3HR9A

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase f40i mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMILYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase mutant F40I
rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 58
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2009-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hr9A00
3AZXA 2UWCA 1OQ1A 5DXDA 1MZ6A 5GZDA 5JVVA 5T55A 2ZGPA 2CYFA 3T1MA 1Q56A 2DTWA 2D6OX 4ZXKA 1BYHA 5HCBA 2E7TA 1N1TA 1URXA 1YO8A 3ZSKA 1LJ7A 1GLHA 2ARXA 2ZHMA 4GKXA 5IK8A 1YYNA 1AX0A 1AF9A 1IS6A 1FATA 1GNHA 4L8QA 3SH3A 5FRAA 3Q9OA 1WLCA 1R1ZA 4K21A 1YXWA 5H9RA 1VALA 3OJBA 1RINA 2DUPA 1SCRA 2DVFA 2DWRA 3N36A 4FOYA 4M3CF 5HCFA 4LBQD 3V0AB 1QF3A 2ARBA 2R0HA 2D43A 1UZYA 2WLQA 1N3QA 2A3WA 1Q8PA 1W6QB 3NV3A 4M3CE 1G86A 4UW5A 1CQ9A 3AJZA 1I1EA 2WT1A 2NYYA 1W6QA 1KDMA 3WNXA 1B09A 3RQ0A 2SBAA 5JOZA 4M00A 3ZYPA 4FQ4A 5DUWA 1MS5A 4CTEA 1MVEA 4FPGA 4MYEA 2YXSA 5DUVA 2A6XA 3MW3A 5H9QA 1WLDA 1F9KA 1YI7A 2DUQA 1V6LA 3T1LA 2P2KA 4WZFA 4XMIA 4RA0A 4YM1A 1IOAA 2A75A 2GNTA 4XJ9A 3V0BB 4XE9A 3WG3A 1QDOA 3N7MA 1LHWA 2DYCA 1MR5A 2LTNA 3KM5A 5CBLA 1JYIA 1V6OA 1W6NA 1H9PA 1ULGA 2R0FA 2AR6A 3AP4A 1S0CA 1JW6A 3OY8B 2A6ZA 5CAZA 5JOXA 5IK5A 2E51A 4PQ9A 1V6KA 3WZ1A 1LHNA 2D3SA 1W6PB 3A4UA 4Q1RA 4XIOA 4YW4A 1S0EA 1MS8A 3OY8A 4FPFA 4YM3A 4Y24A 1W6PA 4XMAA 1AXKA 3FUQA 4YFZA 4W65A 1Y7BA 4YGEA 1FYUA 4DQAA 4YW5A 3JUUA 5LK5A 3USUB 1PZ8A 1LGCA 3O0XA 3OBRA 1LCLA 3SLIA 2GNDA 1QU0A 3AXDA 3ZYRA 3AYDA 3USUA 3WCSA 1GNZA 5CNAA 3M3QA 5GZFA 3IM0A 4XDQA 5EWSA 3N7JA 2ZGNA 5KXEA 1D0HA 3QCWA 2JKBA 3IPVB 2WJSA 1A8DA 4ATFA 1W6OA 4PF5A 2PHXA 1G9FA 1W6MA 4XJZA 5E89A 4AWDA 3B9CA 4LBMA 1KJRA 1LOBA 1V6IA 4FOWA 1CIWA 1QOOA 2DVDA 3AZVA 5H9SA 4DFSA 2PHUA 1AX2A 1QDCA 4R9DA 1XQNA 3ILNA 3M3OA 3T2TA 4AVVA 1CPMA 1G9CA 2DVGA 4XHBA 1AJKA 1MS0A 4P9WA 3WDTA 4FPLA 2ZGRA 4YM2A 1HQWA 2JE9A 1HKDA 2OVUA 3FBYA 4XJAA 3SNMA 4Q1PA 2UU8A 1SLTA 1CONA 4R9BA 4XZPA 1D2SA 4DS0A 1DFQA 3AP6A 4D69A 1LU1A 1KRIA 2OUHA 4C1WA 1GZWB 3NV4A 4UW3A 3N7KA 1S0DA 2D7FA 4YW1A 2DU1A 1GANA 1DYKA 4AGGA 3FLRA 3M2MA 4ITCA 3MW2A 5IK4A 3WG1A 1LECA 4YW3A 1QMJA 2YZ4A 2R49A 2GN3A 3V64A 3AYAA 1N1SA 1DZQA 3I8TA 3WDUA 2AYHA 1WD3A 2ZMNA 3AX4A 2C9AA 3ZXJA 4DRRA 3FLTA 2DV9A 1DLLA 2WKKA 3AP9A 1CR7A 4XYXA 4YLZA 2NN8A 2C5DA 2VXRA 2GDFA 1FAYA 2E53A 2P34A 1SLCA 1A3KA 1N1YA 4XBNA 3ZXFA 3AYEA 4M3CA 4XJ8A 5JMCA 4PCRA 4HL0A 4LBKA 4UW4A 3L2YA 4U36A 2P3KA 1DQ6A 4ASMB 4TZDA 2P3IA 4GKYA 2ZGUA 4SLIA 1DGLA 4R9CA 2G4IA 2ERFA 5E88A 4BMBA 5DZFA 1WW7A 2XB6C 4YFWA 1Z78A 3AZYA 2E6VA 3WG4A 1LHUA 3AYCA 3VKOA 3VKFC 1G9AA 3PMEA 1C57A 2AREA 4YGBA 1Q8VA 1G9DA 1DQ4A 4FPYA 4JC1A 3TAYA 3WV6A 1S0IA 4YG3A 2UWBA 2VW2A 1CJPA 1N1VA 2D6NA 2CNAA 1S0FA 3B3QE 4NOTA 1MS9A 2GALA 1YIFA 2ZGQA 4XTPA 3AZWA 1BJQA 3B00A 4OZXA 5DUXA 2FMDA 3ILFA 3POWA 4GXLA 1GYKA 2R16A 5FREA 1W6NB 3UJOA 1GSLA 3WVJA 4IQPA 5GZCA 1WBLA 1S0BA 1SLLA 4GALA 4YW2A 4FOVA 5JLVA 4Q2FA 1IKPA 3B69A 3A0NA 1HLCA 1VLNA 3INAA 1IS5A 2NM1A 3HN1A 4FOQA 1OFSA 5KXCA 1N47A 2AUYA 4LBNA 4YG0A 4R9AA 3ZXEA 1QNWA 3AK0A 1AXYA 2OW4A 4K1YA 4DRVA 4YZ3A 1SBEA 5GLWA 3I4IA 3MW4A 1ULCA 4P9YA 1LEMA 4LBLA 1U0AA 3AP5A 1WLWA 1ZM1A 5GALA 3RMXA 2CWMA 5KXDA 1KDKA 3ASIA 4FPKA 1C1FA 1A78A 3VKLA 1LGBA 3FLPA 2ZHKA 2E7QA 1Q8QA 1C1LA 2OUJA 2YMZA 2KM2A 1SBDA 2Q5TA 1JHNA 1W6OB 5CB7A 1KQRA 3NV2A 5DG2A 2WT2A 3GALA 4XBLA 1W6MB 2ZGLA 2GMMA 1QOTA 2CY6A 1SFYA 3B01A 1YRZA 1OKQA 1AVBA 4XXAA 3M3EA 3H0OA 2I2SA 2ZHLA 4DPNA 3PVOA 4Y1YA 3WDYA 1JYCA 4XTMA 3ZVXA 4LBQA 1Z0HA 1MACA 3GNEA 3DGTA 2YY1A 2ZKNA 1VIWB 1GV9A 1G8WA 1MS1A 3WHTA 3BIWE 1SACA 3ILRA 1DQ1A 3M1HA 5E8AA 3FUOA 3UK9A 1SLAA 5GJ6A 1CVNA 3NV1A 2PHTA 2D6KA 4UW6A 3WDVA 4Y1XA 4C1XA 3A0KA 3OYWA 2WQZC 3SITA 5SV8A 5DZEA 1DQ2A 5T5JA 2W52A 2CWSA 2ENRA 1FV2A 3HMYA 4XIKA 2A6WA 1KJLA 5GZEA 3QLQA 5DG1A 5EYXA 3POYA 3WOGA 5T5LA 1LOGA 2AGSA 4ATEA 1AXZA 2D6MA 1LOFC 1HQLA 2UURA 4P14A 4PBPA 4BMEA 2A3YA 1BQPA 2NMNA 1IKQA 2ZZJA 4Y22A 4XILA 2A5ZA 1GBGA 2EAKA 5JOWA 1Q8SA 1S1AA 1TEIA 2P3JA 3WG2A 5BYNA 3BODA 1GKBA 1V6JA 1BKZA 2D44A 2WT0A 2ZGMA 4K1ZA 2ZGSA 3ZXKA 4ISRA 3WUDA 3ZSMA 1IS4A 3AZZA 1G9BA 2EALA 1RIRA 1H9WA 3D5OA 1LESA 5AVAA 1WBFA 4FPCA 3N3HA 1N3PA 3PVEA 1BZWA 4WV8A 4FPHA 1SLIA 2VH9A 1ENRA 4AYUA 2TEPA 2NZ9A 3WHUA 2W08A 3IKWA 5GLZA 4JCKA 3W59A 2VW1A 3PJQA 4M3CB 2EXJA 2JECA 1LU2A 2LALA 5L73A 4XJWA 3LCPA 4RL7A 2FHRA 4Y20B 3R4UA 1S0GA 3APBA 1ZA4A 4Y1ZA 4Y20A 2BQPA 2YROA 3W58A 2ZGKA 1MS4A 4P9XA 1F31A 2ZHNA 3WDXA 1DHKB 1UX6A 3D6EA 5GLUA 2WSVA 2D3PA 3R4SA 2W68A 3UL2A 1KITA 1CN1A 1LULA 2PHFA 3HR9A 5HCAA 3RSJA 3LSEA 1S0JA 4BQ1A 1ULDA 3VV1A 1SBFA 1MS3A 3N35A 3BOPA 1QNYA 4FQZA 4FPJA 2SLIA 2AENA 3NWKA 2GMPA 1O4YA 1QGLA 4BM8A 2R1DA 3ZSLA 3POSA 1AJOA 1DYPA 2EIGA 1V6MA 1RITA 2H0BA 4XHXA 1NXD1 2A70A 2CTVA 2VY0A 4FPEA 4Q27A 1LGNA 4AVTA 4XJUA 3AJYA 1FNZA 2AH2A 4CRQA 2ZA9A 5DZGA 3SH4A 1WUVA 3MEPA 4AGVA 4YZ1A 2V73A 5GLVA 2RHPA 2Z42A 2NMOA 3TB0A 4FP2A 5F5QA 5IUQA 2NP0A 5T50A 1FNYA 3V0AA 2VU9A 1VAMA 3ZPYA 1LOAA 4ISQA 1GZCA 5KXBA 1V6NA 4YZ4A 4Z8BA 5EYYA 1JUIA 4H55A 2D6LX 1WW5A 