4OFGA

Co-crystal structure of carboxy cgmp binding domain of plasmodium falciparum pkg with cgmp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
DASIDYNNKKSIIKKMYIFRYLTDKQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEIVKNKKRLRTLGKNDYFGERALLYDEPRTASVISKVNNVECWFVDKSVFLQIIQGPMLAHLEERIKMQDTKVEMDELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CGMP-dependent protein kinase
publication title Crystal Structures of the Carboxyl cGMP Binding Domain of the Plasmodium falciparum cGMP-dependent Protein Kinase Reveal a Novel Capping Triad Crucial for Merozoite Egress.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 44
structure length 142
sequence length 142
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ofgA00
3PLQA 4P9GA 4ZU4A 3UKNA 4FBFA 4EWAA 1J1LA 2GU9A 2MNGA 3LA2A 4WBBA 4IEWA 2Z69A 2CAUA 3ST7A 1ZZ9A 4B29A 2IXIA 3CEWA 4L11A 1RUNA 1XE7A 4KWLA 4FAHA 4OFGA 3KCCA 1RC6A 4E2QA 5FPZA 4BIFA 4JV4A 3H7JA 3RYRA 1QXJA 5BXXA 2XKPA 5LEKA 3BCWA 1SQ4A 1G6NA 1OFNA 2D40A 5EZWA 4MV2A 4JVAA 4Q29A 5FQ0A 1X8MA 2FQPA 5HI0A 5I8SA 2GZWA 2OZJA 2VPVA 2WC2A 3DKWA 4MGIE 2ETEA 5BUVA 4JTOA 2OPKA 3E6DA 1OD5A 1ZX5A 1V70A 3HIFA 4K8FA 4H7LA 5KHJA 3RPQA 1IPJA 3BPZA 2PFWA 2UYAA 3GYDA 2XLFA 4QM8A 4MZUA 4Q0UA 2V09A 3WW4A 3TNQA 3M3IA 3H8UA 4XEZA 2D93A 2C0ZA 3E5UA 3KGLA 2XL9A 3DN7A 3QACA 4PIXA 5F1RA 4PJYA 2Z2SB 1UW8A 3HQXA 4LUMA 4QM9A 1SFNA 2OA2A 1HW5A 4WZCA 1NE4A 5LRSA 4IEOA 2Y0OA 4FAGA 1CX4A 4LUKA 4XF0A 1H1MA 2O8QA 1CAUB 4XF9A 2BGCA 4Q0VA 4A2UA 5BV6A 3I7DA 1CGPA 3N4MA 1LKNA 4KWJA 4D7SA 1J3QA 3USSA 2UYBA 2H6CA 4HVRA 4IEPA 2Q4SA 3E6BA 1I5ZA 2FMYA 3DV8A 3R6SA 3NW4A 3I59B 3QOPA 4CYDA 5J7MA 2HKXA 5FLJA 3EBRA 4XFIA 4AVBA 1X82A 2CV6A 1DGRA 3LA3A 4KWKA 2ET7A 5J48A 3FWEA 2KXLA 3H3ZA 3H7YA 4AQ2A 3ETQA 3D0JA 4ORFA 1DGWA 2K9ZA 2QJVA 4ONUA 4HSLA 4MGZE 3IWZA 2H6BA 2XKOA 1UIJA 5C6CA 3D0SA 4YYOA 1YFXA 5T3NA 1ZZ7A 4MGYE 4XF4A 5AVPA 1NZCA 2QCSB 4E2GA 4IETA 2MPFA 1GQHA 1WLTA 3U10A 3SCGA 4AVCA 4QX5A 4HVOA 3OD0A 3DL3A 2GC0A 2D5FA 3LWCA 2GAUA 3NJZA 5E16A 4HZFA 4Q0PA 3MZHA 1NE6A 1LRHA 2BYVE 4F8AA 3LOIA 1Y9QA 1Q3EA 1PM7A 2GH2A 1UCXA 3LAGA 4TLFA 3BALA 2ZKLA 3WW3A 2MHFA 4Q0SA 1Q5OA 4Z07A 3RNSA 4I09A 1O3SA 4IEZA 5C8WA 2XHKA 2IXLA 1CAXB 3IIAA 4EROA 2K0GA 4MGKE 2BNOA 3E5XA 3WW1A 3H1MA 2D5HA 3NKTA 2GC1A 3SHRA 1O5UA 1ZVFA 4XF3A 5KHKA 5I8TA 3FJSA 4PIZA 1UIKA 3H9AA 2E9QA 2VECA 1YFYA 5FLIA 4UXAA 4BH9A 4GULA 1X8EA 1IPKA 3UKTA 5I93A 4YNIA 3FZ3A 3EJKA 4BHPA 3SMHA 4QGNA 5LEJA 1DZRA 1J3PA 4BYYA 2Q0AA 2PAKA 4EV0A 4MUVA 1CAWB 4IEVA 1DZTA 3JZVA 4N9HA 2DCTA 4JTNA 1ZZ6A 5FQ0B 4I2OA 1QXRA 2EA7A 3NVCA 4OLLA 2BEOA 4EWDA 3ZDSA 3OF1A 4FT8A 4ZU5A 4HN0A 5CU1A 5KHGA 5JSOA 1WA4A 1WGPA 1ZNPA 4KU8A 3ES4A 3M70A 1ZZCA 3H3UA 4I02A 4XF1A 3RZZA 4IERA 5BY5A 5KBFA 1TQ5A 1U12A 3HT2A 3C3VA 1J58A 4N9IA 1O3QA 5EFUA 3BB6A 2QDRA 4WVZA 3U11A 1RUOA 2ATFA 1O5LA 1FT9A 1YLLA 3UKVA 5K8SA 4IEUA 3CL1A 3KMHA 3RYKA 4AVAA 1QWRA 4LULA 1UD1A 3CF6E 4KU7A 4XETA 5I91A 4Z82A 1CAVA 2P17A 2PQQA 3ES1A 4MX3A 4HLTA 2N7GA 3FFQA 5CVRA 1ZRFA 2H0VA 2B5HA 1EY2A 4XFGA 5I8YA 3G7DA 3L2HA 5FPXA 5I0TA 4LA2A 5JAXA 2VQAA 1XE8A 4HN1A 4XFBA 1JUHA 3LZZA 3FHIB 1XRUA 3OCPA 4XFAA 2O1QA 1O3TA 3H1YA 4QGLA 4X6RB 3SCFA 2QVSB 3WW2A 3IDCB 3OTFA 1LR5A 4I0AA 3E6CC 2HJIA 5E1RA 3RDIA 1ZRRA 1ZRDA 3IBMA 3ROUA 4QXKA 3RYPA 5I0RA 3OGJA 3TNPB 1OI6A 2EAAA 3MPBA 3NL1A 4I3PA 2WFPA 4HBNA 1YWKA 5JR7B 1NYWA 1CAXA 3O14A 4Q0QA 3ELNA 1EP0A 1YHFA 4UBGA 1OMIA 4XFFA 3LA7A 3S0MA 2PHDA 4QMAA 5KHHA 2ZCWA 3I54A 5JSPA 4META 1J3RA 2IXHA 4YRDA 5JSRA 1FXZA 4IEQA 2UY9A 4UBHA 2XL7A 2PYTA 4EWEA 1Q43A 5FCCA 4NVPA 4O9EA 2XLGA 4O9GA 2QNKA 4R52A 3CLPA 4DINB 2Q30A 1EYBA 1VP6A 1YFUA 1UPIA 3EQEA 4XFCA 1CAWA 4D7TA 3B02A 5FDBA 3E5QA 5KHIA 3H1WA 1ZZBA 3NSTA 4HMZA 4QGMA 4R8HA 1ZZ8A 4LLOA 4XFHA 3FX3A 4L2NA 5CADA 2XLAA 2OZ6A 2I45A 3IDBB 2IXCA 1YFWA 4LTAA 4IESA 1SEFA 4J1WA 1VJ2A 4J1XA 3GBFA 1I6XA 1QY4A 1RL3A 1FI2A 2B9UA 3EO6A 5LRRA 4I0BA 1O4TA 1J59A 2PA7A 2PHLA 2PAEA 5BPXA 1CAUA 4F7ZA 3S7EA 1X7NA 2XGXA 5D1IA 1RTVA 3EHKA 4HSJA 4HVQA 1O7FA 1L3JA 2IXJA 1PMIA 4YARA 4LA3A 3SXWA 2EVXA 1Y3TA 2GC3A 1EPZA 2CAVA 4I01A 3I59A 1LB2A 2PTMA 5JCTA 2Q1ZB 3BU7A 1RGSA 4KL1A 1NXMA 3U0ZA 3H50A 1O3RA 3D82A 3S7IA 3KSCA 1ZRCA 4PIYA 3PVBB 5J3UA 5I0SA 4RD7A 2BNNA 2UY8A 3HT1A 5FLHA 1ZREA 1YUDA 2IC1A 1H1IA 3E97A 4MH0E 3CJXA 3ACLA 3MYXA 2OYZA 4E2SA 3SCHA 2F4PA 3FE5A 2B8MA 1CAVB 5I0UA 1VR3A 4X6QB 4IEYA 2IXKA 4YSFA 4AXOA 2CGPA 4IEXA 2BNMA 4AQ6A 1GQGA 4LEJA 3VHRA 3MDPA 2GC2A 3KGZA 3CO2A 2ET1A 2PAMA 4ZU7A 3PNAA
chains in the Genus database with same CATH superfamily
