2RS31

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3100
2RMU2 2BBVA 4CDUC 1H8TC 1MEC2 5LK7B 1BMV2 4IV3C 1R092 1C8M1 5C8CC 1TMF1 1RUD2 1FPN3 4WM7A 3ZXAC 4NWWA 3VBSC 1TMF3 4IV3A 1RUC3 3JD73 5BNOC 1FOD2 2R071 2ZZQA 2HWC1 2BPA2 1VRH1 4Q4X2 1FMD1 1NA1A 4CDUB 1H8TB 3TN93 3JB8A 2HWC3 4IV3B 1AYM1 5C8CB 1AR71 5A32A 1GFF2 2HWB1 3VBSB 4Q4W3 1EAH1 5BNOB 1RUJ1 3JBG1 1HRV2 1RUG3 1PGL1 3JBG3 1QQP2 2Y26A 1PO21 1ZBE2 1RUE2 1ASJ2 4CEWC 2RMU1 2PLV1 1HRI3 1OHFA 1K5MC 4RHV3 1QJY3 1ZBA2 1RUI2 4AEDC 2PLV3 4Q4V3 2TBVA 3CJIC 4CEWA 5C4WC 1VAKA 1EV13 5CFCC 2BFUL 1VBC2 2R062 1PGW2 3VDDC 5FOJB 2HWD2 4CEWB 1COV3 1F2NA 3CJIA 5K0UA 1RUF1 5C4WA 1K5MB 4N43C 5GKAC 1POV3 4AEDB 3VDDA 2ZAHA 3CJIB 5A33A 5C4WB 4RS5C 1AR83 4CDWC 4N53C 4N43A 5CFCB 3VDDB 1C8M2 1TMF2 2RS31 1RUC2 1HRV1 3JD72 4JGYA 1PVC3 4RS5A 4N43B 4RR3C 2RS33 4CDWA 3TN92 4N53A 2HWC2 1ZBE1 2RR13 4PDWA 1FMD2 1ASJ1 3VBHC 4RS5B 4CDWB 5AC93 4N53B 4RR3A 2WZR3 1ZBA1 1RUI1 2WFF3 5DDJ3 4Q4W2 1AR72 3VBHA 1Z7S1 1AR93 4RR3B 3JBG2 1VB4A 1RMU1 1VBC1 2R061 2HWD1 4JGZA 1HXS3 1E57A 5BNNA 1QJU1 3VBHB 1HRI2 1QJU3 4RHV2 1QJY2 2WLPA 2PLV2 1B35A 4Q4V2 4WM7C 1CJDA 4GMP0 1FPN1 1EV12 1BEV3 1NA1C 1RUC1 3JD71 1POV0 5C9AA 1COV2 1IHMA 2DF7A 2HWF3 3TN91 1RUF2 4WM7B 1VBA1 1AR82 1VBA3 1RUH1 1F8VA 1NA1B 4Q4W1 5FMOS 3VBUA 1RHI3 1RUH3 1R1A3 1RUG1 1PVC2 2RS32 1AL0G 1AL23 2XPJA 5A32B 1CD3G 3LOBA 1HRI1 4RHV1 1QJY1 2RM23 5AC92 2WZR2 1D4M3 1VBD3 4Q4V1 5D8AA 5JZGC 2WFF2 3FBMA 5BNPC 5CFDA 4RQPB 1AYN3 1EV11 1MQTC 4QPIA 5K0UC 3ZFEA 4GMP1 1PIV3 1Z7S2 5ACA3 5JZGA 1HXS2 1COV1 1TME3 3NAPC 4FSJA 5BNPA 1AR63 1C8NA 1RMU2 4GMP3 5J98B 1PO11 1MQTA 4NWVA 1QJU2 1W39A 1POV1 5JZGB 1RVF1 1PO13 4CDQA 5BNPB 3NAPA 4FTSA 1RVF3 1AR81 1MQTB 5K0UB 1BEV2 4JGYC 1HX6A 1VBE3 1FPN2 1BBT3 2WS93 3NAPB 1R093 4PDWC 1PVC1 1RUD3 3J8F1 2RS13 2HWF2 5A33B 2RR11 1ND2C 3J8F3 1NCRC 5AC91 2WZR1 4JGYB 1VBA2 1R083 2WFF1 1ND2A 5DDJ1 5ABJA 3VBOA 2HWE3 1NCRA 1RUH2 4PDWB 1AR91 2RS53 4JGZC 5BNNC 2ZTNA 4Y4YA 4CDXA 1ND2B 1AL22 1HXS1 1RUG2 1NCRB 1B35C 2GSYA 4FTEA 1D4M2 4QPGC 5L7OC 5FMOL 1NCQA 4JGZB 5BNNB 4GB33 1AYN2 1BEV1 5C9AC 1HQNA 1AUYA 2VQ0A 4Q4Y3 1PIV2 5ACA2 1VBB3 4QPGA 1V9U1 5L7OA 1B35B 1NG0A 2HWF1 1V9U3 2R041 2BUKA 4QPGB 1PO12 5L7OB 3DPRA 2X5IA 1SMVA 2R043 1RVF2 3VBUC 4CEYC 5C9AB 2XBO3 1VBE2 1BBT2 1RHI1 3DPRB 2WS92 2X5IB 1R1A1 4Z92B 4CEYA 2RS12 4CDUA 1H8TA 4WM8C 1AL21 1C8M3 3J8F2 1OOPC 4SBVA 5D8AC 2RR12 3ZFGC 5C8CA 3VBUB 4CEYB 1DDLA 1VB2A 2RM21 1X36A 2R073 5J96B 1D4M1 1R082 1VBD1 4WM8A 1VRH3 3VBSA 3ZFFC 1FMD3 1QJZA 5CFDC 1NY72 4QPIC 2HWE2 1OOPA 5BNOA 3ZFEC 3ZFGA 2RS52 1AYN1 5DDJ2 2MEV1 4WM8B 1AYM3 2GH8A 1PIV1 5ACA1 1AR92 3ZFFA 1OOPB 1AR73 2QQPA 1TME1 2HWB3 2MEV3 1AR61 5D8AB 3ZFGB 1EAH3 4CDQC 1RUJ3 5CFDB 1QJX1 3ZFFB 3JB4C 4QPIB 3ZFEB 1QJX3 4GB32 1PO23 1MEC1 1X33A 4YVSC 1BMV1 1VBE1 2RMU3 4Q4Y2 1BBT1 1VBB2 2WS91 4EJRA 2FZ1A 1MEC3 1R091 3IDEA 1RUD1 2RS11 4CDQB 1K5MA 1V9U2 4YVSA 4AEDA 1FOD1 4Q4X1 5ABJC 3VBOC 2R042 1FOD3 1ND3C 4YVSB 1R081 3VBRC 5CFCA 4Q4X3 1RUF3 4YVWC 2XBO2 1NY71 4CDXC 1WCDJ 2HWE1 2RS51 1RHI2 1ND3A 3VBRA 1R1A2 3M8LA 4YVWA 1M06G 1A6CA 3HAGA 1OPOA 4LLFA 5ABJB 3VBOB 1HRV3 1ND3B 4IV1C 3VBRB 1NCQC 4FTBA 1QQP1 4YVWB 2R072 3VBFC 4CDXB 1RUE1 1VRH2 2RM22 2BFUS 1QQP3 2IZWA 4GH4C 4GB31 1VBD2 1ZBE3 1RUE3 2WWSA 1ASJ3 4IV1A 4BCUA 1AYM2 4RQPC 4Q4Y1 3VBFA 1VBB1 1ZBA3 2HWB2 2MEV2 4Y5Z0 1RUI3 1RB8G 2FZ2A 1NOVA 4GH4A 1EAH2 4IV1B 3DPRC 1NCQB 1RUJ2 2X5IC 1TME2 3VBFB 1AR62 1PGW1 4RQPA 1Z7S3 4RFT0 1PGL2 4GH4B 1RMU3 2R063 1VBC3 1QJX2 2HWD3 1PO22 3S6PA 2XBO1
chains in the Genus database with same CATH superfamily
3T0DA 1L7LA 2RMU2 4AR2A 2VZPA 1H8TC 1MEC2 4ZU4A 3BODA 4XMIA 3VKOA 4IV3C 3JCIA 1W06A 3RGBA 2VTFA 3K4AA 4FPFA 3LFMA 1KGYA 1TMF1 1LTEA 1RUD2 5JMOA 3DYPA 2WAOA 1H4GA 3KGLA 4WM7A 4LMFA 4GWJA 3PTRB 2AEYA 3AYAA 3WDYA 3LGRA 4P08A 2Q5TA 2B9VA 1YHFA 2DCZA 2R071 2ZZQA 5C3SA 3DKWA 4Q4X2 1UU5A 5GLZA 4CUBA 3OYWB 4URAA 2IXLA 2VW0A 4HZFA 4RGAA 3K4DA 2HWC3 3LA3A 4OFGA 4AL9A 4GWNA 2WUHA 3W5NA 1KFXL 1AYM1 1BXHA 4DQAA 4DUVA 3FC0A 1GFF2 2ZEYA 5JOYA 4OHYA 4QX1A 1N1YA 2W5FA 4YRDA 2PAKA 5LRRA 3VBSB 5JMCA 4MX3A 5JOWA 4OYUA 4Q4W3 4E2QA 1GWKA 5BNOB 4M00A 1RUJ1 3JBG1 1WBLA 1JHJA 5FY0A 4LBQA 4D7YA 1LHWA 1QMJA 2I45A 3SHRA 5KHIA 4ZY9A 1LU2A 3ILNA 1UX7A 3LCPA 3C7HA 2A6VA 3QH6A 3RSJA 1W8TA 3THDA 4OI4A 5JR2A 1P8JA 3R4DB 3AP6A 5FZ1A 1PGL1 2Y26A 5DAVA 4YYOA 4CXYA 4LBQB 1ASJ2 5IVEA 4QX3A 1J1TA 5CADA 1DHKB 4CEWC 4BK5A 5IFTA 5GALA 1HKDA 1KFUL 3LKJA 1DCSA 4YARA 1B09A 5DQ0A 2WNVC 1UO9A 5DAQA 3UT0A 2ZEXA 1RUI2 1DG6A 2QQVA 3J7LA 5DN2A 4NAOA 2VH9A 2HLEA 1S0DA 4LUMA 2QZ2A 4Y1VA 4BQWA 1RXFA 2VBBA 4Q8LA 2B4KA 5FYTA 5LA1A 3FN9A 3POBA 2BFUL 1VMFA 1VBC2 5FZOB 2PAEA 5FOJB 2W9XA 4M4PA 3GYDA 3HPNA 5DUXA 4Q0SA 1COV3 1LB2A 1YFYA 1ZREA 2GH2A 1RUF1 2YYOA 1OBNA 5C4WA 4AGGA 2JDZA 3THCA 5LB6A 5I8TA 5T54A 1HB3A 1A78A 2YPJA 2YFUA 1SBFA 4AEDB 1LAJA 4A7KA 2R0FA 3HBKA 3VDDA 4DY5A 2ZAHA 5FJHA 1OFSA 4QXBA 5IK7A 2E53A 3S57A 2BGCA 5C4WB 3RQ0A 5BYNA 2WBKA 4XF3A 4ZXEA 4RS5C 5BXXA 1O91A 4CDWC 4CPBA 2VMCA 