4GH4C

Crystal structure of foot and mouth disease virus a22 serotype
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
GIVPVACSDGYGGLVTTDPKTADPVYGMVYNPPRTNYPGRFTNLLDVAEACPTFLCFDEGKPYVVTRTDEQRLLAKFDVSLAAKHMSNTYLSGIAQYYAQYSGTINLHFMFTGSTDSKARYMVAYVPPGVETPPDTPEKAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDVAETTNVQGWVCIYQITHGKAEQDTLVVSVSAGKDFELRLPIDPRSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein VP1
publication title Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb
molecule tags Virus
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gh4C00
1AR83 3VBSA 1QJZA 2HWC3 1TMF1 4QPIB 1MQTB 4Y5Z0 1AR61 1AUYA 4YVSC 5D8AB 1AR82 1POV0 1VBB3 3VDDB 1ASJ2 1FOD1 4PDWA 5ABJA 1RVF3 1VB2A 4GH4C 4GB31 4Q4W3 1VBB2 3TN91 4Q4V3 5AC93 1HRV1 1WCDJ 2RS32 1RUJ1 1H8TB 1RVF2 3J8F1 4CDUB 1BBT2 3JB4C 4CEYB 5BNOA 4IV3C 5AC92 3CJIC 2TBVA 1NG0A 4Q4X1 1K5MB 1PIV1 4CEWC 1OOPB 4LLFA 3ZFFC 1NA1C 1RUD3 4IV1C 4WM7B 1X36A 2RS12 2MEV2 3DPRC 4FTSA 1FMD3 4AEDA 1VBD1 1AL23 4IV1A 2WLPA 3FBMA 1B35C 1C8M1 3HAGA 1AR71 1Z7S1 4YVWC 4CDWA 1AL22 1QJX3 5DDJ3 2BFUL 1RUE1 5ABJB 2BBVA 1IHMA 4YVSB 1A6CA 4QPIA 2XBO1 1MQTA 4Q4Y1 1QJX2 1RUI2 5DDJ2 3VBRC 1HXS2 1RUH3 5D8AA 4GH4B 1MEC3 3VDDA 2HWF1 2RR11 1VBA2 5LK7B 1R091 3M8LA 4GMP3 2BUKA 2HWB1 1CD3G 1QJU1 4CDQC 1MEC2 1VRH1 4JGYC 4RHV1 2RM21 1TME3 1RUC1 4RQPA 4WM8C 1NCQC 1D4M2 3VBOA 1AR93 5L7OC 3ZFFB 4AEDB 1QQP1 3NAPC 1HRI3 2R063 4IV1B 1AYN3 1TME2 1ZBA1 5ACA3 1K5MA 4WM8A 4FTBA 1COV1 5CFCC 4NWVA 1ZBE1 2R073 1OOPA 1AR92 3DPRB 1F8VA 1POV1 1PVC2 1NCRC 1HRI2 4RS5C 5BNNC 2R062 1AYN2 4WM7A 5ACA2 4JGZA 1B35B 2HWD3 2RMU1 1AYM1 2ZZQA 5CFCA 2R072 4NWWA 4YVWB 3VBUA 1FOD3 5C8CC 1R1A1 1RHI1 1VBC1 2HWD2 2WZR1 5FMOS 2HWC2 1VBE1 2R041 2DF7A 1HRV3 4RR3C 1RUG3 3VBRB 5CFDC 4YVSA 1BEV3 1R081 1HRV2 4RQPB 1RUG2 4Q4X3 4N53C 1PO11 1QJY3 3VBOB 5CFDA 5K0UC 4GH4A 2RS53 1PIV3 4Q4W2 1ASJ1 1BEV2 4Q4V2 4CDQB 1PGL2 3JD71 4JGYB 4WM8B 1NCQB 5A32A 1QJY2 4N53A 2RS52 1PIV2 5L7OB 2RS31 2WFF3 1FPN3 4EJRA 1HQNA 4IV3A 5A33B 3CJIA 1RVF1 3ZFGC 1BBT1 4JGZB 1V9U1 1C8M3 2X5IC 5AC91 5CFCB 4CEWA 1EV13 3ZFFA 1NA1A 1RUD2 1AR73 3VBUB 2WFF2 1FPN2 1NCRB 1RUF1 1F2NA 1RMU1 1ND3C 4RS5B 5BNNB 1RUE3 1OPOA 4N43C 3VBHC 1C8M2 5C4WC 3DPRA 1AL0G 1FMD2 1EV12 2XBO3 1AR72 4Q4Y3 2RS11 3JBG3 2ZAHA 2MEV1 1GFF2 1RUE2 5C8CB 1B35A 3VBFC 5JZGC 4Z92B 4QPGC 1NY72 2WS93 2XPJA 4YVWA 2XBO2 2HWF3 4RR3B 3JBG2 1ND2C 5CFDB 1PO23 2FZ2A 2PLV1 1R093 1AL21 2HWB3 2WS92 2BPA2 2HWF2 2RM23 5A32B 3VBRA 1RUH2 4N53B 1PO22 1QJX1 1RUI1 1PGW2 2HWB2 5DDJ1 4IV3B 1HXS1 3CJIB 2RM22 2HWE3 4Y4YA 1COV3 4CEWB 1C8NA 1NA1B 1VBA1 4CDQA 1POV3 1M06G 4CDXC 4JGYA 3ZFGB 1NCQA 4CDUC 2HWE2 3ZFEC 3S6PA 1MEC1 1COV2 2X5IB 3ZXAC 1TMF3 1AYM3 5L7OA 1BMV2 1D4M1 5A33A 1OHFA 3NAPA 1AR63 1VBC3 1EAH1 4N43B 3VBHB 2QQPA 1TMF2 1NCRA 1VBE3 2R043 5BNPC 5C9AC 4RS5A 5BNNA 1AR62 3VBSC 1AR91 1PVC1 1VBC2 4GB33 5JZGB 5FOJB 1HRI1 3TN93 2R061 4QPGB 2BFUS 5ACA1 1R083 4GMP0 4FTEA 1VBE2 1FOD2 1RUJ3 2R071 5C8CA 5J96B 1VB4A 1PO13 1ND2B 3J8F3 2WWSA 4GB32 1ASJ3 4BCUA 3TN92 4PDWC 5ABJC 1DDLA 1X33A 1R082 4RR3A 2HWD1 1AR81 3JD73 2HWC1 1RUJ2 1PO12 2ZTNA 3J8F2 2RS33 3JD72 4Q4X2 1BBT3 1VBB1 1V9U3 5K0UA 5BNOC 1RUG1 1VBD3 3NAPB 1RUF3 4CDXB 1RMU3 4Q4W1 1BEV1 1V9U2 4Q4V1 3ZFEB 1PGL1 1Z7S3 1VBD2 1QJY1 3ZFGA 1HX6A 1RUF2 1RMU2 2RS13 2RS51 2MEV3 4AEDC 2X5IA 1Z7S2 5BNPB 5C9AB 1ND3A 3VBSB 1RUD1 2FZ1A 4N43A 3VBHA 2WFF1 1FPN1 4CDWC 2PLV3 5C4WA 2RR13 4Q4Y2 2Y26A 1FMD1 4QPIC 1EV11 5FMOL 3VBFA 1W39A 5JZGA 1MQTC 2PLV2 1QJU3 4QPGA 1RUI3 3JB8A 1VRH3 4PDWB 1HXS3 4RHV3 5D8AC 2RR12 1RUC3 2VQ0A 1NY71 5K0UB 1ND2A 3VDDC 1R092 1VAKA 1QJU2 1QQP3 1VBA3 1VRH2 3JBG1 4RHV2 1RUC2 1ZBA3 4SBVA 1SMVA 2IZWA 1ZBE3 2WS91 5BNOB 4RQPC 4RFT0 1H8TC 1D4M3 1QQP2 1RUH1 3VBOC 1PO21 1ZBA2 2RMU3 1PGW1 4CEYC 3LOBA 1EAH3 2GSYA 1ZBE2 1K5MC 4CDXA 1H8TA 1ND3B 4GMP1 1R1A3 1OOPC 1RHI3 4CDUA 3ZFEA 2RMU2 1PVC3 2WZR3 1EAH2 4CEYA 5C4WB 1NOVA 1AYM2 4FSJA 1TME1 1CJDA 4WM7C 5GKAC 2HWE1 4JGZC 1R1A2 3IDEA 1RHI2 3VBFB 1BMV1 1RB8G 3VBUC 2WZR2 4CDWB 1AYN1 2GH8A 5J98B 1E57A 2R042 5BNPA 5C9AA
chains in the Genus database with same CATH superfamily
3CDZB 1KGYA 2ZCWA 4N9IA 1Y9MA 4OHWA 1DGWA 3GZTB 5CG9A 3BTXA 4XVHA 3BU0A 5DN2A 5FYHA 3OUIA 4AI0A 4Y5Z0 1AR61 1RUNA 4IERA 2PAMA 2OQ6A 5FY1A 4JVAA 2C9AA 3LCPA 3AXEA 3H0OA 3O5SA 4YRDA 4XBLA 3WDUA 3ZR5A 4DO0A 3LEGA 5A1FA 3RZLA 4JDMA 2BNMA 3LKJA 4XEZA 1VAMA 1FOD1 3RDIA 2VZQA 1X8MA 1KS4A 3ES4A 3WCSA 1O91A 2OYZA 4Y3OA 2UU8A 4AVTA 4LO4B 3LDKA 4Q4W3 3PTYA 1VBB2 4MXWA 3VKMA 2WWJA 2P3KA 1HRV1 2VNRA 4ZZ8A 1U5ZA 2RS32 2Y6KA 2EA7A 2YV8A 5DQ0A 5FYYA 2VUAA 4YZ2A 2ARXA 1HLCA 2QQIA 3LPFA 3N36A 3E5QA 3OOXA 3SXWA 4CDUB 4M00A 2WYSA 5LEJA 2JDNA 1J3PA 3DXUA 3IPVA 4XUPA 1SEFA 2D44A 4S2FA 3UGGA 2TBVA 2XUMA 1DGRN 3BYWA 1QXJA 3MPPG 4O9GA 5C8WA 2FDGA 1OBNA 1V6KA 1K5MB 1FNYA 3K3OA 2BNNA 4Y1VA 4ZU5A 4HOOA 5BNPA 4EZ4A 3WNOA 4V1PA 2WT0A 5I8YA 1Q8OA 4LLFA 5F8PA 5LY1A 1SQ4A 1L7QA 2CL2A 5KC5A 1F9KA 1OFNA 4META 3AL6A 2OUHA 1CR7A 1O4YA 2RG4A 4LHNA 4AZZA 4LBQA 4XF9A 1H1AA 3HBKA 3RJRA 5LATA 3I2DA 4LE3A 2V72A 3C7EA 5FQ0B 1DBNA 4YZ5A 3VN4A 