2RM22

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2200
1RHI2 5BNNC 1NA1A 1PGW2 5L7OB 3JBG1 4CDQA 4QPIA 5D8AC 4JGYC 4CDWB 1MQTA 1VRH1 2WWSA 1HRI1 2ZTNA 2WS92 4CDXA 4CEYA 2RS33 4SBVA 3S6PA 4Z92B 5DDJ3 1ND2B 4RR3C 1AYM3 5DDJ2 5CFDC 1AYM2 1AR83 1FMD1 1AR82 5BNPC 2RR12 1DDLA 3CJIA 4FTEA 2X5IB 3JD73 4Q4W1 1AYN1 5ABJC 4Q4X1 3ZFFA 4NWVA 1MEC3 4GB33 1TME1 4GB32 1AR93 4PDWC 1AR92 1E57A 1K5MB 2BFUS 3J8F2 4RS5C 4CEWB 1QQP3 4RQPB 1HRV1 5K0UB 2R061 3JB8A 1QJZA 1BBT2 1FOD3 1EV13 1FOD2 1EV12 2RS11 1AL23 5JZGB 1ND3A 4RFT0 4QPGA 1AL22 2R071 1IHMA 5FMOL 4YVWC 5A32B 1RUI3 1RUI2 3DPRA 1PVC3 1FPN3 1PVC2 1FPN2 1VB2A 3JBG2 1X33A 1QJU1 1POV3 4YVSB 2RMU3 2RS31 5DDJ1 1VRH2 1B35B 1AR63 1AR62 2HWE3 5CFDB 2HWE2 1QJY1 2TBVA 4WM8A 4IV3B 3JD71 4IV1A 1MEC1 5ABJB 2X5IC 4GB31 1X36A 3CJIC 1AR91 1AYN3 4PDWB 1AYN2 1OHFA 4Q4X2 3JB4C 2RM23 1ASJ3 1TME3 2BFUL 2RM22 1K5MC 1QQP1 1TME2 1EAH3 1EAH2 5J96B 4CEWC 1PO21 5K0UC 1PO13 1Z7S1 1EV11 1HRV2 4JGZC 2R062 4CDUA 4N43A 1R1A1 2WZR3 5A33B 3VBOC 1NCQB 2RS13 2WZR2 5JZGC 3VBUB 2MEV3 2RS12 4YVWB 1RUI1 1NCRB 1V9U3 5AC91 2R073 1PVC1 2R072 3VBSB 1FPN1 1NA1B 5CFCA 1TMF3 4CDQB 1TMF2 4QPIB 3VBRC 5C9AA 1POV1 2RMU1 1MQTB 3NAPA 1AR61 4YVSC 2HWE1 5BNOA 2FZ1A 1B35C 1QJU3 1RUD3 2BBVA 1QJU2 4GH4A 4CDXB 2RS32 4CEYB 5L7OA 4AEDA 1QJY3 2R043 1AR73 1QJY2 4IV3C 4CDWA 2XPJA 2WLPA 4IV1C 4N53A 3CJIB 3JD72 4Q4V3 1RUH1 1R093 3ZFGA 1R092 1ASJ1 2RM21 1MEC2 3ZFFB 1H8TA 1ND2A 3FBMA 3VBHA 1EAH1 1OOPA 2HWD3 1PO11 2HWD2 1ZBE3 1ZBE2 1RUG3 1QQP2 1GFF2 2WFF3 1BMV2 1RUG2 5C8CA 1PO23 1PO22 1Z7S3 1Z7S2 1CJDA 4JGZB 1RUC3 2WZR1 1D4M1 2MEV1 1AUYA 3VBOB 3VDDA 1V9U1 1NCQC 1ND3B 3VBUC 4QPGB 1RUF1 1R1A3 4WM7A 1NCRC 1R1A2 4RQPA 1TMF1 3ZFEA 4Q4Y3 3VBSC 1PGL1 5AC93 1NA1C 5AC92 2XBO3 3VBRB 4CDQC 3DPRB 2XBO2 4QPIC 4EJRA 1MQTC 1RMU1 1RUD1 2RMU2 1C8M3 4FSJA 1C8M2 5BNNA 4CDXC 4CEYC 5ACA3 4GH4C 5A32A 1NOVA 2R041 1AR71 1AL0G 5D8AA 2BUKA 4GMP3 4JGYA 1HX6A 1VBA3 1C8NA 4WM8B 4Q4V1 4IV1B 1R091 4LLFA 4BCUA 1RVF3 1RVF2 3ZFFC 1M06G 2HWD1 1ZBA1 1RUH3 4RR3A 5CFDA 2VQ0A 1RUH2 1CD3G 1ZBE1 1ASJ2 1BMV1 1RUG1 2WFF1 3VBHC 5BNPA 3LOBA 2HWC3 1PO12 1RUJ1 1VBE3 1VBE2 1RUC1 4RHV1 4PDWA 3VBFA 1HXS3 4CDUB 4N43B 1VBD3 1D4M3 4Q4Y1 1ND3C 1D4M2 2MEV2 4QPGC 4RS5A 1COV3 1V9U2 2XBO1 3TN93 1RUF3 5C4WA 2DF7A 1RUF2 3ZFEC 2RS53 5CFCB 2HWB3 1POV0 1WCDJ 3DPRC 1PGL2 1VB4A 1QJX3 1C8M1 3NAPB 1SMVA 5A33A 1RMU3 1RUE3 2ZAHA 5BNOB 5ACA1 4YVWA 1RMU2 1RB8G 3ZXAC 1RUD2 5FMOS 1RHI3 4GH4B 4GMP1 1VBA1 3HAGA 4FTBA 1NY71 4AEDB 2IZWA 2R042 1AR72 4WM8C 4FTSA 1OPOA 1RVF1 1BEV3 1BEV2 4N53B 4Q4V2 2WS93 3ZFGB 1H8TB 1VBB3 1VBB2 3VBHB 1OOPB 1ZBA3 1VBC1 2HWC1 5LK7B 1ZBA2 1NG0A 1VBE1 2HWF3 2HWF2 2WFF2 2RR13 2X5IA 5C8CB 1HXS1 1RUJ3 1RUJ2 2Y26A 4RHV3 1RUC2 4RHV2 1VBD1 1F2NA 1R083 1R082 3VBFC 1COV1 1K5MA 4CDUC 4N43C 3VDDB 3TN91 1PIV3 3J8F3 1PIV2 4CEWA 5K0UA 1W39A 4WM7B 2RS51 2HWB1 4Q4Y2 3ZFEB 2GSYA 2PLV3 5C4WC 2PLV2 5CFCC 1BBT3 1QJX1 4JGZA 5C9AC 1RUE1 3M8LA 3VBOA 3NAPC 5JZGA 3IDEA 1RHI1 5FOJB 5BNOC 2BPA2 1PGW1 5BNNB 5ACA2 2ZZQA 5L7OC 3VBRA 5D8AB 4AEDC 1VBA2 4JGYB 4Y4YA 1BEV1 4CDWC 3JBG3 1NY72 2WS91 4YVSA 4N53C 1VBB1 1VRH3 1B35A 1HRI3 4Y5Z0 1AYM1 1HRI2 3ZFGC 1H8TC 2FZ2A 1HQNA 1AR81 4RR3B 2HWF1 1VAKA 1ND2C 1OOPC 2RR11 5BNPB 4IV3A 1F8VA 1VBC3 4NWWA 1VBC2 2HWC2 1FMD3 1FMD2 5ABJA 5C8CC 1R081 2GH8A 4Q4W3 2QQPA 4Q4W2 1A6CA 1HXS2 1PIV1 4Q4X3 3J8F1 5J98B 3VBFB 1VBD2 3VDDC 2PLV1 4RS5B 1COV2 4WM7C 1BBT1 4RQPC 3TN92 5C4WB 1FOD1 1HRV3 2RS52 2HWB2 5C9AB 5GKAC 2R063 1AL21 1QJX2 1NCQA 3VBUA 1RUE2 1NCRA 4GMP0 3VBSA
chains in the Genus database with same CATH superfamily
1RHI2 5BNNC 4E4HA 4AAPA 5LBEA 1RL3A 4XZPA 4OI1A 2BU9A 3VDAA 4LHKA 1HKDA 3JBG1 3SXWA 4FFFA 3IAQA 1QNYA 5A3MA 2ZMLA 3H0OA 3JXSA 3RRDA 4MXWB 2VNVA 1IG3A 2ZGLA 4JDOA 4JAAA 5FZMA 4B29A 1H4GA 1VRH1 4P5HA 4ASLA 3AP9A 4C1WA 2JE7A 3DKQA 3I49A 4D6RA 1YHFA 4JQTA 4ES9A 2DCYA 4NR1A 4MH0E 2BNNA 4NVPA 5JMOA 5EXOA 4IERA 4OLLA 5DG2A 2JDNA 4HL0A 1E5HA 4LT5A 3KQ4B 2PQQA 4DNYA 5CKQA 3KD4A 3O7OA 1D2QA 3H8OA 4J1WA 5BNPC 2PHFA 2NZ9A 4GWIA 5JVVA 4CCDA 5FDBA 4DRRA 4XHXA 3VN4A 5FZKA 1DQ0A 1C4RA 4FTEA 3FWEA 4YG3A 4Q4W1 2DFBA 1JI6A 3Q8CA 4K40A 5CADA 4LBQD 1GZ9A 3ZFFA 3ZLIA 3GJBA 1UU6A 2YU2A 4GB33 1TME1 2BQPA 2ZGMA 1FV2A 4GB32 2EIGA 2FCVA 4PDWC 4FPCA 5CIRA 2RDSA 3RZMA 4UW4A 2ET1A 1XQNA 5FYMA 1XNBA 1OSGA 4LNVA 4AE2A 2XQXA 4MVTA 4R4ZA 4CEWB 4BIOA 4FT8A 1UAIA 1W03A 2R30A 5IVFA 5LEJA 3OPZA 3DF0A 3N7JA 5FYTA 3JB8A 1IQAA 2Z79A 4QXHA 1R1ZA 1BBT2 3SEEA 1GBGA 1OH4A 2OQ7A 5DAWA 4LUMA 3RMXA 2KR2A 2RS11 4IEUA 4NIIA 4DQAA 5I8YA 1WD4A 2TUNA 5JZGB 2R071 3CLPA 1IHMA 2W95A 4FPKA 4YVWC 4AHYA 1WBFA 5CG9A 2D98A 2E26A 4IE6A 5A32B 1HJFA 2ZZJA 4QX0A 2P34A 1L3JA 3NW4A 3RZHA 2XJTA 2ZGNA 3T30A 3WDTA 2D97A 2LUWA 1YFXA 4FPOB 1A78A 2FQPA 5FYYA 3A23A 4BQ2A 1POV3 3WQ0A 3DUIA 3THDA 2CTVA 4XXPA 3NKGA 1HQLA 3NWKA 5A1LA 4P9IA 3IDAA 2XQRA 2G9FA 4XFBA 2D6PA 3CHXA 3RFRA 5T5PA 5GLVA 1J3PA 1AJOA 2KXLA 2XVKA 4MXVA 2X09A 5LA9A 5IFTA 2ATFA 4K8RB 4NPMA 2CGPA 1XNAA 4HKWA 2H6BA 1X36A 3KS7A 3V64A 1AR91 4K7JA 