2H6BA

Crystal structure of oxidized cprk in complex with o-chlorophenolacetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
239
Chain Sequence
VEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSVDKLAAALDHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Dna binding protein
molecule keywords ChloroPhenol Reduction gene K
total genus 68
structure length 239
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6bA01
1KU7A 3S7EA 1BI0A 3I71A 4EWDA 3D5LA 1XSVA 2NRAC 4UNOA 3LOIA 1LB2A 3J7AO 4B09A 4UVAA 1P4WA 3B02A 2JSCA 4IERA 1LVAA 1YFWA 1ZYRF 1KYWA 4OMYA 2TDXA 2KKOA 4HW0A 3I59B 4YNIA 2EFOA 3CLOA 1YTYA 2BV6A 5D4SA 2E9QA 4X6RB 3GX4X 1YW8A 3LA2A 4F8AA 3FMQA 1HKTA 4WZCA 1IXRC 2KIFA 4HF0A 3ACLA 3P7NA 4HYEA 1FXZA 2Y75A 3GFJA 2H27A 2GC0A 2ACJA 4LUMA 1UIKA 1OMIA 3WTVC 1RC6A 2QDRA 1SQ4A 5F64A 3DPTA 3DKWA 1R58A 4HN0A 2PBIA 4FAGA 3EBRA 3QACA 3TO6A 3K1MA 1X8EA 1STZA 5FLJA 3U1DA 1ZRFA 1BM9A 4HF2A 2WWYA 4CICA 1USTA 3IWFA 2F5CA 4WK8F 3ML6A 3BY6A 1CX4A 1UFMA 3BWGA 2R7DA 1J5YA 4CZZA 3U10A 3WU1B 1XGMA 1AOYA 2VBWA 3OOPA 5K1YA 3CO7C 2FNPA 1GXPA 1FC3A 4DINB 2FBHA 3HUGA 1UHWA 2X4HA 5LRRA 3ABUA 4ZYHA 2LF7A 4HF1A 5DUKA 5BOXA 4MQVA 4IEWA 3EYIA 5FLIA 3M8EA 3NEUA 4BHCA 1FZPB 4IESA 3HHGA 3OF1A 4IRHA 3P9CA 2QVOA 5LRSA 1G3TA 4J1WA 1OFNA 1K7AA 4YRDA 1SMTA 4XFFA 3TDZC 4CYDA 1LNWA 4KDPA 2XROA 1JE8A 3H9AA 2A69F 2PLYA 4A5NA 4E2GA 4JTOA 3IC7A 4ESJA 4KU8A 4PZJA 2PHLA 5HS8A 2B0LA 3COAC 2Q4SA 2YSRA 4WXDA 2GC2A 1HW5A 4KICA 5H20A 5FQ0B 2HGCA 3IWZA 1G3SA 2XAHA 5HDGA 3FM3A 4EJVA 5A2QK 2LF8A 4YFKF 5I8TA 1EP0A 4WVZA 3IIAA 2UZKA 3B73A 3HT1A 4K2EA 5I0UA 4I0AA 4I09A 4I7HA 4BXUA 2E1NA 2ET1A 3KP3A 5IT9K 3U9GA 3R60A 1Q5OA 1LEBA 1SEFA 3WG9A 1XB4A 3OGJA 2EFPA 2XUBA 5D6FA 4BQAA 4F7ZA 1DGWA 1I1GA 3IDCB 3T0YA 5LGUA 2EA4A 3HT2A 1XGOA 2B5HA 2RNJA 3V8JA 1SD7A 2MBFA 4L18B 1R36A 2OAZA 1K78B 1HW2A 3VODA 1D8JA 1YWKA 3KETA 2DT5A 3DP7A 4ZYDA 4ZZLA 3S0MA 3WTXC 4HBNA 4Q0UA 2KRFA 5JI6A 1RNLA 3E6BA 2D1HA 2GXGA 2NNYA 1GVJA 1WKMA 1YQAA 4OIOF 5CJ9A 2M45A 1JGSA 2FNAA 4GCVA 3CUQC 5E1WA 1HSTA 5EZWA 2VBYA 3WTWC 5F1RA 1J59A 5HLGA 3DPLC 4DQ2A 1LR5A 2VT3A 1P4AA 1LRHA 4I0BA 4HDUA 2XKPA 4IEVA 4ONUA 2O8XA 3VB2A 3I7DA 2YX4A 4XSZF 3W6JB 3MQ0A 4EJOA 2BNNA 1Z05A 2G9WA 3L00A 4RAZA 3L7WA 5DD8A 5CLSA 4LLLA 3RNSA 2E7WA 5E8GA 1X82A 3ES4A 2XKOA 2IRFG 4U88A 2LSOA 1Y0UA 4LMYA 2IXJA 1EYBA 1P4XA 2QYOA 2YX7A 2ZXJA 1LKNA 4G8XA 2CAVA 2ZMEA 4AQ6A 5E1XA 3D0SA 4Q48A 4HX7A 3ERED 5D5UB 4BH9A 3WTSC 2V09A 1Z6RA 4MV2A 2DFIA 4AVAA 2XRNA 4LD5A 2QJVA 4P96A 4HX8A 3LFKA 4EJWA 1NE6A 1TW3A 3WW3A 1WRJA 3J81Z 1FI2A 2HOEA 3WTZA 1ONVA 2P6TA 1LDJA 1O7LA 4P9UA 1J75A 4S04A 3SXWA 2W24A 3QP5A 2C6YA 3GYDA 2FE3A 2BYVE 1EH8A 2UXNA 1UCRA 5FFZA 5FB2A 4MTEA 1YFYA 3T5XA 1IN7A 3FMRA 5J8CA 3FWEA 1YW9A 2IT0A 1LDDA 2NAZA 2LNBA 1J9IA 2D93A 2DO7A 5HS7A 4JVAA 2LKPA 3F8CA 5LHGA 2J5OA 1B9NA 2I45A 5LLQA 5JSOA 2A68F 4LB6B 4IEXA 3GVAA 2CAUA 1PM7A 1O57A 4A0YA 1W5SA 1FLIA 4M6YA 1K78A 4QGNA 3Q9VA 4JK1X 2P5LC 4RS8A 2YPRA 4P55A 5DDGA 2AS5F 4PIYA 1Z7UA 3MFKA 4M9ZA 4MEYF 2YU3A 1RIOH 1ZLKA 1ON2A 1UW8A 5LGTA 1BC8C 4XF3A 2O0YA 3V7SA 2EFWA 3PQKA 5J6XA 1L0OC 3I4PA 2KJCA 1FT9A 1O3TA 4Q5SF 2WFPA 1A04A 1TLHB 3KEQA 2L4MA 1Z1DA 3GFLA 4YIFA 3BCWA 1XRUA 2IVMA 4L9NA 4M6XA 2DQRA 5DUIA 2FRHA 1K79A 2O61A 2FQ3A 2L4AA 2CQKA 2UYAA 3RKXA 1CGPA 2Q1ZB 2KJBA 3EHKA 2M1BA 4Y13A 3DN7A 2OA2A 5FDBA 3PLQA 5FD6A 4QGLA 2OD5A 2DI3A 4EMSA 1TQMA 3DV8A 4Q47A 1RI7A 5CVIA 1ZGJA 3R6SA 4PJYA 1U6GA 3E5UA 4FBFA 1FOKA 1IRFA 4XEZA 1KU3A 3FJSA 4M71A 1HKQA 2P6SA 4DNCA 4EQQA 2HJIA 1IRGA 1R1VA 3CEWA 3R4KA 4HSJA 2VBXA 3GFMA 4Q4ZF 1G6NA 4KWKA 4LTAA 1JHHA 1R00A 1K6OA 2Z33A 1SD5A 4EROA 2MLKA 2EK5A 5AONA 5EEHA 2QZ8A 1QZYA 2Q0OA 4HLXA 3WTUC 3LQRA 3LA7A 1ZN2A 3RTRA 2W57A 3HOSA 4YFNF 2KIMA 4I02A 3REOA 4Y15A 3LZZA 2FBIA 3KFWX 3ZMUA 4R79A 3HIFA 2PTMA 1VP6A 4O9EA 3F72A 2DBBA 1TBXA 3KP4A 4LLGF 1J2XA 4KN4X 1ZAOA 4EM0B 4WX9A 3SZTA 4LG0A 4IETA 1FX7A 1MDMA 4LLNA 3E6DA 1F9NA 2XLAA 4LB5A 1H1IA 3F8FA 1DZTA 1CAVA 4HLTA 1QPMA 3GEZA 2V1UA 2EV5A 4IJAA 5CVJA 2P7VB 5ED4A 1J58A 1J3RA 2QLZA 2K0GA 3FXRA 5FLXZ 2CYYA 4LEJA 2VQAA 4AWXB 1I5ZA 3TOBA 3D0JA 2MD5A 3CUQA 4ENMA 3KP2A 2FSWA 1EH7A 2D2WA 2EA2A 3ZMVA 2OU2A 3GZ6A 4M9SA 4OLLA 1X8MA 2CG4A 4XETA 2XGXA 3RYKA 3F23A 4IEUA 4L5JA 2A61A 3NQOA 5ICGA 5DV5A 3GWZA 2WC2A 1XSXA 1U5TA 4XF0A 3ABTA 2RGVA 1DP7P 4UV9A 1AWCA 1KU2A 4EM1A 4PCQA 2IPQX 4JBAA 1R7JA 5LHIA 3DL3A 4PGGA 1L3LA 3BROA 3FFQA 1ON1A 4ON0A 1D8KA 2EB7A 3IRQA 1I27A 2EJRA 5BV6A 3ZN1A 3NW4A 4LA3A 4MHGA 2ADUA 4XF9A 2A3SA 4L9JA 1SFEA 2Z2SB 1IW7F 1JUHA 3WE3A 4ETSA 4KL1A 3H1MA 4U0YA 2HTSA 4GULA 2HWVA 1CAWB 3FX3A 5BUVA 1YIOA 2ISZA 2CWEA 1O7FA 3G3ZA 2MHFA 2ZO4A 3PQJA 3Q5FA 1HW1A 1J7KA 4G6QA 3ST7A 5BPDA 4HSLA 1SMYF 1IPKA 3NJZA 4N9IA 2WV0A 3QP6A 3SMHA 5J7MA 4FX0A 1RL3A 2H09A 4O3MA 4HN1A 3IBMA 5HLIA 1CAUB 4ZU5A 2W84A 3V7CA 5HLHA 2FA5A 3ZQ7A 4UXAA 2PJPA 2IC1A 1OYWA 2RQPA 2GQQA 2L3DA 3RZZA 5JCTA 3CUOA 1XE7A 2ESHA 1ZZCA 4MZUA 3IKTA 3NRVA 3VEPA 1FP2A 4RGSA 2E1CA 2GA1A 2A07F 3GBFA 1UPIA 1DPUA 1Z91A 1MJ9A 3FZVA 5KHHA 1KQ8A 4MGKE 4MEXF 2GZWA 