2ZHNA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
FSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-9
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 34
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhnA00
4HANA 3AK0A 3JUUA 1BJQA 1UL9A 1BXHA 1QNWA 1J1TA 2ZBJA 1S0IA 3KM5A 1Z0HA 3LSDA 1LHNA 3WUDA 5T5OA 1YXWA 4R9DA 4W65A 4DRRA 2A7AA 3SLIA 1UZYA 4C1WA 1G8WA 2BQPA 2PHFA 3AXEA 4FOYA 4BM8A 4XXAA 1OKQA 1UX6A 1G9FA 3ZVXA 1MZ5A 2A3WA 4DRVA 4AGVA 1Q8OA 5GZFA 3N7MA 1YRZA 3I4IA 2A6ZA 3APBA 1QDCA 4K21A 4Q2FA 1SFYA 3O5SA 4Y24A 3WDWA 1GZWA 3MW2A 1DIWA 4FPCA 1YI7A 1C1LA 2WT0A 4LBQD 4YM1A 3FLRA 1C57A 1W6PB 4YZ3A 1LU2A 2ZAAA 4YFZA 2NMNA 1FV3A 4WVWA 2R1BA 4LBKA 1MACA 2VH9A 4YZ5A 4XDQA 4SLIA 4FOWA 1QMJA 4K1ZA 5DUXA 3C2UA 5FRAA 2P3IA 1KDKA 1LOFA 5JMCA 4NOTA 1DHKB 1RIRA 3AX4A 1AJKA 2ES3A 1NLSA 1F9KA 4GKXA 5DZFA 2JE7A 1CONA 1RINA 3N35A 3AZWA 5GJ6A 1GZCA 1YO8A 5CBLA 4FOQA 2UWBA 3ZSLA 5JOXA 2P3KA 3B01A 3BOPA 2GMEA 2DU0A 4LBMA 1LOEA 2DTYA 1RITA 1GNHA 3FUQA 4YW3A 5JVVA 2GDFA 4LBLA 3AZVA 4YW5A 2OUJA 2GNMA 1W6PA 4UW5A 3WDYA 1WW5A 4FP3A 1ZA4A 1SACA 3AYAA 4M3CE 4Y22B 4YG6A 4F83A 3WDXA 3NV2A 1O4ZA 3RRDA 4ITCA 1A8DA 2EF6A 1QOOA 2GMMA 3W58A 1LGCA 5SV8A 1LENA 3ASIA 3BTAA 1OFSA 2PHUA 5HCFA 1Q56A 1JW6A 2VUAA 2OVUA 4XJ9A 2Z42A 4XIOA 4XIKA 4KBBA 5T5LA 3ZPYA 1GICA 4WV8A 1LGNA 3IPVB 2ZHNA 2AYHA 1HQLA 4BLJA 4ZKTB 1DQ0A 3N36A 2PELA 1G9CA 3MPPG 4CZSA 1V6LA 1DZQA 4GWMA 2B7YA 2D6NA 4GALA 3UK9A 1IKQA 3ENRA 2VU9A 3JU9A 2A75A 2D44A 2UWCA 1WCSA 3LCPA 4PBPA 5CAZA 3TAYA 2WSVA 1N1TA 1QF3A 3OJBA 2ZGSA 3O0WA 4FQ4A 1YYNA 2C5DA 1YIFA 5JLVA 2DVGA 3H0OA 2KM2A 4XOGA 3A0KA 2NMOA 1LOGA 1WD4A 2D6PA 3VKOA 3POWA 4DQAA 5JDBA 4XMAA 1V6OA 1GZ9A 1D0HA 1N1SA 1G86A 1SBFA 1FNYA 5HCBA 3VV1A 3RMYA 4ATEA 3MW3A 1DQ1A 1W6OB 1WBFA 4AGRA 4YG0A 3AZZA 3LSEA 4Y1UA 4OZXA 1UKGA 3V64A 2V73A 4JCKA 1LTEA 2H0BA 2ZHKA 2PHTA 3INAA 4XXPA 1NXD1 1DQ2A 2R0HA 4YZ2A 2UU8A 2D6KA 5T5PA 2V5YA 1B09A 4YLZA 4XYXA 4HL0A 5IK5A 1LU1A 5KXEA 4XZPA 4L8QA 4Y1ZA 1CIWA 2JD4A 3NV3A 1FNZA 4XTMA 2P34A 4XILA 3RMXA 3WVJA 1SLLA 4Q8KA 3B3QE 2P37A 5IK8A 3I8TA 2ZZJA 2JECA 5BYNA 1CQ9A 2NM1A 5FREA 3OBRA 1VAVA 3TB0A 2D6LX 4FPLA 1URXA 1LODA 3OBTA 1C1FA 1SBEA 1WW6A 4BMEA 1N3OA 1W6OA 2JKBA 2NYYA 1HKDA 1F5FA 2NP0A 1OQ1A 3AYDA 4YGBA 3M3CA 5KXCA 1ULGA 5T55A 2AGSA 1Z78A 2GN7A 2GNBA 1S0JA 2WLQA 3ILFA 2AH2A 5EYYA 1HLCA 3VKFC 5DUVA 5DZEA 1ENQA 3AJYA 5T52A 5KXDA 2UWAA 3WV6A 1UAIA 3D6EA 4CTEA 1DQ5A 1KITA 2DVDA 2R0FA 3U4XA 2Q5TA 1Q8VA 2R16A 2YZ4A 2WSUA 3O0XA 4FPOB 4P9YA 3B9CA 2D3SA 3RQ0A 2ZMNA 4ISQA 1GANA 1QNYA 1ULFA 3ZSKA 3VKLA 1QGLA 1JYIA 1GYKA 1KJRA 2P2KA 2XG3A 1AZDA 1CVNA 1JYCA 1FAYA 2ZGQA 3QLQA 1IS5A 4WZFA 4U36A 2AR6A 3M1HA 3PJQA 4I30A 1ENRA 3USUA 1JN2P 3QCWA 2A6XA 4ATFA 2ZGPA 4YGDA 1G9AA 1S1AA 1MS9A 2RHPA 3UJOA 1SCRA 1DBNA 3AXDA 1AX0A 5GALA 2E7QA 3WDVA 1W6MA 1IOAA 2W68A 2ZA9A 4XTPA 4Y1VA 4XJZA 1DQ6A 3WG2A 1N3PA 1N47A 3POYA 3WOGA 4DS0A 1WUVA 4M01A 3BIWE 4IQPA 1CPNA 2DVAA 5EWSA 3SH4A 1WW7A 4XHBA 5DG2A 5DG1A 4XJWA 2ZKNA 5CB7A 5IK4A 1IKPA 1UMZA 3WCRA 3ZXEA 2R1DA 1MS3A 1AXYA 4PQ9A 4P9WA 1ULDA 4M3CB 3M3EA 3WHTA 2CWSA 3AJZA 1WLCA 2E53A 1ONAA 3ZYRA 1I1EA 2JJ6A 3V0BA 5GLWA 4M00A 1QU0A 1AXZA 1VAMA 3Q9OA 5KXBA 5T5JA 4R9AA 2E6VA 3OPZA 1H9PA 1VIWB 4YGCA 5F5QA 2DUQA 3IKWA 1W6QA 1V6IA 1SCSA 1MS5A 3SITA 4AWDA 2ZGMA 2UURA 2HYKA 4YFWA 5IK7A 4RA0A 4DFSA 5H9SA 2CNAA 1G9DA 3UL2A 1GNZA 5DUWA 4YZ1A 4FPJA 3O12A 1PZ9A 3GNEA 3SISA 2ZACA 3VKNA 1S0EA 4M3CF 3WCSA 1A78A 2OW4A 2WQZC 2ERFA 2ZHMA 4JRAA 1R1ZA 4Q27A 1QDOA 2AREA 3FUOA 2ENRA 1WLDA 1DYPA 5H9QA 1AJOA 4RL7A 5JOWA 4M3CA 1LOAA 3WUCA 2ARXA 3R4UA 5DUUA 5EYXA 4Q8LA 3SH3A 2ARBA 4K1YA 1X50A 2JE9A 1U0AA 1Q8SA 2CWMA 2A6VA 5H9PA 1V6NA 4Y1XA 2GNTA 2VY0A 4XJ8A 3POSA 1N1YA 4AYUA 3WG1A 3D5OA 4XJUA 1AX2A 2DYCA 2VW1A 3ZXKA 4AVVA 2A3XA 2D3PA 2VW0A 4FPHA 1FATA 5GZEA 1TEIA 1V6KA 3DGTA 3FLTA 4XBLA 3IMNA 1G9BA 4PBOA 2DVFA 2EAKA 1JUIA 2DV9A 4FP2A 2DUPA 4D69A 4WVVA 1GV9A 1SLAA 1SBDA 1W0PA 4YG3A 2A71A 2EXHA 5GLZA 3ATGA 1MS8A 3NV4A 1KQRA 4FQZA 5GZCA 4PF5A 1GSLA 2LTNA 4UW6A 1ENSA 1QOTA 1BYHA 1QOSA 4P9XA 4BPZA 1JXNA 5E8AA 1HDKA 1H9WA 1XQNA 3DUIA 3NWKA 3MEPA 1AXKA 3USUB 1Q8PA 3WDTA 1MR5A 4TZDA 4FPEA 2C9AA 3A4UA 1S0DA 4UW4A 1SLTA 3AP7A 1SLIA 2YY1A 5DXDA 2ZGKA 1W6MB 3HR9A 2JDZA 5CA6A 2R49A 5IUQA 3WG4A 3PVNA 5GM0A 2NN8A 2PHWA 3V65A 1IS3A 2CYFA 1WD3A 1AX1A 2SLIA 4LBOA 1GKBA 1ULEA 2OUHA 2PHXA 1WW4A 2ZGRA 3CNAA 4AGGA 4YM3A 1DLLA 2E7TA 1V6JA 3N7KA 5JOYA 1CJPA 2D6MA 4ISRA 3V0BB 2ZMLA 3M3OA 3ZXJA 3AP6A 1CR7A 3OY8B 1MVQA 2GALA 3L2YA 4YW1A 3WHUA 4GA9A 1DFQA 3V0AB 2EALA 5DZGA 3WDUA 2ZABA 1CN1A 4TYSA 1DGLA 3FFZA 1W6QB 2EXJA 3T2TA 4Q26A 1UPSA 3AYCA 2ZHLA 1SLBA 4LBNA 2YXSA 2WJSA 5H9RA 1LULA 2DWRA 1A3KA 4H55A 3ZSJA 3AZYA 4ASMB 2DURA 1MVEA 1KDMA 1LHWA 3GALA 1JOJA 1LGBA 1MS0A 4FOVA 4FPFA 4GWNA 2EIGA 4U2AA 2YROA 1S0FA 1LHOA 3IN9A 1BKZA 4YZ4A 4UW3A 3ILNA 5EXOA 5IT6A 1DQ4A 1V6MA 4FVVA 4BLIA 1S0CA 2E51A 5E88A 2W39A 3UJQA 1LCLA 4MYEA 2GMPA 1BQPA 3AP4A 1FX5A 4XBNA 3RS6A 4BMBA 1HQWA 2LALA 3OY8A 5GLUA 4K20A 1Y7BA 1AF9A 2XB6C 