2ZHNA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
FSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-9
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhnA00
1G9AA 3PVNA 5DG2A 5F5QA 1DQ1A 4R9AA 4YGBA 3APBA 1WLWA 2WLQA 3RMXA 2ZGOA 1MVQA 1MZ6A 3WG3A 4YM1A 2DVGA 1W6QB 3AZWA 3ZXJA 3Q9OA 1V6JA 3N35A 1AZDA 3AP9A 1LTEA 5JVVA 1GNZA 5EYYA 3FLTA 4FOYA 1Q8VA 2ZGNA 4XTPA 4Y1UA 2VY0A 5GJ6A 4C1XA 2ZGRA 3ZSLA 3BIWE 2DVAA 4WV8A 1DHKB 5GZDA 2P3IA 1W6OA 3R4UA 2GN7A 4L8QA 2ES3A 3MPPG 1BJQA 5H9SA 4FPEA 5E88A 3AP5A 1G9FA 2ZAAA 1HQLA 1V6LA 4XOGA 4FPJA 1JN2P 3ZYPA 1OFSA 3M2MA 2PHXA 4JCKA 1S0DA 4FPOB 1MS8A 3OY8A 1G8WA 3AZYA 3M3OA 4AVTA 1CR7A 3VKFC 2EF6A 2AH2A 3IKWA 1MS5A 1S0FA 4DRRA 1GICA 2OVUA 3ATGA 3IPVB 2D3RA 3N36A 4K20A 1SLLA 4GA9A 1Q56A 3WCRA 1GKBA 1PZ7A 2AUYA 1DYKA 4Q1RA 1DLLA 3T1LA 3MW2A 2R49A 3CNAA 3BODA 4UW6A 4K1ZA 3AYAA 1N47A 3ASIA 4YZ1A 4Y22B 1LU2A 2D6PA 4YGEA 3HMYA 1D2SA 2ZGLA 1SLAA 2EXJA 4YG6A 5DZEA 2DUQA 4FPYA 5T55A 1ENRA 1ULCA 3MEPA 2CY6A 1YYNA 1QF3A 1QMJA 2A6ZA 2ZGUA 4FOVA 4BMBA 2GN3A 2YZ4A 1D0HA 4P9WA 4M00A 4DPNA 1SCRA 3AXEA 4LBQB 3NV2A 4UW3A 1QDCA 4BLJA 3W59A 1KJLA 3T1MA 3AZZA 1YO8A 1LENA 1QU0A 2D6NA 2ZHKA 2PHTA 4K1YA 4R9BA 1IS3A 1AXKA 4XJ8A 3V0BB 1AXYA 3FBYA 2ZACA 1QOSA 2ARXA 2YMZA 4D69A 1FAYA 1I3HA 1DYPA 1UZZA 2W68A 4P14A 3PMEA 3FLRA 5JOWA 1BZWA 1QDOA 1S1AA 2E7TA 4XMAA 1W6NA 3AYCA 1JHNA 3R4SA 3L2YA 4NOTA 1H9PA 3WDWA 1SACA 1KRIA 3JU9A 4XJ9A 1WW7A 2A5ZA 1F5FA 3AJZA 4YW1A 2WSVA 1W6PB 2CTVA 4H55A 4AVVA 1JBCA 4Q1PA 1QOTA 1Y7BA 3VKNA 2UWBA 3KQRA 1BYHA 1B09A 1GZ9A 3ZYRA 2V73A 2EXKA 1H30A 2DVFA 1LODA 3R05A 4FPKA 1VAMA 4BOWA 1V6OA 5IT6A 2DV9A 1LCLA 3JUUA 4JRAA 4AGVA 5AVAA 5IUQA 3WLUA 3I8TA 2JKBA 3HN1A 4YGCA 2WKKA 4WVWA 1QNYA 2DUPA 4XZPA 3ZSMA 5CBLA 4GWMA 3PVEA 1QNWA 4GXLA 3WUDA 2FHRA 1YRZA 2UURA 3D6EA 3O0WA 1AX2A 1SCSA 3VV1A 5HCBA 3UJOA 5GZCA 3IN9A 4R9DA 3WHUA 2DTYA 3ZXFA 1C4RA 2NYYA 5EYXA 5IK7A 4Y26A 3B3QE 4WVVA 4XIOA 3VUOA 2ZHMA 3OYWA 3M1HA 4LBNA 4PBPA 3N7LA 1S0IA 1UMZA 1WLCA 1W6OB 1GZCA 2HYKA 2D6LX 2WT2A 1CPNA 1UN1A 1IKPA 1CONA 2YY1A 3POWA 1Z0HA 5GLUA 2R1DA 3SLIA 3N7JA 2CL2A 2PHWA 2VXRA 4Q26A 3WHTA 3AYEA 1F9KA 3WG2A 5DG1A 1ULEA 1UKGA 3N7MA 2CYFA 5GZFA 4TZDA 2W08A 4XILA 4AGGA 1WCSA 3OBRA 3O5SA 2R0FA 4Y1YA 2ZGKA 1LHUA 3GALA 2XB6C 4YW3A 3OY8B 2AREA 2FMDA 1GZWB 2D3PA 5E8AA 4XJAA 1LOAA 2D6MA 2P34A 3GNEA 5KXDA 1QOOA 2GNDA 1IS4A 1IOAA 2NMOA 3AP6A 3OPZA 2UWCA 3AK0A 2GALA 1IKQA 1O4YA 5JMCA 1N3PA 1FATA 4U36A 5FREA 3MW4A 2DTWA 5T54A 5JDBA 2VH9A 1LGNA 3ENRA 4ZKTB 1URXA 4YW4A 1YXWA 3VKMA 1S0CA 1G86A 4YZ4A 2A70A 4P9YA 2PHRA 1N1YA 2R1BA 1V6IA 1CPMA 4Q2FA 2ZGMA 4YG3A 2ENRA 3HR9A 5H9PA 5T52A 3SNMA 4WZFA 4MYEA 4YFWA 3RQ0A 1S0BA 1GSLA 2LTNA 4NO4A 4XJWA 1JW6A 2EALA 5IK5A 3ZPYA 3WDVA 4HANA 1LJ7A 1H9WA 3RS6A 4JC1A 2WQZC 4ATEA 3V64A 1GV9A 1LECA 1MVEA 2TEPA 4M3CF 2P3KA 1LEMA 1G9DA 3M3EA 4PBOA 3ILRA 3IM0A 1WBFA 2ZKNA 5HCFA 3WG1A 2ZMLA 1PZ9A 4YG0A 1AVBA 2D43A 3OBTA 3WVJA 3V0AB 1N1TA 1Q8PA 1N1VA 2CWMA 1W6MB 3AZXA 1BXHA 1W6NB 2WNEA 4M3CE 1JUIA 2E6VA 1MR5A 1SBDA 1LHVA 1LHOA 2A6WA 1N3QA 2EXIA 1YI7A 3TAYA 1ZA4A 1GANA 3USUB 3NV4A 1DBNA 1FX5A 4Q8LA 4M3CB 1LOBA 3WDUA 5CAZA 1AXZA 4Z8BA 2R0HA 1TEIA 3A0KA 1UL9A 3MW3A 1UPSA 2JJ6A 1VALA 1LOFA 2I2SA 3PJQA 1W6QA 3RMYA 1WUVA 5DZFA 5H9RA 5GZGA 3OGGA 4DS0A 3AXDA 4K21A 4CZSA 2JE7A 1LOGA 2G4IA 1JYCA 2Q5TA 4YZ5A 1BQPA 1WW6A 2D44A 1LOEA 4FPHA 4GALA 3QCWA 1X50A 4XYXA 1Q8QA 1GLHA 4Y24A 3SITA 4Y20A 4YM3A 4LBOA 1C57A 1CN1A 1SFYA 3AZVA 1FYUA 1NLSA 3BTAA 1LOFC 2D6OX 4ITCA 3FLPA 3NV3A 2PHFA 5IK8A 4AGRA 1VLNA 2ZMNA 2PHUA 2NP0A 2D6KA 5IK4A 1LGBA 1Q8SA 2P3JA 2GDFA 5KXBA 2A75A 3VKLA 5GM0A 1S0EA 1ZM1A 2DYCA 3WUCA 5BYNA 2DVBA 2NM1A 2OUHA 4FPLA 4HL0A 1HQWA 2JD4A 3IPVA 4XIKA 1KITA 1Z78A 3INAA 1BKZA 3KM5A 2OW4A 4TYSA 5DUVA 4BM8A 1CESA 1MS9A 2NMNA 5GLVA 4I30A 3SH4A 2VUAA 1QKQA 5CNAA 4BPZA 2GMMA 1A3KA 4Y22A 3LSDA 4ZXKA 1JOJA 1R1ZA 4Y1XA 1V6KA 4YGDA 2CWSA 1DQ4A 3WOGA 2D7FA 3WDXA 1DQ2A 1W0OA 3D5OA 5JOYA 1YIFA 3H0OA 1DQ0A 2VU9A 2WT0A 4GWNA 1CJPA 4RL7A 4XE9A 1FNZA 1HDKA 2AR6A 1J1TA 1MZ5A 1KQRA 3WDYA 2UU8A 4DRVA 3WG4A 4YZ2A 1OKQA 1GYKA 4LBJA 1LULA 3B9CA 3V0BA 2ZHNA 4YW2A 3ZXKA 1SLBA 4DQAA 3AFKA 1V6NA 3O0XA 2ZHLA 4YW5A 1LEDA 1OQ1A 5GLWA 1VIWB 3ZSJA 2AYHA 2YV8A 2LALA 2RHPA 1DIWA 1UX6A 3FUQA 2ZGQA 3O12A 1W6PA 2A3XA 2NN8A 1W0PA 1UZYA 1XQNA 2KM2A 4FQZA 4FPCA 4UW4A 5LK5A 1WD4A 4DFSA 3N3HA 3RSJA 2DWRA 2ZGPA 4M01A 5GLTA 3LCPA 1O4ZA 1EPWA 1CQ9A 2ZZJA 4GKYA 2ZGTA 2AGSA 5JLVA 3BOPA 4YZ3A 4XTMA 5JOZA 4OZXA 1LOCA 5T50A 2EAKA 4CTEA 5DZGA 3D4KA 1LHWA 4P9XA 5L73A 3IMNA 4XHBA 4BLIA 1WBLA 2BQPA 3T2TA 1CIWA 4KBBA 2WJSA 1JYIA 1MS1A 1PZ8A 1DZQA 1FV3A 2JECA 1ENSA 4FP2A 2H0BA 1N1SA 4FPGA 5DXDA 1SBFA 2GNTA 3RG0A 2A3WA 1G7YA 4Y20B 1AJOA 1LHNA 2R16A 1IS6A 4XBNA 2PELA 3ZXEA 4Q27A 2V5YA 3DUIA 4IQPA 2JE9A 1CVNA 1JXNA 2A6XA 4XBLA 3WDTA 4U2AA 3SH5A 1LESA 1C1FA 3I4IA 4XMIA 2A71A 4GKXA 5F9TA 1DFQA 1GNHA 1RIRA 1GZWA 2D3SA 1LU1A 2W52A 3B01A 3WNXA 2UWAA 1ULDA 1ENQA 1A8DA 2A3YA 5KXCA 1APNA 1WW5A 1C1LA 2XG3A 5DUUA 1FV2A 2WT1A 2YXSA 3B00A 