3OD0A

Crystal structure of cgmp bound cgmp-dependent protein kinase(92-227)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
b'SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRKG1 protein
publication title Co-Crystal Structures of PKG Ibeta (92-227) with cGMP and cAMP Reveal the Molecular Details of Cyclic-Nucleotide Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od0A00
4AXOA 2WC2A 3EBRA 1ZZ7A 4N9HA 5K8SA 5BPXA 5BXXA 2XL7A 1PM7A 1H1MA 2ETEA 2XKPA 2QJVA 1ZRFA 4HMZA 4K8FA 4KWKA 4LUKA 1YHFA 3DN7A 3LZZA 1J3PA 3D0SA 1QWRA 1I5ZA 2OZ6A 3HQXA 2H6BA 4Q29A 2BNMA 3FZ3A 3E6CC 4XFHA 4LUMA 1Q5OA 2Q4SA 2BNOA 5J7MA 5I8SA 5LEJA 5LRRA 4IEQA 2XL9A 5KHJA 1DGRA 1LKNA 3H3ZA 3IWZA 1FI2A 3FX3A 3D0JA 2UY9A 1DGWA 2GC3A 3U11A 2Z2SB 3FWEA 4F7ZA 5J48A 4IEYA 2K9ZA 3G7DA 3IDCB 1ZRCA 1UD1A 1YUDA 1NZCA 4IEXA 4LLOA 3EO6A 4JV4A 3SMHA 4ZU7A 3BALA 1UCXA 1H1IA 3H8UA 3LA7A 1UPIA 3C3VA 1UIJA 1IPJA 1ZZCA 1ZRRA 1I6XA 4XF3A 4IEUA 5FCCA 4HSLA 4ZU4A 5BY5A 4XFCA 3LA2A 1LR5A 4MV2A 2IXJA 1CAVB 1GQGA 4YRDA 1RGSA 1ZVFA 4I09A 3WW4A 1RUOA 1O3TA 3U10A 4DINB 1TQ5A 1DZTA 4P9GA 5KHKA 4NVPA 2D40A 3H1MA 4J1XA 2IXHA 4D7SA 3RPQA 3WW3A 4JTOA 1FT9A 4FBFA 4KL1A 4XETA 4WZCA 3BB6A 1IPKA 3PNAA 3S7EA 3RNSA 4XFBA 3I59B 3IIAA 4YSFA 1ZZBA 4HN0A 2K0GA 4HVOA 4N9IA 3LAGA 4PIXA 1Q43A 3BPZA 4LTAA 3SXWA 1J1LA 3NVCA 5CU1A 1O5UA 4FAGA 4YARA 2FMYA 4AVCA 2N7GA 3H1WA 4KWLA 4ZU5A 2PFWA 3OF1A 2IC1A 4PJYA 4XFFA 1YFWA 4META 4L11A 1XE8A 2EVXA 2GC1A 3H9AA 2DCTA 2HJIA 2PAMA 5LRSA 2QNKA 3CLPA 3D82A 4Q0SA 4AVBA 3KMHA 2GU9A 1RUNA 3CO2A 4BHPA 2Z69A 4HSJA 4EWEA 4O9GA 5JAXA 5I93A 4MX3A 4WVZA 1X82A 4AVAA 2XGXA 3MYXA 5AVPA 2D5FA 1XE7A 1QXRA 3ST7A 1WGPA 5E16A 1YLLA 3FE5A 2UY8A 1OI6A 3USSA 4X6RB 1SEFA 2Q1ZB 3H1YA 2CGPA 4AQ2A 2B9UA 2EAAA 2OYZA 4QM9A 5C6CA 1NXMA 4XFIA 3GBFA 5F1RA 4JVAA 4ONUA 2B8MA 3CJXA 2O8QA 4OFGA 4UBHA 3SCFA 1SQ4A 4IEOA 5I8TA 3S0MA 4PIZA 5E1RA 3RYPA 3OCPA 4FT8A 2H6CA 2OZJA 2CV6A 2PTMA 3LOIA 4MGKE 4BIFA 1EP0A 2CAUA 2KXLA 5BV6A 5FPXA 3ES1A 4B29A 2ET7A 1WLTA 4AQ6A 3NSTA 4R8HA 1PMIA 1YFYA 4Z82A 3SHRA 1FXZA 1VJ2A 3H7YA 3TNQA 3PLQA 1ZNPA 3M3IA 1EYBA 4IETA 2XLGA 5JCTA 5I91A 3DV8A 5FLJA 1XRUA 2QCSB 1NYWA 3L2HA 4IEVA 1O5LA 4I02A 3WW2A 1YFXA 4Q0VA 3E5QA 3N4MA 2VPVA 2IXLA 3RYKA 2QVSB 5JSOA 5KHGA 5FDBA 4XEZA 1JUHA 2ATFA 1OD5A 3ZDSA 1O3SA 3EQEA 1O4TA 2CAVA 4EROA 5HI0A 3NJZA 2GAUA 3LWCA 5LEKA 4UXAA 1EY2A 2Q30A 4I2OA 4YNIA 3O14A 2PAKA 5JSPA 2B5HA 4Q0QA 3KGZA 4JTNA 4E2SA 3B02A 4A2UA 2XLFA 3WW1A 4XF9A 4MGZE 1DZRA 3R6SA 1U12A 2F4PA 1GQHA 4LULA 4Q0PA 1L3JA 5FPZA 3KGLA 2GC2A 1O3RA 1X8MA 3FJSA 2PA7A 4TLFA 5JSRA 4UBGA 4QX5A 3CF6E 2IXKA 3RZZA 4X6QB 5CADA 2UYAA 3DKWA 2GH2A 4MH0E 5J3UA 1EPZA 1WA4A 1VR3A 1CGPA 4HBNA 5D1IA 2GC0A 4E2GA 5JR7B 2I45A 1ZZ9A 3HT2A 1O7FA 5FQ0B 1RTVA 1NE6A 1NE4A 3HT1A 3MDPA 2Q0AA 3NW4A 2IXCA 2VQAA 1YFUA 5C8WA 2MNGA 3KSCA 2PAEA 5T3NA 4I0AA 2BNNA 2GZWA 4O9EA 2BGCA 3BU7A 4OLLA 2V09A 1CX4A 3NL1A 4I01A 2H0VA 2PYTA 4MZUA 1CAUB 2C0ZA 3ROUA 3RDIA 5FQ0A 4IEPA 4CYDA 5I8YA 2PHLA 3LA3A 4QM8A 4MGYE 5BUVA 3ETQA 4L2NA 4XFGA 4XFAA 4J1WA 1X8EA 3ES4A 4KU7A 4YYOA 4QXKA 1Y9QA 3KCCA 2O1QA 4XF4A 4D7TA 3I7DA 4I3PA 5I0TA 3H3UA 1RC6A 3ACLA 4HVQA 4E2QA 3H50A 3EHKA 4KU8A 3GYDA 4IESA 3CL1A 4QMAA 4HZFA 1J3QA 4LA2A 3SCHA 2XHKA 2Y0OA 1J58A 3TNPB 1CAUA 1UIKA 4EWAA 4I0BA 1CAXB 3E6DA 4Q0UA 4HN1A 1UW8A 5I0SA 2VECA 4MGIE 2D5HA 3OGJA 4XF0A 4PIYA 4FAHA 2HKXA 4HVRA 3RYRA 1X7NA 1LRHA 4H7LA 5FLIA 4ORFA 1ZZ8A 4QGNA 1OFNA 1QY4A 4LA3A 2UYBA 4QGMA 2WFPA 3OTFA 3VHRA 1HW5A 3HIFA 1CAWB 2ZCWA 5KHIA 1CAXA 2BEOA 3PVBB 3E5XA 2E9QA 1ZX5A 3FFQA 3MZHA 2XKOA 2ZKLA 5CVRA 3E97A 5EZWA 2P17A 2IXIA 4EWDA 1V70A 3IBMA 4LEJA 3OD0A 2PHDA 2EA7A 2D93A 3QACA 4KWJA 2PQQA 3S7IA 1Q3EA 1YWKA 4MUVA 4RD7A 2ET1A 5FLHA 3NKTA 1J59A 4BH9A 1CAWA 3UKNA 3ELNA 1CAVA 2MPFA 3H7JA 5I0RA 2OPKA 4WBBA 3UKTA 1SFNA 2BYVE 1J3RA 2XLAA 5EFUA 3UKVA 1QXJA 1ZZ6A 3U0ZA 3FHIB 5KHHA 4Z07A 3DL3A 2QDRA 4EV0A 1LB2A 3JZVA 4XF1A 3EJKA 3BCWA 1Y3TA 2MHFA 1VP6A 4R52A 1O3QA 4IERA 3CEWA 3M70A 3I59A 4IEZA 3I54A 2OA2A 4F8AA 4IEWA 2FQPA 1OMIA 3MPBA 4QGLA 1ZREA 4GULA 3IDBB 3E5UA 4HLTA 4BYYA 5KBFA 3QOPA 1ZRDA 1G6NA 3SCGA 3E6BA 5I0UA 1RL3A
chains in the Genus database with same CATH superfamily
4K8RB 2WNVA 3INAA 1FV2A 5KXBA 4QQLA 1ZZ7A 1HRI3 1QH6A 5EHDA 3AXDA 5IYYA 3VZOA 4DY5A 3WLUA 1XNCA 3N7LA 3DN7A 5FUIA 1CIYA 4UW5A 1O59A 4S2DA 2RR13 4BXFA 4RL7A 4RR3A 5A3WA 3ZXDA 2P4EA 5ISLA 2BNMA 3BIEA 2ZHNA 4DNYA 1FYUA 3IMMA 4XFHA 1Q5OA 2VG9A 4UFIA 1W8FA 2Q4SA 4FPKA 3WG2A 4EN0A 2EIGA 4KG0A 5FO8B 5SV8A 5LEJA 2F6BA 5LRRA 5FPLA 5C4WB 4XJWA 4YZ1A 2HEWF 4OMDA 2HWB2 5KHJA 2RS51 3M3OA 1DGRA 3H3ZA 3PU8A 4B4QA 1FI2A 4CXXA 2YV8A 1BBT2 4QX2A 4FOYA 4Y4RA 4UT5A 4U2AA 3ZIXA 2GC3A 4ES8A 1OUSA 4ZXKA 3D8CA 3KV6A 1SLIA 1YO8A 3JUUA 4YG0A 2K9ZA 2W9XA 3H3LA 3G7DA 2R042 3KVBA 1LOAA 1ZRCA 4FPHA 2DVBA 2PXJA 2VM9A 2ZBJA 5CKMA 4M00A 2VCMA 1DQ2A 2IFWA 2Z79A 4OI4A 5JZGA 5JUVA 3BTXA 4LLOA 4ZU7A 1YC61 2VNVA 1UMHA 2VVFA 1RUI3 1H1IA 2DUOA 2ZX1A 3AJZA 3BALA 3LA7A 4NRQA 5CBLA 1ZZCA 5IVFA 1ZRRA 5D21A 2VMEA 1N3OA 1W8TA 4YWAA 2QQPA 4FSJA 