1CIWA

Peanut lectin complexed with n-acetyllactosamine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEANUT LECTIN)
publication title Structures of the complexes of peanut lectin with methyl-beta-galactose and N-acetyllactosamine and a comparative study of carbohydrate binding in Gal/GalNAc-specific legume lectins.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 54
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ciwA00
2PHWA 3H0OA 4FOYA 1QNYA 4FQZA 1SCSA 1CPNA 2D44A 5T5JA 4Y1UA 3WDYA 2ARXA 1MZ6A 2P3IA 4XYXA 1GNHA 3HMYA 3RMXA 1TEIA 2PHTA 4ISQA 4AGRA 4FQ4A 3SLIA 2GNDA 3VKMA 2W68A 3RS6A 2NP0A 3BIWE 1SFYA 1DQ5A 1BKZA 4CTEA 1LHVA 4M3CA 2ZMLA 3RMYA 1Q8VA 2R0HA 1BYHA 3POYA 1MR5A 3WG2A 3I4IA 2ZGQA 3B69A 5JOWA 3RRDA 2GMPA 2VW1A 3AP9A 4U2AA 1ZA4A 3ASIA 4Y1VA 2ZGOA 3N7MA 1LEDA 2EAKA 2H0BA 2Z42A 4YZ4A 1IS3A 2NMOA 5F9TA 4JRAA 4XJUA 1JBCA 1VLNA 2XB6C 4P9WA 2D6KA 4C1WA 2WSUA 1MZ5A 2ZAAA 4XE9A 2P3KA 4I30A 2CWMA 2YZ4A 4BMEA 1ULFA 2RHPA 1LJ7A 3VUOA 1URXA 2ZGLA 5LK5A 3L2YA 3ILNA 3V0BB 4FPCA 4ATFA 4LBQD 4FVVA 3FUOA 1LHWA 2DWRA 4SLIA 1GV9A 2EXJA 1Z78A 2FMDA 1WBFA 1HQLA 1LECA 2ZGTA 3ZXKA 1LGCA 1W6MB 3UK9A 3ZVXA 1UAIA 2HYKA 1Q8PA 3W59A 1LGNA 3UJOA 1G86A 2V73A 2PELA 3MPPG 3V65A 1W6OB 5HCAA 1W6PA 1MS4A 1GZWA 1W6QB 1CVNA 1GZCA 4NO4A 1LOAA 2WKKA 1Z0HA 2DVFA 2R1DA 2VXRA 2WSVA 3AJYA 2NYYA 1WD4A 2A71A 1ULGA 1C57A 2UU8A 2W39A 3N7JA 1S0EA 2AH2A 1H9WA 4P14A 3VKNA 1N1SA 1I1EA 3OBTA 3OYWA 4AVSA 2YV8A 4XHXA 1GYKA 2WLQA 2ZGUA 4GWNA 4HANA 4XBQA 1QGLA 5T54A 3AP5A 2YMZA 4BLJA 1H30A 4YM2A 2UURA 2A6YA 5DUVA 4BOWA 1DQ2A 4XXAA 1G8WA 3ZXLA 3SISA 1WLCA 3OGGA 3VKOA 2YXSA 4CRQA 4XBNA 2ZGMA 1WBLA 1VAMA 5GLTA 3ZSJA 1PZ7A 2ERFA 4YZ5A 1AX1A 2E51A 1BJQA 1V00A 1DQ4A 2E7QA 2TEPA 5DZFA 2DVAA 4Y1XA 3TB0A 4Y1ZA 2GN7A 4Y20B 5CNAA 5EYYA 4JCKA 3MEPA 4DRVA 1MVQA 4LBOA 1JN2P 3WG4A 2SBAA 3FBYA 3AYEA 5DG2A 3WUDA 3ZXEA 3V0AA 4YG6A 3BTAA 4DRRA 4R9AA 1WW7A 4FPFA 1WD3A 1QDOA 3AZWA 1MVEA 2D43A 4XMAA 1A8DA 3TAYA 1JYCA 3AP7A 1SLBA 1AX0A 5T55A 4M01A 2PHUA 3WG3A 3BOPA 4NOTA 3WCSA 4P9XA 2DU1A 2DTWA 2ES3A 4YZ2A 1G9BA 1FATA 1LGBA 2C5DA 1R1ZA 3M3EA 4LBKA 1IS5A 3AJZA 4BLIA 4XIKA 3IKWA 2GMMA 4ASMB 2GNTA 1IKPA 1VALA 2NZ9A 2AYHA 3GALA 1HQWA 3NV1A 1OFSA 5IK7A 5FRAA 4ISRA 3ILFA 3WNXA 3T1LA 4YZ3A 3AYCA 4YFZA 1LODA 1SBEA 1HDKA 2ENRA 3NV3A 1APNA 4YW4A 1AZDA 1S0GA 2ZA9A 3RG0A 4R9DA 1RITA 1KDMA 3ATGA 1H9PA 1XQNA 2D6OX 1LHOA 2UWCA 5GLZA 5T52A 2D3RA 3AX4A 1GBGA 5H9SA 4XTMA 1YXWA 4KBBA 2ZGPA 4XMIA 3HN1A 1LHUA 5JDBA 2EXHA 3APBA 5DUWA 4RL7A 3C2UA 1DQ1A 5SV8A 3OJBA 3SNMA 1GLHA 2JE7A 2JE9A 5GZCA 2WT0A 1DZQA 1LOCA 4Y24A 3ILRA 5IK8A 4WV8A 1AX2A 4LBLA 2NN8A 1BXHA 1ENSA 3WDUA 2EF6A 3SITA 2DUOA 2LTNA 5H9PA 5GZGA 2GN3A 1WLDA 2DV9A 1J1TA 3D5OA 3OY8B 2BQPA 1A3KA 2ZGKA 2D6LX 1QNWA 1G9FA 2UWAA 3U4XA 1IS6A 1GANA 1RIRA 3O0VA 4GKYA 4AVVA 4DFSA 1MS1A 3B01A 1FYUA 4LBMA 5GALA 5BYNA 1Y7BA 2VU9A 1YRZA 1SLAA 3V0BA 4GXLA 2CTVA 4U36A 2WQZC 5AVAA 5JMCA 2D7FA 4UW4A 1CONA 2C9AA 2LALA 3POWA 3LSEA 1S1AA 1BQPA 4AGVA 3WHUA 1G9AA 1YO8A 5KXEA 2D6NA 4YGCA 4K21A 2SLIA 1GSLA 5DZGA 1MACA 2OUJA 4YW2A 4Z8BA 2DYCA 1W6MA 5GLVA 2A70A 5F5QA 2VH9A 3IPVB 2D6PA 1MS8A 1W6OA 5KXCA 3AZYA 4M3CE 3IMNA 1JYIA 1W6QA 1N1YA 1V6JA 4DS0A 4YGDA 1SLCA 2G4IA 5H9QA 5IK5A 3A0NA 2PHRA 3IN9A 2P3JA 2CL2A 3FLRA 1ENRA 5CA6A 1I3HA 2AREA 2GDFA 2B7YA 1DQ0A 1SLTA 2AUYA 2E6VA 5GM0A 1OQ1A 3UL2A 3INAA 2PHFA 2FHRA 2AENA 1LOFA 2JKBA 1PZ9A 1Q56A 3B3QE 4FOVA 4R9CA 1HKDA 1RINA 4Q2FA 4LBQB 1LULA 2JD4A 4XJ8A 4F83A 2E53A 2NM1A 4PCRA 3VKFC 4DQAA 1LESA 1JXNA 4L8QA 4GWMA 1SBFA 1DBNA 3M1HA 1N3PA 4D69A 4Y1YA 1JUIA 2OUHA 4ITCA 5GLWA 3WDWA 4P9YA 2OVUA 1LOFC 2DTYA 1F5FA 1V6KA 2ZHLA 3R4UA 1LTEA 4Y20A 1ONAA 3O5SA 5GJ6A 1MS0A 1V6IA 2WNEA 1LOGA 1D2SA 1YIFA 4YG0A 2E7TA 1LOBA 5GZDA 1MS9A 1WW5A 2EXKA 3VV1A 3WLUA 3NV2A 4TZDA 3GNEA 1UX6A 5HCFA 1CESA 5IUQA 1LHNA 3AZVA 5GLUA 2JDZA 3AXDA 3N3HA 2V5YA 1UL9A 4FP3A 1O4YA 3BODA 3AP6A 3O0XA 3W58A 3DGTA 5T5LA 5JOZA 4UW3A 1LU2A 3D6EA 1ZM1A 3WDVA 4YZ1A 1AJOA 1KQRA 3RQ0A 3FFZA 3WG1A 3NWKA 1X50A 4FPOB 1AXYA 1JW6A 2W08A 4Y22B 1UZYA 3O0WA 4UW5A 2DVGA 3JU9A 2ZBJA 2ZGSA 5JOXA 4YW5A 1V6OA 1S0IA 4FOWA 1VIWB 1PZ8A 5T50A 4PBPA 2VW2A 2I2SA 1AXKA 1KJLA 1CPMA 2Q5TA 2OW4A 4LBJA 5DZEA 5E88A 4YW1A 5CAZA 4C1XA 1C4RA 1Q8QA 1ULEA 3CNAA 2DU0A 3N36A 3PMEA 1LCLA 3IM0A 4PF5A 3WOGA 2W52A 1FNYA 1SACA 1ULCA 2GNBA 4XIOA 1GICA 1QOOA 1S0BA 2AGSA 2ZKNA 3AK0A 3I8TA 1GZ9A 3OPZA 2DVBA 3FLTA 3O12A 2P2KA 2A3XA 3ZXFA 1BZWA 1IKQA 4FOQA 1DLLA 4AYUA 3PVOA 1W6NB 1C1LA 2P34A 2GMEA 1QMJA 2NMNA 1LENA 4XBLA 2JJ6A 2A6XA 1DIWA 3PVEA 3LSDA 1MS5A 4OZXA 3OY8A 1LU1A 3A0KA 4YM1A 4WVVA 2DUQA 5L73A 3WHTA 4WVWA 4GKXA 4Q1PA 1KITA 3ZYRA 1JHNA 3R4SA 3AZXA 3ZSLA 3QCWA 4YLZA 1N1VA 4XILA 2A6VA 1FNZA 4FP2A 3Q9OA 3N35A 4Q26A 1FV2A 4AVTA 4XJ9A 1AF9A 5DG1A 5T5OA 4YW3A 2JECA 1CJPA 2D3PA 3OBRA 4XTPA 4BMBA 2AR6A 3WZ1A 4Q1RA 3USUA 3AYAA 3M3CA 5EWSA 1DHKB 1GNZA 4GA9A 3IPVA 3T1MA 2ZHNA 2R49A 1F31A 3ZSKA 4Y26A 1SCRA 1W0OA 5GZFA 3D4KA 3FUQA 4RA0A 1FV3A 5IT6A 1IOAA 2R16A 1O4ZA 3PVNA 2ARBA 1CIWA 1QU0A 4AWDA 4FPGA 4XXPA 2EIGA 2VW0A 