3OD0A

Crystal structure of cgmp bound cgmp-dependent protein kinase(92-227)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-Crystal Structures of PKG Ibeta (92-227) with cGMP and cAMP Reveal the Molecular Details of Cyclic-Nucleotide Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PRKG1 protein
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od0A00
3QACA 1HW5A 4XFAA 1EY2A 4XF3A 4QGLA 5FPZA 4XFGA 4XETA 1ZZ7A 4O9EA 4XF1A 1LKNA 5J3UA 3I54A 2BYVE 3RPQA 3M70A 1ZX5A 1FT9A 3H1YA 4MGKE 4IEVA 3OTFA 1H1IA 1CAUA 4NVPA 4BH9A 1FI2A 4JVAA 3E6CC 3FHIB 5LRSA 1CAWB 4X6QB 4LUKA 4MUVA 5KHHA 4KU8A 4R52A 5E16A 2K9ZA 2IXJA 3CLPA 3ES1A 2K0GA 4FBFA 1SQ4A 2B8MA 3SHRA 4HVOA 4IEZA 1SEFA 4I3PA 3I7DA 5BUVA 1ZRFA 1X82A 4EWDA 2GU9A 4E2QA 2B5HA 5C8WA 2XLGA 1ZREA 2OZJA 2FQPA 5CVRA 3ETQA 5JSRA 1J59A 4KL1A 3ES4A 3RYPA 1LB2A 1OI6A 4Z82A 3UKNA 2OYZA 2D93A 1J3PA 1H1MA 3FJSA 1O3RA 5EFUA 4GULA 1I6XA 1VP6A 2IXHA 1YHFA 4MGZE 3UKVA 4IERA 1CAXB 1NE4A 2GZWA 1QXJA 4XFHA 1RL3A 3DV8A 4R8HA 4HN0A 3UKTA 5E1RA 1ZRCA 3ACLA 3OF1A 3DN7A 4I0AA 3OD0A 1GQHA 4WZCA 4XFBA 3U11A 4IETA 2ZCWA 4HZFA 5I8SA 4YYOA 1L3JA 4QGMA 1ZVFA 2IC1A 3KSCA 2GC0A 5AVPA 2CV6A 1DZRA 4RD7A 2CAUA 3M3IA 2GAUA 3RDIA 2MPFA 2ZKLA 4HBNA 4WBBA 4Q0VA 3S0MA 4WVZA 2FMYA 2O1QA 2XKOA 3CL1A 3E97A 3LA3A 5I0UA 4PIYA 3NKTA 2BGCA 2WFPA 4LA2A 4HSJA 3IIAA 3EHKA 1UW8A 1CAVA 3NJZA 5K8SA 5KBFA 1XE7A 4Q0UA 3HQXA 1YFWA 4A2UA 1LR5A 3CJXA 4PJYA 1NYWA 2UY9A 2B9UA 4JTOA 5LRRA 1O7FA 2F4PA 1CAWA 1OD5A 3WW4A 5J7MA 5LEKA 1O3TA 3GBFA 4OFGA 3USSA 2XHKA 1XE8A 3HIFA 5EZWA 4F8AA 3D0JA 4AQ2A 5KHJA 1EYBA 3D82A 3MDPA 3LZZA 2CAVA 1V70A 2BEOA 2PAMA 3ZDSA 1ZZBA 3BB6A 1J1LA 1PMIA 2HJIA 2PAEA 1RUOA 1CAVB 2H6BA 3BPZA 4LA3A 3NL1A 2IXLA 5FQ0B 3GYDA 3EBRA 3LA2A 1QXRA 5BY5A 1U12A 2EVXA 1ZZCA 3I59B 1PM7A 2IXCA 3RZZA 2Q1ZB 3H1WA 4AVBA 4XFCA 4BIFA 1O5UA 3SMHA 2QCSB 4HSLA 3KGZA 2UYBA 1VR3A 1YUDA 3BCWA 5KHGA 1ZZ9A 2Q0AA 1O5LA 1CX4A 1ZZ6A 1O3QA 1Q5OA 2H0VA 2MNGA 2PFWA 2Z2SB 4F7ZA 4MX3A 3R6SA 4MGYE 3WW3A 2UYAA 2MHFA 1JUHA 1WLTA 3H7YA 4B29A 1O4TA 4MGIE 5I0TA 3RYKA 4AQ6A 5BV6A 5I93A 2IXKA 1G6NA 3KGLA 4JTNA 2VQAA 3SCFA 3EJKA 4QXKA 4AXOA 4HMZA 2PTMA 2PQQA 1I5ZA 2WC2A 2PHDA 2ET7A 4QMAA 3QOPA 3DKWA 2EAAA 3E5XA 2EA7A 2D5HA 5JR7B 3E5UA 5JAXA 2XL9A 3U0ZA 5FLJA 2O8QA 4E2SA 1OMIA 3OGJA 1RUNA 4IEPA 1WA4A 2H6CA 4FT8A 1CGPA 4N9IA 1EPZA 3E5QA 3S7EA 1J3RA 2N7GA 4LTAA 5I8YA 4HN1A 4FAHA 2GC2A 3NVCA 5CU1A 2IXIA 1UD1A 3MYXA 4UBHA 5T3NA 5FDBA 3E6BA 4IEUA 5FLHA 4KWJA 2VPVA 4BHPA 3H8UA 3DL3A 4UBGA 4ONUA 3BU7A 2P17A 4HLTA 4IEQA 1NZCA 4EWEA 4DINB 1UCXA 2GC3A 4N9HA 3JZVA 3VHRA 3RNSA 2ATFA 4I01A 4META 5I0RA 3PLQA 2PHLA 4FAGA 2D40A 2ET1A 3I59A 4KWKA 3BALA 1YFYA 1J58A 3CEWA 3EO6A 3WW1A 3LAGA 1RC6A 4L2NA 1GQGA 4D7SA 4TLFA 3ROUA 5LEJA 5BPXA 3CO2A 4EWAA 2XL7A 4YARA 4L11A 4OLLA 4AVCA 3OCPA 3S7IA 3KMHA 4O9GA 4LUMA 2XGXA 3E6DA 1CAXA 2Q30A 3MPBA 2PYTA 4XF9A 5JCTA 4CYDA 4I02A 1UPIA 2OA2A 5J48A 3H3UA 2QVSB 2XLAA 3FX3A 4XEZA 3H3ZA 4JV4A 1OFNA 1YFUA 4EV0A 4XFIA 3SCHA 2Y0OA 3IDBB 1TQ5A 5HI0A 4MH0E 3D0SA 1X7NA 3B02A 3HT1A 4QGNA 5BXXA 4IEOA 4E2GA 1NE6A 1UIJA 2BNOA 4K8FA 5FLIA 4MZUA 1YWKA 1UIKA 5JSOA 4X6RB 3G7DA 5KHKA 3NW4A 3LA7A 4HVRA 1DGWA 2BNMA 1XRUA 4BYYA 1X8EA 2Q4SA 4Z07A 2DCTA 1CAUB 1FXZA 4PIZA 4Q29A 4J1WA 3U10A 2OZ6A 4ZU5A 4LULA 2XKPA 3SCGA 1Y3TA 4XFFA 2QJVA 4QM9A 1O3SA 1RGSA 4KU7A 4IEXA 1DGRA 3FZ3A 3TNPB 3NSTA 5JSPA 4YNIA 2QNKA 5KHIA 5C6CA 1Q43A 2GC1A 3N4MA 2BNNA 2QDRA 3L2HA 1YLLA 4MV2A 3H1MA 3KCCA 3PNAA 3FWEA 4HVQA 3H7JA 4UXAA 4LEJA 4Q0SA 5FQ0A 3H9AA 5FPXA 1WGPA 4IEWA 1SFNA 2KXLA 3WW2A 4I09A 4Q0PA 2D5FA 3IWZA 1DZTA 1LRHA 2ETEA 2V09A 3O14A 1VJ2A 4QX5A 3ELNA 1Y9QA 2HKXA 2Z69A 4IEYA 1Q3EA 1ZRRA 4ZU7A 2E9QA 3H50A 4I0BA 4J1XA 4I2OA 4Q0QA 4ORFA 3FE5A 3TNQA 1YFXA 2OPKA 1ZNPA 4LLOA 4YRDA 4AVAA 1X8MA 2C0ZA 5I0SA 3HT2A 3ST7A 2I45A 4P9GA 3LOIA 5F1RA 5CADA 2XLFA 4YSFA 4KWLA 3RYRA 2CGPA 1QY4A 4ZU4A 3IDCB 4D7TA 3IBMA 1IPJA 1J3QA 2UY8A 4XF0A 1ZRDA 5D1IA 1ZZ8A 1RTVA 2GH2A 2PA7A 3SXWA 1QWRA 4IESA 1EP0A 5FCCA 4PIXA 4H7LA 4EROA 2PAKA 3FFQA 3CF6E 3LWCA 3C3VA 2VECA 4QM8A 3EQEA 1NXMA 3PVBB 5I8TA 5I91A 3MZHA 4XF4A 1IPKA
chains in the Genus database with same CATH superfamily
4H3WA 3W5NA 3ZN6B 4QGLA 5FPZA 2HEWF 4WM8B 1NLRA 4Y22B 2R1BA 3LB9A 1ZZ7A 4Y24A 5FP4A 1X9TA 2NPIA 4XF1A 1WMEA 1LKNA 3WVJA 2TBVA 1VLNA 4ZONA 5IVYA 3POBA 3RPQA 4CP2A 3H1YA 1W6MB 2RHPA 4YZ1A 4V1PA 3TN93 5DMYA 5K4LA 1IQAA 1GOGA 3AYEA 1YQ6A 4HKOA 5C8CA 1VRH3 2RV9A 1T6GC 4JDMA 5T5JA 1FX5A 3U4SA 4BM8A 2Y34A 4BH9A 4JVAA 2WZEA 1S0CA 2ZHNA 4Z2AA 5C4WB 2C1FA 3AX4A 1CAWB 1PVC3 5A33B 3O1PA 3RI9A 4MUVA 3RI8A 1GZ9A 2RS32 5E16A 1L7LA 4PF5A 4RR3B 5CYYA 2ZGSA 2YMZA 3ZX7A 1YQCA 2FCUA 2VD7A 4FI9A 1KDMA 3ILFA 1VBC1 1VBB2 4I3PA 3OGGA 1S0GA 4DEQA 1G7YA 2XXZA 3ZFFA 5C3SA 3O1TA 2BRTA 3PUIA 3T2QA 5JXGA 4E2QA 1JZ8A 4K21A 2L9LA 1DYPA 2OZJA 5FFOC 1MS3A 4MXWA 4E9KA 1JZ5A 1IOAA 4Q4X3 1RUC3 3RYPA 1Z0HA 2G1MA 2R6QA 1JODA 1OI6A 3CHXA 4RFT0 4W65A 3LCPA 5LBEA 4XYXA 2WSVA 1AXKA 1FOD1 1XNDA 4RQPA 4Y26A 5CA6A 4IGPA 2YGMA 2JDAA 1H1MA 3VBSA 2A70A 2CDOA 2WS91 1SACA 