4GH4B

Crystal structure of foot and mouth disease virus a22 serotype
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
DRLLTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGHLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein VP1
publication title Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb
molecule tags Virus
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gh4B00
3VDDC 1TMF3 4YVSA 4RS5B 1FOD1 1RMU2 2BPA2 2RS11 4Q4Y3 1RMU1 1EV12 1W39A 5DDJ3 2R071 1NCRB 1RVF1 4CEWC 3VBFC 1RB8G 1EV13 4JGYB 1OOPB 5LK7B 1VBB1 5A33A 1AYM3 1F8VA 4AEDC 1OPOA 4WM8C 1NA1B 4Q4X2 1VBA1 4RQPC 1COV2 1QJY3 4YVSB 5D8AB 4NWWA 1MEC2 1R1A2 1MEC1 1RHI1 1WCDJ 1D4M1 3JBG1 1ZBE2 3M8LA 1ZBE1 2WS92 4Q4W3 4YVWC 2HWD2 2IZWA 2WS93 5J98B 4CDWB 4FTEA 1B35C 1MQTC 1HRV1 4Y5Z0 3VBHA 4CEYB 1PO11 2WFF3 2XBO1 1HQNA 3ZFFA 1IHMA 3LOBA 4Z92B 4QPGC 1ASJ2 2RS31 1PGW2 1K5MA 5A32B 2HWB1 1ASJ3 4PDWB 3VBOB 1QJX1 1AR82 2R063 1AR92 1R081 2BUKA 2HWE1 1HXS3 1POV0 1BEV2 2X5IA 1AR83 1H8TA 1AR93 4CDXB 1V9U2 1POV3 4JGZB 1E57A 1GFF2 1FPN1 1TME1 1AYN3 1VBE3 1ND2C 3TN92 5C4WA 1PVC3 1RUD3 3CJIA 5JZGC 3J8F1 5CFDC 1QJU3 3ZFGC 1AUYA 3TN93 4CDQC 5J96B 1NCQA 1R093 1EAH2 3JD72 3JD71 1FMD2 3VBRA 1FMD1 2R042 1EAH3 4CDUB 1NOVA 1AR71 2RMU1 4WM7B 1DDLA 1VRH2 1VRH1 4QPIB 1F2NA 4RS5A 2RM22 1QQP2 2MEV2 1AL21 4Q4V1 1NCQB 3VBUB 2BFUS 4GMP0 1RUF1 2WZR1 3VBRB 4JGYA 1OOPA 2RR13 4GB33 1PO22 4NWVA 1C8NA 5FMOS 4GH4C 1PGL1 1RUH3 4RR3B 5AC91 1TMF2 1VBC1 1NA1A 4FTSA 1BMV2 4IV3A 5BNPB 1BMV1 4N43B 4Q4Y2 5DDJ1 4Q4Y1 3ZFEB 2VQ0A 5D8AA 5L7OC 3VBHC 1EV11 1AYM2 1RUG2 2HWC3 3ZFFC 1RUG3 4SBVA 1QJZA 4RHV2 4CDWA 1QJY2 4IV3B 5C8CB 1K5MC 1RUI3 1VB4A 2HWF3 3S6PA 4Q4X1 4RHV3 5C9AB 1AR63 4CEYA 1COV1 1RUC3 4Q4W2 5K0UB 1R1A1 2RS13 1NY72 2X5IC 2WS91 1H8TC 5BNNA 4IV1B 1X33A 2HWD1 3VBSC 1RVF3 1ND2B 4BCUA 5A32A 3DPRC 3JB8A 4PDWA 3VBOA 2FZ1A 4CDQB 2WFF2 3NAPB 5C4WC 5CFCC 3CJIC 1ND3C 1VBA3 4CDXA 4JGZA 5BNNB 5FOJB 1VBD2 1ASJ1 1RHI3 5ABJB 1D4M3 3JBG3 1PGW1 2R062 1HXS2 1VBD3 2GH8A 1HXS1 5BNOB 1AR81 1AR91 1POV1 1HRV3 4RS5C 1BEV1 1PO13 2TBVA 1NCRC 4N53B 1V9U1 1AYN2 1VBE2 2DF7A 1VBE1 4CDUA 1PVC2 1RUD2 4JGYC 1OOPC 1QJU2 4WM7A 1QJU1 1SMVA 5ACA2 3VDDB 3TN91 4QPIA 1R092 5L7OB 2HWB3 5ACA3 1QJX3 3VBUA 4YVSC 4CEWB 3VBFB 1EAH1 5D8AC 2HWE3 1ZBA3 2BFUL 4AEDB 1PIV2 2R041 4WM8B 4RR3A 1B35A 5FMOL 2RS52 5BNPA 4N43A 1RUE2 1PIV3 1FPN3 4RQPB 3ZFEA 4CDWC 1TME3 2WLPA 2RS53 4EJRA 2RM21 1QQP1 1RUE3 2MEV1 3J8F3 2RR12 4GB32 1BBT2 4YVWB 4GMP1 1RUH2 1HRI2 1OHFA 1NG0A 1PO21 3DPRB 1BBT3 4FTBA 1HRI3 2PLV2 1B35B 1TMF1 1MQTB 5C8CA 2BBVA 5CFCB 5C9AA 2PLV3 3VBOC 2HWC2 1Z7S2 5K0UA 4QPGB 1AL23 1AYM1 4Q4V3 1RUG1 1Z7S3 3JB4C 4IV1A 4CDXC 1RUI2 2WZR3 1ND2A 4JGZC 2HWF2 1C8M2 1RUJ3 1AR62 4RHV1 1QJY1 1RUC2 1RUC1 4CDQA 5AC93 3NAPA 1C8M3 1VBC3 1FOD2 2RS12 2R072 4Q4W1 1FOD3 1RVF2 1RMU3 1NY71 2R073 1VBB2 5ABJA 4CDUC 5JZGB 1VBB3 5CFDB 3ZFGB 5BNOA 4WM7C 1VBA2 1CD3G 2WFF1 4QPIC 3HAGA 4Q4X3 1RHI2 1COV3 1D4M2 1NCQC 3JBG2 4N53A 3VBUC 2Y26A 4GH4A 1A6CA 1MEC3 3VBRC 1R1A3 1VBD1 5A33B 1ZBE3 1AL0G 2R061 3VDDA 2HWD3 2ZZQA 4RR3C 1HRV2 5L7OA 5BNPC 4FSJA 4N43C 1PO12 3ZFEC 4CEWA 3VBFA 2XBO2 1M06G 2GSYA 4GH4B 4AEDA 1AYN1 2XBO3 4LLFA 1CJDA 2RS32 4WM8A 1PVC1 1RUD1 2HWB2 4RQPA 2RS33 5ACA1 1QJX2 1NA1C 1R091 4IV3C 1R082 3VBHB 5C8CC 2HWE2 3ZXAC 1ZBA2 1ZBA1 5C9AC 2ZAHA 1R083 4YVWA 3ZFFB 3VBSA 5K0UC 1BEV3 1FPN2 3DPRA 1PIV1 4IV1C 1TME2 1V9U3 1MQTA 1K5MB 2RS51 1RUE1 5CFCA 3IDEA 1ND3A 3J8F2 2QQPA 2ZTNA 1HX6A 1VAKA 3NAPC 5GKAC 4CEYC 2RR11 4GB31 4QPGA 2X5IB 1H8TB 1BBT1 1RUH1 3VBSB 1HRI1 3JD73 1VB2A 1AR72 1FMD3 5BNNC 2RMU2 2PLV1 4RFT0 5ABJC 2R043 5C4WB 1AR73 3CJIB 1ND3B 2RMU3 4PDWC 1AL22 4Q4V2 5BNOC 1VRH3 2HWC1 1Z7S1 3FBMA 1NCRA 1RUF2 1X36A 1QQP3 2MEV3 2RM23 2WZR2 1RUJ2 4Y4YA 1RUJ1 2XPJA 4N53C 4GMP3 1RUF3 1PGL2 1RUI1 5AC92 1VBC2 5JZGA 2HWF1 1C8M1 1AR61 1PO23 5CFDA 2FZ2A 3ZFGA 5DDJ2 2WWSA
chains in the Genus database with same CATH superfamily
1CIYA 3OD0A 4Y20B 1TMF3 2P1BA 3VDDC 1TNFA 2PFWA 2X8KA 3FLRA 2QE3A 2BW8A 2RS11 1EV12 3ATGA 4Q4Y3 3V56A 1XXNA 5LBCA 1KRIA 3ZSKA 1RVF1 3GBGA 1QY4A 3LOIA 5FPVA 4MVTA 1YI9A 2EA7A 1G9AA 3I97A 4IEUA 5A33A 1N3QA 1H8VA 4W8JA 5CYYA 4AEDC 2AR6A 2DVAA 4ZONA 4A45A 5HCBA 3USUA 4RD7A 1NA1B 1H30A 1B09A 3DXUA 2MHFA 3O1PA 3LA3A 4HMZA 3M3QA 1J84A 3M4FA 3UGHA 3ECQA 2QQLA 1COV2 3F2ZA 1AVBA 3BIEA 4COYA 2XJUA 1GP6A 2A3YA 2DVFA 2CV6A 2YU2A 1O3SA 2XKOA 2ZGRA 3I3BA 4C1WA 3MIEA 4ZKTB 3ZYPA 5DXDA 5FKBA 3WR0A 1RHI1 1WCDJ 1V6NA 3WHTA 3M8LA 1WBLA 4AQSA 2HWD2 5J37A 5F3GA 4PIZA 4GQ7A 1QDOA 2OZJA 2A70A 3AXEA 3FLPA 1ENQA 1ZA4A 2VU9A 2VPVA 4OMDA 5F2SA 4B3NA 1U5YA 1EY2A 4CDWB 1S55A 2W94A 5KWRA 3J7MA 2J1UA 4TLGA 1MQTC 1V6LA 2JIGA 4LA2A 4Y5Z0 2UU8A 3HN1A 1VE0A 2VVDA 4EROA 3TEWA 3T0DA 2WUHA 3P6BA 1NLQA 3WW2A 3C7OA 1O3QA 3KVBA 3POEA 1ZZBA 3S5QA 4AAPA 1LEMA 3SC7X 3LOBA 1SLBA 2ZCWA 2VJXA 4HPKA 4DZGA 4PBPA 4IXLA 3OYWA 1DQ0A 5E16A 3LEIA 4HSLA 4OHXA 1LAJA 5FZEA 3QCWA 4AQTA 1Y9MA 2OVUA 1ULDA 1S2BA 1S4CA 4XVHA 2ARCA 4CP9A 4PIYA 5DQ0A 5CZKA 5FP3A 1GWLA 4CCCA 1CJPA 1PNFA 1BEV2 3MIDA 4QX0A 2X5IA 1H8TA 