2JEMA 2XJTA 3FWEA 1AYM3 1BBT2 4AI1A 1QXPA 1RUE3 3TBDA 1VBE2 2JKBA 4K21A 4LBQD 4COZA 1NZCA 2B7YA 4Y4YA 1W6PB 5BNPA 1OOPB 4FOVA 5GZEA 1LHUA 2ZGNA 3QH6A 5IK5A 4P9LA 1COV1 5T52A 4P9WA 5JOWA 4K6BA 5BNNC 2TEPA 1LULA 2Q30A 2OVUA 1PZ7A 4C1XA 2PLV2 4UXAA 1FPN1 1K5MA 2XG3A 3ZIWA 1HIXA 2CV6A 3BOPA 3AZWA 4Y24A 2D3RA 1BVVA 1RUC2 3DV8A 5JIAA 4YM0A 2NLRA 3AFKA 3VBRB 2ZKLA 4ITCA 5JMCA 2EF6A 3HMYA 4ATEA 4WM7B 1CAUB 1J1TA 1W6NA 3WHTA 1VIWB 1PO21 1YFUA 3ZYRA 4H7MA 3OD0A 3ZFFC 1VBB1 3OJBA 1HRV2 2JG9A 1AJOA 3RPQA 3AKQA 1QXJA 3OBTA 2B39A 2AR6A 1S0DA 2X5IB 3NAPC 1DQ2A 1QH7A 4D7SA 4HPKA 5T5LA 4PBPA 3LAGA 3V0AB 4LEJA 3JQWA 4K9SA 4YVSB 3RDIA 2XJVA 2QUOA 3SNMA 2RS33 4Y1ZA 4CDQA 2EAKA 5K7PA 2DCTA 2P3KA 2YHJA 3LGRA 1H2KA 1VBD2 1QOSA 1EV12 1FMD2 3GNEA 3VBSB 2OUJA 3JB4C 3RS6A 1LEMA 2Q1ZB 2VNGA 3DKWA 1IKQA 3AKTA 1GLHA 3IMNA 1PVC2 2JECA 4LA2A 1Q8SA 1HQLA 1AR92 1G8WA 2P17A 4XJWA 2Z2SB 1ZZ6A 1SEFA 3ROUA 1KITA 1AR81 3CJXA 2RE9A 4OHXA 4OHVA 1LU2A 3VHRA 5ABJB 1SDWA 2RJKA 3KB5A 4BMBA 1O3TA 3CEWA 4GWMA 1RHI3 4QQPA 1ZZ7A 3ZXJA 5K0UB 1CQ9A 1BXHA 4FXGB 2R062 2XKOA 2RM21 2QQPA 1X36A 1RUG1 1WA4A 2PA7A 3S6PA 4COYA 3NL1A 4TSVA 4XXPA 3J26N 3B9IA 1OD5A 3OCPA 4QGNA 1H2LA 2GNBA 4Q4X2 4IEQA 3ZYJB 2DVDA 3AYAA 4MUVA 1QOOA 1PGL2 1DZTA 4QPGB 1CD3G 3JU9A 2PHLA 5EYYA 4AG4A 5AFEA 2ZS6B 4DNYA 1OLQA 1W6OA 1VBA1 2Y38A 4GALA 3T1LA 4NO4A 1VRH2 5T5PA 3IKWA 1RUF1 1X8MA 1FV3A 1V6KA 2WS91 5C9AC 5EXOA 2VUAA 3H7JA 5FREA 3SMHA 1HRI3 3H1WA 4H55A 2Z5WA 4CDWA 3O12A 1YIFA 5K8SA 1SQ4A 1HXS3 4XFCA 1TME3 2R6QA 1C5HA 1QY4A 4RHV3 2D44A 4LO4B 3KCYA 4MSVA 1B35B 2D93A 1R092 5CA6A 4AI2A 3CF6E 1ENRA 4YLZA 5E88A 2WSVA 5C4WA 2ZACA 1H9WA 1I6XA 4QQLA 4Y26A 1ND3A 4R4XA 4EJRA 4YM3A 4DZGA 3NV4A 