1LKNA

Solution nmr structure of protein tm_1112 from thermotoga maritima. ontario centre for structural proteomics target tm1112_1_89; northeast structural genomics consortium target vt74.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein tm1112
publication title Solution Structure of Hypothetical Protein tm1112
rcsb
source organism Thermotoga maritima
total genus 8
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2002-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lknA00
3RNSA 5JSRA 4HVRA 3H3ZA 4PIYA 2XGXA 1Y9QA 2GU9A 4JVAA 4OLLA 2CGPA 1YLLA 2GC0A 3QACA 2QDRA 4DINB 1QY4A 4AXOA 3B02A 4Q29A 3ST7A 4XF3A 5KBFA 2CV6A 3LAGA 2IXJA 3IDBB 1PM7A 3GBFA 1Q43A 5I0RA 5C6CA 3H7YA 3KGLA 1L3JA 1O5LA 1XE7A 3H3UA 3MYXA 3D82A 4XF4A 5FLIA 2K0GA 4LEJA 4IEUA 1X8EA 1SQ4A 3WW4A 2HJIA 4MZUA 4UBGA 1ZVFA 2MPFA 3H1YA 5I8TA 4QM9A 4A2UA 2PFWA 5LRRA 4Q0VA 4X6RB 1O3QA 1YWKA 2BEOA 3H7JA 3U0ZA 4YYOA 1RGSA 3NJZA 3BALA 5KHJA 3OTFA 3SCGA 4WZCA 5I0TA 1J3PA 1NYWA 2DCTA 1UIKA 2KXLA 2XHKA 3MDPA 2GC3A 4UXAA 5LRSA 2XLGA 3CF6E 4J1XA 4P9GA 1ZZCA 1JUHA 5JR7B 1CAUA 2MNGA 4HSJA 1YFWA 1DZTA 5J48A 3GYDA 1IPKA 3OCPA 4IEWA 3ELNA 4OFGA 2GZWA 3PLQA 4I0BA 1CAVB 3CLPA 4Q0PA 5BY5A 4LULA 1ZREA 2IXKA 2N7GA 3E5QA 4XFBA 3IBMA 3IIAA 1I6XA 3NVCA 5I91A 2H6CA 5I8SA 3RYRA 1DGRA 4F8AA 1H1MA 4KWJA 4BH9A 4ONUA 3OGJA 1YFYA 5AVPA 2QCSB 5KHKA 4MGZE 4YNIA 5FQ0B 3KCCA 2UY8A 3FZ3A 4XFIA 3HT2A 2Q4SA 2GAUA 2QNKA 3JZVA 4LTAA 1CX4A 3EBRA 4HN1A 4X6QB 2B8MA 5FPZA 3LWCA 5BXXA 3RZZA 2UYBA 2VQAA 2F4PA 4I02A 4QGLA 1NE4A 1EY2A 3SCHA 1ZZBA 5C8WA 1VR3A 1Y3TA 1U12A 2CAUA 2OYZA 2PTMA 5F1RA 2P17A 3ES1A 4EWDA 4IEZA 5LEJA 3EJKA 4FBFA 1QXJA 3ACLA 1NXMA 1CAXA 3RYKA 2GC2A 2IXIA 2D40A 4Q0QA 2BNOA 3C3VA 3BCWA 1HW5A 4AVCA 4BIFA 3FE5A 3QOPA 4E2SA 3I54A 1ZRRA 1YFXA 4D7SA 4F7ZA 1EYBA 1UCXA 4Q0SA 3SHRA 2GH2A 4MUVA 3KGZA 4QX5A 2EA7A 5K8SA 2FQPA 4L11A 3SCFA 4AQ6A 4B29A 3LA7A 3M3IA 2OZJA 4WBBA 4IEPA 4IEVA 4R8HA 1WLTA 1RC6A 2BGCA 4E2QA 4PIXA 2OPKA 5FPXA 1EPZA 4JTNA 4O9GA 1ZZ8A 3ES4A 4LA2A 1RTVA 3UKNA 4ORFA 1H1IA 2PAMA 2XLAA 3DL3A 1X8MA 4MV2A 4YRDA 4QMAA 1CAWB 1J1LA 2PA7A 3S7IA 3MPBA 1YUDA 1OD5A 3BU7A 1SFNA 2MHFA 3PNAA 2Z2SB 4J1WA 1IPJA 1LKNA 3FHIB 2VECA 3USSA 2D5HA 2XL9A 1UW8A 4XEZA 1J3RA 3D0JA 1CAVA 3U11A 3DN7A 5I93A 5JAXA 3KMHA 3E6BA 1X7NA 4XF1A 2BNNA 3H8UA 5J3UA 3RDIA 5LEKA 5D1IA 4L2NA 3CJXA 4Z82A 4I3PA 2ATFA 3DV8A 1O3TA 1Q3EA 4PJYA 3E97A 3S0MA 4Q0UA 1UIJA 3CO2A 2UYAA 3E6DA 1XRUA 3TNPB 4MGYE 3UKVA 4QM8A 4XFFA 5T3NA 3BB6A 3WW1A 3E5UA 4HMZA 3I7DA 5EFUA 1FT9A 4FAHA 3IDCB 4IEXA 3KSCA 4IERA 4O9EA 3I59B 2E9QA 3OF1A 4MX3A 2I45A 2V09A 2HKXA 4KWKA 4LA3A 2BYVE 2IXLA 3WW2A 3RPQA 4AQ2A 5KHGA 3CEWA 1ZZ6A 4QGMA 1RUOA 1O3SA 1UPIA 3M70A 1J3QA 5HI0A 2Q1ZB 4META 5EZWA 4I01A 4I0AA 2BNMA 1V70A 4KWLA 3LZZA 1OFNA 4TLFA 3ZDSA 3LA3A 1QXRA 1TQ5A 3HQXA 1RUNA 4HBNA 3E6CC 5CU1A 2PAEA 1ZRDA 3DKWA 4IESA 1NZCA 4HVQA 1SEFA 3D0SA 2OA2A 1QWRA 3MZHA 2XKOA 5FDBA 2IC1A 1WA4A 2WFPA 2PHLA 1X82A 2QVSB 5I0UA 5FLJA 4D7TA 5CADA 4EV0A 2ZCWA 4EWEA 1OI6A 1UD1A 1VJ2A 1LB2A 3UKTA 2XLFA 4MGIE 2FMYA 4AVBA 3H1WA 3NSTA 4PIZA 2PAKA 1LRHA 3IWZA 4UBHA 4AVAA 5JCTA 4FAGA 2Z69A 3E5XA 4IETA 1O3RA 2D93A 4QGNA 1VP6A 5CVRA 4Z07A 4BHPA 2CAVA 1YHFA 3NL1A 3RYPA 1ZNPA 1LR5A 2O1QA 5I8YA 4N9HA 4KL1A 4XFGA 1O4TA 1CAXB 3FWEA 4JV4A 4LUKA 2D5FA 3CL1A 3N4MA 5JSOA 4WVZA 4ZU7A 4HN0A 1G6NA 1ZX5A 3OD0A 4I2OA 3G7DA 1OMIA 3LOIA 2B5HA 2OZ6A 2PQQA 2PYTA 4IEOA 2ETEA 1FXZA 3VHRA 3BPZA 5BV6A 2K9ZA 3U10A 4XF0A 5E1RA 1CAWA 3WW3A 3FX3A 4JTOA 3ROUA 4MGKE 4FT8A 4GULA 3EO6A 1I5ZA 2H6BA 2Q0AA 2ZKLA 3HT1A 4QXKA 2PHDA 3FJSA 3SMHA 4EWAA 2Q30A 4RD7A 4XF9A 5BUVA 4ZU5A 1ZZ7A 3O14A 3H1MA 1RL3A 4XFCA 1DGWA 2QJVA 2XKPA 1CAUB 1ZRFA 4HLTA 1FI2A 4R52A 1PMIA 2WC2A 5BPXA 4ZU4A 4E2GA 4YSFA 1WGPA 2O8QA 3HIFA 3H50A 5FLHA 4XETA 3LA2A 4LLOA 3I59A 2EVXA 2VPVA 3EQEA 3FFQA 4IEYA 4IEQA 5FQ0A 1CGPA 2B9UA 2ET7A 3S7EA 3PVBB 4YARA 5I0SA 4KU8A 5KHIA 1DZRA 1J58A 1O7FA 5KHHA 4HSLA 4CYDA 1GQHA 1ZRCA 2ET1A 2UY9A 3L2HA 4HVOA 4K8FA 4MH0E 2Y0OA 2C0ZA 1O5UA 5E16A 2IXHA 4H7LA 4XFHA 3ETQA 4N9IA 2XL7A 1NE6A 1YFUA 1ZZ9A 4EROA 4BYYA 3H9AA 3SXWA 3NKTA 4XFAA 5JSPA 3EHKA 4NVPA 1J59A 2GC1A 5FCCA 4LUMA 1GQGA 5J7MA 4I09A 3NW4A 3TNQA 2H0VA 2IXCA 4HZFA 4KU7A 2EAAA 1XE8A 1Q5OA 3R6SA 1EP0A
chains in the Genus database with same CATH superfamily
1NQDA 3WINE 5JSRA 1RUI3 2HWD2 4NMIA 3IMMA 3ECQA 4K1ZA 5GZFA 3ATGA 1AR81 2GC0A 2PMWB 3QACA 5FWEA 2EAKA 2IWGB 4DINB 4P9JA 3CKHA 3ZIWA 3VDAA 4YZ1A 4NHLA 4Q29A 1RUI1 5FZCA 3ZYJB 1T6BX 4E8DA 4XOGA 5DAQA 5KBFA 1SLTA 3ZYFA 1B09A 1RUF3 2IXJA 4S2DA 1TNFA 5K4LA 3WQ1A 1UU5A 4WVMB 5FZ4A 2DVFA 3SH4A 3SNMA 5C4WC 5CG9A 5C6CA 2NP0A 4XE9A 1QIQA 1QOSA 1W9TA 1OUSA 2DWRA 1RUF1 3JD72 4AQSA 4BQ3A 1L3JA 2HWB3 1XE7A 2JG8A 5A6YA 5I0RA 3WQBA 1H4GA 5FMBA 4Y1XA 4J25A 1XYNA 2RS33 1B35B 2ZBJA 5FY8A 3O1OA 4DXRA 2WIIB 2HWB1 1J83A 5FJKA 2RS31 4M01A 1IPSA 5JOXA 1FX5A 1W9YA 4XAEA 4UBGA 3WCRA 5I8TA 2A6YA 3DYMA 3ZPYA 4X6RB 3C7HA 1YWKA 1W2UA 1YXWA 2NPIA 4N8MA 2EIBA 2FDJA 4YYOA 3RFRA 3UGHA 1I3HA 1RGSA 3NJZA 4MADA 1ULFA 4GJYA 3ZYIB 4XMIA 4GMP3 1MQTA 2Z5WA 