5FV3A

Crystal structure of human jarid1b construct c2 in complex with n- oxalylglycine.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
467
structure length
455
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
total genus 133
structure length 455
sequence length 467
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fv3A01
5FXVA 3AL5A 2OX0A 4CCJA 2XMLA 2YBPA 3N9PA 5A7WB 2Q8CA 5FYIA 5FJHA 4CUGA 5F32A 5FYSA 5A80A 3U78A 5FYTA 4GD4A 3AVSA 4QWNA 5A7PA 4XDOA 3DXTA 2Q8DA 4D6RA 5FZDA 5F5IA 3N9QA 5F3EA 5FZCA 5A1FA 3N9NA 4Y3OA 5FZBA 2OS2A 5FXZA 4URAA 4UF0A 2P5BA 5IVCA 5E6HA 4CCOA 4GJZA 5FPUA 5ANQA 5FJKA 3U4SA 5FPAA 4V2WA 5A3PA 5FZOB 5FZFA 3ZLIA 5FZ8A 5IW0A 5FY9A 5FZ1A 2XUEA 5F37A 3PDQA 5FUPA 5A7SA 4EZ4A 4EYUA 4AAPA 5LW9A 5IVJA 4CCNA 5FZ9A 4BXFA 4CSWA 2YPDA 5F2SA 5FBJA 4E4HA 5FZMA 2WWJA 5A7WA 5FYUA 5FYVA 2GP3A 5FZEA 5LY2A 3K2OA 5A1LA 2XDVA 3PUSA 3N9LA 5F3GA 2PXJA 5ISLA 5FZ7A 5FWJA 5FXWA 3KV9A 4NUBA 2W2IA 3DXUA 5IVBA 4QXBA 4CCMA 4CCLA 4XDPA 5KR7A 5FY5A 5FUNA 3PURA 5FYCA 5FZOA 5FYMA 4GAZA 5F5AA 4QXHA 3RVHA 5A3NA 5LY1A 5A7QA 5IVEA 5FYZA 5A7NA 5FY7A 5FP7A 5FY4A 4LIUA 3LDBA 3K3OA 3PU8A 5FZ6A 4LIVA 5F2WA 2OQ7A 5FYBA 5K4LA 4CCKA 2XXZA 4IGQA 5CEHA 4BU2A 3PTRB 3N9OA 5FZAA 4D6QA 4DO0A 2OT7A 5IVYA 2Q8EA 4LXLA 4BISA 5FY8A 5IVFA 3KV4A 3KVBA 3PUAA 4IGOA 5F3IA 5FZHA 4C8DA 2OQ6A 5F5CA 3K3NA 5FY0A 4HOOA 5FYHA 5FP8A 3OPTA 3KV5A 4QU1A 2VD7A 5FP3A 4Y33A 5A3WA 4EZHA 5FP9A 2WWUA 5LWBA 4QX7A 4LITA 5IWFA 5FWEA 5FPLA 5F3CA 4IGPA 4Y4RA 5FYYA 5FP4A 4HONA 3PUQA 5FZGA 3NJYA 2YU1A 4DIQA 4TN7A 4QX8A 3OPWA 3AVRA 5FZKA 3LD8A 4V2VA 3ZPOA 3AL6A 2GP5A 3KV6A 5F39A 5FZIA 4GJYA 3N9MA 5FPVA 3UYJA 2YBKA 4UF0B 5A7OA 2YBSA 2YU2A 4ASKA 4QXCA 5FY1A 5A3TA 5FV3A 5FZ0A 4AI9A 5FZLA 3KVAA 5FZ4A 1VRBA 5IVVA 5FZ3A 4D6SA 5FPBA 5FXXA 3PU3A
chains in the Genus database with same CATH superfamily
1K42A 1UOGA 2D7FA 4CCJA 3KCCA 1JW6A 3ECQA 2MEV2 3U1XA 1DGRA 1PX4A 2Q1MA 3DGTA 3DYOA 3KQRA 4XF3A 5FMBA 1O3RA 1YQCA 3A22A 4FBFA 4EWDA 1E5HA 2XLGA 3MLLA 4XC9A 3H42B 1JOBA 4G4FA 4JGYB 3WT3A 4D7SA 1R1A3 3DXTA 2HBUA 4LBKA 3WP3A 1W99A 2A5ZA 2WNEA 3CEWA 3I2DA 4M4PA 4D6RA 5F5IA 1XNKA 2XL7A 5F3EA 4PBOA 5IATA 3VDDC 3N9NA 1G86A 2B46X 4A7YA 1MPXA 4AZZA 4RS5C 4JC1A 4EN0A 4GJZA 4CDQA 4IETA 1VBE1 2IFRA 3NNLA 3POBA 3OYWB 3I3BA 1SLIA 4DS0A 1HW5A 2EF6A 2RMU3 5A3PA 2BOIA 4OZOA 4W6XA 1U5IA 4LKEA 4KL1A 3WOGA 2VOVA 5BNPA 4W6WA 3IZOA 1US3A 2DCKA 2UY8A 4AHYA 3LPGA 4P14A 4D94A 4NOTA 3PL0A 3T2PA 5FZMA 1HN1A 2G9GA 1TZOA 4LBMA 4TYSA 4XABA 5J7MA 3MW2A 2ZMKA 3VKFC 3KMHA 1HJGA 2KM2A 5C8CB 1HB2A 4QD2A 4QX1A 4FQ4A 3ZYIB 3KV9A 1X50A 1S0EA 3AFKA 5DDJ3 4TSVA 4YZ2A 4LMFA 4XF4A 3RG0A 1TMF3 2QQJA 1E5RA 4EN6B 1WCUA 2ORXA 4K9SA 1YIPA 3R05A 3MGUA 4L99A 4MHRA 2P3IA 2JDHA 4N53A 4FPOB 3T3YA 1UU6A 5L7OB 2ZGLA 2G9ZA 5LBBA 1VMJA 5FFOC 3T1MA 3VBSC 3LDBA 4E2SA 4IUGA 5BNOC 1WUVA 4OHZA 2XXZA 1C3HA 4ZXKA 4QKBA 3BU0A 4Q0UA 1W28A 3B01A 2DUPA 3VBHB 3WP4A 1OA3A 2ATFA 2BJSA 4Q1PA 1NCRC 1U12A 2FDJA 4X6QB 5JI9A 2JX9A 2BWCA 4K40A 5ANNA 2IFWA 4AI0A 4BZ4A 1HJFA 1ASJ1 1DQ1A 4YW7A 2J1VA 2VZQA 3ILNA 3OUIA 5C7GA 3T2OA 4QB2A 2WA4A 2BPA2 1RUJ1 3WG2A 5JI7A 1FV3A 2EXHA 1CAWB 3ZDVA 3CQOA 1LHVA 2WZR2 2XKOA 2CDPA 1V9U3 3AXDA 5FYYA 1HRI2 2JDKA 2Y0OA 5L36A 3RZGA 1MS1A 2CTVA 4XQWA 4YVSC 3U11A 2VXJA 3VL8A 2D97A 4OI0A 3SMHA 1AR92 3Q8FA 4GH4B 5J48A 1STMA 2YZ4A 5D8AC 3PTYA 4B29A 1WBLA 3Q8BA 4Z1VA 2ZAAA 4XBLA 1B35B 3WHTA 1C8M3 2XHNA 1QQP3 5KXEA 3PHMA 1R1A1 2XHKA 5A3UA 2WNVB 4P9XA 4IV1A 1ND2B 2VMIA 5J36A 5C33A 2VG9A 1LGBA 4FQZA 5FQ0B 2HEYF 1W6MA 2LW8A 1GYKA 2WZEA 3AP9A 1HRV3 3J8F1 3MYXA 4FPCA 4NHKA 4YG3A 5IK4A 4JZRA 1JZ2A 1VBC3 1PK6A 2J1UA 2RE9A 2QDRA 4CUGA 1RIRA 2RMU1 3DL3A 5A80A 3NL1A 5CVRA 3KS7A 5A33B 5AC91 2WZPP 2YC0A 4Q4X2 4XDOA 4ZHNA 4RD7A 1L7LA 4LHSA 3UT0A 4WVWA 5KXCA 1NT0A 3SNMA 2GH8A 3OEAA 1GNHA 2QTWB 3KCXA 5JAXA 4CDWC 1RMU1 4URAA 4HFSA 1OD5A 1MS8A 2Y38A 1OPOA 4M00A 4AXOA 5A6YA 3ACIA 3PDQA 5I0SA 2FMYA 5LEKA 1RUE3 2WFPA 4HKWA 1H8VA 5FREA 2JG8B 5C5TA 1IS4A 1ZRDA 4KH9A 1UX6A 1Q3EA 4QDQA 5FYUA 4COZA 4QX2A 1OFNA 3MF6A 4KMQA 2ORZA 2WQ4A 4Z82A 5DAXA 5F3GA 3SISA 3O1OA 3E97A 3AB0A 3RFRA 4N7IA 4AE2A 5FKBA 4XZUG 4YZ3A 3WDYA 1OMIA 1BHGA 4FPKA 1MVEA 5A3MA 3S57A 2QDNA 4IXLA 1OOPC 4LK7A 3JBG3 5ABJB 2JE9A 5C9AB 5JUVA 1QU0A 2IXJA 1D0HA 1OC1A 2EIEA 1RITA 3N3HA 3TYJA 4ATEA 3DPRC 3OD0A 3ZYHA 4LO8A 1PGSA 5FY4A 3G7DA 4KGQA 3PU8A 1POV3 1OQ1A 1SFYA 2DV9A 2W94A 2Y6FA 4S2DA 1YO8A 3LEMA 5K4LA 3SXWA 4LBOA 4COUA 3VD4A 4D6QA 2RV9A 2OT7A 2MEV3 2D40A 3POSA 4H2AA 3UJOA 4OQ9A 4WVVA 1ND3A 3PUAA 1GP5A 4QDRA 3VKMA 2FDKA 5JZGB 4CDXA 3K3NA 2ZEWA 4J25A 1GNYA 4MUVA 4RFT0 5IFTA 1GOGA 3CZJA 1FMD1 3FC0A 3LIGA 3SLIA 4KI5M 3K77A 1NQJA 4QX7A 1T6GC 1J84A 1TVGA 2YXSA 2O14A 4MO3M 5IWFA 3HBKA 3WUCA 1RXGA 3PUQA 1O91A 3ZYRA 2XJPA 1QQP1 4W6YA 2JENA 1UPSA 2EXKA 1DQ6A 3KGZA 4Y22B 2DCZA 3AVRA 4D3WA 4IQPA 2FDGA 1A6CA 3AL6A 3ZPOA 4CUCA 2GH2A 2WABA 1HRV1 2YY1A 1Q8OA 3MLJA 5EZWA 4YW4A 3ZYGA 2W1WA 1QXRA 3UESA 3VL9A 4BQYA 4DOUA 1VBC1 1ZBE2 1XNCA 2PHDA 1X82A 3IIAA 3V0AB 2WN3A 2X5IA 3EQEA 5KXBA 2DFCA 1JUHA 3PJYA 2PFWA 5IVVA 3VKOA 2E7AA 1WD4A 4YPJA 2J1TA 3ENRA 1QNWA 4FPHA 3KT4A 3VBFC 3V0BA 5FRAA 1LAJA 3LOBA 3WCSA 4G9SB 3IDCB 1UKRA 4E4ZA 4DEQA 5A7WB 4YM0A 4AVCA 1FOD1 5FYIA 2IXLA 5F32A 1WCKA 3AM2A 1RUE1 3VBUB 1JXNA 1NLSA 4C1WA 1XE7A 2W52A 3M70A 2TBVA 2OIIA 5JSPA 4LUMA 1MQTC 1YI7A 3MDPA 4CEYA 4H7LA 2ZX2A 3I2GA 4DINB 4K8FA 5DAVA 3OBRA 2NN8A 2QUOA 3DECA 1RUD3 2GU9A 3CJXA 4MGIE 4OZXA 3VBOB 5CISA 5FZOB 2ADEA 3VZJA 3PJQA 3OBAA 1MS3A 5HBAA 1LHNA 4NJ4A 2RDRA 2D44A 3GCXA 4C1XA 2F17A 4WBBA 1YQ5A 2LALA 1JYWA 4N8MA 2JDNA 3BIEA 1XBFA 2WWJA 3B00A 1TNRA 3WNMA 2HWE2 2WZR3 1H8TA 2XDVA 2XONA 1HRI3 4PDWA 3AKPA 4P9JA 2XH6A 1CX4A 1H6YA 3MHZA 4CUAA 3B5LB 2W91A 1HV1A 2D5FA 1POV1 1V6KA 2GC3A 1ZZ7A 5HXVA 1AR93 3UETA 1LKNA 4E27A 1XQNA 1UU5A 1XJAA 3OD4A 4P00B 4DFSA 1UY1A 3SHRA 2MEV1 1UZVA 3LA3A 2E33A 1GANA 2VTXJ 1WLCA 3WHUA 1S1AA 2YUEA 3GHNA 4JKLA 4CDUA 5C71A 2ARAA 2G9FA 1W2AX 3LFMA 4FFHA 3KF5A 4HSJA 4CP9A 5A6ZA 5J37A 5EXOA 5FZ6A 4DUVA 3B69A 3PNAA 4UFJA 2E7TA 1DBNA 2QQUA 4MSVA 3RZZA 4KNCA 4AEMA 2WT2A 3ZMOA 5GKAC 5K0UA 1S0JA 3HT1A 5AFBA 3ORJA 3BPSA 1RUF2 5IVFA 3NV2A 4MGZE 5EJ1B 5F3IA 4QGNA 3VZNA 2C0ZA 2BOJA 4HOOA 4YSFA 5DG2A 4QX5A 3H0OA 4M3CA 2FDHA 1LESA 3B9IA 3VBRB 1F31A 2VECA 4WZCA 4XAEA 2H0VA 5DQ0A 1YIFA 2KXLA 5DUXA 3SH4A 2J1AA 2XKPA 3H8RA 4LITA 2A6VA 4KGGA 1H30A 1XU2A 4M3CF 4UFMA 3VBRA 5KHIA 4CTEA 5F1RA 3GNEA 4GKXA 4P08A 4QKDA 5F6KA 4XFFA 2OUJA 3JB4C 5FZKA 3WINE 3I2IA 3LGRA 4W50A 3PVEA 1VE0A 1PNGA 2NLRA 5GLWA 3GALA 4YVWA 3RMXA 1CGPA 1GU3A 1ZX5A 4ASKA 3IPVA 4S2FA 3OOXA 4YW6A 4BXSV 5DXDA 3WF0A 1UW8A 3ES1A 2C24A 2DTYA 1EYBA 4PJYA 2PQQA 1X9PA 3D3AA 1G6NA 1UL9A 3CIHA 3LFIA 4N9IA 2JIGA 2QVSB 4KWKA 5FXXA 3WDWA 3FUOA 2XVGA 3DEMA 1IG0A 5FXVA 2OX0A 4UFHA 3DKWA 1LOEA 1GQPA 1JS9A 2BTVC 1OLRA 2XJSA 3LEKA 3O14A 4QM8A 1W9WA 1WW4A 4YYOA 2Q8CA 4OHVA 2Y0IA 1S0IA 3TRSB 4CU6A 3GCWA 5A7PA 1CZTA 1OPMA 3NAPB 1ODMA 2P3YA 4FP3A 4R9AA 1G8WA 1ZVFA 3WZ1A 1XNAA 3N4MA 1EV13 4A45A 4PCRA 4IEOA 2VZTA 2DUQA 1UIJA 2WZR1 3WVJA 3D6EA 1URXA 1I3HA 1HRI1 1SLTA 1TME3 4V2WA 4E2QA 4M0NA 1NYWA 4ISRA 3OCPA 1IS5A 2VJXA 4PF1A 4RQPC 5BNNC 4IE0A 1XSRA 2WS92 3I7DA 1GSLA 2W1QA 3ROUA 4E8DA 4OQ8A 3NWKA 3N36A 1AR91 2OA2A 5F9TA 4ZKTB 5IVJA 5KHKA 5DUUA 3U4XA 2WR9A 2BVVA 3VHNA 4XF0A 4Y5TA 2R32A 1XOYA 3KQ4B 3M7AA 3TWIA 3VHOA 4KU7A 1XXNA 2FMDA 4CRQA 2PHRA 3QACA 1CAVA 3A0KA 2FD8A 3VN4A 1R082 4FOQA 4K3UA 4WVMB 2WKKA 2WZ8A 4BYYA 1OH4A 1UMIA 4AEDC 4QPIB 2BDRA 4CCMA 1GOFA 2YC4A 3NKTA 1FPN3 2CYFA 4K1YA 3WNKA 4XJ8A 5JPNB 5I0TA 4DMIA 3OGVA 1H9WA 5JDBA 2XJQA 2ZGPA 3V0BB 3HOBA 3MIDA 4WM8C 1QOSA 4YRDA 3SKJE 3MBWA 4Q4X1 1X33A 3CJIC 2Y6LA 3ILRA 3D5OA 5J96B 5JLVA 1R1ZA 1CX1A 2R0HA 2XJTA 2JG9A 2B9VA 1N1SA 4FOYA 1ZRFA 3PTRB 3M3IA 1SLBA 2D3RA 2P37A 5FZAA 3ZYPA 4ARYA 1JYVA 4LE4A 3ZXGA 5SV8A 4QPGC 5C8WA 2Q1ZB 1UKGA 3TEXA 1UZYA 5ACA3 2ZHKA 2WFF2 3IAPA 3RS6A 4CPBA 4LBQD 4FTBA 3RYPA 4LT5A 1A3KA 3OPTA 1SPPA 3GBWA 4QHZA 4W8JA 4AQ2A 3W20A 2CWMA 2LM3A 4MGSA 4N43B 4Y5SA 3SCGA 1HXS3 4LBQB 3QH7A 3ZX7A 5CFCB 3ALQA 2D6NA 4LLFA 1W04A 3T4VA 4LKDA 3AP4A 3LSDA 1W0OA 3J7NA 1S2EA 4NHXA 4AI2A 2YFUA 3FHIB 4JDOA 3VDDA 3AMNA 1NXMA 1RUH2 1JYNA 1K5MB 4RS5A 4XTPA 5BY5A 2AUYA 1VR3A 4MXWA 4EE2A 4HPKA 3SC7X 1CAUB 1W6QA 1YXWA 1SBFA 4H55A 3UYJA 4SBVA 4EJRA 4MGKE 5FY1A 4E4DX 1EY2A 4XXAA 1CIYA 4RHV2 4QGMA 3LSEA 1VBD2 3AMPA 3Q8EA 1H1AA 2UURA 3I97A 4ORFA 3PU3A 1PVC2 3GZEA 1RB8G 4P02B 4E2GA 4LHNA 1N3OA 3HNYM 4QPYA 3HT2A 1TME1 2F4PA 3CHXA 3U78A 4XILA 3VD3A 4Y20A 3BTYA 3N7JA 2W46A 1VAKA 4R52A 1ENQA 1JH5A 2DBIA 2VOWA 4HN0A 2PN5A 2VAUA 3B93A 2Z42A 5FMOS 4GWNA 4XBNA 3WW1A 4JRLA 1COV3 2DCJA 2DURA 1WMEA 1K45A 3HPNA 2VC9A 3ZXDA 3J26N 1RUF3 5C3QA 5FZ8A 3VBSA 5BNOA 3RDIA 1V70A 3DF0A 1W8OA 4AAPA 2ZKNA 2ZX0A 3WF2A 4G3YC 5FOJB 2G4IA 2VW2A 1UO9A 3J7HA 1VBA3 1FPN1 2WQZC 5FPXA 1LB2A 1NCRA 4O65A 1CZSA 5LRRA 5FYVA 2BGOA 1AR82 1RGSA 1ZBE1 2E9QA 2PHXA 1AYN2 4ZS3A 3VB9A 2PLV3 1Y9MA 5DABA 4A3ZA 1CAXA 4AWDA 3WNXA 2WNUC 5ISLA 3R4SA 1KD7A 2W2IA 3KCYA 4CCCA 2NP0A 2CGPA 5HV4A 2DU1A 3FX3A 1LOGA 1ZZ8A 5L9RA 4QHOA 3R4UA 4IDZA 4NPMA 5CG9A 2BQPA 1G9AA 1VIWB 5A3NA 1Z0HA 1NCQB 3VV1A 4QXHA 4BIFA 4YVSA 