4K20A 3D4KA 3O0VA 4HANA 3FFZA 4WVWA 1JOJA 4PBOA 3UJQA 4FVVA 2PHWA 2ZGOA 3R05A 4XXPA 1GICA 4Q26A 1FV3A 1LOCA 5CA6A 1O4ZA 5GLTA 2GNBA 2ZBJA 1SLBA 3SISA 1DIWA 3LSDA 1DQ0A 1LOEA 2WSUA 3O12A 4YG6A 1SCSA 2WNEA 3ATGA 3V0BA 3OBTA 3N7LA 2A6YA 2UWAA 3WUCA 1ENQA 2DVAA 4Y1VA 1GZ9A 1JXNA 1FX5A 4LBOA 2XG3A 4FP3A 3WCRA 1Q8OA 1WCSA 1UKGA 2ZMKA 4LBQB 3RMYA 4GA9A 4YGCA 1LHVA 2D6PA 2GN7A 3AXEA 4Y26A 5T52A 3AFKA 4ZKTB 2YV8A 1W0PA 1DBNA 1W0OA 1ULFA 1J1TA 2JD4A 1NLSA 1WD4A 1VAVA 2GMEA 1MZ5A 2ZACA 3M3CA 1IS3A 1AZDA 3V65A 4AGRA 4U2AA 5GZGA 1UAIA 3OYWB 1LTEA 2ZAAA 2D3RA 2A7AA 2W39A 4CZSA 3PVNA 3SH5A 3RG0A 2EXHA 4BLIA 1G7YA 4BPZA 2CL2A 4KBBA 4F83A 2A71A 3IPVA 4GWMA 5DUUA 3VKNA 1UN1A 1UZZA 3ZXLA 1H30A 4Q8LA 2VUAA 1V00A 4Y22B 4GWNA 5F9TA 2ES3A 4AVSA 3OPZA 3WDWA 4YGDA 4FPOB 1LODA 2HYKA 5T5OA 1WW6A 2JJ6A 2V5YA 3JU9A 1LHOA 1PZ9A 2PELA 3WLUA 2JDZA 5JDBA 2GNMA 2A3XA 4Q8KA 1EPWA 1QKQA 4YM0A 5GM0A 3ENRA 4YZ5A 3U4XA 1LENA 4TYSA 3IMNA 2VW0A 4NO4A 2JE7A 1ULEA 4JRAA 2EXIA 2ZGTA 3RS6A 1N3OA 2A6VA 5IK7A 1LOFA 2DU0A 3DUIA 1CESA 1UL9A 1UMZA 3O5SA 3AP7A 4BOWA 4Y1UA 1ENSA 4BLJA 4YZ2A 2R1BA 1ONAA 1BXHA 1F5FA 4I30A 3VKMA 2DVBA 3CNAA 2B7YA 3BTAA 1UPSA 1DQ5A 1JN2P 4M01A 5IT6A 3C2UA 2ZMLA 4LBJA 5H9PA 4XBQA 4WVVA 1PZ7A 1WW4A 5T54A 2P37A 5T5PA 2DTYA 1X50A 2DUOA 2EXKA 3ZSJA 2PHRA 1GZWA 3OGGA 1JBCA 5EXOA 1I3HA 3RRDA 1LEDA 3VUOA 1QOSA 1APNA 3KQRA 2ZABA 3O0WA 1HDKA 1MVQA 2DURA 3IN9A 1CPNA 3MPPG 4XOGA 1C4RA 2EF6A 5JOYA 1AX1A
chains in the Genus database with same CATH superfamily
2VO5A 2BVBA 4IV1A 1R093 2KA3A 4AHYA 2UWCA 4CPBD 3W20A 3ZFFC 2Z69A 1AR92 4HPKA 5EJ1B 1MZ6A 1DG6A 1UIJA 2OIIA 2QFEA 4OI2A 2ARAA 3HVDA 2IZWA 2ZGPA 5FWJA 4W6YA 3I3MA 4LKDA 3ZKYA 3BTYA 4N8MA 4ZXKA 1UU6A 2D6OX 1OOPC 2CGNA 3C7FA 4CP9B 1YNAA 1YO8A 4NJ4A 5LY1A 3ZSKA 2ARXA 3HAGA 4GKXA 4MXWB 4QXCA 1AF9A 5FJKA 1J58A 4A2UA 1VBE3 1RMU3 1SG3A 4L8QA 4LK7A 2JWPA 3ABZA 4QPYA 5FRAA 1R1ZA 1OVPA 5HXVA 1YXWA 3ON7A 4BIOA 4EQVA 3NNLA 3OCPA 2DUPA 1SCRA 2XXZA 3I2IA 3N36A 4M3CF 2J1SA 1NCQA 1ZBE1 4A7ZA 4KU8A 3AKQA 2PYTA 2WUHA 4JDOA 2YC0A 3LEKA 3N9QA 3EYPA 1NZCA 4AL9A 1ND2B 1M06G 5K0UB 3DF0A 1O5UA 4OZOA 1W6QB 1G86A 3VBHA 1CQ9A 3AJZA 5FR3A 1I1EA 2YU2A 3H8UA 4MGQA 1JU4A 1AR62 4V2VA 1B09A 4YVSC 2SBAA 5JOZA 4NHXA 4UWDA 1AL21 1MS5A 5EIYB 4FPGA 5DUVA 4NIHA 2YXSA 2A6XA 4AI0A 3RI9A 1WLDA 4NHMA 3J4UH 2DUQA 2WNVB 4J6GA 3T1LA 4XFBA 4NROA 1JYWA 1O8PA 5FYMA 4FO9A 4RA0A 4QPGA 2BP6A 2WNOA 5ACA1 4QGLA 4TLGA 1R083 4LIUA 4CDUC 4PDWB 4CXWA 1O3SA 3KM5A 1JYIA 4WVZA 4CUGA 2P1BA 3A23A 1W6NA 4LTAA 1ULGA 2AEZA 1RJ8A 4GB32 3WF3A 3O1VA 2ORXA 4LULA 4MGYE 4PLOA 1H2NA 1V6KA 2D3SA 4XIOA 3VBOA 4LO5B 4JGYB 1MS8A 1ZX5A 2XHKA 4YM3A 4ET7A 5C8WA 4PF1A 5FOBB 1W9TA 3SKVA 4YRDA 4AZZA 2QQOA 1VPHA 2R6QA 4YFZA 5C71A 4S2FA 3LWCA 3VZLA 1Y7BA 1QHDA 2ZPXA 4LO7A 3MDPA 3KB5A 5FYTA 5CISA 2RM21 4MXVA 4S2GA 3OBRA 3O0XA 5DDJ3 3GXUA 1PNGA 1EP0A 2GNDA 3C7GA 3M4FA 2D40A 3ZYRA 1OMIA 3W5MA 1RMU2 3USUA 2BJSA 3RYKA 2BERA 1UZVA 3ZM8A 1IHMA 3M3QA 4URTA 3W5NA 2XUMA 5KXEA 1RUC1 3QCWA 1W28A 2JKBA 3DYOA 1E5SA 1K3IA 2CU5A 2W0XA 1FI2A 4JRLA 5ANNA 5FZBA 3UGHA 2RVAA 2YBKA 4XJZA 2ZX1A 5LA9A 3B9CA 5KHGA 1NY71 3MLLA 4FOWA 4UFLA 4DFSA 3AZVA 2XQRA 3JQWA 2E9QA 3ZN5A 4BE3A 3T2TA 1VB4A 4COZA 2BGPA 2VQAA 2WRAA 1AJKA 4XHBA 1MS0A 4P9WA 4QX1A 3VDDC 3WDTA 5FZ3A 3RPQA 2OYZA 1ZBA3 3GDBA 3BPZA 1HQWA 1HKDA 2OVUA 5JSPA 2UU8A 2QUOA 1SLTA 3PTRB 2JG8B 4R9BA 1DFQA 5FY0A 2GSYA 4D69A 4Q0UA 1GZTA 3SQOA 4C8DA 1MEC1 1DF0A 3WQ7A 5JXIA 4Q0VA 1GZWB 3NV4A 4D6RA 1DZRA 5C3QA 3VDBA 3MIGA 1ND3C 1S0DA 4YW1A 5CVRA 2P6HA 3KHCA 4CUCA 3HWJA 1YHFA 2CV6A 3WG1A 1WZXA 2OS2A 5A70A 1YQ2A 5KBFA 1PO13 4RS5A 4OHYA 1SPPB 2IVJA 1HW5A 4RFRB 1KFXL 1NYWA 4DUXA 2D97A 4W8JA 5DDJ2 4AE2A 4MHRA 3AKRA 4WBBA 1XU1A 1B35C 1X7NA 4YVWB 2VMFA 2ZMNA 3AX4A 3KV5A 1H6YA 3ZXAC 4SBVA 3FLTA 3ACFA 2IXCA 5FY4A 1OD3A 2W5FA 5B4XA 1VMFA 1W2NA 3AP9A 1WCQA 2RJLA 2VAUA 1F5JA 2JG9B 5DAQA 2GH8A 1XPWA 1XYNA 3IT8A 2E53A 3WNLA 1SLCA 2MEV1 4A44A 5L19A 4KMQA 1UIKA 2UY9A 4LLOA 1ZZ7A 2P4EA 4M3CA 4D7TA 5F1RA 2HWC1 4LBKA 4UW4A 1OOPB 3KWVA 3WF0A 2ZGUA 3ETQA 4B3NA 2VCCA 2G4IA 4BMBA 2XKPA 1D4M3 1ZBA2 1Z78A 3M7AA 3AB0A 1H1MA 2TUNA 1LHUA 3K77A 3GJBA 5EZWA 2E26A 4DXRA 3WNKA 3LPGA 5FZ4A 1C57A 5FZEA 1G9DA 1DQ4A 2Y6FA 1DP0A 4A6SA 2VZRA 4OUEA 2CNAA 5DMYA 3L9JT 1S0FA 2V09A 1MS9A 2EIBA 5LRRA 1EV11 1PVC1 2JDAA 2QQVA 4AHXA 1BJQA 1JZ7A 1AL0G 1XRUA 2C6SA 2FMDA 5A6YA 4YVSB 5FREA 2BDRA 1GWMA 4KL1A 5BNQA 4GALA 3LA3A 5FY7A 1CAWA 1PO12 3THCA 1POV3 4O7XA 1IS5A 5FZAA 2AUYA 4INDA 1RYYA 5ABJA 5ERLA 4CDUB 1KEXA 4HOOA 5FP4A 1QNWA 1QJY3 1HX6A 1JS9A 3AK0A 4X8NA 5EJ3A 4DRVA 4K1YA 1QJX3 2YBPA 1SBEA 1L7LA 3OD0A 2ZEYA 5FP8A 1ULCA 2WAOA 1LEMA 1F2NA 1U0AA 4QPIA 4HBNA 4N7IA 3RMXA 3ZKUA 1JZ5A 4Y4YA 5KXDA 1T6GC 2WS92 3ASIA 1I5PA 3FLPA 4WM7C 1Q8QA 3GZAA 4NN0A 1JOPA 1OF3A 4FXGB 5F2WA 3GGLA 1W06A 1GOGA 2WT2A 2WZR3 3WCRA 4YG0A 3B01A 2GMMA 4XXAA 3VD5A 1SFYA 3HNYM 1UOGA 1YRZA 4COYA 2RV9A 3J7NA 2I2SA 4DPNA 1PK6A 4Y1YA 5DAWA 1ZRFA 2GC0A 2VBPA 1K5MB 1VBB3 1Z0HA 1MACA 1OPMA 2O14A 5A7SA 4ZS3A 1C5IA 3WHTA 2RR13 4MG2A 5LY2A 4EZ4A 3BGAA 