3N7KA 4BQ1A 2ZABA 3B69A 1ULGA 4ASMB 5T5JA 1WD3A 4FPFA 2NZ9A 2B7YA 1LGCA 1V6MA 2W39A 2ARBA 2E53A 4FP3A 5CA6A 4LBLA 1KDMA 3O0VA 4AYUA 3A0NA 2EIGA 4ATFA 4PF5A 1MACA 3C2UA 3NWKA 3AX4A 1N3OA 1DQ5A 4R9CA 5GZEA 1V00A 3FFZA 3OYWB 5HCAA 1G9CA 1Q8OA 4LBQD 1SLCA 1SBEA 4FOQA 4ISRA 2A7AA 4W65A 5FRAA 5T5OA 3SH3A 4YLZA 2A6VA 3RRDA 3AP7A 1MS3A 2AENA 4AVSA 4ISQA 1F31A 1QGLA 3ZSKA 2ZA9A 5GALA 4Q8KA 2P37A 5E89A 1DQ6A 3QLQA 1AJKA 4PCRA 4C1WA 2OUJA 5DUWA 1AX1A 2GNMA 1MS0A 4XDQA 1A78A 2GMPA 3V0AA 2EXHA 2P2KA 2WSUA 1W6MA 1HLCA 5EWSA 2ZBJA 3LSEA 2ZGSA 3WCSA 3ZVXA 1AF9A 4F83A 2DVDA 3USUA 3WV6A 4YFZA 1KDKA 4YM2A 1VAVA 4FVVA 4M3CA 1GBGA 5SV8A 1FNYA 3U4XA 2VW2A 2E51A 4BMEA 2Z42A 1SLIA 5KXEA 3DGTA 4XHXA 2C9AA 4XBQA 2DU1A 3M3CA 5CB7A 4SLIA 4YM0A 3ZXLA 2VW0A 2JDZA 3SISA 1G9BA 4XXPA 4LBQA 4Y1VA 2SLIA 2ZMKA 5EXOA 4AWDA 1U0AA 2C5DA 2DUOA 3NV1A 3UL2A 3ILNA 5T5PA 3UJQA 2CNAA 1I1EA 5GLZA 3W58A 4XJUA 4CRQA 1AX0A 3M3QA 1UAIA 1WLDA 3UK9A 4Y1ZA 1S0GA 1SLTA 4PQ9A 4FOWA 4FQ4A 2SBAA 3TB0A 3FUOA 3PVOA 2GNBA 1IS5A 4LBMA 3POYA 1S0JA 5H9QA 5T5LA 1HKDA 3A4UA 1RITA 3VKOA 3ILFA 2YROA 4LBKA 2DU0A 2E7QA 3V65A 1ULFA 3POSA 3AYDA 3WZ1A 2GMEA 5JOXA 4XJZA 2VW1A 1DGLA 1NXD1 1WW4A 2ERFA 1ONAA 2DURA 1KJRA 4RA0A 2A6YA 1RINA 4UW5A 4XXAA 3OJBA 5DUXA 1MS4A 3AP4A 3AJYA
chains in the Genus database with same CATH superfamily
3VBSB 2F4PA 2IFWA 2WS91 2GU9A 5F8PA 4K6BA 4QXCA 1BBT3 3BGAA 5JI9A 3TN92 4GIQA 2VMIA 2WLQA 4X6QB 2ZGOA 3RMXA 4GH4A 3N9LA 4LUKA 1RUD2 4AFMA 3LZZA 3AZWA 3ZXJA 4DXZA 1POV0 4BE3A 5A33B 5FLHA 1CZTA 3AP9A 1LTEA 2BYVE 5JVVA 4WM8A 2OKXA 3FX3A 4FOYA 2EIDA 4NUBA 2BNOA 4EWEA 5EZWA 5C71A 2WINB 1RUJ2 2WQ4A 2Y0OA 1UYZA 1D0GA 5FWEA 2VD7A 2GC2A 1IG0A 3RYRA 3VBHC 3S57A 1PIV1 2LW8A 4JV4A 1QQP1 5KHGA 5KWRA 4L8QA 3MPPG 1BJQA 3W20A 5E88A 2PFWA 3WQ7A 1RUI2 1K5JA 4QHBA 5ACA1 1HQLA 2RMU1 4D7TA 4QQLA 4XOGA 4FI9A 4FPJA 4IE0A 3ZYPA 2PXJA 1HB1A 4FFGA 3M2MA 4A7KA 3J7NA 1E57A 2R072 4FPOB 1MS8A 3L9JT 4RSUA 2XVGA 3M3OA 4IV3C 4AVTA 5BUVA 4OUSA 2AH2A 3IKWA 4EJRA 2RDQA 3CJXA 5HXVA 2J1TA 2JDHA 1FT9A 5JPMB 3BTXA 1GOFA 3ATGA 2D3RA 4JKMA 5HI0A 5HV0A 1SLLA 3WCRA 2ILMA 3MUY1 1XNKA 1RJ8A 2HEVF 2AUYA 4OI0A 3T1LA 5FZHA 3MW2A 3CNAA 3BODA 5FYZA 5FZAA 4M4PA 3AYAA 4PF1A 1MQTB 4HPKA 4LPLA 4AQSA 2D6PA 2XUEA 5F3IA 1D2SA 2DBNA 3ZFFB 4NWWA 4PIZA 1SLAA 2JWPA 4YG6A 4N7IA 1JH5A 4YWAA 5AFBA 4FPYA 5LATA 3MEPA 2PQSA 2XHNA 1YYNA 3CDZB 3OD0A 4Y5Z0 2WS92 2A6ZA 1PO11 4P9WA 4HK8A 3QBQA 4BLJA 3GJAA 3NV2A 5E1RA 5KHJA 5FZ4A 2C26A 3W5MA 2BZDA 3AZZA 1LENA 1OA3A 4MOAA 1HX6A 4XJ8A 1ZA7A 4K9SA 3KVBA 1REEA 2XXZA 3FBYA 5D8AA 1CAXA 2VECA 4JDOA 4RR3A 4CCEA 5FXVA 5FO9B 3FLRA 3G7DA 5FYMA 1BZWA 3H1MA 4JQTA 4MH0E 2WO1A 3JCIA 1JHNA 2GP3A 3L2YA 4E8CA 4BJ0A 1PIV2 1U5XA 2JICA 4XJ9A 1F5FA 2VOKA 1QQP2 4LIVA 4TN7A 1W6PB 3MIBA 4AFAA 3RZZA 3UGGA 1W8ZA 1VBE1 5KBFA 2OXBA 2UWBA 4IE4A 3KQRA 5ACA2 2RMU2 2WWJA 1GZ9A 3ZYRA 3IZOA 3ME2A 4FPKA 3UETA 3IWZA 5IT6A 2BGOA 5C4WB 2DV9A 3WW4A 1LCLA 4QGLA 2KA3A 5FPAA 3I8TA 4E2QA 5L7OB 5HXMA 2VTFA 4WVWA 1QNYA 3Q8FA 3SHRA 3EHKA 1SPPB 5LA2A 2JDYA 1R093 5FPLA 4C91A 2QQLA 3GXUA 1FI2A 1GMMA 3VD5A 1H1AA 1SCSA 3ZFGC 2E63A 2ZZQA 3CZUA 5A3NA 3IN9A 4W6XA 2R6QA 3CMGA 4COYA 3EJKA 5BNOA 2HWC2 3S5AA 5G05L 5CG8A 3B3QE 4AAXA 1AYM3 4A45A 1ZRRA 4LBNA 1YEWA 3GCWA 2IUWA 4XZUG 1GZCA 2HYKA 1CPNA 1IKPA 2VXJA 1NG0A 3N7JA 2CL2A 4PI0A 1W90A 4XAEA 1EP0A 1IPKA 1ULEA 4LO8A 1PO12 4Y3OA 5GZFA 4H2AA 2W08A 4RGKA 1WCSA 3OBRA 4AGGA 4K8FA 2R0FA 5FYUA 3GALA 5I0TA 4Y4RA 4YW3A 2AREA 4JTOA 3VZOA 3ZYIB 2YUEA 3IAPA 2P34A 3GNEA 1C3HA 2GNDA 1IS4A 4JHZA 3PDQA 2NMOA 5A70A 1Y4WA 4L92A 2XPJA 2GALA 1IKQA 5FPBA 4FXKB 1O4YA 3UYJA 4JGYC 2H6BA 3IAQA 2BV4A 2HKXA 3ENRA 3ZYFA 4IL7A 1MPXA 4YZ4A 1HXS1 1RYYA 4P9YA 4QPIC 1VBE2 4C0HA 4D6QA 3S7EA 1IPJA 2JDNA 2PAMA 5BNNC 1OF3A 4XC9A 2X05A 4YFWA 1S0BA 1YCIA 4DUVA 4CDUC 2EALA 4C8DA 1UIJA 4QGNA 3MIDA 1E5IA 3WT3A 1LJ7A 2OS2A 2J7MA 1UO9A 2IVJA 1MVEA 2B39A 4WM7C 2BRTA 2EVXA 3GYDA 4R52A 4AEDA 2X5IB 5I93A 3LPFA 5FZ6A 2ZMLA 4KWUA 2WDBA 1PO23 2FDFA 3WVJA 3BIEA 5C6CA 2E6VA 2CAVA 5FZFA 1STMA 5A32A 1LHOA 1H2KA 1HIXA 2PYTA 3K51A 1GOGA 2LUWA 3AL5A 3MLJA 2JD9A 1ZA4A 3WF1A 4IGQA 3USUB 1QJY3 1EAH3 1YQ2A 4ASKA 1NUKA 1X82A 2Q4SA 5DAVA 3ZLIA 4CEYA 2ZX4A 2I2SA 3FJSA 4HKWA 3H7JA 5JPNB 3O1VA 1WUVA 5DZFA 5H9RA 2JE8A 4PT6A 3AXDA 3T3YA 3FMGA 3LA2A 3PL0A 5FBJA 3RZLA 4FCAA 2JE7A 1LOGA 1JYCA 4ES9A 4P9JA 1JUHA 4L2NA 2BPA2 4GALA 5EPAA 1X50A 3OG2A 2W91A 4CPBA 2MHFA 1NOVA 2Q8DA 3KT4A 5I0SA 3LEMA 2OT7A 4BZ4A 5BNQA 1CN1A 5FZCA 5LWBA 2V09A 4GB33 4CSWA 2R063 1HXS2 1LOFC 2VZVA 3F95A 3R4DB 4ITCA 4CCOA 3FLPA 1VLNA 2ZMNA 5A6QA 1OQDA 3HPNA 2ID4A 3MO4A 4ORFA 5EV7A 3WP5A 2P3JA 4G9SB 2BFUS 1PGW1 2GDFA 2LRPA 1DYOA 2OZ6A 5FYCA 3LEIA 2DYCA 1HB2A 3VZKA 2NM1A 4FPLA 4CP9A 1HQWA 1L3JA 2JD4A 2VZTA 4XIKA 5F5AA 5KHHA 3U10A 5DUVA 3TEWA 2IXHA 2JG9A 3MI8A 4BM8A 1PK6B 2QKDA 2VQAA 3Q8EA 3I49A 1CAWA 1QKQA 3DPRA 4QQOA 4BPZA 1UCXA 2J22A 4Y22A 3LSDA 4CU9A 3AKSA 3WNNA 5LEKA 1A8MA 4Y1XA 2HWE3 2ZS6B 5FY1A 2Y64A 3D5OA 3FBMA 2BU9A 3VZNA 4YSFA 3H0OA 1WCQA 5JOYA 1DQ0A 2DBIA 2RM23 