5L3BA 3DXJF 3NKTA 3C18A 1SFNA 4ASNA 3GO5A 5HOOA 2ETHA 5KHIA 4KUMA 4GGGA 1J0RA 1D5VA 3SCGA 1BI1A 3GUDA 3BPZA 1G4DA 1ZGAA 3E3VA 2JT1A 4HLYA 2ZNZA 2GC3A 3JW4A 5IT9Z 2PFBA 1RUOA 3ECOA 2HYGD 3EO6A 1E17A 3K9TA 1TQ5A 2O1QA 2QQAA 4A0XA 3IL2A 4XRFA 2RKHA 2QENA 1B9MA 2IXLA 3IDBB 1FP1D 2VT2A 5LGNA 1XCBA 3R0AA 4YYOA 2GAUA 1O3QA 1J3PA 4QGMA 2VXZA 3KSCA 4IPAA 4CDGA 1IAWA 2UYBA 5ICEA 1BI2A 3BB6A 4RGUA 3RIRA 4LJZF 1GQHA 4Q0VA 4HV5A 3I58A 3H7YA 2HQNA 1SD4A 1YW7A 1Z9CA 2QBYA 3E5XA 4MGRA 2HYFA 3U2RA 3NSTA 2PEXA 2Y48A 1I6XA 3HQXA 5I93A 2VBZA 4GXOA 1VTNC 3UKTA 1P6RA 4IEPA 1FSEA 4XBFA 1SFUA 3HTSB 1I1SA 3HSFA 3JTGA 1GHCA 3H7JA 4P5OA 2KXLA 4WXHA 2GXBA 2ZJ2A 3WTYC 2BBYA 2HKOA 3V4GA 2FOKA 2O03A 1BOAA 2ZFWA 2O8QA 1OI6A 3H1WA 4M9XA 3S2WA 3GZ5A 4L9TA 2PI0A 3G7DA 3M3IA 4E2SA 3I5UA 2G7HA 1EV7A 2OZ6A 5TJJA 1EH6A 2RDPA 1ZHFA 4BNCA 1ZRRA 1G3YA 2P5KA 4M74A 5KK1A 4KT5C 1YLFA 2V6CA 4QXKA 3CDHA 5H6QA 4EWEA 4XFHA 1WGPA 3M70A 1O3RA 1BC7C 3HRTA 2QWWA 2P17A 2FEZA 1Q43A 4OU0A 1WSUA 2DLLA 4E2QA 1ZARA 1PP7U 4N0BA 2DK8A 2QCSB 2NS0A 2FF4A 3ELNA 1V3FA 5LEJA 4IRIA 2V1XA 2XHKA 4EM2A 3LQQA 1U12A 2STTA 1R5GA 3F6OA 3FXQA 5BQTA 4X6QB 5JR7B 4PIZA 3H3ZA 1E2XA 1QXJA 4YG2F 3RPQA 1CAWA 1U2WA 3CO2A 2EFNA 1UCXA 2MA3A 2UY8A 4RB0A 3WTTC 1FBUA 2PMHA 5JFRA 3TDUC 4LUKA 3WU0A 3KP6A 5K8SA 4ZU4A 4HVRA 1U8RA 3O2PE 4UVCA 3LWCA 1BJAA 2QUFA 1WWXA 4O5VA 2GWRA 4G7ZF 4MGZE 2VE9A 3VHRA 1H1MA 2JPBA 5K5RA 4RGXA 2PMUA 3FXUA 3HRMA 5ILVA 4I3PA 2IA2A 4ESBA 2K7LA 4ENNA 1SAXA 5AIQA 1LJ9A 2D1VA 1NYWA 5BPXA 5ERIA 1WA4A 1KGSA 1BI3A 3L09A 3WE2A 4G6DA 3SCHA 4CO8A 4HQEA 3TQNA 3KMHA 1FYKA 2VPVA 5JSRA 2KIUA 2DAOA 5KVRA 3LAJA 4ZYEA 3IRRA 3FF5A 2DU9A 5DEQA 1IXCA 1BIAA 4LLOA 1R1TA 5E8IA 5KHJA 4BHPA 2Z69A 2BE5F 1U5TC 1TTYA 2DQLA 1DGRA 4A2UA 3Q9SA 5L3GA 2W85A 2F5FA 4BYYA 3EQEA 1H9TA 2N7GA 4QX5A 4PGHA 5CADA 1J1LA 5D5VB 3ZP5A 4RAYA 1F5TA 1MJBA 1DDNA 5ILUA 1IN6A 4O6JA 4UHTA 1OYYA 3HSRA 4L11A 2B9UA 1JXSA 1QY4A 4YFXF 4HDVA 4I01A 4Q29A 4FX4A 3TNQA 1T38A 4IHSA 3BU7A 4WCGA 4KYWA 5DCFA 1Z6TA 1L3JA 4U0WA 3BALA 3DEUA 3C1DA 3MAJA 4RGRA 1HBXG 3I54A 5FCCA 2NYXA 1XSDA 4IF4A 2YR2A 2W25A 2HKXA 2ET7A 1H0MA 1S7AA 4HBLA 3J80Z 4ENKA 3KEOA 1J3QA 3SCFA 1T2KA 1CF7B 3I59A 1ZX5A 1XD7A 1Y9QA 3E97A 3NVCA 2FMYA 2GU9A 5CVUA 2XL9A 5IT3A 3UKNA 1T39A 2ZMEB 3G73A 3GFIA 1QNTA 5CVRA 2HEOA 2CFXA 2EV0A 1PP8F 5DCMB 1EY2A 3FE5A 4D7SA 1BN5A 2XASA 3HTUA 2OZUA 3EUHA 1X7NA 4UBGA 3ELKA 1DZRA 2K02A 4EGZA 3N97A 2J5PA 5J48A 3JSPA 4EJUA 1UIJA 2PAEA 2HDCA 2HTJA 4QWQA 2F5DA 5E1ZB 2CV6A 3PVBB 2L01A 3TO7A 2DPDA 5C8WA 4KIGA 2JRTA 5DYMA 3V8KA 4IEYA 2VECA 1ZG3A 4HX4A 1UHMA 5L3EA 1IN5A 4UXNA 2Q30A 2EA7A 4Q0SA 4GYGA 4MH0E 3CO6C 3P9IA 4Z07A 4UUVA 3SHRA 3RPUA 5E18F 5D4RA 3CLPA 2K4BA 1XGNA 4MQ9F 1D3YA 3M1EA 2UXXA 4QMAA 4HAMA 1IN4A 4XSXF 1W7PA 3VFZA 1SFXA 2P5VA 4KIBA 3BDDA 1FPQA 1PDNC 2Q2EA 5HDKA 1QWRA 1MZBA 4L5IA 3C3WA 2A6HF 4META 5J3UA 2FBKA 1PUEE 5JHUA 3QU3A 1WQ2A 4R8HA 4KU7A 5I0SA 2DW4A 3KGZA 3ETQA 1UD1A 4AXOA 2MH2A 1VR3A 3GXOA 3JSOA 1BIBA 4Y17A 3CUQB 3MEXA 4Q0QA 3HOTA 3EETA 4PIXA 3F6VA 3HHHA 1T0FA 1U78A 2Q0AA 3FMSA 5I91A 3P9KA 1XDSA 1MGTA 1IZ1A 5CYVA 3E6CC 1REPC 1GXQA 3PNAA 4LK0F 2DPUA 2PG4A 3MYXA 3SXYA 4G7OF 5EFUA 2F5EA 2D40A 1ODDA 3U0ZA 3BJOA 3GF2A 3CL1A 4A0ZA 1O3SA 5E16A 4LK1F 4KIFA 1DPRA 4XLNF 1U5TB 3QPHA 2OQGA 3CTAA 5LEKA 4UVBA 5BXXA 3TNPB 3N4MA 4YARA 3H92A 1ZRCA 2GIVA 1FWZA 1Y3TA 2EFQA 2Q8KA 3DQVC 2QNKA 5I8SA 3LA3A 4AVCA 3TO9A 3RDIA 4AVBA 2F4PA 1R1UA 5HI0A 4Z82A 1ZZ6A 3O3KA 2V1DA 2MC3A 4ESFA 1LQ1A 5K5OA 4NHJA 1YO5C 3AAFA 2PYTA 4FT8A 1HXDA 3KP7A 4I98B 1TNSA 3CJXA 2R3SA 2XIGA 3BOQA 2V9VA 2JZYA 3V7RA 3K1PA 1RUNA 5FFXA 3C3VA 2OQRA 3R61A 4NVPA 1R23A 4CGZA 4ENJA 5LHHA 2OBPA 5J8FA 3I0TA 1ZZ7A 1P2FA 4ORFA 3FHIB 2Z99A 3JAMK 4KMUX 4MTDA 4I2OA 4KMFA 3KE2A 1ZG5A 1W7PB 1MDMB 4IEZA 5LBQA 3QRFF 4HZFA 1ZZ9A 5JSPA 5FLXK 4FHTA 4JQFA 5D6EA 4U7BA 3U11A 2B8MA 3M8FA 3K2ZA 5AVPA 1KU9A 2CW0F 4CXFA 1IXSB 2RVCA 2CSOA 3WGGA 3ECHA 3ZN0A 2IXKA 1OYIA 1QZZA 5D1IA 2M87A 3F8MA 3FZ3A 1DUXC 2GH2A 5JR3A 3ZMZA 4H0EA 3SQNA 4YSFA 2PFWA 2HR3A 4G7HF 4QM8A 1IN8A 4A12A 2QVSB 4AVPA 3LWFA 3BJ6A 3L9FA 2Z9OA 4IXAA 4K8FA 4IEOA 1ZZ8A 3C7JA 2O6GE 2BNOA 1FSHA 2EVXA 5ILSA 4LG0B 2E7XA 2GC1A 5CU1A 3QPTA 4NQWA 1CAXA 3J81K 3EQLF 2Y0MA 3F21A 4G94A 4BAYA 4QLCU 4D0PA 2ZKLA 4UBHA 1B4AA 4ZH4F 2ZKZA 2OZJA 4S05A 4M72A 4RB1A 4MGIE 1B59A 6PAXA 3I64A 3BPVA 3KP5A 1TNTA 1BBYA 5BS6A 1JHFA 1XE8A 2PA7A 4FAHA 5KHGA 2EWNA 4HOBA 4NB5A 3JZVA 4EV0A 2XAGA 3H3UA 5C6CA 4U7DA 3IKVA 3RYPA 5I8YA 5AIPA 3RKWA 2QM3A 3VOEA 2HZTA 1XN7A 4ZU7A 4OMZA 1P92A 3PFIA 2D45A 4MNUA 1X3UA 4AQ2A 3FM5A 3RJPA 5D5WB 5I0TA 3WW1A 5FGMA 2ZBKA 3EYYA 1Q3EA 4KWLA 3R0JA 5E17F 2QBYB 1FY7A 3MWMA 5D5XB 2GA2A 4MX3A 3DF8A 3WW2A 3OCPA 2G7UA 1V4RA 5HS9A 2BGCA 3JTHA 4L2NA 4WBBA 1RGSA 1T98A 3KGLA 4L0ZB 1RZ4A 1W4MA 4EJTA 1UB9A 2IXIA 3BP8A 2VOOA 1QO0D 3ZDSA 4JTNA 3H8UA 1CAXB 1HQCA 4N9HA 1MJAA 1H9GA 4KN7X 1OR7A 1RTVA 1ZNPA 1CF7A 4H7LA 3L2CA 3CJNA 4OIPF 5L3CA 1R5HA 5HDNA 3OV8A 5ICCA 5BPIA 2K27A 1F4KA 3SHFA 1G3WA 3ROUA 4HVQA 1ZVFA 2ATFA 2R7FA 4J1XA 1YG2A 4WXCA 3KZYA 2IW5A 4OOIA 