4C0HA 4YNIA 2C1FA 3MFCA 3VL8A 1S0GA 2VPVA 4BLIA 2ZTNA 1IGOA 4XW3A 2DVGA 4LE3A 4FQZA 4I30A 1VB4A 2BYVE 4LA3A 4DB5A 4MH0E 1NLSA 1Z7S1 4K8FA 3OY8B 2DF7A 5EZWA 1NG0A 1WUVA 2WIIB 1OMIA 1TQ5A 1DGRN 5I93A 4JVAA 2NYYA 3M4FA 1I5ZA 3ES4A 4K20A 5E89A 2DFBA 4DOUA 4CEWC 2CWSA 3H50A 4FPLA 1POV3 2KM2A 4IEPA 2YGMA 4GH4C 5SV8A 4GKXA 4XFHA 2PHRA 3WP6A 2R073 3UV9A 4YZ1A 2GH8A 3KT7A 3VBFA 3AMHA 4JGZA 1FXZA 1LGNA 3HAGA 1DYKA 5AC92 2V73A 3ZMNA 2HWC2 4Y20B 4Q8KA 3JD71 3ZX7A 1O7FA 1QDCA 5L7OC 3AKPA 1YNAA 4QPYA 1F2NA 1CGPA 1C5IA 3ZXKA 3CJIA 4C0BA 2QDNA 4AHXA 1SFNA 3ZN4A 3AK0A 3AYEA 2HWE2 4JGYB 4YW2A 1W6PA 1OOPA 4JV4A 4CDUB 4WZCA 2ILMA 2WC2A 4Z07A 4YGCA 2VNOA 1WGPA 3RQ0A 1PNGA 1PIV1 4YYOA 3WW1A 4P9JA 1RUJ3 4K40A 2WT0A 1BEV1 1SBEA 2OUHA 3C2UA 5BUVA 1UZZA 2UY8A 3MW3A 1AR71 2LALA 3ASIA 4WM7A 1AL22 4N43A 3G7DA 1XU1A 3GBGA 1V70A 4KGGA 1VBD1 3VBHC 2HWF2 5DZFA 3ZDSA 4UW3A 1ZREA 1FMD1 2WLQA 2KA3A 2VW1A 3B3QE 4XF4A 2JG8C 1AXYA 4R9AA 3AYDA 4PIXA 4MV2A 3WNXA 1SLAA 1KDMA 4FAHA 2PAEA 1C8M1 1QU0A 4AE2A 2RR11 1EY2A 1C57A 5JI7A 2GAUA 3AP6A 4HKLA 2DVAA 3V0AA 1H8TB 3WCSA 2AH2A 4YVSA 2A71A 1J3RA 4DPNA 5D8AA 4NHKA 2BBVA 3ZSJA 2RS52 2ARBA 3R0RA 1UPIA 4PIZA 1AR61 2HWD1 2R1DA 2XL7A 1LENA 2YMZA 1ZBA2 1DZRA 3SLIA 1GNZA 3HIFA 4HVOA 4Q4W1 4AGGA 1OPOA 5DZGA 1UKRA 3DN7A 2QKDA 2WQ4A 3JBG3 5J36A 1W6MB 2ZA9A 4JTNA 4XQDA 4EWDA 4XJAA 1Z78A 2R0HA 4AHZA 5CBLA 4QPIA 4ZU5A 1ALYA 5CFDC 1NQDA 1Q8OA 4QX5A 1VBC1 3KZ4C 3WUDA 2BWCA 3O0VA 2HKXA 5GLWA 1UX6A 1R083 3FLTA 1LHOA 5GZGA 2XJSA 4PLMA 3WQ7A 5BNPB 1I9RA 3VHNA 3VHOA 3LZZA 2ET7A 1LOEA 1TEIA 3I8TA 3TNQA 2HEVF 1QJY2 3KQRA 5DG2A 5FO9B 3M3CA 3FLRA 2JX9A 3VV1A 1K5MB 4LNVA 1MS5A 4YZ4A 5FQ0A 4UBGA 2VMGA 4QPGA 2ZX0A 3I59A 3RNSA 