4GH4C

Crystal structure of foot and mouth disease virus a22 serotype
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
GIVPVACSDGYGGLVTTDPKTADPVYGMVYNPPRTNYPGRFTNLLDVAEACPTFLCFDEGKPYVVTRTDEQRLLAKFDVSLAAKHMSNTYLSGIAQYYAQYSGTINLHFMFTGSTDSKARYMVAYVPPGVETPPDTPEKAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDVAETTNVQGWVCIYQITHGKAEQDTLVVSVSAGKDFELRLPIDPRSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb
molecule tags Virus
molecule keywords capsid protein VP1
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gh4C00
1HRV1 4GB33 1AR72 3VBFB 1QQP2 1RUE3 4CDXB 2R062 4IV3B 4PDWC 1QQP3 1RUE2 5D8AC 4GH4A 1NG0A 4CDQA 1B35C 2RMU2 5ABJB 4CDUB 2GSYA 5JZGA 2X5IB 1VBC2 4JGYB 1H8TA 1RUD3 4Q4Y2 5A33B 1AYN1 1QJY1 4NWWA 2R042 2RS53 4WM7A 4QPGB 5BNPC 5BNPB 1QJZA 1RUI1 4JGYA 2RR13 5J98B 1W39A 3VBRC 3CJIC 4AEDA 1ND3A 5C8CB 2RR12 1VBA1 1AR82 5L7OA 1AR83 2IZWA 1PVC2 4Q4X3 1ND3B 1PO11 4PDWB 4N53C 1PIV1 1NA1B 5BNNB 1FOD2 3NAPC 1F8VA 4QPGA 4CDWC 5C4WC 1E57A 4RR3C 2WZR2 2ZTNA 5ACA3 2WFF2 4CDXA 4IV1A 2HWB1 1R1A2 1NCQB 1QJX2 1RMU3 1X33A 4WM7B 1R1A3 1VBE1 1RHI1 2RS33 1RMU1 4N43A 1RUC2 4GMP0 5ACA2 5C8CC 2Y26A 1VB2A 5CFDB 2HWF1 4GB32 5FOJB 2WFF1 1BBT3 4YVSB 1FOD3 1FMD3 2HWF3 1D4M3 2R041 2DF7A 3VBHA 1AYM2 1F2NA 4RHV1 2R072 2FZ1A 5C9AB 1AL22 1R081 4N53A 4JGZB 2RS13 2TBVA 1Z7S2 5K0UB 1RUC3 1AL0G 1HQNA 4FTSA 1POV1 1RUG1 3VBRA 2MEV3 1FPN2 3JB4C 5GKAC 1RUD2 1CJDA 2MEV1 1ZBA1 5CFDC 4RFT0 4CEYA 2WZR3 2HWD2 1EV11 4IV1C 2WS91 2HWC1 2RM21 3VBOC 4YVSC 4Q4V1 4CDUC 4IV3A 1EAH1 2R063 5A32B 3JBG3 1WCDJ 1QJU1 4Q4X2 1AR73 4YVWB 4CEYB 4WM8C 1BMV1 1C8M2 1SMVA 1FMD1 1BEV2 1OPOA 1PVC1 4SBVA 1VBD3 5ABJC 1VBB3 4Q4W3 4FSJA 5ABJA 1TMF1 5LK7B 3ZFFA 1ASJ2 1R092 3J8F2 2FZ2A 1RUF1 3JD73 1HXS3 1PO22 5A33A 4RHV3 2HWB2 4WM8A 4N53B 1ZBA3 5BNNC 1H8TC 1COV3 5BNOB 1VBE2 1EAH2 4CDXC 1BMV2 4RR3B 5FMOS 1HX6A 2RM22 3VBOA 3S6PA 4YVSA 2BFUL 1RHI2 2VQ0A 1MQTA 2RS32 4CEYC 3HAGA 1R1A1 1VBE3 2XBO3 1RMU2 4N43C 4RS5B 1EV12 4Y5Z0 1AR93 3JD72 1PO12 1TME2 3TN93 1MEC2 1C8NA 2RR11 1R082 2PLV3 4YVWA 1RUH1 1VBD2 1PVC3 5BNNA 2BPA2 4PDWA 1RVF1 2HWE2 5AC91 1Z7S1 1BEV3 1NA1A 1POV3 1QJU3 1RUF3 1VBB1 4Q4W1 1VBA3 1B35B 5L7OC 1PGL1 2WS93 1RUJ2 1K5MB 4JGYC 2HWC2 1AR61 4CDWB 3VBUB 3VBUC 1AR63 5C9AA 1BBT1 2ZAHA 1MQTC 1H8TB 2RMU3 1AR71 1ZBE3 1RUG3 1K5MA 1RUJ3 3VBOB 5JZGB 4CDUA 2R061 4RR3A 2X5IA 2WZR1 1ZBE1 1RHI3 3ZXAC 2RM23 4CDQC 4CDQB 5CFDA 1V9U3 4YVWC 1RUI3 1HRI1 4Z92B 3VBHC 4LLFA 1AYN3 1QJY3 1R091 4RQPB 1FPN1 1AYM3 4FTEA 1TMF2 4GH4B 1PO21 2HWF2 4GMP3 3JB8A 4GH4C 1ASJ3 3CJIA 1RB8G 1PGL2 2RS11 1M06G 1V9U2 1PGW1 1X36A 1C8M1 1NCQC 1BEV1 4QPGC 4CDWA 1HRI2 1AYN2 1QJY2 1ND2B 3ZFGB 1RUH3 3VBSC 3ZFEA 3ZFFB 1HRV3 4GB31 5J96B 1ZBE2 2PLV1 5CFCB 2WWSA 2WFF3 1AR62 5C4WA 1VBC1 5L7OB 2HWD1 5D8AA 1ND3C 5C8CA 1RUG2 1DDLA 1AR91 1PIV3 1NCRA 3JBG1 2HWB3 4WM8B 5A32A 2XBO1 1HXS2 4Q4V3 1VBA2 4JGZC 3J8F3 1RUF2 2HWC3 4AEDB 1FPN3 4AEDC 1PGW2 4QPIA 1OOPB 1RUH2 1VBB2 1VBD1 4Q4W2 4Y4YA 4WM7C 5DDJ1 3NAPA 1QJU2 2ZZQA 4Q4X1 3LOBA 1MEC3 3FBMA 1C8M3 3VBRB 1AR81 4IV3C 2R073 1HXS1 3VBFA 1PO13 1RUC1 1TMF3 3JBG2 1B35A 1D4M2 3M8LA 1BBT2 1GFF2 4JGZA 3TN92 1QJX1 1TME3 4CEWA 3DPRB 1CD3G 1TME1 1AR92 2WLPA 5BNOC 1A6CA 1RUE1 5D8AB 3VBSB 1RUD1 1EAH3 1HRV2 3CJIB 1OOPC 5CFCA 1RUJ1 2X5IC 5JZGC 3VDDC 4QPIC 1QQP1 1K5MC 1PO23 4GMP1 4N43B 1OHFA 4RQPA 4RS5C 3ZFEB 5K0UA 3VBSA 3ZFEC 2BUKA 1Z7S3 1R093 2RS12 2QQPA 4RS5A 1AL23 1ZBA2 5DDJ3 1D4M1 1V9U1 3DPRA 1FOD1 1AUYA 3TN91 1VRH3 4Q4Y1 2R071 4BCUA 2HWE3 3DPRC 1RUI2 3VBFC 5BNPA 4CEWB 4CEWC 1R083 4FTBA 1NY71 3IDEA 1NA1C 2BFUS 3NAPB 1RVF2 2HWE1 5AC92 1ND2C 3ZFGC 4RQPC 5K0UC 2R043 2RS52 1POV0 2HWD3 1VRH1 1QJX3 2XPJA 5ACA1 4QPIB 4Q4V2 1OOPA 5CFCC 1COV1 1VB4A 4IV1B 1PIV2 3JD71 1NOVA 5FMOL 3VBUA 2WS92 4NWVA 1NCRC 2RS31 1NCRB 1MQTB 1RVF3 5AC93 1IHMA 1NY72 2MEV2 1COV2 1AYM1 4RHV2 1HRI3 1VRH2 3VDDB 3J8F1 2PLV2 3VBHB 2RS51 1AL21 1ND2A 3ZFGA 5C9AC 5DDJ2 5C4WB 1NCQA 2BBVA 3VDDA 4Q4Y3 4EJRA 1ASJ1 2RMU1 3ZFFC 1VBC3 1VAKA 1FMD2 1EV13 2GH8A 2XBO2 1MEC1 5BNOA
chains in the Genus database with same CATH superfamily
4A3ZA 3E6CC 2Y34A 5E8AA 1NQDA 3ZDVA 1RUE3 2VMCA 1D2SA 1ZRIA 2FHRA 4P00B 4CDXB 2R062 4IE7A 1J1TA 2RVAA 1RUE2 5F5CA 5EYXA 5D8AC 3OD4A 5GM0A 3EO6A 5FP7A 5T52A 5G04L 1B35C 2XWBB 3T09A 5A80A 5JZGA 2WDBA 5GLWA 5A3WA 1LHVA 1R64A 3MIGA 2FD8A 2W46A 3KHBA 4AK3A 1VBC2 4ASKA 1X9TA 2XDVA 1H8TA 1GR3A 1QNYA 4XBLA 4Q4Y2 5A33B 1H4HA 4HETA 4LKEA 2RS53 1JHNA 1JZ4A 2A5ZA 5BNPC 1S2KA 3PLQA 4AOCA 1QJZA 2J7MA 4JGYA 4KWKA 5I0UA 3D82A 2J1SA 4BQYA 4HVQA 4AFDA 4LJHA 2LALA 2CYFA 2R7EB 4BXSV 5C8CB 1SHWB 2EAAA 4L11A 4GA9A 1AR82 1Q3EA 2WQ4A 1ZNPA 2IXHA 5JI7A 3OF1A 3VHPA 4B4PA 1GUIA 1J83A 2HLEA 3EHKA 3AJYA 1UO9A 3VB9A 3OTFA 5I0TA 1AR83 5F5IA 4QKFA 4HVRA 2IZWA 3K3NA 1WW6A 1ND3B 1PO11 3MLLA 3TNQA 3MBWA 4CYDA 4GKXA 2YGMA 3ILFA 3L2YA 3LZZA 3M7AA 5CA6A 4M3CB 4BQ3A 2P3KA 3WW1A 1FOD2 1DGRA 2P17A 3JU9A 2FQPA 3KCXA 1E57A 4HPKA 2K2SA 4BQWA 1GZWB 3AZWA 4NROA 3W20A 5H9PA 1JUHA 2A6YA 5DG1A 1WLWA 1GOHA 3ELNA 2WZR2 4RR3C 1BKZA 2WO7A 3KGZA 4BYYA 4Y5TA 4XPVA 3O1OA 2Z5WA 2WFF2 3AFKA 