2H6BA

Crystal structure of oxidized cprk in complex with o-chlorophenolacetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
248
structure length
239
Chain Sequence
VEGLGKDFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVYNLGELKHLSEQTSVDKLAAALDHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChloroPhenol Reduction gene K
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Dna binding protein
total genus 68
structure length 239
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6bA01
5E17F 2W57A 4HF0A 4MGRA 1FI2A 3WU0A 4HDUA 3SHRA 3SXWA 2DQRA 2YX4A 2HDCA 2PHDA 3OOPA 3BY6A 4GULA 1F5TA 4XBFA 2YX7A 4AIJA 1XE7A 2VONA 4D7TA 1HKTA 4KNYA 2KKOA 3GF2A 1ZRCA 4DINB 2H6CA 3JAMZ 1X8EA 1PP8F 3D0SA 3BPVA 1MJ9A 4ETSA 4EWAA 3HTSB 3IDBB 4KWLA 1IW7F 3BPXA 4CO8A 5LHGA 4WWCA 1FC3A 1YO5C 4M71A 2XV4S 1YW9A 5LBQA 5I0SA 1WA4A 2O8QA 1ZRDA 3GW2A 3HUGA 2K02A 4WXDA 4UV9A 1ZNPA 3ECOA 1KU3A 4AIHA 2K4BA 5CVJA 2VE8A 3BB6A 5H6RA 4B09A 1ZZBA 5D6EA 3OGJA 3CUQA 3L2HA 4MNUA 4ESJA 1WQ2A 1IN5A 5FLJA 1UW8A 2XLGA 1IZ1A 3U10A 3K1PA 2UZKA 5KVRA 2OBPA 1ZN2A 4LA2A 2NYXA 4I0BA 4XFAA 2YSRA 3LWCA 2IW5A 3NQOA 3FF5A 4ONUA 2PEXA 3SMHA 1G3WA 1OYIA 3ETQA 4ESFA 1TQ5A 1IXSB 3UKVA 4MQVA 2GAUA 4E70A 3MYXA 4IVNA 1ZHFA 2MA3A 3G73A 3ACLA 2QYOA 5DUIA 5LGUA 1YTYA 2COMA 4EWEA 4GO1A 2EV6A 4M9XA 4KIBA 3QPHA 1YS6A 3C1DA 1LR5A 1DUXC 1UHMA 1VJ2A 2JPCA 4KN4X 1P4XA 3HRMA 4FX0A 3KEOA 3EBRA 1Y9QA 3ST7A 2A68F 3PQJA 4HQEA 1O4TA 5BXXA 4CGZA 2OZ6A 2CYYA 2P4WA 3WW2A 4P55A 4EM2A 1SFNA 2K4JA 1O7LA 2IPQX 1ZZCA 5FLXZ 3REOA 2E9QA 3ES1A 2RV8A 1WKMA 2H09A 2EFNA 4YARA 3DKWA 5FQ0B 2H0VA 5FQ0A 3D0JA 4L2NA 1U78A 2XVCA 3DEUA 2GXGA 4XEZA 2EVXA 4HBLA 4G6QA 4Y17A 2KIMA 3TNQA 5D5UB 2PFWA 1U8RA 1S29A 5F64A 1OR7A 4I0AA 4HLXA 4Z2YA 2Q0OA 3G7DA 4S05A 1UFMA 2EK5A 1ZG1A 4KN7X 3DN7A 2M8EA 1O5UA 4EVIA 5J6XA 5BY5A 1E17A 2QNKA 3QU3A 3QACA 4RB2C 4G7HF 2HYGD 2XLFA 1S7AA 4J1WA 2BV6A 2ZNZA 4FT8A 3DF8A 1DDNA 5HDKA 3RKYA 1ZARA 2WWYA 2BBYA 2RQPA 4BHCA 2MHFA 4GCVA 4P9GA 5KHKA 3Q9SA 1Q3EA 2PFBA 3E6BA 1TW3A 3E5XA 1RNLA 4IEXA 1HW5A 3ISPA 2K27A 3KMHA 3VHRA 4BHBA 3WTZA 3JW4A 5FGMA 1J2XA 1LJ9A 4O6JA 1BN5A 4HQMA 4L9TA 4EJUA 2XL9A 4L9VA 2D5HA 2FF4A 4UVBA 3ZN1A 1ZGJA 2O1QA 2IJLA 1SFXA 2P5LC 2PHLA 4QMAA 2FXAA 1Q1HA 2VN2A 3I0TA 4DQ2A 4XSXF 1HW2A 5I0TA 2ZMEB 1YUDA 2G7UA 4IETA 3GYHX 2A07F 2ZMEA 3O3KA 3KP7A 1I1GA 5E1XA 2UYBA 2DAOA 3PFIA 4KU7A 1UPIA 1FLIA 4U88A 3KP3A 1K7AA 1BIBA 3ECHA 3F8NA 1K79A 4WBBA 1W7PD 4U0VA 1U5TB 1NHAA 2Z33A 1P6RA 1U5TA 3HHGA 4I98B 1ZLJA 3GZ5A 4NVPA 4IRIA 3FHZA 3RYRA 1GQHA 2L3DA 1S7OA 3BDDA 5AONA 4D0PA 6PAXA 5BUVA 4BHPA 4IEUA 1FP1D 1ZZ8A 2L54A 3QAHA 3WTUC 2O6GE 3RYKA 5HDNA 3RI4A 4HX4A 2W85A 2F5FA 1SEFA 4EM1A 2PN6A 3BPZA 1O3RA 1XD7A 1RTVA 4JQFA 3RDIA 5J7MA 3HQXA 2D1HA 2FMLA 3CLPA 3K69A 3V8KA 4IEOA 2XGXA 2PLYA 5AIQA 3NKTA 1U2WA 2IXIA 4LB5A 2HJIA 3E5UA 1RIOH 2CAUA 3LSTA 3DPLC 3H1YA 3FXRA 1BI0A 3U1DA 1PUEE 4RGRA 1ZREA 1FSHA 3DXJF 2QZ8A 1IAWA 3MQ0A 1WLTA 1KYWA 2QM3A 4CXFA 1Z9CA 3K1MA 2VOOA 5A2QZ 2ESNA 1HBXG 5E16A 1GQGA 2L4MA 3P9KA 5HVQC 1C0WA 2F5EA 1SD5A 1JHFA 2OZUA 1ON2A 3FZVA 3D82A 1LDDA 2ETEA 5CLSA 1VP6A 2M30A 4BQAA 1QBJA 2AXLA 4I02A 1TTYA 3P7NA 4Q48A 1T2KA 1ZRRA 1SFUA 3GX4X 4YIIA 2V79A 2YPRA 3KP2A 5FFXA 2PYTA 3MPBA 2Y0MA 5F1RA 5I8YA 2IC1A 1FBQA 3CO7C 3E3VA 1R00A 1T6SA 1R7JA 2ZJ2A 2FOKA 1G4DA 4N9IA 3PLQA 5FPXA 3RKXA 4Q0UA 3K0LA 1XGSA 5KHIA 1J1LA 1IXRC 1TQMA 1LB2A 4HV5A 2HEOA 1W7PB 2KRFA 5CVVA 1W7PA 3NL1A 4EJTA 1ON1A 4IRHA 2MNGA 5LGTA 4O5VA 1YW7A 4R8HA 1QGPA 2F4PA 2UXXA 4LK0F 1J58A 4A6EA 3WW4A 4WK8F 2BNOA 5JI6A 1EH8A 4M6XA 1Y0UA 4Q0SA 1NXMA 2GA1A 5DDGA 4MZUA 5HOOA 4QX5A 5H20A 1LDJA 3ZMTA 5IT9Z 3F8CA 3R6SA 3H3UA 2QLZA 3HRTA 2GC3A 4IEYA 2Z69A 3V7RA 4XFFA 4L0ZB 4MEYF 4MQ9F 3HT2A 5C8WA 4IEWA 4IHTA 4B8XA 4PIYA 2GXBA 1IN8A 4PZJA 4QGLA 2QENA 4A12A 1WI9A 2XKPA 5ILVA 1KU2A 3KETA 2OA4A 5IT3A 1U3EM 5FD5A 4MTDA 3NJZA 4QXKA 3KE2A 1ZZ6A 2EFQA 4UXNA 1O57A 2Q2EA 4F8AA 2JTVA 4RAYA 3H9AA 4M9ZA 2BNNA 3LAGA 1XDUA 3F23A 3W6KB 1H1IA 4AWXB 2IVMA 2UYAA 4P9FA 3UKTA 3F21A 3KSCA 2WV0A 4KWJA 2EV5A 1W4MA 1KU9A 3HOTA 3QRFF 3U9GA 3LWFA 3GLXA 4HW0A 1UB9A 1OPCA 4A0XA 2HS5A 2DI3A 3DQVC 1XSDA 2A69F 1EV7A 1J75A 2XL7A 3LFKA 1Z6TA 3H1WA 2CO5A 4KMFA 3HRUA 1X8MA 1HQCA 1SQ4A 4ASNA 4Z07A 1JXSA 1LEAA 3F72A 1HSTA 4HVRA 3J80K 1P2FA 1D3YA 1B1BA 2P8TA 3LA2A 3JSPA 5I0UA 2GQQA 1EPZA 4PIZA 3R0JA 2DQLA 2NNNA 4YFXF 4LJZF 4IF4A 2CSOA 3GWZA 2RGVA 1KQ9A 3B02A 4HV6A 4P5OA 1VTNC 4Q4ZF 2DT5A 3DV8A 1DP7P 3WTSC 1FWZA 2GIVA 1SMTA 3C7JA 1I1SA 3SCGA 3OV8A 4UXAA 5CVRA 2OQGA 1OMIA 4HVQA 1USTA 3F6VA 3M1EA 1D8KA 4YSFA 3P9CA 4ENMA 2JT1A 1FYMA 2D40A 1S8NA 2W24A 1KYZA 4X6RB 5BPDA 4RB0A 2PJPA 4MGZE 5E18F 1OKRA 1BOAA 2ZO4A 4JVAA 5D8KB 4PIXA 4BH9A 3UKNA 1TQPA 5E1WA 1S6LA 5I93A 2Q30A 3EQEA 3CO6C 1J3RA 3MZHA 5LEJA 3J81K 3TDUC 3CEWA 1OI6A 4ZYHA 5DD4A 1RL3A 2V9VA 1L0OC 1TBXA 3WTVC 2DLLA 4A5MA 5CU1A 2W25A 1UD1A 5HS9A 4AQ6A 1J3QA 3K1NA 5CYVA 3GO5A 2ET7A 2LNBA 4EGZA 3CLOA 4Q47A 2NNYA 2UY8A 3WGHA 1DPRA 3RNSA 4QGMA 1J9IA 3KFWX 3OCPA 3CUQB 2V1UA 1MJAA 2VC1A 2V09A 5FFZA 2DFIA 4I09A 4YIFA 