4GH4B

Crystal structure of foot and mouth disease virus a22 serotype
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
DRLLTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGHLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein VP1
publication title Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb
molecule tags Virus
total genus 46
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gh4B00
5FMOS 1VBA2 4CDWA 5CFDB 1QJU3 4CDWB 1AR71 1BEV3 2RR11 4PDWA 1PGL2 1D4M1 4PDWB 1R081 3J8F3 1PO13 1AR61 5CFDC 1RUG3 2MEV2 2ZZQA 1ZBE1 3ZFGC 1Z7S2 2ZAHA 1POV1 2XBO1 4Q4W3 2RMU1 2BBVA 1AUYA 1OPOA 1RMU1 1QQP2 2R043 5BNPC 1VBC3 3VDDC 1EV13 3LOBA 5CFCC 2BPA2 1VRH1 5JZGA 1PGL1 5JZGB 4Y4YA 1VBD3 2RM23 4GMP0 5FMOL 2R062 1ZBA3 3VBOC 1HXS3 1H8TC 5FOJB 5DDJ1 1COV2 2TBVA 2HWF1 1R1A3 1ND3A 4Q4W2 1ND3B 1WCDJ 2HWB3 1AYM3 2PLV3 1FMD3 1ND2A 1ND2B 4WM8A 4GH4A 4WM8B 1OOPA 4GH4B 1OOPB 5AC92 1RUE3 2WLPA 5C8CB 1RUJ2 1RUC3 3DPRC 5J98B 1EV12 1NCQA 1PO23 1NCQB 2RS32 4Q4Y2 1AR83 1AL0G 3ZFFC 3TN92 1E57A 2WZR2 3NAPC 1RB8G 4RHV3 2VQ0A 5C8CC 1C8M2 1PVC3 1BBT1 1AL21 3VBUA 2ZTNA 1K5MB 3VBUB 1COV1 1HRI2 5C4WC 1ZBE3 4CDUB 1EAH2 1NY71 3CJIB 5C9AA 1VBB1 5C9AB 2RS53 1K5MC 4GB33 4AEDA 1AR82 1FOD3 4AEDB 2HWC2 2XBO3 4EJRA 2RMU3 4CEWA 4N53B 4CDUC 1ASJ1 3CJIC 1AR72 2HWD3 3TN91 1QJX2 2RR12 5ABJB 2FZ1A 1D4M2 1R082 1VBA3 4JGZA 1AR62 2X5IC 1FPN1 4N53C 1TME2 1CD3G 1HRV2 5ABJC 1C8NA 4QPIB 3VBSA 3VBSB 2WS92 4NWWA 4CDXC 1MEC1 2GSYA 1BMV1 1Z7S3 1RMU2 2HWC1 1VBE1 4FTSA 3JD71 5CFDA 5ACA1 1TMF2 2RS12 1QQP3 1VRH2 1QJX1 3ZFGA 3ZFGB 1B35C 2WFF2 4N43B 3VBHC 1TME1 1PIV1 5DDJ2 1HRV1 2HWE1 2HWF2 3ZXAC 2R063 1R091 5K0UC 4N43C 5J96B 1RUF1 1COV3 4Q4V2 5BNPA 2WS91 5BNPB 5CFCA 3VDDB 5CFCB 5BNNC 1AR91 1NCRC 1QJY1 5AC93 1RUH2 1RUD1 5BNOC 3VBOA 1V9U1 1H8TA 3VBFC 3VBOB 1RUJ3 1H8TB 3ZFEC 1TMF1 2RS11 4GMP1 2RS33 4Q4Y3 2WFF1 4RFT0 1BBT2 3TN93 1AL22 2WZR3 3M8LA 1X36A 3HAGA 1QJZA 1C8M3 1FPN3 3DPRA 3DPRB 1AYN2 1NY72 1RUI2 3JBG1 3ZFFA 1HRI3 4Q4V1 3ZFFB 1VBB2 3NAPA 4IV1C 3NAPB 5LK7B 1EAH3 5C8CA 1ASJ2 1A6CA 2R071 1RUH1 2HWC3 4CEYC 4JGYC 5C4WA 1RHI2 5D8AB 5C4WB 1AR73 4RR3C 1FPN2 1QJX3 2RR13 4YVSC 3IDEA 1D4M3 1R083 1K5MA 1AR63 1OHFA 2DF7A 5A33A 1TME3 5D8AC 3VBRC 1PIV3 5A33B 1QJU1 1HRV3 2HWE3 1BEV1 4CDUA 2XPJA 1AYN1 1MEC2 3CJIA 1RUI1 1BMV2 2WWSA 1PO11 1POV3 5A32A 2WS93 5A32B 2X5IA 1VBE2 4N53A 2X5IB 1RUG1 3JD72 5ACA2 4SBVA 1RMU3 5ABJA 1PGW2 1RUD3 1SMVA 4Z92B 1RHI1 4YVWC 1TMF3 2RS13 4CDXA 1VRH3 4CDXB 1PIV2 2WFF3 1HQNA 2HWE2 2R041 4QPIA 1R092 4FTBA 4CDQB 1HX6A 1RUF2 1VBC1 5DDJ3 2HWF3 4IV3C 4RQPB 1F8VA 1NA1C 3JBG3 1AR92 1B35A 4Q4V3 1DDLA 3VBHA 1B35B 5L7OB 3VBHB 1ZBA1 4CDQC 1QJY2 4RS5B 1RUD2 1V9U2 1R1A1 1RVF2 1VAKA 4RQPC 2GH8A 2HWB1 1GFF2 1AYM1 2PLV1 1FMD1 1PGW1 1M06G 1RUH3 5K0UA 4LLFA 5K0UB 4N43A 5L7OC 4QPGC 4RS5C 1CJDA 1RUE1 4WM7C 4FSJA 3JB4C 5BNNA 1RUC1 1BBT3 1AL23 5BNNB 1NCRA 1NCRB 5BNOA 3JBG2 4RHV1 5BNOB 3VBFA 3VBFB 3ZFEA 3VDDA 3ZFEB 1MQTC 1PVC1 1AYN3 4Q4X1 1RUI3 1VBB3 2R072 1RVF1 1F2NA 1IHMA 4CDWC 1ASJ3 4PDWC 2RS51 4GB31 1FOD1 4IV1A 1RHI3 4IV1B 1POV0 1QJU2 1BEV2 2HWD1 2IZWA 4CEYA 4CEYB 3J8F2 1VBA1 4NWVA 4JGYA 1PO12 4JGYB 1MEC3 4RR3A 1RUG2 4RR3B 4YVSA 4YVSB 1VBE3 2FZ2A 2MEV1 3VBRA 5D8AA 3JD73 3VBRB 5ACA3 5JZGC 1Z7S1 4FTEA 2R042 1VB2A 3FBMA 1X33A 5GKAC 1VBC2 1ND3C 1QQP1 1ND2C 1R093 4WM8C 3J8F1 4GH4C 1OOPC 1VBD2 2RM22 1RUF3 4YVWA 1ZBA2 4YVWB 1HXS2 1NOVA 1R1A2 4Q4X3 1NCQC 1AR93 2R061 2HWB2 1AYM2 2PLV2 1FMD2 1QJY3 1V9U3 1RVF3 4Y5Z0 2BFUS 4Q4W1 2BUKA 2Y26A 4GMP3 1RUE2 4IV3A 1W39A 3S6PA 4IV3B 1RUC2 1NA1A 3JB8A 1PO22 1NA1B 3VBUC 5AC91 4CDQA 1RUJ1 4RHV2 4CEWB 1EV11 2RS31 4Q4Y1 4BCUA 4RQPA 1PVC2 5C9AC 1VBD1 2RM21 2WZR1 4Q4X2 5L7OA 4AEDC 4QPGA 4QPGB 4RS5A 1HXS1 1C8M1 4JGZB 4WM7A 4CEWC 4WM7B 1NG0A 1ZBE2 2R073 1HRI1 2RS52 4GB32 2MEV3 4JGZC 1FOD2 2XBO2 1EAH1 1MQTA 2RMU2 1MQTB 1PO21 1VB4A 1AR81 4QPIC 2BFUL 2HWD2 3VBSC 2QQPA
chains in the Genus database with same CATH superfamily
3JU9A 3CBNA 3AYAA 4AQSA 2Q8DA 1CVNA 1MZ6A 1QJU3 2R16A 5FBZA 4CDWA 1AR71 5A1FA 1PVXA 1RUNA 2DUPA 1PGL2 4XUOA 3O1OA 1JODA 1DYKA 1PHMA 1R081 4M0NA 3N9QA 4KMQA 4E4DX 3H0OA 2IXJA 2WNVC 4Z2AA 4YLZA 1LOBA 2ZZQA 2J1TA 5JXHA 5FZ3A 5J1XA 3ZFGC 2D93A 3EMRA 1UYXA 5FXWA 3ZKUA 2ZAHA 4CP2A 2GC1A 4H2AA 3DKQA 1STMA 4FPHA 1OPMA 3UETA 2JDYA 2GC2A 3ZKYA 1OKQA 4W6YA 3G6JB 5DUUA 3FHIB 2AZ5A 5FMDA 4COYA 4XE9A 1WZXA 4IEWA 2AC1A 4GD4A 3SKJE 1AUYA 3BUCA 3SNMA 2YGLA 3ITQA 4XHBA 3OBZA 4YRDA 5L73A 3AXDA 3ASIA 2R043 4DQAA 5JIUA 2DCYA 5EP9A 1SDWA 1KFUL 2GNTA 2K0GA 4LBJA 4MXWB 3OY8B 3VDDC 1EV13 1FV2A 2JD4A 4IEYA 4DXTA 1VRH1 2BPA2 4XPVA 5F39A 4D6QA 3N4MA 4NRQA 1EP0A 3D4KA 3PNAA 3VZOA 4CCNA 4Y4YA 5C3OA 1VP6A 4WVWA 2RM23 4GMP0 4QPWA 1W90A 4PIZA 1CAVB 2FBEA 3V64A 1JHNA 1ZBA3 2XQXA 3VBOC 4LITA 4BQ4A 3FL7A 5DDJ1 2TBVA 2IWGB 2BYVE 5JR7B 3AZZA 1ND3B 2HWB3 2CDOA 2GMPA 3KVBA 1XSQA 2PLV3 5IK8A 1ND2B 2VUDA 4WM8A 4XJ8A 4DRRA 4GH4A 4Z2WA 1DU3D 1QDCA 2Y6HA 1MS1A 1WD3A 3U4XA 1PX3A 2P5BA 4I2OA 1SLLA 2NMNA 2WLPA 1QWRA 1RUJ2 2XUEA 1VMFA 5CA6A 2PYTA 3O1SA 1RUC3 1GLHA 1EV12 1URXA 3POYA 2C9KA 