3I3EA 4H14A 4CE8A 2ORXA 3N7MA 2QCSB 3JB4C 4Q4X2 1ZRRA 2P6CA 3N9MA 4EN6B 2BFUL 3WG4A 1ZM1A 3AKSA 1QQP1 2QQWA 3BPSA 1MVEA 4OFGA 4Q5OA 4AF9A 2QTWB 1JYIA 1A34A 3OGRA 1PO21 4LBLA 4I0BA 3IIAA 2DV9A 3WNOA 2DDUA 4UF0B 4HZFA 4PLMA 4CXXA 1HRV2 2J1TA 4QX3A 3RQ0A 4N43A 1Q5OA 4XOGA 1V6OA 1MS9A 4ZONA 2LRPA 3VBUB 4QXKA 2VNGA 2NP0A 3UL2A 5F1RA 3P3NA 1RUI1 2PHUA 3O1UA 4QM9A 3TYJA 5LCWL 1H0BA 1VALA 1XXNA 4HPKB 4CCEA 1A8MA 1NA1B 2OA2A 4AVCA 2OIIA 1AX1A 2AACA 4Q1PA 4CDQB 4PLNA 4XTMA 3LZZA 3WOGA 1IKQA 1SFNA 2RMU1 3LDBA 3SKJE 5FMCA 4BPZA 5HCHA 5FZ7A 4BJ0A 1AR61 3TAYA 5I91A 2VNRA 4YVSC 3LCPA 1TE1B 2HWE1 2FZ1A 3ON7A 4Y5TA 4DXZA 3K3OA 3IMMA 5IVBA 3QCWA 3THCA 2YGMA 3I2IA 3MI8A 2KD7A 2D5HA 3Q8AA 4GH4A 4CDXB 2YPDA 3C2UA 4CEYB 5LA1A 5FZOA 1GKBA 1PMIA 1VR3A 2ZA9A 3O14A 3VZOA 2P2KA 3O1MA 4AEDA 4QWNA 2XVLA 5L19A 4PI2A 1TZOA 2VW1A 4YGBA 1W6NB 5H9PA 1SCSA 1APNA 3BN6A 5F6KA 4IV1C 2AREA 1REFA 3K51A 4N53A 5D1IA 3CJIB 3JD72 3VKOA 4LA2A 2Y33A 3WF1A 1FI2A 4PF1A 3LFMA 1MEC2 4IEQA 3BYWA 2UWAA 2WA4A 4HSLA 2WA3A 5FO7B 5FOBB 5FZ6A 5A7NA 5CZKA 4D3WA 3LAGA 3TEZA 1C3HA 3FUQA 2A5ZA 1PO11 3U11A 5C3QA 4LOSA 4UAPA 1YXWA 4YLZA 1U0AA 4OUSA 3DYPA 2JDPA 3A4UA 3H1YA 3SHRA 1QXRA 1JYVA 4QQPA 4Q0SA 5BPXA 1A8DA 3LQCA 4GKYA 4A41A 2WNVA 3DGTA 1U5YA 4HG6B 1JUHA 2B9VA 4QB2A 3FFZA 1FYUA 1WCKA 5EJ1B 1OD3A 5A7WB 3VBOB 3VDDA 1HB3A 5JSRA 5T55A 5I0TA 1DGRA 4QPGB 3KZ4C 3M3IA 3NJYA 4QPWA 1R1A3 4YM0A 3VZMA 5JOWA 1R1A2 1QY4A 2ZGTA 3OBRA 1PGL1 3CBNA 3OBAA 3OBZA 5FXXA 1WMXA 5DQ0A 1LJ7A 3E6BA 5FZDA 3MDPA 1G9AA 5CB7A 2V5YA 1CIWA 4LO8A 4QHOA 3ZXEA 3ZYFA 1H2MA 1RUD1 1N1SA 1YJLA 2X10A 3AZVA 3LKJA 4OI4A 3UV9A 1YQCA 5EJ3A 1LOFC 1G9DA 3D82A 1TNRA 4BA6A 3VHPA 1NT0A 2YC2A 1QNWA 5DAXA 3D4KA 3VZLA 3O1PA 5ACA3 5A32A 1NOVA 1AR71 2ZMNA 5HV4A 2CGNA 1AL0G 4HVOA 2D43A 4H2AA 5FZCA 5FV3A 1W6QA 4Z82A 2W1WA 4F8AA 1WW5A 1R091 5ERLA 1K42A 1EPWA 3I8TA 1Q8PA 4CPBA 2D6LX 1RVF3 1LHNA 1RVF2 4CU6A 1UO9A 5F3GA 3OJBA 3ZFFC 3ZMOA 2E51A 4RR3A 3RWKX 2VQ0A 2GMEA 2QQIA 4L2NA 4LBJA 2VECA 4IGQA 1ASJ2 4M01A 1V00A 2R32A 2BERA 5FZ1A 3WV6A 4KBBA 1DF0A 1UKGA 4KQ7A 3CL1A 2FMDA 3L2HA 5LK5A 5C3RA 1DQ4A 2F6BA 1ZZ9A 4GJZA 5DN2A 5L73A 3WW3A 4CCJA 3KT1A 1RUC1 5CKMA 1UW8A 3B3QE 2QQOA 4QD2A 5F3EA 1OQ1A 3ABZA 1YEWA 2VCAA 1NLRA 1X9PA 4O7XA 4CDUB 4GALA 2TNFA 4XFIA 1D4M3 3GNEA 2XLAA 3OUJA 1D4M2 4RS5A 2JDHA 3WR0A 4KGGA 4BQXA 3C7FA 3GF6A 3T3YA 1S0FA 4NE9A 5DAQA 5E88A 5C4WA 4CCLA 4UF0A 4LO6B 3FZ3A 5FR3A 2XLFA 1YO8A 3DEMA 5J7MA 5DAPA 1ZNPA 4AGRA 1WCDJ 3BKZA 3SEPA 5HXVA 1VB4A 2VU9A 1WCQA 3FLTA 5FZLA 1C8M1 4Y20B 1LHVA 3T2OA 4AYUA 2NLRA 3OYWA 3AZXA 1HB1A 1RMU3 3A0KA 1DG6A 5BNOB 1RMU2 3I2GA 3LIGA 4XTPA 2ZHNA 5FZIA 3GJAA 2XJSA 1WW6A 1X7NA 3MLJA 4GMP1 3U07A 2X29A 2QQVA 3HAGA 2WAAA 4EZHA 3OPTA 4I2OA 5FK7A 1N3OA 2RDQA 1AXYA 3PDQA 2R042 4FQ4A 5EFUA 5LA0A 2EAKA 4LBMA 4RL7A 5FIXA 3ZXGA 1BEV3 1BEV2 3E5XA 1SLAA 5DAVA 2WS93 4LPLA 3HPNA 1SDDB 3OPWA 5A6QA 3ENRA 2O0OA 5K9YA 2DCZA 1OOPB 2XG3A 5SV8A 3ACLA 5FY0A 5LK7B 3RZLA 1DZTA 5FYBA 3U75A 4FPLA 1CQ9A 2C24A 1W6NA 1JUIA 4CZSA 3HJRA 3UJQA 5HCFA 4PF5A 1AHSA 2X5IA 2BVVA 2K2SA 1UX6A 4YG0A 5T52A 2CYFA 4W6WA 3KF5A 3SH4A 5JPMB 1MACA 3M7AA 4QX2A 1CAUA 2Y26A 3HEIA 1VBD1 1JOJA 1W2TA 3DXTA 1R083 3H7YA 4CP9A 3TB0A 1R082 2A6XA 3VBFC 5I0RA 3B94A 4N43C 3HNMA 3TN91 1PIV3 1PIV2 3ATGA 2JECA 3W9AA 2VZTA 4BYYA 4S2HA 1LHWA 2RE9A 2W92A 3GCWA 2GSYA 3ZFEB 2GC3A 4LKEA 4YW1A 1QJX1 4P00B 4XVHA 4XFAA 1GQPA 3BTYA 4L11A 2ZGRA 1LHUA 3BIWE 1W9FA 2OUJA 4BM8A 1OLME 5CBLA 4PHZA 1CAXA 5A7WA 3VBOA 1LOGA 5GLWA 5JLVA 1ZRCA 1RHI1 2X8KA 1LOBA 3POGA 1H9PA 2B46X 2V72A 2W68A 3I2DA 4GKXA 4O65A 2IXHA 2E7QA 1QF3A 2B5HA 2IVIB 4FOYA 5JSOA 4CU9A 3QOPA 2E7TA 1DGLA 2ZZQA 5KC5A 1CX1A 2WBKA 3OSDA 4P9GA 2XGXA 2XWJB 4AWDA 3OGGA 4AEDC 1OPMA 1VBA2 3I2KA 4HSJA 5DZGA 4AFDA 1C5IA 5FY8A 5FZGA 1MS0A 1NY72 3HMYA 5LB6A 1SZBA 2FHRA 3WDVA 4AHWA 4N53C 2VMGA 2WINB 1UX7A 3OG2A 1B35A 1HRI3 3ACHA 1HRI2 4IDZA 3WCSA 2X05A 4E27A 4META 3C3VA 1GQHA 1VAKA 4QDQA 3N4MA 1UXZA 2VG9A 1W8OA 5LBCA 3S5AA 3AFKA 4BLIA 2ORZA 1J3RA 3T2PA 4EWDA 4IV3A 1C5HA 3U14A 1WKYA 1XJAA 1KITA 2Y64A 3LSEA 5LBBA 2HWC2 2A71A 2WWUA 2WQ4A 2RJ2A 2WLQA 5EHDA 2UWCA 3QD6A 5A3PA 5GZEA 1UYPA 3QBQA 3UETA 2G9GA 3ZX7A 4M3CA 3N9OA 3TNQA 5FBZA 5FUPA 5M0TA 3LWCA 1GYKA 2GH8A 5C71A 1DQ5A 2A3YA 3Q8FA 1A6CA 1HXS2 3ELNA 3M3QA 4D7TA 3KMHA 4ARYA 1LKNA 1T6GC 4OQ8A 2WZEA 1DQ1A 2WAOA 3AJZA 3VDDC 3C7GA 2ZJCA 3AK0A 3E5QA 1COV2 1OA4A 2HEWF 5JPNB 4HN1A 1BBT1 1DYOA 2EF6A 3JQXA 4FPHA 2IXCA 5LEKA 5FUIA 2PHXA 3UK9A 1PK6B 2WNEA 2XJPA 2RS52 1DYKA 2CWMA 3OOXA 5F5QA 1S1AA 4AOCA 2QQKA 2CGOA 5GKAC 4BQWA 4RN5A 1W8TA 2WN2A 3B93A 5A3TA 2QDRA 4E4SA 3BI3A 5T5LA 5A6YA 1NYWA 4PBOA 4W6YA 3VGIA 2WO1A 1Y4WA 3ACGA 4LBNA 4K1ZA 1J59A 1BLZA 5DZEA 3GZAA 1BVVA 2WR9A 1PGW2 1XU1A 5A3WA 3AMNA 4R9BA 2AH2A 2R7EB 4IETA 3ZXKA 2V5DA 1HDKA 1CIYA 4TN7A 1JU3A 4CDWB 5FO8B 3RJRA 1MQTA 2DVGA 4QXBA 3PUQA 2WWSA 1D0GA 5FQ0B 1Q56A 1NUKA 2DVFA 3OCPA 5APAA 1Y3TA 5IYYA 1JHJA 2ZTNA 5G04L 4IE4A 4E8CA 2RS33 4MO3M 4SBVA 2PHDA 5DDJ3 3KGZA 1TG7A 4RR3C 5DDJ2 3WZ1A 