2C9AA

Crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
259
structure length
259
Chain Sequence
b'ETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE MU
publication title Molecular Analysis of Receptor Protein Tyrosine Phosphatase Mu-Mediated Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 259
sequence length 259
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF00629 MAM MAM domain, meprin/A5/mu
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c9aA02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c9aA01
3VMPA 1V3LA 3O6FA 3B2VL 3EOAB 4ONGH 1XIWB 4OCYL 5L7XL 3O6ML 4G9FD 3QI9C 3GKWL 1F45A 3QFDA 3JBG7 5IK3A 4YZ3A 4IDJL 3H6JA 4D9QD 4R0LC 1NCAH 1R3KB 1JV5B 2JJSA 2NY7L 3P73B 4PJHB 5T3XE 1CLYH 1RIRA 3DURA 4KKNA 5FGCB 2CLRB 4HFWB 3HAEA 4G8GB 1J9CT 2ZUQC 1BQUA 3V5KB 3ZVXA 4OD2A 3AZXA 1JUFA 1MFDL 5HD8C 4O2CB 2ZUVA 3V6OC 3T0AA 2Z35B 5E24E 4OM1L 4LBEA 5KW9H 5DHVA 4NQEA 5FV1L 2NYYA 1AGFA 1Q9KA 5D7LB 3GALA 4OLVL 1VGEL 3DSFL 3WFCH 2W68A 1OW0A 1ZEAL 2X89D 2MQ0A 4OZFH 4MQ7B 2C3VA 2D6KA 2EXJA 1J1OL 1MFAH 2CDEA 1OTUD 2EXWC 2P4AB 2GIYA 1LU1A 5KVMC 3GSVA 1XCTB 3G6DH 2R15A 3FQUA 1J10A 5I1EH 4UW6A 3ZE0E 1DN2A 1VEPA 2DYCA 4RNRA 4JFED 3T0EA 4KMTL 3KM5A 1XMWA 4LCCA 5E6ZA 3V0VA 1F5WA 3QEGL 2Z93B 4HXBH 2M8XA 5IGXH 5I18L 3GSRA 4IS6A 4X9HA 4DTGL 1OVZA 2VR5A 1TTGA 2DQGH 3ES6A 1IFHL 1OWWA 4D0BA 7FABH 5CCKH 4DKDC 3X3FH 5TDOA 4DVRL 1RK0A 1HYSC 2ADJB 3OXRB 3FBYA 2EE2A 3TO4D 1VFAB 3LN4B 5K59F 5I1LB 1F9KA 4PRNB 3JWDH 2KDGA 4O9HL 4ZD3L 5I15L 5ID0A 2WIMA 2W65A 3RPKA 1MHPH 1JWMA 5T50A 2B7YA 5KVFL 4FTVD 2X42A 1WLDA 3N1GC 1WZLA 5D7JD 4N0UA 1XGTB 3QEHA 5T3ZH 2CUIA 2Y4SA 5DSCB 4ZAKA 1MCJA 4U1GB 1S0DA 4KJPC 1LEKB 3KLDA 2GN3A 1I1EA 1F8TL 2Q86B 1QEWA 2DIJA 1NLBH 1S8DB 43C9B 3BIKA 2PELA 5HGAA 4LHQB 4CVXB 1J86A 5BZWB 3GJFH 1EA9C 1REIA 3B6SB 5F6HI 4TUOB 1X9QA 4MAUL 2G9HA 4ZUVB 4CADB 4X6CF 5EH1A 1S7RA 2QKIA 3Q5TA 4V1DE 1U0QA 4PRBB 2QL1A 3C6LA 4U36A 4UBDC 2AGJL 2OK0L 4LCIH 4WI8A 1FGVH 1JW6A 3AREC 4XAWH 4WJ5B 5FHBH 2YPLE 1GAFL 5DD0L 1NMBH 3MR9A 3I75B 1X5AA 4H5SB 4OF3A 5DQ9A 1PKQE 4K9EL 4D2NA 4YW5A 1K9TA 2BSSA 3FT2B 1X6LA 5GXBB 4WU7B 5DD3L 3HKFA 4HWUA 5MI0B 1NAKH 3N9GL 4JJ5A 1RJCA 3D1MC 3G5ZA 1WCSA 1G7YA 4QCIA 3SHSA 3D6GA 4YXHL 3WL9A 4MQTB 5IMMB 3GNEA 4I2XB 4S1QH 5IQ7L 3JV0A 2X1XR 1JPGB 4J1UB 5HD8D 3TJHD 4IRZH 3SE4A 2YD5A 5DJ2A 5GGVY 4KKBC 3V6FA 1NJ9B 1DQDH 4LLUB 3DHJA 2CR3A 1T4KB 4YWGL 3F7PC 3PABB 3F12A 4U1KB 3WLUA 4N8PA 4U1MA 1H3TA 4WTZG 1T66C 4EI5A 1HHIA 1GZPB 4LGPB 2YBRB 3R4DA 3WUWG 2K1MA 1ZHLB 5E7BA 4EBQH 3IB4A 3ZXFA 4Z9KB 1YEFH 1FL3A 2GJ6D 1DBAH 4H8WC 4ZXBB 1UZ6F 4NHCL 1KCRH 2J8UB 1I3UA 4JPVH 2HKFL 2D7FA 1OHQA 1XGRB 4UV4L 5EORL 1D5IH 1CTNA 1C12B 1GJIA 4YLQT 4LCUA 3TT1L 1Q9OB 3SKJH 5C92A 4PJXB 4W6YB 2OTPA 3VXRD 2BNQB 4XAKD 1HK6A 2QSCL 3T1WA 3H3KA 4R9HA 1H9PA 3GMRB 2GSIB 3RA7H 4CNIA 1JRHH 3BAEH 4ZOCA 1FDLL 1J1PL 5D1ZC 4CU6A 3BO8B 1F4XL 2RIKA 2WUBL 1ACYL 3GMNA 3W9DA 2AENA 5CILL 4GS7B 3CMGA 1C5DA 2VLKD 1QR1B 2FL5A 4JDTH 4OZFA 4YK4B 2CRMA 3LB6C 1Z9SA 2Q6WB 2ADIA 4OKVB 3J8F7 5T5FL 1ZLUH 1A6UH 3PGFL 4MDJB 1IS3A 1A3KA 1YQ2A 3FRUA 2AK4A 4Z7VE 4WVWA 3CK0L 1DDHB 1G9NL 4I3GA 4YDJA 5CGTA 5J6HB 3VWJB 2YXSA 4BH8A 2ZOLB 3MLXH 4SLIA 2QADD 4XB7A 4R3SB 1GLHA 1WBLA 2FATH 1AXKA 1NANH 2JB5H 4HX1B 5TGBB 1UACL 3ARTA 3DV6A 3FO2A 1XCQB 4NZRH 3MNZA 4UBDD 1OSPH 4A6YH 4L5FH 2GK2A 2VXQL 2X4OB 4GAYA 3BUTA 4M5YL 4F9LA 3OB0K 2VZOA 3ZYRA 3BE1L 4HLJA 1N1TA 1M6OA 4PY8I 4MXQD 3RZCA 4JZOB 4DVBB 1D0HA 2L4OA 5J12B 3FB6A 5GGUB 2RQ8A 4D69A 3MOBH 2UYLB 3CDFA 3RWIB 4C4KO 5BXFA 1W6QA 3VXSB 2G4IA 3PMEA 5D6CB 5ACMA 4OZHF 2C7UA 4LVNB 4U49A 4Z7NE 3T09A 3RIAK 4LSUL 4R26H 4NYLB 4IHOB 1E28A 4JY5H 2F54D 2AXGB 1MJJB 4KKBD 1CWVA 1FFPA 1JRHI 1U8KA 4PJEF 3GJFA 3KPRE 1F3DH 3E2HB 4L3EB 1Z0HA 2D7QA 3L7FA 3LQZA 4DFIA 1NGPL 2GITA 3LKNB 1UX6A 1T66D 3RY5A 2V2WB 5EU4B 3SE9H 3TCLB 3OJ2C 4DOHB 5HPMA 3DLQR 4ONGL 1LHUA 3RY4A 4NNYB 2NR6C 3G5YA 5DK2A 1WLWA 1UVQB 4JVPA 1CN1A 2P8PB 3LH2H 3IF1A 3NFNB 1Q1JH 4JGUA 2A5ZA 3ASIA 2Q76B 3SDAC 3D9AH 4J4PA 1EV2E 4PJFB 1F3JB 3IGAA 5E99L 1CLYL 3VXNB 3QXAA 4NKMA 2H3NB 1GGYA 1GZ9A 4MX7B 4PJGF 1K4DA 3A6OA 2F8VA 4N0YH 1NANI 2VUYA 5HI4C 4HKBB 4P5TC 4CTEA 2HJFA 5DZGA 1UMZA 4M7JH 5E5RB 4O02H 5KW9L 2VAAB 1VGKA 3RGHA 4HKJB 2XZQL 5DLMH 1V3JA 3WFCL 3ARYA 1WC7A 2COQA 3LB6D 2RHPA 4WGWB 5KSUA 4EEEA 1AFVH 3ZSLA 1MIMH 3MW2A 3FFZA 5HGDB 3VXTB 4R90H 3IDMB 3DX7B 4L8SB 1CPNA 2NXZD 3BQUC 4UT9H 3TNMB 4HKZB 4HGMA 3FJTA 5AD0A 3F58H 4OZIE 3G6DL 3UBXB 4HUUA 3LSOB 2GSGB 2D0FA 3KPSD 4PTTA 1JNNH 1T1WB 4C59B 3WJLC 1SEBB 5J3HD 1A1MB 4CGTA 1S0EA 4P4RA 1E6JL 3IDXL 2FX7H 2D4FA 5E8OA 4X99A 1B9ZA 1CQYA 1T83C 3C60C 5IGXL 4TVPH 2MQ3A 2GMEA 2DQGL 5IROA 3OJVC 7FABL 1LQSR 1XR9A 4FQCH 3WO4B 4AEEA 5CCKL 1F5FA 3B9KA 5IWLC 3LDBC 2X9XA 3GIZH 1MCQA 2F8XC 3DVNA 4HJJH 1KEMH 5DG1A 4YFDB 4MNHB 1QG3A 4MNQD 2VZSA 1ZK9A 3MJGX 3MZTA 1S3KH 2A9MH 4LLQB 3C5JA 4GKNB 3HS0A 4NQTA 2V2XA 1A22B 1MHPL 3F6IA 4LHJB 4HS3A 4KJYA 4PGZA 3ISWA 4Y1AB 3S3SA 1OB1A 1SLIA 2XPGB 3HPJB 3BZEB 1JPFA 3PL6C 1DLLA 1G1CA 5EC1A 3RWHA 1LOFC 1I3GH 5D9SA 