2H6BA

Crystal structure of oxidized cprk in complex with o-chlorophenolacetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
239
Chain Sequence
VEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSVDKLAAALDHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Dna binding protein
molecule keywords ChloroPhenol Reduction gene K
total genus 68
structure length 239
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6bA01
5DUIA 1V4RA 2LF8A 4ESBA 4DINB 3H3UA 2OBPA 4LLLA 1V3FA 4QGMA 3BJOA 4HDVA 2Q30A 1S7AA 2LDUA 3D82A 5ILSA 2C6YA 5E20A 5A2QK 3T8TA 1UCRA 2GQQA 4HX8A 5DDGA 2Z99A 1L3JA 4M71A 1OPCA 1LDDA 1ZG3A 3TDZC 1YW9A 2R3SA 4GYIA 4XFFA 3KCCA 3GF2A 3SXWA 4XF1A 3C1DA 4M72A 4RB1A 2HQNA 4AXOA 4ZYEA 3FX3A 2GXGA 3LQRA 2P7CB 1YTYA 3I54A 4UBHA 5E1RA 2ELHA 2DK5A 3U11A 3QP6A 5I8TA 5BXXA 2V1XA 4E2QA 3H50A 5KBFA 4XLNF 1GXQA 3I71A 5K5OA 3KP4A 4Q4ZF 2VQAA 4P96A 1SFXA 2O0YA 1O7LA 2M8EA 5FLXZ 3BPZA 2YX4A 3H92A 4AVPA 4FHTA 3F6OA 4H7LA 5L3EA 4UUVA 1P4WA 2M87A 5EZWA 4M74A 1JGSA 3IBMA 3F8NA 5CYVA 5FQ0A 4IETA 3QACA 5LLQA 1W5TA 2F5CA 4FAHA 1C0WA 4YFXF 5I0TA 4XEZA 4UVBA 4A5NA 4M6YA 4LK1F 1IN6A 4OMZA 1J59A 2H27A 4MV2A 3CO2A 2O03A 4ENMA 1RC6A 5D5WB 4I0BA 2O3FA 2VN2A 3C18A 5BS6A 1O3SA 2Y48A 2DK8A 4EJVA 4KMUX 3GVAA 1R1TA 5I0SA 4A2UA 2QUFA 3CJNA 4QXKA 4ZYGA 4JTNA 3CL1A 3RJPA 2E7WA 1U5TA 3ES4A 5I0UA 5AIPA 3H1MA 3HRUA 4Q0PA 3KP2A 5ERIA 3COAC 2WTEA 4XF4A 4ZYHA 3AAFA 1IN8A 5FLXK 4ZU7A 5I91A 3CLOA 3BU7A 4UV8A 2VE9A 2OZ6A 5DYMA 2M5WA 5FGMA 4AQ6A 3WTYC 2FRHA 4CXFA 2W84A 1JUHA 4K8FA 2JT1A 3FM5A 3L9FA 3OOPA 5IT9K 5JSOA 1G4DA 1Q43A 4D0PA 1H9GA 1ZZCA 4PDKA 4EGZA 3NL1A 1STZA 5ILVA 1JHFA 4XFGA 4HF2A 4ZYDA 4I7HA 4ZZDA 2DPUA 5D1IA 3J81Z 4A0YA 4DNCA 4QMAA 4HDUA 2DU9A 2MLGA 3F72A 2L54A 3CUOA 5E16A 4L18B 5BV6A 1TQMA 1R00A 3DF8A 4J1WA 2XV4S 5F1RA 3FJSA 3H7YA 2CG4A 4YNIA 2V9VA 1UIJA 3DL3A 2FBHA 4I98B 1V70A 2XASA 3RIRA 4D7SA 1SD6A 1ZLJA 2PHLA 3TO6A 4CDGA 2A69F 1SQ4A 4Y13A 1DZTA 3WW4A 5BPXA 4A12A 4P9FA 1CAVB 2K7LA 4PIXA 3VOEA 5LHGA 2VT3A 3HSRA 1R5HA 1AOYA 4O3MA 2JPCA 1CAWA 1FX7A 1CAWB 2QDRA 2F5FA 2VBXA 5D8KB 4HVRA 1DZRA 4QM9A 3MCZA 2Z5UA 1YIOA 2BNNA 2ISZA 4PIYA 2D1VA 1SD7A 2A5YB 1QBJA 3ZQ7A 4R79A 4YRDA 3ELKA 3I0TA 4Q5SF 4G7OF 1G3YA 2DQRA 2FU4A 3U10A 3I64A 2RDPA 2IXHA 5KK1A 3E6DA 1ZG5A 3ELNA 3ZDSA 1I27A 2BNMA 2YU3A 3MPBA 4IEPA 4LA2A 3FMQA 2EFPA 2IA0A 4EROA 1J0RA 5DV5A 1FBUA 3E5UA 2XAQA 3HUGA 1T2KA 2IXCA 1KQ8A 3BALA 2VC0A 2KIUA 5DD8A 1OFNA 4BHBA 4WZCA 2O6GE 2GWRA 2XAHA 4HBLA 5EEHA 1IXSB 3B73A 3BY6A 3Q9VA 4Z2YA 2E9QA 1TBXA 2HR3A 4OFGA 2GIVA 3G73A 2XKOA 5BY5A 1HSTA 1OKRA 4L9TA 2F5EA 2FNAA 3RI4A 2E7XA 1Q5OA 5E18F 3HRTA 4Y17A 1VP6A 2D93A 2XROA 5IT9Z 1RUNA 3BJ6A 1P2FA 5I8SA 4N9IA 1Z05A 3S7EA 3N4MA 2PQQA 2IT0A 2HZTA 4ASNA 1HKTA 3CF6E 1YFWA 4K2EA 4ZU5A 3OD0A 1J3RA 5LHIA 1O5UA 1WA4A 4QM8A 2QQAA 2MC3A 3FMSA 3JTGA 1RIOH 2O61A 2WWYA 2LNBA 3NSTA 5DCMB 1J3QA 4EM0B 3FXQA 4A0XA 1HKQA 5LRSA 5E17F 2OA2A 3USSA 1CF7B 2B5HA 1XGSA 3M7GA 4IJAA 1IRGA 1XSXA 4M9SA 3CUQC 4KUMA 2C0ZA 4KIBA 4O5VA 3KEQA 4LLGF 2K4JA 1Z6TA 3C3VA 4KL1A 4BHCA 3CTAA 5HS8A 5HDGA 1OI6A 4EWAA 2CQKA 5D5VB 4Z07A 1HBXG 3IDCB 2FF4A 2NRAC 1YW8A 2CW0F 5A2QZ 1OMIA 2R7FA 2A6EF 3J7AO 4XFBA 1FZPB 3R60A 2KXLA 4JV4A 1X8MA 2JRTA 4L9VA 2EA7A 2FXAA 3ZPLA 3F23A 2ZNZA 4O9EA 2MA3A 4AD9A 3IKTA 2L3DA 1GQGA 1UW8A 3KLOA 5D5XB 1YO5C 1W7PA 2I45A 4G7ZF 3TO9A 5BOXA 3PFIA 4PZJA 3IWZA 1ZARA 4FX0A 4OIOF 3R0AA 1SFNA 2X4HA 2DT5A 1KGSA 1TTYA 4FAGA 1I1SA 3EDPA 4N9HA 3FMRA 4HF0A 1GQHA 1MJAA 1UB9A 2ESHA 3NRVA 2EFWA 3MAJA 4LA3A 2GA1A 1B6AA 1FI2A 4S04A 1LNWA 3EYYA 1ZAOA 2PJPA 2VBZA 4I3PA 4KT5C 2PAEA 5LEKA 1YUDA 4TV7A 4MEXF 2XL9A 2DLLA 1F4KA 4GCVA 5HI0A 4P5OA 2Z9OA 3JAMK 4HLYA 1X3UA 1F9NA 3P9IA 4DQ2A 2A3SA 4KFCA 3CO7C 5D4RA 4JK1X 3BJAA 5HOOA 4EMSA 4WX9A 3RYKA 1UIKA 2BYVE 4L0YB 2OQRA 3W6JB 1WI9A 3T1BA 5DD4A 2MNGA 1PMIA 3K1MA 3M9AA 2QVOA 4CHUA 4TLFA 1YLFA 3JW4A 5J48A 1IXRC 2STTA 4EQQA 2UY8A 5ICFA 4ENKA 3HTUA 1O5LA 1XSVA 5HVQC 1P92A 3TOBA 4ENJA 1QXJA 1ZHFA 4XFCA 3GFJA 5J7MA 2Q8KA 4MEYF 4M73A 5CADA 5JR3A 5LGTA 4I2OA 4U7BA 1BJAA 2IP2A 4A5MA 4MGZE 1MJBA 2PFWA 4L5IA 1BM9A 3U1DA 1H1IA 3GO5A 2HWVA 3GEZA 5HDNA 4AQ2A 4WF2A 2WC2A 1PUEE 3B02A 5JCTA 1EH8A 5H6QA 1QWRA 5JFRA 4R8HA 5JVTA 5HS7A 3SMHA 3RYPA 1O3RA 2Q1ZB 1EP0A 3I5UA 1KYZA 4M9ZA 4N0BA 3RDIA 5L3FA 1U3EM 1Z9CA 1YHFA 2DAOA 1XGOA 4IF4A 5ILUA 2PTMA 3RPUA 5E1ZB 3S2WA 1G3SA 4NQWA 5E8GA 4B09A 3O3KA 2H6CA 3V7RA 1IW7F 5FDBA 1XMAA 3WW1A 3EUHA 1W7PD 2FMLA 4P9GA 1XN7A 1W4MA 5KHHA 4IEVA 5KVRA 1BI3A 2KIFA 3QOPA 3RTRA 1P4XA 2RV8A 1CAXA 4HSLA 1CAXB 2ZMEB 1P6RA 3OCPA 2JPBA 1ZRDA 5HS9A 3RKYA 2D1HA 1OD5A 2XVCA 2ET7A 1B1BA 4Q0VA 4LFUA 4UV9A 5L3DA 2PI0A 4CZZA 3WTTC 2ETEA 1TQIA 4HN1A 4G8XA 4GXOA 3QU3A 1XDSA 3DXJF 5D4SA 4HVOA 2STWA 2BE5F 1GHCA 4HBNA 4IEZA 2VBYA 6PAXA 1K6OA 2VOOA 4IHSA 1KQ9A 5FB2A 1P4AA 1CAUB 4AIJA 2P5VA 2MLKA 3N97A 2EWNA 4KA4A 4LB5A 1FY7A 4QX5A 2MD5A 1UPIA 1S8NA 3TGNA 3BROA 2W25A 1FP2A 3FXRA 4LD5A 5BPDA 4EVIA 2PMUA 4LUMA 1DDNA 5IT3A 1LDKB 2A61A 3GW2A 3FE5A 3FF5A 5LGNA 3SZTA 1XB4A 2ZO4A 2MPFA 5CVUA 3L2HA 4YIFA 