1F1ZA 4KU8A 1B9NA 3CTAA 5BQTA 3L2CA 4OIQF 2VECA 4IJAA 5K1YA 4L9JA 4JV4A 5I8TA 5J48A 3V7CA 2IRFG 2C6YA 4MUVA 2RVCA 2EV0A 1GVJA 1WWXA 2LSOA 2FQ3A 2VODA 3SHFA 4HSLA 1D5VA 2DK8A 1T98A 2XHKA 5DEQA 4XFIA 1D8JA 1FY7A 5L3DA 4FAGA 4PJYA 4A0ZA 2HOEA 1YYVA 3IKTA 1YLLA 4WX9A 3LAJA 1QXRA 5KHHA 5EEHA 2DO7A 1K78B 3I7DA 3C3VA 3IIAA 4QGNA 1K78A 3RIRA 4HF2A 2A6EF 1G3TA 4KL1A 2DU9A 4ZYGA 5EZWA 4ZH4F 5ICEA 2FEZA 3H3ZA 3R60A 2A61A 4RS8A 2L4AA 4UV8A 4IRGA 2KXLA 2O61A 4HF1A 1CX4A 3KCCA 2Q1ZB 3BROA 1QY4A 1V4RA 3L9FA 1E2XA 1AOYA 1R23A 1REPC 2FA5A 2PTMA 2VC0A 1VR3A 3FMSA 1OFNA 4P9UA 4LULA 3TOAA 1T39A 5L3EA 3L00A 1MZBA 5JCTA 5JSPA 3TNPB 4O9EA 5JVTA 2D93A 1USSA 2I45A 3E6DA 2FMYA 3TKYA 1B4AA 4KMUX 1RUOA 1RGSA 2EA7A 1QZYA 1FOKA 3TO6A 5LHHA 1YQAA 1LNWA 4R52A 2EFPA 3I58A 1NZCA 2Q4SA 1WSUA 5I91A 4ZZDA 4L5IA 3WTYC 1ZVFA 4XRFA 3AAFA 4IHSA 1I27A 2ZCWA 2OD5A 2OA2A 4JTNA 1CAVA 1QZZA 2CQKA 3LA7A 3IWZA 1V70A 2BNMA 3KP4A 3LQRA 3JZVA 3WE3A 1Z05A 1H9TA 1YFWA 3T0YA 4U7DA 4ENNA 2FSWA 2IXHA 4I7HA 4E2QA 4Y13A 3KLNA 3ROUA 4GYIA 3DFGA 2BGCA 2MC3A 3WU1B 1UHWA 4ESBA 2LF8A 5L3BA 3C18A 2ELHA 4JBAA 3QP5A 4JK1X 3CL1A 3CJXA 1WRJA 3O6BB 3SCHA 1IN6A 4F7ZA 4XF1A 2RN7A 4OU0A 3ERED 3GFIA 3TQNA 5EFUA 1DGRA 5FLIA 4M72A 4WXHA 3U11A 3I71A 1IPJA 2XAHA 4ON0A 3BJOA 5J8CA 2FU4A 4HYEA 2UXNA 4S04A 1PMIA 3E6MA 2J5OA 1UIKA 3WE2A 3WTTC 3SZPA 3S2WA 3O2PE 4XF3A 2ET1A 2KJCA 3J7AO 1HXDA 4AIKA 1GHCA 3FXUA 4HAMA 4NB5A 2MPFA 3JTHA 3EO6A 3D5LA 3F3XA 3R61A 4HN0A 3W6JB 1RC6A 1P4WA 1Z6RA 4WCGA 4K8FA 2NRAC 1XN7A 1JGSA 1SD6A 3EYIA 5ICCA 3GYDA 3O14A 4LLOA 1FBUA 5HLGA 4KYWA 4LEJA 4MTEA 3KGZA 1G3SA 4YYOA 4XF4A 3WG9A 4WZCA 2XIGA 2P6TA 3RZZA 1Z1DA 3RPQA 4Q0PA 4AVCA 2VT3A 2DW4A 1OYWA 2DK5A 4O3MA 3ZMDA 1YHFA 1V3FA 1IF1A 2RDPA 4LB6B 1XGOA 5L3GA 3ABUA 3USSA 2WC2A 1HKSA 4UVCA 3TO9A 2HTJA 2A5YB 3FHIB 5DD8A 3QPTA 1FBSA 2HYFA 1Y3TA 5DCMB 2BYVE 1HSJA 1ONVA 4HMZA 3KGLA 5DCMA 3V8LA 5DYMA 2K7LA 3P9IA 2QCSB 4RGSA 5DUKA 5LEKA 1Z91A 3U2RA 2M45A 3MDPA 2H94A 3HTUA 2XAGA 2CV6A 4AQ2A 5KHGA 1L3JA 2M87A 4ZZLA 2D5FA 3VOEA 2XKOA 1GXQA 5F6FA 1QWRA 5FPZA 4KT5C 2IXLA 3FFQA 1O5LA 4K2EA 4M6YA 1J0RA 4GGGA 4U7BA 3I64A 2IP2A 1B59A 3GFLA 2Q0AA 1T38A 1R1UA 2FRHA 3TO7A 5E1RA 2KIFA 1TLHB 3KZYA 3QOPA 1BI1A 3I59B 4HX7A 1PM7A 1QPMA 3I59A 5HS7A 4IESA 1FPQA 2FBKA 5H6QA 3S0MA 2H6BA 3M8FA 4N0BA 2D1VA 2ETHA 5ILUA 1P4AA 2IA1A 2A3SA 5AIPA 1J59A 3BALA 4LLGF 3GEZA 1F4KA 3L09A 3HOSA 1YWKA 3H1MA 5LRRA 1L3LA 2L02A 3KP5A 3JAMK 5ERIA 1J7KA 4EM0B 4RB3C 4KA4A 1BC8C 1R58A 2HKOA 2FNAA 4OMYA 4MEXF 1YFYA 3RYPA 4ENJA 4HOBA 4LLLA 2MBFA 4J1XA 5LRSA 2O03A 4KUMA 1BI3A 2PQ8A 2IXCA 1XB4A 1I5ZA 4H7LA 2VPVA 3FE5A 3HSFA 1O3SA 2B0LA 3V7SA 1XE8A 1ODDA 5D6FA 3LQQA 4HA8A 4UVAA 4LUMA 5J8FA 2DPDA 5HS8A 3ULQB 4RAZA 3SCFA 1YS7A 1XSXA 4I3PA 3T1BA 3E5QA 1ZG3A 2GWRA 4KDPA 2OPKA 3E97A 5ILSA 3NSTA 3MFKA 4MGIE 2ESHA 2RC4A 4M74A 4ZU5A 4R1HA 5EEGA 5D8LB 1R36A 3IC7A 3DPTA 2IT0A 4OFGA 1YFUA 4KIFA 2OAZA 5J3UA 3IRQA 1R22A 4G7ZF 1UCXA 1FYLA 4QM8A 2V1DA 4LG0B 2ADUA 3IHUA 1K6OA 3KEQA 4LG0A 1KA8A 1Q5OA 5TJJA 1XSVA 4UBGA 3GBFA 4XF0A 3FM3A 3ES4A 4RB1A 1MKMA 4BAYA 4UBHA 5BV6A 4OLLA 4ZU7A 4UNOA 3MAJA 5D5WB 5HLHA 1PDNC 5TRDA 5KBFA 3MCZA 5FO5A 2O0YA 1RUNA 1TW2A 4L9NA 4AD9A 2MD5A 1EH7A 2F2EA 4XFHA 4BIFA 3I53A 4GYGA 5I0RA 5K5QA 4O9GA 4AVPA 5FLXK 5L3FA 2MLKA 1JE8A 1J5YA 3Q9VA 2P7VB 3BJAA 2PAMA 1IRFA 2VXZA 2PBIA 2VOPA 1LKNA 1XRUA 4HN1A 2GA2A 2X4HA 4L0YB 3RJPA 2PG4A 3BCWA 4QWQA 3GFJA 4G94A 4OINF 1FX7A 4HDVA 4B29A 2H27A 4XSZF 4XLPF 2OYZA 4HLTA 5DV5A 2JPBA 5DCFA 4AVAA 4H0EA 2E1CA 3SZTA 1TNSA 2QBYB 2HKXA 3JTGA 2FBHA 2QBYA 5BPXA 4EJOA 5E8IA 4WF2A 3N4MA 1CGPA 1G6NA 4XFBA 1U5TC 3C3WA 5FD6A 1UIJA 4LA3A 5FCCA 2VBXA 5L3CA 3ELNA 4LLNA 4L5JA 2JSCA 2LF7A 3I54A 4N9HA 1WGPA 3G3ZA 5E8GA 3T5XA 2PAKA 2GC2A 1I6XA 3E6CC 2BE5F 4AXOA 1DPUA 4X6QB 3H7JA 2Y0OA 1R1VA 3L7WA 1BIAA 2PMUA 3OTFA 3IL2A 3NRVA 2NAZA 2QQBA 3ZMZA 3KP6A 1T0FA 1KGSA 2R7DA 4META 3OF1A 3WTWC 2HR3A 3LOIA 3RPUA 1QO0D 5BS6A 4CHUA 3HSRA 5K8SA 1HW1A 4FBFA 3LAPA 2JRTA 2YU3A 3FMQA 4OOIA 3GUDA 3GZ6A 3ZMVA 2P17A 1R1TA 2PA7A 3T8RA 1FP2A 3HIFA 3HYIA 2FNPA 4Q5SF 1XCBA 1IRGA 2ACJA 4E2SA 1FXZA 4IXAA 3VEPA 4MGYE 3TDZC 4ZYEA 3QU6A 3GVAA 2AS5F 1CAUB 4D7SA 3MEXA 1CAUA 1DGWA 2F5CA 1XMAA 1ZGAA 1R5GA 2LKPA 1O3QA 1XGNA 3WGGA 3ZMUA 2VBWA 4AVBA 2K0GA 4HSJA 2Y75A 3ZN0A 2B5HA 2B9UA 3VODA 1BM9A 2DTRA 4FAHA 4KFCA 4LUKA 2GZWA 2QJVA 4FX4A 2X0LA 2J5PA 5LGNA 4RD7A 1SAXA 2TDXA 5CADA 2E7XA 1W5TA 4QLCU 2PI0A 1NYWA 5ICFA 2K9ZA 4I01A 1ZG5A 3CDHA 2XRNA 5JHUA 4RGUA 2ZKLA 4EJWA 3EQLF 1YW8A 3J80Z 2P5VA 3FJSA 3H92A 2EAAA 4BXUA 1MGTA 1SD7A 3EHKA 2K86A 4Q0VA 3CJNA 2HTSA 3IBMA 5A2QK 3BJ6A 3M3IA 3FZ3A 3TGNA 2PQQA 3ZMSA 3BZ6A 2STWA 2V1XA 2EFWA 2EJRA 3H7YA 1QQIA 2ZNYA 1XGMA 1FYKA 1SFEA 1CAVB 2CW0F 4A6DA 2XAFA 3NW4A 3LA3A 3HSEA 1KU7A 1P92A 5C6CA 3MZYA 2G7HA 4P96A 1QNTA 2OU2A 4PGGA 4MHGA 3PNAA 1CAXB 2ZXJA 1CAXA 1Z7UA 3R4KA 4TV7A 3KZZA 4M73A 4G6DA 4UUVA 1O3TA 2KJBA 5E20A 2DPUA 3J81Z 3V8JA 4E2GA 1LQ1A 3KLOA 1IN4A 4IEQA 4YG2F 1W5SA 2CFXA 2IXJA 2Q8KA 2R3SA 2FQPA 4DNCA 2UWMA 3ML6A 4PGHA 1EYBA 2HQNA 1ZAOA 3GFMA 3ZDSA 