4PBPA

Crystal structure of zebrafish short-chain pentraxin protein
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
KNLSGKVLQFKTATDNSYVKLYPEKPLSLSAFTLCMRVATELPLDREVILFAYYTPDVDELNVWRERDGRVSLYIQSSKDAAFFRLPPLSTLQTHLCVAWESATGLTAFWMDGRRSLHQVYRKGYSIRSGGTVVLGQDPDSYVGSFDVDQSFVGEIANLQMWDYVLSSAQIKAVYYNQDNRVKGNVFDWDTIEYDVTGNVLVVPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
pubmed doi rcsb
source organism Danio rerio
molecule tags Immune system
molecule keywords C-reactive protein
total genus 52
structure length 206
sequence length 206
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00354 Pentaxin Pentaxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pbpA00
4YM1A 1V6LA 1LOGA 3WG2A 1QNYA 4Z8BA 3V0AA 1VIWB 2ZGSA 3IMNA 3LSEA 5E88A 2B7YA 3FLTA 1IOAA 1JOJA 3ENRA 4M01A 3AFKA 3N7LA 4XIKA 1G9BA 2EAKA 5EWSA 3ATGA 3RRDA 1OQ1A 3AJYA 2W68A 4BLIA 4GKXA 5H9RA 2R1BA 2D3SA 2JE7A 1ULFA 2DVGA 1Q8QA 1HDKA 1BQPA 1MVQA 1Z0HA 3AYCA 1YYNA 2H0BA 1QDOA 5T52A 4XYXA 3W59A 3ZXFA 4H55A 1KDMA 1W6MB 2ARXA 4AVTA 2Z42A 4BMEA 1MS1A 1AXZA 1I1EA 1FNYA 1DYPA 4FP3A 3NWKA 4XTMA 1SLAA 1WW5A 2NMOA 1AJKA 4IQPA 1MACA 1GANA 1YI7A 1GICA 2GN7A 1ENSA 1LHOA 2JDZA 4Y24A 1GBGA 2ZHLA 1LESA 1SBEA 1UN1A 3M1HA 3N3HA 4XMIA 1UX6A 3AP5A 3WDTA 4F83A 3UL2A 2UU8A 4LBKA 3SNMA 1JYIA 5JVVA 5IK5A 4U36A 1FV3A 1GNZA 2ZGTA 1VAVA 3AP6A 2DWRA 1DQ5A 1PZ7A 2WSVA 2ES3A 4KBBA 1G9FA 2WJSA 4YLZA 1APNA 4ASMB 4PBOA 5LK5A 3ZPYA 1CIWA 1DIWA 3CNAA 5DZGA 1IS5A 5DZFA 4XJ8A 1N1VA 4YG0A 2CY6A 4FOWA 3AJZA 3I8TA 4GXLA 4FPCA 4ITCA 3WOGA 3WNXA 3PMEA 3WV6A 2ZMKA 3ZXKA 3AZWA 1CONA 3HMYA 1HLCA 1Z78A 1N3QA 1YXWA 1C1LA 1H9WA 1GKBA 1UZYA 2PHFA 2ZHNA 4YG3A 4K21A 5IK8A 1W6MA 3ASIA 4PQ9A 1RIRA 3LCPA 2P37A 2CTVA 4PCRA 1N1YA 2GMPA 2P3IA 5CBLA 1SCRA 1C4RA 3WCRA 3POSA 5GLTA 3NV2A 4P9YA 2EF6A 4FPKA 1S0IA 3DUIA 2EXKA 2ZA9A 1V00A 2PHTA 2AUYA 3M3CA 3N35A 4Q2FA 1HKDA 3RQ0A 1W6OA 1SBDA 2D7FA 3UJQA 3OBTA 4Q26A 2WT1A 3V0AB 3T2TA 1AXYA 4U2AA 2WKKA 4AVSA 1KJRA 1KITA 3QLQA 4ISQA 2E6VA 2HYKA 3VKLA 3SITA 3VUOA 1LHNA 4BM8A 1CJPA 3A0KA 1LOEA 4FQ4A 1GZ9A 1BJQA 1W6QA 1FNZA 1O4YA 2NYYA 4LBJA 4OZXA 4BLJA 1S0GA 1KJLA 1F31A 3WZ1A 1QDCA 3FLRA 3WDYA 1JYCA 5GALA 1UKGA 2NP0A 1X50A 1LOAA 1KDKA 2GNTA 4BOWA 5GM0A 1AX1A 5F5QA 1AVBA 1DQ6A 2AYHA 1DFQA 2DUQA 1LEMA 3R05A 4Y20B 4XJAA 5GZGA 2ZGNA 5DUUA 4GA9A 4YZ2A 1DZQA 4FPGA 5IK7A 1JW6A 2Q5TA 4ZKTB 2ZMNA 4YFZA 3HN1A 4M3CE 4XJZA 3FLPA 2ZBJA 1G86A 5CAZA 3AZYA 2XB6C 2DU1A 4XBQA 2JKBA 1CPNA 1DBNA 1QNWA 4LBQB 4Y1ZA 3V0BB 3ZYPA 3O0XA 1CN1A 1WBFA 2FMDA 4DS0A 4YZ5A 2V73A 3FUQA 4XIOA 4NO4A 4WZFA 1MS0A 3M3QA 1QOSA 1O4ZA 1OKQA 3NV3A 2OW4A 3JU9A 4RL7A 4GWMA 4AWDA 3AX4A 2ZGLA 3APBA 2EXIA 1W6NB 1G9CA 3IN9A 1LODA 4GWNA 2CWMA 1FX5A 2GMEA 3OJBA 2YMZA 3SH5A 1WUVA 1I3HA 1JBCA 3IPVB 3R4UA 3O12A 4NOTA 5DUWA 3ZVXA 2ZACA 4SLIA 1JUIA 2AREA 1AX0A 4YZ3A 1WLWA 3FUOA 3M2MA 5JDBA 1SFYA 4XTPA 1LGNA 1MS8A 1MVEA 1XQNA 3ILNA 4K20A 5EYXA 5GLWA 4HANA 2ZMLA 5JOYA 3TB0A 4UW3A 1S0CA 2DVFA 2ZGUA 3FBYA 1W6PA 4FQZA 4XHXA 4YW1A 2R1DA 5T5JA 5DZEA 1D0HA 1DHKB 3AXDA 1AJOA 4Y1UA 1CVNA 3AXEA 1V6JA 3DGTA 2LTNA 2I2SA 3WG1A 1MS3A 2GMMA 3I4IA 5F9TA 5EYYA 4P14A 3R4SA 4XZPA 1A3KA 1LENA 4M3CB 3RSJA 2ARBA 4FPOB 4DRVA 5SV8A 1BKZA 1N1TA 2ZKNA 1JHNA 4UW4A 5DG2A 3WCSA 2DUPA 2A70A 2PHRA 5EXOA 5JMCA 5KXDA 1FATA 1SLLA 2D43A 3W58A 4AGVA 2RHPA 2ZGRA 3N7KA 3VKMA 1ZA4A 4UW5A 1DGLA 1S0EA 5T54A 5DG1A 2VUAA 2ZGOA 3KQRA 2A3XA 1LU1A 1LTEA 2A3WA 2AR6A 1C1FA 3OY8A 4DPNA 2NN8A 2VW1A 2GNMA 3N7MA 1NXD1 4UW6A 3MW2A 1GLHA 3N7JA 1B09A 2R16A 4R9CA 3D5OA 3OYWA 5GLZA 1V6KA 5H9SA 3RMXA 3WHUA 1LOFC 2W08A 1EPWA 2GNDA 4LBOA 4TYSA 5KXEA 3VKNA 1FAYA 4CTEA 4Q1PA 3AP4A 2YY1A 2JECA 1S1AA 1G9AA 3V64A 1V6NA 3AYAA 3VV1A 3PVEA 4YW4A 1N47A 3POWA 1IKPA 2GALA 5JOXA 1CQ9A 1A8DA 4YZ1A 2LALA 1LOBA 2AH2A 2ZHKA 1WBLA 1Q8OA 4XXAA 4GKYA 2A3YA 4Q8KA 3BOPA 2CWSA 4Y22B 3O5SA 4Y26A 3USUB 3LSDA 1F5FA 2WNEA 3ZSMA 1V6OA 2CL2A 2UWBA 1SLCA 1JXNA 1LGCA 1Y7BA 2ZZJA 2P3JA 4Q27A 4XHBA 5FREA 3WG3A 2ZABA 4C1WA 5KXBA 5T50A 1DQ2A 4M3CF 2AENA 1UMZA 1FYUA 1IS3A 3WHTA 5AVAA 1YO8A 3KM5A 3AP7A 2ZHMA 4K1YA 4PBPA 1OFSA 3T1MA 1YIFA 4FOVA 3B9CA 1KQRA 1IKQA 1H9PA 4CZSA 3D6EA 1GZWB 1GV9A 3SLIA 1RINA 1V6MA 1G9DA 2C5DA 2ZGMA 1QF3A 3MW3A 3POYA 2R49A 1FV2A 3ILRA 4DRRA 5HCBA 4XE9A 4Y1XA 1YRZA 2E53A 1QKQA 2EIGA 3NV4A 1BYHA 2V5YA 4GALA 2NMNA 5CB7A 3ZSKA 1WW4A 1LOFA 1GNHA 2ERFA 2YZ4A 3WDVA 4JRAA 4JCKA 3N36A 4PF5A 2VY0A 1WLDA 1SCSA 4Q8LA 5HCFA 4DQAA 3UJOA 2BQPA 2PHWA 3GNEA 2A6YA 4DFSA 3B3QE 4M00A 4ATEA 3NV1A 1AX2A 4YGCA 3USUA 4AGRA 4BQ1A 1QOTA 4JC1A 1Q8SA 1S0BA 1Q56A 1N1SA 1C57A 3MW4A 5KXCA 4YW5A 3WG4A 4XJUA 1QOOA 2CYFA 4Y1YA 5IUQA 1MZ6A 2E7QA 1N3OA 2CNAA 2PHUA 2DTWA 2XG3A 2WQZC 3FFZA 3M3OA 4ATFA 5E89A 1S0DA 3ILFA 5BYNA 2A5ZA 3OBRA 4R9DA 4XMAA 4TZDA 3T1LA 2D6PA 2DV9A 2A75A 2A6VA 1GZWA 4YW3A 5T5LA 1VAMA 3MPPG 1UAIA 1DQ0A 3OY8B 2EXHA 3HR9A 2WSUA 2DUOA 1MS5A 4YGBA 5E8AA 3WDUA 3TAYA 4BMBA 2W39A 1DQ1A 2W52A 3AZXA 3B69A 4L8QA 4R9BA 4XOGA 5IT6A 1Q8PA 4YW2A 2R0HA 2JE9A 1BZWA 4YM2A 2WLQA 2DTYA 2DYCA 2GN3A 1IS4A 5CA6A 4YGDA 2P34A 4Y22A 2GNBA 5FRAA 2E51A 1QGLA 1SBFA 1U0AA 