5CFCB 4HMZA 1JN2P 1LESA 3HN3A 3VDDB 5K9YA 2G19A 5JOZA 1V6OA 5L36A 2VTXA 2CU5A 1GANA 4A6OA 2YDEA 1DZRA 1OD5A 1GZWB 1DYOA 1K5JA 2QQIA 3KT7A 1AF9A 1ZBE1 1WCUA 4AVBA 3NMBA 3OGRA 4AHXA 2R16A 1CIYA 4D94A 3VBHC 3I3EA 3WF3A 3ZYGA 3USUB 4K9SA 5DAXA 1NXMA 2P6CA 1O3QA 2C24A 1AHSA 1V6IA 5F3EA 2WFF3 2HEVF 1VLNA 4N90A 2ZXQA 2P3IA 2Q8OA 1Z7S1 3IIAA 2PFWA 3WX5A 5KXDA 4K8RB 4NROA 1VB4A 4BLIA 4D3WA 1X50A 3O5SA 1Q8SA 4YG3A 5JXJA 4XJAA 3ZVXA 3I97A 4TZDA 3Q8EA 2XJPA 5HCAA 1CAWA 3FX3A 3NJZA 2CDOA 4YZ1A 1S0IA 5E88A 1QJU3 1URXA 1QJY2 2BRTA 2YZ4A 3DYMA 4GJZA 4UBGA 5IVBA 2WLPA 2Z5WA 4LTAA 5L73A 1B35A 1KJRA 2NQYA 3N9LA 5EZWA 1S0CA 2VVEA 3GBWA 4WM7C 1CAWB 2CHHA 4E9KA 5F37A 3V0BB 1NKGA 5FZIA 1BHGA 3J9SA 2EA7A 1WCQA 2BDRA 2RDRA 1XNTA 2QQWA 4OCTA 4J1WA 1RUC1 2O8QA 3WG1A 5C9AA 1XNCA 3NNGA 3WCSA 3TN91 1UKRA 1W6MA 2BNMA 2HEWF 1MS1A 1JZ4A 3FHQA 4MXWB 4X6QB 5JI9A 2D6PA 3WDTA 4OI2A 2DBIA 2Z4FA 1VBA1 1H9WA 4GIQA 3VZNA 1RC6A 2A3WA 3ZR6A 4C0BA 5GZDA 5B4XA 1W6MB 1US2A 4NPLA 5T5LA 4A44A 5JXGA 5FPAA 3AZVA 1UU4A 3MBWA 3OPZA 1RUH1 4BQ4A 5FO8B 1MVEA 2IFWA 1NA1B 4BQ3A 4LPLA 2QQLA 5FMOS 1MACA 3IWZA 3BALA 4JHTA 1PVXA 1YIPA 1RUG1 3N35A 1PVC2 3PUSA 2JE7A 5L9RA 1LCLA 2RS32 3OF1A 1RJ7A 3I2KA 2J1EA 1XNDA 3J4UH 4RGKA 5A32B 2HYXA 2V09A 3A7QA 3I7DA 5C3QA 4XJUA 4HFSA 2QVSB 3WSOA 4DRRA 5AC92 2QQNA 1V00A 1OA2A 4OZXA 4OUEA 4Q4V1 3I2HA 3BTYA 2QJVA 2A75A 3H1YA 4MGYE 1NX9A 5CEHA 1S0EA 4LHLA 2J1SA 3MIFA 3WQ0A 2ZCWA 4DEVA 2D5FA 5IW0A 1D7PM 1WCSA 4GMP1 1PIV3 5ACA3 5EIYB 1RUOA 3OGSA 4AZZA 3DN7A 1MZ5A 3WQ7A 3NAPC 1IS6A 5BNPA 3AFKA 1RMU2 1UYXA 2DTYA 3ASIA 5FUNA 3THPA 1VR3A 4ITCA 1MQTA 1KRIA 1W39A 3SEEA 5JSPA 2BWAA 2CWSA 4X6RB 2N7GA 5FZLA 3SMHA 1S0JA 2RDNA 4MGQA 3LAGA 4QDQA 1PO13 3CNAA 1LOFA 2OQ7A 3KF3A 5BNPB 1SDWA 5KHGA 1E5SA 4XMAA 3FZ3A 1Q56A 4PQ9A 1MQTB 5JOXA 2LS6A 5L9BA 5K0UB 3ZKYA 1WD3A 1I1EA 2WKKA 3MEPA 1ULGA 3MV11 5EJ3A 4XFBA 4Y24A 4D6QA 3FFQA 1BJQA 4P9LA 4XJWA 3J8F1 3C3VA 3K51A 3AKQA 2HWF2 3L9JT 2VOWA 2GNTA 1O7FA 2XONA 2ZMNA 4AGVA 4LBQD 5F6LB 5FYSA 4IXLA 4WBBA 4ZONA 5FPUA 3N7KA 1Y7BA 2P5BA 2QBXA 4FFHA 1ODNA 3BN6A 2PHFA 1REDA 2P3JA 5B2GB 3W20A 1R1ZA 1AVBA 4WZCA 3UJOA 5FY7A 2AZ5A 4G9SB 3GALA 5FYYA 3WQ1A 2VXRA 1G7YA 2XLFA 3ES1A 1ACCA 2LALA 2RS53 3I2IA 1JH5A 3P3NA 1QOOA 4JDOA 4QHBA 1OPMA 1S0GA 4Q8KA 4XILA 3WP3A 2ZX4A 1GQGA 1TNRA 1FV2A 3WDVA 1WLDA 1NUKA 3KMHA 4AEJA 4E27A 2H6CA 2QQJA 1B35C 5ERLA 1W8WA 4LK6A 1OFNA 4M4RA 1LU1A 3EB7A 4FTEA 4XBLA 3P6BA 3EQEA 4XUNA 2QDNA 5FMOL 4AFCA 3O0WA 2G9ZA 3WT3A 2YB7A 3RNSA 1SLAA 2AENA 3ATGA 4R52A 2OZJA 3ZDSA 3NNLA 4FBFA 1BEV1 5C9AC 2FDHA 1NLQA 2A1XA 1LR5A 3MLLA 4R4XA 1AUYA 4UWDA 4Q4Y3 1ZZ9A 3BTAA 5FZGA 1V9U1 4Z82A 5L7OA 4GALA 3KVAA 5CKQA 1PHMA 3DYOA 3GHMA 3LD8A 3POYA 3VL9A 2VZQA 3Q8BA 2HBUA 1W0PA 4NIHA 3TEWA 2P2KA 3VHNA 4H7LA 4OHVA 5T52A 2WNOA 2WYSA 4IGPA 3HD8B 4TLGA 3C7GA 5L7OB 1CGPA 1SMVA 2R043 2A70A 3A0KA 2OQ6A 2KD7A 3LF7A 4GJYA 5DZEA 1SBDA 4OI0A 2XBO3 4EYUA 4CXWA 1VBE2 4UF0B 3ROUA 1YYNA 3R6SA 4NIAA 1W0OA 1RHI1 5EV7A 2WS92 1R1A1 4Q26A 1G8WA 3DV8A 4PBOA 4XDOA 2BVVA 4CEYA 5JXIA 1IOAA 1QY4A 3IDAA 5FWJA 1AL21 1C8M3 1NQDA 3FLTA 5JIAA 3PU3A 2BWCA 2D40A 1C57A 3VDBA 3FUOA 1YQ8A 2A6WA 2C26A 2RE9A 1O3SA 2WABA 4FCAA 5FZ3A 2R1BA 3O0VA 4CEYB 3BI3A 1O5UA 3B69A 4P9JA 2XJVA 1FNYA 2GMMA 3RZGA 1F35A 1R082 1VBD1 2VVFA 4WM8A 5FOBB 5FO9B 4IUGA 1QJZA 5JCTA 2R0HA 1NY72 4OZOA 1OOPA 4PLOA 2R32A 3MIBA 4Y5TA 1PNGA 1YEWA 4BYYA 1ULEA 4DZGA 2IUWA 4XC9A 2V4VA 4WM8B 2GH8A 2Q8DA 3H3UA 3R4SA 2V72A 5DPNA 4UOJA 1OOPB 1AR73 3T2TA 4FFFA 4AI8A 5JLVA 1UY2A 1J59A 1DGRA 1EAH3 2XR4A 4OQ8A 5GZGA 2ZHMA 1IPKA 1F4HA 4P00B 2ZMLA 3T30A 5FZ6A 2D98A 3N9QA 3N9NA 4FI9A 1E5RA 5LASA 3RS6A 4CP9A 1PNFA 5FMBA 2XB6C 1REEA 1QJX3 4AQ2A 3UJQA 1PO23 3F95A 2K46A 4KMQA 3UGHA 3S5AA 4KH9A 5DZFA 1IS3A 2AR6A 2JD4A 2RMU3 3U0ZA 2D6NA 5KWRA 1HB4A 1BBT1 2VJXA 3TNPB 1VBB2 2IVJA 5FCCA 3RRDA 4CP9B 1MEC3 4B3NA 1Q5OA 3OEAA 2BGPA 1K45A 2ZX2A 4NPRA 4XJ8A 5FYHA 2ERFA 3H7YA 3PUIA 2RS11 1KD7A 2R6QA 1K5MA 3POSA 4S2DA 1PMHX 4ET7A 4E8CA 4PIXA 4YVSA 4KWLA 3PJYA 1VPHA 2GAUA 1EPZA 1W2UA 1IQAA 1DIWA 4W6YA 5LBEA 1BCXA 5I0DA 1CAXA 3PUHA 4GXLA 4YVSB 3GZEA 5A6XA 4Q4X3 2ZGOA 4LR4A 3D0JA 4YVWC 2CTVA 4UYBA 4LOTA 1WCDJ 1I6XA 2HWE1 3RWKX 5A6QA 5FV3A 3I4IA 4QKFA 1K3IA 1CAXB 5F8PA 1O4TA 1OH3A 3E6CC 3WNOA 1JYNA 1DQ0A 1LECA 2VC9A 5F5QA 3HAGA 3P5BA 2BOJA 2VW1A 2WT0A 4XF1A 2DVBA 4MLOA 1S55A 2GDFA 4FTBA 2R072 2VW2A 2ZGPA 4HK8A 4K21A 1RUE1 2DVGA 1LHNA 2AACA 2DCKA 4ISRA 1UPSA 2GP5A 3ZN4A 1ZZCA 4GH4C 2V5YA 4PCRA 2VCBA 2GC1A 4O9EA 1PK6A 3ZYPA 4COYA 2WQ4A 1ASJ3 3OB8A 4BCUA 4DXZA 1AYM2 3BTXA 3PIJA 1PM7A 5IUQA 2DFCA 2GNMA 5KHHA 4F83A 3J7NA 3I54A 3IDCB 1RUI3 3CF6E 1L3JA 1NOVA 2VMDA 4ZZ5A 5ANNA 1DBNA 2PQSA 2Q4SA 1RUJ2 1WMEA 4UAPA 5LATA 1IG0A 1QDOA 1PGW1 3VHRA 1WMXA 3O1MA 4RFT0 5FP3A 5IK8A 4B4QA 2VQUA 2YGLA 1AJOA 4FPOB 4CCKA 5EJ1B 1PGL2 2CAUA 1VBC3 1DYPA 4R4ZA 2XUMA 2WT2A 5I0UA 2I74A 3GXUA 3ZKUA 3BPZA 3RDIA 3ZMNA 1MR5A 5FBJA 2D93A 4JDNA 3ZYIB 5LK7B 2W0XA 2ET1A 4IEWA 1TQ5A 2VZSA 3R0RA 1H6YA 2OX0A 1YQCA 2WQZC 2JB4A 1H9PA 