1MQTA 2AACA 3OUJA 2D6MA 2R0HA 1DZQA 4ZU4A 3UKNA 1MZ5A 1YJKA 2DTYA 4E9KA 5A32A 1HXS1 1VE0A 2Q1MA 2Y0IA 1J1LA 2DCZA 3AP7A 3LCPA 2SLIA 3ECQA 1HQNA 4QQ2A 3JD71 4IE0A 3ST7A 5CFCB 4URTA 4B29A 1QJEA 1QJU2 2IXIA 2DURA 3RG0A 4AOCA 2IVJA 2LUWA 1AX1A 4WVMA 4BMEA 4IV1B 3HQUA 5CISA 3AZXA 4UI9L 4YW7A 1XE7A 4Z92B 1JW6A 4K40A 4AW7A 1K5JA 3CBNA 4AI0A 3GJAA 2RDSA 3T3YA 2W87A 1LEDA 5A7NA 4ASLA 1XXNA 4YG0A 1VRH1 3WG3A 4ATFA 2KM2A 1QF3A 2JKXA 3NJYA 3V64A 2YFZA 5A3PA 1QXJA 4FPYA 4AFCA 2XKPA 1EUTA 2ZGTA 4DXZA 1HIXA 2ZEWA 4Q4V3 2XHNA 1OFNA 3PVEA 2C24A 4MV2A 4JVAA 4NJ4A 1JHJA 2GZWA 4I3GA 2WC2A 1T2XA 3WVJA 1BVVA 1QHDA 1RUF2 2JIGA 2Q1FA 2JEMA 3A0KA 4FFFA 4QPWA 3I3MA 2VZSA 4MGIE 4S2DA 4AZZA 2KD7A 5FZAA 2IFRA 2BJSA 3O1MA 1G86A 1JOBA 4PLOA 1FPN2 2ZTNA 1VMHA 1S0BA 3WG2A 3KHCA 3HIFA 4S2HA 2QE3A 2Z5WA 4K8FA 3WP3A 3D6EA 3K77A 3RPQA 3LFIA 1QQP3 4IGPA 4CDQC 2PFWA 1VBD2 1VPHA 3FLTA 3GYDA 4JDMA 4BQ3A 4ATEA 2Y6JA 2XLFA 4Y1ZA 3PVOA 1ULDA 1OBNA 1V9U1 4Y1XA 3ZSJA 1GZWA 3ZPOA 3H8OA 3MIHA 3WW4A 1U0AA 1P8JA 5DAPA 1PO22 3M3IA 3P1IA 1AR71 2BQPA 2C0ZA 2D93A 3GALA 3P5BA 4JKLA 2XL9A 4CSWA 1MR5A 4FI9A 2CL2A 5AFEA 2W1QA 2LW8A 2XJQA 2EIBA 3I3DA 3QACA 1BKZA 2CY6A 2WABA 1EAH2 3CKHA 4A3XA 3U78A 1RVF2 5IVVA 4NPMA 1XJAA 1VMJA 1F4HA 5F32A 2RM21 4A42A 5JI9A 3GM8A 2VOKA 4JKKA 3ZXJA 1ASJ2 4K1YA 1LNSA 1D0HA 4LKSA 1VBB2 4QM9A 2FDHA 1W6OA 4XTPA 3WG1A 3GCXA 2P6CA 4BWOA 1RUG1 1IS4A 3INAA 1NE4A 3J26N 3J9SA 4XBNA 1JYNA 1MVQA 1UWWA 2Y0OA 4LUKA 5LBEA 2O8QA 1BHGA 1TME2 2PHUA 1CAUB 4S2FA 4E8CA 5A3UA 2RS51 1GR3A 4Q26A 4A2UA 2HWB3 3UJOA 5BV6A 2IWGB 1XYNA 1MZFA 1X9PA 1NT0A 3GJBA 5KXEA 1CGPA 5F9TA 2DBIA 5EV7A 3M4FA 3IZOA 4YLZA 4YGCA 2H6CA 1LHVA 2XUEA 2UWCA 4IEPA 1QJY3 4CCOA 1QOTA 2VTXA 1LGNA 1MS4A 4N7UA 1VBE1 3WDYA 3LEIA 1ZA4A 4N53B 3R6SA 5L9VA 2YV8A 2BFUS 1GANA 2I2SA 5HV0A 1WKYA 2GP3A 4CUCA 2EF6A 3QOPA 4P9IA 1SCSA 2OS2A 1SLCA 3IM0A 1ULEA 2JDAA 3B9IA 3DCQA 3ZFFA 2JDZA 3LA3A 4KWKA 5IK8A 1HXS3 4M3CE 5FZ8A 5FZ7A 1BEV1 4AGVA 1JUIA 3N9OA 4AQ2A 1SCRA 1WMDA 2C5DA 2DUQA 3JD73 4OQ9A 1YRZA 2ZXQA 1YCIA 1DGWA 4XCAA 2K9ZA 3WF4A 2QBXA 1OLME 3WF0A 3DXUA 5FYSA 4HSLA 3JBG2 1UF2C 2O0OA 1A8MA 2PN5A 3IMNA 1RUI2 4CDUB 5LB6A 3ZYFA 4XXPA 4NHXA 5GLTA 2W94A 3CDZB 3ZN4A 4YZ4A 4MSVA 3SNMA 5C6CA 4AFDA 1ZBA1 4LJHA 1YFXA 4XF4A 2BERA 2VNRA 4A3ZA 4E2GA 1VRH3 3NNFA 4TZDA 4AHZA 1SLLA 1WLTA 3NAPC 4QX5A 4AVCA 5A3WA 4GXLA 3OD0A 3RSJA 4UFIA 4ZKTB 1I1EA 4XVHA 2JDPA 3DL3A 5C9AB 4DUWA 1HV1A 1JODA 2GN7A 3UGHA 1IS5A 1PMHX 4H7MA 1MS8A 1RJ8A 5E16A 1MZ6A 4AI8A 5A6YA 2DU0A 4Q0PA 3APBA 1Y9GA 3WDUA 4UF0A 2ZX3A 4B1MA 1Q3EA 1PM7A 2GH2A 1QQP2 2ADDA 2HWC1 3GZEA 3LAGA 4PT6A 4TLFA 5CFDC 1HB4A 3C7FA 1H6YA 2HWF2 2VVFA 3BALA 5KXDA 5KC5A 4MO3M 4EN9B 4HT1T 4Q0SA 5C4WC 4Z07A 1H8TA 4HG6B 4GJYA 5GLUA 1U5XA 3WP5A 1EV12 2LRPA 2O8OA 1XE0A 4QB1A 4XJWA 5FXWA 4LBKA 4D8MA 4AEDB 3VHOA 5BNOA 2BOJA 1RUH1 2WNVB 3WF2A 5CG8A 1PGL2 2GC1A 2E53A 2PHFA 3TRSB 1GWKA 2EIEA 1RUD1 1ZVFA 1V9U3 2V72A 1ZM1A 3AZYA 4JGZB 4NRPA 4XJAA 5CYYA 2VECA 2DYCA 1VBC2 3OBAA 1AR73 4W4ZA 2XQXA 2HBTA 2GH8A 3CIHA 4BH9A 5IJRA 5J98B 1G9AA 4XAAA 1JZ2A 3ACHA 3POSA 5F3IA 2QQLA 5IK7A 4DUVA 4AEKA 2A6XA 2ZX0A 2VZRA 1DQ6A 3CZUA 1UZYA 1S4CA 3PUQA 2GNTA 1Z7S1 5LEJA 2R062 1J3PA 5C3QA 1PHMA 2VMEA 4Y33A 1DLCA 2RM23 1CAWB 1H2KA 2HWB2 2XJVA 1RXGA 1WW7A 1TNFA 1E5IA 3K75B 4JTNA 3HAGA 4EN0A 4P5HA 3PIGA 2WWUA 3W58A 3NVCA 1RUG3 3AYAA 5FOBB 1QH7A 5JXJA 2ZOEB 2BEOA 4QB2A 5DZEA 3X29B 4FPLA 4EWDA 3DGTA 4HN0A 5CU1A 2RS53 4NIAA 4UFHA 1JZ5A 1WGPA 4AHYA 1ZNPA 2YBPA 2B45X 3VBUA 3M70A 3MHZA 4JKMA 4RS5C 3NWKA 5FZKA 3NQHA 4XF1A 4CEWB 1OPMA 4IERA 4NHMA 4AAPA 4CU8A 1VBE3 4JRLA 1QJZA 5BY5A 5KBFA 4W65A 2VVEA 2XJUA 4OUMA 1GV9A 1S55A 2J42A 2ENRA 3RJ2X 4N9IA 2HLEA 5LASA 4D6RA 1FAYA 3KV5A 4YVSC 1PIV2 5A6ZA 4Z2WA 1R081 3BB6A 3MV01 4QX8A 1K3IA 4A45A 2Y6LA 3VDCA 3WQ0A 3U11A 3ZFEA 1NCRA 1BEV3 1E57A 1O5LA 5IHRA 4XUTA 5JMCA 1VRH2 2WDBA 3AKSA 4LBMA 1YLLA 2DWRA 3UKVA 3VDAA 3KMHA 3RYKA 4AVAA 1H9PA 4YZ3A 1UD1A 5IK5A 4HPKA 3CF6E 3WNLA 3AP9A 1H30A 5JOZA 1ZBA3 3KT4A 1Y9MA 3J8F1 3C2UA 3MV11 3I3QA 4HLTA 2N7GA 2VR4A 3A4UA 3MFCA 1ZRFA 1PGW1 3TEWA 4QQHA 3D3AA 1US3A 2VO5A 5I8YA 3I2OA 3KQRA 2P3YA 2ZZQA 3K4DA 3L2HA 3AKTA 2YGLA 2NM1A 4HN1A 3KV9A 2HWC3 1N1SA 1KEXA 4YPJA 1SFYA 4XFAA 4OI4A 2O1QA 5JZGC 4XUOA 5CA6A 1C5IA 4AL9A 4QGLA 1KS5A 3SCFA 3WW2A 2CNAA 3OTFA 1FV2A 1LR5A 2H0BA 2WWJA 4I0AA 4QHZA 2LROA 4ZZ5A 2HJIA 1S2EA 5JVVA 5C3PA 3RDIA 5LCWL 3RQ0A 1ZRRA 2ZGOA 4NOTA 1SDWA 4L92A 5FUNA 2XVKA 3GHNA 1U5ZA 2ZEZA 3ROUA 3UYJA 2VBBA 1RUH3 3VBOA 2YBKA 4QXKA 1K42A 3RYPA 5LZ6A 4BLIA 4LHSA 3TNPB 1RUD3 4NRQA 4COVA 5C33A 1W0OA 1X33A 1BVP1 2YBSA 5SV8A 1IQAA 1VB2A 2WN2A 3OUIA 3UK9A 2ZGMA 2WFPA 1W8ZA 1Y4WA 2BVVA 1V6MA 1NYWA 2A3WA 3AK0A 4HBNA 4SBVA 3HQRA 5FPVA 4YW3A 2XR4A 4BQWA 5A1LA 4CXYA 1OMIA 2V73A 1W2NA 4CU6A 4ZONA 3S0MA 1ND3C 1WLDA 4NN0A 4DZGA 4CTEA 5IAXA 2ZCWA 3I54A 4D3WA 5FUPA 1IS6A 1J3RA 1Z7S3 3AXDA 4HXCA 3ZM8A 2D98A 1XNTA 3WY6A 4ITCA 1BMV1 3MICA 1VB4A 1AL22 2XL7A 1IS3A 4GA9A 4Y4YA 5FY4A 3USUB 1AYN1 3OGGA 1LHWA 1F8VA 1MS5A 1OF3A 5F7UA 3IN9A 5L36A 1NCQB 5LBBA 1NQDA 4TXWA 1CZVA 4MXVA 4PDWC 1EYBA 3KT1A 1PZ8A 4IE4A 4NAMA 4PBPA 3ZYBA 2JDHA 4Q2FA 4Y24A 4OHYA 1QKQA 4Y22A 1SHWB 2CHHA 2WO2A 3BODA 4KBBA 4LHNA 2XDVA 5K0UC 1RIRA 2RR11 1L7RA 5C4WA 3ZFGA 4CVUA 5L9RA 2VNGA 4CU7A 4B4QA 3RZKA 2Q8OA 5K9YA 5KHIA 3NSTA 3TYJA 1BEV2 4IV3A 3O12A 2WS91 1GWMA 4WM7C 4BQXA 2WNUA 1QOSA 3BPSA 4L2NA 4MOAA 3T4VA 3JUUA 2J1RA 2ES3A 4B7EA 5CAZA 2R041 1PX3A 2WZEA 3BOPA 4LHKA 4FFGA 1R083 2IXCA 1YFWA 1MEC2 1FOD3 1J84A 5FZGA 3MF6A 1SEFA 3VKMA 2R6QA 1RUE1 3CJIA 2VCMA 1REEA 1VJ2A 4PI2A 3PUAA 4EZ4A 5CFDB 3AB0A 3BU0A 4MGTA 3N9QA 5FYTA 1QY4A 4BQ1A 2DCJA 1G9BA 4GH4A 4NROA 