2ZMEA 4AIHA 3CUQB 4LLOA 2AXLA 5D5UB 3ROUA 3VB2A 3T5XA 3V8KA 3TO7A 2Z3YA 1XRUA 4LG0B 1JXSA 4PGGA 3K69A 4UHTA 3V7SA 1KU7A 3SCGA 5I93A 1R5GA 3FHIB 3VFZA 2A68F 4WXDA 4IESA 4IEQA 4IRGA 4LTAA 3JAMZ 4O9GA 3KP7A 3MEXA 2H09A 2GAUA 1T38A 2PYTA 3VODA 3HRSA 3NQOA 2IRFG 1S29A 1AWCA 3LA2A 4R52A 3R4KA 3EBRA 3LWCA 5JI6A 1IRFA 5H6RA 2M1BA 1ZRCA 3HTSB 2GZWA 3LWFA 1FSHA 2HFHA 1LB2A 1NE6A 2ZFWA 3M3IA 2G7UA 2ET1A 2H0VA 4XLPF 2P17A 2FA5A 2DPDA 2CO5A 1DUXC 1BI2A 5L3GA 2HKOA 4L9NA 1LVAA 1KA8A 3V7CA 3GFIA 3W6KB 3V4GA 5EEGA 4AIKA 2QBYA 4L2NA 1ZZ6A 3EHKA 2NAZA 1R1VA 2Y0OA 2PEXA 3WGGA 2DFIA 3LQQA 5F64A 4RGSA 5DEQA 3HT1A 2QQ9A 4JTOA 1WWXA 3H3ZA 4IRHA 2KRFA 1ZZBA 3U0ZA 1FXZA 3MZHA 1IN7A 3BCWA 2EK5A 4GO1A 4MNUA 4E2SA 1QY4A 2DW4A 2QWWA 4D7TA 1W7PB 2B0LA 1RTVA 5JAXA 4MGRA 1T0FA 4BNCA 3IIAA 1T98A 1D8JA 2RN7A 1XD7A 1A04A 1ZVFA 3FZ3A 3QRFF 4L0ZB 3JSOA 3WW3A 2AS5F 2F4PA 4U0VA 1F5TA 3KP3A 3H8UA 1ZGJA 3ML6A 2B8MA 5T3NA 1FBQA 4LLNA 3DQVC 1J3PA 2O8XA 2HDCA 3FZVA 4B29A 2LF7A 2PAKA 1U78A 4Q0UA 1LEAA 2CGPA 3CUQA 4ESJA 4YFKF 1JE8A 3O14A 4IEOA 3KP6A 2PA7A 3D5LA 3UKTA 2VPVA 2CFXA 5HLIA 2XRNA 1HQCA 4AVBA 2K0GA 4ENNA 2XAGA 2ETHA 1NZCA 3IC7A 1H1MA 4A6EA 2JTVA 3SQNA 4LEJA 1T6SA 5FCCA 1XGNA 2Z69A 5FLHA 3L2CA 1Z91A 1L0OC 3TOAA 5J8CA 3BB6A 1SD5A 2P4WA 1D8KA 2HOEA 2PN6A 5BMZA 2QYOA 5FLJA 1IF1A 2A6HF 2O8QA 2HYFA 3CDHA 3DFGA 1BBYA 3KEOA 1YWKA 2OQGA 2RGVA 2Y0MA 2GXBA 3WG9A 1VTNC 2D5FA 3ETQA 2BV6A 1YFUA 1IN5A 5ICEA 4AWXB 1XMKA 3L00A 4HOBA 4AVCA 4CGZA 1YFXA 1R58A 1ZZ9A 1X82A 2DO7A 1DPUA 4ON0A 1Y9QA 4EM2A 3E6BA 4GYGA 3C7JA 3SHFA 1RNLA 3ZMZA 1NYWA 1U5TB 1LEBA 3FFQA 4CYDA 3MZYA 1YS6A 3OTFA 1FBSA 1IPJA 1S7OA 3GYDA 4RS8A 4E2GA 1DP7P 1SEFA 1QXRA 2PLYA 1D5VA 1YQAA 3D0SA 4FT8A 4KDPA 3LOIA 5C8WA 1J5YA 5FPZA 1BC7C 1CX4A 4YIIA 2XHKA 1IPKA 1OYIA 1RZ4A 1ZYRF 1K7AA 1MJ9A 1WGPA 3WTXC 5J6XA 4META 3IRRA 2UYBA 3ZN1A 4H0EA 2ATFA 3DEUA 3EQLF 3IHUA 3K0LA 3KFWX 2N7GA 4XFHA 5I0RA 2P7VB 1TNTA 2ZJ2A 3NVCA 4ZZLA 5ICGA 1DGWA 1S3JA 4R1HA 1LRHA 4XF0A 1E17A 2V6CA 1G3TA 3PVBB 4NVPA 2CAUA 1R36A 4YYOA 4G9YA 3SFZA 4PGHA 2P8TA 4I01A 2BEOA 3RNSA 2HTSA 1QO0D 4KYWA 3G3ZA 4IPAA 4LB6B 2OU2A 4EM1A 1O3QA 2OZUA 4OINF 3JZVA 2QZ8A 1QZYA 1R7JA 1LQ1A 3WE2A 1YG2A 3WODF 3ZN0A 4EWEA 4EJWA 2IXLA 4KMFA 2GC1A 1B9NA 1ZRFA 1ZH5A 2ZKZA 1RUOA 4F8AA 3BP8A 1J58A 1BOAA 3ECHA 2EA4A 4EV0A 1PDNC 1QZZA 1FNNA 1LKNA 5F6FA 2BBYA 2HTJA 2ESNA 4FX4A 4U0YA 3M1EA 1MD0A 4U88A 3RKWA 2P5KA 5DUKA 5D6FA 4B8XA 4XFIA 2L4AA 5FFZA 2EV0A 4MGKE 4HW0A 2G9WA 1KU9A 5EFUA 4IHTA 1RI7A 3FHZA 2M45A 2XKPA 1SMYF 3BPVA 4HSJA 2BNOA 1ZZ8A 3MFKA 1VR3A 1I6XA 4RAZA 4LG0A 3ISPA 1G3WA 4U0WA 5L3BA 4RB0A 3ACLA 4XFAA 3HSFA 4YG2F 4IEXA 4XBFA 3GZ5A 3PNAA 4ORFA 4HV5A 3MDPA 1Y0UA 2FBKA 5J8FA 2UY9A 5JR7B 3NW4A 4YFNF 1Z7UA 2UZKA 1F1ZA 4G6DA 1O57A 1EY2A 3EJKA 3S7IA 4HZFA 2DI3A 5E1XA 3NJZA 4MZUA 1J7KA 1R1UA 1Z1DA 3V8LA 1G6NA 3HT2A 4EJUA 2R7DA 3VEPA 1FT9A 4XSZF 2PMHA 3L7WA 4QWQA 1YLLA 3GFLA 1UFMA 5ED4A 1WSUA 1REPC 4LJZF 1MZBA 4MTDA 4Q0SA 3PLQA 1U6GA 2DQLA 3I59A 2KKOA 1ZRRA 3KMHA 2COMA 1FYKA 3P9KA 2VONA 2HJIA 2VBWA 2X0LA 2IJLA 1BN5A 4KWLA 3TNPB 1XDUA 2UYAA 1PP8F 3MQ0A 4LK0F 2K86A 1H0MA 1ONVA 3ES1A 2HQRA 3J80K 2FOKA 1J75A 1LDJA 2YX7A 1EV7A 2L01A 5FFXA 5BPIA 1U8RA 2K9ZA 3D0JA 3FWEA 2HKXA 4NB5A 1HSJA 2L02A 3DN7A 3PQJA 4JQFA 3QU6A 1CAVA 2J5OA 1FP1D 4PCQA 1O7FA 3RPQA 4U7DA 2M30A 2IA1A 3E5QA 1TW3A 3BWGA 3DKWA 1XCBA 1FYLA 1HXDA 1ULYA 3G7DA 2D2WA 3ZMDA 2BGCA 2FE3A 4HA8A 3CJXA 1LR5A 2V09A 3KGLA 4BAYA 3WGHA 1BI1A 3NEUA 4L11A 1NHAA 4ETSA 3LSTA 5CVVA 1E2XA 2XLAA 1HW1A 2ZXJA 3E6MA 3KSCA 3GBFA 2K4BA 3F22A 2GA2A 4XF9A 4I09A 4BHPA 4WWCA 3REOA 3Q5FA 1RL3A 5K1YA 4HQMA 2EFNA 3CO6C 1BIBA 4QGLA 2O1QA 3HIFA 1CGPA 1XSDA 5DCFA 2L4MA 3I58A 4HX7A 3M8FA 1B4AA 2KJBA 5LHHA 2QLZA 3MWMA 4RD7A 3F6VA 1I1GA 1K79A 2W57A 3WU1B 2QM3A 3IRQA 4WVZA 1KU2A 3KZZA 3BPXA 1VJ2A 4WCGA 5AIQA 3F3XA 3ERED 3T8RA 2V79A 3F8MA 1IZ1A 1MGTA 4UVAA 3IDBB 3I53A 4CO8A 3HOTA 3RYRA 4RGXA 3JSPA 3KE2A 5KHKA 2XIGA 4ZU4A 1QPMA 1LJ9A 3P7NA 3ZMSA 2GC0A 1QQIA 3WE3A 1KU3A 3K1PA 3H1WA 3LAGA 2EJRA 4MTEA 4KWJA 2PAMA 2KJCA 1MKMA 2PQ8A 4X6QB 4HYEA 4RAYA 2KIMA 5H20A 2IXKA 1JHHA 1B9MA 4MQVA 3HOSA 1X8EA 2GC3A 3WTZA 2P5LC 3K1NA 3TDUC 3ZMTA 3E97A 3R6SA 3M70A 1ZG1A 4IVNA 2E1NA 2IC1A 3TNQA 1UHWA 1HW2A 2H6BA 2EA2A 1K78B 1KYWA 5CVJA 3TKYA 1Z6RA 3C3WA 1FLIA 3QPHA 2QJVA 3OF1A 5FD6A 3GUDA 2HGCA 2JZYA 2W85A 5I8YA 2OA4A 1FYMA 4GULA 4Y15A 4L5JA 2FEZA 5BQTA 5HLHA 4IEYA 3WTUC 4IEWA 2UWMA 4M6XA 1J9IA 3WTSC 1J2XA 3JTHA 2CSOA 4KIGA 2YPRA 4ESFA 4BIFA 2WV0A 4HV6A 1U5TC 2CYYA 5KHGA 3EYIA 3K9TA 3HHHA 1ZREA 5JSRA 4G7HF 1TQ5A 1CF7A 3DV8A 4O6JA 1DGRA 3CEWA 4RB2C 2NNYA 4JBAA 4XRFA 4EJOA 3HQXA 5HDKA 2PHDA 5J3UA 4BYYA 5CLSA 3KP5A 4HF1A 2UXNA 4WXHA 4LULA 5K8SA 2P6TA 2Q2EA 4KU7A 4LMYA 5E8IA 1PP7U 1RGSA 5HLGA 1T39A 4L9JA 2PFBA 1YFHA 3LZZA 3TQNA 1GXPA 2NNNA 2VECA 1B59A 1ZGAA 3ZMVA 4KWKA 4G6QA 4QLCU 3WW2A 1FOKA 3SHRA 5AVPA 3LA7A 1YW7A 2LKPA 3E3VA 4IRIA 2FMYA 1Y3TA 1ODDA 2Y75A 4UBGA 5K5QA 3WTVC 2CV6A 5ICCA 2XLGA 5FD5A 5L3CA 1BI0A 3KGZA 3F8BA 4P9UA 2XUBA 2IVMA 3UKVA 1SFUA 3J80Z 1XE7A 4BXUA 