2C9AA

Crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
259
structure length
259
Chain Sequence
ETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE MU
publication title Molecular Analysis of Receptor Protein Tyrosine Phosphatase Mu-Mediated Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 259
sequence length 259
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c9aA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c9aA01
5DA0B 5J89A 1Q1JH 4J3TA 4JFDB 1WIOA 5HDLA 4MX7A 5DD5L 1Y18B 5CIPA 3K2UH 5EO0A 1T66D 3FT3B 1Q9LB 4WEBL 4WFGE 1N8ZA 4GKOA 5EA0L 4FQ1H 4F7TB 3T8XA 2D7PA 4G8FB 4B5EA 4X6DF 2Q3AA 3O2WH 4OIIL 4XGZA 2HMIC 3WIFB 2ZOKA 2A6XA 5TE6H 3VW3L 2F9BT 3CVHA 5LXGL 5F9DC 5L2KD 1Z78A 5GZDA 3OPZL 3UPRA 4XDQA 3VFSA 5CWSA 2ID5A 1OAQL 1DVFD 4PRPD 3VXTA 1HILB 3I84A 4WFFD 4R8WL 2E51A 4RMSA 1NLDH 4HF5L 2QSTA 1YJDL 4YNYB 1N26A 2IC2A 1LO2H 4YAQB 3X14A 4DN3L 2CJUL 3MRPA 3WVJA 4P2OD 2NTFB 1L7TH 1N6VA 4MAYC 3TBSB 4KROB 4R96A 3KPRE 5EBMA 4PJIB 4Q0XL 5M94B 5FYJD 2F54B 2X4QA 4NSKA 3LZFL 5IW6A 3QPQC 4GW1B 43C9B 2J8HA 4NZJA 1T2XA 2Z31A 1L9MA 4HLJA 1H5BC 4G6JH 4HEME 3EFFB 3RDTC 4FQIL 4JLRA 1QFOA 4PFEA 4RIRB 3CDCA 1BEYL 1CD8A 1F4WH 1MJ7L 5E1HB 1K4DA 2IMMA 3DVNB 3OJBA 3OXSB 3OGCB 5BOZG 1U3YA 3KM5A 3QEHB 3RWDA 3TZVA 4K7FB 4JRXB 5CBLA 5TDOB 3CU1A 4ELMF 3EDKA 4JN2B 4MNQA 4XHJD 4UW5A 4ZFZB 3VXNA 2F8VA 4OLWH 2ZZUT 4I18B 1NUDA 4PBOA 4YBHA 3TA3B 2OCFD 1HHJB 1MF2H 2WM0A 1MIEH 2DWEA 2XNAB 5F1KC 1D2SA 4WUUA 4LPVA 4QYOB 1HSBA 3SDCC 1ADQL 4DVBB 3CSYA 5JTWA 1JNNH 4ASMB 1KLGB 3QUYC 3ELAT 4NQDA 3O41B 1W6PB 3STBA 5IB2B 3BZ4B 5IKCA 4QWWD 5ILTL 1P5UA 4YFEA 2BDNH 1J5OH 1NGQL 1ODAA 3AM8C 3EYFB 4K94H 1ZT1B 4IMLB 4LGPB 1VFUA 2VABA 5I73B 2FJHB 4OCRL 4XH2B 3C08H 4K8RL 4OCSL 2NY0B 1EZVY 4LOUC 2CWMA 4K71B 2FB4L 5T5FL 3UXFA 3V4UL 4Y20A 4H25B 1U93A 1F5WA 4Z7VF 2A6KA 4G6AD 4UIMA 5LBSL 4EVNA 1B9ZA 1FFOA 5IUQA 3ZXJA 3H8NA 3ZSKA 3OKKB 3ZO0A 3UYOD 5JA9A 2KZ1B 1RZJH 2BSRA 1N3QA 4J23A 1EH9A 3G5ZB 4HK0B 1W6QA 1JF5A 1UJ3C 4GAJH 2PW1B 4JQXC 3WLBA 4JFOA 1YEDA 1FDLL 1OSZA 3NCJH 1ONQA 1GV9A 4X5WA 4SLIA 2OJEA 4XX1E 3QDGD 3BEWA 4LKCB 1J1OH 1FNLA 4NUGH 5TJWK 5EUKB 5HHPB 2OR7A 1C1EL 3GSRB 4HANA 1OB1A 5F9JB 1ORSA 4FOQA 4YZ2A 1OF2A 1Q56A 2X7LA 3JBG7 2AYHA 4UOJA 4U0RB 2QSCL 5DZLA 1J8KA 1YQ2A 1XGYL 4FZ8H 4K2UH 4IOFD 3LQZA 4PJFA 2A83A 2I9TA 5SV8A 1FLRL 5JOEA 4PP1C 5D2LB 1MUJA 4U1KA 1YYMH 3T0EE 2G2RB 2Z35A 1NDGB 4JCKA 5GZFA 3MQIA 3T08A 2O93L 3PABB 1X5FA 3MGTB 1G7MA 4NIKB 1U8KB 2FECI 3T65A 2ZBJA 2VXTH 3AZWA 1LE5B 3OF6D 1HINL 4Z7WE 2ZUSA 1FORH 3FBYA 5I1CH 2NW2B 2DVDA 4NZRH 1G7PB 1MHEA 5E2TH 5CEYB 5C09A 3WLWC 1F9KA 1N5YL 2Z92A 2DQCL 2VDQH 5E8AA 1KB5H 5ECJE 3K3QA 1GZ9A 5DEGB 4Y2DB 3TNNA 3ZKSD 1OPGL 2MCPL 4I3SL 3AAZB 1EIBA 2ZOLA 1G0XA 4M7ZB 3EAKA 3B9KD 4GG6B 1T2QL 5EU7C 3GMMA 5CGMA 4G9FD 2E7MA 3QBTB 4KAQH 3DBXB 4Y5XC 1D5MB 1UKSA 4KKNA 3RY6A 3LHPL 4MZ2A 4F7EB 3CU7A 2CLRB 3VKFC 1Z6JT 1UZ8A 3QDHA 1KJ2L 4DGYL 1U2HA 2EDEA 1I75A 3GDBA 1VGKA 3MA9L 2VE6B 1JWSA 2BSTB 3GJFH 2R9HD 2ESVA 3V0AA 4ZQKB 5D7KD 4Y16D 2D9CA 3GBML 4UQ2B 2VIRA 1M7DA 3ARBB 3OB0H 3V5HB 3VUOA 4LBOA 2Z4QB 4IEFB 5DS8B 3ENRA 3IRZA 3IFOB 5IEKB 2HYKA 3WD5H 4R90L 1JGVH 2DURA 1Q9KB 2OLDA 2Y1VA 2CKBB 5F9AC 5TGBB 4OGAD 3OYWB 2N7BA 4R97B 1F31A 3MRKA 1P7QB 5D2NA 3D2UB 1QRNA 4DQOH 1SBBA 1F90L 1P6FA 2NX5E 4G42B 5IESH 4FPOB 3A4UA 2UUDK 4JB9L 3RWJB 3WIHL 3KHQA 3W0WD 4LPYA 4XTMA 1QFWH 1DQQB 3VXSB 2ARJB 5HVHB 2ITCA 3P3YA 3MUHL 1OAKL 4JFDD 5IW3A 1N3PA 1SY6L 1G7LB 1EHLL 5F89A 1QBAA 3MA7B 4E5XB 3WHXB 2AQ2A 3IU4L 1RIUL 1D0HA 3N3HA 3WSQL 3JVGA 4NJAH 2HJKA 3G04A 2D44A 4DW2H 1CR7A 1DTUA 4N1CA 4OZGA 2O61A 3F7QA 3ILPA 4WCYH 4WW2F 4B7IA 3BJ91 3HC0B 1ND0A 3G6JF 4JREB 3C8KA 3NIFF 3MLPA 3TO4B 4KJPC 2OTWB 3RX8A 5CJ5A 4TRPL 1W0OA 4WWKC 1U3HB 3OJMB 4FP8L 4O2CB 4P14A 2ADFH 1WFOA 5J13B 2M8XA 5C0BA 1JHTB 4M7LH 3C60A 4YXKL 2ZGNA 4WHTA 4I5BA 3ZXLA 4XNYL 2EDKA 4UB0H 4P5TB 4ZS7L 4XPBL 4KROD 4M6OL 4JPIA 4EUPH 3PV7A 3S6CA 1MIML 2F54D 4XNQB 4F57H 3UZQA 4NQCA 5F9OH 3O8XB 1MS0A 1QVOA 5JUEH 1A4KA 5E8DL 2A6YA 4PLKD 4Q2ZA 5IEHB 4H8WH 3Q6GH 5SWZE 2R0FA 4IOIB 3TPUA 1QOOA 4FXGB 4PJAE 4XBGB 3CFBB 5E1AA 3TF7C 2EAKA 4NCC2 4YPGB 5F7YC 3D85B 3SQBA 3THMH 1N6QL 3MOBH 4FOVA 2XRAL 4BFEA 5T33H 4FRWA 1DUZA 3PV6B 3PWLB 5CD3A 1WBFA 5IBUB 4H0HB 4HWBH 4JKPL 2YBRA 2CH8A 4EDXA 3M1BB 1D5XA 3ARFD 3OKMB 3H7LA 2BJML 5BV7L 2AP2A 1GIGL 5H94B 4PD4J 1A2YB 1A7PH 5EO1A 4U31A 2P46B 1H0DA 1ZS8A 4C56B 1T5WB 3LEYL 4YG0A 4P2RA 1E27B 1RK1B 3TA3D 4ODUA 1ITCA 3LKOB 3LSOB 2HRPH 3WLUA 4RDQG 2D7TH 3BXNB 2OSLB 1DLFH 3L3DA 4QRRE 4HX1B 4E41B 4J3VA 3DVFA 1WZMA 3W11D 3SN6N 2DQFA 2J6EH 1PGRB 3RWFA 1LHZA 2QJDA 1BD2E 1TVBB 3H9ZA 5DYOA 4TZDA 4XWOD 4UNUA 4RA0A 3S37L 5CMAA 3HE7A 4XP9H 4X99B 2NY0D 1LO0H 1TEIA 3WDTA 4HL0A 3RWGA 4QRUA 4YZ4A 4P23C 4Y5VC 4P99A 4MNGA 5C9JB 1BLNA 1D3CA 2R0LL 3D9AH 1WBYB 4BZ2H 4JO3L 3RGVB 4OZFB 1C7TA 2ZP0T 2XPGB 1EUUA 2SBAA 1NFDB 4NGHH 1MLCA 4Y19B 2R1DA 1WWCA 4LSVL 3NFSL 4WUKL 1FYUA 3GMQB 4EEEA 4OGYH 1UM6L 1K2DA 4G3YH 5DD0L 3U46B 2FL5A 1DLHB 1RUQH 5SWSD 5IGXH 3O6LH 3UCRA 2RCSH 