4GH4C

Crystal structure of foot and mouth disease virus a22 serotype
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
GIVPVACSDGYGGLVTTDPKTADPVYGMVYNPPRTNYPGRFTNLLDVAEACPTFLCFDEGKPYVVTRTDEQRLLAKFDVSLAAKHMSNTYLSGIAQYYAQYSGTINLHFMFTGSTDSKARYMVAYVPPGVETPPDTPEKAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDVAETTNVQGWVCIYQITHGKAEQDTLVVSVSAGKDFELRLPIDPRSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords capsid protein VP1
publication title Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gh4C00
4RR3A 1C8NA 3VBSC 4GMP0 5JZGB 1HQNA 4QPGA 1EAH2 2WS91 5BNOA 4Q4W3 1FOD1 1AR81 3J8F3 4Q4Y3 1ASJ3 1H8TB 2WZR2 5CFDA 1MQTB 3VBRB 1RUJ3 4LLFA 4RQPB 2BUKA 5C8CB 2HWF1 5GKAC 1QJX2 1MEC2 1RVF1 2HWC2 4FTSA 3DPRC 1QJZA 2RM23 1K5MB 1HRI1 1VAKA 5K0UC 4Q4V3 2XBO1 1HXS2 2R072 3FBMA 2X5IB 3NAPC 4N43C 3DPRA 2WS92 1A6CA 2BFUL 4JGYC 5FMOS 1FOD2 2R042 1AR82 4PDWC 5K0UA 1C8M3 1RUE1 1QJU1 1VBC1 5C4WC 1R083 5ACA1 1RMU3 2HWB3 4N43A 1R081 1RVF2 3JB8A 4YVWC 2PLV1 1RMU1 4WM8B 2HWB1 4JGYA 1RUI1 3IDEA 4PDWA 1RUG1 1HRI2 1VBA3 1R092 5C4WA 1AL0G 2XBO2 2RS31 1NCRC 4GMP3 3ZFEB 1R1A1 4IV1B 1VRH3 1TMF3 4Y5Z0 4YVWA 1PVC3 4CDWC 5L7OC 1FPN1 1HX6A 1QJY3 4CDXB 2WFF1 1NCQC 5C9AB 4JGZC 4FTBA 1COV1 1NCRA 1RUE2 1EV13 1VBC2 1AR71 1QJU2 1BEV1 1D4M3 5ACA2 4GH4B 4CDWA 5L7OA 4CEYB 5DDJ1 4CDUB 5A32A 1D4M1 2PLV2 4CDQB 1EAH3 1RUI2 5BNNB 4JGZA 1RUF1 1M06G 1ZBE2 2FZ1A 2WZR3 2RS32 4YVSC 5CFCC 3JBG1 3ZFFB 5ABJC 1BMV1 1H8TC 1QJX3 1MQTC 1X36A 1FPN2 1TME2 1MEC3 5C8CC 2WFF2 2HWC3 2RMU1 4GB31 1COV2 4YVSA 5CFCA 1RHI2 2MEV1 1AR72 5CFDC 1HXS3 1BEV2 2RS12 2R073 5ABJA 3VBFA 5DDJ2 3VBHB 1ND2B 2WLPA 1NA1C 2WS93 1AR91 3JD71 2R061 1OOPB 1FOD3 1RUF2 1AR83 2R043 1B35B 1AL22 1ND3B 1RUH2 3CJIA 2RS51 1HRV1 4RS5C 3ZFGC 1RB8G 2R041 3HAGA 3JBG2 3VBOB 1BMV2 2HWF3 1NA1A 3VBSA 1RVF3 3VDDB 4RFT0 4WM7C 2RMU2 4GB32 4RHV2 1HRI3 4RS5A 5FMOL 1ZBA2 3ZFGA 1Z7S1 4AEDC 1R093 2MEV2 5BNPC 2XBO3 4BCUA 4N53B 1R091 4IV3C 3VBFB 1F8VA 4WM7A 1PO21 3JD72 1AR92 2QQPA 4CEWC 2ZTNA 4RR3B 1E57A 2R062 4AEDA 5BNPA 1VBB1 4QPGB 1RUE3 5LK7B 2IZWA 1QJU3 1HRV2 1VBC3 2RS52 4IV3A 3VBUC 5ACA3 4Q4X1 5BNOB 2RR11 4FTEA 3NAPA 4Z92B 2ZZQA 1VB2A 4CEWA 5CFDB 2PLV3 1OPOA 4Y4YA 1RUI3 1NG0A 1RUG3 3ZXAC 1VBD2 4FSJA 1QQP1 1Z7S2 1ZBE3 3VBUA 2RS33 1POV1 3M8LA 4SBVA 1R1A3 1ZBE1 1AR61 1RUC2 1FPN3 1TME3 1PO22 2WFF3 5FOJB 2HWD2 2Y26A 1TME1 1COV3 1VBB2 5D8AC 1AR73 3TN92 4QPIC 3DPRB 1BEV3 2RS13 4NWWA 1PGL1 1RUD1 4Q4X2 1PGW2 2RR12 1RHI1 5DDJ3 5K0UB 2RS11 1FMD1 2ZAHA 4Q4V2 1NCQA 1PIV2 1V9U1 1QQP2 1RUF3 4QPIA 4N43B 5JZGC 1RUH3 1VB4A 3JBG3 1AYM1 4JGYB 1AR62 4PDWB 1AL21 1RUH1 2DF7A 5C4WB 3VBRC 2RMU3 4RQPC 4GB33 3VDDC 5JZGA 2GSYA 4YVWB 1ZBA3 2BBVA 5AC91 2MEV3 1NY72 1F2NA 4RHV1 1PGL2 1RUD2 1ZBA1 1VBE2 2FZ2A 1PO11 1POV0 1H8TA 1K5MC 1NCRB 1MQTA 3VBRA 3JD73 1AR93 1CJDA 1FMD2 4RQPA 5C8CA 2R063 4CDWB 2X5IC 2TBVA 1V9U2 5L7OB 5A32B 3JB4C 1W39A 2RS53 1HRV3 4RR3C 1AYM2 4JGZB 1K5MA 2WWSA 2X5IA 2HWE2 1VBD3 1Z7S3 5AC92 1VBD1 4WM8C 1PO12 1RUC3 4YVSB 5CFCB 1PO23 1OHFA 2HWD3 5ABJB 1RUC1 1BBT2 4IV1C 4Q4W1 3ZFEC 2HWD1 3J8F1 1VBB3 4Q4Y1 1ASJ1 4WM8A 3TN93 4CDXC 1RUJ1 5C9AC 4Q4X3 2RR13 3TN91 5J96B 1PGW1 3CJIB 3ZFEA 4IV1A 1AYN2 4NWVA 1PIV3 4GH4C 2RM21 1QQP3 4CEYC 2BPA2 1NA1B 4CDUC 4CDXA 3VBSB 5A33A 4Q4V1 1PIV1 5C9AA 1POV3 4CDQC 1AR63 5BNNC 4RS5B 3ZFGB 4GH4A 4CEYA 3ZFFC 4CDUA 4Q4W2 3J8F2 1C8M1 4Q4Y2 1ASJ2 2HWF2 4CDQA 4WM7B 5BNNA 1RUJ2 1RUD3 1VBE3 1RHI3 4AEDB 1NY71 5BNPB 1VBE1 2GH8A 3ZFFA 1FMD3 4IV3B 3LOBA 2BFUS 2RM22 1V9U3 1VBA1 3NAPB 3VBHC 1ND2C 4CEWB 5D8AA 1AYM3 4GMP1 5A33B 1VRH1 1AL23 1TMF1 1OOPC 1PVC1 1QJY1 3VBUB 1GFF2 1CD3G 1B35C 1ND3C 2HWE3 3VBOC 3VBHA 1ND2A 1C8M2 5AC93 1X33A 2HWE1 1EV11 5J98B 1R082 4RHV3 1OOPA 1PO13 1RMU2 1IHMA 2HWB2 1DDLA 1NOVA 1B35A 1ND3A 2VQ0A 1RUG2 3VBOA 2XPJA 1EAH1 4N53C 1BBT3 1VBA2 1AUYA 1R1A2 3VDDA 2WZR1 3VBFC 1BBT1 1VRH2 1TMF2 1NCQB 1QJX1 1PVC2 5D8AB 1QJY2 1WCDJ 4QPIB 1MEC1 4QPGC 2HWC1 1SMVA 4N53A 1AYN3 4EJRA 5BNOC 3CJIC 1EV12 1AYN1 1HXS1 3S6PA 2R071 1D4M2
chains in the Genus database with same CATH superfamily
1DHKB 1YLLA 4WV8A 5HV4A 1C8NA 5IYYA 1GLHA 4D0QA 3AKRA 4HVQA 2ZGQA 4GMP0 4HLTA 5F6KA 4GIQA 2A5ZA 5CNAA 4LR4A 4QPWA 3WOGA 4NO4A 4EE2A 4QX3A 2W1WA 1UY1A 2I74A 4KGGA 4Q4W3 2VW0A 4CUBA 2WT0A 4YZ5A 2ES3A 3PVBB 1I6XA 3MV01 4Q4Y3 4EWAA 5CFDA 4CRQA 4WZFA 5JWPA 1X8EA 3WF2A 1GOGA 1GP4A 2F17A 1N1SA 4K40A 1UZYA 4RQPB 3MV11 2YBSA 4CPBA 5A1FA 1TQ5A 5F2WA 1PHMA 1UWWA 3K4DA 2X29A 3IPVA 2VQTA 1MEC2 1RVF1 1AXKA 3OB8A 5FIXA 5FYHA 3WP3A 2WA3A 3ZKUA 1SEFA 4FTSA 3WG3A 1V6MA 2ZEXA 3DPRC 1TVGA 3Q8FA 5J7MA 2RM23 3WDXA 1XNAA 3PUIA 1JOJA 4DB5A 1W8OA 2FDKA 5LRSA 2GH2A 1HXS2 3K46A 4AR2A 4IEUA 5DG1A 4LT5A 3FHAA 3SEEA 1W6NB 2UY8A 4LUMA 4YW5A 4BK4A 3UT0A 4FP3A 3I7DA 3SLIA 3CDZB 2VMGA 1ZRCA 3LPGA 1BHGA 3E6DA 4XYXA 4B4PA 4DQAA 3N7LA 5DUXA 4GXLA 4HFSA 5FZ0A 2A6XA 5K0UA 3VZMA 3K3OA 3W5NA 5CG9A 2EXHA 4XJ9A 1CR7A 4NE9A 2BW8A 4O61A 4P02B 2XJVA 1ULEA 4M3CA 4BU2A 5IVFA 1CONA 3WNOA 1UOBA 1LOFC 5C71A 1QF3A 4UBGA 3K75B 2HWB3 1O4TA 4N43A 2WT2A 1RVF2 3JB8A 5HXMA 4HPKB 1RMU1 4UFKA 5JOWA 1H2KA 3GZEA 