1YYNA 3N7LA 4FPEA 4M3CB 1SLLA 1N3QA 2ZGRA 4WZFA 1QDCA 4XZPA 2D3SA 4Q8LA 2ZGNA 2EXIA 1SBDA 3N7KA 2CY6A 2ZABA 4LBQA 1UZZA 1S0DA 1IS4A 1NLSA 4FPLA 2VY0A 3WDXA 5IK4A 4FPYA 4K20A 1WUVA 3T2TA 3AZZA 3WV6A 4Q8KA 4H55A 1N3OA 1UMZA 3B00A 5H9RA 5JVVA 2XG3A 4R9BA 2A75A 2D6MA 4BM8A 4UW6A 1FAYA 2WT2A 3AFKA 4M3CF 1U0AA 2ZMNA 1DYKA 1WLWA 2VUAA 3KQRA 4YFWA 1CQ9A 4GALA 2ZHKA 4MYEA 1D0HA 5CB7A 1N1TA 3VKLA 3UJQA 1KDKA 2A3YA 2YY1A 5DUXA 3V64A 1G9CA 2ZMKA 1NXD1 1HLCA 1WW4A 1V6MA 2A5ZA 3POSA 1MS3A 1S0FA 2CWSA 3LCPA 4YG3A 3QLQA 5KXDA 3MW2A 1LOEA 2YROA 1DQ6A 1ENQA 3ZYPA 3A4UA 3M3QA 1OKQA 3AYDA 3FLPA 1W0PA 2ZHMA 1V6LA 2EALA 1QKQA 1W6PB 1DFQA 2GNMA 1GZWB 2A7AA 4YM0A 5FREA 3SH3A 3WVJA 4FPHA 3USUB 4CZSA 5DUUA 1Q8OA 5DXDA 1EPWA 1G7YA 5E8AA 2DVDA 2UWBA 4K1ZA 3WUCA 1A78A 4XJZA 5T5PA 3AP4A 2R1BA 3RSJA 2ZACA 3MW4A 1WW6A 2ZZJA 3ZPYA 4ATEA 4K1YA 3OYWB 4PBOA 1AJKA 1S0JA 4Y22A 2GALA 4AGGA 4BPZA 4ZXKA 5E89A 2A6WA 1CR7A 3JUUA 3R05A 3ENRA 1AVBA 1KJRA 4XJAA 3DUIA 3M2MA 1DYPA 4XOGA 1V6NA 5JOYA 1F9KA 2KM2A 1UPSA 2P37A 1YI7A 1S0CA 1LEMA 2A3WA 2DUPA 5JLVA 1G9DA 3WDTA 2R0FA 5HCBA 2WT1A 2CNAA 4LBNA 4YM3A 2PHXA 3HR9A 3WCRA 3ZSMA 4PQ9A 4IQPA 1GKBA 5EYXA 1AXZA 1JOJA 1SLIA 4JC1A 2CYFA 4BQ1A 3V0AB 4W65A 1W6NA 2DURA 3PJQA 3M3OA 2A6ZA 5GZEA 1C1FA 4FPJA 4TYSA 3ZXJA 5CBLA 4ZKTB 1QF3A 1N47A 1VAVA 3NV4A 1QOSA 1WCSA 4XHBA 4YGBA 4HL0A 1FX5A 4DPNA 1UN1A 3SH5A 1CN1A 3KM5A 5KXBA 3MW3A 3SH4A 1UKGA 2WJSA 3AXEA 4M00A 3B9CA 1Q8SA 1QOTA 1B09A 4XJWA 4YGEA 4FPKA 4Q27A 1DGLA 1ULDA 5EXOA 4XDQA 1KRIA
chains in the Genus database with same CATH superfamily
1QNYA 4AOCA 5A33B 1UU5A 3OPTA 1WCKA 2VULA 3I2FA 4Y1UA 3ROUA 2WA4A 4BJ0A 4DXTA 4GIQA 3HMYA 2JG9B 4ISQA 2WNVB 4AGRA 4D0QA 2VCCA 3VHRA 3F95A 1E5IA 3ITQA 1XJAA 4IDZA 4P02B 5FYSA 3SLIA 3W5NA 4QGNA 5D21A 5FFOC 3VKMA 2W68A 3RS6A 4KQ7A 4YW6A 1UO9A 5DAVA 1TMF1 1SFYA 3JBG3 1BKZA 5A7WA 3O1PA 2CGOA 1LHVA 2JG9C 2WNVC 1Q8VA 1W2NA 1BYHA 2E7AA 3HOBA 3POYA 5JSPA 1KS4A 3I4IA 2ZGQA 3IIAA 1U5YA 4QPGB 5DDJ1 1PGW1 2BOIA 4U2AA 4OHWA 4HVRA 3HIFA 4HT1T 4RS5A 1T6BX 1MPXA 3ES1A 2Z42A 2KA3A 2Q8CA 5CIRA 5FR3A 4H7MA 4HKOA 1VLNA 4P9LA 2PMWB 2DCKA 3BGAA 4LEJA 4P9WA 3T30A 1DGRA 3LE0A 1PMHX 3FX3A 5C71A 1RHI3 4ZPIA 2ZEXA 2P3KA 5CEHA 2CWMA 3W9AA 1PIV2 1ULFA 2R30A 4CEWA 3VUOA 5LK5A 3ZM8A 4MXVA 1ALYA 4CCCA 2PQSA 4BXSV 2LUWA 2O14A 1VBB3 2RJLA 3MIDA 4FVVA 5C7GA 1PO22 3FUOA 4Q4X3 4UBHA 3PUIA 2DWRA 4SLIA 3QD6A 1GV9A 1RUJ3 2EXJA 1Z78A 4QQHA 1WBFA 1HQLA 2WBKA 4QU1A 5CZKA 4AI1A 2ID4A 4JZRA 4GWIA 1PX4A 1W6MB 4XFAA 1UAIA 1QH7A 5LATA 2B8MA 2HYKA 4LORA 3S7IA 5CKNA 4IEZA 1QJX2 3WY6A 3V65A 3MPPG 5L36A 1WMXA 3RJ2X 4D6QA 4IW3A 1W8FA 1ASJ3 1RUD2 1XOYA 1LOAA 1RJ8A 2X53S 3Q8EA 4OLLA 2BWCA 4PBPA 4M4PA 5DUWA 1WD4A 5B4XA 2UU8A 1S0EA 2AH2A 1H9WA 1ZBA3 5EJZB 2ARAA 4LIUA 4QKFA 5FY7A 3LFMA 3SCHA 4FTSA 1RHI2 2WL1A 4XHXA 2XMLA 4BQXA 2WLQA 1AR72 4PQQA 2ZX0A 3PU3A 5A7PA 1H8TB 4YVWA 1IG3A 3C8XA 1VBB2 4YRDA 1WWYA 4XXAA 3JBG1 5APAA 3OGGA 3I3QA 5IVJA 1RUJ2 2Y60A 4CEYB 1BBT3 5I0TA 1VAMA 3Q8FA 1JU4A 4OHYA 4NPLA 4OHVA 4NN0A 5KC6A 2Y6JA 1JYXA 5FP8A 2QE3A 2GSYA 4EROA 3S6PA 4CUBA 1DQ4A 2TEPA 4AI0A 1DZRA 3MIEA 3TB0A 4COYA 2RJKA 4Y20B 3BALA 2EIDA 3MEPA 5CFCA 2WNUC 3TN92 2A73B 2SBAA 3ZXEA 1RHI1 3V0AA 1ND3C 4F3JA 1UU6A 1ZBA2 3VBRA 1S2EA 5A3OA 1VBA2 1UMIA 5FZCA 3FZ3A 4BQ3A 2H0VA 3MIFA 3AZWA 4ZXEA 2D43A 2VECA 5HV4A 3TAYA 1NZCA 1VBB1 2EIBA 1JYTA 2PHUA 4Q4X1 1FOD3 2PAMA 4RFRB 2DU1A 2ES3A 1RUJ1 1RVF3 1LGBA 3O1MA 2DF7A 4Q29A 5A32B 1IS5A 3AJZA 4Z92B 4E8DA 2F4PA 3H3UA 4AF9A 4C90A 2GNTA 3AKSA 3MF9A 4NHYA 3FL7A 3LEGA 5A1LA 5JIUA 5FZ9A 2WWSA 1OFSA 1PNFA 2PLV3 1ASJ1 1H8VA 5FLHA 2QQPA 1NCQA 4YFZA 3K77A 1YJKA 1KEXA 3KQ4B 1ZBA1 1AYN3 5FQ0B 4YW4A 3S7EA 2ZA9A 4JGZB 3RG0A 1RITA 2QBXA 4NJ4A 3ATGA 1H9PA 5F8PA 2G19A 3AKPA 5F3IA 2D3RA 5H9SA 1GBGA 5CFDC 4KG8A 3NJVA 1YXWA 3KF5A 4QXBA 1MZFA 4XMIA 4CUAA 5FOJB 1J3PA 4QKBA 3APBA 3C2UA 3EB7A 4EN9B 4YVSC 2JE7A 4E2GA 1RVF2 2WT0A 1LOCA 2Y6HA 3BCWA 1KFXL 2XDVA 1BBT1 3OGJA 2ILMA 1AX2A 3VZLA 2NN8A 1K5JA 3RWNA 4B3NA 3VBFA 5HCHA 3SITA 3IMMA 1F2NA 3WW2A 3AFGA 3UV9A 1J1TA 2XLGA 4K6BA 4W8JA 4CDWA 2WQ8A 1OOPA 1GANA 5IW0A 5FZ3A 4LT5A 3B01A 1FYUA 4LBMA 3ACLA 3QH7A 3KV4A 1SLAA 3AVSA 1XYNA 4HSJA 4LHSA 5FY5A 1R1A3 3EXUA 3RYRA 3OB8A 4CP9A 1LRHA 4OHZA 1S1AA 1H6XA 3KLSA 3WHUA 3RZJA 1HRI3 5LBCA 5BNNA 1FOD1 5KXEA 1XNBA 2D6NA 2RS53 4K21A 1RVF1 2SLIA 5DZGA 3NAPB 3ZN6A 3PLQA 4XCBA 1ZZ7A 2JDPA 2A70A 5F5QA 4LO8A 1ND2C 1VBD2 3KD4A 3QH6A 1XNKA 3I2OA 2GC2A 3FHIB 1NLQA 4OMDA 5FZKA 4NVPA 3PTRB 1JYIA 3IDEA 1V6JA 2PLV1 3KGZA 1FI2A 1GP5A 4YGDA 1SLCA 2G4IA 2XL7A 5H9QA 1T2XA 2JDKA 3IN9A 2X5IA 4LA2A 2CL2A 1ENRA 4NR1A 5FZ0A 5CA6A 5EFUA 2AREA 1W2AX 1AYN1 2VQUA 2E6VA 3MI8A 4PLOA 3CJIB 4CCOA 5C5UA 3T3YA 3UL2A 4BQYA 3INAA 3ZMNA 2F17A 3PURA 3PUAA 5F3GA 3OGRA 4XAEA 4FOVA 1OF4A 1EY2A 3OUHA 4Q2FA 3GM8A 4LBQB 1IPJA 1W8WA 4TWTA 4XJ8A 1JZ3A 1K5MC 2VG9A 1OD5A 4YNIA 2NM1A 4F83A 3FHAA 1PGL1 1HRI2 4IEPA 1UY4A 3DCQA 3LEIA 5JUVA 3IWZA 1NT0A 1UYYA 3M1HA 1REEA 2DFCA 1JUHA 2BUKA 3MFAA 2OUHA 2VGDA 4JAAA 1STMA 3VDDC 5LA0A 3WDWA 1RUE2 3ELNA 3NRUA 5FPVA 1LOFC 1V6KA 3HEIA 