1X50A 4WV8A 5A33A 2BGPA 2XQRA 1I6XA 1XPWA 5FY0A 5K0UC 1YHFA 1EV11 4M00A 3ZIWA 1BK1A 2WWJA 3AXEA 2K46A 4IERA 3SISA 3UKVA 4A45A 2E51A 1RUC1 3ZFGC 1BVVA 4O7XA 4B7KA 1RL3A 4R8HA 4QWNA 1IS5A 5DXDA 5E1RA 2FZ2A 3I3BA 1FOD3 2WQZC 4WZCA 3LQCA 4DPNA 3HD8B 4E4ZA 5JDBA 2P6HA 1VBA1 2HWF1 1B35B 2BW8A 1C5HA 3LIGA 4LORA 4OCTA 5JZGA 2PN5A 3AMMA 1CWPA 4QGMA 1HQNA 3WG4A 2EIEA 3ETPA 2ZX2A 2FDHA 3AP6A 2NYYA 4YG6A 1WW6A 2VOVA 3UV9A 3C2UA 2XDVA 5GKAC 3O1VA 2A73B 1QH7A 4H14A 1H0BA 5E8AA 2WO1A 1EV12 5A3WA 2BQPA 2WA3A 4RD7A 4YGDA 4AFCA 2VQUA 3WD5A 3M3IA 4QXBA 2GAUA 2MPFA 1SLIA 1GP4A 2BUKA 4RA0A 5KXBA 4FTSA 4WVZA 4JGZC 4Y1ZA 4XTMA 3AM2A 2IFWA 3CL1A 4LKEA 4XPVA 1ENRA 5I0UA 5J96B 5FOBB 2VZUA 1W8TA 2QQOA 1RUE1 2WFPA 3NKTA 2JG9A 4L92A 5FZHA 1KGYA 3NV4A 2Q8CA 3SC7X 2Q8DA 5FPVA 3GBGA 3S57A 4HSJA 4LO7A 5K8SA 1CAVA 1LGCA 2W0XA 4Y1VA 3VKLA 3HQXA 5IVEA 1R091 1PX3A 2Y0IA 1MS0A 4QB2A 1AHSA 5IAVA 4YVSA 4LHLA 4BDVB 2X09A 1UQXA 4GWIA 4AVVA 1A78A 1LHUA 3N7KA 2QBXA 3B00A 2B9UA 2VTXJ 1K5MA 1OKOA 4C1XA 4QHZA 4COVA 3WW4A 2WA4A 1O3TA 4EYUA 3V0AA 2OIIA 4GALA 4LBQD 1Y9GA 1DHKB 3GBFA 4LHSA 1NQDA 1K5MB 2HLEA 1TMF2 5FYVA 5CFDC 1H9WA 4E4HA 5LBFA 1W05A 2E63A 3KQRA 3USSA 2D6OX 2JB8A 5EZWA 4ASKA 4LPLA 4F8AA 4Z2WA 4GQ7A 1EYBA 1X36A 4W6XA 2CL2A 1VB4A 2CAVA 1OOPA 4H55A 5FJKA 1ZZBA 4IDZA 4BISA 2XJRA 5B4NA 4GMP3 3PVEA 5FZ1A 2TEPA 3W9AA 2ZX0A 3AZVA 4XUQA 1AYM3 3BPZA 3ZM8A 1OQDA 3I3QA 4JCKA 4LA3A 2BBVA 2QTWB 4D94A 5JVVA 2AH2A 1FMD1 1JN2P 3J9SA 4QPGB 3TBDA 3GYDA 5CAZA 1OA4A 5ABJA 1JOJA 1WMFA 3AJYA 1U12A 1AX0A 3AMQA 3I59B 4QQ2A 4XF4A 1UYPA 2RR11 4GKXA 2Q1ZB 3H1WA 4OZXA 4BIFA 4QX1A 1O5UA 3ZXFA 4W50A 2XONA 3V56A 1LAJA 5FUIA 4O65A 1BQPA 5KHGA 4LT5A 3ZYFA 2KR2A 3M1HA 3I2FA 4BXFA 3NNFA 2LRPA 4QPGC 1MS8A 1ZZ6A 3OGRA 2MNGA 4F7ZA 5LA1A 5L9BA 3LF7A 1NUKA 5FZFA 1ZBA1 2G4IA 2V4VA 3R6SA 5A80A 3O0VA 3GZEA 4Q4V3 1YJKA 1JUHA 4FO9A 2WT0A 1QOTA 2NM1A 4QU1A 2CWSA 1W8WA 4B29A 2A75A 4COWA 3CU7A 1HRV3 1PO13 4PQQA 1QH6A 2J1SA 3DYOA 3POSA 3PTYA 3WNLA 2A6VA 3VBFB 5A7PA 4JDNA 1AR83 4JTNA 5GZGA 1LOGA 1JW6A 1GP5A 3EJKA 5L9VA 2W52A 2QQIA 2C9KA 4AXOA 1F5FA 1ASJ2 5FZAA 2ZHMA 5FUNA 3DPRC 3SH3A 1GNZA 2R30A 1DYKA 4I3GA 4AFDA 5CISA 2PHDA 4QMAA 4JGZA 2BERA 4F83A 4NUBA 3M3CA 1SLLA 3VL8A 1XNAA 4BXSV 1JOPA 3E5UA 4GA9A 4A7KA 3RS6A 3U0ZA 4TTGA 4IL7A 4N43A 2BTVC 3BOWA 4UFIA 5FZLA 1WUVA 4HT1T 1QXPA 4E2SA 5JLVA 4Q2FA 5FMOL 1RUNA 4NR1A 3RGBA 4BLIA 1K5JA 1WA4A 3AYCA 1C28A 2BGOA 1N1SA 4QXCA 3UGHA 4BQYA 2W87A 3VBUA 5EJZB 1RXFA 4CDQB 5FY8A 1W8HA 5CBLA 1V9U3 2Y8KA 4AFBA 3B9IA 1ODNA 2RVAA 3LPFA 2WBKA 3S7EA 4BA6A 3WNMA 4CU8A 2N7GA 1V00A 2HWC2 3Q8AA 4PDWB 2YDEA 1W8OA 2WUHA 4YGBA 2WZ8A 5I8YA 4XIKA 4WVMB 1UY4A 3LEGA 3AZWA 2JG8C 1AR73 2B45X 3HMYA 1APNA 1DBNA 2JE8A 5FZKA 3WQBA 1OA2A 4AK3A 2LUWA 4YW5A 2P37A 3NNLA 3FLRA 3E6BA 4RL7A 4XUNA 4OMDA 1OF4A 1AJOA 5IAXA 2VOXA 1ZBA2 2JECA 1WCSA 2RMU2 2VPVA 3LFIA 2O0OA 2YC4A 1TE1B 3UL2A 1PX4A 3C7OA 4JZRA 2AREA 3T0BA 3ZO0B 1NKGA 4ONUA 1DIWA 1R1A2 5CG9A 1RUH1 1VBB3 4XHXA 3OYWA 1NZCA 1RJ8A 4V2WA 2W92A 4LO4B 3UESA 2R073 1UCXA 1WLCA 3B3QE 2RMU1 4JQRA 4UFMA 5CKMA 4N9HA 2FDJA 2ATFA 1JOBA 3OPZA 5FZ6A 1MVQA 4HPKA 1HRI1 4ZPIA 3UJOA 4META 1VMJA 3MIGA 1OHFA 3IB3A 3AL6A 4B7EA 3V65A 1ZA7A 4R4ZA 4BMBA 3WG3A 3ZYGA 5BNPB 1VRH2 4KWKA 5A3OA 3BALA 2PLV3 1I5PA 2R0HA 4CDXA 3O12A 3CEWA 5A32A 1W6OA 3AXDA 4OI2A 1BBT1 1RC6A 4L2NA 3OPTA 5FYZA 1US2A 1SPPB 4YW6A 4TLFA 3ROUA 4D7SA 5A1LA 4RGAA 4QQPA 1FMD3 3NV1A 3CO2A 4MO3M 3PVNA 5JUVA 4YARA 2LW8A 4Q5OA 4V2VA 4L11A 1W9SA 4OLLA 3SQOA 4YPJA 4DB5A 1L7QA 3S7IA 1SDWA 3MF9A 4UI9L 5FZ9A 2XGXA 5D8AC 5EJ1B 3FBMA 1D2QA 2CDPA 1CAXA 4JDOA 4QX3A 4BIOA 2BDRA 5EYXA 4QX8A 2PXJA 4I02A 2WL1A 3PUAA 2EALA 5CB7A 1P8JA 2WWSA 2E26A 1RMU3 1AUYA 5J48A 1FV2A 5J37A 1V9U2 1SDDB 2OUHA 2XG3A 2XLAA 2YFZA 2AGSA 1AL22 4KGGA 3WDTA 1ENSA 2DWRA 2W1UA 3ZSEA 3ZVXA 1Q8OA 5DDJ3 4IE5A 4D8MA 2VO5A 5IK4A 1VMFA 2ILMA 2RJ2A 4NAMA 4XILA 5IVCA 2AEYA 5T50A 4CP1A 4EZ4A 5FKCA 5T55A 3V64A 3MV01 2Y0OA 2XVKA 3ZXLA 2Y6KA 1TQ5A 2JDPA 4FQ4A 5AFBA 1W2TA 2VY0A 3M7AA 4MH0E 3VD3A 1YJLA 1X7NA 4GB32 1QJX2 2DYCA 1WLDA 2BFUS 3N9MA 4KBZA 3T08A 5BXXA 3MF6A 4E2GA 1Q8PA 1S0JA 4YW2A 1LOFA 2F6BA 3P6BA 3WX5A 5FLIA 2RR12 2RS33 3B94A 4HK8A 4P08A 2A3WA 4W4ZA 4HFSA 4MGTA 4BQXA 1PVC1 4YM2A 3NJXA 2BJSA 3KV4A 3NAPA 4FOWA 4KH9A 5IVJA 2HWD1 2GNTA 4SBVA 1DGWA 5HXMA 1SZBA 4QKDA 2JIGA 2Q4SA 1VBC3 1CAUB 4AAPA 1LHNA 1VRBA 4KG0A 1FXZA 2VMIA 3Q8EA 1RJ7A 3HN1A 3KCXA 4HK9A 2D97A 4PI2A 4UF0A 5FZDA 5AVAA 3RWNA 2CHHA 4LOTA 1POV0 3NV3A 2VBBA 5F32A 3I4IA 3SCGA 3AMHA 5FZIA 4XFFA 1SBDA 2NQYA 4ASLA 5BNQA 3CJIA 1RGSA 1XU2A 3RQ0A 3Q8BA 1CX1A 1S2EA 3FZ3A 3R0RA 2ZAAA 2UWAA 3TNPB 3N35A 3BUCA 4CEWC 4AZZA 1Q8VA 2CNAA 4D7YA 2WNVC 5K0UB 1Q43A 4XHBA 5GM0A 3SNMA 3T2PA 5IK8A 3JD72 3WF4A 1FYUA 5FV3A 2FDIA 2MEV2 3L2HA 1AXZA 4UW6A 1ULPA 4QX0A 4XVHA 4MV2A 2CWMA 4MGSA 3JXSA 4BLJA 2D6LX 3FWEA 1H2MA 2VOKA 4NRMA 4RYDA 5F5QA 5FZ3A 4UXAA 1OD3A 4LO5B 1WBLA 4N90A 4FTEA 2BPA2 1AF9A 1QIQA 2EIDA 2R32A 2VAUA 3H9AA 5TSWA 5FPXA 3HR9A 2FMDA 1AYM2 4XBLA 5APAA 1V6KA 3TEWA 1RUI1 1SPPA 2EXJA 1FPN1 2KXLA 