2C9AA

Crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
259
structure length
259
Chain Sequence
ETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE MU
publication title Molecular Analysis of Receptor Protein Tyrosine Phosphatase Mu-Mediated Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 259
sequence length 259
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c9aA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c9aA01
1GZQA 2BVPB 1MRCL 2BVYA 5MEPB 3PVEA 3OBRA 2AXJA 2VXVH 1WGOA 3TO4C 2GMMA 4XPAH 4L4TD 5KN5B 4E9LA 3AYEA 4JFPA 5GZCA 4GMSL 2JCCA 2PTTB 4FPHA 5IFHL 5DHVB 1P7QD 2EDNA 1MNUH 1RJYA 3IJSB 4Z0XA 1NFDB 4PGDB 4P2QE 3RP1A 4BYHA 3NAAH 5CWSB 4OB5L 1NANH 4QRPA 2A0LD 5J7CC 4NRYA 3BDYH 4HWUA 5D7LB 3WFCL 5JDSB 1C5BH 2ZP0T 1CFSA 1NDGB 1DQ5A 4LEXL 1OTTD 5DRWB 1Y0LA 4XVUD 2YROA 4FFVD 2RCSL 4Q9BA 2GCYA 1U95B 5D72H 4QOKA 5ITBH 1K3ZA 1HILA 3EO0B 3JXAA 3CLFL 5C0JA 2EO1A 4Y89A 4HK0B 4Z7WF 4V1DA 3LEYL 3FQUB 3S4SA 1MH5A 3GZKA 3MV8E 3LQAH 3DGGB 2B1AL 3O4LE 5DFVD 1DBAL 3IDNA 4EI5A 4JLRB 5JW5B 3NIDF 5IK5A 4R4ND 3HZMA 2RR3A 1JPGB 3EAKA 4WWKD 3OG4B 1DJSA 5F89A 1KJMA 3E6HB 3GMOB 5BS0D 5AEAA 4M1CC 1BJMA 2C3WA 2ZCHH 1Q38A 4OT1L 1M7IA 5HHPB 3EDJA 5BO1H 3RIFF 5H9RA 4BMBA 3MV7D 4Q6IA 5FHBL 3RTQC 4XPHH 3T1FA 4JFOB 1CF8L 4XZUB 5F1IA 3TYGL 3DBXA 1S7RB 2XV6B 3C9NB 4LEOB 4FG6D 1V6KA 2R9HC 1MPAH 4BA8A 4AL8L 1TJHL 5EUOF 3G04B 4GA9A 5AYUH 4FQCH 4MAUH 4C54A 4YGEA 3B8SA 5DD5L 2UWAA 3IFNH 4XWOD 3SDCD 5ICXA 5T3XL 4U2ZA 2XZZA 3UAJC 3B9KC 5DJZA 3BODA 1G9EA 1AGDA 1CD1A 1GPOL 4OQTH 1O4YA 4J3SA 1JZ3A 3M1HA 4XPFL 2X4SA 4U1SA 4RMTA 2ITDA 4MQ7A 3IGAB 5IM7B 3M8OL 4Y1AE 2ZPKL 4JFFA 4MA3B 4FP3A 5LG1A 1SLLA 5CNAA 4U1MB 1NJ9B 4XPBL 1MCPL 4AEHL 5DA0B 3V65A 2K1MA 4GBXB 3P4OB 4JFHD 1Q0XH 4HWZA 2X09A 4P2OD 5J1SC 2ARJB 1DFQA 3I2CH 1KJRA 5IBLC 1ADQA 4BLIA 4MJ6A 3VG9C 1U91B 1I4FB 5C6TH 2ZGQA 2DBLH 5ETUB 2YBRB 4HIIB 3BH8B 3S7GA 1NSNH 5T1DL 2BFVH 2BVQA 3X11B 3U2SB 1T7WA 4L8BB 4B53A 5DUVA 1WZLA 4IM8A 1AKJB 3OKMA 1G9AA 5IF0A 1VEMA 1X6NA 4L9LC 2FIKA 4JVPA 1MHHB 2BHUA 5C07A 4X7TB 4LCCC 1Q9OA 4CW1B 4XNYL 4A6YL 3ZKSD 3S9DB 4XDQA 5JIPA 4RA0C 4YLZA 5FA4A 1D3CA 5I18L 3C5JB 1LOGA 1QYGH 4FABL 2H2PC 3W11C 3NFPA 1C08B 4KUZL 1IM9B 4L1DA 4OLVL 5SWSA 1LDPH 5CD3A 3HG1E 4IMLB 3K46A 1GXEA 2VTFA 1AY1L 3CH1B 5L9DL 3DX8A 1I9RL 4OCYH 2Q86A 2PYEE 3F62A 2XTLA 4HS6A 4XMPL 3EO9L 2G60L 4AGVA 1AC0A 2DOCA 5BJTA 1S9YB 3NN8B 5MENB 1ODAA 1YY9D 4K2UH 4RFOL 3EHBC 2NY2B 4LVHC 3TPUB 4XNZB 4PYGA 3MRQB 1QU0A 3O9WC 1QA9A 1AGBB 1U36A 1PDKA 1KCUL 3Q5OA 4PJDF 4OV5B 2EKJA 3LKRA 3RPIB 1RVFL 3BEWA 3GMPA 3L7FB 3RDTB 5IB5A 1WW4A 1LILA 2D4DA 4TUOA 1HHGA 4PJEF 5D7IB 2O93L 2FEEL 3NFSH 1ZT4A 2D9QB 4NNYB 3LCYA 4QYOB 3GKWH 3TO2A 2E7MA 4MNGA 4E41E 4GRWF 4XHJD 1S7SB 5EYYA 1LHVA 3V5HA 4GRLC 4LOUD 2VIRB 3GHEL 5BYNA 2I24N 2HN7A 3SKJH 5H94A 2VUAA 1JI2A 3FQXA 4DEPC 2GT9B 1JGEA 4HV8A 5EO1A 5IIEA 1V6NA 4X6DA 1NGQL 3Q6FA 1X5GA 1FG9C 4Y8DC 1BP3B 4BKLA 4PJHE 1C1EH 3E2HC 1W72L 1PKOA 4XCYB 5DC0A 2ID5A 5E9DB 1JNNH 3I02A 1CGVA 2A74B 2OCFD 1HSBA 2X10A 2B2XH 4NDMB 5FECB 4JAMA 5D6DA 2VXTL 4KZEH 2DM4A 2AJYL 4U6XA 3STZA 1T6WA 1DP0A 3IJHA 2R1WA 1V6LA 5DJ2B 1IGFL 3HMXL 1I1RA 4GAJL 4LLUA 1OSPH 4MNQD 3CFDB 2X1WL 2AK4E 2HFFB 3O4OC 4N0RA 4JGMA 1N1SA 1WBXA 3OKEA 4EVNA 3IYLW 4EZMA 3G6JA 3TBYB 4GAYA 4WHDA 5DHXB 1F4WH 3PWPA 1KEMH 3MBEA 4PJ9C 1BIHA 3W81A 1FO0H 3SPVB 2JCCE 2BSED 4OZHB 5A2IH 3DX7A 3MEPA 2XWJA 2AREA 2YZ1A 1FL6B 3G6AA 3GSUB 3JWDL 4PY8J 3BT2H 4JHZA 3VA2C 2VQTA 4XC3L 1I7TA 3DGCR 2H45A 3OKOA 1T04B 4QRPE 3V52L 1HDKA 1Q1JH 3F7YA 1OQOA 5HJ3B 4LIQL 1ULEA 1RPQA 4PGEA 1MFCL 3H7BA 3DHJA 5L73A 4XC1H 4JKKA 4PD4K 5GZNC 3C8HA 1H8SA 3E6FA 1J0JA 3C08H 4LPVA 1TJGH 3QCTL 1MF2H 3SDAC 1DYPA 4KROB 4QOKE 5ENWB 3R06A 4HKBA 3GBLA 3CLEH 3P0VL 2EAKA 1LEIA 2WWMC 2EXIA 3WFEL 4LBNA 2IPKB 4M4PA 4PGBA 2VAJA 2OLDA 1X5HA 4KXZH 4HIJA 2GJ6A 4WHTB 3A67L 1KJVB 4P4KD 1UVQB 4P4RB 3ZDZF 2WM0A 3TNNA 1C5DB 1DVFC 4XVTH 2KZWA 3D0LB 4UIMB 4LPXA 2VXUL 1SBDA 3ZKMD 1IC5L 1F4AA 3QZWB 2APFA 2X40A 1OVZA 3QG7L 3T04D 1MVUB 2Z31A 3NVQA 4MWFA 1WEJL 1OSZA 2ICEB 2OM5A 4I0CC 3O0XA 4MMXC 4UAOC 4IRZH 1W6MB 1MREL 2WT1A 3MFFB 3ARBC 5IHUL 1N5YL 5F7NC 1XF2B 3VJ6B 5CD5C 1QFWH 5DEGA 4NYLB 3D39A 4O2CA 5HDQH 2BNRE 2HRPL 4F7TB 5DK3A 4LSUH 5E8AA 3FB5B 3T0EE 3CMOH 2CKBB 1SEQL 5HGDB 2UWBA 3DRTA 3EYUL 2ZZUT 4R96A 3MCKA 3VWKB 3DVIA 4AEIL 3KPLA 3QEUB 3ARED 4I18A 4JFFE 3BFOA 4P3DB 2D6PA 1MJUL 1LOFC 5E1AB 3GM8A 2EDFA 3PDOA 3CZFA 4ZFOB 4P14A 1OAXL 4BM7A 1U8OA 4NWTH 1G0DA 1EK3A 4XB8A 3RRDA 3DHMA 3SDDA 1IFHH 3SDXA 4RISL 1HHJA 1WQVT 2EDHA 3FUOA 3WHUA 3BDXA 3QFDA 3N1QC 5EUOB 2OXGA 4CJ0A 2H26B 4JFEB 3EDKA 1DQQA 3MRLB 3FJTA 4Y16B 4Y19D 4LRIA 4OZGA 1DEDA 4RMQA 3LQZA 2W0PA 4PG2A 5H2BB 1ZT1A 1KB5H 4P23D 3HE6A 4L4VE 1J5OH 4WI4A 5C07E 4PJGB 1IKNA 4ALAL 1OAKH 3CGTA 1A2YB 2AJ3B 4HUUB 5KSAD 5LCVH 1JZ7A 2P4AB 5E99L 3ZHKA 3ROOB 4AIZB 4B7LA 5IB4A 3QXDA 1WSST 4WY7L 1AXSB 1XGPB 4Y2DA 1KC5H 3NPZB 4LBJA 4PBOA 2IPUG 2ORBH 1HYSD 3HS0B 4DK6A 1CTOA 4TVPL 4X6CE 1UYWH 1JN6B 2DKSA 1YY8A 7CGTA 3M3CA 5BZDB 1NGPH 3QUZA 