4CDXA 2VC9A 2Y60A 4ISRA 5LBBA 5A70A 3D3AA 1OA4A 3D8CA 3PHMA 5JR7B 3B7MA 4YM0A 1W8HA 1C3HA 5A6QA 1E5IA 4IE0A 4K21A 4CCLA 2J1EA 3U11A 4XABA 4WM7B 3IIIA 3AJZA 4YG0A 4BQ4A 4XXAA 5K8SA 3MV11 3MPBA 2QQLA 2E51A 5LBEA 4BB3A 1RUC2 2JEMA 4XJAA 4BLJA 2ZHLA 4COUA 5LA1A 1DGRN 5D2AA 1PZ7A 1RINA 4YLZA 4YARA 3AMMA 3ACFA 3D0JA 5FOJB 2PYTA 4MADA 2D3RA 3PU8A 5IVYA 4R9DA 4YVSB 1FMD3 1NLRA 4DIQA 4D7SA 1D4M3 4K1ZA 1W3XA 3UYJA 5SV5A 3PMEA 4JV4A 1N1TA 1QHDA 2K0GA 4B1LA 1JW6A 2GC1A 2R072 2Y0OA 2A70A 3WXPA 4DXSA 1R081 1G86A 4YW1A 4YW3A 4ZU4A 5FAXA 3NV2A 4IGQA 1SLCA 3RZKA 4ZZ8A 5FPLA 3LPGA 4D94A 4NRPA 5LY1A 2VOKA 3RRDA 2LS6A 4LBJA 1OURA 1AL0G 3N7MA 3OCPA 4R9AA 2HYXA 3BTYA 1RUG1 4ITCA 4CU6A 1GZWA 1BVP1 2MEV3 2ZMLA 3JB4C 2V4VA 3RS6A 1RUD2 2E6VA 2NYYA 3QACA 4TLGA 2YBPA 4XZPA 4XF4A 2P4EA 3NSTA 2YC4A 3IAQA 1KJRA 1BK0A 4XZUG 5CFDC 3ON7A 3LAGA 4P02B 2WZR3 1EV11 2WS91 4MGIE 4MGQA 4QKDA 3UJQA 3EXUA 3RZGA 3LFMA 4XFHA 3K2OA 1F31A 2E63A 2XJSA 3V0BA 3NJXA 4CVUA 3WCSA 1QJU1 4M3CE 3U0ZA 3ZIWA 3MW4A 3MW3A 4FPKA 1UZZA 4I3PA 4YVWB 4BA6A 4C0BA 1G9BA 3HT2A 3ES4A 4FXGB 1C8M2 4XUNA 1AJKA 4YM1A 1CPNA 1OPOA 1PVC1 3CZJA 2DUOA 4QHZA 4LHLA 5CAZA 2OX0A 4QQLA 2W1UA 2CDPA 1VBD3 2D7FA 1OA3A 3PDQA 5T5JA 2FDFA 5ABJC 3AKPA 2WZEA 4CSWA 1I5ZA 4XBQA 4B7EA 2FMYA 4CCDA 3RI8A 1S0BA 3V0AB 2WWJA 4CP2A 1XSQA 2H6BA 4NJ4A 4LKFA 1OT5A 3AKRA 2GMEA 2UY8A 4YM2A 1Y3TA 2DU0A 1R092 2ZXQA 1LR5A 1OI6A 3USUB 4DMIA 1HQWA 4CUCA 2FZ2A 3FHAA 1W9FA 2XGXA 1XE8A 2YC0A 1GLHA 3KS7A 4LHSA 4F8AA 1N1SA 3WW2A 5A33A 5T54A 2ZA9A 3IDAA 2FCTA 1H2KA 1JZ8A 4AVCA 4IE4A 5A3PA 4A7ZA 2UY9A 5C71A 4CDXC 4CE8A 2VNRA 4I0WB 1BMV2 4FPOB 4RR3B 1HX6A 2A7AA 1UU5A 2NN8A 1CN1A 3S6PA 4QXBA 5G05L 4MYEA 1OC1A 4O7XA 2Y6GA 5I93A 2RS32 2XXZA 3BYWA 4Q0PA 2GNTA 3IB3A 5LASA 2F4LA 1UF2C 1OLMA 2DVAA 2XKPA 4UFHA 3ASIA 1S0DA 4RS5B 4CXWA 1YYNA 4QB2A 4BWOA 1KGYA 3I97A 1SDWA 3AMNA 3NVCA 3VD4A 3UNPA 2VJXA 4DRVA 4GWNA 2VBPA 2UWAA 4Z82A 4OI2A 4XXPA 4Y5Z0 4G4FA 3LSDA 3ILRA 2Y6KA 5LBCA 2PTMA 5I0RA 1JS9A 3OY8B 3RPQA 1LB2A 3AMQA 2BBAA 3BU7A 1OKQA 1MEC2 1CR7A 2YXSA 1O4ZA 4O9GA 3ZSJA 2GC3A 3AYEA 1C1FA 1W6MA 2VGDA 5T5OA 3SH3A 2RR11 2EXHA 5FZEA 1K45A 1VBD2 2D6PA 3MZHA 3R0RA 3ZSMA 5C6CA 2JENA 4PDWA 1RVF1 5AC91 5M0TA 3VGIA 4HONA 1POV3 1CAUA 1AZDA 3H3UA 1E5HA 3OGVA 2DWRA 4AL9A 4WVMA 3R4DB 5BUVA 4AG4A 2VCBA 2VR4A 1BVVA 5L7OC 2BERA 3L9JT 1PGL1 3URFA 3EBRA 3OPWA 4NE9A 2G4IA 3UGGA 1S0EA 2WNEA 1SLBA 2Q8DA 2ZPXA 1DYKA 3D6EA 3WF2A 1RXGA 3ACLA 4JGYC 4NRMA 1AR61 1UXXX 2GAUA 3U4XA 1GSLA 1C1LA 2RG4A 3TBDA 5GZFA 4ZPIA 2UURA 1V6MA 4YW4A 2ZAHA 2PHFA 1OH4A 3R4UA 5FXZA 1UY3A 1VP6A 1LHOA 4LKDA 4M0HA 4AGGA 1AR71 3DYMA 4LBQB 2VVDA 4AHZA 3WG4A 3KV9A 1RUJ3 3RZLA 3OPZA 5JZGB 3DGTA 4GWJA 4YG3A 2WZR1 3SCHA 5GZGA 4YYOA 2GZWA 3RZZA 3ZXAC 2Y6FA 1NXD1 4FCAA 4CDQB 4NIDA 2DBIA 5CFDA 4UT5A 4YVWC 3THTA 1WMDA 4LBQD 1CIYA 3SCGA 5FY7A 2FCUA 3VBHC 2QNKA 3MICA 4OZOA 4A45A 4CXYA 4UBHA 4AVAA 5JR2A 3N3HA 2BGOA 1AYM3 3H3LA 1TMF2 3T30A 3HPNA 1SBEA 4GMP3 2A73B 2P37A 2ZHKA 3JB8A 4MGTA 3KVBA 2G1MA 3OPTA 4PT6A 4ONUA 2D5FA 2R32A 4KG0A 2RDRA 2Z79A 1PGW1 2OIIA 2QE3A 2WRAA 1C8M1 3FUOA 5A1LA 3MLJA 1HRI2 1GOFA 4YG6A 1ND2B 4QU2A 5FIXA 1WLDA 3POFA 4RL7A 3ZFEA 1UL9A 2TNFA 3ZFFB 4COWA 1HRV3 1OFSA 3ETPA 5A7PA 2Q1MA 1A3KA 3DXUA 1KQRA 4EN7B 2Y0IA 2WWSA 3SNMA 3KM5A 3AZZA 3LPFA 1QU0A 2BNNA 4HVOA 1ODMA 2HWD1 3T2PA 2DVGA 1GWKA 1ND3C 5CG9A 1RUG2 4IXLA 1TQ5A 4P9WA 3WR0A 3OGSA 3B93A 1PIV3 4XF0A 3J7LA 3TWIA 2C6SA 1IKQA 5DAWA 2HWB3 3J4UH 1W05A 3M1HA 4PLMA 2IFWA 5DUUA 1BYHA 5A32A 1H2NA 1WCQA 2WR9A 5F37A 4U2AA 3VKOA 1R1ZA 4JGZC 1W8ZA 2Q4SA 1QXPA 1UCXA 1FPN3 1PGW2 4OHXA 2ADDA 3IZOA 3HEIA 4CU7A 4ATFA 1GMMA 1OOPB 1RUH2 1VBB2 4Q4W2 4Y4YA 4LOSA 2D5HA 4OHYA 4WM7C 4Q0SA 2WZPP 5DDJ1 4FP2A 4AF9A 1W04A 5FYIA 4IESA 4Y1YA 4N7UA 2JDUA 2X09A 5JXGA 2R6QA 4M4PA 1G7YA 3VBRB 4AHXA 2DCTA 1YJLA 2R073 3A7QA 1RUC1 4LA3A 1TMF3 3LSEA 1B35A 1YIPA 1SDDB 1W6OB 5IAVA 1WCUA 2RHPA 3J7NA 3I7DA 3S0MA 4IETA 5GALA 5JSRA 3ME2A 2QQVA 2ZHMA 4R4XA 3AP7A 3ILNA 5FZAA 2O14A 1GWLA 1S0FA 1QEXA 3B00A 3DPRB 2FDKA 3J7MA 1HN0A 1BQPA 3GZTB 2WLPA 2ZAAA 5FPBA 4JCKA 2D97A 3DKQA 5HXMA 4Q0VA 4FFFA 3ZYRA 2VD7A 1HB2A 3Q8FA 1YXWA 1YUDA 2JB4A 1VMHA 1ZVFA 5JZGC 4BIOA 5FZHA 3ZO0B 3DKWA 5A3MA 5HCAA 5GZEA 1OHFA 4RS5C 3ZFEC 1UMZA 2EF6A 2VZTA 1EPZA 3O0WA 1NX9A 1R093 2RS12 3OBRA 3PNAA 1MPXA 4XJ9A 5E1RA 2QQPA 1U0AA 3W21A 2A6ZA 1YFWA 2YMZA 1Q8PA 1AL23 5EJ1B 1S0GA 4OUEA 4H7MA 5EJ3A 1SLIA 2ZZJA 3T08A 3DPRA 4BQXA 3GHMA 4QGMA 2CNAA 4NAOA 1N3OA 2R0FA 3WD5A 5DG2A 4C1XA 3BU0A 3LEGA 4H14A 1SBFA 4A44A 2YBKA 1LU1A 4LIVA 4Q4Y1 3POBA 2YUEA 2OVUA 2WO3A 5GLVA 2Y6JA 3M3EA 2YC2A 5F39A 1CESA 1R083 3W5MA 2G19A 1NY71 2WSVA 2AEZA 2QZ2A 1LOGA 3MIHA 3MFAA 2IWGB 1XRUA 3NAPB 2JB8A 5IYYA 1ND2C 1ZREA 4CU9A 4RQPC 2R043 3J7HA 3E5UA 5DAVA 3OSDA 4E2QA 1VRH1 3M3QA 3VL8A 2XPJA 4AVVA 1OSGA 2WIIB 2VOWA 3UETA 4IV1B 4UW5A 1QOSA 4UF0A 2WA4A 4IEVA 3IKWA 1IS4A 1WWYA 1YQ2A 4KBBA 4H7LA 1QH6A 4BQ5A 3N9QA 1V6JA 2DURA 3VBUA 1GOGA 4XW3A 4XJZA 3J9SA 4YGBA 2A1XA 3T4VA 1WW4A 3I2OA 3WDXA 3ZYPA 4I02A 2JE8A 4A6OA 2BWAA 4AI2A 3IDCB 5EHDA 4A3XA 4QGLA 1NYWA 3LA3A 4KQ7A 