3LA3A 4XETA 5CJ9A 2OD5A 1IAWA 2RC4A 1NXMA 2P6SA 3SZPA 2G7HA 2K27A 2EAAA 3GYHX 4KNYA 2VC1A 1FC3A 4OIQF 1SFEA 3V8JA 2Q0OA 3UKNA 4OLLA 3T0YA 1Q1HA 2EFOA 4M9XA 3GZ6A 4UNOA 4HX4A 4ONUA 1TLHB 3U2RA 2VE8A 2HEOA 2EVXA 1EH7A 2QNKA 2ZKLA 1U2WA 3H1YA 1YS7A 4EGYA 1YFYA 5D6EA 4KN7X 2ADUA 4XF3A 5CU1A 2FQ3A 3PQKA 1IXCA 4S05A 4IXAA 1EH6A 2EFQA 3QP5A 3HSEA 1GVJA 4CICA 4WK8F 4OU0A 4MGIE 2ZNYA 2TDXA 3P9CA 3R61A 4RGRA 3GLXA 4X6RB 3O2PE 3IKVA 2GU9A 2ZBKA 2W24A 2Z33A 4MUVA 1FSEA 1S6LA 2IPQX 1SAXA 4Q47A 2GH2A 4A6DA 1ZNPA 1OR7A 3F21A 2VXZA 2HYGD 1UD1A 4LGWA 4I02A 5FQ0B 4LUKA 2FNPA 4EWDA 3ABUA 1TNSA 2ACJA 4YSFA 3SCHA 1L3LA 1R23A 3FM3A 1X7NA 4GGGA 3WGIA 4HN0A 1UCXA 4HVQA 2QVSB 2HS5A 2A07F 4FBFA 3BOQA 1HW5A 1MDMB 4EJTA 3S0MA 4MX3A 1O4TA 2DTRA 1KQ0A 4YARA 3SXYA 2QQBA 2YSRA 2RNJA 2EV6A 3EQEA 3DPLC 2V1DA 4MH0E 3ULQB 1YYVA 5JHUA 2VOPA 4G94A 4HLXA 5D8LB 1QNTA 4E70A 2WFPA 3ST7A 4Q48A 2OZJA 2D45A 2OPKA 1H9TA 2PBIA 2B9UA 1NE4A 4KN4X 4BH9A 5FPXA 3I4PA 3SCFA 4UXAA 4HAMA 2RKHA 4QGNA 4JVAA 2E1CA 2CWEA 1TW2A 3GX4X 5DCMA 4RB3C 1IN4A 3H7JA 5LBQA 1XGMA 5E1WA 1OYWA 3EO6A 2IW5A 1WQ2A 3I59B 2K02A 2DCTA 3HYIA 2H94A 3J81K 5TRDA 3E5XA 5KHJA 3BZ6A 1BC8C 5LEJA 4Q29A 2D5HA 4PIZA 2LSOA 4UVCA 2XLFA 1EYBA 4MGYE 2QBYB 3GWZA 4WBBA 1R22A 5KHIA 4OOIA 2CAVA 5LRRA 2MH9A 4MHGA 3RZZA 2VT2A 3WTWC 3KLNA 2Q0AA 2XGXA 3E6CC 1OYYA 1Q3EA 1FPQA 2RQPA 5JSPA 4BQAA 2FQPA 5K5RA 2YR2A 2V1UA 1ZX5A 4HLTA 2EV5A 1D3YA 3HRMA 5AONA 4J1XA 3DP7A 2DBBA 1XCVA 4HMZA 3I7DA 2RVCA 4RGUA 4F7ZA 1WRJA 2NYXA 1HKSA 4WXCA 3M8EA 3LFKA 2D40A 3O6BB 1MDMA 3BDDA 1ZLKA 3U9GA 3F8FA 3FXUA 2MBFA 3IL2A 3LAJA 4IERA 3CLPA 2MHFA 5LGUA 2JSCA 1ZN2A 5CVRA 1ON2A 1W5SA 4Q0QA 2PG4A 2Q4SA 1ZZ7A 3OGJA 3ZP5A 3ABTA 3L09A 1J1LA 3NKTA 3ECOA 2XAJA 2VODA 1USSA 4HQEA 4ZH4F 1SD4A 2XL7A 2OAZA 2ZCWA 1O3TA 5FLIA 1FWZA 3QAHA 3LAPA 2F5DA 1PM7A 2FSWA 2QCSB 4XSXF 4OIPF 3HHGA 2J5PA 3IWFA 1ON1A 1TQPA 2UXXA 3OV8A 3H9AA 5BUVA 2EB7A 4PJYA 4KICA 2IA2A 3RKXA 1BIAA 3Q9SA 4IEUA 1U12A 1EPZA 5C6CA 3QPTA 4Z82A 4OMYA 2GC2A 2XAFA 3GXOA 3EETA 2Z2SB 3F8CA 4P55A 5TJJA 3DPTA 1K78A 2MH2A 4MQ9F 4I0AA 4UXNA 2F2EA 4A0ZA 4KU8A 4KIFA 3WU0A 2IXIA 1QGPA 2ISYA 3ZMUA 2NS0A 1UHMA 3KETA 5FO5A 1IUYA 4OIRF 2FBIA 2QENA 3R0JA 2OYZA 3VHRA 1SMTA 1CAUA 3KZYA 2IXJA 1XE8A 1I5ZA 1WKMA 3GFMA 3K2ZA 4NHJA 1WLTA 3MYXA 1USTA 5CVIA 1DPRA 4AVAA
chains in the Genus database with same CATH superfamily
1MSFC 4EN6B 1U0AA 2PQSA 4DINB 1IKPA 2WS91 3I2HA 5IFTA 2XB0X 1T8IA 2Q30A 1S7AA 3D82A 4AVSA 5EJ1B 3CJRB 1UCRA 2VJ4A 5KC5A 2VQCA 4HX8A 2NVQJ 1L3JA 2CWSA 4LO7A 3ONQA 1OPCA 1RHI1 3HMYA 3O1MA 1YW9A 2R3SA 4GYIA 1LE8B 5KXBA 2E1MB 2BVVA 3PMEA 3C1DA 4FTEA 5CFCA 3I55I 1JT6A 3HPNA 4XBNA 3CHXA 2AC1A 1WMDA 3U11A 2MEV3 3VV1A 5EEAA 1MS0A 3KCXA 4LKSA 3H50A 4XLNF 3GCWA 3WHTA 5K5OA 3LGRA 4NHKA 3AVSA 4OI0A 3ME2A 2M8EA 5FLXZ 4S2DA 1TMF1 3HGYA 4Q4X2 3H92A 2WS93 4A3CJ 2RM23 3ASIA 3ZR6A 5L3EA 1W9FA 1P4WA 5EZWA 1ETXA 3M3QA 1IG0A 3ZYBA 3USUA 3RZJA 5FQ0A 1OCTC 3K6GA 4U2AA 3QPSA 3VYUB 2R7UA 2E1OA 4GH4B 2F5CA 5G05L 5DM7F 2LVSA 1C0WA 5KCMA 5I0TA 1VBD3 5GZGA 4UW5A 4Q26A 3VPRA 4M6YA 1VBB2 5F6KA 3GALA 1DU6A 4HPKB 3CO2A 3VDBA 2O03A 1RC6A 4BJ6C 1D1CA 5D5WB 5IAVA 3TW6A 2XVGA 2JD4A 1QJY3 4CCOA 4ZJZA 4QQOA 2XC7A 4GIQA 3BIWE 4JTNA 4QQ2A 3CL1A 1U5TA 4RHV3 5AIPA 2YXSA 1RUF3 2VTXA 3DBLB 2WTEA 2R5ZB 4ZYHA 3AAFA 1ZRIA 4CDQB 1S72I 3G1LA 3MV01 2MEV1 1Z7S2 5C3EJ 3WTYC 2XRLA 3CMAI 1LOBA 4K8FA 1IOAA 1HQNA 3OSDA 1FYUA 1G9CA 4A41A 2K9NA 5DM6F 1H9GA 1U9NA 1UX6A 4J25A 2P3YA 4IV3A 5FZCA 2ZJPF 2QQOA 5D1IA 3EB7A 2B9VA 2XQXA 2COBA 4NHXA 4YM1A 1YO8A 1TQMA 2A7AA 2Y6JA 3FJSA 4QPOA 2CG4A 2A6WA 3DEMA 1AR81 1X3WB 2FBHA 4I98B 1IGNA 3WG1A 4D7SA 3CZ6A 5FZEA 2DDUA 3V0BA 2XSDC 4KI5M 4NIHA 1SQ4A 1DZTA 3OR1C 1D4M3 2EH3A 5BPXA 1G2HA 3FUOA 1CAVB 2PMWB 2IBDA 3BVCA 1WW4A 3VOEA 5LHGA 2VT3A 4QXBA 4K3UA 4Q4X1 3QOEA 1Y8QB 5FREA 2X6YA 1RUC3 1FX7A 3WLUA 1W8WA 3CQOA 3W6VA 1Q8SA 2QQUA 3MCZA 2KR2A 5J4YA 4AU7A 1JOJA 1W8NA 1MS1A 1MBHA 2LTNA 2QZ3A 1WCUA 5T5OA 1N75A 3OBTA 4AEJA 4Q5SF 3WDUA 1VLNA 4G7OF 4N43A 3I64A 1W6PA 4BBRJ 4QXHA 3ZDSA 4ZONA 1I27A 1LUJB 2BNMA 1AR72 2ZX0A 1XNCA 2IA0A 2X6XA 1RXFA 4HSRA 3IV5A 3IAM2 2VI6A 3CMEI 5AVAA 1RR7A 2KIUA 1NLRA 1YX5A 3GDBA 4QQHA 1TZOA 4X8PA 2VNGA 4D94A 4BHBA 2XAHA 3TEXA 1LHVA 3B73A 3FXOA 3L9JT 1C1LA 2GIVA 4XJ8A 4L9TA 4A45A 3SFIA 3T3YA 1KS5A 5C33A 1PGL1 1Q5OA 4DUWA 3GZTB 1VP6A 1NCQC 4ABZA 1P2FA 2D6LX 4N9IA 2QQLA 3N4MA 4IGQA 3K4JA 3THDA 3ZQCA 3JRCA 3O1TA 4ARYA 1YFWA 5BNOC 2JIJA 1D7PM 4A3BJ 3J8F2 1QJX2 3O1OA 2FJ1A 2R7ZJ 1FMVA 3JTGA 3FMSA 1VQ5I 1HRV2 5DCMB 1AR92 4EM0B 2QEXI 2M8GX 2W94A 1IQAA 3ZYHA 4ZS3A 4URAA 2B5HA 4XLEA 3M7GA 4GWMA 1HX6A 3CUQC 4BXXJ 2C0ZA 3KV9A 1GBGA 4LLGF 2K4JA 2BXYA 5HS8A 5HDGA 1MS4A 1UO9A 2EXJA 2FF4A 2NRAC 2ZGSA 1NZIA 4FP3A 2LYCA 2CW0F 1FZPB 2VULA 2DFCA 4V2WA 1RR8C 4QPIC 1SVMA 4W8JA 5GZCA 1A6IA 4HKOA 1QQP1 3LSJA 5L19A 4XRMA 4NHMA 4RHV1 3TEYA 1Z21A 1H6XA 3FLTA 4XIDA 1EAH1 4LBJA 2LKSA 2ZNZA 4D0QA 3VBRC 1GQGA 4BDVB 5ABJC 4Y26A 1YO5C 5IVEA 1CR7A 3DU5A 1H4GA 4QT6A 4FX0A 4OIOF 3TP3A 4XJUA 1QH6A 2DT5A 4HK9A 1D0XA 1TTYA 4FAGA 