1S7OA 4LULA 3F8NA 2DCTA 2NNNA 2H0VA 2Y0OA 2ISYA 3RYRA 2OYZA 1TQIA 3KLNA 4HMZA 4JV4A 3MCZA 2UWMA 1QXRA 2A6EF 1B1BA 4G9YA 4OFGA 2STWA 4UV8A 5I0RA 3MDPA 1W7PD 2QQBA 2VE8A 4B8XA 4XFGA 2PQQA 4AIKA 4OINF 2RC4A 4LGWA 4Q0PA 3WODF 2HS5A 4B29A 1KQ9A 2XAFA 3F8BA 2PHDA 4XF1A 5L3DA 2BEOA 2C0ZA 1LEAA 1IF1A 3HRUA 3I53A 3EDPA 3KZZA 3KLOA 1OKRA 1XMAA 4HVOA 1KYZA 2Z5UA 2P8TA 2VOPA 3D82A 3MPBA 2QQ9A 1XMKA 3JAMZ 4KNYA 2BNMA 1YYVA 1KA8A 1FNNA 3NL1A 5FD5A 5DD4A 3ZMDA 2RN7A 1C0WA 3QAHA 2WTEA 4AD9A 1CAVB 4PDKA 4A6EA 4EGYA 5T3NA 4IRGA 3T8TA 2M5WA 1NHAA 3F22A 1TW2A 4XLPF 1S8NA 4RB3C 4A5MA 3MZHA 4OIQF 3IHUA 3BZ6A 5K5QA 2X0LA 3BPXA 3T8RA 2K86A 2FU4A 2VONA 1ZRDA 2ZCWA 1V70A 1YUDA 4L9VA 3J80K 1O4TA 3RKYA 2VN2A 4CHUA 3OD0A 2MLGA 2XAQA 5EEGA 1PMIA 2MH9A 4L0YB 4IVNA 2EV6A 1GQGA 4HV6A 3H50A 1XCVA 4Z2YA 1F1ZA 4MGYE 4O9GA 3E6MA 4AIHA 4LA2A 2MNGA 1QBJA 3O6BB 3W6KB 1MD0A 3K69A 5JVTA 3FHZA 1S3JA 1TQPA 1FYLA 1NXMA 4KWJA 2AXLA 1ZZBA 1OD5A 4IHTA 2ELHA 3GLXA 3HRSA 1W5TA 2JPCA 2MPFA 2PQ8A 5CVVA 4R1HA 5DCMA 4XF4A 3LSTA 2K9ZA 1XGSA 3H1YA 5FPZA 3M7GA 3V8LA 4KFCA 3WGHA 3HYIA 2H94A 3RI4A 2VC0A 5ICFA 1FBQA 1ZREA 5F6FA 3TKYA 1XDUA 1QQIA 2IJLA 2RV8A 2XV4S 4HA8A 2LDUA 2ESNA 4R52A 1SD6A 4EWAA 1ZH5A 4KA4A 4GYIA 1FBSA 4RB2C 4BHBA 5D8LB 4EVIA 1R22A 4YIIA 4LFUA 2D5HA 1HKSA 2L02A 1YHFA 1YFXA 3T1BA 4A6DA 5D8KB 2IXHA 2VODA 4WF2A 3K0LA 3GYHX 2PAKA 3K1NA 3USSA 2M30A 1WLTA 2FXAA 4IEQA 2K4JA 2VC1A 4P9GA 4P9FA 1OPCA 1B6AA 1CAUA 4U0VA 1O5LA 4OIRF 1IPJA 1IUYA 2PAMA 4XFBA 2Z3YA 4MUVA 3F3XA 3QU6A 4XFAA 2L54A 1FYMA 2XAJA 2ZNYA 3OTFA 3ZMSA 2M8EA 3LAPA 1S29A 3L2HA 3SZPA 2COMA 1YFUA 4QM9A 4AIJA 3S7IA 2UY9A 4ZZDA 3TOAA 1O5UA 5KHKA 5FO5A 4WWCA 2ETEA 2HFHA 4TV7A 1EPZA 4HQMA 1HSJA 5L3FA 5FQ0A 2FMLA 2P7CB 2IXCA 1ZLJA 2XLFA 5TRDA 3CF6E 5A2QZ 2CO5A 3HSEA 1VJ2A 3TGNA 3E5QA 1USSA 5FPXA 2XVCA 3UKVA 3WW4A 2H6CA 2IA0A 1S6LA 3ZMTA 2F2EA 1QGPA 2V79A 4TLFA 1NZCA 4D7TA 2A5YB 2IA1A 3BJAA 4GO1A 2XL7A 5BY5A 5JAXA 4ZYGA 4XFCA 4XFIA 2CGPA 1YS6A 2IP2A 2DTRA 3ES1A 3ULQB 3ISPA 5H6RA 3O14A 2HQRA 4E70A 3M9AA 5BMZA 1YFHA 2DK5A 3SFZA 1YLLA 2FQPA 1Q1HA 1WI9A 2D5FA 3QOPA 5FLHA 1YS7A 3ZPLA 2EAAA 5KBFA 1KQ0A 1ULYA 2JTVA 2P4WA 1T6SA 3MZYA 4BIFA 3EJKA 3LAGA 3DFGA 2XLGA 2PN6A 3GW2A 1U3EM 1MKMA 2H6BA 3WGIA 2OPKA 5E1RA 2OA4A 3KCCA 4M73A 4RD7A 1NE4A 1ZG1A 1LDKB 2O3FA 5HVQC 5E20A
chains in the Genus database with same CATH superfamily
3CDLA 1KU7A 2PHRA 3S7EA 2PN5A 4EWDA 3D5LA 1DYPA 1HRV3 4HXCA 4XQFA 1XSVA 3CESA 1PIV3 2L9NA 4BB3A 2B46X 2VE1A 4Y1UA 1P4WA 3UV9A 2GM4A 3ZQHA 4HW0A 3CLOA 1YTYA 2BV6A 4X6RB 3LA2A 3A23A 1RUE3 5LASA 2JUGA 1O4YA 1IXRC 1BVP1 2KIFA 4HF0A 3NMBA 5LCWL 1W6NA 1X36A 1RUF2 1MH3A 4RLFA 1H8AC 2CW8A 1UMIA 1MS5A 5DN2A 1G7YA 2W87A 3RZGA 4LUMA 3HOYJ 4CPBA 4XRSA 3DPTA 3ORJA 3DKYA 3I56I 2O7OA 3VD5A 4HN0A 3QACA 4ZDPA 5C3QA 1STZA 1ZRFA 4UUSA 4CICA 2FDIA 4XZPA 1TVGA 1JHJA 1A6QA 1W2AX 4BU2A 1CX4A 1UFMA 4CU6A 1S55A 3BWGA 3UJOA 2LBFA 5HCHA 3GTOJ 3U10A 3WU1B 4P9IA 2EXIA 2YZ4A 1QPIA 3OOPA 1GXPA 3CO7C 2FNPA 2FD8A 4DINB 2FBHA 3OSGA 1UHWA 2QKMB 1UOGA 1SDDB 4ZYHA 4JRLA 2LF7A 1K6YA 5FP3A 2ZEZA 4MQVA 1GUIA 1KS5A 5FLIA 1AX2A 2HWB1 2D6LX 1Z78A 3KHBA 4IRHA 1W99A 2WKKA 1K7AA 1VQ9I 1SMTA 1QMJA 3TDZC 5B4XA 4CYDA 1FATA 1LNWA 4KDPA 5FRMA 2W0XA 5FZ4A 1OCRH 5J98B 3TEWA 4E2GA 4WM8B 3KEYA 3QD6A 2F48A 4KU8A 4FPFA 2B0LA 3COAC 1HCRA 1Z21A 2Q4SA 3ZPOA 2YSRA 3E1SA 1WLDA 3OY9A 3IN9A 2GC2A 4BQ5A 3IWZA 3GTQJ 3Q8CA 2X9DA 5JIUA 5FZDA 2LF8A 3J8F3 5EYYA 2ZEYA 3RQ0A 5JR2A 4MVTA 3HT1A 4OYUA 4K2EA 1PZ9A 1NCRA 5IFPA 2OT7A 1RUF3 3UYJA 2E1NA 2LR8A 1LEMA 1VRH1 2ET1A 2IFRA 3KP3A 1QJEA 2R1BA 4WM8C 5FPLA 3U9GA 1VQ6I 1GOFA 2FX0A 1QJY3 1SEFA 1OOPC 2EFPA 2XUBA 4BQAA 2JE9A 1GFF2 5J4YA 3VZOA 2DFHA 1DGWA 4IE0A 1BBT3 2VB6A 3GMEA 5EEAA 3NKGA 1ENXA 1XGOA 4XJWA 4OI0A 4B43A 2RS51 4ASMB 2MBFA 2XF7A 1TT0A 2BFUS 2JK3A 1YWKA 3VODA 1SPPB 5C5UA 4DBRA 3BKZA 3DP7A 4ZYDA 5IJRA 2V9PA 3K2AA 2KRFA 2XBO1 4PLMA 5FKBA 1OCPA 2DCYA 2FNAA 4K20A 3CUQC 1HSTA 2ZGLA 5EZWA 2ECCA 3RSJA 5HLGA 3HL2A 1LR5A 5I0DA 3FHQA 1P4AA 4A7KA 3H9QA 3VBFA 3WNPA 1IG7A 4IEVA 1LOAA 3I7DA 5D2AA 3K4BA 4AHWA 5EXOA 1TZOA 4XSZF 3W6JB 3MQ0A 4EJOA 1REEA 2VBPA 3AMQA 2G9WA 4Q4W1 1JU4A 5DD8A 4LLLA 4UFMA 2A5ZA 2E7WA 5A7NA 3S3MA 1AR91 3M3YJ 3CMAI 4RAGA 2JB8A 1EYBA 1YRNA 2GNTA 1U5ZA 4AQ6A 5BNPA 4HX7A 1LHVA 5D5UB 3DU6A 1F5FA 3WTSC 1Z6RA 4MV2A 4RR3A 4B44A 4U87A 1RUJ1 3IIIA 2CQQA 4LD5A 4AEJA 2WNVC 5CAZA 3S17J 3W21A 3OYWA 5FLVA 3WX5A 3POGA 1ASJ1 1W90A 3LFKA 2DA6A 3C2GA 1NE6A 1TW3A 1K5MB 3WW3A 1NLRA 2HOEA 1D4M2 5KCMA 3M2MA 5K0UB 2FE3A 2DJNA 2BYVE 3FXOA 1EH8A 2UXNA 3CLQA 5FB2A 1TWAJ 4BQWA 2DFBA 2A6ZA 3OY8A 2IT0A 3WOGA 2NAZA 3UT0A 5HS7A 5FYHA 2LKPA 3VBUA 3VZMA 2DVBA 2J5OA 2Y60A 2PHTA 1B9NA 1PZ8A 1H8TB 4WVMB 4IEXA 4UWDA 2CAUA 1UY3A 1RIRA 2VZSA 4BL0B 4Y1YA 3A01B 4AFCA 4AI1A 2UWAA 2YPRA 5DDGA 4NWWA 1Z7UA 4E7LA 5F32A 1AR92 1DF0A 5LK5A 2CNAA 4DB5A 1UW8A 1BC8C 2O0YA 2EFWA 3BR0A 3I4PA 2KJCA 4R9CA 3V65A 5FYZA 2VJIA 4GH4A 3GFLA 2WL1A 3OPWA 3BTXA 1XRUA 2IVMA 4L9NA 4M6XA 3I2DA 1BHGA 3VBUB 5FROA 2FQ3A 4ZDOA 2L4AA 2UYAA 1WWYA 4AHYA 3WDVA 5A33B 