2RM22

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2200
4YVSC 1ND3C 1RUJ3 4FTEA 1VBE2 1EAH1 4AEDA 1RVF2 4Q4Y2 1POV3 2RR13 1HXS3 2Y26A 2HWF3 1QJY2 3VBRA 1PGL1 2RS32 1FOD1 1MEC1 5BNOB 2ZTNA 3ZFEA 5BNPC 1TMF2 5A33A 2HWC2 1COV1 4CEYA 1V9U3 1RUH3 1Z7S1 3DPRB 1PGW2 4GH4B 2RS53 3J8F1 4WM7A 1R1A2 2R071 1RVF1 5GKAC 1K5MB 4N43A 4LLFA 1RVF3 1NCRB 5C9AC 2HWB2 3JB8A 3ZFFC 4JGYC 4CDXA 1AR73 1MQTA 4CDXB 1VBD3 3TN91 1BBT2 2BFUL 4N53B 1HRV1 1RUH1 1ZBE1 4QPIB 2FZ2A 2WWSA 4AEDC 3JD72 1D4M1 1VRH2 5ABJA 2RR11 1POV1 2BUKA 4Q4W1 4JGZB 5L7OB 1NA1A 4BCUA 4WM8C 1RUJ1 1QJU1 3JBG1 1QJU3 1NA1B 1FPN1 1POV0 1AL21 1PO22 3VDDC 3VBSA 4RS5A 1BMV2 1RUG1 1RMU3 4Q4X1 1OOPB 1CJDA 3ZFGB 5LK7B 4Q4V3 1B35B 4JGYB 1ZBE2 4CDWC 1NCRC 2R043 1EAH2 3DPRA 5ABJC 1HXS1 3HAGA 1PVC1 1PVC2 3LOBA 1NY71 1AR83 1AR61 4N53C 5K0UA 5CFDC 2WLPA 4CEWA 1PO23 2HWE3 2HWD3 4QPIC 1HRI3 3VBRC 2MEV2 5AC92 5CFCA 1HRI1 2RM21 4WM7B 1RUF2 1BMV1 2PLV3 1VBB1 3JD71 1R083 2GH8A 5ABJB 5A33B 1QJX3 1RHI1 1M06G 4QPGB 1TMF3 1VBA2 5K0UC 4FTBA 1AR72 4YVWC 1R091 2RS33 1R093 1X33A 2X5IC 4GMP0 1VAKA 3DPRC 2R063 5ACA3 1OOPC 2WS92 4CDQB 1OPOA 1C8M3 5BNPB 1R081 2WS91 2HWB3 4RQPB 1FMD2 4CDWA 2WS93 1F2NA 4RS5C 1V9U2 1ZBA3 3NAPC 4GH4A 3VBFC 1ND3B 5A32B 4WM8B 3S6PA 4Q4Y3 1RUC2 1RUC1 1H8TB 2HWB1 1ZBA2 1E57A 1QJU2 1PIV3 1HQNA 1DDLA 4IV3A 1VBA1 5FMOS 3VBRB 4YVSB 4PDWA 2R062 3VBHB 5J98B 3VDDB 4IV1A 1D4M3 1Z7S2 1RUI3 4Q4W2 5C4WB 1PO11 3ZFGC 3JD73 1HXS2 1RUG3 1ZBE3 5CFCC 1FMD1 1D4M2 1VRH1 1R1A1 2R072 2RS11 1AR92 4RHV1 1NCQA 1RUJ2 4IV3B 1RUC3 2PLV1 3CJIA 4QPGC 2BPA2 1VBD1 4YVWB 1NG0A 4N43C 5FOJB 5DDJ2 1AR82 3VBOB 1H8TA 1X36A 1BEV1 2MEV3 5AC93 1MQTC 4WM7C 4CDUB 2HWC3 5JZGB 2RM22 3ZXAC 1COV3 1VB4A 5BNNA 1HX6A 1RUI1 4CDQC 1RUI2 4Q4W3 1Z7S3 3NAPB 4CDUC 1AR91 4GB32 4RHV2 4RQPC 5C4WA 3VBUA 2ZAHA 3VBFA 1QJZA 2RR12 2HWF1 4GB31 3VBOA 4PDWB 1SMVA 2WFF3 1R092 1WCDJ 5DDJ3 1VBD2 1VBC2 5C8CB 1AUYA 4Q4X2 1ND2B 2X5IB 5J96B 1AR62 2XBO1 3J8F3 1RB8G 1F8VA 1K5MC 1ND3A 2RS13 5C8CC 1EV12 1VRH3 1V9U1 4RQPA 2TBVA 1RUD3 2BBVA 4CDQA 4RR3B 1FOD3 1VB2A 5BNOC 3IDEA 3JB4C 1AYN1 1VBA3 1RUE2 1NCQC 1PIV2 1RUE1 4Y5Z0 1MEC3 1NY72 5C9AA 1H8TC 1AR71 2FZ1A 5CFDA 3VBUC 5D8AA 2HWE2 1PIV1 1AL22 4Q4X3 4GMP3 1RUF3 1NCQB 1BBT3 4CDXC 1B35A 1GFF2 2RS12 5BNNB 1EV13 1EV11 5JZGA 1VBB2 5C4WC 3VBSB 2R073 5C9AB 1ZBA1 4GB33 4CEYC 1OHFA 5BNNC 4FTSA 4RHV3 2WFF1 1QJY1 2RMU1 5K0UB 4PDWC 1RUE3 1MEC2 2RS31 1RUH2 3VBHC 2WFF2 4GH4C 1TME3 1PGL2 2ZZQA 1W39A 4SBVA 1CD3G 4RFT0 1PGW1 2HWC1 2VQ0A 1HRV3 1QJX2 2WZR2 4WM8A 5A32A 1QJX1 1RHI3 4QPIA 3VDDA 1NA1C 3NAPA 1AL0G 2X5IA 3J8F2 1ND2A 4JGZC 4N53A 5L7OC 4Z92B 3ZFGA 5C8CA 4RS5B 1IHMA 4IV1C 3JBG3 4Q4Y1 3TN92 1QQP3 1R1A3 1BEV2 5D8AB 1VBC3 5CFDB 1C8NA 5DDJ1 4FSJA 1ASJ3 4IV3C 2BFUS 1FOD2 2DF7A 1PO21 4GMP1 1AR81 2QQPA 1HRV2 4RR3A 1AR63 1PO13 4CDWB 4Y4YA 3VBOC 3CJIC 4QPGA 4JGYA 1RUG2 1OOPA 4CEWC 1PO12 2WZR1 1RHI2 4CDUA 2RMU3 2HWF2 4IV1B 3ZFEB 1RUD2 2R041 4NWVA 5CFCB 3VBHA 1EAH3 2PLV2 4CEWB 1VBC1 1BEV3 1QQP2 2XPJA 3CJIB 1ASJ2 1ASJ1 1RMU1 2HWE1 4Q4V2 1AYM3 4AEDB 1MQTB 1AYM1 5ACA2 4NWWA 2RM23 1A6CA 1AL23 1BBT1 1FPN2 4EJRA 5JZGC 2HWD2 1AYM2 2HWD1 2R061 5ACA1 2GSYA 3VBFB 2RS51 1FMD3 3VBUB 5D8AC 2XBO2 2WZR3 1PVC3 3ZFEC 5BNPA 1B35C 3FBMA 4YVSA 1VBE3 2RMU2 4RR3C 1AR93 1VBE1 3ZFFA 1QJY3 1AYN3 3VBSC 1RUD1 2R042 1TMF1 1TME2 1TME1 3ZFFB 5BNOA 1COV2 3M8LA 3TN93 1AYN2 5FMOL 3JBG2 1NCRA 1QQP1 4N43B 4Q4V1 4YVWA 1HRI2 1K5MA 1FPN3 1RMU2 1VBB3 2MEV1 5AC91 1R082 1ND2C 4JGZA 5L7OA 1NOVA 2IZWA 2RS52 1RUF1 2XBO3 1C8M2 1C8M1 4CEYB
chains in the Genus database with same CATH superfamily
4YVSC 1ND3C 1V0AA 4BQ1A 1TVGA 3LEGA 4HL0A 3UJQA 3DGTA 1EAH1 3MIGA 5DAVA 2Y33A 3IN9A 4AEDA 1REDA 1YQ5A 3UL2A 1D2SA 4Q4Y2 2JG9A 2LTNA 2QQLA 4QU1A 4DS0A 3WY6A 2HWF3 3FUQA 2WN3A 5F2WA 2VXJA 2UWAA 4D7YA 2JDPA 4G3YC 3RJRA 1MEC1 1HV1A 1D7PM 1UY3A 4NE9A 1DGWA 3POJA 4HG6B 3N3HA 4W50A 1Q8QA 1LOAA 1YC61 4YW3A 1F35A 4PHZA 4Q2FA 2GP3A 1UL9A 1XE8A 2HWC2 4CEYA 3UKVA 3WR0A 1ZX5A 1V9U3 5DMYA 1RUH3 4LBQD 4I30A 2RDNA 5KBFA 3DPRB 4N7IA 2EXKA 4QPYA 2JEMA 1J1TA 2ZCWA 3DXUA 3FJSA 5FYZA 1UXZA 2H0VA 5FZ8A 2JE9A 4XF3A 4XCBA 1GP6A 5FPXA 5J1XA 2R071 1OA4A 5F1RA 5GKAC 1W05A 4LHKA 1DQ1A 2LROA 4N43A 3M3QA 4ZHNA 1GZCA 1NCRB 4WVMB 5KXDA 1C1FA 1RXGA 5C9AC 2ZHMA 4FI9A 4I0AA 4NR1A 3JB8A 1K12A 3RVHA 2EXHA 1FATA 4E4ZA 1DIWA 4CDXA 1AR73 4CDXB 2B8MA 4C8DA 1JYWA 1ZYBA 1W8TA 3NNJA 4N8MA 5JIUA 4X8PA 5JLVA 2BU9A 3C2UA 1D0HA 2G19A 4BQXA 3WP6A 4ATFA 1JHJA 1OQEA 2BQPA 2KA3A 1J1LA 2BWAA 3AP9A 3CMGA 4N53B 2D43A 3ELNA 5FYUA 4BA6A 2A6YA 1ZBE1 4QXBA 1LTEA 2WDBA 4XFAA 4QPIB 2FZ2A 1KFXL 4ZONA 1KS4A 1UKRA 4N90A 3JD72 1VRH2 4A42A 4HPKA 4LO5B 3C7OA 3O5SA 4ES9A 1GMMA 1NE6A 3GALA 3GZTB 3LCPA 5J3UA 1LHUA 2WO3A 4Q4W1 4XXPA 2NPIA 3E6BA 3IZOA 4YW5A 4OZXA 5L7OB 3O0XA 1N3OA 4ONUA 2EXJA 4NHLA 4AVSA 1ZZBA 4P02B 4TTGA 2DCKA 2VW1A 4S2FA 1REFA 2AENA 1PM7A 4UT5A 1JN2P 4NO4A 4XMIA 4N9HA 1UYXA 2A6VA 1DLLA 1LCLA 3ABZA 3FBYA 5G05L 1XB9A 5A7PA 3JBG1 1UN1A 3VD4A 3HIFA 2PA7A 3DKWA 3K77A 3OYWB 4HANA 2VXRA 5C7GA 