1PVXA 2HYKA 5FCCA 4P9JA 5IAVA 2QBXA 1QHDA 3JBG3 2EF6A 2P2KA 3TYJA 4EZ4A 2OKXA 4BE3A 1GQGA 4FCAA 2QFEA 2YY1A 3T0BA 3IB3A 2AACA 3URFA 2HWC2 3VBRB 2Y6LA 3RZLA 3UV9A 3ASIA 1MZFA 1VBD2 1T6BX 4OVEA 1O3TA 5DQ0A 4QHOA 5HV4A 4E4ZA 1OLRA 2MEV1 4OMCA 4TXWA 1HV0A 2RR12 5AFEA 2R063 1MVQA 2P1BA 3O1OA 2WAAA 1CZTA 1WCUA 2HLEA 2B39A 4RFT0 3KT1A 2JB4A 3IM0A 2A6YA 1DQ5A 2W91A 3RPQA 1H1AA 2DCZA 1UOJA 1ALYA 3MFCA 3R4SA 4K21A 2VULA 2LUWA 3H8OA 4Q8KA 3OG2A 3USUB 4Z2WA 2VL4A 2D3PA 1IKPA 3S7EA 3MIEA 4FPOB 2ARXA 3RNSA 4XFBA 1RUH1 2VMIA 4PDWA 2WWUA 1MS9A 2Q8CA 5FYTA 4YSFA 1BVVA 4YGBA 2K0GA 4HVOA 3U78A 2Y38A 2WRAA 2EALA 1AYN1 1GNYA 1UYPA 3LAGA 4YVSC 3IMNA 4PIXA 5F39A 3HWJA 1OA2A 1Y9MA 1ZBE1 3O0VA 5JMOA 4AG4A 4YARA 5C5UA 1S4CA 3K46A 5FPVA 2BW8A 1PZ9A 3HBKA 5AC91 3JBG2 1GYKA 1OF3A 4NPRA 3ZXLA 1VBB2 1X9PA 2WABA 3BN6A 5DAQA 1NX9A 3OF1A 1LCLA 5F3IA 2A73B 2TEPA 3F95A 4YG3A 4XFFA 2JG8C 2VZRA 1VE0A 2PHUA 3VB9A 1N1TA 3VV1A 1DLCA 4I3GA 4N53C 3UYJA 5K0UC 1QJY1 1XE8A 2XBO2 1HRV1 2EVXA 4FXKB 1RXGA 2ZS6B 3H9AA 2W2IA 1YNAA 5FY8A 2R062 1OVPA 5C3SA 2W39A 3QH6A 3ZPOA 3VHNA 1G7YA 1UXXX 1U5ZA 1W6PA 1AR82 5CEHA 2C1FA 3POSA 4CCJA 4QPGB 4HSJA 4CDWB 2HH9A 2J1VA 4UFHA 4O9GA 1F4HA 2X8KA 4LE4A 5I93A 4B7EA 3PJQA 4QXBA 1X82A 2ZMNA 2XGXA 3K48A 5AVPA 3P3PA 4UAPA 3JCIA 4RQPA 5FY7A 1QJX1 4PF5A 2B7YA 4LBQD 4NJ4A 3TN91 5JZGB 1STMA 2F17A 2V5DA 2PLV3 3OYWB 3FE5A 4GWMA 5H9QA 3N9OA 4Y1XA 1SEFA 4LO4B 3WDWA 3O1TA 1GNZA 1H8TA 4NWVA 2OYZA 2EAAA 3ZSMA 2KD7A 2RM21 3CJIC 5E88A 1NXMA 1W9SA 4IE6A 4JVAA 2VCCA 4ONUA 2B8MA 4JX0A 3CJXA 4UF0B 3WNOA 5A1FA 2G9ZA 4UBHA 3UT0A 3ZFGA 4PIZA 3VHPA 3CNAA 2IWGB 2IVIB 4KBBA 4OHZA 3HD8B 2ZEZA 4Q26A 4B7KA 3POFA 3WCRA 1LTEA 1UOGA 4N43A 4C90A 2KXLA 5BV6A 4LHLA 5A3OA 2DWRA 3ES1A 4B29A 2BPA2 1QU0A 5FY0A 3AZZA 5GZFA 2ORXA 1XU1A 3HQRA 2VMCA 2XB6C 5FWEA 1C1FA 3T2QA 1OA4A 4P08A 4R8HA 3ZPYA 4IV1B 4CEYA 1HV1A 1PMIA 1YFYA 1OA3A 1OD3A 3SNMA 3HJRA 3H7YA 3TNQA 3PLQA 4BQXA 3LGRA 4QPIB 4GH4C 3LEIA 4IETA 1WA6X 2XLGA 3SQOA 5KXCA 5I91A 3DV8A 4MGSA 1JXNA 4PDWB 5FLJA 4ISQA 4P5HA 1NYWA 4RA0A 1D0HA 3FBMA 3C2UA 1GWLA 1QMJA 3FLRA 4P9YA 3WCSA 4DMIA 4ZZ5A 1JYIA 1QEXA 1YFXA 4S2FA 1ZM1A 2BERA 5FREA 5ABJB 2IXLA 4E4DX 5T54A 5JWPA 5JSOA 2PLV2 2W0XA 5KHGA 1MZ5A 2E26A 5FDBA 4WM7C 2HEYF 1JUHA 1W6OB 3LOBA 4QKFA 2CGOA 4ASMB 1MQTC 3T4VA 2V4AA 1PVC1 3H0OA 3T09A 2CAVA 4L8QA 5C71A 5IVCA 3HNBM 1V9U2 3LWCA 5DG2A 5GLUA 5JOXA 4UXAA 2JE9A 4YW6A 3ZFEB 4NIDA 1LAJA 1NLQA 1EY2A 4H55A 5E8AA 4OHWA 2WL1A 3N36A 1WD3A 5FZ4A 4ZY9A 2ZOEB 3VBUC 2PAKA 2HWE3 2W94A 5JSPA 1V0AA 3MFAA 2ERFA 5EPAA 4E2SA 3ZR5A 2BGOA 4G4FA 1RUC3 2XLFA 3WW1A 4MGZE 1NXD1 1C5IA 3GJBA 1JHNA 5F2SA 5FY1A 5GKAC 3R6SA 2WFF1 3NNJA 1U12A 1VAVA 3AZWA 4Q0PA 4XBNA 1L3JA 2J1AA 1YJKA 4BMEA 2GC2A 2X5IA 1O3RA 2GH8A 4LBMA 5IK8A 1MR5A 3N35A 1QJU1 3JD73 3I3MA 1X8MA 1TNFA 2X10A 4KGGA 1G9CA 4QX5A 2AH2A 1GWKA 1JU3A 1U0AA 3ALQA 3RWNA 1QNWA 1DLLA 4GB31 1H2LA 3OBRA 3RZZA 3AYAA 2OW4A 2QQUA 4X6QB 2UYAA 2ZGTA 2RDNA 5FYHA 3WNNA 3TEZA 2NM1A 1OLQA 2GH2A 4IE0A 5J3UA 1BEV1 3VDDC 4HBNA 5D1IA 4Q4Y1 1PZ7A 3C7EA 1SG3A 4GMP1 4Q4V3 5D8AB 3SKVA 4D7YA 5LZ6A 3FHAA 1NT0A 1U5XA 5JR7B 5JR2A 1ULEA 4WVMB 1PZ8A 4BXSV 3BU0A 2WKKA 2VUJA 1H8TB 1FMD2 1E5HA 2RS13 3W21A 3MDPA 4QB2A 1O91A 3NW4A 4LK7A 2E53A 1VBA3 1WW4A 1RUE2 3FBYA 4FOVA 4YZ2A 5DZGA 2R073 5C8WA 1ENRA 2R30A 3LDBA 4PLNA 3KSCA 4TYSA 1AR92 1YI7A 2XWJB 4GWJA 3VN4A 3LF7A 1CZSA 5C9AB 4AGRA 2PAEA 2GZWA 3AXEA 2BGCA 1CVNA 3T4HB 1CX4A 1WBFA 1LOFC 1W99A 1RUC2 2YG0A 2Y60A 1VBC2 3AL5A 5C3QA 4EN9B 4AEDA 5HBAA 2H0VA 4FQ4A 4YZ5A 1W9TA 1GU3A 1FOD3 1PO21 5JOYA 3ROUA 3AM2A 4QHBA 1SLCA 5A7PA 2RS31 4CEYB 3AKSA 2W47A 2FCVA 3JD72 4A6OA 4L2NA 1QGLA 1UL9A 5EYYA 4CU8A 5A80A 4BISA 3N9MA 2DYCA 3KCCA 3S5QA 2O1QA 2VVEA 3I2JA 2RJKA 3I7DA 3RI8A 4DRRA 4XZPA 4E4SA 3ORJA 1RC6A 1OPMA 1BJQA 3I3QA 3VGIA 1C57A 1VMJA 2ZEWA 3WT3A 3RI9A 4EN6B 2O0OA 1KITA 4LBQB 4QPYA 3VDAA 5FKCA 1GSLA 1Z7S3 2XVKA 2VZ3A 4QMAA 2WNVC 1AJOA 4Q4V2 4A41A 1ND2B 4DXRA 5JLVA 3SCHA 2XHKA 2Y0OA 1J58A 5T5PA 1UMZA 3DPRC 3K51A 4BQ5A 1JBCA 1RHI2 1LGNA 1NCRB 1CAXB 2A3YA 1GOFA 2RS12 1W3XA 3FMGA 4Q0UA 3U75A 4AFDA 5FZLA 3OSDA 4J6GA 5DDJ1 2VOVA 1VBA2 4MGIE 4RR3C 5JIAA 4DRVA 2V72A 4FAHA 1OUXA 1GFF2 5L73A 1A8MA 1VBE3 5FY4A 4C8DA 3GZAA 4QGNA 4FTBA 1S0BA 1BMV1 1VPHA 3OTFA 3VHRA 1XE0A 4TTGA 1H6XA 1FOD2 4AHXA 2I2SA 3KF3A 4OUMA 2WYFA 5F5IA 4AVVA 3UGFA 3D6EA 2ZGPA 3PIGA 1AXYA 4LBLA 4DUXA 2WQ8A 1T6GC 3PVBB 4W6YA 1ZX5A 3AZVA 2ZZQA 5IJRA 1LOBA 3ZSJA 3WV6A 5CVRA 1X33A 2JDNA 3E97A 5C33A 1GZ9A 1DZQA 4EWDA 5FXWA 3THDA 2W46A 1LEDA 2GN3A 2YPDA 4DQAA 1SCSA 3PTRB 1CJPA 1DIWA 1H2KA 4LEJA 3O5SA 1XNAA 3MIGA 1KD7A 2YFUA 4XTPA 2PHDA 3B01A 2DFCA 2ZGQA 4XURA 4CDQB 5A7SA 2KM2A 3BOPA 1AX1A 4MXWA 2PQQA 3S7IA 2XUEA 4QX8A 4XDOA 3W59A 3AMHA 1XSQA 4GXLA 5DZEA 2WS91 5AFBA 1CAWA 1S0FA 4OCTA 5IHRA 3MO4A 3SH4A 3JQXA 4FP2A 3WQ0A 4A42A 3VKLA 1LULA 2JD9A 2VW0A 3Q8AA 4YW2A 2OPKA 3LQCA 4WBBA 1D2QA 5FZ9A 5ACA1 3OPWA 4AFMA 1NKGA 2ID4A 1C5HA 5EFUA 3GDBA 4BB3A 1S0EA 2VW2A 2Q8DA 1H30A 4AEDB 2OIIA 1QXJA 1XNKA 1ZZ6A 5A70A 3AB0A 3LCPA 4CEWA 1ULCA 1UO9A 3AZYA 