4OFGA

Co-crystal structure of carboxy cgmp binding domain of plasmodium falciparum pkg with cgmp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
b'DASIDYNNKKSIIKKMYIFRYLTDKQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEIVKNKKRLRTLGKNDYFGERALLYDEPRTASVISKVNNVECWFVDKSVFLQIIQGPMLAHLEERIKMQDTKVEMDELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CGMP-dependent protein kinase
publication title Crystal Structures of the Carboxyl cGMP Binding Domain of the Plasmodium falciparum cGMP-dependent Protein Kinase Reveal a Novel Capping Triad Crucial for Merozoite Egress.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 44
structure length 142
sequence length 142
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ofgA00
3GBFA 2E9QA 3E6BA 5BUVA 3KSCA 3MPBA 2K0GA 4QMAA 3CF6E 1UCXA 1YHFA 4KL1A 2I45A 3D82A 4L11A 2Q4SA 4BH9A 1DGRA 1QXRA 2D40A 4MGKE 1J58A 4Q29A 2Z69A 2PA7A 1CAUB 1VR3A 3UKTA 2QCSB 2FMYA 3I54A 4LEJA 1LB2A 1QXJA 5D1IA 1UIKA 1Q3EA 5KHKA 5FLHA 3IDBB 3UKVA 5JSPA 5EFUA 4LA3A 2GAUA 3WW1A 1LRHA 2Q0AA 2CAVA 3LA7A 4MGIE 4PIXA 1ZVFA 1GQHA 3GYDA 4PIYA 5KHGA 4GULA 3SCHA 4IETA 4O9GA 3USSA 2HJIA 2N7GA 4KWKA 2B9UA 4H7LA 1NE6A 4HSJA 2EAAA 2PAMA 4WZCA 3FFQA 1XRUA 2H6CA 4JV4A 4XF1A 4XFAA 1RUNA 4XFHA 4QGMA 2XLGA 3ETQA 1NE4A 4ONUA 1I6XA 4HSLA 4XF0A 3PLQA 4IESA 4QX5A 4XF9A 3H7YA 3I59A 3RYKA 2O8QA 3HIFA 3H1WA 5CU1A 1CGPA 1Y3TA 4KU8A 4KWLA 1UD1A 3ST7A 1J3RA 1VJ2A 4FT8A 5LEJA 1GQGA 2QDRA 1ZRDA 2PQQA 4IEZA 1CAVA 5I91A 4MV2A 4HMZA 1NZCA 1RTVA 3ACLA 4AVCA 5CVRA 1J59A 4Q0VA 1XE7A 3I59B 3KGZA 4YNIA 1U12A 3CO2A 4UBHA 2GU9A 2KXLA 2Z2SB 5EZWA 4I0AA 4HBNA 2GC1A 1CAVB 4E2QA 1RL3A 4AQ2A 4R52A 4YRDA 1XE8A 3FE5A 3RYPA 3BPZA 4LA2A 1RUOA 3HT1A 1CAXA 4Z07A 2PYTA 1WLTA 3EO6A 2GC3A 1IPKA 4IEXA 4LTAA 1YLLA 3FHIB 1ZRRA 4N9HA 3N4MA 1IPJA 1OD5A 5KHHA 4AVAA 3M70A 5FDBA 1ZZ9A 3EJKA 1O7FA 2XKOA 4X6QB 3I7DA 3L2HA 1UW8A 4DINB 4ZU7A 4IEQA 3DKWA 5FCCA 2GC2A 3H3UA 1JUHA 1CAXB 3E97A 3E5XA 1YWKA 4J1XA 4CYDA 4IEWA 5FLIA 1X7NA 5J3UA 4Q0SA 3G7DA 3S7IA 2BYVE 4UBGA 2BNOA 1TQ5A 5JAXA 4R8HA 2IXHA 5T3NA 5BXXA 4HZFA 5BY5A 3WW3A 1ZNPA 3CL1A 2VECA 3DL3A 5FQ0A 4AXOA 4FAHA 4FAGA 5F1RA 2IC1A 5JSRA 3CJXA 3OF1A 1SQ4A 4XFIA 4P9GA 1X8MA 1YFWA 3WW2A 1EP0A 4JTNA 3QACA 4B29A 1WGPA 4EWEA 1O3QA 4YSFA 1WA4A 1QY4A 2UYAA 3E6CC 1RC6A 2Q1ZB 2ET1A 1O3RA 2PTMA 3SCFA 4JTOA 4PJYA 5FQ0B 4HLTA 1DZTA 2UY9A 5C6CA 3IWZA 1ZZBA 3H1MA 5KBFA 2UYBA 1YFYA 3ES1A 4ORFA 5I8SA 3RDIA 5I0RA 2C0ZA 3ES4A 1SFNA 4MZUA 3EHKA 4QM9A 4D7TA 5LEKA 4LULA 2UY8A 3S7EA 4IEOA 5C8WA 2OYZA 2QVSB 4EROA 2MPFA 1O3TA 1V70A 3B02A 2CGPA 2B8MA 4MH0E 3OCPA 4N9IA 3JZVA 1PM7A 1DZRA 2GC0A 4MGZE 2ZKLA 1OFNA 3FX3A 2XL7A 4BIFA 3U0ZA 2BGCA 4K8FA 3BCWA 1L3JA 3IIAA 1O5UA 4I0BA 1ZZCA 2EA7A 3D0SA 5AVPA 4I2OA 2P17A 4KWJA 2XHKA 2PAEA 3RNSA 3ZDSA 1DGWA 2DCTA 4I01A 2MHFA 2CAUA 2ZCWA 5LRSA 4WBBA 2PHLA 5I0TA 3NJZA 4D7SA 5I8YA 4YYOA 3WW4A 1SEFA 1NYWA 1EY2A 3OGJA 2WFPA 3NSTA 2EVXA 4QM8A 1O5LA 3NL1A 2BEOA 5E1RA 3LWCA 4XEZA 2H6BA 2GH2A 1HW5A 4YARA 4XFFA 1FXZA 1NXMA 4META 1J1LA 2OZJA 4JVAA 3QOPA 2IXCA 2BNMA 3U10A 1YUDA 5J7MA 1OI6A 2PAKA 4UXAA 4TLFA 5JR7B 2PHDA 4HN0A 4XFBA 5I0SA 3O14A 2B5HA 4Q0QA 3VHRA 3FWEA 4L2NA 1Y9QA 4PIZA 3FJSA 1LR5A 1ZZ8A 1H1IA 1FI2A 4XF4A 2IXIA 1Q5OA 4XETA 2XKPA 1QWRA 3MDPA 4HVOA 3EQEA 2VPVA 2IXJA 2VQAA 3C3VA 3OD0A 4IEPA 4OFGA 4IEYA 3LAGA 4NVPA 3D0JA 3H8UA 4EWDA 3E5UA 1OMIA 2BNNA 2WC2A 4QGLA 3KMHA 1YFXA 4I3PA 1ZZ6A 1CX4A 3CLPA 3R6SA 2H0VA 3ROUA 4ZU5A 1ZRCA 3CEWA 3U11A 5E16A 5BPXA 5JSOA 5K8SA 4XF3A 5I93A 3SCGA 1YFUA 4Q0UA 5FPXA 3BB6A 1FT9A 2ATFA 1ZZ7A 3HQXA 1O3SA 1I5ZA 3MZHA 2FQPA 4AQ6A 4AVBA 4LUMA 3HT2A 4XFGA 1EYBA 3NVCA 1ZX5A 3S0MA 2D5FA 4IEVA 1X82A 4E2GA 4EV0A 2XL9A 3M3IA 4ZU4A 4LLOA 1O4TA 2CV6A 4F7ZA 3H7JA 3DV8A 3EBRA 3LOIA 4LUKA 3H50A 5KHIA 2PFWA 5CADA 4Z82A 3RPQA 2ETEA 1VP6A 3NW4A 4BYYA 5BV6A 4I09A 5FPZA 4HN1A 4HVQA 3H3ZA 4QXKA 4OLLA 1PMIA 4X6RB 3SXWA 3LA2A 3SMHA 2GZWA 3TNPB 4MGYE 2IXKA 5HI0A 4O9EA 1G6NA 3BALA 5I0UA 3SHRA 3ELNA 3RYRA 3E5QA 1RGSA 1Q43A 2Y0OA 2QNKA 3NKTA 4HVRA 4E2SA 2OA2A 2MNGA 3PNAA 3IBMA 1EPZA 1J3QA 3DN7A 5KHJA 3UKNA 5I8TA 2XLFA 1UPIA 2F4PA 1LKNA 2O1QA 4KU7A 2ET7A 1CAWA 4IERA 4J1WA 4XFCA 5J48A 2D5HA 4I02A 2K9ZA 4FBFA 4A2UA 3H1YA 4MX3A 4IEUA 4BHPA 3H9AA 3IDCB 3LA3A 3TNQA 5JCTA 4RD7A 5FLJA 1ZREA 2XLAA 1X8EA 2OPKA 3RZZA 2V09A 3FZ3A 2IXLA 4EWAA 1CAWB 3E6DA 2XGXA 1H1MA 4QGNA 3LZZA 3KGLA 5LRRA 2Q30A 3PVBB 3MYXA 1CAUA 3KCCA 4F8AA 2HKXA 4WVZA 1J3PA 3BU7A 2QJVA 1UIJA 1ZRFA 4MUVA 4Q0PA 2OZ6A 2D93A 3OTFA
chains in the Genus database with same CATH superfamily