1H5BA 2ATPA 3LPWA 4M6NL 5ICZA 1FO0B 4G8EA 2GI7A 4OM1L 4TQEH 4F8QA 5E94A 1Q0XL 2YRPA 1X5YA 4D0DB 1NCBH 4IDJL 5D6CA 1HHGB 2X09A 3LKQA 2Q20A 1OT1A 3E6FB 4HJGB 2A75A 2UZIH 4AT6A 3IDYB 4L29B 2A74B 5T1LA 2AJVH 4YM3A 4ORGB 1FIEA 4PYGA 3BYYA 5J8OA 1GGCL 1AX0A 1NC4D 5KOVC 4L3AA 5CEZL 3TAYA 2CKBL 1YDPB 5AEAA 2VC2H 3S97C 3PG2A 4S1DD 1A7QL 4EI5B 2GITA 2OI9C 5EZLA 4M48L 2DQDL 4YUEH 3T2QA 3DGCR 3SDCA 5MERA 4O4YH 2XG3A 3AREA 4NYLB 3DO7B 4XPHL 4XB8A 1IGMH 3INAA 3OBAA 4LRNL 3SPVB 4F3FA 1C1LA 3MRCA 1JN6A 4ITCA 1SYVA 2V2WB 4NFBA 2HKFL 3CCHB 4OT1L 3AM8A 1ZTXL 1MJUL 2VWEE 5E8EA 2NW3A 4FPFA 3L5XL 4PGCB 3P0VH 4ZODA 5IMMA 4CBPA 2ZGUA 5LGJA 3L5WB 5IB3A 5HCBA 4I0PC 3SKJH 3E2HC 5DLML 4WUUE 2ZGTA 2D7FA 3ORJA 2NXZC 3VXPA 3BUTA 1A6AB 2H9GB 5M7QA 4NQDE 4P5MA 5JHDB 3PXHA 1PZ5A 2D31A 5MP6H 3QHFH 1NGPH 3JWOL 3SOBH 2Y23A 1NFIA 3G6AA 2AK1H 3Q5OA 4HS8L 4LFHG 5HHNA 3S4SB 5IHZB 5A16B 4B0MM 3I2CH 3EJYD 1UJ3A 4JQXA 2DLGA 2HFGL 1NCDL 3QXAB 4J6RL 5KVGL 5DUWA 3D5OA 4MQXC 4N90E 1YYLH 2VZVA 4WI5A 1GZCA 5L88H 4I77L 4GFTB 1D9KB 2HTLC 4MAUH 5CEZD 3G08B 1JIBA 4QXUL 1CDBA 4FG6C 2J2ZA 3EOTH 5HSFA 4X6DA 4HLZG 2VLRB 5B8CB 2L4OA 1P7QD 3D2UD 3EFDL 4FMFA 4XVUD 4OD2A 1J8HB 1G9NC 3BE1H 3BPOB 5IROA 4RWYL 4BYHA 1N4XH 3H3PH 1S9WA 4PGDB 1M1SA 2HFEA 3NZHH 4N8CL 1ZLSL 3ULUF 3QEQD 5DJCB 3WXWL 4H20L 4FQZA 5C2UB 3MRDA 1OQXA 3HR5B 1EXUB 2R0ZL 1DQ1A 1V7MH 3SLIA 4KVCL 4HBCH 4HK3J 3IFNH 3GUTA 2HT4D 3QIWC 4OD1H 2PXYC 4W65A 1U8IB 5ACLA 4L4TB 1WK0A 2R1WB 3PWNB 1EGJA 1X5JA 4U6HB 3S36L 1EAPB 4ELKA 2AEIT 3HE6C 1NCCL 5HY9A 1WW5A 3HUJF 3Q48A 2J12B 3QEUA 5IVXB 3CZJA 2P5WA 4LQFH 1RSFA 1HZHL 3BVNB 3QQ3B 3SE4C 4Y5XA 1FRGH 4MS8D 3AUVA 5E2WH 2ORBL 3TYGL 4O5LL 4CRPA 3MLZH 4KKAD 1KCLA 3FRPA 4LF3B 2B1HH 4YIQA 2I60H 5I1JL 4AEFA 4IOSD 4UW3A 4C59B 3ARWA 1WF5A 5KSBF 4EN3B 1QOTA 4P5TD 4NHUB 4KI5E 1QQDB 1WBZB 2WLZA 4ELMA 2KH2B 1ZA3A 2BNRE 3QSKB 3J8F7 5E03A 2H2SD 4MYEA 4AGGA 2CLZB 3HN1A 5FCSH 4OBRA 1QMJA 4YXLL 3ZL4L 3MV7B 3KNBB 2GAZB 3CUPA 4BFIA 3I6LD 5KSAB 3E0GA 3RZCB 1YEKL 5FHBL 5C6TH 2FYYA 3L9RA 1R3KB 2AEPL 4KVNL 5CBAB 4HUVB 2QHRH 1IFHH 4RGNE 3SDAB 3ZKND 4DKEH 3SE3C 2WQZC 1LEGB 2A6DA 4XVJL 2OL3B 1AE6L 3QUMA 2D6KA 3AZZA 1UWGH 3MGOA 3JTSB 5DRXA 1SBEA 2OUJA 3V8CA 1HWHB 2A3XA 4C56D 4FHBD 4WW1B 1TFHA 1Y6NR 4KZDL 2W0KA 3PDDA 1CDJA 2EDQA 5EC2B 1UKTA 2NCMA 5FOBB 5HGHA 3EGSA 4BOWA 2EDDA 3RP1A 2YSSB 3SHSA 1AC6A 2Y6SC 2EIEA 3B6SB 4DZ8B 2GTZB 3DX8B 4Z7VA 2EKSA 3AJYA 1WAAF 3QA3B 3TB0A 1J0IA 4MJ5A 2R56L 3GSNB 1S7SB 4XCEA 2W08A 3PWPB 5D2NE 4LPTA 1J87A 1DR9A 4LIQL 1G7QA 4DUXA 1UH4A 4S0TD 3EHBD 4DPNA 3MLYH 3MSPA 4IRSD 2WLYA 4F33A 1AKJB 1EFQA 1X6LA 4DCQB 2D6MA 4WWKA 2ZJSL 1I8KB 4QY8B 3X13B 1VADA 2QLVB 3SH3A 4PGEA 1ERNA 1CPMA 3ARPA 3H0TA 3GSVA 2QTEA 2JCCF 3VD9A 1HKLH 3N7KA 1F3JA 3I75A 5DJ6B 3BP6B 5IHBA 4W81A 1T21B 4DVRL 4HGKC 1AGCA 1UCTA 4PJ7E 3AP7A 1CD0A 2NY2B 4LDEB 4NN5B 3TGXA 3AYAA 4FMKA 2BSSA 5ALBH 3K80A 3DECA 1U91B 5GRXG 3ULUC 3G6DL 2IEPA 3VRIA 1H3TA 1S9YB 4UDUA 5CINL 2ZCKH 5E6IB 1KJMB 3RIAK 4BKLB 1T89C 3RRDA 3MROA 3FFCB 4G6KL 3PWJA 2X2YA 5EYXA 4C83B 1I9RL 1DUYA 2F74A 4PUBL 3BODA 3O11A 4M1GH 4KUZL 1HN1A 1LGNA 2IPKA 3TJEH 4CDHA 1A14L 4P2QA 5C0CB 2OXGA 3KYKH 4ZYKA 1FATA 1NLBH 4NQCE 1ZOXA 3QQNA 5EO9A 5KTEL 4NHCL 2CR6A 1GAFL 4UZGA 5DJXB 3MR9A 3B2UC 4YW3A 3GSWA 3FQNA 4XBLA 2HH0H 2EYSA 1NLSA 4O51A 3M17A 1B6UA 1YIFA 5IVZB 4HS3B 4FP3A 3BYTA 1FBIL 1WUNT 4LEOA 4PTTA 1NFKA 1I3UA 4LDLB 1OM3L 1TJIH 4X4YB 3W59A 2X4PA 3FFZA 4P57B 3HR6A 5BMFH 3AB0B 5JW5A 1A6UH 1TXKA 2WWMD 1B2WH 1EBPA 3WUWA 3VFMA 3F7RA 1N0XH 4P2RE 5E2UH 1RZ7H 4LHUA 2ARBA 1IQDB 4Q6IB 3V5KA 4ODWB 6FABL 1PKOA 4NWTH 4NC1C 5INCA 2DQUL 1RZGA 5DMGC 2ZCLL 2DUQA 3VD4A 4MVBC 3IDGB 5E5UB 3GSXB 5CP3H 5J1SC 4A6YB 1OGTB 3UC0H 4P23A 1FL5B 2BZDA 1KG0A 1FYTB 1AXSB 1KGCD 1U8HA 3MLUL 3U9PL 4BQ8A 4Q97A 5GZNC 3FQXA 1VPOL 3OTTA 1IEAA 4FA8A 3UTOA 1A6ZB 3HMWH 1KIRA 1J18A 4RQQB 3VXQB 1QLEL 1DBKL 2P8PA 1KPRA 1BF8A 2AABL 5C0DB 3W2DH 4NNPL 4MXVF 1RD6A 2HVJB 5DI8B 2BC4B 3AVEA 2ARWA 5IM7A 1QD0A 4G80A 4MNGE 4XNZB 4YGVA 1FNEB 4WFEE 3TO2A 1I9IL 3MNZB 2FR4A 1VCAA 4OLUH 4GBXC 1RU9H 3FOMB 1IGTA 3RUGA 3FQWB 1NMAH 3MEPA 1MEXL 4UT7L 1H3GA 1RIHH 1ULDA 4WW2A 3PGDB 1H30A 4L3EA 3C5ZD 1M7XA 1RUAL 3MRIB 3G6JA 5K59E 2IJ0C 4BZYA 3SKOB 1XGPB 1M6OA 3FN9A 4ZTOL 3RA7L 1R0AL 4PLNC 1PQZB 3N1MC 5DFTA 5T5NG 1MCBA 3OSKA 2O5YH 4XB7A 2VISB 3DTXB 3FFDB 4QRPB 4TSCH 1JGUH 1OGAB 2CDGA 4OSUL 3S37X 3KLHC 5HYQA 3CH1B 1I3HA 1CXHA 3TIDA 3FB7A 3LD8C 4L4TD 3AK0A 1T1ZB 2OZ4H 3LMJL 4IRZL 4WI6A 4APQB 5B3JE 5AG8A 5KS9F 2BVOA 4PJ5B 1UM5L 2CLVA 3EJZC 2VLLA 1ZWIA 3GSNL 5FO7B 5GZEA 5J12B 3KS0J 3R06B 5C8JA 3KLAA 5GGSB 4X6FB 4JFPB 4XP4H 1JPGA 1KIPA 4PGZA 5DD1L 1Y0LB 4IHOB 1YJDC 2UU8A 4U6YA 2YPKB 5FKAB 1DBAL 3CSBA 1MH5A 3JUYA 2VH9A 4NDMA 1SLTA 3QCVH 1JPFA 3OBRA 3L3HB 3HZVA 4LASH 5CB7A 5I8EB 2DVFA 1VENA 3VRLE 5KSAD 5JQHC 1CGXA 5IVNA 4P49A 2X40A 1ZEAL 5DJYB 2ZGKA 1EK3A 2AERT 5C2BH 1DHKB 3SDAD 4FOMA 1J1XL 1T5XA 1W72H 3MGAA 4DGIH 4XYXA 1IM9A 3VV1A 4M5YL 2Y07H 4AENB 1BFVL 3IKKA 3S98A 2VN4A 4YHPA 1G9EA 4JCLA 1NJ9B 5H9QA 4PJCA 3HZKA 1RK0B 5J3HC 