2H6BA

Crystal structure of oxidized cprk in complex with o-chlorophenolacetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
239
Chain Sequence
VEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSVDKLAAALDHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChloroPhenol Reduction gene K
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Dna binding protein
total genus 68
structure length 239
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6bA01
3BROA 1UHWA 2B0LA 3MWMA 4A0YA 2FEZA 4U7DA 3DFGA 1Y9QA 2JSCA 5I0SA 1W5TA 3UKVA 1YFWA 5J8FA 1MGTA 2EV5A 4KN4X 4M73A 3H1YA 2B8MA 1I5ZA 2E7XA 5DDGA 3DN7A 3MEXA 1HW2A 2UYBA 1O3TA 1ODDA 1YIOA 1TLHB 3L2CA 5FPZA 5HS9A 3HT1A 1ZRDA 4MHGA 2A07F 2O8QA 1LDKB 3HRTA 2XRNA 4G94A 2DPUA 1GXQA 4ENMA 2Q4SA 1W5SA 1NXMA 5FFXA 4HLYA 4N9HA 3F21A 4OMZA 3WGGA 2Y0MA 4KICA 3DXJF 3FMQA 3ZMDA 2O3FA 4FX0A 3M3IA 3MZYA 3ZMVA 1FLIA 1O5LA 5L3EA 5C8WA 3OGJA 1YYVA 2HEOA 2PQ8A 1UIKA 5BXXA 4UVBA 1XGOA 2DPDA 1X7NA 3LA3A 3KP3A 1RL3A 1ZVFA 1IW7F 4L18B 3ETQA 4ONUA 1ZREA 4XRFA 1K79A 3M9AA 1R7JA 1FBSA 1CAWA 2KIFA 3HUGA 3S2WA 2BNNA 4E2SA 3Q5FA 3U11A 5JR3A 1BIBA 4L2NA 3DL3A 5I0RA 5IT3A 1SFXA 1R5GA 3E5QA 2HKXA 2GC0A 3KCCA 1OFNA 1KU9A 3R6SA 4FBFA 5J8CA 1CAWB 3WGIA 2D1VA 1DZTA 4Y13A 3IDCB 2ACJA 2EV0A 1QO0D 1D3YA 3VOEA 2F5FA 3PVBB 3NSTA 4RAYA 4B8XA 4GGGA 1KYWA 1U8RA 1TBXA 4A2UA 2K0GA 5CVVA 1ZRFA 4BHCA 2EJRA 4MQVA 3BJOA 4QLCU 1ZRCA 1FSHA 3HSEA 3I7DA 4UVAA 1YHFA 3SQNA 1T38A 2PFBA 4HVQA 2RVCA 4WCGA 4KWLA 5ICEA 3KP6A 4HSJA 2F2EA 1NZCA 4XF4A 2W25A 1JUHA 3V7CA 5JR7B 4PIXA 3TDZC 4M6YA 1LEAA 3D0JA 1R5HA 1XB4A 4IEPA 2QBYA 3FXUA 5KVRA 3KLNA 2LKPA 4ZH4F 1B59A 1CGPA 1P4XA 4WF2A 1ZZ9A 5KHGA 2Y48A 3ECOA 3SMHA 4IEVA 3GO5A 1V3FA 5D6FA 3HSFA 2XKPA 3BPZA 2QJVA 4XLNF 2QBYB 5L3GA 1FWZA 1H1IA 2M8EA 3M1EA 4EJUA 1IRGA 3KSCA 5CYVA 4FAHA 4XF0A 1P2FA 3NJZA 3H8UA 4ENNA 4FHTA 1J2XA 4I7HA 5BS6A 4KU8A 1I1SA 3RYPA 2FF4A 4ZYGA 1EY2A 4EWAA 2F5EA 1IAWA 4XFCA 3EUHA 4U7BA 2PMHA 3BCWA 2HGCA 3V8JA 4AQ2A 1EYBA 4XSXF 2DTRA 2GA1A 5LHGA 3T1BA 1KU3A 2MH9A 4UV9A 4TLFA 3HQXA 2CG4A 1USTA 1G3TA 1Z91A 3M8EA 2QDRA 2MA3A 1FP2A 1LNWA 5J48A 4HN1A 1B1BA 4A5NA 4Z82A 1YLLA 2IT0A 3LQRA 4AVPA 4BHPA 3QOPA 2HZTA 4M74A 2YR2A 3COAC 3WTSC 4MTDA 4HZFA 1U78A 1R1VA 2NNNA 1CAUA 3O6BB 4ORFA 3K1NA 3W6JB 3LAPA 3FZ3A 3B73A 3K0LA 5FLIA 3KLOA 3WTVC 3FMSA 4G7HF 4MGIE 4MV2A 3F72A 4LD5A 5DV5A 5L3FA 1GXPA 4ETSA 1X8EA 4CHUA 4ON0A 1CAUB 5A2QK 2XLAA 2V1DA 3I71A 1E17A 2OD5A 1X8MA 4YYOA 2PAKA 3F23A 2GC3A 3HRUA 3ERED 4NB5A 1BJAA 2XGXA 1FSEA 3I59A 5DUKA 1VJ2A 1YFYA 3WE3A 1QQIA 4ZYEA 1LEBA 5CVUA 1BI0A 5EZWA 2VODA 1ZRRA 5DUIA 4M72A 4G9YA 3GVAA 2QM3A 1ZNPA 3GFLA 4P9GA 1XGNA 3R4KA 3TKYA 2DLLA 2VBXA 4IVNA 5LEKA 1MJ9A 1EPZA 4MH0E 4YFXF 4G6DA 4ZU5A 3I59B 3WU0A 4JTOA 3TOAA 3RIRA 4Q48A 4ESBA 2JPBA 4XFIA 1U3EM 2VBWA 3HOSA 3MPBA 4I0AA 3TDUC 3WW1A 2XKOA 4FT8A 3T8RA 4HF1A 2E9QA 3TGNA 4RB2C 4PGHA 2ZFWA 4M9SA 5E8IA 5DCFA 3GFIA 1YW9A 1XSDA 3SCGA 4EJOA 3WTWC 5JSRA 3EQEA 4IESA 4N9IA 1G3YA 4P5OA 2MNGA 2FMLA 2FBHA 1S6LA 5K5QA 2QCSB 3ES4A 3GFJA 1FPQA 4LLNA 2FA5A 4DINB 1RZ4A 2RDPA 5FFZA 3EO6A 2DCTA 5E16A 1QXRA 3GWZA 3VEPA 1CAXA 2W57A 2MD5A 2V9VA 3SZPA 1D5VA 4D7SA 3ML6A 1I6XA 3O3KA 2ZXJA 5E1WA 3S7IA 4ZU4A 1QGPA 5H6QA 3BPVA 2UYAA 1W7PD 5LGNA 4IF4A 3KGZA 3ISPA 2RN7A 3EBRA 3WTTC 5ICCA 2P7VB 1CAXB 1UCXA 3WGHA 4UBHA 5FGMA 1RUNA 1FX7A 2A5YB 3VB2A 1RC6A 1YG2A 1DP7P 3BJAA 4QGMA 2PBIA 3S0MA 3KP7A 5DEQA 3B02A 4P55A 5KHIA 4PCQA 3MQ0A 1QPMA 3KEOA 1T0FA 1U12A 3EJKA 1ZYRF 1WQ2A 4XF1A 3PLQA 4RD7A 1XDSA 2XAGA 2CQKA 2BEOA 2MHFA 4IEXA 2P7CB 1IZ1A 4AWXB 3IWFA 1O5UA 1BI1A 1KGSA 4LUMA 1BN5A 1E2XA 3QU3A 3H3UA 1XMKA 2I45A 2HS5A 2GWRA 4IRIA 4HDVA 1ZN2A 3ACLA 3PQKA 1XCVA 2XAHA 4IEZA 1R1UA 1HSTA 1IPJA 3SZTA 3CF6E 5A2QZ 5F6FA 4XEZA 3IHUA 3CUQC 4B29A 2FQ3A 2XV4S 3CJNA 3SXYA 4BXUA 4XFGA 3H9AA 2PQQA 1RNLA 1HKSA 4X6RB 1IPKA 2J5PA 2J5OA 2OPKA 1KYZA 1XCBA 1ON2A 1DGWA 4R8HA 5IT9Z 1FYMA 4HSLA 5JCTA 1DUXC 1BC7C 2VOPA 2UZKA 4WK8F 1KQ9A 4KFCA 2KIUA 4JQFA 2EAAA 3SXWA 2EB7A 4PIZA 2ZKZA 2EFWA 2PA7A 2E1NA 5DCMA 1S29A 5K1YA 4O9EA 1IXRC 1QXJA 1B9NA 1QWRA 4META 5C6CA 1HSJA 4EWEA 3EQLF 3KE2A 3OD0A 3KETA 5JAXA 2EA2A 5D8KB 4XLPF 4Z07A 4EM2A 4LUKA 3KP5A 2RQPA 4OIRF 2F5CA 3V4GA 2EK5A 5DCMB 1NHAA 4XF9A 4PJYA 1LR5A 1ZX5A 5K5OA 3E6DA 2XL7A 4HA8A 1H9TA 4MEXF 3FM3A 2VN2A 2WC2A 3P9IA 4D0PA 3RDIA 2PTMA 4ZU7A 4U88A 2Y0OA 1UB9A 1YW8A 1XGSA 2RGVA 2PLYA 1P6RA 2BBYA 3TO6A 1XE8A 4Q47A 1YUDA 5FLJA 4LG0A 3E5XA 3ZDSA 1NE4A 5J3UA 4ENJA 4L5JA 5FD5A 5D5WB 1R22A 1D8KA 5D4SA 3WTYC 1Q43A 3FM5A 2K86A 3QPTA 2GXBA 1JXSA 3FFQA 1EH8A 2D1HA 2DQRA 1ON1A 3JSPA 4LA3A 2DFIA 2OQRA 4LA2A 4LG0B 4U0WA 4KMUX 2FU4A 1ZAOA 4UNOA 2P17A 4UXAA 2RKHA 1ULYA 2YSRA 2V09A 3WTXC 3F8CA 4MGKE 1MKMA 4BNCA 3F6OA 4JK1X 2O61A 2BV6A 3SHFA 4P9UA 2DW4A 3ZMTA 1T2KA 4KMFA 1X82A 2HTSA 1DZRA 1TQMA 4IJAA 4UXNA 1F1ZA 3H50A 4NQWA 1ZGAA 2ZNYA 1PP8F 3HYIA 2STTA 4IEQA 3TNQA 4BYYA 1LRHA 4D7TA 1OD5A 4EJWA 4ESJA 4AIJA 2FE3A 3J81K 5I0TA 2VXZA 1YFHA 2IA1A 4XFHA 4A0XA 1UW8A 4OIPF 1BI3A 5ILSA 1I27A 1P4WA 1W7PA 2E7WA 3CEWA 4BQAA 1IN5A 