4WM8C 4XFIA 2R6QA 5F3EA 2OIIA 2DBNA 1MS0A 1V6IA 2XQRA 1XC6A 1LOGA 4CCLA 2WWUA 4BHPA 4BZ4A 5LZ6A 1ZZ6A 4GULA 4G4FA 3OSDA 1EUTA 1WW5A 3DL3A 3SHRA 3UKVA 4TZDA 1UX6A 5HCFA 5IUQA 4C0HA 1R1A1 1RB8G 2JDZA 2IUWA 1DGRN 5ANNA 2E26A 3D8CA 4LPLA 1JOBA 4RR3C 1HRI1 1O4YA 1CAXB 2RS51 4UW3A 2RDNA 2I45A 3NJYA 3W5MA 3WEZA 4YZ1A 5FPAA 4Q4W3 4GWJA 4ZU4A 4CU9A 4QX0A 1AJOA 3AVRA 1SPPB 2WZPP 3WG1A 3NWKA 3DKWA 3ME2A 3T0BA 4DUVA 4DY3A 1AXYA 1JW6A 2W08A 1NZIA 5FYVA 1UZYA 4D3WA 2DVGA 5JOXA 1K42A 4I01A 4YW5A 4EYUA 4LIVA 1O3QA 2VW2A 5DAQA 1KJLA 1CPMA 2JX9A 4LBJA 5E88A 4UFKA 1Q8QA 2Q8EA 3U4SA 3K4ZA 2CHHA 2GC3A 2VUCA 3WOGA 3UETA 4NRMA 1SACA 5FYHA 5FV3A 5LRSA 4FXKB 4XIOA 3JQXA 4J25A 3VBUA 3PMSA 3VBSC 3AK0A 2BJSA 1CWPA 3ZXFA 3WNKA 4LKSA 4QX2A 5JZGC 3IDAA 4FOQA 2XUMA 2YUEA 1DLLA 3U14A 3WNMA 5LEJA 5C3RA 1QJFA 2MHFA 2P34A 1C1LA 1UWWA 1QMJA 1XE0A 2XH6A 3DPRB 2P1BA 2VVDA 2A6XA 1SFNA 1MS5A 4MX3A 1UX7A 1WCUA 3UESA 5I8YA 4WVVA 2DUQA 4FT8A 1WLTA 5TSWA 4GKXA 4Q1PA 1KITA 3DPRC 4QQLA 4UXAA 4A7ZA 2RR13 3O7OA 3JCIA 2HKXA 1PK6B 2WFPA 4RFT0 5DMYA 1N1VA 4R4XA 4XILA 2RV9A 5DPNA 1GWMA 5C70A 4P5HA 2A1XA 4CPBD 4ZS2A 1OLQA 2VZVA 1JTZX 4INDA 4XF0A 2VNVA 4UI9L 1PVC2 4QX3A 2VZTA 3ZYFA 2XLFA 1RTVA 4MH0E 4Q4W1 4TSVA 1WA4A 3FWEA 3KWVA 3IPVA 5FMDA 1RUH3 3T1MA 1BK0A 1Q5OA 3THDA 1MEC2 2CDOA 1SCRA 2CAUA 2Q1FA 4I0WB 5LBEA 2FDHA 5FJHA 4A2UA 1IOAA 4V1PA 2VOTA 2J22A 3MDPA 3VB9A 4LTAA 1CIWA 2TUNA 4LXLA 4P9JA 3VD3A 5FZGA 1Y9GA 3JD72 3BN6A 4XXPA 5A7WB 1H1IA 2VW0A 1VP6A 2RR12 3N7LA 4QPYA 1N3QA 2ZGRA 3AKTA 3KT1A 4XZPA 1YIPA 1HRV2 4HG6B 1X36A 2RDRA 4BQ4A 5FY0A 3KHCA 3EBRA 5EJ1B 3WW3A 2VE1A 1QEXA 1NLSA 1FMD3 4RS5B 1YCIA 2VY0A 1L3JA 1W9TA 4LUKA 4MSVA 3T2TA 3PUSA 3HQRA 3USSA 1N3OA 3CLPA 4XFHA 4COZA 4IV1A 1U5IA 1FAYA 1RUH2 4H2AA 4CEWB 2ZOEB 1UW8A 4BYYA 5ABJA 2YFZA 1WLWA 3A21A 4PHZA 3OUIA 1CQ9A 4HK9A 4H14A 5CB7A 4EZHA 5B4NA 4I0AA 5F37A 2WWJA 3SCFA 3V64A 4XPVA 2ZMKA 2BV4A 2RR11 2PN5A 4MGIE 3POSA 1X9PA 2R063 4TLGA 4O61A 5KXDA 2YG0A 3F2ZA 5I91A 3O1SA 1VRH3 2W1SA 2ADDA 1TQ5A 3ZYPA 1VBE3 4AI3A 4HKWA 4GAZA 3K3NA 1XE7A 2UYBA 2EALA 4O9GA 1QKQA 4XCAA 4EJRA 1YLLA 2GNMA 2A7AA 2X05A 4CZSA 3S57A 3USUB 1LR5A 3I2GA 5K0UC 4DMIA 5JMOA 1G7YA 2TNFA 2X8KA 4K1ZA 2UYAA 2W5FA 3H3ZA 3A7QA 1GQGA 1RUH1 2R1BA 5FZHA 1I9RA 1W03A 2ZXQA 3JB4C 1OBNA 2NLRA 1R083 4BXFA 4YARA 3L2HA 4BPZA 4XUOA 3N9LA 1OVPA 3CEWA 3ZDVA 4Y5Z0 4YVWB 3O1VA 3M2MA 5DAWA 4W4ZA 1RUOA 3G7DA 2VZRA 4N90A 1RGSA 3AMQA 5JOYA 3KSCA 4HLTA 1OQEA 3GJBA 2KM2A 1YQ6A 2NPIA 1CAVA 3IDCB 2R062 2R043 4BH9A 1VRH2 4HN0A 2DUPA 1X8MA 1VBE2 4NRQA 3H42B 4AG4A 1FMD1 4L11A 4YM3A 1QXJA 5AFEA 4WM7A 4Y4RA 4OI0A 5I8SA 4PDWC 4D8MA 5EYXA 2Y38A 5CFCB 3OEBA 1SLIA 1RMU3 4NIGA 3LEKA 4JC1A 2CYFA 5FZDA 4EN6B 3V0AB 3PJQA 2RMU2 4LUMA 4XAAA 1SG3A 3VBRB 1QWRA 2A6ZA 2Z79A 5GZEA 3C7HA 3A22A 4FPJA 1AR93 2VZQA 5FLIA 1X7NA 3PL0A 5CBLA 1QF3A 5LW9A 4DUWA 3VL9A 1RYYA 5JI9A 2W92A 1PM4A 3NV4A 4YGBA 2D5FA 1H2MA 5BNOA 1W99A 2QQKA 5FXZA 1OA3A 1UN1A 3SH5A 1CN1A 5LEKA 2R061 5FKCA 3MW3A 2CSGA 4NAOA 1AR63 4AR2A 1VRH1 1NLRA 2WJSA 3HT1A 1QY4A 1H4GA 3B9CA 1Q8SA 1VBE1 1ZZCA 2R042 1QOTA 3VHOA 4BIFA 5D8AA 1B09A 2HEVF 2RG4A 4XJWA 3BIEA 1VPHA 3FFQA 4AI8A 3ZFFC 4AI9A 3ZR6A 2BFUS 4Q27A 2BNNA 2V4AA 4G3YC 2J1RA 1NCQB 4QPIA 1UYXA 1WGPA 4FQZA 4P08A 4CU6A 1GOHA 1RMU2 3WDYA 3GCWA 4A6SA 1MZ6A 4ARXA 3WF1A 3LZZA 1GNHA 3HJRA 2BGOA 3EHKA 2OPWA 3PVBB 5D1IA 2GNDA 3ETQA 3POIA 4QGMA 3MLKA 3T0AA 4HOOA 3J7HA 3BIWE 5JIAA 1C3HA 4KGGA 2CAVA 4JHZA 4CTEA 3J7NA 3IZOA 3RMYA 2ZMLA 3WG2A 4DRRA 2R0HA 3NNJA 2VM9A 4QX5A 2ZPXA 3RZGA 2R041 3T09A 1W8HA 3POFA 1AR62 5A7OA 3WXPA 3N9OA 1EAH3 4Y1VA 1HIXA 3VBFB 3N7MA 4DXSA 4JRAA 2W1WA 4LE4A 3MBWA 4ZU7A 2FCUA 3ZKYA 2WDBA 5J96B 1EYBA 2D6KA 4NIHA 3U11A 5I93A 3W20A 1RMU1 4CDWB 4LJHA 1OOPB 5K4LA 1OHFA 3WW1A 2RHPA 1NCRA 2ZGLA 4KNCA 1REFA 2VMCA 1W8OA 2XONA 3LAGA 4NMIA 2Y6LA 4CCDA 4LBQD 4CDWC 1OOPC 4C8DA 4CP9B 2VBBA 1LHWA 4D7TA 5BNNB 5FYIA 2WFF3 3AL5A 3ZN6B 4QXCA 2MPFA 2VTXA 1AR61 3ZVXA 1HJGA 3IB3A 5BNNC 4KH9A 2JICA 3UJOA 5J09A 3VHNA 1D0GA 2WABA 2YGMA 3UYJA 4I3GA 3FHQA 1GZWA 4AI2A 4BE3A 4NO4A 1BMV2 2R1DA 2EICA 2VXRA 2WSVA 4QB6A 1ULGA 2X5IB 3N7JA 3VHPA 2VVFA 3UT0A 3NL1A 2J1VA 1I1EA 3OBTA 2VL4A 4QDSA 3RWKX 4AVSA 2YV8A 2LRPA 2XHKA 4BQ2A 2ZGUA 2X5IC 4HANA 2QDNA 4XBQA 5FP4A 5FYYA 4QXKA 2BVBA 2YDEA 4LLOA 1H30A 2G1MA 2YYOA 3EO6A 2HBUA 1G8WA 2CGPA 1J1LA 1JZ6A 2AC1A 5C8CC 4DINB 2XHNA 3VKOA 2VCAA 4MZUA 4CRQA 2ZGMA 1WMFA 1WBLA 4S2GA 3ZSJA 1CIYA 1SEFA 2ERFA 1YWKA 2QCSB 4AQTA 1RUI2 3KGLA 4LK7A 2WA3A 1BJQA 2W9XA 3SKJE 5JXGA 2KR2A 2E7QA 2QQIA 2VZOA 4CCMA 1BMV1 3D82A 4Y1XA 4IV3A 3ACFA 1I5PA 4NHKA 5CNAA 3H1YA 1MVQA 1ZBE2 4LBOA 3VDAA 3WUDA 2XGXA 5DG2A 2XVLA 5C33A 4LA3A 3BTAA 2I07B 2UY9A 3R4DB 1ACCA 3ZFEA 1WW7A 1LNSA 1R64A 2VAUA 5FMCA 4IETA 4ARYA 3NNLA 3FBMA 5T55A 1AX0A 4JDOA 2IXCA 5FLJA 1HB3A 3M3IA 4P9XA 2C24A 1G9BA 1UXXX 2C5DA 2WFF1 1DGWA 4MHRA 3M7AA 4ASMB 1IKPA 3LDKA 2NZ9A 4ZY9A 3GALA 4IEVA 4UFHA 5IK7A 4NPRA 4I0BA 5FRAA 4CSWA 2BP6A 4E27A 2QQWA 4YZ3A 4HN1A 5LY1A 1SBEA 4LMFA 1JZ5A 4IE6A 1J3RA 3OBAA 5FMOS 4S2HA 4R9DA 4URAA 1LHOA 1OKOA 2PHDA 