1ENRA 3GIZH 2PR4H 1D7FA 2GNMA 2FHBA 4DRRA 4YDIL 4I4WB 1FFPB 4XNUH 3B01A 4MDIA 3EDDA 3WNXA 2XB6C 4UW6A 1GCFA 3BWUC 4QOKD 3N85L 3TBVB 4RGOL 1R3HA 3LQAL 3RVXD 5C0FB 4ZOCA 3QFJA 4TULL 4X6DE 2XOTA 4JQIL 2IF7A 5I71B 5IQ7L 1FGNH 5FGRA 4Q58C 3CDGA 3FQTA 3QIWA 3QEGL 3KPRB 2DIAA 5LKNA 2F5BL 4F9PC 2ZSVA 3F7YA 1LEIA 1DQJA 2JELL 2F8OA 5LGHH 4JHBA 2A6IB 3MLRH 1MPAL 1P6AB 4G43A 1AKJD 1MJ7H 1R5VB 1FH5L 4NRZA 2JIXA 3L7EB 3QPXH 3U0WL 5ALCH 5GHWL 1C8PA 1B0WA 1IT9L 1CFQB 4GSDL 3SE4A 3MW4A 4U6TA 5KJRH 3VWKC 3IETB 4K8RC 4PY7A 1ED3B 1UYWL 4JRYE 3LKSB 1FPTH 1KEGH 5FYKL 1ULCA 1NGZA 3T2PA 2HVKA 2XQYG 3KJ6H 4CJ1A 1V3KA 1W0VA 1HQRB 1RIVL 1Q72L 2AJUH 4PBVC 4AY0A 5A2KH 3OXRA 5J6HB 1RZKL 2DI8A 4NWUL 5T52A 4JO1H 3MJ9H 3VG0L 4G9DB 3P40A 4JM2C 2NY3B 5FUCE 2DYPA 2D6NA 4XILA 3CPLB 1XIWC 2IH1A 2FLRT 4K9EH 35C8L 1REIA 5JPNA 1CF8H 4ETQA 3D3VB 4XXAA 4CMHB 4ELME 5IT2L 3CMGA 1HDMB 1U6AL 2JDZA 4YHZH 1CS6A 2EDWA 1J1PH 4OGXH 2A77H 5IVOA 5DC0A 3HHRB 1MAJA 4OM0H 4WWID 4LLDA 4PIRF 3SE8L 4YHKL 3GI9H 1OOAA 3O6KL 3O12A 3V6OC 1NCWH 3H9SD 1T1YB 3ZSLA 1CE6B 5E9DA 1YEFL 2R1BA 3QHZH 5C6WH 4LLQB 5C70A 3LIZL 4XP1H 1FDLH 1FYHB 5FYKD 1R5WA 4QCIA 2J7LA 3O9WA 1UACL 5IHUH 2OQJB 1XGRB 2EYTA 3ASIA 4TVPE 2QSQA 3V5DA 3QG7H 1Q8PA 5FF6A 5J1AB 1BQHG 3UTSA 4Z7VE 3BESR 4RGMB 3WEXB 2DQHH 3GJEB 2YRZA 3Q3GB 5JMRA 1FYTD 5TFSH 2DB8A 4HUUB 1J0ZA 3PIQA 1T3FB 2VNCA 3IDJA 1H9PA 2EDOA 4DUWA 1CLOL 1E6JL 3HI1B 4YR6B 1NGWA 3TVMC 1D5IL 1OAZH 3LRGA 1QNWA 3RBSA 4UINH 3VE0B 2KM2A 2VXVL 1EJOL 4NN6C 4LPWA 1RAMA 2NP0A 4D9RE 4X7FC 4MSWA 2FDBP 3QJFA 2EALA 2AAVA 4ZO6A 1LNUB 2BVEA 2GEEA 4Z7WB 5HI4D 2ZPKL 5HGDA 1T89A 4HXBL 1OCWL 4LAJH 3SCMB 4PLOB 3RVWC 5ISZA 1QO3B 15C8L 4YXHH 3AU1B 1CLZH 3IF1A 5ADOH 3VFRA 2VQUA 3ZMRA 3MLVL 3BRGC 5MEOA 1BZ9B 3NCYP 5HGAA 4LAQH 1BVLA 1H15A 5BZDB 3O0RL 4ZAKB 4XOGA 1OD9A 3WUDA 2PYFB 5C7XH 3HUJA 3ARQA 3MLTB 5T1MB 4Z7UF 5SX5K 4YGEA 4FFWD 3RHWK 4K3GA 5EH1A 3MA9H 4MA8H 2FJGA 4TSBH 4WV1B 1VKXA 5F3BA 3VXRD 2B8OT 3FRPG 5EU6A 1GGIH 3BKCH 4LCWB 4ODTL 5JO5A 1F02I 5EZJA 4O9HH 5KSBA 2WWKT 1HWGB 2W9DL 5DQDH 5ICXB 5GRUL 2MHAB 4XHQA 4QGTA 1V3MA 1DEEB 4UV7L 1HHKB 2G5BB 3WDXA 4JZNB 5D8JL 4K94C 1S7QA 4NPYB 4KHTH 4OLXH 4PJ5D 3QRGH 1BBJA 4R2GC 4WU7B 4DAGL 5GRWA 1OSPH 3AXLA 2O5XH 3MACH 4PJXF 2KQMA 3OJVC 2UY7A 1LDPH 1YN7B 4K21A 4U3XA 1OLZA 3PL6B 1LHUA 2IG2L 4Y26A 1Y6MR 4PJDA 5BCAA 4NRXB 1ZHNB 3MJ8A 3BW9A 1MHHB 2ZHMA 2V2TA 1YO8A 1JBCA 5ITBL 2EE2A 5E2VH 4Z95L 4GA9A 4AGVA 2NX5B 2CWSA 1RZJC 3IFLL 3VFPA 2FIRT 3VGHA 2R49A 4Q9QL 4P3CH 1C08B 3QI9B 2X4TB 1YI7A 2WKKA 3R8BB 5L2KA 4R4FH 1NMCC 1P4LB 1DVFA 3WCSA 3HR9A 1WAAA 1BM3L 1A6TA 2VLME 4D94A 3OG6B 4YHOL 4TTGA 4GXUN 1AXZA 4GBXA 2VAJA 3KPMB 3CZFB 5F9WC 1KB9J 4QXTB 3VI4F 4H5SB 4JC1A 4X8JA 1CZ8H 3QUXB 2CK2A 4FNLL 4U4BA 5LAXB 1MJJB 1LHOA 3NN8B 5BV7C 2GHWB 5DJAB 1MOEA 1IEBB 1UX6A 3LVEA 5FECB 1V6KA 1VA9A 3QAZC 3LB6C 4QRSB 3L3JB 2XQBH 2V6HA 4Y24A 3ATGA 3JV6B 3KYNA 4N0UA 3NBNA 2Y06L 4XNYH 4OBSA 2JCCA 2DMKA 1MLBB 1WTLA 3IGAA 3MBEB 4LNRB 1MFDH 1W6MB 5I1AB 4GW4B 4B50A 5DVKA 5C3LD 1MFEL 1FL6B 1NGYA 1U41A 3SJVA 1MS9A 1K8IA 5E8DH 3G6JE 4IRJB 4KRNA 4MXQC 1XF5A 3NIFE 4LLVA 1TQBB 1QHOA 3OG4B 4HGMA 3HC4L 5IW1A 1F2QA 3WS3B 1T03H 5SWZB 4JANA 2NNAB 2DI7A 3SY0B 2W38A 3M8OH 4PRHA 3DV4B 5IK3B 3UEZA 4KDTC 2WBWB 5DJDA 4XCNB 1L0XA 1JCKA 2Q87A 4XP6H 3OPZA 2EXWC 1DQ6A 2B1AL 2XG5A 4HDIB 4HIXH 1DDHB 4XC3L 1JFQH 1GIGH 4DEPC 4M3CF 1NMBL 2EH8L 4GRWE 4NO2B 5KSVA 4YFWA 5F21B 4LP4A 1SYSA 4P3DA 4OZ4A 3WHTA 5DJ0A 1DQ4A 5DUML 3EO0B 5DVOA 2VN7A 4GMTL 4XBPB 5JXAL 2FEEL 2BRRH 3P4NA 4QRTA 3V0BB 5CJOH 1MS8A 2AUYA 4QRRB 3O4OB 4H26A 3GMNB 4LBQB 2NY6C 4NQXA 3C5JA 3QXWA 1FZJB 2NY3D 3AMKA 3FMGH 1G6RB 1F6AA 3MCKB 4MCYB 1DBNA 1BD2B 2VDKL 2P3IA 4NQVA 1DL7L 3D3VD 4FFYH 3UO1L 3GNML 3WL9A 3TNMB 4UOW1 2DLFH 3MLSH 3FLRA 4LCYB 2XKSA 3WUWG 2ENRA 2ZG2A 1AD9A 1NAMB 2VO5A 3O6MH 1TZGH 3CMOH 1WEJH 4PJBF 1JZ5A 4LHUG 3R1GH 1G9ML 2EDNA 4PJ8D 2EYRA 1HYSD 1BGXL 3QR2A 1C57A 4MX7B 5CIPB 5EO0B 1A22B 3QDMD 4XPFH 4NQEA 2B2XL 1N8ZB 3T8XB 1XR9B 2M1KA 4S1SL 3WDJA 1G6VK 3IPVB 2ZOKB 2EDJA 3WKNA 1G9AA 3MXVL 4LPXA 3CVHB 4XI5D 5CEXB 3UPRB 5DK2B 2K1MA 1WFNA 3VFSB 5CWSB 3SGEH 4F9PA 4CKVX 3VXTB 1YY9C 1UPSA 3ARSA 5A2JH 3BKYL 3QQ4A 1JWUA 3PGCA 2EC8A 1L4IA 4BA8A 3BD3A 2W91A 3ZTNL 4OI8A 2WT0A 3Q2CA 3X14B 3ZSSA 2NY5H 4PCRA 3QFJE 1UCBH 4L4VD 2EKJA 5I1KH 4AWDA 3VWKA 1IEHA 4AIZB 3WO3B 1E6OH 1Y6KR 5EBMB 3A0KA 3OKNB 2XWJB 2AREA 4CNIA 3RI5K 1F4XH 4BUHA 3BPLC 4NSKB 1PG7W 1TETL 1GGCH 5D70L 2Z31B 2EIZA 3FB8A 4GRLC 1DIWA 1FNZA 2WBJC 1DQTA 5EZIH 4AMKL 4G9FA 1GRWA 1YEIL 2DL9A 5C07E 3SCMD 3P0YH 1KELH 2E27L 4JM2A 3OB8A 4FXKA 5L9DH 4OFIA 5MEND 3RWDB 3TZVB 1A4JA 4BK5A 1XIWA 2O5ZL 1FGVH 3PF2A 1YEGH 3CFIC 5CJQH 1KQRA 1EEZA 4J12A 1B0RA 3ARXA 3VXNB 3FO1A 1PSKH 1NKRA 5CILH 4WVVA 2XA8H 2OMNA 2C4XA 5D1QC 2P44B 4NKOA 2GN3A 2R29H 3CIQA 2DWEB 3IAPA 3P9MB 3FOLA 1T7ZA 4MJID 5KS9A 4WUUB 2A1WH 1JPTL 1F4HA 4KPHH 2AEWA 1HSBB 5KXCA 4MDJA 3CSYB 4GMSH 4PGBA 3KVQA 4NQDB 3TFKD 1MNUH 3V6OA 5IKCB 5JDBA 1QSFA 3JWOH 5I74C 3USUA 4LCWD 2UVFA 2RHEA 2XZZA 2GJ6A 2XTJD 1RHFA 2D7MA 3WFHA 