4PBPA

Crystal structure of zebrafish short-chain pentraxin protein
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
KNLSGKVLQFKTATDNSYVKLYPEKPLSLSAFTLCMRVATELPLDREVILFAYYTPDVDELNVWRERDGRVSLYIQSSKDAAFFRLPPLSTLQTHLCVAWESATGLTAFWMDGRRSLHQVYRKGYSIRSGGTVVLGQDPDSYVGSFDVDQSFVGEIANLQMWDYVLSSAQIKAVYYNQDNRVKGNVFDWDTIEYDVTGNVLVVPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-reactive protein
publication title Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
pubmed doi rcsb
source organism Danio rerio
total genus 52
structure length 206
sequence length 206
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00354 Pentaxin Pentaxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pbpA00
1EPWA 1WW7A 1QOSA 1WW6A 4JC1A 4YZ4A 4YFZA 1F5FA 4DRRA 3AP5A 1J1TA 5CB7A 2WLQA 1CIWA 3WDUA 1FAYA 1N3QA 2CNAA 2KM2A 2GMPA 3FFZA 3VKOA 1OQ1A 4XJ8A 4XHXA 1NXD1 3PVNA 1VAVA 1PZ8A 3VUOA 1V6LA 4XE9A 3WV6A 4FPHA 2E7QA 3ZVXA 1DQ5A 4FP3A 2PELA 3KQRA 5SV8A 4TYSA 3AP4A 3M3QA 3POWA 1SBFA 2H0BA 3N7JA 5GZDA 2AGSA 1SLAA 3WDVA 4DPNA 3JUUA 4K1ZA 4YZ5A 1QDOA 1S0EA 2R49A 4YG3A 5JMCA 5DUVA 4C1XA 3FBYA 3SH4A 4XJWA 1GANA 4WVWA 5E89A 4Y20B 1GICA 1UZZA 2DYCA 2G4IA 1Q8PA 2WT2A 2WT1A 3OY8A 4GALA 1ZA4A 1LESA 4LBNA 1FATA 2WT0A 4KBBA 1D0HA 1ULEA 2R16A 1SCSA 3PVEA 3H0OA 3AYAA 4YM0A 3O0WA 2ZGKA 2ZBJA 3O12A 1MS4A 1DQ6A 3L2YA 4F83A 3I8TA 1Q8OA 5GZCA 1DQ1A 1FV3A 1VAMA 2PHXA 3AP9A 4CTEA 5T55A 1Q8QA 4DFSA 2CWSA 1ENRA 1ULCA 1BYHA 4Y1XA 2I2SA 2ZGRA 1SLBA 4XIOA 3FLTA 2A71A 1PZ7A 4U36A 3UJOA 1KDMA 1YXWA 4XXPA 4K21A 4LBOA 3WG2A 3V0AB 1DLLA 3PVOA 2GALA 1UAIA 1UN1A 1APNA 1MS3A 1WW5A 5HCFA 2DU1A 2JE9A 5CNAA 2YZ4A 3ZPYA 3U4XA 5E8AA 5HCBA 3UL2A 3MPPG 4D69A 4XMIA 3OJBA 3WDYA 1KRIA 1AJOA 3WCRA 2PHTA 2ZHLA 3PMEA 4WV8A 5FRAA 3VKLA 4CRQA 2A6XA 5GLVA 4GXLA 4XHBA 1CN1A 2NM1A 5CA6A 3AJZA 5DUWA 3USUA 4P14A 3WNXA 1QU0A 3MW2A 1G9BA 1C57A 3DGTA 4RA0A 5F9TA 4XJ9A 1LOEA 1SCRA 3TB0A 2DVDA 1N1SA 4YZ1A 4ISRA 1DBNA 1GYKA 1Q56A 4I30A 4YLZA 5IK8A 1CJPA 2NMOA 2Z42A 1DYPA 2AH2A 1S0JA 2D3SA 4UW4A 5EWSA 1FYUA 2Q5TA 2PHRA 2E6VA 1H9PA 3OYWA 4LBLA 2UWCA 3SNMA 3WZ1A 3WOGA 4UW3A 1DGLA 2PHFA 1C1LA 4YG6A 5JOWA 1F31A 4M01A 1S0DA 1YI7A 2B7YA 4CZSA 2A7AA 2JKBA 1G86A 2P3IA 4FPEA 4LBQD 3INAA 2VH9A 1MS5A 2ZHKA 2A6VA 2PHUA 1W0OA 3WCSA 2GDFA 4BLIA 1W6PB 1A78A 1QNYA 1S1AA 1URXA 4M3CA 5T5OA 1I3HA 5H9SA 3AJYA 4ZXKA 4FPCA 2UWAA 2YMZA 5DUUA 1V6OA 3R05A 2NMNA 3OBRA 3POSA 1RINA 3ZXFA 1KJRA 4GKYA 3FUQA 1UZYA 4ATFA 4AVTA 2ZGMA 1W6MA 1WD4A 2ZGPA 3ILFA 5H9PA 2D3RA 3NV3A 3NV4A 3D4KA 4NO4A 2FHRA 2GN3A 4AVSA 3MEPA 4XDQA 3O0XA 4FPGA 5GLUA 4DRVA 3N7MA 4FOYA 2YY1A 2GNBA 4YW2A 1AX1A 1GZ9A 2D3PA 4DS0A 2OW4A 3OGGA 3N7LA 1G8WA 4FOQA 5EYYA 2JJ6A 4GWNA 1X50A 2ES3A 3AK0A 5L73A 1A8DA 2ERFA 3BTAA 1SLTA 2ZKNA 4NOTA 2VW1A 4YZ3A 1FX5A 3IKWA 2HYKA 2DU0A 5E88A 3T1MA 1JN2P 1QOTA 2DWRA 2JD4A 3D5OA 1S0FA 5KXDA 3HMYA 1N1VA 1AXZA 4XTPA 1QKQA 3AZXA 2LTNA 1LOCA 4FPYA 4XMAA 3USUB 4M3CF 3I4IA 1H30A 4BPZA 4RL7A 4AGRA 3APBA 2D6MA 1BKZA 4C1WA 1GNZA 1DHKB 2CL2A 1D2SA 3IPVA 4Y1YA 1LODA 1WUVA 1DQ4A 5AVAA 5GALA 1AX2A 2YV8A 3MW4A 3IMNA 3JU9A 1IS6A 4OZXA 3QLQA 1Q8VA 2R1DA 2GN7A 1H9WA 4JRAA 2ZGLA 5DXDA 3SH3A 1VIWB 1GZWA 4Y1VA 4YW4A 3ZSLA 1GKBA 2OVUA 5GLTA 2D43A 1S0IA 1GBGA 2GMMA 1RIRA 2GNMA 2NN8A 2GMEA 1YYNA 4XBQA 1SBEA 1UL9A 1LOFC 3QCWA 3WVJA 5JLVA 3ZXLA 1ONAA 3BOPA 4FPJA 4XJZA 5DG1A 5JOXA 3T2TA 2DVGA 1AVBA 1GZCA 5GM0A 2YXSA 1SLLA 1IKQA 3N36A 1Q8SA 4HL0A 1UMZA 3ZSMA 2A70A 2ZMNA 3AYEA 4Y24A 3FUOA 3ZSKA 1YRZA 2JE7A 1MVEA 4Y22B 4XOGA 1SLCA 2ZGQA 1OFSA 1W6MB 1SLIA 3SITA 1LEMA 3UK9A 1AXYA 2EIGA 2EXKA 1R1ZA 2ZABA 3A0KA 1JYIA 1GNHA 4BMBA 4R9AA 5JDBA 1TEIA 1HKDA 2D6PA 4YZ2A 1WD3A 3NV2A 1YO8A 3WG3A 4WZFA 4K1YA 2ZAAA 2ARBA 1LOFA 1W6NA 1Z78A 2A5ZA 2CY6A 1BQPA 4PCRA 4YG0A 1V6KA 1MS8A 2JDZA 2XG3A 2ZGNA 5H9RA 2ZHMA 2OUJA 1W6OA 4R9CA 4Q2FA 5GZEA 2D6NA 1UX6A 1S0BA 1FV2A 1LEDA 1LOGA 1S0GA 3LSEA 5DZFA 1G7YA 3A0NA 1N47A 3ATGA 3AZVA 1AF9A 1W6QA 2D44A 2A3XA 3ZYPA 5GZFA 2CTVA 3NV1A 4Q27A 4XYXA 1G9AA 1QF3A 1DIWA 4YGEA 1LCLA 5FREA 3OBTA 1LENA 3KM5A 1V00A 3WLUA 3WUDA 1SBDA 3AFKA 3ZXKA 4LBQA 4PQ9A 3WHUA 2WQZC 3DUIA 1KDKA 1A3KA 3CNAA 2ZMKA 4FPFA 1F9KA 4ZKTB 1MS0A 1YIFA 1GZWB 3OY8B 1LHWA 4FPOB 5IK7A 1IS5A 2DTYA 3M3OA 3W59A 2CWMA 2YROA 4JCKA 3M1HA 3SH5A 5CBLA 3LCPA 5T5PA 1FNZA 5CAZA 2SLIA 2WNEA 1FNYA 5EYXA 4YW3A 4ATEA 4AGGA 1MVQA 1LJ7A 3W58A 5T50A 1GSLA 3R4UA 3T1LA 3B01A 3B9CA 3ZYRA 5DUXA 4R9BA 2W52A 5DZGA 4Y20A 1HDKA 2DVFA 2ARXA 1QMJA 1LGCA 5T52A 4GKXA 4P9XA 4HANA 4AVVA 2V5YA 3WDXA 3VKMA 1I1EA 3WHTA 2A6WA 1WLCA 2WSUA 1MACA 1V6IA 1PZ9A 3V64A 5GLWA 1IOAA 4Q8KA 3O0VA 4BQ1A 4DQAA 4GWMA 1C4RA 5JOYA 3B69A 4LBJA 5GZGA 5IT6A 5IUQA 5F5QA 4P9WA 1IS3A 3WUCA 4TZDA 3FLPA 3POYA 1ULGA 1Y7BA 2P2KA 2VW0A 2ZZJA 4XTMA 3SISA 5JVVA 5DG2A 1JUIA 2AREA 1OKQA 4FQZA 1C1FA 1UKGA 1N1YA 4BOWA 1LU2A 3N35A 1BXHA 2LALA 4LBKA 2PHWA 1SACA 1W6OB 3LSDA 5T5JA 1SFYA 4M3CE 1MR5A 3V0AA 1LULA 1AX0A 1QDCA 4UW5A 2P37A 4FOVA 1W0PA 1S0CA 4FPLA 4Y1ZA 4AWDA 5IK5A 4XJUA 2P3JA 1JBCA 1MZ5A 5EXOA 5KXBA 2AENA 3AZYA 2P3KA 3AXDA 4Y1UA 1WCSA 1WBFA 3BIWE 1BJQA 2P34A 1RITA 2A3WA 