3OD0A

Crystal structure of cgmp bound cgmp-dependent protein kinase(92-227)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PRKG1 protein
publication title Co-Crystal Structures of PKG Ibeta (92-227) with cGMP and cAMP Reveal the Molecular Details of Cyclic-Nucleotide Binding
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od0A00
5FPZA 2IXKA 3CLPA 3OCPA 5JCTA 3H7YA 5I93A 4IEYA 4UBGA 5K8SA 2CAUA 2DCTA 4D7SA 4HN1A 1PM7A 1ZZCA 5LRSA 4DINB 3UKTA 4YRDA 1CAXA 4QXKA 1ZZ6A 3DKWA 4P9GA 2IXHA 3RYKA 3OTFA 2EVXA 4I0AA 4IEPA 4BYYA 4IEVA 3QACA 3TNPB 3BPZA 1J58A 2OYZA 2N7GA 1CGPA 3HQXA 3MYXA 1TQ5A 1LB2A 3ETQA 1FXZA 2IC1A 3NJZA 3G7DA 1CAUB 1H1IA 5I0UA 3I54A 5LEKA 1O7FA 4F7ZA 1O5LA 1O3SA 1UCXA 4O9GA 4PIXA 4XF9A 3O14A 4OLLA 5EZWA 2UYAA 4JTNA 1NZCA 4XFGA 5JSRA 2Q1ZB 2H6CA 3MDPA 4IEXA 1U12A 4ZU5A 3DL3A 4OFGA 3FE5A 3KCCA 1DGRA 2FQPA 5KHJA 3NKTA 4Z07A 1ZREA 5CU1A 4META 1WA4A 4WBBA 4QGLA 4KL1A 2OA2A 1NE6A 3NW4A 3KSCA 1PMIA 4I0BA 5FLJA 4XF1A 2XKPA 4PIYA 3E5UA 4LLOA 3ST7A 5KHIA 4BH9A 3PVBB 4I09A 3HT1A 3L2HA 3E5QA 4LULA 2GC3A 2D5HA 5I91A 4HBNA 3CL1A 4Q0SA 4L11A 1NXMA 1G6NA 3SCFA 4AVAA 2Q30A 2GH2A 4YARA 4MGZE 3OF1A 1Y3TA 3H3UA 3S0MA 4E2QA 4LA3A 5JR7B 3BALA 4MGIE 4IERA 1ZX5A 3VHRA 1OD5A 4MX3A 3RDIA 3IBMA 1Y9QA 5E16A 2GZWA 3D0SA 1SFNA 2IXIA 3H3ZA 3CF6E 1SEFA 3NVCA 3LWCA 4LTAA 1RTVA 2PAMA 1RUNA 3H7JA 5C8WA 5I8SA 3H8UA 3M70A 1CAUA 2CV6A 4XF0A 2F4PA 1JUHA 4B29A 5KHHA 2QCSB 3E6DA 2CGPA 3ZDSA 1DZTA 1GQHA 1Q5OA 2QJVA 4IEQA 2MNGA 4FBFA 4EWDA 1UIJA 5BUVA 4A2UA 3ACLA 3RYPA 2B5HA 3E5XA 3FWEA 5FDBA 1CX4A 2ZKLA 2Q0AA 3CEWA 4K8FA 3UKVA 3EO6A 3SXWA 2IXCA 5CADA 3R6SA 3JZVA 2PHDA 4IESA 3USSA 3S7EA 2MHFA 1ZRDA 5LRRA 3FFQA 2BNNA 4JV4A 4I02A 1DZRA 4MUVA 4MH0E 3PNAA 4XFAA 5BV6A 4IEWA 4R52A 4L2NA 4HVRA 4I01A 1J59A 2O8QA 4ONUA 1XRUA 2I45A 2K0GA 3RPQA 1QXRA 4IETA 1J3RA 4UXAA 3SCGA 2WC2A 4HSJA 5AVPA 2UYBA 3WW1A 2VECA 4XFHA 2QDRA 1ZZBA 1I6XA 4Q0UA 1EY2A 3H9AA 2D5FA 1L3JA 3LA3A 3BCWA 1J3PA 1YFUA 1QWRA 4QX5A 4Z82A 3B02A 5T3NA 1EYBA 4HLTA 1UW8A 2EA7A 3S7IA 2VQAA 3WW4A 3OD0A 3NL1A 4I2OA 5C6CA 3MPBA 4Q0PA 1X8MA 4KU7A 2GC0A 2BEOA 3LOIA 4CYDA 2BNMA 4Q29A 2Z69A 3LZZA 5J7MA 4NVPA 3H1YA 1GQGA 3CO2A 4RD7A 4XETA 4MZUA 2HJIA 4XF3A 1X8EA 2XHKA 4MV2A 4IEOA 3EJKA 2OZJA 4X6QB 2QNKA 4O9EA 4BHPA 2KXLA 3IDCB 4EWEA 1YFXA 3GYDA 3HIFA 1O4TA 4AXOA 2EAAA 4QGMA 2MPFA 3ROUA 1CAWB 5EFUA 4LEJA 4LUMA 1XE7A 3I7DA 5LEJA 2C0ZA 4WVZA 2IXJA 5FLIA 2O1QA 5FLHA 3KGLA 4FAGA 4HN0A 4XF4A 3MZHA 1UD1A 3SMHA 3EBRA 4XFCA 5KHGA 3D0JA 1YUDA 3LAGA 2PTMA 3U0ZA 4N9IA 3CJXA 5I0RA 2Z2SB 2Y0OA 2BGCA 2WFPA 2PA7A 1HW5A 1YFWA 2XLAA 3OGJA 3ES1A 4KWLA 4LUKA 3BB6A 3WW2A 2FMYA 5FQ0A 1Q3EA 5J3UA 2XGXA 1RGSA 2IXLA 1XE8A 2XL9A 4MGKE 1X7NA 1VJ2A 4EWAA 4IEUA 1WGPA 4UBHA 2BYVE 1Q43A 4X6RB 4D7TA 2H0VA 5HI0A 1NE4A 4EROA 3N4MA 2ETEA 1QXJA 3LA7A 2B8MA 2UY8A 5BPXA 5I0SA 3DV8A 2UY9A 1O3QA 1X82A 3HT2A 1WLTA 4WZCA 1LRHA 1J1LA 1CAVB 1IPKA 2PAKA 4HVOA 2E9QA 4QGNA 3SHRA 1ZZ8A 4E2SA 3H1MA 1I5ZA 3NSTA 4R8HA 5D1IA 4PIZA 1YLLA 4HSLA 1UPIA 3ES4A 3H1WA 3PLQA 1CAWA 4XEZA 5F1RA 3WW3A 3GBFA 5FQ0B 3U11A 4J1XA 1VP6A 4HZFA 2GU9A 1O3TA 3I59B 4TLFA 2Q4SA 4BIFA 3BU7A 4E2GA 5KHKA 3EHKA 5FCCA 1FI2A 4N9HA 4ZU4A 1OFNA 2QVSB 3E6BA 2XL7A 2VPVA 3QOPA 3ELNA 4FT8A 4AVCA 2OZ6A 3FZ3A 5BXXA 1ZRCA 4Q0VA 5JSPA 3U10A 2PAEA 2PHLA 1J3QA 4KWJA 2HKXA 1NYWA 5FPXA 5E1RA 2ATFA 3FX3A 4JTOA 4AQ6A 5I8TA 2D40A 2XLFA 1SQ4A 1UIKA 1RC6A 4HVQA 4YNIA 2CAVA 5KBFA 5JSOA 4ZU7A 3IDBB 2GC2A 3KMHA 3LA2A 1YFYA 2OPKA 2GAUA 3RYRA 1OI6A 4QMAA 3UKNA 3FHIB 1ZZ9A 1VR3A 1CAXB 4QM9A 3M3IA 5CVRA 4AQ2A 2ET7A 4I3PA 3SCHA 3KGZA 1LR5A 4H7LA 2XKOA 4J1WA 1CAVA 3RNSA 2V09A 1OMIA 1H1MA 2D93A 3IWZA 4YYOA 4HMZA 3TNQA 2K9ZA 2PYTA 1ZRRA 3RZZA 1O3RA 4F8AA 1YHFA 2XLGA 2GC1A 4JVAA 3IIAA 3H50A 4KU8A 3EQEA 4XFFA 2ZCWA 5JAXA 1EPZA 3E6CC 1ZZ7A 3D82A 5J48A 1ZRFA 3DN7A 5I8YA 3I59A 4Q0QA 5I0TA 4XFIA 4XFBA 2PFWA 1QY4A 2B9UA 4EV0A 1LKNA 1RL3A 1ZVFA 4PJYA 1YWKA 3E97A 4QM8A 3C3VA 4KWKA 5BY5A 2P17A 4MGYE 2PQQA 1RUOA 4AVBA 1EP0A 4YSFA 1DGWA 1FT9A 1ZNPA 4GULA 4ORFA 2ET1A 1IPJA 1O5UA 4LA2A 2BNOA 3FJSA 2H6BA 4FAHA 4IEZA 1V70A
chains in the Genus database with same CATH superfamily
1JHJA 3JB8A 4XJ9A 1PNFA 4LOTA 5FPZA 1F4AA 2HWB3 4AEJA 3H7YA 4WZFA 3TEWA 2W1WA 1U5ZA 3NNJA 2CAUA 4JKKA 2JB8A 3BPSA 1OQEA 5LRSA 4DINB 5JUVA 2QQOA 1FNZA 1VPHA 2XVLA 3MI8A 4OZOA 5TSWA 4QXKA 3UKTA 2FDFA 3AP4A 1ZZ6A 2BBAA 3JB4C 1VBD2 3OEAA 4Q4X1 4ZY9A 1KDKA 2EVXA 3I2HA 5C4WA 1RXFA 3GCXA 1APNA 2LW8A 1MVEA 4IEVA 4B4RA 3N9LA 4E4SA 1AL0G 3QACA 2WNVB 3PTRB 4IE0A 5FYUA 5FUNA 4M0NA 1QH7A 3CU7A 4N7UA 2OYZA 5LZ6A 2N7GA 4W65A 5FP7A 1KRIA 5FYVA 1EV12 1D4M2 2LM3A 4PQQA 5JXHA 1QU0A 3N7MA 2DURA 1VBB3 1BEV1 5FZOB 2J1VA 1FXZA 1REEA 1VBE3 2IC1A 1Q56A 5GKAC 1YEWA 3GHNA 5I0UA 5FYSA 4KGGA 3WDVA 4F7ZA 1ZYBA 1O5LA 2YB7A 1UCXA 4PIXA 1RUI3 2R1DA 1OOPA 3O14A 1H8VA 2ERFA 4OLLA 5ERLA 3KCXA 3RGBA 5BNOA 1NZCA 4NWWA 1W6OA 2FDIA 3GZTB 4BQ1A 1RUG2 2H6CA 4AEDC 2AYHA 3LIGA 2QQJA 3M3EA 4ZU5A 5FXWA 3AFKA 3FE5A 3DUIA 4B3NA 3MF9A 1U0AA 1DGRA 5C8CC 1XC6A 3ZYJB 4Z07A 4DXRA 1VBA2 4QQHA 