4Q29A

Ensemble refinement of plu4264 protein from photorhabdus luminescens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
MNIIRKMDWDSMVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a cupin protein Plu4264 from Photorhabdus luminescens subsp. laumondii TTO1 at 1.35 angstrom resolution.
pubmed doi rcsb
source organism Photorhabdus luminescens subsp. laumondii
molecule tags Structural genomics, unknown function
molecule keywords plu4264 protein
total genus 26
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q29A00
2P17A 4MX3A 3PVBB 5I0UA 2V09A 1X7NA 4O9GA 4B29A 2MNGA 2GZWA 2Q1ZB 3MDPA 4FAGA 3B02A 4WBBA 2XKOA 4R8HA 3UKVA 4KWKA 5C6CA 2B9UA 3LA3A 2Q0AA 3RZZA 3BPZA 1Y9QA 3NKTA 2ETEA 4META 1DGWA 1OMIA 1PMIA 4IEPA 5JAXA 4GULA 1JUHA 3EHKA 4A2UA 2MPFA 5JR7B 3LAGA 1OD5A 2XL9A 2QVSB 2ZCWA 2PAMA 4Q0UA 4MGYE 2PQQA 3IDBB 5LRSA 4DINB 3EQEA 3U10A 2PHDA 2O1QA 1O7FA 1IPJA 2EVXA 4XFIA 3TNPB 2QCSB 1L3JA 4Z07A 5JSOA 4P9GA 4OFGA 4N9HA 2B8MA 1I6XA 4HLTA 3H3UA 3GYDA 3VHRA 4FBFA 2FQPA 3S7IA 1OFNA 4XFAA 4XETA 1O3TA 4EROA 4KU8A 3HIFA 4XF1A 3H1MA 3H7JA 4HVQA 4BIFA 2Q4SA 2D93A 2PYTA 3FJSA 5HI0A 3QOPA 3NJZA 4O9EA 2GC1A 1RGSA 1UW8A 4JTOA 3M70A 1CAWA 4RD7A 1J3QA 3D0JA 1CAXB 5JSPA 1WGPA 2ZKLA 3IIAA 1UIKA 2WFPA 3I59B 3O14A 3HT1A 3KCCA 1WLTA 1VJ2A 4HSLA 3CF6E 4FT8A 1QXJA 4WVZA 2GC2A 5J48A 1Q3EA 4IESA 4IEOA 1WA4A 4KL1A 5EZWA 1X82A 4E2SA 3SCFA 2K0GA 1GQHA 3RDIA 4BH9A 5BV6A 1X8EA 1VR3A 2HJIA 2OA2A 3IBMA 4I01A 2BYVE 5CADA 4EWAA 1FT9A 3CL1A 4XF0A 5FDBA 3R6SA 5E16A 4EWDA 2MHFA 5FLHA 3PNAA 4KWJA 5I0RA 4Q0PA 1ZVFA 1CAWB 2F4PA 4Q0SA 3CJXA 4YSFA 1FI2A 5FQ0B 4I0BA 3ES1A 2IXLA 4UBHA 3S7EA 1CAUA 4XF9A 4YNIA 3WW1A 2EAAA 1RC6A 4MUVA 3OF1A 5FLIA 2CAVA 3FFQA 3OCPA 3LA2A 4QGNA 1YUDA 5J7MA 3JZVA 3L2HA 4AXOA 4E2QA 5I8TA 4XFBA 4PIXA 3QACA 1TQ5A 2Z2SB 2QDRA 1QY4A 2IXJA 4Z82A 1Q5OA 3UKTA 4I09A 5JSRA 1O4TA 3SXWA 4IETA 5I91A 3HQXA 4UXAA 2XKPA 1V70A 3E97A 1OI6A 1RUNA 4LEJA 2IXHA 3ROUA 2BGCA 2EA7A 3E5XA 4LTAA 2CV6A 2Y0OA 3I7DA 2GAUA 1RTVA 1X8MA 4OLLA 1XRUA 4I02A 4AVCA 2D5HA 3TNQA 3ACLA 4PJYA 2C0ZA 2UYBA 2HKXA 1YFXA 2VPVA 4LUKA 5FPXA 1EY2A 1UIJA 3G7DA 3E5QA 3U11A 4AQ2A 4HMZA 2OYZA 3LOIA 2Z69A 3RPQA 5I8YA 1VP6A 4QGMA 2PFWA 4MGIE 1NE4A 1J3RA 1ZZBA 1H1MA 2IC1A 1O5LA 3WW3A 4I0AA 1LRHA 4XFFA 3NL1A 1YFYA 3PLQA 1ZRCA 4PIZA 3SMHA 3KGZA 1O3SA 3LA7A 1O5UA 2XLFA 3S0MA 1UCXA 4XFCA 4MH0E 3OTFA 1EYBA 3WW4A 1Y3TA 4NVPA 3I54A 2H0VA 1ZRDA 3H1WA 5F1RA 1ZZCA 4XFGA 3FHIB 2GC0A 4E2GA 2OPKA 4L2NA 1J3PA 4IEVA 4J1XA 3IWZA 3RNSA 4IEQA 4D7SA 4Q29A 2IXCA 4KWLA 2BNNA 4ZU4A 2PHLA 2ET7A 2PAKA 3SHRA 1DZRA 4H7LA 4IEUA 4HN0A 3UKNA 1YFUA 5FPZA 1EPZA 3E5UA 4EV0A 5BPXA 1CAUB 4N9IA 5KBFA 3EBRA 4J1WA 5BUVA 1CAVB 3LWCA 4L11A 4EWEA 4D7TA 4QXKA 5K8SA 3EJKA 3BB6A 1NYWA 3EO6A 3FZ3A 4WZCA 1LB2A 1G6NA 1ZREA 3BALA 3D0SA 5BY5A 1YLLA 4HVRA 3BCWA 4Q0QA 5J3UA 2H6BA 2ET1A 2OZJA 2I45A 5I0TA 3OD0A 3LZZA 1HW5A 2D40A 4K8FA 4TLFA 5I8SA 4IEXA 4HVOA 1IPKA 3I59A 4ONUA 2IXKA 4BYYA 5FQ0A 3ELNA 3H50A 3NSTA 3CLPA 1DZTA 3BU7A 3OGJA 4AVBA 4MGZE 1QXRA 3RYKA 2O8QA 2QJVA 2GU9A 3KSCA 3DV8A 1NE6A 1QWRA 2XHKA 3IDCB 1O3RA 4QM8A 5LEJA 1J1LA 4MZUA 4KU7A 4AVAA 1YHFA 4F7ZA 1YFWA 3KMHA 3DL3A 5CVRA 5KHJA 4XF4A 1CGPA 1O3QA 4PIYA 3WW2A 2DCTA 2E9QA 2UYAA 4ZU7A 4LLOA 3FWEA 4QMAA 3SCHA 4HBNA 3ZDSA 3ES4A 5FLJA 3RYRA 3USSA 3FX3A 1GQGA 2XLAA 5E1RA 4QGLA 2H6CA 3H3ZA 1LR5A 1ZZ6A 4Q0VA 1UD1A 2N7GA 3CEWA 4QM9A 3M3IA 3ST7A 4AQ6A 2IXIA 1CX4A 4JTNA 2BEOA 3MYXA 1J59A 3C3VA 1NZCA 2CAUA 2UY9A 2B5HA 1ZNPA 3NVCA 5C8WA 5KHHA 1ZZ7A 4HN1A 2BNMA 2PAEA 4XF3A 5I93A 1SEFA 4LUMA 3RYPA 4YRDA 1J58A 2XL7A 1H1IA 4IEZA 2KXLA 2VECA 1I5ZA 2ATFA 3E6BA 3CO2A 2GC3A 2FMYA 4IERA 3E6CC 1DGRA 4IEWA 5BXXA 4I3PA 4JV4A 5I0SA 4LA2A 5FCCA 5KHGA 3MPBA 4YARA 3KGLA 5JCTA 4YYOA 1ZZ9A 4XEZA 4XFHA 2WC2A 3GBFA 2VQAA 1SFNA 3H9AA 5LRRA 2OZ6A 3DN7A 4ORFA 3E6DA 1RL3A 3U0ZA 1FXZA 4X6QB 3H7YA 1ZX5A 1ZRFA 1CAXA 4QX5A 2UY8A 4X6RB 4ZU5A 3N4MA 2D5FA 5CU1A 3SCGA 4FAHA 5AVPA 1ZRRA 4JVAA 2PA7A 1EP0A 5KHKA 1CAVA 3FE5A 4LA3A 1RUOA 4R52A 1NXMA 4HZFA 5EFUA 4LULA 2BNOA 2XGXA 1YWKA 3D82A 1SQ4A 2XLGA 2QNKA 4BHPA 4CYDA 3ETQA 3DKWA 3MZHA 4MGKE 1PM7A 1XE8A 2K9ZA 3HT2A 5LEKA 4IEYA 1XE7A 2PTMA 3H1YA 1Q43A 3H8UA 4UBGA 1ZZ8A 1UPIA 3NW4A 2GH2A 5T3NA 4I2OA 2CGPA 1U12A 4HSJA 4F8AA 5KHIA 4MV2A 2Q30A 5D1IA 1LKNA
chains in the Genus database with same CATH superfamily