4CU9A 5C33A 2X53S 5FJKA 1POV3 1CZTA 1GFF2 1FPN1 3LA7A 1I3HA 2NQYA 2WNVA 4NAOA 3UK9A 3CJXA 3LFMA 5T55A 3EO6A 4ZZ8A 1TME1 1J1LA 3WP5A 1JYCA 1DQ6A 1W6OA 1ND2C 2BNNA 3I8TA 4KG8A 1UL9A 5EYXA 5C4WA 3TN92 5JZGC 5BXXA 3PTYA 5DZFA 4DPNA 4EWEA 4Q0SA 3NNGA 2BGCA 4HLTA 1QJU3 3WT3A 5CAZA 1VAMA 2IXIA 4QQLA 3HQRA 2W9XA 4Q26A 1N47A 3JD72 1H4GA 3JD71 3UYJA 3W9AA 4Y1XA 5HXVA 3OPZA 4H7MA 4I0WB 1OLMA 1LHOA 4AFCA 3H9AA 2PHXA 4I30A 1SLIA 1LR5A 5FBZA 1A78A 1GZWA 2RVAA 2VXRA 4AGGA 1GOGA 4QM9A 5FZMA 2GC3A 2PHFA 1DDLA 5FXZA 2Q4SA 2DUOA 1BLZA 5DN2A 4IEOA 2A6WA 4QPIB 3E6DA 2BWAA 4OHWA 2VULA 2WBKA 5EYYA 2VZ3A 3W58A 5FXWA 5DUVA 4IE7A 4P9IA 4Y1VA 2QVSB 2BFUS 2J7MA 1GNZA 4YW6A 4LULA 1RUF1 4YZ5A 1YFUA 2VUCA 3GDBA 1OOPA 4QX1A 4NWVA 3KGZA 5C3QA 1JUIA 4Y1ZA 3QH6A 4NHXA 3ZSLA 3GYDA 3AMNA 5SV8A 5AC91 1HN0A 2D3PA 3EMRA 2WNUB 5DDJ1 1HV0A 1RITA 2FDFA 2AYHA 3ABZA 5H9PA 4YW1A 5D8AA 1JN2P 1AX2A 1WWYA 3SLIA 5KC6A 4HBNA 5F32A 4CU6A 2HWC3 2ZZJA 2JKXA 3ZXLA 4CUCA 4AVCA 3RS6A 1O6UA 1TNRA 3FX3A 5I0UA 4MGTA 1GV9A 1HN1A 3KF3A 3ZYBA 3ZYFA 1RUG3 2W52A 4ASMB 3LA2A 3J7LA 1H1AA 4Z8BA 3UJOA 3I2OA 3LKJA 5G05L 4QKDA 1GQHA 1RUI3 1DLCA 5FAXA 5HPOA 5JXIA 5C9AB 5JXGA 5DAWA 1RUC3 4W65A 5FY0A 1DQ4A 4QM8A 4YG6A 4XUQA 3MZHA 2BU9A 4B1MA 2KD7A 2Q5TA 3ME2A 2RS13 3E6BA 3KV9A 3B01A 1OURA 3OGSA 4KBBA 1X33A 2WZEA 4YM3A 2VMHA 1RVF3 1XSRA 1TVGA 1WLCA 5C70A 3VD9A 5CNAA 4PDWA 1NE4A 2ILMA 4AVBA 4AVAA 2E31A 5C7GA 2JG8A 4V2WA 3IKWA 5C3PA 4LORA 3VHPA 4CDQB 2WFF2 5FZFA 4JVAA 1YFWA 3POIA 3PMSA 3UKTA 2ZGLA 1QF3A 3BVCA 3C3VA 3IBMA 4Q0QA 4Y22B 5J48A 1QKQA 1XC6A 2ADEA 5FLJA 3THTA 1GKBA 1RUNA 5EXOA 3H3UA 1W8FA 1GOFA 2QKDA 3KT7A 3QOPA 4JKKA 2X10A 1RHI3 2W1WA 4H14A 3GXUA 2WR9A 5FYCA 5KXCA 3OY8B 5JPNB 1PNGA 3LPGA 4CZSA 1HXS2 2GH8A 5C71A 1RINA 1HXS1 1S2EA 1JYWA 2JDHA 4EWDA 3LEMA 1F5JA 1UXZA 4D8MA 3MPPG 5BNOB 4B7EA 4QDRA 2RDSA 3AZVA 5EP9A 5GLZA 2K0GA 3LWCA 4N9HA 5FYZA 1OA4A 2RJLA 4Y1UA 3RVHA 1V6MA 1AXKA 5F2WA 4BQ1A 1JH5A 3SH4A 5J7MA 1V9U1 2XLFA 1WCSA 1VBE2 1VBE1 1I5PA 3PVEA 2QBXA 1S0DA 4CDUA 1UYZA 5BUVA 3NRUA 4JGYC 2EALA 2ERFA 5FY1A 1QJFA 3T2PA 1SMVA 3WHUA 4AGVA 5JOWA 2WRAA 3VDDB 1NKGA 1UD1A 4I02A 4TSVA 3Q9OA 5C5UA 3PURA 3CLPA 4CCDA 4BXFA 5IVFA 4GAZA 2BVBA 3T30A 3INAA 5FYSA 4NIIA 2F6BA 4LO8A 4IDZA 1UIJA 5GM0A 3SKVA 4PHZA 1W6PA 2JE8A 2XJRA 4CYDA 3S7EA 4COUA 2D6KA 4AEDB 1H2NA 4DXRA 5KXEA 4FPLA 2V4AA 4XFFA 4GIQA 1B35A 5FMOL 5FY7A 5IVJA 2OZ6A 4FAGA 1ZYBA 1FPN3 3VL9A 3RYKA 4DMIA 3ZFEA 1TME3 4LHLA 2RS53 5JAXA 2FMYA 2JD9A 4EJRA 1QQP1 2WNEA 1AHSA 5IW0A 5FR3A 2OIIA 1FAYA 4AW7A 3WP3A 4DXZA 1W6MA 1XU1A 4JAAA 1DGWA 3MO4A 3MIBA 2VQUA 1SLTA 1GZ9A 1RTVA 3AKPA 3B02A 1AJKA 3DCQA 1FXZA 3KM5A 4A44A 1UWWA 3O1MA 1NG0A 5FOBB 1ZZ7A 1PO21 5FFOC 3HWJA 5FZIA 5E89A 4YZ3A 5KXBA 1H1IA 2ZX4A 1NT0A 5FZCA 5LY2A 5B4NA 4AEJA 4OZOA 1U5ZA 4FO9A 5DPNA 1MQTB 5D21A 4PJYA 4MG2A 4EN8B 2BZDA 5FQ0A 4XDQA 5CFCB 1VR3A 3AP4A 3ZXEA 2PLV3 4MH0E 3VBOC 3RWNA 1Q8SA 4LEJA 4LNVA 4M4RA 4ZU7A 2P3IA 1DYKA 4E9KA 4K1ZA 2YU1A 2KM2A 1Z7S3 1RXGA 2A6XA 3JB4C 1KXGA 2VOKA 3LCPA 4XUTA 5FZ3A 3DYMA 4BQ5A 3N9NA 4D0QA 1DYOA 4AZZA 1PMHX 1UY0A 4K3UA 1MS0A 4WVVA 2ZGOA 4LE3A 1MS3A 1QMJA 2HWF2 1RUJ3 3FBYA 2VZTA 1O5UA 3NV2A 4RHV1 1LHWA 3MUY1 4E2SA 1OUXA 1UN1A 5A6XA 3TNQA 3T3YA 5AC93 3ACLA 2VGDA 3GZAA 4A7KA 2SLIA 4GWMA 3TEZA 2FDIA 1MVEA 3K51A 3U4SA 2ZHKA 4AK3A 5C3RA 3GNEA 4OHVA 1ULPA 2OXBA 3H1YA 3MBWA 2WQ4A 4O9EA 4M4PA 1VLNA 4F3JA 1VBB2 1OF3A 2NMNA 3H1MA 4NHKA 2Y64A 1F5FA 3DYPA 4N9IA 3CBNA 4UWDA 4XMIA 3WG2A 2D7FA 3ETPA 3LDBA 4JX0A 3ZPOA 1F31A 5JZGB 3ZKYA 1JYIA 4YG3A 2GU9A 1DIWA 2JG9B 2Y34A 2O0OA 3HBKA 1I5ZA 2B9VA 2UYBA 2C1FA 4AHWA 4S2DA 1JXNA 2Y33A 4AI0A 4P9XA 5JPMB 2OYZA 3WQBA 3WDUA 2DBIA 1SLCA 3AVSA 3ZYRA 4IE4A 4N53A 4YW2A 3VBUC 3DL3A 4A2UA 5EWSA 4Z1VA 2JDNA 5KC5A 3GGLA 2EIGA 3BUCA 3VD3A 2VBDA 4KWJA 1NAEA 5A3PA 4XDOA 2VXJA 2XONA 1ZBE3 2ZKLA 4MV2A 2WT2A 1TE1B 1AL0G 2YBKA 2R061 4XFIA 4AI8A 4CPBD 2ZHMA 5DZGA 5FMBA 3VHOA 4RR3C 3VUOA 2RJ2A 5FWJA 4N43C 2XWBB 5FZ9A 1RXFA 3IAQA 1FYUA 3NW4A 4XJZA 1UF2C 2P34A 2VZ1A 1DFQA 2GNMA 3PIJA 4U2AA 5LW9A 2JDZA 3VBFA 1ULFA 2EIDA 2GSYA 4CSWA 3P1IA 3AKSA 4LBNA 4A7YA 2JDUA 4NRQA 3BOPA 2VECA 1AYN1 2XBO3 2WYSA 2OQ7A 4LLFA 1UU6A 4WM8A 3DV8A 4YGEA 1RUD1 5JXHA 1BYHA 4GWNA 1H0BA 1I6XA 1SDDB 3RZJA 3HR9A 2HWB2 2JD4A 4B29A 2CSGA 3OBZA 3W20A 2RS33 3FHQA 1QJX2 4TZDA 1NA1C 1R091 3AZZA 5KXDA 4IV3C 1R082 5F3IA 5A7QA 2H0VA 2HWE2 2W1UA 3OBTA 5C8CC 3ZXAC 1LU2A 1RL3A 3W59A 4PQ9A 3RDIA 3DKWA 1K3IA 5CKMA 3WEZA 1LRHA 2CGPA 2IWGB 4WVZA 2VZRA 3GZEA 1ONAA 1PZ7A 4NRPA 3WDTA 4META 4BISA 4NPLA 1G9BA 4NUBA 1ALYA 2WZPP 1PIV1 2IXKA 1D4VB 3D6EA 4IV1C 3SISA 1V9U3 3ZVXA 4W50A 4LJHA 4EZ4A 2GALA 3LIGA 1CWPA 1ZZ8A 3H42B 3IDEA 1ND3A 3J8F2 3IMMA 4QDSA 4UFIA 2C5DA 4Z2WA 1NYWA 5CISA 2XJSA 3MW4A 2XJPA 4N8MA 2ZTNA 1KDKA 2D6NA 3ETQA 1GWKA 1VAKA 3VZOA 3NAPC 1OXCA 3OTFA 3LSDA 1KEXA 2RR11 1JYVA 1DQ2A 1RUH1 4R9BA 1R64A 4ES8A 5FJHA 1XNCA 1VB2A 2B5HA 5L9VA 2VD7A 1YCIA 3O5SA 1FMD3 3ZKUA 4GWIA 1CAVB 4Q8LA 5FY4A 3N35A 4LHNA 2QZ3A 2QQMA 5JI7A 2D6MA 3DECA 3AKRA 3KT4A 3UKNA 1XRUA 1W2NA 2E26A 2YROA 3PUHA 3OUIA 4HK9A 