4FFIA 5FYMA 4Q8KA 3E6BA 1CX1A 3NAPB 1VBB2 1O91A 2HWE1 4M00A 1BVP1 1GZ9A 1K5MB 3IDAA 2K0GA 5F5AA 4GWMA 1BBT2 4XJZA 4F3JA 4Q8LA 4WV8A 3T30A 1TME3 3D82A 1HDKA 1F4AA 3T0AA 1JYIA 4OZOA 1WLWA 1WW4A 2JE7A 1QXRA 1RMU3 4UW6A 1ZBE2 1PIV3 3AZXA 4YW5A 3T2TA 1J58A 2Y8KA 1X9PA 4Q29A 2Z69A 1TMF3 1CAUB 2JDUA 1L7LA 1UKRA 3FL7A 2X5IC 4EN8B 2Y33A 4XBNA 4LE3A 2EXKA 1F2NA 2A5ZA 3IT8A 4GB33 2P6CA 2WS91 5EV7A 2WNOA 4A7ZA 2VOKA 2XDVA 4JQRA 1UAIA 4L92A 4RQPB 3VBUA 4ET7A 5FPBA 1ST8A 3U78A 4W8JA 2ORXA 4ZS3A 3QBQA 3AMPA 1W6MA 3O1MA 2ZJCA 3ZR5A 1ZVFA 3GCXA 3GYDA 3OY8B 1JBCA 2HEVF 1FNYA 1EUTA 2RR12 2IFWA 4P9JA 5AFBA 2JB4A 4UW5A 5IVBA 5FP4A 2JB8A 3RZLA 4GAZA 5FZ1A 4GJYA 4XUNA 4DRRA 2GNMA 1QDOA 1W0NA 2WAOA 2DU0A 4OI0A 1B09A 4HSJA 1TME1 2PAMA 4WZCA 4YVSC 2WJSA 3ORJA 1GLHA 4CCJA 1ODNA 1H8TA 1Q8SA 1MQTA 1RMU1 1V0AA 1PIV1 1YO8A 3CMGA 4XUTA 5C33A 3NNJA 1TMF1 4CDQA 2XWJB 4MHRA 4XFHA 5F39A 3BTXA 3H42B 5LBBA 1ULGA 4IGQA 4M3CA 1H2NA 1NE4A 3FUQA 4GB31 1WW7A 4XF0A 3NWKA 1CZSA 1W6PB 2QZ2A 3PLQA 5DG1A 3HMYA 5FK8A 1ZYBA 1QU0A 3H7YA 2RM21 1V6JA 1S0EA 5HCHA 2LROA 4N53B 5A7WA 4DS0A 1WA6X 3IPVB 5FMDA 5FZLA 2VUCA 1FX5A 4LBOA 4OULA 2ID4A 2WO1A 5GLTA 1UD1A 3VBOB 1W3XA 4LOTA 5F3CA 2ZPXA 4UFKA 1KJRA 4FT8A 1GNZA 4F83A 5LEJA 3DPRA 1SBFA 1AUYA 1NA1C 1SHWB 4RGAA 3M4FA 2BTVC 5E89A 5IK8A 4NHLA 2W87A 4S2HA 1CAVA 3BODA 3T2QA 3WHUA 1CZVA 3V0BA 4FFFA 5CAZA 5IJRA 3ACLA 2JE9A 3OEAA 4PF5A 5BNNA 1J59A 4BE3A 1DF0A 3VBFA 4KBZA 3K3NA 4YNIA 3DXTA 3WG1A 3RWKX 4Y1YA 2CU5A 4YG0A 1WMEA 2XQXA 3AJZA 4LE4A 4XILA 4BZ4A 2RG4A 1XBFA 4NRMA 5GZFA 4XXPA 4BA6A 1OXCA 2WKKA 3AVRA 4AVTA 4FPGA 4XIOA 4LLFA 3BKZA 3RS6A 1CPNA 1LOFC 1OURA 1YQ6A 2A7AA 2VE1A 2WQZC 3H0OA 4C8DA 5F32A 1WBFA 4LA2A 1LAJA 3LGRA 2P6HA 1OQEA 1MACA 1APNA 3N7KA 4S2FA 1AJOA 4Z07A 2EIBA 2ZGUA 3POFA 4P9WA 4OQ8A 4TLGA 5FZCA 2BQPA 1PO13 2D6OX 2WN2A 2ZACA 2VU9A 1IPKA 1QOOA 3ZN6B 4ZKTB 5C4WA 2WLPA 2WT2A 3FHIB 2XWBB 5JZGC 1OLMA 2VXJA 4IGOA 3VZNA 1IPJA 1GWMA 4HXCA 1OD5A 1UYZA 1C28A 4UFMA 4D6RA 1EAH3 2RE9A 1W05A 1YXWA 3VBHB 4CCKA 3ASIA 4IEQA 4FQZA 3PUSA 4DXZA 3H3UA 3U75A 2XG3A 4UAPA 2E7AA 1GUIA 2R7EB 1GWKA 1CAXB 1KS5A 2OX0A 2R062 3E97A 4OHVA 4OVEA 4RR3C 5FZEA 2QE3A 2YBSA 4CYDA 1AL22 1E5IA 5LK7B 2FDGA 3B69A 5F2SA 1VRH2 5DUXA 3SEPA 3S7IA 2DV9A 4CE8A 3T0BA 2BNOA 5JAXA 1OH3A 2W3JA 2GNDA 3ZIXA 4FTSA 1YYNA 2IXHA 2W2IA 4Q4W2 2XUEA 5T3NA 5JIUA 2ENRA 5JR2A 2XBO1 3HVDA 3I2HA 2CYFA 2Q5TA 5BXXA 4HT1T 1FYUA 1V6OA 3MIEA 4NROA 1NY72 2WYSA 3HD8B 4JKKA 2IWGB 1JW6A 1NA1B 1JU3A 1WWYA 2OW4A 2VECA 1MS1A 3CL1A 3HPNA 5CKMA 1RUF3 3D5OA 2IC1A 1PO11 1UY0A 1QOTA 3K46A 3LKJA 3VUOA 4FO9A 1LESA 1XNAA 2P3YA 2HYXA 5JLVA 1ZRIA 1PK6B 2RS53 3NMBA 1REDA 1ULEA 3J8F3 3KD4A 1YFWA 5LA1A 4AGRA 4ZS2A 1EP0A 3BI3A 1SBDA 1OF3A 3HBZA 4B29A 2QFEA 1AYM3 3N9QA 2VOVA 1EAH1 4Q4Y2 3RMYA 2Q8DA 4YSFA 2XB6C 5IVYA 4OQ9A 3GBGA 1IQDC 1GQPA 5JXIA 3E6CC 3VL8A 1JYNA 1XC6A 2V4AA 2ET1A 5IVCA 1W2NA 1O3RA 2PTMA 4JC1A 1ZBA3 1IKQA 4H7MA 5H9RA 4LPLA 1S2KA 2RHPA 3LFIA 5CIRA 2ZX2A 4DRVA 3SC7X 3VBRC 4E27A 2C26A 2D3SA 3LFMA 5BNPB 3JD73 4LO8A 3WNNA 4A44A 4K40A 1ODMA 2ZGKA 2XJUA 4DMIA 3AYCA 1RVF1 2PHFA 2B39A 3MF9A 2G9GA 3TBDA 1C8M3 1OLRA 2HLEA 1RHI1 1DYOA 3POWA 5I8SA 3RDIA 5I0RA 4M01A 1NCQA 5FWEA 2D6LX 3ES4A 5J96B 2JG9A 4GH4A 3WF1A 3TEWA 4S2GA 1O4YA 1R1A2 2Y6JA 2R0FA 4IUGA 5SV5A 4D7TA 1YC61 5HV0A 3POGA 5JZGB 5C8WA 3KQ4B 5C8CC 1OOPB 3NO8A 4NAOA 4EROA 5ACA2 4LKEA 3UV9A 5DABA 5L36A 2ZHKA 1V70A 3J8F1 3B02A 3ZPOA 1UXXX 5EJ3A 3VBSC 4AQTA 2B8MA 2CGPA 4GQ7A 2NLRA 4LBNA 4A41A 4DY5A 2QQLA 1AYM1 4NIHA 3ZXGA 5EIYB 3VD9A 1TG7A 5HCFA 5L7OB 4XHXA 3OCPA 4N9IA 1XE0A 2JD4A 1DZRA 3D4KA 2WS92 1ZBA1 1NXD1 4MGZE 3FX3A 4QB6A 4RS5A 4AYUA 3N9MA 4LBKA 5FZIA 4UI9L 3ZMNA 4BIFA 3U0ZA 4FSJA 2WFF3 4PLOA 1Z78A 3FHAA 1H2KA 4IV3A 2GN3A 5FUIA 3O1TA 3IIAA 5FREA 2BZDA 5SV8A 4I0BA 1UZWA 3Q8EA 4HKOA 2P1BA 1OPOA 1QF3A 4KWUA 5FZ8A 3OB8A 2OIIA 4CU9A 5KC5A 2FZ2A 4LIVA 3DF0A 4KG8A 5AVPA 3WOGA 4I2OA 2QQKA 5F5QA 4KWJA 2WA4A 2LS6A 2XHKA 1PGL1 4C1WA 1BMV2 1REEA 1Y43B 2VCBA 1Y9MA 4C1XA 2DCTA 2MHFA 3POJA 4QPIB 2W1QA 2E7TA 5I8YA 5FO8B 3ZXAC 4B1LA 3F95A 3I2GA 3I2FA 3LEIA 4L0PA 4BXFA 5FZ3A 3AL5A 1EV12 4XQWA 4WM8A 4WM7C 1NLRA 2BGOA 5FYCA 5FZBA 2XMLA 2R1DA 3ATGA 3AZYA 5DN2A 2P5BA 1UPSA 3VKLA 4QM8A 1O5LA 1TMF2 5EHDA 1B35A 3NL1A 3MFCA 4YM1A 2H6BA 3POIA 3W20A 1HW5A 4U2AA 3VBUC 2QQVA 3N7LA 1FXZA 2VXRA 1TE1B 2RM22 4QKNA 3VBRB 4COVA 3O5SA 2OZJA 1N1YA 4GMP0 3USUB 2WFF1 4ASKA 4XMAA 3NAPA 1DFQA 2QTWB 1VBE3 3U10A 5JVVA 4DEVA 2ZGRA 2ZEZA 3O0XA 2HWD3 4UXAA 4IL7A 4NO4A 1ULOA 4PCRA 2AREA 2PHDA 1M06G 4OHYA 2XQRA 3O7OA 1FNZA 4QQHA 5FZ9A 3TEYA 3O14A 3ZN5A 2WWSA 1W2AX 4A7YA 1Y9QA 3THTA 5DDJ2 1H1IA 4XC9A 1NQJA 5A3NA 3WP3A 2QDNA 3EQEA 4C0HA 2IXJA 1ALYA 3C3VA 4RFT0 4IEYA 3B94A 3GHNA 3HNYM 4QQLA 4RQPA 2UWCA 1PNGA 4AEMA 3ACHA 1RUJ3 4CDQC 5J98B 4QWNA 3I97A 2EIDA 2WC2A 1YFXA 2VZOA 1V6NA 1CX4A 3Q9OA 3ROUA 5IYYA 1N3OA 5KXBA 1UO9A 2XJVA 3BPSA 3A0KA 4YZ5A 4M3CE 3AKQA 3FC0A 2PELA 4GD4A 4RYDA 3ZSJA 3VDDB 3I3BA 2VAUA 5GALA 1BVVA 1YEWA 1AL0G 4IV1B 3MICA 1FOD3 4XCBA 1PO23 3SLIA 1G7YA 1YCIA 1WZXA 4X8NA 4Q0UA 1SLIA 5FPXA 1MS0A 3OPTA 3BB6A 1D0GA 1FT9A 2HWD1 1RUC1 1PVC3 3WF4A 1ZZ7A 1W8UA 3HQXA 4UFIA 5T5JA 4CUAA 1RUI1 2VZPA 3UJOA 1I5ZA 1G9BA 1I1EA 4AQ6A 2Z5WA 3IDEA 3QH6A 2V72A 4Y1ZA 3VDCA 4EE2A 2DUPA 1C5HA 2C1FA 3AZZA 3CIHA 5BNNC 1UX7A 3M3QA 3HT2A 1XB9A 2JDAA 2JDHA 4XFGA 5G05L 1OD3A 2WAAA 5FZGA 4PBOA 5ABJC 4DUVA 4E2GA 1UU4A 1KEXA 2XL9A 4ZU4A 4LLOA 3ZFFA 3QLQA 2FDFA 1RUJ1 1POV3 2JG8A 3H7JA 3WR0A 2ZHLA 2YFZA 1IZ3A 2IZWA 5CADA 3VBOA 5FOJB 1ND2A 2ETEA 4BM8A 1VP6A 1AR63 3R4SA 3VD5A 1DGRN 4UWDA 5BV6A 3PL0A 4LBMA 2VW1A 4OI4A 5E8AA 2W92A 2A70A 1UF2C 4Y4RA 3MHZA 3AYEA 3WINE 4HVQA 