3OYWB 1KJLA 3V0AA 2G4IA 3N3HA 2DUOA 1Q8QA 3SH5A 3RSJA 3T1MA 1LOCA 4CRQA 2FHRA 1APNA 1PZ7A 1FV2A 3T1LA 4YW2A 3WLUA 4LBJA 1CPMA 1N3QA 3HN1A 2ZGTA 1EPWA 4GKYA 1N1VA 2W52A 1LJ7A 4PCRA 5GLTA 1QKQA 3ZSMA 4NO4A 2AENA 3O0VA 3OGGA 3ZYPA 1S0GA 2WT2A 4AVTA 3A0NA 1UN1A 1F31A 4LBQB 1LEMA 2CTVA 4XBQA 1W6NB 3MW4A 3R4SA 5LK5A 5F9TA 2A6WA 2EXKA 3N7LA 2WKKA 2W08A 3PVEA 3D4KA 4R9BA 3AFKA 2EXIA 4P14A 3HMYA 2VW2A 4FPKA 2A3YA 2P3JA 1O4YA 4Z8BA 2GN3A 5E89A 1KRIA 3B00A 4XHXA 3AP9A 1GBGA 1S0BA 2AUYA 2WNEA 1MZ6A 3OYWA 3PMEA 3SNMA 3AYEA 4XMIA 3W59A 3ZXFA 3ZXLA 5L73A 3IM0A 2NZ9A 4BOWA 3VUOA 2DU1A 1LHVA 3PVOA 5CNAA 1LHUA 1IS4A 2ZGOA 2ZGUA 4Y20B 2CL2A 1LOFC 3KQRA 2CY6A 1LESA 1VLNA 1W0OA 4DPNA 1ULCA 1UZZA 2SBAA 3ILRA 3WNXA 2TEPA 2YV8A 4Y22A 1GLHA 4LBQA 1PZ8A 4YM2A 1W6NA 1FYUA 1BZWA 4C1XA 5GZGA 1LEDA 2A70A 2FMDA 2YMZA 3WG3A 1JHNA 2A5ZA 4Q1RA 1SLCA 1I3HA 2D7FA 1IS6A 3RG0A 1V00A 1AVBA 5T50A 5GZDA 2WT1A 2D43A 4YM0A 2VXRA 3M2MA 3AP5A 1JBCA 2DTWA 3IPVA 1H30A 4R9CA 2ZMKA 1DYKA 1VALA 2A6YA 4ZXKA 4AVSA 1ZM1A 3NV1A 4YW4A 3B69A 1LOBA 5JOZA 4Y20A 1C4RA 1CESA 2ZGLA 2ZGNA 5AVAA 3WZ1A 1WBLA 1MS1A 5GLVA 2DVBA 1GZWB 3FBYA 5T54A 3AZXA 1LECA 3BODA 4FPGA 2I2SA 1WLWA 4JC1A 4Y1YA 1G7YA 3VKMA 2D3RA 4XJAA 4Y26A 5HCAA 4BQ1A 3M3QA 2D6OX 4Q1PA 2GNDA 4GXLA 4FPYA 1MS4A 3FLPA 3N7JA 3R05A 4YGEA 1D2SA 2PHRA 4XE9A
chains in the Genus database with same CATH superfamily
4A4AA 3AK0A 1QJY3 1UL9A 1RUC3 2ZBJA 1US2A 2W1WA 1H4GA 1PMJX 2BVBA 2W5FA 1NCQB 4CVUA 4MX3A 3A7QA 1WCKA 2XWJB 2D5FA 1J3RA 2GC2A 1BLZA 4MO3M 3AVRA 3SLIA 5KC6A 3IDBB 4BM8A 1ZRFA 1UX6A 1G9FA 3WP6A 1MZ5A 2HYXA 3ZVXA 1CAXB 1Q8OA 3N7MA 2QQMA 4XQWA 3I4IA 4Q4Y1 1QDCA 4Q2FA 3KT4A 1JODA 4QPIA 1BBT1 2B42B 4UBHA 4LBQD 1RVF2 4I2OA 1CAUA 2JG9B 1C57A 1W6PB 4Q0PA 2RS12 5JSOA 4QPGA 5D21A 1B35B 2ZJCA 4IGQA 4LBKA 4MH0E 4CDXB 1MACA 3HWJA 1HRI3 1R092 4SLIA 4XDQA 3WR0A 5A32A 1QXPA 1QMJA 5A7SA 2QKDA 1OXCA 2PXJA 4YVWA 2P3IA 5FRAA 4JDOA 5JMCA 4NOTA 1W8ZA 1RIRA 4AQTA 1COV2 1HB1A 1PVC2 2PQQA 5HXMA 3OOXA 3WNLA 5JR2A 1RINA 4TTGA 3FHQA 1F2NA 1PO12 1GP5A 4FOQA 3ZSLA 2HWC3 2WWSA 3WQBA 1GOHA 2GMEA 4C90A 2JXAA 2RJLA 5LBEA 1LOEA 1F8VA 3VBHA 1UY0A 3KMHA 2GDFA 4BHPA 3POJA 4JQRA 2J1TA 2WDBA 5CFCB 2XBO3 3WDYA 4CUBA 4P5YA 4Q4V2 5FZ0A 2QVSB 4XFHA 4XW3A 1TNFA 4PLNA 1UYYA 3MLKA 3B94A 4A6SA 4CSWA 4LOTA 4GWIA 1A8DA 1L7LA 4BYYA 4M4RA 1LENA 3RZJA 3BTAA 1XC6A 3AFGA 1NUKA 4QDRA 4AFCA 1R082 3MIGA 4XUNA 1D4M3 3TYJA 3ZMOA 3CL1A 4XIOA 1O5UA 4PJYA 1BEV2 3C3VA 3FBMA 1GZTA 5T5LA 1NYWA 4EE2A 1QJFA 2YBKA 2ET7A 3I3QA 1X33A 2BV4A 2AYHA 4MHUA 4I3GA 4BLJA 4ZKTB 5L9VA 2WZR3 3MPPG 4CA9A 4EN8B 4QX2A 1V6LA 4E2QA 4GWMA 4LIVA 4GD4A 3ES1A 3GBGA 3UK9A 2OQ7A 3OG2A 2BFUS 4BWOA 2BYVE 1WCSA 4IE0A 1QHDA 2WSVA 5C9AA 2XWBB 3BTXA 2CAVA 1AR93 1AYM2 3OPTA 3T0BA 4MGZE 3W21A 5A3UA 2D40A 2ADEA 2LS6A 2RJ2A 4GJZA 3MHZA 1LOGA 4J1WA 2D6PA 4MLOA 3VKOA 4QT6A 4HXCA 4B7KA 4DQAA 3VDBA 4XMAA 1V6OA 3J8F1 1RUD3 1N1SA 3LB9A 4I0BA 3VV1A 3G7DA 3ON7A 2RS31 4LK7A 4NVPA 1PGL2 4AGRA 4YG0A 3AZZA 3P5BA 4OZXA 5HXVA 2V73A 4JCKA 2ZHKA 2PHTA 3ORJA 1A6CA 3INAA 1REDA 4Q4X1 2R0HA 4YZ2A 2D6KA 5J48A 1ALYA 4RFT0 4M0NA 3POIA 3VL8A 4Y1ZA 4JV4A 4XTMA 4AZZA 1IPKA 2P34A 3RMXA 4Q8KA 1SLLA 5EFUA 1F15A 1CAUB 3OB8A 5BYNA 4OULA 1RHI3 5A70A 5KBFA 1G6NA 2QUOA 3KCYA 2OZ6A 3NSTA 4OVEA 4QPGB 1WMDA 2Z5WA 4IE6A 3VBOC 1ZREA 4UI9L 1LODA 4EWDA 1OUXA 2A73B 3H1WA 2HWE1 3M7AA 1EV11 1S2BA 2NP0A 3CF6E 1OOPA 1OQ1A 4FI9A 5AVPA 5CKNA 5KXCA 1MEC1 1ULGA 1GOFA 5T55A 1WZXA 2Q0AA 2RDNA 3WY6A 2GNBA 1S0JA 1XOYA 5EYYA 5G05L 4D7YA 3UGGA 2XH6A 5KXDA 5T52A 5A1LA 3WV6A 2GP5A 1I5PA 1KITA 2AZ5A 2DVDA 4I09A 3VBUC 3RZHA 1ZZ7A 3U4XA 1V9U2 1Q8VA 1WWYA 1UMIA 2YZ4A 3O0XA 3RQ0A 4S2GA 4XF0A 3KHCA 1ULFA 1QJU3 4TN7A 2VOTA 3W9AA 3L9JT 4QM9A 1GYKA 1O6UA 3NW4A 3HN3A 3CHXA 4XEZA 4AQ2A 2ZGQA 3P3NA 1IS5A 3NNFA 4U36A 2K0GA 3PJQA 2E26A 3QCWA 3WNNA 2A6XA 1UX7A 3C8XA 2PA7A 1NXMA 2Y6KA 1G9AA 1MS9A 2ETEA 3WSOA 5JWPA 3UJOA 3AXDA 2ZX0A 1RUI3 3ZFEA 4Y33A 4OYUA 3PLQA 1AX0A 3ZMNA 3WDVA 2KXLA 2G9ZA 1IOAA 4XTPA 1QJEA 2R7EB 3FHIB 4J6GA 4I01A 5FLJA 4BE3A 3SC7X 2Y38A 2B39A 1S4CA 3C7GA 3KLSA 2XJPA 4C0BA 2G19A 1UZWA 3ZX7A 1CPNA 2QBXA 3LA7A 4XHBA 1SG3A 4XFFA 4NHXA 4Q4W2 1OD5A 3VGIA 2XXZA 4AI8A 3ZXEA 2VMHA 5FY7A 3NVCA 4AFMA 4PQ9A 4J25A 2WYSA 4P9IA 4QXBA 2CWSA 1CD3G 4IV3A 3ZYRA 5IWFA 3DKWA 4M00A 4AI3A 4CU9A 3TBDA 4BH9A 1VAMA 4OI2A 3Q9OA 3WQ0A 4OMCA 4UFMA 2E6VA 4YYOA 4B29A 3GM8A 4KU7A 4LIUA 5F6KA 3DECA 4AFBA 2DUQA 4A44A 2FQPA 1EP0A 3B7MA 4OQ8A 2RDSA 5L7OC 2W92A 2HYKA 5IK7A 4GMP1 1G9DA 3S6PA 4QMAA 4NHMA 4CCLA 1RGSA 3A21A 1GNZA 2QTWB 3NKGA 4FPJA 3O12A 3GNEA 4FTEA 4CPBD 3ZFFA 4MUVA 2IVJA 4NR1A 1A78A 3I59A 4NRQA 2FZ2A 1W99A 2EIEA 1AHSA 4Q27A 5D8AC 3HQRA 5A1FA 2ENRA 1WLDA 3KGZA 3MUZ1 1LOAA 4UFIA 1ZBE3 4EN7B 3U0ZA 1RUNA 2VOXA 4QX3A 4V1PA 1IZ3A 2YGLA 3EB7A 4K1YA 5C5TA 2YUEA 3SQOA 1XJAA 5H9PA 4QB2A 1JZ3A 4I0WB 4E9KA 3O1SA 4OFGA 5DDJ2 4XJ8A 1N1YA 4NMIA 1M4WA 3WG1A 4DXZA 5ABJA 1HQNA 1H1IA 1OH3A 1AX2A 2VW1A 3ZXKA 3Q8CA 5FYHA 3V56A 2A3XA 3ALQA 2D3PA 1HIXA 1AL23 1JHJA 2YB7A 3CJIA 1TEIA 5FP3A 1C28A 5FPBA 