4DO0A 4LPLA 4BQ5A 5IT6A 2YMZA 4FOYA 4UOJA 4LLFA 3WUCA 1AZDA 3VZNA 2QZ3A 5FY0A 5EHDA 5EJZB 5GZEA 2D6NA 4B3NA 5BPXA 1QJU1 2Z4FA 1SPPA 2A3YA 2VZVA 4GKYA 1HRI2 1LHOA 1UMZA 4HSJA 4R9AA 1YIFA 2HWC2 4CDXA 5CKNA 1AJOA 1OHFA 4HVQA 1O7FA 4ZY9A 1WWYA 3ZX7A 2W1UA 3WCSA 4DRVA 4O65A 3OPZA 2VG9A 1NXD1 5T50A 3U1XA 1UX6A 3O1PA 1LB2A 3I59A 1GOGA 2UWBA 5FY1A 1LOCA 3IPVA 4X8NA 3VZJA 5D8AA 1SZBA 5A7QA 4A7YA 2WUHA 1LHNA 5FPLA 1WCQA 5FOJB 2WIIB 1YQ6A 3H0OA 1MS9A 5CIRA 3LB9A 1HJFA 5LA9A 1RUH2 1WCUA 4YM2A 3THDA 3BIWE 3CNAA 4JGYA 5K4LA 4CXXA 2ZGUA 1AR82 4IW3A 5LA0A 1RUF1 1W04A 2VGDA 1SLAA 3GF6A 3LEMA 4CP9A 5GZGA 1KXGA 2AZ5A 2ZEYA 1MQTC 1GP6A 2OUHA 3OGRA 3PUHA 3WDXA 1YUDA 5FIXA 4HK8A 2WFF1 1REDA 3OOXA 5FMOS 2IC1A 5DAWA 5ANNA 2CYFA 4AHXA 1LJ7A 2YU2A 4P02B 5FXZA 4CPBD 2ARBA 4LBQB 5DAVA 2BVBA 1I5PA 1Z7S2 2Q8EA 4LO8A 3MW2A 4FOWA 2B8MA 2NYYA 3JB8A 2CGOA 1QNWA 3QLQA 3SH5A 4RS5B 3ITQA 3I2GA 4FFHA 3POEA 1PO21 4XDOA 2ZBJA 3PU8A 1LOAA 2ZPXA 2JDNA 4XMIA 1AHSA 3WP6A 4YSFA 1GNZA 1VALA 3BN6A 4AQ6A 5FWJA 1RJ7A 4XJUA 4NIGA 1JYTA 1HRV1 1AL0G 1DGRN 5A33A 3VHRA 1D7PM 3VZKA 1HJGA 1QIQA 3PJYA 1EAH1 3C7GA 1RVF1 1DBNA 3R4SA 2A6VA 3PLQA 2XG3A 1PZ9A 3DUIA 1QOOA 2W52A 4XDPA 4AI1A 3O1TA 2A6ZA 4H55A 3T4HB 3LA2A 1ASJ1 4CRQA 4IEWA 1MS1A 2GMEA 1VBB1 4V2VA 4YVWB 5FFOC 1OLQA 1SBEA 1ZZ9A 4PF5A 3PL0A 4Y4RA 4LBLA 4FSJA 2D6PA 3FC0A 2RR13 1DCSA 5FYCA 1FOD2 1TME1 2W3JA 4L11A 1KDMA 1IOAA 4FAHA 4OHVA 4NUBA 3HD8B 4OYUA 4QKDA 1YIPA 2WS93 5T55A 1V6KA 1Q8PA 1Q56A 3BVCA 4LKEA 3OYWB 4Q1RA 2Q8CA 3VKOA 4BIFA 3UJQA 4CP0A 2ZJCA 2R043 5J96B 2VW1A 3RYRA 4BQYA 3VBFB 5GLZA 2YDEA 5LEKA 3HBKA 3VHNA 1RUE3 2WL1A 2RG4A 1G6NA 2D40A 5EZWA 3K46A 2FQPA 2X5IA 1WW6A 2W92A 1S0IA 1ND2A 4IGQA 2VPVA 2WNOA 4LKFA 1RB8G 1PGW2 1DQ0A 5E88A 3O1UA 1US2A 2RVAA 2ETEA 4COYA 2OPKA 1OD5A 3N7JA 1Q8SA 1BK1A 1QJU3 1V70A 3JBG1 5FBJA 1AR62 2JICA 1RUI1 1WMFA 1LECA 1RITA 2V5DA 2W46A 5F5QA 2MEV3 4FQ4A 4UYBA 1JZ8A 5CZKA 5A3NA 4BPZA 4UAPA 3BPZA 2AUYA 2BFUL 2G4IA 2UYAA 2R1DA 2VMHA 3LKJA 5F39A 3VDBA 1TVGA 3OBZA 2D6OX 2ZHMA 3O1OA 4WVWA 1CQ9A 1TEIA 2JB8A 4LNVA 4V2WA 2VZQA 2DDUA 4Y26A 3TNQA 2W1WA 3H8UA 3LPGA 3E5UA 3LE0A 1LOFA 1ODMA 3MUY1 3VZMA 2WO3A 5DG2A 1BJQA 3ZXLA 3HEIA 1YYNA 3MLLA 1OLRA 1HB2A 1KD7A 1QQP1 1Q8VA 3I2DA 4IL7A 1W3VA 2ID4A 3VBSA 1A34A 2HWF1 4L0PA 1W6NA 4BISA 3J7HA 4NIDA 3T09A 3N7LA 5CBLA 2Z2SB 4JZRA 4BOWA 4GAZA 4QPGA 4HKOA 3ZFFC 1VIWB 2WFF3 2BW8A 4LUMA 3MBWA 2OA2A 4AI2A 1H0BA 2YXSA 5H9SA 4BLJA 1EV11 4BZ4A 1IQDC 2X53S 5LRSA 3NNGA 1GWLA 1U5YA 2C1FA 2HBUA 2VQTA 2VMDA 4MXWB 5K0UB 3UETA 3VHPA 4QX3A 1UOFA 4AK3A 4BMBA 3WX5A 2E51A 1DQ5A 3N4MA 1UYYA 2ZGQA 3KF5A 1PO23 4KWJA 1VBC1 1J3QA 4WM7B 4XAEA 2UYBA 3UL2A 3U14A 4RL7A 2GN3A 4Y1YA 1PNFA 3KV4A 1HRV3 1W99A 4Y1UA 3BTYA 4Q8KA 2J1UA 2VZTA 3VD3A 4C8DA 3NW4A 3LIGA 4OCTA 1EAH3 2C4XA 1W6MB 1RVF3 5T5JA 2RR12 2R061 1ST8A 3V65A 1JU3A 4HFSA 2VMGA 2WA3A 2BU9A 4A7ZA 5J48A 3FWEA 4M3CA 2KXLA 3PVNA 5FPBA 1ASJ3 3FLPA 1H4HA 1XYOA 1VBB3 1W06A 2J1AA 4GD4A 4ONUA 5IW0A 4FCAA 4U36A 1OLMA 5IFTA 4Y20A 4EN8B 1H8TC 4XHBA 1YQCA 2A75A 1TME3 1ENSA 5B2GB 1W8TA 1UIJA 2XKOA 1YQ8A 3D0SA 2I07B 4UW6A 3RI8A 4MGYE 4K20A 1GQHA 5BNOC 1I3HA 3P6BA 3KB5A 3SCGA 2NPIA 2YC0A 3TOJA 4NMIA 3GGLA 5HCAA 2GC0A 3WDWA 3F95A 2GAUA 1QJX1 3NJZA 4K21A 5JMOA 1PIV1 3MGUA 4W50A 1LRHA 3K48A 2MEV2 1UCXA 2WLQA 2O14A 2VUDA 1AR93 3AXEA 2YG0A 4SLIA 1V6NA 4XACA 4XJ8A 5FK7A 2MHFA 3ACGA 3DPRA 4OMCA 5FO7B 3WSOA 5EQUA 1O3SA 2BTVC 3ZKUA 3P3PA 1MQTB 3JBG3 1HN1A 4CA9A 1AXYA 1NA1A 1RUI3 2ZX4A 2J1VA 5IWFA 3T1LA 5A32B 3VBRA 2K0GA 4EROA 3PIJA 3VBHB 1DQ4A 3FUQA 4P00B 5FZOA 1PK6A 4K9SA 3E5XA 3JXSA 4HKLA 3NKTA 1W8WA 2WZ8A 1V0AA 3ZYGA 1DFQA 4NR1A 2GMMA 1ACCA 4XF3A 4E4HA 1PX4A 5I8TA 4WVMB 2TBVA 1W28A 3O1VA 2E9QA 5F3GA 4UXAA 1E5RA 2C9AA 2FMDA 5FZMA 3VBUC 3P3NA 2A70A 4D6SA 1UU4A 2YHJA 2WFF2 4M0NA 1X8EA 4RR3A 5GJ6A 3FZ3A 1BXHA 1AXKA 5FRAA 3FBYA 4BHPA 4CEYC 3ATGA 5EIYB 1SMVA 2HWF3 3FLRA 4BYYA 5FR3A 2YYOA 2JG8A 4EN7B 5FJKA 4IEVA 1DZTA 3T0BA 3JZVA 2KR2A 4N9HA 3ZXEA 3PTRB 4Z8BA 1DG6A 3O0XA 3ZFEC 4A6OA 1QXRA 4QXCA 1NCRC 2ARCA 5IFPA 1EV13 1CD3G 2R1BA 2ORXA 2VC9A 4AI3A 2ZGRA 2J1TA 1HRV2 1M4WA 3KQ4B 3ZDSA 1D0GA 2WZR2 4XZPA 1GNYA 4ZU5A 1FX5A 2B9VA 1WA4A 4YG3A 4XIKA 2B7YA 3UT0A 3ES4A 2JX9A 2VUCA 1VBC3 2VD7A 2WSUA 2D3PA 3BTAA 2RMU2 1V6LA 4LXLA 4BE3A 4FXGB 1GZCA 3ZR5A 3C3VA 5EJ3A 2XQRA 3DKQA 3T1MA 3WNMA 3I2FA 1GZWB 5F6LB 3VV1A 1O3QA 2R063 5EFUA 3GZAA 1LGBA 2ZGSA 3KD4A 1AL21 3B5LB 4WVZA 3HVDA 3C8XA 1WCDJ 1G9FA 4D69A 2WAOA 1OOPA 3TEZA 1CX1A 5FJHA 2ZAHA 3HNBM 2HWE2 3IIIA 3B69A 3ZKYA 2OPWA 5JI7A 2QQPA 2ZAAA 5I91A 4NPRA 3GZTB 3QD6A 1CAVA 2VOVA 3ZLIA 2PQQA 1G9CA 1TE1B 1W6OB 4XQWA 1O8SA 5ANQA 1MZEA 3VBOC 4UT5A 3RVHA 4ASMB 1ALYA 3FFQA 5JPNB 1NOVA 1AR92 2DTWA 4MLOA 2GNDA 2QQIA 5CVRA 4OI1A 1JTZX 2H0VA 3ON7A 2AREA 1LOGA 5C3RA 2XXZA 1DU3D 1JZ4A 1QJX3 2VQUA 3ILNA 1PIV3 5FPXA 3NJVA 3N9PA 1MEC1 2VQAA 1IZ3A 2B46X 4XFBA 1NG0A 1TG7A 1DQ1A 4LE3A 3FHIB 5G05L 5FZBA 5BNPA 3MFAA 4OHWA 4QX1A 2VNOA 3AMNA 1S0DA 3ZR6A 5FMCA 2WJSA 1ZYBA 4AGRA 4NAOA 3GXUA 3W5MA 4Q4Y3 5C9AA 5DZFA 2NP0A 2XVGA 3JB4C 3E6CC 5J37A 5E1RA 5DMYA 1N1VA 4WM8A 4FXKB 1ZRDA 5FZEA 3WQBA 3IBMA 