3O1RA 1Q8VA 3KLSA 3RWNA 4BOWA 3DUIA 3P1IA 2XBO2 3KT4A 1FOD1 2BW8A 2W95A 3SMHA 2GSYA 4PQQA 4MGYE 3MIGA 3TNPB 2A6ZA 3I2IA 4A3XA 5HI0A 4O9EA 4XBLA 4N7IA 3HQUA 3JBG3 3OBAA 3MV11 5FO7B 3ZXLA 2VM9A 4RN5A 4ASMB 3SHRA 4QU1A 2VVDA 4BQ2A 5ANQA 4XW3A 2YY1A 1RGSA 5CNAA 2VZSA 3K51A 5J36A 2C24A 1IQAA 4UF0A 3RGBA 2W46A 1JMUB 1ASJ3 1VMJA 2BOJA 4NIDA 3PNAA 1C8NA 1JUIA 2WINB 1EPZA 3JXSA 1J3QA 1KFXL 4QX7A 5KHJA 4AHYA 5H9SA 2P37A 5FXWA 3DKQA 1DIWA 1W3VA 3C7FA 4K6BA 4ZXEA 1NQDA 4A4AA 2DVFA 1POV1 1UMHA 5FZDA 4E4ZA 1LKNA 1AYN1 5F3GA 3C7OA 1CAWA 2AACA 1RUE1 4ZONA 1WCDJ 4ISQA 1RVF2 1IG0A 5IFPA 5FYHA 4AEKA 5B4NA 5JI9A 2VMCA 1RHI2 3WQ7A 2VQUA 5EYXA 1OKOA 1VBA3 1YQ2A 3H1YA 4BHPA 1MVQA 3WNKA 4LKSA 2W5FA 3LA3A 4U36A 3R4DB 2WR9A 5KWRA 3K4AA 4URAA 4CCDA 4CDWA 1W9SA 1K42A 2JDYA 2WWJA 3JBG1 3ZMOA 3CNAA 3VZLA 1OQ1A 1CR7A 2OPKA 1SCSA 3AP7A 4Y5Z0 4PBPA 3RZZA 4COYA 1RXGA 3FZ3A 1S2EA 2R49A 2VOXA 3ZM8A 1H1AA 3J8F2 3E6DA 4QGNA 1H1MA 2R30A 4M4RA 3WX5A 3LZZA 1ASJ1 4FPKA 3M7AA 5ABJB 2E31A 1RXFA 4Y33A 5CFDC 4QPGA 3KCCA 3FFZA 4F8AA 2HKXA 3GNEA 1QOSA 1UY3A 3WNOA 2G19A 3WF3A 4E8CA 5A3MA 4MXWA 3BU7A 2P4EA 2VTFA 1JZ6A 4CXYA 4AZZA 2OZ6A 3U07A 2VTXJ 5DAQA 3AKSA 3OUIA 4K1YA 4MG2A 4PDWA 1H4GA 3GBFA 4LR4A 2E9QA 5L9RA 2JX9A 4IDZA 4C90A 4AEDA 3I49A 3KF3A 4K8RB 1NCQC 1T2XA 3CF6E 4IXLA 1VBA1 2JG9C 1PGL2 2PMWB 3MIDA 4GH4C 1AF9A 4L11A 4MXVA 4G9SB 1NAEA 1GFF2 4MO3M 2BVVA 2D40A 3GZAA 4L9BA 4MGKE 4CP9A 2OQ6A 1G9FA 2PA7A 2G1MA 1VR3A 4UW4A 2WYFA 3OBRA 1W90A 1VIWB 2AENA 2J1VA 1DP0A 3V0AB 1LHVA 2GNBA 3ENRA 1LB2A 1N47A 5FMOS 1LODA 4W6YA 1UIKA 1W9YA 5A1AA 1ND3A 2ZGMA 2WNUC 4NIIA 1PMHX 5BNPA 5KXEA 4CEWB 5EFUA 1WUVA 4LA3A 5F5IA 1LRHA 5FIXA 5CA6A 2CAVA 4OHWA 1FV2A 1SACA 1W06A 4JDNA 2R073 1TZOA 1R092 5DUVA 4IV3C 4NN0A 3UGFA 1MS4A 2ARCA 4DB5A 2HWC3 3J4UH 3LD8A 1GNHA 1BXHA 3LIGA 4BQ3A 2VULA 2A1XA 3EB7A 2YBKA 1AR83 4P08A 4XJWA 3CU7A 5FBJA 5IW0A 3JCIA 4AVVA 2N7GA 2W1SA 4KWKA 1F15A 4PHZA 4H7LA 2Y38A 2O14A 2EAAA 3OOXA 2RVAA 4FFHA 3CKHA 4GWNA 4CDXC 4BJ0A 3ILRA 1XRUA 4XVHA 5FAXA 5FYVA 2HWB3 2R043 4XF1A 2XXZA 3AK0A 4NPLA 2C5DA 5LBFA 4P5HA 3T3YA 5L7OA 2XUMA 1FATA 3ETQA 3MW2A 4WM8C 1F8VA 1AJKA 2J1RA 5DAWA 1WMFA 1Z7S3 2QZ3A 2YYOA 4HSLA 4ONUA 4JRAA 5D2AA 5IK4A 2X8KA 4IESA 4QX5A 3GALA 1XNDA 1UZVA 4HK9A 5F3EA 1QJU2 5CBLA 3I59A 4QQ2A 4YLZA 2O8QA 1Q8PA 3AFKA 3LF7A 3H1WA 5CU1A 1HQLA 4RHV3 1C4RA 3SH4A 1Y3TA 2AEYA 4KWLA 5A1FA 1A8DA 1J3RA 2ZMKA 3TN93 5ISLA 1POQA 1MEC1 5JOWA 2R071 5DAVA 4I3GA 3WT3A 4AI0A 1O6UA 2HWC1 3I3QA 3UJQA 4QPIA 3URFA 4KI5M 4AI2A 4L99A 4MV2A 2HWD2 1AR81 1GYKA 1RUC2 2YBPA 3B01A 1LHUA 1HN0A 4BMEA 4AVCA 4E8DA 1UZ0A 4QKFA 2VCAA 4FTEA 1RUI2 1XE7A 2PHWA 4CUBA 4AL9A 2D3PA 2DDUA 2VNOA 1RIRA 2FCTA 3AB0A 1AR93 4JGYB 3AP5A 1VB4A 1U5IA 1DCSA 2HWB1 1PMJX 3KV5A 1V6KA 4W6WA 4YM3A 2R1BA 3CO2A 2DUQA 2ZHNA 2GU9A 4UBHA 4MGSA 4BLIA 2Q1FA 5FJHA 4KGQA 3GZUC 3SKVA 1FPN2 5EZWA 1D0HA 2VZVA 3AKPA 3O0VA 1IPSA 1Z7S1 1DYPA 2BWCA 3HBKA 5BNOB 5C9AB 3POYA 4HBNA 1H9PA 1H0BA 3D8CA 4P02B 4R52A 5A33B 4H55A 2QQJA 4YRDA 3UETA 3A4UA 4KMQA 1RINA 1F35A 2BFUL 2E53A 3DGTA 3K2OA 4RHV1 5FYZA 5LB6A 3WP4A 1K12A 4CA9A 4N7UA 3W9AA 2PYTA 3EO6A 4Y5SA 3TN91 4XCAA 4J25A 1UY1A 2WL1A 2W52A 3OPZA 5A6QA 2ES3A 3RSJA 5DG2A 1WCKA 3KHBA 1YLLA 3NJVA 2AH2A 3GXUA 3Q8FA 3ZYGA 5JOYA 4AVAA 2WZR3 3M70A 1QJEA 5DZFA 1O7FA 2VZ1A 4CDXB 4ZY9A 2VOTA 3L2HA 1Q56A 4KQ7A 5CYYA 2I07B 4W65A 4CPBA 4JCKA 3UYJA 4AHXA 3K77A 2WNVB 4DFSA 1AR91 3ZXFA 3ZKUA 1IG3A 1MS9A 3RI8A 4AFBA 5DAXA 2Y64A 1QJX3 1JI6A 1X7NA 4IEWA 5FLIA 5J3UA 3G7DA 2DCJA 2BYVE 5A7PA 2VGDA 4UBGA 1S0CA 1LOAA 1TQ5A 4UT5A 3GHMA 2ZEYA 5A80A 4IV1A 4QB1A 4YZ1A 1AYN2 4RFRB 1LGBA 3LIHA 2RDRA 4Q4X3 4BLJA 1HRI3 3LE0A 1VALA 1F5FA 2DBNA 4XACA 1RUE2 5CG8A 4CDUA 5BY5A 3OBZA 3WW3A 1GZWB 2LUWA 5FQ0A 4TTGA 2RJLA 4FAHA 3VKNA 1RUG3 2ZGNA 2BGPA 1UXZA 5A6YA 2XVLA 3ACFA 3OF1A 3HN1A 4XFIA 4B8EA 2W0XA 4Q27A 1WCSA 2LTNA 2X10A 3FLRA 5T5OA 2RS13 3WW2A 3QACA 2YG0A 2BPA2 2WZR1 5DUUA 3MF6A 1W8WA 4EWEA 5IK5A 1WMDA 4DY3A 4E4HA 2HYKA 1RC6A 1W6OA 3WVJA 2VUDA 4QKBA 4XDOA 2G4IA 2ZHMA 4C91A 1F5JA 3GJAA 4JTOA 2ILMA 4TWTA 1ASJ2 3VHOA 2KR2A 1HJFA 4FPJA 1QIQA 3PVOA 1QJX1 5IAVA 2UY9A 5C6CA 1BYHA 1XSQA 1SDWA 1ZZBA 5KBFA 1LU2A 3AYDA 2BVBA 3C7EA 2FHRA 3WG3A 3BUCA 2UU8A 5J1XA 2UYBA 2VTXA 3BTZA 2ZMLA 4LK6A 2ARAA 4CEYB 3KVBA 1PNFA 2KM2A 4Q4X1 4XTMA 1HRI1 1BJQA 3VB9A 1NOVA 3UK9A 1SFNA 3AX4A 3GF6A 4B4RA 1CONA 4LULA 2Y26A 4YZ2A 1MVEA 3BYWA 1RUG1 2Z42A 3MO4A 1VBA2 1D4M3 4A45A 2PLV3 3W5MA 4AGGA 2CL2A 1YI7A 2RS11 4OYUA 4BU2A 4MH0E 4IW3A 3QCWA 3FMGA 3KHCA 3UGHA 2WZEA 3JZVA 2HBUA 1PM7A 3LDRA 4LIUA 1MS3A 1JS9A 1RUH2 2GC0A 4B3NA 4LBJA 2ZKLA 2ADDA 2D97A 4OI2A 2ZTNA 3FBYA 3SNMA 4Y22B 2BGCA 4Y3OA 4N8MA 1JH5A 3WG4A 4K8FA 1U5YA 2RDNA 3BCWA 4QPGC 3T4VA 1UOBA 2DBIA 2X5IB 1GMMA 2CTVA 2XHNA 1HX6A 3ZFGA 2EA7A 3D0SA 1OA3A 4YW7A 4AW7A 1LOEA 1NCRC 4LBLA 3NV1A 3OSDA 1QQP3 1DGWA 5F8PA 4AEDC 2CAUA 1SZBA 3LB9A 1D2QA 4GWJA 4YGEA 5I0TA 2B4KA 1YNAA 5LBEA 1CWPA 2FZ1A 2XJTA 1D4M1 4D6QA 1XSRA 2K46A 5J09A 3ZYJB 1KJLA 3N7MA 2ARXA 5FUPA 1GBGA 2XOMA 3CBNA 5GM0A 4JGZC 2NMOA 1U5XA 2V5YA 5GLZA 1OA2A 4YW3A 3IAQA 3POBA 4MADA 5A32B 4D8MA 3TB0A 4V2VA 