3PM1A 5HBAA 4HF0A 3WHCA 2VXDA 1UB9A 4XMIA 2ESHA 3VKMA 1OURA 2GA1A 1IJWC 2JA8J 4CU6A 2P3JA 2PJPA 1YJ9I 1H8VA 1UELB 2XL9A 2GLOA 3I4MJ 3ZXLA 4BZ4A 2Z16A 1K4SA 3QLQA 2HEVF 2Z9OA 3JAMK 4SBVA 4HLYA 4LO5B 3JU9A 3P9IA 5HV0A 1LVKA 2A3SA 1IKQA 1VRBA 4H4KC 1QKQA 1ASJ3 3RYKA 1UIKA 2LREA 2X85A 5A33A 1GNYA 3DECA 3W6JB 5DD4A 2MNGA 4DY3A 3M9AA 2AACA 2VZOA 1W8HA 1YLFA 3JW4A 1GFF2 1AYM1 2OKXA 5FFOC 1RETA 3UK9A 1AR71 2XGCA 4XQDA 4ZS2A 4BCUA 5LBBA 2JG9C 2PHWA 4JRAA 3B9CA 4M3GA 1V6JA 1VBC3 3PFYA 2Q8KA 4LMFA 3CCUI 2EXIA 4M73A 2R7EB 5CADA 4II2A 2AQEA 1R1A1 3HZJA 5CBLA 1PMHX 4F3QA 5HLTA 3PDQA 3D8CA 4U7BA 1R49A 3KEYA 4Q4V1 3AG4H 1POQA 4GB32 3U1DA 2AGSA 4HRIA 5HNFA 4CU8A 2JB4A 3JRAA 1PUEE 3B02A 5M3MJ 1NLSA 2W92A 1QHHD 3GTJJ 4AW7A 2J1AA 4LIUA 1O4XA 4NRMA 4G4FA 4FFHA 4RHV2 3VL9A 2A05A 1KYZA 4M9ZA 2BV4A 2QQJA 3RDIA 5L3FA 4Z6YA 1JZ8A 2ZGPA 2DAOA 4IHWA 3S2WA 1G3SA 4BL0B 3NAPC 5E8GA 4B09A 2YGLA 2H6CA 1DQ5A 4RQPC 3W59A 4NAMA 3S30A 1V6LA 3NNGA 3WW1A 4BQNA 1G86A 4AHXA 2FMLA 4P9GA 1H88C 4WM8C 1JZ2A 5KHHA 1W8OA 5KVRA 4LOCA 1BI3A 1RHI2 3RTRA 3ZOBA 2BVLA 1U5XA 4TN7A 1E57A 5T5JA 1Y1WJ 4XXPA 2V5YA 3GHMA 1D2QA 3KCYA 5FZ8A 1H0BA 1SFYA 3RKYA 1DQ4A 3OPTA 2VJIA 5FZIA 2ET7A 3WUCA 4Q0VA 3Q8CA 2LBFA 1Z7S1 3C2UA 2PI0A 3WTTC 4XICA 3R4SA 2E7AA 3HOVJ 4GXOA 3UETA 3DXJF 2ZXQA 4IV1B 2YFUA 3L2VA 2EAKA 1JXNA 2FBEA 4HBNA 1MS8A 1K6OA 3DU6A 2VASA 2D3SA 1VBD1 4NHYA 2Y6GA 3KS7A 2VZ3A 2QCOA 3ZFGA 4CUGA 2MLKA 3PU3A 2X1CA 2ECBA 3VKNA 4LB5A 1FY7A 4QX5A 4AM3A 2X05A 4BISA 1V0AA 1S8NA 2DJNA 1YQ2A 4OQ9A 3TGNA 1AR62 3I8TA 2W25A 1FP2A 2GOMA 2DBNA 2HVSA 3W3CA 4EVIA 2PMUA 4LUMA 1X4OA 4AQSA 1LDKB 3GW2A 5H2FC 3GLLA 1O4ZA 1UAIA 2X1EA 3SZTA 4B4CA 2ZO4A 5LW9A 5CVUA 2NOJB 2YBKA 1WA6X 1JU4A 1F36A 4RLQA 1PUFA 3CF5F 4LG0B 2EXKA 4ITCA 3SCGA 5C8CB 1R5GA 4WXDA 4LTAA 3JAMZ 4M3DA 3KP7A 3MEXA 2PYTA 3VODA 2IRFG 3BTCA 1ETOA 3HRSA 3NQOA 1D1AA 5FJ8J 3LA2A 3ZMOA 3I3BA 2CFOA 1RINA 3CKHA 3O5SA 3LSGA 1N78A 2CSGA 4JGYB 3MW4A 1Q1VA 3D5RC 4NQWB 1JU3A 2KHMA 1DGRN 4H3WA 3ZIWA 1NE6A 2IUWA 2G7UA 2H0VA 1OFCX 4XLPF 2WWUA 4ZC3A 4ITVA 1AX2A 2FCUA 3J7MA 2GNMA 4C9YA 2CO5A 1DUXC 2YU9J 2G19A 4RMNA 3OBRA 1LVAA 1KA8A 1AR82 3V4GA 2E2IJ 1R1VA 3NNFA 2Y0OA 3WGGA 1X2NA 3EUHC 3A21A 4RGSA 2VOVA 3AYAA 1IZ3A 5ANQA 4E9KA 3H3ZA 4BE3A 2V5DA 2KRFA 2ZHMA 2JDMA 2VZVA 3I2DA 3MZHA 2VJXA 3BCWA 3AG2H 1ZBE2 2VLAA 3H35A 1N1VA 2EK5A 3OGVA 5GM0A 5CKNA 3JBG3 5JAXA 4MGRA 3EPZA 4BNCA 3IIAA 1T98A 2WYFA 1S0CA 2R7VA 3FZ3A 2PJRA 4L0ZB 5T54A 1HN1A 3DKYA 5F8PA 1F5TA 3M8LA 3KP3A 3E1F1 1ZGJA 2ZKNA 4RFRB 1FBQA 4QX2A 4LLNA 5E8AA 4NHLA 2QQVA 2HDCA 2XBO2 5GP9A 1ERDA 3WDWA 2VMCA 2MFZA 4EN7B 1PO22 4Q0UA 4XURA 2L0KA 4PDWC 3H9QA 4ESJA 2W95A 1JE8A 4IEOA 3ZO0B 3KP6A 1UG2A 3HOBA 4A44A 1H2LA 2CFXA 5FAXA 5FZLA 2CV1A 4AVBA 2V9PA 4EJRA 1MNEA 2XAGA 2W82A 4GA9A 4UFMA 2OUJA 5C3PA 3SKJE 2EPFA 2F5VA 3VD5A 1O8PA 5CG9A 4Z2AA 5FLHA 5FIXA 3BB6A 1ODMA 1IRZA 2ZX2A 2PN6A 4NNJA 4YM3A 2GP3A 4DZJA 1IF1A 2VNVA 1L7RA 2O8QA 4XYXA 1ZR4A 1YWKA 3KEOA 1PO23 2NN8A 2RGVA 2Y0MA 4ASMB 3OS1A 3ZYJB 5F5CA 3M1HA 3X2QH 5HNHA 3LEMA 4KG8A 5ICEA 4ZHNA 4YG3A 4AWXB 1QJU1 4HOBA 1PIV3 2NMNA 4CGZA 5F3GA 1UAAA 1R58A 3H3LA 1FTZA 5HCBA 5LASA 3SHFA 3V0BB 1RNLA 5F27A 4LE4A 4AI2A 2R16A 4II3A 1NYWA 1YQ6A 4XPVA 1U5TB 1O91A 4CDUB 1CX1A 1FBSA 4QPGA 1IPJA 5L7OB 4XCBA 1SEFA 4MXWA 3D0SA 1W8FA 1GV2A 2XJQA 4OAZA 2EF6A 4HXCA 3OYEA 4Q4V2 4FOQA 5FPAA 4C91A 1J5YA 2ZMEC 4TXWA 2XHKA 1OYIA 4FQGA 3Q8FA 1MJ9A 5A32B 1HV0A 2DN0A 2UYBA 4WVMA 3H9GA 2ERFA 1PMJX 4P5HA 5I0RA 4P5YA 3ZX7A 1OBNA 1BL0A 1AYN2 1GZWB 1DGWA 1W6OA 3VBOB 2V73A 1S3JA 2ZHNA 1Y8RB 1GT0C 4YYOA 4G9YA 2BZTA 2BW3B 4CP1A 4LBMA 2IGKA 1VQNI 2WJSA 4B1LA 1Y39A 3S57A 4QU1A 4CTEA 4HT1T 1QO0D 4OZXA 5CFCB 4RGAA 2TRTA 1W9TA 1CWPA 2QTWB 1ENQA 5EZGA 2OU2A 1V5GA 1JZ4A 1V55H 1O3QA 1ND3A 4ZDOA 4XHXA 3I4IA 5CZKA 2IS6A 1QZYA 2KISA 1KEXA 1QHGA 3WODF 5EIYB 3ZN0A 5F2SA 4LOSA 3HEFA 3OYCA 1B9NA 1ZH5A 1RUOA 2YBPA 5J09A 4S0HB 2RJ2A 1BOAA 3KX2A 1JTZX 3VDDB 2EA4A 1ZK8A 1LKNA 2X6OA 3WDXA 1RB8G 2ZEZA 2BBYA 2HTJA 4A7KA 4IE6A 1NUKA 1V9U3 1HJGA 4U88A 2XF6A 3H3VK 3AYEA 2P5KA 4RSUA 3CC2I 4XRSG 5DUKA 2JIGA 1W0OA 4XFIA 2DF7A 5FFZA 2EV0A 3OSFA 3K70D 3MLJA 3VBRA 1U8BA 4HW0A 1Z67A 4YGEA 4IHTA 1NT0A 4NUBA 2XKPA 4NIAA 4RAZA 1OA2A 3IM0A 2IWGB 5IVCA 2BGPA 5C4WA 3I2GA 4U0WA 5E89A 4XIKA 3CDIA 4M3CA 1W9YA 4XFAA 5FZHA 2ZEXA 2VZPA 5M3FJ 2GMMA 4YG2F 3LFIA 3NAUA 1PK6C 1KFUL 2OV7A 4YRVA 1SVLA 5FZFA 1SEUA 2R071 2Y0SA 1LULA 3KQ4B 1ACIA 3NW4A 2ME0A 3DPRA 5GZEA 1UL9A 5F3IA 1O57A 3ZN4A 3CDLA 3NJZA 4JQTA 3F9KA 1VFCA 2VZ1A 1Z1DA 3V8LA 4W6YA 1R1A3 2E33A 3VN4A 2R7WA 1FV2A 2R7DA 4ISQA 1R082 1VQ4I 4D9JA 2PMHA 5BNNA 5JVGF 1FV3A 1CPMA 1YLLA 3GFLA 5FP4A 4XKVA 4XKCA 1MZBA 2NOGA 3PLQA 1U6GA 2VCCA 1FYKA 1NCQB 4DZPA 1NLQA 2FOWA 4NR1A 2WB1A 2J22A 3AYCA 3I2FA 3E0JB 5DUUA 4LK0F 2RE9A 4E7ZA 1UOGA 1ONVA 2ZACA 5DPNA 2HQRA 3K3OA 3J80K 1Y56A 1LDJA 2YX7A 1LESA 2WT1A 3ZYFA 3GMEA 4JX5A 3FIWA 1P8JA 2PXJA 4PJJA 4TZDA 2W46A 3D0JA 2JDAA 2FCTA 2HKXA 4NB5A 3K75B 3DLLF 2XB6C 3MD2A 1HSJA 1E5HA 2BY2A 3QU6A 5IP7J 1CAVA 1LNSA 2J5OA 1ZBA3 1DDLA 3IIIA 3W5NA 3DPRB 