3ILRA 5JZGA 2I45A 3KSCA 4CDWB 2W1SA 5A32A 4CP0A 3NVCA 3NV1A 5IW0A 3WDVA 1OA4A 5J7MA 4C1XA 2FQPA 2WQZC 3SCHA 5SV8A 4AI9A 2CDOA 2ATFA 4O65A 2W52A 1VJ2A 1YWKA 1MQTC 3VDDB 2HBTA 3WW1A 2DDUA 4B29A 5GZEA 3QLQA 5EYXA 2FD8A 3VD7A 5BXXA 1LOGA 4Y5Z0 4A7YA 1LOFC 2UURA 1XB9A 4PBPA 4BMEA 4GH4C 2A3YA 2NMNA 2YB7A 1R1A2 1IKQA 2ZZJA 2HWE1 4XILA 5J36A 1CAVB 1RC6A 4EJRA 1DLCA 3I3BA 4YNIA 2BGCA 1QJY2 3C8XA 3VLBB 1TEIA 2VL4A 3WG2A 4E4SA 1QJX2 3T0BA 2VQ0A 3POGA 4LKSA 2WT0A 1JMUB 1OLRA 2BOJA 2ZGSA 4ISRA 3AMNA 3DPRB 4W6XA 3OPWA 3GZEA 3THDA 2E33A 4OHXA 3URFA 1H9WA 1LESA 5ANQA 5AVAA 1WBFA 1ZRIA 2EIEA 5IAVA 2HH9A 1EUUA 1D7PM 4CDXC 3MF6A 1SLIA 1AL23 4IV1C 3X29B 5J09A 1EAH2 2WZR2 5BUVA 2EIDA 4QWNA 2W08A 5A1LA 5C3RA 5IFPA 5GLZA 3ST7A 4P9IA 5A7PA 1B35B 4OQ8A 2LALA 4CCEA 5ACA3 4PJYA 2WO7A 5JXHA 1S0GA 2X09A 2QQWA 2VXJA 3APBA 4Y1ZA 4NHKA 4DUWA 2VZ1A 5FZ7A 3ACGA 3RZLA 4CEWB 2ZGKA 5IVJA 2RR12 5AFBA 3FC0A 1F31A 4GWJA 1UX6A 2EICA 1BMV2 2OQ7A 1O91A 2D3PA 4RYDA 4IE5A 1PGL1 2FMYA 2W91A 5LA2A 1KITA 1UX7A 1CN1A 2VQUA 1XC6A 3KV4A 4EE2A 4QHBA 1NCQC 2JXAA 2VMGA 2YG0A 3VB9A 1S0JA 3ZFEB 5BNNA 3N35A 3TOJA 3JQXA 1QNYA 4FQZA 2SLIA 5C7GA 1QJU1 2AENA 2GMPA 1QGLA 2RM23 4N9IA 2R1DA 3POSA 2EIGA 1DYPA 4GMP0 3VBHC 1RITA 5C5TA 1NXD1 1CAXB 2VBBA 3DKQA 3H3LA 1US2A 5CFCA 1ZNPA 3BB6A 2A73B 3UT0A 4OHWA 4RGKA 1JYTA 2XPJA 5FZ0A 4KQ7A 4AGVA 1RUC3 3FZ3A 4ZONA 1Y9QA 4E9KA 1ZBE2 3FHAA 2ZX2A 4UBHA 2PTMA 3TB0A 4FP2A 2Y6LA 2Y64A 1UYXA 4WM8A 4Y5TA 5T50A 3LFIA 3V0AA 3LA7A 4GB31 2OX0A 4XFAA 3EMRA 2QQIA 1VR3A 2G9ZA 4DNYA 2XONA 4QT6A 1JTZX 2XGXA 4HANA 3FFZA 3MIFA 4OUSA 2VUJA 5IWFA 1AL22 2ARCA 2IFRA 3LEMA 4BB3A 4UOJA 4FVVA 2IFWA 5JI9A 3RZHA 3THPA 1W2OA 1CZVA 1LOCA 4Q26A 5FZLA 5GLTA 4DOUA 2ZBJA 1OFNA 1SLBA 2QQNA 2LROA 3PVBB 3NNJA 5BNPA 4KBZA 2WNEA 3OBTA 4LLFA 2ETEA 5D8AA 4GQ7A 5KWRA 3R0RA 4Y33A 2DVAA 2DCZA 1YFYA 3JB4C 4HKWA 1GZ9A 2QKDA 1JXNA 1MEC3 3OGSA 4JHZA 1YFUA 3LGRA 3U10A 3ZDSA 3TEZA 4H14A 3B94A 3RMYA 2B42B 3HN3A 4GA9A 3V56A 3VDCA 4B4RA 3RZZA 4AHWA 4ZKTB 5BNOA 2YV8A 4UYBA 1ULFA 2X53S 4G3YC 4R52A 1WD4A 4XF3A 5FV3A 3FBMA 1MZ5A 3UGGA 4RQPA 4J1XA 3EHKA 1ALYA 5I0DA 3ITQA 4P9GA 4AFAA 1DGWX 4QGNA 2RM22 3MLKA 5FZIA 4LPLA 4AGRA 3JCIA 1TME1 2TNFA 4ZY9A 2WC2A 4COWA 2PN5A 3HPNA 1SFNA 2PQQA 5FPLA 2VULA 4JKKA 4MVTA 4KBBA 4BK5A 2A71A 3AM2A 2MEV3 3VKNA 3A21A 5H9PA 1NY72 4BQWA 2ES3A 4CXYA 2HWC3 3HQXA 4EWAA 5C9AA 4YGDA 5IVEA 5L7OA 1BCXA 1LODA 3I3DA 4JVAA 3VBRB 2BEOA 2JJ6A 1LHOA 3I59A 3WLUA 2FZ1A 2JDZA 2WNUA 3THTA 4MSVA 5JDBA 4AI2A 4Q8KA 5A6QA 3MZHA 1EPWA 2Y33A 3U4XA 3JD72 3S7EA 1PX3A 3IMNA 2ZEZA 3SCGA 4NO4A 3BN6A 5I0TA 3GBWA 2HKXA 5IK7A 1HRV3 4Q4X2 1UL9A 2OA2A 2R073 4LJHA 3SEEA 3FHIB 3HOBA 3MUY1 3KLSA 1UY0A 2QQJA 4RS5C 2DVBA 4Z2AA 3LDKA 1JN2P 1YI9A 4M01A 5K7PA 5DQ0A 3MICA 1MEC2 4GD4A 2IXLA 1TMF1 1X50A 2DUOA 1EV13 4XQWA 3OGGA 1PVC3 5LBEA 1W39A 1IG0A 3QH6A 3RRDA 4CE8A 5LB6A 4LUMA 1LR5A 1YUDA 3I2HA 4NRPA 4QX8A 3E5QA 4MUVA 4CDXB 3PUAA 2YU1A 1O3TA 3VGIA 3KCXA 1C4RA 3CF6E 4IV1B 2EF6A 4HPKB 1UO9A 4XUNA 5F32A 3KT4A 5JOYA 4IE0A 4XFCA 3ZMOA 1JZ8A 1QQP3 5F39A 4JQRA 5C8CA 5GZDA 3D0JA 5T3NA 3ZFGA 4CCKA 2XLGA 2VGDA 4H3WA 1UKRA 1QWRA 4NPLA 3PUHA 1BYHA 1RUH3 5FXZA 3UNPA 5AC92 2VTXA 2E7TA 1DZTA 1N1TA 3BTXA 1URXA 1CJDA 1LJ7A 1GLHA 3GHNA 1HN0A 3GBFA 4WZCA 1AX0A 3O1OA 3EBRA 2UY8A 4HMZA 3UKTA 3D82A 3ZYBA 1NUKA 1NQDA 1WLCA 2HEYF 1JHJA 3QACA 3VBSB 1NCQB 4JTNA 5HV4A 1RINA 5HCFA 5LEKA 4FOYA 4D6QA 3TNQA 4X8PA 5FLJA 3OUHA 5A3PA 2J1UA 2WLQA 5A3TA 1W0NA 2A3WA 2J1VA 1HB2A 2NYYA 5LRSA 1AR82 3RQ0A 3B02A 4IEUA 2AACA 4JTOA 5DUWA 2PQSA 1DU3D 5FY1A 5FMBA 3O1RA 2RDNA 2LM3A 4ZHNA 5ABJC 5A7NA 1NA1B 2P2KA 3GBGA 4XMIA 1BLZA 4XJ9A 1REDA 3V0BB 1AR72 4H2AA 4BQ5A 2XQXA 2DYCA 5FZHA 1HN1A 4QPIC 4CCCA 5CBLA 1FOD2 5FLHA 4PLNA 5BPXA 1H9PA 1VP6A 2CGPA 2R0FA 4D7SA 4E2GA 1S0CA 1JW6A 2E51A 4PQ9A 3WZ1A 1LHNA 5IVCA 3A4UA 2HWE3 3OY8A 1UYYA 1RUE1 2B9VA 4AFCA 2LUWA 1W6PA 4LUKA 5KC6A 1RUF1 2VOXA 3I2OA 3FUQA 1W8OA 2VTFA 4FXKB 4YGEA 4DQAA 1PK6C 1DDLA 4OI4A 5LK5A 3I49A 4LEJA 2GC2A 3USUB 4DXTA 3MIBA 1LCLA 5FMDA 1QU0A 1AR93 1W3XA 2YUEA 3AXDA 3AYDA 4LQRA 3I2FA 3PUQA 4Y5SA 4F8AA 1JZ6A 4CP2A 4MH0E 5HPOA 2F17A 3CLPA 2R32A 1IPSA 5GZFA 3VBUB 5JZGC 5EWSA 1CX1A 4V2WA 1D0HA 1DCSA 3PDQA 3BI3A 5DN2A 5JUVA 2QQPA 1QJZA 1G9FA 1W6MA 3WR0A 2VUDA 1QY4A 4LBMA 4N53C 2DVDA 4HVOA 1R1A1 3H8XA 4D3WA 5FCCA 1H4GA 4I3PA 1QDCA 1XQNA 1G9CA 1STMA 2VNRA 2VC9A 2X5IB 1L3JA 2XJSA 3KGZA 5C6CA 4XFFA 2ZTNA 1TNRA 4YM2A 2WZ8A 1IGOA 4WVMA 4M4RA 2YPJA 4NPRA 4XJAA 3SNMA 2VZUA 2YFUA 2W87A 5A3MA 1X9TA 1F4AA 4IEWA 2W1UA 2DCJA 5FBJA 1XNKA 1IPKA 1AR63 1VBD1 4Q29A 3SXWA 4RGAA 4C1WA 2ZX4A 5CU1A 3U14A 1EAH1 5CADA 2VZPA 5EQUA 1CGPA 3P6BA 3LEIA 2D7FA 4BU2A 1GANA 1CAUA 4AGGA 4YSFA 2XLFA 1VMHA 3FLRA 3M2MA 1GR3A 4QM8A 4RS5B 1QXRA 4YW3A 3Q8FA 1QMJA 2XL7A 3NRUA 1W8FA 1H2MA 2GN3A 3AYAA 1N1SA 4GB33 2O1QA 5C4WA 1BMV1 3DEMA 4OVEA 4NIIA 1O4TA 3S0MA 5HI0A 3WDUA 2AYHA 2D5HA 2WQ8A 2C9AA 3M70A 3E6CC 1IG3A 2DV9A 1OF4A 2XJQA 4I09A 1WLTA 3H1YA 4LHLA 1JZ3A 2H0VA 1W90A 3KD4A 4RR3A 1E5HA 5FP7A 2J42A 5A3WA 4IE7A 1RUJ2 4QD2A 1OH3A 1PMJX 3AYEA 3GZUC 