2RS31

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3100
1Z7S2 2HWE2 4RS5C 2ZZQA 1MEC1 4CDWA 2HWC1 4N53B 1QQP2 2RMU1 1NCRC 4FSJA 1AR82 4Q4W1 1NA1A 1QJY1 1VB2A 5FMOL 1NY72 1RVF2 4YVWA 4PDWC 2PLV1 4RHV3 1RUG3 2QQPA 3VDDA 1RUE2 5LK7B 1PO11 1VBC1 4CEWB 2MEV1 1FOD2 4CDUB 1PVC1 1IHMA 4QPGB 2PLV2 3DPRA 1COV3 4Q4X2 1VBE3 4WM7A 5C8CA 4GH4C 5JZGA 1ND2B 1V9U1 1EAH2 5A32B 2RS51 3VBRB 4RS5A 1PO23 1VBB1 1H8TC 4FTEA 3NAPC 1RMU3 1HRV1 1NCQC 1AR61 1RUF3 1V9U2 4RFT0 4PDWA 1AYN3 4GB31 1C8M3 2XBO2 1VBB2 1RUD1 5CFCB 2DF7A 5A33A 1W39A 3S6PA 4RQPB 1AR62 4LLFA 1AR91 4GB32 2RS33 1QJX3 4CDQC 2HWB3 2GH8A 5C4WB 4GH4A 1OOPB 1D4M3 1RUD2 1NG0A 4JGZB 1R083 1POV1 1QJU1 1RUC1 3JB8A 2RR13 1COV1 1VBE1 1ND3C 3NAPA 1AR92 4WM8C 1PGW1 1NCQA 1RUI1 5K0UC 1EV11 2ZAHA 3LOBA 1B35B 1PGL1 3VBUC 1TMF1 4IV3A 1PO21 3JD71 5ACA3 1QJU2 3VBOB 1AL23 4QPIA 1RUC2 3VBHB 1Z7S3 2HWE3 2HWD2 4Q4Y2 5BNNB 1HRI3 1PGW2 1RUI2 2WS93 1QQP3 1POV0 1EV12 1RUH3 4NWVA 1BBT1 5DDJ1 1TME3 5BNOB 3ZFEA 1AR83 4CDQA 2R043 1RVF3 1MQTB 3J8F1 1VRH3 4RR3A 5D8AB 3JBG3 1AR71 3VBFC 1VB4A 5DDJ2 1BBT2 2RS31 3CJIC 4Q4V3 1ND3A 4WM8A 3VDDC 4CDXB 1FOD3 1FPN3 4Y4YA 5K0UA 2X5IC 3VBUA 1AR72 1FMD3 1CD3G 1R093 5BNPB 2RR11 2RM23 3VBSC 5JZGC 2WZR1 1WCDJ 4N43C 5AC91 4QPGC 2R073 1AL21 5L7OA 4IV1B 1OHFA 3TN93 1BEV3 1K5MB 4YVSB 1PIV1 2WZR2 2XBO3 3VBFA 2HWF1 1QJZA 1TME1 2BUKA 2Y26A 3HAGA 1MEC2 1RUJ1 4Y5Z0 2R063 3CJIA 2HWC2 2RMU2 5J98B 4JGYB 2RS11 1HXS1 1PIV2 4Q4W2 3ZFGC 2X5IA 1QJY2 4AEDB 1M06G 3VBSA 4GMP3 3M8LA 4CEWA 4N43A 1AYM1 2RS12 4QPGA 5CFDB 1PO12 1VBC2 2MEV2 2RM21 3DPRB 1PVC2 5C4WC 1OOPC 4WM7B 2BBVA 5C8CB 5A32A 1VBA3 3FBMA 5ABJB 4IV3C 1ASJ3 2RS52 4RS5B 1AYM2 1RB8G 4QPIC 2HWD3 4Q4Y3 4EJRA 1NCRB 1F8VA 1B35C 1HRV2 1R1A3 3ZFGA 4PDWB 1ZBA3 3ZFEC 5CFCA 4RHV1 1RUG1 1SMVA 1VBD3 2FZ1A 4RR3C 4RQPA 4SBVA 1NOVA 2WFF3 1RHI3 5C4WA 1OOPA 5D8AC 4RHV2 1RUG2 4GMP1 4JGZA 1OPOA 1ZBE3 2BFUS 2XPJA 1H8TB 1HQNA 1RMU1 5C9AC 1COV2 1VBE2 1B35A 1F2NA 1RUF1 1PGL2 1ASJ1 1AYN1 1C8M1 1TMF2 5L7OC 3VBHA 2GSYA 1PO22 3JD72 4GMP0 2WWSA 4CEYB 1R1A1 5BNOA 1AL0G 1MEC3 1RUF2 4N53C 1VAKA 2HWC3 4IV1C 1QJX1 1RUE3 1HX6A 2HWB1 4CDQB 5D8AA 1BMV1 1D4M1 1R081 3J8F2 2PLV3 4Q4X3 2ZTNA 1EAH3 5C9AA 2RS32 1QJX2 1PO13 4CEWC 1BMV2 3ZFFB 5K0UB 4CDUC 3VBUB 4AEDC 1R082 5ACA1 1ND2C 2RR12 1V9U3 1Z7S1 1C8NA 2HWE1 3VBRC 1HRI1 5J96B 2WS91 1QQP1 1RUH1 1DDLA 1VBB3 3ZXAC 4N53A 5AC92 4IV1A 4CDWB 5ACA2 1AR81 1HRV3 1AL22 2R041 1AR63 1K5MA 1RVF1 4YVSA 1VRH1 5ABJC 3JBG1 1NA1B 3VBFB 4YVWB 1HRI2 4GB33 2WS92 1RUH2 5CFCC 2HWF2 1RUD3 1TME2 4Q4V1 3CJIB 1RUE1 4JGYA 1RUJ2 5FMOS 3VDDB 4RQPC 2R042 1FOD1 1FPN1 1VRH2 4Q4X1 1X36A 4CDUA 2X5IB 1HXS2 1FMD1 3JBG2 4AEDA 1AR93 1R091 1EAH1 1ND2A 4JGZC 3VBSB 5JZGB 4Q4V2 1POV3 3VBRA 4FTBA 1QJU3 4N43B 1FPN2 5CFDA 1RUC3 2R071 1FMD2 1A6CA 1R092 2RM22 1RUI3 3TN91 1BEV1 1EV13 5ABJA 2XBO1 1TMF3 3JD73 3VBOC 3VBHC 1NCRA 2R072 2R061 5BNNC 5A33B 2WLPA 3TN92 1BEV2 5DDJ3 5BNOC 1BBT3 3ZFGB 4FTSA 1MQTC 3J8F3 4CEYC 4GH4B 2R062 1AR73 2BPA2 2FZ2A 1AUYA 2BFUL 4NWWA 4BCUA 3NAPB 4CDXC 1E57A 1NCQB 1VBA1 5BNPC 4IV3B 3VBOA 1H8TA 3IDEA 2HWD1 2TBVA 4Q4Y1 4QPIB 2WZR3 1RMU2 3ZFFC 5BNNA 1GFF2 5AC93 2VQ0A 1VBA2 1ZBA1 1ASJ2 2RMU3 1AYN2 3ZFEB 1C8M2 1MQTA 1K5MC 4YVSC 1VBD1 1PIV3 4Q4W3 4CEYA 4RR3B 1QJY3 2HWF3 2WFF1 4CDWC 1R1A2 1RUJ3 1CJDA 1ZBA2 1RHI1 3JB4C 4JGYC 1ND3B 4WM8B 4Z92B 4CDXA 5FOJB 1NA1C 2RS13 1HXS3 2HWB2 1VBD2 4YVWC 1VBC3 1D4M2 1ZBE1 2MEV3 5GKAC 1PVC3 5BNPA 2WFF2 5C9AB 1RHI2 3ZFFA 2RS53 1AYM3 1X33A 5CFDC 3DPRC 1ZBE2 4WM7C 2IZWA 5C8CC 5L7OB 1NY71
chains in the Genus database with same CATH superfamily
4PI0A 1UOJA 4YYOA 1Z7S2 2FCUA 2K2SA 1PZ9A 2O0OA 1WLDA 2BV4A 3W5MA 3ROUA 1W06A 3CO2A 4N53B 1J58A 1DGWA 1GWLA 4FSJA 5KHKA 2XJUA 1FV2A 1CQ9A 4FOWA 1UWWA 1V00A 1VB2A 1XSRA 2WT1A 5FMOL 3I49A 1NY72 3A0NA 2PLV1 1WWYA 2FCTA 4OMDA 3MLKA 3NJXA 3WG3A 3B01A 4MSVA 4YW3A 4YGEA 4RHV3 1RUG3 4CCJA 5GZEA 1HJFA 5LCWL 2QQPA 2ZHKA 2O14A 3GCWA 3UT0A 1HV0A 4QDSA 2PFWA 3O0WA 1YYNA 1VBC1 2RVAA 2MEV1 4E4HA 1IHMA 1VALA 1Y3TA 1COV3 2D40A 4YG6A 2CHHA 2W94A 4LE4A 4I0AA 1V6KA 3ZXGA 2YC4A 1EAH2 4M0HA 5A32B 4FOQA 3LIHA 5HV4A 3ES1A 4YW7A 4CCLA 5HXVA 4O61A 1W6PA 3HOBA 4A7YA 1PO23 4Y4RA 1FXZA 1EPZA 2YU2A 5KC6A 3P3PA 3D4KA 4GWIA 1N3PA 2J42A 2YC2A 3KQRA 3NV3A 4IL7A 1NE6A 4YW6A 5CKMA 5JSOA 5IK4A 5L9VA 2JXAA 1RUF3 5FYMA 3S7EA 1YJKA 5EYYA 4ZS2A 3IMNA 1AYN3 4PDWA 4DUXA 2Y33A 3OOXA 3HEIA 1LENA 3BKZA 3IPVA 4TN7A 4E8DA 2BP6A 2YUEA 5AFEA 1Z0HA 4FXGB 4GULA 3S6PA 2EAAA 3KB5A 1AR62 5T54A 1XB9A 2D5FA 3KGZA 4ZHNA 1JYCA 1OA2A 2HEWF 2ZMKA 3BGAA 4QQHA 1GLHA 3ZR6A 5GZFA 5J09A 5JIUA 4K9SA 1UD1A 1QGLA 1ULEA 2YGLA 5C4WB 4GH4A 1RUD2 1S2BA 1LTEA 3ZOIA 3WSOA 3V65A 3R05A 4XF9A 3AP9A 3F95A 4QWNA 5F39A 2XLGA 3AKQA 1LKNA 2F6BA 4EWAA 2RR13 2JDPA 3I3EA 3SNMA 2ILMA 2JB8A 3AYCA 3NAPA 1H2KA 4LOTA 4OUMA 3POFA 1CWPA 1ZM1A 4OHXA 1RUI1 4U2AA 5FUIA 5C33A 1RXFA 1W8ZA 1SG3A 2IXLA 2OVUA 2QDRA 2WZEA 2ZAHA 3ACLA 2ZGPA 4OCTA 1TMF1 1XU1A 3BTXA 4FFFA 5ACA3 1QJU2 1AJOA 4GWNA 1BK0A 2OQ6A 1HQLA 2RJ2A 3THPA 4YPJA 2HWE3 