1RITA 1HQWA 2DVBA 2VU9A 1ENRA 4FP2A 2P2KA 4M3CA 4ISRA 2SBAA 3VKFC 2UURA 2ZAAA 3BIWE 2YXSA 1LULA 1W6PB 1ULCA 1WW7A 1LCLA 1LHUA 1S0JA 1AZDA 3M3EA 2D6OX 2OUJA 3RMYA 1W0PA 3D4KA 2WT2A 1UL9A 3OYWB 2SLIA 4WVWA 4FPLA 4XXPA 3A0NA 4AVVA 1QU0A 3UK9A 1ULDA 3U4XA 5T55A 1QMJA 1ULEA 4AGGA 1VLNA 1SLTA 1IS6A 2UWAA 1LHWA 4FOQA 2ZGKA 4YM0A 1DLLA 1J1TA 5JOWA 5CNAA 3BODA 1AXKA 1GZCA 1SLIA 3PJQA 5DUVA 4C1XA 2JD4A 4HL0A 2D3RA 1BXHA 1LOCA 2A71A 2OVUA 1LJ7A 1VALA 1LGBA 3O0WA 4K1ZA 4MYEA 2DURA 1D2SA 1NLSA 3MEPA 3PVNA 3O0VA 1W6NA 1N3PA 1DYKA 5DUXA 5GJ6A 2DU0A 4RA0A 3SISA 2D6NA 1KRIA 2WT0A 5DXDA 3ZSJA 1CPMA 1WD4A 4CRQA 3AZZA 2A7AA 4FPJA 4D69A 4WVVA 1HQLA 3L2YA 3OPZA 4FPHA 3AZVA 4XILA 2E7TA 3ZXEA 3WUCA 2UWCA 3AYDA 1LECA 2C9AA 4I30A 4ZXKA 4LBQA 1LHVA 3VKOA 2D6LX 2GDFA 1AF9A 4XDQA 1MS4A 2VH9A 1WW6A 4XJ9A 2PHXA 5T5PA 1A78A 1LU2A 2A6WA 4FOYA 4P9XA 3WLUA 4BPZA 2YV8A 4FPEA 1ZM1A 4P9WA 2ENRA 2G4IA 1WLCA 4YG6A 2A6ZA 4R9AA 3ZSLA 5GZCA 1G8WA 4XJWA 3WUDA 4Y20A 4LBQD 2EXJA 2D44A 3H0OA 1CESA 1GSLA 3IPVA 3QCWA 1URXA 4YZ4A 5IK4A 2P3KA 2ZGQA 1MZ5A 2VW2A 3AK0A 1SACA 2NZ9A 1LEDA 3JUUA 3PVOA 2D6MA 1W6QB 3A4UA 4LBLA 3WDXA 3OGGA 2TEPA 2KM2A 5GLVA 1MS9A 3BTAA 5GZEA 5H9PA 2ZGPA 4Y1VA 1MR5A 2NM1A 3RG0A 1WD3A 4YM3A 4LBNA 2VW0A 4XBLA 2YROA 1TEIA 1WCSA 1W6OB 4WV8A 4YFWA 3RS6A 1ONAA 3SH4A 3V0BA 3ZYRA 3V65A 4W65A 3ZXLA 1R1ZA 4FPYA 2PELA 4XBNA 4FVVA 2EALA 2D6KA 2FHRA 5JOZA 3C2UA 3AP9A 3B00A 3Q9OA 1ULGA 4AYUA 3SH3A 3IKWA 2D3PA 5GZDA 3AYEA 1JN2P 1W0OA 4FPFA 1SLBA 4LBMA 1PZ9A 3ZXJA 1S0FA 5GLUA 5H9QA 5L73A 4YGEA 3GALA 3B01A 4Q1RA 3WVJA 1G7YA 1PZ8A 5HCAA 1DQ4A 2OUHA 1V6IA 3WDWA 5GZFA 5JLVA 2AGSA 1UPSA 5T5OA 2A6XA 1ENQA 1UZZA 2DVAA 2VXRA 2DVDA 3IM0A 1GYKA 2R0FA 3INAA 2JJ6A 1Q8VA 1CR7A 1H30A 1F9KA
chains in the Genus database with same CATH superfamily
4YM1A 1QXJA 2VQUA 3PIGA 1QNYA 4LA2A 1ND2C 4Z8BA 2YFZA 5F7UA 4XCBA 5I0RA 4A6SA 3S30A 3KT7A 1RTVA 1JOJA 4ZHNA 2Q0AA 3ENRA 1J3QA 1OQDA 5LK7B 4M01A 3AFKA 4LKDA 4MXVA 4RHV1 5C6CA 3MIDA 4Q4Y3 1OQ1A 1V9U1 4BLIA 1FPN2 3AL6A 3TBDA 3CEWA 4D8MA 1Y9QA 3VBOA 1ULFA 1WA4A 4WM8A 2WYSA 3AYCA 2H0BA 2QQMA 2XDVA 4XYXA 2UY8A 1ND3C 1RMU2 2XL7A 3RNSA 1KDMA 1OI6A 4DY5A 3GBFA 3VD5A 4NRQA 3RZMA 5D8AC 3PHMA 3OEBA 4D7TA 1MS1A 4CP2A 1FNYA 2RDSA 3D3AA 2KA3A 4IEXA 1K42A 4RHV2 1TME1 4QMAA 3O14A 1QY4A 4G3YC 2XJVA 5FZFA 1VB4A 2XHNA 1EUTA 1UZWA 5AFBA 4C8DA 1NA1A 3VBOB 4Y24A 5LBFA 3M1HA 2E63A 2GH8A 4ET7A 3MLKA 1UX6A 2QTWB 3HJRA 1UY4A 5K0UC 3SNMA 2HWB1 1C8M2 4KGGA 4LBKA 2VCAA 5FLHA 2MHFA 2X53S 3JBG3 3VZMA 2ZGTA 2X09A 3BVCA 5J48A 3AP6A 1PIV3 3OGSA 3VZLA 1DQ5A 1PZ7A 4KBBA 2ES3A 1D2QA 4Q4W2 3AL5A 5FZBA 1MEC3 4C0BA 2P5BA 2JG9A 3N9PA 5CZKA 1Y3TA 1OVSA 2R041 1W9WA 3EO6A 4KI5M 4QX7A 1YQ8A 2CY6A 3I2KA 4O9GA 4YG0A 4FPCA 1U5YA 2IXLA 2JB4A 4Q0UA 1VBA3 1MZFA 1YXWA 2YUEA 1ZZ6A 4YVWA 1HJFA 3NJXA 1PO22 5E16A 3QD6A 4PQ9A 2FDHA 3QBQA 2CTVA 3NQHA 5A3MA 4H14A 1JHJA 4AW7A 1IZ3A 3ZFEC 3LB9A 3NV2A 4AFMA 3ES4A 1NX9A 2VBBA 3CLPA 5A33B 1VBA2 2AUYA 2PHTA 2VZ1A 3M3CA 3RZHA 5IATA 2CGNA 4CDWA 3URFA 1W6OA 3SCFA 1UX7A 2WS92 5I0TA 4QXKA 3N9LA 1WMDA 4Y5SA 1REEA 1PGW1 5FR3A 3T2TA 4IEVA 2XBO2 2WKKA 4AEMA 2Z4FA 5FUPA 4S2HA 5DDJ2 3JXSA 1TZOA 4Y4YA 4FBFA 2HYKA 4LHNA 4NROA 4WVMA 5F2WA 3A0KA 3G6JB 5FPAA 4O9EA 4QM9A 1AR62 3E6CC 2NYYA 5A1AA 5J37A 2YGLA 5FV3A 2HEWF 3M3IA 3J8F2 4CDXA 1F31A 1XNBA 3PJYA 3RVHA 1H2LA 1QDCA 2WS93 5GALA 1UKGA 4N53B 1LOAA 3VBSC 3MGUA 1AX1A 5F5QA 4BOWA 1AVBA 3E97A 1DFQA 1JZ7A 1VRH3 4P9LA 4F3JA 5DUUA 4FPGA 1NQDA 5IK7A 1JW6A 1OVPA 2YGMA 1GU3A 4ZKTB 1NOVA 3WNNA 1R093 1P8JA 4W6WA 3NJVA 4FO9A 4M3CE 3FLPA 2ZBJA 4NWWA 5CAZA 4IEOA 5I0SA 2XB6C 2QQOA 3KGZA 2DU1A 1ODNA 3TEXA 3BKZA 5EJ1B 3MIEA 5K8SA 4QXBA 1BBT2 2VTFA 4EZ4A 3HT1A 2IZWA 4RGKA 4K8FA 1AYM3 4QDSA 4NO4A 4WZFA 3SKJE 4QQOA 3MUY1 2VMHA 1O4ZA 3MF9A 4AWDA 3OGJA 2OW4A 3JU9A 4BDVB 2ZX1A 2ZGLA 4UBGA 4BE3A 1ZNPA 4LJHA 1AR92 5CYYA 2WZEA 3S5QA 4KQ7A 4GWNA 3MIHA 4LR4A 4XUOA 5FO9B 2GMEA 3OJBA 4LIVA 2YDEA 4XZUG 1ACCA 2CGPA 2JDPA 3UV9A 1TNFA 5C33A 5FY7A 1JBCA 3PUAA 3IPVB 2RS52 3I49A 5C4WA 1AL23 1HRV1 4MHRA 4QPGA 5AVPA 4YSFA 1UU5A 4HKLA 4YZ3A 4E9KA 2YC4A 4AI9A 1YIPA 2LROA 1GOGA 1QXRA 4QKDA 4XTPA 1LGNA 3BB6A 1EPZA 1MS8A 1VBC2 4XW3A 5A3WA 1MVEA 2RR12 4ZS3A 2KXLA 1UIJA 4AHYA 4YVSA 4CCMA 1C28A 1MEC2 1S0CA 2DVFA 4FQZA 3ZXJA 2ZEWA 1AJOA 3MIFA 3AXEA 3FJSA 2I2SA 1MS3A 2GMMA 2PYTA 2VC9A 3NAPB 5FP7A 5F9TA 1OT5A 1Z7S3 4PI0A 3DYMA 1W90A 1LENA 2ZXQA 3PUHA 5SV8A 4XFAA 5KHHA 3KHCA 2XBO1 3BN6A 1OXCA 2A70A 4PIZA 5EXOA 1FATA 1EAH2 3H8UA 4BJ0A 3W58A 3HBKA 1HXS3 2P1BA 4FTBA 1CWPA 2ZGRA 4QM8A 4JKKA 3J7MA 2BNMA 1ZA4A 2OYZA 3UETA 1S0EA 4D0QA 4LQRA 1OLRA 4XETA 1QJFA 3KZ4C 1ENXA 2MPFA 2ZTNA 3GYDA 5CIRA 1U5XA 3WX5A 2DBNA 3LEGA 1RJ7A 2VCBA 1RVF1 4DPNA 5FYZA 1OA3A 2PMWB 4K40A 1JUHA 1C8M1 2GNMA 2JEMA 3S6PA 1XXNA 1NXD1 5FZEA 4C90A 2OKXA 4L9BA 5A6YA 3ZFEA 3D5OA 3OYWA 4N43A 1V6KA 2OT7A 3WHUA 1LOFC 2W08A 2W46A 4TYSA 2XJQA 4CTEA 3AP4A 1S1AA 3O1TA 3AYAA 4CYDA 5CFCC 3T2PA 4BK5A 1W04A 1N47A 4CP9B 5BNNA 2VMCA 5FZOB 3POWA 1IKPA 2GALA 2HWD1 3CJIB 5JOXA 1J59A 2RJLA 1VBE1 4EWDA 5FKCA 1BVVA 2AH2A 2ZHKA 1WBLA 2VOWA 4XXAA 4BU2A 