4OFGA

Co-crystal structure of carboxy cgmp binding domain of plasmodium falciparum pkg with cgmp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
142
structure length
142
Chain Sequence
DASIDYNNKKSIIKKMYIFRYLTDKQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEIVKNKKRLRTLGKNDYFGERALLYDEPRTASVISKVNNVECWFVDKSVFLQIIQGPMLAHLEERIKMQDTKVEMDELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CGMP-dependent protein kinase
publication title Crystal Structures of the Carboxyl cGMP Binding Domain of the Plasmodium falciparum cGMP-dependent Protein Kinase Reveal a Novel Capping Triad Crucial for Merozoite Egress.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 44
structure length 142
sequence length 142
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ofgA00
2OZJA 1XE8A 5BV6A 4IEYA 4ZU5A 1CAVB 5I0TA 3RDIA 4Q0VA 3FWEA 4XF4A 3EBRA 1RGSA 3FHIB 5BXXA 3NW4A 2ET1A 2EVXA 5E16A 2FMYA 3VHRA 2O8QA 5FQ0B 4X6QB 2GH2A 2GZWA 2OYZA 4JVAA 3FE5A 3MZHA 5I8TA 4HVOA 4AQ2A 1ZZ8A 4XFFA 2GAUA 3JZVA 4GULA 4I09A 4Q29A 2OA2A 4MV2A 4RD7A 2O1QA 4JTNA 4IEUA 1ZZ9A 4MUVA 4OLLA 4FBFA 3ES4A 2QVSB 4EWEA 3FX3A 2B8MA 2H6BA 1OI6A 3D82A 2KXLA 4D7SA 1ZZBA 4LTAA 4XFAA 2QNKA 1J59A 2HKXA 1PMIA 2VQAA 4IEVA 2CGPA 2D93A 3IDCB 4PIXA 2HJIA 2ETEA 4HMZA 1RTVA 4L2NA 1ZNPA 4FAHA 2IXHA 4I0BA 2GC1A 3M3IA 5FCCA 2OZ6A 4O9EA 2PFWA 1ZX5A 5JAXA 4HSJA 2B9UA 1CAWB 4UXAA 5BUVA 3LA7A 1EPZA 4I01A 2CV6A 3E6DA 5EZWA 1NZCA 4HN1A 3G7DA 1UPIA 4XFCA 4IEOA 5E1RA 2Q0AA 3LWCA 2PA7A 3NL1A 2VECA 5I8YA 3MDPA 4XF3A 1J3QA 2FQPA 3FFQA 4JTOA 3E5QA 1NE4A 5BY5A 4QM9A 3DL3A 3ACLA 2WC2A 4QXKA 4AXOA 3CO2A 4Z07A 1DZRA 2BGCA 2CAVA 2CAUA 4E2QA 3E5UA 4J1XA 3D0JA 2PQQA 2GC0A 2GC2A 3KMHA 1DGWA 4MH0E 1ZZ7A 2Q4SA 1Q3EA 2I45A 4Z82A 4KU7A 4XF0A 5FPZA 3LZZA 3TNPB 5J3UA 4BYYA 4KWJA 4IETA 3I54A 3IWZA 5CADA 3DV8A 2BNOA 1WLTA 2PAEA 4LUKA 3H1WA 4I2OA 4XF1A 1ZZ6A 4IERA 4EROA 4MGYE 5LRSA 4LLOA 3H3UA 4QM8A 1CAXA 3E6CC 4YNIA 1NE6A 2PYTA 5AVPA 1LRHA 1H1MA 3PNAA 1OD5A 3GYDA 3CEWA 3RNSA 4QGNA 1FT9A 2IXLA 3CL1A 3ES1A 1EP0A 2QCSB 1LR5A 5JSRA 1IPJA 4FT8A 3BALA 2BYVE 4NVPA 4AVAA 2IXJA 3WW1A 3EO6A 2XLFA 4WZCA 4XF9A 2Y0OA 1O3SA 3R6SA 1QXRA 3KGZA 2MNGA 2XGXA 4LEJA 1J3PA 2UY8A 3MYXA 3ZDSA 4D7TA 1YFYA 4ORFA 3UKNA 5T3NA 3IDBB 2XLAA 5C8WA 1GQGA 3GBFA 4JV4A 3HQXA 1H1IA 1QY4A 4YARA 1RUOA 2B5HA 4F7ZA 3ETQA 3H1MA 3SMHA 1OMIA 3WW2A 4E2SA 1YFUA 4HVRA 3TNQA 2H0VA 1WA4A 2OPKA 3N4MA 2Z2SB 3B02A 1U12A 1LKNA 1RL3A 4IESA 3EJKA 1PM7A 3CF6E 1XE7A 3CJXA 4X6RB 1FXZA 3L2HA 5F1RA 1NXMA 3D0SA 4UBHA 3BCWA 1UD1A 1X7NA 2IXIA 2V09A 1VR3A 5C6CA 1O3QA 4BH9A 1UCXA 1Y9QA 3EHKA 1CX4A 1X8EA 2UYAA 3I59B 1YFXA 4I0AA 3E6BA 1YUDA 4YSFA 4XFHA 1Q43A 1UIJA 4R8HA 1DGRA 3ST7A 5FLJA 4HVQA 2VPVA 2GU9A 1EYBA 2N7GA 3OGJA 1J1LA 1CAXB 3S0MA 3BU7A 2GC3A 4BHPA 3RPQA 3S7IA 2UY9A 2QJVA 5LRRA 3E5XA 4I3PA 5J48A 1LB2A 5CU1A 1WGPA 2WFPA 4MGIE 1G6NA 3H7YA 1JUHA 1QXJA 2PHLA 3EQEA 3H3ZA 2P17A 5I93A 3OD0A 3USSA 2XKOA 5HI0A 4XFGA 3RYPA 3KGLA 2IXKA 1ZREA 1ZZCA 3NKTA 4TLFA 3OTFA 4IEXA 4FAGA 4YRDA 4UBGA 2IXCA 1YHFA 2UYBA 5FPXA 3SCGA 5KHGA 4QMAA 2QDRA 1ZVFA 3NVCA 4KL1A 5KHHA 1O3TA 3OCPA 3DN7A 4AQ6A 1GQHA 3LA2A 3IBMA 3H7JA 4PIZA 5I91A 5JR7B 3DKWA 4R52A 4AVCA 3U0ZA 3SXWA 3ROUA 4N9IA 5K8SA 3I7DA 2PHDA 2XL7A 4ZU4A 3SCHA 3SHRA 1O5UA 1CAWA 2MPFA 3HIFA 1Y3TA 5I0UA 4EWDA 5KHJA 3UKTA 3PVBB 4J1WA 2MHFA 1QWRA 1VJ2A 1CAUA 5I8SA 4HLTA 1NYWA 1J58A 3RYKA 5LEJA 4HBNA 4KU8A 1FI2A 4CYDA 5JCTA 2H6CA 4Q0PA 5FLIA 4E2GA 3MPBA 2Q30A 4F8AA 2ET7A 2EA7A 2E9QA 4HSLA 3H8UA 4WVZA 2D5HA 1SFNA 2D5FA 3CLPA 2K9ZA 4MGKE 3WW3A 4LA2A 1HW5A 5D1IA 1J3RA 3H1YA 4XFBA 3IIAA 2BNMA 3BPZA 1X8MA 5JSPA 1I5ZA 5FLHA 4WBBA 4B29A 3UKVA 2ZKLA 3BB6A 2C0ZA 5BPXA 1RC6A 4K8FA 2PAKA 1OFNA 1UW8A 2ATFA 2D40A 1XRUA 4L11A 3RZZA 3H50A 4O9GA 1RUNA 1O3RA 4I02A 1O4TA 1ZRFA 2Q1ZB 2PAMA 4QGMA 5FDBA 4IEWA 1O5LA 3OF1A 1ZRCA 4XFIA 3QOPA 4PIYA 2BEOA 4HN0A 3LAGA 2XKPA 5I0RA 3RYRA 3HT1A 3PLQA 1CAVA 4ONUA 1CGPA 1X82A 2IC1A 4AVBA 1TQ5A 4Q0UA 1DZTA 2EAAA 4PJYA 1L3JA 1V70A 3QACA 2XLGA 1ZRRA 4EWAA 1I6XA 5FQ0A 4N9HA 3KSCA 4KWKA 1CAUB 3LOIA 3U10A 2DCTA 2BNNA 5EFUA 4XEZA 2PTMA 1O7FA 4QX5A 3WW4A 4DINB 5KHIA 2Z69A 1YFWA 4XETA 3H9AA 2XL9A 1UIKA 2XHKA 5KBFA 4YYOA 4HZFA 4IEZA 1SQ4A 5CVRA 4P9GA 3SCFA 4EV0A 4MX3A 4LA3A 3HT2A 4META 4IEQA 1YWKA 3M70A 3C3VA 4LULA 3NJZA 3NSTA 4MZUA 4Q0SA 5I0SA 4MGZE 4OFGA 4H7LA 1IPKA 3ELNA 4A2UA 3I59A 4Q0QA 3O14A 4QGLA 1ZRDA 2F4PA 5LEKA 1EY2A 3E97A 3S7EA 3FJSA 3FZ3A 4BIFA 5KHKA 1VP6A 4KWLA 1SEFA 1Q5OA 4LUMA 5JSOA 3U11A 1YLLA 3KCCA 4ZU7A 2ZCWA 5J7MA 2K0GA 4IEPA 3LA3A
chains in the Genus database with same CATH superfamily