1JI6A 2WT0A 4IEQA 4LHLA 1VBB1 5FP7A 1FNZA 3DEMA 2AR6A 1ZRIA 1BK0A 4LIUA 4ARXA 3RZJA 4RQPA 3WG4A 1AR71 4YZ2A 2VMCA 4OI1A 3I3MA 1AYN3 2QDNA 4LUMA 3ZPOA 5ISLA 3I2IA 4YW2A 3ZXKA 1P8JA 4NHXA 3H42B 4E2GA 1RUOA 3J26N 1LKNA 2ZHLA 3PJYA 1OH4A 4W8JA 2E26A 4YW5A 3M70A 1E5HA 1EV11 1DGWA 5J36A 5DQ0A 3H1WA 4HKLA 3GBFA 3PHMA 2G9ZA 4OVEA 4A3XA 4DMIA 4B1MA 5C8CC 2WRAA 3VBRB 3LEKA 1XQNA 4MGZE 4FPCA 4UW4A 1WD4A 1VBD3 1RXFA 4E4SA 5ANQA 1VBA3 4EZ4A 3THTA 1XXNA 1UOFA 2VL4A 1T6BX 1WKYA 4W6WA 1EPWA 3WZ1A 1CQ9A 2ZZJA 4OULA 5IVJA 3ROUA 4QX2A 1GU3A 5JLVA 5JOZA 2VZQA 4PDWA 4XURA 1PGW2 4DY5A 2WYFA 4CEYB 5BV6A 3CL1A 2O8QA 4CTEA 3WNOA 5FP8A 4AOCA 4JHTA 1UQXA 4YVSA 4XHBA 1ODMA 1WBLA 1SZBA 2XVLA 1TG7A 2RJ2A 2YBKA 5L36A 4UFHA 2P17A 3TEZA 4MV2A 3MV11 4Q29A 4N9HA 2W5FA 2R041 3HOBA 3WQBA 5DXDA 2GNTA 1DP0A 1UOBA 2Y60A 4NIIA 3RG0A 4DXTA 1W9WA 1GP6A 1XNCA 5LBBA 3UV9A 4BHPA 5HBAA 3DV8A 5FOBB 3LA3A 3B94A 2V5YA 3DUIA 4IQPA 5IYYA 1WGPA 5ERLA 1COV1 3ACIA 2J1RA 4UBGA 3X29B 1GOHA 3VBFA 3BU7A 1K3IA 2DF7A 4XVHA 5M0TA 3AKRA 3E5XA 1AR72 3KMHA 3KCXA 2BOJA 4YVWC 1LU1A 2W52A 4KI5M 2J42A 1OMIA 1KFXL 2UWAA 3VHNA 2A3YA 1AR81 3KVAA 5LRSA 1APNA 4HZFA 1C1LA 1SFNA 2JB4A 4MG2A 1NCQC 4MGSA 2ZABA 1EV12 3EQEA 5T5JA 4NPLA 2B7YA 1FMD3 2W39A 4Z2WA 1JU3A 3VHPA 3O1UA 4IEUA 4GJYA 1RVF1 5KC5A 1OI6A 1U12A 5A1AA 1NQDA 4PHZA 4ATFA 4X8PA 1MACA 2ZX0A 3H8UA 1ULPA 4EE2A 1W8TA 1NYWA 1DQ5A 4R9CA 1TME3 1V00A 1W9YA 3OYWB 1XE7A 5C9AA 3J4UH 1Q8OA 4GMP3 4Z92B 1VPHA 1S2EA 2P1BA 4UF0B 3OBZA 1GQPA 5SV5A 2R073 2VJXA 4ISRA 4QX8A 2QTWB 1ASJ1 1O3SA 4DO0A 2GZWA 3ZOIA 4CVUA 1OXCA 1R081 3AP7A 1MS3A 5J7MA 2IXLA 1XBFA 1F31A 3ZKUA 3ZDSA 2VR4A 5GALA 4AG4A 4DNYA 2JB8A 3WQ1A 3CBNA 1W2OA 4C1WA 1KD7A 1MS0A 2PMWB 1XE8A 4Q4Y3 3KV4A 3V0AA 5EIYB 2R042 3HBKA 4XUQA 1W6MA 3ELNA 1ZBE3 4AEJA 4EN7B 4MHRA 3VGIA 4PQQA 1PM7A 1UY2A 1YQ8A 2WNVB 4YFZA 1O91A 1VAVA 4FVVA 2VM9A 1GBGA 1VJ2A 4LHSA 5FZ3A 5F1RA 3U4XA 1COV2 2WFPA 3QH6A 3DXUA 3OF1A 3OGRA 4XBQA 5F6LB 4BH9A 5CB7A 3M3CA 1ZRDA 1J3PA 2QQWA 4NIGA 3SISA 3PNAA 4XUTA 2LROA 4LBQA 1BVVA 4AWDA 2DUOA 5CFCC 1I1EA 5GLZA 1AX0A 1CD3G 1KS5A 1MEC1 1AR82 4IETA 4DXSA 5FZBA 1W0NA 2W9XA 2XJVA 2BVVA 3LB9A 2SBAA 1HB3A 2PAEA 1POQA 2VMDA 3E6DA 1S0JA 4MVTA 4QM8A 3B7MA 3VKOA 2G1MA 1W99A 1OT5A 2JIGA 4LBKA 3SC7X 5KC6A 3E5UA 1RVF2 3POSA 1UMIA 2ZAHA 1DGWX 3AYDA 2RMU3 3ETQA 4XJZA 5EJ3A 5FK8A 1NXD1 2ERFA 5FO7B 3ZMOA 4AFCA 3VZJA 2ZXQA 4OZOA 2HH9A 4XXAA 3AKTA 3K3OA 5DUXA 3VDDB 1HV1A 3T2PA 3GM8A 3VBHA 1ASJ2 3RI9A 2W95A 5DG2A 5F5QA 3D0JA 2QQJA 4HG6B 1R082 5FXXA 2YFUA 2UYAA 4MGYE 1AR62 2MNGA 3LIGA 5F2WA 2VVFA 4BU2A 3HNBM 1HB4A 4YM1A 3BN6A 2CHHA 4HVOA 4FBFA 4V2WA 1JZ3A 3NO8A 1EUUA 2PLV3 3TRSB 1GNZA 1RTVA 5BXXA 3FLTA 3W5NA 1Q3EA 4IV3A 2ZGNA 2VZOA 1K5MB 1X8MA 2ARCA 2XLGA 4QKNA 1QH7A 4C1XA 1BEV3 2XKOA 3ZSLA 3H3LA 4XEZA 2HWB1 3ACLA 2VZ3A 3URFA 2QBXA 1HJFA 5FMDA 5CKQA 3SKJE 1WCDJ 1US2A 1PO13 1UZWA 5BNPB 2WNOA 2D40A 3AP5A 4ZU5A 2Q8OA 3B02A 1K42A 4UWDA 4IEXA 3AKPA 1Q43A 1M06G 2QZ3A 2PHXA 4HOOA 1S0DA 3FHAA 4EWAA 2VBPA 2F4LA 4CXYA 2D98A 3VKFC 2WFF3 1MEC2 2EF6A 4QX1A 2J1VA 4O65A 1FOD3 4AI0A 4ZU7A 1GICA 1RUC1 2WAOA 5CYYA 4K20A 3KV5A 3IDEA 3R0RA 4LT5A 4Q1RA 1DLLA 3MICA 4QQHA 4UOJA 4CYDA 3AVRA 4IEWA 3WF0A 4UW6A 5LZ6A 3KSCA 2QQPA 1T6GC 1N47A 4QXBA 1J83A 1YQ5A 4JRLA 3WNPA 3ZFEA 2IC1A 5ABJC 2ZGLA 3H50A 2EXJA 3EYPA 5DZEA 3WNMA 1ENRA 1ULCA 2QQIA 2CY6A 4XFCA 4Z82A 1IZ3A 2GN3A 4LXLA 1D0HA 3JD71 4DPNA 4NIHA 3AXEA 4LBQB 3U07A 2GH2A 2GC3A 1V0AA 3OD4A 3W59A 1KJLA 4Q4X1 1JOBA 1HRI3 4CEWC 5FZKA 3TN91 2FZ2A 1QU0A 3WF4A 1KXGA 4GULA 4EYUA 5A1FA 5DABA 1IS3A 5IVBA 3FWEA 3V0BB 1RUD1 4CXXA 3O1OA 1QOSA 4XFFA 2ARXA 2WWUA 4D69A 1I3HA 4CU8A 3PU3A 1F2NA 4A4AA 4EROA 3PMEA 5JOWA 4P02B 2Y6HA 5A3TA 2E7TA 1S1AA 1X9PA 4OQ8A 1RUNA 1J58A 2HWB2 4NIAA 2VMFA 1SACA 5A3UA 4KG8A 1ZRCA 2B45X 4A6SA 3AJZA 3ZFGA 4AVBA 3FC0A 2CTVA 4H55A 4I01A 4AVVA 5C70A 3GZAA 4RS5C 4GMP0 1BYHA 1B09A 2VNRA 4IXLA 5FZ9A 1JZ5A 2V73A 2EXKA 4LKSA 4AQ6A 1LODA 3R05A 4BOWA 2JG8B 5DDJ1 4R4XA 4DZGA 1O59A 1UY0A 4FT8A 3WLUA 2JKBA 1UZ0A 3KS7A 2WKKA 5IHRA 4QX7A 1RUC2 3MFCA 4GWMA 5JIAA 1QNWA 1YUDA 2JDPA 4MADA 3I2DA 3D6EA 1YRZA 1OOPC 1CAVB 1AX2A 3I54A 3NAPC 3O0WA 4IV1B 5HCBA 4CDWB 3POBA 4RFRB 3D0SA 1HJGA 4R9DA 3WHUA 5CFDB 2DTYA 4IESA 4P5YA 5E16A 1C4RA 5FBZA 3NNFA 3KLSA 1V9U1 4JGZC 1JZ2A 3Q8AA 4K8RB 4PBPA 3N7LA 4EQVA 3LDBA 1VRH1 4N53C 3WW1A 1OH3A 2K46A 4F83A 1Z0HA 5JI7A 4ARYA 2VXRA 2PHWA 4JGYA 3EXUA 2OYZA 4CUBA 1DGRA 1F9KA 3HEIA 4XDOA 3WG2A 5CU1A 1UKGA 1R1A1 4TZDA 1XU1A 2HBTA 3JD72 4XILA 2I74A 3WX5A 3O5SA 3E5QA 4QPIA 1IQAA 5JCTA 2VOVA 2OIIA 3RFRA 2LS6A 4Q4X2 5GKAC 5F7UA 4XAAA 5A3OA 5AC91 5BNNA 2D3PA 4HBNA 3GHNA 1OD5A 3IDAA 4LO7A 3CJIB 3QACA 1AR93 3POJA 4QKDA 3VZLA 5A7SA 4CDQC 4CDUA 3CKHA 5CIRA 1W8WA 5LEJA 1IOAA 3AP6A 5FZOA 5LA9A 2HWF2 5K0UB 1N3PA 2JDAA 3MW4A 5JDBA 4WM7A 4MGTA 3UGFA 1LRHA 4AFDA 4ZKTB 5HV4A 1URXA 1UPIA 2VNVA 1TNFA 3VDBA 1YXWA 3VKMA 1S0CA 1O8SA 2RR11 3OEAA 4HSLA 4YG3A 1V6IA 5T52A 2ENRA 3HR9A 4MYEA 2X09A 1GSLA 2FBEA 2LTNA 4R8HA 1JW6A 5DDJ2 3LOIA 1NKGA 1X9TA 5IK5A 