2H6BA

Crystal structure of oxidized cprk in complex with o-chlorophenolacetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
239
Chain Sequence
VEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSVDKLAAALDHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ChloroPhenol Reduction gene K
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 68
structure length 239
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6bA01
2DQLA 1CAUA 5FPZA 4LUMA 1R22A 2A3SA 3ZQ7A 1ZREA 3P7NA 1HKQA 1VJ2A 2J5PA 1ZZCA 2PHLA 2FSWA 2HQNA 4IEOA 1SFUA 2CSOA 2B9UA 2PMUA 3FM5A 1IZ1A 1O4TA 1HW2A 2DBBA 1Z91A 4IEXA 3SQNA 1XRUA 4K8FA 4ZU4A 3T5XA 3QOPA 4IHSA 2EVXA 2O6GE 4E2GA 5DEQA 3BJAA 5F1RA 4IVNA 3V7SA 3VB2A 3W6JB 3ML6A 3SMHA 1B59A 4U7DA 1P4XA 2DK8A 1ZGJA 4Q5SF 1W7PB 1BN5A 4XFBA 1CX4A 5BMZA 3SXYA 4XLPF 3M7GA 2QM3A 1T98A 1UW8A 1EH8A 2P8TA 3EYYA 1HW1A 4MQVA 2FBIA 2LF8A 5EEGA 4JBAA 5J8CA 3JZVA 4RB0A 4MGKE 1PM7A 3KETA 5J8FA 3E6MA 4QX5A 1V4RA 5DD4A 2VXZA 4HQMA 2DCTA 1B9MA 4A0XA 3IWFA 3C3WA 2LDUA 1ZH5A 1SFNA 5FQ0A 5EEHA 1J5YA 4LGWA 2YX4A 4BHCA 1T0FA 3L00A 3KMHA 1UIJA 2PQQA 4EM0B 2A6EF 2PMHA 4FAHA 1S7AA 1SFEA 3NL1A 3MPBA 4BYYA 1TBXA 3GF2A 1D8KA 4UVBA 3EYIA 2D45A 1S7OA 5BPIA 4BIFA 2EFWA 4X6RB 3F3XA 4AD9A 4IEVA 5T3NA 1KQ8A 2QBYA 3V8KA 4UV9A 1L3JA 2Z9OA 1IXCA 2DO7A 4A6EA 1I1SA 1UD1A 1ZHFA 4YYOA 1JXSA 4M74A 2ETEA 2IA1A 1BI0A 1SD5A 5FLHA 4G6QA 4D7SA 4HBNA 2GWRA 1ZX5A 5E1XA 1X82A 1DPRA 1Z1DA 3WTSC 2A6HF 4IEQA 1MDMA 5H6QA 4FAGA 3DV8A 3J7AO 1NXMA 4PDKA 2ELHA 4QM9A 4LK0F 3EQLF 1ZNPA 3IIAA 4A12A 4LLNA 1UIKA 3DFGA 1IN4A 3G3ZA 3QRFF 3V8LA 3D5LA 2BE5F 3HRTA 4YFNF 3D82A 1Z7UA 1G4DA 4OINF 4MTDA 3E3VA 5D5UB 1NHAA 4D0PA 5HLGA 4ENNA 1S29A 1TQMA 4EM1A 5IT3A 4EM2A 1J58A 3R60A 4XSXF 2CV6A 4UXAA 3GZ5A 1SQ4A 2AS5F 1K78A 2DFIA 2ESHA 1OD5A 4P9GA 2P7VB 1R00A 1IPJA 2HFHA 1WWXA 4P55A 5LRSA 2D2WA 4HX4A 2Y48A 1QXJA 3KSCA 3VHRA 2ZO4A 2XLGA 4Q47A 5ICGA 3ZMSA 5E16A 2O1QA 5TJJA 4O6JA 1SEFA 4GULA 2GQQA 3ZMUA 4PIZA 4HN1A 4LULA 4IEWA 1CAWB 4UXNA 5E1RA 2F2EA 1P6RA 1YS7A 4Z07A 4Q0PA 3E6DA 5K1YA 1L3LA 3H3UA 1G3TA 3MFKA 4KT5C 1MJBA 3IL2A 3KZZA 1UCRA 1ZRRA 3P9IA 1AWCA 4EJTA 2FF4A 2CAVA 5JSRA 1U5TA 1HSTA 2E7XA 2VE9A 1MKMA 5H20A 4KWLA 1GHCA 4HVOA 2K0GA 2M8EA 4MEXF 3FZ3A 4S04A 5TRDA 2PI0A 3HHHA 1RIOH 2ZCWA 1Y9QA 1QPMA 2NRAC 2OU2A 4BHPA 3F8CA 1Q5OA 1VTNC 3RJPA 5D5VB 1KU7A 3ZMDA 1J3PA 2DU9A 3G73A 3WTVC 4Q0VA 4WF2A 1FLIA 3SHFA 1ZN2A 2FQPA 3I4PA 2NS0A 2D93A 2MBFA 4M72A 1ZARA 5D4SA 1ZYRF 3KFWX 2PFBA 3DP7A 2LSOA 2GIVA 2EA7A 2NAZA 3GO5A 3L9FA 1MD0A 5HS7A 4OIRF 1PP8F 3HYIA 4N9IA 1UPIA 2E7WA 5CVUA 3IDCB 3B73A 3I64A 4HLYA 3S7EA 1ZZBA 4FT8A 5I91A 4RB3C 1PUEE 4QGMA 5AIQA 4CYDA 3MEXA 4Z82A 4RGXA 3WE2A 1XE7A 4NQWA 2FNPA 4U7BA 4FBFA 3HRSA 1IUYA 1EH6A 2GZWA 4B29A 4G7OF 3I7DA 2L01A 2A68F 2IPQX 3E5QA 5KHKA 3WE3A 3USSA 2EJRA 3CUQA 4WXCA 1CGPA 2NYXA 1TNTA 1ZGAA 4OIOF 1B1BA 3RTRA 5HLHA 1MZBA 1YFWA 2VT2A 1XMAA 2UYBA 1WLTA 2IXIA 4IESA 3BZ6A 2ZKZA 3ZP5A 1QXRA 5D6EA 1YO5C 4EJWA 3BJ6A 2RN7A 4XF0A 2ZNZA 1IN6A 3GWZA 3R0AA 3F72A 3CTAA 3WTUC 3H92A 2VC0A 4DNCA 5LHHA 2IXHA 2ZJ2A 2IA0A 1U8RA 5KHIA 1DDNA 5EFUA 1YW8A 3WODF 1B9NA 1FYMA 5I0SA 2K86A 4Q0UA 3OV8A 3S0MA 4ZZLA 3U1DA 2P4WA 2GU9A 3BPZA 1D5VA 4MGYE 2IXJA 4QGNA 2JT1A 2QVOA 2HGCA 3KP2A 2IT0A 3TOAA 2V1XA 4XFIA 1BJAA 2N7GA 2PN6A 3H50A 2AXLA 3SCGA 3WW2A 4NHJA 2Z33A 2B8MA 2BEOA 3K9TA 4I0BA 2G7UA 1CAVB 4I0AA 4OLLA 1R1UA 1REPC 4MZUA 5I8TA 5CVVA 3KEQA 1FX7A 2HZTA 2LNBA 3SHRA 3CUQC 3ISPA 1GQHA 4UV8A 4M9ZA 2EV5A 2JZYA 2O03A 5JR7B 1SD6A 2QDRA 4ZZDA 2XAHA 4KMUX 2VECA 3IHUA 3KZYA 2VBWA 3SZPA 4XFHA 4IHTA 4HSJA 2P6SA 3T8RA 4QGLA 4G7HF 1X8MA 3GXOA 2KIMA 5L3DA 4ESBA 2Q4SA 2FE3A 4LFUA 1YFHA 3HRMA 1UHMA 4XETA 5DUKA 4YG2F 3N4MA 1UB9A 2IVMA 3FMRA 2BNNA 5HVQC 1QQIA 5FPXA 1XSXA 3DQVC 2EFNA 2RDPA 4Q29A 3JTGA 4HMZA 3ERED 1AOYA 4UVCA 3KP5A 5HDNA 3HTUA 3MZYA 5ICCA 4UHTA 3PLQA 1WRJA 4OOIA 4YIFA 4L2NA 1LJ9A 3GX4X 3LOIA 4HOBA 5CU1A 2CAUA 1YQAA 3FHIB 5LGNA 3V7RA 2YR2A 5LHIA 2ZMEB 3LFKA 1O3TA 4QWQA 1W4MA 2D1VA 3DPLC 2OA2A 2MH9A 3I59B 4G94A 4WXDA 4LJZF 4M73A 3R0JA 1SD4A 1X3UA 3LAJA 4GYGA 1O3SA 2QENA 3AAFA 2ATFA 3KGLA 1P2FA 2L4MA 4HZFA 4EROA 2XGXA 3I0TA 5K5OA 3KP4A 5E1ZB 2PA7A 3J81Z 3MWMA 2UY9A 1USTA 3MZHA 3ELNA 5CJ9A 1ZLKA 3EUHA 2OPKA 5ED4A 2PFWA 4I02A 1IN7A 2O0YA 1O5LA 2W25A 2QQ9A 4LD5A 4R52A 1XGSA 2CW0F 4G7ZF 1LEAA 4AXOA 3Q9VA 1W5TA 3T1BA 1DZRA 1LQ1A 2Q0OA 4A5MA 3IKVA 2V79A 3TNQA 3VFZA 2X4HA 4OU0A 5JAXA 4XF3A 2QQAA 1X8EA 1YG2A 1OPCA 1FYLA 5FQ0B 2XL7A 2A07F 5AONA 1FYKA 3WTZA 2MA3A 2IA2A 4BAYA 4EJUA 2OAZA 4HVQA 4M6YA 2E1CA 1W7PD 3BY6A 1TW2A 5BPXA 4I7HA 2FQ3A 4CDGA 4LG0A 1H9GA 1XD7A 4KMFA 1QY4A 3IC7A 5D4RA 3HRUA 1YIOA 5K8SA 3HT1A 4HA8A 2ZFWA 2EV6A 3REOA 2DK5A 1J3RA 4Y15A 1OR7A 2UZKA 2VN2A 4EWEA 2V09A 1RI7A 4R8HA 2XL9A 2MPFA 3TO6A 3ECOA 2F5CA 2PQ8A 2R7DA 4MQ9F 4G9YA 1JHHA 1LDJA 4O9EA 1R7JA 5BPDA 2XVCA 3ABTA 4CXFA 3WTXC 1O5UA 4G6DA 3GLXA 5JSOA 2TDXA 3KLNA 2FU4A 1HXDA 6PAXA 4L11A 1FBUA 2ZKLA 2G9WA 3RKXA 2GXBA 3F21A 4R79A 3ZMZA 3ECHA 1ZVFA 2F5FA 3OD0A 1RTVA 5BUVA 4LLGF 1Z6RA 4RGRA 3LSTA 3CJXA 