2D98A 3ZKYA 3N36A 1HRV3 1ND3C 2VNGA 4YVSB 4META 4LBQA 4LHKA 5DZEA 3QOPA 1JYCA 2IXCA 4QQPA 2X05A 2AYHA 4HK8A 4RA0A 1UYXA 1S0BA 3WLUA 2VZUA 5FZOB 5J7MA 3MIBA 2YGMA 2HWF3 5FZFA 5A7NA 4QHOA 1MEC2 2JXAA 4NWWA 3WCSA 4BQXA 4FP3A 3JU9A 4FPLA 4HN0A 5JR7B 3PVNA 5C3PA 5JOXA 4Y1XA 4EZHA 4INDA 2HEYF 1CVNA 2DCKA 1PZ7A 3LEGA 3VHRA 1XNTA 3FWEA 1QQP1 1ZZ8A 5F9TA 5K0UC 3SISA 1LULA 1DDLA 2AR6A 1Q5OA 2IXIA 4QX8A 2XKPA 1OPMA 2JJ6A 3AXEA 2YPDA 3WQBA 3V0AA 4HVOA 2ZEWA 5A7QA 4ZXKA 1Y9GA 4AI3A 4IEPA 3IKWA 5FZ0A 5FY0A 4D0QA 3J7MA 3OEBA 3SKJE 1OVSA 1YJKA 1QJY2 3IAPA 2VZQA 3H8UA 4EWDA 4XQDA 3E5UA 4CEWA 3H8OA 4NR1A 1LJ7A 2WNEA 1DQ5A 1HB2A 2GMPA 4QGLA 4PI2A 1ZZ6A 5FZHA 3P5BA 2PQSA 4ZU5A 3U11A 5E16A 4HANA 1QGLA 2DCZA 5BPXA 5CFCC 1JOBA 4OZXA 2OKXA 3ZFEA 3ZXDA 4YWAA 2A3YA 3SH5A 5BNQA 4A6SA 1A3KA 5FYYA 2UURA 4RHV2 3MIFA 4ISRA 1YFUA 5DAPA 2I74A 3W5NA 1EPWA 3TN92 4FCAA 1NCRB 2HWF1 3RZMA 2JECA 3MI8A 2BBVA 4YM0A 3QH7A 5LASA 4BPZA 4UOJA 2Y34A 4HONA 4Y1UA 2XJRA 1KQRA 2KD7A 2JE8A 2YMZA 3B9CA 3MZHA 3P3NA 3U4SA 2A6WA 1PX4A 3WY6A 4AVBA 1LOBA 2VMFA 3KV4A 1BEV3 3U37A 3M1HA 2CWMA 1BCXA 4LUMA 1G8WA 4CXXA 1ENQA 5FY1A 2D6MA 2JDKA 2WT0A 2LALA 2RS33 1EYBA 4Q1RA 4EN6B 3OJBA 3S0MA 4JGZB 3THCA 1UU6A 2FDJA 1G9DA 1X82A 2HWE2 4N43C 3M3IA 2PHUA 4BYYA 2Z79A 1HV0A 2ZZJA 3CJIA 4F7ZA 1A34A 3DV8A 1CQ9A 2RMU3 1PVXA 1RUF1 3BVCA 1CIYA 1I3HA 1OKQA 3LOIA 3PIGA 4LUKA 1AHSA 4XYXA 5FP7A 2PFWA 4BXSV 3NKGA 2RS51 2OVUA 1UYPA 3RPQA 3PJYA 3NW4A 2YC0A 3N9PA 1ZA4A 5FPZA 3RZGA 2Q8EA 1V9U3 4QXKA 3ZYHA 5HCAA 1YIFA 4K1ZA 1CESA 3T2OA 3W21A 4X6RB 1RUD3 2ZA9A 4RR3B 1HB1A 5C5UA 4QB2A 3KVAA 2XPJA 4YG6A 1W6NA 1GR3A 1SCRA 3WV6A 4E4DX 4PT6A 2QUOA 2ZOEB 3ACGA 5K0UB 5D8AC 3ELNA 5CEHA 4LNVA 2A71A 3JD71 4JGYA 3H8XA 1GP6A 1AXZA 2VNRA 3I4IA 3RYRA 2FDIA 3N3HA 4Y1VA 1X36A 3KT7A 1BEV1 4HVRA 4E2SA 1C8M1 1VBC3 3BIWE 2HEWF 5T5PA 4TZDA 1HB3A 2A73B 5C9AA 5EQUA 3PMEA 2BJSA 5FRAA 3AVSA 3PUQA 2QBXA 3DN7A 1ENSA 4P00B 4COWA 1AXYA 1IOAA 1OUXA 3OYWB 5I8TA 3PMSA 3DECA 2JENA 5A33A 5FKBA 2RMU1 2WN3A 1JU4A 5DUWA 1TME2 1NT0A 1QJX2 4HG6B 2ET7A 4IERA 4A42A 4XFCA 5CFCB 5J48A 2D5HA 5F5CA 5H9QA 1RMU2 4OMDA 1PIV2 3HR9A 4IE0A 4BMBA 1MZFA 4YVWA 4HPKA 1V9U1 2D6KA 4RGKA 4A2UA 4D6SA 2G9ZA 4GA9A 3IDCB 4LITA 4Q4X2 1HRI2 3UGGA 4B7KA 1RUD1 4GB32 3PUHA 4W50A 4RD7A 4FOYA 1J83A 3EMRA 1KGYA 1HXS3 2XLAA 1OUSA 2ZKNA 3B7MA 4Q4V3 1RB8G 1RUG2 4XE9A 5IVJA 2WRAA 5HXMA 1MZ5A 2YC4A 4BQWA 1Z0HA 4KH9A 2WNVA 3BIEA 1K5MA 3N9NA 4TXWA 3ZLIA 4UFHA 2RJ2A 4JRLA 5B2GB 1ONAA 2PN5A 2XJQA 5AC93 3ZYIB 3ZYBA 1IS4A 4BK4A 3KGLA 4GJZA 4N43B 3AMMA 2WSVA 4Q1PA 4K7JA 1POV0 1O4ZA 1GOGA 3WDVA 1CAUA 4YGCA 5C8CB 3ZO0B 2XVKA 1DGLA 3D6EA 4R4XA 1F4HA 1XNCA 4FPHA 3Q8AA 4MUVA 3VBSB 1W6QB 1H8TC 3V64A 2CGNA 1MQTC 4JDOA 4LBQD 5FXZA 1DYKA 3HN3A 3HNMA 5BUVA 5LA0A 1FMD3 3KSCA 3MPBA 3TEXA 5LW9A 2YHJA 4HFSA 1UCXA 1YHFA 4KL1A 5FPUA 1W03A 4AQSA 4E4SA 3OY8A 1QXPA 4BH9A 2XR4A 1JN2P 1AR73 3AC0A 4CCNA 1OH4A 1U5ZA 1HXS1 5D8AB 4WVMB 4Q4V1 1IHMA 3K3OA 3AJYA 3NV4A 2QCSB 2VMEA 1S0IA 4AGVA 3KZ4C 3I54A 1OQDA 4LEJA 1L7RA 4FPYA 1VBE1 2JKBA 2YV8A 2PHRA 2VH9A 3B9IA 5D1IA 5F3IA 2DTWA 2VCCA 3DPRC 4AE2A 3ACIA 3W59A 4DIQA 4FXGB 5AC91 5I0DA 2WABA 5KHKA 5F2WA 1HJGA 3PUAA 3VDAA 4AVSA 5JSPA 3UNPA 2GAUA 3I3EA 3LA7A 5JMOA 3Q8BA 2FBEA 4DOUA 5G04L 2O0OA 1GQHA 2VZTA 4DXRA 4PIYA 3JQXA 1STMA 1PGSA 3GGLA 3MIHA 4WM7B 3VBFC 2EF6A 3ILNA 1W6PA 2XH6A 3IM0A 2WDBA 2ZX1A 2NPIA 2OUHA 4N53A 4O9GA 3IPVA 1FMD1 2GDFA 3JUUA 3BTYA 4HETA 3GZEA 1J1TA 1LHWA 1UQXA 1W2OA 2HJIA 5LBCA 4B1MA 2ZS6B 3VBUB 3LOBA 4K3UA 4LMFA 4IGPA 3FFQA 2VQTA 4UFJA 3VZMA 1Q8OA 4GMP3 4PQ9A 4TYSA 1AR71 1VBB3 1W6MB 4OMCA 2K2SA 1BBT3 4XFAA 2VNVA 1QH7A 4BQ1A 4QGMA 4AI8A 4WZFA 2XLGA 3SQOA 2CSGA 3O12A 1PO21 2LRPA 3NJXA 2R32A 4BQ4A 5CZKA 1I6XA 1C5IA 5FY4A 5IFTA 1ZBE3 2FMDA 4XF9A 4CU8A 1PVC1 4LKDA 1PO12 4Z8BA 5C4WC 3NJYA 4JKMA 4P9YA 1H6YA 4B7EA 3RFRA 2D7FA 3P6BA 1N1SA 3ST7A 2W9XA 5M0TA 4KBBA 2RDSA 1VJ2A 1S0DA 4AI9A 1EAH2 3LQCA 2VW0A 2XJSA 4P14A 5FY5A 4HKWA 1GQGA 3RI9A 3ZOIA 1ZRDA 1BZWA 1XU2A 4CDQB 2PQQA 5C71A 5F37A 2BU9A 5A3PA 2B46X 4Q5OA 1GOFA 2CY6A 1ULDA 4FPOB 1LEDA 1RTVA 2RR13 4AFAA 3KF5A 3PTYA 5A7WB 3EYPA 3PUIA 1AR61 4QXCA 3RZHA 1D7PM 2ZGOA 4BWOA 1VBB1 2Y6HA 1Y7BA 3OUJA 3ZN6A 2WQ8A 4K20A 1BBT1 4QHBA 2JWPA 4BCUA 3WXPA 3OD4A 2KXLA 2Z2SB 3K4DA 3MUZ1 3DPRB 4PDWC 4CU7A 4YVSA 4NJ4A 2AZ5A 4TSVA 3VBHA 1ZBE1 4XDQA 1CAVB 2VO5A 1RL3A 1RUF2 4AQ2A 3V0BB 1W39A 5FWJA 1US2A 1XE8A 3RYPA 1RUOA 1CAXA 2RS52 4CXWA 5C3RA 2ZMNA 5BNNB 3PURA 3VBFB 3WNXA 3ZFEC 4QX1A 1SLAA 1AYM2 3GDBA 3ZSEA 3LPFA 1DQ0A 1HN1A 3WNMA 4QDSA 4OCTA 1GANA 1RJ8A 4LTAA 3ZSKA 1R64A 5LATA 1C3HA 1ZRRA 3AZWA 1ZBA2 1R1ZA 1N3QA 5AFEA 5KHHA 5C5TA 5T50A 4IQPA 3HNBM 3EJKA 3VL9A 2XKOA 1S4CA 3KWVA 1XJAA 3I7DA 4YW6A 4BQ5A 1UW8A 3KT1A 3LDBA 3JD72 4OHXA 3DKWA 5FCCA 1NA1A 2GC2A 1BKZA 1LGCA 1SFYA 3DEMA 5FFOC 5BYNA 3VHNA 4LJHA 1C8M2 4J1XA 1PK6A 1MZ6A 4FOQA 3WEZA 3A0NA 4Q0SA 4CUGA 5FBZA 1NLQA 4AOCA 5A3LA 3T08A 5C4WB 4XUQA 4LHLA 4V1PA 2EXHA 4R8HA 1UOJA 5FV3A 1MPXA 4QXHA 5FKCA 1URXA 3CDZB 3LPGA 4YGBA 3LCPA 1E5SA 2ORZA 1QNYA 1A8MA 3DXUA 4LO6B 4A3ZA 5GLUA 4M3CF 2QQPA 4AXOA 5F1RA 4FAGA 1X50A 3UESA 