1HRV3 1W6NA 1SLCA 2GNTA 2VZPA 1GP6A 5KXDA 4CP2A 2KA3A 2PHWA 1CN1A 2WINB 3MEPA 1QDCA 2PLV3 4Y20A 4I0BA 3PUAA 4RHV3 2ORXA 3VDDA 4XF1A 2P2KA 2HWE3 2JX9A 4CDWB 1LGBA 3FFZA 1BXHA 3ILNA 4FPEA 4LLOA 3FMGA 1NCQC 2E7AA 4BH9A 4A44A 2RS32 3HT1A 1KFXL 1XNTA 2D6KA 2W9XA 2Z42A 4FQZA 2ZGOA 2X29A 1X9TA 4AK3A 4A3ZA 4L11A 3JBG2 1HX6A 5KC5A 2ZGPA 5C71A 2D6MA 2VTXJ 4XIOA 3S0MA 2WA4A 5FO7B 5D8AA 2D43A 3BALA 3E1F1 4WV8A 1S2KA 4MGIE 5LBBA 4DUWA 4ZONA 3I4IA 1UY3A 1F35A 3ZFEA 1O59A 5FY7A 3J26N 1Y9QA 2WQ8A 3D0SA 4B1LA 3I8TA 2DVGA 1QQP2 1LENA 2IXIA 2R043 1UN1A 3H3ZA 2A6YA 3U14A 1ULCA 1S0CA 5FZIA 2MEV2 1B09A 4JX0A 1BLZA 1CD3G 5ABJA 3SISA 3ZSEA 3O1MA 2WO3A 1F5FA 5FZMA 3UNPA 4ES9A 2FZ2A 2YDEA 1GFF2 3C7GA 4YG6A 4B1MA 5FYYA 2O0OA 1AL22 2JE7A 5L9BA 5IVEA 4W6YA 3WNXA 4BOWA 1K45A 3H7JA 1CONA 5ISLA 5I8SA 3OBTA 3P1IA 3RWNA 1UZVA 3A7QA 4N8MA 1WW7A 1I5PA 3RG0A 3VDDB 3QD6A 4B29A 4AFCA 2QTWB 1F4HA 4AOCA 3E6DA 1HB1A 1DZTA 1GQHA 5FFOC 2YBKA 1CESA 2MNGA 4KH9A 3T2QA 2R062 4XILA 4Q4V3 4DFSA 1OH3A 1QJY2 3OYWA 2BFUS 2X09A 4QT6A 4NIIA 5ACA3 2ZKLA 2HWF1 2Q0AA 3CEWA 4QDRA 4A45A 5A6YA 2NLRA 1BBT1 4EJRA 1UXZA 2C1FA 5CADA 4BA6A 1TME1 5D8AB 3W9AA 3JZVA 1LOEA 5E8AA 1DG6A 4EN6B 4IESA 2PN5A 3VDBA 4AE2A 1W2UA 1CIYA 4YZ5A 2MHFA 1FV3A 5J09A 3U75A 2ZX0A 2ZHKA 5AVAA 3WCRA 1VAKA 2CU5A 3K2OA 3OUJA 4NHMA 4QPGC 4UOJA 4CDUA 3IDEA 4D8MA 1REFA 3WLUA 1JYTA 2AC1A 3M7AA 2ZX4A 5DABA 4AFDA 1UY4A 1G9DA 4TTGA 1DZRA 4MH0E 3PNAA 4YVWB 2W2IA 2WL1A 1AR63 1PX3A 3IAQA 1YI9A 4Y1XA 4IEWA 2R073 1G9BA 4CP0A 4HOOA 2J42A 5HV0A 3B3QE 5FZ0A 3VZNA 3O5SA 4QU2A 1R1ZA 2XBO3 5F2SA 5A7QA 2AEZA 1LGCA 2VW2A 5FYZA 3WEZA 3MLJA 1GZWA 5H9RA 1NZIA 4IE6A 4UXAA 3GM8A 1HXS2 3AB0A 2VZOA 2DCYA 4C1WA 2XWJB 4JGZB 4KMQA 1A78A 1J84A 3GCWA 3RMYA 3ZYIB 4J6GA 1ZZBA 1V6LA 4YLZA 2JICA 4Q8KA 1EY2A 3WDYA 1L3JA 1XOYA 5KC6A 1JZ7A 1YFUA 1GBGA 4FOQA 4RQPA 3VLBB 3AP6A 4Z82A 4QX5A 3OYWB 4MHUA 5K4LA 3WG1A 4HLTA 1ZA7A 3DXTA 1UW8A 3VBUA 3WW4A 4AFMA 2ZGNA 3K51A 3VD3A 2J1TA 3CQOA 2WNUB 2HWD1 1D0HA 3RI9A 1J83A 1V0AA 2BEOA 3TWIA 3LOIA 2BNMA 1RUD3 5IFPA 1HJFA 3IN9A 1DQ6A 4LBMA 4E8DA 1VBE2 3LEIA 4QQ2A 2AENA 3LZZA 3NJYA 2WAOA 5FOBB 4ZKTB 4NVPA 1F31A 2YFUA 2YROA 3AYCA 3BIEA 5CFCA 4S2FA 5CG9A 1PNGA 2HJIA 4JZRA 2FZ1A 1UKRA 2WN3A 1O91A 5DQ0A 1X8EA 1DP0A 2VM9A 2C26A 4Q26A 1PO21 5FY5A 1UWWA 2O8OA 3O0WA 4O9EA 1WBFA 2R0FA 1GNYA 3IDCB 5LK7B 1PMHX 3GYDA 5CFDC 1PM4A 4QPIC 1O4TA 5IAVA 1M4WA 4QKFA 4OQ9A 4L99A 3NAPC 3ZN6A 4FP2A 1GZWB 1AR91 2WZEA 1DFQA 2B45X 4LUMA 1UY2A 4GMP3 4OCTA 1HRV2 3I7DA 2C0ZA 1NA1C 4CCOA 4QB1A 1BMV2 3JD73 2VVDA 4WVZA 4BQ2A 1R1A1 2GMPA 4HG6B 4XW3A 4FAGA 3RI8A 4HN0A 2YC4A 4RQPB 2PLV2 5A33B 1R082 4YVSB 3EBRA 1PX4A 2ZS6B 3PIGA 4RHV2 5LATA 3POYA 2B9VA 2RMU3 3V56A 4CXXA 1MQTB 1RUF3 1OC1A 2JDNA 4GD4A 3C7HA 4B7EA 5BNPA 4FFHA 3CJXA 1NLSA 2WZR2 3SITA 3O0VA 1QEXA 3PUQA 2QQMA 2GDFA 4OHZA 4A42A 5EWSA 4CP9B 2WFPA 3WF1A 2PA7A 2XLAA 1QOOA 1HRI1 5CFCB 4P5YA 3LSEA 4P5HA 3BB6A 4WM7B 5DZEA 2A75A 2WS91 5FQ0A 1RUH3 1RGSA 2ID4A 1ZRIA 2IXLA 3ZO0B 2A71A 1W9SA 4H55A 3PDQA 2VOKA 3WF4A 1SFPA 4MGKE 5E6HA 1VJ2A 4A4AA 3MO4A 5FMBA 2QQVA 2WO7A 3N3HA 5L9VA 3W5MA 4X6RB 2R042 4D7TA 1K5MB 4XZPA 4GZ9A 1XSQA 2NYYA 2ILMA 2OW4A 3DPRB 3N4MA 2ETEA 2GP3A 2VCAA 1XQNA 4NHXA 4AI2A 5BNNA 4FPHA 2IVIB 3ZSLA 2UY8A 4J25A 5BPXA 3HJRA 1WKYA 1O3QA 3HT2A 3TEYA 4A7ZA 2I74A 5LBEA 2L9LA 3N7KA 2WT0A 1LOGA 4WZCA 5CG8A 1H2LA 1LRHA 3U1XA 1GQPA 3NNMA 2NMOA 1VAMA 1CAVB 1YIPA 1AUYA 4JKMA 3WP6A 3Q9OA 4AZZA 3PVNA 4WM8C 4CCDA 4ASKA 4FTBA 3MICA 3WNKA 4QGNA 2A73B 2HEWF 3VBRB 1OD3A 1TNFA 2VMIA 4QB6A 5FYBA 1CJPA 3H1MA 1GWMA 4Q4V2 4DNYA 4A6OA 1PIV3 3Q8EA 3NSTA 5K0UA 1PVXA 4PIZA 4KBBA 5ANQA 5ACA2 3PLQA 3ES4A 4XEZA 4YWAA 5F1RA 5F3GA 1N47A 1R093 5A80A 2CNAA 1GWLA 3GBFA 4TLGA 2Y60A 2J1SA 2RJLA 2VZSA 5FQ0B 3AMNA 1LEMA 1VP6A 3HN1A 4XAAA 1QGLA 3P3PA 1XBFA 2Q4SA 1W2AX 1IS5A 3RZGA 4BIFA 5FPLA 3CJIC 1OA2A 5KHKA 1RMU1 3D3AA 5FJHA 5FY0A 2EXJA 3ZXJA 1C8NA 3ZYHA 2F4LA 2VMHA 3K75B 2A7AA 3D6EA 4PLMA 3TEZA 1AR62 2VPVA 1LOAA 3IIIA 2R072 5BXXA 1H8TA 3ZFGC 3RSJA 1LOFC 1PO12 1HV1A 1AHSA 2XBO2 4N43C 1SLBA 3U10A 3ACIA 1J3QA 3AZYA 4GWMA 2RJ2A 1HQLA 3WY6A 3N35A 2QQUA 3KS7A 4UW4A 1PK6C 4JTOA 5I8TA 1W6MB 2HWC1 2ZTNA 3FL7A 4Y22B 1Z78A 1NKGA 2VMEA 4DEQA 1RC6A 2WNEA 5L19A 5C8CB 1FMD3 2EICA 4YW2A 4FPKA 4YNIA 1JODA 4YZ3A 3CMGA 4PLOA 4PCRA 5KBFA 2BQPA 5JSOA 1X9PA 3IDBB 2CYFA 1AXYA 2RR11 5EYYA 1SLTA 3B9IA 3LA2A 3T08A 4UF0A 2DVDA 4XQ4A 2QBXA 1TMF1 3PHMA 4JCKA 1V9U1 5DAPA 5K0UB 3KF3A 1NCRA 2EXHA 3POFA 4QMAA 1ZZ9A 1E57A 3V64A 1X36A 1Y43B 2BV4A 3DYMA 3NJVA 5F7UA 1GU3A 3LD8A 4COVA 2AR6A 2WBKA 1VLNA 4AQ2A 3AL6A 3AZXA 1JOPA 1AYM2 4KI5M 2W1SA 5FMCA 4BE3A 4S2GA 3VDCA 5C4WC 1ZBE3 4J1WA 3VD7A 2OX0A 3T09A 3A0NA 2JE8A 1SZBA 5IK4A 3I3MA 3W20A 2P6CA 3RNSA 2V09A 1D0GA 3WG3A 5FP3A 5A3OA 3S6PA 1RUC1 2G4IA 3IWZA 4JAAA 1BJQA 3J4UH 4HMZA 4XUOA 5FKCA 3AZZA 3FLRA 4AGGA 2AZ5A 3OSDA 1W05A 4GMP0 3UYJA 3BTYA 3WQ1A 4ZXKA 3RZZA 4A41A 3DYPA 3GBWA 1VE0A 5IHRA 3FHQA 3INAA 4MGQA 1AYN3 2VJXA 5H9SA 5C5TA 1L7LA 4FO9A 3SH3A 2HEVF 3ZFFA 1AXKA 4KU8A 4DOUA 3TN93 1S0EA 3OOXA 4OHWA 