5FK7A 1PO22 3ILFA 4PQ9A 5IHRA 1JZ6A 3K75B 5HCHA 4HSLA 3VDDC 2DCYA 1HV0A 3LDRA 4XJWA 4Y3OA 4XAAA 1OOPB 3ZFGB 3I3QA 1LHOA 3N9MA 3T4HB 4AQSA 3OJBA 1MS9A 4JGYB 4M01A 4YM1A 2WSUA 1UU4A 2WAOA 1BHGA 1H1AA 1QH7A 4CDWC 3MUY1 1QKQA 2P3KA 4BIOA 3U4XA 3O1MA 3WP5A 5LW9A 1J58A 5DZFA 2BGCA 2WQZC 5L73A 3OTFA 1PVC2 3C7HA 1SEFA 1NY71 3USUA 2VZSA 3HR9A 2WZPP 1LOEA 3SLIA 3LKJA 4Q0PA 3EXUA 5FR3A 1SFPA 2VMDA 3LA2A 4I3PA 4XAEA 5CFDC 3D0SA 1YRZA 2XLAA 1PO23 4JV4A 4QMAA 1HRI3 1SBFA 2XHNA 3H9AA 4FPCA 1CAXA 1IS3A 2C24A 5DZGA 3ZYHA 2RM21 3ALQA 3S5QA 5JR2A 1URXA 1N3PA 3TNQA 4AGRA 3OCPA 1IGOA 3G6JB 3QCWA 1RUF2 1BMV1 4GJZA 3JZVA 1GZWA 1H2KA 2GH8A 5A3WA 4ASKA 1UY0A 1QJX3 4PIXA 3WF3A 4EN7B 1QF3A 5EFUA 1W6MA 1M06G 1I5ZA 1WKYA 4URTA 5C70A 4QPGB 4MYEA 2WRAA 2ZGMA 4FFIA 2CGNA 1LR5A 5IAVA 3MIFA 1U5YA 3M2MA 2ZX0A 2ETEA 3SC7X 3V65A 4K6BA 5C5UA 2YGLA 3OF1A 4JCKA 5K0UC 4FTBA 4OMDA 4AQ2A 3N35A 4I02A 2B9UA 4A7YA 2XKOA 1JODA 4YARA 3GCXA 5EV7A 2EIEA 4EWDA 3VHPA 2Q8DA 4CU9A 4AYUA 2O8QA 2WS92 1MVQA 2E9QA 1US2A 2W39A 4IEUA 3POEA 1W8ZA 2ILMA 2IXCA 3OGJA 3POBA 5CU1A 5A3LA 1OVPA 1ONAA 2JDMA 4FPEA 5I0RA 2WS91 2HWB3 4XJUA 2VMGA 1YQ6A 4RS5C 5CKQA 2X10A 1J59A 3NAPC 4DXRA 1W28A 2CNAA 2GC1A 1BXHA 3S6PA 1OF3A 1W2TA 2WZEA 4DEVA 1W6PA 5T5OA 2OZ6A 3T3YA 4Y4RA 1E57A 4E8CA 3FX3A 5FZDA 2V4VA 4XDOA 3ZYRA 5D1IA 4BPZA 5FZ6A 2GP5A 2J22A 2WABA 1ZRIA 3MDPA 4BQYA 3RG0A 2KD7A 1CIYA 4D7TA 2WQ4A 2ZJCA 2EVXA 4XFCA 5CIRA 5FMOS 1Q8VA 2O1QA 3FC0A 2QZ3A 3IDAA 4UBGA 4OLLA 4NIIA 4COUA 5A6XA 2G1MA 3DYOA 5FZBA 2VZUA 1OFNA 4HFSA 3AVRA 5LBCA 3UGFA 3PU3A 1SLAA 5KHKA 1D4M3 4Q4W2 2ZEYA 4NHKA 3POSA 4LUKA 4CYDA 3ZFGC 3JD73 5CFDB 5DAQA 1HB4A 2VZTA 1NZCA 1PX4A 2RE9A 1AZDA 1VRH1 3D5OA 1VRBA 3FMGA 4MG2A 1R1A1 3TAYA 2RDQA 4P9XA 4CRQA 4XCAA 2OPWA 3DECA 2ZZJA 5CEHA 2QQNA 4YW7A 3U11A 3QBQA 1Q5OA 3OD4A 4ZY9A 2CGOA 3H1YA 5APAA 4YVWB 1G6NA 1NG0A 4MXWA 1I9RA 4XF9A 1WW6A 3LFIA 2BV4A 3CJXA 4GXLA 4N43C 2Y38A 4FPGA 3R6SA 3TWIA 5FZLA 3LQCA 3VBOB 1LU2A 4H3WA 3K3NA 2DCJA 2Y0OA 1X36A 4OULA 3ZN4A 5LRSA 3J26N 5T5JA 1O5LA 2VCBA 3HBKA 2OA2A 5FLHA 1Y7BA 4QHZA 2XWBB 2GALA 1VB4A 5BNNA 3OPTA 5BPXA 3VHOA 1ODNA 4UFJA 4A3XA 2IXJA 1RUI1 2VMHA 2GH2A 4C1XA 4D0QA 4W4ZA 4M3CF 4ZKTB 4CDUC 3GHNA 1XU2A 2EIDA 4GB32 5CG9A 1UCXA 2W5FA 5BXXA 5GZFA 1FYUA 4GB31 4UI9L 3KV4A 3MIDA 4XEZA 4FOWA 4NIDA 4JKMA 5A7NA 1FV2A 2WFF3 3VZJA 1OA3A 1R092 3AZYA 4XYXA 4UFKA 3WDVA 4H7MA 1VBD2 1IPSA 1U5IA 2QUOA 5C8CB 1PMIA 2A7AA 4LPLA 4P5YA 1POQA 5KR7A 1AR62 2I2SA 2JECA 2MNGA 5C3OA 5KXCA 3NSTA 3RZMA 4UW4A 2WZ8A 3D8CA 2GNMA 4PT6A 1RB8G 4I3GA 4A6SA 4JTOA 1F8VA 2VCMA 1RL3A 3FE5A 5F9TA 2BGPA 2JG8A 1SDWA 2JDUA 1ZRCA 1VRH3 5F6KA 1CAXB 1NZIA 1XYPA 3H1WA 5A6YA 4Z1VA 2PHWA 1JW6A 4EN8B 3I2DA 3KV9A 5GLVA 4E2QA 2OKXA 2BBVA 2YFUA 4AI1A 2ZX1A 1UYPA 1ENQA 1FOD3 1VB2A 3D6EA 4MGZE 4OMCA 2A3WA 3NNLA 3MZHA 4HXCA 1YFWA 2W1UA 3NL1A 1JZ2A 3JB4C 3UESA 2ZXQA 3V0AA 3SKVA 1EYBA 4XJ9A 3VD5A 4Y5Z0 1NCQC 3VKFC 1WCKA 3IAPA 1W04A 2XLGA 3BIWE 2VD7A 4GJYA 1KD7A 1Z0HA 5L9VA 3VBUC 1Q8OA 3OD0A 1XRUA 2QQWA 3IIIA 5IVJA 1U5ZA 1MS5A 4AZZA 5EIYB 2FMDA 4H14A 2WKKA 4ZXKA 1RUF3 3H0OA 1BBT3 5FZ1A 3WNNA 5FK8A 1XNTA 3VDBA 4MGSA 1B35A 5FZOA 4AGVA 2RS12 5A7SA 3MYXA 1O6UA 3RFRA 2PFWA 4O7XA 3ME2A 5JZGA 3T4VA 1ZRFA 2YC4A 3Q8CA 3T30A 2JIGA 1MACA 2R073 3ACLA 5DQ0A 5H9QA 4D6RA 4CCLA 1OH3A 4GB33 4CEYC 1OHFA 5BNNC 1W0OA 3NV3A 2VZOA 4IE0A 3LEKA 5DAPA 3B00A 5EZWA 2B39A 2OS2A 2WFF1 5FPZA 3VUOA 4RFRB 1ZVFA 2DU1A 4KNCA 2PELA 2PHUA 4NVPA 1PGL2 2ZZQA 3NQHA 2AH2A 1W8FA 4QB2A 1DFQA 4MV2A 2XMLA 4TWTA 5EJZB 4QX3A 4XDPA 5F8PA 3ZYBA 3KB5A 4D7SA 2UY9A 4WM8A 3RSJA 5A32A 3ZYFA 1HN0A 1RHI3 2DVBA 3WZ1A 1MS1A 3VDDA 2Z79A 4K9SA 5T5PA 3NAPA 1XNDA 5FWEA 1DQ0A 1PVXA 4DEQA 5GZGA 4JGZC 3GXUA 4AW7A 3ZFGA 3S7EA 2IXLA 4XC9A 5C6CA 5K8SA 3LEIA 1IHMA 4D6SA 3SNMA 3RMXA 4M3CE 1NT0A 4IUGA 4R9AA 1ULDA 1GNYA 4QB6A 3PIJA 3S7IA 4FPKA 1FOD2 2QFEA 2BNNA 3EHKA 1PO21 2YHJA 1AR81 2DDUA 4UYBA 5HBAA 3N9PA 3RYPA 3AMQA 4NPMA 5DUXA 3H8OA 5FY1A 1O3TA 3E97A 4YFWA 3BPZA 1NLRA 5A1AA 3A22A 4Y4YA 2A71A 2VULA 4QPGA 4DY5A 3OY8B 2QVSB 4K8RB 3JQWA 1RUG2 1NUKA 5IVBA 1G9CA 4UOJA 5CYYA 2ZPXA 1XNCA 2WZR1 2J1UA 1RHI2 5CZKA 2D6LX 3AXEA 4UXAA 1Y43B 2AZ5A 5LBBA 5JIAA 4BQ3A 2VMIA 2AGSA 2KR2A 2XB6C 5CB7A 4FAGA 2DCTA 5JMCA 1W6QB 4NWVA 4EV0A 1OBNA 3AL6A 3VBHA 1O4YA 3KMHA 3OBTA 3RI8A 5CFCB 1WA6X 1K5JA 2ZOEB 4WZCA 3KD4A 3VB9A 3H7JA 3SHRA 2ORZA 1VBC1 1EPWA 1WD3A 1BEV3 5EJ3A 1XPWA 5B4XA 3THPA 4LBQA 1N1TA 2FQPA 4Q1RA 1QNWA 2HEYF 3EQEA 2XPJA 2XJQA 3RWNA 4NROA 3OBAA 3T1LA 4AEDB 4IEZA 3ZXJA 2BP6A 2RM23 4MXVA 2ZACA 3TEWA 2PMWB 5C3RA 3WD5A 4CXWA 2GSYA 3OSDA 3EBRA 1ZZ7A 2RS51 4EN6B 3B94A 2QQVA 1RITA 3AZXA 4W6YA 2UURA 3IMNA 2BBAA 3OUJA 2FDGA 2ZBJA 4FT8A 5FZKA 1HKDA 2RJLA 4OUMA 2LS6A 5FZHA 1JTZX 2WR9A 1XC6A 3O1VA 1AR93 1VBE1 4P5HA 1QGLA 3H42B 5KWRA 1AYN3 3C7GA 1TME2 1WBLA 1EUUA 4BXFA 5BUVA 2AYHA 4HT1T 1YQ8A 2WO1A 2ATFA 2WO2A 2TUNA 2BGOA 2VY0A 4AFDA 1K5MA 2HYKA 1UPIA 4G9SB 4XZPA 1S0CA 2D98A 4OVEA 1RXFA 1EUTA 2RJ2A 1ULOA 5C3SA 1ND2C 5FYYA 5JWPA 1DU3D 1NOVA 2VZVA 5L7OA 