3PJQA 2E53A 3B00A 1LU1A 3R4SA 2NP0A 3OYWB 4LBQB 1KJLA 4BMEA 1LHOA 4AYUA 4PBOA 1LGNA 1LHNA 4W65A 2R1BA 2NYYA 4ITCA 4BM8A 1ENQA 2VXRA 3M3CA 4WVVA 1AZDA 2CYFA 2EXHA 4YGCA 2SBAA 2VY0A 3ILRA 1QOOA 3IM0A 4M00A 1Z0HA 5T54A 3RS6A 1LOBA 4AGVA 4K20A 4M3CB 1LHUA 2AUYA 2A6ZA 3WDWA 1HLCA 1UPSA 2UU8A 3AP7A 4ASMB 2FMDA 3OPZA 3ZXJA 3WG4A 1CR7A 3M2MA 1DQ0A 3HR9A 1N3OA 1V6NA 5KXEA 1KQRA 1JOJA 2DV9A 3GALA 3NWKA 1XQNA 4FP2A 4Q1RA 2DUQA 4XBLA 4Y26A 3VV1A 4GA9A 1W6PA 1AXKA 3N7KA 4H55A 1DFQA 1CVNA 1JHNA 2DURA 4Q1PA 5GLZA 2RHPA 2D6LX 2A6YA 2UWBA 1QGLA 1DYKA 3ZSJA 4UW6A 1CPNA 1BZWA 2UURA 3FLRA 4LBMA 3RG0A 4FOWA 3V0BA 2WSVA 1CPMA 4BLJA 2ZMLA 3RSJA 1KITA 2A3YA 3C2UA 3ILNA 3IN9A 3Q9OA 4U2AA 1V6JA 2DUOA 1VLNA 1ULDA 3HN1A 2ZHNA 4XIKA 1MS9A 2AYHA 4P9YA 2E51A 2ZACA 2XB6C 4Z8BA 3AYDA 2C5DA 2GNDA 2VU9A 3AYCA 3BODA 1G9DA 3N3HA 2R0HA 2JECA 4YM1A 5JOZA 1LGBA 3AP6A 2BQPA 2WJSA 4YGDA 1WLWA 3IPVB 1N1TA 4R9DA 1HQLA 1G9CA 1N3PA 2EF6A 4YM2A 2D6OX 1MZ6A 2WKKA 3GNEA 4XBNA 5T5LA 1LECA 3A4UA 3AZWA 4YW5A 2AR6A 1JXNA 1JYCA 2D7FA 4PF5A 4XJAA 3RMYA 3O5SA 3RMXA 4YM3A 4PBPA 1WBLA 5KXCA 2EALA 2W39A 3D6EA 5LK5A 4L8QA 2ZGOA 2EXJA 4XILA 2EXIA 4IQPA 2VW2A 5BYNA 2W08A 2ZA9A 1QNWA 2A75A 2V73A 2C9AA 1CESA 4MYEA 4Q8LA 5IK4A 1ENSA 2GNTA 5GJ6A 3VKNA 4YW1A 1G9FA 2TEPA 2OUHA 2ZGUA 4FQ4A 1DZQA 1GV9A 2VUAA 3MW3A 5DZEA 1B09A 5HCAA 1WLDA 4FVVA 3RRDA 1V6MA 1LTEA 3TAYA 3WG1A 3SLIA 1AJKA 2ZGTA 2R0FA 3AX4A 5H9QA 2W68A 2DUPA 1VALA 1O4YA 1MS1A 2ENRA 2NZ9A 1JW6A 1W6NB 3AZZA 2DVAA 3B3QE 4Q26A 3RQ0A 3UJQA 1LHVA 2E7TA 3ASIA 4Y22A 2EAKA 1WW4A 4XZPA 4YGBA 1IKPA 3V0BB 1ULFA 3M3EA 2D6KA 1HQWA 4SLIA 3VKFC 2DTWA 4XXAA 4FPKA 1GLHA 1ZM1A 1LOAA 1O4ZA 3WDTA 2ZGSA 3ZXEA 1CONA 1CQ9A 1W6QB 3AXEA 3V65A 4YFWA 1IS4A 3ENRA 2DVBA 1U0AA 1NLSA 4ISQA 1DQ2A
chains in the Genus database with same CATH superfamily
1EPWA 3BPSA 4Y5TA 4BH9A 3W5MA 1WW6A 5LBBA 4B7KA 4P9GA 3WNLA 4C8DA 1W9WA 1GFF2 4IERA 1UQXA 4LITA 3RZLA 3WDUA 2VG9A 2KM2A 2WNUA 1XNCA 1OQ1A 4XJ8A 1O8SA 2VL4A 1VRH2 1CIYA 4J6GA 4FAHA 3ZPOA 1V6LA 2VGDA 1DQ5A 5LA9A 2PELA 4COYA 3VZKA 5SV8A 3AP4A 3C7OA 3HNMA 3I3MA 3T2QA 3H3LA 2RMU3 1J3PA 2AGSA 4YZ5A 4QU1A 4YWAA 4GWJA 1OKOA 3GJBA 1ND2B 2R32A 5DUVA 3WW2A 3JD72 4GB31 1V9U1 5JZGA 1AYM2 2GP3A 3MIDA 3OEBA 2VE1A 4DUXA 2DYCA 2J1SA 2WT1A 4CCCA 5FLHA 1B35B 1US2A 4GALA 1RUNA 3KMHA 1BBT1 1W2AX 3O1SA 4PIZA 4FFHA 1FATA 1VBD2 2YUEA 5C9AB 5J48A 4ZU4A 1ZYBA 4P9LA 4KBBA 1OPOA 2P4EA 4WVZA 1SCSA 4NAMA 4AW7A 1XXNA 1ZBE1 3ZN6B 2VPVA 3O0WA 3OGSA 1W2NA 3O1VA 4HKWA 4QDRA 1UOGA 1RVF1 3L2YA 3VBSB 2VVFA 5I0SA 5AFBA 3R0RA 2O14A 4CEWC 3VHOA 1YQ8A 1GZTA 4H2AA 1FV3A 1NCQC 2ZJCA 3VBRB 4IW3A 4J25A 1Q8QA 3ECQA 1J59A 2CWSA 2W1QA 1ULCA 5FMOL 1RUOA 4W6XA 2FBEA 2I2SA 4XC9A 1J3RA 3FLTA 5DAVA 4U36A 1POV0 1KDMA 3WG2A 1CAXB 1K5JA 1DLLA 3PVOA 1OA3A 3WP3A 1HXS3 2E9QA 1WW5A 1MS3A 4S2DA 3ZPYA 5EP9A 4D6QA 5HCBA 3WEZA 3UL2A 4B1LA 3ZYHA 2GC3A 2VZ1A 2XHNA 1EYBA 4XMIA 5APAA 3VZOA 2Y6HA 2W1WA 1O59A 3PMEA 3VKLA 4CRQA 2VMFA 3HIFA 5AVPA 2W5FA 4OCTA 4PQQA 3SEPA 3JQWA 2B4KA 3BIEA 5CA6A 3B94A 1ULPA 1VRH1 2HBTA 3BGAA 4CXXA 3WNXA 2WNUB 1G9BA 3A22A 1XBFA 4QKDA 3EBRA 2QZ3A 2Z79A 4XJ9A 5L19A 1F15A 1RUG2 1VJ2A 3TOJA 1ND3C 5FXZA 1DBNA 3ACFA 4AI2A 1CJPA 1DYPA 3G7DA 2XJSA 5LBFA 3JD71 2D40A 1RYYA 2XQXA 1FYUA 2RV9A 1AYM1 2PHRA 2E6VA 4HKLA 1DG6A 4LBLA 2B9VA 3SNMA 4JHZA 2CGPA 2JENA 3KWVA 4BK4A 1OXCA 2RS32 1VBD1 3MI8A 4DXRA 5I0TA 5A32A 2HEWF 4M01A 1W8ZA 1D2QA 1YI7A 2B7YA 2ZOEB 4OHYA 2JDAA 1ZBA2 3RWKX 4QGNA 5FJKA 2VH9A 2ZHKA 2A6VA 3O1PA 1YCIA 3WQ7A 4Z82A 2GDFA 4BLIA 1HRI3 4IEQA 1URXA 5F3IA 4OQ9A 1ND3A 2TNFA 4JX0A 3AJYA 4ZXKA 5H9SA 1OD3A 5IAXA 5FZCA 4LA3A 5DUUA 3R05A 1UZVA 4XCAA 3I2GA 4KU7A 1FPN2 1GQHA 3VD5A 2ZGPA 4NHXA 2D3RA 4FCAA 3D4KA 3ST7A 1NAEA 4ZZ5A 2FHRA 5LWBA 2QQPA 2WNOA 5LZ6A 4Q0SA 4HKOA 4XDQA 4AVSA 2BYVE 2OT7A 2WWSA 2W47A 4CU8A 4DRVA 2FZ2A 2YY1A 3CHXA 3CDZB 1GZ9A 4XUPA 4DS0A 1YQ5A 3OGGA 1YJLA 1G8WA 2DCZA 4FOQA 2NQYA 3ZXGA 3AL6A 1FI2A 1A8DA 2ERFA 3BTAA 5FYTA 1SLTA 1PGL2 2VW1A 4E4SA 4P02B 3IKWA 2XL7A 4WM7C 4JDMA 3T1MA 3RJRA 1UOJA 3D5OA 4BQWA 1OC1A 1RUG1 3I2IA 3HMYA 1N1VA 1AXZA 4FPYA 2VZSA 4BHPA 1UY1A 4M3CF 2R042 4XFFA 1GU3A 3LDKA 4IE6A 2G1MA 4RL7A 1PNFA 4C1WA 1BKZA 2WZ8A 2Y6LA 2ZXQA 1EP0A 4UBHA 4GB33 4XPVA 4E9KA 3O1TA 2OZJA 3IPVA 3WD5A 4Y1YA 1AX2A 3HWJA 2DFCA 2RS31 1Q3EA 4MHUA 3VDCA 2Y60A 1BBT3 5KHJA 1H9WA 2VULA 1D7PM 2ZGLA 3LF7A 1ZBA1 5DXDA 5F6KA 1ZRFA 5FZMA 5DN2A 3IBMA 2OVUA 4O9GA 5LA0A 1ZBE3 1RIRA 5IVJA 5LB6A 2BPA2 1YQ6A 5LRRA 3GYDA 5JSPA 5FZ1A 3UKTA 1RVF3 3CBNA 4JDNA 5FY5A 5JLVA 4PLNA 1ONAA 4XEZA 1GWLA 3WQBA 2Y38A 3H8UA 3HPNA 3IAPA 4FPJA 2DVGA 4HN0A 3ZFFC 3BTZA 4LUKA 4CDUB 1IKQA 2BW8A 2P6HA 2Y6GA 1XB9A 1AHSA 4HL0A 1FPN1 4IEVA 4CDQC 1NG0A 2NLRA 2PQSA 3JCIA 4Y24A 1QJU2 3GHMA 4AZZA 1OOPC 2JE7A 2HWF3 4M0HA 5EPAA 3M7AA 5KWRA 5LK7B 1UNBA 2ZGQA 1SLIA 1VR3A 4Z2WA 1AXYA 2EIGA 2RJKA 2ZABA 4CDWB 2WO1A 1GNHA 5BNOB 4R9AA 3THTA 5FY0A 1A6CA 1TEIA 2D6PA 1WD3A 1YO8A 2FDKA 3ELNA 4KGQA 1P8JA 1PGW1 3K77A 2ARBA 3JXSA 4EN6B 1PGL1 1OF3A 1W9TA 2A5ZA 1XE0A 2CY6A 3I2DA 5FZDA 3MHZA 2J7MA 1I9RA 2PLV2 1EAH2 1BQPA 2E63A 2W1UA 1VRH3 3PL0A 4YG0A 