3TEWA 2ZS6B 3ALQA 2VO5A 4CUGA 1PIV3 2D40A 5IAXA 4QM8A 3HN1A 4R8HA 3U1XA 2JENA 4NROA 5LB6A 2IZWA 3VBUB 1HV1A 1PM7A 3OJBA 3SNMA 1GLHA 5GZCA 3OOXA 1DZQA 5IK8A 1PO23 2W1UA 3IDBB 4B1MA 1GFF2 1KS5A 3HVDA 4XQ4A 1BXHA 4KU8A 2B42B 1EV13 3T08A 3WDUA 4E9KA 5H9PA 2XPJA 5GZGA 2GN3A 4Z1VA 3BTXA 3HNBM 1O3RA 2E31A 4CA9A 1UIKA 5DAPA 1QJX3 2D6LX 1QNWA 1UY1A 3H9AA 3P1IA 4GMP0 4UT5A 4AVCA 3IT8A 3O1RA 4Z07A 4GB32 1IS6A 3U4XA 1RIRA 3O0VA 3LEMA 1RUD3 5IVBA 1OFNA 1W9SA 4DFSA 4OQ8A 5BYNA 5GALA 2VU9A 3LPFA 1YRZA 1PMJX 4QPGC 1BCXA 2GH2A 4U36A 3RZHA 4CXWA 1KFUL 1NQJA 2WQZC 1CONA 1G9AA 1NKGA 4N43A 2XJTA 1YO8A 1AR73 2QQLA 1Z7S2 3MIBA 4AVBA 2WAOA 5FYMA 1MACA 3HNYM 1QHDA 5JR7B 4A45A 2NQYA 3H1MA 4HSLA 4UOJA 1YQ5A 4CVUA 3EQEA 3IPVB 1XYPA 5FY8A 4G9SB 4KL1A 1M06G 1QQP3 1EV12 2JDAA 4LKFA 4KWJA 3NKGA 4CXYA 5IK5A 2PHRA 2P3JA 3D0SA 3FLRA 3FC0A 3LF7A 2YBSA 2ZEYA 2ADEA 3BYWA 4E2SA 1O3SA 2VQTA 3OPWA 1SLTA 4Q4Y3 1OQ1A 3CU7A 4AEMA 4CCNA 1QXRA 4Y3OA 2XWJB 2AENA 1W90A 2IXJA 4XETA 3TN93 3B3QE 5BNPA 1RINA 1C5IA 1PIV1 3HD8B 1UU4A 2JD4A 2RS33 3K3OA 1VBA3 5FZBA 3FN9A 3MIGA 3M4FA 4PCRA 2VTFA 4BA6A 3IIIA 3MIHA 4H3WA 5JWPA 3RZMA 1DBNA 4D69A 1N3PA 1PO21 2XJQA 4Y1YA 4DXRA 2PAEA 4IV1B 1BEV2 4KI5M 1XBFA 1YFYA 4IUGA 1EV11 2VOVA 1NG0A 4P9YA 2OVUA 5ABJB 4MLOA 4JKLA 1HX6A 4P9GA 1H8TC 2PHLA 1F5FA 1QQP2 4XVHA 3R4UA 5FYCA 4OUEA 1T6GC 2HWF3 1ONAA 3O5SA 1QJX1 3P3NA 3OD4A 2ZX2A 3ST7A 1O59A 1NX9A 2Y6FA 3DYPA 1RUD1 2N7GA 3HQUA 1Y43B 2QFEA 3N9QA 3U10A 4CEYC 4Q4Y2 1GOGA 1MS9A 2EXKA 3VV1A 5IVCA 3GNEA 3AZVA 5GLUA 4D7SA 2JDNA 3J9SA 4L99A 1K45A 4FP3A 3W58A 1AR71 3DGTA 2RS32 4AEJA 4Y5SA 5IJRA 4W6YA 3VD9A 1BEV1 3LWCA 3RQ0A 3FFZA 4IEYA 2FDJA 4IEQA 4AW7A 4X6RB 2FZ2A 4MHUA 1QQP1 2OA2A 3O0WA 3JU9A 2ZGSA 2OQ6A 2OT7A 3GF6A 3ECQA 3V56A 3BI3A 1C8M3 1OI6A 1JS9A 2HWF2 1C8NA 2HWD3 4XEZA 2MEV2 2I2SA 1G9DA 4Q4Y1 5CAZA 1C4RA 1CAVB 2XVGA 5FXXA 3ZFGA 3U37A 3TN91 3K48A 2ET7A 5FZ6A 2P4EA 2YHJA 4KMQA 3AMNA 1RXGA 1ULCA 2RS31 1VBA1 2VC9A 3GJAA 4K9SA 1FPN2 3WD5A 4DEVA 3FJSA 1GICA 3I8TA 2C26A 4QD2A 4WM7B 5C4WA 1REDA 3ZIWA 3O12A 2P2KA 2A3XA 4DEQA 5J7MA 3GDBA 4HPKA 5F39A 2O8OA 3PVOA 1AR82 4JGZC 2GMEA 2IVJA 3ZX7A 2AEZA 1LENA 4UFLA 2JJ6A 3CDZB 3ZXGA 5J98B 5FWJA 5D2AA 3B94A 4CDUA 4OZXA 3A0KA 1CZTA 1VBD3 4JTNA 2HWF1 5L73A 4YYOA 4I3PA 4V2WA 1VAKA 4WVWA 1UPIA 1E57A 1C8M2 4QX1A 3R4SA 5BNOB 2HWD2 2C6SA 3QCWA 4GMP3 5FZMA 1J58A 4UF0A 4YLZA 5A6QA 3MUZ1 4O65A 2A6VA 3E1F1 4CDXA 2WN2A 1NA1A 1J59A 4I09A 1O5UA 5D8AB 5BNOC 2VR4A 4XJ9A 1AF9A 4WVMA 4YW3A 2RJ2A 3OBRA 4IGPA 2ZX3A 1NXMA 4OI4A 2PXJA 3M3CA 1DHKB 1TNFA 4QPIB 2BTVC 2JIJA 2ZHNA 3LOIA 1F31A 5EQUA 5JXJA 4HK8A 3D4KA 3FUQA 1P8JA 3VZNA 5IT6A 1OVSA 1HXS2 2VD7A 3POGA 5J36A 1W2UA 3PVNA 5FZ4A 1KXGA 1QU0A 2Y6GA 1C8M1 1RUE3 2HWD1 1A34A 3NAPC 4CDQA 1YYNA 2BERA 1OQDA 2VPVA 4WZFA 4OQ9A 3BVCA 5LBBA 2BU9A 1R093 4AZZA 1CZVA 5G04L 1TME3 2VTXJ 2GH8A 4RQPA 3OGVA 4XZUG 4FPYA 2WO3A 5LRRA 4I2OA 1WUVA 4FFFA 1M4WA 3DKQA 3WV6A 5JVVA 1O4TA 4UAPA 1ZA7A 2XG3A 4AEDA 4NUBA 3CJIC 4UW6A 4MGTA 4D94A 4L9BA 2VZ1A 3AFKA 3D0JA 4M3CF 4QX8A 1NCRB 2ZEWA 3WF3A 3ZSEA 1YI9A 4N9HA 2AEYA 2VUAA 4YFWA 4GALA 1VBD1 5A6XA 3VKLA 1YFUA 1KDKA 1SZBA 1HB4A 3SMHA 5A80A 1G9CA 2V72A 5FZLA 1AL0G 1WW4A 2A5ZA 4LOTA 3LCPA 4GMP1 3RI8A 4UBGA 4TLFA 5F2SA 4BISA 1OPOA 4LNVA 3AYDA 3FLPA 2ZHMA 1QXPA 2C4XA 1R092 3VBOA 4AVAA 4HVQA 4MOAA 2W47A 1TME2 1UNBA 1GZWB 3S5QA 5FREA 1F5JA 1CJDA 4QQ2A 1FXZA 4JGYA 5E8AA 2UWBA 4QAWA 5IVEA 1A78A 2K0GA 3DN7A 3AP4A 2RDQA 4FI9A 2PAKA 3MW4A 3RDIA 3RSJA 4ATEA 1UZVA 4K1YA 1PGSA 5KHIA 3UNPA 3Q8BA 1AJKA 2HWB3 2Q8DA 4Y22A 2GALA 4DB5A 2JG8A 3KCYA 3THCA 3R05A 3VBHA 3RNSA 1W8TA 4XJAA 1QJU3 1HV0A 3DUIA 1RUE1 2X29A 2WS92 2WO2A 1V6NA 5F5IA 1US2A 1H2NA 3WF2A 1TG7A 1UPSA 2QQJA 2XUEA 1YI7A 2G9FA 3IAQA 1AUYA 2JDMA 1OMIA 1R091 3NQHA 4AL9A 4IEOA 5K7PA 3WDTA 1TME1 4TTGA 1W3VA 3NMBA 3GBFA 2GC0A 4LBNA 4IGOA 4EWDA 5FYBA 4IV3B 4CCKA 4IQPA 4Z2AA 1H0BA 3WP6A 4KWKA 3TNPB 1PVC3 1UXZA 1W6NA 2DURA 3KCXA 5IWFA 3K4AA 5F5CA 4E8CA 4NAMA 1ZRCA 4A3XA 3M3OA 1HJFA 3ZFEB 2ZX4A 1C1FA 2FD8A 1H4HA 4TYSA 2XXZA 1QJEA 5CVRA 1OH3A 2HWB2 2BDRA 4AK3A 4N53A 3I2DA 3DEMA 1ZRIA 1MEC3 1QOSA 1RUNA 4HL0A 4MGKE 5FKBA 5ACA2 1QJU2 3D3AA 4DPNA 4COVA 5KXBA 4QHZA 1JH5A 2VBDA 2XJUA 1UKGA 3WF0A 1X9TA 4EV0A 3JD73 4OI2A 1EUUA 2VCMA 3SEPA 5JSOA 5JPMB 4KG0A 2IFWA 1W8NA 4YGEA 5F1RA 4E4DX 1PVXA 4OULA 4FPKA 1HRV3 2Z4FA 5FZ8A 4FFGA 5FYUA 2FQPA 5EXOA 1YC61 1D2QA 2ORXA 4BOWA 1KRIA 3H0OA 4FOYA 1CPNA 5T5JA 4XFGA 1PK6C 4BB3A 3E6DA 3KV9A 2ARXA 2P3IA 4XYXA 5FWEA 4ZHNA 2HWB1 1EPZA 4AAXA 1TEIA 4IESA 3MFCA 1W2OA 1QJU1 4AXOA 3SKVA 2JEMA 3POBA 1JMUB 2O8QA 5A1FA 4M3CA 3LIGA 2BFUL 1MR5A 2FDFA 4XFBA 5A7SA 5C3PA 3RRDA 2GMPA 1E5SA 2B45X 3TRSB 2VW1A 2BPA2 2WZEA 4LO6B 2EAKA 2H0BA 2E32A 4YZ4A 4AHWA 1PGL2 1WKYA 3KV6A 3AB0A 2YB7A 1UMHA 2XB6C 4JKMA 3ON7A 3ACIA 1V0AA 4XUTA 4C1WA 4RD7A 3I3DA 2ZAAA 4XE9A 4B1LA 1NQDA 4I30A 1XPWA 2Y8KA 1PVC1 2G9GA 5FYZA 3TNQA 3WQBA 1HB2A 1LJ7A 5JSRA 2HJIA 3ILNA 4FPCA 4GH4A 1AYM3 1DZTA 1S2BA 4RS5C 1H1AA 3SCGA 1DYOA 1MEC1 4N43B 3TEXA 1OXCA 5HPOA 3CIHA 1D7PM 2CV6A 1POV0 4CP1A 3KV5A 1W04A 4XUNA 