3KT1A 5HI0A 1LOAA 2HEWF 1FV2A 1F8VA 1BZWA 4C1WA 2E63A 3MEPA 4CDXB 1X33A 1FOD3 5CAZA 1QNWA 1GFF2 4R8HA 4LR4A 1ZBE3 4LLFA 4BPZA 5CG8A 2VU9A 3AJYA 3N7LA 4ES9A 4FO9A 2VULA 3E6BA 1ZRDA 1VP6A 4XBLA 5KXCA 2FMDA 2WA4A 3KSCA 2JJ6A 4AFMA 2TNFA 3ECQA 4WM8C 1COV2 3H1MA 3V64A 1N1YA 3GYDA 2PYTA 1LOGA 3MF6A 1FNYA 1QNYA 1WLTA 1RL3A 2QZ3A 5GM0A 5ACA3 1FPN2 5I0TA 2WZR3 4MGIE 1WBFA 1RUH1 2EXIA 3VBOA 2ZGUA 4B7KA 1D4M1 4O9GA 5BNOA 4LBOA 3B7MA 4E4ZA 5AC91 2XGXA 3PLQA 4PLOA 2HWC1 4LBJA 4O9EA 3NKTA 2E9QA 1PO22 3QACA 5JSPA 5A32A 4I2OA 2B9UA 1UAIA 1VBB2 2NP0A 2YYOA 4FTEA 5GZFA 1RGSA 1LJ7A 5C33A 4LHNA 3TN93 3ZXEA 3VBUB 1AF9A 1AYN2 1X7NA 2ZAAA 4BH9A 2D6OX 4LBQB 3MF9A 1R1A1 4XQ4A 1DBNA 1SLCA 4BM8A 1TMF3 2DUQA 1O3RA 3VLBB 3VGIA 4Z8BA 4YVWB 1IHMA 5IK7A 2VXRA 1ASJ1 3ZFEC 1V6NA 1UF2C 3MIBA 1V6MA 1OPMA 4Z1VA 4Q0VA 2ET1A 4Y20A 1Q8PA 1UCXA 3WW2A 4N9IA 5FMOL 4XPVA 5KHIA 3MI8A 2WWSA 3PTYA 2RS11 5T54A 2MEV2 4R9DA 4IV1C 4N9HA 4B29A 4QGLA 4RR3A 4YFWA 1XNDA 4OULA 4FTBA 2EIGA 4JGYA 4KU8A 2GC0A 3QCWA 3KM5A 4CDUA 5B2GB 5SV5A 5F9TA 1V6LA 4AFBA 3B93A 1W6OB 1AHSA 4HVQA 4IXLA 1BMV1 1AR82 4YM1A 3IDBB 1O4ZA 1Q56A 3D6EA 3WDUA 3LOIA 4NHMA 1U12A 3U11A 1C1FA 2AZ5A 2Y0OA 3OYWA 2BFUS 1QJX1 1AL0G 5DDJ3 2EXKA 1LGBA 5I8TA 5H9RA 1PO11 1WLDA 4DFSA 3ZSEA 5CFCA 1RUI1 3FHIB 3VKFC 2C9AA 3E5UA 1XE8A 4P9YA 5J48A 4AQSA 2YGLA 4KNCA 2ZMLA 1ZBA1 2XBO2 1LOFA 1N1VA 2GMEA 5GZCA 4AEMA 4YZ2A 1HKDA 3AKRA 3VKOA 4HK9A 1GICA 1ZM1A 1FATA 4U2AA 5H9SA 1CJDA 1WCSA 5FDBA 5E1RA 1MQTB 1RUF2 3FUOA 2W39A 1BBT3 2GZWA 3ZFGC 3BOWA 1H2MA 2X5IC 1LU1A 1AUYA 1QH6A 3WR0A 1VBE3 5DUUA 1H8TA 2JXAA 2WA3A 1PVXA 4XF3A 4I3GA 2O8QA 2OZJA 4XF0A 1MVEA 1L3JA 1NOVA 1GNHA 2WT1A 1RUD3 2ZAHA 2FBEA 3M3EA 4Y1XA 