1N47A 2OZJA 4QPGC 4A44A 5IYYA 5BV6A 2ZGOA 3CIHA 4ZU5A 1VB4A 1XE0A 4FPKA 3WCRA 4RFT0 1H2MA 4WVMA 4XF4A 3RDIA 3SLIA 1C8NA 3EBRA 5IAVA 3ASIA 4XUOA 4LT5A 2BWCA 1F2NA 5C33A 2W5FA 3NW4A 4XC9A 5DUVA 1OA4A 1FX5A 4D6RA 3ZDVA 3GHMA 4CEYA 5E88A 1XC6A 3ZXJA 3VHRA 3JD71 3ZFGA 2GNDA 2XPJA 1OFSA 2DVAA 1OH4A 5SV5A 4ZS3A 3TEXA 1OUSA 2WWUA 1OOPC 4CEWC 3W5NA 5FZGA 1ZZ8A 3FUOA 4PQQA 3WG1A 1ENRA 3OY8B 4GULA 4W6WA 3WF1A 4FP3A 5H9QA 2XJPA 2VC9A 2FZ1A 4FPGA 4GJZA 2B39A 4BOWA 1C28A 2ORXA 4JTNA 2YYOA 1XNCA 4COYA 1N1TA 2F6BA 2ZGKA 2ZMKA 1GOGA 1EAH1 2ID4A 3ES4A 3FX3A 3ZMOA 2B8MA 4Q4Y1 2H6BA 5IVFA 1V9U3 2JG9B 4CUCA 1JOPA 1GR3A 1YQ6A 4UW3A 3BPSA 3WDWA 2G9GA 2OW4A 2GSYA 2KXLA 1GU3A 2RS12 2VQ0A 5FV3A 4DXZA 5EYXA 2FDGA 1ZZBA 3PUIA 5JZGA 4LTAA 5LA1A 2TNFA 4YG3A 1C1FA 1U5XA 2D93A 1BQPA 2Y0IA 4RHV3 2HJIA 3DXTA 3KVAA 1RTVA 5FZ4A 4CUGA 1ZNPA 4FAHA 4OI1A 4Q4W1 4JHZA 2RS52 1ASJ3 1NA1B 2PHWA 1OHFA 4ASLA 1MS0A 2VD7A 3ZPOA 1SZBA 5JAXA 3M4FA 1WWYA 1LOAA 2B9UA 2E51A 4HSJA 2J1TA 4A3ZA 2Z79A 1GNYA 3T09A 3AB0A 3MIFA 1EPZA 3VBHA 2CV6A 4LBQB 2W2IA 1I9RA 1JHNA 1JXNA 4P9WA 1UPIA 2VXJA 4IEOA 2BWAA 2Q0AA 3WP3A 2WWJA 2GN7A 1B35C 2HYXA 4SBVA 1R083 1GKBA 4RS5B 5EXOA 4GWMA 3RRDA 1C8M1 1QQP3 2FQPA 3X29B 3U4XA 5DDJ3 5C9AB 1AZDA 1RYYA 3AFKA 1W05A 4NR1A 5C7GA 4XJUA 2XQRA 5LB6A 4CEYC 4IV1B 2VL4A 1JZ6A 1Y4WA 2R1DA 3PJQA 1APNA 2BU9A 4J1XA 3PL0A 4MXVA 4NRMA 5EJ1B 1H30A 1H8TB 1LOBA 4AVSA 1BKZA 1PK6A 2XJQA 1W39A 2HEYF 2PQQA 5F5QA 5IVJA 3WF0A 1CIWA 4OI0A 2GC2A 5FYIA 1IG3A 3USUB 4YGEA 1LODA 4QDSA 5KC6A 1BMV1 4MH0E 1ZZ7A 4R9BA 4CDWB 4G9SB 2Y6LA 3BODA 1W6MA 5CFDC 4KU7A 4LKDA 5FUIA 4ZZ8A 3TNPB 2QE3A 1IZ3A 4HK9A 4Y5TA 1ZYBA 5FMOS 4BQ3A 1GZTA 3T0BA 1OBNA 1RUH2 2RS33 2GNTA 1V9U2 2W39A 3DV8A 5IVBA 1VRBA 2FDJA 1VE0A 1SG3A 4FPEA 1HQLA 2HWD1 2ZAAA 3HWJA 3MUY1 3PUHA 4LUKA 4AAPA 5GLZA 1OF4A 2Y6FA 1YEWA 3FHQA 5HBAA 5FWJA 2E6VA 5BNPA 4Z92B 1I5PA 1S0CA 2BP6A 5CAZA 3ZYPA 2YU2A 4CDXB 5DUWA 1HB4A 5A7OA 4QPIC 3H8OA 1ASJ2 4BWOA 4YNIA 3OYWA 2WZPP 3DGTA 3NNLA 5AVPA 4CP0A 4Z8BA 1LRHA 4XTMA 1WLDA 2JECA 3PNAA 4QX2A 1SACA 1K5MA 1OD5A 2WINB 2DVBA 4LO7A 4P9LA 4QGNA 3O1RA 3POYA 4FFHA 2QCSB 5CEHA 1LR5A 1NCRC 3WF2A 2P3JA 4FOWA 2ILMA 2BYVE 3BALA 2ZGRA 2ZGMA 5IK5A 1WA6X 3GCWA 4N43C 5I0DA 3WW1A 5CKQA 5CFCA 4WM7B 2YGMA 2RMU1 2I74A 1QQP2 3VKLA 1H9PA 1RUC3 1VBE1 5EV7A 1Q8PA 2FZ2A 3VBRC 2A1XA 2JG8A 1UWWA 3JQWA 1IGOA 4UFHA 1OQDA 4MGQA 1W2OA 1UY1A 3GZUC 4JGZA 2AYHA 4YG0A 3RS6A 1VBD1 1TVGA 5T3NA 1ND2A 1S55A 2VOVA 4NROA 4Y22B 4X8PA 4NAMA 2XLAA 4XZPA 5GZCA 5C8WA 1T2XA 1WMEA 2CDPA 4N90A 5FZOA 4ZHNA 2Y6KA 4JV4A 4QKBA 1OVSA 2A3XA 2VZ1A 4YFWA 1AJOA 3ETQA 1UOBA 3CJIB 1OMIA 1LHUA 3UJOA 1I3HA 3AKRA 1YFUA 3AMMA 3TNQA 2H0VA 4MGTA 3KLSA 1U12A 2W46A 1O4YA 2JG9C 4XQWA 2GNMA 2DDUA 2WSVA 1PM7A 1RVF1 4XMAA 3CJXA 4U2AA 1BJQA 1FXZA 3AVSA 3DXUA 1KJLA 5G05L 2WT0A 5LBCA 1UD1A 1X7NA 1YI7A 2IXIA 2V09A 4AGVA 3N36A 1GZWB 2GDFA 1OPOA 2CDOA 3EHKA 4IQPA 4CCEA 1CX4A 3B9CA 2YGLA 5FYBA 4AEDB 4YSFA 1HLCA 2VZSA 1HRI2 3BOWA 5F6LB 4RR3C 1Q43A 1WLCA 3O0XA 1NX9A 3C7GA 3GHNA 4PBPA 1AR71 1UIJA 4LBNA 2NM1A 4JDMA 1VMFA 4CXYA 2WNVA 3M8LA 5FLJA 1LHWA 3TOJA 4L97A 1JZ3A 2DBIA 4KGGA 3OGJA 4A6OA 5L7OA 1T6GC 2WLPA 2LS6A 4RS5C 3UJQA 3M7AA 3BU7A 4ASMB 1GOHA 4I3GA 3RPQA 4BHPA 4D8MA 2UY9A 5LRRA 3E5XA 1W9FA 1RUC2 4FPJA 3O5SA 4QX0A 3GZAA 3ZM8A 1G6NA 3H7YA 1VAKA 4YG6A 4AQTA 2YFZA 5BNNA 4AG4A 2VCCA 3KT7A 4FI9A 2CYFA 1QXJA 2PHLA 5F3GA 3H3ZA 4L92A 5A6QA 4WM8B 1H8TC 1ULOA 3OEBA 5FZEA 2KR2A 2PXJA 3RZGA 1C5HA 4P9IA 4MXWB 3KHCA 1MR5A 4NPRA 4XDOA 2R041 4URAA 4XFGA 4JQTA 1E5HA 1JU4A 1WZXA 2DWRA 4BK5A 4RGGA 1FMD1 3MF9A 3LCPA 3MIDA 5LA9A 1AF9A 4YGCA 5FOBB 2ENRA 3NWKA 3UETA 4FAGA 1GNHA 4OYUA 4FFGA 2D97A 2R063 2IXCA 2ZJCA 5FTTC 2RHPA 3N9MA 3S5QA 5IK8A 4M0NA 2PHRA 3VZLA 3HD8B 1Q56A 1ZVFA 1VB2A 3CHXA 4KNCA 4COZA 5EIYB 5KHHA 1HKDA 3N7KA 3HN1A 2R6QA 1W6OA 3OCPA 4H7MA 1D7PM 1JZ8A 1DYKA 2XJUA 2W08A 1AR93 1T6BX 5JCTA 3H7JA 3DKWA 4R52A 1HB3A 3LFMA 3ZXGA 4CCMA 5BNNB 4XPVA 4ATEA 2OUHA 4KG8A 5K8SA 4DUVA 2MEV3 1QJU2 2BFUL 2PHDA 3W59A 3GM8A 1EV12 3HIFA 3DCQA 1R1A2 4EWDA 3UKTA 1UMIA 3THPA 4EJRA 3MBWA 3CZJA 2HEVF 1REDA 1XQNA 4LBKA 3EYPA 4IE0A 4YW3A 4YW6A 4BQXA 4HLTA 1YCIA 3SH5A 1NYWA 2P37A 4C8DA 4PLOA 4XCBA 3O0VA 3ZYGA 3RMYA 5KXEA 4BQ4A 3AX4A 2WYSA 4M3CA 4XXAA 5L7OC 3TAYA 3HEIA 4KU8A 4LKEA 4KWUA 1XNDA 3ENRA 4IV3A 4DZGA 1RUF3 3OUJA 2XJVA 4H3WA 5AC93 4HT1T 3WY6A 4JC1A 3THTA 5FPUA 3MPBA 4Q4X1 3VBOA 1OH3A 3WOGA 2EA7A 3U78A 4LE3A 1PO11 3H8UA 3BTYA 4WVZA 1W03A 4MGKE 2K9ZA 5C8CB 1REEA 3WW3A 1HW5A 4RHV1 4OMCA 4PHZA 5C5TA 4MGSA 1RUG3 3R0RA 2QQWA 2ADEA 2Q8OA 2WDBA 4CU6A 5JSPA 1VMHA 1I5ZA 1UZVA 2XONA 1WCKA 3QBQA 1F35A 1CESA 2A3YA 2X29A 3U14A 4B29A 2ZKLA 2UWCA 3CJIC 1IS4A 1JN2P 3AYDA 4UFKA 1W6NB 3GF6A 1CX1A 4QHOA 5FYMA 1WKYA 4L9BA 2A71A 1OFNA 2R062 3T4VA 5T5PA 2A3WA 4L11A 4CDQC 4BE3A 4XW3A 1KS5A 3RZZA 3VKNA 3H50A 4O9GA 1E5RA 1AX2A 1AYN1 2JE9A 4KMQA 4Y4RA 4AVTA 5D8AA 1OQEA 1ODMA 4FFIA 1V6NA 2CL2A 1R081 2XBO3 1AR92 1W8UA 3AP5A 4QGMA 1RUJ1 1YC61 5T5OA 2LTNA 4G3YC 1W9YA 1O5LA 3APBA 2D44A 3OOXA 5DDJ1 1Q8QA 1QDOA 1ZBA1 2MEV2 4FQ4A 4INDA 4FOYA 3QH6A 4GB33 1LENA 1AXZA 2FBEA 4HN0A 2CWMA 4LXLA 5CNAA 4NUBA 1M4WA 1ZA4A 1RUD3 5CZKA 5JMCA 5JXJA 1Z7S1 5I0RA 3FLPA 3HT1A 3M1HA 3AMQA 2RVAA 4OHVA 1P8JA 3BYWA 1CJPA 3LOBA 1TQ5A 4Q4Y3 4IL7A 4Q0UA 5DUXA 2Y6HA 5GZDA 1JYXA 2WWSA 1L3JA 1V70A 3QACA 2E32A 4P9JA 4AWDA 4CU8A 1IQDC 5CG9A 4LMFA 1A8DA 1HV1A 3AJYA 1UAIA 2VBDA 2QQKA 4FXGB 2DF7A 3AZVA 4LNVA 5A1LA 3N35A 5AC92 1C1LA 3URFA 2WR9A 3O1TA 3S57A 1S2KA 2RS31 3Q8EA 2QQLA 4F3JA 1CAUB 1H0BA 3LOIA 3N7JA 3LDBA 3N9NA 3NQHA 5FFOC 5JOWA 2JWPA 5FPVA 5EFUA 2QQVA 4Z1VA 1ULPA 4AW7A 3HMYA 