2CTVA 5FP4A 3VL9A 2JG9C 1V6NA 4HKLA 5FP3A 2D6MA 3VDCA 2XPJA 2FMDA 3JB8A 3PVOA 4FTBA 5I0UA 3N7JA 2V09A 2TUNA 4XW3A 3ITQA 4NRMA 3I2KA 1GOFA 5F6LB 2VU9A 5GJ6A 3K3OA 3PUHA 2Q1ZB 3QH6A 3AZYA 1OA3A 3O0WA 4WBBA 2XQRA 2Y38A 3TN92 4UW6A 3BUCA 4R8HA 4JKLA 1D2SA 3CIHA 2B9UA 4QPGC 4CPBA 1VAKA 5DAQA 5EYYA 3NKTA 1PNFA 2KD7A 3OBTA 4META 1OMIA 2ZX4A 5LA9A 5IAVA 4FPKA 4WVVA 4FOVA 4AZZA 2YFZA 4YWAA 1ULEA 2X5IC 2BWAA 1NAEA 3C7EA 5LA1A 2P3IA 1SPPB 2C6SA 2WNEA 1IHMA 2ZX1A 3ZYGA 2ZGQA 2B4KA 3PJYA 5HBAA 2BBVA 1OD5A 2ZCWA 1GLHA 3WX5A 4MGYE 4N53A 2G9ZA 1ULFA 1DQ6A 2CSGA 5IVFA 5LRSA 4CCNA 4OCTA 5FZAA 5HCHA 3ZFEB 2O1QA 5FYVA 3JD71 1IPJA 4BB3A 1IS4A 1BEV2 3MLJA 4XFIA 3TNPB 1DHKB 5L7OC 4LBJA 5CYYA 5FYCA 4DUXA 2VQ0A 2CWSA 3M3OA 1F5JA 4Y26A 5JSOA 1JZ5A 4Q4X1 5CG9A 3LDRA 2XB6C 1E5HA 4QQPA 1PO11 5FY9A 5JZGC 3AYDA 4Y1ZA 5T5PA 3KB5A 3M4FA 4XDPA 4IXLA 5L36A 2FQPA 4OUEA 5GZEA 4Q5OA 3HBKA 5KXDA 1REFA 4EROA 4IGOA 5IK8A 3H8XA 2BQPA 4YZ3A 1WW5A 1SPPA 2W87A 3ZYRA 3T0DA 4UT5A 1JH5A 3LQCA 4M3CE 1MEC2 1TNFA 4LR4A 2B9VA 1WLWA 3MIGA 3QOPA 2LROA 4FQZA 4PI2A 4DY5A 1RGSA 3J8F2 1R091 5K0UB 1VBC2 4JTOA 1QJZA 3M70A 1CAWA 1I5PA 4AF9A 1AJKA 4PDWA 2VNVA 3D0JA 4JRAA 4CXYA 4WV8A 1WGPA 1UYXA 3IDEA 2WFPA 4Y1VA 3R05A 5DAVA 2WIIB 5EHDA 5F2WA 4HSLA 3WEZA 3ECQA 4FT8A 2GC2A 4IESA 1AYM1 5KC6A 1N1TA 1ND3B 5EXOA 3AMQA 2NLRA 2GMEA 4IUGA 2ZGMA 2WBKA 4NHYA 1L7RA 4A7ZA 1FNZA 2A1XA 4DY3A 3ZDVA 3RDIA 1OVPA 2IVIB 4AAPA 3GJAA 4Y4RA 1VPHA 2V4VA 3WDWA 1HIXA 3D4KA 5FR3A 3IBMA 1RYYA 2CNAA 4KGQA 5DDJ3 5J96B 2FDHA 2VMFA 2RS52 5GZGA 3RFRA 5FY1A 4XF0A 1TG7A 3UGHA 2GNTA 3LIGA 1VAVA 1VBD3 5E16A 5BNOC 4HXCA 2VOKA 3B01A 2AR6A 4NUBA 4GH4A 1ZVFA 1K3IA 1CAWB 5K7PA 2HWF2 5IVEA 3OPZA 4QAWA 5FYUA 2RM21 1AL22 3ES1A 3S7EA 1CAUA 4XF9A 1OA2A 2EAAA 3OF1A 3P5BA 3J26N 2XJTA 2GN7A 3WR0A 1GWKA 1BLZA 1VBA3 2A6WA 2UURA 1U5IA 5SV8A 1XE0A 1QF3A 1ODMA 4QGNA 1YUDA 5CZKA 4XJZA 4AXOA 1UOFA 4E2QA 3B9CA 2R30A 1UO9A 4J25A 2RS33 1OURA 2CDOA 2VGDA 1BK0A 1AUYA 5FYTA 5K0UC 1OPMA 2W0XA 1PX4A 1W2TA 3UKTA 3POSA 4M01A 1G8WA 4P08A 4M3CF 3SXWA 3HQXA 5I91A 4UXAA 4UW3A 2XKPA 3LSDA 3WZ1A 4X8NA 1TME1 3CQOA 4QX0A 3K4AA 2IXHA 3IPVB 3HEIA 1GBGA 5C3PA 3I2FA 3PVEA 5A6QA 2JDAA 2RV9A 3HVDA 1EUUA 3VZNA 3IMNA 2XG3A 5EJ1B 3I7DA 3VBUC 1ST8A 3MV01 2OX0A 2Z4FA 1NKGA 5DDJ2 3LPGA 1MQTA 2DUPA 1XRUA 5FMDA 5LBFA 4AVCA 4A4AA 1A8MA 1AR92 4FFGA 1U5YA 3OJBA 3ACLA 3TNQA 1N3QA 4RQPC 1AX1A 4P14A 2UYBA 2HKXA 1YFXA 4LUKA 4N43B 3LSEA 5F3IA 3E5QA 2ZGLA 4O61A 3I3EA 3MI8A 2WZEA 4XBQA 3OOXA 1AR61 4UI9L 2WA3A 3C7GA 3R4UA 4P5YA 1EAH2 4K8RB 5F32A 5FP9A 5L7OA 1NE4A 1SCRA 1H1MA 1YI9A 1Y4WA 2QQVA 5D21A 4C0BA 1QJU1 2EXIA 5FZ0A 3WUDA 1FV3A 3PMSA 2DU0A 2WFF1 1S1AA 3ZX7A 3ZSEA 4I0AA 1JOJA 1LOEA 2QUOA 4W8JA 5KWRA 4JGZC 3WV6A 2EALA 4AEDA 1YFYA 1C8M3 5FZCA 2ADEA 4DRRA 3PLQA 4FOYA 4GJYA 3ZLIA 5CISA 3N3HA 4NAMA 1J83A 4FFIA 4AVSA 1OC1A 2BPA2 1N47A 2PLV1 3FBMA 5IJRA 2DCKA 4LBKA 1WCSA 4XBLA 4TLGA 1RUF3 4LO7A 4M4RA 3WG4A 3S0MA 4XFCA 3PUIA 1EYBA 5BNNB 4BDVB 2ADDA 1Y3TA 2WAOA 3I54A 3SKJE 2A3YA 5A7WB 3V56A 4A6SA 4AI3A 4XBNA 3VHOA 4JGZA 1BJQA 1U5XA 2Y6HA 3AMMA 3CJIA 4B1LA 5JWPA 1AR62 5F5CA 1LHUA 5DAPA 5FYYA 2R0HA 3VBSA 4XFGA 2DUQA 5A7NA 4XABA 1JOPA 1QJFA 2GC0A 2BWCA 1XOYA 2OPKA 5FZMA 1MS4A 4BXSV 2E32A 3OSDA 3I2IA 4IEVA 2WWUA 1S55A 1UAIA 4NHXA 5F5AA 2E53A 3P3PA 3RSJA 4BQWA 3POIA 4AHYA 4HONA 2Y6JA 1UNBA 1AR71 4IEQA 1ZA4A 3MW4A 1VBA1 3T09A 3DYOA 3AK0A 3LGRA 3RJRA 2PHLA 4QX2A 5CFCC 1UY4A 2D6NA 4BMBA 2W52A 1GZWA 3UV9A 1PIV3 3UKNA 4YW2A 1CJDA 2DFBA 2YC4A 5FMOS 3A23A 2JWPA 2RHPA 4JRLA 5F39A 4DNYA 2WO7A 3E5UA 4DXTA 4EV0A 1FX5A 1KJRA 4ATEA 2Y0IA 4QXHA 1CAUB 1GZWB 2ILMA 1MS1A 4IE0A 3VBRC 2W46A 1CONA 3GALA 4AI0A 4FOQA 2AC1A 1ULOA 4J1WA 3WNKA 4IE7A 1HQLA 2ZHKA 1CAVB 1YEWA 1RXGA 2R0FA 4LBQD 3USUA 1A34A 2X09A 4HANA 2K46A 3K75B 1HB4A 4ASLA 4QWNA 1JZ6A 5CNAA 4A44A 2A6YA 2R042 2PLV3 4XQDA 2CYFA 4C8DA 3EO6A 4JQRA 4QB1A 2VMDA 3FZ3A 4NPRA 4YW5A 4AR2A 1PO21 1ZREA 4HL0A 4JDNA 3KT4A 4QPIC 4MXWB 1RUJ1 1AXKA 2RM22 3JB4C 3BCWA 1PGL1 3J7LA 4CZSA 4YFZA 2DBIA 2I45A 3D8CA 2NM1A 3PU3A 1XNTA 2VUJA 3KV6A 1YQ6A 1W8UA 4LHSA 5EQUA 2BERA 2QDNA 2VUAA 4B4QA 2QQKA 3LZZA 1D2QA 1HW5A 2XUMA 4K8FA 2VG9A 3LDBA 4TLFA 2C9AA 4IEXA 5FUPA 1VRH3 3KCXA 1H8TC 2XXZA 1JYVA 2GSYA 3WF4A 4BYYA 1JUIA 3FBYA 1AL0G 4Q8LA 4P02B 4XHXA 3NSTA 3VB9A 1W2UA 4V2WA 2FDFA 3CU7A 3POFA 1QGLA 3VBUB 5DUWA 1IKQA 4MGZE 2RJ2A 2FHRA 5A7WA 1GMMA 3N9QA 3RMYA 3NJXA 4F8AA 1AYM2 2QJVA 3MIEA 5H9QA 3KSCA 1GKBA 3RGBA 3VHPA 3AJYA 4L92A 4WVMB 1YYNA 2Q8DA 4LBQA 2XHKA 2XVGA 1COV3 5JUVA 3VKNA 3O1VA 2HBUA 1S0DA 3UESA 4CPBD 4AVAA 2J1EA 1VBE3 1YFWA 3E1F1 3KMHA 2I07B 1D4VB 3DL3A 1RJ7A 4MSVA 3ZXFA 2QQLA 3MV11 4ZKTB 1QHDA 1WZXA 2ZJCA 4NWVA 3OBAA 3T08A 4H3WA 1HRV3 3ZN6B 2D6PA 3VL8A 1CD3G 3POYA 4LLOA 2LRPA 3SQOA 1Y43B 3ES4A 5F3GA 3VBOB 5H9RA 3THDA 5LASA 4PQ9A 1UOJA 3VLBB 3USSA 3FX3A 4D6QA 2BFUS 4BMEA 1HXS2 5E1RA 2YBPA 5A3OA 3H3ZA 4ES9A 1LR5A 2RDRA 5GLWA 4KMQA 3CEWA 2DDUA 3GF6A 4QM9A 3K46A 5BNQA 4CXWA 1PZ7A 2BEOA 1EV11 4QPWA 3CZJA 4H7MA 5CIRA 2VXRA 2UY9A 4DB5A 3N9NA 5FKCA 5C8WA 3MO4A 1QJX3 5IHRA 1BMV2 3MIDA 4LKSA 4XIOA 5I93A 5I0DA 3ATGA 4LUMA 1NY71 3CJIC 1OLME 2YGMA 3ZMOA 1AR73 1C4RA 5C7GA 4PDWB 3N9OA 5FZIA 2G9GA 2R32A 2ZX3A 4QX7A 3CMGA 2GH8A 1H2MA 1NQDA 3HBZA 1HDKA 4ISQA 3ZYJB 3RRDA 3VHNA 2P3JA 1MS0A 2AGSA 2VBDA 4DEQA 1YIPA 3K48A 1QU0A 3MPBA 3USUB 2J1TA 3HNYM 3SH5A 1LNSA 1TMF2 3GBFA 1SFNA 4YGEA 3R4DB 3RG0A 4PQQA 1X9PA 1D4M3 5A6YA 5K9YA 1DQ4A 1KGYA 5IFTA 1RL3A 2GMPA 3DUIA 4QD2A 2P2KA 1FXZA 2JD9A 5CFDC 2ORXA 2BGPA 5FWJA 3DPRB 4Y20A 1CAXA 4GAZA 2EAKA 4AHWA 1SFPA 1W2AX 2JIGA 3GM8A 1XNBA 4X6RB 3I3BA 4IV3C 3VBRA 3LCPA 1IG3A 5SV5A 3N4MA 1PGSA 3SEEA 4FAHA 2CHHA 4UFJA 4MG2A 5KHKA 3FE5A 1W99A 3BIEA 2MEV2 1UOBA 1RHI2 3ZKYA 2E6VA 2E33A 1BVP1 4GXLA 3WSOA 4FOWA 2VTFA 4Q1RA 5ACA3 3D82A 1F15A 2XLGA 