3ZFFA 1MS8A 2JDZA 4CU9A 4CU7A 5F5IA 2ZHMA 2OUJA 4OZOA 2YDEA 3CQOA 4Q2FA 2Y0IA 1UX6A 2AEZA 4L92A 5JIAA 2R041 3LSEA 3QH6A 5DDJ2 3ATGA 3BN6A 2LRPA 1AF9A 4TN7A 5C8CB 3MIFA 2A3XA 2W0XA 3JD73 5EZWA 4BWOA 3OCPA 3NV1A 3LIHA 4XYXA 1G9AA 3C7HA 2JD9A 3NKGA 1DIWA 1LCLA 5FREA 2VNVA 3KM5A 3OBTA 1RJ7A 4WM8B 3RZZA 3SKJE 5FO8B 3WUDA 4IV1C 2G9FA 3AFKA 4CPBD 1VBD3 5LRSA 4N43B 3KVBA 4XAEA 3FHQA 4DNYA 1E5RA 3DUIA 2VC9A 1XNBA 2B9UA 3ETQA 3WQ0A 2XL9A 3CNAA 2ZMKA 3QD6A 2XJQA 3GCXA 4EZ4A 4QDSA 4I2OA 1U12A 2F4LA 3OY8B 2GH2A 4XFIA 1IS5A 2DTYA 2CWMA 5C6CA 3K2OA 4HT1T 4JCKA 1CAUA 1C8M3 1PVXA 2X5IB 1FNYA 4XFGA 4YW3A 1US3A 4AAXA 4AGGA 5C70A 3NRUA 3GJAA 1LJ7A 1RUD1 1TMF2 1OVSA 3R4UA 4V2VA 4LE4A 4AI9A 1QJU1 4ASKA 5LBCA 4YW6A 4TXWA 1ZZBA 4L99A 4NN0A 5DUXA 4R9BA 3VLBB 4UFIA 2W52A 3RGBA 4Y20A 3POGA 1HDKA 4KG8A 3VHNA 2ARXA 5L36A 3PURA 5CFCC 3NMBA 2RDSA 5HV4A 2XBO2 4Q4V2 3UV9A 2ZX4A 3WXPA 1I1EA 3WF0A 5F39A 1D4M2 3ZR6A 3MIEA 5F3GA 3TWIA 4NIIA 1C4RA 4HK9A 5JXGA 3T0AA 3B69A 3H42B 5IT6A 1ASJ2 1D4VB 2PLV1 1EAH1 1IS3A 1BHGA 3WUCA 1ULGA 2Y6JA 3PIJA 2P2KA 1NX9A 3SISA 4XTMA 1K12A 2FCVA 3K4ZA 2QZ2A 4KGGA 1UY4A 5JIUA 2V5DA 2WRAA 1N1YA 3VDDA 5DDJ1 4LBKA 4UFHA 3LSDA 1SFYA 2ET7A 2OPKA 4M3CE 1XNTA 1GUIA 2VECA 4FFIA 4MUVA 4E4ZA 4FPLA 4AWDA 4F7ZA 5FPLA 1MZ5A 3LA3A 3N9QA 4LQRA 5KXBA 1YEWA 2RS33 2VZTA 4I3PA 4FBFA 1NLRA 4L0PA 2GC0A 4I09A 1WCSA 1VMJA 4MGSA 1RITA 4MXWA 5E16A 1JH5A 2A3WA 3I2KA 1ZBA3 2XJPA 3FN9A 4CYDA 3B00A 3R4SA 1R64A 4SBVA 5IWFA 3C7EA 3VZNA 4K8RB 1OHFA 1LHOA 5KHIA 4QX0A 3VDAA 4AQ6A 1LGNA 4MO3M 2ZKLA 2R1BA 3POIA 2BVBA 2Y6KA 1ENQA 1V70A 3DN7A 2VXRA 3MFAA 2D98A 3LEKA 3UGGA 2EXHA 1RUF2 2WN2A 4J1XA 4KU8A 4RFRB 3VGIA 1K45A 1TMF1 2VNRA 4M00A 1UOBA 1CAUB 1Z0HA 1T2XA 5J96B 4XF1A 2KR2A 3FX3A 2IFWA 4AGVA 1MQTC 2R062 3AB0A 3PUIA 4FTEA 1LHUA 1EV13 2A6ZA 3WDWA 3VL9A 1HJFA 2XBO1 4IV3C 3MLJA 4Q4V1 2FMDA 1PMHX 3ZXJA 4ASMB 2C26A 1D4M1 4YSFA 1UYXA 4K6BA 2G9ZA 1V6NA 4NAOA 3NWKA 3MBWA 3AMPA 2JG9C 5I93A 4FP2A 5LY1A 5FPAA 3BTXA 1C28A 1ASJ1 4GA9A 3VV1A 2O1QA 3N7KA 4H55A 4HVRA 4QXBA 5BXXA 1EY2A 4PDWB 2UWBA 4GD4A 2LM3A 3ZSJA 3ZYJB 1QEXA 3RZGA 4NR1A 1BZWA 1GOHA 1H2MA 1H1IA 1VMFA 3ZIXA 3TEZA 3M3IA 4AVAA 4CDXA 4NRMA 1ZREA 5FQ0A 2WSVA 2A73B 1PMIA 2R043 2WNVB 4OHVA 2ZMLA 2A3YA 3VBUA 4IV3A 2XKPA 3Q9OA 5D8AC 2R6QA 3HN1A 3CJIA 4XIKA 2BWCA 4MSVA 1VP6A 3BB6A 1POV1 1AYN2 1PK6B 4RD7A 4CPBA 2JG9A 2ZACA 2I74A 4Q4Y3 1JZ7A 4L2NA 4Z8BA 1OLQA 2C5DA 3GBWA 3MUY1 2ZEZA 1VPHA 2O8QA 4YM1A 1LGBA 4HMZA 2WJSA 2HEYF 1NQJA 2H0VA 3BU7A 4R9DA 3RVHA 4HOOA 2DCTA 2DFBA 2ZPXA 5T5LA 1CAWB 2FD8A 2VZRA 3A4UA 1GQGA 2O8OA 2XVLA 3A7QA 4PT6A 3OPWA 5JI7A 2WC2A 3EQEA 3OG2A 3IIAA 2QDRA 2RG4A 4X6QB 5ABJB 1RUF1 3O5SA 3O1MA 1OLRA 2ADDA 5A3PA 2VZ3A 1WBLA 5C3RA 2VCCA 4TWTA 3WSOA 3CL1A 4CU6A 4GMP0 2LW8A 3D6EA 2VQTA 2YGMA 5LK5A 1RUD3 2R061 1QJU3 2W92A 4XILA 5JMOA 4D7YA 5BYNA 1REDA 2VW2A 2W08A 1WKYA 1H2KA 3R6SA 3KQ4B 5I8SA 2K2SA 5L7OA 5DAXA 4MYEA 3ZFGB 4QX3A 5IK4A 4QU2A 4S2FA 2HWB2 2WR9A 4RGAA 4E4DX 1XE8A 2WABA 2TEPA 4UWDA 4AI3A 2OUHA 2IXJA 1HRV2 4OLLA 1B09A 1WCQA 3NAPB 1IG0A 2PLV3 1EAH3 2OX0A 5ANNA 2BUKA 5B4NA 3IIIA 5CFDA 2B45X 2RS12 3U10A 4AEDC 4KQ7A 2QDNA 1RXFA 5EFUA 2VD7A 2YC0A 4RN5A 2VAUA 2WS92 1F5JA 5FO7B 2EIEA 5DDJ3 1W6NB 1WMXA 1JOBA 1HX6A 4XETA 4AE2A 5FZBA 3ZR5A 4FAGA 5FZOB 3ASIA 3E6DA 3N9OA 4Y22A 5FP8A 4AI0A 1OF4A 4CP0A 2VTFA 1AYN1 4OHWA 3GDBA 1SDDB 4QKFA 5FK7A 1HQWA 3GHNA 4SLIA 3VKFC 4CCKA 2DTWA 3DPRC 1DLCA 2ZX2A 3CJIB 4HVOA 4XXAA 2XPJA 1GLHA 1YQCA 1LOAA 5F6LB 4MG2A 5DAPA 4MGYE 4LO4B 3OUJA 1CONA 2WAAA 4IDZA 3FC0A 1ZRDA 1IS4A 2Y64A 2JDYA 1GOFA 4BIOA 4FSJA 2CTVA 4N8MA 4ISQA 4AEDA 3BKZA 4NVPA 4NIHA 1E5SA 4JC1A 1RTVA 1HXS2 1S4CA 5KC6A 5GKAC 2G9GA 2VXJA 4DZGA 2HKXA 2P3YA 3U37A 2QQMA 2ZEXA 2BOIA 1I5ZA 1TMF3 3OUHA 4OQ8A 2F4PA 1H2NA 1IQDC 2QTWB 4NWVA 1VAVA 4JDOA 2E7QA 3DPRA 2FDGA 1W2OA 4PF1A 3O1OA 3NJYA 2WO7A 1YNAA 2XBO3 4GULA 4Q4V3 2X09A 1SBFA 2HWB1 3N7JA 2Q8CA 3NQHA 3WDVA 4QGMA 1D4M3 4OI4A 4I01A 1AR72 4YG3A 5L7OB 4C1XA 1DU3D 5LEKA 1NYWA 3FBYA 2PTMA 5C8WA 1HRV1 4AVCA 4IEOA 4LULA 1ACCA 2BGCA 4R4XA 5FY4A 1GICA 4DMIA 3LFIA 4QXHA 2RS11 4DINB 4LBNA 4E2QA 1ULEA 2R16A 2HWD2 5EJ3A 5FYZA 1RXGA 2WS91 2Q8DA 4D94A 3AYAA 1CAVA 4YM0A 2ZGKA 4COVA 3O12A 1YIPA 4X8PA 5IJRA 1MS4A 2IFRA 3KT1A 1DQ6A 1VAKA 4QPIC 5JSOA 3I8TA 5I91A 2Z5WA 3LE0A 4UI9L 4AXOA 1VRBA 4JQTA 4W6WA 4B7EA 2PHXA 2FZ1A 3AP9A 2MHFA 3J7NA 3I3DA 4KI5M 4NWWA 5T55A 1POV3 4DFSA 4F3JA 4R52A 4ES9A 3VHRA 1BYHA 1SEFA 4P00B 4Y1XA 2ZGRA 4PJYA 4XIOA 2A71A 4XXPA 3V0AB 1PO22 4EZHA 3C8XA 3MIHA 2PAKA 2GALA 1UAIA 3ZFEC 3I2OA 3TNPB 5JSRA 3TEYA 1KD7A 5E8AA 3RJ2X 3MPPG 2HWC2 1HXS1 2VJXA 5K4LA 1KRIA 3F2ZA 3OJBA 3WDYA 3WCRA 1JYTA 1RUF3 1SMVA 4TTGA 5SV5A 4DY3A 4NPMA 2A6XA 5GLVA 1UIJA 1R092 1CN1A 1NZCA 3I97A 4XHBA 2NM1A 4IE7A 3AJZA 5FWEA 1AR92 3ME2A 4LO8A 4P14A 4AR2A 2R063 3K75B 1NA1C 1C57A 2ORZA 1C3HA 3DGTA 2MNGA 3IT8A 4RA0A 4XACA 1LOEA 5F9TA 1JU4A 5IFTA 1GYKA 1W0NA 3AKQA 4YLZA 1ND2C 4FFGA 3VBFC 1AR71 4QWNA 1F2NA 4UW4A 1S0JA 2PN5A 2RS52 3ZFEA 1UU5A 4A41A 3OYWA 2QUOA 3ZO0B 2VZVA 3LDRA 2UWCA 4YVSC 1CX1A 4XFHA 3WZ1A 2PHFA 5FYSA 4YG6A 4GB32 2N7GA 