4LTAA 2RJKA 2P6HA 1C57A 5CKNA 3RZJA 4CXXA 2OZJA 3E5QA 5D8AA 5BNQA 2HYKA 4BA6A 1N3PA 3MPPG 1Q8VA 1DQ0A 1SHWB 3U10A 1PO12 3N9OA 1VBE3 2VBBA 5EYXA 1W9TA 4COWA 2HYXA 3SH5A 3KV4A 4RR3B 3EXUA 5EIYB 4NRMA 1SEFA 3USUB 4EWAA 1QJY2 3UNPA 2H0BA 1QH7A 3Q9OA 3IDBB 2GC0A 3KHCA 3EJKA 1JN2P 1GZWA 4MOAA 1SDDB 3FZ3A 1W9FA 1AF9A 1QF3A 2HWE1 2VH9A 2R6QA 1RYYA 2WNOA 1VP6A 3DYPA 5G05L 1IPKA 2HBTA 5F3CA 2RR12 3JQWA 4CA9A 1O8SA 1RXFA 2B4KA 4WM7B 5CAZA 4YW2A 4CDWA 3EMRA 3H7JA 2XOMA 1PZ8A 1JU4A 3WNPA 1BLZA 1QWRA 2W1SA 1YQ8A 1ST8A 4AI1A 4PBPA 4Q4W2 4NIGA 4I3GA 3WSOA 4UYBA 1U0AA 1SCRA 3ZFGC 5A6QA 5AFEA 1J3PA 2G19A 4AI9A 1IS6A 1H0BA 5FR3A 5FK8A 3ZOIA 4I01A 2D5HA 4YW1A 1OBNA 2TNFA 1YQ6A 4OULA 2GNMA 1S2BA 3HNBM 3B3QE 1ULPA 2C9KA 2XMLA 1UZWA 4FP2A 5FK7A 1RUF1 4JQTA 3K48A 5C4WB 2JKXA 3WNNA 4CPBD 1KITA 1XYOA 3AVSA 4LBNA 1IPJA 2OPWA 3AXEA 2VR4A 3MFCA 1RUJ3 1AR72 1OOPA 1IKPA 1LEDA 3APBA 4EN9B 1KS4A 5E88A 1GQHA 4HSLA 5FPUA 3DPRA 3RPQA 4FXGB 5FZFA 1G9DA 1E57A 2VUCA 3KSCA 4B1LA 4CVUA 2XUEA 2B8MA 1W6NB 1GNZA 1XYNA 1BEV2 3C7GA 1HQLA 3JXSA 3Q8AA 4RGKA 3MEPA 5F7UA 1F9KA 2X8KA 3OPZA 3KWVA 4BOWA 2OW4A 3WD5A 4DUWA 4PIYA 1NZCA 3ZXAC 1CD3G 1QXJA 3JD73 3WXPA 1QXPA 1W6OB 4NAMA 4DEVA 2VOKA 1QOOA 4ASMB 1UF2C 2XBO2 4FCAA 3ZM8A 5FWJA 3M3CA 5CYYA 2QBXA 4ZONA 4AOCA 2WAOA 3DXUA 2XR4A 1RUH3 2ZX4A 3OY8A 1JUIA 3J8F3 4TXWA 1PGW2 3ZXJA 1UYXA 1X9TA 2ZGRA 4J1XA 3NQHA 4YGCA 1UNBA 5AC93 4Z92B 3O1UA 2Y6KA 1NE6A 4CP2A 4CP0A 2A6XA 1V00A 5IAVA 4XUQA 1JTZX 1AJOA 5FP7A 5T55A 1UXZA 1LTEA 4HVRA 4META 4XACA 5DAQA 4EV0A 4F7ZA 1RMU3 5A6XA 1W8NA 5KC5A 4MX3A 2GNBA 2BVBA 1KRIA 2XL9A 1UXXX 4D7TA 3T2TA 4KBZA 2D6KA 3JQXA 1POV0 4L9BA 4IEXA 1SBEA 3ZFEB 3WDXA 3VHRA 4E8CA 1UX7A 2WS91 2X53S 3NW4A 4OYUA 1BK0A 2VE1A 3FLPA 1J1TA 2WT1A 3I4IA 1LECA 1KJRA 4IL7A 4JGYC 1ENSA 4Y1VA 3B9CA 3UGHA 3VBFA 5CBLA 4Y24A 1JHNA 3S30A 2BW8A 1Y3TA 5FP9A 1DLLA 4K20A 5HCFA 3UGGA 4UBGA 4XF9A 3TBDA 3WQBA 2FCTA 4M4RA 4F8AA 1LULA 3D4KA 1D4M2 2XJRA 1R081 4Y4RA 3MV11 1Y9QA 2Q30A 2YG0A 1W39A 3EO6A 3JZVA 1MQTA 1BCXA 2R30A 4L0PA 4CEWB 1AVBA 2D6MA 2NPIA 3M3EA 5EP9A 1LRHA 3WQ7A 4A7ZA 4JCKA 2VNRA 1CAXB 4I0BA 1HLCA 3GF6A 4TTGA 3OEBA 2E6VA 2HWD2 2VPVA 4RL7A 3SCHA 4P9LA 2YBKA 4XOGA 1PGL1 1CJDA 4YW3A 2X10A 3O7OA 5A32A 1NA1B 4GKYA 3JB8A 2UYAA 3TOJA 5C8CC 5FZ4A 2VZSA 1FI2A 2C5DA 4GQ7A 3S7IA 3M8LA 1DU3D 1QDOA 4BLIA 4D6SA 4BK5A 3HIFA 4YARA 2LUWA 3V64A 1JODA 5I8TA 2Z69A 1B09A 2GMEA 2GSYA 2A6WA 3AX4A 1NG0A 4AHXA 2SBAA 2ZPXA 3LWCA 2UWCA 1OT5A 1RUG3 2WFF1 1KQRA 3VZOA 5L7OC 4FPJA 3R6SA 4NAOA 5APAA 5CFDB 2K0GA 1G9BA 4LO7A 2W5FA 1UYZA 3MO4A 1FMD3 4AR2A 5FZCA 2ZZJA 4BWOA 2VMHA 1OI6A 2J22A 2VMCA 4HVQA 5FXZA 3I59A 2R7EB 3JD71 2IZWA 5DN2A 4XFBA 3VBHC 2Z79A 5KC6A 1CN1A 5B4NA 4ZU5A 4Q29A 1YI9A 4QAWA 1JZ5A 1RUH1 4P9WA 2WIIB 1AJKA 3NV1A 2UY9A 3NNJA 3PIGA 5F2SA 5JIAA 1XC6A 4R9BA 1MVQA 2DDUA 4ONUA 4UBHA 1OLMA 5FDBA 2GP3A 4LORA 2RG4A 4MZUA 1HQNA 3INAA 2PXJA 3ZMNA 4BQWA 5I8SA 3TN92 4JHZA 4RHV1 5L19A 2ZKLA 4IEUA 1VBD1 4IW3A 4JTNA 3WNOA 2JWPA 1YFXA 3OGGA 2MPFA 4FFFA 5FIXA 1GP4A 1LHUA 1PVC1 1LR5A 1JZ7A 4CCLA 1D2SA 4GH4C 4LUKA 2CGOA 4NROA 4PI2A 1H2MA 5T3NA 4XHBA 1FOD3 4YG6A 3D8CA 3FWEA 3ZYFA 1Z7S2 1QJU2 4XXPA 4CZSA 4GMP3 3POIA 4NRPA 1B35C 1ZA4A 3ZIWA 4INDA 4ZU4A 1W6PB 3H3UA 1RUI2 4C0HA 4UXAA 4CCKA 2WNVC 3CF6E 2ENRA 1ND2C 2ES3A 3WF1A 5JXIA 1I9RA 1AX0A 2ARCA 1AL22 2PTMA 1W0PA 2W87A 4IV3B 2JE8A 3OBZA 4FPLA 3CO2A 1GQGA 4UI9L 4AHZA 2QJVA 3KVBA 3OJBA 4M3CE 2VQUA 4IERA 3HN1A 1LOCA 4X6RB 4DZGA 4BH9A 5FP8A 1CJPA 3A23A 1DZQA 5EQUA 1G9FA 3ZXKA 1Y7BA 2VW1A 1DGWA 4J6GA 1AR81 5LWBA 2P2KA 2DVAA 1VMFA 4NIAA 4R8HA 4L11A 4DPNA 3LKJA 1CPMA 2PHUA 2RDNA 1MZ5A 3ZN6A 4BPZA 5C5UA 3D0JA 1M4WA 5CG8A 5C3RA 1W8TA 2JG8C 2R16A 4CP1A 3IWZA 1GLHA 2NM1A 4RQPA 5BNNA 3C7EA 4Q26A 5B4XA 2RS52 5A7OA 4CDQB 3VDAA 1RUG1 2CU5A 2ET1A 2XBO3 5FLJA 1RINA 1US2A 2B7YA 3TEYA 4ISQA 2EXJA 1K3IA 2OVUA 2XQRA 3A0NA 1AL0G 5BNPB 2VQ0A 1QHDA 4LKSA 4COVA 4JGZC 5C70A 2WINB 1PO11 2PMWB 2XVLA 2WYFA 3AL5A 3QD6A 3BCWA 3RYKA 4UFIA 4AHWA 3VUOA 2QZ3A 5ABJC 5C9AC 4MLOA 3AKRA 3HR9A 5H9QA 4AEDA 1JYTA 4N90A 2YGMA 5FYTA 5LASA 1QJY1 1UPIA 2UYBA 4XTMA 2WQ8A 2D6OX 1LOFC 1LOAA 2WO2A 3BN6A 5DUWA 1UQXA 2YC2A 4XF1A 3ZFFC 4HVOA 1DQ5A 1GWMA 1MS4A 3OGSA 5FUIA 5LA9A 2FCVA 3HNMA 4WM8A 3UKTA 4H3WA 3FE5A 4GULA 3BB6A 4PQQA 1RUNA 2F4LA 1UOBA 3AP5A 3CJIA 5LZ6A 4RGGA 5GLTA 2RR11 3E5XA 4OHWA 4N53B 1H6XA 2VOTA 3WUDA 1CVNA 5JZGC 1GP6A 4OUEA 2CGNA 4BHPA 1WLTA 4QHBA 2HWB2 1GMMA 4XMIA 4BQ4A 1DZTA 3ZIXA 1EPWA 2RM22 1W06A 1D4VB 2DF7A 4QPGA 1WLDA 3POEA 4Q4W1 3VKNA 1YCIA 2LRPA 2YPJA 4KWJA 5LY2A 5A1LA 2JDPA 5LBCA 3VDCA 2IXHA 2AREA 3N9LA 4GMP1 3WW2A 4BCUA 1IQAA 1W03A 3O1PA 2XWBB 2FQPA 1HB1A 4LK6A 4MHUA 1JYIA 3VLBB 3HAGA 4AG4A 1GZTA 1KDKA 4S2HA 2EVXA 4ATFA 5GZCA 1QJZA 2KA3A 4XFHA 1APNA 4Q0VA 1PMHX 2BNNA 2YYOA 5FYCA 2WDBA 5T5OA 3MUY1 5LY1A 1FXZA 1O59A 3EBRA 3M2MA 3O1SA 2J1RA 2P17A 1DHKB 1MZFA 3I2KA 3PIJA 1PO22 1RL3A 4XUOA 1AHSA 2VNVA 5M0TA 1OKQA 4YLZA 3TEZA 4QXKA 2GC1A 1W2UA 2EALA 2VM9A 3MICA 1R092 2JKBA 4LA2A 4LXLA 3MIBA 4YNIA 3A21A 3KT7A 1HB3A 3HVDA 4YFZA 2CNAA 4H7MA 5FY0A 2A70A 4R4ZA 5JCTA 4MH0E 3U14A 1BEV1 3VBUC 1KFUL 5F8PA 3FBYA 2A3YA 3J4UH 4FTEA 1PMIA 2ZGTA 4IV1B 4YZ4A 2Y34A 4HANA 2VUDA 4OHXA 1LU2A 2ILMA 1W6MB 5FPZA 4IGPA 3K46A 4NWWA 3VBOC 1C5IA 3UK9A 1AX1A 2XBO1 1PK6B 2BYVE 4XFCA 1W3VA 4HK9A 5KWRA 1JHJA 1VLNA 1S0DA 2QNKA 4SLIA 5BXXA 4CCEA 3VD9A 3CL1A 3E6CC 1N1VA 2D3SA 5KXDA 1T6BX 3RQ0A 4HT1T 4HKLA 3TNQA 3UGFA 1PGW1 5FPVA 4AL9A 1J83A 3POGA 1XNBA 3ZDSA 1C8NA 4YM2A 4Q4X3 2EA7A 4KG0A 1MEC2 1NX9A 2W39A 1QJX2 1UZ0A 2VZRA 4I02A 4XFIA 3CKHA 4DXRA 3I2HA 1F8VA 1CESA 1RUOA 2JDAA 3CU7A 3H3ZA 3S7EA 1PM4A 1CZVA 2WO1A 5E16A 2YBPA 2WNUA 2ZHMA 3PMSA 1Z7S3 3LA2A 2AEZA 2OXBA 4JDNA 4NN0A 5FJHA 4Z8BA 4XAAA 4X8NA 2OZ6A 1DP0A 3E6DA 1RUI3 4IEQA 5FMCA 3VZLA 2F6BA 5D2AA 3RWNA 3OG2A 2NMNA 2VXRA 3N9QA 4NHLA 2WLPA 4OI4A 3FJSA 2D93A 1D0GA 2KD7A 5EJZB 4UF0A 4UW6A 2R062 2Z4FA 3LF7A 4CCOA 5FOBB 5IVCA 3ITQA 1OA4A 3LEIA 3O0VA 4YZ5A 1D4M1 4CXYA 5L9BA 1UY3A 3U37A 3WW4A 3WQ1A 5FZ1A 1KS5A 5F37A 4Q5OA 3DKQA 1WD3A 2CDOA 2JJ6A 3GHMA 4EZ4A 2PQSA 3JCIA 3DYMA 4EYUA 3GZUC 5LW9A 4F83A 2A3WA 5FZ9A 2W08A 3I3MA 4LR4A 1XRUA 3NRUA 5FBJA 2VZVA 3KGLA 3PUIA 1KDMA 3PVNA 3VBRC 2HWD1 5I0DA 2RDSA 3HMYA 4HLTA 2PHLA 2BERA 1OHFA 4Q2FA 4R9CA 5BPXA 1IPSA 1ND3B 2ZMLA 4UOJA 4NUBA 1F5FA 4ET7A 2VU9A 3OBTA 3PLQA 4CDXB 3B7MA 1YLLA 4MXVA 4RSUA 4B7EA 1S0FA 5DAWA 5EV7A 4JHTA 3PURA 3RVHA 3ZSLA 2NQYA 2AZ5A 3ILFA 2HEWF 2RS32 3POYA 5I0UA 5FYZA 4Q4Y2 2JDZA 2PA7A 1TNFA 2R1DA 3WEZA 1F35A 4NIDA 3K3OA 3VHPA 1ZZBA 2D43A 3M4FA 2ZMNA 1CQ9A 2PHFA 3T09A 5CEHA 1RHI2 2RS12 4XJAA 3ZFGA 4XFAA 1SLCA 2VUAA 1XB9A 4RN5A 2ZZQA 1PVXA 4AW7A 4QQPA 3HBZA 4NO4A 3LAGA 1YNAA 1Q5OA 2X5IB 1O3QA 3WG3A 3NAPC 2JB8A 1F4HA 3WF4A 4QU1A 2WJSA 1O4TA 2WAAA 4K1ZA 1BVVA 1D7PM 2GDFA 1UMZA 1ZBE3 1W2OA 2WWUA 3BALA 3GXUA 2EAAA 5LK7B 1LENA 2FHRA 5FWEA 1WBFA 1GUIA 1SLAA 2ETEA 1NKGA 1WZXA 3MIHA 2N7GA 4Q27A 5JSOA 3TN91 1JU3A 3AYDA 1A8DA 2WC2A 4LHLA 5DZGA 4WZFA 4B3NA 1C1FA 2K2SA 4AVBA 1POQA 1WW6A 2VOXA 2RJ2A 1NUKA 2VMEA 4HETA 4AFBA 3BI3A 4QQHA 2RM23 4WVZA 1ZBA2 3T08A 4XZPA 4CEYB 3C7OA 5FZIA 4D0QA 4AFMA 4HMZA 1Z7S1 1QJU1 3GJBA 5A3TA 1LHWA 1VRH2 2HWC2 1SQ4A 1RUI1 1WCQA 2B45X 2ET7A 3AZXA 1JOJA 3HQRA 2XJVA 2DU0A 2Y33A 1AL21 3I2JA 4QPIC 1K5JA 3NJXA 2R042 2GZWA 4A3XA 2PELA 2ZGKA 3W9AA 1VPHA 1VBB2 4PIXA 2AC1A 1FNZA 5BYNA 1H8TB 3ELNA 2X05A 3B02A 3C3VA 4PDWB 3IMMA 4Q4V2 2WWSA 2BFUS 3LIHA 4CU9A 3CBNA 5FZDA 5CU1A 4FFIA 5GZDA 5CNAA 2VZUA 4OUMA 3BGAA 2HWE3 1BZWA 1WWYA 1TE1B 5LA0A 1HV0A 4JV4A 2QQVA 4K8RB 3NV3A 3VD7A 1N1YA 3ZLIA 5IYYA 4DXTA 5IW0A 5FY9A 5JOYA 1J3QA 2R49A 3WX5A 4CDUB 5D1IA 1XNDA 2QQLA 3CDZB 4XW3A 4CP9B 4KG8A 4BXFA 2C6SA 1UOJA 3BODA 3IKWA 1D2QA 4N43C 3L2HA 5FTTC 4Y26A 3H8XA 2ZJCA 5CFCC 2RS51 1I1EA 5LEJA 1H9PA 4JGYA 3I3DA 5K0UB 2AGSA 1GZ9A 1OKOA 2JDUA 3QH6A 3BTXA 4AFDA 2CAUA 1DFQA 1PZ7A 1XPWA 1FATA 4IE6A 3WDVA 1U5ZA 4KWLA 1AR62 1XU1A 1K5MC 4QQOA 3VGIA 4XDPA 1CONA 5FY5A 4M3CB 3OYWA 4NPLA 1IHMA 4P9GA 4Y5Z0 4GWMA 3NNMA 1AXYA 5GLUA 3V56A 2DVFA 1BYHA 3AMMA 1MEC3 3LCPA 2ZX3A 5FZBA 4D7YA 2W3JA 3SKVA 5FKCA 4LIVA 5HV0A 2W95A 3AZVA 2ZGUA 4Y1XA 5DDJ2 1YWKA 2R0FA 4IGQA 3IM0A 1W8FA 1TMF2 3AKQA 5F5QA 4DO0A 2BGCA 4YVWB 1REFA 5C8CA 3OSDA 2JECA 4IGOA 1J59A 2I74A 2YDEA 4UW4A 1DYPA 2JD4A 5DUVA 1ZRIA 3IPVB 1DG6A 4W4ZA 4MGQA 2I45A 5H9PA 4AGRA 3N7MA 2HWB1 1ENRA 5FYHA 3I54A 3WNLA 5I91A 3WG4A 1JZ6A 1ZREA 2RM21 4UFLA 2JDMA 4K7JA 4L92A 1ULEA 2R063 4LA3A 1QNYA 4O9EA 2PYTA 4QB1A 5L7OA 4ZS2A 3QCWA 2VW0A 1SZBA 5FMOL 3NJYA 3NV4A 2YU1A 3AKTA 2Y6HA 3QOPA 2DYCA 4NHMA 2AYHA 2XG3A 4MGTA 1V6IA 2HWF2 4PI0A 3THTA 2GP5A 1VJ2A 3OUJA 5EFUA 1TQ5A 1WMFA 1QDCA 1F5JA 2VTFA 4IE4A 3VBHA 4I30A 3W21A 2ZHNA 2W1UA 1U5XA 1BMV2 1OF3A 1ZZCA 2P6CA 4A44A 5LATA 2XJUA 4TZDA 2WLQA 4LO6B 1F4AA 4AI3A 1JZ4A 1Y43B 3GYDA 1KGYA 1OQDA 1YEWA 1V6LA 1V9U2 3BOPA 4NIIA 1PO21 1Q8QA 5CA6A 5DZEA 4PLNA 3WR0A 4QT6A 5EHDA 4YM3A 1W8WA 1YFYA 2TUNA 4A6SA 1V6JA 1CAWA 5H9RA 3T4HB 2CSGA 2BWAA 2YMZA 2JXAA 3M3QA 2D6PA 5IK7A 2A75A 4MADA 3THDA 1NCQC 2B42B 5LB6A 4BE3A 2RS33 2WS93 2VMGA 4AFCA 1CAVB 3K4ZA 4KWUA 4QWNA 3CNAA 2QFEA 1C8M2 3OUHA 3WP5A 4GH4A 1DQ4A 1JZ3A 3C7FA 1UU4A 1WMDA 2WUHA 