4BNCA 1O7FA 4A0YA 5IT9K 1QXJA 2F5DA 4IERA 1YIOA 2E1NA 2XROA 3M8EA 1GXPA 4XETA 1LVAA 1YFHA 2IA2A 4IEVA 4WVZA 2YR2A 2GC0A 4ZYDA 2ISZA 4MV2A 2CAVA 1HKQA 2IA0A 4LK1F 4LMYA 4G8XA 3RKWA 1U12A 2M1BA 1IN7A 3PVBB 4MGKE 2PMHA 4M9SA 2STTA 2N7GA 1JHHA 5KK1A 4OMZA 5BPIA 1H1MA 3B73A 2PAEA 4OIOF 3QP6A 3SFZA 3NVCA 2RNJA 1FT9A 5ICGA 4G9YA 1CAWB 5FB2A 2O8XA 1CAWA 1UCRA 4YNIA 4LGWA 3BOQA 1EH6A 1ZYRF 5KHJA 3FXQA 5K5RA 2QVOA 2ISYA 1TQIA 5LLQA 3WODF 4XF9A 1SMYF 5JR7B 4RGXA 3Q5FA 2EWNA 5D5XB 5BMZA 3ZQ7A 3WGIA 2MH2A 1J3PA 2RKHA 3TOBA 1RI7A 4JTOA 2Z2SB 4G7OF 4OIRF 4L18B 3T8TA 4Y15A 2GU9A 3V4GA 4CYDA 3K2ZA 1CF7B 1LRHA 3JSOA 4Z82A 3IKVA 1CF7A 4XFGA 2DBBA 1G3YA 1YLFA 5CVIA 2HWVA 2OZJA 2IXKA 2C0ZA 3F8FA 2XAQA 2ZKZA 5CJ9A 4BYYA 3N97A 3EJKA 3BP8A 2CWEA 3OD0A 4ENKA 3RTRA 2FBIA 3SXYA 4NHJA 1FNNA 2V6CA 2JZYA 3SQNA 1TNTA 1XCVA 2P5KA 4YFKF 3EDPA 3EETA 2M5WA 2QQ9A 1IUYA 3CUQC 5AVPA 1LDKB 2XAJA 3DP7A 2D2WA 3VFZA 1BC7C 2CG4A 4Q0QA 2QUFA 2ZBKA 4PCQA 2UY9A 1LEBA 4ZU4A 2VE9A 3I5UA 5HLIA 5D1IA 2GH2A 5I8SA 3LZZA 4IEPA 4EJVA 3U0ZA 2BEOA 3EUHA 3WW1A 3HRSA 1ZZ7A 4HZFA 4EMSA 2E7WA 2KIUA 3H50A 1S3JA 4YRDA 3F6OA 4LFUA 1NE6A 4EGYA 4LTAA 2HFHA 1OD5A 2WFPA 2QVSB 5BOXA 4QM9A 2O3FA 1ZX5A 4A5NA 1JUHA 4EQQA 2QWWA 2GC1A 3S7EA 2VBZA 2DCTA 3DL3A 3EYYA 4U0WA 1DZRA 1EP0A 2QDRA 4NQWA 2EA2A 1ZZ9A 2EA4A 4OIPF 2R7FA 2G9WA 3F8MA 5CVUA 4I2OA 1H0MA 2CGPA 1ZH5A 4PDKA 4TLFA 5FLHA 3I4PA 5JSRA 4Q29A 5D5VB 1XDSA 1F9NA 2VQAA 1FSEA 1B6AA 4IEZA 1X7NA 3FMRA 4KWKA 2W84A 5HI0A 1AWCA 3ZPLA 1MD0A 2Z99A 4HLYA 3CF6E 2VT2A 5E1ZB 3IDCB 1YG2A 1X3UA 4CZZA 3M9AA 2QQAA 2HGCA 1U6GA 1BJAA 3ELKA 2Z9OA 1OYYA 1SD4A 4XFCA 2LDUA 2VBYA 3IRRA 1ZRFA 4HBNA 5T3NA 4YFNF 3MWMA 4KIGA 3GXOA 1FZPB 4EWDA 4MX3A 3ABTA 4LD5A 4A2UA 5JR3A 5D4RA 2OQRA 2D45A 1YFXA 2B8MA 5ED4A 1NE4A 4EV0A 1ULYA 5JFRA 4XLNF 3K9TA 1DZTA 4L11A 1RZ4A 4GXOA 3M7GA 4WXCA 2HQRA 3COAC 3M70A 4KICA 4U0YA 3ZP5A 3HT1A 4R79A 1STZA 2MLGA 2HZTA 3F22A 4UHTA 3WW3A 1MDMB 3IWFA 1A04A 2Z3YA 2XLAA 2ATFA 1BBYA 3VB2A 1MDMA 5JAXA 1IXCA 2L01A 3PQKA 3FWEA 3FM5A 4MH0E 5K5OA 1X82A 1Q43A 1KQ8A 3CUOA 3S7IA 2P6SA 5D4SA 2EFOA 1XMKA 2P7CB 2FE3A 1EY2A 3F8BA 4IPAA 4HVOA 3FX3A 3NEUA 4CDGA 2Z5UA 3HHHA 1PP7U 1B9MA 1H9GA 1ZLKA 3CO2A 2EB7A 1KQ0A 4CICA 3BWGA 3BU7A 2XASA 3WTXC 2WTEA 5HDGA 2NS0A 1R5HA 2Y48A 4EROA 4HX8A 1BI2A 2XUBA 2ZFWA 1IPKA 2MH9A 3R0AA 5JSOA 4FHTA 1MJBA 5FDBA 2A6HF 4ORFA 5LHIA 3H8UA
chains in the Genus database with same CATH superfamily
1J83A 3B5LB 5E17F 4JQTA 1SBEA 4HDUA 2YX4A 1DQ0A 3PDQA 3OOPA 3BUCA 4F92B 4AIJA 3RI8A 1LHWA 1XE7A 2VONA 3W2AA 4ISQA 1UZ0A 4KNYA 1HRI2 3GF2A 3WX5A 3JAMZ 3LFMA 2JWTA 3FL7A 1PP8F 3D0SA 4ETSA 2BERA 3VKOA 2FQ4A 3BPXA 2BY3A 2JJ6A 3VZLA 3CCUI 4YG0A 3RZOJ 4M71A 4YW7A 5EPAA 2JA8J 5I0SA 1WA4A 3CZJA 1NG6A 2K02A 4WXDA 4YVSA 3WVJA 4CEYB 4G6TB 2K85A 3ECOA 1KFUL 4AIHA 2K4BA 1UAAA 2VMDA 2WQZC 1HJFA 1F2NA 3ZIXA 2KM2A 4PJNA 2AQFA 1UAIA 4BPZA 1IN5A 4K1YA 2DTYA 2XLGA 4N90A 4ATEA 2B63J 1W8WA 1C28A 2WAAA 5KVRA 4LA2A 5K7HA 1KJRA 1FAYA 3W59A 2D3RA 4FPCA 3BTCA 3NQOA 5DQ0A 3FF5A 2VKDA 4UW6A 3U4XA 4ESFA 1WHUA 1HC8A 1TQ5A 2W08A 2ZEXA 3L2VA 3JQWA 2MD0A 3DLAA 5JOZA 3WDVA 1MBEA 1YOVB 3SQOA 5DABA 4ZC3A 5DUIA 3LDBA 2COMA 1D1BA 2WV1A 2EV6A 4KIBA 3LSPA 4NC7A 3DECA 4A3BJ 1DUXC 2IBDA 3ZGKA 1MBJA 1W6PA 1PX3A 4QX1A 2XMLA 2DUPA 3AMHA 3WZ1A 1SCRA 4HQEA 4V2GA 4ET7A 3N05A 1O4TA 4PI2A 1R71A 1S55A 4NIGA 3WW2A 4Y1UA 1XS9A 3JR9A 2BW8A 2ZGUA 2PQSA 4W6XA 5M5WJ 3V0BB 3REOA 3NAUA 3JXSA 1I1EA 1QDOA 5FZ1A 2H09A 4YARA 3CCQI 1JHJA 3D0JA 4L2NA 2XVCA 4ANJA 4XEZA 3H9GA 1AF9A 1U8RA 1S29A 2R043 1OR7A 4A3CJ 5JHFA 3APBA 2E6VA 3ZXAC 2M8EA 4WM8C 5DAVA 1T2XA 4COVA 5EG0B 3SH3A 3QU3A 3R4DB 3A0BC 3GLLA 2P5BA 5IT6A 1X3ZB 4G7HF 2DODA 3USUB 1S7AA 3R4UA 4F3QA 3H1CA 3RQ4A 2PMWB 3G1OA 3DF8A 2Y6LA 3MV01 2WWYA 1WBLA 1OFCX 1EAH1 2FMDA 5KHKA 1HQWA 3Q9SA 5A70A 3K4DA 3BPSA 2Y38A 3E5XA 3KMHA 4AM3A 1VBA2 2TEPA 3AYCA 3JW4A 1LGNA 2W82A 3HQUA 3RCOA 2A71A 2RDQA 3MN2A 4L9TA 2XL9A 4AZZA 2FF4A 4IV1A 2IJLA 1FIPA 3C7HA 2WN3A 4QMAA 2FXAA 1Q1HA 3VYUB 3M3EA 5F39A 1HW2A 4D0QA 4LLFA 2ZMEB 1YUDA 2A6XA 1WLDA 2Q8CA 2UYBA 5E1XA 4CEWB 2VQUA 3BTXA 4YFZA 4XMYA 3VZJA 1I6HJ 4A3LJ 4UYBA 3CC2I 4YELA 1IG0A 4JKKA 1NHAA 4IEJA 3ZN5A 2Z33A 2NVTJ 3VBSA 4IL7A 3HZJA 3PUAA 1YIPA 2K9LA 2I07B 3M3CA 2UWBA 4LO4B 2R32A 5GZDA 1TZOA 1MZFA 1TC3C 3OYCA 3RI4A 4HX4A 4RBOA 2FD8A 2W85A 2F5FA 2L9RA 3CJIB 5FAXA 1XD7A 3TEDA 1RTVA 4H7MA 4JQFA 3FIWA 3RDIA 3VBUB 2B39A 2XGXA 1ZYBA 4OMDA 2BFUS 1WJEA 3FXRA 1W9WA 3WV6A 2LRDA 4DQAA 2XGDA 5GPCA 5BNGA 4QKBA 2VOOA 5G04L 4KWUA 2F5EA 1OLME 4XUOA 3G4SI 1YQ2A 1LDDA 5CLSA 3UT0A 1VP6A 4BQAA 1QBJA 2EIDA 1ZRRA 3WG4A 1SFUA 5F0CA 3S14J 4FXGB 3JBG3 5FFXA 2Y0MA 3BTIA 4JYKA 1F8VA 1NCRA 4JZRA 3T2OA 3ZQFA 2DMUA 3BG5A 4M3CF 1FBQA 3SITA 3S1RJ 1R00A 3ZR8X 3OBZA 4N9IA 1MZ5A 3MIEA 3UYJA 3ZYIB 4WM7C 1X50A 4Q0UA 3K0LA 3KQ4B 4DY3A 2XGEA 5KHIA 2GLOA 1K3IA 1J1LA 1SANA 1W7PB 5K0UC 2VE1A 3JBG2 1KQRA 4I99C 5FPBA 5FO8B 1T6BX 2JSPA 2MNGA 4O5VA 1G2HA 3O1MA 4R8HA 5IK8A 2JENA 3HQRA 1X58A 2WZR2 4FTHA 3FBNB 2UURA 2MG4A 4WK8F 1PGW2 2HYJA 2R49A 2QDNA 4BB3A 4JX6A 1OA3A 4QX5A 