1CIWA

Peanut lectin complexed with n-acetyllactosamine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PROTEIN (PEANUT LECTIN)
publication title Structures of the complexes of peanut lectin with methyl-beta-galactose and N-acetyllactosamine and a comparative study of carbohydrate binding in Gal/GalNAc-specific legume lectins.
pubmed doi rcsb
total genus 54
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ciwA00
5DG1A 2A6YA 2W52A 1S1AA 1HKDA 3NV2A 2W39A 3WOGA 1HLCA 2P37A 1DLLA 3AP4A 4IQPA 4P9YA 4FPLA 5GLZA 3ZXEA 4AGGA 1FNZA 2ZKNA 2ZABA 4CTEA 5KXDA 2WT1A 3WVJA 2ZGPA 4L8QA 4Q8LA 5FRAA 4ATEA 2W08A 4FPGA 3SH4A 1QF3A 2ERFA 4ZKTB 1CVNA 1YYNA 2JJ6A 1VLNA 3VV1A 2AR6A 2ZGSA 3WDVA 2D3RA 1V6IA 3LCPA 3B3QE 1LTEA 2E7QA 4R9CA 5IK7A 2ARXA 5T55A 2ES3A 1VAMA 3QLQA 4AYUA 1GNZA 3B01A 1D0HA 1W6NB 4K1ZA 4ASMB 2UWBA 4Q1RA 3T2TA 5E88A 2RHPA 1LHNA 4YG3A 3OBRA 4Y1XA 1SLAA 4M3CE 5IT6A 1D2SA 4UW3A 1UL9A 1QOSA 1AX0A 5GLWA 3UJQA 2DTWA 4C1XA 2ZHMA 3B9CA 4WZFA 4BMBA 1A8DA 1W6MA 2ZGOA 3RG0A 2NZ9A 4Y24A 3AP9A 4DRVA 5JMCA 4Y20B 1LHOA 3WNXA 4FOQA 4FQ4A 1N1SA 4XYXA 2KM2A 5LK5A 1SLLA 3AXEA 2UWAA 3FUQA 2V5YA 3PMEA 2P3IA 2B7YA 4YGBA 2WQZC 3NWKA 2ZAAA 3O12A 4XJWA 4LBOA 3M2MA 3AZYA 3NV1A 4BM8A 2VXRA 1DGLA 4XMAA 4TZDA 2D6PA 4Q2FA 2YY1A 1S0BA 4XJ8A 1AJKA 4DFSA 2H0BA 4YZ5A 1Q56A 4XZPA 3AZWA 3FUOA 4FPCA 1IS5A 3LSEA 1DYKA 4JRAA 1VAVA 5HCFA 2GDFA 4K21A 4Y22A 4PBPA 3ZYRA 4Y1UA 3OYWA 3U4XA 4ISRA 3ASIA 4XIKA 1JYIA 4R9BA 2NMNA 2Q5TA 4Y1ZA 4CRQA 1G9AA 4KBBA 1SACA 4YW5A 1HDKA 1KITA 1MS0A 5KXEA 2AGSA 1AF9A 2EIGA 1GSLA 1RIRA 2NMOA 5GZGA 4P14A 1LOEA 1G9FA 4GALA 2EF6A 3WHTA 3SH3A 5DG2A 3V0BA 2CWSA 2A6ZA 2ZACA 1W0OA 1GZ9A 3O0VA 3O5SA 2VY0A 2V73A 3T1MA 2GNMA 1GLHA 3LSDA 4LBKA 3R05A 2ZMLA 4PF5A 4ATFA 1V6JA 1NLSA 2PHXA 4WVVA 3ILNA 1IOAA 2FMDA 1XQNA 2PELA 2XG3A 1W6MB 2R0FA 3M3EA 1GZWA 4H55A 4FPYA 4I30A 2EXIA 3NV3A 4P9WA 2UWCA 1I3HA 1F5FA 3VKFC 4GWMA 4YM0A 3WZ1A 1S0GA 2ZZJA 2ZGLA 2A6WA 1SCSA 3MPPG 5JOYA 1W6QB 1S0IA 1SLTA 1WLDA 1SBFA 2WSVA 3ZSMA 2D6LX 4XBNA 1IKQA 4XMIA 3M3OA 5T5LA 3M3CA 1LGBA 1WCSA 2ARBA 2AYHA 4NO4A 5IK5A 1HQWA 1S0EA 1MZ5A 1QNYA 4LBQA 1KDMA 1V00A 2G4IA 5EYYA 5GLTA 4YG0A 3V65A 4XOGA 3V0AA 2CWMA 3A0KA 1VALA 1KRIA 3B00A 1QDOA 2DVBA 4YGEA 5JVVA 1JYCA 1W6PA 4Y22B 3WDXA 1WD4A 2ZGTA 4XHBA 1QDCA 1S0JA 5DUWA 1UKGA 2GALA 1GV9A 3FLPA 1F9KA 2JKBA 5IK8A 1QGLA 1UZZA 1ONAA 4YW4A 2GMPA 4DRRA 5CAZA 3N36A 1LOGA 1Y7BA 3MW3A 4JCKA 4FPEA 1CIWA 3RMYA 2ZBJA 1ZM1A 3JU9A 1H9WA 1N1TA 2TEPA 2D3PA 3AZVA 3BIWE 2CL2A 3V64A 2CNAA 2EXJA 3IM0A 1LHUA 2CY6A 4YM3A 4FQZA 2EALA 2WNEA 3V0BB 1H30A 1VIWB 4AGRA 1BYHA 3GNEA 3WG1A 5GZEA 2P2KA 2GNTA 5JLVA 2W68A 1V6NA 1BZWA 1S0CA 3ILFA 3AYDA 1UX6A 1ULDA 2ZMKA 2YV8A 5H9PA 4Q8KA 3JUUA 1FV2A 1URXA 5DUVA 5GJ6A 1LCLA 3AP6A 4FOWA 3POWA 1MS9A 3N7MA 1CJPA 3D6EA 3ZVXA 2DVGA 1JXNA 1LU1A 2SLIA 1H9PA 3RQ0A 2P34A 4FPKA 5T54A 1GICA 2A71A 1W6OA 1CESA 2D44A 4MYEA 4XJZA 4CZSA 3H0OA 3PVEA 1LODA 2JD4A 3BTAA 1CR7A 1IS4A 1G7YA 3MW2A 1A3KA 1F31A 4YW1A 1DBNA 1QMJA 3AP7A 3DUIA 1DZQA 1G9DA 3AYAA 2GNDA 4LBQB 2VW2A 4Q1PA 3I4IA 1DQ0A 3PVOA 4LBQD 1ULCA 1LOCA 4M3CF 2ZMNA 3USUA 4YG6A 2D43A 3V0AB 1LENA 4GWNA 5KXBA 5IUQA 4HANA 1WUVA 4BOWA 1AXZA 1JHNA 1MR5A 2DUQA 2NN8A 1W6PB 3N7LA 5IK4A 4XJAA 3AXDA 2R0HA 4Q26A 2NP0A 2ZGUA 2ZGMA 1WBLA 2WT2A 4YGCA 1QOTA 2EAKA 3RMXA 3KQRA 3IPVA 5DUXA 2WSUA 4XTMA 1SLIA 2GNBA 4D69A 2R1BA 5FREA 4YZ2A 5T5PA 1Q8PA 1V6LA 2C9AA 5CNAA 3VKLA 3WCRA 3A0NA 3WDTA 1BQPA 2D6MA 3TB0A 4R9DA 4DS0A 4FPHA 1UAIA 1N3QA 3AK0A 3BODA 2DV9A 1KQRA 5JDBA 1MS1A 2A3YA 4M00A 4TYSA 1JUIA 1YXWA 3AZXA 2DYCA 2VU9A 3UL2A 3ZYPA 5EXOA 3PVNA 3KM5A 2DVDA 1BJQA 1WLWA 4GXLA 4LBJA 4YLZA 1N3OA 1CONA 1QKQA 3C2UA 1OFSA 1PZ9A 4FP2A 2PHTA 1AVBA 1HQLA 2A7AA 2E6VA 3ZSJA 2D6NA 1LU2A 2A70A 4WV8A 5CA6A 3A4UA 1S0DA 1QU0A 5T5OA 4AVVA 1W6OB 4P9XA 2SBAA 4U2AA 3D4KA 1ZA4A 1IKPA 2ZGKA 4FPOB 4XXAA 1GZCA 1DQ2A 1BXHA 3OY8A 1UN1A 2ZGQA 3ZXJA 4Y26A 4XE9A 3FLRA 4YW3A 2LALA 4K1YA 1C1FA 2C5DA 5GLUA 3WDYA 4AGVA 3HMYA 4Y1VA 1ENRA 2CTVA 3OBTA 1AXYA 2DU1A 1AZDA 4YFWA 1DIWA 4XDQA 1W6NA 3WG4A 1MVEA 3AX4A 1DYPA 4GA9A 5DZFA 3WDUA 4F83A 3USUB 1SBDA 4XXPA 1MACA 1V6MA 3SLIA 1R1ZA 2CYFA 4NOTA 3VKOA 2A75A 1YIFA 3AYEA 3WV6A 1LEMA 2GN7A 1LJ7A 3WUDA 2ZHLA 1G86A 1LOBA 4XBLA 5T52A 3W59A 5F5QA 1WW4A 3VUOA 4XBQA 5EYXA 3FFZA 1KDKA 4M01A 5JOZA 4YM1A 4Q27A 1BKZA 1SCRA 3OYWB 3APBA 1C4RA 1PZ7A 5T5JA 3HN1A 3AP5A 3Q9OA 1J1TA 1ULFA 1CPMA 1SLCA 2R1DA 2DTYA 1GANA 4YM2A 3ZPYA 2GMMA 5EWSA 2E7TA 1CN1A 3QCWA 1AX2A 3AJYA 2LTNA 5SV8A 1GNHA 2A6XA 3R4SA 2WKKA 3SNMA 1DHKB 3ZSLA 3FBYA 2WT0A 1WW6A 2ZGRA 3D5OA 1GBGA 1U0AA 1PZ8A 2ZGNA 3O0XA 1G9CA 4JC1A 4OZXA 5GZFA 2JE9A 3IKWA 2DVFA 1MS5A 2YMZA 3BOPA 3UK9A 3VKNA 3OPZA 2A3WA 4M3CA 4YZ3A 5DXDA 1ULEA 4FP3A 3WCSA 1NXD1 3N7KA 1FV3A 3WDWA 2NM1A 3INAA 1JW6A 1DFQA 1DQ4A 2DU0A 1GZWB 1I1EA 1KJLA 1TEIA 1G8WA 4YFZA 1AX1A 1LULA 4XHXA 2ZA9A 2NYYA 4AVSA 2VH9A 1KJRA 4YZ4A 5E89A 5DUUA 2PHWA 2PHFA 3FLTA 2E51A 2JDZA 3OY8B 3RS6A 5KXCA 3GALA 3MEPA 3SH5A 2E53A 4XTPA 3T1LA 1AJOA 2ZHNA 4PBOA 4PCRA 3I8TA 1V6KA 3OJBA 1LOFA 2FHRA 5L73A 1JOJA 1MS8A 