2VVDA 3O0XA 2QQNA 4AEDA 2HJIA 2B7YA 3LA2A 4LT5A 5CEHA 1F4AA 1YIFA 3PJYA 3QBQA 2C5DA 1UCXA 3FBMA 2BZDA 4JQTA 2F17A 1D7PM 5IW0A 5J1XA 4BQWA 4OHXA 5A70A 4NRPA 3OD0A 1PM7A 1SLAA 1AL22 4NO4A 3A4UA 5CKQA 3SCHA 1N1YA 4YVSB 4L0PA 2BGOA 3LB9A 4YW7A 5KWRA 1I1EA 4IQPA 1UPSA 3E97A 4XJ9A 5LA1A 4LR4A 4FOYA 4GALA 1I9RA 3K51A 4NPLA 4QWNA 4XUNA 4XF3A 3LEKA 1QJX2 3S30A 3SCGA 3ZYBA 5IK4A 2P4EA 1CAVA 1V70A 2YC4A 3NKGA 3UYJA 3N7KA 3ATGA 5FYVA 4P00B 4AK3A 2YU2A 4BA6A 3AZWA 4KG8A 3PUSA 2J22A 3WG4A 3ZYFA 1JMUB 1CPNA 1G7YA 1GP5A 2XJSA 2A3YA 4G9SB 5FY9A 4QQ2A 2L9LA 3PUAA 4QX3A 3IM0A 2QJVA 3M4FA 4WZCA 5JIAA 4CXWA 2QQOA 3M8LA 4R8HA 2VAUA 2VZOA 2BUKA 2ZABA 2A3XA 3WDTA 3ZXKA 1S55A 3HR9A 1W2OA 4Q1RA 3SLIA 3U37A 1GZCA 1RYYA 4YW2A 4W65A 4INDA 3HN3A 5SV8A 5LK5A 1KITA 3LIHA 1QY4A 5HCHA 1RUOA 1AR93 2H0BA 3JZVA 4XUTA 3ZFFB 3VV1A 3WX5A 4J1XA 2R063 5A7OA 4F8AA 4QGMA 5IATA 4GJYA 4YFZA 1K5MA 4UFKA 1UOJA 1SPPB 1UOFA 1SHWB 4QKFA 4LJHA 5FZDA 2ZOEB 4NWVA 1ZBE1 4XZUG 1YQ6A 3LDRA 4ARXA 5C3SA 1ZZ8A 2Y0OA 2BQPA 1F5FA 2BWCA 2JB8A 4BLIA 1F8VA 1O8SA 1GU3A 4RS5C 1YWKA 2ZMNA 3GZAA 5GZDA 5ACA2 3WP3A 2HWD3 1EY2A 1K12A 3AMHA 1D4VB 3KGLA 4HXCA 3POGA 2VUCA 5FP9A 4YVWB 3VBUA 1UY4A 1AZDA 1XNAA 2W52A 3T2TA 3TN93 1ST8A 1VBC1 5C8CC 1W6MA 3S7EA 2GP3A 4TYSA 3AMNA 2HWC2 3ZMOA 1QDOA 4RR3C 5FYTA 4XUOA 4YVSA 3IZOA 5A6XA 3OJBA 2KD7A 4JX0A 2QVSB 4P08A 5JPMB 1DLLA 2O1QA 3U4SA 2B5HA 2IWGB 5HCAA 2BRTA 4PHZA 4YFWA 1ENSA 3OEAA 3HQRA 2G9FA 1WWYA 3BN6A 4N53C 4M0NA 4Y1UA 4Y5TA 5BXXA 3ZYJB 3POSA 5LA9A 2RS53 4Q1PA 5KHGA 2IVJA 2RJ2A 5FY5A 1BEV2 1OXCA 2YUEA 2GALA 2GC2A 1GANA 4ONUA 3IMNA 4CXXA 5EP9A 4JGYB 5DUWA 3H1WA 4Y20B 1VALA 1NCQB 5A32A 3AKQA 1QJY2 4N53A 5FXVA 2HEYF 1PIV2 2Y6FA 3MFCA 1O7FA 4EJRA 5A33B 1PMHX 1HB3A 4Y4RA 2EIGA 1RVF1 2CGOA 3ZFGC 5L19A 5FZ9A 4AVCA 5DXDA 4O9EA 1HIXA 3VKNA 4D69A 1OKOA 4BE3A 5FPZA 1KD7A 3UJOA 1LOBA 4QX8A 2BW8A 4C91A 4CUGA 3A21A 1AXZA 1DQ2A 1HDKA 1NA1A 1RUD2 1WD4A 1Y43B 3OGGA 4QAWA 3ZFFA 4AI1A 1NCRB 1RUF1 1XNBA 3WQ0A 1ND3C 4CP2A 2AEZA 4HKWA 2DTYA 5A3WA 3DUIA 5CZKA 1SPPA 5BPXA 1E5HA 2FBEA 2MNGA 1FMD2 4NIAA 2QDNA 1QJFA 1REEA 5LASA 2DTWA 4Q4Y3 2A6XA 4CU6A 4FPGA 1JZ3A 3M3IA 5FP3A 1RUE2 1DG6A 2MEV1 2QQKA 3VGIA 4BQ4A 1OLQA 1JW6A 1LOFA 3I3EA 5JZGC 4HL0A 3B01A 4Z92B 4NIGA 5F39A 2XPJA 2K9ZA 4YVWA 2XBO2 2HWF3 1JUHA 3FLPA 1LNSA 1ND2C 2WNUC 3JBG2 5CFDB 3KT1A 4AYUA 2PLV1 2FZ2A 1DGLA 3DKQA 4DUWA 2Y6GA 1H8VA 2MPFA 3E6BA 5LB6A 1W99A 2G4IA 2VQTA 4FT8A 2PHWA 3R4SA 4JQRA 4P9IA 2WS92 5SV5A 4E4SA 3DYPA 2DBIA 2RM23 1RJ8A 4HVOA 4AEMA 1D2QA 2AZ5A 5FYUA 3I4IA 4QHBA 5CAZA 1RUH2 1YFYA 5F37A 4I09A 4L9BA 4CCDA 1PO22 4NE9A 2Y0IA 3EBRA 1RUI1 4OMDA 5DDJ1 4B1LA 3B00A 4IV3B 3HEIA 2I07B 4QHOA 5EHDA 1HB4A 2ZGUA 4IGPA 1JYWA 3HJRA 2B9VA 1LENA 1YHFA 1ULDA 4O65A 1WMDA 1GR3A 4AEJA 4CEWB 2IFRA 1XPWA 2WO2A 5LCWL 2DBNA 4QQLA 1ULPA 3WHTA 3BTAA 3C7GA 3BB6A 3POWA 4JGYA 4RN5A 4Y20A 5FBZA 2ET7A 2R0FA 1HJFA 3USSA 1NCQA 2VZ1A 5GJ6A 3UJQA 3RZHA 3ZFEC 5BY5A 1LB2A 3ORJA 2BGPA 5DAXA 4LHSA 3ZXAC 3ZKYA 1ZRDA 2OQ7A 4V2VA 1BMV2 3ME2A 3H9AA 4XFIA 5A33A 4ATFA 3NAPA 4YW1A 1AR63 2IXCA 1UU5A 3DKWA 3MFAA 3TB0A 1GNYA 2W1SA 2AC1A 2ORXA 3HNMA 4QU2A 4N43B 3N7LA 1RXGA 5FMCA 2ZGLA 4FPHA 2VW0A 2ZGPA 1HV0A 1GP4A 4M3CE 5A80A 1NCRA 2R043 1XBFA 5FZMA 3ACFA 4D3WA 1UZ0A 2IXLA 1GOGA 4XFCA 1WW6A 1OQEA 1ULCA 3J7NA 2UYBA 3NSTA 1GZWA 1WCQA 5LA0A 2JB4A 3IDBB 3H3ZA 3CLPA 3LQCA 5FOJB 1N47A 1CESA 1Y9GA 3PUHA 5CKNA 5IVVA 2ZKLA 1R083 2Z4FA 3RJ2X 5F5AA 5DAPA 4QDSA 3SKJE 1O5LA 5BYNA 5C33A 5J3UA 3H50A 1PO13 3RZGA 1JU4A 3SQOA 2DU0A 1PNFA 3I59B 2RDRA 4TLGA 5F5IA 4AFCA 1UAIA 1W90A 2JIJA 4PDWC 1X33A 1IKPA 4ZHNA 1UKRA 2DCYA 3B93A 1S0JA 2ZMKA 4BHPA 1RUJ2 2VVFA 3LE0A 1H0BA 2GN7A 1AVBA 2XLFA 2VUJA 2VZRA 2QQUA 4TXWA 5JI9A 3NV2A 1LULA 2C4XA 5HCBA 1OLME 3TEZA 2P37A 2RS33 4CU8A 3IB3A 2V4AA 3MLLA 4MO3M 4BZ4A 1O4TA 3JD72 4XPVA 4UW3A 4Z07A 1BK0A 2WKKA 4MGIE 5K0UA 3GALA 4IDZA 2CHHA 2ES3A 4ISQA 4TWTA 3VL9A 3NMBA 1RUG1 3CKHA 1DP0A 1NAEA 4UFLA 2SBAA 4OFGA 4CDXB 3S7IA 1AX2A 2WRAA 4Q4W1 2PMWB 5G05L 2R1DA 2E51A 1V9U2 2EICA 4HN0A 1PGL1 3K75B 4JV4A 2C9KA 2DDUA 3VDBA 3WNNA 3PDQA 1ALYA 1HX6A 3FWEA 5ANNA 5FMDA 1KS5A 4HONA 4URTA 3LFIA 5FIXA 3VHPA 4UI9L 3TEXA 3VZKA 4QXBA 5GLTA 4UXAA 5HI0A 4NJ4A 5T5PA 3ALQA 4FI9A 1MZ6A 3AP5A 5F6KA 2GP5A 5FUPA 5HPOA 1G9DA 4UAPA 3THCA 4AHXA 4XAEA 3VBSB 2HKXA 4QU1A 4N43A 1CONA 3NQHA 4CDWC 4QQHA 4I0WB 4Z2AA 3APBA 2VQAA 3NW4A 3VZOA 5LZ6A 2WUHA 3RWKX 5JIUA 4OI4A 5FYBA 2WSUA 3WW4A 4NRMA 4M4PA 4DXSA 3ZYHA 2JD4A 3EQEA 3WSOA 5FMOL 3HT1A 2Q8DA 3OYWB 5EWSA 1MQTC 5C6CA 3JB8A 2ZX3A 5FP7A 1VLNA 5GALA 3B69A 2Q8OA 4YG0A 3MIFA 2FMYA 4W6YA 4RGAA 2VQ0A 3NV3A 3TWIA 1W6OB 1BCXA 3T0DA 3K3NA 3WG3A 1NY71 1UYZA 3VDDC 2WT2A 2P3IA 2R0HA 3I59A 4AW7A 4BQ5A 2I2SA 1YJLA 3UT0A 5IVEA 4D7SA 2YHJA 3VHNA 4TZDA 4PQ9A 2WO7A 2OA2A 2WQZC 2GZWA 5JOZA 2D5HA 2BTVC 3DGTA 2ARAA 4QXKA 1N3QA 5T55A 1ZBE3 1X9TA 4I30A 5IT6A 2WWUA 4D6QA 3FLRA 4DY3A 4Q0PA 1H8TC 1QQP2 4LK6A 4COWA 2R16A 3ILRA 2ENRA 1PX4A 1HN0A 3HN1A 4ZKTB 2VMIA 5CG8A 3T1MA 2D6LX 1EAH3 2GSYA 4XDOA 5BUVA 4EN6B 1S4CA 2W87A 3ETQA 5A1LA 3ZXDA 4CDXA 1H8TA 2G9ZA 3DYOA 1WW4A 3H3LA 