4L9BA 4OVEA 1ST8A 1KITA 2WABA 5FJKA 2PHWA 1ZRRA 2VCMA 1HRI3 4ZS3A 2H0VA 2GNBA 4KMQA 3VBHB 4NIHA 2WL1A 3MYXA 3N9OA 2ZGMA 1ND2A 2BRTA 2P6HA 3E1F1 2JECA 1YIFA 2GNDA 4NHLA 2PHTA 4L99A 2N7GA 1XXNA 1O59A 1WW5A 3S5QA 3PURA 2BBVA 3THDA 2CDOA 2BU9A 1G9DA 3H1YA 2AREA 1CZSA 2RMU1 4JTNA 1WMXA 1RJ7A 1WLCA 1QWRA 3ZFFC 4AEMA 4YZ5A 1LOBA 1VAKA 4DEVA 5FKBA 1EV13 2RJ2A 4COYA 3OUJA 4RA0A 4PI0A 3SQOA 1QXJA 3E5XA 2WO2A 2JWPA 1H9PA 1PZ8A 2XKOA 1XE0A 5JSPA 3LD8A 1QQP2 4MO3M 1SQ4A 4JAAA 4W65A 5CYYA 4IV3B 5FBZA 4HKWA 4DY5A 1V6NA 2WNUB 4PDWC 4ZXEA 2BTVC 3HR9A 3K4AA 2Z4FA 5A6YA 2ZEWA 1NG0A 4K8RB 5C3RA 5LW9A 1Q8SA 1MS1A 1CAWB 4YW7A 2J22A 2G9GA 3DYPA 4D6RA 2XL7A 1XNBA 3ZDSA 3E97A 5FXVA 3BTXA 3AKSA 2B5HA 4JGYB 3LE0A 2OXBA 4IW3A 5LBFA 3PVBB 5CISA 2R1DA 5DN2A 4R52A 3GBWA 4S2DA 2ERFA 1K3IA 1OXCA 2W2IA 5FMBA 1OBNA 4BMEA 3ZKUA 2R042 1S2BA 1XU2A 1Y43B 1OUXA 1RXFA 3WT3A 4K9SA 4DINB 4ZU5A 5BNPB 1CAXA 5H9RA 2C9AA 1X50A 1GYKA 2JDNA 3AL5A 1WMEA 3VLBB 4R9CA 3QCWA 3CJIC 2EAKA 3VBRC 4AEDA 1ND3A 5LRSA 1W8OA 2D44A 1VBA1 1JYCA 3UJOA 5E88A 5IVVA 3ST7A 5JXJA 2G9ZA 3KT7A 2OKXA 4XAAA 4IQPA 4XFIA 3UKNA 2CGNA 4NHYA 1WLTA 3M70A 4NMIA 4EN6B 4LBNA 3JXSA 4JKMA 5L9RA 1MZEA 3ZYIB 3NAPC 3CBNA 3G7DA 1H1IA 3HIFA 4QPGA 1J3PA 3K3OA 1W3VA 1O3QA 5GLZA 3X29B 1PK6C 4D6QA 4YGCA 2E26A 2R30A 3OB8A 4Q8KA 4IV1A 2OQ7A 3ITQA 3KLSA 1KDMA 2QQUA 5J1XA 5FZIA 1R1A2 1WMFA 1DQ1A 3IM0A 4K3UA 4LHNA 1X33A 4FPYA 4YW2A 2CAVA 3I59B 2DUPA 5EV7A 1R1A3 1VBE1 4XACA 5TSWA 5HCHA 4AXOA 2XVLA 1OUSA 2JX9A 2RS33 1APNA 4ISQA 4N43A 5F8PA 2NMOA 2EXKA 5IAXA 1VE0A 3AC0A 1VB2A 1S0IA 2BDRA 2HWF1 1W6QA 3FN9A 3ZR5A 4I2OA 1RITA 5E16A 5C3QA 5FZ0A 2WFF1 1QJEA 3I54A 2CWMA 1FOD3 1OFNA 4HG6B 4AE2A 2HWF3 5LA0A 1GZTA 2VM9A 4KWJA 5BPXA 1GQGA 5IFPA 1UX6A 5FYVA 2FZ1A 3O14A 4E2GA 1KS5A 1KFUL 1NUKA 3PUQA 3Q8BA 4JGZB 3AVSA 1EYBA 3OG2A 2PFWA 1Z7S2 3USUA 1K42A 3GZEA 4ET7A 2Q8OA 5K4LA 1OPMA 2QQOA 5DZGA 5GLUA 5FYZA 1HQNA 4FTSA 2QUOA 1O5UA 4GAZA 2ZX2A 2WSUA 5FRAA 3VKNA 1FPN2 1UNBA 3B01A 5E6HA 5JOXA 4JQTA 1DQ0A 5LWBA 2K46A 2W95A 1CJDA 3BALA 2MEV1 5DUWA 5F3GA 5AFEA 3GJBA 2XONA 3K75B 3H8OA 4XQWA 2WNUC 3V65A 5A3NA 2CWSA 1W0NA 4CEYA 1I1EA 2A75A 4FBFA 3O12A 4AGRA 4C1WA 4IV1C 3A23A 4XUOA 5FPUA 2HWC1 4QX3A 4CCMA 5FY9A 5IVJA 4QDQA 2B42B 4NHMA 5F3EA 3RSJA 5KXCA 3GBFA 1DQ2A 4YZ1A 5JLVA 1PNFA 3CU7A 4Q4X2 3M3IA 5FK8A 4CEYB 4FOQA 1RL3A 4M3CA 2VH9A 3RQ0A 4QT6A 4CPBD 5I0DA 1OQ1A 2B39A 1OQDA 1UWWA 1SMVA 4UWDA 1YQ8A 3SC7X 5KBFA 1REFA 2EIGA 4SBVA 3D5OA 1OA2A 4QX8A 4E4SA 3I2FA 3A21A 3WQ7A 2JG9A 3BPSA 4NR1A 2J1AA 3ZYGA 5JCTA 4FSJA 3VDBA 1TMF1 4ZXKA 3HWJA 5KWRA 1JZ2A 3NKGA 2WFPA 5CG8A 2AR6A 5FWEA 3J8F2 1GP6A 1JBCA 1XB9A 3JD73 5EWSA 1UZYA 3BTAA 1WW7A 4RHV3 1LOFA 1ZBA3 2XJQA 4W6XA 4DEQA 4CCEA 1H8TC 2JDPA 5C8WA 1K5JA 1Y7BA 2E32A 1EAH2 3RNSA 2WKKA 3M4FA 4GALA 4FAHA 3E6DA 5FMOS 3VBOA 4YVSA 3NNFA 2VQ0A 5H9SA 3PVOA 1Z78A 1MQTA 5FCCA 1NZIA 4JDMA 3O1UA 2ARCA 4XETA 3HAGA 2NP0A 2OW4A 2XBO3 1DZTA 1GICA 3A22A 3NO8A 4N43C 4JKKA 2XQRA 2WAOA 4B7KA 3PIGA 3POEA 3OGRA 3T2QA 1XNAA 2A6XA 3NW4A 1YJKA 1S2EA 3ZLIA 5LEKA 4OFGA 1TNFA 1SFNA 2JJ6A 4NUBA 2O8QA 2BNMA 2BVBA 2ZACA 1AX1A 2AENA 3FWEA 2FDIA 4L2NA 3H50A 1ZZ6A 2WC2A 1C8NA 3O0XA 4AQ6A 3KD4A 1CPMA 1LCLA 1R082 2V09A 2PLV3 4YVWA 5BYNA 5FO8B 1JYIA 2ZX3A 1JMUB 2BPA2 1W06A 5FV3A 1QIQA 5F5QA 3WQ1A 1BEV3 3B9IA 4XTMA 4D0QA 2JDAA 3BB6A 1W90A 3MIFA 1ZRCA 1QJU3 1Y9QA 2WUHA 1RUF3 1REDA 4Z2WA 1VBB1 4Q4W1 3RG0A 1VBA3 3FJSA 3DL3A 3O7OA 2PHXA 4U36A 2JXAA 2HEVF 3K4ZA 1XPWA 1YI9A 1ZM1A 2ZMNA 2XJRA 4EZHA 4CRQA 3H0OA 4IL7A 3WG3A 1VMFA 4KH9A 1OD3A 1BXHA 3CLPA 3T0AA 2HWC2 2I2SA 2HEWF 4PF5A 4AWDA 3VBUB 2O8OA 2IXLA 2OUJA 5KHHA 1AR63 2HJIA 3ZYJB 2UWBA 3ZN6A 2DCJA 4P9JA 4GKYA 5KR7A 4WVZA 5FKCA 5DUVA 4ARXA 1NE4A 2R1BA 4D7YA 3TEZA 2E33A 2D6KA 1UPSA 1Y9MA 5EP9A 4HZFA 4RR3A 4OCTA 1H1MA 1ZBE1 2VZVA 5FLIA 2WJSA 1UIKA 1RHI3 4UFMA 4LO5B 3VKFC 1GNYA 1W8TA 3LB9A 3RWNA 5FYTA 4CUAA 3S57A 3LF7A 1RUI3 2RDNA 1HRI1 1QKQA 1CAUB 1FYUA 3WP6A 4Z92B 2AC1A 1DFQA 1OMIA 4GD4A 4YSFA 4LLFA 4XDQA 1UW8A 3LGRA 3RGBA 4YPJA 3WV6A 4AEKA 4FTEA 5DZEA 1YFXA 4LE3A 4QDRA 1W6QB 2GN7A 1FI2A 3HNYM 1HJGA 1JN2P 3LDRA 4EN0A 2RS11 3BCWA 5CBLA 5FZLA 3HBKA 1VAVA 2QKDA 1V9U2 3CZUA 5IW0A 5KXEA 3T4HB 2BNOA 4LA2A 1CX4A 4P9GA 3LIGA 1WGPA 3AX4A 4CDWA 5JOWA 1GP4A 3RYRA 1QJY2 3ZFGB 1CAVB 1RUH3 4XCAA 2ATFA 4PJYA 1LAJA 2XWJB 1ZBE2 2OZ6A 1YCIA 2GC2A 1UOFA 3NV4A 2E31A 4XBNA 3OJBA 1H1AA 3T2TA 2DUQA 3WDYA 2VZ1A 3I4IA 4XQ4A 2P34A 5L7OB 1XNDA 1L7RA 2WO1A 1DF0A 5C8CA 1TEIA 3SLIA 1WZXA 4CCCA 1AR91 2QQJA 4L92A 2WWUA 5HCBA 1IPJA 2EA7A 3FHIB 5IWFA 1W0OA 2XBO1 4KWLA 1WBFA 2XHKA 4Q4V3 2ZJCA 3J8F3 4UF0B 4Y20B 1XYNA 4YGDA 5FBJA 4AEDB 1PK6B 2A3WA 4OULA 3LDBA 3N7LA 5C5UA 2C24A 1Q8VA 1HN1A 5DUXA 2I07B 4Y4RA 5L9BA 1UZVA 1KRIA 4HANA 4P08A 1HB4A 2VNOA 3IMNA 2VG9A 2JKBA 4PBPA 2SLIA 3UKVA 4Y5SA 2CV6A 4S2FA 2W08A 4LIUA 4Q4X1 5FYSA 3LOBA 3FFQA 4CP1A 1B09A 4HOOA 4XIOA 1H8VA 1AR81 1LJ7A 3HNBM 4XUQA 2YZ4A 4HFSA 2DU1A 1QDCA 4FPHA 1PO13 1HLCA 4Q5OA 1WCKA 2VQAA 5GLTA 2VMFA 4W50A 1D4M2 3GCWA 3WF1A 3LEKA 4MLOA 1DG6A 3PJQA 1LOEA 3FE5A 5FZ9A 3TN92 1QJX1 2IXKA 5KXDA 