1CN1A 2AH2A 4XBLA 4Y20A 3H8XA 4I0AA 5AVAA 3ZMNA 2AREA 4LIUA 5GLUA 1YRZA 1N3OA 2P6CA 3TOJA 1JU4A 3PVBB 3ZSJA 3J4UH 3VKNA 2NP0A 4CUGA 1SFYA 1QQP3 2E33A 3T4VA 2XUMA 4HN1A 1JMUB 3MPBA 4XUPA 4Y4YA 1IS4A 2EF6A 3ITQA 2YY1A 2ZHLA 3A21A 1W9TA 3D0JA 3K4DA 3BIWE 4MXWA 2XDVA 3VDAA 2UYAA 3O14A 1IQDC 4XABA 1C8M1 3VZJA 4AI9A 1AR61 1PO23 5CFDA 3TBDA 2KR2A 5GALA 2FZ2A 2KA3A 3M70A 3WP6A 1OQDA 1XNTA 1H6XA 3LSEA 3W5MA 4OULA 1FOD1 4CCKA 4YZ4A 4BK4A 1RMU2 3T4HB 2WZ8A 1RMU1 1W39A 2BEOA 4UFJA 3V0BB 2R071 4BJ0A 1LOBA 2ZGNA 3PU3A 3A0KA 3KV5A 1I1EA 3NNLA 1RB8G 2BJSA 5FZGA 4JGYB 2B46X 3CNAA 3AX4A 2BRTA 3N7JA 4AQ2A 4B4PA 3BOWA 1F8VA 2G19A 4IEWA 4P9GA 4URTA 3U4XA 1P8JA 4YRDA 3TYJA 1UZZA 4ISRA 1QIQA 3M3OA 4AL9A 4Q4X2 1VBA1 2ZX1A 2ZXQA 4Q2FA 4R9DA 3RNSA 5H9SA 1AF9A 3C7HA 3THCA 3WQ7A 5I0RA 3T1MA 1NQDA 4FXGB 1LOGA 4ORFA 4NWWA 2R49A 3JXSA 1CAUA 5FY9A 1D4M1 3JBG1 4RGAA 3AC0A 4AG4A 4IGPA 5LK5A 2IZWA 5FUIA 3BB6A 3F95A 4YGCA 5KBFA 2Y6LA 2Y6FA 3AYEA 2WS93 1OPMA 2AEYA 2WYFA 4SLIA 3R6SA 4HFSA 3D8CA 1YNAA 4FTEA 2HLEA 1GWMA 1K45A 4DUVA 2TUNA 2IFRA 1HRV1 3FHAA 1FATA 1H9PA 4PLOA 1FV2A 1GLHA 5L36A 1OQEA 3ROUA 2VTFA 1QOTA 3MUZ1 1ULGA 5LATA 5AFEA 4QQPA 4QQ2A 5JR7B 1W8ZA 3ZFFA 2IVJA 1IHMA 1UY1A 1PMIA 5B4XA 3WF0A 1LOCA 3H0OA 4W6XA 5FYMA 3VKLA 5FP4A 2XVLA 5CEHA 2JEMA 1XNDA 2D93A 1D0GA 3ENRA 4XBNA 5JR2A 3CMGA 2P37A 4HVOA 2XUEA 3P3PA 4ONUA 4I01A 1JTZX 1Q8QA 5AVPA 4E27A 1ASJ3 3VBOB 1Z78A 4Z82A 2DCTA 2OUJA 1RIRA 3KGLA 2BP6A 3W21A 3U37A 1KJRA 2R063 4FPGA 2BUKA 4WBBA 4YZ1A 1WW4A 4COVA 3O1SA 3H8RA 3PU8A 5EPAA 1AR83 1AR93 1OFSA 2GC2A 1L7RA 4DEQA 4E8CA 1IS5A 3M3IA 3O1TA 2QQNA 5GZGA 1W3XA 4OI1A 5FYUA 1IKPA 4B4RA 4N7UA 4HETA 3TEYA 3V0AA 1WW7A 2H6BA 1V6IA 4XJUA 1AYN3 2IUWA 2JDAA 3N9PA 4DQAA 4URAA 2VMDA 1FNYA 1RUD3 1X8EA 3BPSA 3CJIA 4J1XA 5FK7A 1YFYA 4LMFA 2UWCA 5JLVA 4LT5A 1WMEA 3ZFGC 5FP9A 1MPXA 3MLJA 5CIRA 4CDQC 1Y9QA 1ZRCA 1PK6A 1R093 2J1RA 2QUOA 3AZYA 3GBWA 4M3CB 4NPRA 5BPXA 3AP5A 4E4HA 5LA0A 2WO7A 4ITCA 3BU0A 2BQPA 3VKOA 3C2UA 2W0XA 2QCSB 2R042 1EAH3 3R0RA 1S2KA 2X29A 1AR71 2ZGPA 1U5XA 3ZIWA 2G9FA 2RMU1 1XBFA 3OUHA 2A3WA 4X8PA 3WX5A 3ON7A 1NZIA 4HKOA 5T3NA 3WG4A 3WOGA 5FZ1A 1HB1A 1YEWA 1QU0A 1WD3A 2VCAA 1KQRA 2MEV2 2RM22 3HIFA 3PHMA 1AL21 1OVPA 4RS5A 1MZ5A 4Q4V1 2W87A 4UT5A 3GJBA 2VUDA 3THPA 2Y6JA 3VBUB 1H1MA 3KQRA 3OSDA 4GMP0 2Q8CA 1N3PA 1UPSA 1VP6A 2R32A 4P5HA 3BTXA 2I74A 2RR13 5BNQA 1IGOA 4QT6A 1C8NA 1XYNA 2DDUA 3WNOA 4DY3A 1PGL1 2B4KA 1RUH3 2GNTA 4RR3B 1VBC1 2XHNA 1BMV2 1MACA 3R4UA 4N43B 4QKNA 5LBBA 4BH9A 1CR7A 1UYYA 1C57A 3OOXA 4COWA 4MLOA 2CWSA 3LB9A 4JDNA 1ZVFA 2HEWF 1A8MA 1EV11 1DCSA 5GLWA 2EXJA 2PAKA 1A34A 1AYM2 3RZGA 1RUG2 4UW3A 3NJYA 3HPNA 3KWVA 4LBOA 4A42A 2FDHA 2QZ2A 4UW4A 2JICA 1DYPA 4SBVA 2G4IA 1LJ7A 3WCSA 1QJY2 4BQXA 1F4AA 4LBJA 4IV3B 3NKTA 5A3OA 1Q8VA 5C8CB 2ZKNA 4OI4A 2RHPA 5FO8B 5IK7A 1J83A 1PMJX 2A7AA 1AR63 4CEYA 1COV1 1GP5A 4LITA 4Q4W2 3O0VA 5FYBA 5FZHA 5CVRA 2HEYF 3N4MA 3IN9A 2W1SA 1OA3A 5IFTA 2X5IC 1BJQA 5LA2A 1H8TC 4IV1B 3WCRA 1CONA 1US3A 2H6CA 2HWD1 3OY8A 1OI6A 4QHBA 4BCUA 4LXLA 4TN7A 3WF3A 4YWAA 5A32A 5LA1A 5K7PA 2WNVC 3JB8A 3KF5A 1Y3TA 2VE1A 2XL9A 3S7IA 3CHXA 4A6SA 3AMPA 5KHKA 3WG3A 3NAPB 5C4WC 5CFCC 4OQ9A 4XOGA 3LIHA 1O91A 1VBA3 2GZWA 2VVEA 3S30A 4ATFA 2NLRA 4TXWA 4BPZA 3LEKA 4CDXA 3N9OA 2W5FA 4JGZA 3IAPA 4FOVA 4LUKA 1CQ9A 3THDA 2B45X 5JSPA 2ZHNA 1D4M3 1WW6A 3JBG3 3FHIB 1HLCA 4LK7A 4OYUA 4LTAA 3N7LA 4PLNA 4ZHNA 3NV3A 4LBQA 1VBD3 2Y6GA 4CCMA 3NVCA 3WDYA 2WQ8A 4Z07A 1OQ1A 1GICA 1SZBA 4M3CF 2EIBA 1UZ0A 2WAOA 5FYHA 2A5ZA 5JOZA 1G9FA 4FPCA 4LKDA 3ACFA 3QBQA 5FP8A 4D6RA 1HRV3 3HMYA 3TB0A 1W2TA 1BEV1 4YSFA 5HCHA 2GMEA 4XQWA 4Z2AA 2GNDA 2QQJA 4RA0A 3WF2A 1DGRN 1PVC2 3GJAA 4KGGA 4LIVA 4QQOA 4MHUA 1OOPC 2QJVA 3MLKA 1S0FA 4WM7A 3POWA 4N7IA 4V2VA 1E5RA 4XZUG 3TN91 3ZXGA 4A7ZA 5C5TA 4QXKA 5CA6A 4ZXKA 5L7OB 2YC0A 3IPVA 2JG9C 3VZLA 2ZX3A 3DXTA 2VAUA 4L99A 5ACA3 4XW3A 2DWRA 3AJZA 2Q0AA 4EE2A 1W2AX 4YVSC 3RZKA 2QTWB 1EYBA 5D8AC 3WY6A 1CAXB 5T5LA 2W91A 3RPQA 1ZBA3 4D7YA 4R9AA 3LQCA 1JOPA 3V64A 2W39A 3I59B 3H7YA 5FREA 5JMOA 1LGCA 1RYYA 4M3CE 5FZOB 2RS52 1CPNA 3FJSA 4QX7A 5K4LA 1HQLA 5BNPA 2JECA 4KU7A 4BU2A 2XH6A 4X8NA 3GBFA 4MGIE 1RUE3 3OCPA 4GWJA 1VMHA 4BB3A 3A23A 2WN2A 1JU3A 1SACA 3AZXA 3DEMA 1PGSA 1W3VA 1GUIA 1LOAA 1U0AA 4GB32 2UWAA 2K2SA 4XQDA 2YG0A 2Z42A 2E63A 4GMP1 1L7QA 1XNAA 1G6NA 2ADDA 4XEZA 2A6ZA 1SEFA 1FX5A 3DPRB 1BBT3 1OT5A 2D98A 2HBTA 3ZN6A 1HRI3 2PLV2 4IE0A 4XXAA 1HW5A 3BTYA 2VNRA 3A22A 4WZCA 3A7QA 4Y1YA 2C26A 4E8DA 1EP0A 1H2MA 1FNZA 2JG8C 1Z7S2 4BQYA 2KXLA 3H50A 1J58A 4XIKA 1E5HA 4RL7A 1WGPA 2VY0A 2P3YA 3ZXKA 5FZAA 4LKEA 3WD5A 5K0UA 5J36A 2Z79A 2DUQA 1AL23 2E53A 5LBFA 4Q4V3 4AOCA 5A7OA 5I8TA 3I7DA 2FDKA 1UZYA 4L11A 1ND2A 2XR4A 3I2IA 3URFA 1X9TA 3CF6E 2WFPA 1SHWB 4PF1A 4DXTA 2WKKA 3AL6A 3NO8A 2VOVA 4NHYA 4XJAA 4Y4RA 4Y5TA 1LHUA 3MYXA 1JZ2A 1Q56A 1VBC3 5HBAA 2YPJA 2XJTA 2ZA9A 3P5BA 3PDQA 3U11A 2QFEA 3I2KA 2GP3A 1SFPA 4IE6A 2P3JA 2J1AA 4MSVA 2J22A 1CPMA 1SPPB 4J25A 3WNKA 1A8DA 2DU0A 3OGGA 3K2OA 3VD4A 4ZY9A 4XCAA 2QDNA 1GMMA 3G7DA 3GCWA 4JRAA 4P9JA 3WLUA 5ABJA 