4O7XA 4YG3A 5L9VA 1UKRA 3ZFFC 1DGRN 1E57A 2WZR2 1YRZA 2WFPA 4YZ2A 1DHKB 1H30A 4DRVA 3T0BA 1QH6A 4F7ZA 1OFSA 3D8CA 1N3PA 3LA7A 5IT6A 1JOPA 4A6OA 2JKXA 4YARA 4OQ8A 3OB8A 3JCIA 5DG1A 4TZDA 1ST8A 1V6LA 3KHCA 1JUHA 1K5MB 4AAXA 1JZ8A 5FUNA 4XAEA 1COV1 1HRI2 2VW2A 3EXUA 1IPSA 3AFGA 2QQWA 1GP5A 3H9AA 1EAH2 2PQSA 4K8FA 1V00A 3AVSA 1NY71 5FO7B 2UYAA 1J3QA 4LJHA 4AI0A 2DUOA 1K5MC 1C57A 2YPDA 2VBBA 3S5QA 3VV1A 4AEDB 2HWC2 3EJKA 2QQOA 3FLPA 1JBCA 2XR4A 2XVGA 1XPWA 3A4UA 4Q1RA 3KZ4C 4YFZA 5FCCA 4PIXA 3IIIA 4Q0PA 4IE7A 2FD8A 3OPWA 5IJRA 1AR72 5A6ZA 3BB6A 3T30A 1D7PM 3KB5A 5ABJB 1VLNA 2WC2A 1YEWA 5D1IA 3GJBA 1R082 1VBA3 3PJQA 5A3MA 2X5IC 2VTXJ 1SFNA 4OCTA 2VZRA 3RWKX 1GOHA 1YXWA 5A3PA 4HG6B 5FWEA 4I0WB 4KNCA 5ABJC 3SEEA 3IT8A 1UY1A 2D3SA 2VZ1A 4UW3A 1NQJA 3MZHA 4QQHA 2WS92 2OZJA 2BEOA 5DUXA 4CDXC 4R9DA 1MEC1 1JZ2A 3WW3A 2ZGTA 2GSYA 3MI8A 5A7WB 4BZ4A 4AHYA 2A75A 3GCXA 1Z7S3 3WXPA 1HW5A 1D0HA 4DS0A 3GHMA 4CXWA 4J1XA 1AHSA 5FBJA 5E89A 1WW7A 3LCPA 4ISQA 3CDZB 5CFDA 3O1VA 1V6MA 2BV4A 2VM9A 3I2FA 4C8DA 1Y9MA 1AXZA 3VD9A 1VRH2 1PK6C 4XUNA 4HK8A 4ES8A 3KF5A 4Y26A 4N43B 2TNFA 3C7GA 3M4FA 3M3QA 1JOJA 1UY3A 3I4IA 5KHJA 1W6MA 3I3BA 5FZBA 5DDJ2 1ULDA 2VNRA 3MPPG 5JOYA 2XLGA 5L36A 2JG9B 1NE6A 2OZ6A 4L99A 2XDVA 1WW4A 3CZJA 1RIRA 4N43C 1ZRDA 2E7TA 5FO9B 1J59A 1CZVA 1COV3 3K4ZA 2JD9A 1UMZA 1S0FA 4DUVA 1OKOA 5BNPB 1CAUA 2P37A 4XBQA 3ZSJA 4O65A 5FWJA 5CFCB 4LNVA 4QDSA 2JG9C 4K8RB 4R9AA 1TVGA 1AR91 3AYDA 2GH2A 3KV5A 3EO6A 4DXZA 2JJ6A 2LROA 2WINB 2JDMA 1MZFA 2VOKA 3OGRA 4LO4B 4Q26A 2HYXA 5KBFA 1XYPA 2YFZA 5DAVA 3VBFC 1H8TB 4E9KA 2OIIA 5DAQA 2DVDA 2RS11 5FZHA 2Y6KA 2Y8KA 1S4CA 2ZA9A 2HLEA 5I8YA 1JOBA 2V73A 5FDBA 4UOJA 2JG8A 1N3OA 4Y1UA 3HNYM 3KS7A 3Q8CA 1KGYA 4EWDA 5IAXA 1CZSA 4LPLA 4KWUA 5T3NA 2ZXQA 5KWRA 4JZRA 1QJZA 1C8M3 2JE8A 3ILNA 4Q1PA 4XDQA 3AKRA 1AJKA 2VOWA 2VZPA 3MICA 1DYOA 4ZKTB 3DPRA 2QDRA 5DQ0A 1NY72 1HDKA 2W2IA 2PHTA 1V6JA 1D0GA 4ORFA 3MHZA 3NAPB 3TRSB 2BGOA 4QGNA 5LK7B 1HV1A 5C8CA 4LUKA 4GWMA 2NZ9A 1KJLA 5DXDA 3TEWA 1BXHA 2R071 3J7LA 1R64A 1YQCA 4UAPA 3AZYA 4XABA 4JGYC 5C5TA 4YNIA 4BXFA 5C4WA 2C26A 4B4PA 3OPTA 4C0BA 1MS8A 3ZSLA 2PA7A 3I3EA 4RR3C 3H8OA 4AHZA 3BTAA 1YFXA 3ETPA 3FJSA 1W6QA 5C7GA 2ZMKA 2CGOA 1L7LA 4OHZA 1D4M3 4XFBA 5GLZA 1NE4A 1GBGA 4XIKA 1AR63 1OQEA 2FDJA 2OQ7A 4JTNA 3ZMOA 4YG0A 1JTZX 5DPNA 4E2QA 3BU0A 5IK5A 5A33B 5FZIA 5GZGA 1MEC2 4FXGB 3GJAA 1O4YA 1RUI1 2EICA 3ZLIA 2CTVA 3IMNA 3PIJA 2VO5A 3B93A 4FOWA 1POV3 1G9DA 4LIUA 5A32A 4EZHA 4RD7A 1SACA 1OUXA 1OT5A 2BNMA 2J1AA 4IDZA 2JDKA 4FOVA 2W1SA 4N53A 3VKNA 3VGIA 1U5YA 2A71A 4IE0A 4LEJA 1FAYA 2HEWF 2P2KA 1UOFA 1RMU3 2Q8OA 2YV8A 3ETQA 4FOQA 1SMVA 4Z92B 1DLCA 1LECA 3C7OA 2JDHA 4UT5A 3MPBA 4P08A 4EZ4A 2RS13 3DV8A 3ELNA 3F2ZA 3LB9A 1RINA 3D3AA 2Y34A 2D3PA 5LBFA 4HKWA 4DXSA 1EPZA 4AOCA 4DEQA 5IVEA 2W52A 1UU6A 4HKLA 2W47A 2XHNA 2Q30A 4N8MA 2JB8A 1DYPA 4A44A 4YSFA 1VBC1 4K3UA 1S2EA 4AEMA 3PVEA 4LO6B 3SEPA 2UWBA 4P9LA 2HBTA 2QBXA 1QDOA 3CL1A 3MLJA 1PMJX 4RQPB 3WCSA 4YM3A 5AFBA 3SITA 4K1ZA 1C1LA 1AR92 1DDLA 3N7JA 1B35B 4X8NA 1H8VA 1UZWA 4RS5B 1HQWA 2WR9A 4NPRA 4B7EA 1O8PA 1RVF2 4E4SA 5IHRA 1UXZA 4FPJA 1K45A 1VAKA 2GH8A 2W08A 4RQPC 1GFF2 5LA9A 3PMEA 4Y20B 3SISA 5K7PA 5K0UA 1ZZCA 4LLFA 1GZWB 2BTVC 3MF9A 3IM0A 4AYUA 4XF0A 2RHPA 1BK0A 2MNGA 4RS5C 1CJDA 1UMHA 1HN0A 1QNWA 1RUE1 2OPKA 2J1VA 4WVMB 1JH5A 2VVFA 4LBOA 1OFNA 4XF1A 2JICA 1W6OA 5BNNB 2KXLA 2AYHA 1REDA 3U78A 4AFAA 1NCRB 2XXZA 5EQUA 2W0XA 5BNOB 4H14A 4NIIA 3POIA 4UI9L 3ZFEA 1MS3A 4D0QA 1BZWA 2R6QA 2PFWA 3SCFA 1W9WA 1I6XA 1RUI3 1WMDA 3ST7A 4OULA 1VBB3 3KLSA 3RDIA 3RMXA 2O0OA 4YM0A 2R072 1GSLA 3ZOIA 3TEZA 2IXKA 1PM4A 3A22A 4AW7A 5EJZB 1G9FA 5FYSA 1ASJ3 1S2BA 5FPZA 1PGSA 3U11A 1OA4A 3ZYHA 4PDWC 5HCFA 3O5SA 1LOFA 3N3HA 4I01A 1NUKA 3DYMA 3OGVA 4QHZA 3T08A 1FOD1 3SLIA 1QXRA 3QCWA 4IV1B 5T5PA 5FTTC 1REFA 5EV7A 4YW5A 3J7HA 2BVBA 5FK7A 3UYJA 3E5UA 2VECA 5J09A 5M0TA 4I0BA 1UY0A 1YFYA 1X9PA 3BOPA 5EJ1B 5CKMA 2F17A 4IE6A 3EB7A 4HPKB 2F4PA 2ZX1A 1ZRFA 2DCKA 3RFRA 4XJZA 1VJ2A 4H3WA 4IGPA 3SQOA 4JHZA 3MUY1 4YVSB 5LY1A 1UIJA 1OVSA 3MW2A 5CG9A 3AZXA 2WNUA 1AXYA 1JHJA 1GICA 4OI1A 3ZXLA 5JXIA 2W92A 4OQ9A 1BYHA 4Q8KA 1AX2A 2VZSA 1LHOA 1CN1A 2ZMLA 4KU8A 3ZXEA 3MW4A 4XYXA 2RDQA 2WIIB 5A7OA 3M3OA 4AI8A 2P4EA 2RJKA 4FTEA 2JEMA 2R1BA 3ON7A 1WA6X 4D94A 5HXVA 1A34A 2WYSA 1KFXL 2C5DA 2PHDA 4CUBA 3AMHA 4U36A 3OBAA 3WNOA 1VBC2 3H8XA 3K2OA 1QQP1 5C71A 1UYYA 2YBKA 2AENA 2IXHA 2E6VA 1R093 3HD8B 3WNLA 3J8F1 4K21A 1OOPC 3WR0A 2ERFA 4E8CA 3KGLA 4YVWA 1F5JA 3WEZA 1Q8PA 1NLRA 3V0BB 1W6NB 3O0XA 3WUCA 5FYVA 1NCQC 1OC1A 4MLOA 4XXAA 4RGKA 3B9IA 3WNNA 2NPIA 2R061 5KHGA 4A7YA 4LBQA 2G9ZA 3T3YA 1CAWB 1QJY3 5J3UA 1PZ8A 4HSJA 1UKGA 4AVAA 4COWA 1C1FA 1V9U3 3E6BA 2XVKA 3W9AA 2ZHMA 4CU6A 2WZPP 4CUAA 4F8AA 2FDHA 2BUKA 1W99A 5BYNA 4WVVA 1WMEA 1RUE2 4QKDA 1H2NA 5IVFA 4IV3A 3S6PA 3PVBB 4MGYE 2RVAA 3KT1A 2G4IA 1NA1B 3H42B 4HOOA 4LR4A 5JVVA 3VBUC 3I97A 2Y6JA 5BXXA 3T4VA 5A3OA 2AUYA 5A3LA 3ACFA 1V70A 4RFRB 1WBFA 4A3XA 4CEWB 1PMIA 2PHRA 3RI9A 4Q4Y1 5FY1A 1U12A 3D6EA 4BQ2A 1S0CA 3GZTB 3WP5A 3OUIA 5L7OA 