1DU0A 2B46X 4Q27A 1DZQA 5IT9Z 1SFOJ 1MBHA 3F8CA 3R6SA 1MIJA 1IS6A 2R071 3ZOIA 4IEYA 2ZSIB 4P9WA 2H0BA 4V1PA 4HNTA 1U5YA 4MQ9F 2YZ4A 5C8WA 2A6ZA 5C9AB 4IHTA 2XUEA 5F3CA 2ENRA 3MIGA 4JC1A 4B8XA 2W7NA 2KZGA 1OT5A 2QBXA 1H2KA 2BY2A 2D44A 2TCTA 3PHMA 1GLNA 4PZJA 3K2AA 1LOFC 4CCJA 3KETA 3OYBA 4RLFA 1OVSA 4MTDA 4QXKA 2Q2EB 1CZSA 2EFQA 2DTZA 1O57A 2J1TA 1RUC1 3BTZA 2VJXA 1LFUP 2BNNA 2HOSA 2QKDA 1XDUA 2KPMA 1H1IA 4AWXB 3R0RA 1UX7A 1M1EB 1YC61 4Q5OA 3S6PA 5DM6F 3F21A 5C71A 1IDYA 1U0AA 1W4MA 2BHYA 3QRFF 1MQTA 3UNGC 1UB9A 3H35A 4ES8A 4Q4W1 5A3UA 2X10A 3IUOA 1Z6TA 4KMFA 3HBZA 1SQ4A 3HM5A 2JD4A 4ASNA 1ZTRA 5JUVA 1AR91 3LEKA 2OC6A 3J80K 1P2FA 1D3YA 1B1BA 4XOTA 5FYZA 1EPZA 2PJRB 2FCUA 1BHGA 3R0JA 2WA0A 1D2QA 2NNNA 2QSFX 2EZKA 4LJZF 2CSOA 1OH3A 2ZPXA 4GXLA 1KQ9A 2ZBJA 4HV6A 4AGVA 5LY1A 4Q4ZF 2XQRA 5CPRB 2FDKA 4ZXKA 1FWZA 2ZGSA 1B35B 1IC8A 3SCGA 1JJ8C 2PHWA 1NT0A 2LTPA 3WQ7A 1Z7S2 4FTEA 4AR2A 3P9CA 4ENMA 2CL2A 1S8NA 2IS2A 3ZXJA 1JN2P 4MGZE 4CP0A 4CPBA 1BOAA 4HEA2 4LOCA 2VUCA 2LTNA 1S6LA 3DEMA 1YE9A 4BU2A 1D7PM 5LEJA 2ZS6B 1DLCA 2ZEZA 1UYYA 1OI6A 1UZZA 2RG4A 3R05A 2A3YA 3B6AA 4BMEA 2DLLA 1B72B 5HS9A 1J3QA 5CYVA 4M3CE 3GO5A 2QQ8A 2ET7A 2LNBA 4A41A 4Q47A 5EGOA 3WGHA 1KONA 2XJTA 3KFWX 3OYWB 5IFTA 3OCPA 4E8DA 1MJAA 2X6OA 3VYTB 2ZKNA 2V09A 2OTJI 2LBFB 2DFIA 4I09A 4ZPIA 1F1ZA 3RZHA 1ND3A 4KU8A 4C2TA 3N3HA 1PZ7A 4IJAA 4XVHA 1JI8A 2ZJQF 2XPUA 3ZXGA 2E53A 1WWXA 1N1YA 2V4AA 3LD8A 1R4MB 4PDWC 2LR8A 1O59A 2YB7A 3SHFA 5CZKA 1SC7A 4ZZ8A 5DEQA 1GLHA 4FVVA 3S16J 4FXKB 4DNYA 4A3FJ 1FY7A 3RWNA 1MS0A 2E5ZA 4FAGA 5ABJB 2OJED 4IQJA 1VBE1 1C5IA 1YYVA 3ILRA 4OZOA 2DO7A 3C3VA 1W2AX 4R4ZA 1K78A 4HF2A 3H36A 2BY0A 4KL1A 1CJDA 2DU9A 3C2HA 2A05A 3ERMA 3M1HA 1OOPC 5FMDA 2A61A 2GN3A 1HLVA 3BGAA 4M3DA 1V55H 1O4XA 3ZXFA 2P34A 3BROA 1XQNA 4V2VA 3VBFB 1V4RA 1D1AA 2PTMA 4NJ4A 4RM3A 1OFNA 4Q4V1 1M4WA 2XJRA 2XPWA 1RUF1 1VBC1 3NAPA 3GTLJ 3TNPB 5C3PA 4JDOA 1RKWA 2WO1A 5JVTA 1USSA 2VMIA 3MKZA 2VKVA 1SCSA 1RUJ1 1V6NA 5F3IA 3TKYA 1RUOA 4LBJA 3VZKA 2EA7A 3M07A 3I2FA 1QZYA 1VNDA 4LNVA 2X5IC 1Y1VJ 4R52A 2Z16A 2FCVA 1WMDA 5JPMB 2HVQA 3MV11 3O1VA 3I58A 1NZCA 1HKDA 3WTYC 1ZVFA 4XKWA 2YU9J 4IHSA 4FISA 2ZCWA 1VMFA 2WB1N 1ETWA 1N1SA 2IXSA 4UFLA 4HFSA 2XUMA 2CQKA 3LA7A 3IWZA 3ZFGA 3NNFA 4DUVA 3WE3A 1JMUB 4XL9A 5E3OA 4ZDOA 2JD9A 1X1DA 4Y5Z0 5JLWA 3PU3A 3FKIJ 2W39A 5EDNA 1IPSA 2L0KA 4CDQB 4GYIA 3OBRA 2OCCH 5IAXA 1FMVA 2MC3A 3WU1B 5JMOA 2LF8A 2M7AA 2VC9A 2BHZA 3CL1A 3CC4I 2LC2A 3O6BB 3FHNA 4OHXA 2RN7A 3VB9A 5K7FA 4CCEA 3GFIA 5EFUA 1DGRA 5FLIA 4WXHA 2JXAA 4HNUA 4CUBA 4Y1VA 4WVVA 2ADDA 5T54A 1HRV3 4OVEA 3POSA 4R4XA 4S04A 3E6MA 3CESA 2D97A 3S2WA 2VQLA 4XF3A 1Z67A 1GHCA 2AYHA 4HAMA 4V19K 4HN0A 3W6JB 4F83A 1TMF3 2NRAC 3T0AA 4AEDC 2NQYA 3FXMA 4GH4B 1SD6A 3GYDA 3O14A 4RHV1 2E5NA 4ZYAA 4MTEA 5A6YA 4EZHA 4WZCA 3PUQA 1DQ6A 4BQYA 3ZPOA 4LMFA 3WUDA 1YRNB 2VKEA 1IRZA 1AXZA 3NO8A 5KNLA 5JLVA 2VT3A 1OLQA 2DW4A 3S3MA 1V3FA 1AR63 2NVXJ 4P9YA 3KEYA 2XB0X 2A6WA 2WQ4A 2ZMNA 2HBUA 1HKSA 3I2HA 4UVCA 3TO9A 3L2YA 3FHIB 5C44J 1YJWI 1QJU2 1QOOA 2VZUA 3ZN6A 1PZ8A 5DCMA 4RGSA 4DGWB 1AR62 2E26A 2L7KA 4GJYA 4GDFA 2BW3B 5KHGA 2KMUA 2BU9A 2D5FA 1T95A 2XKOA 3AM2A 3CNAA 5F6FA 4KT5C 1O5LA 4K2EA 3NARA 4M6YA 1T0FC 4NBQA 1PK6C 4ES9A 3IP4B 5B1BH 3LPFA 1QOSA 4UFJA 3I64A 2E1OA 2IP2A 1AKHB 3HOUJ 1NH3A 2A70A 2DDUA 1EJ9A 3RRDA 4Y4RA 3OYIA 2KIFA 4Q1PA 1I3QJ 4UF0A 2WADA 1RMU3 1BI1A 3I59B 1PMHX 1QPMA 3WY6A 5HS7A 3F9KA 2GP5A 2P37A 1WMXA 4FPJA 1CQ9A 2ETHA 1VRH3 1W36C 4XONA 3MGUA 2HZDA 2EXIA 3SEPA 1IG3A 1YI2I 2LMDA 1U9OA 2DWRA 4IOAF 3BALA 3LFUA 4NRMA 2Y6HA 4LLGF 1RMU2 2RAEA 3HOSA 3CBNA 1SFKA 2AACA 2L02A 1W3XA 1W0TA 3AZXA 3C7EA 2ILMA 1IUFA 4KA4A 1BC8C 3KX2A 1C8M3 2P3JA 1VRH2 2CDOA 1YFYA 4BIOA 4PUSA 5FPAA 2HNHA 4AK3A 3HJEA 1AU7A 2F6CA 3ATGA 2IXCA 1XB4A 3POEA 4H7LA 4ABZA 3HGYA 2ZHMA 5FBJA 4QQLA 2B0LA 2O7OA 2MYSA 2KDZA 4AQSA 1FV3A 4RMNA 5J1RA 4YW5A 3VL9A 1C8M2 1GWKA 3HMYA 1KDMA 3HEIA 4WM8A 1YYNA 3ULQB 3G6EI 2R5YB 1OKQA 4M3EA 2RS32 3E5QA 1ZG3A 4KDPA 1IQAA 4FE7A 4XDOA 4RQPC 2FHRA 4YFWA 4XMIA 4HK8A 5ILSA 3NSTA 2WWJA 2RC4A 2LY2A 4R1HA 5EEGA 1WA6X 1R36A 3CMAI 4AVZA 5IFPA 1NX9A 4KI5M 3JU9A 4KIFA 4QHZA 2OAZA 3IRQA 3TW7A 2IS4A 3NWTA 2X1DA 3VWBA 3ZDVA 4IE6A 4QM8A 4A42A 1O6UA 2HDDA 4KG0A 5TJJA 4D6RA 1XSVA 4XK4A 3FM3A 3KV6A 5BV6A 2FOWA 4OLLA 1HA8A 4IHVA 5GZCA 3D5SC 1W8TA 2A6YA 1TT0A 3MEPA 3WCSA 5FO5A 2O0YA 4L9NA 4JGYC 5LZ6A 1US2A 2RS51 4XFHA 5C3EJ 3PSIA 4GYGA 1DGWX 4AVPA 5FLXK 2RM21 2MLKA 1JE8A 3E0JB 3VZOA 3WR0A 1RUD1 2HU9A 2E51A 3AG1H 3Q8AA 2PAMA 1IRFA 2PBIA 1RETA 3PMEA 2VOPA 1XRUA 2GA2A 1FIAA 5K4LA 3OS2A 2PG4A 4AAXA 3GFJA 3T1MA 3SKJE 1PNFA 2VNOA 1MS3A 3J7ZI 4B29A 4XOGA 1W2UA 2P3KA 4CXXA 2MSYA 2JPBA 2ICWG 1CVNA 2JDHA 3SH5A 1TNSA 2YFUA 1POV0 2DOEA 1VAKA 4QQHA 1ULDA 3UESA 3KF5A 1G6NA 4XFBA 3C3WA 5FD6A 4HXCA 2WNVA 3C2GA 3T4VA 2JSCA 3QH6A 1MS4A 1UL9A 3G3ZA 1WGPA 5E8GA 1XG1A 1I6XA 3E6CC 2QQMA 5FYSA 1YHQI 5HV4A 2BE5F 1W3VA 3I2OA 2VZTA 3WXPA 2GM4A 1E57A 2A73B 2CGOA 3H7JA 4NRPA 5F1JA 1QJEA 2HPMA 1R1VA 3L7WA 5FYUA 5A3PA 2JK3A 3IAPA 1MMDA 4C1WA 2NAZA 3ZMZA 1GZTA 