1UMZA 1Z0HA 3PJQA 3VKMA 3ATGA 2VW0A 1LOAA 1JN2P 1GYKA 3POYA 4BMEA 1B09A 4SLIA 1ULGA 1DQ6A 2OW4A 5GLVA 1N3PA 1MS3A 3RSJA 3ZXFA 2VW1A 2XB6C 1GKBA 3DGTA 1G9BA 1Z78A 1QOOA 1LESA 2AH2A 2D6OX 4U36A 3TAYA 2AREA 3WHUA 3ZXLA 3R4UA 1IS3A 1S0FA 1LECA 1Q8OA 5HCBA 1DQ5A 3AJZA 4LBMA 4XILA 3WUCA 3O0WA 4HL0A 1FX5A 1FATA 1W6QA 4FOYA 1V6OA 4XIOA 4Y1YA 2R16A 3W58A 5H9RA 1YO8A 1MVQA 1WW5A 1YRZA 2P3JA 4ZXKA 4BLIA 2ZHKA 1FAYA 2JECA 5CB7A 4YGDA 2WJSA 4Z8BA 2Z42A 1UZYA 4YZ1A 4C1WA 3WG2A 4ITCA 5GZCA 1EPWA 4GKXA 5CBLA 2DVAA 2PHRA 4XJUA 2YZ4A 1UPSA 3B69A 1Q8SA 4UW6A 3N35A 1AXKA 4FPFA 1MS4A 4RL7A 4M3CB 4DPNA 1LHWA 4PQ9A 4W65A 4BLJA 2VUAA 4ISQA 3ENRA 1QNWA 1RINA 5HCAA 2D3SA 3NV4A 5JOWA 2GMEA 5T50A 3WG3A 4AWDA 1WW7A 2AUYA 4LBNA 4UW4A 1FNYA 4LBLA 4BQ1A 1LGNA 4RA0A 1N47A 1MZ6A 1O4YA 1N1YA 3OGGA 4UW5A 1LGCA 1W0PA 3WLUA 2R49A 2HYKA 2OUJA 1N1VA 5DZGA 5AVAA 3AFKA 1APNA 4BPZA 5F9TA 1O4ZA 3ZXKA 3UJOA 2ENRA 1LEDA 1LHVA 1Q8VA 2A5ZA 1FYUA 4FVVA 1OQ1A 2DUOA 3IMNA 5JOXA 5BYNA 3SITA 3ZSKA 2D7FA 2D6KA 2WLQA 1DQ1A 2YXSA 2DWRA 4YW2A 2UU8A 1JBCA 2EXHA 1C57A 3SISA 2YROA 1ENQA 2OUHA 3RRDA 2UURA 2DUPA 1WLCA 4WVWA 1Q8QA 1CPNA 4K20A 1C1LA 3MW4A 5E8AA 1SBEA 2EXKA 5GALA 4Y20A 1LOFC 3IPVB 4R9AA 2GN3A 1OKQA 4AVTA 1ENSA 1X50A 3M1HA 1IS6A 5H9SA 2DURA 2A6VA 2I2SA 1A78A 3L2YA 3POSA 3AZZA 3N3HA 1SFYA 1YI7A 5GZDA 4DQAA 3M3QA 2AENA 3ILRA 5DZEA 2JE7A 2A3XA 3CNAA 3N7JA 3IN9A 4XJ9A 4GKYA 2OVUA 4FPJA 5H9QA 2P3KA 2BQPA 3AYCA 4FOVA 1RITA 1CQ9A 2PHUA 1SLBA 3HR9A 5GM0A 1WD3A 1WBFA
chains in the Genus database with same CATH superfamily
5DG1A 2A6YA 2X29A 4BIOA 1HKDA 1RUF3 3AP4A 4FPLA 4K40A 1PGW1 1UY2A 2P5BA 4LR4A 1VBB2 1E5HA 4LO8A 2ZKNA 1PHMA 3ETPA 4PHZA 3T3YA 3BU0A 1K42A 3VD5A 5KXDA 2MEV1 4Q8LA 1SG3A 3SH4A 1QF3A 5FZKA 1CVNA 2Q1FA 4ZPIA 4CCMA 1JS9A 2ZGSA 2VCBA 3WDVA 2BNNA 3NRUA 3B3QE 3K51A 3VBFA 2YYOA 1TME1 3CBNA 3NAPA 1W9YA 2W91A 5FUNA 2HJIA 1OOPA 3H7YA 4K1ZA 4ASMB 4BA6A 3FHIB 2RHPA 2XJTA 4CU6A 1SLAA 4CCEA 1EPZA 1UZ0A 2ZOEB 1AX0A 1NA1B 2B9VA 5LZ6A 3GCXA 4CCDA 2OYZA 1BK0A 1A8DA 4HT1T 2NZ9A 4AZZA 2OT7A 4FXGB 2X09A 1ND3B 4NPMA 2JWPA 4A2UA 2XL7A 1ZREA 4IV1C 4FOQA 4GAZA 3LOBA 3T2PA 4XYXA 5JR7B 2OQ7A 2E32A 4R52A 3AKQA 2VMCA 2ARAA 3AXEA 5A1LA 2ZXQA 2TNFA 4A6OA 1BEV3 3FUQA 2V4AA 4MXVA 4AHZA 5BUVA 5LBFA 3VBUA 2Y6JA 4NJ4A 2VUCA 3PMEA 3WD5A 5L19A 3GYDA 1AL0G 2RS33 2RVAA 3DYMA 2ZAAA 3O12A 3I2OA 1WA6X 3MIDA 1DF0A 1NA1C 2WUHA 3DPRB 3VDDB 2D6PA 2JG9C 5FZLA 2XR4A 3WNKA 1CAXB 4GB31 5I91A 4UI9L 1GP4A 5FUPA 2RR12 3WNMA 2LUWA 2ORZA 4KWKA 3ELNA 3FUOA 1YQ8A 5J96B 1R1A2 1XNDA 5F2SA 3LSEA 5HCFA 1UXZA 3H8OA 3J7NA 2XWBB 4DUWA 5FZHA 2PXJA 1CZVA 2E33A 4D7YA 2W46A 1TMF3 2VTXJ 4XF1A 1NY72 1YFWA 4NROA 5J98B 3VZKA 2WYSA 4EWAA 3RWKX 4IL7A 3U4XA 1RMU2 4R9BA 4UFHA 2OPKA 4D6SA 5DN2A 4FTBA 2GAUA 4W4ZA 5JXHA 4ZU7A 2Y8KA 1G9AA 2WO7A 4KBBA 4EE2A 3S7IA 1KITA 1F35A 5D21A 1D4M1 3CIHA 5G05L 3VDDC 1H8TB 5CKMA 5KXEA 2EIGA 3DXUA 1PMHX 2P3YA 2WA4A 4P14A 4WVMA 4XETA 4MGYE 3SH3A 5DQ0A 1XU2A 1XYNA 2PFWA 1W0OA 2ZACA 3O5SA 5FR3A 4HPKB 2V73A 3T1MA 2GNMA 4LBKA 3ZYJB 4A42A 5HI0A 2ZMLA 4PF5A 1V6JA 3MFAA 4QX0A 5K7PA 1OH4A 3AVSA 2PHXA 3OGSA 4L92A 3ILNA 4A7KA 1HV1A 4QKFA 2MHFA 2WFF2 3IDBB 2XG3A 4QAWA 3M3EA 4P9WA 4PDWB 1YFUA 3BTXA 3HEIA 5LATA 1RHI3 4Q4W1 5JIUA 1QQP3 1F5FA 3I2JA 3MUY1 4GWMA 4LLOA 3WZ1A 1NZCA 1AYM3 1RUNA 2ZZJA 2UY8A 2ZGLA 4IEZA 4CCLA 5JOYA 1H8TC 1W6QB 3KCYA 1D2QA 1HRI3 1WLDA 2B9UA 4ES8A 4XBNA 4XFFA 2JKXA 3ITQA 4XMIA 3WF0A 3M3OA 2R043 3I97A 2I45A 3QACA 1WA4A 4N53A 2G19A 3OPWA 1AL21 5A7QA 1S0EA 4AEDA 5CEHA 3MIEA 1V00A 2HLEA 1LR5A 4YG0A 3HBZA 1Z7S2 5FP4A 1KRIA 4FTSA 1VJ2A 4OHWA 1PNFA 2Q8CA 3M4FA 3EBRA 2EAAA 2QDRA 5ABJA 1W6PA 1UY0A 3T2OA 3J4UH 4DY5A 1HRI1 4E4SA 4HOOA 4W8JA 2GALA 3Q8BA 2VUJA 1FMD1 4RGGA 1QJU2 5FLIA 1POV0 1VBD3 1EAH3 2GMPA 3ZYBA 4DRRA 5AFEA 5CAZA 3GM8A 3PVBB 3N36A 4JCKA 2VOVA 5M0TA 1CIWA 1W39A 4DXSA 1PK6A 4BK4A 1ZM1A 3CMGA 3JU9A 2TEPA 4HSJA 4Y33A 3V64A 2CNAA 3IM0A 2DCTA 2GH2A 4RHV2 5K8SA 5LWBA 3RZMA 4LITA 3B5LB 4FQZA 4KNCA 1PGL1 2WNEA 1YQ5A 3ACGA 3DV8A 3TRSB 4COUA 3V0BB 3O1VA 3JB8A 1H0BA 4AEJA 1UU4A 1FOD1 3HVDA 2AEYA 2GNTA 4IGOA 2IXKA 1YUDA 2W68A 5JLVA 2W3JA 3ILFA 4Q4Y2 4S2FA 2BTVC 3LFMA 1UX6A 1ULDA 1JZ7A 1UMHA 2YV8A 1L7RA 2XHNA 5C9AB 4Q8KA 3JUUA 5FZGA 5JI7A 3ACHA 1G6NA 4FOWA 1MS9A 3MHZA 4XABA 2HWF3 1CJPA 4D6QA 1UZVA 4LKFA 3RQ0A 3VHNA 3LZZA 4FPKA 4DINB 1GICA 2A71A 1CESA 1RGSA 3C3VA 3KS7A 2WWJA 1LB2A 2XJRA 1LODA 4JHTA 4TLFA 2UY9A 5C8WA 4YSFA 1F31A 4C90A 1DBNA 2QZ3A 3JZVA 1COV3 1RUJ2 2XH6A 1QJFA 2YC2A 4LBQB 5KHHA 4KG8A 5FP8A 4Q1PA 4A6SA 5A33A 3RGBA 5EQUA 4CEYB 5C9AC 2RM23 1DQ0A 1HRV1 3HNMA 4D7SA 1ULCA 1F4HA 1YFYA 4GWIA 1WCUA 3USUA 2D43A 5A6QA 5IUQA 1RVF3 1WUVA 2XOMA 1JHNA 2C4XA 2NN8A 3N7LA 3DL3A 1NE4A 1BBT3 4YNIA 1VB2A 2HWB2 3E1F1 2NP0A 2H6CA 2ZGMA 1BMV1 4Q4X1 2C6SA 5FK7A 1QOTA 3U78A 2EAKA 4BE3A 2LROA 2WSUA 3KF3A 2GNBA 2R1BA 5FREA 1H4HA 5FYIA 2C9AA 5CNAA 3OUHA 4MZUA 1PVC3 3WDTA 3A0NA 1PVXA 1BQPA 1W2NA 4BZ4A 4CSWA 3E6CC 5B4NA 3TB0A 2GC0A 2Z5WA 2RS51 2IC1A 3I2KA 3AK0A 1RC6A 5FPLA 2ET7A 4XQDA 4A7ZA 4CEYC 1H1IA 1JODA 4M00A 5JDBA 3AL6A 