3CFCH 5CZXD 4P0DA 1RUMH 5BRZA 3ZYJA 1CICD 5KN5A 1U8NA 3ILQD 3GB7B 4OIBA 1AX1A 1SLIA 4P5KA 3IN9A 3PHQB 1ZGLA 5IOPA 1VEPA 2V9TA 3LS5H 2MKWA 2NY1B 2CMRH 5JW4Q 2IFFL 4N0CC 1DQLL 1FNFA 1U93B 3AP4A 4UIMB 4EVNB 5TF0A 1AIFA 1FFOB 5E9DE 2FEDD 3PL6D 4XNMA 5GRVK 2QQLL 2YA2A 4V1DE 1LO3L 1GC1H 2BSRB 3NMEA 2DWRA 4M7JL 1GJIA 1W6QB 3HNTH 2A9ML 4ZTPL 5JW4M 1U8OA 3BKJL 3NPSC 3AX4A 1JL8A 1UGNA 1KJ2A 1ONQB 4Y1AD 5J9PA 4X5WB 3QI9D 2OJEB 4KY1L 5DRZA 1S7WA 3TPKA 2UV3A 4JFFA 1MFBL 2NZ9C 3BEWB 1D5ZA 4RAVA 5DG1A 5KOMC 4F7MA 1OB1B 2AKRA 3DXAE 3F7VA 1ORSB 3NFNA 1OF2B 2X7LB 5T54A 5I75C 1DQDL 4FQ4A 1IC4L 3LQZB 2A83B 2IQ9L 1GHFL 1U8JA 3RWHA 4WO4D 1PYWA 4XCCH 4YDJA 2DYCA 2Z35B 3UAJD 4JG1H 1CL7I 2PNDA 1GSMA 4GALA 3QWQB 2HJLA 3KXFE 1G7MB 4FXLA 4HV8A 4KQ4L 3T65B 3GSOB 4UTBL 2GMEA 4OCNC 1YN6A 4CGTA 4MCZB 3WCRA 3TWCH 3WIHA 2E7LC 3SE9L 2YD9A 2Z92B 1YZZA 1CFBA 1A5FL 3I85A 4WI9A 3VWJC 4XCFL 4PTUA 4KTEH 2ZOLB 1S3KL 4TVSa 4IRJD 3WO4B 3ARFA 3GMMB 2GMPA 3HUJE 4W4OC 1NSNL 4U2AA 5SWZD 3B2VL 4OZFH 4Z78A 4KVNH 3SO3C 3BFOA 1UZ8B 1PKQA 2HKHH 3RIFK 1Q8VA 1GGUA 3BDYL 4RGNB 3T0VA 1VGKB 5EU6E 3CVHL 4HCRH 1JPSL 2AJ3A 4OLVH 3WMSA 4OZHF 3V0AB 7FABL 5HDBF 3DYOA 1DBJL 4MD4A 5GGRA 1FO0H 1T22A 1WISA 4U7MA 4NNYA 1M7DB 1L0YA 2F5AL 4YDKH 3QWRA 1NANI 3MRQB 4ZD3L 3ETBF 1QR1A 2V17H 1OQ1A 4IS6A 3MJ7A 5T3XH 1SLCA 3I3EA 4XMAA 4QRRD 2JJVA 4LBQD 1W6OA 2P8LA 2VDPL 3VJ6A 5E5MB 1KCRL 2HJFA 2VYRE 5KVEH 3PJSA 4LFHD 3MRKB 3ZKXC 5LCVL 5D2NB 2A9NH 1QRNB 3MRHA 4HG4J 5I8CB 4OD3H 1GICA 3AFLA 2NYYC 2EO9A 4NBXB 1BFSA 5L2KE 1VFOA 3P11L 2JJWA 2ITCB 3BKML 3T1MA 3MNWA 1VACA 5CGYD 5IBTH 4PRPE 4NCDA 5DK0A 4LCUA 5F89B 4M7LT 2ZGSA 4PV9A 3DRTA 3OKYA 1WAAE 3MRBA 3RZWA 2HTKD 2IAND 4PRIA 1VGEH 2VDNL 5J11B 2A6JA 2QQQA 1FVEA 4OZGB 4DFSA 4MLIA 4P4KC 2O61B 3C9NB 4RX4A 3ILPB 4DJMA 4CJ0A 5JR1H 4L9DA 3C8KB 3GNEA 1AJ7L 4AEIH 2ZKNA 4AJ0A 4MJ4A 5FYJE 4IJ3C 5ENWA 4EOWH 1B90A 4G6KH 5A2IH 1ONAA 1KYOK 4N5ED 4ZFGL 1KJVA 3DYPA 4ENED 4N0UE 1IMHC 5C0BB 3C60B 2JCCE 1PVHA 4WHTB 2N56A 2DQGL 1KN4H 4PB0H 1UA6H 1WLHA 4JFHD 4JPIB 4NHCH 1GAFH 3VFVA 1AZDA 4NQCB 3GJFA 3QQ9D 4L8CB 2Z31D 3V9FA 3IDXH 5BO1H 3TPUB 1W0PA 2V9RA 4Z7UA 4R9HA 5E1AB 5C1MB 2JECA 1KPUA 3KQRA 1FNSL 5JA8B 4ZNEE 3V2AR 2VW2A 3AGVA 1WFUA 5GRVL 3QH3A 3TZVD 2D4DA 4EDXB 5D1XC 3EOAA 2RB8A 5F71A 4ODXA 4MHHG 1TIUA 4MNQD 1A7NL 5EO1B 2XWTB 4ZFFA 2EXHA 1KIQB 1H0DB 2QSVA 4MA1B 3WHE0 3LEXA 1U0QA 1GGTA 4P2RB 3AP9A 2F53D 3HC3L 4ODUB 2VDLH 1CFSB 2VZTA 3DI3B 3IYLW 3TP4A 1BWMA 1I8MA 4HWEL 2WIIB 2BY1A 3L3DB 3UYRL 5GGVL 2IPTH 1EMTL 1Q0YH 1MHPL 1UVQA 4MXWL 4PJXA 4ETYA 3O3AA 5FB8A 4NQDD 2FSEA 3GKWL 3RWFB 1F3RB 3U6RA 1SLBA 4PD4K 3FB6A 1H9WA 4M7KH 4XVTH 1X4XA 5CMAB 1DBKH 2W92A 3HE7B 4ALAH 2R0KL 4X98A 3T1WA 3RVUD 5E0QA 4HKJA 2DTYA 1GOFA 2KL6A 5DUVA 1UZ6F 2NY1D 4XPTH 3LEVL 5EWSA 3RWGB 4QRUB 3VDAA 1TPXC 1RUKL 1CGYA 1DE4A 4E0RA 5D7JD 4QO1A 3IS1X 2G4IA 4KKBC 4MNGB 4PV8A 1BLNB 2NPLX 1HSAA 3X12A 3CXDH 5C9KA 2PKDA 5H2BA 4LSRH 4XAWL 1NL0H 1MACA 1MLCB 1R1ZA 5HD8C 1RUAH 3N9GL 3GBNH 4RNRA 3CLFL 4F7CA 4KV5F 2ZNWA 4MD5A 3DWTA 5EZOH 3B69A 1ROWA 3LSDA 4YBQD 5IFAH 3MW3A 2ZHLA 3T3PF 4NZUL 1H5BB 2ATPB 3B43A 4GRLA 2BFVL 2WBJA 4JRWA 2OL3H 4G8EB 3PVEA 4FZEL 3H3KA 2YPLA 2QADC 5E94B 4S1RH 5H9PA 3QUKA 1CIUA 4YHIB 3RJDA 5FM5O 2LU7A 2XQYK 3UZVB 5D6CB 1H3PL 1TVHA 1EUTA 2CQVA 4KRPB 3LKQB 3UTQA 5HVWA 3A67H 3BGFC 4AT6B 4LEXL 5T1LB 3QZWA 4WTZA 3EKCA 4H88H 2ICCA 2V7HA 1MCPH 4JGMA 3LS4L 4LBEA 1P5VA 3K74B 5D1QA 1RZFH 4G9FE 3FUQA 5IIEA 4X7SL 2BVUA 3FHAA 5F1IA 1MCQA 3IXAA 5EZLB 5C09D 5MERB 3SDCB 5IF0A 5INDB 2AENA 2ZGQA 3AREB 4AVSA 5DD1H 2YK1H 5CD5D 1SACA 4Q8KA 4XPGL 1XF2B 4AZ8A 4F3FB 4M3CA 3MRCB 1KFAH 1SYVB 3FRUB 4KI5D 3LQAC 3QCTH 2A7AA 5D7IF 3B00A 3WUCA 1ACZA 4P9XA 2NW3B 5D7KE 5E8EB 5DQ9A 3ULVL 4TUOA 5IMMB 1ZAGA 3QXDB 4LKXA 4M61B 5LGJB 5E99L 4DTGL 5KS9E 3PWVB 3HZMB 4TNWK 4BQCA 1JGLL 3VXPB 2GFBA 4XTRD 2GUOB 3ILNA 4P5MB 3V6OE 2XXMB 1I1FA 5CBEA 1MCCA 2D31B 1A3LH 2WT1A 3BT2H 4Y4HC 1OP5H 2ESVD 8CGTA 2CGRH 2YA1A 3N1GC 2E3VA 3REWA 3S35X 1X4YA 5DXWA 5EBWA 2NN8A 4OV6F 4KK6C 1UJ3B 3I3DA 4XJ9A 1A1MA 3L7FB 4JPWH 3O81A 2Y36L 1EZVX 4Q1RA 2NZ9A 5MHSE 3DX6A 3HN3A 1DFQA 4IRSA 4JFDE 5J7CC 5K93A 4PJEF 3SBWC 4GAYA 1KNOA 3H2WA 4X6DB 4S10A 2R16A 3APBA 3B3QE 1AFVH 1QRND 4XTPA 1GANA 1D6VL 4OD2B 1NBQA 2QKIA 4LBNA 4M6ML 4JFFE 1OQOA 1CK0H 1SFYA 3QIBC 4UDTA 3ULVD 1OAXH 3MRDB 3P9WB 5I1LA 3WDIA 4R26H 2AI0L 1N2RA 3TJHD 1RHHA 4MA3A 2QQNH 4J8RA 1ZT7A 2E7LA 4JRYB 3MNVA 1AHWB 5DUPL 3T0BA 1QUNA 4ZFOB 1UB6B 1YYNA 4J3UA 2G9HA 4JPVH 4TTDD 5TE7H 4ELKB 5HY9B 4A6YH 4KTDL 2PELA 4XBQA 2DQEL 3F12A 1E4XI 3QEUB 1TJHL 2OJZH 3VG0H 5C3TA 2Y72A 1A9EA 8FABA 2PHTA 4WY7H 3A6BH 1T20A 4Y5XB 2C3GA 4N8VA 4ZSOA 3OKEB 4D69A 4LK4A 5C0BD 4JO2L 1QKZH 4TUKL 5F70A 5CS7A 5KG9B 1BQLL 1S5HB 3DX7B 4K3EH 5EORL 4NJ9L 2VLJA 1KTRL 3GIVA 1W2KT 5F7FA 4ELMB 1ZA3B 4JEGB 5AZ2H 1XGTA 4KBBA 1OAYH 1MREH 3TBYB 3Q5YA 1MRFL 3RKDD 5I9QB 2ZUQB 4BFIB 3CUPB 2BOCB 3A6OA 1RZIA 3D0LA 5HYFA 2A6VA 5LWYL 3W39B 3ZDYF 5HGBA 2FYYB 1CDUA 2C5DC 5MI0C 3JWDH 3W58A 1ULEA 5I1EH 1WC7A 2YD2A 3RSJA 2EEDA 1J7VR 1QBLH 2BNUA 5L8JB 