4Z92B 1E5IA 1AR73 1XXNA 2R073 2R061 2VBDA 3NKTA 1HW5A 4P00B 4R4ZA 5FIXA 4Z2AA 5JXHA 1G9BA 1JUIA 1YFYA 1ZRRA 3C7FA 1FPN1 2DUPA 1TE1B 3T0DA 2VUJA 5FYIA 4YG3A 3MIBA 4OUSA 5FZDA 5HPOA 5BPXA 4HT1T 2PQSA 3T3YA 3IIAA 2BUKA 4AI9A 3HQXA 2Z79A 4A7YA 4PF5A 2LTNA 1O91A 2AACA 4CXXA 4K40A 1HRV3 1NAEA 2PFWA 3I97A 3JZVA 5IVYA 4A45A 5I8YA 2CAUA 4QQOA 5FY8A 4HFSA 1MR5A 5FMOL 4UYBA 2VGDA 1RUE2 2CHHA 1NE6A 2Z69A 3A4UA 1VMFA 4G4FA 4NIHA 3MBWA 3PTYA 1PGW1 1J58A 3AP7A 4MOAA 4QDQA 2ZGKA 4Y5TA 3POGA 1H4HA 5CKMA 5FZOA 1XYPA 4ZHNA 2OPWA 4XACA 3WG4A 5GM0A 1RUH3 1XNKA 1ZRDA 1R091 2CYFA 5FYMA 2Q8DA 4EROA 4A3XA 1WD3A 1UOJA 4BQ3A 2J1VA 3JB4C 1COV1 1VRH1 4N53C 2XUEA 4AGGA 5L7OA 2XHKA 5FQ0A 2E7TA 2XQXA 5JOYA 1CJPA 1GP6A 5C8CC 2J1AA 2DBIA 3K4ZA 2XLFA 1OUSA 5FZMA 4BQYA 4OQ9A 2VECA 2MEV1 2RR11 1RXFA 2Y6JA 4L2NA 2EVXA 4P9GA 4JGZC 5C3OA 3I3MA 1CN1A 1DGLA 1OKOA 4MGKE 2JWPA 4FFIA 3WNMA 1U5YA 1YFXA 1RUG3 4XABA 2CDOA 5FZIA 4Q4V1 2ZX4A 1KGYA 2DWRA 1A3KA 3H7YA 3BYWA 1UCXA 5K0UA 1KDMA 1RB8G 2E63A 1WCQA 3VBOB 2O8OA 4FPFA 1NCRA 4RS5C 4OI0A 3K77A 1S0FA 1LHOA 3IN9A 5CEHA 1YI9A 1BKZA 1BVP1 2VMEA 4UW3A 5FKBA 1XBFA 4RR3C 5C5UA 1S0CA 2LW8A 1BEV1 1JYVA 2W39A 4B8EA 1ZA7A 2WNUA 3NAPC 1BQPA 3J7NA 1FX5A 3RDIA 4XF9A 1S2KA 3HD8B 5FP8A 5GLUA 2WZPP 5FMDA 2IC1A 3JD72 4LO5B 3OYWB 5FPAA 4NRPA 4QB6A 1YCIA 4AR2A 3ROUA 3LEGA 1JMUB 1ZRIA 2NQYA 2E9QA 1LOCA 3PTRB 4IW3A 5FXVA 1XE7A 2RM23 1H2MA 5E16A 5DPNA 1CPMA 3GXUA 3FFQA 3G6JB 2X53S 1A8MA 2W52A 2VXJA 3HNYM 4LITA 4CCKA 5DAXA 1ULOA 3O1TA 3A0NA 1UN1A 1F31A 4LBQB 1LEMA 4S2FA 1W6NB 4XBQA 1DCSA 5FKCA 2A6WA 2VR4A 4A6OA 2WKKA 2W08A 2VQTA 3DXTA 3ZR6A 1ODMA 2WFF2 4S2DA 2VW2A 2MNGA 2P3JA 3CZJA 4MXVA 1OLMA 2ZEXA 1H8VA 1TMF3 4XHXA 3JBG3 3AP9A 4IEQA 4EWAA 5A6YA 1WMFA 1XU1A 1VE0A 3ZXFA 2HBUA 4XMIA 2Z2SB 2PLV2 3PUSA 1GWLA 5JCTA 1IS4A 1L7QA 2C1FA 2ZGOA 3ZYJB 1R1A3 1YQ5A 2XVLA 5BXXA 2CV6A 4DUXA 3VL9A 4NWWA 5F7UA 1LOFC 1H0BA 1ZBA2 2EA7A 1UYZA 2ZX1A 3OEBA 4F7ZA 3KCXA 3ZIXA 1CWPA 4CDUC 4FXGB 2TEPA 5FZOB 3GZUC 4IE7A 4AI1A 2BNNA 4YM2A 3EYPA 2YMZA 1WGPA 3CMGA 1JHNA 1POV3 2A5ZA 2VMCA 1DGWX 3BPSA 4Q1RA 1E5RA 4H7LA 1HXS2 3IWZA 1E5HA 3U10A 5L7OB 4LHSA 4UFKA 2BWCA 1V00A 4LJHA 4ASLA 3A23A 2TUNA 4LOSA 4XF3A 4NIGA 3MDPA 2FDKA 3U11A 2VMGA 5FZGA 4RS5A 4LTAA 3THTA 1ZM1A 2HWC2 4HOOA 5FZ4A 3T2OA 1V9U1 4AVSA 4HONA 1ZZCA 4W6XA 1ASJ1 2ZGLA 2B5HA 2ZGNA 3WZ1A 3QBQA 2RDQA 2GAUA 3WINE 5A7WA 3BODA 2YYOA 1WLWA 4XUQA 3AKQA 4I0AA 2O1QA 4AAXA 4GB31 5LZ6A 3S5QA 4XAEA 3WXPA 4FPYA 1MS4A 4YGEA 2P3YA 1PIV1 2JE8A 5HV4A 5A6XA 2B9UA 5F39A 4XE9A 1DLCA 5LY1A 2JIJA 3HBKA 3JUUA 5BNOC 1BJQA 4JQTA 1BXHA 1UD1A 4MZUA 3MPBA 1D4M2 3AKPA 3LSDA 3TN92 2WWUA 1OLRA 3WP3A 4R9DA 1H1MA 4RN5A 4N8MA 2WWJA 2A7AA 5IK5A 1UZYA 1G8WA 3AXEA 2Q1ZB 3H7JA 4JGYA 4K6BA 2WZR2 3BI3A 1NY72 2LROA 3QACA 5FZBA 3KQ4B 3NMBA 2IVIB 4RD7A 5GZFA 5K9YA 3TNPB 1HV0A 4M4PA 3U78A 3VBFC 1ND3C 3KVAA 3OD0A 4Q4W1 1JTZX 3THCA 5APAA 4FPCA 2J42A 1C1LA 2YU1A 1O8SA 1OT5A 2VOKA 5F8PA 1GNYA 2RS52 3FLRA 3BU0A 3BALA 3PUHA 5FAXA 3Q8AA 4C8DA 1LU2A 4QU1A 1AR92 5FZKA 1XNBA 2BGPA 2ZAAA 1E57A 2HLEA 2VJXA 1CZVA 1FV3A 2HWB2 2O0OA 3NRUA 4Q0VA 2VH9A 1POV0 4YZ5A 4XFIA 2QQPA 4UFHA 1QJX1 1RUD2 4K1ZA 4LHKA 3RGBA 1IG3A 2E31A 1LOFA 4QQ2A 1EPZA 4UAPA 4Q5OA 1F9KA 4LUMA 5FXWA 2HWF2 3VDDA 2W94A 3O7OA 2ARCA 2JE7A 5KHIA 1CONA 4ES8A 3IDCB 5FZ3A 3TEXA 1QQP2 1UY2A 5FP7A 5GJ6A 2UWBA 1FOD3 2YFUA 3BOPA 1H8TC 5C7GA 1VBA1 2DU0A 2DTYA 1W8OA 1SQ4A 4YW3A 5LA1A 4N53B 1HN0A 5JVVA 4LBLA 3AZVA 5A80A 1H1AA 4YVSC 5A7OA 2JG9A 4BQXA 5C3PA 2GNMA 1W6PA 5FZCA 2QQVA 1ND2C 1SEFA 3LDBA 4XF4A 5CVRA 4URAA 3AYAA 1J84A 1B35A 4CDXA 3DYMA 3WDXA 1PMHX 2E33A 1AYN3 2O14A 1FMD2 1DU3D 3ASIA 4JGZB 1HB4A 3M4FA 4D6SA 2EAAA 2Z42A 4XIKA 4KBBA 3ZDSA 3ZPYA 3DKQA 4WV8A 1EUUA 1LGNA 1UIKA 5D1IA 1OA3A 4DEVA 3N36A 1QH7A 2PELA 4RS5B 1TME3 1RC6A 1DZQA 5C33A 4GALA 3KF5A 1IKQA 1VBC3 2YHJA 4RR3B 2VU9A 3P1IA 5FXXA 1QJU2 3JU9A 2D44A 2WC2A 5IAVA 4ASKA 5CAZA 5CFCA 3GHNA 3NAPB 1REFA 3OJBA 3O0WA 5FJHA 1NLQA 1YIFA 1K12A 4PI2A 1W2UA 2WYFA 2KM2A 3A0KA 1K45A 1YFUA 2JEMA 4KWUA 5IVFA 3MIEA 2PMWB 5BNNC 5JDBA 4QKFA 1RMU1 1RUE1 3NNMA 1D0HA 1PM7A 2HWD2 2GZWA 3PJYA 4META 1I6XA 1UNBA 2FCVA 1BVVA 1DQ1A 3MW3A 4ZU4A 1WBFA 3DCQA 4MGYE 4XFBA 4CP0A 4W50A 3V64A 4JKLA 1NG0A 2G9FA 3IIIA 4UFJA 4CP9B 2OQ6A 5LA9A 4FAGA 4IEYA 1ZZBA 1VB2A 3SHRA 1B09A 4YLZA 3TNQA 4XYXA 4HL0A 4D6RA 1O5LA 2J22A 2VZVA 1QIQA 1OPOA 2X10A 3OTFA 4L8QA 5C3SA 4Q4Y3 3NV3A 1FNZA 3PL0A 4QQHA 5FXZA 3VDCA 4ET7A 3B3QE 1BBT3 5B4XA 2JECA 3LAGA 1JZ5A 1CQ9A 2NM1A 5FREA 3OBRA 1NQDA 4ONUA 4KU8A 4BK5A 4E8DA 4FPLA 1URXA 3SXWA 4UT5A 4AEJA 1N3OA 5DN2A 4KH9A 3WNOA 3O1VA 3ITQA 5CFDA 3VHPA 1EAH2 1NA1C 4HK9A 3AYDA 3GGLA 1BK0A 5JZGC 4HLTA 2VZ3A 3VDDB 4CDUB 1UF2C 4TXWA 4LNVA 2WLQA 1HLCA 3K48A 5DZEA 4CXYA 3CIHA 1RUF1 2VOVA 2VMIA 4DIQA 2XKOA 3U75A 2UY8A 2X8KA 3E5XA 4FPOB 4HKWA 4L0PA 1BMV2 2D3SA 2JDAA 4H14A 4IUGA 4ISQA 1QNYA 1LKNA 1Y9MA 3LE0A 1SMVA 4KGQA 3WW1A 4ORFA 3VKLA 1QGLA 4O61A 3SCGA 3S5AA 1ZBE2 1JYIA 2YBSA 2F4LA 1AZDA 2JDNA 1FAYA 3QLQA 4WZFA 1C5HA 1AR61 2AR6A 2PAMA 3JD71 3OD4A 