2RG4A 2E33A 4QPGA 3OCPA 4NHYA 3USUA 3LQCA 3WHUA 5JXJA 2B9UA 3PLQA 1UOGA 1UQXA 2R0FA 4JGZB 5FYBA 4CEWC 2JDAA 2B8MA 1NLSA 4OHYA 4YGBA 1IPJA 3POJA 3VUOA 1ZBE2 4LKDA 5IFTA 4YW1A 4LBMA 4FPFA 5BY5A 1G9CA 3P1IA 1UO9A 3WSOA 5LB6A 4JGZC 1FOD2 1QOTA 3POGA 3S7IA 1S0GA 1LTEA 4Y1YA 1J3PA 3WNKA 3ZSMA 4C1XA 5FP7A 1MQTB 1ONAA 1PO21 2IVIB 4Y1VA 4XW3A 5EYXA 4TSVA 3ZN5A 3DXUA 1ZZ8A 2CYFA 2Z69A 5FAXA 4KI5M 4K20A 4OVEA 2QQIA 1NKGA 3X29B 5A80A 4YZ5A 1JZ6A 4UFJA 1SZBA 4XBLA 3SCGA 4QQLA 2E63A 4LT5A 2UWCA 2VH9A 5CB7A 4HZFA 4HFSA 3RYKA 1UX7A 3J8F3 5ANQA 2QJVA 2VZVA 4N9IA 1PO13 2QQMA 5GLVA 2EXKA 4QM9A 2VXRA 4CP0A 3PDQA 4XAAA 1O3QA 4JDMA 3VD3A 1FNYA 3WDUA 4OHXA 3H8RA 5DUVA 1UNBA 4CP9A 1S0JA 2P3IA 2FMYA 3A7QA 2DVBA 4NHLA 5DG2A 1W2NA 5IK7A 2JE7A 4CP1A 2DVFA 1LKNA 2FCUA 2WNEA 1OI6A 2P6CA 4KH9A 3OEAA 5A7NA 1K42A 1RXGA 4BISA 5LK5A 4V1PA 4QQOA 1H6YA 3BIWE 4XDPA 2DUQA 4QB1A 4C0HA 4DMIA 1DF0A 1QQP2 2AGSA 2BDRA 2GN3A 3OUJA 2ZMNA 4XCAA 5I91A 4NRPA 3TNQA 2CAUA 1DBNA 2VOVA 4MXWA 4M00A 4AQ2A 2XJPA 3OY8A 3I3QA 3FWEA 3SXWA 1KDMA 1C3HA 4QWNA 5GZDA 3ZR6A 1OSGA 3ENRA 2XL7A 5LEKA 1HB1A 2VC9A 1YJLA 4HN1A 5JZGB 3BIEA 2D5HA 2FDFA 1PGL1 2QZ2A 1NZIA 1XE8A 1XB9A 3GALA 3KD4A 2ADDA 2R062 4RL7A 4FQZA 4OHVA 4MV2A 2OT7A 5FOJB 1AF9A 5HV0A 2C24A 2ZGOA 1IS5A 1ND3A 3GNEA 3J26N 5G04L 1A3KA 1OLQA 5EZWA 3H1WA 1AYM3 3I2IA 1FMD3 1ND2A 1PX4A 3FBYA 3J9SA 1QKQA 1RC6A 3K4AA 1CIWA 1LJ7A 1J1TA 3AXEA 1GQHA 4XJUA 4XQWA 5FJKA 3AKSA 2VJXA 2D44A 3FUQA 3UKTA 3ZPOA 3UT0A 4IW3A 5F5QA 2BRTA 2YC2A 1PO23 4L2NA 4PJYA 4Q4Y2 3NQHA 4Y1ZA 2E9QA 2VCAA 5JXGA 1CPNA 5LRSA 1H1IA 3TN92 3FUOA 1SLAA 1UMIA 1F4HA 1BLZA 2VQ0A 5IW0A 2UYBA 2WA3A 4AQTA 3LOIA 4BQWA 1YC61 4DINB 2RDRA 1PVC3 1BBT1 1AL21 4FVVA 4XFCA 4DPNA 3E5QA 3BGAA 4JKLA 4DUWA 4GZ9A 1DP0A 2ZTNA 1N1YA 1JYCA 2OUJA 4NMIA 4A7ZA 2BJSA 5FYMA 1RITA 3UK9A 4MHRA 4YPJA 3TOJA 1J58A 4UFKA 3HJRA 4HK9A 2HEVF 4QHOA 3BTZA 5C9AB 1ZVFA 3HNMA 2RS53 4P9YA 3IDCB 3QH6A 4GB33 1H6XA 3TB0A 1W0PA 3W21A 4AEDA 4L9BA 4B3NA 2R49A 1JZ5A 4LTAA 5FPXA 2ORZA 4AHXA 1A8DA 2VNGA 1IQAA 2O8OA 1VR3A 1OVPA 5C70A 1W6PB 4BHPA 2HWD3 2RV9A 3HN1A 1QJX2 1WUVA 1X7NA 2VOXA 2FZ1A 3DCQA 4CA9A 2W1UA 1N3QA 5DAWA 3ES4A 3AMQA 5L19A 5I0SA 4LBKA 5FRAA 4AQ6A 1GP6A 2NQYA 1QEXA 5GJ6A 4LKSA 1TME2 4BB3A 4QKBA 3BODA 4D8MA 2P34A 5F3IA 1CD3G 1DLLA 1HRV2 5ANNA 3S5AA 3B5LB 4W6XA 2VW0A 1U0AA 2XKPA 3CKHA 4NVPA 1C8NA 4QDRA 5CZKA 1SEFA 3UKNA 2ZGSA 3C7HA 4K6BA 2W68A 2D6OX 3VBSB 2KD7A 5LA1A 3POBA 2ZGMA 1J83A 3WV6A 5HXMA 5A7WA 2YPJA 2YGMA 2JX9A 3CJXA 3DF0A 3ZM8A 3B9CA 4XUPA 3H3ZA 2HWC1 1VBE1 2WNVB 1Q5OA 4JDNA 5ACA1 1LHUA 4XJAA 1XNBA 1WW6A 4BE3A 1O5LA 2W5FA 2FMDA 1DQ0A 3ZFGB 3FHAA 3PHMA 1W8WA 4FPKA 4Q29A 4CUGA 3VBHC 2Y33A 4KG8A 2ZAAA 4FQ4A 4INDA 5FUIA 3ACLA 5IYYA 1S55A 4P9JA 3LPFA 2QQLA 5KXDA 4Q2FA 2HWE1 4W50A 4CYDA 4PHZA 2VZTA 3J7MA 2DBNA 2WO3A 1GNHA 3O1UA 1GV9A 4MUVA 4B1LA 5J96B 3N9OA 4XUTA 3VHOA 1RUF1 5GZCA 4FO9A 5BNPA 2XJRA 2XJTA 2WS91 3L2YA 3W59A 2WNOA 4WV8A 1LGNA 5CFCA 3LKJA 3VDDB 2WAOA 3NWKA 2BQPA 1LCLA 4D7TA 3ROUA 3UGFA 5I0UA 1MPXA 1YIFA 1GWMA 4TYSA 5FY5A 3NV3A 1CWPA 5HCHA 2J1SA 3M2MA 3MV01 1ALYA 2WAAA 3U75A 1H8TA 1N1SA 3OGJA 3VBOB 1RUJ3 4CZSA 2VBDA 4GMP1 1ULGA 4I30A 5F3EA 1KXGA 3ACHA 2EAAA 4RFT0 1BBT2 5AFEA 1AL22 2WZR3 3MDPA 4UBGA 3NV4A 2QE3A 2PHLA 5F2WA 4EN6B 1DGWA 3HAGA 3BPSA 4PQ9A 1X8EA 3D5OA 3AL6A 2Z79A 2EIEA 4UWDA 3LF7A 3SKVA 4KGGA 3H3LA 1AYN2 5EXOA 5J37A 2C6SA 3GCWA 1HRI3 3WHTA 3ZFFB 4D6RA 1FNZA 1U5XA 3NAPA 1CESA 3WP3A 4BQXA 1Y9GA 1UIKA 3RWNA 1WKYA 3C2UA 1IOAA 4CCKA 1EAH3 2FHRA 1NXD1 4NJ4A 5FR3A 1GUIA 4UYBA 2Z2SB 1DZQA 4JV4A 1H0BA 1OBNA 1V6KA 1A6CA 5B4XA 1O3TA 1JYIA 2GZWA 2A1XA 2E7QA 2HWC3 3KHBA 4O61A 4CEYC 4CTEA 2VNOA 3GHNA 4YYOA 5FXXA 4C91A 4OZOA 5KHKA 3AKQA 5A1LA 4IEZA 3RZHA 1AR73 3HBZA 3THTA 5I0TA 4E27A 3I54A 1CAXB 2JENA 1R083 2VMIA 3DKWA 5B2GB 1S0DA 2Y0OA 4BQYA 1HKDA 1OHFA 3P3PA 4XMAA 4TTGA 5A33A 1WMXA 3VBRC 2Q0AA 1QNYA 5JWPA 2BBAA 2HWE3 1BEV1 3ILFA 4CDUA 4E2SA 3CJIA 3KT4A 3H1YA 2WWSA 3NJYA 1S0BA 1YIPA 3RSJA 1G9BA 4XUQA 1HB2A 3OPZA 4MXVA 2GC3A 2Q5TA 2WS93 5C6CA 3KV9A 1YFUA 4BA6A 3DN7A 3POEA 1Z78A 5CIRA 3ZYFA 1VBE2 4LA3A 2Y0IA 2X5IB 1RUG1 2WL1A 3AB0A 1SDDB 1DQ4A 1H4HA 4L92A 4OHWA 5ACA2 2QNKA 2V5DA 1JXNA 4SBVA 5K4LA 4LUMA 2WZ8A 5JLVA 4LHKA 4GALA 4MH0E 1GNYA 2W39A 5C3RA 1UXXX 3J7NA 5GLTA 1VRH3 1UWWA 2X53S 3VB9A 4CDXB 4I0AA 3FHQA 2KM2A 1LESA 2VVEA 5EPAA 1GOGA 2HWE2 3B94A 3LWCA 1GZTA 1OMIA 1ZA7A 3S30A 1GANA 3BOWA 4QPIA 3ZYJB 4QX3A 5T50A 4ZS2A 4FBFA 5H9QA 5JOWA 2NN8A 1RUF2 5FYZA 2YG0A 1X50A 1WLDA 3PL0A 4GWJA 5DDJ3 4A4AA 2Q4SA 3UKVA 3TNPB 2CSGA 2EAKA 3B3QE 1F8VA 2B4KA 1PK6B 3HQXA 4HLTA 4JCKA 2W1WA 1B35A 5F3CA 5JDBA 2O14A 2O1QA 5IATA 3WX5A 4AVSA 1R1A1 1QJEA 3C3VA 1Q3EA 5FY9A 4EN7B 4AWDA 3LIGA 3K48A 1A8MA 2WQ8A 1IQDC 1WA4A 4R9BA 1GZWA 2VU9A 1M06G 3S7EA 2IFRA 1OURA 5A3UA 4GWNA 3VZNA 2B9VA 4UXAA 4WM7C 4WVMA 3R0RA 4MX3A 1QMJA 2DV9A 2VY0A 1JW6A 2C9AA 2YC4A 3JB4C 3JQWA 2Y6GA 3O12A 3KVAA 5FKCA 4FAGA 4U2AA 5BNNA 1K3IA 1Y4WA 1W05A 4A3ZA 4AGGA 1ODMA 4MSVA 1WGPA 4BK4A 4YZ1A 5FZ8A 1NCRA 2GNMA 5BNOA 3M3EA 4RHV1 4R4XA 4RSUA 2VXJA 2A6YA 