4Q29A

Ensemble refinement of plu4264 protein from photorhabdus luminescens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
MNIIRKMDWDSMVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords plu4264 protein
publication title Structure of a cupin protein Plu4264 from Photorhabdus luminescens subsp. laumondii TTO1 at 1.35 angstrom resolution.
pubmed doi rcsb
source organism Photorhabdus luminescens subsp. laumondii
total genus 26
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q29A00
2Q0AA 2MNGA 3E6BA 3H3UA 3IDBB 4Z82A 4ORFA 3C3VA 1SEFA 1QY4A 4XFBA 1RUNA 5FQ0A 1JUHA 2XKOA 1O3TA 4JTNA 1Q43A 2IXJA 1YFWA 4XETA 4HN1A 1UPIA 3DKWA 4XFFA 4IEQA 4AQ6A 2D40A 4QM9A 4XFHA 1ZRDA 2Q1ZB 4QX5A 5T3NA 3U11A 3NW4A 5CU1A 5JSOA 2C0ZA 1YUDA 5LRRA 1NYWA 3IIAA 2PAKA 4KU7A 4BIFA 1O3QA 5BUVA 2UY8A 3E97A 3FFQA 3ETQA 3TNPB 3DN7A 5KHKA 3ES4A 2UYBA 1VJ2A 1J3RA 5BPXA 1GQGA 5I0RA 4Z07A 1EP0A 5I8YA 3DL3A 4XFAA 1WLTA 4LA2A 5J3UA 3E6CC 5I0SA 3O14A 3SXWA 4R52A 4E2GA 2WFPA 5JSPA 1I6XA 3OTFA 1XRUA 3BU7A 3MDPA 4YRDA 1ZZCA 3FHIB 2GU9A 4QGLA 1UIJA 3BB6A 4IEUA 4LUKA 5LEKA 5I8TA 4H7LA 1X8MA 1OI6A 1O5UA 1OD5A 4IETA 4AVAA 5J7MA 4WBBA 4UBHA 1OFNA 1CAUA 2IXCA 2PA7A 1UW8A 2H6CA 4XF0A 4CYDA 2BEOA 3M70A 4EWDA 3LWCA 3WW4A 1UCXA 1RL3A 3SCGA 3EO6A 3NL1A 4IEWA 3WW1A 1CX4A 2N7GA 3FX3A 1RTVA 1O3SA 5FLHA 1J59A 3RYRA 1J1LA 3S7EA 4LUMA 3RYPA 4HBNA 1FXZA 1CAWA 4QXKA 2ATFA 2XHKA 1ZZBA 5KBFA 3LA3A 1EY2A 2XL7A 5FLIA 5CADA 1ZZ6A 1CAVB 1RGSA 4XF9A 1V70A 2D93A 3OD0A 4HSLA 1SFNA 3PNAA 4KU8A 1UD1A 3KSCA 2E9QA 1ZRFA 4N9HA 2K0GA 3ST7A 2WC2A 4MGIE 3D0JA 3I59B 2IXIA 3SCHA 4MX3A 4IEZA 2CAUA 1H1MA 3JZVA 4I09A 4IEVA 4WVZA 3RZZA 4HN0A 4JTOA 3UKNA 3CEWA 2CV6A 4E2QA 4A2UA 3HQXA 4Q0PA 2D5HA 3BPZA 2PFWA 2BNMA 1VP6A 2KXLA 4I0AA 5FLJA 3BALA 1FI2A 4PIYA 4I0BA 4KL1A 3USSA 3D0SA 4I2OA 3LA2A 2IC1A 2ZKLA 2GH2A 3KCCA 1CGPA 4KWJA 4HVOA 1RUOA 4PIXA 3CJXA 3HT1A 2PHLA 1X8EA 3LAGA 3H1YA 1Q5OA 4IEPA 