3RZZA 3JW4A 4QM8A 2EV6A 3IL2A 2B9UA 1RIOH 3EHKA 1U6GA 4CDGA 1JHFA 4P9FA 1HKQA 2FOKA 2P5KA 3F3XA 4HBLA 3RKYA 3GW2A 2XVCA 3F8NA 3DV8A 3H3ZA 1O7LA 4KUMA 1IN4A 1YFXA 2D5FA 4MGZE 5I0UA 4WX9A 3JSOA 1J0RA 3NEUA 3SCHA 2COMA 3QU6A 2H27A 3J80Z 3RKWA 4FX4A 1PDNC 5JFRA 1S8NA 1KQ0A 1TQ5A 1IN6A 3HTSB 1SD7A 4YIIA 4EQQA 5BUVA 1XRUA 2W24A 2YU3A 4Z2YA 2XL9A 2LDUA 4EJTA 4O9GA 1XN7A 4QGLA 2Q30A 2WWYA 4QWQA 3I53A 1IN8A 2V1UA 4EGZA 4KA4A 2IXLA 1R00A 4KIBA 2PJPA 4P96A 2PYTA 3GF2A 2O6GE 3C3WA 2OZJA 2K27A 2PHLA 3RNSA 3HOTA 4CZZA 1PP7U 1O3RA 3G7DA 1WA4A 1ZLJA 2M5WA 2P5LC 2M87A 1RTVA 2WTEA 4R79A 2PHDA 3IKVA 3CLPA 4YNIA 3E6CC 3FE5A 4EVIA 5DD8A 5D1IA 4A6EA 2Z69A 3BB6A 4MGRA 4L11A 1T6SA 4KT5C 3I64A 3V7SA 4AVAA 3FXRA 3WW3A 4UUVA 2M30A 4KYWA 5F64A 4H7LA 5ICGA 3H7YA 5EEGA 4OINF 1FBQA 1VTNC 3KZZA 4LB6B 2CAUA 1YLFA 4RB1A 1KU2A 4TV7A 4YSFA 3NW4A 2Z2SB 3L2HA 1WWXA 5J7MA 1S3JA 3VODA 4AIHA 3R0AA 2CO5A 1YWKA 3RKXA 3C18A 3ZN0A 4ESFA 2ET7A 5ICFA 3R61A 2Z33A 2ZCWA 2HTJA 2P6TA 2PAMA 1OMIA 3FWEA 1S7AA 2R7FA 3R60A 1SFNA 3JTHA 1OYIA 2OZUA 3F8BA 2GXGA 4NVPA 1DDNA 3S7EA 3E6BA 1TQPA 4QMAA 4BHBA 2K02A 3D82A 4GYIA 3LQQA 1XE7A 4MTEA 3NKTA 4IRHA 3OV8A 3WTZA 4S05A 5KBFA 3U1DA 2KJBA 3Q9VA 2O8XA 2A68F 4AIKA 4Q0PA 4ZZLA 3HSRA 1ONVA 2QZ8A 4O6JA 1BC8C 1SD4A 5LGTA 5AONA 1QNTA 2MH2A 1Z6TA 1XGMA 3I4PA 3J81Z 2O1QA 4LLGF 2BNMA 3JAMK 3ELNA 2V1XA 4MNUA 2KXLA 3L00A 3ZPLA 5F1RA 4JTNA 5D5XB 1QY4A 1UPIA 2Q8KA 2Q1ZB 3BOQA 4M71A 2OU2A 2OZ6A 3E6MA 3QRFF 2D40A 4QXKA 3KP4A 1MD0A 5LHHA 2XHKA 1RGSA 3IRRA 2FMYA 4M6XA 3ZMSA 2FBIA 3P7NA 3T5XA 1XSVA 1LKNA 3BPXA 1V70A 2HR3A 4RS8A 4S04A 2KJCA 1Z7UA 3GZ6A 4FAGA 1T98A 5L3CA 2G9WA 2HQRA 3AAFA 3G3ZA 4U0VA 5KHHA 5KHKA 1XMAA 4HF2A 2GU9A 4LTAA 3FXQA 5D6EA 3V8KA 1HBXG 2IXCA 3LFKA 1OYYA 2XAFA 1SMTA 4OMYA 1JHHA 4IETA 4U0YA 4JV4A 1LJ9A 4HVRA 5I91A 3LWFA 3L9FA 1JGSA 1ZGJA 1BI2A 1OKRA 4ZYDA 2L02A 3BJ6A 2N7GA 2QUFA 4BH9A 1BOAA 3HHHA 2EFPA 3KEQA 2IC1A 3EDPA 4BIFA 3K1PA 3ROUA 3ABTA 3TNPB 3VFZA 4PDKA 4CICA 5L3BA 1H0MA 2Z9OA 3RPUA 3FF5A 2CV6A 2GQQA 2WV0A 2X4HA 4PGGA 3QACA 2QVSB 1FNNA 1ZG5A 1ZLKA 1MJBA 1FI2A 3WW2A 5BPDA 1FOKA 5D4RA 3FX3A 2FQPA 2GC2A 5K8SA 1FT9A 1VR3A 1G6NA 2XLFA 4HV5A 4G6QA 3CO6C 4IEOA 5FLHA 4O5VA 2H09A 5E8GA 4IHTA 4M9XA 2K4JA 4HW0A 4OIQF 3GUDA 1GVJA 5E20A 5AVPA 2MLGA 1F4KA 3SHRA 1ZHFA 3IDBB 1P4AA 1YFUA 4HX4A 4WVZA 4ZYHA 4WWCA 1YS7A 3O2PE 3CO2A 2IXKA 5E18F 4IEYA 1HW1A 2XIGA 3HT2A 1QBJA 3BDDA 4KDPA 4HQEA 2CYYA 2HDCA 3DKWA 2DBBA 4AQ6A 3ULQB 2IA2A 2BNOA 3NQOA 2A69F 4QGNA 3PFIA 3DEUA 5HLGA 1Q5OA 4UV8A 2OAZA 2C0ZA 4KWKA 2GC1A 2IPQX 2QVOA 3E3VA 1F5TA 5CVIA 2GA2A 4LLLA 1XSXA 1UCRA 5LBQA 2FNAA 1A04A 1SQ4A 1R58A 2L01A 2A3SA 5BY5A 4CXFA 5JSOA 2F5DA 3H1MA 1RI7A 1WKMA 2HKOA 1LVAA 1F9NA 4Q0VA 3JAMZ 2PMUA 2VC1A 3GX4X 4Y17A 4XFAA 1JE8A 2MC3A 1TTYA 3Q9SA 3OTFA 3IWZA 5FQ0A 4LFUA 1ZZCA 3UKNA 4HN0A 4I09A 2ZKLA 3WG9A 4OLLA 2BGCA 3U9GA 3T8TA 1HW5A 4KN7X 3SFZA 4DNCA 4RGXA 3MYXA 1J1LA 4WXDA 5E1ZB 2Q0AA 3MDPA 5FQ0B 2ATFA 1X3UA 4Y15A 1FYKA 3O14A 3HIFA 2VC0A 2JPCA 4L0ZB 1Y3TA 1J3PA 2CSOA 2G7UA 3RJPA 4A6DA 5ILUA 4ZZDA 1WI9A 2P5VA 1O3QA 4GULA 1U5TC 1S7OA 5LEJA 3HRSA 4WXHA 3QP5A 5E1XA 1RUOA 2DQLA 3BP8A 4I0BA 1AWCA 5EEHA 1O3SA 1R23A 3CJXA 1FP1D 2CFXA 4Q0UA 2DU9A 2R3SA 5BPIA 4XSZF 3QP6A 4I3PA 2UWMA 2XASA 2NS0A 2KIMA 2MLKA 2VBYA 1WGPA 4KU7A 4I02A 3IIAA 2CW0F 1O4TA 4IRGA 2PI0A 2QYOA 1MJAA 3C7JA 2DK5A 3CLOA 2VQAA 2EFOA 3FZVA 1OYWA 2XUBA 3ZQ7A 4Q29A 3U10A 2RNJA 1YO5C 4EGYA 2F4PA 1Z05A 1EH6A 1ZG3A 1K7AA 2CGPA 4LK0F 3ZMUA 4ENKA 3NRVA 1O7FA 1Z6RA 4Q0SA 2NNYA 5BPXA 3P9CA 2H0VA 4YFKF 5CLSA 3M7GA 1ZZBA 2JTVA 1STZA 4G7ZF 2DK8A 3CO7C 3CTAA 4GO1A 1TNTA 4MUVA 2MBFA 3FMRA 2ISZA 2PFWA 4EROA 5HS7A 2DAOA 2EVXA 2OYZA 4R1HA 2FBKA 1YQAA 3OOPA 4I01A 3JTGA 2OQGA 4EJVA 2ZNZA 4X6QB 3TOBA 1TNSA 3BY6A 4L9JA 3MZHA 2DI3A 2QNKA 4HQMA 4UHTA 2WFPA 4MZUA 2ETEA 4LJZF 2GAUA 1SD6A 4LGWA 2UXNA 4G8XA 2MPFA 2BYVE 2GZWA 4OOIA 4E2QA 1BBYA 4OIOF 1TW3A 3E5UA 5JHUA 2UY9A 5KHJA 2V6CA 2XAQA 3T0YA 3L7WA 2QQ9A 3K9TA 1IF1A 5CVJA 2IJLA 5FPXA 2VOOA 3K1MA 2IW5A 3NL1A 2FNPA 4HLXA 3GYDA 2ADUA 4DQ2A 3V7RA 5K5RA 2ETHA 2IP2A 4K2EA 2LF7A 5HDNA 2V79A 3GFMA 1USSA 3H7JA 3E97A 2CWEA 4LK1F 1B9MA 4MEYF 1W7PB 2D2WA 1K78A 3KP2A 1SFUA 2VBZA 1V4RA 2H94A 4XFFA 2FRHA 4IPAA 4CO8A 5DYMA 3CL1A 3G73A 4HOBA 3LSTA 2VONA 1K78B 1SAXA 2ET1A 5BMZA 4M9ZA 2Y75A 1Z1DA 1WLTA 2PN6A 2P4WA 3MCZA 2K7LA 4I98B 2L54A 4HAMA 3RI4A 2Z99A 3BWGA 3ST7A 3LWCA 1L3JA 1EV7A 1J7KA 4H0EA 3IRQA 2CAVA 1QZYA 4PIYA 2X0LA 1FBUA 3CDHA 3KMHA 5HLHA 1DPRA 3WTUC 4WZCA 2PEXA 3MAJA 2ZJ2A 3EYIA 2A6HF 2VECA 3D0SA 1C0WA 5FDBA 3KZYA 3LAJA 1SFEA 4RGRA 2QQBA 4JBAA 3DPLC 3ZN1A 5HDKA 2L4AA 1TW2A 2LNBA 2L4MA 3HHGA 3USSA 2IXJA 2XAJA 3BZ6A 3GZ5A 3HRMA 3WW4A 5ILVA 4IHSA 4KIFA 2EWNA 5CU1A 3FHZA 1GQHA 3PQJA 4RGUA 5DD4A 1KU7A 1FZPB 5LRRA 3IBMA 1ZZ7A 2EFNA 3EETA 4L9TA 4Q0QA 2STWA 4EM1A 1PUEE 3H1WA 3FHIB 5LGUA 5JVTA 4WXCA 4L9NA 4KNYA 5J6XA 3LOIA 5I8TA 4G7OF 5JI6A 4N0BA 3N97A 2LF8A 2FXAA 1B6AA 3ECHA 2GIVA 1ZZ6A 4A5MA 3OF1A 1U2WA 2VT3A 4E2GA 1SEFA 4LULA 3GBFA 2M1BA 3I0TA 1J3RA 2IXHA 1WSUA 1UHMA 2OBPA 5HS8A 4HYEA 