2EVXA 2QQMA 4GULA 1EP0A 1KXGA 3NVCA 2EICA 2VMEA 1AR83 1AR82 4A7ZA 2VW2A 3CQOA 3KHBA 2ZGPA 5CEHA 2VMIA 1HW5A 3IPVB 3RS6A 1PGSA 2WABA 2WL1A 1WLCA 2D7FA 2PN5A 3B9IA 3ECQA 3LSDA 4NHYA 1WLDA 4IEWA 2ZGQA 2VXRA 1OURA 4Q4X1 4XURA 4KI5M 3FJSA 3NO8A 4NWVA 3U0ZA 3VKFC 3POFA 5DABA 1YIFA 3ZR6A 1XOYA 3S30A 1PHMA 1K5MB 1RXGA 5E16A 1QJEA 5EV7A 5EZWA 3WXPA 1Y43B 4YW2A 4URTA 1H1IA 3ZYPA 3AMPA 4AFBA 1UIJA 1YI9A 3MFCA 4RS5C 3HN1A 5K0UB 4RQPB 1HRV1 2ARAA 2BYVE 2NYYA 3RNSA 4W50A 2JG8B 4G4FA 2VOXA 1J83A 1GWMA 1WWYA 2Y0IA 4R8HA 4M4PA 4YFWA 2DVAA 2X53S 4OHVA 2J1UA 4JTOA 1W6OB 4JKKA 1C28A 2JG9B 4FPEA 2JDKA 2PA7A 4RD7A 4BK4A 1AXZA 4LO4B 1ZZBA 5FAXA 1G9FA 5GALA 1ND3A 4MLOA 2A75A 5FMOL 4HETA 4QX1A 1W8HA 1YRZA 5F6LB 4LK6A 4BISA 3TOJA 4LIVA 3RI8A 4CP0A 5ISLA 3DPRA 1UU4A 4W6XA 5FYUA 1WZXA 1LGNA 3MW3A 3H3UA 2W47A 3BODA 2VD7A 4PQ9A 5JCTA 2W1UA 5LW9A 4Y3OA 3AVRA 3HIFA 3BOWA 1WLTA 5C7GA 4ZHNA 1N3PA 2CAUA 4B7EA 4GA9A 2BW8A 1GOHA 3GYDA 4E4ZA 1RYYA 4UFJA 4TXWA 1NAEA 3B7MA 3GALA 5CFDB 4IESA 4D94A 5FP3A 1JYTA 1N1YA 4YZ3A 4B4QA 2IXIA 1UZ0A 1NKGA 3R05A 5SV5A 4JHZA 2AGSA 1OFSA 3OD4A 4WM8A 5HI0A 3JD71 2BZDA 4AQSA 2Q4SA 4IV1A 4SLIA 4CVUA 2ID4A 1GMMA 3TBDA 1MEC1 5LBFA 4LKFA 2X5IC 2XHKA 1JZ2A 4AVAA 3KV9A 5DUWA 3CJIC 1WLWA 4NHLA 2VGDA 3TEXA 1ENXA 2VQUA 2WDBA 3AB0A 3CKHA 3MO4A 4L99A 1OHFA 1PNGA 5FPZA 3MUY1 3OTFA 3TRSB 3ILNA 3WF4A 2GNMA 3M1HA 2RM23 3USUA 2RM22 4GJYA 2VMDA 1POQA 1X8MA 2VZQA 3ZSJA 4AEKA 1MZ6A 4CCMA 2AEYA 1EV11 4OYUA 1OA2A 4AL9A 3PVOA 4N7UA 4DUWA 3AYCA 1GQGA 2ETEA 2R062 1UY2A 1UY1A 2OZ6A 4LO5B 5EP9A 4Y22A 1R1A1 2WZR3 3VBOC 1NCQB 2WNUB 2WZR2 5FXZA 3S7EA 4FPFA 2MEV3 3CF6E 4K20A 2P1BA 3NNFA 5A1FA 3AYDA 3PU3A 4GXLA 4YW6A 1NCRB 1V9U3 1UQXA 4JX0A 5FZEA 2CHHA 4NOTA 1PVC1 2JEMA 3VBSB 1FPN1 2W39A 2A3WA 3WUDA 5BY5A 1V0AA 4O9GA 1TMF3 3IN9A 3TNPB 1TMF2 4QPIB 3Q9OA 5I0SA 1UIKA 3IDCB 4LBQA 2J42A 3BTZA 1FT9A 5JSPA 2IWGB 1U12A 4LQRA 1I5ZA 1LOFA 1O3QA 2YFUA 1E5RA 5FJKA 3THTA 3ILRA 4RGAA 5F2SA 5FP8A 1B35C 2VBBA 4BDVB 2BBVA 4BB3A 1S0EA 2ZXQA 1CONA 2FDKA 2EXIA 1QXJA 1GP6A 4KWLA 3KSCA 5H9SA 4IW3A 4FAHA 2WNOA 1PZ7A 2XJUA 4BMBA 5F3CA 2W91A 2Z2SB 4IV3C 3HQXA 4CDWA 2CV6A 3K75B 2XPJA 2WLPA 4YW3A 5FQ0A 2BVBA 2VTXA 3VHOA 3WNMA 3DYOA 1HN0A 1Q8VA 1GR3A 1YUDA 4Q4V3 3KCCA 1W99A 1FXZA 3ZFGA 4W4ZA 1ASJ1 4L92A 3ROUA 1DCSA 3MIGA 1W6MA 4LJHA 5FRAA 2A1XA 4Q0UA 3MV01 4MUVA 3FBMA 2GP3A 1EAH1 1JHNA 1H2NA 2CWSA 2GU9A 3ZN6B 3BCWA 5DUXA 1ACCA 1W2OA 5GLUA 4WV8A 2D44A 2O8QA 3BB6A 1ZBE3 1ZBE2 4PLOA 2C9AA 4XE9A 2WFF3 4ZU5A 2FD8A 1BMV2 1DZRA 3EJKA 3IPVA 3PHMA 4FP2A 4MGKE 3WSOA 2W52A 5C8WA 4JTNA 3V0BA 5IVEA 4XJ8A 4YW4A 2JE8A 4EN9B 1W9YA 1FAYA 2BOIA 4FXKB 1CJDA 4JGZB 2HEVF 2YHJA 4LORA 4A6OA 1D4M1 5GZGA 2XUMA 1FNZA 4UFHA 4Y4RA 4DXRA 4E2GA 1DHKB 3POSA 4QGMA 2VZ1A 4YFZA 4RQPA 3O1TA 4Q4Y3 2F4LA 2ILMA 1MVQA 2VR4A 5AC93 5AC92 3I59A 3B00A 4QGLA 5JOXA 1CAWA 3MICA 5FO9B 2EXJA 3B9CA 5H9RA 2WRAA 4EJRA 3KCXA 3J7HA 5F39A 2KM2A 4YARA 2UURA 1MQTC 1RMU1 3MW2A 5A3LA 2ZHMA 4XQ4A 2Z42A 3NJVA 5FBJA 4MGTA 4FSJA 1UKRA 2CY6A 3M3CA 4BHPA 3DV8A 1YQ2A 5I0DA 2R6QA 1D2SA 5FMDA 2R041 5FWJA 3P1IA 4QQLA 5D8AA 1ULGA 1CZVA 1XNKA 4JGYA 3KWVA 4XFFA 1HX6A 3DL3A 4LHSA 4Y1ZA 4QX5A 3BTAA 4KGQA 2BGCA 1YIPA 3M3EA 3IZOA 2W9XA 1LODA 2BTVC 4XW3A 4XQWA 4BCUA 3WW1A 1BVP1 2R1BA 3PUIA 5LY1A 4NRQA 1Z0HA 2HWD1 1M06G 1SBDA 5CFDA 1CWPA 4I09A 1JTZX 5AVAA 1Z78A 3N7KA 3O1SA 1RUG1 4CRQA 2EAAA 5HCAA 5FZ3A 5C3PA 3RWNA 4OULA 4FP3A 4UOJA 3LDKA 4IXLA 2DCTA 5E89A 3LA3A 1XNTA 3AMQA 3DKWA 1CVNA 4A7YA 3LEMA 4D7YA 1JZ6A 4HBNA 2MNGA 4NHMA 1OLRA 1C1FA 2OQ6A 2ZGUA 3VBFA 1DZQA 2ZEXA 2XL9A 3VD7A 4URAA 4UBHA 2J1EA 3SISA 1U5IA 3T4VA 4CTEA 2C1FA 2GNDA 1U5XA 3W58A 4S2GA 2DCJA 4TZDA 1ND3C 4RFRB 2O1QA 3WQ7A 4NAMA 4NROA 5I93A 5BUVA 2XBO1 1RUF3 2UY8A 1G9CA 1ST8A 4JRLA 1RUF2 4YZ5A 3ZFEC 4NIGA 4FPJA 4UBGA 3V0AB 5CFCB 2HWB3 2FCUA 1POV0 4XC9A 3DPRC 5G05L 3VL8A 2ZEWA 3KB5A 3F95A 3VD5A 4QB1A 4HMZA 4CUBA 3HNBM 4XHBA 3NAPB 1IQDC 3VD4A 1LEDA 2WNUA 4Z1VA 1RUE3 2ZAHA 3I4IA 1IPSA 1NXMA 4S2DA 4DXTA 3ZXAC 3J7NA 3T0AA 1VAVA 4AZZA 1IS6A 2L9LA 4MADA 1VBA1 4XABA 3PL0A 5KXBA 4XJWA 2Q30A 2Y60A 1GOFA 1NY71 3AP7A 4QX8A 2IZWA 2J1VA 2ES3A 1JOBA 4MXWA 3ZXFA 2XVGA 1US3A 4WM8C 2CU5A 3SCGA 3E6DA 2XKOA 4XJUA 4R9DA 4HANA 5T5OA 1H2LA 3VLBB 4X8NA 1V6KA 5F2WA 3R4SA 2D6NA 5JXIA 2BJSA 2D3SA 4UFMA 1H8TB 1VE0A 3IIIA 4R9CA 3VBHB 3M4FA 1HB4A 4PIXA 1KJRA 2HWC1 3WDXA 4NHKA 3SLIA 3G6JB 1VBE1 2HWF3 1VLNA 2HWF2 3FN9A 1CESA 2RR13 2VZPA 5HPOA 4ZPIA 4XPVA 1CZSA 4D6SA 2E7AA 4IE7A 1IS4A 5C8CB 1VMHA 4M3CF 4U2AA 1HXS1 4H7LA 4KL1A 1XNCA 5FY7A 2D5FA 4INDA 2ZX1A 4Z8BA 4XQDA 2VPVA 4LUKA 1F2NA 2CL2A 2PHTA 1ZA7A 2UU8A 3QACA 1HQWA 4LR4A 4QQHA 4XJZA 1COV1 4E2SA 3ZN6A 2V09A 4YYOA 1HJGA 2WJSA 5A7PA 3H8RA 3J8F3 5JI7A 4JKLA 4CEWA 2VZRA 3OGVA 4WM7B 1WA6X 2RS51 3H1MA 5A1AA 3FHAA 2YY1A 1H2KA 2PLV3 4XDOA 2LALA 1PX4A 2PLV2 3ZMNA 5LRRA 1J58A 4P9YA 3WHTA 2OKXA 4TTGA 4JGZA 4G3YC 3GCXA 1AZDA 2HLEA 3FFQA 3VHNA 1YFUA 2DVBA 2ARXA 3GZUC 3SCFA 5JZGA 3IM0A 4OI0A 3PUSA 4NIDA 5FZHA 5T50A 4L8QA 1PGW1 4YZ2A 5BNNB 3MIEA 