3H50A 2OZ6A 3RPQA 2QJVA 3NKTA 3NJZA 3ZDSA 1J3PA 2HKXA 4NVPA 2FMYA 2PHDA 4ZU5A 2GC2A 1YWKA 2BNNA 5HI0A 2ETEA 3FE5A 5JSRA 1U12A 5JCTA 2XGXA 4XFCA 5FQ0B 3DV8A 3QACA 5JR7B 2VQAA 1NE4A 1G6NA 1Y3TA 4L2NA 3H7YA 1GQHA 2BGCA 3IBMA 3KGLA 3RYKA 1LKNA 3FZ3A 2MPFA 2CGPA 3U10A 3M3IA 3U0ZA 3S7IA 4BH9A 2BYVE 1DGRA 2HJIA 3TNQA 5C8WA 1O4TA 4FBFA 4ZU7A 2K9ZA 4WZCA 1DGWA 4J1WA 4IERA 3IWZA 4PJYA 3E5XA 2EA7A 2OYZA 3D82A 2UY9A 3I7DA 1YFYA 4IEYA 1Y9QA 3ELNA 1X7NA 3CL1A 4XFIA 4LTAA 3H1WA 5KHJA 5FDBA 5F1RA 3WW3A 4D7SA 4LLOA 3EHKA 4META 3WW2A 2F4PA 1ZVFA 2IXKA 3QOPA 2GAUA 3EQEA 2B5HA 2IXHA 3OGJA 1QXJA 2VPVA 4AQ2A 3NSTA 2XLAA 4YYOA 1FT9A 2B9UA 4O9GA 1YLLA 3H3ZA 5I93A 2QCSB 1IPKA 4EWEA 4EWAA 2Z2SB 2GC0A 4IEOA 4E2SA 2OPKA 1J3QA 3E6DA 1CAUB 4XF1A 4XF3A 1I5ZA 4DINB 4MGKE 2ZCWA 4OFGA 1CAXA 4FAGA 4ZU4A 1O5LA 5D1IA 3BCWA 4B29A 3MZHA 4Q0QA 4AXOA 3KGZA 5BV6A 1EPZA 1CAWB 4Q0UA 4FAHA 3GYDA 5LEJA 3SHRA 1O3RA 5I8SA 4LULA 3R6SA 4MV2A 2CAVA 3FWEA 4I02A 1OMIA 2EAAA 5FCCA 2P17A 1H1IA 1ZZ8A 3MPBA 2ET1A 1XE8A 3PLQA 3FJSA 2PAMA 4JVAA 1X82A 3ACLA 5AVPA 1L3JA 2PAEA 3SCFA 2UYAA 3EJKA 1YFUA 5E16A 5JAXA 2IXLA 1WA4A 4PIZA 1NZCA 5J48A 3EBRA 4AVCA 4AVBA 5BY5A 4X6RB 3CO2A 4KWLA 3ROUA 3N4MA 3GBFA 3IDCB 4QMAA 2GC1A 1DZTA 5C6CA 1PMIA 3KMHA 2H0VA 5FPXA 4I3PA 1ZZ7A 3UKTA 3RDIA 2OA2A 3OCPA 3UKVA 4YARA 4LEJA 4RD7A 1EYBA 1YFXA 4K8FA 4QGMA 4X6QB 5LRSA 2O8QA 2D5FA 4TLFA 3E5QA 2QVSB 1PM7A 5KHHA 3H1MA 2XLGA 1WGPA 2XLFA 5EZWA 5FPZA 4FT8A 4KWKA 1ZRCA 2FQPA 4J1XA 4D7TA 4N9IA 2GC3A 4OLLA 3RNSA 3HIFA 2H6BA 2OZJA 1ZZ9A 1XE7A 1QWRA 4MZUA 4XFGA 3VHRA 3PVBB 1HW5A 3L2HA 3HT2A 1LR5A 1ZRRA 4R8HA 4UXAA 1QXRA 4LA3A 4EV0A 1O7FA 2V09A 4I01A 2MHFA 1IPJA 2I45A 3LZZA 4XEZA 1LRHA 2Z69A 4ONUA 5I91A 2O1QA 3MYXA 4P9GA 4O9EA 4JV4A 4QM8A 1CAVA 2PYTA 4HSJA 3E5UA 3G7DA 4YSFA 2PQQA 5K8SA 4XF4A 5E1RA 3LOIA 2B8MA 5I0TA 1LB2A 3I54A 4L11A 3B02A 4HMZA 1Q3EA 1UIKA 2GZWA 2Q30A 2Q4SA 4Q0VA 3I59A 2Y0OA 4EROA 5KHIA 1SQ4A 4HVRA 