5EJZB 3O0WA 2WO3A 5JMCA 5CISA 5FY7A 3CJXA 5FP3A 2VOWA 4R9DA 2J7MA 4HOOA 3WQ1A 1X8MA 2Y6LA 4RS5C 5EJ1B 4XUPA 2BUKA 4B4PA 4JTNA 1UY4A 1WMXA 3J26N 2YGLA 1O3QA 2IVIB 4DXSA 2WFF2 1WA4A 2UYAA 2W94A 2Q1ZB 1W9FA 4J6GA 2VQ0A 2VR4A 4EYUA 5JZGA 5FR3A 3IZOA 2YB7A 4YFZA 3TWIA 1OOPA 4GIQA 4PDWB 3ME2A 1A78A 1W2UA 1DZTA 5K9YA 2Y6GA 1V6IA 3IWZA 5A6ZA 5F7UA 3PU8A 1KRIA 3IMNA 4IE4A 5FZKA 1YFYA 3ES1A 5CKQA 3A23A 1OHFA 1W9WA 3AMNA 1HIXA 1AL23 2ZBJA 3N35A 2J42A 3PJQA 4QKDA 2C0ZA 2SLIA 2VCMA 5JUVA 3PTRB 2A6VA 3EHKA 4TN7A 5DXDA 1B35C 5IVEA 3S7EA 4BK5A 4IEOA 3VKFC 1XYNA 3OBTA 1V6LA 3IIIA 4JDMA 5CFDB 2QVSB 1IKPA 1W8FA 2CDOA 3NNGA 4JQTA 1A6CA 1TVGA 3JB8A 3FUOA 1CJDA 1ULPA 4MSVA 5APAA 4Q4V2 3NAPC 4NHKA 5IHRA 3ZSMA 3L2YA 2HH9A 1VBE2 3JB4C 1NCQB 1OFSA 1OFNA 2JG9B 3NRUA 5KXCA 4GH4B 2VMDA 2XL7A 5AC92 2ARBA 4OI1A 4Q4Y3 4WVWA 3RRDA 3TRSB 4CP0A 4Q2FA 1VRBA 3ZX7A 1L3JA 2FCVA 3RJRA 4YW4A 5JI7A 4AAXA 4HKLA 2IVJA 5A1LA 2R041 2YC2A 1ZZCA 3NQHA 1LCLA 2WZPP 1AL21 2B7YA 3K75B 4FI9A 1L7QA 4RQPC 3RNSA 3ZDSA 1E5HA 3NNLA 3VBRA 3TEZA 1CJPA 4I01A 2WNUB 4Y4YA 1TNFA 4XQ4A 1UNBA 3USUA 4ARXA 1FMD2 1RUJ2 1WD4A 4DZGA 2VZRA 4WBBA 3NJZA 4YYOA 1JYTA 4RS5B 3WW4A 1QJFA 1TNRA 3WHTA 1OVPA 3N9OA 5F6KA 4BDVB 3OPWA 1KITA 3VZOA 2ZX4A 1R1A3 2J1AA 1AR72 4IV3B 3OGJA 2WA3A 1HV1A 3BOWA 1W99A 3NSTA 1CD3G 4CCEA 4D94A 5A70A 2WSUA 4D7YA 2V5DA 2WO2A 5E1RA 3LWCA 1FOD2 3B3QE 1PO22 5ACA3 5C8CA 2GH2A 2P3JA 2OUJA 3CHXA 3WSOA 1W04A 3I3DA 4DNYA 5EYYA 4YARA 4XFFA 1OBNA 1QH6A 2A6XA 1PVC2 2OS2A 1MS5A 1J1LA 4JVAA 4B4QA 4Q4Y1 3KQRA 3WUCA 4YFWA 2BNMA 4BISA 1YUDA 3ZDVA 3I3MA 4MLOA 1DQ6A 3T0DA 1JOPA 2HBTA 4WM8B 2PAKA 2J22A 1DBNA 2MEV3 1AXKA 4XFBA 1WKYA 4XZPA 2B5HA 4QX2A 1B35B 1JZ3A 3FJSA 3ZFFC 2VD7A 2KA3A 4E9KA 1PGW1 2JG8C 3DCQA 4Q26A 4AR2A 5JWPA 3VDDA 4XF4A 2JDZA 2GNTA 2PXJA 5FZ6A 2E6VA 4BQYA 2Y60A 4QQOA 3VBOC 1ND2C 4PLNA 5B4XA 2GMEA 2VPVA 3DYOA 3OD0A 3POEA 2Y6FA 3LAGA 1AR62 3WNLA 4YG3A 1R1A1 3BGAA 4URTA 4DEQA 1F9KA 1OMIA 1UU5A 1JYVA 1FAYA 2BNNA 4YM2A 3MW4A 3TAYA 1OSGA 2DVAA 3CLPA 2H0VA 4OUEA 2CGOA 2D44A 4CUCA 1EV13 3CEWA 5GLWA 5ACA1 4KGGA 2YU1A 3VDBA 3A21A 4CRQA 4FP2A 3BOPA 2ZGPA 4WM7A 5JSOA 1K45A 2ERFA 5A7SA 3JBG2 4AK3A 1K3IA 5K7PA 1YQ5A 1AVBA 1IS5A 2DVBA 3PHMA 4XF3A 2LW8A 4M0HA 1ENXA 3SCGA 4CTEA 5DPNA 2NN8A 4IE7A 1WCQA 2BOIA 4OHZA 4P9IA 3O1UA 2RM23 4ES9A 2D43A 4YPJA 2EIGA 2MEV1 3FLTA 1N3PA 2ZEXA 2GH8A 2VG9A 2DVGA 4QDQA 5IWFA 4QAWA 5FPAA 1SLLA 4NPMA 3J7NA 5FYSA 1SLCA 3LSEA 2BDRA 3B00A 3NVCA 5JXHA 1BMV1 1ZX5A 4V2WA 4PI0A 3C7HA 4IEVA 2AC1A 2QQNA 2Y6KA 5DDJ3 5DQ0A 4FQ4A 4YW2A 4ES8A 3M3EA 1G9CA 3MEPA 1CPMA 2CV6A 3EBRA 4X8PA 2YUEA 3H50A 5JXJA 5KHIA 2QQIA 2V73A 1JOJA 1W8OA 4FTBA 1EV11 4CDWC 1LECA 1NX9A 3VBHC 2EAKA 4QXBA 3W58A 3VD7A 1N1VA 4DQAA 3H3ZA 4KNCA 4G4FA 4XOGA 2R16A 4OLLA 1G9AA 1DQ4A 4SLIA 4NIGA 3BN6A 3RVHA 1COV3 3WDYA 1CIWA 2B45X 3LA2A 2GZWA 2ZAHA 4L8QA 2BFUS 4O7XA 4ARYA 1G6NA 3MLLA 2BV4A 4R4ZA 5GJ6A 5HXVA 3ZFFB 2ZGSA 2Z4FA 2JG8B 5A3OA 2X53S 1VLNA 3E5QA 1HQNA 2Y0OA 1ND2B 2AUYA 2GP3A 3NKTA 1GSLA 3OGGA 3ZN4A 3ZPYA 2MNGA 2EALA 4DPNA 2VW2A 2ZAAA 3KM5A 1AX1A 2DTYA 3R0RA 4XBQA 5FYIA 3ZXKA 3PU3A 1UN1A 4ATEA 4LHNA 1BK0A 2GN7A 3UKNA 2JEMA 5DDJ1 4LT5A 3FN9A 5LA2A 4Z2WA 4LO4B 3VV1A 2XLFA 1PK6C 1I9RA 1Q8QA 1UPIA 3D3AA 2F4PA 1G86A 3VZJA 5DZGA 3M3OA 4ATFA 2PLV1 5IUQA 5FY9A 3GJBA 2XJPA 4J1WA 1K5JA 3RZKA 3VN4A 1TEIA 3GCWA 5ABJA 5KR7A 4FBFA 2DUOA 4MX3A 4UF0B 4IEUA 4SBVA 3H9AA 4XJ8A 4DO0A 1COV1 1XNKA 2NM1A 5A6XA 2BBAA 5JCTA 1T6BX 2JKXA 1ZREA 2VVEA 3O1VA 5BNPC 1X8EA 2NQYA 2RJKA 3HJRA 1DU3D 2B42B 2WO7A 5FOBB 2XBO3 2QQMA 4EWAA 4XJAA 1CAWB 2YROA 1PM4A 3MPPG 2R072 1NKGA 2HWC2 5LRRA 1EUUA 4CU6A 2Q30A 3PVBB 3I2KA 3MLJA 2BP6A 2Q8OA 4GKXA 3I2OA 1OOPC 5LZ6A 1AR82 4JAAA 2WIIB 4WVZA 2Y0IA 2EICA 1YJLA 4XXAA 4CDWB 4LHSA 2QJVA 1UIJA 1YQCA 5A7OA 1W0PA 4HMZA 2D93A 1SG3A 3OTFA 1OC1A 3WQ0A 5L7OC 5GZDA 1JHNA 2HWB2 2R042 2VMIA 4CPBD 1D2SA 4QMAA 5A3UA 1S55A 2I45A 2TBVA 5JPMB 3N9LA 3U14A 3MW3A 2X29A 4EQVA 1Z7S2 1YRZA 2Q4SA 4ZZ5A 4ASLA 1DGRA 4Z2AA 1RVF3 1HRV1 1KDKA 5JOZA 4MOAA 5C3SA 1RHI3 4QPGB 1WLCA 3NV3A 4FPEA 2W91A 3UKTA 3WCRA 2FMYA 2J1EA 5ERLA 1SLBA 4FFGA 4MXWB 1QXJA 3F2ZA 4A7KA 2W39A 2NP0A 1Q3EA 1O8SA 2YDEA 1KD7A 5FLHA 5KXDA 3IDBB 4QPIC 5KC6A 1PX3A 3UKVA 4AEDB 2VBDA 2ZX3A 3WW1A 3J7HA 2NYYA 4LXLA 2JICA 2Q0AA 4MGIE 1CZTA 4FOVA 4PIXA 2OXBA 4D3WA 5A3WA 3OG2A 5KHGA 3NNMA 1DHKB 1LEMA 1LNSA 3HWJA 4LOSA 4JZRA 4CP9B 1X33A 3V56A 4GULA 3SCHA 4IETA 2XONA 3ZSLA 3VKOA 2WUHA 1AR92 3USSA 4JHZA 5JDBA 1KDMA 3C8XA 2PHXA 5CFDA 1NLSA 3AMHA 3VD4A 2QQOA 1JODA 1S0JA 3S57A 2B9UA 1NE6A 1XOYA 3UT0A 1ND3B 2VC9A 4BB3A 4P5YA 1C1LA 1S2BA 2EIEA 1PGW2 3WG2A 2YU2A 2H6CA 4HL0A 4JV4A 2FD8A 1GV9A 4Y20B 3AYAA 4NAMA 4IE6A 1RUNA 4QDRA 3LDKA 4COZA 1BHGA 1ULCA 1YQ8A 3CZUA 3RZJA 3MFAA 1UX6A 1RJ7A 1MS8A 3P3PA 1BQPA 1W2TA 2C4XA 3R05A 5C7GA 1IGOA 2AEZA 3MGUA 3MV01 1WLDA 3IB3A 1LENA 2CDPA 2CWSA 5JIAA 2JDPA 2A3WA 3LEKA 3RYKA 5A3TA 2F6BA 3THDA 2JIGA 1R083 1ENRA 2ZXQA 3HIFA 1ZM1A 1CGPA 5FP8A 4KU8A 3N7JA 5J37A 3BTAA 1KS4A 3O1SA 5FMBA 2WZR2 4GKYA 2W08A 1VBD3 5BNOA 2QDRA 2RS31 4AF9A 2WNUA 3AL6A 3S5QA 4IEZA 4QD2A 5I91A 2X09A 5EXOA 3HQRA 3ZR6A 