3BPNB 3B5GA 4X4ZA 1SMOA 2A6DB 3QUMB 3AROA 1V05A 3EDEA 4K3JL 5CP7A 2LAGB 3MGOB 4UIKH 5DRXB 4XBNA 5B21A 2VW0A 2RQ8A 2ICWA 1XMWA 4P2RD 2AJXH 2NYYA 2NXYC 3BDXA 3U1SL 4JY6A 1T83C 3A0OA 5HGHB 5D9SA 3CLEH 4D3CH 2NMNA 3EGSB 5C86A 4OKVA 1DJSA 4YW4A 4X80L 5E2JA 4Z7VB 2EKSB 5HHMB 1JZ3A 5ADPL 5LK5A 4OCWH 4HUWA 4QNPF 5KXBA 4MJ5B 4XCEB 5ACZA 1N3OA 3FLTA 5AD0A 1TNNA 4K7PL 1D5IH 5ID0B 2DVBA 2HMID 3QCUL 1IE5A 1L6ZA 1N1VA 4ISVB 5CCKH 3HPJA 4P4KA 5JPMA 1GKBA 1LOCA 3MRLA 1G7QB 1A0QL 1INDL 1YQVL 1HH6A 4I0KA 4RAHA 3RRQA 4YGCA 4F33B 4LVNC 4WWKB 4X5XA 2OK0H 1QRKA 5SWSE 4J2XA 3T4AA 4PGEB 3H0TB 1QPXA 3GSVB 1F3JB 3MLVH 4J4PC 3GRWH 4MAYD 5D1ZC 3CJJA 1NPUA 1AVBA 1AGCB 3LPFA 3P0GB 1LEKA 2D6PA 2IBBA 1CGSL 2NY4B 2BSSB 2I5YL 5CKAA 6CGTA 4DFHA 3QPQD 1ZE3C 4UDUB 3OAZK 4JKLA 3HFMH 3HI5L 2DQJL 4XMKH 4NZTL 3MROB 3DGGA 3RDTD 2H32B 2H1PH 4Y1XA 4J3OC 3RPIA 2F74B 3V95A 1KSRA 3G9VA 2AGJH 3MV9A 3O11B 4OQTL 5FYJU 2IPKB 1LU1A 2ZHNA 2V5TA 1N5AA 4KTYA 2OP4L 3ARGC 3VKLA 4AM0A 5D1XA 1S0EA 1SQ2N 4I3RL 4K9EC 3JTTB 5C0RL 5EO9B 2CRZA 5GS3A 1FZOA 3MR9B 5TQ0L 4EZMA 3GSWB 3WNOA 1B0GA 1KCUL 2IGFL 2C1OA 1N6UA 2EYSB 4Z7UE 4R7DA 4NQUA 3T3ME 4O51B 1JWMA 3M17B 4RDQF 3OAUH 2EXKA 4LEOB 4PTTB 3SDCD 1JYVA 1KTLA 5DMKB 2X4PB 3QUYD 3UZEA 5ITBH 1LDSA 4NN7C 4G8GA 4EJ1C 5HHOA 5D7SL 3BEVA 3WUWB 5GSRB 1FL3A 1U58A 3VFMB 3KPQA 5CSZA 3H9HA 2Q7YB 3ZE2F 3NA9H 4WI2A 3RPKA 3V5KB 2ZGLA 4LLMB 5IUSA 1G8WA 4FQLL 4JM4H 2YUZA 3MRMA 1ES0A 1RZGB 5I1IL 5FUOL 1SEBA 5GRJL 1LK3L 4R3SA 4LOUD 3VFUB 4PJXE 4BPZA 3WBDA 4P23B 5CUSH 1KG0B 4ZNCD 4GWNA 5EU5A 3BTAA 3X3FH 3C6LB 4WENB 5CSGA 1W6NB 5CEZE 4FPHA 4QOKA 5D96B 1EGJL 4LARH 3FQXB 4Y4KC 1IEAB 1IL1B 1KV3A 5I18L 5DA4A 4OAWA 2L0DA 1TZIA 1S9KC 2LTQB 1LO5A 2DUPA 5L7XL 2AV1A 3CK0L 1GH7A 1LMKA 1S5IH 5IM7B 4OZIA 2CO6B 3QEQE 4G80B 3D39A 3N06B 3P77A 3TO2B 3UJQA 4ONHA 1GZPA 5IJVA 5J6GA 1KCKA 3MYZA 4TNVK 5HPMA 5ESAB 1OKQA 5E08L 1RFDL 1ZV5A 5DGRA 4O2EB 4WW2B 1DANU 4PP1D 2BERA 5EBGA 3G6JB 4WGWB 4EDWH 2EZ0C 3WFDH 1M6OB 4POZC 2VQ1A 5TE4H 1PX4A 2FNBA 3K1DA 1CVSC 2ZCHH 5ESQB 5LVEA 3TT3L 3WS6C 2OI9B 2WINA 1NMBH 2N1KA 1FZMB 2CDGB 3WLWD 1I85C 3PNWA 2D3PA 1IGFH 3FB7B 1BBDH 3MRFA 3HMXL 4I8DA 1DFBH 1ITBB 3IKWA 5T55A 4O58H 1C5CL 2HYMA 4BMEA 3MC0A 1IGIH 3VMOA 2P5WD 5D5MF 5I1GH 2EH7H 2BVOB 4X6CF 4LBLA 1PY4A 1U9KA 1ZWIB 2Q76B 5H37H 3I6LE 2NXZB 3S34L 2AXGA 1LESA 3MRGA 1DL7H 3KR3L 1BAFL 1CDHA 5C8JB 2ZUXA 1ENQA 2P3KA 1JPGB 1KIPB 4DUVA 1GOHA 4M3CE 3VKNA 4U6YB 2JB5L 4Y4HA 1QP1A 3CX5K 1JI1A 3FHQA 4NDMB 4FQ2L 4R0LC 3FT2A 4X6BA 3I4IA 1JPFB 3PP3K 4Y0GA 5FA3A 3HZVB 5CA6A 1NCAH 5LQBH 2G75B 2YD4A 1PFCA 3KG5A 2W65A 4M5ZH 1UC6A 4WHYH 4OLYH 3L3KA 3O3BA 5C08A 5GJTH 3GKZA 3W9EA 1CQYA 5BS0A 1Z9MA 3INUL 5I15L 1HHHA 5BQ7B 5I1HL 2EIDA 1MRDL 5T3ZL 5EC1B 4ZUSA 1A8DA 1T5XB 5L6YL 3VKMA 3SBWA 2LQRA 1S8DA 2MPAL 3P4OA 1ZSDB 2LFGA 4HWNA 5C6PB 1ZHBA 4HKXA 3ZSMA 4PB9H 4I18C 4YHPB 1SMAA 2YUXA 5E8PA 1ZLUH 1Z3GL 3IRPX 3P30L 4ERSL 3O3DA 2XFXB 2CUMA 4PJBE 3NAAH 4HMEA 4MDIB 2V7NA 3RNQA 5DJ8A 1YMMD 4GRMB 4HIHA 3QIBA 2VDRL 2FCBA 5HHMD 2YWYA 5I17A 3W5MA 2DDQH 4S2SA 3QFJB 3ZKMC 4JR9L 3WFCH 3V52H 1V7NL 3WKML 4R4BA 1WLDA 3CDGB 3FQTB 3QIWB 2X5PA 1F4YL 1CE1H 3VFTA 5I73C 4IQPA 3S35H 1YPZA 2ZSVB 3F7YB 1LEIB 1DQJB 3BP4A 3RWEA 3QDJA 4YZFF 2R0WH 1SEQL 4GLRH 2C4FT 4Z9KB 3RU8H 4K71C 4KJPD 3SDYL 4B7LA 4OI9A 2UZXB 4YGDA 1BKZA 4NRZB 2JIXB 4YHNA 3RI5F 4WWKD 4TPRL 1L9NA 1P2CA 5C07B 2R4SH 1BJ8A 2X89A 5CGTA 4C1WA 2OXHA 5FKPA 2DM4A 2EDLA 1NGZB 2F19H 3DSNA 5EULV 3S8WA 3EOBA 4OUOA 4YJZL 5FYLL 5IFHL 2HVKB 4YE4L 3VXRA 1JRHL 3WE6A 1JUFB 1W0VB 1GOGA 3QZWG 2YD8A 4WTZG 4K23H 3CNKA 2E9BA 3MODL 3OXRB 4XAKE 2GSIB 1WWWX 5KSUA 1CLCA 2DI9A 4LIQE 2VL4A 4ZSOE 1SM3L 2YPVL 2C5DA 4YM0A 3DIFB 5J4MA 4U3HA 1CDIA 1W8NA 1QYGH 2IH1B 3MCLL 1FVCA 2WUCL 5I8OH 5JPNB 3D25A 4P2QD 3QO0A 3V4PL 5HDQL 1AO7D 4LSSH 4NM4L 2CSPA 2DJUA 4ZO9A 5D7IA 4JDTL 3O45A 4M43L 1W72A 5H9SA 1CN1A 3F6IA 2FX9L 4FPCA 2NM1A 3WZ1A 2X4OA 1MWAH 4S0SD 2PCPA 3L5IA 4P59H 4GKYA 5HHVH 1T83A 4Y22B 4LLDB 3ARYA 4BM7A 2VZSA 1YNTA 1XCQA 2CK0L 3GI8H 1FHGA 1XFPA 5E9DB 1CTNA 1LO3H 3JUZA 4GOSA 1F8TH 4KZEL 4Y2DC 5HCAA 2DLHA 4ZO7A 1KGCE 3EYVA 4M7ZC 3KYOA 3NACH 4HFUL 1TCMA 3BOPA 4QCIB 2VJXA 3X3GL 5FYLD 4LHUD 3O9WB 1KEML 3WG4A 1KXVC 4D0CA 1N7ML 3DRQB 1G7IB 1ZANH 5FF6B 3UTSB 1NCUA 5CJ8A 1YEEL 4D9LL 3DXAB 4AL8L 4P23D 2W60A 5ETUB 1UXSB 3BAEL 3M07A 3VFGL 2VLMD 4PJEA 3V0VB 1CLYH 1KDKA 3PIQB 1HI6A 3C2SA 2NY5C 3T77A 4JGUA 4J4PA 1JTOA 4NT6A 4PJFF 5D1ZA 3VCLA 3T2TA 2DS4A 4UU9A 3S3PA 3ARBC 1FE8L 3QFDA 4Y2OA 3KXFB 1G6RH 4MSWB 2X4NA 1AJKA 3SGEI 2OTUB 4Z5RA 4OFPA 2IQAA 2EDRA 1MELA 2OX5A 4YWGH 2Y5TA 3JXAA 3L3GA 4GH7B 2ADJA 1CR9L 4R97C 5ISZB 3T0XA 4HUMB 1NAMH 1VB9A 3MJ9A 1Z5LA 3IF1B 1I7UA 2RAMA 4XCFH 3L1OH 4W6YB 3VFRB 3CFDA 5MEOB 1LO4H 5HGAB 3ARGA 3QISA 2Y25A 4L3ED 1BVLB 3I6GA 1H15B 5CIPH 2VXUH 4O02L 4L4TE 4KK9C 3HUJB 4CVWA 4LSUL 3U7WH 4MLSA 5GGQL 2YKLH 2YD7A 2P5ED 4OCXH 1KULA 1BVZA 2V5YA 2FJGB 4N8VG 1VKXB 1YC8A 5EIVA 5F3BB 3VH8A 1EFXA 3BZEA 4RFNC 5EU6B 1URLA 1JNJA 3U36A 4UTAL 3I50H 5JO5B 5EZJB 5EOTA 2DQTH 3RX5A 1VSCA 3GK8L 4DZBA 