3OTFA 4YZ2A 1DZTA 1W03A 1YI9A 2JG9C 3FX3A 5DG2A 3WQBA 2ZPXA 1PGW2 2ZKNA 5DDJ1 4HVQA 5BNOB 5A7QA 1W6OB 1SLTA 2XJSA 3JCIA 4XFIA 2ARXA 4XBLA 5FYUA 1AR83 5M0TA 2OT7A 2R043 1WLWA 2ZA9A 3J7HA 1MQTB 3N9MA 2W46A 4CUAA 4GQ7A 4RR3A 1NT0A 1HB2A 5DN2A 1LOFC 5JCTA 2NMNA 2YBKA 3DUIA 2RDSA 4UFJA 2CAUA 2WBKA 1BBT2 1CZVA 4WVMA 4OHZA 2RS31 3WHTA 4Q4V3 5IVFA 4KU7A 4XMIA 4JC1A 2EVXA 3DKQA 5DAVA 3CF6E 4NHLA 2C0ZA 4DXRA 5HCBA 2R6QA 1JHNA 4Y4YA 2E63A 2ARBA 5K0UA 5I0UA 5DMYA 3VBUA 4BJ0A 3E5QA 1A78A 1Q8SA 2ZX4A 4OUSA 1QNWA 1RGSA 5LB6A 4D94A 1JZ8A 2V4AA 3K4DA 1D7PM 5A1AA 1CZSA 3DGTA 1XYOA 2VZSA 1NLSA 2VULA 2JD9A 4LO5B 1S0FA 1WCQA 3B02A 5F5AA 4KWLA 4QXHA 1XYNA 5A6QA 3USUA 2NM1A 2Y34A 5AC91 1XNCA 2XLFA 2D97A 2R073 1MZ6A 1QH6A 1Y9MA 3GF6A 3SXWA 4CZSA 3BB6A 4Y24A 1OHFA 2WQ4A 3I8TA 1BEV3 4XUQA 5T5JA 3VLBB 2E53A 4MV2A 2QJVA 2EIBA 2WZR2 1UU6A 2XBO3 4QGMA 4XF0A 4XILA 5FYYA 4KH9A 5FV3A 2HWF1 3AJZA 1TME1 1S0IA 2IXKA 3LSEA 2J7MA 3NV1A 1CPNA 3HAGA 4AI1A 3S57A 2R063 2DBIA 3KM5A 4PHZA 4QKDA 2VTXA 4YNIA 1QIQA 4XXPA 3AMNA 2P1BA 2FDKA 2RS11 5IJRA 1W6NA 3S5QA 3ZFGC 2IFRA 1QDCA 2R30A 3AJYA 5FK8A 3VZKA 4K21A 4FOYA 4IEOA 4YLZA 2CL2A 2VZQA 3ZXLA 4GMP3 4JRAA 4M4PA 4CXYA 1N47A 1QOTA 3M8LA 4CEWA 4RFRB 2JE8A 5FY8A 3SEPA 2BJSA 1AYM1 4Q8LA 3H42B 3FLPA 4Q0SA 4YG3A 1VBC2 2MEV2 1CVNA 2RM21 3PIGA 3PUAA 3NNLA 1RL3A 3W58A 4CXWA 1R64A 1YFYA 4LHNA 3VKFC 3ZMOA 1CIYA 1J3PA 2WN2A 2ZGTA 4FO9A 5ANNA 5ABJB 4MX3A 1ASJ3 1C57A 5FPBA 4DQAA 1ENXA 2ARCA 5KXEA 3UNPA 4MHUA 3TNPB 4Q4Y3 5T3NA 5CIRA 2PTMA 3ETQA 4MADA 1NCRB 1F8VA 4Y22B 2XHKA 3FHQA 3FUOA 3J4UH 4PIXA 1LR5A 3KVBA 1H2LA 2BVVA 2AYHA 1U5YA 4XQ4A 1UXXX 3AMQA 3WW2A 4PDWB 2GN7A 2AR6A 2VR4A 3KGLA 5FP3A 1KD7A 2P3KA 5LY2A 4RHV1 1RUG1 3AKTA 4C91A 4W8JA 5HI0A 4K7JA 3B69A 4D8MA 4RR3C 4CCMA 2XJRA 2UWAA 1O7FA 3WUCA 4B4PA 2H6CA 1JYVA 5F1RA 5KC5A 3PTYA 1BCXA 3O1PA 4LBMA 2WZ8A 5IK8A 4G9SB 1TVGA 5A3LA 2P5BA 4A45A 5IT6A 1YI7A 5D8AC 4COYA 3VDBA 4JGZA 2VZTA 4XABA 4XBNA 4CXXA 2JE9A 4LA2A 3BTZA 2WAAA 2GU9A 2A70A 2J1EA 4EWDA 1GV9A 5FO9B 3FFZA 4IGQA 3UJQA 1QY4A 4XJ9A 2RJLA 2YV8A 4Y33A 4Y26A 3NJYA 5FFOC 5FZ8A 5HCHA 5HXMA 5B4NA 5C9AC 4HN1A 4KU8A 2Y6LA 5JOWA 3OD0A 3K77A 3QOPA 1S1AA 5BYNA 1B35A 4OHVA 2IVJA 1RUF1 1XQNA 3LPFA 3OCPA 4D7SA 4GJZA 1AYN1 1ULCA 2D3SA 5FYIA 1TMF2 5IVJA 1Q43A 3MEPA 3NV4A 2RDNA 1YC61 1GQGA 2VCAA 4NRMA 2V4VA 1IS4A 2W95A 4Q1RA 1DIWA 3Q8BA 2AC1A 4QDQA 4WBBA 4ZS3A 5IAVA 3N9OA 1W8FA 2P3JA 4GMP0 4MXWA 1XU2A 5FLJA 2WWSA 5JOXA 3S5AA 2C1FA 3NL1A 2XKOA 1GWMA 1MEC3 3MO4A 1BKZA 3D5OA 5EYXA 1YXWA 1OLMA 1OMIA 4C1WA 1AZDA 3FE5A 1IS5A 4FFGA 4CP9A 3O1SA 1W8NA 3Q9OA 3PVEA 1N1SA 1WD4A 3V0AA 5FYZA 3IZOA 5J37A 4AI2A 1BMV1 1JODA 3EJKA 1CAUB 1UY4A 3V0BA 1A8MA 3SKVA 3DYMA 5DABA 2PHDA 3WP3A 1EAH3 4A4AA 3LA2A 1I5ZA 4N9IA 3UKNA 5KHGA 2RS32 4Q26A 3A0KA 1JU3A 4FXKB 4R9CA 4BLJA 4CEWC 5K0UB 3KLSA 1O91A 3VBUB 5FPAA 4AEDC 1R082 1GICA 1HB1A 5FOBB 3DYOA 5JPMB 2BOIA 3OUJA 5ACA1 2VNRA 4UWDA 5IK5A 1FV3A 1QXJA 1UL9A 4IQPA 4XDPA 3T4VA 4EWEA 1IQDC 1G9CA 3WDUA 1W6QB 1SEFA 2GP3A 2HWE1 5T5OA 3WT3A 2OIIA 4BQXA 2VNOA 1G8WA 4LPLA 4LOSA 4XJ8A 2ZEXA 1TNRA 3SCFA 3URFA 3ZXAC 2OA2A 2OYZA 5AC92 5IVEA 4OQ8A 1P8JA 2DTWA 5F2WA 3WQ7A 3B9CA 1AR81 3MLLA 1S2EA 4QQPA 2R041 1WMXA 1AR63 1K5MA 4YVSA 4HSJA 1ALYA 1LHNA 5JI9A 2BVBA 2A1XA 2VGDA 2CGOA 4MGZE 2VW0A 4FCAA 4Q0UA 4AFCA 1RUH2 5SV8A 2HWF2 1RUD3 1TME2 1LEDA 4K8RB 3TB0A 4Q4V1 5IFPA 4ZU5A 4FVVA 1OUXA 4JGYA 5FMOS 4DRRA 2LM3A 1KGYA 4OMCA 3DF0A 4HPKA 5DAQA 5ERLA 3S7IA 2VAUA 5T5LA 2VOWA 5KHHA 3ACHA 4AEJA 3N35A 3VZJA 5FAXA 2VMIA 1ND2A 3AXEA 4JGZC 4IE6A 3U4SA 5JZGB 4BXSV 4W4ZA 4XIKA 4P00B 1POV3 2DBNA 5L73A 1QJU3 1AF9A 3QCWA 3AMHA 3AC0A 1OSGA 2R071 4IE4A 3AKRA 4QX0A 1MS9A 5IWFA 5BY5A 5JOZA 2RM22 1Q56A 1BEV1 3CZUA 4LHSA 1J1LA 1F15A 4KWUA 4G4FA 4GD4A 2JG8A 5FZFA 5JVVA 2XBO1 3THTA 2XHNA 2B39A 3OY8A 4NPMA 3VBOC 1G7YA 2KM2A 2R061 1DQ2A 3PMSA 5BNNC 1PNGA 2B45X 3I3QA 1XNAA 4IXLA 3TN92 4RGAA 1BBT3 1C28A 3GJBA 1W6MA 3HQRA 5FJHA 2TNFA 4AI3A 4XFHA 4HOOA 3R4DB 1UAIA 1OLQA 4FTSA 2ZGNA 5LRRA 3J8F3 4CPBD 4LIVA 3PDQA 4GKXA 2D6MA 1UY0A 2P37A 2W3JA 3MGUA 1W0PA 3RJRA 4LBJA 1W3XA 5FXZA 4WV8A 4XAAA 2VOVA 3MUZ1 4ET7A 3BIWE 3ZYBA 2VMGA 2BFUL 1GQPA 1RINA 3I97A 3MIFA 2Q8CA 3VZNA 4BCUA 1HW5A 5A3TA 1PHMA 2ZACA 4CDXC 3ZVXA 2QUOA 4ZY9A 5IATA 1V6OA 5DAPA 1NCQB 4FQZA 4E2GA 1OVSA 4QB1A 2ERFA 4R9BA 2UWCA 4XW3A 4KI5M 2OXBA 3WNKA 4XE9A 1HIXA 1JUIA 2R1DA 3KZ4C 1JYXA 3RZJA 1SLIA 1VR3A 1JOJA 3OPZA 4Q4Y1 4QPIB 3ZYIB 2WZR3 4E4ZA 1JI6A 1OUSA 2HH9A 4TLFA 3ZFFC 1GFF2 3CQOA 3LEKA 4AAPA 4AQ6A 2DU0A 1FATA 4QD2A 5K9YA 2BNNA 1GOFA 2WDBA 2VZ1A 2WWJA 4QQLA 4LEJA 1KS4A 4IEUA 1AYN2 2DVGA 2GNTA 1HLCA 1Y9GA 3CU7A 2WR9A 3H50A 3ITQA 1K5MC 4YVSC 3RG0A 2DVFA 3HT1A 3OG2A 2XH6A 2WAOA 5BUVA 1W9YA 4JHZA 2VOXA 4CP9B 2ADDA 1V6LA 3DKWA 1AXZA 3GBFA 1O4ZA 3JB4C 4LNVA 5F7UA 3V0AB 2BNMA 1OBNA 2Z4FA 4JGYC 4LK7A 5JI7A 1F5JA 3DEMA 1HXS3 1W8UA 4KBBA 5LEKA 1VBD2 2XGXA 1VBC3 2A6XA 4BOWA 2MEV3 5GKAC 5KR7A 1XNKA 5BNPA 4TLGA 3D8CA 4HKOA 1Y9QA 2OPKA 3WDYA 5GLWA 2JEMA 1O8PA 1YQ6A 4UW5A 5L19A 