4OMZA 1SFXA 1E2XA 3FXUA 2ZNYA 2FOKA 3KLOA 3BU7A 2XAGA 1K78B 3RDIA 4WZCA 2ZXJA 4MV2A 3J80K 1FPQA 3K69A 2QVSB 1YW7A 4BXUA 1HKTA 2GXGA 3OGJA 1OYWA 3RZZA 2V1UA 1ZZ6A 5H6RA 5LLQA 4M6XA 2FEZA 2F5DA 2MD5A 3WTWC 4BH9A 4IETA 3NSTA 5K5RA 1MJAA 4H0EA 3J81K 4D7TA 1L0OC 1LKNA 4LTAA 4MX3A 2GC2A 2H27A 3IRRA 3GUDA 2PYTA 5E17F 3KP6A 1BI2A 1Q3EA 2ET7A 5LGTA 5I8SA 1STZA 5A2QZ 5FLXZ 3D0SA 3M1EA 4PGHA 2P17A 1V70A 5CVRA 3WTTC 1U5TB 3T8TA 4XEZA 2MHFA 4MUVA 2RKHA 1TQ5A 1PP7U 3GYDA 4EV0A 2STWA 1O57A 3MQ0A 3OCPA 4IPAA 4AIJA 3GW2A 3WW1A 3E5UA 4R1HA 1CF7B 4XFGA 1USSA 2MLKA 1ODDA 3RKWA 2OQGA 3MCZA 2YPRA 1WI9A 1UCXA 4A0ZA 4U0VA 1V3FA 4RAYA 2QLZA 5ICEA 2IP2A 1KYWA 4IRGA 3F8NA 1NE4A 1BC8C 1EYBA 2BBYA 2KKOA 2OBPA 4L5IA 1RUNA 1WSUA 4HVRA 4LEJA 3TNPB 1W5SA 1QNTA 2M45A 2ISYA 5KHJA 2QWWA 3LAPA 1YLFA 2GC0A 3QPTA 4ZU7A 3LQRA 1J59A 4E2SA 3B02A 5FD6A 4PIYA 2Z5UA 4WXHA 2DAOA 4IF4A 1R5HA 5JI6A 5LRRA 2F4PA 2QJVA 3V7CA 2H6CA 4HF2A 3C18A 2WFPA 4HYEA 2Z69A 4RAZA 2I45A 2EV0A 4ZYHA 4ZYGA 3DXJF 3ELKA 4QLCU 2IXKA 1YW9A 5HDKA 2JSCA 3EDPA 4JVAA 5FCCA 5I0UA 2RQPA 5BXXA 3H1YA 3F6VA 5C8WA 1CAWA 3JTHA 5HOOA 5E20A 5I93A 4G8XA 5I0TA 2HOEA 3WTYC 4KYWA 2XASA 3LA3A 5JHUA 1WQ2A 1J75A 4HV5A 1LR5A 2QZ8A 1BBYA 4MGZE 2HKOA 2VONA 2DTRA 3E6BA 3QACA 4A5NA 4RB1A 4YARA 4A6DA 4EQQA 5KHGA 4FX0A 4IEYA 2Z2SB 2MH2A 4ON0A 1GXQA 5AVPA 2BNOA 2UWMA 3EETA 4ZYEA 1G3YA 4XFAA 5K5QA 4I2OA 4XF1A 4LB5A 5F64A 2JPCA 2OZ6A 1IRFA 3U11A 1NYWA 2K4BA 3CDHA 4Q0QA 4RD7A 1KU2A 3QAHA 2OZUA 5DUIA 1KGSA 4KL1A 5A2QK 4CHUA 5FLXK 1FC3A 3ZPLA 4YFKF 3BOQA 1T6SA 1J2XA 4WCGA 5CYVA 1O7FA 3GFJA 3F23A 1PDNC 3HUGA 4IRIA 3CL1A 3O14A 1XB4A 2MC3A 4LLLA 1KQ9A 4FX4A 1Z6TA 1B6AA 3F22A 2STTA 2FXAA 5DCMB 4LUKA 1YHFA 3I54A 1HKSA 4TLFA 2EK5A 4ESJA 1IAWA 1DP7P 2MNGA 5L3FA 2RNJA 5D5WB 3QP5A 1YFUA 4GGGA 3COAC 2XLAA 5ERIA 4IEZA 1LNWA 1TW3A 1ONVA 4B09A 2HS5A 2EFOA 4KUMA 1H1IA 4M71A 3KP7A 4IERA 3P9CA 2ZBKA 1K6OA 1XGMA 4KWJA 4YNIA 1EV7A 2ADUA 4GCVA 4HAMA 2V1DA 4PZJA 5KHHA 1JHFA 3FX3A 4L0YB 1BM9A 2D1HA 1TLHB 4HQEA 3SXWA 4M9XA 2DI3A 2K02A 3M9AA 5AIPA 2L3DA 2KJCA 1ON2A 4B8XA 3ES4A 1FP1D 2GA2A 4QM8A 3BCWA 1RNLA 1XCBA 3LA2A 3CO7C 3HOTA 1QBJA 2JTVA 1RGSA 4KDPA 2HKXA 1P4AA 1ULYA 3ROUA 3BROA 3JSPA 3CEWA 4ENKA 3F8FA 1GQGA 3DKWA 3TKYA 5FGMA 3L2CA 2DW4A 2D5FA 4HSLA 2MLGA 3EHKA 2JRTA 4TV7A 5CADA 1RUOA 2B0LA 3O3KA 3KP3A 4IEUA 5J6XA 3K1MA 3QP6A 2RVCA 3K1NA 2EA2A 3OOPA 1FNNA 2HTJA 1VR3A 2CG4A 3W6KB 2H94A 5E1WA 3TO7A 2K27A 2UY8A 4EMSA 1WA4A 3LAGA 4GYIA 1XSDA 3JAMK 1YFYA 3HSEA 2KIUA 5JVTA 5LBQA 1CAXA 3KGZA 3G7DA 2FMYA 3I53A 1K79A 4KNYA 4OMYA 1C0WA 2HYFA 4UUVA 1Z9CA 4JQFA 5FLJA 1J1LA 3ULQB 1ZG1A 3WW4A 5J7MA 1DUXC 3UKVA 3FF5A 1YWKA 2XROA 2A69F 2XAJA 1T2KA 4MEYF 1IN8A 4XSZF 3C1DA 1XCVA 4IRHA 4ZYDA 5HDGA 4KIFA 4XBFA 4KA4A 4YRDA 3DF8A 3GYHX 4O5VA 2CQKA 2QUFA 1CAUB 5DCFA 1XGOA 1YTYA 2IJLA 3O2PE 1JGSA 2HWVA 5C6CA 1X7NA 2HYGD 3HSFA 1XDSA 1B4AA 1FI2A 2XHKA 1EY2A 1XSVA 3J80Z 1FP2A 2UXNA 2Z3YA 2O61A 2BNMA 4BNCA 2EA4A 3H3ZA 4QMAA 3EBRA 3LQQA 3RI4A 5D1IA 3BALA 4LMYA 2FBKA 4CGZA 2FRHA 3S2WA 4HX8A 1R5GA 2O8XA 4HLTA 3JW4A 5ILSA 4OFGA 1TTYA 1OYYA 2VBYA 1XMKA 3U10A 3CLOA 3GVAA 1DZTA 2QQBA 1R23A 3GZ6A 1FWZA 4Q48A 4LG0B 4XFCA 1BI3A 5KBFA 4L9JA 2FBHA 3NVCA 2WWYA 2KIFA 2L02A 1O3RA 3BB6A 1EH7A 1DPUA 3KE2A 1GVJA 3MDPA 4IEPA 4AIHA 3FMQA 5I8YA 4CO8A 5DYMA 2ZMEA 3PVBB 1D3YA 4BQAA 1QZZA 1ZAOA 2XAFA 3I71A 4N9HA 4X6QB 3H7YA 5KK1A 5JFRA 2XLFA 3M3IA 1OI6A 4EVIA 4I98B 3I59A 1IXRC 3L7WA 2ACJA 3Q5FA 3EQEA 1IN5A 1OMIA 5L3GA 5LHGA 2HEOA 1I27A 1XN7A 4RGUA 2ET1A 2Q1ZB 4EWDA 2LKPA 5IT9K 1IPKA 1T39A 2IXLA 1HQCA 1U2WA 4L9TA 3TO9A 2QBYB 4O9GA 2YX7A 1ZLJA 2GH2A 3IKTA 3K0LA 2Q30A 1SMYF 5BV6A 4LLOA 1R1VA 5JCTA 2GA1A 1GXPA 5LGUA 2F5EA 3D0JA 3BPXA 3N97A 1IF1A 2XRNA 4NVPA 4WVZA 2Q8KA 2CO5A 5CVJA 1MDMB 2VBXA 4A2UA 4ENMA 2EAAA 1NZCA 2HR3A 1G3SA 1F4KA 2Q0AA 1I6XA 4H7LA 4AQ2A 3JSOA 3K2ZA 3NKTA 3GFMA 3BP8A 4KIGA 4L18B 4U0YA 3E97A 2ESNA 3LWFA 2EB7A 1T38A 3ZMTA 1Y3TA 1EP0A 3CJNA 2Q2EA 4KN4X 4AWXB 1H1MA 1IRGA 5HS9A 2NNYA 1OKRA 1FSHA 1RL3A 1YUDA 1W7PA 3BPVA 3VOEA 2L4AA 1KYZA 1O7LA 4RB2C 3FXRA 3UKTA 3U9GA 2BV6A 5D8KB 2Y75A 5E8IA 1KU3A 1Z05A 4ENJA 1BOAA 3GBFA 5FLIA 1F1ZA 4O3MA 3EO6A 2L54A 4MGIE 3NRVA 3FXQA 4EJVA 1S3JA 2LF7A 2V9VA 5FB2A 2GC3A 4EGYA 3IRQA 3H1MA 4MTEA 1F5TA 1O3QA 5DDGA 2Y0OA 3OF1A 2W85A 4RS8A 2QNKA 4XF9A 2H09A 2O3FA 3FM3A 1UFMA 3QU3A 2P6TA 3ETQA 3HOSA 4WWCA 4AVPA 1KQ0A 4U0WA 3SCHA 2XKOA 4XLNF 3U0ZA 2NNNA 4KICA 1U3EM 3KEOA 2M87A 3IBMA 2K4JA 1PMIA 4AVBA 1J7KA 3HHGA 5FFXA 2EFPA 4P5OA 2P5LC 2GAUA 4GXOA 3E5XA 4XRFA 4ESFA 3R6SA 4HV6A 2EWNA 3M70A 4HF1A 4HX7A 2W57A 3VEPA 2HQRA 2XIGA 3WGIA 1RC6A 3PNAA 3L2HA 1R1TA 2X0LA 4EGZA 3CLPA 1SAXA 3FZVA 1LDKB 1XDUA 1SMTA 2P7CB 4P9FA 2QCSB 3RYPA 5L3EA 3C7JA 1MGTA 2RC4A 3NEUA 4PCQA 4Z2YA 4L5JA 5BQTA 2OQRA 1FBQA 1FOKA 2PAMA 2PTMA 2Z99A 2P5VA 3HSRA 3MAJA 2P5KA 3WU1B 1RZ4A 2WV0A 2CYYA 2COMA 2RV8A 1Y0UA 5I0RA 2YSRA 4WBBA 2B5HA 1ZRFA 3KCCA 4HF0A 4J1XA 1HSJA 3ACLA 4PJYA 2J5OA 1U78A 4ZU5A 2XV4S 5LEJA 3RKYA 1FXZA 3M8EA 4KWKA 4HBLA 4ASNA 2QYOA 3ABUA 5BY5A 2W84A 1HW5A 1J3QA 1LB2A 