5LRSA 2IXJA 3MLLA 4WVZA 2BWAA 2H6BA 3PVBB 1OFNA 2PLV3 3UKNA 3FJSA 4QXKA 3WW3A 5DXDA 4XIKA 1DFQA 1EPWA 3VBSC 3PJQA 1RUC3 3DPRA 2BEOA 1CJPA 4META 4URTA 4JGZB 4HSLA 1DGWA 5F5QA 3E6CC 1DG6A 4GXLA 1FYUA 5JZGA 2B5HA 1WCDJ 2CY6A 2PHDA 5DZEA 1Z7S2 1OHFA 1XYNA 2E6VA 4R52A 2WQZC 3INAA 5KWRA 5IT6A 1N1SA 2Q1MA 3WG3A 1JUHA 2Q8OA 3WX5A 3CJIB 5JSRA 2PHUA 1S55A 3MW2A 4HFSA 2Z69A 2K0GA 3PJYA 5ABJC 3QLQA 1HRV3 3B5LB 4L92A 2CL2A 1H4GA 3WT3A 4J1XA 5K0UC 2VH9A 3SCGA 1NCRA 4LO5B 2RMU3 4D3WA 1REFA 1V9U2 2ZX1A 4MGKE 4MXVA 2A6YA 1MS4A 3Q9OA 5LEKA 2ZBJA 4V1PA 2PFWA 1GZ9A 1S2KA 1RJ7A 2WJSA 2SBAA 5JIUA 3P3NA 4NR1A 1BJQA 2O1QA 2ZCWA 3JD72 4LO7A 3R6SA 4AQ2A 4LE4A 1AJKA 2ENRA 2F4PA 4OI2A 2CYFA 4FBFA 1EV13 4CDXA 4XF1A 5L36A 3ZSKA 3WG1A 4N43B 1O91A 1PVC3 4RS5A 5KHKA 4FPFA 2XVKA 4B8EA 4QQHA 4GB31 1AR93 2XB6C 1JTZX 1S0BA 3TAYA 3NV1A 1IS6A 3MDPA 3APBA 4BQ1A 1MZ5A 4YFZA 1QGLA 1JOJA 4XJ9A 3PHMA 2YDEA 1ULCA 3SITA 2BUKA 1AYN1 1PIV2 1XQNA 3DF0A 1B35C 2ZHMA 4E9KA 1O3QA 2GC2A 3S7IA 2R041 4N53A 4N7UA 1QWRA 2YUEA 2V5YA 4MGZE 1BEV2 5CNAA 2CNAA 4I0AA 5D8AB 2R063 2HWB3 3JCIA 4AFCA 1OQ1A 1UW8A 2DU0A 4GIQA 2FZ2A 1DQ0A 2GMPA 2GN3A 3KCCA 1EAH3 1AR72 1HW5A 2EA7A 4EV0A 3H1YA 5L19A 4P9IA 2E7QA 5FRAA 4RQPB 5JCTA 4Q4X3 4IEOA 5DG1A 3HBZA 1REDA 1H1IA 2MEV1 4AF9A 1KRIA 1O5UA 4L99A 1SLLA 3S0MA 4YW3A 4OFGA 1WBLA 2VMIA 2A3YA 2X29A 2CGNA 4YGDA 3AZYA 4Q0QA 1C8M2 1PK6C 2DWRA 5I0RA 2RR12 4FPEA 1VRH3 1MEC1 3PVNA 3VBUA 2WNVB 2UWBA 4I3PA 4LBQA 3HWJA 2EVXA 2NMNA 5CIRA 5CG9A 4QPIB 3FBYA 2D3PA 3HN1A 2VVFA 4YVWA 2A7AA 4YG0A 4MZUA 2LUWA 2BNOA 2D40A 4ONUA 5J98B 3TNPB 4BLJA 1GQHA 4HETA 4EROA 2WFF3 2ES3A 3WDTA 3ZMOA 4JDNA 1R093 3DL3A 4Q0UA 1UU6A 1Z0HA 4M3CA 2HWD2 4OUMA 1AR62 1KXGA 