3HR9A

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase f40i mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
SAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMILYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase mutant F40I
rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
molecule keywords Beta-glucanase
total genus 58
structure length 241
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2009-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hr9A00
1KJRA 1LHWA 3UJQA 3TB0A 3HR9A 5KXEA 3N7JA 1W6NA 3AZYA 4YG6A 3UK9A 1TEIA 2GNMA 2JJ6A 3BIWE 4XZPA 2YXSA 4GWNA 1KDMA 3ZXJA 5H9SA 2OVUA 3NV3A 1LOEA 1SBEA 3HN1A 1S0JA 1FNZA 1CVNA 4BM8A 1AXKA 4U36A 1DFQA 3AP5A 5H9QA 1WW5A 2A6YA 3PVOA 1D0HA 1HDKA 5DUXA 4FQ4A 1ZM1A 1F5FA 1FX5A 2NZ9A 3SH3A 1AX2A 3OY8B 4TZDA 4GKXA 1GKBA 3ZYRA 1LHVA 3FUOA 5T50A 2ARXA 1Q56A 1QKQA 3OY8A 3GALA 2H0BA 4LBQA 1G9DA 2ZGOA 2UWAA 1WW6A 3AXEA 2ERFA 2FHRA 3ILRA 4XHBA 3LSDA 4XIKA 4BPZA 4Y22B 1HQWA 2EF6A 3TAYA 1S1AA 3IPVB 3WCSA 1QOTA 1LEDA 5HCBA 3AYEA 4Y20A 2WT1A 1IS6A 3WG3A 4R9DA 1G86A 4Q26A 5JVVA 2DVAA 2P3JA 3MW2A 1NXD1 2ZGQA 4KBBA 4LBJA 3VKNA 4YW5A 1FATA 1CPNA 1S0CA 1PZ7A 2JE9A 2B7YA 4NO4A 2P3KA 2UWBA 2A70A 4WV8A 1LENA 3WHTA 4ITCA 1GYKA 1LHNA 4M3CA 4PCRA 1HLCA 2NP0A 2D6LX 4YW3A 1G7YA 1AXZA 1O4YA 5AVAA 2VUAA 4FPLA 4Q1RA 3WDXA 3AYCA 4XJ8A 4PBOA 5DG2A 4ISRA 2W08A 1FAYA 3APBA 4YLZA 2JECA 3POYA 1LGBA 3L2YA 1DQ6A 4YM3A 1CJPA 4ZKTB 5DUUA 2W68A 4Q2FA 1DHKB 1YXWA 1ULGA 2NMNA 3OPZA 3V0BB 4R9AA 1OFSA 3AJZA 1V6LA 5DZGA 2VU9A 3SH5A 2D6KA 3VV1A 3V0AB 5T5PA 4YZ4A 4I30A 2R49A 3ASIA 3B69A 1CIWA 1SLCA 1UZYA 2DU1A 2ZGKA 4OZXA 2DYCA 5DUWA 3ZXKA 3POWA 4DFSA 4YGBA 2AR6A 2GMEA 1HKDA 3WLUA 1MS8A 1V6OA 1CONA 4Q1PA 1LGNA 3FUQA 4LBQB 3POSA 1ONAA 1SLTA 1GANA 1SACA 4XXPA 1QU0A 3DUIA 1GZWB 1IKQA 3RG0A 3N7MA 4AVSA 2AREA 1GNHA 3ZSLA 3N3HA 4YGCA 2CY6A 4YZ2A 1RITA 5F9TA 5IUQA 3GNEA 5T5JA 4XHXA 3AP6A 1IS5A 1AX1A 2R1BA 2AENA 4GWMA 4AVTA 1N47A 4YW4A 1R1ZA 1GLHA 1W6OA 4XILA 1LGCA 4JC1A 1MVEA 1Q8QA 3D4KA 1LHUA 3KM5A 2ZGRA 4M01A 4JCKA 4WZFA 1JN2P 2DVGA 1W0OA 4K20A 2C5DA 2DUOA 5CBLA 3M3OA 1SLAA 2P37A 1MS5A 1ULDA 3D5OA 3DGTA 1V6NA 1IOAA 1AZDA 1V00A 3O5SA 1Q8VA 3OJBA 4Y24A 1LEMA 2A75A 4Q8KA 1FV2A 2A5ZA 3D6EA 1MZ5A 4JRAA 5GLZA 3N7KA 2UURA 4FPJA 2NMOA 4XBNA 4XOGA 4CRQA 2DWRA 5EWSA 3T1LA 2ZGNA 4UW3A 3T2TA 1ENSA 5GLTA 2ZAAA 1DQ5A 3INAA 4AGRA 1ULEA 4YG0A 4FP3A 3AFKA 4P9XA 5CNAA 2EXHA 1FNYA 2A7AA 2OUHA 1CQ9A 1YRZA 2VH9A 3WUDA 3ZSJA 4H55A 4XTMA 2AH2A 1H30A 3UL2A 5KXBA 4FOQA 4Z8BA 1I3HA 3WVJA 1WUVA 4Q8LA 3WV6A 4YFZA 1UAIA 4XXAA 2DUQA 3FFZA 1MS3A 3CNAA 2ZGSA 1UMZA 3QLQA 5JOXA 1C4RA 5GJ6A 3M3EA 2WQZC 3O12A 2PHTA 3B00A 3M2MA 1CPMA 1SLLA 2CTVA 4YM0A 3U4XA 1RIRA 1KRIA 1W6PA 4L8QA 4PF5A 1KQRA 1AVBA 2E6VA 2A6ZA 1S0BA 3VUOA 1WCSA 4LBMA 2NN8A 1W6MB 3ZXEA 4ATFA 3FBYA 3W59A 3ZPYA 1LCLA 1SCSA 4FOYA 4C1WA 1WLDA 2GMPA 1Q8SA 2WT0A 1S0DA 3V0AA 4BLJA 1YYNA 3QCWA 2ZHNA 2GNBA 3WZ1A 1MS0A 1ZA4A 4SLIA 1NLSA 5CA6A 3N35A 1CR7A 1H9PA 2P2KA 4M3CE 5GLUA 4YZ1A 1JYIA 2D7FA 2XB6C 5GLVA 3LSEA 2NM1A 2VW0A 4RA0A 2Q5TA 2D6PA 3Q9OA 3WNXA 2D6MA 5E89A 1SLIA 5DG1A 4FPHA 2V5YA 1WLCA 2W39A 1LOCA 2WLQA 4GA9A 3ZYPA 3AK0A 5JOWA 5GM0A 1Q8PA 2G4IA 3LCPA 3WG1A 2CNAA 2ES3A 2BQPA 4DS0A 1PZ8A 2D6OX 2GNTA 4MYEA 1X50A 3RS6A 2JKBA 4FPGA 1N3PA 4AVVA 2A6XA 2GALA 2D3SA 1DIWA 2D6NA 4LBKA 3RSJA 4DPNA 5GZGA 4XMAA 1IKPA 3A0KA 2ZGUA 1UKGA 2ZA9A 1F9KA 1G9BA 2YY1A 4BLIA 2VXRA 2CWMA 2JE7A 2I2SA 4FPKA 2E7QA 4GKYA 1AJKA 2ZKNA 4IQPA 4Y1XA 1G9CA 1APNA 1PZ9A 1JW6A 5DXDA 1QF3A 1C57A 3VKMA 2EALA 1Z0HA 2SBAA 4FOVA 1G9AA 4ISQA 2ARBA 1N1SA 2DVFA 3FLTA 3H0OA 4BQ1A 5IK4A 3W58A 5SV8A 1GZ9A 1N1TA 1GSLA 1MS1A 2ZACA 1WD3A 1LOBA 5T55A 1J1TA 5IK8A 1KDKA 1N1YA 4XYXA 3N36A 5EYXA 4BMBA 1QOOA 2VW1A 2XG3A 4LBOA 3WDYA 4FPFA 1WBLA 3T1MA 1QGLA 3RQ0A 5JLVA 1LHOA 1W6PB 1HQLA 5DZFA 3AYDA 2JD4A 5CAZA 1DQ2A 1LULA 4Q27A 4YZ3A 2YV8A 1IS3A 1Y7BA 1GZCA 4M00A 5T54A 4BOWA 1LOAA 3A0NA 3VKLA 1UX6A 3WG4A 1S0FA 1QDCA 4ASMB 4W65A 3M1HA 2DTYA 2WJSA 1A78A 1F31A 4U2AA 3KQRA 4RL7A 3AP4A 3BTAA 1LOGA 2Z42A 4P9WA 1GV9A 1DZQA 1MACA 1O4ZA 2A6WA 4WVWA 1BJQA 4BMEA 2EAKA 4DRVA 2NYYA 3ZVXA 3AJYA 4YFWA 3PVEA 3MPPG 4NOTA 1LODA 3AP7A 4FQZA 1LECA 1MS9A 2DURA 4K21A 2YZ4A 1I1EA 2PHWA 3FLRA 3B9CA 3BODA 5FRAA 5DZEA 2OUJA 3N7LA 3WCRA 2VY0A 1XQNA 1WD4A 1GZWA 2R0FA 4XDQA 2WSUA 1S0IA 3MW3A 4LBNA 4XJ9A 1JUIA 4LBQD 2R0HA 2PHFA 1DGLA 1N3QA 1Z78A 2GNDA 4LBLA 1ULFA 5GZEA 1VAMA 1DBNA 1AJOA 3AX4A 1ENQA 3B3QE 1MR5A 1S0EA 2GN7A 4XBLA 2VW2A 2WSVA 3OBRA 4AYUA 1UN1A 3M3QA 1BZWA 1V6IA 1QNYA 3R4SA 3OYWA 4YM2A 4YZ5A 1AXYA 5JOYA 4UW4A 1MZ6A 2DVDA 2ZMLA 5T5OA 2ZHLA 2WT2A 1YO8A 1WW7A 2TEPA 1AF9A 2HYKA 1QOSA 4UW6A 5LK5A 4R9BA 3ILNA 3ILFA 2D43A 2EXJA 2A3YA 2OW4A 2A71A 2CWSA 2GN3A 2ZGLA 4XMIA 4Y1ZA 1VLNA 3IM0A 2KM2A 3C2UA 2ZMNA 2ZGMA 4FPOB 4FOWA 4HANA 4PBPA 4UW5A 3M3CA 4C1XA 1W6NB 1FV3A 3OGGA 3O0XA 1W6MA 1QDOA 2A3WA 1G8WA 3WHUA 2CL2A 1UL9A 1QMJA 1W6QB 4Y1YA 3PJQA 5GZDA 1V6MA 3JU9A 5JDBA 4P9YA 2PHXA 1LOFC 2E51A 5DUVA 4FP2A 4XJZA 3ZSKA 4YW2A 5HCFA 1G9FA 5KXCA 2CYFA 1SCRA 3ZSMA 2ZBJA 2PHUA 