3RSJA 4EN7B 4NROA 3MUZ1 4NRQA 3AMMA 5A7WB 5C4WB 1NOVA 1AYM2 3AKRA 1Y9QA 3QD6A 1JU3A 2JG8B 1LTEA 4KBZA 4W50A 5GKAC 4JGZC 5C3OA 1VP6A 1JBCA 4XTMA 2B46X 5F2WA 3WVJA 2AR6A 2B45X 3VUOA 3LD8A 4H55A 4LO6B 3V0AB 2WZPP 3MGUA 3CL1A 1S0FA 2NQYA 1ZZBA 1ACCA 1QHDA 4FPLA 4D6SA 1T2XA 3VBSA 1GNHA 2HWC3 1TMF1 2VGDA 4FVVA 4NAOA 4JC1A 4XFBA 3ZLIA 4AFAA 1JZ5A 4QPIB 2Q0AA 1W6QB 1SFYA 2DCJA 1AUYA 3EYPA 2WT1A 2QNKA 2UWAA 2XDVA 3NNFA 3ZXLA 1T6GC 4Q0SA 5D8AB 1WA6X 4K40A 4FBFA 2VCMA 1AR82 5DMYA 4M3CA 2PQQA 1W8TA 2XJUA 3AK0A 3KSCA 3FLTA 3WDVA 3CBNA 2W46A 4LA3A 4YM2A 2E9QA 5E6HA 2VMEA 3ZDVA 1LCLA 3HNBM 5ABJA 1RVF3 3MF9A 3I3BA 1GSLA 4NVPA 2LW8A 4GB31 3LDBA 3I3QA 2QQJA 3CJXA 1UIJA 4JKLA 2CWMA 2VD7A 3GCWA 5C3RA 1SLCA 3HQXA 2CAVA 1WCDJ 2E7AA 1GQPA 2WZEA 2FDHA 1V0AA 3IT8A 1UIKA 4XOGA 3T3YA 2FDIA 1OA4A 2ZXQA 3J8F1 4YYOA 4URAA 4DUVA 1X50A 1YI7A 1MS8A 3EMRA 3LOIA 4GIQA 2A3WA 2ZGRA 3FBYA 3JB4C 3SEPA 3EHKA 4CEYB 5AC92 3CJIC 4BXSV 4KH9A 3DCQA 1DF0A 3NNGA 5FYSA 5FYIA 4AI9A 2DFBA 5AVPA 3FZ3A 4XBQA 3NJZA 4OI2A 3C7FA 3A0NA 4JTOA 4XABA 4N7UA 1QWRA 3UKTA 2B8MA 1OLMA 1OOPB 5FZKA 4R52A 4CDWB 2X09A 1RUD3 2W1WA 4LEJA 4AI2A 3I97A 2PAKA 4IV1C 4C1XA 1LU2A 2ZHKA 4V2WA 1OI6A 4I3PA 4XJ8A 2CDOA 4QDQA 4WM7B 3WT3A 1V6OA 4CCOA 2ILMA 3K77A 2RS12 3RGBA 3UESA 2ZGKA 2VZVA 2Z69A 3DPRC 2P6HA 3NNMA 3W58A 4FTSA 1MVEA 1FMD3 1UMHA 5A7WA 5LEKA 1VBD1 3KV4A 2FCTA 2PHUA 5J48A 5AFEA 3POJA 4IV1A 2JG8A 4N90A 5E8AA 1TE1B 2JD9A 1DQ5A 1PZ9A 1B35C 4E4HA 2I74A 1UO9A 3HAGA 3UETA 2AREA 3FHAA 1GBGA 3AZYA 1Z7S1 2NMOA 5EJ1B 1W8OA 5DDJ3 3V0AA 2LROA 4YW4A 2Q8CA 1PK6C 4BIOA 4BPZA 2XJTA 1XC6A 1W6NB 2QBXA 3P3NA 2XJRA 4LBNA 3SMHA 5JOXA 1H2LA 4MXWB 2DUPA 1HN1A 4QPIA 1UYPA 2OW4A 4DUXA 4E8CA 1JHJA 1W6QA 4Q4Y1 4QX7A 2YROA 3ETPA 4XW3A 3VBRC 3WOGA 1I5ZA 1S1AA 1PK6A 1RUH3 5D8AA 4AFDA 2UYAA 4CPBD 3BIEA 2W91A 4MZUA 1B09A 4DPNA 2SLIA 3IPVB 4BMBA 4Y22A 1C3HA 4ISRA 2HWF1 1CAXB 1Q8PA 2VCBA 4FFHA 2VPVA 2XVGA 3RZZA 5A6YA 3N9PA 5LK7B 2PQSA 4P9YA 4N8MA 2WR9A 2ZPXA 1BJQA 2VZUA 3HT2A 4LTAA 2H6CA 2ZX0A 4MGSA 5DUUA 3J7MA 5EJZB 5I93A 3RNSA 1QJU1 5DABA 2XQXA 1MEC2 4C0BA 1ZRCA 5F1RA 3FFZA 3JQWA 5JAXA 3BU7A 2RM21 1TME3 4KL1A 1VJ2A 3KS7A 4LBQB 4RQPA 1D4M2 1JHNA 2QZ3A 3ZN5A 3VBOA 4BOWA 1TQ5A 1UKGA 5M0TA 3MW2A 4AEDB 1IQAA 1FATA 3VL8A 1K42A 1EYBA 3GYDA 1RIRA 1AYN3 4I3GA 3TEYA 5FZ4A 5DAVA 1ZBA1 5GZCA 3VZNA 3MIHA 1LHOA 2JENA 4XZPA 5CFCC 4CCCA 1OOPA 4KWUA 5C5TA 5IVFA 1H2MA 1O3SA 4Y24A 1HRI2 5BNNC 3CQOA 3NNLA 4WM7A 3O1UA 4Q0VA 1MPXA 3H3UA 4UYBA 2QUOA 5CBLA 4G4FA 5CFCA 2R072 5H9RA 3L2YA 3B3QE 2XMLA 3SISA 3AKSA 1MS1A 3OD4A 4NWWA 5DAWA 5EXOA 4OI1A 4AXOA 1JOBA 1JXNA 3OG2A 3VD4A 3WEZA 2CYFA 3RRDA 1CAVB 2BVBA 4PLOA 4LOTA 5FPBA 1PX3A 2IVIB 1DGWX 5CB7A 5FZBA 1H2NA 1TG7A 4BK4A 5FMOS 2BGCA 3G6JB 2J1EA 4S2DA 4RSUA 3TBDA 2GAUA 2DF7A 2R041 4XJAA 1CN1A 1US2A 1MS9A 2O14A 3U0ZA 1RUG3 2R7EB 4YNIA 3OPTA 4YGCA 4E4ZA 4D8MA 1W6NA 5FZAA 5FZ3A 1L7RA 5IVJA 2ZHMA 3CF6E 1ZX5A 3ST7A 1KFXL 4BDVB 2HYXA 5GZEA 1J1LA 1R081 2OIIA 3BCWA 5C71A 1HRV2 1WMEA 3BPSA 1QIQA 1G8WA 2WO3A 3RZMA 1PO11 5FPVA 4UBHA 5JXGA 4MYEA 2W2IA 3MEPA 5BNQA 1KFUL 2Y33A 5FK8A 4Q4V2 1ENXA 1RITA 4CYDA 5A3PA 1CAXA 1NLQA 1UZVA 3ACIA 4MHUA 1PHMA 5IUQA 4NHKA 1OH3A 3FC0A 2WJSA 2PYTA 1J84A 1BVP1 1BXHA 1W9YA 4XETA 3VD5A 2JICA 3IBMA 3WQ7A 4CCJA 2D3RA 2RS31 4HKOA 4A2UA 4AFMA 2VW2A 2NN8A 3PU3A 2JG9C 5K9YA 2KXLA 1DQ0A 4IEWA 3WUDA 1NX9A 4B8EA 3ILNA 1C8M3 2ZAAA 5ISLA 4QT6A 4FP2A 2A7AA 3M3OA 4CCMA 2XJPA 1AR73 1W0OA 3DYMA 3VBUB 2WFF2 1FPN2 5L36A 1J58A 5FZIA 1F2NA 1G86A 5FZ1A 4RS5B 1O3RA 1W3XA 2QTWB 3OBZA 2QQWA 1W6MB 4J1WA 4Z2WA 3VBHC 1VMHA 2UWCA 2A6ZA 3NWKA 2YFZA 5FP4A 1EV12 5T5JA 2DCTA 5FJHA 2Q5TA 3AKTA 3CEWA 4AL9A 1GFF2 5C8CB 3WP5A 3VBFC 2ZEZA 5C70A 1JZ6A 3VB9A 4Q27A 3ZVXA 4QPGC 3USUB 3URFA 4UW5A 4RR3B 3J7LA 4QKNA 4NAMA 5K7PA 1SLLA 1S2BA 3KF5A 5GLWA 2CNAA 2Y60A 1AL21 5AFBA 3LWCA 2HWB3 4GWJA 4AI8A 4UOJA 5JVVA 5FO8B 2ZX2A 4IETA 2Y6HA 2ZGSA 2EF6A 2RHPA 3I2IA 4S2GA 3WDWA 3M3CA 5A32B 4CZSA 1UYYA 4N53B 4A41A 3OEBA 3ZYGA 2GC1A 4LO8A 5JMCA 5FAXA 1V6IA 1QJX1 3D82A 1PGW2 3BODA 1BHGA 2J7MA 4XCAA 4CUBA 1JZ2A 5I0TA 3ZMNA 3MIBA 2XJVA 3I2OA 2WNOA 1UN1A 2A6YA 4EV0A 5FO9B 2R1BA 2D7FA 2XKPA 4Y4YA 4IGQA 2EIDA 4GWNA 1COV3 3THPA 3N7MA 3PUIA 3JU9A 3UGFA 3GBFA 4A42A 5FTTC 1XNKA 1W05A 1NA1B 1MZEA 5IJRA 1SDWA 3UV9A 1G9AA 1V6JA 4XF1A 2VNOA 3O12A 4LO5B 3ZFGB 3R4DB 1UXZA 1QGLA 4CDUC 5L73A 2HWE2 2QQMA 3S6PA 2VG9A 3KQ4B 2C0ZA 3I2FA 3ON7A 1TMF3 1AYM3 2TEPA 5DG1A 3OTFA 1Q8VA 4FAGA 1YLLA 1REFA 4L97A 4A4AA 2W92A 3LFMA 1UXXX 4FPFA 1CWPA 3I8TA 4X8NA 3BTZA 2Z5WA 1EAH1 1OLRA 1O8PA 1WA4A 2IFWA 1S0BA 4A7ZA 3KZ4C 3BTYA 3CU7A 1GWMA 4P02B 1CX1A 4KNCA 3MUY1 2CDPA 5JSPA 2VR4A 4FOQA 4BIFA 1VBE3 3UKNA 3LSDA 4RS5A 4FPEA 5HV4A 3BVCA 3MHZA 1H6YA 3GBGA 3U14A 1PZ7A 1VBC2 4LKSA 4EZHA 4GB33 1UU6A 2A6WA 3QH7A 2RDQA 5HXMA 5JZGB 3BPZA 2VMDA 5FLHA 4GMP0 5ACA1 4EN0A 1NKGA 1YJKA 2ZKNA 4DNYA 3ZIWA 5C8CA 5J96B 5L9VA 4NIHA 4BQXA 2WNUB 1ND2B 3J8F3 1PM4A 2VE1A 4OHYA 4FQZA 2E32A 2Y34A 4N9HA 3DXTA 4FFFA 5J36A 4Y33A 3TN92 1QOSA 4BCUA 3USUA 1JUIA 3FUQA 3MW3A 4C1WA 4I2OA 2B39A 4RR3A 5DUXA 1ZVFA 3T4VA 5A6QA 