4XF1A 2BVBA 4FFGA 1KS4A 1LRHA 1RUG1 4Y20A 3MF6A 2VVFA 4R9CA 4S2FA 4MVTA 5C4WA 4PIZA 2RS31 3AZVA 3CZUA 2JENA 3MGUA 1NCRC 3VL9A 4K3UA 5FOBB 2JDYA 4GWNA 4IV1B 4MYEA 4Q29A 5GJ6A 3ZFEB 1TMF3 4YLZA 2Q5TA 3NV2A 4PT6A 1YXWA 1CAXA 3DKQA 5J3UA 4IEVA 3MPBA 1OBNA 2VBPA 5C9AB 4LHNA 4JAAA 3THPA 4IESA 3TNQA 3WDYA 3SCHA 5FPXA 4XW3A 4FTBA 3CEWA 4RA0A 1EV13 1Q3EA 4QQHA 4FBFA 4EZHA 3VUOA 3AXEA 1UAIA 3LFIA 5DAQA 4FO9A 1N47A 1LGCA 3VZLA 1LHUA 3ZYFA 4AWDA 4CDWA 2WIIB 4CEYB 4S2HA 4XUPA 4KGQA 4TLGA 1Y7BA 4CDQB 3CIHA 1U5IA 4DXRA 4YW6A 4E27A 2K2SA 1HQWA 4LKDA 2Y8KA 1J83A 4GJZA 4OMDA 2YGMA 3A21A 2C9AA 5FXZA 2PHDA 1ZBE2 1IG0A 4CA9A 1J3RA 4XACA 2RS32 2JJ6A 5A6ZA 5D1IA 1GOFA 3CLPA 1HB3A 3MIHA 3WQ1A 3AYDA 3AL5A 2R6QA 4N9IA 3C7EA 3KHBA 1HDKA 1H8TC 1ZYBA 2NMOA 4XUNA 4OZOA 1XE8A 1W2UA 1GZTA 2JG9C 5FXXA 3HT2A 1IPKA 1MEC3 1WLDA 1W90A 2OUHA 3RFRA 3SH5A 1LNSA 3J26N 4CU6A 1E5HA 5IVJA 3MBWA 1XC6A 2BVVA 2XONA 1KDKA 1K3IA 2O8OA 3AL6A 4PIXA 4YFWA 3U78A 2VMHA 1HXS3 1DQ6A 1CVNA 2RV9A 4IEWA 3VBHB 4NIAA 3NJYA 2IVJA 4GD4A 1K45A 3ST7A 2WBKA 2Y6KA 3AKSA 1LOAA 5KXEA 3HJRA 1C3HA 3LAGA 4BOWA 1W6MA 1ZA4A 4QKFA 4D6QA 1CAUA 4S2GA 3VN4A 1UX7A 2B9UA 3H1YA 2OIIA 3VKOA 1GNZA 2DVBA 1YO8A 1NE6A 3SXWA 5GLZA 1UZZA 1ZX5A 1DU3D 1UZWA 4Y26A 1NA1A 4LKSA 4CCCA 3VBSA 1LOCA 2L9LA 1RVF3 1KDMA 1PM4A 1GU3A 3MIGA 4RFT0 2VGDA 2VVEA 1D2SA 4WM7C 5FBZA 3BI3A 2G9GA 3ZYPA 2KXLA 4HKLA 3UYJA 2GMPA 5IHRA 1HJFA 2P6HA 1CAWA 3I2JA 3AKQA 1Z7S1 4COUA 4COZA 2JXAA 1WBLA 2CHHA 2AR6A 3T1LA 3T0DA 3POFA 2CAUA 4OHXA 3EQEA 3I3DA 4IGQA 4URAA 2A3YA 2RVAA 4QPYA 4YFZA 3WT3A 3O1RA 3I49A 1ENSA 1F8VA 4KWJA 4XIOA 1Q8VA 3WQ7A 2VMCA 2ZGUA 1G8WA 4BM8A 2QQPA 2HYXA 2LROA 4I09A 3RJ2X 5B4NA 4P9WA 4FXKB 1KGYA 4YZ1A 2LRPA 5LK7B 2HYKA 3PU3A 4AOCA 1Q8QA 4AVSA 1J3PA 2B4KA 5CIRA 1IZ3A 1US3A 2XHKA 3ACFA 4UI9L 1W99A 3NAPA 5FCCA 2B46X 3OD4A 2VNVA 1S4CA 4CEWA 1UW8A 2JE8A 5FY5A 4WVMB 2OQ6A 1OPOA 4CE8A 4HSLA 5IK4A 5IVCA 3TEWA 1JOBA 3P6BA 5E88A 1RUG3 3M3OA 1VBD2 5FZ3A 4MHRA 3H1WA 5IJRA 1Z7S2 4PQQA 1ZBE3 1XRUA 4GAZA 4QU2A 4QDRA 2RS33 1CAVA 2VNRA 4JKKA 1LULA 4B8EA 5ISLA 1AR61 2Q4SA 3BTAA 2WT1A 2VZPA 4TLFA 5CBLA 2D6MA 1XE0A 5CU1A 3WDVA 5IK5A 1OLQA 2VBBA 1R64A 1YYNA 1SLLA 4YW4A 5FOJB 1UMZA 1TME1 4FXGB 4K6BA 3B02A 1S0FA 4OLLA 3KVBA 2JKXA 3DXUA 5D8AC 5HXVA 4FAHA 1GBGA 1OXCA 4ARXA 4QXBA 1LEMA 5DZFA 1CN1A 5FP7A 1Q56A 4E4SA 3HBZA 2IWGB 4BIFA 3ZYBA 5JSPA 1H1IA 2RE9A 1Q43A 2D98A 2IXHA 2XHNA 2Y6FA 2WN2A 4IXLA 3ILFA 4XOGA 5FZEA 4CP2A 4DXTA 5EWSA 2ZAHA 5FYUA 4AVCA 1BJQA 1GNYA 3PUHA 1V9U1 2WL1A 3EHKA 3AFGA 1AX2A 4D7TA 1JN2P 4PI0A 1BKZA 2Q8OA 1AR62 1M06G 1F5FA 1XXNA 2ZACA 3MIBA 4WVVA 3AC0A 3ILRA 2WNUA 5A3MA 5F7UA 1JUHA 2OZ6A 1SCRA 2WJSA 3SCFA 4B1LA 1KD7A 3L2YA 3BKZA 3AZWA 4BYYA 3L9JT 4RQPC 2XLFA 1CZTA 1JW6A 5JZGA 3APBA 2BBVA 4YVWB 3A22A 3N36A 5EJ1B 2K0GA 1F2NA 2ZEYA 4FPGA 2W2IA 5CZKA 2B9VA 1JYIA 2YXSA 1EP0A 1V6OA 4M01A 2ARBA 3ZVXA 3JQWA 1ZVFA 4NMIA 3WNMA 2OVUA 1LB2A 3M3CA 2XMLA 4B1MA 2XJPA 1CJDA 5C8CA 2W0XA 3M3EA 1LHNA 4XABA 1W9FA 2EIDA 1NQJA 2OXBA 2QQIA 1V9U2 3AZZA 3I3EA 3KV9A 2D97A 4XUOA 5A32B 1W6QB 2OS2A 3IAQA 4CCLA 4LA2A 1KXGA 4YW3A 3RRDA 4YGCA 1G9AA 2QDRA 1E5RA 3AYCA 1SLBA 3I3QA 4QHBA 1S0IA 3IMMA 2B5HA 2CTVA 4LBQD 3MIEA 1V70A 5CA6A 5CG8A 3S5AA 3TWIA 4MXVA 5KWRA 5JI9A 1ZA7A 1LOGA 3HR9A 2EVXA 2LALA 4XHXA 5JOXA 1OKOA 1REFA 1VBD3 1NE4A 2KR2A 4HK9A 1Z7S3 2VOXA 3O0WA 2VZTA 3ZYRA 5IFTA 1TG7A 4AI1A 5HBAA 3O1PA 1YHFA 3M2MA 5T5LA 2Y64A 1W8ZA 2FCTA 1DZQA 4YVSB 3PMSA 2ADDA 3ILNA 2HEYF 1V6KA 1OHFA 4YRDA 2WNOA 5F8PA 2CSGA 4UWDA 1S0EA 5EYXA 2GNMA 4IV1C 3ZFEC 4HBNA 2VZQA 3NV1A 3OPTA 4WM8A 5EQUA 4CP0A 2Z69A 2BQPA 4QKBA 1RUJ1 3KMHA 5EJ3A 1MZEA 4JKLA 2WO1A 2XKPA 5BUVA 5C9AC 1C1FA 2BBAA 1A8DA 2DTYA 3ES4A 5A80A 5J96B 2G4IA 3IIIA 1NLRA 2A6ZA 3ACHA 3VLBB 5FMCA 4LO6B 4XTMA 1PVXA 5SV8A 4NWVA 3GJBA 1UCXA 4A44A 3AXDA 3QBQA 4MXWA 1OUSA 4CEYC 4CDXA 3OUJA 4QDQA 5A33A 4GWMA 4Q4V1 2EAAA 3OGSA 4A41A 2IXKA 2VCAA 3LF7A 4YW7A 1TNRA 1AR63 3THTA 3OPWA 4CDQC 1UMIA 3LDRA 1YFUA 4W8JA 4YARA 3ZFGB 1RJ8A 2GMMA 2IFRA 4URTA 4DINB 3WEZA 5FP8A 2Y6GA 3ENRA 3MEPA 1UYZA 2ZGMA 4YWAA 1MS5A 5FO7B 2QJVA 4FQ4A 4LBKA 5FY0A 3ZPYA 3A4UA 1MZ5A 2J1AA 5ERLA 2RG4A 3ON7A 1RUJ2 5BNNA 5FKCA 5C4WC 1ULGA 1XNBA 4DY3A 4AEDB 3N9OA 4AGGA 5BNPB 3LDKA 3DV8A 3FBYA 4V1PA 4BQWA 2GNTA 2GH8A 2J22A 2KM2A 4IV3B 4BQXA 4NPLA 3NV3A 2BFUS 2VCBA 3DYPA 4IE7A 3SQOA 4FQZA 1VLNA 1V9U3 4XILA 3VBHC 5A7WB 1KFXL 1OA4A 4OQ8A 2GC3A 1SCSA 2OUJA 2GC0A 5JLVA 1JS9A 4D6RA 3D4KA 5A33B 1VRH1 5FXVA 4R9BA 4W4ZA 4YGBA 3WUDA 4L92A 5GZGA 1ODNA 1PVC1 4QQPA 3WDUA 1JZ5A 1F4HA 3M1HA 4ZHNA 4Z82A 3OG2A 1PMHX 2VZUA 1ND2A 3I2KA 2DVGA 1GANA 4TN7A 3SNMA 4YZ4A 5DXDA 3WCRA 2F6BA 2J1UA 2VH9A 2XVKA 1R082 3C7HA 4CXWA 1BVVA 3PNAA 4AQ6A 3VL8A 1OOPA 3BU7A 1QMJA 2AEYA 1S0JA 3AMHA 1B35A 2VQ0A 3VZKA 3U10A 2SLIA 1EAH1 4U2AA 1U5ZA 2I07B 1CIYA 3H7JA 3HOBA 3NJXA 4B3NA 5FZ7A 2OW4A 2NQYA 4M4RA 2Q8DA 3T30A 3VDDA 1SQ4A 5FZDA 3BGAA 4QHOA 1BBT1 5KBFA 3RYPA 1UY0A 1VRH2 3U07A 5E1RA 5H9RA 1GZWA 1PVC2 1QXPA 1UOFA 1J1TA 3NV4A 1WCDJ 4QPIB 4RGKA 3RG0A 3R6SA 4LK7A 4KBBA 3RI9A 5JXJA 2CGOA 2C4XA 1ULDA 3HPNA 2NM1A 