1CGPA 4E7IA 4FPOB 2OJED 4Y13A 3PLQA 1R1ZA 4RAFA 2R7WA 2OD5A 1VRBA 4XJAA 4YZ4A 5D8AC 2BY2A 2WIIB 2VQLA 4DRVA 4C2MJ 2ZHKA 1TQMA 1XNTA 5A3TA 4RM2A 5GLVA 1ZGJA 4E8DA 3FBNB 2MGQA 2ZAHA 2V72A 1IRFA 4YZ5A 2DDAA 4RMNA 1Y6IA 2C1FA 2P6SA 4DOZA 1MZFA 1R64A 1VBA2 1XYNA 3WDYA 1MZ6A 3GFMA 2I5UA 3O1MA 1ULCA 1BLZA 1K6OA 3S14J 1AR81 3DCQA 2Y6LA 1WCKA 1LGNA 5JXJA 3GZNB 3QPLA 4PUSA 4HLXA 1GT0C 3SYTA 4BS9A 4HK9A 2VUDA 1ZN2A 4FFIA 2YGMA 2YU1A 5F9TA 3B69A 2KIMA 4DEQA 4I02A 1H9WA 1ZBA2 1OQEA 2G19A 1NA1C 2V73A 4GAZA 1GP5A 3PU8A 4R79A 3C7FA 1LHWA 2A6TA 2ZMKA 4LLGF 1UHSA 4I6ZA 4BKXA 4IOCF 1PNGA 2LY1A 1MDMA 4LLNA 3AYCA 2Y6KA 3BYWA 1UYXA 1H1IA 3F8FA 4IE5A 1CAVA 4HLTA 3GEZA 4IJAA 2P7VB 1PVC2 2BOJA 5KC5A 2HDWA 2K0GA 4QHZA 2IUWA 4LEJA 2VQAA 3HM5A 1FOD1 5KAFC 1VBC1 4ENMA 1RUJ3 3WQ7A 4RM3A 4DGWB 3F95A 3HOVJ 3KF5A 5FMOL 1NT0A 5J1UA 3U4SA 4V2WA 3GZ6A 4M9SA 4OLLA 3CJTB 1X8MA 2ZXQA 2Z16A 2XGXA 4L5JA 2Q1FA 2WC2A 4OMCA 2BQPA 2DYRH 3EB7A 4Y5TA 4MHUA 4QKNA 4Y1ZA 5FRNA 1AWCA 1SDWA 2IPQX 1R7JA 5LHIA 3AKPA 3I3BA 5FO7B 4RS5C 3FFQA 3H3LA 2RE9A 3HWJA 4GALA 4BPZA 3I2JA 5GZEA 4XAAA 3C7HA 4H14A 1NG7A 1FMD3 3A0HC 2WZEA 1W28A 3MFCA 3RG0A 3K70C 4XF9A 1ORKA 2WO3A 3F0CA 4JX4A 2HNHA 1MMAA 4AVZA 1UY1A 1JUHA 2E71A 3ZYIB 1M4WA 2AR6A 4NWVA 2DTZA 3G71I 2ZGOA 1CAWB 4CUAA 2DA4A 1O7FA 3RS6A 2MHFA 2CGNA 3GTKJ 2WA0A 3PQJA 5K0UA 1KJRA 4G6QA 3B7MA 3ST7A 4W8JA 3DECA 1IPKA 1C57A 1JI8A 5K7HA 1UOBA 2WV0A 4C0HA 5CEHA 3SMHA 4P9XA 4UFJA 5J7MA 5DM7F 1GMMA 5DZFA 5FPVA 1UAIA 4BM8A 1JZ6A 2W84A 4ZDLA 5HLHA 3AG2H 1IGOA 4DYQA 3VD9A 4FPJA 4AFMA 3CUOA 4PFOA 2CTVA 3MKYB 3IKTA 3NRVA 4QPIB 1US3A 2VMDA 4ATFA 1HLVA 1H1AA 1FP2A 3POIA 2V4AA 4QTRA 1NY72 3S15J 2WA3A 1Z91A 3Q3SA 4WM7A 5A7WB 5KHHA 1H6YA 1KQ8A 4MGKE 2CQXA 4MEXF 1COV3 3DXJF 5EF6A 5HOOA 2VZTA 5KHIA 2BHZA 3WNOA 4XIDA 1JS9A 1IHMA 2RM23 1BI1A 4LE3A 2EBIA 2L7ZA 2R5ZB 2CJJA 5ACA1 3HBLA 3VHNA 3VYTB 4LG3A 1RUOA 1E17A 2O1QA 2QQAA 4A0XA 3IL2A 4MG2A 1ZELA 2P6HA 1DU6A 3OYMA 1FP1D 3TWIA 1QOTA 3A4CA 2ZX1A 4G12A 1CPNA 4YYOA 1O3QA 3P5JA 4QGMA 3WQBA 4CDGA 1DGRM 2VQCA 3OBAA 2K46A 1BI2A 2E2JJ 3ZX7A 4RGUA 2DBNA 4BCUA 4HV5A 5EDNA 3ZXKA 4RHV1 3PFYA 4MGRA 2KZGA 3NSTA 1DQ6A 1RUG3 5CG8A 2M3AA 3HQXA 3HNBM 3I55I 4Q26A 2DFFA 1S1AA 3WP6A 4GXOA 3L2QA 4PQQA 3MW4A 3ZN6A 4IEPA 2JKXA 3WG2A 4Z2AA 3HTSB 3V0AA 3HSFA 3I3EA 2VVEA 4RA0A 1ENRA 2DT7B 3CCRI 2YBKA 4K1YA 2GXBA 4BGDA 2ZJ2A 1JN2P 4BBSJ 2KHMA 2IXSA 1ND3C 3JRAA 4MO7A 3V4GA 4AL9A 2O03A 3H5NA 5BNNB 2ZFWA 4IQJA 1R1A1 3OYHA 5FYIA 2QQVA 3S2WA 3GZ5A 5FUNA 3WUDA 3MO4A 5IVYA 2E6VA 4E2SA 4PJJA 2G7HA 3S8PA 4RA2A 3VKLA 2YBSA 1KFXL 3LPGA 4ZY9A 2R7RA 1NCRC 3N9LA 3JXSA 2RDPA 1ZHFA 4BNCA 1WH5A 2P5KA 3FLPA 1ULOA 1A78A 5H6QA 5F0FA 4AVVA 5EG0B 4KGGA 1BC7C 4CCCA 1XQNA 3D5RC 4OU0A 1CONA 2IVJA 4UFKA 3WD5A 1CD3G 1N1SA 3JCIA 1CR7A 2QSHX 3PTRB 2NS0A 1UU6A 2Y6GA 1H2KA 2KR2A 4L97A 1ND2B 4FE7A 1POV0 5HODA 2R042 4CP0A 1I5PA 3U14A 2WB1A 4PJMA 1A34A 3LDKA 3LSEA 2HWC3 4B3NA 5BQTA 1N3OA 4X6QB 1ETQA 2HLEA 2MG4A 3H3ZA 5HLTA 2Z1DA 3M3CA 2XPVA 1GYKA 1O4ZA 2V9KA 4AHXA 4FPCA 1CAWA 3CO2A 2R7QA 1VQ4I 2UY8A 1TNFA 3N9NA 4RB0A 1YJLA 3WTTC 3CP2A 2LKXA 1FBUA 2VOVA 4LUKA 3TDUC 4ZU4A 1JOPA 3ZQIA 3KV5A 9ANTA 1NQDA 2QUFA 4QU2A 4O5VA 1VQNI 4IW3A 1OVSA 3GALA 1JKOC 3VHRA 1H1MA 2NS7A 4QD2A 5K5RA 2K9QA 2DF7A 5KC6A 5ILVA 3OSDA 2IA2A 4I3PA 2VMHA 4ESBA 1UF2C 4IV1C 4U2AA 2HWB3 4MOAA 4KBZA 5DG1A 4ENNA 1I9RA 2RS31 5AIQA 1LJ9A 2D1VA 4B48A 2PHUA 1GZCA 5ERIA 5BPXA 1KGSA 3VBOB 3ZYFA 3WE2A 3SCHA 3S16J 4XBQA 3B00A 1HRI2 3FKJA 1FMD1 3OIPA 3AKTA 2DAOA 3LAJA 4E27A 3L2WA 1AYN3 1SLTA 5HXMA 3FF5A 2ZJQF 2ZTNA 5DEQA 1RXFA 3VKNA 2W5FA 1S2EA 4RSUA 4XONA 4KT6A 4BHPA 2UV1A 2XJSA 4XJ8A 1TTYA 2ADDA 3AM2A 2L2OA 1KZHA 2Y34A 4BQ2A 4LBQA 2F5FA 4BYYA 5FYYA 4W97A 3RZDJ 4CUGA 4OZOA 3T0AA 1VMHA 5CADA 1TMF2 3OYAA 1J1LA 2VUCA 1EPWA 3ZP5A 4RAYA 1MJBA 5A6QA 1DDNA 2BZTA 3WT3A 5ILUA 1WJ5A 3IPVA 4O6JA 2PHWA 4L11A 2RJ2A 4A3DJ 5LBCA 1IJWC 4LO7A 4HDVA 4GB31 3OYGA 2VVFA 1TC3C 4IHSA 5L9RA 4WCGA 2C6SA 1UU4A 4U0WA 3BALA 3NAPC 4BEHA 3DEUA 3IB3A 1ETXA 2E5ZA 3C1DA 1WMDA 4HG6B 3I54A 4LR4A 2NYXA 1KDMA 4NIIA 1XSDA 4IF4A 2HKXA 1DFQA 4FE4A 2ET7A 1H0MA 4IKFA 5ACA3 2P3KA 4JKKA 3VD3A 4UW6A 2FMYA 2GU9A 5CVUA 1CQ9A 2DVFA 1MEC2 2AZ5A 5DS9A 1OA4A 4CUCA 2ZMEB 1QNTA 2Q8EA 2HEOA 4IL6C 1NCQB 3O0VA 5IP7J 1TZLA 4A3FJ 4PI2A 2XASA 3PUIA 4K40A 4UBGA 3HEIA 5FYBA 4YW2A 3JSPA 1Z7S1 4W1UA 2GSYA 2SLIA 3ZXFA 3ZRGA 2Y64A 4QWQA 4M3GA 5E1ZB 2CV6A 3OYNA 1HQLA 5JIAA 4HX4A 3FHNA 1IN5A 1UXZA 3KLSA 1E5HA 1DHKB 2BJSA 4MH0E 3EUAA 4M3CB 2CUJA 3EXUA 1Y56A 3SHRA 1Z7LA 2CL2A 3A0BC 3BIWE 3LEMA 3M1EA 5E79C 4JGYA 2VMFA 2JKBA 2XWJB 2WT0A 3VFZA 1SFXA 2LMDA 4KIBA 4FISA 4FQGA 3BDDA 4P9YA 4B7KA 4QDRA 1UAAA 3C3WA 4BQ4A 5C4WB 2FBKA 5LBBA 1VF9A 3BGAA 4AXOA 2VCAA 5FIXA 3OGGA 2R7ZJ 4Q0QA 3HOTA 4PIXA 2WFF2 3VL8A 3O8GA 1WCUA 3H8OA 4JHZA 4JDNA 1E5IA 1MGTA 5CKTA 4UB6C 5M0TA 4NRQA 2RDQA 1REDA 2DTWA 2PG4A 3MMYB 3SKVA 4FP3A 5K4LA 2ZGKA 2WNOA 3BJOA 3CL1A 2OW4A 2VH9A 1DPRA 2EIKH 4XLNF 2KL4A 3H1CA 3CTAA 3OR1C 5BXXA 4UVBA 4YARA 3ZQQA 1ZRCA 4LE4A 1FWZA 3W2WA 1W5CC 2YU2A 1CWPA 3VHOA 3B5LB 