4A41A 4RYDA 2CGNA 4N43C 1MQTA 1B35B 3JD71 5FXWA 1Q8PA 1LGNA 2P17A 1G86A 4NE9A 2PELA 3J8F3 4CEWC 2JIGA 3HN3A 3PTYA 3UKTA 5C3OA 3VD5A 1CVNA 3EJKA 1COV3 1GZCA 1HRV1 3BOWA 1Z0HA 2DVFA 4H55A 5IVYA 3PHMA 1GR3A 3AJYA 3VD4A 2A71A 1RJ7A 1C57A 1GU3A 1YHFA 2W39A 3OGSA 3RYPA 3H8XA 3NVCA 3ZN4A 4P14A 3VKNA 1N1SA 3M70A 4AQSA 1W2TA 4Z2WA 5EJ3A 2WZR3 4Z82A 1GYKA 1C28A 1IHMA 5T54A 4QT6A 4E4ZA 5BXXA 2YMZA 3KVAA 2RMU3 5L9BA 5BNPB 4BLJA 1AYM2 2HYXA 2A6YA 5LY2A 4XUPA 3QOPA 5DUVA 1DQ2A 4MXWA 3K51A 2EAAA 2FZ1A 2IXLA 5LA2A 1ND3A 1WLCA 4I02A 2YXSA 1U5ZA 1UKRA 3NW4A 1NYWA 4XBNA 4A42A 3POEA 4E2QA 3VZOA 4X6QB 5BNPC 1PZ7A 2J1EA 5A7NA 4YZ5A 1CX1A 2E51A 2VNGA 3AMHA 3J8F2 2XJVA 2PA7A 5DZFA 3WW4A 2GAUA 2DVAA 5FY1A 5EV7A 4YVWC 3H8OA 1COV2 2YC4A 4V2VA 4DRVA 5IVFA 3I54A 2ETEA 2ATFA 4YG6A 4HBNA 4R9AA 1JYNA 3VGIA 2YBKA 2XJSA 1WD3A 2DCJA 2WZR2 2VMGA 4AHYA 4BDVB 2Y64A 4XMAA 1A8DA 1AYM1 3LA2A 1JYCA 3AP7A 2VNRA 4M01A 3A23A 1HB1A 2IXIA 3BOPA 4NOTA 1XSQA 4YZ2A 3E97A 1W9WA 2DTWA 5IATA 2BBVA 1DCSA 1FATA 5KR7A 1R1ZA 5CFCC 4CUCA 4LBKA 4BLIA 1JU3A 2RM23 3IKWA 4XIKA 1GQPA 2GMMA 1H2LA 1XNDA 2KD7A 3ORJA 2IFRA 2AYHA 3VBRC 3J26N 5CFDA 5J1XA 3UGHA 3J8F1 1HQWA 1F15A 3NV1A 4ES8A 5ABJC 5JPNB 5L9VA 1ENXA 4E4HA 5F6KA 2R072 1COV1 4ISRA 4PIZA 4YVSA 3E5XA 3WNXA 4AHXA 2D93A 2LW8A 5DABA 2FDKA 1UOBA 4JV4A 1BVVA 1SQ4A 2Q1ZB 1APNA 4M4RA 1JZ8A 5BV6A 1KDMA 2WZR1 3OCPA 4KU7A 4AE2A 5IFPA 2D6OX 3G6JB 4NIDA 3ZFGB 1W9FA 3AX4A 2Q1MA 1OH4A 2RMU1 1LHUA 3HPNA 5JDBA 2J1AA 5SV8A 4RL7A 1DQ1A 3IBMA 1NCQC 2XKOA 5C4WB 3LDRA 4Y4YA 4UFMA 4Y24A 4HPKB 2RM22 2GU9A 4Q0PA 4Y5TA 3BU0A 1ENSA 4OI1A 1KGYA 2FBEA 5C4WC 2DUOA 2BNMA 5FMOL 1W0NA 2R071 4CDUB 2IC1A 3PNAA 5C9AA 2YC2A 1A3KA 5FAXA 4QPWA 4LULA 1G9FA 5A7QA 1DP0A 1BVP1 3EMRA 2K46A 1ND2A 4AVVA 2PQQA 2WUHA 4LE3A 4URTA 3V0BA 4UF0B 2Z5WA 5JXHA 1G6NA 4CDXB 4JQTA 4OFGA 4XURA 1NA1B 3N9NA 4UW4A 2LALA 3VBFC 4AGVA 3LSEA 3H7JA 4ZU5A 4WVMB 4JDMA 5BPXA 4GZ9A 5FBZA 3ZYHA 4CU8A 4YGCA 1OF3A 1GSLA 3MGUA 4PIYA 4CDXC 1OLRA 1S4CA 5KHHA 4Z8BA 1NA1C 2R32A 4IE5A 5GLVA 2RM21 5FYTA 4ONUA 3HBZA 4RGKA 3HBKA 4L97A 1O8PA 2VH9A 1POV3 1X82A 1IZ3A 2D6PA 4W6WA 4DIQA 5FZOA 1W6OA 3IMNA 4AFDA 1K5MA 1N1YA 1W6QA 2QQOA 5CKMA 3GBGA 4IEUA 5FZEA 2W94A 1RUI3 3A0NA 2ET1A 3DXUA 3MF6A 4CE8A 2JDUA 1JYWA 3PU8A 1L7LA 1DQ0A 4FXGB 1C5HA 4QX7A 5GM0A 3VDDA 4CDQB 3ETPA 2OQ7A 4B8EA 4CCJA 4OUSA 2W0XA 3SXWA 1YQCA 2PHFA 3AL6A 1ZBE3 1V9U2 2VCBA 2BVVA 5CU1A 1LOFA 1VBC3 2XOMA 3U78A 2Q4SA 1Q56A 2WO1A 1HKDA 4WM8A 2Y26A 1WCDJ 1IG0A 3WNOA 4RQPB 2E53A 3NNGA 1LESA 1JXNA 4OMCA 1UIJA 4SBVA 4A4AA 3I3MA 4NRPA 2OPKA 4GWMA 1SBFA 3VZMA 4AEDB 5LCWL 2DBIA 2F6BA 2QTWB 4L0PA 4BQ5A 2BGPA 3DYOA 4ITCA 3FMGA 2OKXA 1F8VA 5GLWA 1GOFA 5K9YA 1CZSA 4RGAA 2DTYA 1Y9QA 4RR3A 5LA9A 1W8UA 2XKPA 4HXCA 2ZHLA 2XJPA 1LTEA 3ZOIA 2QUOA 2W91A 4RSUA 3WP5A 2WNEA 2ZEZA 4NHLA 2CDPA 1YIFA 4YG0A 2E7TA 2YBPA 5I8TA 3JB8A 3WLUA 5EZWA 1LHNA 5BUVA 1VBC2 3SQOA 3VBOB 1VMHA 3N3HA 2V5YA 1UL9A 3OF1A 4KWLA 3B02A 3O0XA 5T5LA 3HWJA 1LU2A 2Y33A 4KWUA 2B9UA 2FDGA 2WYFA 3D6EA 3WDVA 5FP7A 4JGYB 3VBOC 3WR0A 1WA6X 2DCZA 3P5BA 1KQRA 4N7UA 1POV1 4Q0SA 3I59A 3KCCA 1CAUA 4FPOB 1ZZ9A 5FPZA 1OSGA 4AFCA 2YFUA 4Y22B 1RUC2 1F4HA 1YEWA 2EIEA 2ZBJA 4L2NA 2JG8B 3VBSA 1TE1B 1W05A 3RZZA 4FOWA 1RUI1 3VBHB 5LWBA 1JZ2A 4Q0QA 1OT5A 5T50A 5JZGA 3NJXA 3RZLA 1W39A 2Q5TA 1AXKA 5DZEA 3ZXLA 1TNRA 1GNYA 5KBFA 2J1TA 2JG8C 1SDWA 1O8SA 3HAGA 1F4AA 1OPMA 1ZBE1 3ZN5A 3CNAA 3SEEA 4GB33 3ZMOA 1VBC1 3HT2A 4Q0UA 4JRLA 5FCCA 4MADA 1OUXA 1ZZ8A 2W52A 1FNYA 3MV01 3CBNA 2ZJCA 1L7RA 1O5LA 2GNBA 2P5BA 5JI7A 1S0BA 2AGSA 4A6OA 1QH6A 3E6CC 1GUIA 1GZ9A 1ULPA 3FLTA 3OPZA 5FUIA 5M0TA 2Y6KA 4X8NA 3HQXA 5F2WA 2VQ0A 4LO5B 4AYUA 1Z7S3 3HNMA 1W6NB 4CCEA 2NMNA 2JB8A 4C91A 2J1SA 2XQXA 1DIWA 1VRBA 3IAPA 4QB2A 1ULOA 3L9JT 3OY8A 1LU1A 4YM1A 5A3LA 1HN0A 3B7MA 3I3EA 4N53B 3UGGA 4F7ZA 3ZYRA 1VMFA 3VBUC 2I74A 3AZXA 1L7QA 4OYUA 1WZXA 5FIXA 3UKNA 5A3NA 5C8WA 2Y0OA 3KVBA 4M0NA 4AAPA 4BIOA 1FNZA 4AVTA 1FV2A 3BUCA 2WO7A 5DG1A 2ZZQA 5T5OA 1CJPA 2D3PA 5C6CA 1UZ0A 1S2KA 2W3JA 2AR6A 4BMBA 1OD3A 3WZ1A 3TEZA 3AYAA 3ACGA 3H8UA 2ZKLA 1GNZA 5AC93 4GA9A 2WZ8A 3M8LA 2R49A 3ZSKA 4Y26A 1W0OA 1VR3A 5BY5A 2H6CA 2HBTA 2IXHA 4RA0A 2VVEA 2R16A 1BEV3 5E1RA 1O4ZA 1B35A 4AWDA 2VZSA 4FPGA 4PJYA 2EIGA 5CKQA 1HN1A 4DXZA 4Y33A 4M3CB 5BNQA 1SLLA 4J1XA 4EZ4A 2D3SA 3H7YA 4Q8LA 4O7XA 4BWOA 4FFHA 4GB31 2BOJA 3AMPA 3N7KA 4N8MA 1S0DA 3N9MA 1VE0A 4H7LA 3WDXA 1IQAA 2ZTNA 4FTEA 4AFBA 4AHZA 2Z2SB 3AZZA 2X09A 3GCXA 4Q8KA 1UMZA 3B00A 5H9RA 3T4VA 4AQ2A 4DO0A 5HXMA 2B4KA 4UFIA 2D6MA 4EE2A 4JVAA 2VZ3A 1Z7S1 3CQOA 3VD7A 4LK6A 1YFWA 2WC2A 5FPUA 5DN2A 2HWE3 3JBG2 2XL9A 1QIQA 4QKNA 4GH4B 1XYOA 4Q5OA 4OZOA 4P5YA 1SMVA 5K0UA 4MYEA 1D0HA 3H3LA 4LR4A 1O6UA 3UJQA 2A3YA 2PYTA 5DUXA 1GP4A 1UD1A 1HLCA 1V6MA 4GH4C 2CWSA 3RVHA 4PLNA 3QLQA 3GGLA 3MW2A 2XLAA 1LOEA 2YROA 4IV1C 4YG3A 3X29B 5I0RA 4GQ7A 1DQ6A 3WP4A 2MEV3 1MQTB 1OKQA 2WN3A 3ZKUA 1V6LA 5FZ1A 3U0ZA 3KB5A 1XNCA 3KT7A 5IAVA 1DFQA 2HH9A 3THTA 4YM0A 3WVJA 4CYDA 1SDDB 4FPHA 3AM2A 5DUUA 1MQTC 4K8FA 2VBPA 5DXDA 3PDQA 4B29A 1TZOA 3MUY1 2DCTA 1ZNPA 2DVDA 3WUCA 