5AVAA 1ENQA 2Y26A 3LPGA 5IVJA 3FHIB 5KHHA 4BPZA 4EQVA 3FUQA 3HOBA 4B8EA 1RUJ1 4Q4X1 1JZ3A 4DUWA 3GBWA 3EJKA 1LHVA 1Y3TA 1CX1A 3A0KA 2YPJA 4SBVA 3ZMOA 2DU0A 1TME1 1D4M2 1VP6A 1PM4A 5FZMA 1E5RA 2VMFA 3UJOA 4IERA 3CEWA 3I2FA 2VXJA 3VBHC 1PHMA 1W2TA 1NCQC 4AHZA 3I54A 2WUHA 4BQ4A 5A3PA 2VZOA 1RMU2 2FBEA 1XJAA 2DBIA 3ZXKA 2VGDA 1GANA 1W6NA 2FD8A 3RZHA 1NQDA 1PK6A 5FZ7A 4ET7A 3VBSB 1ZREA 3PTYA 4HLTA 1KGYA 2JIJA 4BYYA 1IHMA 2JKXA 2J1UA 2X53S 3HQUA 4RFRB 3WNXA 2WSVA 5FMOL 1US3A 4RS5A 2EXIA 2P3JA 2CWMA 2GP5A 2ZGSA 1IS4A 2VXRA 2ZJCA 3OUIA 3EBRA 4HPKA 5G04L 3V0AB 4IV3A 4R4XA 3I3EA 1R1A3 1LJ7A 4RSUA 3VZKA 4HKOA 3LIHA 3T2TA 1ODNA 4A3ZA 1H1MA 3Q8EA 2G9FA 2QJVA 4KBZA 4URAA 1YHFA 4CTEA 1JOJA 1PX4A 4ZPIA 3A22A 1K45A 1MS1A 1W90A 2KA3A 2C5DA 2P3KA 3PL0A 4CXWA 2OZ6A 4GJZA 5ERLA 4XZUG 4Q5OA 1A34A 4Q29A 2QQNA 3E6CC 2ZTNA 1OLMA 1RUH3 3HMYA 4LUMA 4L0PA 1EV11 4XAAA 4LBOA 4XYXA 5C8CC 3TRSB 2ENRA 5T55A 5C3RA 5F32A 5DAVA 4MHRA 4M01A 5C70A 1OH3A 3BIWE 4QXHA 1LKNA 1WMDA 3LSDA 4EN8B 1AYN3 4QQ2A 2W1WA 3W9AA 3D0JA 1LOGA 1J83A 2UY9A 3WD5A 4RQPC 4CDXB 4CRQA 4DB5A 4LT5A 3K4ZA 1ZBE3 2AENA 1GR3A 2K2SA 4PBPA 3UGGA 1PMHX 3POJA 3POIA 3O12A 5FZGA 4NE9A 1QJEA 2CWSA 2YC0A 2VUCA 3IDCB 4NN0A 1VMFA 3U1XA 5AC93 1YUDA 4I0WB 2XMLA 5A1LA 2WO1A 2A75A 2E33A 1LHWA 1TNRA 4IEXA 3SMHA 4Z8BA 3WDYA 1GICA 2PHRA 3Q8BA 3FUOA 4MXWB 3ZN4A 4QDQA 3H8XA 1I6XA 4XF3A 2FDGA 4YM0A 1K5MA 2DCKA 1B09A 2NN8A 3AP9A 3CDZB 4HSLA 3PUAA 1UYXA 4CPBA 5A6QA 4CCLA 3A0NA 1HRV3 4FI9A 3ZFGC 5BY5A 4LBJA 2LM3A 3LA2A 2DUQA 3I8TA 2AYHA 3KHBA 3CKHA 3MF6A 3N9NA 4MV2A 3VZMA 1RGSA 4TWTA 2OXBA 1ZVFA 1IZ3A 3WW4A 4AI1A 2YYOA 1R1A2 1S2KA 1UNBA 5FZKA 1IQAA 1MZEA 4BWOA 2BBVA 2WT1A 3EYPA 4ZZ8A 3WUDA 1QOSA 2RMU2 1DZTA 1K12A 2JG9C 2Z42A 2ZGKA 4P9GA 3MEPA 1S2EA 2HWF1 4KI5M 5FPUA 1AL0G 2I07B 2CDOA 3HNMA 1VMHA 1J84A 2J22A 5GLZA 3TN93 2PHFA 2D40A 1URXA 3PMSA 3OUHA 2CDPA 4QQOA 1OVSA 3VD5A 4BA6A 3M3CA 1WLCA 2YBPA 2A3WA 2PHTA 3WDUA 4AK3A 1YIPA 1FT9A 4FBFA 1P8JA 4XETA 4K3UA 4KQ7A 4IXLA 4JGZC 1AYN2 1F31A 1MACA 2P3IA 4NPMA 2A5ZA 3PNAA 4OUEA 4AGVA 4COUA 5J1XA 2RM23 1UKRA 5BNPB 1RUG1 1ZBE2 3NJYA 4NHKA 3FN9A 5FP4A 5JXHA 3CMGA 4K20A 1QKQA 2QTWB 3IIAA 5KC6A 3C8XA 4YVWC 2JICA 4HN0A 1HB3A 5FXXA 1TE1B 3TOJA 1MPXA 4PF1A 1Z0HA 1W04A 2RDRA 4HXCA 4MYEA 3S6PA 2NYYA 3EXUA 1WW5A 4RHV1 4LTAA 4U36A 3SXWA 1CWPA 2FZ1A 5CU1A 4KWUA 2Y6FA 3FC0A 4RS5B 4OQ8A 4FXGB 3ZFFC 1HQNA 3DEMA 2OVUA 2EXHA 1R081 4IV3B 5FJHA 2LW8A 1AJKA 4YW1A 3LDKA 4E4HA 4UFLA 5FZ3A 5SV5A 1W8ZA 3THCA 3USUA 4LHKA 1KQRA 2XJTA 5A6ZA 2PFWA 4HETA 1OF4A 1AR61 2IC1A 4Y22A 2X5IC 3N9PA 3I3BA 4MO3M 4OI2A 3WQBA 1A6CA 1ODMA 3RVHA 4W4ZA 1REDA 4ZKTB 1W9FA 1QJFA 2GN7A 1KJRA 2ZACA 1SLLA 3RMYA 3WF1A 2BU9A 1JOPA 4WVVA 4DEQA 2WZR1 3TN92 1AXKA 4Z1VA 5LRSA 4UI9L 1UKGA 3N3HA 1UQXA 4JCKA 4Y24A 5FYZA 2H0BA 3DXUA 3M8LA 3VZJA 3AP5A 2JECA 2GDFA 3NV3A 3WG3A 5LA2A 1ACCA 2PHXA 4BHPA 1G9BA 3K4DA 1UAIA 2RDSA 1L7QA 1MEC3 3SC7X 4AVAA 2D5FA 2RM22 1QXRA 3JB8A 5FIXA 4BQYA 2E7AA 2VVDA 3THPA 5FMDA 4A7YA 1XYPA 2ZMLA 1MVEA 2Q8OA 4KH9A 5E16A 1YLLA 3KM5A 3TEXA 4QXCA 2HWD3 3AP4A 2JDYA 4K6BA 4M4RA 5JI9A 4QHZA 1K5MB 1M4WA 4ASLA 3R4UA 2WFF3 4LO7A 5LBBA 3VZLA 3H1YA 3WP4A 1Y7BA 3J7NA 4AI3A 4AQ2A 2B9UA 1UU6A 1S0DA 3AX4A 4WM8A 3WX5A 2Y6JA 1POV0 3H8RA 4QM9A 1ULGA 5F1RA 1W6MA 2GMEA 3ZYRA 1Q8QA 1QJU3 2FHRA 4IE5A 2K46A 3GXUA 3CQOA 2DU1A 2R1DA 2VNRA 4QPGA 3SCFA 4CDWA 4QWNA 1TVGA 3VKFC 3S0MA 4AHYA 5FTTC 1CONA 1JOBA 3KZ4C 2JDAA 3OCPA 1PIV1 5F5QA 5FMBA 3RYPA 4FT8A 1NQJA 2RJ2A 4FPCA 1AYM3 2VOWA 3HAGA 4Y1VA 2LTNA 2OZJA 1PO11 2CV6A 4G3YC 3LOIA 4IW3A 4QU2A 1EP0A 3LPFA 1BEV3 2VBPA 1W2UA 2DV9A 2RVAA 1C1LA 3OYWA 3FLTA 2ORZA 3WINE 3PURA 1COV1 1UWWA 1H4GA 2DURA 2DVDA 2YDEA 3K2OA 3N9QA 4LQRA 4UFMA 5FPAA 5FZAA 5JDBA 1G8WA 5F6KA 1RUF1 1U5IA 3VBFC 1OOPC 1XC6A 3VHOA 5FOJB 5LA0A 2JE7A 3I2GA 1HRI2 1S1AA 2E51A 1Q8VA 4UF0A 1XRUA 4I02A 1MEC2 2BBAA 4K40A 3WP5A 3C7OA 1IGOA 3IDAA 2CTVA 5L9RA 2D43A 2QQWA 3RG0A 1MZ6A 3GCXA 1R091 4ZONA 4KG8A 4FFIA 1W03A 3B7MA 3KV4A 3W58A 4NHLA 2HWD2 1M06G 5CB7A 1H2MA 3ZDSA 3SISA 3AKTA 2WZPP 4EROA 1ND3B 2WFF2 5FMOS 5A7WA 3T2OA 5CFCA 5HI0A 2XJVA 1PO23 3NJZA 1JZ6A 3RZKA 4IV1A 3I4IA 2RS33 1V00A 4YNIA 4D8MA 3VL9A 4XE9A 3MHZA 1Q56A 4Q0QA 4QPIA 4Y22B 1YRZA 4JTNA 4P9WA 3EMRA 4A2UA 1HXS3 1DFQA 3VLBB 5LA1A 3S5AA 3FLPA 2VOXA 1GQHA 4LULA 4JHTA 4HK8A 4R9BA 1NA1A 1RVF3 5FPZA 4ES9A 1AYM2 3KGLA 4CDUC 1UY4A 3PVOA 2A71A 1K3IA 4XHXA 5ABJA 4FPGA 1BEV2 1HQLA 1V6NA 4BLJA 1RUI2 4V2VA 3J9SA 1DU3D 2J1RA 3FJSA 5T5OA 1W6OA 2PA7A 4TLFA 5JSRA 3GM8A 3U37A 2EIEA 4D3WA 3THTA 2V4VA 3CF6E 2CY6A 4M4PA 1UY2A 2WT0A 4LBNA 3O1PA 3ZFEA 4JHZA 5KWRA 4IE7A 4XHBA 2A7AA 2JE8A 3IPVA 1WCQA 4Q1PA 3DKWA 5FYMA 2YGLA 2A6VA 1EPZA 1WA4A 1VR3A 2A1XA 2QQLA 5DDJ3 1QDCA 1CGPA 2GC0A 4E2GA 4D6QA 2FCUA 5BNNA 4IDZA 1JTZX 4F83A 4JRAA 3MW2A 4QDRA 1AR71 1WW6A 3AFGA 1O7FA 2VC9A 3HT2A 3IAPA 1BCXA 4LE3A 2BFUL 4RGGA 5FQ0B 5LB6A 4AVSA 1PGW1 1RTVA 1NE4A 4AW7A 5C5TA 5EQUA 4KNCA 4LIVA 4WM8B 4M3CF 1HB2A 1XOYA 3ITQA 1W28A 3JU9A 3K75B 1W6MB 4A3XA 2QQMA 2OX0A 2C4XA 1UY3A 5FYBA 1QF3A 2UU8A 3GGLA 2JXAA 