3M1HA 3OF1A 2XJTA 1ENRA 4HVOA 4N7UA 4PDWC 2ZGPA 4ZY9A 1W8WA 1XE0A 3PUAA 4WBBA 5C4WA 4QPYA 4AK3A 2QDRA 5FY5A 1S1AA 3ZN4A 2FDJA 1SCRA 3ZM8A 4A7KA 5B2GB 3ETPA 3B93A 5GALA 2E7QA 2C26A 1AL22 1IQAA 2W68A 3AMNA 1XYOA 2WNVC 4XJZA 1J83A 1DQ6A 4IXLA 1DF0A 3WW2A 4KNCA 4DS0A 1QXRA 1WUVA 3AC0A 4IQPA 3LEMA 1C8M2 2DVAA 2OS2A 5EWSA 3EJKA 3AMMA 4NPMA 3ZLIA 1PM4A 5BNOB 1VBB2 2JG8C 2P1BA 4XJWA 4LHNA 5DG1A 2WFF1 2BVVA 3J9SA 3VBRC 1OA2A 1UMZA 1US3A 3IB3A 3WCRA 2K46A 3ZYGA 1AXYA 2X29A 1KD7A 4CEYA 3VD9A 2PAEA 3LDKA 4LXLA 2E53A 1HRV2 2VCMA 4NN0A 5GLWA 3AKTA 1ENXA 1QU0A 1KFUL 5GKAC 2PLV1 2RJKA 5C3RA 3WD5A 3VBFB 1ND3B 4IESA 4S2HA 3HBZA 3J8F3 1VIWB 3OPZA 3PHMA 3WX5A 4D6QA 1D7PM 3AVSA 1W6QA 1SCSA 3VD5A 2RS33 1ZBA1 5BV6A 1MS5A 4YPJA 4AEKA 2ZGMA 2JKXA 2UURA 4YFWA 2BZDA 2DCYA 2Y33A 3MV01 3VDAA 4ARXA 3BN6A 2VQUA 4QGLA 2XJQA 2DF7A 2TNFA 4LR4A 1PZ9A 1E5SA 4Q4X3 1RUH2 3SISA 5FZ9A 3WCSA 2GSYA 1U5IA 4JRAA 1R1ZA 3W5MA 1QDOA 4INDA 1HXS1 4RGAA 2CGNA 2W1SA 5H9QA 2XVGA 1RJ7A 5E6HA 4BISA 5FR3A 4CUAA 4K8RB 4A7ZA 4E4ZA 2ARBA 3ZR5A 1RUJ2 1X8EA 2ZEWA 3EMRA 1U0AA 2Q1MA 4I3PA 5FPUA 2CWMA 5LEJA 1H8TB 2HWC1 4CCJA 1YHFA 2C24A 1VBE1 4IEVA 2XJUA 4AYUA 3E5UA 3LA3A 3GZEA 4R8HA 5CFDB 2HWE3 4MSVA 1EV13 4F8AA 2VW0A 4FPHA 4YVSB 3DGTA 4XBLA 1ND2B 5FPVA 3RJRA 5FY9A 5B4NA 4LORA 4AI0A 5A7QA 4PBOA 3TEYA 5EHDA 1UU6A 4CU7A 2DV9A 3I3DA 4FP2A 3RZLA 2JENA 3VHOA 5FK7A 1GV9A 2BOJA 4MVTA 1SBDA 4W8JA 5I0RA 1W0PA 3NJYA 2QFEA 2A71A 2EXHA 4OHZA 4AL9A 1OVSA 1GQPA 5CIRA 4TLFA 5GLZA 1D4M1 5CZKA 1KQRA 2BTVC 4XCBA 4CCDA 3TN91 2C6SA 3MF9A 4IV1C 3AMPA 4LEJA 4D0QA 4AHXA 1QOSA 1QOTA 3U14A 5FZFA 4BPZA 5E8AA 1H9WA 2VD7A 5JR7B 3DUIA 5IAXA 2OYZA 2WZR1 2VZTA 3TRSB 1Q8PA 2JICA 2QZ3A 3SEPA 1O3SA 5C4WB 3SCHA 4B1LA 3WW3A 4YSFA 1LRHA 1S2EA 1SLIA 1UMHA 2YY1A 5JPMB 3FMGA 4QM8A 2Y0IA 2RS51 1K3IA 4AVCA 4B7EA 3PVNA 2HWB1 4UXAA 2OX0A 5BNNB 3E6CC 4OHYA 4AEMA 3V65A 2ZEYA 3GF6A 1QH6A 3I3EA 2DCZA 2ADDA 4QXKA 3CO2A 4PLOA 2WO7A 1LAJA 1GKBA 3O1PA 2WL1A 4CEYB 1IG0A 2JB4A 2ZS6B 2HWF1 2VMFA 1V6JA 4XETA 4E2SA 3LOBA 2D6MA 4FXKB 5K7PA 2FBEA 1QQP1 2ZMLA 3D0JA 3M3OA 3ZXJA 3AP6A 3T2QA 5J36A 4JDNA 3OY8B 1MVQA 2GALA 5ACA1 2H6BA 1VBD2 2BW8A 2Y34A 3AMQA 4GA9A 2B45X 1DFQA 4HPKB 4YW1A 3URFA 3SKJE 3KS7A 1PO21 5ERLA 1UIJA 1NZIA 1W6QB 2EXJA 4XFAA 3T2TA 5BY5A 1ZRCA 1UPSA 2AC1A 5FZ7A 1SLBA 4LBNA 2YXSA 4GMP3 2YPDA 4H55A 3ZSJA 4ASMB 3WEZA 4DXSA 1GP4A 4DB5A 1LGBA 1MS0A 4FOVA 3LZZA 1XNCA 4O65A 1FMD1 5A3WA 3MIHA 3WW4A 3N4MA 3I2GA 5AC91 4Q29A 5EXOA 3ZXAC 4HSLA 5JXJA 2J7MA 1WA6X 5E88A 2IXKA 4GJYA 4J1XA 3VZMA 1LCLA 4NROA 2V4AA 1SDWA 4XBNA 3RS6A 1OLME 1W0NA 1W2TA 1O3RA 1W8NA 2WS91 4RHV1 1KJLA 3DPRC 2G4IA 2W0XA 4MGSA 5EJ1B 2BWAA 1Q8QA 3GCWA 3T1MA 4LUKA 3ZYFA 1UPIA 1F35A 1PZ7A 3I2DA 4H3WA 3WLUA 2VCBA 2ORXA 4LBJA 3HN1A 2ZGTA 4XAAA 4QAWA 2UYBA 3MLJA 1LJ7A 5FZ8A 3VZKA 4D7TA 2R063 2AENA 3OGGA 3MLLA 3ZYPA 2WT2A 4G9SB 3VBOA 2EIBA 3HT1A 3OUIA 1XSQA 3FJSA 4PDWB 4LO8A 1IPSA 1FPN3 4P02B 5IHRA 3MW4A 3R4SA 5F2SA 2VAUA 5F9TA 2HWD1 3N7LA 4OCTA 5FYZA 5LBCA 1W06A 1X9TA 3T09A 5IVCA 3K3NA 1STMA 4TSVA 5DAQA 3N9PA 4FPKA 3UKTA 2RMU2 2WO3A 2WNVB 3CLPA 3Q8BA 4QX5A 2YBPA 2XGXA 4QQLA 5F5CA 3PUQA 3T4VA 4D3WA 1GBGA 1S0BA 3H3UA 3LPFA 1W2OA 2WNEA 3OYWA 3PMEA 1CAWB 4GIQA 1V70A 2QQUA 4JTOA 3SNMA 1W3XA 2I45A 3HJRA 3AM2A 3IM0A 5L73A 5FMCA 4BK4A 4BOWA 1LHVA 4LPLA 3ZSEA 4EN9B 5DMYA 1LHUA 3BIEA 1ZVFA 2JG8B 3R6SA 5J37A 2YC4A 3BGAA 1Y43B 1CZSA 1PHMA 2CY6A 4HKOA 3T30A 4GMP0 3RWKX 4OHVA 1VLNA 3DXUA 1VMHA 1CIYA 2SBAA 2OXBA 2BP6A 3HT2A 2D93A 5EZWA 4I02A 4JTNA 1HB2A 1MZFA 2ILMA 4QXHA 4LBQA 4Y22A 2R042 1W6NA 4C1XA 1T6BX 2VUDA 4QHBA 2A70A 2FMDA 2J1UA 3DF0A 1R093 4A3ZA 3S7EA 4F3JA 2VTXJ 2XDVA 4IE5A 1EAH1 4GQ7A 2RG4A 4KWJA 1COV3 1VRH3 1YEWA 2D7FA 1AR82 4JX0A 3RG0A 4AEDC 5FOJB 2WT1A 4YM0A 5KR7A 3M2MA 3K4DA 3AP5A 1JBCA 4EQVA 1Z7S2 2ZMKA 2L9LA 4ZXKA 1QEXA 4LE3A 5IVEA 1FOD2 4HG6B 3ZO0B 1MQTC 3IAPA 3Q8EA 5JOZA 1RYYA 1C4RA 2CDPA 2MEV3 2RR13 2V09A 5A3LA 1W8UA 3BTYA 1WBLA 1OSGA 1GZWB 1RVF1 2ORZA 3AZXA 1LECA 3D3AA 4FPGA 4Y1YA 2RS11 2J1EA 4Y26A 4EV0A 4Q4V3 3M3QA 5LCWL 1XPWA 2GNDA 3IZOA 5EV7A 3N7JA 2HH9A 4UWDA 3PURA 2PHRA 4CCOA 1QNWA 4X8NA 1J1TA 4Y4YA 1Y4WA 5I93A 1PVC1 5FYYA 3WUDA 2Y8KA 3K4AA 4UBGA 1YXWA 1BEV3 4W65A 2WR9A 4XCAA 3WQ7A 3H9AA 5HV0A 5FPLA 1PO11 4XF1A 2QJVA 4QQPA 5A7PA 1ULPA 1VP6A 4C1WA 4DRRA 4FOYA 2PHFA 4G3YC 4HBNA 2A3WA 1H6YA 1C8M1 2PAKA 4UF0B 3WNPA 4AGVA 5D8AA 1YRZA 2YU2A 3AMHA 1VBB1 2A6ZA 4K21A 4Y24A 4B1MA 1SFYA 1J3PA 4FFGA 1VBC2 2V4VA 1EYBA 4IV1B 1YQ8A 3MW2A 1DIWA 1W9YA 3R0RA 3VBSC 4E2GA 4CDQC 2B46X 1HRV1 1XB9A 3QOPA 2W1UA 1JZ2A 2VMDA 5F5AA 3RWNA 4YFZA 5G04L 2NPIA 2IXLA 2CU5A 2D97A 1HN1A 1R081 2JX9A 3X29B 4FOWA 3M3IA 4EWEA 3RZZA 2BDRA 3JCIA 4W6WA 1DHKB 5K4LA 1AJKA 2ES3A 1BCXA 4GKXA 5DZFA 1D2QA 2OKXA 4CEWC 3D8CA 3AZWA 3VBUB 1GZCA 1R64A 1YO8A 4MGIE 5CBLA 2VO5A 5JOXA 3N9QA 1Y3TA 3TOJA 2VL4A 4LBMA 1NX9A 2GH8A 1W90A 2LRPA 3GJBA 3FUQA 1RITA 3LF7A 3WF4A 4Q4Y2 4FO9A 2XL9A 5LWBA 2ZX3A 1BBT2 1AYM1 2H0VA 4H2AA 3KVBA 4UW5A 4KMQA 1WW5A 1ZA4A 1SACA 1RUJ1 3W20A 4Y22B 4F83A 1JYWA 1UYPA 3RYKA 