5KSBB 1MVUA 4JE4B 1G9NL 4U7KA 4JREC 1RULL 1V6LA 5FHAH 1CVRA 3TO4C 4NM8H 4BQ9A 1DCLA 4L8BA 5JQ6L 1HQWA 1W8OA 1U3HC 1S7QB 2AJSH 3FB5B 2PO6B 3NABH 1BBJB 3SDDB 4XBEL 4I0PD 2RHPA 3AXLB 4PJ8A 1V5JA 1T1XA 3MV8A 4PRNA 5J13C 2NXZD 5EWIH 4M1CC 2H26A 2GJZA 4FQCH 4EBQH 2XKUA 4XZUA 1CT8A 2VR4A 1ORQB 3QDMA 1K4CA 5LCVH 4OZHE 3MJ8B 3BW9B 1J86A 3V4VL 1RZ8A 2V2TB 1Z9SA 5HDBE 3D6GA 4DOHE 3O8XC 5LJYH 3DUUA 1GC1C 1OW0A 4PY8J 5T5JA 2FATH 3BKMH 5L2KB 1UWXK 5D7LA 5D71L 3SISA 4QT5A 4NP4H 1G84A 3S88H 1QFUH 4MQXD 4AH2A 1DVFB 5FOJA 5SX4H 5JOYA 2R1XA 2DBJA 5E89A 5EFIA 3O3UN 3ULVF 2HTLD 2WBKA 1A6TB 3VFWB 5FDYA 1YEJL 4QOKE 3GHEL 1IM9D 3GMPA 2VKWA 4FG6D 4GBXB 4N68A 2DJSA 5I8KH 2H45A 3O3EA 3Q1SL 1X7QA 4P2OB 3UJOA 3P4MA 4X8JB 3S5LA 1SVZA 2AJYH 5GSVB 5FIEA 4MWFA 2WT2A 1JK8A 5HHXL 3KPLA 4N5UA 1UENA 5JIKA 5B3NA 1OARH 5F8QC 3M3CA 3FT3A 2YV8A 4KJYA 4F7TA 5T5NF 3QFJD 3GHBH 4N0UB 25C8L 5TH2A 2XZCL 2JCCB 3WS6A 1KB9K 1RVFL 4JG0L 1I3GL 3QIWD 1NGYB 1I85A 2EO1A 2PXYD 1K8IB 3LD8B 4UT6H 1OWRM 1S0JA 3ZHLA 3KPNA 4YC2C 4JZJB 1XF5B 3QCWA 4LLVB 1MCOL 5GXBB 3HE6D 4CVZA 5IW1B 1TZHA 3EO1A 1LE9A 2VZ3A 2JIXD 3GO1H 4PRHB 1LENA 2QR0B 2R2EA 5DJDB 1UEYA 1KJRA 1A6WH 4PJ9C 3RGVC 1DQML 4OCYL 1U8PA 3TV3L 1ZA6A 2R1YA 1I4FA 1WLCA 1BQUA 3UJIH 5KSVB 4D0BA 2IALA 3KPPA 1SYSB 1JHLH 4PS4L 3MZTA 4OZ4B 4FABH 5DJ0B 3U4EA 4R0LA 4HXAL 5GS0H 5GISH 1HIMH 5F5QA 5HYIA 1ZHKA 1B4JH 1S9VA 5GJSL 3EFFA 4GJTB 3T2NH 4XXDA 5T50A 3WG1A 1AR2A 2AEQL 2FX7H 5I19H 4H26B 3SKUD 4NQXB 3C5JB 4NCC1 1L7IL 2DYPD 3OGCA 1JV5A 3N1PC 1A8JH 2M26A 4F58L 3GSQA 1OAUL 2VQTA 3H9SE 2JJTC 4YZ1A 3IDYC 3WL9B 4RMVA 4XPAH 1G86A 1NH6A 2IBZY 2OR9L 2H3NA 3SDXF 4Y8AA 4YHML 4WU5B 2DM2A 3ULUL 3B9DA 2J88H 1P4BH 4NBZB 4URTB 4FQJH 2D6LX 5FYKE 2R8SL 2EYRB 4M62L 2XNAA 3NCBB 3O0VA 5DVNA 3OHXA 3UJJL 3T0WA 2XXCB 4EI5C 5C08E 4QYOA 4XP5L 5F7NC 1A6VL 12E8L 2Y6SD 3HZYA 5DMIH 1A7RL 2BOBA 3UJTL 5E9DD 2HFFB 2Q8BL 3EYSH 3BX7C 5DWUL 5E00B 3AZYA 2ARJQ 1PG7L 2YRLA 4HS6A 3EYFA 5FM4A 1A3QA 1DZBA 3WIIL 1NUFA 4P9MH 3KLSA 5DZFA 1IGCL 1YECH 4GT7A 4XH2A 4NZUH 4M1DH 5BXFB 1AI1L 2BRQA 3SQOH 3W9DB 3QQ4B 3RFZC 3PGCB 5C71A 4PGJA 4X7TB 3UTSD 2D03L 3AZXA 3HCVA 4YLQT 5E88A 1INEL 1VFMA 1CFVL 2YZ8A 1WD3A 5GS2D 4Q9RH 5EOQH 3MOAH 5JXEC 1H3UA 3VDBA 1YUHA 3O5SA 5K9JH 1FIGH 4RISL 3UYPA 1AXKA 4AEHH 2I27N 2PW1A 1JI2A 3V64A 1RMFH 2CRIA 2FO4B 2EICA 4KV5E 5DHVH 5KVDL 2DQIL 2VW1A 2VITB 3WJJA 2EIZB 3FB8B 3ULUD 1OP3K 3G5YA 4LKCA 2VL5A 3HI6L 4Y5YA 1D9KC 3B9KB 4OJFH 1KN2L 4G9FB 1ENSA 2ZHKA 1FFQA 1URXA 4W68A 3POSA 4OF5A 1X5LA 4FXKB 1A3RH 5ISZD 3U9UA 2F58H 1PLGL 2VSDA 4XVSL 1AGBB 1A4JB 3M2MA 4UT9L 1I9JH 1XIWB 3RVVC 3VXRE 3BPOC 4G5ZL 2NY7H 1EEZB 4PLJC 3ZYZA 1B0RB 2G2RA 4WVWA 2UYLA 2HFTA 3FO1B 4D2NA 3Q5TA 4KK5C 2XYCA 3PABA 3MGTA 1IVLA 1T4KA 2AW2A 4LPUA 1RJLA 2VDMH 1VIWB 3IKCA 3B2UD 5D5MA 4KJWC 5KS9B 5FV1L 3IJSA 4CVXA 5I16A 4X6CA 1PZ9A 3VFNB 2E5EA 4MDJB 4PGBB 4PJ5E 1QNZH 3TYFA 4XXCC 5CEYA 4JRAA 1KUMA 3WFEH 4LVEA 4LSPL 2UVEA 2XZQH 1RURL 4BUGA 3USUB 2GJ6B 4ZUVA 1BIHA 9CGTA 4HUNB 4HW6A 1U95A 4TNWF 3WFHB 4OI7A 3KHOA 4HGWB 3PP4H 5BRZB 5D7IE 3AAZA 1O7SA 5KVFL 1AY1L 1IC1A 2W9EL 4P5KB 1QGLA 2B4CL 1ZGLB 2K3TA 5IOPB 5A2FA 3UTTA 1SBSH 4G7VL 4RMQA 4YHLL 4IBLT 5DMGD 3D5OF 3W5NA 4MVBD 4JHWH 1EHAA 3H3BC 1AIFB 5EIQA 2WK2A 3MLWH 5JOPD 4XNMB 4U6VH 2Q8AH 4EN3C 2VE6A 2BSTA 1XH3A 4UV4H 4ZQKA 4WRLA 5EUOF 5GZND 5CLWA 1F58L 1U8MA 3E8UH 3FQUA 2IANA 4OKDA 3ZLQC 1U8OB 2LU3A 1KJ2B 3NH7L 5J9PB 4HPOL 2MJWA 5DRZB 3ARBA 3RZCC 4JFFB 1D5ZB 2F15A 2PHXA 4RAVB 4KHXH 4G7YH 2Z4QA 1CFTA 4F7MB 1EO7A 2VR9A 3HS0A 2AKRB 1XQNA 3F7VB 5HGGS 4XE9A 4QF1A 3E3QE 4UBDC 1NAKL 5TGBA 4PJEE 1HOCB 1A7OH 3G5XA 4GBXD 4NKQB 4I9WD 3OY8A 1U8JB 3RWHB 3BH8A 1PYWB 2MWCA 4JPKH 4YDJB 3M45A 4LGSB 4LU5H 1F3DJ 3WNLA 4Z0BL 1TQCC 4QRQA 2HJLB 3VXSA 3BQUC 3F5WB 3LSEA 5IMLB 5DRWA 3V0WL 3JWNC 1J11A 3OMZA 2ITDB 4HHAB 1Z0NA 2EXYC 5KBNC 1IBGH 1YN6B 3MA7A 5F3HA 4YBLC 2VDOL 5GGTH 4FPLA 4U1HA 5GLTA 4BH8A 4G6FB 1CN4A 2VTFA 4UNTA 3HAEB 3SJVD 2D4FA 4FVVA 4PTUB 4S1QH 3HC0A 4JKMA 3N35A 5FUZL 3ARFB 2BHYA 1RI8A 1QFHA 2EE6A 2KKQA 2AH2A 1IKPA 5HTSA 2OTWA 1MI5D 3KYMB 1JHKH 5DSCB 4OTXL 4FQHA 1UXWA 1U3HA 4Z78B 3KLDA 1IQWH 1CU4L 2F53A 4PRHD 5DUUA 4Y1ZA 2P7TA 4FS0A 3MXWL 2GK2A 3EJZD 3OWEA 4YGBA 4P48A 1T6WA 3B9EA 1YMHA 3R8QA 3ILRA 4MA7L 1QBMH 1FV1A 5HYSB 3QLQA 3WXVL 2NY2C 2R15A 4OB5L 1DBMH 1DZQA 1E4WL 3U4AA 3ZT6A 3D3VE 4XZPA 4MD4B 4F37K 3U1SH 1FLTX 2W0PA 5JOFA 1T22B 1P4IH 4NNYB 5E6IC 3PWUA 4JHAL 4FXGA 4IS6B 3CFBA 3ZDYE 4YPGA 4LLYA 3D85A 4RFOH 3MV8E 1W6OB 1KLFA 3AFKA 1MQKH 3H6JA 2I9LA 2P8LB 3PV6A 3VJ6B 1R3LB 4ODSH 4GKZA 2HJFB 1WZ1L 4Z77A 3QDME 4TOYL 5D7JA 3VFOA 1MCFA 3PJSB 4NKDA 5HI3C 2X4UA 1IC5L 3SEPA 1TLKA 3MRHB 1MHCB 4HC1A 3DSFH 3FAXA 2A6WA 1MCWM 5F9WB 1AGEA 3MLXH 2CKNA 3WN5C 2PHWA 1L0QA 4BM8A 4P2CG 1V6JA 1IAIL 3KJ4C 3LKOA 5J3HD 3UL2A 3OZ9L 4NRYA 4X9IA 3MNWB 4YDVA 5AZEH 5BV7B 4HX1A 4N9GB 5CZVL 3TN0C 5F1OB 4BZ1H 4NQED 2JTDA 4LCUB 2IWGA 4V2BA 5DK0B 4K3DL 5SWSB 3QAZB 1T04A 3MRBB 4OLZH 3TH3T 4QNPE 3CSPA 1TVBA 4LCCA 4PRIB 2A6JB 3MBXH 4HG4K 5EOCL 1FVEB 1J0HA 4L4VE 5JHLL 1LP9F 5F96L 