3RMXA 1WW5A 5LK5A 1GP5A 1NZCA 2VMHA 1R093 2F17A 2MEV2 5CVRA 1UMZA 1O59A 1OLME 2P3KA 3KB5A 4QU2A 4Q0VA 1DZQA 3DYPA 3I59B 3KGZA 3VDDC 1X9TA 1U12A 2H0BA 4IV1C 2ZZQA 1PHMA 4BIOA 3MLKA 5LA9A 4XAEA 4CDUC 3WNPA 1W9TA 1M4WA 1O8PA 4I0AA 1T6GC 4NRPA 1WW6A 4CDXA 2G9FA 4CCOA 2GC1A 3IN9A 4E2QA 4IE5A 2W68A 3FE5A 1JHJA 1VPHA 2I2SA 3BPZA 3WF0A 3HT1A 1R081 1UL9A 4M4PA 5T52A 1VAKA 1XYPA 1GKBA 4UW3A 1VMFA 3FLPA 5FYUA 2V4VA 2RS12 3WF2A 3TOJA 1WLTA 4JX0A 5GZCA 5GZGA 3O1OA 1VBC1 2GC3A 1I5PA 1VBD1 2CHHA 1QJU3 2W47A 4IEXA 3ABZA 3IMMA 4DUXA 1LU1A 4N9HA 4AFDA 1SPPB 5HCBA 3N4MA 5FUNA 5FY8A 3HEIA 5EP9A 2VZ3A 5FDBA 5L9BA 3PVEA 1ZZ9A 1R091 4X6QB 4DINB 1DQ2A 4ZU7A 4FPFA 1GZWA 1ZA7A 3Q8CA 1JUHA 2WT1A 2BRTA 2TNFA 3E5XA 1RUC3 1YWKA 2C9KA 3ECQA 2ZABA 2GMMA 4C0BA 2UWBA 1RUI3 2EXIA 4NMIA 1H30A 1SLTA 3ZYPA 4GXLA 5FPLA 4DUWA 2QQWA 3WDWA 3POSA 4L97A 3ZVXA 1C57A 5T54A 1D4M2 3VKMA 1JZ2A 2PLV2 2D3RA 5FZMA 1FPN3 4K9SA 4OUSA 1BLZA 4HZFA 1ZNPA 3B5LB 4QPWA 5GKAC 1V00A 4Y26A 3DL3A 5FK7A 4AHWA 5IVVA 3RG0A 2Q1MA 3UL2A 1U0AA 2O8OA 2P2KA 1GWLA 5CG9A 1QJU1 4XPVA 1YI9A 1JYWA 1COV2 1E57A 5JSRA 5LY1A 3S5AA 1SQ4A 5FZ7A 4P9GA 4Y24A 1SFPA 1MZEA 3CZJA 1QJZA 1S0FA 4FPCA 4NHYA 2WBKA 3NNFA 4H3WA 3WZ1A 4CEYA 4MGTA 3TYJA 1WGPA 2QQUA 1H2MA 1LHOA 2WQ4A 4RGGA 4EN0A 3FBMA 3E1F1 2DF7A 1QY4A 2VJXA 2JD9A 4NHMA 4CP1A 4FVVA 4QX0A 4XABA 1ULFA 1H4HA 3ZFGC 1DG6A 2YFUA 3SCFA 4ZPIA 3C2UA 4CDUB 3VZKA 1US3A 4KG0A 1GU3A 3WP6A 4PJYA 5FQ0B 2D6PA 4HLTA 4M0NA 2VBBA 2E26A 1H6XA 2BERA 3AP4A 1UOFA 3C7GA 3I2JA 1QQP2 3H1MA 1AZDA 1GZCA 1HQWA 1QEXA 4ORFA 1HKDA 2F4LA 3ZXEA 4UYBA 2YZ4A 2FDHA 1FPN1 2E33A 1E5RA 5FYBA 4MZUA 3LSDA 4Y22A 3OGRA 3ZXJA 3T2PA 4QM9A 1W6OB 5LEKA 2UY8A 5C3OA 1VE0A 1JZ7A 1GP4A 1AYN3 1FV3A 2PHTA 5D21A 2OYZA 4CCCA 2X5IA 4R9CA 5FMOL 1W8NA 1RUE3 2MPFA 2DFBA 4ZHNA 1UZYA 4W6XA 1O3TA 2A6YA 2YPJA 3S30A 1XU1A 1HRV2 2W1UA 4XUOA 5K4LA 3WDUA 2DVDA 1H8TB 4XZUG 1DGWX 1MQTB 3T1LA 5C3QA 2DWRA 1DLLA 3V65A 3AMQA 3U4XA 4LQRA 4XJUA 2HWF2 1SMVA 3ALQA 4QT6A 3ZYFA 1F31A 4XHBA 4XIKA 3H8RA 2JIJA 2GP5A 3LEMA 1XPWA 3K4ZA 3ETPA 1S0GA 4GMP1 3MUY1 1O5UA 1GZTA 2P34A 4AAPA 1UZZA 5A32A 2OT7A 2E51A 2P17A 2W1WA 5EPAA 2DYCA 2PAEA 2TUNA 3J9SA 1NZIA 1YIPA 2TEPA 1KXGA 1WBLA 4MYEA 2IUWA 4CEWC 2ZCWA 5LRSA 3WD5A 1H8VA 5E88A 1HLCA 2PHLA 4S2DA 1IS6A 3VLBB 4CSWA 4D7SA 5E6HA 4EZ4A 1UOGA 5FZOA 2DURA 2R0HA 1SEFA 3AKTA 1NYWA 3A22A 3H3LA 3INAA 4GALA 1EY2A 4LO5B 4O65A 3DYMA 2WFPA 3I2DA 2EVXA 3VD3A 1DLCA 5AVAA 3OUHA 2BEOA 3GM8A 4XEZA 3ZFGB 2J1TA 4CCLA 1OT5A 4YZ3A 5T55A 3AFGA 3OGVA 3KCYA 2A75A 2WZ8A 3ILFA 3QD6A 2E63A 1Y4WA 4OUMA 1BK1A 1NXMA 3ZYRA 2D6NA 3S6PA 1LGNA 1GICA 5L9VA 1RYYA 2RR11 3AKRA 2AGSA 4XJ9A 4AG4A 5TSWA 3AXDA 4NWVA 4I30A 3I8TA 3O1PA 2UWAA 1GOHA 1RUH3 1W8TA 3WP5A 1OA4A 1JZ4A 1BEV2 4H14A 2VY0A 1HB4A 1OI6A 2C9AA 4GWIA 4NHXA 4TLFA 4AWDA 3X29B 2RS32 1LOGA 1C1FA 2B9VA 3M2MA 4Y5TA 5I0SA 4Q0QA 5JPNB 4L2NA 1UWWA 4PIZA 1LR5A 3CJIC 3RJ2X 5IATA 1FI2A 2NZ9A 1W8ZA 4XETA 2RMU2 2ZGTA 1W0OA 2C6SA 3FHQA 3L9JT 1QWRA 1QDCA 1V6MA 3A7QA 3MDPA 4MVTA 4NRQA 5FZ4A 4LBQB 2VQAA 5L73A 3SITA 3PIJA 4OFGA 5FXVA 1NCRA 2VVFA 4NVPA 4R9BA 3D0JA 1W28A 4XAAA 1V9U2 1SDDB 4JHTA 5IVFA 1OLQA 2EXJA 3KMHA 1LOFA 4I3PA 2QKDA 5FZAA 3R6SA 1RUD2 1LOCA 4W4ZA 4CZSA 1ZRCA 1CN1A 3M8LA 3APBA 2RDQA 2P3IA 4DXTA 3JQWA 2SBAA 3PDQA 2DFCA 1QHDA 4NPRA 5K8SA 1XNBA 4JGZA 1LTEA 5FP9A 4JGYC 4CP2A 5I93A 4RL7A 1R082 5GZEA 1JXNA 4LO7A 2E7QA 1RUH1 1P8JA 3ZIWA 4RSUA 2ATFA 3MBWA 4FOWA 1VBC2 2NMNA 5BNOC 5C9AC 1VBD2 5JXGA 4AEJA 4EN9B 1O3SA 2VUAA 5CKNA 5ANNA 4NIAA 2FQPA 4EN7B 2DU1A 5IAXA 5HPOA 5LCWL 1JYXA 1AX2A 1PZ8A 2R063 4Y20A 3RQ0A 3M3CA 4UFLA 2JDNA 4O61A 4ITCA 1MEC3 5IT6A 2CNAA 3KV9A 4RR3A 1DQ1A 1H9WA 1PZ9A 4LK7A 3KCXA 4AI1A 1VRH3 2J1SA 2OPWA 3T09A 3ZFEB 4EJRA 5HV4A 3ITQA 2D5FA 4LORA 1OF4A 3AP9A 1IS3A 2VBPA 4YVWC 4P9XA 4EV0A 5FPVA 5K0UA 3SH3A 1O4TA 1QMJA 4N90A 5IK7A 4Q4W3 4NUBA 4XMIA 3HOBA 4NE9A 5GLVA 4CVUA 1JTZX 1W8HA 1J84A 4Z82A 1XXNA 2RV9A 4PLMA 5LY2A 3THPA 4G3YC 3WUDA 1UYYA 1N1TA 2E32A 4AFCA 1UKGA 4P9LA 1QJY3 3WDXA 4H2AA 4I09A 1HXS2 4HN1A 4YGDA 3KS7A 1PMIA 2WNVC 3VHPA 1K5MC 3OYWA 3SXWA 4COUA 1D4VB 3G6JB 5FYTA 3GBWA 5T5LA 1QNWA 2VUJA 2IXKA 1XQNA 3BU0A 1QKQA 2ZX0A 3BALA 1XYOA 4JKLA 3K48A 3CJIB 5I0UA 2Q8CA 4XDPA 5CFCA 4M3CB 1WCUA 3AZVA 2WLQA 3B93A 1Q43A 2WWUA 3EXUA 2FDKA 2R061 4GZ9A 2QNKA 1MR5A 5H9PA 2OA2A 4QHZA 4Z1VA 4ZZ8A 3IBMA 4PF1A 3NV2A 4CCMA 2L9LA 3ON7A 1VRH1 3HAGA 4QPYA 4FXKB 5HBAA 3VGIA 2FCUA 2LM3A 1VAMA 3CQOA 3J7LA 5C70A 2IFRA 5FO9B 1WD3A 3GZTB 4Q4W1 4Z92B 1W6NB 4R9AA 2O1QA 4KU7A 3AP6A 2GALA 2A3XA 1LHNA 3AM2A 2HWE3 1NY71 1QJY1 4I02A 1REFA 2K9ZA 5FJKA 4N43A 4I0WB 2YXSA 2ZGQA 5DMYA 3OGSA 1UMIA 4A6OA 3R4UA 1SPPA 4MHUA 1H2LA 2XVGA 5F6LB 3TNQA 4QX3A 5FMCA 1JZ5A 2BWAA 3U1XA 1SBEA 5FTTC 5FLJA 5L19A 1RITA 5FXXA 5LWBA 2ZGLA 1NG0A 3VBSA 1VAVA 1W6QA 1ACCA 4AFMA 5EWSA 4D69A 4K21A 4LKFA 2V09A 4WVVA 2IXLA 2WS93 4CEYC 2J1UA 5CB7A 1JZ8A 1AX0A 2XGXA 4MGQA 3T4HB 2OQ7A 4YW1A 3SEEA 4XTPA 4YVWB 1VB2A 3KV6A 2VMGA 4HPKB 3T1MA 4N53C 2R6QA 5D8AA 3WDTA 1S1AA 2ADEA 4WVMA 4AHZA 1GNYA 3MYXA 1KFUL 2DCYA 2VL4A 4NOTA 1NUKA 4XURA 2JDMA 4YZ4A 1J3PA 1ZRFA 1UY2A 4Q0PA 1VMHA