2HWD1 2CHHA 4CZSA 5FKBA 2XMLA 4JTOA 4CEYA 3INAA 1XNAA 1MS5A 3U14A 5C3SA 3VBSC 4AFBA 1A78A 1S1AA 3U4SA 4QPYA 1XC6A 4P08A 2VQ0A 3VBFA 2BFUS 5KHGA 5CKNA 2YMZA 4IGPA 1AYN3 5C3PA 1Y9MA 3ZXFA 5KHHA 1DGRN 1KJRA 4GKYA 5C4WC 1UZYA 2Q1FA 4ATFA 4YVWA 1K5MC 4YVSA 1PO21 4QX5A 3NW4A 1RMU2 1W8NA 2BVVA 2C9KA 2GN3A 3QOPA 4IETA 3MEPA 1QH7A 1DGWX 1XU1A 4GH4B 5GLUA 3GZAA 4FOYA 2HBUA 2XOMA 2GNBA 4YW2A 1AX1A 2MEV2 4Z1VA 3MZHA 4UXAA 2HWC1 4NIAA 3J9SA 2HWF2 3FWEA 1VMHA 2JXAA 1E5HA 2QBXA 3K4DA 4IL7A 5EYYA 5FZHA 4NHYA 4GWNA 4MADA 4P9IA 2B8MA 5L73A 2W91A 1R091 4EQVA 3VBOC 4BQ5A 2WWJA 1AR91 5E88A 4CCMA 4QHBA 1IGOA 1QOTA 4AG4A 2GH8A 4RS5A 4Q0UA 3H3ZA 5KXDA 4A45A 4X8NA 3ZDSA 2F6BA 2LTNA 2XLFA 3J7MA 5EHDA 2FCTA 3N9PA 4D7TA 1ZZ8A 2HWB3 5FDBA 2RS51 2DCJA 3HN3A 3ZYIB 1GNZA 1DHKB 2CL2A 4A2UA 4Q4X2 3KSCA 3SEEA 1D2SA 3NO8A 1HRV3 1WUVA 4ZHNA 3MW4A 3IMNA 2J1TA 2R7EB 3OPTA 4R8HA 3QLQA 1Q8VA 3CEWA 1D0GA 2RS13 4N9IA 1XNKA 3VBOA 1CX4A 5FOBB 3UT0A 3SH3A 4NHMA 1VIWB 1GZWA 2QQLA 5GLTA 2WS93 1S0IA 1GBGA 2GNMA 1NLQA 3AM2A 4EN0A 4AQTA 1SBEA 4CEYB 3AKSA 1YI9A 4XJZA 5DG1A 5FYYA 2JIGA 2JE8A 2XQRA 4QDQA 2PA7A 1SLLA 5I0DA 3LOBA 1Q8SA 2A70A 2ZMNA 3NNMA 5EV7A 1C8M2 3FUOA 1F35A 1RMU1 2MPFA 3JQXA 5FZLA 2P1BA 1TG7A 1MVEA 1NQDA 2QQJA 4JKKA 4LOSA 1SLCA 4XOGA 4YVWB 4CUGA 5IATA 4AVBA 2R30A 2MEV1 2EAAA 3SITA 3WP5A 3QH7A 3THPA 1JYIA 2HWF1 5CADA 3EMRA 4Q0QA 3CF6E 3SCGA 1F4AA 2ZEYA 1OI6A 4YZ2A 3E1F1 3U75A 1ZA7A 2WQ4A 5D21A 2F17A 3ETPA 1AL22 2EVXA 1Z78A 5ERLA 4XCBA 1IG3A 1L7RA 1VBC2 1COV2 3AKPA 1OD5A 2ZGNA 5H9RA 1RUH2 2KXLA 4FT8A 1RL3A 4XVHA 5FLJA 2E26A 4CEWA 1IQAA 3ZYBA 3IB3A 1NCQA 1LAJA 1S0BA 2D5FA 1LEDA 2LUWA 4LHLA 2E32A 5DZFA 2VUCA 3AZVA 3USSA 1AR73 5FO9B 5BNNC 4Q4X1 1WWYA 4IGOA 1ST8A 1QF3A 3ZN5A 4MH0E 4AOCA 4QX7A 1HV1A 4K9SA 1ZRRA 3WLUA 4B4QA 4DIQA 2JICA 1SBDA 4XZUG 2VR4A 3ZXKA 2ID4A 3V56A 2LROA 4HXCA 1W3XA 4JAAA 2HWD3 2WQZC 1KDKA 1O91A 1HB1A 3K51A 1JYVA 4C0HA 5JZGB 1HW5A 1F9KA 1IHMA 5CG8A 1GZWB 3VBHC 5IK7A 3WY6A 3KV9A 2YROA 2DBNA 4GMP1 4URAA 5CBLA 1O3TA 2BBVA 4LO5B 3PHMA 4Y3OA 1FNZA 5T5PA 2WNEA 3ON7A 2GP5A 2DDUA 4QM9A 3DL3A 1OLME 4HSJA 4XW3A 1LB2A 1C8M1 1KS4A 5T50A 5FZ0A 3PTYA 3T1LA 3ZYRA 2EA7A 4CXWA 2P17A 1PO23 2YPJA 4Y5Z0 2JB8A 5DZGA 4Y33A 2DVFA 4XUTA 1UYZA 5BNOC 1UOFA 4P9XA 4AVVA 5JPMB 2V5YA 4MX3A 3WDXA 3VKMA 4BA6A 3Q8BA 2HWC3 5IVCA 4FO9A 2WSUA 1EV12 1MACA 1V6IA 1PZ9A 3V64A 2QKDA 3LA7A 3M4FA 1AL21 4BQ1A 4GWMA 3VBHA 5JOYA 1UW8A 4LBJA 5GZGA 1R093 1VBC1 5HBAA 1COV1 3A23A 1QIQA 1AR93 1RHI2 1RUH1 1Y7BA 2YPDA 4LK6A 4ZXEA 4JHTA 1PGW2 4BK5A 3LA2A 5FIXA 1JUIA 1J3QA 1OKQA 2AREA 4HG6B 4XDOA 1C1FA 1KEXA 4BOWA 1LU2A 4JGZC 4P5HA 3D8CA 3S57A 3I3QA 5C8CC 1MEC1 2BOJA 2OYZA 1NCQB 4AAPA 4AFCA 3ACHA 2RS53 3MLLA 4UW5A 1HN1A 3PUHA 4FOVA 3LQCA 1DGWA 1GOGA 3ZMNA 1QJFA 2AENA 3WW1A 3H8RA 3DYMA 2P3KA 3AXDA 1H8TC 4N9HA 3TEWA 2H6CA 4D6RA 1BJQA 3N4MA 1Q5OA 3PJQA 2E53A 4Q4Y2 5FZ4A 2NP0A 5A7PA 4W6YA 4OYUA 4IEYA 2PYTA 4WM7A 1OUSA 4AYUA 4PBOA 4RGGA 1YQ2A 5A32B 1DZTA 4ITCA 4ZS2A 1SG3A 3UESA 1HJGA 1XRUA 2FQPA 2I45A 2QFEA 4RR3C 1AZDA 4YGCA 2VOKA 4ONUA 1QOOA 2BTVC 2BWAA 1YUDA 3KHCA 1LOBA 4A6SA 4EWAA 1RMU3 1ND3B 1O8PA 3UETA 1U5ZA 3KT7A 3H1YA 3OPZA 1RUD2 4FXGB 2MEV3 5HXVA 1CR7A 1NKGA 1JI6A 1DQ0A 3HR9A 1EV11 4PLMA 2CDOA 2DV9A 3GALA 3WF1A 5KXEA 2YHJA 5AC92 3KF3A 3U11A 5C33A 5J09A 3NSTA 1W6PA 1DFQA 1CVNA 1PIV2 1RHI1 2DURA 4Q1PA 4RR3A 5GLZA 5FMCA 4WVMA 4OI0A 2WZEA 1QGLA 2BNOA 1DYKA 4UW6A 4AFAA 2VOXA 2ILMA 4A7YA 3RG0A 1XNDA 1CPMA 4X6RB 1YLLA 2WUHA 4NPLA 4CDQA 1OQEA 3T2OA 3PU8A 3IN9A 2XHKA 4U2AA 3T08A 4LLFA 2DUOA 1X7NA 4Q4X3 3TYJA 2Y26A 1OOPA 1W8HA 1MS9A 4LA2A 4ORFA 4LOTA 4YARA 1JHJA 3IAQA 3GZUC 4D7SA 3Q8AA 2XDVA 2RJLA 2VU9A 2WYFA 3AYCA 3BODA 4LIUA 3AKRA 3J7HA 3PJYA 4LKFA 4Q4Y1 3W9AA 3TNQA 5DABA 3GGLA 2BQPA 4YGDA 5A7QA 3IPVB 2QCSB 1HQLA 2ET1A 2WQ8A 3GNEA 3ZMOA 2WWUA 4LR4A 5ACA2 1LECA 4YW5A 5T3NA 2AR6A 4XF4A 1H2LA 2D7FA 4GMP3 4IEWA 3NJZA 4QQOA 4V1PA 4XJAA 3RMXA 5KXCA 1AUYA 4G4FA 3SXWA 4RQPC 4CCLA 3LDBA 4L8QA 1H6XA 5JI9A 2WZR2 1REFA 4EN8B 2A75A 2OIIA 5FV3A 2IZWA 2PQQA 1J84A 3S7IA 4BYYA 1AL0G 3M8LA 4B8EA 1ZZ9A 5FBJA 4IV1A 2EICA 2IVJA 3FJSA 2GNTA 3LEIA 3T30A 5AC91 4AI1A 2C0ZA 1AL23 5CKMA 1GV9A 4LKEA 5DZEA 1R1A2 1PIV1 4PDWC 2Q8EA 1BK0A 2QQWA 4A7ZA 4CVUA 5LA1A 1VBC3 5J98B 1JZ2A 1COV3 3RRDA 2XR4A 4OUSA 4C0BA 1SHWB 5FPUA 1WA4A 2VZUA 2UYAA 1RUH3 3SLIA 1HV0A 1AJKA 2KA3A 1DYOA 2ZGTA 2R0FA 3Q8EA 4RQPA 3AX4A 5BNPC 3EJKA 3LPGA 5H9QA 2C24A 2DUPA 2Q1MA 2W68A 2BFUL 3K46A 2ENRA 1MS1A 2JG8C 1NY72 4Q26A 1MEC3 2VOTA 2VOWA 2O0OA 4I0AA 1KXGA 3MIBA 1HN0A 4I0WB 1LHVA 3RQ0A 3THDA 4Z2AA 1QXPA 4RHV2 2ZX1A 3ZFFB 4CP1A 4YGBA 3RYRA 5A3WA 1ULFA 2ZX3A 2D6KA 1POQA 2HWE2 3CU7A 4PI2A 1Y9GA 5A3TA 5CFCA 3MDPA 1GP5A 3E6CC 1OMIA 4FPKA 4XUQA 4OHZA 5LA2A 1O4ZA 1PGSA 3LKJA 2ZGSA 1CQ9A 3AXEA 1RUI3 4HPKA 3ENRA 2E7AA 1Y9QA 1U0AA 2YC4A 1NLSA 2XXZA 2YXSA 5ACA1 2WAOA 3OB8A 4YFZA 2Y6FA 5FZEA 4N53C 5ABJC 1F5FA 1SDWA 3DF0A 2JG8A 2XJRA 2BNMA 4DRRA 5K7PA 3AP5A 5CB7A 2WLQA 1CIWA 1C5HA 2CNAA 2V72A 2B42B 4E2GA 3FFZA 4XHXA 3HT2A 2YFUA 2WZR1 2J1EA 4CP9A 3VUOA 4FPHA 3ZVXA 4MV2A 3BPZA 2PFWA 1T6BX 4TYSA 5DPNA 4G3YC 2H0BA 