2LS6A 2QQJA 3GZAA 3U37A 2YPJA 4CCNA 4CU9A 4K9SA 1PGSA 1H1AA 3D8CA 2RDSA 3O14A 4B3NA 1TNFA 4QX5A 2CGNA 2X53S 3ELNA 4QU2A 4ZY9A 1OBNA 1Y9QA 4E8DA 4IEYA 5A3NA 1C8NA 3H50A 4XIOA 1IGOA 2GH8A 4J1XA 2OS2A 4K6BA 4CDWC 4I2OA 5IVFA 1WD3A 1IKQA 2WNEA 1XNKA 1JH5A 1JZ6A 1CVNA 2HWE3 5FYUA 3NRUA 3LEIA 2O8OA 1SFPA 5JPMB 3N7MA 1OVSA 1KS5A 3TB0A 1IS6A 5F1RA 1RUD3 4BQ5A 3INAA 2ZPXA 5F8PA 5C3OA 1S2BA 4HL0A 5AFEA 4LQRA 3J8F3 3RYRA 2HWD2 3KF5A 4MXVA 5GLWA 3VKNA 1B35A 3I8TA 3HQRA 1QY4A 4ZU4A 1ZA4A 2WT2A 1CQ9A 2Y38A 2HWB2 3IDCB 4ZS2A 2BOIA 4UT5A 4D7TA 2P6CA 2D7FA 1L7RA 1F15A 3U1XA 1K45A 5D1IA 1D0GA 3BKZA 3VZLA 5I0DA 2QQPA 2PA7A 5KWRA 1SCSA 1W6NB 4FXGB 1N3OA 3BGAA 3WNPA 4Q4Y1 5FCCA 2P3KA 4PIXA 3MIHA 4EROA 3KV6A 2WFF1 5A7NA 1ENQA 3GGLA 5CIRA 4Y1YA 2PHXA 2VECA 3KVBA 2OX0A 5I8TA 5I91A 3Q8CA 3MZHA 4KG8A 4BPZA 5BNOC 1DQ2A 1HW5A 1R081 3AKTA 4XXAA 4XETA 5JMCA 2VCBA 4QPYA 5J3UA 3UK9A 1G9BA 5C8CB 2WAOA 2QQMA 3WQ0A 1AR61 4CEYA 4NIHA 3M3EA 1F2NA 4IEVA 1W6QB 1QJFA 2VNVA 1H1IA 1AYM1 1CONA 3FHAA 4S2FA 2J22A 1FPN2 3VL9A 1QKQA 3BODA 4NVPA 2YY1A 5GLUA 3DKQA 1NG0A 4XJUA 3WF3A 4CCJA 1WCUA 5LRSA 4IV1C 4QAWA 4LUKA 1JYVA 1HJGA 4COZA 2VULA 4N53C 1F4AA 1GOFA 5F6KA 1D2SA 1HXS3 1LENA 2UURA 3CLPA 3ES1A 4H2AA 1SQ4A 1UNBA 2B8MA 5LASA 3SHRA 4HVOA 2JD4A 1LODA 1WCDJ 1ZBE3 2G19A 3K46A 4S2DA 2Z42A 1ZRFA 1RHI3 1X82A 2DVBA 2FHRA 1R1A3 3LEMA 3MPPG 2B5HA 3WV6A 3JB4C 1HB3A 5FZOA 4YVSB 3RJ2X 2R49A 5HCFA 4CDUA 4URAA 3T3YA 1RUG3 3W20A 1Y7BA 3IIIA 1RUG2 5B4XA 4OQ8A 4Y1UA 4E27A 1J59A 4KL1A 3ES4A 1LB2A 1TEIA 1XNCA 1GV9A 2D98A 4W6YA 5L7OA 4JRLA 4CDUB 2W9XA 4G9SB 4KI5M 3D5OA 3GM8A 3ON7A 4GWNA 4LK7A 4XE9A 2NMOA 2D93A 2J1AA 2VJXA 1VBD3 3AB0A 3MIBA 3V0AB 4LBLA 5HV4A 4CP9B 1RMU2 2BP6A 4C90A 3S5AA 4OYUA 1AR81 3WNNA 1VP6A 2VG9A 4NE9A 4TXWA 3UGGA 1X33A 4MGZE 1ACCA 1UYZA 4GD4A 1PVC2 3K2OA 1DG6A 2HEVF 1CJDA 1LESA 3WCRA 3HBZA 4XFHA 4OUEA 1CZVA 2ZGRA 4IQPA 3DV8A 4DXTA 3E1F1 1PGL2 4HN0A 1JU3A 1FNZA 5FOJB 3J26N 3VDDB 3DN7A 4ATFA 1XC6A 5CG8A 1AR93 4NHYA 3U11A 2GMEA 4GB31 2YB7A 3MFCA 5K9YA 1V6LA 2DU1A 4HZFA 1GQPA 3RRDA 1YQ8A 1U5XA 1L3JA 1SLTA 1B35C 2PLV2 3AFGA 5HV0A 4BJ0A 1J84A 1MS4A 3AMNA 3MI8A 5LA0A 2YC2A 4JX0A 4AI8A 4BE3A 2XUMA 4I0WB 3ORJA 3RFRA 5CZKA 4AEDC 2WNUA 2GN7A 4M3CB 1ST8A 1F5JA 2GC0A 5AVPA 5LY1A 1Q8SA 4AI2A 5C9AC 1UYXA 2WR9A 3D4KA 5DABA 1NY71 2CAUA 3A7QA 5FXXA 4C0BA 1JYTA 3AZYA 2R072 3C7EA 3NNGA 3Q9OA 4XZPA 4PI0A 3RDIA 3ZR6A 2YZ4A 1QJY1 1A8DA 5JIUA 1RUD1 3I2OA 1WW4A 5G05L 1H8TB 3LA3A 1ULGA 2AR6A 3T0DA 3SEEA 1PO12 3BI3A 3R4UA 3WZ1A 1NAEA 1ODMA 1XB9A 2VU9A 4GAZA 5F2WA 4N43B 4P9WA 5KBFA 4X8NA 5JWPA 4Q4V2 3PIJA 1YFWA 2VQ0A 2YBPA 2VOWA 3RJRA 1UYYA 5IJRA 3RZLA 3PURA 3OD4A 2I07B 5EXOA 1H8VA 4OUMA 2YROA 5F39A 1NA1B 2Q8EA 3IKWA 5KXEA 1DFQA 2VUJA 2ID4A 4CCMA 1SBFA 4IUGA 2HWC3 1BBT2 4JTOA 5LRRA 2F17A 3WF2A 2F4PA 1OD5A 1VBE3 5FO8B 5CEHA 5LEKA 2AYHA 4ZXKA 1G8WA 3IZOA 1F4HA 1RUJ1 4DEVA 4A7YA 1W3XA 1COV1 2WQ4A 2XHKA 1XE8A 2XHNA 1KFUL 1TME2 1EAH2 3D0JA 4LBMA 2GNDA 4AQ2A 3D82A 3U78A 3BTXA 3P5BA 3LZZA 4FP3A 4MVTA 1O4ZA 5M0TA 4Z8BA 3HN3A 2PAMA 3ZDSA 1AR63 1JTZX 2WJSA 1PMIA 3SEPA 5IVVA 2HJIA 2WO7A 5FZ4A 1W9FA 1BLZA 1N47A 3ABZA 2JD9A 1OLQA 1YC61 3WNKA 4Y1XA 1GNYA 2PHWA 1COV3 2D6MA 5FPBA 1PM7A 5A70A 3AVRA 1UOGA 5DAQA 5BNOB 2RM21 1CZTA 1RIRA 4C0HA 2QCSB 2ZGLA 4HSLA 4C8DA 2UYBA 3O5SA 1KITA 1POQA 4EJRA 3SKJE 2JJ6A 3POGA 1YUDA 1W90A 1YRZA 2VC9A 1N1TA 2Q0AA 3B9CA 1O3QA 2H0VA 2Z2SB 2PFWA 3LD8A 1NCRC 1UN1A 4MGYE 3WW3A 2Q1FA 3KVAA 1YNAA 2EICA 3ILRA 4FCAA 4DQAA 2RM23 1WLTA 4XJ9A 1UKRA 3H7YA 5IVBA 4GZ9A 5C3RA 4PF1A 5JXJA 3N9NA 5I0TA 2A71A 3RYKA 2VNGA 3ACFA 2X8KA 1UF2C 1PVXA 2EAKA 4IV3A 1G6NA 4AEJA 1Z7S2 1RXGA 2GNBA 1QJU2 1H2LA 1Y9MA 2YXSA 2VQAA 1VAMA 3C8XA 1QJY2 1NY72 1SLBA 4Q1RA 3THTA 4FFIA 3OUHA 3K48A 5G04L 3MV11 3KHCA 4PLOA 2PHUA 4JKLA 3WNOA 3DEMA 4HMZA 3HNMA 2PTMA 2WIIB 3MHZA 1D4VB 3DXUA 3SITA 1XQNA 4BOWA 2ET7A 5FXZA 3TEXA 4C91A 5A6QA 1LU2A 4FPOB 1VPHA 2EAAA 4HOOA 3E5XA 4N43C 2H0BA 4K1ZA 2EA7A 2D5HA 5JR7B 3CMGA 5JXIA 5KXCA 5JAXA 2XL9A 3ZXEA 1H9PA 3L2YA 1FATA 2PHTA 1V6IA 4ISQA 4HXCA 5JI7A 3FC0A 2ZS6B 2GALA 4Q4W1 5A3MA 2JG8B 4IEPA 1GNHA 2QKDA 1NQJA 2EF6A 3IN9A 4YM0A 4LO8A 3OUJA 3J7NA 4PDWA 3DYMA 4N9IA 5FAXA 2JDMA 3I97A 3G6JB 4HPKB 1J3RA 2WO2A 4CUCA 2RDNA 1AR82 4LTAA 5F5CA 1OUSA 1GLHA 3UNPA 1VBA2 2VCAA 5AC93 4XMAA 3LDKA 4CCOA 1NCQB 4NPMA 3VKOA 1WMDA 2GC2A 5LA2A 5CU1A 5FYMA 4CXWA 4AHXA 2D43A 2WO3A 1UD1A 3LFMA 3MYXA 1WWYA 3P3PA 1RUG1 2DDUA 2R042 5T3NA 2VTFA 3THCA 3BTAA 1JU4A 4R9BA 2ARAA 4QPWA 4GJZA 3M3OA 4CP0A 1JYXA 3DL3A 2P5BA 2XWJB 3FLPA 3KWVA 4DOUA 3B7MA 3ZN6A 4A44A 1Q56A 4XZUG 3VHOA 5FY5A 1MS1A 2JXAA 3R05A 4XJ8A 4AI3A 4DINB 3EYPA 3VHRA 5C4WC 3RNSA 3K77A 2B46X 3VBRC 3WDVA 4P14A 3ZFEA 2VNRA 4A41A 4I01A 1IS4A 1SCRA 3RMXA 2VZSA 2QQVA 3GCXA 4TLGA 1LULA 1UWWA 2ET1A 2KD7A 4U2AA 5JPNB 3WDWA 5IW0A 3J7HA 3WEZA 5IFPA 3USUB 2C6SA 1YFYA 1J58A 4YGEA 5FPAA 2XPJA 4NAOA 1KD7A 5DUUA 3KV5A 3EO6A 3MLKA 2FDFA 4CUGA 1GQGA 2RJLA 1RITA 2RMU3 5LBBA 4J25A 3MLJA 2DUQA 1SG3A 2ZKNA 1IG0A 3VBHB 1S4CA 3ZPYA 1GICA 2J1UA 4RSUA 1EAH3 4TYSA 1OC1A 