2HQNA 1DPUA 4IEUA 2D93A 2A61A 1J9IA 1QZZA 5TRDA 5FCCA 3V8LA 4HDUA 3K2ZA 4LMYA 6PAXA 3GEZA 2E1CA 1HQCA 5HLIA 2QENA 5ERIA 2OA4A 1SD5A 4UVCA 3D5LA 3EYYA 3M8FA 4GYGA 1LQ1A 5I8SA 3WU1B 4KL1A 4RB0A 4AVBA 4YIFA 4YARA 1LB2A 3R0JA 3TO7A 1OI6A 2C6YA 4CYDA 4RAZA 3VHRA 3NVCA 2JZYA 5HI0A 3LAGA 2FSWA 3BU7A 4HLTA 2ZO4A 1YS6A 4J1XA 3C3VA 3KGLA 1G3SA 3FJSA 4LLOA 1YTYA 5I8YA 1G3WA 5BQTA 4NHJA 1UD1A 1REPC 2HFHA 4YFNF 4MX3A 4O3MA 4EMSA 2ESHA 3ES1A 2PAEA 5CJ9A 3F8FA 4IEWA 4HMZA 4KIGA 1IXCA 3U2RA 1NE6A 4XETA 4L9VA 2DT5A 3I5UA 4JVAA 4HBNA 2RC4A 3ELKA 2EA7A 2NRAC 1J58A 4ASNA 4I2OA 2VPVA 3RYKA 1IUYA 4GXOA 3SCFA 5HDGA 4GCVA 3LA7A 2H6CA 5D8LB 3KFWX 1W4MA 4BAYA 5AIQA 1ZH5A 5IT9K 4WBBA 2HYFA 3RPQA 3I54A 4PZJA 3HTUA 2IXIA 1EP0A 3ZP5A 1H1MA 2UY8A 2D5HA 4XFBA 1J3QA 2BE5F 4HVOA 2P8TA 1PM7A 1HKTA 3GYHX 4AD9A 3TQNA 5CVRA 3TO9A 5LHIA 4RGSA 2AS5F 4R52A 3W6KB 4A0ZA 2IRFG 4HF0A 1CF7A 3RYRA 2TDXA 1MZBA 2JRTA 1IRFA 5E1RA 1ZG1A 4QM9A 1FYLA 2R7DA 4YG2F 5D5UB 1GHCA 2EFQA 1MDMA 3RTRA 2VE8A 4RB3C 1LDJA 1Q3EA 2VT2A 3H92A 2B5HA 1BM9A 2EA4A 1IN7A 1G4DA 3L09A 1CF7B 2ELHA 5FO5A 2OA2A 2Q2EA 2XLGA 5FLXK 3F22A 2ISYA 4F8AA 3DPTA 2YX4A 1ZZ8A 1UFMA 1MDMB 3F8MA 2L3DA 2VE9A 3IKTA 1L0OC 5BOXA 2NYXA 4J1WA 1Y0UA 3CUOA 1O57A 5KK1A 1OPCA 4E70A 5H20A 2G7HA 5FB2A 5LLQA 2RV8A 2AXLA 1BIAA 2Z3YA 2QWWA 1H9GA 4OU0A 1VP6A 1DGRA 2NAZA 2W85A 1SMYF 1J5YA 2K9ZA 1YW7A 1GQGA 2IVMA 2YX7A 3QPHA 4L0YB 5HVQC 2Q0OA 4IERA 2IA0A 4HX8A 4Q5SF 3IC7A 2UXXA 1KA8A 4F7ZA 1J75A 3P9KA 4CGZA 5D5VB 2A6EF 2K4BA 2LSOA 4K8FA 2M45A 2P6SA 5T3NA 3UKTA 4YRDA 4HV6A 1HXDA 2O03A 2KKOA 5L3DA 5JSPA 5H6RA 2YPRA 3C1DA 2O0YA 1B4AA 1OR7A 2Z5UA 2H6BA 1KQ8A 1EH7A 1AOYA 3U0ZA 2PG4A 2QQAA 1J59A 2GH2A 5AIPA 4UBGA 3PNAA 1R1TA 4Q4ZF 3N4MA 4AXOA 2ESNA 3J80K 1Q1HA 3WODF 1I1GA 3CUQA 4L5IA 3REOA 3BALA 3DQVC 1FY7A 1Z9CA 3MFKA 3K69A 4IXAA 4QX5A 4B09A 5ED4A 2HOEA 1U5TA 1LDDA 2ZMEA 5EFUA 4LEJA 2QLZA 2XROA 3CUQB 1IXSB 5E17F 2D45A 1XDUA 5I93A 1R36A 2HYGD 4HX7A 4EWDA 3ABUA 1T39A 5TJJA 3I58A 4LB5A 1K6OA 5BV6A 4XF3A 4EM0B 1FC3A 1WRJA 4AVCA 1XD7A 2JT1A 5CADA 5LRSA 4KWJA 2ZMEB 1U5TB 3OCPA 2ZBKA 3F6VA 3DF8A 1UIJA 4MQ9F 3QAHA 2DO7A 1D8JA 1TQIA 5FD6A 2HWVA 1FXZA 3ZMZA 4MGYE 1P92A 3M70A 4A12A 4EV0A 3LZZA 3GLXA 1CAVA 2W84A 3WE2A 3JZVA 1CX4A 1ZARA 1NYWA 3J7AO 1PMIA 2HJIA 4XBFA 5HOOA 2KRFA 3DP7A 3GXOA 1L3LA 3LA2A 1CAVB 4OFGA 5FLXZ
chains in the Genus database with same CATH superfamily
3NMBA 1UHWA 4A0YA 3MIDA 4FASD 1WI3A 2EXKA 2CDPA 2YU1A 1WFXA 1W5TA 1YFWA 2EV5A 4YW5A 2H8WA 4ASLA 1AYM2 4C2MJ 2VMFA 1TLHB 3VD9A 3L2CA 2Y9ZA 1LHVA 5HS9A 1VBC3 1F5FA 1POQA 3AZYA 4XQ4A 3Q8AA 2VCBA 1UELB 2QF7A 2DPUA 2DU1A 1GP6A 1K45A 2Q4SA 4QWNA 1G59A 1NXMA 1SBDA 4HLYA 3GTLJ 1UG2A 4N9HA 1T2XA 2ZGSA 5IPAA 1MEC1 2RM22 3VL8A 2O8KA 3I3DA 3AKZA 5FZHA 1W6PA 1GZWA 4S2GA 3WX5A 3ZMDA 3LSGA 1Y9GA 2O3FA 4FX0A 2KDZA 3VDDA 1Y7BA 4XBQA 4YW3A 1SBEA 3PUAA 1O5LA 4CE8A 2D43A 4AC0A 1UIKA 4YM0A 2DVAA 1X7NA 3LA3A 1ZVFA 1IW7F 2V5YA 1W6PB 1GZWB 3VDDB 1ZM1A 5F04A 2JK3A 2KIFA 3HUGA 2LM3A 3S2WA 2BNNA 2VPLA 3VDAA 3G1OA 1PUFA 4CA9A 1BL0A 4DZGA 3HUGB 1LKXA 4BIOA 3J7YJ 3FXJA 1OLMA 3IDCB 5EJ3A 2WO3A 2JA2A 2ACJA 1QO0D 2ADEA 1D3YA 2VASA 1ZBE1 1TMF1 3B6AA 3PVBB 4B8XA 1PUFB 1DFQA 1KYWA 1Z3XA 1U8RA 3WHUA 1TBXA 4GMP3 1QVTA 2LTNA 4BQXA 2G0EA 4M4RA 3S6PA 2VCAA 4MQVA 3BJOA 1WLCA 2VUDA 4DNYA 4QTRA 5J4VA 4UVAA 1T38A 4ZZ5A 2RVCA 2ES3A 4WCGA 2VW2A 5KCMA 2R071 1LULA 3KP6A 3MF6A 5HCHA 2YPDA 1GV2A 2JDZA 1S0IA 4NNJA 1XOYA 2R1BA 2BUKA 1JUHA 3W58A 3ZGKA 3ZR8X 4K7JA 1XB9A 2GALA 4IGQA 4QX0A 5KVRA 3KLNA 3NAPA 4TXWA 5B4XA 1V5GA 3TN91 3RI9A 4Y22A 4WF2A 1ZZ9A 4H4KC 1AVBA 4FSJA 2W0XA 3VBRC 3SMHA 2R0QC 3D5OA 3C8XA 1NLSA 2UUZA 1W8UA 4EJUA 1IS5A 3CCEI 1H8AC 4XF0A 4OQ9A 2M0MA 3H8UA 4Y22B 1J2XA 3U21A 1AXZA 1LODA 2KP6A 3WDUA 1X19A 1QOSA 4B44A 3OD4A 3B6CA 2FF4A 1OC1A 3H3VK 3AKQA 4XFCA 5L9BA 2VMGA 5HBAA 2R92J 1MH3A 2CUFA 3SC7X 3FBMA 3K7AJ 1VBC2 5LHGA 3TEYA 3ZKUA 4KG0A 1KU3A 2MH9A 5A7QA 1OSGA 1Z91A 1LNWA 3JRCA 1XJAA 2JWPA 4JOMA 1LOFA 4QPWA 1V6OA 5FZ1A 1YLLA 5IVVA 3M07A 3GZUC 1K61A 4BHPA 1MBHA 2EIJH 3VB9A 4A3KJ 3COAC 5J1UA 3WTSC 2DOEA 5GAEJ 4BLIA 2NNNA 1CAUA 5AFBA 1SMVA 3LAPA 1SPPA 2EIEA 4AU7A 4DYQA 2GSYA 4M3CF 3KS7A 2X29A 4EQVA 3T2PA 3OYDA 3FMSA 5CQEA 4G7HF 4MGIE 3F72A 3HZJA 5F0CA 1GXPA 2PLV2 4DQAA 1C57A 4AFAA 2DCKA 1CAUB 3LSMA 1W28A 1DGRM 5DUXA 1GU3A 1HJFA 2PMZN 3ZKYA 3I71A 1SPPB 1X8MA 1NAEA 4W1UA 2PAKA 3M1CA 3F23A 2GC3A 3WDWA 3WP6A 3C2GA 5IATA 2ARBA 1CD3G 1BJAA 4GWMA 3O0WA 1FSEA 3I59A 1QJEA 1VJ2A 2Y6KA 3WE3A 3W2VA 1RKWA 1MVQA 1UF2C 4N43C 5CVUA 1Y4WA 1W36C 3O1VA 4YW6A 2QM3A 5J98B 4IHYA 4A3LJ 2DLLA 2VBXA 4G6DA 4ZU5A 3I59B 2CYFA 4JTOA 3OSFA 3KT7A 4Q48A 2WZR3 2VBWA 3VHOA 1QJU1 1PO13 2BOJA 4I0AA 3WW1A 1GDTA 2E9QA 5F3IA 2BU9A 3OMYA 1X9PA 2NXNB 4K6BA 3ZIXA 2HU9A 3URFA 5A7OA 3KQ4B 3GFIA 3UGFA 1Q1VA 1U0AA 3BZKA 3LD8A 3WTWC 1H2MA 1G3YA 2E2JJ 2L9SA 1PZ7A 5EF6A 4LO5B 4I0WB 1N77A 2L7FP 1RC9A 1QA6A 5GZCA 1FPQA 4QPIB 2XXZA 1ZK8A 3DBHB 4DINB 1N78A 3EO6A 4MADA 1QXRA 2VO5A 1VBB1 1ST8A 4RLFA 3M7AA 3ZPYA 4DYRA 2W57A 1LGCA 1W6QB 3HMYA 1CQ9A 3SZPA 4NIIA 1I6XA 