1RZIA 2MCPH 1BIIB 1NCDL 4CMMB 3W0WE 4KTEH 4L3EB 1I3RA 2H3NB 1QF3A 4WFFE 2HYMA 5D2NA 1BAFH 3QUMB 4YDKH 1L7TL 4AMKH 4J4PA 4DKDC 3GGWB 1QLEL 5DRNB 5KSVB 5JPMB 4JFDE 4UDTB 3UZVB 3P77A 5K9JL 3MW3A 2XZAH 3AC0A 3KWWB 3MNVA 5L2JB 5HGHB 5I0ZA 1CICC 1OT2A 4BFIB 1BOGB 5KJRL 3K2UL 1M71B 2G2RA 5DRXA 1CLZL 1L9MA 2I5YL 3C5ZC 4PRHD 1E28B 5JO5B 3L7EA 5IVOA 5JXEA 4LFHG 4NQDE 1MR5A 4ODXB 1W6OA 2IGFH 5FRAA 2NW3B 4FPGA 1W0WA 1CLOL 1N8ZB 3D9AH 4PTTB 2OL3B 1T7ZA 1J1OL 3AXLB 3QJFA 1TNNA 4RGNB 4X6DE 4NZTH 4PGZA 4M6AA 4MD0A 1GGYA 2DYPA 3LSDA 3SY0A 3ZE0E 5F7DA 3BKJL 4XVSH 1KEGL 5LQBH 2VZUA 1KJ2H 2QL1A 2F53D 2H0BA 5CLTA 4D8PA 2C1OB 1Y18B 3QISA 2D7OA 2OZ4H 2ATKA 3PWJA 5TF0A 4AT6B 1WT5A 1JK8A 1VGEL 3MMEA 3TIDA 1X44A 2AJXH 1N6QH 5BVPH 3NPSC 5ID1A 2B20A 1J1PH 5F9WB 2J8UA 2YRLA 4Y26A 1YYNA 4GRWB 1XZ0B 2Z9TA 3GSXA 3RWDA 2QQLH 4HKZA 4U1IA 4PRIA 1RV6X 5DEFA 5HTSA 3PL6A 3G6JE 5GLWA 4ZUSA 3QH3B 1C12A 4WFHE 2A75A 1PY4A 7FABL 4FQ4A 1MIML 2CD0A 4QTHA 4KRPC 2GAZA 3N9GH 1BBJB 1U8NA 3JV4A 4NT6A 1CVRA 2VLRA 2QEJA 4JO4L 1B0WA 5F1KC 4KKBD 3PQYD 2WMPA 4XJUA 3LMJL 2WP3O 2Y7QB 3CFBB 3FLPA 2PW1B 2XKUA 4IOFD 5CP3H 1CFTA 2VXQL 1S8DA 3M3EA 5T5FH 5IHBA 3HAEA 1TZIB 1WK0A 3GSNA 1JGLH 1ZHNB 3QQ4A 3HFML 3QIBC 4PBWD 1KQRA 1VFAB 5ESAA 1EZVY 3NACL 5HYJA 2B5IC 4P5MB 3RX5A 3B6SB 5DLMH 4WW1B 4ODWA 2C3XA 4YHOL 4QHKI 5DFTA 2X4UA 4DUXA 3TA3A 1DN2A 4WIQA 3BO8A 3U1SL 3VKMA 4LVEA 5D71L 4KRNA 4NQVA 2GJ6E 4KQ4H 2AV1A 4CRPA 1YEGL 4W4OC 3RWCB 4UTBH 2YPKA 3PIQA 1MCCA 1UEMA 1QSFB 4YWGH 5GIRB 3NZ8B 3ZSKA 4NN5C 1LO3H 3SJVD 4M1GH 3SKOB 4KKCC 3WDYA 1P7HL 4DK3A 4UZGA 3W82A 1X6LA 2R2BA 4HIEB 5E8DH 3ARDB 3PP3K 4HUXA 1LOEA 3RVXD 1ND0A 1CDIA 3F7VB 4JPIA 4ZFZA 4TPRL 1DLHA 5CEZL 4RZCA 3OAUH 2XB6C 4H8WL 2L7UA 4OFYA 3WHXB 3HNSH 4CU7A 3QAZB 5KZCD 3CVHL 3HI6L 4MXQC 4NZJA 5CILL 4LLYA 4HAGA 3DMMD 4JR9L 5HHOA 2XZQL 3TVMA 2HA1A 3BKCH 1EVUA 4JDZB 2HFGL 1CE1L 5F7UA 2Z93A 3TN0B 5IW6B 4IOSD 3NCJH 1OP5K 3SKMA 4X8JB 5EPMB 4APQA 5J06A 3MV9D 1DBMH 4JANA 5E94A 1QFHA 1WC7B 4RFNC 1BZ9B 1LEDA 2R2HB 1VFOA 4P9YA 3VXUB 1WAAA 4GW1A 5T3XE 1JW6A 1PLGL 4HFUH 1M7XA 3VFTB 4JRAA 1MJ7L 1LGCA 3ARTA 5B38A 5FGBA 3QJHB 5AZEL 2JCCF 1G7IB 4IRSC 3KYOB 4OM1L 3MLRL 4NQEE 1H9VA 1UKGA 3A6OA 4XRCB 3ULSB 2NX5B 3V64A 1M6OB 1LE5B 2X44D 3I6LE 2WSVA 2A9ML 3IFPB 4IQPA 5TF1H 1X5FA 4OF3A 1EO8L 4OAWB 1LU2A 1WF5A 1F11B 2NXZB 3GEWB 1NPUA 5T1KD 3VXPB 1UKTA 4MCYA 5A16B 3IDXL 3QQNA 4FP2A 5GS0L 3KLHC 4KQ3L 3FQRA 3T2NL 3L1OH 2FZ3A 4XTRD 3PGCA 1ZEAL 1IKPA 2XNAB 1VB9A 4NC0B 4OCLC 1ZGLB 1D6EB 3KHOA 2VZTA 5F3BB 4HX1A 1OGAD 2QHRL 3NA9H 4PRDB 5FKPB 3TBWA 1B0RA 2HJLB 3TAYA 4K9EC 5I8KH 3D5OA 4P2QB 2CJUH 5B39A 4QO1A 1KG0A 2R69H 3SQOH 1UZ8B 4I5BB 2X9XA 3RHWK 4G8EB 4XCCH 3RSJA 2AVGA 4P2RE 4R97C 3BVNB 2E7BA 4AY0A 4RNRA 2J3SA 1BM3L 3HZKA 2Q6WA 3KXFD 4LAQL 2M8XA 3WKMH 3HMWH 2J1KA 2DVAA 3VXRA 4WO4A 1KN4H 1FORH 3CMGA 1YMME 3MRDB 3RVVC 3SH5A 1JRHI 5I15H 1IAOA 1LHNA 2VMFA 1BWWA 4Y22B 3QUKA 1V6IA 4LSTH 3CCHA 4C4KT 3B2UD 3RWHB 2ZNWA 4XJAA 5EU5A 1U0QA 5IGXL 1GZ9A 2A77H 2DWDA 3MV8B 3O6FD 4HG4K 3KVQA 4CRQA 4XGZB 1LMKA 1RUML 4CVUA 5C92A 1R5VB 5ESQA 3ILRA 5TE7L 1MCLA 2PHUA 1U2CA 1KCSL 1NBQA 2OP4H 1YNLL 4HCRA 3WIFA 1LOAA 4JHAH 4S1DD 2C3GA 4X9IA 4ZDHB 3MPPG 3KPSD 3RWFB 5C0BD 2EDXA 3OPZH 5DJXB 4JQVA 3TC9A 3O6LH 3O2VH 2IH3B 4H1LH 4EI5C 2FD6H 4L8SB 3ULVC 1YMHB 4WHCA 4Z78B 1FNGB 4EQ3A 2ERJB 3Q6GL 4M7KL 5IK3A 3EGSA 2IBZX 1DSFL 1MCWW 3DROB 4QRRE 3N35A 2APVA 5GZGA 3BPNB 3G08A 1EUUA 4QXTB 1N3NB 1RIHH 5I9QC 4Q6IC 1A6VL 4Z18A 1I75A 4MDJA 1YEHH 3DTXA 5GISH 5GGUB 1IKQA 4NO0D 1RIUH 2ERFA 2IAMD 4X4ME 5CSGA 5J3HC 3TBSA 4Y1AB 3UYRH 3SDYH 4PP1D 5DHVH 3U4EA 3WL9B 4LDOB 2JTDA 2VLRE 3IVKA 3BKML 2E9WA 5ACZB 4OCRH 2OI9B 4P5KA 4GBXD 2NN8A 3TBTB 5F8QC 3GUTB 2J7LA 5DURD 3MRGA 1FV1B 1GGBL 2HT2C 4ZO8A 2J6EH 4PREA 1AXTL 1UCBH 4X6CF 1HEZB 1PBYA 2RGSA 3EYOA 1CLYH 5BRZB 1W6QB 5JMCA 4QRQB 3ATGA 5GGVH 43CAA 1JGUL 3QNZA 1I7UB 5HYJE 2FHRA 1QOSA 3RL1A 4X7EC 4H1LG 3EFDL 5BV7C 1LEGB 3MGOB 4YDVB 3GK8L 3P2TA 3V2AR 4DKAA 4DUVA 5ANME 4QRTA 4WTZG 4Y4KA 2YA1A 4F2MB 1MZ5A 5JOPD 4YR6A 1NDMB 5C8JA 2EC8A 1YEKL 1WZMA 3D25A 1OM3H 1ENRA 2ZMLA 3I75B 4J3XA 5FB8A 4R90L 1MLCB 3GI9L 5A2JH 1U0AA 3A6BL 4R2GC 3P9LA 3VU2A 4YZ4A 3VWJD 4AWDA 1WBYB 1IM9D 3B9AA 3I84A 1Q8PA 5A1AA 4JPVH 3TIEA 3BH9B 4PB0L 3HHRB 3HG1B 4ZUVA 1MCKA 1SQ2N 1JNJA 3OWEA 1MQ8A 1AGFA 4CVZB 2AXHA 1LO5B 2PYEB 5F88B 2FECI 5D96C 4X6DF 3X3FL 4FQ2L 1KDMA 4DWHA 4DZBB 1KCVL 3HI5L 4OGYL 4DGYH 2NY2D 4ZUUB 2B1HL 3MJ8A 3VXOA 4JN1L 1A02N 5C09A 1ZT7B 2BRQA 1BF2A 3O41B 1ENSA 1U8KA 4RWHA 2FMDA 1JF6A 1SYSA 1WBZA 4NPYB 2ZUWA 1WICA 4LU5H 1TTGA 4J8RB 1EPWA 4E41B 1A6AB 1FJ1A 3GO1L 1R3KB 1A21A 4M00A 4Q2ZA 4UU9B 5F71A 4LCUA 3DSFL 3OJDA 1CDUA 4ORZC 2MQ3A 1I1AA 3G6JF 4NKIL 2DF3A 2G9HB 4JGUA 1FL3A 3JU9A 4AVSA 4ODVH 4U3XA 1A4JA 4AJ0A 5EA0L 5JHDE 2YR3A 3QUYD 1D9KD 3U0PA 1JGDB 2C3HA 4PJHB 4X4XA 4D0DA 3FTGA 3OR6B 1YQVH 5DQDL 4OI7A 4IHOB 4YX2L 4CKVX 4JRYD 2XQBL 1CT8B 3EOBA 3UTPE 3S34H 3TO4D 1XH3A 4YHIB 1KENH 2JJTA 3QDMD 2JIXD 5DD3H 1TMCB 1WW7A 4YHML 1LO4L 1FDLH 5SX4I 2CDGA 1A0QH 4LQ1A 4R26H 5TE4L 