4DQAA 4HL0A 4XE9A 3SISA 4PQ9A 1UZZA 4AGGA 3OBTA 3NV4A 2SLIA 2PHRA 1WLWA 1Q8OA 3MEPA 4XBQA 4Y22A 3V64A 1BKZA 3JUUA 4YGEA 1QNWA 4Y20B 5IK7A 1DYPA 3ZXFA 3WG2A 1WBFA 1LOFA 2WKKA 1A3KA 1D2SA 1A8DA 3NWKA 1CN1A 5H9RA 5CB7A 4AWDA 2GMMA 3AZZA 3AZXA 4XTPA 1GNZA 4Y26A 5GZFA 1DYKA 3AXDA 3AYAA 4Y1VA 4D69A 3RRDA 3UJOA 5FREA 3NV1A 2V73A 5F5QA 1LJ7A 2YMZA 4GALA 5IK5A 2A6VA 3VKOA 4ZXKA 2UWCA 2A3XA 2E7TA 2YROA 5BYNA 1YIFA 3AZVA 1CESA 4AGVA 1BQPA 2R16A 1UPSA 2P34A 1S0GA 3WDVA 2WNEA 1VIWB 1WW4A 3VKFC 3HMYA 3IMNA 4FPYA 2ZABA 5E88A 4WVVA 4P14A 4XJUA 1LU1A 1SLBA 2D3PA 1C1FA 3IPVA 5GALA 4FPCA 2DVBA 2W52A 3AP9A 1EPWA 5JOZA 3PMEA 1LESA 3V0BA 3O0WA 5IT6A 5EXOA 2EXIA 4XIOA 2AGSA 1V6JA 1W6QA 1H9WA 1ULCA 2C9AA 1MVQA 4CZSA 1GICA 1B09A 3B01A 2RHPA 4CTEA 1DLLA 3SH4A 4FPEA 1DQ0A 2EXKA 1V6KA 1RINA 2ZHKA 2ZZJA 2ZMKA 3I8TA 3WDTA 4F83A 4M3CF 4XJWA 5T52A 4M3CB 4YW1A 3BOPA 1ENRA 2D3RA 1JHNA 2EIGA 5JMCA 1BXHA 2FMDA 1W0PA 3O0VA 5GLWA 5GZCA 2E53A 1SBFA 4YM1A 1AX0A 1GBGA 2AYHA 3WOGA 1DQ4A 2DTWA 2P3IA 2R1DA 1OKQA 2LTNA 3FLPA 3RMXA 4ATEA 3I4IA 2DU0A 1VAVA 3MW4A 2GDFA 3ZXLA 4DRRA 1SFYA 1JBCA 1VALA 2UU8A 3R05A 1URXA 3USUB 2DUPA 3WUCA 1N1VA 5E8AA 3RMYA 5T5LA 1LTEA 1BYHA 2ZHMA 5KXDA 5HCAA 3V65A 3R4UA 5L73A 3IN9A 3PVNA 3USUA 5EYYA 3A4UA 4Y1UA 5H9PA 3SITA 1JXNA 3AZWA 3ENRA 1KJLA 1KITA 2ZGTA 3WDUA 4XJAA 3SNMA 1W6OB 2DV9A 1YI7A 3ATGA 4GXLA 3SLIA 2LALA 4K1YA 1JOJA 3OYWB 1DQ1A 1MS4A 1N3OA 4TYSA 3NV2A 2ENRA 3WDWA 4YGDA 4FVVA 1C1LA 1U0AA 1JYCA 4YG3A 1FYUA 1LU2A 2D44A 3IKWA 4K1ZA 1IS4A 2PELA 1OQ1A 2ZGPA 1SBDA 2JDZA 2AUYA 4R9CA
chains in the Genus database with same CATH superfamily
1LHWA 1OD3A 4HG6B 2Q8CA 4CYDA 1SHWB 3UT0A 5IAVA 3HR9A 5FY8A 4A4AA 1GP6A 1D4VB 1O7FA 1W0NA 5FLHA 2BW8A 3VL9A 2GNMA 2ZEXA 4XZUG 1PMIA 3BIWE 1R083 1R1A3 4N43A 5D1IA 3B5LB 4Y4RA 4MG2A 1OXCA 2MNGA 4JDNA 4JKKA 4W6XA 1EV12 4KI5M 1W3VA 3AL6A 1S0JA 1CAVB 1CVNA 4IESA 5LK7B 2IXLA 1NCRA 2RVAA 3KQ4B 2V09A 2A6YA 1D0HA 3AMHA 2E63A 2HWF2 5F5IA 1AX2A 4QB6A 4AHYA 2BU9A 4XETA 3HN3A 3JZVA 4LBQA 1G9DA 3NKGA 2ZGOA 3AXEA 3EB7A 4K9SA 4XIKA 4C8DA 2Y6KA 4BPZA 5CG9A 3MO4A 1HQWA 1H6XA 4URTA 4IERA 3THDA 5HCBA 2JB4A 1DP0A 3PUQA 2PLV1 5BNNC 2VCAA 3RZJA 1HXS1 2P3JA 4KBBA 2X5IC 5EQUA 2EIDA 3U11A 3N9LA 3J4UH 2XVGA 3ZYFA 4NE9A 1PM4A 2JE9A 2GC3A 2B5HA 2R062 4ET7A 5F5CA 4WV8A 2HWB2 3WHTA 1W2AX 1WGPA 2N7GA 1VRH1 2VBDA 1GYKA 5FP7A 5K4LA 3UKTA 4PF1A 4MXVA 1JZ5A 3J7MA 2HBTA 1HN0A 4CDWB 4MO3M 3DYMA 4XJ8A 2ORZA 2Y33A 3J9SA 2W08A 1FAYA 1EUTA 3APBA 4PBOA 5FKCA 1BHGA 3MF6A 3ZDSA 1LGBA 3B7MA 4BXSV 1IG0A 1OC1A 1CJPA 1H0BA 2VMHA 2JENA 5E16A 5DUUA 2W68A 3WP5A 4BQWA 5L19A 1EYBA 1QJX2 1DHKB 1XRUA 2D5FA 1ULGA 3A21A 2OPWA 4BXFA 2ATFA 2C0ZA 1IG3A 3IDEA 1RUI2 1BEV3 1D4M3 2VU9A 4YZ4A 1D2QA 1ZBE3 3MUY1 3U37A 3NJZA 1CD3G 1CIWA 2QDNA 2OKXA 3UGFA 1JZ3A 4XF4A 3VBFA 2JD9A 2DU1A 2FDGA 1S55A 2BUKA 4BB3A 1RUF2 1POV0 2AR6A 4E2QA 1JODA 3H3UA 2Z5WA 2WO2A 1HKDA 3WLUA 4ES8A 4H7LA 3VHRA 1RUD1 1VE0A 1YJKA 3MFCA 2VVDA 2D5HA 3POSA 3ON7A 1SACA 4XXPA 5LA9A 5C8CB 1UPIA 1GZWB 4LHLA 3N7MA 1RUG1 3RG0A 1TNRA 1YEWA 3D0JA 4Q0QA 3RVHA 4LO6B 2O14A 2B9UA 4UXAA 1ALYA 2Y0OA 2WFF1 3KV5A 3BB6A 5DDJ1 3TN92 3ZKUA 5BNOB 4NR1A 4YZ2A 4RQPA 1UX7A 4XCBA 4AI2A 5J1XA 5ABJB 2XPJA 2VZTA 4XHXA 3AP6A 2VMCA 1AX1A 1O6UA 1N47A 3BIEA 4XILA 2BVVA 2IZWA 3ME2A 1NX9A 4N8MA 1Q8QA 4EYUA 1I9RA 3PLQA 2ZGRA 4WZFA 1JN2P 2DVGA 4K20A 1SMVA 4UI9L 5CBLA 1SLAA 1OUXA 1W8WA 2P37A 4XDPA 1RUE1 3I2GA 4YVSA 2HWE3 5KHIA 2WFF3 1IOAA 5FZLA 2W5FA 4GWJA 1V00A 3KV4A 4RHV1 2WNVA 3O5SA 2ZTNA 4P5HA 4WM8B 2WQ4A 2BYVE 1FV2A 2HJIA 1FPN3 4EN0A 2WS93 5GLZA 4RD7A 3WX5A 1YIPA 1RUE3 1UOJA 4IE4A 5A3UA 2NMOA 2DWRA 5F7UA 3T1LA 2XJUA 1H4GA 3WT3A 2F4LA 5FY5A 3VL8A 4JKLA 1PO23 5FYSA 4IEQA 1GWMA 1E5SA 4YG0A 2QQMA 2P5BA 5FZ1A 3FZ3A 2A7AA 2FDFA 3ZSJA 4IGPA 5KXBA 3HEIA 1WUVA 2WQ8A 1U5YA 2PQSA 4LO7A 1J1LA 4YW6A 4YFZA 1UY1A 4AXOA 2WS91 4LIUA 1OA4A 1UMZA 4V2WA 4TTGA 1C4RA 1UCXA 2WQZC 3FC0A 4K8FA 1T6GC 2PHTA 1ZRDA 2RV9A 1VBE3 2B9VA 1UY4A 3M2MA 4QQOA 4OHXA 1JZ6A 3KVAA 1UYYA 1W6PA 4BWOA 3N9MA 4O9EA 2I45A 2VTFA 2KA3A 5K7PA 1WCSA 4LBMA 2IXCA 4RR3C 3FBYA 1OURA 5FZBA 3THPA 4QAWA 4TWTA 1LCLA 3W59A 4FOYA 2Y6JA 1WLDA 1NXMA 1Q8SA 2WT0A 5D8AA 1QWRA 3WINE 2VULA 4BH9A 3BU0A 1QXJA 2ZHNA 1MS0A 3HQXA 3LOIA 1OUSA 1ZA4A 4OQ8A 2WYFA 3P3PA 1H9PA 4M3CE 2GP3A 3I2IA 5GLUA 5C9AA 1LNSA 1XNBA 3EJKA 2PHLA 5GLVA 3UV9A 2FDIA 3MYXA 2Q5TA 4X6RB 5FZ0A 5HCHA 3Q9OA 1NE6A 5FY4A 2ZX0A 1XNKA 3K4AA 3LA3A 4FO9A 3WNXA 1BEV1 2J1SA 2R061 5DG1A 5G04L 4C0BA 3H7YA 4ASKA 4LNVA 3LEMA 2VNVA 2WLQA 3I3BA 4GA9A 5JOWA 2HH9A 3Q8CA 5GM0A 1T6BX 4J1XA 2G4IA 3WY6A 2G9FA 2ES3A 2BQPA 4DS0A 1QJX3 2D6OX 4MYEA 1MEC2 1X50A 3LOBA 1DZTA 1N3PA 1F4AA 1XJAA 3OB8A 2FQPA 4W8JA 1QQP3 3DYPA 4XMAA 3F95A 1HN1A 4Q4V3 4RS5C 1UKGA 3KHCA 3JD71 3T3YA 1YFYA 1ENXA 3BGAA 1F9KA 2Q4SA 2RJ2A 5IVFA 4FPKA 2JDNA 3VBOC 4B7KA 1GZTA 3WXPA 5EPAA 4EN6B 4DUVA 3VKMA 2F4PA 2ARBA 1NY72 1GQPA 4Q4Y2 1GZ9A 4YPJA 1GSLA 3KGZA 1OOPB 4QKFA 2OPKA 3U07A 1UOGA 5F39A 2E9QA 5FQ0B 5CISA 3QACA 3H8XA 4MXWA 3VLBB 3GZAA 1HQLA 1ST8A 5DZFA 3AYDA 5FYIA 5CAZA 4NPMA 4LO4B 4Q27A 4CEYB 