3HBZA 3MIDA 3WR0A 5JPNB 4HKWA 4B3NA 1DGWX 2RS32 4NHYA 1UPSA 4B4PA 4EZHA 1QOTA 4CEWC 3VL8A 5J09A 1UU5A 2BVBA 1V6MA 1W8HA 1XNTA 2V09A 3AKRA 2J7MA 3MBWA 3OUJA 4OLLA 3NL1A 3NAPC 4F3JA 1BXHA 1HXS2 4CCCA 4I01A 4N90A 1SZBA 3ON7A 4BJ0A 4MZUA 1EAH1 5D8AA 3WF3A 1PGL1 3WDTA 2AGSA 5D2AA 4MADA 1H0BA 1NZIA 1RVF2 4L97A 4TN7A 4WVMA 4CYDA 2XDVA 3VDBA 2JWPA 4QB1A 2C9KA 3I2HA 1ZRIA 2QQVA 3ETQA 5FYSA 5H9SA 5L36A 5A6XA 3PU3A 4XFAA 4ARXA 3ES4A 5ANQA 4YW5A 5A32A 1SCRA 4YYOA 5F7UA 1Y9QA 2WS93 1DYOA 3POEA 4XF4A 2JIGA 1PK6C 3H3UA 2G19A 1HDKA 1N1VA 1JYCA 2WJSA 3ACLA 5A1AA 4HVQA 5C9AA 4E2QA 3EHKA 4EJRA 3I2OA 1LU1A 3KT7A 4XAEA 4HZFA 1OKOA 2YGMA 1WCSA 3ILRA 4LK6A 4UW3A 1J3QA 3BTAA 5FZDA 4XQDA 2CYFA 3TAYA 4JGYC 1BK0A 3OEBA 5GLVA 4XDQA 5FYIA 1GBGA 5IUQA 2PMWB 5A7WB 5CFCB 5L7OA 5DABA 4Y26A 4P02B 1GNHA 4E9KA 2Z4FA 1S0JA 2WO7A 2VR4A 5E6HA 1FNZA 1KFXL 2ARBA 2DCYA 4QAWA 5A33A 1D7PM 1DYPA 2D5HA 3MUY1 3RJRA 2AEYA 4XJAA 5T50A 4AYUA 2HKXA 1RUJ3 1SFPA 1X7NA 1LRHA 2HWB1 3NJXA 1QIQA 3IIIA 2W1SA 3LEKA 4KGQA 4LO8A 5FZFA 1SBDA 1B35C 2ADEA 4CCEA 4Y1UA 1BBT1 2FCTA 1TME3 1NA1B 4QKNA 3WDXA 2QQKA 4NO4A 4OHVA 3ZMNA 5JPMB 3O1UA 4LBQA 1O8PA 2E6VA 3B69A 5HCAA 1ZBA3 3OGSA 3NRUA 1ND2A 2ZGOA 1LHOA 2R041 3D4KA 2P6HA 3HIFA 4FPEA 4S2HA 5EYXA 5A7QA 1OURA 3LEMA 3NNMA 2YU1A 4XXAA 2ZCWA 1O4ZA 1NCRA 3PUSA 1CAXA 2FDKA 2GNDA 3UK9A 3GZUC 3MZHA 2VZSA 4ITCA 3LFMA 3IPVB 5FZEA 5T52A 2ZKLA 2XHNA 5FPBA 1FPN1 1KS4A 1UU4A 5BNOC 5EZWA 2P17A 4Y20A 4AL9A 1XB9A 3HPNA 2VOKA 4CU9A 4AEMA 5BNQA 2WS92 4NHXA 5BNNB 3OD0A 1GZTA 1GZCA 5C4WC 5IW0A 1NCQB 1C28A 1EPWA 4QQHA 3VBOA 2B4KA 5EJ1B 2HWC1 1AL21 2D93A 3WP3A 2ZHLA 4O61A 1SDDB 1VBD1 3QACA 5J98B 4EE2A 5C3OA 4CCDA 3OPTA 5DPNA 3W5MA 3PHMA 2YHJA 4PI2A 5F6LB 3ZX7A 3BVCA 3J4UH 5A7NA 5F5CA 4UW6A 3TBDA 1EV13 3NQHA 2OT7A 2WZEA 3LE0A 5F3EA 3UNPA 2RR11 2VY0A 3ELNA 5FKBA 4CZSA 3OGGA 1JZ2A 2ZHKA 4NRMA 1NLRA 2PQSA 3PIJA 4Q1RA 4LOSA 5I0RA 3B93A 3UKTA 5T5LA 3IKWA 1OFSA 1J3RA 1MS5A 5IVBA 2Q5TA 2YUEA 1RUJ2 4XCAA 2YC4A 3ACFA 2V73A 3DXTA 1OH4A 1S55A 5FYVA 4XUTA 1TME2 2ZA9A 2ZGRA 4RN5A 1OQDA 3UJQA 1UZVA 2F4LA 2PHWA 4C1XA 4CDQA 1UOBA 2L9LA 1JYTA 4Z07A 3AMNA 3ZVXA 3TWIA 1SDWA 1ZBA2 3DL3A 3ZXGA 5T5JA 3VBRC 5APAA 4I30A 4OUSA 4RYDA 4XDPA 4HK9A 4MLOA 2Q1FA 5A32B 1V6KA 3APBA 1NY71 1LNSA 1RUD3 3C7GA 4JZRA 2D6KA 2MHFA 2BOJA 1AF9A 3PDQA 1O3QA 5CNAA 2ILMA 2ZGUA 3NV4A 5FP3A 5J96B 1F5FA 1UN1A 3T2PA 2HWE2 3I59A 1O8SA 4XJZA 3WSOA 3JBG1 5CKQA 2DCJA 4LIUA 1VBB1 2XONA 4QGLA 2VO5A 4GULA 3VZNA 3ZYGA 4OI1A 4FPYA 1WLWA 2HWF3 3QOPA 5CZKA 1CESA 3SCGA 5KBFA 2Y0IA 3AMQA 2D3SA 1RL3A 3L2YA 3NO8A 3WHUA 4AXOA 5EP9A 4AHWA 5A33B 4OYUA 2WC2A 4NIHA 2O8OA 4N9HA 5K8SA 5BPXA 5BXXA 1EV12 3MGUA 2YMZA 2XBO1 4LO5B 1PM7A 2ETEA 4K8FA 4KWKA 4LUKA 1JZ8A 4NWWA 1J3PA 2YU2A 1QWRA 1NAEA 3P1IA 4QX1A 3ZYJB 1I5ZA 5KXDA 1N1YA 5E89A 1JU4A 5DMYA 2VCBA 3NV2A 1AR81 2H6BA 1GV9A 2WNUB 3FZ3A 2VNOA 4FFFA 4D0QA 3AKPA 1RUG3 1LESA 3LIGA 5FR3A 3BTZA 2BNOA 2NPIA 1SHWB 3O7OA 5JIUA 5A3LA 2BOIA 4IEQA 1X36A 5CFDB 3M2MA 1UZ0A 3VBSA 3AC0A 5FRAA 3IWZA 4GIQA 1YEWA 3FX3A 3PUHA 5DN2A 1SPPA 4JKKA 5FP9A 1DGWA 1QDOA 1CPNA 3V0BA 3V0AA 3FWEA 2WWJA 1WD4A 4Y20B 5EV7A 3ZYFA 5K9YA 3BGAA 2R072 1R083 3OEAA 5DAWA 1RUD2 1UD1A 2JDMA 4BLIA 3TEWA 2VUDA 4QD2A 2JX9A 3ILFA 3VBOB 4YGDA 3SH3A 2VZPA 2D6PA 2ZX3A 1UCXA 1W9YA 3N7MA 4BQ3A 5FZHA 1KDMA 2RG4A 1UIJA 3WNPA 4CCKA 2BFUS 1WWYA 1ULDA 3ZO0B 5FY9A 1OPOA 3GF6A 5JMCA 1TMF3 3J8F3 2D97A 1KXGA 4ZU4A 4QPGC 4CDWC 3AMMA 4DUVA 3WEZA 5M0TA 4XFCA 2BV4A 5K7PA 1LR5A 3MF9A 2IXJA 4YRDA 4DY3A 2WZR3 4CUGA 4CU7A 3LDRA 1CR7A 4FOWA 3U07A 5KC5A 1DQ0A 2JDZA 2ZEYA 3ABZA 4W50A 4CDXA 4COVA 1W0NA 5JZGC 3MW3A 4B1LA 4COYA 1YI9A 2ZX2A 1TQ5A 4DINB 5F3GA 4CUCA 3EB7A 3WQ1A 4M3CA 4Y5SA 1U5YA 2LALA 2R49A 3NNFA 3T3YA 3KQ4B 1L7RA 3FL7A 4P00B 5FAXA 5KHKA 4BMBA 1YCIA 4QX3A 1ONAA 4BM8A 3ACIA 4INDA 4NVPA 3WHTA 1T2XA 4ASKA 5FBJA 4LXLA 4CA9A 3ZYIB 3H1MA 1Z7S2 4J1XA 4MSVA 1POQA 3AK0A 3KB5A 4Q4W1 4W6WA 5KXEA 1G9AA 4HFSA 1N1SA 4R9CA 3DCQA 1HB1A 1IPKA 2RS53 5FJKA 3WF4A 1VLNA 4LJHA 4NR1A 2O14A 3D5OA 1IG3A 2ZKNA 5GZGA 3I59B 5JOZA 1R082 5FK7A 1V9U1 4DXSA 4UOJA 5LW9A 1DG6A 4ATFA 3O0WA 3WP6A 5FV3A 4IL7A 4N9IA 1FV3A 2WSUA 1VBE2 4BDVB 1KJLA 5DUVA 4IV1C 3BPZA 4N53A 2VQTA 2ZGNA 1J1LA 2ZMKA 3RSJA 2D6NA 3NVCA 4FAGA 2A6XA 2VTXA 2QE3A 4AVCA 3WDVA 2E32A 4QPIC 5FZ8A 1TMF2 3J8F2 4NHMA 5FFOC 2AZ5A 3AVSA 3H1WA 5L7OB 4PDWC 3CU7A 3RWKX 5GM0A 1HN0A 2JD4A 2V5YA 1ENXA 5DUUA 5LY2A 4CVUA 1I5PA 4JQTA 2B42B 3CIHA 3BYWA 5FYYA 5F8PA 2VZVA 1IS6A 5FZBA 5BNPA 5ABJC 5FZCA 1JYVA 5LK7B 1ST8A 1G9FA 1XNBA 4META 4L11A 4XUNA 4UWDA 1IG0A 3B9IA 2VJXA 3P5BA 4Q2FA 5JXGA 1CJDA 1TZOA 2GC1A 3AMPA 2BUKA 1UY0A 4P9LA 2PAMA 2MEV3 1H4HA 3D82A 1D4VB 3ZFEC 4AVBA 3SITA 2GU9A 1SPPB 2Z5WA 3CZUA 4YGEA 1RUNA 1F15A 4DZGA 3A7QA 5H9PA 2ZAHA 3T0AA 3V0BB 2Z69A 4COWA 2RV9A 1W8OA 2VCAA 2QQJA 2DUPA 2YC2A 4WVZA 1SBFA 1FMD1 2RS52 3NJVA 3WF2A 1XE7A 4ISRA 4Y1ZA 4GKYA 3ST7A 3SKJE 1UX6A 1LENA 2OS2A 5CA6A 1RUE1 4ATEA 1WGPA 2Y6KA 4LKDA 1AR91 3LB9A 4E8DA 1JODA 4NUBA 4AAXA 5IATA 4LHSA 3AVRA 4X6RB 4XILA 2WAOA 5A3NA 4NIAA 4XC9A 2XJUA 1JZ5A 