2ZGLA 4P5HA 4M3CB 4QX5A 2Y6GA 3AZXA 3NJVA 4MGKE 5HCFA 5BNQA 2B5HA 4EROA 2D7FA 2P17A 1X33A 2ZGOA 3CZJA 4K6BA 5ANQA 5JR7B 3WDWA 4CUBA 2VUCA 2YBSA 1SZBA 2WNVB 5FXXA 4C1XA 1A8DA 1E5SA 2AGSA 1FNZA 4KMQA 4WM7C 4CU7A 3TYJA 2JDUA 5FUNA 2BRTA 1GSLA 1NY71 3NNFA 1H0BA 5E89A 4D7TA 1DHKB 4OI2A 2DTYA 2HWE2 1GNYA 1MEC1 4R9DA 3OEBA 3WQ1A 4CDWA 1UPIA 3L9JT 3CBNA 2RMU1 4L92A 5I93A 4RGGA 5CKNA 4W6XA 2X09A 5F3EA 5LA0A 2R16A 1AR82 4Q4W1 5H9SA 1NA1A 1QJY1 2BEOA 2L9LA 4YVWA 4BQ4A 1XC6A 2NQYA 1YCIA 2PHXA 3W59A 4YARA 3TEXA 5FY4A 5D21A 3BPSA 3RYPA 3IKWA 1RITA 2KA3A 2IFWA 1W8WA 5I8YA 2Z79A 3KT1A 3ZSLA 1ULDA 1W0OA 4J6GA 4RL7A 2QQLA 1HKDA 3H1WA 3O14A 4HPKB 3T0DA 3AP7A 3LA7A 1IPKA 2Y6HA 5FDBA 1PVC1 1V6IA 4QPGB 3CHXA 3DPRA 1YWKA 3W9AA 3C7FA 3FHAA 5J7MA 2XQRA 5LBEA 2WQ8A 1F9KA 1K3IA 2F4LA 2GH2A 1ND2B 4YZ5A 3VL9A 1GP5A 4MXVA 5EWSA 4LHLA 4TYSA 5L7OC 4NO4A 2YYOA 3SISA 2WYFA 2R32A 2Y38A 3OJBA 4ASKA 3NNMA 4YM0A 3N9NA 4YM3A 4FTEA 1K12A 1B09A 3O0XA 1RMU3 5A3OA 4QXCA 5EP9A 1MS0A 2VU9A 2WNUC 3HMYA 2PMWB 1AR61 1V9U2 2JG8B 2Z2SB 1RUOA 2VXRA 3VKLA 1C8M3 2ORXA 1OLME 1IS6A 2W5FA 2XBO2 2XKPA 3OBZA 2VZPA 4ITCA 3WQ0A 4C8DA 3O1RA 3AKSA 1RUD1 5A7NA 5CFCB 2YGMA 2DF7A 1KEXA 2VW2A 4QB2A 4CVUA 4LT5A 1W39A 2BGOA 4LR4A 1LRHA 2YROA 4A42A 1GP6A 2I07B 4INDA 3WVJA 1DYPA 2CAVA 2GNMA 1OKOA 5GLVA 3MIHA 2V73A 5FBJA 2RS33 1JZ4A 2HWB3 2DUPA 2YFZA 2WQZC 1OOPB 1UOFA 4NUBA 1PX3A 5IK7A 4UI9L 1NG0A 4LHKA 2PHTA 2ZXQA 1R083 1POV1 4XJWA 4NIHA 1QJU1 5A3WA 1X9TA 2YC0A 3M1HA 1J84A 3IBMA 5FIXA 2A5ZA 3ZSKA 1VBE1 1ND3C 4WM8C 1AR92 3FHIB 4XTMA 1PGW1 1ACCA 2ZX0A 3P5BA 4Q0QA 1LGBA 4JDNA 5CYYA 5DUWA 3VZLA 5FPUA 4Y1ZA 3D0SA 4AHWA 4A3ZA 4TTGA 4FFIA 1WMDA 1H9PA 3LE0A 4Q5OA 5FZGA 2H0BA 2VTXJ 4QGNA 5A7SA 3VUOA 2G1MA 1ZNPA 4Q4Y2 2VECA 1JYWA 4ZKTB 3ZYRA 4MGSA 1VIWB 4NHMA 3N36A 1QQP3 1RUH3 3ZR5A 1BBT1 1TME3 2W1QA 1R1ZA 5J36A 1FAYA 3ZFEA 4EN9B 2GDFA 3AZZA 4R8HA 4XF4A 3J8F1 3BUCA 5D2AA 2LTNA 2J22A 1IGOA 1UZ0A 3AFKA 4BQWA 4LULA 5FPZA 4F8AA 3FLRA 4UT5A 4B3NA 4DY3A 4MVTA 3AFGA 3HNBM 3EHKA 4BIFA 3R6SA 3CJIC 1F31A 2DV9A 1TQ5A 4Y5SA 2EXIA 4OHWA 5IHRA 4URTA 3ZN6B 1Q8QA 4H3WA 5G05L 2PQQA 1UO9A 4XACA 1G86A 2A75A 1UY1A 5BNPB 1O3RA 2RM23 5LBFA 4Y20A 3P1IA 3H3ZA 4LBOA 5LWBA 2CDPA 5FPLA 3VBSC 1JXNA 3UGGA 4PJYA 4AGVA 5IVBA 2WZR1 1XBFA 3PVOA 1G9AA 1A3KA 1WLTA 1PZ8A 2JG9A 4B29A 1WCDJ 3I59B 4PCRA 4UAPA 2ADEA 2P4EA 4LO8A 2ZGMA 3GYDA 4AVVA 3TRSB 2FDIA 3C2UA 1AL21 1AXKA 2D6OX 4YG0A 4H2AA 5L7OA 3B3QE 3LSDA 4IV1B 1LGNA 1VJ2A 1YQ8A 2P2KA 4ZU7A 3TN93 4RYDA 3AM2A 1JZ2A 4AFMA 4FPLA 1ODMA 2QTWB 4W50A 1LOFA 2JICA 3P6BA 5FZ1A 3WNNA 2ZGUA 2XB6C 3HIFA 2SLIA 1QJZA 4XJAA 2ZEYA 5FZ4A 1SFYA 5K4LA 2XDVA 4QXBA 1MS3A 1US3A 1MEC2 4XBQA 2D6KA 3S30A 3CMGA 1QJFA 2RMU2 4IEZA 1TNFA 2QQUA 5FZ0A 4AOCA 5HV0A 1W28A 2FQPA 1HXS1 3POEA 4XOGA 1SQ4A 1UU4A 3EB7A 1CESA 3HT2A 4P9GA 4Q4W2 2WNEA 3T3YA 4LKEA 4AQ2A 1QJY2 1YHFA 3VD7A 2VW1A 4K20A 3H1MA 1PVXA 4TWTA 2TUNA 5FYVA 2E51A 1UQXA 3WDXA 4FPGA 2OUJA 4E9KA 4N9HA 1LOEA 3POJA 3DPRB 3MIEA 4FPOB 3KF3A 4AK3A 1PVC2 5C4WC 5LZ6A 2BBVA 3WY6A 5FYTA 5E8AA 2WN3A 3MI8A 3NQHA 1JTZX 4HG6B 3FBMA 1IZ3A 1UOGA 2VMDA 3HBZA 4M00A 3U14A 4AFDA 1D0GA 1IKPA 1CGPA 3IAPA 2IXJA 2DURA 4CU6A 1JBCA 3NWKA 2WSUA 4OI0A 1U12A 4HBNA 1BVVA 1O6UA 1ENSA 3TWIA 3GZAA 1AVBA 1E5IA 3LF7A 3ZFGA 5A70A 2G9ZA 2B42B 5JWPA 1FYUA 2JJ6A 3ZFEC 4C0HA 2IXCA 3BTAA 1Q5OA 4P9LA 1JZ3A 4P02B 5K8SA 1VBD3 2ENRA 2ORZA 3MIGA 1ZA7A 4RQPA 3H1YA 1TG7A 3T2QA 1NQDA 4COWA 1NOVA 2FCVA 3AMMA 4FP3A 1WBLA 1QWRA 4H7MA 4DRVA 2B46X 2WJSA 2RV9A 3K48A 3PUQA 1IG3A 2DYCA 1O4YA 2PHFA 4GWMA 3VHRA 3VD9A 2DCJA 3BTYA 2VZ3A 1HQWA 4JDMA 1G9FA 4XAEA 3T0BA 4NPLA 4LE3A 5FZAA 3RZZA 1D4VB 1OPOA 3WD5A 4CP1A 5I0SA 1Z78A 1XE8A 2ZGSA 4XDOA 3KQ4B 5FZBA 3H8XA 2BFUS 2A6WA 3GJAA 5T50A 1SLBA 1H1AA 4DFSA 5FY9A 2JDHA 1HQNA 5EZWA 4FPKA 1RMU1 4FPHA 2D3PA 2Y60A 4N90A 1J3QA 4QT6A 3WINE 2BGPA 1BYHA 1VBE2 3OD4A 2ARAA 5AFBA 5C7GA 1GZTA 3LKJA 5FTTC 1DGWX 1SFNA 3A21A 1C8M1 3EBRA 3QD6A 1OH3A 4K8FA 4XJZA 4I3PA 5FZHA 2VJXA 5CNAA 3RDIA 3RWKX 3VBHA 3ZXKA 1GANA 1U5ZA 2YFUA 4AVSA 3NVCA 3TEWA 1ZZBA 5FP4A 2VOTA 2ZMNA 3ST7A 1LGCA 4CEYB 5J1XA 1R1A1 2VH9A 4CCEA 1AL0G 2A3YA 3J26N 1I6XA 1GQHA 1S0JA 2MPFA 4NIDA 2WA4A 4V2WA 5A7WA 3T4HB 2BDRA 3K51A 4OZXA 3RZLA 2HWB1 4UFLA 4KGGA 5D8AA 5FQ0B 2GNDA 3BOWA 3CLPA 2FDGA 1R081 1YO8A 3J8F2 1YJLA 2JECA 2VNVA 4YGBA 1OVPA 2KD7A 3UETA 3ILRA 4G3YC 3KWVA 1S0DA 1OLRA 2MHFA 2P6HA 2Q1MA 2VBDA 1UZZA 2ZTNA 3K75B 1F4HA 1F35A 4NPRA 3ZYJB 2O1QA 4GAZA 4JDOA 4YGCA 5C9AA 3WDTA 4E2SA 1PO13 2EIGA 3T2TA 1XYPA 4MHRA 4CDUC 1Y7BA 5FP9A 4RGKA 1JOBA 1D0HA 4Y20B 2GZWA 1IPSA 4NHKA 5EFUA 3O1UA 1O3SA 4UF0B 1V9U3 1C1LA 1K45A 4HANA 3RYRA 1H4HA 3VBRC 2D6PA 2K0GA 2W1SA 1QQP1 1OKQA 1RUH1 3AYEA 3N9PA 4DEVA 5FPVA 5FWEA 4QQ2A 4Z8BA 3LA3A 3NKTA 1AL22 1BLZA 3WW3A 1JOPA 2XVKA 1T2XA 3AYDA 1LEMA 5ABJC 4ES9A 3OF1A 3MDPA 2ZKLA 4L2NA 1NYWA 2XVGA 3FUQA 4IEWA 2WINB 4HLTA 2WS92 1MACA 4LORA 3SH3A 1W9WA 4XUNA 2W1WA 1RUE1 5JAXA 1H30A 1W8TA 3N4MA 2W9XA 4RQPC 3UKVA 2XL9A 2BYVE 4O7XA 1ULGA 2Q4SA 1IG0A 4Q4X1 1HXS2 