2R0FA 3OCPA 3TAYA 2ZEWA 4LBQA 5DZEA 1JUIA 2ZTNA 1RUE2 3MFAA 2PYTA 4QB6A 4RFRB 4XF9A 5JCTA 1VB2A 5LY2A 3VB9A 4AI1A 4CYDA 3QBQA 1HX6A 1ALYA 1BXHA 1PGW2 2VMFA 4Q4Y3 1OUXA 2X05A 1QJZA 3HNBM 2JDHA 1UPIA 2HWF2 1LNSA 1QJY3 3ALQA 4CZSA 4P9JA 4EN6B 1JZ3A 2E7AA 3N7LA 1QDOA 4XEZA 1D4M2 2ZGMA 5C7GA 1RUE3 4FFHA 1OFNA 3OB8A 5F3IA 4CDQC 2ZEYA 4EV0A 4UWDA 5JZGB 4AGVA 3SCHA 1RUC2 3UYJA 4NROA 1REDA 1DU3D 2XB6C 2VCCA 2DCZA 1O91A 3RWKX 3OY8B 5HI0A 3D0SA 1O8SA 3KT1A 4PBOA 2A6YA 3VZOA 1UY2A 4QGNA 1IQDC 1WBFA 2ZGOA 3DPRB 1W8FA 4YVSC 2VXRA 4L9BA 4WM8A 1A3KA 2D6KA 3WINE 5KXDA 4IE7A 2BNOA 4LMFA 1K5MC 1TZOA 3FUOA 5E6HA 3FN9A 5C9AB 2G9GA 1BEV3 2ZGUA 1UIKA 2R061 3AKQA 4OHVA 4X8PA 2E32A 2DBNA 4OHXA 4JKKA 3K75B 2Z4FA 5A3TA 3NW4A 4YVWB 2EXKA 2XQXA 3LA7A 2BNMA 2B39A 2SLIA 2WS92 4LE3A 2DFBA 4XABA 4BYYA 4EQVA 1VBB1 2J42A 4PIZA 4Q29A 5FMDA 3CJIB 4J1WA 2VW1A 2VW0A 2OZ6A 2B9VA 1ZRIA 4RHV1 3CJIC 4LULA 3ZSMA 5DPNA 1FOD2 2XKPA 4CCKA 1A34A 2RS31 4BMEA 3AK0A 3O1UA 5C5UA 2W39A 1O3SA 4BQ4A 4KU7A 4BK4A 4CEWA 3CQOA 3H8XA 4YZ4A 3LDRA 3OGVA 5ANNA 2HEYF 3RMYA 2VTXA 4F3JA 2DCYA 5KHIA 4P9LA 5L7OB 5FZCA 3TWIA 2GMPA 3EB7A 1ULCA 4BZ4A 4FP2A 2JDYA 2QDRA 3K4ZA 5LB6A 1DQ0A 1YLLA 3ZFEC 5FPLA 4HG6B 3U75A 1D0HA 3ITQA 3BU0A 2YGLA 2JE7A 2FDKA 5T52A 1UY3A 3HPNA 4NN0A 1QJEA 1QQP1 3H7JA 4MYEA 5HXVA 3K4DA 3ME2A 3O0XA 4NHKA 5FZ0A 2VL4A 2ZGPA 3IPVB 1IPSA 2Y6JA 1O8PA 1SBEA 4CTEA 1IZ3A 1PMHX 4L97A 3WHTA 5A1FA 3WW2A 3IPVA 4NIAA 1RUF3 2FCVA 4Q0PA 1PZ9A 3IWZA 1DZTA 1LEDA 1ZM1A 3ZPOA 2XH6A 5CFDB 3L9JT 3GNEA 4CDWA 2HKXA 1NX9A 2Z69A 1JYWA 1Q3EA 3ZKYA 4NOTA 5SV5A 5ERLA 4ORFA 3FE5A 4NRPA 2VW2A 1YFXA 1DLCA 2OPKA 2R041 3NO8A 4CCLA 5IFTA 4CU6A 2OQ6A 4GXLA 4E4SA 2VNOA 1X8MA 2C0ZA 4YM1A 2XBO2 3OBAA 5FTTC 3AFKA 4P9GA 2FDGA 4GWJA 1UZYA 4MGQA 4OUSA 3WHUA 5D8AB 4OULA 5CADA 4DY3A 4K3UA 2FD8A 1QJX1 1EPWA 2IZWA 3OUIA 2DVFA 1DP0A 4QPIC 1YI7A 4IV3B 1MEC3 1NCRB 3O1SA 3MLLA 2P3JA 2W5FA 5H9RA 5C5TA 5F5IA 3B69A 3WR0A 2CGPA 2WRAA 2BWCA 4DMIA 2V4AA 3IBMA 4XJWA 2R043 5GLZA 1SLAA 1W3VA 3TYJA 5A7QA 2C4XA 1ZZ8A 4YM3A 1RTVA 4FVVA 3U4XA 3SXWA 1UU5A 4FSJA 1EP0A 2GP3A 4LJHA 3OSDA 2FCTA 4H7LA 4HKWA 5JZGC 1E57A 2PAKA 3BIWE 4JHZA 2ZMKA 2QE3A 3WP5A 3FFQA 1VBA3 3VBUC 3CF6E 4ARXA 1EUUA 1CIYA 3C3VA 5GALA 1MZ6A 2IVJA 4KMQA 4M3CE 3J8F1 2VOTA 4GH4C 5A3LA 2I2SA 1IPKA 1B09A 3J7MA 4WM7C 4XFAA 2RS52 2ZGKA 2J1EA 4XF3A 5FRAA 5FYTA 4C1WA 1NOVA 5CFCB 4NPRA 5JR2A 3ZSJA 4JC1A 4O9EA 3GJAA 1J1TA 1BYHA 4UFHA 3HWJA 3I54A 5D2AA 3WG2A 3J7LA 5A7SA 4RS5C 3POYA 1ZX5A 3ZOIA 4MGKE 4QKFA 1QJU1 3APBA 2E7QA 3PVOA 2V5DA 4P9IA 2W1SA 1CAUA 4FPFA 4IV1A 4URTA 4YVWC 5FZEA 4B4QA 3W59A 1FI2A 1IHMA 3ZLIA 3E6CC 4OHYA 2SBAA 4X6QB 5EWSA 5KHHA 4KU8A 4XQ4A 1MACA 1SFYA 4LIUA 2K9ZA 3VHNA 2VBPA 4R9CA 5DG1A 5FZ8A 5BNNB 2K0GA 1BKZA 4FBFA 2P4EA 3AZXA 1F31A 4IEZA 4UW5A 4YG3A 1W2UA 2ZZQA 3IDEA 4DFSA 1QJU3 3CDZB 5GLTA 3I7DA 4MOAA 3HNYM 5FK7A 5BUVA 4LNVA 2ZX4A 1OVPA 1DGWX 3PDQA 3UJQA 1LECA 5FMCA 1ZREA 1N1YA 5E89A 2RM22 2VMGA 4Q4X2 5LZ6A 1XXNA 3ETQA 4K7JA 5JSRA 2PQSA 3ZYRA 1EAH1 4EN7B 2NMNA 1QGLA 2YU1A 1GMMA 4M01A 4ET7A 3FMGA 2V5YA 4B4RA 3KCYA 4Z82A 2OVUA 3AYDA 3FHQA 4QQOA 5AC92 2ZZJA 4FPLA 1LJ7A 1RHI1 3FJSA 3JD73 4YW4A 3KM5A 4ZZ8A 4GULA 1JXNA 4AFAA 3QD6A 2LM3A 5DUWA 5BNNA 1W6PA 2YBKA 1PM4A 1QEXA 3KQ4B 4XUPA 2GZWA 1R64A 1QXJA 1ULOA 3AMPA 2OKXA 4CUBA 3VV1A 3I3DA 3VGIA 3WDYA 1CZSA 1W28A 4FTBA 3UKTA 3GDBA 1ZRCA 3ACLA 3B5LB 3OF1A 5J98B 1VBD1 1JHJA 2RS13 1GQHA 3MW2A 4I0AA 4QPIA 2JDNA 2WFF3 4QPGA 4XFBA 1QDCA 4AQTA 5IYYA 4IETA 2ZCWA 5IT6A 3V0BA 1UMZA 5I8SA 2RG4A 5L73A 1UY0A 1MS9A 2E33A 1M06G 1DGRN 5D21A 4AW7A 5J09A 1ZVFA 3OOXA 3WDXA 4BQWA 4AWDA 5FWEA 2TNFA 3OBTA 3KSCA 1NCQA 5BNPC 2CV6A 1DZRA 4ES8A 4GIQA 3M8LA 1PO11 1C3HA 4LKFA 1ND3A 2YG0A 1Z7S3 5LBCA 1WCQA 3TN91 4D69A 1H6YA 2FMYA 3S0MA 4MG2A 2XKOA 4WM7A 3E97A 2F4LA 4PIYA 4RHV3 1HN0A 3PUQA 5A7WA 4LA2A 5ANQA 3OGSA 1PNFA 3I3MA 4AG4A 2ADEA 4DIQA 1W2NA 3IIAA 5C8CC 4QPIB 1UW8A 1GOHA 4W6WA 4W8JA 5GJ6A 5A7WB 1OURA 4A2UA 2VMEA 3F2ZA 1T6BX 1C8M2 4BQ3A 2WYSA 4KWUA 3CNAA 1HXS1 5FREA 5T5LA 1MZFA 5H9PA 4AHWA 2JE9A 1MR5A 4QXHA 4PJYA 4XC9A 4L0PA 4YVWA 4SLIA 1XYPA 3WCSA 1O7FA 5EHDA 2X29A 3BTZA 2LROA 4UFJA 5J7MA 4IE4A 3UETA 3A23A 4RGGA 4DRVA 1JS9A 3GXUA 1W8ZA 3EMRA 3GHMA 4QD2A 5EIYB 5KHJA 5F5AA 1RUJ2 3MDPA 4HETA 4YZ5A 1HB1A 1K12A 1V70A 2BEOA 1FMD2 1PIV3 3BB6A 1N1VA 5IATA 1J1LA 5FYSA 1QNWA 4QDSA 3WQ7A 1RUOA 4AL9A 3VBHC 4XJAA 1U5YA 2JIJA 1C5IA 5LWBA 2P3IA 1VBE1 1W0NA 2RS12 3ZFGB 3VBSC 5FQ0B 2JKXA 1GP6A 1RUJ3 4LBKA 2VUAA 3ZFFB 1TME3 3EBRA 1QXRA 4JAAA 5BY5A 3WDUA 1MZ5A 4OI4A 5C3QA 2NLRA 1XU1A 4E4DX 4PQ9A 4Y4RA 1Y43B 3KB5A 3ACHA 1PK6C 3I2GA 3NV2A 4OHWA 4RN5A 4XFCA 3VKFC 4AVBA 1I3HA 3NJVA 4PLMA 2C9AA 3KGZA 4XQDA 3BTYA 5IWFA 5IK7A 3JBG2 1AR91 3LKJA 5T54A 4Y5Z0 2A5ZA 1O5LA 1QJX3 2R071 3PHMA 3IAPA 4UW4A 4CRQA 2JDZA 1Q5OA 4XTPA 1REFA 2W1QA 1XOYA 4S2HA 3ZIXA 4DS0A 1ZYBA 3PMSA 4A42A 1XNTA 5DAPA 3LIHA 1ONAA 5H9QA 2YUEA 1HRI3 5LK5A 2W08A 5DUXA 2JICA 2MHFA 1O59A 1UZZA 4OQ9A 4Q27A 3WOGA 2X5IB 1O4TA 1I1EA 4MGIE 1W2OA 1OPOA 2Y6HA 5BV6A 4LBNA 5GZEA 1LHOA 3B01A 3IMNA 