4TXWA 4LO4B 3J8F3 3BOPA 2CWSA 1C8NA 2WNEA 2FDFA 2CL2A 4NMIA 1O5LA 1LGCA 4XHBA 2WN3A 2WDBA 2W91A 1DP0A 3PL0A 5FYSA 5B2GB 1FOD1 2GH2A 1TG7A 2JDUA 2JG9C 2W9XA 5BV6A 4RFT0 1O59A 1W06A 4AFCA 3VZNA 2JKXA 3WHTA 3KM5A 3VDDC 1R092 3L2HA 3HNYM 3ZXDA 2HBUA 3B9CA 4QQHA 1IKQA 4LXLA 5FZDA 4NUBA 1GR3A 4NIIA 1CIYA 1YQ6A 1T6GC 3EJKA 2ZGMA 5J3UA 1W9SA 3POYA 5GKAC 3ILRA 3R6SA 2ZX2A 5IVEA 2EIBA 2JD9A 3GCXA 2GU9A 2VNGA 3H8OA 4XE9A 5JSPA 1BEV3 5E1RA 2EIGA 2BP6A 3VBFA 1BYHA 3N9NA 4MGKE 3MLJA 2R073 4YNIA 4AF9A 4IGPA 4CCOA 2XPJA 1AR93 2WNUB 3U78A 4UWDA 5JXIA 2XLGA 5HCFA 1O4TA 1OPOA 2ARAA 3JD73 3UJOA 4DFSA 2VUDA 3ZOIA 1K5MA 1GP6A 1QJU2 1RUJ1 3HIFA 3TN92 3NV1A 3USUA 1IG0A 2HWE2 4YGCA 4JC1A 5FLJA 3U4SA 5FY8A 1S0BA 2RS53 3TRSB 1CAXA 3VZKA 3VDCA 1VBE3 3LDBA 4XEZA 1JODA 2FCTA 3UYJA 3GZTB 3LWCA 4XJUA 1QOOA 4ARXA 5IUQA 2OXBA 1XNAA 2E7QA 2XUMA 1XNCA 3T08A 4P08A 4IUGA 5FDBA 1UZ0A 1FOD3 2PQQA 2WQZC 3M3OA 4BHPA 3BIEA 1S2EA 2RR13 2YC0A 2ZX4A 2VO5A 4NIAA 2A5ZA 1LRHA 4TZDA 1UXXX 1OSGA 2VVFA 2VTXJ 2A75A 1F4AA 4LHLA 4KH9A 1YFYA 2QJVA 3ZYFA 4YW3A 3ZFGB 1NY72 1OF3A 4MGSA 1DQ0A 3OY8B 4XF3A 1FPN1 3WDUA 3KV5A 3TAYA 2Q8CA 1DQ1A 5LY2A 1JH5A 1O7FA 1C3HA 5IT6A 1Q8PA 3TYJA 1ZRRA 2PQSA 4NHYA 2RM21 2Q1FA 4RD7A 3AVRA 4GMP0 2RDRA 2BV4A 4YGDA 4UXAA 1XU2A 5FRAA 2E51A 4W50A 1QGLA 1F4HA 1RITA 2DVBA 4UFJA 4Q4V1 3ZXAC 5FZ1A 2SBAA 4Q0PA 1JZ8A 1IPKA 3SXWA 3S5AA 4GB31 1S0JA 1AZDA 4XUNA 2VZRA 4OHXA 3D4KA 3RMYA 4LLFA 3OYWB 4WVWA 4JGYA 4QXHA 5JIAA 3BOWA 4FPLA 2VMGA 1XBFA 2WWJA 2BGOA 2JDHA 4NRMA 5D2AA 5ERLA 1ULDA 4GMP1 5LA1A 3BI3A 3MZHA 3SEEA 2C9KA 4N43C 4IDZA 5FZ9A 3JQXA 2UWAA 5CADA 2OQ6A 4XF4A 2J22A 5CNAA 1X33A 5L36A 2W1QA 1RUG3 5A1LA 2W2IA 2D3RA 2A71A 1GQGA 1WGPA 1VALA 1LGBA 1XJAA 3VZOA 3K77A 3PTRB 2DURA 3RZLA 5A3UA 5DUXA 1RUE2 4FCAA 1VMHA 2DU0A 2PAKA 3MIBA 4RA0A 3WQ1A 4Y5Z0 4RGGA 3SISA 5BNOC 4Z2WA 5DXDA 2CDPA 1CPMA 1WD4A 3AZZA 4FPJA 3UESA 2J7MA 1CAUB 3S57A 4FPHA 3AZVA 4XILA 2E7TA 3WF1A 4W6XA 3ZXEA 1E5RA 4I3GA 5I8YA 1CAWA 4I30A 1RGSA 5FJKA 4HK8A 5HV0A 2MEV2 1JZ5A 4LBQA 2PAMA 5FYTA 2B46X 4DUWA 4CDUA 2HWF1 2R32A 4IETA 2PHXA 3O1OA 1LU2A 2A6WA 3HT2A 1UOJA 2TNFA 3M8LA 4FOYA 4P9XA 1HRV3 3M4FA 2R072 2Q1ZB 2ENRA 3N9MA 5FPBA 4YG6A 2PLV1 3ZDSA 1XNDA 4PDWC 2YHJA 5KHKA 1SEFA 2RE9A 4QPGB 4Y20A 1PVC3 5EFUA 4OLLA 2D44A 4NWVA 3ZMNA 3RYRA 3IPVA 4YZ4A 1WCDJ 4QT6A 1POV3 2NZ9A 3A7QA 2E7AA 5A1FA 3PVOA 2D6MA 4HLTA 4CA9A 4COVA 1VBE2 4QKNA 4PLOA 1X7NA 2RS51 4ZZ5A 3E5QA 4I09A 3EB7A 1VBB1 2W1WA 1PK6A 4X6RB 1MR5A 2NM1A 5GZEA 5L9RA 4ZU5A 1ND2A 2HEVF 2JG8C 4ZU7A 4KWJA 2K46A 5IAXA 1YQ2A 3IIAA 4I01A 1CAVB 5FQ0B 2Y6KA 1PNFA 3T4VA 1TEIA 4DXSA 1BVP1 2J1TA 3V0BA 3EHKA 4NR1A 4JGZA 3T3YA 5CG9A 1KEXA 3HOBA 4QKFA 4HVRA 3O1MA 1HIXA 2PELA 4FPYA 4EN9B 1RVF2 4FVVA 2EALA 2ZJCA 4WM7B 3H7JA 2D6KA 2FHRA 2H0VA 3LQCA 3RI8A 3U14A 4I02A 4COUA 1W2NA 5A6ZA 3OTFA 4H2AA 1DGRA 2WR9A 2D3PA 2RG4A 2FQPA 1UCXA 5FP3A 2PHLA 3KV4A 1SLBA 4LBMA 1VE0A 1MZEA 2MNGA 3LAGA 2QQVA 3B5LB 4UFLA 1ZBA3 5EP9A 1W39A 4N53A 4YGEA 1EAH1 2ZAHA 5H9QA 3B01A 4IE6A 4JRLA 4OI2A 1DQ4A 2OUHA 1HQNA 1V6IA 1OKOA 2QVSB 5GZFA 4AQ2A 4E2GA 1OUSA 1Y9MA 4GWJA 4BZ4A 2GP3A 2VXRA 4MH0E 2Q4SA 2R0FA 3INAA 5FLIA 5ABJC 2W47A 1V6LA 1LOGA 4YWAA 5FO7B 5APAA 2EICA 4AK3A 4FTEA 3J8F1 3RI9A 4QX5A 1VIWB 3NAPC 4JKMA 4BXFA 3I2DA 5DAWA 3AMHA 5FXXA 3VBRB 3ZFFB 3ECQA 1AYN1 3FLTA 1IOAA 1ZBE1 2V4AA 4LE4A 1RUC3 5D1IA 5TSWA 4AQ6A 1Q5OA 1PO11 1G9BA 3T0DA 2EAKA 3I97A 3RRDA 2HWC2 3HVDA 2H6BA 1F15A 4OUSA 4FTSA 4JAAA 5C3QA 2R1BA 2X10A 2ZX0A 2JE7A 3VBSA 1ZX5A 2V4VA 2XJSA 3EXUA 1BQPA 5IVCA 4MHUA 1MVQA 1Z0HA 2XUEA 3PLQA 1A34A 4WBBA 4H55A 2ARXA 1JYVA 1C8M3 4HKOA 4R8HA 1AXZA 1DYPA 2W1UA 2WQ8A 2XL9A 1WW5A 1UIKA 2RS13 5K4LA 3ZKYA 3POGA 3OGVA 1MACA 1UMIA 4DB5A 1OA4A 2OIIA 1YI7A 3GBGA 2ZEYA 1GICA 5FY5A 2GN7A 4N7IA 1GWLA 5F3GA 4P9JA 2ZHLA 5IFPA 2JG9B 4XMIA 2HWF3 3UT0A 2VQ0A 3AP5A 1JZ4A 2YBKA 1CX4A 2IXCA 2MEV1 2UU8A 3UL2A 3IZOA 4X8NA 3SCGA 1GFF2 4U36A 4AI3A 2QQNA 3E5UA 5IK5A 4CPBD 4NRPA 1VAVA 2WSVA 4I0BA 5EPAA 3IB3A 4YLZA 1G9FA 2R042 1FXZA 1PO23 4UF0A 4PBOA 3OUJA 5JPMB 1CIWA 2XJUA 4AEJA 3CNAA 5DZGA 3ROUA 3WF3A 5DZFA 4XABA 1NA1B 4FOWA 4AOCA 3I8TA 4ITCA 3WNXA 3WP3A 3PUQA 1PIV1 2D98A 3PMEA 5JSOA 3B9IA 1V9U2 3O1UA 1H0BA 1RYYA 5FMDA 5FP8A 2HWB2 3AZWA 5KC6A 1YUDA 3HMYA 1Z78A 4EN7B 1HRI3 1C1LA 1GOHA 3DPRC 3J9SA 3K48A 1GKBA 1UZYA 2HLEA 2PHFA 3CL1A 4YG3A 3VHNA 3ASIA 2WNVB 3E1F1 2Q8OA 3AMMA 4PCRA 3ZXGA 2GMPA 2P3IA 1OH3A 4P00B 2BWCA 5ACA1 1NLRA 1C4RA 2I45A 3POSA 4MX3A 4AAXA 4D6SA 4OI0A 3IMMA 4PIXA 3CMGA 4FPKA 1ZRCA 3DUIA 4J1XA 1X9PA 5F32A 1V00A 4BQ4A 1EYBA 3CF6E 1HKDA 3WNLA 4XFGA 1XSQA 5DAQA 2XXZA 3UJQA 3LOBA 1YQCA 1W3VA 1ND2B 3KB5A 3MF6A 4U2AA 4AVSA 1KJRA 2YPDA 2QQIA 2OZJA 3RDIA 1LHNA 3DN7A 3SITA 2FBEA 5LEKA 5FK8A 5JSRA 4UI9L 4YVSC 5LATA 1R64A 4FQ4A 4PHZA 2BTVC 2BBAA 3NJYA 4OZXA 1FNZA 1O4YA 5ANQA 4BLJA 3WDYA 1W8TA 1QJY2 4N9IA 1KDKA 1XPWA 3NRUA 3C8XA 2DUQA 2RMU3 4XJAA 5FYHA 5KC5A 1PNGA 1E5HA 1JU4A 1SG3A 3CDZB 4DNYA 4CEWB 2Y38A 3F2ZA 4ZPIA 4BA6A 3FL7A 4QGMA 4UFKA 2ZMNA 3LEIA 4XAEA 4ZONA 4YFZA 1RUNA 3MBWA 1RMU3 2V09A 1US2A 2Z79A 4DXTA 2JKBA 1QNWA 4H7MA 4Y1ZA 1RUC2 