3K4ZA 2HWC1 1QOTA 3UNPA 1IQDC 1UY0A 2ZTNA 2W1UA 2XXZA 4XDQA 3P1IA 4FQ4A 1KJRA 4C8DA 4IE4A 1AX1A 1DHKB 5F6LB 2E26A 3H8OA 1GV9A 2XOMA 1EUUA 5C9AA 4Q4X2 1DZRA 5BNOC 3KV5A 5H9QA 3I2JA 4TLFA 5GM0A 4DMIA 1OF3A 5FYMA 2XJQA 3POFA 1VBD3 2JEMA 3NAPB 4BH9A 1QXRA 1N3PA 3JUUA 3B5LB 3POBA 1RMU3 4WVMA 1LJ7A 1BEV1 2JDYA 3CZUA 3ZFEB 1O3QA 2D6PA 1D0GA 4QHZA 4QMAA 5KHJA 2QCSB 2DURA 1Z7S3 5FZFA 3RPQA 1CGPA 3UKVA 4CP9B 4OLLA 5IK8A 1QJY1 5CKMA 4UFJA 1RUF2 3ZFGA 1LHWA 2WQ4A 3LEIA 2EXIA 2RS13 4P9LA 2WO1A 5FZHA 5L9RA 4AGVA 4DEQA 1GZWB 2ZBJA 2X05A 1U12A 3FUOA 1UL9A 3MZHA 4ET7A 3GDBA 3SNMA 5JCTA 3KVAA 2J42A 1YC61 1ND3A 1OUXA 4QDRA 2VBBA 4LITA 4BWOA 1NXMA 5JSRA 4QB2A 1RUD1 2FZ1A 5EYXA 4B1MA 3PHMA 5FLIA 4BMEA 2GDFA 3AJYA 1JH5A 4JKMA 1NLSA 2GNDA 4FXGB 3T2OA 2DFCA 5EQUA 2CV6A 1G6NA 3T4HB 3LSEA 4CP0A 2OS2A 1KJLA 2WA4A 2XL7A 2Y26A 1FMD1 3N3HA 5JZGA 3GCXA 2XH6A 2D93A 2PLV2 1QJU3 3ACGA 5JOYA 2F4LA 4B4PA 3PVOA 4PDWB 5GLUA 3WF1A 3E6CC 2RR12 1HJGA 1R64A 1HW5A 4IE0A 3C8XA 1L3JA 4K1YA 4ZS2A 4B4RA 5K0UB 2WNUA 1ND2A 1P8JA 2OT7A 3I3DA 4NHYA 5FREA 5GLVA 5LBBA 1R092 3FJSA 1VAKA 2BDRA 1LEMA 3MO4A 4QXHA 3A0KA 4XF4A 2P2KA 1WW5A 1VRH2 3JBG1 2D43A 1WLCA 4RHV2 3ZYPA 1RUC2 3JXSA 1ZBA3 3Q8BA 4KGGA 2HEWF 3OB8A 2IZWA 4IE6A 4AI3A 2WS91 2DCZA 2ERFA 5I0RA 2YPJA 1LOGA 1OVPA 3KF3A 1CZSA 4UBGA 4PIXA 4LHKA 4LBMA 1D4M3 1NQJA 1RUH1 1SCRA 4I0BA 4PLNA 3T08A 1V6NA 2YU1A 1PO21 4MGYE 4LBJA 4YARA 2J1RA 3UL2A 3LOBA 4FOVA 2HEVF 2YXSA 4YWAA 1W9TA 3NJVA 4LPLA 4EYUA 5E88A 4DXRA 2RV9A 3WDXA 2VMHA 5EJ3A 3PVNA 2V5DA 4FO9A 1O4ZA 2YB7A 4YGBA 4Q0UA 4NR1A 5B2GB 3MIDA 1VAVA 4K21A 4CUAA 4KWKA 3ZFEA 2RMU2 3GF6A 4LA2A 5A3UA 3HQUA 5FZ8A 4ATEA 5HBAA 1TME1 5JOWA 2DVFA 3OGSA 4CP9A 2G1MA 2RVAA 4QM8A 1UZZA 1NZCA 2JDAA 4Q8KA 4P9WA 1LR5A 3DN7A 1VRBA 1R1A2 1NUKA 1RHI2 3IDEA 4L8QA 1W8WA 2FCVA 4IGOA 5F7UA 1BMV1 3PVBB 3HMYA 1LESA 1XJAA 2WZR2 3E5UA 3OBTA 3PIJA 2P6CA 1AYN1 3VDCA 4ASMB 1NE4A 2HBUA 2RJKA 5J98B 3THDA 3ZXEA 1E57A 4BQ3A 4FPCA 3OCPA 2IXJA 3INAA 1OURA 3JQXA 3U75A 3ZN4A 2VZSA 3E5XA 2D97A 4HLTA 4XBNA 4HSJA 3ECQA 4DB5A 5JMOA 2V4VA 4Z82A 5F3GA 1MQTB 1LHVA 2VOXA 2ZGTA 3T0BA 3U10A 5FFOC 1OD3A 1W06A 3GHNA 1SACA 1JOPA 2C6SA 1POV0 4BU2A 2VMGA 2NMNA 1VBB3 2J1AA 3CNAA 3VDDB 2D40A 4YM1A 1MZFA 1YQ2A 1ASJ2 5KHKA 4PDWA 3BOWA 3WP6A 1QJEA 1ZRRA 1AHSA 5EPAA 5A7NA 3SH5A 3U1XA 4GH4C 2BOIA 2ZHNA 4IEOA 1YFUA 2QKDA 3V65A 4Q4V3 2PHRA 4BLJA 2ZGNA 3OPZA 2O8OA 4ZU4A 1JN2P 4OHZA 1RUJ1 2VH9A 2VTFA 3AP6A 1H8TB 2IXHA 5E1RA 1N1VA 2E53A 3VD3A 1BBT2 5I8TA 4R9DA 1QMJA 4B29A 4IV3C 2VL4A 2VU9A 4LORA 5IFPA 3AL5A 4KQ7A 1W2TA 2H6BA 5KXCA 3AP9A 4QX5A 1N1TA 3R4UA 3IKWA 4H3WA 1WW7A 4JCKA 4CEWC 1XB9A 3O1TA 4QGLA 3ILFA 2LALA 4AVAA 3NO8A 4D7TA 1DLCA 1KDKA 3A22A 2UWBA 4AEKA 4BISA 4DY5A 3W5MA 4H14A 1H1MA 1UF2C 2JE7A 4XFHA 1JYTA 1W2UA 3VDAA 4Q8LA 2A70A 5LW9A 4ZY9A 2Z2SB 1V6MA 3J7HA 1OA3A 1X36A 3MLKA 4IE7A 1LEDA 4ZXKA 4D7YA 2A71A 1IGOA 1AL23 2ETEA 2OX0A 2ZJCA 4LNVA 2WLQA 5T5LA 3SH4A 5FZ6A 3WHUA 2WLPA 2P34A 2D6NA 1C8M1 2PHDA 5DZFA 5GZFA 5JXJA 1UX7A 5LY2A 4BK5A 4B7EA 1AF9A 4M3CB 5F2SA 1AR71 4HG6B 1J3QA 3ITQA 4XFGA 1JYIA 4CDWA 4GWMA 1GOHA 1QJX3 4UT5A 5FWEA 1OT5A 2BFUL 2GNTA 2JDKA 2UY8A 5FYCA 5ABJB 4RGKA 2J1TA 2NM1A 4PQQA 4CCEA 5APAA 2AYHA 1A6CA 1LHUA 2VXJA 3AX4A 3PU8A 4JRAA 4LMFA 1JZ4A 4ZXEA 2AENA 2Y38A 1MQTA 4GD4A 4AVSA 5A7QA 4H2AA 1Q8QA 3W20A 1HXS2 2QZ2A 5JPNB 3KT7A 3U11A 4DRRA 2D3PA 4AVBA 2J1UA 4NOTA 3KV9A 3L9JT 4LIVA 4HT1T 3OUJA 1CVNA 1VE0A 3VDDA 5FOBB 1CQ9A 1BZWA 2NYYA 1W8ZA 5FZLA 2GMMA 2PHLA 2W47A 1HQWA 3AC0A 4EWAA 5KR7A 1VBA2 4Q2FA 3ZO0B 4XDPA 1AJKA 3VD7A 1EP0A 3WF2A 4MADA 4CPBA 1D2SA 2K0GA 4GMP3 1C5IA 2HWB1 4GJZA 4X6RB 1CD3G 2JDPA 1GLHA 4CDQC 5C5UA 1WGPA 4HK8A 2DVDA 1DIWA 1UW8A 3MIEA 4WM8C 4ZU7A 2XWJB 2VULA 3AB0A 3ABZA 3WNLA 1XRUA 4Z8BA 2ET1A 1C1FA 4HANA 5L7OC 1ZZCA 2UY9A 4P14A 2CGPA 1QQP1 4XJZA 5LBCA 4LBLA 4IV1B 5I0UA 3WNXA 1QKQA 1OUSA 1K3IA 3KT4A 5ACA3 3POYA 4WM8A 2CTVA 1COV1 1E5SA 1SLTA 4A6OA 1STMA 4JHZA 1H4HA 5K4LA 1AR92 3NRUA 4X6QB 3DPRB 4QM9A 1PVC2 2WAOA 3JCIA 2VNGA 1LRHA 1YEWA 1S2EA 2R30A 2XG3A 3FX3A 4XHBA 1YUDA 1ODNA 2VTXJ 5F3IA 2NLRA 1LODA 2R062 2R49A 5FZOB 3AXDA 2DUQA 3PURA 4BM8A 2VNVA 4JGZA 3ZKUA 1B35B 5DZEA 2EIBA 2FMDA 1AYM1 2VOWA 3PLQA 3R05A 4K6BA 2BWAA 4YM0A 1US3A 4LQRA 3O1OA 1ZZ9A 3OGRA 4NIIA 1IOAA 2O8QA 4QPYA 5A1AA 1PK6B 3T30A 1ZZ7A 3ZX7A 2HWD2 2ORZA 4KMQA 5JSOA 2ZX4A 3R6SA 4Y22B 2D6MA 1Q5OA 1RTVA 3C7OA 3AZZA 1VBE1 3I2HA 3DV8A 1XSRA 2YGMA 1FT9A 3O7OA 4NN0A 4P5YA 5IAVA 4DXZA 3MI8A 3FMGA 5H9SA 2D6OX 1IS3A 2JE9A 2ZGMA 4MVTA 4P9JA 3VBRB 1UU4A 4HK9A 2KA3A 3BKZA 2YG0A 1GQHA 1BEV3 1D0HA 5EIYB 2OXBA 3VLBB 3HPNA 3HBZA 1DQ6A 5IYYA 1S0DA 3GGLA 2XWBB 1BVVA 4RQPB 5IAXA 3WF0A 1ZNPA 4Q4X3 1Q56A 1QJY3 1U5YA 3VBOB 5AVAA 2X53S 3HOBA 1LU1A 1PIV3 1CJPA 3IIAA 3F2ZA 3LF7A 3Q8FA 2O0OA 3NNJA 4R9CA 1UPIA 3NJYA 1L7LA 3K4AA 3LGRA 5KXBA 5CIRA 1XQNA 5F3EA 3AKPA 1OC1A 3KHBA 3KVBA 1W04A 1JYXA 1HB2A 2MHFA 2RS52 2WNVC 2WYFA 2YY1A 1C5HA 4D6RA 1VIWB 1TVGA 2A1XA 3CJIA 5JUVA 3S5AA 2VZTA 5FK7A 2DVGA 2FDJA 4AAPA 1DQ4A 1WZXA 3EB7A 3RG0A 1CZTA 1ODMA 5FDBA 4E4DX 2X5IC 2IUWA 4DQAA 5AC91 5CFCB 3BI3A 1UZYA 