1CAXB 3LA3A 2A6VA 1RUOA 3UK9A 1GZWA 1OQDA 3I2DA 4I02A 4Q4W2 3WP3A 4AGRA 4CP2A 5FPXA 1CVNA 4XJZA 3V0BA 1S0IA 2LM3A 2XBO1 5FQ0B 4HBNA 1HQNA 3I59B 2CAUA 1GQGA 4LT5A 2NZ9A 3AB0A 1NE6A 3QOPA 3M8LA 1YI9A 1S0EA 1VBC2 4GMP1 1DZQA 3EQEA 3POSA 4WVMA 4K3UA 2D6NA 1YYNA 2ZZJA 1LODA 2GDFA 1W6QA 1ZZ8A 3WP5A 3AJZA 4AEDA 3SISA 1DGRA 2A5ZA 2NQYA 3UJQA 1OQEA 3WLUA 3I7DA 4TZDA 4FT8A 1CAWB 3ZXDA 4AWDA 2R49A 2ZGKA 4L11A 1KFXL 5FTTC 4XFIA 4QU2A 3WHUA 4MYEA 3PMEA 2IXCA 1U5ZA 2VVDA 3B01A 4KQ7A 4Y5Z0 4H3WA 4HLTA 3J8F3 3X29B 3O0XA 4WVVA 3ES1A 4IETA 1LB2A 2R16A 1YJLA 1W2UA 1BKZA 3VBOB 4CEYC 5J37A 3ZFFB 4XJUA 5C8CC 1ULDA 5JDBA 1MQTA 3ILRA 5HCFA 1ND2A 5BNOB 2EAAA 2LTNA 3U4XA 2ERFA 3BIWE 2AENA 4QGMA 4OVEA 2PELA 4MXWA 1LRHA 4P5HA 3ILFA 5JOXA 3AP9A 1G6NA 2R1BA 5A32B 5JOZA 2HWE3 3WQ0A 1F31A 1UIJA 2JICA 4Q27A 2X53S 3EBRA 2ZX3A 2Z42A 1RMU1 1Q3EA 2O0OA 3IPVA 4EN0A 3FLPA 5H9PA 1V9U1 3LB9A 1JYCA 1RUH2 3AMMA 3AP7A 3IWZA 2D43A 1YCIA 2WNUA 1KDKA 3JB8A 2YC0A 4YG6A 3W9AA 1D4M2 1VLNA 1Q8QA 3VDDA 3NW4A 4P9XA 1DHKB 4RL7A 1AL23 3LA2A 4IL7A 1SCRA 3M7AA 2I74A 2HWF3 4A7KA 2HYKA 4RHV2 1A78A 3TRSB 2XWBB 4ZXKA 1NA1C 1RC6A 3DGTA 3WXPA 4RR3B 3ZSLA 1N3OA 4IV3A 3O7OA 3FFZA 3LSEA 1J59A 3WV6A 4ISRA 2VOKA 1QQP1 3ZN5A 1YFXA 4JTOA 4L2NA 4MLOA 5BNPC 3U0ZA 5A33B 2HJIA 1R1A2 2I07B 1MS8A 3U10A 5AFBA 1YWKA 1UD1A 4XIOA 5JVVA 4HKOA 3SHRA 4FPCA 2WINB 1QJZA 3WOGA 3N7KA 3SH5A 1MR5A 4FPOB 1ASJ2 4AI0A 1RVF1 4EWEA 1ENXA 1NE4A 1QJU3 1K5MC 3JQXA 2RS53 4Q4V1 5KHHA 2GC1A 3KCXA 1AYM1 3OYWB 4SBVA 5A3MA 1RUE1 4XBQA 3AMPA 1VALA 3I54A 2PQQA 2RS12 2BVVA 1Y43B 2W68A 5CFCB 1OKQA 3FZ3A 5C9AB 4DRRA 3NSTA 4EN8B 4SLIA 1J58A 2F6BA 4IEYA 3D4KA 3ZXGA 4DMIA 2GNDA 3A4UA 4U36A 4QT6A 1AX0A 4KU7A 3ZYGA 