5CU1A 3T4HB 1NUKA 4BYYA 3RZKA 4L97A 1CN1A 4NAOA 2BEOA 2FMDA 2GC0A 4QX8A 4TN7A 5A6QA 1FPN3 1DDLA 3TOJA 3N9OA 5CG8A 1O3SA 4AEDC 3M3QA 1U5ZA 4I2OA 1VP6A 4JTNA 4CEYB 1KD7A 3NV3A 4AEKA 4DIQA 3I2JA 3ACGA 4AFAA 4EYUA 2WFF2 1W6NB 3CJXA 5F6KA 1VBD1 4ZS2A 4KU7A 5CVRA 3ZMOA 4K7JA 3EMRA 3SCHA 1C5IA 5DABA 4NAMA 3SH5A 2JWPA 1D4M2 3NNMA 4MLOA 1NT0A 2V72A 4Q4W3 4NOTA 3ZVXA 2K9ZA 1MQTC 1RUH3 4V2VA 2AREA 1AX0A 2VMFA 4G4FA 1OD5A 5F3EA 3GCWA 1R083 1DGRN 5ACA2 2MEV3 1UYYA 1EP0A 1XQNA 4JGYB 1JMUB 5EYXA 5IW0A 3VN4A 4B1MA 4CXWA 2ZMLA 5JOYA 1I9RA 2O8QA 3MUZ1 4UW3A 2BW8A 2ZGUA 4XQWA 5FMCA 1NE6A 4Y3OA 1D0HA 5DAVA 4QX3A 3WD5A 4CDUC 4Y1UA 4XF0A 5IHRA 2BGCA 3WG1A 1PMHX 2CHHA 2W5FA 3GBWA 4P14A 3U10A 4QDRA 4XF1A 4FPOB 4B29A 4DRVA 4FFIA 5DG2A 2K0GA 4UW4A 5LB6A 4OHZA 2IXHA 2DUPA 3DYOA 2Y8KA 3D0JA 4UBHA 1HRI2 2Y0IA 3AKQA 4MUVA 3KHBA 2YBSA 2HH9A 5HI0A 1XNTA 3FWEA 3H8XA 5ABJB 2VQTA 3VKMA 1DGLA 2FDJA 4D6QA 3W21A 1LU1A 1X36A 3DXTA 1LTEA 4CCJA 3T2QA 2XBO3 2A3WA 2IWGB 1J3RA 3KV6A 1C1FA 1D4VB 3OY8A 4CDWC 5A3PA 2RDNA 3ZFGA 3VL9A 4P02B 2VW1A 4CCKA 4OMCA 2LUWA 1HB4A 4AXOA 4ASKA 1X8MA 3LA7A 4R9CA 5GLZA 3RMXA 4GH4A 1AR82 4LBOA 2GNDA 3JB4C 4OFGA 1POV1 4LO6B 4YARA 3VKNA 4RS5C 1RVF3 1R1A1 2JECA 2YY1A 4XCAA 3RWNA 4AL9A 4CXXA 1JYWA 1G9AA 1V6NA 3GGLA 3VBUC 1SFNA 1BMV1 5CFDA 3DL3A 2R7EB 3W5NA 1BK0A 2VBDA 1PVC1 2GC3A 1S55A 3WW3A 1OLMA 2JICA 1GWMA 3LZZA 3ZR6A 4QX2A 3OD0A 1CQ9A 3LEKA 1TVGA 1LOBA 1PGW2 2JXAA 2QFEA 5IVVA 1SPPB 4Z07A 3LFIA 1K45A 4FI9A 3USUB 4Y22B 3O5SA 1ASJ3 4COZA 2AACA 1K5MB 1ZYBA 3ACHA 1QJY3 1V6OA 3AC0A 3BYWA 1SLCA 4OUMA 3FMGA 1Y7BA 1VBA1 3DCQA 5FZ3A 5A7QA 3GM8A 2L9LA 2WNUA 1XC6A 1DQ2A 4E4DX 4ES8A 4M3CF 4ZU4A 5BY5A 5DMYA 5EJ3A 1POV0 3O1VA 1IS3A 1XRUA 4LITA 5FYVA 4CP1A 3ZN5A 3AP7A 3TNQA 4HXCA 4K1YA 1REFA 4LK6A 5LW9A 4LPLA 4SBVA 1NCRA 1KQRA 1ZREA 2E33A 1JU3A 1GZWB 1UY1A 3D6EA 1ZZ7A 3WR0A 3KQ4B 1V6MA 4NJ4A 4EWAA 2C5DA 1X8EA 2VOKA 5FKBA 2R49A 2HWE3 2B9VA 4PDWB 4Y4RA 1QKQA 3H7YA 2BJSA 3ZX7A 1H6XA 2B42B 2V5YA 3P5BA 4GALA 3UGFA 3Q8CA 2ERFA 1GNHA 1OUXA 2BNOA 4JRAA 4Y33A 2VY0A 3KCCA 3L9JT 4Q8LA 1X82A 5LASA 2VZQA 1PHMA 5FZAA 3OPWA 2Y6JA 5C70A 3BU0A 3KVBA 1C5HA 1MPXA 1QOTA 2BFUL 3HN3A 4LKFA 4BQ1A 4KWKA 5FMBA 5FY4A 1GUIA 4BWOA 3VD4A 1Q56A 1N1SA 3M70A 5KXCA 3PDQA 2HKXA 3DYPA 4M0HA 4JZRA 3WQ0A 5BNNB 4Y1YA 2RS31 3NL1A 1MZ6A 4FXKB 1N3OA 4PDWA 2XG3A 3EBRA 1AR72 3FHQA 5E89A 1RUC1 4TWTA 4JX0A 3ILFA 3TEYA 3ZFEB 2VZSA 5J09A 1PIV2 4XQ4A 3T1LA 3BGAA 2BZDA 5FYIA 4IE0A 2A6VA 4DZGA 5FY0A 4K6BA 1NCRB 4MZUA 4XUQA 1WMEA 5C3PA 5IYYA 1IHMA 3SC7X 5FZKA 2B4KA 5E8AA 3CKHA 4L2NA 2W39A 3B69A 4R9BA 5A7WA 4BK4A 3KSCA 1XYNA 4XFCA 5LY1A 2JE9A 5BNOA 1HXS2 4BCUA 4FAGA 2JDNA 3POEA 2WLQA 2DTYA 3R0RA 5BNPB 4Z2AA 2X05A 2P34A 4Y22A 4GAZA 1AYM1 2XQRA 4JDNA 2XJTA 5LRRA 5FPLA 2VXJA 1U0AA 1JYXA 1HQWA 2QUOA 1ENRA 2WO2A 5AC91 1QJU1 3I59A 4ISRA 4LUKA 3NAPA 3TN91 3VKFC 3ZSEA 5K0UB 3I3MA 3GDBA 1T6BX 3OD4A 4XC9A 1PX3A 5CFDB 2W92A 3ALQA 5FUNA 4BQ3A 1ULCA 4LO8A 4AZZA 1WW7A 5KHGA 1LCLA 5FUIA 5FMOS 2FZ2A 4IXLA 4MADA 2WO3A 4YVSB 1M06G 2CGOA 4Q29A 1NQJA 4HVQA 4B7KA 5FZCA 4DO0A 5FPXA 1REDA 3A0NA 3THCA 5J96B 5L7OB 2G1MA 5FMOL 1QU0A 1F2NA 2RMU1 2XH6A 3U4XA 4IE4A 1ULEA 1V70A 5AC92 1RUF2 4B1LA 4LIUA 2XVKA 4YM0A 2R063 3VHOA 5JOWA 3BODA 3KCXA 1SLIA 1GZCA 1H1IA 1R091 3K3OA 1ASJ2 4C1XA 4HL0A 2ZCWA 4K1ZA 4MYEA 3WT3A 3AKTA 2C26A 3O0WA 4OI1A 1D2SA 1TME3 1OHFA 3MEPA 1RXGA 3O0VA 3PVNA 3DKWA 4QKBA 5LA9A 1DYKA 1XU1A 3PVBB 5GJ6A 3C7GA 3C7EA 4HKWA 1JOBA 2WAOA 1RUG1 4LK7A 2D6NA 5JXGA 3S0MA 2WT0A 3Q8EA 4CRQA 3DV8A 2ZOEB 4W4ZA 4D69A 1XE8A 1OOPB 4WVVA 1HN1A 2R062 3L2YA 4LHSA 4CCCA 4P5HA 2UWCA 5FPUA 3VDDB 1NLQA 3PMSA 4KBZA 4JHTA 1NA1C 2XWJB 4DEVA 1LHVA 3VKOA 4UT5A 1F35A 1ZVFA 3NNJA 1QJU3 3MV11 2Q8EA 3TN93 1WW6A 1PGL1 5EQUA 2W87A 3BALA 4JV4A 1AYM2 4FPEA 4H7LA 2IVIB 3W20A 4EN0A 4P9WA 1O6UA 2G4IA 2IUWA 4QX1A 4XJWA 5I0UA 3AKPA 3HD8B 3ACFA 1JTZX 3HNBM 3VGIA 4NPMA 1O3TA 2Y6LA 3RYKA 1UQXA 1YLLA 1MZ5A 3AK0A 1RMU1 1PM7A 5CFCB 4GIQA 1W6QB 1QWRA 1W8OA 1NG0A 1O8PA 4OHVA 4DY3A 5IVJA 2KM2A 1MS9A 4WVMB 2VZOA 2W0XA 1UYXA 3EYPA 2ZEZA 3GJAA 4Q4Y1 3RZGA 1EUUA 4QHOA 1NCRC 4YM3A 4KU8A 4LBNA 5CISA 2YROA 4BXSV 1S4CA 1W6OB 4P5YA 1ZBA2 1RC6A 1GQHA 1ONAA 4MV2A 1JS9A 1TNRA 1UU6A 1HXS1 3CJIC 1UNBA 3ZYRA 2N7GA 3I3EA 1R1ZA 2A73B 4LMFA 3H9AA 1O91A 3K4DA 3P6BA 4IV1C 4LO7A 4A6OA 5JOZA 3C2UA 1O3RA 2QZ2A 4BQWA 2VTXA 3AP9A 3B00A 3KGLA 1ULGA 4MXWA 2Y0OA 1RHI3 2J1EA 1CGPA 1PMJX 3AYEA 1JN2P 1W0OA 4TTGA 1SDDB 4XQDA 2GP5A 1OF4A 1S0FA 4B3NA 3ZN6A 1BHGA 3GALA 3SHRA 2PA7A 4DEQA 4Q1RA 1PZ8A 5FP9A 2ZX3A 3VBHC 4KNCA 5FBZA 1ENQA 2DVAA 1ZBE3 5FO8B 2JJ6A 1Q8VA 1CR7A 3NO8A 1R1A2 4OYUA 2TUNA 3WG2A 4D3WA 2DF7A 4YW7A 1ODMA 2ZGSA 4S2DA 1COV3 3IAPA 4LKEA 1YJLA 2XLFA 2EIEA 3LSEA 4HN1A 4QD2A 5DPNA 2B7YA 2RR11 2JDAA 2VCCA 4LOSA 1W8FA 5EWSA 3WF0A 2B45X 3ATGA 2ARCA 4IW3A 1NCQC 1RUE3 2W68A 1NCQA 4GKXA 1RUI2 3I7DA 2F6BA 1UOFA 4IEZA 3VBFC 2D3SA 2DVGA 2VVDA 1Q8QA 1O3QA 2VUCA 4ZY9A 3PIJA 1AYN3 3LA3A 5FBJA 2FDGA 1UF2C 1YYNA 3W59A 1CZSA 1H4HA 2FCVA 5FZMA 3U1XA 1COV2 1W6MB 1RUD3 1QQP3 4AVTA 2D40A 2Z42A 4PI2A 1V0AA 1JZ6A 4IE7A 4UOJA 1TMF2 4HOOA 