2GC3A 2PN5A 4QQPA 4OQ8A 2RDSA 2HLEA 2PFWA 1RMU1 4E2GA 1LAJA 5BNNB 1RUE3 2DWRA 3J26N 3NV1A 4FOWA 5C7GA 1MS4A 5FZGA 3SKVA 1XYNA 3M3EA 4H7LA 1WBFA 5C4WC 1GQGA 3DPRA 1AL0G 4HKLA 1GUIA 3H1MA 2XBO3 1BKZA 4PI2A 1QEXA 4XHXA 2VJXA 3ENRA 5FZOA 5D1IA 2RS11 1EPWA 1VPHA 3JBG3 2P1BA 2ZAHA 4O7XA 3IAPA 1B35A 1UQXA 5FZCA 4U2AA 4AOCA 4EN8B 2ZEYA 1OSGA 3LA3A 2KM2A 4DINB 2AGSA 2WZ8A 2WS93 4EE2A 3KD4A 4R9BA 2YMZA 3WXPA 4W8JA 1W8FA 5LBEA 4A45A 3K2OA 4D94A 5JR2A 1PO23 2QE3A 1R093 3KM5A 5A6ZA 3Q8CA 1OH4A 4HPKA 3H8RA 1ENRA 4IEUA 2HWF2 3I49A 4FP3A 5FXZA 5LRSA 4XXPA 4YGEA 3VBRA 1MS5A 3GZUC 1SBDA 3QOPA 2PAEA 1UMZA 3RI9A 3LA7A 2NZ9A 2XB6C 4XILA 4Q29A 4Y5SA 3VZMA 1QH7A 3KQRA 3OSDA 3ZXJA 1W2NA 2RM22 4OQ9A 5FR3A 4MG2A 2G19A 4JDOA 3RYPA 3GJBA 4IESA 4CA9A 3WINE 5A3MA 5FY0A 3H1YA 2YBKA 3MPBA 2AEYA 2B4KA 2VBDA 3MF6A 1POV3 5B4XA 4K20A 2P3JA 3TOJA 2VCCA 3T2PA 2JG9B 3OBAA 3AMQA 3WNMA 3ZIXA 3ZPOA 1MEC1 4CVUA 1PZ8A 4UFIA 2OZJA 1YFWA 3AZVA 4OUEA 1TNRA 1D4M1 3WZ1A 3WG1A 1XOYA 1RINA 5A3TA 4QKDA 4AHWA 1X9PA 1LGCA 4M3CF 3MV11 3VBHB 4AGRA 1H4GA 3T09A 3GXUA 5BNPC 3M70A 4KBBA 5C9AC 4C0HA 4KG0A 5BNNA 5EZWA 5BV6A 1AR62 1EPZA 1YQ5A 2ZZJA 3WQ1A 2CGNA 2JDHA 3SITA 4GULA 2FQPA 4CCLA 1CZVA 5LA2A 2PELA 2EXJA 1IKQA 1HRI1 2VVEA 1M4WA 2AUYA 2VTXA 1CAUB 1G9FA 4QPGB 2BFUS 4BB3A 2WL1A 3O0VA 4FFIA 4FTEA 3ELNA 4AG4A 1UOBA 4OMCA 4Q0QA 1V6LA 5E89A 3RZJA 1FOD2 1RUJ3 1UY3A 1A78A 2JJ6A 2R071 5EV7A 4HN1A 3W21A 2OVUA 1LOAA 1JZ8A 2IC1A 4DEVA 3ZN6B 1ASJ3 2VO5A 3D5OA 5DPNA 1DDLA 3BIWE 4XYXA 1R082 3BALA 3JD73 3MV01 4CCNA 4M4RA 3EJKA 4LBOA 1Q3EA 1W9WA 2IXIA 3WQBA 1YQ8A 2Y8KA 4MOAA 1PO12 4Z1VA 5JDBA 2Q1FA 5A7PA 3M3QA 5D21A 1GOFA 1RC6A 2D5FA 1GZTA 2X29A 1IPKA 3BOPA 3I2KA 3KB5A 1KQRA 1OQDA 2ZHLA 4BQ2A 1BBT3 1VBB1 1V9U3 1G9BA 3KMHA 2W95A 4COZA 5JXIA 2WDBA 1NE6A 4W6WA 3VD9A 1J1TA 4XFAA 3PNAA 4MV2A 4PJYA 4ZONA 4AAXA 2JX9A 3BGAA 1JYNA 3TRSB 1Q43A 1ZYBA 5JR7B 3FHIB 2IXKA 4Q4V1 1Z0HA 2X10A 4BQ1A 3Q8AA 1VMFA 2WABA 4K3UA 5J7MA 1PGSA 2ZGQA 3WR0A 3E6DA 3GM8A 3OGJA 2JG9A 3AZXA 1Y3TA 1LGBA 1FX5A 2BERA 3PL0A 4LUKA 4ZZ5A 1POQA 4AEDC 1K45A 3GHMA 4DRVA 4UW6A 1KDMA 5IK5A 5DG2A 2B42B 1ULEA 2G9GA 2LUWA 3ZSKA 4AFBA 1WCUA 1PVXA 2JE8A 1XYOA 3H7YA 3PTRB 3WDYA 3QH6A 1OVSA 2VY0A 3VBHA 2WFF1 1FPN1 4XJWA 2VQUA 4QB6A 3KHCA 1JTZX 1C28A 3ZSLA 4BXFA 4FFGA 4TSVA 1GKBA 3FL7A 3WF4A 3AYCA 2AACA 2YC2A 1QDCA 3G7DA 1QH6A 1GNZA 1EV11 1FXZA 1KEXA 4KI5M 4N7IA 1WMXA 1MACA 4RD7A 1XU1A 3VBFA 4Y26A 4QPGA 4DOUA 5FLJA 1CAUA 4ES9A 1HXS3 2LRPA 5FMBA 4AR2A 1S0IA 4LK7A 2BVVA 4LO7A 5F9TA 2EAAA 4YZ1A 1RJ7A 4MUVA 5ANQA 4WV8A 4P9GA 1SZBA 5KC6A 4B4QA 1OPMA 3ZN6A 2PXJA 4OUSA 3V0BB 4R4XA 5G04L 1QQP3 1VBA3 3AYAA 4IEZA 4JDNA 4WVMB 2BJSA 3KCYA 4I0AA 1ONAA 3T0AA 3ASIA 4GKYA 4A6SA 4FPYA 4CE8A 3D0JA 2W3JA 3D6EA 4GWIA 5BNOB 2DV9A 4AQ2A 2UURA 4KU7A 3WNKA 3S57A 2XR4A 4JHTA 1FNZA 4RFT0 4ASKA 2RJLA 2ADDA 1RL3A 1PMJX 4PIYA 4MGZE 2PHXA 2GU9A 4BJ0A 5FUNA 4DZGA 4A7YA 1PGW1 2FDKA 5I8SA 1SFPA 5JLVA 4AHYA 1DGRA 1ZBE2 1LGNA 2BEOA 2VM9A 5T50A 4BQYA 3RI8A 5ERLA 4TTGA 3LIGA 3WV6A 1K5MC 2A75A 1URXA 4COUA 3AYEA 1ND3B 5FY7A 4GMP1 4NPMA 2QQLA 4CDUA 4TN7A 1PVC3 1EAH2 4FSJA 5HCFA 5LBFA 3ZM8A 4OI0A 4MGKE 4L99A 5IWFA 1CJDA 2JDMA 3FHQA 2HWE1 1X7NA 2WINB 2YPDA 1WLWA 5CA6A 2WN2A 3RMYA 4EWEA 3AVSA 1QU0A 5FV3A 2ARCA 4GXLA 3VBUC 1PMIA 1IS4A 3O0WA 2GH8A 2VW1A 5C3PA 2TUNA 2VOKA 2ZS6B 3CHXA 2D3SA 5FZ0A 4A7KA 1AR83 2WAAA 1QJZA 5JI7A 5FQ0A 2XLAA 1ULFA 2X8KA 2PA7A 1WMFA 4QPWA 2E33A 2WN3A 1MVQA 1YO8A 1ZZ6A 3ZDSA 4XIKA 1AXYA 3L2HA 1BYHA 4XTPA 4IE5A 3O1SA 3O1RA 2C1FA 4YVSC 4Y1XA 3D4KA 5LRRA 1OD5A 3NJXA 4UW4A 1C1LA 2ARBA 1UOGA 4I02A 1WLDA 2YC0A 4FXKB 4ZS3A 3NL1A 1XE7A 2F4PA 1NZIA 3RVHA 1G9CA 4IEVA 5FPAA 2YBPA 1ZA7A 5FJKA 1UMIA 4L92A 5GZGA 1JZ7A 4QB1A 1PNGA 1OFSA 1VB2A 1AJOA 1UY2A 3OUHA 3TN91 3AM2A 4K7JA 4NMIA 5AC93 2FDFA 2QQVA 1YI9A 4PCRA 3V0BA 4XC9A 1XXNA 4P9XA 5B4NA 3H7JA 3I54A 4WVWA 1MR5A 1RVF2 2WA3A 1C4RA 1F31A 2VBPA 3AJZA 4WBBA 4K9SA 4XUQA 4YZ3A 3WCRA 3ACHA 1N3OA 3SH3A 2BU9A 5A3NA 3I7DA 1A8MA 2VXRA 4MGQA 5BNOA 3AYDA 1V00A 2EXHA 4IUGA 4YLZA 1FYUA 4LBQD 1NG0A 3GZEA 4Q4X1 5IVBA 2A5ZA 1SDDB 2V5YA 2VECA 3Q8EA 1PIV1 1CIWA 2XUEA 2Y64A 2GN3A 3WW2A 1HV1A 3ZFFC 1NA1C 3WLUA 1GMMA 3GBWA 1VMJA 1ENQA 2R32A 4RGGA 4RFRB 1Z78A 3B02A 3LEMA 2E6VA 4LBKA 4R9AA 1SBEA 1XYPA 4HVRA 2MEV2 4YSFA 2PHTA 2Q1ZB 1O59A 4QKBA 3O1PA 4MX3A 3ZPYA 4GQ7A 2BV4A 2XGXA 4LUMA 3WNPA 3H8UA 2W9XA 3IN9A 1LOFC 4M01A 3DEMA 5CADA 1W6PB 3K46A 4XMIA 3IWZA 1HKDA 1W8UA 3WW3A 4CU9A 1JOJA 4YVWC 2ZGOA 3CMGA 5EYYA 4P5HA 3PJQA 3N35A 1RUE1 4JZRA 2BBVA 4W6XA 2C24A 1IHMA 2P3YA 3C2UA 1OF4A 5H9PA 4ES8A 1ULGA 4LXLA 1SLIA 1VR3A 2CY6A 1GWKA 4D0QA 2XBO1 3IMMA 5K8SA 1YIPA 4Y1ZA 4PI0A 2VOTA 3M1HA 1RUI2 5DDJ2 4CXYA 3SHRA 4PF5A 3EO6A 4GH4B 4DS0A 2Z79A 3EXUA 1MEC3 4JRLA 3UK9A 4Y1YA 3ZSMA 4E2QA 1HB1A 2RR11 4NIDA 1WLTA 1F5JA 4K8FA 3ZR6A 2J1SA 1JYVA 3VKLA 3KV6A 1MZ5A 1R091 5IK7A 4AF9A 2XONA 2JXAA 1XNTA 3N9LA 4UF0B 1VRH1 1F4HA 3RMXA 2GNMA 3RS6A 4JGYC 4RHV1 1J59A 1RUC1 4XQWA 3F95A 1NCQC 1O5UA 5DAQA 5T3NA 4U36A 4HFSA 4J25A 4PLMA 4AQSA 4JTNA 3CIHA 3IDCB 1CPMA 1YFXA 4IEXA 3NAPC 3VKFC 2W68A 1HRI3 