4PLMA 4RR3C 1Q8SA 5IK5A 2QNKA 1AL23 3ETQA 4TTGA 2VQUA 3V64A 2W95A 3LDKA 3HT2A 5LEKA 4IEYA 1XE7A 4OZXA 1NA1C 1MPXA 2JDHA 2WT0A 5LY2A 3KHCA 1CVNA 1VB2A 3MIBA 3NW4A 1MVEA 1WA6X 2QQIA 5A3NA 1IKPA 4HSJA 3S30A 4ASKA 4CDWC 2G19A 1LKNA 3AXEA 1XYPA 1W8HA 2ARCA 4S2DA 1VMHA 2P17A 1SZBA 3JQXA 3OBZA 1DCSA 1LENA 1W9FA 3ZR6A 4MGTA 2WZR3 1CZTA 1RUH1 4CU8A 1X7NA 2RMU2 4B29A 4Q8KA 5EPAA 2ZGUA 3K3NA 2VZTA 2RE9A 4KBZA 4AEDC 3ZSMA 4CUAA 1S0FA 2DVAA 4HKOA 1JZ3A 1K42A 4M0HA 3CHXA 1REDA 5BNPB 1H6YA 5FY7A 5JAXA 1N1SA 4QX8A 3U75A 1TME2 2WZR2 3EHKA 3SKVA 4A2UA 5A3MA 5JOXA 2BJSA 2NYYA 1HB1A 2WLPA 2VZOA 2XR4A 2Y34A 2ZX2A 3LEKA 4Q0UA 2QVSB 2PAMA 3UJOA 1W8FA 1Y7BA 5FYHA 4MGQA 2HEWF 3EQEA 2X10A 2PHDA 3GBWA 3MICA 1OKOA 2W1UA 3B93A 3IPVA 2JECA 3P6BA 1L3JA 1MQTC 4Z07A 3VD3A 3JBG1 4C90A 3GCXA 5FJHA 3T2OA 1OUXA 2NPIA 3ILNA 4RL7A 2JG9A 4P9GA 4OFGA 3QCWA 4N9HA 1H6XA 1RUE3 1C5IA 2ZAAA 2AZ5A 1UZZA 3ILFA 1P8JA 4LIVA 2EIDA 1TZOA 1DYOA 2X29A 2Y8KA 4RS5A 1W9YA 3HOBA 4CEYC 5C3SA 2J7MA 2WS93 2ZOEB 2A70A 3PIJA 1RMU1 2G1MA 1L7LA 5LY1A 3NNJA 1W8NA 2CDPA 1HQWA 1E5IA 2XBO2 4QDRA 3TEYA 4I30A 3VKLA 1CZVA 1YRZA 4K1ZA 2R061 1XPWA 2Q4SA 1S2EA 2HWE3 4CCOA 2D93A 3FJSA 5FUNA 1QJU2 4WM8C 1RUG3 1UW8A 3MUZ1 3AP7A 2WS92 2B46X 1D4M1 2W47A 1RVF3 3AKRA 3AP4A 3AMHA 3MW2A 4Y33A 2WT2A 1J3QA 3AZXA 1CAXB 5JSPA 1PNGA 2VZQA 5FPAA 4JDOA 4AI2A 1IS5A 3I59B 4QPIA 2ZTNA 4KWUA 4E8CA 4G3YC 1A78A 3WNLA 1Q3EA 4Y5TA 1TMF3 4RA0A 3BU0A 3U4SA 2WSVA 2Q5TA 4AI8A 1N1YA 4YZ4A 3LE0A 5EZWA 2DU1A 4UW5A 5GZCA 2VBBA 3DPRC 1UY3A 1RMU3 1TMF1 5F8PA 4BZ4A 2OQ7A 2WINB 4LQRA 3SCFA 4XCBA 2FCVA 2XDVA 3UL2A 4TZDA 5BV6A 1SLBA 1X8EA 1Z7S3 2RR12 4MVTA 3J8F1 4NWWA 4E4DX 2CU5A 4LXLA 1WCDJ 1T6BX 5T55A 5APAA 4GIQA 1V6MA 4FPYA 1BXHA 3IDAA 1W28A 1NQJA 1BKZA 3TAYA 1FT9A 2VMGA 1MS5A 3PHMA 1OFSA 3ZXDA 4CEYB 3KV9A 1LOFC 3FMGA 5FLHA 1WBFA 4Q4X3 3K2OA 3PNAA 2D3SA 2F17A 2WLQA 3EB7A 2FDJA 5I0RA 2R16A 1YQCA 3AL5A 1JHJA 1FI2A 2QQOA 3Q8EA 5FQ0B 3RZLA 2AEYA 1H4HA 3HN3A 2MEV1 4A45A 3WW1A 1F31A 2WQ4A 1PO12 3J7MA 4MUVA 4ARXA 5KC5A 4BLIA 2JE8A 4CDWB 3JD73 4BQ1A 1VAMA 3FFQA 2RS11 1FPN3 4RN5A 3VBOA 3ZKUA 2NP0A 3MUY1 1B35C 5IAXA 4YM3A 2YDEA 1C1LA 1T6GC 4XFBA 1AR63 1HJFA 3SLIA 1TQ5A 2JE7A 4FPJA 3C7HA 4QU1A 4XYXA 4I09A 1HJGA 1OQDA 3RZHA 4B4PA 1RUNA 1DP0A 4GB33 1WUVA 3ACHA 3NO8A 4LEJA 4N8MA 4R9CA 3ACIA 4C0HA 4U36A 2BGCA 1SACA 1X36A 3AKSA 3ZSLA 4LTAA 3N36A 4CCMA 4A3XA 4GH4C 2Y60A 4OI1A 3W59A 2GALA 3RQ0A 2VY0A 1R1A1 2V72A 1K12A 3F2ZA 2RG4A 4FFFA 4DQAA 4E4HA 5A3PA 3VV1A 5FZHA 4XUQA 4I02A 4IGPA 2IUWA 4XACA 5IYYA 1ASJ1 2C0ZA 3ZM8A 2VZUA 4UYBA 3WDYA 4B1MA 5FPXA 2PHUA 1LODA 1UWWA 4FFHA 1JI6A 2VMCA 1HX6A 4JGYC 4LJHA 5A80A 2QTWB 3GJBA 3U11A 4HMZA 3B9IA 2OYZA 3PUSA 5ACA1 3K4ZA 4YLZA 5I8YA 4Y22A 3V0BA 5LBEA 1HRV2 1SBEA 4AEMA 1UYYA 3WNMA 1VMFA 2Z42A 5DUXA 5FV3A 4E27A 3MFAA 1ZZBA 3GZTB 4A42A 2YC2A 3FLTA 3WCSA 3ZXKA 1DBNA 1O5LA 3ZYHA 1DYPA 3WW3A 3WQ7A 1LRHA 2OUJA 1UY2A 4GWMA 1PM4A 4Z1VA 1AR82 3GBGA 3NL1A 2YB7A 3AKTA 5HCBA 3WDVA 1AYN1 2JENA 2Y33A 1LOFA 2JXAA 4AYUA 2XBO1 1ZRCA 1W2OA 4NJ4A 4B3NA 5FPLA 1DU3D 2WYFA 3SMHA 4OUMA 2X53S 4AHXA 4K3UA 5FZKA 4W6XA 1JZ8A 4LT5A 1BVVA 2VOTA 3ENRA 1NZIA 3W5MA 4MH0E 4LIUA 5FYIA 3POBA 4NVPA 1JHNA 1I1EA 1QDCA 1QJY3 2JDPA 5FZFA 1Y9GA 3H1WA 1Z0HA 4FP3A 1SLLA 3ACFA 4Y5Z0 5F7UA 2JG8A 3OBRA 5IK4A 2ZAHA 1KITA 2RJLA 4COYA 1JBCA 5JLVA 3WG3A 3BGAA 2P4EA 3Q8FA 2OKXA 2HEYF 3WQ0A 5FO7B 3M8LA 4HPKB 4QQ2A 4CDXC 2QBXA 4KG8A 3B3QE 1W03A 3KV5A 2C1FA 1KXGA 4J1XA 4QHZA 5IVYA 1V6LA 4YG6A 2WJSA 4NPMA 1AF9A 1WMDA 4KWLA 4QKDA 3VKMA 2BNNA 2GN3A 4JHZA 1COV2 4YGBA 4PI0A 3JBG3 3PL0A 1OF3A 4HN0A 5KXBA 4ATFA 2D6OX 1BHGA 2Y6FA 1OH3A 1LTEA 1WCKA 2VW2A 1F4AA 1K5MA 1SCSA 2JB4A 2PMWB 3WDTA 5IVJA 3ILRA 4WVWA 4EQVA 3O1TA 2Q1MA 4N9IA 3BKZA 4WM8A 2WO2A 1DLLA 1G9FA 3LWCA 5CKQA 1XBFA 1BBT3 3OD4A 3POGA 4D7TA 4QXKA 3O7OA 1WWYA 2MEV3 1BQPA 4Y1UA 4LLFA 1C1FA 3NJYA 4J6GA 5JI9A 1NYWA 4NRPA 5C8CA 2O14A 4GWNA 1VBB2 3WG2A 2YROA 1NCRC 5DG1A 4LBNA 1CWPA 4IE4A 5BY5A 5HXVA 4Q1PA 4HVRA 4BPZA 3ZVXA 1BYHA 4XUPA 5J3UA 4MHRA 4DPNA 1BBT2 2BUKA 2VR4A 5JZGB 4H2AA 5GZDA 5BNOB 4PHZA 5FO9B 4ISRA 1NLRA 1QJEA 3OYWB 1N1VA 1K5MB 3WCRA 2PHFA 1CZSA 1LAJA 2NN8A 3MGUA 5IUQA 3GCWA 4ZPIA 4ZONA 2IXKA 2HEVF 5FZ8A 1I9RA 5FQ0A 4N53B 1UF2C 3T30A 1JZ4A 1UKRA 2XONA 2CY6A 4X8PA 2A3WA 3CLPA 1DZTA 3OGJA 4YFWA 5A6ZA 3ZYPA 4CCDA 1QXRA 1E5RA 2BOJA 4LBMA 1UY1A 2WDBA 3RYKA 4B4RA 4NOTA 4BK5A 2A73B 5C3RA 1LHOA 2NQYA 4GA9A 2P6HA 1YIFA 4G9SB 3WHTA 1UZYA 3V0AA 2EXKA 4YPJA 4CCKA 1UMHA 1DGWX 3B00A 1HQNA 3GHNA 4NHKA 2OIIA 3DV8A 1QWRA 1GFF2 2C4XA 1O3RA 3O1RA 5LEJA 4OULA 3AMNA 3MLKA 4URTA 4YVSA 5JZGA 2A75A 4AFDA 3MLLA 1JODA 4QX3A 2YV8A 4W6WA 1YHFA 5GALA 4CDQA 4F7ZA 2HWF3 1FV2A 3OY8B 4FPOB 4LBOA 4XF4A 1JYXA 4JGYA 1O3QA 3LF7A 1QEXA 3NJVA 1AZDA 5K4LA 5C5UA 4D0QA 5C9AB 5ANNA 4WVMA 3WW2A 2DCTA 2E9QA 1LU1A 4HK9A 1POV1 1VBB3 1WW6A 2R072 4GALA 3NNGA 4GWIA 3IM0A 4R9DA 3FWEA 3ZDSA 4HBNA 1RHI3 1FPN2 2WRAA 3A21A 2AUYA 4OMCA 5LK5A 4AE2A 2BP6A 2WFF2 1GSLA 2WO3A 2XLAA 1VBE2 2ZA9A 1GUIA 4JHTA 4QGLA 1O4YA 4W4ZA 2RS32 4KBBA 3N7LA 1OHFA 1U0AA 2WWSA 4IV1C 2N7GA 1S2BA 