3HR9A

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase f40i mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMILYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucanase
publication title The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase mutant F40I
rcsb
source organism Fibrobacter succinogenes
total genus 58
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2009-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hr9A00
2D3RA 1MZ6A 2NZ9A 4XTPA 2ZABA 1CONA 4AWDA 1V6IA 1QMJA 3A0NA 1HDKA 4YZ5A 2DU0A 1AXYA 1AZDA 1BQPA 1LULA 1W0PA 1WW6A 1QKQA 1OFSA 2D6KA 4CRQA 3M1HA 1GNHA 4FP2A 1N3OA 5T52A 3V0AB 4GXLA 1AX0A 1CPNA 2R1BA 4XJWA 3WDWA 3WV6A 2GNMA 4YM2A 4PBPA 2WSUA 2A6YA 3GNEA 1QGLA 1FNZA 1BXHA 4R9CA 1ULEA 1BKZA 4GKYA 1IOAA 1LGNA 2B7YA 2D6PA 1ULDA 3DUIA 4YZ1A 1XQNA 1LTEA 2VXRA 1AXZA 4LBQD 3B3QE 5DUUA 3N3HA 2D44A 1MACA 1Z0HA 4PQ9A 4AYUA 4H55A 5DZEA 2ZHLA 2DUPA 3SITA 3WG1A 2ARBA 5AVAA 1YI7A 3VKLA 2JE9A 4K1YA 3W59A 3WHUA 5BYNA 1DQ5A 3AZYA 3D5OA 4UW4A 1G86A 3ZVXA 1S0BA 2WSVA 1MS5A 3JU9A 2GMPA 2OUHA 4YFZA 1C4RA 1CJPA 1GKBA 1V6OA 1Q8VA 2R0HA 2EALA 4YGDA 3AP6A 4XHBA 3ZPYA 3WG3A 4Y1ZA 5H9RA 1GLHA 1URXA 5KXCA 4MYEA 4XMAA 4ATEA 3BIWE 4YW3A 3H0OA 5L73A 5DXDA 2ZGTA 5CA6A 3OBTA 3NV1A 4M3CE 3IKWA 4FPKA 3ZXEA 1V6JA 4FPLA 1IKQA 1CQ9A 3OY8A 2C9AA 4BLIA 3ZYPA 2OVUA 2P2KA 3AFKA 4XJAA 2GALA 3LCPA 1SLLA 1R1ZA 1GZ9A 1UZYA 3WZ1A 2JKBA 1WW5A 2D3PA 1RINA 4ASMB 4XIOA 2UWCA 4BLJA 1KDKA 1LODA 2ENRA 1DYPA 1G9FA 3KQRA 5GM0A 5JOZA 1GZWB 1FX5A 4R9BA 2A6WA 4Y1UA 4JC1A 4YZ3A 4Y24A 1LU2A 1F9KA 2GDFA 1W6QA 2LTNA 3QCWA 1WD3A 4Y1YA 3WDYA 1W6NB 2PHWA 2ZZJA 5T5JA 3JUUA 3IPVB 2WT1A 1UZZA 4P9XA 1W6PA 3QLQA 4XBNA 2AGSA 1W6MA 1S0FA 2ARXA 4AVVA 1LGCA 2P3KA 1LOFA 3DGTA 1SBEA 1AJKA 1S0DA 5IK4A 4XJZA 1ENQA 4D69A 1V6LA 5F9TA 3WHTA 4FOYA 4YW2A 1C1FA 1LENA 3USUB 2JECA 2ZHNA 2KM2A 3WVJA 3V0BB 1DQ0A 4Y1VA 3SLIA 3RMXA 3WUCA 3OJBA 4IQPA 4YLZA 5HCAA 2NM1A 3OYWB 1QOSA 1WLDA 3AZZA 2LALA 4FPEA 2YMZA 4LBQA 2WQZC 3WDUA 1G8WA 1G9DA 5FREA 3POYA 4LBKA 5JOWA 4XZPA 3B01A 1Q8PA 1SLBA 3AX4A 4GWNA 5DZFA 1O4YA 2R49A 1GV9A 2CY6A 3HR9A 1KITA 1AX1A 2SLIA 1DZQA 4GA9A 2AENA 4GALA 4LBMA 4AVSA 2ZGMA 1S0CA 3WG2A 3U4XA 3B69A 3AJYA 2D43A 3N7MA 4FP3A 3AJZA 2P3IA 2TEPA 1DFQA 5DUXA 4YZ2A 1FV2A 1QOOA 1UAIA 2DVAA 1SCRA 2GMMA 2JD4A 2PHTA 2YROA 5EYYA 2UWAA 3ZXKA 1IS5A 4P9WA 4W65A 4UW5A 2VW2A 3NV4A 4ITCA 4ATFA 1JUIA 1ULFA 3ZYRA 1N3PA 1RIRA 2WJSA 1AX2A 1H9WA 2H0BA 1O4ZA 2VW1A 1SLCA 1SLIA 3VUOA 4DFSA 1N1VA 1GNZA 3LSDA 1MS9A 3ZSJA 5KXDA 2A75A 3V0AA 1FNYA 1SBDA 3IN9A 2VH9A 4DS0A 1DQ1A 1F31A 2DVBA 3MPPG 4FPCA 4OZXA 4YW5A 3OGGA 1SLTA 3AXDA 1WCSA 4FPOB 4P14A 5SV8A 1CPMA 2DWRA 3VKMA 1KDMA 1A78A 4XDQA 1DHKB 2SBAA 1PZ7A 3MW2A 3R05A 4XILA 3ZXLA 3O12A 2JE7A 3N36A 3N7LA 3V65A 2GN3A 1OKQA 3ZXJA 1WLCA 1NLSA 3FLTA 1AXKA 4WVWA 3RG0A 2DU1A 3FUQA 3CNAA 3UJOA 2GNDA 3NV2A 1JBCA 1GICA 3V64A 4GWMA 5T5PA 1JYIA 1DBNA 4YM0A 3TB0A 2ZAAA 3UL2A 4CZSA 4NO4A 1MS8A 2W52A 2VUAA 1MS3A 3O0XA 3MW3A 5EXOA 3SISA 5IK5A 2CTVA 2EXKA 4Z8BA 2DV9A 2PHXA 5GLUA 1S0JA 3UJQA 3PMEA 2WNEA 2GMEA 3A4UA 1W0OA 1ULGA 2YZ4A 4PCRA 1YIFA 2A70A 3POWA 2YY1A 4FOVA 1D2SA 1VIWB 1V6KA 3TAYA 3UK9A 5JLVA 2P3JA 4I30A 5EWSA 1LGBA 2NYYA 4RL7A 4ZXKA 2Z42A 5T50A 2AREA 5CAZA 3LSEA 1G9CA 1MVEA 2A6ZA 3VKFC 4ISQA 3SH3A 2G4IA 3M2MA 1MS4A 5T5LA 4BOWA 2JDZA 3ASIA 4LBJA 2BQPA 1GZWA 4FOWA 1D0HA 2ZMKA 3M3OA 4M01A 5HCFA 4LBLA 3ZSKA 4XXPA 5T55A 1W6NA 1ENSA 3IPVA 3M3QA 3N35A 1F5FA 4XMIA 2ZA9A 4SLIA 1LHOA 4XYXA 4YW4A 4HL0A 3A0KA 1S0EA 4XE9A 2EIGA 1C57A 2NP0A 1ZM1A 3WNXA 1FV3A 1H9PA 1LESA 1N3QA 3USUA 1G9BA 4K20A 4C1XA 1KRIA 1G7YA 4Q1PA 3V0BA 2ZGOA 3FLRA 1RITA 3KM5A 3WLUA 4AGGA 4AGRA 4AVTA 3AP9A 2ZGPA 1UMZA 4Q1RA 3OYWA 3R4SA 1LJ7A 2DTYA 3AP7A 1ONAA 1HQLA 1W6OB 1N1SA 1CR7A 4NOTA 3ATGA 4PBOA 1JOJA 1GZCA 4XBLA 2HYKA 2PHRA 3ILRA 1LOEA 2UWBA 2Q5TA 5E89A 1UX6A 1UPSA 1YYNA 3T1LA 5GZEA 1A8DA 1HQWA 4M00A 2A6XA 2I2SA 5CNAA 3INAA 1LU1A 5IUQA 2E51A 1N1YA 2ZMLA 1QOTA 3B00A 4XJ8A 2CWMA 3RSJA 2ZGQA 1U0AA 3WG4A 2AH2A 4K1ZA 1PZ9A 1LHNA 3PJQA 1GSLA 2VU9A 4YGCA 3N7JA 1Q8OA 1LOBA 3AYAA 3O5SA 4Q2FA 2CNAA 2A6VA 4R9DA 4XXAA 2DVDA 4YFWA 1PZ8A 2D7FA 2E7QA 5GJ6A 1LHUA 2D6NA 4FOQA 5GZFA 2DVFA 1JN2P 4YGBA 4CTEA 4FPJA 1V6MA 1FAYA 2D6LX 4Q27A 5JVVA 4DQAA 4TZDA 1LHWA 4Y22B 5EYXA 1C1LA 1BZWA 2EXIA 4JCKA 2A7AA 3BODA 2VY0A 2ZMNA 4XOGA 1BJQA 1QDCA 2A3WA 5DZGA 1N47A 1MS1A 1LOCA 1VAMA 3ILFA 3RMYA 1UKGA 5JOXA 1S1AA 3MW4A 1S0IA 3WCSA 5KXEA 5IK7A 3W58A 4WV8A 3N7KA 3I4IA 4YM3A 1MVQA 2YXSA 1LECA 2ZHKA 4M3CB 3FFZA 1QDOA 2D6MA 5DUVA 1QNYA 5F5QA 4BQ1A 1VALA 2CL2A 1UL9A 1YRZA 3AP5A 1TEIA 2A71A 2EXHA 5T5OA 2AYHA 2PELA 3ZSMA 1Q8SA 1SFYA 3GALA 1GYKA 1QU0A 5H9QA 4Y20A 3O0WA 1Y7BA 1IS4A 1LEMA 2W08A 3FLPA 3B9CA 4FPGA 3O0VA 3MEPA 4FPFA 3SH5A 1SACA 1GANA 1OQ1A 2ZACA 4DRRA 2GNTA 4Y20B 4XHXA 1UN1A 2FMDA 2WKKA 4FVVA 1NXD1 1WBFA 5CB7A 3BTAA 2R0FA 3Q9OA 1CESA 1N1TA 1LOFC 4YM1A 5T54A 1WD4A 1DQ4A 2R16A 5IT6A 2WLQA 3RRDA 4BMBA 4C1WA 1LOAA 1CIWA 2ZGLA 5DG2A 1KJLA 1I3HA 5DG1A 3WCRA 4DPNA 2RHPA 2D6OX 3FUOA 3AYCA 1X50A 2W68A 4KBBA 2JJ6A 2VW0A 