3O0XA 1DZQA 1J3PA 2BNOA 1JZ5A 3VLBB 4CDUC 2J1TA 3JCIA 2B42B 3IDBB 4Y26A 1VJ2A 4BYYA 4HSJA 3ZFGB 5KHIA 4GJZA 3FZ3A 3RZMA 2D6PA 2WFF1 4KBZA 2GH2A 4YGBA 4BIOA 1MS1A 2QNKA 5DAQA 3MV11 1CAWA 2CHHA 1COV3 1NCQC 3KLSA 4QPWA 2FMDA 2Y26A 1OH3A 4PIXA 4XILA 4XMAA 3VBRC 5LEKA 3HEIA 5A33B 4BDVB 3D0SA 3NNFA 4IEPA 2DURA 3VZNA 3RFRA 3POYA 4JZRA 3USUB 4DS0A 2HWD3 2VR4A 3POSA 5D2AA 4JTNA 4QKFA 3WW4A 4DNYA 1OLRA 4MYEA 1PO12 3ZFEC 3NJZA 4WVMB 2VMCA 1E5SA 5SV5A 5IAXA 1DGWX 4CEWA 4IESA 4CU7A 2XBO2 3LE0A 3HBZA 3ZYIB 1O7FA 2PHRA 4K21A 1F35A 5HI0A 1O8SA 3G6JB 2VZVA 3OB8A 3DUIA 3NWKA 4XC9A 2CU5A 3MFCA 1CJDA 1O4ZA 2RS32 3PUIA 4HANA 4A3ZA 3T0AA 4AAXA 4OLLA 4NOTA 1ENSA 2LM3A 4RQPA 1WMFA 5A1FA 1ZZ6A 3SXWA 3UKVA 4MO3M 5I91A 2JE9A 4P02B 3ILRA 1VPHA 2VCCA 2A71A 2B9UA 3FWEA 2VNGA 1NLRA 4ZU5A 3ZDSA 5FO9B 2P17A 4YM1A 2ZAHA 4H3WA 4YVWA 1YLLA 4K20A 2BOJA 4BE3A 1US2A 5E1RA 1W8WA 4JDMA 1BEV3 5BY5A 4FFHA 1CESA 1I9RA 2BGPA 3EHKA 4HPKB 5HCFA 2WT0A 1JZ8A 3OYWB 4B4QA 1N1TA 3Q8AA 5IVCA 4XHXA 5LB6A 4YARA 4KG0A 1L3JA 5FLIA 3U07A 2WINB 1LKNA 5A7WA 1QWRA 4C0BA 4CP9B 1OKOA 1MS4A 1HX6A 4AWDA 5FYVA 3KQ4B 2D3SA 2WIIB 5T5JA 5GKAC 4QU1A 4Y3OA 2IVIB 4QPGA 2X5IB 1H8TB 2B8MA 1GP4A 4BQ3A 5FPUA 2DTWA 3K75B 3JD73 5CB7A 2W68A 5EJ1B 4PQQA 5LWBA 2WNVB 3EBRA 1QXPA 4FPFA 5BNNC 4YW7A 1W9SA 2AZ5A 4BMBA 1DBNA 2WNOA 1W6OB 1OH4A 4P9WA 5LCWL 5C4WB 1AX1A 2YGLA 1CGPA 2TEPA 5JUVA 3VD7A 4XAEA 4Y24A 2OW4A 3WP4A 3H8UA 2A6YA 2VZQA 2JB8A 1UKRA 5F6KA 3RRDA 2WZR2 5HV0A 5T5OA 1KITA 3OEBA 4TLFA 4C91A 4L2NA 3MIFA 4MADA 4UFLA 1RGSA 4BXSV 3IT8A 1J3RA 2WO2A 4N53C 2I07B 5LASA 3BYWA 1RUF3 4GMP3 1BK0A 3CU7A 5FXVA 1GZWB 2GMMA 2YB7A 4UF0A 5C6CA 2VOXA 1G86A 4EN9B 2HWF1 2LUWA 3Q8EA 4I2OA 1WCQA 3KV6A 2Q8EA 2AGSA 3WXPA 3ZOIA 4BOWA 1URXA 3ILFA 2IXCA 2WWSA 3KCYA 4OUMA 5G04L 1NUKA 5FBJA 5CADA 2FCUA 4CCOA 1XE8A 1UQXA 1UY4A 1RC6A 5DDJ3 4MX3A 1REEA 4LO5B 2YXSA 5ANQA 4EN7B 4XUNA 3MGUA 1IG3A 3VBFC 1OOPB 1VMFA 2D44A 5LK7B 1VBB1 5DZEA 1J59A 2YBSA 2AC1A 2RDNA 2E7QA 1F15A 2R1DA 3RGBA 4WM8C 2LS6A 2ZAAA 3JUUA 3UETA 4Q0PA 4WVMA 3K48A 4A41A 4DINB 4QGNA 3H1WA 1G8WA 3Q8BA 5FTTC 4QGLA 1SCSA 1N1YA 4YVSB 3ZIXA 1LCLA 4QWNA 1PX3A 1CX4A 5D8AB 3W5NA 1UU4A 5F9TA 2ET7A 1SDWA 1MEC2 3VKFC 1R1A2 1MEC1 2FDJA 3NQHA 4NMIA 1GR3A 5H9QA 4TWTA 2WS92 2GN3A 5EFUA 1N1VA 4DXSA 3ACHA 2WO1A 1MZEA 3B9CA 5GLVA 4UBGA 4BZ4A 4A4AA 4WZFA 4YM2A 1QH6A 1S0IA 1W0NA 4FPOB 4O7XA 5JOXA 1C3HA 5F1RA 2BOIA 1U5IA 2JJ6A 5C8WA 3JZVA 2C0ZA 1V6KA 3VBHA 3AP9A 4XCBA 3RI8A 2O1QA 3K77A 2ORZA 1X50A 2IXLA 2EAAA 2RV9A 2VMGA 2WFF3 1IPKA 1HQNA 3AZWA 3PUQA 4HVRA 4OCTA 3SCGA 1YI7A 2N7GA 1LESA 4XAAA 4Z92B 5FY8A 4EN0A 3T1LA 2JDYA 1ASJ2 1JYTA 4B1LA 1EPZA 1XPWA 3GZTB 2CDOA 1PGW2 2CGOA 1K5MA 2ARXA 1J1TA 2BBAA 1PZ8A 1S0BA 1R1ZA 1V6JA 2HWB1 2LW8A 4UW5A 4PDWB 1W28A 1L7LA 1O59A 4AI3A 4KQ7A 2JG8B 1QJX1 2JWPA 3PTRB 1AR82 1ZRRA 3LDRA 4FVVA 4LKFA 1AR92 4FOWA 1R081 4LO7A 3GM8A 4N90A 2HWE1 4XZPA 3ZXFA 3FFZA 1HXS3 3LEGA 1POV0 2XXZA 2YC2A 5A6YA 3ZYGA 1WBFA 4XF3A 5E6HA 4QB1A 4OHZA 3LF7A 4X6QB 3POFA 3AP6A 1PHMA 4W6WA 2QQWA 3T09A 4TTGA 3ZR6A 3HNMA 1E57A 2VMIA 2VTXA 5LA9A 4MGSA 4PI0A 3PJYA 1WD4A 1VBE3 4PT6A 3MDPA 5A80A 1ZNPA 3ALQA 3J8F1 3PUAA 3PVNA 1UZVA 1V70A 4FFFA 4OFGA 1AXYA 2V73A 1MS5A 5CFDC 2TNFA 1VRBA 2VCMA 3OEAA 4JV4A 4CUBA 2UWBA 2YBPA 4QHOA 1EAH2 2QQOA 4HOOA 2PELA 5J1XA 1T6BX 1W8UA 1REFA 2K9ZA 4P00B 3SNMA 1PZ9A 4QXCA 4FOQA 4UOJA 4QD2A 2YUEA 1WMXA 4K1YA 4CDUB 3FL7A 1UIKA 1NE6A 2Y60A 4ZS3A 4LO6B 3I3DA 2Q1MA 4AVVA 4L0PA 4XFCA 4E4DX 1VRH2 4JDOA 1VRH1 3I4IA 4KWKA 4YGDA 1UU5A 3J7NA 1REDA 3I3EA 5IHRA 1ZRFA 1JHNA 1LU1A 4AHXA 1BQPA 2E51A 2Q1FA 2WL1A 3O1UA 4DUWA 1NCQB 2O14A 1UYXA 1UO9A 1NXD1 2E9QA 4LUMA 4Q1RA 1XSQA 5FYYA 5I93A 2DV9A 1G9CA 2BV4A 2Q8OA 1JOJA 1YQ6A 3B94A 5EV7A 3SITA 3VBRB 3OPTA 2WWJA 1WMDA 3S57A 3E5XA 5FMOS 3KMHA 4GH4C 3K46A 2QQUA 1WCKA 1TMF2 4AFMA 1NA1A 4BQWA 4FTSA 2C9AA 4IV3A 3SHRA 3VHRA 4COZA 4Q4Y2 1V6OA 2VUJA 4M00A 4Q4Y1 1OLME 3ZFEB 5IVEA 5D1IA 5GJ6A 1YJLA 3ZM8A 4Q8KA 5EIYB 1YC61 5L7OC 2YFUA 3MFAA 5CU1A 2ZGQA 1W6MB 5FYTA 3WSOA 2HKXA 4GKXA 2JX9A 4AGRA 2GAUA 4XIOA 3TNPB 1JZ3A 2P6HA 3ZFFC 2Z69A 3WF1A 2CAUA 1OA2A 2GC0A 2WA4A 4FPKA 5IAVA 4KMQA 3NV1A 1RUOA 1TG7A 2R0FA 4CDWA 3KHBA 3AP7A 4EYUA 4Q5OA 4AEMA 5FQ0B 1IS3A 1DZRA 3HQUA 2ZGKA 3N36A 2HWF3 2ET1A 3N9QA 4Q4X1 4RHV3 2J1VA 3S6PA 1OVSA 4DO0A 2IXHA 1LOFA 2FQPA 3PIGA 4FXKB 4EN6B 1WKYA 1O5LA 3KZ4C 2VOTA 5EJ3A 2VW0A 3NNMA 1V00A 1NY72 1IG0A 2XLGA 1W0OA 5FUNA 4AE2A 1W8NA 3IDAA 3BODA 3VBSC 4BWOA 3ZR5A 4D94A 1BHGA 2WA3A 4DRVA 1KFXL 3DPRC 2JE7A 3SCFA 1UMZA 4PBOA 1LHNA 1LHVA 4CXWA 3KSCA 2D5FA 4O65A 1W90A 2BDRA 2G1MA 3CJIC 2JENA 1NXMA 2QQKA 5A7SA 3AL5A 2PTMA 1ULOA 2G9GA 4IL7A 5DUXA 1PX4A 1W2OA 1HB4A 4D6SA 1G7YA 4LR4A 1PK6C 2R7EB 4XPVA 1O3RA 4D7TA 5BNNB 4WVWA 1VBD2 2VM9A 1SCRA 3L9JT 3RJ2X 5JIUA 1XQNA 4IGQA 2E32A 4KH9A 2LROA 3J26N 5FUPA 1BVP1 5LZ6A 4DEVA 1HDKA 4NJ4A 4JC1A 3M2MA 1CVNA 3GHNA 1YYNA 3CIHA 4CE8A 4OZXA 3BN6A 5JIAA 3ZXDA 1POV1 4ZS2A 2P3KA 1VAVA 4RS5C 1HB2A 1CAXA 1JS9A 4K6BA 5E8AA 1DQ1A 4EV0A 1YFXA 3KCXA 5JXJA 2P5BA 2VMEA 1HJGA 1NCRC 4N53B 5T52A 2B39A 2BVVA 