1SLLA 1U9OA 4IF4A 5LATA 2P7VB 2Y2ZA 3WGHA 2GMPA 3OS0A 3AYCA 4UFKA 1NK3P 1RC6A 3T2TA 5BNPA 3BJAA 1LPQA 4O7XA 3VBHA 2ZGUA 5EIYB 4P55A 3AMMA 2OUMA 4PCQA 3SZGA 5FYCA 2K40A 1BK0A 1A35A 2QSFX 1L7RA 4J6GA 1ZYRF 5GLTA 4RD7A 2WYSA 2CQKA 5BNPB 3V65A 2Z16A 1OLRA 2P7CB 3HL2A 4LO8A 3PNVA 1KGSA 1BN5A 3K70C 2ZMLA 3VBHB 4DYCA 4LQRA 2I45A 2HS5A 4LBMA 2GWRA 2UWAA 3LL7A 2QCOA 3K6GA 1F4HA 1ND2A 1W8OA 3HEIA 4RHV3 2XAHA 1UY1A 1I1EA 4IGPA 5FKKA 5FY4A 2WT0A 1R1A1 5L7OA 1RUF3 5A2QZ 2LALA 2WADA 3IHUA 3CUQC 3U75A 3Q0VA 4LHKA 4DB5A 4XZPA 4LBKA 1RNLA 5L7OB 1C1FA 2EZIA 1IPKA 2ZMEC 3U4XA 4XMIA 1W39A 3O5SA 5FTTC 5E79C 2P4EA 1PVXA 1MMGA 4R8HA 4XQWA 5IT9Z 5EYRA 4B4QA 3ZMOA 3ZOBA 1DUXC 5JCTA 5T55A 1KQ9A 2ICWG 2KIUA 2AZ5A 3OOXA 1IGOA 3OYLA 1GICA 1UOFA 1V6LA 2PA7A 2CSGA 2O0OA 3OG2A 1PO12 3CIHA 3C7FA 3KYCB 1FATA 2LH9A 5BNQA 3KETA 2CW8A 5JAXA 1MW7A 2EA2A 5BYNA 2JXAA 1TME1 3KP5A 5J36A 5GLUA 4OIRF 1YRNB 3ZYIB 1NHAA 1C28A 1PK6A 4PJYA 1ZX5A 5K5OA 4HA8A 2BGPA 2L7MP 2PTMA 3BT9A 2YMZA 2Y0OA 4GZ9A 3MV01 3WDXA 2HDWA 2ZAAA 2VIXA 1PK6B 4QPGC 2MEV1 5FPBA 3AG2H 5JVVA 3CJRB 3MV11 3A01A 4BL0B 4LG0A 1YUDA 2E53A 2D7FA 3HM5A 4L5JA 1LNSA 3ILFA 1XC6A 2G1MA 5D4SA 3WTYC 4MXWA 5FPAA 1COV3 4RGAA 4X0GA 2LY9A 4OI0A 2CGOA 2DQRA 1ON1A 2DFIA 3VDCA 1H6XA 2WNVC 3J4UH 4XABA 3A01B 4CP2A 4LG0B 5HV4A 4KMUX 3FKJA 1ULYA 2V09A 2BFUS 2X9DA 1ORKA 4MXWB 4ZJZA 3SHFA 4P9UA 2ZXHA 2DW4A 3ZMTA 1T2KA 4XUNA 2ZZQA 5EHDA 1DZRA 4IJAA 3H50A 5HCFA 3ZQHA 1PP8F 3OEBA 3HYIA 5M5WJ 2R16A 4IEQA 3PHMA 4BYYA 1PM4A 4D7TA 3GDBA 4AI0A 4U36A 2VZPA 5JZGC 4AIJA 2FHRA 3NWSA 4B7KA 2HEWF 2VXZA 2P5BA 2CL2A 4GMP0 4RFT0 4XFHA 1JZ2A 1EAH1 3ZYFA 3SEQA 1I27A 1P4WA 1W7PA 2E7WA 4HSRA 1GWLA 3CEWA 1IN5A 2EV6A 3IL2A 2B9UA 1RIOH 4UYBA 1X50A 2FOKA 3SH3A 1YQ5A 2WDBA 3MLLA 2GM4A 3UKGA 3DV8A 4RHV2 1IN4A 1YFXA 3BTJA 3E7LA 2PHXA 3NEUA 3SCHA 4HK8A 4XURA 4DY3A 3QU6A 5GZFA 2VJXA 1QHHD 3J80Z 1AJKA 4FX4A 1PDNC 5JFRA 1S8NA 4J01A 1TQ5A 3VSLA 3QYBA 3N3HA 1S9HA 4YVSC 1GVDA 2NMOA 4YIIA 5IUQA 2ZC2A 1IRZA 3KHCA 4PF5A 5BUVA 4Z2YA 1IS3A 2XL9A 4NHYA 2LDUA 3W21A 4P14A 1XN7A 1U5YA 1HQLA 3GZTB 3I53A 3BU0A 4EGZA 4AZZA 3AG3H 1GUIA 1BCXA 2PJPA 3LSIA 4P96A 3C3WA 3HOTA 4CZZA 1ZQ3P 1GANA 3V56A 2DUQA 4AGVA 4XUTA 3ZR5A 3G7DA 4NHLA 1W2AX 2YUSA 2RR13 1FIAA 3ERMA 4R79A 2BVMA 5J1RA 2PHDA 3U07A 1Z67A 1IQAA 3WP3A 4UFHA 3FE5A 4EVIA 4M3EA 5DD8A 5LY2A 1YIPA 4AVAA 1A78A 3WW3A 2M30A 2XQXA 2ZX4A 2ZZJA 2XVLA 3H7YA 4ZTFA 4AW7A 1QU3A 4JP0A 1W9FA 2CAUA 1YLFA 2VJJA 4YSFA 2D97A 3CMYA 1S3JA 4AIHA 1JKOC 2CO5A 1H4GA 3FIWA 2LY2A 2F4MB 1NY71 4AI3A 2R4GA 1UJ8A 2XUEA 1PGW2 3R61A 4LMFA 1RUG2 2X10A 2P6TA 5LZ6A 1OMIA 2CJJA 1S7AA 3LIGA 1SFNA 2IEKA 1U0JA 5HV0A 1COV2 3F8BA 3UESA 1BBT3 3WF2A 2GXGA 3S7EA 4QMAA 4BHBA 2K02A 3ZSMA 3JR9A 1XE7A 3PUHA 4MTEA 4XOGA 3U1DA 3AL0B 3CCYA 5K0UC 1O6UA 2DVBA 4Q0PA 1JS9A 2XF7A 4JX6A 2DOAA 5LGTA 5AONA 3A7QA 4KISA 3PTYA 1XGMA 3K4AA 3WT3A 1SCRA 3BR1A 3JAMK 2RS51 4G9SB 2ZBJA 2WZ8A 3ZPLA 5F1RA 5D5XB 2W08A 3QRFF 2XHKA 4E7ZA 4IV3C 5CG8A 3HOYJ 2LW8A 3WV6A 2OF7A 2JD9A 5A3UA 3T5XA 1XSVA 3BPXA 3RSJA 4GRIA 3ZFGA 1BW5A 1POV3 3PIOF 5CIRA 1Z7UA 2B4KA 3WUDA 3BG9A 4QD2A 3FHNA 4Z8BA 2ORXA 4BE3A 2HQRA 3S1MJ 5GAHJ 5B1AH 3OSGA 1S55A 2X5IC 2ZJPF 2H8RA 3SYTA 3RZLA 3ZFGB 4QXCA 1ZTRA 2L7KA 4IQJA 1F15A 3AMQA 3X2QH 1SMTA 2KQRA 4PK4A 4U0YA 4BISA 3FXMA 4JV4A 5CEHA 1X36A 5I91A 3WF0A 2GOMA 3L9FA 1JGSA 4CP0A 2ADDA 1ZGWA 3V64A 5FAXA 4DY5A 1LU1A 5IAXA 2D6PA 2IC1A 5DUVA 4IEJA 2RR12 4FQZA 3ABTA 1D4VB 1O4XA 1MMAA 5CNAA 1GBGA 5TSWA 2X4HA 2BY2A 1MJBA 5BPDA 1FOKA 5D4RA 3FX3A 2FQPA 2GC2A 1FT9A 5DUUA 3PUBA 2FMDA 3CO6C 5F08A 4AFBA 4IEOA 2H09A 4BXXJ 2XB0X 2LC2A 4GWNA 2K4JA 1JGGA 2P6CA 2FUG2 4Q8LA 1GVJA 2MSYA 1F4KA 5C4WA 3IDBB 1WJEA 2XJSA 1UAAA 2QQMA 4DRRA 1W2OA 3ZSKA 1QJZA 3PUFA 4ZYHA 2ZFUA 4A41A 3U4SA 4CCDA 2IXKA 1VRH3 4HKLA 1ODNA 4IEYA 2G19A 3W2AA 3GHNA 3HT2A 4P9LA 5C4WB 2R0FA 1QJY3 4HL0A 2CYYA 1A5JA 4BQ1A 5FKBA 3CU7A 2BNOA 1IG7A 3OYNA 1BBT2 1VQ8I 2R1DA 3PFIA 1YQCA 3NWTA 3DEUA 5HLGA 4IO9F 3JB4C 2QVOA 3LOCA 4U87A 1NCRA 1F5TA 1NLQA 2VE1A 4OI4A 2CY6A 1XSXA 4LO4B 1UCRA 1YNAA 4OVEA 2Y6LA 2B39A 1SQ4A 3MIHA 1R58A 1T0FC 1BA5A 5BY5A 4E8CA 4R9DA 3TL4X 3H1MA 3ALQA 3CZJA 5LA0A 3MBWA 2HKOA 1IJWC 1LVAA 4L97A 4Q0VA 1NCRB 2VC1A 3LEKA 4EN8B 5LW9A 4NN0A 2VQHA 4YGCA 1W99A 1OR7C 4HN0A 4I09A 1DU3D 3H0OA 4ZYAA 5CFDA 3T8TA 1DQ0A 2Q8OA 3ORJA 1J1LA 4WXDA 3JREA 2RMU1 4IOCF 1BVVA 3AJYA 3HC7A 1QNWA 3O14A 3HIFA 2VC0A 1Y3TA 3OPZA 3J8F1 3VD3A 5CFDB 2CSOA 2G7UA 1K42A 4ZZDA 4EN7B 1QHDA 1U5TC 1CZVA 3LPGA 2BERA 1DYPA 3J9SA 1RR8C 2D3RA 4GH4C 3PU3A 3NAUA 2WFF1 3K4MA 2DDUA 1Z7S3 3N7JA 1HRV3 1AWCA 3ABZA 3WP4A 1R23A 1HIXA 3ZSLA 1DCSA 2VPRA 2WS91 4LE3A 2YFZA 3VD7A 4COYA 1W8ZA 2CTVA 2JMWA 3NJYA 4NC8A 4LBOA 4XSZF 2PLV1 2UWBA 1ONAA 2NS0A 2GNTA 3IDAA 4Y5Z0 2VBPA 4XDOA 5DAQA 1WGPA 2LP0A 4CZCA 3MUZ1 3WF4A 3R0RA 5H9SA 3DU5A 1O4TA 4BE2A 3JRDA 1N3PA 2PHFA 4KNCA 2A3XA 2EFOA 2XUBA 5FJ8J 1SACA 2A3WA 3U10A 3THCA 2ID3A 4A69C 1YO5C 4A3IJ 2JKBA 1Z05A 1HF0A 4NOTA 1RIRA 1EH6A 4FPHA 2E1MB 4RYDA 2CGPA 1Y1VJ 2H1KA 3TWIA 2CMPA 3ZMUA 3S3MA 3NRVA 2TEPA 4AFCA 4RAFA 