3WDTA 2IXKA 1RUF1 5I91A 4FFFA 1PK6A 5FJKA 3SISA 3UGGA 1RJ8A 4B1LA 3V0BA 3O0VA 5F39A 4Q8KA 4JDNA 1RUJ3 4FTEA 3B69A 2LW8A 4IETA 4I01A 4ISQA 4BQ4A 4FOYA 2R0FA 5C3PA 3O14A 4QX5A 1OLME 5LZ6A 5JOYA 1ENRA 2VTFA 3AKQA 3ACGA 2B9VA 2XJPA 3AK0A 4BYYA 2G9FA 1QJY2 2YG0A 5HV4A 1I1EA 1PGL1 4AFAA 4QGNA 1W9TA 5JXJA 3AYDA 4TXWA 5BNOB 3B01A 4QB1A 3AKPA 4LA3A 3BTAA 4V2WA 4YW4A 4Y5TA 4DUXA 4XTPA 4NHMA 1GZWB 5I0UA 1OURA 4GWMA 4DXSA 2GAUA 1D2QA 4URAA 5EPAA 1W03A 1WCUA 1KFUL 2Q5TA 2XGXA 4GH4B 1UOJA 1UZWA 2RS53 3J8F1 3WG1A 4GZ9A 4ARYA 3V64A 2E6VA 1AX0A 3J7MA 3I2FA 4XJ8A 1K5MB 3WW1A 4LLFA 4C1WA 3B9CA 5AFBA 3ECQA 1REEA 2QBXA 1JOBA 3KLSA 2VPVA 3KVAA 5FYVA 4N7UA 4ZS3A 4LXLA 1ALYA 4FP2A 5JOXA 1GLHA 2A6ZA 2OUJA 3URFA 3WHUA 2ADDA 1Q3EA 5FBJA 3TN91 2W47A 5A70A 2JJ6A 3GHMA 2YU1A 1TZOA 3TBDA 1IS4A 1E5RA 2W68A 1GSLA 4FPLA 3WW2A 3THDA 4GKXA 3WP3A 4DUWA 1LGBA 1HRV1 1RUH1 2YU2A 4QQHA 3S0MA 2ZGLA 4NJ4A 2WNEA 4BM8A 4L2NA 2BNMA 2XH6A 4C0BA 5JI9A 2PQQA 1OUXA 2WWSA 2YROA 3PVBB 3SCGA 1D4M1 4GWJA 4AEDC 1VMJA 1YUDA 2UWBA 1POV1 2RR11 3LA3A 3N9LA 4QU2A 3I2GA 4JQTA 2IVIB 4E27A 5LA0A 2K0GA 4Y20B 3U37A 3T09A 3MLJA 3CU7A 3LB9A 2AREA 5FUPA 4AWDA 1NA1A 2QDRA 2VOVA 4PF5A 2H6BA 1BKZA 2VW2A 3RRDA 5L19A 4BCUA 5C33A 4WM8C 1JYIA 1RUJ1 4BJ0A 1LJ7A 1QJU1 2VNRA 5EP9A 1ZZ8A 2A1XA 5IK8A 2ERFA 5IYYA 3J4UH 4FPFA 4RL7A 2QQJA 1JMUB 1POV0 3VZNA 1AL21 5EQUA 5FCCA 5IVEA 2V73A 4PIYA 5HPOA 1O4ZA 4AEJA 1RYYA 1WMXA 1CVNA 3AFGA 3LEMA 3NKGA 1YI7A 1RUG1 1RMU3 2R32A 1U5XA 3GZUC 4P9LA 4Q4X1 1CJDA 3BKZA 3T1MA 3H8XA 1B35B 3PL0A 5FZOB 4RGAA 3LDKA 4LBJA 5IK5A 3WQ7A 1ZBE2 2PHDA 3OUIA 3LSEA 4YW1A 1JUIA 4FQ4A 4CCDA 1PNGA 1VP6A 2Z4FA 3WCRA 5LBEA 2NYYA 1HXS1 1GQHA 1CX1A 2JX9A 3GM8A 4L8QA 4CPBD 1WZXA 1PVC1 4XBNA 3LOBA 3FLTA 4HMZA 1HQWA 1V70A 1BZWA 2D6KA 4M00A 1EP0A 3HBZA 2FBEA 1C1LA 2XLFA 3QH7A 4OFGA 1U12A 1GOFA 1UX6A 1ZNPA 2BZDA 1WMEA 5K0UA 2DBNA 2WLPA 1N1SA 3ZIXA 5A1LA 1JZ3A 2HWE3 2HWD3 4QPIC 1KDMA 2EXIA 1XSQA 2MEV2 2VECA 4QQLA 2ENRA 5AC92 5CFCA 5J09A 1HRI1 1JU4A 5FPAA 1CZTA 4MOAA 5JOWA 1YWKA 1W9FA 3WHTA 1XNAA 3RZGA 1UO9A 3CZUA 2JKXA 2PLV3 3DYMA 1VBB1 3T2PA 2BOIA 4QAWA 5HCBA 3ZXGA 3BU7A 1QWRA 1RHI1 5A3PA 3FHAA 4AG4A 4AVBA 4BE3A 2WYFA 2VBBA 4EE2A 2E7AA 4QDRA 3NV4A 4AEKA 3F2ZA 3KCYA 1TMF3 1UZVA 3R0RA 2V5DA 2ZX3A 2EALA 1CAVA 1KJLA 1K45A 1LOFA 2VH9A 4TSVA 4A41A 4D3WA 5DG1A 1AR72 1FI2A 1KJRA 1YNAA 2O0OA 3E5XA 3FN9A 2D44A 4KU8A 1NLQA 3JU9A 2VVDA 1CAUB 1GQPA 2F6BA 2RS33 3LIHA 4IE4A 5FP4A 2X5IC 3HN3A 1C5HA 4ZS2A 4JHZA 1VAKA 4PBOA 4WVWA 1H0BA 2R063 3DPRC 3WUDA 2O8OA 5KC5A 4YM0A 2DFCA 1DG6A 1ULFA 4ITCA 4EZHA 2YY1A 1F15A 2VNGA 5FO9B 1AF9A 1NQDA 1OVSA 1OT5A 1RC6A 1JXNA 3FFZA 1A8MA 5L36A 3FZ3A 4LKFA 1F2NA 1FAYA 2WN2A 4FXGB 1V9U2 2W92A 5CBLA 3GZEA 4Y24A 4XOGA 5J7MA 5A32B 4WBBA 2W87A 2FMYA 4WM8B 1WLTA 1RUC2 4HKOA 1RUC1 4BU2A 5FLIA 4PQQA 4Z82A 1OSGA 1QDCA 3U1XA 4AOCA 5CKNA 3I59A 4Y1UA 1GKBA 2B42B 4YM3A 1PIV3 4XIKA 4QXCA 3VD7A 1HQNA 2ARXA 3AYEA 1DDLA 3JXSA 3VHNA 5L9BA 3IPVB 2Q0AA 2D3PA 1T2XA 2XL9A 4IV3A 2G4IA 4OUEA 3VBRB 3O1RA 2IUWA 5FBZA 5CNAA 5CA6A 3C3VA 5IWFA 2JD9A 5FZCA 3TEYA 2WWUA 4UBHA 4CUAA 2VOWA 4QKBA 5C4WB 3VD9A 1PO11 1HB3A 1RUG3 3RYKA 5FKCA 1ZBE3 2RV9A 3ON7A 1RINA 2RS11 1AR92 2OQ6A 3K46A 1IPJA 2Z2SB 2PLV1 4AHZA 4UF0B 1AXYA 4JX0A 1YFYA 2BEOA 4OI4A 1F5FA 4PJYA 5FY9A 4DUVA 1WLDA 5E88A 1QXJA 4ORFA 4CCKA 1GV9A 1SPPB 1W6PB 5JMOA 2EAAA 4E9KA 4BH9A 2FDKA 2MEV3 3WINE 2ZKNA 5AC93 1KQRA 1MQTC 2JXAA 4WM7C 4A45A 3WT3A 2G9ZA 3P3PA 4MGQA 2YBKA 3WDXA 4DY3A 2RM22 3ZXAC 4OHWA 2AUYA 4DRVA 4R9BA 3OG2A 1W6OA 2HH9A 1OD5A 4QQ2A 1CGPA 3GBWA 4DB5A 1HX6A 3HT2A 4META 4Q4W3 2VM9A 4ZU5A 2XONA 2ZMLA 5I8TA 1QJFA 4I09A 4L0PA 1G9FA 3SKJE 2W08A 4Q0QA 4RHV2 3VBUA 1PZ8A 4XIOA 4DMIA 2FDFA 3VN4A 1VMHA 3CLPA 1FNYA 4LBOA 4BB3A 3A4UA 2K46A 4XURA 3VBOA 3H8UA 2BERA 1ULGA 3FL7A 3ZMOA 1WCDJ 5KHJA 2D3RA 2ZA9A 2CWMA 2JB4A 3KWVA 1SLLA 3RZJA 1VBC2 1YCIA 3C7FA 4XBLA 3TB0A 3ZX7A 3WQ0A 4Q4X2 1ND2B 3O1OA 5J96B 4C91A 1V6OA 4IE5A 2WNVA 2Y64A 4XF0A 2YMZA 3D4KA 3NV1A 4DOUA 4CPBA 3J8F3 2GC0A 3POFA 3U07A 1H4GA 1ND3A 3ZYPA 4W65A 4XHBA 3MW2A 4O9GA 4COVA 5FY7A 3I2HA 4P9IA 2C26A 4RQPA 3SH5A 2WNVB 2I74A 3ES1A 3O12A 2PAKA 3THTA 2Y6GA 2WA3A 1FNZA 3VGIA 1LGNA 1GU3A 1RUD3 5FAXA 4CDQA 3HNBM 4FAHA 1SLIA 3IDEA 3M7AA 3WNKA 3AM2A 2VMEA 3MIBA 2E7TA 4YGDA 1AYN1 4K21A 4YNIA 5FMDA 3I59B 1PIV2 1OQ1A 1RUE1 4JZRA 2Y8KA 4YG3A 4ZXEA 3WNMA 2JIJA 2Z5WA 5C9AA 1V6KA 1A78A 1H8TC 2VJXA 2ZHKA 5FFOC 3ZSKA 2FZ1A 4NRMA 3V0AB 2I45A 2HWE2 1PIV1 3TEZA 2QQIA 3DKQA 5LY1A 4GMP3 5LWBA 3RGBA 5JPMB 2ARBA 2FDHA 1CAWB 3J9SA 1SDDB 4AQTA 5F5IA 2J1SA 2P34A 1MS0A 4CU6A 2CAUA 5FLJA 3LDBA 2ZGPA 1JYTA 5FPUA 2JG8B 5FRAA 4AI9A 3UT0A 4LE4A 2Y6JA 5F5CA 2BWCA 3UKNA 3BALA 2HEWF 2YC0A 4PLMA 3S30A 3CIHA 4DXZA 4RHV3 3PTYA 4L97A 3G7DA 1OKQA 2RMU1 2YPJA 2YPDA 4OZOA 5FQ0B 4Z8BA 3I49A 2CV6A 1MEC2 4QQOA 2DVGA 2UY8A 2IXIA 2JDYA 2WFF2 3NMBA 4KG0A 4R8HA 1TME3 2HJIA 1JOJA 2JDKA 1J84A 1SFNA 4SBVA 3J7NA 3M1HA 1DZTA 4I0BA 4AE2A 3CHXA 1YI9A 2GN7A 4CA9A 4KH9A 1BK1A 1BYHA 2ZABA 1XE7A 2HKXA 3N7LA 4QPIA 