5ACA2 4HLTA 3WQ1A 2GN7A 1SFYA 5IHRA 4JVAA 5ANQA 4Q0VA 3SITA 1MPXA 1LNSA 4DEQA 2BP6A 1FX5A 2VCBA 3AP5A 3GHNA 4UW3A 3JBG3 4CDWC 4XF0A 1YI7A 2VBPA 4S2FA 1FV3A 5KHGA 1GZWB 4MGQA 1VBB1 2QQLA 1T6BX 3N3HA 3MYXA 1VRH3 5FLHA 1F5FA 1KDKA 3ZIXA 1SCRA 3ZFGC 4ASKA 1UWWA 1DP0A 1AR81 1HQNA 2CSGA 3KLSA 1W9WA 5B4XA 3I2OA 2YC0A 3OY8B 4EWEA 1LR5A 5BNPB 3AP6A 1F8VA 5IT6A 3HQUA 4NWWA 5KBFA 2H6CA 3T09A 3MBWA 1NX9A 1L7QA 1US2A 4OI2A 1P8JA 1UF2C 1WMEA 4Q4W3 4B1MA 1NXD1 2XKPA 2HYXA 3FC0A 3I7DA 3O0VA 4Q4W2 5FWEA 4HFSA 5J98B 1F4HA 4A44A 5L9RA 3ZYBA 4Y5SA 3FE5A 1GNYA 5A3OA 3T2QA 2FDJA 3LPGA 5GLZA 3S5QA 1PNFA 1OLQA 4RQPC 2WZPP 3JCIA 5C33A 1NE6A 4WBBA 4MZUA 4OHZA 1NZIA 1X8EA 4CXWA 3LOIA 3U4SA 4QM8A 2HJIA 2O8OA 3UJOA 5C9AB 3LIHA 4NO4A 3A21A 3JU9A 5J36A 2Q0AA 4B8EA 2WN3A 3J7LA 3VBUA 3MGUA 4AG4A 5IVCA 1OLMA 1W8ZA 1DLCA 4DIQA 4LMFA 4IGPA 3RMYA 4H55A 4HPKA 4DINB 1JZ4A 1XYNA 1NA1A 2ZCWA 1GWKA 4C0BA 3VUOA 1S0IA 3C7OA 3EBRA 4CDQA 3WHUA 5D8AC 2FDIA 4JGYC 4DUXA 4IE5A 4KMQA 2YROA 4P14A 5KXEA 4EE2A 4ZZ5A 3K4AA 5LATA 1UD1A 2Y8KA 3MFAA 4LIUA 3NRUA 5D2AA 3AL6A 2A7AA 4YZ1A 2WIIB 3ZYGA 5JAXA 5LRSA 3H8XA 2WS92 5FY1A 2A3XA 4CDXA 4NHXA 4CEYA 2GDFA 1WMDA 3JUUA 1K45A 3S6PA 4Z92B 1ND2B 1AYM3 2DBIA 1W6PB 1YQ8A 5EPAA 1W2NA 1AYM2 5CFDC 4JHTA 3OEBA 1FMD1 1VIWB 5F5IA 2E31A 1SLTA 2WZ8A 1DGWA 2JE9A 4PT6A 2VY0A 2PXJA 2VMHA 2K0GA 4FFGA 3ZSEA 4X6QB 5FPXA 2D93A 3D6EA 4L9BA 3SH5A 3CJIA 1PZ9A 4MOAA 5GJ6A 4RGKA 4Z07A 5FCCA 4ATEA 2LW8A 4MGSA 4XUOA 4AHXA 4YM2A 5FMBA 1AR93 4QKFA 4A4AA 1ENSA 3WDWA 4B7KA 1AR92 1E57A 4EWAA 5BYNA 2XHNA 4I01A 2ZKLA 2OS2A 5FYHA 3W5NA 5FP9A 3WW4A 2Z4FA 3BALA 4AI2A 2WO7A 5JXGA 4AFMA 2P4EA 3NKTA 1QQP3 3AKRA 2WKKA 2ZBJA 1CAVB 1OT5A 2P37A 2R061 4FOWA 3U78A 3UGFA 4N9IA 3D0JA 4C0HA 3UESA 1W0NA 2WT2A 5JOZA 1FOD3 4ZY9A 1FOD2 2AZ5A 1KGYA 2A70A 5IK4A 4RGGA 4QU1A 3HR9A 1KDMA 1IKPA 1AL23 2EIEA 4RFT0 2WUHA 1AL22 4QPGA 5DPNA 2NPIA 2WNUC 3J26N 1RC6A 3QLQA 4CXYA 3VKNA 2BWAA 2ET7A 3KVAA 1QXPA 4W65A 2OPWA 5EYYA 1RUI3 4O61A 5FPAA 5JUVA 1RUI2 2P3KA 2HBTA 1QGLA 2BWCA 3BTXA 4Y24A 2BOJA 5EYXA 3FHIB 4PIYA 4LITA 3IKWA 1O5UA 1MZEA 1LOCA 3I2FA 4JDNA 5FPBA 5FY9A 4ONUA 5FJHA 2YZ4A 2XMLA 3KT4A 1JS9A 4M4RA 4YVSB 3P6BA 2RMU3 3WLUA 2F4PA 4A3ZA 4D0QA 4JQRA 5KHJA 1XE7A 2GNTA 1AR63 2I2SA 2Y6KA 3NQHA 3EHKA 1W8NA 1AR62 2HWE3 2HWE2 2GH2A 5FTTC 2J1SA 3V65A 2TBVA 2FDHA 1ZREA 1GZTA 4CUGA 1KD7A 3ILFA 1Q8QA 1VMJA 2Q5TA 5IJRA 5CG8A 1PZ8A 2ZPXA 3IMNA 3POEA 2ADEA 3I97A 4D7SA 3BU0A 1O3SA 5ABJB 4P08A 1ENQA 4GB31 4QB6A 1V6NA 3O1OA 3R0RA 4UYBA 3JZVA 1IPKA 3OEAA 4KU8A 3WP3A 1AYN3 4PIZA 4NIAA 1W8FA 1AYN2 4BQ3A 4DEVA 2VUJA 2GAUA 5EJZB 3LA2A 4J1XA 4KWUA 1RIRA 3ES4A 5LASA 3ST7A 2E6VA 1N3QA 4AEMA 4LHLA 2WWJA 1J1LA 1CJPA 5F5AA 4CEWC 5J96B 4QQOA 1PO13 2A6YA 4HK9A 1SHWB 4AVBA 4XAAA 1H6YA 2XWBB 4N7IA 2B45X 5IFPA 1JBCA 1IOAA 2VTFA 3S57A 2YV8A 1GSLA 1RINA 3FX3A 4AI0A 4JGZC 2JIGA 3BIEA 4CDUA 1S2EA 3L2YA 4CSWA 5A33B 2DFCA 5JZGC 1MS5A 1Y9QA 3H1WA 5J37A 1GU3A 3CEWA 1JU4A 4PBPA 3H8UA 4ZXKA 3WNLA 5C5UA 5BNQA 5LY2A 5F3IA 5AC91 4UFKA 1ZRDA 3L9JT 4BXFA 3ZXJA 1HN1A 2P3JA 4BQ4A 3VKMA 3ZYRA 2BRTA 2D3RA 1W8WA 5C9AA 4AK3A 1I3HA 3WF3A 1POV1 2Q1MA 1IPJA 2RHPA 5BXXA 4FVVA 3W20A 4BQYA 1UU5A 2WSUA 4K1YA 4Y20A 5DUUA 3DN7A 4Q0QA 3PTYA 4QMAA 2WC2A 5IW0A 5A70A 2C6SA 1BYHA 4E2QA 5BNOA 2HBUA 1R64A 2LTNA 1Y9MA 4HOOA 3BOPA 2A6ZA 2Q8CA 1WCUA 1QJU3 3PIJA 1RUD3 3WNKA 1QJU2 2VMCA 2Y0OA 3POIA 2RS32 4I3GA 1RUOA 1IS3A 3MF9A 5FPVA 3D5OA 3LFIA 4CYDA 1QJY3 1TQ5A 4LBKA 2OX0A 1AR73 1QJY2 3T2TA 2PQSA 1H9WA 3ZYJB 4JDMA 1NQDA 1ULFA 4KG8A 4DXSA 2WFPA 2DVDA 2A6VA 2R49A 3S7IA 1W04A 2W46A 2DCKA 2RJLA 1X82A 4LLOA 1UL9A 1L7RA 1R093 2XDVA 1ODMA 1R092 2Y6GA 1ZZ6A 2G4IA 4JZRA 3WP6A 3WF0A 2H0BA 3ZFFB 1Q3EA 3UYJA 2TEPA 1ND2A 3VZJA 2PYTA 1OOPA 3SC7X 4Y1UA 1JODA 3URFA 4TYSA 4COZA 3H9AA 5FOJB 2IUWA 4UW6A 1E5IA 5FLJA 4Y1XA 3OUIA 3WG3A 3ZIWA 5JR2A 3KGLA 4O9EA 4K8FA 3PU8A 1Z7S3 2R16A 3CDZB 4N9HA 1Z7S2 5FYZA 1RUC3 1T2XA 4XUPA 1LB2A 4GZ9A 5JIUA 1KS4A 1OD5A 2R0HA 1SLLA 3U4XA 1YNAA 3THPA 4EV0A 1F4AA 3TEYA 2FDFA 4OHYA 1J3QA 1QDOA 4XIOA 4FPYA 3AZZA 3VBUC 1RUF1 5FZ4A 4LOTA 2QE3A 4XDQA 3ZFEA 3BPZA 5FYCA 3GM8A 3M2MA 2V4AA 1OBNA 4A2UA 1NA1C 1S0BA 2W1QA 3AZYA 1G9BA 3VBRB 5IK5A 3AKTA 2NM1A 4CDQC 1ZRIA 3WW2A 3WF2A 5DMYA 2QZ3A 5GLTA 4Q26A 5FYVA 3UKVA 3O1VA 5HCBA 1FNYA 2R1DA 2ZHLA 4Q8KA 3ZM8A 3WNPA 4OMDA 4U36A 1C8M3 3INAA 4QAWA 4V2WA 4Y1VA 4L0PA 1C8M2 1HB2A 1ZZCA 3UKNA 4J25A 3RPQA 4CCKA 4CDXC 3I3MA 5L36A 2VNOA 4CEYC 3WCRA 4A7KA 2VVDA 1X50A 2PHRA 3N35A 2V73A 3DECA 1KQRA 1GP5A 2BUKA 2QDNA 4GMP3 4HN0A 2QQNA 2VOKA 4ZKTB 3VB9A 3MIBA 4IEVA 2VZOA 4DS0A 3AXDA 1IZ3A 4V2VA 1UYXA 2CDOA 1XYPA 3SNMA 4W8JA 2YGLA 1GP4A 2Q1FA 4KU7A 1STMA 2Q8OA 4UXAA 1BKZA 1RUH3 3AX4A 5F32A 1OMIA 1RUH2 1CD3G 1IG0A 5JIAA 2ERFA 4TLGA 4NAOA 2ZMKA 3O0WA 3VBHC 3AZWA 3K77A 1F5JA 3A22A 3KF3A 1QH7A 1OI6A 3ZSKA 3WQBA 2XJQA 2XR4A 3AYEA 3LOBA 1FATA 1QOTA 4FPGA 4KWKA 5L9VA 4OZOA 3TWIA 2JD9A 2YBPA 4I30A 3NMBA 4MV2A 2ADDA 3WINE 4E8DA 1BCXA 3K4DA 2P17A 3HVDA 4BWOA 4LHNA 1QEXA 1UOJA 1XYOA 5KHKA 1JMUB 