5CYYA 5FK7A 1FPN3 2WNUC 4OHZA 1UQXA 1KS4A 1YNAA 2DBNA 1X9TA 2FHRA 4NWWA 2W3JA 1QWRA 1JW6A 4IV3A 5FFOC 3T4VA 4KBZA 2B8MA 2DUOA 5C33A 3OBTA 2XHKA 2HWC1 1WGPA 1FMD1 2W1QA 3MFCA 4NOTA 4KGGA 1ZM1A 2OA2A 1AJKA 1H8TB 3MLKA 3VGIA 3BU0A 3HIFA 4IV3B 2P6HA 1W9TA 1GP4A 3O1VA 3MUY1 3NWKA 2VMHA 1W6QB 3T1MA 4FPEA 4XVHA 2PHLA 4QQ2A 3MDPA 1TNFA 2GMEA 5IFPA 3I3BA 3B93A 2HWB1 4XIKA 5B4NA 4COZA 1BKZA 4EV0A 4Q0QA 1BLZA 1O4ZA 3ZXFA 1UWWA 4AAXA 5C8WA 4Y1XA 2ARXA 1SLBA 2E32A 2E63A 3PUQA 3TAYA 1XBFA 4JAAA 4R9DA 1HB2A 5CU1A 3LEGA 1OI6A 2ZABA 1UX6A 2H6BA 1ZBE2 4YFZA 4CA9A 3HT2A 5CG8A 3MV01 2W94A 1WBFA 2I2SA 5JVVA 2CNAA 1OHFA 3N9MA 1K5MC 2DWRA 4ATFA 5IVCA 1QJY3 1JTZX 1RYYA 3O1RA 2RG4A 4AEKA 5IWFA 3WY6A 2ET7A 4ARYA 4S2HA 3UGGA 1H2NA 2DVFA 3CJIC 4OHWA 3UL2A 3VV1A 4CEWA 5FR3A 1SEFA 3ZN6A 1UIKA 1VAKA 1ZZ6A 4YM2A 5I8SA 4FOVA 4B1LA 4K1ZA 2VOVA 4CCOA 3M70A 4YGEA 4DNYA 1W05A 3WEZA 3JQWA 4CEWB 4WVMA 4NHXA 5A3PA 5FXZA 4LBMA 1F4AA 4QKBA 2VL4A 4N43C 3SH3A 2QUOA 2O1QA 1NXD1 3KM5A 2WSVA 4YW6A 4LITA 5FZ0A 1RTVA 3AZXA 3AKSA 4XJZA 3ZXGA 1QOSA 5A33A 2YBSA 4P9GA 3J7HA 5EFUA 4ZZ8A 2Y6GA 1XC6A 3JZVA 1QU0A 2XGXA 4XTMA 5IAVA 4NIGA 4W6WA 1DP0A 2WC2A 1GNHA 2FCTA 1C8M2 2XXZA 4DXTA 1ZNPA 3I2GA 4CCEA 1RUC2 1HRV1 2WN3A 5L9VA 4JGYA 4M3CF 4HT1T 2R1DA 4DS0A 1PK6C 1PVC3 2VGDA 2ZX1A 4RS5A 1VRBA 3ZXDA 1UD1A 2RS33 4Y1ZA 3SCHA 4HBNA 2E6VA 3TN92 4CDWA 3W5MA 1MPXA 3LB9A 2RR13 3PTYA 4HKWA 4AVAA 1C28A 4PDWA 3O1PA 4QQLA 4PLNA 3H1MA 4Y1UA 4GWMA 4N9HA 5F3GA 4H2AA 4YZ3A 2RV9A 4IE7A 4RS5B 1LOBA 2QQMA 4XJ9A 4CDWB 5AC93 4QB1A 4YM0A 1ZBA1 2C4XA 4LULA 3ZXLA 1J3PA 1YLLA 5DDJ3 1XU2A 3PIGA 1JI6A 1AR72 2ZGNA 4L2NA 3VBHA 2D6MA 2VPVA 4GD4A 4UFKA 1AR93 3TOJA 3NJXA 1VJ2A 5LBFA 3B7MA 4HONA 4LJHA 3O1UA 4LOSA 4KU7A 3NV3A 5HCHA 2IXCA 5EQUA 5FMCA 1YFUA 2HWD1 5BNNA 1QJU1 5LRSA 3VBHB 1DQ4A 2AEZA 4UFIA 3EJKA 4HG6B 4DUXA 3V0AB 3TB0A 3RI9A 4YPJA 5FXVA 2VBDA 2DU1A 1Q8PA 1OLMA 1V6MA 2PLV2 4Q4V2 4QM9A 5GLUA 1YFWA 4LA2A 3RI8A 3VZOA 2EVXA 1CJDA 2SBAA 4XBQA 4FFGA 1GWMA 3OBAA 1SFPA 2XQXA 2A5ZA 1C1FA 3LEMA 4PF5A 3OGJA 3CO2A 3JD71 4LBKA 5A7NA 1CX1A 3AK0A 5IVJA 1PMJX 3CLPA 2HWF3 3HNMA 1XYNA 4M01A 5IVVA 3RYPA 1ZYBA 3KVBA 1RXGA 2L9LA 2OIIA 3LQCA 3OUHA 4WM7B 3MFAA 3C8XA 4LLOA 4CCCA 3RZKA 3CZJA 3P1IA 4XUPA 3HJRA 1CPNA 4X8NA 1GOHA 2KXLA 4C1WA 3N9OA 2XLGA 5T5PA 4A2UA 4AFAA 2JJ6A 1F8VA 3A21A 1OSGA 3IAPA 3PVEA 2A71A 3VBUA 1TVGA 1TEIA 4QAWA 1LOCA 2IXJA 3BPSA 4AG4A 1NYWA 4MVTA 2BV4A 5LEKA 2YC0A 4JKMA 3NL1A 1J58A 3UETA 4DIQA 3UGFA 1N3QA 3FLPA 3H50A 1JHNA 4E4SA 2PHTA 1CD3G 1WCKA 4HK9A 4CUAA 3WW1A 2BP6A 2HYKA 1HRI1 3PMSA 2VNGA 1BK1A 5FPVA 4RHV1 2QCSB 2RM23 2VUJA 3AJZA 3AXDA 1YC61 5D8AA 2EXHA 4ES8A 2AYHA 2BJSA 5JZGC 4KI5M 1A8DA 1YQ2A 5FIXA 2NP0A 4HSJA 3DUIA 1YI7A 1EV11 1GLHA 1W2OA 1W2TA 1DU3D 1GBGA 1QNYA 4I3PA 3S7IA 2XDVA 3U37A 3VKFC 3EO6A 4ATEA 4FOYA 4QX5A 2JG8A 1UOBA 4TXWA 3GJBA 1S4CA 3O0XA 1KEXA 3IM0A 5EXOA 4EN6B 3N7JA 4IQPA 4FSJA 1AR63 2Z42A 3RPQA 2AREA 2IXHA 1PO11 1VAVA 1POV1 2W92A 2WO2A 2OPKA 4NRMA 3NQHA 1A34A 4LHSA 3GCWA 3D0SA 5G04L 1W2NA 3NAPA 4F3JA 1AR81 2C9KA 4Q29A 3EXUA 2PHUA 3AKPA 3LWCA 3POWA 3PURA 4BQ5A 5C7GA 3T0AA 1BEV2 4JGYC 3SCGA 2XJQA 1CAUA 1HX6A 3FUQA 1VBE3 3X29B 1FI2A 1FPN2 3ZYBA 5LWBA 3HQRA 2WS93 2X10A 2VULA 3NAPB 1R093 1RUNA 4AHWA 2LTNA 1ULDA 4PDWC 1JYCA 2R7EB 1ULFA 4BXSV 1POQA 2YG0A 3FL7A 4A45A 2CYFA 3WD5A 1ODMA 2XVLA 1CAUB 4BMEA 2NN8A 1HLCA 2Q1MA 1I5PA 1UIJA 4PLMA 5HBAA 1ND2C 3GZTB 5KBFA 3K4ZA 4YW3A 4CYDA 1NCRC 1CONA 3KD4A 2VU9A 5EYXA 5DG1A 3B9IA 5F2WA 1HV0A 1OVSA 4XBNA 5FPBA 3I59A 2WZR1 1W9YA 5FQ0A 5F3CA 1ZX5A 3THTA 1W6PA 1R083 2LW8A 4RA0A 3T0BA 1GQPA 1JZ3A 3RZLA 5FPLA 3MIGA 1RJ8A 1XSQA 4P5HA 2KA3A 2P34A 5FY9A 5BNNC 4CDXA 2YHJA 5FQ0B 2WRAA 2BU9A 2OT7A 5KXEA 3AX4A 4LBLA 4IEZA 4WVZA 1AL22 1HXS1 2BQPA 3QD6A 1QNWA 3O1OA 4AHZA 4QQHA 2UURA 5CG9A 2ZPXA 4Z8BA 2JDNA 2W1SA 4XHBA 2Y34A 2LRPA 3JU9A 1XQNA 5DXDA 1UOJA 1CVNA 2AC1A 5J09A 3SCFA 4QPGC 2G4IA 1S2EA 1NCQA 4CVUA 1OF4A 2VZOA 3E5XA 2PA7A 1UZWA 3OPTA 5BY5A 3CU7A 4XAAA 1YQ6A 3RZHA 3VUOA 4F7ZA 1NT0A 5FPZA 4DY3A 2P1BA 4QT6A 1F5JA 1VBB3 4HOOA 4L9BA 5K8SA 1LNSA 1W3VA 4HVRA 4FO9A 5DAPA 1B35B 3ACGA 1NG0A 1WW5A 3IAQA 5E1RA 2Y60A 1W9FA 1D0HA 3CBNA 3OEBA 3QOPA 2GN7A 2R041 2OXBA 4B8EA 4I0WB 2VD7A 4UFMA 2X5IA 3RYKA 1LOGA 1RVF2 4XF0A 3VBUC 3ZYJB 3MYXA 2GC0A 5C9AB 3ZIXA 3O7OA 2VMIA 4CU6A 2ZOEB 1S0BA 4LIUA 4FPLA 1BBT2 1BK0A 1CAVA 2X5IB 1LHUA 1O8SA 1O3TA 1APNA 1H4HA 2PHXA 2RS12 3IDBB 2BERA 4CDUA 4XFHA 4CZSA 1QKQA 3C7FA 1SLIA 3B5LB 2Y6FA 4SBVA 3LZZA 5A7OA 5D8AC 2RR12 5C8CA 1DDLA 1IQDC 3POEA 4PJYA 2W2IA 4X8PA 3MI8A 2R073 1D4M1 4JVAA 3U78A 1W6OA 3I2JA 3KCYA 2JECA 3WF4A 3ZFFC 2UY8A 4Q0VA 2HWE2 4NE9A 3W21A 4D69A 4BLJA 3J7MA 2JG8C 3FE5A 1DQ6A 2J1TA 4NRQA 1AYN1 1V70A 1YIFA 3DEMA 3M3OA 5DDJ2 1HW5A 1AYM3 3ACLA 3E6DA 1LOAA 1PMIA 1AR92 4GKYA 3S0MA 1SLCA 3Q9OA 3ZYHA 5FP7A 1TME1 2CGPA 3WF2A 5ANQA 2KR2A 2ZEWA 4C0HA 4XF9A 4K6BA 1RUJ3 2J1AA 3VKLA 2QQKA 4RSUA 3BKZA 5FO7B 1QJX1 1ZRIA 3QACA 4ARXA 4XUQA 3IMMA 5I8YA 2X05A 5CNAA 2BZDA 3M1HA 5C6CA 4CCNA 3KV6A 4I01A 