2J1TA 3JBG2 3O7OA 4AEDA 4CCNA 1AR93 1PZ7A 4UFIA 3A7QA 2VO5A 5I8SA 2PHWA 4P9IA 1QJEA 1YFWA 1YNAA 4IEXA 1US2A 4LITA 2GMMA 4HKLA 5CFDA 4FAGA 2C4XA 1W6PB 4C90A 3K4AA 5LRSA 1JS9A 3T2OA 1NX9A 4TZDA 1ZRIA 1UKRA 1W2NA 4HN0A 2ETEA 4D3WA 5F5CA 4YW1A 3TN91 1A34A 4XMAA 3IN9A 3WG4A 2W1UA 4TXWA 3U0ZA 4MOAA 3LFIA 2J1VA 3JD73 4GXLA 2JKXA 3VBHC 1ZX5A 1KDKA 3IPVB 3QLQA 3UGHA 3UV9A 1QDOA 1WKYA 2AUYA 3SCHA 1VMJA 2H6BA 5JUVA 3HN1A 3BU7A 2QQWA 5A3MA 4BMEA 3WCRA 4IDZA 3HQUA 3ZFGB 1JW6A 3ASIA 3TEYA 2OQ7A 3O1TA 3OGRA 1X82A 3HQXA 1JMUB 4GH4B 4AW7A 4H14A 1ULOA 4B4QA 3U10A 2XQXA 4Q2FA 3BCWA 1DQ1A 3GGLA 1SHWB 3LDKA 1O5UA 1XNDA 3T2PA 3WF3A 3NAPB 5KBFA 5LA1A 1HV1A 1QXRA 3WP6A 3OB8A 4CU9A 2A6ZA 2HJIA 4FI9A 1SPPA 1VAMA 3MZHA 5AVAA 3VKMA 1CJPA 4L11A 4CA9A 2PAMA 3VBOA 1H8TA 2JWPA 4K40A 3IIIA 2HEYF 4PLMA 1OF3A 2CNAA 2E7QA 1XE0A 1RMU2 3BN6A 5BNNA 3N7LA 3LD8A 3ZX7A 4JTOA 1S0BA 1ZRDA 4ZZ5A 4OUEA 4AGGA 3N3HA 5BXXA 5F32A 5A80A 3UGFA 4ATEA 3RZMA 1CPMA 4UXAA 4CP2A 2RMU3 2Q30A 1AXYA 4YFWA 4A7KA 1C8M2 2GALA 3ZMNA 2BZDA 1VBD1 4YZ4A 5ISLA 3KMHA 3BYWA 4Q4W3 4RR3B 1QJY3 3SEEA 2YXSA 3NV2A 3WDVA 5DQ0A 1VRBA 4QX7A 1R1A2 2JDMA 1DGRN 1UW8A 4QPYA 1CJDA 3M3QA 4WVMB 3TOJA 5A1FA 5A7WB 1DQ4A 3AK0A 3ZXDA 1UF2C 3MW2A 4ORFA 4X8PA 4CDXA 4D6QA 4EN6B 4Z92B 5LA2A 5J3UA 2HWB2 2I74A 3GBGA 2JX9A 2EXJA 4PLOA 4B8EA 3CEWA 1PVC3 1H6XA 4LBNA 4LMFA 5HBAA 3SH4A 1CAWA 5JR2A 1JZ6A 1JYNA 1HB4A 4D7YA 5C9AB 1RHI2 4XCAA 3WF1A 2IUWA 2FHRA 4Q27A 3ZFFA 4AFAA 4P9XA 2JDZA 1DQ5A 4I30A 4RSUA 3M2MA 4B7EA 5CFDC 1EUUA 1QOOA 1MZFA 3E6BA 3KT7A 4KG8A 3USUB 1DF0A 3T1MA 3WF2A 2GMPA 2Q5TA 1MPXA 4A6SA 5C8CC 3M70A 1XNBA 4D0QA 2BBAA 5T52A 1OC1A 4XPVA 4LTAA 3ZXEA 3OBAA 3USSA 4RS5C 4XXAA 2ZZQA 3T1LA 1CN1A 2IXIA 4BQ5A 4UBHA 1QQP2 2D43A 2B8MA 5A3NA 4B7KA 5FY0A 3Q8EA 3A22A 4Y1YA 4W65A 3WP4A 4BA6A 4QDRA 4DINB 3WLUA 4FFHA 1H4GA 1W6NB 4CYDA 4LO4B 5E1RA 3TEZA 2C6SA 5DAXA 1DZRA 3RS6A 3MPBA 1IS3A 1SCRA 4C0BA 1Q8OA 3VDDA 3OYWA 2MNGA 3I2KA 4OFGA 3E5UA 1O5LA 1RUE2 5LK7B 1PO11 4ZPIA 4CEWB 2QVSB 3ENRA 3N7JA 1O3QA 4Q4X2 3ZYFA 1SLCA 5FMBA 4IE7A 5DUVA 1VBE3 2ZHNA 4WM7A 5A6XA 3WW1A 3WZ1A 1PNFA 1HDKA 3VKOA 1V9U1 4NOTA 1ODNA 3QACA 4Z07A 2RS51 4BQYA 1UMHA 3KCXA 4YFZA 3RQ0A 4M3CF 2ZEZA 4AL9A 5J48A 3K3NA 1H8TC 4W6WA 4DUVA 4FAHA 3ELNA 2G4IA 2OS2A 2K46A 4ARXA 2YY1A 1NCQC 3RZHA 5A1LA 3I2GA 2WA3A 4Q8KA 2WFPA 2YB7A 5FZIA 3BPZA 1DLCA 3S0MA 2QDNA 2YG0A 1VBB2 5DPNA 2VMFA 3VD4A 1UMZA 5A33A 2OKXA 4AEKA 3UYJA 4QMAA 4EN0A 3ILFA 2XVLA 4AVBA 4EN7B 5FMCA 3LAGA 1I1EA 1AR91 2WLQA 4I09A 2OW4A 2R0FA 4GB32 4CDQC 4I0BA 3LDRA 2YZ4A 5DUUA 2PA7A 3OGVA 1JH5A 3LPGA 2R49A 4NHYA 4QX8A 4JGZB 4UW4A 1PK6C 1REDA 3POIA 1NLRA 3JZVA 5A7PA 2WIIB 2XOMA 3JUUA 3B93A 1V6MA 3JB8A 5KXBA 4FQ4A 2D98A 4GALA 1T6GC 3M3OA 5FZEA 4IEQA 5F37A 1GWKA 2WNUA 1S0CA 1YIFA 3PUIA 1PGL1 1B35B 1Y4WA 1V70A 3E5XA 4Q0PA 4OZOA 2ZX3A 1SPPB 4IV3A 4MGIE 3JD71 5FZOA 3VBOB 1OQ1A 1AL23 2XXZA 3AL6A 4Z82A 1W0NA 1RUC2 2W92A 2K9ZA 2YU1A 3AP6A 4KWKA 3T08A 2ZX1A 5FKCA 1CZTA 2QQIA 5BNNB 2IXHA 5CBLA 5JMCA 3DXUA 4MXWB 2WS93 2WNVC 4NWVA 1POV0 1EV12 1GZCA 1MS4A 1AX2A 2WNOA 3UKTA 2VQTA 2Q8EA 3G6JB 5JOYA 2E32A 5KXCA 1RVF3 3AX4A 2W91A 4HSLA 3LEGA 4LA3A 2W0XA 3JBG3 1CAXA 3VDCA 3VBFC 1DLLA 3CNAA 3ZSMA 5CAZA 1WA4A 4LBQA 3SH5A 3G7DA 5IFTA 4P9YA 4Z2AA 2B4KA 3MFAA 2AACA 3V0BB 3K2OA 4I01A 3ZSEA 1E5HA 1ND3A 2VQUA 4WM8A 2FBEA 5DZFA 5KXDA 3VDDC 1LOAA 3POGA 4CDXB 1FOD3 2PN5A 2VL4A 4I2OA 4M4RA 1NLQA 2CY6A 3O1OA 2X5IC 1UY3A 2ES3A 5C3QA 1AR72 4EN8B 1WUVA 3I2JA 3WX5A 4GZ9A 4CCDA 4BQ1A 3E6CC 3AXDA 3U07A 3VHOA 2ZMLA 1WBFA 2UWBA 2WO3A 5L9BA 3QH6A 3I2OA 2WZPP 1HN1A 2W39A 4N43C 5FZ3A 1W3VA 4QPGC 3U37A 4DMIA 1UPSA 2JIGA 3A23A 2Y8KA 3PU3A 4QU1A 1U0AA 3U11A 3LOIA 2WT2A 3WF0A 5FKBA 1XRUA 1GOHA 2JD4A 2F17A 2E6VA 1K5MB 3KV9A 1SCSA 4YVSB 3WUDA 3GZUC 5GZCA 1HN0A 5H9PA 3UJOA 1W8OA 4NMIA 1BHGA 2BUKA 2Y26A 5E88A 5FZ6A 1JN2P 4FPJA 4Y5Z0 1YQ5A 5DZGA 3CJIA 1NXD1 1YIPA 3FN9A 1ZRFA 4MH0E 1PM4A 3BALA 3FJSA 5J98B 2DFBA 3MLJA 4JGYB 3RI9A 2D6NA 3RMXA 1REEA 3V56A 1D2SA 4AVCA 3I7DA 1O4TA 4XDQA 1PIV2 1WW6A 1ZREA 4W6YA 3OUHA 4NHXA 1OA4A 4AFBA 1N3QA 1C5HA 3SCGA 3WOGA 3B7MA 3AZVA 3LOBA 3VBSA 4DXTA 4IUGA 2A3XA 4Q1PA 2CTVA 2O8QA 5JXIA 1BQPA 2Y64A 3RZKA 4COUA 2RDQA 1PO12 3DECA 5B4XA 4LQRA 3ZLIA 4OI1A 3AVSA 4DXSA 1OOPC 1KJRA 4WM7B 4XFCA 5A32A 1ZRCA 1H1MA 1Y43B 2JB4A 1ENRA 2WO1A 4HK8A 4IV3C 5I0RA 3NMBA 2RS52 5FJKA 5CZKA 3OY8B 3ZYGA 1RB8G 4UFMA 1PX4A 4S2HA 2HWD3 3ZN4A 5CADA 4YGDA 3THCA 3N7MA 2VZRA 1WLCA 3GZEA 1XSQA 3D82A 4JQRA 3THDA 3ZN5A 1LOGA 3Q8AA 4URAA 2AENA 1R1A3 1VE0A 3R4SA 4YW2A 3POSA 1W6MB 2D5HA 1QH7A 1VLNA 2IWGB 4X8NA 3VZMA 5BV6A 2QCSB 4HK9A 3LEIA 2W87A 1SMVA 4KG0A 4OVEA 2C24A 1GZWA 3F2ZA 4AI0A 2FZ1A 5FYBA 3I2FA 3HBKA 3N7KA 3SLIA 5E6HA 1RXGA 2AEZA 3O0VA 3FZ3A 1S55A 4DNYA 2GC0A 4RA0A 3Q8CA 4XTPA 4XQWA 4H55A 2IC1A 1H8VA 1KXGA 1RHI3 4FPEA 2QZ3A 1MS5A 2RG4A 1JZ7A 1AX1A 1XPWA 5C4WA 1LODA 4KL1A 2FD8A 2VNGA 4CSWA 3C7HA 3RRDA 1SBFA 4QB6A 3I2DA 5LW9A 4O65A 5JMOA 3WNOA 4QHBA 5FREA 1NKGA 2HYXA 4AYUA 2AZ5A 4A3XA 4XHBA 1IPJA 1WW4A 4META 