1OFNA 4CA9A 4K6BA 4N43B 5A7SA 4C91A 1VRBA 3GBGA 1VBD3 1VPHA 4XF4A 1URXA 3UNPA 4QQ2A 5KR7A 2MEV2 4QPGC 2DTWA 3RDIA 4UI9L 3HT2A 1V9U2 3TN93 3UT0A 3LDRA 3FUOA 3FHQA 1AXKA 1PK6A 2E33A 3CZUA 3POYA 4XUQA 5A3NA 5JMCA 1OF3A 4YW7A 4BE3A 2C5DA 2PHLA 3SH3A 4CU7A 1U5ZA 4JCKA 5TSWA 2E32A 3NJXA 4H7MA 4YGDA 2Q8DA 4UFLA 4A6SA 2XL7A 3ES1A 1I6XA 1QJX3 4B4RA 4C8DA 1YC61 2J22A 2WQ8A 5FP4A 2VQTA 1SMVA 4LEJA 5A33A 4BK5A 5T54A 4YZ4A 5ACA1 3T1MA 1RB8G 3NNMA 4AI3A 1CGPA 5FMOS 3HBZA 1C57A 1RHI3 4GH4B 1XSRA 1RGSA 2JX9A 5CVRA 5FZOB 4FTBA 1OA3A 4IEZA 5H9QA 4AEDB 3ZO0B 4XFCA 3D8CA 3RZKA 3B5LB 3QH6A 4FTSA 3PMEA 3N9NA 1F35A 1OPOA 1RVF1 4UFIA 3FLRA 4MX3A 3H50A 5E8AA 1QDCA 3N7LA 4ZZ8A 1JZ8A 1K5JA 1UXXX 4N53B 3Q8EA 4Q4V2 4NIHA 3LF7A 2VQAA 2EXKA 1OKQA 1PM7A 2OXBA 2YYOA 4XCAA 4Y33A 4UW5A 3D0SA 3O5SA 1I5PA 2IVJA 4K3UA 4OVEA 1O6UA 3FMGA 1J1TA 2GNBA 1ZBA3 3K2OA 4I02A 3ZSLA 1ZBA2 1ALYA 1NG0A 1OXCA 2SLIA 4KNCA 4BMEA 1KJLA 2VZUA 2ZX0A 2GALA 3PUAA 4YWAA 1V6IA 1QKQA 2C4XA 2WFF2 4LTAA 2ZX3A 1OQEA 1G6NA 3VZKA 4LKDA 3IBMA 4IEOA 1Y9GA 1RUJ3 2PTMA 2WNVB 2YFZA 3GBFA 3K48A 1RUJ2 4QXCA 4Y26A 4RHV3 3WVJA 2VBDA 4X8PA 3POBA 3IDBB 4RHV2 5GZCA 1OUXA 3ITQA 2D6MA 1K3IA 4HKLA 1K5MA 5FKCA 4CDUC 1UOFA 3JQWA 2FCTA 3VDDB 3ZR5A 1UOBA 2XUEA 5T5JA 3ZOIA 2JDAA 2ZEYA 5K0UA 4P9JA 3MPPG 5IK8A 3WDYA 1EUTA 4Q4Y2 3ZVXA 3KM5A 2JG8A 4QPYA 4OMCA 3WNNA 4BLJA 4R52A 5A7OA 1JH5A 1GV9A 3PJYA 1W2AX 4FFIA 1BBT3 5I8SA 2XH6A 4YM1A 4NUBA 1NQJA 1DU3D 4Y1YA 1G86A 3VV1A 5C9AC 2FBEA 4XIKA 1W6OA 1XSQA 2JG9A 2VVFA 5FP7A 2PELA 3M8LA 1UY0A 5B4NA 5K4LA 2Z5WA 1F9KA 2HH9A 2J1RA 5BNOC 3ZDSA 1O91A 4IE0A 3N9PA 3ZXDA 4V1PA 2YG0A 3VD3A 3NNGA 1SACA 1PX3A 1C1LA 1H8VA 3I3BA 4JC1A 2WYFA 2OZJA 4MYEA 4AI8A 3G7DA 4HT1T 3LD8A 3VBRA 1ULPA 4Y4YA 1BEV1 2D6OX 4QU2A 5K8SA 3RVHA 1W6QB 2BGOA 2WS91 4YG6A 3VDBA 1G7YA 2ENRA 3CU7A 1N1VA 4QT6A 3VZNA 4XETA 1AYM1 5JI9A 1UPSA 4YGEA 5L9BA 2FZ2A 2IFWA 4RR3B 5FZ0A 2VULA 3ZDVA 5CA6A 1ND2C 1SLBA 5FZAA 3GZTB 1OOPC 2B9UA 2HKXA 1DYPA 4AI1A 4Q8LA 4E9KA 1VBC3 1ZVFA 2G19A 3FL7A 1L7LA 1VBC2 5A3UA 1BXHA 1OVSA 1S0CA 3LEKA 4AQ2A 1XBFA 3AC0A 1LECA 1GNHA 1AF9A 1R081 1BK1A 2VUDA 2OVUA 1UZWA 2ZS6B 3GBWA 3KVBA 1JYNA 3U37A 4IQPA 5I8TA 2VZ3A 1PIV1 3EMRA 4Q4X3 1W8UA 2JDMA 2VOWA 3T0BA 4GWJA 4WZFA 4GD4A 1IGOA 4RS5B 4B3NA 3T0DA 3AYAA 5I0UA 3W5MA 3AXEA 1SDWA 3H7JA 4MHUA 4ORFA 3R4DB 2LROA 2VCCA 2B7YA 4HONA 3ZSMA 5C4WB 2LM3A 5FZFA 3ZYIB 5CU1A 4FAGA 1FOD1 1HRV3 1JOPA 1S4CA 2W1SA 3J7MA 2HWB2 4P5YA 4Q29A 4EQVA 3AKQA 3DCQA 2ZGOA 4KG0A 4QDSA 1UYYA 1VAMA 1O3RA 1AL21 4YW5A 1YFWA 4MGYE 4XJ9A 4XXAA 1NCQA 3OYWB 3F2ZA 5JXJA 4AI9A 1RUE2 1M4WA 3CNAA 1NCRA 1DLLA 1F15A 1D4VB 3VD9A 3VBSA 1SBFA 1J84A 3KQRA 4JRAA 5FUNA 4DMIA 5L7OB 2GN3A 1LTEA 3OB8A 4NPRA 4OZXA 4QPIA 4R4XA 2VW0A 4GAZA 5AVPA 3WP5A 2VZSA 4XUTA 4YSFA 3ACFA 2OUHA 1HRI1 3ETQA 1LOEA 3EQEA 2PHWA 1YQ6A 3C8XA 5JOYA 2RV9A 2Y6JA 1JZ3A 1UMHA 5FZ8A 4AVVA 5AFEA 1ZZ8A 2DUQA 4AEJA 4LKSA 5T3NA 3EO6A 3M3OA 1OKOA 5J09A 3PMSA 5FKBA 1SQ4A 4ISRA 3IWZA 4UWDA 3WY6A 4K9SA 4COVA 3ZN5A 3AVSA 2ZKNA 3PVNA 1H30A 2W0XA 3U10A 2QQJA 3KV5A 2RR12 1MS4A 2RDNA 1RJ7A 2ZHKA 1DDLA 1Y7BA 1YFYA 3O12A 2X5IB 1BZWA 3JD73 1AYN1 5ABJC 2DUPA 3POJA 5CYYA 2SBAA 2AENA 1AX0A 1MEC3 1CAUB 3AJYA 1V6JA 4KWJA 2JXAA 4R9AA 1YQ5A 4CP9B 2Q1ZB 5KXCA 2BFUS 4LA3A 3OGJA 5J3UA 1MR5A 5LWBA 2BGPA 3HD8B 3J8F2 3T08A 1QHDA 2VE1A 1DIWA 1ZX5A 1F31A 1RITA 1BJQA 1O4YA 1V6MA 2BNOA 2UY9A 1MZ5A 2RDRA 2YDEA 1PMHX 4EZ4A 1TVGA 1PK6C 1W9SA 1O59A 2JD4A 3I54A 2DTYA 4KBZA 1QJZA 3NNLA 3KV6A 3WX5A 3BU7A 1GICA 1SEFA 3MIDA 3A0NA 1EV13 5IAXA 1EV12 3AFGA 1LAJA 2YBSA 3O0XA 4JV4A 1CAXB 3PVBB 5D21A 2IXJA 5IWFA 2BEOA 4AFCA 5JDBA 1JYWA 4IEXA 4HVRA 4YGCA 4XBNA 2WO3A 1LGBA 2RG4A 3VDCA 5HBAA 4GIQA 3VL9A 4PCRA 4BXSV 1W0OA 4AW7A 3K4ZA 2ARCA 1MS1A 2CNAA 2OT7A 4M0HA 3WT3A 3NJZA 1H1MA 1DGWX 1PVC3 4AVTA 1FPN3 1PVC2 2I74A 3FBYA 4XF9A 1FPN2 1VB2A 5A6XA 3JBG2 5A6ZA 1X33A 3PTRB 3W21A 2C0ZA 1WUVA 1QJU1 1E5SA 2DBNA 2RS31 3HBKA 3RYRA 5DDJ1 3X29B 1S2KA 1OUSA 1VRH2 2D3PA 2ZACA 2ZOEB 3NV1A 4QGNA 1B35B 1W05A 5A7QA 2WSVA 2E9QA 5BV6A 3B02A 5FPUA 1UMZA 3ACIA 2DU1A 5JWPA 3PUHA 3WNXA 1QJY1 2BBAA 4PQQA 1NLQA 3I3QA 4M00A 1EYBA 1LEMA 5FFOC 4XUNA 4ZU7A 1B09A 2MPFA 1LRHA 4IV3B 4OCTA 3D3AA 3KCYA 2VUCA 3OGSA 1ULCA 5CAZA 5EWSA 2GC1A 1ZYBA 5KC6A 2B8MA 5IATA 2JDYA 4ATFA 2NMNA 4M3CB 2PMWB 2ZX4A 1KFUL 2ZAAA 2W08A 1NE4A 1GLHA 5LA2A 3U1XA 2JKXA 1N47A 2N7GA 2PFWA 2E63A 2JWPA 1V6LA 4L97A 4MGZE 2VMFA 4PDWB 1ASJ3 1TME3 2W87A 3OBTA 5FZ9A 1K5MC 1TME2 4FQZA 4XFGA 2UWBA 4ASMB 5AFBA 4DRVA 2VOVA 5F7UA 1EAH3 1H4HA 4GQ7A 4NMIA 3W59A 2PAMA 1EAH2 3K3NA 4GWMA 1WW7A 3CIHA 5K0UC 3AMMA 1Z7S1 4Q27A 1REDA 2I07B 3KV4A 2JG8C 2VL4A 3E97A 4QKDA 5ANNA 4XF1A 2V4VA 3MEPA 4P9XA 3QH7A 1UMIA 2O14A 5GM0A 3UGHA 2ZX2A 3BVCA 2JG9C 2Y6HA 4A45A 2R0FA 4CPBD 4HXCA 3KHCA 4GWNA 3HN3A 2VC9A 1QMJA 1WD3A 1GANA 1CZTA 2RS13 3MIHA 1VJ2A 1S0JA 2RS12 5DG1A 4YVWB 1ULDA 1ULEA 3N36A 4MGIE 4DY5A 2R073 5C5TA 3AKPA 5FYSA 2QVSB 4HVQA 2R072 4P02B 1YJKA 2EIDA 3V0AA 2AR6A 5CFCA 4B4PA 3K46A 4DUVA 1LULA 4OHWA 3VBRC 5C6CA 