3HQXA 1ZZ7A 5BOXA 1XGNA 4QXKA 4ONUA 1CF7A 3RYKA 3E6CC 1JE8A 3V4GA 1YS6A 2DT5A 1I1GA 5FFZA 1IW7F 2UXXA 3QPHA 2WC2A 2IC1A 4YFXF 2KXLA 3SCFA 1Q43A 4JTOA 3ZDSA 1FT9A 4CICA 3CUQB 1YLLA 4I01A 1QZYA 4LB6B 5ILUA 2A5YB 3HIFA 5D5XB 2KRFA 2BGCA 1XE8A 2OZJA 1A04A 2E1NA 5LEKA 4ETSA 3NQOA 4IJAA 2FA5A 3Q9SA 2PEXA 2DPUA 3F8BA 4Y17A 5ICFA 3WW3A 2OD5A 1J0RA 2VBZA 4MNUA 4BHBA 1BIBA 1BIAA 1LDDA 2PBIA 3FMSA 5D8LB 2R3SA 4A0YA 1ON1A 1VP6A 2VOOA 4L9NA 4F8AA 1JUHA 4LA2A 4U88A 3JAMZ 3C3VA 4ORFA 1DGWA 3TDUC 3LWCA 3IDBB 3RPQA 4XFFA 2PAKA 1DGRA 2D40A 4E2QA 4E70A 3GFLA 5J48A 1FBSA 2IRFG 3EJKA 4HN0A 2KJBA 3HT2A 1QWRA 4EWAA 1H0MA 2M5WA 1MJ9A 3QU6A 4ZH4F 4HW0A 3BDDA 2CGPA 5EZWA 3DPTA 1U5TC 3FJSA 3GFIA 2DQRA 3RIRA 3WGGA 5ILVA 1KA8A 3FFQA 2VE8A 2M1BA 3TDZC 5F6FA 2V6CA 3I5UA 2Y0MA 2DPDA 2H0VA 1OFNA 3R4KA 3BWGA 2XKPA 3NJZA 2UYAA 3U2RA 1QO0D 2CFXA 1WKMA 2E9QA 2K7LA 3GEZA 3PFIA 4HDVA 5FDBA 3FWEA 3DN7A 4PGGA 2WTEA 4IXAA 3FE5A 4AVCA 3F8MA 2VPVA 3F6OA 2IW5A 4AIKA 4EJOA 3NW4A 3CF6E 2HDCA 5DV5A 3RYRA 2ISZA 4DINB 1TQPA 1ZZ9A 4CZZA 4J1WA 4KU7A 5FO5A 3L09A 2GC1A 2PLYA 4MH0E 3H1WA 5D6FA 2XUBA 2VC1A 5FD5A 4UBGA 1ZG3A 1U12A 1BC7C 4JTNA 1P4WA 3PQJA 4LK1F 1OYIA 3ZN1A 1ZZ8A 3TQNA 1G3WA 2XAQA 1ZRCA 4UVAA 2OYZA 3VODA 4L0ZB 1CAXB 5DCMA 2BYVE 1K7AA 3OTFA 2ETHA 1LRHA 4MGRA 3H7JA 2H6BA 2EFQA 1D8JA 4NB5A 2RGVA 3ST7A 4UNOA 2DLLA 2O8QA 4P96A 3ZMVA 1LVAA 3R61A 1H9TA 1UHWA 3T0YA 3CO2A 4LA3A 3CO6C 3LZZA 2PJPA 4I09A 2C6YA 5IT9Z 1R58A 4FHTA 4AVAA 1F9NA 2HTSA 1IXSB 3O6BB 4UBHA 1R36A 5BS6A 3BJOA 4WK8F 3ZN0A 3WU0A 4HDUA 3IWZA 2R7FA 2FNAA 4RGSA 5L3BA 1KU9A 5E8GA 4N0BA 4Q4ZF 2A61A 3HTSB 1YYVA 5L3CA 1TNSA 2VT3A 1NE6A 3V8JA 3TOBA 5HLIA 5HS8A 2D5HA 5JSPA 1CAVA 4F7ZA 4Q0SA 3SFZA 1I5ZA 5HI0A 3TGNA 1QGPA 2YU3A 2G7HA 3RPUA 1ZG5A 1TQIA 2M30A 2W24A 5E18F 1S8NA 4P9UA 4OIPF 4S05A 1LEBA 4I3PA 4JK1X 4YIIA 1FZPB 1YFXA 2PAEA 5DD8A 3H8UA 2VOPA 2JPBA 4Y13A 3RNSA 4DQ2A 4YSFA 1BI1A 1Q1HA 4MHGA 3SZTA 1SD7A 4L9VA 4OIQF 3DEUA 4WX9A 2IXCA 1J9IA 3ES1A 1FSEA 5CVIA 1WGPA 3S7IA 1E17A 4GO1A 2OA4A 3LA7A 2CWEA 1U6GA 3DL3A 3CUOA 3UKNA 4META 2HJIA 4PIXA 4HLXA 2VQAA 1HBXG 3K1PA 3H9AA 3FHZA 5KVRA 3I58A 1G6NA 2FMLA 4KIBA 3MYXA 3WGHA 1ZRDA 1EPZA 1P92A 2VODA 2PHDA 5JR3A 2C0ZA 4KN7X 3M8FA 4JV4A 4XF4A 4KFCA 3PQKA 4KU8A 5CLSA 5J3UA 2PG4A 4K2EA 2K9ZA 1S6LA 3WG9A 4M9SA 1FY7A 4AQ6A 3P9KA
chains in the Genus database with same CATH superfamily
3DLAA 5FZOB 2J42A 1NLSA 1R22A 2A3SA 1TG7A 2B45X 4AYBA 2J5PA 3MICA 2EPFA 1FV3A 2EZLA 5T5JA 2PMUA 1RPWA 1Z91A 2WNVB 4LHLA 2N8GA 1PO12 4WM8A 2DA1A 3SQNA 1XRUA 5DAVA 1YQCA 3QOPA 3O8HA 5L19A 1QNWA 4Q4X2 3GBWA 5FYUA 2E6VA 4E7HA 2BOJA 4CCLA 1APNA 1DHKB 3VUOA 5H9PA 5FKLA 3UT0A 2VMDA 3ML6A 1B59A 1P4XA 3KB5A 1JTYA 5GM0A 4Q5SF 1BCXA 1CX4A 4B1MA 4DMIA 4XLPF 2DXIA 1T98A 3VDXA 1VQKI 2VBBA 3PNVA 4BQQA 1HW1A 3USUB 2FBIA 5C71A 3ZFEA 1LPQA 3H9QA 3AXEA 2KT0A 3E6MA 4QX5A 3OGGA 4NIGA 1B9MA 2VZPA 2E7TA 3VHPA 2LY9A 2R16A 2P37A 3FL7A 2AQEA 2JDNA 1SFNA 3BIEA 4N53B 5EEHA 4LGWA 3NV3A 3WF4A 1T0FA 4PSXA 2D43A 3DYMA 4Y22A 1ASJ1 1JKQC 1HCRA 4QDRA 1AR61 1DYOA 1OSGA 4DYQA 3OYCA 4G9SB 2IAIA 1W6MA 3VBUA 2Z9OA 1A31A 3AKRA 2YPDA 4A6EA 1I1SA 4CU8A 4EN0A 3WHUA 1W2OA 5CKNA 1MBGA 2W00A 1X82A 1BJZA 1IC8A 1DPRA 4Z8BA 4IEQA 1BKZA 4PK4A 4FAGA 1QJU3 1NXMA 4FVVA 1IQDC 4LLNA 1TME3 1R083 1TWCJ 3G3ZA 1Y1WJ 2CUFA 3HRTA 4YFNF 3N9QA 3U21A 5M3MJ 1G4DA 4OINF 4A3GJ 1ASJ2 3H42B 1MH4A 5JMOA 4IE6A 1AR62 2XPUA 4D0PA 2F5VA 3GNEA 1N3QA 5IT3A 3GXUA 4D7MA 3DTEA 1J58A 2CV6A 3WG7H 2RV9A 1BK1A 5A33A 3KYLA 1R00A 2D6MA 5DPNA 2DJIA 4BY1J 1GSLA 1EUTA 2ZO4A 1MBFA 3WHTA 5E16A 4E4HA 5TJJA 4FQ4A 1PO23 2CQQA 4NMIA 4CEYA 3Q0UA 1T0FC 2GQQA 4HN1A 2X09A 3WUDA 2JG9A 5BNGA 4XW3A 3MO4A 1L3LA 1ZM1A 1A5JA 1I50J 4X1EA 2FF4A 2DVAA 2DA2A 5JXIA 3WQ0A 1U5TA 1WMDA 5TSWA 3UNPA 5A3TA 2P6CA 2EQRA 5H20A 1PGSA 4BQ4A 1S9HA 5JOYA 1CVNA 3MKZA 1R4MB 1EA3A 4XNFA 5TRDA 4D7NA 1ST8A 1E3PA 5F5QA 4Q4V2 3HHHA 1W06A 2ZCWA 4C91A 5EQUA 3EYPA 2NRAC 5FZ1A 2DTZA 1SCRA 2OU2A 4BHPA 2DCEA 3F8CA 1Q5OA 1B35A 4PDWC 1VTNC 3MV01 2HVRA 2M0MA 1J3PA 4Q0VA 4WF2A 1D0XA 5IVBA 5F5IA 2BY1A 1ND3C 4I0WB 5DZEA 2D93A 3K4AA 4JP0A 4AVSA 1ZARA 1NCRB 1ULOA 3CD6I 4GMP0 3AG4H 2GLOA 3QCWA 2LSOA 3KZ4C 4KMQA 3GO5A 1WCDJ 3L9FA 1W6QA 5JI7A 2QA4I 2PLV1 4AVVA 5C8CA 1D4VB 4UW4A 4N9IA 1LE8B 2KP6A 1UPIA 5FJ8J 3S32A 4XBNA 4Y1XA 4Y1UA 1AHDP 3ZR8X 2QQOA 2ILMA 3D5RC 3S7EA 1UMZA 1V6IA 3L2VA 2VQ0A 4QGMA 5FZ3A 3KV9A 1VQ7I 2AH2A 4S0HB 2E19A 4R9AA 3UL2A 3CZ6A 1XE7A 4LOCA 5C9AB 1LEMA 4NQWA 2FNPA 1DP0A 1ODMA 4U7BA 4XPVA 1IUYA 4B29A 2DDBA 5IVCA 1GLNA 5KXDA 1TWGJ 2L01A 4BB3A 1QJY1 5JZGC 4P9WA 3WE3A 2ZGNA 3USSA 2GN7A 1ZGWA 4QPGA 4FTEA 4NHXA 4AVTA 3OYWA 3WNXA 5GZCA 3HNBM 2NYXA 3UK9A 2WBMA 2DUQA 5IVEA 3WG3A 5GLUA 2PLV2 1GZTA 2VT2A 2UYBA 2DN0A 2O5RA 1H2MA 3FXLA 3GTJJ 2QQWA 4BE1A 3OYEA 5D6EA 1POGA 4EJWA 1TWFJ 2EALA 2ZNZA 3VHOA 4IL6C 3R0AA 1B35C 1NZIA 3NNJA 1CIWA 1YRZA 4DNCA 1ERDA 5LHHA 2R071 2ZJ2A 2IA0A 4XAAA 4JKMA 5BNNA 3M4OJ 2A05A 1DDNA 3WODF 1FYMA 1QJY2 1S7EA 4XC9A 2A7AA 1RUG1 2P4WA 3OYBA 1FOD3 1XC5A 3OEBA 4KGQA 3KP2A 4A3KJ 2V1XA 4XFIA 3U1XA 2PN6A 