2DYCA 2DUOA 2V73A 1TME2 5CU1A 1QF3A 2BP6A 3VZLA 4FTBA 3J9SA 3B94A 3CZJA 5DUVA 4OCTA 2R073 1R1ZA 4KGQA 5DZGA 5FPLA 4CCKA 2H0VA 1IS6A 4RA0A 4DXTA 1POV1 4EWDA 5JXHA 4ZPIA 1DFQA 1NCRC 4NUBA 3WW1A 1H1IA 1AYN2 1ULOA 1WD3A 4XJUA 4AGGA 1E5RA 1W9SA 2RMU1 4QX1A 4EN9B 5A7SA 2FHRA 4XIOA 4XF0A 1UZWA 3ROUA 2ZZQA 1LHNA 4LIUA 1UWWA 4GAZA 3DF0A 4FPJA 2DCKA 3ZYIB 3N4MA 3MICA 1NT0A 3D0SA 1GP6A 4W4ZA 4B3NA 1FOD3 1GICA 4QX2A 1R1A1 5GLZA 1RHI1 2OUJA 2YYOA 5T52A 1W6PA 4YPJA 2WZR1 2WBKA 3RYKA 1QNWA 4HETA 1H9PA 1U0AA 2JIGA 1HRV3 3DL3A 3I2GA 1CX4A 4HMZA 5FXWA 1GYKA 5FO7B 5FCCA 1RXFA 5CFDC 2A73B 3ZSEA 3BUCA 1KRIA 2XQRA 1BLZA 2GNBA 4YG3A 4J6GA 5FPUA 4LE4A 2EVXA 2XL9A 2QDRA 3SCFA 1C57A 4E27A 3ZOIA 4UFHA 1RUG2 2ZA9A 3VZJA 5K0UC 5CFDA 2EALA 4XXAA 5FPXA 4GH4A 1LKNA 4Q4W2 1ASJ1 4AE2A 3POEA 4CDQB 4LHLA 4E8DA 1PGL2 2Y6LA 3ZXFA 3JD71 2Y6JA 2E31A 4WM8B 2D98A 2WIIB 2EXKA 2EAKA 1QXPA 3OY8B 1S2KA 3WD5A 1DYKA 1K5JA 2W5FA 2OZ6A 3A23A 2J1VA 1APNA 1UY1A 2WSVA 4LKFA 4UF0A 5L7OB 2WFF3 1FPN3 2XVKA 1HQNA 2BBAA 4IV3A 5A3OA 1ZRIA 3S0MA 2BNOA 2CSGA 2YBSA 1RGSA 4NHLA 3WY6A 1BBT1 4HBNA 4JGZB 1V9U1 3OBRA 4NPRA 3HVDA 1Y7BA 3OGVA 3RZKA 2I45A 2E63A 1XSQA 1AXKA 3ZXGA 4CEWA 4HVQA 3WG2A 1EV13 1IG3A 2RE9A 3NVCA 1QNYA 1SLBA 2YZ4A 1YYNA 3PIGA 5IFTA 5FP8A 3HWJA 4L2NA 2ZMLA 1OPOA 4OZOA 4K8RB 4N43C 1MS3A 3FFQA 4XAAA 4OHVA 1C8M2 1JODA 5FBJA 3TAYA 3ZSJA 2WFPA 2R6QA 1HQLA 2JDZA 1J83A 1F35A 4GKXA 1AR72 5FY4A 5FY8A 2XHNA 5FUIA 3N9NA 3AP4A 3MBWA 3W59A 1X8EA 2VMFA 1X82A 4AWDA 3PUQA 3N9QA 3LZZA 1A8DA 1OA2A 1W0PA 4L11A 1NY72 2ZEXA 4Q5OA 3RWNA 3VHOA 4DIQA 4FAHA 4A3XA 2W39A 2LM3A 4A3ZA 2OKXA 5T5OA 3Q9OA 3VKOA 4YG6A 4IEYA 3AP7A 3HIFA 4SLIA 2XVLA 5HXVA 1S0GA 4UWDA 1NXD1 4OZXA 2K2SA 2W94A 3KCXA 3PMEA 2BPA2 5J09A 1LECA 2XKOA 5I0SA 5T54A 5F3CA 3P5BA 2VZPA 3N9MA 2FCUA 4RYDA 4S2HA 3O1MA 2JDUA 4F3JA 1TZOA 4XQDA 1IZ3A 1FAYA 2HWB2 4YGDA 1W3VA 1HXS1 3CJIB 1BQPA 1DU3D 1H6XA 2W1QA 4OULA 2HWE3 1TEIA 2YGLA 4E2SA 2XLGA 2ADEA 3LAGA 1YCIA 4ASLA 2WNVB 1C8NA 1O3TA 1VBA1 3UGHA 4CDQA 2ZACA 3ZYRA 2ID4A 2DVAA 3HD8B 4CDXC 1M06G 2OPKA 2B9UA 5F32A 5J37A 3PVEA 2F6BA 3O1VA 4NHXA 4QD2A 3OY8A 4IL7A 3U78A 1COV2 2X5IB 3MLJA 4XQ4A 2Q30A 5CYYA 5L7OA 4AQTA 1ZA4A 3POIA 3K48A 1OHFA 1W9FA 4AHZA 3N9OA 1DQ1A 2P17A 1DZTA 1NYWA 1SFNA 4X8PA 4LOSA 1VBC3 4MGTA 3TNPB 5E16A 1YXWA 4KU8A 2QQPA 3D8CA 1W2AX 1TMF2 1IG0A 4M0HA 1O6UA 3I3MA 3IDAA 5FRAA 4CP1A 4YZ4A 4MSVA 1OQ1A 5I91A 1YRZA 2GMPA 3P3PA 2N7GA 3E1F1 3VBSC 1AR91 1J3RA 5FYZA 3W5NA 1EUTA 1PVC1 1DYOA 4B7KA 3KCCA 1XE8A 2R061 4PBOA 3K4DA 1SCSA 2ATFA 2BYVE 4FPOB 4HPKB 3QACA 4YW5A 5LWBA 1WKYA 5CVRA 2E7QA 1VBE2 2Z42A 3OPWA 4MLOA 1WCKA 1SBFA 1DZQA 1VB4A 4YW3A 3MYXA 4F7ZA 2WWSA 1CAWB 3IAQA 4GB32 2GC0A 3RYRA 2CU5A 3D3AA 3H8XA 2VC9A 1S0EA 4F83A 5EFUA 5ABJC 2VMCA 3H42B 2W0XA 4PBPA 4DFSA 2HWD1 1AR81 3M2MA 2BOJA 3C3VA 3AFGA 4I01A 4RL7A 4CSWA 1LOCA 5KXEA 4A44A 4H7MA 2XHKA 3J8F2 3OYWA 5FKBA 4O61A 5TSWA 2OPWA 2PHFA 3WF3A 3AFKA 4WVVA 1JYCA 2DVBA 3QCWA 3V56A 1W6OA 5F5QA 5FWJA 1S0CA 2TNFA 1KXGA 4ITCA 2NP0A 3ES1A 2AH2A 3NV4A 1WUVA 2Q8EA 3NKTA 1RUF3 1FV2A 4KWLA 3IIIA 1ZRFA 3B9IA 1W8HA 3TNQA 2HBTA 3VHRA 1XNCA 1UNBA 2WNVA 2V09A 1GWLA 2ZEWA 4IXLA 3TYJA 1VBD2 4BYYA 1U5XA 2KR2A 1RMU2 3SC7X 2RS51 3MDPA 4JKKA 4OUMA 2MEV3 3FN9A 4XE9A 2D6KA 2X5IA 1UD1A 3KLSA 2JG8C 3RFRA 1LOEA 1Z7S2 1JI6A 3FE5A 2PTMA 5IVYA 1W03A 1YNAA 4PIZA 4UFMA 5BNPB 4YM3A 1GZ9A 5C9AB 3M7AA 1I5PA 1MS0A 1FV3A 1H2KA 2YDEA 3QLQA 4QQOA 1H9WA 4K1ZA 3R0RA 5FKCA 3T2QA 4CRQA 5IHRA 5KBFA 4NHMA 2QFEA 3S5QA 2PLV3 2WQ8A 3N7JA 5C4WA 2LTNA 4QXCA 5KXDA 1ZREA 2RR13 4GA9A 2JKXA 1JS9A 4XMAA 1OKQA 4Q4Y2 1WCSA 4KWJA 3RQ0A 2WC2A 4WVZA 1IPSA 2LS6A 4XURA 4E9KA 4HSLA 1A34A 4LLOA 2VUDA 3SEEA 2ZX1A 4IW3A 1E5IA 4QPIC 4OVEA 4PT6A 1W39A 4XACA 5CISA 4FCAA 2P5BA 1RUI3 5A3LA 1DYPA 3J4UH 1VRH3 2GMEA 2JWPA 1A3KA 4ORFA 4RHV3 5D8AC 3V64A 1N1SA 1I3HA 1RUC3 1ZM1A 4IEPA 4ARYA 4MHRA 4G3YC 1W28A 2C26A 4Q26A 3O14A 4EROA 2DU1A 2WNEA 1CAWA 4LULA 5FZ7A 4COYA 4CTEA 5D2AA 1QJU2 3HNYM 4IEQA 2JECA 5F5CA 3OF1A 3U07A 4YW6A 3AVRA 2A6VA 4QGNA 3CO2A 3ACLA 1F15A 5KHHA 4C90A 2VOVA 1SMVA 2YFUA 4SBVA 4AQ6A 4WZFA 4EQVA 3B7MA 3DECA 3WUCA 1AX0A 1CIYA 3TEWA 1WBLA 1W8NA 3GJAA 1IS5A 4RQPC 3U4XA 3AMPA 1UYXA 4LKEA 1Q8SA 4OYUA 1XU2A 4GZ9A 1OMIA 3VBOC 5JWPA 4MH0E 1XE0A 1ZBA2 3WP4A 2RMU3 5FZEA 4LKDA 4XFFA 2Q4SA 4CEYC 4CU7A 4COVA 1YQCA 1FI2A 2CAUA 3B9CA 5FXXA 5I0DA 2K46A 3PMSA 1BK1A 1I6XA 2E7TA 5IVCA 1XNDA 1SG3A 4MXVA 1TNFA 1R1A3 5L9BA 1OOPC 1RHI3 1H30A 5HV0A 2FD8A 3MW4A 2VCAA 2CWSA 2GH2A 2WZR3 4HZFA 2EIEA 3LPGA 3T1LA 4CEYA 2W08A 5CNAA 1W0NA 4AVVA 2VZ3A 2HYKA 1Y4WA 4WM7C 3A7QA 1DCSA 1T6BX 1NLRA 1REDA 2RDNA 2HH9A 2JKBA 3GNEA 3KGZA 4XCBA 3VBFB 3X29B 1RB8G 4QX0A 2NPIA 3KWVA 4CUCA 4R4ZA 4FPKA 4PF1A 5C3QA 5KHIA 2Q1MA 3C7HA 3MIGA 3P6BA 1UX6A 4JAAA 2R042 3W9AA 1QOOA 1U5IA 3THTA 1NQDA 1IPJA
chains in the Genus database with same CATH topology