2I60H 1OP3H 5I1AA 2CUIA 3MREA 4ISVA 2VDNL 1IRAY 5DK0B 2OQJB 3GSVA 2Q20A 2OVUA 1Y6KR 1H30A 3PJSA 1X5LA 2AK4B 3R4SA 2FBJH 4FZ8L 5IR1A 2J4WL 3O8XB 1QKQA 1XF4A 5F72S 2VQUA 2QADC 4KJYA 2A1WH 5EU7E 2ZSWA 3ZXEA 1R5WA 5D6DC 5DG1A 2ZUYA 3IU3A 4P0DA 5D1XB 2APXA 4E42B 1T83A 1DL7H 1NEUA 4KK8C 5DJ6A 3C2SA 4UBDC 1AX1A 2ADFL 4QHLB 4X98B 4CDHA 5KVEL 2GNTA 3DV6A 1IVLA 5FF6A 5GGRA 1QOTA 1FRGL 3EZ8A 3NBNA 3GHBL 4PJAA 3BRFA 1N59B 5F1OB 4QF1A 3S88L 5GS1B 3ZSLA 1CGYA 3MBEC 4CVXA 2HJFA 3QO0B 1OF2B 5H8DA 1ZHBA 4YW1A 5I8EA 1BGXL 1CFQA 2XWBA 3ZDYE 4JM4L 4IS6B 2CXGA 1J1TA 5GZDA 4JREC 3U7AA 1T0NB 1NCTA 2FYYB 3MLUL 4LSPH 4M1CD 4PP2A 1IGJB 3D69B 1FFOB 4QRSB 1UENA 5FYKU 3MNZA 2BXZA 3QQ9C 3RTQD 3NIGE 5EZIH 3VFOA 2ICWJ 2VISB 2YK1H 5DMIH 2FSEA 2BX5A 1FCCA 4YPGB 3WOGA 2Y9RT 4PJCE 3MYJB 1V7MH 3VGAB 3W2DH 4AENB 2BJMH 2R9HD 5I8OL 3MQIA 4C83A 3ZYRA 3V6OA 3ABZA 3MPCA 4FNLL 3V4VH 1EERB 5DVMA 5KVDL 3T1WA 4BZ2L 1OP5H 4GKOA 2Y07L 4XPGH 2KM2A 1KYOJ 3GI8H 4U0QB 4WEBH 1GIGH 4ZTOL 4X7SL 5ABDE 3ARGA 1TVBA 3UAJD 1GJIA 1JNLL 3GMLB 4JRXA 2ESVE 1Z2KA 2ADIA 2EDTA 3WNXA 3HN3A 1TCRB 5HI3C 3T0AA 5LGHL 5CMAB 3RY5A 4OLUH 3OY8A 2AP2A 2L4OA 4NNXB 2I26N 2NZIA 3SDXF 2W08A 3HC0B 3UPRA 1V6JA 3W39B 1HIMH 1JHTA 4OFDA 3DXAD 1JRHL 3AYCA 2CIKA 5IHLB 2EYSB 4URTB 1D5IH 1FG2B 3DIFA 1J0YA 4OZGF 2PHRA 1IILE 3VFGH 5I71C 2LFGA 4YUEH 1OT1A 3UJTH 2BNRB 2DM2A 4L8DB 3QRGL 3T4AB 3VXTA 3IJYA 5IBLD 2Z31C 3FRPG 3MCLL 1DUYB 3T0EB 2VDRH 3BD5A 3O45A 5EBMA 3TBVB 3RNKB 5IK7A 1F9KA 1MCDA 5GGTH 2P8PB 2BNQD 5HCAA 3VWKD 5CS7A 5BQ7A 5IQ9A 1T5WA 1KPUB 3D85D 1DBJH 4LVOC 4YDJB 4MDIB 3BAEH 3P0GB 4CUCA 3GJFA 25C8L 1HXYB 3MBXL 4OUUB 2AEWA 2CIIA 2ZGRA 3VXSD 3WN5B 2VLKA 2XACC 1R3LB 1A7NH 2Z91A 4K3EL 4F80A 1K5NB 1MS8A 3MRFB 5J9PB 1UKQA 3WIIH 3MRMB 2NY3B 1AP2A 1XF1A 5T5NG 5JIKA 5CZVL 3MLXL 1T1WB 1FNSH 2IG2H 1TPXC 3K3QA 1S0EA 3D4KA 5C2UB 3V8CA 3KYNB 4I18C 4G43B 4OQTA 3JTSA 2H2PD 2BNUA 3W11D 3G5XB 5INDA 3RU8H 3N7MA 3DVGA 5DC9B 2G5RA 2ZOKA 1DBKL 2ICCA 4Z7UA 4F57L 4L4VB 2FHFA 2F19L 3SDDC 5C07B 1P7QA 3U30B 5DXDA 5DI8A 5D7SL 1ULFA 2AI0H 1E4XI 3N7JA 4F83A 3EHBD 4LRIC 1MOEA 1M05A 5EOCJ 4PG2C 4MJ2A 3D3VA 4QEGA 4TSCL 5C0CD 3UROR 3HE6C 1X5JA 4X6CB 3TGXA 4X5XA 1IKNC 2CMRH 5JHLH 1JZ2A 3LRGA 3CFJA 2RFXA 5KOVC 2X4NB 3IDYB 1LU1A 4GLRI 4Z77B 4GMTL 3W0WB 4DAGL 3BWAB 2CYFA 5FYJU 1KNOA 1T4KA 4DVRL 1ZV5A 4GRLD 4HMCA 4BSWA 1C8PA 1O7VA 2GK0B 4Y2DC 1BJ1H 2X4TB 4L8CB 4JKLA 1FLRL 3FRUA 2C1PB 3V4PH 4OSUH 1D5XA 3T3PE 5K9OA 4Y5XB 1DE4B 5BVJB 1U3ZA 4JFDB 3ZKXC 1CONA 5FEBA 3QUZC 2SBAA 1PSKL 2CKBH 1TJIL 1QLFA 4FP8L 5JVVA 3QDJD 3V0BB 4DS0A 1HI6A 2XN9A 2E53A 5HSFA 2L7JA 5D2NC 3WD5H 4Y20A 4J4PC 4PRNA 4NQDB 2A6WA 1NAML 2E9IA 1CXHA 1T03H 5C0FB 4UT6H 1EIBA 3FO0L 1MEXH 2N1KA 4Y5VA 3STBA 3T2TA 1MFAH 4F7EA 2NZ9C 5TE6H 3ZKNC 3VFPA 1YEFH 3WUDA 4LCWD 1S7TB 3QZWG 3FCTA 2ZMKA 1SYVA 2VC2H 2LVEA 1RIVH 3I02B 3WLWD 3ZKQD 4HEPG 3SO3C 3RVWC 5FIEA 4NKDB 1NC2D 4QY8A 4D9LH 5JXEC 2P47B 4PJ9D 1U93B 5JW3H 5FUCE 1Z6JT 4HC1L 4Y4HA 4GWNA 2Q7YA 2FB4L 3DJ9A 3PV6A 1VPOL 1X7QA 4N0FB 5TJWK 2BXYA 1OAYL 3UBXB 4MX7B 2XXMB 4YM2A 2OJEB 3CD4A 4YHLL 5D4QA 5AUMB 3EDFA 4JO3L 2ZHLA 5ADPH 1UPSA 3VFMB 1F8TH 2MSPA 4OLXL 3MA9L 2DL9A 3V5KB 5JOZA 3G6JB 1EDQA 1W0PA 1PFCA 3BOVA 4H5SB 1T1ZA 4TULL 1MRFH 4HUWA 2DDQL 1WT5C 2C4XA 5GZND 1U41A 1KN2H 1RK0B 2OR9H 1IL1B 4TSBL 4OZFB 3WJJA 1LOCA 1EX0A 1YO8A 2DQFB 2M1KA 2YN3A 3GNML 5ID0A 5KAQF 2CLVB 1DQ0A 2D7TL 1A6UH 2DLGA 2CRYA 5T3ZH 4U1KA 1CXEA 2WWMD 4NBZB 3PL6C 4N90E 1UMZA 4D9QE 4NHCH 2YKLH 1FBIL 4JFQB 5EORH 5I75C 1BEYL 2EXYC 5F7KC 4GSDL 1G7QB 3GSQB 3HC4L 5TH2B 3WUWA 4XTPA 1MJJB 3ETBF 3E6FB 5DT1L 4OIIL 5I1EH 2JB6A 2X4PA 2I07A 2EKSA 2IQAB 4I0PA 1FO0A 4BUHA 5AG8A 2Q3AA 3V4UH 3N1PC 1FFRA 4NO4A 1PQZB 3KJ6H 3AZXA 4RX4D 1QDCA 3WSQH 5FO9A 2NLJA 2D31B 2YS4A 4ORGB 1AX0A 1AE6H 5EBLA 1A7QL 2YPLE 5KSBA 2A6VA 4OCXH 5D1ZA 5LVEA 3C5SB 3SE8H 1UB5B 4KDWA 1UC6A 3V6OE 1XIWA 1N4XL 3FFCB 2OL3H 1WFOA 3ARBD 1ES0A 3JWOC 3PHOB 1KPRA 5D5MA 5F96L 2VLJD 5CD5D 5IVXA 1GCFA 4K07A 2AEPH 3HRZA 3TA3C 1FE8L 4QGYA 2FJFA 1X4XA 3AAZB 1A6ZA 4PV8A 1HSAA 2XZCH 4M61B 4PJBA 2P8LA 4N0CC 3VRLE 1MS9A 2VDMH 3VGGA 5A2LH 1IEAB 4JPKH 1TETL 5E4IA 4S2SB 1W0YT 4OTXL 4G9FD 1JGVL 2V7NA 2RAMA 1E6OH 4GRWH 1MCIA 1IKFH 3IM0A 1W0OA 1K6QH 3FO2A 1S3KL 1BX2B 2A6XA 4YFWA 3B5TA 4D94A 2PELA 5EU3B 1B6UA 1T2XA 3LAFA 1HKDA 5EUKA 4JJHA 4X4ZA 2CGRH 3T09A 5F6IB 3NGBC 2GMEA 2VAAB 2ES3A 2WUCL 1KACB 5ICYB 3ZYIA 5LBSL 1CG9B 1FQ9C 4FFZL 5K9QG 3TVMC 3CSPA 4AM0B 1NGXA 4PLNC 2R8SL 1SY6L 2R2EA 3H9ZA 5HD8C 1GBGA 2W65B 1MHCB 4ZPVA 4F33A 4NQEB 4UT9L 5IFAL 2FGZA 4APQC 5HYSA 4FQXA 5I66A 2I2SA 2IBBA 2KPNA 2X4RB 1A7PH 1RAMA 1UM4L 3LQZB 3O11B 5FOBA 4G3YL 3PWUA 4NJ9H 2E6VA 3QDGD 1PG7H 4HH8A 3PGDA 3WS6A 1IGCH 1NCNA 2CY6A 1KB9K 5FGBC 1AZDA 1DQDH 1N5AB 3OKNA 1S9XB 3OGOE 3TZVA 4RA3A 3VXQA 5TQ2H 6FABL 3BRDA 3INUH 2BOCB 1I1FA 1XGUB 1LHWA 4S1SH 1XF3B 3KYAA 1T2QH 3NV3A 4M3CE 5E0QA 3DRQB 3HLAB 4LPUA 4YNYA 2BMKB 3L3GA 1Z5LA 4PJCF 4H55A 5ACLA 4A6YB 1KB5A 2W9DL 2R4RL 5GS3A 1MVEA 1IC7H 4K21A 4L8QA 1CICD 3P0YH 2ZG1A 3QEQE 5IKCA 1P4LB 4QHKJ 1RULH 5T33H 4G6ML 