4COWA 2YC4A 1MEC1 5EYYA 2JDAA 4XXPA 1HJGA 4MSVA 1G9BA 1KS5A 3IMNA 1W6NA 4KG0A 1W0NA 5I0SA 4GZ9A 2D5HA 3KHBA 4AK3A 4AFDA 1I3HA 4U2AA 1DLCA 1UL9A 1C4RA 5JDBA 2J22A 2FDFA 1RUD1 5FBZA 2P4EA 5C5TA 3ST7A 3M2MA 3I8TA 1W6NB 4UT5A 5GJ6A 1IS5A 3K75B 4AI1A 3RWNA 2VM9A 1XE0A 1UZYA 4Q4X1 4PF1A 4Q0PA 3ENRA 4YWAA 1MZFA 2ADEA 2ARBA 2G9FA 3K3OA 1RUF3 2XLAA 4HKOA 2Q1FA 2OYZA 4CDXC 2DUPA 1RINA 2TNFA 3M3QA 1PM4A 2FDKA 3ZYFA 1HV1A 3MIEA 5FY4A 2YPDA 3SXWA 3KT1A 4JC1A 4DMIA 1GYKA 2ZGSA 2XKOA 2XQRA 3GF6A 4E8DA 5JXHA 4MO3M 4KU8A 4YVWA 1CPMA 3VLBB 2XWJB 2AUYA 3LSDA 1XXNA 4I09A 2FD8A 3WR0A 1H1IA 4XIOA 2W52A 4A7YA 4BMBA 4NHLA 1JYVA 5A3UA 4IV1C 1NCQC 4YVWB 5IYYA 2RVAA 2GALA 1GZTA 2XVGA 4R9BA 2RM22 2A6ZA 2W95A 3BU7A 4QDRA 1JZ8A 3DECA 2PQQA 1ZBE3 3MO4A 4GB31 1UW8A 1Q8QA 5FP4A 3MGUA 1KJLA 3LIGA 2R30A 2BBAA 2F4LA 5F5CA 1ENQA 2ZGKA 4RQPC 4CUGA 3GCXA 2CAVA 3HBZA 5EPAA 2EXKA 4K3UA 1EUUA 4QU2A 4IEUA 3W59A 2HWB2 2MEV2 3KF5A 4CSWA 5ISLA 4L0PA 1RB8G 2FZ2A 4GH4A 2JG9A 2Y33A 3ILFA 4XZPA 3U75A 4CPBD 2X5IC 3AL5A 1AR62 5A3OA 3WQBA 1Z7S3 3PLQA 1KITA 1DF0A 3NO8A 4NHKA 4P02B 4AQ6A 5LCWL 3FHIB 3WUDA 4D7TA 4LBJA 4XABA 2JD9A 2VBPA 4GH4B 3WINE 1D4VB 4KBBA 1A8MA 2CSGA 4AQSA 2XHNA 2J42A 4NUBA 4TN7A 1XNAA 2G1MA 2C9AA 2PXJA 3EHKA 2PAMA 1G9DA 3DL3A 2BBVA 3AZZA 1UNBA 4URTA 3ILRA 4CDUC 2CY6A 3D82A 4BE3A 2XKPA 1WA4A 2YGMA 3B00A 4L97A 2NLRA 4PBPA 1BMV2 4UW3A 4JKLA 3NV4A 3KZ4C 5KHJA 1R092 5A80A 5C8CC 1OKQA 1WZXA 2VMEA 3DF0A 2JDMA 3AKRA 2Y0OA 2DVDA 4YM1A 3ZXAC 5J48A 1DFQA 2ZHKA 1XYOA 1RUC3 1FOD2 4DXSA 2W1WA 3WDWA 3BGAA 1VRH1 2CGOA 3ETQA 4LO7A 2WNUA 4XE9A 5FLJA 3TN93 4MH0E 3O1TA 2VXJA 3LIHA 5APAA 3WNMA 2P3KA 3CJXA 1W2AX 3HQUA 2UWBA 2GU9A 2VTXJ 4FQ4A 2Z79A 3OG2A 4PIYA 3WUCA 2WNUB 3RJ2X 2LUWA 3FWEA 1N3PA 4YW4A 1QXPA 5JR7B 4I0AA 2HBTA 4HANA 1OA4A 1UMHA 3U14A 3ZM8A 1HRV2 2UWAA 2YBPA 1IS4A 1N1VA 4Y1YA 4FXKB 4YZ2A 2QTWB 1RUG3 2BYVE 3H8UA 5A3MA 1N1SA 3I3MA 3MUZ1 4WVVA 1QQP2 4K8FA 1WD4A 5GZEA 3WHUA 1UOFA 1O3RA 2C6SA 1WMDA 2ZACA 2RHPA 3D4KA 3GM8A 4KWKA 1ZBA2 3H7JA 1VMHA 3MLJA 2PLV3 4Q4V3 3VZMA 4P9IA 2BGOA 1W90A 2TBVA 1OD3A 2HH9A 2IWGB 5AVPA 4Y3OA 3WVJA 3OBRA 4XPVA 3AVSA 2SLIA 1T6BX 5F3IA 2FCUA 4XDQA 5JSOA 1XOYA 4BH9A 3OY8A 3I2DA 2HWD2 1UPIA 3UYJA 2UY9A 5AVAA 3ON7A 3S7EA 1F2NA 3CJIA 3WW4A 4IE4A 3ZO0B 3V64A 1JYTA 2VQAA 3PDQA 2VY0A 1K5MB 4DINB 2LM3A 4MGZE 3OY8B 5H9SA 2Q8CA 1YXWA 1SCSA 4MHUA 4AI0A 2EIDA 3CDZB 3QCWA 4QHOA 1D2QA 1OXCA 4XCBA 4LUKA 3CJIB 3W9AA 4IEVA 1K42A 3N9PA 4W4ZA 3H8OA 1MS5A 2UYBA 1HJFA 4N53C 4N43A 3H3LA 2BNNA 1V6NA 2XUEA 4D6SA 2F6BA 3N4MA 1TMF2 4XETA 5FYUA 4PT6A 2RS31 3JD72 3AYCA 1L7QA 1TZOA 2ZX3A 4N43B 4DXRA 4RR3C 1YJKA 4IEQA 3IKWA 5D21A 3MW4A 1YFXA 3WW2A 4JX0A 4QKNA 3JXSA 1NAEA 4META 3EYPA 4ZS2A 5F6KA 3M4FA 4AW7A 3T3YA 4YW5A 5LA9A 1JUHA 4R9CA 4EN7B 2DURA 1GR3A 2JG9C 3PHMA 4YG6A 5FK8A 1OT5A 1N1TA 1DGWA 2EXIA 5FYMA 1DGRN 3PL0A 5HXMA 1TG7A 3Q8CA 1DGLA 4LIVA 2A73B 1F9KA 4NVPA 1VAMA 1PK6B 1AX0A 1ENRA 3JBG2 2B42B 4QX2A 1RMU1 2R061 2VVDA 3CMGA 2BOIA 3MHZA 4Z07A 2OKXA 1WLCA 4FPHA 3PUAA 4JGZA 1D2SA 1XPWA 4DPNA 4ASKA 1HRI2 3NW4A 1HIXA 2YBKA 4DFSA 2QE3A 4RHV2 4YNIA 5HV0A 1OH4A 1PX4A 2VR4A 1V6LA 5KXCA 3WZ1A 4Y5SA 4LORA 4BWOA 1W03A 1WLTA 5FYVA 3WP4A 3RZMA 2JDPA 1DQ5A 3PU8A 4GMP0 2PTMA 5CISA 2ETEA 4A7ZA 1UU6A 3WDUA 1LJ7A 3PJQA 1EV12 4FT8A 1BEV3 3ZSKA 5KHKA 5A1FA 2ZZJA 5A6ZA 4IEOA 1GNZA 4A4AA 1ALYA 1BYHA 3MF9A 5CAZA 4BK4A 1Y9MA 1CN1A 3FBYA 4LE3A 4BU2A 3V56A 5LY1A 1AXZA 3VZLA 4AI2A 2DF7A 3J26N 4Y20A 2O8OA 4U36A 5FP8A 1RUF2 2DCJA 4NRPA 4V2WA 1C1LA 3U4SA 1UMIA 3CL1A 2CDPA 2YC2A 2ORZA 3OD4A 4AXOA 3L2HA 4Y20B 1AR82 5T5JA 1OQDA 4E2SA 3SISA 3HVDA 4G4FA 4I02A 4Q4W1 1UXXX 2BNOA 2EIGA 2ZKLA 3BIEA 5A3LA 1RHI3 4LKEA 4OHXA 5F39A 1QDCA 3TBDA 1R1A3 3M3IA 3NNJA 4XUOA 1WWYA 2W08A 1CESA 3OUJA 5FLHA 4V2VA 1AL23 1S0FA 2ZHLA 2Y38A 1MS4A 4BB3A 1RITA 3WP6A 3VN4A 3SQOA 4CP0A 4CUCA 1ZZ7A 1HN0A 4YM3A 1T2XA 3MF6A 5HV4A 2RDSA 2WZR2 3VD9A 3N7LA 3ZSJA 1VBD3 2ORXA 4Y22A 5CBLA 2D6KA 5LW9A 3FBMA 4XYXA 1W8OA 1J3QA 5CFDA 3WG4A 1XSRA 1KDKA 2HKXA 4IGOA 4QPIA 1GMMA 2RJKA 4EWAA 4MG2A 1VE0A 3ZFEA 2YY1A 1Z7S2 4NR1A 2PELA 4PI0A 4BJ0A 1HXS2 5JZGA 2V4AA 1COV1 1GSLA 1UYZA 1GZ9A 3M3EA 4EZ4A 4TLFA 2JDYA 1C8NA 5KR7A 3POGA 2VNRA 4XQWA 3PVOA 5FZCA 4FPKA 4NWVA 4NPMA 1X8EA 4QQOA 5CIRA 3NNMA 5K4LA 2V73A 3RG0A 3ZN6B 3OD0A 5JZGB 2WSUA 1MS0A 2K0GA 3ES4A 4CDQA 1QF3A 3LPGA 3MIDA 4I30A 5GZCA 5J7MA 4FTSA 1NZIA 1RVF3 3TRSB 2ARAA 3PMEA 1S1AA 3RMYA 4LKDA 4WVMB 3KB5A 4OMDA 2GNDA 4B4PA 4JHZA 2P37A 4DUWA 3AJYA 3E5QA 1BBT3 4L99A 3T2QA 1W9WA 5IHRA 1OLRA 2EAKA 2ADDA 4AGRA 2RS13 3TWIA 1T6GC 4J6GA 5A33B 3NV1A 3PNAA 3B02A 4LXLA 4LO8A 5GLTA 4IEXA 5CKNA 4OI1A 5IVFA 1U5IA 3CHXA 5FZEA 2JX9A 1UYPA 3AP9A 3B9CA 3KHCA 2JICA 4R8HA 2CGNA 1G9CA 3ZSLA 1QXRA 3ZSEA 3AP5A 4JGYB 1VBA2 5HPOA 4ONUA 2A6YA 1ND2A 2W87A 2WFF1 2WWUA 3CZUA 3A0NA 3VBOA 4AVVA 2HWE3 5ABJA 4EE2A 3AKTA 1NCRA 2WFPA 1RUH2 1LOEA 4PDWB 3SKJE 3U10A 3HOBA 2PHDA 4JGZC 4S2GA 1QEXA 1Y3TA 2ZTNA 4ISQA 1W3XA 2WNEA 1XNKA 2WO1A 4AF9A 4JQRA 5IT6A 2Y6LA 4YZ5A 1ND2B 4QX7A 5A3WA 