5J1XA 4JAAA 4XQ4A 2RS13 4XJ9A 4LEJA 1SFNA 2UWAA 1N1TA 3HEIA 2JDYA 4FPEA 3LB9A 3MW3A 4GA9A 5E6HA 4DNYA 1R083 1B35A 3BIWE 3U4SA 2XB6C 5FPAA 2EXIA 1VBC2 2Q1FA 4XCBA 2WNVA 3OF1A 4RR3C 1ND2A 1ZA7A 1RJ7A 4K21A 1OLME 1XNTA 5FQ0A 3WY6A 4I3PA 2Z2SB 3DN7A 5CKMA 3NJZA 3THCA 2JG9B 3ES4A 1Q8PA 2EIGA 5FZEA 1QIQA 4FAGA 3KD4A 5A33A 3K51A 1BKZA 2WA3A 3E5UA 5IHRA 1MEC1 1V6MA 5DZFA 1J3RA 1QJX1 2VUJA 4ZY9A 4AI8A 4WM7C 4EWEA 4BQ5A 2LROA 1SG3A 5KBFA 5JPMB 4GB32 4DY5A 1IOAA 3QLQA 1NZIA 4COYA 5KR7A 1ZBA3 1EAH2 3P5BA 1SPPB 3L9JT 3C2UA 1LCLA 3ZSMA 1QKQA 3B94A 5FYMA 3MIFA 1EUTA 4GAZA 4B4PA 4OI2A 5IVEA 2WFF3 2ZGNA 5FBZA 2DVGA 4UW3A 2Y6GA 5A7NA 2CV6A 3F2ZA 4IEYA 2ARXA 2Y6JA 3HQUA 1W2TA 2JG8A 4BIOA 1LNSA 2XWJB 4XURA 4XPVA 3MV01 5F2WA 4GMP0 5DG1A 3VDDB 2CAVA 3AZZA 4RS5B 1OQEA 2L9LA 2R061 4BU2A 5IJRA 1GWKA 4MXWB 2XGXA 4IEZA 2GAUA 1OUSA 4HPKB 4BMEA 2SLIA 1W6QB 3RJRA 5IK8A 2CHHA 2TEPA 3JBG2 4HZFA 4PT6A 5C4WC 4LOTA 1W9YA 1H2NA 3G6JB 2P4EA 4Q4V3 4JGZA 1DGRN 3WCRA 4DRRA 4RFRB 3ZVXA 1HKDA 2A6ZA 1N3QA 2VD7A 4LBLA 1WGPA 2ZHLA 1QY4A 1C5HA 5ABJA 5C9AA 1GZCA 3AJZA 1GOHA 3H3LA 5BUVA 1AXZA 1WKYA 3H1YA 5T54A 1UYPA 5HCAA 5HPOA 1GBGA 4OVEA 1SFPA 4RHV3 5H9SA 1LOFA 1VBD3 3AKSA 3USSA 3ZFFA 1BXHA 1PZ9A 1DGWX 4Y20B 4FTSA 4XUTA 4JX0A 1PVC3 3RRDA 3ZR6A 3AMHA 3ABZA 1UMHA 1X8MA 3ZSKA 3S0MA 1LOBA 1OLQA 4BDVB 4Q8KA 1IG3A 5CB7A 3DV8A 4GJYA 3SEEA 4KU8A 5JZGA 2YU2A 2RS31 4OUSA 2C4XA 4Q4Y1 5JWPA 1WA6X 3UL2A 3I2OA 5IUQA 3ZKUA 1Z78A 4XYXA 4BK4A 4RYDA 4QGLA 2OKXA 3VBSB 3VZKA 5BNOB 1AR63 2D3PA 4A42A 1WA4A 5E8AA 2RVAA 2QCSB 4FVVA 5FPBA 4ES9A 5CADA 1OUXA 1RHI1 2RS11 4P9YA 2QE3A 1RUC2 3ZSJA 3UJQA 3DUIA 4ASLA 4BQ3A 2JE7A 1NCRB 4YGDA 2GMPA 1W0NA 1MZEA 1ZZ6A 3CZUA 4Y22A 4FOVA 4CU7A 1NQDA 2BUKA 1LHOA 2VVEA 1BVP1 1WMXA 2VNOA 2A6YA 3POJA 3TB0A 2VULA 1I5ZA 5A1FA 4LBJA 2ZGSA 1AR83 2P5BA 1AYN3 2VNGA 3V0AA 3ETPA 3NNGA 3RWKX 5HI0A 3ZFEC 4EN8B 4FPFA 2V5YA 1L7QA 3NSTA 4YVSB 2FBEA 4DQAA 1O6UA 2ZGQA 5FUPA 5LK5A 3IT8A 5AVAA 4M01A 2ZBJA 3EHKA 1VMHA 5DPNA 5JR7B 4F3JA 1UN1A 4AFAA 4CCNA 2VO5A 1ZBA1 4HN1A 2YPDA 5D8AB 2WO7A 4E4HA 3N7KA 5A7WA 3ZKYA 4CU8A 3RMYA 5T5PA 4NVPA 3WP6A 1RUD2 1RVF2 4AVSA 5FO8B 3VBUA 1VRH1 4NWVA 2HWC1 2ZGMA 3P3PA 1SLLA 5FZ7A 1OVPA 4LULA 3RYRA 1RC6A 2G1MA 2ZEYA 3H1WA 3FFZA 3IAQA 1ULCA 2J7MA 4U2AA 4ES8A 2E7QA 4CEWC 3IDAA 4QDSA 4Z07A 2YFZA 1X36A 2HWF3 1PO13 3WLUA 2R041 5C3OA 3WQ0A 1GZWB 5BV6A 2P34A 3VBOA 2VZ3A 3UKVA 2ZAHA 3NO8A 4N9HA 5FZOA 1VBB1 1ZYBA 4QQLA 3LE0A 2Y8KA 1QJY3 2Q5TA 2BBVA 1H4HA 2PAMA 2AENA 1NA1C 1TEIA 1IS3A 4XCAA 4Q4V1 4BQ2A 2RHPA 1NLQA 4LNVA 1NXD1 4TLGA 4D69A 4CDWB 3ACFA 2Q8OA 2BNOA 1H2KA 3O0XA 1DDLA 4XVHA 2ZABA 3N35A 1ULDA 3GBFA 4OMCA 2RR13 3A4UA 2VCBA 2QQPA 4KQ7A 3SITA 4E9KA 2A71A 2OQ6A 2QQOA 2YROA 4AGGA 5A70A 3E1F1 5HXMA 4LJHA 1YFUA 5CFDC 4ARXA 1GWLA 3GZAA 2GNTA 3LPFA 4Q4W3 4Y33A 4FXKB 4MGYE 4QPWA 4QX0A 4TWTA 2O0OA 1OSGA 3RZMA 4FOWA 1C1LA 4AEKA 4IEPA 2QZ2A 2DVBA 3K4AA 3O0WA 4AK3A 5LRSA 2BGPA 2WSUA 1W8HA 1AR61 5FAXA 5CZKA 1U5YA 3MW4A 4Z2AA 4V2VA 5F39A 3KV6A 5FCCA 2VGDA 1QOTA 4YFWA 1OOPB 1A34A 2ZTNA 3SH3A 5JOZA 5A3LA 1A78A 3FN9A 1LODA 2DCTA 3ASIA 4Y1UA 2LTNA 2HKXA 2Q4SA 3DPRB 2I07B 1AXKA 2V4VA 5FZ0A 3SCFA 4DB5A 4BQXA 2DCYA 2OUHA 3AP7A 2BZDA 4FPYA 3O1TA 2XPJA 1AR73 4GB33 3I3QA 3UV9A 1XYPA 4LQRA 1Y9GA 2ID4A 3GGLA 3GM8A 3H9AA 3DCQA 5DDJ1 1EAH3 5L73A 3ZSEA 1YJKA 3BOWA 1ZRCA 1TMF1 3ON7A 1AYN1 2J42A 2J1EA 4ZZ8A 4AGVA 4EQVA 5KHJA 2IVIB 4GD4A 1BEV3 1V6NA 3GJAA 4QX3A 2ARBA 4EN7B 2RDQA 3LQCA 1WW5A 4BM8A 4LPLA 3U0ZA 3RI8A 4BLJA 4GWJA 4O9GA 5CIRA 3OY8B 4JGZB 5T52A 3OB8A 1QEXA 4IV3C 2HJIA 1RJ8A 5FJKA 4AVTA 3ACGA 3RGBA 2BBAA 3AC0A 1DF0A 1L3JA 4UFKA 3OGRA 1UCXA 3K4DA 4XFGA 1Q56A 1SACA 2E63A 2HWF1 3AMQA 1NY72 2RJLA 3JUUA 4YWAA 4Q0QA 1BMV1 1EV12 5C3PA 5I0RA 2VCAA 2WBKA 4DXZA 4S2GA 4IE7A 2W9XA 2E26A 4A4AA 4FPGA 4AQTA 3PUSA 4K6BA 3NAPA 3BKZA 5GZGA 1MS9A 1V9U1 1TME2 2J1SA 3M1HA 5GJ6A 3URFA 1LGNA 2D6LX 5JXHA 5E1RA 4LE3A 4QXBA 3ME2A 4LLOA 1GKBA 4B4RA 3ETQA 3VBFB 4PLOA 1PHMA 1SBDA 1R64A 3FUQA 2IUWA 2R072 1HQWA 1H1IA 4NHYA 5F5AA 4FSJA 1JYCA 1FV2A 3MPBA 3RJ2X 1JBCA 4CDQC 2WL1A 1T2XA 1L7RA 2HLEA 5JXGA 1C8M1 3O1VA 3SEPA 4CCDA 5G04L 4QQ2A 1MQTB 5FYBA 1MS5A 1ULGA 3WF3A 4Q0PA 2OQ7A 3T0DA 3GBGA 5BNPC 2B9UA 1QJFA 4XIKA 1RUC3 1JI6A 1D4M3 1FPN2 1YQ2A 1OXCA 1F15A 2QQKA 3LOIA 4YG0A 3T0BA 4WVMA 5F5CA 1YYNA 4QMAA 5A32B 2GMMA 3NVCA 1J58A 4QPIA 2VZOA 2BNMA 2P1BA 3KV5A 2EICA 2UWBA 1ALYA 3H7YA 5FP3A 4E4SA 1CPNA 1S0CA 2HWD3 3ZPYA 3KB5A 4LKFA 4UAPA 4AVVA 4PHZA 1G9CA 5FPLA 3KM5A 2ZXQA 1WLWA 4FFGA 3OGJA 5J98B 4N53C 4TN7A 5ACA2 4FI9A 3HJRA 4J1WA 3S6PA 4L97A 4L8QA 1AR71 4GB31 4X8PA 4A41A 4D8MA 2JEMA 2DFBA 1EAH1 4W65A 1OVSA 1X8EA 2R1BA 1BBT2 3POFA 3S5QA 3ZXFA 3FFQA 2K9ZA 3AZWA 1W8ZA 4A7KA 3R4DB 1HXS2 2BU9A 4GIQA 3I59B 1RVF3 3WDTA 4QXCA 1G7YA 1FX5A 5T5JA 4EROA 3BTZA 1QGLA 1W90A 4U36A 3IN9A 1KXGA 5EJ3A 4OI1A 3V65A 5HCBA 5C6CA 3A7QA 3LDRA 4N43A 2NYYA 4LBQA 4QKFA 3BVCA 3Q8CA 5CFCA 2GNDA 3BUCA 4XUNA 4OCTA 3I8TA 3ACLA 1JZ8A 1JMUB 2W92A 3JBG1 5FYSA 2ZOEB 5J09A 1ZNPA 2A1XA 1K5MA 3U07A 2ZACA 4XJWA 2A3XA 4PQ9A 4NIHA 2X29A 3LDKA 4O7XA 4BJ0A 1REEA 1CAUA 2VTXA 2AACA 4GWIA 4Y1ZA 1DLCA 3MZHA 1XSQA 3RSJA 4TLFA 1UAIA 2AH2A 3KZ4C 1YRZA 4IESA 5JOWA 1VAVA 3TN93 2WRAA 3RI9A 5SV5A 2WYSA 2UU8A 1UZZA 3KF3A 5JMOA 1O3SA 5LBFA 3H50A 1VB4A 4CSWA 3ZFFB 3FL7A 2DBNA 3CMGA 4IV1C 5K8SA 1FT9A 4UT5A 1COV2 4HKOA 1QJU3 3C8XA 3MLKA 1V6OA 1UOFA 2A73B 1YC61 2HEVF 4I2OA 2W47A 2VBDA 3HWJA 1CR7A 1PK6C 3J7LA 1J1LA 4O61A 1AL23 1PX3A 4JDMA 3GZTB 4Q0SA 1PIV2 1CIWA 1O8PA 1RUC1 1ZRRA 1VBA2 3HD8B 1HB4A 1OH3A 4HXCA 5JVVA 2ZA9A 1Q43A 3GDBA 2C26A 3KLSA 5FY7A 3TEWA 5B2GB 2HH9A 2I2SA 2PLV2 4I0AA 3EYPA 3LZZA 4LIUA 1AYM2 4PIZA 1LEMA 3ZN6B 4B7KA 1KFXL 2IXKA 4ZU7A 1PNFA 4YGBA 2P3KA 1GICA 5TSWA 5I93A 1AX2A 5E89A 3FBMA 5LBEA 4XJUA 1O3TA 5FY8A 4RQPB 1X7NA 5BNNB 1AZDA 2WSVA 2FZ1A 2B5HA 2AEYA 2H6CA 4MV2A 4EZHA 4XJZA 4QB6A 1QJEA 5AVPA 4FAHA 1C28A 1NCQA 1S2KA 5DAPA 4PLMA 1W3XA 4Q8LA 1ENXA 2RS53 4WV8A 1UWWA 1C4RA 4I0WB 1RUD1 1DYKA 1RVF1 1VBE2 2VMDA 2ZGOA 3HN3A 5IK5A 4HONA 4OHYA 1SMVA 3WV6A 5ERLA 4AEDB 3RZKA 2PAKA 1HDKA 3PVBB 4ZXEA 5LA1A 1TG7A 3LD8A 4XIOA 1GFF2 2YGLA 3U75A 3W59A 5C3SA 2MNGA 4XETA 3AZYA 1ULOA 4XUPA 2ZS6B 3NJVA 2VVFA 1H2LA 4ITCA 4RR3A 2ZEZA 3P1IA 2FCUA 4WM8B 3USUA 4A6OA 5JSRA 5KHGA 2E53A 2O1QA 5K9YA 3CJIB 5CKQA 3MI8A 1W05A 3ST7A 1UYYA 4NRQA 4V1PA 1NE4A 1ND3C 1VRBA 1PMJX 1YFWA 4GZ9A 4JQRA 4B1MA 1O5UA 4CDXC 4PF5A 2JIJA 1HIXA 2E31A 4P9IA 4I09A 2R073 3NKGA 3ZN4A 5J3UA 3IB3A 4GXLA 4QPGB 1KJLA 3N9PA 1ACCA 4Z2WA 4WM7A 4H14A 1VAMA 2HWB3 2PAEA 4XEZA 2WO3A 4BQ1A 3FLRA 1H1MA 1P8JA 2C1FA 2IXIA 5LCWL 1PM7A 3MFAA 2YHJA 3EB7A 3M3OA 2Q0AA 2VZ1A 4Y3OA 2OS2A 3F95A 1M06G 3AK0A 4P5YA 3C7HA 2VCMA 2EIBA 2CL2A 1Q8SA 2DUOA 5F6LB 2VMFA 4BB3A 3MIEA 1FAYA 1PGL2 1ASJ2 5EWSA 2X5IC 3O12A 2WN2A 3O1RA 4C91A 4XBQA 2BP6A 2NMOA 4QKNA 3T1LA 3AJYA 1JYXA 4XQDA 1DCSA 1V0AA 1RUJ2 4C0BA 1CWPA 4N7UA 3VZMA 5C4WA 4HK8A 4IEWA 4AYUA 3BPZA 3K2OA 2JB4A 1DZRA 2VCCA 3L2YA 2PHTA 1O5LA 1PO23 4LOSA 2LS6A 1GV9A 5FXWA 3LEGA 2B39A 4IEVA 2DVDA 1E5IA 5GLZA 5GZFA 1EPZA 3AYAA 3RNSA 3W5NA 3IMNA 2FZ2A 1N47A 5GZEA 2QKDA 1R093 4AQ6A 4DUXA 1BBT3 1ULFA 3BTAA 2VVDA 2FDFA 4CEYC 2FDIA 1K12A 1W6NA 2KR2A 3JD72 1S0BA 1QMJA 3CLPA 1KEXA 3I49A 2GC2A 3FHAA 4ZZ5A 1R1A2 1GR3A 4DY3A 2E51A 2O8QA 4OMDA 3W5MA 1DQ2A 1ZZ9A 3J8F2 1W6OA 2Q8EA 4BISA 3E6BA 3NMBA 2X09A 5D21A 4AAXA 2RMU2 4YZ1A 4C8DA 1SDWA 3WDUA 5AC92 2XVKA 1BK1A 1H8TC 4JKMA 4DXSA 3VKLA 2OPKA 2YB7A 4PDWC 1LU1A 2BRTA 4JTOA 1NY71 3H1MA 3O5SA 1HX6A 1YUDA 3J7MA 1LJ7A 5A3WA 1EV11 3D0SA 1RMU2 2CY6A 3NNFA 2A7AA 5EPAA 4GALA 3WW3A 3ATGA 3TAYA 2BFUL 5T50A 2IXCA 3FLTA 2EAKA 3AYEA 1WCDJ 1QJX3 2WNUB 3K75B 5FZGA 1I5PA 4DIQA 1DIWA 4NPRA 3OPWA 1S4CA 2V09A 4AQSA 4CDUC 2XUMA 1O4ZA 4FT8A 5FMDA 3AP6A 1ZM1A 4R4XA 3RZLA 3BYWA 2R071 5IFPA 3H8OA 4NMIA 4OFGA 1O7FA 4OLLA 3ZFEA 4DRVA 2P3JA 4LHKA 1WCSA 3N9MA 4HG6B 5GM0A 3MIGA 4UF0B 2YBSA 4P5HA 1OD3A 4R9DA 5K0UC 1W2NA 1MACA 3KVAA 2CWSA 4AF9A 5FZ3A 2XLFA 2EIDA 4NR1A 2VL4A 3PUHA 4UW5A 5FLIA 1LGCA 2IWGB 5JOXA 1PIV3 3P6BA 1EP0A 2GALA 5GLVA 4L2NA 1UY2A 3T0AA 1ODNA 2W0XA 1OA2A 2ZEXA 5I8YA 5JMCA 4CEWA 3O1MA 2XLAA 1FNYA 4CXWA 2QQMA 3IBMA 3ZXLA 2V4AA 3TNPB 1AYM3 2Q8DA 1E5SA 4Y1YA 2Y60A 2O8OA 4XMAA 1BJQA 3VD5A 4LO4B 3WG1A 1IGOA 4BMBA 1NA1A 5ANQA 3ZXEA 1FYUA 4YVWC 1XE0A 4AVAA 3IIIA 4JRAA 5ACA1 1REDA 4JVAA 1RUG2 5A7SA 2AR6A 5LA2A 2W68A 3AFGA 1MR5A 2ZX1A 2OYZA 2NZ9A 3UKNA 1R091 3PMEA 3T30A 1BBT1 1FMD2 2QQIA 3N7LA 3SQOA 4XDQA 1YJLA 1UY0A 3MUZ1 1HXS1 4RA0A 4Q4Y3 2VZPA 4HL0A 3ZFGB 5GALA 2JD9A 5K7PA 1WW7A 3MF9A 3OTFA 1A8MA 4MVTA 4KBBA 4UWDA 4YW5A 5KHHA 5CFDA 1OF4A 1QQP2 4B8EA 1S0GA 1SCSA 4Q1RA 5IVBA 1IQDC 1W8UA 1MZ6A 1OFSA 1RHI3 3AYCA 4XE9A 4CUBA 2D98A 2Z5WA 2BEOA 5EYYA 3HQXA 5FUNA 1HRV2 1DYOA 1QH6A 5DMYA 5T5LA 2IVJA 3ZN5A 3ZYBA 3KT1A 4XHXA 1AUYA 5A7QA 1HN0A 1NOVA 1ONAA 4MYEA 2VQTA 3X29B 4B4QA 1YHFA 4JKKA 3FHQA 2DWRA 4IE5A 3T2QA 4AEJA 1UIKA 1UY4A 4Y4YA 3JU9A 5FO7B 5L9VA 3H8UA 2V73A 2BV4A 3J9SA 2XQXA 3POWA 1O4YA 5IVYA 1XE8A 2H6BA 1H4GA 2JICA 1FOD2 5FLHA 1UD1A 5FZHA 4URTA 1EUUA 2QQNA 1W9SA 4A2UA 3I2FA 1JOPA 1RUE2 4YGEA 3PVOA 4LO5B 1OURA 2GN7A 2Y26A 1DGLA 4FO9A 4NE9A 5JIUA 2ZCWA 3THPA 3KHBA 1VALA 1COV1 3LA7A 3BU7A 2MHFA 2Y64A 2ADDA 5A3OA 1NLRA 1VRH3 5HCHA 2HWC3 5FO9B 1NAEA 5FP4A 2VBPA 1W6PA 3IDEA 3ZYJB 2ERFA 3FMGA 2V5DA 5IAXA 1ASJ3 2GN3A 1RTVA 1Y4WA 2E32A 2V72A 4M0HA 4QM9A 4QX8A 4RGAA 3ZR5A 3D82A 2PHWA 1IZ3A 1S55A 2K46A 3ACHA 4QU2A 4IV3A 1BQPA 2R043 3QBQA 4ZPIA 3VDBA 4MG2A 5IT6A 1PIV1 2DTWA 4C90A 5A1AA 1VBA1 1VBB3 2JG9C 3W58A 3I3EA 3RZHA 1F2NA 4HBNA 4CYDA 2VY0A 3R0RA 1MS0A 3ZO0B 3P3NA 1VB2A 5FV3A 2C9AA 5JXJA 2QQWA 5FZLA 5JR2A 4CE8A 2PLV1 4YM1A 3S5AA 1IKQA 2IC1A 1AYM1 2WT0A 1I6XA 2VQAA 2YV8A