chains in the Genus database with same CATH topology
4Q8KA 3E6BA 3NAPB 1VBB2 1O91A 2HWE1 4M00A 1BVP1 1GZ9A 1K5MB 2K0GA 4GWMA 1BBT2 4XJZA 4F3JA 4Q8LA 4WV8A 1TME3 3D82A 1HDKA 1JYIA 1WLWA 1WW4A 2JE7A 1QXRA 1RMU3 4UW6A 1ZBE2 1PIV3 3AZXA 4YW5A 3T2TA 1J58A 4Q29A 2Z69A 1TMF3 1CAUB 1UKRA 2X5IC 4EN8B 4XBNA 4LE3A 2EXKA 1F2NA 2A5ZA 3IT8A 4GB33 2WS91 5EV7A 4A7ZA 2VOKA 4JQRA 1UAIA 4L92A 4RQPB 3VBUA 3QBQA 3AMPA 1W6MA 2ZJCA 1ZVFA 3GYDA 3OY8B 1JBCA 2HEVF 1FNYA 2RR12 2IFWA 4P9JA 5AFBA 4UW5A 4DRRA 2GNMA 1QDOA 4OI0A 2DU0A 1B09A 4HSJA 1TME1 2PAMA 4WZCA 4YVSC 2WJSA 1GLHA 1H8TA 1Q8SA 1MQTA 1RMU1 1YO8A 1PIV1 5C33A 1TMF1 4CDQA 2XWJB 4XFHA 1ULGA 1H2NA 1NE4A 3FUQA 4GB31 1WW7A 4XF0A 3NWKA 2QZ2A 1W6PB 3PLQA 5DG1A 3HMYA 1ZYBA 1QU0A 3H7YA 2RM21 1V6JA 1S0EA 4N53B 4DS0A 3IPVB 1FX5A 4LBOA 4OULA 5GLTA 1UD1A 3VBOB 2ZPXA 1KJRA 4FT8A 1GNZA 4F83A 5LEJA 3DPRA 1SBFA 1AUYA 1NA1C 4RGAA 5E89A 3M4FA 2BTVC 5IK8A 4NHLA 4S2HA 1CAVA 3BODA 3WHUA 3V0BA 5CAZA 3ACLA 2JE9A 4PF5A 5BNNA 1J59A 4BE3A 1DF0A 3VBFA 4YNIA 3WG1A 4Y1YA 4YG0A 1WMEA 3AJZA 4LE4A 4XILA 4BZ4A 5GZFA 4XXPA 4BA6A 2WKKA 4AVTA 4FPGA 4XIOA 4LLFA 3RS6A 1CPNA 1LOFC 2A7AA 2WQZC 3H0OA 1WBFA 4LA2A 3LGRA 1OQEA 1MACA 1APNA 3N7KA 4S2FA 1AJOA 4Z07A 2ZGUA 4P9WA 2BQPA 1PO13 2D6OX 2ZACA 2VU9A 1IPKA 1QOOA 3ZN6B 4ZKTB 5C4WA 2WLPA 2WT2A 3FHIB 2XWBB 5JZGC 3VZNA 1IPJA 1OD5A 1C28A 1EAH3 2RE9A 1YXWA 3VBHB 3ASIA 4IEQA 4FQZA 4DXZA 3H3UA 2XG3A 2E7AA 1CAXB 1KS5A 2R062 3E97A 4OHVA 4OVEA 4RR3C 2QE3A 4CYDA 1AL22 5LK7B 3B69A 1VRH2 5DUXA 3S7IA 2DV9A 2BNOA 5JAXA 2GNDA 3ZIXA 4FTSA 1YYNA 2IXHA 4Q4W2 5T3NA 5JIUA 2ENRA 2XBO1 2CYFA 2Q5TA 5BXXA 4HT1T 1FYUA 1V6OA 3MIEA 1NY72 3HD8B 4PDWA 2IWGB 1JW6A 1NA1B 3CL1A 2OW4A 2VECA 1MS1A 3ZSEA 1RUF3 3D5OA 2IC1A 1PO11 1QOTA 3LKJA 3VUOA 4FO9A 1LESA 5JLVA 1PK6B 2RS53 1REDA 1ULEA 3J8F3 3KD4A 1YFWA 4AGRA 1EP0A 1SBDA 3HBZA 4B29A 2QFEA 1AYM3 2VOVA 1EAH1 4Q4Y2 3RMYA 4YSFA 2XB6C 3GBGA 3E6CC 3VL8A 2ET1A 1O3RA 2PTMA 4JC1A 1ZBA3 1IKQA 4H7MA 5H9RA 1S2KA 2RHPA 5CIRA 2ZX2A 4DRVA 3VBRC 4E27A 2D3SA 5BNPB 3JD73 4LO8A 4K40A 2ZGKA 2XJUA 4DMIA 3AYCA 1RVF1 2PHFA 2B39A 3MF9A 2G9GA 3TBDA 1C8M3 1OLRA 1RHI1 3POWA 5I8SA 3RDIA 5I0RA 4M01A 1NCQA 2D6LX 3ES4A 5J96B 2JG9A 4GH4A 4S2GA 1O4YA 1R1A2 5SV5A 2R0FA 4D7TA 5JZGB 5C8WA 5C8CC 1OOPB 3NO8A 4EROA 5ACA2 3UV9A 5L36A 2ZHKA 1V70A 3J8F1 3B02A 4AQTA 3VBSC 5EJ3A 2CGPA 2B8MA 4GQ7A 2NLRA 4LBNA 4DY5A 1AYM1 3ZXGA 5HCFA 5L7OB 4XHXA 3OCPA 4N9IA 2JD4A 1DZRA 3D4KA 2WS92 1ZBA1 1NXD1 4MGZE 3FX3A 4RS5A 4AYUA 4LBKA 4BIFA 3U0ZA 3ZMNA 4FSJA 2WFF3 4PLOA 1Z78A 1H2KA 4IV3A 2GN3A 3IIAA 5FREA 5SV8A 4I0BA 4HKOA 2FZ2A 1OPOA 1QF3A 5KC5A 2OIIA 3DF0A 4KG8A 5AVPA 3WOGA 4I2OA 5F5QA 4KWJA 2WA4A 1BMV2 2XHKA 1PGL1 4C1WA 1REEA 1Y43B 4C1XA 2DCTA 2MHFA 4QPIB 2E7TA 5I8YA 5FO8B 3ZXAC 1EV12 4XQWA 4WM8A 4WM7C 1NLRA 2R1DA 3ATGA 3AZYA 1UPSA 3VKLA 4QM8A 1O5LA 1TMF2 1B35A 3NL1A 3MFCA 4YM1A 2H6BA 1HW5A 4U2AA 3VBUC 3N7LA 1FXZA 2VXRA 1TE1B 2RM22 3VBRB 4COVA 3O5SA 2OZJA 1N1YA 4GMP0 3USUB 2WFF1 4XMAA 3NAPA 1DFQA 1VBE3 3U10A 5JVVA 2ZGRA 3O0XA 2HWD3 4UXAA 4IL7A 4NO4A 4PCRA 2AREA 2PHDA 1M06G 4OHYA 3O7OA 1FNZA 4QQHA 3O14A 3ZN5A 2WWSA 4A7YA 1Y9QA 3THTA 5DDJ2 1H1IA 1NQJA 3WP3A 2QDNA 3EQEA 4C0HA 2IXJA 1ALYA 3C3VA 4RFT0 4IEYA 3B94A 3GHNA 4QQLA 4RQPA 2UWCA 1PNGA 4AEMA 1RUJ3 4CDQC 5J98B 2WC2A 1YFXA 1V6NA 1CX4A 3Q9OA 3ROUA 5KXBA 1N3OA 2XJVA 4YZ5A 3A0KA 4M3CE 3AKQA 3FC0A 2PELA 3ZSJA 3VDDB 5GALA 1BVVA 1AL0G 4IV1B 3MICA 1FOD3 3SLIA 1PO23 1G7YA 1YCIA 4X8NA 4Q0UA 1SLIA 5FPXA 1MS0A 3BB6A 1D0GA 1FT9A 2HWD1 1RUC1 1PVC3 1ZZ7A 5T5JA 3HQXA 1RUI1 3UJOA 1I5ZA 1G9BA 1I1EA 4AQ6A 2Z5WA 3IDEA 3QH6A 4Y1ZA 2DUPA 1C5HA 2C1FA 3AZZA 5BNNC 3M3QA 3HT2A 4XFGA 4PBOA 5ABJC 4E2GA 1UU4A 2XL9A 4ZU4A 3ZFFA 4LLOA 3QLQA 1RUJ1 1POV3 2JG8A 3H7JA 3WR0A 2ZHLA 1IZ3A 2IZWA 5CADA 3VBOA 5FOJB 1ND2A 2ETEA 4BM8A 1VP6A 1AR63 3R4SA 1DGRN 5BV6A 4LBMA 2VW1A 4OI4A 5E8AA 4HVQA 2A70A 1UF2C 3AYEA 3WINE 1Q8VA 3KLSA 3RWNA 4BOWA 3DUIA 2XBO2 3KT4A 1FOD1 2BW8A 3SMHA 2GSYA 3TNPB 4MGYE 3MIGA 2A6ZA 4A3XA 5HI0A 4O9EA 4XBLA 4N7IA 5FO7B 3JBG3 3ZXLA 4ASMB 3SHRA 2VVDA 4XW3A 2YY1A 1RGSA 5CNAA 3K51A 5J36A 1IQAA 1ASJ3 3PNAA 1C8NA 1JUIA 2WINB 1EPZA 1J3QA 1KFXL 5KHJA 4AHYA 5H9SA 2P37A 1DIWA 4K6BA 1NQDA 1POV1 2DVFA 4E4ZA 1LKNA 1AYN1 1CAWA 1RUE1 1WCDJ 4ISQA 1RVF2 4AEKA 5JI9A 1RHI2 3WQ7A 5EYXA 1VBA3 3H1YA 4BHPA 1MVQA 3LA3A 4U36A 3R4DB 5KWRA 4CDWA 3JBG1 3ZMOA 3CNAA 3VZLA 1OQ1A 1CR7A 2OPKA 1SCSA 3AP7A 4Y5Z0 4PBPA 3RZZA 4COYA 3FZ3A 2R49A 2VOXA 1H1AA 3J8F2 3E6DA 4QGNA 1H1MA 2R30A 3WX5A 3LZZA 1ASJ1 4FPKA 3M7AA 5ABJB 5CFDC 4QPGA 3KCCA 3FFZA 4F8AA 2HKXA 3GNEA 1QOSA 5A3MA 4MXWA 3BU7A 2OZ6A 3U07A 3AKSA 4K1YA 1H4GA 3GBFA 4LR4A 2E9QA 2JX9A 4C90A 4AEDA 1NCQC 3CF6E 4IXLA 1VBA1 2JG9C 1PGL2 3MIDA 4L11A 4GH4C 1AF9A 4MXVA 4G9SB 1GFF2 2BVVA 2D40A 3GZAA 4L9BA 4MGKE 1G9FA 2PA7A 1VR3A 4UW4A 3OBRA 1VIWB 2AENA 3V0AB 1LHVA 2GNBA 3ENRA 1LB2A 1N47A 5FMOS 1LODA 4W6YA 1UIKA 1ND3A 2ZGMA 2WNUC 5BNPA 5KXEA 4CEWB 5EFUA 1WUVA 4LA3A 1LRHA 5CA6A 2CAVA 4OHWA 1FV2A 1SACA 4JDNA 2R073 1R092 5DUVA 4IV3C 4NN0A 1MS4A 4DB5A 2HWC3 3J4UH 1GNHA 1BXHA 2VULA 1AR83 4XJWA 3CU7A 4AVVA 3JCIA 2N7GA 4KWKA 4H7LA 2Y38A 