3H50A 4CDQA 4EN8B 3WW2A 3LB9A 2KIQA 1VQ6I 4BY7J 4JHTA 2BEOA 5JDBA 5FKKA 1CAVB 4OLLA 2R7QA 3B94A 2W82A 2ZBJA 5C7GA 1FX7A 2ZEXA 3IAQA 1ZYBA 1RVF1 2R072 2JZYA 2RE9A 1XNKA 4ZZDA 2XAHA 1PM4A 4XJAA 3KZYA 4BBSJ 1RUG2 2DWRA 4OQ8A 2V1NA 4E4SA 1AZDA 4HSJA 2P6SA 5J3LA 4GQ7A 4QGLA 1V5GA 2GM4A 1LHUA 4YZ1A 3SH4A 3KM5A 1HF0A 2OIIA 4SBVA 5EEAA 4XETA 3P5BA 3GZTB 4YG2F 4Q1RA 2D7FA 4IQ4A 2IVMA 5HVQC 4XQWA 5BNNC 2WWSA 2TNFA 3DQVC 3U37A 5FPAA 3PURA 4AI2A 1DGRM 4UB8C 5CYYA 4XZPA 1MVEA 4TXWA 3ERED 2WNUB 1IV8A 3MZYA 2FDGA 4UHTA 4LMFA 5GZFA 1VRBA 3QH6A 4QPIC 2PHFA 2GMPA 5FY8A 2GN3A 4HOBA 1BR4A 4FPLA 2PHRA 1YQAA 3FHIB 5LGNA 4ZHNA 4XHBA 5IAVA 4CUAA 4ZC3A 1OA3A 2D1VA 4AI3A 2FD8A 3DPLC 1W8NA 2OA2A 5FBJA 2MH9A 3S3OA 2A6WA 4LJZF 1AYN1 2Y69H 3R0JA 3PM1A 1X3UA 1GMMA 1TE1B 4UOJA 3LAJA 1MH3A 1JZ4A 3CCUI 3TW6A 3DPUA 2QENA 4IQPA 2JECA 1NCQC 2AQFA 3KGLA 1N3OA 2OV7A 5F2WA 1P2FA 3HVDA 2BXYA 1LNSA 2CH0A 2L4MA 4RQPA 3QOEA 4EROA 5K5OA 2EZHA 3J81Z 5EG0B 2VCAA 2XONA 1F35A 2OQ7A 2UY9A 2A73B 2LBFB 5FZFA 2VBPA 3ELNA 3KZIC 3JXSA 4TN7A 1RUC3 1T2XA 1ZLKA 1RUF1 1LU2A 2CV1A 2VMHA 4A3JJ 2O0YA 2X9DA 2PHXA 2QQ9A 4AW7A 2BW3B 4R52A 2NLRA 1LEAA 5DQ0A 3W9AA 1LQ1A 4A5MA 4NC8A 3MKYB 1OC1A 1X8EA 4ZTFA 4FXKB 1AYN2 2VOKA 2LYCA 4D6QA 2A3YA 1H8VA 3WTZA 2MA3A 2D5VA 1XNCA 2OAZA 2F17A 2WFF3 4OYUA 2JG8B 1W7PD 5BPXA 2XF5A 2NS8A 2FQ3A 4IHWA 3IC7A 5D4RA 3POGA 1Z3XA 1KGYA 5K8SA 2NM1A 2E5ZA 4HA8A 3VBSA 3PVNA 2DK5A 1D4M1 4Y15A 2EICA 2GALA 1AJKA 2UZKA 2YUSA 1PMHX 1RUF2 4C3HJ 1RI7A 1W6OB 2XL9A 2MD0A 1N75A 5FZOA 1GU3A 4FP2A 1T95A 5FUPA 4R4XA 3ILNA 3RGBA 3I2DA 2JDMA 2WZR1 4XL9A 4LXLA 4O9EA 2NVTJ 3KHBA 3GLXA 1HXDA 1Z7S3 4L11A 2ZKLA 3MIDA 2GXBA 1R5ID 1W90A 1MQTB 2X05A 4QX7A 4XDOA 2BFUL 5F5AA 1Z6RA 3LSTA 3C2BA 2MSYA 1DF0A 4CCMA 1JYNA 1D4M2 2CMPA 3BU7A 2BUKA 2XJTA 3BLYA 4MV2A 3J80K 5HLTA 4S2HA 2ZMEC 4YWAA 2W94A 2OQ6A 1TT0A 1OYWA 2Y30A 4NPLA 2WZR2 2FEZA 3HOVJ 2F5DA 4BH9A 4IETA 3VSKA 3ABZA 1TWHJ 2W48A 4H0EA 3J81K 4B4QA 1L0OC 5ACA3 1LKNA 3DYPA 3BN6A 2DDUA 1H8TA 3RS6A 2QQKA 3GUDA 1X9PA 3KP6A 4PLNA 4YG0A 5LGTA 2ID6A 3ZSEA 3KVAA 1VNDA 2P17A 3B6CA 3WUCA 3FXOA 3M8JA 2W91A 4XEZA 5GJ6A 5FY1A 3BR0A 2STWA 3BUCA 5LWBA 3OYFA 3HWJA 1USSA 1J09A 4UFHA 1A78A 3RKWA 4M3CE 3H0DA 5AC91 1HJGA 2WNVC 4LBLA 1WI9A 2VNGA 2F6CA 2P4EA 4IHYA 1MS0A 2GSYA 4A3MJ 1V3FA 2R7TA 3H3VK 2IP2A 4IRGA 1PO22 1IHMA 2CQ7A 3C7FA 2ZHMA 3LD8A 3K3OA 5LA0A 3LEKA 2KKOA 4I99C 3ITQA 3ZXEA 3HAGA 1WSUA 3AKTA 3A0BC 4LEJA 1W5SA 2M45A 5KHJA 2QWWA 2GC0A 4XTMA 1CJDA 4F3JA 4ZU7A 1GWMA 5FD6A 3EPZA 3IIIA 5FZIA 2HYKA 4Q27A 3DCQA 1NX9A 3IAPA 4A3IJ 2F4PA 4NHKA 2ADDA 5GTIC 9ANTA 1HV0A 2WAFA 3C18A 2DFFA 2J1VA 2RDRA 4RAZA 1X19A 2EV0A 4ZYHA 4ZYGA 2WT1A 3LIGA 3ELKA 3VZKA 1RJ8A 4GWNA 5CFDB 3AYCA 2K85A 3AFGA 1MZ6A 2WNEA 2D3PA 3NQHA 2JSCA 5AC92 5K4LA 4N53C 2WO3A 3GCWA 4C1XA 3F6VA 1OCTC 5E20A 5I93A 3WNMA 2O9LA 4KYWA 2NOGA 1LR5A 1JZ6A 3O1UA 1S0CA 4GALA 3Q3SA 3GTOJ 1QU3A 2XVGA 5FJHA 2K9SA 3E6BA 3S3NA 1YI7A 3DBRB 4YARA 5KHGA 4EQQA 4CYCB 3C7EA 3J7AY 1GXQA 2BNOA 2UWMA 3MI8A 4M00A 2RM23 1G3YA 2CTVA 1WGXA 2HBUA 1BEV1 2C6SA 1PUFB 5K5QA 3LFMA 4XF1A 3JU9A 2JPCA 2OCCH 2FDIA 4JC1A 3U11A 3W2VA 1PGW1 2IS1A 1NTCA 3TL4X 1KGSA 4KL1A 3VHNA 2OKXA 4XR6A 4CHUA 3PUFA 3JRBA 2ZGKA 2TRTA 4WV8A 3I2IA 1T6SA 3QYBA 4WCGA 3CJIB 5IPAA 3GFJA 1CPMA 3I3EA 3LFIA 3HUGA 1YIJI 4IRIA 3CL1A 3O14A 3WT3A 2MC3A 4FX4A 3PJRA 3BCBA 1SEUA 2FXAA 1MBJA 5DCMB 3N35A 1QHGA 4S2DA 2E63A 3TEXA 3OBTA 1YQ2A 4AIDA 5C4WB 4MFEA 2EK5A 1IAWA 1DP7P 5L3FA 1BEV2 5GLWA 1JODA 5ERIA 1ENQA 3BODA 1TW3A 1XXNA 4DFSA 2HS5A 5B66C 3RSJA 1UF2C 1PGW2 2EFOA 4KUMA 3S2HJ 2Z5WA 5LZ6A 3DTIA 3INAA 2M4GA 5A7WB 5GZDA 1YX5A 3P9CA 1Y9GA 3ACFA 4MO3M 1Y1VJ 1SDDB 4GCVA 1Y9MA 1W36D 1ZA4A 5KHHA 3AL0B 3CHXA 4YGDA 1V6MA 2DMPA 2ZHLA 1BM9A 1TLHB 4HQEA 3WNPA 5K7FA 3SXWA 1LOCA 1J1TA 1VPHA 3M9AA 2KJCA 1OH4A 3BYWA 1QHDA 4JYKA 3DYOA 4BJTA 1HRV1 1VI0A 4WVMB 2VIXA 2ZX3A 1BXHA 5ABJB 3WSOA 1RNLA 3LA2A 3CO7C 4LKDA 4LHNA 3RPUD 2QBXA 1P4AA 2ADEA 3ROUA 1DG6A 2GNBA 3KEYA 4NUBA 1MMNA 2GIZA 1GQGA 4JCKA 3TKYA 2VJ4A 1NCRC 2D5FA 2BERA 4LO7A 3BZCA 2JRTA 1RUE2 5CADA 2VM9A 3A7QA 1E5SA 3F2ZA 2EA2A 3OOPA 1VR3A 4AFCA 3Q0WA 2DMQA 2H94A 3JRFA 3O1OA 3OYGA 5E1WA 3TO7A 3WQ1A 3CESA 3JAMK 1YFYA 3CNAA 4LR4A 3QPLA 5LBQA 2VZVA 2YZ4A 3KGZA 1ZR4A 1W9FA 3I53A 1HRV2 3ZYRA 1OQ1A 5C9AC 3BG9A 2Y2ZA 3SFIA 3ULQB 1ZG1A 5GKAC 5J7MA 5FR3A 2R041 3NARA 1YWKA 2XROA 4MHUA 1XCVA 2QUOA 1LKXA 1S0EA 4ZYDA 5HDGA 4A7KA 1IS6A 1K4SA 4TZDA 2FCUA 1S0DA 1DU3D 5K7PA 2LY2A 5FKBA 4A93J 3MF6A 3VZLA 2NS7A 1XGOA 1YTYA 3HDDA 3AFKA 4ARYA 2HWVA 2HYGD 5FK8A 1D2SA 1UZ0A 3TP0A 2WBKA 1FP2A 2O61A 3LPGA 3G6JB 4BQ3A 4QMAA 4H55A 4XVHA 1PK6A 2LR8A 3BALA 1WVRA 4LMYA 3VBHB 2FBKA 4HX8A 1BW5A 5LY1A 2O8XA 3NV4A 1TTYA 5IVFA 4JRLA 3R4UA 1XBFA 5IVYA 5FP9A 4BWOA 3GZ6A 1XJAA 1AUYA 1VQLI 4YFZA 1H88C 1QGLA 2WNUA 3ZIWA 1GV9A 1W8ZA 2QSHX 5B4NA 4C0HA 1Q8SA 1O3RA 3BB6A 2E51A 1EH7A 5A7OA 2VQHA 5DAXA 3BG3A 4YM3A 3FMQA 3ZPYA 2YC0A 5E3NA 1ZAOA 4X6QB 3ZXGA 5FV3A 3CC7I 5KK1A 5JFRA 4FOQA 4OVEA 4XUTA 4AI8A 1FMWA 4PFOA 1I6HJ 3T4HB 1XYNA 4ET7A 4BPZA 3Q5FA 1IG0A 3EQEA 