1KGSA 1N3OA 4META 2EZIA 3WTWC 2R7UA 5CFCC 1GFF2 1ETYA 4D5FA 4CHUA 3PFYA 2JRTA 4CEYA 3GZ6A 2CQ7A 5FKOA 1FOXA 3DUIA 3J7MA 4GWIA 1FP2A 1Z7LA 4CDWB 4NIAA 2FNPA 3AVRA 3MFAA 4LG3A 3BODA 4FQGA 2E7AA 5F6KA 3T09A 5EV7A 3CJTB 1R64A 3RQ0A 3VEPA 4WM7A 1CIWA 3FFZA 3MEXA 4PSXA 1B8IB 1R5GA 2BVMA 1XGNA 5K0UA 1R081 3K77A 2YPJA 2YG0A 5IK4A 2VBWA 1MZEA 3OEBA 3ZR5A 3I9V2 2D6MA 1HXS1 2YGLA 3N7LA 5A7WB 1VI0A 3VODA 4C3IJ 1RJ8A 4K40A 1FMD3 2RJLA 2XWBB 2X0LA 2DA4A 2J5PA 1W8NA 3ZR6A 2VPLA 3BG6A 3OYDA 4A6OA 2PI0A 1OLTA 3IM0A 3OYFA 4K8RB 4RGUA 3KQRA 2QKLB 4EJWA 3KHBA 1YW8A 4X0GA 1R093 2V73A 2OS2A 3FJSA 3H92A 2YC0A 3F2ZA 3BJ6A 5EJCA 1JZ6A 4U87A 3M3IA 2Y8KA 1Q8PA 3PTRB 2PQQA 3OGGA 3CCJI 3A4UA 4RYDA 2CUEA 2STWA 4QX7A 4IGPA 1CZTA 2EJRA 1GP5A 1ENSA 3SFIA 3H7YA 4W4ZA 5A3MA 4RAGA 1TEIA 4OCTA 1BR4A 1APLC 1CAVB 2K9QA 1OPMA 2QQUA 3LSEA 1AZDA 1IDZA 2KDOA 4E7LA 3X2QH 2VZVA 1P92A 4DRRA 5C6CA 4LHKA 2G7HA 4P96A 1QNTA 2CFOA 2OU2A 4PGGA 4HRIA 3ZM8A 1W8FA 1CAXB 4A3IJ 2ZXJA 4CVUA 5GLVA 3R4KA 3KZZA 5HNFA 1VB2A 4A4AA 3AP6A 1GKBA 3J81Z 3POBA 3P1IA 2CV0A 3W2WA 5HLTA 3WLUA 2ME0A 3KLOA 1E0EA 2ZGLA 3WQ1A 2CFXA 1I3HA 4YGDA 2L7FP 4JP0A 5FMCA 3AZWA 4DNCA 4XLAA 5IYYA 5FZ0A 3ML6A 4PGHA 2LALA 3ZDSA 3JD71 2XR4A 4BNCA 3KVBA 3UKGA 1QXJA 4IERA 1YIOA 4N8MA 2IAIA 3POWA 2ZOEB 2KIQA 2L2OA 1YFHA 2JKXA 2QE3A 1VBD2 2YR2A 3ECQA 2JA2A 1NY71 2ISZA 4INDA 2JDZA 4JRLA 1GYKA 2AXTC 4HKLA 5FY9A 2HH9A 4LK1F 4AIDA 4XQFA 3TW6A 1U12A 3CCVI 1PIV1 4COWA 2WLQA 1VQLI 3AVSA 3MUY1 4M9SA 3RGBA 1JHHA 5KK1A 1Z3XA 5L73A 3A1YA 3WHUA 1SVMA 5FXXA 5FZDA 1AA7A 2QGUA 4OIOF 3SFZA 5IOZA 4CCKA 2O8XA 1CAWA 3VZNA 5G05L 5LY2A 2QVOA 4UUSB 1SMYF 4BQ3A 3Q5FA 1O4ZA 5FZEA 1CR7A 1HCRA 2BFUL 2W47A 2RKHA 3KF3A 1RI7A 3JRCA 2XRLA 4G7OF 2AGSA 4L18B 5C3SA 4Y15A 2GU9A 1YJ9I 1CF7B 1LRHA 1YX5A 3JSOA 3IKVA 3LMMA 5CVIA 2XB6C 5CG8A 3F8FA 5DMYA 1IS4A 3N97A 1Z77A 1W6OB 3BP8A 2VTXA 3OD0A 1TWGJ 1KD7A 2OX0A 3N9PA 4PDWA 2EXKA 2HEVF 3HPNA 4C30A 4NHJA 1FNNA 3ASNH 2JZYA 5GADJ 3FBIB 2E71A 1XCVA 1UZWA 3DTEA 5HBAA 1PO21 3SYTA 4RR3C 1VQ5I 2M5WA 2WNEA 3CUQC 5FO9B 2D2WA 4CA9A 2CG4A 1DGRN 4FASD 2ZBKA 5KCMA 2UY9A 2DYSH 2V9KA 3I5UA 4P5HA 4GFBA 3NV3A 3UGFA 4AEKA 5I8SA 5FKNA 1OOPA 4XLEA 2R7EB 5EYRA 2WAOA 1NQDA 2JDNA 3WW1A 2VW1A 2A5ZA 1BJZA 1LPQA 1DYKA 2B9SA 1QU3A 1S3JA 3WCRA 4YRDA 1FOYA 1W8UA 5HXVA 3FXJA 4LTAA 3A02A 3CMYA 4AI8A 5LBCA 4QPGB 2V5DA 2GC1A 4OI1A 4I6ZA 1E3HA 4IGQA 2ZMKA 1P7IA 2R93J 4HANA 1EP0A 2G0EA 2JG8A 4MLOA 2G9WA 5CVUA 3VGIA 4I2OA 3K46A 1Y9MA 4IQPA 1AYM3 4PLOA 4P02B 4MG2A 3WHCA 4TLFA 2Q8OA 1PVC3 1XDSA 3I55I 1B6AA 4ZDLA 1X7NA 2DBIA 1KS5A 2W84A 1BBT3 1IGOA 4XDPA 1AWCA 1MD0A 2WA4A 2OF7A 3OY8A 4V2FA 1YG2A 5CAZA 3DXUA 4CZZA 1I9RA 2QUOA 5FY8A 2HVSA 1GZ9A 2Z9OA 1VMJA 1WCKA 2B45X 2LDUA 2FUG2 1XNAA 4HBNA 4YFNF 4IE0A 2WS91 4QPOA 4D6SA 5EP9A 5FWJA 3UGGA 2BVLA 1LULA 2ZGMA 1AX2A 3HWJA 3QODA 3S57A 5JR3A 1ZBA1 1YFXA 3WOGA 4EV0A 1C8NA 1EPWA 1YQ5A 5JFRA 4GXOA 4BJ6C 3UNPA 4YM0A 4E4HA 3HT1A 4UB8C 3I2KA 4H2AA 5BNNB 2CY6A 1VQNI 1FYUA 1MDMB 1A04A 2Z3YA 1BBYA 3JCIA 3FM5A 1X82A 1KQ8A 5A6QA 1XYNA 2DMNA 4D1QA 4AEDA 1W36D 4DMIA 4GAZA 2DMTA 2PHTA 4BZ4A 2W3JA 3Q0WA 4YM1A 3K4ZA 2ZZJA 5DXDA 1B9MA 1H9GA 5F0FA 3CO2A 5BNOC 2VZQA 3HDDA 2D98A 4CICA 5FYBA 5L7OC 1NLRA 1QJX1 1X4PA 3RZJA 2ZGPA 1R1A3 2WTEA 3GTGJ 3I4IA 3IMMA 2MEV1 5AC91 3OYNA 2ZFWA 4OUEA 1IPKA 3UJOA 2L7ZA 4CEWC 1HQLA 1UOFA 1FNZA 4C9YA 2W57A 4HF0A 3EYPA 3PUFA 3I2IA 3ZRGA 2HDCA 2PHDA 3AXDA 3UV9A 1W06A 4ZS3A 1F5TA 4XBFA 4DBQA 1S2EA 4DUXA 1GR3A 1R1A2 2JDUA 1U0JA 2R5ZA 1PM4A 4DINB 2H6CA 2FDIA 1X8EA 2F6BA 1REDA 1SLAA 1EAH2 1JZ7A 1YQ6A 1FC3A 1PK6A 1YJKA 4LBLA 4Y20A 2CWMA 2XV4S 1YW9A 4YVSB 2ZABA 4YZ5A 4PJLA 4B48A 4C91A 4A69C 5CVJA 3S93A 2VE8A 3CZUA 5FPLA 3BB6A 4XBQA 4PFOA 1ZZBA 2Z1DA 3OYWA 4XILA 1SEUA 5EYYA 2K9NA 3BQZA 4MNUA 4ESJA 1XBFA 2A6TA 4XRMA 2CW7A 1IZ1A 3MHZA 5ISLA 3K1PA 3UJQA 2Q5TA 2UZKA 1N75A 1ZN2A 4XFAA 3LPGA 4EN9B 2YSRA 3LWCA 4MOAA 2EIMH 2QSHX 1ZBE1 4GALA 3HNYM 3CF5F 1JZ2A 4K7JA 1G3WA 1WW6A 3ZCOA 3ETQA 2VM9A 5DZEA 1IXSB 3UKVA 3J4UH 1UY4A 4IVNA 2DA6A 3S2DJ 1H2LA 2MA3A 1PO11 4NHYA 2JUCA 4BXFA 4GO1A 3PSFA 1JOBA 5CBLA 3AG3H 1LR5A 3ETPA 2E7QA 4XACA 1UHMA 1VJ2A 1W6PB 4ZONA 3HRMA 2PXJA 3EBRA 3HD8B 3BOWA 5IATA 2A68F 1FPN1 1VBB1 4Y1YA 3I3MA 3BR5A 4P1WA 1TL8A 3VBFA 5IOYA 2KQRA 3QPLA 1Y8RB 3ENRA 3W3CA 5TSWA 2OZ6A 5IVYA 4D5CA 3M3YJ 5DAWA 1VQ8I 3HN1A 4YM3A 4CU8A 5JXGA 3MLLA 2RV8A 4C90A 4RQPA 2KA3A 4B7KA 2H0VA 2VG9A 1JW6A 3WNOA 5FQ0A 4IV3A 1W90A 3WD5A 2DVDA 1DGLA 4HBLA 2OIIA 4FO9A 1XPWA 3TNQA 1UXXX 2JIGA 1EV11 5KC5A 4Z2YA 4HLXA 2NS8A 1W99A 1LEDA 4KN7X 2CJJA 2ELJA 4Y24A 1SFYA 1IKQA 2P2KA 1WGXA 4TXWA 5JZGA 1D0XA 5J6XA 3QACA 4RB2C 2GP3A 5FUPA 1TZLA 4J1WA 1N25A 1G8WA 3AZZA 2BV6A 1D4M1 1ZARA 2JICA 2MHFA 1L7LA 4GCVA 2WAQA 2IVJA 1AXKA 3WP3A 3KT7A 1Q3EA 1ACCA 3E6BA 1GUIA 2Y26A 1TW3A 2D3PA 4JGYA 4P5YA 4CDQA 1RNLA 5FWEA 4NHXA 1HW5A 3WTZA 3ASOH 3LFIA 3I97A 1LJ9A 1BN5A 4IV1B 2QZ3A 4L9VA 1KITA 2ZGQA 1W5CC 1ZGJA 4MXWA 1SHWB 5J37A 2ZX2A 3SDGA 5L19A 3S3OA 4BWOA 4XSXF 4YG3A 4DXTA 5FY1A 1E5IA 4R9BA 1ND2C 4URAA 3O3KA 4CUAA 1GZCA 1I1GA 2F17A 2R072 