chains in the Genus database with same CATH topology
5FXVA 3AL5A 2OX0A 4CCJA 2XMLA 2YBPA 3N9PA 5A7WB 2Q8CA 5FYIA 5FJHA 4CUGA 5F32A 5FYSA 5A80A 3U78A 5FYTA 4GD4A 3AVSA 4QWNA 5A7PA 4XDOA 3DXTA 2Q8DA 4D6RA 5FZDA 5F5IA 3N9QA 5F3EA 5FZCA 5A1FA 3N9NA 4Y3OA 5FZBA 2OS2A 5FXZA 4URAA 4UF0A 2P5BA 5IVCA 5E6HA 4CCOA 4GJZA 5FPUA 5ANQA 5FJKA 3U4SA 5FPAA 4V2WA 5A3PA 5FZOB 5FZFA 3ZLIA 5FZ8A 5IW0A 5FY9A 5FZ1A 2XUEA 5F37A 3PDQA 5FUPA 5A7SA 4EZ4A 4EYUA 4AAPA 5LW9A 5IVJA 4CCNA 5FZ9A 4BXFA 4CSWA 2YPDA 5F2SA 5FBJA 4E4HA 5FZMA 2WWJA 5A7WA 5FYUA 5FYVA 2GP3A 5FZEA 5LY2A 3K2OA 5A1LA 2XDVA 3PUSA 3N9LA 5F3GA 2PXJA 5ISLA 5FZ7A 5FWJA 5FXWA 3KV9A 4NUBA 2W2IA 3DXUA 5IVBA 4QXBA 4CCMA 4CCLA 4XDPA 5KR7A 5FY5A 5FUNA 3PURA 5FYCA 5FZOA 5FYMA 4GAZA 5F5AA 4QXHA 3RVHA 5A3NA 5LY1A 5A7QA 5IVEA 5FYZA 5A7NA 5FY7A 5FP7A 5FY4A 4LIUA 3LDBA 3K3OA 3PU8A 5FZ6A 4LIVA 5F2WA 2OQ7A 5FYBA 5K4LA 4CCKA 2XXZA 4IGQA 5CEHA 4BU2A 3PTRB 3N9OA 5FZAA 4D6QA 4DO0A 2OT7A 5IVYA 2Q8EA 4LXLA 4BISA 5FY8A 5IVFA 3KV4A 3KVBA 3PUAA 4IGOA 5F3IA 5FZHA 4C8DA 2OQ6A 5F5CA 3K3NA 5FY0A 4HOOA 5FYHA 5FP8A 3OPTA 3KV5A 4QU1A 2VD7A 5FP3A 4Y33A 5A3WA 4EZHA 5FP9A 2WWUA 5LWBA 4QX7A 4LITA 5IWFA 5FWEA 5FPLA 5F3CA 4IGPA 4Y4RA 5FYYA 5FP4A 4HONA 3PUQA 5FZGA 3NJYA 2YU1A 4DIQA 4TN7A 4QX8A 3OPWA 3AVRA 5FZKA 3LD8A 4V2VA 3ZPOA 3AL6A 2GP5A 3KV6A 5F39A 5FZIA 4GJYA 3N9MA 5FPVA 3UYJA 2YBKA 4UF0B 5A7OA 2YBSA 2YU2A 4ASKA 4QXCA 5FY1A 5A3TA 5FV3A 5FZ0A 4AI9A 5FZLA 3KVAA 5FZ4A 1VRBA 5IVVA 5FZ3A 4D6SA 5FPBA 5FXXA 3PU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXV A;  3AL5 A;  2OX0 A;  4CCJ A;  2XML A;  2YBP A;  3N9P A;  5A7W B;  2Q8C A;  5FYI A;  5FJH A;  4CUG A;  5F32 A;  5FYS A;  5A80 A;  3U78 A;  5FYT A;  4GD4 A;  3AVS A;  4QWN A;  5A7P A;  4XDO A;  3DXT A;  2Q8D A;  4D6R A;  5FZD A;  5F5I A;  3N9Q A;  5F3E A;  5FZC A;  5A1F A;  3N9N A;  4Y3O A;  5FZB A;  2OS2 A;  5FXZ A;  4URA A;  4UF0 A;  2P5B A;  5IVC A;  5E6H A;  4CCO A;  4GJZ A;  5FPU A;  5ANQ A;  5FJK A;  3U4S A;  5FPA A;  4V2W A;  5A3P A;  5FZO B;  5FZF A;  3ZLI A;  5FZ8 A;  5IW0 A;  5FY9 A;  5FZ1 A;  2XUE A;  5F37 A;  3PDQ A;  5FUP A;  5A7S A;  4EZ4 A;  4EYU A;  4AAP A;  5LW9 A;  5IVJ A;  4CCN A;  5FZ9 A;  4BXF A;  4CSW A;  2YPD A;  5F2S A;  5FBJ A;  4E4H A;  5FZM A;  2WWJ A;  5A7W A;  5FYU A;  5FYV A;  2GP3 A;  5FZE A;  5LY2 A;  3K2O A;  5A1L A;  2XDV A;  3PUS A;  3N9L A;  5F3G A;  2PXJ A;  5ISL A;  5FZ7 A;  5FWJ A;  5FXW A;  3KV9 A;  4NUB A;  2W2I A;  3DXU A;  5IVB A;  4QXB A;  4CCM A;  4CCL A;  4XDP A;  5KR7 A;  5FY5 A;  5FUN A;  3PUR A;  5FYC A;  5FZO A;  5FYM A;  4GAZ A;  5F5A A;  4QXH A;  3RVH A;  5A3N A;  5LY1 A;  5A7Q A;  5IVE A;  5FYZ A;  5A7N A;  5FY7 A;  5FP7 A;  5FY4 A;  4LIU A;  3LDB A;  3K3O A;  3PU8 A;  5FZ6 A;  4LIV A;  5F2W A;  2OQ7 A;  5FYB A;  5K4L A;  4CCK A;  2XXZ A;  4IGQ A;  5CEH A;  4BU2 A;  3PTR B;  3N9O A;  5FZA A;  4D6Q A;  4DO0 A;  2OT7 A;  5IVY A;  2Q8E A;  4LXL A;  4BIS A;  5FY8 A;  5IVF A;  3KV4 A;  3KVB A;  3PUA A;  4IGO A;  5F3I A;  5FZH A;  4C8D A;  2OQ6 A;  5F5C A;  3K3N A;  5FY0 A;  4HOO A;  5FYH A;  5FP8 A;  3OPT A;  3KV5 A;  4QU1 A;  2VD7 A;  5FP3 A;  4Y33 A;  5A3W A;  4EZH A;  5FP9 A;  2WWU A;  5LWB A;  4QX7 A;  4LIT A;  5IWF A;  5FWE A;  5FPL A;  5F3C A;  4IGP A;  4Y4R A;  5FYY A;  5FP4 A;  4HON A;  3PUQ A;  5FZG A;  3NJY A;  2YU1 A;  4DIQ A;  4TN7 A;  4QX8 A;  3OPW A;  3AVR A;  5FZK A;  3LD8 A;  4V2V A;  3ZPO A;  3AL6 A;  2GP5 A;  3KV6 A;  5F39 A;  5FZI A;  4GJY A;  3N9M A;  5FPV A;  3UYJ A;  2YBK A;  4UF0 B;  5A7O A;  2YBS A;  2YU2 A;  4ASK A;  4QXC A;  5FY1 A;  5A3T A;  5FV3 A;  5FZ0 A;  4AI9 A;  5FZL A;  3KVA A;  5FZ4 A;  1VRB A;  5IVV A;  5FZ3 A;  4D6S A;  5FPB A;  5FXX A;  3PU3 A; 
#chains in the Genus database with same CATH topology
 1K42 A;  1UOG A;  2D7F A;  4CCJ A;  3KCC A;  1JW6 A;  3ECQ A;  2MEV 2;  3U1X A;  1DGR A;  1PX4 A;  2Q1M A;  3DGT A;  3DYO A;  3KQR A;  4XF3 A;  5FMB A;  1O3R A;  1YQC A;  3A22 A;  4FBF A;  4EWD A;  1E5H A;  2XLG A;  3MLL A;  4XC9 A;  3H42 B;  1JOB A;  4G4F A;  4JGY B;  3WT3 A;  4D7S A;  1R1A 3;  3DXT A;  2HBU A;  4LBK A;  3WP3 A;  1W99 A;  2A5Z A;  2WNE A;  3CEW A;  3I2D A;  4M4P A;  4D6R A;  5F5I A;  1XNK A;  2XL7 A;  5F3E A;  4PBO A;  5IAT A;  3VDD C;  3N9N A;  1G86 A;  2B46 X;  4A7Y A;  1MPX A;  4AZZ A;  4RS5 C;  4JC1 A;  4EN0 A;  4GJZ A;  4CDQ A;  4IET A;  1VBE 1;  2IFR A;  3NNL A;  3POB A;  3OYW B;  3I3B A;  1SLI A;  4DS0 A;  1HW5 A;  2EF6 A;  2RMU 3;  5A3P A;  2BOI A;  4OZO A;  4W6X A;  1U5I A;  4LKE A;  4KL1 A;  3WOG A;  2VOV A;  5BNP A;  4W6W A;  3IZO A;  1US3 A;  2DCK A;  2UY8 A;  4AHY A;  3LPG A;  4P14 A;  4D94 A;  4NOT A;  3PL0 A;  3T2P A;  5FZM A;  1HN1 A;  2G9G A;  1TZO A;  4LBM A;  4TYS A;  4XAB A;  5J7M A;  3MW2 A;  2ZMK A;  3VKF C;  3KMH A;  1HJG A;  2KM2 A;  5C8C B;  1HB2 A;  4QD2 A;  4QX1 A;  4FQ4 A;  3ZYI B;  3KV9 A;  1X50 A;  1S0E A;  3AFK A;  5DDJ 3;  4TSV A;  4YZ2 A;  4LMF A;  4XF4 A;  3RG0 A;  1TMF 3;  2QQJ A;  1E5R A;  4EN6 B;  1WCU A;  2ORX A;  4K9S A;  1YIP A;  3R05 A;  3MGU A;  4L99 A;  4MHR A;  2P3I A;  2JDH A;  4N53 A;  4FPO B;  3T3Y A;  1UU6 A;  5L7O B;  2ZGL A;  2G9Z A;  5LBB A;  1VMJ A;  5FFO C;  3T1M A;  3VBS C;  3LDB A;  4E2S A;  4IUG A;  5BNO C;  1WUV A;  4OHZ A;  2XXZ A;  1C3H A;  4ZXK A;  4QKB A;  3BU0 A;  4Q0U A;  1W28 A;  3B01 A;  2DUP A;  3VBH B;  3WP4 A;  1OA3 A;  2ATF A;  2BJS A;  4Q1P A;  1NCR C;  1U12 A;  2FDJ A;  4X6Q B;  5JI9 A;  2JX9 A;  2BWC A;  4K40 A;  5ANN A;  2IFW A;  4AI0 A;  4BZ4 A;  1HJF A;  1ASJ 1;  1DQ1 A;  4YW7 A;  2J1V A;  2VZQ A;  3ILN A;  3OUI A;  5C7G A;  3T2O A;  4QB2 A;  2WA4 A;  2BPA 2;  1RUJ 1;  3WG2 A;  5JI7 A;  1FV3 A;  2EXH A;  1CAW B;  3ZDV A;  3CQO A;  1LHV A;  2WZR 2;  2XKO A;  2CDP A;  1V9U 3;  3AXD A;  5FYY A;  1HRI 2;  2JDK A;  2Y0O A;  5L36 A;  3RZG A;  1MS1 A;  2CTV A;  4XQW A;  4YVS C;  3U11 A;  2VXJ A;  3VL8 A;  2D97 A;  4OI0 A;  3SMH A;  1AR9 2;  3Q8F A;  4GH4 B;  5J48 A;  1STM A;  2YZ4 A;  5D8A C;  3PTY A;  4B29 A;  1WBL A;  3Q8B A;  4Z1V A;  2ZAA A;  4XBL A;  1B35 B;  3WHT A;  1C8M 3;  2XHN A;  1QQP 3;  5KXE A;  3PHM A;  1R1A 1;  2XHK A;  5A3U A;  2WNV B;  4P9X A;  4IV1 A;  1ND2 B;  2VMI A;  5J36 A;  5C33 A;  2VG9 A;  1LGB A;  4FQZ A;  5FQ0 B;  2HEY F;  1W6M A;  2LW8 A;  1GYK A;  2WZE A;  3AP9 A;  1HRV 3;  3J8F 1;  3MYX A;  4FPC A;  4NHK A;  4YG3 A;  5IK4 A;  4JZR A;  1JZ2 A;  1VBC 3;  1PK6 A;  2J1U A;  2RE9 A;  2QDR A;  4CUG A;  1RIR A;  2RMU 1;  3DL3 A;  5A80 A;  3NL1 A;  5CVR A;  3KS7 A;  5A33 B;  5AC9 1;  2WZP P;  2YC0 A;  4Q4X 2;  4XDO A;  4ZHN A;  4RD7 A;  1L7L A;  4LHS A;  3UT0 A;  4WVW A;  5KXC A;  1NT0 A;  3SNM A;  2GH8 A;  3OEA A;  1GNH A;  2QTW B;  3KCX A;  5JAX A;  4CDW C;  1RMU 1;  4URA A;  4HFS A;  1OD5 A;  1MS8 A;  2Y38 A;  1OPO A;  4M00 A;  4AXO A;  5A6Y A;  3ACI A;  3PDQ A;  5I0S A;  2FMY A;  5LEK A;  1RUE 3;  2WFP A;  4HKW A;  1H8V A;  5FRE A;  2JG8 B;  5C5T A;  1IS4 A;  1ZRD A;  4KH9 A;  1UX6 A;  1Q3E A;  4QDQ A;  5FYU A;  4COZ A;  4QX2 A;  1OFN A;  3MF6 A;  4KMQ A;  2ORZ A;  2WQ4 A;  4Z82 A;  5DAX A;  5F3G A;  3SIS A;  3O1O A;  3E97 A;  3AB0 A;  3RFR A;  4N7I A;  4AE2 A;  5FKB A;  4XZU G;  4YZ3 A;  3WDY A;  1OMI A;  1BHG A;  4FPK A;  1MVE A;  5A3M A;  3S57 A;  2QDN A;  4IXL A;  1OOP C;  4LK7 A;  3JBG 3;  5ABJ B;  2JE9 A;  5C9A B;  5JUV A;  1QU0 A;  2IXJ A;  1D0H A;  1OC1 A;  2EIE A;  1RIT A;  3N3H A;  3TYJ A;  4ATE A;  3DPR C;  3OD0 A;  3ZYH A;  4LO8 A;  1PGS A;  5FY4 A;  3G7D A;  4KGQ A;  3PU8 A;  1POV 3;  1OQ1 A;  1SFY A;  2DV9 A;  2W94 A;  2Y6F A;  4S2D A;  1YO8 A;  3LEM A;  5K4L A;  3SXW A;  4LBO A;  4COU A;  3VD4 A;  4D6Q A;  2RV9 A;  2OT7 A;  2MEV 3;  2D40 A;  3POS A;  4H2A A;  3UJO A;  4OQ9 A;  4WVV A;  1ND3 A;  3PUA A;  1GP5 A;  4QDR A;  3VKM A;  2FDK A;  5JZG B;  4CDX A;  3K3N A;  2ZEW A;  4J25 A;  1GNY A;  4MUV A;  4RFT 0;  5IFT A;  1GOG A;  3CZJ A;  1FMD 1;  3FC0 A;  3LIG A;  3SLI A;  4KI5 M;  3K77 A;  1NQJ A;  4QX7 A;  1T6G C;  1J84 A;  1TVG A;  2YXS A;  2O14 A;  4MO3 M;  5IWF A;  3HBK A;  3WUC A;  1RXG A;  3PUQ A;  1O91 A;  3ZYR A;  2XJP A;  1QQP 1;  4W6Y A;  2JEN A;  1UPS A;  2EXK A;  1DQ6 A;  3KGZ A;  4Y22 B;  2DCZ A;  3AVR A;  4D3W A;  4IQP A;  2FDG A;  1A6C A;  3AL6 A;  3ZPO A;  4CUC A;  2GH2 A;  2WAB A;  1HRV 1;  2YY1 A;  1Q8O A;  3MLJ A;  5EZW A;  4YW4 A;  3ZYG A;  2W1W A;  1QXR A;  3UES A;  3VL9 A;  4BQY A;  4DOU A;  1VBC 1;  1ZBE 2;  1XNC A;  2PHD A;  1X82 A;  3IIA A;  3V0A B;  2WN3 A;  2X5I A;  3EQE A;  5KXB A;  2DFC A;  1JUH A;  3PJY A;  2PFW A;  5IVV A;  3VKO A;  2E7A A;  1WD4 A;  4YPJ A;  