2C9AA

Crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
259
structure length
259
Chain Sequence
ETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE MU
publication title Molecular Analysis of Receptor Protein Tyrosine Phosphatase Mu-Mediated Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 259
sequence length 259
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c9aA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c9aA01
4KVCL 1FGNL 3RBSA 1XEDA 3RMXA 3F7PC 2PXYC 4S1DD 2CRYA 4OLWH 2NY3D 2DQGH 5EWIL 1S5IL 4KI5E 5D7JD 2VDML 5DJAB 2PR4L 2RHPA 1NJ9A 4ZOAA 4L29B 4OM0H 5EC2B 1IEHA 5HJ3A 1BGXL 1WBXB 3KG5A 2R2BB 4WJ5B 4M7LT 1U8HB 3TBVB 3PL6C 3MFFA 4O02L 3RNKB 1M71A 4JFPA 5C7XH 1I1AB 1P2CB 3JVGC 5INCA 3MUZ1 5DD0L 2VDRL 5LK5A 1H5BB 1Z5LB 5T5FH 2HT4D 1MAJA 4G6KL 4MQ7A 1UM6H 3PWLA 5ISZB 5GALA 4X5WB 1KOAA 2IH1B 1MCBA 1RHHB 1F3JB 1FE8L 2ARJQ 3MV7E 3TZVD 4PJ9A 1JN6A 1CXLA 4LSTL 2AENA 3WO4C 1NAMA 4XPFL 4POZC 5I0DA 1QVOA 1B6DA 2ZWLT 3SQOH 3QIUA 2CRZA 2AJXH 2FX9L 2O5YL 3M17A 5IB1B 1VGKB 3CJJA 4NCC1 4S1SL 4W81A 5IVOA 4HPOH 4ERSL 1WWAX 1YJDL 3NH7H 2EDJA 5HHOB 2MTPA 3P0VL 3WDHA 1SLAA 3OXSA 5ESVA 4MJIB 4PREA 2BC4B 4YNYB 5F9JA 2ADGA 4P46A 5C0CA 1DGLA 4EOWH 1D2SA 3OMZA 1KN2L 5KVDL 1B0GB 1J8KA 5KSVA 4R9CA 1A1NA 3ZSMA 5EO1A 1YNLH 4GWNA 4KMTL 2VXTL 2E7LC 3BZEB 3QIBA 4GRWF 4NKDA 2HRPL 5TQ0L 4HUKB 2DLTA 5E9DE 4Q9RH 4RGND 4ISQA 3VI3E 1MSPA 3JZ7A 3BP7B 3QNYB 3MBEB 4CW1B 3H9YA 3HG1B 2FHRA 4FXGA 1G6RH 2I60H 2OJZH 2ED9A 4KAQL 4QF1B 4UIKH 4FTVB 4LSVL 1ULEA 4X7CC 3QCUH 2YD9A 4UUJA 1S7UB 5IROA 1NC4A 2PF6A 4QRRD 3L7EA 5F8RC 2XRAH 1A6VH 4JPIA 2DAVA 4XMPL 3LSEA 4Y4HB 1CLZL 4Z78B 1MFEH 4I48B 3UPCA 5BRZB 3BYYA 2AVGA 3SDYH 5T50A 1G7HB 1QPXA 4PRPE 3KPRE 4U1JB 1CR9L 1Z0NA 3THMH 1T03L 1EJOH 1YUHB 4YHKH 3TO2A 3ET9F 5B3NA 5DHYB 1GH7A 3IYLW 3IFNH 5FM8A 1UA6L 5I1EH 4P99A 4LEOA 4J6RL 1Z0HA 4LLQA 3QQNA 2KUTA 3H3PH 3CVIL 4LBQB 3LMJH 4AEIL 2DQTH 1GGCH 4X7TA 4AENB 2A7AA 2E5EA 4F57L 2IAMB 2P5EA 3TN0D 4L9DA 1Q56A 3S34H 3AS0A 3ZXKA 3UJQA 1PDKA 5H2BB 5CINL 3ROLA 3REVB 1D9KB 3U4EB 3MXVL 5CBEA 3RS6A 5E8AA 2VQUA 3EYVB 4DEPC 2PYFB 4DUXA 4YG0A 3BQUC 2ICWB 3DX9B 2DUQA 3DXAD 4QHMB 1TNNA 1JK8A 2UVFA 1SY6H 4YPJA 1E4WH 2DQGL 1CGUA 3LN9A 3GRWH 2ZUYA 4WCYH 4YZFE 4NO2B 4N0UB 5H9PA 3RIAK 4UT6L 3RX5A 2Q76A 3LKSB 4OM0L 1ZXQA 3QUMB 4PJBE 2DLIA 2FATH 3MLWL 1T66C 4PJFA 3G5YA 4QWWD 1NSNH 1AGFA 1IGFH 3CSYB 3QHZH 4Z7UF 1XIWB 3GMQA 3W11D 3IM0A 2AJZB 1XGQA 1ES0B 2XN9E 1ADQA 4UDUA 3SGJC 5C7XL 1WW4A 4DCQA 1BQHG 2NY4B 4OUUA 1JHNA 2D44A 5FYLL 2ICWJ 3JWDC 1DBAH 3INUL 4QNPE 1CICA 1J1XH 3OKKA 4L3CB 1DQ2A 1KN4H 1VENA 2QBWA 3TT3H 1SMAA 4LMQI 3T2PA 4NDMB 4D0DA 2I2SA 2X4RB 1INDH 4MZ2A 4ODXA 2Y06H 4HQQH 4KK9D 4WY7L 5CILH 1MCWM 4LP5A 2NZ9C 1W0VA 4NQDD 2OTUB 2AJXL 3CXDL 4PP1D 4KRLB 4Q2ZA 1X7QA 4WEMB 1RIVH 1I3UA 4A6YB 7CGTA 4NGHH 3IDJB 3CNAA 5EUOA 1UZ8A 3WXWH 3IETA 2JJUA 4E41D 3ARGC 3I3DA 4YGCA 3E0GA 3OAUL 1SYVB 4J3WA 3QXDB 4RGMC 2DM3A 1IC1A 3CC5B 4LHQB 4QY8B 5IUQA 2BXYA 3TNNB 5C07E 1U36A 5DUWA 1G9DA 3X14B 4R9AA 3TAYA 4FZEL 3QUZC 3RIAF 1TQBC 4HWBA 3VWJC 3F12A 4LPVA 5C3LD 2KM2A 5C9JB 1U8MB 5EBMA 3K81A 4FABH 1NAKH 3PIQB 4LNRA 4U1SA 1RJCA 2AKRB 1MZ5A 4W70A 5CJOL 1A14L 3QFDB 4DW2H 2VLKB 25C8H 3OKNB 1N3PA 5DC9B 1S9KC 1TJGH 5E95B 4NRYA 4K3HA 3WJJA 4IRJA 1ZLSH 1F13A 1CJPA 3GSRA 3QCUL 4P46D 1CT8B 2NZIA 4G7YL 4QRTB 3VDCA 5C0CD 1B2WH 4ZSOA 3HB3C 4U1HA 2R49A 1NGWA 1YECL 1A6VL 1QKZH 4MWFA 4K3DH 5KN5B 3KGRA 4XP9L 3IXAB 2A3WA 3QIBD 1A6WH 1HHGA 4PJGA 5JXAH 3QXTA 2D3PA 1MFEL 4PB9L 4K71B 1T04A 1IM9D 5INDA 1S0BA 3SDYL 4G6FB 1ZT7B 3RL2A 2R39A 2DU1A 1EJOL 1XZ0A 3AREA 1PBYA 3E8UH 5E08L 3OXRB 3MGOB 4TOYL 4AEEA 2KQMA 4LASH 4WW1B 1NC4D 1C4RA 4FQHA 1JOJA 3H3PL 4FFWC 4QO1A 1CG9B 3PHQA 3LMJL 4GXUN 1IT9L 4PRHD 3QEHB 4KK5D 4PJEF 4JN2A 3SDXF 2P8LB 4MXQC 4PLNC 1W72H 5EO0A 5IK4A 1VFAB 5FECB 1B09A 1EGJH 3S34L 1DN0B 4OCSH 4UW6A 3W39A 2EDNA 4QYOA 4FQPA 5IESL 5F9DC 4BMEA 3RY6A 5I1GL 1UWXH 2VH9A 4UILH 3S5LB 3BWAA 2X9XA 4OCYL 1KULA 4U1IA 5KOVC 1JWSA 4JGMA 4B53A 3P0GB 4NQEA 3QPXL 4KUZL 1AIFA 4EI5A 4RGNE 1E4WL 5DYOB 1KJ2L 1QLRA 3ARFC 3WDWA 3C60D 3UYRH 2FNBA 2P43B 2EC9T 4KY1L 5FV1L 4K8RC 2FATL 3DMMA 1KSRA 1C5BL 1ACYH 1T1ZB 3O4LB 4R6UA 3QHZL 2W65A 4X4ME 3RX8A 1YMMB 4QRRE 1D5ZA 4P2QA 3RZCA 3C09B 1XCTB 4JFDA 1ZLVH 1RJZA 1MRFL 4NQSA 4YHMH 3VKOA 3GBML 4Z0BH 1P6FA 3WKMH 1J1XL 2A74B 4HC1A 1S9YA 3HAEH 5SWSE 1A8JH 1BOYA 1MFBL 1CIUA 4WNQA 1RZJH 1IGMH 4YBHA 3DNKA 4HEPG 4RQQA 4HG4J 4ZS7L 3PF2A 3OJDA 3WFHA 5C09D 3T3PF 3HE7A 1QBMH 1OGAA 4MA3B 3BGFC 1L4IA 1T0MB 4POZD 4HUNB 4MCYA 3M3OA 4MJ4A 4JZJC 1JIBA 2XA8H 4OB5L 5TE7L 3SGEH 3VXUB 4OV6F 5AYUH 2RFXB 4OJFH 1LGVA 4X80H 5JDSA 1Z3GH 1ZSDB 5TE6H 3P0YH 1CICD 1W6OA 3WXWL 1XGPB 2HT3C 2DDQH 4XVSH 5JW3H 3VXNB 2AV7A 4YHLL 3K2MC 5CD3B 4RDQF 4U2YA 3H6JA 3MJ9H 4XRCA 2K1MA 4F37F 1A0QL 3H8NA 4PYGA 5E5MA 3O45A 2WWKT 3EO0A 4LLUB 3KPPB 4I3GA 4DW2L 1IAIH 4ASMB 5KAQG 1TJGL 1ZVYA 1I7ZB 2V2XB 5E8PA 5DMKB 3ROOB 3ARYA 3PABA 4DAGH 4MHHI 3LS5H 1HSBA 2MQ0A 4LCUA 3MLRL 1NANH 5HYJA 3SHSA 5T3ZH 5CEZD 3MNWA 3ELAT 2CD0A 