4GMP0 4RHV2 3M3QA 5IUQA 5FY9A 5FY7A 4IW3A 3KGLA 4CXYA 3RZMA 1WA6X 4AEKA 1S0BA 3CBNA 3FUQA 1LEMA 2JB4A 1PO23 3RZKA 3I49A 4CSWA 2XOMA 4QXKA 1AYN2 1GZTA 1NCQC 2X10A 3PL0A 3VBOC 1HDKA 1JHNA 4EN8B 1LHVA 1R083 2G9FA 2HH9A 4IE0A 2R063 2JG9C 4TWTA 1GZWA 1KFXL 2WC2A 4N7UA 4YLZA 1KS4A 3KZ4C 4AGGA 3K51A 3QOPA 4HANA 4AEDB 2VMDA 1GYKA 3AVSA 1PNGA 1X9PA 1FNYA 1RMU1 4QKNA 4LBOA 1MQTC 4YG0A 1UY1A 3PU3A 3AYAA 1OOPB 1PIV2 2WFF2 1PO21 5FLJA 2O8QA 4K40A 1VMHA 3OGJA 1IG3A 1H8TA 1D7PM 4AGRA 3OBZA 1YQ2A 2HWB1 4XXPA 5A6XA 1CGPA 4AFMA 4N53B 3ZYHA 3DXTA 1LOAA 4FOVA 4UW3A 3ZFEB 3E5QA 1D4M1 3KS7A 3AP4A 4EN0A 2CGOA 2A6ZA 5F7UA 3CIHA 4N53A 1LOFC 3AP5A 5J1XA 4A6SA 4N7IA 4M4RA 1U5ZA 4QX2A 4R9DA 3NVCA 4A6OA 1RUI2 1W6NA 1WKYA 2DUPA 3NAPC 2VUDA 2W3JA 2WQ8A 5FDBA 5FLHA 2HWB3 2QQUA 4CDUC 1G9CA 2ZGQA 4KWJA 3VKMA 4BHPA 2HWD3 3H8UA 1AR72 4JGYB 1FAYA 2A3XA 4YW7A 1UOJA 4INDA 1GWKA 2E31A 3BU7A 2P17A 4Q1PA 3MGUA 3H42B 3P1IA 4Y22A 3WQ1A 2Q1MA 1BVP1 1YXWA 4WVVA 4EWEA 3T4HB 5CFCC 2VVEA 1TG7A 4KBBA 5EJ3A 4UYBA 3VDBA 4NRQA 2ZHLA 2VVDA 4FPHA 2ADDA 2QQKA 1U0AA 3PLQA 4EZHA 3HQUA 4FAGA 4MLOA 3POFA 2W47A 4QHBA 2D40A 4EE2A 4DUXA 5DAWA 2DVAA 2JDKA 3I59A 3ZFFC 4D6QA 4FQZA 4LKSA 3B93A 3BOPA 4GB33 1PMJX 1UU4A 4WZFA 1RUF2 3WW1A 3T1MA 1UX7A 4ZXEA 3AJZA 3N9OA 3H8OA 3LSDA 2I74A 1S0DA 2Y26A 4K8RB 1NZIA 1S55A 4UFLA 3UGFA 3HJRA 5IHRA 2JENA 2P3YA 2XJQA 1QU0A 3ZXJA 3POJA 1OQ1A 1KEXA 5HPOA 1AZDA 4RQPC 1W9WA 2PMWB 3E6DA 2LALA 2Q30A 4NWVA 3MPBA 2BFUL 2RS53 4ISRA 4LITA 4QKBA 4DXZA 4Q8KA 5A6ZA 2W95A 1C57A 1IKPA 2XUEA 5C9AA 3CZJA 4NJ4A 1RINA 5H9SA 2FBEA 3VD9A 3QH7A 2QVSB 2BVVA 5FZMA 1PGW1 3FX3A 3VBOA 4CDQA 2AC1A 1WW5A 2QZ3A 3ZYIB 2C5DA 5C71A 1YFUA 3OPWA 3VBFA 1N3QA 4CEYB 4QQHA 4XFIA 3ZMNA 1VIWB 2P2KA 1POV1 5FPUA 1NT0A 3VD7A 3A4UA 2WINB 4Q4W2 4YZ3A 5JMOA 1JYIA 1OQEA 2ORZA 3GJBA 3IDBB 4P9XA 2W94A 1MQTA 1OH4A 1V9U1 2QFEA 2NZ9A 2B42B 5GZFA 3WUCA 1ULEA 3R4DB 2JWPA 3MIFA 4Z1VA 3LEKA 4WM8C 1YIFA 3HT1A 2VXJA 1STMA 1OLME 2DVGA 2DCJA 1S1AA 3ZXKA 2ZACA 4JGZB 4R9AA 1LGNA 1U5IA 2Y60A 1F8VA 1OFSA 5BYNA 2ZEXA 1NE6A 5F6LB 2XBO3 4A3ZA 5F37A 1Z78A 3ASIA 2NP0A 1UIJA 4NO4A 1YCIA 4OZOA 4MZUA 5A3PA 5KC6A 3VUOA 4DNYA 3OEBA 4G4FA 2HBUA 4AE2A 4X6RB 3G7DA 4MSVA 3HBKA 1E5RA 2HYXA 4R4XA 4AEMA 4HVRA 3O0WA 1XRUA 1BMV2 2MEV1 2WN2A 1ULFA 1F9KA 2DCTA 4CE8A 4NHLA 3JBG1 3IDAA 4PLNA 4AQSA 3ZKUA 2VGDA 4YW3A 4H7MA 1XYNA 2VVFA 1J83A 1Y3TA 3VZKA 1YYNA 2QJVA 3KHBA 3IAQA 4Y33A 3T2OA 1HRI2 4OHZA 4WVMA 1H6XA 5CKNA 4CPBA 3DGTA 2PHRA 3T2TA 4ZKTB 5T5OA 4NHXA 4TN7A 3NSTA 3PTRB 4AVSA 3C7FA 3CKHA 3ECQA 2J1VA 3U14A 1W2AX 3OG2A 3VBRB 1UXZA 3PJYA 3JBG3 4Y20B 1BBT3 1EUTA 1RUH2 2VR4A 3N9QA 1SLCA 1UU6A 3H1MA 1C8M1 1DCSA 1YIPA 3NKGA 1AX1A 1OXCA 2IWGB 2VMCA 5DN2A 3ZSLA 3NNMA 3NWKA 2Q8OA 3PUSA 1ULDA 1OOPC 4OMCA 5A6YA 1AX2A 2Z5WA 4LEJA 1NLQA 3I2HA 1W6QA 2YBSA 5FQ0A 2ENRA 2GMMA 1NCRA 2AACA 2WLPA 1WGPA 4FPJA 4IEWA 4QHOA 4BQ1A 1ZBE1 4B8EA 4FPKA 2Z79A 1TNRA 5FY1A 1DLLA 5KR7A 2XJPA 1ND2A 2ETEA 5ABJC 5C3PA 1VJ2A 4IV3C 1UAIA 2A7AA 3FLTA 2XVGA 1H2NA 3RZGA 5DDJ1 1ZRRA 3H0OA 4ZU7A 1ND3B 3AL5A 4I0BA 1OKQA 4GH4B 2V73A 4Q0QA 3KT4A 3TNQA 2IFRA 2QQLA 2RR13 4BU2A 5SV8A 2ZMLA 1UPSA 1W6PB 2V72A 4LLOA 3ZYPA 4YFZA 4AVAA 2UWBA 4P00B 4Q26A 5FYYA 2I45A 4A3XA 1YEWA 3LOIA 4LBQB 1DYOA 1Y4WA 5ABJB 1OF3A 2E53A 1BJQA 4D6SA 1Z7S1 2XLFA 2K2SA 2XJSA 2VZTA 3VBFC 5FXWA 1V6NA 4KWLA 1BMV1 2WABA 3GZTB 2W46A 4L8QA 5ACA2 1QF3A 2W2IA 3BIEA 3O7OA 4AYUA 3V0BB 5DQ0A 2ZEZA 3VZJA 4Q4W3 4S2GA 4CDXB 2R1DA 3AKRA 1UOBA 5A1AA 4LIVA 2G9ZA 4XF0A 1ZRDA 3UT0A 1HV0A 2GH2A 2RS51 5DDJ2 5ACA1 2WSUA 4AI9A 1HRV1 4IESA 2XVLA 3A0KA 1W0PA 3MUY1 2ZX1A 1D4M3 5FP3A 3PU8A 5L36A 1HB2A 4PDWC 2HWF3 3LWCA 5F3CA 4GH4A 4XUTA 3ZSKA 1RB8G 4QM8A 5DZFA 1NXMA 3LDBA 1AVBA 2JKBA 1HLCA 2WKKA 4CPBD 1LOCA 3LPGA 4G3YC 5FP7A 5DUVA 3QACA 4JHTA 3POIA 1EY2A 1POV3 1MPXA 4MHRA 4XFGA 1W04A 4P9YA 1BHGA 1LTEA 5L7OC 3P3NA 4M0HA 2QQWA 2JX9A 4L99A 4XBNA 2BYVE 1O4YA 1XBFA 2WLQA 3M70A 1FT9A 1IS3A 3FL7A 3OTFA 5B2GB 2J1TA 4CXXA 1GBGA 1HIXA 1VALA 4TZDA 1BCXA 1ZBE2 2UU8A 4DUWA 2WWUA 4PT6A 5EV7A 3WY6A 1TME1 2ZGNA 1OSGA 3FHIB 3F95A 3MIEA 3BYWA 1G9AA 5FBZA 4AHYA 1R093 4IGQA 4LR4A 1CJPA 1XNBA 4R52A 3VBRA 5ISLA 4AHZA 2IXJA 2ZMNA 4EN9B 1UX6A 4TSVA 4LHNA 4QX7A 3SLIA 3T09A 1FPN3 1SEFA 2ZAHA 2HWC1 4P02B 1RUF1 2JG8A 3TEZA 1UXXX 4EWDA 2GU9A 4HKLA 4FXKB 4AR2A 2RE9A 1WZXA 1JBCA 1HJFA 5C8WA 2XLGA 5HCHA 2DTWA 2LTNA 5DAVA 2FQPA 1W6MA 4XCBA 5CVRA 4LKDA 4AOCA 4AF9A 3OEAA 1UOFA 5DZGA 2CU5A 2GDFA 4RGKA 2GSYA 2IVIB 5FO7B 2Y33A 3I2IA 4QT6A 4YW1A 3UKNA 2OYZA 1RVF3 1ND2C 1TVGA 2AENA 1J3PA 3JU9A 3KT7A 1MZEA 2WZR2 1RUH3 3KLSA 2KM2A 5FXVA 1PZ8A 1O3RA 4KGQA 1WCKA 2VZPA 1V6MA 5EFUA 3MEPA 1CESA 2IXHA 1R092 2HBTA 1VAVA 3LOBA 4A4AA 3I2KA 1CPNA 1CAXB 2ZABA 1NE4A 1DF0A 5K0UA 3WG1A 4YFWA 1ASJ1 3EXUA 4Z92B 3RVHA 1W99A 4DUVA 3ZFGA 2WT1A 4K1YA 4LOSA 3MO4A 1K42A 4LBJA 3OD0A 5EQUA 1C1FA 4MXWB 5LA9A 3RG0A 2VZ1A 3WUDA 4YYOA 1W0OA 5FMOS 4OI1A 3AKSA 4UOJA 4CCEA 1UKGA 1DQ4A 3ACGA 1AR62 2ARXA 3VDAA 2BV4A 3ZDVA 5D8AA 5GZCA 3BN6A 5BNPA 1BK0A 2VZRA 2IC1A 1WLWA 3WP6A 2DBIA 2HWE2 1ASJ3 2R062 