2NZ9A 2EXKA 3NJZA 5C3PA 3ZYHA 2WNUB 3ZKYA 5FYCA 1F2NA 2Q8OA 3KF5A 1NXMA 2EIEA 2AEYA 5C8WA 2ID4A 2XLAA 2D44A 1PGL2 2VCBA 5DZEA 3RNSA 3PL0A 2QQKA 3JD72 3UK9A 4DEQA 3IT8A 1ZRRA 1H2NA 5GLTA 3VV1A 4Z2WA 2YHJA 4B1MA 4HFSA 3DYPA 4JQTA 1S2KA 2ZJCA 3C7GA 2VVFA 5BNOA 3LWCA 3VL8A 3O1MA 1MVQA 1W6OA 2VPVA 1FT9A 4N53C 2HWC3 2FMYA 1J83A 1EPWA 1LCLA 4IV1C 4NR1A 3RVHA 1TEIA 1SDDB 1F4AA 1C3HA 4DO0A 1VMFA 5FZ7A 1RUE3 1NUKA 4LKDA 2CU5A 1O3TA 3EYPA 4DB5A 1QHDA 3NNJA 3SKJE 3ZKUA 4Q4X3 1APNA 1DP0A 1ZA4A 4ONUA 2A7AA 4MGQA 4DUWA 4IEYA 1F5FA 4QX1A 3ME2A 2WABA 4S2GA 5E16A 4ASMB 1PGSA 4K1ZA 1QJX2 1I5PA 2JIJA 4EZHA 1YLLA 3PU8A 5T5PA 3MF9A 4A41A 1ENQA 4R4XA 5EPAA 1YFXA 3ZDSA 1SBEA 5KHJA 2A3WA 2C5DA 2C9KA 2XUEA 3E1F1 5T55A 1V6NA 3EXUA 1LOBA 2AREA 2DCTA 1C8NA 2AH2A 3PLQA 5FR3A 4UFHA 4NAMA 4P9JA 2XONA 5J96B 1UYYA 2VUAA 1RC6A 2WS91 4LJHA 4BYYA 1VBB3 1ZYBA 4P08A 1LAJA 4FPYA 4E27A 2BWAA 3BIEA 1YEWA 1DGLA 4P14A 3B94A 4CDWB 2W08A 1HRV3 1UN1A 4BK4A 1OF4A 1RVF1 1JHJA 2DDUA 2NPIA 5IAXA 4PLNA 3JBG1 1NA1B 3Q8FA 3JXSA 4UW3A 4X6RB 4YVWB 1HRI2 4GB33 1GR3A 2BU9A 1K5JA 1FI2A 1C4RA 3KV4A 1N1TA 3CJIB 5LEJA 1E5RA 2OUHA 1W2OA 2VD7A 3MIDA 3HNYM 3LZZA 1FOD1 3T0AA 4BXFA 1VRH2 2F4PA 4PT6A 3TNQA 3GXUA 1KJLA 2D93A 1UY2A 4LBLA 3U1XA 2HYKA 4AZZA 4CDUA 5A3PA 2QQJA 2W68A 2VVEA 2XR4A 4OLLA 2ZX2A 3VBSB 2VTFA 1N1VA 2WO2A 4M01A 5AVPA 3RPQA 3HR9A 1W2AX 4X6QB 4XF1A 2DVDA 4O9GA 3VBRA 2GMEA 4FTBA 1FPN2 2E7AA 4HKWA 4HZFA 1RUC3 5FP8A 1H1IA 4OI4A 3FBYA 1FMD2 1DG6A 3H8RA 1R092 5C6CA 3ZDVA 3DXTA 3C7EA 4HXCA 2QKDA 1DU3D 1EV13 2GC2A 1LU1A 5ABJA 2QE3A 3V64A 2EA7A 3ATGA 2DU1A 1PMIA 1JYTA 4COZA 1IQAA 4LIUA 3ZPYA 4I3GA 3W21A 3OGGA 3LEMA 4JHTA 1BZWA 1NCRA 3RI8A 4F3JA 1Q8VA 4L0PA 4Y22A 4S2DA 1I9RA 2JDAA 1NQJA 3M3CA 4PF5A 5EXOA 4MGYE 1OFSA 2WLPA 3OGJA 1LESA 3FMGA 4Y1VA 5BNOC 3AMPA 2B7YA 3GNEA 4LXLA 1TZOA 5DG1A 4YW4A 4JTNA 1G9BA 1U5XA 2GNBA 1YFUA 1JYIA 1MQTC 2CSGA 4QHZA 1FNYA 1GZWB 3VKNA 2WYSA 4Y5TA 3WNPA 3C7OA 4CEYC 1LOCA 1AR73 5F5IA 3JQXA 3H0OA 1XE7A 3LCPA 2VG9A 3MHZA 3N9LA 1BK1A 1T6BX 4BHPA 1AX0A 4UW6A 4NIGA 1X9PA 1AUYA 2FZ2A 4NWWA 1JU4A 5FP7A 4MO3M 4DOUA 1MS8A 3MW3A 2R1BA 4SLIA 5EV7A 2JENA 3JQWA 3OPTA 3ORJA 2LW8A 5CKQA 2JDKA 2ZGQA 3EO6A 2WRAA 2G9GA 3VGIA 3ZPOA 1CONA 1Q3EA 2HWD1 2TBVA 3IDEA 1GYKA 3OSDA 2DCYA 4XFGA 4WVVA 1QMJA 3T30A 4ATFA 5I0TA 4AG4A 1GU3A 5CG9A 2Q1FA 3BODA 1PM7A 2PHUA 4UBGA 5FZCA 4CTEA 2YBPA 2VQ0A 5JXGA 1VBA2 3MPPG 3ETPA 4F7ZA 4PBOA 1ONAA 4V1PA 1QU0A 3ZFEB 1W90A 3H3UA 3TBDA 3FL7A 2PXJA 3I3BA 3X29B 4A44A 1PIV3 4XIOA 4NRPA 3RWNA 1S0EA 1I3HA 4WZCA 4O9EA 5CB7A 1L7QA 4XFBA 4DXZA 2NMOA 2VMEA 2RE9A 3OBRA 4IE0A 1RUJ3 4QM8A 5GM0A 3D6EA 1ZBA2 1RHI1 2HBTA 3VD3A 4V2VA 1W9FA 5FOJB 2E9QA 2XJVA 1HJGA 1CAUA 1GZ9A 2Z69A 3ES4A 3WNLA 2X10A 1OQEA 4JAAA 1N3OA 5FZKA 3POWA 1DYKA 4H7LA 3L2YA 4HMZA 4BLIA 4EYUA 2LALA 1UCXA 4PBPA 2WFF2 2EAKA 2SBAA 1WA6X 4OQ9A 2E31A 5CISA 4XCBA 1UNBA 3HVDA 3ZIWA 2RS53 4AQSA 2NLRA 2JG9B 3M3EA 2G9FA 3LQCA 4ZU4A 4YM1A 1SLAA 3AP4A 1ZBE2 2CGNA 5L7OB 2Y6KA 5EQUA 4YWAA 1LHVA 4NE9A 1W6QA 3WG2A 4BE3A 3C3VA 1L7LA 1AJKA 3RSJA 3BVCA 2QQNA 1DCSA 4JRLA 1JZ5A 1WW5A 1W9TA 5JXHA 3ZIXA 2HWC1 3AZYA 1NCRC 2P34A 5I8TA 1YUDA 2DWRA 3HNMA 3WXPA 4CCCA 1H9WA 1ZZ8A 3IDAA 3OUIA 3ECQA 4XUOA 1RVF2 3O12A 2YPDA 5JSRA 4PDWC 5F3IA 4FOVA 5LBCA 1OH4A 1UOBA 4LLOA 1WCKA 2A6YA 5A6YA 5B2GB 1J59A 3VHNA 5EIYB 2ZBJA 3PMEA 1LHWA 5FY1A 2HLEA 2WL1A 1QKQA 2OZJA 4KBZA 3LIGA 4Q0VA 3W20A 3MV11 3IAQA 4FBFA 5F2SA 4XZUG 4AEMA 5C70A 3WR0A 4UYBA 1FOD2 4NJ4A 4Y1UA 4NRQA 1H6YA 4CDUB 3H3LA 1SDWA 2PLV2 2BERA 4PIYA 5FZDA 4L9BA 5C8CA 1DZQA 3PURA 4GH4C 5I0DA 5H9RA 2PAKA 5JZGA 2WKKA 3DL3A 1L7RA 2J1UA 1EY2A 4KGQA 5C5UA 2LROA 4R4ZA 2W2IA 3VBRB 1BXHA 1W99A 2ZCWA 1SLLA 4AHZA 4RS5A 4P9WA 1VBB1 2X8KA 4NIAA 2RDRA 2V72A 3NAPC 4LUMA 1AHSA 2W52A 4XVHA 1HRV1 3M3IA 4AF9A 3O5SA 3ABZA 2V5YA 1J3RA 1GUIA 4MGTA 3C8XA 4QU2A 2W47A 1GNHA 3KV6A 4RFT0 4E2QA 4CUCA 1OD5A 5CA6A 5JXJA 2UY8A 3RGBA 3A4UA 4GB31 1X8MA 4B1LA 4FT8A 2BGCA 2CV6A 1RIRA 3HWJA 2Y0OA 1RTVA 5EJ1B 4EE2A 2A73B 2X29A 5FY7A 3SC7X 4RQPB 4LLFA 4JCKA 3OBTA 4XC9A 4Q29A 1PMJX 1D2QA 4P5YA 4XUTA 5JIAA 1GOGA 5FZMA 3IB3A 2Q1ZB 4S2FA 1MZEA 4BQ2A 1GNZA 4QGLA 1QJX3 2VBBA 2UURA 3AP5A 4IERA 2GH8A 1D4M3 3GM8A 4R9AA 5A7OA 1IOAA 3ALQA 4QKNA 2ZOEB 4AQTA 4K3UA 2XWBB 1ZZ9A 1RUC1 2QQVA 4LKFA 1COV1 1LULA 4IGOA 5FY5A 2VXJA 3AVRA 4GKYA 3NRUA 5FXVA 5G04L 3ACIA 2PELA 1RYYA 1OA3A 1NCQA 3PNAA 4UOJA 5IVYA 5K0UC 1EV11 2VZVA 4LO7A 3VBUC 3HN3A 2XL7A 5F6KA 2KR2A 3UL2A 1PO21 4QXKA 4HONA 1LJ7A 2P6CA 2EXHA 3I4IA 4QPIA 1LNSA 3VBHB 3BOPA 3WCSA 1Z7S3 5KWRA 2XG3A 4CCKA 2HWD2 5EJZB 1X7NA 5DAWA 4LUKA 5CEHA 1HRI3 2QQMA 2BTVC 2VZOA 1RUI2 5FO7B 3WHUA 1W2TA 4WVWA 2EIDA 1L3JA 3PHMA 3PVBB 1BJQA 1CAVA 4GIQA 4CDQA 5GLZA 3I3DA 2DUOA 2V09A 4HVOA 1VRH3 2G19A 4CPBA 5D8AB 4JX0A 4OHYA 2QFEA 1AR71 1PK6A 1OPMA 4JZRA 3ZYPA 5JDBA 2NYYA 1VB4A 3KCCA 4BB3A 5DDJ2 3APBA 3PIJA 1UYZA 3WNXA 2PHRA 1DBNA 1UYXA 5FZLA 3KT4A 4MYEA 4IESA 4U36A 5FUPA 3FFQA 3WV6A 4LKSA 1KFUL 1FPN3 3CDZB 4KNCA 3H9AA 2ZHMA 1TE1B 3IIAA 5FYSA 1WCUA 