3GHMA 4LA2A 4LK6A 1QJFA 2VVEA 4A44A 3DYPA 4HANA 4AI1A 1ODNA 1ZBA1 2EAAA 5HCHA 4JC1A 4BWOA 1TZOA 1W8HA 1CJDA 2YYOA 2TEPA 3G6JB 3ZYHA 2VUJA 1LEMA 1POV1 4PBOA 3ILRA 4FO9A 2ZKNA 1SDDB 2QVSB 3WG1A 1RUG1 1OA4A 5FMOL 2C6SA 3VD3A 1H1MA 3MFAA 2YDEA 4J1XA 5BPXA 1N1TA 5DAPA 2DCJA 1W3VA 2CWMA 1V9U2 3AZXA 1BXHA 1JUIA 1MR5A 4ASLA 1LHVA 2A6WA 2HWC1 1NCRB 1VRH2 2EXIA 3CO2A 3N9MA 2PN5A 5IW0A 3TAYA 3VBOB 1ND3C 3JXSA 3NV4A 1DBNA 4Q8LA 4RD7A 4AK3A 3BUCA 1B35C 4Y33A 2FDHA 5IAVA 1PNGA 5CAZA 5JSPA 3DYOA 1AXZA 1R1A2 1TEIA 3MW3A 3LE0A 4D6SA 3OGVA 4N43C 1VALA 1LOFA 4NPRA 1W6QA 2BDRA 3KCCA 3OGGA 4QU2A 2R32A 4XQDA 5AC92 3SKVA 2WLPA 2C9KA 2E9QA 3HQXA 3E6CC 3D8CA 1RUF1 3HN3A 1TE1B 1W06A 1GWKA 3O14A 1Z7S1 2XONA 4YZ5A 3RDIA 1ND2B 5FUPA 3NMBA 4B4RA 4OQ9A 1H0BA 4BK4A 5IFPA 4XYXA 3ZFEC 3RJRA 3VBSC 2V5DA 3DKQA 5F39A 3SITA 1UMHA 2Y6FA 3OB8A 3ALQA 4FXGB 3TWIA 1SFYA 2RS31 1FYUA 1VBB3 3J9SA 3BTAA 1X36A 4AI9A 3TEXA 3NV3A 2PHFA 2RR12 4AGRA 1XNTA 3HQRA 4AL9A 2PHUA 2NP0A 2D6KA 4QPGA 4XFHA 5IK4A 2AACA 4Y5SA 1LGBA 4NR1A 5D1IA 4HN0A 3VKLA 3RZKA 1UZVA 1S0EA 5BYNA 4OHYA 3ORJA 5JXIA 1ZBA2 3NRUA 4AEKA 4EWDA 3OPWA 3IPVA 4LHKA 1KITA 3SXWA 4GH4B 4QD2A 5BY5A 2YC2A 3MIGA 3QOPA 1RUG2 3FHQA 2VPVA 3CZJA 1BLZA 4HETA 3S6PA 5FZOB 4KGQA 5GLVA 4B7KA 3SH4A 4WM8B 1YQ6A 3NJZA 1A3KA 1L7QA 4NWVA 1JOJA 4ET7A 4WM7B 1Y43B 3T4VA 1BMV1 1V6KA 2CWSA 1W2AX 1QXRA 2J1UA 3WDXA 1VBC1 3WOGA 2ADEA 2G19A 1O5LA 2ARAA 1QJX3 3PUAA 1CJPA 1RUH1 2F6BA 3KZ4C 4Q0SA 1PHMA 1SQ4A 3T4HB 5C8CA 1D4M2 1HDKA 1J1TA 1MZ5A 2VZSA 4GAZA 3KT7A 2C1FA 2C4XA 2D5FA 3ACGA 1UY4A 5FY0A 1WLTA 2FDGA 1JMUB 1LULA 2ZHNA 1OD3A 4XETA 2W1SA 1MQTC 1RUF2 3EBRA 5JZGA 3PU8A 3ZFFC 2DFCA 2OPWA 1Z7S2 1DZRA 2K9ZA 2XBO1 2BTVC 2J1AA 2Q0AA 4OHXA 2VBDA 1UOJA 1OQ1A 1VIWB 3H9AA 2J1SA 4KWLA 3MBWA 3ZSJA 2K0GA 5J98B 2LALA 2RHPA 4ZONA 3N9PA 4NIDA 2VOXA 3NQHA 3T08A 3O12A 3T2OA 1GQHA 2RS32 1W0PA 4I3PA 4I3GA 3RSJA 2VE1A 2DWRA 4HPKB 2ZGPA 1VRBA 3N9QA 3LCPA 1O4ZA 3TBDA 2WQ8A 5FFOC 4GZ9A 4LR4A 4XF1A 5FZLA 2VZUA 3BTZA 2RS11 5K9YA 1KS4A 4YZ3A 3RZHA 2BWCA 4COVA 5T50A 2EAKA 4LORA 2Q1FA 2W1QA 1O6UA 4ZHNA 2N7GA 2JDUA 5L73A 3IMNA 4BLIA 1JZ6A 1OVSA 3K4AA 4JAAA 4JQRA 3CLPA 3AKQA 1RHI3 3NJXA 1CIWA 4Q4W1 3VLBB 3LFIA 4QX0A 3TNQA 5FQ0A 4YVWA 3T09A 3MGUA 1DZQA 1XB9A 1FV3A 5JXHA 5G04L 3VB9A 2JECA 4DB5A 5D8AB 2H0BA 4FPGA 1CAXB 4M0HA 1SBFA 4RR3B 1G7YA 3ACFA 4K7JA 3UGHA 4L99A 1BMV2 1NCQA 5C4WC 1IS6A 3RPQA 1OA2A 1VBC2 1LNSA 4Q27A 4CCMA 5L7OC 2OPKA 4PLOA 4CXWA 2HWD3 1CVNA 5FY8A 1RUH2 1W2UA 1DG6A 1OC1A 3J8F1 4TXWA 3SMHA 3WDTA 1C8M1 4W6YA 1ZZBA 5AVPA 4GKXA 2RS51 1JZ7A 5I0RA 5FZIA 4C90A 4Q4V3 1GNHA 1GZWA 5FY9A 5CKMA 1VMHA 5D21A 4OI2A 2FZ1A 2VAUA 4RHV2 3WNXA 1BBT1 4K3UA 2BNNA 1ULDA 4OUEA 3PUQA 2WO3A 4A41A 4I0BA 2E31A 3RWNA 2XG3A 1H2NA 5DUUA 1RUE3 2XBO2 1FV2A 2YXSA 3KT1A 3N7KA 4QKFA 3VD7A 3QH7A 3ZIXA 4NHMA 4AHYA 4BQ1A 3PLQA 4ASMB 2ZOEB 3JZVA 4FPFA 1ALYA 4QKBA 2BUKA 4A42A 1C5IA 4KWJA 3HBZA 4RFT0 3BKZA 1YQCA 4FP3A 5CZKA 1H8TC 3T0AA 4LNVA 4XDPA 3A0NA 5BNOB 3C2UA 3AX4A 4MHUA 5GZEA 1NZIA 2BW8A 2VVDA 3U1XA 1UIKA 5HPOA 1SLCA 3KF3A 1SBEA 1GWLA 2RS12 3C7GA 3IIIA 3PVBB 4TLFA 3K75B 3VBUA 4P00B 3PTRB 4AI3A 4HXCA 4Q0UA 3FFQA 5EHDA 1D2QA 4QDSA 5K4LA 3E6BA 5FV3A 3UKVA 4AVSA 5F3CA 1QGLA 2ZA9A 2RJLA 2O0OA 5E89A 3QLQA 1AJKA 4PCRA 3EB7A 2VNOA 4Q4W2 4QGMA 5A7WA 4QWNA 4AFBA 4EN9B 3ZDVA 5F37A 1HRV3 1YWKA 2JDMA 5CFCA 2YBPA 4AI8A 1YLLA 1UF2C 1WMDA 2EA7A 2GC0A 4H7LA 2ZBJA 4HT1T 1SG3A 2TBVA 4KNCA 4YNIA 1WA4A 3WV6A 3PUSA 1CAUA 5C3PA 2IZWA 1KDKA 4BK5A 4M3CA 4IEZA 4QPGC 4EZHA 4QB2A 4BMEA 2E51A 3J8F2 4N9IA 4UI9L 5FTTC 1C8M2 2WZ8A 4XHXA 3UNPA 2RS52 2DU1A 4GD4A 2DCKA 2X5IC 3LKJA 2JDZA 3NNMA 2ZKLA 1LR5A 2ZMKA 1AL21 1UWWA 2CGOA 2KXLA 3NV1A 3UL2A 2G9FA 3I2JA 1BBT2 2DDUA 4BXSV 3PTYA 4CRQA 4XJUA 4IEVA 1DDLA 2FCUA 3LFMA 4OHWA 1UAIA 3AB0A 3ZN4A 5F5CA 1SLTA 2UY9A 2WA4A 3DECA 4FQ4A 4B8EA 3WP6A 3FUOA 1RMU3 4Q5OA 2GNBA 1IS5A 1OQEA 1XYOA 3POYA 3AC0A 2FMYA 5H9QA 4AEDB 3ILFA 4H3WA 4BDVB 1ACCA 5FLIA 4D6RA 5JSRA 1ULFA 3KD4A 2Z4FA 2VBBA 2GMEA 3C7OA 4Q0PA 1E5SA 1DGLA 3I59A 4NMIA 1SFPA 2XLAA 4QMAA 1I9RA 5A32B 2ZX3A 1RINA 2FCTA 3OJBA 5FY5A 3AP4A 4RGAA 3AJYA 3SCGA 3PVNA 3RYPA 1PVC3 2GC1A 5IAXA 3WEZA 5FR3A 4R9AA 3JQXA 4P9LA 5FZ8A 2ZTNA 5JZGC 1TMF3 1MVQA 3HNMA 5JR2A 3ZKYA 3K4ZA 5EFUA 3FE5A 3KGZA 3H7YA 3WF2A 1V6JA 4MXWA 3KHBA 5J3UA 3WNKA 3BB6A 3P1IA 3NNJA 1GNYA 5EYYA 2UYBA 3IMMA 1Q8VA 1R091 4XTPA 3U4SA 5FKBA 3ZX7A 2ZGRA 1RL3A 3DKWA 3RYKA 3AL6A 3BIWE 2DVAA 4MGKE 4WV8A 1DHKB 2Z79A 1J1LA 1T2XA 4JKKA 1W6OA 1AYM1 3M8LA 2GN7A 1NLRA 4XF0A 5F6KA 2WA3A 1NY71 4FPEA 5IVVA 2JX9A 3LPGA 1ZREA 3Q8CA 1S2BA 2VCMA 5ABJA 3POGA 3TOJA 4EN8B 5FZMA 2NPIA 3S5QA 3TN93 1OFSA 4JCKA 1AL22 4OCTA 3OY8A 1RUD3 4KU8A 2MPFA 4XUOA 3K77A 1OLRA 2XHKA 2V4VA 5LBFA 1W8OA 5CVRA 4NRPA 5FZDA 3THDA 4CP9B 1WWYA 3C7EA 1PM4A 2OVUA 2P6HA 2PAKA 4GA9A 1Q56A 1RUJ3 3HWJA 3M4FA 3RVHA 1EY2A 1PZ7A 3VL8A 5CFCB 1DYKA 4LK7A 4CEWA 2JG9B 2R49A 4PJYA 4CP0A 4XFGA 4K1ZA 4KQ7A 1CAWB 5FYTA 2XLFA 3DPRB 3ASIA 4E9KA 4YZ1A 4Y22B 3HMYA 1US3A 4L9BA 1RUI3 4P08A 2MEV1 1YJLA 2DUQA 4NHYA 