5JR2A 3ZIXA 3SKVA 1JODA 1OT5A 1IQDC 5F3EA 3BN6A 5J36A 2R071 2VOTA 3OYWB 4QB6A 4RR3A 4U36A 3TOJA 3VBSC 1MVQA 4QB1A 5DZGA 4C1XA 1ODMA 4OUSA 4CUCA 4HKOA 4JQRA 4LHSA 3BB6A 4HVOA 4DY5A 4GWIA 3ZO0B 3VKMA 4FPJA 1EAH2 2WS91 2ZOEB 4ES8A 5FUIA 1W28A 3O1OA 4UW6A 3IN9A 1QOOA 3K2OA 1GP5A 2WQ8A 3I2IA 5FWEA 1AR81 1C5IA 4CXXA 1NXD1 1H8TB 2CYFA 3WUCA 2VTFA 4NPRA 1RUJ3 1WW7A 4LLFA 4PIYA 4CCEA 1FXZA 2OKXA 1HW5A 5GKAC 3KT7A 4PF5A 2D6KA 1WA4A 3ZX7A 4B29A 4BQ2A 5A7OA 3MPPG 1U12A 1VAMA 3AYEA 4Z2AA 5C3QA 1YI7A 1QJZA 1AHSA 4NAOA 3T4VA 1HRI1 3DEMA 1H6XA 4LHLA 2PA7A 3OBZA 4ZXKA 4Q4V3 1Q5OA 1AVBA 2XBO1 4NIGA 3GF6A 2A70A 2R072 1EYBA 4BE3A 3NNMA 2VG9A 1GQGA 3NAPC 1Y9QA 4Q1RA 4Z8BA 4JTOA 3BALA 3ZYHA 3PJYA 5FK8A 1UIKA 3W9AA 3O0VA 1DIWA 3WNLA 2WS92 3KSCA 1O7FA 5LBCA 1MPXA 2W52A 4QDSA 2AZ5A 2R042 1AR82 2C9KA 3HQUA 4BWOA 1BVP1 2ZZJA 2MNGA 4RL7A 4NRQA 1R083 3VZOA 3I3MA 3C7FA 5ACA1 2VC9A 3RGBA 2JDAA 4QQOA 4YM2A 1DLLA 1NZCA 3N4MA 1W3VA 3KZ4C 3BYWA 4ATFA 2AH2A 2Z4FA 4FT8A 4YVWC 5FMBA 3THDA 3VKNA 4DXSA 2HWB1 1IG3A 4JGYA 1RUI1 3IDEA 1QEXA 2JEMA 1UZ0A 4PDWA 3WNPA 4E4HA 4Q2FA 2IC1A 5F6LB 4BA6A 2P3IA 4XE9A 1HRI2 4CCMA 1R092 2FBEA 3LIHA 4ONUA 2XBO2 2J1VA 4RYDA 3AVRA 3FZ3A 4XZPA 3TBDA 1ZZ8A 2R32A 1VRH3 3ITQA 4G3YC 4HT1T 3VDBA 4XURA 5C3SA 3NNFA 1PVC3 1FPN1 1HX6A 4K9SA 4OCTA 5FZ9A 2V73A 3QD6A 3ZXFA 4Y22A 5JIAA 1ALYA 1VALA 1IOAA 2C26A 5H9QA 4EROA 3ZSMA 3KLSA 2QQMA 3U37A 4CUGA 1X9TA 3O5SA 1COV1 1NZIA 3AZXA 2C5DA 1AR71 1LOBA 1VPHA 1WD4A 2YYOA 4YYOA 4DEQA 1PM7A 2GN3A 4NHXA 5F1RA 5ACA2 4NR1A 2EXJA 4GH4B 3RNSA 2VBDA 2WNUC 5L7OA 4CDUB 3KF3A 2VJXA 4UFMA 2W47A 3GCXA 4PBOA 2YC4A 3ZIWA 4D3WA 5L36A 1PK6B 3RMYA 3V0BA 2IXIA 1EAH3 1RUI2 2UU8A 1KQRA 4JGZA 5H9PA 1H4HA 4P14A 3J4UH 3NNLA 2A75A 4R4XA 3C3VA 4FOQA 1W6OB 4LO4B 3WNKA 1SLAA 3LSDA 4A3ZA 5IAXA 4YVSC 3WG1A 4LNVA 5C33A 1SDDB 3BU0A 3JBG1 3ZFFB 1VP6A 4Q8KA 4MLOA 3W59A 3GZUC 3WF4A 3HBKA 2D7FA 1OF3A 3QH7A 3ZSJA 5A3LA 3FL7A 1FPN2 3BPZA 1UKRA 2O8QA 2PAKA 3ME2A 5A3WA 3U14A 4QHZA 5C8CC 4XJZA 2Z79A 4IGPA 1LODA 4LUKA 5JPMB 1H30A 2HJIA 2Z2SB 3FUQA 3G7DA 4IEZA 4XIKA 2VW1A 3AK0A 1MVEA 5F5AA 3CNAA 4XBNA 1QOTA 4C1WA 1F31A 1COV2 2E9QA 2QQNA 4QB2A 5CFCA 1RHI2 1AR72 1N3PA 3B5LB 2OPKA 3MW2A 3BVCA 4HN0A 2JDKA 4H14A 2R073 2B45X 5E6HA 5ABJA 1ZZ6A 2YZ4A 2PHRA 3W5MA 3B01A 4JTNA 3FFQA 5A7NA 3S5QA 2NYYA 3OGGA 3ORJA 3QH6A 4LITA 2F4LA 5FRAA 3DGTA 4BMBA 3OBAA 3FWEA 5I91A 2BGOA 1IS5A 2XL9A 2WS93 3LKJA 3POWA 1U0AA 3DN7A 2BNOA 1IGOA 2R043 3ACGA 1AR83 3POIA 1UX6A 1NAEA 4E4DX 2BV4A 3C7GA 1RUH2 3ZFGC 2BZDA 1HRV1 2A3WA 2W39A 3JBG2 2HH9A 5JPNB 1NX9A 1O59A 2BNNA 3UJQA 2QQJA 5F39A 1C4RA 5J37A 4DRVA 1Q8PA 4XF9A 1UY3A 1FYUA 1QXJA 5KC5A 4TYSA 4JC1A 1LENA 1W8WA 1GZCA 5GALA 5FV3A 5FWJA 1Y4WA 3D8CA 4A4AA 1H2LA 2WO3A 1HRI3 2C24A 2XXZA 1ZBA2 4RS5A 2CWSA 4AEDC 1R093 5BNPC 4EQVA 1JYCA 2D5HA 2XBO3 4Y4RA 5LASA 3VD9A 1D2QA 1XSRA 3D82A 3HNYM 3M7AA 3I2FA 2VR4A 3KCYA 1UOJA 4IEPA 3TRSB 4IV3C 4YW2A 1SBFA 3RZLA 1PZ9A 3JCIA 2BYVE 5A7QA 1XOYA 3CO2A 1PO21 1X9PA 1ZZ7A 4GQ7A 4AGVA 3NNJA 5JSOA 1VMJA 2ZTNA 1E57A 1UD1A 1VIWB 4RSUA 3WDWA 2ZGNA 1RINA 1CPNA 1VBB1 2WQ4A 1HRV2 4DUVA 4CU9A 3H3LA 5IVBA 1TZOA 4NJ4A 4UW4A 5ACA3 3UV9A 2IVIB 4Q4X1 1URXA 2E6VA 2WNVA 3AM2A 2JDMA 4QQLA 4HSJA 3N9LA 4ZY9A 2ZZQA 3SKJE 3WINE 4TTGA 5JUVA 4L11A 4CCJA 5CFDB 3NKGA 2PHWA 3AMPA 1RUI3 3U4SA 2ZX4A 5FLIA 4R4ZA 5HCFA 2YBKA 4QD2A 4R9DA 3RZHA 4ISQA 5F2SA 3NNGA 4AEJA 3E97A 3IPVB 2WZ8A 4P9LA 3VBUA 1S55A 2QE3A 2NLRA 2ZA9A 3KQRA 3NVCA 3W20A 1YI9A 3VZNA 2OQ7A 1ZBE1 2EA7A 4P9IA 2ZGOA 4JDNA 1DGRN 1BLZA 1FPN3 1WLTA 1J3QA 3BCWA 2UWCA 3IBMA 1PO22 4UYBA 2VNOA 4DUXA 1DGWX 3MDPA 4D7SA 3EO6A 4FPLA 5HV0A 5J1XA 1JI6A 2X53S 2GP3A 3MLJA 5FZBA 5KHJA 2E32A 2CAVA 2WA4A 3WHUA 5A70A 1COV3 1AX0A 1VBB2 4I3PA 3WP5A 2ZKNA 4IL7A 1AR73 1ZZBA 2A73B 4QPIC 1FT9A 1I5ZA 4QGNA 2NN8A 2EICA 3HD8B 4ES9A 4Q4X2 1QH7A 3LOIA 1WLWA 5GM0A 4ZZ8A 5IVEA 2YB7A 4FPEA 5K0UB 3A0KA 3CJXA 4UFLA 2VUDA 1CGPA 4W6WA 3MYXA 5LA9A 3C2UA 2JKBA 4M3CB 3WXPA 4XFAA 4LIUA 1FNZA 5FTTC 1NCQA 4P5HA 2D44A 1RIRA 2ZCWA 4NN0A 2VULA 4N43B 3I2GA 1S2KA 1RUH3 2D6LX 2Q0AA 3Q9OA 1QDOA 3CZJA 1VB4A 3JBG3 3POSA 1AYM1 1OUXA 3KT4A 2BGCA 2YPDA 1K12A 4WZCA 4CVUA 5I0RA 1WMXA 1ZM1A 5BYNA 4ARYA 2DF7A 4Y20B 4Q0QA 2I45A 4ZS3A 5C4WB 4GKYA 2CY6A 3WF0A 5FYVA 2Q1MA 2VNGA 4I2OA 2JICA 3K4AA 5BPXA 1G7YA 3O1VA 4CP9A 2UURA 3VDDC 1ENXA 2VZRA 4KQ7A 1ZBA3 1CAXB 2QVSB 4L2NA 1NY72 4QMAA 2PFWA 4Z07A 1JHNA 2FCUA 1Z0HA 4Q1PA 1EPWA 1XYOA 3IIAA 2DFBA 5FXWA 1POV0 2J7MA 1OLMA 1ZRIA 2WUHA 3LEIA 5L9BA 1JYWA 5LB6A 4XFFA 1MQTA 4IERA 3VBRA 3ZDVA 4KWLA 2BP6A 1UN1A 2D6PA 3ETPA 2EXIA 4IUGA 4AL9A 3PIGA 1W6PA 5FPBA 4CDWB 4OHVA 1GP6A 4OULA 4KG8A 1C57A 4JVAA 4YM1A 2QZ2A 4FFIA 1HRV3 4RR3C 4HANA 4RR3B 5EYYA 1AYM2 3QACA 1HJGA 1SDWA 1ULFA 2ATFA 2JDUA 2EIEA 1K5MA 2NPIA 3KWVA 2WWSA 3ES1A 4A6OA 3EB7A 2JB8A 4PBPA 4LBMA 4Q5OA 1BCXA 1H2MA 2HWE2 1S2EA 2X5IA 4MGSA 1YFYA 2DTWA 1U5YA 3RYKA 3RZMA 5FYZA 4PF1A 5KXDA 1RJ7A 1W8NA 1PMIA 2E7QA 2VVDA 4LOTA 2CV6A 2JDHA 1YIFA 1ZZ9A 3H9AA 3TEZA 1ZRDA 1SHWB 1VBD1 3VD3A 3OBRA 4JDMA 4NHKA 5DAVA 1NYWA 1MS0A 3PHMA 1REEA 2D40A 1OQDA 2QNKA 