5JAXA 1OOPC 3V65A 2WFF1 5BNOC 1RJ8A 3E6CC 1ASJ3 2E33A 2GH8A 3J8F1 3IPVB 1QJX1 3PUHA 3JD72 4K6BA 5I8YA 3WV6A 2JG9A 3DGTA 4YM3A 2PFWA 1QY4A 2JG8A 4P14A 4XCAA 4EV0A 4PJYA 2BPA2 1DQ5A 1N3QA 3NKGA 1NCRB 1JS9A 3T0AA 1RUF2 1UPSA 3C3VA 4IGQA 4KWKA 2JJ6A 1GMMA 2P17A 3TOJA 4MGYE 1DDLA 1EUTA 1W9YA 2PQQA 5E89A 2JDUA 1ZBA1 2W95A 4AVBA 4YSFA 1DGWA 1FT9A 2A5ZA 2XJVA 5G05L 5CISA 2Q8DA 3PVOA 4CEWB 4CTEA 1V6NA 3GDBA 4EE2A 2XUMA 1ENRA 2BNOA 3ZYBA 4CPBD 5C3SA 5JZGA 2VZQA 5H9QA 1OLME 4GIQA 4WVMA 3WF3A 1ULEA 2OIIA 2Y64A 1IOAA 2DVBA 1CR7A 3LDRA 4M00A 3C2UA 1GNHA 3RZKA 4QX1A 1UYXA 3AYAA 1A3KA 4Z2WA 1AX0A 2DCTA 2XR4A 2EIBA 1RUJ2 2BBVA 5FPUA 1CAXA 2UURA 2CHHA 2FCTA 3GF6A 3PJQA 4QPGB 5DAVA 3CKHA 1MS9A 4UFMA 1OA3A 3RYKA 2J1RA 3OTFA 1QDOA 3ZFEC 4I0AA 1FPN3 1AX2A 4LBQD 1SPPA 3MGUA 1DQ4A 1J58A 4W4ZA 2RHPA 3ME2A 5A6QA 3HQXA 3N9MA 4G9SB 4C90A 5ABJC 4OMDA 4V1PA 4LKFA 3ETQA 2P34A 2X53S 2ZEYA 1SDWA 2CGNA 1XB9A 1GICA 1CQ9A 2DCKA 5GLZA 4CDQC 1AR73 4AYUA 5AC93 3G7DA 3VBSA 1CAUB 1UO9A 3IT8A 2YBSA 3MIEA 3I54A 1QKQA 3J7NA 1VB4A 1TNRA 1W8WA 3VKLA 3WQ0A 4BMEA 4RN5A 2R30A 1GWKA 1VBD1 2E7QA 1RHI3 1PIV2 3JQXA 4LITA 1VBC1 1GOGA 2RVAA 3ZYPA 2UYAA 4XFGA 3U07A 1BQPA 5JSRA 2Y6HA 2HLEA 2Q1FA 4QDQA 1IPSA 1SBFA 1D4M1 4PDWA 4LO8A 4OFGA 1IQAA 3ZPYA 5FP8A 3KCCA 3OB8A 2FQPA 3WDUA 3ZMNA 1HQWA 4XQWA 3NKTA 4EN7B 1ZREA 2NQYA 5CU1A 3URFA 4WBBA 3RQ0A 1S2EA 3OY8B 4IXLA 1NE6A 1HIXA 5T5LA 2UWBA 3T4HB 3O1SA 1SCSA 3K3NA 4LKDA 3BTAA 3I2DA 3KSCA 4P00B 4ISQA 2QQKA 2A3YA 1SPPB 3B69A 1RUG1 2YG0A 4EN8B 3E5UA 1SHWB 3ST7A 5CFDB 5IVVA 2AGSA 2ZAAA 3LGRA 1MPXA 3WNNA 4BQYA 2H0BA 1LU1A 4Q4W3 5FZHA 3AXDA 4NPMA 4P02B 3NAPB 5L7OC 1BYHA 2D5HA 2ZGQA 5FAXA 1VBA1 1MEC2 3CL1A 1FMD2 1HB3A 1O8SA 1N3PA 2VG9A 4NRQA 4LJHA 4YW7A 1PGW2 5DAQA 4GB31 3AM2A 3UESA 1GZ9A 1EPWA 2Q30A 4MGZE 1WCDJ 1JI6A 3H3UA 5JR7B 2PHTA 3KWVA 4NE9A 4MX3A 3LIHA 4E4ZA 2Y6GA 3KQRA 5H9PA 5E16A 2GZWA 4LHLA 1HLCA 3R05A 3HPNA 1DBNA 5C33A 3MBWA 2FHRA 2VC9A 2WNVA 2RS31 3VZOA 5T50A 2C9KA 2Q8EA 3T2PA 3OBAA 3ZM8A 2JXAA 4HK9A 5FPBA 1A8DA 3POSA 4HT1T 3VBUC 5LK5A 3LWCA 3FBYA 3O1TA 3V0BB 1LHVA 4HPKB 4R9CA 2DF7A 4Q1PA 4GKYA 5FZOA 3JBG1 4Q4X3 4B4QA 5A3MA 1LAJA 2VUCA 4O61A 1RUNA 2F17A 4M0HA 3VL8A 3POEA 1NY72 4LBQB 4JDNA 3RJ2X 1Q8OA 5EJ3A 4HONA 4YW4A 4JRAA 4K1YA 1ND3B 4OYUA 5FY8A 4UW5A 4PF5A 1US3A 5KHHA 4URTA 5F5IA 4D0QA 4EZ4A 2YC2A 3SQOA 3K48A 1B35B 4UT5A 1QQP1 2UWAA 1BEV3 5LBCA 1LJ7A 1NQJA 3S57A 4IEQA 1KFUL 3TN92 1M06G 2MEV1 5GZDA 1TE1B 1UIJA 3WNLA 1URXA 3FLTA 2JDAA 1ASJ2 3E5XA 5A32B 3FWEA 2YHJA 4M4RA 4HK8A 2DCZA 4OZXA 1KS4A 4AAPA 1CX4A 3I3DA 2KM2A 5CKMA 1AL21 3POGA 5HCFA 1UYPA 1VMJA 3G6JB 3WUDA 5GZGA 1F2NA 1MZEA 2XOMA 5FY4A 1QIQA 5CYYA 3S7EA 3USSA 4AEMA 1H0BA 4LBNA 5FZFA 4XHBA 3M3CA 5LRRA 1QNWA 3GJAA 2JDZA 1U5IA 5K9YA 2BNNA 3ALQA 3BOPA 4JV4A 4QQLA 4RSUA 1F15A 3ITQA 4OUSA 1UNBA 1NLRA 2R7EB 2QQIA 2R061 3HVDA 3JUUA 5A3WA 4CDWA 3GZUC 3DF0A 5FP4A 1GUIA 1WA6X 2ARAA 2NZ9A 5BV6A 4YPJA 2QDNA 1HJGA 3FUOA 4LIVA 1RXGA 1ENSA 4L2NA 1DQ2A 2DFCA 3MW2A 5BNPC 3UJQA 2O8QA 4ONUA 5HXMA 2E32A 1YJKA 1YNAA 1XRUA 2JKBA 3S5QA 1ONAA 2I45A 1DYPA 2VY0A 4RGGA 4IETA 5JVVA 1JZ5A 3M8LA 1YC61 1KJRA 2WT1A 5FZDA 1WCUA 3MFAA 3SCGA 1G86A 3WP3A 4HSJA 4I3GA 5AVPA 1L7RA 3OPWA 4QDSA 2HYXA 4P9XA 4V2VA 4R9DA 1H30A 1RJ7A 2JDPA 2X05A 2VNOA 3CJIB 2AUYA 2D44A 3LA3A 1J3PA 2ZA9A 3A4UA 4K3UA 5DDJ1 3UV9A 1VALA 5FPAA 4DXSA 1FATA 1RITA 1QWRA 1W0PA 3A22A 3B02A 5T3NA 1PZ9A 1PZ8A 1FPN2 1W8HA 1D7PM 2QQNA 3I2FA 5DG1A 3S7IA 3OD0A 2IWGB 4M3CF 1QJU2 3HR9A 4I2OA 2WN2A 1H4HA 3POWA 3THTA 5C6CA 3IAPA 5FPVA 2VUAA 3ZXDA 5A3UA 4LO4B 2VQUA 5BNNC 4CYDA 1CX1A 3AP5A 1HXS1 4H7MA 4AI9A 1T6GC 4SLIA 5FYHA 1AR72 5T55A 1BVP1 3OPZA 1VRBA 4MZUA 1UMZA 3WR0A 2CY6A 5FXXA 1ALYA 4XF3A 4MV2A 1RHI2 3WOGA 4TWTA 4DQAA 4X6QB 2QNKA 4BHPA 4C0BA 2KXLA 3MPPG 2ZEZA 4CRQA 3VBOB 3H8OA 1Y4WA 4AXOA 2EAAA 4QGMA 3NO8A 4IV1B 2WIIB 1CAWB 1C8M2 4XXPA 2R16A 3AX4A 4AGVA 1OT5A 2JECA 1V6IA 5B4NA 3F95A 3Q8AA 1Y7BA 3U4XA 1U5YA 2ZGUA 3WG4A 3RJRA 4BQ5A 3PUIA 5EV7A 5FLIA 2XQRA 1KEXA 2O1QA 4Y1YA 4AFAA 2ZACA 4XF4A 4FQ4A 3A21A 3SMHA 2HWF3 3ENRA 3KZ4C 4NMIA 1LOBA 4CCEA 4UYBA 3W59A 2AREA 5KHGA 3EYPA 3D0JA 1C3HA 3ACFA 3KM5A 4YVWA 3PJYA 5FBJA 2PTMA 3U0ZA 1F8VA 4N9IA 4RR3A 4NIDA 3O12A 3JXSA 2RDQA 5FZ3A 4Q4W2 2Z2SB 2C24A 2BGCA 3ACGA 4CDXA 1H8TC 2E6VA 3FC0A 4LPLA 1YFWA 1V6JA 3VBHA 3VBFA 4JRLA 1C5HA 3BVCA 4KWLA 4LUKA 4RYDA 5LB6A 1VIWB 1EAH1 2ZJCA 1ZA4A 1Q3EA 1LNSA 2WJSA 2XGXA 4JGZA 5IVBA 4CEYA 1Q8PA 1UU4A 2PLV1 2DTWA 1R081 2RM21 2XL9A 3AMPA 3THDA 3Q8FA 4RHV1 3TB0A 1RYYA 2Q8CA 5GLUA 2HEYF 3CZUA 4CUCA 4FXGB 2P3JA 4EN0A 4LO7A 4XCBA 1H1AA 2CL2A 5JLVA 2H0VA 2WLQA 4LORA 3VZJA 2WZR1 1NE4A 3I2JA 1DF0A 1QOTA 4N53B 5FV3A 3MW3A 2WNUA 4PBPA 4M01A 4AEKA 1UOJA 2QZ2A 4JDMA 5JMOA 3DV8A 2P5BA 1XSRA 1WLCA 2ARBA 4Q4X2 2IFRA 3ACHA 5FZLA 1PGSA 4Y24A 1F5JA 1YQCA 3OG2A 1AR83 4AQSA 1J1LA 4HKLA 3N9QA 4XVHA 5FOJB 4FPOB 2HWD3 1YYNA 5JOWA 3ZN5A 4IDZA 2O14A 4HVOA 4FFGA 1RVF2 2DU1A 2UWCA 5JXJA 4Z1VA 4RR3B 4OI2A 4TXWA 2A3XA 1YCIA 3O0XA 3V0BA 3POBA 2A6XA 4CDXB 1GZCA 2DU0A 5EJ1B 1YLLA 3VV1A 1UPIA 