2UU8A 3AZVA 5E8AA 3RQ0A 1CVNA 3AZWA 4Q26A 4AGVA 2ZGKA 2DVGA 1QF3A 2ZBJA 2CYFA 3OPZA 1CN1A 1DGLA 1DIWA 2WT0A 4Q8KA 1LHVA 4P9YA 1LEDA 3VKNA 3NWKA 1WW4A 1SCSA 4XJ9A 1Z78A 1DYKA 3AK0A 3HMYA 1A3KA 1ZA4A 4M3CF 1WUVA 2AR6A 2EAKA 2ES3A 2DURA 3D6EA 2DUQA 4U2AA 1BYHA 4TYSA 5IK8A 5GZDA 3VKOA 4YW1A 3ZSLA 1WBLA 5E88A 4UW3A 5JMCA 1ULCA 5DUWA 2UURA 5GLZA 1DQ2A 4ISRA 1W6OA 2WT2A 5GLTA 3AXEA 2XB6C 3AYEA 5FRAA 3VV1A 2GN7A 4GKXA 3POSA 4ZKTB 3WUDA 1DQ6A 4FPHA 3L2YA 3OY8B 1DLLA 1MR5A 5CBLA 4HANA 1JHNA 5HCBA 1ENRA 2V5YA 4BM8A 4U36A 4L8QA 1WW7A 3IMNA 5KXBA 4BMEA 1H30A 2P34A 4Y1XA 4F83A 1J1TA 4XIKA 5GZCA 2A3YA 2DUOA 1IS6A 4FPYA 4Y26A 4JRAA 1AVBA 1VAVA 3SNMA 2NMOA 3OBRA 3C2UA 5GLVA 2NMNA 2ZHMA 3I8TA 4UW6A 1KQRA 1YO8A 4XJUA 1G9AA 3AP4A 1W6QB 2W39A 3HN1A 2OUJA 4XTMA 1JW6A 1GBGA 2GNBA 2ZKNA 2ZGSA 2E53A 4YG0A 1W6PB 1FYUA 4WVVA 5LK5A 5JDBA 1I1EA 4K21A 1W6MB 4FQZA 1SLAA 2NN8A 4LBOA 4DRVA 2XG3A 3M3EA 2A3XA 2A5ZA 1LCLA 1APNA 4YZ4A 5GALA 1EPWA 3ILNA 3R4UA 1Q8QA 4Y22A 5H9PA 1LOGA 3WDTA 3PVEA 3ENRA 1KJRA 4WZFA 4YG6A 2DYCA 2AUYA 2FHRA 3NV3A 1WLWA 2ZGRA 2R1DA 3PVOA 2PHUA 3WDXA 4PF5A 3AYDA 4RA0A 3WOGA 3RS6A 1IS3A 2D3SA 3IM0A 4LBQB 4LBNA 3ZXFA 1IKPA 5JOYA 1QNWA 1MZ5A 2E7TA 4FQ4A 3SH4A 2C5DA 1V00A 4Q8LA 2ZGUA 1HKDA 2ERFA 2E6VA 4YG3A 3AZXA 3BOPA 1MS0A 4M3CA 4BPZA 2DTWA 3WDVA 4XBQA 5GLWA 1SBFA 5H9SA 1HLCA 3D4KA 1VLNA 1JYCA 3APBA 2V73A 2YV8A 1AF9A 3FBYA 3M3CA 4R9AA 2EXJA 2EF6A 1B09A 1V6NA 1FATA 1AJOA 4YGEA 3T2TA 3T1MA 3PVNA 2CWSA 1S0GA 1Q56A 5GZGA 2OW4A 2ZGNA 1JXNA 1YXWA 2P37A 2PHFA
chains in the Genus database with same CATH superfamily
5CKMA 1CJDA 1MZ6A 2VZ3A 2ZABA 1QJU2 4QGLA 3LA7A 4QU2A 5J96B 4AWDA 5JXIA 1QMJA 4HPKB 1UYZA 4WM7B 3WQBA 4CRQA 3G7DA 5IFTA 3NJXA 4NRQA 5T52A 3V0AB 1AX0A 1CPNA 2Q8OA 2C9KA 4XJWA 2WO7A 1JZ2A 5J48A 3KT7A 4PBPA 1J59A 3I59A 2OX0A 4GKYA 4GH4A 4CEYB 3C8XA 1AR81 2D6PA 3DUIA 3U14A 3RVHA 1W0NA 2PFWA 1LTEA 3SMHA 4LBQD 3B3QE 4HVRA 2RMU2 1MACA 5KHHA 1R1A3 3W20A 1OQEA 1O8SA 5C33A 3BPSA 1PM7A 1ND2A 1QJU3 4V2VA 2ARBA 4LQRA 5FXVA 3VKLA 2JE9A 4DXSA 2CDOA 3C7HA 2P3YA 2R30A 1MS5A 5SV5A 3GHNA 3ZFGB 1TVGA 4AQ6A 1AR72 4B29A 3AP6A 4XHBA 4Y1ZA 5FY5A 1URXA 3VD5A 4FTBA 5I8TA 3KT4A 4ATEA 4YW3A 3VBSC 4R52A 3ZFEA 4Q0UA 5IVYA 3H0OA 2G1MA 4HSJA 3VDDA 5FXWA 3KLSA 4QXHA 3KHBA 4D8MA 3JB4C 3ZM8A 3M4FA 1W04A 4ZPIA 5C8CB 4M3CE 3D0SA 1IKQA 1QXPA 5JXHA 1WMFA 3LAGA 1PNGA 1US2A 1XNDA 1SPPB 1IGOA 3ZYPA 3LKJA 3ZIWA 3LCPA 5JR7B 2Y38A 1CAXB 1GZ9A 1BEV2 3JBG3 3UT0A 2PQQA 1RINA 4ASMB 5JSRA 1H4GA 4PLNA 4AK3A 1FMD3 4JDNA 2XXZA 2VMIA 3I3EA 2VQ0A 4OLLA 3WF1A 4R9BA 2A6WA 2DFCA 2J7MA 5JI7A 1WLTA 4JC1A 3UGGA 1F9KA 2F4PA 1AR73 1WA4A 4K8RB 1MZFA 4ARXA 2WFF1 4QKFA 1JYXA 2WT1A 2D97A 1HXS1 2LM3A 2VUDA 4P9XA 4XBNA 4W8JA 5D21A 5FO7B 3UKTA 4IE5A 2WS92 3ZFFB 4WVMB 2QQKA 4KQ7A 4AVVA 2P3KA 1LOFA 3DGTA 1D4VB 4NHYA 4UWDA 5I8SA 2VD7A 5IK4A 4XJZA 4X6RB 2AC1A 4F8AA 1V0AA 3ORJA 2O1QA 2VVEA 4CDQB 3CL1A 4YWAA 1C1FA 1LENA 2VMGA 3N9PA 1R64A 4RHV2 2ZHNA 4YW2A 1XC6A 4BXSV 5FO9B 1F8VA 1DQ0A 1V9U1 1VMJA 3M8LA 2I07B 1W8FA 4LIUA 3WUCA 1RUE1 4GB32 3OUIA 4IQPA 5BNNA 5C9AA 2P17A 3OYWB 1QOSA 3FHAA 1OH3A 2YMZA 1HB1A 1G8WA 1RUG1 1KFUL 2H6CA 2PAKA 4QAWA 2BDRA 4UXAA 3H1MA 3N4MA 3OUHA 1TQ5A 1F4AA 1R093 3B01A 2JXAA 1Q8PA 1SLBA 3AX4A 3C7OA 3IDCB 4LE3A 5J09A 3KF5A 1GV9A 3WW3A 1AX1A 1US3A 2ET7A 4LBMA 4AVSA 1PNFA 4UAPA 1C28A 4E4HA 2ZGMA 1VE0A 5IYYA 1PGL2 1ZBA1 3WG2A 1H8VA 1NE4A 3U4XA 3RZLA 2D43A 1DU3D 4F7ZA 2JG9A 4OHYA 1YHFA 4QKBA 4N43A 4XFHA 1O5LA 2Y6KA 4MGIE 1QJZA 4RHV3 1XNCA 2DVAA 3WP3A 2A1XA 1UMIA 2Q1ZB 3ZXDA 4D7TA 1UXZA 4P9WA 4UW5A 4MGTA 1NT0A 3IBMA 2JB8A 5J7MA 5FIXA 2WJSA 1AX2A 1JS9A 2H0BA 1ODNA 1Q43A 3I2DA 3N9QA 4CPBA 4AF9A 1I5ZA 2CHHA 1F35A 5KXDA 2ZXQA 2A75A 4KI5M 5I93A 4CUBA 2WNVC 4WM8C 1JZ8A 1X82A 1DQ1A 2PAMA 1UYYA 1X8EA 3AXDA 1H6YA 1WCSA 1L7LA 2QTWB 4NROA 4EN6B 3NW4A 2DWRA 3IT8A 3NAPA 4UBHA 3VKMA 1CZTA 5A6YA 1XRUA 2QZ3A 1RUJ2 4XDQA 3R05A 4E2QA 3O1PA 4JX0A 4NPMA 3WQ0A 2CGPA 3MFCA 1YJKA 5LWBA 2QZ2A 3N7LA 4NPLA 5IFPA 4W4ZA 1ND3B 1OKQA 3ZXJA 1EY2A 3VBRA 3NKTA 1VB4A 5FZAA 3S57A 3AKSA 3NV2A 1GICA 2P1BA 5BNPC 1A34A 5T5PA 5LA9A 2VBPA 2OXBA 3J8F1 3VBRB 1MS8A 3T3YA 4NIIA 1O91A 2Q8CA 2WC2A 5IJRA 2BBVA 2PHXA 3OG2A 4OQ9A 2FCUA 4CXXA 4IEVA 4HN0A 2JG8C 4XFFA 3VL8A 3FC0A 1AR91 5CFDC 3JQWA 4IESA 4LIVA 3NSTA 5HBAA 1NA1C 2YHJA 3LWCA 5LBFA 1V6KA 5JLVA 1AYN1 2WAOA 1CAWA 4I30A 4IDZA 5EWSA 5EJZB 4JQRA 3S7EA 2QQNA 5ANNA 3ZKUA 2Z42A 5T50A 4EZHA 3HQRA 3LSEA 2RV9A 4WBBA 2WNUC 5CAZA 1F5JA 4ISQA 5C6CA 4QPGC 4URAA 3AKRA 5K7PA 3MIHA 4E2SA 4NWVA 3ZYJB 4CCCA 5EQUA 5FY4A 4V1PA 3ASIA 1NY72 1H8TB 1XE8A 1W28A 4P5HA 3I7DA 3BTYA 3IB3A 2BEOA 4M01A 4LBLA 2RG4A 3J26N 4CDXC 1HQNA 3DXUA 4PIZA 1ZREA 4OUSA 4I02A 4DUVA 2RDQA 3JQXA 4MUVA 1R083 1U5XA 3N35A 4LE4A 4O65A 1BCXA 2YG0A 1W9FA 4XYXA 1MEC2 1RTVA 1OD5A 3SKVA 4QPWA 2NP0A 1DGRN 2QQMA 5FQ0B 2IUWA 2QBXA 1VBE2 2YC0A 4NPRA 2ZZQA 4C1XA 4D3WA 3TEYA 3V0BA 1OFNA 2ZGOA 2RMU1 3KS7A 4AGGA 4AVTA 2B4KA 5IVFA 1JOPA 2QVSB 3N9LA 3AP9A 4W6WA 2ZGPA 3VBHC 1UMZA 4Q1RA 3AP7A 2D5HA 2X05A 1N1SA 3ZXFA 2RM22 1GZCA 4PBOA 4XBLA 4EQVA 1J3RA 1NQJA 