1W6MA 2BV4A 1TVGA 3WG4A 4RL7A 1SBEA 2JDYA 4GH4B 5C9AC 4Q27A 2B39A 2KXLA 1PX3A 2WQ8A 2EIEA 2XHKA 3RZKA 3MDPA 1ND3B 4GMP1 4M3CB 5LRSA 3I3EA 2OQ6A 3APBA 3WDTA 1K45A 5IVFA 2EF6A 5CA6A 1W6QA 2I2SA 1MZFA 2Y8KA 2VBDA 4LOSA 4J1XA 1MS4A 2Z42A 1RUG2 1RVF3 4B1LA 3MIGA 3IAQA 2B45X 2OPWA 4ATFA 4ISRA 4XXAA 1DZTA 4LNVA 1WZXA 1RVF1 4DNYA 2LTNA 4OFGA 2XDVA 5GJ6A 1CAVB 2FBEA 3JB4C 4Y1YA 2AGSA 2BVBA 5C3PA 1NLRA 2CNAA 2X05A 3WF2A 3KWVA 5F3IA 5BY5A 2IXKA 2D6MA 1GOGA 2VG9A 4XFBA 4LQRA 3IIAA 4XJ9A 4YW2A 5KXEA 3GXUA 4GB32 4CXWA 1PHMA 3V65A 4OHYA 3NVCA 1SBFA 4KI5M 2XJVA 4C0BA 2D7FA 2QTWB 5T5JA 1LEMA 1H1MA 2CTVA 5APAA 5GZCA 3BTYA 4HKLA 4H55A 5FY5A 1OT5A 1HQWA 4D6QA 1X50A 4PI0A 5AVPA 5FY0A 2ADEA 1YQ2A 1VLNA 4CDUB 3IDAA 1WMFA 4QPIB 3TBDA 4XFIA 1CPMA 3FZ3A 1VIWB 2Q4SA 1ONAA 4N43B 4E9KA 4Y1VA 3VDCA 2QNKA 3NO8A 3RWKX 4LORA 4UF0A 3EBRA 1AX2A 1W6PA 3OEAA 4HN1A 2A70A 3JCIA 4LBMA 3SC7X 2B8MA 2BPA2 2W68A 3LWCA 4LBNA 2WS92 3M8LA 3AZXA 4MO3M 2E32A 2UYBA 1MS8A 3VD4A 3JB8A 1YYNA 2ZACA 5F3GA 4NRMA 2A6XA 2RJLA 5EIYB 1KDKA 3PVEA 3RMXA 2NMOA 2A6VA 2ZAAA 1WUVA 5C8WA 5LZ6A 4HKWA 5JMCA 3KF5A 1VR3A 4NAOA 1UNBA 1AR92 2FCUA 1U12A 1CJPA 3AC0A 1COV1 5D8AB 2V73A 4CZSA 5JIAA 1HV0A 2DBIA 5ERLA 5KXDA 4HK9A 3NAPB 3TEXA 2VXJA 3RWNA 2HYXA 2HYKA 1F5JA 2Y60A 5JPNB 2RDQA 3EJKA 3ZN4A 3NKGA 5M0TA 5FYYA 3GZTB 4WM8B 4FQZA 5F3EA 3NV3A 1NXMA 4CDQB 4BQ4A 1W8OA 1YI9A 1TZOA 2GC2A 4HETA 3VN4A 2YBPA 4DUXA 3DF0A 3DPRC 1BVP1 3WG1A 5IVYA 2W92A 3A7QA 2BNOA 4Q0QA 4D3WA 3RZLA 4GJZA 3O12A 2QQIA 3WXPA 1NA1B 5LA0A 2JE8A 1S0IA 1TE1B 4AVCA 3FE5A 4EZ4A 2VZTA 5LA9A 4ET7A 3I2JA 1QHDA 2QQVA 4LK6A 2G1MA 4PCRA 1UCXA 2AC1A 1S0DA 4LXLA 4Q0SA 1HB3A 1TMF3 2W2IA 3LDKA 4KBZA 1WW6A 4R9BA 4AL9A 4FPFA 5CZKA 4XJWA 2FQPA 1OF4A 5A3OA 3AZVA 3M3IA 4NIIA 4YGCA 1TMF1 4WBBA 3VLBB 2ARXA 2W5FA 3GCWA 3IM0A 5FIXA 1SHWB 4BCUA 4D8MA 4IEVA 1WLTA 1UY4A 2W0XA 4E2QA 2O8OA 2OPKA 5FPXA 3DYOA 4JTNA 5DAPA 2ZXQA 4A7KA 4O9GA 1UY1A 4LA2A 2LALA 1PO12 1CZSA 1LEDA 3I3MA 2E31A 5FMOL 1XNTA 3ZN5A 1Y43B 3CBNA 4Q4Y3 1X8MA 2W95A 5FO9B 3VGIA 3KLSA 4MXWB 4QMAA 4DY5A 1GP4A 1UWWA 4MHUA 1UY0A 3NJXA 4HK8A 2ERFA 3CJIB 3MPBA 5FZIA 1YUDA 5GLUA 2RMU3 3PNAA 1RMU3 2JD4A 5F39A 4KGGA 1X36A 4FP2A 3FHIB 4XUOA 4AAPA 4GWIA 3LDBA 3USSA 2JEMA 4N53C 1YIPA 5A7WB 2RMU1 4WV8A 2D5HA 1JZ3A 3M7AA 1RMU1 1RHI3 3MFAA 1F5FA 2PHXA 2XL9A 3P3PA 1E5SA 5I93A 3DN7A 5JAXA 2GMPA 3HBZA 1RHI1 4XDOA 3I2OA 5DABA 3ZFEC 1G9FA 4OMCA 2GP3A 3JQXA 4AVVA 3U14A 1WLCA 2BW8A 3OSDA 4I3PA 2WNVB 4N90A 5FZOA 3PIJA 3MLLA 1P8JA 5FZ7A 4PJYA 3ZXGA 4N7IA 2VULA 4FPEA 3E97A 5LATA 3SKVA 5BNNC 2VW0A 1XNCA 5FZFA 1XRUA 3EXUA 4IE6A 4YM2A 3H42B 2AENA 2ZGPA 5HXVA 3TNPB 3VBRA 1GYKA 1MEC2 1MPXA 1HRI2 1RUH2 4XFFA 5A80A 1UN1A 2VY0A 2WNUC 3WW1A 4AW7A 2R063 1GOFA 4NJ4A 5FP7A 5H9RA 5IVCA 4AEDC 1O4YA 2VZVA 1TG7A 1FMD3 4L0PA 4OHVA 5BNPB 2E9QA 5A7PA 1OF3A 2LUWA 2EXKA 4MX3A 4Y4RA 4KWKA 2R061 4CDXB 2AEZA 4LA3A 3BOPA 1S0BA 2ARAA 2BYVE 3AP4A 5C3RA 4TWTA 4IGOA 1RUOA 1O3SA 2LW8A 3WF4A 4OQ8A 5H9PA 2R042 2BFUL 1J3QA 2HWD1 1SCRA 2YZ4A 4JRAA 1PMHX 3VZLA 3OGRA 2BNMA 5I0DA 1PZ7A 1POQA 1PVC2 1GNHA 3TRSB 3PTRB 3O1MA 1QXRA 1TQ5A 3WDUA 4PLMA 1RUNA 2GH8A 2WWUA 3E6CC 3N7MA 3TEZA 4BLIA 1HX6A 1OOPA 3ZXAC 1E5IA 4NRPA 3VBSB 4LKEA 2LROA 4FTSA 3MW4A 4CPBA 4P08A 5FYIA 5DG1A 3ZFEA 3JD71 1ST8A 4YVWC 4KGQA 3MZHA 2QQNA 4FFGA 2IC1A 4XJUA 5GZDA 1DYKA 1CR7A 2WFPA 3T0DA 4AI0A 1WW5A 1VBC3 1UU4A 5CADA 3BOWA 5BNNA 3J9SA 2PLV3 2D98A 2YPJA 4EWEA 1VJ2A 1TME3 2WO2A 3I8TA 1LU2A 4GMP0 5FO8B 1VBC1 3H1WA 3HQUA 4WVMA 4XJ8A 1QF3A 2XHNA 4AK3A 2PLV1 4NN0A 4PIZA 2VQUA 2PAKA 4K6BA 3IWZA 3QLQA 2A6ZA 1TME1 4K8RB 4UBHA 1V6OA 4AVAA 4B4QA 1PNFA 2A3XA 4RS5C 4OCTA 3ZFGC 1XXNA 1WBFA 2X53S 2Z69A 4V2VA 3E5XA 1M06G 1SLIA 1CESA 2D93A 5CVRA 4Z07A 4BHPA 1ZBE3 1HN0A 2YG0A 3NL1A 4ITCA 3RYPA 2W1UA 3ZMOA 4KG8A 4YZ4A 1MACA 1H2KA 4UFIA 2AYHA 5I8YA 2D97A 4W6WA 4XFGA 4CDWB 2QQKA 1RUG3 1W2AX 2FZ1A 1ZBE1 2ZHKA 4P9LA 2JDNA 2WZPP 5A3LA 5HV0A 3VD7A 1GFF2 1Y9MA 2X5IB 4ASMB 3P6BA 3VDBA 3VHOA 1AL22 3A0KA 2DU1A 4URAA 1OLQA 1RUG1 1AVBA 1EPWA 1S0EA 2Y38A 3RI8A 1RINA 3C8XA 4RQPC 3OOXA 2WSVA 4FPLA 1RUE3 5L19A 2RS12 3D8CA 1S1AA 2C1FA 4GH4A 4Y1UA 2UU8A 4DEQA 3ZSKA 4YVWA 5T5OA 2RR12 3BPZA 4ZZ5A 2WT2A 5K0UC 2PELA 5AC93 5EJ3A 1H2LA 4XF0A 3EB7A 1SFYA 2HBUA 1RUE1 2WO7A 4YGEA 3VBFC 4YFWA 4DS0A 1CIWA 3K4AA 4JTOA 1JYXA 1BMV2 4COVA 3VZJA 3RJRA 3AP9A 2BGOA 4FT8A 2RJKA 3EO6A 1W8NA 4LHSA 3TYJA 2Q0AA 2ZKLA 5CYYA 1SLAA 2ZX3A 1MQTB 1W6MB 1W9FA 2VOXA 5F5CA 2AR6A 3QH6A 2QQPA 2Y64A 2SBAA 1ZBA2 4GWJA 2ZGUA 5F37A 1UMHA 4RS5A 5BUVA 1FPN2 2XOMA 3I2DA 4FOWA 4Q4X3 4JDOA 1W6QB 1UPSA 1AZDA 2G9FA 3H1MA 4ASKA 5A3NA 4XFCA 2QJVA 2CHHA 3ZMNA 4BA6A 5C8CC 4EN6B 5FZBA 4Q4X1 5L9BA 1REDA 5L9RA 5JI7A 1NCQC 1FI2A 5C4WB 3DXTA 1ENQA 1SFPA 5HBAA 3POIA 3RRDA 3ZYRA 2X8KA 2VMFA 1STMA 1AR72 4CUBA 1H6XA 2TUNA 3W20A 1S55A 3SEPA 1EV13 3HIFA 1LOEA 2B46X 4IGQA 2QQUA 1WCDJ 2J1RA 2WT1A 2ZA9A 2ZX1A 3CU7A 3IMNA 4XETA 2VUAA 4LOTA 3I59A 5K0UA 1URXA 4IEYA 3J7NA 4IEQA 1EV11 4N43A 1H9WA 3B94A 2GP5A 3PIGA 3T0AA 3AP5A 4YARA 2W3JA 3VBFA 4QD2A 4TN7A 1NXD1 1DZRA 3RGBA 3OPZA 2AZ5A 1OLRA 5T5PA 