2QQMA 5GALA 3B7MA 4Q4W3 4WM8C 3EB7A 4QAWA 3WW4A 1DQ0A 3PUSA 4DINB 5KHIA 2VW2A 5K4LA 1DQ4A 3I2HA 4WVWA 3J26N 1OA3A 3KV6A 2DCYA 5DMYA 3AJZA 2XL9A 5FMDA 3MIHA 4AI0A 4DEQA 1W6PA 4LHKA 1PM4A 5FJKA 1KS4A 4EV0A 1ND3C 2WA4A 4OUSA 1A6CA 4LA3A 4MO3M 3HT2A 4QU2A 5FKCA 4BB3A 4QDRA 4JAAA 5F2WA 4A7YA 1PO23 4B8EA 2RDSA 2BZDA 2WNUC 2GP3A 3ITQA 1GNZA 4XAAA 1QNYA 3M3OA 1DU3D 4LULA 3WNXA 4C1WA 5GZFA 4MZUA 1TNRA 2IUWA 4CCDA 5D8AC 3DPRA 4LQRA 4OFGA 4Y5SA 2OXBA 4LE4A 1LTEA 2XBO2 4H7LA 5L73A 2YZ4A 1ZBE1 5A32A 2HWC3 3I59A 1M06G 2F4PA 3ZFEB 5LEKA 4CP2A 4BMBA 3DYOA 4GB32 3AMNA 4LBLA 4DY5A 3SEEA 4BIFA 5KHKA 4UOJA 5A7QA 2E33A 2QQJA 2VY0A 3J7HA 3MLJA 1ONAA 1BHGA 2A6ZA 2D6MA 3N3HA 1PGL1 5T54A 3ZXDA 1TMF3 4DY3A 5JSOA 5ANQA 1J84A 2OT7A 3OD4A 1W6QA 1EAH2 3HNYM 5FYSA 1JYTA 2GMEA 2ZX3A 3AKTA 4QXCA 2HBTA 3GGLA 1QOTA 4Q4Y2 5FZLA 4RYDA 2V72A 2B4KA 1COV1 5J7MA 4YVSB 4IEPA 3DYMA 2JIJA 2BERA 1OKOA 2VAUA 4GMP1 5FO9B 3KQRA 1YQ2A 2ZHLA 2B45X 1IQAA 1MS8A 2HWD3 2R071 1XE8A 3PIJA 1OUXA 1WW4A 4GMP0 4H55A 3MEPA 1BK0A 1W0OA 3DYPA 3I3DA 2EIDA 2EXIA 2QQIA 4YGBA 5FREA 2BW8A 2VQUA 4W4ZA 4COUA 4QKFA 1NQJA 3WNPA 1SDDB 2BGOA 1RGSA 1PNGA 4EQVA 1IPSA 3BIEA 5K9YA 3FHIB 4Q4W2 4BLJA 2ZS6B 1W2AX 2BGPA 4K9SA 3F2ZA 1E5IA 5H9RA 1JUIA 5C8CC 2ET1A 3B94A 3GBGA 3MGUA 4TTGA 2EVXA 2WZEA 1NLRA 3VN4A 3RZMA 4PDWA 5FQ0B 3NRUA 1LOGA 1GQPA 5SV8A 3ZSMA 5CIRA 2GH2A 2GZWA 2OYZA 3FE5A 3MZHA 1ODNA 5I8TA 2NYYA 1IKQA 4UFLA 5DZGA 4YZ3A 5BNOB 4I09A 4Y1YA 4AR2A 4H2AA 4MV2A 1NCQA 4RD7A 1QNWA 5GLTA 5A70A 3I2IA 1F4HA 3POJA 3J7LA 1C8M2 1EUUA 1OA2A 2OX0A 4JDOA 4MUVA 5HV0A 4CPBD 1H9WA 2VZQA 4FBFA 4LR4A 5H9SA 3GCXA 4SLIA 1LHVA 1OI6A 1SPPA 2A73B 4LJHA 1W3XA 3B93A 3T2TA 5C5UA 1DG6A 5F5AA 4CU9A 5CA6A 3W5MA 3ZOIA 1MQTA 3VDDB 5A6XA 4D7SA 5FPZA 1GFF2 1UY0A 3WV6A 4NAOA 2DVDA 4RA0A 5HXMA 1BBT1 4BQ5A 4XFAA 1BMV2 2HKXA 1PMIA 3EXUA 2VUDA 1V6IA 3N9PA 4IEVA 5EWSA 2AEZA 3LIHA 4PIXA 3FMGA 4GH4A 4TZDA 4DRVA 4YGDA 2IXHA 3T08A 1CR7A 3U75A 5J37A 3M3IA 2BV4A 1ZX5A 2BFUS 4YLZA 1MZEA 3KCXA 4QPGA 3PTRB 1RVF3 1XB9A 5A3WA 5BNQA 4NIHA 5BUVA 1KQRA 3B3QE 3MIEA 1JZ4A 1ULEA 4RQPB 4Q4V1 5DQ0A 4XHBA 4HN1A 2HWD2 1AR63 2PLV1 3AVRA 2R061 4UF0A 4OZXA 1VRH3 4K6BA 5E1RA 3V0AB 3LWCA 3WT3A 3NL1A 4XUPA 2VGDA 5F39A 2PHTA 4W6YA 1Q8OA 3VBFB 3GZTB 4QWNA 2JDZA 2WJSA 3PJYA 5A7NA 3K4AA 5DAQA 5KXCA 3E5QA 1LESA 1AHSA 1NE4A 3ACLA 3DL3A 1HJFA 4QXKA 3IAPA 4NPMA 1DZRA 5DXDA 2CAVA 4AL9A 5FOJB 5GLWA 4E2QA 4F83A 3E5UA 1NLQA 2ARCA 1AR73 2W92A 3LDRA 1OOPA 2MEV1 2JD4A 4CEWA 2Z5WA 4K1YA 5FXXA 3S6PA 2XR4A 4WVMB 2ZGSA 3N9QA 1JZ5A 2D6OX 3V0BA 1DGWA 3B01A 4JRAA 3NV3A 2DCJA 3SKJE 3ZPYA 5FYHA 3VDBA 2I45A 4Z82A 1E57A 2RMU2 1DQ6A 1Z78A 1RHI3 2ZKNA 3FC0A 3NV1A 1L7QA 4XF0A 2JB4A 4BU2A 2XB6C 2R16A 3KF5A 3POFA 1WW7A 2VZOA 2QKDA 3IWZA 2C1FA 4AE2A 2DUOA 4CP9B 1RUF1 1MQTC 5AC91 1VBD2 4FP2A 5HCFA 3PUQA 4DUXA 5LBEA 3PHMA 4XHXA 4COVA 5C4WC 2ZA9A 3A0NA 5IVCA 1R64A 3H1WA 3IMNA 4NRQA 4OHWA 3RJRA 3WX5A 2XUEA 1AUYA 4EROA 5GZGA 2LW8A 1FYUA 4A45A 5LRSA 2FHRA 4LLOA 2ZX2A 2TBVA 1QEXA 3H3UA 3UNPA 1GLHA 1RUG1 3KCYA 1QU0A 4IUGA 4QB1A 1N3PA 4URTA 2YG0A 4YVSC 5LZ6A 3CBNA 2VMDA 5A3PA 1RVF2 4JGYC 3NMBA 3GYDA 4AHXA 4NJ4A 2PMWB 3A4UA 2R7EB 3AZZA 3ES1A 1B35A 1OF3A 2WA3A 4ITCA 3GALA 4JKKA 1PX4A 3WG3A 1GWLA 5J1XA 1VAMA 4HOOA 5ABJC 4FT8A 4XVHA 1JHJA 4AVAA 2ZABA 2IXJA 4B7EA 1CD3G 1SLCA 2D98A 2PELA 5L9VA 3BTXA 4LBMA 1O3SA 2Y0OA 5F2SA 4XIKA 3VBUC 2XBO1 3HN3A 5A3LA 3KGZA 1NT0A 4DEVA 4DFSA 3VBHB 4LEJA 2UY8A 4YM0A 5DUUA 1AR72 1XU2A 2RDQA 3LIGA 4ORFA 1CZSA 2ZACA 1YQ5A 4GB31 5FMCA 1HRV3 3UKNA 2HEWF 4BPZA 1RUD1 3OBAA 1XU1A 3PDQA 5CFDA 1W2TA 1S0GA 1DYOA 1SFYA 3MFAA 3CDZB 4AGRA 4YARA 1QY4A 5JPNB 2W91A 2YPDA 1RHI2 2WAAA 2P6CA 4MSVA 1GOFA 4IGPA 4NHXA 3KS7A 4Q4X3 4AEJA 4NIGA 3ZSLA 4TWTA 1GUIA 3NV2A 5FZKA 1GP4A 3CF6E 5F3IA 1PO13 4LBJA 4AFCA 1PNFA 5DZFA 4D3WA 1EUTA 2DU1A 3MPPG 4X6RB 4B4QA 4CDUA 5F1RA 1NXMA 3W9AA 1IS5A 2R042 2FCVA 2WQ4A 5CISA 4XMIA 2ORZA 1FMD2 3POGA 2Q8DA 4QPIA 3OPTA 1UCXA 1A34A 1VAVA 1UZYA 3OGRA 2UYAA 3FL7A 4B1LA 3JXSA 4I0AA 2RJLA 3C7FA 4XUNA 3V65A 4BXFA 3T2PA 2VBPA 1RIRA 3ZYRA 3AMPA 4NN0A 1AYN3 4RQPC 1DYPA 1NCRA 4ZZ5A 3LPFA 4UFJA 2VMHA 4IE5A 1XNTA 4N43A 1PO21 3KZ4C 5BNPB 5JIAA 1RUJ3 1KXGA 2N7GA 3IKWA 4UWDA 2WN2A 4OULA 1ENQA 3VBSB 1GWKA 1GZCA 2JDKA 3NAPC 3VHNA 1W0NA 1ZBA3 2GC3A 1N1SA 4U36A 3VBRA 3OYWB 3T0AA 3AZXA 2P3YA 1BEV3 2QJVA 3VZKA 4I3PA 4CCLA 4BISA 3ZKYA 1WGPA 5DAVA 2Y6GA 4Y1ZA 1HXS3 1XSQA 1Z7S3 2ZOEB 4OMDA 1QOSA 1UXZA 1K5MB 2W0XA 2DU0A 1ENSA 2HWC1 2W9XA 2VOTA 5IVEA 2BDRA 5KXBA 1UMHA 1WCUA 1WBLA 2DUPA 4PCRA 4S2GA 2DVFA 4OI4A 1K3IA 2JKBA 1RITA 2J1RA 3OY8A 1HRV2 1HB1A 2YUEA 3AP4A 3UESA 2XKOA 2G4IA 2X5IB 5JI7A 1AX0A 2EXJA 5CFCB 2F4LA 3RYPA 1AR81 3KGLA 3VZOA 5APAA 2BBVA 5IVVA 1TMF1 4GQ7A 1ZZCA 4TLFA 3OTFA 3VZNA 2Y8KA 2IZWA 1KD7A 2WZR1 4OUMA 2JG8B 3CZUA 4YRDA 2JG9A 1CVNA 4UBGA 3ZN6B 3WHTA 4Q4X2 2Z42A 3SCGA 5KHGA 4QMAA 3VKFC 1ND2B 2QDRA 4HPKA 1WMXA 4FSJA 3ZSKA 1PO12 3RI8A 1O3TA 5FZOB 2Y60A 4CDUC 2JB8A 4JX0A 4RHV2 4BQ2A 2RDRA 2XHNA 4AQ6A 3ZFFB 1GQHA 3LA2A 3ZN4A 1BZWA 1YIFA 2W94A 5JR7B 4AFDA 5IFTA 3SXWA 2ZEXA 3F95A 3ROUA 1NA1A 1XPWA 1ULCA 2A6YA 4PQ9A 4KQ7A 3I7DA 2QDNA 