4D7TA 1JHJA 2JICA 5T54A 4BOWA 4DY5A 3I2KA 4A6OA 5L7OC 1GMMA 5FZ3A 1S0FA 2HWE1 4W65A 2ILMA 4QX8A 5JXHA 3JB4C 2DTYA 4J1WA 2W94A 4N43C 5KHHA 3OUJA 1PK6B 4KG0A 2WFF2 5FYHA 3HT1A 1U5XA 3VBRB 4GH4C 4BMEA 4AFDA 4MGYE 4DRVA 2MEV1 3ZVXA 4YFWA 1OD5A 4NOTA 2QFEA 5FXZA 1B35C 2IXHA 4N53C 1O91A 1QJU1 2QQIA 4F7ZA 5BNPA 2J1TA 1XYOA 3OF1A 4JGZB 4LOSA 1HQNA 1XQNA 2R0FA 2AEYA 2WSUA 4LBNA 2R073 4JQTA 4J25A 4XJ9A 1JUIA 1K3IA 2R0HA 2WDBA 3GBFA 1N3QA 2VQAA 1CAUB 4L92A 2BOIA 5JXGA 4FTSA 5GZEA 1VAMA 3MIGA 4LHNA 5BNNA 5FWJA 2DDUA 2RS51 1OQEA 2ZX4A 3LZZA 5JR7B 3OCPA 1S0EA 1X33A 1PO11 2PLV3 1NA1B 4FAHA 1XE8A 1TVGA 3KWVA 1J58A 1QXRA 4CDQC 3CZJA 1MZ6A 1X8EA 4I3GA 3FHQA 5FXVA 1H6YA 3DPRC 2ZHLA 1K5MA 4Q4W2 5LBFA 1AF9A 2HYKA 5A1FA 1QOSA 1XNCA 4DZGA 5KR7A 3ACGA 4R9BA 5DPNA 3ILFA 5C4WB 1GU3A 2EXJA 3OBAA 2CWSA 1W2UA 5CZKA 2ZGLA 1J59A 1LR5A 4BU2A 3CO2A 4PBPA 4C1XA 3NJVA 4YWAA 1RHI3 2C1FA 2BGPA 2VZ3A 3KB5A 3WHUA 5HXVA 4AEMA 5I0RA 5GZDA 2XLAA 2R043 3ZLIA 3WP3A 1C8M1 4MGKE 5A3TA 3KCCA 1JH5A 2YU2A 1AR73 1G9FA 4XEZA 2YFUA 2ZBJA 1EV11 4PI2A 1O5LA 1ZRIA 4LKDA 5JSOA 5A7QA 4HETA 2RS32 2IFWA 5FV3A 3I2HA 3SXWA 4Y22A 2JG9B 3MEPA 4XBQA 2W1UA 2XXZA 4D94A 5JSPA 2FDKA 3S7EA 2VNOA 1NKGA 1CX4A 1KFUL 1VBB2 3O1UA 4KGQA 4LE4A 1BVVA 3LAGA 1WBFA 4RYDA 3WG2A 3ZFEA 5CB7A 5H9RA 2VE1A 2HWC1 1VMJA 3H3LA 1TNFA 1JOPA 2GMMA 1W3XA 1Y4WA 3AZZA 4HLTA 2WR9A 4OHVA 1WWYA 1JTZX 4N9IA 4Y1VA 5IWFA 4D69A 2WZR2 2RJLA 2VCBA 4HVQA 2DFBA 3VKOA 2UWCA 3E5XA 3BI3A 2E7TA 2WA4A 4CCKA 5FPAA 5BYNA 2DFCA 1CESA 2XL9A 1BQPA 2YBPA 1UPSA 4FFFA 3WDVA 1ZREA 2QE3A 5BXXA 1VRH2 2HWC3 3HMYA 3G6JB 1AL21 3AVSA 5AFBA 1HX6A 1C1FA 3IPVA 5CKNA 3GHMA 2CU5A 5JI7A 5JOZA 5FLIA 1C8NA 2W87A 2PYTA 1LESA 3C7HA 4E27A 2CGPA 2P3YA 3GBGA 4UF0A 4A7ZA 3P1IA 1W6QA 3GXUA 1VBC2 5FZ9A 5FY0A 1NE4A 2WWSA 3GGLA 3R6SA 1DLLA 2Q30A 3MICA 3SH4A 4CXYA 2VC9A 3SQOA 2ZHKA 2ZZJA 4S2GA 2Y64A 4AK3A 3SEPA 3I8TA 3WDTA 2JXAA 4CDUC 3GZTB 5FR3A 5I93A 4QPGB 5JMCA 3CZUA 4MADA 4B29A 3O1MA 3POJA 1BXHA 4BQ4A 1W0PA 2J1RA 5GZCA 1RUF1 2VNRA 4C90A 1DQ4A 1H8TC 1XXNA 2P3IA 1OKQA 3BCWA 3FLPA 3RMXA 1W28A 3I4IA 2DU0A 5LBCA 1VAVA 5EJZB 1SFYA 3ZFGB 3CBNA 4IV1B 1SZBA 4Q4X1 5A6YA 1N1VA 3ES4A 5E8AA 3LIGA 3J8F2 1ND2A 3USUA 3IN9A 3PVNA 5HV0A 5EYYA 1FT9A 3IAPA 4CP9A 3MDPA 4CSWA 4Y1UA 5FZGA 4DXZA 3SITA 1JXNA 3ENRA 2RM21 3I2FA 1NLRA 1KITA 1KEXA 2ZGTA 3IT8A 4LE3A 3RGBA 3WDUA 5J48A 1W04A 2X8KA 5A7SA 1FPN2 4AEJA 1KXGA 3SLIA 4K1YA 1JOJA 5FPZA 4W6YA 1AR63 1DQ1A 1W8NA 2CV6A 1UQXA 3E5QA 3NV2A 2ENRA 4AVBA 2E26A 3CIHA 1X82A 1JYCA 3UESA 5JZGC 2D44A 4K1ZA 2ZGPA 1BVP1 5EFUA 4Q4W1 4MXWB 3TB0A 3GJBA 5KXEA 3IMMA 4I0WB 4EE2A 2ADEA 4MGSA 2EA7A 1QXPA 4YG6A 5FP4A 4E8CA 5LRRA 5ACA2 5I0DA 5K8SA 5ERLA 1C5HA 2YXSA 1PVC2 1T2XA 2QQNA 1PIV1 2WRAA 5AC92 2I07B 3BTXA 5H9SA 3NV3A 4LKSA 1F15A 1VBA1 2QQUA 1SBEA 3HN1A 1OHFA 1HB3A 4U36A 1F5JA 5DMYA 4GJZA 3ZFGC 1WMEA 1ZM1A 4TZDA 3SH3A 1IZ3A 1H2MA 1UO9A 2PFWA 3I49A 1LRHA 3OY8A 4GAZA 5K9YA 4LORA 2GC0A 3ZXAC 4MVTA 1CIYA 2ZCWA 3W9AA 2UWAA 3C7OA 4XHBA 4W4ZA 3LSDA 4FT8A 3VBRC 4COUA 4G3YC 4Y22B 2EF6A 4GB31 2B46X 1TMF1 2WZR3 5T52A 3WCSA 1QOTA 3OPTA 3AYEA 2DF7A 4XFHA 1IHMA 3O1SA 1HV1A 1XB9A 3VBUA 4IE6A 3WG3A 1RMU2 1GP5A 4I09A 5JVVA 4NIHA 3MW2A 4LBJA 1HRV2 1YHFA 3E1F1 2QTWB 1R64A 2P6CA 1ZBE2 4GB33 4OI4A 3GZEA 4S2DA 3VKNA 4Y4YA 5FMDA 4EN9B 3USSA 5BNNB 4YW5A 1CPNA 1PX4A 3NRUA 5IVYA 3MF9A 2B7YA 1V9U1 3LQCA 2VQ0A 4CCCA 1NA1A 4XFBA 2P3KA 2EICA 4AR2A 2UWBA 1H8TA 5EHDA 1O3TA 3FHAA 3IIIA 2VL4A 4ITCA 4M3CA 1OT5A 4JGYA 2NP0A 3OOXA 1RMU3 4QQHA 3S5AA 4O7XA 4HBNA 1UZ0A 3P3NA 3VD7A 2VGDA 3AYCA 3RWNA 4ISRA 4YLZA 2JECA 2GC2A 5FOJB 1BEV2 1Y3TA 4PHZA 5IFPA 3ES1A 5FJHA 4A2UA 3S6PA 4E4DX 1XOYA 1JZ4A 3P5BA 2BFUL 4AFBA 5AFEA 3RZHA 2KD7A 1UYPA 4R9AA 3V0BB 3PUSA 2PAEA 2VECA 5DZGA 2P6HA 3VDCA 4CE8A 2J1EA 4OUEA 1UKRA 3VV1A 5T5PA 1FMD3 2W9XA 4QHBA 5C5TA 4I30A 1CJDA 1UZVA 3ACIA 3B69A 5F1RA 5HV4A 5JZGA 1PGW2 1QJU3 2BVBA 4QHZA 1P8JA 4DUXA 4IEVA 5DUWA 4KWUA 1DU3D 3OPWA 3QOPA 4DFSA 4YGBA 3D3AA 1X9PA 2GMEA 4E2GA 4WM7A 2V5DA 2AEZA 4NJ4A 4QGLA 1PO13 3JB8A 1PO21 1O4TA 4B4QA 1O3QA 1ZRCA 1K5MC 2JEMA 2GZWA 3PMSA 1CONA 3SHRA 4Q1PA 1LGNA 2OQ6A 4R4ZA 1KFXL 2W3JA 4D7SA 1YC61 2HEWF 4COWA 1IPJA 1SLTA 2Y38A 1QJY1 2HWF3 2ZAHA 3WF4A 1QU0A 3DUIA 5A3MA 1IKQA 2K46A 2AREA 4IW3A 3ZFGA 4QX1A 2XBO1 3N3HA 4UFLA 3VDDA 1C5IA 3ZFFA 4QQLA 2Z4FA 2WWJA 4BZ4A 2VD7A 3MHZA 4PDWC 1IQDC 2VMGA 4CUAA 4DO0A 5F9TA 5FZEA 4RR3B 3V0AA 3GNEA 5BNOC 1JU4A 2DCTA 3KCYA 4CCMA 1IS5A 1OLQA 2R1BA 3QD6A 3AMPA 1BBT1 4AVTA 3M70A 3VBRA 3HD8B 3J8F1 4UFIA 3EO6A 4H14A 4HKWA 3WW1A 1UU5A 2Y6LA 3KM5A 2W95A 4WBBA 4M01A 3VZKA 3CEWA 1Q3EA 3MIBA 4OQ9A 2QQOA 3CMGA 3KSCA 3ORJA 4A45A 1V6NA 4UBHA 3OGVA 4AI0A 4NN0A 5J98B 2BWAA 1YFXA 4DY3A 3W21A 3IDBB 2VR4A 2A75A 4Q8KA 1OMIA 2PAMA 1JZ7A 1PX3A 2UURA 4B4RA 4XOGA 1NYWA 1W8HA 4UF0B 2DCZA 4IL7A 4XFGA 2OT7A 2VUCA 4UW3A 2Y26A 2ZAAA 2EIEA 4OMDA 1C28A 3K77A 2TNFA 5CNAA 3SCGA 4CVUA 4QGNA 4IGOA 5A7PA 1CQ9A 2VH9A 2X29A 5ACA1 4LLFA 2AH2A 4PQQA 3UL2A 4ARYA 4FOQA 1DCSA 4FXGB 3WVJA 4AQSA 2XWBB 4Q8LA 3WV6A 1XNDA 4XXAA 2DUQA 1UF2C 3EHKA 5A3PA 3POIA 3CNAA 3IDCB 