4E2GA 2D43A 1RUG2 2PHWA 3MW3A 4LE4A 4UXAA 1NCRB 1S2KA 4JRLA 4IERA 3VKNA 4LO5B 4KWUA 1AXKA 1J3RA 2JEMA 4Q1PA 4DEQA 2GSYA 1CZVA 2X09A 2ZKNA 3CEWA 4IEPA 5E16A 4E4ZA 1D4M2 1RIRA 2JDHA 4A3ZA 2JKXA 3UNPA 2XVKA 2W1UA 5FKCA 2ZMKA 3TNQA 4EZHA 4RL7A 5BNNB 5T3NA 4SLIA 5FZFA 1AYN2 2EF6A 1RGSA 2VQ0A 2QZ3A 3MW2A 1G9FA 2VZRA 4Z1VA 1H2LA 4QPGA 1QH7A 3T1LA 2XMLA 1YO8A 2BEOA 3AYEA 2WZEA 1STMA 3ABZA 3LE0A 5CB7A 4ZS3A 1UY3A 1E5IA 1W99A 3SH4A 3IZOA 1IGOA 4EN8B 2E7AA 1YWKA 2ZGTA 2BUKA 2ZGMA 3LA7A 4QPGB 3RZZA 2D7FA 4QGNA 1W9SA 3RYRA 3VB9A 4C8DA 2NMNA 2ZGRA 3DPRA 4Q0UA 4C90A 1D0GA 2VZ1A 3D5OA 2DVAA 2QKDA 3N36A 1CX4A 1HN1A 4PIZA 4Q1RA 2VZVA 4FQZA 3WNKA 3NRUA 1EUTA 2K9ZA 4ZKTB 2IVIB 4MZUA 3DPRB 1UN1A 1U5YA 1IKPA 4K40A 2D3RA 4FPYA 3OYWA 2F17A 1SLLA 3ZXEA 1HQLA 2J7MA 4PQQA 3I2OA 5KC6A 1YQ5A 2YXSA 3B01A 3WW3A 3J8F2 1QH6A 3INAA 4P5YA 1J1LA 4BZ4A 1LHVA 4HN1A 1EP0A 5GM0A 3ZFGC 1MS8A 3OUIA 3VBUB 3K2OA 5CA6A 4GQ7A 1I9RA 1NE6A 1FXZA 1UY1A 3OOXA 4QMAA 3WDXA 1X36A 4BQ1A 2EIEA 5CFDC 3VBSA 1FMD3 2IFRA 1XE7A 1Z0HA 3VZKA 2WAAA 4QPIC 1BVVA 4BA6A 1LEMA 1O4YA 5IJRA 1YJLA 3E6BA 1CQ9A 3UKTA 3ZFEC 5BNOA 4JZRA 1GICA 3H9AA 1BQPA 2JE9A 4MGKE 2QNKA 2GC3A 2TUNA 2FMDA 2VZUA 3ZXKA 2EALA 4AVCA 4C1XA 2K2SA 3LDRA 1NLSA 2R49A 1W8NA 1PIV1 5ACA1 3MIHA 3ZFFA 4NHMA 1XE8A 3AZWA 2NPIA 2HWB3 2FQPA 2MEV3 3F2ZA 1U12A 3NJVA 4K7JA 5D8AB 4RFRB 4Z2AA 2W68A 4HN0A 2OW4A 3D3AA 4MUVA 4CDQC 4FPGA 2FCVA 4L8QA 1OLME 3ZFFB 4NO4A 3POJA 1UZ0A 3JB4C 3AZYA 1SPPA 5EJZB 2JG8B 1JU4A 2PYTA 5C5UA 5E89A 5E8AA 3KGZA 2OUJA 3AC0A 4GB32 2JKBA 2VCMA 4H55A 3AB0A 1JYWA 4N7UA 4PHZA 2B45X 4QU1A 2B9UA 2VUAA 3K46A 2ENRA 1SPPB 5FZOA 4Q5OA 2FZ1A 4XQDA 5JIUA 3MZHA 5E6HA 3IDEA 1XB9A 2BVBA 2VQTA 1NE4A 3A4UA 4ZU7A 3ZPYA 4XHXA 4CTEA 1V9U2 3PVBB 3D6EA 4OMCA 5A7PA 4AEDA 2B39A 4YZ4A 5IATA 2RDQA 4M0HA 2DUQA 5JAXA 1MS9A 3VBOC 4ORFA 5ABJC 5LZ6A 1GKBA 4W8JA 1FOD3 3N7MA 4AOCA 1ND3C 4O65A 3VBRC 5CFCA 2GC2A 3P3PA 2NM1A 4LT5A 4QM8A 5C70A 2RS51 2YMZA 2B5HA 1Q43A 5FMDA 1GZWA 5LBBA 2A7AA 3ZLIA 3H8RA 3I2FA 1RHI2 5LK5A 1R1A2 3M8LA 4YGBA 3WP5A 1SLTA 1U5ZA 1KXGA 3I59B 5EHDA 3LOIA 5A1AA 1LRHA 3WNNA 4OUSA 1W6PB 2XJUA 1EPWA 2X29A 1OPOA 4WZFA 4LLFA 3H42B 3WG3A 4IE6A 4P9XA 5FZBA 3USUA 1HRV3 5JI7A 2Q0AA 4QPYA 3VBFC 1REFA 4BOWA 2RJ2A 1VRH2 4CDXB 3ZN5A 5GLWA 1IPJA 4LK7A 3D8CA 4AI3A 1UF2C 1JS9A 1QQP3 2IZWA 4IE0A 3ZSMA 5A7WA 1VBD2 4KG8A 1AX1A 1SFNA 4ZXKA 4IV1A 1W8HA 3VD5A 4Q4Y1 5AFEA 3ZDVA 1SCRA 5A7QA 1ZBA3 2QQOA 4MV2A 5A7WB 1A3KA 5HCBA 2D44A 2WINB 4IV1B 3DPRC 1NCQB 2C5DA 2XH6A 5I0TA 4HL0A 2WL1A 5AFBA 4RQPA 4RN5A 3KV9A 5JPNB 3BB6A 2O0OA 2XWBB 1HDKA 3ECQA 1QHDA 1UCXA 3AMHA 1DQ1A 1GZCA 4TSVA 1LODA 4OVEA 2EICA 1IKQA 3OBZA 3V0BA 2HWD3 2VOXA 3S6PA 1UZZA 3QH7A 1G86A 4AE2A 2VUCA 1BVP1 2D97A 2XBO1 1MZEA 4RQPB 3CQOA 3GGLA 2E7TA 3NSTA 5FZ9A 3UK9A 5FUIA 3K48A 3RMXA 4L92A 5DZGA 3U4XA 3HN1A 2BW8A 5FDBA 1JBCA 5BPXA 4EN0A 4LKFA 2CV6A 3AMNA 1Y9GA 1C8M1 4YGDA 3ZXJA 4AAPA 4MXWA 4CCDA 1WLWA 4YLZA 4MGSA 4FP2A 2A3YA 2GNBA 4L11A 2ZBJA 3VBSC 3WNLA 3BUCA 1TMF3 1OURA 2XG3A 2XL7A 5FXWA 4BM8A 5HI0A 3JD73 1CAVB 5BNOC 1PGSA 2DCYA 1SFYA 2KM2A 2BPA2 5T55A 4BQYA 3OTFA 1NA1A 1W8FA 2Q1ZB 4JV4A 4NAMA 5FP9A 4CDUB 3WNPA 4EN9B 1OUXA 3JB8A 3HQXA 5DAWA 3EBRA 5H9PA 3H0OA 5FYBA 1DYKA 1Q3EA 4FAHA 4RYDA 5C8CB 5LA0A 1FAYA 3I3QA 3OGGA 4JKKA 3IIIA 3E5UA 1EYBA 1AR71 3LDKA 4CXXA 5A32A 2JE8A 5FZ8A 4AVTA 1W6OB 1US3A 3FJSA 2GN3A 1EAH1 2OVUA 3OCPA 1H0BA 5FZAA 2HEYF 2WA4A 4WV8A 4AEMA 4BQXA 3BTZA 4F8AA 5KC5A 1Y4WA 2VZTA 5FAXA 2ZEZA 5M0TA 1V0AA 2EXJA 2VCAA 3CIHA 1QGLA 3DKQA 3JBG3 4QGMA 1YI9A 2ZGQA 4AWDA 2C1FA 4GA9A 5LBCA 3UKVA 1PO21 3UKNA 1RUE2 5J1XA 1C5IA 3SITA 1UYYA 1F15A 1H30A 2W91A 3AYDA 3POFA 5FZ4A 5IK5A 2EAAA 2RMU1 2PLV1 2W46A 2YV8A 1HRI3 1PX3A 3W58A 1FNZA 4RHV3 1OVPA 2VAUA 1JXNA 1ZA4A 3ZIWA 1WW6A 2IXKA 3KLSA 5FKBA 5FYIA 4AEDC 1YRZA 5T5OA 4QX8A 3ACFA 2YU1A 2PHRA 3KSCA 1OF3A 3QBQA 1LGBA 3WV6A 3FLRA 5C4WC 5FZ7A 4IETA 1X8MA 1N3OA 1UZVA 3ACIA 1JMUB 1EV13 4FAGA 4XFFA 5CFCC 2VMFA 4ZU5A 2R062 1PGW2 3VDDC 5DMYA 2D6LX 2WR9A 1Q8VA 4RGGA 2ARCA 5FXXA 1QJEA 4B29A 4LO4B 4D0QA 1DQ2A 5K0UA 2E31A 3VD4A 2IXIA 4YW1A 5J3UA 3MPPG 4K20A 1ZRDA 3VD3A 5GKAC 1G6NA 1POV3 1X7NA 1SQ4A 4HVQA 1JYIA 2JDUA 1QJFA 4IW3A 5FWEA 3VDAA 4CCLA 2WIIB 4Y4RA 1DZQA 4QXCA 3WNXA 2CL2A 4JQTA 1R64A 4LHKA 4N8MA 4CE8A 1AR83 3BVCA 2WA3A 3GBGA 4EWDA 4AFBA 2DTWA 3N3HA 4O7XA 3BOPA 3WG2A 4JTOA 2ATFA 2OS2A 2VG9A 3ACHA 3L2YA 4XQ4A 5FYCA 2I07B 2MHFA 4KWJA 3TEYA 4LBOA 1UAIA 4NJ4A 3ETPA 4FPJA 3ORJA 4KL1A 4N53A 2J1VA 3V65A 1GNYA 2HWC2 1IZ3A 5F32A 1GP5A 1FMD2 1ASJ1 4W50A 5JSRA 3H8XA 1JZ2A 3C7EA 2J1UA 1WMFA 2X8KA 4D6RA 1AX2A 4GWIA 4B7EA 4A42A 5JPMB 2XJTA 1AZDA 1JOBA 2WO3A 4N53B 3VZJA 4RR3A 2WZR3 3WXPA 3HNBM 1RUI1 3H3ZA 4QWNA 3ZMOA 4BHPA 3H1WA 4HETA 4Q4W2 3VL8A 1UY4A 1W8UA 3WOGA 1FT9A 5I0RA 1M06G 3ZOIA 2DDUA 3KQRA 4LO6B 2WDBA 1CWPA 5F2SA 4RR3B 4ZPIA 4AHYA 3AP4A 3WF1A 2VZ3A 3AMPA 4ASMB 4B4RA 4E4DX 4QX0A 1VBC1 2NMOA 3LA2A 2VNVA 4V1PA 2UWCA 1HXS3 1E57A 3AL6A 3O12A 3POIA 1BZWA 2WZPP 5A3NA 2JWPA 3MPBA 3FFZA 1I5ZA 1QXJA 1JU3A 