1EP0A 1FMD3 4BK5A 1CD3G 3VZOA 1R093 2RR11 4J1WA 4NVPA 1SFPA 3GALA 3P3NA 4M3CA 5JZGC 1LU2A 1MVEA 3MV01 2EALA 2VM9A 1KITA 2O8OA 4IW3A 4AI9A 4AHYA 2LRPA 2YDEA 4IETA 3OEAA 3IDCB 1POQA 2DVAA 5IYYA 3I54A 1J1TA 1YRZA 1GP4A 1HB3A 2WNVA 2XWJB 4ZXKA 4NIIA 4QM9A 5LY1A 2GN3A 5FXWA 3INAA 2FDFA 5F5QA 2UU8A 3ZXFA 3BI3A 1PIV1 3KD4A 2VVDA 1KQRA 4LK6A 4XQDA 5EJ3A 3VBFA 1XXNA 3HPNA 1JUHA 5GALA 2VBPA 1RUJ1 4ZZ8A 1XOYA 2WUHA 2HWC2 2WO7A 2RJKA 3MICA 3IWZA 3K4ZA 4GA9A 4BQ3A 4EZ4A 2X5IA 1CR7A 1YQ2A 5CVRA 4AEDB 1MR5A 1UU5A 1M06G 3J7LA 1ST8A 4XFAA 2XUMA 1RJ8A 1KS5A 4FPFA 2VZUA 2CWSA 2OZ6A 1LHOA 3NSTA 3CKHA 5LA9A 3H8OA 4FP2A 5FLIA 4N43A 1ZVFA 3GCXA 2RS12 5F9TA 3R4UA 3MF6A 4QPGA 2ET1A 4IEPA 5CFDB 1UMIA 2XJPA 3ILNA 4YZ3A 1QEXA 2J1AA 1S0GA 4XZPA 3PJYA 1C1FA 3SQOA 4ASLA 4RD7A 5C8CB 1REFA 1Q8PA 3B9IA 2ET7A 4PF1A 1VBA3 3ACGA 4LO6B 2R7EB 3ZXJA 5K7PA 3FC0A 4JKMA 2Y0IA 3HD8B 1O8SA 1AYM2 1NZIA 4RS5B 4BPZA 1OT5A 4QPIC 5GJ6A 4EJRA 1QF3A 1WMEA 3IDBB 3BU0A 2WC2A 4PQ9A 5FLHA 1XJAA 2OPWA 2PQSA 1VAVA 1B35C 3DN7A 3CL1A 4ZONA 2DCKA 4AVAA 1HRV2 2BOJA 1MS1A 1EYBA 4K1YA 3RYKA 1YQCA 1ZBA3 4MUVA 3K3OA 1UXZA 2YMZA 3NO8A 4IEVA 5LASA 5CFCA 1GMMA 3SITA 4AR2A 1NAEA 2UY9A 2VQAA 2DVBA 3D0JA 1NE4A 3M4FA 4SBVA 2E33A 4D69A 4BDVB 4EV0A 5C3RA 1W2UA 2FDHA 2Q8DA 2WFF3 3B5LB 1GBGA 3B00A 1WD3A 1XNTA 4NAOA 3MBWA 4E4DX 4XUPA 2EF6A 1OD3A 3I2IA 1QOSA 4XF3A 3POYA 3UESA 2Z42A 2GC1A 4HT1T 4UFKA 2ZEWA 2BPA2 1OOPA 4XFFA 4AE2A 3VD5A 4RHV2 1RUG2 4GMP1 2YPJA 5FK7A 3U4XA 2E26A 2H0VA 4Y1XA 3ZO0B 1W8HA 2WSVA 1ZBE3 1UZVA 4IGPA 4KWJA 4Y3OA 2X53S 3ZM8A 3GHMA 2CDOA 2JDYA 3U75A 1QXPA 2BQPA 3MYXA 2XPJA 1N1YA 2VMHA 1H8TB 1UX6A 3VB9A 2N7GA 3J7NA 4AVTA 2A6VA 3I3MA 1COV2 1V0AA 1DGRA 4BISA 5GZGA 1KDMA 3TAYA 3FLTA 5SV5A 5L36A 1W9SA 4BIOA 4XEZA 1ASJ1 3DCQA 1U5IA 2QQOA 2QBXA 2VOKA 2GSYA 1PO22 3PUSA 4F83A 4N8MA 2DCZA 3GDBA 3LB9A 4YRDA 5FCCA 2Y6JA 2FMDA 4OYUA 3KS7A 4MZUA 4M0NA 3LFMA 3J7MA 4D6RA 1NZCA 2V5DA 4JV4A 4A7ZA 2B9UA 1RUF2 4KQ7A 1VAKA 1CAVB 1WCSA 4ES8A 1UIJA 4JVAA 4IE5A 1BVP1 1QJX1 4AHXA 3ON7A 4XYXA 4CCOA 1HX6A 4CDQB 3O1VA 3H7YA 1D4M1 3L2HA 2X05A 1PK6B 3ZSJA 4AXOA 4ARYA 2PLV3 3AL5A 5GZDA 1RJ7A 2EICA 2I45A 2KXLA 2VMCA 2Y6FA 2UYBA 3D3AA 5CU1A 4CUGA 5APAA 5I91A 5C5TA 3KSCA 5C3SA 4Z1VA 3QH7A 4I02A 1CAWB 2VCCA 4DPNA 1VP6A 2PHLA 2QNKA 3WF4A 4DY5A 2GP5A 4E4SA 3ACFA 3ZN6A 5DUXA 4XJUA 4YSFA 5HPOA 1FX5A 3ZFFB 3AZWA 4A6OA 1BMV2 1V6JA 2XJQA 4NROA 2XMLA 1UZWA 2CYFA 4I0WB 3LGRA 2VUDA 5A3UA 3N9QA 3GZTB 4ZXEA 2ZAAA 4CP0A 2D6LX 1ND2C 2VE1A 2RR12 5D1IA 1Z7S1 2I2SA 4D6SA 1SACA 4PQQA 3I59A 1LB2A 3E6DA 5LBBA 1HRI1 1CX1A 5GLUA 3CJXA 1RUNA 1DDLA 4QHOA 3EMRA 3NNGA 1LECA 4N53A 1M4WA 3IM0A 4IV1A 5TSWA 4HVRA 4AI8A 5DXDA 2VC9A 1QNYA 2DFCA 2WT0A 5ACA2 2LS6A 4PI2A 2J1RA 2XJTA 5HCAA 4COVA 1VRH1 3I2HA 5KHIA 1URXA 1GKBA 2JG8C 3H8UA 4HETA 4DZGA 2C26A 1UZYA 3VBFB 5IUQA 4ISQA 5CFCC 2RHPA 4ISRA 2GAUA 4NN0A 1RUJ2 1CIWA 1CX4A 3AYAA 3VN4A 3VDDB 3M7AA 3OYWB 2R042 1FPN1 4QX3A 3SHRA 1UX7A 1DFQA 2BWCA 4BM8A 1X36A 2X5IB 1FMD1 1ZZ6A 3KCYA 5FMDA 5LATA 4L8QA 4FPCA 2CWMA 1R091 2R0HA 3E97A 3W5NA 1LHUA 3H7JA 1EAH1 1X8EA 3POBA 5FBZA 2FDJA 2ZGKA 4Q4V2 2A71A 2LUWA 3FWEA 5F8PA 2VY0A 4J1XA 4XETA 4CU8A 4N43B 4QPWA 3RJ2X 3KHBA 4R52A 3GHNA 5A6ZA 1X50A 1ULPA 4XHXA 4DIQA 3WEZA 4LBKA 5FRAA 5C71A 1A6CA 4CRQA 2ATFA 1RUI3 5F3GA 5LK5A 1ZZCA 2BW8A 3DV8A 2NN8A 5JPNB 4BMBA 5JLVA 1TMF3 3VDAA 5L9RA 3JU9A 2VUJA 1DYOA 1W04A 3WNMA 1DQ0A 2OX0A 1UYPA 2R072 2JE7A 4N7IA 4GWJA 3AKPA 4BWOA 1UKGA 1PMHX 2Q0AA 3NW4A 1VPHA 3WP5A 5A33B 5IVCA 1EUTA 2VCMA 1BEV2 1VMHA 5DDJ3 4YM2A 3R0RA 4MLOA 2TEPA 2NP0A 1G9DA 4QAWA 2GC3A 1W05A 4N7UA 4YZ1A 3CIHA 3MUY1 4GJYA 2DUQA 2R062 3AB0A 3QBQA 4LBQD 3VHPA 4MG2A 1WW7A 2WWUA 4QX2A 3WG1A 5JSPA 1C5IA 4L99A 3PVNA 5FPXA 1H2MA 4QQOA 2PYTA 3NKGA 1G6NA 4JKKA 4M3CE 4EQVA 2IVIB 2ZHLA 1MZ5A 1ZZ7A 3KV5A 3LDBA 3SMHA 4BZ4A 4L97A 1E57A 4AAXA 1VBA1 2BNOA 5BNPC 4RN5A 4IV3B 3MIBA 4XURA 2JDNA 5FZOB 4E8CA 2D3RA 3PTRB 3WW4A 4AWDA 5F6LB 1O59A 5FZ9A 2B9VA 4QKBA 5AC93 4BH9A 5BPXA 3RZGA 1STMA 1ZBA1 3MW4A 1ASJ2 3GBWA 2UYAA 4J25A 2ZGRA 1MQTA 5F3CA 2HBUA 3OPWA 3IMMA 3RMYA 4CEYA 4QKFA 1OFNA 2P3IA 4CE8A 1K42A 5H9QA 1CAXB 2HWF3 3OGSA 4WZFA 2PAEA 2WFF1 4HL0A 2J1SA 4LBQB 1WMFA 4CDWC 2P3YA 4JKLA 1WZXA 2ZS6B 4OULA 3T09A 3KVAA 1ND3B 1OXCA 4WM8B 5FQ0A 5EHDA 1NA1C 1DQ6A 2RS13 2ZABA 5FYHA 3MFCA 4YVWC 3EQEA 5C3OA 1D4M2 1ZBE1 1KFXL 2QZ2A 5IVVA 2ZZJA 3U78A 3J9SA 5FWJA 5CG8A 1IKQA 1SBDA 1ULFA 2E7TA 4BU2A 2Z5WA 4YW5A 4TSVA 5IW0A 1OURA 2HKXA 1OI6A 3PJQA 4AGRA 1S4CA 2CGPA 3PUHA 1AYM3 5FO8B 2C9AA 3RFRA 1UIKA 4WVZA 3DPRC 4B4RA 3HJRA 3K46A 3KHCA 2JKBA 2HEVF 2IZWA 4A2UA 4DS0A 4UF0A 1OQDA 1WGPA 1KRIA 4PIZA
chains in the Genus database with same CATH topology