4Y5TA 4CCDA 5LBEA 5GJ6A 3VBOB 3O12A 3H1WA 3JD73 1AR91 1CPMA 1HRV3 1SLLA 1D4M1 2CTVA 2BNOA 3EYPA 4YM0A 5K0UB 4CP2A 1KRIA 3ZIXA 3VD3A 5LY1A 1AVBA 4PI0A 1C8M3 2A6ZA 2NN8A 2VVEA 4IV1A 1DGRA 5A32B 1RJ7A 3N4MA 5FP8A 3A23A 4L0PA 3X29B 1VAKA 1S0DA 1J83A 4BLJA 1YYNA 3QCWA 4Y5Z0 2VTXJ 2YGLA 1GWLA 4YNIA 1KS4A 3LDRA 1GQHA 1NLSA 1NT0A 3N35A 1CR7A 2P2KA 5FLJA 3U75A 1HB1A 4ZONA 3ZMNA 4XFIA 4YZ1A 1AR93 1HRV1 2D7FA 1OFNA 2JE8A 2XB6C 2XVLA 2ZX3A 1C8M2 4EJRA 5LW9A 4RA0A 4NHXA 3CJXA 4LPLA 3AKQA 4QQPA 3ZR6A 4LO5B 4IEZA 2D6MA 4RS5A 4FPHA 4LHSA 1RUH2 2MPFA 2XKOA 4AE2A 1WLCA 4NWVA 5FP9A 2RS31 4I01A 2ZJCA 4IV3A 3JCIA 3WP4A 3DKQA 1AL0G 4NPLA 3MGUA 1AR81 4EV0A 3VHNA 3IB3A 4META 1EAH2 1O8PA 1WCDJ 3FBMA 3QH6A 2JKBA 3LIHA 3QH7A 4XABA 4AVVA 4Z07A 5HPOA 1ZBA2 1J84A 1HRI1 4YYOA 1S4CA 5BUVA 3M8LA 1AYM3 3RSJA 3ZR5A 5GZGA 1IKPA 3A0KA 5ABJA 3N9QA 4NPRA 1UY3A 3H8RA 3N9OA 3DCQA 4QX2A 5J7MA 1G9BA 1RUJ1 2R30A 2YY1A 4K6BA 5B4NA 3MUZ1 4Y1XA 2E7QA 4M4RA 1AJKA 4X8NA 4AGVA 5FMOL 1G9CA 4OLLA 3CU7A 2YU1A 2Q1MA 4AG4A 1YI9A 2HWD3 4FOVA 4CDXA 1I6XA 2DVFA 1Z7S1 3FLTA 1RYYA 3H0OA 4TXWA 4L99A 1PMHX 3PTYA 5SV8A 5C70A 3LB9A 1MS1A 2ZACA 4O9GA 2W91A 5LA2A 4AVAA 3LD8A 5IK8A 2Q1ZB 1KDKA 5A6XA 4XYXA 3ALQA 1WMFA 4GH4A 4LK6A 2VW1A 2VMIA 1JMUB 4FPFA 3T1MA 4JKMA 1QGLA 3B93A 3RQ0A 3VHPA 1LHOA 1O59A 2RG4A 5A7NA 2NPIA 1PO22 1B35A 1FOD1 1O3RA 4FFIA 1LULA 1RUJ3 1W2NA 4YZ3A 4LT5A 1CGPA 1GZCA 1VBE1 3N9PA 2OA2A 4MV2A 4ONUA 5FY7A 2ADDA 1ULPA 3FE5A 1LOAA 3K4ZA 3GBWA 4ORFA 3RZLA 1RB8G 2BGOA 3WG4A 4AF9A 2W46A 3M1HA 3ACHA 1W9FA 2WJSA 3H1YA 2PLV2 5IATA 1RHI2 4U2AA 5JUVA 3KQRA 4RL7A 3AP4A 5FBJA 3B94A 4LKFA 4AEDC 2A6WA 1ND3A 1BJQA 4M0NA 3LE0A 3PVEA 1E57A 1LODA 1R081 1R1A1 3PUHA 4JVAA 2JG9A 1W99A 4FQZA 4XW3A 4GULA 4MLOA 1MS9A 3NAPA 1I1EA 2PHWA 3FLRA 4LO8A 2GH8A 3GZUC 4QXKA 5FRAA 5LEKA 2Y8KA 3AKTA 2X05A 4MUVA 1S0IA 2ZEWA 3I2OA 3VBHC 5L7OB 4LBQD 4XF0A 5I8TA 2PHFA 3PVBB 5FYZA 5B4XA 5HXMA 2CHHA 1ND2B 4QDQA 4CCJA 4URAA 1DGWA 1AR61 3HNMA 5IHRA 2ETEA 1QJX1 3AX4A 4XAEA 3B3QE 5C3OA 1MR5A 1V70A 2VBPA 1OQDA 1RUI3 4JQRA 4XBLA 1WMXA 2DBNA 4XF9A 1FXZA 3M3QA 1BZWA 1MEC3 1QNYA 2JIJA 4JV4A 4YZ5A 1AXYA 5JOYA 2WT2A 1YO8A 1WW7A 1RUC3 2IWGB 4JGZC 3TOJA 1I5PA 5LK5A 2QDRA 3ILNA 5IFTA 1K45A 1QHDA 1VB2A 1WZXA 5JIUA 1WCKA 3TEZA 4TLFA 1AR71 2A3YA 3GJAA 1ASJ3 2GN3A 1KGYA 3ELNA 4J6GA 5BY5A 1VLNA 1W06A 2KM2A 3IM0A 2ZMNA 2ZGMA 4RFRB 4FOWA 4CP1A 3GM8A 3ETQA 2YPJA 5F2SA 4FBFA 3RZGA 4MX3A 3VD4A 2BOJA 4QKDA 2A3WA 2RS12 5DAPA 3RYKA 4BIFA 3A7QA 1QMJA 1W6QB 3CL1A 4QKBA 4RGGA 3Q8AA 1RUG2 3LA7A 2RS33 4P9YA 5DUVA 3TN93 5KC5A 2RDQA 2WN2A 2QKDA 4YW2A 5KHKA 5HCFA 1L7LA 2E33A 1SCRA 3ZSMA 1UD1A 2OXBA 4I0BA 4XE9A 3THTA 5DAQA 3T2PA 4RN5A 2CDOA 3B02A 4PQ9A 3WR0A 1KD7A 2JWPA 4AGGA 1W8ZA 3IAQA 4CDUB 4OFGA 3V64A 1VBC3 3JUUA 4W50A 4QX0A 1REFA 2HWD2 4I2OA 4Y20B 3Q8EA 2XQRA 2XJQA 4P9LA 1LOFA 4K3UA 1A3KA 4AFMA 2HKXA 1RUH3 4GB32 4OUMA 2BRTA 1R092 1RVF2 1ND3C 4QDRA 3AZXA 2XR4A 2EVXA 1GNZA 3S30A 3LEKA 5GZFA 1DYKA 1OSGA 1RMU1 1CAWA 3ZFFC 5KWRA 5FREA 4IXLA 1EAH1 4K8RB 2V73A 5KC6A 4IEUA 1LJ7A 4DEQA 4ZXKA 3TWIA 3U14A 1Y9GA 4XQWA 1X36A 4KBZA 1LAJA 4N9HA 3LDKA 1V9U2 2BDRA 1GP4A 3AZVA 2WBKA 3NNFA 2QQLA 3OEBA 3ZYHA 2R16A 2UYBA 4MHRA 1OLRA 3HNYM 1ODNA 1RUJ2 4P5YA 3VKFC 5IVVA 4CU6A 5M0TA 1ULOA 3IMNA 4FPYA 2ZABA 2WFPA 3J8F3 5FZMA 4LITA 3OD4A 3PUAA 1SLBA 1ZX5A 2KR2A 2ZKLA 5CFDA 2RS53 1UYZA 1UXZA 4FPCA 4P9JA 1EPWA 2YC0A 4KL1A 4AZZA 3BPZA 3V0BA 1W8OA 1ZZ8A 3QBQA 2O0OA 2AGSA 2OZ6A 1V6JA 1H9WA 2MHFA 3T30A 1CAUA 2C24A 2C9AA 1SFPA 1MVQA 4NIDA 3B01A 3PURA 4DINB 4CTEA 3TBDA 5DAXA 4QXCA 2OYZA 3LKJA 1V6KA 3JBG2 2WAOA 3POGA 4CUGA 4D6SA 2JG8B 2WLPA 3WW4A 2ZMKA 3K4DA 4XACA 4F83A 4XJWA 2R041 1ENRA 1W90A 1JHNA 1PGW1 2EIGA 1ZRFA 1EPZA 1IPSA 5GLWA 4ASLA 1VPHA 2E53A 1YJLA 2G9ZA 1OA3A 1GBGA 2X53S 5IVEA 4OYUA 3ZYIB 2R1DA 4LULA 4COYA 5FMBA 3RWKX 5J96B 4UFJA 4OHZA 3HPNA 4DRRA 1VJ2A 2GDFA 2VAUA 4AI9A 4QM8A 1SDDB 1XU2A 4PDWB 1QJY2 2DUPA 4AQ2A 3OD0A 1EV13 1LTEA 1H1IA 4IV1C 4OMCA 5HCAA 3V65A 3R4UA 4HK9A 5L73A 4D3WA 2XHNA 1HXS2 2CGOA 3A4UA 1VBB3 1ZZBA 2VPVA 3OBZA 2BGCA 2YC4A 3SNMA 2VZVA 2DV9A 3U1XA 4IEWA 1X9TA 5KHJA 2FCTA 2LALA 1DF0A 1H2KA 2BV4A 1YWKA 4NUBA 4CDXB 1MS4A 1ODMA 4HMZA 4TYSA 5F8PA 4LA2A 3PHMA 4LMFA 5C33A 3AKPA 3WDWA 4YGDA 2P17A 4JZRA 1PGL1 1C1LA 2W92A 4IE0A 4YG3A 2B4KA 3KMHA 1A8MA 1LU2A 4D0QA 5F3CA 1OQ1A 3PU8A 2RMU3 3F2ZA 5L9BA 3DEMA 4FFHA 4R9CA 4OI1A 4YARA 3FMGA 4OHWA 2IXIA 3N7JA 1M06G 1W6NA 1ZZ9A 3I59B 3AZYA 3UK9A 3I2JA 4ES9A 2DCYA 4FCAA 2CSGA 4QB1A 3VHOA 2XWJB 3POFA 2PA7A 1AR83 1KDMA 1K42A 1LOEA 1TMF3 2IUWA 1DFQA 1HV0A 3VBUC 1WW5A 2NQYA 5L9VA 2QCSB 2R6QA 3PVOA 1CAVA 3T0AA 1HDKA 1QQP2 2XLFA 4QXHA 4FQ4A 5JZGB 2NZ9A 3VZOA 4TLGA 4GKXA 3NO8A 3U78A 3NNLA 1RUG3 3FUOA 5FUNA 4Q4V1 5FUPA 2ARXA 2J1UA 4CCOA 1FMD1 3GALA 1YQ5A 4NHLA 2ERFA 3ILRA 1JYNA 4AHZA 1IPKA 1H2NA 3TEWA 1XE7A 2BNNA 3TAYA 3IPVB 1UU4A 4Y3OA 1LEDA 4JTNA 2JDAA 5FZOB 5I0UA 4Y20A 1SPPB 2WT1A 1QJU2 1IS6A 1XSQA 2JB8A 4R9DA 1G86A 5J3UA 1JZ8A 2DVAA 1ZVFA 2WYSA 1XE0A 4RR3A 2YHJA 5LBBA 3T0DA 1BMV1 1XSRA 3VN4A 2XJRA 3VDDB 2D40A 3KF3A 2J1AA 1FATA 5D8AC 