1LGNA 3VBHB 2HWB2 2X8KA 1UZWA 3VBFB 3LB9A 2JDKA 3ZFFC 1OHFA 1PO23 1K5JA 1ULPA 2VNGA 5JIAA 4CCNA 4ZZ5A 3CNAA 4IV3C 4CEYB 5HV4A 3P3NA 1O3TA 1LHWA 3AZWA 1JZ6A 5J37A 2WAAA 1JYXA 4MOAA 2JD4A 4NHLA 1W8ZA 3BU7A 4JGYC 4E2GA 5LY2A 3K77A 5FWJA 1YQ2A 2JG9C 2P3KA 2ZX1A 4YVSA 5A33A 5F6LB 4ASMB 2JG8C 4CXWA 4QHZA 1AR93 3FBMA 4NJ4A 1MQTA 4PBOA 4DRVA 4ZU4A 4COUA 3E6BA 3NWKA 1X33A 4XJWA 1R1A3 3O1VA 1ZRCA 4Q0VA 1VBB2 4ZS2A 2VCMA 3OGRA 4FI9A 4CP9A 2ZZJA 3FHAA 2PAEA 2XG3A 1IKPA 5JPMB 4QQOA 2XJTA 1MS4A 5B4XA 1QXPA 5LA1A 4WM7A 3MIBA 4AQ6A 2X5IC 3VD5A 5JZGC 3BU0A 1UAIA 1JW6A 4YM1A 5FZ7A 2W52A 4HVQA 4JQTA 2V73A 1RUI2 4NIAA 5C5UA 4OVEA 2W0XA 1OPMA 2GC2A 4H2AA 2D6OX 1VMHA 1XNBA 1WMFA 1YFYA 3GNEA 1OPOA 1YXWA 3R4UA 4GH4C 1HRI3 1K5MA 2GAUA 5DMYA 3RYRA 1HN1A 1OI6A 3FHIB 5FRAA 3UJOA 3DPRA 2WS93 4DB5A 1PO11 1AX1A 2PQSA 4KG8A 1LCLA 5FZ1A 4D6RA 3KGZA 2WWJA 4H7LA 5FK7A 3WG2A 5JPNB 4XE9A 3TYJA 5BNQA 3MLLA 1H6XA 1UYYA 4NROA 5L7OB 4EZHA 4AI0A 1CAVA 3OUHA 2WWUA 4NIHA 4MXWA 2WT2A 3MF6A 3HNMA 2HWE2 1PGL2 4P9WA 3TNQA 2DBIA 5GLVA 5A3TA 4K21A 1K3IA 4FTEA 4FSJA 4P9YA 1ZRRA 3UL2A 5DUVA 3VBRA 1W6QA 1DGWX 3JCIA 1O3RA 2Z5WA 5LA9A 4BIOA 4EQVA 1YHFA 3VBSC 4LO5B 4QXCA 3BTXA 5LWBA 1AVBA 3ZR5A 1UYZA 4JVAA 4N90A 2PELA 3APBA 1AXZA 2WDBA 3H50A 1AYM1 2A6WA 3EQEA 4NHKA 4YGDA 1XPWA 1ODNA 2BGOA 4NPRA 4A7KA 4ZHNA 4XJAA 5JOYA 3J7LA 1QNYA 1G9FA 1UZYA 2ZX2A 5IK7A 3AYEA 5FXZA 1YJLA 3M4FA 4QAWA 3DN7A 3ZXKA 4PDWC 4XFIA 2VD7A 4Y26A 4RS5C 3ZPOA 1YIFA 1H4GA 1RL3A 2W08A 1SBEA 3DXUA 1YWKA 4XZUG 5A6XA 1JUIA 4E8CA 5BYNA 4NN0A 2ES3A 2QQWA 1V6MA 4IE5A 1RINA 3PU3A 2BRTA 1D4VB 2YU2A 2XVKA 1ND2B 5FZ4A 1JZ8A 3BKZA 3RZMA 2VQ0A 3KT1A 2GNBA 3MIHA 4BQ3A 1EP0A 4CXYA 1UX7A 4XDQA 2W3JA 4CCCA 4L0PA 4QXBA 4ORFA 1POV1 5JI7A 1OLMA 1RMU3 5C9AB 4LBKA 2OUJA 4LA2A 3FJSA 3IKWA 5CB7A 4BXSV 2YY1A 1JU3A 4BQ4A 5A7SA 3JD71 1Y9GA 3GZAA 2CSGA 4Y1VA 1W6MA 1BVVA 1COV1 4Y22A 4A7YA 4K20A 4MXWB 2AEYA 3LCPA 1V70A 5C8CA 2D3RA 3LEGA 3BTZA 2PHFA 1GV9A 3CLPA 3I3QA 2VZUA 1W6QB 3B9CA 3OCPA 4AVTA 2FBEA 4LBJA 5I93A 4IEYA 1RUF1 3RZHA 4UBGA 4QKNA 3TRSB 4Y4RA 4IGPA 4HN1A 3T1LA 4D7SA 1W03A 4GAZA 1PM7A 1ZZCA 1XYPA 4Q1RA 4H3WA 3Q8CA 2HWC3 4YRDA 2D6NA 2W87A 1QJFA 4DEVA 1MS0A 4S2HA 1BHGA 2IXHA 5JXIA 4IUGA 5IW0A 3ZR6A 4LBLA 1YI7A 4QHBA 5GZEA 5LW9A 5DAXA 4BYYA 2YBPA 3NV2A 2BERA 2Y33A 3PVEA 2VE1A 1C4RA 1P8JA 1TMF3 2YGMA 2WO1A 2WNVC 3BODA 3DCQA 1V9U3 1S2BA 4DZGA 1CWPA 4XC9A 1AR82 1TQ5A 1CVNA 2YPJA 3O7OA 4CSWA 3WDWA 3ZIXA 2HWD2 4W6WA 4LKEA 3D5OA 4TSVA 3GGLA 2D98A 5F3IA 2LROA 5CIRA 1OQDA 5FTTC 3LOBA 1H1IA 1RUJ1 5LEKA 3T0BA 3DKQA 3ZKUA 5K7PA 4HETA 1CJDA 3FLPA 3U78A 1O3SA 5DN2A 1UX6A 4DXTA 1S0IA 4WVWA 3USUB 3PTYA 2VXRA 4AEDB 2VOTA 4JTNA 4H14A 1RUC3 1E5RA 2Q1ZB 4A6SA 4FPFA 1GNZA 2JB4A 4LLFA 3T2OA 1PO22 2G19A 3MDPA 1VRH3 4IEXA 1W9WA 3IPVA 3ZX7A 3DL3A 1VMFA 1W06A 2ZGRA 1WD3A 4Y1ZA 1LECA 2WNOA 1Q8QA 3TBDA 5KHJA 1XXNA 4LOSA 4AQTA 1IGOA 4QGLA 2Y6JA 2OA2A 4DXZA 1Y9MA 3IB3A 1AR92 4FP3A 2BJSA 4FOWA 2YZ4A 5HPOA 3J8F3 2YC0A 2VNVA 1QJX3 3HEIA 1PIV1 4OMCA 5FMOL 1PMIA 1US2A 1Z7S1 2ZX3A 4L92A 4Q4Y1 1G7YA 5FLJA 1UOGA 5IWFA 4S2DA 4XTMA 4F83A 5DZGA 1RUD2 2ARCA 4CEWA 4Z2AA 1NCQB 2ZMLA 3CIHA 4OUMA 1OVPA 2XKPA 4QPWA 1UL9A 1PVC1 1WCQA 2B42B 1W04A 1CZTA 1X50A 5E88A 3E5QA 3EXUA 4G3YC 4TYSA 2GC3A 1L7QA 1YQ5A 3AKTA 1S1AA 4XACA 1ZBA3 4HBNA 4AVSA 4IL7A 5A7NA 2JDMA 3IM0A 1G6NA 5CNAA 3O1RA 2P3IA 4RFRB 1KQRA 4XJUA 2ZPXA 3UT0A 3RZLA 2DYCA 2K2SA 3WQBA 2LUWA 2QQLA 1HRI2 2DWRA 4INDA 3KT7A 4IERA 2VGDA 2GMEA 4QPGA 1JU4A 1OD5A 3RDIA 3I2IA 1QMJA 3IBMA 5CKQA 3SLIA 1W8FA 3ZOIA 2XJQA 1IG0A 1ENXA 2VTFA 3FUQA 4UFKA 1W8TA 3VKNA 1QF3A 3AK0A 4LTAA 4PT6A 1MEC1 4LHKA 1FX5A 1FV2A 4YGEA 1PGW1 4Y5TA 5GALA 4FFFA 5DUWA 1S0DA 3ZSKA 3KQ4B 4JDOA 2PAMA 2RMU2 3AVSA 4LHNA 4OHXA 5HXVA 1CAUA 2CV6A 4AHWA 1RUE3 2PXJA 4LIUA 2QUOA 2RS53 1DIWA 4IQPA 4R4ZA 4QB2A 2ZMKA 4QHOA 3VDDC 1LTEA 4CZSA 3VUOA 3KHBA 1NT0A 2ZAHA 1Q5OA 4XYXA 4NR1A 2QJVA 1FOD1 4EWDA 5D21A 4Y5Z0 2I2SA 3NMBA 3ZSMA 2A3WA 3RYPA 1RUH2 4RFT0 1J1TA 2B46X 3VHNA 3RVHA 2UU8A 1OLRA 3JQWA 4QX3A 2VZ3A 1VBD3 2LTNA 1IKQA 3SXWA 2JDHA 1VBC3 2IXCA 2DVAA 2EAKA 3BGAA 2Q5TA 3R6SA 3OY8A 4DIQA 1MVQA 3C8XA 2PHDA 2Y0IA 2EF6A 4XXAA 3S30A 5IJRA 1DYKA 5D8AC 5KXBA 4KBZA 3ZXEA 4DRRA 2RS11 1ZRDA 2NPIA 1D4M3 3N7LA 2V5DA 3FFQA 2SLIA 4XAEA 2G9GA 1W2OA 4E4DX 1W90A 1I1EA 4URAA 1UZZA 2G1MA 5DPNA 2W91A 3M2MA 1JTZX 1W2TA 2XJPA 4YZ4A 1IG3A 5CFDA 4YVWC 5FIXA 3R4DB 4PF1A 1IZ3A 2DCJA 4R52A 3V0AB 4HVRA 4YM2A 4GQ7A 1J59A 1JBCA 2HYKA 4BISA 3NAPA 4XJ8A 1WWYA 5B2GB 2GMMA 3WDTA 2VO5A 1SLLA 3LPFA 4Y33A 1GZTA 4CUGA 1RB8G 2K0GA 1GP4A 1J3RA 1NA1A 2YMZA 2C5DA 2Z4FA 3N9PA 4IV3B 2JKXA 4CPBA 3H8RA 2Z79A 1C1LA 5FR3A 4DO0A 2VECA 4UFIA 4B8EA 2QDRA 1H6YA 4NHYA 1H9PA 4HANA 4Q0UA 2D5FA 3CBNA 4JQRA 3BCWA 3AP7A 5EHDA 3PL0A 4DUVA 1R092 3AMHA 2ZBJA 3WDXA 2BU9A 2XJUA 5CA6A 4GB33 4KQ7A 1RIRA 1EV11 2D6LX 4CCMA 2R32A 3N9OA 1UY1A 3NL1A 3C7OA 3VB9A 2DTYA 1OSGA 1V9U2 2EALA 2FMDA 2JD9A 4E2QA 4MVTA 1X8MA 4XDOA 4KU7A 5JXGA 2GC0A 2WNUC 4HPKA 4NRPA 3KT4A 4U36A 3OBRA 4QPYA 4Q29A 2Z69A 5J98B 4D7YA 3BIWE 2G9ZA 3WNMA 3LQCA 