4C57C 2AYHA 1PQZB 1XEDA 1RZKC 4NRXA 3UTZB 3I6LE 1YA5A 3AYEA 4BYHA 4YQXL 2R2BB 2W0KA 5F7HA 1QBBA 1NLBL 3WS6C 3UK9A 1UGNA 3I85A 4M4RA 3AVEA 1BHGA 2VC2H 1G1YA 4GRWB 2ERFA 5TE4H 4Z0XB 5JHDE 4PR5B 5IK3B 3C9NB 1OLLA 3L3IA 1IQWH 4TPRH 1J0YA 5CZVH 1F00I 2P48B 4X4MA 5D7IF 2OJZH 1T0MB 4A6YA 1R5IA 1NUDA 4RX4D 3VXPA 3GJEB 4LCIL 3DURB 1FGVL 2J8HA 2NR6D 2NY2C 1MHHA 1RV6X 4XAWL 5FHBL 3K4AA 2GNDA 4GRMA 1BZ7A 1NMBL 1JP5A 4GG6E 4OD2B 4GAJH 2D7TH 1K6QH 2R1YA 2DI9A 5L6YH 3SDAD 2IALB 2E9JA 3RIFK 4YBLC 1I7ZA 2B2XH 2EH8H 2ICWB 4FQIH 5F71A 1QNYA 3LIZH 1NAKL 3R1GH 5DHVB 4M43H 5ANME 4P9MH 1JBJA 1H5BB 1AGFB 3HZVA 1GC1C 2H32B 2ADGB 3MFFA 5F7EH 1DN0B 4BFGA 1VAMA 5L88H 4FPOB 1N6UA 2DL9A 2CDEB 3ESUF 4IRZL 5MERA 2VMFA 3GSVB 4IOFC 3DVFA 1CPMA 2WWMC 1DQDL 4ZTPH 2OZ4L 3ILFA 3ROOA 2LQRA 4OV6F 4RNRB 3HMXH 4YPGB 5CJBA 2D43A 4LCCB 1J88A 2PTUA 4ZS7H 1P7QA 3EOBB 3WS3A 1FYHB 1NCCL 2OVUA 5D5MB 2FEDD 1GH7A 5F1SA 4LIQH 4EBQL 1EXUA 2V9QA 4B7LA 3BH9B 4QRTB 1JHKH 5C07B 1OGAD 1MHEA 1QFUH 3ES6B 1U8QA 3BKMH 4LBQA 4ELMB 5TDOB 5BVJB 4UV7H 1KCRL 1RK0B 2XFXB 4JPVL 2FLBT 2B4CC 1BZQK 1IEBA 1B09A 3C60D 2UWAA 3SKJL 4H0IA 2W65B 2VLRB 4MXVE 4Q6IA 3C8KB 3OR7A 4FFVC 2BY3A 4XRCB 4Y5XB 4CMMB 4UTBH 3RA7L 1JRHL 3BAEL 4YHIA 1P7HL 3DXAD 2WNEA 1CIDA 2NP0A 4JREC 3QEHB 1JFQL 3T1FB 3MLWH 1HXYA 3JVGA 4OLWH 2ZGNA 4LCWE 4ZAKB 2P5WD 3QZWA 2VB5A 4JB9H 1R3IL 1JTOA 4TYUA 3AS1A 4JDTL 1VACB 3SJVE 5CP3H 1PG7H 1XF4B 4NO4A 3SDCB 5ITFB 4EDWH 4X9BA 1U8NB 4WEUD 3RVTC 1A8JH 3VI4F 2VE6A 3BIKB 1A6UL 4LDEB 4MD0B 1D9KA 3PL6D 3PV6B 1AGEA 2BNUA 3RRQA 2W0LA 4XGZB 2YPVH 3HZKA 1GRWA 1LOBA 4FXLA 1S7RB 4JM2A 4K8RH 2NMSA 4CJ0A 2VIRA 3HFMH 1H8OA 3VFTA 4OLZH 2XTLA 4RAVB 1S1AA 3MLXL 1KCLA 5AAMA 4PG9A 3MR9B 3BEWA 2FATL 4LRIC 5DQ9B 4LU5H 1XF3A 4OGZA 4I0PB 2JB5L 5CBLA 2XG4A 3BH8A 1WAAE 1MI5E 1T20B 3PWVB 5ACZA 4NZRL 2CSPA 1TCRA 4HGWA 3OTTA 4IRJB 4A6YL 4L5FL 3T3MF 2PO6C 2NY2D 4ISVB 3QDMA 4W81A 3WL9B 5INDB 2R2CA 4KTEH 3NAAH 1NGQH 2IADA 4FOVA 1VAVA 1JPSH 2X4SA 1W72H 2OM5A 3MRRB 5DJ2B 4AL8H 2DLHA 3N35A 5GGRB 1HXMA 3CFDA 4YXKH 1KIUA 4L1HA 4N90E 4CMHC 3VXQA 4Y4KC 3F12B 3LEXB 5B22A 4HUXB 5IVXB 2V5MA 1CDIA 5HDQH 4U1MB 5I17A 1WIUA 4P14A 1FNGB 2YN5A 1ERNA 3M45A 4EI5B 1JMXA 3KJ4B 4RCAA 5IMOA 1LO2H 4R26L 4FOYA 3MYJB 3MREA 5E9DA 4JY5L 3BODA 3HN1A 2ZSVB 1TZIB 4UI2A 3VMNA 4PGEA 4F33B 2WWMD 1FL3B 4WVRA 5I74B 3T77A 2ILLA 5H35A 5GGRY 4JCKA 2F19H 3SE9L 4Z8BA 1L7TL 3UYPA 1RMFL 1A6ZB 3UDWC 3VFVA 1OT1A 5JPNB 1HKFA 5C0CE 1WFNA 1BYHA 2VW2A 3IRPX 1CXFA 3D69B 3R06B 1LESA 3LH2L 4UQ2A 5HYFA 1Q1JL 4QRRA 2C9AA 3D9AL 2QHLA 1CE1H 1YPZB 4WY7H 3FFCA 1FIGH 1RUAH 4PJCA 5MEOA 2FL5B 1AP2A 3IXTA 1IM3B 1ZE3C 4FFVD 4KU1A 3H3BC 1XH3A 4Y5VC 4HH9A 5H9SA 4N0YL 5JOWA 3TYFA 3H9SD 4XDQA 3SCMB 2AK4B 1BM3H 4O02L 1OD9A 1OCWH 5HYJE 1W0WB 1ULCA 4YDJB 3HMXA 5FYKU 4N8VA 3TYGH 3DETD 5DEGA 4PJ9A 3VI3E 1WGOA 3CH1A 4BH8B 1AFVL 3RVTD 5IJVB 1BQLH 1MIML 4P99A 1UYWH 3WD5H 2UVEA 4R90L 2OR7A 1NSNH 2Y7QA 3GSNH 1LP9B 4UT9L 2W59A 2LTQC 3F58L 1RAMA 4K21A 1KG0A 5EO0A 4ZYKB 3FO2B 1JNNL 2VQTA 1PDKA 3MNZB 4ZKTB 5FUZH 1AKJB 1QA9A 2F53E 4MCZA 2FX7L 3NPSC 2JE9A 4OGYH 1QLFA 4GAYB 4NQCE 3S36X 1ZXQA 1CD8A 2FHBA 1YC8A 4XZUA 4HH8A 3UJTL 5E8EA 2NY0C 1M6OB 3DIFA 3RZCB 4YHNA 1JNHA 1LHVA 1AXTH 1MRFL 3H0TA 3PDOA 3GIZL 3L3DB 5LCVH 5GGSB 4HJJL 2PO6D 1GNZA 1KEML 1TJHH 5FFLA 3QG6A 1QRND 1S3KL 5CP3A 1XQNA 4TNVF 1URLA 1V7MH 2ARBA 2BNRD 5J4MA 2HT4D 4FFZL 4WHCA 3MUJA 1I7UA 1FFPB 2DQCH 1U8KB 5C0EA 1JI1A 4ATEA 3V0BB 4MAYB 4Y4KD 3BMWA 5FUOH 3ZDXE 1I3GL 3LQZB 2ID5A 4OIAA 2GITB 1C08B 5HVWA 1N5YH 4UNTA 1KYOK 5GGSY 3G9AB 3TIEA 3GO1H 2EIEA 3WHE1 1PZ7A 5DJ8B 4M1GL 1JZ8A 5DK2B 4QNPE 3R0MA 4LRNH 5T3XD 2VC2L 5TE4L 4QOKA 1Y7BA 5TDPB 5FYLE 3PJSA 4WW1A 3TBYA 5JW3H 3EO0A 4OLXH 5CZVL 5FIEA 5IR1A 4RISH 5IVZA 4JHBA 2FX8H 4APQC 3IGAB 5L8KB 2OJZL 3BESR 3QXAB 4NKMB 2OMNA 4OF8A 2FEEI 1SLBA 3FB7B 1EHLL 4NQDE 1UZZA 3DRQB 4I8DA 1B88A 4P9HC 1W72A 3UTSA 2D7TL 1K6QL 3WHTA 4H55A 5L6YL 1ZHBB 3TH4T 2PYFA 4XC1H 3HHRB 4LSPH 2EDEA 3H42L 3QSKB 3V79C 2B2XL 2EH8L 4FQIL 5EZOL 5TDNB 3RVXC 1N5AA 3D39E 3V4UH 3R1GL 1IS5A 3FQRA 4M43L 4U6XB 1VGKB 5C1MB 4P9ML 1CD0A 1EFXA 4XILA 2QTEA 3FT4A 4WWKB 3S5LB 1PY4A 1WCQA 2B1HH 3IDJA 3A67H 1CD9B 3CFEB 1U8LA 1U36A 5L88L 3I84A 1FHGA 4LAQH 4YGEA 5FF6B 2QHRH 2V9TA 1INQA 1CQ9A 2R16A 4Y26A 3H0OA 3I50H 4GW1A 2C1OA 3BRGC 3APBA 3AZZA 4H0HB 4G6FB 5AD0B 4ZTPL 1CZ8H 2H1PH 4HHAA 4HUUB 5D2NA 5L0QB 4YAQB 3HMXL 4DUWA 1LOAA 3H7BA 3GUTA 4P4RB 4ZS7L 3N06B 1D2SA 4U3CA 1D5MB 4E41E 4LIQL 2QSVA 3ORJA 1N3NA 4UTAH 5L2KD 4Z8FH 4WW2F 3VD4A 5J9PA 1QFUL 1QSVA 3TN0B 1XR9B 2QSTA 3ULSB 4RWYH 3B9KB 1AIFB 2Z0BA 1AHWA 4XCCH 1X5JA 3GMOA 3GJFK 1QNWA 5B39G 1MCKA 4ZODA 3RFZC 2P2KA 5H2BA 1ADQA 4PBOA 4F83A 2EEAA 1I7TA 3D3VD 5EU7E 1Y6MR 2NY0D 4P23B 3B9CA 4PRHA 4P9XA 3DX9A 4M8VA 4UTBL 4PD4J 5DZEA 5DZLA 4HUVA 4UDUA 1A0QH 1OB1B 3IFOA 1JPFB 4KROB 5EC1B 3MLWL 5C0BD 1CR9H 1CU4L 4OLWL 3X13A 5IB1A 3S88H 3WDVA 4Y20A 3WE6A 4JB9L 1BZ9B 4KQ3H 1BJ1J 1PG7L 2EDQA 2FGZA 1M7IB 4EDWL 3OKDA 4LDLB 4Z7WA 2NY1D 5GLVA 4V1DD 3GSNA 2YZ4A 4L9LC 4JFFA 1F4AA 2R4SL 4JFPB 2EDHA 1RZJC 3GSUB 