2J1T A;  3ENR A;  1QNW A;  4FPH A;  3KT4 A;  3VBF C;  3V0B A;  5FRA A;  1LAJ A;  3LOB A;  3WCS A;  4G9S B;  3IDC B;  1UKR A;  4E4Z A;  4DEQ A;  5A7W B;  4YM0 A;  4AVC A;  1FOD 1;  5FYI A;  2IXL A;  5F32 A;  1WCK A;  3AM2 A;  1RUE 1;  3VBU B;  1JXN A;  1NLS A;  4C1W A;  1XE7 A;  2W52 A;  3M70 A;  2TBV A;  2OII A;  5JSP A;  4LUM A;  1MQT C;  1YI7 A;  3MDP A;  4CEY A;  4H7L A;  2ZX2 A;  3I2G A;  4DIN B;  4K8F A;  5DAV A;  3OBR A;  2NN8 A;  2QUO A;  3DEC A;  1RUD 3;  2GU9 A;  3CJX A;  4MGI E;  4OZX A;  3VBO B;  5CIS A;  5FZO B;  2ADE A;  3VZJ A;  3PJQ A;  3OBA A;  1MS3 A;  5HBA A;  1LHN A;  4NJ4 A;  2RDR A;  2D44 A;  3GCX A;  4C1X A;  2F17 A;  4WBB A;  1YQ5 A;  2LAL A;  1JYW A;  4N8M A;  2JDN A;  3BIE A;  1XBF A;  2WWJ A;  3B00 A;  1TNR A;  3WNM A;  2HWE 2;  2WZR 3;  1H8T A;  2XDV A;  2XON A;  1HRI 3;  4PDW A;  3AKP A;  4P9J A;  2XH6 A;  1CX4 A;  1H6Y A;  3MHZ A;  4CUA A;  3B5L B;  2W91 A;  1HV1 A;  2D5F A;  1POV 1;  1V6K A;  2GC3 A;  1ZZ7 A;  5HXV A;  1AR9 3;  3UET A;  1LKN A;  4E27 A;  1XQN A;  1UU5 A;  1XJA A;  3OD4 A;  4P00 B;  4DFS A;  1UY1 A;  3SHR A;  2MEV 1;  1UZV A;  3LA3 A;  2E33 A;  1GAN A;  2VTX J;  1WLC A;  3WHU A;  1S1A A;  2YUE A;  3GHN A;  4JKL A;  4CDU A;  5C71 A;  2ARA A;  2G9F A;  1W2A X;  3LFM A;  4FFH A;  3KF5 A;  4HSJ A;  4CP9 A;  5A6Z A;  5J37 A;  5EXO A;  5FZ6 A;  4DUV A;  3B69 A;  3PNA A;  4UFJ A;  2E7T A;  1DBN A;  2QQU A;  4MSV A;  3RZZ A;  4KNC A;  4AEM A;  2WT2 A;  3ZMO A;  5GKA C;  5K0U A;  1S0J A;  3HT1 A;  5AFB A;  3ORJ A;  3BPS A;  1RUF 2;  5IVF A;  3NV2 A;  4MGZ E;  5EJ1 B;  5F3I A;  4QGN A;  3VZN A;  2C0Z A;  2BOJ A;  4HOO A;  4YSF A;  5DG2 A;  4QX5 A;  3H0O A;  4M3C A;  2FDH A;  1LES A;  3B9I A;  3VBR B;  1F31 A;  2VEC A;  4WZC A;  4XAE A;  2H0V A;  5DQ0 A;  1YIF A;  2KXL A;  5DUX A;  3SH4 A;  2J1A A;  2XKP A;  3H8R A;  4LIT A;  2A6V A;  4KGG A;  1H30 A;  1XU2 A;  4M3C F;  4UFM A;  3VBR A;  5KHI A;  4CTE A;  5F1R A;  3GNE A;  4GKX A;  4P08 A;  4QKD A;  5F6K A;  4XFF A;  2OUJ A;  3JB4 C;  5FZK A;  3WIN E;  3I2I A;  3LGR A;  4W50 A;  3PVE A;  1VE0 A;  1PNG A;  2NLR A;  5GLW A;  3GAL A;  4YVW A;  3RMX A;  1CGP A;  1GU3 A;  1ZX5 A;  4ASK A;  3IPV A;  4S2F A;  3OOX A;  4YW6 A;  4BXS V;  5DXD A;  3WF0 A;  1UW8 A;  3ES1 A;  2C24 A;  2DTY A;  1EYB A;  4PJY A;  2PQQ A;  1X9P A;  3D3A A;  1G6N A;  1UL9 A;  3CIH A;  3LFI A;  4N9I A;  2JIG A;  2QVS B;  4KWK A;  5FXX A;  3WDW A;  3FUO A;  2XVG A;  3DEM A;  1IG0 A;  5FXV A;  2OX0 A;  4UFH A;  3DKW A;  1LOE A;  1GQP A;  1JS9 A;  2BTV C;  1OLR A;  2XJS A;  3LEK A;  3O14 A;  4QM8 A;  1W9W A;  1WW4 A;  4YYO A;  2Q8C A;  4OHV A;  2Y0I A;  1S0I A;  3TRS B;  4CU6 A;  3GCW A;  5A7P A;  1CZT A;  1OPM A;  3NAP B;  1ODM A;  2P3Y A;  4FP3 A;  4R9A A;  1G8W A;  1ZVF A;  3WZ1 A;  1XNA A;  3N4M A;  1EV1 3;  4A45 A;  4PCR A;  4IEO A;  2VZT A;  2DUQ A;  1UIJ A;  2WZR 1;  3WVJ A;  3D6E A;  1URX A;  1I3H A;  1HRI 1;  1SLT A;  1TME 3;  4V2W A;  4E2Q A;  4M0N A;  1NYW A;  4ISR A;  3OCP A;  1IS5 A;  2VJX A;  4PF1 A;  4RQP C;  5BNN C;  4IE0 A;  1XSR A;  2WS9 2;  3I7D A;  1GSL A;  2W1Q A;  3ROU A;  4E8D A;  4OQ8 A;  3NWK A;  3N36 A;  1AR9 1;  2OA2 A;  5F9T A;  4ZKT B;  5IVJ A;  5KHK A;  5DUU A;  3U4X A;  2WR9 A;  2BVV A;  3VHN A;  4XF0 A;  4Y5T A;  2R32 A;  1XOY A;  3KQ4 B;  3M7A A;  3TWI A;  3VHO A;  4KU7 A;  1XXN A;  2FMD A;  4CRQ A;  2PHR A;  3QAC A;  1CAV A;  3A0K A;  2FD8 A;  3VN4 A;  1R08 2;  4FOQ A;  4K3U A;  4WVM B;  2WKK A;  2WZ8 A;  4BYY A;  1OH4 A;  1UMI A;  4AED C;  4QPI B;  2BDR A;  4CCM A;  1GOF A;  2YC4 A;  3NKT A;  1FPN 3;  2CYF A;  4K1Y A;  3WNK A;  4XJ8 A;  5JPN B;  5I0T A;  4DMI A;  3OGV A;  1H9W A;  5JDB A;  2XJQ A;  2ZGP A;  3V0B B;  3HOB A;  3MID A;  4WM8 C;  1QOS A;  4YRD A;  3SKJ E;  3MBW A;  4Q4X 1;  1X33 A;  3CJI C;  2Y6L A;  3ILR A;  3D5O A;  5J96 B;  5JLV A;  1R1Z A;  1CX1 A;  2R0H A;  2XJT A;  2JG9 A;  2B9V A;  1N1S A;  4FOY A;  1ZRF A;  3PTR B;  3M3I A;  1SLB A;  2D3R A;  2P37 A;  5FZA A;  3ZYP A;  4ARY A;  1JYV A;  4LE4 A;  3ZXG A;  5SV8 A;  4QPG C;  5C8W A;  2Q1Z B;  1UKG A;  3TEX A;  1UZY A;  5ACA 3;  2ZHK A;  2WFF 2;  3IAP A;  3RS6 A;  4CPB A;  4LBQ D;  4FTB A;  3RYP A;  4LT5 A;  1A3K A;  3OPT A;  1SPP A;  3GBW A;  4QHZ A;  4W8J A;  4AQ2 A;  3W20 A;  2CWM A;  2LM3 A;  4MGS A;  4N43 B;  4Y5S A;  3SCG A;  1HXS 3;  4LBQ B;  3QH7 A;  3ZX7 A;  5CFC B;  3ALQ A;  2D6N A;  4LLF A;  1W04 A;  3T4V A;  4LKD A;  3AP4 A;  3LSD A;  1W0O A;  3J7N A;  1S2E A;  4NHX A;  4AI2 A;  2YFU A;  3FHI B;  4JDO A;  3VDD A;  3AMN A;  1NXM A;  1RUH 2;  1JYN A;  1K5M B;  4RS5 A;  4XTP A;  5BY5 A;  2AUY A;  1VR3 A;  4MXW A;  4EE2 A;  4HPK A;  3SC7 X;  1CAU B;  1W6Q A;  1YXW A;  1SBF A;  4H55 A;  3UYJ A;  4SBV A;  4EJR A;  4MGK E;  5FY1 A;  4E4D X;  1EY2 A;  4XXA A;  1CIY A;  4RHV 2;  4QGM A;  3LSE A;  1VBD 2;  3AMP A;  3Q8E A;  1H1A A;  2UUR A;  3I97 A;  4ORF A;  3PU3 A;  1PVC 2;  3GZE A;  1RB8 G;  4P02 B;  4E2G A;  4LHN A;  1N3O A;  3HNY M;  4QPY A;  3HT2 A;  1TME 1;  2F4P A;  3CHX A;  3U78 A;  4XIL A;  3VD3 A;  4Y20 A;  3BTY A;  3N7J A;  2W46 A;  1VAK A;  4R52 A;  1ENQ A;  1JH5 A;  2DBI A;  2VOW A;  4HN0 A;  2PN5 A;  2VAU A;  3B93 A;  2Z42 A;  5FMO S;  4GWN A;  4XBN A;  3WW1 A;  4JRL A;  1COV 3;  2DCJ A;  2DUR A;  1WME A;  1K45 A;  3HPN A;  2VC9 A;  3ZXD A;  3J26 N;  1RUF 3;  5C3Q A;  5FZ8 A;  3VBS A;  5BNO A;  3RDI A;  1V70 A;  3DF0 A;  1W8O A;  4AAP A;  2ZKN A;  2ZX0 A;  3WF2 A;  4G3Y C;  5FOJ B;  2G4I A;  2VW2 A;  1UO9 A;  3J7H A;  1VBA 3;  1FPN 1;  2WQZ C;  5FPX A;  1LB2 A;  1NCR A;  4O65 A;  1CZS A;  5LRR A;  5FYV A;  2BGO A;  1AR8 2;  1RGS A;  1ZBE 1;  2E9Q A;  2PHX A;  1AYN 2;  4ZS3 A;  3VB9 A;  2PLV 3;  1Y9M A;  5DAB A;  4A3Z A;  1CAX A;  4AWD A;  3WNX A;  2WNU C;  5ISL A;  3R4S A;  1KD7 A;  2W2I A;  3KCY A;  4CCC A;  2NP0 A;  2CGP A;  5HV4 A;  2DU1 A;  3FX3 A;  1LOG A;  1ZZ8 A;  5L9R A;  4QHO A;  3R4U A;  4IDZ A;  4NPM A;  5CG9 A;  2BQP A;  1G9A A;  1VIW B;  5A3N A;  1Z0H A;  1NCQ B;  3VV1 A;  4QXH A;  4BIF A;  4YVS A;  4LTA A;  2RJK A;  2P6H A;  1C57 A;  5CKN A;  3RZJ A;  4CXX A;  2OZJ A;  3E5Q A;  5D8A A;  5BNQ A;  2HYK A;  4BA6 A;  1N3P A;  3MPP G;  1Q8V A;  1DQ0 A;  1SHW B;  3U10 A;  1PO1 2;  3N9O A;  1VBE 3;  2VBB A;  5EYX A;  1W9T A;  4COW A;  2HYX A;  3SH5 A;  3KV4 A;  4RR3 B;  3EXU A;  5EIY B;  4NRM A;  1SEF A;  3USU B;  4EWA A;  1QJY 2;  3UNP A;  2H0B A;  1QH7 A;  3Q9O A;  3IDB B;  2GC0 A;  3KHC A;  3EJK A;  1JN2 P;  1GZW A;  4MOA A;  1SDD B;  3FZ3 A;  1W9F A;  1AF9 A;  1QF3 A;  2HWE 1;  2VH9 A;  2R6Q A;  1RYY A;  2WNO A;  1VP6 A;  3DYP A;  5G05 L;  1IPK A;  2HBT A;  5F3C A;  2RR1 2;  3JQW A;  4CA9 A;  1O8S A;  1RXF A;  2B4K A;  4WM7 B;  5CAZ A;  4YW2 A;  4CDW A;  3EMR A;  3H7J A;  2XOM A;  1PZ8 A;  1JU4 A;  3WNP A;  1BLZ A;  1QWR A;  2W1S A;  1YQ8 A;  1ST8 A;  4AI1 A;  4PBP A;  4Q4W 2;  4NIG A;  4I3G A;  3WSO A;  4UYB A;  1U0A A;  1SCR A;  3ZFG C;  5A6Q A;  5AFE A;  1J3P A;  2G19 A;  4AI9 A;  1IS6 A;  1H0B A;  5FR3 A;  5FK8 A;  3ZOI A;  4I01 A;  2D5H A;  4YW1 A;  1OBN A;  2TNF A;  1YQ6 A;  4OUL A;  2GNM A;  1S2B A;  3HNB M;  3B3Q E;  1ULP A;  2C9K A;  2XML A;  1UZW A;  4FP2 A;  5FK7 A;  1RUF 1;  4JQT A;  3K48 A;  5C4W B;  2JKX A;  3WNN A;  4CPB D;  1KIT A;  1XYO A;  3AVS A;  4LBN A;  1IPJ A;  2OPW A;  3AXE A;  2VR4 A;  3MFC A;  1RUJ 3;  1AR7 2;  1OOP A;  1IKP A;  1LED A;  3APB A;  4EN9 B;  1KS4 A;  5E88 A;  1GQH A;  4HSL A;  5FPU A;  3DPR A;  3RPQ A;  4FXG B;  5FZF A;  1G9D A;  1E57 A;  2VUC A;  3KSC A;  4B1L A;  4CVU A;  2XUE A;  2B8M A;  1W6N B;  1GNZ A;  1XYN A;  1BEV 2;  3C7G A;  1HQL A;  3JXS A;  3Q8A A;  4RGK A;  3MEP A;  5F7U A;  1F9K A;  2X8K A;  3OPZ A;  3KWV A;  4BOW A;  2OW4 A;  3WD5 A;  4DUW A;  4PIY A;  1NZC A;  3ZXA C;  1CD3 G;  1QXJ A;  3JD7 3;  3WXP A;  1QXP A;  1W6O B;  4NAM A;  4DEV A;  2VOK A;  1QOO A;  4ASM B;  1UF2 C;  2XBO 2;  4FCA A;  3ZM8 A;  5FWJ A;  3M3C A;  5CYY A;  2QBX A;  4ZON A;  4AOC A;  2WAO A;  3DXU A;  2XR4 A;  1RUH 3;  2ZX4 A;  3OY8 A;  1JUI A;  3J8F 3;  4TXW A;  1PGW 2;  3ZXJ A;  1UYX A;  1X9T A;  2ZGR A;  4J1X A;  3NQH A;  4YGC A;  1UNB A;  5AC9 3;  4Z92 B;  3O1U A;  2Y6K A;  1NE6 A;  4CP2 A;  4CP0 A;  2A6X A;  1V00 A;  5IAV A;  4XUQ A;  1JTZ X;  1AJO A;  5FP7 A;  5T55 A;  1UXZ A;  1LTE A;  4HVR A;  4MET A;  4XAC A;  5DAQ A;  4EV0 A;  4F7Z A;  1RMU 3;  5A6X A;  1W8N A;  5KC5 A;  4MX3 A;  2GNB A;  2BVB A;  1KRI A;  2XL9 A;  1UXX X;  4D7T A;  3T2T A;  4KBZ A;  2D6K A;  3JQX A;  1POV 0;  4L9B A;  4IEX A;  1SBE A;  3ZFE B;  3WDX A;  3VHR A;  4E8C A;  1UX7 A;  2WS9 1;  2X53 S;  3NW4 A;  4OYU A;  1BK0 A;  2VE1 A;  3FLP A;  1J1T A;  2WT1 A;  3I4I A;  1LEC A;  1KJR A;  4IL7 A;  4JGY C;  1ENS A;  4Y1V A;  3B9C A;  3UGH A;  3VBF A;  5CBL A;  4Y24 A;  1JHN A;  3S30 A;  2BW8 A;  1Y3T A;  5FP9 A;  1DLL A;  4K20 A;  5HCF A;  3UGG A;  4UBG A;  4XF9 A;  3TBD A;  3WQB A;  2FCT A;  4M4R A;  4F8A A;  1LUL A;  3D4K A;  1D4M 2;  2XJR A;  1R08 1;  4Y4R A;  3MV1 1;  1Y9Q A;  2Q30 A;  2YG0 A;  1W39 A;  3EO6 A;  3JZV A;  1MQT A;  1BCX A;  2R30 A;  4L0P