3GBGA 3O0XA 1UX7A 3GBFA 1IPSA 3GNEA 4JDOA 1VBC1 3WNKA 5L9VA 2O8QA 2UWAA 3MUZ1 3ILNA 1SQ4A 4IEOA 4WV8A 5I8TA 2VMHA 2EIBA 4M3CB 5D8AC 3HR9A 1JYWA 1I3HA 4AR2A 1S2BA 3JD71 3PUIA 1VAKA 2WBKA 4GALA 4C0BA 1XNDA 1H8TC 1TEIA 2OUHA 4WVWA 2RHPA 3QH7A 2ET7A 1WLTA 1NG0A 2JDHA 3T08A 2EXKA 4YVSB 2LS6A 3NSTA 3OY8B 4FFHA 1QJY3 3P3NA 2ZPXA 1OLME 4HKLA 1QQP1 2MEV2 1WZXA 2R32A 4FFGA 1VJ2A 3KD4A 2JEMA 2XJSA 3M3IA 3UL2A 5C9AC 2NP0A 3KS7A 1LU2A 3A21A 1W0PA 4Q4V1 2TUNA 4Z2AA 2JB8A 3ZXAC 2JDKA 3SLIA 1HKDA 4N43C 2QCSB 3L2HA 4IEVA 1RHI1 3BKZA 4PHZA 2Y33A 2BDRA 1DQ4A 3WW2A 2RS11 3MW4A 2VBDA 3E5QA 2DDUA 3N4MA 1FNYA 2VPVA 2JG8B 3O1VA 3DYPA 3RYKA 1XXNA 1VBA1 2WYSA 4PQ9A 1SMVA 4N53B 4CEYC 1BK1A 4YPJA 4CDUA 5I0DA 1QJX3 5K0UB 1KRIA 1W6QB 2ATFA 1RUH2 3DGTA 2I74A 3AFKA 5FP7A 3EQEA 1O4TA 2IFRA 2PELA 1EAH3 1O3SA 1YJLA 2R1BA 3B3QE 5G05L 2GAUA 5LEKA 1YIFA 1LECA 2Q30A 3ZR6A 4I2OA 1VB4A 2VTFA 5JVVA 5IT6A 4Y1YA 3O14A 2J42A 4W8JA 1YQ2A 2B5HA 3KGZA 3B02A 1KS5A 2VQ0A 4R9DA 4XF9A 4XMIA 4K9SA 4XOGA 1ND2C 2F4PA 5AC92 5CISA 5JOWA 3V56A 4O7XA 2VTXJ 4XUQA 3AJYA 1NCRC 2XOMA 3SEPA 3X29B 4LNVA 3M3QA 4XTMA 1OQ1A 3C7HA 2DBNA 4J25A 1F9KA 5EXOA 1C4RA 3MIFA 2W68A 4IGOA 5FXVA 1W2AX 2G9GA 1GP5A 1DCSA 1NLSA 1WMEA 1QJY2 1ND3A 2IXKA 5HV0A 4K1YA 3K3NA 1HRV2 3R4DB 3CJIB 4FQZA 2G1MA 1X9TA 1W06A 4CP9B 4CSWA 2C6SA 5IVYA 3VD3A 4MH0E 2OQ7A 5EWSA 2J1TA 3VUOA 1Z78A 3OOXA 1ULPA 3OPZA 1RYYA 3NNLA 3ECQA 2HWB3 4E8CA 2I45A 1ZZ9A 2Y64A 1MS0A 1V6IA 1LOFA 5IFPA 1BBT3 1GOHA 1VIWB 1NE6A 3HT1A 5LCWL 5DG1A 3ZN5A 4BZ4A 1QJX2 4YM2A 5LK5A 3WG1A 4A4AA 3D3AA 4Y3OA 5FZOA 2IXCA 2D7FA 2EAKA 2VQAA 3MI8A 4ZHNA 1OXCA 2ZEXA 1PGL2 2R043 4CUBA 1W3VA 2HYXA 5EIYB 1PVC3 5FZ0A 1JN2P 1VB2A 4I0AA 1L7LA 4CP1A 1X50A 4LO6B 2BNNA 1BVP1 4GH4B 4O9EA 3BU7A 3DUIA 4UFKA 4CDQC 4OHYA 1OSGA 2GMPA 2X05A 1FPN3 2GNBA 2XR4A 3ETPA 2RE9A 4A45A 5A3TA 2PYTA 1H9WA 1CAUB 2C0ZA 3ZM8A 1JZ7A 1D4M1 2OPWA 3PMEA 4IEPA 4JQRA 5FQ0A 5I8YA 3M1HA 2PHLA 3N7JA 4DS0A 4QT6A 4MGYE 3R05A 2HWC3 1BZWA 1AL23 2WDBA 4WM7B 1W8NA 1VBD3 3ZSKA 5BUVA 1MQTB 3DPRA 2FZ2A 3AYEA 1RMU1 1LODA 2ZXQA 3WG4A 2W5FA 5B4NA 3KF5A 4AEKA 1X8EA 4QDSA 2WQZC 4R4ZA 3ZYPA 5FUPA 3I97A 1HJFA 4JDMA 4Y5TA 5I0TA 4D7TA 4AEDC 5BNOB 2CU5A 4GB33 5ANNA 3VBUB 1KFUL 2W95A 5GALA 4A7ZA 2WNOA 2X29A 3MIHA 2Q1MA 3NV1A 3GYDA 3RFRA 5BYNA 3CL1A 4AWDA 1QJZA 1HB4A 4ZS2A 4CDUB 5IAXA 4KMQA 1W9WA 4XIOA 1VRH1 4LA2A 4YZ3A 3TNPB 2BZDA 1UYZA 2WNEA 4Q4Y3 1UIKA 3LSEA 4GMP3 4I0BA 4FTSA 3QCWA 2IZWA 4Y33A 3KHCA 2ZHMA 1HJGA 1UW8A 2VE1A 4AI0A 1HN1A 3OGJA 2W1QA 5F2WA 5FUNA 4XBQA 3IAQA 2AEZA 2BWAA 4CUAA 5FZIA 1PVC2 3CZJA 3JQWA 3ME2A 1LEMA 2W92A 5B4XA 1A78A 1GUIA 4ORFA 3VBSC 2WLPA 3VDDB 5C3PA 3BUCA 1FPN2 4AAPA 4LA3A 1A3KA 2ARAA 4QGMA 3ZXFA 2A70A 3VDCA 2QZ2A 1HW5A 2NQYA 2XUMA 4UW4A 2A6WA 1VBB3 2UURA 4XCBA 4D6RA 2XH6A 4DOUA 5KHIA 1OC1A 1N3QA 3GALA 3F2ZA 4QKDA 5FO9B 3E5XA 1AL22 3FFQA 4FPJA 4IUGA 4BOWA 2NLRA 3A4UA 1XPWA 3Q8CA 1QJU2 2WR9A 2WIIB 3CBNA 4SLIA 2CL2A 4LKFA 1POV1 1V70A 3IBMA 2XBO3 4XXPA 1MS3A 2R7EB 4GB32 4A6SA 2VQUA 2WQ4A 3OBZA 5JI7A 3GJAA 2NMOA 4C91A 1QXPA 1AR83 1UZWA 1R1A1 4CU6A 4L9BA 2XG3A 5GLWA 2Q8EA 3TB0A 3ZXJA 4CDXC 1IS3A 2RMU1 4RD7A 5FLHA 3NKTA 5FZOB 5HCHA 4Q4Y2 3POYA 3UKNA 5IK4A 1CAVA 4D94A 3H7JA 1V6OA 3PVEA 4XJUA 2HEVF 4L99A 4BQ2A 4QB6A 2VZQA 4CCMA 1SFNA 2BYVE 3QBQA 1JHJA 5LY1A 2PN5A 1QNYA 3ZXEA 1NY72 3ZSLA 3U0ZA 3ZSEA 4C0HA 3HEIA 1SFYA 3VBHA 1ASJ1 1NCQA 1GP6A 3IN9A 2WO3A 1C8M1 2WNVB 5FZ1A 2C26A 1G9DA 3DPRB 2AC1A 2HBUA 3C7FA 4XF1A 3LKJA 2FDHA 3BCWA 5DAXA 2R0HA 3J7LA 1PO22 4X8PA 5FZ6A 2E31A 4BK5A 1GKBA 1UF2C 4RR3B 4GA9A 3MV11 4URTA 1LOEA 1KDKA 1DQ6A 3WZ1A 3J7MA 2ZZJA 4F8AA 1N3PA 1VRBA 3A23A 2EICA 4IEWA 2FQPA 1OMIA 5EJ3A 3MPBA 2G4IA 4DFSA 3MLLA 2UWBA 3IDBB 1W0OA 5B2GB 3ZLIA 4AE2A 1R1ZA 2YFZA 2P6CA 4FVVA 4OHXA 3VKNA 4D6SA 5I0UA 5JXIA 1S0GA 3M7AA 3T1MA 3Q9OA 3VD9A 5C8CA 2ZX4A 4AI9A 1GMMA 5A6YA 3GZEA 5BNPC 2XL7A 1KEXA 5IVVA 2XKPA 2HBTA 1ZRFA 4Q4W3 1IKQA 2W08A 4HMZA 3LZZA 4XACA 1H2NA 3D0SA 5FO7B 1GLHA 3HQXA 1F4AA 3BTYA 1E5IA 2XVLA 2W3JA 4S2GA 4UFJA 3GZTB 1HQWA 3ZYHA 4FOQA 5DDJ2 5CG9A 5ACA3 3UETA 5J7MA 5I8SA 3I3DA 1BQPA 4RS5C 1GQPA 4JDNA 1HLCA 1MS8A 3GHNA 4PT6A 1V9U3 2XL9A 5FXZA 4LOTA 4IV3C 2XVGA 4TZDA 3AP6A 3ZOIA 2GNMA 1EUTA 2TNFA 3B94A 5EJZB 3U4XA 2Y34A 1DDLA 1JYNA 2VUAA 1GZWA 3FHQA 2J1SA 2QZ3A 2DF7A 3U11A 2Z2SB 4F7ZA 4FPFA 2VD7A 5IWFA 5F9TA 4IEYA 5J48A 3DF0A 1BMV2 2ZABA 4AEJA 1JH5A 2C24A 3ZDVA 1PGSA 4H3WA 4Q4X3 3RMXA 5HXMA 2J1EA 4IGPA 4AVTA 1DGRN 5LBEA 5JXJA 2BP6A 4CP2A 1QOOA 1NZCA 4XJ9A 4FP3A 3EO6A 4JV4A 4OQ9A 2WNUA 3H8UA 3TEYA 1UPIA 2JG9A 3C3VA 4NRPA 3AZXA 1IPJA 4XVHA 4Z92B 3RZGA 1US2A 4IEUA 2XWBB 3JXSA 5CG8A 5IVEA 3B00A 5CFDA 3AYCA 3WY6A 5HXVA 5HCFA 1AUYA 4CE8A 5LATA 3DECA 1UXZA 1CAVB 1R64A 3MICA 3AKQA 1WCKA 4GMP0 4I09A 1Y43B 1RUOA 4PI0A 1CPMA 2BJSA 3B9CA 4LHNA 3U10A 3PJYA 5C7GA 4JGZA 2E63A 5GZEA 4Q4W2 4ARYA 1XBFA 2B46X 1I1EA 2JKBA 1Y4WA 3POWA 2D3RA 3ZN6A 1JW6A 1SBEA 1S0CA 1K5MC 4OZOA 3RGBA 4AFBA 5F37A 1FMD3 4FPLA 3VBHB 1SLAA 3WXPA 4JAAA 1Q8SA 1OQEA 2WO2A 1AXZA 4XBLA 4YVWA 1RIRA 1HRI1 4AFCA 5ACA2 1RUE3 2WWSA 