4JGZA 2NVYJ 1RC9A 3J7ZI 4RR3C 1RMU3 2F4PA 2VNVA 2YPDA 1NCRB 4NHYA 2KM2A 2V1DA 1S0BA 2XF5A 3DU5A 1LQ1A 5K5OA 3AAFA 1HXDA 3AG1H 1NTCA 4I98B 1H2NA 4EZHA 2UUZA 3UR3C 5IYDJ 2ILMA 3OUIA 2G9FA 2UU8A 5CKMA 1AR82 3PL8A 2WQZC 2OQ6A 1Q56A 3BCAA 1R23A 1ZGWA 1RRJA 4F83A 1LNSA 4AYBA 1ND2C 3P1IA 1QJX3 4COVA 1E57A 4MTDA 1ZG5A 2C9AA 1MDMB 1XNKA 1ZZ9A 4LO6B 2RDRA 4LKEA 3U75A 2E63A 3OYWB 1FOYA 4BBRJ 2R7UA 3AKRA 5D6EA 2FDFA 3SEQA 4Q1RA 2R071 5FOBB 3M8FA 1RR7A 2PX9A 1SLLA 3WGGA 1WH7A 1RJ7A 3ZXDA 3ZN0A 1IV6A 4BK5A 2Z5WA 2J1AA 3TAYA 4CDQC 2KP6A 2MEV2 2M87A 3F8MA 1W6QB 1BCXA 5JR3A 3OIOA 1K5MC 4H0EA 1IKQA 3IH4A 1BYHA 4G7HF 4QM8A 1BXHA 4AVPA 3LWFA 3BJ6A 2FCUA 1PJRA 2EIDA 3L9FA 2Z9OA 5JPMB 5CFDA 1D0GA 1FSHA 1VBC3 4LG0B 4FPGA 4O7XA 4XLHA 1JI6A 3QPTA 3BC8A 3EQLF 4CDQB 3SDBA 4BAYA 4QLCU 1BZWA 4RHV2 4CE8A 1VRH3 4D0PA 4UBHA 1B72B 4M00A 1H8TC 4LHSA 5F8PA 3U1XA 1SLIA 4S05A 4RB1A 1MW7A 3I64A 1DU0A 4M3DA 2PA7A 4HOBA 2J22A 3AL0C 3BTYA 4AQSA 4BJ6C 3S1MJ 5C6CA 1DG6A 3RYPA 3A21A 4YW4A 4NIGA 1MEC1 3VSLA 5I8YA 4ZZ5A 1AU7A 1RYYA 2HZTA 4FTBA 1Y43B 1XN7A 4OMZA 1MNEA 1P92A 2D45A 5KHDA 4R9DA 2JQ7A 1V6OA 3FM5A 4L8QA 4QKBA 1S0IA 3RGBA 5FGMA 3POYA 4ZONA 1MZ5A 5E89A 1V6NA 2VZRA 1V5FA 3D1NI 5EV7A 3W6VA 2LKSA 1GKBA 1CIWA 5CKNA 3DEMA 4AVTA 1V4RA 5IPAA 3AL0B 1RPWA 1ENHA 1FNZA 4B1RA 1T98A 1SFPA 1W4MA 3HXLA 2QTWB 2WYSA 4KGQA 2ZBJA 2IXIA 4O61A 3G6EI 2A75A 1W6OB 5F5IA 2JB4A 2ORZA 1CAXB 5J3LA 4N9HA 1Z7S3 4WZFA 2B4KA 1ZBA1 1PO23 2WT2A 2PLV1 1YCIA 2FQ4A 3VWBA 2XJUA 3CJNA 4GMP0 5F39A 5JI7A 2BXZA 3RZMA 5ICCA 4MIMA 2IGKA 2K27A 2ZMEC 2QSFX 2X05A 5GP9A 1OH3A 1G3WA 2WQ8A 4HVQA 3TMOA 2ATFA 3LF7A 4WXCA 2BGOA 3KZYA 2IW5A 3AG4H 4FXKB 1NAEA 2R072 2VTXA 2H0VA 2OYZA 1D0XA 1LJ7A 1TQIA 4IX7A 1ZA7A 4A69C 4C2TA 3ZN5A 1B1BA 2R043 4OFGA 2STWA 4UV8A 3USUA 5JOXA 2QQBA 2R7VA 4B8XA 1IG3A 2HXOA 1MBHA 2E26A 1B09A 5HV4A 2HEVF 3DLAA 2X6YA 3B6CA 2XGEA 3LCPA 4CEWA 2L7MP 4ANJA 2GNMA 5D8AB 1Z77A 4YGBA 5FO9B 2C0ZA 3LKJA 2A3YA 3I53A 3KLOA 5FPBA 1KYZA 2VOPA 2VKVA 3U21A 3N7JA 3D82A 3JAMZ 2BNMA 3OY8B 2ZGTA 1QIQA 1FNNA 5DD4A 3ZMDA 4LO5B 1AYM1 1HB3A 2ZMNA 5C4WC 3ZSMA 4AD9A 3RI9A 4A6EA 1IS6A 1RR8C 4IRGA 4A45A 1VBA1 3USUB 2BBVA 1G9BA 1MBJA 4A5MA 3MZHA 4XUTA 2XQXA 5E3LA 4Q4W3 5K5QA 1YYNA 3ZYPA 1Q8OA 2VIXA 4D7NA 1BEV2 3FUOA 1TNRA 3U4XA 3RKYA 2XAQA 4E4DX 1GQGA 2DMNA 4AEMA 4A3IJ 4O9GA 3E6MA 1LGBA 3O6BB 2ELJA 3K69A 3M3QA 1S3JA 3ZFEA 3ZFFB 3J7NA 1TQPA 1NXMA 4YVWA 4DUWA 2ELHA 3BG3A 4UAPA 5J47A 5DCMA 5CVVA 4XF4A 2DA1A 1XGSA 4UUSB 1C4RA 4LK7A 3WGHA 2VC0A 4QXCA 1LULA 1O8SA 4LBKA 2IJLA 2V26A 3KV4A 2ESNA 2MFZA 3ZFFC 1SD6A 2TUNA 2G0EA 1ZH5A 2IS6A 4KA4A 2E19A 2WAQN 1X19A 4EVIA 1R22A 1Y7BA 3FDYA 1RUH2 2D5HA 1A6CA 3OEBA 4S0HB 3FC0A 5A6XA 5JXGA 1GBGA 1YFXA 5FZBA 3T1BA 2DCZA 3VPRA 1YEWA 5IVVA 2DURA 5F6KA 3Q8FA 2M30A 3FK6A 1WLTA 3AZZA 5AFEA 2K4JA 4YW1A 1VBD3 4OMDA 4N43B 1JUPA 3BR1A 1B6AA 1IGNA 1WGXA 3KT4A 3S93A 4U0VA 4HEA2 3MEPA 4XFBA 2Z3YA 1TWFJ 1IQAA 1LOEA 3LSMA 1DQ0A 1S0JA 2Y9ZA 1JZ2A 2BTVC 4QM9A 4AIJA 3S7IA 5J96B 1QJX2 1ENQA 3GBGA 4D3WA 2VQHA 2X09A 4TV7A 1WD4A 1EKEA 3ACFA 2IXCA 1QVUA 2CSGA 5TRDA 3OYCA 2CO5A 2FDGA 1PHMA 1VJ2A 3CCQI 1M1EB 3K4ZA 5F3GA 1MNDA 3CMEI 1P7JA 2VUAA 2X29A 1HDPA 2B45X 2DMPA 3K46A 5FZHA 2B63J 1SLAA 2PJRA 5BY5A 2KPMA 4XFCA 1X4OA 4F3QA 1AA7A 3ES1A 3ULQB 1ULFA 4L0PA 3A01A 4XVHA 2ZGMA 2WADA 2DK5A 2OTJI 2IS1A 1YLLA 1IRXA 2FQPA 2XB5A 3W9AA 5FAXA 1WI9A 1W8TA 1VAMA 3KCYA 4NUBA 2D5FA 2D6NA 3QOPA 3HJEA 1KQ0A 2QKDA 2P4WA 3PUSA 3MZYA 3MIBA 3DFGA 4BJTA 5HCBA 4AAPA 2HXIA 1MKMA 3Q0VA 2V4JC 3SH5A 1WFXA 1R49A 4H2AA 4MXWA 1ZBA3 4CCDA 1LDKB 4TSVA 5E20A 2O8OA 1MMGA 4ZXKA 4EATA 2JN6A 4UNOA 2WYFA 4M6VA 4B09A 1VI0A 4FQZA 2M9HA 5T54A 2WWUA 3B02A 4FOVA 1YFWA 1KYWA 2A5WA 2VW2A 2KKOA 2GNDA 4AEDA 1HOMA 4AG4A 2EFOA 5EZHA 5D4SA 2E9QA 1YW8A 3MW2A 2ID6A 3QCWA 2XPJA 3FMQA 3WF0A 3BUCA 4WZCA 1CQTA 4ISQA 1OT5A 2R062 1D0YA 1GNHA 3JCUC 5IWFA 2LTPA 2F4LA 5ABJB 3LMMA 1FXZA 3FBYA 1ETKA 3ZGKA 3GFJA 2H27A 3TN91 1WPKA 1DQ4A 5T5PA 3N7KA 4O65A 4ZPIA 1OMIA 4CCEA 1PMJX 1SQ4A 3DPRA 3MKLA 5F64A 3VBRC 3M4OJ 1NX9A 1S7EA 1QNYA 1R58A 3EBRA 2CWSA 3TO6A 4CP9B 3GLLA 3U1DA 1SAUA 1R4MB 1BM9A 4XAEA 4LPLA 2F5CA 2WO7A 4IV1A 3ZVXA 5BNNC 2HWB2 4HNVA 3D6EA 2FJ1A 1YQ2A 3OG2A 2EH3A 2GXAA 1XGMA 3BT9A 3B93A 1QQP1 1FEXA 2VBWA 5K1YA 1EJ9A 5JPNB 5ABJA 2EZIA 3HUGA 3ASOH 2X4HA 2P2KA 4QXBA 5LRRA 3ABUA 4BQYA 1MS9A 2JWPA 1RUI2 5F5CA 3M8EA 2P3YA 1PO12 3NEUA 3P9CA 4QPYA 1MH4A 5LRSA 3AKSA 3WU2C 1GU3A 4WV8A 2HWC2 4YG6A 2A3WA 1J1TA 2VQ0A 4XFFA 2XPWA 4DMIA 5L9BA 1K61A 2XROA 4HKWA 4B4CA 1LENA 2NOGA 2PLYA 3CCJI 2XHNA 4D0QA 3U78A 4ZS2A 2P5BA 3MIEA 3LDRA 2BRTA 2Y26A 3NV2A 5H20A 2QDNA 1ULGA 3FM3A 5A2QK 5I8TA 1EP0A 4WVZA 2UZKA 3B73A 2XC7A 3V56A 2ICWG 2WWJA 1UMQA 4XE9A 4I09A 4L92A 2ZKNA 5T55A 4FCYA 1JYIA 2ARAA 1FPN3 5IFTA 4IHYA 1BOBA 3R60A 4QQPA 1LEBA 3WG9A 1XSRA 3OGJA 3W2VA 3GJAA 1RUC2 1E3HA 1SVLA 2YC2A 3WNNA 1ND3A 4YRVA 2AXTC 3T0YA 2R073 4B7EA 2EA4A 4AI3A 3PHMA 2DJIA 3FUQA 3A0KA 4YZ3A 1R36A 2OAZA 1K78B 1D8JA 3OBTA 3PUHA 2WJSA 4Z6YA 2R0QC 3T1LA 2Y33A 1POV3 3FXMA 4ZZLA 3WTXC 2DUQA 4Q0UA 1AR62 