4XBLA 2XVGA 4LBQA 2V5YA 2JIGA 2X5IB 4AI1A 2B7YA 1GQGA 2RS33 1SBDA 1Q8SA 3H1YA 2XH6A 4P9JA 4XETA 1ND3A 5FUPA 4CDUC 2XHKA 4I30A 3LDBA 4I0WB 4QXHA 4AFBA 4G4FA 1B35A 4XBQA 1QH6A 4LO6B 1WBLA 4HFSA 2W1UA 4QPIB 2E63A 1RUC2 3KV9A 4GH4B 3LDKA 1QJU1 3HIFA 3SNMA 5A32A 1MZ6A 1VRH2 2VW1A 2WSUA 5FKBA 1W28A 3MIGA 2FD8A 1OF3A 3LE0A 2MPFA 4QX7A 2XWBB 3D8CA 3ETPA 3PU8A 4NRMA 2RE9A 3ZKYA 1NA1B 4LK7A 2K46A 1VB2A 4LEJA 2BGPA 1QQP3 2VXJA 1XE7A 1MACA 1PMJX 4GWNA 4COYA 1UU6A 1QHDA 2YGLA 3UETA 5F5CA 4CU9A 3S5AA 2IXJA 3AFGA 3KGLA 3DYOA 2P6HA 3J8F2 3N7JA 4FPGA 5EXOA 3MZHA 1UD1A 5KXEA 1E5IA 1WW6A 2VCCA 1UOFA 3ILFA 2FDHA 3C7FA 1AL23 4RQPC 2VOVA 2YU1A 1OURA 1ZBE2 2JEMA 1YUDA 3LAGA 1C57A 1WMEA 2GSYA 4YVSC 4XPVA 5FZAA 1MQTC 1WLWA 3WINE 4DMIA 3BOWA 3VD4A 2EIEA 2VBPA 5I0RA 1C8M1 1V00A 1QJEA 1LEDA 4XABA 3VZLA 1HW5A 2VZ1A 5L9RA 2IFWA 1WMDA 3OGJA 1GLHA 2R063 2IUWA 2FMYA 5KWRA 2W94A 1AYN2 3I3BA 5CFCC 3OJBA 1JYCA 1MZFA 1BKZA 1WZXA 2WKKA 4WM7C 3ZLIA 4TN7A 3M1HA 5IK8A 3CJIA 2JIJA 4RS5B 1XYOA 4QKBA 2R6QA 4OULA 5IVYA 1X7NA 3IZOA 3MW4A 4IEUA 3A23A 4EWAA 3O1UA 3PIJA 4RGAA 2J1AA 1GANA 2ARXA 2RDSA 1Q43A 3HNBM 2QKDA 5HI0A 4NIGA 4EROA 5EJZB 1A8MA 1K5MC 4QX2A 1QXJA 3WNOA 2B8MA 3DPRC 4XDPA 1H2MA 1LOFA 2J7MA 3HOBA 1FAYA 1DZQA 2WO2A 3KV6A 4K8RB 2W47A 4K1ZA 5DDJ3 3ZVXA 1W8OA 4DY3A 2ZHNA 2D97A 2Q1MA 2ORZA 4HL0A 3SH4A 1PK6A 1OUSA 1JHNA 3LFMA 3WUCA 4AG4A 4XUTA 3KHCA 4BCUA 1RUE2 4WM8B 2RS52 3ECQA 4UFJA 1IPKA 1W8UA 1W6PB 2FCUA 5A1FA 5IT6A 4EN9B 1JYWA 1T6BX 2PAKA 4FPCA 5L73A 2E9QA 1QJY1 4E9KA 3VZMA 4BLIA 1W3XA 3RZJA 1REDA 4K40A 1LHUA 1ZZ8A 2D3PA 3NV3A 4L8QA 2SBAA 1HXS3 3VBRC 3VBOA 3AJYA 3WP5A 5IVJA 5C3PA 3RRDA 4Q5OA 3QCWA 4M3CB 4IV1A 3WF2A 1CAWA 2VZRA 4PI0A 3ZYFA 1G8WA 4CE8A 1VBC2 3GALA 2WR9A 4J1XA 4HZFA 4BU2A 4CUAA 2BWAA 3CDZB 3GJBA 3I59B 2BZDA 4TLFA 5FZKA 1XE0A 5L36A 1I3HA 1V6KA 4ARYA 3HBKA 1SCRA 3MV11 3SKVA 3UK9A 1RVF1 4ZPIA 3WF0A 5LA0A 1ULGA 2D7FA 3GBGA 1KS5A 1DQ1A 3EHKA 4YW6A 3OPTA 1ODMA 5GZFA 2W46A 2QVSB 5GM0A 3I2GA 3H0OA 4ET7A 1MS8A 4QQPA 2OVUA 2XL7A 1S0GA 3ZFGB 3ELNA 5IVCA 5T5OA 4FT8A 4MADA 4FVVA 4AI8A 4N43B 2D3SA 2HWB1 2BDRA 1A34A 3M3QA 3HQRA 1KITA 3KVAA 4BB3A 5JSPA 5KR7A 1JZ4A 1JOBA 2PHLA 2V4AA 4FPJA 1W39A 1PK6B 4KWJA 2HKXA 5GJ6A 3OGSA 3W58A 2RG4A 4Y4YA 1NYWA 5AC92 5FPXA 4PLNA 1NQDA 2ATFA 2D40A 3AJZA 3POIA 1BCXA 3CHXA 3GXUA 2GP5A 4W6XA 3WX5A 3ZIWA 5FY1A 2BVBA 2CAVA 5EPAA 4Y5SA 4ZU7A 5CAZA 5A7OA 5AFBA 2AH2A 4E27A 1ACCA 5FJKA 1NUKA 3N9NA 5D2AA 1G9AA 2OPKA 3U37A 1WMXA 2QFEA 4GB32 2WRAA 4W8JA 3T0DA 3RFRA 3UKNA 1G9CA 5K0UC 1EAH3 1VAVA 1MS1A 4N53A 4QU1A 1VBB1 2A1XA 2PHUA 4XQDA 3ZSJA 4BXFA 2NM1A 1VBE1 3M3IA 3LPGA 5CVRA 5C4WB 1KD7A 1R083 2RM23 3SH5A 4I3PA 2J1UA 2XUEA 4FPYA 5IVFA 1LR5A 2P4EA 1W99A 4UAPA 2IZWA 3LSDA 3HQUA 5C70A 2WZR3 2JDYA 1RUI1 3GZEA 1OMIA 5FMDA 1BBT3 1H1MA 2CWSA 1XJAA 2D93A 4YYOA 4PQ9A 4CCJA 5A3LA 2K9ZA 3JU9A 1TME3 1IHMA 2NP0A 3QH6A 2XLGA 2Y38A 5HBAA 2D6PA 2GC1A 3HN3A 2WQ4A 5J36A 4BLJA 1OOPB 1HRV1 5BNOB 1LHNA 1BMV1 1SMVA 2ZCWA 2EXKA 5DXDA 1W6OB 1DQ0A 4M3CE 4R9AA 4GXLA 5F5QA 1ZZ7A 3D82A 4FXKB 2B39A 1ZRFA 4Z92B 3UGFA 1CPNA 3ZXGA 4Q0QA 4YW5A 2XONA 1PGL1 2HWE1 4XFBA 2E51A 1YQ6A 4CDQA 1W6NB 1OUXA 4KGQA 1ZVFA 4XOGA 5C3OA 3KV4A 4AAXA 3LEMA 5FYIA 1I9RA 4ATEA 4OHVA 3E97A 4QM8A 1GOHA 2ZHMA 1NCRC 3LKJA 3MIFA 3ON7A 1JOJA 1N1VA 4Y20B 1RUOA 4LK6A 2Y6LA 5A6ZA 4IW3A 3WD5A 4HKOA 1NOVA 2ZMNA 4CVUA 1IPJA 3K4ZA 4GJZA 4PHZA 4DPNA 3WNPA 4CEWC 4K7JA 4JHZA 3ZYGA 4FAHA 4P9LA 1F9KA 2V4VA 4IEZA 3OD4A 4XHXA 1DGLA 3AC0A 3NV1A 3X29B 3AP9A 2CDOA 1GR3A 1LODA 4GWJA 2A70A 2IXKA 4JHTA 1S0FA 1BEV2 2R041 3K4DA 5JCTA 5IAXA 1GKBA 3AL5A 3MLKA 2Y26A 4CU7A 2GN7A 5EQUA 5K8SA 3LFIA 1JMUB 2EXIA 2OQ7A 4O7XA 5IUQA 4AL9A 1R64A 3J7HA 1TVGA 3SKJE 2NMNA 4OHYA 5T5JA 2DUPA 2HBTA 4O65A 3ZFEB 3DKWA 4P9GA 1OKOA 3ORJA 2VUDA 1W0OA 1JH5A 1XNKA 2J1EA 5FZGA 1D2QA 1DLCA 1TEIA 2DUOA 4IEPA 2BTVC 3WQ7A 1Z0HA 5F32A 3UGGA 4ISRA 5DDJ2 3TNPB 2R49A 1KDMA 4L9BA 3BPZA 3VHOA 3MFCA 5ABJB 5IFTA 1CGPA 4UWDA 2YV8A 5FYTA 1OBNA 4D3WA 3ATGA 3I2OA 4BPZA 3MYXA 2XB6C 4CDQB 3NNFA 5L7OA 1O8PA 3ZN4A 4MG2A 4B7KA 1OVSA 1LB2A 1PO13 4XJZA 5DG2A 1C1FA 1STMA 1XU2A 1BZWA 2HH9A 5F8PA 3THPA 3THCA 4Q4V1 5JOZA 3NJZA 1ULDA 3AYDA 4TZDA 4CCLA 1O7FA 5HCBA 5FO9B 4YGBA 4C8DA 5ACA1 1XU1A 3U4SA 4BQWA 4O9GA 4XF9A 5GZCA 2TEPA 1MZ5A 4FCAA 5DUXA 1NLQA 4UFHA 5EZWA 1MR5A 2PHXA 4QX0A 2VVFA 3B94A 2RDRA 1W0NA 4MYEA 1U12A 4AW7A 4HKWA 1SG3A 3QLQA 1AR81 4NO4A 4F3JA 2ZXQA 3H3LA 3MHZA 2I07B 4X8PA 4META 1WA4A 2Y8KA 4OI4A 5F37A 1AYM3 1AR61 4KL1A 3P5BA 4YFZA 2R071 4AHYA 4M4PA 1T2XA 5A70A 3KLSA 1ULOA 3NW4A 1ND2A 4R9BA 5FMOS 3SEPA 2JENA 2VTXA 2P3YA 2XBO1 2FDKA 3OGGA 4CDUB 1GYKA 1H9WA 1SLIA 2XXZA 3AMMA 5FXVA 5C9AA 4XUPA 3K4AA 3OUIA 4PIYA 4XMIA 4MXVA 5KHIA 4GALA 4OI1A 2QE3A 3PVBB 4DS0A 5FP9A 4I09A 3L2HA 3WXPA 1NAEA 2Y6FA 4LULA 2RJKA 2E7TA 5I91A 3R0RA 5G04L 4XBNA 4YW3A 4Q0SA 4YZ2A 2OPWA 3SCFA 1NXMA 4AHXA 1K12A 1POV3 4AVAA 4NWVA 2GH2A 4YARA 1UXXX 3OF1A 1Y3TA 5LY1A 3MIDA 3KV5A 4Q2FA 1IS6A 4LA3A 4BJ0A 4AHZA 5A3NA 4P08A 1COV3 1ZX5A 1XNAA 3VHRA 1EAH2 1RUD1 1IS3A 1HB4A 3VZKA 