4Q0SA 4QSHA 5BPXA 1LESA 3P9CA 2XPUA 4D5FA 1STZA 1O59A 2DK8A 1AZDA 5ACA3 1TNTA 4IHVA 1VRH2 4MUVA 2MBFA 2WSUA 2E5ZA 3FMRA 3VBOC 4DXZA 2X1DA 2EVXA 4R1HA 3OOPA 3DLAA 1QJY2 2ZNZA 2W46A 3K4BA 1IDZA 3BY6A 1DHKB 1UZWA 2QNKA 4X1EA 2L9NA 1ODMA 4AI8A 1WW6A 2IWGB 3UGHA 5IVFA 4YRVA 1QJX1 3O1OA 2UXNA 3PNTA 2VR4A 4CUAA 4XJ8A 1MBKA 2HI3A 5EQUA 4XM3A 3NNMA 3E5UA 2V26A 1GOFA 2C9KA 4LOTA 1IF1A 4R4XA 2BHZA 1XE0A 2YFUA 1BKZA 3GYDA 2CFOA 5JXHA 4DQ2A 2E63A 2A70A 1LVKA 1SLCA 2MFZA 2E2IJ 4MLOA 4Y33A 3LDKA 5IVYA 1ETQA 1USSA 4LITA 5JDBA 4PDWA 1B72A 5FP3A 2M34A 3MLKA 1R64A 2YS9A 3G6JB 4AFMA 4QQPA 3ILRA 4CO8A 3CL1A 2IS6A 1B72B 4YGDA 2PN6A 2P4WA 3MCZA 4I98B 5HXMA 3T4VA 2Q8CA 2L54A 4HAMA 2OT7A 3LOBA 1J7KA 1Z7S2 3PSIA 1QZEA 1HRV2 2J1SA 4PIYA 1FBUA 3KMHA 4OUSA 5HLHA 3IM0A 1WWYA 2PEXA 2ELJA 3D0SA 4FPGA 3WUCA 1MBJA 4RGRA 3ZN4A 4C91A 3DPLC 3A0NA 5HDKA 1QDCA 1TW2A 2K3FA 3AP4A 1BMV2 3N7KA 4QKBA 4J00A 4JGZA 2R6QA 3C2UA 4MFEA 1GNYA 1UZCA 2ZOEB 2XWBB 2EF6A 3PQJA 4RGUA 1V00A 5DD4A 2Z79A 1FZPB 2ZGQA 3IBMA 2WO1A 2WO2A 1N3OA 5E89A 4JGZB 2R93J 1OUSA 3ON7A 1JUIA 4HPQA 5G05L 1REDA 2W2IA 1W06A 2AO9A 5JVTA 2WV1A 5IP9J 1FNYA 5J6XA 4BACA 5ACA2 4GB31 1PO11 3PNYA 3EUHC 5FOJB 4BQ5A 1POV0 3T4HB 3I2HA 2JE8A 5J1XA 3AVSA 3MD2A 1B6AA 3UGGA 4ABZA 3AMNA 5FBZA 3DEMA 5DM6F 2HBUA 2KR2A 2RNGA 4NUBA 4MVTA 4BWOA 3QLQA 1J3RA 3L2UA 1WJFA 4YZ2A 3IMNA 4P9IA 2HQNA 1PIV3 1S7EA 2OXBA 4XXPA 4ASMB 2A61A 4PUSA 4XOPA 3V8LA 3POFA 2V5DA 5HLIA 3MFCA 2KL4A 4UVCA 3D5LA 4GYGA 4QKDA 4F3JA 3WU1B 1WCQA 2P3JA 4Q1RA 1LENA 3B7MA 5F7UA 4AVBA 1CPNA 4YARA 3TO7A 1OI6A 2C6YA 4D94A 2BY1A 4RAZA 2J1TA 2KA3A 2JZYA 4YW7A 1OLME 2CS3A 3H9JA 2FSWA 2V4AA 1PO21 1YS6A 2EZLA 4J1XA 4HG2A 1E5HA 1G3SA 3FJSA 2W39A 3BZCA 1G9DA 1WJ5A 3ZQQA 4A3CJ 4M00A 4R9AA 2ESHA 3PJYA 4I99C 3ES1A 2PAEA 4PQQA 1X1BA 1YRZA 4XETA 3I5UA 2HWF3 2XGEA 2HWC3 2JE9A 1J58A 4ASNA 2VJIA 5GM0A 4CRQA 4GXOA 1N47A 4LBJA 1BVP1 4N43A 3VBSA 1LTEA 5ANQA 5AIQA 2NS7A 4WBBA 2HYFA 5IVJA 1EP0A 1H1MA 2A6XA 2VXDA 1GWMA 5FMDA 2GN3A 1ULEA 3S15J 2PHTA 3F95A 4XBLA 1F43A 4N43B 3VBSB 2IS4A 1JN2P 1DDLA 2GP3A 3OGGA 5LHIA 4RGSA 2AS5F 5HPOA 3T0AA 1QKQA 3R05A 3AZXA 3RYRA 5HLTA 2AUYA 4JGYC 1IRFA 5E1RA 1BW6A 3LSHA 1ZG1A 4QM9A 4M3GA 1YHQI 4H55A 5FZ8A 2VT2A 3H92A 4GAZA 3JRFA 2EA4A 5FUIA 2VBBA 4NR1A 2EQRA 2OA2A 3WOGA 4F8AA 4GWIA 1VBD3 3SDBA 3F8MA 2VE9A 3RCOA 3IKTA 5AC91 3CCVI 5BOXA 1DLLA 3OBZA 1Y0UA 3SEZA 5KK1A 1OPCA 1W0PA 3VZJA 2JWTA 2WZPP 2J1RA 3MKYB 2CUEA 1XYPA 3OR1C 4LOCA 2RV8A 4WVVA 4K1ZA 3ONQA 4OHXA 3D4KA 5F5IA 4QHBA 1H9GA 4OU0A 2RDQA 4FO9A 1DGRA 2W85A 3POEA 1J5YA 4RLQA 4XILA 1SAUA 1GQGA 4AHYA 1M06G 1X4OA 2RS31 4X8NA 5HVQC 1PIV2 2Q0OA 4IERA 2IA0A 4A4AA 3IC7A 4F7ZA 4AYBA 1LGBA 3VN4A 1RUG1 3P9KA 1LCLA 3EYPA 4CGZA 1TVGA 5D5VB 3I4NJ 5J1YA 2K4BA 2LSOA 3JXSA 4K8FA 4NO4A 2M45A 4LORA 5FYZA 1SHWB 2LBFA 5FY9A 3JD73 1HXDA 1GV5A 4C3HJ 5JSPA 1H8TA 1Q8QA 2NN8A 3NKGA 2F4IA 4B4PA 3P3PA 3PO3J 1VMJA 2Z5UA 2H6BA 2LBFB 1J59A 5EYYA 2FBEA 4OHVA 4FFGA 1H8TB 3NNJA 3N4MA 2Y31A 4AXOA 2R063 5IK4A 4PLNA 5IVBA 3POJA 3WODF 3CUQA 4L5IA 1F31A 1SZBA 2RQQA 3BALA 4BDVB 2EXJA 3K69A 3HNMA 2D5VA 5F0FA 1ZELA 2FZ2A 4C90A 2HWF2 4BXSV 3TP0A 2E60A 2DJIA 2V4JC 3I2GA 2K9NA 2ZMEA 3O7OA 4C2TA 2QLZA 2XROA 3CUQB 2W91A 2R041 4IKFA 3J7LA 1WW5A 1T39A 5TJJA 5EZGA 4LK6A 2P0WA 3WF1A 4XF3A 4EM0B 3FC0A 3LKJA 4ATEA 3KIOA 5LRSA 4I3GA 5K7ZA 3SKJE 2ZMEB 2CUJA 3OCPA 1KITA 3F6VA 4AEJA 4RSUA 2A71A 2HWVA 5J47A 3U37A 1V6MA 1AYN2 4L8QA 3RZOJ 1CX4A 5FUNA 1ZARA 5DM7F 1OPMA 1VRBA 3J7AO 3BPSA 3USUA 1PMIA 4N4NB 4XQFA 3RMXA 5FYTA 2L9VA 1L7QA 3GXOA 4GALA 4OFGA 2QQLA 5CISA 3SQOA 1G9AA 4F92B 2FD5A 3CCLI 3QBQA 3JBG1 3USUB 1ETVA 2LFBA 5IP7J 3MMYB 5J8FA 3O12A 1VBD2 5F32A 1RUC3 3H1YA 1I5ZA 3EPZA 2E7XA 5DDGA 3E1SA 5JPNB 2UYBA 4B1RA 3ZQCA 1O3TA 2ZGTA 3HAGA 3GBGA 4QPGB 4QPOA 1MS0A 2WNVA 3H9GA 3GTJJ 4NAMA 4UW4A 5FO7B 3TRSB 1AR83 1XNAA 2VQTA 4G94A 1GKBA 1GXQA 2DA1A 4ENMA 4HSTA 1ZBA3 5FFXA 2X53S 1RPWA 2WNVB 3HQRA 3DU6A 2GP5A 5C5TA 4YG3A 3MZYA 1FLIA 4S2FA 4XIDA 4KITB 2YDEA 3OGJA 3VD4A 3JD72 4L9BA 5T5OA 2ID6A 1H2KA 3AKPA 1XGOA 4K9SA 5KR7A 1JZ7A 4L18B 1ZREA 1QH6A 4CDXC 4D8MA 1K79A 3ZR6A 1JI8A 2DCYA 2WR9A 2V1NA 1IGNA 4E2SA 5F0HA 1OA3A 3Q5FA 3BCBA 1HDDC 3U11A 5JR3A 1BIBA 1ASJ3 4PJMA 5IFTA 4PLOA 1R5GA 3OUIA 1O8PA 3OIQA 4R9BA 3KCCA 1OFNA 2BTVC 2R062 2HZDA 3HOUJ 1C3HA 4FBFA 3OIOA 3DTKA 2D1VA 5J3LA 3O1SA 1DZQA 5GTHC 3CMGA 4LKEA 3VOEA 4RAYA 1FMD1 1JTXA 2JEMA 3H8OA 2K0GA 4YVSB 5CVVA 4BDYA 1ZRFA 2EJRA 4IE6A 5GADJ 4QLCU 3I7DA 2IFWA 1YHFA 1X3ZB 3FFZA 2F4OB 1T08B 2W95A 1K5MC 1RUI1 2F2EA 1VQ6I 3VKNA 3MI8A 4YELA 2J1AA 3V7CA 4PLMA 2K2SA 2LREA 4A3JJ 4C3IJ 1LEAA 3WR0A 1R5HA 4IEPA 1VNDA 3AFKA 4ZH4F 2VGDA 5DXDA 1CGPA 1XU1A 4W50A 3FMGA 3IB3A 1BR1A 3LSRA 4FTSA 2ZGLA 4ARXA 2BXYA 3PO2J 4ZTJA 2DCZA 2VCMA 2Y48A 3AXEA 3ECOA 3RZDJ 3GO5A 1V3FA 4TZDA 1FOD2 3HSFA 5JI7A 4BB3A 2M8EA 1EKEA 4NHKA 1IRGA 2OIIA 1KFXL 4FAHA 2QKLB 4WVWA 1MEC3 1OUXA 4ENNA 4FHTA 3NRUA 5FIXA 2JJ6A 1TWGJ 2YROA 4IHXA 1N75A 5KXBA 1RUC2 2YG0A 2D98A 5B3SH 2W48A 4MYEA 3BCWA 2HGCA 4CU9A 2JRMA 5H9QA 3FXKA 1AKHA 4XSXF 3WDTA 4LT5A 1JUSA 