1S0CA 1MQTC 3GF6A 1PZ7A 2WWUA 4ARXA 1OF3A 1R091 1WCQA 2BFUS 4NO4A 3UGGA 2FZ1A 4QMAA 1ZZ6A 2A70A 4RHV3 4AEKA 5C8WA 3HAGA 1NG0A 2RS52 4PCRA 4UBGA 1HLCA 5FZ4A 4CDWA 5LEJA 2D6LX 4YW3A 1G7YA 1HIXA 2EIBA 2VUAA 4FPLA 1M4WA 1KS5A 2OZJA 4IEXA 1CWPA 5LATA 4Q1RA 4RSUA 3WNPA 4JDOA 2TBVA 3POYA 2Y6GA 4RGAA 3L2YA 1DQ6A 4YM3A 1W8UA 3NAPC 5CIRA 3RI9A 1ZNPA 1W8FA 2JDKA 2RM23 5A3LA 4RHV2 1YXWA 4WM7C 1IGOA 2NMNA 3OPZA 4BQXA 4LUMA 5FPUA 4CEYA 2C4XA 1J3QA 2BJSA 4QXBA 3SH5A 2D6KA 2Z79A 3V0AB 3EBRA 4AI1A 4GD4A 4P00B 2F17A 4CP9B 1RC6A 5CEHA 1NZIA 1Y9QA 1LB2A 1QJY3 2HWF1 2D98A 1GOHA 3LDBA 2ZGKA 3C7FA 5JSRA 1W9YA 2DYCA 3ZXKA 3R4DB 4LR4A 3POWA 5F6KA 3OEAA 4A6SA 1VBA3 3VBOA 1QY4A 2YYOA 2R7EB 1MS8A 3MBWA 4L97A 3ZPOA 5A1AA 5BNPB 4JGZA 1COV1 3FUQA 5DABA 4LUKA 4L11A 1YQ8A 1HJFA 4AVSA 3NNMA 3O1PA 3S7IA 3JBG3 4RQPB 5FJKA 2VZUA 2CY6A 4YGCA 1UXXX 1RXFA 1RITA 3KV6A 5IUQA 2YG0A 3C7GA 4LLOA 4KMQA 4KG8A 1H8VA 3U4SA 2Y6HA 5FUIA 3ST7A 3UETA 2AENA 3ZDVA 5CVRA 1R1ZA 3J7HA 1GLHA 4LKEA 1W6OA 3ZO0B 4Z1VA 2WO3A 4C0HA 1RHI1 1W39A 5LWBA 1MVEA 5FZCA 2WZR1 3VBSC 1LHUA 4Q0VA 4JTOA 4YVSB 3S5QA 1W0OA 3TEYA 2C5DA 3BALA 3M3OA 2WZPP 1UW8A 4XCAA 1MS5A 3WP6A 5AC93 4AQ6A 1ULDA 2WNVB 3D5OA 4CCEA 1RUC2 4N53A 4XDOA 4HSJA 1OVPA 3OJBA 4Y24A 3AM2A 4IV3B 1NUKA 4MSVA 3RPQA 5F2WA 2WNUA 4H7MA 4UFMA 3N7KA 4CRQA 3MIDA 4FI9A 3ABZA 5DAWA 4NWWA 4QM9A 5FKBA 2PMWB 4LA3A 4NHYA 2ZGNA 4GQ7A 1JOBA 3T2TA 3U10A 5GLTA 3OGSA 3WNLA 3FHIB 5LB6A 1DQ5A 3INAA 1ULEA 3H42B 3IIAA 5FZDA 2EXHA 4IGQA 4A7YA 4MGTA 5A6ZA 4HKOA 1JYTA 4QX5A 2JDYA 2VVFA 4H55A 4XTMA 1H8TB 1H30A 3DXTA 1VBC1 3JD72 4FXKB 3ZN6A 4Z8BA 1ASJ1 2XMLA 4A42A 3O1TA 3PUIA 1UAIA 5DDJ3 3FFZA 4CDQA 2RE9A 2WZ8A 1RUD2 2ZGSA 1CAXA 4PJYA 5DN2A 5JOXA 5ISLA 1DLCA 5CKQA 3ACFA 3LA2A 1QQP1 1OBNA 4AAXA 2BEOA 3WF1A 3ROUA 4Q4Y1 3E6BA 4Q0UA 2E6VA 2K9ZA 4WZCA 4GH4B 1S0BA 3TN91 5A6QA 1FMD2 2CDPA 4PLNA 1W6MB 4IETA 1PK6C 3PJYA 4ATFA 3L9JT 4M0HA 4NRPA 4CP0A 1WKYA 1ZBA3 4QX3A 1SCSA 2VZQA 3R0RA 1REDA 1SEFA 2XUEA 3ZPYA 4C1WA 2P4EA 1AUYA 2AC1A 2QZ3A 5LCWL 3NKTA 3WZ1A 5FO7B 4N90A 5C8CC 4TN7A 3NJYA 5CA6A 4XUOA 1JYIA 5FIXA 2LS6A 2DBIA 4OULA 2NM1A 2VW0A 4Q4X3 3ZYGA 2D6PA 4QPIC 1HW5A 3FL7A 1RVF3 4H3WA 4EWAA 4IEOA 2D93A 5E89A 1UYXA 5ABJC 5FFOC 2FD8A 3LWCA 3Q8FA 2W1WA 4DB5A 3ZXDA 2RJKA 1LOCA 2ZEYA 1VMHA 3I2DA 2RDNA 3AK0A 5FYBA 1J3RA 3H9AA 3LCPA 1QJFA 3WG1A 3PU3A 2BZDA 2UY8A 2GC1A 3K75B 4XUNA 2GNTA 4NAOA 2HWD1 4FPGA 3ZX7A 2Q8EA 2LRPA 3MIFA 2A6XA 5FO9B 2GALA 2D3SA 1DIWA 2O8QA 4DPNA 3VBFC 3WW3A 1RVF1 2ZGUA 1PNGA 4CA9A 5KHGA 4BLIA 2VXRA 3M3IA 2V4VA 2CWMA 2JE7A 4ZHNA 3NNJA 2ZKNA 3A22A 1PZ9A 1PO12 5DXDA 1ACCA 2E31A 5C3PA 2EALA 1VBA2 4ISQA 4KH9A 1AYN1 2VQTA 2WNOA 5FK8A 2XLGA 5FYVA 4BQ1A 1QJEA 5GKAC 1HXS3 4A3XA 5A33B 4V1PA 5TSWA 5T55A 3J26N 5FQ0A 1WD3A 1LOBA 1OI6A 1J1TA 5C3QA 3E97A 2FBEA 3N36A 4FFGA 2XG3A 3WDYA 5CFDB 2G9GA 4PIYA 3VD9A 1US2A 4KWLA 5JLVA 3T4HB 1WA6X 3SMHA 2X10A 2YV8A 2JIGA 4XUTA 3VKLA 1O5UA 2GSYA 1MZFA 1QDCA 4ZU4A 4ASMB 5FPLA 3W5MA 3MZHA 1A34A 4Q0PA 4MHUA 2LM3A 1A78A 1F31A 4MGZE 5C5UA 2Z42A 3BTYA 3VBHA 1DZQA 1MACA 2JDUA 2WINB 4K7JA 4WVWA 3RZKA 2NYYA 1E5HA 3AJYA 5F3IA 3O1OA 5IW0A 4YVSC 2FZ2A 4CDUA 1TE1B 2R042 3KV9A 2DURA 3TNPB 2RS13 3LEGA 4TSVA 3BODA 3EXUA 5FP3A 4EN7B 2WL1A 4HXCA 4X8PA 5FYCA 5DZEA 2VCCA 2YUEA 2YBSA 4EZ4A 5C8CA 2VY0A 3NW4A 4XF1A 1GZWA 4XDQA 3MW3A 4JRLA 4Y5SA 1RUC1 2ID4A 1GOGA 2WNUB 1DGLA 1ZYBA 2GNDA 4E4HA 1Y9MA 2IVJA 2HWB1 1O8SA 1DBNA 2J7MA 4AHWA 1ENQA 4ZY9A 3L2HA 1ND2C 2WSVA 2AACA 3OBRA 4AYUA 1UN1A 1JYWA 2Y6FA 4ZXEA 5A80A 1MQTA 3R4SA 3AVRA 3OYWA 1K5MB 4YM2A 5FYTA 5T5OA 2DVDA 2J22A 3JQWA 2TEPA 2RDSA 2I74A 2OS2A 3MPBA 1OLME 1UY0A 2W2IA 3KF5A 2D43A 3GHNA 1GWKA 4BYYA 1NZCA 2OW4A 5IAXA 1YUDA 4XMIA 1PGSA 4FPOB 4QPIB 2ZX1A 3M3CA 2FCUA 1W6NB 2HYXA 3I59A 3IZOA 3OGGA 5L9RA 2K2SA 3NMBA 5LRSA 1W6MA 1QDOA 1SG3A 4KWKA 2AZ5A 2CL2A 2WIIB 5FMCA 3PJQA 3JU9A 5C9AC 2VOKA 2PHXA 2JG8A 4QT6A 1U5ZA 3IWZA 1LOFC 3ZSKA 4XJZA 3J7LA 4XPVA 2MEV2 2XBO2 3HBZA 2YPDA 3URFA 2CYFA 4CU9A 3RYRA 2V4AA 2QVSB 4UAPA 5FPVA 3BVCA 3HBKA 2XBO3 3RJRA 3IBMA 1QH7A 3SISA 5FZAA 1UZZA 3E5UA 3C3VA 1FOD3 4BISA 5FOBB 1JZ2A 3OBTA 4AI8A 2VM9A 3NV4A 3CF6E 1HRI3 1UMHA 3H1MA 4K40A 5EV7A 4COVA 1RL3A 1BKZA 4N7UA 2VOWA 2H6CA 4YGEA 2RR13 1AHSA 1QNWA 3ZFEB 2X09A 1YFUA 1W2OA 5IK7A 4OI0A 5EP9A 1SPPA 3KLSA 5FZ7A 1A8DA 1CN1A 3KZ4C 4XQDA 5D2AA 3U4XA 3O7OA 4XQ4A 3AKSA 3WNKA 5D8AB 5EZWA 4Q4X2 3AYAA 5F6LB 4BDVB 3DECA 4RGKA 2VJXA 3VD5A 5FXXA 5I91A 5EIYB 4A3ZA 3UKVA 4AW7A 5F5QA 2YMZA 4QB2A 4F8AA 2A6VA 2JDPA 2OX0A 2QQVA 1RUE2 4PLMA 2RM22 4QU2A 2ET7A 3CJIA 3VZJA 3WQ1A 2QUOA 3MLKA 1UIJA 1S0GA 4O61A 1VIWB 1WW4A 2C26A 1CAXB 4NROA 3CLPA 3SKVA 3VBSA 4B3NA 3S0MA 2B45X 4P14A 3UGHA 2ZEZA 3BPSA 4NAMA 4PIZA 1X7NA 4AI3A 2D3PA 4QU1A 1AYN2 1XNAA 4EN8B 5J09A 2DVBA 3AP9A 3ETPA 1GNYA 2OIIA 4Z2AA 5IT6A 1PVXA 3BU7A 3OGRA 2EXIA 1VRBA 3SEEA 5L7OA 1ULCA 1XYPA 4L2NA 3PL0A 1CZVA 1UNBA 1GICA 1B09A 3LF7A 4CU8A 1DG6A 1C3HA 1DQ0A 5LA0A 2EXKA 1JI6A 1PVC1 3HWJA 5AC91 1W9WA 4Q0SA 1COV3 2EAAA 1POQA 3FX3A 4YW1A 3BOPA 2W47A 5J37A 4DXSA 3D82A 2FDJA 2B8MA 4PIXA 4IDZA 4P08A 4B7EA 1NQDA 3O0VA 