1P9QC 3A23A 3KB5A 4A3MJ 1Z0XA 1W5CC 3N9NA 3DKWA 1XCBA 1FYLA 3OL4A 1PGW1 4AFCA 3FHAA 3MKLA 2VCAA 4BAYA 3NEUA 1NHAA 4ETSA 5JI9A 1HDPA 2XLAA 2ZXJA 3KSCA 2EIEA 5AFEA 2GA2A 3RMXA 4WWCA 5H9RA 5K1YA 2HQAA 5C71A 1CGPA 1XSDA 2ID4A 2L4MA 3I58A 1R1ZA 1B4AA 2KJBA 4IZZA 3ENRA 3MFAA 4JQRA 3O0WA 3QQAA 3IRQA 4WVZA 1W8ZA 3KZZA 2IFRA 1DZQA 1BBT1 3BPXA 1N3PA 1HXS3 1RMU1 5IP9J 1RUD1 2R0QC 2V79A 5FZ4A 1JUMA 3VHPA 2BJSA 1MGTA 1JTXA 5GLZA 3B6AA 3HOTA 2BY0A 3KE2A 5KHKA 3P7NA 3JB4C 1QQIA 1PVC2 3DYOA 5FPBA 3RWKX 1JZ3A 3FBMA 4HYEA 5DN2A 2V72A 2A6VA 5H20A 4AI1A 5IVJA 2XONA 1SPPB 5EQUA 3Q8EA 4MQVA 3HOSA 3AZVA 2P5LC 4C3HJ 3E97A 3W20A 3M70A 2E1NA 2W87A 3HNBM 1HW2A 2E35A 3DPUA 2VQHA 4XAAA 1K78B 1Q56A 2JJ6A 1GOGA 1KYWA 1WZXA 3JD73 3MF9A 4FISA 3B01A 4XUPA 5I8YA 2QSHX 1FYMA 4UT5A 2LLKA 4IW3A 1EPWA 1PX4A 4HANA 2B39A 3M3YJ 4JP0A 2UWMA 4FASD 3AP6A 2YPRA 3H0DA 4MGQA 3VBUC 1H1AA 3HOUJ 4O61A 1U5TC 4F93B 3FXMA 4XR6A 3HBLA 5K9YA 1FOD1 2ZMLA 3K9TA 1JZ7A 3HHHA 4O6JA 1X1CA 4XUTA 3VKLA 1EA3A 1MVEA 3D4KA 1UYZA 2KLOA 1FMD1 1AYM2 3DCQA 3SISA 4L5EA 5HDKA 5FY9A 5T55A 5CLSA 3GJBA 2P3KA 3I56I 2UWCA 2M3AA 4LULA 2AO9A 5K8SA 1A35A 4BY7J 2ZBJA 2Q2EA 4LMYA 5E8IA 4FSJA 1QXPA 4D1QA 5HLGA 1T39A 3TRSB 2VXJA 2C26A 1NCRB 3UJOA 3ZMVA 1O59A 2L7ZA 3ZN5A 5AVPA 3VBOA 2LKPA 5FZ7A 4CUCA 5FZDA 1Y3TA 1UU6A 3SEPA 3WHBA 2CV6A 3TYJA 3B6CA 5ICCA 1W3VA 2ZGKA 4R4ZA 1OKOA 3KGZA 2XUBA 1LOFC 4BXUA 5D2AA 3LA3A 1W6NB 1IAWA 2RMU1 1NXMA 4NROA 2ELJA 2EAAA 4KNYA 1N77A 3JD72 2VUDA 3IDAA 4IX7A 3UKNA 3POFA 3A4UA 1TLHB 3U2RA 2HEOA 2QNKA 1JKQC 2X51A 1SZBA 3T2OA 1IS3A 1GNZA 4YW3A 5CU1A 4DYRA 1W2AX 3ZSJA 1REEA 3LKJA 2AH2A 2D44A 5C44J 4YPJA 4WK8F 3DKXA 4MGIE 3LOBA 2ZNYA 3R61A 3P9CA 1KFXL 2JECA 4X6RB 2ZZQA 1UHSA 3IKVA 2GU9A 3BU0A 3NRUA 4DZGA 5CQGA 1FSEA 1S6LA 3WSOA 2WAQA 1SAXA 4DEVA 1QDOA 5F3CA 4W97A 2GH2A 3CCSI 3AP5A 1TME2 1UD1A 4LGWA 1CZTA 4Q4W2 4B8EA 2IGOA 4NIDA 4I02A 1H2KA 5FQ0B 3MIGA 3HNYM 4LUKA 2UWBA 3MKWB 2DCJA 2ACJA 1R23A 2CDPA 3TEDA 1BKZA 2O8OA 2DFFA 4B3NA 4HN0A 1MEC2 1ZA4A 1UCXA 1B8IA 2JXAA 4M3FA 2E32A 1OJLA 4HPKA 1VRH1 3DEEA 2A07F 2GMPA 2JDHA 1BZWA 3Q0VA 3VBHA 2K9MA 4MX3A 1O4TA 2DTRA 2O7OA 3MUZ1 3B00A 2QZ2A 5FZ1A 5FKMA 2HOTA 5A1AA 2LROA 3EQEA 3DPLC 2V6EA 3AL0B 2G9FA 4JDOA 4IHVA 4BOWA 3FC0A 5C8CC 4E7LA 5JHUA 3ZKYA 4BDYA 4G94A 3LE0A 2YYOA 1WW6A 2LOOA 3ZSMA 3T4VA 1QNTA 2CWMA 2WFPA 1LJ7A 2VMHA 5JZGB 2LC2A 5FZBA 2D45A 3BKZA 3VBHC 1H9TA 4OHWA 2B9UA 2P4EA 4HKLA 1GQPA 3CU7A 2GDFA 4BH9A 3QYFA 3QODA 4UXAA 4A6SA 4ZXKA 3VBRB 4NC6A 3KZIC 2E1CA 2CWEA 2K9SA 1O4YA 3DXTA 5A6YA 2IGNA 1YC61 4CDQC 1OYWA 1DYKA 4PDWA 1WJCA 1R083 2K02A 3HYIA 2M7AA 2H94A 3HXLA 4A4AA 5KHJA 1DQ6A 1Q8PA 4Q29A 2YGMA 2QQMA 2NVUB 1XBFA 4UVCA 2WQZC 2ZX3A 4MGYE 5FKOA 4AEKA 5KHIA 4OOIA 4XDOA 5GKAC 2QE3A 2LS6A 3WTWC 3KLNA 4Y1UA 2XGXA 3S3MA 4PJNA 1W6MA 1IG3A 2RQPA 3MUY1 1UXZA 4Y22A 2PX9A 2W08A 2WY7Q 1ULCA 2YR2A 4DOUA 2ICWG 2EV5A 2RG4A 3DYMA 1XCVA 1SLTA 4JX4A 2VAUA 5SV8A 4RGUA 1LPQA 2ZXIA 4WXCA 4O7XA 1NAEA 1KGYA 4K1ZA 1ZLKA 3FXUA 2FD5A 2RDQA 4Y5SA 2DVBA 5SV5A 1ZN2A 2XF7A 5CVRA 3Q9OA 4UFIA 1W5SA 2VIXA 2KMUA 3UR3C 2XUEA 5FY7A 3NV4A 3JQXA 5BNNC 3ZP5A 2FDJA 3ABTA 1DBNA 3VWBA 5AC91 3RZDJ 1STMA 4CSWA 2PELA 2VR4A 3C7EA 2XAJA 3FUQA 4BJTA 3JRFA 1SLCA 2DCEA 2VODA 4C2MJ 2Y6FA 1Z77A 1AL22 3ZQHA 1UMQA 2ZCWA 1LU1A 1FWZA 2CGOA 2QCSB 2WN3A 1MZ5A 2A1XA 4PDWB 4UUTA 4Y20A 4OIPF 1F5JA 1M1EB 1X33A 3IWFA 1ON1A 5DAPA 1JUSA 3LDBA 2EB7A 4PJYA 3DYPA 4KICA 1FMD3 3OUHA 4JX0A 4IEUA 5EZHA 3PUHA 4LHLA 1EPZA 4Z82A 1K5JA 4OMYA 2XAFA 4GJYA 2ILMA 3GXOA 3EETA 3VBUA 1W2UA 5AC93 2RR12 2IVJA 4P55A 1MH4A 3TN93 3O8GA 4UW6A 4I0AA 3PNVA 3ZLIA 4BMEA 2Y69H 4KU8A 4KIFA 1ODNA 2HWB3 1AF9A 5A1LA 3VDXA 3ZMUA 2NS0A 4I0WB 3NV2A 3KETA 1IUYA 1YOVB 2WO3A 4OIRF 2FBIA 2QENA 5F0FA 2W5FA 2WA4A 3VHRA 1CAUA 3KZYA 1F5FA 1XE8A 3DBHB 2J1VA 5C9AA 1MMSA 2ZAAA 2DTZA 1PK6A 4HNUA 3IH3A 3RQ0A 1PK6B 2RM21 1WVRA 2LF8A 4D5FA 4ESBA 4GB31 3TL4X 4LLLA 3P5BA 1V3FA 4QGMA 3BJOA 3BTJA 1IS5A 1PGW2 1QQP3 5ILSA 2C6YA 4IKFA 1R092 2GQQA 4XILA 1BBT2 2BGOA 2LP0A 4UAPA 2HWB2 2TNFA 4XFFA 4MHUA 3NWKA 2F4LA 2W1UA 3NKGA 3GF2A 2HYJA 3BG9A 3CCVI 4NPLA 4DXZA 4MOAA 3LQRA 2X10A 3I54A 2QKMB 3AP9A 4E2QA 4QKFA 2B46X 4LR4A 3KP4A 4Q4ZF 5C70A 2R49A 2O0YA 1O7LA 2JUGA 3LPFA 1V6OA 1S9HA 4AVPA 3K7AJ 2DYCA 3MMYB 2GXAA 2PMZA 4ZDPA 5K7FA 4OAYA 5FKLA 3F8NA 4H14A 4F91B 1DCSA 3QACA 3CNAA 5A7WA 2MYSA 3H5RA 1JBCA 5B3SH 1HQWA 3UV9A 2GNDA 4XEZA 5CFCC 4A5NA 1NKGA 4OMZA 3AKZA 2RS12 4MV2A 2MC4A 2OCEA 4ENMA 3POIA 1O3SA 5BS6A 4PJMA 3IPVB 1W0TA 4KQ7A 4KMUX 2E2HJ 1R1TA 4IDZA 5I0SA 4GFBA 3CJNA 1CQ9A 1JYXA 2P34A 3AMQA 5J40A 5GTIC 2NPIA 1KDMA 2HWE1 3F95A 1DLLA 5I0UA 3JXSA 1K42A 2YZ4A 1JGGA 3ETPA 1W6PB 2FDHA 3KT4A 3W2WA 1QOSA 1BMV1 3COAC 1IN8A 3RI9A 1PJRA 1MSEC 1QZEA 3THTA 3CLOA 5I91A 3BU7A 1SHWB 5FGMA 1OPMA 3WF3A 2FRHA 5CFDA 2ZABA 2BBVA 2JT1A 4KJZA 3FM5A 5JSOA 1G4DA 4D0PA 1W0NA 3UT0A 1E5RA 3AKRA 1NH3A 4HF2A 2WZEA 5ANNA 3J81Z 4A0YA 4DNCA 2MLGA 3F72A 4QPIB 3SEQA 5E16A 4L18B 1R00A 2XV4S 3DF0A 5F1RA 3M7AA 1RUC2 1NK3P 1XXNA 3DL3A 1V70A 4FTSA 2XASA 5C4JJ 1LODA 1D0ZA 1ZLJA 4GXLA 