5FWJA 1CD3G 4A4AA 2XMLA 3SEPA 1G8WA 2ARAA 3K4DA 4I01A 1AR92 3WHUA 2C1FA 1HKDA 4LBKA 4UFJA 2JDHA 1A6CA 1XC6A 3JQWA 1X9PA 4IGOA 1UZ0A 3ENRA 3KQRA 2Q30A 2RDQA 2WLQA 5F32A 1AXZA 1RUD1 2P6CA 4PQQA 4QXCA 4JZRA 2J1UA 1OLME 2C0ZA 4FPCA 2NPIA 5FP3A 3U07A 1DQ5A 1RUJ1 1C4RA 1YI7A 2X5IC 3AXEA 2XHNA 4QHOA 4RYDA 4QPIC 3VDDC 3I49A 2EXIA 1QQP1 2X8KA 4LORA 1PO23 4N43B 5FZGA 1XNTA 4CP9B 5JPNB 1DLCA 1UPIA 4NHKA 3TRSB 1ULPA 4RN5A 2AEYA 1KDKA 3RYKA 2Y64A 3UESA 4UFIA 4EV0A 2VUCA 2WN2A 1D4M1 3IDBB 4UBGA 1YHFA 1W2UA 5F2SA 1FOD1 1C5HA 2D6OX 2R49A 5I0SA 3V0BB 1DIWA 2BOIA 2PHUA 2XH6A 1VRH3 3OD0A 3RJRA 4LR4A 4AQTA 4ZONA 4Y1ZA 5LCWL 2WAAA 4QQ2A 1RUI2 3VBFC 5EXOA 5F6KA 5BNPA 1RYYA 5JI9A 1H0BA 2CL2A 4CEWB 2YU2A 3NNLA 4LKSA 4E8CA 4FTBA 2Y33A 3TB0A 2QFEA 1NA1C 3TEXA 1RVF2 5AC92 3ZFGC 2PQSA 4HK8A 1BJQA 4DB5A 4C0HA 5K0UC 3FFZA 2RS52 5AVPA 5CIRA 1W8FA 2Q8EA 1GNZA 1G9AA 4E9KA 1PNGA 1AVBA 1POV0 2YV8A 3UK9A 4R9BA 4CZSA 5ACA1 1ENRA 3V56A 4DUWA 1CONA 3PVEA 1OOPA 1A8MA 2TEPA 2XUEA 2E7TA 4XFGA 5JDBA 5FZ6A 2VL4A 1CJPA 1NLSA 5L9VA 4OI1A 2VQTA 1QNWA 2A3YA 5EFUA 3SEEA 1NOVA 3NV3A 3CHXA 4XF9A 3VZOA 4DUVA 1H6XA 5T5PA 5ERLA 2WS92 1D0HA 4NWVA 1QMJA 4NIGA 3ZPOA 1FV3A 2E7AA 4YFZA 1W9SA 5A7SA 4XFBA 1NY72 1O91A 3VL9A 5F6LB 5IVCA 2YGLA 1WA6X 3AKTA 1T6BX 3NJYA 3AXDA 4XUTA 5FP9A 5A7NA 5ISLA 2V4AA 1REEA 1U5XA 1FATA 1WUVA 2ZEYA 3WSOA 4FP3A 3KCYA 3T0BA 3ZXFA 4BQ1A 1VRH2 2C5DA 1MZ6A 1J84A 2CGOA 2PLV2 3J8F1 4JHTA 4LO7A 3USSA 2RS51 5KHIA 1GANA 3ZFGA 4ORFA 3K48A 2ARBA 2ZHNA 4FO9A 1UYZA 2VMDA 1UKGA 3BPZA 3C7FA 4P9YA 5C4WB 4QAWA 4RGAA 2MPFA 3MI8A 5FZMA 3VDDA 2ET1A 3SXWA 1V6LA 3QH7A 3UKTA 4GXLA 2DDUA 2VVFA 5IK8A 2AUYA 3H42B 5J48A 2XUMA 2VMEA 3MIDA 3QOPA 2GH8A 1GQHA 5FO7B 4EN9B 2ZEXA 3I2GA 1S0JA 1ZA4A 3AP5A 3WQ0A 4GB33 5DXDA 3SMHA 4XOGA 5IK7A 5HCFA 1V00A 1Q8OA 1VRBA 5FXXA 1W2AX 2J42A 3A0NA 4GJYA 1PZ9A 4YM3A 3TNPB 5A7OA 1WKYA 2J1VA 3WQBA 1W6NB 5IUQA 2H0BA 3NJVA 2WT0A 3H7YA 2XR4A 4AI3A 4B1MA 3I59A 3A4UA 2RMU2 3KV4A 5JOYA 3VZMA 1UY2A 1LRHA 1UXZA 2GSYA 5FZKA 2X5IB 3KMHA 2BV4A 4YZ3A 5FJHA 3WG1A 4Y1VA 3VZKA 2YPDA 1DCSA 1W03A 3NMBA 4C91A 1D7PM 1RUD3 1W9YA 4BMBA 2ADEA 1AYN1 1MACA 4NWWA 5FYUA 4XDPA 5C33A 3GGLA 1PM4A 3RYPA 3ZXDA 2W52A 1RUI1 1MS4A 3KWVA 4BE3A 2BZDA 2RR13 4LOTA 4BM8A 1W39A 1Q43A 3WF4A 1CIWA 5F7UA 2RR12 4Y20A 3SISA 3WNLA 4DOUA 2E7QA 3OBZA 2ID4A 1AXYA 5L7OA 3CIHA 1J3QA 5A1AA 4JVAA 2XG3A 3R4SA 5F3IA 3PUHA 2QQKA 4Q4X3 5DABA 2A6VA 2VZ3A 2QQIA 3IIAA 4Y1UA 4YW5A 1NA1B 1X82A 3SH5A 2DVBA 4FPLA 5FZCA 4LBLA 2WN3A 3WNNA 4Q2FA 3PTRB 3FLPA 1LHUA 2W87A 1W2TA 3C7GA 4QGNA 2JE7A 3KF5A 4XURA 4Y3OA 2YFUA 1E5RA 1YEWA 3Q8CA 1XOYA 2VPVA 5LK5A 4E2SA 1US3A 2VW2A 2W5FA 3CNAA 1VPHA 1US2A 2PXJA 4AR2A 3FLTA 1LECA 3FMGA 3ROUA 1F9KA 2WNOA 1MZ5A 3GDBA 2YU1A 4HSLA 2VCCA 1OD5A 5ACA2 4XFFA 5C8CC 2Y26A 4KBZA 2XQXA 5FZ1A 3SITA 5CFDB 1T6GC 4GB32 2DVFA 5FLHA 5A6XA 4MOAA 4PCRA 3GXUA 2PELA 2D98A 3Q8EA 1CAWA 4FQZA 1ULEA 4XYXA 1BBT3 3ZSEA 2W1QA 4FOVA 1DYOA 5T3NA 4YNIA 2R041 4I30A 2UYAA 3DECA 3VBHA 1C28A 4EZ4A 2A6WA 4V1PA 1S0CA 1W9WA 3ZMNA 2FBEA 4C90A 4WZCA 4CTEA 1AL22 4N53A 2GP3A 4OHWA 3KV5A 2D3SA 4KU8A 1U5IA 4META 2RS13 1DLLA 4PI2A 3MUY1 3FC0A 5CKMA 1VIWB 2BWCA 3PUSA 2EALA 5K0UB 4GWIA 4Q1PA 5JOZA 2I45A 2OA2A 1N1YA 5CEHA 2DFCA 4CP9A 2JDMA 5JIAA 4B3NA 5IVFA 4Q0QA 3WNXA 4LUMA 1RC6A 1UOGA 3A0KA 4KL1A 3VBRA 5EIYB 4DXRA 4QDSA 1CVNA 1LU2A 4YFWA 2VZQA 3BTZA 2HYKA 2V72A 1JZ5A 3U37A 2ORZA 4HKOA 1DZRA 4HT1T 3CF6E 2ZX4A 2D43A 3I8TA 3N7JA 4UFLA 1Y9GA 2IUWA 4RFT0 5A3UA 2HWD2 2QBXA 2L9LA 1XE7A 4FOYA 3WLUA 1DZQA 2VNGA 2RM21 1UU4A 3MIEA 3VBOC 4YVSC 3WP5A 4FVVA 4JQRA 4Q4V1 1O3TA 2BW8A 2R063 1XJAA 4LLOA 3IT8A 3BI3A 5A32B 1NLQA 2OQ6A 4URTA 1WCDJ 3T1MA 3LQCA 1SBDA 4HSJA 4UI9L 5FFOC 4MGSA 1PM7A 1SLLA 2IXIA 1HDKA 3ORJA 3WF3A 2B4KA 1UY4A 4QMAA 4A7KA 1UD1A 4E27A 1P8JA 4MSVA 3EQEA 4BZ4A 3FHQA 4OZXA 4NRQA 2H6CA 2X05A 4QHBA 3VUOA 2DV9A 5LK7B 2VECA 4P9LA 3H7JA 3NKTA 5FDBA 2WNVB 3ZFFA 4FI9A 1ASJ2 1KD7A 2MNGA 5EQUA 2GDFA 4IEZA 4LK7A 1JXNA 5GJ6A 3PL0A 1RUF1 2GNMA 1N1VA 5LA2A 4AVTA 3I2DA 5FUIA 2VULA 3N9PA 2HWB2 4LE4A 2BYVE 4OMCA 4M01A 1VALA 1RUNA 1COV3 2JDKA 3FL7A 2X53S 5A7WA 5BNOB 5HV0A 1VBE2 4UXAA 5F2WA 2PHDA 3BIEA 5T50A 1AJOA 4TN7A 3O1MA 2RM22 3HVDA 1NQJA 2OZJA 4LNVA 1LOCA 4P14A 4XVHA 4FPGA 5KHGA 2Z2SB 4AFBA 1ZRDA 1ENSA 2LRPA 5DMYA 2V5DA 4KG8A 2XVKA 3H1MA 4OMDA 5I91A 3N7KA 1PX3A 4K8FA 2RE9A 4LO4B 1R1A1 1VBE3 4XUPA 1VR3A 1RMU2 1RIRA 1N3QA 2VBDA 2VW0A 2A71A 2DVDA 1URXA 2YDEA 2WNVA 1VAMA 5FPVA 3WDTA 1FX5A 1TG7A 1W6OA 4JTOA 3ZYBA 1MS9A 3JD72 4N8MA 2P5BA 2ZX1A 3UGFA 2PMWB 3VZJA 2PHLA 4QM9A 1TME2 5GZDA 4DNYA 1F15A 3KZ4C 1UKRA 3C8XA 3MEPA 4XC9A 2XVGA 4LULA 2VTXA 1PGSA 4FFGA 2VMIA 4QM8A 5B4NA 4PF1A 2VQUA 2XJPA 3S7EA 1GZ9A 4SLIA 4N9HA 5C70A 1PVC3 5J09A 2VU9A 2PN5A 1JZ3A 4EWEA 4PIYA 1Z7S1 5FY8A 4UOJA 4F3JA 3WUCA 1M4WA 3W59A 1HJFA 5FQ0B 5I8SA 1LNSA 1AX0A 2Q1FA 3CO2A 4AVBA 1V6OA 3KCCA 3OY8A 3TOJA 1SFPA 2GMPA 4XMAA 1UYXA 3ZMOA 2YHJA 2WS93 1CQ9A 3ZYFA 5J36A 3PVNA 1HIXA 1K5MB 3KHCA 4ZKTB 2NZ9A 1J1LA 2D93A 3ZVXA 5B2GB 2D6MA 4HN1A 4MGKE 4HXCA 5FMCA 1SCSA 4QWNA 4NPRA 3KF3A 3VBUC 3WNOA 1UQXA 