2PYTA 3M70A 3OPZA 5JIUA 4QX2A 1PO23 3D5OA 4IGOA 5FO9B 2AGSA 2YHJA 3FHIB 2XUEA 4D8MA 3BOWA 4FCAA 2ZX2A 1GQPA 1O5LA 1ST8A 1YQ8A 2Q1ZB 3DYMA 4PI2A 5EFUA 5FZ8A 4XDOA 4MGQA 1VBB3 1AJKA 4IEOA 5GZFA 1LECA 3ZPOA 5IATA 2W1SA 2XQRA 1MZFA 2YY1A 5K9YA 1A34A 1W9TA 4I0BA 5L9RA 1W6MB 1OPMA 1UIJA 4Q4X3 5CVRA 3J7HA 4FTEA 3I3BA 1CAUB 2VXRA 4K7JA 3KCCA 3WQ0A 4COVA 2WAAA 5G04L 3E6BA 2Y38A 1SBDA 4O65A 2HEVF 5EPAA 4GH4C 1MS1A 1V00A 5TSWA 3OY8A 4CU7A 1NA1B 2J42A 4CDUC 4LPLA 4PLOA 3VBSB 4XF3A 3LSEA 5I0DA 5I8SA 4BQYA 1PK6C 4KU7A 1HN0A 2XG3A 3CF6E 3KV4A 1Z78A 1DYKA 5FLHA 1CAWB 5FYSA 3BOPA 3NKTA 1XNKA 2XVLA 4FPHA 4AFDA 5CKQA 3VHPA 4HETA 1DQ5A 5DUUA 4A3XA 1JZ4A 4P5YA 3ZFFC 3T1MA 2HWF2 2PTMA 2VW2A 1PX4A 3HWJA 3QLQA 2D3RA 4FOYA 4HL0A 5ANQA 3BUCA 2QQWA 3I59A 1HB4A 3LD8A 4LULA 5FZCA 2AEZA 3KVAA 5FJKA 3TEXA 3MIDA 3R0RA 4O7XA 4AXOA 1SFYA 3WW3A 4AF9A 4MSVA 4HMZA 1L3JA 5AFEA 4H7MA 3QCWA 4E4ZA 1SZBA 3WNXA 1OFNA 2YG0A 1HIXA 3AB0A 2EAKA 1YJLA 3IM0A 4HG6B 1WCSA 2PQSA 4M0HA 5IUQA 3HQRA 3NAPB 3WQBA 2XJRA 3KQ4B 4UW5A 2PMWB 3S7EA 4CEWB 1XPWA 1ZRFA 1AYM3 2BGPA 3DCQA 3NRUA 4GMP1 2XJUA 3BODA 4JRAA 4M4PA 1O4YA 2X09A 2ZHLA 4K21A 3MUY1 4AK3A 1GYKA 1QKQA 2VY0A 5FZOA 4EN9B 1CAVB 1H4GA 1WD3A 3WF1A 4XFIA 2HWE3 1GWKA 2E33A 3LWCA 4L99A 3TB0A 3LEKA 2JG8A 3ZM8A 4P9GA 2N7GA 4PJYA 5FREA 3P3NA 2A3XA 1X33A 3OTFA 2XQXA 2Q1FA 3LE0A 3MFAA 3ZDSA 3N7KA 5JVVA 1BK1A 3OCPA 3PVNA 4LBQA 1O4ZA 4M0NA 1Q8SA 3H8UA 3ELNA 1KFUL 1ND3A 3IMNA 4GALA 4UXAA 1RC6A 1UU4A 3AP6A 3VBOA 1CESA 5K7PA 5FP3A 2J1EA 5FJHA 1AUYA 2O0OA 1R1A2 4B7EA 3GDBA 4FPYA 2Y6HA 3ZYIB 1ZRRA 2GAUA 4NHLA 5A1LA 5GLVA 5CKNA 1US2A 4LKEA 2CWMA 3ZKYA 3M3IA 2GN7A 5IW0A 1QU0A 4OUEA 4P00B 4YZ3A 5FZ6A 1WW5A 4JQTA 2R16A 4N53A 4AVAA 5DG2A 1KRIA 1SFPA 4QAWA 1Y9MA 2AYHA 5DN2A 4EJRA 1RL3A 4F3JA 1GZ9A 2WNUB 1MZ6A 2D3PA 3FLPA 2DCYA 5DZEA 3WW1A 1WCKA 3ZXDA 4ASLA 1DP0A 5CFDC 4OI0A 1D4M2 4QM9A 1G9BA 4DO0A 3UETA 3MO4A 5JZGB 4QPGA 4ZS2A 2QQKA 3AMNA 3H42B 3MUZ1 4Y33A 2W1UA 3FC0A 3WX5A 1UU5A 3ACIA 4LOSA 5BNOA 1FOD1 2FD8A 3A0NA 5JR7B 4LORA 1MS9A 4HVRA 4L0PA 5LEKA 3AVSA 4R52A 5JCTA 4YM3A 5A1AA 4BK5A 3GBGA 4S2DA 4QU1A 4TXWA 5C8CB 3LFMA 3K4ZA 3N9QA 4XJUA 5I0SA 2YFUA 3NJZA 1YFXA 4G4FA 3D6EA 1LHVA 4P08A 2E51A 3KD4A 1XNDA 2WR9A 5LWBA 3AP4A 1R1ZA 5I0UA 4AI8A 3RZGA 5FAXA 3AP9A 3AFKA 2YFZA 1BZWA 3UGHA 1G6NA 1S2BA 1VAKA 2XDVA 4KMQA 3VDCA 5APAA 3LA7A 2IXJA 3MF9A 2E26A 4P9JA 5K0UC 3AKTA 1W9SA 3GZAA 5FPUA 3PIJA 2R7EB 2VTXA 3FBMA 1G9DA 3LDBA 5LRRA 1PZ8A 1ULCA 5FMDA 2P37A 4XJAA 2HEWF 4N43C 3DPRA 5FZIA 3R4SA 1KJRA 4A7ZA 3JQXA 2VOWA 3B9CA 1W2AX 2FMDA 1A6CA 2AREA 5EXOA 2BFUL 5FMOS 1FOD2 5FYBA 4BQ1A 1UXZA 2NZ9A 3T2PA 2AUYA 2OPWA 4B7KA 1IKPA 5DAPA 3WR0A 1VBC1 1JTZX 5DAXA 2TUNA 1TEIA 3PMEA 2P17A 1SACA 5FFOC 3PU8A 2X8KA 2DVFA 3ZXKA 4EYUA 5JXIA 4XFGA 2UWBA 3RI8A 4Y24A 1OD3A 4L97A 4WVZA 3AZYA 1H1AA 1R081 5FYTA 4AQTA 5JOZA 4HN1A 4A42A 2PLV1 2ZHNA 2VPVA 4WM8B 4UT5A 4WBBA 1I5PA 2OT7A 4PLNA 3UKVA 5CB7A 4BB3A 2UYBA 2GU9A 4OI1A 3USSA 2A7AA 3ZR6A 3HN3A 1DBNA 1WCUA 4YSFA 2ZHKA 3B7MA 1LOFA 1HB2A 4NHMA 4QM8A 4GMP3 3T3YA 4KWUA 3CU7A 1QH6A 2VMFA 4LJHA 3EBRA 4MXWB 3RPQA 4CDWC 4LTAA 3ZYJB 4CDXB 3I8TA 3OGRA 5FLJA 1CQ9A 4AZZA 1DGRA 3HMYA 5KHGA 1NCQC 2WAOA 4JDOA 1PNFA 1UY2A 4JRLA 3B00A 3ZSEA 1JZ6A 3URFA 1WW4A 4AHXA 3RZJA 1DQ0A 4IE6A 4XHBA 4BQ3A 1NCRA 1VBC2 5C5TA 2QDNA 1YNAA 4HXCA 4IETA 5T5JA 1D4M3 1LCLA 2ZGKA 1Y9GA 5FPLA 2D6OX 2ZS6B 4ATEA 3WLUA 2XJQA 2VOKA 4M3CE 5HCAA 4BHPA 3OUHA 2PLV2 1X82A 2RDRA 2OA2A 5BNNB 1Y3TA 2G9FA 2VAUA 2VXJA 5GLUA 2ZABA 2BDRA 2GMEA 3ZXLA 4HK8A 2E53A 1SLIA 4XETA 3MLKA 5K8SA 3V0AA 3O1MA 2VCMA 2ZMNA 5CKMA 2VCCA 4KI5M 3M4FA 2LTNA 4CCDA 1CX1A 3HT1A 2RJLA 2D93A 5T3NA 4QX5A 5JI7A 5IK8A 3ZN6A 3RDIA 4XBQA 2AACA 3MLLA 2WO2A 4A45A 3MIFA 4LBOA 5HCBA 1MQTC 1UNBA 1J84A 1P8JA 4KH9A 1G9CA 4KNCA 1YWKA 1H8VA 2ZGTA 1L7RA 4O9GA 5FYMA 1EUTA 3EYPA 4GB31 2BOIA 3WNNA 4EN6B 5JOYA 4IE0A 2W5FA 1RYYA 2BU9A 1O6UA 2RS12 4XXPA 3RZKA 2JG9A 2WFPA 3VKFC 3NMBA 1ND2B 3GBFA 4FOWA 3USUA 5LA1A 5LW9A 2WLPA 4YNIA 4BLJA 1NA1C 4Y1ZA 4K8FA 3A23A 2YC0A 5KC6A 2VZSA 4FFFA 3JD71 1AR91 1JYXA 4W50A 1QDCA 1YQ6A 5FY7A 3AJYA 2R061 2BRTA 1OOPB 1FOD3 4NVPA 2JD9A 4AVBA 4A7KA 1B35B 1AL22 3IZOA 4NHYA 3CJIA 4Y1YA 5K4LA 3GBWA 4FPKA 2R041 2G1MA 3CHXA 5IVYA 4LBLA 5FY4A 1UL9A 3DUIA 1WMDA 1YRZA 2B8MA 1JZ3A 1FV2A 2ADEA 2Y60A 3VDDB 1XB9A 4NRMA 3QOPA 3U4XA 4AHYA 4OFGA 2WN3A 4XPVA 1HLCA 4GB32 4RHV2 4ZU7A 1GZWB 3T4HB 1WWYA 1XNTA 4AG4A 2Y0OA 1EY2A 2VQAA 3RJRA 3PTRB 4BCUA 2P34A 4GKXA 5T55A 4ITCA 1R091 3BIEA 3WY6A 2C1FA 1J59A 2PQQA 1O3SA 4EZ4A 1DZRA 1JUIA 4HKWA 4WM7A 2DBNA 4AE2A 5EZWA 3HQXA 3JD72 1AR92 4I0WB 3H8XA 4CEWC 4IE5A 1HN1A 1V0AA 1W8UA 2IXLA 2R062 2VZOA 1XSQA 2FQPA 3GNEA 1C5HA 2W08A 3ZXGA 5BY5A 3FLRA 3TEYA 2ZEWA 4C8DA 5C70A 1NQDA 4XQ4A 5LY2A 1VBC3 4YZ2A 2Q8EA 3GM8A 3OGJA 4MX3A 2RR11 1X50A 1W2TA 2PELA 3ZOIA 1F5JA 2EIBA 3PL0A 2QQVA 4JHZA 1REDA 4XMAA 2O1QA 1VB2A 1NLQA 5FK7A 3RWKX 1CWPA 2PLV3 1Y43B 1LEDA 4Y4YA 1UQXA 3KM5A 3TNPB 5LCWL 2TNFA 4NRPA 1UXXX 3KHCA 2WWJA 3ZXAC 2JDZA 3NSTA 4TZDA 4FSJA 1QQP1 4ASMB 4AQ2A 1UMHA 4XTPA 4I02A 1V6JA 5FKBA 2CNAA 2RJ2A 