4TLFA 2CG4A 1USTA 4IL6C 1AR82 1FP2A 2BVVA 4XACA 4EATA 4XLHA 1UHSA 1ZBA2 2X6OA 4Z82A 1AKHB 3I49A 3B3QE 3AP7A 4LXLA 4M74A 4I30A 3Q8FA 3K2AA 1RB8G 1U78A 1R1VA 3K1NA 1ZBE3 2RDNA 1TMF3 1VB4A 3B73A 3MIBA 4XRMA 2DV9A 1JOPA 1EJ9A 2AHQA 3VKLA 2F48A 5L3FA 4HNVA 4RS5C 3OYKA 4ETSA 1F36A 1X8EA 2WY7Q 4AOCA 1DGRN 2XLAA 1ASJ2 2OD5A 2R073 1QGLA 1ZR4A 4OI1A 3OUJA 5IY5H 2YPJA 4ARYA 2X5IA 3ERED 4AYBN 1FOWA 2ME6A 2LMDA 1YFYA 2TRTA 1QQIA 2X48A 1LEBA 1FTTA 5EZWA 2DYCA 3LFMA 5DUIA 4M72A 4G9YA 2QEXI 2ZHKA 3RS6A 4QX3A 2Y33A 2X5IB 4IVNA 5LEKA 1EPZA 4MH0E 3K3OA 3TN93 4IV1A 1N3QA 4B3AA 4KGQA 4ESBA 2M3AA 5BNOA 2JE7A 4YG6A 5E3MA 1OKQA 1QMJA 3MPBA 5FZGA 4XJUA 3GZNB 3ZXDA 5F27A 4JKLA 2F6CA 4XUQA 1OQ1A 4QXHA 3VBUA 2CUZA 1ETOA 4IV1B 2VKDA 1HDPA 4M9SA 4MXVA 3V0BA 4RGKA 4XRSA 5E8IA 4E4HA 2VVFA 5BNOB 1V6IA 2Y6GA 2F4LA 1SC7A 2VMEA 2DYRH 2M7BA 4V2VA 2B9SA 2ZKNA 4A44A 4PCRA 2BXZA 1NG0A 2MNGA 4XNFA 3V0BB 5K5QA 3VZNA 2QCSB 4Z2AA 2VOWA 3B00A 1H1AA 2CW7A 3I2JA 4DS0A 3T2QA 2WNUA 1G9FA 5LK7B 3S30A 3V0AA 4LLNA 5DPNA 2FA5A 2K85A 1BMV1 3CF2A 5FFZA 2VUJA 5F2SA 3WNNA 5E16A 4JX4A 2AACA 2EIKH 1MEC2 1CAXA 3LSKA 3A1YA 3ZQLA 1GYKA 4D7SA 3ML6A 2BY3A 1AL21 2FQ4A 3S7IA 2WNUB 3I3LA 1GWKA 2UYAA 3V0AB 2DT7B 3N9OA 1LFPA 2ZACA 3A02A 1V9U1 2DMTA 3BOWA 4CP9A 1CAXB 5FGMA 3VB2A 4II2A 1UMQA 2ZX3A 1GNZA 4CEYC 1DP7P 4NWVA 1GR3A 4QGMA 4RN5A 1WLDA 3RQ0A 3BQYA 4OUEA 1MQTA 1A36A 3RWNA 5ACA1 1T0FA 1J1TA 3OPWA 4F93B 4CP9B 1ULGA 3OB8A 4D7MA 1LHOA 5C5UA 2MHFA 1LAJA 2VUCA 2K9QA 3ITQA 4NIDA 1YC61 4BQQA 1MQTB 1CIWA 4FI9A 4TWTA 1ULPA 1ULDA 3AL6A 3PQKA 1XCVA 1ZBE2 2XHNA 1TMF2 5C4XJ 2RJLA 4IEZA 1C5HA 1E0EA 2QQ8A 3ZYJB 3CZUA 5LY1A 4CA0A 3WF3A 2VTXA 1JH5A 4ZDPA 4B29A 1RITA 1JYTA 2FQ3A 2XV4S 2ZHNA 1QJU3 3SXYA 1OLQA 2JKXA 2VMIA 3F0CA 4XFGA 3CC7I 2O14A 3SLIA 2R072 2WLQA 3M4FA 1HKSA 1LGNA 2RDSA 3Q0WA 3ZCOA 2XJPA 2OPKA 4W6WA 4ZHNA 1RUD1 2YHJA 2PJRA 1W90A 3VYSB 4UFMA 1FYMA 1BC7C 3LPFA 4WK8F 2HOTA 4JQFA 1W8FA 3SXWA 1OCTC 3WU2C 2OTLI 2JB4A 3TN92 1W04A 1W8NA 2AGSA 2PJRB 2A6ZA 3ZQIA 5DCMA 2J1VA 4O9EA 1B9NA 3K4DA 2WINB 3OYCA 1JYIA 2WNOA 5H2FC 1HSJA 3S1QJ 4AEDC 3ZVXA 3OD0A 2VU9A 1VBB3 3ZFFA 4Z07A 4LUKA 1LHUA 1P7IA 2F5CA 2HOAA 5DCMB 1LR5A 1FPN2 3DGTA 3E6DA 2JG8A 1H9TA 2DOFA 3P9IA 4D0PA 3RDIA 2JDPA 3A4UA 4ZU7A 3NJVA 4DXSA 3PIJA 3ZFFB 2W3JA 2YC4A 2EXHA 3TO6A 5FLJA 3NARA 3E5XA 1LJ7A 3O8GA 3W20A 1R22A 3ZMNA 1FTZA 1D8KA 4ET7A 3AP6A 2GXBA 1MR5A 2OUJA 4UT5A 1WCDJ 3EUKL 3LIHA 3JSPA 2WWUA 2DDAA 3ABKH 3HOXJ 2FU4A 2K46A 4UXAA 3WTXC 4BNCA 3F6OA 2BV6A 1UG0A 3QD6A 1X82A 1ERDA 2FCUA 1TQMA 1TL8A 1F1ZA 3B01A 4NQWA 2ZNYA 2STTA 1R1A3 3OGSA 4MO7A 1LRHA 4DXTA 4EJWA 4CEWC 2O5RA 2DF7A 3WNXA 1WJCA 4ESJA 3AMPA 1WCMJ 2FE3A 4G4FA 2I5UA 3U14A 1GMMA 4NQWB 2QQKA 5C71A 5ILSA 3AMHA 2CQNA 3UNGC 3RZZA 2C5DA 2YBSA 2P37A 4CDGA 1H89C 2P5KA 2VZ3A 3F8NA 1O7LA 4KUMA 1WCUA 1V6NA 4MGZE 3WCSA 3JSOA 2H27A 4QIWN 1ZYBA 1WVRA 2DA4A 1OBNA 4A93J 5A1LA 4QQHA 1QJU2 2D6KA 1W36D 2CV2A 5ERLA 3QH7A 2IZWA 4QWQA 4CCLA 1WZ2A 2IXLA 1N1VA 2XVKA 4JDNA 3ZDVA 4M01A 2PHLA 1O3RA 5DG1A 2VOXA 1ZLJA 2P5LC 1JHNA 2JDNA 3T08A 2VBDA 3AL5A 3BTLA 2V72A 2MEV3 3ZXAC 4FOWA 4JYKA 1JHJA 3CF5F 4NE9A 5BNNC 3KVBA 1WMFA 1PZ9A 4MGRA 3BVCA 4KT5C 1VBB2 2AEZA 2F6BA 4H7LA 3G1LA 1NZIA 4OINF 4RDUA 1X3WB 1KU2A 4TV7A 3NW4A 2Z2SB 3WG4A 1WWXA 2J7MA 5J7MA 3VODA 1WUVA 1YWKA 1T33A 4QX1A 2LROA 3OIPA 3I2KA 3RKXA 4EZHA 1WMDA 3C18A 1K6YA 4IDZA 2WAEA 3T3YA 2ZCWA 1RUH2 4XLCA 2HTJA 2PAMA 4FE7A 2R7FA 3R60A 3RQIA 4BS9A 4IE5A 5EGOA 4Y1VA 1OYIA 3S2HJ 1S0GA 1BYHA 1EAH3 4NVPA 1YEWA 1IDYA 1TQPA 1AYN1 2L7ZA 1QOTA 3M3YJ 3LQQA 4MIMA 3WTZA 1VQNI 4S05A 3Q8BA 3VBFA 5KBFA 1EUUA 5EGOB 2NZ9A 4PSXA 1APNA 3Q9VA 4RM2A 1S2BA 1WJDA 4ZS2A 5C8CA 3HSRA 2HH9A 1WLWA 4FE4A 1Z6TA 1R1A2 3VBFB 3G1MA 3J81Z 2EBIA 1FMWA 5FPUA 3CCSI 2BNMA 4DEQA 4PI0A 2KXLA 1U8BA 3L00A 4JTNA 5C8CB 5FKMA 2J1EA 1QY4A 4M71A 2G4IA 3S3OA 4DO0A 5JLWA 2DUOA 4M6XA 2FBIA 1F2NA 5LA1A 3H35A 2WL1A 1V70A 1G2HA 2HR3A 5ANNA 3GZ6A 5KXCA 4BQOA 1T98A 4BBSJ 4DIQA 2NVUB 1VBE1 4XCAA 2DVDA 4LG3A 2G9WA 5L3CA 3L2YA 3GJBA 3O0XA 4M3FA 5KHHA 3L9JT 5FUPA 1XMAA 2KM2A 1CESA 1TP4A 3FXQA 4AYUA 4QXBA 1Q8PA 3DLLF 2IXCA 3D1NI 5B2GB 3LFKA 1OYYA 1H88C 5KC5A 4IETA 1PHMA 1VQPI 3OS2A 2BBVA 3K4JA 1LJ9A 2QZ3A 4HVRA 3OYAA 2R7WA 2HVSA 1NA1C 1GUUA 1OKRA 3N7MA 2DA6A 3W59A 4NMIA 2N7GA 2QUFA 4BH9A 3THPA 1APLC 2EFPA 3ECQA 2VTFA 4RAGA 3ZLIA 3K1PA 3ROUA 3NV3A 2CU5A 3TNPB 4CICA 5L3BA 3J7MA 3RPUA 2MEV2 3KB5A 2CV6A 3MO4A 2WV0A 4OAZA 2ZGMA 3WW2A 1FI2A 2SBAA 5K8SA 1VR3A 1G6NA 4HOOA 4G6QA 1LEDA 2YXSA 1BZWA 3OYJA 3S16J 4M9XA 4OIQF 4QU2A 3S8PA 3SHRA 3LF7A 4PJ0C 1IC8A 2GH8A 1CZSA 3KV5A 5K7FA 5KWRA 4WWCA 3RZJA 1PNGA 3CO2A 3X29B 4IXLA 4BJ5C 2OW4A 4P00B 4IL7A 3WHBA 1HKDA 3H9QA 3M3QA 4XE9A 2HDCA 3FXOA 4CP1A 2RS53 4AQ6A 3ULQB 1OPOA 3APBA 1EAH2 2EILH 4UV8A 1FOXA 2OAZA 4UWDA 2DVGA 4C0HA 5J96B 2R5YA 2GC1A 2BV4A 4CCEA 4ZDOA 1XU2A 2NVTJ 1W0OA 4EYUA 4A7YA 5LBQA 1A04A 3KWVA 2ID4A 2E7QA 1NTCA 1N1SA 2L01A 2XBO1 3PMSA 3RWKX 3B94A 1FOD1 1W3XA 2R5YB 3IAPA 1OH3A 1Z77A 3H8XA 2ARAA 1GSLA 2VNGA 2BDRA 1H30A 2DT6A 2NVQJ 3Q9SA 5TISC 4JC1A 2VH9A 5EJCA 