2JG9B 4FFIA 1GV9A 4HPKA 4I0BA 1SG3A 1JZ7A 2VNOA 4COVA 2JENA 4XACA 4XEZA 2Y8KA 3ELNA 1VMJA 3PVNA 2UYAA 4HPKB 1ZZ8A 3JUUA 4CP2A 5F1RA 1FPN1 3KV4A 5FRAA 1ZRRA 2DYCA 4QKDA 4IGQA 1W04A 5JWPA 1ENSA 1FATA 1NA1C 2WZ8A 4HSLA 4I3GA 3VDCA 1LKNA 1POV0 2ZGLA 3AMQA 4GAZA 5DG2A 4AVSA 1COV2 1W8ZA 1HB1A 2VCCA 4R9AA 5FY5A 5J37A 2UU8A 1IHMA 3HR9A 4UF0A 1NZCA 2ZJCA 1M4WA 3MICA 4XFGA 4EROA 1EY2A 1ENXA 4COUA 1J84A 4A41A 3ZYRA 4MGIE 3OGVA 3T2OA 5L19A 1WKYA 3LEIA 5KXBA 1LEDA 5CZKA 4DRVA 3BCWA 5J36A 1OQ1A 1Y43B 4ASLA 1VBA3 2WT1A 1G9AA 4S2FA 1Z78A 1CZSA 3VKMA 3ZX7A 1X9PA 4OULA 1RUH3 2ILMA 3DXUA 2OPWA 2E33A 3GBFA 4B7KA 1IG3A 3GZUC 1KDMA 1N47A 4FOQA 4INDA 3WLUA 1C3HA 1AL0G 4LKSA 4XFCA 4DOUA 5EP9A 3U11A 2XPJA 4HLTA 5FREA 5I91A 3SC7X 3LOBA 3SLIA 5CKMA 5DABA 2JIGA 2G9GA 1QJY1 4QD2A 2GMPA 5FY8A 2A6XA 1D4M3 5SV8A 4AI9A 5FZDA 5I93A 2WFF2 5JUVA 1H2MA 2FDJA 2VOKA 1O59A 4D7SA 1ZRFA 3RJRA 4XAEA 3RVHA 3U07A 3G6JB 3SNMA 5BNPC 1LENA 4JCKA 5SV5A 2YUEA 5EWSA 3NV2A 1AYN3 1MQTC 4LNVA 1MVQA 3S30A 5A70A 5K0UC 3GZAA 4XCAA 3C7OA 1VP6A 2YU2A 1LOFC 1IPSA 4KNCA 3T4HB 4TYSA 4UFHA 1TME3 2XL9A 4TWTA 3ALQA 4GMP3 5IAXA 5J98B 2YROA 2F4PA 1OQEA 1QJU2 4BQ2A 4H14A 4LBNA 3VHOA 4XUTA 1LHOA 1RVF1 3UV9A 1GOGA 1ZZBA 3JQXA 2XJSA 1QIQA 3KT4A 2OUHA 3BOWA 4CCJA 4DO0A 1CIWA 2WQ8A 2WJSA 5C3RA 3HNYM 5K7PA 4JRAA 4DB5A 4UW5A 2Y6HA 1WW7A 2DFBA 2OZ6A 2C0ZA 1GUIA 2ZGUA 5CVRA 4MXVA 4YW7A 2DU0A 5T50A 3WF0A 4UBHA 1PVC1 1RUD3 4UFLA 1LGCA 2W47A 1GWLA 2QDRA 1JUIA 2RR11 1U0AA 2WLQA 3GDBA 4BDVB 4OQ9A 4CU9A 4J25A 1ZA7A 3J8F3 5DUVA 3TEXA 4UI9L 4QB6A 3B3QE 4B1MA 4P9WA 2H0VA 2XJRA 4UFJA 5AC91 4FOWA 4MOAA 3SKVA 1DZTA 3IN9A 4JTNA 3M7AA 5DDJ1 4XTPA 1OC1A 1ULCA 3Q8FA 3R05A 2Y64A 4FP3A 2BTVC 2D6OX 5F5IA 3SH5A 1JZ6A 1CR7A 1VIWB 1ONAA 4HXCA 4KQ7A 2Q8EA 1AR91 4G3YC 4WVWA 3ZPOA 3B94A 4Y4YA 1F5FA 1L7RA 3NNFA 2J1RA 3APBA 3IB3A 4CU7A 2D3SA 4XZUG 4GULA 3BIWE 4PI2A 4OUMA 3T08A 5GLVA 4JDMA 1XRUA 3NKGA 5HCFA 4AQTA 2CWMA 2DV9A 2VO5A 4QXKA 1GU3A 5LEJA 1WW4A 1E5HA 3IBMA 3IT8A 4BXFA 2WYFA 1KQRA 4BIOA 1XNBA 1PZ8A 2QFEA 1MS3A 2VECA 1H2KA 5L7OC 5IVYA 4JGZB 3BYWA 3EMRA 4GB33 1UOGA 2JIJA 4H7MA 3RFRA 1YCIA 3R4UA 3NVCA 1HQNA 2V5DA 4J1XA 1RL3A 1PIV2 3AVRA 5ACA2 4EQVA 2Z69A 5DUUA 1ST8A 2PN5A 4LA3A 1JZ5A 3E1F1 4XXAA 3URFA 5IK4A 2HWF1 4O61A 1FV3A 2VMGA 4TTGA 1V9U3 1LULA 1JODA 2W39A 3KQ4B 5BUVA 3WCRA 3G7DA 5LY2A 4RD7A 4QHZA 1AXYA 1PO12 2Y0IA 3AMMA 3AM2A 4E4HA 2FDGA 3E97A 4QXHA 5D1IA 4MGTA 1SBEA 1WUVA 4M0NA 4CEYC 1XU1A 1S2BA 2MNGA 3KWVA 3KV5A 3T2PA 1WA6X 2Y6KA 1Q8OA 3U1XA 5A3TA 4FXGB 2P17A 4IE5A 3GJAA 3HEIA 1H8VA 1SACA 2ES3A 5HXVA 1VALA 1U5XA 1CZTA 4Z92B 2E51A 4W65A 2ZS6B 3CKHA 1H6XA 3KCXA 4A6SA 1H8TA 5BV6A 5FJKA 3AP7A 4WM8C 2WWJA 4YW2A 1LGNA 1C5HA 1NLRA 4LQRA 3IPVA 1OOPC 1V6KA 4QPWA 5D2AA 2ID4A 1W6QA 2ZA9A 1HQWA 3C2UA 4IEYA 3VD7A 1VB2A 2AH2A 2IC1A 2RM21 1OLQA 1SZBA 5BNQA 2FBEA 5C3OA 1Y9QA 5C3PA 5J96B 2HJIA 1VRH3 3AXEA 4NIDA 3DXTA 3TYJA 3IPVB 2VOTA 3LPFA 3GHNA 4A3XA 5FTTC 1DGWX 2RS52 4XFAA 3ZFGA 2E7QA 4H3WA 5FZHA 2MEV1 4YGCA 5DUWA 4YFWA 2GZWA 5G05L 4NN0A 2GP3A 1DLLA 5H9QA 3VHPA 3Q8AA 1UKGA 2QQPA 3TEZA 2TEPA 4EWEA 1AR61 4NHYA 4Y22B 3ZFGB 2NYYA 1JYXA 4LEJA 4OLLA 5FZKA 3HWJA 3HT1A 4HKLA 2H0BA 5F9TA 2DCTA 1XJAA 2Y6JA 3KS7A 4GKXA 3A23A 2QQUA 4KGQA 3KCCA 3S5QA 5CFDB 3I49A 4N7IA 2ZHNA 4QPIB 4M3CA 1GOFA 2D3PA 3ZFEB 4UW6A 4ZHNA 3AFGA 4IL7A 4QGLA 2LROA 3LDBA 4Q27A 3DGTA 1O6UA 1X33A 4XOGA 4YVSC 1BMV1 1MZ6A 1VBE1 3GNEA 3ITQA 4N9IA 3USSA 1K12A 4Q4Y2 3UESA 4BIFA 4M3CB 2WS91 5FUPA 4EJRA 5F7UA 4I2OA 1XYPA 1R091 4FVVA 3ZR5A 2YFZA 1OUSA 4CDQB 1FYUA 2WNVA 1NQJA 2E9QA 4MADA 2X53S 3ME2A 2FDIA 1PZ9A 1ULOA 2B46X 5C71A 1GQHA 1F31A 2MPFA 4HVOA 1OMIA 1FOD1 2O14A 2FMYA 5F5AA 3NKTA 1SDDB 5FY1A 2R042 5H9RA 4XFIA 2WNVB 1W28A 5A1LA 5TSWA 1UMZA 4MHRA 1R081 1YUDA 2E26A 2XBO2 2ZX0A 1NY71 1UY0A 5FPXA 1TE1B 3I3DA 1CJPA 3K77A 1H1MA 2Q30A 3A22A 1QOTA 4XW3A 2WN2A 1J83A 5GZFA 1O8PA 4YSFA 5FZMA 4Y26A 3WHTA 4CU8A 2WO7A 3HMYA 1ND3A 3VBRA 5A7SA 4C91A 5LA2A 5FYZA 1A6CA 4LHNA 1PZ7A 1V6JA 3OJBA 4UW4A 4IESA 3FMGA 3RZJA 4XF4A 1SHWB 5ABJB 3VBOB 3T09A 4QDSA 5FLIA 3SEPA 3OSDA 1ND3B 1X82A 3DCQA 3VBRB 4IDZA 1QQP1 3K3NA 4AFMA 3NJYA 1JOJA 1FX5A 2PMWB 2RJLA 4Z2WA 2BFUS 2JDKA 1OA3A 2EIBA 4CCMA 1OKOA 1UXZA 4FPCA 2AGSA 1RUE3 2JXAA 4BPZA 2WWSA 2Z2SB 3OPWA 1ZVFA 3O1SA 4QQPA 4ES9A 1ZRCA 5A6YA 3QLQA 3LSEA 2XOMA 3VBFA 1VBB1 3O14A 4AYUA 4XURA 2JB8A 4MYEA 4Y5Z0 4NMIA 4YG0A 1ULPA 4P14A 4CP1A 2NZ9A 2A3XA 4W6XA 1H1AA 1EAH2 4Q2FA 4M3CE 1O5LA 4Y33A 1TME2 4CRQA 3V0AA 3VBFB 2ZAAA 3FHAA 3LFIA 4P9YA 4NIIA 2B7YA 2P3YA 2VUDA 4QB2A 3LEKA 1GP6A 1RMU3 2R063 4K1YA 4O9GA 1QJX2 4BISA 1PO22 1JOPA 3M3CA 4XDPA 4D8MA 2VE1A
chains in the Genus database with same CATH topology