5E89A 1HQWA 2J1SA 2G19A 3I2GA 3N9NA 4S2GA 4DZGA 1AR71 3LEGA 2V4VA 1W8TA 2E51A 2VMDA 4QM9A 5JPNB 1N1YA 1HN1A 5LEKA 2R042 4YNIA 2JIGA 3PUIA 3VBFC 3WG4A 1LRHA 2AH2A 4IV3B 1WGPA 5CIRA 5FZ1A 3MZHA 1BMV2 4N7UA 1BK1A 2JDAA 2VOVA 3IIIA 3HVDA 3N7JA 4J1XA 4K7JA 3O5SA 3LF7A 3QOPA 2W3JA 5FYYA 4XXAA 3VBOB 1QJY2 3O1UA 4AI8A 2E7QA 4A41A 1LHUA 2D6NA 3WD5A 3VBSB 1C8M1 5CFCC 1BEV1 5GZFA 1UYPA 1RUOA 1Y3TA 3S7IA 1RJ8A 1B35C 1JN2P 4ZONA 1NZIA 4TZDA 3KQ4B 1F2NA 1REFA 2XJTA 3DYPA 2EXIA 3P1IA 1E5IA 2XJVA 2VY0A 3MGUA 4MV2A 2HKXA 5DZGA 2ATFA 4LT5A 4UI9L 4A42A 3VZJA 3THCA 2WS91 1DZRA 2HBTA 4QGNA 5JOXA 2VZTA 3MW4A 2R6QA 1IZ3A 1K12A 1OOPB 4HSLA 4P5YA 3ES4A 2VMHA 4P9JA 1CIYA 2X5IC 5A7WA 4RHV1 1LECA 2W2IA 4Y3OA 4JDOA 4JTNA 3J7MA 1QDOA 5DUVA 5F5QA 4GB31 4Q4Y3 4Q4W2 3THDA 3AP5A 4CCJA 1UF2C 5FZBA 4AAXA 1FI2A 4CDUB 3WW1A 2C4XA 4QX1A 4KMQA 1QU0A 1H1IA 3NNGA 3W9AA 5FZOB 2BNNA 3O0WA 3B9CA 4CUCA 5F39A 3O0VA 3MEPA 2ZACA 2IXLA 4O9EA 1W2AX 1PGL1 2XJPA 3ZX7A 2FMDA 2MNGA 3J7HA 3MDPA 3MHZA 5D2AA 4NHKA 3ES1A 3SCHA 5A1AA 1PVC2 4XFAA 1JZ5A 5CB7A 2CDPA 3Q9OA 4CCLA 3GYDA 1TMF2 1U5ZA 1ZZ7A 4W6YA 2WDBA 1LOAA 2ZGLA 5FMBA 3WCRA 1VAKA 5DG1A 4E4ZA 4FTEA 1BBT2 1RVF2 3UETA 1GR3A 3AVSA 2IXJA 3M3IA 5L9BA 5DAXA 2BVVA 3FUOA 3AYCA 4B8EA 1GP5A 2VW0A 5FPUA 5FXXA 2XVLA 4LKEA 4RD7A 3LDKA 4CSWA 3ETPA 4A6OA 2WT0A 4P9YA 4M4PA 1SCSA 1JZ4A 1DYKA 5DPNA 5ANQA 1RUJ1 3HMYA 4HFSA 1JYWA 1A3KA 1ZA4A 2D40A 3S30A 2EAKA 2WNVB 3D6EA 2BP6A 4WM8B 1COV3 1BYHA 4HXCA 5D8AB 3VKOA 1ZVFA 3ZMNA 3ZPOA 3C7FA 1YUDA 5IVEA 1WBLA 5A1LA 2E9QA 3W5NA 4M4RA 3MYXA 3PU3A 5FRAA 1JODA 1O4TA 2GN7A 4BDVB 3POSA 4JGZA 2QQOA 4BB3A 2WRAA 3E6BA 5BNPA 4WM7C 4RGGA 4HANA 4ET7A 4BM8A 3NJYA 4U36A 1SDWA 3TN92 4AHWA 3OF1A 4BMEA 5JOYA 4Y1XA 5FDBA 3FHQA 3MLJA 4LHLA 4PIXA 5GZCA 4HOOA 2DCYA 3GZUC 4JRAA 2JX9A 1VAVA 1XE0A 2B5HA 3C2UA 5GLVA 2JG8A 3RZJA 1OLME 4NHMA 2FD8A 1XXNA 1YQCA 1W6QB 1YWKA 2D93A 1NA1A 2OUJA 2W39A 2XGXA 5F5CA 1E5RA 1OA2A 4XTMA 5DDJ3 1JW6A 4YG0A 5KBFA 2ZGSA 5LK5A 1W6PB 5KHKA 3S5QA 5CFDB 3NO8A 3CF6E 3HJRA 4FQZA 4AAPA 2ARCA 3GDBA 2JENA 5K0UC 1NY71 5FPBA 2A3XA 1Q5OA 1APNA 1ASJ3 4QPGA 4RR3C 3I2FA 3R4UA 4JV4A 1WCQA 2GC1A 2TNFA 4BXFA 2VOWA 1KJRA 4UFHA 4WZFA 2BTVC 2DYCA 4AEMA 2FHRA 2AEZA 2WNUB 1H2MA 3TN93 3WDXA 1CAUB 1H4HA 4MHUA 2E63A 4PF5A 5FYCA 3WOGA 2O0OA 3ZFGC 1SEFA 4AEKA 4CDXA 4CCOA 4LBQB 4D7YA 3ECQA 1KS4A 1MEC1 3Q8AA 3TRSB 3IAQA 4P9GA 4SBVA 1C5IA 2F6BA 2ZGUA 1VBE1 4XW3A 4YG3A 3BOPA 2VZQA 5C8CC 4BPZA 3BUCA 5GLWA 5C3OA 3RZMA 4JZRA 2CSGA 2Z2SB 1JYCA 1AF9A 4R9AA 3ALQA 3UGHA 1FT9A 1L7RA 1SFNA 1CX1A 2WZ8A 1B09A 2HWF1 4YGEA 3T2TA 1OHFA 2RM21 4QQPA 1AR83 2OW4A 2W91A 2IXCA 5L36A 4L97A 4GWJA 1NQDA 2RS12 2D3RA 2PYTA 1CZSA 1H2NA 4J25A 3VBHB 3ZLIA 3A0NA 3GXUA 2R041 2DFBA 4QPYA 1LULA 4IEZA 4O61A 4XF1A 1WW6A 1QKQA 2D6KA 3RZKA 3M1HA 3ZFFC 1JZ7A 1BMV1 1N3OA 2PHLA 4QWNA 1YCIA 4GXLA 5DQ0A 3VBFA 4MVTA 5FUIA 3WV6A 2RR12 4EYUA 3TEZA 2GNMA 2W0XA 5FZKA 2OIIA 2A6YA 2X53S 1QJY1 1OI6A 1FNZA 1BXHA 1UD1A 1BKZA 2GP5A 4LEJA 1W8OA 4NE9A 1ULDA 1IG3A 2AEYA 4IE0A 5FZ7A 4EN8B 4Z07A 2VXRA 3VBUB 1CD3G 2D44A 5FY8A 3WSOA 5CFCA 1D2QA 1TNFA 3GZAA 2W9XA 3MPBA 3OEAA 4AYUA 4H55A 1PMHX 2WN2A 2DUPA 2OS2A 4P00B 5AVAA 1YI7A 3W59A 2C24A 2WFPA 4QT6A 5CFCB 4RFT0 1DQ5A 2JDHA 3KMHA 4L9BA 1YQ2A 2WZR2 3DCQA 4LK6A 4GJYA 1S0BA 4UFLA 4AVBA 4LUMA 1NLQA 2GMPA 2OUHA 1B35B 2Z5WA 3H50A 3WW4A 1C4RA 1CJPA 4BQ4A 3RJRA 1IG0A 2E31A 2R0HA 2Y26A 4YVWC 5FY1A 5FKBA 3ZPYA 2RR13 3WG3A 1GLHA 4UOJA 4Y4YA 4OZOA 3GM8A 4XMAA 5IWFA 1GP6A 2WZEA 2ZS6B 3PUAA 3WEZA 5CISA 3O1MA 3CLPA 5FJHA 4JHZA 3RGBA 4UFKA 1HXS3 1FPN2 1NCQA 2OKXA 3OBTA 4Q4W1 4MGQA 3KV6A 1EPZA 3RJ2X 3K4ZA 5F2WA 3B9IA 4NVPA 3ZXEA 4NRMA 4AI0A 4E8DA 2VZRA 5B4NA 4GZ9A 1CQ9A 2BVBA 2EIDA 2W47A 3OY8A 4C0BA 3MIFA 4IGPA 5LA1A 4BE3A 2X5IB 4NIHA 1I5PA 2P2KA 5TSWA 2WYFA 1R1ZA 2BW8A 1WW5A 1V9U3 2GU9A 2XR4A 5JIAA 3OOXA 1QH6A 1XNAA 4I0AA 1LODA 1RUE3 2ENRA 2WZR3 2EIEA 2XONA 3GBGA 4RSUA 3KQRA 4EROA 1GZWB 4Y1UA 4X8NA 4YZ3A 2GDFA 3QCWA 1PVC1 3C7GA 4Y5TA 5FZDA 2WWUA 4ARYA 2XLAA 4QDRA 2ZZJA 5T5JA 3JUUA 3IPVB 3RWNA 1UU6A 1TMF1 2WAAA 2WO3A 3QLQA 4IGOA 3T2OA 3NVCA 3FN9A 3BU0A 1ND3C 4COZA 1SBEA 2DCKA 2XDVA 1AJKA 3HN3A 2VQTA 3VDBA 1BBT1 1RVF1 3ZDVA 1ENQA 3T30A 3RYKA 4CEWB 1V6LA 2K2SA 4UBGA 5JZGB 3V56A 5F9TA 4ES9A 1ZBA3 4Q4V1 3WHTA 4L11A 3USUB 3OBAA 3OTFA 5DMYA 3I2JA 3SLIA 3U75A 3K77A 2NM1A 3CHXA 5FZ3A 3POIA 2LALA 2ZEYA 4S2HA 5J36A 1OLRA 5CG9A 2VC9A 3ZYGA 2RE9A 4QKNA 1O5UA 4LBKA 3T4HB 5JOWA 1F15A 2PQSA 3RI8A 2V09A 3BALA 4ZHNA 5A32A 4GWNA 2PHDA 1RYYA 2VPVA 4N9HA 5E6HA 1UWWA 1YQ5A 1X33A 2ET1A 3HR9A 5JI9A 3OD0A 5FO8B 2FZ2A 2SLIA 4XF4A 2Y60A 4GALA 4I09A 1S0CA 2JDUA 2ZEXA 3AJYA 3N7MA 4FP3A 4KG0A 4AI2A 1AR92 4OHWA 2OQ7A 4ZS2A 1UAIA 3KV4A 1H8TC 3NNJA 1NE6A 1NCRB 2YPDA 3NV4A 4X6QB 1W9TA 3VZKA 3ZYRA 1YFYA 2QQUA 3MUZ1 4CTEA 3PIJA 3L2HA 4HPKA 3ACFA 4WM7A 2VW1A 5JXGA 4QPIB 1GWLA 1OQDA 3EQEA 4MH0E 4QQ2A 3PTYA 1GNZA 5EHDA 1MS9A 2OQ6A 2X10A 3V0AA 2WN3A 1VBA2 2WL1A 3J8F3 2VH9A 4DS0A 2DVBA 4DOUA 3MPPG 4OZXA 5SV8A 1SLTA 4P14A 3I3DA 5JAXA 3JB8A 4IEXA 4NJ4A 4CUGA 4EWEA 2WO1A 3DL3A 5CU1A 3X29B 3ON7A 