2P3YA 3ST7A 4AQ6A 3AFKA 2A3XA 4QT6A 4NIDA 1LGCA 1RJ8A 4JTNA 3O1PA 2VZSA 4LO8A 5JMOA 4FTSA 1OD3A 5FJKA 1WMEA 3VZMA 4RHV3 4MHUA 3VZKA 4SBVA 2P34A 2Q8EA 2B5HA 2ZPXA 5C4WB 3S57A 2JB8A 3WT3A 1LU2A 4UFIA 2DYCA 1LGBA 2DTWA 1AX2A 4ZXKA 5A3WA 1KD7A 3CNAA 4HN1A 2HWF1 1ASJ2 2PAEA 3CBNA 1A3KA 1F4HA 2Y64A 3N9PA 3NAPB 3RYPA 4D94A 1NA1A 1WLCA 2E26A 1J58A 2VO5A 4LKDA 3RJ2X 4CDXB 1H1IA 3AFGA 3KQ4B 2JG8C 4IEZA 1NCQC 2B45X 3R4SA 2VECA 4EN6B 1RVF2 2J1VA 4CUGA 4EZ4A 2HWD3 5J1XA 2ZHLA 3TRSB 2ATFA 4N90A 5ABJB 1C5HA 3E6CC 3APBA 2YHJA 4IEWA 3KT7A 4HK8A 5BXXA 4CDXA 4F3JA 2ZZQA 4OUSA 4M4PA 5FOJB 3QH7A 4LA2A 5FCCA 5I0SA 3RVHA 1OKQA 2YMZA 1F5FA 5JCTA 1RVF1 4NR1A 1YC61 4OMDA 1MZFA 2XMLA 4AGVA 2YY1A 4Y4YA 4Q26A 2WC2A 2QFEA 3T4VA 2JDZA 3IZOA 3VBHB 3H9AA 1TEIA 1FMD1 3RS6A 1R082 3DN7A 3L2YA 5HV0A 4ORFA 3E6DA 4OI4A 1DZQA 4UOJA 1DF0A 1G7YA 1HB3A 2XJVA 3A7QA 4P9XA 4W6YA 5CB7A 5FXWA 5AC91 3U1XA 1ZX5A 4BJ0A 1ENSA 1XNAA 4GMP0 3NV2A 4OI2A 5GM0A 4XJWA 3CZUA 2VMIA 5JXHA 5C9AC 1R081 4QX5A 1BK1A 2WFF3 5L9BA 4XJ9A 3Q8AA 2YZ4A 3SISA 2HWC3 1ZBE3 3A0NA 2D5FA 3PTRB 4FPEA 4AGGA 3OEBA 4JVAA 4GZ9A 4RQPB 2HWB1 5B4NA 1EP0A 1D4M2 2V73A 1NUKA 2WABA 1CJPA 3N7MA 4R52A 1NXMA 4RYDA 1B35B 5EFUA 3VDAA 5FYMA 2XGXA 5HCFA 3ZPYA 1M4WA 1SQ4A 4RFT0 3A4UA 3K77A 3OGRA 2W5FA 4Z92B 4AEDB 2XWJB 2JIJA 4AI9A 1GWLA 4E4SA 4DMIA 2ZGPA 1W9WA 1IS3A 1AVBA 2K9ZA 3AP9A 3MEPA 5FZ9A 3WF0A 4C1XA 2AH2A 1UL9A 1OXCA 3JU9A 2RS51 1GZTA 3B69A 4P9IA 3AP6A 3AZWA 1GANA 4RGGA 1WW7A 4DEVA 3WNOA 5C4WC 1ODNA 4AW7A 3FC0A 3WQ1A 4YM1A 4IV3B 2HWE2 2WR9A 4ES8A 5A33B 3VDBA 2RM23 1LEMA 3NAPC 3OUJA 3ZFEA 5CG8A 3W20A 4R4XA 3W9AA 2A6ZA 3MF9A 2QQPA 1SLIA 5D2AA 4AEJA 1W8TA 1PGW1 2YU2A 1DQ0A 3IAPA 1YQ8A 2QQJA 1E5SA 2ZGRA 5FAXA 3ZXEA 3MFCA 3ZMNA 2MNGA 2BZDA 2VAUA 4COUA 1REEA 1B35A 1LHVA 4GD4A 2VMHA 1HKDA 1VRH2 1Q8OA 2RDSA 1UYPA 4KWKA 2VNRA 4XUOA 5C6CA 2W08A 3NAPA 4A3ZA 1AX0A 1NCQA 1JN2P 1Y9QA 4AFAA 1NA1B 1GNHA 1GNZA 2ETEA 1DG6A 1W9SA 1DGWA 1ND3C 4ASMB 1PMIA 1BZWA 4IEPA 2BGOA 4A7YA 1JUHA 1UOGA 2A7AA 4IQPA 5L73A 4NIAA 4BE3A 1ENQA 5A1FA 2A6XA 5JR7B 3K51A 1QJX2 1MEC1 3LAGA 2H0BA 4L9BA 4KG0A 2DF7A 3VDDA 2J22A 4DIQA 2YBKA 2GP5A 1MS8A 5FY0A 2D7FA 3DYMA 5JXIA 4UFLA 5E88A 1AJOA 5JOZA 4Q4Y1 1C28A 1GNYA 1N3OA 4DINB 1D7PM 3J4UH 1IZ3A 1XXNA 1O7FA 1RMU2 2VL4A 3MIFA 2R073 3NRUA 2QCSB 4XUNA 3DYPA 4XURA 2VTXA 1PX3A 5A1LA 4CU6A 2E7AA 3FN9A 1R093 1W8OA 3BYWA 2B8MA 3BTXA 1CQ9A 1CPMA 1I6XA 2R041 3VBSB 4HLTA 3KM5A 1PIV1 3JCIA 3H3UA 1JYIA 3GYDA 3J7NA 3VHRA 1GV9A 3TEZA 4FXGB 4WM7A 2WN2A 4FBFA 1OUSA 1S0GA 3S7IA 3SEPA 4L8QA 5KXEA 1EUTA 4K9SA 2FDKA 1Z78A 3AJZA 4XFAA 4XETA 4XJAA 2F4LA 3U07A 1S2KA 2X8KA 5A6XA 4KU8A 3HIFA 4JGZB 4YG3A 1ZBA1 1V6KA 1MS9A 3H1MA 1NLSA 5FMBA 4HVQA 4BIFA 4AQSA 5F5QA 2R071 1MACA 2B42B 2GP3A 1JOBA 4LORA 3I2JA 2VCAA 3NJZA 1W06A 4HETA 4O9EA 5H9PA 3WQBA 4V2VA 5FYZA 1UYZA 2WNVC 4NHLA 1V6JA 4W50A 4RD7A 1S0CA 5D8AB 2VNGA 3OPTA 4DUVA 1ULCA 5C8CC 2A71A 1XNKA 1OA4A 2EICA 2ZKLA 4CCEA 1LHNA 4XIKA 5K0UA 3O1SA 2XH6A 1C8M2 3TN93 3ZYFA 1MR5A 1RUD3 3O14A 1GU3A 1IQDC 3HT1A 1WLTA 4TWTA 1VJ2A 4MLOA 3CF6E 1QXJA 5DZFA 4O65A 4XDOA 2RMU1 3TOJA 4IEOA 3ZN4A 5DPNA 3CJIB 4QB2A 4COZA 4BIOA 5A7QA 5G04L 1C8M1 1AR91 3I8TA 3VBFA 1US2A 4RS5C 1QNYA 2J1UA 4QDSA 3W21A 1PVXA 4YW3A 1WMXA 2K0GA 1GWMA 1GQHA 2VC9A 4BH9A 4MXWA 4ZZ8A 3S6PA 4N7UA 1RB8G 5F6KA 2OS2A 1X50A 4RFRB 2OA2A 5G05L 4UFHA 1QDOA 4I01A 4LBQB 4ZZ5A 3BPSA 1OPOA 2NMOA 5M0TA 1W3VA 1W6MB 3AXDA 4LNVA 4EWAA 4B7EA 3CL1A 4YG0A 2CWMA 3OGSA 3R6SA 1AYN2 5L7OB 1AR81 2BBAA 4N43C 5J09A 5ISLA 4GKXA 2JD4A 4KWJA 4Y22B 2Q1FA 1WD4A 1NY72 4Q0PA 5IW0A 4Q0SA 2F4PA 4XAAA 4YSFA 5C5TA 4FP2A 1X9TA 5H9SA 2OW4A 5CKMA 5T50A 4UBHA 3DXTA 4UWDA 4JKMA 3POEA 2HYXA 1HRV1 3ABZA 4BA6A 1RC6A 3FL7A 5FLIA 1W0OA 3BIWE 2Z5WA 1NG0A 1OBNA 4N43A 4Q4V3 2GDFA 5IVBA 1RUF2 3N9LA 4JC1A 3VKOA 1V9U2 1ACCA 3T2TA 4S2HA 3H8OA 3CDZB 3JZVA 3L2HA 4W65A 4Q4W1 1APNA 3PVNA 4YM2A 5I8TA 5EWSA 5JOWA 4A6OA 4K7JA 4CCJA 4PIXA 3INAA 4OQ9A 3QACA 4EYUA 2Z2SB 1F8VA 5ANQA 1C57A 1LJ7A 1VMJA 1QY4A 1VBC3 4DO0A 1XYNA 3M2MA 3NV3A 1Q5OA 2KA3A 2WN3A 3M3CA 1O4TA 2BU9A 4QPGB 5DG2A 1LEDA 1PK6A 3IMMA 4IETA 1K5JA 3KF3A 4KH9A 2V5DA 3VBHC 1V70A 2VZPA 3E97A 5DMYA 4YZ2A 4PBPA 2WT1A 4JCKA 3PDQA 3ROUA 1H0BA 2EA7A 4BXFA 3AYEA 3AP5A 2Y0OA 4CDUA 4LBLA 2J1AA 4OLLA 1RUG1 1RIRA 4M3CB 4YVWB 3LFIA 2D5HA 3HQUA 3PTYA 2ZXQA 5FK7A 1VBD1 5C4WA 5IFPA 1OQEA 3WDXA 1BMV1 1JU4A 4YW6A 3D3AA 3AYCA 2VPVA 2CGOA 1EY2A 2RS12 1UIJA 3G7DA 4IV1B 4JZRA 2RDQA 5LA2A 4Y5SA 4UF0A 4QU2A 2YYOA 4DXSA 3LOIA 1HRI1 1FYUA 4OHVA 2UWBA 2HH9A 5B2GB 3OB8A 3B94A 2PFWA 3KWVA 3H0OA 4KI5M 1MZ5A 4QGMA 5EYXA 5FZ1A 3KCYA 4UF0B 3I2OA 1ENXA 1GP5A 1S0JA 4K20A 5DUUA 3P1IA 2CGNA 4PF1A 4URAA 3H8RA 2X5IA 5JOYA 2IC1A 4UFMA 1AYM3 1UPSA 1YNAA 4JAAA 5A70A 3FFZA 4XZPA 5FY4A 3LD8A 4OHYA 2LM3A 1XC6A 4Q4Y2 5LBCA 1G9CA 4N53C 4IDZA 1UZ0A 2TEPA 2GNBA 3VN4A 1H2NA 3T0AA 3RZMA 1UY0A 2VM9A 3FUOA 4NRQA 3VKFC 2HYKA 2ZGNA 4CP1A 4EN8B 2X05A 3KGZA 1MQTB 1LOGA 1O5UA 4M3CA 1UQXA 1DYKA 3OTFA 1RUF1 2BDRA 3WW4A 3GHMA 1O8SA 4LKEA 3VZJA 5BNOA 3WUCA 1ZRDA 3VZLA 1HRI2 5FP8A 1V6OA 5F1RA 1GICA 4AFCA 