4XF9A 2W94A 1REEA 1SLAA 3JUUA 1YHFA 1DF0A 2B46X 2ZTNA 1QDOA 1S0EA 4I3GA 5FAXA 2JDKA 2XJVA 3MF9A 1W8UA 5FZ7A 1U5YA 1OT5A 3SH4A 4XJWA 3NAPC 1R1A1 5E89A 5K9YA 4N53A 4FTBA 4Y20B 1W8TA 2WT2A 1TNRA 1RHI3 2V4VA 1LESA 4A6OA 2L9LA 3PIGA 4ES8A 2QQVA 2VBBA 1OURA 4IE4A 1IPKA 4E8CA 5L9VA 1RGSA 3ITQA 3PVEA 4GJZA 2CU5A 3J7LA 3AMNA 3H0OA 3FMGA 4JQRA 3URFA 1NY71 4NRQA 4OMDA 2ZBJA 1W2UA 4QM8A 5FTTC 5FZGA 5L9RA 2ZX0A 2RDQA 2J1UA 1OSGA 3AL5A 1ZZCA 4RHV1 3KV4A 1Q8OA 5GZCA 4ET7A 1MQTA 1VAMA 2HWE1 3MICA 4QKBA 4CTEA 2W87A 3NNFA 4RYDA 2VVEA 3FL7A 1ENRA 3VDDB 3D82A 4H7LA 1KFXL 1PZ7A 2JIJA 1DCSA 1YXWA 2TBVA 2ZS6B 4LBOA 2YU2A 3MFCA 4LXLA 3HD8B 4JZRA 2Z4FA 1UN1A 3T2PA 4BU2A 1BEV2 2DU1A 3U4XA 1XSQA 3RZJA 1W3VA 1K42A 5CKQA 4CXYA 4BCUA 4QPGC 4BE3A 3BVCA 1W2TA 4H14A 4D69A 2WA3A 4KL1A 1AJOA 2IXKA 4MXWB 1VB4A 2JKXA 4WV8A 4KBZA 3L9JT 3PLQA 2B5HA 4OI2A 4GXLA 1PHMA 1TZOA 3ACIA 2XVGA 4LE3A 5IYYA 5DUWA 1NXMA 4NMIA 1KGYA 3Q8CA 3VDBA 2VCMA 1ZX5A 5D8AA 3MW2A 1O3QA 2PHDA 5FPXA 1LR5A 3N9LA 5F7UA 3TB0A 2DVDA 4XURA 5C71A 4CP9B 1RC6A 1GP4A 5FPZA 5FK8A 4GZ9A 2NMOA 2Y33A 2Z42A 3LPFA 2C6SA 5AC93 4A44A 2Y34A 5FZ9A 5FUIA 1QH6A 2JDNA 4UT5A 1ENXA 2W1SA 5F8PA 1PIV3 1XYNA 4ZY9A 4UW3A 1O5LA 5FUPA 1C1LA 3VL8A 5JOWA 3NKTA 3VZLA 4NHKA 5HV0A 3ZLIA 1S0DA 4I02A 5FXXA 1UU4A 1RUE2 4LBQD 4UAPA 5A33A 3E5UA 1PNGA 4UBGA 4IEZA 3RYKA 1QNYA 5FMBA 4GWIA 3THCA 4M3CA 1CZVA 5K0UC 3OGJA 4FPCA 3TBDA 5J37A 2NMNA 5FYHA 1QJEA 3POSA 2VQAA 4CDXB 3FUQA 5FBZA 5FQ0B 4AVTA 4GAZA 5F37A 2ZGMA 1W6MA 3ILFA 5JPNB 5H9PA 3MIGA 3HBKA 5DAQA 4NO4A 3VBUB 4IV3B 1WGPA 3KT4A 1BEV1 4FPGA 4KWJA 1Y3TA 1SQ4A 2A1XA 1VBE2 2VCBA 2W95A 4B1MA 3BU0A 4ZS3A 2D3PA 2J42A 2JG9B 2OW4A 5ACA3 3H7YA 3N7LA 4R4ZA 3SMHA 3IZOA 5C3QA 4LNVA 4RFT0 1TME2 4A3XA 3OUIA 1X50A 2ES3A 3DKWA 2JWPA 4HVQA 4YZ3A 1FX5A 2FDHA 1YC61 3UGFA 2HYKA 3MYXA 3WNKA 1NCRC 1JN2P 2DWRA 2WZR3 1E5IA 1T6GC 3SKVA 4JKMA 1W8FA 2HEVF 4XTPA 3NNGA 1CGPA 3B9IA 4XUOA 5D8AB 3OD0A 3AMMA 3POJA 1H30A 4JRLA 4BPZA 1XJAA 4AGRA 1BVVA 3APBA 2D6MA 2GAUA 3K3OA 3VD7A 3UNPA 1LODA 1DQ4A 1R1A3 5AVAA 2YV8A 4MVTA 5GALA 5F3EA 1W9FA 3JU9A 2RR12 4KWKA 4YW7A 2JEMA 2QQOA 2R1DA 4JRAA 1RUE1 1W39A 2XVKA 5FPBA 1NCRA 1GKBA 1SFPA 5IVYA 2GMMA 2D43A 1UCXA 3QBQA 2ORXA 2GMEA 3WW3A 4EWDA 2FDJA 1TE1B 1MZEA 4NIGA 1X9PA 4RHV3 4JGYC 2XONA 5CFDB 4Y4RA 2BZDA 2HWE3 2K46A 3POEA 5FR3A 1UZWA 1IPJA 1NUKA 4LT5A 3N36A 1UMZA 3ZSMA 3AYEA 2E33A 3C7GA 4EWEA 4F8AA 1UZ0A 5HXMA 3ZSKA 3MV01 4CUAA 1YRZA 4GH4C 1I5PA 3SQOA 4Y22B 2QQIA 1OFSA 1VBE1 1W6MB 3KGZA 5FZ6A 3EXUA 4FI9A 1LEMA 3WX5A 4CP2A 3CO2A 1J1LA 3POBA 1R1ZA 2W2IA 3T4VA 1TME1 3NJXA 2V4AA 3NV2A 3WG3A 4NRPA 1X8EA 3OF1A 3PUQA 3BALA 2Y0OA 2ZAAA 4HFSA 4K1YA 2QQKA 3H1WA 4LHNA 4I0BA 4XQWA 3P6BA 2VUDA 1UXZA 2IVIB 3PU3A 4AFMA 4AEDB 3R4DB 1AR82 1LNSA 2XH6A 4PCRA 5K8SA 3LFMA 4DY5A 2P6CA 2XG3A 4QPIA 1M06G 1OPMA 2XLAA 4R9CA 4B3NA 4BQYA 4MGQA 4XF0A 4ASLA 2ARAA 2Q8OA 1FV2A 2X29A 1LOGA 3HVDA 1S0GA 4ARYA 2KD7A 1G7YA 5AFEA 3A0NA 2GSYA 1N47A 4O9EA 1L3JA 3AVRA 2D44A 1W6QA 4A3ZA 5IVFA 3FHAA 2BBAA 5GZFA 3E5QA 5A3MA 2VQUA 3DPRB 4YGEA 5FUNA 2RR11 1BCXA 3RDIA 4PIXA 4OFGA 4LBQA 1B35C 1UMHA 4P9JA 4D6SA 5FP7A 5JUVA 5C9AC 4YRDA 1A3KA 3I2FA 2ZEWA 4FPOB 3VZJA 5A3UA 4N7IA 3K3NA 1UKRA 1X8MA 3JBG2 1NA1A 5CAZA 1X82A 2WDBA 1GWKA 2DCYA 2VBPA 4KH9A 4KWLA 4LHKA 5EYXA 4ATEA 3VBRC 3VD9A 1CAVB 1GSLA 1X33A 1ND2A 4HBNA 3W5NA 3H8OA 1WA6X 1FMD2 4DXSA 1M4WA 3ZN4A 1XOYA 3GCWA 5FCCA 2LS6A 1BEV3 5FP4A 4GKXA 1UYPA 4QQHA 2BRTA 1CZSA 3WHTA 3T09A 2A6WA 1WLCA 1Q43A 1DDLA 2UYBA 2GZWA 5E6HA 5GLWA 2WLPA 2JDPA 3O0VA 3ZN6A 4Q4W2 4AL9A 4DQAA 5A6XA 2VZPA 1NZIA 3CIHA 5A7OA 1QQP3 2Q1ZB 1AR81 5IUQA 5F5QA 3VBSA 3ZXDA 4QB1A 4MHRA 3POYA 4QHZA 4DOUA 3BUCA 2VW0A 2ZZJA 4XFBA 3VBRA 5JVVA 5DG2A 2Y8KA 2J1VA 5FOJB 2WNUC 1UKGA 2IWGB 4JVAA 4QHOA 3N35A 4QPIB 2LALA 4UF0A 5T5JA 4IEXA 3U78A 5C4WA 2JB4A 1MR5A 4QX2A 5A3LA 1LULA 1AX0A 1CAXA 1K5MA 1QDCA 2P37A 3HNYM 5I0RA 4GQ7A 3P3PA 4D8MA 5IK5A 4XJUA 3IDBB 1JBCA 5EXOA 3N9MA 1WMFA 3KCCA 4Y1UA 1WBFA 3EB7A 3KGLA 3W20A 2P34A 5CYYA 3ES1A 2IXLA 5JZGC 1RUE3 3ZFEB 2X53S 1WZXA 1U5IA 1LU1A 4BQXA 3LOIA 3OYWB 1WCDJ 4LBQB 1X36A 2RDNA 1UXXX 1ZVFA 4JTNA 5J1XA 1JZ5A 3OGRA 2H6BA 3KZ4C 2WO3A 3HEIA 3WF4A 3JBG1 1DZRA 2XJTA 4W65A 4BM8A 1XE7A 3GXUA 1GQPA 3M3CA 1NOVA 4WVVA 1JODA 1NE4A 1OA4A 2E31A 2SBAA 3HQRA 2VOVA 2WFPA 5A70A 4EJRA 1NA1B 3VD4A 5T54A 1H6YA 1FMD1 5FKCA 2XKOA 4K20A 1UF2C 3S7EA 1H1MA 3VBFB 1HLCA 1QJY3 2UU8A 1DGRA 3G6JB 4IUGA 1VBE3 2AC1A 5A7WA 2BU9A 3HQXA 1J83A 3WG4A 3LZZA 4QT6A 3RYPA 1TME3 1XQNA 1BMV2 5A3NA 2YU1A 4Q4W1 4YVSB 4BISA 2PAEA 1FOD2 3ORJA 4XBLA 5IVEA 1JZ3A 2VMIA 1AXKA 1XU2A 5C3OA 1JHNA 3I49A 2A6YA 3WR0A 3IDEA 4HN1A 1CPNA 2VMEA 2VNGA 1QJZA 2UURA 3ALQA 2WBKA 1UY3A 4IE5A 4PLOA 4LBMA 4HONA 2YC2A 1LKNA 3BYWA 3FE5A 3LD8A 5ANQA 3V0BA 4PI0A 3FZ3A 3NNLA 2YBPA 3RSJA 1KITA 3ILNA 4NPRA 1V6JA 4UF0B 2ZHNA 4RS5B 3ZX7A 1Z7S2 5C4WB 2AYHA 2CAUA 1MEC2 1ZNPA 2CGNA 1LRHA 5JAXA 1K5MB 1OFNA 1IPSA 2RR13 5CISA 5F2SA 4KWUA 1WCKA 4E2SA 1G9DA 2YBSA 2PXJA 1O4TA 2R0HA 2Z69A 4QB6A 5JOZA 3BOWA 3AP6A 2WFF2 3U0ZA 1G9CA 1N1TA 2D93A 5G04L 2EF6A 4YM2A 1PX3A 1MZ6A 2D6OX 2WKKA 3C7FA 