3I2IA 5AC91 5T5PA 1FPN3 1KD7A 4XC9A 2ZACA 5FO8B 2ZZJA 2BNOA 2JWPA 3LOBA 4XUQA 1Q43A 4Q4X2 3NSTA 4AGGA 3ES4A 4RHV3 5E89A 3VDBA 2Y34A 2HWE2 1CR7A 1AR83 4PDWA 1AVBA 4MG2A 2VMDA 3C7FA 3VZJA 2WNUB 4MXWB 1ZVFA 4K40A 5GKAC 1ND3B 4K3UA 1F9KA 2Z69A 2P37A 1O7FA 4EN8B 3K46A 1ASJ2 4MGZE 2YC0A 1LEMA 1YUDA 4X8PA 5LA1A 1XB9A 2CNAA 2PHXA 4KBZA 1PHMA 3HR9A 3KF3A 3WCRA 4FAHA 4NHMA 3C7GA 1AL23 5G05L 3WQ7A 4CP0A 1AXZA 1JOJA 3OG2A 3BTYA 3I3BA 4OCTA 3I7DA 3QBQA 4BQ1A 2RVAA 4XDOA 3I2JA 4K8RB 4ZS3A 3ZFFA 3RYKA 2HWE1 1UOGA 2WRAA 3ZXJA 4QDQA 4ZKTB 1D4M3 1N47A 4RHV2 2C1FA 1VAVA 5FPXA 1BBT2 4WM7C 1HXS3 1UY3A 2V5DA 4W6XA 3KM5A 2CU5A 5J48A 4AEKA 4XABA 3R6SA 3AXEA 4M00A 2MEV1 4DUXA 5FP9A 4C0BA 5CFDB 3J4UH 3I49A 2XBO3 1JODA 1Y9MA 4LQRA 1JHJA 3Q8CA 2XR4A 1V70A 4NHXA 3LB9A 2E9QA 3CZUA 4QDRA 4XQWA 4B4QA 3CZJA 2QZ3A 2VJXA 2HLEA 4YVSB 4K7JA 3VN4A 3GYDA 2PHWA 3ZPOA 1AL22 1SCSA 3PJYA 5FY9A 2D44A 1FPN1 1XXNA 3S0MA 4DY5A 4ES9A 3ZLIA 1J84A 1FOD2 1NUKA 5FZAA 4RHV1 3RMXA 2PHTA 4FQ4A 5D8AC 4B4PA 3AC0A 5C5TA 1AR81 5AC92 1D4M2 3LD8A 4LHLA 1UQXA 4LOSA 5A3UA 5I0DA 2NP0A 2RE9A 2VZPA 1DQ5A 2BWAA 2ZX1A 4D7YA 2L9LA 5A3TA 2O0OA 4QPIC 3B69A 5JOWA 2PLV2 2VQAA 2VMEA 4ZONA 3LA7A 2P6CA 2B39A 4FAGA 5J3UA 3AP9A 4COUA 3AMMA 5LASA 3BKZA 1Q3EA 1VB4A 1ZA4A 3ASIA 2ZGOA 1LEDA 2IVIB 2QJVA 1PNGA 4R4ZA 1AYN2 1IS3A 2NMOA 2XBO2 5F9TA 5HV0A 4XJUA 1JBCA 3P6BA 5C9AB 2ZCWA 1AL21 2WSUA 4META 1MZ5A 3LPGA 2YZ4A 1ND2B 3LFIA 1ZZBA 4BMEA 3POJA 2FDIA 1URXA 5C9AC 3L2YA 1ZRRA 3V0BB 1X8EA 4IXLA 5HXVA 1POQA 3H50A 3KT4A 1D4M1 1CX4A 4RN5A 4A3ZA 5E16A 1UYZA 3CKHA 4ATFA 1CAWA 2V4VA 3WNNA 4FBFA 3GHMA 2C0ZA 5KC5A 1GZTA 1HXS1 2FMDA 3WSOA 1YJLA 1LECA 5FPBA 2ZGTA 3OUJA 4JDNA 3O1UA 3LKJA 4XFCA 1LGCA 3ZXKA 3UK9A 5L7OA 5IVVA 1NE4A 4LO4B 2WS93 2UY8A 3UGFA 4MGYE 2XWBB 1LAJA 1NCRC 2GZWA 2V73A 3ACHA 5EPAA 1W6OB 1HQNA 5FZOB 5HCAA 1W6PA 2XBO1 4IERA 1MS4A 2WNOA 1K5MB 1W6QB 2B5HA 2WKKA 1RL3A 2NYYA 5C8CA 3O1TA 3WX5A 5DAXA 2KXLA 2VMHA 4ASLA 1R1A2 5FMBA 4MV2A 1QJZA 3ZR5A 2DDUA 3AKRA 3OYWA 1XRUA 3VDDB 5C3SA 4UFJA 2P6HA 4QHBA 4GWNA 1X33A 1QGLA 3VL8A 2RS52 3AP5A 2X10A 5CG9A 2YU2A 1GP6A 4WM8B 3FE5A 4YM2A 3RI9A 2UURA 4DNYA 1IPKA 1W8ZA 1HW5A 3VLBB 3SISA 3BB6A 3C7OA 2BGCA 3OEAA 4MGSA 5AVPA 1LKNA 2F4LA 5GLTA 1E5RA 3K2OA 5ACA3 5FO9B 4BQWA 3ZYJB 1GMMA 1AX1A 1V00A 4EWAA 3TWIA 1UYPA 2ARCA 4RR3B 3OBZA 1ST8A 4Y1ZA 3ZXDA 2GN7A 5EYYA 2K2SA 4JCKA 1BLZA 1JN2P 2QQVA 3WG4A 3FBYA 3AYEA 5F6LB 2VOKA 3B93A 3T2OA 3CL1A 4PI2A 5HI0A 2ZAHA 4NPMA 5JCTA 2BEOA 5L19A 3ABZA 2JE8A 3GXUA 4FPFA 1QDOA 4XDPA 1MVEA 5F7UA 1SLBA 1W06A 2RS13 4QGLA 3WG3A 3B5LB 3C3VA 3WCSA 4IV3C 2JDYA 1H2KA 4FCAA 3M3EA 1QJY3 4CP2A 4HMZA 1SHWB 4N7IA 2FMYA 3PIJA 4BK5A 3MZHA 3TYJA 2EVXA 1VALA 2WS91 2BYVE 1IQDC 3I59B 2J7MA 1CAUB 4MVTA 3T2PA 3ZFEC 5FDBA 3MYXA 2QNKA 3W21A 4J1WA 3RGBA 5ERLA 5LK7B 3VBSB 3ILFA 3MV11 3T1LA 4LKDA 3TOJA 3AYCA 4ORFA 3PIGA 1LODA 5A33A 4A7YA 1HDKA 2V09A 2HWC3 5JZGB 4WBBA 2ENRA 1BK1A 3Q8AA 4DS0A 1DG6A 1WCQA 3NV3A 1AZDA 1S0GA 1J3QA 3DECA 5JXIA 4QQOA 5FPLA 1XU1A 1XE8A 4FO9A 2UWCA 1XQNA 5GLZA 2JG9A 1CGPA 2WNVA 5L9RA 5T52A 3WNLA 3ZYGA 3C7EA 4XTMA 1UCXA 3CF6E 4KBBA 4OHXA 2O1QA 2ZGPA 1CD3G 3I97A 2VMIA 4Q4W2 5F3CA 2OYZA 2P3YA 4QMAA 2RS12 2EXHA 3W59A 4F8AA 5I0SA 2Q8OA 4HZFA 2FCVA 2JE9A 1VMJA 4XW3A 4BU2A 4DZGA 5IHRA 2TBVA 4AFMA 1QJY2 2QQUA 3GZUC 3ILRA 4QPGA 4WV8A 5CISA 4LBLA 4B7EA 4DOUA 1UOFA 5ACA1 5FZIA 5CYYA 2EF6A 3MLLA 4CPBA 5J37A 2LTNA 1YQ2A 3J7MA 2WR9A 5KWRA 3GHNA 1WLDA 2DV9A 3D5OA 3OY8B 5SV5A 2BQPA 2ZGKA 2WINB 5FTTC 2BRTA 5K8SA 1GQHA 2UWAA 1E5HA 2W2IA 4GKYA 3SC7X 2HWC2 1MS1A 3CO2A 1Y7BA 4NWVA 4GXLA 2CTVA 2W46A 1EP0A 5KHGA 5AVAA 5JMCA 1DF0A 1IGOA 1OA2A 2C9AA 2D7FA 3POWA 2RS11 1BQPA 1OC1A 3CHXA 3TEYA 4YW7A 3WT3A 1F35A 1ODMA 1H1MA 2FCTA 1QJY1 1RUG3 2OUJA 4YW2A 2DYCA 3KMHA 2VUJA 1W6MA 3ZIXA 3LIHA 4YPJA 4IE7A 4RGGA 4QXHA 5DQ0A 3ZXAC 5KHKA 1MS8A 5KXCA 5ISLA 3AZYA 4M3CE 3MO4A 1UY0A 4IE4A 4BK4A 5FXVA 2GP5A 3QACA 4LHNA 1XNAA 1UOJA 4KGQA 2YU1A 1DDLA 5F5AA 4ET7A 1I3HA 2HWC1 1PO13 2B7YA 2GDFA 2K9ZA 1ZX5A 2AUYA 3AKQA 3CJXA 3LA3A 4QB1A 3ZYBA 4EN0A 2W1QA 1B35C 2FHRA 4XQDA 2JKBA 2QZ2A 1PZ9A 1H8TA 2PTMA 1NY72 2RDSA 4FFIA 4JKKA 4R9CA 5T3NA 4NIIA 4COWA 1LULA 2GP3A 2YPJA 1XSRA 3VKFC 4B4RA 4DQAA 4L8QA 3WQ1A 3E5QA 3ZO0B 4CEYA 1ZYBA 1RUG2 2VZUA 2D98A 1JUIA 1O91A 5B2GB 3KHBA 2WNUA 4XFFA 4PT6A 4R52A 2HEYF 3RJRA 1ZRDA 5A3PA 4IGQA 1H6YA 3T2QA 4HVOA 4Y20A 1NOVA 5LBFA 5GJ6A 4JQRA 5K0UB 2Q0AA 1D2SA 1D4VB 4D6RA 1NAEA 2R073 1I6XA 1PO12 1LOBA 2E63A 5GZDA 1FMD2 1JYVA 4IE0A 3NV2A 2D97A 1NY71 1CESA 4IEWA 3AXDA 2OZ6A 3I2HA 4MUVA 3BODA 3AP6A 1Y4WA 1J83A 1VJ2A 4N9IA 5JOZA 5FJKA 5A32A 1RUG1 1ZM1A 2OX0A 1IPSA 3WF4A 3VZKA 4OUMA 5A3WA 1K12A 3GZTB 4B7KA 1X50A 3K75B 4GD4A 4IEXA 3ZDSA 4XACA 5A70A 4UW5A 2WAAA 3EYPA 5A6YA 1V6OA 1S0IA 1Y3TA 4PDWB 2WYSA 1VIWB 3JZVA 4LO7A 3P3PA 1PZ8A 1OLMA 4YW1A 1PO11 5FQ0A 2OW4A 4JGZA 1MZEA 4C1XA 5EHDA 1ULEA 4Q0VA 4GJYA 2DU0A 3N36A 3PMEA 1LCLA 3IM0A 4PF5A 2B9VA 5E6HA 1GWKA 2AACA 1TVGA 2YGLA 3MHZA 1RUF3 1DLCA 4HONA 1W3XA 1QOOA 1GWLA 4QU2A 3WQ0A 2ZKNA 2J1UA 2DVBA 4S2DA 1BZWA 1R082 2WIIB 1IKQA 