4YYOA 1Z7S2 2K2SA 1PZ9A 2O0OA 1WLDA 3ROUA 3CO2A 4N53B 1J58A 1DGWA 4FSJA 5KHKA 2XJUA 1FV2A 1CQ9A 4FOWA 1V00A 2WT1A 1VB2A 5FMOL 1NY72 3A0NA 2PLV1 3MLKA 3WG3A 3B01A 4MSVA 4YW3A 4YGEA 4RHV3 1RUG3 5GZEA 2QQPA 2ZHKA 1HV0A 2PFWA 3O0WA 1YYNA 1VBC1 2MEV1 1IHMA 1VALA 1Y3TA 1COV3 2D40A 4YG6A 4LE4A 4I0AA 1V6KA 3ZXGA 1EAH2 4M0HA 5A32B 4FOQA 3ES1A 5HXVA 1W6PA 4A7YA 1PO23 1FXZA 1EPZA 5KC6A 3P3PA 3D4KA 1N3PA 3KQRA 3NV3A 4IL7A 1NE6A 5JSOA 5IK4A 2JXAA 1RUF3 3S7EA 1YJKA 5EYYA 3IMNA 1AYN3 4PDWA 1LENA 3IPVA 2YUEA 5AFEA 1Z0HA 4FXGB 4GULA 3S6PA 2EAAA 3KB5A 1AR62 5T54A 2D5FA 3KGZA 1JYCA 1OA2A 2HEWF 2ZMKA 4QQHA 5J09A 1GLHA 5GZFA 5JIUA 4K9SA 1UD1A 1QGLA 1ULEA 2YGLA 5C4WB 4GH4A 1RUD2 1S2BA 1LTEA 3V65A 3R05A 4XF9A 3AP9A 2XLGA 3AKQA 1LKNA 2F6BA 4EWAA 2RR13 3SNMA 2ILMA 3AYCA 3NAPA 1H2KA 4OUMA 1ZM1A 4OHXA 1RUI1 4U2AA 3WOGA 2OVUA 2QDRA 2IXLA 2ZAHA 3ACLA 3LOBA 2ZGPA 1TMF1 1XU1A 5ACA3 1QJU2 1AJOA 4GWNA 1HQLA 3THPA 2HWE3 3OTFA 4YZ2A 1DZTA 2JG9C 1YI9A 3FX3A 5DG2A 2ZPXA 1PGW2 2ZKNA 5DDJ1 4HVQA 5BNOB 1W6OB 1SLTA 2XJSA 3JCIA 4XFIA 2ARXA 4XBLA 1AR83 2R043 1WLWA 2ZA9A 1MQTB 4GQ7A 4RR3A 1LOFC 5JCTA 2NMNA 3DUIA 2CAUA 1BBT2 4WVMA 4OHZA 2RS31 3WHTA 4Q4V3 4KU7A 4XMIA 4JC1A 2EVXA 3CF6E 4NHLA 2C0ZA 5HCBA 2R6QA 1JHNA 4Y4YA 2E63A 2ARBA 5K0UA 5I0UA 3VBUA 3E5QA 1A78A 1Q8SA 2ZX4A 4OUSA 1QNWA 1RGSA 4D94A 3DGTA 1XYOA 1NLSA 2VULA 4LO5B 1S0FA 3B02A 4KWLA 1XYNA 3USUA 2NM1A 5AC91 1XNCA 2XLFA 2D97A 2R073 1MZ6A 1QH6A 3GF6A 3SXWA 4CZSA 3BB6A 4Y24A 1OHFA 2WQ4A 3I8TA 1BEV3 5T5JA 3VLBB 2E53A 4MV2A 2QJVA 4QGMA 2WZR2 1UU6A 2XBO3 4XILA 4XF0A 4KH9A 2HWF1 3AJZA 1TME1 1S0IA 2IXKA 3LSEA 3NV1A 1CPNA 3HAGA 4AI1A 2R063 3KM5A 4YNIA 4XXPA 3AMNA 2RS11 1W6NA 3ZFGC 2IFRA 1QDCA 2R30A 3AJYA 3VZKA 4K21A 4FOYA 4IEOA 4YLZA 2CL2A 3ZXLA 4GMP3 4JRAA 1N47A 1QOTA 3M8LA 4CEWA 4Q8LA 1AYM1 3FLPA 4Q0SA 4YG3A 1VBC2 2MEV2 1CVNA 2RM21 1RL3A 3W58A 1YFYA 4LHNA 3VKFC 3ZMOA 1J3PA 4FO9A 2ZGTA 5ABJB 4MX3A 1ASJ3 1C57A 4DQAA 1ENXA 5KXEA 3TNPB 4Q4Y3 5T3NA 5CIRA 2PTMA 3ETQA 1NCRB 1F8VA 4Y22B 2XHKA 3J4UH 3FUOA 4PIXA 1LR5A 1H2LA 2BVVA 2AYHA 1U5YA 4XQ4A 3AMQA 3WW2A 4PDWB 2GN7A 2AR6A 3KGLA 1KD7A 2P3KA 4RHV1 1RUG1 3AKTA 4C91A 5HI0A 4K7JA 3B69A 4RR3C 2XJRA 2UWAA 1O7FA 3WUCA 4B4PA 2H6CA 5F1RA 5KC5A 3PTYA 1BCXA 4LBMA 5IK8A 4G9SB 5A3LA 5IT6A 1YI7A 5D8AC 4COYA 4JGZA 4XBNA 2JE9A 4LA2A 2GU9A 2A70A 4EWDA 5FO9B 1GV9A 3FFZA 3UJQA 1QY4A 4XJ9A 2RJLA 2YV8A 4Y26A 5FFOC 5C9AC 4HN1A 4KU8A 5JOWA 3OD0A 3QOPA 1S1AA 5BYNA 1B35A 4OHVA 1RUF1 1XQNA 3OCPA 4D7SA 1AYN1 1ULCA 2D3SA 1TMF2 1Q43A 3MEPA 3NV4A 1GQGA 4Q1RA 3ZN5A 1IS4A 1DIWA 4WBBA 2P3JA 4GMP0 4MXWA 1XU2A 5FLJA 2WWSA 5JOXA 2C1FA 3NL1A 2XKOA 1MEC3 1BKZA 3D5OA 5EYXA 1YXWA 4C1WA 1OMIA 1AZDA 3FE5A 1IS5A 3Q9OA 3PVEA 1N1SA 1WD4A 3V0AA 5J37A 4AI2A 1BMV1 3EJKA 1CAUB 3V0BA 1A8MA 2PHDA 1EAH3 3LA2A 1I5ZA 4N9IA 5KHGA 2RS32 4Q26A 3A0KA 4FXKB 4R9CA 4BLJA 4CEWC 5K0UB 3KLSA 1O91A 3VBUB 4AEDC 1R082 1GICA 5FOBB 5JPMB 5ACA1 2VNRA 1FV3A 1QXJA 1UL9A 4IQPA 4EWEA 1G9CA 3WDUA 1W6QB 1SEFA 2HWE1 3WT3A 5T5OA 2OIIA 2VNOA 1G8WA 4XJ8A 3SCFA 1TNRA 3URFA 3ZXAC 2OA2A 2OYZA 5AC92 2DTWA 3WQ7A 3B9CA 1AR81 3MLLA 4QQPA 2R041 1AR63 1K5MA 4YVSA 4HSJA 1ALYA 1LHNA 5JI9A 2BVBA 2VGDA 4MGZE 2CGOA 2VW0A 4FCAA 4Q0UA 4AFCA 1RUH2 5SV8A 2HWF2 1RUD3 1TME2 1LEDA 3TB0A 4Q4V1 4ZU5A 4FVVA 4JGYA 5FMOS 4DRRA 2LM3A 3DF0A 4HPKA 3S7IA 5T5LA 2VOWA 5KHHA 4AEJA 3N35A 3VZJA 5FAXA 2VMIA 1ND2A 3AXEA 4JGZC 5JZGB 4XIKA 1POV3 5L73A 1QJU3 1AF9A 3QCWA 3AMHA 1OSGA 2R071 3AKRA 1MS9A 5BY5A 5JOZA 2RM22 1Q56A 1BEV1 1J1LA 4G4FA 2JG8A 5JVVA 2XBO1 3THTA 2B39A 3OY8A 3VBOC 1G7YA 2KM2A 2R061 1DQ2A 3PMSA 5BNNC 1PNGA 2B45X 4IXLA 3TN92 4RGAA 1BBT3 1C28A 1W6MA 4AI3A 2TNFA 4XFHA 3R4DB 1UAIA 1OLQA 4FTSA 2ZGNA 5LRRA 3J8F3 4GKXA 2D6MA 2P37A 3MGUA 1W0PA 3RJRA 4LBJA 4WV8A 2VOVA 3BIWE 2VMGA 2BFUL 1RINA 3VZNA 3MIFA 4BCUA 1HW5A 1PHMA 2ZACA 4CDXC 3ZVXA 2QUOA 1V6OA 1NCQB 4FQZA 4E2GA 2ERFA 4R9BA 2UWCA 4XW3A 4XE9A 1HIXA 1JUIA 2R1DA 3KZ4C 1SLIA 1VR3A 1JOJA 3OPZA 4Q4Y1 4QPIB 3ZYIB 2WZR3 4E4ZA 3ZFFC 4TLFA 1GFF2 4AQ6A 2DU0A 1FATA 4QD2A 5K9YA 2BNNA 4QQLA 4LEJA 1KS4A 4IEUA 1AYN2 2DVGA 1HLCA 2GNTA 3CU7A 3H50A 1K5MC 4YVSC 3RG0A 2DVFA 3HT1A 2XH6A 5BUVA 2VOXA 1V6LA 3DKWA 1AXZA 3GBFA 1O4ZA 3JB4C 4LNVA 3V0AB 2BNMA 4JGYC 5JI7A 1F5JA 1HXS3 4KBBA 5LEKA 1VBD2 2XGXA 1VBC3 2A6XA 4BOWA 2MEV3 5GKAC 1XNKA 5BNPA 3D8CA 4HKOA 1Y9QA 2OPKA 3WDYA 5GLWA 2JEMA 4UW5A 5L19A 2ZGLA 4P5HA 4M3CB 4QX5A 3AZXA 4MGKE 5HCFA 5BNQA 2B5HA 4EROA 2D7FA 2P17A 1X33A 2ZGOA 4K6BA 5JR7B 3WDWA 2WNVB 4C1XA 1A8DA 2AGSA 1FNZA 4WM7C 3TYJA 1GSLA 1NY71 1H0BA 5E89A 4D7TA 1DHKB 4OI2A 2DTYA 2HWE2 1MEC1 4R9DA 3WQ1A 4CDWA 1UPIA 3L9JT 4L92A 2RMU1 5I93A 4RGGA 4W6XA 2R16A 1AR82 4Q4W1 5H9SA 1NA1A 1QJY1 2BEOA 4YVWA 2NQYA 1YCIA 2PHXA 3W59A 4YARA 3RYPA 3IKWA 1RITA 2KA3A 2IFWA 5I8YA 2Z79A 3KT1A 3ZSLA 1ULDA 1W0OA 4J6GA 4RL7A 1HKDA 3H1WA 3O14A 4HPKB 3AP7A 3LA7A 1IPKA 5FDBA 1PVC1 1V6IA 4QPGB 3DPRA 1YWKA 3W9AA 5J7MA 1F9KA 2GH2A 4YZ5A 1ND2B 3VL9A 4MXVA 5EWSA 4LHLA 4TYSA 4NO4A 2YYOA 3SISA 2R32A 2Y38A 3OJBA 4YM0A 4YM3A 4FTEA 1B09A 3O0XA 1RMU3 1MS0A 2VU9A 2WNUC 3HMYA 1AR61 1V9U2 2JG8B 2Z2SB 1RUOA 2VXRA 3VKLA 1C8M3 2XBO2 1IS6A 4ITCA 2XKPA 3WQ0A 3AKSA 1RUD1 5CFCB 2YGMA 2DF7A 2VW2A 4LT5A 1W39A 4LR4A 1LRHA 2YROA 2I07B 4INDA 3WVJA 1DYPA 2CAVA 2GNMA 5GLVA 3MIHA 2V73A 2RS33 2HWB3 2DUPA 2WQZC 1OOPB 5IK7A 1NG0A 4LHKA 2PHTA 1R083 1POV1 4XJWA 