2A6WA 1UZ0A 3SCHA 2YBPA 2MPFA 4RR3A 4OI2A 1Y3TA 5I0UA 3SHRA 5KHJA 3MLLA 4NWVA 2WQZC 2VUAA 4QX7A 4LBQA 2KM2A 3H3LA 4LO5B 1VJ2A 2ZBJA 1OD3A 3M3CA 2NN8A 2WUHA 2X53S 5FXVA 1UYYA 1AYN2 2W1SA 1LOEA 4QD2A 1AL21 1J58A 4ES8A 5LEJA 2BUKA 1N3QA 1R082 4HKOA 4RS5A 4AVVA 2VCAA 1RUJ2 1ZBE3 3BN6A 3HQRA 4R4ZA 1MVEA 1WD3A 5DDJ2 3ACIA 1ZBA2 2WIIB 4EN7B 4YFZA 4E2GA 2DCKA 3JBG3 4W50A 1HXS2 1H8TA 1Z7S2 1E5SA 5FZ7A 1C4RA 1YI9A 2NMNA 1W06A 2WNVB 4HSLA 2WRAA 4OZOA 1PVXA 5FYUA 3USUA 3VZMA 1UYXA 1RJ7A 1SFNA 5D21A 4AFAA 3PTYA 2YXSA 4S2HA 4XURA 4FTBA 1COV3 1J3RA 4CP1A 1TZOA 1AJKA 1UOGA 3H1YA 1NZIA 1TEIA 4M4PA 4XFBA 4D6SA 4GMP3 4BDVB 2ADDA 1DP0A 2B7YA 2R073 3OSDA 3WUDA 3UKVA 4GXLA 4RN5A 2A75A 3SKVA 2J1VA 2XMLA 4XTPA 4CRQA 4D69A 1RC6A 3JB4C 4K8FA 1ZM1A 2RS32 1OT5A 3GZEA 5T52A 1JYNA 2ZAHA 4Y1UA 3I4IA 1VLNA 5F37A 2CY6A 1KFUL 2K46A 1WW6A 3RZHA 4D0QA 1AR61 2P1BA 2ZMLA 4LBOA 3VDAA 1VRH1 3A22A 2Y6JA 1O8PA 4I02A 3WR0A 4DIQA 1ZRFA 4Q1RA 1QJZA 1H1AA 2Q1ZB 2DURA 4W6XA 4YW5A 3J7MA 2EAKA 2PAMA 4XABA 4CU7A 1RINA 5FDBA 1KFXL 1DF0A 4IEWA 1NA1C 2GALA 2IWGB 3PVNA 4LOTA 3WCSA 4AI9A 1ACCA 1FATA 2BRTA 3LD8A 4L0PA 3AZWA 2BEOA 4A3XA 2X09A 5LW9A 3LAGA 1R093 1KITA 3J8F1 1W9WA 4AZZA 1O59A 1C57A 1KRIA 3RYRA 3PLQA 1CAVA 1CGPA 1FOD3 1W6OB 5IW0A 2WNEA 2IC1A 2HLEA 3B69A 4XBQA 5B4NA 2ZZJA 4QXBA 2VTXJ 3CNAA 2EXHA 2GH8A 1RUE1 1G9FA 1RHI1 1ZBE2 1W9SA 3VBSC 1ZRRA 1CJDA 4P14A 5C9AC 3OG2A 3LKJA 3BOPA 4MLOA 1I6XA 5H9PA 4XUTA 4N9HA 3GXUA 3KSCA 4PBOA 4CUBA 4E4DX 1BBT3 4IV1C 3AXEA 3WSOA 2RG4A 3JBG2 2VNGA 2DCTA 1PGL2 4ISQA 2KA3A 1O7FA 1LJ7A 3KVBA 2LRPA 1D4M1 5FZ9A 1WCSA 4LHSA 4ARYA 4XETA 4CDWC 2VXRA 1JW6A 4M3CB 4S2FA 3ZYFA 5JOZA 3UGFA 1COV2 4DS0A 2QTWB 4IV3B 3VHOA 3RWKX 2RJKA 2AUYA 3CJIA 4FPCA 4QPYA 2XHKA 3WP4A 4LK6A 4Q4V3 5KBFA 2R072 3OPWA 1SQ4A 2PLV3 3DKQA 4P9GA 5KR7A 5A33A 2VU9A 4MHRA 3VBOB 2VZUA 4CDQA 1CIYA 1C5IA 2AGSA 2NLRA 2W3JA 3VL9A 1BK1A 2W1UA 3HPNA 5F3EA 1TME3 5FY4A 3K4DA 3BU0A 4BZ4A 2VNVA 3WNOA 4Q0SA 3HNBM 3ON7A 4HG6B 2VVEA 3HJRA 1X9TA 4V2WA 1OLQA 3ZFFC 1GZWA 1UKGA 2D7FA 3RG0A 2FCUA 1AX1A 4DXRA 1QJY3 4BMEA 4CDXC 3IIIA 1YRZA 3IDEA 1ZRDA 4FVVA 3S7EA 3FBMA 4N53B 4XCAA 3FJSA 1QMJA 2YY1A 4GJYA 3MO4A 1H2LA 3ZXAC 1G9DA 4XUQA 4Y5Z0 1BVP1 2DTWA 1VP6A 1V6LA 1NAEA 4XDPA 1SEFA 1HRV1 2CTVA 4RFRB 4LUMA 4BQYA 2FD8A 5FK8A 5FBZA 1D0GA 4NWWA 3SNMA 3PVEA 3KCCA 4XJ8A 4ZU7A 3OUHA 3T0DA 4AQSA 5T50A 3OBTA 5JMOA 2K0GA 4WM7C 2ZX1A 3LA3A 3P3NA 4P02B 3H0OA 2E7TA 3MFCA 4K40A 4AI3A 3VKOA 1KJRA 5EHDA 4DXTA 3NV4A 5JIUA 3POWA 5FMBA 4IEYA 4MOAA 1BBT2 5GZEA 4Q27A 1LCLA 5I0TA 4KI5M 4A6SA 4LLFA 4GA9A 4DOUA 4WM8A 3THDA 5FR3A 5LATA 1ULGA 3O1VA 5BYNA 1QDCA 5J98B 1AVBA 3WDXA 3O0WA 4C91A 4FTEA 3INAA 1PGSA 3PUAA 1GP6A 1N1YA 1LAJA 1HN0A 4NIDA 5E16A 3TEZA 1ND3A 1DFQA 2HWF3 3HBZA 4ZY9A 4KGQA 4Q4V2 2OVUA 5FRAA 2PLV2 1VBA3 2BVVA 1A3KA 2WNUA 2ZXQA 4HVOA 4AQ2A 5IK4A 2GAUA 1ULDA 1VIWB 1FV2A 3IPVA 3OJBA 1PZ9A 1JOBA 4Q29A 4YVWB 2OA2A 3PVOA 2HH9A 3VD9A 3NO8A 1X36A 1ZZ9A 2C24A 4IEUA 3A0KA 3A23A 4GD4A 2PHFA 4KG0A 4OLLA 4Y20B 1RJ8A 4YM3A 5JUVA 1LHNA 3HR9A 3WG4A 2VJXA 1W6PB 2A7AA 2JD9A 2JIGA 2QQOA 2TUNA 4O61A 2DBNA 1FPN1 3L9JT 1F4AA 4BA6A 1BEV1 5ERLA 2P3IA 4AEDC 1WUVA 1PGW1 3LSDA 2IVJA 1HXS1 3V64A 2JDUA 4AHZA 2CGPA 2QNKA 2VQAA 2XXZA 1D4VB 4Y26A 4CSWA 3IDCB 1V6KA 2ETEA 4HMZA 3VUOA 2VNRA 3POIA 3C7HA 4L2NA 3T3YA 2BTVC 1XNKA 2NPIA 2HWE1 2Y26A 4I0BA 4R9CA 3WQ7A 2OZ6A 4O9EA 2PFWA 5K0UB 5A32B 1CAWB 4AFMA 4XJAA 3RWNA 1SLIA 4C1XA 2J7MA 2EIBA 2BJSA 1RUF2 2XVGA 4UXAA 1US3A 3LA7A 4I01A 3E6DA 2A6XA 4QB6A 5EZWA 1NZCA 3WZ1A 5B2GB 3K3NA 4CCNA 3SITA 3ZVXA 4YZ5A 4LO4B 5FBJA 1RMU3 1MACA 2UWBA 2VECA 4XBNA 3K75B 1VBB3 3MDPA 4XF3A 1REFA 4ZONA 5I8YA 4EZ4A 4Y3OA 1MPXA 4QX8A 5KC5A 1W6QB 5C8CA 4PF5A 5A1AA 3O1PA 3FFQA 3I3MA 4JTOA 3AM2A 3NNJA 2YU1A 4M3CE 4PLMA 2DFCA 2WC2A 1UX7A 1HDKA 4LKFA 5FYCA 1RUG2 4QX1A 5FYZA 2CAUA 5B4XA 2G19A 2CHHA 1K45A 2HWF2 1QJFA 2HBUA 2GC0A 3T1LA 5GLVA 1VBA2 1CPNA 2W95A 3I97A 1WCDJ 2WABA 4CTEA 2VUCA 5HPOA 1BXHA 4ISRA 4PLNA 5JVVA 4A4AA 1LU2A 1OLME 5A7SA 1YIPA 1SFPA 4ARXA 2VTXA 3OBZA 5FJHA 3RVHA 4LIUA 4KWJA 1MZFA 4PDWB 2ARXA 3T2OA 4BQ1A 1W28A 5BNNC 1SLBA 1PVC1 3GBWA 3I54A 1W8TA 3ZKUA 3IM0A 1CQ9A 1F31A 1HJGA 1PMJX 5JI9A 1JBCA 3HAGA 4NIAA 1S2EA 2ZHKA 4NE9A 4V2VA 4ZS2A 3JBG1 1RUD2 3AFGA 4RGKA 5FY1A 1NCQB 2F17A 1AXYA 1OLRA 1AR83 1QH6A 2DFBA 5LY1A 4LO8A 4IERA 2WAOA 4MGYE 3VDCA 2WZR3 4IXLA 2QBXA 4X8NA 3T1MA 1XNBA 4QM8A 1CAXA 1QJX1 1SPPB 4A41A 3R4UA 1B09A 3MIGA 2JDPA 2VBBA 2PYTA 2RM23 1H1MA 1R1ZA 2C6SA 4JHTA 3FLTA 4CXWA 3ILNA 3GJAA 3I2JA 1MS4A 2WT2A 2IXLA 2VE1A 1EP0A 4GH4B 1IPJA 3J7NA 3ZXFA 5JLVA 4NVPA 4BK4A 2YC2A 1UQXA 3AKSA 3EO6A 1MVQA 3M3EA 5LK7B 4WZCA 4GIQA 1LOFC 1CZTA 2P2KA 3R6SA 3BKZA 4QPGB 2GNBA 1WMFA 4Q1PA 3VD7A 3AYAA 3I3BA 2MNGA 2XGXA 3TYJA 3A7QA 2HWB3 2AACA 1J3PA 2XJRA 4JKLA 4UW6A 2WFF3 4P00B 1W3VA 4UF0B 5FO7B 4QX3A 4Q8LA 3RFRA 4DB5A 2VOXA 4CA9A 4H14A 1A8MA 1JS9A 3D8CA 1BYHA 1R091 1AL23 3IDBB 3DUIA 2W1WA 1PO22 3HNMA 1W8OA 5FK7A 3ZXEA 2J1EA 4CCCA 3I8TA 4YVWC 1FOD1 2ZGLA 3PMSA 3HQXA 4LOSA 1RUOA 3R05A 2B5HA 5KWRA 4F7ZA 3WF3A 4BIOA 1S2BA 5GKAC 2VVFA 2AH2A 1G7YA 1YYNA 1TG7A 5EPAA 1WA4A 3N4MA 