3N9OA 3IKWA 4YYOA 4PIZA 1QH6A 3GJBA 1IQAA 5DG2A 1Q8PA 3J8F2 4N53A 1I3HA 4Z92B 3H3ZA 4OYUA 1CX4A 1CAWA 1CZVA 5FMCA 1Q43A 4GWIA 4RS5B 1ZRRA 2XVKA 2DTYA 3N7MA 4D69A 1PX3A 2WJSA 3AVSA 4Q4Y1 5FZ4A 3TN92 1R1A3 1BEV2 2W3JA 1VBC3 4ZU7A 2E33A 4BWOA 1DZRA 3L9JT 1GOGA 2VAUA 4FSJA 3K3OA 5C3QA 4IV3C 2W1WA 2ZGKA 1UZYA 3MF9A 2DF7A 2XOMA 2CL2A 4GMP1 4LOSA 2QQPA 1QXRA 1OPMA 3QOPA 3N9NA 1UW8A 1XBFA 3NO8A 1LOBA 1AR63 4CE8A 1IG3A 1VJ2A 4DXTA 4CVUA 4LT5A 1LKNA 3USSA 3UJOA 3ACHA 1W6NA 3MO4A 1EPZA 1ZA7A 3UV9A 4KI5M 2J1RA 1OOPA 1UX7A 4GULA 2BOJA 4XFFA 1UMIA 3R05A 2YBSA 2LALA 1XXNA 3CEWA 2VVFA 2AC1A 2P1BA 4CDUA 1HJGA 2W1SA 4MGKE 2RVAA 4F83A 3VZOA 2J7MA 3PNAA 3KGZA 1LGCA 2E31A 3EJKA 2ZGNA 1G7YA 4K1ZA 5H9PA 4KWKA 4PI0A 4JHTA 2XKPA 1MZFA 4FPHA 1SLTA 1GBGA 4A44A 4CUGA 5E6HA 3RZLA 4XUTA 1MS8A 3MF6A 4A7KA 3ROUA 1ASJ1 1SBDA 2VNVA 4EN0A 2RDRA 5FP9A 1XJAA 3U14A 2HWE1 2D6PA 2P5BA 4XUPA 3CL1A 4IEQA 4Q4V2 1MQTB 5IVCA 1OD3A 1DHKB 1LHWA 1UOGA 4JRLA 3J7HA 4QXHA 3D3AA 1A6CA 1W90A 3POGA 3ACIA 1LU1A 3KT1A 4LUMA 5JZGC 2HWD1 1WW4A 1QJEA 2R061 4QHOA 4XQ4A 3BIEA 2JDAA 2WNUC 3VBFB 3RWKX 4GWNA 2VUJA 3VBUB 1C57A 1VMFA 5FY8A 2VC9A 4QPWA 1AX2A 2ET7A 5FPVA 1R64A 4YGCA 3WQ1A 4Y1XA 2PN5A 4YG6A 2Y0IA 2NMOA 1M4WA 3ZO0B 3E6DA 4YVSA 2ES3A 3U0ZA 1S0GA 4FBFA 4IEXA 1LODA 2YV8A 4KL1A 2EA7A 2XJSA 1TMF1 1TME1 3H3UA 1SZBA 1CAUA 1TG7A 3ZFFB 1COV2 2CHHA 5DABA 1N1VA 3ZN6B 5BV6A 1AHSA 3JBG2 2H0BA 3INAA 3HNMA 2CYFA 4Q4V1 5C5TA 5FYMA 3HEIA 1FPN3 2Y6HA 1JHNA 1R082 5J36A 5KC6A 4JGZA 1LEDA 2Q4SA 4XFIA 4DNYA 3BB6A 1DCSA 2RS52 1CIWA 4AI2A 3WOGA 2J42A 1BLZA 2CTVA 3OPWA 4CEYB 2F4PA 2A6WA 4YZ1A 2NN8A 1OH4A 1ODMA 2A73B 1WUVA 3BN6A 4P08A 5JXHA 1QY4A 3K51A 5DN2A 2P37A 3GDBA 4DIQA 5IVVA 3LZZA 4LQRA 4FP3A 5FYHA 2SBAA 3HD8B 3VHRA 1H4HA 2C6SA 1UOBA 2RG4A 3ORJA 1FOD1 5JI7A 3RJ2X 4XMAA 5T54A 4S2GA 2ZTNA 4JTNA 5BNPC 3B9IA 1QEXA 1TMF2 3JUUA 4CCNA 1RUOA 1UQXA 4BZ4A 1JH5A 5IVYA 4GAZA 1FXZA 3WNOA 4R4ZA 4XJZA 5FDBA 3KV5A 1V6LA 3V0BB 3PUQA 1LULA 2VGDA 2X8KA 2ET1A 1PGW2 1ULPA 4Y33A 1G9DA 3FLRA 4QX1A 2MPFA 3ZKUA 3HOBA 4AI3A 3PDQA 4DINB 1W3XA 2VUAA 1RVF1 1ZZ9A 5K9YA 2E7QA 2NLRA 3Q9OA 1ACCA 3K48A 1QNYA 3DV8A 3AP7A 1Y9GA 1YQCA 2HWB2 4KGQA 4OHZA 5CVRA 2BTVC 4FVVA 4IGOA 1VAVA 3ZFFC 3AZZA 5IUQA 1MQTA 1MZEA 2P2KA 1W06A 1V6MA 5JPNB 1VBD3 1BBT2 1G9BA 4FPYA 5C71A 1UYZA 3OOXA 1C5IA 1YJKA 2HYXA 1GUIA 2PTMA 1A34A 4XZUG 4IEVA 5I0TA 4QHBA 3TOJA 2DUPA 2JE7A 1PZ9A 4TYSA 1QOSA 1W9YA 2YBPA 1NKGA 4Y5SA 1DP0A 1APNA 1W8HA 2ZMNA 5IT6A 3S5AA 1U0AA 4QM8A 3LF7A 3K4AA 4XW3A 5ABJA 3ILRA 1WWYA 4XHXA 2BUKA 1A8DA 4MHUA 1US3A 2B46X 4YGEA 3T2OA 2NP0A 3I2OA 3FHIB 4C0HA 1F9KA 4UW5A 5FZ7A 3SEPA 3WNPA 2DVFA 2WNUB 5FZ3A 2XDVA 1YFXA 3WX5A 2B5HA 2Y6FA 1VIWB 5A3NA 3DCQA 3POWA 2PHTA 2QTWB 4ISRA 3PUHA 2JICA 2ZMKA 2W1QA 3LSDA 4AAXA 2GMEA 1QJU3 2DWRA 3ZXFA 4XETA 1FPN1 4QKNA 1W6QA 1NQJA 5GJ6A 2ZHLA 5LA9A 3WLUA 2K9ZA 2SLIA 1NYWA 3WP4A 4RS5A 1BMV2 1Q8SA 2FCVA 1CWPA 4DFSA 3S57A 5F2SA 2WAAA 4KBBA 1O7FA 5LK7B 4Q4V3 3T2QA 4AEMA 2JB8A 5LA2A 2GNBA 4NUBA 2P3JA 3AP6A 1ZRDA 2V72A 4QX8A 2DURA 1RTVA 5A7WB 2IFWA 2R043 1EAH2 1UYYA 2J1VA 2X53S 2P6CA 1WMDA 2QQKA 4HLTA 5ABJC 3WDUA 4V1PA 3ZN6A 4IDZA 4N9IA 2F17A 4WVZA 1L7RA 5LASA 1VR3A 4LKSA 1AR83 2VL4A 4BK4A 4A4AA 3RS6A 2VVEA 5DPNA 3MUZ1 5GALA 5IFTA 4FO9A 4XFBA 4BXSV 1CN1A 4DPNA 4CEWA 5IJRA 2ZEWA 2JG9B 3D82A 3ZXEA 1VAMA 4CU8A 2X29A 2WNUA 3ZYIB 4WM7B 4K8FA 4LHNA 4XDQA 4E2SA 1W2NA 5IVFA 3NW4A 2DUQA 1LHNA 3AC0A 3I2KA 3JD71 1OKOA 5A3TA 1R083 4A2UA 2XHKA 2AACA 3AP5A 4FXKB 5A33B 5ABJB 4A6OA 1ZM1A 3OGRA 2XJTA 5T52A 1H2MA 1IG0A 5L9RA 2W2IA 4XQDA 2YB7A 2VR4A 2Y60A 1BVVA 1J3RA 4AK3A 4IW3A 3FUOA 1UY4A 2DVDA 3NNGA 4LIVA 1TE1B 1R091 4UW3A 5IATA 5F32A 2BW8A 1UAIA 1X33A 1ULEA 1TQ5A 4GMP0 4B8EA 2YYOA 3H8RA 3AKSA 4U36A 4ET7A 1JU3A 5ACA3 3BODA 1G9AA 1OOPC 2JG8C 3ZSJA 4CDQB 5JUVA 2ADEA 1W6NB 3UNPA 1S0IA 4NRQA 5B4NA 1W9SA 3E1F1 4BQ2A 2Q1FA 4W8JA 3KQ4B 2Q8CA 4CSWA 3BU0A 5I8SA 4UWDA 5FZFA 3PVNA 4EWAA 4IEOA 2CSGA 2A3XA 2AR6A 1CJPA 1OLRA 3I2IA 3MI8A 3KF3A 4Q4Y3 2A6XA 2Q8OA 1TEIA 5CKMA 4S2HA 1H8TB 2C4XA 3O1SA 5CG8A 3A0NA 3EB7A 1QJU2 2PQSA 1N3QA 3B02A 2VOTA 3LGRA 4CP2A 5KHIA 5JSPA 4V2VA 2WT0A 1S4CA 4Q8LA 2WNOA 1NAEA 2ZGRA 4CCOA 1VBA1 2VE1A 3KQRA 2GC3A 2J1AA 4JC1A 3NRUA 4YVSB 3I3BA 4CZSA 4NRPA 3QLQA 4PDWA 4YW2A 1S0EA 3WUCA 2R062 3VBHB 5A7OA 2R0HA 3T2TA 3VDDB 4UAPA 3WW4A 4BMEA 1GANA 1W8NA 2VZPA 4MGYE 4NHXA 3ZYGA 1IZ3A 4COZA 5GZCA 1RUI3 1O59A 2R1BA 1WW5A 4HKWA 1PK6B 3EO6A 5CFCC 2B4KA 4BHPA 1UU6A 1EY2A 1LEMA 1SBEA 1UKGA 3A23A 1YIPA 4IQPA 4B4PA 1CQ9A 2QQUA 2FDJA 2J1TA 1UOFA 1MS3A 3MGUA 4S2DA 4BIFA 1Y4WA 3CJIA 4M3CA 4EN9B 2BPA2 2TNFA 5HCAA 4IEPA 3DN7A 4Z2AA 5F3EA 5DDJ2 1AR82 2VTXA 1W8WA 2D6NA 3ZLIA 5FO8B 1O3RA 4CCJA 2XL7A 4Y26A 1HN1A 5E8AA 2YXSA 2KXLA 3I97A 4HBNA 3ZDVA 1UIKA 2WUHA 4K3UA 2BVVA 4IE7A 4CDUB 1O3QA 1IOAA 4OHYA 1UIJA 2HWC3 4PLNA 3OEAA 1I5PA 5FUIA 3WV6A 4LO7A 1COV3 3QD6A 4XQWA 5JSRA 5J48A 2R7EB 1JYXA 4QDSA 1Z7S3 3NAPB 1J3PA 1HLCA 2H6CA 1H1IA 1E5SA 1JOPA 4QXKA 4BISA 3W59A 2JDZA 3L2HA 1H9PA 3NVCA 4Q0VA 2ZAHA 