4N9IA 2ZCWA 4OHWA 1DGWA 3GZTB 5CG9A 4AI0A 4Y5Z0 1AR61 1RUNA 4IERA 2PAMA 4JVAA 2C9AA 3LCPA 3AXEA 3H0OA 3O5SA 4YRDA 4XBLA 3WDUA 4JDMA 2BNMA 3LKJA 4XEZA 1VAMA 1FOD1 3RDIA 1X8MA 1KS4A 3ES4A 3WCSA 1O91A 2OYZA 2UU8A 4AVTA 4LO4B 4Q4W3 3PTYA 1VBB2 4MXWA 3VKMA 2P3KA 1HRV1 2VNRA 1U5ZA 2RS32 2YV8A 2EA7A 4YZ2A 2VUAA 2ARXA 1HLCA 3N36A 3E5QA 3SXWA 4CDUB 4M00A 5LEJA 1J3PA 3IPVA 1SEFA 2D44A 4S2FA 2TBVA 2XUMA 1DGRN 3MPPG 1QXJA 4O9GA 5C8WA 1V6KA 1K5MB 1FNYA 4Y1VA 2BNNA 4ZU5A 5BNPA 4V1PA 2WT0A 5I8YA 1Q8OA 4LLFA 1SQ4A 2CL2A 5KC5A 1F9KA 1OFNA 4META 2OUHA 1CR7A 1O4YA 4LHNA 4LBQA 4XF9A 1H1AA 3RJRA 3I2DA 4LE3A 5FQ0B 4YZ5A 1DBNA 3VN4A 2VVDA 3O0XA 4AEDA 2HJIA 2B7YA 3LA2A 4LT5A 1YIFA 3PJYA 3QBQA 2C5DA 1UCXA 3FBMA 4OHXA 3OD0A 1PM7A 1SLAA 1AL22 4NO4A 3A4UA 3SCHA 1N1YA 4YVSB 3LB9A 5KWRA 1I1EA 4IQPA 1UPSA 3E97A 4XJ9A 4LR4A 4FOYA 4GALA 1I9RA 3K51A 4XF3A 1QJX2 3S30A 3SCGA 5IK4A 1CAVA 1V70A 3NKGA 4AK3A 3N7KA 3ATGA 4BA6A 3AZWA 4KG8A 3WG4A 1CPNA 1G7YA 2XJSA 2A3YA 4G9SB 4QQ2A 3IM0A 2QJVA 3M4FA 4WZCA 5JIAA 3M8LA 4R8HA 2ZABA 2BUKA 2A3XA 3WDTA 3ZXKA 1S55A 3HR9A 4Q1RA 3SLIA 1GZCA 4YW2A 4W65A 4INDA 5SV8A 5LK5A 1KITA 1QY4A 1RUOA 1AR93 2H0BA 3JZVA 3ZFFB 3VV1A 3WX5A 4J1XA 2R063 4F8AA 4QGMA 4YFZA 1K5MA 2ZOEB 4NWVA 1ZBE1 1ZZ8A 2Y0OA 2BQPA 1F5FA 2BWCA 4BLIA 1F8VA 4RS5C 1YWKA 2ZMNA 3GZAA 5GZDA 5ACA2 3WP3A 2HWD3 1EY2A 3AMHA 1D4VB 3KGLA 4YVWB 3VBUA 1AZDA 2W52A 3T2TA 5C8CC 1VBC1 1W6MA 3S7EA 4TYSA 3AMNA 2HWC2 3ZMOA 1QDOA 4RR3C 4YVSA 3OJBA 2QVSB 5JPMB 1DLLA 2O1QA 2B5HA 2IWGB 5HCAA 4YFWA 1ENSA 4N53C 2G9FA 5BXXA 3E6CC 4M0NA 4Y1UA 3ZYJB 5KHGA 3POSA 2RS53 4Q1PA 1BEV2 2YUEA 2GALA 2GC2A 1GANA 4ONUA 3IMNA 4JGYB 5DUWA 3H1WA 4Y20B 1VALA 1NCQB 5A32A 3AKQA 1QJY2 4N53A 2HEYF 1PIV2 3MFCA 1O7FA 4EJRA 5A33B 2EIGA 1RVF1 2CGOA 3ZFGC 5L19A 4AVCA 5DXDA 4O9EA 1HIXA 3VKNA 4D69A 4BE3A 5FPZA 1KD7A 3UJOA 1LOBA 2BW8A 4C91A 3OGGA 1AXZA 1DQ2A 1HDKA 1NA1A 1RUD2 1WD4A 1Y43B 3ZFFA 4AI1A 1NCRB 1RUF1 1XNBA 3WQ0A 1ND3C 4CP2A 4HKWA 2DTYA 3DUIA 5BPXA 2FBEA 2MNGA 1FMD2 2QDNA 1REEA 1IPJA 2DTWA 4Q4Y3 2A6XA 4FPGA 3M3IA 1RUE2 1DG6A 2MEV1 3VGIA 1OLQA 1JW6A 1LOFA 5JZGC 4HL0A 3B01A 4Z92B 2XPJA 2K9ZA 4YVWA 2XBO2 2HWF3 1JUHA 3FLPA 2WNUC 1ND2C 3JBG2 5CFDB 3KT1A 4AYUA 2PLV1 2FZ2A 1DGLA 1H8VA 2MPFA 3E6BA 2G4IA 4FT8A 5SV5A 4JQRA 2PHWA 3R4SA 4P9IA 4E4SA 2WS92 4HVQA 2RM23 1RJ8A 4HVOA 4AEMA 1D2QA 2AZ5A 3I4IA 4QHBA 5CAZA 1RUH2 1YFYA 4I09A 4L9BA 1PO22 2Y0IA 3EBRA 1RUI1 5DDJ1 3B00A 4IV3B 2I07B 2ZGUA 1LENA 1YHFA 1ULDA 1WMDA 1GR3A 4AEJA 4CEWB 2IFRA 4QQLA 3WHTA 3BTAA 3BB6A 3POWA 4JGYA 4Y20A 5FBZA 2ET7A 2R0FA 3USSA 1NCQA 5GJ6A 3UJQA 1LB2A 3ZFEC 5BY5A 3ZXAC 1ZRDA 1BMV2 3ME2A 3H9AA 4XFIA 5A33A 4ATFA 3NAPA 4YW1A 1AR63 2IXCA 1UU5A 3DKWA 3MFAA 3TB0A 4QU2A 4N43B 3N7LA 2ZGLA 4FPHA 2VW0A 2ZGPA 1HV0A 4M3CE 1NCRA 2R043 4D3WA 2IXLA 4XFCA 1WW6A 1OQEA 1ULCA 3NSTA 2UYBA 1GZWA 3IDBB 3H3ZA 3CLPA 5FOJB 1N47A 1CESA 2ZKLA 1R083 3RJ2X 5BYNA 5C33A 1O5LA 5J3UA 3H50A 1PO13 2DU0A 1PNFA 3I59B 4AFCA 1UAIA 4PDWC 1X33A 1IKPA 1UKRA 2DCYA 3B93A 1S0JA 2ZMKA 4BHPA 1RUJ2 2VVFA 1H0BA 2GN7A 1AVBA 2XLFA 2VUJA 5JI9A 3NV2A 1LULA 5HCBA 2P37A 2RS33 3MLLA 4BZ4A 1O4TA 3JD72 4XPVA 4UW3A 4Z07A 2WKKA 4MGIE 5K0UA 3GALA 2ES3A 4ISQA 4TWTA 3VL9A 1RUG1 2SBAA 4OFGA 4CDXB 3S7IA 1AX2A 4Q4W1 2R1DA 2E51A 1V9U2 4HN0A 1PGL1 4JV4A 1ALYA 1HX6A 3FWEA 1KS5A 4URTA 3VHPA 3VZKA 5GLTA 4UXAA 5HI0A 5T5PA 3ALQA 1MZ6A 3AP5A 5F6KA 1G9DA 4AHXA 3VBSB 2HKXA 4N43A 1CONA 4CDWC 4QQHA 4I0WB 3APBA 2VQAA 3NW4A 3VZOA 5JIUA 4OI4A 2WSUA 3WW4A 2JD4A 3EQEA 5FMOL 3HT1A 3OYWB 5EWSA 1MQTC 5C6CA 3JB8A 2ZX3A 5GALA 1VLNA 3B69A 2Q8OA 4YG0A 3MIFA 2FMYA 4W6YA 4RGAA 2VQ0A 3NV3A 3TWIA 1W6OB 1BCXA 3WG3A 1NY71 3VDDC 2WT2A 2P3IA 2R0HA 3I59A 4AW7A 2I2SA 1YJLA 4D7SA 2YHJA 3VHNA 4TZDA 4PQ9A 2WQZC 2OA2A 2GZWA 5JOZA 2D5HA 2BTVC 3DGTA 4QXKA 1N3QA 5T55A 1ZBE3 4I30A 5IT6A 3FLRA 4DY3A 4Q0PA 1H8TC 1QQP2 4COWA 2R16A 3ILRA 2ENRA 3HN1A 4ZKTB 2VMIA 5CG8A 3T1MA 2D6LX 1EAH3 2GSYA 5BUVA 4EN6B 3ETQA 3ZXDA 4CDXA 1H8TA 1WW4A 4EN7B 3RSJA 3AMMA 5C4WB 1NOVA 1AYM2 3AKRA 1Y9QA 3QD6A 2JG8B 1LTEA 5GKAC 4JGZC 1VP6A 1JBCA 4XTMA 2B46X 3WVJA 2AR6A 2B45X 3VUOA 4H55A 4LO6B 3V0AB 2WZPP 3MGUA 3CL1A 1S0FA 2NQYA 1ZZBA 1QHDA 4FPLA 3VBSA 1GNHA 2HWC3 1TMF1 2VGDA 4FVVA 4XFBA 4JC1A 4AFAA 4QPIB 2Q0AA 1W6QB 1SFYA 2DCJA 1AUYA 2WT1A 2QNKA 2UWAA 3ZXLA 1T6GC 4Q0SA 5D8AB 4K40A 4FBFA 1AR82 4M3CA 2PQQA 2XJUA 3KSCA 3AK0A 3FLTA 3WDVA 4LA3A 4YM2A 2E9QA 1LCLA 5ABJA 1RVF3 3MF9A 1GSLA 4NVPA 4GB31 3CJXA 1UIJA 2CWMA 1SLCA 3HQXA 2CAVA 1WCDJ 2E7AA 3IT8A 1UIKA 4XOGA 1OA4A 3J8F1 4YYOA 1X50A 1YI7A 1MS8A 4GIQA 3LOIA 2A3WA 2ZGRA 3FBYA 3JB4C 4CEYB 3EHKA 5AC92 3CJIC 4KH9A 1DF0A 2DFBA 5AVPA 3FZ3A 4XBQA 3NJZA 4OI2A 3A0NA 4JTOA 4N7UA 1QWRA 3UKTA 2B8MA 1OOPB 4R52A 1RUD3 4LEJA 4AI2A 2PAKA 4IV1C 4C1XA 1LU2A 2ZHKA 1OI6A 4I3PA 4XJ8A 4WM7B 3WT3A 1V6OA 2ILMA 2RS12 2ZGKA 2Z69A 3DPRC 3W58A 4FTSA 1MVEA 1FMD3 5LEKA 1VBD1 2PHUA 5J48A 5AFEA 5E8AA 4IV1A 2JG8A 4N90A 1TE1B 1DQ5A 1PZ9A 1B35C 2I74A 3HAGA 2AREA 1GBGA 3AZYA 1Z7S1 2NMOA 3V0AA 5DDJ3 4YW4A 1PK6C 4BIOA 4BPZA 2XJTA 1W6NB 3P3NA 2XJRA 4LBNA 3SMHA 5JOXA 1H2LA 4MXWB 2DUPA 4QPIA 2OW4A 1W6QA 4Q4Y1 2YROA 4XW3A 3VBRC 3WOGA 1I5ZA 1S1AA 1PK6A 1RUH3 5D8AA 4AFDA 2UYAA 4MZUA 1B09A 4DPNA 2SLIA 3IPVB 4BMBA 4Y22A 1C3HA 4ISRA 2HWF1 1CAXB 1Q8PA 3RZZA 2VPVA 2XVGA 5LK7B 4P9YA 2ZPXA 1BJQA 4LTAA 3HT2A 2H6CA 