1UOFA 4ZXEA 5F5CA 3FN9A 5J09A 3SH5A 5FZOA 4Q1PA 1S0EA 4CU8A 1GU3A 1QJU2 2LTNA 3H3LA 1QJU1 4AVTA 2F17A 5ACA2 2PHLA 1DGRA 3HVDA 4QPIA 4IEQA 2XWJB 3JQWA 4PI2A 4LBMA 3WNXA 1Y9GA 5EZWA 1UW8A 2HWB3 2VNOA 3AM2A 4JCKA 4GALA 5IVVA 1X7NA 3MF9A 1EUUA 1QJX3 5BYNA 1D2SA 3EJKA 4XFGA 3EB7A 3AYDA 4QX3A 5CKQA 4PCRA 3VBFB 2HWE3 2BFUL 3M7AA 4MHRA 1O4TA 4YG0A 1MS8A 2CWMA 2CGNA 1DZTA 3HT2A 5DMYA 3VB9A 2R041 3LGRA 4C0HA 3U0ZA 3UGGA 4WM8B 1UYPA 1MR5A 4XF0A 1PM7A 4V1PA 1LGNA 5B2GB 1Y4WA 4KWLA 1NZCA 1RUE2 1PIV3 1W6QB 2Q1ZB 2WNUA 1UNBA 3AKQA 1YQ5A 1OD5A 4A3XA 1CZSA 1DGLA 5C3SA 5A1AA 2RM21 2MEV1 3RSJA 1S0GA 3KB5A 4NN0A 2YYOA 1UKGA 3A0NA 3J8F3 3H7JA 3K3OA 5DUUA 5FZ6A 3Q8CA 3WNMA 3LDKA 1BBT2 1HB3A 4XYXA 1HRI2 1OHFA 3ZYHA 1JODA 1U12A 2JDPA 3AMHA 1WLTA 2ZABA 3I2JA 4LK6A 4YFWA 3VGIA 3QACA 3D5OA 4K7JA 4FTBA 2AACA 2VVFA 4HN0A 4OUEA 4L92A 1JOBA 1XNKA 4QU2A 1STMA 2BBVA 4IQPA 5C9AA 1QDCA 2HWC2 3KCCA 5FYIA 1XU2A 4CVUA 3A4UA 1GSLA 1GNHA 2XMLA 4FQZA 4QB6A 4QHZA 5L9RA 4GULA 1WW5A 4YFZA 4GA9A 1H6YA 5DAXA 1AYM1 3BTZA 1RUG1 2FD8A 2R1BA 4CDXC 4FBFA 1UY3A 4HL0A 4AHYA 1TZOA 2O8OA 1RUI2 3AMQA 4IERA 1WLWA 4JGZC 2AUYA 4HZFA 5HCAA 3FE5A 1JYNA 3RYRA 5LRRA 4LOSA 5FZKA 1QJY1 2RDQA 3ZDVA 1HKDA 1RUC2 4CP2A 4IE5A 1RUC1 3LZZA 3I3MA 3UESA 4CDQA 1OLQA 1C8M3 2GNBA 4Q29A 3CDZB 2RS12 3I2FA 2EXIA 3FC0A 4Q4W1 1OMIA 4MZUA 5FMCA 1WA4A 4Y22A 4E4ZA 1ODMA 1FOD3 1RVF2 1W04A 1RMU3 3I2DA 1LEDA 2Y8KA 2R073 3FFQA 3VD5A 2OPKA 4OQ8A 1HIXA 4JHTA 4MXWB 4QX2A 4NROA 3ZX7A 3AJYA 3PJQA 4RGGA 4MGYE 4ISQA 4XHBA 4JKLA 3K4AA 5CFDB 1XOYA 1GQPA 5BNOA 4WM7C 1SFNA 4L97A 4NE9A 2YGMA 4UXAA 3CEWA 2OS2A 1UPIA 3ST7A 2YFZA 3HN3A 2NM1A 5M0TA 3UV9A 3HAGA 4Q4X3 2XVKA 3OD4A 1KFUL 4P9LA 1RHI2 2EXKA 4CXYA 1JBCA 4KL1A 3K4ZA 1VIWB 4MGQA 1UMIA 2DFCA 2PQSA 4KU8A 3GCXA 4D6QA 1A6CA 1QH7A 4FP2A 4ES9A 2WSUA 4YLZA 4W6YA 4K9SA 4QMAA 4QB2A 4XTPA 3BCWA 2PAMA 1W9FA 2D5HA 3POBA 1CIWA 3VDDA 4BM8A 5A6ZA 1OKQA 1CX1A 5BNPC 3U78A 3E1F1 3EYPA 4HXCA 1W8TA 1OC1A 3J9SA 1XNBA 2OUHA 2PYTA 2VG9A 5FKCA 2A75A 1QXRA 4I3PA 5DG2A 3C8XA 2ENRA 2ID4A 1BKZA 1Q8OA 4FQ4A 2Y38A 3SKJE 3GF6A 1CAUB 4HK8A 3GZUC 4ET7A 1WUVA 4GH4B 4AEDA 1VALA 4F7ZA 3I2GA 1H2LA 3SMHA 1PVC1 3KV4A 3WG1A 4P5YA 2HYKA 1YIPA 3PMEA 3M1HA 4C1XA 1XE7A 3IB3A 3M3EA 4QX5A 3TRSB 3X29B 2CTVA 3DN7A 2DCJA 2EIEA 1MS9A 2VW1A 2A3XA 5GZEA 1OFNA 1S1AA 2ZBJA 5CG8A 4U36A 1GNYA 3ZLIA 2XGXA 1IQAA 2CYFA 2JDMA 4XF4A 1LNSA 3WW3A 2DVBA 2W95A 3ASIA 3O1RA 5A3NA 2J42A 2Z5WA 3BKZA 2CNAA 3CQOA 2F4PA 3ZFFB 4XQ4A 5K0UC 3AFKA 4INDA 1FPN2 1SBFA 3OGJA 4O61A 4AYUA 3I2HA 2RE9A 3HT1A 1TME2 4AHZA 4ASKA 3ZMOA 5K8SA 4BMEA 1MQTA 2PHTA 2W1QA 2RS51 4FPHA 3WNLA 2MNGA 2V5YA 4MUVA 5T54A 5CFCA 1Q5OA 4G3YC 4AXOA 2XG3A 2ZACA 2PMWB 4NPMA 2D3RA 2QQPA 2XQXA 4MXVA 3C7FA 5H9RA 4MOAA 2WWUA 2DCZA 3RQ0A 4JRLA 4FPJA 3ILNA 4RGKA 5FPAA 1W06A 1SLAA 4GB31 2G9ZA 4GD4A 5FO7B 5F8PA 2R16A 4HKWA 5E88A 1D7PM 3VBSB 4FFIA 2PAEA 1W6NB 2IFWA 3AVRA 2UY8A 4AI1A 4DRRA 5FP7A 4JHZA 2RG4A 3P3NA 4LKSA 1LULA 1M4WA 4BA6A 2PLV1 2R6QA 4RFT0 5ABJC 3V0AB 2WN3A 4LHKA 2R043 2W08A 4R8HA 1ULCA 2VQAA 2VC9A 2NN8A 3BGAA 1AR73 3NNJA 3CJIB 3IIIA 2RMU3 4PDWC 1GQGA 2PQQA 3WW1A 4RSUA 1ODNA 3BALA 2C4XA 1W8HA 1Z7S1 2ZX2A 2J1SA 3MICA 2XL7A 5FRAA 3FBMA 5L73A 3RZHA 1PK6B 2VW2A 1RUF2 1X36A 2MEV3 2PHDA 2RM23 2VBPA 5A7NA 1RUJ2 2FCTA 5IT6A 1RUJ1 3VHNA 4AFAA 2EICA 1K12A 2XPJA 3CKHA 1ULEA 2D97A 3H3ZA 4KWUA 4NVPA 4E4SA 4AI2A 5LEJA 5ANNA 5AC92 5JZGA 5KHJA 3U14A 3SCHA 4BK5A 1JZ4A 2ZX0A 4FT8A 5DDJ2 2JG9A 1OBNA 1ZREA 1IZ3A 4LA3A 4YVSA 4R4XA 4RS5B 5A3UA 1HQWA 1E5IA 2DCKA 2BPA2 3SEEA 2GC1A 3PUSA 4XF9A 1NCRB 4UFHA 2WDBA 2Y0OA 1C5HA 1GANA 4W4ZA 4CEWC 3U75A 3AXDA 3TWIA 1EV13 1KDMA 4G4FA 3C7EA 4AVSA 4EWAA 2NPIA 1AXZA 2YPDA 1AYM3 1KD7A 1JZ7A 4L9BA 2WLQA 5A1LA 1OPOA 4NR1A 4BQ4A 3NL1A 3ZPYA 1NQJA 2VUAA 1QEXA 4LPLA 1KS5A 3RZZA 5A70A 4RFRB 1OSGA 2ZGUA 2ZMKA 5ISLA 2IC1A 3KHCA 4RQPC 1X8MA 4CPBA 1QJY3 1UMHA 2Y0IA 4ASLA 3J7HA 3QH7A 4IEXA 2Q8DA 3EQEA 1D2QA 3CZUA 2I2SA 1ZBE2 4C8DA 3JQXA 1ZBE1 4Q4W3 5FWEA 4YVWC 5FZ4A 2D43A 2ZGSA 5I0TA 5L9BA 5JDBA 3S0MA 4M01A 3B7MA 4TYSA 4A6OA 5T5PA 1ZZ9A 2EXHA 4MGZE 5J98B 1APNA 3IM0A 4GJYA 3T2OA 4E2QA 3APBA 1LODA 1W9WA 4LLOA 4AQ6A 5CKNA 1B35C 4IETA 2DBNA 2WC2A 5JWPA 3PVOA 2VO5A 3LD8A 3R05A 1YWKA 4OI0A 4YPJA 4CEYB 4D7SA 1PO11 3OGVA 3T08A 2DU1A 4H7LA 4CCEA 3VZMA 3WVJA 2ZMNA 2XBO1 4E2GA 4PF5A 2XHKA 3MW3A 5IK5A 4Q27A 3DF0A 4CP1A 4QPGC 1DG6A 1QOOA 1O3TA 4ATEA 5FCCA 5FZBA 3IZOA 2RS31 5FPXA 2YDEA 3D4KA 2HBUA 3LPFA 2XQRA 4HONA 4IEZA 1W03A 4FOYA 5A32B 3I49A 4B7KA 3WZ1A 3AB0A 4OI2A 4QAWA 5IYYA 3LAGA 4YW3A 1DP0A 1MVQA 3ZSMA 1PVXA 3BI3A 3SQOA 2CY6A 4JQRA 4CDXB 1C5IA 1V9U2 3RG0A 4JGZB 4DB5A 2F4LA 4R4ZA 2UURA 4LBQD 3KVAA 1KGYA 2MPFA 1CAVA 3O12A 4XACA 2RJKA 3WDVA 3UL2A 3C7GA 4FI9A 2VQTA 2W47A 4QXBA 3U1XA 4LBQB 1PVC3 4NIGA 4P14A 3N3HA 4YW4A 4Q0UA 3HNYM 1AUYA 1JUHA 1IPJA 4CCNA 3TN93 5J96B 1NCQA 3NSTA 2X05A 1X82A 1HV1A 1X9PA 1XB9A 4UBHA 5A3LA 1Q43A 3OG2A 2GDFA 1FMD2 2DCYA 3VBRA 1FMD1 3I3QA 4CCLA 3NKGA 2VMFA 5GLTA 1QNYA 1UZWA 4FFGA 3MLLA 1NOVA 3AYCA 2VNVA 5F39A 1LENA 4WM7B 5DUWA 1UOBA 4NO4A 2VH9A 2W2IA 