2H0VA 1WMFA 4AGVA 1MQTB 4NPLA 4XACA 4IEPA 2QFEA 3NAPA 2OYZA 2ZABA 1XPWA 3GGLA 3P5BA 4AQ6A 4EN0A 2VH9A 2Y34A 2KA3A 2QQUA 1XRUA 2VCMA 3LB9A 3LEGA 4D6QA 1MZFA 2QNKA 2W2IA 5KXDA 5E6HA 4XDPA 4ZS2A 5L7OA 1CR7A 3LE0A 3R4UA 4HK8A 1BK0A 1XC6A 1RUNA 4TLFA 2R043 4I0WB 4N90A 4DZGA 4IUGA 4NRPA 2IFRA 5CKNA 1YCIA 1A3KA 3Q8BA 4Q1RA 3VHRA 1DQ6A 2YMZA 4MHRA 1OH3A 3DYMA 4QHBA 4C90A 1RUH1 4AVSA 3RZZA 2RM21 1H8TA 4WZCA 1D7PM 1W90A 4TWTA 4XEZA 3GZEA 3MV11 1UPIA 2GP5A 4TSVA 1WBLA 1RJ8A 3VBHA 1JYXA 2XLGA 4MSVA 4HKOA 4BZ4A 2RJKA 2GMPA 2VOTA 1W9TA 2HWD3 2XJVA 3LPFA 1PM4A 4DFSA 2HWD2 2EA7A 2QBXA 5KHIA 1Q8SA 4ISQA 1XB9A 2GZWA 1RUG3 1QQP2 1GFF2 2UYAA 2VO5A 1GOGA 1RUG2 1UZVA 5C8CA 3AP4A 3I2JA 4ES8A 4F7ZA 2XXZA 3MW4A 1PO23 5HV0A 3ETPA 1PO22 2XONA 3H3ZA 1HIXA 1LU1A 1XE0A 2JIJA 4AGGA 3LEIA 2NN8A 4XJAA 2WZR1 3ASIA 2YPJA 4WVMB 1UNBA 4A42A 1QU0A 3V56A 4Z2AA 2MEV1 4N8MA 2I45A 1JZ5A 1AUYA 2VJXA 1WCSA 2CAVA 3VKLA 2OW4A 1V9U1 4NJ4A 2CDPA 4YRDA 1NCQC 4CCNA 3WP4A 1AX2A 1ND3B 5HXMA 4EN7B 1AVBA 2P5BA 3HQRA 4WM7A 1NCRC 1H1AA 1S2BA 1TMF1 4XMIA 3SKVA 3VBSC 4COYA 1YWKA 2JJ6A 2VXJA 3CMGA 4CUCA 2FMYA 4J6GA 2XBO3 3DPRB 2XBO2 1PMJX 4QPIC 1O7FA 3AM2A 5DZFA 2EALA 4ITCA 3RYKA 3POWA 3A7QA 4F83A 2ARBA 3GXUA 2JICA 1Q8OA 1SG3A 2RMU2 1QJFA 4I3PA 3E6CC 2J7MA 2XOMA 4FO9A 3RG0A 4QHZA 2IC1A 4BQ1A 5BNNA 1SLIA 1QWRA 4GH4C 3PIGA 1SPPB 2C9KA 2VTXJ 1ENRA 4ZS3A 4CP1A 3DXUA 1VBA3 4FCAA 1C8NA 1I1EA 4WM8B 4LE3A 1S0GA 4WVWA 4Q4V1 4IV1B 5IVJA 1JW6A 3E1F1 1ULOA 2BV4A 3ZYHA 1GZWA 3GHMA 4LLFA 1XNDA 5KHHA 4IL7A 1NLSA 2HEYF 5F37A 3FLPA 2K46A 2PAEA 1JYCA 1TNFA 1WA4A 3IT8A 1ZBA1 1EPZA 2G1MA 3NL1A 5E1RA 3USSA 5B2GB 5IVVA 1ZBE1 1XE8A 2NQYA 5EIYB 4IGOA 1BMV1 2YBKA 4M0NA 4CU8A 2WFF1 1O8PA 3OY8A 3USUB 5BNPA 1KS5A 3C7HA 1YYNA 5A80A 4E4DX 1YLLA 2VAUA 1O8SA 3ZKYA 3RJ2X 1O3TA 2RVAA 2HWC3 3I2HA 1PO12 2B4KA 2W94A 1RUJ1 3HNYM 1VBE3 3UKTA 2QZ2A 2FDGA 2IXLA 1JN2P 1VBE2 1XU2A 2Y6FA 4RHV1 4QKBA 5CNAA 3ORJA 2D6KA 1RTVA 1W2UA 3WG1A 2C26A 3EYPA 1NZCA 2WNVC 2ZGSA 3PNAA 5DUVA 3WDUA 4PDWA 2VVEA 1HXS3 1OQDA 4QX7A 1LOAA 4RYDA 2F17A 5IK7A 1W3VA 2XB6C 4LBOA 3HWJA 4Y22B 1X9TA 1BQPA 4Q4Y1 4FOQA 2YC4A 4X6RB 2P3YA 3MIFA 3MUZ1 1GWLA 1COV3 3B01A 4DPNA 3UGGA 3NV3A 2DF7A 4BH9A 2MHFA 1O4TA 1BHGA 2RS53 4FXGB 2YU1A 1TEIA 1OVPA 1UY3A 1DFQA 2WT1A 2JENA 1REEA 1S0DA 4LULA 3P3PA 1CPNA 1PGL2 2JB4A 4D8MA 1S55A 4LK7A 5C3OA 1CX4A 4LBQB 4ZU4A 4LXLA 2BNMA 1Q43A 3T4HB 1LHOA 5F9TA 1G8WA 4RSUA 2LS6A 3B69A 4YVWA 2HYKA 3SQOA 4DOUA 2K9ZA 1RUD2 4KH9A 1JZ7A 3J4UH 3RYPA 3ZKUA 3IB3A 4XFHA 3MLLA 2VM9A 3EB7A 2Z69A 1LESA 5EQUA 1UN1A 3PVEA 4AFAA 4BOWA 3AMHA 2DWRA 4AHZA 3GDBA 4K21A 1AR72 4YM3A 5J1XA 1W28A 3WUCA 1HLCA 5JXHA 3CZJA 1W0PA 1KEXA 4Q2FA 1SFPA 1WW4A 3MF6A 1UZYA 1HV0A 3H3LA 3ZFGB 4AQTA 4COUA 3BUCA 4C1XA 1VBB3 3H42B 1W6MB 3APBA 4QDRA 1CPMA 1VBB2 1W6PA 2D40A 2OPKA 1UOGA 4PJYA 4OUMA 3ZPOA 2DURA 1VBC1 3MHZA 1LGCA 5FREA 1RXFA 4XBLA 1OC1A 1ONAA 3C7EA 3E5UA 4XCBA 2A6WA 4M3CE 1UZZA 2WYSA 4OUEA 2DUOA 2AUYA 2ZEZA 3RGBA 1QH6A 2Y38A 1KFXL 2YXSA 3V0BB 1GUIA 3OD0A 1ZRFA 4CP2A 4YPJA 4EYUA 1KRIA 1SLCA 2A73B 4H3WA 3CO2A 1RUC2 4ZXEA 5J48A 1PVXA 3LA7A 4QKNA 4BIFA 1DGRN 3M70A 2UYBA 4LO7A 1H6XA 1LU2A 4XAEA 5IVYA 3RI9A 5C3SA 1QOSA 4AR2A 1SBEA 3ME2A 2W3JA 1W39A 2QUOA 4NN0A 3EXUA 2HWB1 2ZGKA 1CAVA 3BGAA 2G9ZA 4WVVA 5FYIA 4A3XA 4FOVA 2YB7A 3ZXLA 4DB5A 5C4WC 2VZVA 3ALQA 4FFHA 1GNZA 1W06A 1QOOA 3I59B 4UT5A 2B39A 5FK8A 5CFCC 1CAWB 3NV2A 3LGRA 4WVMA 2DYCA 4EN8B 1JXNA 1RUE1 4CCOA 5FXVA 3HOBA 3PURA 4EROA 2DU0A 3NAPC 3PLQA 3CJXA 3KT7A 3IDEA 3I3DA 3NV4A 5C70A 4AAXA 4D69A 2BPA2 2JKBA 4P9LA 4ET7A 1N1TA 4BQ5A 5FLIA 4RA0A 5FPLA 4ARXA 4COWA 4XMAA 2WQZC 4B1LA 4LE4A 2AEZA 4JKMA 4WVZA 1WGPA 5L7OC 2GC2A 5D8AB 5CISA 3N9LA 4JGYB 2P3IA 3ZN4A 3ZPYA 4CCCA 4FI9A 4MG2A 3SMHA 1VMFA 4XZUG 4PI0A 5FY4A 4YNIA 4YVSA 5LZ6A 3NSTA 1HV1A 5GZDA 3WEZA 3HT1A 1I9RA 1VP6A 4CUAA 2EXHA 4Y5Z0 1DBNA 2AC1A 1D0HA 1LCLA 3SCHA 1DQ2A 1H8TC 5F8PA 2IXKA 5IAVA 3MZHA 4XYXA 2HWF1 3MLKA 1K12A 1SPPA 4XILA 5F5CA 1IS5A 1V70A 3RZGA 1EUUA 3T1LA 3TEWA 3J9SA 2PAKA 2RR11 4G9SB 2BDRA 3AL5A 3R6SA 2EIBA 5JR7B 5IUQA 4XBQA 3RZJA 5FXWA 1UY4A 1FMD3 2J1AA 3WD5A 3IAPA 1FMD2 5ABJA 3N9QA 5C8CC 2WO2A 1QIQA 3S0MA 1UCXA 5FY5A 1MS8A 1ZZ7A 5KWRA 2AYHA 1W3XA 4F3JA 2VUAA 4P9WA 1GZCA 2QQPA 1O5LA 4IEYA 4NRMA 2W5FA 5GZFA 3MPBA 4I0AA 3J8F1 2QJVA 3VBFB 4DO0A 2Q8EA 2JB8A 2JDZA 2Y6LA 3PJQA 1VBD2 2XJRA 5FZBA 4FBFA 2PLV1 4OQ9A 3OUHA 4BU2A 4WM7C 1OF4A 1UYZA 3TN92 4Q0PA 5K7PA 4OHXA 4XF3A 2GMMA 3WG2A 2JDUA 4Z2WA 3RSJA 1EY2A 3OF1A 4DY3A 4AXOA 1CN1A 2B42B 2QKDA 2R063 3O1RA 1QJX2 5DXDA 1O4ZA 2E53A 3NNJA 1ODNA 2GC0A 2P6HA 1AJKA 2WT0A 2YUEA 4GMP0 2NMOA 1ZA4A 1MS3A 1LENA
chains in the Genus database with same CATH topology