3VZMA 2ZEYA 1QJZA 2IXKA 2TUNA 4E2SA 5FWJA 4JVAA 4FOVA 4BMBA 3WP4A 2YZ4A 4COUA 4M00A 1SCRA 4AVCA 1QDCA 2FCVA 2ET7A 1MZEA 2HYXA 3NNLA 4RS5A 3N9OA 4RQPB 1YHFA 5C3OA 3VBRC 4YYOA 1AR61 4XQWA 3VL9A 3SCFA 2D6NA 1ZX5A 4K1YA 2Y33A 2H0VA 1EPZA 1KFUL 2Y6LA 1AXYA 1TNRA 2JXAA 2VQUA 1OPOA 5FYBA 3SCHA 2YMZA 3KF5A 1FAYA 1R092 1UZZA 2W68A 3ABZA 1XC6A 3I3BA 4LLOA 4NHKA 4P14A 2I45A 2JDKA 4ZS3A 1QDOA 4XMAA 4DFSA 1PO21 1W6NA 1XYPA 2QNKA 1QHDA 3AYCA 4S2HA 1JZ4A 1KRIA 3JU9A 1OOPA 1WW7A 3NAPA 4YRDA 4YW1A 4AZZA 1AYM2 3VBUC 1JU4A 4O9GA 1NY72 4Q1PA 1Y7BA 3DXTA 4AAPA 5DAXA 3BPSA 2WS93 4JGZA 1M4WA 3O1SA 1QJY1 1EAH1 1IQDC 1JHJA 1H30A 2DVFA 4NPMA 5AC93 4LKFA 4N53A 5LCWL 4SBVA 3ZR6A 3JUUA 4JRAA 4AGVA 5AVAA 4PDWB 4J25A 5IUQA 3HN1A 1VMFA 4AF9A 4LKDA 4F8AA 5DN2A 3MLLA 3J7HA 5CBLA 4CCLA 4MO3M 2A73B 2XJSA 3FL7A 1H6XA 3PVEA 4GXLA 4M4RA 4YVSB 4BQXA 5C5UA 3WUDA 3CEWA 5LA1A 5DPNA 2XWJB 1W2TA 1IHMA 4IGOA 3OPTA 1YFYA 5FUNA 3T2QA 5A6ZA 4GQ7A 1YFXA 1KGYA 3ZXFA 1F8VA 1QY4A 2VQTA 1PIV3 4UBHA 3BPZA 4Y26A 4CDQA 1QQP3 4WVVA 5FIXA 2ZHMA 5FYYA 5IK7A 3ZSEA 1CWPA 1UMZA 1W6OB 2WNUA 2QQOA 2D6LX 2MEV2 5ACA3 3I2KA 5IVYA 5GLUA 2VTXA 1O5UA 4GB31 4Q26A 2R061 2XVKA 3VD4A 2HBUA 4BIOA 2W1WA 1W9TA 4UT5A 5DG1A 3N7MA 4O7XA 2CYFA 5ABJB 5J1XA 4D7SA 3VBFB 3U37A 4FAGA 4Y1YA 1LHUA 3OCPA 3POEA 3OY8B 2JKXA 4XFIA 2WYSA 3I2GA 1A34A 4XPVA 1ULOA 1RUG3 4XJAA 3ETPA 2D6MA 3WQ0A 1JOPA 4FTBA 2B4KA 1QOOA 2GP5A 1C28A 4MX3A 3OPZA 3TEYA 4OHVA 2UWCA 2VCCA 2HWC3 3AK0A 1UX7A 3W21A 4CEWB 1W05A 1PO22 4U36A 4M0NA 2VQ0A 1TVGA 2VH9A 5C8WA 2CGPA 3OUHA 2B46X 4CCDA 1G86A 2HWE1 2A70A 3MF6A 3S7IA 4KMQA 4LULA 4LKEA 4B1LA 1Q5OA 4Q2FA 1N1YA 2R1BA 1CPMA 1EAH2 1QJY2 3SNMA 1UU5A 5C9AB 3NKTA 4WZFA 2RM21 3RQ0A 4XJWA 2WO7A 1VE0A 5CISA 1AL0G 1ND3A 3ZPYA 1B35A 1CGPA 4RS5B 1OPMA 1H9WA 4TSVA 2DFBA 1QJEA 1AYN1 3V64A 1GV9A 1LECA 2WNVC 4NHLA 4B4QA 3BALA 4W4ZA 1OFNA 1UXZA 3NKGA 4N43A 4RYDA 5FMCA 3M3EA 5FY4A 4ZZ5A 1WBFA 3PUIA 4V2VA 1I5PA 4YG0A 3V0AB 1Q8PA 3OEBA 5IFTA 1N1VA 4I2OA 3WSOA 1W6MB 5B2GB 1W6NB 3FHIB 3OGJA 4M3CE 3ZN6A 2ORZA 1SBDA 2RG4A 4QB1A 4XFAA 1VBE3 1YI7A 4PIXA 1ZZ6A 3VBSA 2OA2A 1FX5A 4GB32 1NA1C 1VBD1 1ENXA 2BP6A 2HEWF 2R062 1VBA1 2OQ7A 3AM2A 3C8XA 3LD8A 3UESA 3HT1A 3WDUA 4Z8BA 1SHWB 1UL9A 2BGCA 2VCBA 4CA9A 3ZR5A 2B5HA 3PJQA 3GBWA 5FP9A 2QUOA 4S2FA 3PMSA 5A33A 4DS0A 1F4AA 3ZM8A 4K21A 1XSQA 5DMYA 2WZR1 4ZPIA 4CZSA 3GJBA 4H14A 1BQPA 3CF6E 3MDPA 1WW6A 4L0PA 4ES8A 1OLMA 2FQPA 4L11A 4IEYA 4YM3A 4LBOA 2YG0A 2HWF1 2QFEA 4FTEA 1HN1A 1PVXA 2ZPXA 4J6GA 1F35A 1RUH3 3AZVA 1NLSA 1XU2A 1DLCA 2HWE2 2D6OX 1BHGA 2HJIA 2EIBA 3MPBA 4LQRA 1YFUA 4DIQA 1BCXA 2RM22 3S30A 4CU6A 2BNMA 5I91A 2A75A 2I07B 3VBHB 2WR9A 1K5MC 5GM0A 3DCQA 1ZM1A 1VB2A 2DVBA 3HAGA 1JZ8A 5FO8B 1AYN2 1CX4A 1F5JA 3H8XA 4I02A 1UYYA 2FDIA 1XNAA 3AMQA 2Z69A 3N9NA 4AQ2A 5BNPC 3MF9A 2ZX2A 1MS9A 4LJHA 4OUMA 4I30A 4IDZA 1MQTA 5CNAA 4IV3B 1UY3A 5FZ1A 4HVRA 5FP3A 3ZFFA 4UFJA 5IATA 1FMD1 5FYIA 1HXS3 2XKPA 3K2OA 4YGDA 2D7FA 2VNGA 4FFFA 4GJZA 1DQ2A 3OSDA 5CEHA 1W0OA 5LB6A 3AMHA 3JBG1 1VBD2 1YIFA 1VBA2 2WABA 2VU9A 3ZIWA 5K7PA 1TME1 4XE9A 4GMP1 4FFIA 2B42B 5LBCA 5LA0A 3VHOA 3H8RA 3WDYA 3T30A 1GP4A 2AZ5A 3PIJA 1WMXA 2CV6A 1NLQA 4QX5A 4DRVA 3KV6A 2GAUA 2YB7A 2VZPA 3AVSA 3KQ4B 3B9CA 1X8EA 3MUZ1 3THCA 1H4HA 4XFBA 2WZR2 4ONUA 4ZS2A 4DINB 5JXGA 1LB2A 1ZZ7A 4OFGA 4B7EA 5JWPA 2IXCA 4HK9A 3O0XA 3THPA 4EN6B 5F32A 4W50A 4YPJA 1LEDA 3HNYM 5GLWA 4Q4Y1 4MSVA 2W87A 4AR2A 1H2MA 2WNUC 3GCXA 5IWFA 3FUQA 1U5IA 2ZGQA 1W6PA 2AC1A 4BYYA 5FJHA 5LBEA 3J8F3 2KM2A 4FQZA 4PI2A 5LK5A 2ZX1A 1C8M3 3D82A 3MIHA 3MIEA 4BISA 3ZFEB 1FXZA 2Y0IA 2E7AA 4GKYA 1J59A 1UKRA 2ZGTA 2AGSA 4JDNA 1Y9GA 2ATFA 1C8NA 4V1PA 5C4WA 2ETEA 5L7OA 1JODA 2VZRA 3D4KA 4BXFA 3H1YA 1SPPA 2LM3A 1W04A 2WIIB 3GZTB 3T2TA 3U14A 2WN2A 1J3QA 2VULA 5LY2A 4OMDA 2W47A 1WZXA 3AMNA 1MS1A 3UKTA 4AHXA 4FP2A 1VAKA 4UFMA 1L7RA 1C5HA 3O1MA 3ECQA 1VR3A 5J48A 3P5BA 1FMD2 1AJOA 2JG8C 5C7GA 2R16A 1Y3TA 4A7YA 3LDRA 2PELA 3ZXEA 4DUXA 3UT0A 3JBG2 3ZFGB 3LOBA 4KBZA 1JXNA 2IXJA 2A6XA 3P3PA 1TME2 3GDBA 4XBLA 3WNLA 2WZEA 4CCCA 4A7ZA 1H8TA 2XL9A 2Q1MA 3I4IA 4XMIA 2A71A 5JSOA 1PMJX 1XJAA 2YPDA 1DFQA 4CDWC 4IV1C 4ZZ8A 4URAA 4QQ2A 2ZEWA 1D4M1 3PURA 5CFDC 2J1EA 2CDPA 5L9VA 1IG3A 3B01A 5T3NA 2DCTA 4AVAA 1ENQA 4OMCA 4AI2A 4QDQA 2XQRA 1WW5A 1GQGA 5A7NA 4NE9A 3JQWA 2IXIA 2PLV1 1ULGA 4NN0A 1LAJA 1GP5A 1XNDA 1WD3A 3CQOA 3MLKA 4Q4Y2 4CDXC 5FZ0A 4DUWA 2WL1A 1LGCA 4QU1A 2ARBA 1ZBE2 3ZXGA 4LBLA 3JB4C 3O0VA 1BEV1 3ACHA 5A80A 2BBAA 3IDCB 4XCAA 3WF3A 1XYNA 3NWKA 5C33A 5HCAA 3O1RA 4MGIE 4PLMA 1G9CA 5A3MA 3U78A 1AL23 1G6NA 3CJIC 2YBSA 3NVCA 4FOQA 3Q8BA 2A7AA 1AR73 1XNBA 4JGYB 3O7OA 4YLZA 2CAUA 3SH3A 5EP9A 2A6VA 3RRDA 1MZFA 5EQUA 3VN4A 5CG9A 1UU6A 4ISQA 5K0UC 3ZMNA 3ZSKA 2QDRA 4QPIB 1L7LA 4LO6B 3UKNA 1F15A 4LOSA 2X5IA 1QJU1 3A23A 2Y8KA 1U5YA 2WFF1 3W9AA 1JYTA 5BNNB 2GNMA 1EV13 4XDQA 1FOD1 5FMBA 4CDUB 2EXHA 2P2KA 2WSUA 1OUSA 3AMMA 4BIFA 1YC61 3LSEA 4B4PA 1AF9A 2Y6JA 2WWSA 3KV9A 4K40A 1K45A 3USUA 5JIUA 4FTSA 4CUGA 4HLTA 4WVZA 2Z2SB 1WMEA 4WZCA 5SV8A 4N8MA 2VW2A 5FPXA 1NAEA 