3MTRA 1FG9C 3STLA 4KWUA 3ZKQD 2SBAA 2H8PA 3HZKB 3CXHJ 5GJ6A 3NZHL 3D87B 2FSEA 2CIIA 3KVQA 5GS1C 3RKDD 5C6TL 5CB7A 3NCYS 2MOVA 5GRUL 1HHKB 5HI4C 2G75B 1AXYA 4G6MH 3X3FL 5E03A 3SBWC 3VKLA 1UZYA 3IDIA 3RVUC 3RUGB 1TEIA 3GNML 1IEBA 4LASL 4HFWA 5CEXB 5E2UH 3AAZA 4C1WA 4JFZH 4EN3A 3SITA 3MRHB 5IEHA 4K7FA 1EGJL 2Z8RA 3KYMB 5GJTL 1NGYA 2I5YH 1ETZB 5IF0A 3NIFF 1FV1B 5F7DB 5LGHH 1KCUH 4M4PA 2FZ3A 4TNVF 1A8DA 3MLVH 1ONQB 2F9BT 4XBEH 4XPHH 4NO3A 1QR4A 1U0QA 2YSSA 3MCKA 5HDQL 1DUYB 3N1PC 3T0XA 2X4OA 1NL0L 1IZJA 4OQTL 2NX5A 5JW5B 1S78C 4OZHA 4EIZC 2MSPA 4PR5A 3HI1A 4PV8A 2AW2A 1KEGL 1I1AC 3ZPYA 2X4PA 4V2BA 5C0CE 1NGQH 3Q5TA 2EH7L 3DROB 3AXLA 1MEXH 4PTTA 1UB5B 1P4IL 4TVPD 4QXGL 2EO1A 2NCMA 4G42B 3U6RB 4L9LA 4ZQKA 4QEGA 4NQED 4XP5H 2GUOB 4YHML 5D7SH 5ADOH 4OGYH 1C1LA 5J1TC 1BJ1H 4EI5D 5DDHB 3BD4A 2H3NA 3QDMA 2FWOA 2NY5C 32C2B 3ZKSD 4NKIH 1EEYB 4GUPB 1LK3H 3U0TA 1G8WA 2ZGMA 1IOAA 3DMMD 3T1WA 2VOTA 3IF1B 3BIAX 4NOBA 5C0JA 2A2QT 1X5XA 4OFYA 1IQWL 4K3JH 5T1DL 4P2QD 3WS6A 5HPMA 3RZCD 3V5KA 3GMOB 1R24B 1NGXB 4ZFOL 4J7RA 3POSA 1Z3GL 2P44B 3WO3B 2EE2A 2YPLB 3KJ4B 5I17A 1KNOA 3KPOB 4HAGA 4XVSL 3LQZB 1YC8A 1B4RA 3QCVH 5M7QA 3WNOA 3ARGD 1V7MH 3EOYG 2DIBA 2XXCB 3HE7D 2C3VB 3TCLA 5GGSA 3HPLB 2EZ0C 3ARRA 5LGJA 3MBEC 4NQCA 4WO4B 4WIQA 4Z18A 2DD8L 4MNGB 2NY1C 3ARBB 3P73B 3MMEB 4IEFB 1IAIL 1NCNA 1YY9C 3GALA 4Y0GA 2P5EE 3BKJH 2NMNA 3RDTA 3ATGA 1RJLB 5F9TA 1G0XA 3DV4B 5MEPA 4Y4HC 2P8PA 1GCFA 4ZTPH 3LQMA 3WMSA 3ZKXB 1FIGL 5SWZD 1EO5A 5A2LH 2FJFA 3CMOH 1H8NA 4LLDA 3U7AA 1TENA 2W0KA 3BH8B 4EBQL 4QLRA 3MNZB 5EU6D 5EU4A 3MOQA 3MLSH 1C1EH 4JDTH 4ZDHA 2DMCA 3TO4B 2WLQA 1X5IA 3ZE0E 4PJFE 1UWEH 4NN5C 4PD4J 4PJ7F 4M1GH 1NDGA 4GG6B 2IAMC 4MD5A 4YE4H 5A2KH 3USUB 1SBSL 2GJZB 2PYEA 4KHTH 2ZG2A 4NKOB 3VXMB 2PO6B 3WIIL 1RVFH 4LSDA 5D7KD 3MR9A 4P5KB 4NJ9H 1T6VN 2BVEA 2I5YL 1YEKH 5EZIH 3QZWG 3PWNA 4YG3A 2AXGB 4YDIH 3BN9D 3UTPD 5LGHL 2E8YA 3EGSA 3RZWA 4G6AD 4KMQA 3MLVL 3NACH 1CFQB 4XPHL 4RNRB 3MV9B 1MRDL 4WEBH 3UTTD 1TFHA 1XGRB 3IDGB 5DRXA 5GGVH 3CZFB 5LBSH 1X6LA 5TGBB 3MLTB 2IJ0C 5CKGA 5F7UA 1XIWC 1TQCB 3RU8H 3ULSB 3AJZA 3NFSH 5EUOE 2IG2L 1I85A 2OL3H 5C08D 2Z8SA 3ECBA 3MGTA 5FYKH 2NY4C 4XIKA 4U0RC 3QEUA 2ZUQB 4JCMA 3FFCD 5K9QI 4LFHG 2P8MA 5DD3H 1FNEB 4KZDH 4HKXA 2QKIA 4YR6A 2VR4A 1JHTB 1N3OA 4XDQA 2EXWD 5T54A 5C0BB 2CXKA 1QBAA 5D71H 3CVHH 4ZNCD 4Q8KA 3B2UD 4RAUB 4K20A 3QZWA 2YKLL 4AGRA 5CSZB 4QHNB 2BQPA 4RRPG 2MQ3A 5ILTH 3K8MA 1V7NL 4XXPA 1HILB 4Q0XH 3EYOB 1IKFL 2MHAB 3P4MB 3PJSA 2R8SH 3AB0C 5T1LD 1ZVHA 4ZSOE 4L5FL 5M95B 4ODVL 4K3JL 4ZXBA 1PGRB 1KCKA 4ZD3L 3RJDA 3LEXB 43CAA 2WT0A 4DQOH 1S5HB 3OB8A 4WFGD 2VLRB 3ZL4H 5D2NC 4JFOA 4RBPK 5EUKB 4FPKA 4U6HA 4PJGE 4KQ3L 1FJ1A 2AP2A 1J88A 1GSMA 1UXSB 3P9MB 4GLRH 4XILA 3QDMD 3MW3A 3X13A 3QCVL 2AJVH 4OM1L 1MF2L 5J1AA 1NCAH 3HN3A 2F19L 4HBQA 4P2OB 4S1QL 1HYSC 5DZNA 4QRUA 1PX4A 2W0FA 3U30B 4MDJB 4UDTB 1Z9SA 2P1YA 3LDBB 3ULVE 1O7VA 3VXTA 2AGJH 5C0IA 2CRIA 3GBNH 1KFAL 2WMPA 4HXAH 4L3EA 4RRPA 5D70H 2YC1A 1BZWA 1HYRC 3BKJL 3D18B 1UM4L 3B2VH 2GNMA 1MCCA 1T80A 3HCVA 4OF8A 5C0NC 1OCWH 2BY1A 1BZ7A 3O2VL 5FUOL 4TVPE 3MOAH 1MQ8A 2DUOA 1B6UA 5CWSA 5D1QA 1PZUB 4NQEE 4K71C 3C5ZA 1WCQA 2ZHNA 4OIIH 2AV1B 3NTCL 4U2ZA 2A0LC 4Q6IA 2N56A 1ZTXL 3DX7B 4NQCD 4HULB 2EIDA 5FCUH 1KCSH 4EDXB 1ZHBB 5LKNA 1VEOA 4M7LL 1A6PA 4KRMB 5FKPA 2B8OT 1MH5B 2OQJA 4C59B 1GYKA 4MDIB 2XKSA 1QDOA 3MLSL 1JNHA 1BAFH 4UV4H 3PUCA 3X11B 3QHTC 4XBQA 2NW3A 5CGYD 5HD8C 1IAMA 4FQLH 3LD8B 4P2QE 4F9LA 2OJEA 3G04A 4YE4L 3U0WL 4P2RB 4JY4B 5I8CB 2ITCA 3D5OF 4GAGH 1FH5L 3FOLA 3WD5L 4JFDE 3GJFB 1MWAL 2WUCH 2ZOKA 4OF7A 5I1KL 5I73C 4CL7A 1UM5H 4MA1B 5FOBB 1QQDA 4NJ9L 2VLJA 1FL3B 4BFEA 2X09A 4RZCB 1ZA3A 3OPZL 4GFTB 4XCCH 4K3EH 3V8OA 1TETL 1EZVX 1OTUD 3NACL 3PP3K 4YZ2A 4F7PB 5CLWA 1OGAE 3L3DB 1EHLH 3K4ZA 4NRZB 5C6WH 5GRWA 2GAZA 4BKLA 4PV9A 5GIRB 3N7KA 1U8KA 1JZ3A 3SNMA 3CCHB 1YEGL 1HHIA 2PYED 4Z8BA 1A7NH 1TJIL 1LHVA 2R4SH 2XG3A 2YY1A 2IANB 2QQLH 1T3FB 3RU8L 1J12A 4GA9A 1X50A 2OL3L 3C09C 4RCAA 2OZ4A 1K5NA 2VY0A 2YD6A 2P47B 1HH6B 1XF4B 1S7WB 4X4ZA 5TF1H 3IFPA 4K94H 5GGRY 2JCCA 1X5FA 1P7QA 4MD0B 3AYDA 1I8KA 3V6FB 3DARA 1WITA 4AG4L 3MRRB 2APBA 1MHEB 4UINH 1J5OL 3CVHL 3SGEI 1KPVA 4CVZB 1C7SA 3EYQD 4BELD 4U1KA 2D31B 1FPTH 2M1KA 1Y6NR 4P0DA 2DMBA 4MAYD 4M48L 1WD3A 3PNWA 1C5CH 5CUSH 1RK0A 5ICZB 1WBLA 1VA9A 3JBG7 1KJ3H 1NUFA 4LOUD 2YBRB 1JWUB 1RUAH 4R8WH 5HYJE 2H9GB 4UQ2B 4X4YA 5IK7A 4M43H 1WC7B 2CDFA 3FQXA 5IQ9A 1A1OB 4M7ZB 1TZGL 3MRCA 1TDQA 3STZA 5DF0A 5D7KE 1A6UH 3C2AH 3QI9B 2W0PA 1IAII 5CZXC 2EECA 3T04D 4K7PH 5EU3A 3HKFA 4W68A 5CHNA 1YIFA 1I1CA 3U0PA 2AJVL 5D5MA 4LVNB 4X6FB 4X4XB 4HG4K 1S8DB 4LRNH 2EH8H 3W9EA 1PZ5A 5F1IB 1XF2B 5B8CA 1R3HB 1ENSA 5CP7B 3MXWL 1KLFA 1RU9L 2HRLA 4WTZG 5IB2A 3K0WA 2ZOLB 4AK1A 5D70L 2NY1D 5C08E 3X3GH 2H26A 1RZKH 5GXBB 5EOCH 4FQXB 5J89A 3QLQA 1PKQB 2FGWL 2FBOJ 1BFOB 1OB1A 3SE4A 3TIEA 4QGYA 3AZVA 1X5LA 3O6LH 2QHRH 4JRWA 2W91A 3UTSB 3RG0A 3OY8A 4JO3H 4F7EB 1LOFC 1HHHA 2X89A 1P1ZB 5C0EA 2NX5E 1DSFL 1MIEH 4BFIA 3BRDA 4TYSA 5FCUL 2GITA 3QO1A 3S96B 1AO7A 3MLPA 4OZHE 