4BK4A 4OHXA 1RMU2 3K3OA 5G04L 5C8CA 3IDEA 3AM2A 2F6BA 1HRI1 4OULA 1OI6A 1PO13 3R4UA 5A3LA 1GUIA 2EAAA 2AENA 1ENQA 3MPBA 4YGBA 4I3PA 3OY8A 5FXXA 3ZFGC 2BPA2 3WNXA 1HQWA 4NWWA 1C5HA 4XQDA 4FPGA 2VZ3A 5FYHA 3LA7A 2VOTA 4LBQD 3SLIA 2W39A 4IV3C 2LALA 4QMAA 2JG9A 5JSPA 2D7FA 2FZ2A 3POBA 2WNUC 2IXHA 4XCBA 4JHZA 2JXAA 4YRDA 4JGZA 1GFF2 2YUEA 4UBHA 3LOBA 1UL9A 2WWSA 3H8RA 4YFZA 3RZGA 4LITA 4YGDA 2ZGKA 4AEJA 1AR81 1BYHA 2DUPA 3LIHA 1FNZA 4NVPA 4FP2A 4O7XA 4UF0B 4O9EA 3WF1A 5IK4A 3CJIC 2ZMLA 4O9GA 1JN2P 2CTVA 1UQXA 1VAVA 3F2ZA 2Q30A 4FTSA 4MADA 3ILFA 4FQZA 4GH4C 5L7OB 3M3OA 1YXWA 2EXIA 3ENRA 3EQEA 4N90A 1CAWA 2V4VA 5IVFA 1GLHA 4QKNA 3SQOA 4D7TA 3SKJE 4NPLA 1GKBA 1C1LA 2PHRA 4DEVA 4IQPA 4HMZA 4PQ9A 5LA2A 5LW9A 3FFZA 5BNOB 3WT3A 2DVFA 2JD4A 2LS6A 4QX7A 4CDXC 1MVEA 3TAYA 2XLAA 4AVTA 4NHKA 1GMMA 4C1XA 3I3BA 4PLMA 2XJPA 1AL23 1XNDA 5D8AC 2QZ2A 3THTA 4QD2A 5DABA 1KQRA 4DB5A 4J1XA 3GBFA 2ADEA 1I6XA 4M4RA 4CEWA 5DPNA 5BNQA 4JGYC 2FCVA 1CPNA 3EO6A 5LRRA 4D0QA 5FZLA 2XOMA 1V00A 2P3IA 3ALQA 2JE8A 1Z0HA 1QJX2 5KXBA 1V6IA 4EQVA 4F7ZA 1XSRA 2VY0A 2NZ9A 1W9YA 3PUSA 1B35A 1FOD1 2YB7A 4E8DA 4AR2A 2NMNA 1DGWX 1X36A 4COWA 4IE7A 3IAPA 2IXJA 2E33A 1NLSA 1G8WA 4LA3A 1GOFA 3SXWA 2EVXA 4UFMA 5L73A 4Q4Y2 4MYEA 4OUEA 1EPZA 3LD8A 4M00A 3VBUB 1GOHA 2Q1ZB 2E32A 3BU7A 3DYMA 1RUC2 1MEC3 2D6KA 2VCBA 3LGRA 1C57A 4FPFA 4L97A 3WNKA 1K45A 3IAQA 4QDQA 4A4AA 4F3JA 1CR7A 3S7IA 1DYKA 3NO8A 5EXOA 4CDQB 4QPIA 4K8RB 4Y5SA 5DUWA 3VKNA 1D4VB 5J09A 3OPWA 4ISQA 1SLBA 1N47A 5JOWA 1F35A 3B9CA 3RI9A 1PO12 2ZGLA 4QXBA 3SH4A 4W6WA 3W5NA 3TN91 1ONAA 3LSEA 5FY5A 4YM0A 3ZSKA 3ZFEB 4GWIA 1GZTA 1NCRB 1H8VA 1AR61 2YZ4A 3LSDA 5KWRA 5ABJC 3ZN5A 1R1A2 1HRI3 3A23A 1UMHA 1XQNA 2X05A 4KG8A 3A22A 4GALA 2BDRA 1H1IA 4C0BA 4GMP1 4YM3A 1AVBA 3LEGA 3MYXA 3TEXA 1A78A 3O1SA 4X8PA 2R7EB 4HPKB 3FE5A 5DUUA 2JDYA 4LBNA 1UY2A 4L99A 5CKQA 3JQXA 4TWTA 2EICA 3CHXA 2IZWA 2ZHKA 3K2OA 3WNPA 4RN5A 4IEXA 5CG9A 1OPOA 2BNMA 4HONA 1LU2A 2VZOA 5FYMA 1PM4A 1GZ9A 3V56A 4AQTA 3KGZA 1AJKA 2ET1A 2PAMA 4XILA 5A3MA 1AR83 2K2SA 5FYYA 2BZDA 4DMIA 1LODA 2YC2A 4COUA 4P9GA 3ZVXA 2A71A 4RQPA 3QCWA 1JMUB 4AQSA 1UN1A 5FZ6A 1QEXA 4EWAA 4RYDA 4B8EA 2W68A 2WZPP 2X5IC 2GU9A 3C7HA 1ND2C 3THCA 2Z69A 5KC6A 2BBAA 2CAUA 2PELA 1WLCA 1GP4A 3EYPA 3THPA 1YO8A 1F9KA 4XQ4A 3MUZ1 2TEPA 3AVRA 3HBZA 1ULFA 3W9AA 1H2MA 2VNVA 5AFBA 4BM8A 3MEPA 1ULPA 4OMDA 4KWLA 1NCQA 2EIDA 4OFGA 3KCCA 1YI9A 1RC6A 5T5OA 2CDOA 4H3WA 3VBOB 5FPZA 5J36A 1S0EA 3ZYPA 3U4XA 3T2TA 4XUNA 1PMJX 3OEAA 3OEBA 3LFMA 1W3XA 4CP1A 4D94A 2VJXA 3D5OA 3VLBB 3BCWA 2OQ7A 2VQ0A 4FTEA 4XUPA 4G9SB 4NIIA 4DUXA 2UURA 2XH6A 1LOFC 3AYDA 5FQ0A 1X8MA 3ZXKA 1SDDB 1OVPA 4YFWA 1JZ6A 4ZS2A 2OZJA 3AZVA 4UFJA 2W95A 4GWNA 3NAPB 2DVGA 2RJLA 3VBSC 5BUVA 1O91A 1ZX5A 5L19A 1PVXA 3O0VA 3U07A 4QPGC 3NV4A 4R9DA 1NAEA 2RE9A 5FZ1A 4H7LA 4WVVA 5IVEA 1DIWA 1IPJA 5KHJA 3ZYRA 3WG4A 4A6SA 3QH7A 3RFRA 3SISA 1D2SA 3IKWA 2UWAA 5ACA2 4Y22B 2ZX2A 1W6PB 3IDAA 2JD9A 5C4WB 1G7YA 1ZRIA 1W9WA 3WXPA 2E26A 3V0AB 2XB6C 5JLVA 3KGLA 1UOJA 1MS3A 4GZ9A 3VDDC 4IV3B 1OUSA 2Y6HA 3DN7A 1L7LA 4PLNA 2WNUB 2Y34A 2MEV1 4P9LA 2KA3A 4IGOA 3RZMA 1CIYA 2EXHA 1H2LA 4Q1PA 4AVVA 5FBZA 3TN93 4OI0A 2QUOA 4RA0A 1A6CA 3IMMA 3N7KA 1BQPA 4DXRA 4PJYA 3CJIB 3Q8AA 3BOWA 4LIUA 1AR63 1UW8A 4W6XA 3LQCA 3MPPG 1IG3A 2QTWB 1SACA 2WO1A 4GH4B 3NNLA 3K4ZA 3AC0A 4WZFA 1H4GA 4GMP3 4D6QA 4XZUG 2WSVA 4FAGA 1CX4A 4RSUA 2XBO2 3CQOA 4XF0A 4P9WA 3ZN6A 5DUVA 1JS9A 3LDBA 2BGCA 4Q0VA 3ZSEA 1SPPB 3GCWA 5DAQA 1XNCA 1IPSA 4M4PA 5FYUA 4D7SA 4YW5A 4HVRA 4LIVA 4XHXA 4MHUA 2Q4SA 3ZSMA 4OZOA 2Y38A 5C3OA 1DHKB 1I5ZA 2FMYA 3Q9OA 4Q4X1 3SITA 1WUVA 4ES8A 5JIUA 1W03A 3I59B 5F3EA 3ZIXA 1HX6A 3C7OA 2TUNA 3IPVB 3KWVA 1OSGA 5D8AB 3TWIA 4XBLA 4QHOA 4QDRA 5FLJA 3RWNA 1K5MA 3EBRA 4RHV1 4XFIA 4BU2A 4B1LA 1X82A 2CV6A 1DGRA 1N3QA 1T6BX 3D4KA 1W6QA 4HKWA 5F8PA 4E4ZA 3VN4A 1TNRA 2VM9A 4CCNA 4KMQA 4AVSA 1XBFA 4JGYB 4W8JA 4UWDA 5JXGA 2PQSA 2P37A 3D0JA 4ORFA 1S1AA 1F5JA 5K7PA 2QKDA 2J7MA 2JIJA 1HB3A 2DUOA 3I2KA 2XWJB 3B00A 3DPRC 3IWZA 4YVSB 2HYXA 2WZR1 5FREA 3WQ1A 2H6BA 2VXRA 1NA1C 4YYOA 5FV3A 3VBRC 4OVEA 5T3NA 1ZZ7A 2VH9A 2FBEA 1PK6C 5AVPA 4CCEA 2PHXA 2W1SA 5D2AA 2MPFA 4YVWA 1CJDA 5ABJA 2RMU1 4JC1A 1UY3A 3A0NA 3NMBA 1W39A 2AH2A 1XOYA 3AKQA 2ZHNA 1UYPA 3S57A 4LO7A 1W0PA 4DIQA 2W08A 2FD8A 2YPJA 3MZHA 4XJ9A 3J7NA 2DU1A 3LOIA 1Y9QA 2CGNA 4P9JA 4RR3C 3MIEA 2W91A 5BNNA 2BWCA 2K46A 1LOBA 4KG0A 4RGKA 3VL8A 3RNSA 3VBFA 2HWE1 4I09A 2DBNA 4JX0A 4CEYA 1QMJA 5FUIA 2JE9A 2JG8C 3I2HA 4HOOA 2ARXA 5F37A 1CAXB 3IIAA 4CP2A 4EYUA 1OVSA 4MGKE 5A7PA 1UY4A 4BXFA 2BNOA 2DFCA 1W8HA 2D3RA 3WW1A 2D5HA 5IVYA 3UESA 1XNKA 3B01A 3OUHA 4QB6A 5JZGB 1AF9A 1N3PA 3SHRA 3PDQA 4FO9A 1W9SA 1E5SA 2WKKA 4FPOB 5KHKA 1W2OA 4GMP0 3TN92 4QHBA 1AR91 3POIA 3AMHA 1O8PA 4LKDA 4AFBA 5FLIA 1PVC1 5A7WA 3W59A 1HLCA 1LTEA 3N9MA 4HL0A 1IPKA 4MG2A 5I93A 4I0WB 2ZX1A 1IKPA 5FAXA 3J4UH 1C3HA 3QBQA 2I74A 4H2AA 1HKDA 3SMHA 2XMLA 1MS0A 2Y6GA 3WDTA 4QGNA 4EE2A 1DZRA 2QDNA 5BYNA 3ORJA 3WD5A 2Q0AA 4OZXA 2DF7A 4BIOA 4EV0A 2F17A 2HEWF 4J6GA 1WD3A 2DCTA 3PURA 2HH9A 3URFA 3DEMA 4XJZA 3WLUA 4YG6A 2X5IB 3V0BB 2DFBA 2VMIA 1ND3B 