2ZX0A 5DUUA 5I93A 3RNSA 1QJU1 4C0BA 1ZRCA 1MEC2 5F1RA 3FFZA 3JQWA 5JAXA 3BU7A 2RM21 1TME3 4KL1A 1VJ2A 3KS7A 4LBQB 4RQPA 1D4M2 1JHNA 2QZ3A 3ZN5A 3VBOA 4BOWA 1TQ5A 1UKGA 3MW2A 4AEDB 1IQAA 1FATA 3VL8A 1EYBA 3GYDA 1RIRA 1AYN3 4I3GA 5GZCA 1ZBA1 3VZNA 3MIHA 1LHOA 2JENA 4XZPA 5CFCC 1OOPA 1H2MA 1O3SA 4Y24A 1HRI2 5BNNC 4WM7A 4Q0VA 3H3UA 2QUOA 5CBLA 4G4FA 5CFCA 2R072 5H9RA 3L2YA 3B3QE 3SISA 3AKSA 1MS1A 3OD4A 4NWWA 5EXOA 4OI1A 4AXOA 4EWDA 5IK5A 1JXNA 2CYFA 3RRDA 1CAVB 2BVBA 4PLOA 5CB7A 1DGWX 1H2NA 5FMOS 2BGCA 3G6JB 3TBDA 4S2DA 4RSUA 2GAUA 2DF7A 2R041 4XJAA 1CN1A 3U0ZA 1MS9A 1RUG3 4YNIA 4YGCA 4E4ZA 1W6NA 2ZHMA 3CF6E 1ZX5A 3ST7A 1KFXL 5GZEA 1J1LA 1R081 2OIIA 3BCWA 1HRV2 1WMEA 1G8WA 1PO11 4UBHA 4MYEA 3MEPA 5BNQA 1KFUL 4Q4V2 1ENXA 1RITA 4CYDA 1CAXA 1PHMA 5IUQA 4NHKA 3FC0A 2WJSA 2PYTA 4XETA 1BVP1 1BXHA 2JICA 3IBMA 3WQ7A 2D3RA 2RS31 4HKOA 4A2UA 4AFMA 2VW2A 2NN8A 2JG9C 5K9YA 2KXLA 1DQ0A 4IEWA 3WUDA 4B8EA 3ILNA 1C8M3 2ZAAA 4QT6A 4FP2A 2A7AA 3M3OA 2XJPA 1AR73 1W0OA 3VBUB 5L36A 2WFF2 1FPN2 1J58A 1F2NA 1G86A 1O3RA 4RS5B 1W6MB 4J1WA 4Z2WA 3VBHC 2UWCA 2A6ZA 3NWKA 1EV12 5T5JA 2DCTA 2Q5TA 3AKTA 3CEWA 1GFF2 5C8CB 3WP5A 3VBFC 4Q27A 3ZVXA 4QPGC 3USUB 3URFA 4UW5A 4RR3B 5K7PA 1SLLA 1S2BA 5GLWA 2CNAA 1AL21 5AFBA 3LWCA 2HWB3 4AI8A 5JVVA 5FO8B 2ZX2A 4IETA 2ZGSA 2EF6A 2RHPA 4S2GA 3WDWA 3M3CA 5A32B 4CZSA 4N53B 3ZYGA 2GC1A 4LO8A 5JMCA 5FAXA 1V6IA 1QJX1 3D82A 1PGW2 3BODA 5I0TA 3ZMNA 3MIBA 2XJVA 1UN1A 2A6YA 4EV0A 5FO9B 2R1BA 2D7FA 2XKPA 4Y4YA 4GWNA 1COV3 3THPA 3N7MA 3JU9A 3GBFA 5FTTC 1XNKA 1NA1B 1MZEA 1SDWA 3UV9A 1G9AA 1V6JA 4XF1A 2VNOA 3O12A 4LO5B 3ZFGB 3R4DB 1QGLA 4CDUC 5L73A 2HWE2 3S6PA 2VG9A 2C0ZA 1TMF3 1AYM3 2TEPA 5DG1A 3OTFA 1Q8VA 4FAGA 1YLLA 1REFA 4L97A 4FPFA 3I8TA 4X8NA 2Z5WA 1EAH1 1OLRA 1WA4A 2IFWA 1S0BA 4A7ZA 3KZ4C 3CU7A 4KNCA 5JSPA 4FOQA 4BIFA 1VBE3 3UKNA 3LSDA 4RS5A 4FPEA 3GBGA 1PZ7A 1VBC2 4GB33 1UU6A 2A6WA 3QH7A 5JZGB 3BPZA 5FLHA 4GMP0 5ACA1 4EN0A 1YJKA 2ZKNA 4DNYA 3ZIWA 5C8CA 5J96B 2WNUB 1ND2B 3J8F3 4OHYA 4FQZA 4N9HA 5J36A 4BCUA 3TN92 1QOSA 3USUA 1JUIA 3FUQA 3MW3A 4I2OA 2B39A 4RR3A 5DUXA 1ZVFA 2HWC1 1QOTA 2ZTNA 4XDQA 4FQ4A 1KJRA 1AX1A 1DHKB 1GV9A 5C9AA 4Q4X2 1DZRA 5BNOC 5H9QA 4TLFA 5GM0A 4DMIA 2XJQA 1VBD3 2JEMA 3NAPB 4BH9A 1QXRA 1N3PA 3JUUA 3B5LB 4WVMA 1RMU3 1LJ7A 1BEV1 3ZFEB 1O3QA 2D6PA 1D0GA 4QMAA 5KHJA 2QCSB 2DURA 1Z7S3 3RPQA 1CGPA 3UKVA 4OLLA 5IK8A 1QJY1 3ZFGA 1RUF2 1LHWA 2WQ4A 4P9LA 2EXIA 2RS13 4AGVA 1GZWB 2ZBJA 1U12A 3FUOA 1UL9A 3MZHA 3SNMA 5JCTA 1ND3A 4BWOA 1NXMA 5JSRA 1RUD1 2FZ1A 5EYXA 3PHMA 5FLIA 4BMEA 2GDFA 3AJYA 1JH5A 1NLSA 2GNDA 4FXGB 2DFCA 2CV6A 1G6NA 3LSEA 4CP0A 1KJLA 2WA4A 2XL7A 2Y26A 1FMD1 3N3HA 5JZGA 2XH6A 2D93A 2PLV2 1QJU3 5JOYA 4B4PA 3PVOA 4PDWB 5GLUA 2RR12 1HW5A 1L3JA 4K1YA 4B4RA 5K0UB 2WNUA 1ND2A 5FREA 5GLVA 5KHKA 1R092 3FJSA 1VAKA 1LEMA 3A0KA 4XF4A 2P2KA 1WW5A 1VRH2 3JBG1 2D43A 1WLCA 4RHV2 3ZYPA 1RUC2 1ZBA3 4KGGA 2HEWF 2IZWA 4AI3A 2WS91 2DCZA 2ERFA 5I0RA 2YPJA 1LOGA 4UBGA 4PIXA 4LHKA 4LBMA 1D4M3 1NQJA 1RUH1 1SCRA 4I0BA 4PLNA 1V6NA 1PO21 4MGYE 4LBJA 4YARA 3UL2A 3LOBA 4FOVA 2HEVF 2YXSA 5E88A 3WDXA 2VMHA 5EJ3A 3PVNA 4FO9A 4YGBA 1O4ZA 4Q0UA 4NR1A 5B2GB 3MIDA 1VAVA 4K21A 4KWKA 3ZFEA 2RMU2 3GF6A 4LA2A 4ATEA 5HBAA 1TME1 5JOWA 2DVFA 4QM8A 1UZZA 1NZCA 4Q8KA 4P9WA 1LR5A 3DN7A 4L8QA 1R1A2 3IDEA 1RHI2 1BMV1 3PVBB 3HMYA 1LESA 2WZR2 3E5UA 4CDWB 3OBTA 4ASMB 1AYN1 1NE4A 2RJKA 5J98B 3ZXEA 1E57A 4FPCA 3OCPA 2IXJA 3INAA 3JQXA 3ZN4A 3E5XA 2D97A 4HLTA 4XBNA 4HSJA 3ECQA 4DB5A 4Z82A 1MQTB 1LHVA 2VOXA 2ZGTA 3U10A 5FFOC 3GHNA 1SACA 1POV0 2VMGA 2NMNA 1VBB3 3CNAA 3VDDB 2D40A 4YM1A 1MZFA 1ASJ2 4PDWA 3BOWA 3WP6A 1ZRRA 1AHSA 3SH5A 4GH4C 2ZHNA 4IEOA 1YFUA 2QKDA 3V65A 4Q4V3 2PHRA 4BLJA 2ZGNA 3OPZA 2O8OA 4ZU4A 1JN2P 4OHZA 1RUJ1 2VH9A 3AP6A 1H8TB 2IXHA 5E1RA 1N1VA 2E53A 5I8TA 1BBT2 4R9DA 1QMJA 4B29A 4IV3C 2VU9A 4KQ7A 2H6BA 5KXCA 3AP9A 4QX5A 1N1TA 3R4UA 3IKWA 4H3WA 1WW7A 4JCKA 4CEWC 4QGLA 3ILFA 2LALA 4AVAA 3NO8A 4D7TA 1KDKA 2UWBA 4AEKA 4DY5A 4H14A 1H1MA 1UF2C 2JE7A 4XFHA 1W2UA 4Q8LA 2A70A 2Z2SB 1V6MA 1OA3A 1X36A 3MLKA 1LEDA 4ZXKA 4D7YA 2A71A 1IGOA 1AL23 2ETEA 2ZJCA 4LNVA 2WLQA 5T5LA 3SH4A 3WHUA 2WLPA 2P34A 2D6NA 1C8M1 2PHDA 5DZFA 5GZFA 4B7EA 1AF9A 4M3CB 1AR71 1J3QA 4XFGA 1JYIA 4CDWA 4GWMA 1QJX3 2GNTA 2BFUL 2UY8A 5ABJB 2NM1A 2AYHA 1A6CA 1LHUA 3AX4A 4JRAA 2AENA 2Y38A 1MQTA 4AVSA 1Q8QA 1HXS2 2QZ2A 5JPNB 3KT7A 3U11A 4DRRA 2D3PA 4AVBA 4NOTA 3L9JT 4HT1T 1CVNA 3VDDA 5FOBB 1CQ9A 1BZWA 2NYYA 2GMMA 2PHLA 1HQWA 4EWAA 1VBA2 4Q2FA 3ZO0B 1AJKA 1EP0A 1D2SA 4GMP3 1C5IA 2HWB1 4X6RB 1CD3G 1GLHA 4CDQC 1WGPA 4HK8A 2DVDA 1DIWA 1UW8A 3MIEA 4WM8C 4ZU7A 2XWJB 2VULA 3AB0A 4Z8BA 1XRUA 2ET1A 1C1FA 4HANA 5L7OC 1ZZCA 2UY9A 4P14A 2CGPA 1QQP1 4XJZA 4LBLA 4IV1B 5I0UA 3WNXA 1QKQA 3KT4A 5ACA3 3POYA 4WM8A 2CTVA 1COV1 1SLTA 1H4HA 1AR92 4X6QB 3DPRB 4QM9A 1PVC2 3JCIA 2VNGA 1LRHA 2R30A 2XG3A 4XHBA 3FX3A 1YUDA 2NLRA 1LODA 2R062 2R49A 3AXDA 2DUQA 4BM8A 4JGZA 1B35B 5DZEA 2FMDA 1AYM1 2VOWA 3PLQA 3R05A 4K6BA 2BWAA 4YM0A 1ZZ9A 1IOAA 2O8QA 4QPYA 1PK6B 1ZZ7A 3ZX7A 2HWD2 5JSOA 2ZX4A 3R6SA 4Y22B 2D6MA 1Q5OA 1RTVA 3AZZA 1VBE1 4NN0A