4B1MA 4CYDA 1GQHA 2DTWA 4PDWC 1C8M2 2R073 2V5YA 4O61A 4A45A 4BK4A 4ZZ8A 3H3LA 4AFDA 3AFGA 4YW5A 1PX4A 1O5UA 4AYUA 5GLTA 1H8VA 2AACA 4XFHA 1W28A 2W9XA 1VRH3 4JQRA 1DZQA 4XJZA 1OLME 5FZGA 5A33A 5C9AB 1ULDA 3AXEA 1U5ZA 2DVGA 3TAYA 1YFUA 2FDKA 1JYNA 5LY2A 1VRH1 1W6PB 3SXWA 3NKTA 3N7LA 4XFAA 5D8AA 5L36A 2A3WA 2R32A 4JDNA 5DZEA 3EHKA 4NVPA 1X9PA 3ZN6A 1QJY2 5C8CA 5E8AA 2GC1A 4FO9A 1AR62 3MIHA 3O1VA 1D4M3 1Z7S3 1N1SA 1W8ZA 1QNWA 4UOJA 1VMHA 3GBWA 2WDBA 2JE7A 1D4M1 1D4VB 2QKDA 3GCXA 4N7UA 1Z7S1 1W8FA 3FHQA 4XURA 2ORXA 3HAGA 2WT0A 3RNSA 4L99A 2XJSA 4HVRA 5DXDA 1NA1A 3JU9A 2XGXA 2J42A 4JVAA 4OLLA 2PHWA 1RUC2 4Q8LA 2QDRA 3POFA 1QY4A 2RS52 4P9IA 2Q8CA 1Q8OA 3FLRA 4AXOA 4EN0A 5IK7A 4PF5A 4Y5TA 5ACA2 3T1LA 4XF3A 3U1XA 1C3HA 1PIV3 2XJQA 2CV6A 1VBE3 3LAGA 4PDWA 3U75A 1ND2C 3HVDA 2UURA 4QDSA 1S0GA 3WQ7A 3O0WA 2VVFA 5KXBA 2E26A 1PIV1 3KGLA 5KXCA 1VBE1 4U2AA 2Q8DA 1A6CA 2D6NA 1V9U2 5FUIA 3VL8A 3L2YA 3WHUA 3H3UA 1E5HA 5FLIA 2WABA 3VZOA 1KEXA 1Y4WA 2R16A 1CD3G 3DXUA 1A8MA 2J22A 1C8NA 5G05L 5LA1A 4YFZA 2YBKA 4PQ9A 2FZ2A 3AB0A 4H3WA 3C7GA 1VPHA 2HJIA 2XUEA 1LOFC 1IS3A 1XU1A 1ZVFA 3H1YA 4AQTA 3F2ZA 3NV2A 5FZ8A 4A2UA 4K9SA 5LRRA 4XJAA 5IK4A 3H7JA 5A7QA 4UFLA 3AZZA 4MHRA 3BALA 3GGLA 1MEC3 1CVNA 4H14A 1L7RA 1OD3A 2KA3A 1HB4A 2OIIA 2WUHA 3OTFA 3OGSA 5I0TA 3KV4A 1UZ0A 5C33A 1RUJ2 3RZJA 3IAPA 1DYOA 1MEC1 5IWFA 1PGL1 2GC3A 1PO22 3OJBA 1VBB2 2XLGA 3VD3A 2W91A 3T30A 2A6WA 3ZXDA 2QQLA 2J1EA 5IUQA 1S0JA 3NRUA 1APNA 3ILRA 4RYDA 2R0FA 1ZZCA 5ANNA 5IW0A 2D6LX 1CAUA 2WNVA 1ND2A 2ZX2A 5LW9A 1VBA2 1WMDA 2PQSA 3AVRA 1JH5A 2QFEA 3D6EA 2VCBA 3T3YA 3ZSEA 3DPRB 2VTXJ 5CBLA 3CZJA 3GYDA 1W90A 1IPKA 5J48A 1R083 2VNGA 2JKBA 3ELNA 4IV1C 2GZWA 1DF0A 3ZKYA 2BP6A 3I3QA 5C3SA 3PLQA 1OVSA 1UX7A 4I0BA 2I07B 2VMEA 4NHMA 1SG3A 2AH2A 1ZRIA 3CLPA 2R1BA 3VDDC 1Q8SA 1R081 4RN5A 3ZSLA 4BPZA 4LBQB 2ZHNA 5FPAA 1PGSA 2N7GA 3E5QA 3IBMA 1EAH3 4B3NA 5E89A 3MIBA 3OUIA 5FZOB 1H2NA 4CDXA 1LOFA 4BB3A 3MHZA 1Y9GA 3LIHA 3WF0A 5I91A 2ZAHA 5I8SA 1FV3A 1REEA 1KFUL 1EAH1 2ZX4A 2B42B 3CMGA 5JI9A 1S2EA 5EYXA 2EIGA 3QD6A 3GZAA 4HOOA 4BH9A 3CIHA 5CKMA 1YFYA 1MS9A 3MIEA 2QCSB 1NCRC 2AUYA 1KJRA 4D0QA 3VB9A 1C4RA 4JGYC 2V5DA 2ZABA 3AYDA 4DQAA 3A22A 3OUJA 1RUD3 3PUIA 4YNIA 2VCAA 2UY8A 4C91A 3PL0A 3GALA 2EIDA 2VUCA 2E33A 2W1SA 1N1TA 3JZVA 4LTAA 1RUD1 3CNAA 1ULGA 1UOFA 2W1WA 1C5HA 1PK6C 3GNEA 3J8F3 1YQ8A 5AC92 1KGYA 4UFMA 1UY3A 5BXXA 1DLLA 2VQAA 4YLZA 4N53B 4CUAA 1GP6A 5J09A 4V1PA 3M3OA 2A3YA 3J8F1 4XPVA 1F2NA 3L9JT 4Q4W2 2RM23 4QGLA 2HH9A 4IV1A 2VVEA 4DXSA 2PXJA 3SCHA 1KRIA 5LWBA 4OHXA 3ZOIA 3USUB 1QU0A 3U07A 1GZCA 2VCCA 4EE2A 3VDDA 1PGW2 1GWKA 2WA4A 3UJOA 2RM21 4CE8A 3ZFEB 3UK9A 2OYZA 4QDRA 1V6MA 5IVJA 4LKFA 1D2SA 1IOAA 1MR5A 1AL21 1DHKB 3LD8A 3ZYGA 3OGGA 3ZSJA 1QDCA 5KC6A 2R30A 1G86A 3A23A 1XSRA 5BNNB 5EJZB 3KCYA 4W6YA 2ZKNA 1UAIA 2RS11 5HCFA 4FBFA 2OX0A 5A7OA 1QXJA 3ACLA 4G4FA 4CDWA 2WNUB 5CFDC 3RYKA 4BQYA 3IB3A 2VZPA 1NCRA 3WR0A 1VAMA 4AEDB 4CXXA 1UX6A 2X5IA 4JGYA 3J7HA 1H6YA 2HLEA 1HIXA 3C3VA 1XB9A 4YPJA 4A42A 2XBO3 4A44A 2D6OX 5DDJ2 1HW5A 1CIYA 1VBD3 4BIFA 1JZ6A 2XQXA 5FMCA 2JG9B 3DYPA 3O0XA 2X09A 4QX0A 1GZWA 4BQ2A 2MEV2 3W21A 4D7SA 3P3NA 2XBO1 1QMJA 4FVVA 4Q26A 1VBD1 3PVOA 2J1AA 1PK6A 3SHRA 3KGZA 4IE4A 2EA7A 4AHWA 1FPN1 2Y26A 5FPVA 5H9SA 4AQ6A 1IS4A 4QHZA 5JLVA 5FBZA 5ABJC 1G8WA 4IEPA 2WWJA 1KS5A 1UOJA 3VKLA 3VD9A 1SLCA 4PIXA 3B5LB 4QKDA 3FHAA 3V64A 3ZXEA 4BLJA 4AVSA 1H2MA 4L8QA 1ZZ8A 1AL0G 2PHTA 3GHMA 1JZ7A 5FKCA 1OHFA 4RGAA 4YVWB 1IGOA 4QQHA 1R1A3 2RDNA 3WOGA 1R092 1J1LA 1FYUA 2PA7A 3KCXA 4Y4YA 3TN93 1JOBA 1OD5A 1W8UA 3MLJA 3BU7A 2W08A 4XILA 2A7AA 2Z2SB 1IPJA 2XJRA 1R1A1 2CY6A 2XONA 4NHYA 4UFKA 3WF3A 4TZDA 2VECA 5FYUA 1DIWA 1OKOA 5CFDA 3TN91 2FDGA 5C4WA 4AHXA 1W0PA 3POWA 4XACA 1DFQA 3LFMA 5IK5A 4SBVA 2YFUA 3DCQA 4RS5B 4YZ5A 3ZFGB 3B3QE 4XEZA 1J3RA 4BJ0A 3PUHA 2VH9A 1XNAA 4ISQA 1CZTA 4IUGA 3H8UA 4DRVA 4JX0A 1QGLA 3JUUA 2ZOEB 2OT7A 3OD4A 2W39A 4UI9L 4Z82A 5GALA 1VB4A 4Q1PA 5A1FA 1OKQA 2DUQA 3DV8A 5F6KA 1MZ6A 1W3XA 2XWJB 1O3TA 5LY1A 2EXJA 3N9NA 1UIJA 1OQDA 3E6DA 5ABJA 1FATA 4QPGC 3MF6A 2HWF2 5F6LB 1BEV2 3RQ0A 4K7JA 4NUBA 3BB6A 2ZHLA 3E5UA 4HMZA 4CU8A 3I7DA 4MLOA 1UXZA 4RQPB 3WG2A 1T6GC 3SEEA 2OS2A 2VU9A 3IDCB 4XQDA 3T4VA 4AFBA 4EQVA 4IERA 4O9EA 3I59B 5D21A 5C9AA 5K0UB 2V09A 1SDWA 2VTFA 2HKXA 4Y5Z0 3VBOC 3ZXKA 1JZ5A 2JX9A 1VE0A 2ZTNA 3VBFB 3CEWA 3NV1A 1ZZ6A 4UFHA 1DG6A 3IKWA 3JXSA 3ENRA 4XHBA 4Q8KA 1D0GA 1DQ4A 1YRZA 3RS6A 3MUZ1 1ASJ3 1YQ6A 5HI0A 2Q1ZB 2QE3A 2VNRA 4K20A 2DVBA 1V6NA 3PDQA 4META 2OKXA 4CEWC 2A5ZA 2IFWA 4FPCA 1VALA 4KWLA 3POYA 2XVKA 4TLFA 4AVTA 4LT5A 3LA3A 3NNFA 5FK8A 1ASJ1 1GQPA 1CZVA 1AXYA 1WMEA 2LRPA 5A33B 1COV3 2VVDA 4QXCA 3MV11 2WL1A 2VL4A 4X8NA 2Y33A 2PAEA 5FZ0A 2WJSA 2XVLA 5FPLA 2CDOA 2VJXA 4PLNA 1T2XA 2TEPA 1NZCA 3AXDA 4HVQA 2GNMA 1D7PM 3EMRA 2OA2A 1NQJA 4BE3A 4D69A 5CEHA 4AEJA 3BI3A 3ZN6B 1WA4A 5C8CB 3I3BA 4M4PA 2PHLA 5C3OA 2QVSB 1NCQB 2NMNA 4NE9A 4FCAA 1FV2A 4D7TA 3WX5A 1HRV2 4CPBD 4EV0A 1PNGA 1QQP2 1ZM1A 4PQQA 4QX2A 5F32A 1QOTA 1OI6A 2BZDA 1W0NA 2EALA 5LB6A 5GZEA 2WA3A 2VTXA 3WLUA 5EV7A 