4J19A 2ZKLA 3DYMA 5FY5A 3CQOA 3U9GA 3BTZA 1BEV1 1W8WA 3CCUI 1NLRA 5C70A 1V5EA 4DNCA 4RGXA 3MYXA 2HVRA 2ECBA 5E1ZB 2OS2A 3R4SA 3K2OA 4BXFA 4L0ZB 4FQGA 2GXAA 2ERFA 4RR3A 2HWE2 2WNEA 3RJPA 3K4KA 2W1QA 3N9LA 1WI9A 4BOWA 1O3QA 5F8PA 3SEPA 1DLCA 3CDIA 3G2BA 5D8AA 1GP5A 2L0KA 4RR3B 4ZY9A 2EZHA 3FK6A 1RUOA 2HYXA 3TEZA 3BP8A 5FKNA 1W9YA 1IS6A 2BVBA 3CJXA 3UL2A 1S0FA 4P02B 5DAWA 2DU9A 1TNFA 5BPIA 5D8AB 4C8DA 4PJNA 2W47A 4I3PA 2UWMA 2JIJA 1XYNA 5DAXA 4KU7A 1NG6A 2MGQA 2JIGA 4IRGA 5DG2A 3J7NA 5FZEA 5ABJC 4D0QA 3AZVA 2RNJA 5FJHA 2F4PA 2L5QA 1YXWA 2J42A 4K3UA 3UYJA 4A3DJ 5JXGA 4V2GA 5A7SA 1O7FA 1AUYA 4PJLA 5L19A 3B9IA 2JA7J 2NNYA 1D0YA 5CA6A 3CC4I 4FFFA 4YFKF 5CLSA 1QEXA 3IMMA 2JTVA 5LBEA 3CO7C 2VCCA 4GO1A 1ETXA 4GD4A 5HS7A 2QDNA 2OYZA 2FBKA 3JTGA 2OQGA 4BQYA 4AVVA 3WQBA 2RS52 5H9PA 1TNSA 2R7TA 5GZGA 3KHBA 2DFCA 4IE0A 4B3XA 2VMHA 4LO7A 4NPRA 3OOUA 3CJIA 3U1XA 4UHTA 2WFPA 3ACIA 2W1WA 3N7LA 4KBBA 3KCYA 2XSJC 4LJZF 2GAUA 1MS9A 4OOIA 2RMU3 4XOTA 4E2QA 1NXD1 5T5PA 2Y6FA 5JHUA 4CCNA 3CJIB 2UY9A 3VDDC 5AFEA 2V7FA 3J8F3 3T0YA 2ELKA 3MIFA 3UT0A 4HLXA 1MS5A 3VKFC 3HWJA 4BLJA 4LIVA 2CV1A 4YM3A 2M7AA 2IP2A 4K2EA 2WFF3 2VOTA 2OTJI 3H7JA 1SFOJ 3H1CA 4XTPA 5FMOL 2CWEA 1B9MA 4C9YA 4AI2A 4NIGA 1SFUA 2WS93 1RINA 1V4RA 2VZOA 2H94A 4URTA 1W2UA 2Y34A 1IUFA 3VYUB 2PLV3 1NX9A 1IRXA 1HLVA 3BR2A 3U1KA 3G73A 4HOBA 4W4ZA 2UURA 3S5QA 4M6VA 2YBPA 5CKMA 1SAXA 2Y75A 2K7LA 5DDJ2 1ZRIA 1OOPA 4KBZA 3P1IA 5CQGA 5KAFC 3O1PA 2DYSH 1KEXA 2E6VA 1UMZA 3LQCA 3IRQA 2CAVA 3CDHA 2Y69H 2W82A 1DPRA 2CV0A 1LFBA 1DQ2A 4A3MJ 1OOPB 2AC1A 1C0WA 2K9LA 1VQ4I 2KRHA 3KZYA 3LAJA 4DRVA 4JBAA 3IPVA 3ZN1A 2L4AA 2XH6A 1UXXX 2L4MA 1YX3A 3USSA 2IXJA 2XAJA 3GZ5A 3WW4A 2DA7A 3NAPC 4IHSA 2ZSHB 1OA2A 4TSVA 4D6QA 4FPLA 1UY4A 1GZCA 1GQHA 1WJAA 3IPVB 2YUEA 1VF9A 2WQ8A 3ZXGA 5T54A 5LRRA 1ZZ7A 2TCTA 3H0DA 3L2VA 4L9TA 2TUNA 1QJX3 4EM1A 3O0VA 1LFUP 1V6KA 4UFLA 3L2WA 1AX0A 1HV0A 3VDXA 2R5ZA 3DEWA 2Q8DA 4BDZA 4RFRB 3NV2A 5FZBA 3TMOA 3VLBB 1POGA 1D0GA 5F6LB 2Y6JA 4Q1PA 3I56I 2NM1A 2LF8A 3ECHA 2GIVA 1BLZA 2ZXWH 3OF1A 3GNEA 2R5ZB 5IYDJ 1Z78A 4LULA 1FPN1 3K4NA 2KZGA 4QHOA 4BBRJ 4FQ4A 2E5NA 4E7LA 5EDNA 1LOFC 3RKQA 2WT2A 4B3NA 4AM3A 1OJLA 1UHMA 1UKGA 1LE8A 3P5BA 2RMU2 3CJTB 4N53C 1RMU1 1HN1A 4FPFA 2WBKA 3J8F2 1US2A 1W05A 4LMYA 1UZ0A 3GMEA 4PBPA 3GEZA 2HPMA 1GLNA 1JW6A 2RE9A 1R4NB 1LE8B 2QENA 2R7OA 5ERIA 1LOAA 1SD5A 3EYYA 3M8FA 5JOXA 2XB6C 4DBQA 1MS8A 1CR7A 4KL1A 4M3CA 5CYYA 2AH2A 5KHDA 3RSNA 4WM8A 2WFF2 4AEMA 2V6EA 5C3QA 2JG9A 3I8TA 3VHRA 2Y8KA 1OCPA 1D7PM 1I5PA 3BU7A 4HLTA 4V2WA 2ZO4A 1SDWA 5T52A 2WS92 3ZYHA 2XPVA 1QDOA 4M3CB 4WM8B 1G3WA 4NHJA 1UD1A 1K5JA 4FPJA 3ZFEC 2JG9B 4LKSA 1QQP1 5CJ9A 4IEWA 3LSDA 4HMZA 3AP5A 2E7TA 2VMDA 5AVAA 1IXCA 1Q8VA 4UFIA 2W68A 2DT5A 4PT6A 2BW3A 4JVAA 4HBNA 4XMYA 2CGNA 2NRAC 2XGCA 3GCMA 1HQWA 2VPVA 3RYKA 1JUPA 4DZPA 3SCFA 1S0DA 5HDGA 2H6CA 1YJWI 2X85A 2BWCA 4Y5SA 1JBCA 3NWKA 4PZJA 3HTUA 3N9NA 2BW3B 3ZP5A 2VNRA 2UWCA 4QT6A 1J3QA 3GHMA 5FYUA 3WVJA 1U9NA 1VQOI 2JA5J 1WKYA 5DZFA 4HVOA 4GB33 4XAAA 1HKTA 5F3EA 3L1PA 5FP7A 5L9VA 3GYHX 4AD9A 1R5ID 4F55A 3NO8A 2IRFG 3K75B 1OQYA 1NCQA 4HF0A 4AHWA 1A6CA 1HOMA 3TP3A 2JD4A 1FYLA 4ZXEA 5CBLA 2VKEA 1JJ6C 3RTRA 4QPIA 2A5ZA 1QJX2 1PYVA 5FZMA 4HK9A 2B5HA 4HONA 1BM9A 1AXKA 1H0BA 5FXVA 3HB9A 3HOVJ 3ASNH 1NCQB 4Z92B 4UUSA 2A6TA 3L09A 1D1CA 2ELHA 2GNBA 5FO5A 1SFYA 1W6QA 3QODA 1QJFA 3SFIA 4CVUA 2XLGA 5FLXK 2ISYA 4XJ9A 3UETA 2YX4A 4PSWA 3NJXA 5J37A 4BZ4A 5DN2A 4RBOA 2L3DA 3AYDA 2E1OA 4N4OB 2IVJA 2E33A 2NYXA 4UUSB 2D6MA 3CUOA 2EIGA 1O57A 3BTCA 5BNPC 2NOGA 3PSFA 4UB8C 5FYYA 3VBHC 1VP6A 1SMYF 2X09A 4OMDA 2IVMA 1PO23 3QPHA 5FMBA 1FX5A 3AFHA 3M4OJ 2BGOA 5JOYA 2FCVA 5FBJA 4HX8A 5KXEA 5FKLA 4LPLA 4K20A 1RUH1 3UR3C 3VYRB 1ND2C 3AXDA 1AU7A 4Q4Y2 4XUOA 2HYJA 2NS8A 5E3OA 1IQDC 5L3DA 3CCRI 4C1XA 5L7OC 4DEVA 4UUTA 1I39A 2I10A 3OBAA 1R091 3LCPA 1B4AA 2ZS6B 2BOIA 2P3IA 3VV1A 2Z1DA 1EH7A 1AOYA 1KONA 4IUGA 2DWRA 5AIPA 2QQOA 3AFGA 3POSA 1R1TA 5FP9A 3K10A 2VVEA 3O1RA 1SVLA 3W6VA 4JDOA 4R9CA 3WNOA 1I3QJ 4YZ4A 5EPAA 4MG2A 1NQJA 2E36A 3DQVC 1FY7A 1Z9CA 2W87A 5C9AA 1AR62 4AR2A 4B09A 3I3BA 2BJSA 4LEJA 5E17F 1AL0G 4QX2A 4Q26A 2HLEA 3I58A 1K6OA 2WWSA 5GLZA 5C9AB 3RJ2X 5BV6A 2EH3A 5L36A 2XJQA 1PK6C 2ZBKA 1YRNA 1UIJA 5A3TA 4MQ9F 1BJQA 2DMQA 2WAAA 1D8JA 3B69A 4GB32 1TQIA 3HBLA 1FXZA 4MGYE 5AC93 4EV0A 3LZZA 4AAPA 3DWLE 2HWB1 1R49A 1ULFA 1X1AA 4WM7C 3JZVA 5DMYA 2Y0SA 4A3GJ 1TT0A 4XBFA 3E1F1 4LJHA 3KX2A 5HOOA 3DP7A 2X51A 2RS33 1L3LA 3LA2A 2O0YA 2Q1FA 3BR5A 3BROA 3I2FA 2B0LA 1IG0A 2FEZA 3ASOH 2HXOA 4U7DA 1RUG3 2JSCA 5EG0A 3UKVA 1D2QA 1MGTA 2JA6J 4KN4X 1UMHA 2W92A 4BQWA 4M73A 5LBCA 3DN7A 4FPOB 1YJNI 2VKHA 3I3EA 1ODDA 1YIOA 2ZXQA 1RETA 4GIQA 5EG0B 2C26A 3HT1A 3MKWB 1ZRDA 4MHGA 1GFF2 1BR4A 2O8QA 1LDKB 2XRNA 1PO22 5F39A 2IAIA 2X05A 1W5SA 1KJRA 4L99A 1MS1A 2ZEZA 1A34A 4Q27A 4TYSA 4OMZA 2ORZA 2VZRA 2LS6A 3WGGA 1VMHA 2AEYA 4XHBA 1W5CC 4KICA 4XXAA 3DXJF 2WAQA 3FMQA 3HXLA 3M3IA 3T09A 5EJ1B 4EEFG 5FPLA 1EA3A 1XYOA 3MPPG 4JDMA 5C8WA 4XN3A 1CPMA 1JYWA 4SLIA 1V0AA 1KS4A 3HGGA 3KP3A 3MW2A 1XSQA 