4QGNA 4BHPA 1NE6A 5EFUA 3LA7A 3SMHA 1J58A 4IESA 4F8AA 4HVQA 5I0UA 4MH0E 1VR3A 4MGZE 1DZRA 1ZNPA 5CVRA 2XKPA 2PTMA 3S0MA 3CF6E 3H8UA 4BYYA 3CLPA 1YHFA 4MUVA 4Q0SA 4IEXA 2VECA 4HZFA 1ZX5A 4UBGA 2BNOA 2ET7A 3ES1A 3OF1A 4GULA 1CAXB 4Q29A 2EVXA 5KHGA 2XL9A 1RC6A 3NVCA 4YNIA 1TQ5A 5BXXA 3H7JA 3H9AA 1NXMA 2QDRA 4F7ZA 2QNKA 4HLTA 1ZREA 4MGYE 2DCTA
chains in the Genus database with same CATH superfamily
1TNFA 4COUA 3K48A 4ORFA 3C3VA 4L9BA 4Q2FA 1QY4A 2ZZQA 2P1BA 3MHZA 1GP5A 4MXWB 4BMEA 5K0UC 5FZFA 1OSGA 3WUDA 4B1LA 2NYYA 4LT5A 1BKZA 2ZGUA 1RUE3 3N9QA 4FFHA 5CNAA 4PDWC 1YFWA 1JYVA 1OA2A 4QPGC 4WVMB 4BCUA 2X53S 3O1TA 1ZBA2 4XFHA 2ERFA 4AWDA 1ZRDA 5F3GA 3I2GA 4QPYA 3G6JB 3VBUA 3U11A 5CU1A 3MPPG 3FMGA 4LKEA 3AP6A 2C9AA 1NYWA 4KU7A 3POSA 4LE4A 3GNEA 2EF6A 3THDA 4CUGA 3UNPA 3BIEA 2R0HA 3IAPA 1XB9A 3E97A 3KVBA 3ETQA 4RA0A 4TXWA 1KEXA 3TNPB 1JODA 4OHXA 3WG3A 2HWF2 3DN7A 5D21A 3P5BA 2AUYA 5DAVA 5EP9A 3RMXA 4AEDC 5JZGC 5L7OB 5AC92 1CZTA 1SFYA 4D6QA 4ZZ5A 2DDUA 3ACIA 3J8F3 2ZAHA 1EP0A 3B69A 4N7IA 4OMCA 3DL3A 5B4NA 1VBA2 1L7RA 2G9GA 4LA2A 2ZMKA 1NA1A 4N8MA 4CCKA 5G04L 3SXWA 4RHV1 4YGCA 1IG0A 1HRV2 1X50A 5CFDC 1AYN3 3WNXA 2CGOA 2PLV1 4QX2A 3VHPA 2JEMA 4AF9A 4XHXA 4YRDA 3ZDVA 5B4XA 2VZSA 3I49A 5JXHA 1NLSA 4RL7A 1UIJA 5FY0A 4IEUA 4LUKA 4JQTA 2G19A 4XACA 4FPOB 4BK5A 1W05A 1TMF3 5I8TA 2WS92 4TZDA 3T09A 3W5MA 3SNMA 3C7HA 4BQWA 2I2SA 3A4UA 4Q5OA 2HBUA 3ZSEA 4IETA 4WV8A 2BV4A 2IXCA 1VRH1 2PA7A 2WFF1 4Y5SA 4YZ4A 3RZJA 3M7AA 1F35A 4O61A 1JYXA 1CQ9A 2BEOA 4JKMA 3INAA 4EWDA 3LWCA 2OW4A 3WW4A 2BBVA 1BXHA 2HEWF 2VMHA 2ZTNA 4HANA 1WW5A 1BVP1 1UOBA 1WD3A 2C1FA 2YG0A 4Y1YA 2FCTA 1CX4A 1AXZA 4JKLA 1O3SA 1UN1A 1SBFA 2ARXA 4HBNA 4N43A 2RM22 2B45X 1CAWA 4CCOA 1NQDA 5JDBA 4I30A 1O4YA 1IHMA 2XVKA 3VBFB 4G4FA 1HXS1 2XHKA 4HPKB 5IK4A 2D43A 1L7LA 5FZCA 1WMFA 1GR3A 1CAVB 1MS1A 5KXEA 2AC1A 1V6LA 4PDWA 1Z0HA 3A0KA 4XF9A 1V70A 2D93A 2Y64A 4COVA 3ZVXA 1HDKA 2WL1A 1QXPA 4AW7A 