4MGIE 4I0WB 4Y1ZA 2DVAA 4W8JA 3VHNA 1GBGA 5ANQA 3ZYBA 1GZTA 1GR3A 3KVAA 1LRHA 4CP2A 4W50A 4NR1A 3UGGA 3MUY1 1D0HA 4FPJA 5B4NA 5JDBA 1DQ6A 3VBOA 3KS7A 4I3GA 5FYMA 4QGNA 5LK7B 1O3RA 1SDDB 4A7ZA 1AYM2 4LJHA 3U4SA 1US2A 3HEIA 4LO7A 1ULPA 1KITA 2O1QA 4YM0A 4ATEA 4PDWB 1LJ7A 5GLWA 3WQ0A 1ACCA 4CEWA 1UY2A 2V4VA 2D43A 1CAXB 2HWE2 3VKNA 1F8VA 1PO21 5FZMA 5CISA 2D5FA 3CL1A 3ILNA 3POJA 5JVVA 2ZGMA 4ZU7A 2QQWA 1G6NA 4MG2A 1BXHA 3M3EA 3M1HA 5J96B 1LOAA 4I2OA 1NY71 2QQOA 5BNQA 4ZPIA 4GA9A 3LOIA 2B5HA 3QBQA 4SLIA 4NOTA 2PQQA 3X29B 2DV9A 1KFXL 4EYUA 3MBWA 1MS1A 4IEOA 3IT8A 1FXZA 2Q1MA 3VHRA 4NWVA 4ZY9A 1JODA 1K3IA 1LGCA 1HXS3 5DN2A 4HG6B 3U10A 2E63A 4EJRA 2VXRA 4R9DA 5FZDA 5H9QA 3WW3A 4A7YA 3C7OA 1W9SA 1RB8G 2BBAA 4BDVB 4HFSA 3FFZA 1DU3D 2J1VA 1HXS1 1KS4A 4NPLA 1GNZA 1XU2A 1IKPA 1JU4A 5LBBA 2H6BA 1YEWA 2VCMA 2GSYA 5L73A 4QXKA 4NPRA 2PHDA 3A21A 2WZR2 3DPRA 3WHTA 1W0OA 4CXYA 3SMHA 4EWAA 1WA6X 2Q30A 4MOAA 2WFF3 4RD7A 4QX8A 1U0AA 1NUKA 2HWC2 3WNOA 4ZU5A 2FCVA 4RHV3 1ZZ7A 1YJKA 3I2IA 4IV3C 3J7LA 3THCA 1PMJX 4XTPA 3LPFA 2WFF1 1N1VA 4LBQA 3OPWA 4R9CA 2O0OA 1LENA 2DVDA 4RHV1 4IE5A 1DGWA 1CAUB 1FOD2 1ND2B 1UF2C 5JXIA 1ZRFA 3KT4A 2YU2A 2CSGA 3UGFA 3U4XA 2R6QA 3I2KA 4A4AA 4QWNA 4HANA 1PMIA 2FDFA 2RDSA 3M3CA 4ZU4A 1OVPA 4NRQA 1C1LA 1F9KA 2Y6JA 4PT6A 5BNOC 4AFCA 2XPJA 1GWLA 2O8QA 3WP4A 1QKQA 4PI2A 2CWSA 2TBVA 3FMGA 3H50A 4MGTA 3AZYA 4Y3OA 2B7YA 1HDKA 1Q8QA 2RG4A 3LA2A 3RG0A 3ZPOA 3BKZA 1HQLA 2EVXA 2VPVA 3FFQA 4FXGB 4Q4V3 2OVUA 2WO1A 2HWD3 2B9UA 2JG9C 4LBLA 4R4XA 4A3XA 3K75B 5F3CA 2P3KA 4IL7A 3N9QA 3D5OA 5A6QA 1G9BA 1MS3A 5L7OC 1J58A 1W06A 3AFKA 3MV01 4Q4V1 4CVUA 5KHHA 4HSLA 5F5AA 4PF1A 5AFEA 3PU8A 1G7YA 2EICA 3GBGA 3I49A 2JXAA 1W8TA 2VZRA 4MH0E 3NNJA 4N53A 3WUDA 5E16A 3IZOA 3S57A 2C5DA 4H7LA 4XIKA 4BXFA 2A75A 4P9XA 1JUIA 3I2HA 3JD73 4N9IA 4XXPA 1AYN2 4QPWA 1NE6A 3USUA 1UYYA 5FR3A 4AGVA 5FZAA 1AX0A 4U36A 4IV3A 3RI9A 4NHKA 5J98B 4CCLA 3ZYHA 2WR9A 3MI8A 1WCUA 1JOJA 4FXKB 3ZFFC 4BYYA 1L7QA 2BWAA 4CCDA 5JSPA 5DZFA 1O59A 1LOCA 1OBNA 1XC6A 2ADDA 1LHOA 4JKKA 1VMFA 1UZYA 1QDOA 1W6NB 1LOGA 4LE4A 5FMDA 5JMOA 1S0CA 1XQNA 2D44A 2E53A 3AMHA 1GQGA 1O4ZA 5J7MA 2YC0A 4IV1B 3M3QA 3N9PA 3JQWA 3NW4A 2H0VA 1BJQA 2P37A 3FL7A 5K9YA 3IPVB 2JDAA 2WNUA 2TNFA 3PUAA 3N9OA 3GZUC 4FFHA 3VDDB 4UW3A 1WCQA 4XZPA 4AEDA 3WNKA 2PHRA 1OC1A 1EP0A 2ZEYA 2PHFA 3H3ZA 4JCKA 3NV4A 1HB1A 1ZYBA 2GU9A 3V0AA 4NPMA 5DUUA 1YLLA 2JG9A 2JKXA 4DZGA 1MVQA 3R4UA 1YNAA 4QQOA 4AOCA 5L7OA 1Q8PA 1Q8VA 1PM7A 3IDBB 4LLFA 3GBFA 4UAPA 4Y5SA 3F95A 2WNEA 1AUYA 1Q43A 1NCRB 4X8PA 4P9WA 3H7YA 4JGYB 4PHZA 2XVGA 1BYHA 2DBNA 1O5LA 4W65A 3VUOA 2ZGRA 4NAMA 5FOJB 3I97A 1W8WA 2D3PA 2YYOA 3D82A 3RJ2X 3J7MA 3T08A 5A32A 1GZWB 1OQEA 1UKGA 4AEKA 2W46A 4LEJA 3R0RA 4DXZA 4IEUA 3ZFFA 3ZYPA 4CP0A 1PK6B 1X8EA 2FD8A 4NO4A 5A6ZA 2WQZC 4FOYA 4B4PA 3VBUC 3KHBA 2WYSA 4OI2A 3JBG2 4IGPA 4QM9A 4GB33 2PFWA 4YVSC 4Q0VA 5FYBA 2Y34A 4A6SA 3Q8AA 4PLOA 3VV1A 2JB4A 5CG8A 1O3QA 3U0ZA 5EPAA 1W6OA 1DLCA 1OA4A 2RDRA 1AR82 1PVXA 4YW6A 4GB31 4CTEA 5FUPA 4DIQA 4XBLA 2VZOA 5FPUA 3HD8B 1DGRN 2BVVA 5IATA 2WAOA 1NYWA 2DCTA 1UIKA 1JW6A 2VMGA 3ZFGA 5FYVA 1OFSA 1OH4A 2P3IA 4JRLA 4UXAA 1GP5A 1JYWA 3ZR6A 4IE7A 5JR2A 1RUF2 2DDUA 3CF6E 4CCOA 4P9GA 2ZZJA 1JUHA 1M4WA 2W94A 2YC4A 4IDZA 1DYPA 5FO7B 5CFDB 2WS93 4HT1T 1E57A 2BDRA 2W1QA 3BYWA 3O1SA 1OURA 2OUHA 3VBHC 2HWB2 4LO8A 4YG0A 3WD5A 3OCPA 4CCEA 4IEWA 1N3PA 1BK0A 1ALYA 2L9LA 2R0HA 2VQTA 2DYCA 3O7OA 4WVWA 4XCAA 2RS32 3WY6A 1WD3A 2WS91 4K3UA 3RVHA 3WF1A 4MGQA 5FXZA 4RQPA 4OMDA 4DPNA 2NM1A 2ENRA 4LKDA 2D6KA 4LULA 5J37A 1K5MC 4XUNA 1AR93 4YGBA 3ABZA 3K4ZA 5LK5A 5L9VA 1H30A 4WM7C 2DU0A 3VBUA 2GN3A 4HKOA 4KH9A 1AR91 2H6CA 4YVSA 5ABJB 3RYRA 1UYXA 2WO3A 4Y22B 1QQP3 2ZGQA 4DEVA 3KZ4C 1DQ5A 3HJRA 3WSOA 1W05A 4E8CA 3B9IA 4QXHA 4AI8A 1YQCA 1QQP1 3B7MA 3GHNA 3INAA 5JOYA 2BQPA 2BWCA 2VUDA 5FQ0B 4Z8BA 5DUXA 1RXGA 3HT2A 5CKNA 2GAUA 2PN5A 5F5QA 4M3CE 5J1XA 3AKRA 3FBYA 2VW1A 4HXCA 3N7KA 4A41A 2ARCA 5CNAA 1RVF2 3EYPA 4X6QB 1Y7BA 1PZ9A 1YO8A 4D6RA 1WCSA 2E51A 4QQPA 5JUVA 2VZUA 1QEXA 3PTYA 3RZZA 5C71A 1NCQA 3AYAA 2F4PA 4I02A 4ZS3A 3OY8B 4DFSA 3T1MA 4COYA 1F4AA 1NE4A 1EY2A 3LB9A 2VMIA 2BGPA 4TXWA 3BGAA 5GLVA 4P5HA 5LBCA 3NNMA 1RIRA 1Y3TA 2CGOA 3AMMA 3FUOA 2CAUA 1PO13 1K5MA 1CQ9A 3MIDA 5FYTA 4D94A 2PTMA 1MZEA 3B69A 5F1RA 5EQUA 4G9SB 3T4HB 4XBQA 4WM7A 4EWDA 2ZMKA 3POGA 3Q8CA 5LEJA 1PO11 4JDMA 1HV1A 5F7UA 4QPGB 1BBT2 5DG2A 4NROA 2BFUS 5FP9A 1NLSA 5FREA 1FNYA 5CB7A 1QJZA 5DAXA 4JAAA 1CAXA 1H9PA 4EN7B 4GWMA 4RR3C 2XJUA 2BJSA 1HLCA 2IXIA 4QX1A 2XJPA 3HWJA 1NAEA 1WW4A 1XNKA 4KBBA 3SITA 4UYBA 2C4XA 4DY3A 3VBOB 1A78A 2BTVC 3KM5A 3QOPA 4QHOA 2WLPA 3UV9A 5FFOC 2VMDA 1ZRRA 2ZX0A 3WDXA 2J1SA 3NNLA 1EYBA 5DQ0A 5FXXA 5HCHA 5DZGA 1JOPA 3WP6A 1GICA 4MUVA 3I3DA 4WZFA 4CEWB 1F15A 4H7MA 4QX5A 5FP8A 5K8SA 1RJ8A 3RSJA 1POV0 1IS6A 3SCFA 3BUCA 4B29A 3LA7A 5JXJA 2H0BA 5T52A 2ZGSA 3AMQA 5IYYA 2ZMNA 3O1UA 4R8HA 3A4UA 3R4SA 1RC6A 2BGCA 2E6VA 4CA9A 5FZ6A 1SCSA 4LIUA 3AM2A 1LGNA 1EPZA 1HRI3 1F4HA 1RUH3 2WNOA 3BTAA 3POBA 3MFCA 1RTVA 5CAZA 1SZBA 4M0NA 3UKNA 4JGZC 1A3KA 3OYWA 3DEMA 