3QH6A 1OOPC 4N43A 3GBGA 1OUXA 3NRUA 4OLLA 1RMU1 5HXMA 1QGLA 5CB7A 4FT8A 1UKRA 2HYKA 1OH3A 2BBVA 5KHGA 5T5LA 5JSOA 4AI9A 2ARAA 1K12A 3VD5A 5GZFA 1S0CA 3AKPA 3MF9A 2EXJA 3PTYA 3RGBA 2DVBA 5IUQA 1D2QA 3NV3A 1SLIA 4RFT0 5FWEA 2PHWA 1DP0A 4XXAA 3RZZA 1JBCA 4PDWB 1TQ5A 2DVDA 1U12A 2P4EA 2VE1A 3L2YA 4JCKA 4NWVA 4Q4X3 1J58A 1RXFA 3GDBA 3A7QA 5A3OA 4RHV3 4N7IA 1JHNA 2FDGA 1RUOA 4ZXKA 2E63A 4HETA 4KI5M 3HNYM 2WQZC 4LO6B 2R16A 3KVAA 5BNPC 5K8SA 2WRAA 4GJZA 1YQ2A 1KITA 1WMEA 2A5ZA 3CL1A 4DY5A 3ZYJB 1W6NB 1UY0A 1OURA 2QFEA 2WZR3 4OI2A 5C9AC 3DYPA 2YPDA 4JDNA 4QPGB 4XETA 4KU7A 4DY3A 5GZCA 4Z82A 4WM8C 3ACFA 4KGGA 4CDWA 3VD4A 4YWAA 3NV1A 4PI0A 5C8CC 4MX3A 2RMU3 1S2KA 4RGAA 4UW4A 3ILRA 1W2AX 5LBFA 1EY2A 4XFGA 3N36A 3WF3A 1POV1 5J1XA 4Q4W1 1LCLA 1KGYA 1HDKA 3VDDB 3WP4A 2VCAA 3WQ7A 1JOPA 4LA2A 5JAXA 1XE8A 2WYFA 5E6HA 2V5YA 3R0RA 1S0JA 3OCPA 5T52A 2JG9C 2YROA 1O3TA 1NKGA 2VZ1A 3W21A 1CZTA 3T2PA 3ZXAC 4JGZC 1VBA2 2HWE3 1Q8OA 3IDCB 3RMYA 1W8NA 3HN1A 3ZDVA 5CFCA 3VUOA 4EJRA 2OQ6A 3LDKA 1VMFA 5GALA 1QXPA 4CUGA 1YJLA 3AP6A 3WHUA 1NY72 4IV1A 4M3CB 3IT8A 4OQ8A 1SBFA 2FCUA 5A6QA 5HCHA 5FKBA 4GIQA 1F4AA 2A73B 2HWD1 1SBDA 1CESA 4Y20B 3WR0A 1W2TA 3GZUC 3NL1A 4QXHA 1PVC3 1YWKA 3ZYIB 5FY7A 1KS4A 1W0NA 4Q4Y1 4QPYA 5JR7B 2QQKA 3ASIA 1S0FA 1Q8QA 3ELNA 3KT7A 4UBGA 5TSWA 1REFA 4NHYA 3VBHA 1JZ7A 1RUC1 1W8OA 2G9FA 2PHDA 4META 4NE9A 3AL6A 1R091 3RZJA 5JSRA 1FXZA 4IEQA 2UY9A 4U2AA 1DLLA 5IYYA 4KGQA 1UZWA 5EPAA 4EWEA 1PO11 4XBQA 1Q43A 3OD4A 5FY8A 1IKQA 2PLV1 1TZOA 3I2IA 4FFIA 2XLGA 2CU5A 5SV5A 4FPCA 2VZPA 1C8M1 4C91A 4LK7A 5H9PA 2X09A 1Y43B 4ASKA 4CEWC 4R52A 3CLPA 3IB3A 4B4PA 1FMD1 1N1TA 1RMU3 1UPSA 1VP6A 2WQ4A 3M2MA 5E8AA 4Q4X2 1GQPA 1YFUA 2D97A 3DPRB 1R1A1 2OXBA 3O7OA 2VW0A 4CXWA 1UPIA 1YEWA 4DEQA 1KJRA 2P6HA 4OHZA 4XFCA 1NA1B 1HB1A 2BGOA 4INDA 3VBRB 4RHV2 4GB32 5D21A 5FZOB 1PK6B 2JWPA 3B02A 3SH3A 3E5QA 1CPMA 2ZACA 1ENXA 1ZZBA 2PHTA 3H1WA 2VBPA 1B35C 4XIOA 4CU9A 4QGMA 3B3QE 4TN7A 1ZZ8A 4LLOA 4G4FA 4K7JA 2R32A 4XFHA 2E7AA 3FX3A 4AAXA 5CADA 2R30A 1H6XA 1YC61 5H9QA 1OA2A 3IDBB 1JYVA 1OF4A 1XU2A 4YW4A 4CPBA 1JXNA 4MGQA 3KV6A 4IESA 2OW4A 3M3CA 4J1WA 5FY9A 5I0DA 1ULCA 3K51A 4ZHNA 4RR3B 5JWPA 1KDKA 4LQRA 4IE5A 5CEHA 2R071 2WT0A 4PBOA 2G9GA 3J7LA 3FMGA 4TYSA 3U37A 1RL3A 3WV6A 4AE2A 4QPIC 2B9UA 4KBZA 2EXKA 2Q5TA 1UY1A 1AX0A 4I0BA 1B09A 1O4TA 3M3QA 2JG8B 5DG1A 2PA7A 2PHLA 4TLGA 1CAUA 3S7EA 1X7NA 2GDFA 5JR2A 2XGXA 1HN0A 4XMAA 2RS12 1XYPA 3Q8EA 5F3CA 3HPNA 3EHKA 4KQ7A 4YZ5A 3O1RA 2OX0A 1MACA 5FZ4A 1L3JA 1PMIA 4YARA 1I9RA 1XPWA 2E7QA 3GBWA 5JPMB 2YY1A 1UMIA 1Y3TA 4N53A 4CUAA 2CAVA 5DDJ2 1POV3 4XURA 1C1FA 2ZS6B 2PTMA 4Q4W3 3WUDA 5IVCA 2AC1A 4LO5B 2HEYF 1WCKA 5GLWA 2EIGA 4KL1A 1NXMA 1DF0A 3POYA 1V6OA 2Q8DA 3U0ZA 5KR7A 3D82A 3C7EA 2B42B 1O3RA 1ZRCA 2P1BA 5LWBA 4S2GA 1D4M2 3PVBB 4JQRA 4PIYA 4UFLA 3RS6A 5A1FA 1F5FA 2ZEXA 4QKFA 1SLTA 1M06G 1RUJ2 3FBMA 2WYSA 1U5IA 5A1AA 3AL5A 5I0SA 4GQ7A 4MGSA 2WN3A 3L9JT 2JECA 2OVUA 3ZPYA 1J83A 4CDUA 4QKBA 1PVC2 2RDRA 3AKRA 5F2SA 5FLHA 5FP8A 1ZREA 4RQPC 1OOPB 1QJFA 1UXZA 3NNMA 3NJXA 4G3YC 4XC9A 3BIEA 3POJA 1LOEA 3S6PA 1STMA 2P3JA 5FYVA 1LU1A 2HWD3 2JE7A 3VL9A 4RFRB 2GNMA 3HJRA 3E1F1 4MH0E 1SG3A 3CJXA 1KFUL 3KHBA 4RGGA 5L9BA 2OYZA 5ACA1 3VD7A 1XNAA 5GKAC 1AYM1 2UU8A 2EAKA 1WMXA 4Q5OA 1CAVB 2NN8A 2FDFA 3U4SA 2CWSA 3ZFFB 4IEYA 1RUC3 1NCQC 5FMBA 2A7AA 5F2WA 5HCBA 4IXLA 3TBDA 3VDDA 2IXKA 3NNJA 1W9FA 2G19A 2Y6FA 1ULOA 1GQGA 1R093 1OT5A 3LDRA 4LEJA 4CCMA 1ZBE1 2GC2A 1T6GC 2OT7A 4I30A 5ISLA 3AP4A 3CO2A 1FYUA 4Y1VA 2IUWA 4ZU7A 4Q4V2 1NZIA 3PNAA 3PU3A 1GNHA 2PLV3 4FBFA 3HNMA 2VW2A 4K6BA 1C8M3 2B39A 4R4ZA 3T30A 4DNYA 5BNPB 2NQYA 3ACIA 5FPAA 1FMD3 2E31A 2MNGA 1BBT1 4WBBA 4CCCA 4AEDA 5B4XA 3OGSA 1R1A3 4AWDA 4B4RA 3VKLA 2WNVA 5DAXA 4AF9A 1ZA7A 1GU3A 2E7TA 1HQLA 2JDMA 1DDLA 3CEWA 1AXZA 3HWJA 4WM8B 2XBO1 4BCUA 4E4DX 1WBLA 2RDNA 5LY1A 1RUNA 5C7GA 4LO4B 4P08A 3ZXGA 2GP5A 4AGGA 4BXSV 4DFSA 5C8CB 3BGAA 5EYYA 3H8XA 4QQLA 1RHI1 4E2QA 1LHUA 4AHWA 2XJSA 5FZFA 5L7OA 3LEKA 1DYPA 4JV4A 3OY8B 1PNGA 3H7JA 5F5CA 3H3LA 3KS7A 5LK7B 3K4AA 3TEYA 3MO4A 5FYZA 1XSQA 1H8TB 5BXXA 1NQJA 4FPJA 5JXHA 1NLQA 5HXVA 1Y7BA 1TMF1 1POV0 2VMCA 2XJTA 4FOVA 4W6YA 3RJRA 1SQ4A 2R073 2W5FA 3GNEA 4Q29A 2JG9B 5HI0A 4LE4A 3Q8CA 5I8SA 1OD3A 2ZGPA 3SC7X 3ME2A 1CWPA 3DKWA 1L7QA 1UU5A 2ZKNA 2A1XA 5EYXA 5IAVA 1CZSA 4JTOA 3M3EA 3E6DA 2Z79A 2GSYA 4Q4W2 2LM3A 5M0TA 5C5TA 3R05A 4P14A 3OB8A 4KWUA 1ODNA 2B4KA 4Y3OA 3HN3A 4R9CA 5JOYA 1AX2A 5IATA 2NMOA 2Z42A 1IG0A 4ARYA 4TSVA 3RZLA 3VB9A 3MW3A 4QM8A 2L9LA 2QQWA 4MZUA 1X9TA 3N35A 4Q0UA 2P3KA 1JI6A 1BCXA 2V09A 5AC91 4XPVA 1FATA 2XPJA 4XEZA 5T5PA 1W9TA 2J1SA 2VU9A 1WCSA 4O61A 1QJY2 3ZIWA 1GYKA 5EJ1B 3SEPA 3B7MA 3DYOA 2JKBA 2QQUA 4ISRA 3AX4A 4Z1VA 3KF3A 2HWD2 3VD9A 4A44A 2CWMA 3CMGA 3KLSA 5FMOL 1W05A 1OQEA 4PIXA 1O59A 2VOXA 5FZCA 4YM1A 1EUUA 5F1RA 5IVBA 5C70A 4KH9A 4M01A 3PMEA 5HCFA 2HEVF 1HXS2 1K5MC 2WA4A 2Y26A 2G9ZA 3HQXA 2WAAA 3JD72 1LESA 5LBCA 1SFNA 2E6VA 4CDQA 2CSGA 1WW4A 3NKGA 2WR9A 1HW5A 2BUKA 4WZCA 3CU7A 1R092 4IEOA 4K1ZA 2XVLA 5ACA3 4CEYB 4GWMA 1H1MA 1AYM3 1GP5A 3MIBA 4YW2A 4XF9A 3T08A 2SBAA 5ERLA 4EZHA 