35C8H 3C5ZD 3P40A 4Z95H 4BH8A 5DD0L 2LALA 1MQKL 3DI2B 4P2RB 2PKDA 2YD8A 4MZ2A 4FOYA 2A7AA 1S0DA 1FIGL 2E7CA 4RGOL 2EDJA 1XCQA 1H3VA 2XT1B 5CCKH 5CZXC 5DJCA 3VA6A 4WVWA 3VGFA 4AH2A 1YMMB 1I1CA 4JFYB 1MI5A 5AZ2L 3KM5A 4W70A 5I76A 3GIVB 1JFQH 3CNAA 5FREA 1F4YH 3S96A 5IMLB 3CFKB 3AB0B 1C1FA 4PR5B 5C0EA 1QTYT 1RI8A 4OGXH 5CHNA 3Q0HA 5HVGB 3MV8D 1DZBA 2VDKL 3QIUB 3QI9C 2FLRT 1IJ9A 1G9NH 3O4LD 2E27H 5F7WC 2DQHL 4RQQA 2EEDA 1FL5A 1RZKC 5DR5L 2FX8L 5GQBA 4WO4C 3SH4A 4PBVC 5D1QA 4PS4H 1QOKA 5I74B 2ZHKA 5DZOA 4NO3A 1SCRA 2XI9A 3N7KA 4OZIA 1TQCB 4E5XA 1HINL 1GZWB 4PG9B 5LAXA 5HHNB 3VXMD 2ARBA 4BLJA 2F74B 1O0VA 2WBJA 1INQB 4KRLB 4MJIE 4HPYL 3BP5A 1RY7B 1YN6B 4PJ8A 4KRPD 5IMKA 3RWIA 1BBDH 1HH9A 1I3GH 1MCQA 5E2UL 1RUAH 1GVIA 1JZ8A 1I8LA 4RMRA 1W72B 4M5ZH 4QRRB 1VIWB 3VD7A 5JZ7C 1FGNH 4Q0XH 1HHHA 1LVEA 2QJDA 4WEUD 1R3IL 1T1YA 1NMCC 2HKHH 5JPNB 3INAA 1IGYA 4D0BB 4G8IA 1CDCA 4YGAB 4ELKA 1V00A 3V0AA 4JQVC 3DSNA 3KPQA 4N8PA 2X89D 5EZLB 3NTCH 1B2WH 3QIBD 4NC1E 2CR3A 2OZ4A 3EOAB 3LKOB 1ENQA 4D9RE 4FQLL 4ZAKB 1ZA6B 4NQSB 1NANI 4I2XA 2V9TA 3RNQA 5F9TA 1JCKA 3H9SD 3ARQA 5MEQA 2NP0A 5J12B 3G5VA 4G9DB 4XMKL 1S5HB 2NY5H 5C0AB 4AGGA 1CQYA 2ZKHH 5FDWB 2R0FA 3RZWA 4X0KB 4YDIL 4WDIA 4FFYH 2R23B 1HXMA 4N9GA 5M94B 1BVLB 5C08B 1S9WB 5I30H 2HT4C 4ODSL 3REWA 1DFBH 1OCWH 3JV6B 5HYJB 2DQUH 2BSRB 4PJ5A 4MLIA 4J6RL 4OJFH 3TYFA 4X4YA 5GS2D 3U6RA 4ZO7A 4KKCD 5ANMB 3SCMA 3S35H 3GSRA 2WNGA 3T3PF 2V17L 3FO9A 1K2DB 3PE9A 3WXVL 5EN2B 5CP3A 2AEQL 1NLBH 2DLEA 3IF1B 2DWRA 1JMXA 1LGVA 4MXQD 1S7VB 1YEJH 3JBG7 2BOBB 1ORSA 3SKNA 4HBCH 5DXWA 3GSWA 4RWYL 1JBJA 5EOCH 1YI7A 3MLWH 3IFOA 5L88L 5IB1B 1AO7D 3PXJA 4UW6A 2VE6B 4Y4KC 5C9JA 8FABA 3AZWA 2B39A 1JPSL 5GRUL 1R3HA 4LK4A 2IPTH 2F8OA 5JMRA 1NL0H 2FR4A 4FQHA 1A1MA 5FK9B 4HUVA 4ELME 4P9XA 1H3XA 4GRMA 4X8XA 3HPLB 4F7PA 2ZBJA 1QO3A 5IEHA 4BK5A 3I9GL 1FHGA 4XXDA 1VKXA 1ZWIA 1NBYB 1F13A 1FYTB 5FO7B 2HFEB 4IRSD 1EO5A 5J89A 4PGCB 1UN1A 1CGTA 1CL7H 3E8UH 4G80A 1A1OB 3ARRA 2ZJSL 5FYKL 3NV4A 3LD8B 2FHCA 1L4IA 2PW2B 5L8KB 1QFUH 4KGJA 2AK1L 4OCMC 4TNWF 3SHSA 2I9LA 4GKNA 3BOPA 3L5XH 4OUOA 2UV3A 1SBEA 3QFJE 4NSKB 5JHDB 4QRUA 1DQMH 1I9JL 2OSLA 1CIWA 1ZVSB 3MA7A 1FVCB 3D87B 3GM0A 5EU6A 3KLAB 2DIAA 3KPMA 5F7HA 5IMMA 3KLHD 3S3PA 4I48A 4DN4H 3MXWL 2HWZL 5TDOA 4Z7QF 1E4WL 3O6ML 3TWCH 4DFIA 4PJAF 3GMNB 1I1AC 3USUA 3BPCA 5KXCA 2ZGMA 5DZGA 1RZGA 1L9NA 5FUOL 1I9EA 5GS2H 4XP6H 2FNBA 1IAIH 1T2JA 1WJ3A 3H3PL 4N8VB 5D93B 4P5TA 4G5ZH 4NM8H 4I77L 32C2A 4P3CL 2AJZA 4KAQH 4GT7A 3QUXB 2ATPB 3BP7A 4NJAH 3QA3A 3VMPA 4UDUB 1SMOA 1WUNT 3QNYA 4Z8FH 2JJTC 2EH8L 1FZOA 3ULUL 4H0HB 2NY4B 3BHBB 1UQSA 5IHZB 5F1NA 4M1DL 4LCIL 1YJDL 4XBGA 1E4KA 4YFLF 3RVVD 2NY6C 1QSEA 4P9ML 1IS3A 4DCQA 1IARB 1D5ZB 4Z6AT 1NXD1 1GC1C 4QRPD 4YC2C 3EYSL 4HWBH 4K8RL 4R7DB 3BZ4B 4HXBL 3ZXLA 4CZSA 2N4IA 5JXAL 1MJ8L 3HB3C 2MPAH 2F5AH 3LEXB 4KRMB 3VRLF 1T83C 5BMFL 4QOKD 1CDYA 3I6KA 3SJVA 2IWGA 1R3JA 5KVGL 4V1DD 2WANA 4W68A 4O2FA 2F54A 1UXSA 4UUJA 1CZ8H 3NV2A 4PJCB 2UY6A 3EYFA 4PJFA 4YGVA 4EI5D 3KPRE 1GOHA 1KIRA 3ULVD 3OR7A 2QLVB 3WUCA 4QHNA 2VDPH 4JY4B 1V6MA 4HLZG 3GBNH 2D6OX 3REVA 2QBWA 5JR1L 3S6CA 1QR1A 1CR9L 2JK5A 2ESVB 4RIRB 3O3AB 3LS4L 3IKWA 3UTSB 2VDLH 2P24A 3RVUC 3OXRA 2ZHNA 1NGWA 5FYJL 2QKIB 3V6OC 5ISZE 2ICES 5J3HD 4NIKB 4IJ3B 1BHGA 4QLRA 2BC4B 3TP4A 4YHKL 1KSRA 3KQRA 3DUUA 3HN1A 2NY1C 3ARGC 1UWXK 4ODUA 1INDH 3BP6A 4FQZA 1CBVL 4AG4L 2WNEA 1FLTX 2HT2D 3DVFA 2XFXB 8CGTA 1U58A 3RGVB 4FTVE 3BQUA 3QEHB 1IC4L 5TDNB 4M8QB 4JKPH 5DVKA 1SHMA 4ZUTB 1PZ9A 3KPOA 4JFFD 4D0CB 2VZ3A 5JA9A 3HUJA 4WUUB 3ROLA 5I16B 3OPZA 3UYPA 1VGKB 2HLFC 1P4BL 2GTWA 4WV1B 4U0RC 5IJVA 4H1LA 2UWCA 1S0GA 4B50A 4WTZA 5CEYB 4I4WA 2Z8VC 3KNBA 5IV2A 2AUYA 4Z0BH 1T22B 1XGYL 2VZVA 5HHXL 3UO1H 1RZFL 4CNIA 4LSQL 5ICZB 4PJ7E 4CMHB 1NUDA 1ZHLB 2BVPA 4ZNEE 5DTFB 4H0GA 1FZJB 4AIOA 1GSMA 2PO6B 4R2GD 5MEPA 3UTTE 4XBNA 4XJZA 4G7YH 5KN5A 4I3RH 5I1IH 3MJ7B 2PTTA 2CLZB 1BQLL 4G6AC 2XG3A 3ZHLA 1Z9LA 5DHVA 5C07D 3P4MB 4KXZI 3O0RH 2J88L 2W9EH 3IJSA 3DVNB 5GPRA 1NFDA 4PGDA 1OD7A 5E7BA 3NAAL 5CWSA 2CL2A 2AJSH 1EJOL 1V7NL 3QLQA 2DUOA 1ZOXA 2J6EA 1K8IB 2E51A 4YEFA 5D7LA 2D7NA 3MTRA 4OGZA 5JDSA 5SWSD 3O0WA 3TT3H 1B3JA 3ALWA 3R0NA 3ILPB 1NDGA 3NCCB 3OAZK 3QWOB 4ZODA 2GSGB 3VI3E 1SACA 1TVHB 5DRWA 5I1KH 3B5GA 3P11L 1I7RB 4I3SL 2YSSB 3GDBA 1U95A 5ITBL 3UJOA 2BY2A 3EO0A 1MCOH 4HK0A 1LEKB 4X6FB 3TT1L 4GXVH 5DDHB 3FQUA 2X4QB 1W8OA 4NBYB 3BEVB 4DVBB 3LQAL 1ACYH 2OTWB 1IGTB 3DGGA 4PTUB 2JF1A 3E3QC 1LD9B 4JLRA 5JW5A 3ECBB 3AS2A 1YYML 1X3DA 1JPGA 4FFVC 4FPCA 3UPAA 5TQ0L 1AQKL 3E6HA 3AS3A 2ZCHL 5HHPA 5DG2A 3CVHB 1T3FA 4NP4L 2NY7H 2D7QA 3EYVB 4JFOA 4XZUA 3H42H 2HLAB 2VKWA 5I6XB 3QR2A 3A0NA 1S7RA 4FQQB 4LEOA 4XB7A 4M7JL 2YMXL 3DV4B 4AVTA 5GM0A 5MI0C 1J05A 4OLWH 4HWEH 4DW2H 5EU6E 1O4ZA 1A5FH 3MLSL 2DQEH 4FOVA 3X3GH 2HAZA 2DMCA 2EH7H 3NIFE 2VW2A 3FHQA 3TJHC 1MRDL 4N8CH 2QADD 3B8YA 1P84J 3H3KA 2IBGA 3EKCA 2A3XA 4M48H 3IGAA 2YC1B 5IM7A 3B3IB 4UV4H 4Y5VC 4MA3A 4UBDD 4FQIL 4KKLC 4K3JH 1NJ9A 3L5IA 4U1MA 4WNQB 4GBXA 3V8OA 3P4OA 2JE8A 5IW3A 2ARJA 1XF4B 3B2VL 