2IXHA 3N7KA 3RJ2X 3HN1A 4D7SA 1SLTA 3WW3A 4JTOA 4Q27A 1MEC1 3VKMA 3KCXA 4KL1A 1AR93 1F2NA 2CSGA 1UOFA 3PVNA 1OT5A 4IQPA 3SEEA 1ULFA 2SBAA 5KR7A 4WZCA 3BB6A 1FATA 2VU9A 3ZFFA 4DO0A 2R16A 1LHUA 3HVDA 3S57A 1GP4A 2HWD1 3ZKUA 1VBC3 1ZA4A 5HPOA 2CHHA 1CN1A 2BWCA 1YXWA 1ZZBA 4Q4X2 3MLKA 5HCBA 3WNMA 1PX3A 5CKNA 2GALA 1LGCA 2E7TA 1W8UA 3KVAA 4YW7A 4UYBA 1SACA 3PUQA 1Q43A 1W6PB 3ENRA 5TSWA 1VAMA 3NWKA 1O5UA 4GAZA 3ZYBA 5C8CB 2QKDA 3KLSA 2FMYA 2GNTA 5H9RA 2N7GA 4AQSA 2R6QA 1W8WA 1FAYA 2B9VA 1JZ4A 1AYM1 2VZ1A 2D98A 4KWLA 3ZIWA 1QQP3 4RQPB 4ZU5A 3RS6A 4Q8LA 1RUI1 4PJYA 4MGTA 1YFWA 5CAZA 2AREA 3HNYM 3T0DA 3BPSA 1XYNA 2D6MA 3WVJA 1RHI3 4IGQA 4MGQA 2YZ4A 3POGA 2DCTA 1ND3C 4PCRA 1OHFA 2HJIA 4PQQA 3I49A 2QNKA 3CLPA 2XJRA 4Q0SA 3RZMA 4EN7B 3KMHA 1GZWB 1ZA7A 1I9RA 3CO2A 3DKQA 3KQRA 4R9AA 5DUWA 4AOCA 1PNFA 4QKBA 3ZFGB 4EWEA 5JAXA 2W87A 3K77A 4MX3A 5K4LA 5FWJA 1E57A 4YM3A 5L9BA 2R061 2W1UA 3MYXA 2X09A 3P6BA 1F35A 4N43B 4AI8A 1YYNA 2NZ9A 4K1ZA 1DHKB 1Q8PA 1OBNA 3M4FA 2JG9B 3DYOA 1ULOA 1Q8OA 2UY8A 5DXDA 2GMMA 5FY5A 2VZUA 1OI6A 1PNGA 1Y9GA 3ACHA 3USSA 2Q1ZB 4Y4YA 4N8MA 3WUCA 2CGNA 3DYMA 2CGPA 1C8NA 3H42B 4NOTA 4Y5Z0 5C6CA 5IK5A 3JB4C 1XYOA 4XFIA 1HXS1 4H14A 4RHV3 2VMGA 1RJ7A 4LR4A 1FX5A 2DTYA 4LITA 4OFGA 4JGZB 1RVF1 4H2AA 1AX2A 5E1RA 4MXVA 3AP7A 3LFIA 3VBFA 1E5SA 1OOPA 1QQP2 1UZYA 4XUOA 3ZN6B 5FMCA 4DXZA 2H6CA 4HL0A 4AFAA 1EUUA 3K4AA 2P37A 4DIQA 2PTMA 4MGKE 2LRPA 4BIFA 4YVWB 1AR63 2CAUA 4P9IA 4OI0A 5FPXA 4WM8C 4NPLA 4AGGA 3T30A 3KV9A 3MV01 2D6OX 3OD4A 1LHNA 4AQ6A 2WN3A 3BOWA 4CCNA 2AR6A 4NAMA 3OB8A 3SH5A 4Z82A 2HWF2 2D6LX 3SHRA 1FXZA 1ZNPA 3ZFFB 1EYBA 2QQIA 1JUIA 5JCTA 1DQ1A 2VAUA 2GP3A 4XPVA 1OKQA 4FTEA 1O5LA 1WW7A 1XU2A 2XQXA 2WN2A 1UZZA 3RQ0A 4Q0VA 1C3HA 2WZ8A 2X5IB 4BQ1A 1GOGA 2QVSB 3O1SA 1H6YA 2DVFA 3J7HA 1RITA 4XEZA 1AHSA 1RUG2 4DXTA 1OD5A 4MVTA 1QH7A 3VKOA 2ZGMA 4WZFA 4XMAA 5FBZA 3O1MA 3RRDA 3OJBA 1VALA 4N7IA 3OY8A 4YVSA 2QQOA 5IK7A 1D4M3 4YW4A 3I2DA 2A6ZA 3BODA 4JRLA 3MPPG 4GZ9A 3V64A 3OBTA 1WMFA 1DYKA 2PLV1 3L9JT 4RHV2 1N47A 4NIGA 1RMU3 2VNGA 2ADDA 2TBVA 1BHGA 4HONA 1DZRA 3I2KA 5FYUA 3R0RA 4HT1T 4QX7A 4XJ8A 5GLTA 2BQPA 1DGLA 5LA9A 4GKXA 1PIV3 3QLQA 2JG8A 4LMFA 1D0GA 2WA3A 4M3CE 4QPWA 5CFCC 1AR62 4CXYA 5K0UA 1MS4A 1H9PA 1ENSA 1PO13 2WLQA 1W6QA 2CNAA 2FDJA 3E1F1 4IE4A 4AQTA 4UBGA 2DTWA 1VRH3 5FYCA 1BKZA 2VOTA 4NMIA 4GQ7A 1W39A 4QU1A 2QUOA 5CADA 1YQCA 3B5LB 1COV3 2D44A 2YBSA 3NKGA 2VMDA 1V6LA 2WZR2 3W5NA 1NA1C 3KV5A 1RUF3 4A44A 3RZJA 3UGHA 1RXFA 1CZVA 3OGRA 3WNLA 4XABA 2BVVA 1HX6A 4B1MA 5A7OA 2WT2A 4K7JA 2ARCA 4QX0A 3NAPA 2AUYA 3WOGA 2Y8KA 4YG6A 4XUPA 3HN3A 2Q0AA 4YGCA 4COZA 4AZZA 1R093 3POBA 4OULA 2XXZA 4RGAA 1YFUA 4NAOA 2MNGA 5A3MA 4V1PA 2P34A 4XQ4A 1F8VA 3UESA 1AX0A 2JENA 3M3EA 5CIRA 2B45X 2ZAAA 5BNNC 3CJIA 5T3NA 2JDPA 3VBFB 1OOPB 4CP9A 3U4SA 3BI3A 3NNGA 2DVGA 5GZDA 3MIBA 1ZBA1 1K42A 5DAPA 1F5JA 1WCDJ 3KCYA 1G86A 1WUVA 4QQPA 2OQ6A 4CPBD 1POV3 4OZXA 5FOBB 1BYHA 4NIIA 1REFA 1J1TA 1A8DA 4GWIA 4GWNA 3RDIA 3W20A 4LBKA 3WQ7A 1PIV2 3LA3A 2VZTA 4PLMA 4LKEA 4QM8A 2NMNA 2HWE1 5A3UA 4BIOA 1PO12 2DVAA 2FMDA 1DF0A 4JGYA 4XFGA 1NOVA 3V65A 1RUC1 5GJ6A 1VRH2 4LORA 4J1WA 2EXJA 2RMU3 4KU7A 2JJ6A 4P9XA 2Y6HA 4QXKA 4I3PA 1COV2 4O65A 3OBAA 4XQWA 5J36A 4BK4A 4GH4A 3H50A 4HG6B 5F3CA 4YLZA 4A7KA 4KU8A 4IESA 1RUF2 4JKMA 1AVBA 4AF9A 1B35A 2XQRA 4LPLA 1YQ8A 4G9SB 3AYDA 1CAUA 1D2SA 4PLOA 4E27A 4EWAA 4YFZA 1HIXA 3GCWA 3E6DA 5DUXA 4ZXEA 1UY1A 1WKYA 1AR73 1ASJ3 1LOCA 4HN1A 4HOOA 5I0SA 1RJ8A 4GD4A 2ZGLA 1JMUB 3IDEA 4WM7A 2BTVC 1R092 1C8M3 2VECA 2YB7A 1JYXA 1MQTA 4DEVA 4C1WA 2KR2A 4W6XA 4X8NA 4XF0A 4PIYA 1IOAA 1S0IA 4P14A 4TLGA 3OGVA 4HVRA 3RYRA 4MG2A 1DBNA 3LEGA 4H7LA 2FDIA 5DZFA 1IS5A 4D69A 5BNOA 5FLIA 2RJLA 1ZZ8A 3VD7A 3VBUA 4MOAA 3ZKYA 5L7OC 3VD4A 1OFNA 1QY4A 1JS9A 2YXSA 4LKSA 1W2NA 2UYBA 4XIKA 2WA4A 2YBKA 2XPJA 2WFPA 2R071 5C4WA 2BGPA 3Q8FA 1RUD1 1W2OA 2VW1A 4CP0A 1CAWB 1H8VA 2WINB 4JC1A 1K5JA 2EIDA 2IUWA 4DPNA 1REEA 3O1RA 2RDQA 4TSVA 2A3XA 2BEOA 2E9QA 3WF0A 4CCOA 5LBFA 2W52A 2XKOA 1YQ5A 4PBOA 3KT4A 2WNUC 2IXIA 2LROA 2ZX0A 4ZS3A 1AZDA 4XW3A 1LGBA 3S30A 1FOD1 5CYYA 4YW3A 4CEWB 4GJYA 2SLIA 4FO9A 3QD6A 4HANA 4YZ4A 4EYUA 2FDFA 1CD3G 5CFDC 2EA7A 3NAPB 3VDDA 4KWJA 3N9LA 5IFTA 4LLFA 3I2IA 1O6UA 1XSRA 4BQWA 1Q3EA 3GHMA 1RB8G 1YWKA 2BRTA 4MUVA 2ET1A 2OUJA 3U14A 5L19A 1J59A 3CHXA 4M0NA 3ACGA 4NROA 4BH9A 2GSYA 4B4RA 1JI6A 1WMXA 4YM1A 1WBLA 1AR72 1ASJ2 2MPFA 1O4YA 2IVJA 1DP0A 3AL6A 3G6JB 4JKLA 3VBRA 4BCUA 1PGW2 1C8M2 5LWBA 2XJQA 2UWCA 1Z7S1 3ATGA 3VBOC 4V2WA 1UMIA 2P5BA 2XLAA 1XQNA 3NMBA 4BU2A 1W6NB 3IT8A 4W65A 1WLDA 1PK6B 5F5AA 3UKVA 1ZYBA 1UYYA 3KWVA 1PMJX 2YROA 5GZCA 4YFWA 1GWMA 5FP8A 2VBBA 4AI2A 3T1LA 1RINA 2JDUA 4HPKB 1TG7A 4N7UA 5FK8A 2QDRA 3FFZA 4JGYB 2P3YA 3J26N 4EV0A 1LB2A 1CIWA 3JZVA 1CQ9A 1EAH2 2ES3A 1VBE1 3K3OA 2C9AA 4R52A 2R0FA 2E7QA 4L92A 2Y6GA 1SLBA 1APNA 1IQDC 3M70A 4IEZA 4M0HA 1V6JA 2XJPA 4MHUA 4H7MA 1TMF1 2OA2A 3J8F1 2QDNA 3IZOA 4P5YA 5LBCA 1B35B 1BLZA 5LASA 1NUKA 1YQ6A 3MLJA 4RGKA 3E5UA 1ZRDA 1G6NA 2DFBA 3LD8A 3E6BA 2VH9A 1W05A 5J37A