4Q0QA 4FP3A 3NWKA 4ASLA 1SLAA 2C4XA 4GWIA 3UNPA 4XFHA 3EQEA 1NYWA 2NMOA 1AJKA 2NQYA 1KXGA 5FPZA 4WM8B 1GANA 3IDCB 2Y6HA 2WO7A 2DFBA 3VD3A 1LHOA 4GB33 2JDZA 4COYA 1HW5A 3TEWA 1XNKA 4ONUA 1O8SA 1NCQB 2BNNA 3THDA 2LW8A 1OBNA 1SBEA 1UN1A 3N3HA 1NZCA 3WDTA 1NKGA 5KHIA 1JYIA 1STMA 2Z2SB 2VJXA 1W8HA 3CBNA 1FV3A 1GNZA 3HEIA 3J7NA 3DXUA 4GMP3 4XDOA 4A45A 2B8MA 2BUKA 3GF6A 1BEV2 4UFIA 3VD7A 1W28A 4BQ5A 1DZTA 1HRV2 2VOVA 3VBHA 5KWRA 1W05A 1DIWA 2WS91 3HQRA 4OVEA 1IS5A 4GB32 1WA6X 4JGYC 1PVC2 3POJA 1IPJA 2CAUA 2F4PA 4LHKA 2J1VA 4GXLA 3WOGA 4NHLA 3WV6A 1VBC3 3ZXKA 1QXPA 2OS2A 4PQQA 3JD72 3ELNA 4X8PA 1N3QA 3VHRA 1OLME 1ZZ8A 2WZR3 3OG2A 4K21A 2O8OA 2YU2A 3LCPA 4OMDA 4WZCA 3ZFFC 2XONA 4A2UA 5CBLA 2G9GA 3AM2A 1LNSA 1SCRA 3VBSB 4URAA 5C9AC 4HT1T 4LNVA 5BXXA 4P9YA 3NNLA 1XE0A 1RUJ2 1S0IA 2P3YA 2ZA9A 1AR73 2X5IB 3KT4A 5IVYA 4K9SA 2VM9A 3N35A 3BTZA 4Q2FA 4E2QA 2CSGA 5CFDC 4RN5A 2JDYA 3OBTA 3P3PA 1RUI1 4Q26A 2G9FA 2C24A 1RHI1 2WT1A 3V0AB 1FT9A 4A44A 4B4RA 3ZYIB 1AXYA 5EV7A 4R52A 3ES1A 3NJZA 3ZIXA 4ISQA 3OOXA 2HWD3 4Q4V3 3VKLA 1LKNA 3UKNA 4BM8A 1CJPA 2WRAA 2WN2A 3KF5A 3LDRA 2RS33 1W6QA 4IGOA 5C8CA 5CFCA 4EZHA 3FE5A 4EE2A 2NP0A 1AUYA 2DCKA 4OHWA 4NIDA 5GM0A 3VDBA 1IPSA 2JDKA 2AYHA 3DKQA 3PU3A 4HZFA 3MIGA 3ACIA 4FT8A 4MG2A 5FK7A 4IEUA 1EV13 4YZ2A 3LPFA 2VE1A 1DZQA 5A32A 3WNKA 2B39A 2FDIA 3DPRA 3FBMA 2Q5TA 4C91A 3J4UH 4B7EA 4WM7A 5EJZB 3HAGA 3FFQA 3F95A 1RUE1 2F17A 3AMPA 1CPNA 1DBNA 1QHDA 3V0BB 5FY9A 2EA7A 2UYBA 3VDDA 1WBFA 3KD4A 4L11A 4CDQC 1GP5A 4RHV3 5IAVA 3FUQA 3H1WA 2JIJA 4XIOA 3O1SA 3H3LA 1HV1A 1OOPA 1RUD1 2WL1A 1QOSA 1UU4A 2XQXA 5K7PA 1PK6B 4MGZE 1RUH2 3WQ7A 1ZBA1 5L7OC 1OKQA 3E5XA 3MPBA 4NN0A 4NVPA 4GWMA 3ZYHA 1D7PM 2ZEXA 3APBA 2EXIA 1RUD2 3E6BA 4IE5A 3IN9A 1H2NA 1LODA 2FD8A 3OEAA 2CWMA 1FX5A 4NPRA 1L7LA 1WUVA 2A1XA 1HB1A 4UYBA 2TBVA 1CJDA 3R4UA 5DUWA 2P6CA 3OCPA 2QQKA 1QEXA 2B5HA 2VCMA 3FN9A 3D82A 3PU8A 1UYZA 1F8VA 2GC1A 2PN5A 3UKTA 2QKDA 5CKMA 1WLWA 3FUOA 3LDKA 4A3ZA 5EIYB 1Y4WA 5I8TA 1BLZA 5JDBA 2CV6A 2YU1A 5J98B 3BUCA 2W94A 2ZZQA 4WM7C 5L7OA 4M4RA 4HANA 5BNPA 1PO12 2VULA 2R043 1CZVA 3TB0A 3C3VA 2J1UA 5DZEA 3AXDA 3DGTA 1S2KA 1W8NA 3Q8BA 1CAUA 2LTNA 3ITQA 5C5TA 3I59B 4QB6A 2RJ2A 4RYDA 5K0UA 4XZPA 4M3CB 3RSJA 2ARBA 1BKZA 2ZKNA 1JHNA 1FOD2 1UPIA 4OQ8A 3IDBB 4QXCA 1VBC1 5JMCA 4AEDA 3ZIWA 3JQWA 1L7RA 2WZR2 2JX9A 3LD8A 4HBNA 4UFMA 4B4QA 1DLCA 4FAHA 4AVCA 1J1LA 5T54A 4EN6B 5A7WB 2VUAA 2IXIA 2A3XA 3AFGA 3LIHA 4AQTA 3T0BA 1QIQA 1AR71 1W2UA 2VNOA 3WNPA 1WCKA 2AR6A 1HX6A 2HWC1 1ZZCA 4I0WB 2LRPA 2XKOA 2C1FA 1H8TA 2FCUA 2WNOA 1H8TC 4Z92B 4UW6A 4E27A 1RB8G 1GLHA 2IC1A 1B09A 2WIIB 5F2SA 3ZSJA 4AFDA 1ALYA 2R6QA 1EPWA 5JI7A 1FAYA 2VNVA 2BPA2 4IV1A 4A7KA 2XGXA 1UOGA 3KCYA 3MYXA 3P3NA 3VV1A 4BQXA 4CDXC 4CCDA 1KS4A 5JAXA 5IVBA 1SQ4A 5FY1A 3FHAA 2W95A 5FAXA 3FHIB 1A8DA 4Q8KA 4LUMA 1COV1 1Q8OA 4GKYA 3U11A 4A3XA 2E9QA 5FXZA 3ZSMA 1F5FA 1FMD1 2ADEA 5K9YA 2ZZJA 5KXBA 4Q27A 5AFEA 4AHZA 3POBA 4AVBA 5D21A 1VB2A 4RR3A 2AENA 5EZWA 4HVOA 4RR3C 5FFOC 1ZBE2 3ZYGA 5LZ6A 5AVAA 4JKLA 1UMHA 4PBPA 1OFSA 3T1MA 1YIFA 3HNMA 4FOVA 3IIIA 4QPIA 4CZSA 1H9PA 2XVGA 3V56A 1GV9A 3MLLA 1RINA 4EQVA 1H6YA 4LORA 1W2TA 3BCWA 3JBG2 3NKTA 3ST7A 3LIGA 4DRRA 3H3UA 5HCBA 1YRZA 2HWC3 3T09A 4DUVA 3RZJA 1YNAA 4Q0VA 2F4LA 4LA3A 5F3IA 5JI9A 3ZSKA 1WW4A 3MV01 2J1RA 3SQOA 2QQPA 4FXGB 4PT6A 5C3SA 2JE8A 2WFF3 3NNGA 4Q4X2 4JCKA 3N36A 4IEWA 1QQP2 1WLDA 5F37A 1SCSA 2PHWA 3GNEA 2A6YA 1NZIA 4M00A 3UKVA 4ATEA 4E2SA 2JG8B 1SPPA 3WSOA 4UFHA 1DU3D 3Q8AA 3LE0A 4YW5A 4GH4C 3LA2A 1K3IA 1O5UA 2BFUS 5C7GA 5IVFA 2WA3A 4QU2A 2CNAA 3VBFB 3WQBA 2PHUA 1J58A 1XYPA 4IEPA 4ATFA 3ZFGC 4HFSA 3N4MA 2D6PA 4XACA 3MDPA 4CEWC 4A42A 1U12A 1IGOA 3MPPG 5J1XA 4EWEA 3IDAA 5FTTC 5DDJ3 1W9FA 2DUOA 2ORZA 1OURA 2X5IC 2YG0A 4HSJA 4YGBA 5A7SA 5A3LA 2DBIA 1UD1A 1V9U3 4RR3B 5F8PA 3WW2A 1DF0A 4D7YA 1AR63 1J83A 4MGIE 1VBD2 2VBPA 4OZOA 5JIUA 5C9AB 5ABJA 3AB0A 2R0HA 3B94A 4NPLA 4JDOA 4OI4A 1BZWA 2BWAA 4YM2A 2DYCA 1QJX1 2GZWA 4YRDA 1NAEA 1WZXA 4IV3B 4O61A 2GNBA 2HJIA 4XF9A 3NVCA 3U07A 1SBFA 3BTYA 1OA2A 2BOIA 3MO4A 3KVAA 5T3NA 2VU9A 4A7ZA 5HCHA 5D8AB 5FZHA 4D7SA 3CJIA 1KFUL 1QH6A 3N9QA 2WWSA 4N53C 4BQYA 4CP9A 5F39A 1A8MA 3QACA 2YXSA 1W6PB 1VBD3 5HXVA 2W1SA 4IV1B 5HV4A 1Q3EA 2H6CA 3M3EA 3AVSA 2D6OX 1W0PA 4W6YA 1AR83 1UL9A 2QQUA 4N43B 4XXPA 4QAWA 5JXHA 1QH7A 1J3PA 3CO2A 2WA4A 3KS7A 2BOJA 4XUPA 4AVVA 4ZZ8A 1BBT3 3UK9A 1EV11 1H8TB 5LBEA 5T55A 1QMJA 1VLNA 2ET7A 3KMHA 1IQAA 1SLTA 2R30A 5FXWA 1ULPA 1IQDC 1LHWA 4FOQA 1T2XA 3I2IA 1DLLA 4DUXA 4RQPC 1J1TA 4OQ9A 5B4XA 2JD4A 5F5AA 1B35C 1LOCA 2OVUA 2VG9A 2E31A 3K3NA 2YB7A 1VJ2A 1NLSA 3WF2A 5DDJ1 2WABA 1HJGA 1W6NA 1N3PA 4EV0A 2NLRA 3IDEA 4QGLA 3MFAA 2P17A 3M7AA 4CEYC 4QX0A 4CEYA 1J84A 2PXJA 1KRIA 2D93A 5JR7B 2A7AA 1K5MC 2WQ4A 1HQLA 3I54A 5EHDA 3X29B 4AI0A 3OSDA 1WCQA 3WUCA 1D4M1 2C9AA 4WVZA 5HBAA 3OPTA 1YI9A 1RJ8A 2BERA 2XVLA 4X6QB 4XJ9A 2GDFA 2RS12 2XKPA 4XDQA 2VH9A 4ES9A 4COWA 5F1RA 3C7FA 3ZYBA 1A78A 3WLUA 3NW4A 2YV8A 4CCNA 1WLCA 5GZCA 3J7LA 1RUH1 4N7UA 2QNKA 4CE8A 2WFPA 3SKVA 1CESA 1UWWA 4LKSA 3QCWA 1URXA 5IK4A 2P3KA 2KR2A 2WO1A 3KWVA 