A;  4CEW B;  1AVB A;  2D6M A;  2NPI A;  3M3E A;  5EP9 A;  1LRH A;  3WQ7 A;  4A7Z A;  4JCK A;  2VNR A;  1CAX B;  4I0B A;  1HLC A;  3GF6 A;  4TTG A;  3OEB A;  2E6V A;  2HWD 2;  2VPV A;  4RL7 A;  3SCH A;  4P9L A;  2YBK A;  4XOG A;  1PGL 1;  1CJD A;  4YW3 A;  2X10 A;  3O7O A;  5A32 A;  1NA1 B;  4GKY A;  3JB8 A;  2UYA A;  3TOJ A;  5C8C C;  5FZ4 A;  2VZS A;  1FI2 A;  2C5D A;  4GQ7 A;  3S7I A;  3M8L A;  1DU3 D;  1QDO A;  4BLI A;  4D6S A;  4BK5 A;  3HIF A;  4YAR A;  2LUW A;  3V64 A;  1JOD A;  5I8T A;  2Z69 A;  1B09 A;  2GME A;  2GSY A;  2A6W A;  3AX4 A;  1NG0 A;  4AHX A;  2SBA A;  2ZPX A;  3LWC A;  2UWC A;  1OT5 A;  1RUG 3;  2WFF 1;  1KQR A;  3VZO A;  5L7O C;  4FPJ A;  3R6S A;  4NAO A;  5APA A;  5CFD B;  2K0G A;  1G9B A;  4LO7 A;  2W5F A;  1UYZ A;  3MO4 A;  1FMD 3;  4AR2 A;  5FZC A;  2ZZJ A;  4BWO A;  2VMH A;  1OI6 A;  2J22 A;  2VMC A;  4HVQ A;  5FXZ A;  3I59 A;  2R7E B;  3JD7 1;  2IZW A;  5DN2 A;  4XFB A;  3VBH C;  2Z79 A;  5KC6 A;  1CN1 A;  5B4N A;  4ZU5 A;  4Q29 A;  1YI9 A;  4QAW A;  1JZ5 A;  1RUH 1;  4P9W A;  2WII B;  1AJK A;  3NV1 A;  2UY9 A;  3NNJ A;  3PIG A;  5F2S A;  5JIA A;  1XC6 A;  4R9B A;  1MVQ A;  2DDU A;  4ONU A;  4UBH A;  1OLM A;  5FDB A;  2GP3 A;  4LOR A;  2RG4 A;  4MZU A;  1HQN A;  3INA A;  2PXJ A;  3ZMN A;  4BQW A;  5I8S A;  3TN9 2;  4JHZ A;  4RHV 1;  5L19 A;  2ZKL A;  4IEU A;  1VBD 1;  4IW3 A;  4JTN A;  3WNO A;  2JWP A;  1YFX A;  3OGG A;  2MPF A;  4FFF A;  5FIX A;  1GP4 A;  1LHU A;  1PVC 1;  1LR5 A;  1JZ7 A;  4CCL A;  1D2S A;  4GH4 C;  4LUK A;  2CGO A;  4NRO A;  4PI2 A;  1H2M A;  5T3N A;  4XHB A;  1FOD 3;  4YG6 A;  3D8C A;  3FWE A;  3ZYF A;  1Z7S 2;  1QJU 2;  4XXP A;  4CZS A;  4GMP 3;  3POI A;  4NRP A;  1B35 C;  1ZA4 A;  3ZIW A;  4IND A;  4ZU4 A;  1W6P B;  3H3U A;  1RUI 2;  4C0H A;  4UXA A;  4CCK A;  2WNV C;  3CF6 E;  2ENR A;  1ND2 C;  2ES3 A;  3WF1 A;  5JXI A;  1I9R A;  1AX0 A;  2ARC A;  1AL2 2;  2PTM A;  1W0P A;  2W87 A;  4IV3 B;  2JE8 A;  3OBZ A;  4FPL A;  3CO2 A;  1GQG A;  4UI9 L;  4AHZ A;  2QJV A;  3KVB A;  3OJB A;  4M3C E;  2VQU A;  4IER A;  3HN1 A;  1LOC A;  4X6R B;  4DZG A;  4BH9 A;  5FP8 A;  1CJP A;  3A23 A;  1DZQ A;  5EQU A;  1G9F A;  3ZXK A;  1Y7B A;  2VW1 A;  1DGW A;  4J6G A;  1AR8 1;  5LWB A;  2P2K A;  2DVA A;  1VMF A;  4NIA A;  4R8H A;  4L11 A;  4DPN A;  3LKJ A;  1CPM A;  2PHU A;  2RDN A;  1MZ5 A;  3ZN6 A;  4BPZ A;  5C5U A;  3D0J A;  1M4W A;  5CG8 A;  5C3R A;  1W8T A;  2JG8 C;  2R16 A;  4CP1 A;  3IWZ A;  1GLH A;  2NM1 A;  4RQP A;  5BNN A;  3C7E A;  4Q26 A;  5B4X A;  2RS5 2;  5A7O A;  4CDQ B;  3VDA A;  1RUG 1;  2CU5 A;  2ET1 A;  2XBO 3;  5FLJ A;  1RIN A;  1US2 A;  2B7Y A;  3TEY A;  4ISQ A;  2EXJ A;  1K3I A;  2OVU A;  2XQR A;  3A0N A;  1AL0 G;  5BNP B;  2VQ0 A;  1QHD A;  4LKS A;  4COV A;  4JGZ C;  5C70 A;  2WIN B;  1PO1 1;  2PMW B;  2XVL A;  2WYF A;  3AL5 A;  3QD6 A;  3BCW A;  3RYK A;  4UFI A;  4AHW A;  3VUO A;  2QZ3 A;  5ABJ C;  5C9A C;  4MLO A;  3AKR A;  3HR9 A;  5H9Q A;  4AED A;  1JYT A;  4N90 A;  2YGM A;  5FYT A;  5LAS A;  1QJY 1;  1UPI A;  2UYB A;  4XTM A;  2WQ8 A;  2D6O X;  1LOF C;  1LOA A;  2WO2 A;  3BN6 A;  5DUW A;  1UQX A;  2YC2 A;  4XF1 A;  3ZFF C;  4HVO A;  1DQ5 A;  1GWM A;  1MS4 A;  3OGS A;  5FUI A;  5LA9 A;  2FCV A;  3HNM A;  4WM8 A;  3UKT A;  4H3W A;  3FE5 A;  4GUL A;  3BB6 A;  4PQQ A;  1RUN A;  2F4L A;  1UOB A;  3AP5 A;  3CJI A;  5LZ6 A;  4RGG A;  5GLT A;  2RR1 1;  3E5X A;  4OHW A;  4N53 B;  1H6X A;  2VOT A;  3WUD A;  1CVN A;  5JZG C;  1GP6 A;  4OUE A;  2CGN A;  4BHP A;  1WLT A;  4QHB A;  2HWB 2;  1GMM A;  4XMI A;  4BQ4 A;  1DZT A;  3ZIX A;  1EPW A;  2RM2 2;  1W06 A;  1D4V B;  2DF7 A;  4QPG A;  1WLD A;  3POE A;  4Q4W 1;  3VKN A;  1YCI A;  2LRP A;  2YPJ A;  4KWJ A;  5LY2 A;  5A1L A;  2JDP A;  5LBC A;  3VDC A;  2IXH A;  2ARE A;  3N9L A;  4GMP 1;  3WW2 A;  4BCU A;  1IQA A;  1W03 A;  3O1P A;  2XWB B;  2FQP A;  1HB1 A;  4LK6 A;  4MHU A;  1JYI A;  3VLB B;  3HAG A;  4AG4 A;  1GZT A;  1KDK A;  4S2H A;  2EVX A;  4ATF A;  5GZC A;  1QJZ A;  2KA3 A;  4XFH A;  1APN A;  4Q0V A;  1PMH X;  2BNN A;  2YYO A;  5FYC A;  2WDB A;  5T5O A;  3MUY 1;  5LY1 A;  1FXZ A;  1O59 A;  3EBR A;  3M2M A;  3O1S A;  2J1R A;  2P17 A;  1DHK B;  1MZF A;  3I2K A;  3PIJ A;  1PO2 2;  1RL3 A;  4XUO A;  1AHS A;  2VNV A;  5M0T A;  1OKQ A;  4YLZ A;  3TEZ A;  4QXK A;  2GC1 A;  1W2U A;  2EAL A;  2VM9 A;  3MIC A;  1R09 2;  2JKB A;  4LA2 A;  4LXL A;  3MIB A;  4YNI A;  3A21 A;  3KT7 A;  1HB3 A;  3HVD A;  4YFZ A;  2CNA A;  4H7M A;  5FY0 A;  2A70 A;  4R4Z A;  5JCT A;  4MH0 E;  3U14 A;  1BEV 1;  3VBU C;  1KFU L;  5F8P A;  3FBY A;  2A3Y A;  3J4U H;  4FTE A;  1PMI A;  2ZGT A;  4IV1 B;  4YZ4 A;  2Y34 A;  4HAN A;  2VUD A;  4OHX A;  1LU2 A;  2ILM A;  1W6M B;  5FPZ A;  4IGP A;  3K46 A;  4NWW A;  3VBO C;  1C5I A;  3UK9 A;  1AX1 A;  2XBO 1;  1PK6 B;  2BYV E;  4XFC A;  1W3V A;  4HK9 A;  5KWR A;  1JHJ A;  1VLN A;  1S0D A;  2QNK A;  4SLI A;  5BXX A;  4CCE A;  3VD9 A;  3CL1 A;  3E6C C;  1N1V A;  2D3S A;  5KXD A;  1T6B X;  3RQ0 A;  4HT1 T;  4HKL A;  3TNQ A;  3UGF A;  1PGW 1;  5FPV A;  4AL9 A;  1J83 A;  3POG A;  1XNB A;  3ZDS A;  1C8N A;  4YM2 A;  4Q4X 3;  2EA7 A;  4KG0 A;  1MEC 2;  1NX9 A;  2W39 A;  1QJX 2;  1UZ0 A;  2VZR A;  4I02 A;  4XFI A;  3CKH A;  4DXR A;  3I2H A;  1F8V A;  1CES A;  1RUO A;  2JDA A;  3CU7 A;  3H3Z A;  3S7E A;  1PM4 A;  1CZV A;  2WO1 A;  5E16 A;  2YBP A;  2WNU A;  2ZHM A;  3PMS A;  1Z7S 3;  3LA2 A;  2AEZ A;  2OXB A;  4JDN A;  4NN0 A;  5FJH A;  4Z8B A;  4XAA A;  4X8N A;  2OZ6 A;  1DP0 A;  3E6D A;  1RUI 3;  4IEQ A;  5FMC A;  3VZL A;  2F6B A;  5D2A A;  3RWN A;  3OG2 A;  2NMN A;  2VXR A;  3N9Q A;  4NHL A;  2WLP A;  4OI4 A;  3FJS A;  2D93 A;  1D0G A;  2KD7 A;  5EJZ B;  4UF0 A;  4UW6 A;  2R06 2;  2Z4F A;  3LF7 A;  4CCO A;  5FOB B;  5IVC A;  3ITQ A;  1OA4 A;  3LEI A;  3O0V A;  4YZ5 A;  1D4M 1;  4CXY A;  5L9B A;  1UY3 A;  3U37 A;  3WW4 A;  3WQ1 A;  5FZ1 A;  1KS5 A;  5F37 A;  4Q5O A;  3DKQ A;  1WD3 A;  2CDO A;  2JJ6 A;  3GHM A;  4EZ4 A;  2PQS A;  3JCI A;  3DYM A;  4EYU A;  3GZU C;  5LW9 A;  4F83 A;  2A3W A;  5FZ9 A;  2W08 A;  3I3M A;  4LR4 A;  1XRU A;  3NRU A;  5FBJ A;  2VZV A;  3KGL A;  3PUI A;  1KDM A;  3PVN A;  3VBR C;  2HWD 1;  5I0D A;  2RDS A;  3HMY A;  4HLT A;  2PHL A;  2BER A;  1OHF A;  4Q2F A;  4R9C A;  5BPX A;  1IPS A;  1ND3 B;  2ZML A;  4UOJ A;  4NUB A;  1F5F A;  4ET7 A;  2VU9 A;  3OBT A;  3PLQ A;  4CDX B;  3B7M A;  1YLL A;  4MXV A;  4RSU A;  4B7E A;  1S0F A;  5DAW A;  5EV7 A;  4JHT A;  3PUR A;  3RVH A;  3ZSL A;  2NQY A;  2AZ5 A;  3ILF A;  2HEW F;  2RS3 2;  3POY A;  5I0U A;  5FYZ A;  4Q4Y 2;  2JDZ A;  2PA7 A;  1TNF A;  2R1D A;  3WEZ A;  1F35 A;  4NID A;  3K3O A;  3VHP A;  1ZZB A;  2D43 A;  3M4F A;  2ZMN A;  1CQ9 A;  2PHF A;  3T09 A;  5CEH A;  1RHI 2;  2RS1 2;  4XJA A;  3ZFG A;  4XFA A;  1SLC A;  2VUA A;  1XB9 A;  4RN5 A;  2ZZQ A;  1PVX A;  4AW7 A;  4QQP A;  3HBZ A;  4NO4 A;  3LAG A;  1YNA A;  1Q5O A;  2X5I B;  1O3Q A;  3WG3 A;  3NAP C;  2JB8 A;  1F4H A;  3WF4 A;  4QU1 A;  2WJS A;  1O4T A;  2WAA A;  4K1Z A;  1BVV A;  1D7P M;  2GDF A;  1UMZ A;  1ZBE 3;  1W2O A;  2WWU A;  3BAL A;  3GXU A;  2EAA A;  5LK7 B;  1LEN A;  2FHR A;  5FWE A;  1WBF A;  1GUI A;  1SLA A;  2ETE A;  1NKG A;  1WZX A;  3MIH A;  2N7G A;  4Q27 A;  5JSO A;  3TN9 1;  1JU3 A;  3AYD A;  1A8D A;  2WC2 A;  4LHL A;  5DZG A;  4WZF A;  4B3N A;  1C1F A;  2K2S A;  4AVB A;  1POQ A;  1WW6 A;  2VOX A;  2RJ2 A;  1NUK A;  2VME A;  4HET A;  4AFB A;  3BI3 A;  4QQH A;  2RM2 3;  4WVZ A;  1ZBA 2;  3T08 A;  4XZP A;  4CEY B;  3C7O A;  5FZI A;  4D0Q A;  4AFM A;  4HMZ A;  1Z7S 1;  1QJU 1;  3GJB A;  5A3T A;  1LHW A;  1VRH 2;  2HWC 2;  1SQ4 A;  1RUI 1;  1WCQ A;  2B45 X;  2ET7 A;  3AZX A;  1JOJ A;  3HQR A;  2XJV A;  2DU0 A;  2Y33 A;  1AL2 1;  3I2J A;  4QPI C;  1K5J A;  3NJX A;  2R04 2;  2GZW A;  4A3X A;  2PEL A;  2ZGK A;  3W9A A;  1VPH A;  1VBB 2;  4PIX A;  2AC1 A;  1FNZ A;  5BYN A;  1H8T B;  3ELN A;  2X05 A;  3B02 A;  3C3V A;  4PDW B;  3IMM A;  4Q4V 2;  2WWS A;  2BFU S;  3LIH A;  4CU9 A;  3CBN A;  5FZD A;  5CU1 A;  4FFI A;  5GZD A;  5CNA A;  2VZU A;  4OUM A;  3BGA A;  2HWE 3;  1BZW A;  1WWY A;  1TE1 B;  5LA0 A;  1HV0 A;  4JV4 A;  2QQV A;  4K8R B;  3NV3 A;  3VD7 A;  1N1Y A;  3ZLI A;  5IYY A;  4DXT A;  5IW0 A;  5FY9 A;  5JOY A;  1J3Q A;  2R49 A;  3WX5 A;  4CDU B;  5D1I A;  1XND A;  2QQL A;  3CDZ B;  4XW3 A;  4CP9 B;  4KG8 A;  4BXF A;  2C6S A;  1UOJ A;  3BOD A;  3IKW A;  1D2Q A;  4N43 C;  3L2H A;  5FTT C;  4Y26 A;  3H8X A;  2ZJC A;  5CFC C;  2RS5 1;  1I1E A;  5LEJ A;  1H9P A;  4JGY A;  3I3D A;  5K0U B;  2AGS A;  1GZ9 A;  1OKO A;  2JDU A;  3QH6 A;  3BTX A;  4AFD A;  2CAU A;  1DFQ A;  1PZ7 A;  1XPW A;  1FAT A;  4IE6 A;  3WDV A;  1U5Z A;  4KWL A;  1AR6 2;  1XU1 A;  1K5M C;  4QQO A;  3VGI A;  4XDP A;  1CON A;  5FY5 A;  4M3C B;  3OYW A;  4NPL A;  1IHM A;  4P9G A;  4Y5Z 0;  4GWM A;  3NNM A;  1AXY A;  5GLU A;  3V56 A;  2DVF A;  1BYH A;  3AMM A;  1MEC 3;  3LCP A;  2ZX3 A;  5FZB A;  4D7Y A;  2W3J A;  3SKV A;  5FKC A;  4LIV A;  5HV0 A;  2W95 A;  3AZV A;  2ZGU A;  4Y1X A;  5DDJ 2;  1YWK A;  2R0F A;  4IGQ A;  3IM0 A;  