4BQ4A 2XLAA 3J7MA 5JDBA 5EHDA 5FQ0A 5B2GB 2ARAA 4ZONA 2R0FA 2O14A 2VOVA 4ORFA 4AFMA 2LUWA 1RUC2 2FMYA 4JKMA 2RJKA 3I2HA 4QX0A 5C3OA 4UF0A 4BJ0A 2HWD2 4CYDA 1OFSA 5FY9A 4R9AA 1N3QA 3JZVA 4QXCA 5T5PA 1T6BX 4CP1A 4Q0PA 3X29B 3TN92 4C0HA 1LOEA 2RS13 4NWWA 5JMCA 3ZMOA 1W3XA 1RUD1 4AI9A 1PGW2 2RR12 1RHI1 3FLTA 2ZAAA 4NAMA 3D0SA 1JU4A 5SV5A 2XOMA 3DKWA 2YC2A 4V2VA 2RHPA 4OQ9A 2YROA 3IDBB 1ULPA 3GHMA 2JG8C 3D3AA 3P3PA 3SHRA 1S0DA 4XDPA 1PIV2 4BZ4A 3B94A 1SPPA 2J1TA 1QQP2 1YUDA 1K5JA 3E6CC 1O91A 3FUOA 4L9BA 5JZGC 3I2OA 2V5YA 3ECQA 4CXYA 2ET7A 4NIHA 4JGYB 4KL1A 4XF4A 4PDWB 2FDFA 2W9XA 1CX4A 1J1LA 1RUH1 3EMRA 4CCNA 4MV2A 4AQSA 5KHKA 3KV5A 3NWKA 1S1AA 4M3CF 2P5BA 2WYFA 1JH5A 3IWZA 5CISA 4DZGA 3B9IA 2ZX0A 4G9SB 4X6QB 4GB33 5A3TA 2GSYA 3MFCA 4QWNA 1OH4A 4IEXA 1WA6X 4IDZA 5FY1A 1AXYA 2ET1A 4Y22B 4I01A 1RUD2 1ZBA1 1VBE2 2UY9A 5AVPA 1DQ4A 4L8QA 1JYNA 4FPFA 3KCXA 1QHDA 3TYJA 3G6JB 3B69A 1BK0A 2W87A 1AR93 1OC1A 3JD73 4RQPA 4XCBA 5CAZA 5IT6A 5D21A 1RXGA 1UYPA 2GNBA 1BXHA 2R063 2ZGLA 3KT1A 5L7OB 1LR5A 1FAYA 1EUUA 3LA2A 2DUPA 1H2NA 2DVDA 2XKOA 5A3PA 4YG6A 3JB4C 2P2KA 1W39A 2WSUA 5A3NA 5KHIA 3EJKA 4E2QA 4HONA 4H3WA 5DQ0A 3UJOA 5C6CA 3V0BB 5T50A 4JGZB 3ETQA 3SEPA 1IS3A 1GV9A 2A6YA 3O1UA 4EN8B 1VE0A 1W6NA 5E16A 2DFCA 1LHOA 1W0OA 2WO7A 4KU8A 3R4UA 4XQDA 2ZXQA 3SH4A 3VD4A 1C1LA 4E2SA 2V5DA 1WCQA 4I0AA 1YC61 1I9RA 4I3GA 5A6QA 3R4DB 2PHLA 4WM8C 3PTYA 3VKLA 3INAA 5IFPA 3LQCA 5GZCA 1RUC3 3I97A 5CFCB 1OURA 5A6XA 1D4VB 2HWD3 5ABJB 2PAEA 3SCGA 2A6WA 3AKPA 4Y3OA 2OZJA 2ZGRA 2PHFA 5FP9A 3J8F1 3IDAA 5IAVA 4YPJA 1ASJ1 3U1XA 4HPKA 4JCKA 1LGNA 3TN93 4CDXC 2CGPA 1IS6A 4MZUA 1GKBA 4AYUA 1YIPA 2RR13 1H6YA 4XF0A 3WHTA 4EWEA 4W6YA 2VECA 1GSLA 2DCKA 4MUVA 5FDBA 4AI2A 1N3OA 3I4IA 3GYDA 3ZFEA 4IV1A 4LMFA 1AYN2 5CADA 3N3HA 1PIV3 1QQP3 2BPA2 4LIVA 4LLOA 3KF5A 1FX5A 4LK6A 1SBEA 4CSWA 5C9AA 2GDFA 2ZGPA 5F37A 1M4WA 1YQCA 4PCRA 5BNNC 1A78A 5DAWA 4CPBD 5FUNA 2X10A 2YUEA 4RS5B 5JXGA 4NIIA 3WSOA 4SLIA 3OEAA 4OUMA 5DMYA 2R1DA 2FDGA 5C5UA 4CEYA 1FV3A 1JMUB 1U5XA 2GC1A 2ZEZA 4IEQA 2DV9A 4J25A 5F3IA 3J8F2 1C8M1 1ASJ2 2IFWA 4CDQA 4KG0A 3BTXA 1KITA 3LB9A 1WW6A 5FZAA 1RUD3 5FZ1A 1VBE3 4YG0A 4DMIA 1RHI3 4LBNA 4LEJA 1ZZCA 2WSVA 1NY71 2DUQA 5FZMA 5LA0A 2CDOA 4KBZA 4CU8A 3WD5A 1DZTA 1XE7A 4Y5TA 5FZGA 2VUJA 5FPZA 3ZXJA 4AHZA 4N8MA 4AVVA 4GJYA 5CYYA 1PZ7A 2YBPA 4NROA 1HB1A 3KGZA 2A71A 5H9SA 4O9EA 2GNDA 3LPFA 1VRBA 2WNVB 4KWKA 1VBA1 1POQA 1ND2C 2XJTA 3ZYGA 1G9FA 3OJBA 3NQHA 2WQZC 4LQRA 4UBHA 3ZMNA 3GJAA 3N7MA 1LHWA 2VQUA 4E9KA 3H3UA 5BXXA 3H8RA 2A6VA 2DUOA 5FYIA 3HNBM 4XDQA 3KV6A 5HI0A 3SH3A 2Y0IA 1OOPC 2R30A 3FN9A 4DPNA 4J1XA 1QJY1 5A3OA 5KXCA 1JZ7A 4F8AA 1F15A 2XJSA 3IKWA 3VBUB 1CD3G 2WABA 1B35C 4QGLA 5DABA 1OF4A 4UFIA 3VBHA 5LEJA 4ZZ5A 1C8M2 2QTWB 5F5IA 3O7OA 2HWE1 2JIJA 1GR3A 2G9ZA 2RDQA 2C6SA 3AJZA 5FP4A 4QGMA 5FYCA 4MHUA 4QXKA 4MGKE 2BEOA 3C7OA 4Q26A 1AXZA 1RMU2 1H0BA 1IHMA 2K46A 1DDLA 2VZ3A 1NOVA 1O5UA 1UU6A 1RUG2 1N1YA 5FUPA 3UESA 3Q8CA 2QKDA 3B3QE 2YPJA 4QX7A 4R8HA 1VBA2 3J7NA 3P5BA 4J1WA 3V56A 1AJOA 3HN1A 2WZR1 3AMQA 2ARCA 2OX0A 4AHWA 4D6SA 1XBFA 4INDA 3RMXA 4AEKA 2XVGA 1NCQB 2P3KA 4QX8A 1XYNA 1VJ2A 1QJX1 1W03A 2BOJA 2IXCA 2W46A 1QJY2 3CL1A 1YJKA 1I1EA 3UKTA 1OI6A 2HWC1 4LO8A 4F83A 4D94A 1W9WA 2WWUA 4AVTA 1AX1A 1AYN3 1DF0A 2ZKLA 3R05A 4HOOA 4X6RB 1VMHA 4DUWA 3ALQA 2QQOA 3CJIC 3WDTA 2JECA 3MICA 4DXZA 3H50A 1V6IA 3N7JA 4MADA 1H9PA 3D0JA 1WBFA 3UKNA 2DU1A 2EF6A 2BWAA 2JWPA 4GULA 4CP9B 5C3PA 3UGGA 2MHFA 1HQNA 1XNCA 2W95A 4PHZA 4Z1VA 1DG6A 5FBJA 3T0BA 4FP2A 4ZPIA 2HLEA 2ID4A 1HQLA 3IAPA 5LA2A 1I3HA 1XU1A 2EXKA 3J8F3 3VDAA 1ASJ3 1FNYA 2AENA 2WZR2 4UAPA 4XVHA 5L9VA 4WVMA 1MQTB 1GOHA 2YU1A 3VBRB 3WZ1A 1RGSA 2BUKA 2HWF1 4FPOB 4OI4A 2H0VA 2DU0A 1W6PB 1QJX2 2UYAA 1QY4A 4K1ZA 4LHKA 3Q8BA 2HWC2 3J7LA 1ENQA 2KD7A 1SLTA 3BTZA 3RZZA 3J9SA 5I8TA 3TAYA 1CPMA 1K5MB 1QJFA 3ACLA 2XWBB 3RWNA 3K77A 4LO5B 1MR5A 3H0OA 2X5IB 1DQ2A 5GLTA 2JDPA 2VM9A 1BYHA 2ZX3A 1DYPA 1W9YA 2Y34A 1O8SA 3OBTA 1RUOA 5J09A 3ATGA 4YW1A 4PQ9A 4BMEA 4Q8LA 4XFBA 3S0MA 3NO8A 5FZ4A 4LE3A 4LO7A 3MW4A 1SFNA 3WF3A 4JGYC 2BJSA 1V6NA 4PDWC 2FDHA 3POYA 1C8M3 3PUQA 1RUE1 1QJU1 3UNPA 3O14A 3GALA 2C0ZA 4X8NA 1LJ7A 1WGPA 3FMGA 2PN5A 4MGYE 1RMU3 3E5UA 5F3CA 4COWA 3VHOA 1QXRA 2ZMKA 4Y1XA 4TSVA 4BPZA 1DQ1A 4H7LA 1A8MA 2H6CA 4EN0A 5IK7A 5M0TA 1UOGA 5A7PA 2DCZA 3VD7A 1LAJA 3WP4A 1GUIA 1VBA3 3OD0A 1AL0G 5LATA 2W91A 4IW3A 1OD5A 1IS4A 2DCJA 2IUWA 1PNGA 1R1A1 2DDUA 2WKKA 3PJQA 4QX1A 1A3KA 4Y5Z0 4YM0A 3UGFA 4YVWA 4MGTA 3BPSA 1T6GC 1W2OA 1QJY3 3LEMA 2JE9A 3OY8B 3ZN4A 4DNYA 5L7OC 4A2UA 2WFF1 4AAPA 3NL1A 2FCVA 2CL2A 2H0BA 2PAMA 3M3QA 2ZJCA 5EJZB 2PXJA 4JGZC 1JHJA 1NLSA 2Y6LA 1RUE2 4EN7B 1QJU2 3JXSA 4AFCA 1BEV1 3VGIA 3AX4A 4B4QA 4EWDA 1JXNA 3DECA 3ASIA 1F35A 5DDJ1 5A32A 1W6QA 5JMOA 2QUOA 5HCHA 3P1IA 1D4M1 4AI3A 3RS6A 5F5QA 5KR7A 3CBNA 3I59B 2ZPXA 4YG3A 2D3SA 2ERFA 1SG3A 4JHTA 1DFQA 4BXFA 1RUF1 1VR3A 4N7UA 2Z42A 3VD5A 2FZ1A 1HV1A 1STMA 2VTXJ 2WZR3 1OMIA 2LS6A 4CCKA 3KS7A 5CFCC 4QKNA 2B7YA 1O3RA 2E7TA 2UWAA 4ZU4A 4C0BA 4J6GA 1CZVA 5ABJC 1BMV1 5FYYA 3JU9A 1JU3A 1QJX3 3OSDA 