1QR4A 4KRLB 1I1YA 3CC5B 4Q6IC 1XF3B 4HT1L 1NEZG 5JNYA 3K81A 4ODVH 5M95B 1KOAA 3OQ3B 4WHCA 5ENWB 2R69L 1UEMA 1Q1JL 1QNYA 1FJ1B 1NC4B 4JN1H 2ZWLT 3K2UL 4YEEA 4PJ9A 3FO9B 4GUPA 4XC1H 3RGVA 4OZFA 5JMCA 3QB7C 3VWKD 4K8RD 4M8QA 2XPGA 5F97E 1CDGA 4U05A 3GJFK 3O2WL 4Y19A 4CMMA 5MENE 5TE6L 2W1NA 4F15B 3VFVB 3NZ8A 1BWWA 4XMPH 4U7SA 1I8IA 2FD6H 4HJ0C 1U8LA 4Z7UB 1ETZA 3JV4A 3OB0K 4C1XA 3EO9H 3AXEA 1NLDL 5C0IA 4JM2D 4MJIE 3H0OA 1LO2L 4MQ7A 3VH8G 4LCIH 3ZE1F 1BHGA 4N0YL 3EOAB 1XIWD 1L7TL 2J4WH 4HJGA 5DD3H 4CN1A 2JJTA 4L29A 4LCWE 5DTFA 1S7RA 2XTJE 2X6MA 4FQLH 5B4MC 1GBGA 1UZZA 2EDBA 1YDPA 5GZGA 3UBXG 1AQKH 1JTTA 1AGFA 4PJXB 4EI5A 2RFXB 3O3AB 5FB8B 1F4WL 2FSEB 4Q8LA 1T0NA 3BZFA 3L6FA 1RPQA 3PHOA 1QSFD 2RGSA 3VXMA 3DO7A 3U6RB 2GJ6D 2YMZA 4GKXA 3FB6B 4XWGH 4HZAA 3WUZA 2V2WA 5BRZD 4P9WA 3CCHA 4X98B 4P4RA 3ZE2E 4APQC 2UZYB 2K7PA 3O2DA 4OLWL 1WBLA 4Y1AE 3U83A 1MF2L 5L0QC 1SJXA 1MIEL 1DE4B 5MHSD 1CDCA 1JTPA 1KBGH 3QEQB 2H9GA 4PV8B 3SKNA 4OCLC 1HSAB 3SKMA 2HLFC 5JHDA 1JNNL 5H2BB 2PW2A 5FYKU 2P42B 1KYOJ 3EYQC 5JIIA 1X6NA 1FVDB 3FLPA 3RUGF 3WJLC 4F7CB 5IWLC 3TVMD 2BDNL 1J5OL 3S5LG 3HKFA 4K94L 3BPLB 3FZUC 4MD0A 4TNVF 4GKNA 3RL1A 2RIKA 4JFFD 1MCEA 5KAQF 4C54A 4LSTH 4MZ3A 5EBLA 3DMMC 3C08L 5IK4A 2VRAA 4GRLB 4HIJA 4PJGF 4RBPH 3QUMH 4X7CC 3TT3H 1HHIA 1OD7A 5JOXA 1E4JA 1TVHB 4HKZA 4ZPVA 3BN9C 3RVWD 3QXVA 3UTQB 1CESA 3R4DA 4A2LA 3PMEA 2NMSA 1J0YA 4NQSA 1F6FB 1RZJL 4TVPH 2DL2A 1J8HA 1F00I 2FBJH 2WW8A 3QZWB 5JLZB 4CN6A 4GAJL 2EE9A 3MV11 4DS0A 2GCYA 1NDMA 3GMOA 3NCJL 4LBEB 1P9MC 3HR5A 1J1OL 4G6MH 4OFVA 5IIEB 4NUGL 43CAA 2BCKA 5F1IB 3IXAB 3TBTA 5IF0B 5I71C 4N9OB 3NTCH 3B3IA 2Y7QA 1CGWA 4G6FD 3EDFA 3MUY1 4K2UL 2APVA 5DFVC 4M3CB 5I74B 4XHXA 4AYUA 1U8IA 4QXGH 2RR3A 5AYUH 2R1WA 5TF1H 4YW5A 3IDUA 5DZOA 4U6HA 1YYML 1RUPL 2ENSA 4TUOB 4LKXB 1LHNA 1O4ZA 1AH1A 5IVXA 5D5ME 4KRMB 4UUJA 2CUHA 4G8IA 3WV0A 3QQ3A 4R2GD 2VXTL 1CI5A 4JY5H 5I1HH 2VY0A 2GFBB 5I30H 1FORL 3FO2A 5I1CL 1I1FB 4GXVH 4NZRL 5CBEB 5JDSB 5E2TL 1IAOB 1ULVA 1PBYA 3H42H 4R6UA 2X70A 4EN3A 2A0LC 4RMWA 3FO0H 2VDQL 1KB5L 3P30H 5B38A 2VUOA 3L5HA 3SDXA 1LWRA 2E8YA 2CLZA 1G7YA 1UFUA 2H32H 3UTTE 2Y4SA 3QWRD 4PJBB 3MV7A 1S7XA 2GAZA 3BJLA 3FUOA 1EPFA 1GPOH 4PJCF 3RZCA 4KAQL 2AV7A 4D9QD 1MVEA 2EXJA 3DX6B 1R3KA 1INQA 2A38A 5A1AA 4IRSB 4HUVA 2XI9A 2LTNA 4CU7A 4GAYB 1KNOB 4J7RA 4CMHC 1UH2A 1WCQA 2IANE 2QKIB 3UMTA 3ZSJA 4Q27A 1SEQH 1B88A 1CL7H 4MAYA 4CVUA 4U36A 3SGKC 1CDYA 4JY4A 3BHBA 1W0YT 4NKIH 4YK4C 4M4RA 4M00A 4UDTB 2HWZL 2X4SA 3BQUA 1UH3A 5GGVY 5I1LB 2YSSA 4YEFA 5F7EH 2P48B 2GTZA 4MJ2A 1N2RB 3U2SB 3WD5L 1GZWA 3LB6D 4BMBA 1RHHB 3F7PC 1JGVL 4MA3B 3S3JA 1P7KA 4J8RB 3RDTA 2FZ3A 4PRID 5GZCA 3MNVB 4RAUA 4Z7QF 4L3CB 1GGBH 1JRHH 3EZJB 5ID1A 1LOAA 4RX4D 3RKPA 3IAGC 1IZJA 2WANA 4DQOL 2IPUG 2ADGA 5IESL 4JFHE 4UOW0 5GGUA 1JP5A 3POYA 4C4KT 4YZFE 1HXYA 32C2A 3F12B 4MXQD 2WP3O 4CADA 2R39A 3FN0H 1QFWL 2WUBH 1A9EB 8FABB 4DCQA 4RGMC 1T20B 4P9HH 2GNBA 5GM0A 4N8VB 4ZSOB 3SO3B 2WLQA 1SLLA 1QU0A 1SLAA 2EXWD 3UPCA 1LOGA 2AGSA 2JJSC 5JIHA 1FAIH 4XXPA 4NO5B 2VLJB 3STLA 4NJAL 3T0EC 4GKSA 4DW2L 2Z9TA 3CFJA 3GIVB 4FTVA 4DQAA 3QUYA 1XGTB 3U4XA 4BFBD 1XZ0B 2XKNA 4WCYL 4BSJA 3HG1A 2MTPA 4MNQE 5F7DB 1KJLA 3D18A 5HHQA 1RZIB 1NANH 2F53E 2YMXH 4PJAF 5HGBB 2DTMH 3FFCA 1JNLH 1CG9A 3HPLA 1WC7B 1I7ZA 2NY6D 4JJ5A 2BNUB 5T5OA 3X11A 4PY8I 3ROOA 4M9OA 5K9QG 4M7LL 5CP7B 4L1DA 2MSPA 5C0CA 2YOCA 4XNXH 2IADA 4UB0L 2J5LC 1F97A 1KEMH 4ZAKC 1BJ1J 2ICWB 1KENH 4PYHA 1N7MH 2NLJA 5DJXA 3WN5A 4F57L 4OQTA 5F9OL 2OUHA 4JY6B 5JUEL 1NC2D 4E42A 2ZUTA 2Z42A 5IK7A 4H8WL 4OKVB 1K3ZA 3Q6GL 3AYDA 1MAMH 1JGDA 3VFGH 1IARB 5IFJA 4GRWH 4ZS6C 3B5TA 3TN0A 1MCWW 1BQHA 3MOBL 3THML 3QIUC 1XCTB 3MFFA 5T33L 3D0VB 5ACZB 2XY1A 2WSVA 4HWBL 4FQQA 2FGZA 4AYFA 5EUOA 3HPJB 1CONA 1KCSL 5JPMB 3MRLB 1A7PL 5I1DA 1HH6B 4Q6IA 3WFBH 4ODWA 1C5BH 4Y1YA 3C5ZB 2HRPL 1YY9D 2B5IC 2D7TL 3VGDA 4A6YA 1BQSA 1JBJA 4DN4H 5DURD 2J6EL 4LQ1A 3TEUA 3V6FA 1JF1A 4YQXH 1O0VA 1FFRA 1A6ZA 1LEKB 2BP3A 3PP3H 4PJFE 2H0BA 5BVPH 1TNMA 4QTIH 5JW4N 1KT2A 4IIQB 3O0XA 3GFUA 2HVJA 4EXPX 3LH2L 4GRLD 5ICYA 2BC4A 4GLRI 2WBJD 3KS0H 4QHLB 4Z8FH 5KXDA 1LO0L 2YPLD 2AXJA 3IJHA 1FNEA 3RQ0A 3MNZA 2EECA 3D9AL 4JFZH 1IAKA 1T7VA 3FOMA 1C12A 5C09E 5DT1H 3BGAA 1N5AB 2AK4A 5AVAA 2YEZA 4AM0B 3QUXC 4NGHL 2B0SH 2AJZB 2ZMKA 5JW3H 3MRIA 2DU1A 1FZOB 5ITFB 1HKDA 4OGYL 5SWQA 2MQ0A 4G3YL 1B0GB 5D1QD 2D0GA 2C1OB 1Q38A 3SH4A 1A9BB 1JWMB 1RUQL 3RJQB 2ZKHH 2PHFA 2RCSL 4F7PA 4AQ1B 3OJDA 4X9GA 2VISA 2CXKA 1KTLB 4QRPA 4TQEL 5DD6A 2VXSH 3A6CH 3MBEC 1UWEH 4L8SB 1NCBL 3LDBC 4OZHB 4EXKA 1OTTC 3I02B 1S7UA 5I0ZA 3RVTC 4PJDF 3P9LA 1LU2A 1VAMA 4WI7A 4DOHB 5L8LB 1U58B 3KPQB 2ESVE 1TQBC 4HQQH 5CSZB 2UZIL 3H9HB 3BISA 1T1ZA 1SBFA 2AJVL 1XGUA 3HNSH 4QHMA 4APQA 3MRMB 1JNHA 1SEBB 2YHGA 3B9CA 2VXQH 4R3SB 2WWKO 1VERA 4ZUUA 3O6FC 4XJWA 3HMXA 1TPXB 4N0CD 5JOZA 1BX2A 2VC2L 4NO3B 5EU5B 1YMMA 2W0LA 1DSFH 2ENYA 3VXME 5DRNA 5GGSA 4JFPA 4O4YL 4QOKB 1Y0LA 3NGBC 4IHOA 3VA2C 1C16B 1IGML 1WW7A 2X1XR 2IAMC 4OAWB 1QRNE 5F1NB 1A6PA 2ZGPA 1W0WB 5IWLA 1MCKA 1VFBA 1TZIB 5EN2A 5K9OA 3B9AA 