1ZYBA 4QPYA 5KXEA 4P9IA 3IIAA 2XL7A 2FD8A 3ZXLA 2VW0A 3QD6A 1G9BA 2O1QA 5EXOA 1QXPA 2C5DA 4CU7A 2QCSB 4D0QA 3ILNA 4MXVA 1W8NA 1XRUA 5F2SA 1GZTA 5T5PA 4D3WA 2BERA 3W58A 4A6OA 5I8YA 2NLRA 1WLDA 4RHV1 3UK9A 3BVCA 2QQKA 1NCRC 4HONA 1HRI1 3VBOC 2R043 4MLOA 4AE2A 2BVBA 2PLV2 4QM9A 3WHTA 5T5LA 4HFSA 3A4UA 3ZN5A 4I09A 1X33A 2BOIA 2DU0A 2UY8A 4GWIA 1W3XA 3V65A 1BEV2 3TYJA 3WXPA 4AW7A 2B8MA 4EV0A 5FYVA 1COV3 1WW4A 5FZ7A 2A1XA 1RB8G 1ONAA 2DURA 1KJRA 1DCSA 1DZTA 1MS4A 1VP6A 4E4HA 1G9AA 1H8TB 1W8UA 3BOWA 5FCCA 2XMLA 1DQ1A 4BCUA 1ND2C 3NJVA 2R7EB 3A21A 2VUCA 4YGBA 3APBA 3NL1A 1WLWA 2P4EA 1AR83 1MZ6A 3WG3A 3HJRA 2DVGA 1W6QB 1FPN1 2AEZA 4JTNA 3WR0A 1QJU2 3Q9OA 4N7UA 1YIPA 2WFF2 1PK6A 3N35A 1AZDA 3POIA 1FOD2 1OLME 4JZRA 4QX3A 2W92A 1ZNPA 2XJTA 4I0WB 4E8DA 4TWTA 2VY0A 1A6CA 4UAPA 4Y1UA 5GJ6A 2XJPA 1RVF3 3C7HA 2Y26A 5A7QA 4LMFA 2MEV3 4LE3A 3SQOA 1R64A 4E4ZA 2O14A 5GZDA 2P3IA 1ZZ8A 4LTAA 3WINE 2B9UA 5E6HA 3R4UA 1U5ZA 1UW8A 3I2FA 2ES3A 5H9SA 5D2AA 4N90A 1HN0A 1ASJ3 1G9FA 2ZAAA 4NAMA 2Q30A 3OUJA 2PHDA 1YFWA 4GH4C 4XQ4A 3H8OA 3RJ2X 3BU0A 1V6LA 1R083 1JN2P 4BQ4A 2CU5A 4RN5A 1O4TA 3R6SA 1AR63 5LK7B 4QPGB 4PLNA 1UYPA 4WM8C 1G8WA 3AZYA 4DXRA 1CR7A 1OKOA 4YW7A 3VD9A 1W03A 1PGL1 5J09A 1MS5A 1S0FA 2BWAA 4BB3A 1NT0A 2YU2A 4DRRA 1HRI2 1PMIA 4XW3A 5IVCA 5L19A 2EIEA 1NXMA 2KR2A 4META 3IPVB 3N36A 5FPVA 4B29A 5B4NA 5DAWA 1AR91 2OQ6A 3RI8A 4HVQA 2P3YA 1GKBA 4COWA 3LF7A 4TTGA 1NE4A 1PNFA 5A6XA 3VBRA 1JYVA 1GR3A 4HN1A 1YI9A 4QAWA 1LU2A 4O61A 4YGEA 4UFKA 4GWJA 4YARA 2RDRA 4QHZA 5T55A 1CX1A 4XUNA 1I6XA 3P3NA 3WW2A 1QF3A 2IFRA 1QMJA 2XR4A 2ZGUA 4G3YC 5CKNA 5C8CB 5FAXA 3ZYBA 1IPSA 4UW3A 4D8MA 4HKOA 1MEC3 4QB6A 5IVEA 1OSGA 3T1MA 3E1F1 1FPN2 1S2KA 1YO8A 5AFEA 4LOTA 4R9BA 2ZHKA 2PHTA 1PMHX 1AXKA 1F4HA 4XF4A 3LA7A 2ZACA 4IE7A 5FLJA 5FPUA 2VG9A 4XCBA 5JZGB 3OBAA 1DYPA 2RJKA 4RGGA 1UY1A 1NQJA 3DL3A 4O9EA 3LIHA 1OVPA 3R4SA 4NOTA 1XOYA 4YW6A 1OLQA 1H9PA 2Y6KA 3WDWA 3F2ZA 5I8SA 2A5ZA 2QQNA 2XOMA 2WSVA 5A1LA 3ST7A 2WUHA 1JBCA 1QOTA 3E97A 1DF0A 1O3QA 3VKNA 1H1IA 3LGRA 3POFA 5FYSA 4MZUA 4KL1A 2ET1A 2W94A 1VAMA 2VOWA 1V6OA 1QH6A 4NJ4A 4NRMA 5D8AC 4CP2A 5FZGA 5CADA 4YGCA 4RR3C 5DAQA 3PUHA 1PGL2 3PIGA 5FKCA 2DUPA 4XZPA 3ZSMA 3ZXDA 4IGPA 4DY3A 1VMJA 3OGSA 4BQYA 1NE6A 2Y6GA 4BQ5A 1UYXA 2FHRA 1AR92 2UURA 2KD7A 4AEMA 5C3QA 4NAOA 3VV1A 1O3RA 2RV9A 2X29A 3UJOA 4AHWA 5GZCA 1WCKA 4YVWB 2VZ1A 5FQ0B 2HWB3 4WVMA 5FXWA 2QQMA 3VHRA 5FDBA 2NYYA 5EYXA 2ZEZA 1AUYA 3USSA 3GZUC 4XIOA 1QIQA 5FYHA 4CUAA 3VUOA 3OYWA 3M1HA 4AHZA 3HIFA 4KWKA 1S0IA 2W2IA 1WLCA 4UF0A 1AHSA 2WT2A 3IDBB 1NCQB 2XQXA 1UN1A 2Y38A 1CONA 2YY1A 1DU3D 1H6YA 2B9VA 2R1DA 3SLIA 2XJRA 3K3NA 3AYEA 5A3WA 1ZVFA 1JS9A 2X10A 3WP3A 2HEYF 2W3JA 2VMGA 4ZU4A 3TNPB 3NW4A 4COZA 4IE5A 2HLEA 1JYWA 3B9IA 2ZGKA 2XB6C 3AFGA 2FMDA 1RUC3 1GZWB 1GWMA 5E8AA 1LOAA 4Y4YA 5BNOC 1SDWA 5JXJA 2L9LA 4DOUA 5KXDA 3KHCA 1UU4A 5B4XA 1BK1A 2ZJCA 3O1TA 5L9BA 3IT8A 4CUCA 3U0ZA 4XF9A 2VTXJ 5FMOS 2VOTA 2WNVA 4IUGA 5JMCA 3I3DA 1HQNA 3A7QA 1FATA 5FREA 5T54A 2DTWA 5F3GA 3GGLA 4UFLA 5JUVA 5EJZB 1LGNA 3U75A 3T0DA 3N4MA 4YW4A 3M3IA 2PHLA 1RGSA 2PHRA 2IVIB 5H9PA 2ZGMA 3JD73 2YPJA 5LRRA 3ZO0B 1QJX1 3RWKX 5JAXA 2BEOA 2CGNA 4NO4A 3O1PA 1QEXA 3VBUB 2WZR3 1Y9QA 3C7FA 4Q4X3 1CZVA 1NA1A 3WDVA 5J96B 1PK6C 5TSWA 1H4GA 1UXXX 3RS6A 4ATEA 2WQZC 2QQVA 1PGSA 4HMZA 1KEXA 2P3KA 3MIFA 4M3CF 4QT6A 1EYBA 2RDNA 2TNFA 4OI4A 2AEYA 4CPBD 1W28A 1G9DA 2XWBB 3IM0A 4KU7A 5HCFA 1ZRFA 2HWF3 4L97A 4BQ3A 3BYWA 3ES4A 1PZ9A 3NNGA 5A7WB 2EICA 1AVBA 2D43A 3OBTA 4NVPA 2VMEA 3ZYGA 4QQPA 4UFIA 4C0BA 1CIYA 2WNEA 3KWVA 5F3EA 3RNSA 4QXKA 1HV0A 3OUIA 4LHNA 3M7AA 4MUVA 1N3QA 3BI3A 3VDDA 1VBB2 1GANA 1CAUB 1CZSA 5C5TA 4M3CB 1LOBA 4DEQA 3BCWA 4JDMA 1NZCA 5EJ1B 4X8NA 3POWA 2R0HA 3A0KA 5DDJ3 1YNAA 4ZY9A 1UPSA 2JJ6A 4WBBA 3HVDA 5FOJB 3FN9A 4AQTA 4AEDC 4MGQA 3RMYA 3NJYA 4IE6A 5GZGA 2G9GA 2JIJA 2YGMA 4PIYA 4IEOA 2OZJA 4B3NA 2VUDA 5KHKA 3KGLA 4XF3A 4IEPA 5C3RA 1SMVA 2GH8A 2G4IA 3D3AA 1K5MA 4Q0VA 2Q5TA 5A7OA 1RHI1 2D44A 4CCJA 1LOEA 4FPHA 4Z2AA 2D5HA 3OTFA 3QCWA 4LEJA 5I8TA 4R4ZA 1XPWA 1XE0A 1V9U3 1Q8QA 1GLHA 5FPZA 4Y24A 4WVMB 3H3UA 1OUXA 3GZEA 3JBG3 4Y20A 4BA6A 3A22A 2NQYA 1VRH3 3I97A 3I3EA 5L9RA 1C57A 1OBNA 5BNPA 5JMOA 1V70A 1E5RA 1W9SA 3B93A 1HW5A 4CEYC 4XACA 4CE8A 1RC6A 4H7MA 5IK8A 3I59B 1R1A3 1NX9A 3OOXA 3P6BA 1UNBA 3KCYA 1QJX2 4LE4A 2HWD1 4XABA 5ANNA 1OF4A 3IB3A 4LITA 2WZPP 3LEGA 2QJVA 1Q8SA 2Q1ZB 4NRQA 5KXBA 2BGPA 2DCYA 3WD5A 4JX0A 2X8KA 5IJRA 3GF6A 3WUCA 4HL0A 2OUHA 3ES1A 2XJQA 4Q4V1 2YC4A 4A3ZA 5KR7A 2WAAA 1JYNA 1O7FA 1Z78A 3INAA 1BKZA 3ZYJB 3KM5A 2OW4A 4TYSA 5FK7A 4CP1A 2WC2A 2JENA 4MXWB 4CCNA 4KG0A 1CESA 2NMNA 3DF0A 1RUE1 2F17A 1JYXA 2VUAA 3CIHA 1K12A 2E32A 2GMMA 4ZXKA 1WA6X 5KHIA 1R1ZA 4A2UA 2Z5WA 4Q0QA 1X7NA 1DQ4A 2RR13 5F5IA 2O8OA 2V4AA 4FAHA 4GWNA 2XJUA 4RL7A 3SEPA 2W46A 4HSJA 4Z1VA 2VMHA 2OX0A 1KQRA 4BQWA 1PX4A 2C24A 2D97A 1REFA 2UU8A 2VC9A 2BJSA 1ZBA3 2PTMA 4OLLA 1OKQA 5LASA 1GYKA 1NA1B 2JG9C 4FFHA 4LBJA 3MYXA 3MHZA 4E4DX 3I3QA 4ZXEA 1POV3 3V0BA 1PX3A 2BBVA 2QQUA 1S55A 1SLBA 