4DEVA 3NW4A 1X36A 1QJEA 1TME2 2PHTA 2WFF2 2GP5A 2HWC3 1W05A 2TEPA 3RSJA 4AI0A 1WZXA 3WW4A 4META 2RMU1 1W8FA 4XAEA 3T2QA 2FDJA 3ZXEA 3ZN5A 1GMMA 2JX9A 2YDEA 4COYA 2SBAA 2ILMA 4YVSA 4GA9A 3PLQA 4XQWA 2MEV1 5FZOB 1BEV2 1N1TA 5FPAA 3VBFA 1VMFA 3PURA 3NJVA 4MGIE 2VUCA 4P9YA 2JG8B 5DDJ2 5F9TA 4TWTA 4QT6A 1PGSA 5ANNA 5IVVA 3WP6A 3T2OA 3N9MA 3SC7X 4P9XA 1K42A 5EIYB 3L2HA 4FPCA 3ZSLA 2R49A 3T08A 1RUF2 1W8TA 4LBQB 1SLCA 4K8RB 2V72A 3CKHA 1ND3B 3OEBA 4RS5C 2RS51 1RB8G 2VMIA 2ARXA 3HAGA 3VBOB 1N1VA 2HWF3 4YGDA 1BMV2 1IPJA 4CZSA 4IQPA 2Y33A 4CCOA 1JOPA 1LTEA 2QBXA 3ZR5A 3WVJA 2EALA 1NKGA 1OVPA 4AFAA 2HKXA 2YMZA 4D69A 2BWCA 4MG2A 2RMU2 3HIFA 1JYTA 4Y5SA 1GWMA 4RD7A 2XLGA 2JE7A 5FMOL 3ZFGA 2ZGSA 2MEV2 2YV8A 3SITA 2V4AA 4JX0A 2A1XA 1W0NA 3HNMA 3FHQA 3Q8AA 4OHWA 3AP7A 4N53B 2WZPP 4E2GA 2CGNA 2ENRA 2JIGA 5F32A 3VBFB 2WNVC 4ZKTB 4RGGA 4X8PA 4XCAA 4RFRB 3VB9A 1BQPA 3N9NA 4ASKA 4NUBA 5L73A 3C8XA 3POEA 5DUWA 4AEDA 5GZDA 3PVEA 1O3TA 5BNPA 1Q8OA 5LZ6A 1MACA 2H6BA 3LCPA 4K1YA 1RUE3 4QPGB 3VV1A 2IZWA 1QJU3 2RS52 3GXUA 4IV3A 3U11A 3VBUC 1D0GA 1UO9A 3N9PA 2Z5WA 2V4VA 1UYXA 2ZHMA 4IE4A 5BNOB 5HPOA 1T2XA 1ZREA 5AVAA 4Z92B 2VZVA 4Q0UA 5A7WA 1S0GA 4BIOA 1OVSA 4UFHA 2P3YA 3WG4A 3U0ZA 2VZ1A 5G05L 2KA3A 1IQAA 5F5CA 4E8DA 1NG0A 2XH6A 4Y1UA 2VMDA 5FO8B 3K48A 2Q30A 2WINB 4EV0A 3SISA 4AW7A 1POV1 3M8LA 2VUAA 1R1A3 1WMFA 4SBVA 4N9HA 5EV7A 3S7IA 1XQNA 2DBIA 2X05A 3THCA 2WC2A 1IKQA 1TME3 4OYUA 1MS8A 2WFF3 2WRAA 1PMJX 5FZLA 1L7QA 2DVAA 3K3NA 4XJWA 1EPZA 2Y26A 4MH0E 2V09A 4A6SA 5FPVA 5I0TA 2PHUA 1FI2A 5DUVA 1MS4A 1D0HA 2YGLA 3DPRB 1BEV3 3LA3A 2JDNA 4UOJA 1PGL1 4JZRA 4RN5A 5DDJ3 4UFJA 5LBEA 2RS11 2P3JA 2R0HA 5LBBA 1DGWA 3IDCB 4FAGA 2WZEA 4XUTA 1FMD1 1MS3A 1FATA 4Q4V2 1YFWA 2B39A 4LKFA 4XFHA 1RUF3 2D43A 4QPIA 2ORZA 5C7GA 2QCSB 1O3QA 1B09A 3GCWA 3VHRA 3MZHA 1X8MA 1APNA 2ETEA 1QNYA 1QWRA 2EIGA 1AL21 2QQLA 4XC9A 5JSRA 1NXMA 3T2TA 3WG2A 3JUUA 2GZWA 1F9KA 1OH3A 4QXHA 3MW3A 3OYWA 5B4XA 3VBRC 2W68A 2RMU3 1LESA 2WDBA 1GICA 3ABZA 5E8AA 4IEYA 3V64A 4AEMA 4CUAA 1CZSA 5AC91 2E63A 2MEV3 5F3GA 3PVOA 4F7ZA 3F95A 1TNFA 4RHV1 4Y1VA 1KEXA 4V2WA 3SMHA 4AAXA 1PGL2 2E7AA 1KS5A 4W6XA 5GZEA 5FR3A 2FZ2A 1GQHA 1PO11 2J1SA 4OVEA 1IPSA 3OF1A 4LBJA 1LU2A 1H8TA 1QGLA 1K5MC 2RDNA 1NCRB 3IB3A 4N90A 1OSGA 4FFHA 2NP0A 3VZJA 2W1QA 3W58A 2PHXA 5C8WA 1FMD2 4BXSV 2R1BA 2RDSA 5I8YA 3O1TA 2X5IC 1OQEA 2TBVA 2VD7A 4FI9A 2QQUA 4Z2WA 2FHRA 4ZU5A 1VAVA 2RS53 2XL7A 3H3ZA 3O1SA 3RYRA 3VHNA 4XXAA 1WKYA 3T09A 1XU2A 2WNEA 2MPFA 3OUIA 4H55A 4Q0SA 3KB5A 4AGRA 4AFBA 3V0AB 1TE1B 2W92A 1UZVA 2HBUA 1L7LA 5AFBA 1S0BA 1YQ5A 2BTVC 2QZ3A 4CTEA 3ZN6B 4XJ8A 1UKGA 1X7NA 4LXLA 3B93A 4YGEA 2BERA 4D7YA 4FVVA 5AC92 5JAXA 4BLIA 1GNHA 1PX3A 5FZKA 1KJLA 1WUVA 3UK9A 1PO12 1OQ1A 3K51A 1YEWA 5C3RA 3POBA 2I2SA 5CEHA 3E5XA 5T52A 3E1F1 4XFCA 3BTYA 1OLME 1RUC1 3AMMA 4NPMA 1LGBA 2LW8A 3O0XA 4K20A 1BBT2 2JG9B 4Q4W1 2W3JA 4C90A 1W04A 2HWD1 3USUB 3WW2A 1NUKA 4Q4Y1 3U75A 4XBLA 3GZTB 2JD4A 4ZXEA 2VMEA 1S0CA 4DFSA 4JV4A 4QQ2A 1G86A 1RUNA 1XJAA 2GC2A 3TN91 4GZ9A 1H9WA 5E89A 4DOUA 1PGW1 3CJIB 2Q8CA 4BH9A 3RVHA 4M00A 1QNWA 2DURA 2P4EA 1QIQA 1JZ8A 1HV0A 1WLCA 3T0AA 4Q27A 5FZHA 1ENRA 2RM21 3GGLA 2XB6C 1UPIA 3DXTA 1J58A 4ET7A 1LU1A 2OYZA 1RITA 3F2ZA 1PIV1 4OMCA 1POV3 3OOXA 1ZNPA 1JBCA 2VL4A 4NIDA 3V65A 3DL3A 1CIWA 4XAAA 2YU2A 4Q0VA 3O12A 2XUMA 1DGLA 2BNMA 3IT8A 5LK5A 1D7PM 4C91A 1YQ2A 5KXBA 1ACCA 1ULOA 4GH4A 4A7YA 4LA3A 2WYSA 4CDUA 3CQOA 3FJSA 4Q4W2 3ROUA 5FY8A 2K9ZA 4Q4Y2 1W06A 4W65A 4XEZA 1PK6A 1HKDA 5J48A 3LGRA 2J1RA 2Y6JA 2DCTA 3HVDA 2ZMLA 4WM7B 5I93A 2HBTA 1DYOA 2F4PA 3PUAA 4BDVB 4WVWA 3LIGA 1W6OA 1RTVA 3LEGA 4MOAA 4RGAA 1C28A 4GWJA 1F4AA 1VBE1 3AYAA 3HEIA 2VE1A 2P1BA 3MI8A 2DWRA 3ZFFA 1FMD3 1OKQA 5KHHA 3ZLIA 1XYPA 1OA3A 2NMNA 3LOBA 3POGA 1GWLA 2RM22 4OHZA 4ISRA 3WV6A 2LM3A 2XWJB 3AP5A 3LZZA 1DLCA 3W21A 1JYVA 1V6LA 1WMEA 4XMIA 3Q8EA 2E31A 1OLRA 5D8AA 3RQ0A 5IWFA 5A3UA 1AL23 1TMF1 3I2DA 3POJA 4OI2A 5BV6A 2DYCA 1O8PA 3FX3A 4OHYA 2ORXA 1E5SA 4LE4A 4XZUG 4HZFA 4PLMA 1GFF2 1ND3C 5DPNA 4E8CA 1NT0A 3VBOC 2ZBJA 5FQ0B 1JZ2A 3S30A 3UL2A 1ONAA 4MGZE 5AC93 3A7QA 1EV11 5J98B 5A7SA 1OA2A 1H1MA 4UF0B 2XR4A 4RHV3 5GLWA 2VU9A 3H1MA 2VO5A 1CJPA 4FOVA 2FDIA 1PO13 3N35A 3PUSA 4I30A 2HWB2 1DCSA 3ZSKA 1W8HA 5JXHA 2ZX1A 1UF2C 2GALA 2QFEA 4BISA 2CU5A 3WCSA 4QKDA 4DS0A 3GHNA 2JB4A 5A6YA 2XPJA 1QOSA 2B42B 3DYOA 4N53C 1BBT3 3S57A 3H7YA 1AF9A 3I54A 1UYYA 2AC1A 3KGLA 1UY4A 3FE5A 2D6NA 3VBFC 3H8OA 3MHZA 4N7IA 5T5OA 5BNQA 4UW3A 2W94A 1TMF2 4NOTA 4B4RA 1YCIA 3DF0A 4DIQA 2CDPA 3E5QA 1SPPB 3EXUA 4OZXA 5D8AB 5EP9A 1UPSA 5L19A 1MEC1 1LKNA 4QPGC 5FZFA 1SMVA 1W0PA 2WLQA 5D2AA 1RXFA 3FFZA 3PDQA 1AZDA 3CMGA 4XUQA 5BNOC 2D5FA 1W2NA 4H2AA 5T54A 3BIWE 5LBFA 5LY1A 2P6CA 2XGXA 1EV12 2G19A 1AYN1 4MO3M 1HXS1 3S6PA 3OGVA 4BQ5A 1E5IA 4DRRA
chains in the Genus database with same CATH topology