1RHI2 5BNNC 1RL3A 4XZPA 4OI1A 4LHKA 1HKDA 3JBG1 3SXWA 1QNYA 5A3MA 2ZMLA 3H0OA 3RRDA 4MXWB 2ZGLA 4JDOA 4JAAA 4B29A 1H4GA 1VRH1 4P5HA 4ASLA 3AP9A 4C1WA 2JE7A 1YHFA 4ES9A 2DCYA 4NR1A 4MH0E 2BNNA 4NVPA 5EXOA 4IERA 4OLLA 5DG2A 4HL0A 4LT5A 2PQQA 4DNYA 3KD4A 3O7OA 1D2QA 4J1WA 5BNPC 2PHFA 2NZ9A 5JVVA 5FDBA 4DRRA 4XHXA 3VN4A 1DQ0A 1C4RA 4FTEA 3FWEA 4YG3A 4Q4W1 2DFBA 4K40A 4LBQD 1GZ9A 3ZFFA 1UU6A 4GB33 1TME1 2BQPA 2ZGMA 1FV2A 4GB32 2EIGA 4PDWC 4FPCA 5CIRA 4UW4A 2ET1A 1XQNA 1XNBA 1OSGA 4LNVA 4AE2A 4MVTA 4R4ZA 4CEWB 4BIOA 4FT8A 1UAIA 2R30A 5LEJA 3OPZA 3DF0A 3N7JA 3JB8A 1IQAA 2Z79A 1R1ZA 1BBT2 1GBGA 4LUMA 3RMXA 2RS11 4IEUA 4DQAA 5I8YA 1WD4A 2TUNA 5JZGB 2R071 3CLPA 1IHMA 4FPKA 4YVWC 4AHYA 1WBFA 5CG9A 2D98A 5A32B 2ZZJA 2P34A 1L3JA 3NW4A 2XJTA 2ZGNA 3WDTA 2D97A 2LUWA 1YFXA 4FPOB 1A78A 2FQPA 1POV3 3WQ0A 3DUIA 2CTVA 4XXPA 3NKGA 1HQLA 3NWKA 4P9IA 2G9FA 4XFBA 2D6PA 5T5PA 5GLVA 1J3PA 1AJOA 2KXLA 2XVKA 4MXVA 2ATFA 2CGPA 4HKWA 2H6BA 1X36A 3KS7A 3V64A 1AR91 4K7JA 4H14A 3N7MA 2QCSB 3JB4C 4Q4X2 1ZRRA 4EN6B 2BFUL 3WG4A 1ZM1A 3AKSA 1QQP1 4OFGA 1MVEA 4AF9A 1JYIA 1PO21 4LBLA 4I0BA 3IIAA 2DV9A 4HZFA 4PLMA 1HRV2 3RQ0A 4N43A 1Q5OA 4XOGA 1V6OA 1MS9A 3VBUB 4QXKA 2VNGA 2NP0A 3UL2A 5F1RA 3P3NA 1RUI1 2PHUA 4QM9A 3TYJA 1H0BA 1VALA 1XXNA 4HPKB 1A8MA 1NA1B 2OA2A 4AVCA 2OIIA 1AX1A 4Q1PA 4CDQB 4PLNA 4XTMA 3LZZA 3WOGA 1IKQA 1SFNA 2RMU1 4BPZA 1AR61 3TAYA 5I91A 2VNRA 4YVSC 3LCPA 1TE1B 2HWE1 2FZ1A 4DXZA 3QCWA 2YGMA 3MI8A 4GH4A 2D5HA 4CDXB 4CEYB 3C2UA 1GKBA 1PMIA 1VR3A 2ZA9A 3O14A 3VZOA 2P2KA 4AEDA 2XVLA 5L19A 5H9PA 2VW1A 4YGBA 1W6NB 1SCSA 1APNA 5F6KA 4IV1C 2AREA 1REFA 3K51A 4N53A 5D1IA 3CJIB 3JD72 3VKOA 4LA2A 1FI2A 1MEC2 4IEQA 2UWAA 2WA4A 4HSLA 2WA3A 5FO7B 5FOBB 4D3WA 3LAGA 1C3HA 3FUQA 2A5ZA 1PO11 3U11A 1YXWA 4YLZA 1U0AA 4OUSA 3A4UA 3H1YA 3SHRA 1QXRA 4QQPA 4Q0SA 5BPXA 1A8DA 4GKYA 2WNVA 3DGTA 1U5YA 1JUHA 3FFZA 1FYUA 1WCKA 3VBOB 3VDDA 5JSRA 5T55A 5I0TA 1DGRA 4QPGB 3KZ4C 3M3IA 3VZMA 1R1A3 4YM0A 5JOWA 1R1A2 1QY4A 2ZGTA 3OBRA 1PGL1 1LJ7A 3E6BA 3MDPA 1G9AA 5CB7A 2V5YA 1CIWA 4LO8A 3ZXEA 1H2MA 1RUD1 1N1SA 1YJLA 3AZVA 3LKJA 4OI4A 3UV9A 5EJ3A 1LOFC 1G9DA 3D82A 1TNRA 4BA6A 3VHPA 1QNWA 3VZLA 3D4KA 5ACA3 5A32A 1NOVA 1AR71 2ZMNA 2CGNA 1AL0G 4HVOA 2D43A 1W6QA 4Z82A 4F8AA 1WW5A 1R091 1EPWA 3I8TA 1Q8PA 2D6LX 1RVF3 1LHNA 1RVF2 3OJBA 3ZFFC 3ZMOA 2E51A 4RR3A 2VQ0A 2GMEA 4L2NA 4LBJA 2VECA 4M01A 1ASJ2 1V00A 2R32A 3WV6A 4KBBA 1DF0A 1UKGA 4KQ7A 3CL1A 2FMDA 3L2HA 5LK5A 1DQ4A 2F6BA 1ZZ9A 5L73A 3WW3A 3KT1A 1RUC1 1UW8A 3B3QE 4QD2A 1OQ1A 1NLRA 4CDUB 4GALA 2TNFA 4XFIA 1D4M3 3GNEA 2XLAA 4RS5A 1D4M2 3WR0A 4KGGA 3GF6A 1S0FA 5E88A 5C4WA 4LO6B 3FZ3A 2XLFA 1YO8A 5J7MA 1ZNPA 4AGRA 1WCDJ 5HXVA 1VB4A 2VU9A 3FLTA 1C8M1 4Y20B 1LHVA 4AYUA 2NLRA 3OYWA 3AZXA 1RMU3 3A0KA 1DG6A 5BNOB 1RMU2 4XTPA 2ZHNA 2XJSA 1WW6A 1X7NA 3MLJA 4GMP1 3U07A 2X29A 3HAGA 1N3OA 1AXYA 2R042 4FQ4A 5EFUA 2EAKA 4LBMA 4RL7A 3ZXGA 1BEV3 1BEV2 3E5XA 1SLAA 2WS93 3ENRA 2O0OA 5K9YA 2DCZA 1OOPB 2XG3A 5SV8A 3ACLA 5LK7B 1DZTA 4FPLA 1CQ9A 1W6NA 1JUIA 3UJQA 5HCFA 4PF5A 1AHSA 2X5IA 2BVVA 2K2SA 1UX6A 4YG0A 5T52A 2CYFA 4W6WA 3SH4A 5JPMB 1MACA 3M7AA 1CAUA 2Y26A 1VBD1 1JOJA 1R083 3H7YA 3TB0A 1R082 2A6XA 3VBFC 5I0RA 3B94A 4N43C 3TN91 1PIV3 1PIV2 3ATGA 2JECA 3W9AA 4BYYA 4S2HA 1LHWA 2RE9A 3ZFEB 2GSYA 2GC3A 4YW1A 1QJX1 4XFAA 4L11A 2ZGRA 1LHUA 3BIWE 2OUJA 4BM8A 5CBLA 1CAXA 3VBOA 1LOGA 5GLWA 1ZRCA 1RHI1 2X8KA 1LOBA 4GKXA 1H9PA 2B46X 2W68A 3I2DA 4A3XA 5FOJB 2IXHA 2E7QA 1QF3A 2B5HA 4FOYA 5JSOA 3QOPA 2E7TA 1DGLA 2ZZQA 5KC5A 4P9GA 4AWDA 2XGXA 2XWJB 3OGGA 4AEDC 1OPMA 1VBA2 4HSJA 5DZGA 4AFDA 1C5IA 1MS0A 1NY72 3HMYA 2FHRA 3WDVA 4AHWA 4N53C 2VMGA 2WINB 1B35A 1HRI3 1HRI2 3WCSA 4E27A 4META 3C3VA 1GQHA 1VAKA 3N4MA 2VG9A 3AFKA 4BLIA 1J3RA 4EWDA 4IV3A 1C5HA 1KITA 3LSEA 2HWC2 2A71A 2WQ4A 2WLQA 2UWCA 3QD6A 5GZEA 3QBQA 2G9GA 3ZX7A 4M3CA 3TNQA 5FBZA 3LWCA 1GYKA 2GH8A 1DQ5A 2A3YA 1A6CA 1HXS2 3ELNA 3M3QA 4D7TA 3KMHA 1LKNA 1T6GC 3AJZA 1DQ1A 3VDDC 2ZJCA 3AK0A 3E5QA 1COV2 1OA4A 2HEWF 5JPNB 4HN1A 1BBT1 2EF6A 3JQXA 4FPHA 5LEKA 2IXCA 2PHXA 3UK9A 1PK6B 2WNEA 2XJPA 2RS52 1DYKA 2CWMA 5F5QA 1S1AA 2CGOA 5GKAC 3B93A 2QDRA 4E4SA 5T5LA 1NYWA 4PBOA 4W6YA 3VGIA 4LBNA 4K1ZA 1J59A 5DZEA 3GZAA 1BVVA 1PGW2 1XU1A 3AMNA 4R9BA 2AH2A 4IETA 3ZXKA 1HDKA 4CDWB 5FO8B 3RJRA 1MQTA 2DVGA 2WWSA 1D0GA 5FQ0B 1Q56A 2DVFA 3OCPA 1Y3TA 2ZTNA 2RS33 4SBVA 2PHDA 5DDJ3 3KGZA 4RR3C 5DDJ2 3WZ1A 2EVXA 4GULA 1EP0A 1KXGA 3NVCA 1AR83 1AR82 4A7ZA 2VW2A 2ZGPA 2VMIA 1HW5A 3IPVB 3RS6A 1PGSA 2WL1A 1WLCA 2D7FA 2PN5A 3B9IA 3ECQA 3LSDA 1WLDA 4IEWA 2ZGQA 2VXRA 4Q4X1 3FJSA 3NO8A 4NWVA 3U0ZA 3VKFC 1YIFA 3S30A 1PHMA 1K5MB 5E16A 5EV7A 5EZWA 3WXPA 1Y43B 4YW2A 4URTA 1H1IA 3ZYPA 3AMPA 4AFBA 1UIJA 1YI9A 3MFCA 4RS5C 3HN1A 5K0UB 4RQPB 1HRV1 2BYVE 2NYYA 3RNSA 2JG8B 4G4FA 2VOXA 2Y0IA 4R8HA 4YFWA 2DVAA 2X53S 4OHVA 4JTOA 1W6OB 1C28A 2JG9B 4FPEA 2PA7A 4RD7A 1AXZA 4LO4B 1ZZBA 5FAXA 1G9FA 5GALA 1ND3A 4MLOA 2A75A 5FMOL 4HETA 1YRZA 5F6LB 3TOJA 3RI8A 4CP0A 3DPRA 1UU4A 4W6XA 1LGNA 3MW3A 3H3UA 3BODA 4PQ9A 5JCTA 3HIFA 3BOWA 1WLTA 1N3PA 2CAUA 4B7EA 4GA9A 2BW8A 3GYDA 4E4ZA 3B7MA 3GALA 5CFDB 4IESA 4D94A 1N1YA 4YZ3A 4B4QA 2IXIA 3R05A 5SV5A 2AGSA 1OFSA 3OD4A 4WM8A 5HI0A 3JD71 4AQSA 2Q4SA 4IV1A 4SLIA 3TBDA 1MEC1 2X5IC 2XHKA 4AVAA 5DUWA 3CJIC 1WLWA 4NHLA 2VGDA 1ENXA 3AB0A 5FPZA 4L99A 1OHFA 1PNGA 3TRSB 3OTFA 3ILNA 2GNMA 3M1HA 