chains in the Genus database with same CATH topology
2WNVA 3INAA 1FV2A 5KXBA 4QQLA 1ZZ7A 1HRI3 1QH6A 3AXDA 3VZOA 4DY5A 3WLUA 1XNCA 3N7LA 3DN7A 4UW5A 4S2DA 2RR13 4RL7A 4RR3A 3ZXDA 2BNMA 2ZHNA 4DNYA 1FYUA 4XFHA 1Q5OA 2VG9A 2Q4SA 4FPKA 4EN0A 3WG2A 5FO8B 2EIGA 4KG0A 5SV8A 5LEJA 2F6BA 5LRRA 5C4WB 4XJWA 4YZ1A 2HEWF 2HWB2 5KHJA 2RS51 3M3OA 1DGRA 3H3ZA 4B4QA 1FI2A 2YV8A 1BBT2 4FOYA 4U2AA 3ZIXA 2GC3A 4ES8A 4ZXKA 3D8CA 1SLIA 1YO8A 3JUUA 4YG0A 2K9ZA 3G7DA 2R042 1ZRCA 1LOAA 4FPHA 2DVBA 2ZBJA 4M00A 1DQ2A 2IFWA 2Z79A 4OI4A 5JZGA 4LLOA 4ZU7A 3BALA 2VVFA 1RUI3 1H1IA 2DUOA 2ZX1A 3AJZA 3LA7A 5CBLA 1ZZCA 1ZRRA 1N3OA 2QQPA 4FSJA 1PVXA 2HYKA 5FCCA 4P9JA 1QHDA 3JBG3 2EF6A 2P2KA 3TYJA 4BE3A 1GQGA 4FCAA 2QFEA 2YY1A 3URFA 2HWC2 3VBRB 3UV9A 3ASIA 1MZFA 1VBD2 4OVEA 1O3TA 4E4ZA 1OLRA 2MEV1 1HV0A 2RR12 5AFEA 2R063 1MVQA 4RFT0 2B39A 3KT1A 3IM0A 2A6YA 1DQ5A 3RPQA 1H1AA 2DCZA 1ALYA 3MFCA 3R4SA 4K21A 2VULA 2LUWA 4Q8KA 3USUB 4Z2WA 2D3PA 1IKPA 3S7EA 3MIEA 4FPOB 2ARXA 3RNSA 4XFBA 1RUH1 2VMIA 4PDWA 1MS9A 4YSFA 1BVVA 4YGBA 2K0GA 4HVOA 2Y38A 2EALA 1AYN1 4YVSC 3LAGA 3IMNA 4PIXA 3HWJA 1OA2A 1ZBE1 3O0VA 4AG4A 4YARA 2BW8A 1PZ9A 5AC91 3JBG2 1GYKA 4NPRA 3ZXLA 1VBB2 3OF1A 1LCLA 2A73B 2TEPA 4YG3A 4XFFA 2JG8C 2PHUA 1N1TA 3VV1A 4I3GA 4N53C 5K0UC 1QJY1 1XE8A 2XBO2 1HRV1 2EVXA 4FXKB 2ZS6B 3H9AA 1YNAA 2R062 2W39A 3QH6A 3VHNA 1G7YA 1U5ZA 1W6PA 1AR82 2C1FA 3POSA 4QPGB 4HSJA 4CDWB 4O9GA 2X8KA 4LE4A 5I93A 4B7EA 3PJQA 1X82A 2ZMNA 2XGXA 3K48A 5AVPA 3P3PA 3JCIA 4RQPA 3TN91 1QJX1 4PF5A 2B7YA 4LBQD 5JZGB 2PLV3 3OYWB 3FE5A 4GWMA 5H9QA 4Y1XA 1SEFA 4LO4B 3WDWA 1GNZA 1H8TA 4NWVA 2OYZA 2EAAA 3ZSMA 2RM21 3CJIC 5E88A 1NXMA 4JVAA 4ONUA 2B8MA 3CJXA 4UBHA 3ZFGA 4PIZA 3VHPA 3CNAA 2IWGB 4KBBA 4OHZA 3HD8B 4Q26A 4B7KA 3WCRA 1LTEA 4N43A 4C90A 2KXLA 5BV6A 4LHLA 2DWRA 3ES1A 4B29A 2BPA2 1QU0A 3AZZA 5GZFA 1XU1A 2XB6C 1C1FA 1OA4A 3ZPYA 4R8HA 4IV1B 4CEYA 1HV1A 1PMIA 1YFYA 1OA3A 3SNMA 3H7YA 3TNQA 3PLQA 3LGRA 4QPIB 4GH4C 4IETA 2XLGA 5KXCA 5I91A 3DV8A 4PDWB 1JXNA 5FLJA 4ISQA 4P5HA 1NYWA 4RA0A 1D0HA 3FBMA 3C2UA 1QMJA 3FLRA 4P9YA 3WCSA 4DMIA 1JYIA 1YFXA 4S2FA 1ZM1A 5FREA 5ABJB 2IXLA 4E4DX 5T54A 5JWPA 5JSOA 2PLV2 2W0XA 5KHGA 1MZ5A 5FDBA 4WM7C 2HEYF 1JUHA 1W6OB 3LOBA 2CGOA 4ASMB 1MQTC 3H0OA 1PVC1 2CAVA 4L8QA 1V9U2 3LWCA 5DG2A 5GLUA 5JOXA 4UXAA 2JE9A 3ZFEB 1EY2A 4H55A 5E8AA 4OHWA 2WL1A 3N36A 1WD3A 2ZOEB 3VBUC 2PAKA 2HWE3 5JSPA 3MFAA 2ERFA 4E2SA 4G4FA 1RUC3 2XLFA 3WW1A 4MGZE 1NXD1 1C5IA 5GKAC 1JHNA 4CDUC 3R6SA 4OI0A 2WFF1 1U12A 1VAVA 3AZWA 4Q0PA 4XBNA 1L3JA 1YJKA 4BMEA 2GC2A 2X5IA 1O3RA 2GH8A 4LBMA 5IK8A 1MR5A 3N35A 1QJU1 3JD73 1X8MA 1TNFA 4KGGA 1G9CA 4QX5A 2AH2A 1U0AA 3ALQA 3RWNA 1QNWA 1DLLA 4GB31 1H2LA 3OBRA 3RZZA 3AYAA 2OW4A 4X6QB 2UYAA 2ZGTA 2NM1A 1OLQA 2GH2A 5J3UA 1BEV1 3VDDC 4HBNA 5D1IA 4Q4Y1 1PZ7A 4Q4V3 4GMP1 5D8AB 4D7YA 1U5XA 5JR7B 1ULEA 4WVMB 1PZ8A 2WKKA 2VUJA 1H8TB 1FMD2 2RS13 3MDPA 1O91A 3NW4A 2E53A 1VBA3 1WW4A 1RUE2 3FBYA 4FOVA 4YZ2A 5DZGA 2R073 5C8WA 1ENRA 2R30A 4PLNA 4TYSA 3KSCA 1AR92 1YI7A 2XWJB 3VN4A 5C9AB 4AGRA 2PAEA 2GZWA 3AXEA 2BGCA 1CVNA 1CX4A 1WBFA 1LOFC 1RUC2 1VBC2 4EN9B 4AEDA 5HBAA 2H0VA 4FQ4A 4YZ5A 1FOD3 1PO21 5JOYA 3ROUA 3AM2A 4QHBA 1SLCA 2RS31 4CEYB 3AKSA 3JD72 4L2NA 1QGLA 1UL9A 5EYYA 2DYCA 3KCCA 2O1QA 2VVEA 4DRRA 2RJKA 3I7DA 3RI8A 4XZPA 4E4SA 1RC6A 1OPMA 1BJQA 3VGIA 1C57A 3WT3A 3RI9A 4EN6B 2O0OA 1KITA 4LBQB 4QPYA 1GSLA 1Z7S3 2XVKA 4QMAA 2WNVC 1AJOA 4Q4V2 1ND2B 5JLVA 3SCHA 2XHKA 2Y0OA 1J58A 5T5PA 1UMZA 3DPRC 3K51A 1JBCA 1RHI2 1LGNA 1NCRB 1CAXB 2A3YA 2RS12 3FMGA 4Q0UA 4AFDA 4J6GA 5DDJ1 2VOVA 1VBA2 4MGIE 4RR3C 5JIAA 4DRVA 4FAHA 1GFF2 5L73A 1A8MA 1VBE3 3GZAA 4QGNA 4FTBA 1S0BA 1BMV1 3OTFA 3VHRA 1FOD2 4AHXA 2I2SA 4OUMA 4AVVA 3D6EA 2ZGPA 4LBLA 1AXYA 3PVBB 1T6GC 4W6YA 1ZX5A 3AZVA 2ZZQA 1LOBA 3ZSJA 3WV6A 5CVRA 1X33A 3E97A 5C33A 1GZ9A 1DZQA 4EWDA 1LEDA 2GN3A 4DQAA 1SCSA 4LEJA 1CJPA 1DIWA 1H2KA 3O5SA 3MIGA 4XTPA 1KD7A 2PHDA 3B01A 2DFCA 2ZGQA 4CDQB 2KM2A 3BOPA 1AX1A 4MXWA 2PQQA 3S7IA 3W59A 3AMHA 4GXLA 5DZEA 2WS91 5AFBA 1CAWA 1S0FA 3SH4A 3JQXA 4FP2A 3WQ0A 3VKLA 1LULA 4YW2A 2VW0A 2OPKA 4WBBA 1D2QA 5ACA1 4AFMA 1C5HA 5EFUA 1S0EA 2VW2A 1H30A 4AEDB 2OIIA 1QXJA 1XNKA 1ZZ6A 3AB0A 3LCPA 4CEWA 1ULCA 3AZYA 5AVAA 1ENQA 2Y26A 3FHIB 5KHHA 4BPZA 3FUQA 4B8EA 1RUJ1 4Q4X1 3GBWA 3EJKA 1LHVA 1Y3TA 3A0KA 2YPJA 4SBVA 3ZMOA 2DU0A 1TME1 1D4M2 1VP6A 3UJOA 4IERA 3CEWA 3VBHC 1PHMA 1NCQC 4AHZA 3I54A 1RMU2 2FBEA 3ZXKA 2VGDA 1GANA 1W6NA 1NQDA 1PK6A 3VBSB 1ZREA 3PTYA 4HLTA 4BYYA 1IHMA 2X53S 3WNXA 2WSVA 5FMOL 4RS5A 2EXIA 2P3JA 2CWMA 2ZGSA 2ZJCA 1IS4A 2VXRA 4HPKA 3V0AB 3EBRA 4IV3A 4R4XA 3VZKA 1R1A3 1LJ7A 4RSUA 4HKOA 3T2TA 1H1MA 2G9FA 2QJVA 1YHFA 4CTEA 1JOJA 1MS1A 2KA3A 2C5DA 2P3KA 2OZ6A 4Q29A 3E6CC 2ZTNA 1RUH3 4LUMA 3HMYA 1EV11 4XYXA 4LBOA 5C8CC 3TRSB 2ENRA 5T55A 4M01A 3BIWE 1LKNA 1WMDA 3LSDA 4EN8B 1AYN3 4QQ2A 3W9AA 3D0JA 1LOGA 2UY9A 3WD5A 4RQPC 4CDXB 4CRQA 4DB5A 4LT5A 1ZBE3 2AENA 1GR3A 2K2SA 4PBPA 3O12A 4NN0A 2CWSA 2YC0A 3IDCB 5AC93 1YUDA 4I0WB 2A75A 1LHWA 1TNRA 4IEXA 3SMHA 4Z8BA 3WDYA 1GICA 2PHRA 4MXWB 3FUOA 3ZN4A 1I6XA 4XF3A 4YM0A 