3WINE 4R52A 1XJAA 1F2NA 1QQP2 3IPVB 4O9GA 2R30A 4ZZ5A 1K42A 4L8QA 1GZCA 3V0BA 5FPLA 2V4VA 5IJRA 4EZHA 4CTEA 4NIAA 4C90A 2WZR1 2DVGA 3E5UA 4JGYA 5A7PA 4K40A 2YV8A 4GB33 1PO22 3POJA 3MF6A 3I54A 1LB2A 2I45A 3N7KA 4H55A 5F3CA 2BNMA 2QDRA 4XDPA 3NJXA 3B69A 2D6LX 4GXLA 5BNPB 3R4SA 1IKQA 1QNWA 3EXUA 4P08A 4B8EA 3Q8FA 4RN5A 4DOUA 2VBBA 2VQ0A 5FZ7A 1W0PA 5TSWA 2DUPA 3VBHC 5FV3A 4ARXA 4ZPIA 2W92A 1S0CA 1N1SA 2HJIA 5FZLA 4BHPA 1OF4A 2BYVE 4RYDA 1ZRDA 3E97A 1POQA 1K5JA 1ZM1A 2X09A 3B9IA 3PL0A 1BVVA 3IMNA 4AR2A 1KS4A 2HYXA 5C3OA 3H8OA 4HVQA 2DFBA 3UJQA 3ZN6B 2Y6HA 1QJZA 2A1XA 4RHV2 1FV3A 1WLDA 1YO8A 2XVGA 3M3CA 2OPWA 2JKBA 1K5MC 1UY2A 1VB4A 3D3AA 4KNCA 4IEYA 3ZN4A 2IXJA 1GZTA 5FK8A 2JDKA 1TEIA 2D6OX 3D82A 5JSRA 5FLHA 3QLQA 1JYXA 5EQUA 5K0UB 4M0NA 4XBQA 1R1A1 3ZYJB 3KS7A 5FMDA 3MEPA 2WS91 5BNNA 1O8PA 3WDXA 4IUGA 4LHSA 2ZEWA 4NAMA 5DAPA 1XE0A 5I0DA 5GZDA 1ND2B 3ZN5A 4K8RB 3VBOA 1D0HA 4IGOA 4AFBA 2FZ1A 4R9CA 1CZVA 3RZLA 3VKMA 4M0HA 1T2XA 2LALA 2YZ4A 1ND3C 5F6LB 3ZSEA 3PLQA 1ENRA 2FCVA 1JHJA 2K46A 3N7MA 3ZO0B 2XLAA 4S2FA 4QX8A 1DF0A 5A6QA 5FOJB 1O4YA 1ASJ1 5ABJB 2BTVC 3WQ1A 3IDCB 1YXWA 3UNPA 4OUSA 1PGW1 2DTYA 2R062 5LBEA 5I8YA 5DG1A 3HOBA 2ZS6B 3RMYA 3POGA 4OMCA 1DHKB 3WUDA 4LOTA 4YM0A 3MHZA 4BLIA 1Y43B 1AR81 1C4RA 4QDQA 2ORXA 5JMCA 1AR91 4GKYA 2E7TA 1DU3D 4I09A 4M3CA 1CAWB 2FBEA 5FZ0A 1F9KA 4CUAA 5A3TA 3T2QA 4OHYA 1PO13 2TBVA 4IEVA 5IATA 1ZZCA 2W46A 1EUTA 1AX0A 2WAAA 2WQZC 1AYN2 4UFKA 2VZUA 4XTMA 1SBDA 2DF7A 1UX7A 5F37A 1RUD2 1NLSA 2XKPA 1LGBA 1ACCA 2O8QA 4DY5A 2WABA 2D40A 5IK4A 2BGOA 1A3KA 1W6QA 2Y6KA 3CO2A 1ST8A 3MW2A 3VDCA 4D69A 4BIFA 2VL4A 4I3GA 4XXPA 1R092 5I0SA 2VCBA 2E6VA 2C24A 2HH9A 3DKQA 3CZJA 3UT0A 1F4HA 1FT9A 3TAYA 2NYYA 1HJFA 3PNAA 3VBUA 1G9DA 1SLLA 4CEWB 1EAH1 2FHRA 4XFBA 1Z0HA 4LQRA 2C9KA 1DQ5A 1ZA7A 4PLMA 4UAPA 2PHUA 1AZDA 1PIV2 1QGLA 5IVYA 1VMJA 5L19A 2QQIA 5DABA 4RR3A 3WNNA 1V0AA 3GALA 3FUOA 1YQCA 4N43A 2OA2A 3N9LA 2WT1A 1W9YA 4RQPB 2UY9A 3B93A 4CDWC 2FDGA 3B5LB 4FP3A 5IVBA 4UI9L 2WLPA 2J1EA 3OGRA 1Q3EA 5HV4A 5JVVA 2OT7A 2RR12 1MZ6A 4CXXA 2E7AA 4G9SB 1LOFC 3OJBA 4YVWB 3ELNA 5IUQA 2ZEYA 3WNPA 4Y33A 1RUH2 1W8OA 5FXXA 3RI9A 4DUXA 1W6PB 5LY1A 2VTXJ 2V72A 3V65A 1GOHA 1UAIA 4KGQA 1KJLA 4Q0VA 3LFIA 3HJRA 4HKLA 1B35B 1TMF1 4XETA 1EPWA 3ACIA 5C8CA 5FIXA 3NV4A 5K9YA 3WV6A 3RJRA 2ZPXA 4UW6A 1J3QA 4QGMA 5A7WB 2ES3A 4LO4B 4NIHA 2XJVA 5FZDA 2VZOA 1XYPA 1NX9A 3O1VA 1YJKA 3VL8A 4QPGB 3IIAA 3MI8A 3AMMA 1MZFA 1SG3A 4IV1A 3VDBA 1IS6A 4S2HA 1W2UA 1ENXA 3S5AA 2L9LA 2WZR3 2BWCA 5JSOA 1C8M2 2P4EA 1AR62 5KHHA 5HXMA 3NJVA 5JI9A 1YQ8A 4XFAA 1IOAA 3K3NA 2EVXA 2ZMLA 3NAPA 1WZXA 1WCUA 1FOD2 3TEXA 4CRQA 4XJ9A 3B00A 2PHWA 5IWFA 1ZX5A 2JIJA 1UCXA 1YQ2A 1UXXX 2R072 5CBLA 1JW6A 4J6GA 4XF1A 4OVEA 3MIHA 3ZXJA 1BMV1 1NY71 3HD8B 3VV1A 1QXJA 3OBRA 5I8SA 1OD3A 1H2KA 1C28A 4CP0A 4D3WA 2DYCA 4UF0B 5F3EA 4BQ2A 1VBB3 2Z4FA 2ZGMA 3O0WA 1W99A 5IK8A 2ETEA 3AFGA 3UGFA 1QOSA 5APAA 2VOWA 3WDWA 1VBA2 5GZFA 1CD3G 5BV6A 4HG6B 4QPIC 2WSVA 3QD6A 1LECA 1AJOA 2R0HA 3ACGA 4LE4A 3OPWA 1RJ8A 2PA7A 1UOGA 1LOEA 5FY5A 4AF9A 3FUQA 3U10A 1GBGA 1D4M2 3JBG2 3OF1A 5EHDA 3O1OA 3ES4A 5FPBA 4XE9A 1JZ6A 2V5DA 4GH4A 2LRPA 1MEC3 3IWZA 3BPZA 1R1A3 1VBD1 3AYAA 5EJZB 2QQVA 4GZ9A 3SEPA 2JXAA 2YMZA 2OX0A 5FPZA 5T50A 5J3UA 2ZZQA 5JOYA 1FI2A 3WUCA 2CDPA 2NMOA 4I0BA 2JB4A 1BCXA 1HRV2 1SBEA 2ZGTA 2ZOEB 4QPYA 4AFDA 5GZCA 5L7OA 4FSJA 2WNUC 2XJQA 4AEKA 1ZRIA 3R4DB 1IPSA 2XOMA 3HNBM 4XURA 1YHFA 4LBKA 1M06G 2AENA 2PXJA 3VZKA 4DFSA 1S0JA 4P9YA 2WJSA 4ARYA 1GYKA 2WO3A 3I59A 4LBLA 3AK0A 2OKXA 4BLJA 5FZ8A 3GHMA 4XJWA 4J1WA 3MIGA 3L2HA 3VN4A 4FCAA 1TQ5A 4XUOA 4JTOA 1DLLA 1H9WA 3RWKX 1BXHA 5ACA1 3T2TA 2B7YA 5ERLA 4F83A 1OUSA 3VBHB 4WV8A 5AFBA 1UOJA 1ZBA2 1ZBA1 5C9AC 3L2YA 1PM4A 1WA6X 1YIFA 2ARBA 2PN5A 1R083 4FPYA 2GN7A 1QJEA 2W3JA 3E5QA 3ES1A 3VBSA 4CCJA 2EAKA 4DIQA 1W6NA 3MV01 4QQHA 5JCTA 5F5AA 3DPRA 2Q30A 4CA9A 4NIDA 2C6SA 2ARAA 2DVDA 2ZJCA 3T0BA 5CG9A 3FMGA 1C1FA 1Y7BA 5FDBA 1K5MB 2P2KA 3WQ0A 2A73B 4JKMA 1UX6A 2Z2SB 1RUE1 4QXHA 4KI5M 2RDRA 1JI6A 3O7OA 5A3WA 1YUDA 4K8FA 4X6RB 4F8AA 3OUJA 4FAHA 3HQXA 1H4HA 1BZWA 1T6GC 4YNIA 5DAVA 3N9MA 3CL1A 2HEVF 2BERA 2ZEXA 4CEYC 5F5IA 3KD4A 2YC4A 4JQTA 1BBT1 3SH3A 4YW5A 4YYOA 4FPEA 2SBAA 2CAVA 2VZPA 4S2GA 1HRI1 2XB6C 5F5QA 4HT1T 2VZSA 3JU9A 4UFMA 2GP5A 4EQVA 1AR72 2YHJA 1W05A 1RJ7A 3KT1A 5LRSA 2RMU2 1LTEA 5IFPA 5A3MA 3RYPA 2AEZA 1ND3B 2A6VA 2OQ6A 2H0BA 4NHLA 1SQ4A 1AL22 3B3QE 4XJ8A 3E6CC 3DYOA 4Q4V2 1VRH3 2HWC1 3BU7A 3RMXA 3WF4A 5BNOC 5F7UA 4UYBA 1QHDA 1NCRA 1C1LA 4H2AA 3FLTA 4ZU4A 1SPPA 3NMBA 3DGTA 3USSA 1Q8PA 3AKTA 2CL2A 4Y5SA 4IW3A 2GMPA 4NHMA 2ZEZA 2V09A 4QKBA 3ORJA 1PGL2 1XYOA 4YZ2A 2ATFA 1RUI1 3OBAA 1VBC2 4XFHA 5KR7A 5KHGA 3ZFGA 4MGKE 1BK1A 3BTAA 4NRMA 2NZ9A
chains in the Genus database with same CATH topology