2HWB3 4YM1A 1VBB1 2YB7A 2FCVA 2Z2SB 2WC2A 3ZN5A 5T3NA 3T4VA 4ATEA 2Q8OA 3DYOA 3MW4A 3K48A 3ZXLA 4R4XA 5J36A 1COV2 4BQ5A 4IEPA 5LA1A 2XL7A 3MLLA 1VALA 3R05A 1DGWX 1URXA 3USUB 5FZOA 3WUCA 1L7QA 5LZ6A 1CX1A 4C91A 1AR82 2WZEA 3AZWA 4YVWA 4DIQA 5BV6A 1F4HA 2J42A 1KJLA 2IXKA 4I02A 4P9GA 4WVMA 3HQRA 1ZBA1 4XJAA 3MI8A 4NIAA 4YSFA 2WO7A 5JI9A 4NMIA 1W6OB 5FY9A 3RJ2X 3DPRA 3LPGA 4AEDB 5DQ0A 3ATGA 5C6CA 5IVBA 3H8OA 4FTBA 2K0GA 4INDA 5IJRA 2CAVA 3OYWB 2VZ1A 1N3OA 5JMOA 4D6QA 4CEWC 3PIGA 5BPXA 1XPWA 5LASA 3S57A 2XONA 1FYUA 2PQQA 2PELA 1R093 1SBDA 1SFNA 2AUYA 2JDZA 4S2HA 1V9U3 1EAH3 1KJRA 4IE7A 3SCFA 3UJQA 2XVKA 3K3OA 4Q29A 5I0SA 1YQ6A 5F37A 5JR2A 3OUIA 2RR12 1TEIA 1RUF3 4HONA 2JJ6A 1AL23 5IVJA 4XZPA 4GWNA 1MZEA 5F3GA 3ZXJA 1FOD2 2OVUA 2XQXA 5CADA 1FNZA 3LFMA 4BM8A 1AXKA 5FPBA 5H9QA 3AP5A 4E8DA 3N9NA 2VMEA 5ANQA 5F5AA 2A1XA 1AYM2 4Q4Y3 5IYYA 2QQJA 1DZRA 5DUXA 1F5FA 1FX5A 5HBAA 3OY8B 1GKBA 3ZYRA 1LHVA 4UWDA 3ZOIA 2WO1A 4JHZA 4RS5B 5FYUA 5T50A 1Q56A 1QKQA 2PTMA 4BK5A 4OCTA 2H0BA 2DCJA 4MGIE 5FZKA 1WW6A 2NLRA 2FHRA 1F35A 4AFCA 4CUBA 3UKNA 3FN9A 5C3SA 1VB4A 3H3ZA 3PDQA 3ZFEC 3AFGA 1S1AA 3ZIWA 4WM8A 1QEXA 3ZMOA 5EJ1B 4CDWC 2HWE2 3V56A 2VBBA 2B39A 2QQPA 2MEV3 4Q26A 1NXD1 2ZGQA 2ARAA 1VBD3 3ZSEA 3GCWA 2B42B 4Z82A 1FPN1 4Q4W3 4O65A 4G9SB 2Q1FA 4UYBA 3JQXA 4JGYB 1ZZCA 1RUOA 4LOTA 1LENA 4QQ2A 1L3JA 4OVEA 2VTXA 4KGGA 1LHNA 3BKZA 3KCXA 5L36A 2QJVA 1O4YA 1AXZA 3CJIB 3EQEA 4QDSA 5AVAA 1RUNA 3K51A 2GU9A 3ACLA 3WDXA 1UZWA 5DG2A 5G05L 5CKMA 2LUWA 5CU1A 3H50A 3NVCA 2X5IA 4A41A 4H2AA 4ZKTB 4HKLA 1YLLA 1BBT3 4Q2FA 2W1SA 5C71A 2O1QA 3ZN4A 1OFSA 2R063 3U0ZA 1PIV2 3AJZA 1V6LA 1OPMA 3GYDA 2QQWA 3BUCA 2RMU1 3M4FA 4E4ZA 3Q8BA 2A73B 5FZ8A 2IVIB 4GZ9A 2R49A 3ASIA 5FK7A 3BTZA 3KHBA 3ZN6B 1SLCA 1UZYA 3T2OA 4OZXA 2RS11 3T09A 2VCMA 4QHOA 5JPNB 1NCRB 4NIIA 2VXJA 1DGRN 5FBZA 1F2NA 4R8HA 1NQJA 2Y34A 3RYPA 3WQBA 4BIOA 4CXWA 1PIV3 5ANNA 4FAGA 4CU7A 3ECQA 4KNCA 4CDXC 2W1QA 4EQVA 1V6OA 1VP6A 4WM7B 4CDQB 1XU1A 1POV1 1F8VA 2ARCA 4LBQB 1UU6A 1H1MA 1ONAA 2ZZQA 1GANA 5B2GB 4LIVA 4F3JA 2ZX2A 2XOMA 2VNGA 3H7JA 4AL9A 5CFCA 1UIKA 3ZFFB 1TZOA 1VRH3 1GNHA 4CEWB 4JDMA 3RNSA 3ZSLA 1UOFA 1D7PM 3RDIA 5C4WC 4Z2WA 4CXXA 5F32A 4D7YA 4A44A 4BE3A 1OVSA 4EZHA 2XH6A 2BNMA 5T5JA 3SC7X 2WNUC 3D0SA 4GWMA 2YDEA 2V72A 1POV3 4I3PA 4YW4A 2JG8C 3KGLA 1Q5OA 2VUJA 1LGCA 2PHDA 1RGSA 4JC1A 3TEXA 2GP5A 2PN5A 4CCLA 3MV01 3D4KA 4AEDA 3MV11 3TNQA 4BQYA 4JCKA 3O14A 2DUOA 2DCKA 4G4FA 4AVCA 3FJSA 4XF3A 2HWC2 4EWEA 3DGTA 5FZHA 3I3DA 2YBKA 1AZDA 4RQPC 2XJVA 4ZU5A 5JXJA 4ZS3A 2PXJA 1E5IA 1Q8VA 3HIFA 2UY9A 4W6WA 1LEMA 4P02B 2E7AA 3GDBA 3DL3A 2A5ZA 3D6EA 1MZ5A 4JRAA 3K3NA 3WSOA 4B8EA 1XNTA 4FPJA 2Y60A 4XBNA 4ZZ5A 4ZU7A 4UOJA 3WD5A 4D8MA 2BWCA 4Q5OA 3DN7A 5EWSA 4M4PA 3VDBA 2C9KA 1ENSA 2J1VA 4KQ7A 5FMOS 1NAEA 4AGRA 1TME2 4FP3A 3AFKA 4P9XA 3M7AA 1FNYA 2XHKA 2OUHA 4OZOA 1ZRRA 4CPBA 3OTFA 3WUDA 1YRZA 1PK6A 3CDZB 4GJYA 3K46A 1GOFA 1V0AA 1IQAA 4HVOA 4BHPA 1I3HA 2TUNA 5I0TA 2WNVC 1AL22 4DNYA 3BOWA 2VOXA 2CGNA 1S2BA 2XJPA 5SV5A 4JX0A 3I3MA 5JWPA 3O1RA 1MS3A 1X8MA 1D0GA 1J3PA 4NHKA 3QLQA 4FTEA 2O8OA 4HN1A 4N7IA 3M3EA 1AYM1 2XJSA 3B00A 3E6DA 1W2TA 1RIRA 5A33A 4E4SA 2Z69A 4L8QA 4PF5A 1KQRA 3IDAA 2YC2A 1GR3A 2H0VA 4QPIA 5K0UA 3VUOA 2VZSA 2VOTA 4EWDA 3ZXEA 2L9LA 5FYYA 3T0BA 1HB4A 2GMPA 3SKJE 2QQKA 1WA4A 4NRQA 4XUPA 3WQ0A 3T2QA 1Z7S3 4HFSA 5A7WB 5A32A 1BBT2 2WABA 1NA1C 2GNBA 4COZA 3PTRB 2C6SA 4SLIA 4EROA 1W03A 3WF2A 4SBVA 1YNAA 2VMDA 4JGYC 1JUHA 3LSEA 5FY1A 4UFKA 1VBD2 4Y33A 1OH4A 4DUWA 3VBHB 5CFCC 1SDWA 1SLIA 4HVRA 1DDLA 4HK8A 3UNPA 2WAAA 3OUHA 1R082 1R1A2 1ZZ7A 2V5YA 2W39A 5C4WA 3ZYPA 2HEVF 5ACA3 1S2KA 1OF4A 1Q8PA 1WMDA 2CNAA 4QPGC 3DKWA 4NHMA 4YRDA 1RUI1 1PZ8A 1VMFA 2XDVA 4LEJA 1EP0A 3RS6A 1AYN3 4GMP0 2VG9A 1NOVA 3KT1A 1S2EA 2CAUA 1YCIA 2D6NA 4LBKA 3MLJA 4ZZ8A 2JDMA 2ZS6B 3HQUA 2ZA9A 3ZKYA 1MPXA 5FYMA 4BA6A 5JCTA 5HI0A 1MQTB 4OUSA 4KU8A 1AR62 1FI2A 2I2SA 4GKYA 4IQPA 3K2OA 1APNA 1JW6A 1BLZA 1PM7A 2Y0IA 3NL1A 4YW7A 3WEZA 1QF3A 1C57A 1G9AA 1Z0HA 2SBAA 1N1SA 2WA3A 3POEA 5IK4A 4XC9A 4XURA 4IEYA 3VBSB 3W58A 1W8TA 4QX7A 1N1TA 5JAXA 1G6NA 4BJ0A 1QIQA 1RTVA 1N1YA 4N53B 5DAVA 4AHXA 5EYXA 2VZPA 1QOOA 4LBOA 2XKPA 3MIEA 4BMBA 1B35B 1UOBA 1UWWA 1WBLA 5A1LA 1XBFA 3MFAA 4Q4V2 1W6PB 3AL5A 3W5NA 2LROA 1PVC3 2Q0AA 3VDDC 1AR72 2JD4A 1DQ2A 3ZXGA 5CFDC 1IS3A 1RJ8A 1Y7BA 4PDWA 2G1MA 4M00A 3RFRA 5CFCB 1NCQB 2BERA 3A0NA 4KWJA 5BNOA 2IFRA 4N43B 1UX6A 1WCUA 1STMA 2YFZA 2ET1A 4P9IA 4RFT0 1HJGA 2ZPXA 2ZXQA 4PT6A 1U12A 5FAXA 3BTAA 3OGJA 1LOGA 2F6BA 4A7KA 1XYNA 1A6CA 4P9WA 4XVHA 4AQTA 1GV9A 4CUCA 1O4ZA 4HT1T 5A3WA 2EAKA 4LJHA 3FFQA 3MPPG 5F3EA 4CPBD 1K12A 1ND3B 1TMF2 3NAPB 3AP7A 3WF0A 3VGIA 3BN6A 3WNMA 1LECA 1JYXA 5CG8A 3C8XA 1OPOA 1PNFA 2YZ4A 4K21A 3DF0A 3B9CA 4XAAA 4LXLA 3UYJA 2KXLA 1BK0A 3J7NA 2OUJA 3I54A 3N7LA 3WCRA 1ZBE1 3VB9A 2VQUA 4AFAA 1BK1A 1UMIA 3CHXA 1HRI2 1WD4A 2QNKA 1YQCA 4UFHA 4WM8C 1OA2A 3OSDA 2BPA2 4OHYA 4I0AA 5JIAA 1Q43A 2GAUA 1Z78A 1TG7A 4HPKB 1ULFA 3C7EA 4LBLA 1YQ2A 3I7DA 1TME3 1AJOA 2JDHA 2HEYF 5BNQA 3GCXA 1K5JA 1NLQA 2WN3A 4IUGA 2GN7A 4X6QB 2VW2A 2JX9A 