1W0WB 4GRMA 1BAFL 4JO2L 1FDLH 2H2PC 4UB0H 1F90H 1A9EA 5EIQA 3TBSB 4OCXH 3EO9L 1P4LA 3SGKA 2GMPA 3ULUL 4MLSA 5LXGH 1MOEA 2ZSVA 4WUUB 1WVZA 1DYPA 1AP2A 1AZDA 4D8PB 4WFGE 2DQEH 4MCZB 4WTZA 4KJPC 5D1QD 4CVUA 2MKWA 3C5ZD 3H7LA 2WUCL 5KVMC 3N1GC 1D5BA 5D6DC 3QIWB 5K9KB 1UM5L 5TDNB 4NQXB 3V8CA 5T5OA 3QDME 5IW1A 3CXHK 1FL6B 4ZAKC 1G9ML 1DLFH 3MRMA 2DJUA 4O58L 2HFTA 1JL8A 2XY1A 3MNVA 4K3EL 2AEWA 2G2RA 2W9EH 4ONHB 1RFDH 3MLYH 1EHLL 1H3GA 3NN8A 1C57A 4L4VA 3OKMA 4O2FB 2EEBA 4NNYA 5GSRB 1OP5K 4GW4A 1AQDA 4HIHA 1D6VH 4UOW1 4P9WA 2QQLL 3SEPA 4L8SB 5JXEC 5BXFA 3VH8G 5K9JL 2VLJD 5IOPA 1KLUB 2ADIB 4ELMA 3U9UA 5I1IH 2JB5L 5IM7B 4Y19D 5A16A 5TF1L 2E3VA 4LSSL 4K94L 3QXUA 1NBVL 3L3OA 2BNRA 1HXMA 2VH5H 3O3EA 4NM8L 3LH2H 3SPVA 3CDFA 3QDAA 5DWUL 4NQCE 3LN4B 3D3VA 2A6ZA 4F2MB 2KQNA 3EBAA 2VZSA 1HKLH 2KH2B 4QGTA 5ESAB 1BBJA 1VAVA 1RIHL 4G8GA 1I1FA 5JR1L 2EDOA 1MCKA 4OGAC 1FNFA 1DBBL 1IEAB 4NC1C 3UDWC 2HJLA 4QCIA 1BX2B 5CUSL 5L2KB 1KJ3L 1N47A 3ZDXE 4NQTA 1MCHA 12E8H 3DPBA 1Y18A 1FZOB 4M43L 4M93B 4R7DA 2H6PA 2G60H 2F8VA 1CDCA 4PLKD 1S9WA 3KJ4C 3TT1H 2YXSA 2SEBB 5F9WC 3WEXB 4X9FA 1P7QD 2ZCLL 4I2XA 2BP3A 3CNKA 3VH8A 3WG3A 4F58H 3FTGB 4LF3A 5C70A 4DKEL 1ZS8A 3NVQA 4K7PL 4FA8A 1U58B 4LLMB 1K4DA 4ZODA 4OZFB 2BMKB 1BREA 4WO4C 4PB0L 1JPST 3ARBC 4P4KB 1CESA 1E6OH 4CADB 1VIWB 2WT2A 3GB7B 1GOFA 1QD0A 1CU4L 5BS0D 1YC7A 3DRQA 1J0JA 1HYSD 5TDPA 2PYEE 1M7DB 1QFPA 3TJHD 2AEQH 1T83C 1YJDC 4LRIA 4WU5B 5DRWB 5H94A 4ZFZA 3T2OA 3V5HB 2AI0L 2ILLA 2IH3A 4O51B 3KNBA 1MJ8H 2VABA 3KYOB 2QR0A 4BQ1A 4ZFOB 3DX6B 3O6LL 5C0ND 2AQ3A 4LGPB 2RR3A 4C4KT 4DTGL 2YZ4A 5HGBB 4ESKA 1QFWH 1HWGB 1QBLL 1YEHH 1IQDA 3HNTH 1FNSH 3TH3T 1BBDH 4HIJB 4JVUA 5C0FB 4BH8B 3TO4C 1MQKH 3O3AA 1C12A 1MIEL 5K9OA 4BOWA 1LNUA 4I18C 3WHE1 3ZT5A 3ZE2E 1F90L 3ZTJH 3PV6B 4C58B 3JV6B 4KDWA 2BK8A 3SKJH 4Z8FH 3O3UN 4AIZA 2QQKL 4POUB 3NFPB 3VFRB 1ND0B 2VXVL 3OF6D 1UEMA 1X5KA 1MVUB 1AHWB 1PJ9A 2DQEL 1J1TA 3ZSJA 4V1DA 1WLDA 5IW6A 3F7YB 1DQ4A 3QJFB 3I3BA 3DHMA 2VKXA 4HGWB 4MNQA 2EEAA 2XACC 3NCFB 4NYLA 3T8XB 5KG9A 4U31A 4NNPH 5SX5H 3A0KA 1ERNA 4BH7B 2W9EL 4GKNA 2GIYA 1PLGL 5TQ2H 5CD5C 3L3IB 2A6JA 4PUBL 1J10A 1B4JL 2WUBH 1TQCC 5GS0L 3BSZL 4PD4K 5F7MC 1A7PL 3WIHL 2XOTA 2NR6D 5DHVA 1JNJA 5TFSL 1OP9A 3S36H 3TVMA 1QYGL 2HWZL 2BNUA 2LAAA 5DUML 2P5WA 5DO2C 3EYFB 5EORH 2ZUQC 1VFBA 3BPCB 1GZQA 1TVBA 3QQ4A 4GJTB 4RWYL 1G7LB 3CFBB 1TCRA 4Y5YC 5SWQB 5DMJB 3ILNA 4WHYG 3T0EC 1IGTA 3LSOB 2XIDA 3LH2L 4HH9A 4IMKC 2HLFD 3D6EA 3N7LA 1I7RA 2VSCA 5F89A 5IMKB 3W0WB 1HKLL 2EDXA 2ED8A 4L3EE 5C8JA 4R2GD 5AD0B 4GMSL 3OJMB 5ICXB 4GLRI 4KK8D 4AY0A 3O4OB 4G6JH 4X5XB 5HGDA 5I16A 4D9RD 1BIIB 2YMZA 5T1MB 3EHBC 1YPZF 2AJUH 2ZCKH 5I9QC 4U6VL 1QPPA 2EYSB 2G60L 2BSED 3BD5A 3JVGA 4IMLB 3INAA 1WBZB 5JIPA 2OSLB 2LTQB 2BNRD 4JR9H 1LO3L 5KVFH 4NJAL 1C16A 2YPKA 3POWA 4H25B 1RIRA 1WCSA 2VISB 2VLME 4P2OC 2X4NA 2M2DA 4FN0A 4Z7UA 4G8GD 3U30C 3G6AA 3VE0A 3A6CH 4P3DB 2WIIA 3LDBC 1AJKA 4DFSA 1WD4A 3VXQA 2O5XH 1UVQB 4G9DB 4BZ1H 1E6OL 1TTGA 3VDAA 4XAKD 2ARWA 1TZIA 1DUZB 2JIXD 1MFAH 1T4KB 3BUYA 1BD2D 4JDVA 4W6WB 3FQRA 3RRQA 1FFNB 1CD0A 1MS0A 4LHUB 3KPSB 1D5XB 2WLYA 4Q7DA 3IU3B 4KJQC 3NABL 5DMGC 5DK2B 4O5LH 2VLJE 4P2CG 1NQBA 4UT9L 1MJ8L 5I8EA 5HCBA 4PJ8A 4Y19E 5C86A 2ZUVA 5JO5A 1AXTH 4YO0B 1IM3B 1OAQH 1VERA 4PF5A 1NEUA 1HCFX 2VDLL 2X7LA 1QFWL 4R26L 4U05A 5J9PA 4IIQC 2VAAB 1J9CT 2FH8A 2OTWA 1LP9B 2OBGA 5KSBB 3HMWH 1FHGA 2W68A 3PDGA 1JTPA 4PRIB 3QULB 3O41B 4LVHB 3SDDA 4PJCF 4M3CB 3LD8C 3M8OH 4J1UB 2APVA 2DKMA 4O2EA 4Z5RB 2V5TA 2I9TA 3UTQA 2YR3A 1EVUA 4JB9H 2IBZY 3RTQB 1Q9OA 4DKDC 3CLFH 2H2PD 1R3KA 5C0DA 3OKLA 2BDNL 1JYNA 2VZVA 4JZNA 4YAQB 5GJSH 3ALPA 3IDNB 4MA1C 4LBLA 5DRNA 2JCCE 3GSWA 3OJ2C 3LCYA 4HHAA 3FBYA 1I9EA 3L1OH 3FQTA 1LGBA 1P5VA 1ZKAA 2JB6A 5E5UB 4LCCC 3PWVA 4O9HL 1QLFB 4Y4FB 1L6XA 4O00A 4MJ6A 3PWJB 5ETUB 2OS7A 5KANG 3CIQA 2E53A 1RUPH 1BKZA 3SE3A 4BK5A 1SACA 1XFPA 4OI9A 4ZO8A 5D1XB 2C5DC 2R1YA 1E27A 4GMTL 4PBVC 2OYPA 4LBKA 4ZAKD 3QFJB 5CIPA 5I76B 1KLGA 2ZPKL 1SEQH 3O8XA 4GXVH 4KGLA 2ZZJA 5GGVY 1KIUA 4P23B 2WUBL 2Z93B 5JW4Q 1I1RA 4ZUVB 3BISA 2WWMD 4OCLC 3CFEA 4MA7H 3UJJL 5E8DH 2ARBA 1JNLH 4PJAB 1YQVH 1PQZB 1Z6JT 1EHAA 4YDJB 4V1DD 3S36L 3VFNA 4P57B 4PJXB 4AIOA 5KXCA 5AZ2H 3MW2A 1A6ZB 1GIGL 2OM5A 3HFML 5EORL 3VJ6B 3IPVB 5I1LA 1ZLUH 1SBDA 1MWAB 1JF5A 4ODTL 3KXFB 4Z95H 3VFTB 5J6HA 3GIZL 4JHBA 3UZVB 3VW3H 1G7JA 2DKSA 3LS4H 1FV3A 3MOBH 3CLEL 5D5ME 4PJEA 1AFVH 3SDXA 2ORBH 2ZG3A 3BQUA 4XPTL 1EBPA 4XXCA 5LVEA 1JMZA 4OLXH 2MPAL 5GSVB 3I6GB 4ZNEA 4Y22A 3L3KA 5HCFA 4ZPVA 4DUVA 4XE9A 4PP2A 3U7YL 2OTPA 3KYKL 4LAJH 4N0RA 3O3BB 4KRPB 4H1LG 2XZZA 2P5WD 1JF6A 3CFCL 3S37X 3GJFK 3VFVB 1SEBA 2CLVB 4M7ZC 4Y8AA 2EIZA 1ED3B 1KIRA 4YW1A 3BESR 5J6GA 3NV1A 1NMAH 2OL3B 3QI9C 3SGJA 1NAMH 1TTFA 4ZFFA 4ZKTB 4JPWH 3V4UH 1EAPA 2B5IB 1CPNA 1SYSB 1HI6B 3OHXA 4LVNC 3JTSA 1AO7E 4HJGA 2AUYA 3EOTH 5EOQL 4MXVF 3CVHB 1CE1L 2LABA 4RDQG 4A2LA 1QSFB 4HCRL 2NZ9A 3QP3A 4J3TA 2K7QA 4BZ1L 1G7PB 3IGAA 3MSPA 2BSRA 2NM1A 4XAWH 4QT5B 1MAML 1DJSA 5EFIB 1MHHA 2GJ6A 1FYTB 2NY7H 3EOAA 2KKQA 1F3RB 2W52A 2QL1A 