1UZWA 4Q8LA 3TO6A 4Y13A 3I2IA 1HJFA 5M0TA 4N53C 1VQOI 1A5JA 2K7LA 1AU7A 4JGZA 3WD5A 3VSKA 3O0VA 5LA2A 1AOYA 4O3MA 2JPCA 1CAWA 3L2RA 2LY9A 4OI2A 5D8KB 2TEPA 1XS9A 4RAFA 4FFFA 4QM9A 4FPKA 4PIYA 2D1VA 5A80A 4E4ZA 4BGDA 4JRLA 1RKWA 3S1NJ 4V2VA 2NQYA 1SD7A 4AYBA 3M4OJ 3ZQ7A 4R79A 2K9LA 1C8NA 2DCKA 1LU2A 1G3YA 1XC5A 2DQRA 3U10A 2ZHKA 1UYYA 5KK1A 3ELNA 5K0UC 3PTRB 2OVUA 5DUVA 3MPBA 4GH4A 4LA2A 4HG6B 4EROA 1J0RA 5DV5A 1YQCA 5C4WC 2IXCA 1KQ8A 3BALA 3U4SA 5M5XJ 2WAAA 1YHQI 2WFF3 1LTEA 2R072 2B7EA 5FUNA 4WZCA 5EEHA 4Z2YA 1WW7A 2DA5A 2Z42A 3GCMA 5A7SA 4OFGA 1ZR2A 5BY5A 4PI2A 1XMXA 3ZXEA 3HPHA 2F5EA 4CEWB 2V4JC 3RI4A 3GBWA 2E7XA 5E18F 2K3PA 1CN1A 2NYYA 2XROA 1JS9A 1TL8A 3FMGA 1NA1B 1Z05A 3MIEA 4YG6A 2PQQA 2IT0A 4IOAF 3KD4A 1HCRA 4K2EA 5HV4A 1J3RA 2WZR2 1WA4A 5K0UB 1U0JA 2QQAA 2MC3A 1RIOH 4OULA 2O61A 2WIIB 2LNBA 5F9TA 3ZXKA 3FXQA 5E17F 1MEC1 1CF7B 4E7HA 3HNMA 1XGSA 3BG7A 4IJAA 2JA2A 1IRGA 1XSXA 4KUMA 4FP2A 4KIBA 1VBA3 1TT5B 3KEQA 3OY8A 2MG4A 3N7KA 3J9SA 3C3VA 4KL1A 5JXHA 4NIIA 1QJU2 4EZ4A 4BDZA 2XPUA 1OI6A 4K21A 3V56A 4EWAA 1XU1A 4PHZA 5D5VB 2JE9A 2XJRA 4B7EA 4J19A 1W2TA 2XR4A 4HPQA 4BXSV 3VHNA 5F32A 1RHI3 2D6PA 1VF9A 4XOGA 2VW2A 4RFT0 4JV4A 1PZ7A 1X8MA 4OHVA 3UNPA 2JRTA 2B7YA 1RMU2 4XJZA 3BR6A 4AHYA 4NO4A 1NX9A 1S0JA 3GGLA 1RUE3 3OYIA 5F6LB 4DYQA 2I45A 2CGNA 2XPWA 4A3XA 1WGXA 1BEV2 3PFIA 4PZJA 3IWZA 3ZQQA 2GN3A 3R0AA 2ADDA 1SFNA 1KGSA 3OD4A 5IK4A 1ETQA 2FZ1A 1APNA 1I1SA 2JEMA 5KWRA 4G3YC 4N9HA 5IJRA 4PT6A 3J7HA 1YXWA 5FWJA 3ZFGC 5LZ6A 1ULOA 1N1SA 3K4AA 3JRGA 3TN91 4R4XA 3MAJA 1LNWA 1MBEA 2EIDA 4P9XA 5FZOA 3EYYA 3NMBA 4AHWA 4KMQA 1C28A 2PAEA 1J1TA 3ZRGA 5LEKA 2W91A 5C7GA 3CCLI 3I2OA 1YI7A 4LJHA 3LSMA 5FBJA 1X19A 4K8RB 1AR91 5C4XJ 2DDBA 3LB9A 1X3UA 2KQRA 1F9NA 4QQPA 3CO7C 3DCFA 2ME6A 5D4RA 3UL2A 3BJAA 2LY2A 2JA6J 5HOOA 4S2GA 1LECA 2XGDA 2BYVE 4L0YB 1VBC2 3S5QA 2EZHA 4J00A 4AZZA 5EV7A 3K1MA 1HN0A 2P3IA 2QVOA 4CHUA 1XPWA 2ZHLA 5GLWA 4TLFA 1IXRC 4COWA 3S15J 5EG0B 3I97A 5B1BH 1XSQA 4EQQA 2UY8A 3WG4A 4CEYA 4ENKA 4AHZA 3N9MA 3ZXDA 1VPHA 2VCBA 1IV8A 1AYN1 3G4SI 4RQPA 4Z2WA 4OQ8A 5K7HA 2BRTA 3JBG1 1P92A 4QIWN 1ENHA 2EILH 1U5IA 2VOWA 4GWNA 3GF6A 1OCPA 5JR3A 3LSDA 2VL8A 4I2OA 2ZMKA 4D69A 2IP2A 4A5MA 1L7QA 4OUEA 5FZ0A 1MJBA 3WHUA 4L5IA 5IK5A 1OF4A 3GTPJ 4CYCB 4HKWA 3T09A 5HDNA 4WF2A 3V0AB 3OUIA 5JCTA 5E3MA 3ON7A 3LQCA 5JFRA 4R8HA 4XC9A 5JVTA 3MFCA 3EUAA 2CW8A 3RYPA 4JCKA 3SH4A 4NC8A 1EP0A 1H30A 1GR3A 1U3EM 1MBFA 3S3NA 1Z9CA 1YHFA 3ZMNA 1GV5A 5ILUA 4HG2A 4I99C 1JODA 4BQ1A 3O0XA 4NQWA 3U78A 4ZKTB 1AZDA 1TG7A 5JPNB 4KNCA 2PHUA 2GN7A 1IW7F 1MACA 2GMEA 3IMMA 2IS4A 1OVSA 3QPLA 1GICA 1NY71 1AL23 1W7PD 2W1OA 1T2XA 3VZKA 1XN7A 5FBZA 5GAGJ 1P4XA 2VUCA 2VVDA 1ORKA 1CAXA 3FXKA 3FBNB 3VZNA 3A0BC 3K46A 2JPBA 1CQTA 5HS9A 1HF0A 2XVCA 1B1BA 4LBQB 5KAFC 3K3NA 2YB7A 2RQQA 4CCJA 4FO9A 2DDAA 2L2OA 1OQYA 1XDSA 3CZJA 5ISLA 2CMPA 5B66C 4E4SA 3THCA 4EN0A 4F83A 4YW1A 1F4HA 2YROA 1UYPA 4IEZA 2VBYA 2HWD1 2WB1N 2DV9A 4Q4W3 1W9WA 2WQ8A 5FB2A 1P4AA 1NA1C 2P5VA 1HDKA 5FK7A 4XN0A 3OR2C 1HC8A 1UPIA 4LBLA 3FXRA 2D43A 1WJ5A 1VQPI 5LA9A 3K2OA 1DDNA 5IT3A 2GH8A 1YI9A 1CESA 2C1FA 4A3IJ 4XJ9A 4YIFA 2I07B 2W48A 3C2HA 2JSPA 3J7ZI 4AIHA 3CUQB 4LLOA 1X3ZB 5D5UB 3ROUA 1OPOA 4CH7A 1DIWA 3V8KA 4X6AJ 5A6QA 3J7YJ 2Z3YA 1XRUA 1JXSA 3CJTB 2TCTA 1NA1A 1E3OC 2FDFA 4O9GA 1PO12 2KDZA 2F4IA 2HI3A 4YZ3A 3R4KA 3BZKA 5A7WB 1R71A 3LWCA 5JI6A 1ULFA 2M1BA 1ZRCA 3LWFA 2YS9A 1FSHA 2ZFWA 1RUH1 3ABKH 2ET1A 3PSIA 4PLNA 2P17A 1W36D 2F6BA 2KFDA 3LSIA 2OW4A 2NMOA 2R063 2E60A 3HB9A 3GFIA 1E0EA 4FXKB 2NLRA 3L1PA 4L2NA 1ZZ6A 2XPVA 4E8DA 5JXIA 4XMYA 1JJ8C 1XNKA 2PEXA 2ZS6B 2CUZA 5F64A 1QPIA 2VTFA 2JA7J 3HT1A 4AUXA 4JTOA 5IUQA 1WWXA 4FFGA 4IRHA 5D21A 2ZX4A 2WFF1 3WP3A 1IN7A 1QJZA 5EGOA 4DXRA 3AKPA 3SH5A 4GO1A 4MNUA 2DW4A 5IWFA 2UUZA 1OCCH 2RNGA 4D7TA 4UYBA 1RTVA 4MYEA 2R0FA 2CY6A 1GVDA 1D8JA 2RN7A 1A04A 4L97A 1JI8A 1FNYA 1FOD2 2F4PA 1WKYA 1K6YA 3OYWA 1O6UA 5F0CA 3ITQA 4G12A 4DFSA 2DUPA 5J3LA 2O8XA 3NO8A 4LKFA 4XUQA 4WVMB 3U75A 3FZVA 2VBPA 1I3AA 2LG4A 1U78A 2ELKA 4XM3A 2E2JJ 1CZSA 4RL7A 4NAOA 4YFKF 3K48A 1YE9A 3D5LA 3GZUC 5FP7A 5HLIA 1OISA 1LHUA 5C5TA 2K0GA 3FKIJ 1FAYA 4ENNA 2KPMA 5LBCA 3WNKA 4QWNA 1NZCA 2JTVA 1JZ6A 2HPIA 4LEJA 2JDZA 2A70A 1F8VA 3TOAA 5J8CA 1SD5A 2P4WA 1D8KA 2HWD2 4WM7A 1CJPA 2QYOA 4Q1PA 5FLJA 1UMHA 4GWJA 3CDHA 4IE7A 4OHYA 2GXBA 2D97A 3K10A 1TT0A 2R061 1W1WE 1PHMA 1BQPA 1YFUA 4AVVA 3U1XA 4AVCA 1XYOA 1MMAA 3WQ1A 1X82A 2DO7A 3T0BA 4ON0A 2X9DA 3TN92 3E6BA 5T52A 1GLHA 5JHFA 4TWTA 3ZMZA 1QHDA 2RM22 5J4VA 5LA0A 4RS8A 1D5VA 4M01A 1YQAA 1GUUA 4DQAA 1VBD2 2OF7A 1UG0A 2WBMA 2RVAA 2R92J 2VXRA 4QKDA 3PJQA 3BT9A 1WCKA 5FPZA 1BC7C 4YIIA 1IPKA 2E7QA 1RZ4A 1ZYRF 3WP4A 1VBA1 3VB9A 2HWE3 5LATA 5J98B 4META 2BDRA 2ATFA 3KFWX 3K0LA 4XFHA 2P7VB 1TNTA 2E34A 3NVCA 3OYDA 2ZPXA 1MNDA 2B45X 4JHTA 2E26A 4XF0A 4COVA 2VZUA 1G3TA 4P9LA 2YY1A 3ILRA 2P5BA 4NVPA 2CAUA 3SFZA 4FI9A 4PGHA 1AUYA 4RS5B 2WLQA 4YW5A 3RNSA 2HTSA 1Z0HA 3G3ZA 1ND2A 5DTDA 2DCZA 4IPAA 2WLPA 4BK4A 5EJ3A 2DVDA 3ASOH 2HWC2 2JG8A 1J83A 2BUKA 3ZOIA 3JZVA 2QZ8A 