2IFRA 4AFCA 5KHKA 2J1RA 2WINB 3CL1A 3S30A 1O3RA 1JYVA 1MQTC 1H8TB 1DYPA 2RMU3 1IPKA 1YQ5A 1ZBE3 3INAA 3MFCA 5ANNA 3THPA 1K5MA 4ZU7A 1OF4A 1EUTA 3VBOB 3P5BA 4OQ9A 5FY0A 4CDUA 3CDZB 4H3WA 2X5IA 4LO8A 4IE6A 4LXLA 4O65A 4C8DA 1SCRA 1QY4A 2RM23 3NRUA 4RFRB 2W1WA 3K46A 2QZ3A 2GALA 3NV1A 1Z0HA 4M00A 1TNRA 1CX1A 5FUPA 4ZHNA 1U12A 4CCJA 1FXZA 1JUIA 1TZOA 2W0XA 3E6BA 1AYN3 5KC5A 1R091 3VD7A 1SZBA 3VHOA 3ETQA 4JX0A 1FPN1 4XDOA 3UL2A 4K7JA 3AYAA 4FPFA 4GH4B 2HWF2 1HB3A 1O8PA 1FNZA 1GQPA 1IPSA 1XNKA 4Q27A 1YC61 2WNUA 1OF3A 2IVJA 3CJIA 5HXVA 1RB8G 1DBNA 5K9YA 5C3PA 1PGL2 1XNCA 3H8UA 4YZ4A 1M06G 4ZY9A 2WNVC 4D69A 4IEXA 1JZ7A 4CCNA 1X36A 1GNHA 4RGKA 1NCQC 3VKMA 4DY3A 1JTZX 4IEOA 4MGYE 1MS5A 4ASLA 3NNGA 4B8EA 4MG2A 1BCXA 1AYN2 1XSRA 4Y1XA 1UAIA 3ATGA 4AFMA 1UMIA 3VBSC 4XEZA 3HQXA 5LRRA 2PLV1 4N90A 4XHXA 2UWCA 4LHKA 4MXVA 3RZHA 4Y26A 5CFCB 4XILA 3GM8A 3LOIA 3U75A 4CCKA 4IEUA 3JUUA 5IK4A 2ZGRA 1VBC1 3JQXA 3O5SA 5IVEA 2QQWA 2VZPA 5JMOA 1C5IA 4AVSA 3KB5A 3KVAA 5FZBA 1GKBA 1W9TA 2VZOA 2V5YA 3K77A 4QX7A 3BVCA 3JBG1 4HKLA 4D8MA 4UYBA 3F2ZA 2QDRA 3LKJA 1DGWX 5EZWA 3IN9A 2V73A 3PMSA 4IERA 4XJWA 4F7ZA 1BK1A 1WD3A 4AHWA 1VBA2 5IFTA 4J6GA 5FYCA 2VCAA 2VXJA 4TTGA 5FPZA 2EIBA 4AEDC 1J3RA 4BISA 4KU7A 2IVIB 5JWPA 1UOJA 5FPXA 2QQMA 3O1PA 4QPIA 5AVAA 1ZZCA 5LB6A 1EPWA 2XLFA 1O7FA 3VD9A 3O1TA 1PMJX 5ANQA 4BHPA 4QB1A 2QVSB 3I3MA 2KXLA 3MF6A 4W4ZA 3C7EA 1BZWA 4LPLA 1LESA 2ET7A 2WA3A 4FT8A 1QJU2 2ZZQA 5FLJA 3VHNA 3FBMA 3ZSLA 4B4RA 4QX1A 1CZVA 5C3OA 2UYBA 1ENXA 1ODNA 2Y6LA 3LFIA 5HI0A 3OEBA 4XJ8A 1HXS1 2JE9A 3I2JA 1H6YA 2D6NA 5FREA 2F4PA 4DPNA 1F5JA 3GNEA 4QXKA 2ZCWA 2ES3A 5BXXA 3WOGA 3AMPA 3M8LA 3M2MA 3BGAA 2J1TA 2AGSA 1AF9A 1LEDA 1K12A 1W6NA 2AACA 3FX3A 4QQHA 1GFF2 4JGZA 4R8HA 4N7IA 2B8MA 2PAKA 2W3JA 1TME3 4AHYA 2XOMA 4MX3A 4ATEA 4Y22B 2CTVA 1L7LA 5CU1A 2ZGOA 5BNOC 1OVPA 2JDYA 1RUE1 4NN0A 2RJKA 2ZEZA 3DXTA 1T2XA 1YWKA 4LO6B 1NKGA 3U4SA 2OPWA 4HLTA 4LTAA 3ZXGA 2PQQA 3GZUC 4BOWA 2VUDA 1EAH3 5DAQA 1HRV2 1MS3A 2VW1A 5DZFA 3KGLA 2WBKA 1OOPC 1JYWA 1ULCA 4I3GA 4HL0A 5A3OA 5T55A 5J3UA 2PAEA 3ACIA 4GMP1 2QQNA 4XQDA 4RQPA 4Z2AA 3VBSA 2BUKA 1O4YA 1Z7S3 2ZX0A 3ZSKA 5HV4A 3FLRA 4UAPA 5I8TA 3CMGA 2BJSA 4JRLA 2VO5A 1I6XA 3MLKA 4K6BA 4B4QA 3V0AA 3MF9A 3POSA 2FDHA 2R0HA 1H9WA 4GULA 2XL9A 5F1RA 1DU3D 3LA7A 2NMNA 1QOTA 5JPMB 1AUYA 3AVRA 3SHRA 2HEYF 4BU2A 1KS4A 2WQ8A 2IXCA 5A6ZA 4KI5M 3RDIA 3F95A 4BCUA 1F35A 1F4HA 2GU9A 2HWE3 3DPRC 3WW3A 4ZS2A 1NXMA 1IZ3A 2DCZA 3GCXA 3OGJA 4IDZA 5BV6A 1UU6A 2JG9B 3KQ4B 4CEWC 3UGHA 3IDEA 4P5YA 4X6QB 5IHRA 1I5PA 1UY1A 2BFUS 2HWE1 3P1IA 1A78A 4WV8A 1LKNA 3AK0A 3OGGA 4X8PA 2W47A 3C2UA 2Q1ZB 3C7HA 3WDUA 3RZMA 1AHSA 2HWD3 4J25A 2PHRA 3PTYA 2Y8KA 3AZYA 4Q4V2 4A2UA 4QXHA 1EY2A 1GZCA 5CFCC 1VB4A 4ASMB 1ZZ8A 4YZ2A 2WZ8A 5IK5A 3H3ZA 4XHBA 4CU8A 2YB7A 1SLTA 3LEIA 5B4XA 3BN6A 3RMXA 3JD71 3Q8AA 4MGZE 3PUAA 3V64A 4QPWA 3IBMA 5DAXA 5JSOA 3CEWA 2ORXA 2YFZA 5FOBB 3RZJA 1NCRC 3GYDA 1RVF3 1MQTB 2ZGKA 4A42A 4NAMA 5AC93 3UT0A 1UX7A 2GP5A 3DUIA 4MHRA 4BK5A 1W6MB 2VUJA 3ZM8A 1W0PA 5A3TA 1U5YA 5LZ6A 5LATA 3Q9OA 4URAA 4AI0A 1JOJA 4NIAA 1NAEA 4AGVA 2BVVA 5FTTC 1G9CA 1COV2 4Y33A 4HBNA 2A3XA 4XFAA 4GZ9A 3ZR6A 5LA9A 1LOAA 4B29A 1FNYA 3CKHA 3VDDB 2Q0AA 1JZ6A 3WVJA 2VMGA 2SBAA 1QJFA 1AL21 3AKQA 1SLAA 4AI8A 2EVXA 4GIQA 4CUGA 5C9AC 3TEYA 4TXWA 3T0DA 3B3QE 3MW2A 3ZOIA 1LGNA 4COVA 2XLGA 4R4ZA 4Q4Y3 1YQ6A 2OT7A 3TAYA 1G6NA 1TVGA 3BUCA 2LUWA 5H9QA 5CZKA 1MVQA 1XU1A 4BDVB 3OBTA 1VBC3 1JYTA 2Q5TA 1PHMA 2VE1A 5JMCA 4XTPA 3ZXEA 4L97A 3H1WA 4OHVA 1UMHA 1N47A 1IS5A 2CU5A 4FFIA 2XBO2 1MEC1 5L36A 2BGPA 5A7WB 4PLOA 5BNOA 3KT4A 4I09A 1HRV1 4QX0A 4Y22A 1AR72 5FYHA 3VBFB 4MVTA 2ZABA 1WD4A 1QQP3 1ULGA 3SCFA 1X8EA 4D7TA 4AI9A 4GH4A 2P3JA 4XIKA 4CDQA 3EYPA 2C4XA 4HPKB 4FPJA 4XF3A 5ABJB 4CDUB 2VTXJ 4EN8B 3B69A 3WUDA 1YLLA 1MS8A 3WDVA 1SPPB 2ZBJA 4G9SB 3P3NA 2EIEA 1J58A 1FAYA 2NLRA 4QQPA 2GN3A 2CY6A 1MZFA 3AP4A 4YWAA 4YW6A 3GBGA 2B45X 1QJY1 1ZZ7A 3T1LA 5FZFA 2DFBA 4FAGA 3J26N 2Q8CA 4WM7A 5J7MA 1PVXA 4QPGB 3M3OA 4XFCA 5FXWA 1ZX5A 3AL6A 4J1XA 3WHTA 1A34A 1HB1A 1TE1B 4BLIA 1BLZA 2B7YA 5J98B 4AYUA 4ES9A 1W99A 2O1QA 1HV1A 3ZN6B 3MV01 3HJRA 4FPEA 4JHZA 3DV8A 1BHGA 1RGSA 3GALA 4QU1A 1F5FA 5FYMA 3VD3A 3WCRA 4GJZA 2WQZC 1NT0A 1PVC2 4BH9A 3AP6A 1STMA 4K20A 3O1RA 4NHXA 4COZA 2KM2A 1VJ2A 2VOTA 1HW5A 4AQSA 4WVVA 5DPNA 4PDWB 1SPPA 1XQNA 4N53C 4NIIA 1PIV1 4M3CF 3VD5A 2Z42A 4CXXA 4DO0A 5BNNB 5KHJA 1QGLA 3NNMA 1CWPA 1F8VA 2VTFA 4CDWC 1VLNA 5C4WC 5JUVA 5APAA 2LM3A 2VZRA 4XE9A 4CUBA 1E5SA 1O4TA 5HBAA 1UOBA 1YFYA 1W6PB 1CGPA 4FFHA 2ZTNA 3VV1A 5ACA3 2Y6HA 3ALQA 4NPLA 4JRAA 2IC1A 1IGOA 3AM2A 1ULFA 4PLNA 2HWB1 5FZ3A 1NCQB 1QJX2 1RMU3 2D3PA 3PUIA 3ZPYA 1NE6A 1W2OA 4PIZA 4F83A 5IJRA 2DCYA 3ACHA 1YQCA 3QH6A 2W94A 1KEXA 4TLFA 3RI9A 5BY5A 4QX2A 1RHI1 4IUGA 3B94A 2Y38A 1RMU1 4XCBA 3WP4A 5A3LA 4GMP0 4E4DX 2CSGA 3AB0A 5FUNA 2RDSA 2VY0A 4TYSA 1G9FA 3WDWA 1IS6A 4JDOA 1GU3A 3AZXA 2P3IA 1VMJA 4D3WA 1FT9A 1YFUA 1W2NA 1DQ6A 2DF7A 3WEZA 1AYM2 1F2NA 4RHV1 2C9KA 2G9FA 3I3DA 4XAEA 5CKNA 2VUAA 2CGPA 3AYDA 3D4KA 4XMIA 5A1FA 2K9ZA 2W9XA 5C9AB 3PJYA 4LBMA 4S2GA 