4CEYA 1RUH1 3KCCA 1KDMA 4DO0A 3QH6A 1AR93 4CXWA 2SBAA 3MW2A 4FSJA 3WF3A 3ZXLA 3I3BA 3O12A 1JTZX 4C8DA 2JE7A 3LPFA 3W21A 1F4HA 2W1UA 3V65A 3LD8A 1AYN3 2R061 4GJZA 1UOBA 1W03A 1WLCA 1YFWA 3OSDA 1AXKA 1RUF2 2BGCA 3GF6A 4MX3A 3UJOA 4FTSA 1JBCA 2JICA 1OSGA 3VZOA 3WNPA 1PK6B 3P3PA 4CZSA 4NO4A 5K0UB 2W52A 2VUAA 4AQ2A 3ZFGA 3MW3A 1GQGA 4RR3B 3T0DA 4PT6A 4Z8BA 2DV9A 4IV3C 5GLUA 1CGPA 3AMPA 5FKCA 2VXJA 1OC1A 1RJ7A 2DBNA 3CZUA 4MGSA 2WNEA 1EUUA 1QJX2 2YZ4A 1VBC2 5JSOA 3BTZA 5A7QA 3WP4A 1YIFA 3A22A 5IATA 3I49A 4OQ8A 4DY3A 1NAEA 1VIWB 5AVPA 3TAYA 3VBOC 4IUGA 2P3JA 3AKQA 5C8CA 2NYYA 3RYPA 1HIXA 1GWMA 3I2IA 2V72A 4IEOA 4ZXKA 4CYDA 4EN9B 3A23A 1SPPA 1IPJA 3ME2A 4IV1B 5FYTA 1RB8G 1RC6A 3EMRA 1POQA 1CAXA 2RS11 3LEIA 2RMU3 5EIYB 4BOWA 4RS5B 5DAWA 3T09A 4COUA 4OI1A 5JZGA 2Q1MA 5FPLA 2FMYA 2ZMKA 3M3OA 1W3VA 2B9UA 5HCFA 1C8M2 1T6GC 3HPNA 2CGNA 1OKOA 4LORA 3CBNA 5ABJB 5BV6A 2FDJA 3I2HA 1ENSA 1W8NA 2X09A 1J83A 3WX5A 1OOPC 1JH5A 2P5BA 5FY0A 2RR11 3ZFFA 1F5FA 4WVMA 1LHOA 1PX4A 2VUJA 5JUVA 2FCVA 5A1FA 2EIGA 5K4LA 5KC5A 3MBWA 2VZUA 4KH9A 3RZHA 2Q30A 4CDQA 2ARAA 1Q3EA 4COYA 3E5XA 4K20A 2XPJA 3D3AA 3WP5A 3WLUA 4CDUC 4EN7B 4UF0B 1H1MA 2VNVA 4P02B 2VZ1A 1QH7A 4MXVA 3LB9A 2HWC2 3OYWA 3R4SA 1LB2A 1JMUB 4HBNA 2RVAA 3SC7X 1IQDC 1W6OB 4HKWA 1JOJA 2PHRA 3ILRA 4Z1VA 1HJFA 1C8M3 2Q5TA 2WZR1 2XBO2 1UX6A 1UPSA 1YYNA 5FCCA 1BEV3 1A8DA 5FP8A 4QHZA 3VD3A 4CCMA 1Y9GA 2A6XA 5C3QA 2I2SA 1ZBE2 3INAA 1CX4A 1LU1A 2B46X 4HZFA 5FPVA 1PIV1 4S2DA 4JVAA 3CJIB 5FOJB 5FK8A 4TN7A 1OVSA 2VQAA 3RSJA 2ZGQA 2V4AA 2V5DA 4GMP0 1GNYA 4XFIA 5A3MA 3ABZA 5I0DA 2VM9A 1PZ9A 2Q8EA 1C5HA 1FPN1 1LHNA 5FP3A 1GSLA 2WS93 2ZJCA 1P8JA 1LOBA 2ZX1A 2PN5A 1AL0G 4HLTA 4Q2FA 5L9VA 2A6VA 4YVWB 5FZ0A 4HT1T 3UGFA 4BYYA 3B93A 4GQ7A 1PZ8A 4YFWA 5GJ6A 4G9SB 4M0HA 2VECA 1GQHA 2MEV1 3M70A 2WLPA 3PLQA 3K75B 4FT8A 1MQTB 2DVFA 4GMP1 4LTAA 2WWJA 4GB33 4N90A 4DQAA 2YBSA 2VNOA 1ZA7A 2IVIB 5EYXA 4JCKA 2Z69A 2XUMA 2A7AA 2VBDA 2Q0AA 2ZMNA 4XOGA 1BJQA 1DGWA 2A3WA 1MS1A 4XAEA 3RMYA 4QX2A 4MXWB 5D8AC 1VBD2 5K9YA 1GWKA 1VJ2A 3HT2A 3WCSA 5IK7A 3OD4A 2Y6HA 1L7QA 3I4IA 3KHCA 5FWJA 1ND3A 2YXSA 1W90A 2YU1A 2XVGA 4AI3A 4M3CB 3A7QA 1AL22 1OUXA 4FAGA 2BZDA 5FTTC 3ZYHA 2EIBA 3K48A 3QBQA 1HRV2 1VALA 2CL2A 1YRZA 4XURA 4BIOA 2A71A 5T5OA 3TNPB 2YPJA 2VOKA 3UYJA 4B1MA 1ZX5A 2PA7A 3I3MA 3GALA 1GYKA 3K46A 1TNRA 4LO4B 2FBEA 4E9KA 4XACA 4Y20A 4BQ3A 2GC0A 1Y7BA 1LEMA 3J7LA 3FLPA 4N7IA 3I54A 3SH5A 2WA3A 2HWD2 1IPKA 2OPWA 1GANA 4IW3A 1OQ1A 1ZZ9A 4Q5OA 4CU6A 2UY9A 4Y20B 1PGW1 1KS5A 4DINB 1RXFA 1KD7A 1NXD1 4QXCA 1QJEA 2R0FA 1VRBA 3KVBA 4AEDC 2K9ZA 5T54A 5LZ6A 5FZHA 5A33B 1WMEA 1RUJ3 5C7GA 4N9IA 3RRDA 1YQ6A 2IXKA 4J6GA 1CIWA 1GUIA 4NR1A 3O7OA 4BMBA 4C1WA 2OT7A 4OFGA 5F3IA 1H8TA 5IHRA 1WCKA 2YGLA 1I6XA 4CCDA 1Y9MA 2W68A 2JWPA 2JJ6A 3MF9A 1YFXA 1RUD2 4CP0A 2UY8A 3AZVA 3RQ0A 2XL7A 3WNMA 4AEJA 1CVNA 5FZ4A 1H1AA 3WT3A 1UOGA 1VBA1 3PURA 5FMDA 2OZJA 1UU5A 3RNSA 2DVGA 2ZBJA 3BOWA 2IZWA 2OZ6A 2BYVE 2J22A 2WQ4A 5FP9A 2QJVA 1DGLA 3DXTA 2EA7A 1E5HA 3ZN6B 4Q8KA 3VKNA 2VTXJ 4Q0SA 4B3NA 1WW4A 5FQ0A 2HBUA 4XUPA 4ASKA 4DY5A 4CDWB 4EWAA 3SQOA 4LLFA 2QQJA 3M7AA 4M3CF 2AR6A 2ES3A 4U2AA 1DYOA 3U11A 3O1TA 4PLMA 4YW1A 3NJVA 3MICA 5BNOC 1GOHA 1HJGA 4QX0A 1RUF1 1UCXA 2UURA 5LEJA 1CZVA 1DQ2A 4ISRA 1EYBA 1K5MB 1HW5A 3AXEA 2OA2A 3HWJA 3Q8CA 4ZKTB 1RUD3 3WUDA 2F4LA 1DQ6A 2VOXA 3UV9A 5C3SA 3VB9A 2HWF2 4GIQA 1EP0A 2NPIA 4XFCA 1K3IA 4L8QA 4L99A 1WW7A 3K3NA 4NAMA 5A80A 4YYOA 1H30A 1SHWB 2P34A 2W87A 4XDPA 3VZNA 4F83A 2A3YA 2DUOA 1IS6A 2AACA 1QJX1 1VBC1 1AVBA 4IV3A 1EV11 2NMOA 3DPRB 5B2GB 5KWRA 2NMNA 5G05L 1UX7A 4UW6A 1OH4A 1YO8A 4B7EA 4TTGA 4LOSA 1MEC3 1RUC2 2FQPA 3HN1A 3O1RA 4EWDA 5J37A 3H7YA 4XQDA 3VBOA 3VHNA 4CVUA 2WNOA 3VBUC 5JDBA 4BQ2A 4AVCA 4K21A 1VBE3 5F6LB 5FYHA 3VBSA 4AG4A 1W6MB 4IEWA 4AVAA 4IERA 2NN8A 4MO3M 2BRTA 3POEA 3NNLA 2IXIA 2VZSA 1LCLA 4AOCA 1ZRDA 3MIGA 2FCTA 5H9PA 5HXMA 1W06A 3L9JT 3WDTA 2XWBB 2HWF3 4QXBA 1XNKA 1ODMA 5EPAA 1PVXA 1JU4A 2RM23 3PVOA 4RQPC 2TUNA 2R1DA 2PHUA 2LS6A 4PI0A 3IDBB 3AYDA 1XBFA 3WF2A 4AL9A 1UZWA 4QB1A 1IKPA 5APAA 1OOPA 3SH4A 2H6BA 2VR4A 1EUTA 4IEPA 4LKSA 2R043 4ZU7A 2FDGA 4PI2A 4BQXA 4OMDA 2ERFA 3HEIA 5IVBA 2C0ZA 1UYXA 5I0SA 3D4KA 1VLNA 2ETEA 2V73A 2YV8A 4ZU5A 2HWC1 2W95A 5I0TA 1PMJX 2BU9A 4JAAA 4BZ4A 4CDUA 3DKQA 1QJY3 2VMCA 3AMMA 4XCAA 3WNNA 3T1MA 1OVPA 2BPA2 3PVNA 2CWSA 5GZGA 4NWWA 2XBO1 3P6BA 5FZOA 3E6CC 2VNRA 4KBZA 1Y43B 2D5FA 1XU1A 2L9LA 2PHFA 3R0RA 5E1RA 1ZBE1 2NZ9A 3E5QA 4H14A 4XTPA 3P3NA 5IVVA 2PAEA 4RFRB 1KXGA 2GZWA 4PDWB 3QH7A 3VD4A 2XWJB 1PO21 3AKPA 2UYAA 4YZ5A 5A7OA 3MUY1 2DU0A 4HETA 1AZDA 1BQPA 4F3JA 4FO9A 4IE4A 4LJHA 1GNHA 1JU3A 2NLRA 3KZ4C 4KG8A 4CEWC 4YVSB 5JZGC 1JYNA 3PU8A 4YM2A 1VRH2 3GNEA 1MPXA 3RFRA 4MOAA 4CP9B 4OUMA 1QGLA 1DGRA 1ULEA 2B7YA 5FMOL 4HK9A 4RGKA 4DEQA 4AHYA 4YZ1A 5J3UA 1XQNA 1J3PA 2H0VA 4Z2WA 4JGYB 3Q8BA 5DUUA 4A2UA 1HB4A 4BCUA 1ZRRA 4Q4W3 1UIJA 4QX3A 4H7LA 5FUPA 3ZSEA 4CCKA 4ZZ8A 3KB5A 5L7OB 2ZKLA 4MGYE 4Q4V2 2QE3A 5DZEA 5LBBA 4A6SA 3SITA 4YPJA 3I2KA 1W9SA 1UIKA 2JKXA 2VZOA 4UW4A 5A7NA 4JRLA 1G86A 1OF4A 2VQUA 5FP4A 