1DBNA 2V7NB 2YPLD 5DUXA 3SKMA 1YNLH 3MZGB 3WLBB 2WQRA 4FN0A 1FFOA 3HFML 1R5IB 5A2LH 4OLZL 2R0ZH 5K33A 5D7SH 4JZJA 3VXUB 3KNBB 1MHHB 1AXSA 1T7XA 1EZVX 5K9QG 4Y5YC 4GRMB 2Z31A 1BZ7B 2ZUSA 5E95B 3UAJC 2GUOB 2UWEB 3CFIC 4LU5L 5FA4A 1Y18A 1MVEA 3T1LA 2DLGA 1IJ9A 4LASH 4CVWA 2X7LA 3VD5A 4QXUH 2BCKB 4HV8A 3TEUA 5KTEH 3ALXA 1FAKT 2B7DT 1SBFA 4OF5A 1TPXB 1FYTB 5BS0E 4Z7QE 3OJMB 3HZVB 5DFVD 1V00A 1VLNA 2GMMA 3QH3B 1FVDA 3OL2A 4KTEL 3ARRA 3NAAL 2ZGUA 3QUYB 4IIQB 4PJAA 2CLVA 1NCBH 1ORQB 4U3HA 4ZMAT 1JPSL 4KK9D 1VENA 1W72L 2B1AH 5ERWA 3HC3H 3FUQA 5E2WH 3O6KH 4AL8L 4RQQA 2BVOB 4YDVA 4P3CL 4YXKL 4L4JA 2NY6C 4BQ8A 3ROOB 1Q9WB 1MH5B 1K3ZA 5HDQL 1AXZA 5IVNA 4MD5A 2GTZA 3WS3B 2CGRH 1P7QB 2XB6C 1SMAA 2VN4A 1K8IB 3B8SA 3FMGH 4AYFA 1BWWA 5CUSH 1P9MA 1T7ZA 3WG4A 4NWTH 4LBQB 3ARFB 1ZLUK 4HBQA 4G80B 1JGUH 2XV6B 4WHTA 3QCVH 2F19L 4YHLL 1FC1A 5AAWA 3BXNA 4I0KA 3ALPA 5IW1B 5KANG 1JGLH 4Q6IB 4FQZA 4PJ5B 1XAUA 1FATA 3OR7B 5LGKA 2BXZA 4CDGC 2N7BA 3HI1B 4YHIB 4FZEH 4OGXH 3TA3D 3BKYH 1SBBA 2IBZY 5FOBA 4WY7L 1NKOA 1OP3H 1FIGL 4UUJA 1T5XB 3RG0A 1RUAL 3QZWB 3REVB 5DRXB 1ADQL 3S7GA 3QNZA 4UU9A 2CXKA 4O2FB 2VE6B 3V0AC 1J8HB 1BM3L 5EZJA 3HZKB 1OCWL 5AYUH 3FTGA 1MRCH 3TYGL 1B0WA 1UKGA 1KTLA 2IFFH 1MCSA 4YZ4A 2FEEL 1MCHA 4S1DC 1UYWL 3WD5L 4PG9B 1JPTH 4D3CH 4U2ZA 1HSAA 1OY3B 5GS1B 4KZEL 1NSNL 5EO9A 2A3WA 1S7UA 1XF3B 3QAZC 5IBTH 3OSKA 3BH8B 4YFLI 2P5EA 2W91A 5ACZB 1JHTB 2NXYD 3HE6C 4M48H 1BPVA 1JBCA 4HGWB 2B8OT 3T2TA 1V6OA 3C5ZA 3QDMB 1UQSA 4OGYL 1I1YA 1L0QA 4P5MB 3K81A 3UAJD 2IADB 2N1KA 3SGDH 2ARJQ 5IW6A 3HE7A 1K85A 2JELH 4FXGA 4G42B 4WEBH 3EYOA 4K7PX 4BK4A 1I9IH 1AXTL 1YN6A 2DVBA 3OGCA 3CFDB 2R29H 4MXWH 5LCVL 3VXQB 3U79A 1TJHL 4EN3A 4YW1A 1UWEH 5D1XA 3ZO0A 1UKSA 3KPRD 5KG9A 1ZT7B 5ECJE 4FQ1L 4P46C 1N1VA 3MREB 3MV8E 2H2PC 1I85A 4NIKB 3TPKA 3AROA 1NCDH 2Y07L 4CL7A 5FAAA 2DQCL 5LKNA 3T77B 4HJ0C 2NY6D 3VWKD 3CDGB 5FUOL 2DMCA 2BY1A 1IILE 1N5YL 2DTMH 1KFAH 1CXLA 1YYML 3CSBA 3BP6A 1RI8A 2IGFH 1VFBA 3T04D 3UC0H 3VFVB 1SLLA 4LRNL 4JFXB 2R8SH 3P0VH 5HVGB 5JUEH 2XT1B 1G7QB 2YZ8A 1MWAH 5GRJH 4LLDB 1TZHB 5JW3L 5K9OA 4OLXL 5MEPA 4RISL 1U2CA 3QDGA 2FX8L 1CVSC 5FDWB 4I13B 2Y6SC 1S9VA 1U58A 3CGTA 1ZOXA 3MRJA 3VCLA 1W0OA 4LMQE 4J8RA 3VDBA 4A2MA 4PG2C 3NZ8B 5BV7C 3WHUA 3ARGC 3QIUD 3BWAA 4JLRA 3DVIA 3PP3H 4U31A 5IFJB 2YKLL 1VHPA 5DHXB 4XC1L 4LSPL 3TYFB 1ONAA 3EDJA 3MGOB 4J3UA 3BRDA 2DD8H 4XNYH 2DM7A 1GBGA 4AEFA 4YIQA 5DMKA 3AY4A 4N8VB 3RGVC 1CGYA 5DEGB 5KSBA 1BBJB 3D2UD 4JO2H 4PJ9B 2D6OX 1LGCA 3A67L 3CH1B 1NEZA 1CVNA 3QEQD 3SGDI 5HXMA 2QHRL 1NUGA 5TFSH 3IJYA 2EKJA 1AQDB 3I50L 2PYEE 2FMDA 1Y0LB 4UDTA 4BLJA 1ETZA 1MUJB 1B4JH 2CDGB 2H1PL 3O8XB 3FQNA 3DYOA 3SKOA 4ZSOA 3HC0B 3N1MC 4S1DD 3UPCA 4S1SL 1I9EA 3CSYA 3UJIH 2X6MA 4MGXA 5C09E 3ZDZF 4H1LH 3NV1A 4UTAL 5BZDB 5GS0D 1Q8PA 5E8EB 3ZXKA 4OUOA 3AK0A 5DEZA 1I8MB 4RBPH 4B5EA 5GJ6A 2FGWH 3QWRA 3PQYD 3RWCB 1OPGL 3RPIB 1LOEA 3N7KA 1M71A 4RWYL 3PDOB 4AT6A 5B3NA 5DC4B 5IJKC 1DCLA 5IB4B 1S7QA 2FSEA 4R97C 3WUCA 3QG6B 3WHE0 2LVCA 2XNAB 3FO0L 3VFRB 3BP5A 3TPUA 2NX5A 4Z7UE 4LSQH 1CE6A 1VDGA 5KS9F 2ZGTA 1DR9A 1WZMA 3VXOB 3I6LD 5LBSH 2ZG3A 1F02I 1A0QL 2M2DA 5CJOH 3VUOA 2J88H 4NZDA 1ZLVH 2HVJA 4RMRA 3S88L 1G7LA 5DUPH 3WN5C 5JHDD 3OQ3B 3SGKA 3KJ6H 4KQ3L 3QUZA 2CNAA 2H2PD 4I1NB 4F8TA 5C0RL 5EPMA 2D31B 3U48A 5IM7A 1WLHA 4QOKB 4PJBF 1NC4B 4HUWB 4JRXB 4P2OA 3RWGB 3PJSB 1A1NA 3TBYB 1Z0NA 3WSQH 2DDQH 2W0FA 5IR1B 1N26A 5IVZB 5DUWA 1YNLL 4OAWA 3VFOB 3WJJA 4LARH 4IMLA 3BP4A 1RK1B 5D7SL 5TQ0H 3O4LB 1PSKH 2EALA 3ZT6A 5CEYA 4G9FA 3NIFF 3TBTB 2F74A 4G43A 4HZAA 1UM4H 1W72B 3UTSB 1MCLA 3T2PA 4LASL 2PYFB 4QXUL 1QZ1A 2C5DC 1B0GA 3MODH 2Y6SD 1N5AB 5A2JH 3RNQA 1CFTA 4HEPG 4IMKC 1UWXH 1DBJH 2YD8A 3IDJB 3DX8A 3ARGD 3DTXA 4WGVB 5KSAB 4NC1E 1NCBL 2BOCA 5DI8A 5F9JA 4MYEA 4M3JA 4NDMA 3MGTA 1INQB 3SDDB 5E2WL 2AJXH 3L2YA 3IETA 4U1LA 3HR5A 4WUUB 1N8ZA 4HHAB 5D2NB 2DN7A 2WK2A 3PVOA 4G9DA 3K4ZA 1QBAA 5JOZA 3H7BB 5HY9B 3GUTB 2X89A 2CGRL 1W6PA 5HHOE 4L8CA 3VJ6B 1N3NB 4LSDA 5IUQA 3O3AA 5CUSL 1NFDA 2XN9D 3K8KA 5HHPA 4NWTL 3MUGA 5K9JH 1MWAA 3H2WA 3S9DB 1JGUL 1HHGA 3BZ4A 4JFEA 1DIWA 3QCVL 5EO1B 3GSQA 3U1SH 2CKBH 4L4TE 5HDLA 1CDYA 3AAZA 2CH8A 4X6DA 2EZ0D 2XTJB 1JGLL 1I7TB 2ZGLA 5C7XH 4PRHB 5C0DA 3IPVA 1G7JA 4N9GA 4LCWD 3HUJE 1CLZH 4G6AD 4OGXL 2J6EH 3BKYL 5AZEH 1SBDA 3IFOB 3TO4A 3CFCH 4OCWL 5F7UA 1MFCH 2CRYA 3K7UA 2DB8A 2EYSB 1PFCA 2ARJA 3RL1B 5JDJA 2E27H 3MLYH 1HHKB 3Q6GH 4Z7WB 5CNAA 4FTVA 1U8JA 1Y6KR 1MS5A 1T1XB 4ZUSA 5D7JA 1VFUA 1MVUA 3LD8B 3U0PA 4PJHE 1L6XA 3SKMB 5DS8B 4PJDE 5IB3A 1HCFX 4RIRB 1HWGB 5FGCE 1MRCL 2IFFL 5F7MC 5FB8B 4YO0A 4G8GE 2A6YA 2YPKA 4DGIL 1MJ7L 3MROB 3BWUC 4H1LA 4D3CL 2EECA 4F7CA 4PJ8C 5FA4B 1Y18B 5IBTL 4DZ8B 3FZUC 2VY0A 3SPVB 5IEKB 2NTFA 3MCKA 3I2CL 5I66A 1W0PA 2YUVA 3HI6H 5D7LE 2YC1B 4M48L 3AJYA 4UB0H 1CICC 5ICXA 1I8KA 4Z78B 5D93C 1FVDB 2OXHA 2Q3ZA 1KIRA 4XCEA 3X3GH 3MRLA 4PJAB 5F93C 2WM0A 2CLVB 1QHPA 3LZFL 3QXTA 3A0OA 4N90D 4H8WH 2W9LA 1HNGA 1KLUA 4PJCE 2ZOKA 4R0LA 4M3CF 2AQ3A 4LPUA 3FO1B 2YEZA 4RQQB 1I9IL 3VGBA 5F1NA 3INAA 3TBWA 4KV5E 2Y5EA 5FYKD 4LLWA 1UWEL 2Z92A 