3ZXLA 3W5NA 3I3BA 2TBVA 1GWMA 3S7IA 3WX5A 1EUUA 2AYHA 4G3YC 1LTEA 4X8NA 3B5LB 3C3VA 5J37A 1RUC3 3NWKA 4H55A 1DGWA 1JOPA 4OUSA 2CAUA 1LOFC 1POV1 5FP4A 5FZ7A 4PHZA 3T3YA 5GKAC 2AZ5A 1YRZA 1D4VB 4BJ0A 4AFAA 1NZCA 5FQ0A 1CZTA 3H9AA 2ZGTA 1ZBA1 4P5HA 2EXJA 1V0AA 4FQ4A 3VKLA 2BP6A 3LA2A 3WP3A 3LCPA 3FZ3A 1Y4WA 1SACA 3RJ2X 1Q5OA 4DRRA 5FZOA 4RGGA 2NQYA 1AXKA 3IAPA 4IEWA 4EE2A 3AFGA 1GV9A 4WVMB 4CDUC 3POWA 1YNAA 2LROA 3HBZA 3N9NA 1EAH1 4IV3A 4QX5A 3MO4A 5DQ0A 4L0PA 4PIXA 3JBG3 4EWAA 4A7YA 3OOXA 1AR73 4LMFA 1MVEA 1WBLA 4MV2A 4WM8C 2X29A 1D2QA 4P9IA 1O3SA 4H2AA 1IG0A 4DXZA 1BMV1 1I3HA 1FMD1 1C57A 1BEV2 2W68A 1SFYA 3IWZA 4D6SA 5EPAA 5FYYA 2WT2A 2JIGA 2YY1A 4N9IA 2FDGA 2ZGNA 3ZN5A 2I74A 4AZZA 2RV9A 1VBB3 2VZUA 4Q4W3 5IVBA 5ABJA 1ZRFA 3KT1A 4I0AA 5D21A 5JIUA 2ZKNA 1POQA 4MXWB 2VOVA 3M3CA 4BIFA 1QF3A 3N35A 1HXS3 3EB7A 1PO22 5FP8A 4WM8A 4N53B 2E53A 2XJUA 4BXFA 4EWDA 5BNNC 4WBBA 1LGCA 2DYCA 3U1XA 1IS3A 1EP0A 1QDOA 3POJA 3WNPA 3BKZA 3VHRA 1U5ZA 1OQEA 4MXWA 5CADA 3OBAA 2JG8C 2W1SA 2ZMKA 2F17A 2BFUL 1RHI2 3HOBA 3VN4A 5BNQA 5HPOA 4NPMA 1DGLA 4GWMA 4P9XA 5C3SA 3VZLA 5KC6A 1ZZ9A 4CEYC 2JG9C 3HQUA 1XBFA 3BOWA 4DZGA 1S1AA 3T2OA 4E4HA 1EV12 4OYUA 4EROA 1OLQA 1AR93 1O8SA 2DTYA 3O1SA 3NNJA 1PO12 2ZGSA 3DEMA 2KR2A 2YYOA 1OVSA 3TN93 3S5AA 2JG8A 5FZ8A 4LEJA 3SKVA 4MH0E 4QKNA 3WG2A 2BOJA 5JAXA 3EMRA 3H8XA 2ZOEB 1FV2A 3WZ1A 1RUH1 3N9LA 2NM1A 2W91A 4MHUA 4GQ7A 5FZ4A 5BNNA 2W39A 2XJTA 1UN1A 2EICA 4QQOA 2HWE2 3GF6A 2QCSB 1NA1A 4W6WA 5FO9B 4O61A 3I2KA 2P3YA 3HD8B 3RFRA 3WW4A 3VDAA 1LHNA 2ETEA 3LDKA 4BPZA 3BODA 1JI6A 2D40A 3OYWB 4IE5A 4Z07A 3ZXKA 4Z8BA 1B35B 3MDPA 4QPYA 1GBGA 1LEMA 3EJKA 1MS0A 3G6JB 4L8QA 5JVVA 3AMHA 1RUJ2 1QOOA 5AFBA 3E5QA 1CAXB 2VZSA 4OHZA 1X7NA 4QB6A 4TSVA 4CDWB 3LEMA 4Q8LA 4UW6A 1ULDA 1S55A 5CB7A 3U10A 4ES8A 2OPKA 4O9EA 5C9AA 1BBT1 1F4AA 2PAMA 3R6SA 2YG0A 1RUG3 2LW8A 2XJVA 4NO4A 5CNAA 3N36A 3MUZ1 2R061 3ES1A 3GHNA 2E9QA 1JHJA 1V70A 2ZGUA 3ACGA 3WY6A 2QTWB 2QDNA 4CDQC 4Z1VA 3OYWA 4AI1A 4LT5A 5E89A 4JDNA 1V9U3 2VMHA 3MIBA 5F3CA 2FCVA 2QJVA 4DXTA 2ENRA 4Q29A 5LY2A 1I9RA 3PIJA 1H4GA 4NVPA 1HV0A 4IEQA 1KXGA 1QJY3 2HBUA 4RQPB 1X8MA 2VOXA 3DF0A 3KV6A 1PO21 4HMZA 4GH4C 3HN3A 4EQVA 1ASJ3 1W8WA 4I0BA 1L3JA 1UYYA 1H2LA 5DAPA 3IMMA 1PMIA 3AYCA 5F9TA 4XF1A 1W8NA 4V2VA 4IEPA 1PX4A 3WINE 1BEV1 2MHFA 4RSUA 3BOPA 1AX2A 4QPGC 2DCKA 3RMYA 2BEOA 4AEJA 4Y24A 5T5LA 3FBYA 2BGCA 1W28A 4GB31 2P2KA 3FUQA 1PK6A 5J96B 5GZCA 1GP5A 1W6PA 5I8YA 3I3EA 2EIDA 1O6UA 1UIJA 2WFF3 4K40A 1AR62 5C4WA 2JIJA 3DCQA 3TEWA 3P3PA 2ZGPA 4PQ9A 5D8AA 2VXRA 3BIWE 4ZZ5A 1D0GA 1H2MA 5JXHA 2HBTA 3JZVA 3K51A 3O0VA 4LBQA 1QXRA 2ARXA 1OH3A 2XLAA 3U78A 3WNKA 5C7GA 1DDLA 4AW7A 1NCRA 3DN7A 3DYOA 1ZYBA 4WM8B 5EYYA 4RD7A 1HXS2 2W92A 3OUHA 4KNCA 1UZWA 1A8DA 1RUF2 1SG3A 2HWC3 3R05A 3THCA 2IXJA 4FOWA 3SH4A 4AAXA 3HNMA 2B46X 3LWCA 4JKLA 3C7OA 1LODA 1VBD1 3IPVB 1JH5A 1S4CA 1KFXL 5FMDA 4LITA 4KWUA 2X10A 3CQOA 2DTWA 3NAPA 4W8JA 1QH7A 1MEC3 4E4ZA 4OLLA 2CHHA 2B9VA 5C5TA 1C8M3 1DQ4A 2ZKLA 1PMHX 1XYOA 4LQRA 1XYPA 4IV3C 5FY1A 1W8UA 2HH9A 2C26A 4IEYA 3IPVA 1ZZBA 4MZUA 3VBFA 4OI0A 4YRDA 1O5LA 3JBG2 2ILMA 5F5AA 3L2HA 3H8RA 3HMYA 4OUMA 4LUKA 2GMMA 1BBT2 4DS0A 3W9AA 3OUIA 1LULA 2JG8B 3B9CA 3POYA 4LBOA 3CJXA 1JU4A 2Z69A 5CVRA 5L19A 4CEWA 3APBA 3OEAA 1TME1 3AP9A 1IQDC 4QD2A 2BQPA 5JXIA 2D6LX 3GZAA 3MGUA 5D8AB 3U14A 1JU3A 4LK6A 3ZYHA 4TWTA 5FR3A 4NOTA 3VBSB 4M4RA 2JKXA 2FDJA 5FY4A 1JYNA 5FYBA 3TYJA 4BK4A 3CJIB 3QD6A 3HQRA 4HK9A 4Q1RA 5CKQA 5CFCA 5FY5A 4OQ8A 3N4MA 4X6RB 1LHWA 3ZKYA 2VVEA 1K5MC 2OYZA 3UV9A 4EYUA 1ACCA 2AH2A 4OI4A 4XJUA 5K0UA 3ZFEB 3WF0A 1JYXA 2ZS6B 4HN0A 1V6IA 4RS5A 3RVHA 4TZDA 4KGQA 1H30A 5FK7A 2YBSA 4JC1A 4W6YA 1ZBA2 3I2HA 4UW3A 5DDJ3 2P1BA 1DP0A 4CPBA 4E8DA 1V9U1 3N9MA 3PU3A 1MR5A 3LIHA 3MPPG 3B02A 1JODA 4K1YA 3HT1A 3NQHA 3TN91 1YO8A 3QBQA 4MUVA 4CCOA 3P6BA 4S2HA 1KJLA 2R071 2R16A 2B9UA 3ABZA 5FZDA 1DHKB 4A41A 3ZX7A 2ZGQA 5IATA 2UU8A 2YROA 3QLQA 5SV8A 5K7PA 1RJ8A 3NL1A 1ULOA 4DUXA 1Q56A 5IT6A 3ZXJA 3W58A 3KSCA 2JICA 2PA7A 1UYPA 2FMDA 4PBOA 3O1VA 4A6SA 3D0SA 1LENA 2OS2A 2OUHA 1IG3A 1QJX3 1LGBA 1L7QA 4FXKB 4QPIB 1UY0A 1ALYA 2VBBA 2KA3A 4DQAA 5A7QA 1COV1 3AZVA 4Q26A 2F6BA 3I3QA 3NJZA 3POIA 2GH2A 1RUOA 1IOAA 1PIV2 1ENQA 1ZA7A 2VAUA 3HN1A 3ZIXA 1WA4A 5FZOB 5FMOL 1JOBA 1OKOA 2WYSA 1OLRA 4UW4A 2RS31 2LTNA 5D1IA 1NCRB 2HKXA 1ONAA 1IHMA 2XB6C 1Q8QA 1HQLA 5KXBA 2DBNA 2WYFA 3GJAA 3ZN4A 2MEV2 2VNVA 3VZNA 4CA9A 4QKBA 4INDA 4Q0UA 2ZGLA 1AYM1 4RHV2 4YGEA 4CP0A 1SEFA 2WT1A 4UFKA 3SKJE 2YPJA 3RWKX 3ECQA 4AAPA 4IGPA 1V6KA 4KGGA 5DDJ2 2JD4A 1WCSA 1N3PA 4WVWA 2JD9A 1NCQA 2RJLA 3I2IA 3MHZA 1IKPA 2O0OA 5L73A 3VDCA 1J59A 1RTVA 4EJRA 1ASJ1 5FPAA 5LEJA 4BQ2A 3WNMA 4M0NA 4V2WA 2JDZA 4WZFA 2TUNA 1FMD2 2GC0A 4J1WA 1CAVA 2KD7A 5EJZB 4DFSA 4ARYA 4AQ2A 3POGA 1IQAA 3JCIA
chains in the Genus database with same CATH topology