4Q8KA 1A3KA 1OMIA 4QX1A 2NQYA 1XN7A 1MVQA 4KQ7A 3VWBA 2IXLA 3WG4A 1RUH3 3OPTA 2WNOA 5F39A 4O9GA 1WI3A 1VBE3 2GH2A 5JUVA 1WFXA 1VBA1 2WFF2 5EG0A 2VW0A 2VZOA 2GA1A 3TEZA 3BPXA 3N97A 1IF1A 4GMP1 2XRNA 1EAH1 3I3BA 3KPHA 4NVPA 1JJ6C 3LL7A 2CO5A 3ZLIA 2VBXA 4ITCA 4COYA 3L2RA 5F37A 3KYDB 4RA0A 1J84A 2CWSA 4QAWA 2F4IA 2HR3A 1G3SA 2Q0AA 4H7LA 1OD3A 2DYCA 1XNAA 5A1AA 4DB5A 4L18B 2EB7A 4QSHA 4XCBA 1EP0A 3NO8A 3GHNA 2E26A 3WDYA 1IRGA 4TLGA 4NPMA 2WNUC 3U4XA 4B44A 4RS5A 3CF5F 3BPVA 3N7JA 3HOYJ 2E7AA 2L4AA 3TMOA 4CDXB 4RB2C 1VBA2 3K46A 1WWYA 3UKTA 4CDUB 2YC2A 2Y75A 5E8IA 4PJJA 1Z05A 4ENJA 4P5HA 2QEXI 3S3MA 4HPKB 4EGYA 3NNLA 3AL6A 4AAXA 3WF1A 4MTEA 2HVSA 2F4OB 2QKDA 3DEMA 2HYXA 2Y0OA 4RS8A 2H09A 2O3FA 1UY1A 4FSJA 2K40A 1UFMA 4H4KC 5B1BH 4UUTA 4AVPA 4PUSA 4GWIA 4A4AA 4XUQA 2BVVA 3KV5A 2M87A 1ZRIA 3ALQA 4FXGB 3ON7A 2UU8A 1TWAJ 1J7KA 3HHGA 4RFT0 2EFPA 3O0XA 2P5LC 2GAUA 4XRFA 1A36A 1W8UA 2VG9A 4ESFA 4HV6A 2EWNA 1WCMJ 4HX7A 3A01B 1D2QA 5FREA 4ZZ5A 5F9TA 2X5IB 2JA2A 1RC6A 1EUUA 3PNAA 5M0TA 2ENRA 3C7HA 1LDKB 2HWE1 5EJ1B 2LY1A 2YFUA 1FMVA 2AO9A 2AXTC 2OJED 3POWA 1PVC1 1G8XA 1OKQA 3C7JA 3TP3A 2YBPA 1MGTA 1FMD1 2RC4A 3A2KA 5BQTA 1OCCH 1FBQA 1R49A 2PAMA 3IDEA 3AK0A 4C3IJ 4HKOA 1EV11 4CZCA 3MAJA 2P5KA 4BQNA 1E5HA 4YVSA 3B00A 2VR4A 2JG8C 2WV0A 2A75A 3TN91 4QQ2A 2YSRA 2CJJA 2ZGTA 5LBEA 1WJCA 3ZX7A 1U78A 1GANA 4FOWA 1OVPA 4N43B 1P9QC 2XV4S 5IOYA 2RJLA 4XKVA 1FXZA 2ZXHA 5HNHA 2BXZA 5EF6A 4ASNA 5ANNA 1S2BA 2G19A 1OURA 4FETA 4GJZA 2ME0A 2W84A 2QQIA 2DFCA 2J1TA 2HWE2 2E7QA 3IV5A 3HN3A 3DGTA 5J1UA 4RM3A 1DGRN 4NE9A 3RJ2X 3K51A 2IC1A 3OG2A 1FMD2 1Q43A 1SLAA 1EV12 3I4NJ 4CICA 1MQTC 1IRXA 3ZSJA 1H2NA 3ZYJB 3VD5A 4PLOA 3TN92 3V42A 2KRFA 2B7EA 2OZJA 1A04A 2E1NA 1YI9A 5LEKA 3NQOA 1CPNA 2FA5A 2PEXA 3ZR5A 2DPUA 4Y17A 5ISLA 2PBIA 4A0YA 1ON1A 4ZONA 4DUXA 2P3IA 4CU9A 2O8KA 1TZLA 1Y43B 4ORFA 1HA8A 3RPQA 3A0KA 1DGRA 3LSPA 3R0RA 4E2QA 1RRJA 3H5NA 5K0UA 4E70A 3HPHA 5LW9A 4AL9A 1FBSA 1IDYA 3EJKA 3SKJE 2EIKH 2DUPA 2KJBA 2DU0A 3ERMA 2A71A 2R7WA 4HKWA 1JUIA 1MJ9A 3OGVA 3QU6A 5D21A 1D0YA 2OT7A 3FJSA 3GFIA 2DQRA 1XSQA 5LFAA 5B1AH 1UO9A 3FFQA 4NIHA 5GADJ 2DU1A 1GP4A 3TDZC 4BDZA 3S15J 5F7UA 3I5UA 2Y0MA 4F93B 4IV1B 4URAA 2WZ8A 4PJNA 3NJZA 2VQCA 3U2RA 2DTWA 4ASKA 1B09A 2V9KA 3GEZA 4W6WA 4WVWA 1PUFA 3MN2A 3MFAA 3ZQQA 4R4ZA 4A7ZA 3POYA 2WTEA 4Y1YA 4CCDA 1MNEA 2YV8A 2LW8A 1K5JA 2LUWA 3ASIA 3F6OA 2IW5A 2R0QC 4EJOA 5CPRB 3K4DA 2HDCA 2VMEA 1R4NB 3RYRA 2ISZA 1JTZX 1TQPA 2P0WA 4CZZA 3DBHB 4KU7A 1HN1A 2WQ8A 1K5MA 2PLYA 3H1WA 4YW4A 3FXKA 3AG3H 4CP9B 3K4BA 5FD5A 4BE3A 1BC7C 2A6VA 1LJ7A 3FLTA 1OUSA 1LU1A 4RGKA 3A21A 1G3WA 5FYTA 5FZGA 4UVAA 1CAXB 4XKCA 5DCMA 1K7AA 3BR5A 1LRHA 5JXJA 5CFDC 2EFQA 1D8JA 2GNDA 2VXJA 3LSKA 4CCEA 4UNOA 2O8QA 2C26A 3UR3C 2XJSA 4P96A 3ZMVA 3T0YA 2OPTA 4LA3A 3CO6C 1OVSA 1FOYA 5FMOL 2C6YA 4I30A 4A7YA 4AVAA 2HTSA 1T08B 3GTPJ 1R36A 4GB31 3K4JA 3ZN0A 2OCEA 1AR71 2R7FA 4A69C 1KU9A 1ACIA 1OOPB 3TEWA 2BV4A 3KVBA 1UZWA 1W9WA 1V9U1 1NE6A 2CUEA 4NBQA 5IYBJ 1DQ0A 4YZ3A 3TOBA 1G8WA 5F3IA 2D5HA 4Q0SA 1I5ZA 2YU3A 4XE9A 5ABJA 2XDVA 1ZG5A 3K4ZA 1COV1 1JOBA 2R7RA 2M30A 3BTAA 3BZKA 4FQGA 3CMMA 2IS4A 4OIPF 4N7UA 5L73A 3N7LA 2W46A 3CJIC 2CHHA 1XNTA 3J8F3 1K4TA 1BW6A 2JPBA 1C4RA 4MHGA 3RQ4A 3A0HC 4OIQF 3ZYGA 1AR72 4YEJA 2IXCA 5JVVA 2DV9A 5A1LA 3S7IA 3LMMA 1V9U2 4RHV3 1QDCA 2X51A 2Z4FA 1YQ5A 5C4WC 2AENA 2UUZA 4FCYA 1JHJA 5HCFA 2J1AA 2J1EA 3MYXA 3WGHA 1ZRDA 1COV2 2DBIA 3S30A 3ZYHA 2NXNB 3ILRA 4CRQA 4AGRA 1C28A 2E34A 5LASA 4KU8A 4HG6B 4C2MJ 2PG4A 1TNRA 2LMDA 1S72I 1JH5A 1S6LA 3AL0C 2K9LA 5FY5A 1FY7A 3H8RA 3G4SI 1VBB3 4LUMA 1RXFA 4IKFA 4IXLA 3DXUA 1REDA 4M0HA 1HKQA 4J00A 1VJ2A 2HH9A 5F1JA 1WMFA 2XQRA 5EYYA 1ZZCA 1KD7A 2HQNA 2YXSA 2DFHA 4I76A 1SFUA 1Q8VA 5C4JJ 2CSOA 2BZTA 4OHXA 3FM5A 4OI4A 5ERLA 2BPA2 2JWPA 4Y52J 2RREA 3G2BA 2CGNA 4NHMA 2R1DA 2O6GE 1VQMI 2WN3A 3BJAA 5F1RA 2Q2EB 1D7PM 1HX6A 4CEWB 5C3PA 3AP9A 1JT0A 3W6JB 2BTVC 4U7DA 3FLRA 2O0OA 2DK8A 4J25A 1ZGJA 1W7PB 2I10A 3H0OA 4XFBA 5BMZA 3WG2A 3SXYA 1KQRA 2A6XA 2QM3A 2HDWA 1UW8A 1IO2A 3EYYA 1SC7A 1E3OC 4NIIA 1VBE2 2ZMNA 5J8CA 5IOZA 4LNVA 1XE0A 3KETA 3S5QA 5J8FA 5SV8A 1G2HA 1UOJA 4A0XA 3RZDJ 1TME1 3IWFA 4BEHB 4QPWA 5FQ0A 1AJOA 4IHXA 4MGQA 3KMHA 2PQQA 4ZJZA 3ACHA 2PMHA 1O6UA 4L8QA 1S7AA 3BG7A 2VCCA 1SFEA 5FXXA 4UVBA 1LENA 5BPIA 1CQTA 4BIFA 2JE8A 4BQ1A 4AG4A 3F3XA 3N05A 3JRDA 2EZKA 1FPN3 2XHNA 4IEVA 5T3NA 4FTSA 3CJQB 1IXCA 1IGNA 1OFSA 1ZHFA 4YYOA 1LOAA 1ITYA 5EP9A 3SH3A 1BI0A 3BTLA 4QPQA 3T2TA 4COWA 4HSTA 4G6QA 3W3CA 4HBNA 2ZGMA 2JX9A 1ZX5A 1C8M3 2RR13 4FASD 4LK0F 3EQLF 1ZNPA 3VBHC 2VKVA 1UIKA 1RHI1 2D6PA 2IGOA 5CFCA 3ABLH 3IAM2 3S1QJ 3V8LA 5J1RA 4Q8LA 5E6HA 4CA0A 4JX6A 2ZEWA 4P9JA 4X8NA 4XZUG 4DOUA 1SLIA 3THCA 3RRDA 3BQYA 2DYRH 1NHAA 1RUD3 2JE7A 5F6KA 2JJ7A 5HLGA 4ENNA 1P8JA 1S29A 4FP3A 3AKQA 4HL0A 3O1RA 3CJRB 1K78A 4HK8A 2JKXA 3GTLJ 1IPJA 2B46X 4P55A 5LRSA 4XICA 1QXJA 2JB4A 1RKTA 3ZFFB 2G0EA 5CB7A 4Q47A 3K70C 5ICGA 2O1QA 4O6JA 3ECQA 2KZVA 4PQQA 1PIV3 3E1SA 3AJZA 1AR83 1RHI2 1REEA 2K46A 1GUUA 1DIWA 4Q0PA 5J1YA 4QDQA 1ZBE1 1G3TA 3MFKA 