2VZRA 3I97A 1V6IA 5BNPC 3AMMA 2WS92 1Z7S2 3WF3A 4UW4A 1TME1 4QPGA 2ZMLA 1PHMA 3CKHA 3VDAA 2XGXA 1NCQC 2R071 3HOBA 2RDRA 3MIHA 4UW6A 3NQHA 4FSJA 3PNAA 3AMNA 3LEIA 4LTAA 2XJTA 3THCA 4DXRA 4XFAA 1OLMA 1OOPA 3VZNA 2G19A 1XC6A 2A71A 1VBE2 4QGMA 4Y1ZA 3RZZA 3WW2A 3C2UA 5A70A 4HANA 4UW5A 1H4HA 2YGMA 4DMIA 3KT4A 1L7RA 1FV3A 1YFWA 4LHKA 3E6CC 3O0XA 4NIGA 3RZMA 1G8WA 2ZOEB 3O1VA 3HVDA 1UL9A 2GH2A 4Y1YA 5FO8B 1V6MA 2RR11 4HSLA 5JDBA 1W9TA 1EUUA 3WNNA 5A7WA 5FDBA 2E51A 4FP2A 2HLEA 4AOCA 5C9AB 4GMP1 2VO5A 5KXCA 1REEA 2BP6A 2PHUA 4DQAA 4HL0A 3JBG1 2LW8A 5A3NA 3H8UA 3VZLA 3VZMA 5C3RA 2OQ7A 4IV3C 1JYVA 2SLIA 2PHRA 1WLWA 1Q8OA 1VBD1 3WNOA 5FPXA 4MH0E 1DYOA 1MEC1 3ZYJB 3CJIC 5FXWA 1DYPA 3ZXFA 3HJRA 1WLTA 4E9KA 2WKKA 1D2SA 3NWKA 4AWDA 4OI2A 4WVZA 1BCXA 1CAWB 4XTPA 3DV8A 5FZ6A 2HBUA 3ITQA 4DXTA 5FZFA 4Y26A 4YVWB 3AXDA 1H2LA 3HT2A 1US3A 2R32A 5E1RA 5FZIA 2UYAA 3JXSA 3RRDA 1JU3A 3AKRA 3UJOA 3NV1A 3DPRB 3W20A 4GALA 5IK5A 1E5RA 4AAPA 2FDHA 2QZ2A 5JXIA 2A3XA 1NY71 4WVMB 2IXJA 2YROA 5JPMB 4XFFA 1YIFA 3LPFA 4QKNA 3AC0A 3P6BA 4QPWA 4LQRA 4S2FA 4BQ2A 1RXGA 2P34A 1QH6A 4HZFA 2WNEA 3POBA 4MOAA 4R52A 2ORXA 5E88A 1GFF2 1NCRC 4WVVA 1ASJ2 5D21A 4XJUA 4GIQA 3G7DA 1LU1A 4HOOA 1PGL2 4UT5A 5GALA 2WUHA 2H6BA 2W52A 3NJXA 3PMEA 3O0WA 2BTVC 4ZPIA 4GWIA 1SQ4A 5FCCA 3VBUB 1UY2A 5EXOA 4XIOA 1CZTA 3SCHA 1OKOA 5FTTC 1PMJX 1GUIA 1GQGA 4JHTA 4CEYC 2VUDA 4L9BA 5A3OA 2VZOA 1NCQA 3VBFB 1CZSA 4CZSA 5APAA 5EJ3A 2D97A 2RHPA 2P1BA 3KS7A 3KT7A 4QD2A 2RMU2 4FPEA 4KU7A 1OH3A 4NRMA 5E6HA 5LY2A 4B1LA 3WQ7A 1RINA 1ZA7A 2JKXA 3DXUA 4JAAA 2BBVA 1OOPC 1AR92 2JG9C 1QJZA 1EY2A 1D4M2 2FMYA 2D3RA 2PAKA 4M3CF 1JS9A 4M3CB 4BCUA 5I8YA 4LK7A 3BYWA 4HN0A 1HB2A 3RI8A 2IC1A 3ZYBA 2FMDA 4PLOA 3NSTA 4YVWC 3PIJA 3HNBM 1SBFA 1LKNA 1AX0A 2AYHA 1VR3A 2BBAA 2VMFA 1H1AA 2DTWA 3WOGA 2LTNA 4QPYA 5DDJ2 1JBCA 1W9SA 3OG2A 4ZS2A 4B4PA 4Z92B 3B9IA 4CEWA 2UU8A 3FWEA 4MGQA 4QWNA 5K0UC 3RMYA 1TQ5A 5T5LA 1BYHA 2W0XA 2ZHMA 2QBXA 5C7GA 5KXDA 3D8CA 2XUMA 4HPKA 1W05A 5H9PA 1RUD3 3AB0A 3KD4A 3CQOA 4XUQA 1BMV2 3NNGA 2E32A 1RUH1 1O3SA 4BQ3A 3EMRA 4E2SA 5KBFA 3KVBA 1I5ZA 4DEVA 4CCNA 1YI7A 3I3EA 4GXLA 4V2VA 3ZM8A 3LFIA 5I8SA 4MZUA 2VOVA 5AVPA 1Y43B 4NVPA 4BK4A 4D6RA 3T08A 4DOUA 4B1MA 2Q8DA 2X5IB 3AMQA 4FVVA 4XFCA 3I3QA 1U0AA 1U5IA 4IE5A 3IKWA 1IS4A 5FWEA 5A7OA 3LGRA 5CYYA 3TRSB 2R072 5IVCA 4GMP3 3TYJA
chains in the Genus database with same CATH topology
1LHWA 4CYDA 3HR9A 1D4VB 1O7FA 3VL9A 5FLHA 2BW8A 2GNMA 1PMIA 3BIWE 1R083 1R1A3 4N43A 5D1IA 3B5LB 2MNGA 4JDNA 4W6XA 1EV12 1S0JA 1CAVB 1CVNA 4IESA 5LK7B 2IXLA 1NCRA 2V09A 2A6YA 1D0HA 3AMHA 2E63A 2HWF2 1AX2A 4AHYA 4XETA 3JZVA 4LBQA 1G9DA 3NKGA 2ZGOA 3AXEA 4K9SA 4XIKA 4BPZA 5CG9A 1HQWA 4URTA 4IERA 5HCBA 2PLV1 5BNNC 1HXS1 2P3JA 4KBBA 2X5IC 3U11A 3J4UH 2XVGA 2JE9A 2GC3A 2B5HA 2R062 4WV8A 2HWB2 3WHTA 1WGPA 2N7GA 1VRH1 1GYKA 3UKTA 4MXVA 4CDWB 4XJ8A 3J9SA 4PBOA 2W08A 1FAYA 3APBA 3ZDSA 3MF6A 1LGBA 3B7MA 1CJPA 1H0BA 2VMHA 2JENA 5E16A 5DUUA 2W68A 3WP5A 5L19A 1EYBA 1QJX2 1DHKB 1XRUA 2D5FA 1ULGA 2ATFA 2C0ZA 3IDEA 1RUI2 1BEV3 1D4M3 2VU9A 4YZ4A 1D2QA 1ZBE3 3NJZA 1CD3G 1CIWA 2QDNA 4XF4A 3VBFA 2DU1A 1S55A 2BUKA 1RUF2 1POV0 2AR6A 4E2QA 3H3UA 2Z5WA 1HKDA 3WLUA 4ES8A 4H7LA 3VHRA 1RUD1 1YJKA 3MFCA 2VVDA 2D5HA 3POSA 4XXPA 1SACA 5C8CB 1UPIA 1GZWB 4LHLA 3N7MA 1RUG1 3RG0A 1TNRA 4Q0QA 3D0JA 4LO6B 2B9UA 4UXAA 1ALYA 2Y0OA 2WFF1 3TN92 3BB6A 5DDJ1 5BNOB 4NR1A 4YZ2A 4RQPA 4AI2A 5ABJB 2XPJA 4XHXA 3AP6A 1AX1A 1N47A 4XILA 2BVVA 2IZWA 3ME2A 1Q8QA 1I9RA 3PLQA 2ZGRA 4WZFA 1JN2P 2DVGA 4K20A 1SMVA 5CBLA 1SLAA 2P37A 1RUE1 4YVSA 2HWE3 5KHIA 2WFF3 1IOAA 1V00A 4RHV1 2WNVA 3O5SA 2ZTNA 4P5HA 4WM8B 2WQ4A 2BYVE 1FV2A 2HJIA 1FPN3 4EN0A 2WS93 5GLZA 4RD7A 3WX5A 1YIPA 1RUE3 2NMOA 2DWRA 3T1LA 2XJUA 1H4GA 3WT3A 3VL8A 1PO23 4IEQA 4YG0A 3FZ3A 2A7AA 3ZSJA 5KXBA 1WUVA 1U5YA 4LO7A 1J1LA 4YFZA 4AXOA 2WS91 1OA4A 1UMZA 1C4RA 1UCXA 2WQZC 3FC0A 4K8FA 1T6GC 2PHTA 1ZRDA 4QQOA 1VBE3 3M2MA 4OHXA 4BWOA 1W6PA 4O9EA 2I45A 2KA3A 5K7PA 1WCSA 4LBMA 2IXCA 4RR3C 3FBYA 3THPA 3W59A 4TWTA 1LCLA 4FOYA 1WLDA 1NXMA 1Q8SA 2WT0A 5D8AA 1QWRA 3WINE 2VULA 4BH9A 1QXJA 2ZHNA 1MS0A 3HQXA 3LOIA 1ZA4A 3P3PA 1H9PA 4M3CE 5GLUA 5C9AA 1XNBA 3EJKA 2PHLA 5GLVA 3UV9A 3MYXA 2Q5TA 4X6RB 3Q9OA 1NE6A 3WNXA 2ZX0A 1XNKA 4FO9A 3LA3A 1BEV1 2R061 5DG1A 4C0BA 3H7YA 4LNVA 2WLQA 4GA9A 5JOWA 5GM0A 4J1XA 2G4IA 3WY6A 2G9FA 2ES3A 2BQPA 4DS0A 1QJX3 2D6OX 4MYEA 1MEC2 1X50A 3LOBA 1DZTA 1N3PA 2FQPA 1QQP3 4XMAA 4Q4V3 4RS5C 1UKGA 3JD71 1YFYA 1ENXA 1F9KA 2Q4SA 4FPKA 3VBOC 4B7KA 3WXPA 4EN6B 3VKMA 2F4PA 2ARBA 1NY72 4Q4Y2 1GZ9A 1GSLA 3KGZA 1OOPB 3U07A 2OPKA 2E9QA 5FQ0B 3QACA 4MXWA 3VLBB 3GZAA 1HQLA 5DZFA 3AYDA 5CAZA 4Q27A 4LO4B 4CEYB 4D7TA 2JICA 5T54A 4BOWA 4DY5A 5L7OC 1S0FA 2HWE1 4W65A 2ILMA 3JB4C 2DTYA 4J1WA 4N43C 5KHHA 1PK6B 4KG0A 2WFF2 3HT1A 1U5XA 3VBRB 4GH4C 4BMEA 4AFDA 4MGYE 4DRVA 2MEV1 3ZVXA 4YFWA 1OD5A 4NOTA 2QFEA 1B35C 2IXHA 4N53C 1O91A 1QJU1 4F7ZA 5BNPA 1XYOA 3OF1A 4JGZB 1HQNA 1XQNA 2R0FA 2WSUA 4LBNA 2R073 4XJ9A 1JUIA 2R0HA 4L92A 3GBFA 1N3QA 2VQAA 1CAUB 4FTSA 5GZEA 1VAMA 3MIGA 4LHNA 5BNNA 2RS51 1OQEA 