1IAIM 4JHZA 4LOUD 4XJ8A 5A43C 1A14H 4OZGA 3LY6A 4MWFA 5E4IA 4PJ7A 4ODBD 4Y2DC 1FNHA 1NCDL 2D6LX 4WO4C 2EIZA 4NSKA 5CIPH 5C9JB 4HLZH 2FO1A 1DQQB 2EE3A 5JMCA 1N64H 2HLAA 5C0CD 2DTML 1KFAL 4GWNA 3S35X 5FHAH 4AIOA 2Q7YA 3P30H 3VGAB 3KPQB 3U46A 5GSVA 3BXNB 1YEHH 2IGFL 4ETQB 1C8PA 3TIDA 1S5IH 1N3PA 1FH5H 1HDMB 3UBXG 2R8SL 3QO0A 4I4WB 3HB3C 3P0VL 1FPTH 5JUEL 4MQXC 1WBFA 1HQ4B 1MWAL 4X5WA 4BUGA 2I9TA 1MS1A 3WHXB 1X6NA 2Y1VA 5D71H 5FOBB 3T2QA 2RAMA 3Q48A 3NIDE 3QQ4B 2XYCA 2MCG1 3UXFA 1YEEH 1QLEH 4FQ4A 1NMCC 4U1IB 1QR4A 3Q2CA 4OJFH 3F7YA 2ZMKA 5HYJD 1BGXH 1L0XA 1NBZA 4LSSH 1ZVHA 1JF1B 2DD8L 2W60B 4XNYL 1NDMB 5I8CB 1QFWM 2VLKA 1KT2A 3FTGB 4M6AA 1LCLA 5T1MA 3BD5A 4JO2L 3QNYA 1WV7T 3MJ8A 3TV3H 4P48A 1LU2A 2DLFH 5TQ2H 2E6PA 3VKNA 5TFSL 3HA0A 2X44D 2J12B 1A2YA 2X41A 4P3DA 2F53D 1S7UB 1IKNC 3P9LA 2RFXA 35C8H 2YD9A 4WI5A 5T1LB 5EU7C 1MR5A 4PJIB 4JG1H 1AO7D 5I1DA 2CKBA 2VISA 3C5ZB 1WJ3A 3B9EA 1RUKH 1UQSB 1CF8L 4M03A 1X5IA 3KAAA 4I5BA 1B0RA 4PJ8D 5IW6B 4M9PA 4R9BA 4Y1YA 3O2DH 5IK8A 4J3VA 4NN6B 3FZUD 5JHLH 4FQXB 2J6EA 2EC9T 3OGCB 2OSLA 3X14B 4M6ML 1CICD 1UC6A 4ISQA 4XP6H 2Y06L 3AREA 4GSDH 5D1XB 3T0DA 3POSA 2MOVA 1HILA 3CXHJ 3QR2A 4LSQL 5KG9B 4XT1C 4Z18A 4J3SA 2WT1A 4RZCA 3ULVF 3RBGA 5CJOL 2AKRB 1OQOA 2J88L 4R4BB 5C8JA 3MA9H 1RJLA 3QNXA 1LDSA 1Z5LB 5DUPL 3UX9B 2BSTB 1JHLH 3WEXA 3BP6B 5FYLD 5ACLA 4Y2DD 2F54A 3MRKA 1G9DA 4WO4D 4MA1C 5T1DL 3WSQL 2DDQL 4NQDD 4XPGH 4HIJB 5IIEA 1FZOB 2A6WA 4LARL 1ZVSB 4YR6A 3MRJB 3VCLB 4PGDB 5TQ0L 1PSKL 4N5EC 5JW5A 1WBZA 3D39D 2ITDB 1S78C 1RINA 3HB3D 1FAIH 2A75A 5GRUH 3BWAB 1NGWB 4MB5A 1UM4L 4MQXD 4U1JA 3TVMC 3NFPB 4YHKH 5SWZB 1OP5H 3O12A 3O4OC 3MODL 3T65A 2PHWA 1KCVH 3RMYA 2AJYH 2FECI 1EO7A 2W38A 2ZBJA 3MMEA 1JWUB 4RMUA 1DBJL 4QHKJ 2DQFA 3MPPG 4LP5A 4ZO8A 4LL9A 1MCWW 3ARQA 3HPLA 1WT5C 3EZJB 4FPCA 4X7TA 3EIFA 3IJYB 4U1SA 3KS0J 3ULVD 5D1ZA 1IEAA 4PUBL 5CIPA 2AJXL 4UDTB 4KFZC 3UTOA 2APVA 3DJ9A 5ETUA 4E41D 4P2RA 3U30B 2EDRA 3SKOB 2ZSWB 1NFIB 3C2UA 3EDDA 4YXLH 4Q1PA 3VRJA 4XMIA 1WBYB 1U8IA 1JI2A 4QYOA 3JWDC 4R4FH 4O51B 2Q8AL 1N3QA 4F9LC 3TO2B 1QBMH 5FA3A 3E6HB 3TNNB 5I8KH 3B3IB 1C16A 5F8QC 5CBAB 2VAJA 1RZKH 3KPSA 5EUOF 2A6KA 1AGCA 3M3QA 1Z3GL 3P40A 3WNMA 4KTDH 2AJ3B 3AYDA 1S7QB 2R0KH 3L95B 4IOIA 4XP4H 3U1SL 3CU7A 4WFFE 1GZQA 2NX5B 5DMJB 1NBYB 1PZ5A 5C7XL 5H94A 2MQCA 2DI8A 2OMBA 1N2RA 4KKAC 4PV8A 1CLZL 4Q74A 1RZIA 4L3EE 4KRPB 5AZEL 4XCYB 3CFCL 4Y16C 1MFCL 2HVJB 4MJ6A 5A16B 3QXVA 4MNQA 4JN2A 2EXHA 3FHQA 1IM9D 4DOHE 1P84K 3QXWA 3W11D 1H3UA 5FCSH 1BD2B 3MLYL 4IBLT 5EPMB 1XF2B 4FQQB 5IM7B 3UTTB 4OV5A 2HRLA 3OAUH 4DZBA 2CKNA 1KJMA 4UZGA 3KQRA 5EWIH 1NEUA 1MCWM 3PWJA 5B8CC 5JPMA 4OI9A 4QXGH 5DC0A 1FNZA 1GC1H 2D0GA 2XY2A 2VH9A 2EEBA 4UINH 4CDHA 5CMAA 2CUMA 3LAFA 4P9YA 4QHMB 2F74B 2IH1A 3O2DA 4G43B 4QLRA 1WFOA 3CXDH 4JAMB 4PRPB 2G60H 4P57A 3U36A 3IVKA 3HI6L 1MAMH 4NN7B 1TFHA 1CFTB 3I3DA 3O3EA 3BJ91 1M7DB 4RX4A 1K8DA 4UB0L 4N5ED 5HHME 1RIVL 1S78D 3DX8B 3X3GL 5IMLA 4XPTH 1AJKA 1I1CA 2BOCB 3TVMD 5F9JB 4H8WL 3ARDC 4NDMB 4HBCH 3RUGA 3VFNA 4NNXB 4BOWA 2J4WL 3BN3B 3SDAA 4BKLA 3IDIA 2E7BA 4G7YH 1RJYA 3RRDA 4JFOB 1F90H 4JJHA 4OZFG 3HCVA 1A4KB 5ILTH 2I26N 4PRIB 1B2WH 4AYUA 2HN7A 4K3GA 3BHBA 2GK0A 1OP3K 1P7KB 3FN0L 2ATKB 4L8CB 2WZPD 4P5TA 2EDTA 4HGKC 4U6TA 4QTHA 2DWDB 2J2ZA 2FNBA 1W8OA 4OFDA 1NMAL 1OAQH 4F7EA 3MUGB 2UUDH 1MWAB 1Q56A 4Y4HD 1N64L 2O93L 2NMNA 5DD6B 3WG2A 3JSSA 1INDH 4J6RH 2X4RA 4F7PA 1F6AB 3MRGA 1R5VA 3W0WB 2BSRB 1YEHL 2FIRT 2V2TA 1DVFB 4X6DB 3O0WA 3LKOA 1FH5L 1VA9A 3BQUA 5DXDA 1TQCC 5C0DB 3IPVB 1J0JA 1A47A 1RZGB 1LE5A 4X4ZA 1FPTL 5AEAA 4Y1AE 2Z4QB 5KXCA 1YYLH 5E5UB 4LFHG 1N3OA 1XGQB 5D71L 1LGBA 2H26A 4FMKA 1T83A 3C60A 3AYAA 1JGDA 2OCFD 3JV5A 2EDFA 1YY9C 4HF5H 4OJFL 5C0FA 1RITA 1FFNA 2DTYA 1P4BH 2EYTA 1X5FA 4KKAD 3OAYK 5CEZD 1BGXL 4FTVB 1G6RH 1ZSDA 4LSSL 4Y16D 3DXAA 1MVUB 3PGDB 5E00A 4PP1D 2ZPKL 2P5WA 1U8HA 1QLRA 1HI6A 3KPOA 4YO0B 1B4RA 4CRPA 5E4EC 2YPKB 4ONHB 4MLSA 3OKLA 3P9MA 3IDNA 4PV9A 4JGJA 1RZ8A 3TV3L 2DLFL 2P24B 1F4HA 2DYPB 2EXYC 4NT6A 3WFBH 3PL6A 4YDLB 35C8L 5GZDA 4AIZB 3MCKB 2JK5A 3PIQA 2AV7A 1R6VA 4GKOA 4X6FB 5JDSA 2HJKA 1UJ3A 5GZCA 1FNEB 5ICXB 5J13B 4E0RA 3WS6A 1A6AB 1RUKL 2W0PA 3QDGE 3QI9B 1CR7A 1KIRB 4XCEB 1W6NB 3MRLB 2PTTA 2X4QA 1M05B 5T3XH 3O2DL 1Z2KA 2EDOA 2CIIB 1YJDC 3KPMB 4R0LB 1S7XB 4WFEE 3JUUA 2MCPH 2CDFB 1MNUH 3TBWB 3M3EA 4FPHA 3MV8D 3NCMA 1LENA 2EDJA 5J89A 4GSDL 5DGRA 3P77A 1ZGLP 4J3WA 4BZYA 2VW1A 2C26A 3LOWA 5D5ME 1F4YH 3VXMB 3ARDD 3QIBD 2BVUA 1VEOA 2XWJB 4GO6B 1BX2B 4OZGB 2CIKB 1BMGA 5C07E 4MWFB 4PJ7B 1HHJB 3NCCB 4N0FA 4I9WE 2WINB 4ELME 4KK6D 1GZWB 4NSKB 4LAJH 4WUKH 3S5LG 4ZS6D 1NDGB 3PP3K 2H6PA 1XF5B 3MA9L 3MXVH 4DW2H 3QQNA 1URXA 1JHLL 5E2UH 3U46B 2APWA 4RRPG 1AI1H 3HNTL 2VLRE 5GSVB 3TBSB 3O0RH 3WNLA 1I8IA 1AR1D 2ZZJA 1Q8SA 4MQSB 5JOPE 2HFFA 1S7SA 1C1EH 5GZNC 5KS9B 4X5WB 2W92A 2I9TB 2L7JA 1AGBA 2MMXA 1OAXH 4XPGL 3M3CA 4NC1C 3IJHA 3JVGC 5DUBB 5CAZA 2VDLL 3IFLL 2IAMC 2VUOA 3G6JF 5JW4R 2X4UA 2YR3A 4MD4A 5EIIA 4LVOC 1KEGH 1Q9LB 3E8UH 1FN4B 1FAIL 1A7PH 5GRUL 1LGVA 3F7YB 3MPCA 1TVBA 1D9KC 4HPOH 1NBZB 