2V72A 2WA3A 3FC0A 3RRDA 3VD7A 4ITCA 1C5IA 1QJY2 1UWWA 1RUC2 2PHUA 2BU9A 5J98B 1JUHA 5HCFA 1JW6A 1PGL1 4WM8C 2BERA 1RL3A 2VUAA 1ZZ8A 5FUNA 2OVUA 2VCCA 4XJ9A 4BA6A 1DP0A 3KB5A 1K5MC 1PK6C 5JSRA 2FDGA 4E27A 2XMLA 4W6YA 3VHRA 1GICA 3WF2A 5JXIA 1HQLA 1DQ0A 1WCDJ 4IEWA 4OUEA 1G9CA 2VZOA 3H50A 1JI6A 2X5IC 3GZAA 3HQUA 4GH4C 2B7YA 2XJSA 2Y64A 4N53A 4AFDA 3ENRA 1ASJ3 1GUIA 2VZSA 2XJVA 3FN9A 4WM7C 1PX4A 2A75A 2N7GA 2UWCA 4PBPA 1L3JA 5C8CA 1N1TA 3JB8A 4FQ4A 4FSJA 3FL7A 1SFNA 2DVGA 3H0OA 4XURA 1ZZ9A 2R32A 3BB6A 4GB33 3ZDVA 3DPRB 1U5XA 1HRI2 3POWA 4LO4B 4JGZA 4ZXEA 4NIDA 1PIV3 1OF3A 3B9IA 4FCAA 1G86A 1SBFA 1H2LA 4PHZA 3RYRA 1W6OB 4XPVA 3LSEA 4TWTA 4X6QB 5A3OA 4XFCA 3WNKA 1YIPA 1HB3A 1WA4A 2ZPXA 4QX0A 1LTEA 5IATA 4O9GA 5KHGA 1NCQC 1O59A 1WMXA 2W46A 1NXD1 4KG0A 1YWKA 5ISLA 1DQ2A 2XPJA 2XKPA 5FWEA 3BKZA 3E5QA 1DZRA 2ET1A 3KV5A 5D8AB 4CU6A 4RR3A 1LU1A 1GFF2 2A1XA 4XZPA 3NJXA 2JD4A 2VZRA 4Q4W3 3VN4A 1IQDC 4CCNA 3NAPA 4AAPA 5SV5A 5DAPA 5IK8A 3I8TA 2XBO2 3MIFA 3ZYIB 2ZZJA 5F5IA 2XLGA 5EQUA 4A42A 2BOIA 1VAVA 2GH2A 3SCFA 2D6LX 1JZ6A 1VBD1 2CGPA 3OBTA 1H2KA 4BMEA 4YNIA 1OPMA 4HKLA 1QJX3 4QXCA 3DN7A 4W4ZA 4D8MA 3L2HA 5A3MA 1F5FA 4GZ9A 4HSJA 5LB6A 2KA3A 4YGBA 2RS32 4SBVA 1HJFA 1WCUA 2AGSA 5LBBA 4CP9A 1WKYA 1VJ2A 2GN7A 1GR3A 4ZONA 3WUCA 4RGKA 5DUVA 1ENQA 3AJYA 5IFTA 3KCCA 1UAIA 3RNSA 4AW7A 1JS9A 2JIGA 3D6EA 4Q4X2 4RYDA 5F2WA 5A6QA 4QU2A 3ZFGC 3LPGA 5A3TA 4IGPA 1UO9A 2WINB 2WSUA 4WVZA 5FZ1A 1VBA3 3B9CA 3B02A 1OI6A 2ZMNA 4CPBA 2Q8EA 1GANA 4Z2WA 3QH7A 1OURA 3OUHA 2YGMA 4AEDB 5A3NA 1KJRA 3RZKA 1OH4A 3BTZA 1JYCA 5FP9A 3MIDA 1OLQA 4ATFA 3USUA 1MQTB 2WN3A 2X5IA 4YGDA 3KT7A 3POEA 4Z07A 5LASA 2LUWA 1FXZA 2RHPA 1MPXA 1GWMA 2B4KA 1IGOA 2EIDA 2HWE2 2OIIA 4GULA 4NPLA 3KF3A 5J7MA 1D0GA 4CDUA 2VTFA 1T6GC 4CDWC 2ZA9A 4KI5M 4Y1VA 4GWJA 3WG2A 4OHXA 2ZOEB 2RVAA 3POYA 1JU4A 1OF4A 3RI9A 4NPRA 3H8RA 3BIWE 4BQ4A 5F1RA 5HCHA 5DG2A 5FLHA 4RFRB 5L9RA 3NNLA 2RMU1 2R1DA 1MS3A 3ZN6B 2HEYF 3J7HA 5C8CB 1ULDA 4M3CB 4E8CA 3M3EA 3WHTA 1RHI2 2QCSB 3AJZA 2UYAA 4KBZA 1ONAA 3UV9A 1I1EA 4FFHA 3V0BA 4EZ4A 1KFXL 3N9MA 2VZ1A 5DDJ1 4BDVB 3ETQA 5I91A 2EICA 5KXBA 2OPKA 5T5JA 1X82A 4R9AA 1RMU3 1RUE3 3CEWA 4PT6A 4BJ0A 1H9PA 3NJZA 1YFWA 5CU1A 3VBSB 2Q30A 2IZWA 2Y6FA 2IXCA 3MV11 1F4HA 4RA0A 5H9SA 3GDBA 4DFSA 2CNAA 4KQ7A 2CGOA 2PN5A 4XUOA 3ZIWA 4DINB 2WIIB 3HAGA 3LIGA 4IL7A 5DUWA 2R041 3KWVA 3UL2A 4YZ1A 5CISA 1YLLA 4L11A 4RGGA 3KZ4C 2ZACA 3VKNA 5BNOA 3CZUA 4M3CF 5DABA 2I74A 2WQZC 4N43C 3ZXDA 4AFAA 1UKRA 2XVKA 1W3VA 1YUDA 2BPA2 3HVDA 1DYPA 4IEPA 1AR81 4RL7A 3M70A 4CP2A 4ZZ8A 4E4HA 2XR4A 4IETA 3USSA 5IVVA 4QPIC 4CEWB 3R4UA 3T0AA 1C3HA 1Z7S1 4K9SA 5DUUA 4N9HA 5EYXA 3EO6A 5BUVA 1JYTA 1X50A 2D5HA 3GHMA 1Q8SA 2J1SA 3BVCA 3FHAA 4Y1XA 3VBFA 1ND3A 2GNTA 2VY0A 2JD9A 2XONA 3KV6A 3OEAA 3D5OA 1CGPA 1RUI2 1UOFA 1HV1A 1Q5OA 2DYCA 4DEQA 4AVVA 1OC1A 4YVWC 1FATA 3IAQA 1V6KA 4Y5Z0 1J1LA 3FLTA 3IMNA 3I7DA 1REEA 2B9VA 2DVFA 1CAVB 3DYPA 4AI2A 4QPWA 2WABA 1RUF3 4WVVA 1M06G 5JSPA 3EQEA 4UOJA 2UY9A 3K75B 5CADA 4BU2A 4ZS3A 3ATGA 4WM8B 2WAAA 3NV4A 2R30A 4H7MA 4FQZA 1X36A 1K5MB 1PK6B 3VBHC 5GZCA 2BBVA 2JB8A 1GSLA 3HNMA 4P9XA 2DCKA 1SPPB 3VHNA 1JXNA 1HDKA 5AFEA 4AHYA 1H8TA 3NWKA 1AR63 1AXKA 3JD73 2X5IB 3USUB 4GH4B 4CXWA 2QQJA 3U4SA 1OMIA 2QQKA 3H3LA 4AXOA 1ZX5A 1S0DA 2IFWA 1VBC1 1PX3A 2Q8CA 4Q0QA 3LEIA 4HZFA 4YVSA 2MHFA 1SLTA 2P6HA 2Y60A 1ND2A 5DXDA 1UOGA 2VM9A 3IDEA 4PF1A 5L36A 5LK7B 4ZU5A 2JDZA 3IMMA 5IUQA 5I0DA 4LQRA 4BB3A 3O14A 2PHWA 4QGMA 3GZTB 1IS3A 1JZ8A 1O4TA 2SLIA 5J09A 3HPNA 3TWIA 1ULEA 2OUHA 2PHXA 3CNAA 4IDZA 4YM3A 2WFF3 2VUCA 1DLLA 3OGJA 4CP1A 4FBFA 2Q4SA 4KGGA 3N7KA 1W2NA 2QE3A 4IEUA 2E32A 4BIFA 4ISRA 4YARA 3V0BB 5C9AC 3LFIA 1TZOA 4B4RA 2OA2A 2V5DA 3HEIA 4IE4A 4NJ4A 3ZYHA 5CG8A 1F4AA 2GU9A 1O3TA 3L2YA 3VD3A 3WHUA 4N43A 3UGHA 3AKRA 2PLV3 4LMFA 1JYXA 1ZZ6A 2EALA 5DZGA 3V0AB 4CYDA 2ZABA 2VNRA 4O9EA 4TYSA 1K5JA 1BHGA 3FFZA 3JXSA 2JDUA 4Q26A 2ZHLA 1PGW2 5L19A 1ZBA3 1AR72 2R072 2XOMA 3T2PA 1W2AX 3BCWA 2WJSA 1LULA 3FE5A 5BNQA 5BNNA 1WLTA 1LHWA 4L92A 1JOJA 4OZOA 1X9PA 2EIGA 4U2AA 2YROA 1QJY1 1RUC1 2DBNA 1OD3A 2P4EA 2ZKLA 4OI4A 3HNBM 3ILNA 2KR2A 1DQ4A 1W03A 3ELNA 1HXS3 4BQ2A 4BLIA 3JQXA 5LA0A 2KD7A 3MFAA 1VRH2 3UJQA 1OQEA 4EYUA 1OQDA 4MYEA 5FYCA 5F37A 5IFPA 2GMPA 3DYOA 1FT9A 4N90A 2H6CA 3C7EA 3C7OA 3NJVA 5FY1A 3OY8A 4K20A 2IXIA 4HPKA 3E1F1 4MG2A 3ZFGB 1TVGA 4EN6B 3OBZA 1HX6A 1JYNA 4JKKA 3SH5A 5AFBA 1VBE3 3KV9A 2MEV2 2RR12 2FHRA 1FV2A 2BNOA 2VBBA 4K8FA 4PCRA 1N1VA 1OOPC 1ST8A 2OT7A 1W8FA 1QKQA 2WO2A 4NO4A 5GLTA 4LHLA 3O0VA 4Z1VA 1XU2A 1S0GA 5FYTA 5K8SA 3VB9A 1HRI1 4YWAA 3UNPA 1YC61 1UXXX 5C3QA 1VAKA 3D4KA 1GWKA 1NA1A 3AFKA 2EXIA 4P14A 4R9BA 3WP4A 3HMYA 5JZGA 1PGSA 5IVJA 3TN93 3O1MA 1QJZA 3SEEA 4CDWB 4Z8BA 1KRIA 5E89A 5BNPC 3IDAA 3W5NA 3DEMA 2WUHA 2AUYA 2YC2A 1MZ6A 2RDRA 2QQWA 3ZXLA 3VUOA 3S57A 2DU1A 5LBFA 3PDQA 2ZGUA 1L7RA 2FDIA 4AVBA 4Y20B 2CL2A 5C71A 2WO1A 5A6ZA 4XZUG 1MZEA 2QNKA 1LESA 1MEC3 3ZFEC 1RUG2 2XBO1 1W9FA 4DPNA 1UZZA 3ILRA 2RS53 4WVMB 4XUTA 3THDA 2YPJA 4Q0UA 2YV8A 4PDWA 4BXSV 4BXFA 2HWB3 