3NAPB 4DMIA 5JMCA 2K2SA 5BNNC 2P3KA 1DQ6A 4ASMB 4GKYA 1DGLA 2VJXA 4AG4A 3AMPA 2GAUA 5J1XA 2Y6GA 2ERFA 1RVF1 1EPZA 2TBVA 2ZZQA 3AZYA 3SCFA 3UETA 2WR9A 3ZXDA 4XW3A 4CA9A 1K12A 3VD4A 1KS5A 1S2BA 1U5YA 2IUWA 4IETA 3AYCA 1G9AA 1PGL2 4FSJA 3AMMA 4KWLA 1RHI1 1X36A 3TAYA 4KU7A 2MHFA 4ZXEA 1QJU2 1CJPA 2D6NA 2NLRA 4R4XA 3B3QE 1TME3 1Y43B 4NMIA 1UQXA 3GCWA 2R042 5FQ0B 1YJLA 1E5IA 4IV3A 1UW8A 2DBIA 3HD8B 1KS4A 1ZVFA 3ILFA 1W9SA 1XE8A 4CCLA 3AKSA 1GYKA 2R16A 4GXLA 3ROUA 3UJOA 1CAWB 1KD7A 3WVJA 4J25A 2ADDA 4ONUA 1SLLA 4EN9B 4YW2A 5FYSA 2XMLA 4DUVA 1ZYBA 2Y38A 4IGOA 1VLNA 3O1TA 3HN1A 1CX4A 1UY2A 1W8HA 4NHYA 5BNPC 5LEJA 3LQCA 4QU2A 4R9AA 4GULA 5D8AC 3ZXEA 2ZCWA 1AXYA 2OW4A 5A6ZA 1DGRN 3POJA 1YFWA 3H7YA 5GLWA 4NIDA 3DXUA 3I4IA 3KV9A 4DZGA 3VBFB 1H8TB 1W8TA 4LBLA 2XH6A 4QDSA 4I2OA 3AP5A 1WLWA 1ZM1A 4ZPIA 2XUEA 2HEWF 3KCCA 4FPKA 4LHNA 1C1FA 4UF0B 1A78A 3VKLA 5BNOC 2AZ5A 1K5JA 2E7QA 2F6BA 2WWUA 3UKVA 2X05A 4LORA 2Q8EA 4KWKA 3O1PA 5LBFA 2ID4A 3S7IA 4RQPC 1ACCA 2Q5TA 1W6OB 5CB7A 1PK6B 4A3ZA 4XFIA 1XNBA 1NCRB 3M3EA 3H0OA 5FYBA 1MZFA 2ZHLA 1O8SA 4I01A 3WDYA 1JYCA 3CJIB 1C8M2 4XTMA 2OQ6A 4LBQA 2YGLA 1PIV1 3IAQA 2YY1A 1PNFA 4UFHA 1VIWB 1GV9A 1G8WA 1MS1A 2P5BA 5IHRA 3GM8A 1SACA 4N43C 5E8AA 1DQ1A 3M1HA 3ZMNA 5GJ6A 3JD71 3IDAA 5C9AC 5L7OC 2PHTA 2D6KA 4UW6A 4N53B 1TME2 2C24A 3ES4A 3OUIA 4Q4X1 4XAAA 1V9U2 1JZ2A 2CWSA 5A80A 4QB2A 3HT2A 1PGSA 5E1RA 1FV2A 2HWD1 3WOGA 4AR2A 1JZ4A 1DGRA 3I2KA 4Q4Y1 1K42A 4TTGA 4HKOA 3T2QA 5BV6A 2AGSA 4QB6A 3TEYA 2BBAA 4P14A 1OD5A 1BQPA 4OMCA 3DYPA 4AQ2A 4Y22A 3JXSA 2YC2A 4L97A 2EAKA 3CU7A 1WMFA 1LRHA 1S1AA 4HZFA 1F35A 1GKBA 4K1ZA 1BKZA 2YFZA 2W3JA 4AEMA 1PX4A 3ZXKA 5I0SA 1I5ZA 2QVSB 4PIYA 1IS4A 3AZZA 1SQ4A 1RIRA 3D5OA 3T09A 4FPCA 4BXSV 5LA1A 3N3HA 1NAEA 4ZU5A 1ZRRA 4CCMA 1X33A 1POQA 2FDGA 2XL9A 4WV8A 2WIIB 4P9JA 4CEYC 3BTZA 1ENRA 4AYUA 2W94A 3TNPB 5AC91 1OLME 4LOTA 3IKWA 3MBWA 1TMF2 3MIEA 5FKBA 4AAXA 2VW1A 3PJQA 2B9UA 5C8CC 4PI0A 5JWPA 2WS93 2HWB1 3I54A 3ZFFB 2VOTA 5CFDA 4J1WA 3NL1A 1ZA4A 3A22A 1J83A 1CD3G 2VE1A 2BQPA 2WN3A 1IZ3A 2HWF2 3NQHA 4Q0SA 3W58A 1F8VA 4P9XA 4K8FA 2H6BA 2ZHNA 4AQTA 5HCHA 4BYYA 1OBNA 2IWGB 2WSVA 4UAPA 3LDRA 4FAGA 1W8UA 3ZIWA 1BK0A 1RUE3 5BNNB 2FDHA 3NJVA 2PHFA 3HR9A 4JX0A 2F4LA 1W3VA 1E5RA 1O7FA 1RUF3 2Q1FA 2VZOA 1AR81 5KHIA 4K9SA 1SBFA 2BNNA 5CEHA 5F3EA 1WMEA 4FPJA 1JYXA 3P3PA 3NWKA 5FYUA 4CP9A 4EZHA 1GNYA 5A33A 4AQSA 1GU3A 2A70A 2CTVA 2VY0A 1RUD1 2YHJA 4LKFA 5FZ1A 5FXXA 2I07B 4XJUA 4AVTA 2VOVA 4OYUA 3NNFA 4YW7A 1FNZA 5JXGA 1OUSA 2ZA9A 5FMOL 5DZGA 1AR71 2QTWB 1ULOA 1Y9MA 1HQNA 4YZ1A 5GLVA 5LW9A 1WMDA 1FOD1 2Z42A 2E63A 3MHZA 5F5QA 1HXS2 4IDZA 3ZPYA 4OLLA 4DXZA 5KXBA 4BQXA 1ND2A 5K0UA 1R1A3 4YZ4A 4HXCA 5EYYA 3CJXA 3ZPOA 5FMOS 5D2AA 1YEWA 4K20A 1FXZA 1GP5A 4AK3A 4YARA 1JH5A 2WINB 4QX0A 4UFJA 2QE3A 2ZGOA 3PUIA 3Q8EA 3P3NA 3FWEA 5BNPB 3AKPA 3POIA 3RYRA 1IQDC 2WNVA 5C3OA 1YJKA 4AW7A 1QJEA 2VVFA 3KVBA 3MPBA 5D8AB 1DQ0A 3O12A 1SDDB 2MPFA 1VBD3 1SCSA 5F6KA 2QBXA 4PDWA 2A6YA 3N9LA 4QQ2A 1ENQA 4Y1VA 4EYUA 2C26A 3EO6A 4UXAA 1FX5A 1X82A 4LBOA 2XG3A 5FYIA 1EAH3 4HK9A 1WCSA 4XACA 4CCNA 3WQ1A 2CAVA 2D6PA 3U07A 2BWCA 3AXEA 1RUE2 1TNFA 1VMJA 2W95A 3JB8A 4JGYA 4LKEA 5E16A 2VG9A 5T52A 1RUOA 3RDIA 1RUF2 1L7QA 1VRBA 2JD4A 3KZ4C 1NLSA 1L7RA 4Y3OA 3VHRA 3ZSEA 2GMEA 4HSJA 5D21A 2RDSA 2VR4A 3V65A 1JU3A 1W2TA 2FCUA 2VNOA 3VHOA 4QHZA 3ZN4A 2QNKA 3OGRA 4HVQA 1UAIA 3D3AA 3OYWB 1LTEA 1TE1B 3WP5A 4LE4A 1SZBA 2WN2A 5JXJA 1RUNA 2W39A 2VZTA 3MFAA 2EVXA 5FO7B 1U5ZA 2EXHA 4E4DX 4BLIA 3WW2A 2BTVC 2ADEA 4N43B 2CL2A 4BPZA 4C0HA 4F83A 3WQ0A 5DUUA 1UZZA 4Q8LA 2VUAA 4UBGA 3ME2A 5B2GB 5F9TA 2VPVA 3VZMA 3WDWA 4KG8A 1YLLA 3AMHA 1MPXA 1PZ9A 4Q4W1 1LKNA 2PELA 1GQHA 3RNSA 1BEV1 2YBSA 4EROA 3T30A 3POEA 1ZBE3 5M0TA 4ZZ8A 2BVVA 3PL0A 5FZMA 4CDQA 5JMOA 3MV11 4BA6A 1ULEA 1XNCA 3RS6A 1N3OA 4NE9A 3NNMA 3S30A 3LDBA 2RS51 1ND3B 4FI9A 2K0GA 4BDVB 3AP7A 1RHI3 3SC7X 2JDPA 3SEPA 2R1BA 1VBD2 4QXKA 3CNAA 1UPSA 2VMDA 2ZAHA 3BYWA 5C4WC 5ISLA 2VCMA 2WA4A 2ZMLA 1BK1A 3J8F1 2P37A 4FCAA 1QIQA 4LO4B 3ZSJA 2GP5A 1HB4A 2C4XA 1Z7S2 2Z4FA 1GZWA 4Z07A 1I3HA 5F2SA 1RUJ1 4A3XA 2RS12 1V70A 2R062 3O0WA 3IN9A 1CPNA 1KFUL 2Y6KA 3WT3A 4CEYB 4XOGA 1MZEA 5SV5A 4QX3A 4CCOA 2JIJA 4PIXA 4FFHA 3T2PA 5FZ9A 1SPPA 5I0RA 1DGWA 2E7AA 1OQ1A 5DXDA 1I9RA 4PT6A 1TQ5A 3PLQA 5JVVA 3B7MA 3BIEA 3B5LB 3CO2A 2W46A 4YVWA 3T1MA 1Q56A 4FTSA 2V72A 3U78A 5I8YA 5HCBA 4BCUA 4C0BA 5G05L 3OOXA 4L9BA 4OMDA 2W1QA 2ZOEB 3HBKA 2J7MA 1EYBA 2JG9A 4QXHA 1POV0 5IK8A 5FYCA 5CZKA 1FATA 1T2XA 3RI8A 1C5HA 1GNHA 1RJ7A 5FAXA 3KMHA 4IE4A 5F3IA 2R041 5H9RA 1VALA 3OJBA 3LB9A 2DVFA 4C90A 1EUTA 5FYVA 4LBQD 4XEZA 2R0HA 2ARBA 1RVF2 2D43A 3J7LA 1UZYA 4A7KA 1A34A 4QPGC 4QQOA 1Q8PA 4M3CE 3NV3A 3PTYA 4UW5A 5LATA 3ZXGA 4BHPA 1RHI2 2PAMA 3RWKX 1COV2 4ZS2A 4LA2A 2K9ZA 3LPFA 1MVEA 3MW3A 3ZN6B 1YFXA 3C7HA 3JD73 1BBT2 2GC3A 3DCQA 5FZDA 3VBOC 4LT5A 4LE3A 4WZFA 2VUCA 2NQYA 3DYMA 5FMCA 4YM1A 4Z2WA 2A75A 2GNTA 3ALQA 1RB8G 4Q4X3 1QDOA 3N7MA 5EV7A 3VL9A 1PHMA 1LHWA 1MR5A 2LTNA 4AVCA 4CUAA 3CKHA 1HJFA 3FFQA 4Q4Y3 4YVSA 4B7KA 1OKOA 2AR6A 4QX7A 