5CJQH 4YHKL 5DJXA 4JFYA 4OFVA 1KCVL 4HMDA 5FM5M 1CONA 2AJYL 3EYUH 4RBPK 2GDFA 1UZYA 3QUXC 1RHHA 2VLKB 3VG9C 3WFDL 4GALA 3NCEB 5T1MB 2JJUA 2PYED 5C0AB 3S6CA 3ZSTA 3HRPA 5F1OB 3O3BB 1HEZB 1XGPB 1DQ1A 2CK2A 2XKNB 4AEHL 1A2YB 2A77H 3RJQB 4P3DB 3WYRA 3P9LB 5GPRA 1DSFH 4OIIH 4NQUA 2Y72A 2ZG1A 2V5YA 5C09D 3DI2B 2V9RA 1T1ZA 4YXLL 5DC9B 5HYQA 3AB0C 4R4FL 1ZLVK 4FQLH 4LCYB 1CFBA 2EXYD 1QBML 3NCJL 3KWWA 4MDIA 5GRXG 1BJQA 4WDIA 2X40A 5F8RC 1KJVB 4C4KT 4NN5C 4G9FE 4FFWC 5I8KL 4FPYA 3EGSA 1RZKL 3B2UC 2OL3H 1TNMA 5IVXE 4KTDL 4D9QE 2AJZB 1BFOB 3LRHA 4JGMA 3AREB 2R0KL 4XP4L 2A1WH 5ICZB 3GBLA 1YZZA 4BLIA 3KHQA 1MCPH 1HILB 4LHUB 4MJ4A 4JFDA 4LRIA 3VH8A 1VPOH 4PRAA 1T3FA 1DQ2A 1I3HA 1G6RA 4LDOB 4QRPA 4RZCB 4FABH 1T5WA 3C5SB 2NW2A 3RHWF 2SBAA 3EYVA 3P9WB 3I02A 5EWSA 2PO6A 3JTSA 4LLYA 2BFVH 2GNBA 5GZFA 2PTVA 1CGTA 2HH0H 4S2SA 1I75A 3VD3A 5D1QC 5CZKA 3WEXB 4P9HH 4XBGA 1UWXK 3DROA 1EEYA 1J1XH 2R1WA 5DFTA 4ZNEE 4M4PA 4Y88A 4W6XB 4Y4KA 3CSPA 5I71C 3DO7A 4OI8A 5L9DH 4MCYA 4ASMB 1YPZE 1GC1L 5IIEB 1HE7A 3QEUB 5HYSB 3B5GA 3WIFB 2O26U 4UINL 4YR6B 2IMMA 1IQDB 4WNQB 1JE6A 1KIQB 1EDQA 5JW5B 1BJ1H 3ZKQD 5GZND 1OT2A 4U1JB 2YOCA 2X9YA 3QA3A 1JN6B 3RTQC 4I18A 4X7FC 3KG5A 2P7TB 2D6MA 4OM0H 2BERA 1JGVH 1OD7A 1MAML 2IAMD 5DUMH 2VDRL 3QUKA 5SWQA 3WNKA 3OKOA 3UDWA 3LKQA 1ZWIA 4QRQA 4XPTL 3HPLB 2PW2A 4AMKH 5JA9A 4HBCL 2JJVA 5ESQA 2NY4B 4U1SB 4PJHF 4X4XA 5D1ZB 2A73A 2B4CL 4P4KB 1LO3H 3QZWG 3QUXD 4JY6B 2DM4A 1F90L 4LK4A 4K2UH 3CNKA 1BOGA 4M1CC 4P2RB 5HHOD 3HLAA 2PKDA 5ILTL 3BISA 4Y4FB 1B2WL 3VRJB 1EUUA 2NN8A 1AGDA 4I77H 2JF1A 1QGLA 3DGGA 1QSEB 1DQJB 3VKOA 4Y19E 2RB8A 3QWQB 1CG9B 1T0PB 4JO3H 4XPAH 2V7HB 3SNMA 2VZUA 4U1GC 4L4TD 5DRWA 4ONOA 4YHYC 1PKOA 1R24A 4M3CB 3ABZA 4YPJA 4FOWA 1IGML 2DAVA 4HSQA 5DK0B 1IC5H 4AGVA 1INDL 4KHXH 4IOIB 4J6RL 3MUZ1 1MIEH 4U6HA 2VZVA 4R2GB 4ZUTA 2JCCF 2VL5A 3S37H 1GZQB 2DUOA 3C87A 1LEMA 1QQDB 3FONB 1PZ5B 4KV5F 5H94B 1F2QA 3L5WB 1RZJH 4P2QB 4YBQC 3P4MA 3B2UD 4P59H 4OQTH 4Z0BH 4ATFA 4PV8B 1XIWD 3U6RA 1YYLL 3V7AE 2IBZX 4LPCA 5C2BH 4C54A 2WW8A 2AR6A 3SDXF 3V52L 3I6KB 3ZXLA 4QF1A 1M7XA 2DQJH 1E4WH 4Q26A 4HF5L 5MI0C 1P4BL 2AXFA 1NQBA 3PXJA 3W39A 4OV5B 2P1YA 1KJMB 1PZ9A 5B3JF 1G6RL 1PX3A 4G8GD 3STLB 5F7NC 4CJ1A 1JMZA 3DI3B 3PWJB 5JPMB 5C0BA 1QSFE 5A2FA 3L5JA 5MEQA 1LEDA 3G5XA 1CN4A 1YO8A 4H26B 3KHOA 1GGIH 4OCRH 1S9WA 5DD5H 5CMAB 3JUYA 1HINL 4NO0B 5D7LD 1AXIB 3UJOA 4V1DA 3TF7C 3WFBL 3FOMB 1YNKL 2CTVA 3VU2A 3MRCA 2D3VA 2WLZA 2YPLA 5DG2A 4LBNA 3GFUA 2OL3A 4BSJA 3IVKB 2GJ6E 1GVIA 3V8CA 1PKQA 4X6CE 5DD1H 5FKPA 3OY8A 5DHYA 4K7FA 2HWZH 3MA7A 2YY1A 2DS4A 3UL2A 3U9UB 5E6IC 5D7KE 3ZKSD 4GRLB 5LGJB 1OSZB 5L2JA 4XBLA 5T3XL 2Y5TA 1YEIH 3RTQD 3RUGB 3VFNB 1T6VN 1ZA6A 1GANA 4WV1B 3VXRE 2MCPL 4NJAL 4NPYA 5FECA 3IDIB 1MNUL 5MENB 2KUTA 2OTUB 2WV3A 3ZZ1A 1GKBA 4NKQB 1VEMA 4BA8A 1IGTA 4HS6B 3HCVB 5JIIA 3AP7A 3P11H 2A0LC 3F65A 2MKLC 1WTGT 3L3KA 4O5LH 4PTUA 5BQ7A 1F4YL 4X4YA 2GK0B 3RVUD 3UO1L 1MELA 4P5TB 4GS7C 2APFA 1FNSL 4BM8A 3QULB 4MVBC 2RJMA 4WUKL 4N8VG 1YNTA 4YK4C 1FE8H 3MXVL 4OF7A 1BQHA 2ICEB 2VU9A 4DW2L 1KN2H 2NM1A 1EJ6A 3MRGB 1R5VB 2M1KA 5E8DH 5AWNH 3MCLH 3O0RL 1A5FL 2V2TB 2WANA 1L7IH 2AJSH 3BQUB 1QHOA 5KXBA 4LLMA 1C1EL 4JZNA 4ZFFB 1MS8A 3V5DA 1OAXL 1UZ6E 1LEIA 4XMPL 2KM2A 1WD4A 4CZSA 2H26B 2EXKA 2G75B 4OZ4B 4V2CB 1BOYA 1KEGL 1NBVH 4WFGE 5BOPA 3E8UL 1I8LC 2J8UF 5GS0H 5JLZA 1S9XA 2EYTB 1C5CH 5HYIA 3B5HA 1CLOL 3DWTA 3RIAF 4HPOL 3DGTA 1E4XH 2VXSH 3ULUF 3TA3A 3DXAB 1B6DA 4Q9BA 3EYUL 4PJXF 4QT5B 5DJCB 3LPWA 4MLIA 2ITCA 5KZCB 1PX4A 2P5WB 4NOTA 1U95A 4YE4H 1QLRB 4FNLH 3VXUE 4Z7VA 2PHTA 5CP7A 4NKOB 1W0VA 2R1BA 2LE9A 4CVZA 3BJLA 3P9MB 4PV9B 1TMCB 2Z31C 4P3WA 4XPHH 5F89A 3MEPA 4XNQB 5EBLA 5DTFA 5IHUH 3PL6B 1T89C 1DZQA 3BDBA 4MSWB 1N7MH 3CVIH 2ZJSH 3O5SA 3AFLA 4LF3B 1A1OB 4OB5H 4OIIL 1FYTE 4URTB 4GMSL 2VDNH 3OB0H 1S0JA 3I3BA 5AG8A 3L9RA 5GRWA 4MZ3A 4KQ4H 3GMMA 4WIQA 4ODUB 5HGBA 2FO4A 4FQLL 4CRQA 4S1RH 1G7IA 4K23L 2R23A 2D0HA 2PTTB 2FH6A 4IJ3C 4L9LA 4GKSB 5HJ3B 1HWHB 4LBLA 1LEGA 5I1CH 2GCYB 4OQTA 3S4SB 4HULB 4DWHA 1N59A 1ZS8A 2OL3L 1EVUA 1YECH 2YWYA 1J1TA 1HH9A 4PS4H 2A1WL 3H9HB 2EE6A 3P77B 4ZXBD 4DFSA 1MCPL 4Y5YA 3SE3C 3KGRA 4OCSH 3DRTB 2PF6A 4NUGL 2ZCLH 4RFEA 2H0BA 1S9KC 3P4OA 1VPOL 2FWOA 3JV4A 1FVCA 4P5KB 1LK3L 2D6NA 4PB9H 1Z9OA 4YBLB 3ULUD 1ULFA 5GSRB 3G08A 5EOTA 3ZSSA 4FABL 2BNQD 2A0LD 2BFVL 1OP5K 5EUOB 2HH0L 5BV7H 3KPRA 1KQRA 1QYGH 5C08E 4P9HL 2HG5B 4OZHE 5CGMA 1CBVH 1ZVYA 1I8IB 4PJ5E 1J1XL 3OBAA 5DWUH 3WBDA 1PG7X 2Q20A 1P69B 4MVBD 2VITA 1Y6NR 1E4XI 3VWKA 1GZCA 4PJEE 1AGBB 5L9DL 5JMOC 1IARB 2FYYB 1I1AC 4M9OA 3IJHB 5F21B 4L8SC 5JA8B 5JZ7C 2X4UB 3T0XA 1EAPB 3Q0HA 6CGTA 1CDGA 3DUUA 5JOFB 1CCZA 2BHYA 4NWUH 1UT9A 2LU7A 5I2IB 3VWJD 1J8HE 1TVBB 3MRBA 4F7TA 1DZBA 2WKKA 1EBPA 4CBPA 4JFYB 3PHOA 4OM0L 1U3HC 2VN7A 4Q7DA 5DUML 5F7FA 4XMKH 4NUJA 3WUZA 5JLVA 3WO4C 1C1LA 1FZMA 1FNYA 4PJGE 4AMKL 4RL7A 5KXDA 4PJFF 3AMLA 2H8PB 4LPTA 5IK5A 5HTSA 5IFAH 3EJYC 1LO3L 5GM0A 2VTFA 4K2UL 4ZPTA 4BH7A 1T1ZB 1HHHA 3ZL4H 1YMHB 4GXUM 3D2UA 4I77L 2VDKH 4GAGH 4OZIA 4TN9A 4KK5C 1SYSB 5DJ0A 1F4WH 