5F6KA 1JUIA 2WS93 4P5YA 2QQJA 2RMU1 2VU9A 2FDFA 4PIZA 1HXS1 1FPN3 4NWWA 3IWZA 2R071 2W92A 3JCIA 1JTZX 5FO9B 3D0SA 1WLWA 2AZ5A 3POEA 4LBJA 2E31A 3GZAA 4YLZA 2XUMA 1C5HA 5APAA 4CDQB 3Q8AA 3C2UA 5C3QA 4A41A 1HQLA 3POIA 3O1UA 1ASJ3 2DCKA 3KV9A 4HETA 5JPNB 1VBA1 2Y34A 1LU2A 2A70A 2WZR1 1VBB3 5FAXA 2QBXA 4Q4V2 3MIBA 2W1WA 1S0DA 4IUGA 5T5OA 3RZGA 4U2AA 2WS91 3ZIXA 4E2QA 4NHXA 4ET7A 5FZ6A 5DDJ1 2WAAA 1K5MA 1RUG1 2OX0A 3LKJA 1OBNA 2ZGQA 3LQCA 1NQDA 4Y26A 5GLUA 1XE7A 2C5DA 3MGUA 3LEMA 3MLJA 4FAHA 2FBEA 3ORJA 5FK8A 2AACA 1AZDA 4AQTA 4IV3B 1W6NA 4Z2WA 4AE2A 3WDUA 5DZFA 3ECQA 3IAPA 4F83A 3KQ4B 2C0ZA 1GP5A 3SLIA 1PO13 1R1ZA 2Y38A 2QZ2A 5FYYA 4AK3A 4XUNA 4ARXA 3TEWA 3LIGA 5F5IA 3WV6A 5L7OB 2DBIA 2ZHLA 4BJ0A 3OEAA 4IE4A 3DYOA 3W59A 4XBQA 5EYXA 3FFZA 1KDKA 3FE5A 3WY6A 4Q27A 3AMNA 5EZWA 1C4RA 3HN1A 2HWC2 1AR81 4JKMA 4QX3A 1OF3A 4I3GA 4XAAA 5BNNC 5AC91 2DTYA 2JENA 4IV3C 5CIRA 5F5CA 3K48A 2E7TA 3QCWA 5EWSA 2CDPA 1AR93 2LTNA 4XURA 3ZSLA 1LRHA 4JTOA 2ZGRA 3D5OA 2YGLA 1YI9A 4HKWA 4QQLA 2B4KA 2V5DA 4JVAA 1O3QA 2ZGNA 3I2GA 4X6QB 4JC1A 1Q5OA 1RUH1 4OZXA 3WEZA 5I8TA 5FP3A 5FY9A 2O1QA 5L7OC 3BOPA 2HWD1 1TE1B 3PLQA 2MPFA 2RR13 3OPZA 3UKVA 2A3WA 3E6BA 4YZ3A 1POV3 3U10A 3L2HA 5LASA 3D8CA 1R1A3 3SC7X 3N7KA 5EV7A 1GWMA 1YCIA 5L36A 1AR62 1SPPB 1I1EA 2WO1A 4LKEA 3VD9A 1G8WA 2GC3A 3K4AA 2H6BA 1EUUA 1XB9A 1AX1A 2VO5A 5FZ8A 5EJZB 2ZA9A 4N90A 1AR91 4CDXA 4YZ4A 4RYDA 2PHFA 2HH9A 1VRBA 2E51A 2W0XA 4GJZA 5KXCA 3RJ2X 3SH5A 4XTPA 4RQPB 3VL8A 1AJOA 1OA3A 1W3XA 2ZHNA 3S0MA 3KV5A 1V6KA 1W03A 4LT5A 4JHZA 1JZ8A 1JOJA 1H6YA 3PJQA 4MXWA 3QOPA 3VKMA 2K46A 1GYKA 3ROUA 4BMEA 3U0ZA 4SLIA 1ULGA 4JDMA 1IHMA 3SCFA 4XF9A 1HQNA 1MS3A 4B8EA 5J36A 4IDZA 2VW1A 1GKBA 4FCAA 5FP7A 2AH2A 4E4HA 1LESA 1W8NA 4U36A 1E57A 4QPWA 1BK1A 2AREA 2WFF3 2Y0OA 3CZJA 3TAYA 3WW1A 5FZOB 3ZXLA 2F4LA 1LECA 1DQ5A 3AJZA 3N9QA 1UZWA 3WUCA 1L3JA 4EN0A 1FX5A 1FATA 5J37A 3I59B 4B4RA 3CO2A 5FMDA 1GWKA 1CIYA 4XIOA 5FKBA 4CEWA 1MVQA 4CP9B 2P3JA 4ZXKA 1H6XA 3B7MA 2JECA 5CB7A 2QKDA 4YGDA 5F5AA 4CCJA 1POQA 1UYPA 3SEEA 4C0BA 4YZ1A 3ZN6A 2XJQA 4ITCA 1QJY1 5J1XA 4GKXA 4LHNA 3T08A 2DVAA 3ZMNA 5FMCA 4B29A 2PHRA 3QBQA 3VKNA 5CBLA 5JPMB 2VMDA 4GH4C 4XF3A 1XC6A 3WF1A 4EV0A 3TYJA 3D0JA 4MHUA 4FPFA 3GHMA 4AI2A 3L9JT 1Z7S3 2P1BA 4UFMA 4PQ9A 5JXGA 4ISQA 4D3WA 4AVCA 1H2NA 2Z79A 3PNAA 4XACA 1UYYA 2VQUA 2VM9A 2OKXA 1ZRCA 3LDRA 5SV5A 3W5NA 3AB0A 3JD71 3WG3A 4AWDA 1WW7A 2AUYA 3BCWA 4QT6A 4LBLA 2X53S 4PQQA 3LEKA 1MZ6A 5JXJA 1N1YA 1QJU3 1VBC2 3EMRA 4WM7A 1W0PA 5JCTA 3H8UA 2PAMA 1B35B 2HBTA 3KT7A 4LJHA 2QVSB 2WR9A 4NIGA 5JSRA 2VZTA 4AQ6A 4RHV3 1L7QA 2JB4A 2WO2A 5C5UA 4META 5C6CA 3TNQA 1O5LA 3LDBA 5A3WA 4WM8B 3SITA 3ZSKA 2WLQA 4OI1A 1C8M2 4A3XA 4NHKA 2EVXA 4N8MA 2X5IA 4COWA 2O8OA 1CAWA 4IXLA 4LO6B 4Q4Y3 2OIIA 1NX9A 4HN0A 4S2HA 4YW2A 4CXXA 1C57A 3E97A 3MICA 2WA3A 1UO9A 4IE5A 3SCGA 4DO0A 4QGLA 2VGDA 3RRDA 2DUPA 2LW8A 2A1XA 5FY0A 4JZRA 1B35C 3THPA 1SBEA 3MIFA 5LCWL 2F6BA 3NNFA 1D7PM 1LOFC 3IPVB 4AVTA 2ORXA 2BOIA 3M1HA 4Y4RA 1QIQA 1I6XA 1W90A 4J6GA 1UYXA 4D94A 2I2SA 3L2YA 2WLPA 4QXKA 3AZZA 4WM8C 4AW7A 1YI7A 4AI0A 5C33A 2A73B 1U5XA 3M3QA 2DCJA 4DQAA 4OHYA 1D4M2 2C9KA 4HFSA 1RUJ3 1IG3A 2BZDA 2VUDA 4CDUA 3AKRA 1NCRB 1NG0A 4GKYA 4XJ9A 4DNYA 5BNPA 2P3KA 1O3RA 4I3PA 4ONUA 4QPIB 3I3EA 1R082 1RUI1 2QQIA 3LAGA 2WNVB 1UNBA 4P9GA 2PHUA 1SLBA 5GM0A 1WD3A 2VVEA 1S2KA 3ES1A 1OD3A 3KVBA 1RUD2 4W6WA 3FHQA 2BNMA 4IEWA 3MF9A 2HWB3 4OMDA 3NV2A 3WOGA 2XVKA 1HLCA 2P37A 3H42B 4MGSA 5GLZA 4RR3A 4ZS2A 4AGGA 4Q29A 3ZXDA 2VBPA 1FNZA 3CHXA 4A44A 1K3IA 1JZ6A 1S2BA 1EUTA 1VRH2 1JYXA 4QB1A 4QU1A 1PO22 2ZGPA 5FRAA 4ATEA 1NCRC 5CYYA 3RI8A 1EV11 1YYNA 2JJ6A 1VLNA 4X8NA 3VV1A 1BCXA 2ZKLA 2QQWA 2D3RA 2CHHA 3IB3A 3VDBA 4AI9A 2P17A 2VVFA 4R9CA 5IK7A 2BPA2 2F17A 3WNNA 4MLOA 2BGCA 1VAMA 3VBSB 4AYUA 4QPGA 5FPZA 5BNOB 2G9FA 2IXHA 3I7DA 4H7LA 4I02A 5E88A 2G9GA 2WZEA 3LOIA 4YG3A 4Y1XA 1D0GA 5IT6A 3PIJA 1ZZ6A 4I09A 1O59A 4FAGA 5A3NA 4OYUA 5KR7A 4AOCA 3UJQA 2DTWA 4FFHA 3FWEA 3VD4A 1SHWB 1W6MA 3E5XA 2EIEA 4Y24A 4XUOA 3GXUA 1HIXA 1W9TA 4Y20B 2CSGA 3LEIA 1Y43B 3VB9A 3WNXA 4I2OA 2VD7A 2GC2A 1VBE1 5LK5A 4TSVA 1SLLA 3CJIA 5CG8A 1EY2A 5DAVA 2JE8A 1UMIA 2RE9A 4YARA 1UXXX 3CU7A 3KMHA 4URTA 2DCZA 3H1YA 4ARYA 2V5YA 2XBO2 5BNOC 2WNUA 4YGBA 3ZFGB 1NCQA 3RPQA 1UOBA 2ZX3A 4CP1A 2VCAA 4LBOA 5LBBA 3M2MA 3W9AA 2I74A 1R092 2EIDA 5FPAA 3R6SA 4IE7A 5C5TA 2CGPA 4XFCA 4Q2FA 1EP0A 1FOD2 1WZXA 2PMWB 4XJ8A 4R8HA 3ZYFA 4CVUA 4XFGA 1ST8A 2H0BA 1KXGA 1W8TA 3IAQA 4AI3A 4RS5A 4NE9A 3MFCA 3S30A 5F3CA 3D82A 4CUCA 3OGJA 2Y6FA 1OPOA 4YW6A 2GDFA 5HV4A 5A6XA 5IWFA 3PU8A 3WQBA 1CX1A 3U1XA 2NPIA 3ZYRA 4FTEA 1HX6A 3KWVA 1NAEA 2DCYA 2HWE1 1JYIA 5CG9A 1ZRFA 2XVGA 3ZFGC 2QTWB 2HWC3 2K2SA 4DEVA 2ZEZA 5B2GB 2Q5TA 4D7TA 4OULA 1SACA 1IPSA 1HB4A 1ZBE1 1MS0A 5FMBA 3H3UA 4LA2A 2AGSA 3VBFB 1GSLA 2BJSA 2W2IA 3NAPB 3RZKA 1UY3A 4YVWB 1G9FA 4LTAA 1OOPB 4LHLA 2BU9A 2A6ZA 2CWSA 1QJZA 5I8SA 1GZ9A 3T0AA 3U07A 5A32A 4AVAA 2FQPA 1D4VB 3LSDA 1HRV2 2P6HA 4CCOA 3C7FA 3DF0A 3ZSEA 3IDEA 1IOAA 2FMDA 4XFHA 3LE0A 2PELA 4MO3M 4P02B 1AR63 1GZWA 3KCCA 3T0BA 