3ZVXA 3CU7A 4FFFA 1VBD1 4D6RA 4YFZA 3Q8FA 4PQQA 1V6OA 4YGDA 2WNVA 4WM8A 1NLRA 1UY3A 5D8AA 5JPMB 4MYEA 1PVC3 5LBCA 3VDAA 3BIWE 4E2GA 3THPA 2I74A 4NMIA 1AL21 5L73A 4Q4X2 3VDCA 1TMF3 5DXDA 4CU9A 1NCRC 3RYRA 5CA6A 1HRV1 2HWE1 4H2AA 3NV1A 5LRSA 3BTXA 2AZ5A 4FPKA 1V6JA 3WR0A 4I3GA 4CPBD 3AL5A 1BBT3 1RVF3 2C9AA 2J1TA 4QPIC 4XQ4A 4BLIA 2OVUA 4Q4V3 2WIIB 2J1UA 3AFKA 3BN6A 4HN1A 1SLLA 1UZYA 2W46A 3NMBA 4OUEA 5DABA 2D3PA 2HWD1 1HB2A 4D6SA 1WCDJ 3RDIA 3U0ZA 4DNYA 2UWCA 4XF3A 1KDKA 5KHGA 4A7YA 1G9FA 2WQ8A 2ZEWA 3MV11 5JOZA 5LY1A 3U37A 2HJIA 1RMU2 3FBMA 1W6QA 2LTNA 1UXXX 1WD3A 3EB7A 3UKVA 1O8PA 1QXRA 1W6NB 3T0BA 2P6CA 4XUNA 1SZBA 1UU4A 3H1YA 1UZZA 4CU8A 5KHIA 1W6PA 3DECA 1YC61 3TNQA 5ACA2 1LR5A 5CFDA 2RDSA 1C3HA 2ARXA 1S0FA 2W92A 4A45A 4G3YC 4Q4X3 4QQOA 4TXWA 3WP6A 1H0BA 4CUAA 3NRUA 4D69A 4QDSA 2XVKA 1RUH2 1ULOA 3FFQA 2PLV2 4LULA 3TEXA 3O1OA 1RUD1 2KM2A 3PTRB 1PK6C 4Y1VA 4AEDB 1D0GA 2KD7A 3CEWA 2WNUA 5FLIA 3B94A 3RMXA 4XUQA 1CAUA 2ZCWA 2R7EB 1QQP2 3LEMA 4YLZA 5HCAA 5JMOA 1WLDA 2R062 3OUJA 4LBQA 4FPEA 4KU8A 5C3PA 3LGRA 1DZTA 3R6SA 2VVDA 5FREA 1TE1B 2Q4SA 5DZFA 3ZYIB 1O4YA 1YNAA 2FDFA 5FUNA 2R49A 3NKGA 5I8YA 4GWIA 5BUVA 1KITA 3PDQA 1DZQA 1U5IA 4AXOA 5A3UA 1RUNA 1E5SA 4GH4C 1XSQA 4IV1C 4OI0A 1RUI2 3ZKYA 1W9YA 2P3IA 5C5UA 1VMFA 1AR62 4Z2AA 5BNOA 1RUH3 2J42A 2WBKA 3MIBA 2JD4A 2YROA 3KV9A 4RS5C 5I0UA 1YQ8A 2UWAA 3MLKA 1IS5A 1ENXA 2B39A 3B5LB 4MADA 3ZXKA 2DDUA 1HN0A 4FCAA 1YEWA 1ND2C 2VW2A 4ITCA 1O3RA 1JUIA 1X9TA 2R063 1N3PA 5FLHA 2QKDA 2RS32 3VBHA 3T2QA 5ABJC 5BNOB 2CAVA 2YUEA 5AC92 5K8SA 2BWAA 4A4AA 3VUOA 3KT1A 2ZOEB 3HNBM 2YU2A 3LSDA 4QDQA 2VMEA 4JKMA 3GZEA 1FNYA 1FOD2 4KWKA 1SBDA 4CP2A 3FMGA 4YW5A 1RUC1 4P08A 1Z7S2 3ST7A 1IHMA 4FPOB 4N53B 1UY2A 5JXJA 3GGLA 1LKNA 1CPMA 4QHBA 4I3PA 3DEMA 4Z82A 3U78A 4CXYA 3DKWA 3EHKA 1OPOA 4MLOA 1RUI3 4QM8A 1DG6A 1O3TA 4QB2A 1QIQA 1AR63 1XNTA 4QHOA 4XILA 1PZ7A 2B42B 5FK7A 3VBUA 4B7KA 3OGRA 4COWA 2IWGB 4ES8A 1ULPA 2GN3A 3D8CA 4CE8A 2Y64A 4I2OA 3FLTA 3GCWA 1CWPA 4FXGB 3KSCA 2HYXA 3RG0A 2DU1A 3AMQA 4GWMA 1VR3A 4E8CA 1JYIA 1DBNA 1JI6A 3DV8A 4QU1A 4YM0A 2ZAAA 2ADDA 3C3VA 2RS13 2O8OA 4J1WA 1B35A 2Y0IA 3CJIC 3U07A 4LO7A 5EXOA 3ZR5A 4XUOA 1O3QA 2CTVA 5B4XA 1IQAA 3UJQA 1K42A 2YFUA 3BKZA 1CAVB 1GOGA 4RQPB 3A4UA 4PCRA 1ULGA 3LZZA 1STMA 2F17A 2A70A 3POWA 2YY1A 4FOVA 5F5AA 2WABA 1PIV2 5LRRA 4DIQA 4K8FA 1VBB2 5BY5A 1LGBA 4R4ZA 5FZMA 1JOBA 4RL7A 1MQTC 2X5IA 1G9CA 3PUHA 2EVXA 2QNKA 3VKFC 3SH3A 5JSPA 5C9AC 2FDIA 4YARA 3NQHA 5ERLA 4K40A 2JDZA 4W6XA 4MSVA 3ACLA 3BYWA 3O1SA 4WVZA 1EAH2 2BQPA 3AMNA 4K9SA 1GZWA 4FOWA 4NHLA 5J1XA 2MEV2 3VN4A 2XUEA 4XVHA 2W94A 1UOJA 4XXPA 4AFAA 2J1EA 4HK8A 4LXLA 3IPVA 1KGYA 4LHNA 4LA2A 1W05A 1M06G 2RDNA 4JDMA 3POFA 3H3UA 4BWOA 2BOJA 3K3OA 1VRH1 3GCXA 4HL0A 1S0EA 2JG9C 4P9LA 1PIV3 5C4WB 2XKPA 3AB0A 4CEWA 2WZPP 1ZM1A 3GZTB 2YB7A 5HXVA 4JTOA 4Y5Z0 4ZU4A 3WNXA 1LESA 3ZN5A 3USUA 1ZRCA 1YLLA 4ZS3A 5A3WA 2VULA 1FPN3 1RITA 4AGRA 2R072 2HEYF 1JUHA 1W39A 1J1LA 1HRI2 2XQRA 4KGGA 1OT5A 5FYIA 2XL9A 1H2KA 5FZ6A 1CR7A 1O59A 3ATGA 4NOTA 4YRDA 4DXRA 5FR3A 2HYKA 2JB4A 4IE6A 1LOEA 2MEV3 2UWBA 4FFIA 3T1LA 5A70A 4FBFA 5FZLA 4GMP3 4M00A 5FZGA 3A21A 3HNMA 4CP1A 3ZIXA 4AFMA 2BNOA 3H7JA 3HQUA 4XUTA 3DYOA 1RHI1 2EAAA 1OF3A 3RPQA 2RS52 4XJ8A 3WINE 4QQHA 3AMHA 4XC9A 4Q4X1 4AI9A 3TEWA 5IVJA 4MG2A 2VU9A 4YGCA 3VZMA 3ZXAC 3MFAA 4UFMA 4I01A 2VJXA 3OGSA 1PGW2 4YW7A 3SXWA 2CNAA 4TLGA 1NCRA 2R073 4R9DA 3AKTA 3ZR6A 2DVDA 3RZGA 2VNGA 1PO12 4XF9A 4FOQA 4ORFA 1UQXA 4QPIA 5LBEA 5EP9A 2XH6A 5A6QA 1FAYA 1X36A 1LHWA 4Y22B 1RMU1 3E6DA 4D94A 1VB2A 1BVVA 2DBIA 2JIJA 1QDCA 2W1SA 4CDWC 5CEHA 3WW2A 3ZDSA 2WUHA 3ILFA 5ACA1 2O8QA 3D0JA 5CVRA 3N9MA 3BB6A 2XHKA 1S0IA 2C6SA 5KXEA 3W58A 4R4XA 2Y6GA 4GULA 3N7KA 4YM3A 1K5MC 4QKDA 3J4UH 2PLV1 1RL3A 4BQYA 2B8MA 2D6MA 5LA0A 5A7PA 3WNLA 5HCHA 5FY9A 1QQP1 1R1A2 1PK6A 1TEIA 2IVJA 2AYHA 4EV0A 2PELA 4HG6B 5K0UA 4XAAA 3ZSMA 5A3LA 2Q8DA 1DCSA 4GAZA 2G9FA 4QMAA 4RR3A 5H9QA 3K2OA 3H8UA 2HH9A 2I45A 1IS4A 3DPRC 2W08A 5KHJA 3KGZA 4FPGA 3PIGA 4QD2A 4FPFA 1SACA 1SFPA 2BUKA 5HPOA 5F32A 2WA4A 1VBA3 4DRRA 2VO5A 3UESA 3WNKA 4XHXA 5HI0A 3WXPA 3LIHA 2HEWF 5DAPA 2YDEA 1RUI1 4AQSA 1DLCA 2FDKA 2BV4A 1U12A 4META 1AR61 1YFUA 1CESA 5CYYA 4YM1A 1EV12 4KNCA 4S2FA 1WD4A 1H2LA 4IV1A 3AL6A 2R16A 3DN7A 3QACA 2CAUA 5IT6A 2WLQA 3J7NA 3HQXA 5DG2A 1KJLA 1JZ6A 3I59B 4RS5A 3WF4A 5JWPA 2VZVA 4DPNA 2RHPA 2RS31 4GH4B 3OCPA 2VTXA 5EZWA 2DCTA 5AC91 2YYOA 4D0QA 1XB9A 4I0BA 2XOMA 1RUF3 4KBBA 3TOJA 3JBG2 2UU8A 4NIAA 5ABJA 5FP7A 4W50A 4AGVA 1UOFA 1FOD1 1FMD2 1QF3A 4L2NA 5FXZA 1Z7S1 2CYFA 1ND2B 3OPZA 4Q0PA 3VHPA 5JIUA 4PHZA 1DIWA 3HAGA 5CADA 4LNVA 1LEDA 3NWKA 1Z78A 3GBWA 1QJX3 2BOIA 1VBC3 4HVQA 2LW8A 1WUVA 1EV13 5FWEA 2DURA 3S0MA 2RJKA 2ORZA 4TYSA 4UF0A 4DB5A 4EE2A 5AFBA 4UFJA 5IW0A 3ZSLA 3UKNA 5E88A 4UW3A 3ZN4A 3ZFEB 5DUWA 1XU2A 3VDDB 1OXCA 1W6OA 2WT2A 3BPZA 2XB6C 3VV1A 2QCSB 1OURA 4GKXA 4AI1A 3VHRA 4COVA 2YC4A 4PDWC 3ZO0B 2YBKA 4FPHA 4PF1A 3L2YA 2XQXA 2LROA 3JD72 2ID4A 4FI9A 5CBLA 3LFIA 2P6HA 2J1RA 4UT5A 5KXBA 3P5BA 3T4VA 3CJIA 1R092 1O6UA 4FPYA 4Y26A 3TBDA 