4KT5C 1PVEA 2M7AA 1AWCA 3IDAA 5FUIA 4QQLA 4Q5OA 3ZRGA 4BJ0A 2VE9A 1MKMA 3VSLA 1HDPA 1SBFA 1UYPA 2ZXQA 4HVOA 3G71I 3BGAA 2LK2A 1W6NA 2ZS6B 4QXBA 2X5IA 3GTQJ 1UU4A 4LLFA 1VMHA 2PI0A 2YGMA 5A32B 1Y9QA 3ZN6A 1QPMA 4P14A 4PJLA 4HETA 4RA2A 3SDBA 1SLBA 5D5VB 3ZMDA 2VULA 2WT2A 3WTVC 4BL0B 1ALYA 1FLIA 3SHFA 1MEC1 2FQPA 3I4PA 2MBFA 3KLSA 4M72A 1ZBE2 1ZYRF 2PFBA 2MFZA 2EA7A 4AE2A 1AF9A 1S4CA 4CDXC 4EATA 4CDUC 3NMBA 3HYIA 2DT7B 3A4UA 3U75A 5T5LA 3LGRA 4BQ5A 2E7WA 4EE2A 3I3LA 1I3AA 2LKSA 3W6VA 3C2UA 1NK3P 2LREA 2C9AA 4FT8A 5I91A 4ZTJA 5EYXA 2VJXA 5H9SA 1RUJ3 5GPAA 1XTAA 4RGXA 1V6JA 3VBRA 1OKOA 3SEPA 3B6AA 1OF3A 2PQSA 1CWPA 4G7OF 2SBAA 5FROA 4FCAA 2IPQX 3CCQI 3E5QA 1MEC2 5KHKA 4FFFA 5FMDA 5FZ7A 1KDMA 2XB5A 2JJ6A 3ZFGA 4OIOF 3VBFB 3GJBA 1O59A 3BTCA 3RTRA 1DLLA 5FZMA 1HXS3 2CU7A 1YFWA 1S2EA 4PSWA 2EILH 2X5IC 4IQJA 4MLOA 4IESA 4XJ8A 2ZKZA 4JX0A 5FYVA 2VQLA 1YO5C 4LBOA 3BJ6A 2RN7A 4ZKTB 4XF0A 1IN6A 1KRIA 3WDWA 2RDNA 3F72A 1W0UA 2VC0A 3M4FA 2QQ8A 4DJAA 2K3PA 5KHIA 5EFUA 4Q4Y1 1SLTA 2EIMH 2K86A 3S0MA 1O91A 3ZR6A 4ZZLA 3HOUJ 3U1DA 3HNYM 4MGYE 4XQFA 1WCSA 4N43C 2JT1A 2AHQA 3SC7X 4LITA 2HGCA 3ZMOA 3MVPA 2IT0A 2QKLB 4W1UA 2QSGX 3BT9A 2AXLA 1LGCA 4LIUA 3DPRA 3ZGKA 1F5FA 4LT5A 2I8DA 3S1NJ 4IV1A 5IJRA 2YU2A 1BL0A 2E1MB 4I0BA 3S8PA 2JICA 4O7XA 4MZUA 5CVVA 3CCYA 4Y1ZA 5FZLA 2LNBA 2BU9A 3SHRA 1GQHA 1NG7A 4M9ZA 2EV5A 5JR7B 2L9RA 1SD6A 3HD8B 3WF2A 4Q4Y2 2W1WA 2X6WA 1OCOH 4HK9A 4YVWB 3IHUA 1HRI1 4XFHA 4IHTA 1RIRA 3FMGA 4JDNA 3T8RA 2NVQJ 2R7OA 1X8MA 1XQNA 5KC6A 5L3DA 1VAVA 4ESBA 4NDLA 5F0HA 4AEDC 4LFUA 1YO8A 2DBNA 2CYFA 5DDJ2 3HRMA 3LDRA 3AMQA 5M5XJ 3VZOA 3GJAA 1UB9A 3MUY1 1H9WA 4UUSB 1JGGA 2AC1A 2HWD3 1XYOA 3E1F1 2W1OA 3EB7A 3VD4A 2LC2A 4HMZA 3W2WA 3WDUA 3ONQA 3KD4A 1H6XA 4OOIA 4L2NA 3LKJA 1HRI2 3GX4X 2YBSA 2XB6C 5JXHA 4UFMA 3VDDB 4ZYAA 2CAUA 4AFMA 5BNOB 3V7RA 3K4CA 4XKBA 3ZQLA 2ZJRF 1VRH1 3NKGA 4D0QA 4C30A 3BOPA 1VIWB 1O3TA 5DG1A 1X58A 1JN2P 4ES8A 4KWUA 4DPNA 3IKWA 4G94A 2MG4A 1UJ8A 4WXDA 5CBLA 2ZX4A 2BWCA 2WADA 5JLVA 2M9HA 1I3HA 2VJIA 4WM8B 3Q8CA 4M3BA 3O12A 3ZPOA 3PU3A 2ATFA 1GFF2 4AHWA 2B63J 3GTKJ 4B7KA 4BK4A 3KP4A 3MZHA 2OPWA 2CL2A 2XSJC 3FK6A 5CJ9A 2XRLA 3EUHA 2OPKA 1AX2A 4I02A 1Y6IA 3LSHA 2JA5J 3FKIJ 4LD5A 1XGSA 2EXIA 3FLPA 4AXOA 3Q9VA 4D5CA 2ZFUA 3ZFEB 2MEV1 1QJZA 1PO13 3PO3J 3BG5A 4OU0A 5JAXA 1Z7S1 4XF3A 3I4IA 4QKFA 4Q4X3 4C3JJ 4LKFA 3K3NA 2XL7A 1TMF1 4B4RA 1ULFA 1ND2A 1L7LA 4BAYA 4EJUA 4HVQA 3K6GA 4BISA 2E1CA 4LG0A 1H9GA 1XD7A 2WINB 3HG9A 1W0PA 4TSVA 3HRUA 1YIOA 1FNZA 3PIPF 4K6BA 2R7XA 5JMCA 2ZFWA 4LG3A 5EPAA 3O1PA 1W6MB 3VBUB 2YBKA 5A3PA 1OR7A 1OOPC 2WN2A 3QQAA 4EWEA 3PSIA 1KONA 5KHDA 2MPFA 1DQ6A 1JOPA 5F3CA 5KXEA 1OBNA 1WMEA 2R7DA 1JHHA 2MEV2 1R7JA 2W1UA 3ABTA 4CXFA 2XJRA 2TDXA 3KLNA 6PAXA 3KQ4B 1A8MA 2ZX0A 3AG1H 5GLTA 3RKXA 3F21A 3ZXFA 1TMF2 1W2AX 3HOXJ 4WM7A 2AREA 3SH5A 5LB6A 2HWB1 1RITA 1GP6A 4OMZA 1HB2A 3NJYA 4GKXA 2ZNYA 3DTKA 5E3OA 2XAGA 3RDIA 1U9NA 1DP3A 5A33B 1FPQA 1YW7A 5FZ4A 2Y6JA 1JZ5A 4PI0A 2GXGA 3H35A 3RZZA 2V1UA 5H6RA 1HV1A 4KT6A 4M6XA 2MD5A 4CEYB 2XVLA 3B3QE 2P2KA 5EWSA 4B3AA 1MJAA 4YW3A 2DOAA 2JG9B 1E5IA 5FKCA 1X2NA 3AXDA 1ASJ3 3GDBA 2XBO1 1AR63 2H27A 1D1BA 3IRRA 4CUCA 1RUI1 1IOAA 3VL8A 2ET7A 5LY2A 3A22A 1STZA 3FBNB 1X3WB 1VAKA 3M1EA 1YIFA 1N3PA 2HWB2 5FMCA 4FPJA 1U5TB 2QGUA 2ECCA 2RKHA 3HC7A 1TQ5A 1RR7A 1O57A 3OCPA 4MO7A 1SFKA 4IPAA 3RFRA 1NH3A 1CF7B 4XFGA 1NKGA 2DUOA 1F5JA 2FDHA 2OQGA 3W59A 4KITB 4A0ZA 1W0TA 4XHXA 4U0VA 1QVUA 4BQYA 2QLZA 4XQ4A 1W6PA 2ME6A 4CEWC 3JRHA 1BC8C 1ODNA 3JQWA 3CCMI 1K12A 2D6OX 4HFSA 2OBPA 1RUI2 1X1DA 2E32A 4EYUA 1OCZH 2EINH 2ISYA 1W6QB 3LAPA 3TOJA 4S2FA 2RS51 5C8CB 2C4XA 4LPLA 1J59A 3B02A 4PIYA 2Z5UA 1R5HA 4Q4V3 4ZZ8A 2QJVA 1V00A 1K6YA 2VOTA 3FBMA 5IYYA 5A3MA 2PN5A 3DXJF 4A3LJ 3CCSI 1YJKA 3ZFFA 3O1SA 4NQWB 5AFEA 3VLBB 2HWF1 3N7KA 4A3FJ 1UN1A 1X1AA 5BXXA 3VGIA 3ZYFA 3PUSA 5HOOA 2ZXIA 2IWGB 3WTYC 3HBKA 2XASA 5JHUA 3FHQA 3S1MJ 4QPGB 5CA6A 4HV5A 2VJJA 1BBYA 4MGZE 3W20A 2HKOA 2X10A 3Q8FA 4CP0A 2VONA 2DTRA 4Q26A 4ISRA 2R1BA 1GOGA 5IVJA 1N1SA 4IEYA 1NG0A 2RS52 4AQSA 2Z2SB 3WR0A 2M3AA 3AZVA 2W4SA 5AVPA 1WH7A 3EETA 4ZYEA 4M0NA 1BBT1 4FQZA 4OHYA 4I2OA 5SV5A 3FN9A 5DTDA 1F43A 5A32A 4UFIA 2HWF2 1JUSA 5DUIA 1JYWA 3WDXA 2WABA 2RJ2A 2JEMA 2X1EA 1FC3A 3ZPLA 2F6BA 2JDKA 2G9GA 4BDYA 2VOWA 4X8PA 3O0VA 3SDGA 3J7YJ 2FOWA 5JVGF 5IK7A 2PLV3 5EXOA 1UL9A 2VL4A 2WAQN 1Z6TA 4CDQB 4DZGA 1YHFA 3OD4A 3I54A 3H1CA 5F5CA 3LEIA 4AFDA 1WW6A 4TYSA 5EZGA 2MNGA 4A41A 1YFUA 2RNJA 1BBT2 1EF4A 1QVTA 1NAEA 3COAC 2XLAA 5HXMA 1H9PA 1UKGA 3SITA 4UT5A 4L92A 1QJY3 2XGCA 4YG3A 4MYEA 1FX5A 2JDHA 4CTEA 5FZDA 4IERA 2GH8A 1MMAA 4QX3A 4ZPIA 2ZGRA 3ZM8A 2ZBKA 3PVOA 4KWJA 1UY2A 1ULPA 1ETOA 2ADUA 4NJ4A 1A6CA 3W58A 3FX3A 1XPWA 3VBFA 1HQLA 3IPVA 2WAQA 1J83A 4M9XA 2DI3A 5AIPA 2L3DA 3CKHA 5DUWA 4B8XA 2PELA 4MVTA 2DCZA 1HC8A 2TCTA 1MNMC 5J40A 1DU0A 2Q8CA 2E53A 3ME2A 2R5YA 1BLZA 2HKXA 1VFCA 5EJZB 2R073 4XXPA 1OCRH 4AU7A 4ENKA 3DKWA 3ZXLA 5FGMA 3EXUA 4LIVA 1RUG3 1BOBA 3OSDA 2MLGA 2IFRA 1CJPA 2F4LA 3D4KA 4DOZA 3KP3A 4IEUA 5FFOC 3AP6A 2CG4A 1UY4A 4HXCA 