1QDOA 4XILA 3AMNA 5C4WA 3VBFA 1OFSA 2HWF1 3UETA 1GNZA 3B7MA 1IPKA 3VZKA 4AHYA 4YLZA 3RZKA 3IAQA 4PDWB 1SMVA 2VMFA 2O14A 5A80A 5CADA 1X82A 4XUNA 5EJ1B 4QD2A 3OGVA 3T0BA 1DQ4A 1S55A 2CGPA 1RUNA 2A5ZA 4IEYA 5DDJ3 3OGSA 2AEZA 3U78A 1B09A 5FPLA 1AUYA 1OMIA 1SCSA 5FV3A 4WVVA 5FXZA 3WDYA 4ES8A 4OQ8A 2X5IB 1YO8A 5M0TA 1LAJA 1ZA4A 3PLQA 2XBO1 1YHFA 4EROA 1ENXA 1MZ5A 4P00B 3BTXA 5C8CC 1EV12 3E5QA 1UU5A 4XF4A 5FYIA 1V9U1 1WA4A 1XNBA 3WNLA 1PNFA 1HW5A 3SITA 3Q8BA 3U4SA 3TYJA 4BK5A 4XPVA 3HQXA 4XBQA 1GZTA 1DYKA 2P17A 2YGMA 3POYA 3CF6E 4LE3A 3MLKA 4AF9A 1KITA 1S2KA 4GKYA 4YFZA 3I3DA 3ZOIA 2VQAA 2D6OX 2DTWA 1VBA3 1IS5A 1LECA 2JD4A 3LA7A 3P3NA 3VKOA 3KHBA 4TZDA 4YGBA 1MEC3 1NY72 1XYNA 2RJKA 4LR4A 4MO3M 4B29A 3LPGA 4XABA 1AR71 2XQXA 1GOHA 2XVGA 2Z69A 4K40A 3THCA 2WL1A 4BDVB 4DZGA 1AL22 2TEPA 3PJQA 4YZ5A 1S0JA 4TLFA 5FXXA 4GALA 2Q1MA 2WQ8A 1NCQB 5DZEA 2RDSA 4FOQA 3MEPA 4CDXC 3BTYA 3Q8FA 4P14A 3A0KA 3VBRC 4HVQA 5F37A 5BNNB 1PMHX 1EV11 3VDAA 1VBB2 5C4WC 1FT9A 1SHWB 3VBSB 4QKFA 1H8VA 2DCZA 3MFCA 3WDWA 4HN1A 5JOZA 2UU8A 3GNEA 5ANQA 3KF5A 3VL8A 1Q56A 4R52A 2ZKLA 2WLQA 4MXWB 4PDWC 3ZIWA 3B5LB 3IBMA 1SCRA 5FJHA 2IVJA 4P9YA 2RS31 3KHCA 5GLUA 1RUH2 4FPJA 1BJQA 1NXMA 4GH4C 5FMBA 2Y6KA 3VD3A 5I8YA 2QKDA 4OI1A 4LJHA 1W6MB 1Y9QA 4EYUA 2F4LA 1CD3G 3DXTA 3WVJA 4NPLA 2HWC1 4I2OA 1QJX2 2WZR2 1PK6C 2JKBA 4UFMA 5DXDA 1DLCA 3HQUA 1AXKA 3VL9A 2FD8A 4FOVA 1WW7A 4HSJA 2UYBA 3ILNA 3WF4A 3LFMA 2VOKA 4PCRA 1NA1C 4NIHA 1SQ4A 1DBNA 1HDKA 4B7EA 2X5IA 4CCCA 4AXOA 3DYPA 1G8WA 2B45X 5HXVA 3LD8A 3NJXA 3ZXLA 2R16A 3AFKA 2L9LA 2XUEA 4ATEA 1DQ2A 1UD1A 3WF1A 4H2AA 4XACA 3JBG3 1PGSA 4FFGA 4XUQA 3H1MA 1QQP3 2A70A 3BOWA 4R9CA 5AVAA 4XE9A 3VV1A 4GA9A 3MFAA 1CPNA 3RZHA 5DDJ1 4LORA 4ZU4A 1ASJ3 1UY2A 3AMPA 4HK9A 4D94A 1XU1A 3ZKYA 1NLSA 2C9KA 2ZEZA 4LBNA 1O3SA 1HRV2 5HCFA 1IQDC 4RD7A 2LRPA 1DGRA 3R4UA 4KQ7A 1JZ5A 1PO13 3VBOC 4YWAA 3ITQA 1O4TA 3I2JA 4JGYA 3Q8AA 2WINB 5SV5A 1BQPA 3HPNA 3M3CA 5LB6A 4XFGA 4UW6A 1L7QA 4LTAA 2WFPA 3OBRA 5GLZA 3AYAA 1UPSA 2HWF2 3HT1A 3I4IA 2PAEA 1RUD2 2R041 3OYWA 4IV1B 5EWSA 3ZFEB 1SPPA 2P6HA 1Y3TA 4CP9A 5HV0A 2PLV2 4CEWB 2R1DA 5LEJA 4Y1VA 3GBFA 2XWJB 4BMBA 2D7FA 1AVBA 1STMA 2V4AA 1C3HA 3CJIB 4M3CB 4M4RA 1YIFA 2VMCA 2JWPA 3SMHA 2WWJA 1WMFA 4UFHA 2QQMA 4SLIA 4YM2A 3GJAA 1AYM1 5ACA2 2Y34A 5FO7B 2ID4A 3ZXKA 3CBNA 1AL23 3CQOA 1BBT1 1FPN2 3H3LA 5FKBA 2EF6A 2OUHA 5A7QA 4EJRA 4Q0UA 1HB2A 2OYZA 3M4FA 1FMD3 5FXVA 3X29B 4E4DX 2D5FA 2GNTA 5D8AC 1S0FA 5LRRA 1X7NA 1VLNA 1W8UA 1OLQA 3NJZA 4EQVA 3N4MA 2BJSA 5BNPA 1LRHA 4HZFA 4IESA 1B35C 3W5MA 3FBMA 5H9RA 4Q0SA 2QDNA 2RMU2 3WQBA 3KM5A 4P9JA 2LUWA 3NKTA 5F3IA 4RR3C 2OVUA 4UFIA 2GNDA 1DQ5A 5CISA 3ZFFA 4IGPA 2Q1ZB 3E5UA 3VKLA 3BVCA 4FCAA 1GNHA 1RUD1 2ARCA 2R042 2WYSA 3H50A 1CONA 3USUB 4L9BA 5F5QA 1T6GC 5BNOA 3TN93 5DUVA 3AZVA 1AYN2 1NCRA 2Z42A 4WVMA 4RA0A 4YG0A 1QQP1 4IE6A 5JR7B 4N43B 5HI0A 4YVWA 1HRI2 2DBIA 3M3EA 4AHXA 2MEV1 5AC91 3B3QE 2WSVA 2XR4A 4KMQA 5FZ0A 5FY5A 5T5LA 4OHVA 2CDPA 1DZQA 4AFBA 1ENSA 3AL5A 2IZWA 4OQ9A 2E63A 2LM3A 5LY2A 3U75A 3W5NA 4KWJA 1SACA 4QQPA 4D8MA 1JZ8A 5DUUA 3T0DA 1VBE2 2RHPA 2HBTA 4LK6A 2ZEXA 1RVF2 3MICA 1DYOA 3LOIA 4LBKA 1UWWA 4W6WA 5GZEA 3D0JA 5LK5A 1POV3 2RR13 1HXS3 2XXZA 4JVAA 4TN7A 1YYNA 2Y26A 4AHWA 2YC2A 2N7GA 3PVOA 3VBRA 4C90A 4OI2A 3IMMA 5A6QA 4GQ7A 1CZSA 1UMZA 2RS32 4JRAA 5FZ9A 4U2AA 3L2YA 2VZRA 1TNFA 1GWLA 1SLBA 1X8MA 3ZFEA 1XNKA 4BOWA 3PURA 3MLLA 5A33A 1COV1 4AVCA 1T6BX 3LPFA 4I0WB 2R49A 4RSUA 3WF0A 3W9AA 3KCCA 4HPKB 3ZVXA 2V09A 2FCTA 1Z7S1 4QGLA 4AI8A 5CAZA 2PYTA 3KVBA 1Z78A 2C9AA 3ZPOA 4BQWA 2BDRA 2ZX4A 4WM7A 2W91A 4AI0A 3BTZA 4CCEA 1LB2A 4H55A 2OXBA 2OPKA 1R1A2 4L92A 3WG3A 2XG3A 1VPHA 4HOOA 4IEWA 3N7KA 5LATA 1RVF3 5BNQA 1H30A 1UMHA 3I54A 3NJYA 2VG9A 4JGYC 3AKTA 3MHZA 4MVTA 2AEYA 4LNVA 4WZFA 5GM0A 2CY6A 5KHHA 1AX1A 3RPQA 2QCSB 3ZSLA 1HB1A 2PHFA 2VUCA 1W0PA 4LBQB 1D4VB 2BFUL 3TRSB 3BI3A 1CAVB 4XXAA 2R30A 3K2OA 1SG3A 4MZUA 4CP9B 5TSWA 1ZZ6A 4PI2A 2J1EA 5I0SA 2JG9C 2OZJA 2W52A 3EMRA 3RZZA 1JYNA 3SEEA 3VZMA 3I3EA 4IXLA 2QQOA 2XJUA 5IW0A 2DVAA 1IKQA 3SH3A 3WF2A 3LAGA 1JZ7A 1JUHA 1HJFA 2WBKA 1PM4A 3NNMA 1N1YA 4JGZB 2IWGB 3UGHA 4F7ZA 5LBFA 5ERLA 4CCMA 1J83A 2VZQA 1O8SA 2ZS6B 3BCWA 3PTRB 2WA4A 5A3OA 3BUCA 3BGAA 3KSCA 5BYNA 3WSOA 4Q29A 2ZGQA 3DL3A 1CR7A 1KDKA 2DU0A 2WNVC 3MIEA 1JYVA 1NA1B 1V6JA 3IB3A 3N36A 4LIUA 4MLOA 4GD4A 3IWZA 3APBA 1YLLA 2W95A 3VBSA 3E6CC 3GCWA 2VZ3A 5JVVA 2OQ7A 3EYPA 4O9EA 5JCTA 3WG2A 5FUNA 1X9PA 1YQ2A 2Q30A 1IKPA 4E4SA 2YFZA 4LBLA 5ISLA 2JE8A 5DAXA 2VUDA 4FPOB 5A3UA 1NCRC 3POIA 4O61A 4XFHA 2OIIA 5E16A 3DPRA 3KV6A 1MR5A 4COYA 4CP1A 5FIXA 3HAGA 1WCQA 2ZHNA 2WIIB 2NMNA 1IS6A 5FREA 4INDA 5JAXA 1OXCA 4NIAA 1LOFC 3R4SA 5BY5A 5F6LB 1NE4A 2C1FA 2VNOA 1JBCA 2D5HA 2ZGOA 1AR61 4N53C 1E5IA 2W46A 4Y22B 4AGGA 5IK7A 4J6GA 2EAKA 4B1MA 5IAXA 3V56A 1H6YA 1TNRA 1O91A 3GGLA 4YZ3A 2HBUA 4MX3A 3WXPA 3ZYJB 4BQ5A 2UWCA 1QHDA 1C4RA 4MADA 3UK9A 2OW4A 4Y20A 4Q5OA 2GDFA 1W0NA 4YW6A 1XQNA 4NHYA 5FXWA 1MZ6A 4XF1A 5JDBA 4AFCA 3ETPA 3OGGA 1LHVA 3O0WA 2GMPA 