3I7DA 3BKZA 4BQ2A 2PLV2 4A41A 1V6JA 3POGA 1LKNA 1B35B 4Y5TA 3LPFA 1C8M2 3USSA 2Y64A 1CJPA 5DXDA 1FMD2 3E6BA 4NRMA 4YVWC 3I49A 4ZXEA 1ZBE3 3DV8A 2Y8KA 3JCIA 2G1MA 2J22A 4XW3A 2VXJA 2Y6KA 1NX9A 4YW6A 4V1PA 3WHTA 3POFA 4CYDA 5J7MA 2BOIA 2HKXA 2CDPA 2AGSA 1UKGA 1OH4A 4OUSA 5FP7A 5FZIA 4AVBA 1UZ0A 2DVAA 2VAUA 1QNYA 2JDKA 3WNOA 3OGVA 2ET7A 2FDJA 3AMPA 3I3EA 2QQJA 4XABA 1J1TA 4QPIB 3H7YA 1Z78A 3H3ZA 4LK6A 4A7KA 1BBT3 2R49A 3ETQA 5FZHA 1PGSA 3R4DB 1OKQA 5BNNC 3FHAA 1C28A 2QJVA 3KCXA 3N9LA 5FK8A 5JXIA 1OA3A 4ZPIA 5FMDA 4MGZE 2VCCA 4UFKA 3VBFC 2WQ8A 2C26A 2XBO3 4LBOA 2J1EA 1UOBA 3FL7A 4GKXA 3AFKA 5APAA 5LY2A 4FPEA 5FO9B 1RHI3 2R072 1NZCA 2RJKA 2QCSB 2C9KA 3EMRA 1MPXA 4AFMA 4IETA 3KCYA 2FCTA 1V9U2 4QT6A 3U10A 2AEZA 4C90A 2YC4A 4HVOA 4YW1A 4C1WA 1S0GA 3RWKX 5IVJA 2FDIA 2PMWB 5EP9A 1AR72 3PUIA 1AUYA 2BGPA 2D5FA 2NLRA 3LWCA 2VL4A 4TTGA 1N3OA 2BRTA 3USUA 3WCRA 1TMF3 3FN9A 3HOBA 4HZFA 3AMMA 1NE6A 2BYVE 1H2NA 4F8AA 4QX2A 3Q8FA 3EB7A 5A7OA 2X8KA 5FP4A 1UOGA 3WNNA 4CE8A 2QQNA 2WO7A 4XE9A 1X50A 2ZKLA 2XONA 3WW3A 2RM22 1Q5OA 1QDCA 2GALA 2RHPA 4P5YA 5F5AA 4IEZA 5C8WA 2YU1A 3PHMA 4RQPB 4ES9A 2XHKA 4CCDA 2IXLA 4NO4A 5LK5A 2W2IA 2ZHLA 1RUG2 1VAMA 4DPNA 3H1MA 3PJQA 3UGGA 4JAAA 2YFUA 5JDBA 4HK9A 3M7AA 3WOGA 4XTMA 3BTZA 4N43C 3AZZA 3NAPA 4LT5A 2RS52 3FHQA 1O5UA 3B93A 5EWSA 2A6YA 1LAJA 3M1HA 5AC93 3FJSA 4PIZA 1UIKA 3H9AA 4QX0A 3ZO0B 1H9WA 1YFYA 4DXSA 3T2QA 5FO8B 4GULA 4FOQA 3OJBA 1SFPA 3HR9A 4HANA 4M3CF 3KM5A 5FZ3A 1VBE2 3AP5A 3I2JA 3UKTA 3AVSA 3WDVA 4YNIA 5CFDA 5LA1A 4P9YA 4Q27A 3EJKA 2VMFA 1W6PA 5H9RA 1JOJA 3K3NA 5A6XA 4J25A 3MIGA 5HPOA 2ZA9A 1AYM2 3MLJA 2QQMA 2PAKA 3N7MA 2RS31 1COV1 2VULA 4Q8LA 4MUVA 5LATA 3AMQA 3V0AA 1VBA1 4IUGA 3ZFGB 1WA6X 2ILMA 1JU4A 2R0FA 5HBAA 3GHMA 1JH5A 1ZZ6A 2ZABA 5FQ0B 5A70A 4I2OA 3RZHA 2VVDA 1NY71 1YI7A 2EA7A 4AEMA 4B7KA 5DN2A 4QU1A 2A6WA 2FDKA 1OA4A 1ZBE2 3POWA 3OF1A 1OFSA 3DECA 1F15A 3BTXA 5DZGA 5FXVA 2A3XA 1ZBA2 3ZXFA 4KU8A 1JYXA 5AVAA 5FZ0A 3JU9A 1VLNA 1ZZCA 4BA6A 2ZMKA 2Y60A 3H3UA 4CDWC 4I02A 1RYYA 1BBT2 3DF0A 1JYWA 3S5AA 1WLWA 5A80A 3HT2A 1IHMA 3G6JB 4E4SA 3AJZA 4ET7A 4K3UA 3ZMOA 2P5BA 1YQ5A 3MLKA 2QDRA 5FP3A 2W47A 1OKOA 3J8F3 2AYHA 1OQ1A 2JDUA 2ATFA 2ORZA 3Q8BA 1RHI2 5DQ0A 1BZWA 4UW5A 5FPUA 5JOXA 1JYIA 1FT9A 2V4AA 3OSDA 2FZ1A 3WZ1A 4CDXB 4IEUA 4PQQA 2BV4A 2VZUA 4FPKA 4LBQA 2IVIB 4PF1A 1GICA 1QWRA 4LULA 4CUBA 4R4XA 4NHLA 5CFCC 2ZGNA 4BB3A 1TMF2 5FTTC 4QDSA 2P17A 2VUAA 2DCKA 4IE6A 4IV1C 4RS5A 4BDVB 4GB31 3ES1A 2D6LX 2D3SA 1A3KA 3I97A 4MVTA 5FYIA 3KVBA 4H14A 1RUD2 1DQ2A 2ZZJA 2W9XA 4JRAA 3ZN6B 3RMXA 3PMSA 4L9BA 5DUXA 3WEZA 3T0DA 3BUCA 2B5HA 1KFXL 2JB4A 4YVSA 4AYUA 4LHLA 4CCLA 1DYOA 5A7SA 1APNA 1XU1A 3G7DA 2WLPA 1FPN1 5I0TA 3VBHC 1JUHA 3LZZA 1C4RA 1O4YA 4F83A 1XRUA 4XDQA 5CKMA 4LORA 5CNAA 1VBD1 3AFGA 3H1YA 2GMPA 4X6RB 3S30A 2QVSB 2EALA 1EPWA 4C0HA 3D8CA 5AC92 1K5MB 3AYCA 2P34A 1W6QB 2WT1A 4DS0A 3UGFA 1HV0A 1LENA 1S2BA 5F5IA 1KRIA 2RS11 4XUQA 4XYXA 2D44A 1UNBA 5I0RA 3OGJA 1AYN3 4AFAA 2Y33A 1FNYA 2XUMA 3OYWA 1W2UA 4CP9B 5A33B 2OKXA 5GLVA 4FPHA 1UO9A 4LR4A 1QU0A 1UAIA 3OG2A 3ETPA 4JHTA 1CAXA 3O14A 2DCYA 3LF7A 4Q0QA 5DDJ1 4BK5A 4DRRA 4QWNA 5A3TA 1EP0A 1YHFA 3UNPA 4XFFA 4ZS3A 4FTBA 4Z2AA 5ABJB 3VZOA 5KHHA 1OQDA 4CCJA 5JZGA 3WINE 1O4ZA 4ARXA 1NUKA 2XJRA 1R082 1D4M1 2JJ6A 4GWJA 4D7YA 1IGOA 1PZ7A 1C8NA 1COV3 1RUJ1 2RS33 2PYTA 4UW3A 2VTXJ 1JZ3A 1VBA3 4MHRA 5FCCA 1W8UA 5JIAA 1VAKA 4EN6B 3VZLA 5C71A 5KXCA 2C6SA 2WBKA 5BNNB 2QNKA 3OBRA 4DINB 4NIHA 4PHZA 4XOGA 4YGEA 4COZA 3I8TA 2AEYA 1O6UA 3U75A 2VUJA 1QH6A 3OBTA 1LGCA 4LMFA 2WNEA 1LEMA 3W20A 3NV2A 1WW5A 5FDBA 3J8F2 3V0BA 5FKCA 1ND3A 2AR6A 2QQOA 3N9NA 5B4NA 4R8HA 2VTFA 1OC1A 1UYZA 2LTNA 3I4IA 3N3HA 3MW4A 1ND2B 5FYBA 5JUVA 2F4LA 1G9DA 5FZ9A 1FV3A 2OZ6A 1POQA 4BJ0A 1CONA 2I45A 4DOUA 1XB9A 5T54A 1UU6A 4M0HA 2IFWA 4N53C 3JQWA 2BP6A 5A7WB 4IDZA 4LTAA 4L8QA 3KZ4C 1VRBA 2TNFA 3T2OA 4QQOA 4DQAA 3MIFA 2XWBB 4Q4V1 3ZYHA 2OUJA 1N1YA 3B94A 3HMYA 4PDWA 3TB0A 1ENRA 5C3SA 1FI2A 5E89A 1UXXX 1F2NA 1XNBA 2WT2A 4DXTA 3CZJA 5GM0A 1CN1A 4MXWA 5K0UA 1J59A 3MI8A 2PAEA 3SEEA 2VOWA 4CDUC 3ZMNA 4BQ4A 3AZWA 2DV9A 2W0XA 4URAA 5D1IA 3O0WA 1RTVA 4GB33 4YZ1A 3ZOIA 4N43B 1WZXA 2FHRA 4PCRA 4WM7A 1E5HA 2PXJA 1OXCA 5F6KA 2WINB 2BWAA 1RUF3 3AYEA 1BLZA 4QQPA 3S5QA 3T0AA 4ZZ8A 1A8DA 2GNBA 3VKFC 1H1AA 2GC3A 3ZSLA 4I01A 3VBSB 3M8LA 4LBJA 5JCTA 1FPN3 1W6MA 1UZZA 1RGSA 1UYXA 4P9XA 1W8FA 4FVVA 2QQVA 5C5UA 3H50A 4LOSA 3KSCA 3FUOA 4R9BA 2RJ2A 2D43A 1VBD3 1BMV2 1PGL1 3O5SA 4FP3A 4WV8A 1WD4A 5FP9A 1CIWA 1YNAA 3SKVA 1AYN2 5J3UA 4AG4A 4QAWA 2X10A 4RD7A 2BNNA 3MIDA 1QDOA 2UY8A 1R1ZA 2ZMNA 1LULA 3HT1A 1UX7A 2YGMA 4CZSA 1R64A 1CVNA 4Y5Z0 1F31A 1JYCA 2RS13 3J7MA 3EXUA 2RV9A 3ABZA 2RDQA 3OPTA 5FZDA 3ZXDA 1BK0A 5GZDA 1RINA 3E97A 3AJYA 4AEDC 3ACLA 3RRDA 2P2KA 2WNVC 4E2SA 2VBDA 1UZVA 3SCHA 1ULGA 2F4PA 1COV2 2RS32 4JDOA 4YZ2A 1W90A 1XC6A 3A21A 5DDJ3 2HWB1 5I0UA 1DGLA 3UV9A 3VGIA 1VR3A 3BYWA 4X6QB 4CDWB 3BI3A 2WS92 2OIIA 4QU2A 5HV4A 1GSLA 1URXA 2CGPA 4AXOA 4N8MA 1QJY1 1KJLA 2JENA 2R042 2X29A 1NLRA 5L7OC 4E27A 1GBGA 3H42B 1D4M3 4CCKA 4LOTA 4KNCA 3MDPA 1WBFA 2ERFA 1RUJ3 3DXTA 1RUE2 4JQTA