5LY2A 4B1LA 1NXMA 5A3PA 1UPIA 4YVSC 1XPWA 4AR2A 1I9RA 1TME1 2ZHMA 2W1QA 4C90A 1KQRA 4HKOA 4XJUA 1PO22 1VBB1 4BJ0A 2HEVF 1D4M1 4YVWA 2YBPA 1X7NA 1YI9A 1NKGA 2E53A 1I1EA 1FYUA 4JGYC 2E33A 4XEZA 2WR9A 2XKOA 1S2BA 2Y34A 5A3OA 4MGKE 3WF0A 5EV7A 2BFUS 2QQWA 1MQTA 4FXKB 3ZOIA 5L7OC 4H7MA 2MPFA 2ORXA 2XG3A 3M3EA 4YZ4A 1EAH1 4K3UA 3ILNA 1BK0A 3HT1A 2HWC3 1Q8QA 4KU7A 4FFHA 1WCUA 3JD73 2WYSA 3ENRA 1UY1A 2AUYA 3NV3A 1WLWA 2ZGRA 2XBO3 1OD3A 4QX5A 5BNNB 5C9AB 3RS6A 1VP6A 2VL4A 5A7SA 5JR2A 3IM0A 4MXWA 1ZBE3 4QX8A 3EXUA 1NYWA 4MGZE 4OCTA 2Q1FA 1MZ5A 3KD4A 1PO23 2C5DA 4BA6A 1HKDA 2A73B 1W9WA 2E6VA 3AVRA 5FZIA 1J3QA 3AZXA 4CCNA 4M3CA 1OUSA 3WDVA 1W3XA 4Y5SA 2R071 5H9SA 1RGSA 1HRI1 3M3CA 3HNYM 3KWVA 3GHMA 1POV0 5EFUA 2XLFA 3SEPA 2EXJA 2JE8A 2EF6A 4QXKA 4B4RA 2JG9B 1FATA 1AJOA 2HWB2 4G4FA 1HV1A 4N43B 3CMGA 1Y9QA 4XFGA 4IXLA 3G6JB 1AUYA 2ZGNA 4GD4A 4BH9A 1JXNA 1PMIA 1YXWA 2HWE2 2P37A 4AFCA 1ZZ8A 1REEA 4OVEA 3PNAA 3BGAA 1CONA 4LOTA 2KR2A 2QDRA 1HX6A 3THTA 1V6IA 5L9RA 2RS51 1HDKA 3NL1A 1BLZA 1POV1 1AXYA 1W0PA 1OFSA 3OPTA 1UY4A 1YIPA 2JEMA 4FP2A 2OYZA 2R1BA 2BWCA 2XMLA 2ZEZA 3WDWA 5FBZA 5A33A 2IXHA 1VBD3 4JKLA 4L92A 5F8PA 2WSUA 3IMMA 4MHRA 4XETA 3O14A 2HLEA 3FZ3A 3IDEA 1Y4WA 3MIDA 3NAPB 2ZPXA 1PO11 4R9CA 3VZLA 3LOBA 1IOAA 1LGNA 4URTA 5LW9A 3ITQA 2HWB3 4WZCA 5DAQA 1AL23 3IAPA 3JZVA 4JGZC 1WA6X 1AXZA 4DXZA 1XSRA 5E16A 5LA2A 3N3HA 5LK7B 1OBNA 1Z0HA 1HRV3 2HWE3 2X29A 4PQ9A 3KCXA 4IEQA 5FMOS 5F6KA 3WQ7A 4EN0A 2ZHLA 3WG1A 4QX7A 3ZN6A 4K1YA 3WHUA 5BYNA 5L19A 3AZYA 3D5OA 3EYPA 2JDYA 4OMCA 2IC1A 4FFGA 2WSVA 1R082 3JU9A 2HWD3 4CDWA 4KWLA 4YW6A 1GKBA 4NN0A 1Q8VA 3C7EA 2EALA 3MV01 5F3CA 1S2EA 2FDHA 5H9RA 5KXCA 2Y8KA 2N7GA 1K5MA 1O7FA 2ZGTA 1R1A1 4DUXA 4ZZ5A 4OHVA 1CAWB 3IKWA 4FPLA 4OULA 1QJU1 3OEBA 3AM2A 3CJXA 2RJ2A 2CGOA 5FBJA 1BHGA 1W2NA 5FZCA 5LCWL 2XHNA 3FWEA 5FPXA 4BU2A 1OA4A 4XJAA 2GALA 3WZ1A 3NJZA 2JKBA 2YGMA 5G04L 3E97A 4XIOA 1ZZCA 3DPRA 1DYPA 4N53C 5GM0A 1QJFA 3VD9A 1FX5A 2YFZA 1JHJA 4Y24A 1LU2A 3KCYA 3SKJE 3WDYA 4Y1YA 1QXJA 4RN5A 4H3WA 4BK5A 2PHWA 2IFRA 1T2XA 1SG3A 2O14A 2AGSA 1W6MA 3VD7A 1LGCA 2BFUL 5F5IA 1S0DA 3LDBA 1A6CA 4ZXEA 4LKFA 3E5UA 4FOYA 4ZY9A 2JECA 2VZPA 2ZX4A 1DP0A 3JBG1 3WVJA 3V0BB 4AW7A 4LITA 1FMD1 3OJBA 1KEXA 5A3TA 3BVCA 2ZX2A 3I3QA 3WDUA 3AZZA 3MO4A 3CIHA 4A3ZA 2WQZC 2GH8A 3H3ZA 1G9DA 1GOFA 3F2ZA 3POYA 2JDNA 4XZPA 2E26A 2QQPA 1UZVA 4CU7A 3KF3A 5F1RA 5C71A 1DGWX 2CY6A 2CV6A 5FYUA 1ACCA 3GBFA 4GA9A 2AENA 4XABA 2J1VA 3H9AA 1ZZBA 1KFXL 1W8WA 1RUC3 4NAOA 4XF0A 2VVFA 4Y4RA 2GP3A 3B69A 2VE1A 2VMFA 3AJZA 2Y33A 2TEPA 2W5FA 1XYNA 3POBA 3URFA 1DFQA 4ONUA 5DUXA 4YZ2A 1FV2A 1QOOA 2GMMA 2PHTA 1PHMA 1K5JA 1SCRA 4M0NA 4Q4Y2 5EYYA 5FZEA 5T3NA 1E57A 3DYMA 4W65A 1W8ZA 3JD71 4IETA 1AHSA 1W8UA 4ATFA 1ULFA 5AFEA 4PDWA 5LASA 1RIRA 4E4DX 2ZX0A 1H9WA 5FJKA 1XE7A 4AHZA 3RWKX 1R091 1O4ZA 1SLCA 1SLIA 4DFSA 1N1VA 1UNBA 5FFOC 3K4AA 1X8MA 3ZSJA 4BQ5A 5FZ9A 4CCEA 3IN9A 5C4WC 4FPCA 1F31A 4XFBA 3OGGA 1ZRIA 4YVSA 2UYBA 2RDRA 4CP9A 2GAUA 4UFIA 3F95A 3NNFA 1WWYA 2DF7A 3LEKA 1NCQC 4BHPA 4BQWA 2BGOA 1LAJA 1GZTA 1A78A 1UKRA 5LB6A 1DHKB 4JGYA 5F37A 3CDZB 4D7SA 3N36A 3QD6A 4LK7A 2JDKA 4ASLA 2KA3A 3HD8B 5A7WB 2QFEA 3EBRA 1NLSA 5FLJA 5L7OA 4WVWA 3FUQA 1SQ4A 3CNAA 2XJQA 3TYJA 1QHDA 2GNDA 4A7KA 3V64A 5CG8A 3TB0A 1ZNPA 4EJRA 2XJSA 3UL2A 3LDRA 1MS3A 3O0XA 5FPAA 3SISA 5IK5A 4LKDA 4B4PA 2EXKA 1D7PM 2VCBA 5C70A 1S0JA 1S2KA 2TBVA 3PMEA 2BJSA 2VUCA 2GMEA 1W0OA 4NHXA 4Q0VA 4IGQA 5HV4A 2G9GA 1XJAA 3EO6A 1XOYA 1D2SA 1COV2 1RHI2 3UK9A 3OPWA 1VRH3 1VMHA 1PX3A 2HWB1 3LE0A 4O9GA 3ELNA 2AREA 3AC0A 1MVEA 1SDDB 2A6ZA 1J84A 3ZMOA 2G4IA 3M2MA 4DXTA 1MS4A 5T5LA 4C0HA 4LBJA 3T0AA 2FZ1A 1D0HA 3FX3A 2Y6LA 2R32A 4FAHA 5DN2A 1W2OA 2E7AA 2E32A 3ZSKA 5T55A 1W6NA 4LR4A 4E4SA 3LA3A 2VBBA 4INDA 3NNMA 1YJLA 4PJYA 4E27A 4Q0QA 3M3QA 2PXJA 4KL1A 1AYM2 2VG9A 3LOIA 3WY6A 4XMIA 4X8PA 2ZA9A 1GP4A 3IZOA 4SLIA 4YW4A 3CKHA 2XJRA 1UY0A 3A0KA 4XE9A 3MLLA 3DF0A 1RHI3 1QWRA 3JCIA 1C57A 5DDJ2 5A6XA 1WMXA 4OHXA 1FV3A 1H9PA 2QQVA 1N3QA 1W2UA 5I0RA 1G9BA 3OBZA 1KRIA 1G7YA 1X9PA 3ZYFA 4Q1PA 3FLRA 3KM5A 4AEDA 2G9ZA 4AQTA 2LUWA 3SHRA 2K46A 3I97A 4HVOA 5C5TA 1ASJ2 2ZX3A 3D82A 3FHIB 1O3SA 1LJ7A 1LNSA 2DTYA 4IEYA 1ONAA 1HQLA 4TSVA 2VTFA 4BLJA 2OPKA 4JGZB 5GZEA 1R081 4OYUA 4OI4A 2GH2A 5GKAC 5BNPB 3FJSA 3FL7A 4OHZA 3RZZA 5CNAA 3WQ1A 4CA9A 3GJBA 4YSFA 3PUSA 4TWTA 1AYM3 3K4DA 5IUQA 3FE5A 3WNOA 1RMU3 2ZMLA 1U5YA 3PVBB 1QOTA 3B00A 5F2SA 2CWMA 4CEYC 4AFBA 1U0AA 5JCTA 3POJA 2VCCA 1ZRFA 3E1F1 4K1ZA 3VL9A 2X8KA 3PJQA 4XQWA 2JG8B 4PLOA 5ACA3 4KWUA 3OGVA 5A6ZA 2BBAA 1Q8OA 1NG0A 2CU5A 1XNBA 3AYAA 5FY7A 1NA1B 2Z79A 1ZZ6A 1PM4A 5HV0A 2D7FA 1XYPA 4P9IA 4IE7A 1BVP1 2PLV3 1AR82 3SEEA 4LPLA 5DAVA 4NIGA 4NUBA 2VAUA 5FPZA 2Y0OA 1SMVA 2D98A 3LIGA 1NUKA 4QQLA 4YGBA 4FPJA 1QQP3 1V6MA 2D6LX 1NOVA 4OI2A 4Q27A 4QPGB 5JVVA 4B4QA 4LLOA 4IEUA 3H3LA 5FMCA 4JQTA 1C1LA 1BZWA 3EJKA 4AE2A 5C8WA 4LO5B 3IIAA 3BODA 4N53A 1N47A 1LOCA 1VAMA 1S55A 2BERA 4CDXB 5F7UA 1UKGA 3N9OA 3KV5A 1OLQA 1JZ3A 4LA3A 1S1AA 3ACGA 5FYZA 2WWSA 5CKQA 3KGLA 3PMSA 5FZ8A 4WV8A 1GU3A 3U10A 3VDDC 3H42B 