1ZRFA 4RR3A 4UF0B 2CGNA 2K0GA 3ST7A 1OH4A 1QJFA 2HWF3 5EPAA 3KLSA 4DMIA 4MGIE 3I59B 5AC93 1W28A 1UZVA 1C5IA 3SCHA 1X9TA 3NNLA 2VUJA 4RS5B 1P8JA 1D7PM 2VOXA 3MO4A 1ULOA 3JZVA 4FPKA 3OBRA 4XOGA 1VBA3 3MI8A 1COV1 3PURA 4I09A 4IEVA 4K40A 4WVZA 3RZZA 2DFBA 2WUHA 2W08A 4JTOA 4AEDA 5J1XA 4EN0A 3HJRA 4YW2A 1VIWB 1R1A1 4LBOA 3HQXA 1U5XA 2ZX1A 1QKQA 2D5HA 1IS6A 2R32A 1W90A 2VZTA 1POV3 1RUJ2 3PJQA 2GMEA 4GH4B 4P08A 4KBBA 2WO7A 5ANNA 4I0AA 2OPWA 5FYYA 1RUD2 1DGLA 2ZACA 3WT3A 5C70A 1JYWA 3NV4A 3FBMA 4RR3B 1MVEA 4CDQB 4E27A 1FNYA 1W6QB 5FYTA 2RG4A 3AKTA 5DUWA 4PQQA 4BXSV 2IVJA 4IV3B 3VGIA 2VVEA 4AFMA 3K3NA 4BOWA 2K2SA 2IC1A 2YV8A 4AHXA 5E89A 4CXXA 3GZEA 5D8AB 4P5YA 4KWJA 5ANQA 5CKQA 4BB3A 1SLIA 4GWIA 2NM1A 5FJKA 1VBB1 5IVJA 3LAGA 3H1YA 5ABJC 3H50A 3ZYBA 1UYYA 2VZQA 4HONA 4TWTA 2QJVA 3FLPA 5A7WB 5A33B 1A8MA 2RM23 4OULA 2D6NA 3NNMA 2DVGA 4QAWA 4K7JA 1DLCA 1GQPA 2C9KA 2D3SA 4UFJA 3FE5A 5C71A 1GYKA 4LR4A 3VBOB 1OXCA 1Q8SA 1U12A 4Y5TA 2AEZA 2G9ZA 3BN6A 3N35A 4XFCA 4CDUC 4CPBA 3BPSA 2A7AA 5JIAA 1BK1A 4CUAA 2WABA 1NCRA 4YG6A 3PUSA 1V9U1 3VDAA 1W6NB 1OLME 1LULA 1Y3TA 4L2NA 2RV9A 4CSWA 3N7KA 1KDMA 3H7YA 4M3CB 2BGCA 3WUCA 3KGLA 2VBPA 2Z5WA 1W8UA 5FZ7A 3MBWA 5C4WB 2E53A 1GZ9A 1RMU2 2AENA 2JENA 3V0AB 3M1HA 3U0ZA 3AL6A 4Z8BA 4FOQA 1UMHA 4BH9A 2HJIA 5F32A 5C8WA 1O4TA 1YIFA 1YQCA 4XZPA 4NOTA 3V65A 1N1SA 4AGVA 4NPRA 4J1WA 4Y4RA 4DNYA 3BTYA 4ZS2A 5FPUA 5IJRA 3CNAA 5LBEA 5F9TA 1RVF1 2B42B 1LCLA 2UY9A 5A7SA 4K6BA 4BQXA 2VZOA 3UESA 3ELNA 3VKOA 1W6MB 4LK7A 1VRH2 2FDIA 4XFIA 1K5MC 3TEYA 3T0BA 1RUD3 4BQ1A 4OQ8A 3B7MA 4FPHA 3WW3A 1DFQA 2BGOA 3EHKA 3KWVA 3WW2A 1OLRA 1V6JA 3O1MA 3BYWA 3MUZ1 5FK8A 1W39A 1KS5A 2GAUA 3EQEA 3VZMA 3AZVA 2VPVA 3BGAA 4XAAA 4LXLA 3AMMA 2HWC2 1NCQB 2XLAA 3N7MA 4Q4Y2 4COYA 1DQ0A 2AYHA 1YLLA 2QCSB 3ZR5A 5FZ3A 1UKGA 2YFUA 3JQWA 3T2TA 4UFMA 1OFSA 1JYCA 3NKGA 3KT7A 5A3UA 3IMMA 3LEGA 4PLOA 5JLVA 2XR4A 1JOJA 3BOWA 1W2NA 1VBD1 3KB5A 2ADDA 