1W8F A;  1TMF 2;  3AKQ A;  5F5Q A;  4DO0 A;  2BGC A;  4YVW B;  1REF A;  5C8C A;  3OSD A;  2JEC A;  4IGO A;  1J59 A;  2I74 A;  2YDE A;  4UW4 A;  1DYP A;  2JD4 A;  5DUV A;  1ZRI A;  3IPV B;  1DG6 A;  4W4Z A;  4MGQ A;  2I45 A;  5H9P A;  4AGR A;  3N7M A;  2HWB 1;  1ENR A;  5FYH A;  3I54 A;  3WNL A;  5I91 A;  3WG4 A;  1JZ6 A;  1ZRE A;  2RM2 1;  4UFL A;  2JDM A;  4K7J A;  4L92 A;  1ULE A;  2R06 3;  4LA3 A;  1QNY A;  4O9E A;  2PYT A;  4QB1 A;  5L7O A;  4ZS2 A;  3QCW A;  2VW0 A;  1SZB A;  5FMO L;  3NJY A;  3NV4 A;  2YU1 A;  3AKT A;  2Y6H A;  3QOP A;  2DYC A;  4NHM A;  2AYH A;  2XG3 A;  4MGT A;  1V6I A;  2HWF 2;  4PI0 A;  3THT A;  2GP5 A;  1VJ2 A;  3OUJ A;  5EFU A;  1TQ5 A;  1WMF A;  1QDC A;  1F5J A;  2VTF A;  4IE4 A;  3VBH A;  4I30 A;  3W21 A;  2ZHN A;  2W1U A;  1U5X A;  1BMV 2;  1OF3 A;  1ZZC A;  2P6C A;  4A44 A;  5LAT A;  2XJU A;  4TZD A;  2WLQ A;  4LO6 B;  1F4A A;  4AI3 A;  1JZ4 A;  1Y43 B;  3GYD A;  1KGY A;  1OQD A;  1YEW A;  1V6L A;  1V9U 2;  3BOP A;  4NII A;  1PO2 1;  1Q8Q A;  5CA6 A;  5DZE A;  4PLN A;  3WR0 A;  4QT6 A;  5EHD A;  4YM3 A;  1W8W A;  1YFY A;  2TUN A;  4A6S A;  1V6J A;  1CAW A;  5H9R A;  3T4H B;  2CSG A;  2BWA A;  2YMZ A;  2JXA A;  3M3Q A;  2D6P A;  5IK7 A;  2A75 A;  4MAD A;  3THD A;  1NCQ C;  2B42 B;  5LB6 A;  4BE3 A;  2RS3 3;  2WS9 3;  2VMG A;  4AFC A;  1CAV B;  3K4Z A;  4KWU A;  4QWN A;  3CNA A;  2QFE A;  1C8M 2;  3OUH A;  3WP5 A;  4GH4 A;  1DQ4 A;  1JZ3 A;  3C7F A;  1UU4 A;  1WMD A;  2WUH A;  5J1X A;  4JAA A;  4XQ4 A;  2RS1 3;  4XJ9 A;  4LEJ A;  1SFN A;  2UWA A;  1N1T A;  3HEI A;  2JDY A;  4FPE A;  3LB9 A;  3MW3 A;  4GA9 A;  5E6H A;  4DNY A;  1R08 3;  1B35 A;  3BIW E;  3U4S A;  2XB6 C;  5FPA A;  2EXI A;  1VBC 2;  2Q1F A;  4XCB A;  2WNV A;  3OF1 A;  4RR3 C;  1ND2 A;  1ZA7 A;  1RJ7 A;  4K21 A;  1OLM E;  1XNT A;  5FQ0 A;  3WY6 A;  4I3P A;  2Z2S B;  3DN7 A;  5CKM A;  3NJZ A;  3THC A;  2JG9 B;  3ES4 A;  1Q8P A;  2EIG A;  5FZE A;  1QIQ A;  4FAG A;  3KD4 A;  5A33 A;  3K51 A;  1BKZ A;  2WA3 A;  3E5U A;  5IHR A;  1MEC 1;  1V6M A;  5DZF A;  1J3R A;  1QJX 1;  2VUJ A;  4ZY9 A;  4AI8 A;  4WM7 C;  4EWE A;  4BQ5 A;  2LRO A;  1SG3 A;  5KBF A;  5JPM B;  4GB3 2;  4DY5 A;  1IOA A;  3QLQ A;  1NZI A;  4COY A;  5KR7 A;  1ZBA 3;  1EAH 2;  3P5B A;  1SPP B;  3L9J T;  3C2U A;  1LCL A;  3ZSM A;  1QKQ A;  3B94 A;  5FYM A;  3MIF A;  1EUT A;  4GAZ A;  4B4P A;  4OI2 A;  5IVE A;  2WFF 3;  2ZGN A;  5FBZ A;  2DVG A;  4UW3 A;  2Y6G A;  5A7N A;  2CV6 A;  3F2Z A;  4IEY A;  2ARX A;  2Y6J A;  3HQU A;  1W2T A;  2JG8 A;  4BIO A;  1LNS A;  2XWJ B;  4XUR A;  4XPV A;  3MV0 1;  5F2W A;  4GMP 0;  5DG1 A;  3VDD B;  2CAV A;  3AZZ A;  4RS5 B;  1OQE A;  2L9L A;  2R06 1;  4BU2 A;  5IJR A;  1GWK A;  4MXW B;  2XGX A;  4IEZ A;  2GAU A;  1OUS A;  4HPK B;  4BME A;  2SLI A;  1W6Q B;  3RJR A;  5IK8 A;  2CHH A;  2TEP A;  3JBG 2;  4HZF A;  4PT6 A;  5C4W C;  4LOT A;  1W9Y A;  1H2N A;  3G6J B;  2P4E A;  4Q4V 3;  4JGZ A;  1DGR N;  3WCR A;  4DRR A;  4RFR B;  3ZVX A;  1HKD A;  2A6Z A;  1N3Q A;  2VD7 A;  4LBL A;  1WGP A;  2ZHL A;  1QY4 A;  1C5H A;  5ABJ A;  5C9A A;  1GZC A;  3AJZ A;  1GOH A;  3H3L A;  5BUV A;  1AXZ A;  1WKY A;  3H1Y A;  5T54 A;  1UYP A;  5HCA A;  5HPO A;  1GBG A;  4OVE A;  1SFP A;  4RHV 3;  5H9S A;  1LOF A;  1VBD 3;  3AKS A;  3USS A;  3ZFF A;  1BXH A;  1PZ9 A;  1DGW X;  4Y20 B;  4FTS A;  4XUT A;  4JX0 A;  1PVC 3;  3RRD A;  3ZR6 A;  3AMH A;  3ABZ A;  1UMH A;  1X8M A;  3ZSK A;  3S0M A;  1LOB A;  1OLQ A;  4BDV B;  4Q8K A;  1IG3 A;  5CB7 A;  3DV8 A;  4GJY A;  3SEE A;  4KU8 A;  5JZG A;  2YU2 A;  2RS3 1;  4OUS A;  2C4X A;  4Q4Y 1;  5JWP A;  1WA6 X;  3UL2 A;  3I2O A;  5IUQ A;  3ZKU A;  1Z78 A;  4XYX A;  4BK4 A;  4RYD A;  4QGL A;  2OKX A;  3VBS B;  3VZK A;  5BNO B;  1AR6 3;  2D3P A;  4A42 A;  1WA4 A;  5E8A A;  2RVA A;  2QCS B;  4FVV A;  5FPB A;  4ES9 A;  5CAD A;  1OUX A;  1RHI 1;  2RS1 1;  4P9Y A;  2QE3 A;  1RUC 2;  3ZSJ A;  3UJQ A;  3DUI A;  4ASL A;  4BQ3 A;  2JE7 A;  1NCR B;  4YGD A;  2GMP A;  1W0N A;  1MZE A;  1ZZ6 A;  3CZU A;  4Y22 A;  4FOV A;  4CU7 A;  1NQD A;  2BUK A;  1LHO A;  2VVE A;  1BVP 1;  1WMX A;  2VNO A;  2A6Y A;  3POJ A;  3TB0 A;  2VUL A;  1I5Z A;  5A1F A;  4LBJ A;  2ZGS A;  1AR8 3;  2P5B A;  1AYN 3;  2VNG A;  3V0A A;  3ETP A;  3NNG A;  3RWK X;  5HI0 A;  3ZFE C;  4EN8 B;  4FPF A;  2V5Y A;  1L7Q A;  3NST A;  4YVS B;  2FBE A;  4DQA A;  1O6U A;  2ZGQ A;  5FUP A;  5LK5 A;  3IT8 A;  5AVA A;  4M01 A;  2ZBJ A;  3EHK A;  1VMH A;  5DPN A;  5JR7 B;  4F3J A;  1UN1 A;  4AFA A;  4CCN A;  2VO5 A;  1ZBA 1;  4HN1 A;  2YPD A;  5D8A B;  2WO7 A;  4E4H A;  3N7K A;  5A7W A;  3ZKY A;  4CU8 A;  3RMY A;  5T5P A;  4NVP A;  3WP6 A;  1RUD 2;  1RVF 2;  4AVS A;  5FO8 B;  3VBU A;  1VRH 1;  4NWV A;  2HWC 1;  2ZGM A;  3P3P A;  1SLL A;  5FZ7 A;  1OVP A;  4LUL A;  3RYR A;  1RC6 A;  2G1M A;  2ZEY A;  3H1W A;  3FFZ A;  3IAQ A;  1ULC A;  2J7M A;  4U2A A;  4ES8 A;  2E7Q A;  4CEW C;  3IDA A;  4QDS A;  4Z07 A;  2YFZ A;  1X36 A;  2HWF 3;  1PO1 3;  3WLU A;  2R04 1;  5C3O A;  3WQ0 A;  1GZW B;  5BV6 A;  2P34 A;  3VBO A;  2VZ3 A;  3UKV A;  2ZAH A;  3NO8 A;  4N9H A;  5FZO A;  1VBB 1;  1ZYB A;  4QQL A;  3LE0 A;  2Y8K A;  1QJY 3;  2Q5T A;  2BBV A;  1H4H A;  2PAM A;  2AEN A;  1NA1 C;  1TEI A;  1IS3 A;  4XCA A;  4Q4V 1;  4BQ2 A;  2RHP A;  1NLQ A;  4LNV A;  1NXD 1;  4TLG A;  4D69 A;  4CDW B;  3ACF A;  2Q8O A;  2BNO A;  1H2K A;  3O0X A;  1DDL A;  4XVH A;  2ZAB A;  3N35 A;  1ULD A;  3GBF A;  4OMC A;  2RR1 3;  3A4U A;  2VCB A;  2QQP A;  4KQ7 A;  3SIT A;  4E9K A;  2A71 A;  2OQ6 A;  2QQO A;  2YRO A;  4AGG A;  5A70 A;  3E1F 1;  5HXM A;  4LJH A;  1YFU A;  5CFD C;  4ARX A;  1GWL A;  3GZA A;  2GNT A;  3LPF A;  4Q4W 3;  4Y33 A;  4FXK B;  4MGY E;  4QPW A;  4QX0 A;  4TWT A;  2O0O A;  1OSG A;  3RZM A;  4FOW A;  1C1L A;  4AEK A;  4IEP A;  2QZ2 A;  2DVB A;  3K4A A;  3O0W A;  4AK3 A;  5LRS A;  2BGP A;  2WSU A;  1W8H A;  1AR6 1;  5FAX A;  5CZK A;  1U5Y A;  3MW4 A;  4Z2A A;  4V2V A;  5F39 A;  3KV6 A;  5FCC A;  2VGD A;  1QOT A;  4YFW A;  1OOP B;  1A34 A;  2ZTN A;  3SH3 A;  5JOZ A;  5A3L A;  1A78 A;  3FN9 A;  1LOD A;  2DCT A;  3ASI A;  4Y1U A;  2LTN A;  2HKX A;  2Q4S A;  3DPR B;  2I07 B;  1AXK A;  2V4V A;  5FZ0 A;  3SCF A;  4DB5 A;  4BQX A;  2DCY A;  2OUH A;  3AP7 A;  2BZD A;  4FPY A;  3O1T A;  2XPJ A;  1AR7 3;  4GB3 3;  3I3Q A;  3UV9 A;  1XYP A;  4LQR A;  1Y9G A;  2ID4 A;  3GGL A;  3GM8 A;  3H9A A;  3DCQ A;  5DDJ 1;  1EAH 3;  5L73 A;  3ZSE A;  1YJK A;  3BOW A;  1ZRC A;  1TMF 1;  3ON7 A;  1AYN 1;  2J42 A;  2J1E A;  4ZZ8 A;  4AGV A;  4EQV A;  5KHJ A;  2IVI B;  4GD4 A;  1BEV 3;  1V6N A;  3GJA A;  4QX3 A;  2ARB A;  4EN7 B;  2RDQ A;  3LQC A;  1WW5 A;  4BM8 A;  4LPL A;  3U0Z A;  3RI8 A;  4BLJ A;  4GWJ A;  4O9G A;  5CIR A;  3OY8 B;  4JGZ B;  5T52 A;  3OB8 A;  1QEX A;  4IV3 C;  2HJI A;  1RJ8 A;  5FJK A;  4AVT A;  3ACG A;  3RGB A;  2BBA A;  3AC0 A;  1DF0 A;  1L3J A;  4UFK A;  3OGR A;  1UCX A;  3K4D A;  4XFG A;  1Q56 A;  1SAC A;  2E63 A;  2HWF 1;  3AMQ A;  1NY7 2;  2RJL A;  3JUU A;  4YWA A;  4Q0Q A;  1BMV 1;  1EV1 2;  5C3P A;  5I0R A;  2VCA A;  2WBK A;  4DXZ A;  4S2G A;  4IE7 A;  2W9X A;  2E26 A;  4A4A A;  4FPG A;  4AQT A;  3PUS A;  4K6B A;  3NAP A;  3BKZ A;  5GZG A;  1MS9 A;  1V9U 1;  1TME 2;  2J1S A;  3M1H A;  5GJ6 A;  3URF A;  1LGN A;  2D6L X;  5JXH A;  5E1R A;  4LE3 A;  4QXB A;  3ME2 A;  4LLO A;  1GKB A;  4B4R A;  3ETQ A;  3VBF B;  4PLO A;  1PHM A;  1SBD A;  1R64 A;  3FUQ A;  2IUW A;  2R07 2;  1HQW A;  1H1I A;  4NHY A;  5F5A A;  4FSJ A;  1JYC A;  1FV2 A;  3MPB A;  3RJ2 X;  1JBC A;  4CDQ C;  2WL1 A;  1T2X A;  1L7R A;  2HLE A;  5JXG A;  1C8M 1;  3O1V A;  3SEP A;  4CCD A;  5G04 L;  4QQ2 A;  1MQT B;  5FYB A;  1MS5 A;  1ULG A;  3WF3 A;  4Q0P A;  2OQ7 A;  3T0D A;  3GBG A;  5BNP C;  2B9U A;  1QJF A;  4XIK A;  1RUC 3;  1JI6 A;  1D4M 3;  1FPN 2;  1YQ2 A;  1OXC A;  1F15 A;  2QQK A;  3LOI A;  4YG0 A;  3T0B A;  4WVM A;  5F5C A;  1YYN A;  4QMA A;  5A32 B;  2GMM A;  3NVC A;  1J58 A;  4QPI A;  2VZO A;  2BNM A;  2P1B A;  3KV5 A;  2EIC A;  2UWB A;  1ALY A;  3H7Y A;  5FP3 A;  4E4S A;  1CPN A;  1S0C A;  2HWD 3;  3ZPY A;  3KB5 A;  4LKF A;  4UAP A;  4AVV A;  4PHZ A;  1G9C A;  5FPL A;  3KM5 A;  2ZXQ A;  1WLW A;  4FFG A;  3OGJ A;  5J98 B;  4N53 C;  4TN7 A;  5ACA 2;  4FI9 A;  3HJR A;  4J1W A;  3S6P A;  4L97 A;  4L8Q A;  1AR7 1;  4GB3 1;  4X8P A;  4A41 A;  4D8M A;  2JEM A;  2DFB A;  1EAH 1;  4W65 A;  1OVS A;  1X8E A;  2R1B A;  1BBT 2;  3POF A;  3S5Q A;  3ZXF A;  3FFQ A;  2K9Z A;  3AZW A;  1W8Z A;  4A7K A;  3R4D B;  1HXS 2;  2BU9 A;  4GIQ A;  3I59 B;  1RVF 3;  3WDT A;  4QXC A;  1G7Y A;  1FX5 A;  5T5J A;  4ERO A;  3BTZ A;  1QGL A;  1W90 A;  4U36 A;  3IN9 A;  1KXG A;  5EJ3 A;  4OI1 A;  3V65 A;  5HCB A;  5C6C A;  3A7Q A;  3LDR A;  4N43 A;  2NYY A;  4LBQ A;  4QKF A;  3BVC A;  3Q8C A;  5CFC A;  2GND A;  3BUC A;  4XUN A;  4OCT A;  3I8T A;  3ACL A;  1JZ8 A;  1JMU B;  2W92 A;  3JBG 1;  5FYS A;  2ZOE B;  5J09 A;  1ZNP A;  2A1X A;  1K5M A;  3U07 A;  2ZAC A;  4XJW A;  2A3X A;  4PQ9 A;  4NIH A;  2X29 A;  3LDK A;  4O7X A;  4BJ0 A;  1REE A;  1CAU A;  2VTX A;  2AAC A;  