2DAOA 3PFIA 4KU7A 3DBLB 1UPIA 1FLIA 3KP3A 2O8KA 4NDLA 5EWSA 3W5MA 3F8NA 3B01A 4FI9A 1V5GA 4F3JA 3VBSB 4OMCA 5C8CB 1XB9A 1P6RA 1ZLJA 4PCRA 4NVPA 3FHZA 2AH2A 5KC6A 3ZSEA 2L3DA 1OUXA 4B4CA 1BEV1 3BDDA 5AONA 3S2HJ 3CU7A 5A33A 3L2UA 4PSWA 5BUVA 2VMGA 4BHPA 4ATFA 2R7VA 3WU2C 1Y7BA 1ZZ8A 4XMAA 3QAHA 2D43A 4AQTA 3ZYGA 2DJNA 3ZFFC 3ZYFA 1SLIA 4RSUA 1PJRA 2HOAA 2EICA 4EQVA 3K69A 2PLYA 5AIQA 5FOJB 5CFCA 4B3NA 4DOUA 4HOOA 3W6VA 3GTJJ 3O7OA 1QJFA 2HI3A 3O1SA 1OCZH 3VHPA 1QGLA 4F91B 2E1MC 1FSHA 1QRYA 4J25A 5FP3A 1O8SA 2BOIA 2QZ8A 2UWCA 4EN0A 2QM3A 1Z9CA 2YXSA 5HODA 4A3XA 5A2QZ 4OHZA 3W9AA 3P9KA 5IP6A 2Y2ZA 1GOGA 1QMJA 2ETEA 2LY9A 2AXLA 1RVF1 4XABA 4I02A 2AC1A 1TWCJ 3GX4X 5FLMJ 5BNQA 2V79A 3H3VK 4EYUA 1NCRB 2YPRA 2PYTA 3MPBA 4HK9A 3CQOA 1BL0A 3J8F1 3NRUA 5JVVA 4XTPA 3OL3A 2O5RA 1G8XA 1WLWA 2FOKA 1KS4A 4CZCA 3RMXA 3ACIA 1G4DA 3PIPF 1NCQC 4K3UA 4OI4A 2JDKA 3RKXA 5FPXA 1J84A 1F15A 1XGSA 1TQMA 2BBVA 3K4MA 5FRAA 5DAQA 2KRFA 3NL1A 2D6NA 3N9LA 4IRHA 1PGL1 5LGTA 5GM0A 1AXYA 3ZXKA 5EZHA 1A8DA 1QGPA 2F4PA 4Y1XA 1WJAA 3CKHA 1J58A 4A6EA 1H9PA 3OY9A 3M7AA 2E7TA 1JZ8A 1A6CA 1WCDJ 4NROA 1JXNA 5IYDJ 2ZAHA 2R0FA 1O4YA 3PJQA 3KHCA 4XJ9A 2K46A 1Q8SA 1GBGA 3HRTA 2GC3A 2QQIA 3AP7A 4XKVA 3V7RA 4CU9A 5FZ6A 3MZ8A 2ERFA 1BXHA 4LT5A 4PIYA 4HKWA 4BY1J 1U9NA 1BVP1 1UPSA 4QGLA 2XKPA 2OA4A 3JRAA 3RS6A 5M3FJ 5FY4A 5FD5A 3O1UA 3NJZA 2XGCA 1ZZ6A 1DHKB 4F8AA 3CMEI 4RAYA 3H9AA 2OKXA 4M9ZA 4Z1VA 3LAGA 1X3WB 5IVVA 4YVWB 3IAM2 1F4AA 2P6HA 4LPLA 3RZDJ 1NKGA 3LDRA 2EV5A 1MQTB 3JRHA 3HOTA 1Y4WA 4Q4Y3 2HS5A 2NS7A 2D6LX 4WVMA 5T5OA 5B3SH 4C1XA 3OEAA 1RUF3 3H1WA 2CO5A 1G9CA 4AYBA 2BV4A 4Z07A 1LEAA 1UKGA 1XE0A 4AFMA 3CZ6A 1JYVA 1AR73 4HSRA 2P8TA 5E88A 3O8GA 4Q4Y2 1QOTA 2CWSA 2BXZA 4Y33A 1QQP1 3TN91 4IF4A 1RUF2 2RGVA 3B02A 1X1AA 1VTNC 1QF3A 1H2NA 5GZFA 4B1MA 3DV8A 1RUJ2 2WJSA 1RPWA 1UX6A 2O14A 3GZTB 3WTSC 3C7GA 4YRVA 4NHLA 2GIVA 1SMTA 5FY0A 1I1SA 3WF3A 4BLJA 4GH4C 2P81A 3F6VA 2P0WA 3M1EA 1K6YA 5IW0A 1D8KA 5JOXA 4GMP1 3DEWA 4D69A 2FJ1A 1WFXA 4X6RB 4DIQA 3C8XA 2PJPA 5E18F 3KT4A 1OKRA 4JVAA 5JOWA 3EQEA 1J3RA 4AFDA 4S2DA 4PI0A 5H9PA 3BR1A 1X1PA 5M5YJ 4B1LA 3K4JA 1XOYA 1DYOA 5DD4A 1RL3A 4RFRB 2WO3A 3BQYA 4CCNA 1HB3A 4A5MA 1A78A 1UD1A 1XNDA 2HWB3 3K1NA 4JOMA 5EGOB 1RUI1 2NNYA 4BJTA 4KT6A 3RNSA 1YRZA 2XHNA 1J9IA 2Y6FA 3VL8A 1GV5A 1OA4A 4Q1RA 2VC1A 4UB6C 3TB0A 3CJRB 1X19A 1SLBA 3IKWA 2VJJA 4OIQF 2VECA 5K1YA 4NIDA 4ZHNA 4JV4A 5CA6A 5J48A 2HWB2 3HGGA 3PNYA 2C6YA 3RKQA 2EV0A 2EINH 3NMBA 3NQHA 4CDWA 3O0VA 4HSLA 2VCAA 4Q4X3 1SDDB 3I2DA 3W2VA 1H30A 4PJYA 3VPRA 2KISA 2ZAAA 2HWD1 1X1BA 5IY5H 4FCAA 4KH9A 4WX9A 4RHV2 1QXRA 1AHSA 4J19A 1K78B 3I7DA 1MNEA 4IUGA 5LA1A 3RIRA 2NMNA 1AX1A 4BQWA 1JOPA 1QU0A 3WNPA 5SV5A 5EZWA 3PUSA 4FQZA 3H3ZA 3HVDA 4Q4X2 3EUHC 2KXLA 2O61A 4LK6A 4HF1A 2Q1ZB 3KCCA 1CX4A 4FFIA 1O91A 3L9FA 4JKMA 1E2XA 2FA5A 4NPLA 3ZSMA 5FY5A 3OUHA 2V1NA 1V00A 2BGPA 3TOAA 3NAPB 1V5FA 1T39A 4PBOA 1SACA 5L3EA 2VVEA 2RDSA 1MZBA 2ID4A 2HWE1 3A01B 1AUYA 2Y0IA 3VD9A 5J96B 3E6DA 2RVAA 3SLIA 1H6YA 2YU2A 3POGA 1K4SA 2VH9A 1UOGA 2JG9C 3HC7A 3QLQA 4RN5A 2BDRA 1DF0A 4JGZA 4N53C 4ZZDA 1D0ZA 4FPHA 3GZEA 3L9JT 1HRI1 1I27A 2OD5A 4F55A 4GRIA 5FK8A 3ZFGB 1CAVA 1UU4A 1V9U1 3JZVA 2VXJA 5GAHJ 1HOMA 5JIUA 1H9TA 3T0YA 2L9NA 2IXHA 4I7HA 4E2QA 2ECCA 3J7LA 3RMYA 1YJLA 3DFGA 2RMU3 2BGCA 3A21A 5A3OA 5DAXA 1UHWA 2ZGKA 4EN8B 3MBWA 1WRJA 4Y26A 1IOAA 2FBEA 1IN6A 4F7ZA 1OHFA 4OU0A 3ERED 5FZ8A 2ARAA 4BK4A 3U11A 4AFCA 2R1BA 1OF3A 1VB4A 3HL2A 3IH2A 2XAHA 5J8CA 2FU4A 2YDEA 3SH4A 1OSGA 5FP7A 2KHMA 4XBNA 2J5OA 3SZPA 5L7OA 2WFF3 1HXDA 5E8AA 3WF4A 3O0XA 3D5LA 2W1UA 1TNFA 2QA4I 1Z6RA 4WCGA 4K8FA 1JGSA 5C3OA 3EYIA 4LLOA 1ENRA 5HLGA 1UELB 5IJRA 4XAAA 4XF4A 3WG9A 2XIGA 1V5EA 3ZQCA 3O8HA 4Q0PA 2R6QA 1I50J 1F43A 4BE3A 3BCBA 4BXXJ 1MVQA 1T8IA 5FK7A 4O3MA 3ZMDA 2JDMA 5ACA3 5FO7B 2M0CA 3QH7A 2RDPA 1YJNI 3T2PA 4YW2A 2GH8A 3ABUA 3OIPA 3USSA 1WMEA 2WC2A 2BXYA 4N7UA 1DU6A 5GLUA 3ZN6B 3GHNA 1Y3TA 5DCMB 1ASJ3 3DPRC 2XSDC 2X29A 2VR4A 3V8LA 3TL4X 2QCSB 4A3DJ 5DUKA 3U2RA 2IUWA 3BYWA 4QDSA 1QZEA 2Q1FA 3HTUA 4CDUC 4LJHA 2CV6A 4AQ2A 2LW8A 1ZA4A 4ZZLA 3VOEA 4YEJA 1LHUA 5IP9J 1OCPA 2WSVA 1QWRA 5FPZA 5C70A 2CQQA 5E3NA 1ETKA 5FMOS 4GGGA 1XPXA 5DDJ3 1ASJ2 2AUYA 3GNEA 3W20A 3LSMA 4AHXA 3VN4A 1B59A 1Z0HA 2Q0AA 2B42B 2RS52 2WAFA 4UT5A 2FRHA 1LOCA 5E1RA 4UF0B 3GF6A 2XJQA 4L97A 2RM22 5CKMA 2R041 1PM7A 1W04A 5J3LA 1SZBA 3AX4A 2WZEA 2PHXA 4EJRA 1FPQA 5H6QA 3DYMA 3ACGA 3S0MA 4RGAA 5DDJ2 2J1AA 2H1LA 4N0BA 3TEYA 2D1VA 4HL0A 4LK7A 1K5MA 1EUTA 2A3SA 2WABA 2WT1A 4DFSA 1V6LA 3WHBA 2HWC3 3H5NA 4P9JA 3L09A 1ACIA 2E31A 2VUJA 3A0KA 4XIKA 3GGLA 4F52A 1RXGA 4EM0B 1HLCA 1MZ6A 2HKOA 2ZGTA 4OMYA 3GTOJ 1AR81 1MBFA 1TVGA 4ENJA 4AEJA 1OA2A 1BI3A 2PQ8A 5JI7A 2HWC2 2VPVA 2XF5A 4CH7A 3FE5A 3K4NA 1XXNA 3IAS2 1ODDA 5D6FA 5J8FA 3KYLA 4WM8B 1SFPA 1JKOC 2VL4A 5HS8A 2QQNA 1EF4A 3QD6A 3SCFA 1XSXA 3NWKA 5FLVA 4Y3OA 3MVPA 4HG2A 3T1BA 4C3HJ 1D5YA 1OLRA 1NZIA 2OPTA 1DIWA 3MFKA 1BJQA 1YCIA 4M74A 1MEC3 2CW8A 4CXWA 3ZSKA 2ORXA 4R9DA 5D8LB 3GCMA 2BRTA 3V65A 3IC7A 4WVWA 1ENXA 1MPXA 1R5ID 2C6SA 2D5VA 5BNPA 