1RXGA 3B5LB 3DPRC 4DQAA 1W39A 1EUTA 3AFKA 1OHFA 1RHI2 1V6NA 3EO6A 2QE3A 4NROA 5A6YA 3C3VA 3I2HA 4UYBA 2V72A 1HRV1 2K2SA 2AYHA 2H6CA 2YV8A 1DGRN 2C0ZA 1DIWA 1UX6A 1RJ7A 1Y9MA 3DYMA 4QDRA 5A7PA 1W8FA 3EMRA 1ZZCA 2A3XA 2NN8A 1UZYA 3KB5A 2E33A 3N3HA 4RQPC 3ITQA 4QHOA 4M01A 5GLTA 5FXZA 1D4M3 3WW3A 1GUIA 2JG8A 2P6CA 2HWD2 4KH9A 1OURA 1QWRA 3BOPA 4XTMA 2Q8EA 4OZXA 1LOCA 1ST8A 1UOGA 4X6RB 2VGDA 5I0UA 5DZGA 4J1WA 3WY6A 2Y34A 4Q4V2 2RDSA 1TQ5A 3NSTA 1LHWA 1RUF3 4P9XA 1O3TA 5A3LA 2GSYA 1Z7S3 2BQPA 2XDVA 1CAVA 4CDWA 4KBBA 4IV1A 2WJSA 1JYIA 2QZ2A 2PA7A 5CFDA 1PZ8A 4BQ2A 5JR7B 1RUE2 3K46A 4URTA 3K4DA 1ENSA 3CHXA 1N1SA 2VCAA 2YU1A 3MV01 4P9GA 2A3WA 2CDOA 1RMU1 2RS33 4OHZA 1VB4A 4Y20B 1LHNA 5J37A 4OYUA 3MZHA 4DEVA 3J7MA 4XBNA 5FY7A 4PDWC 4G4FA 4CDXA 1UD1A 3ZXAC 3HT2A 1OOPB 3VDCA 2JE9A 3HD8B 2WBKA 3NAPB 2ORXA 1ZZ9A 4U2AA 4F7ZA 3SH5A 3IBMA 3J7LA 1LESA 1C1FA 3LAGA 4YVSC 5F9TA 3LQCA 4D94A 4JGZB 3RZGA 4LA3A 4S2GA 3RGBA 1PVC1 1QJU3 1RIRA 1D7PM 4FSJA 2RVAA 4LO5B 4N53B 2D3SA 3CJIA 2XUMA 5A3PA 4JKLA 3VDAA 3FZ3A 5APAA 1TMF1 4LO4B 2YGLA 1A8DA 4QPWA 5IVFA 2FDKA 5KXCA 2WT1A 3B00A 3H3ZA 4CCKA 4INDA 5K0UA 2W1UA 3B69A 1BVP1 1O8PA 1HRV2 2DCZA 2NZ9A 5K8SA 2JEMA 1V6MA 3VDDC 2E53A 5FUIA 5CA6A 3VBFC 1VBC3 5FZEA 1KDMA 4AYUA 3BTYA 3V56A 2EIGA 4P5HA 4PF5A 5LY1A 4CDQB 1N3OA 2ZCWA 3I7DA 3FFZA 2D93A 4I0AA 4Z07A 2WNUB 4LBQD 4W65A 5FRAA 2ZEXA 2R30A 3S0MA 4XUPA 5T5OA 1H8VA 2IWGB 4RHV3 5C3SA 2AENA 4Q8KA 2P37A 4E27A 4UXAA 1DQ6A 3K48A 3JB8A 2XBO3 2OUJA 1IGOA 5DUWA 1AX1A 3DN7A 2PQQA 2WN3A 3I2OA 4EN0A 1A78A 2GMPA 1SEFA 2CSGA 2VO5A 5C9AC 1RUJ1 1HLCA 1H2LA 1RMU2 2X53S 2YFZA 5EWSA 2Q8CA 1NCRA 3VBOA 2ZGSA 3WCSA 3ZVXA 5FJKA 2DVDA 4YM2A 1W2NA 3ON7A 4LLFA 1FNYA 2P5BA 2RS13 1QXJA 1YJKA 2XH6A 2Z42A 1RUI1 1SLIA 4QXHA 3DGTA 2C9AA 2W0XA 4SLIA 1FPN3 1GFF2 4YM0A 1PVC2 2FDJA 4XXPA 1JTZX 2BFUL 2SLIA 3GBGA 4TLGA 4Y1VA 1U0AA 1S4CA 2R071 2ADDA 5I0DA 2XGXA 1ND3B 3UJQA 2CNAA 3LWCA 1I5ZA 4Q4W3 1REDA 1TMF2 1B35B 3M3QA 3SEEA 1ND2A 4Y1ZA 4S2DA 1S0GA 1W9FA 4D7YA 4PQ9A 4FOWA 3T0BA 4F3JA 3RZMA 1XSRA 3CU7A 4N43B 1D4VB 3TB0A 3PVOA 3U11A 1J3RA 2YC0A 4LBMA 3HQUA 1HKDA 1RITA 4IW3A 4Y5TA 2YROA 1WMFA 1J84A 2YHJA 2RE9A 2E7QA 1WCUA 3AMPA 3L2HA 5JOXA 3LDKA 1ZBE1 2VW1A 5FP4A 4KGGA 3ZN6B 5LW9A 4CDXB 2WO2A 4RA0A 2A6YA 4UW5A 4AXOA 2RS53 4IERA
chains in the Genus database with same CATH topology
3VBSB 2F4PA 2IFWA 2WS91 2GU9A 4K6BA 1BBT3 5JI9A 3TN92 4GIQA 2VMIA 2WLQA 4X6QB 2ZGOA 3RMXA 4GH4A 4LUKA 1RUD2 4AFMA 3LZZA 3AZWA 3ZXJA 4DXZA 1POV0 4BE3A 5A33B 5FLHA 3AP9A 1LTEA 2BYVE 5JVVA 4WM8A 3FX3A 4FOYA 4EWEA 2BNOA 5EZWA 2WINB 1RUJ2 2WQ4A 2Y0OA 1D0GA 2GC2A 3RYRA 3VBHC 1PIV1 4JV4A 1QQP1 5KHGA 5KWRA 4L8QA 3MPPG 1BJQA 5E88A 2PFWA 3WQ7A 1RUI2 4QHBA 5ACA1 1HQLA 2RMU1 4D7TA 4QQLA 4XOGA 4FPJA 3ZYPA 3M2MA 4A7KA 1E57A 2R072 4FPOB 1MS8A 3L9JT 4RSUA 2XVGA 3M3OA 4IV3C 4AVTA 5BUVA 4OUSA 2AH2A 3IKWA 4EJRA 5HXVA 3CJXA 1FT9A 5JPMB 3ATGA 5HI0A 2D3RA 1SLLA 3WCRA 2ILMA 4OI0A 1XNKA 1RJ8A 2HEVF 2AUYA 3T1LA 3MW2A 3CNAA 3BODA 3AYAA 1MQTB 4HPKA 4AQSA 2D6PA 3ZFFB 1D2SA 4NWWA 4PIZA 1SLAA 4YG6A 4N7IA 1JH5A 5AFBA 4FPYA 3MEPA 1YYNA 3OD0A 4Y5Z0 2WS92 2A6ZA 1PO11 4P9WA 4HK8A 3QBQA 4BLJA 3NV2A 5E1RA 5KHJA 3AZZA 1LENA 1OA3A 1HX6A 4XJ8A 4K9SA 1REEA 5D8AA 3FBYA 1CAXA 2VECA 4JDOA 4RR3A 5FO9B 3FLRA 3G7DA 1BZWA 3H1MA 4MH0E 3JCIA 1JHNA 3L2YA 1PIV2 1U5XA 2JICA 4XJ9A 1F5FA 2VOKA 1QQP2 1W6PB 3MIBA 4AFAA 3RZZA 1VBE1 5KBFA 2UWBA 5ACA2 3KQRA 2RMU2 1GZ9A 3ZYRA 3ME2A 4FPKA 3IWZA 5IT6A 5C4WB 2DV9A 3WW4A 1LCLA 4QGLA 2KA3A 3I8TA 4E2QA 5L7OB 4WVWA 1QNYA 3SHRA 3EHKA 1R093 4C91A 1FI2A 1H1AA 1SCSA 3ZFGC 2E63A 2ZZQA 3IN9A 4W6XA 2R6QA 4COYA 3EJKA 5BNOA 2HWC2 5CG8A 3B3QE 1AYM3 1ZRRA 4LBNA 1GZCA 2HYKA 1CPNA 1IKPA 1NG0A 3N7JA 2CL2A 1EP0A 1IPKA 1ULEA 4LO8A 1PO12 5GZFA 2W08A 4AGGA 1WCSA 3OBRA 4K8FA 2R0FA 3GALA 5I0TA 4YW3A 2AREA 4JTOA 3VZOA 3ZYIB 2YUEA 2P34A 3GNEA 1C3HA 2GNDA 1IS4A 2NMOA 4L92A 2XPJA 2GALA 1IKQA 4FXKB 1O4YA 4JGYC 2H6BA 2HKXA 3ENRA 4IL7A 4YZ4A 1HXS1 4QPIC 4P9YA 1VBE2 4C0HA 3S7EA 1IPJA 2PAMA 5BNNC 4YFWA 1S0BA 1YCIA 4CDUC 2EALA 1UIJA 4QGNA 3MIDA 3WT3A 1LJ7A 1MVEA 2B39A 4WM7C 2EVXA 3GYDA 4R52A 4AEDA 2X5IB 5I93A 2ZMLA 1PO23 3WVJA 5C6CA 2E6VA 2CAVA 5A32A 1LHOA 1H2KA 1HIXA 2PYTA 3K51A 2LUWA 3MLJA 1ZA4A 3USUB 1QJY3 1EAH3 1X82A 2Q4SA 4CEYA 2ZX4A 2I2SA 3FJSA 4HKWA 3H7JA 5JPNB 1WUVA 5DZFA 5H9RA 3AXDA 3FMGA 3LA2A 4FCAA 2JE7A 1LOGA 1JYCA 4ES9A 4P9JA 1JUHA 4L2NA 2BPA2 4GALA 1X50A 2MHFA 1NOVA 3KT4A 5I0SA 4BZ4A 5BNQA 1CN1A 2V09A 4GB33 2R063 1HXS2 1LOFC 3R4DB 4ITCA 3FLPA 1VLNA 2ZMNA 1OQDA 4ORFA 5EV7A 3WP5A 2P3JA 4G9SB 2BFUS 1PGW1 2GDFA 2OZ6A 2DYCA 3VZKA 2NM1A 4FPLA 1HQWA 1L3JA 2JD4A 4XIKA 5KHHA 3U10A 5DUVA 2IXHA 2JG9A 3MI8A 4BM8A 1PK6B 2QKDA 2VQAA 1CAWA 1QKQA 3DPRA 4QQOA 4BPZA 1UCXA 4Y22A 3LSDA 3AKSA 5LEKA 1A8MA 4Y1XA 2HWE3 2ZS6B 3D5OA 3FBMA 3VZNA 4YSFA 5JOYA 3H0OA 1DQ0A 2WT0A 2RM23 4IEQA 4LHLA 1VBB1 1FNZA 2AR6A 4RQPA 3WG4A 1AR71 4YZ2A 4OI1A 1AYN3 2QDNA 4LUMA 4YW2A 3ZXKA 4E2GA 1RUOA 3J26N 1LKNA 2ZHLA 3PJYA 4YW5A 3M70A 1EV11 1DGWA 5J36A 3H1WA 4HKLA 3GBFA 