3A6BH 1ORSA 2BOCA 2E7MA 4XZPA 4NWTH 3SE8L 3UX9B 1FP5A 4EUPH 2ARJB 4FQXC 3T77B 4H1LA 1XR8B 1FBIL 2A6DA 2XG4A 3DSFL 2DUPA 5IVNA 5DA4A 4P9XA 3D25B 1YNTA 4XCFH 3FLPA 2HTLD 4NNXB 3NIDF 3MLUL 3RHWK 4YZ4A 1HH9B 1M1SA 1T6WA 2QEJA 1OGTA 1R5IB 2FJHA 1CLYL 2VQTA 3VFPA 1OAQL 4WZFA 1R1ZA 2NQCA 2AQ2A 3VWJA 2O61A 4F83A 3GO1H 2NMSA 1CTOA 1SQ2N 3BW9A 4HS6A 4L4VE 5C0GB 1I1YB 3BP6A 3FQWA 3M8OL 3F58L 1FO0A 5HVGB 3V0BB 1AKJB 3CDGB 2SLIA 1HQWA 5DVMA 3N9GH 4DKAA 1DEEB 4ELME 2N7BA 2X4QB 4LPWA 3WSQL 4PJ8D 5BZDB 3QIWC 3ARDA 3WFCH 3EZ8A 3HZYA 4PJDB 4NP4H 3FO0L 1A6TA 1B0RA 2BNRE 2H32A 2AABH 5GRXG 4Q9BA 3FO9B 3M45A 4KTEH 3S7GA 3W5MA 3D3VE 2J3SA 3L1OL 3ZSLA 1L0YA 4KPHH 4EXPX 4YPGA 3C6LA 4XCYA 4R4BA 4G8GE 4HK3N 2DQCL 1R5WA 4A2MA 4U33A 4NQVB 1DBJL 1FFQA 1A22B 3WLWC 4JFXA 5CP3A 3AGVA 1F8TH 2IFFL 1KBGH 4GXVL 4Y16B 1QR1B 4E42A 5EXOA 1BD2E 1GLHA 4L8SC 1ZHNA 3HC0B 5F5QA 4F7CB 1A02N 4QRSA 5AAWA 1JYWA 1MELA 3D1MC 1HXYA 4I2XE 1DL7H 4F3FA 1CFBA 3F62A 3IFLH 3UTOA 4HKBA 4XTRD 5BMFL 3M3QA 5F1OB 2IGFH 5T5JA 2FX7H 3TIDB 3KLSA 2F15A 3MRGB 4J12A 4Z95L 1OSPL 1S3KL 2C7UB 1U8QA 5DO2D 2X4UB 3VW3L 2F53B 2A9MH 3MOBL 4NHUB 5IUSA 1CR7A 3LPFA 4NCC2 1K2DB 3QUYB 4IRSB 1AFVL 3HE6A 4DN3L 1N26A 3KLHC 3O8XD 3LKQA 4Y88A 1PEWA 3QUKB 5H9QA 5I1DA 4HUXB 3T0ED 4EVNA 4OZIF 1N59B 4HFUH 1HNGA 4U3HA 4E5XB 3D0LA 1C1FA 4APQA 3RVWD 3D69B 5LQBL 3WFZA 1W6PB 4JVWA 1RIUL 2LU4A 1MHCB 5KOMC 1ZGLA 2BVPA 1V6KA 1I8MA 1DR9A 1ZWIB 3WL9B 3H9SB 5CSBA 2V9TA 1SJXA 1DBML 4XTPA 4WWID 1FAYA 3WOGA 1KIQA 5JOWA 5D8JL 3EHBD 3L3JA 1CDJA 1NAML 1KC5H 2J6EA 2OXHA 1OAUH 4NHCH 3V4UL 2ZUWA 4X6CF 1JRHL 2CDGB 1EFXB 3NV2A 3LQAL 5F6IB 2DQFA 1F2QA 4P4KC 2A83A 4YHIB 3I9GH 3VU2A 3HR5B 1N64L 1K8DA 1AX1A 3BE1H 1FIEA 4P14A 3FO1A 1NMBH 4K2UH 3BOPA 1DFBH 4GRLB 4GRWE 4AGVA 3K1KC 1FN4B 4DKFH 4AT6A 2EIBA 4RGOH 4Z7NF 1T1YA 1ZHKB 4HLJA 5CEZH 5FO7B 1IC7L 1QFWI 2ZKHH 3QA3B 3DVNB 3LZFL 3MRPB 4G8IA 4V1DE 3BKCH 3LEYH 2X44D 3L5XL 1J11A 3LHPH 3B9KB 5I15H 4MD4A 2PELA 2UUDH 3VFSB 4MNQE 3ZSSA 4I0PB 2EXYD 3MLZH 3ZYZA 1QFHA 1RPQA 4ODBD 3GGWA 4OT1H 3B5GA 1H8SA 1QU0A 1ZVSB 3QUXB 4YDLB 1CDYA 4N0CC 1CLOH 1F02I 3GO1L 4HMEA 3OG6B 3ZXLA 5DK0A 3OGGA 4NKMA 4U0QB 2HJFA 4CZSA 1S7QA 4YHOH 4OD1H 5FO8A 1EO7A 1U6AH 1HLCA 3FN3A 2P5WE 2IALB 4P5TB 4CAGA 4JM2B 6FABL 5KBNC 4LU5L 2DTSA 3N9GL 4LCIH 1HINL 1NGZA 1AHWC 2DWDA 3FLRA 1XH3B 2XKUA 2XKNA 2X70B 3WFBH 3RWHB 3WFCL 1ZLVK 5EULV 3R1GL 4NPYA 4Y5VB 3VWKA 4MX7A 4BSVB 3W5NA 1A21A 3QYCA 1UGNA 4JPVH 5GS1A 2Q86B 1J8HA 3NZ8B 5DJYB 3BP5B 5ICYB 2AXFA 1XGYH 4NO0A 3T65A 3WNPA 5C71A 1L0XA 1AD9A 4C83B 3KHQA 1F8TL 3O6FA 5BO1H 1KBGL 4WU7B 4UNTA 1V3MA 3H9HB 4X9GA 1MREH 3MYZA 2CR3A 2K7PA 3ARDD 4M9PA 4U6XB 4QOKA 5D72H 5IB5B 1HQ4A 1LO4H 4G3YH 3RWCB 3IFLL 3CD4A 3IFOA 4AH2B 1PZ7A 4HGMA 3SDAB 4Y24A 2IGFL 3C6LD 4Z7UE 2QTEA 3JWDH 4YFZA 3ZKMD 1GZCA 2Q20A 3BIBX 5E9DB 2DQUH 5DJ6B 1A3RH 5J7CC 1CPMA 2VDKH 1ZA4A 2BSTB 3B5TA 4BQ9A 4IQPA 1QACA 4ZYKB 3QRGH 4LKCB 3TFKC 1K6QH 4L29A 4JJ5B 2OR8A 1WBXA 1Z9LA 5E99H 4PGEB 3VFUB 1F5FA 4WJ5A 1H3VA 2W9DH 5I71B 1U8HA 3TBVA 4J4PA 1SLIA 2CR6A 4CVWA 3VMNA 2XNAB 1IS6A 3Q6FA 5KZCD 3O6MH 5F88B 1OKQA 2B4CH 1PVHA 2LTQC 3D39A 3GSQB 3DUUB 2AREA 1H5BA 1A4KB 2R0ZH 3MO1B 4XX1G 2XZQH 3HE6D 3OGCA 1QA9A 2IH1A 1OAUL 4OLUL 5HVHB 3B5HA 3DIFB 4MS8D 4PLOB 5HHNA 4QXUH 1LHZA 5D93B 3KPRB 4H5SB 3JTTB 3S4SB 4I9WD 4H88L 5DJ0B 1NUNB 1S7TB 3MACH 2HYKA 5IB1A 3I9GL 2ZAAA 3QJHA 4APQD 1KPUA 1P9MA 3P77B 3TA3A 1BOGB 2GCYB 1RK1B 2WSVA 2WP3O 4G7VL 3I6KA 4ZO6A 1EIBA 4GO6B 5LWYH 3LN5A 5HHOA 4GW1A 5FGBA 1IGYA 2QJDA 4DKFL 4NZUL 5H9SA 1EA9C 4WFEE 2H2SC 2WNEA 1TVHB 5E8NA 3G6JB 1JNNH 4ODHL 1Q72L 1NCCH 2A6KB 3A6OA 4HWBL 4JDZB 1UJTA 3UBXG 3WFEL 1JGUL 3CPLB 1MLBA 1N8ZA 1MHPH 5L7XL 4HPYH 4AL8L 4F7MB 1GANA 3JU9A 4JAMA 4JPKL 3P9LA 2Q7YB 2ZGNA 4WHTA 1LEKB 3GMLA 1PG7W 2DVAA 5DT1L 3BZEA 2UZIH 1JYCA 1XGUB 3IDUA 4XNYL 4OT1L 5I1HL 4QHLB 3N06B 1BQUA 1OW0C 1LGCA 5FDWB 5IG7A 3BP7A 1G9NL 1AC6A 2BNQA 3TNMB 5AUMA 4LVHC 4CW1A 5M94B 5EZLA 1A7RH 4QF1A 5I0ZA 3VGBA 5GISH 3AXDA 4FTVA 4OD1L 5E1AA 3JWOH 2IADB 3RTQC 4B41A 1DYKA 5JOEA 1S7UA 1SJEA 2XN9B 3VD7A 3WLBB 4QHKI 1WFUA 2VYRE 3OBTA 4LCWA 2VUYA 5DUVA 5IT6A 4G43B 4OFDA 3WFBL 4KKAD 3MREB 4PJEE 5HY9A 2WINB 3SDXE 4BFGA 4IRZH 4Z78A 4Y4FC 4I48A 3UBXA 2CLRB 5BRZA 4ZNEE 2A6VA 1OQXA 2R2CA 2YUXA 1FNYA 3C5SB 2P3IA 5D1XC 2YPVL 1G7HA 3ULVL 1AR2A 5DR5H 4XJ9A 4PGDB 4U1JA 5JUEL 5FO9B 2VLLB 2Z31C 4LSQH 3I02B 5GRJH 1XGYL 5T1KA 2HFEB 3FONA 3QCTH 4P23C 1U92A 1DQMH 4GKZB 1URLA 4PJ5D 1A7BA 4LBQA 2UYLB 2F8OA 2VXQH 3I2CH 4B5EA 4YEEA 3WLWD 2HVJB 5E8EB 2ICEA 3LRHA 4BZ2L 5IV2A 2YUVA 4TVPL 1BWWA 4UTAL 4R0LB 2FRGP 4UU9A 5DJZB 1IILE 5IQ7H 1U8PB 4G3YL 3VWKD 3VXRB 4JC1A 3REVA 1D9KA 3I75B 1QO3B 2IPUK 4H26A 1TLKA 2XY2A 1LD9B 1YRZA 2MMXA 1JPSL 1J8HD 3DUSA 2P7TB 1ZT4A 2XT1B 2ICWA 3DX9A 4NO0D 4QHMA 1KPRB 1L7TH 5H37H 1RZGB 1FFPB 5I18H 2NY3B 3D5OA 2R1BA 5D7JB 5IT2L 1N6QH 1LE5A 3O6FD 4HZLB 3O5SA 4D69A 3LPWA 4KZEL 4NO2A 2FD6H 4N0UA 4KRPC 1WTGT 4XZUB 2E6JA 2GJ6E 2XZAH 3LKSA 2HA1A 4WV1A 3QUMA 3DRTB 1GVIA 1FCGA 3QH3B 4MJ5A 5DQ9A 1HIMH 4QOKD 1SM3L 2W9DL 1KCRH 