1R1ZA 3FFQA 1W8OA 3PMSA 1NX9A 2XQRA 3PMEA 2GZWA 2VO5A 1QOTA 1OLMA 1YJLA 3KS7A 1LOGA 1GYKA 1VBA2 5LEKA 5LA1A 1YFUA 2BNOA 2EIGA 1F5JA 3HN1A 3MV11 4B7KA 3M3OA 4BLIA 2I07B 4RGKA 4Q26A 5FY0A 3SCFA 1R093 5IK4A 3DUIA 3ZR6A 2ZAAA 1JI6A 1XOYA 1MS4A 4M0NA 3MPBA 3R4DB 4ARXA 1ZREA 3AZWA 3IDCB 2K2SA 3AJZA 4COWA 1K3IA 3MPPG 4ASMB 4X6RB 5FP7A 4IGQA 1YEWA 4AQ6A 2DUOA 1F31A 3AP4A 2VZ1A 4NAMA 5G04L 4HVRA 1OPOA 4X6QB 1C8M3 5BNPB 3BPSA 1R081 2BYVE 3MW3A 4RQPB 1FMD2 1SFYA 2WS93 3ST7A 3PJYA 4CDWA 1UXXX 2B7YA 1ZBA3 3KT7A 4GH4A 3VBFC 1ND3B 1S0DA 4BLJA 5T50A 5T55A 3U10A 1GR3A 1V00A 5J37A 5K7PA 3AYCA 3LIGA 2ZX2A 1H9WA 1ZBA2 2HWB1 5F7UA 4MGIE 3HNYM 3A21A 1C28A 1OI6A 3W20A 2VQUA 3ETQA 3LWCA 1PMJX 3JCIA 5FQ0A 5GLTA 4OCTA 4DO0A 2WO7A 4Q1PA 1KGYA 4CU7A 3MBWA 2PAMA 3SQOA 3WW3A 1GQGA 2V5YA 3ES4A 1L7LA 1RIRA 5J98B 2XUMA 1QOOA 1GWMA 4MH0E 1JYCA 4IV1A 2FCUA 1G86A 4K1YA 4QDQA 1Z7S2 1KEXA 1DGLA 4QM9A 1OF4A 1HXS2 4R4XA 4CP0A 1FMD1 1D4M2 2D6MA 5FYTA 2R072 1DGRN 3ZN5A 1W6OB 2HLEA 3P6BA 4RHV1 3TNPB 1NCQA 4CUCA 5FWJA 1RUJ2 4IV3B 3T0AA 1RUC3 1LENA 2P3YA 4FFHA 2A75A 2CDOA 4QPGC 1VBD1 3HJRA 2NQYA 1L3JA 2PHRA 1DF0A 5FOJB 3OPZA 1GZ9A 4LO6B 4NMIA 3RDIA 5FZEA 5T3NA 2CU5A 2Y6LA 1H8TA 2C5DA 1BEV1 5ACA1 1W2AX 3NNFA 3Q8EA 2BVBA 4LITA 5FZIA 1HIXA 3LE0A 5E89A 2YUEA 5FZGA 5KXEA 3O1PA 3A7QA 3O1UA 5EYXA 4XUOA 5SV8A 3SXWA 3T08A 5JSOA 5JZGB 3J7LA 3NV2A 4IERA 4KU7A 3KT4A 3SH4A 3TEXA 4JAAA 1ULCA 2UYAA 4L99A 4ZPIA 2D93A 4CDQC 2G9GA 3OY8A 1RUI2 2GMMA 4IL7A 3AX4A 2PHLA 3SCHA 5C8WA 4H7LA 2E32A 1AR91 1VE0A 1JS9A 3DEMA 1QMJA 3BYWA 3FLPA 1MVEA 4RQPC 3N9QA 3ZPYA 4EZ4A 5A3MA 3VLBB 4JKLA 1QJZA 2RR12 5LCWL 2DV9A 3O7OA 5FZMA 1LESA 1J3QA 1WD4A 2ZGUA 4HKLA 1LOCA 1H2NA 1BCXA 3IM0A 4PBPA 3ENRA 4E4HA 3I8TA 4B4QA 3OB8A 4KWLA 2WT1A 3AB0A 4LULA 3VKNA 4E2GA 4E8DA 1JZ4A 1XYOA 1W3VA 3WG4A 1E5HA 4A3ZA 4Y1ZA 4ZZ5A 2QNKA 4ZZ8A 5ANNA 4LMFA 4K7JA 3VDCA 1CESA 5B2GB 2W94A 1OQDA 2YZ4A 4D6QA 1K5MC 2MHFA 2RS13 1O8PA 3PUIA 2PHXA 3C8XA 4QWNA 2E53A 3MW4A 1UZ0A 5FPBA 5AVPA 3FWEA 4AVVA 2TBVA 2JENA 5A1FA 5FP8A 2VU9A 4JQRA 4YZ2A 3ACFA 2NZ9A 3B93A 5K4LA 1XSRA 3I7DA 4RR3B 5BNOC 3QACA 2WC2A 5KHGA 3OBZA 3ZDSA 3C7EA 3VZLA 1RUE2 2P3IA 4QX7A 1OC1A 3WEZA 3RI9A 4LEJA 2VBPA 5FOBB 3NJVA 5CFDA 3ZMNA 4YRDA 5D8AA 1UF2C 3HQRA 4JDMA 4AAPA 4F3JA 3IT8A 4Q4X3 3HWJA 4YSFA 4AFMA 1WCSA 4UF0A 4DRRA 3ASIA 5A7WA 3UYJA 3KGLA 1X8EA 1AJOA 3VKMA 2DFBA 2XVLA 3BOPA 1H1MA 3GZAA 3AJYA 1GFF2 1X50A 2VQTA 1EV13 4XJAA 4XVHA 5GLWA 4AL9A 4DQAA 5JXIA 3RQ0A 1K42A 3AMMA 4RGGA 2EICA 3I3MA 3OUHA 1WGPA 4HVOA 3PIGA 3CO2A 1KXGA 5C9AB 1ZBA1 5IFPA 2X09A 4G4FA 3PHMA 1XE0A 3ZR5A 4FTSA 1WLCA 2OX0A 4LKEA 4YVWC 5EYYA 2GU9A 2WT2A 4YPJA 1QU0A 1QJY1 2D97A 4LBMA 2CAVA 4LO4B 4B4RA 5AFEA 4B3NA 5K0UB 1RUE3 4O65A 2E51A 2VW0A 4NPRA 5FTTC 1X9TA 1YXWA 3VBHC 4NIGA 1BK0A 3ZXDA 2PXJA 1OA2A 2NM1A 4PLOA 4LKDA 2VCAA 1W39A 4F8AA 4LO8A 3PVEA 4RFT0 1PGW1 2VQ0A 5HXMA 1HRV3 1W2UA 4NOTA 4TLGA 2YDEA 3ATGA 1CPMA 4HONA 3RMYA 4X8NA 4QKDA 5FYCA 4XTMA 1P8JA 1OUSA 3CDZB 3NWKA 4LLOA 2VBDA 4RN5A 1QJX1 1AJKA 5D2AA 5FYSA 4EWEA 1MPXA 2ORXA 2OT7A 2C0ZA 3AXDA 2ZGTA 1AL0G 2JDHA 3CZJA 1ND2A 3HVDA 5L7OC 4P9WA 3HMYA 2JDNA 3PUSA 4OUSA 5C8CA 5F3GA 3CKHA 5F5AA 3RYRA 3ZSMA 1QIQA 2IXHA 4CXXA 5D21A 3P5BA 1WBFA 2KM2A 4IV1C 4Z2WA 5GZDA 1UZZA 3FHQA 5D8AB 4A7ZA 5I93A 3F95A 4KWUA 1HQLA 1V6NA 1N47A 3K4ZA 4NAOA 3UKTA 4CTEA 1Y9MA 2GC2A 1C8NA 2ARAA 4CXYA 1UNBA 1ST8A 2BFUS 3CNAA 2E26A 3QH6A 4M0HA 1QXPA 5E1RA 2GN3A 1KRIA 4HETA 4FQZA 2FHRA 2D40A 4LHLA 2QE3A 4RR3A 4Q27A 3AKRA 4CDWB 3CJIC 4GIQA 5DUWA 2W9XA 1GP4A 4LK7A 3RNSA 3MV01 4YZ4A 2P4EA 1D0GA 1WLWA 1VALA 4L11A 1PO12 4CEWC 2FDIA 3P1IA 2Q8EA 2W0XA 3IDBB 5DAWA 1I6XA 2RMU3 1A3KA 2A3YA 1GICA 1NXD1 1EAH3 3K4DA 2X05A 4KBZA 3M70A 1H6XA 3AMHA 3OEBA 3WNXA 1S2EA 4NN0A 1QQP2 4HN0A 4OHXA 1SLCA 3ZSEA 1ASJ2 1W99A 2IFRA 1RMU1 1S0BA 4MGTA 3M3IA 1O5UA 4QX2A 2BRTA 2R6QA 1AYM3 3PU8A 1S2BA 1ZZCA 4UFLA 3ZM8A 4ASLA 5F3CA 2VCCA 4NWWA 1PZ7A 2QZ2A 1W2OA 2XJRA 4W6XA 4WV8A 5KXBA 1LNSA 4AVTA 5FY4A 4QT6A 2HWD2 1AYM2 5FYBA 2IC1A 4J1WA 5FZAA 3WCSA 4Z07A 2DYCA 2ZGSA 3PUAA 2D3SA 4CUBA 1DQ6A 2VOXA 4QGMA 1AXZA 2XBO2 1RJ7A 5EXOA 1H2LA 4P9GA 2WZR3 1GWKA 1PVC3 4KGGA 3MIHA 4PF1A 3KCXA 4RYDA 1V6IA 3ZFEC 4AVAA 3W58A 1KS5A 3N7JA 4MUVA 3KZ4C 1GP5A 1DYPA 1VBE3 4Y22A 3IPVA 3GYDA 4MSVA 1FX5A 4M4PA 3GF6A 5I0DA 3O1TA 1BVP1 4OI0A 3GBGA 3JQXA 4MHRA 4AR2A 4LA2A 1QJY3 2HEVF 3VBSC 4HK8A 4LHSA 2QJVA 5A6ZA 3H7YA 1UY1A 4QX0A 2CWSA 3M8LA 4JDOA 1RGSA 3DF0A 5FMOL 4J1XA 1F4HA 2VTXJ 4LOTA 5EHDA 1RMU2 1VBB3 5H9SA 4JKKA 1FV3A 1S1AA 4K20A 4Y1YA 1PHMA 5JXGA 3W21A 1W9WA 2XBO3 1C8M2 3IIAA 1C8M1 2XJVA 1F4AA 4J25A 4KG8A 5FP3A 4R9DA 1DGWX 2EIBA
chains in the Genus database with same CATH topology