2PAMA 2YBSA 4OHZA 4IXLA 1HRI1 1RUH1 2WYFA 1WBLA 4ZHNA 2JENA 2DURA 2P6HA 4QB6A 4RFRB 4GAZA 1HJGA 5CFCC 2MHFA 3B01A 1V6LA 4AFMA 3ACGA 3AVSA 2EXHA 2R043 1LKNA 1F31A 4YW7A 4MSVA 4Z92B 2WN2A 4OI4A 4RR3A 1LULA 4LMFA 5EWSA 3BTZA 1PVC3 1HB2A 4BQXA 2R041 1OPMA 1UW8A 5IK8A 4AR2A 3IIIA 3U11A 3D0JA 3RZGA 3GJBA 4CUCA 3E6BA 1X7NA 2XQRA 3FLPA 4XF1A 5GM0A 1WMXA 1PVC1 1TMF2 2D6PA 4JKMA 5JPMB 3S30A 5LEKA 3WG3A 2DTYA 4L2NA 2A73B 3CJXA 1JXNA 1N3OA 4BWOA 2ATFA 3MIFA 3NNGA 3LEMA 4JHTA 1Q3EA 3ACIA 4QXBA 4CEYC 2ZEZA 5C5TA 1KJLA 5EHDA 3LKJA 4FFIA 2JDUA 1CX1A 4B8EA 3ALQA 4E4HA 3OBTA 2UWAA 5T3NA 4XDPA 2JDKA 3UESA 1DGWX 1GMMA 1UOGA 5FOBB 2EXIA 1CJDA 1G9AA 2CGNA 4Q4Y2 4IW3A 2I45A 2DUPA 2R1DA 5EP9A 5DUWA 1BK1A 2B4KA 2IXLA 4S2GA 2RMU2 3WW2A 3P1IA 3RPQA 1RMU2 2WWSA 2VBBA 3CZUA 4URTA 5CFCA 2OUJA 4KWUA 3S5AA 1UPIA 5JOZA 5A3UA 2ID4A 5EZWA 2R49A 2D3RA 4I01A 1W6NA 1QNYA 1V70A 1RHI2 3LZZA 1OFNA 2P34A 4FPYA 3RZHA 4HBNA 4S2HA 3VKFC 2K46A 2JG8C 4OI1A 4CP9A 4RGKA 3BODA 1CPNA 1V6IA 2DCYA 3H0OA 1AL23 3IPVA 2OQ7A 1S4CA 1ZRDA 4IV3B 3WV6A 3DKWA 1J1TA 3KQ4B 4CUGA 4DB5A 3K2OA 1DDLA 2G4IA 3PJYA 1QWRA 2RS13 5FDBA 3HMYA 3KV6A 1JMUB 2RR13 3LEKA 3MLKA 4DO0A 5ISLA 4Z2AA 5I0UA 1QJX2 2OXBA 2XXZA 2JE9A 3VKOA 5A3PA 3K77A 1JZ8A 3AYEA 2ZCWA 1V00A 1DP0A 2AREA 2O14A 3P5BA 5FZLA 2RR11 4FOQA 1XYOA 3UKTA 3WDYA 1ZA7A 1IG3A 2XLFA 3PVNA 2R062 5BNOB 4AVBA 1Z0HA 2FMYA 3GF6A 4B7KA 4QX3A 1GNYA 2VMHA 1FMD2 4YG3A 2RV9A 1QJU2 4S2FA 3N36A 1OXCA 2E7TA 5JCTA 1BMV1 4FAGA 2XWBB 4KG0A 4GXLA 3V0AB 1ZBA3 4IETA 2JDZA 4M3CF 2YC2A 3K4DA 5CKQA 4CU7A 5DMYA 2ZHMA 1FPN3 4AE2A 1ODNA 3DECA 3O0VA 4OZXA 5T5LA 2CAVA 1YQ5A 1YHFA 2BERA 1LR5A 4MVTA 4YW1A 5FPBA 5L7OB 1KQRA 3O1PA 1IHMA 2QBXA 1ZBA1 3KV5A 3LSDA 4QHBA 4N9HA 3LGRA 4KL1A 2YROA 3FWEA 4GQ7A 1JYVA 3HR9A 5JSOA 4WVZA 4Y26A 3PUQA 3TEWA 4HN0A 1JYCA 5FV3A 1RXFA 3W5MA 2Q8EA 2J7MA 3LFIA 3OD0A 3VZMA 1WLWA 4HL0A 3BU0A 1AR73 5A32B 3KVBA 1VAKA 1AXKA 1LODA 2PYTA 3ZFFB 3ILFA 3PURA 4QQLA 2ETEA 3VL9A 3LEGA 4MYEA 3WEZA 1AHSA 2RHPA 2Q8OA 3OBAA 1AR71 1SPPA 5BV6A 1WLDA 3I2GA 3LE0A 2K9ZA 1VBC2 2Y0IA 3WZ1A 2JIJA 5E1RA 5HCBA 3UL2A 1CAWA 2PLV2 2XUMA 4JC1A 5IVBA 2OW4A 4XQ4A 2JDPA 1TME2 2WZEA 3MGUA 4F83A 3ROUA 4MGKE 2YMZA 2QQJA 1W6OB 1XNDA 4GULA 2RJ2A 4DXTA 1L7LA 1SBDA 4LBOA 1C8M3 4OVEA 5AFBA 4CCJA 1JZ2A 2VOVA 4BMEA 2WAAA 1UQXA 3ACHA 3FJSA 4AHYA 2P5BA 3ZLIA 2LS6A 2ORZA 1C8M1 3HQRA 5FYCA 4Z1VA 1ZBE2 4YM3A 1ULOA 4TTGA 3N9MA 3AP6A 3POSA 5FRAA 4ZS2A 3C2UA 5F5IA 3Q8FA 4AAXA 2GN7A 1IQDC 4NIGA 1ULCA 1UZVA 1AJOA 1WD4A 4HLTA 4FFFA 1QJEA 2VM9A 4RA0A 5F9TA 1QJY3 2YB7A 3AJZA 1HQNA 5FBJA 5HXMA 2VZSA 1GLHA 1AR63 4LBQD 1QXPA 3LIGA 4HPKB 2WC2A 3LPGA 4OZOA 4V2WA 4KQ7A 5BPXA 2ZEWA 1QOOA 4Y22A 3URFA 1JYTA 4LPLA 2GNDA 4YSFA 1QJY1 4LKSA 3D4KA 1RUE2 4CCCA 3SISA 1AR61 4C1WA 4IE0A 4OULA 5FLHA 1X9TA 2X10A 2BOJA 3EQEA 5FQ0A 4BK5A 5EXOA 3D3AA 2ET7A 2HEVF 1UMZA 3VBUB 5HPOA 1H8TC 3PVBB 1WCKA 1RUC3 4AGRA 5JIUA 3HN3A 4YVSB 2RS53 3OUHA 5KHIA 2VR4A 3KQRA 5SV8A 4Z2WA 1O7FA 2WRAA 4DMIA 5ACA3 3SH5A 4O7XA 4ES8A 5IHRA 1BBT3 2YV8A 3BN6A 4XHXA 2JECA 1RUC1 4HVOA 1IG0A 5JOWA 4C8DA 2C0ZA 2RS51 3PU3A 2IZWA 1S2BA 1BKZA 2BU9A 2DFBA 3OY8A 5ACA1 2IUWA 2VOWA 4CCKA 1BBT1 3ETQA 2GDFA 4GZ9A 3KHCA 2VUJA 2XL7A 2IFRA 1V9U3 2C24A 2K2SA 2VZQA 4Q4X2 1ZZ9A 2C9AA 5FXWA 1H4HA 4C0HA 4CCNA 3LQCA 3H9AA 2G9ZA 5CIRA 2VC9A 3ZXJA 1V9U1 3W9AA 5AVAA 4TSVA 5LCWL 3LF7A 4CP1A 3KD4A 3SLIA 3V0BA 2FCTA 1VB2A 4XMAA 3AP7A 3UETA 3ZIXA 5FY4A 3VBHB 4D6SA 3THDA 1US3A 2UWBA 3M2MA 4AGGA 4QPGA 1FAYA 4IQPA 3TNQA 1EV12 2P6CA 5KC5A 4KU7A 3ZDVA 3W59A 2JIGA 3AKSA 3DKQA 5SV5A 3R6SA 4XUTA 1K5MB 1LECA 2RE9A 2VOKA 3WP3A 1S2KA 2ZS6B 1XBFA 4PIYA 1Y9QA 3J26N 1G9DA 1XSQA 2CGPA 1RUJ3 4WM7B 1H8TA 4JHZA 1YJLA 2P3JA 2E7AA 1K12A 1PO23 3B02A 5A3TA 2ZEXA 3ST7A 1VBB3 2R072 2ES3A 1UYPA 4P9YA 3WNNA 4GD4A 1RUJ1 2CWMA 1IS5A 3CHXA 2A1XA 1BCXA 4O65A 4R4ZA 1VBB1 1UOBA 1VBA3 2GNBA 1VRH2 2QUOA 2VE1A 5FTTC 5F2SA 2DF7A 5JZGC 1W03A 1PM4A 2XMLA 4R9AA 1W39A 4GKXA 5FAXA 3B9CA 2AEYA 1JHNA 4BU2A 3MYXA 4XF4A 1VBA1 1R64A 2K0GA 4LO5B 2YFZA 4AI1A 2WBKA 5A1AA 2XR4A 4JQTA 2DUOA 1V6KA 3HNYM 1CONA 1X33A 2B9VA 4JKLA 1OA2A 4LR4A 2SLIA 1DBNA 1SQ4A 3WW4A 3C7EA 2BRTA 4MZUA 4FTBA 1D4M2 2J1TA 2MPFA 3A0NA 4YW4A 3WDWA 1TNRA 1Z7S2 4LBKA 4FI9A 5A3MA 5A70A 2WINB 4XDQA 5FWJA 3VBRC 1JI6A 2BEOA 1W8HA 1GOHA 2WKKA 4OHWA 4ASLA 3T2TA 1FNZA 5KHJA 2P3YA 4PBPA 3AK0A 4XZUG 1DQ2A 3OEBA 3SCGA 1KDMA 2YGLA 4WZCA 5A7NA 1GZ9A 3V56A 1J3PA 3OYWB 5C5UA 3H8OA 5FZEA 4YWAA 4COZA 1IKQA 3OG2A 3ZM8A 3ETPA 3AKPA 2Y6GA 1PIV2 1VBE2 2P1BA 2GMEA 3GM8A 4LHLA 5KR7A 4Q4Y1 5KWRA 5FP3A 3Q9OA 3H8RA 3CQOA 4B4RA 5JR7B 1EUUA 3AKQA 3WNPA 2MNGA 1GU3A 1SACA 1NOVA 2JDMA 4TLGA 4HSJA 3E1F1 4XYXA 4RR3B 1YFWA 3IDEA 2JDHA 3PJQA 5FY9A 1POV3 3U37A 5JZGA 1NZIA 1BQPA 2CL2A 3WNXA 4NHXA 2W47A 4Q4W3 3B00A 1OOPC 5AC91 5T50A 1MZ5A 4Q5OA 1POV1 2KM2A 5K7PA 4F3JA 1BLZA 1SLBA 2YGMA 4Q0PA 4E4SA 4K1YA 4Q4W1 1ZREA 3WT3A 2XJTA 4BIOA 5GZGA 4Y20A 1J84A 4ARYA 3ACFA 4DUWA 1I1EA 1I9RA 1I6XA 3N35A 4AG4A 3AX4A 4JZRA 1PGW1 3AMPA 3UYJA 2V72A 4ARXA 1YC61 2GMMA 3R05A 1QJX3 1DGRA 4FOVA 4F8AA 4KWJA 1VRBA 1SLLA 1F35A 