4XBNA 3AZWA 3B5LB 3WP6A 1RUI2 1XSRA 1JYCA 1NT0A 5E1RA 3S5AA 4UFKA 3RMYA 3VBOB 1SFNA 4Q0PA 2TUNA 4PBPA 3LB9A 1F8VA 2EALA 2W39A 1G6NA 4A4AA 3CKHA 2XUMA 3UYJA 4CDUC 2ZGOA 4LMFA 2J22A 1W8OA 2EXIA 4IQPA 4IE0A 5BNNA 2V73A 2QNKA 2B39A 2C4XA 1CESA 3T0DA 3OSDA 3MGUA 4Q8LA 2X8KA 4MZUA 5IW0A 1PM7A 2BGPA 4FFFA 2FDFA 3VKNA 5GJ6A 1BMV1 5A7WB 4CDWC 3HNBM 1FOD1 4YW1A 5FMDA 5FYCA 1UY0A 2VTXA 1VB2A 1IZ3A 2VUAA 1YJKA 3MW3A 5FYVA 2W3JA 1AR83 1WLDA 4FVVA 4IGQA 1K3IA 1Y43B 4COZA 1V6MA 3TAYA 3VB9A 3ACLA 5FY9A 4K7JA 4AI8A 3GBFA 5IVVA 1YFWA 4O61A 4CDUA 2WIIB 4LPLA 1VALA 1O4YA 2NZ9A 1JW6A 1OBNA 3B3QE 4L9BA 4LK7A 4QD2A 3RPQA 2IUWA 2E7TA 3SCHA 4XZPA 1WW4A 1OUXA 4IXLA 1IKPA 3V0BB 1Z7S1 5JWPA 4WBBA 4CEWB 3DECA 4CDWA 5BNOA 3BTYA 2EIBA 2ZAHA 3KF5A 5G05L 3JB8A 2BV4A 1ZM1A 3IWZA 4WM8C 3T3YA 3MPBA 3ZXEA 3V65A 2WFF1 4BDVB 4N43C 4LEJA 2J1AA 4XF3A 4A42A 4AK3A 5KC5A 1DQ2A 4BXSV 1V0AA 3KVAA 1S2EA 1OH3A 1WW7A 3SCFA 2ZZQA 4D0QA 3WNMA 1QOSA 1RUI1 3MV11 4YZ4A 4CCDA 5DQ0A 3PVBB 1QXJA 4NJ4A 4RGKA 5LW9A 4AHWA 3JBG3 3WT3A 1SZBA 1J1TA 3OD4A 4CA9A 3SHRA 1FAYA 1N3QA 3ACGA 1CWPA 1H1AA 2X5IC 2GMPA 3BCWA 4FXKB 1W04A 2VBDA 3EYPA 4JGZA 4AF9A 2VCAA 3VKOA 5CEHA 5FZ3A 5C8CA 5M0TA 1NXD1 4J1WA 4K8FA 3PVNA 3DYPA 1FMD3 3M70A 1PZ8A 4XE9A 3WV6A 3CLPA 5FXWA 2VMCA 4FP3A 4NHLA 4UFLA 3B02A 3KQRA 4WM8A 3I7DA 3M3QA 3POWA 5F1RA 5GZDA 1V9U3 5FZIA 4B4PA 4N43A 4DXTA 4PHZA 4DPNA 4K1ZA 5BNNB 1H8TA 3DEMA 5FXVA 2R49A 2X05A 3W21A 4LTAA 1I6XA 4E4HA 1JMUB 5DMYA 5JMCA 3WP4A 3IDAA 4Q4W3 1O7FA 2WO2A 1GANA 1W90A 4WVWA 2ATFA 2IC1A 5IVBA 1GWMA 3CJXA 1JTZX 1UZZA 1VBA2 2G4IA 1Q8PA 2BDRA 3OY8A 3WF2A 2XWJB 3E5XA 1ZA4A 2Q4SA 3J8F2 3WNNA 5JXJA 1ODMA 2X5IA 4UFMA 2WT0A 4AHXA 1D0HA 2DBIA 4XABA 2BGOA 2CGOA 4OUMA 3VBHB 1L7QA 3MLKA 1MZFA 4F83A 2HLEA 1OH4A 3NVCA 1BLZA 1DQ1A 3KB5A 2OQ7A 1PVC2 3H50A 4DXZA 4AHZA 4MGIE 1UWWA 1SLBA 1S55A 3T0BA 3UJOA 2CV6A 4QMAA 4CCJA 5IFPA 4K21A 5C7GA 3ZYGA 2BERA 3LEGA 4OULA 4QB2A 2IXCA 4B4RA 1APNA 2I07B 5HCFA 4NUBA 2JE9A 5CNAA 2YZ4A 5BV6A 2FCUA 2CAVA 1WCUA 4QPWA 4ZONA 2PHTA 2ZHLA 1JS9A 1JUHA 1QWRA 3WINE 5FRAA 4CCNA 3LGRA 2CDPA 2JX9A 5A7SA 1J58A 2HYXA 4CUCA 1OLMA 4Q5OA 3P5BA 4KNCA 4HSLA 4QXCA 3USUA 4DUVA 2GC2A 5JXHA 4WM7B 5EJZB 1QU0A 3JB4C 3ES4A 3I3BA 1YWKA 4JGZB 4AQSA 3I59A 1SCRA 1KFUL 4KG0A 4DEVA 1N1SA 4YZ1A 3PMSA 4ISRA 4XDPA 1AYM3 1Q56A 4I30A 5IK8A 1YFXA 5LY2A 1S2BA 2VO5A 2AH2A 2D3SA 3HQUA 5EWSA 4AFDA 1YFUA 3HBZA 2Q5TA 1FOD3 2RE9A 1H9PA 2YG0A 3K48A 1VBA1 1H8TB 2HH9A 2FMYA 3MO4A 2RDRA 4GIQA 3WOGA 4QX1A 3WNOA 5JR2A 1QJX2 3J8F1 1DGLA 3J26N 3E6BA 2AEYA 3VD3A 4LHSA 5BUVA 1STMA 1F31A 1SPPA 4W4ZA 5CG9A 3ABZA 3DKQA 2A7AA 2JKBA 1G86A 2P3IA 4FPEA 1XPWA 2GC1A 5F5CA 4BIFA 4QKNA 1HB3A 2PHUA 4QXKA 3TN92 5B2GB 1W0OA 3WCSA 2DF7A 2WN3A 4URTA 1KS5A 3AMHA 1W6PB 4PIYA 3AFGA 3F95A 4E27A 5EIYB 3VN4A 1OQDA 4RR3B 2WNVC 4WVMB 5T5OA 1FT9A 1I3HA 3EHKA 1Z7S3 2UWAA 1V6OA 1E57A 3VDDC 1ALYA 1PVC1 3OBRA 5FYMA 4OUEA 1RINA 1EUUA 1PK6C 3RNSA 4QX8A 1WD4A 2CSGA 3NV3A 2VTXJ 3NV4A 4CDQB 2YB7A 4MGTA 2DCKA 5FLIA 2WFF3 4H3WA 3O0XA 1OOPB 4Z92B 2VVDA 3N7MA 3HT1A 3ROUA 4PDWA 1WLTA 5HCHA 1CZTA 5A7NA 2V09A 2VZQA 5A6QA 1R082 2JJ6A 1OVPA 1JYWA 3IDCB 4EE2A 5BNPA 2RM22 3AK0A 3FBMA 2VUJA 3PNAA 1W9SA 3S5QA 2JDUA 3MF6A 4AEMA 2WNVA 1ZZ7A 2ZKNA 4NOTA 5D1IA 5ISLA 1RUG3 1WMEA 2DU0A 2VZOA 4TLFA 3ZYFA 4OHXA 5A6ZA 2JD4A 4QQ2A 3OEAA 1S0FA 4XFAA 4IEUA 3O1RA 3DYOA 1W06A 1PK6A 2QQUA 3USUB 1QKQA 3AZXA 1LOCA 2BNNA 4XMAA 1PMJX 5I0UA 1A34A 3I4IA 3I59B 4OVEA 3ZFGC 3KD4A 5J3UA 4MGKE 1RB8G 1GR3A 4AQ2A 1ZZ6A 2PMWB 1QJX1 1W99A 4G9SB 1CAWA 1TVGA 1IS6A 4OZXA 5KHKA 3J4UH 3H8XA 2GN7A 4IV1B 5ABJA 3O14A 4M0NA 1DP0A 4LJHA 4OI1A 4Y1VA 3U1XA 4YW4A 3ZSLA 3TN91 4COWA 1SPPB 2VMDA 2D97A 2NN8A 3H7JA 3E97A 1YYNA 4XBQA 1O3RA 1UL9A 3QCWA 1LOFC 4M4PA 3P3NA 3WVJA 3ZXLA 3ZOIA 5A1FA 1VBB2 3BOPA 1FPN3 1PO12 1ODNA 1GMMA 5JOXA 3T2TA 3AKTA 1AVBA 1GZCA 4RQPB 5GM0A 3JZVA 3ZFGA 4CDXC 4AEKA 4C91A 1RUC2 3OBZA 5IAVA 4XFCA 1H4HA 3VBUC 2WA4A 4XQ4A 4META 3L2HA 4LO6B 2Z2SB 4QQLA 3CJIC 4B29A 1TQ5A 3S0MA 5L9BA 3NAPA 4LIVA 5FMOS 4INDA 5B4XA 1QXRA 4O65A 3UK9A 1Y4WA 4EYUA 3A0KA 2EXKA 4V2WA 5FPVA 5CFCB 3RWNA 4BMBA 4YNIA 1R081 5JDBA 4Q0VA 1HKDA 1EPZA 1UY2A 2RM21 2PHLA 4HZFA 4WZFA 4MGZE 1LOFA 4HPKB 1W6NA 4HLTA 3TRSB 1W8WA 3H3UA 3HOBA 1JYXA 2VNOA 5FZOA 3UKVA 1ULOA 1JU3A 5BNPB 5FZKA 1V6KA 5D2AA 4BJ0A 4LUMA 2R072 3POFA 1W6OA 2JG8B 1QQP2 2D6NA 4Q29A 1OA2A 3O7OA 5J7MA 1W05A 3CZJA 2UY9A 3KV6A 1O5UA 3TEXA 4ZPIA 2GU9A 3H1MA 3ZYPA 2ZCWA 1UU6A 4Q27A 5L7OC 2BEOA 1AR62 3KHBA 3RZMA 1VBA3 3B93A 1LENA 4P5YA 2IXIA 1V00A 3J8F3 1QHDA 4BQ3A 4DEQA 4QPGA 2OA2A 2WYSA 4PQ9A 3NNJA 1HIXA 3WHUA 2BP6A 3KCXA 3GF6A 4IESA 4MXVA 1RUJ2 4FPFA 4NE9A 1W9YA 2VMGA 4N53B 1MS0A 4ZKTB 1YIFA 3IMMA 4XQDA 1LHWA 5CFDC 3B7MA 1VBB1 2HJIA 3M3OA 3W59A 1PO11 1QY4A 1VE0A 5FZFA 3M1HA 3SH5A 4AHYA 4UOJA 2WZPP 3LCPA 2SLIA 1RUC1 1PVC3 2QQNA 3ZKUA 4UFJA 1MVQA 3W58A 4NROA 5FYUA 3B01A 4QAWA 3B9CA 4LORA 5J36A 1HB2A 5A3OA 1JYNA 2QVSB 1L7LA 2W9XA 5CVRA 1MQTB 1QMJA 1LGCA 3EO6A 1JOPA 3OTFA 5T52A 3ZXAC 1WMDA 4HANA 5LBEA 3MUZ1 5FYBA 4C90A 4EV0A 5FZAA 2FDIA 2RMU2 2XUEA 3PUAA 2IXHA 2XLGA 3PUSA 3D0JA 