1WZKA 1F45A 4HHAB 3PWPD 3P3YA 4WTXA 5HHVL 3MBED 1WWWX 1U91A 1I4FA 4U1NB 4Y4HC 5ETUA 4AYUA 2X42A 5TGBB 2YBRA 3NZHL 2P7TB 5KSBF 4HIIA 3BH8A 1LP9E 3U2SA 3X11A 3IRPX 4L8BA 1YNKL 1IEBB 1ZTXH 1AKJA 1ERNA 2ZHMA 3BPOB 3RPKA 1Q72H 3QQ9D 2VN7A 1KELH 1MHHA 1JTPA 1CXIA 3O12A 4X7TA 1EO7A 4CW1A 4O5LH 4JM2B 3VKOA 1GAFH 2NY0C 4WVVA 1WCBB 4W6XB 3H9HB 2P3IA 1N0XL 4PJBF 2DVDA 4RSVA 3WJJC 1CK0L 4N0UE 3LKSB 1P5UA 3HTLX 1IZJA 2W9LA 4F15C 3C5JA 2VW0A 1C08A 1IM9A 4LHQB 4ELMF 4H26B 4IMLA 5HI4C 3U48A 4NFCA 3CH1A 5HI3D 1TDQA 1ZHKB 3GFUA 5ILTL 2XPGB 4OCYL 4YK4B 1KULA 4RDQF 4M62L 2H41A 1XR8B 2YPLB 5F21B 2GJ6D 4XP5H 3NN8A 4DGIL 5MENA 5GJTL 1TQBC 1J0HA 4S1RL 3TPUA 1HK6A 4M43H 1G7JB 4I0PC 1GHFL 3MRQA 4PBXA 5GZFA 2JB5H 2VH5L 4GQ9L 1AGBA 2YOCA 4OV5A 1EHLL 2Z31D 3RPIA 4F58L 3RDTA 3L7FA 3OV6A 1QNWA 3FRPA 3KJ4C 1RZJL 4G42A 1QPPA 1EFXB 5D7IA 5D1ZC 3GKWL 4NNYA 4Z7NE 4QYOA 5DMGC 1S7SA 4YDLB 3Q1SH 2YD6A 1QHOA 3RJDA 3PWNB 2DQCH 2VIRA 4WFGE 4K71B 3FL7A 1TIUA 1BFVH 5ADOL 2GT9A 1MCHA 1SM3H 1OQ1A 2J5LB 5HVHB 5E8PB 2P43B 4NHUB 3RAJH 4XNQB 4OD3L 2IANE 1P1ZB 2D44A 4LF3B 1YXWA 5E9DA 1N64L 4OZFH 4CN1A 1QBML 2FX9H 2ZCKL 3EZJB 2A74A 3IPVB 3GJFB 4K7PH 3CZJA 4Q9RL 1KTDB 3IDUA 4NDMA 5FECA 1MRCH 2ITCB 3SDDD 5C3LD 1II4E 4XP4H 5DJ2A 1BMGA 2DMKA 1OSPL 2DQJL 4LCYB 3OGCB 3CFDA 2HFFA 3C87A 1L0YA 2XQYK 1S0IA 1CGSL 3I6LD 5L2KB 3TBYA 5GGTA 2YD7A 4OB5H 5F7EH 2IBZY 3HE6D 3SPVA 1H9PA 1S0BA 4KK9D 4OZHA 5HPOA 5IOPB 3UBXG 3WFCH 2R1XB 1FL6A 3GSUA 2F58L 3CUPB 4LLMB 4ERSL 1UG9A 4HK3N 3AXDA 1Q9KB 4M4RA 1T04A 4FQXC 4NO2B 2RCSH 3BPLC 5HJ3A 4R0LB 4M3CB 3RBSA 1KJ3L 5FV1L 3CLFH 4XC1L 4WI8A 3BGMB 4OZFG 3WS6C 3RKDC 3LEYH 1TJGL 2V2TB 4PFEA 3QUZD 2V5SA 4P3WA 2B1AH 4M6ML 2DI7A 5ENWA 2LV4A 5E4EB 3QEQB 1DBAH 2Y25A 1UM6H 3B9DA 1T4KB 3NABL 3VH8A 3WDIA 4J4PD 2IH1B 3OBAA 4ZSOE 2AS5M 3U7YL 2IPKA 2W1NA 1UJ3B 2FGWL 2VUOA 3DX9B 4OT1H 1WVZA 4WHTA 4R3SB 3FT3B 1KJVA 1UVQA 4P4RA 2YWYA 5FHBH 4DQOL 1FVDB 3KLDA 1C5DA 4XVTL 4TOYL 1CF8H 3TYGH 3D0LA 4UIMA 3ZKND 2BVEA 5KTEL 3MLZL 3AP4A 2GY5A 1DHKB 2V5TA 4XAWH 1QSVA 4AL8H 1TJHH 3QZWA 5C9KA 1HDMB 5EO9B 2OTUB 1NGZB 1MVUA 1ONAA 5JXED 2ICEA 2VSCA 3QIUD 5DD5H 2G5BB 5GJSH 5T3XH 2IMNA 1W6MA 1JYXA 2YA0A 3MFFA 1GPOH 1PW3A 1E6JL 1WD3A 4XPFH 2VZ1A 5FYKE 1XF2A 1WW6A 3MZTA 3VJ6A 3LDBB 4NYLA 3ZKMC 2HP4A 5A40E 5HDQL 2Y6SC 3M8OH 2ZPKH 4F7TA 1RK1B 3OYWB 3FB5A 2CKBA 1GGTA 5DA4A 4XPBH 2IADB 5HGDA 4MJIB 2YPVL 4AEHH 4Q6YA 2WW8A 3DGTA 3VWKA 2X9YA 4DN3H 1ZLUK 3QEUA 5D1QC 4P3DA 5E1AA 4BPZA 2Y36L 4ZFOA 3I4IA 3U0WH 4KY1H 3U4BL 4WGWB 3R1GL 3PL6D 2AJUL 4P59L 5T1DH 2WBJC 5DMKB 2EXYD 3S5LB 3OGGA 5SWZB 5EUOA 1RURH 2FWOB 2H26A 4JFEA 4PJ8C 2V5YA 3MRLA 1Z9OA 4Y16A 1FSKC 1AJKA 2VLRD 4PY8I 5IW1B 1I8LC 4IRJB 5L6YL 4XNYH 5GGSB 5L7XL 4HSQA 2Z0BA 5H2BA 1H3PH 3AYAA 1OHQA 5CINL 1R0AL 3BTAA 1TXKA 4DGVL 5GGSY 1IM3B 1YEIL 3MRPB 3ULUE 4FABH 4PJGA 3OAZH 1A2YA 3VI3F 4KUZH 4OKVB 2AJ3A 4C56E 4HUUA 3V0AC 1J1XL 2ZG2A 3PWLB 3ROOA 1AY1H 4AIZA 5L9DH 3HZYA 4MAYB 4MB5A 1I9RH 1G6RL 4XMPH 5HYJD 4MA8H 1SJEB 1AXSA 2G60H 1KC5L 1XGPA 4DPNA 3PABB 3WMSA 4M8VA 3TA3D 3HS0A 3A0KA 1QNZL 4NKMB 1JN6A 4RFOH 4KPHL 2P5EE 3H6JA 1T1XB 5BZDA 3UDWA 4N0CD 1ZSDB 4PF5A 3OKLB 1BIIA 4ZO6A 4CMMA 2WBKA 5HYIA 4LQFL 4L3EA 1XIWB 1RVFH 3ZTJH 2H3NA 1A64A 4XCNB 4YDKL 3QUMA 1KXQE 3A6CL 4X5LA 1INEL 5DWUL 2EXJA 4WW2B 3GGWA 1SLTA 4OFVA 5DRNA 3SCMC 5KSVA 5JPMA 4UDTA 1MLBB 5C0DB 1YC7A 1U3JA 4LMQI 2XZAL 3KWWA 5L2JA 2WIMA 5HGHA 4RFEB 3MCG1 1Y6MR 5MERB 4BFIA 1BOGA 4OFYD 3LRSB 1M71A 1NGQH 3VUOA 4ELMB 1E28A 5JO5A 3CXDL 5HHOD 2IGFL 3NIFF 4ODXA 3TVMD 2KL6A 1A22B 1W72H 2NW3A 3D9AL 3LCPA 1N8ZA 4PTTA 2OL3A 3AXLA 4ZPTB 4M7ZB 2BSTB 2Y06L 3C8KB 2EIZB 5HD8D 5LQBL 5FYJE 5KANG 1KJ2L 4APQD 2VXTH 1F3JB 2DAVA 5SV8A 2AJYH 3DYOA 1UKSA 3WV6A 3BKYH 5J6GB 3BN9C 4LSVH 2C1OA 1Y18A 1IGFH 3HMXH 4GAJH 4BQBA 4AT6A 1J0KA 2WSUA 2BRRH 1N6QL 4JQXA 2W0FB 3QFJB 3GMQB 3PV7A 2HFTA 1LNUB 2UVFA 4RGMC 1FNAA 2R2EB 1F42A 3HAEH 1XZ0A 1G9FA 5E6IB 5F9AC 1MAML 3GSNH 1AH1A 3FT2B 2YMZA 3JWDH 3UPCA 1WBFA 3QH3A 5JW4N 2ARXA 3Q9OA 3V52H 4OZHE 5DUWA 1N1YA 1CTNA 1G9DA 1BBJA 3I6GB 2NTFB 4F3FB 3TZVB 4NRXB 1XGQB 4J3VA 1GGIL 1WTGT 2Y7QA 3CFBA 1HKFA 2ED8A 2PW1A 4ZOCA 3GMRB 4GUPB 5M95B 3QCTH 2P5WE 4M7LL 4J1UB 3LKPB 5T5FL 2GMPA 4KKAD 2EZ0C 1TZIA 2E9JA 1VA9A 3OJBA 1JGLL 3P0VH 1ZHNA 2K3TA 2JKXA 3PVOA 5IB3B 1HE7A 2ZA9A 3ZT7A 4PJFF 2P8MB 1VFAA 4K7FB 3WFEH 3FMGL 5I1JH 1X5ZA 4P5MA 4P5TC 3B6SA 1KFAH 4MCZB 4WW1A 1HNGA 2AR6A 1IT9L 4EN3B 2LTQC 1SLAA 4YHPB 4MHHG 1JIBA 4P46B 1Z0MA 2VXUH 1YPZB 3IU4L 3HAEG 1A6TB 4YBLB 4J3UA 3CFEB 1IC5H 2W0KA 4U33A 4WO4D 3VXRD 3QG7H 3RWCA 4QXGL 1WEJH 4YWGL 3X13B 1QSFA 1E4KC 3NH7L 4PIRF 5GIRA 4YO0B 1BFTA 3NZ8A 3DUHA 1MREH 5TFSL 4M1GL 1A8JH 3MUGA 3SKOA 4X9HA 5E8DL 5IHUH 4HIEA 1N5YH 3ARDA 5CJ5A 3K2MC 4CN4A 3UCRA 3F7VA 3QEGL 3K8MA 4KVNH 4H88L 4EOWL 3OAUL 4ZD3L 1RZ8B 2HRPH 3CFCL 3KPRB 2X5PA 3PHQB 3GIZL 1EHNA 3HNSL 2Z4QB 3CSBA 5KAQG 1SEQH 3U9PL 2A6YA 4S1QH 5D70L 3RMXA 3EYUH 3RY6C 4TSAL 3HUJF 4A2MA 5JZ7D 4TYSA 4AEIH 1QRNE 4LRNL 5I73B 5J13B 1MJUH 3KYKL 1NAMB 1U8MB 3LSOA 4D3CH 1OAXH 1WLHA 3KPNB 3TN0A 3HPJB 