3E6CC 5E8AA 1NQDA 1RUE3 1D2SA 2FHRA 4CDXB 2R062 1J1TA 1RUE2 5EYXA 5D8AC 3OD4A 5GM0A 3EO6A 5T52A 1B35C 2XWBB 5JZGA 5GLWA 1LHVA 3MIGA 4AK3A 1VBC2 1H8TA 1GR3A 1QNYA 4XBLA 4Q4Y2 5A33B 1H4HA 4HETA 2RS53 1JHNA 2A5ZA 5BNPC 1S2KA 3PLQA 1QJZA 4JGYA 4KWKA 5I0UA 3D82A 4HVQA 4AFDA 2LALA 2CYFA 5C8CB 2EAAA 4L11A 4GA9A 1AR82 1Q3EA 2WQ4A 1ZNPA 2IXHA 5JI7A 3OF1A 3VHPA 4B4PA 3EHKA 3AJYA 3OTFA 5I0TA 1AR83 4HVRA 2IZWA 1WW6A 1ND3B 1PO11 3MLLA 3TNQA 4CYDA 4GKXA 2YGMA 3ILFA 3L2YA 3LZZA 3M7AA 5CA6A 4M3CB 2P3KA 3WW1A 1FOD2 1DGRA 2P17A 3JU9A 2FQPA 3KCXA 1E57A 4HPKA 2K2SA 1GZWB 3AZWA 5H9PA 1JUHA 2A6YA 5DG1A 1WLWA 4RR3C 3ELNA 2WZR2 1BKZA 3KGZA 4BYYA 4XPVA 2Z5WA 2WFF2 3AFKA 4CDXA 4ISRA 3PHMA 1OA4A 3D8CA 5JR7B 3B7MA 4YM0A 1C3HA 4K21A 3U11A 4WM7B 4YG0A 3AJZA 4XXAA 5K8SA 3MPBA 2E51A 1RUC2 2JEMA 4XJAA 4BLJA 2ZHLA 4COUA 1DGRN 1PZ7A 1RINA 4YLZA 4YARA 3AMMA 3D0JA 5FOJB 2PYTA 2D3RA 4R9DA 4YVSB 1FMD3 1NLRA 4D7SA 1D4M3 4K1ZA 5SV5A 3PMEA 4JV4A 1N1TA 1QHDA 2K0GA 1JW6A 2GC1A 2R072 2Y0OA 2A70A 3WXPA 1R081 1G86A 4YW1A 4YW3A 4ZU4A 5FAXA 3NV2A 1SLCA 4D94A 2VOKA 3RRDA 4LBJA 1AL0G 3N7MA 3OCPA 4R9AA 1RUG1 4ITCA 1GZWA 1BVP1 2MEV3 2ZMLA 3JB4C 3RS6A 1RUD2 2E6VA 2NYYA 3QACA 4XZPA 4XF4A 3NSTA 1KJRA 5CFDC 3LAGA 2WZR3 1EV11 2WS91 4MGIE 3UJQA 3EXUA 4XFHA 1F31A 2E63A 2XJSA 3V0BA 3WCSA 1QJU1 4M3CE 3U0ZA 3ZIWA 3MW4A 3MW3A 4FPKA 1UZZA 4I3PA 4YVWB 4BA6A 4C0BA 3HT2A 3ES4A 4FXGB 1C8M2 4YM1A 1AJKA 1CPNA 1OPOA 1PVC1 5CAZA 2DUOA 4LHLA 4QQLA 1VBD3 2D7FA 1OA3A 5T5JA 5ABJC 3AKPA 1I5ZA 4XBQA 2FMYA 3RI8A 1S0BA 3V0AB 4CP2A 2H6BA 3AKRA 2GMEA 2UY8A 4YM2A 1Y3TA 2DU0A 1R092 1LR5A 1OI6A 3USUB 1HQWA 2FZ2A 2YC0A 2XGXA 1XE8A 3KS7A 1GLHA 4F8AA 1N1SA 3WW2A 5A33A 5T54A 2ZA9A 1H2KA 4AVCA 4A7ZA 2UY9A 4CDXC 2VNRA 4I0WB 1BMV2 4FPOB 4RR3B 1HX6A 2A7AA 1UU5A 2NN8A 1CN1A 3S6PA 4DNYA 5I93A 4MYEA 2RS32 4Q0PA 2GNTA 1UF2C 2DVAA 2XKPA 3ASIA 1S0DA 4RS5B 1YYNA 4BWOA 1SDWA 3AMNA 3NVCA 4DRVA 4GWNA 2UWAA 4Z82A 4OI2A 4XXPA 4Y5Z0 4G4FA 3LSDA 3ILRA 2PTMA 5I0RA 3OY8B 3RPQA 1LB2A 3AMQA 3BU7A 1OKQA 1MEC2 1CR7A 2YXSA 1O4ZA 4O9GA 3ZSJA 2GC3A 3AYEA 1C1FA 1W6MA 2VGDA 5T5OA 3SH3A 2RR11 2EXHA 3MZHA 1VBD2 2D6PA 3R0RA 3ZSMA 5C6CA 2JENA 4PDWA 1RVF1 5AC91 3VGIA 1POV3 1CAUA 1AZDA 3H3UA 2DWRA 4WVMA 3R4DB 5BUVA 4AG4A 1BVVA 5L7OC 3L9JT 1PGL1 3URFA 3EBRA 2G4IA 1S0EA 2WNEA 1SLBA 2ZPXA 1DYKA 3D6EA 3ACLA 4JGYC 1AR61 3U4XA 2GAUA 1GSLA 1C1LA 3TBDA 5GZFA 2UURA 1V6MA 4YW4A 2ZAHA 2PHFA 3R4UA 1VP6A 4M0HA 1LHOA 4AGGA 1AR71 4LBQB 2VVDA 4AHZA 3WG4A 1RUJ3 3OPZA 5JZGB 3DGTA 4YG3A 2WZR1 3SCHA 5GZGA 4YYOA 2GZWA 3RZZA 3ZXAC 4FCAA 1NXD1 4CDQB 5CFDA 4YVWC 3THTA 1WMDA 4LBQD 3SCGA 3VBHC 2QNKA 3MICA 4UBHA 4AVAA 3N3HA 1AYM3 1TMF2 1SBEA 4GMP3 2A73B 2P37A 2ZHKA 3JB8A 4ONUA 2D5FA 2R32A 4KG0A 2Z79A 1PGW1 2OIIA 2QE3A 1C8M1 3FUOA 3MLJA 1HRI2 4YG6A 1ND2B 4QU2A 1WLDA 4RL7A 3ZFEA 1UL9A 2TNFA 3ZFFB 4COWA 1HRV3 1OFSA 2Q1MA 1A3KA 1KQRA 4EN7B 2Y0IA 2WWSA 3SNMA 3KM5A 3AZZA 1QU0A 2BNNA 4HVOA 2HWD1 2DVGA 1ND3C 5CG9A 1RUG2 4IXLA 1TQ5A 4P9WA 3WR0A 3B93A 1PIV3 4XF0A 3TWIA 1IKQA 2HWB3 3J4UH 3M1HA 4PLMA 2IFWA 5DUUA 1BYHA 5A32A 1H2NA 4U2AA 3VKOA 1R1ZA 4JGZC 2Q4SA 1QXPA 1UCXA 1FPN3 1PGW2 4OHXA 4ATFA 1OOPB 1RUH2 1VBB2 4Q4W2 4Y4YA 2D5HA 4OHYA 4WM7C 4Q0SA 2WZPP 5DDJ1 4FP2A 4AF9A 4IESA 4Y1YA 4N7UA 2R6QA 1G7YA 3VBRB 4AHXA 2DCTA 1YJLA 2R073 1RUC1 4LA3A 1TMF3 3LSEA 1B35A 1YIPA 1W6OB 2RHPA 3I7DA 3S0MA 4IETA 5GALA 5JSRA 3ME2A 2ZHMA 4R4XA 3AP7A 3ILNA 1S0FA 3B00A 3DPRB 1BQPA 3GZTB 2WLPA 2ZAAA 4JCKA 2D97A 4Q0VA 3ZYRA 1YXWA 1YUDA 1ZVFA 5JZGC 4BIOA 3ZO0B 3DKWA 5A3MA 5HCAA 5GZEA 1OHFA 4RS5C 3ZFEC 1UMZA 2EF6A 1EPZA 3O0WA 1R093 2RS12 3OBRA 3PNAA 2QQPA 4XJ9A 5E1RA 1U0AA 2A6ZA 1YFWA 2YMZA 1Q8PA 1AL23 1S0GA 4H7MA 5EJ3A 2ZZJA 1SLIA 3DPRA 3GHMA 4QGMA 2CNAA 1N3OA 2R0FA 3WD5A 5DG2A 4C1XA 4H14A 1SBFA 1LU1A 4Q4Y1 2YUEA 2OVUA 5GLVA 3M3EA 1CESA 1R083 1NY71 2WSVA 2QZ2A 1LOGA 3MIHA 3MFAA 2IWGB 1XRUA 3NAPB 1ZREA 1ND2C 4RQPC 2R043 3E5UA 4E2QA 1VRH1 3M3QA 3VL8A 2XPJA 4AVVA 1OSGA 2WIIB 2VOWA 4IV1B 4UW5A 1QOSA 2WA4A 4IEVA 3IKWA 1IS4A 4KBBA 4H7LA 1QH6A 1V6JA 2DURA 3VBUA 4XW3A 4XJZA 3J9SA 4YGBA 1WW4A 3WDXA 3ZYPA 4I02A 2BWAA 4AI2A 3IDCB 4A3XA 4QGLA 1NYWA 3LA3A 4KQ7A 4L9BA 4OVEA 1KITA 2PHWA 1ZRRA 1HRI3 2H0VA 2GNBA 3VBHB 2WL1A 3MYXA 2ZGMA 1ND2A 2JECA 1YIFA 2GNDA 4NHLA 2PHTA 4L99A 2N7GA 1XXNA 1WW5A 2BBVA 1G9DA 3H1YA 2AREA 1G9BA 2RMU1 4JTNA 3ZFFC 1RJ7A 1WLCA 1QWRA 4AEMA 4YZ5A 1LOBA 1VAKA 1EV13 4COYA 4RA0A 1QXJA 3E5XA 1H9PA 1PZ8A 2XKOA 5JSPA 1QQP2 1SQ4A 4JAAA 4W65A 4DY5A 4IV3B 5FBZA 4HKWA 1V6NA 2WNUB 4PDWC 2BTVC 3HR9A 1NG0A 1Q8SA 1MS1A 1CAWB 2G9GA 2XL7A 1XNBA 3ZDSA 3E97A 3AKSA 2B5HA 4JGYB 3PVBB 2R1DA 4R52A 3GBWA 4S2DA 2ERFA 4BMEA 2R042 1S2BA 1XU2A 1Y43B 3WT3A 4K9SA 4DINB 4ZU5A 5BNPB 1CAXA 5H9RA 2C9AA 1X50A 1GYKA 1WMEA 3VLBB 4R9CA 3QCWA 3CJIC 2EAKA 3VBRC 4AEDA 1ND3A 5LRSA 2D44A 1VBA1 1JYCA 3UJOA 5E88A 3ST7A 3KT7A 4IQPA 4XFIA 3UKNA 2CGNA 1WLTA 3M70A 4EN6B 4LBNA 1MZEA 3ZYIB 3NAPC 3G7DA 1H1IA 3HIFA 4QPGA 1J3PA 1O3QA 5GLZA 3X29B 1PK6C 4YGCA 2R30A 4Q8KA 4IV1A 3KLSA 1KDMA 1R1A2 1WMFA 1DQ1A 3IM0A 4K3UA 4LHNA 1X33A 4FPYA 4YW2A 2CAVA 3I59B 2DUPA 5EV7A 1R1A3 1VBE1 5TSWA 4AXOA 2XVLA 2JX9A 2RS33 1APNA 4ISQA 4N43A 2NMOA 2EXKA 1VB2A 1S0IA 2HWF1 1W6QA 4I2OA 1RITA 5E16A 2WFF1 3I54A 2CWMA 1FOD3 1OFNA 4AE2A 2HWF3 4KWJA 5BPXA 1GQGA 1UX6A 2FZ1A 3O14A 4E2GA 1KS5A 1KFUL 4JGZB 1EYBA 2PFWA 