chains in the Genus database with same CATH topology
1MQTA 4ZU4A 3UKNA 2D6MA 2R0HA 1DZQA 1MZ5A 1YJKA 2DTYA 4E9KA 5A32A 1HXS1 2Q1MA 2Y0IA 3LCPA 1J1LA 2DCZA 3AP7A 2SLIA 3ECQA 1HQNA 4QQ2A 3JD71 3ST7A 5CFCB 4URTA 4B29A 1QJU2 2IXIA 2DURA 3RG0A 2LUWA 1AX1A 4WVMA 4BMEA 4IV1B 3AZXA 4Z92B 1XE7A 1JW6A 4K40A 4AW7A 4AI0A 1LEDA 4ASLA 1XXNA 4YG0A 1VRH1 3WG3A 4ATFA 2KM2A 1QF3A 3V64A 1QXJA 4FPYA 4AFCA 2XKPA 2ZGTA 4DXZA 1HIXA 4Q4V3 1OFNA 3PVEA 4MV2A 4JVAA 2GZWA 4I3GA 2WC2A 3WVJA 1BVVA 1QHDA 1RUF2 3A0KA 2JEMA 4MGIE 4S2DA 2IFRA 1G86A 4PLOA 1FPN2 2ZTNA 1S0BA 3WG2A 3HIFA 4S2HA 2QE3A 2Z5WA 4K8FA 3WP3A 3D6EA 3RPQA 1QQP3 4CDQC 2PFWA 1VBD2 3GYDA 3FLTA 4JDMA 4ATEA 2XLFA 4Y1ZA 3PVOA 1ULDA 1V9U1 4Y1XA 3ZSJA 1GZWA 3MIHA 3WW4A 1U0AA 1PO22 3M3IA 1AR71 2BQPA 2C0ZA 2D93A 3GALA 2XL9A 1MR5A 2CL2A 5AFEA 3QACA 2XJQA 1BKZA 2CY6A 1EAH2 4A3XA 1RVF2 5JI9A 2RM21 2VOKA 3ZXJA 1ASJ2 4K1YA 1D0HA 4QM9A 1VBB2 1W6OA 4XTPA 3WG1A 4BWOA 1RUG1 1IS4A 3INAA 1NE4A 3J26N 3J9SA 4XBNA 1MVQA 2Y0OA 4LUKA 2O8QA 1TME2 2PHUA 1CAUB 4S2FA 2RS51 1GR3A 4Q26A 4A2UA 2HWB3 3UJOA 5BV6A 2IWGB 1XYNA 1MZFA 5KXEA 1CGPA 5F9TA 5EV7A 3M4FA 4YLZA 4YGCA 2H6CA 1LHVA 2UWCA 4IEPA 1QJY3 1QOTA 1LGNA 1MS4A 4N7UA 1VBE1 3WDYA 1ZA4A 4N53B 3R6SA 2YV8A 2BFUS 1GANA 2I2SA 2EF6A 3QOPA 4P9IA 1SCSA 1SLCA 3IM0A 1ULEA 3B9IA 3ZFFA 2JDZA 3LA3A 4KWKA 5IK8A 1HXS3 4M3CE 1BEV1 4AGVA 1JUIA 4AQ2A 1SCRA 1WMDA 2C5DA 2DUQA 3JD73 1YRZA 1YCIA 1DGWA 2K9ZA 4HSLA 3JBG2 1UF2C 2O0OA 1A8MA 2PN5A 3IMNA 1RUI2 4CDUB 4XXPA 5GLTA 3ZN4A 4YZ4A 4MSVA 3SNMA 5C6CA 4AFDA 1ZBA1 1YFXA 4XF4A 2VNRA 4E2GA 1VRH3 4TZDA 4AHZA 1SLLA 1WLTA 3NAPC 4QX5A 4AVCA 4GXLA 3OD0A 3RSJA 4ZKTB 1I1EA 3DL3A 5C9AB 1HV1A 2GN7A 1IS5A 4H7MA 1MS8A 1RJ8A 5E16A 1MZ6A 4AI8A 2DU0A 4Q0PA 3APBA 3WDUA 2ZX3A 1Q3EA 1PM7A 2GH2A 1QQP2 2HWC1 3LAGA 4TLFA 5CFDC 2HWF2 2VVFA 3BALA 5KXDA 5KC5A 4EN9B 4HT1T 4Q0SA 5C4WC 4Z07A 1H8TA 5GLUA 1U5XA 3WP5A 1EV12 2O8OA 4XJWA 4LBKA 4AEDB 3VHOA 5BNOA 1RUH1 2WNVB 5CG8A 1PGL2 2GC1A 2E53A 2PHFA 3TRSB 1RUD1 1ZVFA 1V9U3 4JGZB 1ZM1A 3AZYA 4XJAA 2VECA 2DYCA 1VBC2 1AR73 4BH9A 2GH8A 1G9AA 5J98B 3POSA 5IK7A 4AEKA 2A6XA 2ZX0A 1DQ6A 1UZYA 2GNTA 1Z7S1 5LEJA 2R062 1J3PA 1PHMA 2RM23 1CAWB 1H2KA 2HWB2 2XJVA 1WW7A 1TNFA 4JTNA 3HAGA 4EN0A 4P5HA 3W58A 3NVCA 1RUG3 3AYAA 5FOBB 1QH7A 2ZOEB 2BEOA 5DZEA 3X29B 4FPLA 4EWDA 3DGTA 4HN0A 5CU1A 2RS53 1WGPA 4AHYA 1ZNPA 3VBUA 2B45X 3M70A 4RS5C 3NWKA 4XF1A 4CEWB 1OPMA 4IERA 4NHMA 5BY5A 1VBE3 4JRLA 1QJZA 5KBFA 4W65A 2VVEA 2XJUA 4OUMA 1GV9A 1S55A 3RJ2X 2ENRA 4CEYA 4N9IA 1FAYA 4YVSC 1PIV2 4Z2WA 1R081 3BB6A 3WQ0A 3U11A 3ZFEA 1NCRA 1BEV3 1E57A 1O5LA 5JMCA 1VRH2 4LBMA 3AKSA 1YLLA 2DWRA 3UKVA 3KMHA 3RYKA 4AVAA 1H9PA 4YZ3A 1UD1A 5IK5A 4HPKA 3CF6E 3AP9A 1H30A 5JOZA 1ZBA3 3KT4A 3J8F1 3C2UA 4HLTA 2N7GA 3A4UA 3MFCA 1ZRFA 1PGW1 4QQHA 5I8YA 3KQRA 2ZZQA 3L2HA 3AKTA 2YGLA 2NM1A 4HN1A 2HWC3 1N1SA 1SFYA 4XFAA 4OI4A 2O1QA 5JZGC 5CA6A 1C5IA 4QGLA 1KS5A 3SCFA 3WW2A 2CNAA 3OTFA 1FV2A 1LR5A 2H0BA 4I0AA 2HJIA 5JVVA 3RDIA 3RQ0A 1ZRRA 2ZGOA 4NOTA 1SDWA 4L92A 2XVKA 3GHNA 1U5ZA 3ROUA 1RUH3 3VBOA 4QXKA 3RYPA 4BLIA 3TNPB 1RUD3 5C33A 4COVA 1W0OA 1X33A 1BVP1 5SV8A 1IQAA 1VB2A 3UK9A 2ZGMA 2WFPA 4HBNA 2BVVA 1V6MA 1NYWA 2A3WA 3AK0A 4SBVA 4YW3A 1OMIA 2V73A 3S0MA 1ND3C 1WLDA 4NN0A 4DZGA 4CTEA 2ZCWA 3I54A 4D3WA 1IS6A 1J3RA 1Z7S3 3AXDA 2D98A 3WY6A 1BMV1 4ITCA 3MICA 2XL7A 1AL22 1VB4A 1IS3A 4GA9A 4Y4YA 3USUB 1AYN1 3OGGA 1LHWA 1F8VA 1MS5A 3IN9A 5L36A 1NCQB 1NQDA 4MXVA 4PDWC 1EYBA 3KT1A 1PZ8A 4PBPA 4Q2FA 4Y24A 4OHYA 1QKQA 4Y22A 3BODA 4KBBA 4LHNA 5K0UC 1RIRA 2RR11 5C4WA 3ZFGA 2VNGA 4B4QA 2Q8OA 5K9YA 5KHIA 3NSTA 3TYJA 1BEV2 4IV3A 3O12A 2WS91 4WM7C 2WNUA 1QOSA 4L2NA 3JUUA 2ES3A 4B7EA 5CAZA 2R041 3BOPA 4LHKA 1R083 2IXCA 1YFWA 1MEC2 1FOD3 3MF6A 1SEFA 3VKMA 2R6QA 1RUE1 3CJIA 1REEA 1VJ2A 5CFDB 3AB0A 1QY4A 4BQ1A 2DCJA 1G9BA 4GH4A 5IT6A 2YMZA 4FOYA 4LLFA 3WUCA 1AZDA 3VZNA 2QZ3A 5GZEA 2D6NA 4B3NA 5BPXA 1QJU1 2A3YA 4GKYA 1HRI2 1LHOA 1UMZA 4HSJA 4R9AA 1YIFA 2HWC2 4CDXA 1AJOA 1OHFA 4HVQA 1O7FA 3ZX7A 3WCSA 4DRVA 3OPZA 2VG9A 1NXD1 5T50A 1UX6A 1LB2A 3I59A 2UWBA 1LOCA 3IPVA 4X8NA 3VZJA 5D8AA 4A7YA 1LHNA 5FOJB 2WIIB 3H0OA 1MS9A 5CIRA 3LB9A 1RUH2 4YM2A 3BIWE 3CNAA 4JGYA 2ZGUA 1AR82 1RUF1 2VGDA 1SLAA 3GF6A 5GZGA 1KXGA 2AZ5A 1MQTC 2OUHA 3WDXA 1YUDA 4HK8A 2WFF1 1REDA 2IC1A 2CYFA 4AHXA 1LJ7A 2ARBA 4LBQB 2BVBA 1Z7S2 4LO8A 3MW2A 4FOWA 2B8MA 2NYYA 3JB8A 2CGOA 1QNWA 3QLQA 3SH5A 4RS5B 1PO21 2ZBJA 1LOAA 2ZPXA 3WP6A 4XMIA 1AHSA 4YSFA 1GNZA 1VALA 4AQ6A 1RJ7A 4XJUA 1HRV1 1AL0G 1DGRN 5A33A 3VHRA 3VZKA 3PJYA 1EAH1 1RVF1 1DBNA 3R4SA 2A6VA 3PLQA 2XG3A 1PZ9A 3DUIA 1QOOA 2W52A 4AI1A 2A6ZA 4H55A 3LA2A 1ASJ1 4CRQA 4IEWA 1MS1A 2GMEA 1VBB1 4YVWB 5FFOC 1OLQA 1SBEA 1ZZ9A 4PF5A 4LBLA 4FSJA 2D6PA 3FC0A 2RR13 1FOD2 1TME1 4L11A 1KDMA 1IOAA 4FAHA 4OHVA 3HD8B 1YIPA 2WS93 5T55A 1V6KA 1Q8PA 1Q56A 4Q1RA 3OYWB 3VKOA 4BIFA 3UJQA 4CP0A 2ZJCA 2R043 5J96B 2VW1A 3RYRA 3VBFB 5GLZA 2YDEA 5LEKA 3VHNA 1RUE3 2WL1A 1G6NA 2D40A 5EZWA 2FQPA 2X5IA 1WW6A 1S0IA 1ND2A 2VPVA 1RB8G 1PGW2 1DQ0A 5E88A 2ETEA 4COYA 2OPKA 1OD5A 3N7JA 1Q8SA 1BK1A 1QJU3 1V70A 3JBG1 1AR62 2JICA 1RUI1 1WMFA 1LECA 1RITA 5F5QA 