3V0AA 2WSVA 4XTPA 3VXSD 4L4VB 3V6ZB 3KWWB 2MPAH 3O2WL 4MJIB 4WDIB 4XPAL 5F9TA 4NJ9H 4O2EA 4QKXB 3EGSB 4WFFD 3OYWA 1QNZL 4M61A 3QIWB 1ITCA 4TULH 4F58H 5I0ZA 1U8PA 5C0IA 3MV7E 1KELH 1IC5L 4XE9A 3RIFF 1LO5A 5SWSE 1MIEL 2GNTA 3TC9A 4L3ED 3S37L 3ETBF 4JFDB 1MCBA 1Z78A 4YZFF 3VH8B 4AQOA 4PRAB 4GKZB 1MCEA 3HNVH 2VXUH 1RZJL 3DMMC 3PQYA 1T3FB 5KJRL 4QGYA 4X0KA 4P59L 5DQDH 4Z0BL 4QRPB 4AVVA 3LPFA 3GB7B 2CXGA 3X11A 4BZ1H 3EYVB 4BFIA 3I02B 4OQ1A 2PO6B 5C2BL 3WNXA 1TJGH 2CJUL 4LLYB 4ELKA 4DN4H 5B4MC 3A6BL 2GAZA 3ATGA 2DQJL 1E4WL 4NRYB 3QBTB 3D0LA 4XHJC 1QP1A 4L9DA 2WLQA 3DROB 1BVZA 1CXKA 1BBDH 2IBGA 1T04A 2LU3A 2DMBA 4NO5A 4YZ5A 1UWGH 1X4YA 1LHNA 2EDNA 3IU3A 4KVNH 4Y4KB 1FV1A 2OYPA 4X6BA 4MCYB 2D2OA 4PGCA 4KRNA 3FAWA 5JHDA 4UNUA 5IQ9A 3U2SA 3S3JA 5JQHC 4P2CG 2X4NA 4KJQD 1MPAH 1GGIL 3ZYJA 5DD5L 2Z91A 3FFDA 2Q7NA 1R1ZA 3T3PE 5E2TH 3HC4H 5IOPB 1G7PA 1MLBA 1UZ8A 2EDKA 2XRAH 3AGVA 2DUQA 4HQQH 1OGAE 1VKXA 1UB5A 2HFEA 1Q8QA 1I1AD 3FN3A 4GG6A 1IC7H 3IAQA 3JV6A 4F9PC 1CD1B 1NAMH 3KDMA 2VABB 3FLTA 2UUDK 5DD1L 5JZ7D 2OP4H 5D7IE 4ZUWA 3UYOD 3WUWA 3OKEB 2HWZL 4GRWF 4CN4A 2EXIA 3LKQB 1ZWIB 3ARBC 1T22B 2DRUA 3RDTB 5JQ6H 1MZ5A 1U91B 1M1SA 5ANMA 3GMQB 1YEIL 5ESQB 4JO4H 1GV9A 5L8JB 4U0QB 2A73B 3MNVA 5I19H 1OAUH 2WT0A 5HHNB 4EDXB 2LU4A 4F2MB 4MB3A 3IKKA 1KPVB 3P11L 1RIUH 2R56H 2ICWJ 7CGTA 1EEZB 2RR3A 4O5LL 4PG2A 4Y5XC 1QDOA 4TNWF 3ARGA 2VLMD 4Y5VB 4TSAH 1A7RL 1ZTXH 1D5XA 2NNAA 1DEEA 2YA2A 4LSRL 3EJYD 5J11B 3GGWA 3ROLA 5EBMA 2AP2A 2X09A 5DRWB 2YUZA 4K55A 1R24B 4ZFGL 4DFHA 1FE8L 1KCUH 3E1F1 3SDCC 3RGVA 1MFBH 3POYA 4JFZH 2GALA 2VDOL 1HQRB 4Y1AD 1EZVY 1MCDA 1KN2L 4KK5D 4OIBA 3VDAA 5E8DL 2E53A 5AWNL 2ENSA 3MCLL 4ZUTB 2VL5B 1SCSA 2OW4A 4FOQA 5FEBA 1DLHA 2AJSL 1IKFH 2XN9A 3B4NA 3ILQC 4TQEH 2IANE 4XBPB 3WDTA 4GT7A 1TJIH 4ZTOH 2FJHA 4KDWA 1U92A 3NPSB 2G5RA 4C55A 1K2DA 4I0PC 4QF1B 4R7NB 1OM3H 2HVKB 4ELMF 5DURB 1L9MA 2NY0B 3VE0B 5T1KB 4LCWA 4IRJC 3CX5J 4JRXE 1VFMA 5CWSA 3OJDB 4P2OC 1HDKA 2VXSL 5IJKA 1LE9B 4Q9QH 4BQBA 2ZGMA 2VH5H 4CW1A 5B4MD 3IDGA 1MS3A 2EICA 1YEKH 1WSST 4YE4L 5FRAA 4FNLL 3G5XB 4XHJD 3O4LE 3CCHA 1S9WB 3G6JB 4KI5F 2R39A 4XPHL 4UW3A 5E2JA 4V1DB 4M62H 5DJZA 4YLZA 3VI4E 3FQXA 1Z9MA 1KXTB 1N7ML 3CVIL 2ZJSL 1DANT 2YPLB 1ZA4A 2ZWLT 3WN5A 3BZFB 2OL3B 4OLEA 3CFKA 2SEBB 2AI0H 5FKPB 5DHYB 3OY8B 5T55A 4KQ4L 1JYIA 3H8NA 4WFED 2W1NA 5FYLH 1F58L 3LRGA 1WAAA 1MI5A 2W9EH 3PWLA 3DBXA 5E8PA 3BOPA 4TNVK 4LKXA 5CD3A 4QHUB 3SY0A 1G9MC 2AREA 1CGUA 4OT1H 3EYFA 2HRPL 1TVHA 2ESVE 4DK3A 4WUUE 1QO3B 4APQB 3FOLA 3RWJA 1H3GA 1YECL 5C07D 3MRDA 3PWPB 2PNDA 1IGTB 1J0KA 3OAZH 2I07A 2MJWA 4I9WD 3ARBD 3T3ME 3KXFB 5BQ7B 2ZCLL 3S3PA 1A6TB 1DBBH 1BVKA 5JTWA 2Y9RT 3MLZH 1SJHB 2C5DA 4PB9L 4YGVB 3BPNB 2E9WA 5FGBC 5TH2A 2VLRD 4F3FA 4IMKA 4XNUL 4RA0C 1XT5A 4DS0A 4G8IA 3IAGC 3H9SE 2PW1A 5JOPD 1VERA 1ZLWH 2Q87A 1FZJA 1QYGL 4LPYA 3SCMC 3L3OA 1D3CA 1CBVL 3ULVH 4ZAKD 3GEWB 2CR6A 2KQMA 1LTEA 4OCXH 3BX7C 3PVEA 3MRFB 3F5WA 2N4IA 3H3PH 3AZVA 3SDCD 3OB8A 3O3DB 5E5MA 3RL2B 5C0CA 1NAMA 2X70A 3PDDA 4KAQH 4LPVA 2VR4A 4XNZC 1QVOA 2FR4A 3HG1B 4JO1L 3OKKB 3V9FA 4NFDA 3LN5A 3MV01 3THMH 1G6VK 3ILQD 5CD5D 1N4XH 4K7PY 3KPPA 4HS8H 1S9XB 3K74B 4NWUL 5DT1H 3SDYH 5JLZB 1AVBA 4D0DA 4EVNA 5INCA 2X2YA 4PP2A 5F6HJ 4XMKL 3QQ3B 5DJDB 2ITCB 4I0PD 4HWEH 4Z7VB 5IHBA 4UILL 4KRLB 2DQEH 1W0VB 4R9CA 2OTWA 4CVZB 1QRNE 3QXUA 3BW9A 3MJ7A 5HYJA 5F89B 4IRJD 4JFHE 1YPZF 1H9VA 5HCAA 1A3LH 1TZGH 4HZLA 5D2LB 4HWZB 5IFAL 3ILRA 2BNRE 4X98B 5DYOA 1OARL 4JDVB 3L3JB 1XGYH 4JEGB 2A6DB 4WWID 3ZL4L 3L9RB 1UA6H 3MLTA 2VDKL 4GAGL 2FO4B 5HGBB 4D0CA 4F37F 1TEIA 3MLPA 5IEHA 3NABH 4MAYC 1B90A 1CFSB 2XWBA 3H9ZA 4TUKH 4AH2B 2Q8BH 1AE6H 2MPAL 1T1YA 1LEGB 1CIUA 2F53A 3CDCA 1EX0A 3O81A 4G3YH 3ZXJA 4NJ9L 4JDZA 4R8WH 3KS0H 3MNWB 4NQCA 3KYNA 4JY4A 4BSVA 3KPLB 4OGAC 4TULL 1N59B 1ZS8B 2LFGA 1KELL 1RURH 4PD4K 3WIHH 1FL5B 1Q8VA 1H9WA 1LP9F 2I9LB 5F3BA 2ERJC 4PJ8A 2FWOB 2ZACA 3TJHC 1KB5H 3A6CH 2VXUL 3MFGB 4B41A 5DQDL 2E9IA 4JRYB 2VYRE 4ODTH 4AG4H 4GKYA 1EHNA 3VRLF 1OQ1A 1CICA 2R0HA 1S7WA 1SM3H 1TJGL 4DKEH 5EDXA 4DN4L 5C6WH 1MVQA 1FLRH 1SACA 2W39A 2A6VA 5LXGH 3ET9F 3Q3GB 2JCCB 1HKLH 2BOBB 3PWNB 3O11B 2YN3A 3LHPH 1UWGL 4XYXA 3IKCB 4WWKC 4KVNL 5DJAB 2YSSA 3B9DA 3KLSA 5T33H 4H0GA 3DUSA 1EEQA 1HIMH 2E3VA 5K9KA 3SCMD 4XPFH 2VKWA 2BZDA 1MPAL 4OUUB 2I2SA 4ZPVA 1Z9LA 2KBGA 3CPLA 4WHDA 4Y2DA 5CLTA 3SDXB 3S34L 4WO4A 5DUUA 3IJSB 1SEQH 2GTWA 2P8LA 2VXTH 3WVJA 5L0QC 3M8OH 1A4JB 5L2KE 4JM4L 1JGEB 3SKNB 3PHOB 4NQDA 4HK0A 4YGAB 2CLZB 1IC7L 1NAML 2XG3A 2OP4L 1NLDL 5GGTL 1JF6A 3Q9OA 1T2JA 3TN0C 4QHKI 4KJWC 3QUML 3D39A 5F96H 5JQ6L 4AVSA 3VD9A 3LCYA 1DFQA 1AKJD 2VZ1A 4UT7H 4JO4L 4LFHD 3EO1A 3D3VE 5T5PA 3Q6FB 4Z77B 5I19L 1OAUL 4NM4L 4Y19D 4ZPTB 4P23C 2Q3AA 3W9EB 1RIUL 2R56L 4TTDD 3T2OA 5IF0A 3RZCD 2ZAAA 5LK5A 3T08A 2YD4A 2QADC 5C0BE 1FL6B 1KPUA 4OZIB 4XMLH 4G8EB 1OF2A 4G7VH 4KDVA 4KROC 3F8UB 2R1XB 2VSCA 3WXWH 2GFBB 1LD9B 4EKXA 1ZGLA 1WZKA 4HAGA 4O2EB 1MREH 4YJZL 4NZUL 1XR8A 4E41A 5F1IA 1MFBL 5C0IB 1GOGA 4NKDB 5SV3A 1INEH 4PGBA 3NH7H 3LSDA 4MAYD 4NQVB 3Q1SH 1IKNA 4W4OC 1IKFL 1WW5A 