2EAAA 4GWNA 4CDXC 3ILRA 1XRUA 5FAXA 2HWB3 2R043 4XF1A 3AK0A 5L7OA 2C5DA 4P5HA 2XUMA 1FATA 3ETQA 3MW2A 4WM8C 1F8VA 1AJKA 5IK4A 1WMFA 1Z7S3 2QZ3A 2YYOA 4HSLA 4ONUA 4JRAA 2X8KA 4IESA 4QX5A 3GALA 1XNDA 4HK9A 1QJU2 5CBLA 3I59A 4QQ2A 4YLZA 2O8QA 1Q8PA 3AFKA 3H1WA 5CU1A 1HQLA 4RHV3 1C4RA 3SH4A 1Y3TA 4KWLA 1A8DA 1J3RA 2ZMKA 3TN93 1MEC1 5JOWA 2R071 4I3GA 3WT3A 4AI0A 3UJQA 2HWC1 4QPIA 3URFA 4AI2A 4L99A 4MV2A 2HWD2 1AR81 1GYKA 1RUC2 3B01A 1LHUA 4BMEA 4AVCA 4FTEA 1RUI2 1XE7A 2PHWA 2D3PA 2VNOA 1RIRA 3AB0A 1AR93 4JGYB 3AP5A 1VB4A 1U5IA 2HWB1 1V6KA 4W6WA 4YM3A 2R1BA 3CO2A 2DUQA 2ZHNA 2GU9A 4UBHA 4BLIA 4KGQA 3GZUC 1FPN2 5EZWA 1D0HA 3O0VA 3AKPA 5BNOB 1Z7S1 2BWCA 1DYPA 5C9AB 3POYA 4HBNA 1H9PA 1H0BA 3D8CA 4R52A 5A33B 4H55A 4YRDA 3A4UA 1RINA 2BFUL 3DGTA 2E53A 4RHV1 3WP4A 4N7UA 3W9AA 2PYTA 3EO6A 3TN91 2WL1A 3OPZA 2W52A 2ES3A 3RSJA 5DG2A 1WCKA 1YLLA 2AH2A 3ZYGA 5JOYA 4AVAA 2WZR3 3M70A 5DZFA 1O7FA 4CDXB 3L2HA 1Q56A 4KQ7A 2I07B 4W65A 4JCKA 4AHXA 2WNVB 4DFSA 1AR91 3ZXFA 3RI8A 1MS9A 4AFBA 1QJX3 4IEWA 1X7NA 5FLIA 5J3UA 3G7DA 2DCJA 2BYVE 2VGDA 4UBGA 1S0CA 1LOAA 1TQ5A 3GHMA 4IV1A 4YZ1A 1AYN2 1LGBA 4Q4X3 4BLJA 1HRI3 1VALA 1F5FA 1RUE2 5CG8A 4CDUA 5BY5A 3WW3A 1GZWB 2LUWA 5FQ0A 2RJLA 4FAHA 3VKNA 1RUG3 2ZGNA 2XVLA 3OF1A 3HN1A 4XFIA 4B8EA 2W0XA 4Q27A 1WCSA 2LTNA 3FLRA 5T5OA 2RS13 3WW2A 3QACA 2BPA2 2WZR1 5DUUA 3MF6A 4EWEA 5IK5A 1WMDA 4DY3A 2HYKA 1RC6A 1W6OA 3WVJA 2G4IA 2ZHMA 4C91A 1F5JA 4JTOA 2ILMA 4TWTA 1ASJ2 3VHOA 4FPJA 3PVOA 1QJX1 2UY9A 5C6CA 1BYHA 1SDWA 1ZZBA 5KBFA 1LU2A 3AYDA 2BVBA 3WG3A 2FHRA 2UU8A 2UYBA 2ZMLA 4CEYB 1PNFA 2KM2A 4Q4X1 4XTMA 1HRI1 1BJQA 1NOVA 3UK9A 1SFNA 3AX4A 3GF6A 4B4RA 1CONA 4LULA 2Y26A 4YZ2A 1MVEA 1RUG1 2Z42A 1VBA2 1D4M3 2PLV3 4AGGA 2CL2A 1YI7A 2RS11 4MH0E 3QCWA 3FMGA 3JZVA 1PM7A 1MS3A 1RUH2 2GC0A 4B3NA 4LBJA 2ZKLA 2D97A 4OI2A 2ZTNA 3FBYA 3SNMA 4Y22B 2BGCA 1JH5A 3WG4A 4K8FA 1U5YA 3BCWA 4QPGC 2X5IB 2CTVA 1HX6A 3ZFGA 2EA7A 3D0SA 1OA3A 4AW7A 1LOEA 1NCRC 4LBLA 3NV1A 1QQP3 1DGWA 4AEDC 2CAUA 3LB9A 1D2QA 4YGEA 5I0TA 1YNAA 2FZ1A 2XJTA 1D4M1 5J09A 3ZYJB 1KJLA 3N7MA 2ARXA 1GBGA 5GM0A 4JGZC 2NMOA 1U5XA 2V5YA 5GLZA 1OA2A 4YW3A 5A32B 3TB0A 2D98A 3N36A 1HRV3 1ND3C 2VNGA 4YVSB 4META 4LBQA 4LHKA 5DZEA 3QOPA 1JYCA 2IXCA 4QQPA 2AYHA 4HK8A 4RA0A 1S0BA 3WLUA 5J7MA 3MIBA 2YGMA 2HWF3 3WCSA 1MEC2 2JXAA 4NWWA 4FP3A 3JU9A 4FPLA 4HN0A 5JR7B 3PVNA 5JOXA 4Y1XA 4INDA 2HEYF 1CVNA 2DCKA 1PZ7A 3VHRA 3FWEA 1QQP1 1ZZ8A 5F9TA 5K0UC 3SISA 1LULA 1DDLA 2AR6A 1Q5OA 2IXIA 2XKPA 1OPMA 2JJ6A 3AXEA 3V0AA 4HVOA 4ZXKA 4AI3A 4IEPA 3IKWA 1YJKA 1QJY2 3H8UA 4EWDA 4XQDA 3E5UA 4CEWA 4NR1A 1LJ7A 2WNEA 1DQ5A 4QGLA 2GMPA 1ZZ6A 4ZU5A 3U11A 5E16A 4HANA 1QGLA 2DCZA 5BPXA 5CFCC 4OZXA 3ZFEA 3ZXDA 2A3YA 3SH5A 5BNQA 1A3KA 2UURA 4RHV2 3MIFA 4ISRA 1YFUA 2I74A 1EPWA 3TN92 4FCAA 1NCRB 2HWF1 2JECA 3MI8A 2BBVA 4YM0A 3QH7A 4BPZA 4Y1UA 2XJRA 1KQRA 2YMZA 3B9CA 3MZHA 3P3NA 2A6WA 3WY6A 4AVBA 1LOBA 1BEV3 3M1HA 2CWMA 1BCXA 4LUMA 1G8WA 1ENQA 2D6MA 2WT0A 2LALA 2RS33 1EYBA 4Q1RA 4EN6B 3OJBA 3S0MA 4JGZB 1UU6A 1G9DA 1X82A 2HWE2 4N43C 3M3IA 2PHUA 2Z79A 1HV0A 2ZZJA 3CJIA 4F7ZA 3DV8A 1CQ9A 2RMU3 1PVXA 1RUF1 3LOIA 1OKQA 1I3HA 4LUKA 4M3CA 4XYXA 1AHSA 2PFWA 3NKGA 2RS51 2OVUA 3RPQA 3PJYA 3NW4A 2YC0A 1ZA4A 5FPZA 1V9U3 4QXKA 5HCAA 1YIFA 4K1ZA 1CESA 4X6RB 1RUD3 2ZA9A 4RR3B 2XPJA 4YG6A 1W6NA 1GR3A 1SCRA 3WV6A 4E4DX 2QUOA 2ZOEB 5K0UB 5D8AC 3ELNA 4LNVA 2A71A 3JD71 4JGYA 2VNRA 1AXZA 3I4IA 3RYRA 3N3HA 4Y1VA 1X36A 3KT7A 1BEV1 4HVRA 4E2SA 1C8M1 1VBC3 3BIWE 2HEWF 5T5PA 4TZDA 2A73B 5C9AA 3PMEA 5FRAA 3DN7A 1ENSA 4COWA 1AXYA 1IOAA 5I8TA 3OYWB 3PMSA 5A33A 2JENA 2RMU1 5DUWA 1TME2 1QJX2 2ET7A 4IERA 4XFCA 5CFCB 5J48A 2D5HA 5H9QA 1RMU2 1PIV2 3HR9A 4BMBA 1MZFA 4YVWA 4HPKA 1V9U1 2D6KA 4A2UA 4GA9A 3IDCB 4Q4X2 4B7KA 1HRI2 1RUD1 4GB32 4RD7A 4FOYA 1HXS3 2XLAA 2ZKNA 3B7MA 4Q4V3 1RB8G 1RUG2 4XE9A 1MZ5A 1Z0HA 4KH9A 2WNVA 1K5MA 4JRLA 5B2GB 1ONAA 2PN5A 2XJQA 5AC93 3ZYIB 1IS4A 3KGLA 4N43B 3AMMA 2WSVA 4Q1PA 4K7JA 1POV0 1O4ZA 3WDVA 1CAUA 4YGCA 5C8CB 3ZO0B 2XVKA 1DGLA 3D6EA 4R4XA 1XNCA 4FPHA 4MUVA 3VBSB 1W6QB 1H8TC 3V64A 2CGNA 1MQTC 4JDOA 4LBQD 1DYKA 5BUVA 1FMD3 3KSCA 3MPBA 2YHJA 4HFSA 1UCXA 1YHFA 4KL1A 4AQSA 4E4SA 3OY8A 1QXPA 4BH9A 1JN2P 1AR73 1U5ZA 1HXS1 5D8AB 4WVMB 4Q4V1 1IHMA 3AJYA 3NV4A 2QCSB 1S0IA 4AGVA 3KZ4C 3I54A 1OQDA 4LEJA 4FPYA 1VBE1 2JKBA 2YV8A 2PHRA 2VH9A 3B9IA 5D1IA 2DTWA 3DPRC 4AE2A 3W59A 5KHKA 4FXGB 5AC91 4AVSA 5JSPA 2GAUA 3LA7A 2FBEA 4DOUA 2O0OA 1GQHA 4PIYA 3JQXA 1PGSA 3MIHA 4WM7B 3VBFC 2EF6A 3ILNA 1W6PA 2XH6A 3IM0A 2ZX1A 2NPIA 2OUHA 4N53A 4O9GA 3IPVA 1FMD1 2GDFA 3JUUA 4HETA 1J1TA 1LHWA 2HJIA 3LOBA 2ZS6B 3VBUB 4K3UA 3FFQA 3VZMA 1Q8OA 4GMP3 4PQ9A 4TYSA 1AR71 1VBB3 1W6MB 2K2SA 1BBT3 4XFAA 1QH7A 4BQ1A 4QGMA 4AI8A 4WZFA 2XLGA 3O12A 1PO21 2R32A 1I6XA 1C5IA 1ZBE3 2FMDA 4XF9A 1PVC1 1PO12 4Z8BA 5C4WC 4P9YA 4B7EA 2D7FA 1N1SA 3ST7A 4KBBA 1VJ2A 1S0DA 1EAH2 2VW0A 2XJSA 4P14A 4HKWA 1GQGA 3RI9A 1ZRDA 1BZWA 1XU2A 4CDQB 2PQQA 2B46X 2CY6A 1ULDA 4FPOB 1LEDA 1RTVA 2RR13 4AFAA 3PTYA 1AR61 2ZGOA 4BWOA 1VBB1 1Y7BA 3ZN6A 4K20A 4BCUA 1BBT1 4QHBA 3WXPA 3OD4A 2KXLA 2Z2SB 3DPRB 4PDWC 4YVSA 2AZ5A 4TSVA 3VBHA