1R091 3AP4A 4N90A 4FBFA 3OY8B 2A6ZA 4YWAA 2E32A 2FCVA 4X6QB 1W6PB 4YW4A 1S0EA 4XUTA 1VBA1 4HFSA 1C8M1 2CGOA 4NHLA 4WM7B 3UV9A 4Y24A 4Y4RA 4I0AA 4CDUA 4XMAA 4COVA 1AXKA 1J1LA 1HB1A 5DAXA 4D7YA 1UCXA 2WWJA 4NPMA 1PGW2 3JUUA 1LGCA 2BW8A 3WSOA 3P1IA 3UGFA 3SLIA 1A6CA 5BY5A 2VOWA 4XAEA 1D0GA 4CUBA 3OD4A 4H7LA 4NWVA 3WCSA 4XF1A 4LIVA 1Q3EA 2OT7A 1FMD2 3CIHA 2BUKA 4MGZE 3EJKA 2DCTA 3I2JA 1V9U1 2OPKA 4UT5A 4XDQA 3N7JA 2ZGNA 5FO8B 1XNTA 4ATFA 3HNBM 3IPVB 2WQ4A 3CBNA 5AC93 4PF5A 4YW6A 3DN7A 4JAAA 5DAVA 4XDOA 2W2IA 4CU8A 5FIXA 3LFMA 1QOOA 1WCKA 5H9SA 3VZOA 2PHUA 1AX2A 2XBO2 1PIV2 1K5MA 4DB5A 4R9DA 3M3OA 4AVVA 1CPMA 1GP6A 3OGVA 1MQTB 3MGUA 4NAMA 4QKBA 4W4ZA 3U4SA 4Z1VA 2UYBA 4BIFA 4HONA 1EY2A 1REFA 2JE9A 3FBYA 3U1XA 1ZRCA 4CDWA 5FJHA 3CZJA 3SKJE 4GH4B 1FPN2 2ET1A 2XJTA 1R081 5G04L 5JIUA 1CONA 4XZPA 1D2SA 4DS0A 3AP6A 1AR83 3O7OA 5FLIA 1YQ5A 2HWD2 3PJYA 4XC9A 5FYZA 4Q4Y2 1LU1A 2RDQA 4OULA 4M4PA 1KRIA 3TN91 3BOWA 4UW3A 2ZS6B 1XBFA 1ODMA 4B8EA 1RUD3 3N7KA 3NKTA 4BZ4A 2VECA 1C28A 2VCBA 3ZIXA 5FP9A 2DU1A 4LNVA 2NPIA 4AEKA 5LA0A 2VCAA 1AR73 4A45A 1VBC2 3L2HA 4I3GA 4LA3A 5IK4A 4K6BA 1LECA 2OKXA 1FOD3 3H50A 2YGMA 3WNOA 2YZ4A 2HWF1 3S5AA 2MNGA 3RZKA 2HJIA 1UYPA 1DZQA 5CFDC 2Y60A 3PU3A 4EN0A 3DPRA 2BGOA 3I8TA 1XE7A 4LOSA 2Y0OA 5GKAC 1UD1A 1H1IA 2A1XA 4MADA 2R30A 1SEFA 3H42B 4COUA 4DRRA 4GAZA 1DLLA 2WKKA 5CYYA 5FY8A 4XYXA 4YLZA 2VNVA 1XXNA 1ZZBA 3TRSB 4HETA 1A3KA 3NO8A 3WW3A 1N1YA 4XBNA 3ZXFA 2AC1A 1GOFA 4BQ4A 2EA7A 2HWB2 4XJ8A 1B35A 4PCRA 4HL0A 5LBCA 2VZQA 5K9YA 4U36A 4TZDA 4O9EA 2J1AA 4CEWA 5IVBA 4HVRA 4L11A 5DZFA 3JBG1 5IAXA 3NW4A 1WW7A 2XB6C 4DY3A 1TZOA 4HG6B 5F37A 2E6VA 1HXS1 3VBHB 5F6LB 3T3YA 2DFCA 4Q0PA 3LA2A 2LRPA 2OXBA 3PMEA 3I2DA 3S57A 3RVHA 1GWKA 2AREA 3IWZA 1DYOA 4YGBA 3ZOIA 1W03A 1UF2C 3ZYFA 1YCIA 4FPYA 2Q8OA 1AYN1 4ES9A 3ZFEA 4XURA 1S0IA 4YG3A 2VMHA 3I7DA 5A7OA 4AI3A 4Q4V1 1N1VA 3KVAA 4TWTA 5K0UC 1NE6A 3BKZA 4NOTA 1WMXA 2GALA 4QPGB 3NNGA 1RUD2 3AZWA 2KD7A 1UY3A 3B00A 1SDWA 1H2LA 3PHMA 1CAXA 4N7UA 3J26N 3POWA 4AI8A 5FZGA 5GZCA 1W6NB 4JKMA 4IQPA 4MGKE 1WBLA 1G6NA 4FOVA 1KGYA 1SHWB 4Q2FA 5JLVA 1IKPA 3B69A 3POBA 4JGZA 3IZOA 3RZJA 3INAA 3VBOB 4L2NA 4FOQA 5KXCA 2JB4A 4MLOA 4LBNA 5FPZA 4A41A 1ZA7A 5CG9A 4PDWC 1GMMA 2L9LA 3FJSA 4R8HA 4Q4W3 1NKGA 4YZ3A 1BEV3 2BYVE 3MW4A 1JYVA 4MOAA 4P5YA 4RN5A 4QU1A 5GALA 2CWMA 4P00B 5FK8A 2RS53 1LGBA 5FZOA 3WP6A 3J9SA 4QQPA 5FZ8A 1OLQA 1X8MA 2KM2A 4Z82A 2WFF1 2WDBA 3NV2A 3SMHA 5DG2A 3GALA 4QMAA 4XBLA 4DO0A 1QOTA 1OKQA 4XF4A 2VTXJ 3KS7A 3KCYA 1PO21 1RUJ3 1XNAA 2RG4A 5I8TA 5FPAA 4LO8A 5IVFA 3KT1A 3PMSA 3DGTA 2E31A 2QQMA 2ZKNA 3B93A 2IXHA 3MO4A 3GYDA 3NSTA 4BISA 4LK6A 2RS32 3BIWE 1CWPA 5A3OA 1ZREA 3FUOA 3BU7A 1SLAA 3WW4A 4BWOA 2WLPA 5LK7B 2BBVA 4AHZA 3UYJA 2G9FA 2Z79A 3DL3A 5DZEA 1DQ2A 4CP1A 4DY5A 2JDYA 1ASJ1 2C9KA 3HMYA 4CDQC 2A6WA 2X29A 1RL3A 3OPTA 4ATEA 1QJU3 2D6MA 2GC1A 3G6JB 1HQLA 4E2SA 2DBNA 4GMP1 4KH9A 3AMQA 1Z7S1 1J3PA 3BALA 4R4ZA 5A1AA 2R043 1NG0A 3VZJA 2GU9A 1UYZA 2PFWA 1PMHX 1W9YA 2RS11 2Y8KA 4GZ9A 1Q8SA 2R061 5K4LA 1H1AA 2P3JA 1HRI2 4IEZA 4Q4W2 5D1IA 3VBRA 5BYNA 3BODA 1BEV2 3IIIA 3KF5A 4LR4A 2ZJCA 3K4DA 3ZSMA 4V1PA 1WA4A 3ZR6A 2PLV1 4CCDA 5L36A 1G9BA 3BCWA 3WP3A 5A3UA 1UPIA 3VN4A 2RS52 3KV6A 4MX3A 2HLEA 1QXPA 3K4AA 4HN1A 3ZYHA 4RSUA 3I2GA 4DXSA 4FPHA 5FPXA 4KWUA 3J7MA 1W8ZA 5KHJA 4IEVA 2TEPA 4XETA 2NZ9A 4KWJA 4NR1A 3J8F2 5CFDB 4P5HA 3RZGA 3UESA 4M3CB 2HEVF 2EXJA 2JE8A 4OQ9A 4XJWA 3LCPA 4IEQA 5JSOA 1GFF2 4LHKA 3T4HB 3AKTA 1XE0A 2V5DA 5LBBA 2JICA 1S55A 5EP9A 4Y20A 2YROA 4YPJA 4A6OA 2JG9C 2FDKA 1BHGA 1MS4A 2W1WA 4QPWA 2WABA 5FP3A 3ETPA 3WDXA 1JOBA 4AVAA 3D6EA 2O8QA 5GLUA 2JDNA 3K75B 1W2AX 2WO1A 4UFIA 2W68A 5I93A 2G9GA 5CFCC 2FZ2A 1W8WA 1VBA3 1C8M3 1W04A 4B4PA 1S4CA 3H7JA 2VM9A 3RSJA 3EXUA 3LSEA 2P6CA 3TYJA 1OQEA 5A3LA 1OXCA 1COV1 1MS3A 3K4ZA 5A33B 3BOPA 5F5CA 4WM8C 1XSQA 4BM8A 4XHXA 1V6MA 2H0BA 4MO3M 1BBT1 2DCYA 1M4WA 1LGNA 4AEDA 4CSWA 2XVKA 2AH2A 3VBSA 1WUVA 1V9U3 3LD8A 3MEPA 4M0HA 5I8SA 4E8DA 2BRTA 3H3UA 2NMOA 3ACLA 4HK8A 2NP0A 1FNYA 2HBUA 2XJVA 2QZ2A 2WYSA 4ISQA 4MV2A 5ABJB 4AVBA 1GZCA 2R7EB 3ZX7A 3U11A 5JPMB 4XZUG 4H55A 2D6LX 1WW5A 2J1TA 3D4KA 3O0VA 3POFA 4OCTA 4WVWA 4QDQA 2EAAA 5A7WA 1JI6A 4QPIB 3WNPA 4PBOA 4E2QA 4HKLA 4MGTA 2PHWA 5EJZB 4MGSA 4XXPA 4AAPA 4UFKA 1FV3A 1PGW1 3AFGA 4MGIE 5FPVA 2GNBA 1O59A 1NA1A 1RUG1 2W92A 1DIWA 3LSDA 4L92A 3PUSA 3V0BA 2GH2A 4IEYA 2J22A 4P08A 3B9IA 1FMD1 2UWAA 3WUCA 2J1RA 2LS6A 4QQLA 1Y9GA 3Q8CA 4KGGA 3TN93 4EWDA 5AFEA 1R092 3I3QA 3EB7A 1Q8OA 2ZMKA 1TMF3 5J37A 3TBDA 2PXJA 1O6UA 2VMEA 4YGCA 1LHVA 1VBA2 3OUJA 4Y26A 2QDRA 1BVP1 3AFKA 5DPNA 5HXMA 1W0PA 2XBO1 1DBNA 4RGGA 2G1MA 4ARXA 3J7HA 5CKMA 1VAVA 5JZGB 2HWF3 3GZTB 4P9LA 1RXFA 1IS3A 1AZDA 5A32B 1TG7A 2VQTA 3DXTA 2Y0IA 3E5UA 3Q8AA 3VHPA 1VBE2 1OI6A 2IXKA 4U2AA 1UMHA 1K5MC 4IEPA 4ZU7A 2ZAAA 1I6XA 2QZ3A 1FPN1 1XOYA 4AQ6A 3PVNA 3SH5A 2WNUC 3RG0A 2RJ2A 4G4FA 1OHFA 2VOKA 3VBUA 4UI9L 4CDWC 4W6WA 2BOIA 3TWIA 3ZYGA 1UN1A 1H4HA 3ZXLA 1ZZ9A 2RMU1 1V00A 5A6XA 3C7EA 3GHMA 4GWNA 3K3OA 4GIQA 4PHZA 2J1EA 3RZMA 3M8LA 1CZTA 3R4DB 2V5YA 