3VBFB 1NLQA 3JUUA 4EN9B 3T2QA 4QAWA 1Q56A 4COZA 3JXSA 5FYHA 3POFA 1NT0A 5FLHA 4NIGA 2EXJA 4P9XA 5GM0A 2BGPA 2D40A 1RVF1 3MUZ1 2DWRA 2OQ6A 4CDWC 2Q1MA 2VOTA 4M4PA 5F3GA 5H9PA 4ARXA 1JS9A 4LIVA 1V0AA 1MVQA 5A7PA 5CBLA 5FYCA 3OUHA 2XJVA 2W3JA 1QY4A 3ZXGA 4N7IA 1C5IA 5LCWL 1VMHA 1HLCA 4IV1A 3PIGA 2Q1ZB 4DFSA 4XTPA 3AC0A 1POV0 1AX0A 1YI7A 1UF2C 2PQQA 4AFDA 5BV6A 3N36A 2B5HA 1BEV2 1WCSA 4L97A 4XTMA 3ZXKA 2IZWA 4AI3A 3NL1A 4HPKA 2LRPA 2YHJA 3AYEA 3M1HA 4NWVA 2D98A 1US3A 3RYRA 4JGYB 3AZWA 4M3CB 3IIAA 5FZMA 1O6UA 1WBLA 1MEC3 3AYCA 4BIOA 2JB4A 1RUG2 4RR3B 4YVSA 3MIBA 3PTRB 2VE1A 2PN5A 4IL7A 1O7FA 2LM3A 4JTOA 2QQVA 4XJWA 5D8AA 1C4RA 4FPCA 3NVCA 4ZU4A 4FI9A 5F7UA 3H3UA 3I3MA 2F4LA 3AMMA 5F8PA 5JSPA 1H4GA 1XNDA 2ARCA 5FZAA 3ZYIB 1VB2A 1XNTA 3MEPA 1BCXA 4G4FA 2ZEZA 1MZ5A 1XE0A 4PLMA 1AJOA 1WLWA 5DAPA 1ULOA 4LBQD 4COUA 1QJFA 4HL0A 1ZA4A 3PURA 2ZX2A 4IEOA 4WM8C 2CGNA 4GH4C 4J25A 1VBD2 4ISRA 4CCJA 3LEGA 5G05L 2QFEA 1DQ5A 5FV3A 3V0BA 1HXS2 4K9SA 2G1MA 5FMCA 1NOVA 1UY4A 1R1A2 3P3NA 1AR93 4K40A 5GALA 4QXBA 1CAWA 1O91A 5CU1A 5H9SA 2EXHA 3AK0A 1LR5A 2BZDA 1JYTA 2Z42A 2DVAA 1RVF3 1O4TA 4Q4W1 4GIQA 4BH9A 1W0NA 2Y26A 5A6QA 5C3SA 3MW3A 1KS4A 1W39A 1YJKA 2YBSA 2VQUA 1NA1A 1V6IA 3JB8A 4XJ9A 5C33A 1XNKA 1QHDA 5AC91 5FZOA 3O1PA 1O5UA 3Q9OA 4CDQA 3I2OA 4RHV2 1FX5A 2PAMA 4D7YA 2R7EB 2RS31 4BCUA 5FQ0B 3NNLA 4KL1A 2E32A 3I3DA 1SLBA 2TUNA 3AJYA 2ZX0A 4R9CA 3SHRA 2XG3A 4CU8A 5DABA 1LHVA 2ZEXA 4H7LA 4BJ0A 3NJXA 3SC7X 3WUDA 3HQUA 4JRAA 1EYBA 1NAEA 4AK3A 1WD4A 2R073 2A6XA 1PMHX 5T5JA 4EV0A 5FOBB 4BM8A 2GMEA 2PHXA 3MFCA 2VG9A 1Y43B 2RJLA 4GAZA 2VL4A 2W95A 2XBO2 3T0AA 2GC0A 2ZHLA 1MQTA 2RMU2 4TWTA 3OBTA 2FDIA 4MGTA 4AFMA 2WBKA 1TQ5A 2DTWA 3E6DA 3LEIA 2R1DA 3CIHA 1AR81 2P3KA 2X09A 3O0WA 4NE9A 1HJGA 1YQ6A 2BFUL 2VMHA 4QB6A 4QPIC 1US2A 1RUOA 3Q8AA 3TWIA 2Z5WA 3INAA 2QQPA 1JZ3A 1IZ3A 4ONUA 1D4VB 4FFFA 1XJAA 2YC0A 5CFDB 2C0ZA 1ZX5A 4MGSA 4FPLA 4ATEA 1EPWA 1H9PA 2OS2A 2RR11 4GXLA 2DU1A 3FE5A 4PDWB 3U37A 3PVNA 1CPMA 4LKFA 4A6SA 4LO7A 2TEPA 4YM1A 4CXYA 3HVDA 3VZKA 4OLLA 2WDBA 5CFDC 2A3WA 2Y64A 3IAQA 4RYDA 1F9KA 4MG2A 1ZBE1 2PAEA 4S2GA 1GMMA 3VZLA 3M3CA 5HPOA 5J7MA 2WO7A 3VHPA 2UU8A 3H1MA 1GQPA 5IVJA 1JYNA 4D69A 3RZKA 4W65A 5E1RA 2PHUA 2CDPA 3FN9A 2LALA 3NJVA 4P00B 3A23A 4Q4W3 1B09A 3T09A 3RGBA 4XFAA 4IE4A 5JAXA 2SBAA 3NNMA 4QB2A 2PELA 2BU9A 3C7EA 4L0PA 3U1XA 3FLRA 4R8HA 3RYPA 2Q8CA 4AI9A 3VKFC 1UYZA 4BU2A 3ZYPA 1VBC3 2A7AA 3N35A 3LOBA 3QACA 5FYYA 1R1ZA 5JZGA 1FT9A 5DUWA 1W8FA 4EROA 1OXCA 4XILA 2OVUA 3PUHA 3T4HB 5FMOL 3W5NA 1E5RA 3HT1A 2EF6A 2WN2A 1LU2A 3IDBB 2HWF1 2XJSA 4Q4W2 1SFYA 2DCZA 2HYKA 4X6RB 1GR3A 4BOWA 2JG8C 3OSDA 1W2OA 2Q1FA 4YW6A 4UFIA 1OOPB 2ID4A 2VPVA 3IDAA 4KGQA 1UOJA 4XFFA 5AC92 1RUE3 2W9XA 2AACA 2ZKLA 5A7SA 5C8CB 2EXIA 1OH4A 3WLUA 3WCRA 1CX1A 3DPRC 3U14A 4Y33A 3VHRA 4XFIA 1AZDA 4BPZA 1NCQB 2RS32 1UZYA 1AR83 2VUJA 5BPXA 1AL0G 1EUUA 4QM8A 4Y5SA 4DY5A 4UBHA 1RB8G 4PI2A 1FI2A 3GZUC 2X05A 3RZLA 2ZACA 4RN5A 1W9SA 1UU4A 3CEWA 4LOSA 3WF3A 1J1LA 3LZZA 5C8CC 1RGSA 2OA2A 4W6WA 1DIWA 3H7YA 3IB3A 5JUVA 3LA2A 1ENRA 2BP6A 1LHNA 3ZSEA 4W4ZA 1JYXA 1SG3A 2D43A 2P3JA 3D0SA 4IEXA 4ZU5A 1CX4A 4BIFA 2QDNA 4ZPIA 3VBUB 2R0HA 1RJ7A 1UPSA 1UW8A 1IG0A 2H0VA 3A21A 4JRLA 3VKLA 5C4WC 4J6GA 2VR4A 1ZBE3 3NNGA 2VNVA 1UN1A 3BKZA 5C9AA 3NJZA 1QF3A 2HEYF 2CGPA 2OYZA 1AR82 4GQ7A 1FOD3 3U07A 3DYOA 1XNAA 5IFPA 3MV11 1TNRA 1ZYBA 3PUIA 5FZDA 4EJRA 2ZEYA 3I2JA 5IK4A 2W94A 4N53B 4XETA 4OMCA 1XXNA 1W6PA 2AR6A 2C1FA 4GWIA 4HXCA 3DUIA 3VZJA 4ZY9A 3BI3A 4XF4A 1C5HA 3TN91 1PM7A 2RR12 1ZRRA 2Y60A 4DNYA 1K12A 1OQDA 2G9GA 4OMDA 1XRUA 5FUPA 1OH3A 2FCTA 3OEBA 3Q8FA 2IXIA 4N53C 3FC0A 1GNZA 5CKNA 4XDOA 1JU4A 2OPWA 2ZGKA 3URFA 3VHNA 5FZFA 1LU1A 4QHBA 4WZFA 1FATA 4YGCA 5F5IA 3VBSA 2BVVA 3EYPA 4O9EA 5EIYB 3NO8A 2I2SA 2EVXA 3K46A 4R4ZA 5FPVA 5JPMB 1MVEA 2GMMA 2W91A 3IAPA 3TYJA 1MZEA 2SLIA 3GBFA 3PMSA 3SH4A 3UESA 5HI0A 4B7KA 1LAJA 1ULEA 4AGVA 4NHXA 4OUMA 4QMAA 1SPPB 1Y7BA 1BVP1 4NHMA 2EIBA 3UV9A 1UPIA 2FCVA 1XQNA 3JD71 1YUDA 1TMF2 5F6KA 4AHWA 1QQP3 1QJX1 3ZFGA 2Y6FA 4YG6A 2WFF2 3WDYA 2QCSB 2JDNA 1UAIA 5EHDA 3W20A 4SLIA 2BERA 2OUHA 2BW8A 2J1EA 2XVLA 3B01A 3N7LA 4RGAA 3ACIA 1TME1 3ECQA 1PIV1 4GJZA 3KSCA 1HRV1 3WT3A 2HWF2 3ZXAC 4NIHA 1IGOA 1I3HA 2R063 3HWJA 5CADA 5K0UC 3LEMA 4YGEA 4FPYA 1U5ZA 1UU5A 2QQJA 3APBA 2Y38A 3EHKA 4Q4V2 3MO4A 3OYWB 4QT6A 2ZS6B 1F5FA 1VE0A 1PZ7A 3MIDA 2RJ2A 1GZ9A 1GWLA 3CU7A 1DCSA 3J4UH 3ZVXA 1LEMA 2AREA 2E31A 4I09A 4OUSA 4A41A 4CPBA 2R32A 1W8ZA 1ULFA 2HH9A 1RUH2 4BMEA 2ZX3A 3R05A 3MIEA 3VBOA 1DQ1A 2XMLA 2ZGRA 3ZFEC 4OI4A 4LKEA 4NN0A 5LZ6A 2VTFA 4Q4Y3 4AEKA 5LBBA 3M7AA 3TN93 5C5UA 2Q8EA 1CAVA 4FT8A 3M8LA 3SCHA 5FMBA 1X36A 3ALQA 1S0EA 4YW3A 3K77A 5T5LA 4OI0A 5CEHA 4IXLA 4V2WA 4DUXA 5F9TA 1SLCA 1I5PA 1YO8A 3WQ0A 4CUCA 2ZHKA 5HBAA 2A6VA 1LOFC 2ZOEB 3ZFFA 1VPHA 4JX0A 1BHGA 1E5HA 3ZYGA 2D5FA 3PU8A 5ISLA 5H9RA 2UWAA 4Z1VA 2BOJA 3AP6A 3A0KA 4QX2A 4XMIA 3F95A 4BWOA 1M4WA 2V09A 4XZPA 1RTVA 2B45X 1W9TA 1WLCA 4UFHA 5GLWA 5A3NA 5B4NA 1AVBA 3VD4A 3ZR5A 1KJRA 1RHI2 1CIYA 3TAYA 3ZDVA 3LFMA 1ZREA 3I59B 3NKTA 