2ZGOA 5J3UA 1R22A 3CCRI 3EXUA 1FYLA 1MS5A 5KR7A 4UW4A 3GMEA 2HWF3 3IHUA 3KEQA 4KGQA 2VY0A 2ZHKA 1MEC2 1XNTA 3LGRA 1HXS2 4UBGA 5LBEA 3WDXA 4BBSJ 4UBHA 4IHWA 2VBBA 5A7OA 4ZU7A 4UNOA 3U1XA 1COV1 3BCAA 5HLHA 5KBFA 4BE2A 3DCQA 3MCZA 2X85A 4I3GA 4GMP0 1ND2A 4AD9A 2W52A 1RUE3 1EH7A 1HB1A 2HWF2 2F2EA 4OI0A 1R9TJ 3FN9A 4AG4A 3I53A 2LROA 2DJIA 5I0RA 5FZCA 2HDWA 4XIDA 5T52A 2M4KA 4E9KA 4CRQA 3BJAA 5FZMA 1HDPA 2VXZA 2SBAA 4FPOB 1D1CA 5FIXA 3K6GA 3MKLA 2G4IA 4HN1A 4OQ9A 2X4HA 3OR1C 4C0BA 3DCFA 3RJPA 1G9FA 3WNXA 3W5NA 4QWQA 4OINF 1JKPC 1Z78A 2V7FA 2WDBA 4BJ5C 2Q8DA 4XM3A 3RZGA 3JBG1 3LE0A 3FXKA 2H27A 1D0HA 2AZ5A 4XLPF 1DP3A 3OSGA 2K3PA 1AHDP 5DCFA 3KYCB 1JI6A 4AVAA 1MMAA 2HKXA 3JTGA 2EF6A 4A3GJ 2QBYA 1XNKA 4LOTA 5FKBA 4WF2A 2DN0A 3AP5A 3N4MA 2M0MA 4BDYA 1U5TC 2WNVB 4GA9A 2VBXA 5L3CA 3WNKA 4LLNA 4L5JA 4PJ0C 4FQ4A 3PU8A 2J42A 4LE3A 3T5XA 1OURA 4AXOA 2CRGA 5HCFA 1U5IA 3EUAA 1W2TA 3GBGA 1ETOA 3BG9A 4X6QB 1VQMI 4GZ9A 3CJQB 3MF9A 4CDXC 3DWLE 2PMZN 3IL2A 3FUQA 3NRVA 4NHKA 4L8QA 4ZTJA 2QQBA 3ZSJA 1I5PA 2O8OA 3LEIA 3LOIA 3RPUA 1N78A 3Q0VA 2ZB9A 5BS6A 4LKDA 1HW1A 3LAPA 1GQPA 2YU3A 3AKPA 5F3EA 3GUDA 2NVUB 2P17A 3J9SA 2PA7A 1H4GA 5LA9A 4Q5SF 1XCBA 1IRGA 1CPNA 4E2SA 1I39A 2VQTA 4AVTA 4ZXEA 4WM7B 4AYBN 1K83J 4S2GA 3QU6A 3GVAA 5FYVA 5A7QA 1NY72 2ZGRA 2WY8Q 5K0UB 3U21A 3WG7H 1VE0A 2CUJA 4OHWA 1QEXA 2QSGX 3UETA 3ZMUA 4FTSA 2QFEA 1PIV2 3PL0A 4AVBA 3OPZA 3PNTA 1H88C 2Y75A 3ZN0A 1WCQA 3ZXEA 2B5HA 3KV5A 2EIJH 1BMV1 2B9UA 1D2SA 4XJWA 1BM9A 2DTRA 3FLTA 4FAHA 2DUOA 2QJVA 4LKSA 1GT0C 2TDXA 2W1QA 5IVFA 4QLCU 3V56A 1T33A 5C4WA 4E7ZA 2WIIB 1ZG5A 4CU6A 4XAEA 3QYFA 5IVJA 2ZKLA 1ZA7A 4G9SB 3VBOA 3EQLF 2RHPA 3J80Z 2H1KA 2EAAA 5IWFA 4YGEA 2L9SA 3EHKA 5DAPA 1PMJX 3CJNA 1XSQA 2HTSA 1UN1A 2OTLI 3G2BA 3IBMA 3ZSLA 1EKEA 3FXLA 4IX7A 1UNBA 2YBKA 3ABLH 3DKQA 4YW4A 3BZ6A 2P3YA 5B4NA 1FTTA 2CUZA 4O7XA 2HXIA 2EFWA 1KGYA 1W9TA 5L36A 5IVCA 4P9LA 1EUUA 3VDCA 1XGMA 1VF9A 2VQCA 2XVGA 2CW0F 3OB8A 4A6DA 2XAFA 1GMMA 4RS5A 5A7SA 3VHNA 3NW4A 4W6YA 2KT0A 1PO22 1UYXA 5HXMA 1KU7A 4UY8I 1CWPA 3AKTA 3IPVA 3FBYA 1LESA 1Z7UA 4ZJZA 1VBA3 4UUVA 4G6DA 2DPUA 1WJCA 3OYKA 3JQXA 1DQ5A 2VPRA 2YBSA 3D4KA 4YG2F 3U75A 4KG8A 1GU3A 3THTA 2UWMA 3KZ4C 4MFDA 2R7SA 4QDQA 4Y7NJ 3KD4A 1P8JA 5BNNC 2JB4A 3WDWA 4A0YA 2F5DA 3BT9A 1KEXA 2E1NA 2XROA 2GNTA 4AHZA 3M8EA 1GXPA 4AGGA 1LVAA 4GB33 4IEVA 4FE4A 4E7KA 4MV2A 1OBNA 3HOVJ 2IA0A 1X2MA 4KGGA 4JX4A 4XHBA 3LSKA 4G8XA 3T0BA 1PVXA 3RKWA 2WS93 1QVUA 2DFCA 3PVBB 3AMPA 2PMHA 1R1ZA 3M3OA 5LW9A 5EXOA 3HAGA 4B3AA 2YYOA 3D5RC 5EHDA 1H1MA 1RRJA 4BQ5A 2PAEA 5CNAA 1DLLA 4GB32 4L99A 1S5LC 3THCA 1F5JA 5FZOA 4XXAA 1CAWB 5C8CA 5FB2A 1TE1B 1C3HA 3T08A 1ZYRF 5FZ9A 5KHJA 3FXQA 5K5RA 2WS92 1OUSA 4XF9A 2R30A 1V54H 5TGTA 4RA0A 2NVQJ 4AI1A 1A35A 2JDPA 3OGRA 3Q9OA 4Q8KA 3TOBA 2R7TA 2KLOA 2Z2SB 4QX8A 5HV0A 3WDUA 2CDPA 2JA6J 3NNGA 3V4GA 4CYDA 1NAEA 1Y1WJ 4QPYA 4QHBA 2HWVA 3PVOA 4M4PA 2LKSA 3WF1A 1ENQA 3LCPA 2WKKA 2XAQA 5CKTA 3Q8CA 3EJKA 1WH7A 4PDWB 2CWEA 3AKZA 2VMCA 4D94A 2QQOA 1JTZX 3QQAA 4LHLA 4CZSA 2V6CA 1WCUA 4YZ3A 3SQNA 1QXPA 2WZPP 4CSWA 4HPKA 3TEZA 1VIWB 2XF7A 4CCMA 2EXJA 2Y0SA 3MUZ1 1IUYA 2FCTA 2XAJA 3VFZA 3Q0UA 4PCQA 4TLGA 1LEBA 4Y5TA 2LY1A 1OOPB 5HLIA 2YC4A 3CMGA 4XCAA 2WZR3 1P9QC 2BEOA 3POIA 3EUHA 2DU1A 3HRSA 4HZFA 2L7MP 2VIXA 2E7WA 3A2KA 1UOJA 4EGYA 2QCOA 1RJ7A 1OD5A 2WFPA 2HYKA 2W4SA 2TRTA 4QM9A 1JYWA 2CNAA 4EQQA 3IH4A 3S7EA 2VBZA 2C1FA 2W91A 3UK9A 3DL3A 2FDGA 2UV1A 3EYYA 4U0WA 1E5RA 2JG8B 3H0OA 2XPJA 2D6OX 1HB2A 3WEZA 3M1CA 2EA4A 5GAEJ 1H2MA 4ARXA 5HPOA 1ZH5A 1TWFJ 1C57A 3OIQA 4NWWA 3BTJA 2WNUC 2X05A 5F5CA 5D5VB 1NG0A 1GUUA 1F9NA 1HRV1 2JG9A 1YEWA 3GTMJ 1S0GA 3FHQA 3FMRA 2RR13 4KWKA 4N53A 3HBKA 3OY8B 3AB0A 2Z99A 5GJ6A 3RZLA 3FHAA 4B4QA 5IYCJ 1TMF1 2ADEA 2HGCA 1BJAA 3AKSA 3ELKA 4LIUA 4ZZ5A 2Q8EA 2YC2A 1SD4A 1WJ5A 4XFCA 2VBYA 1LE8A 2ZX3A 4KIGA 1OR7C 2RR12 4P14A 1PO13 4EWDA 1RUH3 3K75B 4C2MJ 5D4RA 2OQRA 1CESA 5ED4A 2VASA 3CIHA 4DXZA 4PF1A 3QYEA 4XLNF 1ZBE2 2OXBA 2CU5A 2PN5A 4YVWA 1AR61 2PLV1 1HV0A 4E4DX 1QIQA 5FPVA 4NUBA 1FPN3 2HQRA 3DYOA 5GZGA 1PO12 1Q8VA 1STZA 4W8JA 4UHTA 1RUH2 3WW3A 5FZIA 1IXCA 4NMIA 2L01A 3PQKA 3FWEA 4MH0E 5A7PA 5K5OA 3OOXA 2CGNA 2VZPA 5EJ1B 4MIMA 4XICA 1AYN1 3S7IA 4AEDB 2P6SA 3A22A 1FPN2 1VBB2 5C5UA 4E8CA 4IPAA 2EH3A 3BVCA 3FX3A 2PHUA 3MW2A 4CDGA 1Z7S3 1WW7A 1TME1 4DRVA 3WTXC 2D6PA 2NS0A 1JYIA 1IRXA 2Y48A 1RMU1 4OHVA 1LUJB 3BLYA 4KJZA 3OBAA 5FDBA 1OF4A 4ORFA 2CYFA 1JYTA 2CQNA 4UOJA 3SHRA 1FI2A 3WU0A 5GLWA 3SXWA 3A0HC 4FSJA 1VRH1 3DBHB 4QB2A 3BY6A 4GULA 3SNMA 2YX7A 2DVAA 3V0AA 5FZ7A 3VYSB 3ZFEC 5C4XJ 1FNYA 4L0PA 2R5ZB 4BDZA 3GJAA 3S17J 4Q2FA 4D7YA 2R7QA 1GDTA 3HPHA 1QA6A 3M8LA 2ZJPF 1BK0A 3WT3A 4RGGA 1MJ9A 1D4M2 2SLIA 3HTSB 3IDBB 1OISA 2M3AA 1IW7F 1C8M1 2VMEA 1PK6B 4WWCA 4Y20B 4DEVA 1DG6A 4E27A 1GOFA 1YO5C 5LBQA 4KMQA 2O8QA 1ZRDA 3GW2A 3HUGA 1VAVA 3WINE 4IKFA 2XWJB 4NE9A 1GICA 2Z79A 2G9FA 1KU3A 2KRCA 5H6RA 4B09A 5D6EA 1ENHA 3OGJA 4IW3A 1POV1 3L2HA 1JT0A 2JRMA 3FUOA 1WQ2A 1UW8A 3BTLA 4XKCA 3SDBA 4W6WA 2ZHNA 2HYXA 4NWVA 5APAA 4I0BA 3HXLA 1BEV3 3IDEA 2IW5A 4XE9A 