3OD0A 4Y20B 1TMF3 3VDDC 1TNFA 2PFWA 2X8KA 3FLRA 2QE3A 2BW8A 2RS11 1EV12 3ATGA 4Q4Y3 3V56A 1XXNA 1KRIA 3ZSKA 1RVF1 3GBGA 1QY4A 3LOIA 4MVTA 1YI9A 2EA7A 1G9AA 5A33A 4IEUA 1N3QA 1H8VA 4AEDC 2AR6A 2DVAA 5HCBA 3USUA 4RD7A 1NA1B 1H30A 1B09A 2MHFA 3LA3A 4HMZA 3M3QA 3M4FA 3ECQA 1COV2 1AVBA 4COYA 2XJUA 2A3YA 2DVFA 1O3SA 2CV6A 2XKOA 2ZGRA 4C1WA 4ZKTB 3MIEA 3ZYPA 5DXDA 3WR0A 1RHI1 1WCDJ 1V6NA 3WHTA 3M8LA 1WBLA 4AQSA 2HWD2 5J37A 4PIZA 4GQ7A 1QDOA 2OZJA 2A70A 3AXEA 3FLPA 1ENQA 1ZA4A 2VU9A 2VPVA 4B3NA 4CDWB 1U5YA 1EY2A 1S55A 5KWRA 1MQTC 1V6LA 4LA2A 4Y5Z0 2UU8A 3HN1A 2VVDA 4EROA 3WW2A 1O3QA 1ZZBA 3LOBA 1LEMA 1SLBA 2ZCWA 4HPKA 4DZGA 4PBPA 4IXLA 3OYWA 1DQ0A 5E16A 4HSLA 4OHXA 3QCWA 4AQTA 2OVUA 1ULDA 1S2BA 4PIYA 1CJPA 1PNFA 1BEV2 3MIDA 2X5IA 1H8TA 5C33A 2X53S 1POV3 1GFF2 1FPN1 3LA7A 1I3HA 2NQYA 2WNVA 3UK9A 3CJXA 5T55A 3EO6A 1TME1 1J1LA 3WP5A 1JYCA 1DQ6A 1W6OA 1ND2C 2BNNA 3I8TA 4KG8A 1UL9A 5EYXA 5C4WA 3TN92 5JZGC 5BXXA 3PTYA 5DZFA 4DPNA 4EWEA 4Q0SA 2BGCA 4HLTA 1QJU3 3WT3A 5CAZA 1VAMA 2IXIA 4QQLA 4Q26A 1N47A 3JD72 1H4GA 3JD71 3W9AA 4Y1XA 5HXVA 3OPZA 4H7MA 4I0WB 1LHOA 4AFCA 3H9AA 2PHXA 4I30A 1SLIA 1LR5A 5FBZA 1A78A 1GZWA 2VXRA 4AGGA 4QM9A 2GC3A 2PHFA 1DDLA 2Q4SA 2DUOA 4IEOA 2A6WA 4QPIB 3E6DA 2BWAA 4OHWA 2VULA 5EYYA 3W58A 5DUVA 4P9IA 4Y1VA 2QVSB 2BFUS 1GNZA 4LULA 1RUF1 4YZ5A 1YFUA 1OOPA 4NWVA 3KGZA 1JUIA 4Y1ZA 3QH6A 3ZSLA 3GYDA 3AMNA 5SV8A 5AC91 2D3PA 2WNUB 5DDJ1 1HV0A 1RITA 2AYHA 5H9PA 4YW1A 5D8AA 1JN2P 1AX2A 3SLIA 5KC6A 4HBNA 2HWC3 2ZZJA 3ZXLA 4AVCA 3RS6A 1TNRA 3FX3A 5I0UA 1GV9A 1RUG3 2W52A 4ASMB 3LA2A 1H1AA 4Z8BA 3UJOA 3LKJA 1GQHA 1RUI3 5FAXA 5C9AB 1RUC3 4W65A 1DQ4A 4QM8A 4YG6A 3MZHA 2Q5TA 3ME2A 2RS13 3E6BA 3B01A 4KBBA 1X33A 4YM3A 2VMHA 1RVF3 1WLCA 5CNAA 4PDWA 1NE4A 2ILMA 4AVBA 4AVAA 2JG8A 3IKWA 3VHPA 4CDQB 2WFF2 4JVAA 1YFWA 3PMSA 3UKTA 2ZGLA 1QF3A 3C3VA 3IBMA 4Q0QA 4Y22B 5J48A 1QKQA 5FLJA 3THTA 1GKBA 1RUNA 5EXOA 3H3UA 2QKDA 3KT7A 3QOPA 1RHI3 4H14A 5KXCA 3OY8B 5JPNB 1PNGA 4CZSA 1HXS2 2GH8A 1RINA 1HXS1 4EWDA 5BNOB 1F5JA 3MPPG 4B7EA 3AZVA 5GLZA 2K0GA 3LWCA 4N9HA 1OA4A 2RJLA 4Y1UA 1V6MA 1AXKA 4BQ1A 1JH5A 3SH4A 5J7MA 1V9U1 2XLFA 1WCSA 1VBE2 1VBE1 3PVEA 4CDUA 5BUVA 1S0DA 4JGYC 2EALA 2ERFA 3WHUA 4AGVA 5JOWA 1SMVA 3VDDB 1UD1A 4I02A 4TSVA 3Q9OA 3CLPA 2BVBA 3INAA 2F6BA 4LO8A 1UIJA 5GM0A 1W6PA 2XJRA 4CYDA 3S7EA 4COUA 2D6KA 4AEDB 1H2NA 5KXEA 4FPLA 4XFFA 4GIQA 1B35A 5FMOL 2OZ6A 4FAGA 1ZYBA 1FPN3 3VL9A 3RYKA 4DMIA 3ZFEA 1TME3 4LHLA 2RS53 5JAXA 2FMYA 4EJRA 1QQP1 2WNEA 1AHSA 2OIIA 1FAYA 4AW7A 3WP3A 4DXZA 1W6MA 1XU1A 4JAAA 1DGWA 3MIBA 1SLTA 1GZ9A 1RTVA 3AKPA 3B02A 1AJKA 1FXZA 3KM5A 1NG0A 5FOBB 1ZZ7A 1PO21 5FFOC 3HWJA 4YZ3A 5KXBA 1H1IA 2ZX4A 4AEJA 1U5ZA 4FO9A 1MQTB 4PJYA 4EN8B 5FQ0A 4XDQA 5CFCB 1VR3A 3AP4A 3ZXEA 2PLV3 4MH0E 3VBOC 3RWNA 1Q8SA 4LEJA 4LNVA 4ZU7A 2P3IA 1DYKA 4E9KA 4K1ZA 2KM2A 1Z7S3 2A6XA 3JB4C 1KXGA 2VOKA 3LCPA 4K3UA 1MS0A 4WVVA 2ZGOA 4LE3A 1MS3A 1QMJA 2HWF2 1RUJ3 3FBYA 3NV2A 1O5UA 4RHV1 4E2SA 1LHWA 1UN1A 3TNQA 5AC93 3ACLA 2VGDA 3GZAA 4A7KA 2SLIA 4GWMA 1MVEA 3K51A 2ZHKA 4AK3A 3GNEA 4OHVA 3H1YA 2WQ4A 4O9EA 1VLNA 4F3JA 1VBB2 2NMNA 3H1MA 4NHKA 1F5FA 4N9IA 3WG2A 4XMIA 2D7FA 1F31A 5JZGB 1JYIA 4YG3A 2GU9A 1DIWA 2JG9B 2O0OA 1I5ZA 2UYBA 2C1FA 4AHWA 4S2DA 1JXNA 4AI0A 4P9XA 5JPMB 2OYZA 3WDUA 1SLCA 3ZYRA 4N53A 4YW2A 3VBUC 3DL3A 4A2UA 5EWSA 4Z1VA 5KC5A 2EIGA 4KWJA 1ZBE3 2ZKLA 4MV2A 2WT2A 1TE1B 1AL0G 4XFIA 2R061 4AI8A 3VUOA 2ZHMA 5DZGA 3VHOA 4RR3C 4N43C 2XWBB 1FYUA 3NW4A 4XJZA 1UF2C 2P34A 1DFQA 2GNMA 4U2AA 2JDZA 3VBFA 1ULFA 2GSYA 3AKSA 4LBNA 4A7YA 3BOPA 2VECA 1AYN1 2XBO3 4LLFA 4YGEA 4WM8A 1UU6A 3DV8A 1RUD1 1BYHA 4GWNA 1H0BA 1I6XA 3HR9A 2HWB2 2JD4A 4B29A 2RS33 1QJX2 4TZDA 1NA1C 1R091 3AZZA 5KXDA 4IV3C 1R082 5C8CC 2H0VA 2HWE2 3OBTA 3ZXAC 1LU2A 1RL3A 3W59A 4PQ9A 3RDIA 3DKWA 2CGPA 1LRHA 2IWGB 4WVZA 1ONAA 1PZ7A 3WDTA 4META 1G9BA 1ALYA 2WZPP 1PIV1 2IXKA 1D4VB 3D6EA 4IV1C 3SISA 1V9U3 3ZVXA 2GALA 1ZZ8A 3IDEA 1ND3A 3J8F2 2C5DA 4Z2WA 1NYWA 2XJSA 3MW4A 2XJPA 2ZTNA 1KDKA 2D6NA 3ETQA 1VAKA 3VZOA 3NAPC 3OTFA 3LSDA 2RR11 1DQ2A 1RUH1 4R9BA 4ES8A 1XNCA 1VB2A 2B5HA 1YCIA 3O5SA 1FMD3 4Q8LA 1CAVB 3N35A 4LHNA 2QZ3A 5JI7A 2D6MA 3AKRA 3KT4A 3UKNA 1XRUA 2YROA 4HK9A 4XBLA 4Y20A 1CN1A 2AH2A 4I0AA 5AVAA 3ZMNA 2AREA 5GLUA 1YRZA 1N3OA 3TOJA 3PVBB 3ZSJA 3J4UH 3VKNA 2NP0A 1SFYA 1QQP3 2XUMA 4HN1A 3MPBA 4Y4YA 1IS4A 2EF6A 2YY1A 2ZHLA 4MXWA 3D0JA 3BIWE 2UYAA 3O14A 1C8M1 3VZJA 1AR61 1PO23 5CFDA 3TBDA 5GALA 2FZ2A 2KA3A 3M70A 3WP6A 1OQDA 3LSEA 4OULA 1FOD1 4YZ4A 1RMU2 1RMU1 1W39A 2BEOA 3V0BB 2R071 1LOBA 2ZGNA 1I1EA 3A0KA 1RB8G 4JGYB 2B46X 3CNAA 3AX4A 3N7JA 4AQ2A 4B4PA 3BOWA 1F8VA 4IEWA 4P9GA 4URTA 3U4XA 3TYJA 4YRDA 1UZZA 4ISRA 3M3OA 4Q4X2 1VBA1 2ZX1A 4Q2FA 4R9DA 3RNSA 5I0RA 5H9SA 1AF9A 3WQ7A 3T1MA 1NQDA 4FXGB 1LOGA 4ORFA 4NWWA 2R49A 1CAUA 1D4M1 3JBG1 4RGAA 4AG4A 5LK5A 2IZWA 3BB6A 4YGCA 5KBFA 3AYEA 2WS93 1OPMA 4SLIA 3R6SA 4HFSA 3D8CA 1YNAA 4FTEA 2TUNA 2IFRA 1HRV1 1FATA 1H9PA 4PLOA 1FV2A 1GLHA 5L36A 1OQEA 3ROUA 1QOTA 1ULGA 5AFEA 4QQPA 4QQ2A 5JR7B 3ZFFA 1IHMA 1PMIA 1LOCA 3H0OA 4W6XA 3VKLA 2XVLA 2JEMA 1XNDA 2D93A 1D0GA 3ENRA 4XBNA 2P37A 4HVOA 3P3PA 4ONUA 4I01A 1JTZX 1Q8QA 5AVPA 4E27A 1ASJ3 3VBOB 1Z78A 4Z82A 2DCTA 2OUJA 1RIRA 3KGLA 1KJRA 2R063 4FPGA 2BUKA 4WBBA 4YZ1A 1WW4A 4COVA 1AR83 1AR93 1OFSA 2GC2A 1IS5A 3M3IA 5GZGA 4OI1A 1IKPA 4B4RA 4N7UA 4HETA 3V0AA 