2RV9A 2YPDA 4XURA 4PI2A 2RM22 1SFNA 3AKPA 5FYCA 3NV4A 4HXCA 3CF6E 1H2NA 3VBUB 2C6SA 1SEFA 3TEXA 2LS6A 5T54A 2XJRA 3AVRA 3NVCA 1C5IA 5CZKA 3OEBA 4FOVA 4QKDA 4DUXA 1CPMA 1UOBA 3HBZA 2HWF2 1TG7A 2X10A 1OFSA 4W50A 1RTVA 3ILRA 4SBVA 1IQDC 4GWIA 1BBT2 5C8WA 3H8UA 2VOWA 3M70A 2W39A 1TME2 4XF0A 4LKSA 2PHRA 3B01A 3VL9A 5HCAA 2F4PA 4NUBA 2E26A 1JUHA 2VMGA 2WABA 2QCSB 4P9IA 1ND3C 3AKSA 3USUA 5A1LA 1W9FA 1JZ3A 2CGPA 2BVVA 1KGYA 4GMP1 3ZDSA 4AEDA 5C7GA 4OQ8A 3NQHA 1B35C 4FBFA 5BUVA 5FZ8A 4B4PA 1Q8VA 4A2UA 4BK4A 3ACLA 2B5HA 1RUJ3 3B7MA 5FZBA 5FZEA 5FDBA 2BFUL 4IGOA 4LE4A 4UFLA 4LBOA 3ZN6B 3KCYA 1V6OA 4K8FA 3EO6A 3UKVA 1JYVA 2RMU1 1GP5A 3L2YA 2DBNA 4Q27A 1W8NA 5JWPA 3KVBA 4Q8LA 4MLOA 2DVFA 2OKXA 5C3QA 4NOTA 1XNDA 2BP6A 3NNLA 2C9AA 5FBZA 2YUEA 2RR13 4FOYA 1XYNA 2VUJA 4I02A 4ITCA 3BYWA 5FYMA 1NCQA 1ULFA 4MUVA 4MSVA 1E5SA 4A3XA 3WVJA 3PMEA 2ZGSA 4XFAA 1RUH1 4BK5A 1WLDA 5BNPB 1N3OA 3EMRA 4I01A 2C4XA 3BI3A 1H2KA 4LMFA 5LASA 1JXNA 3I49A 1Z7S3 3H42B 4Q4Y3 2W92A 2VBDA 4Y1UA 4OUEA 1JYNA 1JZ2A 2VMFA 3ASIA 2VR4A 3RPQA 1QXRA 3VHPA 2FDJA 3WSOA 3T4VA 4MGTA 1N1TA 2WA3A 2WC2A 5FREA 2UYBA 1PVC3 5A7PA 3WW1A 2XQXA 4XFHA 3ZXLA 3VKFC 5FO8B 1LOCA 1I6XA 3H9AA 2ADEA 3BUCA 3KB5A 3LF7A 1OA4A 1JN2P 2GN3A 5A7WA 2VZVA 3KF5A 4LXLA 4QX8A 4X8NA 5F39A 2W1QA 3WT3A 4NAOA 4BMBA 1EYBA 1OF4A 2EA7A 5FZCA 2LALA 2VQAA 4ASLA 5FK8A 5BNNB 3MPBA 4Q0PA 3HWJA 5CKNA 2VNRA 1MS5A 1W9TA 1S55A 2HBUA 4ZXEA 1DYOA 3HMYA 2WFF3 4E4HA 3ZDVA 3VKOA 2WSVA 3J7MA 5LBFA 2ZKNA 2OT7A 4YGCA 5J7MA 4BDVB 5IK5A 3R4SA 1SDDB 3CO2A 4RD7A 5C3RA 5EIYB 1S4CA 4CU8A 1R1A2 2JE9A 2VH9A 1O4ZA 1R091 1FYUA 1MEC3 3QH7A 3EJKA 4IEOA 2WZ8A 3VKMA 2OZJA 2J22A 3SEEA 4CDWC 1UF2C 4C1XA 4MO3M 2A6VA 4EWEA 2EIGA 1YFXA 2VVEA 1UMHA 5JDBA 2TBVA 1CZVA 1UU5A 3MUY1 2BOJA 2OS2A 3VBOC 1N1SA 2VZTA 3ROUA 3ZXAC 4CUBA 3VGIA 3ZYRA 1UY0A 4R4XA 5FZ9A 1HKDA 3I2KA 5EFUA 1POQA 1MS3A 4IV1C 1BK1A 4AI3A 5LEJA 2IVJA 3WZ1A 4OI0A 4EYUA 1FOD3 1AF9A 1ZM1A 3TAYA 4XMAA 4CU6A 4JKLA 1CIWA 4XTPA 2WS92 1D2SA 1WD4A 3MUZ1 5FLHA 1DGRN 2Q8OA 5A7WB 3I97A 1O6UA 3OGVA 3WHUA 4XFCA 2GNMA 3I3EA 2Y34A 1QJZA 2YYOA 3PURA 1POV0 1OLQA 4QWNA 4ARXA 4FPLA 4RA0A 4RGKA 1HDKA 1DHKB 3AXEA 1VRH1 1QOSA 1FMD1 2BOIA 3V0AA 1H8TB 1U5XA 2RS13 3AZVA 2VL4A 2Y0OA 4GKXA 3T3YA 5EYXA 4N7IA 3NNGA 3T1MA 3POJA 4ZS3A 1YQ8A 5DUUA 2AACA 1GOFA 3ES1A 4U2AA 3ABZA 3WW2A 4IV3A 2P37A 1LULA 1OKQA 5J3UA 1XE8A 2W5FA 3B5LB 3PUSA 4UW6A 3RS6A 5J96B 2WQZC 2DV9A 4JGYA 1HQNA 1COV2 2JWPA 4ATFA 1FNYA 1KJLA 1ZBE1 4UF0B 1WGPA 4LHSA 5SV5A 4C0HA 4UBHA 5DZFA 3DECA 5FWEA 4IE7A 2BYVE 2FCVA 4NPLA 5CEHA 3WCSA 5I0DA 2XPJA 5FUIA 3NRUA 3H8XA 4LE3A 4LQRA 2B4KA 1OXCA 2VU9A 3LA7A 4N53C 2XHNA 4AVVA 1ENQA 1NY71 2DDUA 2ZABA 3KD4A 3EB7A 4UI9L 2UY9A 4YFWA 1X82A 5I0SA 5LA2A 1W2NA 1WLTA 1JYIA 2VCBA 1SACA 1NXD1 1AYN1 2VQTA 1EV13 2X5IA 1UKGA 5F5AA 5F9TA 2CTVA 1HV0A 2F6BA 1XNCA 3N36A 3TN91 5JOXA 3J9SA 2ZGTA 3OBZA 4KWUA 3SHRA 1RMU2 3HNYM 2VBBA 5F3EA 1ASJ1 2OUHA 3VN4A 2P1BA 4QPIA 4E2SA 5AFEA 4GH4A 5JMCA 1HB2A 1I5ZA 3AMQA 1WW4A 4RR3C 1UMIA 4RL7A 5JR2A 2OQ6A 3O1OA 4R8HA 1NG0A 5D1IA 3NJXA 2NN8A 3SC7X 3ZFFB 4LT5A 4HSLA 3B00A 3H1WA 4CDXC 3WP4A 4YG3A 1BK0A 2WYSA 3WW3A 3T30A 3ZMOA 1HN0A 1RUG3 3VBHC 4AR2A 3VBFC 3U11A 3M3OA 2ADDA 5T52A 2A6ZA 2KD7A 1RUE1 2GU9A 4AGRA 2E53A 4JGZC 1QJU3 2RS51 2HWC2 4JGYB 4WVVA 4BZ4A 4CEYC 5IATA 2JG9B 3C7EA 3AKRA 3D4KA 1VBA3 1AJKA 2JG8B 2YXSA 1NX9A 3WHTA 3K46A 3IDAA 4D94A 2ZHLA 1S0JA 2CWMA 2RR12 3AKQA 5FCCA 1FI2A 3IMMA 4N9HA 4CCKA 4ES8A 1OFNA 4XIKA 1TMF2 2E31A 2KR2A 5GLWA 4D6QA 2Y6KA 2DFBA 3QOPA 2W68A 3VD9A 4AVCA 2OZ6A 3FZ3A 4LNVA 1C28A 1WCSA 2VMCA 2ZGKA 2OXBA 3ZXFA 4NAMA 2ZOEB 5LCWL 2XDVA 1Z7S2 4Q4Y2 5JZGB 4MGSA 3RWKX 4WVMB 5E1RA 5FY9A 5DAWA 5A3PA 5M0TA 3FX3A 2ZGLA 2XLFA 5ANNA 1SQ4A 1UIKA 1N1YA 2GNDA 1PVC2 4IE4A 4LR4A 2R1BA 4XUNA 4YG0A 4COWA 2VOXA 1LHOA 1A6CA 4ZZ8A 1DU3D 1C8M3 3JBG3 4RS5A 1FPN1 3KMHA 4XUQA 2YFZA 4CP1A 4D69A 4DY5A 3UGHA 5JIUA 4Y3OA 3F2ZA 4COZA 3L9JT 1VR3A 1CAXB 4QM9A 2ZZQA 3PMSA 1O4YA 4C91A 1AZDA 4CA9A 4AF9A 4GJYA 1AR71 1DLLA 2ET7A 2BW8A 5AC91 2BUKA 1SLAA 3SCHA 1OQ1A 4GA9A 2WLPA 2MEV3 2WFF2 2XKOA 1YRZA 2V72A 4FTSA 3HD8B 5F3CA 5FZ6A 3A0KA 4YM0A 5JI9A 4L97A 4K9SA 1LU2A 1RHI1 1QJX2 2EIDA 2XMLA 4V2WA 4AWDA 2PMWB 1PZ7A 4WM8A 3W5NA 1CZSA 2WYFA 2CGOA 3LEKA 1W6PA 5APAA 5F6KA 2WUHA 2VAUA 3Q8BA 5KXCA 4KNCA 2RDNA 3K3OA 2PYTA 3VBSB 2ZEWA 3W21A 4BM8A 4D6SA 4YZ1A 2ZEXA 4F8AA 4JC1A 1PHMA 4YW1A 2CDPA 2XJSA 5F2WA 3IIAA 4BWOA 1ZBA2 1E5HA 2DUQA 2QQPA 4M3CA 2TNFA 3HAGA 4QD2A 4BQXA 3MV01 1GSLA 4XFFA 1EPZA 2ZGMA 2LRPA 3CZJA 1QJY3 1ST8A 1TZOA 1DCSA 1K42A 1WUVA 1IS4A 3IMNA 1WCKA 4PDWB 5J48A 1FOD2 1UZ0A 1LESA 3I59A 1EUUA 5SV8A 5IYYA 4MHRA 3BN6A 5HCHA 5I0TA 5CBLA 2B9UA 1UQXA 4UW3A 1KXGA 1LKNA 1YO8A 2ENRA 5EP9A 1W3VA 2WWSA 2GALA 4KG0A 1SFYA 2TUNA 4Z8BA 4Q4W1 5J1XA 5BY5A 3QBQA 3ZFGA 2FDGA 1S0BA 3P6BA 1ND2C 3DEMA 2G9FA 1ZNPA 4N43A 5T5PA 4GULA 2R0HA 2RS12 3B93A 1AJOA 2ET1A 1RVF3 1O5UA 2VMDA 2VW0A 1WW5A 2QZ3A 3GHMA 2H6BA 5C9AC 1OH4A 5A1AA 3FN9A 2WZPP 5GLTA 3T2TA 4FFIA 2BWCA 2VULA 3O1PA 3VDAA 3RMXA
chains in the Genus database with same CATH topology