1O8PA 4AVTA 1ZZCA 3I4IA 3FHIB 4DS0A 1NXD1 2JDKA 4Q2FA 5GLZA 1BEV1 1J3PA 1G9DA 3ZSJA 5C70A 5JR2A 4MO3M 1SLCA 1T2XA 3S5QA 1HLCA 2PELA 1W0PA 4XXPA 3IWZA 1ENRA 4IV3A 5A33A 1R1A2 2P1BA 2A5ZA 3KQRA 4YGCA 3KS7A 4RGKA 5FZOB 3M3QA 3VDDB 2BTVC 3WD5A 1YO8A 4Q4W3 2FCUA 1UZVA 4XCAA 2IXCA 2VOWA 4ZU4A 5A7OA 2J1SA 4WM8B 1RUH3 2PAKA 4XDQA 4BQ2A 1DZRA 4ET7A 1W6NB 2YU1A 5EP9A 3OEAA 4IEUA 1PO13 2W1SA 3IB3A 2G4IA 1D0HA 2R062 2ZEYA 4BK4A 3KHBA 4FPCA 5FPZA 3O5SA 1EPZA 5FY5A 1RITA 2ZGOA 4CDUC 4YVSB 4Y24A 1SLTA 3RMXA 3ME2A 5FZLA 3ORJA 5FYBA 3TN91 1KS4A 2Y6GA 3EBRA 5AC93 3Q8CA 1PGL2 1WW4A 1YXWA 2Q8OA 5LWBA 2DVFA 5FIXA 4L11A 4EWEA 1JTZX 2BFUL 1HN1A 1W6OA 1DQ1A 1UU4A 4CDQC 3TEWA 3GNEA 4CEYA 2JE9A 1HV0A 2YG0A 4E8DA 3EJKA 3ZYBA 3BB6A 5CKNA 4XHBA 2VUDA 4LO5B 1FOD2 1LB2A 2VQTA 2ZEWA 3I2DA 3D0SA 3HNBM 4BQYA 5AC92 3UGGA 4CXXA 1PMHX 2Y6KA 4Q0QA 1PVC1 3QD6A 4TSVA 2OZJA 1SFYA 2ZHNA 2B7YA 3HD8B 4QPYA 2YPJA 2VXJA 3I3DA 5A1AA 2RMU3 4QDQA 1W6NA 5F3CA 4LE3A 3IN9A 2WKKA 2C24A 2D40A 4XUTA 2P37A 5I8SA 2F6BA 2WAAA 4HVOA 4YGDA 1RUC2 4ZS2A 5LZ6A 2WNVA 3POWA 1VLNA 2XJPA 1LHWA 1Q8VA 4CU7A 1IOAA 3ZFGA 3HJRA 1GYKA 2W94A 3ZO0B 3ELNA 4AWDA 2RR11 3H50A 2VMEA 1W6QB 3BU7A 4PCRA 3THTA 4AG4A 4CCCA 4AVBA 3KZ4C 3PURA 1WBLA 2TNFA 3NNLA 2KR2A 4YVWC 2D6LX 2O8QA 4DOUA 2ZEZA 1RUC3 1SDDB 2W92A 4A41A 2XJRA 4Z2AA 1LOCA 1JMUB 3IDCB 3ACGA 3K4DA 3GZEA 2YFUA 3GGLA 1YI7A 3LB9A 4P9WA 5FXVA 5FPUA 1J1LA 4MZUA 3WLUA 5JMCA 1QJY2 1UN1A 4KU7A 2FZ2A 3SC7X 5CFDB 1NOVA 5HXMA 1QJX1 2JX9A 5LB6A 4KQ7A 5CVRA 3WP3A 4E4ZA 1FNYA 1YQ2A 1UMIA 4QKBA 2E63A 2WS91 5E6HA 4AVVA 3MPPG 1AHSA 1PK6B 1RUE2 5DQ0A 4YVWA 5E89A 5FZ7A 5C33A 3U4XA 5CFDA 1ND3A 3MW3A 2ES3A 1DIWA 4R9AA 4OQ8A 1FOD3 1RUI1 4FI9A 2W3JA 4NPLA 5BNNA 3SCHA 4QMAA 1J1TA 4XMAA 1NCQB 5LCWL 1H8VA 4HKWA 5GZFA 2WA4A 3UETA 5FLJA 5IVVA 3FLRA 3RYRA 4NIGA 2VW1A 2V4AA 4L97A 3C8XA 3NNMA 1OLMA 2H6CA 1RHI1 4Q4Y3 4S2GA 3G6JB 4FVVA 2D6KA 1RUH2 1N3PA 4Q0VA 1URXA 2XVLA 2WZPP 5KR7A 4I3GA 4LHKA 3DXUA 1CX4A 2PXJA 2EIGA 2J42A 3MYXA 2O0OA 3C3VA 1OLQA 2OUHA 1CIWA 1H8TB 1QQP2 1UXZA 1ZNPA 2VD7A 3NVCA 3KVAA 1PHMA 1AR83 3AYAA 4Z2WA 1X33A 2P5BA 2XUEA 5KHHA 1H2LA 3M7AA 1FATA 1ZZ7A 4KNCA 5L9RA 4XF3A 1SEFA 2LALA 1OQ1A 1SDWA 2VVEA 2IWGB 4NIIA 1DLCA 1JXNA 2WWJA 5A32B 2WNUA 2JDYA 3SH3A 2KXLA 2PHRA 2D97A 2FBEA 4RS5B 2FZ1A 1OH4A 3BN6A 4P9LA 4XC9A 3WDUA 5FOBB 2D3PA 2FMYA 2IFRA 3R0RA 4QQLA 3URFA 2I2SA 2I74A 2QKDA 1COV1 2JDNA 4I3PA 3OUHA 5J98B 4BISA 1JYNA 2DCZA 5KHGA 1KFXL 3ZXAC 3ZFFC 2B39A 4YW7A 5A7SA 2JICA 4TXWA 4YYOA 1FAYA 1ZZ9A 2EF6A 3RZGA 3FHAA 1Z7S2 4ITCA 4XEZA 1GR3A 2DV9A 3PJQA 2ZMLA 4OZOA 5JXGA 1C3HA 2OZ6A 2WNUC 3AZZA 1UX6A 3HWJA 3MIHA 5KXCA 1BBT1 4GB31 3U0ZA 2G9FA 4BOWA 1DQ2A 3T2QA 1H8TA 3H7YA 3M3EA 4UW4A 5L19A 2TBVA 2ERFA 1KQRA 3ON7A 3PIGA 3UYJA 3NNFA 5FTTC 4D7YA 4L99A 1QH7A 1KEXA 2UY8A 5AVAA 1OOPC 4ZU5A 4PT6A 4XILA 2QZ3A 5FUIA 4AAXA 5LW9A 4C1WA 1YQ5A 4NE9A 2ARXA 5GKAC 1B09A 2PA7A 3DEMA 2Q8CA 1R083 2KM2A 2VVDA 3W58A 3WXPA 4LA3A 3JXSA 1JYTA 4LHNA 3J8F3 1SHWB 2HWB3 5CFCA 1LESA 4GJZA 1PO23 4HPKA 4CP2A 3FUQA 4LULA 5A3LA 5F3EA 4GMP1 1ND2C 1YWKA 1Q8QA 5D8AC 1VALA 1F35A 4QKNA 1XNCA 4CA9A 1RUD1 4DFSA 4HOOA 3MZHA 4MGKE 1PM7A 5BNNC 2GMMA 1NX9A 1XE8A 3PUAA 2PTMA 5IWFA 2GNMA 3H1YA 3W5NA 4RHV1 4MGSA 3O1OA 3H8UA 3C2UA 4SLIA 4ZXEA 3U78A 2DVBA 3OPWA 2R49A 2ZBJA 3T3YA 4CE8A 2SBAA 1AXYA 1NT0A 1S0IA 2OVUA 2BVVA 2WO1A 3NQHA 2UWCA 3RZJA 1YJLA 4MV2A 1FOD1 3UT0A 1E57A 3H3LA 5D1IA 4RGAA 1GP4A 1SLAA 5T5LA 2BRTA 4CEWA 1YJKA 4XAEA 2AEZA 4MX3A 3VDDC 3X29B 3PVBB 1KS5A 3OY8A 5A3UA 2RS31 4O9GA 1XNDA 4FTEA 5FBJA 1DDLA 2GZWA 2J1RA 3MDPA 4CEWB 4FAGA 5CFCB 3B02A 1QOSA 2XKOA 3UKVA 3WF2A 4AOCA 4FPHA 5EJ3A 1VIWB 2W39A 3U37A 3LA3A 3O12A 2Q0AA 3RZZA 3BPZA 1QNWA 2QQNA 3AMPA 5FK8A 2VCMA 3WINE 4YW1A 1UKGA 3SITA 1XYOA 3N7KA 3PU8A 3KT1A 4H55A 4GULA 1VBC1 2AREA 3EYPA 5LBBA 1OF4A 4CUBA 2MPFA 2A6VA 1U5ZA 5T52A 3B7MA 3N35A 2O8OA 4Q4V1 3O0XA 4XQWA 3T2PA 2RR13 2XL9A 1LULA 3WP4A 2WNOA 4CDQB 2QQWA 5AFBA 3WNPA 3AKPA 3DPRA 3IAQA 4Y20B 2OPWA 2PQQA 3IDBB 2V5YA 1A6CA 4D69A 1G9BA 2LTNA 3VBFC 5KHIA 3U10A 5JVVA 1H9PA 5BYNA 3T1MA 3WP5A 2XWBB 1RUJ2 2EVXA 4XPVA 2PHXA 2E7QA 1POQA 3IKWA 1POV0 2IZWA 3NV4A 4GWJA 1NCRA 4QPIB 5GLVA 2VVFA 4QXBA 1EPWA 1PVC3 2D98A 2RJKA 1H1AA 3BI3A 3CKHA 3HAGA 1CIYA 1OOPA 3MF6A 2WUHA 4QXCA 5ACA2 1KRIA 1I3HA 2OQ6A 1YCIA 2VCBA 4RR3B 1KJLA 3DCQA 3HMYA 4FSJA 4B7KA 3P3NA 2DTYA 1DQ5A 1OFNA 2JEMA 1O3TA 3JD72 2E31A 2D44A 1DGRN 5FO8B 3BTYA 1QQP3 4JDMA 4XF1A 5FRAA 5BNPA 4MXVA 4D3WA 3H7JA 2ZEXA 2XOMA 4HFSA 2SLIA 4OI0A 2PN5A 4TYSA 1O4ZA 1W6PB 1ZBE1 2VCCA 3AKQA 2PYTA 2AACA 3V0AB 4Y1YA 5HI0A 4I0WB 3LFMA 2GC1A 2W2IA 3I2GA 3KV4A 3WVJA 5IK7A 1PO22 4PLNA 2UU8A 5TSWA 5FZ4A 5BNPC 1K5MC 2EXJA 2CL2A 3IIAA 3J9SA 1UIKA 3AL6A 4QQOA 2IVJA 5T5OA 4G4FA 3V65A 4LO4B 1FMD3 4FPLA 5HV4A 3KCCA 3PUQA 5FMOL 3VBRB 1LECA 1A8DA 2PHWA 3ZFFA 1PZ8A 4WVZA 3ZYIB 5J48A 1ONAA 1G9AA 1V6IA 1JS9A 4Z8BA 2YXSA 1VBD2 1W6MA 1WA4A 3JQWA 4KL1A 4XMIA 1V9U1 3VBHA 1W9TA 1TME3 2ZHMA 1X82A 4E2SA 2ARAA 4FQ4A 1QKQA 1Z7S1 1ZBA3 2L9LA 4XTMA 3BOPA 5A32A 2OXBA 1VR3A 3MHZA 4LKFA 2HJIA 2ZKNA 4O7XA 2BYVE 