5IW6A 2DIBA 4X8JA 5EPMA 1ED3B 1DBML 5ISZB 1LQSR 1WC7A 4RISH 1BZ9A 2R2HA 1DQLL 3VXUA 1JHLL 4B5EA 4GG8B 4HFUL 3VFTA 3WLBB 4PCRA 1X4ZA 4GJTB 4YXKL 5IVZB 3QJHA 1G7IA 4LBKA 3KYOA 4FTVB 4UQ2B 4L4TE 1OGTB 3K4DA 3CPLB 2FRGP 4XRCA 1F02I 3D2UB 4LP4A 4Y4FB 1CDBA 4XNMB 1CI5A 2HT4D 3ULSA 2NX5A 1BF8A 3TFKC 2Z35B 1M6OA 4ALAH 3JVGA 1LE5A 1W6NB 4ZYKB 3VD3A 5EIVA 5E99H 3IFPA 4FXKB 5D7JB 2E5EA 4YJZL 2DD8L 1PX3A 2VN4A 1HOCB 3FFDB 1K85A 2JE7A 5F7MC 4WY7H 4OAWA 1N6UA 1F11A 4S0SD 3BQUC 3VXPA 2E7HA 5A16A 1HZHL 2V2WB 3UMTA 1K4CB 3QNXB 3QXVA 4PJ7B 5HHMB 5KXBA 4MQTB 2WWKT 3L1OL 1MCWM 3LVEA 3UTTB 2YY1A 5KG9B 2ZMNA 1KPVB 1NCDH 3ET9F 2VQ1B 2VXSL 2X1OA 2FEDC 2XNAA 15C8L 2DQDL 3ASIA 1ZGLA 1D6EA 4Y4KD 5F3BA 2FH8A 1X5IA 5J11C 4PRDA 1L7TH 2XTJC 5FKPA 4C59B 2HJLA 1WFNA 4N8VG 4M7LT 5E1HB 4P2QA 2P37A 2CJUL 4X9GA 1QLEH 3MZGB 4ZOEA 1NBVH 1UZ8A 4I5BA 2PTVA 4G8EA 1AD0B 3N50A 3MW2A 3BVNA 2XOTA 5CJOL 1AJ7L 3FONB 1PEWA 5FYLD 4ZXBB 5BS0E 3QB7C 4HCRH 4NNPL 3K2UH 1CLZH 2VL5B 2Y72A 2I5YH 3MV7E 5E2WL 2H9GB 4LHUB 3N1FC 5CIPB 3H9YA 3MRDA 2V5MA 1CLOH 5B39G 4U7MA 1J1OH 3GSOB 1DQ2A 2N7BA 2LE9A 1JYVA 2EC9T 2IQ9L 2ZABA 2BK8A 4Y22A 1IS4A 3B00A 1TZHB 5C09D 3RWHA 5B3NA 5CSZB 4XMLH 3MYZA 2ENRA 1YDPB 2DU0A 2JKBA 2VO5A 4XGZA 1CD0A 1R5VA 2GNDA 5IWLA 2OP4L 1U8QB 2EXHA 1VGEH 1ZLUH 3WNMA 2ZUQB 3FOMB 4ZDHA 4MXWL 1PZ5B 3RWFA 2H8PB 2W59A 2UUDK 1I1AD 5INCB 5DJXA 1QLRB 4UW3A 2VABB 4JFHE 2IH3A 4U6TA 4L8SA 2D43A 1YMHA 4Z78A 5I8CB 2HG5B 1FNGA 2F8VA 2APTA 2JELL 4J3WA 4BOWA 3LRHA 3DROA 7FABH 2R0HA 4QXTA 5DC4B 1ZLSL 1N3NA 4JPWL 4KI5E 2YD2A 4JO4H 3TJEL 2OXHA 5E70A 1EMTL 4X83A 1YEHL 3LMJH 5GISL 5GGUA 4LLAA 3ULUF 3DO7B 1FP5A 5KOMC 1UH3A 3HR6A 2VXQH 4Y1AA 3SDYL 1CXKA 2NY6D 3WO4B 3WL9A 1HQWA 2ZSVB 5ACZA 2A2QT 1OD9A 2DRUA 3TBTA 3HFMH 3VGEA 2ZKNA 3GUTA 3QA3B 2A6DB 3NACH 1FV1A 3HB3D 1HEZA 2ZGOA 4YHOH 1CLYL 1X5XA 5BRZA 1W6QA 5FYLH 1A6WL 5JA8B 3U1SH 4QRQA 3QG6B 5DRZB 1LP9B 1LTEA 1I7UA 3OB0H 5AD0B 5IK8A 2BY0A 4DCQB 1A14H 4XNXL 4NQCB 1YEGH 3EJYD 4W6YB 4BFEA 1KDKA 5D6CB 4GBXC 5DUBB 1LEGA 3MGOA 4YDVA 4AQOA 4ASMB 2VU9A 1MS4A 2R29H 4D9QD 4F2MA 4BZYA 2P3JA 1NDMA 1AR2A 1I9IL 3QHTC 4NUJB 3CNKA 3I75A 2B4CL 3TNMB 3IT8D 4TN9A 3OHXB 4TVSa 1MLCA 3MXVL 4N0UB 3F12B 5D7IF 4J7RA 3S37L 1QSFE 3OZ9H 1BXHA 2WV3A 4TPRH 4EXPX 1WBYA 3GRWL 4AEFA 3BH9A 1OAQL 1IZKA 3HG1A 5DUXA 5FKAB 1GYKA 4H8WH 3MR9B 4GKXA 2XYCA 3WNKA 3CVHH 3HI6H 4CVZA 1LO5A 3RVUD 2PYEA 5F88A 2XZQH 5DFWH 3O3EB 4HW6A 3CIQA 1GOFA 3FB6B 3BMVA 3KS0J 4LKCB 3L3JB 3MLVL 2PCPB 4DZBA 4DGYL 5T5NF 4M3JA 4ZUUA 1CE1H 1EAJA 5L0QB 1ZT7A 4M03A 1SBBA 2NY1D 3ARGD 3EO1B 3O41A 4NC2B 4JRXD 5JOXA 5C6WH 1R5IB 1KLGB 4UQ3B 1YYLH 4NPYA 3K1KC 1JHKL 4HKJB 1SBSH 1PLGH 2EXKA 2A73B 1MJ7H 4DKFL 2W60B 4J8RA 3VG0L 3V6FB 4E41A 1A6AA 5GZOC 5AZEH 4PJXE 1T0MB 1R3KA 1U3HB 2PHTA 2NY2C 4OM1H 4UU9A 3HR9A 3BP4B 2HLFD 3MX0A 3MLRH 4XNZC 5E03A 4Q7DA 1P7KB 2R0LL 4MNQE 4TNVK 4F37K 4XXCA 2G9HA 1VHPA 4HWNA 5EOTB 3MSPA 1AQDB 1I8KA 3RDTC 3G9AB 2A9MH 1MFEL 4GO6B 5DVOA 4OZHF 4M5YL 3GMMB 1JGDA 2EDOA 3VFNB 5J1AB 4PJHA 3OX8B 3ZT6A 1YQVL 4YZ5A 3MJ9L 4IHOA 1E4JA 1JTOA 1M1SA 2IANB 2FL5B 1CT8A 1QDOA 5IBUB 5I1GL 4XNUL 3S34L 1KENL 4G8FB 3IDXH 1RIRA 4CTEA 5GS0H 2VLKD 3T2NH 4QHUA 2A38A 4RBPK 1IC1A 1ZEAH 3P73B 5DK0A 2OQJA 1T0PB 1NFIB 5E2VH 4GXUM 2AK4A 3RHWF 2QHRH 3O8XA 5D1XA 3AM8A 5T50A 4LAJH 4X7FC 1RHFA 4E42A 4FPEA 2MJWA 4QXWA 4FXGB 5K9QI 4P9HL 1BM3H 4HEME 4QHLA 4X98A 2AGSA 4LAQH 4AK1A 3ZXJA 2EDWA 1NC4B 2NMOA 1AHWB 2NXYB 1N59A 2IMMA 2OR7A 5JIIA 3D3VD 5GS1A 5F7YC 1LDSA 1ZMYA 1UGNA 3QO0A 1OF2A 4ODBD 4CBPA 3C2AL 5IGXH 3MACL 4IS6A 5HCBA 1T0NA 4LSPL 1DCLA 2FYYA 1BKZA 4Q1RA 5E7FA 1IGJA 3D69A 1FFOA 4QRSA 3SGDH 4YXLL 4X6BB 3MRKB 1RUMH 3CVIL 3LKNB 4N5UA 1Q8VA 1I3VA 4N68A 5DMIL 2VISA 5TE7H 2Q76B 3SOBL 1YNLH 4JVUA 4TUKH 4YPGA 4ZSOB 1CIDA 5IUSA 1V7ML 2P44B 3MYJA 3W2DL 1G9ML 2PXYB 4AENA 2E7TA 3TM6A 2D6KA 3HNTH 3HZVB 1OB1B 3OB8A 1ZLWK 5DJDB 1UX6A 5CEXB 4KROC 3PMEA 4TRPL 4WEBL 2XN9D 5CBEB 2DQGL 3PP4L 5JLZB 3GMLA 1T3FB 3CSYB 3TJHD 5HPMB 1TCRA 2ZGNA 5CMAA 4Y8AA 4M7KH 3WIHA 5FFLA 1FZMB 4G6FB 4NNXA 4FFWC 5I2IB 3GJFH 3T3ME 2R16A 3ORJA 3HC0A 5IT6A 3QP3A 3W39A 4ZMAT 1F58L 1UM5L 3BN3B 2ENSA 1J05B 1UJTA 4KKLD 3BXNB 3T4YB 2EYSA 2D3RA 1FG2A 1D5MB 3IXTB 3BI9X 5E5UB 4LPCA 1RUQL 4Y19E 4KJPC 2BNRA 4L8DA 2BQPA 3T4AA 2QSVA 3DYMA 1JWSB 1H5BB 3ISWA 3T0EA 1DUYA 3TBVA 4LP5A 2X1XR 3RNKA 4Y4HD 2P8PA 1F6FB 4PJGF 1SLIA 5BZWB 4MS8D 2V7HB 1KPUA 2QSQA 4YM0A 1GGBH 4YDJA 4MDIA 3V0VB 3DWTA 1AXTH 5B4MC 4XOGA 2ZUUA 4OUUA 1HXYA 3GNEA 1Z3GH 3WN5A 1R3LA 2EDEA 1JGUH 3EBAA 1K5NA 5T1LB 4NZUL 1G86A 3MRFA 5J9PA 3CXHK 5KW9L 3MRMA 4WJ5B 2NY0D 1RJZB 4NGHL 3EFDH 2VLLB 3GK8H 5BRZE 4LBLA 1T1WA 5EZOL 3VWKC 3IAPA 3W58A 3HE7B 3KYNA 4G43A 1FFNB 3G5XA 1YEKH 2WUBL 1N2RB 4R90H 5HI4D 3GI9H 2DJ4A 3RQ0A 4L4VA 2C26A 3D18B 1S7UB 5C0RL 3FN0H 5C0GB 5BXFB 3UL2A 2MCG1 4C56B 1T5XB 3GB7B 2E9BA 2WAHA 1NKOA 3CX5K 4Y16C 1N26A 5EOQH 3A4UA 4I0PD 3QDHA 1WIPA 3RUGE 4YE4L 4FQ2H 4JG1L 3V6ZB 2CR6A 2AGJL 4L1HA 3O2DL 1KCVH 3HI5H 4OGYH 4H25B 4KJQC 1JZ4A 4X6CA 2ICWI 2B1HH 4PRHE 2P5EB 2I27N 2CMRL 1U8JB 4KHTL 5D1ZD 