3PHMA 4A3XA 4OVEA 4DMIA 5C8CC 3VBRB 1XQNA 4MGZE 4FPCA 4UW4A 1WD4A 1VBD3 4E4SA 1VBA3 3THTA 1XXNA 4W6WA 1EPWA 1CQ9A 2ZZJA 4OULA 3ROUA 5JLVA 5JOZA 4PDWA 4DY5A 1PGW2 4CEYB 5BV6A 3CL1A 2O8QA 4CTEA 4YVSA 4XHBA 1WBLA 2XVLA 5L36A 2P17A 4MV2A 4Q29A 4N9HA 2R041 5DXDA 2GNTA 3RG0A 1XNCA 3UV9A 4BHPA 5HBAA 3DV8A 5FOBB 3LA3A 3B94A 2V5YA 3DUIA 4IQPA 1WGPA 1COV1 3X29B 4UBGA 3VBFA 3BU7A 2DF7A 3AKRA 3E5XA 1AR72 3KMHA 3KCXA 4YVWC 1LU1A 2W52A 2UWAA 1OMIA 1KFXL 3VHNA 2A3YA 1AR81 5LRSA 1APNA 4HZFA 1C1LA 1SFNA 1NCQC 2ZABA 1EV12 3EQEA 5T5JA 2B7YA 1FMD3 2W39A 4Z2WA 3VHPA 4IEUA 1RVF1 5KC5A 1OI6A 1U12A 1NQDA 4ATFA 4X8PA 1MACA 2ZX0A 3H8UA 1NYWA 1DQ5A 4R9CA 1TME3 1V00A 3OYWB 5C9AA 1XE7A 3J4UH 1Q8OA 4GMP3 4Z92B 5SV5A 2R073 4ISRA 1ASJ1 1O3SA 2GZWA 1R081 3AP7A 1MS3A 5J7MA 2IXLA 1F31A 3ZDSA 5GALA 4AG4A 4DNYA 3WQ1A 4C1WA 1KD7A 1MS0A 1XE8A 4Q4Y3 3V0AA 2R042 1W6MA 3ELNA 1ZBE3 4AEJA 4EN7B 3VGIA 1PM7A 2WNVB 4YFZA 1O91A 1VAVA 4FVVA 1GBGA 1VJ2A 5F1RA 3U4XA 1COV2 2WFPA 3QH6A 3OF1A 4XBQA 5F6LB 4BH9A 5CB7A 3M3CA 1ZRDA 1J3PA 3SISA 3PNAA 4LBQA 4AWDA 1BVVA 2DUOA 5CFCC 1I1EA 5GLZA 1AX0A 1CD3G 1KS5A 1MEC1 1AR82 4IETA 2XJVA 2BVVA 3LB9A 2SBAA 2PAEA 3E6DA 1S0JA 4MVTA 4QM8A 3B7MA 3VKOA 5KC6A 4LBKA 3E5UA 1RVF2 3POSA 3AYDA 2ZAHA 1DGWX 5EJ3A 2RMU3 3ETQA 4XJZA 3WZ1A 3ZMOA 1NXD1 2ERFA 5FO7B 4AFCA 3VZJA 4XXAA 3AKTA 5DUXA 3VDDB 1HV1A 3VBHA 1ASJ2 3RI9A 5DG2A 5F5QA 3D0JA 1R082 2UYAA 4MGYE 1AR62 2MNGA 2VVFA 4YM1A 4HVOA 4FBFA 3NO8A 2PLV3 3TRSB 1GNZA 1RTVA 5BXXA 3FLTA 1Q3EA 4IV3A 2ZGNA 1K5MB 1X8MA 4C1XA 2XLGA 1QH7A 1BEV3 2XKOA 3ZSLA 4XEZA 2HWB1 3ACLA 3URFA 1WCDJ 1PO13 5BNPB 2D40A 3AP5A 4ZU5A 2Q8OA 3B02A 4IEXA 3AKPA 1Q43A 1M06G 2QZ3A 2PHXA 1S0DA 4EWAA 2D98A 3VKFC 2WFF3 1MEC2 2EF6A 1FOD3 4AI0A 4ZU7A 1GICA 1RUC1 4K20A 3IDEA 3R0RA 4LT5A 4Q1RA 1DLLA 3MICA 4QQHA 4CYDA 4IEWA 4UW6A 3KSCA 2QQPA 1T6GC 1N47A 3ZFEA 5ABJC 4JRLA 2IC1A 2ZGLA 3H50A 2EXJA 5DZEA 1ENRA 1ULCA 2CY6A 4XFCA 4Z82A 1IZ3A 2GN3A 1D0HA 3JD71 4DPNA 3AXEA 4LBQB 3U07A 2GH2A 2GC3A 3OD4A 3W59A 1KJLA 4Q4X1 1HRI3 4CEWC 3TN91 2FZ2A 1QU0A 1KXGA 4GULA 1IS3A 3FWEA 3V0BB 1RUD1 1QOSA 4XFFA 2ARXA 4D69A 1I3HA 1F2NA 4EROA 3PMEA 5JOWA 2E7TA 1S1AA 1RUNA 1J58A 2HWB2 1SACA 1ZRCA 4KG8A 2B45X 3AJZA 3ZFGA 4AVBA 3FC0A 2CTVA 4H55A 4I01A 4AVVA 3GZAA 4RS5C 4GMP0 1BYHA 1B09A 2VNRA 4IXLA 2V73A 2EXKA 4AQ6A 1LODA 3R05A 4BOWA 2JG8B 5DDJ1 4R4XA 4DZGA 4FT8A 3WLUA 2JKBA 3KS7A 2WKKA 1RUC2 3MFCA 4GWMA 5JIAA 1QNWA 1YUDA 3I2DA 3D6EA 1YRZA 1OOPC 1CAVB 1AX2A 3I54A 3NAPC 3O0WA 4IV1B 5HCBA 4CDWB 3D0SA 4R9DA 3WHUA 5CFDB 2DTYA 4IESA 5E16A 5FBZA 1C4RA 3KLSA 1V9U1 4JGZC 4PBPA 3N7LA 1VRH1 4N53C 3WW1A 4F83A 1Z0HA 5JI7A 2VXRA 2PHWA 4JGYA 3EXUA 2OYZA 1DGRA 1F9KA 3WG2A 5CU1A 1UKGA 1R1A1 4TZDA 1XU1A 3JD72 4XILA 2I74A 3WX5A 3O5SA 3E5QA 4QPIA 1IQAA 5JCTA 2VOVA 2OIIA 4Q4X2 5GKAC 5AC91 5BNNA 2D3PA 4HBNA 3GHNA 1OD5A 4LO7A 3CJIB 3QACA 1AR93 4CDUA 3VZLA 4CDQC 5CIRA 5LEJA 1IOAA 3AP6A 2HWF2 5K0UB 1N3PA 3MW4A 5JDBA 4WM7A 1LRHA 4AFDA 4ZKTB 1URXA 1UPIA 1TNFA 1YXWA 3VKMA 1S0CA 2RR11 4HSLA 4YG3A 1V6IA 5T52A 2ENRA 3HR9A 4MYEA 1GSLA 2FBEA 2LTNA 4R8HA 1JW6A 5DDJ2 3LOIA 5IK5A 3GHMA 4LA2A 2VVEA 4HANA 4AI1A 1ZBA1 2EAAA 4JC1A 4BWOA 1CJDA 2YYOA 2TEPA 3G6JB 2VUJA 1LEMA 1POV1 4PBOA 3ILRA 4FO9A 2ZKNA 2QVSB 3WG1A 1RUG1 1OA4A 5FMOL 1H1MA 3MFAA 2YDEA 4J1XA 5BPXA 1N1TA 2DCJA 2CWMA 1V9U2 3AZXA 1BXHA 1JUIA 1MR5A 4ASLA 1LHVA 2A6WA 2HWC1 1NCRB 1VRH2 2EXIA 3CO2A 3VBOB 2PN5A 3TAYA 1ND3C 3NV4A 1DBNA 4Q8LA 4RD7A 4AK3A 1B35C 5JSPA 1PNGA 5CAZA 1AXZA 1R1A2 1TEIA 3MW3A 4N43C 1VALA 1LOFA 4NPRA 1W6QA 3KCCA 3OGGA 4QU2A 2R32A 4XQDA 5AC92 2WLPA 2E9QA 3HQXA 3E6CC 3D8CA 1RUF1 1TE1B 3O14A 1Z7S1 4YZ5A 3RDIA 1ND2B 4B4RA 1H0BA 4XYXA 3ZFEC 3RJRA 3VBSC 3SITA 3ALQA 4FXGB 3TWIA 1SFYA 2RS31 1FYUA 1VBB3 3J9SA 3BTAA 1X36A 3NV3A 2PHFA 2RR12 4AGRA 2PHUA 2NP0A 2D6KA 4QPGA 4XFHA 5IK4A 1LGBA 4NR1A 5D1IA 4HN0A 3VKLA 5BYNA 1S0EA 4OHYA 1ZBA2 4AEKA 4EWDA 3IPVA 4LHKA 1KITA 3SXWA 4GH4B 4QD2A 5BY5A 3MIGA 3QOPA 1RUG2 3S6PA 2VPVA 4HETA 4B7KA 4KGQA 5GLVA 3SH4A 4WM8B 3NJZA 1A3KA 4NWVA 1JOJA 4WM7B 1Y43B 1BMV1 1V6KA 2CWSA 1QXRA 3WOGA 3WDXA 1VBC1 1O5LA 1QJX3 1CJPA 1RUH1 2F6BA 3KZ4C 4Q0SA 1PHMA 1SQ4A 5C8CA 1D4M2 1HDKA 1J1TA 1MZ5A 3KT7A 2C1FA 2D5FA 1WLTA 1LULA 2ZHNA 4XETA 1MQTC 1RUF2 3EBRA 5JZGA 3ZFFC 2DFCA 1Z7S2 1DZRA 2K9ZA 2XBO1 2BTVC 2Q0AA 4OHXA 1OQ1A 1VIWB 3H9AA 4KWLA 3ZSJA 2K0GA 5J98B 2LALA 2RHPA 2VOXA 3O12A 1GQHA 2RS32 1W0PA 4I3PA 4I3GA 3RSJA 2DWRA 4HPKB 2ZGPA 3LCPA 1O4ZA 3TBDA 5FFOC 4LR4A 4XF1A 2RS11 5K9YA 1KS4A 4YZ3A 2BWCA 4COVA 5T50A 2EAKA 2N7GA 5L73A 3IMNA 4BLIA 4JAAA 4JQRA 3CLPA 3AKQA 1RHI3 1CIWA 4Q4W1 3VLBB 3TNQA 5FQ0A 4YVWA 3MGUA 1DZQA 1FV3A 2JECA 4DB5A 5D8AB 2H0BA 4FPGA 1CAXB 4M0HA 1SBFA 4RR3B 1G7YA 4K7JA 4L99A 1BMV2 1NCQA 5C4WC 1IS6A 3RPQA 1OA2A 1VBC2 4Q27A 5L7OC 2OPKA 4PLOA 2HWD3 1CVNA 1RUH2 1W2UA 1DG6A 3J8F1 3SMHA 3WDTA 1C8M1 4W6YA 1ZZBA 5AVPA 4GKXA 2RS51 5I0RA 4C90A 4Q4V3 1GNHA 1GZWA 4OI2A 2FZ1A 4RHV2 3WNXA 1BBT1 4K3UA 2BNNA 1ULDA 4I0BA 3RWNA 2XG3A 1H2NA 5DUUA 1RUE3 2XBO2 1FV2A 2YXSA 3KT1A 3N7KA 4BQ1A 4AHYA 3QH7A