4MGZE 1CZTA 1V0AA 1FT9A 4NRPA 1I3HA 1AYN2 5A6YA 4KL1A 4YM0A 3T09A 5J09A 3FN9A 1SCSA 3HOBA 1V70A 3MPPG 1S0IA 3VBFC 3NAPC 2Q8EA 1SBFA 3VBUB 4XCAA 1IKQA 1OOPC 2J7MA 1RUE3 2C26A 4UFKA 4EZHA 3O1OA 2LRPA 1OVPA 5FWEA 2ARBA 2XGXA 4B4PA 1HQWA 5AVPA 1KDMA 4MGTA 4Q5OA 3G6JB 3CL1A 2XQRA 4XOGA 4N9HA 1WMFA 3A0KA 4JV4A 1C5IA 2D5HA 4QX5A 4Z1VA 5JVVA 3OG2A 4RD7A 1ZZCA 2QNKA 3WDXA 2WZ8A 1WD4A 5CADA 5HBAA 3H8RA 4QHOA 1AR71 4NIDA 1S0JA 4ZY9A 2Q1ZB 2PLV3 3POBA 1F9KA 1V9U1 3ZR5A 3VBUC 5IK8A 4RGAA 1ONAA 4YW4A 4CU9A 2RG4A 3MYXA 3T2QA 1Y7BA 5EJ3A 2HEYF 1S2EA 1Y9MA 2ADEA 2X05A 3SEPA 5A3LA 5BY5A 1UOFA 2G9ZA 2ZBJA 2ZZQA 5DDJ2 5T3NA 1N1TA 4NWVA 3AZVA 4P9IA 2EXJA 4IV1B 3VZMA 5LRSA 1LHUA 4CDWA 3VDCA 4KWJA 5I0UA 4YM3A 4KU7A 3T0DA 2WIIB 1OKOA 2W95A 3WG1A 2P2KA 5IFTA 1UY1A 4BH9A 2VTFA 2PLV1 4JQRA 1RUF1 3AYDA 5DAWA 5H9PA 1UU6A 5C3OA 1JOPA 1OC1A 1URXA 3DCQA 3F2ZA 4RFT0 2WFPA 1LCLA 3AP6A 4I0WB 5GJ6A 3POWA 1OUSA 4DMIA 2JG9B 2XJUA 3USSA 1W04A 2DVGA 2LM3A 3EB7A 1VBC3 3WF2A 3LIHA 1OMIA 1ZZ9A 4XJZA 5FQ0A 1CD3G 1YLLA 2ETEA 4KWLA 2JD4A 2VBBA 1WMEA 2GZWA 1CR7A 3ACIA 4BK5A 1IS4A 1G7YA 3I49A 2QQOA 3ALQA 1A3KA 3KCXA 3MW2A 4N53B 1G9DA 4HLTA 5A7WA 4AEDB 1GQHA 1W9FA 4N7UA 1KFXL 5F3EA 3K75B 4HK9A 1W8HA 1C8M3 3PVOA 2GU9A 4M3CF 1UOJA 1UW8A 1JZ4A 5IVEA 1QJX2 1LENA 4GWNA 1DG6A 2HWD2 2VBDA 2Z69A 3NNLA 4FI9A 4JRLA 4BOWA 3AMMA 5ABJB 5IK4A 5JWPA 1W6PB 5HPOA 1P8JA 2ZGUA 3B94A 1YC61 4AL9A 5A3PA 1HV0A 4FXKB 2UYBA 3RMXA 3KQRA 5GKAC 3TOJA 3OD0A 1NLQA 4XTMA 2OZJA 4CUAA 5T5PA 3I3BA 1BEV1 3AC0A 3VKLA 1MPXA 4N53C 3WCRA 1F15A 1W8WA 4LA3A 3H7JA 4Z82A 5FYVA 4AEDC 1XE0A 1PK6B 4R9DA 4O65A 2RS31 4FPHA 1N3QA 3BODA 2A3YA 4IEPA 4UBHA 3VBOA 4B7KA 4TYSA 1PIV3 1YXWA 3KSCA 4XZUG 3HT1A 2BP6A 4URAA 3LGRA 5EXOA 3PVNA 3ZYPA 5ABJC 3W5MA 3RZJA 1R083 3HT2A 5EFUA 2VC9A 1MQTA 2R32A 4JX0A 4COVA 1CONA 1RUD3 1ZBA2 1OFSA 1PZ9A 1F8VA 1TMF1 3NJXA 4PF1A 2E6VA 3KD4A 2VOKA 3IDCB 3K3OA 4NIAA 4BQ4A 4WV8A 1PK6C 5CA6A 3DKWA 2DF7A 3K3NA 4FBFA 4AVVA 1VRH3 3UV9A 1XYPA 1PO23 2JDUA 4FPOB 4IGQA 1OLRA 3GHNA 4BQXA 1GZCA 4KGQA 1UN1A 5HXVA 3ZXJA 3RZHA 4XE9A 3FLRA 2XXZA 4FFFA 1C1FA 4Z92B 3W21A 1ENRA 4RGKA 1UKRA 5CFDA 1AXYA 2YFZA 4HVOA 5K9YA 1OLMA 4XDQA 4AG4A 4E27A 5A33B 1MVEA 3AX4A 4H7MA 1SEFA 4OQ8A 2GSYA 3USUB 3NSTA 5FIXA 1YNAA 4NHYA 1T6GC 1RHI1 2QJVA 1QQP1 3I2HA 2CYFA 3THTA 1A8MA 2A75A 3AYEA 1LEMA 1LJ7A 1AYM1 3CQOA 1ND3A 3VBHA 1LOBA 3JD72 5F5QA 3BOWA 4LEJA 5FMOL 4M01A 4EN8B 3OYWB 4QD2A 3APBA 5FZIA 3RFRA 5T5JA 3WQ1A 3AP5A 1WLTA 1J1TA 1ULFA 2R041 1SLCA 2R1DA 2KR2A 3KV6A 5C71A 1XPWA 3ZXAC 4NAMA 1CN1A 2XBO3 3NKGA 4K9SA 4TLGA 4M4PA 4XCBA 1GNHA 2A6XA 2WKKA 3VGIA 1Q3EA 1U5IA 3R0RA 2V4VA 4YVSA 3DPRA 1U0AA 3O0XA 1R093 1YQCA 2R062 4G9SB 4GMP0 3GZTB 4XDOA 2RDRA 1MEC2 2YMZA 1S55A 4M3CA 4AFAA 2YHJA 1Y4WA 4FP3A 5I0TA 1NXD1 1FV3A 3WDWA 4JDOA 3QD6A 3GGLA 2BV4A 4Y4YA 5FYTA 2DU0A 1QXRA 2FDIA 1KJLA 1VBD1 1EAH1 2WBKA 4JGYA 4CXWA 1LULA 3LWCA 4XHXA 2NYYA 2FZ1A 3ZFEA 4E8DA 1KJRA 2YC0A 3K4ZA 2ZTNA 3FLTA 5IFPA 5LW9A 4Y5SA 3OSDA 1W2OA 4XQ4A 1K5MB 3GALA 3MEPA 4TWTA 2E53A 2BOJA 3T1LA 4H2AA 3I8TA 5CISA 4M0NA 3OJBA 3VL9A 4IEUA 5L73A 1OSGA 1MS8A 3A23A 3TN92 1Z0HA 4MG2A 3ATGA 2VW0A 4NVPA 1JYNA 4N9IA 1NZIA 2WL1A 4QDSA 3POJA 5ACA2 2OW4A 2WN2A 3SXWA 4XW3A 5FZMA 3RYKA 3WQ0A 1XBFA 2WWUA 4Y3OA 4XC9A 1O8PA 4F3JA 2WRAA 2F4PA 2K9ZA 1H8VA 1Z78A 1QOOA 5FFOC 2BFUL 4PDWA 3WHUA 2HWF1 3ABZA 5JSPA 1K5MC 1UYZA 3LFIA 4YYOA 2JG8A 1W6QA 3ZPOA 1V6OA 3UNPA 4NPRA 4GZ9A 5H9RA 1YRZA 4QX1A 4BLIA 1JYTA 2ZHKA 4L9BA 1O7FA 1UWWA 3GJBA 1COV1 3G7DA 3MLLA 1Y9QA 3OPTA 5LB6A 4Z8BA 5KHJA 4QDRA 3AVRA 2XONA 2RM21 2W94A 2Y6LA 1RUC2 1WCDJ 3B69A 4UW6A 1HJFA 1JYWA 1RVF1 2Y6GA 2IUWA 2CAVA 3M3IA 1MS4A 1RJ7A 4RL7A 4DUVA 1BBT1 3MLKA 2C24A 4BLJA 2VUAA 3KLSA 4UAPA 3BN6A 3LPFA 1GR3A 1RINA 3TBDA 1NLRA 5J7MA 1ZZ8A 1PVC1 4LBNA 3FBMA 3D3AA 1LGNA 4RA0A 1NYWA 4B1LA 3JXSA 4CDXB 3O1MA 3MBWA 4AEKA 4BXSV 3BTYA 1LGCA 3T30A 2R49A 5A3TA 1DGRN 1OUXA 2OUJA 1N1VA 3PJYA 4LORA 1PM7A 1W2UA 4HKLA 3AFKA 1APNA 5F9TA 1O4ZA 1XNKA 2ENRA 4A3ZA 5C3SA 2A5ZA 3B9IA 1FPN1 4DB5A 4NRMA 4FVVA 2DUOA 5BYNA 3ZOIA 2D98A 5BNNB 1YEWA 4LKDA 4CU8A 4EJRA 3VZLA 4XFAA 5C4WA 1DQ1A 2JB8A 3FJSA 4WBBA 2BERA 1ASJ1 1JBCA 2YROA 1XOYA 4CDXC 1ENQA 4HSLA 1JU4A 5IAXA 1VBB1 3S57A 4P9LA 1CPNA 1DZRA 3MW4A 4OLLA 1BLZA 1GZTA 5FO7B 1GMMA 1W0NA 4OCTA 4R9AA 4WVZA 1ENSA 3MV01 4CEWB 3VD7A 5H9SA 2A6VA 2FDGA 2Y60A 1RJ8A 3J8F2 3N3HA 4UFLA 5FP9A 1SFYA 3ZN6B 4IEYA 1Y3TA 4ZZ5A 2AENA 3C7EA 2J1SA 2V09A 3ILRA 5DZEA 4V1PA 2JE7A 1NKGA 3N7JA 2BVBA 4M4RA 5FYBA 1M06G 3BPSA 4QKNA 5H9QA 2YB7A 2RS12 1KEXA 2XKOA 3MDPA 5IAVA 1RITA 4AHYA 1PO11 5I0SA 3VDAA 5FPXA 4W6XA 1KFUL 1QJX3 2XVLA 1X8EA 2YPDA 2P6CA 4HMZA 2W39A 3N9PA 4CEWC 1DLLA 4P9YA 3RYRA 3ZXEA 5IW0A 5KHIA 1NXMA 3ZFFA 4BQ3A 4WM7B 2ZABA 2JIJA 4RN5A 2ADDA 2RDNA 3WQ7A 3WNOA 2VQ0A 4IESA 4L8QA 1VAKA 1RMU3 4PIYA 2W08A 1LKNA 4GMP3 3PHMA 2ERFA 4QGNA 4XUQA 4ZKTB 2VZUA 4BXFA 3HJRA 2FDHA 1V6IA 1LTEA 1CJDA 3TEZA 4EWEA 4UFJA 2ES3A 1DLCA 3FFQA 5FY5A 1GNZA 2RR11 3B01A 4EROA 5FPUA 4P5HA 4Q1RA 1POV1 2X5IB 3T2TA 4HZFA 1CAWB 2GP5A 4CDQA 1R1A1 5A6ZA 3DN7A 1D2SA 