2VL4A 1LWRA 2AJZA 1HDMA 2BZDA 4OD3H 5EA0H 3T3PE 4HC1L 5JIKA 4RA0A 3O6ML 2B4CL 2EF6A 3ESVF 3HS0A 5HHME 1JN2P 1YA5A 1B90A 3AS1A 2R0ZL 5ERWB 3TZVB 1MJUL 3C87A 5JPMA 1MCPL 1ZOXA 1FORL 2X4RA 3IVKA 1WIOA 4YXKH 1I9IL 4ZUSB 2EDYA 5FF6B 3UYPA 4POYA 1VFUA 1GICA 2OTUA 1PG7L 3ILFA 2DWEA 2CWSA 5F7WC 4J4PD 2ES3A 5I1JH 2XQBH 3ZHLA 2MFNA 1VSCA 1DQQB 2HVKB 4M6OH 2IQAB 4N0FB 3D39D 1X5JA 2D7TL 5FHBL 3CH8A 3ZMRA 1LP9F 5KSBF 1L0QA 3QXDA 3CC5A 3TNNA 3GZKA 4QXTA 5DLML 3D85D 1IC5L 1ONAA 1UAIA 5C9JA 2VO5A 3LB6C 5BZWA 3QO0A 3PIQA 3HMYA 4M3KB 7FABH 3K2UH 4RGNB 1RURH 3OG4B 3TA3D 4ODUB 3IN9A 4BSWA 2NY2D 5DJ8B 3M1HA 2VLKA 4ETQB 5T52A 3HLAA 3ENRA 1CGTA 5GGUB 1CGWA 2BOBB 5FYJE 4RMQA 1NMCB 1CT8A 3JWOL 4QRTA 2CWMA 3SLIA 1WT5C 5HHVL 4WW2B 4QRRB 5H9RA 3MODL 4XI5C 4KKLC 1R3JA 3O11A 3S5LG 3MA9L 1MCOH 3LEVL 4XP6H 4DN4H 1W6NB 3D0VB 1GAFH 4YM0A 2OUHA 2CMRH 4JQVA 2XYCA 4JRYD 3KPLA 4W4OC 4KDVA 2BNQD 2R2HA 1YQ2A 3NIFE 2RB8A 1SJVA 4I9WE 4PPTA 1FNLA 3OXRA 3SJVD 3MGOA 4Y16C 5SV3A 1WICA 4WW1A 1MS9A 3MRQA 1WFOA 5ANMA 4DVRL 1M7IB 3OL2A 2P8LA 4LAQL 4LBOA 3I2CL 4XHBA 3W59A 4LCWD 4M6MH 4O2CA 3TN0B 3ULUC 1V5JA 1CF8L 1QDCA 1NFDB 3F7VB 3SKOA 3MJ8B 1DN0A 3FB5B 4XMLH 5HSFA 4URTB 3FFDB 5IBLD 4AQ1B 3MRIB 4WUKH 2Z4QB 1FZJB 3S5LA 4IRSC 1P4BH 1OY3B 3QWOB 4PBOA 4Y1ZA 3SGDH 1LO5A 1G9MC 3DXAB 4RMVA 1T1WB 4LDOB 4X9BA 2GTZA 5T1KD 1S7VA 3M3CA 2NY5H 2ZSWA 4UMGA 4DVBA 5DYOA 2VQ1B 2YZ1A 1N6QL 3QDGA 1YEJH 4YWGH 1DDHB 2YA0A 3G5VA 3EIFA 2A9NL 1VEMA 3MBXH 1O7SA 1LO0L 2IPKB 1JZ2A 4HXBH 3O4LA 1QSZA 4GW5B 3FHAA 1UXWB 3PDDA 1EEUA 1KCRL 3H2WA 4CN4A 5C92A 5DMIH 5EA0L 5E94B 3RVTD 1FAKT 2DQHH 2EYTA 1MJ7H 3QXAA 1XCTA 3UK9A 3L6FB 1CGSH 4Z76A 5F1SA 2AJYL 2A74A 1MIMH 5F6IC 3TBWB 2AJSH 4K94C 2P2KA 4Y5XA 5C0AA 5CMAB 2UWEB 3BDYH 2EXHA 5JA8B 5IVXF 4G80B 1W0YT 1NJ9B 4QHKJ 5FKAB 4YXKL 4JRXA 1QZ1A 2JE9A 4NZDA 3SDCA 3QWQB 3QQ9D 3AY4A 4NQDB 4GRLC 1QRND 3HI5L 4K23L 3MV8A 4MA3A 4TSBH 4FOWA 3MFFB 4HW6A 1M71B 4JFPB 4RISH 4XMIA 5INCB 5IWLA 4KMLB 4CDGC 1RZ7L 4JKPL 1AX0A 5GRVL 4X98A 4HWEH 1NFIA 5CGMA 3N7MA 4E41B 1ZSDA 3TCXA 2C3WA 1BIHA 1XGPA 4I0PC 4BQ6A 1LEDA 2H2SD 1ZEAL 1IFHL 2X4TB 4XXDA 4R4FH 1NAMB 1CYGA 1J8HE 3FJTA 3CUPA 1CQ9A 2ZA9A 1RUQL 1QVOB 3PP4L 3QUXC 4YDLC 4KI5C 4K3GA 1LMKA 5E88A 4LSPL 2P37A 1FVDA 4FFYH 1FVEB 7FABL 5GRZA 3TB0A 1XR9B 4PJDF 5JORA 3VXOA 1EK3A 5IJVB 4FPLA 1PAMA 2CKBA 1I7ZA 2Z0BA 3OXSB 3BD3A 4OZXA 3BT2H 4P5TC 3OWEA 4I77L 5DMKA 3ROOA 4QOKE 5F9JB 4JM2C 4P46B 5C0CB 3VFMB 1OTTC 3GSVA 4X7DC 4FRWA 2BHZA 4PRDB 4P3CH 2CXGA 3MRLA 2V17L 5J57B 4PJ7E 1BYHA 2ZCHH 4Y5VC 4DN4L 3QIBB 1S9XA 3ZHKA 4NUGH 5H35A 2CMRL 1R5VB 2HTKC 4N8CH 1KEML 3GM0A 4CRPA 3NWKA 1IM9B 1LOFA 1ITCA 3QEQA 1HHKA 4FQIH 1GGTA 3AM8A 1MFNA 2VAJA 4IOIB 4UUJB 1NC4B 1JHLH 3AP5A 2Z31D 1GHFH 3T2NL 4N90D 3VV1A 4PRHB 3L7EB 5CEXA 5K59F 3RWDB 2WBJD 3D2UA 3KQRA 3D39E 5EBWA 3RVXD 3WV6A 1GL4B 2RBLA 1E28B 4L8QA 3OYWA 3HR9A 1KB9K 3SDAC 4X99A 4XMLL 3BJ91 1ETZA 1A7OH 1FSKB 1NFKA 1HEZA 1FV1A 5F7DA 3HC3L 3ZXEA 4XPAH 1NH6A 1ONQA 5EG6C 5FUZL 3VMPA 3GI8H 5E2TL 5IFHL 1MFCH 4LEOB 1JGVH 4LLQB 1DUYA 2VZUA 4D0BB 4X8JA 3AXEA 1OD9A 2V2TB 3C60B 5JW5A 4X7TB 3MUHL 5HHOE 1E4KA 3LRSB 5I71C 4M8VA 5A3IC 2WKKA 5GS0C 2N1KA 1OAXH 5HYQB 5I6XB 3QG7L 4H0GA 4NFCA 3WIFB 1HZHH 4ODSL 4A6YH 4EDWH 3ROLB 5JIIA 1H3UA 3DROA 3OAYK 5CBEB 5D1ZA 4GAYA 4F15C 5T33L 4IBLT 2E9IA 5ADPH 1MJ7L 2OR9L 3U6RA 2XZCL 5HVHC 1W8NA 2V5YA 4XX1E 1JK8B 1UKSA 4YC2B 2F58L 3MEPA 3LAFA 4NN7B 2E27L 5D93C 2CNAA 3RGVA 4WHCA 5DDHA 1RV6X 5FYJU 2ZJSH 32C2A 3CFDA 3QDGD 5B4MC 2BNQE 1LOAA 4GUPA 5C09B 3VKNA 2Q76B 3POYA 5HI3C 3WS3B 4PJFB 4S1RL 3G5YB 4NN6B 1C08B 5DJCB 1AGFB 4FTVE 1GGYA 2PN5A 4S11A 3VGDA 1YEIL 3GMNB 4CJ0A 1XGQB 2UY7A 3TYGL 2GFBB 4OUUB 5FHAH 5BQ7B 4LCWE 3GMOA 3FCTA 1MCSA 3GSUA 4PCRA 1R24A 1LOCA 3O2DA 1DE4A 4ZG1A 5C2BH 3WHTA 1CICB 1MPAH 3OKKB 3V0WH 5E6IA 3JV5A 5BRZE 3FT4A 5C0AD 3KPOA 3QNXB 3LQZA 4Y2DA 1UYWH 3PGFL 4JRXD 1R3IH 3P2TA 1W0VB 1OAYL 3SDCD 1I3GH 2A38A 5IJKC 4LBEB 1YPZA 1NGPL 4H8WH 5FUCE 2FX8H 3MV8D 1LO2H 3REWA 4Q2ZB 3A67L 4PS4H 1GSLA 2EKSB 2OR7A 1NUDA 4DZ8A 4WI7A 1QEWB 3PGDA 4R90H 1YYLL 3H3KA 5FFLA 4Q8LA 3IETB 5HYEA 2Y07L 1Q9KB 1M05B 1RJLA 3TBTA 4CU6A 4TTGA 5ID1A 1WZLA 5B38B 1O0VA 2YA2A 3U4BL 1WUVA 3V52L 3QPQC 3ILRA 2XFXA 1BQHB 4P3CL 4P49A 4RFOH 1F4XL 4HV8B 3GKWH 3FN0H 5EBMB 3G6DL 1WSST 3C08H 2NY6D 4MHHG 4LNRB 4U1SB 4NRXB 2IMNA 2VDOH 2TEPA 3BH8A 1VLNA 3K8KA 5IR1B 2WSKA 3MCG1 3MNZA 2GW5A 2XWTA 4LLYA 4L8DB 4N0UE 3U9PL 4FQIL 2J8UB 3IRPX 1Q94A 1FRGH 2DURA 3GSRB 1L9NA 1QRNE 4FPGA 3TV3H 2N4IA 1T0NB 1JHLL 4ZSOB 5F3HB 4U1HB 1G9BA 3USUA 4R0LC 2PO6A 5CEYB 3V79C 1YEFL 3D48R 5KJRL 4PJGB 2A77L 4ENED 4ITCA 3E6HB 2E9JA 4KFZC 4K9EL 5HI5D 5KXEA 4P5KA 4Q27A 4I8DA 1QOOA 1T04B 4PJCA 5ID0B 3QEQD 4S1DC 4MAUH 5DS8B 1N5YL 2NY3C 4LARH 2F5BL 3H42L 5D7JC 1CFQA 1IBGL 1WEJH 3OJBA 2NYYA 1XF1A 1MNUL 4Q2FA 1AXIB 3IDGA 3DX8A 3PHQB 2R1WA 3CAFA 3CZFA 1YI7A 4PBXA 3MLTA 3D2UD 3DO7A 1TTUA 3GK8L 5F7FA 4M01A 5ALBL 2OZ4L 2BCKA 4OKDA 3ULSA 1KELL 5DRZA 3W39B 4QYOB 3LKOB 5T5PA 1HZHL 3P11L 3HI6H 3DWTA 1KTRL 5KTEH 2HT4C 3BWAB 1I8LC 4U1IB 1JJUA 