1DHKB 1YLLA 4WV8A 1C8NA 1GLHA 3AKRA 4HVQA 2ZGQA 4GMP0 4HLTA 5F6KA 4GIQA 2A5ZA 5CNAA 4LR4A 3WOGA 4NO4A 2I74A 4KGGA 4Q4W3 2VW0A 2WT0A 4YZ5A 2ES3A 3PVBB 1I6XA 4Q4Y3 4EWAA 5CFDA 4CRQA 4WZFA 5JWPA 1X8EA 4K40A 1N1SA 4RQPB 1UZYA 1TQ5A 1PHMA 2X29A 3IPVA 1MEC2 1RVF1 1AXKA 3WP3A 2WA3A 1SEFA 4FTSA 3WG3A 1V6MA 3DPRC 5J7MA 2RM23 3WDXA 1JOJA 4DB5A 5LRSA 2GH2A 1HXS2 4IEUA 5DG1A 4LT5A 1W6NB 2UY8A 4LUMA 4YW5A 4FP3A 3I7DA 3SLIA 2VMGA 1ZRCA 3E6DA 4XYXA 4B4PA 4DQAA 3N7LA 5DUXA 4GXLA 4HFSA 5K0UA 2A6XA 3VZMA 5CG9A 2EXHA 4XJ9A 1CR7A 2BW8A 2XJVA 1ULEA 4M3CA 1CONA 1LOFC 1QF3A 4UBGA 2HWB3 1O4TA 4N43A 2WT2A 1RVF2 3JB8A 4HPKB 1RMU1 5JOWA 1H2KA 4XF1A 2BVBA 1KS4A 1LRHA 1RUG1 4Y20A 3MF6A 2VVFA 4R9CA 4S2FA 4MVTA 5C4WA 4PIZA 2RS31 3AZVA 2JENA 3MGUA 1NCRC 3VL9A 4K3UA 5FOBB 4GWNA 4IV1B 4MYEA 4Q29A 5GJ6A 3ZFEB 1TMF3 4YLZA 2Q5TA 3NV2A 1YXWA 1CAXA 5J3UA 4IEVA 3MPBA 5C9AB 4LHNA 4JAAA 3THPA 4IESA 3TNQA 3SCHA 5FPXA 4XW3A 4FTBA 3CEWA 4RA0A 1EV13 1Q3EA 4QQHA 4FBFA 3VUOA 3AXEA 1UAIA 4FO9A 1N47A 1LGCA 3VZLA 1LHUA 4AWDA 4CDWA 4CEYB 2WIIB 4S2HA 4KGQA 1Y7BA 4CDQB 1U5IA 4E27A 2K2SA 1HQWA 2YGMA 2C9AA 2PHDA 1ZBE2 1J3RA 2RS32 2JJ6A 5D1IA 3CLPA 3MIHA 3WQ1A 3AYDA 2R6QA 4N9IA 1HDKA 1H8TC 1ZYBA 2NMOA 1XE8A 1W2UA 2JG9C 3HT2A 1IPKA 1MEC3 1WLDA 2OUHA 3SH5A 3J26N 2BVVA 1KDKA 2O8OA 4YFWA 4PIXA 2VMHA 1HXS3 1DQ6A 1CVNA 4IEWA 3VBHB 3ST7A 3AKSA 1LOAA 5KXEA 1C3HA 3LAGA 4BOWA 1W6MA 1ZA4A 1CAUA 4S2GA 3VN4A 2B9UA 3H1YA 2OIIA 3VKOA 1GNZA 2DVBA 1YO8A 1NE6A 3SXWA 5GLZA 1UZZA 1ZX5A 1DU3D 4Y26A 1NA1A 3VBSA 1LOCA 1RVF3 1KDMA 4RFT0 3MIGA 2VGDA 2VVEA 1D2SA 4WM7C 5FBZA 2G9GA 3ZYPA 2KXLA 4HKLA 2GMPA 1CAWA 4COUA 3AKQA 1Z7S1 4COZA 2JXAA 1WBLA 2AR6A 3T1LA 2CAUA 4OHXA 3EQEA 4YFZA 2A3YA 4QPYA 3WT3A 1ENSA 1F8VA 4KWJA 4XIOA 1Q8VA 3WQ7A 2ZGUA 1G8WA 4BM8A 2QQPA 4I09A 3RJ2X 4P9WA 4FXKB 4YZ1A 5LK7B 2HYKA 1Q8QA 4AVSA 1J3PA 5CIRA 1IZ3A 2XHKA 5FCCA 3NAPA 2B46X 3OD4A 4CEWA 1UW8A 4WVMB 1OPOA 4HSLA 5IK4A 5E88A 1RUG3 3M3OA 1VBD2 3H1WA 1Z7S2 1ZBE3 1XRUA 4QU2A 2RS33 1CAVA 2VNRA 1LULA 4B8EA 1AR61 2Q4SA 3BTAA 2WT1A 5CBLA 4TLFA 2D6MA 5CU1A 3WDVA 5IK5A 1OLQA 4YW4A 1YYNA 1SLLA 5FOJB 1UMZA 1TME1 4FXGB 4K6BA 3B02A 1S0FA 4OLLA 5D8AC 5HXVA 4FAHA 1GBGA 1LEMA 5DZFA 1CN1A 1Q56A 4E4SA 3HBZA 2IWGB 4BIFA 5JSPA 1H1IA 2RE9A 1Q43A 2D98A 2IXHA 4IXLA 4XOGA 4CP2A 3ILFA 5EWSA 2ZAHA 4AVCA 1BJQA 1V9U1 2WL1A 3EHKA 3AFGA 1AX2A 4D7TA 1JN2P 1BKZA 2Q8OA 1AR62 1F5FA 1XXNA 2ZACA 3MIBA 4WVVA 3ILRA 2WNUA 1JUHA 2OZ6A 1SCRA 2WJSA 3SCFA 1KD7A 3L2YA 3AZWA 4BYYA 3L9JT 4RQPC 2XLFA 1JW6A 5JZGA 3APBA 2BBVA 4YVWB 3N36A 2K0GA 1F2NA 4FPGA 1JYIA 2YXSA 1EP0A 1V6OA 4M01A 2ARBA 3ZVXA 3JQWA 1ZVFA 2OVUA 1LB2A 3M3CA 2XJPA 1CJDA 5C8CA 2W0XA 3M3EA 1LHNA 1NQJA 3AZZA 3WDYA 1V9U2 5A32B 2D97A 1W6QB 4LA2A 1KXGA 4YW3A 3RRDA 4YGCA 1G9AA 2QDRA 3AYCA 1SLBA 4QHBA 1S0IA 2B5HA 2CTVA 4LBQD 3MIEA 1V70A 5CA6A 5CG8A 3TWIA 4MXVA 5KWRA 5JI9A 1LOGA 3HR9A 2EVXA 2LALA 4XHXA 5JOXA 1REFA 1VBD3 1NE4A 4HK9A 1Z7S3 2VOXA 3O0WA 3ZYRA 4AI1A 5HBAA 1YHFA 3M2MA 5T5LA 1DZQA 4YVSB 3PMSA 3ILNA 2HEYF 1V6KA 1OHFA 4YRDA 1S0EA 5EYXA 2GNMA 4IV1C 3ZFEC 4HBNA 3NV1A 4WM8A 4CP0A 2Z69A 2BQPA 1RUJ1 3KMHA 5EJ3A 1MZEA 5BUVA 5C9AC 2XKPA 1C1FA 2DTYA 1A8DA 3ES4A 5J96B 2G4IA 1NLRA 2A6ZA 3VLBB 4LO6B 4XTMA 1PVXA 5SV8A 4NWVA 1UCXA 3AXDA 3QBQA 4MXWA 4CEYC 4CDXA 5A33A 4GWMA 4Q4V1 2EAAA 2IXKA 4CDQC 1TNRA 1AR63 3THTA 1YFUA 4YARA 3ZFGB 1RJ8A 2GMMA 2IFRA 4URTA 4DINB 3ENRA 3MEPA 2ZGMA 1MS5A 5FO7B 2QJVA 4FQ4A 4LBKA 3ZPYA 3A4UA 1MZ5A 5BNNA 5C4WC 1RUJ2 1ULGA 1XNBA 4DY3A 4AEDB 4AGGA 5BNPB 3DV8A 3FBYA 4V1PA 2GNTA 2GH8A 2KM2A 4IV3B 3NV3A 2BFUS 4FQZA 1VLNA 1V9U3 4XILA 3VBHC 1KFXL 1OA4A 2GC3A 1SCSA 2OUJA 2GC0A 5JLVA 3D4KA 5A33B 1VRH1 4R9BA 4YGBA 3WUDA 4L92A 5GZGA 1PVC1 4QQPA 3WDUA 3M1HA 4Z82A 1ND2A 2DVGA 1GANA 3SNMA 4YZ4A 5DXDA 3WCRA 2F6BA 2VH9A 2XVKA 1R082 1BVVA 3PNAA 4AQ6A 3VL8A 1OOPA 3BU7A 1QMJA 1S0JA 3AMHA 1B35A 2VQ0A 3VZKA 3U10A 2SLIA 1EAH1 4U2AA 1U5ZA 2I07B 3H7JA 4B3NA 2OW4A 2NQYA 3VDDA 1SQ4A 1BBT1 5KBFA 3RYPA 1VRH2 3U07A 5E1RA 5H9RA 1GZWA 1PVC2 1QXPA 1J1TA 3NV4A 1WCDJ 4QPIB 3RG0A 3R6SA 4KBBA 3RI9A 2CGOA 1ULDA 2NM1A 3ZIXA 5J36A 2R071 3OYWB 4RR3A 4U36A 3TOJA 3VBSC 1MVQA 5DZGA 4C1XA 4OUSA 4HKOA 4JQRA 3BB6A 4HVOA 4DY5A 3ZO0B 3VKMA 4FPJA 1EAH2 2WS91 2ZOEB 4ES8A 4UW6A 3IN9A 1QOOA 1AR81 1C5IA 1NXD1 1H8TB 2CYFA 4NPRA 1RUJ3 1WW7A 4LLFA 4PIYA 1FXZA 1HW5A 5GKAC 3KT7A 4PF5A 2D6KA 1WA4A 3ZX7A 4B29A 3MPPG 1U12A 1VAMA 3AYEA 1YI7A 1QJZA 1AHSA 1HRI1 4LHLA 2PA7A 4ZXKA 4Q4V3 1Q5OA 1AVBA 2XBO1 3GF6A 2A70A 2R072 1EYBA 4BE3A 2VG9A 1GQGA 3NAPC 1Y9QA 4Q1RA 4Z8BA 4JTOA 3BALA 3PJYA 1UIKA 3W9AA 3O0VA 1DIWA 2WS92 3KSCA 1O7FA 2W52A 2AZ5A 2R042 1AR82 4BWOA 1BVP1 2ZZJA 2MNGA 4RL7A 1R083 3VZOA 5ACA1 4QQOA 4YM2A 1DLLA 1NZCA 3N4MA 3KZ4C 4ATFA 2AH2A 4YVWC 4FT8A 3VKNA 2HWB1 4JGYA 1RUI1 3IDEA 2JEMA 4PDWA 4Q2FA 2IC1A 5F6LB 4BA6A 2P3IA 4XE9A 1HRI2 1R092 2FBEA 4ONUA 2XBO2 3FZ3A 4XZPA 3TBDA 1ZZ8A 2R32A 1VRH3 4HT1T 4G3YC 1PVC3 1FPN1 1HX6A 4K9SA 2V73A 3QD6A 3ZXFA 4Y22A 5JIAA 1ALYA 1VALA 1IOAA 5H9QA 4EROA 3ZSMA 3KLSA 3O5SA 1COV1 3AZXA 2C5DA 1AR71 1LOBA 1WD4A 2YYOA 4YYOA 1PM7A 2GN3A 5F1RA 5ACA2 4NR1A 2EXJA 4GH4B 3RNSA 2WNUC 5L7OA 4CDUB 4PBOA 3ZIWA 4D3WA 5L36A 1PK6B 3RMYA 3V0BA 2IXIA 1EAH3 1RUI2 2UU8A 1KQRA 4JGZA 5H9PA 1H4HA 4P14A 3J4UH 4R4XA 2A75A 3C3VA 4FOQA 1W6OB 4LO4B 1SLAA 3LSDA 4YVSC 3WG1A 4LNVA 5C33A 3JBG1 