5A6YA 4XJ9A 1W2UA 1X33A 3B02A 1LKNA 2HWC2 5FP4A 1RL3A 4M4RA 2LM3A 5JXGA 2ZPXA 2D43A 1U0AA 5C4WA 3JCIA 3VD3A 5FZ3A 2VOWA 4YZ2A 3TN93 3IAQA 3L2HA 3D0SA 2XG3A 1KDMA 3BCWA 1AR82 3FHAA 2R30A 3POBA 3POSA 1TMF2 5C6CA 3TEWA 2ES3A 1SBFA 4BH9A 1QF3A 2JDAA 1GMMA 2WZR2 4ZXEA 1X8EA 1XNAA 2WO2A 3B9IA 4OVEA 4YVSA 1UY4A 1YFXA 3E6BA 1YUDA 3WNKA 1U5YA 4JGYA 3RI9A 2Z4FA 1QXPA 5C3PA 2ZEYA 4YW7A 5ABJA 4R8HA 1DGRA 2VTFA 3NJYA 3ST7A 2VPVA 5AFEA 1UU5A 4D94A 2FDIA 3DECA 1XBFA 4LK7A 1EYBA 2B46X 5FP9A 3R4SA 4K1ZA 4NIIA 1G86A 1TME1 3AK0A 1N3OA 4RSUA 3VBUA 4QHBA 1RUI1 3S7IA 1W8HA 3MW3A 4YM1A 3PU8A 5J48A 3J8F3 5CU1A 1IKPA 2WFPA 4G4FA 4MGIE 1QJY1 5F32A 4WVVA 1UOJA 1JYCA 3SH4A 2BBAA 3I2DA 1H8VA 1JUHA 1VBC3 2L9LA 5A7WA 1POV1 2JXAA 3V56A 3CU7A 2W87A 4COWA 3UYJA 1K5JA 5I93A 2NZ9A 2AENA 3USSA 3WQ0A 5BNOA 1U5ZA 3BVCA 1L7LA 1AL22 3SH3A 4D7YA 2OUJA 2E7AA 1ZRIA 1TNFA 1S0FA 1RUE3 3IN9A 3ZN5A 3AYEA 1IHMA 2EIGA 3HBKA 4ES9A 4K8RB 1HQNA 4CEYB 5IT6A 1ZREA 1DZQA 2R0FA 3AZYA 3NKTA 3ZFGB 4DPNA 4EN0A 4MYEA 5C3SA 4GZ9A 5C3RA 3C7OA 1YHFA 5CKMA 2C5DA 2DTYA 5FPXA 3LEMA 3MIBA 3ZFEC 5IAXA 2RJ2A 1G9AA 3NVCA 1WD4A 1D4M3 4FPYA 4Z2WA 5CFDB 3O1SA 1SCRA 3IB3A 1OVPA 2XH6A 1LGNA 4JDNA 4XJWA 2WKKA 3IBMA 3RJ2X 5I91A 1S0IA 2XQXA 1G9BA 1LULA 5HCAA 3QH7A 4TXWA 4HONA 1DDLA 5DG1A 2ZX4A 3FBYA 4AEMA 3ZR6A 2XL7A 3M3QA 1NUKA 4ZU4A 1O5UA 1QKQA 4FPHA 2XWJB 1HN1A 3SC7X 1BLZA 2O8OA 4XE9A 5G04L 2FMDA 3PVBB 1J83A 5JZGB 2HWF1 3ZXLA 1DCSA 1NY71 1QWRA 4RQPA 3AC0A 4EE2A 3ZO0B 1PX3A 2ZHMA 2WT1A 2C26A 4M0HA 3V0AA 5I8SA 1AR62 1WBFA 2B42B 4GALA 1VBA1 1VRH2 4GKXA 4E4SA 3ME2A 1GZ9A 4QQOA 3W20A 4C0BA 4OHYA 1LGCA 3RYKA 3K77A 4B4PA 4QPIB 5L19A 3NAPA 4HBNA 2D6PA 3LDKA 1US2A 2OQ7A 3NNFA 2VMEA 1FI2A 2XUMA 4CYDA 3ZYIB 2RV9A 2J42A 2WSUA 4J25A 4Y24A 2VO5A 2VR4A 3J8F2 2ET7A 1NCRB 2E9QA 3D3AA 1VBC2 3IDAA 4LHNA 4N43B 5EQUA 4XJZA 5FY5A 1GANA 2D5HA 1IG0A 1KGYA 2D5FA 5BNOC 3LQCA 4LA2A 2NQYA 3WD5A 4V1PA 3ZYBA 4K20A 5IHRA 5FPLA 4HFSA 2ZGPA 3IIAA 4UI9L 4FXKB 2BPA2 1RUE2 2Q1MA 3KF3A 1X8MA 3MUZ1 5T5JA 3VBRB 3WQ1A 2YPJA 4B4RA 4Q8KA 3AP7A 4QKDA 5FY0A 4W65A 4WBBA 4NHKA 2OQ6A 3NNMA 4AK3A 3BB6A 1MZ5A 5GM0A 5IVYA 3CQOA 4NPLA 3K46A 5BPXA 1PK6B 1DIWA 1GSLA 5LA2A 1SBDA 3W58A 4CP9A 1UW8A 2ATFA 2D40A 4XXPA 2ZX0A 2ZZQA 5DABA 3VDDC 3H42B 3HVDA 4KBBA 5DPNA 5A3UA 2ZGUA 1S0DA 3UL2A 1D4M2 1DBNA 1W6MB 2JDMA 1Y9MA 1RMU1 3LFIA 5FZ8A 1O4TA 1SLAA 1YNAA 1UMZA 4UFMA 1VBB1 3RMXA 2EIEA 5LA0A 1UL9A 1ZA7A 4HKLA 1RUH3 3B5LB 4TSVA 2WN3A 3WVJA 3A21A 3MV11 4CCOA 2DYCA 3OF1A 1JZ2A 2PHXA 1UN1A 4PIYA 2VM9A 3NJXA 4BXSV 4YZ1A 4IW3A 5C71A 3H8RA 4O65A 1ULFA 2Q5TA 2SBAA 2VOKA 2GP5A 1X9PA 4HPKB 1OURA 4CCKA 1D2SA 5JOYA 1NLSA 1JI6A 5EJ3A 4JCKA 4ONUA 4E8DA 5EP9A 2ZGTA 2FDFA 5J36A 4B3NA 5JPMB 5ACA1 1RXGA 2YHJA 4AVBA 3WG2A 3RZKA 4AHWA 3VBFC 2B9VA 1DZTA 1FPN3 2EAAA 4PJYA 4DO0A 2IVIB 1L7RA 2XLGA 2OKXA 2J1AA 4RR3B 1OXCA 3IMMA 3S5AA 1GICA 3KWVA 1HIXA 3U4SA 4YW2A 5FXZA 5F9TA 3ILFA 1YJLA 5DAPA 3HOBA 3FUQA 4KWKA 3ETPA 3W21A 3ORJA 3O1UA 1XYNA 2PTMA 1JYIA 2A6VA 4QQLA 2HWE3 1ENXA 1RXFA 3OBRA 4QX5A 3UV9A 4XQ4A 2Z69A 1YFWA 2YC0A 4FTSA 5CG8A 1UU6A 4OQ8A 3H9AA 3WDTA 5DG2A 2ZEZA 4CUAA 5CYYA 3ZFGC 4YYOA 1MEC1 2R49A 4IEZA 4JGZB 5CVRA 3SCFA 3M2MA 2D3RA 1CZVA 3D6EA 3PIGA 4JRLA 4MX3A 1UX6A 2RM21 2RE9A 4K7JA 4LIVA 2VW1A 4IEQA 3NKGA 3C3VA 4ZXKA 1PIV3 1H6XA 3JQXA 1FV3A 1DQ2A 5I0SA 5CB7A 3RZJA 2JE7A 3C8XA 3BTZA 2K2SA 1IPKA 2P6HA 3ELNA 5A6ZA 3IT8A 3KV9A 5FZ6A 1W90A 4QGLA 3LEGA 1SLLA 3ZMNA 4AI8A 1LHOA 1EY2A 1HX6A 4TYSA 4AYUA 3ZYHA 1UO9A 3FZ3A 5JDBA 2HWB1 5GLUA 3U07A 5JZGC 2WFF1 2X05A 3DEMA 5ANNA 3KT4A 4KWLA 4XYXA 5DZEA 4MADA 4Q2FA 4E4HA 4YW4A 5L36A 3EMRA 2Q1FA 5FP7A 3AP9A 3U11A 4R9DA 4CCJA 3VBSA 2JICA 5C9AA 5ISLA 1PVC3 1PHMA 2ZCWA 4P5HA 1FPN2 1V6JA 1HRI3 1ALYA 3I2KA 4IV1A 3RSJA 1BEV2 3KHBA 3ABZA 1PGW2 1O4ZA 4J6GA 1DQ1A 4GWJA 3R4DB 2PQSA 3VBHC 2J1SA 2NMOA 1Z0HA 1CAVB 4Q0VA 2RR11 3FWEA 4NHLA 2QUOA 1XXNA 4FOVA 4Y1VA 5EJZB 1V6MA 4CDWA 4DXSA 3TN91 4CXXA 1F5JA 2X5IA 5BXXA 5L7OB 1QJX3 2CWSA 2HWE2 3MI8A 4RGAA 5A80A 2G9FA 2C9KA 1AXKA 2D6KA 2FMYA 5J96B 5FUNA 5IJRA 2O8QA 3P5BA 4X6QB 4AHYA 2EALA 2FCTA 2QFEA 3BI3A 4JVAA 1V0AA 1HV0A 3ZN6A 2W1QA 2W47A 2WNOA 2ARBA 3SISA 1PK6C 1QH7A 4XFFA 4R9AA 2Q8EA 3JZVA 4Y4YA 4NO4A 5FO8B 1RB8G 1AYM3 4P5YA 2O0OA 3U1XA 1FNYA 4ET7A 2O1QA 3H8XA 4ASKA 4M00A 4P9YA 3WLUA 3ZFFA 4B1MA 1O6UA 2C4XA 4IE7A 1PIV2 4FPLA 2QVSB 4XBLA 4EWEA 4IE4A 3VHPA 4CDXA 3D82A 1KEXA 2UU8A 3OB8A 5A3OA 5A33B 4GAZA 1UNBA 5JOXA 1JTZX 1W2NA 4M01A 4CDQB 3BTAA 4UYBA 3VGIA 3WUCA 5J09A 2LUWA 1J59A 1UPSA 2Y64A 1QIQA 1VBC1 1JOJA 2X10A 1KDKA 1Y7BA 3WDVA 2E7QA 3SEPA 3ZSEA 4AI1A 3C2UA 2JE8A 2GC1A 4UAPA 5FCCA 1W0PA 3N7LA 4UFIA 1QJU3 3CKHA 4QQ2A 4WM7A 5BNPC 1EV13 2I2SA 1R1A3 1PVC2 4LITA 2JENA 3WQBA 4MG2A 1MS1A 3RZLA 1VALA 1OQ1A 2VZ3A 2WO3A 3G7DA 4P9XA 2LALA 4XFCA 1K5MC 3CMGA 4HETA 3KT1A 1UYZA 1YXWA 1F5FA 5FY8A 2PA7A 4Y22A 4Z2AA 1HB2A 2ZGQA 2PHUA 1WLWA 1J3QA 2YFUA 3K48A 1Y43B 1J1TA 3DF0A 2X5IC 2ZHNA 5BY5A 1QJX2 4QM9A 4XAEA 5CFCC 4LPLA 4AXOA 3CO2A 4E8CA 4N8MA 4Z07A 3P1IA 4QXHA 3D5OA 3WXPA 2BGCA 1IOAA 2P5BA 3TWIA 5IK7A 3D0JA 3LPGA 4OCTA 3O1OA 1C3HA 1VPHA 2JG8C 1O8SA 2RS11 2DCZA 5LBFA 