2RMU2 1H8TC 1MEC2 4ZU4A 3BODA 4XMIA 3VKOA 4IV3C 3JCIA 4FPFA 1TMF1 1LTEA 1RUD2 1H4GA 3KGLA 4WM7A 3AYAA 3WDYA 3LGRA 2Q5TA 2DCZA 1YHFA 2R071 2ZZQA 3DKWA 4Q4X2 1UU5A 5GLZA 3OYWB 2IXLA 2VW0A 4HZFA 4RGAA 2HWC3 3LA3A 4OFGA 4GWNA 1KFXL 1AYM1 1BXHA 4DQAA 3FC0A 1GFF2 5JOYA 4OHYA 1N1YA 4YRDA 3VBSB 2PAKA 5LRRA 5JMCA 4MX3A 5JOWA 4Q4W3 4E2QA 5BNOB 4M00A 1RUJ1 3JBG1 1WBLA 4D7YA 4LBQA 1LHWA 1QMJA 2I45A 3SHRA 5KHIA 1LU2A 3ILNA 3RSJA 3LCPA 3QH6A 2A6VA 1PGL1 4OI4A 3R4DB 3AP6A 2Y26A 4YYOA 4LBQB 1ASJ2 1J1TA 5CADA 1DHKB 4CEWC 5GALA 1HKDA 1KFUL 3LKJA 4YARA 1B09A 2WNVC 1RUI2 1DG6A 2VH9A 1S0DA 4LUMA 2QZ2A 4Y1VA 4Q8LA 2BFUL 1VBC2 2PAEA 5FOJB 3GYDA 5DUXA 4Q0SA 1COV3 1LB2A 1YFYA 1ZREA 2GH2A 1RUF1 2YYOA 5C4WA 4AGGA 2JDZA 5I8TA 5T54A 1A78A 2YPJA 1SBFA 4AEDB 4A7KA 2R0FA 3VDDA 4DY5A 2ZAHA 1OFSA 5IK7A 2E53A 2BGCA 5C4WB 3RQ0A 5BYNA 4XF3A 4RS5C 5BXXA 1O91A 4CDWC 5CFCB 4HMZA 1JN2P 1LESA 3VDDB 5K9YA 5JOZA 1V6OA 5L36A 1GANA 2YDEA 1DZRA 1OD5A 1GZWB 3KT7A 1AF9A 1ZBE1 4AVBA 4AHXA 2R16A 4D94A 3VBHC 3ZYGA 3USUB 4K9SA 1NXMA 1O3QA 1AHSA 1V6IA 2WFF3 2HEVF 1VLNA 4N90A 2P3IA 2Q8OA 1Z7S1 3IIAA 2PFWA 3WX5A 5KXDA 4BLIA 1VB4A 4D3WA 1X50A 3O5SA 1Q8SA 4YG3A 4XJAA 3ZVXA 4TZDA 2XJPA 5HCAA 1CAWA 3FX3A 3NJZA 4YZ1A 1S0IA 5E88A 1QJU3 1URXA 1QJY2 2YZ4A 4UBGA 2WLPA 2Z5WA 4LTAA 5L73A 1B35A 1KJRA 2NQYA 5EZWA 1S0CA 2VVEA 3GBWA 4WM7C 1CAWB 4E9KA 3V0BB 3J9SA 2EA7A 4J1WA 1RUC1 2O8QA 3WG1A 5C9AA 1XNCA 3WCSA 3TN91 1UKRA 1W6MA 2BNMA 2HEWF 1MS1A 4MXWB 4X6QB 5JI9A 2D6PA 3WDTA 4OI2A 1VBA1 1H9WA 4GIQA 3VZNA 1RC6A 2A3WA 4C0BA 5GZDA 1W6MB 5T5LA 3AZVA 1UU4A 3OPZA 1RUH1 5FO8B 1MVEA 2IFWA 1NA1B 5FMOS 1MACA 3IWZA 3BALA 1PVXA 1YIPA 1RUG1 3N35A 1PVC2 2JE7A 1LCLA 2RS32 3OF1A 1RJ7A 3J4UH 1XNDA 5A32B 2V09A 3I7DA 4XJUA 4HFSA 2QVSB 4DRRA 5AC92 1V00A 1OA2A 4OZXA 4Q4V1 2QJVA 2A75A 3H1YA 4MGYE 1S0EA 4LHLA 3MIFA 3WQ0A 2ZCWA 2D5FA 1WCSA 4GMP1 1PIV3 5ACA3 1RUOA 3DN7A 1MZ5A 3WQ7A 3NAPC 1IS6A 5BNPA 3AFKA 1RMU2 2DTYA 3ASIA 3THPA 1VR3A 4ITCA 1MQTA 1KRIA 1W39A 5JSPA 2BWAA 2CWSA 4X6RB 2N7GA 3SMHA 1S0JA 3LAGA 1PO13 3CNAA 1LOFA 5BNPB 1SDWA 5KHGA 4XMAA 3FZ3A 1Q56A 4PQ9A 1MQTB 5JOXA 5K0UB 1WD3A 1I1EA 2WKKA 3MEPA 1ULGA 5EJ3A 4XFBA 4Y24A 3FFQA 1BJQA 4P9LA 4XJWA 3J8F1 3C3VA 3K51A 3AKQA 2HWF2 3L9JT 2VOWA 2GNTA 1O7FA 2ZMNA 4AGVA 4LBQD 5F6LB 4IXLA 4WBBA 3N7KA 1Y7BA 2PHFA 1REDA 2P3JA 5B2GB 1R1ZA 1AVBA 4WZCA 3UJOA 2AZ5A 4G9SB 3GALA 3WQ1A 2VXRA 1G7YA 2XLFA 3ES1A 3P3NA 2LALA 2RS53 4JDOA 1JH5A 4QHBA 1QOOA 1OPMA 1S0GA 4Q8KA 4XILA 3WP3A 2ZX4A 1GQGA 1TNRA 1FV2A 3WDVA 1WLDA 4E27A 3KMHA 4AEJA 2H6CA 1B35C 1OFNA 1LU1A 4FTEA 4XBLA 3EQEA 2QDNA 5FMOL 4AFCA 3O0WA 3WT3A 3RNSA 1SLAA 2AENA 3ATGA 4R52A 2OZJA 3ZDSA 4FBFA 1BEV1 5C9AC 1LR5A 3MLLA 4R4XA 1AUYA 4Q4Y3 1ZZ9A 3BTAA 1V9U1 4Z82A 5L7OA 4GALA 1PHMA 3GHMA 3POYA 3VL9A 1W0PA 2P2KA 3VHNA 4H7LA 4OHVA 5T52A 1CGPA 5L7OB 3HD8B 1SMVA 2R043 2A70A 3A0KA 5DZEA 1SBDA 4OI0A 2XBO3 1VBE2 3ROUA 1YYNA 3R6SA 1W0OA 1RHI1 5EV7A 2WS92 1R1A1 4Q26A 1G8WA 3DV8A 4PBOA 2BVVA 4CEYA 1IOAA 1QY4A 1AL21 1C8M3 1NQDA 3FLTA 5JIAA 2BWCA 2D40A 1C57A 3FUOA 2A6WA 1O3SA 2RE9A 4FCAA 4CEYB 2R1BA 3O0VA 1O5UA 3B69A 4P9JA 2XJVA 1FNYA 2GMMA 1R082 1VBD1 2VVFA 4WM8A 5FOBB 5FO9B 5JCTA 1QJZA 2R0HA 1NY72 1OOPA 4PLOA 2R32A 3MIBA 1PNGA 4BYYA 1ULEA 4WM8B 2GH8A 3H3UA 3R4SA 1OOPB 1AR73 3T2TA 4AI8A 5JLVA 1J59A 1DGRA 1EAH3 5GZGA 2ZHMA 1IPKA 2ZMLA 2D98A 3RS6A 1PNFA 2XB6C 1REEA 1QJX3 4AQ2A 3UJQA 1PO23 4KH9A 5DZFA 1IS3A 2AR6A 2RMU3 2JD4A 3U0ZA 2D6NA 5KWRA 1BBT1 3TNPB 1VBB2 5FCCA 3RRDA 1MEC3 4B3NA 1Q5OA 2ZX2A 4NPRA 4XJ8A 2ERFA 3H7YA 4S2DA 2RS11 1KD7A 2R6QA 1K5MA 3POSA 4PIXA 4YVSA 4KWLA 3PJYA 2GAUA 1EPZA 1W2UA 1IQAA 1DIWA 4W6YA 1BCXA 1CAXA 4GXLA 4YVSB 4Q4X3 2ZGOA 4LR4A 3D0JA 4YVWC 2CTVA 1WCDJ 1I6XA 2HWE1 3I4IA 1CAXB 1O4TA 3E6CC 1DQ0A 1LECA 5F5QA 3HAGA 2VW1A 2WT0A 4XF1A 2DVBA 4MLOA 1S55A 2GDFA 4FTBA 2R072 2VW2A 2ZGPA 4HK8A 4K21A 1RUE1 2DVGA 1LHNA 2DCKA 4ISRA 1UPSA 3ZN4A 1ZZCA 4GH4C 2V5YA 4PCRA 4O9EA 2GC1A 3ZYPA 1PK6A 4COYA 2WQ4A 1ASJ3 4BCUA 4DXZA 1AYM2 1PM7A 5IUQA 2DFCA 2GNMA 5KHHA 4F83A 3I54A 3IDCB 1RUI3 3CF6E 1L3JA 1NOVA 1DBNA 2Q4SA 1RUJ2 1WMEA 1QDOA 1PGW1 3VHRA 4RFT0 5IK8A 4B4QA 2YGLA 4FPOB 1AJOA 1PGL2 2CAUA 1VBC3 1DYPA 4R4ZA 2XUMA 2WT2A 5I0UA 2I74A 3BPZA 3RDIA 3ZMNA 1MR5A 2D93A 4JDNA 3ZYIB 5LK7B 2W0XA 2ET1A 4IEWA 1TQ5A 3R0RA 2WQZC 1H9PA 4OHZA 1FPN3 2WNUC 1KS4A 1YNAA 2FHRA 4NWWA 1QWRA 1JW6A 4IV3A 5FFOC 2B8MA 2DUOA 5C33A 3OBTA 2XHKA 2HWC1 1WGPA 1FMD1 4NOTA 3MFCA 4KGGA 1ZM1A 2OA2A 1AJKA 1H8TB 3MLKA 3VGIA 3HIFA 4IV3B 3NWKA 2VMHA 1W6QB 3T1MA 4FPEA 2PHLA 4QQ2A 3MDPA 1TNFA 2GMEA 3B93A 2HWB1 4XIKA 4COZA 1BKZA 4EV0A 4Q0QA 1O4ZA 3ZXFA 5C8WA 4Y1XA 2ARXA 1SLBA 2E63A 3TAYA 4JAAA 4R9DA 5CU1A 1OI6A 2ZABA 1UX6A 2H6BA 1ZBE2 4YFZA 3HT2A 5CG8A 1WBFA 2I2SA 5JVVA 2CNAA 1OHFA 1K5MC 2DWRA 4ATFA 1QJY3 1JTZX 4AEKA 3WY6A 2ET7A 4S2HA 3VV1A 1H2NA 2DVFA 3CJIC 4OHWA 3UL2A 4CEWA 1SEFA 3ZN6A 1UIKA 1VAKA 1ZZ6A 4YM2A 5I8SA 4FOVA 4K1ZA 2VOVA 3M70A 4YGEA 4DNYA 3JQWA 4CEWB 4WVMA 4LBMA 4N43C 3SH3A 2QUOA 2O1QA 1NXD1 3KM5A 2WSVA 1RTVA 3AZXA 3AKSA 4XJZA 3ZXGA 1QOSA 5A33A 4P9GA 5EFUA 3JZVA 1QU0A 2XGXA 4XTMA 4W6WA 2WC2A 1GNHA 1C8M2 1ZNPA 1RUC2 1HRV1 4JGYA 4M3CF 4HT1T 2R1DA 4DS0A 1PK6C 1PVC3 2VGDA 2ZX1A 4RS5A 3ZXDA 4CDWA 1UD1A 2RS33 4Y1ZA 3SCHA 4HBNA 2E6VA 3TN92 3LB9A 2RR13 3PTYA 4HKWA 4AVAA 1C28A 4PDWA 4QQLA 4PLNA 3H1MA 4Y1UA 4GWMA 4N9HA 4YZ3A 4RS5B 1LOBA 