3ZFFB 1VP6A 4Q8KA 4MLOA 3W59A 3GZUC 2D7FA 3QH7A 3ZSJA 1FPN2 3BPZA 1UKRA 2O8QA 2PAKA 3ME2A 5C8CC 4XJZA 2Z79A 1LODA 4LUKA 5JPMB 1H30A 2HJIA 2Z2SB 3FUQA 3G7DA 4IEZA 4XIKA 2VW1A 3AK0A 1MVEA 4C1WA 3CNAA 4XBNA 1QOTA 1F31A 1COV2 2E9QA 5CFCA 1RHI2 1AR72 1N3PA 3B5LB 2OPKA 3MW2A 4HN0A 4KH9A 4H14A 5ABJA 2R073 2B45X 1ZZ6A 2YZ4A 2PHRA 3B01A 4JTNA 3FFQA 2NYYA 3OGGA 3QH6A 5FRAA 3DGTA 4BMBA 3FWEA 5I91A 2XL9A 1IS5A 2WS93 3LKJA 3POWA 1U0AA 3DN7A 2BNOA 1IGOA 2R043 1AR83 1UX6A 4E4DX 1RUH2 3ZFGC 1HRV1 2A3WA 2W39A 3JBG2 5JPNB 2BNNA 3UJQA 1C4RA 5J37A 4DRVA 1Q8PA 4XF9A 1FYUA 1QXJA 5KC5A 4TYSA 4JC1A 1LENA 1GZCA 5GALA 3D8CA 1H2LA 1HRI3 4RS5A 4AEDC 1ZBA2 2CWSA 1R093 5BNPC 1JYCA 2D5HA 2XBO3 1D2QA 3D82A 3M7AA 3TRSB 3KCYA 4IEPA 4IV3C 4YW2A 1SBFA 1PZ9A 3JCIA 2BYVE 3CO2A 1PO21 1ZZ7A 4GQ7A 4AGVA 5JSOA 2ZTNA 1E57A 1UD1A 1VIWB 4RSUA 3WDWA 2ZGNA 1RINA 1CPNA 1VBB1 2WQ4A 1HRV2 4UW4A 5ACA3 3UV9A 4Q4X1 1URXA 2E6VA 2WNVA 3AM2A 4QQLA 4FTEA 4HSJA 3WINE 2ZZQA 4L11A 5CFDB 3NKGA 2PHWA 3AMPA 1RUI3 2ZX4A 5FLIA 4R4ZA 5HCFA 4QD2A 4R9DA 4ISQA 4AEJA 3E97A 3IPVB 4P9LA 3VBUA 1S55A 2QE3A 2NLRA 2ZA9A 3KQRA 3NVCA 1YI9A 3VZNA 1ZBE1 2EA7A 4P9IA 2ZGOA 4JDNA 1DGRN 1FPN3 1WLTA 1J3QA 3BCWA 2UWCA 1PO22 2VNOA 1DGWX 3MDPA 4D7SA 3EO6A 4FPLA 2X53S 3MLJA 5KHJA 2CAVA 2WA4A 3WHUA 1COV3 1AX0A 1VBB2 4I3PA 3WP5A 2ZKNA 4IL7A 1AR73 1ZZBA 2A73B 4QPIC 1FT9A 1I5ZA 4QGNA 2NN8A 3HD8B 4ES9A 4Q4X2 1QH7A 3LOIA 1WLWA 5GM0A 5K0UB 4FPEA 3A0KA 3CJXA 1CGPA 4W6WA 3MYXA 3C2UA 2JKBA 4M3CB 3WXPA 4XFAA 1FNZA 5FTTC 1NCQA 4P5HA 2D44A 1RIRA 2ZCWA 4NN0A 2VULA 4N43B 1S2KA 1RUH3 2D6LX 2Q0AA 3Q9OA 1QDOA 1VB4A 3JBG3 3POSA 1AYM1 3KT4A 1RUNA 2BGCA 4WZCA 5I0RA 1ZM1A 5BYNA 2DF7A 4Y20B 4Q0QA 2I45A 5C4WB 4GKYA 2CY6A 2Q1MA 2VNGA 4I2OA 2JICA 5BPXA 1G7YA 2UURA 3VDDC 1ENXA 4KQ7A 1ZBA3 1CAXB 2QVSB 4L2NA 1NY72 4QMAA 2PFWA 4Z07A 1JHNA 1Z0HA 4Q1PA 1EPWA 1XYOA 3IIAA 2DFBA 1POV0 4XFFA 1MQTA 4IERA 3VBRA 4KWLA 1UN1A 2D6PA 2EXIA 1W6PA 4CDWB 4OHVA 4OULA 4KG8A 1C57A 4JVAA 4YM1A 2QZ2A 1HRV3 4RR3C 4HANA 5EYYA 1AYM2 3QACA 1SDWA 1ULFA 2ATFA 1K5MA 2NPIA 2WWSA 3ES1A 4PBPA 4LBMA 1BCXA 2X5IA 1H2MA 2HWE2 1YFYA 2DTWA 1U5YA 3RYKA 5KXDA 1RJ7A 1PMIA 2E7QA 2VVDA 2CV6A 1YIFA 1ZZ9A 3H9AA 1ZRDA 1VBD1 3OBRA 4JDMA 4NHKA 1NYWA 1MS0A 3PHMA 1REEA 2D40A 1OQDA 2QNKA 2PYTA 3M70A 3OPZA 5JIUA 1PO23 3D5OA 5FO9B 2AGSA 2YHJA 3FHIB 3BOWA 4FCAA 2ZX2A 5EFUA 1O5LA 5A3LA 2Q1ZB 1VBB3 1AJKA 4IEOA 5GZFA 1LECA 2YY1A 5K9YA 1MZFA 4I0BA 1W6MB 1OPMA 1UIJA 4Q4X3 5CVRA 1CAUB 2VXRA 4K7JA 3KCCA 3WQ0A 4COVA 3E6BA 2Y38A 1SBDA 2HEVF 4GH4C 1MS1A 1V00A 5TSWA 3OY8A 1NA1B 4CDUC 3VBSB 4PLOA 4XF3A 3LSEA 5I8SA 1PK6C 4KU7A 2XG3A 3CF6E 1Z78A 1DYKA 5FLHA 1CAWB 3BOPA 3NKTA 1XNKA 2XVLA 4FPHA 4AFDA 3VHPA 4HETA 1DQ5A 5DUUA 4A3XA 3ZFFC 3T1MA 2HWF2 2PTMA 2VW2A 3HWJA 3QLQA 4HL0A 2D3RA 4FOYA 3I59A 4LULA 4AXOA 3MIDA 3R0RA 1SFYA 3WW3A 4AF9A 4MSVA 4HMZA 1L3JA 5AFEA 4H7MA 3QCWA 4E4ZA 3WNXA 1OFNA 1HIXA 3AB0A 2EAKA 1YJLA 3IM0A 1WCSA 4M0HA 5IUQA 3NAPB 2XJRA 4UW5A 3S7EA 4CEWB 1ZRFA 1AYM3 4JRAA 4GMP1 2XJUA 3BODA 1O4YA 2ZHLA 4K21A 4AK3A 1GYKA 1QKQA 2VY0A 4EN9B 1CAVB 1H4GA 1WD3A 4XFIA 2HWE3 3TB0A 3LWCA 4L99A 2JG8A 4P9GA 2N7GA 4PJYA 5FREA 3P3NA 2A3XA 1X33A 3OTFA 3MFAA 3ZDSA 3N7KA 5JVVA 1BK1A 3OCPA 3PVNA 4LBQA 1O4ZA 4M0NA 1Q8SA 3H8UA 3ELNA 1KFUL 1ND3A 3IMNA 4GALA 4UXAA 1RC6A 1UU4A 3AP6A 3VBOA 1CESA 5K7PA 1AUYA 2O0OA 1R1A2 4B7EA 4FPYA 3ZYIB 1ZRRA 2GAUA 4NHLA 5GLVA 2CWMA 3M3IA 2GN7A 1QU0A 4YZ3A 1WW5A 2R16A 4N53A 4AVAA 5DG2A 1KRIA 2AYHA 4EJRA 1RL3A 4F3JA 1GZ9A 2WNUB 1MZ6A 2D3PA 3FLPA 2DCYA 5DZEA 3WW1A 1WCKA 3ZXDA 4ASLA 5CFDC 4OI0A 1D4M2 4QM9A 1G9BA 5JZGB 4QPGA 3AMNA 3WX5A 3FC0A 1UU5A 5BNOA 1FOD1 3A0NA 5JR7B 1MS9A 4HVRA 5LEKA 4R52A 5JCTA 4YM3A 3GBGA 4S2DA 5C8CB 4XJUA 5I0SA 3NJZA 1YFXA 4G4FA 3D6EA 1LHVA 2E51A 3KD4A 1XNDA 3AP4A 1R1ZA 5I0UA 4AI8A 5FAXA 3AP9A 3AFKA 1BZWA 1G6NA 1S2BA 1VAKA 3LA7A 2IXJA 3MF9A 4P9JA 5K0UC 3AKTA 3GZAA 3FBMA 1G9DA 5LRRA 1PZ8A 1ULCA 2P37A 4XJAA 2HEWF 4N43C 3DPRA 3R4SA 1KJRA 4A7ZA 3JQXA 2VOWA 3B9CA 2FMDA 1A6CA 2AREA 5EXOA 2BFUL 5FMOS 1FOD2 4BQ1A 2NZ9A 2AUYA 4B7KA 1IKPA 3WR0A 1VBC1 1JTZX 2TUNA 1TEIA 3PMEA 2P17A 1SACA 5FFOC 3ZXKA 2X8KA 2DVFA 5A3MA 4XFGA 2UWBA 3RI8A 4Y24A 4L97A 4WVZA 3AZYA 1H1AA 1R081 4AQTA 5JOZA 4HN1A 2PLV1 2ZHNA 2VPVA 4WM8B 4WBBA 4PLNA 3UKVA 5CB7A 2UYBA 2GU9A 4OI1A 3USSA 2A7AA 1DBNA 4YSFA 2ZHKA 3B7MA 1LOFA 4NHMA 4QM8A 4GMP3 3CU7A 1QH6A 3EBRA 4MXWB 3RPQA 4CDWC 4LTAA 3ZYJB 4CDXB 3I8TA 5FLJA 1CQ9A 5KHGA 1DGRA 3HMYA 1NCQC 4JDOA 1PNFA 4JRLA 3B00A 3ZSEA 3URFA 1WW4A 4AHXA 1DQ0A 4XHBA 1NCRA 1VBC2 2QDNA 1YNAA 4IETA 5T5JA 1D4M3 1LCLA 2ZGKA 2D6OX 2ZS6B 4ATEA 3WLUA 2XJQA 2VOKA 4M3CE 5HCAA 4BHPA 2PLV2 1X82A 2OA2A 5BNNB 1Y3TA 2G9FA 5GLUA 3ZXLA 2ZABA 2GMEA 4HK8A 2E53A 1SLIA 4XETA 3MLKA 5K8SA 3V0AA 1M06G 2ZMNA 3M4FA 2LTNA 3HT1A 2RJLA 2D93A 5T3NA 4QX5A 5JI7A 5IK8A 3ZN6A 3RDIA 4XBQA 3MLLA 3MIFA 4LBOA 5HCBA 1MQTC 1G9CA 4KNCA 1YWKA 1H8VA 2ZGTA 4O9GA 4GB31 4EN6B 5JOYA 2RS12 4XXPA 2JG9A 2WFPA 3VKFC 1ND2B 3GBFA 4FOWA 3USUA 2WLPA 4YNIA 4BLJA 1NA1C 4Y1ZA 4K8FA 2YC0A 5KC6A 3JD71 1AR91 1QDCA 3AJYA 2R061 1OOPB 1FOD3 4NVPA 4AVBA 4A