3GF6A 1VBC1 3ACIA 4O61A 4B1MA 5IVVA 4FFIA 4CDQB 3VHNA 2GNMA 5IK5A 3N9NA 3VZKA 1QKQA 2X5IA 4YZ5A 1LENA 3JBG3 5J3UA 4NIAA 2VW0A 2JE7A 3K46A 4JRAA 1HXS3 3IMMA 1Y3TA 2RE9A 2ZGTA 2G19A 4QAWA 4MHUA 4FFGA 2DU0A 3WY6A 1CESA 1R082 1UMZA 3O5SA 1AUYA 2PHDA 4Y1UA 1ENSA 3LEGA 1AYN3 3BTAA 2B7YA 2WL1A 3H3ZA 5L9RA 4HSLA 5IT6A 2V4VA 3NKGA 3DPRC 2PAKA 1Y4WA 4META 4Q4V3 1WW4A 4WVVA 4XCBA 4XBQA 1D4VB 2DTYA 2PMWB 2EXKA 4XF9A 3RWNA 3TN92 5FOJB 2JD9A 2HYXA 2PHRA 4QDRA 1JBCA 3BPSA 5EXOA 5JR7B 5CKNA 1OURA 1UOFA 3LE0A 4S2DA 2OZJA 1U12A 3ZFGC 1LEDA 1KXGA 1QOSA 3QBQA 3KQRA 2BNOA 2ZABA 3ZO0B 4CU7A 1O5LA 4OI0A 3KGLA 3MPPG 4CYDA 1OA3A 1UY4A 5FPBA 2VMIA 3VD3A 3JZVA 3AC0A 2YYOA 3LAGA 1ZZ6A 5J96B 4IEOA 3T0DA 4JDNA 3AZXA 1W05A 3E97A 2IXIA 5IJRA 3UKNA 2XHNA 4LMFA 3CHXA 3T08A 3LOBA 1UU5A 2CDPA 2XKOA 5T55A 3DV8A 2CYFA 3RJ2X 5CKQA 2DTWA 4CEWC 3N9PA 5LCWL 4IGPA 3G7DA 2ZHMA 1YYNA 1IS6A 5CFCB 4NWWA 3QOPA 3SH3A 3Q9OA 4K21A 4MXWA 4QKNA 3NAPA 3OG2A 4EWEA 1UMIA 5APAA 3HEIA 3ZFEC 2WFF3 2WFPA 3FE5A 3ECQA 2QQKA 1VE0A 2DWRA 1HV1A 3IB3A 3NJZA 1JYNA 2DFBA 4QKFA 2XJPA 5FZCA 4WM8B 3V0AB 1QF3A 5C3PA 5FBZA 3DECA 3JBG2 4IGQA 1RUI1 1J84A 1HRV1 1N3QA 1PO23 4XQDA 3HT1A 2R071 2D5FA 3IBMA 2WT1A 4HT1T 3PU8A 4HN0A 2Y34A 1S2KA 2BFUL 1W6QA 1KDMA 3WNXA 3WF2A 4FTEA 4XQ4A 4M00A 3ZYPA 1YQ6A 2DF7A 4JGZC 4FQ4A 4C91A 3CL1A 1AYN2 1WWYA 4CTEA 3MYXA 4MYEA 2ILMA 3U75A 5H9QA 3IDCB 4Q4V2 2W47A 1F9KA 1YI7A 4BJ0A 1V6LA 4Q5OA 3MLJA 1IOAA 1XNDA 4G9SB 4XE9A 3WG3A 1W2UA 5FQ0A 2IXJA 5B4NA 1ASJ3 1SFPA 2QDNA 2BFUS 3H9AA 3OTFA 1V6OA 3KT7A 3S5QA 4EV0A 2LW8A 1NE4A 3GCXA 3OEBA 4GMP3 5CAZA 1RTVA 2Q8DA 2V4AA 1GWLA 1JUHA 1QQP1 4E8CA 5JOXA 1Z7S3 1R64A 4Q1RA 3NJXA 5C5UA 5BNOB 2WAAA 4FPFA 2RS13 2N7GA 1F4HA 2WYFA 1AYM1 2R063 2XJRA 1WGPA 5F5AA 1RUH1 5FO9B 1LAJA 4RQPB 1RXGA 4W65A 1UNBA 1WKYA 4DEVA 2ORZA 1FYUA 2P3YA 2RS31 5CIRA 4YW5A 1GUIA 1OQDA 3VBFA 2PLV3 3MV01 1H8TA 2XDVA 3WNNA 2Q4SA 1PZ8A 4B7EA 3AVSA 1XSRA 3VDAA 4BQYA 4UF0A 5JSRA 4LO6B 1GNZA 4XFGA 5CNAA 2BU9A 1RGSA 2WFF2 3IM0A 3WXPA 2XWBB 1PMIA 2WJSA 1A8DA 1C8NA 1W6OA 3Q8BA 4ARYA 5F7UA 2PHXA 1D4M2 4ZU4A 5E89A 4AWDA 3F2ZA 1NCRA 1PO22 2ZX3A 3LKJA 5C9AB 5L7OB 1KJRA 1LOBA 1V6IA 4JZRA 1CIWA 1XYPA 3CJIA 5TSWA 1OH4A 3R6SA 3RYPA 4I0BA 4BQ3A 3I59B 5A7QA 1QH7A 2WNUB 3ILNA 5F5IA 3ZYJB 3OEAA 2DVGA 4TSVA 1YQCA 3OBAA 1HRI1 1OC1A 3PNAA 4PIZA 4KI5M 4FPLA 2YC4A 2CHHA 2ZGRA 2Q8CA 5JCTA 4F7ZA 1RVF3 3FN9A 5HV0A 4Q1PA 5EFUA 2VVDA 4XUOA 4LHSA 1NLQA 4IE6A 4N53A 2RDRA 5DAPA 3VBRC 2VNGA 3A7QA 2JEMA 1ASJ2 5FY9A 3LIHA 1COV3 1VRH1 2JG8A 5FWEA 4JQTA 2OUHA 1YC61 1NX9A 1BBT3 3RJRA 5IYYA 5JAXA 2JDMA 1HV0A 5FUIA 4K8RB 1DYKA 1UXXX 2Y6JA 4ITCA 3MW2A 2ZEXA 2ZKLA 4TN7A 4RHV1 5LWBA 1V0AA 1PM7A 4RR3C 2R49A 2VZVA 3V64A 2PLV2 5IFTA 1AR91 2VZ3A 4D0QA 5C8CB 3ZFGB 4ASKA 4I02A 4XABA 1UU4A 1WD3A 3MI8A 1ST8A 2DCKA 3AL6A 4IXLA 1U5XA 3WF1A 3ZXJA 2ZXQA 1UXZA 3C7OA 4UFMA 2Q30A 1CR7A 2NN8A 2Q1MA 1UOJA 2C5DA 2VXRA 4AOCA 4QX5A 2GDFA 1FAYA 2P34A 5FKCA 4XDPA 4A42A 1W8NA 2XWJB 3O1UA 1QJFA 1RUG3 2PA7A 1VBB2 4K3UA 3U0ZA 4EN8B 3CEWA 3ZFFA 3L2YA 2AEYA 4NUBA 2B5HA 3FMGA 1F15A 1FMD3 2JDHA 2P3IA 2WA3A 2XOMA 4O9GA 5FTTC 1YQ8A 4SLIA 1UZWA 4R9CA 5FPUA 5A1FA 2K46A 3WQBA 1QH6A 4QGMA 1OOPA 5E88A 2JDUA 3I97A 4AEDC 4QXBA 1ODNA 4YFWA 1NOVA 5F3CA 2BNMA 4NRMA 4S2HA 4GJYA 4Z92B 3WG4A 2CSGA 4GWIA 4IV3C 3QH7A 3VBSC 3VKOA 3VKFC 5KR7A 4FT8A 1AR61 1J3RA 5I0UA 2XBO3 2VMCA 1PIV3 3IAPA 3VD9A 1S2EA 1Q8VA 4JC1A 3FL7A 3WV6A 2BWAA 5FYYA 2UWBA 2VW2A 4D94A 2XR4A 5FUNA 5KC5A 5L9VA 1IPJA 5CG8A 1O3RA 3H1WA 1YIFA 2ZGQA 4XTPA 1K45A 3WX5A 1FPN3 4OZXA 4D6SA 1W9FA 5DUXA 4X6RB 5HBAA 1GSLA 4JGZB 4CU9A 1S0BA 4QQHA 2BV4A 2HWD3 4BK4A 1LB2A 1OA2A 3BUCA 2ZX0A 3A0NA 4N9HA 1HLCA 1NA1C 5JI7A 3T0AA 1J3QA 2NM1A 1X8EA 2RMU3 1OFSA 4KG0A 5KHKA 2BZDA 1BVVA 1FT9A 1N47A 3IIAA 4AF9A 3O1SA 4H7MA 4M0NA 1VBC3 4QHOA 4CPBA 4B4QA 2FDJA 1GOHA 4KNCA 4P9YA 3K51A 1D2QA 3CMGA 5FZOB 2IC1A 3I3EA 4AFDA 1KDKA 4KGQA 4ASLA 2XJUA 4D8MA 1H6XA 1VBE1 3LF7A 2D98A 1RMU1 1JODA 2ZHKA 5ACA2 1RUG2 2FCTA 3WD5A 1C1LA 2OUJA 2YMZA 3FX3A 1YIPA 2D93A 2JX9A 4TLFA 1SBDA 3KQ4B 1JHNA 3LOIA 1KQRA 4JHTA 3NJYA 3T2OA 1W6MB 2ZGLA 3MUZ1 2CY6A 1PM4A 3TEWA 1AVBA 1WA6X 2JIGA 1SMVA 2XLAA 3TEXA 4BH9A 3PVOA 4JDMA 4I0WB 3N4MA 3ZVXA 1REEA 4AFBA 2HWB3 2JKXA 4W50A 3GNEA 3VBUC 5C33A 3P5BA 1US3A 3WNMA 2WO2A 4QB1A 4XVHA 5FYHA 3WINE 2YDEA 4WVMB 4OI1A 3UK9A 4QX2A 1T6BX 1VAKA 1CVNA 3BU0A 5K8SA 2VBDA 4URAA 3ACHA 4YYOA 4Y1XA 3NMBA 1C3HA 1Q5OA 3A0KA 3N9OA 2B46X 3OYWA 3KHBA 4ORFA 3SITA 5T5JA 3ES1A 3ZR5A 4BQ2A 2X5IC 1RUC2 2ENRA 2WWSA 2WO3A 4XIKA 1KJLA 5DG1A 3POYA 2FBEA 5FXVA 4EN7B 5T5LA 1J59A 3WEZA 3HBZA 1AXZA 3QD6A 4N43A 3IDBB 3VDDA 5C70A 1VB2A 2B8MA 2BPA2 1O3QA 2RMU2 5JR2A 1CAUB 4ES8A 2A5ZA 1GBGA 3FHQA 5JOWA 4IEXA 1HB3A 5F8PA 1W9WA 1CAVA 1IQAA 1V6JA 2D44A 4RD7A 2ZGMA 3CZUA 4OHZA 2PAEA 2X10A 4A4AA 5C4WB 1H0BA 2Q1ZB 3WUDA 1RUI3 2I74A 4XUQA 1OSGA 2EALA 4L99A 5DDJ1 3USSA 3W21A 4AEJA 1UOBA 2OZ6A 3HNMA 1N3PA 2WBKA 4OUMA 3PVEA 1ND3A 4AFMA 5JPNB 1BZWA 1QEXA 3H8OA 2ET7A 2VH9A 2GP3A 3M3IA 4RR3B 1ZRDA 4LXLA 1HIXA 3WHUA 3HQRA 2JB8A 4BXFA 4JCKA 3W59A 