5F2SA 5CADA 2PLV2 3RWNA 1H9WA 5DUVA 4JQTA 4LK6A 2WQZC 3O0VA 4FXKB 3BTAA 4QQHA 3VD9A 1ZYBA 2ZX0A 4COVA 3AM2A 5FDBA 3ZXJA 1RINA 1VBA2 3TYJA 1KDMA 2C9KA 3WG1A 4EWDA 2MHFA 3ZIXA 1S0BA 5JPMB 4C91A 1HV1A 2W9XA 1GZ9A 3VBUA 2FD8A 5FWEA 5FZEA 2VOVA 3CJXA 4PBOA 1VE0A 4I0BA 2ID4A 5JIAA 2FDIA 3SNMA 2VZ3A 2IXLA 1JYCA 2X5IB 4YNIA 2ZACA 1PIV2 4FPFA 1W2NA 3POJA 2JDUA 3VGIA 1BCXA 4GQ7A 2HWD2 3FLPA 2HWD1 1Y9MA 3AB0A 4DZGA 1IG0A 2CAVA 3OCPA 3QLQA 2VTXJ 2VJXA 4QB6A 1QOOA 5AFEA 2UWAA 3LA2A 2WL1A 4CU9A 4PDWC 4CVUA 4BQ5A 5J7MA 4NROA 3FHQA 5FPBA 3D6EA 1HRI3 4IW3A 2ZGKA 5JDBA 4FPGA 3NMBA 4GMP3 2Y26A 5DDJ1 3WP6A 2BV4A 4IE5A 2QDRA 5DZEA 4BM8A 3VD5A 5DAXA 2IXJA 4YVSC 4Z82A 3BTZA 1H2KA 2R043 1CPNA 4RSUA 2XQXA 3J7HA 4P00B 3LIHA 4PLOA 1W05A 3OUIA 1DGLA 1LGNA 1OI6A 4XVHA 2DFCA 5EV7A 1HN0A 4WM7C 1GQPA 4AGRA 1K45A 2WZ8A 5LATA 4JKKA 4XZUG 3OYWA 4DRVA 4IL7A 5IT6A 3E5XA 1EAH1 2CV6A 1KFUL 3MBWA 3UK9A 1ZM1A 2GNDA 1R64A 5ABJC 2RVAA 2GAUA 2JG9B 4ARYA 2C5DA 1AR72 5DABA 1RTVA 5E8AA 1X8MA 4AL9A 1GOHA 5C9AA 2R063 4YM0A 3GZUC 4AHZA 5JPNB 1MZEA 4PJYA 5FBZA 1UU6A 3RI8A 1XSRA 3IIIA 2WSUA 3OGVA 2XJUA 1OLRA 2ZGSA 3GDBA 4AQ2A 5C8CB 3DF0A 4KGGA 4CTEA 1W6QA 1ULGA 2RS53 2Z69A 3RPQA 4PF5A 1VP6A 1MVQA 1VRBA 4MGIE 3ASIA 4K40A 1J3RA 4OHXA 1QJU3 2YC0A 1CR7A 4DXRA 3D5OA 2R1BA 5FZBA 3ZPOA 2IFWA 5ERLA 1SBFA 3NWKA 4L0PA 2ARBA 4ZY9A 4BQ4A 5C71A 4XFFA 2ZGTA 4OVEA 1ASJ3 1ZBA2 2ZZJA 1H30A 2NZ9A 4YZ5A 4PIZA 3HN1A 2XVKA 2HWC1 1LOBA 1W3XA 2BOIA 2WZR1 3A0KA 3LA7A 1PZ9A 1O3SA 2P6CA 3A22A 3ZN6A 4S2FA 2XLFA 1W39A 3UJQA 1UCXA 4P9YA 1LCLA 5FKBA 4K6BA 5A7PA 3L9JT 3ZFFB 5FREA 5J36A 2VOXA 3I2HA 3WF3A 2H0VA 1GOGA 4BCUA 2BVBA 4NN0A 4YZ1A 2ENRA 2WNUB 4XTPA 5FXZA 3UNPA 5EIYB 2FCTA 2ZS6B 1AL21 3UGFA 3LPFA 4NAOA 3VZOA 4E2GA 4EN0A 4L2NA 1H4GA 2P3KA 5L9VA 1RUI3 4IGQA 4BLJA 3RWKX 1PGW2 1FMD2 4LE4A 5F37A 4LO6B 1AR93 1AXZA 3N9MA 3RNSA 1S0EA 3C7OA 5F9TA 4D7SA 4Q29A 1TE1B 5C3OA 1RUJ3 3BODA 4Q4V2 2DUOA 2VZ1A 4P9JA 3ZSKA 5CBLA 2C26A 2XHNA 2ET7A 5FPVA 3RI9A 3SHRA 2AYHA 4EZHA 3TWIA 1ZBE2 4H7LA 4OYUA 1J84A 5FMCA 1YFUA 5DXDA 3LEGA 5FP7A 2DVDA 2YPDA 1XJAA 2W68A 1MS3A 4CP9A 4EN7B 4XQ4A 3DKQA 5BPXA 5JSRA 1HB2A 1VRH1 2EIBA 5KBFA 4D8MA 4TN7A 3Q9OA 4CCLA 5BUVA 1R1ZA 1EAH3 1WKYA 3SH4A 1ALYA 2ZMNA 4CUCA 2RDNA 3NKGA 2HWB2 4CRQA 5K8SA 1W04A 3TEXA 3WNXA 2XJQA 3ZFEC 4MADA 2FDGA 1TVGA 4AI1A 4NO4A 4DUWA 4D6RA 1POV3 2HWE1 1CX1A 4AFBA 1AYN3 4WZCA 5JIUA 3BOWA 1G6NA 3BALA 1TNRA 3VD4A 1IPSA 1O91A 1YLLA 1HXS1 3GZAA 2VH9A 4CP0A 4BQ3A 5J37A 2YGLA 4RHV2 1DFQA 4P5HA 2VUCA 2H6BA 5B4XA 2VNOA 1JYWA 2ET1A 5I0TA 2PQSA 4QX1A 2ORZA 4AEKA 3OD0A 1KDKA 2WQ8A 4CDUB 3VD7A 1RUD2 5FXXA 1CESA 3LOBA 3EXUA 4CP9B 3H42B 2JKBA 1JU3A 1EV13 5C3QA 3DGTA 1IPKA 4DXZA 4LPLA 3WY6A 4LK7A 5CAZA 3I59A 4ONUA 1PK6C 5JXJA 1QH6A 1V9U3 4QHBA 3KD4A 4OHWA 1ZA7A 4H14A 4JX0A 1IS6A 1F2NA 3I3MA 1OSGA 3HQRA 4IE6A 4FCAA 2AENA 4Q27A 4GH4B 2HBTA 4F83A 3TBDA 4AFMA 3F95A 5HPOA 4MYEA 3V0BB 1WD3A 1L7QA 1XU2A 1W6PA 2WNVB 3WOGA 1ULPA 4R9BA 3DECA 4EJRA 2EIEA 4QHOA 4LMFA 2GU9A 3WHUA 1ND2B 3THPA 1S4CA 1RUG2 1UU5A 1NE6A 4COWA 3ZN5A 4GB32 4JGYB 3I97A 4QM8A 1UMZA 2WYSA 4WZFA 3TB0A 4NHMA 3I49A 5CA6A 1WMFA 2VE1A 1OT5A 2D43A 5HCAA 4BWOA 1V00A 2OT7A 5KHJA 1GP6A 2YUEA 1WCQA 2JDMA 3C7FA 3JUUA 1CGPA 2W1WA 4QKFA 1R092 4PIYA 4ZS3A 1W6OB 2HWC2 1VBE1 3THCA 4XJUA 1XSQA 2UYAA 1D0GA 3HR9A 4ZU7A 1US3A 1BEV3 1O59A 3HPNA 4CSWA 1NCRB 2E51A 2R1DA 2RS13 4EE2A 5A3TA 1R1A3 3BVCA 2DURA 1OVSA 1GQGA 1WCUA 5JI7A 3ZFGC 1JZ2A 3KLSA 2ZABA 4V1PA 2W91A 3PMEA 1VB4A 1IGOA 5FYSA 1ZZ6A 1UX7A 2LW8A 2QZ2A 1UD1A 5LK7B 1UZWA 3M3IA 4M0NA 5LA0A 2IXIA 3VBSC 3ETPA 3M1HA 2DVGA 1J59A 3AC0A 2VW0A 1SG3A 1NZCA 1NLQA 2XJSA 1ULDA 2CAUA 5F5IA 5FZOA 3T1LA 3VUOA 1ND2A 4Q4X2 5CEHA 2R7EB 2JJ6A 4B8EA 3ZXLA 3JBG2 2Y6LA 4A7KA 1MZ6A 5FZDA 1M06G 1QIQA 3LEMA 1F9KA 4FO9A 5IVCA 2BNMA 4RQPA 3HNMA 1C8NA 4LITA 4ZHNA 1SMVA 4YRDA 2VZRA 2DWRA 2XL7A 4HT1T 3ZXGA 4AK3A 4WM7B 1Q56A 4Y1XA 4MOAA 2QQMA 5DAWA 1FPN1 1OOPB 2DBNA 1W90A 4RR3A 1I5ZA 2LUWA 3E6BA 3CO2A 2GC3A 3KVBA 2PHTA 1RUI2 4GKYA 4IERA 3WF1A 1DGRA 3O1MA 5T54A 2VZVA 4NMIA 5FZ6A 3VBFB 4JV4A 1PMJX 1V0AA 2EXHA 1O6UA 4YARA 3KGLA 4HG6B 2NMNA 4N7IA 5FY8A 4LHLA 5FZ3A 5T5JA 3ALQA 4XFHA 3AZVA 3AX4A 1QJY1 2VQAA 1IQAA 2W1QA 5LRRA 3QBQA 4LOTA 4UFKA 4CDWA 2R6QA 4XOGA 4BQXA 4EN9B 1JZ7A 3LKJA 5D8AA 4X6QB 4BU2A 4OHZA 4LOSA 5DN2A 3RZKA 2D3RA 4Q4W2 1ZRFA 4D6SA 1QQP1 5DZGA 4NIHA 1XQNA 2XBO3 1QXPA 4U2AA 4K1YA 2VULA 2ZMKA 4Y3OA 1WLDA 2DCYA 3S5AA 5GLUA 1G86A 2QE3A 5CU1A 3SCGA 1SBDA 4R4ZA 1MEC3 1W0NA 1ZRRA 4YW4A 5AVPA 4XE9A 1XB9A 1CAVA 2QQUA 4XJ8A 1RXFA 1UXXX 2BW8A 4M00A 1RUOA 4IV1A 3LEIA 4HZFA 2JKXA 2BNOA 3ZOIA 3ZFGB 1RUC1 1HXS3 2E7TA 3AVSA 3OGGA 4CEWC 1ZRIA 3Q8BA 4INDA 5ABJA 3O1UA 4K21A 4BHPA 2VBPA 4XXAA 4CYDA 1W8WA 3DKWA 3KF5A 3WNNA 3GXUA 3U14A 5FZGA 1Q43A 4AQTA 1PVC2 1RUE1 2DCJA 2HLEA 2Z79A 1CN1A 1JW6A 4UBGA 1ZZ8A 3EMRA 3AVRA 4UAPA 5EJZB 5GLTA 1UPIA 3T0BA 1QOTA 2GH2A 2JG8B 5T3NA 3NV1A 3ZIWA 4E9KA 5IATA 3T4HB 3IT8A 1STMA 3OG2A 2CGPA 4I2OA 5FFOC 3I3QA 3VBOC 1U12A 1LOAA 2LS6A 1W8ZA 3B5LB 1Q8PA 1VBB1 1GZCA 1XU1A 2K2SA 2Q30A 3ZR5A 4QPGA 1EV12 1QMJA 2YBSA