5FBJA 3T4HB 1LB2A 4JHTA 3NJZA 1UZWA 1JI6A 4P00B 5ANQA 1VB2A 1WMEA 1ZREA 4XBLA 1PMIA 1ZRFA 3I2KA 2YPDA 3ZFGC 3PVEA 3ZFFB 3LSDA 1SFPA 1UF2C 2MNGA 3J7LA 1DU3D 3WHTA 1AHSA 4NWWA 5FZFA 3N4MA 1JHNA 1OLME 2G9ZA 5FZ7A 4O9EA 5A6ZA 3ZSLA 1DGWX 2VOXA 4LHKA 5FK8A 2XVKA 5CADA 1XU2A 5A3MA 1YFXA 4FP2A 2OXBA 3NKTA 3Q9OA 3N35A 4Q26A 4QWNA 1S55A 5KHJA 2H6BA 4CDUC 2JECA 1V9U3 2LM3A 3MLJA 3OTFA 3R0RA 4XTPA 5EP9A 1RUF2 3NAPA 1R081 2E33A 4Q1RA 2GC1A 2PFWA 4GJZA 2ORZA 3USUA 5EWSA 1AR92 2BBAA 2VOWA 2BW8A 5JR2A 5GZFA 5FO7B 2VNOA 1JZ4A 1FV3A 3WP3A 5CG8A 1A6CA 2ARBA 3BPSA 4UYBA 1BHGA 2D5HA 1OUSA 4LITA 1U5XA 3THPA 3CJIA 3GZAA 4FPEA 3N9PA 4E4SA 3BTZA 4D6SA 1QDCA 4EN7B 1O3TA 3ZYIB 2W95A 2ZGNA 3MICA 2JDHA 2EXIA 1SBDA 4OVEA 2CY6A 4CXXA 4FTBA 2ZABA 4LBQA 1UZZA 1U12A 3GBWA 1IS4A 3B9IA 3LQCA 4FPLA 4HFSA 4UWDA 5IK4A 1RUF1 1YQ8A 2QVSB 1JOPA 2BZDA 1OA4A 3DXTA 4K20A 3DV8A 4ZZ8A 1UY2A 1AR91 4AFAA 3RZKA 4R9BA 2A75A 4BM8A 5JAXA 4MO3M 4CDQC 2QDRA 2WT2A 3U75A 1U0AA 2ZMNA 3U07A 4W50A 5FUNA 1DYKA 3KQRA 4EQVA 2ZHKA 4RQPC 1CAWB 1N1TA 2VMFA 1W28A 4FSJA 2YY1A 4XF1A 3MPBA 4QHOA 1RUC3 1NXD1 2B46X 4XF4A 4M0HA 4ASKA 1EAH2 1MS3A 1S0FA 3PUQA 4AEDC 2JKXA 5L7OB 1ENQA 3A4UA 3M3QA 3WNPA 1W0PA 4J6GA 4NIAA 3CMGA 5F32A 2VUDA 1W6PB 4Q4V3 1V9U1 1I5ZA 1CAXA 2JXAA 2QQNA 3DF0A 3SH3A 5L7OC 3JQWA 1Q8OA 2OZJA 1EPWA 5C8CB 1JZ7A 2W87A 1W9YA 3LDBA 4PI0A 4JX0A 1SPPA 2WQ4A 4XJZA 4A44A 4XF3A 5FOBB 1YNAA 1WW6A 3ZPYA 4PIXA 3OYWB 3H8RA 4PBOA 1S0JA 4A7KA 2XJRA 4S2FA 5FK7A 3PUHA 2QQMA 3O1OA 1WMDA 2Y0IA 3S5AA 4ZXKA 2WFF2 3NNFA 2A6WA 4CU7A 3JUUA 3LGRA 3ENRA 1KJRA 3GZEA 4AQ6A 1DYPA 5C3QA 1TMF3 2VXJA 4XOGA 2J42A 1EAH1 2QKDA 2LROA 3NNMA 4JGYC 4L92A 1US3A 5FP3A 2EA7A 2IWGB 5DDJ3 3RPQA 1S0CA 2WLPA 4PLMA 1XNTA 2A3WA 5JLVA 4JTOA 1OURA 3S30A 3URFA 4TXWA 4ZZ5A 5EIYB 2R0FA 5HCBA 2WT1A 2HEWF 4YWAA 4QQPA 2IXKA 4Q4V2 3OD0A 1RC6A 2LS6A 4PQ9A 3VBHC 3ZSMA 1GKBA 5HBAA 3VDCA 2DFBA 4XF9A 4QKDA 5AFBA 5IFTA 5FY4A 4PF1A 4QM9A 4W65A 5I0UA 3DPRA 2R7EB 2DCYA 2OS2A 4BCUA 5IYYA 3NO8A 3H1WA 3KZ4C 1PX3A 3K4DA 3RFRA 4HKLA 1K3IA 3T0DA 3E6BA 5FUPA 3TBDA 1FT9A 1WCSA 3O14A 4XHBA 4EWEA 1FX5A 1RXFA 1RUC1 3WINE 1A8MA 1TMF2 4TN7A 4YSFA 1PK6A 4WVZA 3SH4A 4HETA 3BPZA 4IL7A 4MGQA 3BU7A 1NE6A 4LLFA 1ODNA 4P9IA 1PGW2 2AZ5A 5DDJ2 3E5UA 2JB4A 4WZCA 3KS7A 3DYMA 2JD9A 4LKEA 2Q30A 4Q4V1 2C9KA 1DGLA 1ULDA 3JXSA 4N53C 5A1AA 4XDQA
chains in the Genus database with same CATH topology
1QNYA 5A33B 1UU5A 1WCKA 2VULA 4Y1UA 3ROUA 2WA4A 4GIQA 3HMYA 2JG9B 4ISQA 2WNVB 4AGRA 3VHRA 3SLIA 4QGNA 5FFOC 3VKMA 2W68A 3RS6A 4KQ7A 1TMF1 1SFYA 3JBG3 1BKZA 2CGOA 1LHVA 2JG9C 2WNVC 1Q8VA 1BYHA 2E7AA 3POYA 5JSPA 1KS4A 3I4IA 2ZGQA 3IIAA 1U5YA 4QPGB 5DDJ1 1PGW1 4U2AA 4OHWA 4HVRA 3HIFA 4HT1T 4RS5A 3ES1A 2Z42A 2KA3A 5CIRA 4H7MA 4HKOA 1VLNA 4P9LA 4P9WA 2DCKA 4LEJA 1DGRA 3FX3A 1RHI3 2P3KA 2CWMA 3W9AA 1PIV2 1ULFA 2R30A 4CEWA 3VUOA 5LK5A 4MXVA 1ALYA 2LUWA 4FVVA 1VBB3 2RJLA 3MIDA 1PO22 3FUOA 4Q4X3 4UBHA 2DWRA 4SLIA 3QD6A 1GV9A 1RUJ3 2EXJA 1Z78A 4QQHA 1WBFA 1HQLA 4AI1A 1W6MB 4XFAA 1UAIA 1QH7A 3S7IA 2B8MA 2HYKA 4IEZA 1QJX2 3WY6A 3V65A 3MPPG 5L36A 3RJ2X 1ASJ3 1RUD2 4OLLA 1LOAA 1RJ8A 2X53S 5DUWA 4PBPA 2BWCA 3USUA 1WD4A 2UU8A 1S0EA 2AH2A 1H9WA 1ZBA3 4FTSA 3SCHA 1RHI2 2WL1A 4XHXA 2WLQA 1AR72 2ZX0A 1H8TB 4YVWA 1VBB2 4YRDA 4XXAA 3JBG1 3OGGA 1RUJ2 4CEYB 1BBT3 5I0TA 1VAMA 4OHYA 4OHVA 4NN0A 5KC6A 2QE3A 2GSYA 4EROA 3S6PA 1DQ4A 2TEPA 4AI0A 1DZRA 3MIEA 3TB0A 4COYA 2RJKA 4Y20B 3BALA 5CFCA 3MEPA 2WNUC 3TN92 2A73B 2SBAA 3ZXEA 1RHI1 3V0AA 1ND3C 4F3JA 1UU6A 1ZBA2 3VBRA 1VBA2 3FZ3A 2H0VA 3MIFA 3AZWA 2D43A 2VECA 3TAYA 1NZCA 1VBB1 2PHUA 4Q4X1 1FOD3 2PAMA 2DU1A 2ES3A 1RUJ1 1RVF3 1LGBA 2DF7A 4Q29A 5A32B 1IS5A 3AJZA 4Z92B 2F4PA 3H3UA 4AF9A 4C90A 2GNTA 3AKSA 3MF9A 5JIUA 2WWSA 1OFSA 1PNFA 2PLV3 1ASJ1 1H8VA 5FLHA 2QQPA 1NCQA 4YFZA 1YJKA 1ZBA1 1AYN3 5FQ0B 4YW4A 3S7EA 2ZA9A 4JGZB 3RG0A 1RITA 3ATGA 1H9PA 3AKPA 2D3RA 5H9SA 1GBGA 5CFDC 4KG8A 1YXWA 1MZFA 4XMIA 5FOJB 1J3PA 3APBA 3C2UA 4EN9B 4YVSC 2JE7A 4E2GA 1RVF2 2WT0A 1LOCA 3BCWA 1KFXL 3OGJA 1BBT1 2ILMA 1AX2A 3VZLA 2NN8A 3RWNA 4B3NA 3VBFA 3SITA 1F2NA 3WW2A 3AFGA 3UV9A 1J1TA 2XLGA 4K6BA 4CDWA 1OOPA 1GANA 4LT5A 3B01A 1FYUA 4LBMA 3ACLA 3QH7A 1SLAA 1XYNA 4HSJA 1R1A3 3EXUA 3RYRA 1LRHA 4OHZA 1S1AA 3KLSA 3WHUA 1HRI3 5BNNA 1FOD1 5KXEA 1XNBA 2D6NA 2RS53 4K21A 1RVF1 2SLIA 5DZGA 3NAPB 3ZN6A 3PLQA 1ZZ7A 2A70A 5F5QA 4LO8A 1ND2C 1VBD2 3KD4A 3QH6A 1XNKA 2GC2A 3FHIB 1JYIA 4NVPA 3IDEA 1V6JA 2PLV1 3KGZA 1FI2A 4YGDA 4DS0A 1SLCA 2G4IA 2XL7A 5H9QA 3IN9A 2X5IA 4LA2A 2CL2A 1ENRA 4NR1A 5CA6A 5EFUA 2AREA 1AYN1 3MI8A 2E6VA 4PLOA 3CJIB 3UL2A 3INAA 3ZMNA 4FOVA 1EY2A 4Q2FA 4LBQB 1IPJA 4TWTA 4XJ8A 1K5MC 2VG9A 1OD5A 4YNIA 2NM1A 4F83A 1PGL1 1HRI2 4IEPA 3IWZA 3M1HA 1REEA 2DFCA 1JUHA 2BUKA 3MFAA 2OUHA 2VGDA 4JAAA 3VDDC 3WDWA 1RUE2 3ELNA 1LOFC 1V6KA 4WM8C 4XFIA 2R6QA 2OIIA 1MS0A 1V6IA 1LOGA 4BHPA 4BZ4A 1ZZ6A 4GULA 4G4FA 3UKVA 1WW5A 3DL3A 3SHRA 4TZDA 1UX6A 5HCFA 5IUQA 4C0HA 1R1A1 1RB8G 2JDZA 1DGRN 3D8CA 4RR3C 1HRI1 1O4YA 1CAXB 2RS51 4UW3A 2I45A 4YZ1A 4Q4W3 4ZU4A 1AJOA 2WZPP 3WG1A 3NWKA 3DKWA 3ME2A 4DY3A 1AXYA 