4XCAA 2QJVA 1OT5A 3E1F1 2JECA 5L73A 1LU2A 2W9XA 1XJAA 2FHRA 3ORJA 3R4UA 4RL7A 2X8KA 4Y20B 1U5IA 3GJAA 4K7JA 5FUPA 1OUXA 5FY5A 1PVXA 3HIFA 3OSDA 4QKDA 4XF0A 3K48A 3OB8A 4CEYA 3S6PA 3OBZA 1DHKB 2F4PA 3OF1A 2GZWA 5LASA 1ZBA1 3R4SA 1OPOA 3NAPC 3UL2A 3K2OA 4FAHA 1LULA 1AYM3 3IDEA 5HCAA 4EN6B 2JDKA 3MFCA 1H8VA 5DABA 5L9BA 2WZPP 4BQ1A 4JV4A 2B45X 1ULDA 4Q0QA 3VV1A 5J48A 1ENXA 2RS33 2O0OA 3ELNA 2B4KA 4AEDB 1O4YA 2MEV2 3ZSLA 2ZEWA 2P17A 1AJOA 4RFT0 2B39A 1UWWA 3HQUA 1ND2C 4FPEA 4Q27A 5A3NA 4IV3B 3N9MA 2HWC2 4CCJA 3AJYA 4TXWA 4CRQA 5FXWA 4PI2A 4IERA 3MIHA 3SH4A 5IATA 2V73A 2RHPA 1OVSA 1NZIA 4CVUA 3MIDA 1NQJA 1PO11 3MF9A 4LITA 5IUQA 5LZ6A 4IESA 2VU9A 5FZ6A 1RUI2 1GP4A 1HRV2 1GQPA 1LOAA 1VAMA 2C0ZA 2WNVC 3PURA 4MZUA 4XPVA 4DEQA 2QQUA 1V6NA 2CAUA 2QQLA 2R072 5A7WB 1NXMA 5E6HA 3PIJA 3T4VA 4DIQA 4Z8BA 4NVPA 5AVPA 1NT0A 1JUIA 2RJKA 1AHSA 2Y6HA 1LNSA 1UZ0A 3AL5A 4FTBA 3PIGA 1HRI3 1JOJA 4AXOA 4P02B 3UJQA 5I91A 3CDZB 3R05A 1GICA 1EV12 3ZN6A 5CA6A 2WS91 1O4ZA 1PVC2 5J98B 4CU6A 4XFHA 4JGYC 5FZFA 3SISA 4IUGA 4NAOA 1LOEA 2WSUA 4YG6A 3ATGA 4E27A 4OHVA 1HJGA 3N7LA 3F95A 1VRH3 3VBFC 1H8TC 1UY1A 4HLTA 4XUPA 4FP3A 4CXXA 3E6BA 3J8F3 5FZKA 1D4M1 1UKGA 1QQP2 3VL8A 4LBQB 2VVEA 1TVGA 3D0SA 2GN7A 3K3NA 3KF3A 4IW3A 2Q0AA 1AYM2 3H8RA 1W0OA 4RHV3 4WM7A 1RUH2 1WCDJ 1J1TA 4FFFA 1A8MA 5EHDA 1ZZCA 5FFOC 2ZACA 3C3VA 3M3CA 3RFRA 1NCRC 1GQGA 1CIYA 3LIGA 3LZZA 3CJIC 5GZGA 1WCUA 3WP4A 4E4HA 2VZSA 1Q43A 2C1FA 2D3RA 5JIAA 3AVRA 4PLMA 3EQEA 2A7AA 3U37A 4CZSA 2O8OA 1QXJA 2IVIB 2PHLA 3OGJA 4K40A 4QM9A 4F3JA 2KR2A 1G7YA 5FDBA 1NLRA 1XU2A 3O14A 3IPVA 4GWMA 1X9PA 4NIGA 3HJRA 1POV1 2QCSB 1H30A 2UYAA 3H1MA 2KXLA 4Y22B 5F3GA 3RGBA 2VD7A 1CZSA 4AVSA 3OPZA 4E4ZA 1E57A 4FPOB 3W9AA 2HYKA 2JG8C 5T5OA 1WW6A 1QJY1 3JU9A 1QJX1 1XYOA 3E5XA 4JKLA 1H2KA 3ZLIA 2A3XA 4YM0A 1ULPA 3ENRA 5GM0A 3ZYIB 1MQTA 4TYSA 4L0PA 1OLMA 3SHRA 2XVGA 2JENA 2XVLA 4AI1A 1ZZ8A 2EXIA 2WZEA 4IL7A 3ZDVA 2A6VA 1LOFA 4BOWA 3DUIA 3D8CA 5EPAA 3O1MA 4GH4A 4B1LA 4BLJA 3VZNA 2OPWA 4PQQA 2Z5WA 4OFGA 3WF4A 4YZ2A 1ONAA 1BXHA 1F5FA 4I30A 3VKMA 5C3SA 1DQ5A 1VRH2 5FK7A 5IVYA 2Y26A 3C2UA 4LBJA 5T54A 1W99A 2WZR1 4DINB 1PZ7A 5T5PA 2FDFA 1P8JA 4GJZA 2HWE2 2H6CA 2FDIA 1VBB1 4YVWC 3VUOA 2Z2SB 1APNA 2YPDA 3DKWA 3CQOA 3E6DA 5KHHA 1HDKA 1MVQA 2DURA 4RHV2 4NRQA 2RR11 4CDXA 4ZZ5A 3BVCA 1AX1A
chains in the Genus database with same CATH topology
2BVBA 4IV1A 1R093 2KA3A 4AHYA 2UWCA 3ZFFC 2Z69A 1AR92 4HPKA 1MZ6A 1DG6A 1UIJA 2OIIA 2QFEA 4OI2A 2IZWA 2ZGPA 4W6YA 4ZXKA 1UU6A 2D6OX 1OOPC 2CGNA 1YNAA 1YO8A 3ZSKA 2ARXA 3HAGA 4GKXA 4MXWB 1AF9A 1J58A 4A2UA 1VBE3 1RMU3 4L8QA 4QPYA 5FRAA 5HXVA 1R1ZA 4BIOA 1YXWA 3OCPA 2DUPA 1SCRA 4M3CF 3N36A 1NCQA 1ZBE1 4A7ZA 4KU8A 3AKQA 2PYTA 4JDOA 2YC0A 1NZCA 1M06G 1ND2B 5K0UB 3DF0A 1O5UA 1W6QB 1G86A 3VBHA 1CQ9A 3AJZA 1I1EA 3H8UA 1AR62 1B09A 4YVSC 2SBAA 5JOZA 1AL21 1MS5A 4FPGA 5DUVA 2YXSA 2A6XA 4AI0A 3RI9A 1WLDA 4NHMA 3J4UH 2DUQA 2WNVB 4J6GA 3T1LA 4XFBA 4FO9A 4RA0A 4QPGA 5ACA1 4QGLA 1R083 4CDUC 4PDWB 1O3SA 3KM5A 1JYIA 4WVZA 1W6NA 4LTAA 1ULGA 1RJ8A 4GB32 4LULA 4MGYE 4PLOA 1H2NA 1V6KA 2D3SA 4XIOA 3VBOA 4LO5B 4JGYB 1MS8A 1ZX5A 2XHKA 4YM3A 5C8WA 5FOBB 4YRDA 2R6QA 4YFZA 4S2FA 3LWCA 3VZLA 1Y7BA 1QHDA 2ZPXA 4LO7A 3MDPA 3KB5A 2RM21 4MXVA 4S2GA 3OBRA 3O0XA 5DDJ3 3M4FA 1PNGA 1EP0A 2GNDA 2D40A 3ZYRA 1OMIA 1RMU2 3USUA 3RYKA 1IHMA 3M3QA 4URTA 2XUMA 5KXEA 1RUC1 3QCWA 2JKBA 2W0XA 4JRLA 1FI2A 4XJZA 2ZX1A 3B9CA 5KHGA 1NY71 3MLLA 4FOWA 4DFSA 3AZVA 3JQWA 2E9QA 3ZN5A 4BE3A 3T2TA 1VB4A 4COZA 2VQAA 4XHBA 1AJKA 1MS0A 4P9WA 3VDDC 3WDTA 3RPQA 2OYZA 1ZBA3 3BPZA 1HQWA 1HKDA 2OVUA 2UU8A 2QUOA 1SLTA 2JG8B 4R9BA 1DFQA 2GSYA 4D69A 4Q0UA 1MEC1 1DF0A 3WQ7A 4Q0VA 1GZWB 3NV4A 1DZRA 3MIGA 1ND3C 1S0DA 4YW1A 5CVRA 3HWJA 1YHFA 2CV6A 3WG1A 5KBFA 1PO13 4RS5A 4OHYA 1HW5A 1KFXL 1NYWA 2D97A 5DDJ2 4AE2A 3AKRA 4WBBA 1XU1A 1B35C 1X7NA 4YVWB 2ZMNA 3AX4A 3ZXAC 4SBVA 3FLTA 2IXCA 3AP9A 2RJLA 1F5JA 2JG9B 2GH8A 1XYNA 3IT8A 2E53A 1SLCA 2MEV1 5L19A 1UIKA 2UY9A 4LLOA 1ZZ7A 4M3CA 4D7TA 5F1RA 2HWC1 4LBKA 4UW4A 1OOPB 2ZGUA 3ETQA 4B3NA 2G4IA 4BMBA 2XKPA 1D4M3 1ZBA2 1Z78A 3M7AA 3AB0A 1H1MA 2TUNA 1LHUA 5EZWA 1C57A 1G9DA 1DQ4A 2CNAA 3L9JT 1S0FA 2V09A 1MS9A 5LRRA 1EV11 1PVC1 4AHXA 1BJQA 1AL0G 1XRUA 2FMDA 4YVSB 5FREA 4KL1A 5BNQA 4GALA 3LA3A 1CAWA 1PO12 1POV3 1IS5A 2AUYA 4INDA 5ABJA 4CDUB 1QNWA 1QJY3 1HX6A 3AK0A 4X8NA 5EJ3A 4DRVA 4K1YA 1QJX3 1SBEA 3OD0A 1ULCA 1LEMA 1F2NA 1U0AA 4QPIA 4HBNA 4N7IA 3RMXA 4Y4YA 5KXDA 1T6GC 2WS92 3ASIA 3FLPA 4WM7C 1Q8QA 3GZAA 4NN0A 4FXGB 2WT2A 2WZR3 3WCRA 4YG0A 3B01A 2GMMA 4XXAA 1SFYA 4COYA 1YRZA 2I2SA 4DPNA 1PK6A 4Y1YA 1ZRFA 2GC0A 1K5MB 1VBB3 1Z0HA 1MACA 1OPMA 1C5IA 3WHTA 2RR13 3ILRA 5JZGA 2I45A 3KSCA 4CDWB 5A32A 4CP0A 3NVCA 3NV1A 3WDVA 1OA4A 5J7MA 4C1XA 2FQPA 2WQZC 3SCHA 5SV8A 2ATFA 2W52A 1VJ2A 1YWKA 1MQTC 3VDDB 3WW1A 4B29A 5GZEA 3QLQA 5EYXA 5BXXA 1LOGA 4Y5Z0 4A7YA 1LOFC 2UURA 4BMEA 4PBPA 4GH4C 2A3YA 2NMNA 1R1A2 1IKQA 2ZZJA 2HWE1 4XILA 5J36A 1CAVB 1RC6A 4EJRA 3VLBB 4YNIA 2BGCA 1QJY2 1TEIA 3WG2A 4E4SA 1QJX2 2VQ0A 2WT0A 1OLRA 2ZGSA 4ISRA 3AMNA 3DPRB 