1QH6A 3DUIA 1PGL2 4ONUA 2P4EA 2WQ4A 2JWPA 2YPDA 3OGJA 4D7YA 1YIFA 1QJX1 1GV9A 3WDVA 4JGZB 5KHKA 1XJAA 4MGZE 1TEIA 1QJU3 3KCCA 2NYYA 2G9GA 1B35C 1Q56A 1LOBA 4OUMA 1FMD1 3ZSMA 1CX4A 4LIVA 5CFCB 2VNVA 1QJU1 2MEV3 5FYHA 1N3QA 2VD7A 3AL5A 4YW3A 1UXXX 3AKTA 2Y6LA 4YM1A 5FPZA 2QZ2A 5JWPA 4AEMA 4CSWA 1MS5A 3K51A 1R082 2F6BA 5LASA 2MEV1 1UMIA 1OA3A 4M0HA 4CP9B 1ZZBA 1JN2P 1XE0A 4UW6A 1H1AA 4DOUA 5BNOA 5HCAA 1CN1A 4ZXKA 4FTEA 5FZ3A 4I30A 1GSLA 1W99A 3UNPA 4AI9A 3HNBM 1JYIA 5G04L 4QB2A 4FSJA 4GH4C 1EAH2 3FN9A 1W2OA 2JB8A 2QDNA 3G6JB 4B7EA 4UT5A 3KB5A 5T54A 5C3QA 4L92A 1ND3C 1XPWA 1W3VA 2R7EB 4AI3A 1O6UA 4OUEA 2P17A 3LDRA 3ES1A 4A3ZA 2NLRA 3B93A 3U78A 4IEZA 2W87A 1LESA 4CEYB 1I5PA 1LNSA 4XW3A 1UZZA 1WKYA 4QKFA 1R093 3AZWA 3I2FA 4QKBA 4QT6A 5IVEA 5B4XA 1VAVA 2VBPA 2QQMA 4QPYA 1JBCA 2PHUA 4C90A 1R091 4OQ9A 1A34A 1RUD2 4LHNA 2D40A 3CDZB 3PMEA 3SQOA 1U5YA 1REFA 3BCWA 1AF9A 1V6JA 1N47A 1B35A 4EZHA 5C7GA 4E2SA 3I54A 3FBMA 1YFXA 3J8F2 4F7ZA 4GALA 2Y6HA 4Q2FA 3PMSA 5J36A 2J1UA 3UJQA 2GH2A 3QCWA 5A6XA 1BVVA 3LSEA 4NWWA 4L11A 2CDPA 2HBTA 3RZMA 2RM22 3OPTA 2OZJA 4TYSA 5FZKA 4E4DX 4EROA 1LHVA 2VOTA 2JG8B 2E7QA 2YXSA 2BBVA 2FDHA 4G3YC 4XVHA 2HWF3 3M4FA 1BEV3 3AMNA 3ES4A 4P00B 3PHMA 3BPSA 1RUI2 4OYUA 2VZ1A 4BISA 3FUQA 4CDUC 3VZNA 5IT6A 1OLMA 3WNLA 4QPIC 1DGLA 4ORFA 1H1IA 2HWF1 2DCKA 1SPPB 2XLAA 4PBOA 5EYYA 3DL3A 4YRDA 4MV2A 1BEV1 5LA2A 1ND3A 4M3CA 4N43C 4OI0A 4L97A 3BTXA 1CAWB 3K3OA 3S7IA 3T0BA 4K21A 3S6PA 1SFNA 5LBEA 3ZR5A 3THTA 4J1WA 4ES9A 1GUIA 4QU2A 1R1ZA 3BIWE 2VGDA 1KD7A 3OB8A 1UU6A 1UKRA 2WSUA 3LCPA 2RVAA 2Z4FA 3KF3A 1HN1A 2XBO2 5IFPA 4HPKA 1VBD2 3W58A 1C5IA 2C9KA 4Y33A 1CAVA 1ODMA 4P5YA 3AYCA 3HOBA 3KMHA 3ORJA 2BNNA 4LE3A 4W6XA 2FDIA 3POEA 5A3WA 5J3UA 3RDIA 5FMOS 4XTMA 2XH6A 1GANA 1JS9A 5D8AC 5D1IA 1ULEA 1OUXA 4FQ4A 4H2AA 3NAPC 3ZKUA 4COUA 3FC0A 3O1RA 1C1FA 3MEPA 3S0MA 4Q0UA 3CO2A 2UYAA 3UKVA 2VQ0A 3N3HA 4FPGA 1LTEA 4MGYE 1HRV3 4QM8A 4XCBA 4AWDA 4WM8C 4AF9A 3MF9A 4CDQC 1S0FA 3ZX7A 2BUKA 2QZ3A 5EFUA 3VD5A 2ZZQA 1FT9A 4FAHA 4IEXA 3KSCA 1HRV1 3S5QA 5C70A 1JHJA 1SMVA 4CDUA 1C57A 2HEYF 1BZWA 1R1A2 1NA1C 2Q1FA 3OF1A 4QPIA 4M4RA 2FMDA 2JJ6A 4GIQA 4GKYA 5FY7A 3TN92 4CU9A 4ZONA 5IVVA 4LITA 4FPHA 5IJRA 5KHGA 4AQ2A 1QJFA 2ZPXA 2ZGKA 3QH7A 4MXVA 4QGMA 1EUTA 1AYM3 2JD9A 3NQHA 3NJVA 3K3NA 3M70A 1AXZA 3O1TA 3IN9A 2XG3A 1YI7A 5A1LA 4I0AA 4LK7A 1HKDA 3ASIA 1DQ0A 1BHGA 3PUSA 1AYM1 2HWE3 5DAWA 3VBHA 3ZDSA 4QAWA 5D2AA 4WVVA 1LHNA 3HQXA 1U5XA 2C26A 2R071 3SH3A 3H8XA 3BIEA 3ON7A 5CU1A 5A7SA 5E88A 3Q8BA 4BOWA 1UYZA 3MW2A 1OSGA 3KT1A 2HWE1 3NMBA 4KNCA 1XNBA 3T2QA 4IESA 2F17A 2CYFA 4UF0B 4BM8A 1SEFA 3D0SA 5E6HA 1E5RA 5TSWA 2XKOA 3AJYA 1MS0A 1K5JA 3V0BB 3OGVA 4YZ2A 3NAPA 1JZ4A 1X82A 3W5NA 1LU1A 1NKGA 3CJIC 3GJAA 5FLJA 4C1XA 5DAVA 3SKJE 1Z78A 3VHPA 3OBRA 2CU5A 4OUSA 1UD1A 3NJYA 3TWIA 1D2QA 1LB2A 4WM8A 4KMQA 1XOYA 5FZ1A 1VMJA 4QB1A 2VAUA 4CDQA 3NSTA 1NX9A 2P2KA 5EJ1B 1O91A 3LOBA 2WZ8A 2WZR3 4DRRA 2KR2A 2ZGNA 4E4ZA 1O8SA 1OPOA 2YHJA 2DCJA 3GDBA 3ME2A 3T2OA 2Y6KA 3N9LA 3TEYA 2HWC3 1H8TB 1VP6A 4BXSV 2WZR1 1ZNPA 1ASJ2 3HBKA 4UWDA 2GALA 2DFCA 4CU6A 2FHRA 1ZA4A 5FYZA 2HWC1 5FZHA 2WNVC 4LHKA 1O4TA 5FY1A 1FOD3 4JV4A 4LUKA 3MO4A 4YG6A 3N4MA 2V4AA 2ILMA 3KV9A 4L9BA 5GKAC 5B2GB 1COV2 1G9CA 2YY1A 4BQ1A 1ZX5A 1JTZX 1DCSA 3WP5A 4INDA 3VZKA 5IAVA 1FOD1 3G7DA 1OMIA 1LAJA 4P02B 2NN8A 1RJ7A 2OZ6A 5DUVA 3THPA 3LEIA 2UWCA 1YCIA 5BNPC 1W04A 2YDEA 4EN9B 4AZZA 2C6SA 2F4LA 4CDXC 1JU3A 4MXWA 2Y6FA 2JICA 2XB6C 4A6OA 5FP4A 3WNMA 2ZJCA 3CJIA 3FX3A 3HPNA 4E27A 2WLQA 1U5IA 2KD7A 3MW3A 4XUQA 5T55A 5DPNA 4QU1A 4XUPA 1WW7A 1IQAA 1I5ZA 1LCLA 1AJKA 1MVEA 3HT1A 5FYSA 3K48A 4FP3A 2D3SA 3MICA 1IZ3A 2W52A 5A7WA 3Q8EA 3ZVXA 4BMBA 4ZKTB 2VMCA 1V0AA 4NIDA 4LBJA 2NZ9A 4XF9A 4RGGA 4AI2A 4XAAA 4BZ4A 4CRQA 2A71A 1AYN3 5FUNA 1NLQA 3TB0A 3VBSC 2VNOA 1A8DA 1W2TA 3O14A 1ENXA 3N7JA 3C7FA 4FPKA 3I4IA 1RL3A 2HEWF 3J4UH 1RYYA 1W2NA 1AYN1 2LM3A 1AX1A 1LHUA 1OQ1A 1NY72 2XKPA 2ZGOA 3WUCA 3ZO0B 2WN3A 5FK7A 4XC9A 1WWYA 4MGSA 4YZ3A 3ITQA 3WVJA 1UL9A 5DDJ3 2VO5A 5HV4A 5JZGB 4R52A 2G19A 3NWKA 5JXGA 1GKBA 5JXHA 4E2GA 4RSUA 4UW4A 3R4DB 4AFAA 4AHZA 4BQ5A 1WGPA 4RFT0 1XYPA 4EN8B 5DDJ1 3GZEA 3VKMA 2Q5TA 2GNTA 4XBNA 1ENRA 2IVJA 2YUEA 3K46A 4JGZA 5FKBA 1HXS2 4LLOA 4QKNA 5F2WA 2ZGTA 3T2PA 4Y24A 4Y20B 4CCMA 5BNPA 1QH7A 1CGPA 1KXGA 2I74A 3S7EA 2VW2A 4Q1RA 3O5SA 5I0SA 4KU8A 1ENSA 3KT7A 1PZ8A 2YU1A 3OBZA 4XIOA 1DQ1A 2DCZA 4XABA 5LBFA 4NIAA 5BYNA 3VBRB 1ZRCA 3WCSA 2ET1A 4CDWC 1K42A 2UY9A 3L2HA 1NT0A 4BQWA 5IFTA 4K8FA 2Y0OA 3DGTA 4DUVA 1H0BA 3HN1A 1OH3A 2IXHA 2WFF2 1RITA 2X5IC 4LO6B 4M00A 1NG0A 4GWNA 4RHV2 4ZXEA 4K40A 3T09A 4QX7A 4LO4B 2VZ3A 1GWMA 3VBSA 1LGBA 4QDQA 5FJHA 3UT0A 3ZXLA 2Z79A 4UW5A 1UZWA 2ARBA 5GLZA 4QQ2A 5FZ9A 5FXVA 1CWPA 1UO9A 4YGDA 2X29A 1C28A 2IVIB 5IAXA 2BOIA 1J59A 4CEYA 3BVCA 2ZMLA 3HNMA 4J6GA 5FCCA 4LUMA 3JBG3 3MPPG 4FPOB 1LHWA 1HJFA 1N1YA 4XQWA 3RMYA 4I09A 2ZGLA 1W9WA 3ZXFA 3FLTA 2IXCA 1OOPB 4HZFA 5F8PA 4W4ZA 3AL6A 2NQYA 4P14A 1O8PA 2EAAA 3TOJA 1MQTC 1XE8A 3JBG1 4NIHA 1AR83 4HONA 1Q5OA 4UFJA 4COWA 4Q4V2