4A7KA 1W2AX 2JDZA 1QJX3 4GKXA 1NXMA 1Y9QA 4JDOA 1I1EA 3IDEA 5FZEA 2VZ3A 1MS4A 4OUEA 4MGQA 3B69A 1DGWX 1K5MA 2WNUC 2JDUA 2YUEA 1VAVA 2DF7A 2NYYA 3NV1A 3E6CC 1TME3 2ZGLA 1PIV3 1QJU1 1HRV3 1RYYA 3CQOA 4KWJA 1X8MA 1AYN1 3RZMA 3E5XA 2LW8A 2ZHNA 3AKPA 3GF6A 4UFLA 2VCCA 5LBEA 4IEUA 4CCCA 3RQ0A 5IVCA 3WINE 4ZXEA 1WCQA 4Q27A 3KV4A 1W8TA 2L9LA 2X5IA 5FK8A 4BYYA 5A1AA 4TLFA 2D6MA 3JD72 4XEZA 2ET7A 1H2LA 1J84A 3WQ7A 5ABJA 1PGW2 4XQ4A 3ZXJA 4QDQA 4ZHNA 1IKPA 5JR2A 3KT7A 3I2HA 4DIQA 5CKQA 1LOCA 2XWJB 4Y22B 4YVWC 4E4HA 5F5AA 2DYCA 3RS6A 3ZIXA 4CDXA 4NIDA 2MPFA 3LSEA 3OOXA 4LHSA 1PIV2 2RE9A 5KXEA 2UY9A 1FXZA 5LATA 2DU0A 2R041 1LGCA 4KQ7A 1LGBA 2VZOA 4HONA 1OLMA 1GKBA 1WLTA 3N9MA 4IEQA 2DFBA 2VGDA 3AMPA 1MACA 2CWMA 4IV3C 1G8WA 1PK6A 1ENQA 1W06A 4P9WA 1QXPA 4HVOA 5CISA 1KITA 1DZTA 2IC1A 4CCMA 4BXSV 5L7OB 4LBNA 2NP0A 3VBHB 1ZBA1 3WNMA 4EN0A 2GU9A 1RL3A 3UGGA 4GKYA 1YI9A 1G6NA 1W3VA 2GDFA 2HWB1 3CHXA 3TEXA 1T6GC 2OKXA 4AFBA 2PLV1 4ZZ5A 4I3GA 4YZ3A 4NAMA 2OXBA 4N43A 4NRMA 2UY8A 5L7OC 4XFHA 4QXCA 4QPGC 5DZGA 3ZPYA 2OX0A 1TG7A 4NPLA 2WJSA 3I2DA 2JIGA 3AM2A 4P02B 1YQ8A 5APAA 1RUC1 1BBT3 3WZ1A 1AL23 2JG9A 2XLFA 5KXCA 3KM5A 2CWSA 5FLIA 5L9RA 2XQRA 4TN7A 3NNJA 3WG4A 3RJRA 4D3WA 3CNAA 1OF4A 3VBFA 1NZCA 3WDTA 4DO0A 2WZEA 3KV6A 3U10A 2JXAA 4UF0B 4BLJA 3WQ1A 3L9JT 1AYN3 1YWKA 4M4RA 5J48A 2XJQA 4QU1A 4PI0A 2VUAA 4XF3A 2MHFA 5T5OA 1REEA 1T6BX 1C28A 1O3SA 1E5IA 4JAAA 2EALA 2VZUA 4CP9B 5FZ6A 3CMGA 3PVOA 4FCAA 3V0AB 4PT6A 2WLQA 2VMCA 2A73B 4MYEA 2WN3A 1SLTA 1DGRA 3GDBA 4CDQC 2ET1A 4Z8BA 2VZQA 4MHUA 1Y3TA 1XC6A 2XHKA 3ABZA 3IPVB 4NR1A 1KDKA 2YU2A 1UZVA 3NRUA 1ZRIA 3NSTA 4CU7A 1UY2A 2J1UA 4DEVA 3DXTA 3PJYA 4BQ1A 3IMMA 2WKKA 2K2SA 2E51A 3BU7A 1QJU2 3ME2A 4LO5B 4N9HA 4NAOA 1H9WA 1GYKA 2PHFA 4S2HA 3KCYA 3PUSA 4CEYB 2W87A 1OQ1A 3AL5A 1VBA1 3VL9A 4JGYA 5JMOA 4M3CA 2ORXA 1LHWA 5BNQA 1W8OA 2WWJA 3R4SA 1RJ8A 2QKDA 5SV8A 2BOIA 2YMZA 4AR2A 1SBFA 5BUVA 4RR3A 2IXCA 3QOPA 1W28A 3HN3A 1I9RA 4KWKA 2ILMA 4EN8B 4XVHA 2CY6A 1VBE3 2MEV1 3NW4A 2XGXA 2PXJA 3VBRB 3VKMA 5ACA3 1W2UA 3LDBA 5LASA 4XCBA 1Z7S1 5FKBA 4J1WA 4P9IA 3I2KA 5KR7A 3OG2A 1OA2A 5JI9A 4FPEA 2R042 2V5YA 3FBMA 1X33A 5GKAC 3I8TA 1X82A 5JSOA 1ND3C 5CYYA 4BQ5A 1O8SA 3S0MA 4P9GA 4IE5A 1KEXA 1ND2C 2A70A 5E6HA 3N7KA 3OJBA 4W8JA 5JPNB 4NPMA 2FDKA 2RM22 3ES1A 1RUF3 1ULCA 2YU1A 4JVAA 4MVTA 1OA3A 1UZZA 1HB3A 3ZN4A 1ZBA2 1W2TA 2B42B 3ZX7A 2J22A 4RGGA 4LBLA 1W03A 4BMBA 3UJOA 3LDRA 2RDNA 2VVDA 3OD0A 4YZ4A 3LA3A 2HWB2 1LOGA 2B46X 4HBNA 4UW4A 2PLV2 1H2KA 4PF1A 1ZZ7A 1SCRA 5KHHA 1SBEA 4HT1T 4BQ3A 2BFUS 1HIXA 1IS4A 2R30A 3QLQA 5JI7A 1N47A 1U5IA 2QQNA 2AEYA 4GMP3 5JOZA 3CZUA 3MBWA 4O9GA 2WSVA 1F4AA 1SHWB 4ARYA 4YGDA 1RUC2 2IFWA 2WABA 2J7MA 1IS6A 2B39A 4IGOA 1DG6A 4LHLA 4AE2A 2N7GA 4D7SA 4PLOA 1D2SA 2CL2A 4IGQA 4YFWA 1JN2P 2X8KA 2JE9A 3RJ2X 4JKKA 5A7QA 4RQPA 5FQ0A 1OF3A 2HKXA 1Q8SA 3BALA 4P5YA 3PTYA 1VBD1 3PU3A 5JSRA 2P6HA 5F6LB 3OBRA 4AEDC 1O4ZA 4HANA 1F15A 4RS5A 1DZRA 1FV3A 1HXS1 1C8M1 4LQRA 1J3RA 3H8UA 4WM7B 5FP3A 3M70A 1CZTA 1NG0A 1XU2A 3FLTA 4Y20A 4ZU7A 2V4VA 3VDAA 4AEJA 5T55A 4NOTA 3ZN6B 3AP7A 5F2SA 4YW4A 5FIXA 2LTNA 2MEV3 1UL9A 4FFGA 2WUHA 3BPZA 4G3YC 5FYTA 4LO8A 4MO3M 3WNXA 2D6PA 4B1MA 2YYOA 4PBOA 5TSWA 2JECA 4XC9A 4ASLA 3E97A 4EWAA 3RI8A 3RPQA 5A70A 1POQA 3U0ZA 3WW2A 2ZZJA 5FMOS 1QXJA 4AVCA 2IUWA 5FPLA 1VBA2 1KD7A 5JOXA 1QGLA 5AVAA 4CDWB 1BEV3 2CNAA 5FLJA 3KGZA 4PDWA 1D4M1 4Q0VA 4UFMA 1CJPA 3KMHA 2DVGA 3GZEA 2WYFA 4FP3A 2WA4A 1AR61 4I02A 5LRRA 2EIDA 5DN2A 4XXPA 3AMNA 4B4RA 3HEIA 1RUG3 2MEV2 4XBNA 4IEPA 5F32A 4CE8A 2LUWA 3P5BA 4F3JA 2D6NA 2VMEA 2A3XA 4OYUA 5C3QA 1NQDA 1Z7S2 2CAVA 4H7MA 3WF4A 2H6BA 1POV1 3ZIWA 4NUBA 4AI1A 5LBCA 2XBO1 3AP4A 1BVVA 2YY1A 3PUQA 4Q0SA 3WVJA 4OI2A 2RMU1 2YFUA 4URAA 1W8UA 4QXHA 2BBVA 1NX9A 4EE2A 1OPOA 5CAZA 1RMU1 3HQRA 3LFIA 5FP4A 5I8TA 1APNA 4QXKA 5BNPC 4QGMA 5LY2A 5E88A 1UCXA 4AI2A 3IWZA 5CFCC 5FREA 4PIYA 1DQ2A 4FFHA 4HMZA 5FZCA 1ZZ9A 2QZ3A 1KQRA 1VBD3 3WW1A 2WQ4A 2ZPXA 2J1RA 2WO2A 3LAGA 3G7DA 3RRDA 3MF6A 1HXS3 1H8TC 2C4XA 5CNAA 1COV2 2HBUA 4LOTA 1R1A3 3K3NA 4A45A 2VULA 3RZJA 4XHXA 1WCDJ 1WWYA 1QH7A 4F83A 3ZDSA 4ATFA 4WM8B 1OOPA 4GH4B 3KCCA 3RZGA 3RZZA 3KCXA 5ERLA 1L3JA 1DFQA 3HBKA 5J98B 3QH7A 1S0IA 1NCQA 2ZCWA 1IG3A 3LSDA 1QOOA 3GYDA 4NHKA 2E7AA 3NAPC 1JYWA 1CQ9A 3MIGA 4RHV3 4FAHA 3DECA 4KWLA 5IVYA 1W6NA 4COVA 1ZZ6A 1C8M2 3POWA 3FFQA 4FPOB 5HCBA 1YLLA 3I2GA 3JZVA 1Q8QA 3IBMA 3VBUA 1GWKA 5JCTA 3ZO0B 2W1QA 4MGKE 2I07B 1IKQA 5A6YA 2ES3A 2Y6LA 3DYPA 4K1YA 3K75B 4CDUB 2NMOA 3CJIB 4ES9A 3ORJA 5J36A 2GNBA 1AXKA 4IESA 1VBB1 3WQBA 4MZUA 3WDWA 1DGLA 4PLNA 2PAKA 1SQ4A 3WP6A 2XBO3 4AAPA 5FY8A 2D97A 2H6CA 2RMU3 3DGTA 4CEWA 2UURA 1L7QA 4EYUA 2DFCA 3FX3A 1JZ7A 4CDUC 3DEMA 1SFPA 1ASJ1 3E1F1 1W9YA 1ODNA 3CJIC 4KBZA 4XACA 2ARBA 3Q8EA 4BDVB 4QX7A 1IS3A 3WW4A 2JIJA 1HJFA 2WRAA 1EUTA 1D4M2 3OGGA 1ZRCA 2ZEWA 4N7UA 2V4AA 4JGZA 1AR62 2CHHA 1JYVA 2WSUA 1FPN1 1PZ9A 4CRQA 4CU9A 4ASKA 4LMFA 2G19A 1UX6A 4Q8LA 1S1AA 4Z82A 1MS0A 5K8SA 2D6LX 1LB2A 2A3YA 4WBBA 4FFIA 1YFWA 1WMFA 4QPIB 4FOYA 3C7FA 4K7JA 3T2OA 4XURA 2XL9A 3SH3A 2E53A 3K4DA 