3ZFEC 4AFDA 4LHSA 4LO8A 1MVQA 4NRPA 3PL0A 1OA3A 2ZHKA 5D1IA 3FFZA 4BQ1A 1QNYA 3HOBA 3CQOA 3ACHA 1NZCA 1ST8A 1UL9A 2Z4FA 2EXHA 4TLFA 4DMIA 5FYSA 1Q8SA 2W1WA 1NX9A 1SFYA 1HB3A 1ZYBA 2YC2A 2RS33 5AC93 1K45A 2BGPA 2GC3A 2WINB 3JXSA 3MIEA 5FAXA 5A3NA 1CAVA 1OLMA 1T6BX 1VPHA 4RQPA 4BISA 3LFMA 4EZ4A 3TWIA 1FOD3 2GNTA 2JDMA 5M0TA 3IWZA 2VCMA 1UN1A 4O7XA 1Z7S3 2WKKA 3ZYBA 4CDQC 4FVVA 4AZZA 1L3JA 4HKLA 3CO2A 2BNMA 1WBFA 3ACIA 3RI9A 3BTAA 2WFF2 1H6XA 3J9SA 1N1TA 1LOFC 5IAVA 3T2PA 3VBFB 1HXS2 1TZOA 1DQ4A 4Q4Y1 4XZUG 1TME2 4R8HA 3VGIA 3ETQA 2DCJA 2J1AA 2K0GA 4K6BA 5FV3A 3PJYA 4V2WA 1I3HA 1D4M2 2WO2A 1MZEA 3HIFA 1G6NA 1JYVA 1A8MA 3HBZA 2D6OX 5BXXA 4Q29A 5CKNA 2P4EA 1X50A 3OGJA 2PTMA 5BNNC 3LQCA 1WZXA 5FZFA 4IL7A 1V9U2 5E8AA 4A7ZA 2C26A 3AZWA 1ALYA 4Q26A 2DCZA 1RUE2 5LATA 1DF0A 2ZGKA 5KC6A 2MHFA 4QGMA 3H8XA 1V70A 1RUG2 1CN1A 1LHVA 4XCBA 1FXZA 2QQIA 2B9VA 5C4WA 5IAXA 2VGDA 1HV0A 3MI8A 4XJ9A 3AK0A 4LHKA 4PIYA 5EJ3A 3USSA 1OPMA 2WFF3 3W5MA 4KGQA 5KR7A 3KVAA 2DUQA 1WMDA 1TME3 5IK8A 5GZDA 1VBB3 4N8MA 4N43C 1M4WA 3GJAA 1ZBA2 1D4M3 4RGAA 3PUQA 5JMCA 3LA2A 1ULCA 5GLZA 2Y6JA 3SCGA 5GLTA 2RJLA 3AYEA 1NCQB 4A3XA 5C3RA 3K51A 2VOTA 3U4SA 5FYBA 4XPVA 3T08A 3OY8B 3MF6A 1DLLA 1GQPA 1EAH3 1MR5A 2Y6FA 3HBKA 5J98B 1JHNA 5F3GA 5HCBA 2ILMA 1ENRA 2V5YA 5FYMA 2GC2A 3IMNA 4JKKA 1RUG3 1J1TA 4XIKA 4Y33A 4D6QA 2ADEA 5I91A 4I0WB 3SNMA 3ZXGA 3AFGA 3BCWA 2KXLA 3OBRA 3OB8A 3ROUA 4AHXA 3POGA 1COV1 2PMWB 3BI3A 4LMFA 3I8TA 4NIDA 3NAPC 3CZJA 1G9AA 3SCFA 1REDA 2QQLA 3AP4A 3VLBB 4UYBA 2ZTNA 1GBGA 2GNBA 2ZKNA 3PHMA 4WVVA 2NQYA 5FOBB 2XJUA 3UNPA 5EJ1B 4Z92B 3VHOA 5BNQA 1UZ0A 4HONA 1SLAA 4MZUA 4DEVA 1GMMA 3S5AA 4KWJA 4QB6A 5F3EA 4LBOA 3VBRC 4DRVA 5GALA 2A5ZA 1DDLA 2JDPA 3S6PA 4DUWA 1HRI3 1EPWA 4LO6B 4Y22A 1LOGA 2C1FA 3LPGA 4XDOA 3Q8EA 3PVEA 1W2TA 4YG6A 2LRPA 2XLGA 1JYTA 3B7MA 5CZKA 3H8OA 4RA0A 4JHTA 1J58A 1AYM1 1IS3A 1S4CA 2D3SA 2VCAA 3J8F2 4LUKA 4LBNA 1IPSA 3H1WA 2EICA 4HMZA 3IDAA 4RYDA 1W99A 1QNWA 3BIEA 2E7TA 4FQ4A 5DDJ1 3I2OA 2RS53 3U1XA 1QEXA 1POV3 1V00A 1WKYA 4Q8LA 5A32B 1UW8A 4BIFA 1W8HA 3O1VA 1QY4A 1MS0A 1UO9A 5FYVA 5BPXA 2DTWA 4XBQA 1SBFA 4BK4A 1HLCA 2QUOA 1ASJ1 2JD9A 3APBA 3FBYA 2B45X 3B02A 1GFF2 4L0PA 1AYN2 1OMIA 1UMHA 1XYOA 2QDNA 5ISLA 1V6NA 3BU7A 4A44A 3H8RA 1C8NA 1PO13 2ZAHA 3R4DB 1TG7A 1S0GA 1Q56A 2GSYA 1RXGA 2IFWA 3TN91 5IVCA 4C91A 1PGSA
chains in the Genus database with same CATH topology
1CJDA 1MZ6A 2ZABA 1QJU2 4QGLA 3LA7A 4QU2A 5J96B 4AWDA 1QMJA 4HPKB 4WM7B 4CRQA 3G7DA 5T52A 3V0AB 1AX0A 1CPNA 2Q8OA 4XJWA 5J48A 3KT7A 4PBPA 1J59A 3I59A 4GKYA 4GH4A 4CEYB 1AR81 2D6PA 3DUIA 2PFWA 1LTEA 3SMHA 4LBQD 3B3QE 4HVRA 2RMU2 1MACA 5KHHA 1R1A3 1OQEA 5C33A 1PM7A 1ND2A 1QJU3 2ARBA 3VKLA 2JE9A 2R30A 1MS5A 5SV5A 3GHNA 3ZFGB 4AQ6A 1AR72 4B29A 3AP6A 4XHBA 4Y1ZA 4FTBA 1URXA 5I8TA 3KT4A 4ATEA 4YW3A 3VBSC 4R52A 3ZFEA 4Q0UA 3H0OA 4HSJA 3VDDA 3KLSA 3JB4C 3M4FA 5C8CB 4M3CE 3D0SA 1IKQA 1QXPA 1WMFA 3LAGA 1PNGA 1XNDA 1IGOA 3ZYPA 3LKJA 3ZIWA 3LCPA 5JR7B 2Y38A 1CAXB 1GZ9A 1BEV2 3JBG3 2PQQA 1RINA 4ASMB 5JSRA 1H4GA 4PLNA 4AK3A 1FMD3 4JDNA 2VMIA 4OLLA 2VQ0A 4R9BA 2A6WA 2DFCA 5JI7A 1WLTA 4JC1A 1F9KA 2F4PA 1AR73 1WA4A 1MZFA 2WFF1 2WT1A 2D97A 1HXS1 2LM3A 4P9XA 4XBNA 5FO7B 3UKTA 2WS92 3ZFFB 4WVMB 4KQ7A 4AVVA 2P3KA 1LOFA 3DGTA 1D4VB 5I8SA 5IK4A 4XJZA 4X6RB 4F8AA 4CDQB 2O1QA 2VVEA 3CL1A 4YW2A 1C1FA 1LENA 2VMGA 4RHV2 2ZHNA 5FO9B 1F8VA 1DQ0A 1V9U1 3M8LA 2I07B 3WUCA 1RUE1 4GB32 4IQPA 5BNNA 5C9AA 2P17A 3OYWB 1QOSA 2YMZA 1G8WA 1RUG1 1KFUL 2H6CA 2PAKA 4UXAA 3H1MA 3N4MA 1TQ5A 1R093 3B01A 2JXAA 1Q8PA 1SLBA 3AX4A 3IDCB 4LE3A 5J09A 1GV9A 3WW3A 1AX1A 2ET7A 4LBMA 4AVSA 1PNFA 1PGL2 1C28A 2ZGMA 1ZBA1 3WG2A 1H8VA 1NE4A 3U4XA 2D43A 1DU3D 4F7ZA 2JG9A 4OHYA 1YHFA 4N43A 4XFHA 1O5LA 4MGIE 1QJZA 4RHV3 1XNCA 2DVAA 3WP3A 2Q1ZB 3ZXDA 4D7TA 4P9WA 4UW5A 3IBMA 5J7MA 2WJSA 1AX2A 2H0BA 1Q43A 3I2DA 4AF9A 1I5ZA 5KXDA 2A75A 5I93A 2WNVC 4WM8C 1X82A 1DQ1A 2PAMA 1X8EA 3AXDA 1WCSA 4EN6B 3NW4A 2DWRA 3IT8A 3NAPA 4UBHA 3VKMA 1XRUA 2QZ3A 1RUJ2 4XDQA 3R05A 4E2QA 3WQ0A 2CGPA 3MFCA 1YJKA 2QZ2A 3N7LA 1ND3B 1OKQA 3ZXJA 1EY2A 3VBRA 3NKTA 1VB4A 3AKSA 3NV2A 1GICA 5BNPC 5T5PA 3J8F1 3VBRB 1MS8A 1O91A 2WC2A 2BBVA 2PHXA 4IEVA 4HN0A 2JG8C 4XFFA 3VL8A 3FC0A 1AR91 5CFDC 3JQWA 4IESA 3NSTA 5HBAA 1NA1C 2YHJA 3LWCA 1V6KA 5JLVA 1AYN1 1CAWA 4I30A 5EWSA 4JQRA 3S7EA 2Z42A 5T50A 5CAZA 3LSEA 4WBBA 2WNUC 1F5JA 4ISQA 5C6CA 4QPGC 3AKRA 5K7PA 3MIHA 4E2SA 4NWVA 3ZYJB 4V1PA 3ASIA 1NY72 1H8TB 1XE8A 4P5HA 3I7DA 2BEOA 4M01A 4LBLA 3J26N 4CDXC 1HQNA 4PIZA 1ZREA 4OUSA 4I02A 4MUVA 3JQXA 1R083 1U5XA 3N35A 4LE4A 1BCXA 4XYXA 1MEC2 1RTVA 1OD5A 2NP0A 1DGRN 5FQ0B 2YC0A 1VBE2 4NPRA 4C1XA 2ZZQA 4D3WA 3V0BA 1OFNA 2ZGOA 2RMU1 3KS7A 4AGGA 4AVTA 2QVSB 3AP9A 4W6WA 2ZGPA 3VBHC 1UMZA 4Q1RA 3AP7A 2D5HA 1N1SA 3ZXFA 2RM22 1GZCA 4PBOA 4XBLA 1J3RA 1NQJA 5E89A 1HQWA 4S2GA 4DZGA 1AR71 2E51A 4QM9A 5JPNB 1N1YA 5LEKA 2R042 4YNIA 3VBFC 3WG4A 1LRHA 2AH2A 4IV3B 1WGPA 5CIRA 3MZHA 1BMV2 4N7UA 1BK1A 2VOVA 3N7JA 4J1XA 4K7JA 3O5SA 3QOPA 4XXAA 3VBOB 1QJY2 4AI8A 2E7QA 1LHUA 2D6NA 3WD5A 3VBSB 1C8M1 5CFCC 1BEV1 5GZFA 1RUOA 