4W6XA 3URFA 4OHXA 1H9WA 1LESA 5AVAA 1WBFA 4CDXC 3MF6A 1SLIA 1AL23 4IV1C 3X29B 5J09A 1EAH2 2WZR2 5BUVA 2W08A 5GLZA 3ST7A 4P9IA 1B35B 2LALA 5ACA3 4PJYA 1S0GA 3APBA 4Y1ZA 4NHKA 4CEWB 2ZGKA 2RR12 5AFBA 3FC0A 1F31A 1UX6A 1BMV2 1O91A 2D3PA 1PGL1 2FMYA 1KITA 1CN1A 4QHBA 1NCQC 2JXAA 2VMGA 1S0JA 3ZFEB 5BNNA 3N35A 3TOJA 3JQXA 1QNYA 4FQZA 2SLIA 1QJU1 2AENA 2GMPA 1QGLA 2RM23 4N9IA 2R1DA 3POSA 2EIGA 1DYPA 4GMP0 3VBHC 1RITA 1NXD1 1CAXB 5CFCA 1ZNPA 3BB6A 2A73B 4OHWA 2XPJA 4KQ7A 4AGVA 1RUC3 3FZ3A 1Y9QA 4E9KA 1ZBE2 2ZX2A 4UBHA 2PTMA 3TB0A 4FP2A 4WM8A 5T50A 3V0AA 3LA7A 4GB31 4XFAA 1VR3A 4DNYA 4QT6A 1JTZX 2XGXA 4HANA 3FFZA 3MIFA 4OUSA 2VUJA 1AL22 2IFRA 4FVVA 2IFWA 5JI9A 3THPA 4Q26A 1LOCA 4DOUA 5GLTA 2ZBJA 1OFNA 1SLBA 3PVBB 5BNPA 2WNEA 3OBTA 4LLFA 2ETEA 5D8AA 4GQ7A 5KWRA 3R0RA 2DVAA 2DCZA 1YFYA 3JB4C 4HKWA 1GZ9A 2QKDA 1JXNA 1MEC3 1YFUA 3LGRA 3U10A 3ZDSA 4H14A 3B94A 3RMYA 2B42B 4GA9A 3V56A 4B4RA 3RZZA 4AHWA 4ZKTB 5BNOA 2YV8A 1ULFA 2X53S 4G3YC 4R52A 1WD4A 4XF3A 3FBMA 1MZ5A 4RQPA 4J1XA 3EHKA 1ALYA 4AFAA 4P9GA 1DGWX 4QGNA 2RM22 3MLKA 4AGRA 3JCIA 1TME1 2TNFA 2WC2A 4COWA 2PN5A 1SFNA 2PQQA 2VULA 4MVTA 4KBBA 2A71A 3AM2A 2MEV3 3VKNA 1NY72 2ES3A 2HWC3 3HQXA 4EWAA 5C9AA 4YGDA 5L7OA 1BCXA 1LODA 4JVAA 3VBRB 2BEOA 2JJ6A 1LHOA 3I59A 3WLUA 2FZ1A 2JDZA 2WNUA 3THTA 4MSVA 5JDBA 4AI2A 4Q8KA 3MZHA 1EPWA 3U4XA 3JD72 3S7EA 3IMNA 3SCGA 4NO4A 5I0TA 3GBWA 2HKXA 5IK7A 1HRV3 4Q4X2 1UL9A 2OA2A 2R073 3FHIB 3KLSA 4RS5C 2DVBA 1JN2P 1YI9A 4M01A 5K7PA 3MICA 1MEC2 2IXLA 1TMF1 1X50A 2DUOA 1EV13 4XQWA 3OGGA 1PVC3 1W39A 3QH6A 3RRDA 4LUMA 1LR5A 1YUDA 3E5QA 4MUVA 4CDXB 1O3TA 3VGIA 3KCXA 1C4RA 3CF6E 4IV1B 2EF6A 4HPKB 5JOYA 3KT4A 4XFCA 3ZMOA 1QQP3 4JQRA 5C8CA 5GZDA 3D0JA 5T3NA 3ZFGA 2XLGA 2VGDA 4H3WA 1UKRA 1QWRA 1BYHA 1RUH3 5AC92 2E7TA 1DZTA 1N1TA 1URXA 1CJDA 1LJ7A 1GLHA 3GHNA 3GBFA 4WZCA 1AX0A 3EBRA 2UY8A 4HMZA 3UKTA 3D82A 1NQDA 1WLCA 2HEYF 3QACA 3VBSB 1NCQB 4JTNA 1RINA 5HCFA 5LEKA 4FOYA 3TNQA 4X8PA 5FLJA 2WLQA 2A3WA 2NYYA 5LRSA 1AR82 3RQ0A 3B02A 4IEUA 4JTOA 5DUWA 1DU3D 2LM3A 5ABJC 1NA1B 2P2KA 3GBGA 4XMIA 4XJ9A 1REDA 3V0BB 1AR72 2DYCA 4QPIC 5CBLA 1FOD2 5FLHA 4PLNA 5BPXA 1H9PA 1VP6A 2CGPA 2R0FA 4D7SA 4E2GA 1S0CA 1JW6A 2E51A 4PQ9A 3WZ1A 1LHNA 3A4UA 2HWE3 3OY8A 1RUE1 4AFCA 2LUWA 1W6PA 4LUKA 5KC6A 1RUF1 2VOXA 3FUQA 4YGEA 4FXKB 4DQAA 1DDLA 1PK6C 4OI4A 5LK5A 4LEJA 2GC2A 3USUB 3MIBA 1LCLA 1QU0A 1AR93 2YUEA 3AXDA 3AYDA 4F8AA 4CP2A 4MH0E 3CLPA 2R32A 5GZFA 3VBUB 5JZGC 5EWSA 1D0HA 1QJZA 1G9FA 1W6MA 3WR0A 1QY4A 4LBMA 4N53C 2DVDA 4HVOA 1R1A1 4D3WA 5FCCA 1H4GA 4I3PA 1QDCA 1XQNA 1G9CA 2VNRA 2X5IB 1L3JA 2XJSA 3KGZA 5C6CA 4XFFA 2ZTNA 1TNRA 4YM2A 1IGOA 4WVMA 2YPJA 4NPRA 4XJAA 3SNMA 5A3MA 4IEWA 2DCJA 1XNKA 1IPKA 1AR63 1VBD1 4Q29A 3SXWA 4RGAA 4C1WA 2ZX4A 5CU1A 1EAH1 5CADA 1CGPA 2D7FA 1GANA 1CAUA 4AGGA 4YSFA 2XLFA 3FLRA 3M2MA 4QM8A 1GR3A 4RS5B 1QXRA 4YW3A 1QMJA 2XL7A 1H2MA 2GN3A 3AYAA 1N1SA 4GB33 2O1QA 5C4WA 1BMV1 4OVEA 1O4TA 3S0MA 5HI0A 3WDUA 2AYHA 2D5HA 2C9AA 3M70A 3E6CC 2DV9A 2XJQA 4I09A 1WLTA 3H1YA 4LHLA 2H0VA 3KD4A 4RR3A 1RUJ2 4QD2A 3AYEA 3NAPB 5JMCA 4DMIA 2K2SA 5BNNC 2P3KA 1DQ6A 4ASMB 4GKYA 1DGLA 4AG4A 3AMPA 2GAUA 2ERFA 1RVF1 1EPZA 2TBVA 2ZZQA 3AZYA 3SCFA 3ZXDA 4XW3A 1PGL2 1KS5A 1S2BA 1U5YA 4IETA 3AYCA 1G9AA 4FSJA 3AMMA 4KWLA 1RHI1 1X36A 3TAYA 4KU7A 2MHFA 1QJU2 1CJPA 2D6NA 2NLRA 4R4XA 3B3QE 1TME3 1Y43B 2R042 5FQ0B 1YJLA 4IV3A 1UW8A 3HD8B 1KS4A 1ZVFA 3ILFA 4EWDA 1XE8A 2QQPA 3AKSA 1GYKA 2R16A 4GXLA 3ROUA 3UJOA 1CAWB 1KD7A 3WVJA 4ONUA 1SLLA 4EN9B 4YW2A 1ZYBA 2Y38A 1VLNA 3HN1A 1CX4A 5BNPC 5LEJA 4QU2A 4R9AA 4GULA 5D8AC 3ZXEA 2ZCWA 1AXYA 2OW4A 1DGRN 1YFWA 3H7YA 5GLWA 3I4IA 4DZGA 3VBFB 1H8TB 4LBLA 4I2OA 2XH6A 3AP5A 1WLWA 1ZM1A 2HEWF 3KCCA 4FPKA 4LHNA 1C1FA 1A78A 3VKLA 5BNOC 2AZ5A 2E7QA 3UKVA 2F6BA 4KWKA 3S7IA 4RQPC 2Q5TA 1W6OB 5CB7A 1PK6B 4XFIA 1XNBA 1NCRB 3M3EA 3H0OA 1MZFA 2ZHLA 4I01A 3WDYA 1JYCA 3CJIB 1C8M2 4XTMA 4LBQA 2YGLA 1PIV1 2YY1A 1PNFA 1VIWB 1GV9A 1G8WA 1MS1A 1SACA 4N43C 5E8AA 1DQ1A 3M1HA 3ZMNA 5GJ6A 3JD71 5C9AC 5L7OC 2PHTA 2D6KA 4UW6A 4N53B 1TME2 3ES4A 4Q4X1 1V9U2 2CWSA 3HT2A 1PGSA 5E1RA 1FV2A 2HWD1 3WOGA 1DGRA 4Q4Y1 4HKOA 5BV6A 2AGSA 4P14A 1OD5A 1BQPA 4AQ2A 4Y22A 4L97A 2EAKA 3CU7A 1WMFA 1LRHA 1S1AA 4HZFA 1GKBA 4K1ZA 1BKZA 4AEMA 3ZXKA 5I0SA 1I5ZA 2QVSB 4PIYA 1IS4A 3AZZA 1SQ4A 1RIRA 3D5OA 4FPCA 3N3HA 4ZU5A 1ZRRA 1X33A 2XL9A 4WV8A 2WIIB 4P9JA 4CEYC 1ENRA 4AYUA 3TNPB 5AC91 3IKWA 3MIEA 1TMF2 5C8CC 2VW1A 3PJQA 2B9UA 5JWPA 2WS93 2HWB1 3I54A 3ZFFB 5CFDA 4J1WA 3NL1A 1ZA4A 1CD3G 4Q0SA 2BQPA 1IZ3A 2HWF2 3W58A 1F8VA 4P9XA 4K8FA 2H6BA 2ZHNA 4AQTA 4BYYA 2WSVA 2IWGB 4FAGA 3ZIWA 1RUE3 5BNNB 2PHFA 3HR9A 1O7FA 1RUF3 5KHIA 1AR81 4K9SA 1SBFA 2BNNA 1WMEA 4FPJA 3P3PA 3NWKA 5A33A 4AQSA 2A70A 2CTVA 2VY0A 1RUD1 2YHJA 4AVTA 2I07B 4XJUA 2VOVA 1FNZA 5FMOL 2ZA9A 5DZGA 1AR71 1HQNA 4YZ1A 5GLVA 1WMDA 1FOD1 2Z42A 2E63A 5F5QA 1HXS2 3ZPYA 4OLLA 4DXZA 5KXBA 1ND2A 5K0UA 1R1A3 4YZ4A 5EYYA 3CJXA 5FMOS 4K20A 4AK3A 1FXZA 4YARA 1JH5A 2WINB 2QE3A 2ZGOA 3P3NA 3FWEA 5BNPB 3AKPA 3RYRA 2WNVA 1YJKA 4AW7A 2VVFA 5D8AB 3MPBA 1DQ0A 3O12A 2MPFA