3VBSA 3CCEI 3DYMA 2D1HA 2NNYA 3PIPF 1VBE3 2BERA 5CJ9A 4PFPA 5E1WA 4CVUA 2GLOA 2DA5A 1J59A 2RS13 3PVEA 2NVQJ 3DPLC 2E60A 4DQ2A 4HDUA 3QQAA 5HV0A 1T2XA 5ANQA 5FZ1A 5FPAA 3VB2A 5CIRA 4OUEA 5A32B 1Z05A 3L00A 1F35A 4XXPA 5FZIA 1GOHA 3RNSA 5E8GA 3OR2C 3VYUB 5CPRB 3ZFEB 3O1PA 4CCJA 3O0XA 1Y0UA 4LMYA 2IXJA 2Y0SA 2ZXJA 1LKNA 2ZMEA 4AR2A 2JDKA 2BHYA 3ERED 2XSDC 4E9KA 2VJ4A 2RAEA 2V09A 5FKNA 4AAXA 1L7LA 1SPPA 2DFIA 1RUE2 2BP6A 4NC7A 2XRNA 2DFEA 3PU3A 5GPCA 1OXCA 4LBQD 3LQCA 3AZXA 2VZ3A 5B66C 3J81Z 1G8XA 2W1SA 3I9V2 5FZEA 4AF9A 2VW1A 1CIYA 3R4DB 5FY9A 1O7LA 4P9UA 1J75A 4CCLA 2H1KA 4FOYA 5F37A 3C2UA 4S04A 1OBNA 4TWTA 3N9QA 3SXWA 1NXD1 1WW5A 2C6YA 4XILA 4YM2A 4MTEA 1YFYA 3FMRA 5J8CA 4YW6A 1BBT2 2WABA 1LDDA 3CZUA 2D93A 4JVAA 5LWBA 1VMFA 1UMHA 2VCMA 1G59A 2I45A 5LLQA 5JSOA 3S3NA 2YC4A 4A0YA 4M6YA 1K78A 4Y52J 4JK1X 2P5LC 2YBPA 4PIYA 5H9QA 2JWTA 4AVSA 2LY9A 1D4M3 3CMGA 5H9RA 1RIOH 1ZLKA 1ON2A 5LGTA 4X8PA 5JOYA 2JG9C 4Q5SF 3VDXA 2AC1A 1TLHB 2WFPA 3TOJA 3AL6A 3NNFA 2L4MA 1JYNA 5FMBA 1QGLA 2YG0A 2EALA 1DIWA 5IP6A 4HSRA 5DUIA 2FRHA 3B9IA 4OQ8A 2XG3A 2DBIA 3P5BA 2QQJA 1Z0XA 1I3HA 4DZPA 3VZJA 2LRDA 3Q9OA 4LBLA 1EV11 1LHOA 2OA2A 2JA6J 5JVVA 5FZ9A 2LBFB 2W1WA 1QJFA 2ME0A 2DI3A 2LRPA 3DV8A 2QF7A 1X2NA 3CQZJ 3J26N 4D6SA 1V5EA 2Q1MA 5CVIA 4PJYA 2J1VA 1V9U1 2HWD2 2M4KA 1FOKA 1YIPA 4QDQA 1KU3A 2XGCA 1HKQA 2EF6A 1PO22 2BOIA 3VBFB 1AVBA 2QFEA 2HJIA 3CEWA 3R4KA 4BQOA 2DYSH 4Q4ZF 2ZA9A 3NNGA 1VBE1 4NE9A 1ZM1A 3MIFA 2VMGA 4CDUB 2EK5A 5EEHA 1HKDA 3WTUC 1PIV2 1OCOH 2VKEA 3RTRA 4C2UA 4RS5A 1AX0A 1RJ8A 1VBC2 1XU2A 3VDAA 3ILFA 3KFWX 3ZMUA 3LFIA 2H1LA 3FLRA 3F72A 2DBBA 1TBXA 3KP4A 1HF0A 1J2XA 3VYSB 1C3HA 4CEYB 3SZTA 1C5HA 2VVDA 3OS0A 3E6DA 2P4EA 1F9NA 5G05L 2XLAA 5A7PA 1DZTA 1QPMA 3URFA 2JIJA 1J58A 2QLZA 3FXRA 2XF6A 3DEWA 4AWXB 3TOBA 1V6LA 5CG9A 4XKWA 3OYJA 2A73B 3QH7A 2GMMA 5BNOC 4YW3A 4XORA 1EH7A 2D2WA 1GR3A 2EA2A 4FETA 1AR73 5JWPA 1IDZA 4S2GA 2CG4A 4D1QA 1MPXA 4XETA 2CY6A 3F23A 4IEUA 4KH9A 4B8EA 2A61A 3NQOA 5ICGA 5DV5A 2VMCA 2O5RA 2CGOA 5F04A 1U5TA 4URTA 4XF0A 1XS9A 2JEMA 2QUOA 4XOGA 2XJPA 4UV9A 1KU2A 2EIEA 2K3PA 1L3LA 4BQ3A 5JOZA 3ENRA 5BNOB 1IQDC 4Y7NJ 1ZR2A 3K4MA 1V6MA 3R05A 2WY8Q 1Y8RB 1D8KA 3QBQA 2EB7A 1UKRA 1I27A 2EJRA 3I3DA 4LA3A 4MHGA 2F4OB 4Y4RA 4SBVA 4L9JA 4RGGA 3JUUA 4NHKA 3CJIC 3H1MA 4LQRA 1SZBA 5L7OA 4U0YA 1R091 4XUQA 5HXVA 3CZJA 5BUVA 2XVKA 2CWEA 3G3ZA 1SFYA 5A33A 2BV4A 2BOLA 2JUCA 3CZ6A 4FXGB 2ZO4A 1DGLA 2W52A 1GOGA 1X58A 4HSLA 1SMYF 4YVSA 4AM3A 1Z67A 4JQTA 5FMOS 3ZQFA 3NJVA 3WNLA 3VBUC 5ANNA 4O3MA 1LTEA 3IBMA 1CAUB 2FA5A 3ZQ7A 4XRSG 5FYUA 4ATEA 1KITA 1SMVA 3RZZA 5JCTA 2ESHA 4MZUA 2NXNB 4A41A 1QJU3 2JE7A 1RITA 3AP6A 1ND3B 1FOXA 3ABMH 5FV3A 3VEPA 4FCAA 4M4RA 4RGSA 2E1CA 5A3LA 2CQNA 4QB6A 2W39A 1UPIA 1DPUA 3AXDA 4BWOA 3FZVA 1YQ8A 3WVJA 5L3BA 2QEXI 4A3LJ 1C1FA 2PELA 3C18A 2WB1N 1SFNA 1K4TA 1QJZA 2R1DA 4DO0A 3GO5A 3J8F1 2ETHA 3NQHA 4KUMA 4HKLA 5EIYB 4E4HA 4COUA 5C70A 1JOBA 2CH0A 3GUDA 1ZGAA 3WUCA 4IUGA 2J1TA 2P1BA 1U9OA 2HQ5A 4OHXA 4CXXA 4HLYA 5JLWA 2MABA 2XVGA 2PFBA 3DXUA 3TP0A 4NIHA 1WLWA 2JA7J 5FR3A 4XRFA 4BLIA 1B9MA 4HT1T 4E7HA 2GAUA 2D3RA 2VXZA 1REFA 1IAWA 2VZQA 5JXHA 4GH4B 1B8IA 1ZA4A 5ICEA 4XZUG 4UF0B 1D2QA 4OAZA 4LJZF 3SJMA 2NPIA 1JXNA 3I58A 2K5CA 4GB32 1ZKGA 3TEYA 1J83A 1Z9CA 3SEEA 1OR7C 3E5XA 2RQQA 1IC8A 2Y48A 4YM3A 1I6XA 3WG7H 2WAFA 4BMEA 2X1CA 3UKTA 1PO11 2QQWA 1W9YA 1QOOA 1FSEA 5LZ6A 4OI4A 5IK8A 1RHI3 2EAKA 3O1UA 1O91A 2D7FA 2BBYA 1R092 5J1RA 1DZQA 2HKOA 2FOKA 1DP3A 3VBHA 1BOAA 4D5CA 2A70A 2NYYA 4BDZA 1RUG1 1GLNA 2O8QA 3H1WA 4M9XA 4QB2A 4L9TA 5LATA 5JZGC 3G7DA 3DEEA 3AFGA 3I5UA 3DWLE 2C24A 1QJX1 2OZ6A 4N43A 3UJQA 2VOXA 2NQYA 3GHNA 1NH3A 3MHZA 1IPSA 3JRCA 1LU2A 4DS0A 3NJXA 1YITI 4JQRA 2HWE3 4XFHA 4EWEA 3M70A 1O3RA 1FMWA 3HRTA 2QWWA 1KXGA 2FEZA 4ZTJA 2VULA 5LA0A 1Q43A 1WSUA 3VKMA 1ZARA 3HKZA 3DTKA 1LKXA 5GAHJ 4XQWA 2R5YB 3GDBA 2XHKA 5FYCA 5GZFA 1AJOA 1EAH1 2STTA 4N4NB 5JLXA 2AYHA 3F6OA 2P3JA 4I76A 1F2NA 2Y0SN 2M7AA 3OEAA 4GD4A 4CDUC 4TLGA 1JZ8A 1QXJA 5JVGF 3OPZA 3RPQA 2AH2A 2TRTA 4PJLA 4XUOA 3ZXAC 1PUFB 3LB9A 3IAS2 3VN4A 3WDUA 3CNAA 4R4XA 2P37A 4XJUA 4ZKTB 4HVRA 4NN0A 1U8RA 3O2PE 4ISRA 3OYKA 3TEZA 2ZXIA 1NK3P 1WWXA 1IO2A 2GWRA 3ZFEC 4G7ZF 1YXWA 1DYKA 2A7AA 3K10A 2AACA 2JPBA 3O1OA 4RGXA 4DOUA 1SVMA 3LIGA 3HRMA 1UZ0A 2XR4A 2ZEXA 4CP1A 2PHXA 2WO2A 1SAXA 1UY2A 3LEKA 5C3EJ 1W9TA 2JA5J 1WA4A 4F55A 3L09A 1X1CA 4G6DA 1CJDA 1G9AA 2VZVA 5JUVA 3TQNA 1FYKA 4DFSA 5KVRA 4E4SA 4AYBN 3ACGA 4A3GJ 1S2BA 2E7QA 2DU9A 3ZKUA 4XTPA 5EGOB 5FZAA 1R1TA 2Z69A 4E8CA 1U5TC 1D1AA 3NAPA 4A2UA 2VJJA 5A1FA 4P5YA 5L3GA 2W85A 1GP4A 1H9TA 2N7GA 4WM7B 1VAVA 5A7WA 5FK7A 4PGHA 5GADJ 3RVHA 1F43A 1VIWB 1IN6A 4QSHA 2TNFA 4UHTA 1A36A 5CQEA 3GCWA 4JDOA 4AEDC 3BTCA 3AKZA 2C26A 4LIVA 4FOWA 4I01A 3TNQA 4FX4A 3TP3A 4NHXA 3BU7A 4D6RA 1MBKA 5DCFA 3THCA 1Z6TA 1WMFA 3N35A 4RGRA 5ACA2 3ME2A 2XAUA 1SVOA 1W8NA 4JGYC 1LE8A 4NR1A 2CU7A 4NHMA 3LSPA 4IO9F 2BW3A 3RZJA 4HBLA 3KEOA 3DBLB 1ZX5A 1V9U2 1DQ1A 4QPWA 4JX0A 1V55H 5IYCJ 1E0EA 2MEV3 1AXZA 3G73A 5M5YJ 3GFIA 2W08A 5JMCA 5CVRA 3AYAA 