4X9GA 2YHGA 1KIPB 4MXQC 3AMKA 3WDYA 5GIRA 1AD0A 1UCBH 5IV2B 3FT3A 3U9PL 4X0KB 5DGQA 4OGAD 4TQEL 4UT6H 1N6QH 3HE6B 3X11B 1ZGLM 1TJIL 4ZTOL 1FORH 2F5BH 1ZA3A 1UB6A 1YY8B 4ELKB 4Z76B 5F3HB 2DQTL 4XXPA 3D0VB 2GAZB 1OM3L 1G9EA 3ECBA 5JNYB 1DLFL 3D0LB 4J4PD 4Q58C 1QSFD 3HRZA 4Q2FA 3IXAA 2O5ZH 4LEOA 1AD9B 3QDAA 2IEPA 3S8WA 1T0NB 3FCTB 3LKRA 2ZUXA 2ZCHH 3ZKMD 4IIQC 4Q9QL 4X6BB 1J87A 4PLJD 4PGCB 1IM9A 1WFTA 5IQ9B 2QQNH 3U2SB 2AAVA 4P46B 1T21A 3OMZA 5GQBA 2BXYA 2RBLA 4I3RH 3DECA 3NA9H 4QEGA 5EUKA 4WWKD 4M62L 5SWZE 3VFWB 1DQ6A 1LDPL 1G7PB 2A9NH 1WWCA 1U2HA 5D7KD 5K93A 5FO8B 4IRSB 3ZYIA 4F57H 1VKXB 2HFEB 3JV6B 1MS9A 3KDMB 3UZQA 2D03H 5L8LB 4ZUWB 3WIHA 4G6FD 1FLTX 5DQJA 1A7OH 3GBNH 2VRAA 2W9EL 4LLVB 3GSXA 5E08H 4OKDA 5BS0A 5ADOH 1KB5A 2GJZA 3ZTJH 5EIQA 1KJ2H 1QBLH 3VV1A 2LAAA 4XH2A 3OXSA 5EU5B 3AS0A 3C08H 5DRZB 4JPWH 1NPUA 5HPOA 1BIIA 1ZHNA 3TN0D 5BJTB 4LGSB 3G5VA 1CK0L 3QB7C 2UWEF 4KJWD 1W2KT 3B9KD 2ZGRA 2HFTA 1BQPA 1DBBL 3TVMA 3KLAA 1D5XB 3LVEA 2NNAB 2WSUA 3GGWB 3BP7A 3O45B 2NXZC 3I6GA 3BGFC 1UAIA 3GIVA 4KDTC 3ZPYA 4NGHL 4P23D 1A9BA 3RGVB 2BK8A 1CT8A 5J3HC 1VALA 2XOTA 1BQSA 2GHWB 5E1AA 1DQMH 3K2UH 1WT5A 5CEXB 8CGTA 3DV4A 4UW5A 4KROD 4CAGA 5JXED 1H15A 2A6JB 1YMME 1CFNA 1T7WA 5ICYB 4OCXL 3SO3C 3U4EB 3ZYPA 3BDYH 4Y4HA 2F58L 3ZXEA 2XIDA 4WFGD 3JTTA 2ZGSA 4KK8C 5GLUA 3PNWA 4KAQL 4PYHA 1WZ1H 2D9QB 4FZ8H 2OQJB 1K2DB 3LMJH 5KSVA 4HW6A 1BD2E 1AY1H 3UTTE 2ZG2A 1OAYH 1JWSB 1N4XL 3SDYL 4HS8L 5DT1L 2ZMLA 1UCTA 3ZSMA 1KJ3H 4LEXH 3VXUD 1P1ZB 5C0JB 4GBXB 3RU8L 3BUYB 1HH6A 3SJVB 1WCBA 1MCOH 4K1YA 1ULVA 4LHUG 4MA8L 4HWEL 5D4QA 3VFUB 4J12A 3GM0A 3I8TA 2DQEL 1EIBA 4YGDA 3GMPB 1FYTD 1YJDH 5GLZA 4EXPX 2A6IB 3TT3H 2NY3C 1A3LL 1TZGL 4N8CH 4XCNA 4LMQI 4U0RB 4Y16A 2RGSA 3QUYD 4PRPE 1FP5A 3S96A 5F7WC 3WN5B 3KR3H 3KYKH 3CFKB 5DJ6A 1UA6L 1EEUA 3B8YA 3PVNA 1CFQA 1YI7A 4Z95H 2BVQB 3IDYC 1MI5B 3NABL 5FGSA 1CXEA 3DBXB 1U93B 1I3VA 2Q8BL 4XP9H 3KPNB 1A9EA 1QDCA 1UM5H 2ED8A 3FQTB 2DQUH 3STZA 3E6FB 3EYFB 4R8WL 1NCAL 1P7QD 5DR5H 4RDQG 5B8CA 2BP3A 5HYSG 1TVHB 4AGRA 1FJ1A 3BVNA 3FOLB 5IG7A 3DX6A 4PRIE 1AXYA 4NQSA 2IPUK 3MRDB 3NBNA 1RURL 1KRIA 4FXKA 4LBQD 3WIHL 4NNPH 4M3KB 4XX1G 3ARFD 2E8YA 4GW4A 1OAZH 4N0RA 3I3EA 5ESVB 1BVKB 5M95B 2VJXA 1KB5L 3A6CL 5ALCH 4FQJH 3AP4A 2V5RA 2CRIA 4HKXB 4ODTL 4AG4L 1Q38A 5C08D 3BD3A 1MCRA 3MV8A 3RQ0A 4PJ5D 5GZOD 5FO7B 1SM3L 5FUCE 4ZFZB 4G8IB 3SH4A 2BHZA 2YK1H 4LKCB 1ES0A 5M94B 2BVTA 3W0WE 1X7QA 4WI3A 5CSZA 1MFAL 3IFPA 5CHNA 3ARDA 3MRMA 4F15C 1P4IH 1L9NA 2FEDC 1AC0A 5LXGL 1MQKH 3L1OH 3QEQE 1PLGH 4K07A 5I1EL 2E6QA 4QGTA 3UTQB 1F6FB 2XQBH 4CKVX 4XP1H 4N0CC 3DVGA 4QHNA 5GJSH 5C0CB 1NAMB 2BHUA 2X70B 5FO9B 1DBMH 4HXBL 1WTLA 4XHBA 5K9QI 4XPFL 1J8HD 4DGYH 2VLLA 3QUMB 3D85D 4M5ZH 2DWEA 2DWRA 3IN9A 1IAKA 3O8XC 4HIEA 5J1AA 3LN5B 4HDIB 1UKQA 2VXTL 1SEQL 1JCKA 4XC3H 3SQOH 3X3FL 4DQOH 1YIFA 1KJ2A 4D0DB 4GXVH 5I30H 4KK8D 4XNXH 4EI6A 2X4PA 3ARVA 1RUMH 4K3JH 2YROA 3JWDL 3PQYE 1MHCA 1SY6H 4ODXB 1RJZA 2HFGH 1Z6JT 2O61A 1BZWA 3G04A 4GOSA 5F96L 2OTWB 1R3JA 5B38A 3BW9B 4AQ1B 4DQAA 3FQWB 3QLQA 4UT7L 1Q8OA 3MOAH 3G9VA 1QOKA 3LKSB 3MV11 2CMRH 3QDMD 4UOJA 4HZLB 2VNCA 5B39A 1IT9H 2NW3B 5T3ZL 4TOYH 4I48B 4YNYB 4XPBH 2AEQH 1DBKH 3O6FB 2PYEA 2WBKA 1UJ3C 3MLTB 1N0XH 3MXWH 3T3PF 3L5IA 4JFQA 3MCG1 3QFDB 3EO9H 2XWBB 2JIXD 4XMLL 2NY3D 3MV7D 2ICCA 3OKNA 1T2QH 1GGBH 2NZ9C 3ARPA 4JDZB 5SWSD 3U82B 1MREL 4NQCB 3ILPA 5E8NA 4NFCA 2HAZA 4D8PA 4YBHA 5C09A 4BQ1A 1P5VA 1INEL 2DKMA 3KYOA 5KANI 3HAEB 1CDUA 5GRVL 1AR2A 3NH7L 3BIWE 4EUPH 1XFPA 3VXME 3D25A 3Q1SL 5F3BB 4UAOC 1JUFB 2F5AH 3OWEA 3ZDZE 3PHQA 4LBEB 4UT6L 4Z7UA 4NQEB 2X4TA 1WEJH 1N6QL 2VLJE 4XVSH 1Q9KB 3BPOC 4FA8A 1FORL 2F5BL 4M7LT 4S1QL 1FRGH 5GRYA 2C3VB 3BYYA 1T80A 5GS2H 2C1PA 1SYVA 3RWEA 3CJJA 3MBXH 2CQVA 1C7SA 1TLKA 3W82A 5EFIA 9CGTA 2O5ZL 3CSGA 1P6FA 5KS9E 4EJ1C 3FQUB 2O5XH 2ZCHL 1KPRA 3T0EB 3F6LA 3DUSB 5KSAC 1UN1A 4KPHH 3GMLA 3V0VB 1F6LL 4O58H 5JR1H 5K9KB 2QQNL 3SDDC 3GSRB 3MV9E 4IS6B 2WQ8A 4H25A 4ZPVB 3CPLB 2FHFA 4BMEA 1YEFL 3L7EA 1DBAL 4I3RL 5GHWH 3NA9L 4D0BB 2P8LB 4QRSA 5J6GA 2BRRH 4PJ9D 5CBEA 2A9NL 2ZUUA 4JKMA 4BSWA 4PJBE 4N0CD 1D5IL 5CKAA 4F57L 2XN9E 5SV4A 5ID0B 5JW4M 5C0AE 4XHQA 2BMKA 2D03L 4MMXC 5T5NG 1R3HA 3GBNL 3O8XD 5E08L 1JWMB 5ADOL 3NIFE 3BIBX 4QXTA 1KJ2L 1QBLL 4L29A 3L5XH 4N0UB 4PCRA 1ZT1A 1LO4H 4PB0H 2B5IC 3C08L 2D6PA 2IAMA 1DHKB 5H37G 3CZFA 3C6SA 2YS4A 4ZNCD 1NMCB 3DETC 1QEWB 4PBXA 1JN2P 4GA9A 3D5OA 3EW3B 1JJUA 5HGAB 4M6NH 3N36A 1OF2B 2TEPA 3PJQA 3RVVC 1FZKA 1QUNA 3SKUD 1H0DA 2G9HB 1JTTA 2R2HA 1NGZA 1FFQA 4PREA 4FQPA 3K1DA 3QUXA 4X5XA 2C4FU 2QKIB 3GBMH 5GGVH 4E41B 2VQ1A 5HHOA 3FO9A 4FPKA 3C6LB 2DJSA 3M1BA 4JQXC 2VDPH 4NBZB 4PLNC 3INUH 3MLRH 3GKZA 3L6FA 1DQML 3SOBH 2QR0A 5IHZA 5IW3A 2IAND 1CLCA 2XQYK 4YG6A 1DUZA 3STBA 2BSSB 2Q1EA 2NZ9D 2J5LC 4L4TA 4JJ5B 4FQ2H 3BDYL 3G5ZB 4GW5A 2W52A 1OSPL 4QCIB 1SY6A 4HD9A 1ZA3B 5KAQG 4QOKD 3HUJA 1NC4D 4JRXD 4FZ8L 1LNUA 1CL7H 3LMJL 3ECBB 4H88H 3S4SG 1OAYL 3BKJH 2HT4C 3HRZB 3IFNH 3V6FB 1KJ3L 2WLYA 3NZHH 3LV3A 3LPGA 3O4LD 4RWHA 3MOBL 2ZP0T 3TBVA 1HHIB 3ZT5A 1RZ7H 5FYKE 1HKDA 3IDUA 