2VMGA 4JGZC 2DVGA 1FNZA 1G8WA 3KMHA 4CPBA 1FAYA 3B00A 4I0WB 1ND2C 3KQ4B 2Q4SA 3PMEA 3L2YA 1AYM2 1Q3EA 3ZLIA 2VVDA 1RUI3 3I2FA 4LKSA 3J9SA 3ILRA 3G6JB 4A42A 2JDHA 2RS51 3LZZA 5FY9A 5LWBA 5J3UA 4BYYA 2WLQA 1JYWA 1ND3B 3PURA 5FZMA 1IS6A 4IETA 3Q8FA 2V5DA 4AEDA 5F5CA 5CADA 4Q5OA 1POV3 4XZUG 1WW5A 2WNUB 2BNOA 1GYKA 1H4GA 1WLTA 2PAEA 3K3OA 1R092 3IPVB 5E8AA 4EN9B 3LB9A 4FPFA 4YM2A 1SBEA 3MLKA 3WP6A 4O7XA 4AAXA 4YW1A 1I1EA 1HQWA 5D8AB 1OSGA 1FOD2 4S2DA 4XF1A 4I2OA 1ZZ6A 4CZSA 2VZTA 2Y38A 2YB7A 5CKNA 2KD7A 2BOIA 2D6NA 1NG0A 4LORA 1D0HA 1WMDA 5C3OA 5DAWA 2A70A 3E6CC 3MW4A 3KB5A 1UZZA 2C9AA 1NE6A 2OIIA 3AP6A 2IFRA 5A1FA 5L9BA 4Y33A 5A3TA 4HK8A 3JB8A 3I3EA 3POEA 3KV4A 3CEWA 5C3QA 1JH5A 1IS3A 3RNSA 3LGRA 4HL0A 2XOMA 1FT9A 5LY2A 3CL1A 1JZ7A 4FQZA 4QDQA 5DAXA 2BOJA 5GJ6A 5JR2A 5JSRA 2WNVC 2VH9A 4GKYA 2V4VA 4MXWA 1H6YA 1S0BA 2AC1A 2XLFA 1POQA 2A5ZA 4EN6B 4XF9A 4N7UA 3LF7A 2ZTNA 3OPZA 1LOCA 5AFBA 1QXRA 5FP8A 3SQOA 1RUH1 5LBBA 1V6OA 4TN7A 1V9U1 3MYXA 4OUEA 2Q8CA 1YFYA 3ZDSA 4D7TA 2QQUA 3AKPA 3ACHA 4NOTA 4PF1A 5CBLA 3GNEA 4ZKTB 5A3NA 2UURA 1GV9A 3MHZA 3UT0A 2P34A 3VLBB 5FYTA 2WS93 1GQGA 3GBFA 1TME2 1DGWX 1H1IA 2CU5A 3LSEA 4TLGA 1OLMA 1K12A 3HQUA 3NJVA 1JODA 3BIWE 1RUI2 4BJ0A 1G9CA 5HCHA 3H1MA 1F9KA 2W68A 3SMHA 3VL8A 5DN2A 3N9OA 1ASJ1 4WZFA 3TRSB 3WW2A 3ZYJB 4E2SA 3WDUA 4HVRA 2G9ZA 4FO9A 2OPKA 1QJY2 1F15A 2Z2SB 1YQCA 4OHZA 4BM8A 4IESA 2JDYA 3EJKA 4PI2A 4CVUA 1GWMA 4N53A 1XE7A 1UYPA 2ZMNA 5JXIA 2EF6A 1H4HA 3AL5A 2R32A 5F5IA 3BUCA 3K51A 1D2QA 2YC4A 3FN9A 4QU1A 4UBHA 3NNGA 2O14A 5IATA 2YBSA 3DPRB 2JKXA 1JMUB 2ZEWA 3OEAA 1VR3A 2YBKA 3JD73 3RGBA 1O3QA 3VB9A 4QHZA 1Y9QA 3T2QA 2VMCA 1AL0G 1QQP1 5FZBA 3I59B 5FZ0A 5L9RA 2H0BA 4UW5A 4XFHA 4AI2A 5HCBA 1W9TA 5IUQA 2XVKA 2E53A 5FP3A 2J1UA 4GWIA 4EZHA 3WNMA 5D2AA 1F8VA 1H2NA 3I2GA 4QKNA 4XILA 1O91A 1UU4A 4HVQA 3AKQA 1QHDA 2GU9A 1EAH3 4LBQD 4JZRA 1LOFA 1J1LA 5LK5A 5IFPA 1CAXB 3S0MA 3VZJA 1PIV1 5LASA 2W52A 1H2KA 2V73A 3VD4A 1WCQA 4HKWA 1DGLA 3N9LA 2BVBA 4IV3C 1LB2A 3O1MA 4K3UA 5FXWA 2FDHA 3ZR5A 4M3CF 3ALQA 1NY72 1W6NA 5JWPA 2RDNA 2YROA 3EQEA 2GN3A 4DUWA 3VBOC 1PMHX 2P17A 5ACA3 3OD0A 4AOCA 4YZ4A 2UWAA 4E9KA 2QQNA 2SLIA 4YVWA 1V00A 3QD6A 5FUPA 3U37A 5HI0A 4XOGA 1EPWA 4L99A 4QQPA 5FAXA 4FOQA 2IXKA 4ZPIA 2QQPA 2WS92 3AMHA 4Y20A 2OPWA 4PT6A 5FPBA 5A3MA 1GBGA 2VULA 3C7EA 4UT5A 1YJKA 4IEXA 2FDKA 2PN5A 1QJEA 3Q8CA 2BQPA 1LECA 1YO8A 2VG9A 2VUJA 4IE6A 4K21A 3TBDA 2UYBA 1HRI1 2TEPA 2R0HA 2AEYA 4NRPA 1QGLA 2DV9A 4FFFA 2WO7A 4N53C 3WF4A 3OGSA 4KL1A 5E6HA 3WEZA 2XVLA 2XDVA 2CGOA 1C8M3 3DN7A 4BLIA 3WNNA 2P4EA 4QB2A 4PIZA 3U0ZA 4C0HA 4L8QA 3WINE 4AVCA 4P08A 1A78A 5JXHA 2J22A 2EXKA 4N9IA 2AR6A 4DQAA 1SHWB 3JD72 5E89A 1MEC3 4GWNA 1Y9GA 5K0UA 3ECQA 2XWBB 1CAWA 1MQTB 3LEIA 3O7OA 4MHUA 4NMIA 4W8JA 1RUC1 4OHXA 2VQTA 4E27A 3TEYA 4J1WA 4HANA 5C4WB 2MHFA 1CAUA 1W99A 3UK9A 1LNSA 2G1MA 5FZFA 5FZAA 5FKBA 2OS2A 1RMU2 2V4AA 4CE8A 4YPJA 4AF9A 1BVVA 1VBB2 3GDBA 1AYM1 2WYFA 2LROA 1JU3A 3KM5A 2WZ8A 3FLRA 2JX9A 2XJTA 4NHMA 4DRRA 5KXDA 1DHKB 1X50A 2AREA 5FYVA 4BCUA 2E31A 3LEKA 2CSGA 2H6CA 2DUQA 4I30A 1W8WA 4JGYB 4Q0PA 5FLIA 1UOFA 4QQHA 2Q30A 4F8AA 3O12A 4KBZA 3N7MA 5T5LA 3VD5A 2R1BA 5ABJB 1UY3A 3FFZA 3K2OA 2NP0A 5FZ1A 2GMPA 3AL6A 1SCSA 4PI0A 2CNAA 5ACA2 3CLPA 5FIXA 3E1F1 3JU9A 3THCA 1UZWA 4QPWA 5D1IA 3VBUB 1UXXX 2WBKA 1XYPA 2BNMA 3OGGA 3BPZA 5F7UA 1NKGA 2D3PA 5FLHA 5FMOL 5IWFA 1MS3A 1Q8VA 2IFWA 2P3KA 1QJU1 1TE1B 1OOPB 1EV11 2C0ZA 2VW0A 2XJSA 2JDNA 1MS5A 1LU1A 1R1A1 4CEWB 2YDEA 5FZCA 2RR13 3ZFEA 2PAKA 1XYOA 5A7WB 4AEKA 1LEMA 3WP5A 1CONA 3V0BB 1K42A 3T4HB 1XRUA 2ZGNA 3OUIA 1S4CA 3MV01 3QCWA 4XQDA 1RUNA 2RMU3 3WDYA 1O3RA 3UGHA 1W8FA 1OC1A 2JJ6A 4YWAA 2VCMA 1VBE3 3ZIXA 1U5IA 2VCBA 3DPRC 2ERFA 4R4XA 3J4UH 1S0JA 4FCAA 1NXD1 3KD4A 3ACFA 4LO6B 1MEC2 4EN8B 1ZRCA 4XFIA 5K0UC 1VBD3 3QOPA 3Q8AA 2Y34A 3OGVA 2RM22 2XKPA 3MW2A 1W04A 1S0EA 1OPMA 2VZRA 3VV1A 2CGNA 5A7PA 1X82A 1CWPA 1BCXA 1XJAA 1LEDA 5F8PA 4AGGA 1W8ZA 4MVTA 2ARAA 3UGGA 1DLCA 3IZOA 3T30A 3BGAA 1PZ7A 1NQDA 4IDZA 5FZIA 4JQRA 2AZ5A 4IGQA 5FYYA 1NOVA 3K4ZA 2YMZA 4EWAA 5FQ0A 1STMA 5FWEA 5F6KA 4C90A 4D6QA 1SMVA 4QT6A 2E63A 2HWB2 4N7IA 4LHLA 1B35B 2EICA 2WFF2 3U10A 3D4KA 1UY2A 2BNNA 4A7KA 1POV0 4JKMA 2HYKA 4KH9A 4XEZA 4E4ZA 1CN1A 4FPOB 3ACGA 1YQ8A 1UKRA 2GMMA 2I07B 2QZ2A 3MICA 3NAPB 5M0TA 4XACA 1MS9A 5AVAA 2X8KA 4NHYA 3AYCA 4Y1XA 2VZPA 1AR91 4UW4A 4HXCA 4BQWA 4Q26A 1PZ8A 2D6LX 3ZX7A 5C70A 4EYUA 2WQ8A 1UIKA 1LGBA 1SDWA 4PDWC 4HZFA 3VDDA 1XSRA 4WV8A 4RL7A 2VNOA 3WHUA 2RR12 5F3CA 5FY7A 4META 1CPMA 1S1AA 3I3QA 3ZIWA 5HV4A 1UF2C 5HXVA 1YWKA 1DQ5A 1W8NA 5T55A 5LCWL 1OKQA 3M70A 2VZVA 5TSWA 3TN92 3Q8BA 2V5YA 3NJZA 1NCQC 3NSTA 4A7ZA 3S30A 5FZDA 4MGZE 1VBE2 4XDQA 1Q8SA 3I49A 4A2UA 3ZXKA 5FPAA 5FZHA 4Q0QA 1MZ6A 2RS13 3JUUA 3O14A 3TB0A 4B7KA 1GP5A 4IGOA 4DMIA 3E97A 5K7PA 3I2OA 1ST8A 3ATGA 1VMJA 2YV8A 4CDUB 4DNYA 3QLQA 3LE0A 3PU3A 2R043 5EYYA 2QZ3A 1URXA 4AFBA 2VMIA 3P3PA 1Q5OA 1FMD3 3KV5A 2RS53 3MF6A 3VBFA 2D3SA 3AXDA 4GH4C 1DLLA 3ZSJA 1YLLA 4ATFA 1DGRN 3Q9OA 2WS91 3GJBA 3P6BA 2Y33A 4OQ9A 2WO1A 2VMFA 4XIOA 1QOOA 3WNLA 2JEMA 1JYVA 3RQ0A 3VKMA 1N1VA 1XOYA 1SLTA 2E26A 2WL1A