1TMF3 1LOBA 2QDNA 2VE1A 4XBQA 1CR7A 2YPDA 4K20A 2ES3A 2OXBA 1ND3C 1URXA 3N9PA 4NWWA 3VD4A 4Y5SA 3T4VA 1PO22 2ZKLA 3AKPA 1V0AA 4HBNA 4LO6B 4KNCA 1E5IA 4Q0VA 4WBBA 3ZMOA 2WZR3 4FFGA 2O1QA 5FYBA 5LK7B 1HV1A 5JI9A 4GJYA 2CY6A 4I30A 3WLUA 1H30A 2BGCA 3ENRA 4J6GA 3GHNA 4JGYA 1LHWA 1GKBA 4CVUA 4XQWA 4DRRA 4RS5B 3EHKA 3NJZA 3ZXDA 5KC5A 1XE7A 4Q0UA 3VDDC 4A7ZA 1YI9A 4PHZA 5ACA3 1DZQA 5JOWA 1SHWB 1S0EA 2WYFA 3MIDA 2D3SA 5E88A 5FKBA 3THDA 3ZYJB 2OPWA 4DY5A 3RZHA 1LR5A 4LXLA 2VBDA 2VZVA 2XR4A 2GN3A 3CJXA 4XCAA 1LCLA 3I2DA 4M4PA 1NYWA 1OLRA 2UY9A 4XOGA 3DCQA 2OW4A 1XSQA 4XURA 1CAWA 3OJBA 4FPGA 2VZOA 1HKDA 4RQPB 1FV3A 5FUPA 3JUUA 1XE0A 2CYFA 4OFGA 2DVDA 2DUOA 3HIFA 3QLQA 5CFDA 4CDWB 2P1BA 1JZ4A 1HQLA 2IUWA 4CA9A 1JMUB 1UO9A 3OYWB 3VBHA 1AXYA 3I3EA 2PAEA 3IMMA 1CAVB 2A6WA 2H6BA 4O61A 1OA3A 3JD71 2PELA 5A7OA 5FIXA 1AR92 1LU1A 1VBC2 3WF1A 4XDPA 3NL1A 3D6EA 2IXLA 4OI0A 1F35A 1AR71 5F9TA 5HCAA 1E5SA 3LA2A 2EVXA 1ZZCA 3A21A 3MUZ1 1R082 2IXCA 4QDQA 3RZZA 3S30A 4ATEA 4N8MA 1YO8A 3H8RA 3SMHA 3OBRA 1VR3A 1PIV1 2ZOEB 3C7GA 1VBE2 2RS11 5F2SA 1CIWA 3BCWA 3M4FA 3VHPA 1GZCA 4M3CA 1LOEA 1ZZ9A 2E7TA 5L9RA 5C4WA 3WF0A 1T2XA 4CCDA 3TEYA 2XWBB 2D6NA 4MHUA 4D6RA 1UZWA 1CX4A 3KV9A 4YWAA 3OY8A 4ASMB 4XMIA 1S2KA 4MX3A 1ENXA 2X5IA 5CNAA 2D44A 1ND2B 4NPLA 2UYAA 2OUJA 4ZZ5A 2DTYA 3BVCA 1OH3A 1PZ7A 1W39A 2QUOA 2WNUC 4AQ6A 5I93A 1RUI3 4IXLA 3FBYA 3RSJA 5FZOB 4XJZA 2IXKA 4LHKA 1XSRA 5JOZA 1AL23 2WS93 3O1RA 1HQWA 1W9TA 2TUNA 3S6PA 3S5QA 1MVEA 3X29B 4XDOA 4BK5A 2PHFA 3SCFA 1GUIA 3THPA 2VMHA 1EV13 1HXS2 4XAAA 4Y4YA 4CCCA 5LATA 1CN1A 3TRSB 1UZ0A 2B4KA 1NA1C 4CP9A 4CUAA 3DECA 1AYN1 2PQQA 2HWE1 4U36A 4JRAA 3WP3A 4FOQA 1I5ZA 3VN4A 4IV1B 2OT7A 3DPRA 3W5MA 1KRIA 3JQWA 4HONA 1WD4A 1Q8QA 3DF0A 3DKWA 4KQ7A 1WMXA 2YFUA 4NIGA 1AL21 5FYCA 3VDCA 1PHMA 4JGYC 2A3YA 4GWMA 1V6JA 2EXIA 1S0IA 2GP5A 1XYOA 2Y6GA 2YU2A 4RS5A 3PJQA 4AVTA 4B1LA 1A8MA 3VDDA 2A1XA 2WDBA 4D0QA 1OMIA 3DUIA 3LE0A 3NAPB 4AI0A 1E5HA 2DU0A 2H6CA 2W91A 3LGRA 4FT8A 2KA3A 2CTVA 2Y6FA 4JKMA 2BBAA 3URFA 1EPZA 1REEA 5HBAA 3U07A 3A0NA 3R4SA 3D3AA 1W8UA 2DFCA 2NN8A 4Q8LA 2WZR1 5J36A 3VBUB 5BNOA 1KXGA 3O1MA 2YC0A 4HN1A 3I2JA 2XJVA 4CEWB 1SMVA 3SH4A 4LLFA 4FAHA 5GZDA 2IXIA 2W68A 1C8M3 3JB8A 3CZUA 1C4RA 3GCWA 4UBHA 3HEIA 1BEV1 4IEUA 1QOSA 3GALA 5IK5A 5FYHA 4CEYC 5A3UA 3ZXGA 4YZ2A 4PBPA 4DZGA 1BZWA 4UBGA 2R7EB 4NHMA 1RVF1 1UMHA 5CFCA 5HCBA 4YGCA 1KJRA 3ZXAC 4HLTA 4IEQA 4M0NA 3POWA 5FP8A 3H3LA 1H2KA 2GC3A 1PK6B 3AP9A 3WP4A 4IE6A 3JZVA 3JQXA 4COYA 1GWMA 1CD3G 4Y20A 3VLBB 2VUCA 2WNVB 2JDUA 5K7PA 3A22A 5I0RA 4WVWA 5BNNC 2PHLA 3VBSB 3J4UH 3K3OA 2VZQA 4UFKA 4MADA 3PMEA 5CKQA 1HN1A 1DQ5A 4DXSA 1UMIA 2JEMA 1G9FA 1M4WA 3TN92 2ORXA 2VZ3A 5FZ7A 3U10A 1QNYA 3LAGA 1R1A1 2X5IC 5FYIA 4CDXC 1OLMA 4AAXA 1YQ5A 2ZGTA 5LEJA 5BPXA 1DQ1A 3ILNA 3VZMA 5FWJA 4NIDA 4EWAA 5JIAA 1N3PA 1QQP3 2XL7A 1XJAA 1GANA 1NLSA 4NIIA 3W58A 2CSGA 1JZ7A 4AVCA 3KMHA 4FPCA 4O9GA 4LUMA 3JCIA 2W1WA 1NXD1 5LCWL 5DAXA 2QQNA 3ZR5A 3O1OA 2YHJA 3ACIA 2E6VA 3TOJA 3VBOB 4DO0A 1W9YA 2D6PA 3AP7A 2ARBA 1AJKA 4BQ2A 1W06A 4CU7A 2OQ7A 2EIBA 2OA2A 3N3HA 1S0FA 3H3UA 1QHDA 3IM0A 2GNMA 4M3CF 3MICA 1VBD2 2WNUB 3H3ZA 3K3NA 4JV4A 4ES9A 3AZZA 3MW4A 4JQTA 1MS5A 1NA1A 2VM9A 5GLVA 1H4GA 1HRV2 1HB4A 4FPYA 1MQTB 4Q4V1 5EYYA 5FY4A 2FZ1A 2YYOA 5DG2A 2EIGA 3KD4A 3WNXA 3N9LA 1KDKA 3T0AA 3J8F2 2Q5TA 1MEC2 2XJUA 1JYCA 3ATGA 3B02A 2JG9B 1GZWB 1RHI2 4FPEA 4LK6A 1DGLA 3RZJA 1RUD2 5AC91 4IEOA 4AEDA 1UZVA 1MEC1 1VRH1 2UWCA 1GSLA 5FR3A 5LW9A 2AZ5A 3Q8FA 4K8FA 4RR3C 2WNOA 3NMBA 3NQHA 2ZHKA 4P5HA 1OPMA 3BPSA 2WAAA 2Y6LA 1YWKA 4B4PA 2DF7A 5JSOA 3MW3A 4E8CA 1I9RA 2XMLA 2DCKA 5KHKA 2BWAA 3W21A 2RJKA 1DQ6A 2D3PA 1WW7A 2AEZA 3HOBA 1X8EA 4Z07A 1RYYA 2O14A 3KF3A 4Y5TA 5T5PA 3ZYBA 4XAEA 1KQRA 2BZDA 1G9DA 4ZU5A 1OT5A 2XBO1 4QB1A 3USUA 5A32B 3VZNA 1JYNA 4BCUA 5FZBA 1US3A 2RDQA 4QM9A 4Q4X1 5FP9A 4IEXA 4BWOA 2BVBA 4OVEA 1H4HA 1DGRA 1JZ2A 4B1MA 2R16A 4WM7B 5JOXA 5JSPA 4GKYA 2YV8A 3GZUC 4YNIA 2DURA 4FFFA 5JXHA 2QNKA 2BOJA 2VQTA 3ZN5A 2MEV3 5C6CA 1PK6A 2BU9A 2GC1A 3N4MA 2WZPP 2BNNA 1GWLA 2WNVA 2B7YA 3C7HA 1KJLA 2J1RA 3KCCA 1RVF2 3QH6A 3PNAA 5F3EA 2VH9A 4Y3OA 5F3GA 1DDLA 5L19A 3PIGA 4HVQA 3MBWA 3NNJA 1AL0G 1COV2 3HVDA 4PCRA 2Y64A 4QDRA 3VD5A 2EXHA 4Q0SA 3K4AA 4DXRA 5FJHA 2QZ2A 1QQP2 4ITCA 4XDQA 4FOYA 4UF0B 1SFNA 4UAPA 5C33A 4GMP1 2ZA9A 2AUYA 4I09A 3FFZA 5FZGA 1GU3A 2D5FA 3DYPA 1LRHA 2V09A 4P5YA 2ZJCA 2ERFA 3GBWA 5FBJA 1W8NA 2HYKA 3IT8A 1O6UA 1W03A 2WN3A 2E9QA 4ARYA 4COUA 1K3IA 3LSEA 1V6OA 1BEV2 3SH5A 1TMF1 1AYN3 1ZNPA 5EPAA 2ZBJA 4YRDA 4QQLA 1GR3A 1QOOA 5I0SA 3HT2A 3AC0A 3ST7A 2PLV1 1A6CA 3GF6A 4ZS3A 5FMBA 2ARCA 1CPMA 3ZN4A 3WSOA 1UL9A 1C1LA 4YSFA 3M2MA 4XUOA 2VCMA 3SKVA 3NJYA 5JOYA 1LGBA 2D3RA 5FK8A 4BB3A 1ZBA3 5C70A 1PGL1 4ZHNA 2ZXQA 3PUHA 3N36A 2ZX3A 2XJTA 1W6OB 1JI6A 1IPJA 1J3QA 1GFF2 2RDRA 2UY8A 4XW3A 3T30A 3T1LA 5EP9A 1QWRA 1H8TC 1VAKA 4XACA 1G86A 2C26A 3N7JA 4D3WA 4LE4A 2C24A 2DV9A 3HAGA 1VE0A 2P34A 3EQEA 4RR3A 3WT3A 3PVBB 1R1ZA 5FO9B 2A6XA 2J7MA 3POEA 1QMJA 4Q4Y2 3QCWA 4IGOA 3WXPA 4NMIA