chains in the Genus database with same CATH topology
1NQDA 3WINE 5JSRA 1RUI3 2HWD2 3ECQA 4K1ZA 5GZFA 3ATGA 1AR81 2GC0A 3QACA 4DINB 2EAKA 2IWGB 4P9JA 3ZIWA 4YZ1A 4NHLA 4Q29A 1RUI1 3ZYJB 5KBFA 4XOGA 1SLTA 1B09A 1RUF3 2IXJA 4S2DA 1TNFA 3WQ1A 1UU5A 4WVMB 2DVFA 3SH4A 3SNMA 5C4WC 5CG9A 5C6CA 2NP0A 4XE9A 1QOSA 2DWRA 3JD72 1RUF1 4AQSA 1L3JA 2HWB3 1XE7A 2JG8A 1H4GA 4Y1XA 1XYNA 2RS33 1B35B 2ZBJA 2WIIB 2HWB1 2RS31 4M01A 5JOXA 1FX5A 4UBGA 3WCRA 5I8TA 2A6YA 3ZPYA 4X6RB 1YWKA 1W2UA 1YXWA 2NPIA 4YYOA 1I3HA 1RGSA 3NJZA 1ULFA 3ZYIB 4XMIA 4GMP3 1MQTA 2Z5WA 1W6MA 3WG4A 4RL7A 1SBEA 4GH4B 5C9AC 4Q27A 2B39A 2KXLA 2XHKA 3MDPA 1ND3B 4GMP1 4M3CB 5LRSA 3APBA 3WDTA 2EF6A 5CA6A 1W6QA 2I2SA 1MZFA 4J1XA 1MS4A 2Z42A 1RUG2 1RVF3 3MIGA 2B45X 4ATFA 4ISRA 4XXAA 1DZTA 4LNVA 1RVF1 4DNYA 2LTNA 4OFGA 5GJ6A 1CAVB 2FBEA 3JB4C 4Y1YA 2AGSA 2BVBA 1NLRA 2CNAA 5BY5A 2IXKA 2D6MA 2VG9A 4XFBA 3IIAA 4XJ9A 4YW2A 5KXEA 4GB32 1PHMA 3V65A 4OHYA 3NVCA 1SBFA 4C0BA 2XJVA 2D7FA 5T5JA 1LEMA 1H1MA 2CTVA 5GZCA 4HKLA 4H55A 1HQWA 1X50A 5AVPA 1VLNA 4CDUB 1WMFA 4QPIB 3TBDA 4XFIA 1CPMA 3FZ3A 1VIWB 2Q4SA 1ONAA 4N43B 4E9KA 4Y1VA 2QNKA 3NO8A 3EBRA 1AX2A 1W6PA 4HN1A 4LBMA 2A70A 3JCIA 2BPA2 2B8MA 2W68A 3LWCA 4LBNA 2WS92 3M8LA 3AZXA 2UYBA 1MS8A 3JB8A 1YYNA 2ZACA 2A6XA 2RJLA 1KDKA 3PVEA 3RMXA 2NMOA 2A6VA 2ZAAA 1WUVA 5C8WA 4HKWA 5JMCA 1VR3A 1AR92 1U12A 1CJPA 1COV1 5D8AB 2V73A 4CZSA 5JIAA 1HV0A 5KXDA 4HK9A 3NAPB 3RWNA 2HYKA 1F5JA 5JPNB 3EJKA 3ZN4A 3NKGA 3GZTB 4WM8B 4FQZA 3NV3A 1NXMA 4CDQB 1YI9A 2GC2A 4HETA 3DF0A 3DPRC 1BVP1 3WG1A 4D3WA 4Q0QA 2BNOA 3O12A 3WXPA 1NA1B 1S0IA 1TE1B 4AVCA 3FE5A 1QHDA 4PCRA 1UCXA 4Q0SA 1S0DA 1TMF3 4R9BA 1WW6A 4FPFA 4XJWA 2FQPA 3AZVA 3M3IA 4YGCA 1TMF1 4WBBA 3VLBB 2ARXA 3IM0A 4BCUA 4IEVA 1WLTA 2W0XA 4E2QA 2O8OA 2OPKA 5FPXA 4JTNA 4A7KA 4O9GA 4LA2A 2LALA 1PO12 1LEDA 5FMOL 3ZN5A 1Y43B 4Q4Y3 1X8MA 5FO9B 3VGIA 3KLSA 4MXWB 4QMAA 4DY5A 5GLUA 4HK8A 2ERFA 3CJIB 3MPBA 1YUDA 2RMU3 3PNAA 1RMU3 2JD4A 4KGGA 1X36A 4FP2A 3FHIB 3USSA 2JEMA 4N53C 1YIPA 2RMU1 4WV8A 2D5HA 3M7AA 1RMU1 1RHI3 3MFAA 1F5FA 2PHXA 2XL9A 3P3PA 5I93A 3DN7A 5JAXA 2GMPA 3HBZA 1RHI1 3ZFEC 1G9FA 3JQXA 4AVVA 1WLCA 2BW8A 4I3PA 4N90A 2WNVB 3MLLA 4PJYA 3ZXGA 4N7IA 2VULA 4FPEA 3E97A 5BNNC 2VW0A 1XNCA 1XRUA 3EXUA 4YM2A 5HXVA 3TNPB 2AENA 2ZGPA 3VBRA 1GYKA 1MEC2 1HRI2 1RUH2 4XFFA 1UN1A 2VY0A 2WNUC 3WW1A 4AW7A 2R063 5H9RA 4AEDC 1O4YA 1FMD3 4OHVA 5BNPB 2E9QA 4MX3A 2LUWA 2EXKA 4KWKA 2R061 4CDXB 4LA3A 3BOPA 1S0BA 2BYVE 3AP4A 4TWTA 1RUOA 1O3SA 5H9PA 2R042 2BFUL 1J3QA 2HWD1 1SCRA 2YZ4A 4JRAA 3VZLA 2BNMA 1PZ7A 1PVC2 1GNHA 3TRSB 1QXRA 1TQ5A 3WDUA 4PLMA 1RUNA 2GH8A 3E6CC 3N7MA 4BLIA 1HX6A 1OOPA 3ZXAC 3VBSB 4FTSA 3MW4A 5DG1A 3ZFEA 3JD71 4YVWC 4KGQA 3MZHA 2IC1A 4XJUA 5GZDA 1DYKA 1CR7A 2WFPA 4AI0A 1WW5A 1VBC3 1UU4A 5CADA 3BOWA 5BNNA 3J9SA 2PLV3 2D98A 2YPJA 4EWEA 1VJ2A 1TME3 3I8TA 5FO8B 1LU2A 4GMP0 1VBC1 3H1WA 4WVMA 4XJ8A 1QF3A 4AK3A 2PLV1 4NN0A 4PIZA 2PAKA 4K6BA 3IWZA 3QLQA 2A6ZA 1TME1 4UBHA 4AVAA 1V6OA 4B4QA 1PNFA 2A3XA 4RS5C 1M06G 3ZFGC 1XXNA 1WBFA 2X53S 2Z69A 3E5XA 1SLIA 1CESA 2D93A 5CVRA 4Z07A 4BHPA 1ZBE3 4ITCA 3NL1A 3RYPA 3ZMOA 4KG8A 4YZ4A 1MACA 1H2KA 2AYHA 5I8YA 2D97A 4W6WA 4XFGA 4CDWB 1RUG3 2FZ1A 1ZBE1 2ZHKA 4P9LA 2WZPP 5A3LA 1GFF2 2X5IB 4ASMB 3VHOA 1AL22 3A0KA 2DU1A 1OLQA 1RUG1 1AVBA 1EPWA 1S0EA 2Y38A 3RI8A 1RINA 4RQPC 2WSVA 4FPLA 1RUE3 5L19A 2RS12 3D8CA 1S1AA 2C1FA 4GH4A 4Y1UA 2UU8A 3ZSKA 4YVWA 5T5OA 2RR12 3BPZA 5K0UC 2WT2A 2PELA 5EJ3A 1H2LA 4XF0A 1SFYA 1RUE1 4YGEA 3VBFC 4YFWA 4DS0A 1CIWA 4JTOA 1BMV2 4COVA 3VZJA 3RJRA 3AP9A 4FT8A 2RJKA 3EO6A 3TYJA 2Q0AA 2ZKLA 1SLAA 2ZX3A 1MQTB 1W6MB 2VOXA 2AR6A 3QH6A 2QQPA 2SBAA 1ZBA2 2ZGUA 4RS5A 5BUVA 1FPN2 3I2DA 4FOWA 4Q4X3 4JDOA 1W6QB 1UPSA 1AZDA 2G9FA 3H1MA 4XFCA 2QJVA 4BA6A 3ZMNA 5C8CC 4EN6B 4Q4X1 1REDA 5JI7A 1NCQC 1FI2A 5C4WB 1ENQA 5HBAA 3RRDA 3ZYRA 2X8KA 1AR72 2TUNA 1S55A 1EV13 3HIFA 1LOEA 2B46X 1WCDJ 2WT1A 2ZA9A 2ZX1A 3CU7A 3IMNA 4XETA 2VUAA 3I59A 5K0UA 1URXA 4IEYA 4IEQA 1EV11 4N43A 1H9WA 3B94A 4YARA 3AP5A 3VBFA 4QD2A 1NXD1 1DZRA 3OPZA 2AZ5A 1OLRA 5T5PA 4CYDA 1GQHA 2DTWA 4PDWC 1C8M2 2R073 2V5YA 4AFDA 3AFGA 4YW5A 1O5UA 4AYUA 5GLTA 1H8VA 4XFHA 1VRH3 4JQRA 1DZQA 4XJZA 5C9AB 5A33A 1ULDA 3AXEA 1U5ZA 2DVGA 3TAYA 1YFUA 1VRH1 1W6PB 3SXWA 3NKTA 3N7LA 4XFAA 5D8AA 5L36A 2A3WA 2R32A 4JDNA 5DZEA 3EHKA 4NVPA 3ZN6A 1QJY2 5C8CA 5E8AA 2GC1A 4FO9A 1AR62 3MIHA 1D4M3 1Z7S3 1N1SA 1QNWA 3GBWA 2JE7A 1D4M1 1D4VB 2QKDA 4N7UA 1Z7S1 3HAGA 2WT0A 3RNSA 4L99A 2XJSA 4HVRA 5DXDA 1NA1A 3JU9A 2XGXA 4JVAA 4OLLA 2PHWA 1RUC2 4Q8LA 2QDRA 4EN0A 1QY4A 2RS52 4P9IA 4AXOA 1Q8OA 3FLRA 5IK7A 4PF5A 5ACA2 3T1LA 4XF3A 1C3HA 1PIV3 2XJQA 2CV6A 1VBE3 3LAGA 4PDWA 1ND2C 2UURA 1S0GA 3WQ7A 3O0WA 2VVFA 5KXBA 3KGLA 1PIV1 5KXCA 1VBE1 4U2AA 1A6CA 2D6NA 1V9U2 3WHUA 3VL8A 3L2YA 3H3UA 5FLIA 3VZOA 2R16A 1CD3G 1A8MA 1C8NA 4YFZA 4PQ9A 2FZ2A 3AB0A 4H3WA 2HJIA 1LOFC 1IS3A 1XU1A 1ZVFA 3H1YA 4AQTA 3NV2A 4A2UA 4K9SA 5LRRA 4XJAA 5IK4A 3H7JA 3AZZA 3BALA 1MEC3 1CVNA 4H14A 2KA3A 2OIIA 3OTFA 5I0TA 5C33A 1RUJ2 1MEC1 1PGL1 2GC3A 1PO22 3OJBA 1VBB2 2XLGA 2A6WA 3ZXDA 5IUQA 1S0JA 1APNA 3ILRA 2R0FA 1ZZCA 