3JB8A 4XJ9A 1PNFA 5FPZA 4AEJA 2HWB3 3H7YA 4WZFA 1U5ZA 2CAUA 1OQEA 5LRSA 4DINB 1FNZA 2XVLA 3UKTA 3MI8A 5TSWA 4QXKA 3AP4A 1ZZ6A 3JB4C 1VBD2 4Q4X1 1KDKA 2EVXA 5C4WA 4B4RA 1APNA 1MVEA 4IEVA 4E4SA 1AL0G 3QACA 2WNVB 4M0NA 1QH7A 3CU7A 4N7UA 2OYZA 2N7GA 4W65A 1KRIA 1EV12 1D4M2 2LM3A 1QU0A 3N7MA 2DURA 1VBB3 1BEV1 1FXZA 1REEA 1VBE3 2IC1A 1Q56A 5GKAC 3GHNA 5I0UA 4KGGA 3WDVA 4F7ZA 1ZYBA 1O5LA 1UCXA 4PIXA 1RUI3 2R1DA 1OOPA 3O14A 1H8VA 2ERFA 4OLLA 5BNOA 3KCXA 1NZCA 4NWWA 1W6OA 3GZTB 4BQ1A 1RUG2 2H6CA 4AEDC 2AYHA 3M3EA 4ZU5A 3AFKA 3FE5A 3DUIA 4B3NA 3MF9A 1U0AA 1DGRA 5C8CC 3ZYJB 4Z07A 1VBA2 4QQHA 1HRV3 1W6NA 1SLCA 2GNTA 5KXDA 4CP2A 2KA3A 2PHWA 1CN1A 2WINB 3MEPA 1QDCA 2PLV3 4Y20A 4I0BA 4RHV3 3VDDA 4XF1A 2P2KA 2HWE3 2JX9A 4CDWB 1LGBA 3FFZA 1BXHA 3ILNA 4FPEA 4LLOA 3FMGA 1NCQC 2E7AA 4BH9A 2RS32 3HT1A 1KFXL 2D6KA 4FQZA 2Z42A 2ZGOA 2X29A 4AK3A 4L11A 3JBG2 1HX6A 5KC5A 2ZGPA 2D6MA 4XIOA 3S0MA 2WA4A 5FO7B 5D8AA 2D43A 3BALA 4WV8A 4E2QA 1S2KA 4MGIE 3I4IA 3ZFEA 3J26N 1Y9QA 3D0SA 3I8TA 2DVGA 1QQP2 1LENA 2IXIA 2R043 1UN1A 3H3ZA 2A6YA 1ULCA 1S0CA 2MEV2 1B09A 1CD3G 5ABJA 3SISA 3ZSEA 1F5FA 2FZ2A 4ES9A 2YDEA 1GFF2 4YG6A 2O0OA 1AL22 2JE7A 4W6YA 3WNXA 4BOWA 3H7JA 1CONA 5I8SA 3OBTA 3RWNA 1WW7A 3RG0A 3VDDB 3QD6A 4B29A 4AFCA 3E6DA 1DZTA 1GQHA 5FFOC 1CESA 2MNGA 4KH9A 2R062 4XILA 4Q4V3 4DFSA 1QJY2 3OYWA 2BFUS 4QT6A 5ACA3 2ZKLA 2HWF1 2Q0AA 3CEWA 2NLRA 1BBT1 4EJRA 2C1FA 5CADA 4BA6A 1TME1 5D8AB 3W9AA 3JZVA 1LOEA 5E8AA 1DG6A 4EN6B 4IESA 2PN5A 4AE2A 1W2UA 4YZ5A 2MHFA 1FV3A 5J09A 2ZX0A 2ZHKA 5AVAA 3WCRA 1VAKA 4QPGC 4NHMA 4CDUA 3IDEA 1REFA 3WLUA 3M7AA 4AFDA 2ZX4A 1G9DA 1DZRA 4MH0E 3PNAA 4YVWB 4Y1XA 2WL1A 1AR63 1YI9A 4IEWA 2R073 1G9BA 4CP0A 3B3QE 3VZNA 3O5SA 4QU2A 1R1ZA 2XBO3 1LGCA 2VW2A 3MLJA 1GZWA 5H9RA 4UXAA 1HXS2 3AB0A 2DCYA 4C1WA 2XWJB 4JGZB 3RMYA 1A78A 3ZYIB 4J6GA 1ZZBA 1V6LA 4YLZA 2JICA 4Q8KA 1EY2A 3WDYA 1L3JA 5KC6A 1YFUA 1GBGA 4FOQA 4RQPA 3VLBB 3AP6A 4Z82A 4QX5A 3OYWB 3WG1A 4HLTA 1UW8A 3VBUA 3WW4A 4AFMA 2ZGNA 3K51A 2WNUB 2HWD1 1D0HA 3RI9A 2BEOA 3TWIA 3LOIA 2BNMA 1RUD3 3IN9A 1DQ6A 4LBMA 1VBE2 4QQ2A 2AENA 3LZZA 5FOBB 4ZKTB 4NVPA 1F31A 2YROA 3AYCA 5CFCA 4S2FA 5CG9A 1PNGA 2HJIA 2FZ1A 1UKRA 1O91A 1X8EA 4Q26A 1PO21 2O8OA 3O0WA 4O9EA 1WBFA 2R0FA 3IDCB 5LK7B 3GYDA 5CFDC 4QPIC 1O4TA 1M4WA 4L99A 3NAPC 3ZN6A 4FP2A 1GZWB 1AR91 1DFQA 2B45X 4LUMA 4GMP3 1HRV2 3I7DA 2C0ZA 1NA1C 1BMV2 3JD73 2VVDA 4WVZA 1R1A1 2GMPA 4FAGA 4XW3A 3RI8A 4HN0A 4RQPB 2PLV2 5A33B 1R082 4YVSB 3EBRA 2ZS6B 4RHV2 3POYA 2RMU3 3V56A 1MQTB 1RUF3 4B7EA 5BNPA 3CJXA 1NLSA 2WZR2 3SITA 3O0VA 4OHZA 2GDFA 5EWSA 2WFPA 2PA7A 2XLAA 1QOOA 1HRI1 5CFCB 3LSEA 4P5HA 3BB6A 4WM7B 5DZEA 2A75A 2WS91 5FQ0A 1RUH3 1RGSA 3ZO0B 2IXLA 2A71A 4H55A 2VOKA 4MGKE 1VJ2A 3N3HA 4X6RB 2R042 4D7TA 1K5MB 4XZPA 2NYYA 3DPRB 2ILMA 2OW4A 3N4MA 2ETEA 5BNNA 4AI2A 1XQNA 4FPHA 3ZSLA 2UY8A 5BPXA 1O3QA 3HT2A 4A7ZA 2I74A 3N7KA 2WT0A 1LOGA 4WZCA 5CG8A 1H2LA 1LRHA 2NMOA 1VAMA 1CAVB 1YIPA 1AUYA 3WP6A 3Q9OA 3PVNA 4WM8C 4FTBA 3MICA 4QGNA 2A73B 2HEWF 3VBRB 1TNFA 2VMIA 1CJPA 3H1MA 4Q4V2 4DNYA 1PIV3 5K0UA 3NSTA 1PVXA 4PIZA 4KBBA 5ACA2 3PLQA 3ES4A 4XEZA 5F1RA 1N47A 1R093 2CNAA 3GBFA 2RJLA 5FQ0B 3AMNA 1LEMA 1VP6A 3HN1A 1QGLA 3P3PA 2Q4SA 1IS5A 4BIFA 3CJIC 1OA2A 5KHKA 1RMU1 2EXJA 3ZXJA 1C8NA 2VMHA 2A7AA 3D6EA 4PLMA 1AR62 2VPVA 1LOAA 2R072 5BXXA 1H8TA 3ZFGC 3RSJA 1LOFC 1PO12 1HV1A 1AHSA 2XBO2 4N43C 1SLBA 3U10A 1J3QA 3AZYA 4GWMA 1HQLA 3WY6A 3N35A 3KS7A 4UW4A 1PK6C 4JTOA 5I8TA 1W6MB 2HWC1 2ZTNA 4Y22B 1Z78A 1RC6A 2WNEA 5L19A 5C8CB 1FMD3 4YW2A 4FPKA 4YNIA 4YZ3A 4PLOA 5KBFA 4PCRA 2BQPA 5JSOA 3IDBB 2CYFA 1AXYA 2RR11 5EYYA 1SLTA 3B9IA 3LA2A 2DVDA 4XQ4A 1TMF1 3PHMA 4JCKA 1V9U1 5K0UB 1NCRA 2EXHA 4QMAA 1ZZ9A 1E57A 3V64A 1X36A 1Y43B 4COVA 2AR6A 4AQ2A 1VLNA 3AZXA 1AYM2 4BE3A 4S2GA 5C4WC 1ZBE3 4J1WA 3A0NA 5IK4A 3RNSA 2V09A 1D0GA 3WG3A 3S6PA 1RUC1 2G4IA 3IWZA 4JAAA 1BJQA 3J4UH 4HMZA 4AGGA 3AZZA 3FLRA 2AZ5A 4GMP0 3WQ1A 4ZXKA 3RZZA 3GBWA 3INAA 1AYN3 5H9SA 4FO9A 3SH3A 2HEVF 3ZFFA 1AXKA 4KU8A 4DOUA 3TN93 1S0EA 4OHWA 5JAXA 1OOPC 3V65A 2WFF1 5BNOC 1RJ8A 3E6CC 1ASJ3 2GH8A 3J8F1 3IPVB 1QJX1 4K6BA 3JD72 5I8YA 3WV6A 2JG9A 3DGTA 4YM3A 2PFWA 1QY4A 2JG8A 4P14A 4EV0A 4PJYA 2BPA2 1DQ5A 1N3QA 3NKGA 1NCRB 1RUF2 1UPSA 3C3VA 4KWKA 2JJ6A 2P17A 3TOJA 4MGYE 1DDLA 2PQQA 5E89A 4AVBA 1ZBA1 4YSFA 1DGWA 1FT9A 2A5ZA 2XJVA 3PVOA 4CEWB 4CTEA 1V6NA 2XUMA 1ENRA 2BNOA 5JZGA 5H9QA 4GIQA 4WVMA 1ULEA 2OIIA 1IOAA 2DVBA 1CR7A 4M00A 3C2UA 1GNHA 3AYAA 1A3KA 4Z2WA 1AX0A 2DCTA 1RUJ2 2BBVA 1CAXA 2UURA 3GF6A 3PJQA 4QPGB 1MS9A 1OA3A 3RYKA 3OTFA 1QDOA 3ZFEC 4I0AA 1FPN3 1AX2A 4LBQD 3MGUA 1DQ4A 1J58A 2RHPA 3ME2A 3HQXA 4G9SB 4C90A 5ABJC 4V1PA 3ETQA 2P34A 2X53S 4CDQC 1SDWA 2CGNA 5GLZA 1GICA 1CQ9A 2DCKA 1AR73 4AYUA 5AC93 3G7DA 3VBSA 1CAUB 3IT8A 3MIEA 3I54A 1QKQA 1VB4A 1TNRA 3VKLA 3WQ0A 4BMEA 2R30A 1VBD1 2E7QA 1RHI3 1PIV2 3JQXA 1VBC1 3ZYPA 2UYAA 4XFGA 3U07A 1BQPA 5JSRA 1SBFA 1D4M1 4PDWA 4LO8A 4OFGA 1IQAA 3ZPYA 3KCCA 2FQPA 3WDUA 3ZMNA 1HQWA 4XQWA 3NKTA 4EN7B 1ZREA 2NQYA 5CU1A 3URFA 4WBBA 3RQ0A 