2Y0IA 4D3WA 2K27A 2UY8A 4QIWN 3O8GA 3LAGA 4GYIA 3WNKA 3WHCA 4OQ9A 2DMUA 4KNYA 4K1YA 1UAIA 3HM5A 5DS9A 3VD7A 2ZGUA 4Z1VA 5F0CA 5F0FA 3CP2A 3KIOA 1RVF3 4Q4W1 5EDNA 4DYRA 3AMNA 4RQPB 4KIFA 1Q8PA 3OL3A 4YRDA 2X29A 4XILA 3C2GA 2ARBA 2EH3A 1JZ3A 1E57A 3GYHX 2WS91 1PMJX 1SACA 3VBFC 1R1A1 4YVWA 1CAUB 3ZQHA 1UY0A 3LEMA 3O2PE 5C6CA 4FPOB 4QXCA 2A5ZA 1YEWA 1FI2A 2MGQA 1A34A 2XHKA 1SHWB 3VL9A 2WRAA 4E8CA 2ZSHB 3S2DJ 4QPOA 1ACCA 5FYBA 2EA4A 4B7EA 4AR2A 3H3ZA 2VZSA 3EBRA 2K9MA 2JKBA 4IV3A 3ETPA 4CGZA 2FRHA 3S2WA 1POV1 3OYAA 1K3IA 2YG0A 1T33A 3JW4A 1H89C 3VB9A 1R1ZA 2VMFA 4OFGA 3B5LB 1OT5A 2I2SA 3LPFA 1OYYA 2VBYA 1KS4A 2WL1A 3U10A 1AX0A 4IL7A 3GVAA 1LECA 4K1ZA 4Q4W2 2IXSA 1R23A 3VKFC 1FWZA 5C4XJ 1LOFA 2HPIA 2XGDA 2YMZA 4XFCA 5KBFA 4L9JA 3GHMA 3VBSB 4GZ9A 2WS92 1DPUA 1R1A2 4IEPA 5FO9B 3RWNA 1SPPA 2Q5TA 3O1VA 3PVBB 3H7YA 2XLFA 2E1MC 3JR9A 1OI6A 1AYN3 4M3CA 3WCSA 1IXRC 1V55H 1GWLA 3NAUA 3WQBA 2JQ7A 2UWCA 2L5QA 4PI2A 4OZOA 1I27A 2ET1A 2Q1ZB 5G05L 4EWDA 3TEDA 1TZOA 2WT0A 1IPKA 1HQCA 4L9TA 3LSMA 4MG2A 4AVZA 4PF5A 2KRCA 3S57A 2G9ZA 4YW7A 5BV6A 4LLOA 1R1VA 1RUF3 1GXPA 2F5EA 3OUJA 4F91B 2WO7A 4INDA 3LIHA 3VBOC 2JVHA 1MDMB 4G12A 3V0BA 1QQP1 3I2HA 3H36A 4QB1A 4O61A 1I6XA 4AQ2A 4CP2A 3K2ZA 5DZGA 2O8OA 3VKMA 1UNBA 4U0YA 3E97A 3JB8A 3ZXDA 3GZNB 4D6SA 3JD71 3H3LA 3CJNA 1O4ZA 4DEVA 1RINA 4KN4X 4X6AJ 1H8TB 1BVVA 5HS9A 2NNYA 4E7JA 4M01A 1FSHA 3DKYA 1RL3A 5LCWL 5FZAA 4M3EA 3O5SA 1JUPA 1UOGA 1D4M3 2ZJQF 3QLQA 1XU1A 4P08A 1MSEC 2HEWF 3VDDC 3J7HA 5BNOC 5D8KB 3AM2A 2A3WA 2Y31A 4IGQA 1F1ZA 2VTFA 2NP0A 2L54A 4K21A 3NRVA 3FXQA 4EJVA 1S3JA 2LF7A 5FB2A 5C44J 2GMMA 2WZR3 1QXPA 3H5RA 3MV11 3HJRA 1O3QA 1QQP2 4HNUA 2JD4A 3GZAA 2QNKA 4IOAF 4XF9A 1JZ8A 2ZMKA 3WF3A 4WM8C 4MOAA 1JI8A 4B48A 3O1MA 3HOSA 1R64A 4JGYA 2VUMJ 4WWCA 4ISQA 3JD72 3N9MA 4U0WA 2FCTA 1RETA 4XLNF 3U0ZA 4AK3A 4UI9L 3HGGA 4KICA 3IBMA 2K4JA 5E8AA 5FFXA 3OYDA 4P5OA 3SEQA 2OUHA 4R9CA 1N1YA 1YQ8A 4HF1A 3KQRA 4IX7A 3VEPA 3DEWA 4D9JA 3H5AA 3N9PA 1R1TA 3CLPA 1CIYA 1SAXA 3J9SA 2AUYA 3ZFEC 1VAMA 1SMTA 3VPRA 4P9FA 2OC6A 1C5IA 1GKBA 2KISA 5L3EA 5J96B 3NEUA 4PCQA 5FJKA 2HZDA 2Y6FA 3RI8A 1SBEA 4XMIA 1LHWA 5D2AA 4CU7A 1RZ4A 1X9TA 2XJQA 2RV8A 1OHFA 2ZHNA 4AEKA 2L7MP 1ZRFA 3KCCA 2RJKA 4J1XA 2LALA 1HSJA 2NPIA 3VBUC 3SLIA 2NVXJ 2WR9A 4R9BA 3M8EA 4LBMA 3TB0A 1BK0A 4AM3A 3HN1A 4LO5B 1IZ3A 2QYOA 1LHVA 3KHCA 2V4VA 1LB2A 1S1AA 2B42B 1XGNA 1W8OA 4ONUA 2DMTA 1CF7A 2VB6A 3E6CC 1JE8A 4B8EA 5AC93 3V4GA 4LO4B 2FQ4A 2WC2A 2NZ9A 2I74A 1OXCA 3SCFA 4JTOA 1UHSA 4DBQA 5EGOB 3ZDSA 3BTXA 3CUQB 1YLLA 4GRIA 4I01A 3FUQA 3L9JT 1MZ5A 4LB6B 1GNZA 1MS3A 5M3FJ 5KAFC 2A5YB 2P81A 3WLUA 2YDEA 3AKSA 2V5YA 1N78A 1ULCA 2VZ3A 1XE8A 3RZLA 3LSEA 3I56I 4PQ9A 3HUGB 3VDCA 4YG6A 3WW3A 3I3DA 1BIBA 1LDDA 3FMSA 5D8LB 2R3SA 3MPPG 1OLRA 3DECA 4F8AA 4LA2A 3CCJI 2MW8A 3ZQFA 1DGWA 2VI6A 3MW2A 3TDUC 1NA1A 5CQEA 4XFFA 4CEYC 2D40A 2ICWG 4CCCA 3GFLA 2JG9C 2HWC1 2VZQA 4L99A 5J48A 1JU4A 3BVCA 4EWAA 2KFDA 2M5WA 2WAAA 3T1MA 4ZH4F 1WLDA 2CSGA 3BDDA 2CGPA 1U5TC 5GZEA 3WGGA 1KA8A 1LGNA 1UU5A 2VVFA 3BR1A 4FO9A 4UFJA 4E7LA 2DPDA 2H0VA 1BEV3 5GPCA 1YHQI 4BZ4A 5FY0A 4XMYA 1WKMA 4HDVA 3QWLA 5FZKA 3WNNA 3S5AA 3DN7A 4PGGA 3OOXA 2VPVA 2DMNA 3NW4A 2HWC2 2YPJA 4V2GA 1BR1A 1QRYA 1POQA 2W92A 3MIGA 3FHNA 4FPCA 3H9GA 1X1PA 2KHMA 4MH0E 5D6FA 2XUBA 2PX9A 3IH4A 2P5BA 4GH4A 5C8CC 3ASNH 3T4VA 4UBGA 1ZG3A 1G9DA 3VKOA 3WDVA 1P4WA 4LK1F 1FOXA 1OYIA 4RL7A 2XAQA 4L0ZB 2BYVE 5B3SH 3NV1A 1Y39A 4MGRA 4HKLA 2WQZC 3F9KA 1QNYA 2ZA9A 4YGEA 4A3BJ 3RZMA 3D5OA 4FPYA 1BJQA 3RZHA 1RUE3 4K20A 1FEXA 5IT9Z 4F3QA 1UX7A 1R58A 4YPJA 4QPGC 3J7LA 2JSPA 2LOOA 5BS6A 4Z2WA 3BJOA 2Y38A 3IWZA 5GLZA 2FNAA 4ARXA 5FOBB 2EIEA 2DURA 5HV0A 1TNSA 1UZCA 2CNAA 1HRV3 4Y1VA 3V8JA 1TEIA 1TL8A 4LO6B 3W21A 5HS8A 3NAPA 4IO9F 4NHYA 4F7ZA 5DUXA 5HI0A 2L9NA 2FDJA 1QGPA 1PK6B 1APLC 2G7HA 3BR2A 3M2MA 1XC6A 2GNTA 2YFZA 5CKTA 2JN6A 1X4OA 5JLWA 2W24A 1T8IA 2WB1N 4P9UA 3OOUA 4DXTA 3AJYA 2WJSA 4YIIA 1RVF2 3I9V2 1YFXA 2PAEA 2HYJA 2VOPA 3PO2J 4DQ2A 1YJLA 4L9VA 2Q8OA 4FFHA 2VNRA 1SG3A 4BCUA 5FYMA 3SQOA 1J9IA 1CZTA 2BGOA 4CDQC 4DY3A 4B1RA 4GO1A 2J1UA 4IZZA 2E60A 1D1CA 3LA7A 2CWEA 2KLOA 5FZBA 3T0BA 2ZJPF 2DT6A 2SLIA 2ZKNA 3Q8BA 3L1PA 4OULA 2YU9J 2R043 1SLLA 1AYM1 1VALA 1JKOC 1RMU1 2FMLA 1S0JA 5D8AA 3OR2C 2WB1A 3OS0A 2VZRA 1XSRA 4BBRJ 3EMRA 3M8FA 5FP8A 5FP4A 4KFCA 5GAGJ 4HONA 2RMU1 4K40A 2K9ZA 3WG9A 3MGUA 4YFWA 4XXAA 1CAUA 3B9IA 3WOGA 5T5PA 3PUQA 3P7NA 4DZJA 2A5WA 3AYDA 1JTXA 3ENRA 3KV6A 3PVEA 4L9BA 5IWFA 3G6EI 3SISA 1GOHA 1W8HA 1HW2A 2DBBA 4OI0A 1ZBA1 4IEXA 2R061 3WU2C 2D97A 5C5TA 3FC0A 4C0BA 4DXSA 1GP5A 4DQAA 4K8FA 2Y26A 4ZU4A 1AYM2 4C2UA 1DU6A 2EVXA 4E2GA 3OBAA 5DEQA 4FISA 4IVNA 3OUHA 4N90A 4Q1PA 5FLVA 4E8DA 3VB2A 4LO8A 1FPN1 3MD2A 3SMHA 3WINE 4MGTA 1DCSA 2ZAAA 1S0IA 3ILFA 4RS5B 5FZ8A 1BN5A 3G1LA 2VU9A 1WD4A 2RMU2 3BOWA 5FP3A 2NN8A 4CSWA 1EH8A 2P8TA 5HPOA 2Y9ZA 2LF8A 2WY8Q 4JBAA 3KCXA 3JZVA 1VQ4I 4RB0A 1NLRA 4MGKE 1XPXA 1GZWB 2VZUA 2ID4A 5DN2A 2I5UA 1YCIA 4BQOA 2LDUA 3MBWA 4P9IA 1ZH5A 1W1WE 1ZBA2 2G1MA 1J5YA 2R062 2YX4A 4BHCA 4GWJA 5C70A 3L00A 