1Y3TA 3S7IA 1RJ8A 1B35C 1JN2P 4TZDA 1F2NA 1REFA 2XJTA 2EXIA 2XJVA 2VY0A 3MGUA 4MV2A 2HKXA 5DZGA 2ATFA 4LT5A 3VZJA 2WS91 1DZRA 4QGNA 5JOXA 3MW4A 2R6QA 1IZ3A 1OOPB 4HSLA 3ES4A 2VMHA 4P9JA 2X5IC 4RHV1 1LECA 4JDOA 4JTNA 1QDOA 5DUVA 5F5QA 4GB31 4Q4Y3 4Q4W2 3AP5A 1UF2C 4CDUB 1FI2A 3WW1A 1QU0A 1H1IA 3W9AA 2BNNA 3O0WA 3B9CA 3O0VA 3MEPA 2ZACA 2IXLA 4O9EA 1PGL1 2XJPA 3ZX7A 2FMDA 2MNGA 3MDPA 4NHKA 3ES1A 3SCHA 1PVC2 4XFAA 5CB7A 3Q9OA 3GYDA 1TMF2 1U5ZA 1ZZ7A 4W6YA 1LOAA 2ZGLA 3WCRA 4E4ZA 1VAKA 5DG1A 4FTEA 1BBT2 1RVF2 1GR3A 3M3IA 2IXJA 2BVVA 3FUOA 3AYCA 4B8EA 2VW0A 2XVLA 4RD7A 2WT0A 4P9YA 1SCSA 1DYKA 1RUJ1 3HMYA 4HFSA 1A3KA 1ZA4A 2D40A 3S30A 2EAKA 2WNVB 3D6EA 4WM8B 1COV3 1BYHA 5D8AB 3VKOA 1ZVFA 3ZMNA 1YUDA 1WBLA 2E9QA 3MYXA 5FRAA 2GN7A 1O4TA 3POSA 4JGZA 3E6BA 5BNPA 4WM7C 4RGGA 4HANA 4BM8A 4U36A 1SDWA 3TN92 4AHWA 3OF1A 4BMEA 5JOYA 4Y1XA 5FDBA 4LHLA 3MLJA 4PIXA 5GZCA 2DCYA 3GZUC 4JRAA 2JX9A 1VAVA 2B5HA 3C2UA 5GLVA 2JG8A 4NHMA 1XXNA 2W39A 1W6QB 1YWKA 1NA1A 2D93A 2OUJA 2XGXA 1OA2A 4XTMA 5DDJ3 1JW6A 4YG0A 5KBFA 2ZGSA 5LK5A 1W6PB 5KHKA 5CFDB 3NO8A 3CF6E 4FQZA 2JENA 5K0UC 1NY71 2A3XA 1Q5OA 1APNA 1ASJ3 4QPGA 4RR3C 3R4UA 4JV4A 2GC1A 2TNFA 2VOWA 1KJRA 4WZFA 4AEMA 2BTVC 2DYCA 2FHRA 2WNUB 1H2MA 3TN93 3WDXA 1CAUB 1H4HA 4PF5A 2E63A 3ZFGC 4AEKA 3WOGA 2O0OA 4CDXA 1SEFA 4D7YA 4LBQB 3ECQA 1KS4A 1MEC1 3TRSB 4P9GA 4SBVA 1C5IA 2F6BA 2ZGUA 1VBE1 4XW3A 4YG3A 3BOPA 5C8CC 4BPZA 5GLWA 2Z2SB 1JYCA 1AF9A 4R9AA 3ALQA 1FT9A 1SFNA 1B09A 2HWF1 4YGEA 3T2TA 1OHFA 2RM21 4QQPA 1AR83 2OW4A 5L36A 2IXCA 4L97A 1NQDA 2RS12 2D3RA 2PYTA 1H2NA 3VBHB 3A0NA 2R041 2DFBA 4QPYA 1LULA 4IEZA 4XF1A 1WW6A 1QKQA 2D6KA 3M1HA 3ZFFC 1BMV1 1N3OA 2PHLA 1YCIA 4GXLA 3VBFA 4MVTA 3WV6A 2RR12 2GNMA 2W0XA 2OIIA 2A6YA 2X53S 1QJY1 1OI6A 1FNZA 1BXHA 1UD1A 1BKZA 4LEJA 1ULDA 4EN8B 4Z07A 2VXRA 3VBUB 1CD3G 2D44A 5CFCA 1D2QA 1TNFA 3GZAA 3MPBA 4AYUA 4H55A 2DUPA 5AVAA 1YI7A 3W59A 2WFPA 4QT6A 5CFCB 4RFT0 1DQ5A 3KMHA 4L9BA 2WZR2 1S0BA 4AVBA 4LUMA 2GMPA 2OUHA 1B35B 2Z5WA 3H50A 3WW4A 1C4RA 1CJPA 3RJRA 2Y26A 2R0HA 4YVWC 3ZPYA 2RR13 3WG3A 1GLHA 4Y4YA 4XMAA 2ZS6B 3CLPA 1HXS3 1FPN2 1NCQA 3OBTA 4Q4W1 1EPZA 3RJ2X 3B9IA 4NVPA 3ZXEA 4AI0A 1CQ9A 2BVBA 3OY8A 4C0BA 3MIFA 4BE3A 2X5IB 2P2KA 5TSWA 1R1ZA 2BW8A 1WW5A 1V9U3 2GU9A 5JIAA 4I0AA 1QH6A 1LODA 1RUE3 2ENRA 2WZR3 3GBGA 4RSUA 4EROA 3KQRA 1GZWB 4Y1UA 4X8NA 4YZ3A 2GDFA 3QCWA 1PVC1 2XLAA 2ZZJA 5T5JA 3JUUA 3IPVB 3RWNA 1UU6A 1TMF1 3QLQA 3NVCA 1ND3C 4COZA 1SBEA 2DCKA 1AJKA 1BBT1 1RVF1 1ENQA 3RYKA 4CEWB 1V6LA 2K2SA 4UBGA 5JZGB 3V56A 5F9TA 4ES9A 1ZBA3 4Q4V1 3WHTA 4L11A 3USUB 3OTFA 3SLIA 2NM1A 2LALA 4S2HA 5J36A 1OLRA 5CG9A 3ZYGA 2RE9A 1O5UA 4LBKA 5JOWA 3RI8A 2V09A 3BALA 5A32A 4GWNA 2PHDA 2VPVA 4N9HA 1X33A 2ET1A 3HR9A 5JI9A 3OD0A 5FO8B 2FZ2A 2SLIA 4XF4A 4GALA 4I09A 1S0CA 3AJYA 3N7MA 4FP3A 4KG0A 4AI2A 1AR92 4OHWA 1UAIA 1H8TC 1NE6A 1NCRB 3NV4A 4X6QB 3VZKA 3ZYRA 1YFYA 4HPKA 3L2HA 4WM7A 2VW1A 4QPIB 1OQDA 4MH0E 3EQEA 4QQ2A 3PTYA 1GNZA 1MS9A 3V0AA 1VBA2 2WL1A 3J8F3 2VH9A 4DS0A 2DVBA 4DOUA 3MPPG 4OZXA 5SV8A 1SLTA 4P14A 5JAXA 3JB8A 4IEXA 4EWEA 3DL3A 5CU1A 3X29B 4CEYA 1RUH1 3KCCA 1KDMA 3QH6A 1AR93 2SBAA 3MW2A 4FSJA 3ZXLA 3O12A 1JTZX 2JE7A 3V65A 1AYN3 2R061 1WLCA 1YFWA 4MX3A 1AXKA 1RUF2 2BGCA 3GF6A 3UJOA 4FTSA 1JBCA 2JICA 1OSGA 3VZOA 1PK6B 3P3PA 4CZSA 4NO4A 5K0UB 2W52A 2VUAA 4AQ2A 3ZFGA 3MW3A 1GQGA 4RR3B 4Z8BA 2DV9A 4IV3C 5GLUA 1CGPA 3AMPA 1RJ7A 2WNEA 1QJX2 2YZ4A 1VBC2 5JSOA 3WP4A 1YIFA 4DY3A 1VIWB 5AVPA 3TAYA 3VBOC 5C8CA 2P3JA 3AKQA 2NYYA 3RYPA 1HIXA 4IEOA 4ZXKA 4CYDA 4EN9B 3ME2A 1IPJA 4IV1B 1RB8G 1RC6A 1CAXA 2RS11 2RMU3 4BOWA 4RS5B 4COUA 4OI1A 2Q1MA 2FMYA 2ZMKA 3M3OA 2B9UA 5HCFA 1C8M2 1T6GC 2CGNA 5ABJB 5BV6A 1ENSA 3WX5A 1OOPC 1JH5A 2RR11 3ZFFA 1F5FA 4WVMA 1LHOA 2VUJA 5KC5A 2EIGA 4KH9A 2Q30A 4CDQA 4COYA 1Q3EA 3E5XA 4K20A 2XPJA 3WP5A 3WLUA 4CDUC 4EN7B 1H1MA 1QH7A 4MXVA 3LB9A 2HWC2 3OYWA 3R4SA 1LB2A 4HBNA 1W6OB 4HKWA 1JOJA 2PHRA 3ILRA 4Z1VA 1C8M3 2Q5TA 2WZR1 2XBO2 1UX6A 1UPSA 1YYNA 5FCCA 1BEV3 1A8DA 2A6XA 2I2SA 1ZBE2 3INAA 1CX4A 1LU1A 2B46X 4HZFA 1PIV1 4S2DA 4JVAA 3CJIB 5FOJB 3RSJA 2VQAA 5A3MA 2ZGQA 4GMP0 4XFIA 1PZ9A 1C5HA 1FPN1 1LHNA 1GSLA 2WS93 2ZJCA 1LOBA 2ZX1A 2PN5A 1AL0G 4HLTA 4Q2FA 2A6VA 4YVWB 4HT1T 4BYYA 3B93A 4GQ7A 1PZ8A 4YFWA 5GJ6A 4G9SB 4M0HA 2VECA 1GQHA 2MEV1 3M70A 2WLPA 3PLQA 4FT8A 4GMP1 1MQTB 2DVFA 4LTAA 4GB33 4N90A 4DQAA 2VNOA 5EYXA 4JCKA 2Z69A 2XUMA 2A7AA 2Q0AA 2ZMNA 4XOGA 1BJQA 1DGWA 2A3WA 1MS1A 3RMYA 4MXWB 5D8AC 1VBD2 5K9YA 1VJ2A 3HT2A 3WCSA 5IK7A 3OD4A 3I4IA 1ND3A 2YXSA 2XVGA 4AI3A 4M3CB 1AL22 4FAGA 5FTTC 3K48A 3QBQA 1HRV2 1VALA 2CL2A 1YRZA 4BIOA 2A71A 5T5OA 3TNPB 2YPJA 2VOKA 1ZX5A 2PA7A 3GALA 1GYKA 1TNRA 4LO4B 2FBEA 4E9KA 4Y20A 2GC0A 1Y7BA 1LEMA 3FLPA 4N7IA 3I54A 3SH5A 2WA3A 2HWD2 1IPKA 1GANA 1OQ1A 1ZZ9A 2UY9A 4Y20B 1PGW1 1KS5A 4DINB 1KD7A 1NXD1 2R0FA 4AEDC 2K9ZA 5T54A 5A33B 1WMEA 1RUJ3 4N9IA 3RRDA 4J6GA 2IXKA 4NR1A 1CIWA 4BMBA 4C1WA 3O7OA 4OFGA 1H8TA 1WCKA 2YGLA 1I6XA 2W68A 2JJ6A 3MF9A 1YFXA 1RUD2 4CP0A 2UY8A 3AZVA 3RQ0A 2XL7A 4AEJA 1CVNA 1H1AA 3WT3A 1VBA1 2OZJA 1UU5A 3RNSA 2DVGA