chains in the Genus database with same CATH topology
4H3WA 3ZN6B 4QGLA 5FPZA 2HEWF 4WM8B 1NLRA 4Y22B 2R1BA 3LB9A 1ZZ7A 4Y24A 2NPIA 4XF1A 1WMEA 1LKNA 3WVJA 2TBVA 1VLNA 3RPQA 4CP2A 3H1YA 1W6MB 2RHPA 4YZ1A 4V1PA 3TN93 1IQAA 3AYEA 4HKOA 5C8CA 1VRH3 4JDMA 1T6GC 5T5JA 1FX5A 4BM8A 4BH9A 4JVAA 1S0CA 2ZHNA 5C4WB 2C1FA 3AX4A 1CAWB 1PVC3 5A33B 3RI9A 4MUVA 3RI8A 1GZ9A 2RS32 5E16A 4PF5A 4RR3B 2ZGSA 2YMZA 3ZX7A 1KDMA 3ILFA 1VBC1 1VBB2 4I3PA 3OGGA 1S0GA 1G7YA 3ZFFA 4E2QA 4K21A 1DYPA 2OZJA 5FFOC 1MS3A 4MXWA 4E9KA 1IOAA 4Q4X3 1RUC3 3RYPA 1Z0HA 2R6QA 1OI6A 4RFT0 4W65A 3LCPA 4XYXA 2WSVA 1AXKA 1FOD1 1XNDA 4RQPA 4Y26A 5CA6A 2YGMA 3VBSA 1H1MA 2A70A 2WS91 1SACA 1X50A 4WV8A 5A33A 1I6XA 5K0UC 1YHFA 1EV11 4M00A 3ZIWA 1BK1A 3AXEA 4IERA 3SISA 3UKVA 2E51A 1RUC1 3ZFGC 1BVVA 4B7KA 1RL3A 4R8HA 5DXDA 1IS5A 5E1RA 2FZ2A 1FOD3 2WQZC 4WZCA 4DPNA 3HD8B 4E4ZA 5JDBA 1VBA1 2HWF1 1B35B 2BW8A 1C5HA 5JZGA 2PN5A 3AMMA 4QGMA 1HQNA 3WG4A 2ZX2A 3AP6A 2NYYA 4YG6A 1WW6A 2VOVA 3UV9A 3C2UA 5GKAC 2A73B 1QH7A 4H14A 1H0BA 5E8AA 1EV12 2BQPA 2WA3A 4RD7A 4YGDA 4AFCA 3WD5A 3M3IA 2GAUA 2MPFA 1SLIA 2BUKA 4RA0A 5KXBA 4FTSA 4WVZA 4JGZC 4Y1ZA 4XTMA 3AM2A 2IFWA 3CL1A 4XPVA 1ENRA 5I0UA 5J96B 5FOBB 3NKTA 1RUE1 2WFPA 2JG9A 4L92A 3NV4A 3GBGA 4HSJA 4LO7A 5K8SA 1CAVA 1LGCA 2W0XA 4Y1VA 3VKLA 3HQXA 1R091 2Y0IA 1MS0A 1AHSA 4YVSA 4LHLA 4AVVA 1A78A 1LHUA 3N7KA 3B00A 2B9UA 1K5MA 4C1XA 4COVA 3WW4A 2WA4A 1O3TA 3V0AA 2OIIA 4GALA 4LBQD 1DHKB 3GBFA 5CFDC 1NQDA 1K5MB 1TMF2 1H9WA 2E63A 3KQRA 3USSA 4F8AA 2D6OX 4Z2WA 5EZWA 5CG8A 4GQ7A 1EYBA 1X36A 4W6XA 2CL2A 1VB4A 2CAVA 1OOPA 4H55A 1ZZBA 2XJRA 4GMP3 3PVEA 2TEPA 3W9AA 2ZX0A 3AZVA 1AYM3 3BPZA 1OQDA 4JCKA 4LA3A 2BBVA 4D94A 5JVVA 2AH2A 1FMD1 1JN2P 3J9SA 4QPGB 3TBDA 3GYDA 5CAZA 1OA4A 5ABJA 3AJYA 1JOJA 1WMFA 1U12A 1AX0A 3AMQA 3I59B 4QQ2A 4XF4A 2RR11 4GKXA 2Q1ZB 3H1WA 4OZXA 4BIFA 1O5UA 3ZXFA 3V56A 5KHGA 1BQPA 4LT5A 3M1HA 4QPGC 1MS8A 1ZZ6A 2MNGA 4F7ZA 3R6SA 1ZBA1 2G4IA 3O0VA 4Q4V3 1YJKA 1JUHA 4FO9A 2WT0A 1QOTA 2NM1A 2CWSA 4B29A 2A75A 4COWA 3CU7A 1HRV3 1PO13 1QH6A 3POSA 3PTYA 2A6VA 3VBFB 4JDNA 1AR83 4JTNA 5GZGA 1LOGA 1JW6A 3EJKA 2W52A 4AXOA 1F5FA 1ASJ2 2ZHMA 3DPRC 3SH3A 1GNZA 2R30A 1DYKA 4I3GA 4AFDA 2PHDA 4QMAA 4JGZA 4F83A 3M3CA 1SLLA 3VL8A 4A7KA 3E5UA 4GA9A 3RS6A 3U0ZA 4IL7A 4N43A 2BTVC 3BOWA 1WUVA 4HT1T 1QXPA 4E2SA 5JLVA 4Q2FA 5FMOL 1RUNA 4NR1A 4BLIA 1WA4A 3AYCA 1C28A 1N1SA 3VBUA 4CDQB 5CBLA 1V9U3 4AFBA 3B9IA 3S7EA 4BA6A 2N7GA 1V00A 2HWC2 4PDWB 2YDEA 4YGBA 5I8YA 4XIKA 4WVMB 3AZWA 2JG8C 1AR73 2B45X 3HMYA 1APNA 1DBNA 4AK3A 1OA2A 2LUWA 4YW5A 2P37A 3FLRA 3E6BA 4RL7A 1AJOA 2VOXA 1ZBA2 2JECA 1WCSA 2RMU2 2VPVA 2O0OA 1TE1B 3UL2A 3ZO0B 2AREA 4ONUA 1DIWA 1R1A2 5CG9A 1RUH1 1VBB3 4XHXA 3OYWA 1NZCA 1RJ8A 4LO4B 3B3QE 1UCXA 1WLCA 2R073 2RMU1 4JQRA 4N9HA 2ATFA 3OPZA 1MVQA 4HPKA 1HRI1 3UJOA 4META 3MIGA 1OHFA 4B7EA 3V65A 4R4ZA 4BMBA 3WG3A 3ZYGA 5BNPB 1VRH2 4KWKA 3BALA 2PLV3 4CDXA 2R0HA 5A32A 3O12A 3CEWA 1W6OA 3AXDA 4OI2A 1BBT1 1RC6A 4L2NA 4D7SA 4TLFA 3ROUA 4RGAA 4QQPA 1FMD3 3NV1A 3CO2A 3PVNA 4YARA 4DB5A 4L11A 4OLLA 3S7IA 1SDWA 3MF9A 2XGXA 5D8AC 3FBMA 1D2QA 4JDOA 1CAXA 4BIOA 5EYXA 4I02A 2WL1A 2EALA 5CB7A 2WWSA 5J48A 1RMU3 1AUYA 1FV2A 5J37A 2XG3A 1V9U2 2OUHA 2XLAA 3WDTA 2AGSA 1AL22 4KGGA 3ZVXA 1ENSA 2DWRA 5IK4A 3ZSEA 1Q8OA 5DDJ3 2ILMA 4XILA 4CP1A 5T50A 5T55A 3V64A 2Y0OA 2XVKA 3ZXLA 1TQ5A 5AFBA 4FQ4A 2VY0A 3M7AA 4MH0E 1YJLA 1X7NA 4GB32 1QJX2 1WLDA 2DYCA 2BFUS 5BXXA 3MF6A 4E2GA 1Q8PA 1S0JA 4YW2A 1LOFA 2F6BA 3WX5A 5FLIA 2RR12 2RS33 3B94A 4HK8A 2A3WA 4HFSA 1PVC1 4YM2A 4FOWA 3NAPA 4KH9A 2HWD1 2GNTA 4SBVA 1DGWA 2Q4SA 1VBC3 1CAUB 1LHNA 4KG0A 1FXZA 2VMIA 1RJ7A 3HN1A 3KCXA 4HK9A 2D97A 3RWNA 5AVAA 1POV0 3NV3A 3I4IA 3SCGA 3AMHA 4XFFA 1SBDA 2NQYA 4ASLA 5BNQA 3CJIA 1RGSA 1XU2A 3RQ0A 3R0RA 3FZ3A 2ZAAA 2UWAA 3TNPB 3N35A 4CEWC 1Q8VA 2CNAA 4D7YA 2WNVC 5K0UB 1Q43A 4XHBA 5GM0A 3SNMA 5IK8A 3JD72 1FYUA 2MEV2 3L2HA 1AXZA 4UW6A 4MV2A 2CWMA 4BLJA 2D6LX 3FWEA 1H2MA 2VOKA 5F5QA 4UXAA 4LO5B 1WBLA 4N90A 4FTEA 2BPA2 1AF9A 2R32A 3H9AA 5TSWA 5FPXA 3HR9A 2FMDA 1AYM2 4XBLA 1V6KA 1RUI1 2EXJA 1FPN1 2KXLA 3GZAA 2YPJA 4K9SA 1PGSA 1H1AA 3D8CA 3O14A 4B3NA 1TNFA 4QX5A 2CGNA 2X53S 3ELNA 4QU2A 5JI9A 1Y9QA 4IEYA 1C8NA 3H50A 4XIOA 1IGOA 2GH8A 4J1XA 4K6BA 4CDWC 4I2OA 1WD3A 2WNEA 1IKQA 1XNKA 1JH5A 1CVNA 2HWE3 2O8OA 5JPMB 3N7MA 1KS5A 3TB0A 1IS6A 5F1RA 1RUD3 3INAA 2ZPXA 1S2BA 4HL0A 5AFEA 3J8F3 3RYRA 2HWD2 5GLWA 4MXVA 3VKNA 1B35A 3I8TA 1QY4A 4ZU4A 1ZA4A 2WT2A 1CQ9A 2Y38A 2HWB2 3IDCB 4D7TA 2D7FA 5D1IA 1D0GA 3VZLA 2QQPA 2PA7A 5KWRA 1SCSA 1W6NB 4FXGB 1N3OA 4Q4Y1 5FCCA 2P3KA 4PIXA 3MIHA 4EROA 2WFF1 1ENQA 5CIRA 4Y1YA 2PHXA 2VECA 5I8TA 5I91A 3MZHA 4KG8A 4BPZA 5BNOC 1DQ2A 1HW5A 1R081 3AKTA 4XXAA 4XETA 5JMCA 4QPYA 5J3UA 3UK9A 1G9BA 5C8CB 3WQ0A 1AR61 4CEYA 3M3EA 1F2NA 4IEVA 1W6QB 1H1IA 1AYM1 1CONA 4S2FA 1FPN2 3VL9A 1QKQA 3BODA 4NVPA 2YY1A 5GLUA 1NG0A 4XJUA 5LRSA 4IV1C 4LUKA 4COZA 2VULA 4N53C 5F6KA 3CLPA 1D2SA 1HXS3 1LENA 2UURA 3ES1A 1SQ4A 2B8MA 3SHRA 4HVOA 2JD4A 1LODA 1WCDJ 1ZBE3 4S2DA 2Z42A 1ZRFA 1RHI3 1X82A 2DVBA 2FHRA 1R1A3 3MPPG 2B5HA 3WV6A 3JB4C 3RJ2X 