4EM0B 2Y64A 4FAHA 3DXTA 2RS31 3BCAA 3NL1A 2LM3A 4XBLA 3MPBA 3HNMA 1TBXA 1D8KA 3QD6A 4RQPC 4Y20A 1S7OA 1RUD1 2EFWA 2AR6A 4OCTA 4X6RB 4XLCA 2AEZA 1VBA3 4EQVA 1KQ8A 1AR91 2YY1A 4UV9A 1L3JA 3M3CA 2DA6A 4Z2AA 2DO7A 1AKHA 1UD1A 2QKMB 4GMP3 1EAH3 1JXSA 3J26N 2ETEA 1GNHA 2DA7A 1SD5A 4CPBD 1WJ5A 5FLHA 4OAZA 4BACA 4QHZA 1PZ9A 2GWRA 2Y9YA 3WP5A 4CDWA 2A6HF 1PVXA 1MDMA 5H6QA 2L7FP 5EV7A 2D6KA 3J7AO 2ELHA 4QM9A 4A3XA 3K4KA 2VL8A 3IIAA 1LUJB 3V64A 3B9CA 3CBNA 3DFGA 1IN4A 3QRFF 1NG6A 3D5LA 2BE5F 3D82A 4YVSB 5IK8A 3BI3A 5DUUA 2Q1MA 2RS32 2WLPA 1IKPA 3I2FA 5D5UB 3ACGA 4BQ2A 1FTZA 2DJNA 5GP9A 2Z42A 3VBSC 1AR92 3R60A 4OHWA 4CZSA 2HI3A 2AS5F 2Y6GA 3NNMA 2DFIA 2GP5A 1GZCA 1OD5A 5IAXA 2P7VB 2D44A 5HODA 1DLCA 2HFHA 1KFXL 2Y48A 3JBG1 4E7IA 4M3GA 3ZMSA 5LK7B 5FPLA 3ZMUA 1PZ7A 2VTXJ 2XMLA 4XJWA 5E1RA 2F2EA 2DA5A 2BGPA 4XKWA 3H3UA 5IP9J 3ZO0B 1B8IB 4NAOA 4B47A 3V0AA 1MJBA 1JKPC 3IL2A 3P9IA 1W9SA 1QU0A 3QBQA 1A6IA 5KR7A 1XS9A 1HSTA 4IHVA 1SFPA 2E7XA 3VDBA 1OFCX 4KWLA 1GHCA 1W3VA 4UB6C 4XIOA 2WO2A 2XSDC 3CCVI 2HWE3 3RVHA 4MEXF 3FZ3A 4S04A 3U4SA 1PVC3 1XX5A 1TNFA 1GOFA 3FBIB 3B01A 3JBG2 4ZDOA 1FMD3 2HXIA 3FK7A 1EV13 3K10A 3RJPA 1KU7A 1R71A 5K0UB 4A6SA 3G73A 2CV2A 2XC7A 4QPYA 1ZN2A 3N3HA 3TN93 5C5UA 2NS0A 1H8TC 3UV9A 5D4SA 3KFWX 4H7MA 2R92J 2ZJCA 1MD0A 4GDFA 2R32A 2W1QA 5HS7A 4OIRF 4HG2A 1PP8F 2PHWA 3PNTA 5L36A 1UYXA 3KYCB 3KT1A 3HQRA 3IMNA 3IDCB 3B73A 3I64A 4P1WA 4LK6A 4HLYA 4U36A 1ZZBA 1LEDA 3M3EA 4RB3C 5HCAA 2OTJI 5AIQA 2ELKA 4CYDA 4IUGA 1RYYA 4Z82A 5IVVA 2VMCA 3BPSA 2DCKA 4KISA 2FBEA 4LE3A 4FBFA 3HRSA 5FXWA 2GZWA 1ENSA 1M06G 5EGOA 3A0NA 4UW3A 1MZEA 2VUDA 2EJRA 1WW5A 3CUQA 4HPQA 2HNHA 4Y4YA 1U5XA 4WXCA 4JX4A 4B3XA 1TNTA 2IVIB 1ZGAA 1K5MB 4S2GA 1JS9A 3QPSA 4CCKA 1ULDA 5HLHA 3RMYA 1MZBA 4QTRA 1X50A 1R091 4BMBA 5GAHJ 1ENXA 2IXIA 4ZDLA 3BZ6A 2PHUA 2QSFX 1UOFA 1QXRA 1Y8RB 2G9FA 2OUJA 1QPIA 1OA4A 4QB2A 1F9KA 3WTUC 3BTZA 3H92A 4DRVA 4QQPA 1U8RA 5L9VA 2VQTA 2WUHA 3GZUC 2L9VA 1B9NA 5B5EC 4HANA 4Q0UA 1OLTA 4ATEA 3NWTA 1BA5A 3BPZA 3T1LA 3M8LA 3HL2A 4GXLA 3TOAA 1R092 2AACA 4NHJA 2GP3A 3CCEI 2ZZJA 2XG3A 2W1SA 1UKRA 2W5FA 3N9OA 5CEHA 3K9TA 5IYCJ 3AZZA 4NPRA 1S0FA 3ZKYA 4I0AA 1REPC 3KX2A 3GF6A 5I8TA 3U07A 1YQ6A 1YRNA 1VQPI 1H2KA 1ZR2A 3CUQC 3ISPA 4JGZA 2O14A 2O03A 4RAGA 3ZSMA 1HQWA 5C33A 4GWMA 2QDRA 4KMUX 2VECA 2A70A 5J98B 2ZGQA 3N9NA 4CU6A 2XJPA 4W65A 2B4KA 3IH3A 1Z67A 1V6LA 3GXOA 2KIMA 1UPSA 2JXAA 2Q4SA 4XIKA 1ETYA 3M1HA 1IG7A 1YFHA 4PF1A 1ETWA 5DUKA 4CP1A 1U5YA 2P34A 4XLAA 4E4ZA 5FYYA 1EPWA 2EF6A 4OUSA 1XSXA 3ACIA 4GJYA 2ZSIB 4NRQA 4RR3B 4FOVA 2QQMA 3PL0A 1H2LA 4R9DA 4Q29A 3LEGA 3OY8B 3JTGA 2ARCA 1AOYA 3KP5A 5HDNA 4JKKA 5ICCA 1H8AC 4GB33 2IFWA 1WRJA 1DZQA 4YIFA 1AR73 4DGWB 1LJ9A 3LOIA 3TBIA 5CU1A 2BBVA 1IDZA 4XUNA 1YC61 4AAPA 1T6GC 2NVUB 2ZMEB 1WZ2A 1V9U3 1VLNA 4HOOA 5IHRA 1W2UA 1W4MA 1HKDA 1VZ0A 4OHVA 4COUA 3R4DB 1VBC1 3LFUA 3T2OA 1F36A 3CQOA 4COVA 4M73A 1CQ9A 3GZEA 1SD4A 1COV3 2OXBA 3MW3A 4D5FA 4GYGA 1O3SA 3AAFA 1FYUA 1ZELA 3M3YJ 3CMGA 2XGXA 1WCUA 2R042 3I97A 2VOXA 2PA7A 3PU8A 5CG8A 2BJSA 3I55I 2B7YA 4UAPA 2R7VA 3PTRB 4FFGA 2V73A 5ED4A 1NQJA 2GBYA 1IN7A 3K70D 5DAPA 5B4XA 4G7ZF 5DZFA 2JVGA 3T1BA 3OYLA 1DZRA 2Q0OA 1VQ9I 5IFPA 2V79A 3UGFA 3VFZA 2X4HA 1VBC2 3CMYA 4BS9A 1RR8C 2QQAA 1FYLA 1JBCA 5FQ0B 3T09A 3AP4A 2WYSA 1Q8OA 2FDFA 5LK5A 3HOWJ 3RI9A 3M3OA 1TW2A 4I7HA 1JYIA 4NNJA 3WHBA 1QY4A 3HT1A 3AP5A 2JE9A 3REOA 2EV6A 3TEYA 3SEZA 1E0EA 1C5HA 2ZEYA 4G6TB 2VN2A 1XYPA 3GALA 2C9KA 2ARAA 2EAKA 2V09A 4R8HA 2P3JA 2QFEA 3TO6A 1S5LC 4XRSA 4YW2A 4FI9A 4MQ9F 4G9YA 1LDJA 1F2NA 5BPDA 2YUEA 5AFBA 2XVCA 3WTXC 4YZ2A 1PK6C 2FU4A 3THPA 4EN6B 5CFCB 2G9WA 5IP6A 2HBTA 4R79A 4UW6A 3B93A 2X85A 5A7QA 1RTVA 1SDWA 5BUVA 4RGRA 2BVLA 3CJXA 3AZYA 3OYNA 1ENRA 5LATA 2BW8A 1W3XA 3IMMA 1E2XA 3KS7A 4V2VA 2E36A 3G1MA 1K78B 4WZCA 2ZXJA 2VMIA 4KBZA 3K69A 2QVSB 4CCJA 4BXUA 2WSUA 2W68A 4BJ6C 1EAH2 2VE1A 1ZZ6A 5LLQA 1HB1A 3WTWC 1GZWA 3NSTA 4N4OB 5K5RA 3LNQA 4PDWA 1QJX1 4ZXKA 3FDYA 4OMCA 1DQ2A 1P7IA 2COBA 2HLEA 1ND3A 4LTAA 2GC2A 1QHHD 2PYTA 2W9XA 3NNFA 5E17F 2DCYA 5FO7B 2LD5A 4XIDA 3B69A 1JUMA 3ZDVA 4CXYA 5I8SA 4PGHA 5M5WJ 1V70A 5CVRA 3FBYA 3WTTC 5CKQA 2MHFA 4CUBA 1XNDA 3GYDA 1GV5A 4Q4V1 1W6NB 3GW2A 2BHYA 3WW1A 5GAEJ 2BRTA 1WUVA 1US2A 5C3OA 2MLKA 1G9CA 3D3AA 2VLAA 3HQUA 4LBJA 5LA9A 3ZN6B 1BZWA 1RHI3 2JK3A 2W7NA 2M8GX 4QKNA 4AQTA 1QJX2 1KYWA 4Y24A 4CXWA 4CA9A 3K4MA 1QJFA 3F8NA 1NE4A 4RGGA 3BR3A 1EYBA 5JZGA 5F3GA 1UG2A 1SANA 1LULA 5C3RA 2ZAHA 2ORXA 4L5IA 4HVRA 3D6EA 4RS5C 4NRMA 3TNPB 1QNTA 1MBHA 2WKKA 2OVUA 3ABKH 4E2SA 3S17J 2DAOA 3A03A 4IF4A 4JAAA 1ORKA 4K7JA 5JI6A 3AKZA 2RQQA 3V7CA 4HF2A 2WFPA 4BXSV 3UKGA 1W0OA 3IZOA 4QLCU 1VMFA 1YW9A 2VUCA 3VBRB 3JCUC 1V6KA 3EDPA 1PVC2 4E7KA 2VJ5A 5I0UA 1LOGA 1I9RA 3OS1A 2RQPA 3WV6A 3H1YA 5C8WA 1ZBE3 2DOEA 4NWVA 3JTHA 3CC4I 1ETVA 2AZ5A 4G8XA 3J7MA 4XUOA 5I0TA 2HOEA 2R7ZJ 1D0GA 3LA3A 1C1LA 1WQ2A 1J75A 1B8IA 2AGSA 2J1RA 3ZFGB 5LBFA 1LHOA 2GNMA 2KM2A 5T52A 4A5NA 4RB1A 4COZA 2FZ2A 2YROA 2Z1DA 2K2SA 1YIPA 5FY7A 5JWPA 4ON0A 4YW5A 3L2QA 1PJRA 1SLCA 5FZ6A 4CH7A 2LKXA