3AKPA 4XF3A 4DINB 4MGKE 2ZCWA 1QMJA 5EHDA 4DEVA 4LITA 1DBNA 1S55A 1CAXA 4H55A 4H7MA 4ZU4A 1R081 5D1IA 2GN3A 4XYXA 3PVOA 4B4RA 2NN8A 1ASJ1 3BCWA 3NJXA 4B29A 2OUJA 2WWSA 3VDBA 3WDXA 3HWJA 4UT5A 5TSWA 3HNBM 4J6GA 2E7TA 4Q0QA 4R9BA 4YGDA 2CDPA 2DUPA 2QQNA 3KGZA 1FPN2 5BV6A 1V6KA 1Q8QA 1EPZA 1GANA 3APBA 3IPVB 3OGGA 4Q0UA 4W4ZA 4FAHA 1CR7A 2J1VA 4FPGA 5GM0A 2DTYA 3GYDA 3TWIA 4FP2A 3ZN5A 2XQRA 4CDUA 5LWBA 2Z4FA 5JI9A 3AMPA 5A3LA 1NOVA 1PGSA 4NJ4A 1C4RA 2JKBA 3IM0A 5A3OA 4XPVA 1RMU3 4MV2A 4QX8A 3TN91 1W6PA 1WKYA 4I02A 4CPBD 1VBC2 3UJQA 2R30A 4GWNA 3T4VA 1KGYA 2OKXA 1TZOA 1OH3A 2VM9A 1FATA 2WAAA 2WIIB 5FMBA 4CEYB 4CP9B 1ZZ8A 4ASKA 4E8CA 1O6UA 1WCDJ 1XE8A 3PLQA 2PAMA 2VCCA 2RS12 5FZOB 3BODA 3EMRA 3HBZA 1L3JA 1MR5A 1O8SA 1W8HA 2PAEA 3KF5A 3MUY1 1BHGA 4JHZA 3SCFA 1AR62 4FPJA 2Q1FA 3IB3A 3FN9A 1VRH3 1LHWA 2ORZA 1WA4A 1OPMA 3NAPB 2DU0A 4XJWA 1NZCA 1JOPA 3LCPA 3X29B 4NHKA 5J48A 2OS2A 3VZNA 4AVBA 5FOBB 1LHUA 3CJIC 4KWLA 3N4MA 1QJY1 1VBB2 2WQZC 1DZTA 1SDWA 2HWD1 2OQ7A 1C57A 1OF3A 3B01A 2ZXQA 5CZKA 3MZHA 2WSUA 1S4CA 1GNYA 2YXSA 2WYSA 2W3JA 4LBLA 2XVGA 4I3PA 3W59A 2ZX2A 4CDXC 3POIA 1LGCA 3UKTA 2OA2A 2V4VA 2Y8KA 3LGRA 3N9PA 1WLDA 4QKBA 1CZSA 3ZN6A 3AMHA 4LEJA 4YARA 3BUCA 2QFEA 1HX6A 4Q4V1 2B9VA 2X10A 4YWAA 4K8FA 1RXFA 2IZWA 5IVCA 1H8TA 3D6EA 3MGUA 2D5FA 1RUI2 2J1AA 2JE9A 5F3EA 5FKBA 2W1SA 4BLJA 4CRQA 4ES9A 5A1AA 4XCAA 1ENRA 4OUEA 5HCBA 3RJRA 5C3QA 2VULA 4W6WA 2JD4A 1S0FA 3OUIA 4NO4A 2NP0A 4J1XA 2VG9A 2R49A 5BNNC 1OOPC 2PMWB 2Y6GA 4FQZA 3HIFA 1AJOA 2H6BA 1LGBA 3EYPA 2OZJA 3NWKA 4QX7A 1JMUB 3VD4A 4AGGA 3B00A 1N3OA 4ZXEA 3U4XA 1WZXA 1COV3 3OGSA 4IE7A 4HL0A 1LR5A 5J96B 1R1A3 1QXRA 5GLTA 4EV0A 1O7FA 1PVXA 3ZO0B 3I3BA 1TNRA 1WMEA 2MHFA 3O1UA 1AR81 1H8TB 1IPJA 4URAA 2JG9A 3VBRB 3WZ1A 4R9AA 3RS6A 2A3YA 4MVTA 1YCIA 4ONUA 2O1QA 4P9GA 4NHYA 1R092 4UW4A 3WDVA 4D6RA 4O9EA 3UYJA 4CP2A 2RS13 1LJ7A 4LE3A 4Y22A 5KC5A 3ZKYA 2JDYA 1DQ1A 4MXVA 1AR63 1W8FA 4DB5A 