2ZGQA 1GOFA 4NHKA 4RQPA 5KR7A 4QQ2A 1SACA 4AHWA 3POFA 3IWZA 3JUUA 1YQ5A 4J6GA 5FYUA 4E4ZA 2ETEA 3WDXA 2VZUA 5BPXA 2P4EA 2QDNA 2PFWA 4GJZA 4P9GA 5H9PA 5IWFA 5JMOA 1WD3A 1R082 1XE7A 4GJYA 3VB9A 2IXJA 4H3WA 2VW0A 1VRBA 4RSUA 5ACA3 1QJY1 4CDQB 2OA2A 3WF4A 2EVXA 2QQWA 4AR2A 4YFWA 3SH4A 3H42B 3I2FA 3JB8A 5FZ6A 5FXVA 2RM22 4AE2A 3ZXLA 3AKSA 1OH4A 4XBNA 4GULA 2HWE1 2Y64A 1XSRA 4RS5A 4YW6A 5M0TA 2VMIA 4PLMA 4YVWC 5A3OA 2KD7A 5JVVA 2RS11 5A7PA 3UGGA 5C5UA 4GD4A 5A32B 5DAXA 3IKWA 5GZDA 2WNVA 1E5SA 1PZ9A 1ZZBA 1PVXA 5GLUA 4V2WA 4XFFA 3MI8A 1WKYA 2BVVA 1HB3A 2ATFA 4Z82A 2RM23 1SDWA 4CCEA 1H2MA 4PIYA 3WVJA 2NPIA 3ZPOA 5HCAA 3A21A 1G6NA 2Y26A 4N90A 4IEYA 5JLVA 2DCZA 3H1MA 1UY2A 2A6XA 3KT1A 3U0ZA 4HK9A 2DVDA 2O0OA 5DN2A 2GAUA 4KGQA 4TLGA 1ND3A 1RUF3 1IS4A 4IERA 4XFIA 1ZRFA 2XLAA 3WP4A 1OQEA 1AYN2 2WZ8A 1XOYA 4WM8C 1AL21 4UF0B 3V0AA 5CEHA 2VOXA 4URTA 1EY2A 3IMNA 5L19A 5E88A 2WAAA 4CDWB 2V5DA 1OD3A 2ID4A 5C3OA 1KGYA 4XIKA 3N7LA 3A23A 4DMIA 1JZ2A 3CZUA 3AJYA 2W3JA 1B35B 4I3PA 2WWUA 1WMFA 4PF1A 5H9RA 5FYCA 3JZVA 4LT5A 4CUAA 5BUVA 2VGDA 3CU7A 1HDKA 2GC2A 3QH6A 2YYOA 4KL1A 1QDOA 5T52A 3ZXFA 1DG6A 1KFXL 4IGQA 3AMNA 4BMEA 4MOAA 1I1EA 4LO5B 4XTMA 4QPGC 1UY0A 4MSVA 4IQPA 4NE9A 2VD7A 5I93A 3TWIA 1ENSA 1I5PA 2JB8A 5L9VA 2OPKA 1GBGA 2VNRA 4META 1VMFA 1OFNA 5E6HA 1MEC1 1B35A 1LESA 2VMDA 5SV5A 3VBHB 4F83A 1L7QA 1YWKA 2I07B 3JD71 3RJRA 4MGQA 4C0HA 4M4PA 5FP4A 3A22A 5A3NA 5F3CA 1L3JA 3IBMA 1W8ZA 2FZ1A 3VBRA 1TMF1 1UOBA 3ZFFA 4J25A 2DWRA 1XB9A 1JYNA 2WJSA 2VZTA 1APNA 2C6SA 4ASMB 1W99A 5LK5A 3ZPYA 2WNUC 5ANNA 1ND3B 3CZJA 4XURA 5KBFA 3O1RA 1GP4A 4NHXA 4XJ8A 1N1VA 1FI2A 1UYPA 3AJZA 2JENA 1GQPA 2ZMKA 3DEMA 1SFPA 2QZ3A 3IT8A 5F5CA 5FZGA 1CONA 3T2OA 1HLCA 3U75A 3FC0A 1H9WA 3ZR5A 2ZHNA 2UY9A 5IK8A 1W6MA 1W8UA 2ZKLA 3NMBA 1RIRA 2P37A 2VECA 3AMQA 4E8CA 1N1YA 2VOTA 4V1PA 5FOJB 4QDQA 1GWKA 5BNPC 2VMEA 4XUTA 3WW1A 1M4WA 1Z7S2 3WCRA 5GLTA 5B4NA 4RS5B 2IXKA 3HQXA 1W2OA 2EF6A 2ET1A 5C71A 1AL0G 2EXKA 1W8WA 4JGZB 1OOPC 3RQ0A 3K51A 5FZLA 4CUCA 3K4AA 2D7FA 1SBDA 2Q1MA 4L92A 4CDQA 5FOBB 3OF1A 5FQ0A 1CAVA 4CU6A 4FFGA 1ZRDA 1K5JA 3QH7A 4LOTA 4BISA 2BRTA 1KITA 2K2SA 3QLQA 1WWYA 2E6VA 1YC61 1BMV2 3VUOA 4MGYE 3CHXA 3USSA 3ZLIA 1SMVA 2QBXA 3FZ3A 3I2GA 3BPSA 1LOEA 1R1A3 1GZ9A 1BJQA 3JCIA 1U5IA 4LBJA 3OUHA 1US3A 3ZYJB 1S0GA 2GSYA 1KJLA 2VVEA 4QQLA 4Z1VA 3WZ1A 5BNNC 5JZGC 2VL4A 1A6CA 3FLRA 1JYCA 3H50A 4CP0A 1W3XA 1X50A 4RQPB 3ZN6B 2GNTA 1W03A 3I3QA 1BBT1 1DQ6A 5FYYA 2D5FA 4MGTA 1LEMA 3R05A 4O65A 4Y20B 2ZPXA 5GZGA 2ZGNA 1VBB2 4GA9A 2YC2A 3I3DA 4N9HA 3LF7A 4Q4X1 1W2AX 2E32A 4MXWB 4E4HA 2WINB 2VPVA 3HN1A 3KLSA 1OPMA 4XJZA 2E26A 5FYMA 1G86A 1YFWA 3AZYA 2WUHA 3POIA 4CDUB 4XBQA 3GHMA 4XFBA 4LBQB 4L99A 4BB3A 4TSVA 3ZYPA 1CAWB 2VZVA 3O0XA 1X9TA 1IG3A 1MQTA 1POQA 2DDUA 5CKNA 4NHMA 4DS0A 4YZ5A 2V73A 4BQ2A 1I5ZA 3PURA 2OPWA 4QQPA 2RDQA 1ZRIA 1HB2A 1MS0A 4TLFA 5FYBA 3UGHA 4RL7A 3AX4A 4GZ9A 2HWF2 1H4GA 2D97A 3ETPA 1G9CA 3U37A 1YEWA 2EIDA 2CU5A 2VAUA 1TME2 2YMZA 1VMJA 4B4PA 1I3HA 4EROA 1GNYA 5FZ7A 4IEQA 2Y34A 1OMIA 4QB1A 4HPKB 3O12A 1PM4A 2PAEA 3PUIA 2PTMA 2VZPA 2ZACA 4J1WA 4SLIA 1QJX3 3T0AA 1JUIA 4MVTA 4BIOA 3OBAA 3LEMA 2C0ZA 2BVBA 1JI6A 3M2MA 3OGRA 4E4SA 1SFYA 3DF0A 2BDRA 4YYOA 5LEJA 4LE3A 3B7MA 3ILNA 4K20A 5GLWA 3R4DB 5A7OA 3RJ2X 2CDOA 4N8MA 1I6XA 3NSTA 1BCXA 4HN0A 3FBYA 2YFUA 4XAAA 1W6PA 1ASJ1 2XMLA 4XHXA 2R1DA 4YW1A 1PO21 1DHKB 5T5JA 1AL22 1CVNA 1V6JA 4CPBA 3I4IA 5EYYA 5D8AA 3R4SA 4I0AA 1A3KA 3RWKX 1KS5A 3VHPA 1N1TA 3B02A 4HSLA 2BU9A 2XJRA 3WCSA 3C7OA 3K4ZA 2PHRA 3H3ZA 4IV3A 4KG8A 4R4XA 5KXDA 1SLLA 1UW8A 2D43A 5FZIA 3VBOC 5C8WA 4NIHA 3FX3A 2RHPA 3GHNA 4AGVA 1DGWX 3VBUA 2AEZA 3N7KA 5L9BA 4XVHA 5C9AA 4JQTA 5FJHA 4UW5A 5DG1A 3HWJA 2ZGOA 3KQRA 4IESA 4IL7A 4JQRA 1UO9A 3GZUC 4CSWA 4QHBA 1XYOA 2HWD2 2XJPA 4Q4V2 4QHZA 3D8CA 4JDMA 5ISLA 1PMIA 2HEYF 4QPWA 4IV3C 2NN8A 1F5JA 2Y33A 4CU8A 1RL3A 2G9ZA 3N7MA 3WXPA 2RS32 2VR4A 1EAH3 3MW2A 4P9IA 1LR5A 3N7JA 3O1PA 5G04L 2R16A 5H9SA 3C7HA 2OX0A 2VUJA 1D0GA 5KXEA 2YPJA 3KF3A 2LM3A 4Q1PA 5I8SA 3LPGA 3ZN4A 2Y6FA 1ST8A 3V64A 3G7DA 4Q4Y2 5IFTA 4S2GA 2XOMA 3I2HA 5F5IA 1R081 5JZGA 3PVEA 2RMU2 4YW4A 2WLPA 3OB8A 3WNOA 4EJRA 1EV12 1YCIA 1JOPA 4DINB 1Y9GA 1CAXB 4YZ1A 2LALA 2AZ5A 5FCCA 3J7HA 2WZR1 2WC2A 2A3YA 2PLV3 4A41A 4Y26A 2JG8A 1RUG2 4KWLA 3TEZA 3LSDA 1ZA7A 4S2FA 2UWBA 5DAPA 1JXNA 1PK6C 3WG3A 4BH9A 2P3JA 4C1WA 5FREA 4CU9A 5A70A 2ZABA 5BNOB 2FDKA 5T50A 3RPQA 3WP5A 1OLQA 3S7IA 4OCTA 1VBB3 1UMZA 3WW4A 1FYUA 4HETA 3WP6A 3K2OA 1YO8A 3B93A 1VR3A 1H2KA 2ZHMA 1FMD3 4DXRA 3T30A 4ZXEA 3CQOA 3GZAA 3SLIA 1G9DA 3GXUA 5FZ0A 4LULA 4JHZA 4KG0A 5C3RA 2O1QA 4M0NA 1E5IA 1QF3A 3MW3A 5LRSA 1FV2A 3VZJA 1TQ5A 3MICA 4XDPA 1UY3A 4Y1XA 2E53A 3NV4A 4QPIB 5HXMA 4K3UA 3WINE 1RUI3 1E57A 3TNPB 3KV9A 2NMNA 5CB7A 2CAVA 2DCYA 3H1YA 3RYPA 5JR2A 1ULOA 1LOFA 3WDVA 2YZ4A 4XPVA 4AAPA 2QQJA 4PF5A 1BEV1 1H1MA 4MO3M 3SMHA 4DQAA 2BQPA 2HWB3 4CCLA 1YJKA 3K46A 1TMF3 3B3QE 1DCSA 5A6XA 3AKRA 1AX2A 3QOPA 4AGRA 4F7ZA 2AEYA 1Q8SA 3WY6A 4DOUA 5LCWL 5LWBA 5FPVA 1AR91 4LEJA 1QJX2 1HV0A 1C57A 1UZVA 1RUF1 3MW4A 5FZOA 5JPNB 2DCTA 3WG4A 1K12A 4DXZA 2CYFA 