4YVSC 1ND3C 4BQ1A 4HL0A 3UJQA 3DGTA 1EAH1 3MIGA 4AEDA 3IN9A 1REDA 3UL2A 1D2SA 4Q4Y2 2JG9A 2LTNA 4DS0A 3WY6A 2HWF3 3FUQA 2UWAA 4D7YA 4G3YC 3RJRA 1MEC1 1HV1A 1DGWA 3N3HA 4YW3A 1Q8QA 1LOAA 4Q2FA 1UL9A 1XE8A 2HWC2 4CEYA 3UKVA 3WR0A 1ZX5A 1V9U3 1RUH3 4LBQD 4I30A 5KBFA 3DPRB 4N7IA 2EXKA 4QPYA 2JEMA 1J1TA 2ZCWA 3FJSA 2H0VA 2JE9A 4XF3A 5FPXA 2R071 1OA4A 5F1RA 5GKAC 4LHKA 1DQ1A 4N43A 3M3QA 1GZCA 1NCRB 4WVMB 5KXDA 1C1FA 5C9AC 2ZHMA 4NR1A 4I0AA 3JB8A 2EXHA 1FATA 4E4ZA 1DIWA 4CDXA 1AR73 4CDXB 2B8MA 1ZYBA 5JIUA 4X8PA 5JLVA 3C2UA 1D0HA 3WP6A 4ATFA 1OQEA 2KA3A 2BQPA 1J1LA 2BWAA 3AP9A 4N53B 2D43A 3ELNA 4BA6A 2A6YA 1ZBE1 1LTEA 4XFAA 4QPIB 2FZ2A 1KFXL 1KS4A 1UKRA 4N90A 3JD72 1VRH2 4HPKA 4LO5B 4ES9A 3O5SA 1NE6A 3GALA 3GZTB 3LCPA 5J3UA 1LHUA 4Q4W1 4XXPA 2NPIA 3E6BA 4YW5A 4OZXA 5L7OB 3O0XA 1N3OA 4ONUA 2EXJA 4NHLA 4AVSA 1ZZBA 2DCKA 2VW1A 4S2FA 1REFA 2AENA 1PM7A 1JN2P 4NO4A 4XMIA 4N9HA 2A6VA 1DLLA 1LCLA 3FBYA 3JBG1 1UN1A 3HIFA 2PA7A 3DKWA 4HANA 3OYWB 2VXRA 1PO22 3ILFA 4PQ9A 4HSLA 3VDDC 2DCYA 1HV0A 4XJWA 1OOPB 3ZFGB 1LHOA 4AQSA 3OJBA 1MS9A 4JGYB 4M01A 4YM1A 2WSUA 1UU4A 1H1AA 1QH7A 4CDWC 1QKQA 2P3KA 4BIOA 3U4XA 3WP5A 1J58A 5DZFA 2BGCA 2WQZC 5L73A 3OTFA 1PVC2 1SEFA 1NY71 3USUA 3HR9A 2WZPP 1LOEA 3SLIA 3LKJA 4Q0PA 3EXUA 3LA2A 4I3PA 5CFDC 3D0SA 1YRZA 2XLAA 1PO23 4JV4A 4QMAA 1HRI3 1SBFA 3H9AA 4FPCA 1CAXA 1IS3A 5DZGA 2RM21 3ALQA 1URXA 1N3PA 3TNQA 4AGRA 3OCPA 1IGOA 3G6JB 3QCWA 1RUF2 1BMV1 3JZVA 1GZWA 1H2KA 2GH8A 1QJX3 4PIXA 4EN7B 1QF3A 5EFUA 1W6MA 1M06G 1I5ZA 4URTA 4QPGB 4MYEA 2ZGMA 2CGNA 1LR5A 3MIFA 1U5YA 3M2MA 2ZX0A 2ETEA 3V65A 4K6BA 5K0UC 2YGLA 3OF1A 4JCKA 4FTBA 4AQ2A 3N35A 4I02A 2B9UA 4A7YA 2XKOA 4YARA 5EV7A 4EWDA 3VHPA 4AYUA 2O8QA 2WS92 1MVQA 2E9QA 2W39A 4IEUA 2IXCA 2ILMA 5CU1A 3OGJA 5A3LA 5I0RA 4FPEA 1ONAA 2WS91 2HWB3 4XJUA 2VMGA 4RS5C 1J59A 3NAPC 2CNAA 2GC1A 1BXHA 3S6PA 1W6PA 5T5OA 2OZ6A 1E57A 3FX3A 3ZYRA 4BPZA 5D1IA 3MDPA 3RG0A 4D7TA 2WQ4A 2ZJCA 2EVXA 4XFCA 5CIRA 5FMOS 1Q8VA 2O1QA 3FC0A 2QZ3A 4COUA 4UBGA 4OLLA 1OFNA 4HFSA 1SLAA 5KHKA 1D4M3 4Q4W2 4NHKA 3POSA 4LUKA 4CYDA 3ZFGC 3JD73 1NZCA 2RE9A 1AZDA 1VRH1 3D5OA 3FMGA 1R1A1 3TAYA 4P9XA 4CRQA 2ZZJA 3U11A 3QBQA 1Q5OA 3OD4A 2CGOA 3H1YA 4YVWB 1G6NA 1NG0A 4MXWA 1I9RA 4XF9A 1WW6A 3CJXA 4GXLA 4N43C 3TWIA 2Y38A 4FPGA 3R6SA 3VBOB 1LU2A 4H3WA 2DCJA 2Y0OA 1X36A 4OULA 3ZN4A 5LRSA 3J26N 5T5JA 1O5LA 2OA2A 5FLHA 1Y7BA 2XWBB 2GALA 1VB4A 5BNNA 5BPXA 3VHOA 4A3XA 2IXJA 1RUI1 2VMHA 2GH2A 4C1XA 4M3CF 4ZKTB 4CDUC 3GHNA 1XU2A 5CG9A 4GB32 1UCXA 5BXXA 5GZFA 1FYUA 4GB31 3MIDA 4XEZA 4FOWA 1FV2A 2WFF3 3VZJA 1OA3A 1R092 3AZYA 4XYXA 3WDVA 4H7MA 1VBD2 2QUOA 1U5IA 5C8CB 1PMIA 2A7AA 1AR62 2I2SA 2JECA 2MNGA 5KXCA 3NSTA 4UW4A 3D8CA 2GNMA 1RB8G 4I3GA 4JTOA 1F8VA 1RL3A 3FE5A 5F9TA 2JG8A 1SDWA 1ZRCA 1VRH3 5F6KA 1CAXB 1XYPA 3H1WA 4Z1VA 2PHWA 1JW6A 4EN8B 3I2DA 5GLVA 4E2QA 2BBVA 4AI1A 2ZX1A 1ENQA 1FOD3 1VB2A 3D6EA 4MGZE 2A3WA 3MZHA 1YFWA 3NL1A 3JB4C 3V0AA 1EYBA 4XJ9A 4Y5Z0 1NCQC 3VKFC 1WCKA 2XLGA 3BIWE 1KD7A 1Z0HA 3VBUC 1Q8OA 3OD0A 1XRUA 1U5ZA 1MS5A 2FMDA 4H14A 2WKKA 4ZXKA 1RUF3 3H0OA 1BBT3 1B35A 4AGVA 2RS12 3MYXA 2PFWA 5JZGA 3ME2A 1ZRFA 5H9QA 1MACA 2R073 3ACLA 4GB33 4CEYC 1OHFA 5BNNC 1W0OA 3NV3A 5FPZA 3B00A 5EZWA 2B39A 3VUOA 2WFF1 1ZVFA 2DU1A 4KNCA 2PELA 2PHUA 4NVPA 1PGL2 2ZZQA 2AH2A 1DFQA 4MV2A 4TWTA 3KB5A 4D7SA 2UY9A 4WM8A 3RSJA 5A32A 1RHI3 2DVBA 3WZ1A 1MS1A 3VDDA 2Z79A 4K9SA 5T5PA 3NAPA 1XNDA 1DQ0A 1PVXA 5GZGA 4JGZC 4AW7A 3ZFGA 3S7EA 2IXLA 5C6CA 5K8SA 1IHMA 3SNMA 3RMXA 4M3CE 4R9AA 1ULDA 3S7IA 4FPKA 1FOD2 2QFEA 2BNNA 3EHKA 1PO21 2YHJA 1AR81 5HBAA 3RYPA 3AMQA 5DUXA 3E97A 4YFWA 3BPZA 1NLRA 4Y4YA 4DY5A 2A71A 2VULA 4QPGA 3OY8B 2QVSB 3JQWA 1RUG2 1G9CA 2ZPXA 1XNCA 2WZR1 1RHI2 2D6LX 3AXEA 4UXAA 1Y43B 2AZ5A 2VMIA 2AGSA 5CB7A 2XB6C 4FAGA 2DCTA 5JMCA 1W6QB 4NWVA 4EV0A 5CFCB 3VBHA 1O4YA 3KMHA 3OBTA 3RI8A 2ZOEB 4WZCA 3KD4A 3H7JA 3SHRA 1VBC1 1EPWA 1WD3A 1BEV3 5EJ3A 3THPA 4LBQA 1N1TA 2FQPA 4Q1RA 1QNWA 2HEYF 3EQEA 2XPJA 2XJQA 3RWNA 3T1LA 4AEDB 4IEZA 3ZXJA 2RM23 4MXVA 2ZACA 3WD5A 2GSYA 3EBRA 1ZZ7A 2RS51 4EN6B 3B94A 1RITA 3AZXA 4W6YA 2UURA 3IMNA 2ZBJA 4FT8A 1HKDA 2RJLA 4OUMA 1JTZX 1AR93 1VBE1 4P5HA 1QGLA 5KWRA 1AYN3 1TME2 1WBLA 5BUVA 2AYHA 4HT1T 2ATFA 2TUNA 2VY0A 4AFDA 1K5MA 2HYKA 1UPIA 4G9SB 4XZPA 1S0CA 2D98A 4OVEA 1ND2C 5JWPA 5L7OA 1DU3D 1NOVA 3WDTA 2IXKA 1RUF1 5I91A 1PK6A 3SISA 3V0BA 1RJ8A 3O0VA 4Q8KA 4JDNA 1RUJ3 4FTEA 3B69A 4IETA 4I01A 4ISQA 4FOYA 2R0FA 3O14A 4QX5A 5JOYA 1ENRA 3AKQA 2XJPA 3AK0A 4BYYA 2G9FA 1QJY2 1I1EA 1PGL1 4AFAA 4QGNA 3AYDA 5BNOB 3B01A 3AKPA 4LA3A 3BTAA 4YW4A 4XTPA 4NHMA 1GZWB 5I0UA 4GWMA 2GAUA 1D2QA 1KFUL 2Q5TA 2XGXA 4GH4B 2RS53 3J8F1 3WG1A 3V64A 2E6VA 1AX0A 4XJ8A 1K5MB 3WW1A 4LLFA 4C1WA 3B9CA 5AFBA 3ECQA 1REEA 3KLSA 2VPVA 4N7UA 1ALYA 4FP2A 5JOXA 1GLHA 2A6ZA 2OUJA 3URFA 3WHUA 1Q3EA 3TN91 2JJ6A 3GHMA 3TBDA 1IS4A 2W68A 1GSLA 4FPLA 3WW2A 4GKXA 3WP3A 1LGBA 1HRV1 1RUH1 4QQHA 3S0MA 2ZGLA 2WNEA 4BM8A 4L2NA 2BNMA 2XH6A 4C0BA 5JI9A 2PQQA 2WWSA 2YROA 3PVBB 3SCGA 4AEDC 1D4M1 1YUDA 2UWBA 1POV1 2RR11 3LA3A 4QU2A 4E27A 2K0GA 4Y20B 3MLJA 3CU7A 3LB9A 2AREA 4AWDA 1NA1A 2QDRA 2VOVA 4PF5A 2H6BA 1BKZA 2VW2A 3RRDA 5L19A 4BCUA 5C33A 4WM8C 1JYIA 1RUJ1 1LJ7A 1QJU1 2VNRA 1ZZ8A 5IK8A 2ERFA 3J4UH 4FPFA 4RL7A 1POV0 3VZNA 1AL21 5FCCA 2V73A 4PIYA 1O4ZA 4AEJA 1CVNA 3AFGA 3NKGA 1YI7A 1RUG1 1RMU3 2R32A 1U5XA 3GZUC 4P9LA 