1EUTA 1QJY2 1IOAA 4YPJA 4Q8KA 2AACA 2W46A 3SC7X 3ZDVA 1ZRIA 2YYOA 2WINB 4S2GA 4DB5A 5KR7A 1GP6A 5FY8A 4P9WA 1U5XA 4OMCA 4A7KA 4TZDA 3FLPA 3DCQA 2R071 5BPXA 3WQ1A 3PTRB 4WZCA 1A8MA 3D0SA 3N9NA 3HJRA 4BZ4A 1QQP1 3OBAA 2J1RA 3GBGA 5K0UA 4HK8A 1PM4A 4FQZA 1BXHA 2PHWA 5A1AA 5LASA 1SACA 1W6OB 2OKXA 3S30A 2QE3A 4EN7B 3RZHA 2QJVA 4GJYA 4TSVA 4ARXA 3KLSA 3ZM8A 3V0AA 3I2HA 4MOAA 4Y1ZA 1W0PA 1S0CA 2OXBA 2ADEA 1AR61 3Q8FA 4NIDA 4LO7A 1UO9A 2P3JA 3D3AA 1BK1A 1QJX3 3AZYA 3H9AA 5F32A 1CJDA 3BIWE 1JZ8A 5A80A 2VM9A 2YFZA 3ZSEA 3AMQA 1UX7A 4W8JA 1NE6A 3RFRA 1RUJ1 1W03A 3TN93 4QPGB 5F3CA 1KJLA 4BMEA 3OOXA 5I8YA 5C5UA 5FZ8A 3I3EA 1F4HA 4RSUA 4Y5SA 3KCYA 1LHNA 4H7MA 2NYYA 1CD3G 1C5IA 2CYFA 2YGLA 3VZMA 2VY0A 3ILRA 5C5TA 3RZKA 3IM0A 1O6UA 5I8TA 3AVSA 5TSWA 5CU1A 3UGHA 2EIDA 5A33B 5FP3A 4CCOA 1O3SA 1GNYA 2RJ2A 4M3CB 2AUYA 1UPSA 1ZRCA 3AP7A 5HI0A 2Q0AA 2RMU1 1C8NA 3M2MA 4DUWA 3KS7A 2K0GA 1N3OA 1ASJ3 2UY8A 1KQRA 1JOJA 1QJY1 1R083 3AC0A 3FHIB 5FP9A 1YFYA 4LKDA 2RM23 2D5HA 4UYBA 1XYOA 4Q1RA 3LIGA 2DUQA 3VHPA 3WNPA 1BVP1 3A21A 4Y26A 4N90A 4Z07A 5JCTA 3KV5A 4S2HA 5FWJA 4BQ4A 3WW4A 2WL1A 2RHPA 2D6LX 2BJSA 3I54A 5LCWL 4JGYA 4AEJA 5FY1A 3FLRA 3U07A 3LWCA 4FOWA 1FXZA 1RJ8A 4BXFA 4ZU7A 4BLJA 5K0UB 3LEMA 1HRI2 2XJUA 3NL1A 3C2UA 1TNFA 5HPOA 2XWBB 3BI3A 3DV8A 1VLNA 1ULDA 4YYOA 4GH4A 4E8DA 4P9YA 1JZ4A 2E51A 3T4HB 3P1IA 4EN9B 2XB6C 1W28A 3AYDA 2GNDA 1HQNA 1UYYA 5BY5A 3QACA 3N3HA 2JECA 4MLOA 1HB4A 1UIKA 4CE8A 4COUA 3GZTB 1WLWA 4QQPA 5F2WA 2X10A 4M4RA 2ETEA 3PDQA 1N3PA 4EROA 5LEJA 4TLGA 4BQ2A 5EJ1B 1H4GA 5FFOC 1VBB3 1JXNA 1PO13 4PF5A 4L97A 4CUBA 4ZZ8A 4CEYC 1H0BA 5KBFA 4YM3A 1NCRB 1RUC3 2OPWA 4HETA 4N7UA 1UPIA 4LLOA 1X9TA 5JR7B 3NJVA 1UMIA 3UKNA 2EXJA 4D3WA 1XYPA 4L11A 2Q30A 2ZA9A 1QNWA 2VMHA 4JV4A 4ZU5A 2C9AA 5LATA 3CMGA 4XUNA 4Y4YA 4LKSA 4KMQA 4YVWC 5IHRA 2NPIA 4BB3A 5EQUA 1ENSA 3OGVA 4W50A 1B35A 4CSWA 1G9FA 1PX4A 2ARCA 3LAGA 5FJHA 5A6YA 2G19A 2ZGUA 4FQ4A 4XAAA 1V9U2 1DZQA 3S6PA 2C1FA 2PAMA 3DXTA 5F5AA 5C9AA 3C3VA 5DAWA 5HCAA 4JKLA 3RI8A 3DXUA 5JXIA 1LTEA 1BBT2 5FYIA 3WG1A 2R073 3FFQA 3ZKYA 3GM8A 1H8VA 1UD1A 4K40A 2JDHA 3I2JA 5FY7A 4DO0A 2P5BA 1ZBE2 3AZZA 1HRI1 3ZIWA 2DVAA 2YBKA 4JGYB 4FTSA 4QGLA 1MPXA 2XGXA 5A1LA 3UJQA 1RVF2 2OZ6A 4RS5C 2EAKA 3WF3A 2RVAA 2OS2A 2K9ZA 3K4AA 3M3EA 4O7XA 1AR63 2OQ6A 5BNQA 3HAGA 2JDMA 4IEPA 3X29B 5CZKA 3WDTA 1S2KA 3O1UA 3GZEA 3RI9A 4CCEA 1W6QB 2AZ5A 3CZUA 4YFWA 1JZ6A 2DVBA 1RUJ3 3RS6A 4K3UA 5GZEA 5CIRA
chains in the Genus database with same CATH topology
1EPWA 4BH9A 1WW6A 4B7KA 4P9GA 1GFF2 4IERA 3WDUA 2VG9A 2KM2A 2WNUA 1XNCA 1OQ1A 4XJ8A 1VRH2 4FAHA 4J6GA 1V6LA 2VGDA 1DQ5A 2PELA 4COYA 3VZKA 5SV8A 3AP4A 2RMU3 1J3PA 2AGSA 4YZ5A 1ND2B 2R32A 5DUVA 3WW2A 3JD72 4GB31 1V9U1 5JZGA 1AYM2 3MIDA 2DYCA 2WT1A 5FLHA 1B35B 4GALA 1RUNA 3KMHA 1BBT1 4PIZA 1FATA 1VBD2 2YUEA 5C9AB 5J48A 4ZU4A 1ZYBA 4P9LA 4KBBA 1OPOA 4WVZA 1SCSA 4AW7A 1XXNA 1ZBE1 3ZN6B 2VPVA 3O0WA 4HKWA 1RVF1 3L2YA 3VBSB 2VVFA 5I0SA 5AFBA 3R0RA 4CEWC 3VHOA 1FV3A 1NCQC 2ZJCA 3VBRB 1Q8QA 3ECQA 1RUOA 2CWSA 1ULCA 5FMOL 4W6XA 2FBEA 2I2SA 1J3RA 3FLTA 4U36A 1POV0 1KDMA 3WG2A 1CAXB 3WP3A 1DLLA 3PVOA 1OA3A 1HXS3 2E9QA 1WW5A 1MS3A 4S2DA 3ZPYA 5HCBA 3UL2A 2GC3A 4XMIA 1EYBA 3VZOA 3PMEA 3VKLA 4CRQA 5AVPA 3HIFA 3JQWA 5CA6A 3B94A 1VRH1 3WNXA 2WNUB 1G9BA 5L19A 3EBRA 2QZ3A 2Z79A 4XJ9A 1RUG2 1VJ2A 3TOJA 1ND3C 1DBNA 4AI2A 1CJPA 1DYPA 3G7DA 2XJSA 3JD71 2D40A 1FYUA 1AYM1 2PHRA 2E6VA 4HKLA 1DG6A 4LBLA 3SNMA 2JENA 2RS32 3MI8A 1VBD1 5A32A 5I0TA 2HEWF 4M01A 1D2QA 1YI7A 2B7YA 2ZOEB 4OHYA 1ZBA2 4QGNA 2VH9A 2ZHKA 2A6VA 1YCIA 3WQ7A 4Z82A 2GDFA 4BLIA 1HRI3 4IEQA 1URXA 1ND3A 2TNFA 5H9SA 3AJYA 4ZXKA 4LA3A 5DUUA 3R05A 4KU7A 1FPN2 1GQHA 2ZGPA 2D3RA 4FCAA 3D4KA 3ST7A 2FHRA 2QQPA 4Q0SA 4HKOA 4XDQA 4AVSA 2BYVE 2WWSA 4DRVA 2FZ2A 2YY1A 1GZ9A 4DS0A 3OGGA 1YJLA 1G8WA 2DCZA 4FOQA 2NQYA 3ZXGA 1FI2A 1A8DA 2ERFA 3BTAA 1SLTA 1PGL2 2VW1A 4E4SA 3IKWA 2XL7A 4WM7C 4JDMA 3T1MA 3RJRA 3D5OA 1RUG1 3HMYA 1N1VA 1AXZA 4FPYA 4BHPA 4M3CF 2R042 4XFFA 4RL7A 1PNFA 4C1WA 1BKZA 4E9KA 4UBHA 1EP0A 4XPVA 4GB33 2OZJA 3IPVA 3WD5A 4Y1YA 1AX2A 3HWJA 2DFCA 2RS31 1Q3EA 1BBT3 5KHJA 1H9WA 2VULA 2ZGLA 5DXDA 5F6KA 1ZBA1 1ZRFA 3IBMA 2OVUA 4O9GA 1ZBE3 1RIRA 5LRRA 3GYDA 5JSPA 3UKTA 1RVF3 4JDNA 5JLVA 4PLNA 1ONAA 4XEZA 2Y38A 3H8UA 4FPJA 2DVGA 4HN0A 3ZFFC 4LUKA 4CDUB 1IKQA 2BW8A 1AHSA 4HL0A 1FPN1 4IEVA 4CDQC 1NG0A 2NLRA 3JCIA 4Y24A 1QJU2 3GHMA 1OOPC 2JE7A 2HWF3 4M0HA 5LK7B 3M7AA 5KWRA 2ZGQA 1SLIA 1VR3A 4Z2WA 1AXYA 2EIGA 2RJKA 2ZABA 4CDWB 5BNOB 1GNHA 4R9AA 3THTA 1A6CA 1TEIA 2D6PA 1WD3A 1YO8A 3ELNA 4KGQA 1PGW1 4EN6B 2ARBA 1PGL1 2A5ZA 2CY6A 3I2DA 1I9RA 2PLV2 1EAH2 1BQPA 2E63A 4YG0A 1VRH3 3ZFFA 1MS8A 2JDZA 2ZHMA 2OUJA 2YDEA 4Q2FA 2Y0IA 1UX6A 4L92A 5JIAA 2R041 3LSEA 3QH6A 5DDJ2 3ATGA 1AF9A 5C8CB 3MIFA 2A3XA 2W0XA 3JD73 5EZWA 4BWOA 3OCPA 3NV1A 4XYXA 1G9AA 3NKGA 1DIWA 1LCLA 5FREA 3OBTA 3KM5A 4WM8B 1RJ7A 3RZZA 5FO8B 3WUDA 4IV1C 2G9FA 3AFKA 5LRSA 1VBD3 4N43B 4DNYA 3DUIA 3ETQA 1XNBA 2B9UA 3WQ0A 2XL9A 3CNAA 2ZMKA 3QD6A 2XJQA 4I2OA 1U12A 3OY8B 2GH2A 4XFIA 1IS5A 2DTYA 2CWMA 5C6CA 4HT1T 4JCKA 1CAUA 1C8M3 1PVXA 2X5IB 