4G9SB 5C8WA 3MLKA 4NWWA 1QOSA 3RNSA 3WF1A 1BK1A 1Z0HA 2V72A 4XIOA 2VW1A 2FQPA 1BMV1 1X9TA 1SPPA 1HN1A 3UL2A 3N7MA 1LENA 1RMU2 1UZ0A 2XUMA 3VD5A 1ENXA 5FJHA 4FTSA 2ETEA 3VDBA 1MR5A 3KF3A 3N9PA 4MGZE 5FZ7A 5C3PA 4LE4A 5I0RA 2RS12 1XYOA 2KR2A 2ENRA 2XOMA 4HKOA 4L11A 4A42A 1TZOA 2F6BA 1B35C 5GZEA 1D2QA 2BNOA 3ZMNA 2I74A 1W8NA 2AEZA 1S2KA 3FFZA 1TNFA 3W5MA 5EWSA 4QKFA 4CPBD 4E2GA 2YROA 1W6MB 3ZYBA 4QX1A 2JDPA 3LE0A 2GNDA 4GJYA 1R091 4CVUA 3MIHA 1PNFA 4JKMA 4LLOA 5FY4A 5KC6A 4META 3OYWA 5JMCA 3POSA 4KBBA 3WP4A 3BTXA 3A0NA 4S2FA 1CGPA 4LHNA 5EFUA 1CAUB 3SMHA 2NLRA 1QIQA 5FYIA 5BNNC 5FYUA 2RDSA 4GA9A 1BJQA 5HCAA 2XH6A 5T54A 1BKZA 5LA2A 4NROA 1G7YA 2ZBJA 3WF2A 1NCRC 1QJY1 5AC93 2XJUA 3TEYA 1RUD1 5BNOC 2XKOA 1G86A 1V9U1 2A5ZA 2K9ZA 2LS6A 2D7FA 3RG0A 3THCA 4ASMB 4CSWA 1TMF1 2Z4FA 4I3PA 4QU2A 3NMBA 2QQKA 2PHWA 2RS33 4ZXKA 2W46A 4FXKB 1OD5A 1O59A 2VTXA 2WFF1 4AZZA 2VCMA 2JG8B 4URTA 1W3XA 2WQZC 4XOGA 3CO2A 5A3WA 1SBDA 3WNPA 3AP5A 3P6BA 1FPN3 5T52A 4PBPA 5GLUA 1V6OA 4WVZA 4V2VA 1XBFA 3OGSA 2YBPA 5FP9A 3BTYA 1GQGA 3DPRB 3O14A 3GBWA 5K9YA 1KRIA 1RUI2 3JBG1 5F5CA 2VMGA 3OTFA 4Q4V1 3H50A 3ILRA 4MADA 5KXBA 3ZXDA 1VBB2 4IV1C 2VMDA 5CVRA 1Q8VA 5EJ3A 4QX5A 3RMYA 1H1MA 1VMJA 5L9BA 3TBDA 1YNAA 4Y1XA 3VN4A 1GOFA 3EQEA 4FP2A 3T1LA 4M0HA 5FP8A 1V6NA 1ASJ2 2BWAA 1RUH1 1F35A 1HB4A 1XE7A 3C8XA 4Q0QA 4D6SA 1NYWA 4P14A 3I59A 5D8AB 5C4WB 3AX4A 3SH5A 3UNPA 4M3CF 3O1MA 4AGRA 1FPN2 2RR13 4YVSC 1ENSA 1JMUB 1W6QB 1LNSA 3RVHA 1VALA 3L2HA 3R6SA 3WG3A 3N9NA 3WDVA 1XU1A 3AP9A 2JWPA 4DB5A 3WY6A 3GZAA 5D8AC 4QX0A 4JQRA 2XPJA 2YZ4A 2CU5A 4C1WA 3LDKA 4Q5OA 2GN7A 3WG2A 5DAXA 3Q8BA 1HV0A 1BMV2 1PO11 1AX1A 4AG4A 4QGLA 4B4QA 5A32B 5CG8A 3EBRA 1MS5A 4TXWA 2ARXA 3B00A 4HN0A 3MIFA 4X8PA 1TE1B 5KC5A 4QPYA 2BNNA 3JQXA 5D21A 3AFKA 5FZ0A 3KQ4B 3THDA 3ZXFA 4B8EA 1RUD3 4LXLA 1Q43A 4LA2A 3R4DB 5AVPA 4Y22A 2JKBA 1RHI1 1XOYA 1TMF3 1ZM1A 4QQPA 4YW2A 3WOGA 4HVQA 5A3TA 3QD6A 4NIAA 2WFF3 4AXOA 1HQNA 2DDUA 4IUGA 4IERA 1CONA 4Q0UA 1T2XA 4LORA 3V56A 3WG1A 1R092 1OUSA 2H0BA 5FZOB 5SV5A 4E8DA 2BWCA 4FTBA 4CDQB 4FSJA 1HX6A 3D0JA 5FZ9A 3NNFA 2VCBA 2HWF3 1N1VA 5FXVA 5LWBA 1GP4A 1LODA 3VL8A 4JC1A 4AVBA 1NA1C 5LW9A 2IXLA 3HT2A 3JBG3 3B7MA 4PQQA 4Q4V3 1O3RA 3VBHA 3KQRA 2EA7A 3QBQA 1EY2A 1QJY2 3BYWA 2GALA 2WNVA 1RUD2 4PF5A 3T1MA 2K46A 5I93A 1F31A 2ARAA 1V9U2 5EYYA 2E26A 3WD5A 3ZSKA 1SCSA 1AYM1 1FMD1 1PGW1 1RUH3 3O1TA 3WF0A 5K0UB 3I49A 2QTWB 4LK7A 2J42A 2OW4A 1XYNA 2PTMA 3VDCA 2FDGA 1SLIA 5IUQA 3T0DA 3GM8A 4EWEA 2WT0A 2DCTA 4X6QB 3O1RA 5FXZA 5FZ1A 3KWVA 4QKNA 4HVRA 1W6OB 2XONA 3HR9A 3ACGA 3S57A 3IN9A 1GZCA 1CR7A 4FPGA 1QU0A 1JI6A 4CCLA 1FYUA 4CCOA 4CCEA 2A6WA 3GGLA 3JBG2 4LULA 3N9LA 4Y24A 2XLAA 1E5SA 1OLRA 1P8JA 4UF0A 4ET7A 3VDDA 3ZFEB 4KG0A 1MQTC 1PVC1 2P3YA 2XWBB 5FPBA 5IWFA 2ZGQA 3AZVA 3H7JA 4Q4X1 4RA0A 3V65A 3MYXA 4TLGA 5FPUA 2VMFA 2AH2A 2ZGUA 2ZGNA 3GXUA 1W9FA 1YYNA 2O8QA 1L7RA 3HMYA 4XFGA 5FZKA 2P1BA 4AVVA 5IVVA 3AVRA 3OF1A 2VQTA 2YXSA 3K51A 2VBPA 1F2NA 1IHMA 4XQDA 3THPA 3V0AA 4MGIE 1W0OA 3VZMA 4E4ZA 5FY7A 4DXRA 2ZX4A 5F37A 3U4SA 2ZGPA 1LOEA 2DURA 2RS51 4P5HA 4GB31 4R52A 5FZGA 2XB6C 3IPVA 1LEDA 5IVBA 1RHI3 1K5JA 3VLBB 1UYPA 3BN6A 1DQ6A 1TEIA 4Y3OA 5F1RA 1PNGA 2HWD1 2NM1A 5IAVA 3CF6E 4CEYA 2D3RA 1N1TA 1OLME 2A6ZA 2QVSB 3J8F2 2G9FA 1PO12 1GU3A 4H55A 3O0VA 1Q8OA 2DCJA 2YDEA 2ADEA 1H2MA 4KU7A 1XSRA 2CV6A 4S2DA 4NO4A 4QQ2A 3O7OA 3LD8A 4DZGA 1VRBA 4ITCA 4YWAA 3LEKA 1UD1A 5I8SA 1ACCA 2WNUB 1WCUA 2FZ2A 2X29A 3BCWA 3NV2A 3NKGA 3VBRA 3JD73 2D6KA 2HJIA 3LPGA 1H1AA 4UW5A 5JZGC 2WWUA 1JZ4A 3AJZA 3VD7A 4WZCA 1CAXA 2EIGA 2P17A 1A78A 1LULA 4M01A 4AFCA 4AF9A 4Z07A 1ZNPA 3UJQA 1YCIA 3DL3A 4PCRA 1VIWB 4ZS3A 3IZOA 3VKOA 5LA0A 3FZ3A 4IEVA 4ZONA 5D2AA 3HPNA 1VAMA 3HOBA 2ZABA 4YM2A 1YHFA 1RXFA 2QQUA 3M3IA 3MFAA 5FY0A 4UW6A 2WO1A 3LGRA 1G9AA 4QX8A 5E16A 2QUOA 5I0DA 4BK5A 1W04A 4IQPA 4YVWB 5FPAA 3R4UA 3T2PA 3B02A 2KA3A 4Q4X3 3CLPA 4L8QA 1W8HA 3AKTA 1OD3A 1YQ2A 2VD7A 4AL9A 1BQPA 1AYM2 1WCKA 1FMD2 1LOAA 1YQ5A 4LBQB 4QD2A 2GP3A 4XF9A 1XNCA 5DZEA 3WDXA 4Y5Z0 1HQLA 4IETA 4MOAA 4OFGA 4HETA 1JUIA 2YB7A 5FZ4A 4IV3B 2DTYA 3ZYRA 1PO22 2BGCA 1KS5A 4EQVA 5LEJA 3I7DA 3K3OA 4CCDA 3PUAA 4Y4RA 1MS9A 2I45A 1RUJ1 2B7YA 1LRHA 2WT2A 2WT1A 3IKWA 4YW7A 1EV11 2GP5A 2ZKNA 2X10A 2IVJA 4ZZ8A 4LK6A 4LE3A 4CXXA 1UOBA 4DOUA 4A2UA 1PVC2 5C9AC 2PMWB 2RM21 2VUCA 2WZR1 4JQTA 4M3CE 4Q4X2 5GZFA 3GBGA 1ULPA 5A6XA 5KHIA 4OZXA 4QPGB 5JIAA 3USUB 4WM7A 3HNBM 5DZFA 4XZUG 2GAUA 1I5ZA 4Y5TA 2ATFA 5FZLA 3D82A 1IPKA 1WW5A 3OD4A 3BVCA 2VAUA 5FFOC 4N90A 3ZN6A 4GULA 1HRI1 3W58A 3ATGA 3T2TA 2RS52 3MGUA 4DY3A 4GB32 1ZZBA 3FMGA 2DBIA 1JU3A 4B29A 1EAH1 4AVTA 4C90A 5FO8B 2ZJCA 5E8AA 3UGHA 3HIFA 1VB4A 4HSLA 5DMYA 3LIHA 4BLIA 2HWD2 4JHTA 3VBSC 3MLLA 5HV4A 3USSA 2VQAA
chains in the Genus database with same CATH topology