1JW6A 2W08A 4D3WA 1UZYA 2DVGA 5JOXA 4I01A 4YW5A 1O3QA 2VW2A 1KJLA 1CPMA 2JX9A 4LBJA 5E88A 1Q8QA 2GC3A 3WOGA 1SACA 5LRSA 4FXKB 4XIOA 3JQXA 3VBUA 3VBSC 3PMSA 3AK0A 3ZXFA 5JZGC 4FOQA 2XUMA 2YUEA 1DLLA 5LEJA 2MHFA 2P34A 1C1LA 2XH6A 1QMJA 3DPRB 2VVDA 2A6XA 1SFNA 1MS5A 4MX3A 5I8YA 4WVVA 2DUQA 4FT8A 1WLTA 5TSWA 4GKXA 4Q1PA 1KITA 3DPRC 4QQLA 4UXAA 4A7ZA 2RR13 3O7OA 3JCIA 2HKXA 1PK6B 2WFPA 4RFT0 1N1VA 4R4XA 4XILA 4P5HA 1OLQA 1JTZX 4INDA 4XF0A 1PVC2 2XLFA 1RTVA 4MH0E 4Q4W1 4TSVA 1WA4A 3FWEA 3IPVA 1RUH3 3T1MA 1Q5OA 1MEC2 4I0WB 1SCRA 2CAUA 4A2UA 1IOAA 4V1PA 3MDPA 4LTAA 1CIWA 2TUNA 4P9JA 3JD72 4XXPA 1H1IA 2VW0A 1VP6A 2RR12 3N7LA 4QPYA 1N3QA 2ZGRA 3AKTA 3KT1A 4XZPA 1YIPA 1HRV2 1X36A 3EBRA 3WW3A 1NLSA 1FMD3 4RS5B 1YCIA 2VY0A 1L3JA 4LUKA 4MSVA 3T2TA 3USSA 1N3OA 3CLPA 4XFHA 4COZA 4IV1A 1U5IA 1FAYA 1RUH2 4CEWB 2ZOEB 1UW8A 4BYYA 5ABJA 1WLWA 1CQ9A 4HK9A 4H14A 5CB7A 4I0AA 3SCFA 3V64A 4XPVA 2ZMKA 2PN5A 2RR11 4MGIE 3POSA 2R063 5KXDA 5I91A 1VRH3 1TQ5A 3ZYPA 1VBE3 4HKWA 1XE7A 2UYBA 2EALA 4O9GA 1QKQA 4EJRA 1YLLA 2GNMA 2A7AA 4CZSA 3USUB 1LR5A 5K0UC 4DMIA 1G7YA 2TNFA 2X8KA 4K1ZA 2UYAA 3H3ZA 1GQGA 1RUH1 2R1BA 1I9RA 3JB4C 2NLRA 1R083 4YARA 3L2HA 4BPZA 3CEWA 4Y5Z0 4YVWB 3M2MA 1RUOA 3G7DA 4N90A 1RGSA 3AMQA 5JOYA 3KSCA 4HLTA 1OQEA 2KM2A 2NPIA 1CAVA 3IDCB 2R062 2R043 4BH9A 1VRH2 4HN0A 2DUPA 1X8MA 1VBE2 4AG4A 1FMD1 4L11A 4YM3A 1QXJA 5AFEA 4WM7A 4OI0A 5I8SA 4PDWC 5EYXA 2Y38A 5CFCB 1SLIA 1RMU3 4JC1A 2CYFA 4EN6B 3V0AB 3PJQA 2RMU2 4LUMA 3VBRB 1QWRA 2A6ZA 2Z79A 5GZEA 5FLIA 4FPJA 1AR93 5CBLA 1X7NA 1QF3A 3VL9A 5JI9A 3NV4A 4YGBA 2D5FA 1H2MA 5BNOA 1OA3A 1UN1A 3SH5A 1CN1A 5LEKA 2R061 3MW3A 1AR63 1VRH1 1NLRA 2WJSA 3HT1A 1QY4A 1H4GA 3B9CA 1Q8SA 1VBE1 1ZZCA 2R042 1QOTA 3VHOA 4BIFA 5D8AA 1B09A 2HEVF 4XJWA 3FFQA 4AI8A 3ZFFC 2BFUS 4Q27A 2BNNA 4G3YC 1NCQB 4QPIA 1WGPA 4FQZA 1RMU2 3WDYA 1MZ6A 3LZZA 1GNHA 3EHKA 3PVBB 5D1IA 2GNDA 3ETQA 4QGMA 3MLKA 5JIAA 3BIWE 1C3HA 4KGGA 2CAVA 4CTEA 4DRRA 3RMYA 2ZMLA 3WG2A 2R0HA 4QX5A 2ZPXA 2R041 1AR62 3WXPA 1EAH3 4Y1VA 1HIXA 3VBFB 3N7MA 4JRAA 4LE4A 4ZU7A 5J96B 1EYBA 2D6KA 3U11A 5I93A 1RMU1 4CDWB 1OOPB 1OHFA 3WW1A 2RHPA 1NCRA 2ZGLA 4KNCA 1REFA 3LAGA 4LBQD 4CDWC 1OOPC 1LHWA 4D7TA 5BNNB 2WFF3 3ZN6B 2MPFA 1AR61 3ZVXA 5BNNC 4KH9A 2JICA 3UJOA 5J09A 3VHNA 1D0GA 2YGMA 4I3GA 1GZWA 4AI2A 4BE3A 4NO4A 1BMV2 2VXRA 2R1DA 2WSVA 1ULGA 2X5IB 3N7JA 3VHPA 2VVFA 3NL1A 1I1EA 3OBTA 4AVSA 2YV8A 2XHKA 2ZGUA 2X5IC 4HANA 2QDNA 4XBQA 4QXKA 2BVBA 2YDEA 4LLOA 1H30A 2YYOA 3EO6A 1G8WA 2CGPA 1J1LA 5C8CC 4DINB 3VKOA 4MZUA 4CRQA 2ZGMA 1WMFA 1WBLA 4S2GA 3ZSJA 1SEFA 2ERFA 1YWKA 2QCSB 4AQTA 1RUI2 3KGLA 2WA3A 1BJQA 2E7QA 1BMV1 3D82A 4Y1XA 4IV3A 4NHKA 5CNAA 3H1YA 1MVQA 1ZBE2 4LBOA 3WUDA 2XGXA 5DG2A 2XVLA 5C33A 4LA3A 3BTAA 2I07B 2UY9A 3R4DB 3ZFEA 1WW7A 4IETA 3FBMA 5T55A 1AX0A 4JDOA 2IXCA 5FLJA 3M3IA 4P9XA 1G9BA 2C5DA 2WFF1 1DGWA 4ASMB 3M7AA 1IKPA 2NZ9A 3GALA 4IEVA 5IK7A 4NPRA 4I0BA 5FRAA 4E27A 4YZ3A 4HN1A 1SBEA 1J3RA 5FMOS 4S2HA 4R9DA 1LHOA 2PHDA 2ZS6B 3ALQA 1PIV3 2D40A 4QM8A 3HN1A 4R8HA 2JENA 2IZWA 3VBUB 1HV1A 1PM7A 3OJBA 3SNMA 1GLHA 5GZCA 1DZQA 5IK8A 1PO23 3IDBB 1GFF2 1KS5A 4XQ4A 1BXHA 4KU8A 2B42B 1EV13 3WDUA 4E9KA 5H9PA 2XPJA 5GZGA 2GN3A 4Z1VA 1O3RA 1UIKA 1QJX3 2D6LX 1QNWA 3H9AA 4AVCA 4GMP0 3IT8A 4Z07A 4GB32 1IS6A 3U4XA 1RIRA 3O0VA 1RUD3 1OFNA 4DFSA 5BYNA 5GALA 2VU9A 1YRZA 4QPGC 1BCXA 2GH2A 4U36A 1KFUL 1NQJA 2WQZC 1CONA 1G9AA 4N43A 2XJTA 1YO8A 1AR73 1Z7S2 3MIBA 4AVBA 1MACA 5JR7B 1QHDA 2NQYA 3H1MA 4HSLA 3EQEA 3IPVB 1XYPA 4G9SB 4KL1A 1M06G 1QQP3 1EV12 4KWJA 3NKGA 5IK5A 2PHRA 2P3JA 3D0SA 3FLRA 3FC0A 4E2SA 1O3SA 1SLTA 4Q4Y3 1OQ1A 3CU7A 4AEMA 1QXRA 2XWJB 2AENA 2IXJA 3TN93 4XETA 3B3QE 5BNPA 1RINA 1C5IA 1PIV1 3HD8B 1UU4A 2JD4A 2RS33 5AC92 1VBA3 3MIGA 3M4FA 4PCRA 4BA6A 3MIHA 4H3WA 5JWPA 1DBNA 4D69A 1N3PA 1PO21 2XJQA 4Y1YA 2PAEA 4IV1B 1BEV2 1YFYA 1EV11 2VOVA 1NG0A 4P9YA 2OVUA 5ABJB 4MLOA 4P9GA 1HX6A 4AI3A 1H8TC 2PHLA 1F5FA 1QQP2 3R4UA 1T6GC 2HWF3 1ONAA 3O5SA 1QJX1 3P3NA 3OD4A 2ZX2A 3ST7A 5ABJC 1RUD1 2N7GA 1Y43B 2QFEA 3U10A 4CEYC 4Q4Y2 1MS9A 2EXKA 3VV1A 3GNEA 3AZVA 5GLUA 4D7SA 3J9SA 4L99A 4FP3A 3W58A 1AR71 3DGTA 2RS32 4AEJA 4W6YA 1BEV1 3LWCA 3RQ0A 3FFZA 4IEYA 4IEQA 4AW7A 4X6RB 2FZ2A 1QQP1 2OA2A 3O0WA 3JU9A 2ZGSA 3ECQA 3GF6A 3V56A 1C8M3 1OI6A 2HWF2 1C8NA 2HWD3 4XEZA 2MEV2 2I2SA 1G9DA 4Q4Y1 5CAZA 1C4RA 1CAVB 2XVGA 3ZFGA 3TN91 3K48A 2ET7A 2YHJA 3AMNA 1ULCA 2RS31 1VBA1 4K9SA 3WD5A 1FPN2 3FJSA 1GICA 3I8TA 4QD2A 4WM7B 5C4WA 1REDA 3ZIWA 3O12A 2P2KA 2A3XA 5J7MA 4HPKA 2O8OA 3PVOA 1AR82 4JGZC 2GMEA 3ZX7A 1LENA 2JJ6A 3ZXGA 5J98B 3B94A 4CDUA 4OZXA 3A0KA 1VBD3 4JTNA 2HWF1 5L73A 4YYOA 4I3PA 4WVWA 1VAKA 1UPIA 1E57A 1C8M2 3R4SA 5BNOB 2HWD2 3QCWA 4GMP3 1J58A 4YLZA 2A6VA 4CDXA 1NA1A 1J59A 4I09A 1O5UA 5D8AB 5BNOC 4XJ9A 1AF9A 4WVMA 4YW3A 3OBRA 2ZX3A 1NXMA 4OI4A 3M3CA 1DHKB 1TNFA 4QPIB 2BTVC 2ZHNA 3LOIA 1F31A 4HK8A 3D4KA 3FUQA 3VZNA 5IT6A 1HXS2 1W2UA 3PVNA 1KXGA 1QU0A 1C8M1 1RUE3 2HWD1 3NAPC 4CDQA 1YYNA 2VPVA 1OQDA 4WZFA 1R093 1TME3 2GH8A 4RQPA 4FPYA 5LRRA 4I2OA 1WUVA 1M4WA 3WV6A 5JVVA 1O4TA 2XG3A 4AEDA 3CJIC 4UW6A