1ZBA3 1UL9A 1QOSA 2J1VA 4WM7C 1SDDB 1NY71 5GLWA 4BHPA 4FT8A 4YWAA 4C1XA 3ZM8A 4GH4B 3B9CA 3JBG2 4WZFA 2ZGOA 3RG0A 1RMU1 5D2AA 2B45X 1VMJA 4DRVA 1TZOA 5JMCA 1LHOA 5HXMA 2JXAA 2VZ3A 2ATFA 3BVCA 2IFWA 5FZDA 2PAEA 2D93A 1PGW2 1PX4A 2H0VA 1DDLA 4AVBA 3DKQA 4QM8A 2UWAA 3SKJE 4BQWA 3AM2A 4PLMA 3J7MA 2MEV2 4BYYA 2P3IA 5A1AA 1I5PA 2X5IC 4W50A 3NWKA 3KZ4C 4CDUB 2Q4SA 2HBUA 2VMEA 5JAXA 4LUMA 5BNPB 3ZKYA 5ISLA 4I01A 3NV1A 2VXRA 1DGLA 3RDIA 2VMIA 2YPJA 3F95A 4XMAA 5BXXA 2VZOA 2TBVA 1TME2 2VNRA 3WNLA 4TZDA 1S0BA 2WFF1 3LPGA 4YZ5A 1Q56A 4TN7A 3WP5A 1WKYA 2BEOA 1XU1A 2R30A 3AZWA 4FPCA 1IS5A 1DYKA 5I93A 1VAVA 5CFCA 1IQAA 4AR2A 4Y22A 5FPBA 2PHLA 4NMIA 4PBPA 1PM4A 5BPXA 5A70A 4BQ2A 5JI9A 3FL7A 3HNYM 4CDUC 1JYVA 5BNPC 3B93A 3ACFA 3CF6E 2J1EA 3P3NA 5FJHA 5FLJA 3GBFA 4LK6A 3CLPA 1UCXA 4QQPA 5F32A 1AF9A 1H2LA 5IVJA 4QM9A 1LOEA 4GALA 4QPGB 3WHTA 1Z7S1 2B39A 2KD7A 5DG2A 3I2FA 3DECA 1X36A 2VY0A 1GLHA 1F2NA 3R05A 4RR3C 4ATFA 1U5YA 4ZONA 4WVVA 5JMOA 4Q0PA 2XLAA 5FKCA 3BTZA 1XQNA 4GB32 2IWGB 4JGZA 1W6MB 2R0FA 5FZ0A 4FPYA 2EXIA 3NV3A 1QJU1 1TG7A 4JKLA 4BCUA 3NJYA 4COYA 2B8MA 3ZYHA 2IXLA 2DFCA 1JZ3A 4TTGA 2VZSA 2ZEXA 2A6WA 3CJIB 3BYWA 4BQYA 4RQPA 4QQHA 4V2VA 5I0RA 3UKNA 1C28A 4Q0SA 4RHV1 3ZSMA 4QPGC 3PMSA 2QQMA 1ZRIA 2CV6A 1NCQB 3M3CA 3MIHA 3PU3A 3Q8EA 4MGIE 1WCSA 2XUEA 3TN93 1O5UA 1Q43A 3B02A 4M0HA 4OHVA 4OUEA 5ANQA 5LA9A 5IK5A 5ACA3 3BUCA 5JXIA 4D8MA 4MGKE 4Q4Y1 2X8KA 5EYYA 1ZYBA 5J3UA 4RS5B 3V0AA 1VALA 3B00A 1W8UA 3I2DA 5FZOA 2JDAA 5I8YA 3C7HA 3CJIC 3P1IA 1U5ZA 2ZGTA 3VHPA 5B4XA 1CAUB 2XJVA 4IEXA 5A3MA 1GV9A 3BI3A 2XWJB 1QGLA 3I59A 3ZN4A 2WNUC 1NCQC 4Q4W2 2UYAA 5TSWA 5FOJB 4CP9A 1YHFA 4LHKA 1S4CA 1QHDA 4S2GA 3NNJA 5JIAA 5A80A 3S7EA 3OOXA 3FC0A 4WZCA 3RMYA 3RZLA 1RUJ1 1ULPA 2D3PA 3BIWE 2CL2A 5C70A 1KGYA 3O1RA 1QWRA 1X9PA 4N7IA 4RS5C 3T4VA 2EALA 4X6RB 1AHSA 1H30A 4KI5M 3IDAA 4UFIA 1BYHA 4AGRA 5EIYB 3GNEA 5A32B 1AL22 4GQ7A 1V6NA 3O1PA 2HWB1 5LEJA 4LPLA 2BBAA 2ZMKA 4XPVA 3GBGA 2Q8OA 2VVDA 4QXHA 4OI0A 1FV2A 4QB2A 4LXLA 4L2NA 3P5BA 1AYM2 4O9GA 3ZVXA 1OURA 3DYPA 1JXNA 5K0UA 1IZ3A 4E4ZA 1GUIA 1H9PA 2P34A 1HRI2 4Q4V3 1LAJA 4AFCA 5C8CA 1W6OA 5JZGA 4HVQA 4S2DA 4HBNA 1FMD2 3HNBM 5ERLA 1M4WA 4A4AA 4H14A 1RYYA 4CCKA 2QFEA 1OXCA 2VZRA 2Y33A 5IATA 1DZQA 5FYUA 2HEVF 3AYAA 2VULA 2GNDA 1ZZBA 2VW2A 4H3WA 4MX3A 4KGGA 2BWCA 2J22A 4KH9A 1PGL2 1LOCA 2ZEWA 2QQUA 3H9AA 3HN3A 3H3ZA 1W06A 4EZ4A 1MR5A 1O91A 4O7XA 5FBZA 4Q4V1 4XJAA 3AXDA 4Q26A 4QX7A 3QH7A 5LA0A 2WT2A 3K46A 5L9BA 4LLFA 5JSOA 4LQRA 1SMVA 3I2IA 3IPVA 5EPAA 5FYZA 1DU3D 1SLIA 1EAH2 4ASKA 4D69A 2PQQA 1V6LA 3Q8CA 3OUIA 1U12A 5LBCA 3VZOA 4LE4A 3ZIWA 3J8F3 3NMBA 3U75A 2DV9A 3C8XA 5L9VA 1QH7A 4Y5TA 2FDJA 4CDWB 4QPYA 1VE0A 4JKKA 5D1IA 4QPIA 4LKSA 5CZKA 2RS13 3KM5A 5DAQA 4DIQA 2WNVA 3OGVA 3BKZA 3J7LA 2CU5A 1BJQA 3LA2A 1WCKA 1CAVA 2WNOA 4GXLA 1N3OA 1WGPA 1XE8A 5IHRA 1GOGA 1QY4A 3HWJA 1VP6A 3IT8A 3QH6A 3S6PA 4HONA 1AVBA 4I0BA 2VCMA 2L9LA 2JDMA 1UIJA 4FFGA 5DAXA 4ZU4A 3RJRA 4BDVB 1E5RA 3HPNA 2J1TA 3LA3A 2HWC1 1JUHA 3N9NA 5FLHA 1BMV2 2GH8A 4Q4X2 3VD3A 4P9XA 2SBAA 4CDWC 3HBKA 5HV0A 1ZA4A 4OI4A 2ZGKA 3AMHA 2DBNA 2VL4A 5FQ0B 1BXHA 3OY8A 2ET1A 4NHLA 4K1YA 2CAUA 1COV2 3WDYA 2HYXA 4AGVA 3E5QA 5A7WB 2RS52 5FWJA 2CTVA 3OBTA 3VBSA 5FYSA 2DU1A 1ODNA 4YFWA 4HN1A 5HCHA 1DIWA 3UGHA 3WG4A 3FMGA 4GA9A 4BWOA 1OT5A 3S5AA 2RMU2 3K4DA 1SBDA 2KA3A 3E6DA 1HXS2 4XXPA 1J58A 1AR61 2R072 2VNOA 1W9SA 4QHZA 3OB8A 3VKOA 1PMIA 1YIFA 3JBG3 4MUVA 1UOGA 5FZCA 1CZSA 4DEQA 4GWJA 2JIGA 3UGFA 4EN7B 1WW4A 4J1WA 5FXZA 3VBRA 5JOZA 3VUOA 1VBA2 2JDKA 2OS2A 2WQ8A 1BKZA 1SCRA 2D40A 1PZ7A 2CDOA 2P4EA 2WZR2 4FO9A 3Q9OA 1X8MA 1RUE1 4IEQA 4KU8A 1TNFA 1ALYA 1ND2A 1GANA 2ZS6B 3R4DB 1HN0A 2GMMA 4ZXEA 2MEV3 2WS92 3ZR6A 1AX2A 1DGRA 3AJYA 4SBVA 5SV8A 1QEXA 2VMFA 1DHKB 1JH5A 2RDSA 3FBYA 2XJSA 1RUG2 5JR2A 1GBGA 5K0UC 1PZ8A 4WVMB 3U37A 4XQWA 2YU1A 3AKSA 2E26A 1PGSA 4YPJA 1TME3 3OTFA 3ZXGA 3UK9A 2WO3A 4AHXA 5A1FA 1ULEA 2FMYA 1ASJ2 4UWDA 4OVEA 3WCSA 3INAA 1JW6A 3RWNA 5FCCA 2YBPA 3PIGA 5FZ9A 3VBOC 2Q8DA 2EA7A 5FMOS 1ZA7A 3UESA 2JDZA 3RS6A 1O3TA 1UX7A 4NRQA 3VHOA 4PBOA 4PCRA 5A7OA 1BVVA 2CGOA 1AR82 2XLGA 2FHRA 2WC2A 1ZNPA 3HAGA 1MQTC 4TXWA 5FZ1A 3C7GA 5AC92 5CFDB 4N43A 1LOAA 2E7AA 4YVWA 4E4DX 3POYA 4UF0A 2BW8A 1DQ6A 3OUJA 3RVHA 1FI2A 4YW7A 1UPIA 3NQHA 4LOTA 3ZXFA 3OCPA 3DGTA 5KHKA 2D5FA 1PO12 3EJKA 2AC1A 2QCSB 1X82A 3FX3A 1RUH2 4L97A 2D6OX 1JI6A 4GB33 3R4UA 1US2A 2Y6KA 1IS3A 1S0FA 1SDWA 1VBC1 3VBHB 4DUXA 4E9KA 1Q8OA 2XDVA 5D8AA 2ZCWA 4XILA 4BIFA 3O0WA 1CGPA 2DDUA 1QJEA 4FOYA 5IJRA 5A3OA 3CJXA 4Y1YA 2R16A 3JQXA 5CFDC 3POGA 2R6QA 3NW4A 3MUZ1 1AR92 1JMUB 1F5JA 1MZEA 2WJSA 4Q0VA 3ETQA 1OFNA 4NPLA 3VZNA 3POFA 3RYPA 1ZVFA 5GZCA 1C8M1 1C3HA 3GJAA 4YVSB 4K3UA 1D4M3 4MVTA 2QQKA 1W99A 5FJKA 1Q8SA 2VZVA 3ZDVA 4AHWA 4DY3A 2V72A 3N35A 4LUKA 3RZZA 4MADA 1ND3C 2OPWA 1WWYA 3VBHC 4LMFA 4M3CB 4XVHA 4DPNA 1ULOA 4J1XA 2WYFA 3CKHA 4AFDA 3ENRA 1O3SA 2BFUS 4P00B 1OHFA 5AFBA 2FDKA 2W5FA 3N9LA 4IE0A 3NV4A 4JGYB 1WCQA 5T50A 3LDKA 4BQ1A 2XLFA 4DXRA 4NR1A 3JB4C 3ZFEB 2Y0IA 3GDBA 3OGGA 4UW5A 4Q4W3 4E8CA 5DAPA 2HYKA 3U11A 