4XQWA 1YG2A 3CCMI 1X2MA 3ZCOA 1ZELA 2GC1A 2DVGA 2ZX1A 4F8AA 3BP8A 1S1AA 5CISA 3ECHA 5A1FA 1L7LA 3H36A 2RREA 4U0YA 1HQLA 2UWAA 1HV1A 1EUTA 3VZMA 1E3HA 4FQ4A 4CDWA 2WZPP 4XK4A 1RUD3 4QKBA 3FHZA 2M45A 3S93A 1SMYF 4HSJA 2OXBA 3MFKA 2YMZA 3P3PA 3IH4A 2CUEA 3ACLA 4BACA 4BQ4A 1MQTB 3LD8A 4IHXA 1K83J 3IP4B 3HWJA 1MNMC 4HV5A 1UMZA 3MDPA 3W2AA 4FPOB 2FBKA 3ESWB 4LO6B 5IPAA 1Z7UA 1UU5A 1F1ZA 4G6DA 1EY2A 1OH3A 5FPVA 3TEWA 4Y5TA 4YVWB 4V19K 3WQBA 3A01B 1XNBA 4JGZB 1OOPC 3OYFA 1WPKA 4IV3C 1XQNA 1C57A 2VC9A 3NJXA 3L7WA 4QWQA 3AJZA 1WSUA 3G6JB 3CQZJ 3WV6A 4MTDA 2RS53 3QYEA 1ZRRA 3KMHA 2COMA 2VONA 1IC8A 2X0LA 2VQ0A 4WV8A 1YYNA 4KWLA 1XDUA 3DEWA 1PP8F 2C5DA 3CMMA 4CP9B 1F2NA 2BZDA 4KH9A 1RITA 2Z79A 3ES1A 1UOJA 1PGL2 3C7GA 1A31A 5FFXA 1U8RA 2K9ZA 3T2PA 3ZN6A 2LALA 4DNYA 2VUAA 4XKBA 1FOYA 1NG6A 2L02A 2KL4A 3DN7A 2VMDA 3UYJA 4JQFA 1OQDA 1KXGA 2JG8B 5FXZA 2DA2A 3ZYPA 1OOPB 5KNLA 3K4BA 1HXDA 2RHPA 4RA2A 2OTLI 3H5NA 5J1XA 3G7DA 1RUD2 3T1LA 3POEA 1ZKGA 2BGCA 4X8NA 2FE3A 1TMF2 5C9AC 3WGHA 3F2ZA 2CTVA 3DGTA 3A01A 3ZQLA 3OMYA 4Q4W1 1B72A 3ZFEA 3E6MA 2W52A 3V0AA 3CCJI 1DQ1A 4LO4B 2XH6A 4XF9A 4I09A 3REOA 3Q5FA 4HQMA 3CO6C 3VZJA 4IL7A 4QX1A 2RJLA 4Y3OA 5F5IA 3VD3A 4A42A 2O0OA 1VI0A 1LGNA 2V26A 5LHHA 1ZGWA 2VH9A 4AVTA 5LBEA 3F6VA 4HL0A 1C4RA 5IATA 2JX9A 3TAYA 3ILNA 1VJ2A 4MO3M 5AIQA 1QQP2 1BJQA 2W0XA 5CNAA 1QEXA 4UVAA 3OYMA 4AFBA 4CO8A 2E1MC 3RYRA 4RGXA 3VBFB 2A3YA 4XN3A 3O12A 4ZU4A 1QPMA 4UW3A 4RN5A 3OJBA 1TE1B 3LAGA 4KWJA 1X1PA 4LOTA 3DBRB 2M34A 2A6XA 4PFPA 1WJEA 1OLQA 4RAYA 2N8GA 1JHNA 1B9MA 1X8EA 1SC7A 2WR9A 3K1NA 3MKZA 5J1UA 1UHWA 4HEA2 3C2GA 2E36A 4Q2FA 2ECCA 1PM4A 2DA6A 3TKYA 1Z6RA 4C30A 1I6HJ 1VE0A 1EJ9A 3OF1A 2R042 2B9SA 2HGCA 5FJKA 4LBNA 4GULA 2A6ZA 4Y15A 5DUWA 2FEZA 3ZM8A 5FMBA 4IEYA 2JMWA 4IEWA 4M6XA 3HOXJ 3NWTA 1J2XA 3JTHA 3EYPA 1I50J 3VBFC 4DRVA 5M5YJ 2WV0A 2DXIA 4NDLA 3HBZA 3ACGA 3BTYA 5JLXA 3O8HA 4AAXA 1TQ5A 5T5PA 3DV8A 2E51A 3CEWA 2DFBA 4M00A 2VPLA 2QSGX 3MIDA 5LBFA 4AFDA 2H1LA 1B35C 1RUH2 4EJOA 2QA4I 1PVEA 2VNRA 2PHDA 4D8MA 4BYYA 1VQMI 2OTJI 4HF1A 2UXNA 4WXHA 3HOWJ 1RIRA 1H8TC 4YLZA 2M4GA 4CZSA 3HBKA 2W3JA 4KU7A 1E5SA 3URFA 2HWE2 5FMCA 2D6KA 2PFBA 1GXPA 1WWYA 2DVAA 1YJLA 2HWC3 4A7ZA 2HBTA 1W6QA 3KT1A 3VZOA 3ZYRA 4AYUA 3ZFEB 1YW7A 2WAFA 3E3VA 1IHMA 3QBQA 2XWBB 4ZXEA 3FL7A 2CHHA 2Y75A 2EALA 4UBGA 4PQQA 5EPAA 5LFAA 3WTVC 1RUC1 3ZKUA 3F8BA 4ZZ5A 1V6NA 2DMUA 2KRCA 5HODA 3UKVA 1VQLI 2X5IB 4XETA 1ND2B 5CJ9A 1RUI1 2RMU3 4C2UA 1JKPC 1U5ZA 3U14A 4YELA 2G7HA 2K27A 1FC3A 4B44A 4OIQF 3CBNA 4BQYA 2TBVA 3AZWA 3UNGC 2DODA 2VQLA 3GZ6A 4UNOA 3RS6A 4ONUA 1EH7A 1U2WA 2FHRA 4Q5OA 3TBIA 4NE9A 5IK7A 4PBPA 2ADUA 3MBWA 1S5LC 4XIOA 3PQKA 1IXCA 2L7MP 5FRNA 1AJOA 3QP5A 3HSEA 1K5MC 2EXHA 3IPVA 3RKQA 2FCVA 3Q0WA 3V64A 3MW2A 3N35A 2K9QA 3O2PE 2BFUS 2ZBKA 1TWHJ 3SDGA 4P02B 3HVDA 4MUVA 4YGBA 2IPQX 1ZNPA 1OR7A 1W36C 2W7NA 4PJLA 1AKHA 1SFPA 4EWDA 2WYSA 4AVZA 3N7MA 4YSFA 3SCHA 1L3LA 2KZVA 2PMZN 3FM3A 3SH3A 5T5LA 1X7NA 1WJDA 4XBQA 3SITA 1NQJA 4CUAA 3AFHA 5F2WA 2PHFA 5FWEA 4UB8C 4HVQA 1FMD2 2HWF1 3OS2A 3RCOA 2ZGNA 2RS52 2EIMH 4E7KA 2WAOA 4FOVA 5LY1A 2Y9ZA 3I3QA 2BBAA 3BOQA 1HW5A 2Z5WA 4BQXA 1US3A 1DYPA 3AK0A 3JR9A 1LFUP 2HNHA 2QQBA 2YSRA 3KF5A 3KVAA 4P9WA 2V1DA 4MGSA 1YYVA 1VQ8I 2HWD3 5D8LB 2I8DA 3LCPA 1JUIA 2A75A 2OUHA 2CUFA 2OPKA 4BB3A 1ST8A 2O8KA 1NE4A 4KN4X 1NY72 3DXUA 5FPXA 2K85A 1Q8VA 1SCRA 4V1PA 4D3WA 4BK5A 1OCRH 2XXZA 2DTWA 4QGNA 4JVAA 4JC1A 5DCMA 4N43B 3HQRA 4Y5Z0 1XGMA 4FPCA 3IN9A 5L7OA 3KZ4C 3OIQA 1WW5A 4AGVA 1C8M2 5FO9B 5JOYA 3BZ6A 2AUYA 3CLQA 5IVYA 4JZRA 2LSOA 2XLFA 2O9LA 1UX7A 1EYBA 2QBYB 1HIXA 1NQDA 2CAVA 1UZCA 2L9LA 2AREA 3VBUB 4AOCA 3LEGA 2DA7A 3WP5A 3E6CC 5FZOB 1Q3EA 5FYIA 1Y6IA 5JSPA 4BQAA 2JJ7A 4XLCA 2K3FA 1ZX5A 2H0BA 2R0HA 3ORJA 2C24A 4LBQD 2A71A 4HMZA 2VMGA 2RVCA 5EDNA 4F52A 3ZR8X 5F5QA 3O6BB 2PLV1 4BLIA 3BG6A 4RLFA 1AHDP 2XVLA 3I3DA 2B4KA 1WI3A 2LMDA 2XWJB 3LAJA 2DYRH 3F0CA 5FYZA 2B63J 4QX7A 4BQQA 4OHZA 1ON2A 3CJIC 2CS3A 5FZMA 2YUSA 1YRNB 2W1WA 2D6OX 2Q4SA 3PJYA 2EQRA 3C8XA 1YRNA 5IYYA 3K77A 3M07A 3ZXFA 2VW1A 2DFEA 4F92B 3P1IA 3NAPA 1DP0A 3JREA 1RUG3 4LHNA 5FZGA 1ZBA2 4HQEA 5LD2C 1VRH2 1OFSA 1O3TA 4LKEA 2RJKA 4MGTA 1F35A 1G8WA 5LWBA 2F5DA 1TME1 4MADA 5EYXA 4P9IA 3K4CA 3R05A 4QX0A 2V4AA 1MVQA 3HR9A 2QQNA 3HHGA 3RZHA 2J5PA 3LSHA 4D5CA 5JWPA 3JBG2 5BUVA 1X4PA 4U87A 3RKXA 3CC7I 4Z8BA 2IZWA 4G6TB 3J7NA 2W47A 4OYUA 4CDXB 5DDJ2 3A0NA 2CRGA 2AXTC 3I3MA 3OPZA 2JG9A 5TJJA 1K78A 4WVVA 2NVXJ 1OLMA 2O5RA 4XZPA 5JXJA 1G7YA 2C9KA 3AMHA 3S17J 5F39A 1QGPA 2ISYA 4YW4A 2OYZA 2ZMNA 2VNOA 2DOEA 2IXJA 3A1YA 1A6CA 4CXWA 3MYXA 4NHJA 3K2ZA 1WLTA 5C3RA 5AFBA 1USTA 1X9TA 1V4RA 1X58A 3HQUA 1RUH3 3AX4A 3H3UA 2X29A 2ZEWA 4HDVA 1HXS2 3KVBA 2LDUA 3ZR5A 2EBIA 3T8TA 5DG2A 2K46A 2Z99A 4M71A 4JHZA 1LDDA 3TDZC 4BEHB 5DAXA 3KCCA 5CFDB 1TWGJ 3SXWA 4XF1A 4M72A 4RB1A 2HQNA 2V1NA 3A2KA 5L9BA 3DLAA 1RUG2 2P7CB 2BOJA 1YTYA 1C8M1 1VMHA 5E1RA 4B4QA 2DK5A 1W6QB 3QP6A 1LOAA 2R4GA 1V6KA 1E3PA 1GXQA 4CA0A 2VQAA 1SFXA 4UWDA 4LITA 2ZZJA 3OBZA 1YQ5A 3WQ7A 4FHTA 3AL6A 1OOPA 4GB33 3BR5A 3F6OA 