chains in the Genus database with same CATH topology
2CTVA 3VL9A 2JG9C 1V6NA 4HKLA 2XPJA 2D6MA 2FMDA 3JB8A 3PVOA 4FTBA 5I0UA 3N7JA 2V09A 2TUNA 4XW3A 5F6LB 2VU9A 5GJ6A 2Q1ZB 3QH6A 3AZYA 1OA3A 3O0WA 4WBBA 2Y38A 3TN92 4UW6A 4R8HA 1D2SA 2B9UA 4QPGC 1VAKA 5EYYA 3NKTA 1PNFA 3OBTA 4META 1OMIA 2ZX4A 4FPKA 4WVVA 4FOVA 1ULEA 2X5IC 2BWAA 2P3IA 2WNEA 1IHMA 2ZX1A 3ZYGA 2ZGQA 3PJYA 5HBAA 2BBVA 1OD5A 2ZCWA 1GLHA 3WX5A 4MGYE 4N53A 1ULFA 1DQ6A 5LRSA 3ZFEB 2O1QA 3JD71 1IPJA 1IS4A 1BEV2 3MLJA 4XFIA 3TNPB 1DHKB 5L7OC 4LBJA 5JSOA 2VQ0A 2CWSA 3M3OA 1F5JA 4Y26A 4Q4X1 5CG9A 2XB6C 4QQPA 1PO11 5JZGC 3AYDA 4Y1ZA 5T5PA 3KB5A 3M4FA 4IXLA 5L36A 2FQPA 5GZEA 5KXDA 1REFA 4EROA 5IK8A 2BQPA 4YZ3A 1WW5A 3ZYRA 1JH5A 4M3CE 1MEC2 1TNFA 4LR4A 4FQZA 1WLWA 3MIGA 3QOPA 4DY5A 1RGSA 3J8F2 1R091 5K0UB 1VBC2 4JTOA 1QJZA 3M70A 1CAWA 4AF9A 1AJKA 4PDWA 3D0JA 4JRAA 4WV8A 1WGPA 3IDEA 2WFPA 4Y1VA 3R05A 2WIIB 4HSLA 3ECQA 4FT8A 2GC2A 4IESA 1AYM1 5KC6A 1N1TA 1ND3B 5EXOA 3AMQA 2NLRA 2GMEA 2ZGMA 4A7ZA 1FNZA 4DY3A 3RDIA 3WDWA 1HIXA 3D4KA 3IBMA 2CNAA 4KGQA 5DDJ3 5J96B 2RS52 5GZGA 4XF0A 2GNTA 1VAVA 1VBD3 5E16A 5BNOC 2VOKA 3B01A 2AR6A 4GH4A 1ZVFA 1CAWB 5K7PA 2HWF2 3OPZA 2RM21 1AL22 3ES1A 3S7EA 1CAUA 4XF9A 1OA2A 2EAAA 3OF1A 3J26N 2XJTA 2GN7A 3WR0A 5SV8A 1DDLA 1VBA3 2A6WA 2UURA 1U5IA 1QF3A 4QGNA 1YUDA 4XJZA 4AXOA 4E2QA 3B9CA 2R30A 2RS33 2VGDA 1AUYA 5K0UC 1OPMA 2W0XA 3UKTA 3POSA 4M01A 1G8WA 3SXWA 4M3CF 5I91A 3HQXA 4UXAA 4UW3A 2XKPA 3LSDA 3WZ1A 4X8NA 1TME1 2IXHA 3IPVB 1GBGA 3PVEA 3VZNA 3IMNA 2XG3A 3I7DA 3VBUC 5DDJ2 1MQTA 2DUPA 1XRUA 4AVCA 1A8MA 1AR92 3TNQA 1U5YA 3OJBA 3ACLA 1N3QA 4RQPC 1AX1A 4P14A 2UYBA 2HKXA 1YFXA 4LUKA 4N43B 3LSEA 3E5QA 2ZGLA 3MI8A 4XBQA 1AR61 2WA3A 3R4UA 1EAH2 5L7OA 1NE4A 1SCRA 1H1MA 1YI9A 4C0BA 1QJU1 2EXIA 3WUDA 1FV3A 3PMSA 2DU0A 2WFF1 1S1AA 3ZX7A 3ZSEA 4I0AA 1JOJA 1LOEA 2QUOA 5KWRA 4JGZC 3WV6A 2EALA 1YFYA 1C8M3 4DRRA 3PLQA 4FOYA 3N3HA 4AVSA 2BPA2 1N47A 2PLV1 3FBMA 2DCKA 4LBKA 1WCSA 4XBLA 1RUF3 4LO7A 3WG4A 3S0MA 4XFCA 1EYBA 5BNNB 1Y3TA 3I54A 3V56A 2A3YA 4AI3A 4XBNA 3VHOA 4JGZA 1BJQA 1U5XA 3AMMA 3CJIA 5JWPA 1AR62 1LHUA 2R0HA 3VBSA 4XFGA 2DUQA 2GC0A 2BWCA 2OPKA 1MS4A 4IEVA 1S55A 1UAIA 3RSJA 2E53A 3P3PA 4AHYA 1AR71 4IEQA 1ZA4A 3MW4A 1VBA1 3AK0A 3LGRA 3RJRA 2PHLA 5CFCC 2D6NA 4BMBA 2W52A 1GZWA 3UV9A 1PIV3 3UKNA 4YW2A 1CJDA 2DFBA 5FMOS 4JRLA 2RHPA 4DNYA 3E5UA 4EV0A 1FX5A 1KJRA 4ATEA 2Y0IA 1CAUB 1GZWB 2ILMA 1MS1A 3VBRC 4AI0A 1CONA 3GALA 4FOQA 4J1WA 1HQLA 2ZHKA 1CAVB 2R0FA 4LBQD 3USUA 4HANA 4ASLA 5CNAA 2A6YA 2R042 2PLV3 4XQDA 2CYFA 3EO6A 4JQRA 3FZ3A 4NPRA 4YW5A 1PO21 1ZREA 4HL0A 4JDNA 3KT4A 4QPIC 4MXWB 1RUJ1 1AXKA 2RM22 3JB4C 3BCWA 1PGL1 4CZSA 4YFZA 2I45A 3D8CA 2NM1A 2VUJA 2VUAA 2QDNA 4B4QA 3LZZA 1D2QA 1HW5A 2XUMA 4K8FA 2VG9A 4TLFA 2C9AA 4IEXA 1VRH3 3KCXA 1H8TC 2GSYA 4BYYA 1JUIA 3FBYA 1AL0G 4Q8LA 4XHXA 3NSTA 1W2UA 3CU7A 1QGLA 3VBUB 5DUWA 1IKQA 4MGZE 2FHRA 3RMYA 1AYM2 2QJVA 3MIEA 5H9QA 3KSCA 1GKBA 3VHPA 3AJYA 4L92A 4WVMB 1YYNA 4LBQA 2XHKA 2XVGA 1COV3 3VKNA 1S0DA 4AVAA 1VBE3 1YFWA 3KMHA 2I07B 1D4VB 3DL3A 1RJ7A 4MSVA 3ZXFA 4ZKTB 1QHDA 2ZJCA 4NWVA 3ZN6B 4H3WA 1HRV3 2D6PA 3VL8A 1CD3G 3POYA 4LLOA 1Y43B 3ES4A 3VBOB 5H9RA 4PQ9A 3VLBB 3USSA 3FX3A 2BFUS 4BMEA 1HXS2 5E1RA 3H3ZA 4ES9A 1LR5A 5GLWA 3CEWA 4QM9A 3GF6A 5BNQA 1PZ7A 2BEOA 1EV11 4H7MA 5CIRA 2VXRA 2UY9A 4DB5A 5C8WA 1QJX3 1BMV2 3MIDA 4XIOA 5I93A 3ATGA 4LUMA 1NY71 3CJIC 2YGMA 3ZMOA 1AR73 1C4RA 4PDWB 2G9GA 2R32A 2ZX3A 2GH8A 1H2MA 1NQDA 3HBZA 1HDKA 4ISQA 3ZYJB 3RRDA 3VHNA 2P3JA 1MS0A 2AGSA 1YIPA 3K48A 1QU0A 3MPBA 3USUB 3SH5A 1TMF2 3GBFA 1SFNA 4YGEA 3R4DB 3RG0A 1D4M3 5K9YA 1DQ4A 1RL3A 2GMPA 3DUIA 4QD2A 2P2KA 1FXZA 5CFDC 3DPRB 4Y20A 1CAXA 2EAKA 4AHWA 3VBRA 1XNBA 4X6RB 4IV3C 3LCPA 5SV5A 3N4MA 1PGSA 4FAHA 5KHKA 3FE5A 2MEV2 1RHI2 2E6VA 1BVP1 4GXLA 4FOWA 4Q1RA 5ACA3 3D82A 2XLGA 4PLMA 4RR3C 1Q8SA 5IK5A 2QNKA 1AL23 3ETQA 3V64A 3HT2A 5LEKA 4IEYA 1XE7A 4OZXA 1NA1C 2WT0A 1CVNA 1VB2A 3MIBA 3NW4A 1MVEA 1IKPA 4HSJA 3S30A 4CDWC 1LKNA 3AXEA 1XYPA 4S2DA 2P17A 3JQXA 1LENA 2WZR3 1RUH1 1X7NA 2RMU2 4B29A 4Q8KA 2ZGUA 2RE9A 4AEDC 3ZSMA 1S0FA 2DVAA 4HKOA 4M0HA 1REDA 5BNPB 5JAXA 1N1SA 1TME2 2WZR2 3EHKA 4A2UA 5A3MA 5JOXA 2NYYA 2WLPA 2ZX2A 4Q0UA 2QVSB 2PAMA 3UJOA 1Y7BA 2HEWF 3EQEA 2PHDA 3GBWA 3MICA 3B93A 3IPVA 2JECA 1L3JA 1MQTC 4Z07A 4C90A 3JBG1 2NPIA 3ILNA 4RL7A 2JG9A 4P9GA 4OFGA 3QCWA 4N9HA 1RUE3 1C5IA 2ZAAA 2AZ5A 1UZZA 3ILFA 2X29A 4RS5A 4CEYC 2WS93 2ZOEB 2A70A 1RMU1 1HQWA 2XBO2 4I30A 3VKLA 1YRZA 4K1ZA 2R061 2Q4SA 2HWE3 2D93A 3FJSA 1QJU2 4WM8C 1RUG3 1UW8A 3AP7A 2WS92 2B46X 1D4M1 3AKRA 1RVF3 3AP4A 3AMHA 3MW2A 2WT2A 1J3QA 3AZXA 1CAXB 5JSPA 1PNGA 4JDOA 4AI2A 1IS5A 3I59B 4QPIA 2ZTNA 4G3YC 1A78A 1Q3EA 1TMF3 4RA0A 2WSVA 2Q5TA 4AI8A 1N1YA 4YZ4A 5EZWA 2DU1A 4UW5A 5GZCA 3DPRC 1RMU3 1TMF1 4BZ4A 2WINB 3SCFA 3UL2A 4TZDA 5BV6A 1SLBA 1X8EA 1Z7S3 2RR12 4MVTA 3J8F1 4NWWA 4E4DX 1WCDJ 5T55A 4GIQA 1V6MA 4FPYA 1BXHA 1NQJA 1BKZA 3TAYA 1FT9A 2VMGA 1MS5A 3PHMA 1OFSA 3ZXDA 4CEYB 1LOFC 3FMGA 5FLHA 1WBFA 4Q4X3 3PNAA 2D3SA 2WLQA 5I0RA 2R16A 1FI2A 5FQ0B 1H4HA 2MEV1 3WW1A 1F31A 2WQ4A 1PO12 