4EJRA 5LEKA 2VPVA 3WG3A 2F17A 4Q0SA 1NLRA 3I2FA 5FLIA 4AQ6A 1LB2A 3OBAA 3TEWA 2ZXQA 4V2VA 2WNVA 1I3HA 3H8UA 4DNYA 3KT1A 1AVBA 3BU7A 5T50A 4JZRA 2D43A 2VBPA 2HWF3 2VXRA 4MXWA 5DAVA 5L9BA 2VTXA 4JDMA 2DTWA 3IPVA 4R4XA 4R9CA 1CAWA 2VZUA 2A6YA 1NY71 1QQP3 3MUY1 4IV3C 4L97A 2QQNA 4CCMA 3NV1A 4DUVA 2JG8A 4N43B 3PUIA 3B69A 1LOBA 1WMEA 4XC9A 2AEYA 4YW4A 1S55A 1XE8A 1CESA 3VBRA 1I9RA 1PO23 2RM22 3K3OA 5AVAA 5I0TA 4AHZA 5J1XA 1MS1A 2JDPA 2DVBA 3PU8A 5GLVA 4QPIB 3S7IA 4CTEA 2I2SA 5HCAA 1AR91 1GOGA 2D3RA 5KHHA 5FFOC 4BQ1A 3K2OA 1LNSA 4QWNA 1JH5A 2HEWF 4EZHA 3M8LA 1D2SA 1RUD1 4MGTA 3M3CA 3WP5A 3ZFFC 3KSCA 1BK1A 1FMD3 1QY4A 2DFCA 4HANA 5A32B 4O7XA 2VVFA 4LA3A 1S0IA 3KM5A 5AC93 4YVWB 1Z0HA 3F95A 1LHNA 3PNAA 3KGLA 1NE4A 2IXHA 5CYYA 1I5ZA 5T5OA 1DDLA 2VZPA 1QWRA 2YFZA 1TMF2 3JBG2 5A7NA 2I07B 1U12A 3RZGA 2J1RA 2BQPA 3POBA 3ACFA 5FZEA 4PQQA 1J59A 1O8PA 5I8SA 4XXAA 1OKQA 4MGQA 2QQLA 4DRVA 3ABZA 5FO7B 2WS93 4RHV3 1R1A2 1UYXA 5FZHA 3APBA 3O5SA 2IWGB 3WDWA 3WF0A 1ASJ2 1GZWA 4LO7A 3VBHB 5ABJC 4OUMA 1CJDA 1YI7A 5EIYB 2WT0A 4YM1A 5BNPA 1UY4A 2Y6HA 2LM3A 1RHI1 3CJIC 2ZX2A 4YZ3A 4NIIA 5CG9A 4XQDA 4PIZA 2NMNA 3I2HA 4CCEA 4WVWA 2R1BA 4GB32 5C6CA 1D4VB 4NUBA 4QHOA 5FPZA 4X6RB 4DY5A 2QQOA 2G9GA 1PIV2 2WFPA 5FY0A 2HWD3 5DUXA 3C2UA 1NA1B 2VE1A 2VNOA 3J26N 1KDKA 5E1RA 5FY4A 5EP9A 1SHWB 5JZGB 3AX4A 2OZJA 1NLSA 4FAHA 5FOBB 3N35A 5D2AA 5JPNB 4UF0A 4LO6B 3THPA 1YQ6A 4BIOA 4CUGA 1IHMA 5F6LB 2P3KA 3B01A 4BCUA 3CDZB 4JVAA 1PNFA 4IV1A 1GNHA 1QJU1 2XJRA 3POFA 4YW5A 2OUJA 1DG6A 1UY3A 4NIAA 3RPQA 2WLPA 5FO8B 1OA4A 5C9AB 4FP3A 1ZNPA 2TBVA 4ZU7A 5LATA 3F2ZA 4B4PA 4M3CE 4YG6A 3CBNA 4RQPC 3NV2A 5DQ0A 1O4ZA 1YQ2A 1JOPA 2GMMA 1GQGA 1QOOA 2EF6A 3W58A 1LGCA 4OHWA 5SV8A 4MADA 3MZHA 1X7NA 4LKEA 1OFSA 2P5BA 1RUI1 1DGRA 1Q56A 3N9NA 1QJX2 1P8JA 2WBKA 1H2NA 2JDMA 3ME2A 2WQ4A 4RSUA 3U1XA 1EAH3 4NRMA 4URTA 4HVRA 4MXWB 3IPVB 2ZHNA 4JAAA 5JAXA 1UQXA 2GC0A 4A2UA 4R52A 2VC9A 3LOIA 3ZN5A 3H8OA 4CZSA 5FZLA 2D6NA 1LR5A 4ES9A 3MICA 3VBRB 2WZ8A 1VBA2 3HIFA 3LDRA 1RTVA 3H3ZA 3O1RA 4LT5A 3MF6A 3LCPA 2Y0OA 4IEXA 2IFRA 4P5HA 5FWJA 4OMDA 5I0UA 1RVF3 2WA4A 4L99A 3TAYA 1QF3A 4ZPIA 2GC3A 2ZGSA 1YYNA 2C5DA 2RS13 4NAMA 1O7FA 2K2SA 5JLVA 2FCTA 3ZPOA 4XOGA 2NMOA 2NLRA 1WD4A 3B5LB 5LRSA 4N7IA 5K0UC 2X09A 1GZ9A 2VCAA 2DFBA 3DL3A 4EN0A 1NCRC 1FNYA 1HJGA 1OBNA 4N9IA 1W9TA 5HCBA 3RMYA 1C8NA 2AEZA 4YRDA 4ATEA 4XUPA 4FTBA 4Y1UA 1PVC3 3VZLA 1UKGA 1VPHA 3JQWA 3KV4A 1OOPB 2PYTA 2YDEA 1UU5A 3J7MA 4JHZA 5LY2A 2H0BA 5LRRA 4DUWA 3I49A 3PMSA 4XXPA 4C91A 1PO13 4IEZA 2WNUC 4AE2A 3BPZA 2UU8A 2JDYA 4HETA 3H8XA 5T5PA 3LEKA 3VBUA 2WAOA 5J3UA 2FDHA 2V5YA 4X8PA 1BMV1 1C8M3 5FMBA 3A22A 5KXEA 3LFMA 3K46A 1CIWA 3P3PA 1VBB3 4LLOA 4AVAA 4XILA 1ZBE1 4PIYA 4HVQA 2ZZQA 3WVJA 4HN0A 3U07A 1GU3A 2P37A 5BNPB 3RI8A 1U5ZA 1OFNA 5ANQA 3ACLA 5TSWA 2PHDA 2VULA 1SZBA 1RJ8A 3DPRA 3HOBA 3TB0A 1AUYA 2Z4FA 1AYN2 1C1FA 1SBEA 1WW6A 4KG8A 1DGWA 4PI0A 5FJKA 1W8HA 1R083 1RMU2 1W6OA 2JKBA 2NYYA 1HKDA 1W05A 2CSGA 2D98A 1AL21 2P17A 3H1YA 3S30A 5C8WA 1UW8A 4PIXA 1YNAA 3PIJA 3ZFEB 1AR71 2R071 2WRAA 2VOWA 1NZCA 1DYOA 1Z78A 1NQJA 4CUCA 3FX3A 5KC5A 3O1UA 3ILFA 5IVBA 3ACGA 2AH2A 4DXTA 3VKFC 4RQPA 3VD4A 4BZ4A 2GP3A 2UWAA 4QKDA 4Z82A 1YJKA 1IPJA 1DZTA 1DQ5A 1TME2 4LKDA 2R0FA 2Q5TA 2R16A 4P9YA 3KD4A 2RV9A 4OLLA 4UFLA 1CX1A 1V0AA 4FFFA 3ZKYA 3ZSKA 4QKNA 4COYA 2BJSA 3T4HB 1XRUA 2W91A 4AF9A 2P2KA 2XG3A 3P6BA 1CVNA 1AYM3 3N9OA 5EJ3A 4P9LA 1RUJ3 4IV3B 3CJXA 4I30A 5JI9A 1JN2P 1Y9QA 2WZEA 4ZZ5A 5FYBA 1VMJA 3RJ2X 2G1MA 3DV8A 3J4UH 2FZ1A 3PU3A 1UZVA 3VZJA 3WF3A 1DBNA 4Y4RA 4JHTA 4XFGA 5IW0A 3UGFA 2BNMA 4DMIA 3ZYBA 1W6MA 2BGCA 1TQ5A 2JDKA 2O8QA 1ZYBA 1OVPA 3D0SA 3QH6A 5FYVA 1N3PA 4DY3A 1SFPA 1RUH1 1N47A 3EHKA 2WN2A 3WOGA 4QX1A 4M01A 4LA2A 1RUF2 2W2IA 1NT0A 4WZCA 3WF1A 3ZFFB 3LWCA 1NOVA 3SH4A 1WW7A 3SMHA 1YJLA 2ZAHA 2XHNA 5LA2A 3I59B 2ZKNA 5CB7A 4AEDA 5IK4A 3CU7A 5FBZA 1FI2A 1IKPA 3UKNA 4DO0A 5FPXA 1GQHA 3O1OA 2W3JA 3U37A 4P9WA 3RVHA 4NE9A 4FTSA 1VR3A 5FTTC 5JIAA 1WLCA 3NO8A 2JJ6A 1MQTA 1W9WA 5FO9B 3ZKUA 1AXZA 1AR62 3GCXA 5FUPA 2VNVA 5C70A 3OGVA 4YGCA 3ST7A 5F5QA 5ABJB 4LLFA 3IKWA 3I2OA 1V6IA 4QX7A 2C0ZA 3SITA 4AWDA 1RUG1 4LULA 5A33A 3CJIB 3RYPA 1KS5A 3R4DB 1EUTA 1UOBA 5LW9A 3ACHA 4DXRA 3QD6A 5HI0A 1XYNA 1S0EA 4PLMA 4GAZA 1V9U3 2OW4A 4JGYC 4E4SA 2ERFA 2ZHMA 3ES4A 1GMMA 3GBWA 3UETA 5F3CA 2AREA 1JZ4A 2W95A 4K3UA 3ZN6A 3FUOA 4NHKA 5F3IA 4NAOA 5JXGA 3UKVA 1AJOA 2DDUA 5JOWA 4M3CA 2F4PA 1UXZA 3MFCA 1TNRA 2X05A 5FYUA 2ARXA 2ATFA 1A34A 5FK8A 2Q1FA 4Q8LA 3SH3A 4QB1A 5ANNA 3H1MA 5FUIA 1YQCA 2JE9A 3IBMA 4C0HA 2A6VA 4HMZA 1V6NA 5JUVA 3MYXA 4QHZA 2VZQA 1VBD3 2RE9A 3POSA 5JIUA 4QD2A 5FYSA 1KS4A 4XJUA 2RM21 3S0MA 3VBSA 3LKJA 2XLAA 3UESA 4L9BA 4CDQA 5GZEA 2E7AA 3OSDA 1ODNA 2FDFA 3AB0A 5I0SA 2EAKA 4IGOA 3VDDC 4RQPB 1CZTA 1UU4A 4D69A 1TG7A 2PTMA 1SLAA 2VQAA 4BQ5A 4AG4A 5KHKA 1QXJA 1MS8A 3PVBB 3RFRA 3OPWA 4LE4A 4CEWA 1JOBA 1ENSA 1TMF1 1BYHA 3JBG1 4UW6A 2HKXA 5FQ0B 2BEOA 2JG9C 3CKHA 1XQNA 1PVXA 3MEPA 3EXUA 4D7SA 5FMOS 3RZMA 4JKMA 4ARYA 1B35C 4CDXC 4NWVA 3WDTA 2GC1A 1R1A1 