5FKMA 1J09A 5BNNA 1PP8F 5DCMB 2YY1A 3KF3A 2KMUA 1PVEA 3PTYA 1X7NA 1I6HJ 1GSLA 2K02A 1T33A 3N97A 1V5GA 2J5PA 5H9SA 3FXKA 1KD7A 2PAEA 2W91A 1BR1A 2HH9A 2X1DA 2VUJA 2L01A 3TO7A 2DPDA 4N7UA 2JRTA 3ECQA 4IEYA 5J37A 4NAMA 1AX1A 2M0CA 5IVFA 5M5WJ 4AFBA 4JRAA 4Q0SA 4GYGA 1F8VA 4Z07A 1DQUA 1R083 5AC93 4PLNA 3RPUA 5BNGA 2WNUA 1AR83 5D4RA 3CLPA 2K4BA 4W4ZA 1OURA 2LYCA 1KQRA 4XJZA 1YI2I 1OH4A 1SLBA 5FWEA 4IQ4A 1CZSA 5ABJC 4QB1A 4XSXF 1IZ3A 1W7PA 2QQMA 1FPQA 5HDKA 1QWRA 3T1MA 4E7ZA 1MZBA 3O1VA 1SEUA 4Q4V1 3JQWA 1LOFC 4PI0A 1XTAA 4KU7A 2QQLA 4M0NA 3CC7I 3WQ0A 1XG1A 4Y17A 3VHPA 3CUQB 3HC7A 1APLC 3ZXJA 2LFBA 3RMXA 2OUMA 2WAEA 1TEIA 2V7FA 2GH8A 2FD5A 3ACIA 3F6VA 3HBKA 1EUUA 4JP0A 3FMSA 5I91A 2R7TA 1HJGA 3AMPA 3WSOA 1XPWA 5JDBA 1IZ1A 1YIFA 3E6CC 5FY7A 4YVWB 3HD8B 3I8TA 1RVF2 3OOUA 2DMTA 5FYMA 4IHXA 4LK0F 1QJY2 1JT6A 1MIJA 3J7HA 3R4SA 3L2VA 2F5EA 5EFUA 2W47A 1ODDA 4YG3A 3KV6A 3GF2A 3AZYA 3LSKA 1W6NB 3PIGA 1F15A 2WZR2 3QPHA 2G4IA 4HPQA 3L2UA 4RYDA 3V42A 2DA3A 1OFSA 1LU1A 4INDA 2EFQA 4YM1A 5KXEA 2Q8KA 5FY1A 1MQTC 3BIEA 4MSVA 3PJQA 3DF0A 4YVWC 4XOTA 5ISLA 1Z3XA 5FKCA 5HI0A 3H9JA 3O3KA 2JIGA 4XXAA 2PMZN 4ESFA 1VMJA 2BY0A 2QQOA 3PNYA 1ASJ2 4GJYA 3KP7A 3VZLA 1TNSA 2R3SA 2XIGA 2JZYA 3JRFA 3TW7A 5FFXA 3NAPB 2KLOA 2OQRA 3C3VA 4NVPA 1DLCA 2PLV2 1VB2A 1W2UA 3SEZA 3ZCOA 1RUD3 1ZZ7A 5DXDA 1HJFA 1RINA 3FHIB 2Z99A 5DDJ1 1UXXX 3T08A 3L2RA 4KMFA 3KE2A 3ZSEA 4IE7A 4IEZA 3QRFF 1BL0A 4ES9A 1MSFC 3PUAA 4NIDA 1WUVA 1RUC1 4U7BA 1XSQA 4MHRA 3U11A 1NG6A 1S9HA 1VLNA 1UQXA 5AVPA 1YX3A 2ZHNA 4EZ4A 1IXSB 2RVCA 2Y6HA 3QYEA 2FCTA 1Y9GA 3POFA 4LO8A 2YFZA 3IP4B 1GZWA 3ETPA 2DCJA 3ZXSA 4XOPA 4ASKA 1HXS1 4OULA 1DUXC 2CV1A 2IAIA 1QZEA 4JX5A 4Q4Y2 2PFWA 4FI9A 2QVSB 3SFIA 2VNRA 2JG8C 3ZMNA 4IEOA 2BY3A 3C7JA 2WWSA 4AI0A 4Y26A 2M2EA 1C8M3 2PHFA 2GC1A 1UWWA 4UT5A 3R0RA 1CAXA 3J81K 1X1BA 3OYFA 3F21A 1AHSA 1FPN1 1WW6A 2XXZA 2ZKLA 3RRDA 5CISA 4ZH4F 2ZKZA 6PAXA 4OHYA 2F17A 3HN1A 3QODA 5BS6A 4F92B 5EGOA 1R082 2OKXA 4NB5A 4TTGA 3JZVA 4EV0A 4DZGA 2XJRA 5FRAA 3IKVA 4K9SA 1PGL1 3MF6A 3HBZA 2R16A 4RQPA 1X3UA 5DZGA 2RDSA 3K6GA 1GZWB 4LXLA 4AGGA 4IHWA 3WW1A 5F27A 2E33A 4QQLA 3EYYA 4KWLA 3R0JA 5E17F 1M06G 2E2IJ 1AYN1 1W39A 4MX3A 4AEDB 4P9JA 3DLLF 1VBD2 2XRLA 5GLZA 5HS9A 4GB33 2OCCH 3SDGA 4L2NA 1OISA 1RZ4A 3WQ1A 2ZJPF 3KZ4C 5C4JJ 3BP8A 2X48A 3K51A 5F2SA 1QO0D 3SH4A 4Y3OA 5IYYA 4PJ0C 5H2FC 1H9GA 1IS3A 1RTVA 1X1AA 3WHCA 1CF7A 4H7LA 5B2GB 3PM1A 3MIHA 3L2CA 5JZGB 2Q8DA 1R5HA 1VNDA 2GP3A 4AQTA 1AUYA 2XB6C 1CZVA 1ZK8A 2HWD1 4IZZA 1BQPA 3NV1A 5GTHC 5IATA 3OIQA 1V0AA 4UFHA 1W0UA 4J25A 1HN1A 4OOIA 3KYDB 4GKXA 4A6OA 2WAAA 3F8NA 4CRQA 2R5YA 3H42B 2ISYA 1BR4A 2QQPA 4HMZA 3HOXJ 2VOTA 3MCZA 3VL9A 3LDBA 1SBDA 4C8DA 2CV2A 2ARXA 4OUMA 4XFGA 5DPNA 3M7AA 1NZIA 1U5IA 2VPRA 1OLRA 1PX3A 1VQLI 4Q0PA 1B72A 4YW7A 4B4RA 3TW6A 2UWBA 5FKKA 1KQ9A 2XAFA 3F8BA 2PHDA 1MQTA 3WEZA 1N3QA 3VB9A 1HV0A 2X5IB 2EIMH 2HI3A 3AYEA 4LBQB 3EDPA 1PVC3 4CPBD 3W3CA 1OKRA 4R9BA 5IP9J 2RMU2 2SBAA 2P8TA 1NCQA 2QQ9A 4KNYA 3OL3A 1MBEA 1YYVA 3NL1A 2Y6JA 1FOD2 2RN7A 3AP7A 1W36C 1G2HA 1WI3A 3O5SA 2FZ1A 1H0BA 2XONA 1CAVB 4ZHNA 1ACIA 1VPHA 3GTLJ 3T8TA 1NHAA 2X1EA 2UWCA 4OI2A 3F22A 2Y38A 1TW2A 3ZQLA 4GA9A 4GDFA 3BPXA 3BPSA 4JGZB 3WHBA 2VONA 3DBHB 1YUDA 4L9VA 1OCTC 3HQUA 4AE2A 3OD0A 2ORXA 2E34A 3EUHC 4L0YB 4XIKA 3H50A 3WG1A 1RB8G 1XCVA 2R92J 2PLV3 4OQ9A 4AIHA 1EUTA 1VBA3 3NWKA 1ZYBA 2OF7A 3GTGJ 3KS7A 2D43A 2MD0A 1GZTA 3OUJA 2AXLA 2HVSA 1OD5A 1MBFA 1SCSA 2L9RA 1S0EA 4IHTA 1UELB 3JD73 4QU1A 2JPCA 4E7JA 4ES8A 1JGGA 1UZVA 4FPKA 3H1YA 5FPZA 3AB0A 2FDKA 3HYIA 2H94A 1FTTA 4DXZA 4Y33A 1FBQA 5DAXA 5A3OA 5GZGA 1ZREA 4FO9A 3UETA 2RV8A 2XV4S 2HWE2 2WZR3 4EWAA 5T52A 2R7OA 4E6KG 1QEXA 1XNAA 2ID3A 4BHBA 2W46A 4LFUA 4Q4Y1 1N1TA 1YHFA 4HG2A 1UYZA 2HYXA 5LBFA 2QA4I 3EMRA 1OLME 2IXHA 4WF2A 4JGYB 3K0LA 3BI3A 2WLPA 2ARCA 4P02B 3VBSC 2WR9A 3S57A 5FUIA 1N25A 1OPCA 4D7YA 1CAUA 4HOOA 4FASD 4Q27A 1OKQA 1RKTA 3FLTA 3IDAA 3IAM2 4AZZA 3F3XA 3QU6A 2L54A 2WN3A 1BR2A 2XAJA 2ZNYA 3IT8A 3OTFA 2KIQA 5C71A 2E1OA 4MGQA 1E5SA 3T2OA 4P5HA 3SZPA 2COMA 1H2LA 4S2HA 4I0WB 1DLLA 1IG0A 2UY9A 3TOAA 5KHKA 4OAYA 4WWCA 5FXZA 1EPZA 4YW5A 1WJCA 2VZOA 2P7CB 1ZLJA 4Y22B 3CDZB 4XMYA 3CF6E 3LL7A 5A2QZ 3HSEA 3H5RA 5A6ZA 1OQDA 1GDTA 3HGYA 3KQ4B 3E5QA 1USSA 1JKPC 4GFBA 3J8F2 1LOBA 2XVCA 4UW3A 3I2FA 3I3MA 3ZMTA 1QGPA 2B7EA 2V79A 4TLFA 3AJZA 4P08A 2BW3B 5FY8A 4BQ1A 1OCCH 3GXUA 2GN3A 5EJCA 5JAXA 5KWRA 2CGPA 4IDZA 3I2GA 2DT6A 3ISPA 5H6RA 1B35C 2NMOA 1ENSA 4E70A 3M9AA 3KB5A 1Q1HA 1IS5A 4A3JJ 5CNAA 1KFUL 2W00A 5FLHA 1F4HA 2VO5A 5KBFA 3LGRA 4L9BA 1PZ7A 2JTVA 5F5QA 2WINB 4G4FA 1T6BX 4OHVA 1EA3A 1ZQ3P 3ZO0B 2X5IA 3LIHA 3VBHC 2RDNA 2PN6A 3GW2A 1U3EM 5F0HA 3WGIA 4M0HA 2CDOA 2OA4A 2CU5A 2X6WA 1K3IA 4M73A 4J00A 3C7OA 1NKGA 4GJZA 5HVQC 4EEFG 2F5VA 1BI0A 1PVXA 4C3IJ 3FISA 3LPFA 3LOIA 5BYNA 1LB2A 3TBDA 2ECBA 4UVAA 1Z3YA 2ZGSA 3HOUJ 4C3HJ 1LESA 2JSCA 4IERA 1JZ3A 1Q8QA 1LVAA 2HPMA 4OMYA 2TDXA 2WFF1 4CCOA 3CCVI 2D6OX 3GX4X 4HSTA 2RM21 2LALA 5AC91 1XPXA 2XJVA 1HKTA 5FXWA 1YQCA 1K5JA 2D3PA 3ACLA 5GZCA 1W9WA 2J7MA 2I2SA 