1LO5B 1EO8H 3P0VL 3O4OC 2AV1B 2NZ9D 1OL0A 5GIRA 2QEJA 3SKJL 2MNUA 3DMMA 3P77B 2Q6WB 3ULVE 4YHYC 5FGBC 3TT1H 1GZPB 5IJVB 5J6GB 5C0AD 2QADB 4OZXA 1FZKB 5HPMB 1FG2A 5E4IA 1AXTH 4U2ZA 2HT3C 5MP6L 2GNTA 3QHFL 1NGPL 3SOBL 2E7BA 1LP9A 3MV01 1X50A 2AK1L 3ROLA 5BZWA 1C4RA 4OZGE 1OTSC 2APTA 1MJ8L 1KXTB 3I2CL 2WAHA 1BQPA 4AVVA 1IC7H 2ERJC 2VQ1B 1S7VB 4QXWA 4FP2A 1P9MA 4QGYA 1KRIA 5I6XB 1YYLL 3I9GH 2BNQD 5L88L 4MAUL 4V2CB 5C0FA 4DKFH 2WINB 3ESUF 4LBKA 1CD9B 3KAAA 3Q6FA 4OZFG 2KZWA 3EOTL 3PNWB 1FCGA 4K7PY 3U7YH 5C0BE 3V6BR 3G5VA 3AS3A 1DBBH 1J9CT 2EDXA 3KPRA 4OFYA 3VWJD 5A40E 1YNLH 3LKRA 5CFHA 3NV3A 3BE1L 2FHFA 1MCNA 3BRDA 2VXRA 1N4XL 3H3PL 2CYFA 2DKSA 1AO7A 4XAKD 3NZHL 4TYUA 2UY6A 4JFQA 4HUXA 4UILH 4X8XA 1KJ3H 4ZUTB 2FHRA 1V7ML 2AXGB 3BP5A 3MRGB 2BMKB 2JD4A 4HBCL 3H9SB 2VLJD 3IFNL 3C6SA 4XMLH 1S1AA 4KMTH 4MMZC 4LMQE 1HH9A 4OD1L 1NBVL 3O2VL 4X6BB 3C2AH 1HQRA 2Z31C 5GS1C 3ZZ1A 3F65A 5DR5H 1YEHH 5FA3B 5KANG 3EW3B 2W65B 3MYJA 1KC5H 4GG8A 2VUYA 4LQFL 3RAJH 3L3KB 3O3BB 2G60H 5FCUH 5C08B 3W9EB 1X5KA 4GAGH 5B22A 5BS0B 3P73A 2DD8L 1HHHB 1FRGL 1Z0HA 2CD0A 5E2WL 4ZUSB 3MRRA 4H1LA 2B1HL 4Y5VA 2I60L 1S8DB 1I7TA 3QJHA 3P4OB 1LCLA 4KK8C 4W70A 1ZHBB 4HKXB 4UI2A 3SDXE 5E8PB 2VWEC 1CBVH 2NYYD 1N64H 4HJJH 2LV4A 3IFPB 2V7NB 3SGKA 3RNQB 5B39A 5DJ8B 2DMCA 2OM5A 4HIHB 2Z8RA 3QIBB 4ONOA 5C6TL 2FGWH 2XZAH 3LQMA 3VU2A 5KXEA 1N1TA 5I17B 5SX4I 2A70A 2ILLA 2QHRL 1IFHL 4HIEB 4RISH 3LV3A 5L8KB 4R4BB 4DKEL 1LEMA 1I7RB 2E9WA 4DK3A 1Q94A 1QLRA 4LLQA 4LVOC 5ACMA 3VG9B 3VFTB 5C0GA 3S4SG 1UWGL 4P4KD 2VOTA 1MFCH 3BP4B 4ONFH 3QDJB 4X9HA 2FX8H 2OQJA 5F7KC 3RWEB 5E24E 4L1HA 3ARZA 2J1KA 1RJZA 1A1NA 1E4XH 1KF9B 4ODHH 4R9CA 2RBLA 4GQ9H 5J1AA 4YHNB 4PJGA 2AQ1A 1BOYA 2B4CC 1HYRC 1WBXA 1K6QH 4XT1C 4XVSH 3GJEA 3Q3GA 4OF0A 2P5EA 4UT9H 1CGTA 4G5ZH 4JM2F 5FKPB 1AD0A 2JJSA 1MRCH 2MFNA 4XJ8A 3AZVA 5JW4R 4YR6A 3BWAA 4PJ7F 3VXRB 4JZOA 5DVMA 3WE6B 1SJEA 5BOPA 3VE0A 3T0EA 1UWXH 4FFVC 1QSVA 4WJ5A 4N1EA 1JYXA 5AWNH 3CX5J 3MLYL 2WQRA 2COQA 3PGFH 1SVCP 5GS0C 1NCTA 1MFAH 3IM0A 2YD3A 1HE7A 4FFZL 4JKKA 5MI0B 4FPJA 4PQ9A 1ACYH 3MV9D 4ONGH 4U49A 3MX0A 4I0PA 5CSBA 4HAFA 3R05A 2WMPA 3SGJC 3AU1A 1FX5A 3D25B 3WYRA 1HKLL 4PBPA 4PG9A 4FTVE 2IMNA 3QO0B 5D1XD 2GTWA 5FYJH 1BZ9A 5DK3A 3EYUH 3F62A 5D7IB 3CGTA 3QULA 3O45B 3HG1E 1W72B 5FA4A 4ZAKA 2Q5TA 4U1IA 4G7VH 5ALBL 4Y1VA 4P46C 5F44A 3VXUA 2X4OB 1EEYA 2PCPB 2BVYA 4Q74A 1CGVA 2ZCKL 1IGYA 1YNTB 2PTUA 4JFED 5DD5H 1GZQA 4WEBH 2PYEA 5HI5C 5EA0H 3QIUA 4M1GL 4G8GD 2ZACA 5HHOD 4OIIH 3TJEL 3EYVB 4F80A 1P69B 3WO4C 3VW3H 4U1LA 3KYKL 5B38G 4CN4A 1CWVA 5LXGH 1NLBL 3OPZH 3LN4A 1LOFC 4D0CB 1OAQH 2GY7B 5IB1A 1GGYA 4JO4L 2HH0L 4R8WH 4RGNC 4CW1B 2GDFA 2DV9A 4HF5H 1ULFA 4Z0XA 2XTLA 1YJDH 4KKBD 2JJ6A 1RJYB 4PJEB 5ERWA 3V0AC 4DN3H 2CJUH 2YZ1A 1TJIL 1HI6B 3NVQA 3T77B 5BMFL 2WP3T 5EUOE 2I07A 5GZOC 3FL7A 1A6UL 4NT6B 3VCLB 2NX5A 4UU9B 5HD8D 1B2WL 2TEPA 1F2XK 2BVTA 3UTZA 4Q0XH 2X4TA 3LZFH 1N0XL 3QFDB 1CYGA 5E2UL 1TJGL 1ZLVK 2PXYA 1RZ7L 3KPSD 4NWTL 5CNAA 1P4LA 3IJYA 4FQIH 4X0KA 3D39D 3IB4A 3HE6A 2Y5TB 2E6QA 1BEYH 1IS3A 1IKNC 2ADJB 1XAUA 4HUKB 5FXCH 2QADD 5D2NC 1Z5LB 5IQ9B 3CFDB 4EQ3A 4NO4A 4QXTA 1J10A 3ARGB 3I6GB 1QFPA 1D6EA 4OTXH 1VDGA 3NN8A 4JDZA 5DJAA 4PREA 4M93B 1IEBA 3VI3F 4I48A 3W2DL 1SJHA 3QG6B 5EU7E 3TJHC 2P5WE 3DHJA 1JVKA 3BIKA 3ZE0F 3JVGC 1MWAA 3MJGX 1ADQH 5J11C 3VH8B 4OLUL 3U36B 1MLBA 5EOTB 3MBEA 2AK4E 4DZBB 2CRYA 1MVUB 1RU9L 5GJ6A 5ILTH 1G9CA 2PTTA 1NMAL 1FNGA 1FN4A 1RIHL 1NGQH 2ZNXA 3AY4C 3FQRB 3SE3A 1M71A 5E4EB 2Z93A 5T1KA 3I6KA 4OCRH 2JB6B 3P2TA 4WDIA 4PJAA 3Q0HA 5IK3A 4K8RH 4BLIA 1WVZA 4OCSH 1DGLA 4PJ8B 4PRNB 3MV8B 1LULA 4F37F 2FB4H 1WZ1H 5T5FH 3V4UH 3C60C 2GJZB 3O6FA 3DUIA 4XZUB 1CT8B 5LBSH 1N1YA 3U0TA 3QDMB 1K4CB 1NUGA 1WWAX 4TSCL 1JGUL 2CDEA 1RZ8B 3N1QC 2W0FB 4Y4HD 4QHKJ 2XV6B 5DJ2A 3DUUB 4AIXA 4GS7B 2IAMA 3C09B 3S36X 1MS3A 3P4LA 4IMKC 4KK6D 2C9AA 2OZ4L 5CZVH 4QT5B 3U30B 4PPTA 4BSWA 4AH2B 1UKQA 5C08D 4LVHC 2R1XB 5BS0D 3ALXA 1C1EH 3TCLA 1FZJA 5EFIB 1G6RA 1NQBA 1YMME 3TIEA 3MCKA 3ULSA 2XWBA 2QSCH 5HHME 1XGYH 4O2FA 2EF6A 5FK9B 4XP4L 1JYIA 2HT2C 4Q6YA 1IGJB 3O3EB 4MA1C 1X7QB 3P4MB 4L4VB 3H7BA 1FLRH 1OP9A 3U82B 1M4KA 4LCYA 1NAMA 3DVGA 4MWFB 4CUCA 1JK8B 5F7WC 3AP5A 4AIOA 2J8UF 2EEAA 5FGCE 3QCVL 3DUSA 5AUMA 1A1OA 2XG4A 4KFZC 4ESKA 2P3JA 1YNKL 3KPLB 4LASL 3FTGA 4B53A 3QIBD 3BGMA 1RIRA 1HINH 3UPAA 4LMQI 4PRDB 2XICA 4KJYB 1HEZA 1CXEA 1N1SA 1XR9A 5TH2B 5C2BL 2NR6C 3IPVA 4RA0C 1N5YH 1W72L 3HE7C 4YO0B 4DGIL 2DQCH 1LP9E 4KGJA 2Y07L 5CEXA 5MENB 2R2HA 2EC9U 4J3SA 4LP5A 3MUZ1 5DK2A 3KPNB 1OPGH 3NCYS 5T3ZE 1BIIB 2MCPH 2ZA9A 4I3SH 3QDJD 3BO8A 2OR8A 3OKLA 4CVZB 3GIZL 1T2QH 2PR4L 4MQTB 1TZHB 3EO1B 2X9YA 1BZQK 4XNUL 1LE9B 3A0NA 2R2EB 3LHPH 5IB5A 3WG3A 1U8PB 4MJIB 3IDNA 4N0YH 3NCCB 2X89D 3L95A 1IZKA 1KJ2H 4DGYH 1ZA6B 2R1YB 1I4FB 4AIZA 4D0BB 2IALB 3KPPB 4OUUA 4Q9BA 3OKNA 2XWJA 1FGNL 2BY3A 1YY8B 3U4EB 4P2QE 2V5SA 2XTJB 4R0LB 4Z7NF 4KKLC 5GS1A 2DIJA 1AO7E 1ZHKB 1S9VB 3GBMH 4PR5B 1CICB 5LGHL 3MREA 5FDWB 1BOGA 4XXDB 2ATKB 5F6IB 3MLRL 4PP2A 5CJXC 2WNGA 4YM1A 2P45B 3QPXL 1RITA