4H7LA 4CDUA 4OZOA 4MHRA 4RA0A 1MZ6A 1JGSA 2MABA 2VPRA 5CYVA 3T4HB 4IETA 3KYCB 5FYMA 4KG0A 5A3NA 1OD3A 1W5TA 4BJ5C 3MLKA 4YFXF 2ZJQF 4LK1F 1Z3YA 1SMVA 1J59A 1FX5A 1PUFB 2H27A 2RS33 4XJWA 5C3OA 4I0BA 5EG0A 3C18A 1UNBA 4XORA 2BOIA 3AB0A 3ZQGA 4Q4Y3 1TEIA 3T2TA 4A2UA 3O1RA 2QUFA 2LTPA 1GZWA 3POYA 2ZA9A 3W58A 2NP0A 4AQTA 1WJFA 4ZYGA 2E5NA 2HQ5A 1Y9MA 2E7WA 1R091 3ES4A 1JYCA 2M2EA 5FUPA 3HRUA 1SAUA 4Q0PA 1JJ6C 1YEWA 5FY4A 2K40A 3RZOJ 1DGLA 5ERIA 1VBA2 1MH3A 3IAPA 4XF4A 3FK6A 1V6IA 4UV8A 3PUSA 2VE9A 2DCYA 2XB5A 2M5WA 1RJ7A 4LLFA 1C8M3 4DO0A 2DURA 1H6YA 2I2SA 3L9FA 3OOPA 5IT9K 2D6MA 4CDXC 4MFDA 3WU2C 1ZZCA 4FE7A 3WT3A 1STZA 4IQ4A 1JHFA 1RPWA 4XFGA 1F31A 2BQPA 4ZYDA 5FZKA 5A3UA 2DPUA 2A3WA 5F5AA 1AHSA 2DU9A 5IOZA 1FOWA 1K3IA 2L54A 1MBKA 3NV1A 1CD3G 3INAA 1B8IB 4PLOA 3VBHB 5BV6A 1RUF2 3HGGA 1YX3A 1UIJA 1CIWA 1CIYA 5EWSA 3WY6A 1VBE1 2PHLA 3GCXA 3RSJA 3NNLA 2A69F 1S7EA 2F48A 1Y9GA 4YGDA 3J7LA 3UJQA 4BEHA 4P9FA 4PIXA 1WD3A 4B1MA 2LRDA 3HSRA 1R5HA 1T95A 4M0HA 2ZXHA 1CAWB 4IQPA 3WNXA 1BYHA 5E79C 4B48A 2F5FA 2VBXA 2WNVC 4HVRA 1MZEA 1VMFA 2R5YB 2Z5UA 2ADEA 4QX8A 3ZSEA 4COUA 2TUNA 1HRI1 1QBJA 4YRDA 3I0TA 5TISC 4MO7A 3POJA 3A02A 2RDPA 5IOYA 2JWPA 1B35B 2JQ7A 2WAEA 1S55A 3HPGA 4IV1A 2EFPA 1GWKA 3HUGA 4UB6C 5CB7A 2Y26A 3PUIA 2VC0A 5H9SA 4L99A 4NIGA 1OFNA 3AMPA 4Y52J 4YM2A 4Y20B 1UY2A 1IXSB 3Q9VA 1DP3A 2RS11 2XKOA 4F3JA 1OXCA 2FNAA 3OYHA 1QJEA 3MPPG 1N3OA 3HRTA 1AXYA 1YJNI 4Y17A 2D93A 1WCSA 5I8SA 4UW4A 3S7EA 1HB2A 1POV1 1FATA 5J1YA 1VBE3 2PLV3 4PF1A 3L2UA 4WM8A 3UKGA 1SBEA 5LHIA 2WNUA 4LIVA 1YIFA 5DZFA 1VRH3 2A6TA 3O1VA 1J3QA 3NJYA 4ZDLA 5A32A 4BE2A 1X50A 1HKQA 5LRSA 2ZOEB 4OI1A 2R30A 3OYBA 4COZA 1TZLA 1QDCA 4YVSA 2WDBA 2W00A 1YJWI 2XBO3 4QAWA 1Z6TA 3CTAA 4CEYB 3FDYA 4CDWB 4FPGA 4QPGC 1HBXG 3WCSA 4W1UA 4FPJA 3BTZA 4QDQA 2CH0A 1JI6A 2R7FA 4J6GA 3J7AO 3S2DJ 5FMDA 1NG0A 2NVYJ 4RQPB 5FZ6A 2KXLA 4P1WA 4JKLA 4L9VA 1LEDA 3AXEA 3W9AA 1V00A 2FXAA 3ZPLA 3F23A 1PVC1 4O9EA 2MA3A 4AD9A 3V65A 2AR6A 3CP8A 2L3DA 1UW8A 4G7ZF 3TO9A 4BQ5A 5FY8A 5BOXA 3HD8B 1K12A 3HJEA 2C9AA 3PJRA 1ZARA 3N7LA 2WZ8A 4LKDA 2X4HA 1JN2P 4M6VA 1V5EA 2FDGA 2JDKA 2BOLA 3NRVA 2EFWA 4A7YA 1B6AA 1FI2A 4S04A 4W4ZA 1WJAA 4AI0A 1ZAOA 1SLAA 2VBZA 2VL4A 1YUDA 1FPN1 2DLLA 2WNOA 2RDRA 4LHSA 2ID3A 5FR3A 2CQNA 2LBFB 2J1UA 4DQ2A 1XX5A 4Y4RA 1I39A 4JK1X 1ND2C 2X5IC 3AZYA 1AJKA 2OQRA 1D1BA 1WI9A 3T1BA 1QNWA 4PSWA 4R9CA 3OIOA 5J48A 2K2SA 2STTA 5FOBB 4LNVA 3RZLA 1W39A 3L2QA 3B94A 1R4MB 4UF0A 5CAZA 3RZKA 2WFF2 4K6BA 4RYDA 5HVQC 2Y64A 2L9SA 2VU9A 4ENJA 1QXJA 1LFPA 1ZHFA 5GPAA 3GFJA 1EAH2 5G04L 1XPXA 1UKRA 2BP6A 4D6QA 1G9AA 5LGTA 1WUVA 2XGEA 3WEZA 1MQTC 4UFLA 5FY1A 5IHRA 1H8TB 3GO5A 2HWVA 1BLZA 3WNMA 2P6HA 4TYSA 1BR4A 4AQ2A 3BYWA 3N7JA 3K4MA 2Q1MA 2WZR1 2HWB1 5HS7A 1O3RA 1ZYBA 3I5UA 3AKSA 3K4NA 2NM1A 3AYDA 2V7FA 2DU1A 1GLNA 1JYVA 4IF4A 4RS5A 1BK0A 3RPUA 5E1ZB 4M3EA 3PIOF 4CCKA 3ATGA 2RDSA 3OYLA 3O3KA 4NBQA 3V7RA 5BNNB 1XMAA 2IS2A 3EUHA 2L7FP 4HSTA 3H42B 5BNOA 2M9HA 1W4MA 2KIFA 3QOPA 4HNTA 1CAXB 2ZMEB 1P6RA 4YZ1A 4K7JA 1HXS1 1RMU3 3VSLA 2A6YA 3VKOA 4UV9A 5L3DA 5A3MA 4HN1A 4M4RA 4G8XA 1GNHA 3A7QA 2D3PA 2CU7A 1DGWY 5FV3A 2DU0A 4HVOA 5A33B 2BE5F 1GHCA 5IYBJ 1ONAA 6PAXA 3I49A 2G9ZA 2VOOA 4IHSA 3J4UH 2JDPA 4M3CF 4YW2A 4OMCA 1CAUB 5BYNA 3MKYB 4J01A 3OS0A 1ULDA 3GNEA 1MQTA 4XMAA 4QDSA 3AFGA 2VMFA 4KA4A 2MD5A 1VBE2 3BROA 3T0DA 2Y8KA 4E4DX 4LD5A 2VOXA 3LIGA 4KISA 5A70A 2A61A 2JE8A 3FE5A 4B7KA 3FF5A 5LGNA 2MPFA 3USUB 3GBGA 1KS4A 2G1MA 2ZMEA 4AK3A 1LFBA 3BIEA 3ZQFA 2ES3A 5A3PA 3VYSB 1IO2A 3VB2A 3T5XA 4OUMA 3BQYA 2DUOA 1HRI2 1MIJA 5GPCA 1V54H 4RDUA 3KV4A 4UHTA 3V7SA 4B47A 3HL2A 3VFZA 2A68F 4IESA 4IRGA 3ZIXA 2CV2A 1Z3XA 2GAUA 4UFJA 4E7JA 1R081 4XQFA 1S29A 1PX3A 1AWCA 5JIUA 3RWNA 3S8PA 3WF0A 1IRFA 1LENA 2VCMA 2H1KA 4JKKA 3SEZA 3CCYA 4XOTA 3HTSB 2GZWA 1VBB1 2WKKA 1QMJA 3ZFFC 2WS92 4BU2A 3MGUA 5H9QA 4NPRA 4D6RA 2DPDA 1IRXA 1IS6A 2JENA 1HB1A 2R7QA 4L9NA 3V7CA 4UFKA 3W6KB 5EEGA 4AIKA 3H9JA 1PYVA 5J37A 4XTPA 2NAZA 4LPLA 4AGGA 1VAMA 2FDKA 1A6QA 3AL0C 5B5EC 2AHQA 3RJ2X 2DFIA 2F4MB 1WMFA 3X29B 3A03A 5KXCA 2HZDA 4AF9A 2OS2A 5ACA2 2QQ9A 1WBFA 2WNUB 2WNVA 3D3AA 3WDVA 1OT5A 4CUBA 1WMXA 3C7OA 1XYNA 1RUJ1 2XG3A 1QY4A 2QWWA 1EF4A 1W7PB 3VBSA 2B0LA 4IL6C 3H5AA 2YHJA 1W0UA 5CPRB 1ZVFA 4QTRA 2ZGMA 3JSOA 3WW3A 3OIPA 4GMP1 5FYVA 3H8UA 4FETA 3ML6A 3FFZA 5T3NA 2FMDA 4XDQA 1Q8QA 3DQVC 1G9DA 3OGRA 2PAKA 2J42A 2IFWA 2WNEA 4CPBA 2CGPA 3R4DB 5BNPB 3CUQA 2L5QA 3U07A 5JR2A 3O14A 2PA7A 1IGOA 3UKTA 4CDWC 2WSVA 1FOD3 2XRNA 1HQCA 3D5OA 2LW8A 2EIKH 2Y6HA 3PNTA 3WINE 2ETHA 2HYKA 4A6EA 5JLWA 2WINB 4LE3A 4DYCA 4ES9A 3SQNA 1NOVA 4QPQA 3L2CA 1KJLA 1Z91A 1L0OC 1B09A 4EYUA 4Q1RA 4IE5A 2HOEA 5BMZA 4WM7B 4Y1XA 3B93A 1NG7A 2P0WA 3DUIA 2AENA 5C3QA 1TWFJ 3FISA 2HYFA 2EICA 3PL0A 2R073 2QDNA 1HB3A 5FLVA 3WG9A 1VTNC 4A3GJ 2KD7A 2D5FA 1F4AA 1IN5A 2R7RA 1UYXA 1XMKA 2DOFA 3L00A 4AEDB 2W9XA 1YFXA 4NJ4A 3IH2A 3EXUA 1ZZ9A 1VAKA 4FXGB 2DTYA 1DPUA 1Y9QA 3JCIA 4EM2A 5GLUA 4GYGA 3C7JA 2W4SA 1LKXA 4H7MA 3FFQA 3MZYA 1R9TJ 3OTFA 2CJJA 3GYDA 1RUF1 4FT8A 4KDPA 4NOTA 1DHKB