1Z7S2 3USUA 2Q8OA 1OPMA 5GLUA 5DZGA 1HQNA 4FTSA 2QUOA 1O5UA 2ZX2A 2WSUA 5FRAA 3VKNA 1FPN2 3B01A 5JOXA 1DQ0A 5DUWA 1CJDA 3BALA 2MEV1 5AFEA 4XQWA 2WNUC 3V65A 2CWSA 4CEYA 1I1EA 2A75A 4FBFA 3O12A 4AGRA 4C1WA 4IV1C 2HWC1 2B42B 4NHMA 3RSJA 5KXCA 3GBFA 1DQ2A 4YZ1A 5JLVA 1PNFA 3CU7A 4Q4X2 3M3IA 4CEYB 4FOQA 1RL3A 4M3CA 2VH9A 3RQ0A 4QT6A 1OQ1A 2B39A 1OQDA 1SMVA 5KBFA 1REFA 2EIGA 4SBVA 3D5OA 1OA2A 4E4SA 3WQ7A 2JG9A 4NR1A 5JCTA 3ZYGA 4FSJA 1TMF1 4ZXKA 3HWJA 5KWRA 3NKGA 2WFPA 5CG8A 2AR6A 3J8F2 1JBCA 3JD73 5EWSA 1UZYA 3BTAA 1WW7A 4RHV3 1LOFA 1ZBA3 2XJQA 4W6XA 1H8TC 5C8WA 1Y7BA 3RNSA 1EAH2 2WKKA 3M4FA 4GALA 4FAHA 3E6DA 5FMOS 3VBOA 4YVSA 2VQ0A 5H9SA 3PVOA 1Z78A 1MQTA 5FCCA 4JDMA 4XETA 3HAGA 2NP0A 2OW4A 2XBO3 1DZTA 1GICA 3NO8A 4N43C 4B7KA 2A6XA 3NW4A 1YJKA 5LEKA 4OFGA 1TNFA 1SFNA 2JJ6A 2O8QA 2BNMA 2BVBA 2ZACA 1AX1A 2AENA 3FWEA 4L2NA 3H50A 1ZZ6A 2WC2A 1C8NA 3O0XA 4AQ6A 3KD4A 1CPMA 1LCLA 1R082 2V09A 2PLV3 4YVWA 5BYNA 5FO8B 1JYIA 2ZX3A 2BPA2 5F5QA 3WQ1A 1BEV3 3B9IA 4XTMA 3BB6A 3MIFA 1ZRCA 1QJU3 1Y9QA 1RUF3 1REDA 4Z2WA 1VBB1 4Q4W1 3RG0A 1VBA3 3FJSA 3DL3A 3O7OA 2PHXA 4U36A 2JXAA 2HEVF 1YI9A 1ZM1A 2ZMNA 2XJRA 4CRQA 3H0OA 4IL7A 3WG3A 4KH9A 1BXHA 3CLPA 2HWC2 2I2SA 2HEWF 4PF5A 4AWDA 3VBUB 2O8OA 2IXLA 2OUJA 5KHHA 1AR63 2HJIA 3ZYJB 2UWBA 3ZN6A 2DCJA 4P9JA 4GKYA 4WVZA 5DUVA 1NE4A 2R1BA 4D7YA 2D6KA 1UPSA 4HZFA 4RR3A 1H1MA 1ZBE1 5FLIA 2WJSA 1UIKA 1RHI3 4LO5B 3VKFC 3LB9A 3RWNA 1RUI3 1HRI1 1QKQA 1CAUB 1FYUA 3WP6A 4Z92B 4YSFA 1DFQA 1OMIA 4LLFA 4XDQA 1UW8A 3LGRA 3WV6A 4AEKA 4FTEA 5DZEA 1YFXA 4LE3A 1W6QB 2GN7A 1FI2A 4EN0A 1JN2P 5CBLA 2RS11 3BCWA 1VAVA 2QKDA 1V9U2 5KXEA 2BNOA 4LA2A 1CX4A 4P9GA 1WGPA 3AX4A 4CDWA 5JOWA 3RYRA 1QJY2 3ZFGB 1CAVB 1RUH3 2ATFA 4PJYA 2XWJB 1ZBE2 2OZ6A 1YCIA 2GC2A 3NV4A 4XBNA 3OJBA 1H1AA 3T2TA 2DUQA 3WDYA 3I4IA 4XQ4A 2P34A 5L7OB 1XNDA 1DF0A 5C8CA 1TEIA 3SLIA 1AR91 4L92A 5HCBA 1IPJA 2EA7A 3FHIB 1W0OA 2XBO1 4KWLA 1WBFA 2XHKA 4Q4V3 2ZJCA 3J8F3 4Y20B 4YGDA 1XYNA 4AEDB 1PK6B 2A3WA 4OULA 3N7LA 1Q8VA 5DUXA 2I07B 1KRIA 4HANA 2VNOA 3IMNA 2VG9A 2JKBA 4PBPA 2SLIA 3UKVA 2CV6A 4S2FA 2W08A 4Q4X1 3LOBA 3FFQA 4CP1A 1B09A 4XIOA 1H8VA 1AR81 1LJ7A 2YZ4A 4HFSA 2DU1A 1QDCA 4FPHA 1PO13 1HLCA 5GLTA 1WCKA 2VQAA 1D4M2 4MLOA 1DG6A 3PJQA 1LOEA 3FE5A 3TN92 1QJX1 2IXKA 5KXDA 1CD3G 1G8WA 4I01A 1AR92 3WHUA 2C1FA 1HKDA 4LBKA 1A6CA 3JQWA 3ENRA 3KQRA 2Q30A 2WLQA 1AXZA 1RUD1 2C0ZA 4FPCA 2NPIA 3U07A 1DQ5A 1RUJ1 1C4RA 1YI7A 2X5IC 3AXEA 3VDDC 4QPIC 2EXIA 1QQP1 2X8KA 5JPNB 1PO23 4N43B 1UPIA 4NHKA 3TRSB 1KDKA 3RYKA 4EV0A 1D4M1 3IDBB 4UBGA 1YHFA 1W2UA 1FOD1 1C5HA 2R49A 2D6OX 5I0SA 3V0BB 1DIWA 2PHUA 2XH6A 1VRH3 3OD0A 3RJRA 4LR4A 4AQTA 4Y1ZA 4QQ2A 1RUI2 3VBFC 5EXOA 5F6KA 5BNPA 5JI9A 1H0BA 2CL2A 4CEWB 4FTBA 3TB0A 2QFEA 1NA1C 1RVF2 5AC92 3ZFGC 4HK8A 1BJQA 4DB5A 4C0HA 5K0UC 3FFZA 2RS52 5AVPA 5CIRA 1GNZA 1G9AA 4E9KA 1PNGA 1AVBA 1POV0 2YV8A 3UK9A 4R9BA 4CZSA 5ACA1 1ENRA 3V56A 1CONA 3PVEA 1OOPA 1A8MA 2TEPA 2E7TA 4XFGA 5JDBA 1CJPA 1NLSA 4OI1A 1QNWA 2A3YA 5EFUA 1NOVA 3NV3A 4XF9A 3VZOA 5T5PA 2WS92 1D0HA 4NWVA 1QMJA 1FV3A 2E7AA 4YFZA 4XFBA 1NY72 1O91A 3VL9A 5F6LB 2YGLA 3AKTA 3AXDA 1REEA 1U5XA 1FATA 1WUVA 4BQ1A 4FP3A 3KCYA 3ZXFA 1VRH2 2C5DA 1MZ6A 2PLV2 2CGOA 3J8F1 4LO7A 3USSA 2RS51 5KHIA 1GANA 3ZFGA 4ORFA 3K48A 2ARBA 2ZHNA 4FO9A 5C4WB 1UKGA 3BPZA 4P9YA 4RGAA 2MPFA 3MI8A 3VDDA 2ET1A 3SXWA 1V6LA 3QH7A 3UKTA 4GXLA 2VVFA 5IK8A 2AUYA 5J48A 2XUMA 3MIDA 3QOPA 2GH8A 1GQHA 5FO7B 4EN9B 1S0JA 3AP5A 1ZA4A 3WQ0A 4GB33 5DXDA 3SMHA 4XOGA 5IK7A 5HCFA 1V00A 1Q8OA 3A0NA 4YM3A 1PZ9A 3TNPB 1W6NB 5IUQA 2H0BA 2WT0A 3H7YA 4AI3A 3I59A 3A4UA 2RMU2 5JOYA 3VZMA 1LRHA 2GSYA 2X5IB 3KMHA 4YZ3A 3WG1A 4Y1VA 3VZKA 4C91A 1RUD3 4BMBA 1AYN1 1MACA 4NWWA 5C33A 3RYPA 3ZXDA 2W52A 1RUI1 1MS4A 4BE3A 2RR13 4BM8A 1W39A 1Q43A 1CIWA 2RR12 4Y20A 3SISA 4DOUA 2E7QA 1AXYA 5L7OA 1J3QA 4JVAA 2XG3A 3R4SA 4Q4X3 2A6VA 4Y1UA 3IIAA 4YW5A 1NA1B 1X82A 3SH5A 2DVBA 4FPLA 4LBLA 4Q2FA 3FLPA 1LHUA 4QGNA 2JE7A 5LK5A 2VPVA 4E2SA 2VW2A 3CNAA 3FLTA 1LECA 3FMGA 3ROUA 1F9KA 1MZ5A 5ACA2 4HSLA 5C8CC 1OD5A 4XFFA 2Y26A 5CFDB 3SITA 1T6GC 4GB32 2DVFA 5FLHA 4PCRA 2PELA 2D98A 1CAWA 4FQZA 1ULEA 4XYXA 1BBT3 3ZSEA 4FOVA 5T3NA 4YNIA 2R041 4I30A 2UYAA 3VBHA 1C28A 2A6WA 4V1PA 1S0CA 3ZMNA 4C90A 2FBEA 4WZCA 4CTEA 1AL22 4N53A 4OHWA 2D3SA 4KU8A 1U5IA 4META 2RS13 1DLLA 3FC0A 1VIWB 2BWCA 2EALA 5K0UB 4Q1PA 5JOZA 2I45A 2OA2A 1N1YA 2DFCA 5JIAA 4B3NA 4Q0QA 3WNXA 4LUMA 1RC6A 3A0KA 4KL1A 3VBRA 1CVNA 1LU2A 4YFWA 2HYKA 4HKOA 1DZRA 4HT1T 3CF6E 2ZX4A 2D43A 3I8TA 3N7JA 4RFT0 2HWD2 1XE7A 4FOYA 3WLUA 1DZQA 2VNGA 2RM21 1UU4A 3MIEA 3VBOC 4YVSC 3WP5A 4FVVA 4JQRA 4Q4V1 1O3TA 2BW8A 2R063 4LLOA 3IT8A 5A32B 4URTA 1WCDJ 3T1MA 1SBDA 4HSJA 5FFOC 1PM7A 1SLLA 2IXIA 1HDKA 4QMAA 4A7KA 1UD1A 4E27A 4MSVA 3EQEA 4BZ4A 4OZXA 2H6CA 4QHBA 3VUOA 2DV9A 5LK7B 2VECA 4P9LA 3H7JA 3NKTA 5FDBA 2WNVB 3ZFFA 1ASJ2 1KD7A 2MNGA 2GDFA 4IEZA 5GJ6A 1JXNA 4AVTA 4E4ZA 1RUF1 2GNMA 1N1VA 3I2DA 2VULA 2HWB2 4LE4A 2BYVE 4M01A 1VALA 1RUNA 1COV3 2X53S 5BNOB 1VBE2 4UXAA 2PHDA 5T50A 1AJOA 2RM22 1NQJA 2OZJA 4LNVA 1LOCA 4P14A 4FPGA 5KHGA 2Z2SB 4AFBA 1ZRDA