1RL3A 1HRI2 2KD7A 3ETQA 4ONUA 5DUWA 2R0HA 2R043 3PTRB 4XL9A 2XF6A 4XW3A 4C30A 3WG3A 4NDLA 3QOEA 1H9PA 4L2NA 1SFXA 3E5QA 2LG4A 1WMXA 2D44A 4N7UA 4ISRA 3IH4A 2HKXA 2GC0A 5JOZA 1FOYA 2E51A 3R6SA 2VW0A 5J8CA 3PL8A 1Y1WJ 4KMQA 4OWRB 2A7AA 1DZTA 4Y13A 3RPUD 2FDHA 2JJ7A 1W9WA 2XDVA 3THDA 2F5FA 3NSTA 3GTKJ 4M0HA 5F9TA 3LEIA 4GGGA 1JZ4A 4XJWA 2JB8A 2VG9A 4GJZA 1UX6A 2O9LA 4LIUA 2A75A 4BHCA 4YW4A 1ZRCA 1FSHA 3ESWB 3DUIA 5LB6A 3HSEA 3A2KA 2JICA 1TWAJ 2PFBA 2DFFA 2HWE1 4KWLA 2GN7A 1UL9A 3P5JA 1ENHA 1CONA 3JBG3 4XF4A 1V54H 1QIQA 1JJ8C 4PIXA 5A3OA 3H0GJ 3TDZC 5BNNA 2D6LX 4CXYA 5AC92 1OD3A 2OCEA 2VL8A 2A3YA 3TEDA 1XB4A 4QQOA 2QBYA 3FXUA 2E19A 4OAYA 2X8KA 5FY8A 2LKPA 4RQPA 3HG9A 3KF3A 3CJQB 4X6AJ 4Q5OA 3DPRA 3AL0C 5BNNB 5KHGA 5GTIC 3VKOA 2WAOA 2XF5A 2AREA 2VD7A 3GTQJ 2XKPA 3BPZA 2RS32 2QBYB 1KGYA 4LK7A 2QFEA 4RQPB 1P2FA 3NJZA 2V73A 4D9JA 3DPRB 3MKZA 4I7HA 1FV3A 4KU8A 1I1SA 4ZYGA 1EY2A 3GXUA 4V2FA 1IAWA 4V1PA 2B9VA 1JTZX 2I74A 2PMHA 5EZHA 4P5HA 2EZKA 2WA0A 1YI2I 2BP6A 2OVUA 1UU4A 1UYYA 1G7YA 1ZA4A 1EYBA 3S93A 2DTRA 1AHSA 2KZVA 2HVQA 2GA1A 2NP0A 3QYEA 3T1BA 4NRPA 3OYGA 4UV9A 1W8TA 3VL9A 3HQXA 1A31A 1G3TA 4BKXA 1UU6A 2QDRA 2MA3A 2YY1A 5J48A 4NC7A 4CDQA 1R081 3F2ZA 2IBDA 3MZ8A 1BOBA 2SLIA 2B46X 3SH4A 4AVPA 4KQ7A 2PN5A 2R7QA 2HZTA 3ZFGC 2YR2A 3C7GA 2VUAA 1O4YA 4MTDA 3ZN6A 4HZFA 4CDQB 2NVYJ 4E6KG 3W6JB 2W1OA 3K0LA 5TGTA 1FMD3 5FLIA 3WQ1A 1B35C 4U2AA 3RRDA 3WTVC 2ZX1A 4MV2A 5DV5A 2CNAA 3ZN6B 2R042 2E2HJ 4CHUA 4ON0A 5A2QK 3K77A 4W8JA 1RUI3 3HEFA 2VVDA 4YYOA 1AR91 4UW6A 3HRUA 4UW3A 4NB5A 3WNMA 4P9XA 1NQDA 2KFDA 2WYFA 5DUKA 4CCCA 2WB1A 2WN2A 5FY7A 3AG1H 3FBIB 5A32A 3T1LA 5J4YA 3ACHA 2VODA 3ZXJA 3I55I 3GVAA 4QQ2A 4HRIA 1EV11 3BTIA 1ZNPA 3GFLA 4AHZA 3R4KA 3TKYA 1XNDA 1MJ9A 3OGVA 3UV9A 2DA3A 4AQSA 3RZKA 2RREA 1NA1A 3RIRA 2IXSA 2JPBA 3NNGA 5A32B 3JRHA 3TBIA 1U3EM 3HOSA 1W0UA 2LRDA 3TDUC 2XKOA 3IUOA 4FT8A 1HXS1 4HF1A 1HX6A 3H5NA 4RB2C 4PGHA 5C4WC 3JBG2 2ZFWA 1NA1B 4L0PA 1W1WE 5DDJ1 5CB7A 4OYUA 1YW9A 2WZEA 1XSDA 3SCGA 4EJOA 5JSRA 3EQEA 5F6KA 1YCIA 4HETA 1A8DA 3I3QA 3BR3A 1LHWA 3HN3A 4P5OA 2FMLA 4DBRA 3IV5A 1MMNA 2BQPA 1Q56A 3OS1A 3M2MA 5M5YJ 3ZXSA 2M4GA 1PGL1 5FWJA 4B47A 2RDPA 4FOQA 2DCTA 2DURA 3GWZA 4CSWA 3GCWA 2XUMA 2MD5A 2V9VA 1D5VA 4BQ4A 1VFCA 2W00A 5H6QA 5JVGF 2C6SA 3AK0A 5LGNA 2V9PA 3ISPA 3W9AA 3O1MA 3EBRA 4QPYA 3WTTC 1RHI1 5A80A 3OWTA 1FX7A 3SJMA 1I3AA 5FOBB 2E26A 5DZGA 2E7AA 4QKFA 2Y0SN 3V42A 1Z21A 3KP7A 5FK7A 5DEQA 3SISA 3B02A 5CFDC 1Y0NA 3MQ0A 1QPMA 3KEOA 1F9KA 4XUPA 2R7EB 1U12A 2CQXA 3EJKA 5GALA 1VAVA 3PLQA 2JDYA 1XDSA 2B42B 2BEOA 2R7ZJ 4NBQA 1QVUA 4IEXA 3A4CA 1IZ1A 5CAZA 3QU3A 3TEXA 2VZTA 3H3UA 4FP2A 1OF4A 4EZ4A 4KJZA 3Q0UA 4IRIA 5FJKA 4HDVA 1ZN2A 5HODA 3VZMA 2ARXA 1FMD2 4XQDA 1XNBA 1IPJA 3SZTA 2VZSA 4BCUA 5H9RA 4WZFA 1VBA1 3N05A 1YITI 5F6FA 4BY7J 3EXUA 2TBVA 4ZONA 2VOVA 3H9AA 5FK8A 1RUI2 2R7UA 2PQQA 4M0NA 2XG3A 4X6RB 2BZTA 1ENSA 2J5PA 1R1ZA 1WZXA 2ZJRF 2Z4FA 2FDGA 3CDZB 2VNVA 1ON2A 2WAQN 2YU2A 4P9YA 2XQRA 1D4M1 2E1MC 4HSLA 3HKZA 2LYCA 5FYMA 2EAAA 3KQRA 4PIZA 4YW2A 2EFWA 2GMMA 1Y6IA 3VUOA 2E1NA 5K1YA 1QXJA 3PIPF 2XJUA 2VB6A 1EPWA 1QWRA 2RJKA 1X58A 4META 4CDUA 4K1YA 3WHTA 4EWEA 3KE2A 1YJLA 5A6XA 5J09A 4YZ3A 4XLPF 3RQ4A 4QQLA 1HB3A 2RQPA 3OGRA 2BRTA 3DF0A 3P3NA 1AL23 2XL7A 5ABJA 5CFCA 4CDUB 4MEXF 2VN2A 2WC2A 1W0NA 1OCOH 1V9U3 1PVC1 3WY6A 1UB9A 1YW8A 3QH6A 2RGVA 2PLYA 5F37A 2BBYA 3TEWA 3GTGJ 3BOPA 3GJAA 3HJRA 1YYNA 5ABJB 5CFCB 2X1EA 1IG3A 3HD8B 5EYXA 3HPGA 4IX7A 3ZDSA 4ENJA 5FD5A 2E35A 5D5WB 1ZKGA 1Q43A 3OR2C 2DXIA 2GMEA 2K86A 3QPTA 4AVZA 4JX5A 3S32A 1GNHA 1MNDA 4JRLA 4Y26A 4XRSG 4LA2A 1MZ5A 4XORA 1WGXA 2X6XA 4UNOA 3NQHA 2P17A 3ZYBA 2YSRA 3J7AY 3F8CA 1MKMA 4D1QA 4KMFA 3PDQA 3KYDB 1ZGAA 5C44J 3TNQA 1RKTA 3KLSA 3FHAA 3PM1A 1F35A 1DU6A 5A3NA 5I0TA 2KDOA 3OSDA 2IA1A 4A0XA 2PQSA 4PDWC 1UW8A 4OIPF 5FYHA 4BQAA 4MHRA 4QM8A 2JDKA 2XONA 1RUD3 2QQVA 1JHFA 1HKQA 3F3XA 4XIOA 3AJZA 2XVCA 4XBNA 2ZGPA 2D5FA 5B5EC 5GZEA 5I0UA 1J0RA 2Y6HA 5FMCA 2COMA 5IW0A 2VULA 1A6IA 3RKWA 2IVIB 3DPUA 4Q4W1 3VZOA 4RM3A 3FN9A 3HTSB 1SD7A 4HKOA 1AF9A 3ZXFA 4EQQA 1XRUA 1JZ5A 3ZX7A 4CYCA 2YZ4A 2F5VA 1S0BA 4O9GA 4A42A 2DMNA 2G9ZA 4QGLA 2IS1A 2NPIA 3ZYRA 4Q4Y1 1NK2P 2JDHA 2WWYA 4AF9A 1S1AA 4LOSA 4KA4A 1R00A 4KIBA 2YGLA 2PYTA 3GF2A 1S72I 2K27A 1FJLA 1PP7U 4CYCB 1DYOA 4XHXA 1XC5A 1JKQC 3M8JA 4LNVA 1LECA 4Z6YA 2M5WA 3KD4A 4JGZC 1RTVA 2WTEA 1FMVA 4PFPA 4IE4A 2DTYA 1BJZA 3IKVA 4YNIA 3E6CC 3DXTA 5D1IA 2ZABA 1RUJ1 3BB6A 1G86A 1T6SA 3FXRA 2PHRA 4UUVA 5JPMB 4TN7A 2QQPA 1W0TA 3I4IA 2WA3A 5ICGA 1AR61 5EEGA 1FBQA 1VTNC 1YJKA 1AL22 5HCAA 3MF9A 4RB1A 1C8M1 5E3LA 2R7SA 4CCOA 3L2HA 2WB1N 3WG1A 3R0AA 2WBMA 1V9U2 2WSVA 4FPCA 4KG8A 3P6BA 3LDRA 4OZOA 1UZVA 2B7EA 3NAPB 5A7NA 2VQLA 5ICFA 1ENQA 4YEJA 1JOJA 4CCMA 2DBNA 1B8IA 3BQZA 1TG7A 1HB2A 1TEIA 3WD5A 3JTHA 5FKCA 2OZUA 3VBRA 3I97A 1XNKA 1JOBA 1K4SA 3RGBA 3D82A 3U78A 1HN0A 4IRHA 1B8IB 2KIQA 5M0TA 3KV6A 5JUVA 2O8XA 1DF0A 3VBRB 4ZZLA 1LOGA 4O6JA 2ZEWA 1BC8C 3RVHA 5A3PA 5FRAA 1YO8A 1WBFA 3I4PA 4N53A 2O1QA 4FVVA 4LLGF 5CKQA 4NPMA 3ELNA 2V1XA 1WJBA 4MNUA