chains in the Genus database with same CATH topology
1N47A 2OZJA 4QPGC 5BV6A 2ZGOA 4ZU5A 1VB4A 4FPKA 3WCRA 4RFT0 1H2MA 4WVMA 4XF4A 3RDIA 3SLIA 1C8NA 3EBRA 3ASIA 4LT5A 2BWCA 1F2NA 5C33A 3NW4A 5DUVA 1OA4A 1FX5A 3GHMA 4CEYA 5E88A 3ZXJA 3VHRA 3JD71 3ZFGA 2GNDA 2XPJA 1OFSA 2DVAA 5SV5A 1OOPC 4CEWC 1ZZ8A 3FUOA 3WG1A 1ENRA 3OY8B 4GULA 4W6WA 4FP3A 5H9QA 2XJPA 2FZ1A 4FPGA 2B39A 4BOWA 1C28A 4JTNA 2YYOA 1XNCA 4COYA 1N1TA 2F6BA 2ZGKA 2ZMKA 1EAH1 3ES4A 3FX3A 3ZMOA 2B8MA 4Q4Y1 2H6BA 1V9U3 2JG9B 1GR3A 3WDWA 4UW3A 2G9GA 2OW4A 2GSYA 2KXLA 2RS12 2VQ0A 4DXZA 5EYXA 1ZZBA 5JZGA 4LTAA 2TNFA 4YG3A 1C1FA 1U5XA 2D93A 1BQPA 2Y0IA 4RHV3 2HJIA 1RTVA 1ZNPA 4FAHA 4OI1A 4Q4W1 2RS52 1ASJ3 1NA1B 2PHWA 1OHFA 4ASLA 1MS0A 5JAXA 3M4FA 2B9UA 1LOAA 2E51A 4HSJA 2Z79A 3AB0A 3MIFA 1EPZA 3VBHA 2CV6A 4LBQB 1I9RA 1JHNA 1JXNA 4P9WA 1UPIA 4IEOA 2BWAA 2Q0AA 3WP3A 2GN7A 1B35C 4SBVA 1R083 1GKBA 4RS5B 5EXOA 4GWMA 3RRDA 1C8M1 1QQP3 2FQPA 3X29B 3U4XA 5DDJ3 5C9AB 1AZDA 3AFKA 4NR1A 4XJUA 4CEYC 4IV1B 2R1DA 3PJQA 1APNA 4J1XA 4MXVA 1H30A 1H8TB 1LOBA 4AVSA 1BKZA 1PK6A 2XJQA 1W39A 2HEYF 2PQQA 5F5QA 1CIWA 4OI0A 2GC2A 3USUB 4YGEA 1LODA 5KC6A 1BMV1 4MH0E 1ZZ7A 4R9BA 4CDWB 4G9SB 3BODA 1W6MA 5CFDC 4KU7A 3TNPB 2QE3A 1IZ3A 4HK9A 5FMOS 1ZYBA 1RUH2 2RS33 2GNTA 1V9U2 2W39A 3DV8A 4FPEA 1HQLA 2HWD1 2ZAAA 3HWJA 4LUKA 5GLZA 5HBAA 2E6VA 5BNPA 4Z92B 1S0CA 5CAZA 3ZYPA 4CDXB 5DUWA 4QPIC 1ASJ2 4BWOA 4YNIA 3OYWA 2WZPP 3DGTA 5AVPA 4CP0A 4Z8BA 1LRHA 4XTMA 1WLDA 2JECA 3PNAA 1SACA 1K5MA 1OD5A 2WINB 2DVBA 4LO7A 4P9LA 4QGNA 3POYA 2QCSB 1LR5A 1NCRC 2P3JA 4FOWA 2ILMA 2BYVE 3BALA 2ZGRA 2ZGMA 5IK5A 4N43C 3WW1A 5CFCA 4WM7B 2YGMA 2RMU1 2I74A 1QQP2 3VKLA 1H9PA 1RUC3 1VBE1 5EV7A 1Q8PA 2FZ2A 3VBRC 2JG8A 3JQWA 1IGOA 1OQDA 4JGZA 3GZUC 2AYHA 4YG0A 3RS6A 1VBD1 5T3NA 1ND2A 1S55A 2VOVA 4Y22B 4X8PA 2XLAA 4XZPA 5GZCA 5C8WA 1WMEA 4N90A 4JV4A 2A3XA 4YFWA 1AJOA 3ETQA 3CJIB 1OMIA 1LHUA 3UJOA 1I3HA 3AKRA 1YFUA 3AMMA 3TNQA 2H0VA 3KLSA 1U12A 1O4YA 2JG9C 4XQWA 2GNMA 2WSVA 1PM7A 1RVF1 4XMAA 3CJXA 4U2AA 1BJQA 1FXZA 1KJLA 2WT0A 1UD1A 1X7NA 1YI7A 2IXIA 2V09A 4AGVA 3N36A 1GZWB 2GDFA 1OPOA 3EHKA 4IQPA 1CX4A 3B9CA 2YGLA 4AEDB 4YSFA 1HLCA 1HRI2 3BOWA 5F6LB 4RR3C 1Q43A 1WLCA 3O0XA 3GHNA 4PBPA 1AR71 1UIJA 2NM1A 4JDMA 2WNVA 3M8LA 5FLJA 1LHWA 3TOJA 4L97A 4KGGA 3OGJA 5L7OA 1T6GC 2WLPA 4RS5C 3UJQA 3M7AA 3BU7A 4ASMB 4I3GA 4BHPA 3RPQA 2UY9A 5LRRA 3E5XA 1RUC2 4FPJA 3O5SA 3GZAA 1G6NA 3H7YA 1VAKA 4YG6A 4AQTA 4AG4A 3KT7A 2CYFA 1QXJA 2PHLA 3H3ZA 4L92A 4WM8B 1H8TC 1C5HA 4P9IA 4MXWB 1MR5A 4NPRA 2R041 4XFGA 2DWRA 4RGGA 1FMD1 3MF9A 3LCPA 3MIDA 1AF9A 4YGCA 5FOBB 2ENRA 3NWKA 4FAGA 1GNHA 2D97A 2R063 2IXCA 2ZJCA 5FTTC 2RHPA 5IK8A 4M0NA 2PHRA 3VZLA 3HD8B 1Q56A 1ZVFA 1VB2A 4KNCA 4COZA 5KHHA 1HKDA 3N7KA 3HN1A 2R6QA 1W6OA 3OCPA 4H7MA 1DYKA 2XJUA 2W08A 1AR93 5JCTA 3H7JA 3DKWA 4R52A 3ZXGA 5BNNB 4XPVA 4ATEA 2OUHA 4KG8A 5K8SA 2MEV3 1QJU2 2BFUL 2PHDA 3W59A 1EV12 3HIFA 1R1A2 4EWDA 3UKTA 3THPA 4EJRA 2HEVF 1REDA 1XQNA 4LBKA 4YW3A 4HLTA 1YCIA 3SH5A 1NYWA 2P37A 4PLOA 3O0VA 3ZYGA 3RMYA 5KXEA 3AX4A 4M3CA 4XXAA 5L7OC 3TAYA 4KU8A 4DZGA 1XNDA 3ENRA 4IV3A 1RUF3 2XJVA 4H3WA 5AC93 4HT1T 3WY6A 4JC1A 3THTA 3MPBA 4Q4X1 3VBOA 3WOGA 2EA7A 4LE3A 1PO11 3H8UA 4WVZA 4MGKE 2K9ZA 5C8CB 1REEA 3WW3A 1HW5A 4RHV1 1RUG3 3R0RA 2Q8OA 5JSPA 1I5ZA 3QBQA 1WCKA 1CESA 2A3YA 2X29A 4B29A 2ZKLA 2UWCA 3CJIC 1IS4A 1JN2P 3AYDA 1W6NB 3GF6A 4L9BA 2A71A 1OFNA 2R062 5T5PA 2A3WA 4L11A 4CDQC 4BE3A 4XW3A 1KS5A 3RZZA 3VKNA 3H50A 4O9GA 1AX2A 1AYN1 2JE9A 4AVTA 5D8AA 1OQEA 1V6NA 2CL2A 1R081 2XBO3 1AR92 3AP5A 4QGMA 1RUJ1 5T5OA 2LTNA 4G3YC 1O5LA 3APBA 2D44A 5DDJ1 1Q8QA 1QDOA 1ZBA1 2MEV2 4FQ4A 4INDA 4FOYA 3QH6A 4GB33 1LENA 1AXZA 2FBEA 4HN0A 2CWMA 5CNAA 1M4WA 1RUD3 1ZA4A 5JMCA 1Z7S1 5I0RA 3FLPA 3HT1A 3M1HA 3AMQA 4OHVA 1CJPA 3LOBA 1TQ5A 4Q4Y3 4IL7A 4Q0UA 5DUXA 5GZDA 2WWSA 1L3JA 1V70A 3QACA 4P9JA 4AWDA 5CG9A 1A8DA 1HV1A 3AJYA 1UAIA 4FXGB 2DF7A 3AZVA 4LNVA 3N35A 5AC92 1C1LA 3URFA 1S2KA 2RS31 4F3JA 1CAUB 1H0BA 3LOIA 3N7JA 5FFOC 5JOWA 5EFUA 4Z1VA 4AW7A 3HMYA 5GALA 3B7MA 4Q4W3 4WM8C 3WW4A 1DQ0A 4DINB 5KHIA 2VW2A 1DQ4A 4WVWA 3J26N 1OA3A 2DCYA 3AJZA 2XL9A 3MIHA 4AI0A 1W6PA 4LHKA 1KS4A 4EV0A 1ND3C 2WA4A 4OUSA 1A6CA 4LA3A 4QU2A 3HT2A 4JAAA 4A7YA 1PO23 4B8EA 2WNUC 1GNZA 1QNYA 3M3OA 1DU3D 4LULA 3WNXA 4C1WA 5GZFA 4MZUA 1TNRA 5D8AC 3DPRA 4OFGA 4LE4A 5L73A 1LTEA 2XBO2 4H7LA 2YZ4A 1ZBE1 5A32A 2HWC3 3I59A 1M06G 2F4PA 3ZFEB 5LEKA 4CP2A 4BMBA 4GB32 3AMNA 4LBLA 4DY5A 4BIFA 5KHKA 2VY0A 3MLJA 1ONAA 2A6ZA 2D6MA 3N3HA 1PGL1 5T54A 3ZXDA 1TMF3 4DY3A 5JSOA 3OD4A 1W6QA 1EAH2 2GMEA 2ZX3A 3AKTA 1QOTA 4Q4Y2 5J7MA 1COV1 4YVSB 4IEPA 4GMP1 5FO9B 3KQRA 2ZHLA 2R071 1IQAA 1MS8A 2HWD3 2B45X 1XE8A 4GMP0 4H55A 1WW4A 3MEPA 1W0OA 4YGBA 2EXIA 5FREA 2BW8A 4COUA 1NQJA 1RGSA 1PNGA 5K9YA 3FHIB 4Q4W2 4BLJA 2ZS6B 4K9SA 5C8CC 5H9RA 1JUIA 2ET1A 3B94A 3GBGA 3MGUA 2EVXA 1NLRA 3VN4A 4PDWA 5FQ0B 1LOGA 5SV8A 3ZSMA 5CIRA 2GH2A 2GZWA 2OYZA 3FE5A 3MZHA 5I8TA 2NYYA 1IKQA 5DZGA 4YZ3A 5BNOB 4I09A 4Y1YA 4MV2A 1NCQA 4RD7A 1QNWA 5GLTA 1C8M2 1OA2A 4JDOA 4MUVA 1H9WA 4FBFA 4LR4A 5H9SA 4SLIA 1LHVA 1OI6A 2A73B 3B93A 3T2TA 5CA6A 1DG6A 