1WW7A 2H6BA 1V6IA 4XJUA 1AYN3 4DQAA 1FNYA 1RUD3 1X8EA 3CJIA 4J1XA 1YFYA 2UWCA 5JLVA 4LT5A 1WMEA 3ZFGC 3MLJA 5CIRA 4CDQC 1Y9QA 1ZRCA 1PK6A 1R093 2QUOA 3AZYA 4M3CB 3GBWA 4NPRA 5BPXA 3AP5A 4ITCA 2BQPA 3VKOA 3C2UA 2W0XA 2QCSB 2R042 1EAH3 3R0RA 1S2KA 2X29A 1AR71 2ZGPA 1U5XA 3ZIWA 2G9FA 2RMU1 2A3WA 4X8PA 3WX5A 4HKOA 5T3NA 3WG4A 3WOGA 1QU0A 1WD3A 3HIFA 1KQRA 2MEV2 2RM22 3PHMA 4RS5A 1AL21 1MZ5A 4Q4V1 3THPA 3VBUB 1H1MA 3KQRA 4GMP0 1N3PA 1UPSA 1VP6A 2R32A 4P5HA 2I74A 2RR13 5BNQA 1IGOA 4QT6A 1C8NA 1XYNA 4DY3A 1PGL1 1RUH3 2GNTA 4RR3B 1VBC1 1BMV2 1MACA 3R4UA 4N43B 4BH9A 4COWA 1BMV1 1CR7A 1C57A 4MLOA 2CWSA 3LB9A 4JDNA 1ZVFA 2HEWF 1A8MA 1EV11 5GLWA 2EXJA 2PAKA 1AYM2 1RUG2 4UW3A 4LBOA 2QZ2A 4UW4A 2JICA 1DYPA 4SBVA 2G4IA 1LJ7A 3WCSA 1QJY2 4LBJA 4IV3B 3NKTA 5C8CB 1Q8VA 2ZKNA 4OI4A 2RHPA 5FO8B 5IK7A 2A7AA 1AR63 4CEYA 1COV1 4Q4W2 3O0VA 5CVRA 2HEYF 3N4MA 3IN9A 1OA3A 2X5IC 1BJQA 1H8TC 4IV1B 3WCRA 1CONA 2H6CA 2HWD1 3OY8A 1OI6A 4QHBA 4BCUA 5A32A 5K7PA 2WNVC 3JB8A 1Y3TA 2XL9A 3S7IA 3AMPA 5KHKA 3WG3A 3NAPB 5C4WC 5CFCC 4XOGA 1O91A 1VBA3 2GZWA 2VVEA 3S30A 4ATFA 2NLRA 4BPZA 4CDXA 4JGZA 4FOVA 4LUKA 1CQ9A 2B45X 5JSPA 2ZHNA 1D4M3 1WW6A 3JBG3 3FHIB 1HLCA 4LTAA 3N7LA 4PLNA 3NV3A 4LBQA 1VBD3 3NVCA 3WDYA 4Z07A 1OQ1A 1GICA 4M3CF 2A5ZA 5JOZA 1G9FA 4FPCA 3QBQA 1HRV3 3HMYA 3TB0A 4YSFA 1BEV1 2GMEA 4XQWA 2GNDA 4RA0A 1DGRN 1PVC2 4KGGA 4QQOA 1OOPC 2QJVA 3MLKA 1S0FA 4WM7A 3POWA 4N7IA 3TN91 3ZXGA 4A7ZA 4QXKA 5CA6A 4ZXKA 5L7OB 2YC0A 3IPVA 2JG9C 3VZLA 2ZX3A 4L99A 5ACA3 4XW3A 2DWRA 3AJZA 2Q0AA 4YVSC 1EYBA 5D8AC 3WY6A 1CAXB 5T5LA 3RPQA 1ZBA3 4D7YA 4R9AA 3V64A 2W39A 3I59B 3H7YA 5FREA 1LGCA 4M3CE 2RS52 1CPNA 3FJSA 5BNPA 1HQLA 2JECA 4KU7A 2XH6A 4X8NA 3GBFA 4MGIE 1RUE3 3OCPA 3AZXA 1SACA 1PGSA 4GB32 1LOAA 1U0AA 2UWAA 2K2SA 4XQDA 2Z42A 2E63A 4GMP1 1G6NA 4XEZA 2A6ZA 1SEFA 1FX5A 3DPRB 1BBT3 2D98A 3ZN6A 1HRI3 2PLV2 4XXAA 1HW5A 2VNRA 4WZCA 4Y1YA 1EP0A 1H2MA 1FNZA 2JG8C 1Z7S2 2KXLA 3H50A 1J58A 4XIKA 4RL7A 1WGPA 2VY0A 3ZXKA 3WD5A 5K0UA 5J36A 2Z79A 2DUQA 1AL23 2E53A 4Q4V3 5I8TA 3I7DA 1UZYA 4L11A 1ND2A 3URFA 3CF6E 2WFPA 2WKKA 3NO8A 2VOVA 4XJAA 1LHUA 3MYXA 1Q56A 1VBC3 5HBAA 2YPJA 2XJTA 2ZA9A 3U11A 2QFEA 2P3JA 4MSVA 1CPMA 1A8DA 2DU0A 3OGGA 2QDNA 3G7DA 4JRAA 4P9JA 3WLUA 5ABJA 3O0XA 1DZQA 1J3PA 2BNOA 3VLBB 4CDUC 3JCIA 2B42B 3IDBB 4Y26A 1VJ2A 4BYYA 4HSJA 3ZFGB 5KHIA 3FZ3A 2D6PA 2WFF1 2GH2A 4YGBA 4BIOA 1MS1A 2QNKA 1CAWA 1COV3 1NCQC 3KLSA 2FMDA 2Y26A 4PIXA 4XILA 4XMAA 3VBRC 5LEKA 5A33B 3D0SA 4IEPA 2DURA 3VZNA 3USUB 3POYA 4DS0A 2HWD3 3POSA 4JTNA 3WW4A 4DNYA 1OLRA 4MYEA 1PO12 3ZFEC 3NJZA 5SV5A 1DGWX 4CEWA 4IESA 2XBO2 3HBZA 3ZYIB 1O7FA 2PHRA 4K21A 5HI0A 3G6JB 3DUIA 3NWKA 3MFCA 1CJDA 1O4ZA 2RS32 4HANA 4OLLA 4NOTA 1ENSA 2LM3A 4RQPA 1WMFA 1ZZ6A 3SXWA 3UKVA 5I91A 2JE9A 3ILRA 2A71A 2B9UA 3FWEA 2VNGA 1NLRA 4ZU5A 3ZDSA 5FO9B 2P17A 4YM1A 2ZAHA 4H3WA 4YVWA 1YLLA 4K20A 4BE3A 5E1RA 4JDMA 1BEV3 5BY5A 1CESA 1I9RA 3EHKA 4HPKB 5HCFA 2WT0A 3OYWB 4B4QA 1N1TA 4XHXA 4YARA 4KG0A 1L3JA 5FLIA 3U07A 2WINB 1LKNA 4C0BA 1QWRA 1MS4A 1HX6A 4AWDA 2D3SA 2WIIB 5T5JA 5GKAC 4QPGA 2X5IB 1H8TB 2B8MA 2DTWA 5CB7A 3JD73 2W68A 2WNVB 3EBRA 1QXPA 4FPFA 5BNNC 2AZ5A 4BMBA 1DBNA 1W6OB 4P9WA 5C4WB 1AX1A 2YGLA 1CGPA 2TEPA 4Y24A 2OW4A 3WP4A 3H8UA 2A6YA 1UKRA 5F6KA 3RRDA 2WZR2 5T5OA 1KITA 4TLFA 4C91A 4L2NA 3MIFA 1RGSA 3IT8A 1J3RA 4N53C 2I07B 4GMP3 1RUF3 3CU7A 1GZWB 2GMMA 5C6CA 2VOXA 1G86A 4EN9B 2HWF1 2LUWA 4I2OA 2AGSA 3WXPA 4BOWA 1URXA 3ILFA 2IXCA 2WWSA 3KCYA 4OUMA 5CADA 1XE8A 5DDJ3 1RC6A 4MX3A 1REEA 4LO5B 2YXSA 4EN7B 3MGUA 3VBFC 1OOPB 2D44A 5LK7B 1VBB1 5DZEA 1J59A 2E7QA 2R1DA 4WM8C 2ZAAA 3JUUA 4Q0PA 4WVMA 3K48A 4DINB 4QGNA 3H1WA 1G8WA 5FTTC 4QGLA 1SCSA 1N1YA 4YVSB 3ZIXA 1LCLA 5D8AB 1CX4A 1UU4A 5F9TA 2ET7A 1SDWA 1MEC2 3VKFC 1R1A2 1MEC1 1GR3A 5H9QA 4TWTA 2WS92 2GN3A 5EFUA 1N1VA 1MZEA 3B9CA 5GLVA 4UBGA 4BZ4A 4WZFA 4YM2A 1QH6A 1S0IA 4FPOB 5JOXA 1C3HA 5F1RA 1U5IA 2JJ6A 5C8WA 3JZVA 2C0ZA 1V6KA 3VBHA 3AP9A 3RI8A 2O1QA 1X50A 2IXLA 2EAAA 2VMGA 2WFF3 1IPKA 1HQNA 3AZWA 4HVRA 3SCGA 1YI7A 2N7GA 1LESA 4Z92B 4EN0A 3T1LA 1ASJ2 1EPZA 3GZTB 1PGW2 2CGOA 1K5MA 2ARXA 1J1TA 1PZ8A 1S0BA 1R1ZA 1V6JA 2HWB1 4UW5A 4PDWB 4AI3A 4KQ7A 2JG8B 1QJX1 4FVVA 1AR82 1ZRRA 4XZPA 1AR92 4FOWA 1R081 4LO7A 4N90A 3ZXFA 2HWE1 3FFZA 1HXS3 1POV0 3ZYGA 1WBFA 4XF3A 4OHZA 4X6QB 4W6WA 3AP6A 1PHMA 1E57A 2VMIA 3PJYA 1WD4A 1VBE3 3MDPA 1ZNPA 3ALQA 3J8F1 3PVNA 1V70A 4OFGA 5CFDC 1AXYA 2V73A 1MS5A 2TNFA 4JV4A 2UWBA 1EAH2 2PELA 1REFA 2K9ZA 3SNMA 1PZ9A 4FOQA 4QD2A 2YUEA 4CDUB 4K1YA 1UIKA 1NE6A 4LO6B 4AVVA 2Q1MA 4XFCA 4E4DX 1VRH2 4JDOA 1VRH1 3I4IA 4KWKA 4YGDA 1UU5A 1REDA 1ZRFA 1JHNA 1LU1A 4AHXA 1BQPA 2E51A 2WL1A 1NCQB 4LUMA 2E9QA 4Q1RA 1NXD1 5I93A 2DV9A 1G9CA 2Q8OA 1JOJA 3B94A 5EV7A 3SITA 3VBRB 1WMDA 3E5XA 5FMOS 3KMHA 4GH4C 1WCKA 1TMF2 4AFMA 1NA1A 4FTSA 2C9AA 4IV3A 3SHRA 3VHRA 4COZA 4Q4Y2 1V6OA 2VUJA 4M00A 4Q4Y1 3ZFEB 5D1IA 5GJ6A 1YJLA 4Q8KA 5L7OC 3MFAA 5CU1A 2ZGQA 1W6MB 4AGRA 2HKXA 4GKXA 2JX9A 2GAUA 4XIOA 3TNPB 3ZFFC 2Z69A 2CAUA 1OA2A 2GC0A 2WA4A 4FPKA 1RUOA 3NV1A 2R0FA 4CDWA 3AP7A 4AEMA 5FQ0B 1IS3A </