1R3KA 3OAZK 5JOEA 3FB8A 1YJDL 4PJHA 2DI7A 3UYRH 4PJDA 4LQFH 1X50A 3TT3L 2EC8A 1JUIA 1D5ZA 2A70A 2CLRA 4N8CL 1C7TA 4XJZA 4G8GA 4YHPA 2E6VA 1VESA 1IRAY 3O2VH 4I18C 4C56E 5KSAD 4FPFA 3AS2A 1DQLH 3KR3L 4D94A 2LAGB 4O2CA 3SDDD 5D1QA 1VCAA 4LCUB 4D9RD 4Z7WF 2Z35A 4EUPA 2IG2H 4AM0A 3BKCH 3QP3A 4Z95L 2ESVD 4WUUD 1ZLWK 5D7LA 4CNIB 4XP9L 5BS0B 4MA1B 1UM5L 2GJZB 5DMGC 5E88A 1CGSH 1II4E 2DQUL 5DR5L 4MQ7A 3CXHK 3GMNB 3W9DB 4YW4A 3VGAC 3OXSB 4XWOC 1C5DB 3EHBC 1JYNA 1MY5A 4OZFB 3BRFA 1NCNA 4GLRH 1CFVH 1XCTA 1QSEE 4NNPL 3U4AA 5LJYH 4DCQA 2ADIB 1OAZL 5CJ8A 3K4DA 3PV7A 4YW2A 3KLAB 3RTQA 2V73A 3FRUB 5ALCL 4FQJL 4M7JL 5J06A 2Z93A 4XOGA 2DIAA 4M3CE 5HDBF 2M26A 5F9DC 1TQBB 3QG7H 5DLML 1GGUA 4PJAF 1PG7W 4XTRC 2VR9A 1CT8B 4Y0GA 2W08A 1UXSA 4OZXA 1W8NA 1JZ3A 4RAHA 2ADJA 1CL7I 4Q9RH 3OXRA 1VFAA 1P4IL 2ZKHH 3DV4B 4BQ9A 3RVVD 1JZ5A 5EU3A 2G2RA 4P2QE 1FFRA 1YDPA 3QPQC 3EDEA 4OFYD 3L1OL 3TZVC 3DV6B 4TTGA 1EUTA 5I76A 4XP1L 5GJSL 3SLIA 3PNWB 3Q5OA 4TVPL 4DGYL 3S35H 5KSVB 2EE9A 5CJXC 1AO7E 5DSCA 1NGXA 4FQCL 3SQOL 5F9OH 4DQOL 4JN1H 3EAKA 3FB6B 2Q86A 1CIWA 4GXVL 5I30L 43C9A 2GNMA 2DQDH 5BXFB 3O0XA 1W6QB 2EO1A 1WCBB 3MJ9H 3VA6A 1RUML 4K3JL 1SY6L 3BMVA 1QFHA 4IDJH 2A9ML 2C7UB 4ODVH 5BZWA 3VH8G 2HFGL 3B6SA 4JFHD 2R0WH 4TUOA 4CVUA 3MBEC 1E28B 3DYMA 5DMIH 4CADA 5JOXA 2IH3A 4FQXC 2D7NA 5I9QC 1FCGA 2NY1C 3PWUA 1FO0H 3GJFB 3MOAL 2XKUA 1KLGA 2CMRL 1DTUA 4WJ5A 4XCNB 4M7ZB 5DZNA 3L7FB 4K94C 5EIVA 4L8QA 1IT9L 1JF5A 4JR9H 4TOYL 3I75A 5FM4A 1MFDH 4JG0H 4XPBL 5IBUB 2AEQL 4WU7A 1DBKL 4BM7A 2CD0A 2O5YH 4Q2ZA 3RBSA 5HPMB 3QCTH 4JANA 4GLRI 5E6YA 2E51A 4ZQKA 3M07A 1N0XL 3G5YB 3MXWL 1CDBA 3CC5A 4WW2C 4WI2A 3EO9L 1YUHA 2D4DA 3VFMA 4U2YA 4Y8DC 4UW4A 1VGEH 5KBNC 1T2QL 3IF1B 1A9EB 1GGBL 1UG9A 1IQWL 4DEPC 2L0DA 4TPRL 5B8CB 5IB5A 5MENE 4M7KH 4N5UA 4GXUN 5ELIA 1UEYA 2FHCA 2WIIA 3CLEH 4Y24A 4Y22A 5DFVC 4FXKB 2KQNA 4LLUA 3T4AA 2PCPA 1T4KA 4GAJL 1K4DB 4GW4B 5TF0A 5DMGD 4KK9C 3UTPE 2HJFB 3WNPA 3LIZL 1YQVH 4XWOD 4PJIF 3EHBD 1ZHLA 1A7NH 5I18H 4XVSL 2AJVH 3EJZC 2YV8A 1WC7B 1V05A 5E6IA 3GSOA 5F7EL 1ES0B 3V7MA 3SQBA 4ZXBA 5KSUB 1KENH 3MGAA 2J8UA 1PZUB 3MBXL 1XGRA 3ZKXB 3ZHDA 1C12A 4WHYG 1EMTH 4XIKA 4ERSH 3ZYZA 1Q9OA 5JOYA 1FNLA 4PTTB 4LBKA 2O5XL 2BNQA 3ULVE 1MACA 1YEDA 4XTRD 2YMXH 3UJJH 4B50A 3DVGB 3G6AA 2GSIA 5KVFH 5E8OB 4O58L 4X99B 1K3IA 5JR1L 5I1AA 3BO8A 4UIMA 4L3AA 1JHKL 2ATPA 3QPQD 1SQ2N 3BKML 5GHWL 1A21A 3U30C 3TZVD 1QR1A 4UV7L 1KJ2B 3WDUA 2BRRL 1F8TH 4NCC1 2WBJC 3DVNB 3TA3C 2Q6WA 4OKVA 4MDJA 1F13A 4ORZC 1MHCB 3C5JB 1G7MA 2V6HA 2O61B 4N1CA 3HS0B 2V2XB 1DDHA 2OXGA 5GRVK 5T1LD 1R3JB 5B38B 1E27A 2OJEA 4HS3B 4KJYB 4ITCA 2AGJH 1R0AH 3WKMH 5EZLA 5I0DA 3C5ZD 2ZOLA 3RWHB 2JLLA 3QHZH 5D9SB 1LO4L 5DD0H 4PB0L 4NRXB 4BELD 3IMNA 4OF6A 3MBED 4HX1A 2ZUWA 5TGBA 2FB4H 5EZIH 4FQXD 4NZTH 1I8LA 2EDDA 1XCQA 4JFQB 4YFLF 4M6NL 5HVHB 5D1XD 3L3IB 2X4OA 2YPVL 3D18A 1BJ8A 3AJZA 4K8RL 3GBML 5GGVL 1BJMA 4D8PB 5GISH 4A6YB 3VXPB 2NXYC 3QRGH 2OLDA 3INUL 4DVBA 2V5SA 1NKRA 3KYOB 5E4EB 5GGUA 3SOBL 5DA0B 3UBXI 3D25B 5DVKA 4WTWA 4YWGH 2UYLA 3RWIA 2R1YB 2XKSA 3VXSA 4QWWC 1T89A 2H32H 2FHRA 4RGNB 1I7ZB 5A3IC 1RHFA 4FQ2L 4OD1H 3CMOH 3MJ9A 2AXGA 1T7YA 1HOCA 5M7QA 4J3XA 5EUOE 4YFZA 1NGQL 3MFFB 4NHCH 4L3EA 5DEFA 5E56A 3RWEB 3LKNA 4FPLA 5DA4A 5EORH 2V17H 1C1FA 5MERB 4B53A 4M93C 1V6MA 1FO0A 4NN7C 5E89A 1BREA 4KTYA 3NZHL 3TT1H 3VWKC 4NNYA 2AQ2A 3EJZD 4FFYH 1V8HA 1VB9A 5A2IH 1UVQA 2I27N 1P6AB 3SE3A 2P34A 3GMLB 1LO2L 5SWZD 1Q8MA 1RZ7L 3UMTA 1EXUB 2P47B 2ZABA 1F3JA 1JZ6A 1D5BA 1MHEB 1U8QB 3UYRL 3VXNA 4YZ1A 4L1DA 3H7LA 1PGRB 5J6GB 5CBEB 3O2VL 4BSWB 5EOCH 3A0NA 1A8DA 1SBSH 1IEBB 4NCC2 3SH3A 1C4RA 5EOQH 2IG2L 4RSVA 3BKCL 5C0ND 1R3HB 2FRGP 1OKQA 5C86A 3FRPA 2AS5M 3BFOA 1G9NH 2VAAA 3QIUC 3TH2T 4R4NC 2K3TA 2IPKA 3IYLW 2WBJD 1CGSL 5FUCC 2GQHA 4MHHI 3OBTA 1EGJH 1CE1L 1ZT1B 1HXYB 3VGFA 4NQXA 1I1AA 1DVFC 3VXTA 5GZGA 2Z8VC 2IAMB 3CZFB 4L8SA 3C6SB 4LGRB 3TNMA 4Q8LA 1CFVL 3NPZB 2ICWI 3NFSH 3UBXA 3LSOA 1IE5A 1T1WA 4L4VE 1SEBA 5HI5C 4MJIE 1D9KB 1JVKA 5SX4H 1AGEB 2BNUB 1FZKB 2WWKT 4XJ9A 1U3HA 1AX1A 1A6WH 2NX5D 3GM8A 2WJSA 1AQKH 4JM2B 3HI5H 4X5XB 5CEZE 5GJTH 2VERN 3QG7L 3EYQC 2VIRB 3VFTB 3MLUH 3SEPA 1YMMD 4GQ9H 4S0SD 1BQLL 3ZYOA 4KRPD 3QQ9C 4Q9RL 5IHZB 2ZKHL 3BEWB 5ISZE 1MVFA 3GSNL 4MNHA 5GS0C 1A7BA 3P0GB 4K3DH 4L4TB 3BPCA 4GKNA 5DK3A 4LSUH 4GW5B 5FUZL 1TCRB 1BD2D 1HZHH 3UTTD 3AB0B 3OAYH 4Y1AA 1X5LA 3QFJE 1YRZA 3HUJB 1CXHA 2XPGA 3HPJA 1NFDF 4YDLC 4QWWD 3S35L 1NGPH 2X4SB 3VKFC 5A3ID 1HXMB 2BVPA 3LV3B 2R2BA 3VFGH 5J13C 3O3UN 2DQDL 1LVEA 3MJ9L 4QO1A 4HIIA 4X6DF 3TBVB 5I17B 4Z0XA 4DN3H 4PR5A 3C9NA 4ODVL 3N85H 2R0WL 5IMOB 1V3KA 4Z6AT 1V7ML 5E9DB 5DMIL 1G9MH 4PRPD 5D72H 2HT2C 3FB8B 4PYGA 2ED9A 4PGEB 5E99H 1T0MA 3DMMA 4M02A 4PJDB 1FO0L 3GJEA 1GGTA 1D5ZB 5H35B 4YHPB 3RX5A 5E03A 5F9WC 3U4BH 3ZE1F 1KDKA 2ZZUT 4JR9L 1H3XA 1WIPA 2EIDA 3GO1L 4CU7A 3O9WC 4JG0L 1J5OH 4Y8AA 5E1HB 5D1QB 2O5YL 1UXWA 2IALA 2DM2A 3QCTL 2ICWA 2KL6A 4ZO6A 4EUPB 2IJ0C 4AM0B 5J8OA 2YD3A 1CTOA 1H5BA 2XZQH 4PRID 1NXD1 3FLPA 2C4XA 2H32A 5SX4I 3TH3T 4UQ2B 5I71B 2ADGA 4QRRB 4PY7A 1DN0A 3NGBB