2RM23 3USUA 2RM22 1X8MA 3ZSJA 4AEKA 1MZ6A 1EV11 1OA2A 3PVOA 4N7UA 3AYCA 1GQGA 2ETEA 2R062 2OZ6A 4LO5B 4Y22A 1R1A1 2WZR3 3VBOC 2WZR2 1NCQB 2WNUB 3S7EA 4FPFA 2MEV3 3CF6E 4K20A 3AYDA 4GXLA 1NCRB 1V9U3 4NOTA 1PVC1 2JEMA 3VBSB 1FPN1 2W39A 2A3WA 3WUDA 5BY5A 4O9GA 1TMF3 3IN9A 3TNPB 1TMF2 4QPIB 3Q9OA 5I0SA 1UIKA 3IDCB 4LBQA 1FT9A 5JSPA 2IWGB 1U12A 1I5ZA 1LOFA 1O3QA 3THTA 3ILRA 4RGAA 1B35C 2BBVA 1S0EA 1CONA 2EXIA 1QXJA 4KWLA 3KSCA 5H9SA 4FAHA 1PZ7A 2XJUA 4BMBA 2Z2SB 4IV3C 4CDWA 3HQXA 2CV6A 2XPJA 2WLPA 4YW3A 5FQ0A 2BVBA 3VHOA 1Q8VA 1GR3A 1YUDA 4Q4V3 3KCCA 3ZFGA 1FXZA 1ASJ1 4L92A 3ROUA 3MIGA 5FRAA 1W6MA 4Q0UA 4MUVA 3FBMA 1EAH1 1JHNA 1H2NA 2CWSA 2GU9A 3ZN6B 3BCWA 5DUXA 5GLUA 4WV8A 2D44A 2O8QA 3BB6A 1ZBE3 1ZBE2 4PLOA 2C9AA 4XE9A 2WFF3 4ZU5A 1BMV2 1DZRA 3EJKA 3IPVA 3PHMA 4FP2A 4MGKE 2W52A 5C8WA 4JTNA 3V0BA 4XJ8A 4YW4A 4EN9B 1FAYA 4FXKB 1CJDA 4JGZB 2HEVF 2YHJA 1D4M1 5GZGA 2XUMA 1FNZA 4E2GA 1DHKB 3POSA 4QGMA 4YFZA 4RQPA 4Q4Y3 2ILMA 1MVQA 5AC93 5AC92 3I59A 3B00A 4QGLA 5JOXA 1CAWA 3MICA 5FO9B 2EXJA 3B9CA 5H9RA 4EJRA 3KCXA 2KM2A 4YARA 2UURA 1MQTC 1RMU1 3MW2A 5A3LA 2ZHMA 4XQ4A 2Z42A 4FSJA 1UKRA 2CY6A 3M3CA 4BHPA 3DV8A 2R6QA 1D2SA 2R041 4QQLA 5D8AA 1ULGA 4Y1ZA 1XNKA 4JGYA 4XFFA 1HX6A 3DL3A 4QX5A 3BTAA 4KGQA 2BGCA 1YIPA 3M3EA 1LODA 2BTVC 4XW3A 4XQWA 4BCUA 3WW1A 1BVP1 2R1BA 1Z0HA 2HWD1 1M06G 1SBDA 5CFDA 4I09A 1JTZX 5AVAA 1Z78A 3N7KA 1RUG1 4CRQA 2EAAA 5HCAA 3RWNA 4OULA 4FP3A 4IXLA 2DCTA 5E89A 3LA3A 3AMQA 3DKWA 1CVNA 4A7YA 4D7YA 4HBNA 2MNGA 4NHMA 1OLRA 1C1FA 2ZGUA 3VBFA 1DZQA 2XL9A 4UBHA 3SISA 4CTEA 1U5IA 2C1FA 2GNDA 1U5XA 3W58A 4S2GA 2DCJA 4TZDA 1ND3C 2O1QA 3WQ7A 5I93A 5BUVA 2XBO1 1RUF3 2UY8A 1G9CA 4JRLA 1RUF2 4YZ5A 3ZFEC 4FPJA 4UBGA 3V0AB 5CFCB 2HWB3 1POV0 3VL8A 3DPRC 3KB5A 4HMZA 4XHBA 3NAPB 1LEDA 2WNUA 4Z1VA 1RUE3 2ZAHA 3I4IA 1NXMA 4S2DA 3ZXAC 1VAVA 1IS6A 1VBA1 5KXBA 4XJWA 2Q30A 1NY71 3AP7A 2IZWA 4MXWA 2ES3A 3ZXFA 2XVGA 4WM8C 3SCGA 3E6DA 2XKOA 4XJUA 4R9DA 4HANA 5T5OA 1H2LA 3VLBB 4X8NA 1V6KA 3R4SA 2D6NA 2D3SA 1H8TB 4R9CA 3VBHB 3M4FA 4PIXA 1KJRA 2HWC1 3WDXA 4NHKA 3SLIA 3G6JB 1VBE1 2HWF3 1VLNA 2HWF2 1CESA 2RR13 4XPVA 2E7AA 5C8CB 1IS4A 4M3CF 4U2AA 1HXS1 4H7LA 4KL1A 1XNCA 2D5FA 4INDA 2ZX1A 4Z8BA 4XQDA 2VPVA 4LUKA 1F2NA 2CL2A 2PHTA 3QACA 2UU8A 4LR4A 1HQWA 4QQHA 4XJZA 4E2SA 1COV1 3ZN6A 2V09A 4YYOA 2WJSA 3J8F3 5JI7A 4CEWA 4WM7B 2RS51 3H1MA 2YY1A 1H2KA 2PLV3 2LALA 2PLV2 3ZMNA 5LRRA 1J58A 4P9YA 3WHTA 4JGZA 4G3YC 1AZDA 3FFQA 3VHNA 1YFUA 2DVBA 2ARXA 3GZUC 3SCFA 5JZGA 3IM0A 4OI0A 5T50A 4L8QA 1PGW1 4YZ2A 5BNNB 3MIEA 5ACA2 4HLTA 3WQ1A 2GN7A 1SFYA 4JVAA 4Q0VA 3SITA 1FX5A 3AP5A 3GHNA 4UW3A 4CDWC 3JBG3 4XF0A 1YI7A 4S2FA 1FV3A 5KHGA 1GZWB 1VBB1 5FLHA 3N3HA 3MYXA 1VRH3 1F5FA 1KDKA 3ZIXA 1SCRA 3ZFGC 1HQNA 1AR81 3KLSA 2YC0A 3OY8B 4EWEA 1LR5A 5BNPB 3AP6A 1F8VA 5IT6A 4NWWA 5KBFA 2H6CA 4OI2A 1UF2C 1WMEA 4Q4W3 1NXD1 2XKPA 3FC0A 3I7DA 4Q4W2 3O0VA 5J98B 4HFSA 3FE5A 5GLZA 1PNFA 1OLQA 4RQPC 2WZPP 3JCIA 5C33A 1NE6A 4WBBA 4MZUA 4OHZA 1X8EA 3LOIA 4QM8A 2HJIA 2O8OA 3UJOA 5C9AB 4NO4A 3JU9A 5J36A 2Q0AA 4B8EA 3VBUA 3MGUA 4AG4A 3RMYA 4H55A 4HPKA 4DINB 1XYNA 1NA1A 2ZCWA 4C0BA 3VUOA 1S0IA 3EBRA 4CDQA 3WHUA 5D8AC 4JGYC 2YROA 4P14A 5KXEA 1UD1A 3MFAA 2A7AA 4YZ1A 2WIIB 3ZYGA 5JAXA 5LRSA 2WS92 2A3XA 4CDXA 4CEYA 2GDFA 1WMDA 3JUUA 3S6PA 4Z92B 1ND2B 1AYM3 5CFDC 1W6PB 1AYM2 1FMD1 1VIWB 1SLTA 1DGWA 2JE9A 2VY0A 2VMHA 2K0GA 3ZSEA 4X6QB 5FPXA 2D93A 3D6EA 4L9BA 3SH5A 3CJIA 1PZ9A 5GJ6A 4Z07A 5FCCA 4ATEA 4AHXA 4YM2A 1AR93 1ENSA 3WDWA 4B7KA 1AR92 1E57A 4EWAA 5BYNA 4I01A 2ZKLA 3WW4A 3BALA 4AI2A 4AFMA 3NKTA 1QQP3 3AKRA 2WKKA 2ZBJA 1CAVB 2P37A 2R061 4FOWA 4N9IA 3D0JA 4C0HA 2WT2A 5JOZA 1FOD3 1FOD2 2AZ5A 2A70A 5IK4A 4RGGA 3HR9A 1KDMA 1IKPA 1AL23 4RFT0 4QPGA 1AL22 2NPIA 2WNUC 3J26N 1RC6A 3QLQA 3VKNA 2BWAA 2ET7A 1QXPA 4W65A 5EYYA 1RUI3 1RUI2 2P3KA 1QGLA 2BWCA 4Y24A 5EYXA 3FHIB 4PIYA 3IKWA 1O5UA 1MZEA 1LOCA 4JDNA 4ONUA 2YZ4A 3KT4A 4YVSB 2RMU3 3WLUA 2F4PA 5KHJA 4JQRA 1XE7A 2GNTA 1AR63 2I2SA 1AR62 3EHKA 2HWE3 2HWE2 2GH2A 5FTTC 3V65A 2TBVA 1ZREA 1KD7A 3ILFA 1Q8QA 2Q5TA 5CG8A 1PZ8A 2ZPXA 3IMNA 4D7SA 1O3SA 5ABJB 1ENQA 4GB31 1V6NA 3R0RA 3JZVA 1IPKA 4KU8A 3WP3A 1AYN3 4PIZA 1AYN2 2VUJA 2GAUA 3LA2A 4J1XA 1RIRA 3ES4A 3ST7A 2E6VA 1N3QA 4AEMA 4LHLA 1J1LA 1CJPA 5J96B 4CEWC 4QQOA 1PO13 2A6YA 4HK9A 4AVBA 2XWBB 4N7IA 2B45X 1JBCA 1IOAA 2YV8A 1GSLA 1RINA 3FX3A 4AI0A 4JGZC 4CDUA 3L2YA 5A33B 2DFCA 5JZGC 1MS5A 1Y9QA 3H1WA 5J37A 3CEWA 4ZXKA 4PBPA 3H8UA 5BNQA 5AC91 1ZRDA 3L9JT 3ZXJA 2P3JA 3VKMA 3ZYRA 2D3RA 5C9AA 4AK3A 1I3HA 1POV1 2Q1MA 1IPJA 2RHPA 5BXXA 4FVVA 1UU5A 2WSUA 4K1YA 4Y20A 5DUUA 3DN7A 4Q0QA 3PTYA 4QMAA 2WC2A 1BYHA 4E2QA 5BNOA 2LTNA 3BOPA 2A6ZA 1QJU3 1RUD3 1QJU2 2Y0OA 4I3GA 1RUOA 2RS32 1IS3A 3MF9A 3D5OA 4CYDA 1QJY3 1TQ5A 4LBKA 1AR73 1QJY2 3T2TA 3ZYJB 1H9WA 4JDMA 1NQDA 1ULFA 4KG8A 2WFPA 2DVDA 2A6VA 2R49A 3S7IA 2DCKA 2RJLA 1X82A 4LLOA 1UL9A 1R093 1R092 1ZZ6A 2G4IA 3ZFFB 3WP6A 2H0BA 1Q3EA 2TEPA 1ND2A 3VZJA 2PYTA 1OOPA 4Y1UA 3URFA 4TYSA 4COZA 3H9AA 4UW6A 5FLJA 4Y1XA 3WG3A 3ZIWA