3OY8B 4IXLA 1NE6A 1HIXA 5T5LA 2UWBA 1SCSA 3BTAA 3I2DA 3KSCA 4ISQA 2A3YA 3B69A 1RUG1 4EN8B 3E5UA 3ST7A 5CFDB 2AGSA 2ZAAA 3LGRA 2H0BA 1LU1A 4Q4W3 3AXDA 3NAPB 5L7OC 1BYHA 2D5HA 2ZGQA 5FAXA 1VBA1 1MEC2 3CL1A 1FMD2 2VG9A 1N3PA 1PGW2 4GB31 3AM2A 1GZ9A 1EPWA 2Q30A 4MGZE 1WCDJ 3H3UA 5JR7B 2PHTA 4MX3A 4E4ZA 3KQRA 5H9PA 5E16A 2GZWA 4LHLA 1HLCA 3R05A 1DBNA 5C33A 2FHRA 2WNVA 3VZOA 2RS31 5T50A 2JXAA 4HK9A 1A8DA 3POSA 4HT1T 3VBUC 5LK5A 3LWCA 3FBYA 3V0BB 1LHVA 4HPKB 4R9CA 2DF7A 4Q1PA 4GKYA 3JBG1 4Q4X3 4B4QA 5A3MA 1RUNA 4M0HA 3VL8A 1NY72 4LBQB 4JDNA 3RJ2X 1Q8OA 5EJ3A 4YW4A 4JRAA 4K1YA 1ND3B 4UW5A 4PF5A 5KHHA 4URTA 3K48A 1B35B 1QQP1 2UWAA 1BEV3 1LJ7A 1NQJA 4IEQA 1KFUL 3TN92 1M06G 2MEV1 5GZDA 1TE1B 1UIJA 1URXA 3FLTA 1ASJ2 3E5XA 5A32B 3FWEA 2YHJA 4OZXA 4HK8A 2DCZA 1KS4A 1CX4A 2KM2A 1AL21 5HCFA 3G6JB 3WUDA 5GZGA 1F2NA 1MZEA 3USSA 3S7EA 4AEMA 1H0BA 4LBNA 4XHBA 3M3CA 5LRRA 1QNWA 2JDZA 1U5IA 5K9YA 2BNNA 3ALQA 3BOPA 4JV4A 4QQLA 4RSUA 4OUSA 1NLRA 4CDWA 2R061 3JUUA 3GZUC 3DF0A 2NZ9A 5BV6A 2QDNA 3FUOA 1ENSA 4L2NA 1DQ2A 2DFCA 3MW2A 5BNPC 3UJQA 2O8QA 4ONUA 1YJKA 1YNAA 1XRUA 2JKBA 1ONAA 2I45A 1DYPA 2VY0A 4RGGA 4IETA 5JVVA 3M8LA 3WP3A 1KJRA 2WT1A 3SCGA 3MFAA 1G86A 4HSJA 4I3GA 5AVPA 4P9XA 4R9DA 1H30A 1RJ7A 2VNOA 3CJIB 2AUYA 2D44A 3LA3A 1J3PA 2ZA9A 3A4UA 4K3UA 5DDJ1 3UV9A 1VALA 1FATA 1RITA 1QWRA 1W0PA 3B02A 5T3NA 1PZ9A 1PZ8A 1FPN2 3S7IA 5DG1A 3OD0A 2IWGB 4M3CF 1QJU2 3HR9A 4I2OA 5C6CA 1H4HA 3POWA 3THTA 2VUAA 3ZXDA 4LO4B 5BNNC 4CYDA 3AP5A 1HXS1 4H7MA 1T6GC 4SLIA 5T55A 1AR72 1BVP1 3OPZA 4MZUA 1UMZA 3WR0A 2CY6A 1ALYA 4XF3A 4MV2A 1RHI2 3WOGA 4TWTA 4DQAA 4X6QB 2QNKA 4BHPA 4C0BA 2KXLA 3MPPG 4CRQA 3VBOB 4AXOA 2EAAA 4QGMA 3NO8A 4IV1B 2WIIB 1CAWB 1C8M2 4XXPA 2R16A 3AX4A 4AGVA 2JECA 1V6IA 1Y7BA 3U4XA 1U5YA 2ZGUA 3WG4A 3RJRA 5EV7A 5FLIA 4Y1YA 2O1QA 4AFAA 2ZACA 4XF4A 4FQ4A 3SMHA 2HWF3 3ENRA 3KZ4C 1LOBA 3W59A 2AREA 5KHGA 3D0JA 1C3HA 3KM5A 4YVWA 3PJYA 2PTMA 3U0ZA 1F8VA 4N9IA 4RR3A 3O12A 4Q4W2 2Z2SB 2BGCA 4CDXA 1H8TC 2E6VA 3FC0A 1YFWA 1V6JA 3VBHA 3VBFA 4JRLA 1C5HA 4KWLA 4LUKA 1VIWB 1EAH1 2ZJCA 2WJSA 1Q3EA 1ZA4A 2XGXA 4JGZA 4CEYA 1Q8PA 1UU4A 2PLV1 2DTWA 1R081 2RM21 2XL9A 3AMPA 4RHV1 3TB0A 5GLUA 2HEYF 4FXGB 2P3JA 4EN0A 4LO7A 1H1AA 2CL2A 5JLVA 2H0VA 2WLQA 3VZJA 2WZR1 1NE4A 1DF0A 1QOTA 4N53B 3MW3A 2WNUA 4PBPA 4M01A 4AEKA 2QZ2A 4JDMA 3DV8A 1WLCA 2ARBA 4Q4X2 2IFRA 1PGSA 4Y24A 1F5JA 1AR83 4AQSA 1J1LA 4HKLA 5FOJB 4FPOB 2HWD3 1YYNA 5JOWA 3ZN5A 4HVOA 1RVF2 2DU1A 2UWCA 4Z1VA 4RR3B 4OI2A 2A3XA 1YCIA 3O0XA 2A6XA 4CDXB 1GZCA 2DU0A 1YLLA 3VV1A 1UPIA 1LGNA 3VBHB 2HWB2 2X8KA 3VBFB 3LB9A 3ZFFC 1OHFA 1PO23 2VNGA 5JIAA 3CNAA 4IV3C 4CEYB 3P3NA 1O3TA 1LHWA 3AZWA 5J37A 2JD4A 4NHLA 3BU7A 4JGYC 4E2GA 2JG9C 2P3KA 2ZX1A 4YVSA 5A33A 4ASMB 5F6LB 2JG8C 1AR93 3FBMA 4PBOA 1MQTA 4DRVA 4ZU4A 4COUA 3E6BA 3NWKA 1X33A 4XJWA 1R1A3 1ZRCA 4Q0VA 1VBB2 2ZZJA 2PAEA 2XG3A 1IKPA 5JPMB 4QQOA 2XJTA 1MS4A 1QXPA 4WM7A 3MIBA 4AQ6A 2X5IC 5JZGC 1UAIA 1JW6A 4YM1A 2W52A 4HVQA 2V73A 1RUI2 4OVEA 2W0XA 1OPMA 2GC2A 2D6OX 1XNBA 1YFYA 1WMFA 3GNEA 1OPOA 1YXWA 3R4UA 4GH4C 1HRI3 1K5MA 2GAUA 3RYRA 1OI6A 3FHIB 5FRAA 3UJOA 3DPRA 2WS93 4DB5A 1PO11 1AX1A 4KG8A 1LCLA 3KGZA 4H7LA 3WG2A 5JPNB 4XE9A 3TYJA 5BNQA 3MLLA 5L7OB 4AI0A 1CAVA 4MXWA 2WT2A 3MF6A 1PGL2 2HWE2 4P9WA 3TNQA 5GLVA 4K21A 4FTEA 4FSJA 4P9YA 1ZRRA 3UL2A 5DUVA 3VBRA 1W6QA 1DGWX 3JCIA 1O3RA 2Z5WA 4BIOA 1YHFA 3VBSC 4LO5B 1AVBA 4JVAA 4N90A 2PELA 3APBA 1AXZA 3H50A 1AYM1 2A6WA 3EQEA 4NHKA 4YGDA 4NPRA 4A7KA 4XJAA 5JOYA 1QNYA 1G9FA 1UZYA 2ZX2A 5IK7A 3AYEA 1YJLA 3M4FA 3DN7A 3ZXKA 4PDWC 4XFIA 4Y26A 4RS5C 1YIFA 1H4GA 1RL3A 2W08A 1SBEA 1YWKA 1JUIA 5BYNA 4NN0A 2ES3A 1V6MA 1RINA 1D4VB 2XVKA 1ND2B 2VQ0A 3KT1A 2GNBA 3MIHA 1EP0A 4XDQA 4ORFA 1POV1 5JI7A 1RMU3 5C9AB 4LBKA 2OUJA 4LA2A 3FJSA 3IKWA 5CB7A 2YY1A 3JD71 3GZAA 4Y1VA 4A7YA 1W6MA 1BVVA 1COV1 4Y22A 4K20A 4MXWB 3LCPA 1V70A 5C8CA 2D3RA 2PHFA 1GV9A 3CLPA 3OCPA 3B9CA 1W6QB 4AVTA 2FBEA 4LBJA 5I93A 4IEYA 1RUF1 4UBGA 3TRSB 4D7SA 4HN1A 3T1LA 1PM7A 1ZZCA 1XYPA 4Q1RA 4H3WA 2HWC3 4YRDA 2D6NA 1MS0A 4S2HA 2IXHA 4LBLA 1YI7A 4QHBA 5GZEA 4BYYA 3NV2A 3PVEA 1C4RA 1TMF3 2YGMA 4DZGA 2WNVC 3BODA 1V9U3 1S2BA 1AR82 1TQ5A 1CVNA 2YPJA 3O7OA 3WDWA 3ZIXA 2HWD2 4W6WA 3D5OA 4TSVA 2D98A 3LOBA 5CIRA 1OQDA 5FTTC 1H1IA 1RUJ1 5LEKA 5K7PA 4HETA 1CJDA 3FLPA 1O3SA 1UX6A 1S0IA 4WVWA 3USUB 3PTYA 2VXRA 4AEDB 4JTNA 4H14A 1RUC3 2Q1ZB 4FPFA 1GNZA 4LLFA 1PO22 3MDPA 1VRH3 4IEXA 3IPVA 3ZX7A 3DL3A 2ZGRA 1WD3A 4Y1ZA 1LECA 3TBDA 1Q8QA 5KHJA 1XXNA 4AQTA 1IGOA 4QGLA 2OA2A 4DXZA 1AR92 4FP3A 4FOWA 2YZ4A 3J8F3 2YC0A 1QJX3 1PIV1 5FMOL 1PMIA 4L92A 1Z7S1 2ZX3A 4Q4Y1 1G7YA 5FLJA 4S2DA 4XTMA 4F83A 5DZGA 1RUD2 4CEWA 1NCQB 2ZMLA 4OUMA 2XKPA 1UL9A 1PVC1 2B42B 1X50A 5E88A 3E5QA 3EXUA 4G3YC 4TYSA 2GC3A 3AKTA 1S1AA 1ZBA3 4HBNA 4AVSA 4IL7A 3IM0A 5CNAA 1G6NA 2P3IA 1KQRA 4XJUA 2ZPXA 2DYCA 2K2SA 2LUWA 1HRI2 2DWRA 4INDA 3KT7A 4IERA 2VGDA 2GMEA 4QPGA 1OD5A 3RDIA 1QMJA 3IBMA 3SLIA 2XJQA 1ENXA 3FUQA 3VKNA 1QF3A 3AK0A 4LTAA 1MEC1 4LHKA 1FX5A 1FV2A 4YGEA 1PGW1 5GALA 5DUWA 1S0DA 3ZSKA 4JDOA 4LHNA 2PAMA