1MQTA 3VDDB 4D7SA 1GFF2 3WV6A 2DVDA 4RA0A 1BBT1 4XFAA 1BMV2 2HKXA 1PMIA 3EXUA 4IEVA 1V6IA 5EWSA 4PIXA 3FMGA 4GH4A 4TZDA 4DRVA 4YGDA 2IXHA 1CR7A 5J37A 3M3IA 1ZX5A 2BFUS 4YLZA 1MZEA 3KCXA 4QPGA 1RVF3 5BNQA 5BUVA 1KQRA 3B3QE 3MIEA 1ULEA 4RQPB 4Q4V1 4XHBA 4HN1A 2HWD2 1AR63 2PLV1 3V0AB 2R061 4OZXA 1VRH3 4K6BA 5E1RA 3LWCA 3WT3A 3NL1A 2VGDA 2PHTA 4W6YA 1Q8OA 3VBFB 3GZTB 2JDZA 2WJSA 3PJYA 5KXCA 3E5QA 1LESA 1AHSA 1NE4A 3ACLA 3DL3A 4QXKA 1DZRA 5DXDA 2CAVA 5FOJB 5GLWA 4E2QA 4F83A 3E5UA 1AR73 1OOPA 2MEV1 2JD4A 4CEWA 2Z5WA 4K1YA 3S6PA 4WVMB 2ZGSA 2D6OX 3V0BA 1DGWA 3B01A 4JRAA 3NV3A 2DCJA 3ZPYA 2I45A 4Z82A 1E57A 2RMU2 1DQ6A 1Z78A 1RHI3 2ZKNA 3FC0A 3NV1A 4XF0A 5FPZA 2XB6C 2R16A 1WW7A 3IWZA 2QKDA 4AE2A 2C1FA 2DUOA 1RUF1 1MQTC 5AC91 1VBD2 4FP2A 5HCFA 3PHMA 4XHXA 4COVA 5C4WC 2ZA9A 3A0NA 3H1WA 3IMNA 4OHWA 3RJRA 3WX5A 1AUYA 4EROA 5GZGA 1FYUA 5LRSA 2FHRA 4LLOA 2ZX2A 2TBVA 3H3UA 1GLHA 1RUG1 3KCYA 1QU0A 1N3PA 4URTA 4YVSC 1RVF2 4JGYC 3GYDA 4AHXA 3A4UA 3AZZA 3ES1A 1B35A 2WA3A 4ITCA 3GALA 3WG3A 1VAMA 5ABJC 4FT8A 4AVAA 2ZABA 2IXJA 4B7EA 1CD3G 1SLCA 2D98A 2PELA 4LBMA 1O3SA 2Y0OA 3VBUC 4XIKA 2XBO1 5A3LA 3KGZA 4DFSA 3VBHB 4LEJA 2UY8A 4YM0A 5DUUA 1AR72 1XU2A 4ORFA 4GB31 2ZACA 3UKNA 1HRV3 2HEWF 4BPZA 1RUD1 1XU1A 5CFDA 1S0GA 1SFYA 3MFAA 4AGRA 4YARA 1QY4A 5JPNB 1RHI2 4MSVA 4Q4X3 3KS7A 4AEJA 3ZSLA 4TWTA 3NV2A 3CF6E 1PO13 4LBJA 4AFCA 1PNFA 5DZFA 4D3WA 2DU1A 3MPPG 4X6RB 4B4QA 4CDUA 5F1RA 1NXMA 3W9AA 1IS5A 2R042 2WQ4A 4XMIA 1FMD2 4QPIA 1UCXA 1VAVA 1UZYA 2UYAA 4I0AA 2RJLA 3V65A 1RIRA 3ZYRA 3AMPA 4NN0A 1AYN3 4RQPC 1DYPA 1NCRA 2VMHA 4N43A 1PO21 3KZ4C 5BNPB 5JIAA 1RUJ3 1KXGA 2N7GA 3IKWA 4OULA 3VBSB 1ENQA 1GZCA 3NAPC 3VHNA 1ZBA3 2GC3A 1N1SA 4U36A 3VBRA 3OYWB 3AZXA 1BEV3 2QJVA 3VZKA 4I3PA 1WGPA 4Y1ZA 1HXS3 1Z7S3 2ZOEB 1QOSA 1K5MB 2W0XA 2DU0A 1ENSA 2HWC1 5KXBA 1WBLA 2DUPA 4PCRA 4S2GA 2DVFA 4OI4A 2JKBA 1RITA 3OY8A 1HRV2 2YUEA 3AP4A 2XKOA 2G4IA 2X5IB 5JI7A 1AX0A 2EXJA 5CFCB 3RYPA 1AR81 3KGLA 3VZOA 2BBVA 1TMF1 4GQ7A 1ZZCA 4TLFA 3OTFA 3VZNA 2IZWA 1KD7A 2WZR1 4OUMA 2JG8B 4YRDA 2JG9A 1CVNA 4UBGA 3ZN6B 3WHTA 4Q4X2 2Z42A 3SCGA 5KHGA 4QMAA 3VKFC 1ND2B 2QDRA 4HPKA 4FSJA 3ZSKA 1PO12 3RI8A 1O3TA 4CDUC 4RHV2 4AQ6A 3ZFFB 1GQHA 3LA2A 3ZN4A 1BZWA 1YIFA 4AFDA 5JR7B 3SXWA 3ROUA 1NA1A 2A6YA 1ULCA 4PQ9A 4KQ7A 3I7DA 2QDNA 2A6WA 3SCHA 3SHRA 5I0UA 2MPFA 4RR3A 4OI2A 1Y3TA 5KHJA 3MLLA 4NWVA 2WQZC 2VUAA 4LBQA 2KM2A 4LO5B 1VJ2A 2ZBJA 3M3CA 2NN8A 2X53S 1AYN2 1LOEA 4QD2A 1AL21 1J58A 4ES8A 5LEJA 2BUKA 1N3QA 1R082 4HKOA 4RS5A 1RUJ2 1ZBE3 4R4ZA 1MVEA 1WD3A 5DDJ2 1ZBA2 2WIIB 4EN7B 4YFZA 4E2GA 2DCKA 3JBG3 1HXS2 1H8TA 1Z7S2 1C4RA 1YI9A 2NMNA 2WNVB 4HSLA 1PVXA 3USUA 3VZMA 1RJ7A 1SFNA 4AFAA 3PTYA 2YXSA 4S2HA 4FTBA 1COV3 1J3RA 4CP1A 3H1YA 1AJKA 4XFBA 1TEIA 4GMP3 2B7YA 2R073 3WUDA 3UKVA 4GXLA 2A75A 4CRQA 4XTPA 4D69A 1RC6A 3JB4C 4K8FA 1ZM1A 2RS32 5T52A 2ZAHA 4Y1UA 3I4IA 1VLNA 2CY6A 1KFUL 1WW6A 1AR61 2ZMLA 4LBOA 1VRH1 4I02A 3WR0A 1ZRFA 4Q1RA 1QJZA 2Q1ZB 1H1AA 2DURA 4W6XA 4YW5A 2EAKA 2PAMA 1RINA 5FDBA 1KFXL 1DF0A 4IEWA 1NA1C 2GALA 2IWGB 3PVNA 3WCSA 1FATA 3AZWA 2BEOA 4A3XA 3LAGA 1R093 1KITA 3J8F1 1C57A 1KRIA 3RYRA 3PLQA 1CAVA 1CGPA 1FOD3 1W6OB 2WNEA 2IC1A 3B69A 4XBQA 2ZZJA 3CNAA 2EXHA 2GH8A 1RUE1 1G9FA 1RHI1 1ZBE2 3VBSC 1ZRRA 1CJDA 4P14A 5C9AC 3LKJA 3BOPA 4MLOA 1I6XA 5H9PA 4N9HA 4E4DX 3KSCA 4PBOA 1BBT3 4IV1C 3AXEA 3JBG2 2VNGA 2DCTA 1PGL2 4ISQA 2KA3A 1O7FA 1LJ7A 1D4M1 1WCSA 4CDWC 4XETA 2VXRA 1JW6A 4M3CB 4S2FA 5JOZA 1COV2 4DS0A 3VHOA 4IV3B 2RJKA 2AUYA 3CJIA 4FPCA 4QPYA 2XHKA 3WP4A 5KBFA 4Q4V3 2R072 1SQ4A 2PLV3 4P9GA 5A33A 2VU9A 3VBOB 4CDQA 1C5IA 2AGSA 2NLRA 3VL9A 1BK1A 1TME3 4BZ4A 4Q0SA 2VVEA 1OLQA 3ZFFC 1GZWA 1UKGA 2D7FA 3RG0A 1AX1A 1QJY3 4BMEA 4CDXC 1YRZA 3IDEA 1ZRDA 4FVVA 3S7EA 3FBMA 4N53B 3FJSA 1QMJA 2YY1A 1H2LA 3ZXAC 1G9DA 4Y5Z0 1BVP1 2DTWA 1VP6A 1V6LA 1SEFA 1HRV1 2CTVA 4LUMA 5FBZA 1D0GA 4NWWA 3SNMA 3PVEA 3KCCA 4XJ8A 4ZU7A 4AQSA 5T50A 3OBTA 2K0GA 4WM7C 2ZX1A 3LA3A 3P3NA 3H0OA 2E7TA 3MFCA 4K40A 4AI3A 3VKOA 1KJRA 3NV4A 5JIUA 3POWA 4IEYA 1BBT2 5GZEA 4Q27A 1LCLA 5I0TA 4LLFA 4GA9A 4DOUA 4WM8A 1ULGA 5BYNA 1QDCA 5J98B 1AVBA 3WDXA 3O0WA 4C91A 4FTEA 3INAA 1PGSA 1N1YA 5E16A 1ND3A 1DFQA 2HWF3 3HBZA 4KGQA 4Q4V2 2OVUA 5FRAA 2PLV2 1VBA3 2BVVA 1A3KA 2WNUA 4HVOA 4AQ2A 5IK4A 2GAUA 1ULDA 1VIWB 1FV2A 3IPVA 3OJBA 1PZ9A 4Q29A 4YVWB 2OA2A 3PVOA 3NO8A 1X36A 1ZZ9A 4IEUA 3A0KA 2PHFA 4KG0A 4OLLA 4Y20B 1RJ8A 4YM3A 1LHNA 3HR9A 3WG4A 1W6PB 2A7AA 2TUNA 1FPN1 3L9JT 4BA6A 1BEV1 2P3IA 4AEDC 1WUVA 1PGW1 3LSDA 1HXS1 3V64A 4AHZA 2CGPA 2QNKA 2VQAA 1D4VB 4Y26A 3IDCB 1V6KA 2ETEA 4HMZA 3VUOA 2VNRA 4L2NA 2BTVC 1XNKA 2NPIA 2HWE1 2Y26A 4I0BA 4R9CA 3WQ7A 2OZ6A 4O9EA 2PFWA 5K0UB 5A32B 1CAWB 4AFMA 4XJAA 3RWNA 1SLIA 4C1XA 1RUF2 2XVGA 4UXAA 3LA7A 4I01A 3E6DA 2A6XA 5EZWA 1NZCA 3WZ1A 5B2GB 3SITA 3ZVXA 4YZ5A 4LO4B 1RMU3 1MACA 2UWBA 2VECA 4XBNA 5I8YA 1VBB3 3MDPA 4XF3A 1REFA 5KC5A 1W6QB 5C8CA 4PF5A 3FFQA 4JTOA 3AM2A 4M3CE 4PLMA 2DFCA 2WC2A 1HDKA 1RUG2 2CAUA 2HWF2 2GC0A 3T1LA 5GLVA 1VBA2 1CPNA 1WCDJ 4CTEA 1BXHA 4ISRA 4PLNA 5JVVA 1LU2A 1YIPA 4KWJA 1MZFA 4PDWB 2ARXA 4BQ1A 5BNNC 1SLBA 1PVC1 3GBWA 3I54A 3IM0A 1CQ9A