4XBLA 4YZ4A 2ZZQA 2PEXA 1OYIA 4XYXA 5H9RA 2GAUA 4E70A 3WQBA 5FYMA 1GP6A 3TBDA 3AP9A 3ACLA 3FMGA 2EIGA 2QYOA 3HNBM 3AMNA 3O12A 1ZGWA 1YTYA 1FOD1 1UYPA 4BQQA 3HJRA 4M9XA 3QPHA 1YS6A 1LOAA 4BDVB 1D0GA 1BEV2 1WBFA 3B94A 5EF6A 3Q8FA 2JPCA 2GNDA 3KEOA 3POFA 5FP4A 2HEWF 4K20A 3PQJA 2YFZA 1DQ4A 1MH3A 4Y22A 3ME2A 2P4WA 2K3FA 1SFNA 4XHXA 2D7FA 1YI7A 2IPQX 1W1WE 2OT7A 5FLXZ 3ES1A 1WKMA 3LIGA 3NKGA 4RQPB 4XC9A 4OI2A 4BQ4A 3A01A 5FQ0B 3VBRC 4IV3B 1HJGA 3LNQA 3DEUA 2GXGA 3RWKX 4MO7A 4Y17A 3BTYA 2KIMA 2PFWA 3IB3A 5F64A 2VMFA 1JUSA 2EK5A 1ZG1A 4BEHA 2H8RA 3U14A 5JZGB 4NHMA 4EVIA 5BY5A 1E17A 3ZOBA 1GZWA 2QNKA 4XPVA 1ULPA 2JKBA 4IQ4A 3ZPYA 1WUVA 3U07A 4FFHA 2WN2A 3SEZA 2LH9A 3J8F2 2ZNZA 4FT8A 5HDKA 4IZZA 3P3PA 3RKYA 1AL21 2X1CA 2O0OA 4BHCA 2LVSA 2W9XA 4JGYB 4BQ2A 2NN8A 2PFBA 1QNWA 3WP5A 4YZ1A 4IEXA 4ZTFA 5ERLA 3GTQJ 3VHRA 2K27A 3ZMOA 5C3RA 3ZN4A 4BHBA 1PGL2 4DOZA 5AVAA 4DJAA 1J2XA 4N43C 4MXWB 4QPIC 1X33A 3HN3A 1SFXA 1URXA 2WA3A 4OULA 2P5LC 4LKFA 2IEKA 1ITYA 3I0TA 5IYBJ 4DQ2A 2W94A 1TWHJ 5I0TA 2JECA 4YGCA 4IETA 3A03A 3GYHX 2A07F 1Z0XA 5FZHA 3KP7A 2ZACA 4JCKA 1U5ZA 4PQQA 1D0YA 1S0EA 5FFOC 4U88A 1BIBA 3NNJA 2JJ7A 4U0VA 1MR5A 3NWSA 1U5TA 1GP4A 1IV8A 5A7NA 4QQOA 3RYRA 4DYQA 5A33B 1S7OA 4D0PA 1QJU3 3VKLA 2MGQA 3QPSA 6PAXA 3CCMI 4HNVA 1FP1D 1SDWA 5FXVA 3RYKA 1QPIA 4CDXA 2V72A 1SEFA 4EM1A 1OVPA 2PN6A 1FMD1 1UZYA 1SBFA 3TP0A 5J7MA 4PF5A 4LO8A 2VMHA 3QCWA 2FMLA 3OIOA 1LHOA 3CLPA 5CFCB 4AU7A 3HG9A 3NKTA 1U2WA 3K3NA 4LB5A 2HJIA 5K7PA 4XW3A 2CAUA 3LSTA 3DPLC 1ZK8A 3H1YA 3U78A 3U1DA 1H8AC 1PUEE 1ZREA 1ULEA 2WZ8A 3DXJF 5FMOL 3ZYJB 1IAWA 5CFDC 3OSFA 1R091 1KYWA 3X29B 4OQ8A 4CXFA 2DVGA 3K1MA 5B5EC 4A3JJ 2VU9A 5E16A 4QX0A 1IS3A 1C0WA 2GBYA 4BE1A 1SD5A 1JHFA 4COZA 1NOVA 1MNDA 3FZVA 3QBQA 1TTYA 4Q48A 1T2KA 1ND3C 3VBHC 4YIIA 2CU7A 3KP2A 3AYDA 3SEEA 3TEWA 2DT7B 5F1RA 4JHZA 5I8YA 2M9HA 4XJUA 2YUEA 5A6XA 3E3VA 1T6SA 1R7JA 5FOBB 2ZGNA 4NIHA 3GTKJ 4XQ4A 4LIVA 4AHYA 1DYPA 5CQGA 3AL5A 5H9SA 1IXRC 4YW6A 2HEOA 5CVVA 1ON1A 4LQRA 3BG3A 1CPMA 1JKRC 4AEMA 2VB6A 1F4HA 1QHDA 2XPVA 1RUI3 4XUPA 2BNOA 1NG7A 2VNVA 1BR2A 3WG3A 1Y0UA 2GNMA 4DS0A 2GA1A 5DDGA 4MZUA 5HOOA 1YI9A 5H20A 3ZMTA 1W0OA 1JZ5A 4CCOA 2RS33 5K9YA 2QLZA 4XDQA 4LE4A 3NAPC 2DA3A 1HN0A 1FV2A 3AFHA 1RUI2 4AWDA 2MC4A 1JJ6C 1W6QA 4NPMA 1IN8A 3LSJA 1OCCH 4A12A 4LR4A 1XU1A 1KU2A 5IT3A 3WNMA 4B3XA 1H9WA 1IO2A 2ZEWA 3N9OA 3MPPG 2JTVA 1S9HA 2ZC2A 5KHDA 5LFAA 2VAUA 5J09A 4YM2A 2PX9A 3RZMA 3UKTA 3KSCA 2WV0A 3K10A 4XZPA 4AC0A 1UMZA 3ZFGC 4OUSA 2R0QC 2XDVA 3GLXA 4HW0A 1OPCA 4A0XA 2KFDA 4WVMB 3SZGA 2DI3A 3OYGA 3DQVC 2E2HJ 1XSDA 2YV8A 4OAYA 2O9LA 1NA1C 1EV7A 2XL7A 4PHZA 3LFKA 3CD6I 5DG2A 3ORJA 3OBTA 3HRUA 1X8MA 2NM1A 2YU1A 2EALA 3F72A 2DMQA 1ZM1A 2HPIA 4C2UA 4HVRA 2WWUA 5L9RA 2VJ5A 2VVFA 2GQQA 2DYCA 4AAPA 4NAMA 3J7AY 4CP2A 2BZDA 2HQAA 4X8NA 2DQLA 2VNGA 2BWAA 2DCZA 3AZYA 2CSGA 2V5YA 2BWCA 1BQPA 1VLNA 3GTPJ 2DT5A 2R061 3TRSB 3D3AA 1DP7P 4N4OB 4DB5A 1NLSA 4BM8A 3HB9A 1V9U3 5FKLA 1LU1A 3GHMA 3PIGA 4HONA 3HR9A 1NK3P 1USTA 1DGWY 2BUKA 1XC5A 3H5RA 4YSFA 3HPGA 4MYEA 2JT1A 2D40A 2VZ3A 1KYZA 4MGSA 3DPUA 1CX1A 5BPDA 1W8HA 4RB0A 3OSDA 2VJIA 4AI3A 4QKDA 2LOOA 4BH9A 3VV1A 4BOWA 1TQPA 5I93A 1BCXA 1V9U2 5DN2A 4G12A 1RHI1 5FYHA 2E32A 4ZYHA 1L0OC 1TBXA 1O8PA 3FKJA 2R4GA 4C0HA 2BOJA 3WTVC 1SG3A 3MW4A 1LCLA 2ZTNA 5CU1A 1OPOA 2R0HA 3ZYHA 1ZR4A 2WB1A 4EGZA 3RG0A 1AYM1 4NC8A 2CTVA 2FDJA 3N7KA 1DPRA 4RR3B 1PVC1 5DUVA 1QNYA 2C5DA 2RNGA 1NLQA 4EN7B 2VQGA 3CUQB 2V1UA 4YGBA 2JIJA 5FFZA 4YIFA 4EEFG 1B9NA 3VYRB 3L2CA 1BBT1 1V6IA 1OD3A 3V7CA 4NPRA 3JRFA 1Q1VA 1GVJA 2KZVA 3A7QA 3AG2H 2YS9A 2FQ3A 3I2GA 3WF2A 1ST8A 3NJYA 1D5VA 2DK8A 4XFIA 2W1WA 5T55A 2EILH 1QH6A 2HOEA 5DZGA 3PJYA 1W6NB 3JREA 1I3AA 3FLPA 3O5SA 4TWTA 5DG1A 1PUFA 4Q8LA 4QGNA 5IAVA 2A6EF 2EQRA 1G3TA 2W2IA 3LIHA 5GLTA 4KBZA 2FEZA 4RS8A 4UV8A 1MVEA 2Y33A 4ITCA 2VUDA 3I3BA 2WNUA 3MKYB 1R23A 1BW5A 2XVLA 4TSVA 3MI8A 3FMSA 4AFBA 4P9UA 4LULA 2W0XA 3L00A 5CISA 2DA2A 4JRAA 3L2WA 5JSPA 1UG2A 1UU6A 2D93A 1F5FA 2DFBA 3M8JA 2CV2A 1Y39A 1B4AA 2KL4A 5FYTA 1SVLA 1LOFA 1FOKA 4O65A 1H89C 3TO6A 3BC8A 1MS8A 4JGZB 3LF7A 1JOJA 2X53S 3GZNB 3K4CA 1VRBA 2Q4SA 4KNCA 1WSUA 1UMQA 4L5IA 1R1A1 3K4BA 4XRFA 2DVBA 5F0HA 2OA2A 4JTNA 1KRIA 2YMZA 1QZZA 2BNMA 1V70A 5D8AC 3LQRA 2R042 1GSLA 4FP3A 1Z05A 2MABA 1YFWA 1W0PA 4U7DA 4ENNA 2FSWA 4H3WA 4Y13A 3JRIA 2AR6A 4UI9L 3KLNA 3ROUA 4B1RA 2JDAA 4ESBA 2VQ0A 5L3BA 3S1QJ 1AR83 2ELHA 4JBAA 3QP5A 1RIRA 2VCBA 3CJXA 4RGKA 4K1ZA 5DUXA 1JYXA 4XF1A 5LASA 4GQ7A 1VBD3 3CDIA 3TQNA 3ABMH 2ZMLA 4M72A 3I71A 4MVTA 3KWVA 2Z5WA 2NZ9A 3BJOA 4HYEA 2NVYJ 3W58A 2UXNA 5BNOB 4CTEA 1PMIA 4NC6A 1UIKA 5L7OB 3WE2A 1AR82 2DTWA 3J7AO 4AIKA 4SBVA 2MPFA 4NB5A 2A3XA 3JTHA 1MNMC 3EO6A 3F3XA 3R61A 2XBO3 1A5JA 4B4RA 1BR1A 1XN7A 1K5JA 1FBUA 4KYWA 3E1SA 4CCDA 4IDZA 4YYOA 4COYA 5M3MJ 4LBKA 2R7OA 2P6TA 3ZFEA 4AFAA 2XBO2 5EQUA 3RSNA 4FOVA 2L5QA 1OYWA 2CMPA 1H8TC 5E3LA 3N35A 1YHFA 3Q8EA 5FJHA 2IFRA 1UHSA 4Z6YA 4D7NA 3WNLA 3OR2C 1XGOA 2AQEA 1IHMA 3VDDC 2Y9ZA 5J98B 5A1AA 2A5YB 3QPTA 2W92A 3OOUA 3B7MA 1FBSA 4CCLA 2ZJCA 1COV3 2HYFA 2WNVC