4YVSC 5AVAA 3DPRC 5DPNA 1R64A 1PIV1 1SFNA 1SFPA 3S5QA 3HIFA 2C1FA 4IV1A 1LEDA 1LHVA 1Q8VA 2J42A 1HB2A 1A34A 1KD7A 3WXPA 1XXNA 1FYUA 1R081 3JQWA 1OQ1A 1RXGA 3IMNA 3WF4A 5JOXA 4K8FA 2HKXA 5KBFA 3ME2A 5A7NA 1QJY2 1JHJA 3KF5A 1AL23 5FZ7A 1RUD1 1XRUA 4NAOA 4NHMA 3NVCA 5IVVA 2YXSA 3PURA 4JGYC 4LO7A 2UU8A 1J59A 3BPZA 3ZFEC 5IVFA 2OUHA 1NA1A 4XDPA 2VMHA 3MV11 4WVWA 1WLCA 2G1MA 2JG9A 3J7HA 4K20A 1C1LA 5E8AA 4LHSA 1VRH1 1W2AX 4AAXA 4ES9A 5KWRA 1PO21 3DEMA 1OD5A 2JG8B 4QWNA 4MOAA 5GALA 2ZEYA 5FY7A 2Z4FA 2IVIB 2GN3A 1OKQA 4P9JA 1X50A 4X8PA 5FPVA 1IS6A 4ZU5A 1YIPA 1FMD3 1A78A 2W1UA 2YFUA 2ZX0A 2QDNA 2XQXA 4XFBA 4GJYA 1GU3A 1O8SA 3CNAA 1LNSA 1OLME 4FFIA 3IN9A 4O61A 2YG0A 5EP9A 5FZBA 3NO8A 2OVUA 4PDWC 1DCSA 4IEOA 3UYJA 4EWDA 2BQPA 1MZFA 4CA9A 3AYCA 5F8PA 2VCCA 4UYBA 1KS5A 3VDDA 1CQ9A 2YDEA 1CAXA 4PJYA 1FOD3 4XF4A 5F39A 2JG8C 4HVRA 3WW2A 2HEWF 3P6BA 5LEKA 2J1AA 1T2XA 1S1AA 2W52A 4EN6B 5FTTC 1OF4A 2BBVA 2BNOA 4IQPA 4ORFA 3N4MA 4K6BA 2Q30A 3EQEA 1E5SA 1YJKA 4CTEA 4CE8A 4OUSA 2WT1A 3WVJA 2XBO1 4AF9A 2Q1MA 5E6HA 1J84A 3LD8A 3IIAA 4RSUA 4FPGA 2KXLA 3PUIA 3WT3A 2AR6A 1HW5A 2RJ2A 1R091 4NIIA 2GP3A 3LCPA 3KGLA 1H8TA 4G4FA 2E7QA 2ARXA 5T55A 4D6RA 4DOUA 2QQPA 3PUHA 3QLQA 2BDRA 1D0HA 1W6NB 3WSOA 4A7YA 1X7NA 2UWBA 5C4WB 5FZEA 4HPKA 4ASLA 1LHNA 3OBRA 2VZ1A 2GC1A 3OBAA 2W9XA 4M3CE 3Q8FA 4UW3A 5FZFA 1HRV3 1NE6A 3O7OA 1RUI2 4KBZA 5LBEA 3BIEA 3H50A 1HJGA 3KV4A 1J3RA 3UKTA 3M8LA 2LS6A 2BWAA 2ZHMA 5F3GA 4IGPA 4BMBA 5FY8A 2E9QA 3AP9A 4AI1A 4FQ4A 4Q4X3 1AYN3 3BB6A 2K0GA 1N1SA 3GF6A 2KM2A 4OZOA 1ACCA 1VMFA 5A3UA 3KVAA 2DFBA 3CZUA 1PNGA 2VQAA 3E5UA 3RNSA 3N9OA 1IQDC 3M70A 2B7YA 5C4WC 2EIBA 2RS53 2WQZC 2B46X 3M7AA 5JUVA 1EV12 4XJWA 5FBJA 2CGNA 2WABA 1UU5A 4CP0A 3AZYA 4BM8A 1SZBA 5FYMA 1JZ2A 2VZPA 2Y64A 3EYPA 2RMU3 4CYDA 3X29B 1HXS3 2YY1A 4PIXA 4DZGA 1AJKA 4DFSA 5FV3A 2R073 4QU2A 4XZPA 4AQSA 4HK8A 3NL1A 4Z2AA 1AYN1 4PLOA 3FHAA 1QXJA 4JRAA 4AAPA 5A7PA 2WN3A 5IVCA 4K21A 5F3IA 3ZFFB 4BQ5A 4W6YA 4Y1UA 3OYWA 2PYTA 2PAKA 1J3QA 1VBA3 3HD8B 4QQOA 3KHCA 4HG6B 2JD9A 3ASIA 4ISRA 4XIKA 2WZR3 4NN0A 3T4HB 2NMNA 4Y1ZA 3H3LA 3IZOA 3SHRA 4CRQA 4IE6A 1VBE2 3KGZA 3WR0A 4PI0A 4YW5A 1HDKA 5DDJ3 4QX2A 3PTRB 1RUG3 1GOFA 1JOBA 1UQXA 1RIRA 1TQ5A 1XSQA 2NMOA 4MXWB 4QX8A 4V2WA 4MH0E 5GZGA 1PX3A 1YQ2A 2EF6A 4BISA 2ZX4A 3K77A 2VOWA 3V0BA 1K12A 3HQUA 3O0VA 4JTNA 4MHRA 3MO4A 5KC5A 4CP2A 3AKPA 5IVYA 4AEMA 3ZFFC 5FO8B 1NLSA 1CX4A 3THCA 5C9AA 2PA7A 4I30A 4H55A 1XNCA 4IEVA 2UWCA 2TUNA 5KHGA 1DP0A 3VKFC 2J1UA 1S0GA 4QXBA 1GOHA 4CUBA 2VR4A 1SLTA 3LEGA 2WSVA 2HWE2 2D6LX 4IERA 1AR83 4XF0A 4CDQC 5T5LA 4L99A 1LGBA 3I3QA 2VOXA 5AC93 2PHDA 2AYHA 4NO4A 5BNQA 4B1MA 1MZ5A 1ZBE2 1QNYA 1VMHA 2NLRA 3H1WA 4LBQA 1IPJA 2G4IA 4LNVA 4EYUA 2JDPA 5GLTA 4CEYA 4AI8A 3AL5A 3V65A 2JX9A 3UGGA 3J26N 1RUH3 2CWMA 3ACLA 1QDOA 1REDA 2MNGA 4PI2A 2DVBA 4YGEA 2HWD3 5CFCB 1JYCA 2FCTA 5FY1A 3WP3A 2VG9A 4GD4A 4Y22B 4XHBA 1QDCA 4CUGA 4EQVA 5DUWA 1HB3A 1UKGA 1YQ6A 3FLPA 3KT1A 4GULA 2JKBA 4HXCA 4OI2A 1OA4A 1UZZA 3A7QA 1YWKA 5EHDA 4AQ2A 2B5HA 4QB6A 2VXJA 1LOGA 3MW3A 1UF2C 2ZJCA 4FPEA 2BUKA 4B7EA 2IXJA 4OFGA 1H9WA 2RDQA 3URFA 3DXTA 3C7OA 5DMYA 2BGOA 4JAAA 2CY6A 1UY4A 4PT6A 1VIWB 2WWSA 3TNPB 1QJX1 5GZEA 5CFCC 5CVRA 3EO6A 4ZS3A 1BZWA 1S0CA 1XSRA 1XNTA 5LRRA 3TWIA 2OA2A 2B42B 4QKBA 4QQ2A 5FXVA 3J9SA 3EXUA 4JGZB 4AFMA 4ZZ8A 3H8XA 1REFA 5DUVA 3NNGA 1OI6A 1W9WA 2WDBA 3A22A 4F7ZA 3N7MA 4C91A 3D6EA 1OA2A 1LU1A 2SLIA 1ENXA 2OXBA 1VB4A 1AR72 4GMP1 5LK7B 5T54A 4C8DA 1FXZA 2D44A 1V9U2 3LA7A 4MYEA 1EYBA 4OUMA 4CZSA 1H2MA 1RUE2 2VNGA 1C8NA 1J1LA 2VECA 3H0OA 3PVEA 4QGMA 1J3PA 1K5JA 3BTAA 4KG0A 4LK7A 4R4ZA 5FY4A 3I3DA 3EHKA 4QKDA 1I9RA 4YW1A 1QMJA 3AP7A 2IVJA 3DUIA 3O1TA 3ZX7A 5BNNA 2JDYA 4IV3A 1QJY3 4JGZC 3BALA 3I4IA 2N7GA 1ZBA1 4LBQD 4E2GA 3BGAA 1REEA 2ZMNA 4YG6A 3V0AB 1L7LA 5KXBA 2IXIA 4HANA 5FXXA 3RI9A 1AXZA 2VOTA 5CKQA 2DUQA 2R0HA 2PLV2 1RUOA 1OH3A 1RUF2 1WBLA 4RQPC 4YGCA 3ZO0B 5L7OA 1GQGA 2JEMA 5E16A 5DUXA 3ST7A 4RR3B 4YZ2A 3FZ3A 1Q8PA 4OHZA 3SQOA 3JD73 1W28A 1JU3A 2D6MA 1BVP1 3ES4A 2W1QA 2YC4A 3NJZA 1E5IA 4DS0A 2OQ6A 1W8ZA 1UAIA 5ANNA 4J25A 4LOSA 1KQRA 5C7GA 1MS1A 2ARCA 3MI8A 3AZXA 2QQLA 1X33A 2DYCA 5F2WA 1J83A 3WP6A 3UL2A 1GNYA 2JICA 1GQPA 3O1SA 5FYCA 1W05A 2DVDA 1X9TA 2R063 4RFRB 3SKVA 1RTVA 3I3MA 5K4LA 5FDBA 1QKQA 4NUBA 1MEC3 3GZUC 2VTXA 4FP2A 4UXAA 2PHTA 3UETA 2A7AA 5IYYA 1H1MA 3SMHA 3WNPA 2QQNA 3ZSJA 2D6NA 1KS4A 4LULA 1SPPA 5K0UB 4L11A 2VMGA 1ZX5A 2NQYA 4A45A 2VJXA 3A4UA 3VHRA 1QU0A 4L0PA 5CU1A 5C8CB 1W6OB 1BHGA 3V56A 1O6UA 1GFF2 3IMMA 5JZGB 3D4KA 4OQ9A 4XXAA 1IKPA 3MPBA 1AUYA 2QQVA 5E1RA 1DQ2A 2BYVE 4Q0QA 2IZWA 1BEV2 2W1SA 3NNMA 1A6CA 4YW3A 4E2SA 2QUOA 2LALA 1OPMA 4O9EA 1VR3A 2R061 1NQJA 1Y9GA 3HMYA 4Y1VA 2WNUB 2RS32 2FCUA 3A21A 1TVGA 2ID4A 1MEC1 5LA2A 3W20A 1T6BX 3WP4A 1DYPA 4XUPA 1YJLA 3NJVA 1H2KA 2XKPA 3JBG1 1MACA 1K45A 1OQEA 1V6MA 2W47A 3CEWA 1RUI3 1QXPA 1W2TA 2VPVA 5FZ3A 3MZHA 4GH4A 4NOTA 5C8CC 4OHXA 2XHKA 3CDZB 5JZGC 2GN7A 3WUDA 4BB3A 4OMCA 1G86A 1TMF2 3HQRA 3OGRA 4XBLA 5T52A 1XNAA 2QE3A 2BGPA 4YM1A 2FCVA 3THDA 2YBKA 4MGQA 1CPMA 1QH6A 