1K5MA 2DCKA 1B09A 2NN8A 3AP9A 4HSLA 3A0NA 1HRV3 3ZFGC 5BY5A 4LBJA 2LM3A 3LA2A 2DUQA 3I8TA 2AYHA 3MF6A 4MV2A 3VZMA 1RGSA 4TWTA 1ZVFA 1IZ3A 3WW4A 4AI1A 2YYOA 1R1A2 1S2KA 4BWOA 1IQAA 1MZEA 2BBVA 2WT1A 3WUDA 1QOSA 2RMU2 1DZTA 2JG9C 2Z42A 2ZGKA 4P9GA 3MEPA 2HWF1 1AL0G 2I07B 5GLZA 3TN93 2PHFA 2D40A 1URXA 3PMSA 4QQOA 4BA6A 3M3CA 1WLCA 2A3WA 2PHTA 3WDUA 4AK3A 1YIPA 1FT9A 4FBFA 4XETA 4K3UA 4KQ7A 4IXLA 4JGZC 1AYN2 1F31A 1MACA 2P3IA 2A5ZA 3PNAA 4AGVA 4COUA 2RM23 1UKRA 5BNPB 1RUG1 1ZBE2 4NHKA 4K20A 1QKQA 3IIAA 5KC6A 4YVWC 2JICA 4HN0A 1TE1B 3TOJA 1Z0HA 4MYEA 3S6PA 2NYYA 3EXUA 1WW5A 4RHV1 4LTAA 4U36A 3SXWA 2FZ1A 5CU1A 3FC0A 4RS5B 4FXGB 3ZFFC 1HQNA 2OVUA 2EXHA 1R081 4IV3B 1AJKA 4YW1A 5SV5A 3USUA 4LHKA 1KQRA 2XJTA 2PFWA 4HETA 1AR61 2IC1A 4Y22A 2X5IC 4OI2A 1A6CA 1REDA 4ZKTB 2GN7A 1KJRA 2ZACA 1SLLA 3RMYA 4WVVA 2WZR1 3TN92 1AXKA 4Z1VA 5LRSA 1UKGA 3N3HA 4JCKA 4Y24A 3VZJA 2H0BA 3M8LA 3AP5A 2JECA 2GDFA 3NV3A 3WG3A 2PHXA 4BHPA 1G9BA 1UAIA 1MEC3 4AVAA 2D5FA 2RM22 1QXRA 3JB8A 2E7AA 2VVDA 3THPA 4A7YA 1XYPA 2ZMLA 1MVEA 2Q8OA 4KH9A 5E16A 1YLLA 3KM5A 2HWD3 3AP4A 4K6BA 5JI9A 1K5MB 1M4WA 4ASLA 3R4UA 2WFF3 4LO7A 3VZLA 3H1YA 3WP4A 1Y7BA 4AI3A 4AQ2A 2B9UA 1UU6A 1S0DA 3AX4A 4WM8A 3WX5A 1POV0 4QM9A 1ULGA 5F1RA 1W6MA 2GMEA 3ZYRA 1Q8QA 1QJU3 2FHRA 2DU1A 2R1DA 2VNRA 4QPGA 3SCFA 4CDWA 3VKFC 3S0MA 4AHYA 5FTTC 1CONA 3KZ4C 3OCPA 5F5QA 1PIV1 3RYPA 4FT8A 1NQJA 4FPCA 4Y1VA 1AYM3 2VOWA 3HAGA 2LTNA 2OZJA 1PO11 2CV6A 4G3YC 3LOIA 4QU2A 1EP0A 1BEV3 1W2UA 2DV9A 1C1LA 3OYWA 3FLTA 3WINE 1COV1 1H4GA 2DURA 2DVDA 2YDEA 5JDBA 1G8WA 5F6KA 1RUF1 1U5IA 3VBFC 1OOPC 3VHOA 5FOJB 2JE7A 1HRI2 1S1AA 2E51A 1Q8VA 1XRUA 4I02A 1MEC2 4K40A 3WP5A 1IGOA 2CTVA 2D43A 3RG0A 1MZ6A 1R091 4KG8A 3B7MA 3W58A 4NHLA 2HWD2 1M06G 5CB7A 1H2MA 3ZDSA 3SISA 3AKTA 2WZPP 4EROA 1ND3B 2WFF2 5FMOS 5HI0A 5CFCA 2XJVA 1PO23 3NJZA 4IV1A 3I4IA 2RS33 1V00A 4YNIA 3VL9A 4XE9A 1Q56A 4Q0QA 4QPIA 4Y22B 1YRZA 4JTNA 4P9WA 4A2UA 1HXS3 1DFQA 3VLBB 3FLPA 2VOXA 1GQHA 4LULA 4HK8A 4R9BA 1NA1A 1RVF3 5FPZA 4ES9A 1AYM2 3KGLA 4XHXA 3PVOA 2A71A 5ABJA 4FPGA 1BEV2 1HQLA 1V6NA 4BLJA 1RUI2 3J9SA 1DU3D 3FJSA 5T5OA 1W6OA 2PA7A 4TLFA 5JSRA 4D3WA 3THTA 3CF6E 2CY6A 2WT0A 4LBNA 3ZFEA 5KWRA 2A7AA 3IPVA 4Q1PA 3DKWA 2YGLA 2A6VA 1EPZA 1WA4A 1VR3A 5DDJ3 1CGPA 1QDCA 2GC0A 4E2GA 5BNNA 1JTZX 4F83A 4JRAA 3MW2A 4XHBA 1AR71 1WW6A 3AFGA 1O7FA 3HT2A 4RGGA 4LE3A 1BCXA 5FQ0B 2BFUL 4AW7A 4AVSA 1PGW1 1RTVA 1NE4A 4KNCA 4WM8B 4M3CF 3JU9A 1W6MB 4A3XA 1QF3A 2UU8A 5JPNB 2JXAA 3HBZA 3MIDA 3WR0A 4HKWA 4B3NA 1DGWX 2RS32 1UPSA 4B4PA 1QOTA 4CEWC 3VL8A 5J09A 1UU5A 1V6MA 2BVBA 2V09A 3AKRA 4OLLA 3NL1A 3NAPC 4F3JA 1BXHA 1HXS2 4I01A 4N90A 4MZUA 1EAH1 5D8AA 1PGL1 3WDTA 2AGSA 1H0BA 1RVF2 4L97A 4WVMA 4CYDA 3ETQA 5H9SA 5L36A 4XFAA 3ES4A 4YW5A 5A32A 1SCRA 4YYOA 1Y9QA 2WS93 4XF4A 1PK6C 3H3UA 5C9AA 1HDKA 1N1VA 1JYCA 2WJSA 3ACLA 4HVQA 4E2QA 3EHKA 4EJRA 1LU1A 3KT7A 4HZFA 2YGMA 1WCSA 3ILRA 4UW3A 1J3QA 3BTAA 4XQDA 2CYFA 3TAYA 4JGYC 5GLVA 4XDQA 1GBGA 5IUQA 5CFCB 5L7OA 4Y26A 4E9KA 1GNHA 1S0JA 5A33A 1FNZA 1KFXL 2ARBA 2DCYA 1DYPA 2D5HA 3RJRA 4XJAA 5T50A 4AYUA 2HKXA 1RUJ3 1X7NA 1LRHA 2HWB1 4KGQA 4LO8A 1SBDA 1B35C 4Y1UA 1BBT1 1TME3 1NA1B 3WDXA 4OHVA 4NO4A 3ZMNA 5JPMB 4LBQA 2E6VA 3B69A 5HCAA 1ZBA3 1ND2A 2ZGOA 1LHOA 2R041 3D4KA 3HIFA 4FPEA 4S2HA 5EYXA 4XXAA 2ZCWA 1O4ZA 1NCRA 1CAXA 2GNDA 3UK9A 3GZUC 3MZHA 4ITCA 5T52A 3IPVB 2ZKLA 5BNOC 1FPN1 1KS4A 1UU4A 5EZWA 2P17A 4Y20A 5BNQA 2VOKA 4AEMA 2WS92 5BNNB 3OD0A 1GZCA 5C4WC 3VBOA 1NCQB 1C28A 1EPWA 4QQHA 2HWC1 1AL21 2D93A 3WP3A 2ZHLA 5J98B 1VBD1 3QACA 3PHMA 2YHJA 5F6LB 3ZX7A 3J4UH 4UW6A 3TBDA 1EV13 2RR11 2VY0A 3ELNA 4CZSA 3OGGA 2ZHKA 1NLRA 5I0RA 4Q1RA 3B93A 3UKTA 5T5LA 3IKWA 1OFSA 1J3RA 1MS5A 2Q5TA 2YUEA 1RUJ2 2V73A 1S55A 1TME2 2ZA9A 2ZGRA 1OQDA 3UJQA 4C1XA 2PHWA 4CDQA 4Z07A 3AMNA 3ZVXA 3TWIA 1SDWA 1ZBA2 3DL3A 3ZXGA 5T5JA 3VBRC 4I30A 4OUSA 4HK9A 4MLOA 5A32B 1V6KA 3APBA 1NY71 1RUD3 2D6KA 2MHFA 1AF9A 1O3QA 5CNAA 2ILMA 2ZGUA 3NV4A 5J96B 1F5FA 1UN1A 2HWE2 3I59A 4XJZA 3JBG1 2DCJA 1VBB1 4QGLA 4GULA 3VZNA 3ZYGA 4OI1A 4FPYA 1WLWA 2HWF3 3QOPA 5KBFA 1CESA 3SCGA 5L7OB 2Y0IA 3AMQA 2D3SA 1RL3A 3L2YA 3NO8A 3WHUA 4AXOA 4AHWA 5A33B 2WC2A 2O8OA 4N9HA 5K8SA 5BPXA 5BXXA 1EV12 3MGUA 2YMZA 2XBO1 4LO5B 1PM7A 2ETEA 4K8FA 4KWKA 4LUKA 4NWWA 1J3PA 5KXDA 1QWRA 3ZYJB 1I5ZA 1N1YA 5E89A 3NV2A 1AR81 2H6BA 1GV9A 2WNUB 3FZ3A 2VNOA 3AKPA 1RUG3 1LESA 2BNOA 2NPIA 3O7OA 5JIUA 5A3LA 4IEQA 1X36A 5CFDB 3M2MA 3VBSA 5FRAA 3IWZA 4GIQA 3FX3A 1DGWA 1QDOA 1CPNA 3V0BA 3V0AA 3FWEA 1WD4A 4Y20B 5EV7A 5K9YA 2R072 1R083 4BLIA 1RUD2 1UD1A 4QD2A 2JX9A 3ILFA 3VBOB 4YGDA 3SH3A 2D6PA 2ZX3A 1UCXA 3N7MA 1KDMA 1UIJA 2BFUS 1ULDA 3ZO0B 1OPOA 3GF6A 5JMCA 1TMF3 3J8F3 2D97A 1KXGA 4ZU4A 4QPGC 4CDWC 3AMMA 4XFCA 5K7PA 1LR5A 3MF9A 2IXJA 4YRDA 4DY3A 2WZR3 4FOWA 1CR7A 3U07A 5KC5A 1DQ0A 2JDZA 4CDXA 4COVA 5JZGC 3MW3A 4DINB 4COYA 1YI9A 2ZX2A 1TQ5A 3WQ1A 4M3CA 1U5YA 2LALA 2R49A 5KHKA 5FAXA 4BMBA 1YCIA 1ONAA 4BM8A 4INDA 4NVPA 3WHTA 3ZYIB 3H1MA 1Z7S2 4J1XA 4MSVA 3AK0A 3KB5A 4Q4W1 4W6WA 5KXEA 1G9AA 4HFSA 1N1SA 4R9CA 1IPKA 2RS53