4XJ9A 4CDWB 5AC93 4YM0A 1ZBA1 4LULA 3ZXLA 1J3PA 1YLLA 5DDJ3 1XU2A 1AR72 2ZGNA 4L2NA 3VBHA 2D6MA 2VPVA 3TOJA 1AR93 1VJ2A 3B7MA 4KU7A 3NV3A 2IXCA 1YFUA 2HWD1 5BNNA 1QJU1 5LRSA 3VBHB 1DQ4A 3EJKA 3V0AB 3TB0A 3RI9A 5GLUA 2DU1A 1Q8PA 1V6MA 2PLV2 4Q4V2 4QM9A 1YFWA 4LA2A 3RI8A 3VZOA 2EVXA 1CJDA 2SBAA 4XBQA 2A5ZA 1C1FA 4PF5A 3OGJA 3CO2A 3JD71 4LBKA 3AK0A 3CLPA 2HWF3 1XYNA 4M01A 3RYPA 1ZYBA 2OIIA 4WM7B 3MFAA 4LLOA 1CPNA 4X8NA 2KXLA 4C1WA 2XLGA 5T5PA 4A2UA 4AFAA 2JJ6A 1F8VA 1OSGA 3PVEA 2A71A 3VBUA 1TEIA 1LOCA 2IXJA 4AG4A 1NYWA 4MVTA 5LEKA 2YC0A 3NL1A 1J58A 1N3QA 3FLPA 3H50A 1JHNA 4E4SA 2PHTA 1CD3G 1WCKA 4HK9A 3WW1A 3PMSA 2HYKA 1HRI1 2VNGA 1BK1A 4RHV1 2QCSB 2RM23 2VUJA 3AJZA 3AXDA 5D8AA 2EXHA 4ES8A 2AYHA 5JZGC 1A8DA 2NP0A 4HSJA 3DUIA 1EV11 1GLHA 1YI7A 4I3PA 5CAZA 1DU3D 1GBGA 1QNYA 3S7IA 4ATEA 3VKFC 3EO6A 4FOYA 4QX5A 2JG8A 3O0XA 3IM0A 5EXOA 4EN6B 3N7JA 4IQPA 4FSJA 1AR63 2Z42A 3RPQA 2AREA 2IXHA 1PO11 1VAVA 1POV1 2OPKA 3D0SA 3NAPA 4F3JA 1AR81 4Q29A 3EXUA 2PHUA 3AKPA 3LWCA 3POWA 1BEV2 4JGYC 3SCGA 2XJQA 1CAUA 1HX6A 3FUQA 1VBE3 3X29B 1FI2A 1FPN2 2WS93 2VULA 3NAPB 1R093 1RUNA 4AHWA 2LTNA 1ULDA 4PDWC 1JYCA 1ULFA 2CYFA 3WD5A 2XVLA 1CAUB 4BMEA 2NN8A 1HLCA 2Q1MA 1UIJA 4PLMA 5HBAA 1ND2C 3GZTB 5KBFA 4YW3A 4CYDA 1NCRC 1CONA 3KD4A 2VU9A 5EYXA 5DG1A 3B9IA 1HV0A 4XBNA 3I59A 2WZR1 5FQ0A 1ZX5A 3THTA 1W6PA 1R083 4RA0A 3MIGA 1RJ8A 4P5HA 2KA3A 2P34A 5BNNC 4CDXA 2YHJA 5FQ0B 5KXEA 3AX4A 4LBLA 4IEZA 4WVZA 1AL22 1HXS1 2BQPA 3QD6A 1QNWA 4AHZA 4QQHA 2UURA 5CG9A 2ZPXA 4Z8BA 4XHBA 3JU9A 1XQNA 5DXDA 1CVNA 5J09A 3SCFA 4QPGC 2G4IA 1NCQA 3E5XA 2PA7A 5BY5A 3CU7A 3VUOA 4F7ZA 5FPZA 4DY3A 4QT6A 1F5JA 1VBB3 4L9BA 5K8SA 4HVRA 4FO9A 1B35B 1NG0A 1WW5A 5E1RA 3QOPA 1D0HA 2GN7A 2R041 4B8EA 4I0WB 2X5IA 3RYKA 1LOGA 1RVF2 4XF0A 3VBUC 3ZYJB 3MYXA 2GC0A 5C9AB 3ZIXA 3O7OA 2VMIA 2ZOEB 1S0BA 4FPLA 1BBT2 1CAVA 2X5IB 1LHUA 1O3TA 1APNA 1H4HA 2PHXA 2RS12 3IDBB 4CDUA 4XFHA 4CZSA 1QKQA 1SLIA 3B5LB 4SBVA 3LZZA 5D8AC 2RR12 5C8CA 1DDLA 4PJYA 4X8PA 3MI8A 2R073 1D4M1 4JVAA 1W6OA 3KCYA 2JECA 3ZFFC 2UY8A 4Q0VA 2HWE2 4D69A 4BLJA 2JG8C 3FE5A 1DQ6A 1AYN1 1V70A 1YIFA 3M3OA 5DDJ2 1HW5A 1AYM3 3ACLA 3E6DA 1LOAA 1PMIA 1AR92 4GKYA 3S0MA 1SLCA 3Q9OA 2CGPA 1TME1 4C0HA 4XF9A 4K6BA 1RUJ3 3VKLA 4RSUA 5FO7B 1QJX1 3QACA 5I8YA 5CNAA 3M1HA 5C6CA 4I01A 4COWA 1MEC1 5EYYA 4XXPA 4MSVA 1G9BA 1KS5A 3IMNA 1W6NA 4KG0A 5I0SA 2D5HA 4AK3A 4AFDA 1I3HA 4U2AA 1UL9A 1C4RA 5JDBA 1RUD1 5FBZA 3ST7A 3M2MA 3I8TA 1W6NB 5GJ6A 1IS5A 4AI1A 3RWNA 1UZYA 4Q4X1 4Q0PA 3ENRA 1MZFA 2ARBA 2G9FA 1RUF3 2XLAA 4HKOA 2OYZA 4CDXC 2DUPA 1RINA 2TNFA 3M3QA 1HV1A 3MIEA 3SXWA 3KT1A 4JC1A 4DMIA 1GYKA 2ZGSA 2XKOA 3GF6A 4KU8A 4YVWA 1CPMA 3VLBB 2XWJB 2AUYA 3LSDA 1XXNA 4I09A 3WR0A 1H1IA 4XIOA 2W52A 4A7YA 4BMBA 4NHLA 4IV1C 1NCQC 4YVWB 2GALA 2XVGA 4R9BA 2RM22 2A6ZA 3BU7A 2PQQA 1ZBE3 4GB31 1UW8A 1Q8QA 3MGUA 1KJLA 2R30A 1ENQA 2ZGKA 4RQPC 2CAVA 3HBZA 2EXKA 4K3UA 4QU2A 4IEUA 3W59A 2HWB2 2MEV2 2FZ2A 1RB8G 4GH4A 2JG9A 3ILFA 4XZPA 2X5IC 1AR62 1Z7S3 3PLQA 1KITA 1DF0A 3NO8A 4NHKA 4AQ6A 3FHIB 3WUDA 4D7TA 4LBJA 4GH4B 3WINE 4AQSA 1D4VB 4KBBA 1A8MA 2C9AA 3EHKA 2PAMA 1G9DA 3DL3A 2BBVA 3AZZA 4URTA 3ILRA 4CDUC 2CY6A 3D82A 4BE3A 2XKPA 1WA4A 2YGMA 3B00A 4L97A 2NLRA 4PBPA 1BMV2 4UW3A 3NV4A 3KZ4C 5KHJA 1R092 5C8CC 1OKQA 3DF0A 3AKRA 2Y0OA 2DVDA 4YM1A 3ZXAC 5J48A 1DFQA 2ZHKA 1XYOA 1RUC3 1FOD2 3WDWA 1VRH1 2CGOA 3ETQA 4LO7A 2WNUA 4XE9A 5FLJA 3TN93 4MH0E 2P3KA 3CJXA 2UWBA 2GU9A 4FQ4A 3WUCA 2Z79A 4PIYA 2WNUB 3RJ2X 2LUWA 3FWEA 1N3PA 4YW4A 1QXPA 5JR7B 4I0AA 4HANA 1OA4A 1HRV2 2UWAA 1IS4A 1N1VA 4Y1YA 4FXKB 4YZ2A 1RUG3 2BYVE 3H8UA 5A3MA 1N1SA 4WVVA 1QQP2 4K8FA 1WD4A 5GZEA 3WHUA 1O3RA 1WMDA 2ZACA 2RHPA 3D4KA 4KWKA 1ZBA2 3H7JA 3MLJA 2PLV3 4Q4V3 3VZMA 4P9IA 2TBVA 2IWGB 5AVPA 3WVJA 3OBRA 4XPVA 2SLIA 4XDQA 5JSOA 4BH9A 3OY8A 3I2DA 2HWD2 1UPIA 2UY9A 5AVAA 3S7EA 3WW4A 1F2NA 3CJIA 3ZO0B 3V64A 2VQAA 2VY0A 1K5MB 4DINB 2LM3A 4MGZE 3OY8B 5H9SA 4DZGA 1YXWA 1SCSA 4AI0A 3QCWA 1D2QA 3W9AA 4LUKA 3CJIB 4IEVA 1MS5A 2UYBA 4N53C 4N43A 2BNNA 1V6NA 3N4MA 2F6BA 1TMF2 4XETA 2RS31 3JD72 3AYCA 2ZX3A 4N43B 4RR3C 1YJKA 4IEQA 3IKWA 3WW2A 3MW4A 1YFXA 4META 5F6KA 3M4FA 4AW7A 4YW5A 1JUHA 4R9CA 4EN7B 2DURA 1GR3A 2JG9C 3PHMA 4YG6A 1N1TA 1DGWA 2EXIA 1DGRN 1DGLA 2A73B 1F9KA 4NVPA 1VAMA 1PK6B 1AX0A 1ENRA 3JBG2 2B42B 1RMU1 2R061 2VVDA 4Z07A 1WLCA 4FPHA 4JGZA 1D2SA 4DPNA 1HRI2 3NW4A 1HIXA 4DFSA 2QE3A 4RHV2 4YNIA 5KXCA 1V6LA 3WZ1A 4BWOA 1WLTA 3WP4A 1DQ5A 4GMP0 2PTMA 2ETEA 4A7ZA 1UU6A 3WDUA 1LJ7A 3PJQA 1EV12 4FT8A 1BEV3 3ZSKA 5KHKA 2ZZJA 4IEOA 1GNZA 1ALYA 1BYHA 3MF9A 1CN1A 3FBYA 4LE3A 3V56A 1AXZA 3VZLA 4AI2A 2DF7A 3J26N 4Y20A 2O8OA 4U36A 1RUF2 2DCJA 1C1LA 3CL1A 3OD4A 4AXOA 3L2HA 4Y20B 1AR82 5T5JA 1OQDA 4E2SA 3SISA 4G4FA 4I02A 4Q4W1 2BNOA 2EIGA 2ZKLA 5A3LA 1RHI3 3TBDA 4OHXA 1QDCA 1R1A3 3M3IA 2W08A 1CESA 5FLHA 1AL23 1S0FA 2ZHLA 2Y38A 1MS4A 1RITA 3WP6A 3VN4A 4CP0A 1ZZ7A 4YM3A 3MF6A 2WZR2 3N7LA 3ZSJA 1VBD3 4Y22A 5CBLA 2D6KA 3FBMA 4XYXA 1J3QA 5CFDA 3WG4A 1KDKA 2HKXA 4QPIA 2RJKA 4EWAA 3ZFEA 2YY1A