5AAMA 3HMXH 2GK2A 2NXYD 3TZVC 1MFDH 1AIFB 4EI5B 4N9GB 4UTBL 2RAMA 3JV4B 3WDXA 1YYMH 2VLKE 2ZJSL 2DL9A 3G6JF 5CSZA 4Y1VA 3UZQA 1ORQA 3IU4H 4HT1H 1HILA 3DMMB 5GZOD 3EYOA 5E7FA 5HDLA 4L1DA 5D7LA 3P4MA 2H1PH 1F4WH 3MX0A 1UWGL 4P2QB 2ZUSA 5D1ZD 35C8H 3L9RA 3RZCB 4HS3B 4RMTA 3LEXA 1RD6A 1YEEH 1RJZB 4NQSB 3VD3A 2AERT 2EDBA 2OP4L 2OXGA 3QNZA 3R8QA 1UXSA 3RGVD 1GGBH 3FRUA 4WNQB 2J5LB 3OR6A 4HL0A 4RQQB 5MEND 3ARGB 5C6PB 3WFHB 2WIMA 2DVFA 2WBWB 5SX5K 4JQIH 4RGNC 1R3IL 3HE7B 1UG9A 4M5ZH 5IGXH 2COQA 5DI8B 1AGCB 5L88H 4OLZL 3SKNB 4H8WL 3VUOA 1TQBB 1EXUB 4MDJA 4UZGA 4PRBA 3JV0A 4MCYB 1JV5A 5ANME 4KI5D 4GG8A 4PS4L 2HMID 1JUFA 3GSNH 3GM8A 4HIXL 5DTFB 3RIFK 2YV8A 4WI9A 4YFWA 4F7TB 1U95B 4N68A 2UZXB 4HBCL 4WW2C 5EBGA 1JPTL 1DQ1A 1W6OB 3OR7B 1AE6H 5E6ID 4XNQA 2X1WL 1HKDA 1EBAA 5HGAA 1F4YH 3X12B 2LFGA 2AV7B 2C1PB 4N5ED 4Y2DD 5HDOA 5GGQL 5SWZB 1OTTD 4M1DL 2A1WH 4WTXA 4RFOL 2KDGA 1N1VA 1ITBB 2AV1A 2X2YA 3DX7A 5DJXB 5EOTB 1SBEA 2VDOL 1MZ6A 4HEME 5FA3B 1LJ7A 2RQ8A 5EU6B 1AXKA 1ZHBA 3C8KA 3QDGE 1L7IL 3MV7D 5IBTH 3V0AA 3L5WA 4JN1H 1MY7A 1FNHA 4MDIA 4DRRA 3X11A 4FOVA 4OSUL 4Z7VB 4LQFL 5CAYB 2WJSA 2FLRT 1FZKB 3O4LE 4LCUB 1IAIM 5I8OH 1G6RA 2CGRH 3MNWB 4XBGB 2ZMNA 2AH2A 3SGDI 1IS4A 5I8CA 3MYJB 3STLB 2YD2A 4FXKB 2D7FA 2H8PB 5F96H 4XJWA 2CIIB 2VZOA 1OAKL 3T3MF 5C0AE 1FL3A 1A7QH 2DTML 2FGZA 5ALCL 2D6MA 4ZUTB 3BZFB 4JRXE 2LE9A 3TBYA 5BOZG 5EO9A 2FL5A 1FGNH 3IDIB 1AI1H 2QSCH 1WJ3A 3W9DA 1CXEA 1JWMA 4F7PA 4XC1H 3UTTB 3MV8E 4NRZA 1IEBB 5EWIH 4UW3A 3HC4L 1S5IH 5GIRA 4HFWB 4N9OB 1RZ8A 4M7KL 1LHOA 2VDMH 3WV0A 4QWWC 2PR4H 3L3GB 3VXPA 3BRFA 3GJEA 5IEHB 1BGXH 2X1QA 3NCYP 3SCMA 3W11C 1Q0YL 3HPJA 4K7FB 4C56A 4LEXH 1KTDA 1BFSA 5C08B 3TLRA 3ZVXA 1UH2A 1NGYB 1APNA 4CU7A 1LHWA 1LHNA 2PETA 4O02H 5GS0D 2C4FU 2DI8A 5DC4B 5DD0H 3AU1B 3FFCB 2FZ3B 4MGXA 5TE4L 1LECA 3BX7C 1HH6A 1S7WA 2IFGA 1I7TA 4G6KH 1BVLB 3V6FA 2NYYD 2X4OB 4KK9C 3MRRA 1IAKB 1MHEA 1FE8H 1WLHA 2NTFB 4FPEA 1YYML 3RKPA 3V6OA 5DFWH 1LEGA 5K9QG 3WNXA 4OZHB 4LSTH 2X10A 4PRPD 1SY6A 3MROB 3L5HA 4HT1L 4PR5B 4BUGA 4PV8B 1OF2B 2FX9H 2O5YH 5ICZA 5JHLL 3GRWA 4S1SH 5T1LB 4UT7L 1U2CA 2YBRA 1JWUA 3AXLB 3G5XB 4LMQE 2H9GA 4PTTB 4UQ2A 1SLCA 4ERSH 4Z7WB 35C8L 1WC7A 3HZVA 2VC2L 4O4YH 2IBBA 1A1OA 3P0VH 4ZQKB 3AP7A 2NN8A 1JF1A 5I30H 1X5AA 2P34A 3P3YA 4OZIA 3WLUA 3WE6A 2H3NB 1KN2H 3QDMB 4GKSB 2FWOB 4WHYH 5KVDH 1UN1A 4FQZA 5EZOL 1PSKL 3QISA 3QIUC 5GGRA 3QEQE 4KMTH 3LQAC 4N8VG 4WW2F 4X6FA 4X4XA 1S8DA 5IGXL 2HRPH 1ZA6A 5TQ0H 5FREA 5D7LD 5L88L 1XF2A 5L8LB 1R3HA 5GLVA 1UCBL 1LK2A 1G9FA 4UQ3B 3RA7L 5CP7A 2GN3A 4P46C 4X6CA 2NW2A 5H8DA 4KAQH 3K4DA 4FOYA 2HAZA 3F5WB 4LSVH 5ACZA 4FPJA 3P4OA 5I17B 3OKEA 1KNOB 2QSVA 1CDGA 4FQXA 3S3SA 4AGGA 1F4YL 3QIBC 4M61B 4KI1A 5FIEA 3NV4A 2P46B 3PVNA 1ZLUK 1QHPA 4XWOD 4XMPH 4C55A 1UT9A 2A1WL 3UTSA 3TCLB 5GGSB 1CLZH 4PJIF 3ZYRA 4F7EA 5EH1A 1DANU 5DFTA 4NQCB 1A2YA 1WBYA 1P1ZA 2D7OA 2R1XB 4MQSB 1NFDF 3R4UA 4JN1L 1T03H 1CR9H 5IROC 4KTDH 4KU1A 4N8VA 2PHXA 1F2XK 4KK5C 1UA6H 1PZ9A 3TBSA 2R16A 4LL9A 2JE8A 3C8HA 4GKOA 2FHFA 2Y4SA 4XWGL 3CVIH 5MEPB 2P8PB 3SKMA 1MVQA 1S0GA 5GS2H 2FJFB 3U2SB 4D8PA 4MCZA 4LLDB 2DVBA 1FSKC 2JELH 1SHMA 1CLCA 3QIWA 5KSAA 1AVBA 1TXKA 4YGVB 2EXKA 5TDNA 2CK2A 4NQXA 4OF6A 5CINH 2VZ3A 1T5WB 1UEYA 1OQ1A 3MXVH 1NBYB 5JHDA 1P84J 5C07D 4ZDHB 1IGJB 4RFNB 1J7VR 3NA9L 5D7IB 3WDIA 5F93C 5TF0A 3C60C 4ONHA 1AI1L 1WFTA 2QSCL 5MHSD 5DZEA 5T5NF 5EBLB 4XC1L 1NDGB 4MD5B 5L6YL 2PYEB 5I6XC 4UT6H 3AS3A 4M00A 4O2FA 5MERA 1I9JL 3GUTA 3MLWH 2UWEF 3RNQB 1UPSA 3MR9B 4LEXL 5DK3A 3TH4T 4N0YL 2APFA 3GI9L 4KTYA 3CFJA 3PWNB 1W72A 3KPQB 5CKAA 4YC2C 1EGJA 4XHJD 4NN7C 5FYLH 3HAEG 2OVUA 1YPZE 4ZUWB 1FZMB 4XVJL 4KV5F 3INUH 4G8EA 4YM3A 5KW9L 3AC0A 5KS9F 5KXBA 4MYEA 1OAZH 1RMFL 3LN4A 4HLZH 3R8BB 5DZOA 5F7KC 1GPOL 4NN6C 5ESAA 4MAYB 4WY7H 3H3BC 1I1EA 4LVEA 1V00A 3SCMD 1IEAA 5IFAL 4ELKB 4C56D 1BX2A 2B2XL 3CXDH 3ECBB 4JY5L 5F7HA 5DQJB 5BOPA 2NY0D 1UL9A 2JD4A 2G4IA 1JZ6A 4TRPL 5ITBL 2P3JA 1QHOA 4HDIB 1PG7X 1CICC 1DEDA 3LKRB 4O4YL 4HKXB 1VADA 2QKIB 4YR6B 2SEBA 2ZUXA 3WEXA 5EDXA 5I30L 2DQDH 3DUHA 3OAUH 3QZWB 1GBGA 2QADC 4X7SL 4HUVA 4FZEH 1KJLA 1U58A 1WW6A 1CGVA 1G1CA 3HAEA 2YS4A 3I50H 3AZYA 3M07A 4B7LA 3GB7A 3KPNB 1IKQA 1WTLA 4HWNA 5CJOH 1A14H 4Y20B 2X40A 3EOBB 43CAB 2A6WA 1U9KA 1M7DA 4H0IA 2FEEI 2V7HA 5DVOA 2NY1B 1FJ1B 1GGUA 2BHUA 4G7YH 3GJFH 1V6JA 1Q9WB 4O51A 4Z77B 4PJCE 4PLJD 3KYOA 1DCLA 3ARQA 4YHYC 4JHAL 3X13B 4KXZH 4SLIA 1K4CB 4ZFOA 1YECH 2XWBA 2ICCA 3RKDC 4WENB 1RJYA 2HKFH 4XP9H 2JJTA 2ATPA 5HGBA 1QSEA 4FPOB 3LSDA 4LLWA 1G9CA 2E51A 1XAUA 3BPLB 4PB9H 5SWSD 1EEQA 5C0IB 3MJ9A 2ZMKA 3WG4A 3MRJA 1G9NC 4HUUA 1OD7A 2YC1B 5IK3B 1EERB 4J3VA 4KTDL 1BM3L 1WW5A 5E08H 3LKNB 5JZ7D 4TOYH 3KPMB 1GOGA 3PV6A 3LV3A 3EJYD 3GSOB 5DZFA 5K33A 2R0KH 1BZ7B 1IT9H 3VFRA 3NFPA 2ZHMA 1EDQA 2HLAA 4U3XA 4NN5B 3IJYB 1ND0A 2VSDA 5CWSB 5D1QB 2A3XA 4RA3A 3C5ZB 1QG3A 1MVUA 1AHWA 5IKCB 2APXA 3F7YA 3QJFA 4Q6IB 3KPTA 5IESH 2JELL 1T89A 2NNAB 4PJHF 5HDBF 2JKBA 1CIDA 2ZHLA 1REIA 5FKPB 5I1GH 3E2HB 4XGZB 2OQJB 4XHQA 4ETYA 4OCYH 3ULVC 2NW3B 4BH7A 3QPXH 4OCRH 5J4MA 