4Q4X1 1CJDA 3T1MA 1B35B 4RGAA 4LBJA 5IK5A 3WQ7A 1ZBE2 2PHDA 3LSEA 4YW1A 1JUIA 4FQ4A 1PNGA 1VP6A 3WCRA 2NYYA 1HXS1 1GQHA 2JX9A 4L8QA 1PVC1 4XBNA 3LOBA 3FLTA 4HMZA 1HQWA 1V70A 1BZWA 2D6KA 4M00A 1EP0A 3HBZA 2FBEA 1C1LA 2XLFA 3QH7A 4OFGA 1U12A 1UX6A 5K0UA 1ZNPA 1WMEA 2WLPA 1N1SA 3ZIXA 2HWE3 2HWD3 4QPIC 1KDMA 2EXIA 3VBRC 2MEV2 2VECA 4QQLA 2ENRA 5AC92 5CFCA 5J09A 1HRI1 5JOWA 1YWKA 3WHTA 2PLV3 1VBB1 5HCBA 3ZXGA 3BU7A 1QWRA 1RHI1 4AG4A 4AVBA 4BE3A 2E7AA 3NV4A 4AEKA 3KCYA 1TMF3 3R0RA 2ZX3A 1CAVA 1KJLA 1LOFA 2EALA 2VH9A 4TSVA 4D3WA 5DG1A 1AR72 1FI2A 1KJRA 1YNAA 2O0OA 3E5XA 4KU8A 2D44A 4YVWC 3JU9A 2VVDA 1CAUB 2F6BA 2RS33 2X5IC 1C5HA 1VAKA 4PBOA 4WVWA 1H0BA 2R063 3DPRC 3WUDA 2O8OA 5KC5A 4YM0A 2DFCA 1DG6A 1ULFA 4ITCA 2YY1A 2VNGA 5FO9B 1AF9A 1NQDA 1RC6A 1JXNA 3FFZA 1A8MA 5L36A 3FZ3A 1F2NA 1FAYA 4FXGB 1V9U2 5CBLA 4Y24A 4XOGA 5J7MA 5A32B 4WBBA 2FMYA 4WM8B 1WLTA 1RUC2 4HKOA 1RUC1 5FLIA 4Z82A 1OSGA 1QDCA 3I59A 4Y1UA 1GKBA 2B42B 4YM3A 1PIV3 4XIKA 1HQNA 2ARXA 3AYEA 1DDLA 3VHNA 3IPVB 2Q0AA 2D3PA 2XL9A 4IV3A 3VBRB 2G4IA 5FBZA 5CNAA 5CA6A 3C3VA 4UBHA 2VOWA 5C4WB 1PO11 1RUG3 3RYKA 1ZBE3 1RINA 2RS11 1AR92 1IPJA 2Z2SB 2PLV1 4AHZA 1AXYA 1YFYA 2BEOA 4OI4A 1F5FA 4PJYA 1WLDA 5E88A 1QXJA 4ORFA 1GV9A 1W6PB 2EAAA 4E9KA 4BH9A 2MEV3 3WINE 2ZKNA 5AC93 1KQRA 1MQTC 2JXAA 4WM7C 3WT3A 3P3PA 3WDXA 4DY3A 2RM22 3ZXAC 4OHWA 2AUYA 4DRVA 4R9BA 1W6OA 4QQ2A 1OD5A 1CGPA 3GBWA 4DB5A 1HX6A 3HT2A 4META 4Q4W3 4ZU5A 5I8TA 2ZMLA 4I09A 1G9FA 2W08A 4Q0QA 4RHV2 3VBUA 1PZ8A 4XIOA 4DMIA 3VN4A 3CLPA 1FNYA 4LBOA 3A4UA 3VBOA 3H8UA 1ULGA 3ZMOA 1WCDJ 5KHJA 2D3RA 2ZA9A 2CWMA 1SLLA 1VBC2 1YCIA 4XBLA 3TB0A 3ZX7A 3WQ0A 4Q4X2 1ND2B 5J96B 4C91A 1V6OA 2WNVA 4XF0A 2YMZA 3D4KA 3NV1A 4DOUA 3J8F3 2GC0A 3U07A 1H4GA 1ND3A 3ZYPA 4W65A 4XHBA 3MW2A 4O9GA 4COVA 4P9IA 3SH5A 4RQPA 3THTA 2WNVB 2I74A 3ES1A 3O12A 2PAKA 2WA3A 1FNZA 3VGIA 1LGNA 1RUD3 5FAXA 4CDQA 4FAHA 1SLIA 3IDEA 3M7AA 3AM2A 3MIBA 2E7TA 4YGDA 1AYN1 4K21A 4YNIA 3I59B 1PIV2 1OQ1A 1RUE1 4YG3A 2Z5WA 5C9AA 1V6KA 1A78A 1H8TC 2ZHKA 5FFOC 3ZSKA 2FZ1A 3V0AB 2I45A 2HWE2 1PIV1 4GMP3 5JPMB 2ARBA 1CAWB 3J9SA 4AQTA 2P34A 1MS0A 2CAUA 5FLJA 2ZGPA 2JG8B 5FRAA 4LE4A 2BWCA 3UKNA 3BALA 2HEWF 2YC0A 4PLMA 3S30A 4DXZA 4RHV3 3PTYA 4L97A 3G7DA 1OKQA 2RMU1 2YPJA 5FQ0B 4Z8BA 2CV6A 1MEC2 4QQOA 2DVGA 2UY8A 2IXIA 2WFF2 4R8HA 4KG0A 1TME3 2HJIA 1JOJA 1SFNA 4SBVA 3M1HA 4AE2A 1DZTA 4I0BA 1YI9A 2GN7A 4KH9A 1BK1A 1BYHA 2ZABA 1XE7A 2HKXA 3N7LA 4QPIA 3IKWA 4YYOA 4PIZA 1QH6A 1IQAA 5DG2A 1Q8PA 3J8F2 4N53A 1I3HA 4Z92B 3H3ZA 1O3TA 1CX4A 1CAWA 1Q43A 4RS5B 1ZRRA 2XVKA 2DTYA 3N7MA 4D69A 2WJSA 4Q4Y1 3TN92 1R1A3 1BEV2 1VBC3 4ZU7A 4BWOA 1DZRA 3L9JT 4FSJA 4IV3C 2ZGKA 1UZYA 3MF9A 2DF7A 2CL2A 4GMP1 2QQPA 1QXRA 1OPMA 3QOPA 1UW8A 3NO8A 1LOBA 1AR63 1VJ2A 4LT5A 1LKNA 3USSA 3UJOA 1W6NA 1EPZA 3UV9A 1OOPA 4GULA 4XFFA 3R05A 2LALA 1XXNA 3CEWA 2VVFA 4F83A 4CDUA 4MGKE 3VZOA 3PNAA 3KGZA 1LGCA 3EJKA 2ZGNA 1G7YA 4K1ZA 5H9PA 4KWKA 2XKPA 1MZFA 4FPHA 1SLTA 1GBGA 1MS8A 3MF6A 4A7KA 3ROUA 1ASJ1 1SBDA 4EN0A 2HWE1 2D6PA 3CL1A 4IEQA 4Q4V2 1MQTB 4JRLA 1DHKB 1LHWA 1A6CA 3KT1A 1LU1A 5JZGC 4LUMA 2HWD1 1WW4A 2R061 4XQ4A 2WNUC 3VBFB 4GWNA 2VUJA 3VBUB 1C57A 1AX2A 2ET7A 4YGCA 3WQ1A 4Y1XA 2PN5A 4YG6A 2Y0IA 2NMOA 1M4WA 3ZO0B 3E6DA 4YVSA 2ES3A 3U0ZA 1S0GA 4FBFA 4IEXA 1LODA 2YV8A 4KL1A 2EA7A 2XJSA 1TMF1 1TME1 3H3UA 3ZFFB 1CAUA 1COV2 3ZN6B 5BV6A 1N1VA 1AHSA 3JBG2 2H0BA 3INAA 2CYFA 4Q4V1 1FPN3 1JHNA 1R082 5J36A 5KC6A 4JGZA 1LEDA 2Q4SA 4XFIA 4DNYA 3BB6A 2RS52 1CIWA 4AI2A 3WOGA 2CTVA 4CEYB 2F4PA 2A6WA 4YZ1A 2NN8A 2A73B 1WUVA 1QY4A 3K51A 2P37A 3LZZA 4FP3A 2SBAA 3HD8B 3VHRA 1H4HA 1FOD1 5JI7A 3RJ2X 4XMAA 5T54A 4S2GA 2ZTNA 4JTNA 5BNPC 3B9IA 1TMF2 3JUUA 1RUOA 4BZ4A 1JH5A 1FXZA 4R4ZA 4XJZA 5FDBA 1V6LA 3V0BB 1LULA 2VGDA 2X8KA 2ET1A 1PGW2 1G9DA 3FLRA 4AI3A 2MPFA 4DINB 2VUAA 1RVF1 1ZZ9A 5K9YA 2E7QA 2NLRA 3Q9OA 3K48A 1QNYA 3DV8A 3AP7A 2HWB2 4KGQA 4OHZA 5CVRA 2BTVC 4FVVA 1VAVA 3ZFFC 3AZZA 5IUQA 1MQTA 1MZEA 2P2KA 1V6MA 5JPNB 1VBD3 1BBT2 1G9BA 4FPYA 1C5IA 1YJKA 2PTMA 4IEVA 5I0TA 4QHBA 3TOJA 2DUPA 2JE7A 1PZ9A 4TYSA 1QOSA 1APNA 2ZMNA 5IT6A 1U0AA 4QM8A 4XW3A 5ABJA 3ILRA 4XHXA 2BUKA 1A8DA 2B46X 4YGEA 2NP0A 3FHIB 4C0HA 1F9KA 4UW5A 2DVFA 2WNUB 1YFXA 3WX5A 2B5HA 1VIWB 3POWA 2PHTA 4ISRA 2JICA 2ZMKA 3LSDA 2GMEA 1QJU3 2DWRA 3ZXFA 4XETA 1FPN1 1W6QA 1NQJA 5GJ6A 2ZHLA 3WLUA 2K9ZA 2SLIA 1NYWA 3WP4A 4RS5A 1BMV2 1Q8SA 4DFSA 4KBBA 1O7FA 5LK7B 4Q4V3 4AEMA 2GNBA 2P3JA 3AP6A 1ZRDA 2DURA 1RTVA 2IFWA 2R043 1EAH2 2X53S 1WMDA 4HLTA 5ABJC 3WDUA 4V1PA 3ZN6A 4N9IA 4WVZA 1VR3A 1AR83 3RS6A 2VVEA 5GALA 4FO9A 4XFBA 1CN1A 4DPNA 4CEWA 2JG9B 3D82A 3ZXEA 1VAMA 2X29A 2WNUA 3ZYIB 4WM7B 4K8FA 4LHNA 4XDQA 4E2SA 3NW4A 2DUQA 1LHNA 3JD71 1R083 4A2UA 2XHKA 3AP5A 5A33B 4FXKB 5ABJB 1ZM1A 5T52A 2XJTA 1H2MA 4XQDA 1BVVA 1J3RA 4AK3A 3FUOA 2DVDA 1TE1B 1R091 4UW3A 2BW8A 1UAIA 1X33A 1ULEA 1TQ5A 4GMP0 4B8EA 2YYOA 3AKSA 4U36A 5ACA3 3BODA 1G9AA 1OOPC 2JG8C 3ZSJA 4CDQB 1W6NB 1S0IA 5I8SA 3PVNA 4EWAA 4IEOA 2A3XA 2AR6A 1CJPA 1OLRA 3MI8A 4Q4Y3 2Q8OA 2A6XA