2MEV3 4FQ4A 4BPZA 3BPZA 2AUYA 2BFUL 2G4IA 2UYAA 2R1DA 2VMHA 3LKJA 2D6OX 2ZHMA 4WVWA 1CQ9A 1TEIA 4LNVA 4Y26A 3TNQA 3H8UA 3E5UA 1LOFA 3VZMA 5DG2A 1BJQA 3ZXLA 1YYNA 3MLLA 1OLRA 1KD7A 1QQP1 1Q8VA 3I2DA 4IL7A 3VBSA 2HWF1 1W6NA 5CBLA 3N7LA 2Z2SB 4BOWA 4QPGA 4HKOA 3ZFFC 1VIWB 2WFF3 2BW8A 4LUMA 2OA2A 4AI2A 1H0BA 2YXSA 5H9SA 4BLJA 1EV11 4BZ4A 2X53S 5LRSA 1U5YA 2C1FA 4MXWB 5K0UB 3VHPA 4AK3A 4BMBA 3WX5A 2E51A 1DQ5A 3N4MA 2ZGQA 3VDDA 1PO23 4KWJA 1VBC1 1J3QA 4WM7B 3UL2A 2UYBA 4RL7A 2GN3A 4Y1YA 1PNFA 1HRV3 4Y1UA 4Q8KA 3NW4A 1EAH3 1W6MB 1RVF3 5T5JA 2RR12 2R061 3V65A 4HFSA 2VMGA 2WA3A 4A7ZA 5J48A 3FWEA 4M3CA 2KXLA 3PVNA 1ASJ3 3FLPA 1H4HA 1XYOA 1VBB3 4ONUA 4FCAA 4U36A 4Y20A 4EN8B 1H8TC 4XHBA 2A75A 1TME3 1ENSA 5B2GB 2XKOA 1UIJA 3D0SA 2I07B 4UW6A 3RI8A 4MGYE 4K20A 1GQHA 5BNOC 1I3HA 3KB5A 3SCGA 2NPIA 2YC0A 3TOJA 5HCAA 2GC0A 3WDWA 2GAUA 1QJX1 3NJZA 4K21A 1PIV1 3MGUA 1LRHA 3K48A 2MEV2 1UCXA 2WLQA 1AR93 3AXEA 4SLIA 1V6NA 4XJ8A 2MHFA 3DPRA 5FO7B 1O3SA 2BTVC 3P3PA 1MQTB 3JBG3 1AXYA 1NA1A 1RUI3 2ZX4A 3T1LA 5A32B 3VBRA 2K0GA 4EROA 3VBHB 1DQ4A 3FUQA 1PK6A 4K9SA 3E5XA 4HKLA 3NKTA 3ZYGA 1DFQA 4NR1A 2GMMA 4XF3A 5I8TA 4WVMB 2TBVA 2E9QA 4UXAA 2C9AA 2FMDA 3VBUC 3P3NA 2A70A 1UU4A 2YHJA 2WFF2 4M0NA 1X8EA 4RR3A 5GJ6A 3FZ3A 1BXHA 1AXKA 5FRAA 3FBYA 4BHPA 4CEYC 3ATGA 1SMVA 2HWF3 3FLRA 4BYYA 2YYOA 2JG8A 4EN7B 4IEVA 1DZTA 3JZVA 4N9HA 3ZXEA 4Z8BA 1DG6A 3O0XA 3ZFEC 1QXRA 1NCRC 1EV13 1CD3G 2R1BA 4AI3A 2ZGRA 1HRV2 1M4WA 3ZDSA 1D0GA 2WZR2 4XZPA 4ZU5A 1FX5A 1WA4A 4YG3A 4XIKA 2B7YA 3ES4A 2JX9A 1VBC3 2WSUA 2D3PA 3BTAA 2RMU2 1V6LA 4BE3A 4FXGB 1GZCA 3C3VA 5EJ3A 3T1MA 1GZWB 5F6LB 3VV1A 1O3QA 2R063 5EFUA 3GZAA 1LGBA 2ZGSA 3KD4A 1AL21 3B5LB 4WVZA 1WCDJ 1G9FA 4D69A 1OOPA 2ZAHA 2HWE2 3B69A 5JI7A 2QQPA 2ZAAA 5I91A 4NPRA 3GZTB 3QD6A 1CAVA 2VOVA 2PQQA 1G9CA 1TE1B 1W6OB 4XQWA 1MZEA 3VBOC 4ASMB 1ALYA 3FFQA 5JPNB 1NOVA 1AR92 2DTWA 4MLOA 2GNDA 5CVRA 4OI1A 1JTZX 2H0VA 2AREA 1LOGA 1DU3D 1QJX3 3ILNA 1PIV3 5FPXA 1MEC1 2VQAA 1IZ3A 2B46X 4XFBA 1NG0A 1DQ1A 4LE3A 3FHIB 5BNPA 3MFAA 4OHWA 2VNOA 3AMNA 1S0DA 2WJSA 1ZYBA 4AGRA 4Q4Y3 5C9AA 5DZFA 2NP0A 2XVGA 3JB4C 3E6CC 5J37A 5E1RA 1N1VA 4WM8A 4FXKB 1ZRDA 3IBMA 4OHXA 1RMU2 5C8CA 3IDEA 3AM2A 2F6BA 1HRI1 4OULA 1OI6A 1PO13 3R4UA 5A3LA 2EAAA 2AENA 1ENQA 3MPBA 4YGBA 4I3PA 3OY8A 3ZFGC 2BPA2 3WNXA 1HQWA 4NWWA 1C5HA 4XQDA 4FPGA 3LA7A 4LBQD 3SLIA 2W39A 4IV3C 2LALA 4QMAA 2JG9A 5JSPA 2D7FA 2FZ2A 2WNUC 2IXHA 2JXAA 4YRDA 4JGZA 1GFF2 2YUEA 4UBHA 3LOBA 1UL9A 2WWSA 4YFZA 4YGDA 2ZGKA 4AEJA 1AR81 1BYHA 2DUPA 1FNZA 4NVPA 4FP2A 5IK4A 4O9EA 3CJIC 2ZMLA 4O9GA 1JN2P 2CTVA 1VAVA 4FTSA 2Q30A 3ILFA 4FQZA 4GH4C 5L7OB 3M3OA 1YXWA 2EXIA 3ENRA 3EQEA 4N90A 1CAWA 1GLHA 4D7TA 1GKBA 1C1LA 2PHRA 4IQPA 4HMZA 4PQ9A 3FFZA 5BNOB 3WT3A 2DVFA 2JD4A 4CDXC 1MVEA 3TAYA 2XLAA 4AVTA 4NHKA 4C1XA 4PLMA 2XJPA 1AL23 1XNDA 5D8AC 2QZ2A 4QD2A 1KQRA 4DB5A 4J1XA 3GBFA 1I6XA 4CEWA 5BNQA 4JGYC 1CPNA 3EO6A 5LRRA 1V00A 2P3IA 3ALQA 1Z0HA 1QJX2 5KXBA 1V6IA 4F7ZA 2VY0A 2NZ9A 1B35A 1FOD1 2NMNA 1DGWX 1X36A 4COWA 2IXJA 1NLSA 1G8WA 4LA3A 3SXWA 2EVXA 5L73A 4Q4Y2 4MYEA 1EPZA 4M00A 3VBUB 2Q1ZB 3BU7A 1RUC2 1MEC3 2D6KA 4FPFA 3LGRA 1C57A 4L97A 4F3JA 1CR7A 3S7IA 1DYKA 3NO8A 5EXOA 4CDQB 4QPIA 5DUWA 3VKNA 1D4VB 5J09A 4ISQA 1SLBA 1N47A 5JOWA 3B9CA 3RI9A 1PO12 2ZGLA 3SH4A 4W6WA 3TN91 1ONAA 3LSEA 4YM0A 3ZSKA 3ZFEB 1NCRB 1H8VA 1AR61 2YZ4A 3LSDA 5KWRA 5ABJC 3ZN5A 1R1A2 1HRI3 1XQNA 4KG8A 4C0BA 4GALA 4YM3A 1H1IA 4GMP1 1AVBA 3MYXA 1A78A 4X8PA 4HPKB 3FE5A 5DUUA 4LBNA 4L99A 3JQXA 4TWTA 2IZWA 2ZHKA 5CG9A 4IEXA 1OPOA 2BNMA 1LU2A 1GZ9A 3V56A 4AQTA 3KGZA 1AJKA 2ET1A 2PAMA 4XILA 5A3MA 1AR83 2K2SA 4DMIA 1LODA 4COUA 4P9GA 3ZVXA 2A71A 4RQPA 3QCWA 4AQSA 1UN1A 4EWAA 4B8EA 2W68A 2WZPP 2X5IC 2GU9A 1ND2C 2Z69A 5KC6A 2CAUA 2PELA 1WLCA 3THPA 1YO8A 1F9KA 4XQ4A 2TEPA 3HBZA 1ULFA 3W9AA 1H2MA 5AFBA 4BM8A 3MEPA 4KWLA 1NCQA 4OFGA 3KCCA 1YI9A 1RC6A 5T5OA 4H3WA 3VBOB 5J36A 5FPZA 1S0EA 3ZYPA 3U4XA 3T2TA 4CP1A 4D94A 3VLBB 3D5OA 3BCWA 2VQ0A 4FTEA 4G9SB 2UURA 2XH6A 1LOFC 3AYDA 5FQ0A 1X8MA 3ZXKA 4YFWA 2OZJA 3AZVA 4GWNA 3NAPB 2DVGA 2RJLA 3VBSC 5BUVA 1O91A 1ZX5A 5L19A 1PVXA 3O0VA 3U07A 4QPGC 3NV4A 4R9DA 2RE9A 4H7LA 4WVVA 5KHJA 1DIWA 1IPJA 3ZYRA 3WG4A 3QH7A 3SISA 1D2SA 3IKWA 2UWAA 5ACA2 4Y22B 2ZX2A 1W6PB 5C4WB 1G7YA 3WXPA 3V0AB 2XB6C 5JLVA 3KGLA 1MS3A 3VDDC 4IV3B 3DN7A 4PLNA 2WNUB 2MEV1 4P9LA 2KA3A 2EXHA 1H2LA 4Q1PA 4AVVA 5FBZA 3TN93 4OI0A 2QUOA 4RA0A 1A6CA 3N7KA 1BQPA 4PJYA 3CJIB 3BOWA 1AR63 1UW8A 4W6XA 3MPPG 1SACA 4GH4B 4WZFA 1H4GA 4GMP3 2WSVA 4FAGA 1CX4A 4RSUA 2XBO2 4XF0A 3ZN6A 4P9WA 5DUVA 2BGCA 4Q0VA 3ZSEA 1XNCA 4D7SA 4YW5A 4HVRA 4XHXA 2Q4SA 3ZSMA 2Y38A 1DHKB 1I5ZA 2FMYA 3Q9OA 4Q4X1 3SITA 1WUVA 4ES8A 5JIUA 3I59B 3ZIXA 1HX6A 2TUNA 3IPVB 3TWIA 1OSGA 5D8AB 4XBLA 5FLJA 3RWNA 1K5MA 3EBRA 4RHV1 4XFIA 1X82A 2CV6A 1DGRA 1N3QA 3D4KA 1W6QA 4HKWA 4E4ZA 3VN4A 1TNRA 4AVSA 4JGYB 2P37A 3D0JA 4ORFA 1S1AA 1F5JA 5K7PA 2QKDA 5FMOS 2DUOA 2XWJB 3B00A 3DPRC 3IWZA 4YVSB 2WZR1 5FREA 3WQ1A 2H6BA 2VXRA 1NA1C 4YYOA 3VBRC 4OVEA 5T3NA 1ZZ7A 2VH9A 2FBEA 1PK6C 5AVPA 2PHXA 2MPFA 4YVWA 1CJDA 5ABJA 2RMU1 4JC1A 3A0NA 1W39A 2AH2A 3AKQA 2ZHNA