3TN91 1W8OA 1ODMA 4YM2A 3ZPYA 3K2OA 1PIV2 1US3A 4DXTA 5ACA1 5IVBA 4DXZA 1PMJX 3R4SA 3KB5A 3SNMA 2XPJA 2WT0A 3WINE 1O4TA 1WW6A 1EV13 4INDA 4XAEA 5I0DA 1W3VA 1NOVA 1G9CA 3TEYA 2VNVA 1RUC3 1GWLA 2I07B 2JE9A 2PN5A 5GZFA 5F7UA 3IKWA 1CAVB 2DVFA 2XL9A 1MS5A 2EICA 5FOBB 1JZ5A 5DXDA 3UT0A 2PTMA 4QXCA 2ZX1A 3TEXA 4LIUA 3ZDSA 1DYOA 2VQTA 2NM1A 1STMA 4PLNA 4YRDA 1DFQA 1DQ4A 3MF6A 1GZWB 2Y6HA 1RHI2 1TEIA 3VN4A 1QQP2 4YFZA 3U4SA 4UOJA 3LB9A 2JDNA 4AVSA 4K8RB 2VH9A 4MSVA 5FXWA 5E89A 5DUUA 5A7SA 2PHWA 5EJ1B 1UD1A 1DGWX 3AMQA 3OY8B 2Z2SB 3VLBB 4QHBA 4QPIC 3WF3A 1B35A 1VBE3 2WNVC 1RUC1 1LOFA 2FD8A 2R042 3WW4A 4JQTA 1UMZA 2YU2A 1WMDA 4D0QA 1NT0A 1JN2P 3PUSA 3IIIA 1B09A 4CU7A 5J48A 2RJKA 5GLVA 1IGOA 4IETA 5LY1A 1N3PA 5C3PA 1TNRA 4NIHA 4WM8A 5BV6A 3RSJA 2XB6C 3ZMOA 2WZPP 4F8AA 1G9BA 2WQ4A 3AFGA 3PL0A 4KWUA 3OEBA 1RL3A 1RXFA 4HKOA 3ON7A 5LY2A 1IPKA 4UBGA 5HCBA 4B3NA 4G3YC 3VBRB 3U14A 4LBMA 4UT5A 1ZRDA 5L9RA 2D97A 4HL0A 4LO5B 2OZ6A 1XYOA 4XUTA 4EN9B 1VBD2 1GP6A 3W58A 3VBSC 1ND2B 1YO8A 1WW5A 2VZQA 3GCWA 2HWE3 3ZN5A 1OQDA 1FAYA 2Z42A 1UZYA 4K7JA 4C1WA 5FUIA 3PTYA 3WG2A 2PQSA 2X10A 1EPWA 3OF1A 4CPBA 4LE3A 4KQ7A 4XJUA 1ZBE3 2YZ4A 1UPSA 4AXOA 4IW3A 1NCRA 1I5ZA 4I0AA 2AEZA 1AXKA 2Q0AA 2ZPXA 4LIVA 3I54A 4KMQA 1WMXA 3PUAA 2Y26A 1LHWA 4W65A 1UIKA 2YBSA 3VBRC 1QNWA 4LO4B 5HCAA 2D3SA 1CAUA 5FYHA 5KC6A 4B4QA 3GZEA 1ZRRA 1ND2C 2GMEA 5JOWA 2XMLA 3OD4A 3WX5A 4UW4A 1FNYA 2HWF2 1ZZ7A 3KT4A 4Q0UA 1N47A 1O4YA 3SCHA 1DZTA 4JDNA 3WLUA 3WW3A 5F1RA 3J8F1 3MIGA 4XEZA 1HN1A 5DZGA 1W8FA 2O14A 4MV2A 4BPZA 1VPHA 5G04L 1YFXA 2BVVA 2J1RA 3P3PA 3UJOA 3ZXKA 3OBZA 1DGWA 4N43B 4R4XA 2RS11 1SQ4A 3PDQA 4UF0B 2RV9A 4QMAA 3ZLIA 2O8QA 5F6LB 1IG0A 1OVSA 5FZAA 2D7FA 2D6KA 2W87A 3NKTA 5F37A 2RM22 4Y5Z0 5BNOA 3O14A 5LA1A 3ZYIB 2DWRA 4BU2A 1CWPA 3PUQA 2EXHA 1RVF2 3SISA 2JDHA 2ZAHA 1HB1A 4ZHNA 1F4AA 2O0OA 2YGMA 1BBT2 3H1MA 4Z07A 3ZYGA 2BRTA 2UURA 2XJPA 5FZ4A 1Q8QA 4CCCA 5D8AB 1OLQA 4XFIA 2E63A 2FZ2A 2EXKA 1XNBA 3AKTA 1NUKA 4Y20A 5DABA 1H1AA 2WINB 1AR73 2ZX2A 1PVC2 4N43C 4YVWC 1V9U3 1XJAA 3IBMA 2IXCA 3GBWA 2RJLA 4QDQA 2DURA 2YUEA 3POSA 5C3RA 5GZDA 1H4GA 3VBOB 2IFRA 3ZFGA 4C0HA 2A3XA 2ILMA 2R7EB 4AFBA 2VE1A 3KHBA 5CKNA 1RB8G 2VAUA 4P08A 4CPBD 1FPN2 4FPJA 4CXYA 3LF7A 4FOVA 3ZKUA 4GIQA 4FSJA 3HR9A 5D8AC 4CCNA 3HQXA 3AMPA 3BU7A 3N9MA 1MQTB 3VZJA 1WBFA 4COZA 2WAOA
chains in the Genus database with same CATH topology
5DG1A 2A6YA 2X29A 4BIOA 1HKDA 1RUF3 3AP4A 4FPLA 4K40A 1PGW1 3UKTA 4LR4A 1VBB2 4LO8A 2ZKNA 1PHMA 5KXDA 2MEV1 4Q8LA 3SH4A 1QF3A 1CVNA 2ZGSA 3WDVA 2BNNA 3B3QE 3K51A 3VBFA 2YYOA 1TME1 3NAPA 2HJIA 1OOPA 3H7YA 4K1ZA 4ASMB 4BA6A 3FHIB 2RHPA 2XJTA 1SLAA 1EPZA 2ZOEB 1AX0A 1NA1B 2OYZA 1A8DA 4HT1T 2NZ9A 4FXGB 1ND3B 4A2UA 2XL7A 1ZREA 4IV1C 4FOQA 3LOBA 4XYXA 5JR7B 4R52A 3AKQA 3AXEA 2TNFA 1BEV3 3FUQA 4MXVA 4AHZA 5BUVA 3VBUA 3PMEA 3WD5A 5L19A 3GYDA 1AL0G 2RS33 2ZAAA 3O12A 3MIDA 1DF0A 1NA1C 3DPRB 3VDDB 2D6PA 2JG9C 1CAXB 4GB31 5I91A 2RR12 2LUWA 4KWKA 3ELNA 3FUOA 5J96B 1R1A2 1XNDA 3LSEA 5HCFA 2XWBB 4D7YA 1TMF3 4XF1A 1NY72 1YFWA 5J98B 3VZKA 4EWAA 4IL7A 3U4XA 1RMU2 4R9BA 2OPKA 4FTBA 2GAUA 4ZU7A 1G9AA 4KBBA 3S7IA 1KITA 1D4M1 3VDDC 1H8TB 5KXEA 2EIGA 4P14A 2WA4A 4WVMA 4XETA 4MGYE 3SH3A 1XU2A 1XYNA 2PFWA 1W0OA 2ZACA 3O5SA 4HPKB 2V73A 3T1MA 2GNMA 4LBKA 3ZYJB 5HI0A 2ZMLA 4PF5A 1V6JA 3MFAA 5K7PA 4L92A 2PHXA 3ILNA 4A7KA 1HV1A 2MHFA 2WFF2 3IDBB 2XG3A 3M3EA 4P9WA 4PDWB 1YFUA 1RHI3 4Q4W1 5JIUA 1QQP3 1F5FA 4LLOA 4GWMA 3WZ1A 1NZCA 1AYM3 1RUNA 2ZZJA 2UY8A 2ZGLA 4IEZA 5JOYA 1H8TC 1W6QB 3KCYA 1D2QA 1HRI3 1WLDA 2B9UA 4ES8A 4XBNA 4XFFA 4XMIA 3M3OA 2R043 2I45A 3QACA 1WA4A 4N53A 1AL21 1S0EA 4AEDA 3MIEA 1V00A 1LR5A 4YG0A 3HBZA 1Z7S2 1KRIA 4FTSA 1VJ2A 4OHWA 1PNFA 3M4FA 3EBRA 2EAAA 2QDRA 5ABJA 1W6PA 3J4UH 4DY5A 1HRI1 4E4SA 2GALA 2VUJA 1FMD1 4RGGA 1QJU2 5FLIA 1POV0 1VBD3 1EAH3 2GMPA 4DRRA 5AFEA 5CAZA 3PVBB 3N36A 4JCKA 2VOVA 1CIWA 1W39A 1PK6A 1ZM1A 3JU9A 2TEPA 4HSJA 3V64A 2CNAA 3IM0A 2DCTA 2GH2A 4RHV2 5K8SA 3B5LB 4FQZA 4KNCA 1PGL1 2WNEA 3TRSB 3DV8A 4COUA 3V0BB 3JB8A 1H0BA 4AEJA 1UU4A 1FOD1 2GNTA 2IXKA 1YUDA 2W68A 5JLVA 3ILFA 4Q4Y2 4S2FA 2BTVC 1UX6A 1ULDA 2YV8A 5C9AB 4Q8KA 3JUUA 5JI7A 1G6NA 4FOWA 1MS9A 2HWF3 1CJPA 3RQ0A 3VHNA 3LZZA 4FPKA 4DINB 1GICA 2A71A 1CESA 1RGSA 3C3VA 3KS7A 1LB2A 2XJRA 1LODA 4TLFA 2UY9A 5C8WA 4YSFA 1F31A 4C90A 1DBNA 2QZ3A 3JZVA 1COV3 1RUJ2 2XH6A 5KHHA 4LBQB 4KG8A 5C9AC 4Q1PA 5A33A 4CEYB 5JCTA 2RM23 1DQ0A 1HRV1 4D7SA 1ULCA 1YFYA 3USUA 2D43A 5IUQA 1RVF3 1WUVA 1JHNA 2NN8A 3N7LA 3DL3A 1NE4A 1BBT3 4YNIA 1VB2A 2HWB2 2NP0A 2H6CA 2ZGMA 1BMV1 4Q4X1 1QOTA 2EAKA 4BE3A 2WSUA 2GNBA 2R1BA 5FREA 1H4HA 2C9AA 5CNAA 4MZUA 1PVC3 3WDTA 3A0NA 1PVXA 1BQPA 4BZ4A 3E6CC 3TB0A 2GC0A 2Z5WA 2RS51 2IC1A 3AK0A 1RC6A 2ET7A 4XQDA 4A7ZA 4CEYC 1H1IA 4M00A 5JDBA 5F6KA 1JUIA 2WS93 2RMU1 2VU9A 4PIZA 1HXS1 1FPN3 4NWWA 3IWZA 2R071 3JCIA 1JTZX 5FO9B 3D0SA 1WLWA 2AZ5A 4LBJA 3GZAA 4YLZA 2XUMA 1C5HA 4CDQB 3C2UA 1HQLA 1ASJ3 2DCKA 4HETA 5JPNB 1VBA1 1LU2A 2A70A 2WZR1 1VBB3 5FAXA 4Q4V2 3MIBA 1S0DA 5T5OA 4U2AA 2WS91 3ZIXA 4E2QA 5DDJ1 1K5MA 1RUG1 3LKJA 