3JU9A 3AYAA 4AQSA 4CDWA 1CVNA 1MZ6A 1QJU3 2R16A 5FBZA 1RUNA 1AR71 1PVXA 2DUPA 1PGL2 1PHMA 1DYKA 1R081 4M0NA 4E4DX 3H0OA 2IXJA 2WNVC 4YLZA 1LOBA 2ZZQA 3ZFGC 2D93A 2ZAHA 4CP2A 2GC1A 4FPHA 1OPMA 2GC2A 1OKQA 4W6YA 3G6JB 5DUUA 3FHIB 2AZ5A 4COYA 4XE9A 4IEWA 1AUYA 3SNMA 2YGLA 4XHBA 4YRDA 5L73A 3AXDA 3ASIA 2R043 4DQAA 5JIUA 2DCYA 1SDWA 1KFUL 2GNTA 2K0GA 4LBJA 4MXWB 3OY8B 3VDDC 1EV13 1FV2A 2JD4A 4IEYA 2BPA2 1VRH1 4XPVA 3N4MA 1EP0A 3D4KA 3PNAA 3VZOA 4Y4YA 1VP6A 4WVWA 2RM23 4GMP0 4PIZA 1CAVB 2FBEA 3V64A 1JHNA 1ZBA3 3VBOC 5DDJ1 2TBVA 2IWGB 2BYVE 5JR7B 3AZZA 1ND3B 2HWB3 2GMPA 2PLV3 5IK8A 1ND2B 4WM8A 4XJ8A 4DRRA 4Z2WA 4GH4A 1DU3D 1QDCA 1MS1A 1WD3A 3U4XA 4I2OA 1SLLA 2NMNA 2WLPA 1QWRA 1RUJ2 5CA6A 2PYTA 1RUC3 1GLHA 1EV12 1URXA 3POYA 4YG3A 1UKRA 3ZFFC 1DGRN 1E57A 2WZR2 1YRZA 2WFPA 4YZ2A 1DHKB 1H30A 4DRVA 1QH6A 4F7ZA 1OFSA 3D8CA 1N3PA 3LA7A 5IT6A 4YARA 5DG1A 3JCIA 4TZDA 1V6LA 1JUHA 1K5MB 1COV1 1HRI2 2VW2A 3EXUA 3AFGA 3H9AA 1EAH2 4K8FA 1V00A 1NY71 5FO7B 2UYAA 1J3QA 4AI0A 2DUOA 1K5MC 1C57A 3VV1A 4AEDB 2HWC2 3EJKA 3FLPA 1JBCA 2XVGA 3A4UA 4Q1RA 3KZ4C 4YFZA 5FCCA 4PIXA 4Q0PA 1AR72 3BB6A 3KB5A 5ABJB 1VLNA 2WC2A 5D1IA 1R082 1VBA3 3PJQA 5A3MA 2X5IC 1SFNA 1YXWA 4I0WB 4KNCA 5ABJC 3IT8A 2D3SA 4UW3A 1NQJA 3MZHA 4QQHA 2WS92 2OZJA 2BEOA 5DUXA 4CDXC 4R9DA 1MEC1 3WW3A 2ZGTA 2GSYA 3MI8A 4BZ4A 4AHYA 2A75A 1Z7S3 3WXPA 1HW5A 1D0HA 4DS0A 3GHMA 4J1XA 1AHSA 5E89A 1WW7A 3LCPA 4ISQA 5CFDA 1V6MA 1AXZA 1VRH2 1PK6C 4HK8A 4ES8A 4Y26A 4N43B 2TNFA 3M4FA 3M3QA 1JOJA 3I4IA 5KHJA 1W6MA 5DDJ2 1ULDA 2VNRA 3MPPG 5JOYA 2XLGA 5L36A 2JG9B 1NE6A 2OZ6A 4L99A 1WW4A 1RIRA 4N43C 1ZRDA 2E7TA 5FO9B 1J59A 1COV3 1UMZA 1S0FA 5BNPB 1CAUA 2P37A 4XBQA 3ZSJA 5CFCB 4LNVA 2JG9C 4R9AA 1AR91 3AYDA 2GH2A 3EO6A 4DXZA 2JJ6A 2WINB 4LO4B 1MZFA 2VOKA 4Q26A 5KBFA 1XYPA 3VBFC 1H8TB 4E9KA 2OIIA 2DVDA 2RS11 2ZA9A 5I8YA 2V73A 5FDBA 2JG8A 1N3OA 4Y1UA 3KS7A 4EWDA 5T3NA 5KWRA 1QJZA 1C8M3 3ILNA 4Q1PA 4XDQA 3AKRA 1AJKA 2VOWA 3MICA 4ZKTB 3DPRA 2QDRA 1NY72 1HDKA 2PHTA 1V6JA 1D0GA 4ORFA 3NAPB 3TRSB 4QGNA 5LK7B 1HV1A 5C8CA 4LUKA 4GWMA 2NZ9A 1KJLA 5DXDA 1BXHA 2R071 3AZYA 4JGYC 4YNIA 5C4WA 4B4PA 4C0BA 1MS8A 3ZSLA 2PA7A 4RR3C 4AHZA 3BTAA 1YFXA 3FJSA 1W6QA 2ZMKA 2CGOA 4OHZA 1D4M3 4XFBA 5GLZA 1NE4A 1GBGA 4XIKA 1AR63 1OQEA 4JTNA 3ZMOA 4YG0A 1JTZX 4E2QA 5IK5A 5A33B 5GZGA 1MEC2 4FXGB 1O4YA 1RUI1 2CTVA 3IMNA 4FOWA 3B93A 1POV3 1G9DA 5A32A 4RD7A 1SACA 2BNMA 3VGIA 4FOVA 4N53A 3VKNA 1U5YA 2A71A 4LEJA 1FAYA 2HEWF 2P2KA 1RMU3 2Q8OA 2YV8A 3ETQA 4FOQA 1SMVA 4Z92B 1LECA 3MPBA 2RS13 3DV8A 3ELNA 3LB9A 1RINA 2D3PA 4HKWA 1EPZA 2W52A 1UU6A 4HKLA 2Q30A 1DYPA 4YSFA 1VBC1 4K3UA 4AEMA 3PVEA 4LO6B 2UWBA 4P9LA 3WCSA 1QDOA 3CL1A 3MLJA 4RQPB 4YM3A 5AFBA 3SITA 4K1ZA 1C1LA 1AR92 1DDLA 3N7JA 1B35B 4X8NA 1H8VA 4RS5B 1HQWA 4NPRA 4B7EA 1RVF2 4E4SA 4FPJA 1VAKA 2W08A 2GH8A 4RQPC 3SISA 1GFF2 3PMEA 4Y20B 5K7PA 5K0UA 1ZZCA 4LLFA 1GZWB 2BTVC 3MF9A 3IM0A 4AYUA 4XF0A 2RHPA 2MNGA 4RS5C 1CJDA 1QNWA 1RUE1 2OPKA 4WVMB 1JH5A 2VVFA 4LBOA 1OFNA 4XF1A 2JICA 1W6OA 5BNNB 2KXLA 2AYHA 1REDA 4AFAA 1NCRB 2W0XA 5BNOB 4H14A 3ZFEA 1MS3A 1BZWA 2R6QA 2PFWA 3SCFA 1I6XA 1RUI3 1WMDA 3ST7A 4OULA 1VBB3 3KLSA 3RDIA 3RMXA 2O0OA 4YM0A 2R072 1GSLA 2IXKA 4AW7A 1G9FA 1ASJ3 1S2BA 5FPZA 1PGSA 3U11A 1OA4A 4PDWC 5HCFA 3O5SA 1LOFA 3N3HA 4I01A 1FOD1 3SLIA 1QXRA 3QCWA 4IV1B 5T5PA 5FTTC 1REFA 5EV7A 4YW5A 2BVBA 3E5UA 2VECA 5J09A 4I0BA 1YFYA 3BOPA 4HPKB 2F4PA 2ZX1A 1ZRFA 2DCKA 4XJZA 1VJ2A 4H3WA 4YVSB 1UIJA 5CG9A 3MW2A 3AZXA 2WNUA 1AXYA 1GICA 4OI1A 3ZXLA 1BYHA 4Q8KA 1AX2A 1LHOA 1CN1A 2ZMLA 4KU8A 3ZXEA 3MW4A 4XYXA 2WIIB 3M3OA 4AI8A 4FTEA 2RJKA 2JEMA 2R1BA 4D94A 5HXVA 1KFXL 2C5DA 2PHDA 3AMHA 4U36A 1VBC2 1QQP1 2AENA 2IXHA 2E6VA 1R093 3HD8B 3J8F1 4K21A 1OOPC 3WR0A 2ERFA 3KGLA 4YVWA 1F5JA 1Q8PA 1NLRA 3V0BB 1W6NB 3O0XA 3WUCA 1NCQC 4XXAA 4MLOA 3B9IA 5KHGA 2NPIA 2R061 4A7YA 4LBQA 1CAWB 1QJY3 5J3UA 1PZ8A 4HSJA 1UKGA 4AVAA 4COWA 1C1FA 1V9U3 3E6BA 2XVKA 3W9AA 2ZHMA 2WZPP 4F8AA 2BUKA 5BYNA 4WVVA 1WMEA 1RUE2 1H2NA 4IV3A 3S6PA 3PVBB 4MGYE 3KT1A 2G4IA 1NA1B 3VBUC 4LR4A 5JVVA 5BXXA 2AUYA 5A3LA 1V70A 4A3XA 1WBFA 4CEWB 1PMIA 2PHRA 3RI9A 4Q4Y1 1U12A 3D6EA 1S0CA 3GZTB 3WP5A 5L7OA 4QPGA 3OCPA 3USUA 3WHUA 2B9UA 3PLQA 2R0FA 4JGZB 4CEWC 2B8MA 1NLSA 4OHYA 4YGBA 1IPJA 3VUOA 1ZBE2 4YW1A 4LBMA 4FPFA 5BY5A 1G9CA 4JGZC 1FOD2 1QOTA 3S7IA 1S0GA 1LTEA 4Y1YA 1J3PA 3ZSMA 4C1XA 1MQTB 1ONAA 1PO21 4Y1VA 4XW3A 5EYXA 4TSVA 3ZN5A 1ZZ8A 2CYFA 2Z69A 5FAXA 4OVEA 4K20A 3X29B 4YZ5A 4XBLA 3SCGA 4QQLA 2E63A 4LT5A 2UWCA 2VH9A 5CB7A 4HZFA 4HFSA 3RYKA 3J8F3 2QJVA 4N9IA 1PO13 5GLVA 2EXKA 4QM9A 2VXRA 4CP0A 1O3QA 4JDMA 3WDUA 1FNYA 4OHXA 5DUVA 1S0JA 2P3IA 2FMYA 4NHLA 2DVBA 5DG2A 5IK7A 2JE7A 4CP1A 2DVFA 1LKNA 2WNEA 1OI6A 4KH9A 4V1PA 4QQOA 3BIWE 2DUQA 4DMIA 1DF0A 1QQP2 2AGSA 2GN3A 2ZMNA 5I91A 3TNQA 2CAUA 1DBNA 2VOVA 4MXWA 4M00A 4AQ2A 2XJPA 3OY8A 3FWEA 3SXWA 1KDMA 1C3HA 5GZDA 5LEKA 1OSGA 3ENRA 2XL7A 4HN1A 1PGL1 1YJLA 5JZGB 2D5HA 2QZ2A 1XE8A 3GALA 3KD4A 2R062 4RL7A 4FQZA 4OHVA 4MV2A 5FOJB 1AF9A 2ZGOA 1IS5A 1ND3A 3GNEA 3J26N 1A3KA 1OLQA 5EZWA 3H1WA 1AYM3 3J9SA 1FMD3 1ND2A 5LK5A 3FBYA 1QKQA 1RC6A 4C0HA 1CIWA 1LJ7A 1J1TA 3AXEA 1GQHA 4XJUA 4XQWA 3AKSA 2D44A 3FUQA 3UKTA 5F5QA 1PO23 4L2NA 4PJYA 4Q4Y2 5LRSA 4Y1ZA 2E9QA 1CPNA 1H1IA 3TN92 3FUOA 1SLAA 2VQ0A 2UYBA 2WA3A 4AQTA 3LOIA 4DINB 1PVC3 1BBT1 1AL21 4FVVA 4XFCA 4DPNA 