1EAPB 2X4NA 4KJWC 1T7YA 2IALB 5DMGD 1KCLA 2DTSA 5H35B 1ITBB 1XIWD 3W0WA 4Z77A 3BWAA 3O3BB 4GOSA 4I9WD 1OARL 1VFBB 2PYFB 2GK0A 4L8CA 3ARFB 2X4TA 4JG0H 4LVNB 2F53E 2C1PA 1V8HA 3GO1H 4Y5XA 1DE4A 2UUDH 5BVJA 2Z92B 4JFDA 3AP7A 4PUBH 3DSFH 4UW5A 1WCQA 4G42B 1P4IL 4NKIH 3AXEA 5CKGA 1MVQA 3V0BA 3M07A 5EA0H 2IF7A 2EYTB 3R0MA 1J8KA 1MS0A 4IDJH 3WD5L 2VW1A 3ARUA 4BQ6A 4X80H 3BISA 4NQDA 5DQDH 4YX2H 4KI5F 4TUJB 2DICA 5C0FA 3T1MA 1DEEB 1MFAL 2IFFL 5LXGL 4YHMH 1DLFL 1LO4H 1QFOA 4X99B 5TE6L 4MQXC 5DD1H 5TE4H 5LKNA 1S7TA 1DYKA 1GNHA 5FHAL 5JOYA 2NR6C 2CK0L 3C8DA 2VDNH 2Z8WC 4NKDA 4MYEA 2GY7B 1U93A 2QSCL 1NMAL 3O5SA 2JJSA 1KRIA 2ARWA 1CDGA 2Q3ZA 3VD5A 2J4WH 4N0FA 4PD4J 4RGNC 3UBXA 4QHMB 4XX1E 2VWEC 4MX7A 1K4DB 5IP4A 2OJEA 3KAAA 2XICA 5AUMA 4PRBB 5ADPL 1KXVC 1EBAA 3RZCB 3VFMA 3MGAA 1JF1B 3L6FB 4FQXD 4POZC 1OTSC 1MWAL 4GG6E 5FM8A 4PLJC 3V5KA 2ADFH 3WLWC 4BSVB 3FZUC 3WZ1A 4H5SA 1MRFL 2EICA 5MHSD 1RK0A 1IL1A 2EDYA 4OGAC 4OZFA 3RKDD 4Q8LA 3GHBH 4JQXC 5JNYB 2DQFA 3S88H 1QVOB 3TZVD 4GW4B 5F9WC 2VB5A 1BZWA 2CLVA 4HF5H 3R8BB 5SX5K 1A6UL 5KS9B 2ZZJA 4OCSL 1BGXH 4LGPB 4JM4H 2P5WB 1KIPB 1C5CL 4X9BA 2HKFL 4KI5C 3MLUH 4JGJA 4JFQA 3S5LG 1BPVA 1G7QA 3GSQA 3QPXL 5TH2A 1MJJA 3TESA 3RWJB 3IDIB 4XI5C 2DI9A 2IQAA 1QSZA 2GNMA 3V4UL 5I8OH 1UWGH 1U8IB 1RSFA 1PQZA 4FNLH 3L5WB 3VH8B 5KVDH 4ODHH 2JD4A 3HCVB 5D2LE 4HIHB 4ODTH 1RJLA 2Y07H 4LFHD 4ZG1A 2D31A 1AE6L 3QIWB 4ORGA 1DBNA 4X7SH 1BFSA 3C5SA 1UB5A 3WUWG 5B8CB 3WO3B 1XGTB 1F5FA 1JNHB 3FFCA 1CL7I 3MRRB 2ZGTA 3PHOA 1MI5D 5AG9A 5DUUA 4K20A 4LARL 3AP6A 2AEPL 4PJXF 2ADGB 2XRAH 2Y6SD 3MV9E 5GRYA 4MA1B 1JRHH 1B9ZA 1RFDL 3AAZA 4M61A 3C60B 5SV4A 2Q8AH 3AJZA 2XG5A 1B09A 1A7RL 4KC3B 4RRPG 1S0FA 3QRGH 1Q9LB 5D1QD 3MCLH 4XBLA 3KS0H 4U6HB 1IEAA 1W0VA 5HGAB 4S2SA 4FPJA 3PWVB 5H9SA 1KGCD 4JFXB 4LLWB 1QRNB 3MJGX 2BVOB 1K6QL 3M45A 3QCWA 1EHXA 1BX2A 2WBJD 3ARDC 1Q0YH 25C8H 3MBXH 4M93B 2A6JB 2P2KA 5EU3A 4PJ8D 4ZS7L 4F9LA 1EZVX 1IAII 4RBPH 5GRZA 4K3EH 2VAAA 3QAZC 1ONQB 2X05A 1I8MB 5ICYA 1TITA 5CZVH 2XKNB 3MLXH 2KZ1B 1CG9A 4KDTA 4XTMA 5JLVA 4RDQG 4R6UA 5CA6A 1PG7X 4AM0A 4NKQB 4EDWL 4XCEB 4X7DC 3TN0C 5ESVB 2W65A 1DBKH 1MHCA 4L4TB 4FA8A 3APBA 4NQEA 4F57H 4FVVA 3RVTD 2F19H 1OGAE 2HTKC 5IEKB 3B83A 2X4RA 3O11A 1G9NC 5I1DB 3FBYA 4HGMA 3O2WL 4ATEA 4DZ8B 3DX6B 1BZ7B 1G7MB 1J8HE 2CTVA 2ZACA 4P99A 1IGCL 4YW3A 3L3OA 3VDBA 4JO1L 3WFHB 2CRZA 4OF5A 4AGRA 2X9WA 4PLKC 1N5AA 1UB6B 1S9XA 2GN3A 4OLZL 4TSCH 5TQ2L 3KXFE 2X70B 3BYTA 2BOCA 3HZYB 1XGUA 4UB0L 4S1SL 2FHBA 5HYSG 1XF3A 3VFVB 3JVGC 1F4XL 3WDTA 4PJ5D 3ZO0A 3EFFB 1QBLH 4GMTH 3DRQA 3HLAA 1F90H 4HS8L 2BMKA 3SCMD 1H3UA 1RUKH 4DVRH 1GYAA 5GALA 2NXZC 5F9OL 4A6YA 4R4FL 2JJ6A 1FLRH 4B7IA 3MUY1 1ZLWH 2CUMA 1P4LA 2P42B 1KJLA 1Z9SA 35C8L 2WBWB 4ONOA 1A9EB 1PSKH 4WWKB 4P2RA 4FP8H 2N7AA 4K3HA 2A9NL 1UL9A 3POYA 2R0WL 5BS0B 5K59E 1ROWA 1X5YA 2DKUA 3KPSE 5C0BE 3UTZB 3MV7B 5CCKL 2HMIC 2XXCB 1DBBH 2R4SL 4IMKA 4QT5B 1NAMH 1YMMA 1RD6A 4JFYA 2CWSA 2WINB 3I3EA 3GIVA 3U82B 3LS5L 2NY5C 1K3IA 3BN9D 3FO0H 5IMLA 3CFKA 3F6LA 4PR5A 3LN5B 1FGVL 2Y23A 1SLBA 5CJXA 4YHYB 3TV3L 1CFBA 3QIUA 3AS1A 5D7KE 4U6VL 3SDCB 4XVJL 4NN7B 3IETB 5HYFA 2GDFA 3OXSB 4UOJA 3ZSTA 4EKXA 2JECA 3TH2T 2FB4H 5E88A 1VPOH 1GZWA 4PG9A 5HHNA 1OAYH 4DOHE 4U1LB 2F74A 3ZL4L 4YHLH 4U6YB 2VUYA 1INQA 1WTLA 2VZOA 4JO3H 3TF7C 1OLZA 4KZDL 3B4NA 4L29B 3IKKA 4IEFB 4OLXH 3C2UA 1YN6A 1S9VB 3MA9H 5JW4R 5CUSL 1VADB 4P2OB 3RL2B 1I3GL 1RUAL 5EU6D 4OM0L 2WWKO 4TULH 5IWLC 1W72A 2DDQH 3F7PC 3WHTA 4TSBH 1KBGL 4QRRA 1JXNA 1A6PA 3MRIB 4YM1A 3PGFL 4P48A 4XBPB 5JPNA 3GNMH 2O5ZH 4D0BA 2EZ0D 5I1CH 4FQ1L 2MNUA 5EZLA 2YUXA 4LPTA 1HHIB 4L8SC 4X4MA 5SX4H 4XZPA 3HMXA 3EOAA 1CFVL 3LKOA 5JOPE 1RMFL 4OLYL 4WENB 4ZAKA 1BEYH 1ZA6A 2ERJC 2CQVA 4NQSA 4P5TD 4GSDH 3HC4H 3BIKB 1IQWL 3BPNC 2C7UB 3RUGF 5JDBA 3OMZA 4G9DA 4OIIH 1S5HA 5DT1H 3S35X 5C0AA 3QPQC 5FDWA 5KSUB 5HYQB 4X0KA 1MAJA 4LSDA 1ZAGA 4BQ1A 2R23A 1QP1A 4S0TD 1UZ6E 4PJIE 3U46B 3GJEB 1BVLA 5C08A 1S9WA 1NCAH 1ZS8B 3UC0H 1QSED 1LE9B 3JV6A 1A7QH 5GRJL 5CIPH 2BSRA 1S5IL 4GKYA 2OI9C 5MP6L 5T1MB 1N4XH 4U1GB 4RL7A 4R8WH 5ANMA 1H3GA 3ZYJA 5J0BA 2Q7NA 5F96H 5EO0A 3O3DB 2EE6A 2CPCA 1K2DA 1FE8H 5E56A 5EN2A 1OTUC 3WBDA 4EBQL 3FFCE 2JJWA 5HVFB 3IF1A 4XWGL 1NCCL 5JUEL 2N56A 1S7VA 2GEEA 2BOBA 4HBCL 1RINA 4QKXB 1QFWM 4RAUB 5EOCL 4DTGL 4G6JL 4L5FL 3MUGB 5IB1A 2KBGA 4F7MB 2VE6A 2F54D 3Q5TA 2DYCA 1TETH 4OTXH 5E2TL 2Q1EA 4NZDA 1JGVH 5DGQA 3H2WA 3KG5A 4IIQB 3WNPA 4LSSL 1NL0L 1S3KH 1LENA 3H0TB 4PJHF 1CU4L 5FK9A 4FRWA 3TH3T 1JPTH 3HPLA 4ZXKA 5IBTL 1Y6NR 4JRYE 1NBYA 2WUCH 4LHUG 1FYTA 5FO7A 2HFEA 3LSOB 4YW2A 1FX5A 4WU7B 3MLYH 3QDME 4PGCA 4NFBA 5LBSH 1CL7L 3K7UA 4FFZH 4LLQB 3UZQA 4NN6B 1A1OA 5I19H 2H2SC 5ALBL 4ZTPL 5L8JB 3TFKD 2R8SH 5SWQB 1SY6H 4PJXB 3ZVXA 1CE6B 1JZ5A 1CGWA 2PW2A 2VXRA 4MNQB 1OAUL 5E95B 4GW5B 5IFAH 5A3IC 5AAWA 3JWNC 3L5XL 3N0PB 1RZ7H 4YPJA 5CZKA 4NSKA 1GRWA 5JHDA 1G7PB 4UT7L 3BQUD 4NZRL 1ZVSA 1KTLB 4G3YH 1FVCA 4J2XA 1BFOB 3KLAA 3AU1B 4L3CA 5HYEA 3BSZL 1G7YA 1BVZA 5BW7A 4C1XA 1KXTB 3EDDA 6CGTA 4P57B 1XCTB 4ETQB 1MAKA 6FABH 2FEDD 4F7CB 