2JG9C 5JWPA 1VAVA 5FCCA 1BMV2 2WL1A 3ETQA 3M1HA 4WV8A 1MS0A 3AMNA 3E97A 4CZSA 3UL2A 4M01A 4AFDA 4FPYA 1BK1A 2TBVA 2E7AA 5KXEA 2H0VA 5BY5A 2QJVA 2DU1A 4X6QB 1QJX2 4YSFA 4CDQC 1PO12 2Q5TA 5EWSA 1QJY3 3P3PA 4J1WA 3C3VA 1LKNA 1RUI2 3RYKA 3E6DA 1QDOA 2P37A 1PZ9A 4RQPA 5FPZA 3IDCB 4YM2A 2CGPA 1F5FA 4E2QA 2DCJA 2SLIA 2NN8A 3BPZA 3DPRB 4AXOA 4DINB 2D97A 2WNVA 1F9KA 3NV3A 3OBRA 5JZGB 2RS31 5KHGA 3GHNA 3MYXA 2DCZA 1LEDA 4OI0A 4GH4B 4COVA 3N36A 3A0KA 1O5LA 2MNGA 4L8QA 1CX4A 4OHZA 1RINA 3K48A 1COV3 2DVFA 3JUUA 1H0BA 4D69A 1NCRB 3WP4A 4FQ4A 5KBFA 2DURA 1FPN3 5L7OB 1CAXA 5BV6A 2UURA 1S0FA 3L2HA 4LBLA 4AVAA 2XHKA 5LK7B 5FLHA 1H2NA 1A3KA 4CP1A 2DVBA 5GKAC 5I0SA 4E2GA 1HX6A 2ZPXA 4JC1A 1O3SA 2R32A 1VJ2A 1PO23 1RHI1 2VUJA 3RI9A 5BNNA 2P3IA 2WFF1 3BTAA 1YIPA 4XHXA 4Z92B 1VBB3 4F8AA 1F5JA 1PGW1 2DTWA 4QQ2A 1S1AA 4RS5B 4CDWC 1KJRA 1WD4A 5GLZA 3ATGA 1CAWA 4WBBA 4Y1VA 2P34A 2B45X 1URXA 3J4UH 3RYRA 3WDXA 1UU5A 5KC6A 3WDWA 2GMMA 4N53B 5C4WC 2IXHA 4YG3A 1ND3C 4ZU7A 4YW4A 5J09A 4BYYA 4YARA 3ZFFA 1ZVFA 3RMXA 1LHVA 3CNAA 1HRI1 2OPKA 1ZX5A 2VOVA 2JE9A 4IEUA 4HZFA 4B7EA 4IEWA 1HLCA 5T5OA 3FFQA 4M3CF 3BB6A 4AGVA 1HXS1 1DIWA 1TME1 2XLAA 1UL9A 3NAPA 4WZFA 4RHV1 4F3JA 1KQRA 1YRZA 4L9BA 2DFCA 2JENA 4GB32 1XYPA 4KWJA 3MGUA 3W58A 3J8F1 3JZVA 5GZDA 1NCQC 2PHXA 4LBKA 5F6KA 4MX3A 1DQ5A 2A6ZA 2ZGLA 5GALA 3RI8A 2R042 1JYIA 2FHRA 2IXIA 1H30A 1S0JA 2ZGTA 2XJPA 4JDMA 2Q0AA 2RM23 3RJ2X 2QFEA 1RUG3 2Y0IA 3VBFC 1ZBE2 1PK6A 4PDWC 4PIYA 5E8AA 3TOJA 4JGZC 2MHFA 1JW6A 5BNQA 2D6PA 4M3CB 4QM8A 1W0OA 4A7ZA 1HV1A 2WFPA 4N90A 1C8NA 1GZWB 4FPHA 4GULA 5FOJB 1IS5A 3EHKA 1VBA3 1LHWA 3KT4A 2G9GA 3V0BB 1POV1 3H8UA 1QOTA 1MEC2 3VUOA 1RUF3 5I8YA 2ZGPA 3E5QA 5JOYA 2WS93 