3I3BA 4FPEA 3I2JA 3J8F2 3ZOIA 2C9AA 4TZDA 1RUOA 5FV3A 1Q3EA 1VBE2 4QDSA 3GYDA 4UW4A 3I54A 1W6MB 3HR9A 5F32A 3LD8A 1CAVA 4COZA 4LK6A 2DCTA 2VVEA 3I2KA 2R49A 4COVA 5CA6A 1DGRN 4KWKA 4BQWA 2NN8A 5K0UB 1W28A 2FD8A 5T3NA 1NCRB 4WM8A 1POV1 1AX1A 2Y26A 3WQ1A 2MPFA 3ZXGA 4KWLA 1K5MA 1PK6A 4LBOA 1W9SA 1WW4A 2ZGRA 2JDHA 3AL5A 2RMU3 1SPPA 3UYJA 2ZEZA 3MI8A 5DAWA 5CFCC 1Q43A 2VNGA 3I2IA 4M0HA 4XQ4A 4DZGA 5FP4A 3BUCA 2WNUB 1Y9GA 2DCJA 3MO4A 3KHBA 4GH4A 1CR7A 4YW6A 3MGUA 1JZ7A 5DDJ3 3SKVA 1W8TA 1W39A 5IYYA 4K7JA 3WDUA 4WM7A 4ZS2A 4P08A 1EV12 3VLBB 4OI1A 3E6BA 3AYCA 4IERA 3OGSA 4V2WA 5A33B 1PNGA 1MEC2 1W04A 3EBRA 2XUMA 1UY1A 1F5JA 4NHYA 4COUA 5H9RA 4DOUA 3AZYA 3NL1A 1O3QA 2FMYA 1MVEA 2DURA 3GALA 4QGNA 5F3EA 2R043 4TLGA 4GWNA 1H6XA 5KHJA 2XQRA 5ACA3 3GJAA 5FZ6A 2BGOA 4CCCA 1AL0G 4YZ4A 4NHLA 1V6MA 4FVVA 4AOCA 2E51A 1NCQA 5EPAA 1AR83 5JI7A 1XNTA 2W87A 4B4QA 2Y6GA 3AP4A 5EJZB 1UZ0A 4JRLA 1HQWA 1Z7S3 4BMBA 2LALA 4CU8A 1Y7BA 1AF9A 2R6QA 2XB6C 3ECQA 1CAXA 5FBJA 3V0AA 1X8MA 2YG0A 3N3HA 2DUOA 5ACA2 3UT0A 1KEXA 2XL7A 1RXGA 4MHRA 3RSJA 3VZNA 2FCUA 1CX4A 1VB4A 1APNA 2IUWA 4CRQA 1PO22 3AKSA 2F6BA 3K51A 4YW2A 3T1LA 1N3QA 4CDQB 5CFDC 2C4XA 3NQHA 1EPWA 4GKYA 1K42A 3ZSMA 5I8TA 3TEZA 4QKBA 4AVTA 1EY2A 5IJRA 2BBAA 4FT8A 5LK5A 2CTVA 5HBAA 2VG9A 4QX8A 2EXKA 2W47A 4XDOA 3PVEA 3NNJA 2ZTNA 2ID4A 2Q8OA 1VRBA 3E6DA 5FZAA 5AC92 5FCCA 2A3YA 1O4YA 1J3QA 2GN3A 3Q8FA 2B8MA 4AHWA 2QQIA 3B00A 2BRTA 2HEVF 3BOWA 5J96B 4XDPA 5KWRA 3AL6A 1FOD1 3ZFGA 3AYEA 3W59A 3LIHA 5FDBA 4QPGC 4COWA 5M0TA 2NZ9A 2PHLA 4HK8A 3PVOA 5CNAA 2WS92 4RHV2 4B3NA 4E4DX 3FZ3A 3LQCA 4KL1A 5F3GA 5C4WC 5A3PA 3E97A 2K9ZA 2QZ2A 3KQRA 3OGRA 4LKFA 4XVHA 3VZOA 4AQSA 3NNGA 4MV2A 1W0OA 2BFUL 1ACCA 3GBFA 1ULCA 5A7WB 5CKQA 2WQ8A 3WNXA 2VQ0A 1GLHA 2W1QA 1PZ8A 5JMOA 3LA2A 1FYUA 1AYN1 1BZWA 2IXJA 4Y5SA 5GZGA 1LEDA 4P9JA 1SDDB 2YC0A 4CE8A 4Y3OA 1T2XA 1POQA 3C7HA 3WT3A 1SLCA 2Y6LA 2HJIA 4CDWA 2VVDA 3IT8A 1IS6A 5GZDA 4IEOA 4YW7A 1JU3A 4CEYC 2C9KA 1H30A 1DYKA 1VALA 1OHFA 2QDNA 2ZCWA 2HBTA 3ACIA 3N9LA 1XSRA 4LKSA 1TME1 1PMIA 4A41A 4JGYB 2WNOA 1XNAA 3OCPA 1KXGA 3D82A 3H42B 3J7LA 4Y20A 3PIGA 4WM7B 4D94A 3CQOA 1NKGA 3OUJA 3FBYA 5T54A 3FWEA 4WVMA 5IT6A 4JC1A 3VKMA 1G7YA 2ARAA 2R062 4XJAA 3LGRA 4HN1A 2D6OX 4Q1PA 1XNDA 4GXLA 1FPN2 2W9XA 3FLPA 3R05A 3T08A 2P6CA 5A1AA
chains in the Genus database with same CATH topology
3AK0A 1QJY3 1UL9A 1RUC3 2ZBJA 1H4GA 2BVBA 1NCQB 4MX3A 1WCKA 2XWJB 2D5FA 1J3RA 2GC2A 5KC6A 3SLIA 3IDBB 4BM8A 1ZRFA 1UX6A 1G9FA 3WP6A 1MZ5A 3ZVXA 1CAXB 1Q8OA 3N7MA 4XQWA 3I4IA 4Q4Y1 1QDCA 4Q2FA 3KT4A 4QPIA 1BBT1 2B42B 4UBHA 4LBQD 1RVF2 4I2OA 1CAUA 2JG9B 1C57A 1W6PB 4Q0PA 2RS12 5JSOA 4QPGA 1B35B 2ZJCA 4LBKA 4MH0E 4CDXB 1MACA 3HWJA 1HRI3 1R092 4SLIA 4XDQA 3WR0A 5A32A 1QXPA 1QMJA 2QKDA 5FRAA 4YVWA 2P3IA 4JDOA 5JMCA 4NOTA 4AQTA 1RIRA 1COV2 1PVC2 2PQQA 1RINA 1F2NA 1PO12 4FOQA 3ZSLA 2HWC3 2WWSA 2GMEA 4C90A 2JXAA 2RJLA 1LOEA 1F8VA 3VBHA 3KMHA 2GDFA 4BHPA 4JQRA 5CFCB 2XBO3 3WDYA 4Q4V2 2QVSB 4XFHA 4XW3A 1TNFA 4PLNA 3MLKA 3B94A 1A8DA 4BYYA 1LENA 3BTAA 3AFGA 4AFCA 1R082 3MIGA 1D4M3 3TYJA 3ZMOA 3CL1A 4XIOA 1O5UA 4PJYA 1BEV2 3C3VA 3FBMA 5T5LA 1NYWA 2ET7A 1X33A 4ZKTB 2AYHA 4I3GA 4BLJA 2WZR3 3MPPG 4EN8B 1V6LA 4E2QA 4GWMA 3ES1A 3GBGA 3UK9A 2BFUS 4BWOA 2BYVE 1WCSA 1QHDA 2WSVA 5C9AA 2XWBB 1AR93 1AYM2 2CAVA 4MGZE 2D40A 4MLOA 1LOGA 4J1WA 2D6PA 3VKOA 4DQAA 4QT6A 4B7KA 4XMAA 1V6OA 3J8F1 1RUD3 1N1SA 3LB9A 4I0BA 3VV1A 3G7DA 2RS31 4NVPA 1PGL2 4AGRA 4YG0A 3AZZA 4OZXA 5HXVA 2V73A 4JCKA 2ZHKA 2PHTA 1A6CA 3INAA 1REDA 4Q4X1 2R0HA 4YZ2A 2D6KA 5J48A 1ALYA 4RFT0 4M0NA 3VL8A 4Y1ZA 4JV4A 4XTMA 1IPKA 2P34A 3RMXA 4Q8KA 1SLLA 5EFUA 1CAUB 5BYNA 4OULA 1RHI3 5KBFA 1G6NA 2QUOA 3KCYA 2OZ6A 3NSTA 4OVEA 4QPGB 1WMDA 2Z5WA 3VBOC 1ZREA 1LODA 4EWDA 2A73B 3H1WA 2HWE1 3M7AA 1EV11 1S2BA 2NP0A 3CF6E 1OOPA 1OQ1A 5AVPA 5KXCA 1MEC1 1ULGA 5T55A 2Q0AA 3WY6A 2GNBA 1S0JA 5EYYA 4D7YA 2XH6A 5KXDA 5T52A 3WV6A 1KITA 2AZ5A 2DVDA 4I09A 3VBUC 1ZZ7A 3U4XA 1V9U2 1Q8VA 2YZ4A 3O0XA 3RQ0A 4S2GA 4XF0A 1ULFA 1QJU3 3W9AA 3L9JT 4QM9A 1GYKA 3NW4A 4XEZA 4AQ2A 2ZGQA 3P3NA 1IS5A 4U36A 2K0GA 3PJQA 3QCWA 2A6XA 2PA7A 1NXMA 1G9AA 1MS9A 2ETEA 5JWPA 3UJOA 3AXDA 2ZX0A 1RUI3 3ZFEA 3ZMNA 3PLQA 1AX0A 3WDVA 2KXLA 1IOAA 4XTPA 3FHIB 4J6GA 4I01A 5FLJA 4BE3A 2Y38A 2B39A 3KLSA 2XJPA 4C0BA 3ZX7A 1CPNA 3LA7A 4XHBA 4XFFA 4Q4W2 1OD5A 3VGIA 4AI8A 3ZXEA 2VMHA 3NVCA 4AFMA 4PQ9A 4P9IA 2CWSA 1CD3G 4IV3A 3ZYRA 3DKWA 4M00A 4AI3A 3TBDA 4BH9A 1VAMA 4OI2A 3Q9OA 3WQ0A 2E6VA 4YYOA 4B29A 4KU7A 5F6KA 4AFBA 2DUQA 2FQPA 1EP0A 3B7MA 5L7OC 2HYKA 5IK7A 4GMP1 1G9DA 3S6PA 4QMAA 4NHMA 1RGSA 1GNZA 3NKGA 4FPJA 3O12A 3GNEA 4FTEA 3ZFFA 4MUVA 4NR1A 1A78A 3I59A 1AHSA 4Q27A 5D8AC 2ENRA 1WLDA 3KGZA 1LOAA 1ZBE3 4EN7B 3U0ZA 1RUNA 2VOXA 4V1PA 1IZ3A 2YGLA 4K1YA 2YUEA 5H9PA 4I0WB 4E9KA 4OFGA 5DDJ2 4XJ8A 1N1YA 4DXZA 1M4WA 3WG1A 5ABJA 1HQNA 1H1IA 1AX2A 2VW1A 3ZXKA 3V56A 2A3XA 3ALQA 2D3PA 1HIXA 1AL23 4Z92B 3CJIA 1TEIA 1C28A 2R061 1AR73 1XXNA 2R073 3NKTA 1HW5A 4R4ZA 1G9BA 1JUIA 1YFYA 1ZRRA 1FPN1 2DUPA 1TE1B 2VUJA 4YG3A 3MIBA 