1ETOA 4BEHB 4JAAA 1MMNA 1UIKA 4LKFA 1UOFA 1RC6A 3MD2A 3PJRA 2QDRA 4A4AA 5KAIC 5FZGA 3S1RJ 4B3XA 3HMYA 4FAGA 3K1MA 5FLJA 3ZYGA 4HF2A 2WWYA 3TBIA 3IWFA 3MV11 4A7ZA 1POQA 4LJHA 1POV1 3ML6A 3U07A 4CTEA 5GLTA 2ZAAA 2E35A 2VQGA 1P9QC 5FZOB 2IEKA 3KYLA 1AOYA 5KNLA 4DNYA 2JECA 4KNCA 2DA7A 2DOAA 1H30A 3SZGA 2R063 5DUKA 5BOXA 1L7QA 4IEWA 4DUXA 4MYEA 2RS12 3M8LA 1SCRA 1AR72 2AGSA 1FZPB 1GWLA 3OF1A 4S2FA 2QVOA 5GALA 1KONA 1G3TA 4H7MA 3AVSA 4UYBA 2DVGA 2WS93 1W05A 2AO9A 3CCYA 4YLZA 2P3IA 2NS8A 1UYYA 2Q8OA 5FJHA 4JTOA 5J40A 5FKLA 1QVTA 4PZJA 4XQDA 5HS8A 3ZXGA 3KHCA 1C8M1 4WXDA 1U5XA 2E51A 3AMHA 4NMIA 1HW5A 3M1HA 1LEDA 5FQ0B 5CFDB 4GIQA 2GMPA 1G3SA 5HDGA 4EJVA 1X2MA 2GALA 1OD3A 3ABZA 5C9AA 4NC8A 1K42A 1MSEC 1ONAA 4RFRB 2DOEA 3RPUD 4OZXA 2VASA 2RMU3 1Q5OA 3B94A 4YFZA 2CYFA 2Y8KA 1FIPA 2QQ8A 4QIWN 4F7ZA 1YQ5A 1YI7A 1Y1WJ 1I1GA 3H0OA 3IDCB 4G6TB 4NNJA 3THTA 1VALA 4DXSA 3VGIA 2R041 3HT2A 1AR61 1QDCA 1Y8QB 2RNJA 3V8JA 2DN0A 4YPJA 1ODNA 2JVHA 5HPOA 3FMGA 3R4UA 1HW2A 1P8JA 4LMFA 3KETA 2DT5A 4IE6A 3ITQA 4Y24A 3JRIA 4HBNA 4WVMA 2I74A 2HEYF 1HRV1 1WLCA 4XACA 4BXFA 3E6BA 1SANA 1T08B 1GVJA 1WKMA 1PIV1 1YQAA 4OIOF 1JGSA 4M3CE 2HBUA 2W3JA 5FP7A 4GCVA 1NOVA 3PL0A 4NPLA 3WTWC 1PO13 1TWGJ 4LOSA 2VT3A 4I0BA 4AEKA 3I2IA 2JRMA 2O8XA 1ETVA 1TG7A 2YX4A 3WP3A 1W6QA 3WDTA 4RAZA 3AX4A 3L7WA 5CLSA 3N9OA 3VKOA 2R4GA 1YQ6A 2Q2EB 3ES4A 3ALQA 2IRFG 4U88A 2LSOA 1QXPA 3RFRA 3ZN6B 4K7JA 2CFOA 1P4XA 2L7FP 2CAVA 5E1XA 4KWUA 4CU9A 3Q0UA 4Q48A 4PBPA 3N7MA 1U0AA 2D97A 4GMP1 3MLLA 3G4SI 1V9U3 5DG2A 4AVAA 3QWLA 3MIDA 4I3GA 2QJVA 4HX8A 1CX1A 3VDCA 1Q1VA 3OS2A 4EJWA 5JXIA 1ONVA 2P6TA 1LDJA 1X4PA 5K7PA 3ZM8A 4Y20B 4FOQA 2W24A 3QP5A 1STMA 4KMQA 2KT0A 2DUPA 5FFZA 1I3QJ 2RS52 1IN7A 2W82A 2C9KA 2ZC2A 3RJ2X 2J1EA 1ULEA 1J9IA 2DO7A 2E2HJ 2X5IC 3F8CA 1BW6A 3VBRA 5A6YA 1EAH3 2E5NA 3LFUA 2A68F 1W6MA 4QAWA 2EZKA 3KM5A 1PM7A 1O57A 3S3OA 1FLIA 1JYVA 1I39A 1QJU2 1QKQA 4QGNA 3Q9VA 3J7MA 2HWD3 2RR13 4P55A 1N77A 4M9ZA 2ELKA 4CEYC 3PO3J 4XF3A 3V7SA 5J6XA 2OIIA 2WBMA 1A04A 2BZDA 3DBRB 4M3CA 2WNVA 1Z1DA 1PK6A 3BZKA 2C5DA 4QX3A 4L99A 2DQRA 3D5SC 3AMMA 1LHUA 2DMQA 3NNLA 3RKXA 4BK4A 3EPZA 4AGRA 3BOPA 4FTSA 3DN7A 4XJ9A 4SLIA 1OOPA 2EXJA 1VBE2 2K9MA 2R0HA 4EMSA 5FYTA 4HETA 5A70A 4J19A 4RHV3 4FQ4A 4Q47A 4GRIA 2WZPP 2LP0A 1U6GA 3NO8A 3E5UA 4FBFA 5AC92 4II2A 1PYVA 3AMNA 1GV9A 3Q8EA 3H0GJ 4X0GA 1IRGA 1R1VA 5FZLA 1LVKA 4KWKA 2DTYA 3PIOF 1JHHA 3DPRB 1SD5A 2MLKA 3L9JT 1I50J 5AONA 2QZ8A 1QZYA 3HPGA 1YJNI 1S0DA 3LA7A 4QHBA 3AYDA 4B4PA 2W57A 4YFNF 1E3OC 5TSWA 2VUMJ 4WVVA 1W03A 2DVAA 1VP6A 4O9EA 3HUGB 2FCVA 4EM0B 4IETA 4ET7A 1FX7A 1YI9A 2OXBA 2NP0A 1QHGA 5CQGA 3SLIA 5ED4A 3P6BA 4KQ7A 1J3RA 1D7PM 1I5ZA 3SC7X 1FV2A 1NK2P 2MD5A 3D0JA 2BDRA 2JG9A 2FSWA 5FXVA 4YFWA 4LHNA 3WZ1A 4XBLA 4U36A 5M3MJ 2GP5A 2LTNA 2CQ7A 2BU9A 3OYLA 2VTXJ 3VSKA 1GWKA 5HCFA 3OBRA 4N8MA 3GWZA 3IM0A 4QDSA 4QKDA 4CDUA 4PSWA 2LY2A 2AQEA 2EZLA 2RGVA 2BW8A 3LSIA 1CPMA 1EV13 1ACCA 4PCQA 4JBAA 1SBFA 4PGGA 3DL3A 1B35B 5CFCB 1ON1A 5F1JA 2L7KA 4CDQA 5BV6A 2GBYA 3ZN1A 3NW4A 2ADUA 1X1PA 2COBA 2OS2A 2A3SA 2Z2SB 2HWF1 2JG8B 4YGDA 2WQ4A 3I2OA 4D9JA 3PDQA 4ETSA 1IOAA 4KL1A 1ETYA 2VTFA 5A7QA 4IOAF 2HTSA 4GULA 2HWVA 3ZXLA 2YC0A 1WJEA 1YIOA 4YM0A 4MXWB 3GZAA 1W8HA 2JG9B 1AYM3 2ZZQA 1J7KA 3LNQA 3RZHA 5BPDA 4JKMA 1W6PB 4Y1XA 2OUJA 1Q8PA 5TGTA 2QQIA 3D4KA 4AI9A 3HOWJ 3QP6A 3FBIB 3AC0A 5F2WA 3ZIWA 2YUSA 1OUSA 4HN1A 4BOWA 1QHHD 3WV6A 4ZU5A 1X3WB 3FIWA 5DTDA 4UXAA 2PJPA 4BJ5C 2IC1A 1OYWA 3MV01 1S0GA 1L7RA 1JYXA 4LNVA 1XE7A 1ZZCA 5IYBJ 1QRYA 3OUHA 3ZQGA 3D8CA 5KXDA 1PM4A 3U37A 1O6UA 3C7EA 2GA1A 3VBOA 4FFGA 2OPTA 2Z42A 1MJ9A 4D69A 4XMIA 2OV7A 3GCMA 4D5FA 5B1BH 2ENRA 4ASNA 3UL2A 3D5OA 4CA9A 4GGGA 2WAQA 3WF3A 1H8TA 5EHDA 3SCGA 1DCSA 1G4DA 5GTIC 2EINH 3E3VA 2JT1A 5A7SA 1HIXA 1LODA 3CF5F 2ZNZA 3JW4A 1TQ5A 2ZX0A 4PDWA 2YUEA 2O0OA 4QPQA 2D44A 4Q4X3 5FP8A 3TRSB 3IDBB 1S4CA 1DQ5A 5LGNA 1XCBA 3H3VK 1J3PA 4IPAA 2Y69H 3K4KA 4XDOA 2AENA 1V6JA 1RHI1 3BB6A 1N1YA 3ZOBA 4Q0VA 2JDHA 3G6JB 2HQNA 1YW7A 2QBYA 1RUD2 4JZRA 4S2DA 2HYFA 1O8PA 4BE1A 1QOSA 2PEXA 4PJNA 4M3CF 3WLUA 2W95A 4BZ4A 5I93A 1Q8SA 1LFPA 1RHI2 3TL4X 3ZQCA 1VTNC 1P6RA 2R30A 2K2SA 2RS11 4BQQA 3K2OA 1VQ5I 4XBFA 4N43C 3JD72 1GHCA 3H7JA 1MS0A 4WXHA 4JX6A 3M3EA 3WTYC 5FZOA 1ST8A 3CMMA 4GWIA 2WDBA 3MZ8A 1UNBA 2W68A 2W4SA 1OI6A 1FJLA 3ZR5A 1MZEA 3HQRA 2XOMA 2A1XA 5FWJA 2PMWB 3RQIA 3M3IA 2ZABA 1JU3A 5J1XA 1EV7A 2RVAA 3HAGA 4HNTA 5TJJA 3SKJE 2A05A 1ZRRA 1WJFA 1MR5A 4XMAA 4WM8A 5DZEA 3DYOA 4M74A 4NOTA 4KT5C 5CYYA 3JBG2 2F6CA 1VFCA 4XUPA 1RUC3 4JGZC 2P17A 3TEXA 1T8IA 3IAPA 2HVQA 4BLJA 1PP7U 1FOD3 4X6AJ 2UURA 3MPPG 3I49A 5FO8B 5LK7B 3ELNA 1V3FA 1WBLA 4BQNA 4A3CJ 5CA6A 1HXS2 2V1XA 2VW0A 5K7FA 4EM2A 2CWMA 1Y9MA 3IDEA 4IHVA 3K77A 1R5GA 2V5DA 2Z4FA 5JOWA 1UX6A 4CDWA 3DPRC 1D4VB 2EXHA 1WCQA 3H9GA 4PIZA 2IWGB 4DPNA 4IXLA 2X10A 3INAA 1E2XA 4GQ7A 2E1MC 4V2GA 4BJ0A 2X6XA 4HKOA 1C5IA 1AR93 3ZYBA 2EFNA 1UCXA 5FK8A 3U1KA 3A7QA 2D5VA 3WU0A 3KP6A 5K8SA 3MBWA 4UVCA 3LWCA 3VDDA 3DUIA 1GNYA 2ZACA 1BJAA 1A31A 4LK6A 4ZTFA 5C3OA 2QBXA 2VE9A 3JRBA