3E5QA 2ZTNA 1N1YA 1JYCA 2OUJA 4A7ZA 3UK9A 1RITA 3TOJA 1J58A 4HK9A 2HEVF 5C9AB 1ZVFA 2RS53 4P9YA 3IDCB 3QH6A 4GB33 3TB0A 4AEDA 1W0PA 4B3NA 4L9BA 2R49A 5FPXA 4AHXA 1A8DA 2VNGA 1IQAA 2O8OA 1VR3A 1W6PB 4BHPA 2HWD3 3HN1A 1QJX2 1WUVA 1X7NA 2VOXA 2FZ1A 1N3QA 5L19A 3ES4A 3AMQA 5I0SA 4LBKA 5FRAA 4AQ6A 2NQYA 5GJ6A 1TME2 3BODA 2P34A 1CD3G 1DLLA 1HRV2 3B5LB 4W6XA 2VW0A 1U0AA 2XKPA 4NVPA 1C8NA 3UKNA 1SEFA 2ZGSA 4K6BA 2W68A 2D6OX 3VBSB 2ZGMA 3WV6A 2YPJA 2YGMA 2JX9A 3CJXA 3DF0A 3B9CA 3H3ZA 2HWC1 1VBE1 2WNVB 1Q5OA 4JDNA 5ACA1 1LHUA 4XJAA 1XNBA 1WW6A 4BE3A 1O5LA 2FMDA 1DQ0A 3ZFGB 3PHMA 4FPKA 4Q29A 3VBHC 4KG8A 2ZAAA 4FQ4A 4INDA 3ACLA 1S55A 4P9JA 5KXDA 4Q2FA 2HWE1 4CYDA 1GNHA 1GV9A 4MUVA 5J96B 5GZCA 3VHOA 1RUF1 4FO9A 5BNPA 2XJRA 2XJTA 2WS91 3L2YA 3W59A 4WV8A 1LGNA 5CFCA 3LKJA 3VDDB 3NWKA 2BQPA 1LCLA 4D7TA 3ROUA 5I0UA 1YIFA 4TYSA 3NV3A 3M2MA 1ALYA 4CZSA 1H8TA 1N1SA 3OGJA 3VBOB 1RUJ3 4GMP1 1ULGA 4I30A 1KXGA 2EAAA 4RFT0 1BBT2 5AFEA 1AL22 2WZR3 3MDPA 4UBGA 3NV4A 2QE3A 2PHLA 4EN6B 1DGWA 3HAGA 4PQ9A 1X8EA 3D5OA 2Z79A 4KGGA 1AYN2 5EXOA 5J37A 3WHTA 1HRI3 3ZFFB 1FNZA 1U5XA 3NAPA 1CESA 3WP3A 1UIKA 3RWNA 3C2UA 1IOAA 1EAH3 2FHRA 1NXD1 2Z2SB 1DZQA 4JV4A 1H0BA 1O3TA 1V6KA 1A6CA 1JYIA 2GZWA 4CTEA 2E7QA 2HWC3 4CEYC 2VNOA 3GHNA 4YYOA 4C91A 5KHKA 3AKQA 4IEZA 1AR73 3HBZA 3THTA 5I0TA 4E27A 3I54A 1CAXB 2JENA 1R083 2VMIA 3DKWA 5B2GB 1S0DA 2Y0OA 1HKDA 1OHFA 3P3PA 4XMAA 5A33A 3VBRC 2Q0AA 1QNYA 5JWPA 3ILFA 2HWE3 1BEV1 4CDUA 4E2SA 3CJIA 3KT4A 3H1YA 2WWSA 1S0BA 1YIPA 3RSJA 1G9BA 3OPZA 4MXVA 2GC3A 2Q5TA 2WS93 5C6CA 4BA6A 1YFUA 3DN7A 1Z78A 5CIRA 1VBE2 4LA3A 2Y0IA 2X5IB 1RUG1 2WL1A 3AB0A 1DQ4A 1H4HA 4L92A 4OHWA 5ACA2 2QNKA 4SBVA 1JXNA 4LUMA 5JLVA 4LHKA 4GALA 4MH0E 2W39A 5GLTA 1VRH3 2X53S 4CDXB 4I0AA 2KM2A 1LESA 2VVEA 3B94A 2HWE2 3LWCA 1OMIA 3S30A 1GANA 3BOWA 4QPIA 3ZYJB 5T50A 4FBFA 5H9QA 5JOWA 2NN8A 1RUF2 1X50A 1WLDA 5DDJ3 2Q4SA 3UKVA 3TNPB 2EAKA 3B3QE 1F8VA 1PK6B 3HQXA 4HLTA 4JCKA 1B35A 5JDBA 2O1QA 3WX5A 4AVSA 1R1A1 3C3VA 1Q3EA 4EN7B 4AWDA 3K48A 1A8MA 1WA4A 4R9BA 1GZWA 2VU9A 1M06G 3S7EA 2IFRA 4GWNA 3VZNA 4UXAA 4WM7C 4WVMA 3R0RA 4MX3A 1QMJA 2DV9A 2VY0A 1JW6A 2C9AA 3JB4C 3JQWA 3O12A 4LTAA 4FAGA 5BNNA 4U2AA 4AGGA 4MSVA 1WGPA 4YZ1A 1NCRA 2GNMA 5BNOA 3M3EA 4RHV1 4R4XA 4RSUA 2A6YA 3VBFB 3JUUA 4EN9B 1Q56A 4COZA 5FLHA 2EXJA 4P9XA 5GM0A 2D40A 1RVF1 2DWRA 4CDWC 2Q1MA 5H9PA 1MVQA 5CBLA 2XJVA 1QY4A 3ZXGA 4N7IA 1C5IA 1HLCA 4IV1A 2Q1ZB 4DFSA 4XTPA 1POV0 1AX0A 1YI7A 1UF2C 2PQQA 4AFDA 5BV6A 3N36A 2B5HA 1BEV2 1WCSA 4L97A 4XTMA 3ZXKA 2IZWA 4AI3A 3NL1A 4HPKA 2YHJA 3AYEA 3M1HA 4NWVA 2D98A 3RYRA 4JGYB 3AZWA 4M3CB 3IIAA 1WBLA 1MEC3 3AYCA 4BIOA 1RUG2 4RR3B 4YVSA 3MIBA 4IL7A 2PN5A 1O7FA 2LM3A 4JTOA 4XJWA 5D8AA 1C4RA 4FPCA 3NVCA 4ZU4A 3H3UA 3AMMA 5JSPA 1H4GA 1XNDA 3ZYIB 1VB2A 3MEPA 1BCXA 4G4FA 1MZ5A 4PLMA 1AJOA 1WLWA 4LBQD 4COUA 4HL0A 1ZA4A 2ZX2A 4IEOA 4WM8C 2CGNA 4GH4C 1VBD2 4ISRA 2QFEA 1DQ5A 3V0BA 1HXS2 4K9SA 1NOVA 1R1A2 3P3NA 1AR93 4K40A 5GALA 1CAWA 1O91A 5CU1A 5H9SA 2EXHA 3AK0A 1LR5A 2Z42A 2DVAA 1RVF3 1O4TA 4Q4W1 4GIQA 4BH9A 2Y26A 3MW3A 1KS4A 1W39A 1YJKA 1NA1A 1V6IA 3JB8A 4XJ9A 5C33A 1XNKA 1QHDA 5AC91 1O5UA 3Q9OA 4CDQA 4RHV2 1FX5A 2PAMA 4D7YA 2RS31 4BCUA 5FQ0B 4KL1A 1SLBA 2TUNA 3AJYA 2ZX0A 4R9CA 3SHRA 2XG3A 1LHVA 4H7LA 3WUDA 4JRAA 1EYBA 4AK3A 1WD4A 2R073 2A6XA 5T5JA 4EV0A 5FOBB 4BM8A 2GMEA 2PHXA 3MFCA 2VG9A 1Y43B 2RJLA 2XBO2 2GC0A 2ZHLA 1MQTA 2RMU2 4TWTA 3OBTA 4AFMA 1TQ5A 2DTWA 3E6DA 2R1DA 5JOXA 1AR81 2P3KA 3O0WA 4QPIC 2BFUL 2VMHA 1RUOA 3TWIA 2Z5WA 3INAA 2QQPA 1IZ3A 4ONUA 1D4VB 2YC0A 5CFDB 2C0ZA 1ZX5A 4FPLA 4ATEA 1EPWA 1H9PA 2RR11 4GXLA 2DU1A 3FE5A 4PDWB 3PVNA 1CPMA 4LO7A 2TEPA 4YM1A 3VZKA 4OLLA 5CFDC 2A3WA 1F9KA 1ZBE1 2PAEA 4S2GA 3VZLA 3M3CA 5J7MA 3VHPA 2UU8A 3H1MA 4D69A 4W65A 5E1RA 2PHUA 2LALA 4Q4W3 1B09A 4XFAA 5JAXA 2SBAA 2PELA 3FLRA 4R8HA 3RYPA 3VKFC 3ZYPA 1VBC3 2A7AA 3N35A 3LOBA 3QACA 1R1ZA 5JZGA 1FT9A 5DUWA 4EROA 4XILA 2OVUA 5FMOL 3HT1A 2EF6A 3IDBB 1LU2A 2HWF1 2XJSA 4Q4W2 1SFYA 2DCZA 2HYKA 4X6RB 1GR3A 4BOWA 2JG8C 1OOPB 2VPVA 4KGQA 4XFFA 5AC92 1RUE3 2ZKLA 5C8CB 2EXIA 3WLUA 3WCRA 3DPRC 3VHRA 4XFIA 1AZDA 4BPZA 1NCQB 2RS32 1UZYA 1AR83 2VUJA 5BPXA 1AL0G 4QM8A 4DY5A 4UBHA 1RB8G 1FI2A 3GZUC 2ZACA 1UU4A 3CEWA 1J1LA 3LZZA 5C8CC 1RGSA 2OA2A 4W6WA 1DIWA 3H7YA 3LA2A 1ENRA 1LHNA 3ZSEA 2D43A 4IEXA 2P3JA 3D0SA 4ZU5A 1CX4A 4BIFA 2QDNA 3VBUB 2R0HA 1RJ7A 1UPSA 1UW8A 2H0VA 4JRLA 3VKLA 5C4WC 4J6GA 1ZBE3 1UN1A 5C9AA 3NJZA 1QF3A 2HEYF 2CGPA 2OYZA 1AR82 4GQ7A 1FOD3 3U07A 1TNRA 1ZYBA 4EJRA 5IK4A 4N53B 4XETA 1XXNA 1W6PA 2AR6A 2C1FA 3DUIA 3VZJA 4XF4A 1C5HA 3TN91 1PM7A 2RR12 1ZRRA 4DNYA 1OQDA 2G9GA 1XRUA 2IXIA 4N53C 3FC0A 1GNZA 2ZGKA 3URFA 3VHNA 1LU1A 4QHBA 4WZFA 1FATA 4YGCA 3VBSA 2BVVA 4O9EA 3NO8A 2I2SA 2EVXA 5JPMB 4R4ZA 1MVEA 2GMMA 3TYJA 1MZEA 2SLIA 3GBFA 3PMSA 3SH4A 5HI0A 4B7KA 1ULEA 4AGVA 4OUMA 4QMAA 1Y7BA 1BVP1 4NHMA 3UV9A 1UPIA 1XQNA 3JD71 1YUDA 1TMF2 5F6KA 4AHWA 1QQP3 1QJX1 3ZFGA 4YG6A 2WFF2 3WDYA 2QCSB 1UAIA 4SLIA 2OUHA 2BW8A 2XVLA 3B01A 3N7LA 4RGAA 1TME1 3ECQA 1PIV1 3WT3A 3KSCA 1HRV1 2HWF2 3ZXAC 1IGOA </