4YVSB 2R49A 5HCFA 4CDUA 1RUG3 1Y7BA 1RUG2 4Y1UA 4E27A 1J59A 4KL1A 3ES4A 1LB2A 1TEIA 1XNCA 1GV9A 2D98A 4W6YA 4JRLA 4CDUB 4G9SB 3D5OA 4GWNA 4XE9A 2NMOA 2D93A 1VBD3 3AB0A 3MIBA 3V0AB 4LBLA 1RMU2 4C90A 1AR81 1VP6A 2VG9A 1X33A 4MGZE 1PVC2 1DG6A 2HEVF 1CJDA 1LESA 3WCRA 3HBZA 4XFHA 2ZGRA 4IQPA 3DV8A 1PGL2 4HN0A 1FNZA 5FOJB 3J26N 3VDDB 3DN7A 4ATFA 1AR93 3U11A 2GMEA 4GB31 3MFCA 5K9YA 1V6LA 2DU1A 4HZFA 3RRDA 1U5XA 1L3JA 1SLTA 1B35C 2PLV2 3AFGA 1MS4A 3AMNA 3MI8A 4AI8A 4BE3A 2XUMA 4I0WB 4AEDC 2WNUA 2GN7A 4M3CB 1F5JA 2GC0A 5AVPA 1Q8SA 4AI2A 5C9AC 3D4KA 1NY71 2CAUA 4C0BA 3AZYA 2R072 3Q9OA 4XZPA 3RDIA 5JIUA 2YZ4A 1QJY1 1A8DA 1RUD1 1WW4A 1H8TB 3LA3A 1ULGA 2AR6A 1PO12 3R4UA 3WZ1A 2VU9A 4N43B 4P9WA 5KBFA 4X8NA 5JWPA 4Q4V2 1YFWA 2VQ0A 2VOWA 3RJRA 3OD4A 2I07B 5EXOA 1H8VA 4OUMA 2YROA 1NA1B 3IKWA 5KXEA 1DFQA 2VUJA 1SBFA 2HWC3 1BBT2 4JTOA 5LRRA 2F4PA 1OD5A 1VBE3 5FO8B 5LEKA 2AYHA 4ZXKA 1G8WA 1RUJ1 4A7YA 1COV1 2WQ4A 2XHKA 1XE8A 1KFUL 1TME2 1EAH2 3D0JA 4LBMA 2GNDA 4AQ2A 3D82A 3LZZA 4FP3A 4MVTA 1O4ZA 4Z8BA 2PAMA 3ZDSA 1AR63 1JTZX 2WJSA 1PMIA 2HJIA 1N47A 1OLQA 4Y1XA 2PHWA 1COV3 2D6MA 1PM7A 5BNOB 2RM21 1RIRA 4C0HA 2QCSB 2ZGLA 4HSLA 2UYBA 3O5SA 1KITA 4EJRA 2JJ6A 1YUDA 1YRZA 1N1TA 2Q0AA 3B9CA 1O3QA 2H0VA 2Z2SB 2PFWA 1NCRC 1UN1A 4MGYE 3WW3A 1YNAA 3ILRA 4FCAA 4DQAA 2RM23 1WLTA 4XJ9A 1UKRA 3H7YA 5I0TA 2A71A 3RYKA 2VNGA 2X8KA 1UF2C 1PVXA 2EAKA 4IV3A 1G6NA 4AEJA 1Z7S2 2GNBA 1QJU2 1H2LA 2YXSA 2VQAA 1VAMA 1QJY2 1NY72 1SLBA 4Q1RA 3THTA 3K48A 4PLOA 2PHUA 4HMZA 2PTMA 2WIIB 1D4VB 3SITA 1XQNA 4BOWA 2ET7A 4C91A 1LU2A 4FPOB 2EAAA 3E5XA 4N43C 2H0BA 4K1ZA 2EA7A 2D5HA 5JR7B 5KXCA 5JAXA 2XL9A 3ZXEA 1H9PA 3L2YA 1FATA 2PHTA 1V6IA 4ISQA 5JI7A 5A3MA 3FC0A 2ZS6B 2GALA 4Q4W1 2JG8B 4IEPA 1GNHA 2QKDA 1NQJA 2EF6A 3IN9A 4YM0A 4LO8A 4PDWA 4N9IA 5FAXA 4HPKB 3G6JB 1J3RA 1AR82 4LTAA 1GLHA 1VBA2 5AC93 4XMAA 1NCQB 3VKOA 1WMDA 2GC2A 5CU1A 4AHXA 2D43A 1UD1A 3MYXA 3P3PA 1RUG1 2R042 5T3NA 3BTAA 4R9BA 4CP0A 3M3OA 3DL3A 2XWJB 3FLPA 4DOUA 3B7MA 3ZN6A 1Q56A 3VHOA 4DINB 1MS1A 2JXAA 3R05A 4XJ8A 4AI3A 3VHRA 5C4WC 3RNSA 3WDVA 2B46X 3VBRC 3ZFEA 4P14A 2VNRA 4I01A 1IS4A 1SCRA 3RMXA 1LULA 4U2AA 2ET1A 5JPNB 3WDWA 3USUB 1YFYA 1J58A 4YGEA 2XPJA 1KD7A 5DUUA 3EO6A 3MLKA 1GQGA 2RJLA 1RITA 2RMU3 3MLJA 2DUQA 2ZKNA 3VBHB 3ZPYA 1GICA 4RSUA 1EAH3 4TYSA 3TAYA 2R0FA 3OCPA 4LBQA 5DZEA 1JUIA 2ZTNA 1RUE2 3MFAA 2PYTA 4XF9A 5JCTA 1VB2A 4AI1A 4CYDA 3QBQA 1HX6A 1ALYA 1BXHA 1PGW2 4Q4Y3 1QJZA 1UPIA 2HWF2 3ALQA 4CZSA 1QJY3 4EN6B 4P9JA 2E7AA 3N7LA 1QDOA 4XEZA 1D4M2 2ZGMA 1RUE3 1OFNA 4CDQC 4EV0A 5JZGB 4AGVA 3SCHA 1RUC2 1REDA 1DU3D 2XB6C 2DCZA 1O91A 3OY8B 5HI0A 3D0SA 3KT1A 4PBOA 2A6YA 3VZOA 4QGNA 1WBFA 3DPRB 2ZGOA 4YVSC 2VXRA 4L9BA 4WM8A 1A3KA 2D6KA 3WINE 5KXDA 2BNOA 1K5MC 3FUOA 5C9AB 2G9GA 1BEV3 2ZGUA 1UIKA 2R061 3AKQA 4OHVA 4X8PA 4OHXA 3NW4A 4YVWB 2EXKA 3LA7A 2BNMA 2B39A 2WS92 2SLIA 4LE3A 2DFBA 4BYYA 1VBB1 4PIZA 4Q29A 3CJIB 4J1WA 2VW1A 2VW0A 2OZ6A 4RHV1 3U10A 3ZSMA 3CJIC 4LULA 1FOD2 2XKPA 2RS31 4BMEA 3AK0A 2W39A 1O3SA 4KU7A 4CEWA 4YZ4A 2HEYF 3RMYA 4F3JA 2DCYA 5KHIA 4P9LA 5L7OB 3TWIA 2GMPA 1ULCA 4BZ4A 4FP2A 2QDRA 1DQ0A 1YLLA 3ZFEC 1D0HA 2YGLA 2JE7A 5T52A 4NN0A 1QQP1 3H7JA 4MYEA 5HXVA 3ME2A 3O0XA 4NHKA 2ZGPA 3IPVB 1SBEA 4CTEA 1IZ3A 4L97A 3WHTA 3WW2A 3IPVA 1RUF3 4Q0PA 1PZ9A 3IWZA 1DZTA 1LEDA 1ZM1A 2XH6A 5CFDB 3L9JT 3GNEA 4CDWA 2HKXA 2Z69A 1Q3EA 4NOTA 5SV5A 4ORFA 3FE5A 2VW2A 1YFXA 2R041 2OPKA 3NO8A 4GXLA 4E4SA 2VNOA 1X8MA 2C0ZA 4YM1A 2XBO2 5FTTC 3AFKA 4P9GA 1UZYA 3WHUA 4OUSA 5D8AB 4OULA 5CADA 4DY3A 4K3UA 1QJX1 1EPWA 2IZWA 4QPIC 2DVFA 1YI7A 4IV3B 1MEC3 1NCRB 3MLLA 2P3JA 5H9RA 3B69A 3WR0A 2CGPA 2BWCA 4DMIA 3IBMA 4XJWA 5GLZA 2R043 3TYJA 1SLAA 4YM3A 1ZZ8A 1RTVA 4FVVA 3U4XA 3SXWA 1UU5A 4FSJA 1EP0A 4H7LA 4HKWA 5JZGC 1E57A 2PAKA 3BIWE 3WP5A 2ZMKA 2QE3A 3FFQA 1VBA3 3VBUC 3CF6E 3C3VA 5GALA 1MZ6A 4M3CE 3J8F1 4GH4C 5A3LA 2I2SA 1IPKA 1B09A 4WM7C 4C1WA 4XFAA 2RS52 2ZGKA 4XF3A 5FRAA 5CFCB 1NOVA 4NPRA 3ZSJA 4JC1A 4O9EA 1J1TA 1BYHA 3HWJA 3I54A 3WG2A 4RS5C 3POYA 1ZX5A 4MGKE 1QJU1 3APBA 2E7QA 3PVOA 4P9IA 4IV1A 1CAUA 4FPFA 4URTA 4YVWC 4B4QA 3W59A 1FI2A 1IHMA 3E6CC 4OHYA 2SBAA 4X6QB 5EWSA 5KHHA 4KU8A 4XQ4A 1MACA 1SFYA 3VHNA 2K9ZA 4R9CA 5DG1A 5BNNB 2K0GA 1BKZA 4FBFA 3AZXA 1F31A 4IEZA 4UW5A 4YG3A 1W2UA 2ZZQA 3IDEA 4DFSA 1QJU3 5GLTA 3I7DA 5BUVA 4LNVA 2ZX4A 1DGWX 3UJQA 1LECA 1ZREA 1N1YA 5E89A 2RM22 2VMGA 4Q4X2 1XXNA 3ETQA 4K7JA 5JSRA 3ZYRA 1EAH1 4EN7B 2NMNA 1QGLA 4M01A 3FMGA 2V5YA 4B4RA 3KCYA 4Z82A 2OVUA 3AYDA 4QQOA 5AC92 2ZZJA 4FPLA 1LJ7A 1RHI1 3FJSA 3JD73 4YW4A 3KM5A 4GULA 1JXNA 4AFAA 3QD6A 2LM3A 5DUWA 5BNNA 1W6PA 2GZWA 3AMPA 1QXJA 3VV1A 3VGIA 3WDYA 4FTBA 3UKTA 1ZRCA 3ACLA 3B5LB 3OF1A 5J98B 1VBD1 3MW2A 2RS13 1GQHA 4I0AA 4QPIA 4QPGA 2WFF3 4XFBA 4AQTA 1QDCA 4IETA 2ZCWA 5IT6A 3V0BA 1UMZA 5I8SA 5L73A 1MS9A 1M06G 1DGRN 4AW7A 5J09A 1ZVFA 3WDXA 4AWDA 2TNFA 3OBTA 3KSCA 1NCQA 5BNPC 2CV6A 1DZRA 4ES8A 4GIQA 3M8LA 1PO11 1C3HA 3TN91 1ND3A 3S0MA 1Z7S3 4D69A 2FMYA 2XKOA 4WM7A 3E97A 4PIYA 4RHV3 4LA2A 1PNFA 4AG4A 3IIAA 5C8CC 4QPIB 1UW8A 4W6WA 5GJ6A 4A2U