4OUSA 5BPXA 4HT1T 3IIAA 2BUKA 3HQXA 2Z79A 4A7YA 4PF5A 2LTNA 1O91A 4K40A 1HRV3 2PFWA 3JZVA 5I8YA 2CAUA 4QQOA 4HFSA 1MR5A 5FMOL 2VGDA 1RUE2 1NE6A 2Z69A 3A4UA 4G4FA 3PTYA 1PGW1 1J58A 3AP7A 2ZGKA 1H4HA 1XYPA 3WG4A 5GM0A 1RUH3 1XNKA 1ZRDA 1R091 2CYFA 4EROA 4A3XA 1WD3A 3JB4C 1COV1 1VRH1 4N53C 4AGGA 5L7OA 2XHKA 5FQ0A 2E7TA 5JOYA 1CJPA 5C8CC 2XLFA 2VECA 2MEV1 2RR11 4L2NA 2EVXA 4P9GA 4JGZC 1CN1A 1DGLA 4MGKE 1U5YA 1YFXA 1RUG3 4Q4V1 2ZX4A 2DWRA 1A3KA 3H7YA 5K0UA 1UCXA 1RB8G 1KDMA 2E63A 3VBOB 2O8OA 4FPFA 1NCRA 4RS5C 4OI0A 1S0FA 1LHOA 3IN9A 1YI9A 1BKZA 1BVP1 4UW3A 4RR3C 1S0CA 1BEV1 2W39A 4B8EA 2WNUA 3NAPC 1BQPA 1FX5A 3RDIA 4XF9A 1S2KA 3HD8B 2WZPP 5GLUA 2IC1A 3JD72 4LO5B 3OYWB 1YCIA 3ROUA 2NQYA 2E9QA 1LOCA 1XE7A 2RM23 1H2MA 5E16A 1CPMA 3FFQA 3G6JB 2X53S 1A8MA 2W52A 3A0NA 1UN1A 1F31A 4LBQB 1LEMA 4S2FA 1W6NB 4XBQA 2A6WA 2WKKA 2W08A 2WFF2 4S2DA 2VW2A 2MNGA 2P3JA 4MXVA 1H8VA 1TMF3 4XHXA 3JBG3 3AP9A 4IEQA 4EWAA 1WMFA 1XU1A 3ZXFA 4XMIA 2Z2SB 2PLV2 5JCTA 1IS4A 2C1FA 2ZGOA 3ZYJB 1R1A3 2XVLA 5BXXA 2CV6A 3VL9A 4NWWA 1LOFC 1H0BA 1ZBA2 2EA7A 2ZX1A 4F7ZA 3KCXA 3ZIXA 4CDUC 4FXGB 2TEPA 3GZUC 4AI1A 2BNNA 4YM2A 2YMZA 1WGPA 1JHNA 1POV3 2A5ZA 1DGWX 4Q1RA 4H7LA 1HXS2 3IWZA 5L7OB 3U10A 2BWCA 1V00A 4ASLA 2TUNA 4XF3A 3MDPA 3U11A 2VMGA 4RS5A 4LTAA 3THTA 1ZM1A 2HWC2 4AVSA 1V9U1 1ZZCA 4W6XA 1ASJ1 2ZGLA 2B5HA 2ZGNA 3WZ1A 3QBQA 2GAUA 3WINE 3BODA 2YYOA 1WLWA 3AKQA 4I0AA 2O1QA 4GB31 3WXPA 4FPYA 1MS4A 4YGEA 1PIV1 2B9UA 4XE9A 5BNOC 3JUUA 1BJQA 1BXHA 1UD1A 4MZUA 3MPBA 1D4M2 3AKPA 3LSDA 3TN92 1OLRA 3WP3A 4R9DA 1H1MA 2A7AA 5IK5A 1UZYA 1G8WA 3AXEA 2Q1ZB 3H7JA 4JGYA 4K6BA 2WZR2 1NY72 3QACA 5GZFA 4RD7A 5K9YA 3TNPB 1HV0A 3VBFC 1ND3C 3OD0A 4Q4W1 1JTZX 4FPCA 1C1LA 2VOKA 2RS52 3FLRA 3BALA 5FAXA 1LU2A 1AR92 1XNBA 2ZAAA 1E57A 4Q0VA 1FV3A 2HWB2 2O0OA 2VH9A 1POV0 4YZ5A 4XFIA 2QQPA 1QJX1 1RUD2 4K1ZA 4LHKA 1LOFA 4QQ2A 1EPZA 1F9KA 4LUMA 2HWF2 3VDDA 3O7OA 2JE7A 5KHIA 1CONA 4ES8A 3IDCB 1QQP2 5GJ6A 2UWBA 1FOD3 3BOPA 1H8TC 1VBA1 2DU0A 2DTYA 4YW3A 1SQ4A 4N53B 5JVVA 4LBLA 3AZVA 1H1AA 4YVSC 2JG9A 5JSPA 2GNMA 1W6PA 1ND2C 1SEFA 4XF4A 5CVRA 3AYAA 1B35A 4CDXA 3WDXA 1AYN3 1FMD2 1DU3D 3ASIA 4JGZB 3M4FA 2EAAA 2Z42A 4XIKA 4KBBA 3ZDSA 3ZPYA 4WV8A 1LGNA 1UIKA 5D1IA 1OA3A 3N36A 1QH7A 2PELA 4RS5B 1TME3 1RC6A 1DZQA 5C33A 4GALA 1IKQA 1VBC3 2YHJA 4RR3B 2VU9A 1QJU2 3JU9A 2D44A 2WC2A 5CAZA 5CFCA 3GHNA 3NAPB 1REFA 3OJBA 3O0WA 1YIFA 1W2UA 2KM2A 3A0KA 1YFUA 2JEMA 5JDBA 3MIEA 5BNNC 1RMU1 1RUE1 1D0HA 1PM7A 2HWD2 2GZWA 3PJYA 4META 1I6XA 4AXOA 1BVVA 1DQ1A 3MW3A 4ZU4A 1WBFA 4MGYE 4XFBA 4CP0A 3V64A 1NG0A 2G9FA 4FAGA 4IEYA 1ZZBA 1VB2A 3SHRA 1B09A 4YLZA 3TNQA 4XYXA 4HL0A 1O5LA 3OTFA 1OPOA 4L8QA 4Q4Y3 3NV3A 1FNZA 4QQHA 3B3QE 1BBT3 2JECA 3LAGA 1CQ9A 2NM1A 5FREA 3OBRA 1NQDA 4ONUA 4KU8A 4FPLA 1URXA 3SXWA 4AEJA 1N3OA 4KH9A 5CFDA 3VHPA 1EAH2 1NA1C 4HK9A 3AYDA 5JZGC 4HLTA 3VDDB 4CDUB 1UF2C 4LNVA 2WLQA 1HLCA 3K48A 5DZEA 1RUF1 2VOVA 2VMIA 2XKOA 2UY8A 2X8KA 3E5XA 4FPOB 4HKWA 1BMV2 2D3SA 4H14A 4ISQA 1QNYA 1LKNA 1SMVA 4KGQA 3WW1A 4ORFA 3VKLA 1QGLA 1JYIA 3SCGA 1ZBE2 1AZDA 1FAYA 3QLQA 4WZFA 1C5HA 1AR61 2AR6A 2PAMA 3JD71 3OD4A 3M1HA 3OF1A 2XJTA 1ENRA 4HVOA 4N7UA 4PDWC 2ZGPA 4WBBA 5C4WA 4QPYA 4AK3A 2QDRA 1S1AA 3ZN4A 1SCRA 4A7KA 5B2GB 3B93A 5GALA 2E7QA 1AL22 1IQAA 2W68A 3AMNA 1XYOA 2WNVC 4XJZA 1DQ6A 3WW2A 4IXLA 1DF0A 4KNCA 4DS0A 1QXRA 1WUVA 4IQPA 1C8M2 2DVAA 5EWSA 5BNOB 3EJKA 3AMMA 1VBB2 2JG8C 5DG1A 4XJWA 4LHNA 2WFF1 2BVVA 3J9SA 3VBRC 1OA2A 1UMZA 3WCRA 3ZYGA 4CEYA 1AXYA 2X29A 1KD7A 2PAEA 2E53A 1HRV2 4NN0A 5GLWA 3AKTA 1ENXA 1QU0A 1KFUL 5GKAC 2PLV1 2RJKA 3WD5A 3VBFB 1ND3B 4IESA 4S2HA 3HBZA 3J8F3 1VIWB 3OPZA 3PHMA 3WX5A 1W6QA 1SCSA 2RS33 1ZBA1 5BV6A 1MS5A 4AEKA 2ZGMA 2UURA 4YFWA 2DCYA 4QGLA 2XJQA 2DF7A 2TNFA 4LR4A 1PZ9A 4Q4X3 1RUH2 3SISA 3WCSA 2GSYA 1U5IA 4JRAA 1R1ZA 1QDOA 4INDA 1HXS1 4RGAA 2CGNA 5H9QA 2XVGA 1RJ7A 4A7ZA 4E4ZA 2ARBA 1RUJ2 1X8EA 1U0AA 2Q1MA 4I3PA 5LEJA 2CWMA 1H8TB 2HWC1 1YHFA 1VBE1 4IEVA 2XJUA 4AYUA 3E5UA 3LA3A 4R8HA 5CFDB 2HWE3 4MSVA 1EV13 4F8AA 2VW0A 4FPHA 4YVSB 3DGTA 4XBLA 1ND2B 3RJRA 4AI0A 4PBOA 1UU6A 2DV9A 4FP2A 2JENA 3VHOA 1GV9A 4MVTA 1SBDA 5I0RA 1W0PA 4OHZA 2QFEA 2A71A 2EXHA 5GLZA 5CIRA 4TLFA 1D4M1 1KQRA 2BTVC 3TN91 4IV1C 3MF9A 3AMPA 4LEJA 4AHXA 1QOSA 1QOTA 4BPZA 5E8AA 1H9WA 5JR7B 3DUIA 2OYZA 2WZR1 3TRSB 1Q8PA 2JICA 2QZ3A 1O3SA 5C4WB 3SCHA 3WW3A 4YSFA 1LRHA 1SLIA 2YY1A 5JPMB 3FMGA 4QM8A 2Y0IA 2RS51 4AVCA 4B7EA 3PVNA 2HWB1 4UXAA 5BNNB 4OHYA 3E6CC 4AEMA 3V65A 3GF6A 1QH6A 2DCZA 4QXKA 3CO2A 4PLOA 1GKBA 2WL1A 4CEYB 2ZS6B 2HWF1 1V6JA 4XETA 4E2SA 3LOBA 2D6MA 4FXKB 5K7PA 2FBEA 1QQP1 2ZMLA 3D0JA 3M3OA 3ZXJA 3AP6A 5J36A 4JDNA 3OY8B 1MVQA 2GALA 5ACA1 2H6BA 1VBD2 2BW8A 4HPKB 3AMQA 4GA9A 2B45X 1DFQA 4YW1A 3URFA 3KS7A 1PO21 1UIJA 1W6QB 2EXJA 4XFAA 3T2TA 5BY5A 1ZRCA 1UPSA 1SLBA 4LBNA 2YXSA 4GMP3 4ASMB 4H55A 3ZSJA 4DB5A 1LGBA 1MS0A 4FOVA 3LZZA 1XNCA 1FMD1 3MIHA 3WW4A 3N4MA 5AC91 4Q29A 5EXOA 3ZXAC 4HSLA 5E88A 2IXKA 4J1XA 3VZMA 1LCLA 4XBNA 1SDWA 3RS6A 1O3RA 2WS91 4RHV1 1KJLA 3DPRC 2G4IA 2W0XA 2BWAA 1Q8QA 3T1MA