2ZX4A 3LZZA 5JR7B 3OCPA 1S0EA 1X33A 1PO11 2PLV3 1NA1B 4FAHA 1XE8A 1J58A 1QXRA 4CDQC 1MZ6A 1X8EA 4I3GA 3DPRC 2ZHLA 1K5MA 4Q4W2 1AF9A 2HYKA 1QOSA 1XNCA 4DZGA 4R9BA 3ILFA 5C4WB 2EXJA 2CWSA 1W2UA 2ZGLA 1J59A 1LR5A 3CO2A 4PBPA 4C1XA 1RHI3 2C1FA 3KB5A 3WHUA 5HXVA 4AEMA 5I0RA 5GZDA 2XLAA 2R043 3WP3A 1C8M1 4MGKE 3KCCA 1JH5A 1AR73 1G9FA 4XEZA 2ZBJA 1EV11 1O5LA 5JSOA 4HETA 2RS32 2IFWA 3SXWA 4Y22A 2JG9B 3MEPA 4XBQA 5JSPA 4D94A 3S7EA 2VNOA 1CX4A 1KFUL 1VBB2 4KGQA 4LE4A 1BVVA 3LAGA 1WBFA 3WG2A 3ZFEA 5CB7A 5H9RA 2HWC1 1TNFA 2GMMA 3AZZA 4HLTA 4OHVA 1JTZX 4N9IA 4Y1VA 4D69A 2WZR2 2RJLA 4HVQA 2DFBA 3VKOA 2UWCA 3E5XA 2E7TA 2WA4A 5BYNA 2DFCA 1CESA 2XL9A 1BQPA 1ZREA 1UPSA 3WDVA 2QE3A 5BXXA 1VRH2 2HWC3 3HMYA 3G6JB 1AL21 5AFBA 1HX6A 1C1FA 3IPVA 3GHMA 5JOZA 5JI7A 2CGPA 5FLIA 1C8NA 2PYTA 1LESA 4E27A 3GBGA 4A7ZA 1W6QA 1VBC2 1NE4A 2WWSA 3R6SA 1DLLA 2Q30A 3MICA 3SH4A 2ZHKA 2ZZJA 4S2GA 4AK3A 3I8TA 3WDTA 2JXAA 4CDUC 3GZTB 5I93A 4QPGB 5JMCA 4B29A 1BXHA 1W0PA 5GZCA 2VNRA 1RUF1 4C90A 1DQ4A 1H8TC 1XXNA 2P3IA 1OKQA 3BCWA 3FLPA 3RMXA 3I4IA 2DU0A 1VAVA 1SFYA 3ZFGB 4IV1B 4Q4X1 1N1VA 3ES4A 5E8AA 3J8F2 1ND2A 3USUA 3IN9A 3PVNA 5EYYA 1FT9A 3MDPA 4DXZA 4Y1UA 3SITA 1JXNA 3ENRA 2RM21 1NLRA 1KITA 2ZGTA 3IT8A 4LE3A 3WDUA 5J48A 2X8KA 1FPN2 4AEJA 1KXGA 3SLIA 4K1YA 1JOJA 5FPZA 4W6YA 1AR63 1DQ1A 2CV6A 3E5QA 3NV2A 2ENRA 4AVBA 1X82A 1JYCA 5JZGC 2D44A 4K1ZA 2ZGPA 1BVP1 5EFUA 4Q4W1 4MXWB 3TB0A 5KXEA 4I0WB 2EA7A 1QXPA 4YG6A 5LRRA 5ACA2 5K8SA 1C5HA 2YXSA 1PVC2 1PIV1 5AC92 2I07B 5H9SA 3NV3A 1VBA1 1SBEA 3HN1A 1OHFA 4U36A 1F5JA 3ZFGC 1WMEA 1ZM1A 4TZDA 3SH3A 1IZ3A 1H2MA 2PFWA 1LRHA 3OY8A 5K9YA 2GC0A 3ZXAC 4MVTA 2ZCWA 3W9AA 2UWAA 4XHBA 3LSDA 4FT8A 3VBRC 4COUA 4G3YC 4Y22B 2EF6A 4GB31 2B46X 1TMF1 2WZR3 3WCSA 1QOTA 3AYEA 2DF7A 4XFHA 1IHMA 1HV1A 3VBUA 3WG3A 1RMU2 4I09A 5JVVA 3MW2A 4LBJA 1HRV2 1YHFA 4GB33 4S2DA 1ZBE2 4OI4A 4EN9B 5BNNB 3VKNA 4Y4YA 3USSA 4YW5A 1CPNA 3MF9A 2B7YA 1V9U1 2VQ0A 1NA1A 4XFBA 2P3KA 1O3TA 2UWBA 1H8TA 4ITCA 4M3CA 4JGYA 2NP0A 1RMU3 4QQHA 4HBNA 3P3NA 2VGDA 3AYCA 3RWNA 4ISRA 4YLZA 2JECA 2GC2A 5FOJB 1BEV2 1Y3TA 3ES1A 4A2UA 3S6PA 4E4DX 2BFUL 4AFBA 5AFEA 3V0BB 4R9AA 2PAEA 2VECA 5DZGA 1UKRA 3VV1A 5T5PA 1FMD3 4QHBA 4I30A 1CJDA 5F1RA 3B69A 5JZGA 1PGW2 1QJU3 2BVBA 4IEVA 5DUWA 1DU3D 3QOPA 4DFSA 4YGBA 2GMEA 4E2GA 4WM7A 4QGLA 1PO13 3JB8A 1PO21 1O4TA 4B4QA 1O3QA 1ZRCA 1K5MC 2JEMA 2GZWA 3PMSA 1CONA 3SHRA 4Q1PA 1LGNA 4R4ZA 1KFXL 4D7SA 2HEWF 4COWA 1IPJA 1SLTA 2Y38A 1QJY1 2HWF3 2ZAHA 1QU0A 3DUIA 5A3MA 1IKQA 2AREA 3ZFGA 2XBO1 3N3HA 3VDDA 1C5IA 3ZFFA 4QQLA 4BZ4A 4PDWC 2VMGA 5F9TA 4RR3B 3GNEA 5BNOC 2DCTA 3KCYA 1IS5A 1OLQA 2R1BA 3QD6A 3AMPA 1BBT1 4AVTA 3M70A 3VBRA 3HD8B 3J8F1 3EO6A 4H14A 4HKWA 3WW1A 1UU5A 3KM5A 4WBBA 4M01A 3VZKA 3CEWA 1Q3EA 3MIBA 3KSCA 1V6NA 4UBHA 4AI0A 4NN0A 5J98B 2BWAA 1YFXA 4DY3A 3IDBB 2A75A 4Q8KA 1OMIA 2PAMA 2UURA 4B4RA 4XOGA 1NYWA 2DCZA 4IL7A 4XFGA 4UW3A 2Y26A 2ZAAA 1C28A 2TNFA 5CNAA 3SCGA 4QGNA 1CQ9A 2VH9A 2X29A 5ACA1 4LLFA 2AH2A 3UL2A 4FOQA 3WVJA 4FXGB 4AQSA 2XWBB 4Q8LA 3WV6A 1XNDA 4XXAA 2DUQA 1UF2C 3EHKA 3CNAA 3IDCB 5GJ6A 3VBOB 3O12A 3H1WA 3JD73 1AR91 1CPMA 1HRV3 1SLLA 1D4M1 2BNOA 2CTVA 4YM0A 3U4XA 5K0UB 4CP2A 1KRIA 3ZIXA 1AVBA 1C8M3 2A6ZA 2NN8A 2VVEA 4IV1A 1DGRA 5A32B 1RJ7A 3N4MA 3X29B 1VAKA 1S0DA 4BLJA 1YYNA 3QCWA 4Y5Z0 2YGLA 4YNIA 1KS4A 1GQHA 1NLSA 3N35A 1CR7A 2P2KA 5FLJA 4YZ1A 3ZMNA 4XFIA 1AR93 1HRV1 2D7FA 1OFNA 2XB6C 2XVLA 2ZX3A 4EJRA 1C8M2 4RA0A 4QQPA 3CJXA 3AKQA 4LO5B 4IEZA 2D6MA 4RS5A 4FPHA 1RUH2 2MPFA 2XKOA 4AE2A 1WLCA 4NWVA 2RS31 4I01A 2ZJCA 4IV3A 3JCIA 3WP4A 1AL0G 3MGUA 1AR81 4EV0A 3VHNA 4META 1EAH2 1WCDJ 3QH6A 3FBMA 2JKBA 3QH7A 4AVVA 4Z07A 1ZBA2 1HRI1 4YYOA 5BUVA 3M8LA 1AYM3 3RSJA 5GZGA 1IKPA 3A0KA 5ABJA 4NPRA 5J7MA 1G9BA 1RUJ1 2R30A 2YY1A 4K6BA 4Y1XA 2E7QA 1AJKA 4X8NA 5FMOL 1G9CA 4OLLA 3CU7A 2Q1MA 4AG4A 1YI9A 2HWD3 4FOVA 4CDXA 1I6XA 2DVFA 1Z7S1 3FLTA 3H0OA 4L99A 3PTYA 5SV8A 3LB9A 1MS1A 2ZACA 4O9GA 4AVAA 5IK8A 2Q1ZB 1KDKA 4XYXA 3ALQA 1WMFA 4GH4A 2VW1A 2VMIA 4FPFA 3T1MA 1QGLA 3B93A 3RQ0A 3VHPA 1LHOA 1PO22 2NPIA 1B35A 1FOD1 1O3RA 1LULA 1RUJ3 4YZ3A 4LT5A 1CGPA 1GZCA 1VBE1 4MV2A 2OA2A 4ONUA 3FE5A 1LOAA 4ORFA 3GBWA 1RB8G 3WG4A 4AF9A 3M1HA 2WJSA 3H1YA 2PLV2 1RHI2 4U2AA 3KQRA 4RL7A 3AP4A 3B94A 4AEDC 2A6WA 1ND3A 1BJQA 4M0NA 3PVEA 1E57A 1LODA 1R081 1R1A1 4JVAA 2JG9A 4FQZA 4XW3A 4GULA 4MLOA 1MS9A 3NAPA 1I1EA 2PHWA 3FLRA 4LO8A 2GH8A 3GZUC 4QXKA 5FRAA 5LEKA 3AKTA 4MUVA 1S0IA 3VBHC 5L7OB 4LBQD 4XF0A 5I8TA 2PHFA 3PVBB 1ND2B 1DGWA 1AR61 2ETEA 1QJX1 3AX4A 3B3QE 1MR5A 1V70A 1OQDA 1RUI3 4JQRA 4XBLA 4XF9A 1FXZA 3M3QA 1BZWA 1MEC3 1QNYA 4JV4A 4YZ5A 1AXYA 5JOYA 2WT2A 1YO8A 1WW7A 1RUC3 2IWGB 4JGZC 3TOJA 5LK5A 2QDRA 3ILNA 1QHDA 1VB2A 5JIUA 1WCKA 4TLFA 1AR71 2A3YA 1ASJ3 2GN3A 4J6GA 3ELNA 5BY5A 1VLNA 3IM0A 2KM2A 4CP1A 2ZMNA 2ZGMA 4FOWA 3ETQA 2YPJA 4FBFA 4MX3A 2A3WA 2RS12 3RYKA 4BIFA 1QMJA 1W6QB 3CL1A 4RGGA 1RUG2 3LA7A 2RS33 4P9YA 5DUVA 3TN93 5KC5A 2QKDA 4YW2A 5KHKA 5HCFA 1SCRA 3ZSMA 1UD1A 4I0BA 4XE9A 3THTA 3B02A 4PQ9A 3WR0A 1KD7A 4AGGA 4CDUB 4OFGA 3V64A 1VBC3 3JUUA 1REFA 2HWD2 4I2OA 4Y20B