2D6LX 1CAUA 2WNVA 1ND2A 2ZX2A 1VBA2 1WMDA 3D6EA 3ZSEA 1JH5A 2QFEA 5A3MA 3DPRB 5CBLA 5J48A 3GYDA 1IPKA 1R083 2VNGA 2JKBA 3ELNA 4IV1C 2GZWA 1DF0A 3PLQA 4I0BA 2I07B 4NHMA 2AH2A 3CLPA 2R1BA 3VDDC 1Q8SA 1R081 3ZSLA 4BPZA 4LBQB 2ZHNA 1PGSA 2N7GA 3E5QA 3IBMA 1EAH3 4B3NA 5E89A 3MIBA 1H2NA 4CDXA 1LOFA 5I91A 2ZAHA 5I8SA 1FV3A 1REEA 1KFUL 1EAH1 2ZX4A 2B42B 5JI9A 5EYXA 2EIGA 3QD6A 3GZAA 4BH9A 1YFYA 1MS9A 3MIEA 2QCSB 1NCRC 2AUYA 1KJRA 1C4RA 4JGYC 2ZABA 3AYDA 4DQAA 1RUD3 4YNIA 4C91A 2UY8A 3GALA 1N1TA 3JZVA 4LTAA 1RUD1 3CNAA 1ULGA 1C5HA 1PK6C 3GNEA 3J8F3 5AC92 5BXXA 1DLLA 2VQAA 4YLZA 4N53B 5J09A 4V1PA 3M3OA 2A3YA 3J8F1 4XPVA 1F2NA 3L9JT 4Q4W2 2RM23 4QGLA 4IV1A 2VVEA 3SCHA 1KRIA 4OHXA 3USUB 1QU0A 3U07A 1GZCA 3VDDA 1PGW2 2WA4A 3UJOA 2RM21 3ZFEB 3UK9A 2OYZA 1V6MA 1D2SA 1IOAA 1MR5A 1AL21 1DHKB 3ZYGA 3OGGA 3ZSJA 1QDCA 5KC6A 2R30A 1G86A 5BNNB 3KCYA 4W6YA 2ZKNA 1UAIA 2RS11 5HCFA 4FBFA 1QXJA 3ACLA 4G4FA 4CDWA 2WNUB 5CFDC 3RYKA 1NCRA 3WR0A 1VAMA 4AEDB 1UX6A 2X5IA 4JGYA 1HIXA 3C3VA 2XBO3 2D6OX 1HW5A 1VBD3 4BIFA 2JG9B 3O0XA 1GZWA 2MEV2 4D7SA 3P3NA 2XBO1 1QMJA 4FVVA 4Q26A 1VBD1 3PVOA 3SHRA 1PK6A 3KGZA 2EA7A 4AHWA 1FPN1 2Y26A 5H9SA 4AQ6A 1IS4A 5JLVA 5FBZA 5ABJC 1G8WA 4IEPA 1KS5A 3VKLA 1SLCA 4PIXA 3B5LB 3V64A 3ZXEA 4BLJA 4AVSA 1H2MA 4L8QA 1ZZ8A 1AL0G 2PHTA 3GHMA 1OHFA 4RGAA 4YVWB 1IGOA 4QQHA 1R1A3 3WOGA 1R092 1J1LA 1FYUA 2PA7A 3KCXA 4Y4YA 3TN93 1OD5A 3MLJA 3BU7A 2W08A 4XILA 2A7AA 2Z2SB 1IPJA 2XJRA 1R1A1 2CY6A 4TZDA 2VECA 1DIWA 3TN91 5CFDA 5C4WA 4AHXA 1W0PA 3POWA 5IK5A 1DFQA 4SBVA 4RS5B 4YZ5A 3ZFGB 3B3QE 4XEZA 1J3RA 2VH9A 4ISQA 3H8UA 4DRVA 1QGLA 3JUUA 2ZOEB 3OD4A 2W39A 4Z82A 5GALA 1VB4A 4Q1PA 1OKQA 2DUQA 3DV8A 5F6KA 1MZ6A 2XWJB 1O3TA 2EXJA 1UIJA 1OQDA 3E6DA 5ABJA 1FATA 4QPGC 3MF6A 2HWF2 5F6LB 1BEV2 3RQ0A 4K7JA 3BB6A 2ZHLA 3E5UA 4HMZA 3I7DA 4MLOA 4RQPB 3WG2A 4AFBA 1T6GC 2VU9A 3IDCB 4XQDA 4IERA 4O9EA 3I59B 5C9AA 5K0UB 2V09A 1SDWA 2HKXA 4Y5Z0 3VBOC 3ZXKA 2JX9A 2ZTNA 3VBFB 3CEWA 3NV1A 1ZZ6A 1DG6A 3IKWA 4XHBA 3ENRA 4Q8KA 1D0GA 1DQ4A 1YRZA 3RS6A 1ASJ3 5HI0A 2Q1ZB 2QE3A 2VNRA 4K20A 2DVBA 1V6NA 4META 4CEWC 2A5ZA 2IFWA 4FPCA 1VALA 4KWLA 3POYA 2XVKA 4TLFA 4AVTA 4LT5A 3LA3A 1ASJ1 1AXYA 1WMEA 5A33B 1COV3 2VVDA 4X8NA 2WL1A 2PAEA 2WJSA 2XVLA 4PLNA 2TEPA 1NZCA 3AXDA 4HVQA 2GNMA 4BE3A 2OA2A 1NQJA 4D69A 4AEJA 3ZN6B 1WA4A 5C8CB 2PHLA 2QVSB 1NCQB 2NMNA 4FCAA 1FV2A 4D7TA 1HRV2 4EV0A 1PNGA 1QQP2 1ZM1A 1QOTA 1OI6A 2EALA 3WLUA 5GZEA 2WA3A 5EV7A 4MGIE 4I0WB 4Y1ZA 2DVAA 3VHNA 1GBGA 1GR3A 1LRHA 4CP2A 4NR1A 1D0HA 4FPJA 5JDBA 1DQ6A 3VBOA 3KS7A 4I3GA 1O3RA 4QGNA 5LK7B 4A7ZA 1AYM2 4LO7A 2O1QA 1KITA 4YM0A 4ATEA 4PDWB 1LJ7A 5GLWA 3WQ0A 4CEWA 2D43A 1CAXB 2HWE2 3VKNA 1F8VA 1PO21 2D5FA 3CL1A 3ILNA 5JVVA 2ZGMA 4ZU7A 1G6NA 1BXHA 3M3EA 3M1HA 5J96B 1LOAA 4I2OA 1NY71 5BNQA 4GA9A 3LOIA 2B5HA 3QBQA 4SLIA 4NOTA 2PQQA 3X29B 2DV9A 1KFXL 1MS1A 4IEOA 3IT8A 1FXZA 2Q1MA 3VHRA 4NWVA 1LGCA 1HXS3 3U10A 2E63A 4EJRA 2VXRA 4R9DA 5H9QA 3WW3A 1RB8G 4A7YA 4HFSA 3FFZA 1DU3D 1HXS1 1KS4A 1GNZA 1XU2A 1IKPA 2H6BA 5L73A 2GSYA 4QXKA 4NPRA 2PHDA 2WZR2 3DPRA 3WHTA 1W0OA 3SMHA 4EWAA 2Q30A 4RD7A 2WFF3 1U0AA 2HWC2 4ZU5A 4RHV3 1ZZ7A 1YJKA 4IV3C 4XTPA 2WFF1 1N1VA 4LBQA 4R9CA 2O0OA 1LENA 2DVDA 4RHV1 1DGWA 1CAUB 1FOD2 1ND2B 1UF2C 1ZRFA 3KT4A 3U4XA 2R6QA 4HANA 1PMIA 3M3CA 4ZU4A 1C1LA 1F9KA 5BNOC 4AFCA 2XPJA 2O8QA 3WP4A 1QKQA 2CWSA 2TBVA 3FMGA 3H50A 3AZYA 2B7YA 1HDKA 1Q8QA 3LA2A 3RG0A 1HQLA 2EVXA 2VPVA 3FFQA 4FXGB 4Q4V3 2OVUA 4A3XA 2HWD3 2B9UA 2JG9C 4LBLA 4R4XA 2P3KA 4IL7A 3D5OA 1G9BA 1MS3A 5L7OC 1J58A 3AFKA 4Q4V1 5KHHA 4HSLA 5AFEA 1G7YA 3GBGA 2JXAA 4MH0E 4N53A 3WUDA 5E16A 2C5DA 4H7LA 4XIKA 2A75A 4P9XA 1JUIA 3JD73 4N9IA 4XXPA 1AYN2 1NE6A 3USUA 4AGVA 1AX0A 4U36A 4IV3A 3RI9A 4NHKA 5J98B 4EROA 3MI8A 4FXKB 1JOJA 3ZFFC 4BYYA 2BWAA 5JSPA 5DZFA 1LOCA 5DDJ2 1LHOA 1UZYA 1QDOA 1W6NB 1LOGA 4LE4A 1S0CA 1XQNA 2D44A 2E53A 3AMHA 1GQGA 1O4ZA 5J7MA 2YC0A 4IV1B 3M3QA 3JQWA 3NW4A 2H0VA 1BJQA 2P37A 5K9YA 3IPVB 2WNUA 2TNFA 3GZUC 3VDDB 4UW3A 4XZPA 4AEDA 2PHRA 1EP0A 2PHFA 3H3ZA 4JCKA 3NV4A 2GU9A 1ZYBA 3V0AA 5DUUA 1YLLA 2JG9A 4DZGA 1MVQA 3R4UA 1YNAA 4QQOA 5L7OA 1Q8PA 1Q8VA 1PM7A 3IDBB 4LLFA 3GBFA 2WNEA 1AUYA 1Q43A 1NCRB 4X8PA 4P9WA 3H7YA 4JGYB 2XVGA 1BYHA 4W65A 1O5LA 3VUOA 2ZGRA 5FOJB 3RJ2X 2D3PA 2YYOA 3D82A 5A32A 1GZWB 1OQEA 1UKGA 4AEKA 4LEJA 3R0RA 4DXZA 4IEUA 3ZFFA 3ZYPA 4CP0A 1PK6B 1X8EA 4NO4A 2WQZC 4FOYA 4B4PA 3VBUC 4OI2A 3JBG2 4QM9A 4GB33 2PFWA 4YVSC 4Q0VA 4PLOA 3VV1A 5CG8A 1O3QA 3U0ZA 1W6OA 1OA4A 1AR82 1PVXA 4CTEA 4GB31 4XBLA 3HD8B 1DGRN 2BVVA 1NYWA 2DCTA 1UIKA 1JW6A 2VMGA 3ZFGA 1OFSA 2P3IA 4JRLA 4UXAA 1RUF2 3CF6E 4P9GA 2ZZJA 1JUHA 1M4WA 1DYPA 5FO7B 5CFDB 2WS93 4HT1T 1E57A 2OUHA 3VBHC 2HWB2 4LO8A 4YG0A 3WD5A 3OCPA 4IEWA 1N3PA 3O7OA 1ALYA 4WVWA 2R0HA 2DYCA 2RS32 3WY6A 1WD3A 2WS91 4K3UA 4RQPA 4DPNA 2NM1A 2ENRA 2D6KA 4LULA 5J37A 1K5MC 1AR93 4YGBA 5LK5A 1H30A 4WM7C 2DU0A 3VBUA 2GN3A 4HKOA 4KH9A 1AR91 2H6CA 4YVSA 5ABJB 3RYRA 4Y22B 1QQP3 2ZGQA 3KZ4C 1DQ5A 3B9IA 4AI8A 1QQP1 3B7MA 3GHNA 3INAA 5JOYA 2BQPA 2BWCA 5FQ0B 4Z8BA 5DUXA 3HT2A 2GAUA 2PN5A 5F5QA 4M3CE 3AKRA