4YFLI 4KUZH 5D7LE 4CRQA 2YRZA 1KJ2H 1AH1A 3FOLB 4KY1H 3LKPB 5JMOC 3RY6C 8FABB 2FLBT 1FG2B 1C5BH 1AF9A 5KSAD 3EYFA 1XCQB 3BPCA 2VLJB 4PG9B 1CFTA 2UUDK 3VRJA 5JHDD 1ZA3B 1TNMA 4Y19B 4EI5C 4NFDA 1N6UA 4U0RB 1MRFH 5SWQA 3GBMH 1LEMA 4OLVL 2F54A 3LSOA 1S7SA 4MQXD 1JYXA 3Q6GL 3SH3A 1INEL 2PTTB 4PV9B 1MFBH 1OAZL 1U8KB 3HA0A 3RWIA 4JHWL 3W0WA 3DMMC 4ZS7H 4C1XA 4JG1L 1S7XB 2D9CA 2UZYB 2IBGA 3SQBA 4X5XA 3RZCC 4TUKL 3B9DA 4MXVE 2VW2A 5T1MA 1K5NB 5TE7H 4OB5H 4RMSA 3AB0B 5BV7H 2GYSA 3QG6B 1WBZA 4DQAA 2OSLA 3C2SA 2B4CC 1P7QB 2J5LC 4HSQA 3O0VA 5JOYA 2DQDL 1BJMA 2PHWA 1KPVB 2W39A 5D2NB 1II4E 1FV2A 3EAKA 3HE7C 4PJ9D 2VISA 4YHLH 3ZT7A 1ULCA 5E8OB 1NCWH 1S1AA 4P3DA 4TQEH 2YEZB 5CJBA 4GALA 3WUWG 1A0QH 3NIDE 3QIUD 5MHSE 3R06A 4G9DA 3PVOA 4S2SA 2YOCA 3I50L 4X6EB 4YBLC 4YGEA 1MRCL 3HUJF 3EDFA 4Y7MA 5BS0B 1DUZA 3OX8B 4P9YA 3KDMA 2CDFB 3FQXB 4U4BA 1GYAA 4EIGB 3MRCB 1I3RA 1RZIB 3BH9A 1FFNA 4K07A 3KPSA 1P53A 2KBGA 2J8UF 1NCDL 2Y9RT 1N5AB 2VRAA 3MLRH 4R96A 1W6QB 2FO1A 3U0PB 1OP3K 2IEPA 2Y6SD 1A4JA 4XP1L 2J8HA 1X6NA 5D5MB 1JPFB 2HKFL 3W9EB 1PZ5B 3RPKA 5E2WL 1LEIB 3NZHH 1BEYH 2WK2A 5C6TH 3MC0A 3MUGB 4GBXA 3RWEA 2VAAA 4MXWL 3KR3L 1LP9A 5KSBA 1DQ0A 5IMMB 5GRUH 5IP4A 4KRNA 2XV6B 1IGCL 1RULL 5F70A 3QULA 2GY5A 3X3FH 5IB2B 1MCJA 5HBBA 3O41A 3M1BA 5EIIA 1CN4A 4M3CA 5GZCA 4C56E 3QDJA 3WUWA 4G9FA 3K46A 2Z91A 3GNMH 3ZYOA 3JWOC 3DTXB 5C2UB 2R0KL 3TPKA 1GRWA 4CU8A 4YAQA 3IDNA 1QSED 4H20L 3BN9C 5FCSH 1INQB 5GJTH 5ABDE 5C0EB 3FB8A 4BFIB 4G6AC 1YNKL 3SE9L 3V6OE 4Y4FA 5I73B 3RAJH 4KROD 3BDXA 4U6YB 5MI0B 3T4AB 3W82A 2CK0L 4OCRL 4OCWL 5FYJL 3T4YA 5HDQH 2DICA 5I76A 3EZJB 1NL0H 2EE9A 4OQTH 3BGMB 4NM4L 3BMVA 1S9VB 2R0LL 2Z93A 4F80A 1U42A 1P69B 4YHZL 4U1GC 1PQZA 3K1DA 1EHXA 2P5ED 5J11B 5HYSB 4Q74A 1KEGH 4OZIE 4TSAL 5T3ZD 1CVSC 4FG6C 3BWUC 2EH7H 3BIKB 4IDLA 3IPVA 3DO3A 3CX5K 1HWHB 1P4IH 1SFYA 3MRMB 2EXWC 4FPYA 3W2DL 4QXGH 5B3JF 2L7JA 1Q9LA 3TPUA 3B2UC 5D9SB 2VTFA 2FIKA 4OZFH 2B1HH 5GLZA 1BQSA 3I6GA 5GRYA 5F7LB 3NN8B 3MV01 4R2GB 4X6CE 4NNYB 1C5DA 4HIHB 2DM7A 2HFGL 3DI2B 3O3BA 4D9LL 2W60A 3U46B 3VA6A 3HRZB 4MVBC 5IHUL 1QKQA 5IOPB 1GZWA 2J6EL 1IQWH 1PY4A 5T1DH 1IAOA 2DKUA 4ZOCA 4R7NA 1ED3A 1Q0XL 1LVEA 2OL3A 1BZ9B 5BV7L 1N2RA 5DVKA 5C9KA 3UTSE 2EDRA 3MUJA 3L3OB 2BNRB 3FHQA 1HXMB 2VB5A 3SPVB 5GZFA 4Z7NE 1DBKH 3WDVA 2F54D 4MMXC 4XJAA 4YM2A 1CD9B 1PEZA 3RPIA 5GLWA 2F74B 4G8GB 1I1FB 1UH4A 2XTJD 1G84A 1BFVH 1NCWL 4CJ1A 1VACA 2AJ3B 3CVHA 1FC2D 3BGAA 4TQEL 4JFQB 4WI4A 2QADD 3K8LA 4LPCA 2D43A 2J7LA 2DD8H 1Y18B 1VFOA 2JIXB 2Y5TB 2H6PB 5EFIA 1A3LL 1BD2B 4FZ8L 4WWKA 4YW3A 5IVXA 2ARJA 1U0AA 4I2XB 3HN1A 3GSXB 2GNDA 5CZVL 3D25A 4LF3B 1Z2KA 3ZTNL 4Z7VF 5JHDE 1RUKL 1KRIA 1ZS8B 1K4DB 4R9DA 1FIGH 1LDPH 4DGYL 3CH1B 1WBFA 1YO8A 1WIUA 1R5IA 3QB7C 4S0TD 1NCBL 2Q7NA 5IHZB 1JZ5A 1BEYL 4EBQH 3PV7A 5C0RH 2UU8A 4NZTL 3G9VA 1JI1A 5CGYC 5C0GA 5J06A 3UYOD 4ZFZB 1D5IH 4IRJD 3FOMB 5MP6L 1T22B 4FNLL 5DXWA 3CDGA 3GSNB 3C5JB 1JPGA 1CDIA 1XGTA 1CFNB 1DEEA 4IDJL 4E9LA 4Q9QL 2X4QA 1SBSH 1WT5A 5BVPL 5BZDA 4BK4A 1T1XA 5DD6B 4PJDA 3MUY1 3MPCA 4NT6A 3WIIH 3G08B 3LIZL 3RWGB 1IQDB 5DJDB 1WQVT 3FO9A 4GBXD 1GKBA 1N4XL 4RFNC 1BF8A 1EZVY 1OTUC 2BFVL 1JP5A 2DJ4A 2QQNL 3VGHA 5K9OB 2XB6C 4X8XA 1BVKB 3RAJL 1LNUB 1R6VA 4Y4KA 5CJXC 5CLTA 1QFWM 3FRPG 1GNZA 2DB8A 1MRDH 1NEZG 2BVQB 3ARED 3QDJD 4G9FD 4X0KA 4ZAKB 3ZLQC 1HQRA 3VGGA 4TSCL 4FFZH 2J8OA 1F3DJ 3RWJA 4XMKL 1U93A 5AYQA 2J12B 2R56H 3MRFB 4AIZB 3ULVD 3SH5A 2EEDA 5ESQB 3UC0L 1QR1A 1JTTA 4LSRL 5GRVK 2VXUL 3HC0A 4F7CA 1W6MA 2DLHA 4V1DB 2IG2H 5IW6B 2GTWB 1YN7B 4WFHD 5KG9B 4BA8A 3TIDA 4RMRA 4TULL 3MRGA 3KLAB 4N1EA 2F53A 1P84K 2ATKA 4GKNB 3SISA 1K2DA 3QUYA 3EYQC 4Z7WF 4LNVA 2B1HL 4MAYC 4ZO7A 3WDJA 2YKLH 3QUKA 2FECL 4HUXA 1I85C 2LVEA 1N59A 5F9AC 3S37L 3FQNA 4LOUC 2ID5A 1DZBA 3FRPA 1V7NH 5DD5L 3S6CA 1IKFH 1NEZA 2P5WB 2AGSA 3UMTA 3V4PL 1VFBB 4EI6A 1W6PA 3W58A 3VMOA 3B3IB 4TUOA 4L5FH 4NZJA 4ODVH 1NDMA 2H45A 4ZD3H 2X9WA 3ILPA 2IQ9H 2N7AA 4JFDD 1QSEE 1IGTB 2YD7A 4KQ3H 2D2OA 4HH9B 1DBKL 3H7BB 1D5MB 2Z9TA 2W08A 2CDGA 2ZABA 3ZYIA 5F9WB 2FBJH 1RZFL 1A78A 1KT2B 3WNMA 4WFFD 5F44A 4OM1H 1MF2H 2AK1H 4NOFA 4GKYA 1H30A 1BFVL 4YHIA 2F19H 4S1QH 2VZTA 2GSGB 5HGDB 1NKRA 3E3QE 1OGAD 4KXZI 4GRLA 1FN4A 3D9AL 4QRPA 2JJVA 4I13B 1KFAH 5HVFB 4LLVA 1GOHA 5L2JB 4WDIB 4LPTA 3S88L 3QA3A 3DVNA 2HT2C 4OD2A 1JI2A 1UM4H 5I74B 5T3ZE 3B9KA 4WI2A 1MCDA 2DMKA 2WP3T 4I0PA 1GGIL 3O2VH 4U1NA 5FUOH 1OSZB 1NLDL 3G6AB 1YY8B 1WV7T 3VE0B 1N0XL 1LDPL 3PWPA 3BPLC 2CQVA 3WFDL 2DLFL 1ZV5A 1ZVSA 3NTCH 2BY0A 3V5DA 5LGKA 2BVTA 1ZTXH 1CGYA 2R69L 3QHFH 4XBPA 1TZIB 2ZGRA 1IKNA 4M7LH 5C0RL 3NA4A 4WWKD 3WUDA 2VL5A 8CGTA 5FM5M 1D5IL 3DI3B 2IALA 1YMHB 5D7IF 5E1HB 4JM2A 3IXTB 2G5BA 4I18B 5D1QC 4CKVX 1AGBB 5HYJD 2EE6A 3C5ZC 3U0WH 3ZDYF 4PJ8B 5L8JB 4XPBL 1FH5H 1VHPA 1XH3A 2DQJL 4Q6IC 5CJ8A 2X70A 5JO5B 3WD5H 3WCYA 5L8KB 3RWHA 1MWAH 1N0LA 4FQCL 5I8KL 4AYUA 3GIVB 5I1KH 2F54E 3E2HC 3UL2A 1WCBA 4W6YB 2CUIA 2BRRL 3W0WE 2Q86A 3OPZH 2XTJE 5A2IH 4PBPA 2Q8AL 3NZ8A 5DJYA 3BP5A 5ICYA 3Q2CA 1TETH 4Q58C 4YHNA 4HKZA 1MVFA 4O2EB 4F9LC 2A73B 2I9TB 