1OOPC 3B69A 4XHBA 5HBAA 2R071 4Q0PA 5A33A 5KHJA 4P14A 4LTAA 1OA2A 5LEJA 2IXKA 1AXZA 2CWMA 4Y1YA 1RTVA 2E7TA 1KJLA 1ZRRA 3R4DB 1XYOA 4WVMB 3ST7A 3WZ1A 2IZWA 3T2TA 1W6QB 2KXLA 4EN6B 5E16A 2XH6A 4AEDB 1J3QA 4XFFA 2ZJCA 5JPNB 2VVEA 4KH9A 1D2SA 4K7JA 2I2SA 2YZ4A 1N3QA 1QMJA 4PBOA 1HV0A 1Q43A 5KXDA 1M4WA 3VBRC 1RIRA 1N1TA 2BFUL 2C0ZA 5C9AA 1CIWA 3D8CA 2ZZQA 4Q4Y3 3OTFA 4WM7C 2B46X 4N43C 4X6RB 1DDLA 1HDKA 4CP0A 2W08A 1NYWA 1SCSA 4KWLA 2JE7A 4CTEA 4MVTA 4BZ4A 3KD4A 4NHLA 4ZKTB 1CR7A 4JCKA 3RYPA 1Z7S3 1RUJ1 2XUMA 2PAKA 1ND2B 3FMGA 4IQPA 3TYJA 1R1ZA 5FLJA 4S2GA 2UYBA 3MLKA 3ZYIB 4MXWB 1RUNA 1IS4A 1CPMA 4L97A 1MACA 1ONAA 3M2MA 4LULA 3KLSA 5CU1A 4YVSC 4ISQA 3PVEA 3MIHA 3WQ1A 5D8AC 2DCKA 4UBHA 3THTA 3ELNA 5C8CA 2A6WA 3ZN6B 2ZGRA 1EP0A 1VAKA 4BHPA 2GSYA 3IPVB 3RRDA 1E57A 4XF9A 3NVCA 5FAXA 2E53A 3ZO0B 1H9PA 1U5XA 3AMQA 4NVPA 3LSDA 4AEKA 2WNUB 1BVP1 1PNFA 3JD73 4HKWA 1ZRCA 4AI8A 2D98A 4FXKB 4RA0A 3VDDB 3HD8B 1ZA4A 1NLRA 5KC5A 3ZXFA 3R4SA 4QD2A 4JQRA 4CEWA 4AK3A 4XBNA 4QPIC 3FUQA 3H3ZA 4GH4A 3R05A 3O5SA 3UKVA 1LGCA 2BPA2 5BYNA 4IV3B 5JI9A 3ZFEB 1H1MA 3GZTB 1RMU2 2ZHKA 4XMAA 3D5OA 4UW4A 1DYPA 3FC0A 4OI4A 1OI6A 3WW4A 1PIV3 2IWGB 4M00A 5L7OA 1S0CA 1D0GA 2ZHNA 3JBG1 1QKQA 2W0XA 4S2HA 4PJYA 1NA1A 1BEV3 4IV1B 1M06G 3AP4A 1WMDA 2HEYF 1VR3A 2N7GA 1AR73 3BU7A 2BVBA 3GHMA 3VZJA 4YRDA 4QPGC 4ASLA 1JH5A 3AZZA 5CB7A 4B4QA 2A3WA 1VBD3 1R081 5FFOC 3ZSMA 1FMD3 2OIIA 1RUD2 3W59A 4LO8A 4NPRA 4K1ZA 4AVCA 1W39A 1UPSA 4RSUA 4FCAA 2VG9A 4A3XA 3USUA 3LA7A 5FOBB 2ZGOA 3N7JA 1C8M3 2FQPA 2YPJA 4BE3A 2PAMA 2RR13 3M3QA 4FOQA 1QQP2 1OSGA 1JBCA 2FMYA 4OZXA 3USSA 3VKLA 3AZXA 1X50A 4A2UA 4D7TA 1GR3A 4XEZA 4Q26A 3WG4A 3GF6A 4NN0A 3VL9A 5IK8A 3U07A 4F83A