4MUVA 5KC5A 4BLIA 4CDWB 3JD73 4BQ1A 1VAMA 3FFQA 2RS11 1FPN3 3VBOA 2NP0A 1B35C 4YM3A 2YDEA 1C1LA 1T6GC 4XFBA 1AR63 3SLIA 1TQ5A 2JE7A 4FPJA 4XYXA 4I09A 1OQDA 4B4PA 1RUNA 4GB33 1WUVA 4LEJA 3NO8A 4R9CA 4C0HA 4U36A 2BGCA 1SACA 1X36A 3AKSA 3ZSLA 4LTAA 3N36A 4A3XA 4GH4C 4OI1A 3W59A 2GALA 3RQ0A 2VY0A 1R1A1 4DQAA 3VV1A 4I02A 1ASJ1 2C0ZA 3WDYA 5FPXA 2PHUA 1LODA 4Z8BA 4JGYC 1HX6A 3U11A 4HMZA 3B9IA 2OYZA 5ACA1 4YLZA 5I8YA 4Y22A 3V0BA 1HRV2 1SBEA 4AEMA 2Z42A 5DUXA 4E27A 3MFAA 1ZZBA 3GZTB 3FLTA 3WCSA 3ZXKA 1DBNA 1O5LA 1DYPA 3WW3A 3WQ7A 1LRHA 2OUJA 4GWMA 4Z1VA 1AR82 3GBGA 3NL1A 3AKTA 5HCBA 3WDVA 1AYN1 2JENA 1LOFA 2JXAA 4AYUA 2XBO1 1ZRCA 4B3NA 1DU3D 3SMHA 4OUMA 2X53S 4AHXA 4K3UA 4W6XA 4LT5A 1BVVA 3ENRA 4MH0E 4NVPA 1JHNA 1I1EA 1QDCA 1QJY3 3H1WA 1Z0HA 4FP3A 1SLLA 4Y5Z0 2JG8A 3OBRA 5IK4A 2ZAHA 1KITA 2RJLA 4COYA 1JBCA 5JLVA 3WG3A 3WQ0A 2HEYF 5FO7B 3M8LA 4HPKB 4QQ2A 4CDXC 4KG8A 3B3QE 4J1XA 2C1FA 1KXGA 1V6LA 4YG6A 2WJSA 1AF9A 1WMDA 4KWLA 3VKMA 2BNNA 2GN3A 1COV2 4YGBA 3JBG3 4HN0A 5KXBA 4ATFA 2D6OX 2VW2A 1LTEA 1WCKA 1K5MA 1SCSA 3WDTA 3ILRA 4WVWA 2Q1MA 4N9IA 4WM8A 1DLLA 1G9FA 3LWCA 1BBT3 3OD4A 4D7TA 4QXKA 3O7OA 2MEV3 4Y1UA 1BQPA 4LLFA 1C1FA 4J6GA 5JI9A 1NYWA 5C8CA 4GWNA 1VBB2 3WG2A 2YROA 1NCRC 5DG1A 4LBNA 5BY5A 5HXVA 4Q1PA 4HVRA 4BPZA 3ZVXA 1BYHA 5J3UA 4DPNA 5JZGB 1BBT2 2BUKA 5GZDA 5BNOB 5FO9B 4ISRA 1NLRA 3OYWB 1N1VA 1K5MB 3WCRA 2PHFA 2NN8A 3MGUA 5IUQA 2IXKA 2HEVF 1I9RA 5FQ0A 4N53B 1UF2C 1UKRA 2CY6A 4X8PA 2A3WA 3CLPA 1DZTA 3OGJA 4YFWA 3ZYPA 1QXRA 4LBMA 3RYKA 4B4RA 4NOTA 2A73B 1LHOA 2NQYA 4GA9A 4G9SB 1YIFA 3WHTA 3V0AA 1UZYA 2EXKA 1DGWX 3B00A 1HQNA 3GHNA 4NHKA 2OIIA 3DV8A 1QWRA 1GFF2 1O3RA 5LEJA 4OULA 3AMNA 3MLKA 4URTA 4YVSA 5JZGA 2A75A 4AFDA 3MLLA 5GALA 2YV8A 4W6WA 1YHFA 4CDQA 4F7ZA 2HWF3 1FV2A 3OY8B 4FPOB 4LBOA 4XF4A 1O3QA 4JGYA 5C9AB 1AZDA 4WVMA 3WW2A 2DCTA 2E9QA 1LU1A 4HK9A 1POV1 1VBB3 1WW6A 2R072 4GALA 3IM0A 4R9DA 3FWEA 3ZDSA 4HBNA 1RHI3 1FPN2 2AUYA 5LK5A 4AE2A 2WFF2 1GSLA 2XLAA 1VBE2 2ZA9A 4QGLA 1O4YA 2RS32 4KBBA 3N7LA 1OHFA 1U0AA 2WWSA 4IV1C 2N7GA 1S2BA 3ST7A 4AQ6A 3AFKA 2A3XA 4QT6A 1LGCA 1RJ8A 4JTNA 4LO8A 4FTSA 1WMEA 3VZMA 4RHV3 3VZKA 4SBVA 2P34A 2B5HA 2ZPXA 5C4WB 3WT3A 1LU2A 2DYCA 1LGBA 2DTWA 1AX2A 4ZXKA 1KD7A 3CNAA 4HN1A 2HWF1 1ASJ2 2PAEA 4D94A 1A3KA 3NAPB 3RYPA 1NA1A 1WLCA 3RJ2X 1J58A 4CDXB 1H1IA 3AFGA 2JG8C 4IEZA 1NCQC 2B45X 3R4SA 2VECA 4EN6B 1RVF2 2HWD3 2ZHLA 3TRSB 2ATFA 4N90A 5ABJB 1C5HA 3E6CC 3APBA 2YHJA 4IEWA 3KT7A 4HK8A 5BXXA 4CDXA 4F3JA 2ZZQA 4OUSA 5FOJB 3QH7A 4LA2A 5FCCA 5I0SA 1OKQA 2YMZA 1F5FA 5JCTA 1RVF1 4NR1A 1MZFA 4AGVA 2YY1A 4Y4YA 4Q26A 2WC2A 2QFEA 3VBHB 2JDZA 3H9AA 1TEIA 1FMD1 3RS6A 1R082 3DN7A 3L2YA 4ORFA 3E6DA 4OI4A 1DZQA 1DF0A 1G7YA 4W6YA 2XJVA 4P9XA 5CB7A 5AC91 1ZX5A 1ENSA 4GMP0 3NV2A 4OI2A 5GM0A 4XJWA 2VMIA 5C9AC 1R081 4QX5A 1BK1A 2WFF3 3SISA 4XJ9A 2YZ4A 2HWC3 1ZBE3 3A0NA 2D5FA 4FPEA 4AGGA 4RQPB 4JVAA 2HWB1 1EP0A 1D4M2 2V73A 3N7MA 1CJPA 4R52A 1NXMA 1B35B 5EFUA 2XGXA 5HCFA 3ZPYA 1M4WA 1SQ4A 4RFT0 3A4UA 4Z92B 4AEDB 2XWJB 4E4SA 4DMIA 2ZGPA 2K9ZA 1IS3A 1AVBA 3AP9A 3MEPA 4C1XA 2AH2A 1UL9A 3JU9A 2RS51 3B69A 4RGGA 4P9IA 3AP6A 3AZWA 1GANA 1WW7A 5C4WC 4AW7A 3FC0A 3WQ1A 4YM1A 4IV3B 2HWE2 5A33B 4ES8A 2RM23 1LEMA 3NAPC 3ZFEA 5CG8A 3W9AA 4R4XA 2A6ZA 3MF9A 2QQPA 1SLIA 4AEJA 1PGW1 1DQ0A 2ZGRA 5FAXA 3ZXEA 3MFCA 3ZMNA 2MNGA 4COUA 1REEA 1B35A 1LHVA 2VMHA 1HKDA 1VRH2 1Q8OA 4KWKA 5C6CA 2VNRA 2W08A 3NAPA 4AFAA 1AX0A 1NCQA 1JN2P 1Y9QA 1NA1B 1GNHA 1GNZA 2ETEA 1DG6A 1DGWA 1ND3C 4ASMB 1PMIA 1BZWA 4IEPA 4A7YA 1JUHA 2A7AA 4IQPA 5L73A 4BE3A 1ENQA 2A6XA 5JR7B 3K51A 1QJX2 1MEC1 3LAGA 2H0BA 4L9BA 4KG0A 2DF7A 3VDDA 1MS8A 2D7FA 5E88A 1AJOA 5JOZA 4Q4Y1 1C28A 1N3OA 4DINB 3J4UH 1IZ3A 1XXNA 1O7FA 1RMU2 3MIFA 2R073 2QCSB 2E7AA 1R093 2B8MA 1CQ9A 1CPMA 1I6XA 2R041 3VBSB 4HLTA 3KM5A 1PIV1 3JCIA 3H3UA 1JYIA 3GYDA 3VHRA 1GV9A 4FXGB 4WM7A 4FBFA 1S0GA 3S7IA 4L8QA 5KXEA 4K9SA 1Z78A 3AJZA 4XFAA 4XETA 4XJAA 3U07A 1S2KA 2X8KA 4KU8A 3HIFA 4JGZB 4YG3A 1ZBA1 1V6KA 1MS9A 3H1MA 1NLSA 4HVQA 4BIFA 4AQSA 5F5QA 2R071 1MACA 2B42B 5H9PA 3NJZA 4HETA 4O9EA 4NHLA 2WNVC 1V6JA 4RD7A 1S0CA 5D8AB 2VNGA 1ULCA 5C8CC 2A71A 1XNKA 1OA4A 2ZKLA 1LHNA 4XIKA 5K0UA 2XH6A 1C8M2 3TN93 1MR5A 1RUD3 3O14A 3HT1A 4TWTA 1WLTA 1VJ2A 4MLOA 3CF6E 1QXJA 5DZFA 2RMU1 3TOJA 4IEOA 3ZN4A 3CJIB 4COZA 4BIOA 1C8M1 1AR91 3I8TA 3VBFA 4RS5C 1QNYA 1PVXA 4YW3A 2K0GA 1GQHA 4BH9A 4MXWA 3S6PA 4N7UA 1RB8G 5F6KA 1X50A 2OA2A 1QDOA 4I01A 4LBQB 1OPOA 2NMOA 1W6MB 3AXDA 4LNVA 4EWAA 4B7EA 3CL1A 4YG0A 2CWMA 3R6SA 1AYN2 5L7OB 1AR81 4N43C 5J09A 4GKXA 2JD4A 4KWJA 4Y22B 1WD4A 1NY72 4Q0PA 4Q0SA 2F4PA 4YSFA 4FP2A 5H9SA 2OW4A 5T50A 4UBHA 1HRV1 4BA6A 1RC6A 5FLIA 1W0OA 3BIWE 2Z5WA 1NG0A 4N43A 4Q4V3 2GDFA 1RUF2 4JC1A 3VKOA 1V9U2 3T2TA 4S2HA 3JZVA 3L2HA 4W65A 4Q4W1 1APNA 3PVNA 4YM2A 5I8TA 5EWSA 5JOWA 4K7JA 4PIXA 3INAA 3QACA 2Z2SB 1F8VA 1C57A 1LJ7A 1QY4A 1VBC3 1XYNA 3M2MA 3NV3A 1Q5OA 2KA3A 3M3CA 5DG2A 1O4TA 4QPGB 4AEDA 5JSRA 1LEDA 1PK6A 4IETA 4KH9A 3VBHC 1V70A 3E97A 4YZ2A 4PBPA 2WT1A 4JCKA 3ROUA 1H0BA 2EA7A 3AYEA 3AP5A 2Y0OA 4CDUA 4LBLA 4OLLA 1RUG1 1RIR