4GWI A;  4Y1Z A;  1DLC A;  3MZH A;  1XSQ A;  3RSJ A;  4TLF A;  1UAI A;  2AH2 A;  3KZ4 C;  1YRZ A;  4IES A;  5JOW A;  1VAV A;  3TN9 3;  2WRA A;  3RI9 A;  5SV5 A;  2WYS A;  2UU8 A;  1UZZ A;  3KF3 A;  5JMO A;  1O3S A;  5LBF A;  3H50 A;  1VB4 A;  4CSW A;  3ZFF B;  3FL7 A;  2DBN A;  3CMG A;  4IV1 C;  5K8S A;  1FT9 A;  4UT5 A;  1COV 2;  4HKO A;  1QJU 3;  3C8X A;  3MLK A;  1V6O A;  1UOF A;  2A73 B;  1YC6 1;  2HEV F;  4I2O A;  2W47 A;  2VBD A;  3HWJ A;  1CR7 A;  1PK6 C;  3J7L A;  1J1L A;  4O61 A;  1AL2 3;  1PX3 A;  4JDM A;  3GZT B;  4Q0S A;  1PIV 2;  1CIW A;  1O8P A;  1RUC 1;  1ZRR A;  1VBA 2;  3HD8 B;  1HB4 A;  1OH3 A;  4HXC A;  5JVV A;  2ZA9 A;  1Q43 A;  3GDB A;  2C26 A;  3KLS A;  5FY7 A;  3TEW A;  5B2G B;  2HH9 A;  2I2S A;  2PLV 2;  4I0A A;  3EYP A;  3LZZ A;  4LIU A;  1AYM 2;  4PIZ A;  1LEM A;  3ZN6 B;  4B7K A;  1KFX L;  2IXK A;  4ZU7 A;  1PNF A;  4YGB A;  2P3K A;  1GIC A;  5TSW A;  5I93 A;  1AX2 A;  5E89 A;  3FBM A;  5LBE A;  4XJU A;  1O3T A;  5FY8 A;  4RQP B;  1X7N A;  5BNN B;  1AZD A;  2WSV A;  2FZ1 A;  2B5H A;  2AEY A;  2H6C A;  4MV2 A;  4EZH A;  4XJZ A;  4QB6 A;  1QJE A;  5AVP A;  4FAH A;  1C28 A;  1NCQ A;  1S2K A;  5DAP A;  4PLM A;  1W3X A;  4Q8L A;  1ENX A;  2RS5 3;  4WV8 A;  1UWW A;  1C4R A;  4I0W B;  1RUD 1;  1DYK A;  1RVF 1;  1VBE 2;  2VMD A;  2ZGO A;  3HN3 A;  5IK5 A;  4HON A;  4OHY A;  1SMV A;  3WV6 A;  5ERL A;  4AED B;  3RZK A;  2PAK A;  1HDK A;  3PVB B;  4ZXE A;  5LA1 A;  1TG7 A;  3LD8 A;  4XIO A;  1GFF 2;  2YGL A;  3U75 A;  3W59 A;  5C3S A;  2MNG A;  4XET A;  3AZY A;  1ULO A;  4XUP A;  2ZS6 B;  3NJV A;  2VVF A;  1H2L A;  4ITC A;  4RR3 A;  2ZEZ A;  3P1I A;  2FCU A;  4WM8 B;  3USU A;  4A6O A;  5JSR A;  5KHG A;  2E53 A;  2O1Q A;  5K9Y A;  3CJI B;  5CKQ A;  3MI8 A;  1W05 A;  3ST7 A;  1UYY A;  4NRQ A;  4V1P A;  1NE4 A;  1ND3 C;  1VRB A;  1PMJ X;  1YFW A;  4GZ9 A;  4JQR A;  4B1M A;  1O5U A;  4CDX C;  4PF5 A;  2JIJ A;  1HIX A;  2E31 A;  4P9I A;  4I09 A;  2R07 3;  3NKG A;  3ZN4 A;  5J3U A;  3IB3 A;  4GXL A;  4QPG B;  1KJL A;  3N9P A;  1ACC A;  4Z2W A;  4WM7 A;  4H14 A;  1VAM A;  2HWB 3;  2PAE A;  4XEZ A;  2WO3 A;  4BQ1 A;  3FLR A;  1H1M A;  1P8J A;  2C1F A;  2IXI A;  5LCW L;  1PM7 A;  3MFA A;  2YHJ A;  3EB7 A;  3M3O A;  2Q0A A;  2VZ1 A;  4Y3O A;  2OS2 A;  3F95 A;  1M06 G;  3AK0 A;  4P5Y A;  3C7H A;  2VCM A;  2EIB A;  2CL2 A;  1Q8S A;  2DUO A;  5F6L B;  2VMF A;  4BB3 A;  3MIE A;  1FAY A;  1PGL 2;  1ASJ 2;  5EWS A;  2X5I C;  3O12 A;  2WN2 A;  3O1R A;  4C91 A;  4XBQ A;  2BP6 A;  2NMO A;  4QKN A;  3T1L A;  3AJY A;  1JYX A;  4XQD A;  1DCS A;  1V0A A;  1RUJ 2;  4C0B A;  1CWP A;  4N7U A;  3VZM A;  5C4W A;  4HK8 A;  4IEW A;  4AYU A;  3BPZ A;  3K2O A;  2JB4 A;  1DZR A;  2VCC A;  3L2Y A;  2PHT A;  1O5L A;  1PO2 3;  4LOS A;  2LS6 A;  1GV9 A;  5FXW A;  3LEG A;  2B39 A;  4IEV A;  2DVD A;  1E5I A;  5GLZ A;  5GZF A;  1EPZ A;  3AYA A;  3RNS A;  3W5N A;  3IMN A;  2FZ2 A;  1N47 A;  5GZE A;  2QKD A;  1R09 3;  4AQ6 A;  4DUX A;  1BBT 3;  1ULF A;  3BTA A;  2VVD A;  2FDF A;  4CEY C;  2FDI A;  1K12 A;  1W6N A;  2KR2 A;  3JD7 2;  1S0B A;  1QMJ A;  3CLP A;  1KEX A;  3I49 A;  2GC2 A;  3FHA A;  4ZZ5 A;  1R1A 2;  1GR3 A;  4DY3 A;  2E51 A;  2O8Q A;  4OMD A;  3W5M A;  1DQ2 A;  1ZZ9 A;  3J8F 2;  1W6O A;  2Q8E A;  4BIS A;  3E6B A;  3NMB A;  2X09 A;  5D21 A;  4AAX A;  2RMU 2;  4YZ1 A;  4C8D A;  1SDW A;  3WDU A;  5AC9 2;  2XVK A;  1BK1 A;  1H8T C;  4JKM A;  4DXS A;  3VKL A;  2OPK A;  2YB7 A;  4PDW C;  1LU1 A;  2BRT A;  4JTO A;  1NY7 1;  3H1M A;  3O5S A;  1HX6 A;  1YUD A;  3J7M A;  1LJ7 A;  5A3W A;  1EV1 1;  3D0S A;  1RMU 2;  2CY6 A;  3NNF A;  2A7A A;  5EPA A;  4GAL A;  3WW3 A;  3ATG A;  3TAY A;  2BFU L;  5T50 A;  2IXC A;  3FLT A;  2EAK A;  3AYE A;  1WCD J;  1QJX 3;  2WNU B;  3K75 B;  5FZG A;  1I5P A;  4DIQ A;  1DIW A;  4NPR A;  3OPW A;  1S4C A;  2V09 A;  4AQS A;  4CDU C;  2XUM A;  1O4Z A;  4FT8 A;  5FMD A;  3AP6 A;  1ZM1 A;  4R4X A;  3RZL A;  3BYW A;  2R07 1;  5IFP A;  3H8O A;  4NMI A;  4OFG A;  1O7F A;  4OLL A;  3ZFE A;  4DRV A;  2P3J A;  4LHK A;  1WCS A;  3N9M A;  4HG6 B;  5GM0 A;  3MIG A;  4UF0 B;  2YBS A;  4P5H A;  1OD3 A;  4R9D A;  5K0U C;  1W2N A;  1MAC A;  3KVA A;  2CWS A;  4AF9 A;  5FZ3 A;  2XLF A;  2EID A;  4NR1 A;  2VL4 A;  3PUH A;  4UW5 A;  5FLI A;  1LGC A;  2IWG B;  5JOX A;  1PIV 3;  3P6B A;  1EP0 A;  2GAL A;  5GLV A;  4L2N A;  1UY2 A;  3T0A A;  1ODN A;  2W0X A;  1OA2 A;  2ZEX A;  5I8Y A;  5JMC A;  4CEW A;  3O1M A;  2XLA A;  1FNY A;  4CXW A;  2QQM A;  3IBM A;  3ZXL A;  2V4A A;  3TNP B;  1AYM 3;  2Q8D A;  1E5S A;  4Y1Y A;  2Y60 A;  2O8O A;  4XMA A;  1BJQ A;  3VD5 A;  4LO4 B;  3WG1 A;  1IGO A;  4BMB A;  1NA1 A;  5ANQ A;  3ZXE A;  1FYU A;  4YVW C;  1XE0 A;  4AVA A;  3III A;  4JRA A;  5ACA 1;  1RED A;  4JVA A;  1RUG 2;  5A7S A;  2AR6 A;  5LA2 A;  2W68 A;  3AFG A;  1MR5 A;  2ZX1 A;  2OYZ A;  2NZ9 A;  3UKN A;  1R09 1;  3PME A;  3T30 A;  1BBT 1;  1FMD 2;  2QQI A;  3N7L A;  3SQO A;  4XDQ A;  1YJL A;  1UY0 A;  3MUZ 1;  1HXS 1;  4RA0 A;  4Q4Y 3;  2VZP A;  4HL0 A;  3ZFG B;  5GAL A;  2JD9 A;  5K7P A;  1WW7 A;  3MF9 A;  3OTF A;  1A8M A;  4MVT A;  4KBB A;  4UWD A;  4YW5 A;  5KHH A;  5CFD A;  1OF4 A;  1QQP 2;  4B8E A;  1S0G A;  1SCS A;  4Q1R A;  5IVB A;  1IQD C;  1W8U A;  1MZ6 A;  1OFS A;  1RHI 3;  3AYC A;  4XE9 A;  4CUB A;  2D98 A;  2Z5W A;  2BEO A;  5EYY A;  3HQX A;  5FUN A;  1HRV 2;  1DYO A;  1QH6 A;  5DMY A;  5T5L A;  2IVJ A;  3ZN5 A;  3ZYB A;  3KT1 A;  4XHX A;  1AUY A;  5A7Q A;  1HN0 A;  1NOV A;  1ONA A;  4MYE A;  2VQT A;  3X29 B;  4B4Q A;  1YHF A;  4JKK A;  3FHQ A;  2DWR A;  4IE5 A;  3T2Q A;  4AEJ A;  1UIK A;  1UY4 A;  4Y4Y A;  3JU9 A;  5FO7 B;  5L9V A;  3H8U A;  2V73 A;  2BV4 A;  3J9S A;  2XQX A;  3POW A;  1O4Y A;  5IVY A;  1XE8 A;  2H6B A;  1H4G A;  2JIC A;  1FOD 2;  5FLH A;  1UD1 A;  5FZH A;  4URT A;  1EUU A;  2QQN A;  1W9S A;  4A2U A;  3I2F A;  1JOP A;  1RUE 2;  4YGE A;  3PVO A;  4LO5 B;  1OUR A;  2GN7 A;  2Y26 A;  1DGL A;  4FO9 A;  4NE9 A;  5JIU A;  2ZCW A;  3THP A;  3KHB A;  1VAL A;  1COV 1;  3LA7 A;  3BU7 A;  2MHF A;  2Y64 A;  2ADD A;  5A3O A;  1NLR A;  1VRH 3;  5HCH A;  2HWC 3;  5FO9 B;  1NAE A;  5FP4 A;  2VBP A;  1W6P A;  3IDE A;  3ZYJ B;  2ERF A;  3FMG A;  2V5D A;  5IAX A;  1ASJ 3;  2GN3 A;  1RTV A;  1Y4W A;  2E32 A;  2V72 A;  4M0H A;  4QM9 A;  4QX8 A;  4RGA A;  3ZR5 A;  3D82 A;  2PHW A;  1IZ3 A;  1S55 A;  2K46 A;  3ACH A;  4QU2 A;  4IV3 A;  1BQP A;  2R04 3;  3QBQ A;  4ZPI A;  3VDB A;  4MG2 A;  5IT6 A;  1PIV 1;  2DTW A;  4C90 A;  5A1A A;  1VBA 1;  1VBB 3;  2JG9 C;  3W58 A;  3I3E A;  3RZH A;  1F2N A;  4HBN A;  4CYD A;  2VY0 A;  3R0R A;  1MS0 A;  3ZO0 B;  3P3N A;  1VB2 A;  5FV3 A;  2C9A A;  5JXJ A;  2QQW A;  5FZL A;  5JR2 A;  4CE8 A;  2PLV 1;  4YM1 A;  3S5A A;  1IKQ A;  2IC1 A;  1AYM 1;  2WT0 A;  1I6X A;  2VQA A;  2YV8 A; 
#chains in the Genus database with same CATH homology
 5FXV A;  3AL5 A;  2OX0 A;  4CCJ A;  2XML A;  2YBP A;  3N9P A;  5A7W B;  2Q8C A;  5FYI A;  5FJH A;  4CUG A;  5F32 A;  5FYS A;  5A80 A;  3U78 A;  5FYT A;  4GD4 A;  3AVS A;  4QWN A;  5A7P A;  4XDO A;  3DXT A;  2Q8D A;  4D6R A;  5FZD A;  5F5I A;  3N9Q A;  5F3E A;  5FZC A;  5A1F A;  3N9N A;  4Y3O A;  5FZB A;  2OS2 A;  5FXZ A;  4URA A;  4UF0 A;  2P5B A;  5IVC A;  5E6H A;  4CCO A;  4GJZ A;  5FPU A;  5ANQ A;  5FJK A;  3U4S A;  5FPA A;  4V2W A;  5A3P A;  5FZO B;  5FZF A;  3ZLI A;  5FZ8 A;  5IW0 A;  5FY9 A;  5FZ1 A;  2XUE A;  5F37 A;  3PDQ A;  5FUP A;  5A7S A;  4EZ4 A;  4EYU A;  4AAP A;  5LW9 A;  5IVJ A;  4CCN A;  5FZ9 A;  4BXF A;  4CSW A;  2YPD A;  5F2S A;  5FBJ A;  4E4H A;  5FZM A;  2WWJ A;  5A7W A;  5FYU A;  5FYV A;  2GP3 A;  5FZE A;  5LY2 A;  3K2O A;  5A1L A;  2XDV A;  3PUS A;  3N9L A;  5F3G A;  2PXJ A;  5ISL A;  5FZ7 A;  5FWJ A;  5FXW A;  3KV9 A;  4NUB A;  2W2I A;  3DXU A;  5IVB A;  4QXB A;  4CCM A;  4CCL A;  4XDP A;  5KR7 A;  5FY5 A;  5FUN A;  3PUR A;  5FYC A;  5FZO A;  5FYM A;  4GAZ A;  5F5A A;  4QXH A;  3RVH A;  5A3N A;  5LY1 A;  5A7Q A;  5IVE A;  5FYZ A;  5A7N A;  5FY7 A;  5FP7 A;  5FY4 A;  4LIU A;  3LDB A;  3K3O A;  3PU8 A;  5FZ6 A;  4LIV A;  5F2W A;  2OQ7 A;  5FYB A;  5K4L A;  4CCK A;  2XXZ A;  4IGQ A;  5CEH A;  4BU2 A;  3PTR B;  3N9O A;  5FZA A;  4D6Q A;  4DO0 A;  2OT7 A;  5IVY A;  2Q8E A;  4LXL A;  4BIS A;  5FY8 A;  5IVF A;  3KV4 A;  3KVB A;  3PUA A;  4IGO A;  5F3I A;  5FZH A;  4C8D A;  2OQ6 A;  5F5C A;  3K3N A;  5FY0 A;  4HOO A;  5FYH A;  5FP8 A;  3OPT A;  3KV5 A;  4QU1 A;  2VD7 A;  5FP3 A;  4Y33 A;  5A3W A;  4EZH A;  5FP9 A;  2WWU A;  5LWB A;  4QX7 A;  4LIT A;  5IWF A;  5FWE A;  5FPL A;  5F3C A;  4IGP A;  4Y4R A;  5FYY A;  5FP4 A;  4HON A;  3PUQ A;  5FZG A;  3NJY A;  2YU1 A;  4DIQ A;  4TN7 A;  4QX8 A;  3OPW A;  3AVR A;  5FZK A;  3LD8 A;  4V2V A;  3ZPO A;  3AL6 A;  2GP5 A;  3KV6 A;  5F39 A;  5FZI A;  4GJY A;  3N9M A;  5FPV A;  3UYJ A;  2YBK A;  4UF0 B;  5A7O A;  2YBS A;  2YU2 A;  4ASK A;  4QXC A;  5FY1 A;  5A3T A;  5FV3 A;  5FZ0 A;  4AI9 A;  5FZL A;  3KVA A;  5FZ4 A;  1VRB A;  5IVV A;  5FZ3 A;  4D6S A;  5FPB A;  5FXX A;  3PU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...