2ZGQA 4Y26A 1NQDA 5GLUA 1XE7A 2C5DA 3MGUA 3MLJA 4FAHA 2FBEA 1AZDA 4AQTA 4IV3B 1W6NA 4Z2WA 4AE2A 3WDUA 5DZFA 3ECQA 4F83A 2C0ZA 3SLIA 1PO13 1R1ZA 2Y38A 2QZ2A 4AK3A 3WV6A 5L7OB 2ZHLA 3W59A 4XBQA 5EYXA 3FFZA 1KDKA 3FE5A 3WY6A 4Q27A 3AMNA 5EZWA 1C4RA 3HN1A 2HWC2 1AR81 4I3GA 5BNNC 5AC91 2DTYA 2JENA 4IV3C 5CIRA 3K48A 2E7TA 3QCWA 5EWSA 1AR93 2LTNA 3ZSLA 1LRHA 4JTOA 2ZGRA 3D5OA 2YGLA 1YI9A 4HKWA 4QQLA 1O3QA 4JVAA 2ZGNA 4X6QB 4JC1A 1Q5OA 1RUH1 4OZXA 5I8TA 5L7OC 2O1QA 3BOPA 2HWD1 1TE1B 3PLQA 2MPFA 2RR13 3OPZA 3UKVA 2A3WA 3E6BA 4YZ3A 1POV3 3U10A 3L2HA 3D8CA 1R1A3 3N7KA 5EV7A 1YCIA 5L36A 1AR62 1I1EA 1G8WA 2GC3A 2H6BA 1AX1A 2ZA9A 4N90A 1AR91 4CDXA 4YZ4A 2PHFA 2E51A 2W0XA 5KXCA 3RJ2X 3SH5A 4XTPA 4RQPB 3VL8A 1AJOA 1OA3A 2ZHNA 4LT5A 3S0MA 1V6KA 1JOJA 4MXWA 3PJQA 3VKMA 3QOPA 1GYKA 3ROUA 4BMEA 3U0ZA 4SLIA 1ULGA 4JDMA 1IHMA 3SCFA 4XF9A 1HQNA 1MS3A 4B8EA 5J36A 2VW1A 1GKBA 4FCAA 2AH2A 1LESA 4U36A 1E57A 1BK1A 2AREA 2WFF3 2Y0OA 3TAYA 3WW1A 3ZXLA 1LECA 1DQ5A 3AJZA 3WUCA 1L3JA 4EN0A 1FX5A 1FATA 5J37A 3I59B 4B4RA 3CO2A 4XIOA 4CEWA 1MVQA 2P3JA 4ZXKA 3B7MA 2JECA 5CB7A 2QKDA 4YGDA 4C0BA 4YZ1A 3ZN6A 2XJQA 4ITCA 1QJY1 4GKXA 4LHNA 3ZMNA 2DVAA 5CBLA 4B29A 2PHRA 3QBQA 3VKNA 5JPMB 4GH4C 4XF3A 4EV0A 3TYJA 3D0JA 4FPFA 3GHMA 4AI2A 3L9JT 1Z7S3 4PQ9A 4ISQA 4D3WA 4AVCA 1H2NA 2Z79A 3PNAA 1ZRCA 5SV5A 3AB0A 3JD71 3WG3A 4AWDA 1WW7A 2AUYA 3BCWA 4QT6A 4LBLA 2X53S 1MZ6A 1N1YA 1QJU3 1VBC2 4WM7A 1W0PA 3H8UA 2PAMA 1B35B 3KT7A 2QVSB 5JSRA 4AQ6A 4RHV3 4META 5C6CA 3TNQA 1O5LA 3SITA 4WM8B 3ZSKA 2WLQA 4OI1A 1C8M2 4A3XA 4NHKA 2EVXA 2X5IA 4COWA 2O8OA 1CAWA 4IXLA 4LO6B 4Q4Y3 2OIIA 4S2HA 4HN0A 4YW2A 1C57A 3E97A 3MICA 2WA3A 3SCGA 4QGLA 2VGDA 3RRDA 2DUPA 1B35C 3THPA 1SBEA 3MIFA 2F6BA 1LOFC 3IPVB 4AVTA 3M1HA 1I6XA 4J6GA 4D94A 2I2SA 3L2YA 2WLPA 4QXKA 3AZZA 4WM8C 4AW7A 1YI7A 4AI0A 5C33A 2A73B 1U5XA 3M3QA 2DCJA 4DQAA 4OHYA 1D4M2 4HFSA 1RUJ3 4CDUA 3AKRA 1NCRB 1NG0A 4GKYA 4XJ9A 4DNYA 5BNPA 2P3KA 1O3RA 4I3PA 4ONUA 4QPIB 1R082 1RUI1 3LAGA 2WNVB 4P9GA 2PHUA 1SLBA 5GM0A 2VVEA 1WD3A 1S2KA 3ES1A 1RUD2 4W6WA 2BNMA 4IEWA 3MF9A 2HWB3 3NV2A 3WOGA 2XVKA 1HLCA 2P37A 5GLZA 4RR3A 4AGGA 4Q29A 3ZXDA 1FNZA 1S2BA 1VRH2 1PO22 2ZGPA 5FRAA 4ATEA 1NCRC 3RI8A 1EV11 1YYNA 2JJ6A 1VLNA 4X8NA 3VV1A 1BCXA 2ZKLA 2D3RA 2BPA2 2P17A 2VVFA 4R9CA 5IK7A 4MLOA 2BGCA 1VAMA 3VBSB 4AYUA 4QPGA 5FPZA 5BNOB 2G9FA 2IXHA 3I7DA 4H7LA 4I02A 5E88A 2G9GA 3LOIA 4YG3A 4Y1XA 1D0GA 5IT6A 4I09A 1ZZ6A 4FAGA 3UJQA 2DTWA 3FWEA 1W6MA 3E5XA 4Y24A 1HIXA 4Y20B 3WNXA 1Y43B 4I2OA 2GC2A 1VBE1 5LK5A 4TSVA 1SLLA 3CJIA 5CG8A 1EY2A 2RE9A 4YARA 3CU7A 3KMHA 4URTA 2DCZA 3H1YA 2V5YA 2XBO2 5BNOC 2WNUA 4YGBA 3ZFGB 1NCQA 3RPQA 2ZX3A 4CP1A 4LBOA 3W9AA 3M2MA 2I74A 1R092 3R6SA 2CGPA 4XFCA 4Q2FA 1EP0A 1FOD2 4XJ8A 4R8HA 3N4MA 4XFGA 2H0BA 1KXGA 4AI3A 4RS5A 3MFCA 3S30A 3D82A 3OGJA 1OPOA 2GDFA 2NPIA 3ZYRA 4FTEA 1HX6A 2DCYA 2HWE1 1JYIA 5CG9A 1ZRFA 2XVGA 3ZFGC 2HWC3 2K2SA 5B2GB 2Q5TA 4D7TA 4OULA 1SACA 1ZBE1 1MS0A 3H3UA 4LA2A 2AGSA 3VBFB 1GSLA 3NAPB 4YVWB 1G9FA 4LTAA 1OOPB 4LHLA 2CWSA 2A6ZA 5I8SA 1QJZA 1GZ9A 3U07A 5A32A 4AVAA 2FQPA 1D4VB 3LSDA 1HRV2 3DF0A 3ZSEA 3IDEA 1IOAA 2FMDA 4XFHA 2PELA 1AR63 1GZWA 3KCCA 4MGZE 1FT9A 1I3HA 1AYN2 4KL1A 4YM0A 5J09A 1SCSA 3MPPG 1V70A 1S0IA 3VBFC 3NAPC 1SBFA 3VBUB 1IKQA 1OOPC 1RUE3 2ARBA 2XGXA 4B4PA 1HQWA 5AVPA 1KDMA 3G6JB 3CL1A 4XOGA 4N9HA 1WMFA 3A0KA 4JV4A 1C5IA 2D5HA 4QX5A 4Z1VA 5JVVA 4RD7A 1ZZCA 2QNKA 3WDXA 5CADA 1WD4A 5HBAA 1AR71 1S0JA 2Q1ZB 2PLV3 1F9KA 1V9U1 5IK8A 3VBUC 4RGAA 1ONAA 4YW4A 3MYXA 1Y7BA 5EJ3A 2HEYF 5A3LA 5BY5A 5DDJ2 5T3NA 2ZBJA 2ZZQA 1N1TA 4NWVA 3AZVA 4P9IA 2EXJA 4IV1B 3VZMA 5LRSA 1LHUA 4CDWA 4KWJA 5I0UA 4YM3A 4KU7A 2WIIB 3WG1A 2P2KA 4BH9A 2PLV1 4JQRA 1RUF1 3AYDA 5H9PA 1UU6A 1URXA 4RFT0 2WFPA 1LCLA 3AP6A 4I0WB 5GJ6A 3POWA 4DMIA 2JG9B 2XJUA 3USSA 2DVGA 2LM3A 1VBC3 1OMIA 1ZZ9A 4XJZA 5FQ0A 1CD3G 1YLLA 2ETEA 4KWLA 2JD4A 1WMEA 2GZWA 1CR7A 1IS4A 1G7YA 3ALQA 3MW2A 1A3KA 3KCXA 4N53B 1G9DA 4HLTA 4AEDB 1GQHA 4N7UA 1KFXL 4HK9A 1C8M3 3PVOA 2GU9A 4M3CF 1UW8A 1QJX2 1LENA 4GWNA 1DG6A 2HWD2 2Z69A 4JRLA 4BOWA 5JWPA 3AMMA 5ABJB 5IK4A 1W6PB 2ZGUA 3B94A 1HV0A 4FXKB 2UYBA 3RMXA 3KQRA 5GKAC 3TOJA 3OD0A 4XTMA 2OZJA 5T5PA 1BEV1 3VKLA 3WCRA 4N53C 4LA3A 4Z82A 3H7JA 4AEDC 4R9DA 1PK6B 2RS31 4FPHA 1N3QA 3BODA 2A3YA 4IEPA 4UBHA 3VBOA 4B7KA 4TYSA 1PIV3 1YXWA 3KSCA 3HT1A 3LGRA 5EXOA 3PVNA 3ZYPA 5ABJC 1R083 3HT2A 5EFUA 1MQTA 2R32A 4COVA 1CONA 1RUD3 1ZBA2 1OFSA 1PZ9A 1F8VA 1TMF1 2E6VA 3KD4A 2VOKA 3IDCB 4WV8A 1PK6C 5CA6A 3DKWA 2DF7A 4FBFA 4AVVA 1VRH3 3UV9A 1XYPA 1PO23 4FPOB 1OLRA 3GHNA 1GZCA 4KGQA 1UN1A 5HXVA 3ZXJA 4XE9A 3FLRA 4Z92B 1C1FA 1ENRA 1UKRA 5CFDA 1AXYA 4HVOA 5K9YA 4AG4A 4XDQA 4E27A 5A33B 1MVEA 3AX4A 4H7MA 1SEFA 2GSYA 3USUB 3NSTA 1YNAA 1T6GC 1RHI1 2QJVA 1QQP1 2CYFA 3THTA 1A8MA 2A75A 3AYEA 1LEMA 1LJ7A 1AYM1 1ND3A 3VBHA 1LOBA 3JD72 5F5QA 3BOWA 4LEJA 5FMOL 4M01A 4EN8B 3OYWB 4QD2A 3APBA 3WQ1A 5T5JA 3AP5A 1WLTA 1J1TA 1ULFA 2R041 1SLCA 2R1DA 3ZXAC 1CN1A 2XBO3 3NKGA 4K9SA 1GNHA 2A6XA 2WKKA 3VGIA 1Q3EA 1U5IA 3R0RA 4YVSA 3DPRA 1U0AA 3O0XA 1R093 2R062 4G9SB 4GMP0