4JVAA 4QB2A 2QDRA 2YBPA 5C8CC 2QCSB 2DTWA 2G19A 3THTA 4D6RA 3FFZA 3ORJA 4CVUA 2X8KA 2HBTA 1S0DA 1VAKA 3PUSA 4A4AA 1CX1A 1PO13 5BYNA 4R9DA 3OBRA 4XMAA 1DGWA 4FSJA 1TE1B 2DV9A 2LS6A 3HPNA 1LB2A 2XWBB 1GZWA 1QJZA 5T5LA 1VAMA 4AI2A 3MFCA 3LFMA 5JCTA 1UAIA 2QQLA 1RXFA 2Z69A 4ORFA 2EXHA 3J26N 4QWNA 3O7OA 3HR9A 4F8AA 2WSUA 3PNAA 1MS5A 4ARYA 3ZKUA 5J36A 4OHYA 4BMBA 4L8QA 2W52A 3AZXA 3Q8FA 4RFRB 4XOGA 5LBCA 4YW2A 2VZ3A 3LKJA 3VDAA 3VL8A 2X29A 2BBVA 2IVJA 1S2BA 4EN8B 2GN3A 2P6HA 4AEDB 4BIFA 5CA6A 4PJYA 2QE3A 3I3BA 1WMXA 1CZTA 2RV9A 3D0SA 4FFFA 3ZDVA 4CU7A 1DYOA 3RGBA 3PTYA 2ILMA 1AR61 3HQUA 1VRH2 4FP2A 2P2KA 4HMZA 2Y60A 4L0PA 4M3CA 2BYVE 1RHI2 3WEZA 2UURA 2ZAAA 3BIWE 2RVAA 5JZGB 1LULA 3K75B 4CXYA 1LHUA 5A7NA 2BGPA 4CUGA 1H1AA 1Y43B 2OUJA 4GH4B 4QPIC 2WT2A 4OUEA 2SLIA 5CKQA 3W5MA 5J7MA 4QPYA 2J1AA 1HRI1 1ZZ9A 5C4WC 3LGRA 5JWPA 3GZEA 3W9AA 4AGGA 1VRH1 3GJBA 4B8EA 1CD3G 1YHFA 2B9UA 2AC1A 1IS6A 1AR81 2ZGKA 3ME2A 5DQ0A 5C4WB 1NXMA 1GZTA 1PX4A 2PLV2 5I91A 1AXKA 2J42A 3PJQA 5DUVA 5FIXA 4KWUA 1SHWB 5I0DA 4K8RB 1W0NA 1LAJA 1BXHA 1LJ7A 2UYAA 4JTOA 3VBUB 4D94A 4UAPA 3OBZA 1D4M3 3ABZA 1QQP1 5FWEA 5BNQA 2RJKA 2JDMA 1FMD2 4E8DA 3OPZA 1UXZA 4A7YA 3LOIA 1SZBA 3AYDA 1LECA 4INDA 3RFRA 5JUVA 1WLTA 3NNFA 4KMQA 4ZXKA 5G05L 1OC1A 2OZ6A 3CIHA 3ETQA 2D6LX 1W9TA 1AF9A 1JZ3A 1MS4A 4G9SB 5T5PA 1UKRA 4QGNA 2XR4A 3BU7A 3ON7A 4BPZA 4AHXA 1ZM1A 3DPRB 2HYXA 4LLOA 2A6ZA 4R9AA 3ZSLA 1G8WA 3WUDA 2ADDA 2VQAA 4LBQD 4Q4X3 2EXJA 2WBKA 3THPA 3H0OA 1GSLA 4HPKA 4PLNA 4Y5TA 2WZPP 3BTXA 4OULA 4QU1A 1YFUA 4YPJA 1QJEA 5FZ4A 3H8RA 2VW2A 4Q5OA 3ZM8A 1LEDA 4CDXB 1Q43A 5C8CB 2IFWA 2DCJA 1YFXA 2ORXA 3A4UA 5LA0A 4LBLA 4AI1A 3OGGA 2R061 2TEPA 2JIGA 5GLVA 3DECA 3BTAA 3SEPA 2PHDA 2ZGPA 4Y1VA 4NIGA 2Q30A 4GQ7A 5FZ8A 3RG0A 1DZRA 3I2OA 4HONA 1Z7S1 2D5HA 2J1SA 4AQSA 2WNVC 4XBLA 5JXJA 2ZS6B 1MQTB 1WCSA 5LBBA 2I74A 5HPOA 3P1IA 4WV8A 3ZO0B 3RS6A 2Q8DA 2R071 2FMYA 1W9YA 4CUBA 2X5IA 3V65A 5A33A 4LTAA 4W65A 4O7XA 3IAQA 3NKGA 1VPHA 2EAAA 4RGAA 1NE4A 3VLBB 5IJRA 2Z5WA 1BK1A 2IFRA 3Q9OA 1PGL2 1HN0A 4AYUA 4AFBA 4CEWA 3VD9A 3SH3A 1WCUA 1RUJ3 2Y6GA 3MHZA 4FFHA 5KHJA 5LA2A 4FPFA 3E6DA 4AG4A 1H8VA 1AHSA 4HG6B 3S7EA 2DFCA 1NY71 4YVWB 4AVAA 5L73A 3ACLA 2WYFA 3WNMA 3OUIA 3BPZA 1GMMA 4Q4W1 1G7YA 2XHKA 3HBZA 3RZZA 3WDWA 4Q0SA 3JBG1 5F6LB 4JGZC 4R4ZA 2AGSA 1UPSA 2O14A 5A80A 5T5OA 2OQ7A 1PGSA 1UZZA 5FWJA 3IM0A 1GYKA 4W8JA 4AI8A 3VBRC 5AC93 1RUOA 2WFF1 5A3TA 1H30A 1F9KA 1JYTA
chains in the Genus database with same CATH topology
4YM1A 1QXJA 1QNYA 4LA2A 1ND2C 4Z8BA 5I0RA 3S30A 3KT7A 1RTVA 1JOJA 2Q0AA 3ENRA 1J3QA 1OQDA 5LK7B 4M01A 3AFKA 4MXVA 4RHV1 5C6CA 3MIDA 4Q4Y3 1OQ1A 1V9U1 4BLIA 1FPN2 3TBDA 3CEWA 1Y9QA 3VBOA 1ULFA 1WA4A 4WM8A 3AYCA 2H0BA 4XYXA 2UY8A 2XL7A 1ND3C 1RMU2 3RNSA 1KDMA 1OI6A 4DY5A 3GBFA 5D8AC 3PHMA 4D7TA 1MS1A 4CP2A 1FNYA 2KA3A 4IEXA 4RHV2 1TME1 4QMAA 3O14A 1QY4A 4G3YC 2XJVA 1VB4A 5AFBA 1NA1A 3VBOB 4Y24A 3M1HA 2E63A 2GH8A 3MLKA 1UX6A 5K0UC 3SNMA 2HWB1 1C8M2 4KGGA 4LBKA 5FLHA 2MHFA 2X53S 3JBG3 3VZMA 2ZGTA 5J48A 3AP6A 1PIV3 3VZLA 1DQ5A 1PZ7A 4KBBA 2ES3A 1D2QA 4Q4W2 1MEC3 4C0BA 2JG9A 1Y3TA 2R041 4YG0A 3EO6A 2CY6A 4O9GA 4FPCA 1U5YA 2IXLA 4Q0UA 1VBA3 1MZFA 1YXWA 2YUEA 1ZZ6A 4YVWA 1PO22 5E16A 3QD6A 4PQ9A 3QBQA 2CTVA 5A3MA 4H14A 4AW7A 1IZ3A 3ZFEC 3LB9A 3NV2A 4AFMA 3ES4A 3CLPA 5A33B 1VBA2 2AUYA 2PHTA 3M3CA 2CGNA 4CDWA 3URFA 1W6OA 3SCFA 2WS92 5I0TA 4QXKA 1WMDA 1REEA 1PGW1 3T2TA 4IEVA 2XBO2 2WKKA 4AEMA 4S2HA 5DDJ2 4FBFA 4Y4YA 2HYKA 4LHNA 4WVMA 3A0KA 3G6JB 4O9EA 4QM9A 1AR62 3E6CC 2NYYA 5J37A 2YGLA 2HEWF 3M3IA 3J8F2 4CDXA 1F31A 1XNBA 3PJYA 1H2LA 1QDCA 2WS93 5GALA 1UKGA 4N53B 1LOAA 3VBSC 3MGUA 1AX1A 5F5QA 4BOWA 1AVBA 3E97A 1DFQA 1VRH3 4P9LA 4F3JA 5DUUA 4FPGA 1NQDA 5IK7A 1JW6A 2YGMA 4ZKTB 1NOVA 1R093 4W6WA 4FO9A 4M3CE 3FLPA 2ZBJA 4NWWA 5CAZA 4IEOA 5I0SA 2XB6C 3KGZA 2DU1A 3MIEA 5K8SA 1BBT2 3HT1A 2IZWA 4K8FA 1AYM3 4NO4A 4WZFA 4QQOA 2VMHA 1O4ZA 3MF9A 4AWDA 3OGJA 2OW4A 3JU9A 2ZX1A 2ZGLA 4UBGA 4BE3A 1ZNPA 1AR92 4KQ7A 4GWNA 3MIHA 4LR4A 5FO9B 2GMEA 3OJBA 2YDEA 2CGPA 5C33A 3UV9A 1TNFA 1JBCA 3IPVB 2RS52 5C4WA 1AL23 1HRV1 4QPGA 5AVPA 4YSFA 1UU5A 4HKLA 4YZ3A 4E9KA 1YIPA 1QXRA 4XTPA 4XW3A 1LGNA 3BB6A 1EPZA 1MS8A 1VBC2 1MVEA 2RR12 2KXLA 1UIJA 4AHYA 4YVSA 1C28A 1MEC2 1S0CA 2DVFA 4FQZA 3ZXJA 1AJOA 3MIFA 3AXEA 3FJSA 2I2SA 1MS3A 2GMMA 2PYTA 3NAPB 5F9TA 1Z7S3 1LENA 5SV8A 4XFAA 2XBO1 2A70A 4PIZA 5EXOA 1FATA 1EAH2 3H8UA 3W58A 1HXS3 4FTBA 2ZGRA 4QM8A 2BNMA 1ZA4A 2OYZA 1S0EA 1OLRA 4XETA 3KZ4C 1ENXA 2MPFA 2ZTNA 3GYDA 5CIRA 1U5XA 3WX5A 1RJ7A 1RVF1 4DPNA 1OA3A 4K40A 1JUHA 1C8M1 2GNMA 2JEMA 3S6PA 1XXNA 1NXD1 4C90A 4L9BA 3ZFEA 3D5OA 3OYWA 4N43A 1V6KA 3WHUA 1LOFC 2W08A 4TYSA 2XJQA 4CTEA 3AP4A 1S1AA 3AYAA 4CYDA 5CFCC 5BNNA 1N47A 3POWA 1IKPA 2GALA 2HWD1 3CJIB 5JOXA 1J59A 2RJLA 1VBE1 4EWDA 1BVVA 2AH2A 2ZHKA 1WBLA 2VOWA 4XXAA 4LO4B 3J8F3 3BOPA 2CWSA 1C8NA 2WNEA 2CL2A 1O5LA 1LGCA 4XHBA 5B2GB 1FOD1 2GH2A 2JG9C 5BV6A 4RFT0 4AFCA 3VZNA 3WHTA 3KM5A 3VDDC 1R092 3L2HA 3ZXDA 3B9CA 4QQHA 1IKQA 1GR3A 1T6GC 3EJKA 2ZGMA 5J3UA 3POYA 5GKAC 3ILRA 3R6SA 2ZX2A 2GU9A 2VNGA 4XE9A 5JSPA 1BEV3 