1FNYA 4XFGA 4YW3A 4AGGA 1LJ7A 1RUD1 1TMF2 3R4UA 4LE4A 1QJU1 1ZZBA 4L99A 4NN0A 5DUXA 4R9BA 3VLBB 2W52A 4Y20A 3VHNA 1HDKA 4KG8A 2ARXA 5L36A 5CFCC 2XBO2 4Q4V2 3UV9A 2ZX4A 3WXPA 1I1EA 1D4M2 3MIEA 3TWIA 1C4RA 4HK9A 3B69A 5IT6A 1ASJ2 1D4VB 2PLV1 1EAH1 1IS3A 3WUCA 1ULGA 2P2KA 3SISA 4XTMA 2QZ2A 4KGGA 5JIUA 1N1YA 3VDDA 5DDJ1 4LBKA 3LSDA 1SFYA 2ET7A 2OPKA 4M3CE 2VECA 4MUVA 4E4ZA 4FPLA 4AWDA 4F7ZA 1MZ5A 3LA3A 5KXBA 2RS33 4I3PA 4FBFA 1NLRA 2GC0A 4I09A 1WCSA 4MXWA 1RITA 5E16A 1JH5A 2A3WA 1ZBA3 2XJPA 4CYDA 3B00A 3R4SA 4SBVA 3VZNA 1OHFA 1LHOA 5KHIA 4AQ6A 1LGNA 2ZKLA 2R1BA 2BVBA 1ENQA 1V70A 3DN7A 2VXRA 3MFAA 2D98A 2EXHA 1RUF2 4KU8A 4J1XA 3VGIA 2VNRA 1TMF1 4M00A 1CAUB 1Z0HA 5J96B 4XF1A 3FX3A 2IFWA 4AGVA 1MQTC 2R062 3AB0A 4FTEA 1LHUA 1EV13 2A6ZA 3WDWA 3VL9A 2XBO1 4IV3C 3MLJA 4Q4V1 2FMDA 4ASMB 3ZXJA 1D4M1 4YSFA 4K6BA 1V6NA 3NWKA 3AMPA 2JG9C 5I93A 4FP2A 1C28A 1ASJ1 4GA9A 3VV1A 2O1QA 3N7KA 4H55A 4HVRA 5BXXA 1EY2A 4PDWB 2UWBA 2LM3A 3ZSJA 3ZYJB 4NR1A 1BZWA 1H2MA 1H1IA 3ZIXA 3M3IA 4AVAA 4CDXA 1ZREA 5FQ0A 2WSVA 2A73B 1PMIA 2R043 2WNVB 4OHVA 2ZMLA 2A3YA 3VBUA 4IV3A 2XKPA 3Q9OA 5D8AC 2R6QA 3HN1A 3CJIA 4XIKA 2BWCA 4MSVA 1VP6A 3BB6A 1POV1 1AYN2 1PK6B 4RD7A 2JG9A 2ZACA 2I74A 4Q4Y3 4L2NA 4Z8BA 1OLQA 2C5DA 3GBWA 2O8QA 4YM1A 1LGBA 4HMZA 2WJSA 2HEYF 1NQJA 2H0VA 3BU7A 4R9DA 2DCTA 2DFBA 2ZPXA 5T5LA 1CAWB 3A4UA 1GQGA 2O8OA 2XVLA 5JI7A 2WC2A 3EQEA 4X6QB 3IIAA 2QDRA 5ABJB 1RUF1 3O5SA 1OLRA 1WBLA 4TWTA 3CL1A 4GMP0 3D6EA 2YGMA 5LK5A 1RUD3 2R061 1QJU3 4XILA 4D7YA 5BYNA 1REDA 2VW2A 2W08A 1H2KA 3R6SA 5I8SA 2K2SA 5L7OA 3ZFGB 4MYEA 5IK4A 4QU2A 4S2FA 2HWB2 4RGAA 4E4DX 1XE8A 2TEPA 4AI3A 2OUHA 2IXJA 1HRV2 4OLLA 1B09A 3NAPB 2PLV3 1EAH3 2BUKA 5CFDA 2B45X 2RS12 3U10A 4AEDC 4KQ7A 2QDNA 5EFUA 2YC0A 5FO7B 2WS92 1F5JA 5DDJ3 1W6NB 4XETA 1HX6A 4AE2A 4FAGA 3ASIA 3E6DA 4Y22A 4AI0A 4CP0A 1AYN1 4OHWA 1HQWA 3GHNA 4SLIA 3VKFC 2DTWA 3DPRC 2ZX2A 3CJIB 4HVOA 4XXAA 2XPJA 1GLHA 5F6LB 1LOAA 4MGYE 4LO4B 1CONA 3FC0A 1ZRDA 1IS4A 4BIOA 4FSJA 2CTVA 4ISQA 4AEDA 4NVPA 4JC1A 1RTVA 1HXS2 5KC6A 5GKAC 2G9GA 4DZGA 2HKXA 1I5ZA 1TMF3 2F4PA 1H2NA 4NWVA 1VAVA 4JDOA 2E7QA 3DPRA 1YNAA 2XBO3 4GULA 4Q4V3 1SBFA 2HWB1 3N7JA 3WDVA 4QGMA 1D4M3 4OI4A 4I01A 1AR72 4YG3A 5L7OB 4C1XA 1DU3D 5LEKA 1NYWA 3FBYA 2PTMA 5C8WA 1HRV1 4AVCA 4IEOA 4LULA 2BGCA 4R4XA 1GICA 4DMIA 2RS11 4DINB 4LBNA 4E2QA 1ULEA 2R16A 2HWD2 5EJ3A 2WS91 4D94A 3AYAA 1CAVA 4YM0A 2ZGKA 4COVA 3O12A 1YIPA 4X8PA 1MS4A 2IFRA 3KT1A 1DQ6A 1VAKA 4QPIC 5JSOA 3I8TA 5I91A 2Z5WA 4AXOA 4W6WA 4B7EA 2PHXA 2FZ1A 3AP9A 2MHFA 1J59A 5T55A 4NWWA 4F3JA 1POV3 4DFSA 4R52A 4ES9A 3VHRA 1BYHA 1SEFA 4Y1XA 2ZGRA 4PJYA 4XIOA 2A71A 4XXPA 3V0AB 1PO22 3MIHA 2PAKA 2GALA 1UAIA 3ZFEC 3TNPB 5JSRA 1KD7A 5E8AA 3RJ2X 3MPPG 2HWC2 1HXS1 1KRIA 3OJBA 3WDYA 3WCRA 1RUF3 1SMVA 5SV5A 4DY3A 2A6XA 5GLVA 1UIJA 1R092 1CN1A 1NZCA 4XHBA 2NM1A 3AJZA 1AR92 3ME2A 4LO8A 4P14A 2R063 1NA1C 1C57A 3DGTA 1C3HA 3IT8A 2MNGA 4RA0A 5F9TA 1LOEA 1GYKA 3AKQA 4YLZA 3VBFC 1ND2C 1AR71 1F2NA 4UW4A 1S0JA 2PN5A 2RS52 3ZFEA 1UU5A 3OYWA 2QUOA 3ZO0B 2UWCA 4YVSC 4XFHA 3WZ1A 2PHFA 4YG6A 4GB32 2N7GA 2HWD1 4CZSA 4JTOA 4CEYA 3INAA 1MS5A 3VBSC 1A78A 1S1AA 4QPYA 2VQ0A 3VBFA 2BFUS 5KHGA 2YMZA 1AYN3 3ZXFA 5KHHA 1DGRN 1KJRA 4GKYA 5C4WC 1UZYA 4ATFA 4YVWA 1K5MC 4YVSA 1PO21 4QX5A 3NW4A 1RMU2 2BVVA 3QOPA 2GN3A 4IETA 3MEPA 1QH7A 1DGWX 1XU1A 4GH4B 5GLUA 3GZAA 4FOYA 2GNBA 4YW2A 1AX1A 2MEV2 4Z1VA 3MZHA 4UXAA 2HWC1 3J9SA 2HWF2 3FWEA 2JXAA 4IL7A 5EYYA 4GWNA 4P9IA 5L73A 2B8MA 1R091 3VBOC 1AR91 5E88A 4QHBA 1IGOA 1QOTA 4AG4A 2GH8A 4RS5A 4Q0UA 3H3ZA 5KXDA 4X8NA 3ZDSA 2F6BA 2LTNA 2XLFA 5FDBA 4D7TA 1ZZ8A 2HWB3 2RS51 2DCJA 3ZYIB 1GNZA 1DHKB 2CL2A 4A2UA 4Q4X2 3KSCA 1D2SA 3NO8A 1HRV3 1WUVA 3MW4A 3IMNA 4R8HA 3QLQA 1Q8VA 3CEWA 1D0GA 2RS13 4N9IA 1XNKA 3VBOA 1CX4A 5FOBB 3SH3A 4NHMA 1VIWB 1GZWA 5GLTA 2WS93 1S0IA 1GBGA 2GNMA 3AM2A 4EN0A 4AQTA 1SBEA 4CEYB 3AKSA 1YI9A 4XJZA 5DG1A 2PA7A 1SLLA 3LOBA 1Q8SA 2A70A 2ZMNA 5EV7A 1C8M2 3FUOA 1RMU1 2MPFA 3JQXA 1MVEA 1NQDA 4XOGA 1SLCA 4YVWB 4AVBA 2R30A 2MEV1 2EAAA 3SITA 3WP5A 3QH7A 3THPA 1JYIA 2HWF1 5CADA 4Q0QA 3CF6E 3SCGA 4YZ2A 1OI6A 2WQ4A 1AL22 2EVXA 1Z78A 1VBC2 1COV2 3AKPA 1OD5A 2ZGNA 5H9RA 1RUH2 2KXLA 4FT8A 1RL3A 5FLJA 4CEWA 1IQAA 1NCQA 1S0BA 2D5FA 1LEDA 2LUWA 4LHLA 5DZFA 3AZVA 3USSA 1AR73 5FO9B 5BNNC 4Q4X1 1QF3A 3ZN5A 4MH0E 1HV1A 4K9SA 1ZRRA 3WLUA 4B4QA 2JICA 1SBDA 3ZXKA 3V56A 4JAAA 2HWD3 2WQZC 1KDKA 1O91A 3K51A 4C0HA 5JZGB 1HW5A 1F9KA 1IHMA 5CG8A 1GZWB 3VBHC 5IK7A 3WY6A 4GMP1 2YROA 5CBLA 1O3TA 2BBVA 4LO5B 3PHMA 5T5PA 1FNZA 2WNEA 4QM9A 3DL3A 4HSJA 4XW3A 1LB2A 1C8M1 1KS4A 5T50A 3PTYA 3T1LA 3ZYRA 2EA7A 2P17A 1PO23 2YPJA 4Y5Z0 5DZGA 2DVFA 5BNOC 4P9XA 4AVVA 5JPMB 2V5YA 4MX3A 3WDXA 3VKMA 2HWC3 4FO9A 2WSUA 1EV12 1MACA 1V6IA 1PZ9A 3V64A 2QKDA 3LA7A 3M4FA 1AL21 4BQ1A 4GWMA 3VBHA 5JOYA 1UW8A 4LBJA 5GZGA 1R093 1VBC1 5HBAA 1COV1 1AR93 1RHI2 1RUH1 1Y7BA 1PGW2 3LA2A 1JUIA 1J3QA 1OKQA 2AREA 1C1FA 4BOWA 1LU2A 4JGZC 4P5HA 3D8CA 5C8CC 1MEC1 2OYZA 1NCQB 4AFCA 2RS53 3MLLA 4UW5A 4FOVA 1DGWA 3ZMNA 2AENA 3WW1A 2P3KA 3AXDA 1H8TC 4N9HA 2H6CA 1BJQA 3N4MA 1Q5OA 3PJQA 2E53A 4Q4Y2