1QJU1 2YC0A 3M1HA 3IBMA 2A5ZA 3ZSKA 1VBE1 1ND3C 4WM8C 1AR92 3FHIB 4XTMA 1PGW1 2ZX0A 4Q0QA 1LGBA 4JDNA 5DUWA 3VZLA 4Y1ZA 3D0SA 4AHWA 1WMDA 1H9PA 2H0BA 4QGNA 3VUOA 1ZNPA 4Q4Y2 2VECA 4ZKTB 3ZYRA 1VIWB 4NHMA 3N36A 1QQP3 1RUH3 1BBT1 1TME3 1R1ZA 5J36A 1FAYA 3ZFEA 4EN9B 2GDFA 3AZZA 4R8HA 4XF4A 3J8F1 2LTNA 1IGOA 3AFKA 4LULA 5FPZA 4F8AA 3FLRA 4B3NA 4DY3A 4MVTA 3AFGA 3EHKA 4BIFA 3R6SA 3CJIC 1F31A 2DV9A 1TQ5A 2EXIA 4OHWA 4URTA 3ZN6B 1Q8QA 4H3WA 2PQQA 1G86A 2A75A 5BNPB 1O3RA 2RM23 4Y20A 3H3ZA 4LBOA 3VBSC 1JXNA 4PJYA 4AGVA 2WZR1 3PVOA 1G9AA 1A3KA 1WLTA 1PZ8A 2JG9A 4B29A 1WCDJ 3I59B 4PCRA 4LO8A 2ZGMA 3GYDA 4AVVA 3TRSB 3C2UA 1AL21 1AXKA 2D6OX 4YG0A 5L7OA 3B3QE 3LSDA 4IV1B 1LGNA 1VJ2A 2P2KA 4ZU7A 3TN93 3AM2A 4AFMA 4FPLA 1LOFA 2JICA 2ZGUA 2XB6C 3HIFA 2SLIA 1QJZA 4XJAA 1SFYA 1MS3A 4XBQA 1MEC2 2D6KA 3S30A 2RMU2 4IEZA 1TNFA 2FQPA 1HXS1 4XOGA 1SQ4A 1UU4A 1CESA 3HT2A 4P9GA 4Q4W2 2WNEA 4AQ2A 1QJY2 1YHFA 2VW1A 4K20A 3H1MA 1PVXA 4TWTA 2TUNA 2E51A 3WDXA 4FPGA 2OUJA 4E9KA 4N9HA 1LOEA 3DPRB 3MIEA 4FPOB 4AK3A 1PVC2 5C4WC 2BBVA 3WY6A 5E8AA 3MI8A 1JTZX 3FBMA 1IZ3A 3HBZA 4M00A 4AFDA 1CGPA 1D0GA 1IKPA 2IXJA 2DURA 1JBCA 3NWKA 2WSUA 4OI0A 1U12A 4HBNA 1BVVA 1ENSA 3TWIA 3GZAA 1AVBA 3ZFGA 2B42B 5JWPA 1FYUA 2JJ6A 3ZFEC 4C0HA 2IXCA 3BTAA 1Q5OA 4P9LA 5K8SA 1VBD3 2ENRA 3MIGA 4RQPA 3H1YA 1NQDA 4COWA 1NOVA 3AMMA 4FP3A 1WBLA 1QWRA 4H7MA 4DRVA 2B46X 2WJSA 5IK5A 3K48A 2DYCA 2PHFA 1O4YA 4GWMA 3VHRA 2DCJA 1HQWA 4JDMA 1G9FA 4LE3A 3RZZA 3WD5A 1D4VB 1OPOA 4CP1A 5I0SA 1Z78A 1XE8A 2ZGSA 2BFUS 2A6WA 5T50A 1SLBA 1H1AA 4DFSA 1HQNA 5EZWA 4FPKA 1RMU1 4FPHA 2D3PA 4N90A 4QT6A 1J3QA 3WINE 1BYHA 1VBE2 3OD4A 5AFBA 3LKJA 5FTTC 1DGWX 1SFNA 5C33A 1C8M1 3EBRA 3QD6A 4K8FA 3RDIA 4XJZA 4I3PA 3VBHA 5L7OC 5CNAA 3ZXKA 1GANA 1U5ZA 4AVSA 3NVCA 1ZZBA 2ZMNA 3ST7A 1LGCA 4CEYB 1R1A1 2VH9A 1AL0G 2A3YA 3J26N 1I6XA 1GQHA 1S0JA 2MPFA 2WA4A 3K51A 4OZXA 2HWB1 4KGGA 5D8AA 5FQ0B 2GNDA 3BOWA 3CLPA 1R081 1YO8A 3J8F2 1YJLA 2JECA 4YGBA 3ILRA 4G3YC 1S0DA 1OLRA 2MHFA 2Q1MA 2ZTNA 3ZYJB 1UZZA 4NPRA 2O1QA 5C9AA 4JDOA 4YGCA 3WDTA 4E2SA 1PO13 2EIGA 3T2TA 1XYPA 4CDUC 1Y7BA 1D0HA 4Y20B 2GZWA 4NHKA 5EFUA 1O3SA 1V9U3 1C1LA 4HANA 3RYRA 1H4HA 3VBRC 2D6PA 2K0GA 1QQP1 1OKQA 1RUH1 3AYEA 4QQ2A 4Z8BA 3LA3A 3NKTA 1AL22 3WW3A 2XVKA 3AYDA 5ABJC 1LEMA 4ES9A 3OF1A 3MDPA 2ZKLA 4L2NA 1NYWA 2XVGA 3FUQA 4IEWA 2WINB 4HLTA 2WS92 1MACA 3SH3A 1RUE1 5JAXA 1H30A 3N4MA 4RQPC 3UKVA 2XL9A 2BYVE 1ULGA 2Q4SA 4Q4X1 1HXS2 3JBG2 4AEDA 3O7OA 1AR93 1PZ7A 5I8SA 2PHWA 4P9IA 1YFWA 1YNAA 4IEXA 2GMMA 4HKLA 5CFDA 4FAGA 1W6PB 4C90A 5LRSA 4TZDA 4HN0A 1UKRA 2ETEA 4D3WA 4YW1A 3TN91 4XMAA 3IN9A 3WG4A 3U0ZA 3JD73 4GXLA 3VBHC 1ZX5A 1KDKA 3IPVB 3QLQA 3UV9A 1QDOA 2AUYA 3SCHA 2H6BA 3HN1A 3BU7A 5A3MA 4BMEA 3WCRA 3ZFGB 1JW6A 3ASIA 1X82A 3HQXA 4GH4B 4AW7A 4H14A 4B4QA 3U10A 4Q2FA 3BCWA 1DQ1A 1O5UA 1XNDA 5KBFA 3NAPB 1HV1A 1QXRA 3WP6A 2A6ZA 2HJIA 1VAMA 3MZHA 5AVAA 3VKMA 1CJPA 4L11A 2PAMA 3VBOA 1H8TA 4K40A 2HEYF 4PLMA 2CNAA 2E7QA 1RMU2 5BNNA 3N7LA 3ZX7A 4JTOA 1S0BA 1ZRDA 4AGGA 3N3HA 5BXXA 4ATEA 1CPMA 4UXAA 4CP2A 2RMU3 2Q30A 1AXYA 4YFWA 4A7KA 1C8M2 2GALA 3ZMNA 1VBD1 4YZ4A 3KMHA 4Q4W3 4RR3B 1QJY3 2YXSA 3NV2A 3WDVA 1R1A2 1DGRN 1UW8A 4QPYA 1CJDA 3M3QA 4WVMB 3TOJA 1DQ4A 3AK0A 3ZXDA 1UF2C 3MW2A 4ORFA 4X8PA 4CDXA 4EN6B 4Z92B 5J3UA 2HWB2 2I74A 3GBGA 2JX9A 2EXJA 4PLOA 4B8EA 3CEWA 1PVC3 4LBNA 5HBAA 3SH4A 1CAWA 4D7YA 5C9AB 1RHI2 2FHRA 4Q27A 3ZFFA 4AFAA 4P9XA 2JDZA 1DQ5A 4I30A 4RSUA 3M2MA 4B7EA 5CFDC 1QOOA 1MZFA 3E6BA 3KT7A 4KG8A 3USUB 1DF0A 3T1MA 2GMPA 2Q5TA 5C8CC 3M70A 1XNBA 5T52A 4XPVA 4LTAA 3ZXEA 3USSA 4RS5C 4XXAA 2ZZQA 3T1LA 1CN1A 2IXIA 4UBHA 1QQP2 2D43A 2B8MA 4B7KA 4Y1YA 4W65A 3WP4A 4BA6A 4DINB 3WLUA 1H4GA 1W6NB 4CYDA 4LO4B 5E1RA 1DZRA 3RS6A 3MPBA 1IS3A 1SCRA 4C0BA 1Q8OA 3VDDA 3OYWA 2MNGA 4OFGA 3E5UA 1O5LA 1RUE2 5LK7B 1PO11 4CEWB 2QVSB 3ENRA 3N7JA 1O3QA 4Q4X2 1SLCA 5DUVA 1VBE3 2ZHNA 4WM7A 3WW1A 3WZ1A 1PNFA 1HDKA 3VKOA 1V9U1 4NOTA 3QACA 4Z07A 2RS51 3KCXA 4YFZA 3RQ0A 4M3CF 5J48A 1H8TC 4W6WA 4FAHA 3ELNA 2G4IA 2YY1A 1NCQC 2WA3A 4Q8KA 2WFPA 3BPZA 3S0MA 2QDNA 1VBB2 1UMZA 5A33A 4AEKA 4QMAA 4EN0A 3ILFA 2XVLA 4AVBA 4EN7B 3LAGA 1I1EA 1AR91 2WLQA 4I09A 2OW4A 2R0FA 4GB32 4CDQC 4I0BA 2YZ4A 5DUUA 2PA7A 1JH5A 2R49A 4JGZB 4UW4A 1PK6C 1REDA 1NLRA 3JZVA 2WIIB 3JUUA 3B93A 1V6MA 3JB8A 5KXBA 4FQ4A 2D98A 4GALA 1T6GC 3M3OA 4IEQA 2WNUA 1S0CA 1YIFA 1PGL1 1B35B 1V70A 3E5XA 4Q0PA 2ZX3A 4IV3A 4MGIE 3JD71 3VBOB 1OQ1A 1AL23 4Z82A 1RUC2 2K9ZA 3AP6A 4KWKA 2ZX1A 5BNNB 5CBLA 2IXHA 5JMCA 4MXWB 2WS93 2WNVC 4NWVA 1POV0 1EV12 1GZCA 1MS4A 1AX2A 3UKTA 3G6JB 5JOYA 5KXCA 1RVF3 3AX4A 4HSLA 4LA3A 2W0XA 3JBG3 1CAXA 5CAZA 3VBFC 1DLLA 3CNAA 3ZSMA 1WA4A 4LBQA 3SH5A 3G7DA 4P9YA 3MFAA 3V0BB 4I01A 3ZSEA 1ND3A 4WM8A 5DZFA 2FBEA 5KXDA 3VDDC 1LOAA 4CDXB 1FOD3 2PN5A 4I2OA 2CY6A 2X5IC 2ES3A 1AR72 4EN8B 1WUVA 3WX5A 4BQ1A 3E6CC 3AXDA 3U07A 3VHOA 2ZMLA 1WBFA 2UWBA 3QH6A 2WZPP 2W39A 4N43C 4QPGC 4DMIA 1UPSA 1U0AA 3U11A 3LOIA 2WT2A 1XRUA 2JD4A 2E6VA 1K5MB 4YVSB 1SCSA 3WUDA 3GZUC 5GZCA 5H9PA 3UJOA