5E1RA 2EIGA 3VBFA 1BYHA 4MGKE 3MLJA 2R073 4YNIA 4AF9A 2XPJA 1AR93 2WNUB 2XLGA 5HCFA 1O4TA 1OPOA 3JD73 3UJOA 4DFSA 1K5MA 1RUJ1 1QJU2 3HIFA 3TN92 3NV1A 3USUA 2HWE2 4YGCA 4JC1A 5FLJA 1S0BA 2RS53 3TRSB 1CAXA 3VZKA 1VBE3 4XEZA 3GZTB 3LWCA 4XJUA 1QOOA 5IUQA 2E7QA 2XUMA 1XNCA 5FDBA 1FOD3 2PQQA 2WQZC 3M3OA 4BHPA 2RR13 2YC0A 2ZX4A 2A5ZA 1LRHA 4TZDA 1OSGA 2VVFA 2A75A 4LHLA 4KH9A 1YFYA 2QJVA 4YW3A 3ZFGB 1NY72 1DQ0A 3OY8B 4XF3A 1FPN1 3WDUA 3TAYA 1DQ1A 1JH5A 1O7FA 1C3HA 5IT6A 1Q8PA 3TYJA 1ZRRA 2RM21 4RD7A 4GMP0 4YGDA 4UXAA 1XU2A 5FRAA 2E51A 1QGLA 1RITA 2DVBA 3ZXAC 4Q4V1 2SBAA 4Q0PA 1IPKA 3SXWA 4GB31 1S0JA 1AZDA 4OHXA 3RMYA 3D4KA 4LLFA 3OYWB 4WVWA 4JGYA 5JIAA 3BOWA 4FPLA 2VMGA 1ULDA 4GMP1 3MZHA 4N43C 3JQXA 2UWAA 5CADA 4XF4A 5CNAA 1X33A 5L36A 1RUG3 2D3RA 2A71A 1GQGA 1WGPA 1VALA 1LGBA 3VZOA 2DURA 5DUXA 1RUE2 4FCAA 2PAKA 2DU0A 3MIBA 4RA0A 3WQ1A 4Y5Z0 4RGGA 3SISA 5BNOC 4Z2WA 5DXDA 1CPMA 1WD4A 3AZZA 4FPJA 1CAUB 4FPHA 3AZVA 4XILA 2E7TA 3ZXEA 4W6XA 4I3GA 5I8YA 1CAWA 4I30A 1RGSA 4HK8A 2MEV2 4LBQA 2PAMA 2B46X 4CDUA 2HWF1 2R32A 4IETA 2PHXA 1LU2A 2A6WA 3HT2A 2TNFA 4FOYA 3M8LA 4P9XA 1HRV3 3M4FA 2R072 2Q1ZB 2ENRA 4YG6A 2PLV1 3ZDSA 1XNDA 4PDWC 2YHJA 5KHKA 1SEFA 2RE9A 4QPGB 4Y20A 1PVC3 5EFUA 4OLLA 2D44A 4NWVA 3ZMNA 3RYRA 3IPVA 4YZ4A 1WCDJ 4QT6A 1POV3 2NZ9A 2E7AA 3PVOA 2D6MA 4HLTA 4COVA 1VBE2 4PLOA 1X7NA 2RS51 3E5QA 4I09A 5GZEA 1VBB1 1PK6A 4X6RB 1MR5A 2NM1A 4ZU5A 1ND2A 2HEVF 2JG8C 4ZU7A 4KWJA 3IIAA 4I01A 1CAVB 5FQ0B 1PNFA 1TEIA 1BVP1 3V0BA 3EHKA 4NR1A 4JGZA 5CG9A 4HVRA 1HIXA 2PELA 4FPYA 4EN9B 1RVF2 4FVVA 2EALA 2ZJCA 4WM7B 3H7JA 2D6KA 2FHRA 2H0VA 3RI8A 4I02A 4COUA 3OTFA 1DGRA 2D3PA 2FQPA 1UCXA 2PHLA 1SLBA 4LBMA 1MZEA 2MNGA 3LAGA 3B5LB 1ZBA3 5H9QA 1W39A 4N53A 4YGEA 1EAH1 2ZAHA 3B01A 4JRLA 4OI2A 1DQ4A 2OUHA 1HQNA 1V6IA 2QVSB 4E2GA 5GZFA 4AQ2A 4BZ4A 2VXRA 4MH0E 2Q4SA 2R0FA 3INAA 5FLIA 5ABJC 1V6LA 1LOGA 5FO7B 4AK3A 4FTEA 3J8F1 3RI9A 4QX5A 1VIWB 3NAPC 3I2DA 3AMHA 3ZFFB 3VBRB 3ECQA 1AYN1 3FLTA 1IOAA 1ZBE1 4LE4A 5D1IA 1RUC3 5TSWA 4AQ6A 1RUOA 1Q5OA 1PO11 1G9BA 2EAKA 3RRDA 2HWC2 2H6BA 4OUSA 4FTSA 4JAAA 2R1BA 2ZX0A 2JE7A 3VBSA 1ZX5A 2XJSA 3EXUA 1BQPA 1MVQA 1Z0HA 3PLQA 4WBBA 4H55A 2ARXA 1C8M3 4HKOA 4R8HA 1AXZA 1DYPA 2XL9A 1WW5A 1UIKA 2RS13 1MACA 4DB5A 1OA4A 2OIIA 1YI7A 3GBGA 1GICA 2GN7A 4N7IA 4P9JA 2ZHLA 2JG9B 4XMIA 2HWF3 2VQ0A 3AP5A 3UL2A 1CX4A 2IXCA 2MEV1 2UU8A 3WP5A 4X8NA 3SCGA 4AI3A 1GFF2 4U36A 5IK5A 3E5UA 1VAVA 2WSVA 4I0BA 4YLZA 1G9FA 2R042 1FXZA 1PO23 4PBOA 1CIWA 2XJUA 4AEJA 3CNAA 5DZGA 3ROUA 5DZFA 1NA1B 4FOWA 5JSOA 3I8TA 4ITCA 3WNXA 3WP3A 1PIV1 2D98A 3PMEA 3B9IA 1V9U2 1H0BA 2HWB2 3AZWA 5KC6A 1YUDA 3HMYA 1Z78A 4EN7B 1HRI3 1C1LA 3DPRC 3K48A 3J9SA 1GKBA 1UZYA 2PHFA 4YG3A 3CL1A 3VHNA 3ASIA 2WNVB 2Q8OA 3AMMA 4PCRA 3ZXGA 2GMPA 2P3IA 2BWCA 5ACA1 1NLRA 1C4RA 2I45A 3POSA 4MX3A 4OI0A 4PIXA 4FPKA 1ZRCA 3DUIA 4J1XA 1V00A 1EYBA 3CF6E 1HKDA 4XFGA 3UJQA 3LOBA 1ND2B 3KB5A 3MF6A 4U2AA 4AVSA 1KJRA 2OZJA 3RDIA 1LHNA 3DN7A 3SITA 2FBEA 5LEKA 5JSRA 4YVSC 4FQ4A 2BTVC 4OZXA 1FNZA 1O4YA 4BLJA 3WDYA 1QJY2 4N9IA 1KDKA 2DUQA 2RMU3 4XJAA 5KC5A 1PNGA 4DNYA 4CEWB 2Y38A 4BA6A 4QGMA 1RUNA 2ZMNA 4YFZA 1RMU3 2V09A 2Z79A 2JKBA 1QNWA 4H7MA 4Y1ZA 1RUC2 5CU1A 4BYYA 4L97A 1CN1A 2BEOA 2FMDA 2GC0A 1FPN3 1DDLA 3TOJA 5CG8A 1O3SA 4AEDC 3M3QA 1U5ZA 4I2OA 1VP6A 4JTNA 4CEYB 1KD7A 3NV3A 4AEKA 4AFAA 2WFF2 1W6NB 3CJXA 5F6KA 1VBD1 4KU7A 5CVRA 3ZMOA 4K7JA 3SCHA 1C5IA 3SH5A 1D4M2 4MLOA 4Q4W3 4NOTA 3ZVXA 2K9ZA 1MQTC 1RUH3 2AREA 1AX0A 4G4FA 1OD5A 1R083 1DGRN 5ACA2 2MEV3 4JGYB 1EP0A 1XQNA 5EYXA 3VN4A 2ZMLA 5JOYA 1I9RA 2O8QA 4UW3A 2BW8A 2ZGUA 4XQWA 1NE6A 1D0HA 3WD5A 4CDUC 4Y1UA 4XF0A 2BGCA 3WG1A 3GBWA 4P14A 3U10A 4XF1A 4FPOB 4B29A 4DRVA 5DG2A 2K0GA 4UW4A 4OHZA 2IXHA 2DUPA 3D0JA 4UBHA 1HRI2 2Y0IA 3AKQA 4MUVA 5HI0A 3FWEA 5ABJB 3VKMA 1DGLA 1LU1A 1X36A 1LTEA 2XBO3 2A3WA 2IWGB 1J3RA 1C1FA 1D4VB 3OY8A 4CDWC 3ZFGA 3VL9A 2VW1A 2LUWA 4AXOA 1X8MA 3LA7A 4R9CA 5GLZA 3RMXA 4GH4A 1AR82 4LBOA 2GNDA 3JB4C 4OFGA 1POV1 4LO6B 4YARA 3VKNA 4RS5C 1RVF3 1R1A1 2JECA 2YY1A 3RWNA 1G9AA 1BMV1 1V6NA 3VBUC 1SFNA 5CFDA 3DL3A 3WW3A 1PVC1 2GC3A 1S55A 2JICA 3LZZA 3OD0A 1CQ9A 1LOBA 1PGW2 2JXAA 2QFEA 4Z07A 3USUB 4Y22B 3O5SA 1ASJ3 4COZA 1K5MB 1ZYBA 4OUMA 1QJY3 1V6OA 5BNPA 1SLCA 3FMGA 1Y7BA 1VBA1 2WNUA 1DQ2A 4E4DX 4ES8A 4M3CF 4ZU4A 5BY5A 5EJ3A 1POV0 1IS3A 1XRUA 4CP1A 3ZN5A 3AP7A 3TNQA 4K1YA 1REFA 4SBVA 1NCRA 1KQRA 1ZREA 3D6EA 1GZWB 3WR0A 1ZZ7A 1V6MA 4EWAA 2C5DA 1X8EA 2VOKA 2R49A 2HWE3 4PDWB 1QKQA 3H7YA 3ZX7A 2B42B 2V5YA 4GALA 2ERFA 1GNHA 2BNOA 4JRAA 2VY0A 3KCCA 3L9JT 4Q8LA 1X82A 1PHMA 1C5HA 4BQ1A 1QOTA 2BFUL 5JPMB 4KWKA 4BWOA 1Q56A 1N1SA 3M70A 5KXCA 2HKXA 4M0HA 3WQ0A 5BNNB 4Y1YA 2RS31 3NL1A 1MZ6A 4FXKB 1N3OA 4PDWA 2XG3A 3EBRA 1AR72 5E89A 1RUC1 4TWTA 3ILFA 3ZFEB 5J09A 1PIV2 4XQ4A 3T1LA 2A6VA 4DZGA 4K6BA 1NCRB 4MZUA 1WMEA 1IHMA 5E8AA 4L2NA 2W39A 3B69A 4R9BA 3KSCA 1XYNA 4XFCA 2JE9A 5BNOA 1HXS2 4BCUA 4FAGA 2WLQA 2DTYA 3R0RA 5BNPB 2P34A 4Y22A 1AYM1 4JDNA 2XJTA 5LRRA 1U0AA 1HQWA 2QUOA 1ENRA 5AC91 1QJU1 3I59A 4ISRA 4LUKA 3NAPA 3TN91 3VKFC 3ZSEA 5K0UB 3OD4A 5CFDB 3ALQA 1ULCA 4LO8A 5KHGA