4C83A 2YUWA 1V6IA 4FFZL 5B22A 4WU7A 1Q9OB 1R3KB 2R56L 3H9HA 3OKLB 1YEGH 2HH0L 5E2JA 5IIEA 1A47A 4JZNB 1TJIH 4DOHE 3HR6A 5DRNB 4EN3D 2VU9A 1MI5A 3PXHA 5HHPB 4CVXB 2YD3A 3RWCA 2DYPA 3FQTB 2JE7A 4K9EC 2D03L 4F33B 5I2IB 2DQIL 4KVNL 5TDOB 2R1YB 1E27B 4G8FB 4FG6D 4Y4KD 3BEWA 5F3BB 2EYRA 5KVEL 3L7FA 5DJ6A 5CIPB 3WDUA 1KLGB 4ZOBA 4AG4H 3O8XB 4Y5YB 2BSTA 1J5OH 1LDSA 1MLCA 1J1PH 2NX5D 1JZ4A 3T0EB 3RL1A 3CFEB 4FOMA 1QOSA 1U8IB 2WLZA 2Y23A 4M48H 4IHOB 1ENRA 1VGEH 3VFNB 3DURA 3O81A 2C26A 2ZACA 2V5RA 2UURA 4PLKC 2V5SA 2XNAA 3O0RH 4JZOB 4S10A 3ZZ1A 3N35A 3NGBC 4MVBD 2OLDA 15C8L 4M1CD 1TZGH 2IQ9L 3MO1A 2A6IA 4UV7L 4K1ZA 4I4WB 4KKCD 5I9QB 4DFIA 3OSKA 4LBJA 4Y22B 4FQJH 3H0TA 3DIFA 3I8TA 1LP9E 3O6KL 5KSBE 4XPGH 5KVGL 4DK6A 2FBJL 5FOJA 4H5SA 2DN7A 1Q8VA 3S4SA 2AK1L 4RX4A 5DA0B 4DRVA 4NBYB 1KJMB 3C8DA 1S7TA 1U91B 4TN9A 3QDJE 4G9FE 4HIEB 5BW7A 1EFQA 3P77A 3TJHC 1BOGA 1SEBB 1U8OB 2GCYA 1RK1A 4L4TA 3Q5YA 4OFYD 2KPNA 1KIRB 4CDHA 1IGIL 5J6GB 3WDYA 1CK0L 1RU9H 3MXWH 3HNSL 1KG0A 5EU7C 1VKXA 3G6JA 3CFIC 2D6KA 4ONFL 1BLNB 5L9DH 3KHOA 4YGBA 3OHXB 3MRNA 3U1SL 1E4XH 4W6XB 5F1NB 4WFHE 3KWWB 3ZYPA 2FGWH 2CSPA 4S0SD 2PUQT 3RVVD 4DZBB 1TZHB 4DGVL 1XGUA 5B8CC 4QHLA 3OKOA 2G5RA 2R29H 3B83A 4JCLA 5IJKA 2ZBJA 2BSRB 5DUPL 2D3RA 3TC9A 4YLQT 4H8WC 4P59L 1DSFH 3QHFL 2VUOA 1I4FB 1X4XA 2GK0A 4PRNA 4QRPD 3EOAB 5E0QA 4C57C 3AYEA 4H0HB 4IIQB 43C9A 5F6HI 2BOCB 3ARSA 4JO2H 2A6DB 2F8XC 4LSUL 3RDTD 3SE4C 1ACZA 3B9KD 3EO9H 2XN9A 2D0HA 1YNTB 5LJYH 4EXKA 4U36A 3ULUH 1RSFA 4OZGB 1IRAY 4AWDA 1MS1A 2FJHB 3PWPD 4YK4B 1EPWA 3VFPB 3MREA 5GGTA 2XPGB 2HN7B 2AS5M 3ALWA 4YH6A 2CLRA 4WI8A 3C5SA 3UJIL 3BW9B 5MI0C 1G9MH 4TTDD 4WFFE 4PGDA 3FT2B 4O58H 3I02A 4LCCB 3BP6B 5EPMA 3FQWB 3O2WL 3UTZA 2FCBA 4NZRH 3SGKC 3ARTA 3MRDA 2HFEA 4LDLB 5KSUA 1O4YA 4LGRB 4XNXH 2NR6C 1U2HA 2UYLA 2H0BA 1A9BA 5JA9A 2VIRA 5J11C 1UJ3A 2DLGA 2F5AL 3ARDB 4WVWA 1B0RB 4EEEA 1UB6A 5FYKE 2H32B 3UXFA 4HKJA 5DJZA 5AWNL 3VXRA 4K55A 2FECI 1QO3A 5K9JH 5IVZA 4WHDA 3CX2A 4GAFB 3BAEH 3C6LB 4XCYB 2JB5H 4R4BB 1DQ5A 1R0AH 3T1FA 4YXLL 2P7TA 1R5WB 2HLFC 1UKTA 1IS5A 4LSSH 1KPRA 1VPOH 2ESVB 2VNCA 1NBVH 3FKUS 4JFYB 4NM8H 4JFXB 2RIKA 5DWUH 3FB7B 4XVTH 4R2GC 2Q8BL 4ZTOL 3A4UA 2OUJA 4JEGB 4LKXA 1KUMA 1J1PL 4XZUA 3VFGL 4ORZC 4KK8C 1RIHH 5F72S 1OTSD 5JR1H 4OQ1A 1O4ZA 3AX4A 3BOVA 5IVXE 1DBBH 5IB3A 3QH3A 4QHUA 1IKPA 1MI5D 4GSDH 1VGEL 1HXYB 2M26A 1KJ2B 4F3FB 1NCUA 1S7RB 4HKBB 3C6SA 2DYPD 1HOCA 4ISRA 2YXFA 5KZCB 1OT2A 1H0DB 1NKOA 2VDQL 3O0RL 3F7QA 2RCSL 1JHKL 4P4RB 3CMGA 3KM5A 1I8LA 5ERWA 3HE6B 4DPNA 1PYWA 2ZCLH 1UFUA 5E56A 3MFGB 4FQJL 3TZVA 3P30L 3MJGX 4EVNB 4XPGL 1G7YA 4DKEH 2PTVA 4NO4A 4ZS6D 3RWFA 5FF6A 4CMMB 3NCMA 4LCYB 3D0LB 4PB0H 4U1LA 5JOFB 4APQB 1M6OB 1RAMA 1OL0A 3BVNB 5DZLA 1CU4H 1DQQA 2BVPB 2P42B 2HVKA 1I8MB 1AGDB 2IQAA 2VXSL 3OTTA 3WXVL 4ZXBD 1LILA 3RGHA 3IRZA 4N0FA 3PXJA 3DYMA 3IJSB 5AZEL 5L0QB 4PJDE 4J3XA 1QUNA 5CJQL 4HMCA 2EXJA 5E7BA 2AI0H 2VR5A 4JJHA 1NPUA 4BZYA 1R3LB 5L9DL 3OAYH 4KKBD 5DUBB 1JGLH 5BV7B 1E4XL 2AEIT 2HT2D 3PDOB 3WZ1A 2A83B 4Z7QF 5F8QC 4LFHD 4RX4D 4DTGH 4GXUM 2CKBL 2IMMA 1QBLH 1X3DA 2EC8A 4JLRB 3V6ZA 2V9QA 2R29L 4L4TD 3ARVA 4LRIC 3BKML 2EIEA 4ETQA 1D3CA 2LU7A 1SLTA 5GGUA 4L3ED 3QR2A 4N5UA 3KS0H 3SO5A 3QBTB 2C3HA 4WW2A 5E00A 3CK0L 4OFIA 3HHRB 2R0WH 2QQKH 3EFFB 3WN5A 3D0VA 3GGWB 2VXVH 3GNEA 5K59E 3DJ9A 1ULGA 4UW4A 2CIKB 3FLTA 2VE6B 1J05B 3BZ4B 4NSKA 5IK5A 1QOTA 4HJ0D 3TJEH 3PJQA 1S7QB 3T0VA 2OMBA 2VLMD 2VR9A 1NLBL 5BVJA 1KYOJ 1IC4L 3I3EA 4UI2A 4NZRL 1PLGH 4PJ5B 4KC3B 4UNVA 2WWMC 1H15B 1EAJA 4PUBH 2FYYB 1B4JH 4XNXL 4PJIA 2ZGOA 1BJQA 4N8PA 5T5NG 2VERN 3BSZH 5GS0H 1T7ZA 4HIIA 1A7PH 3O3DB 3WIHH 2Y36L 3TN0A 3CU1A 2CLZA 5TFSH 4L1HA 1NFDA 2D4DA 3F7VA 2I07A 3MJ8A 4YBQD 1QYGH 2HWZH 4JFEA 4JQXA 3FUOA 4Z0XA 5DUMH 3VWKB 4KKNA 3RP1A 3FFDA 1CE6B 2Z4QA 1FZJA 2EDWA 3BAEL 1J8HB 4RWYH 5HTSA 3SO3B 9CGTA 1R0AL 4NO0B 3N1FC 3DXAA 4MNHB 1T1WA 3NBNA 3O9WA 3BEVA 1VPOL 1AD9B 4YDVA 3O6FB 1KDMA 4XVTL 3VFWB 4BQBA 3ILQD 3PGCA 4QRPE 4YFLF 5FK9B 1EEZB 1ZANL 5J3HD 4QOKB 4GMSH 1FQ9C 4GSDL 4NUJB 4KDTA 3IFOB 1FFOA 5D6CA 4CNIB 4YZ1A 3BP4A 1X4ZA 5E94A 4TPRL 3UO1L 4PJ7B 2DF3A 4ORGA 4U6VH 3T2TA 5J12B 5F6HJ 3PWPE 3B6SA 3L6FA 4ALAH 2FHCA 3AUVA 4XJ8A 2NTSP 1FLRH 3TBWA 1LO3H 1YYNA 2R1DA 5CMAA 2UWEA 4NJAH 4U49A 3P40A 4G80A 2ZZUT 1AR1D 4NO5A 3PMEA 5FKAA 1SLLA 3KYAA 4D0CB 2GSIB 3VG9B 2ITDB 4NQDA 1I75A 2C3XA 3FFZA 3TYFB 3O2DL 1VALA 1FGVL 2BVYA 1CFSA 3Q6FB 3D39B 4EUPG 5KS9A 1JYIA 2ZGSA 4AM0A 1YN6B 5I74C 4E41A 3OGCB 2HTLC 1QA9B 4Y1XA 3NABH 2FEDD 1E6JL 3O12A 3CSBA 5HHNB 3UJTL 4UT9H 5DVNA 2X4TA 1JGLL 2UWBA 1WGOA 1VESA 3D85B 4OV5A 2I24N 3MRBA 1A6AB 3NV3A 1WZ1H 4FVVA 3RUGF 2I27N 4P9HL 4GQPH 1Y0LB 2B7DT 3QJHB 2VDLH 3FMGH 1KPUB 3TA3B 4R26H 1FVEA 4D3CL 3J7HA 2NY2B 3I6KB 2DLEA 1BQLL 1GC1L 1XR9A 3LN5B 1DQDL 5IJVA 4GW1B 5FYKU 1IGYB 4M8QA 3DVGB 2MCPH 1A3QA 5E8NB 2ZGUA 2DBLL 4OZ4B 4P9ML 1FAIH 1MI5E 2BRQA 5EC1A 5HPOA 3VFMA 3RQ3A 5IMOB 4FP2A 1MLBB 1N8ZB 4PJ8C 1AY1L 1XF5B 3B3QE 4JAMB 3P9LB 4PRDA 4YUEH 4WHTB 2R0WL 2BDNH 3GMLB 5CFHA 1QLEL 4EUPA 1UZZA 5LAXB 2XA3A 3OKDA 1CFV