1EGJL 3GMNA 4XXCC 1YC8A 1CFNB 3AX4A 2XTJD 3SGJA 2CDEB 3WDHA 1VFMA 4N8VA 3FQWB 1C7TA 1J9CT 3LN4B 2NMSA 1LK2B 2ATPA 3QUXA 4J3TA 5C70A 4DKEH 4UDUA 3EDEA 4LHJB 2W9DH 2R4RH 4KH2A 4Z8FL 4AQ1B 4MB4A 5D2LF 1A47A 3BHBA 1MY7A 4HG4J 5GSVB 4G6MH 5IHZA 5DD0H 1MQKH 4U1JB 4UIKL 3BE1L 1WLWA 1PKQE 2EIEA 1OAZL 1T21B 1G6RB 1D5ZA 4RGOH 1U8LB 1FH5L 3K1DA 3HR5B 4P4KB 2C3VB 4HWBL 2KQMA 4R7DA 3BZ4A 5K33A 1BJ1J 1T66C 3O8XC 5D7LD 2RBLA 5AZ2H 1VACA 4TQEL 1XF5B 1C4RA 2MPAL 5D1XC 1A4KB 3FLTA 1NCWL 4ZO9A 3LEXA 2UURA 2VITB 1LHZA 3F58L 5C2BL 2VDKH 2DM7A 3LPWA 3IKCB 4YFDB 1BJ8A 5DR5H 2FX8H 3KYMB 3DXAE 3K8LA 4EEEA 4XJ9A 4X5WB 1WWCA 3DECA 3G9VA 5GS1C 4Z7WE 1MCSA 2FATL 4PJCA 1NLDL 5F9DC 1KIUA 4UILL 3L9RB 3TPKA 2YD9A 4HPYH 4JY4A 2BNQE 3M1BB 2C4FU 4NQXB 2O61B 2UWEE 4ZFFB 5SV3A 2YD1A 3AREB 2ESVA 2D0FA 4RIRA 3O3AA 3CK0L 3UTSA 2JLLA 4GALA 4OFIA 3VGAC 3VXSE 1R3IH 2QKIA 3FOLB 4YHNB 3BW9B 2CWMA 1KJ2B 4WUKL 2BC4A 4U3HA 3KGRA 4K9EL 1TZGL 3PDGA 1L7IH 1INDL 1YN7B 4LBQB 4ISQA 2IJ0C 4WI3A 4Y19B 4JCLA 2P48B 5DQ9B 1DDHB 4UNTA 2XFXA 1HH6B 4N0YL 3RGVA 3QEHA 4P23B 3U7WL 1ZA4A 2WQRA 5TDNA 5ERWB 2GITB 4M8QA 2HVJB 1YUHB 3DURB 5A2FA 3S97C 4XMKH 4NOTA 1S7WA 1C7SA 4ZUTA 1QHPA 5IQ7L 4D0CA 3I50L 4WUUA 5I16A 2GSIB 4Q9CA 5KSAB 1VGKA 1HHKB 4WV1A 2Q87A 1DUZB 1VFUA 4N5EC 4XYXA 4X6EA 3ILFA 5GRWA 4FQJL 4ODSH 5CEYA 5C0AE 1J10A 2FO4B 4U1HB 3T0EC 1P53A 4BJLA 3R8QA 3PF2A 4Z0BL 3SN6N 1T20B 2VDQL 1T22A 4J6RH 3UO1L 3L3IB 1QZ1A 3JUYA 5C0CE 3VW3L 2EE3A 5ICZA 1FC2D 5GHWL 5C6PB 1ZHLA 3VKNA 1MCEA 5DTFA 1VESA 5C08E 1FZJA 4YGCA 5IBUG 2KDGA 3ALXA 4Y7MA 2V17H 2PO6A 1MACA 4R7NB 3OG6B 3AFLA 4BQCA 3V0WL 1AKJD 3WXVH 5JIHA 2EDQA 5HDBE 1D6VL 3WN5C 3MJ7A 4LIQE 2CLZA 3UJQA 5K59F 4HJJL 3P4MA 2NY3C 1FN4B 4RWYH 3DVNA 2IFGA 5L88H 1RUPL 3G6DL 3B9EA 4XJWA 1LESA 2AQ3A 3ULVL 1MS3A 1JPSH 1K8IA 4HKXB 3RUGB 1QBAA 4M6NH 2UY7A 5GRUH 2OUHA 3QDJE 4D2NA 4YQXL 4I30A 3ILPA 1PYWB 2QQNL 1QBBA 4XHBA 3QWOA 2CRIA 2GSGA 3ESVF 1TVHA 4PRHB 2D3PA 1AGCB 1NQBA 2MHAB 1I7RA 3U30C 5IT2L 1X9QA 2YSSA 3O3UN 3RA7L 4OZXA 3I9GH 2ED9A 2FX7L 5DS8B 5MEND 3ZE0F 3WG3A 3QHZL 5GZOD 5DQJB 1LEKA 4X6FA 2DU1A 3UJJL 5DDHA 2X4QA 3KPPA 3BEVA 4HK3J 4I3GA 3N7LA 1ACYL 4DVBA 2GJJA 2OTWA 1IGTA 2ZJSH 4PTUA 2F53B 2F9BT 5FYKH 3MLPA 2I9TB 3RDTD 4R9BA 1LD9A 1FYTE 3ECBA 4LGSB 3TCLA 3VV1A 3IDYC 2AK1H 2ZGSA 5F3HB 4PJEE 4M02A 3CVHA 2MTPA 1F3DH 3EYVA 1NCUA 4JZJB 2HLAA 4MD5B 4FQQA 3O6KH 1G0YR 4K94L 2DQTL 4Y5XC 1UZZA 5BV7L 2OK0L 3DV4A 3MXWH 1I8KB 1A3LH 2HWZH 4HWEL 4NO5B 3O6MH 4DW2L 4K3GA 1JL8A 1ADQL 3WXWL 1A5FL 2DQEL 3TB0A 4JB9H 2M26A 5H9QA 5FUOH 5ALCL 5E9DD 1TFHA 2OJZH 4ZFGL 4N8CL 2D0GA 3H3PH 2DWEB 3PQYB 3V7AE 4I77H 4OCWL 2Q8BL 1NUNB 3N1GC 4QHUB 1HLCA 3LN9A 2YC1A 4Z7VE 3B3IA 1O5DT 5T54A 2EH8H 1UZ6F 5E8OB 3ULUH 3ES6B 4PJIF 5DUML 5DK2B 1BQPA 3C6LB 1ZVYA 3BUYB 4PYHA 4WNQA 2X7LB 2UYLB 1TEIA 1I7ZB 4GG6B 1YJDH 5AAMA 5KANI 4CADB 4P9MH 4HHAA 1QKZH 1XQNA 4GAFB 5FCSH 2NNAB 2JJSC 2ZG3A 4U1NA 1H8NA 3EYSH 4K8RH 5TGBA 2P7TA 4HXBH 2LAAA 4K3DL 1Q8SA 4N1HB 1NCBH 1U6AL 3KR3H 5JXAH 1MJ8H 1G7LB 1IEBA 3JV0A 2O5YL 3T2QA 2FEEI 4IBLT 5BMFH 1U8HB 2VLJE 4ZQKB 5C71A 5E08L 1LO0L 2AV7B 3IDJB 4O5LL 4TVPE 4JM2A 2H1PH 1WCBA 3H9HA 4XP1L 5KVGH 2A71A 3PP3H 1HQRB 3LKSA 4Y5YB 4KROD 1BQHB 1PGRB 1U3YA 4H26A 4JN2B 5GSRB 1N3OA 2DTYA 2V2XB 1ZHKA 5D2LB 2XPGA 5KZCB 4JDTL 4FFWD 2RJMA 1DGLA 3DMMB 1XR8A 2YPLA 2MWCA 5JR1H 5DUPH 1CR9H 3UJIL 3LS4H 3AROA 2IEPA 4OF8A 3QCVL 2YD3A 5KXDA 2XY2A 4Z9KB 1G7JA 3MV01 1GGCL 1W2KT 3QXTA 3FQTB 2JB5L 5FYJH 4O58L 3MV9B 4KJPD 4Z5RB 1WZ1L 2ILLA 5IJKA 3UTSE 4EI6B 2D6LX 5CBAB 4YHKH 2BDNL 1IGML 1UA6L 1EFXA 1GH7A 4CVWA 5KVMC 1IGIL 2ADJB 1CBVH 4HXAL 4HGWA 1Z0NA 4PB9H 2DQIL 2LVCA 5B4MD 3ZTNL 1EV2E 4K7PX 3PWNA 1JWUB 1A7OL 3K4AA 5FM5M 5IESL 4R9DA 2XY1A 3BDBA 2DURA 3S8WA 5E8PA 5D8JL 4NHUA 3QDGE 3RAJL 4KI1A 4XNQA 3BRGC 1P1ZA 1KLFA 1VAMA 4LF3A 4NRZB 4WUUE 2B0SL 5T1KB 3CAFA 3IPVA 5HHXH 3MLTB 4LSQH 3UK9A 1KTDA 2R2CA 2VLME 1I3UA 1I8IB 1T7XA 2ITCA 1KUMA 3LIZH 4GS7B 2V73A 3AK0A 4XP4L 3QULB 4KFZC 4LCYA 4JFED 4X9FA 4F9LC 1BQLH 3OGCA 4Y16D 4AZ8A 1OGAB 3FQNB 5F6IC 2J88H 3SISA 5L2KA 4HT1L 1GNZA 2A6KB 1A3RL 1FZKB 4KDTC 5F7EL 3AS0A 1J8HB 1EJOH 4KJQD 2DS4A 5E6ZA 1VEPA 1V7NH 4E0RB 5IOPA 5CJQL 2RHPA 2R0KH 2R1XA 5E6YA 3MRNB 4GAGL 4I13B 2HH0L 1LCLA 4KJWD 3CUPA 1P6AB 4LLMA 3KXFB 3VMOA 1OOAA 1Q9KA 3ZXFA 5ELIA 1YNTB 3MROB 3P11H 1BVKB 4U7KA 4FPKA 4I3SH 4NO2A 4R0LA 4M3CA 5GGVY 2FJHB 3BIWE 3WKNA 3GBML 1EJ6A 2LQRA 1DLLA 3CX2A 3AY4A 3BGMA 2J8OA 3RMYA 1Q9WB 3TT1H 4MSWB 4KK9C 5EBWB 4M9OA 3FB8B 4LSRL 2V2TA 1DTUA 3O6FB 2VL4A 5T3ZD 4L3ED 3QEQA 4RAVB 4XH2B 1UM6L 2P45B 4JHWL 1YYMH 2UWEF 5TQ0H 1AQKH 2IH1A 5IROA 3T77B 1UJ3A 3DX9A 1DN0B 2D7PA 3VXME 4PRPE 4NP4H 3KPSB 3FT3A 4R3SA 4K23L 5C0BB 2XWTB 5IG7B 1FVDA 5CEZE 3SEPA 4MQXD 3CDYA 1AI1L 4ZOAA 4XAWL 4M7JH 3RWGA 2YMXH 3LHPL 3MOQA 1HDMA 2NR6D 5FGRA 5EO9A 2OTUA 3VH8G 1NGZA 1FNHA 3TCXA 3ENRA 3MLSH 1ZANL 2H6PA 5GJSL 2G5BA 4JZNB 2VJXA 5H37H 2FECL 3E0GA 4XP9L 4RGND 5T5LA 4QWWC 1MRDH 3WCRA 3K74B 3BGFB 4IMKC 4U31A 4HQQL 3F5WB 2O5XH 2QTEA 4LKXB 3WFBH 4NO0B 4JRWA 4POZD 2IAMB 1OTSD 1LO2L 4LAS