5J09A 4HXCA 4FBFA 4FCAA 4XF4A 1W0OA 1H9WA 3WR0A 5E1RA 2ZAAA 2RHPA 5FYMA 2B8MA 1DG6A 3IKWA 3AFGA 3ETPA 4I0WB 4GWJA 1WW4A 3B02A 4ITCA 4HMZA 4KMQA 4FPFA 1UIKA 2GZWA 2Q30A 1OT5A 5T5JA 1AR91 4H14A 4AI0A 4CU6A 5L73A 1MZFA 4AOCA 3O1PA 1QOSA 1VBB3 4MHRA 3GGLA 1UYZA 5KHIA 2CTVA 2Y26A 3V0BB 1NZIA 4PLNA 3ZN4A 4QGNA 2GN7A 4BHPA 5FZ8A 1ND2B 4QU2A 5DAQA 5LATA 3CJIA 3SMHA 1J58A 1G7YA 5A70A 5C5TA 3J8F1 4P5HA 5FZLA 5I0UA 1CESA 3A21A 1ASJ2 3KV4A 1JBCA 3ZXGA 1BJQA 2E33A 2ZGQA 3WXPA 2HWB2 1AX1A 1Q8VA 1RJ8A 1VR3A 5DUUA 4CDXA 2A5ZA 2W46A 3ALQA 4AFDA 1ZNPA 4RYDA 2P37A 1G9AA 1DHKB 2PTMA 4B3NA 3VLBB 2W92A 3DECA 1S2BA 3WVJA 1UO9A 3U1XA 3RWKX 1JZ7A 3TAYA 4BYYA 2FDFA 2BWCA 4NIHA 2QE3A 3OGRA 1CIYA 5FPLA 4MUVA 1JTZX 3LDRA 3PUHA 1PK6B 2VECA 3POFA 3AX4A 1ZX5A 4OHVA 2ET7A 5LBFA 4AVTA 5E88A 3P1IA 1HN1A 1WWYA 2B46X 1IG3A 1ZM1A 2VNOA 2KM2A 3I2HA 3ZFFB 3DGTA 2XL9A 1BLZA 3NVCA 4MGSA 5BNNA 1DYOA 4YNIA 3BOPA 3BTXA 1OOPA 5GLWA 4OI1A 4J25A 3BKZA 3O0WA 1XSQA 1GNHA 1RVF3 3K3OA 3H7JA 1UY4A 3IN9A 3H9AA 2QDRA 5G05L 5LA2A 2Q8EA 2VOWA 3FUOA 2LM3A 2JIJA 3O0VA 4INDA 4R9DA 4AHZA 1ZREA 1POQA 1OLMA 2DCTA 1YQ6A 4MGYE 1R093 2R1BA 3KS7A 2MNGA 3E6BA 3LEKA 3N9LA 1CX1A 1SEFA 5KXCA 2BPA2 1Z78A 4M00A 4Z2AA 3DPRA 1PNFA 2VBDA 2XKOA 2X8KA 3UT0A 3MV01 1ZBA1 2UWBA 4JTNA 4QDQA 3KCXA 3I4IA 1KFXL 5FYHA 4ASMB 4XETA 2P6CA 3DKWA 3ECQA 3I2IA 1IPSA 1JOBA 1MEC2 5C8CB 3WQ1A 3QBQA 2YMZA 5CFCA 3VZJA 5JI7A 5FP4A 5JMCA 3NW4A 5H9PA 3T4HB 4BE3A 4Y1VA 2DBIA 3PVNA 1VBD3 2V5YA 3QH7A 4KNCA 3UGFA 4CU9A 2FCUA 4ET7A 2HWF1 4YGEA 1BYHA 3WNMA 2PHXA 2HBTA 2ORXA 5FZMA 1ONAA 3D5OA 2W2IA 2ZZJA 4IQPA 3J26N 1UYXA 1LOFC 3ZYGA 5FO7B 3ES4A 4NRMA 5GJ6A 1YYNA 1ZA4A 1VJ2A 2J1SA 1ASJ3 1J3RA 2BW8A 2HWB3 1SLTA 4TYSA 5I0RA 2RJKA 5JOYA 4LNVA 1MS4A 1NLRA 5I8YA 1QGLA 1J83A 1JW6A 4XFAA 2SBAA 4FFGA 1HRV1 1AL0G 4A6SA 3I2OA 3UJOA 4XMAA 4EZ4A 4CCMA 2YPDA 1F31A 1POV1 2RS52 3QH6A 5H9SA 2E32A 4OYUA 4KGGA 2ZEZA 5LBCA 4NIGA 4GALA 4DXRA 1S0CA 3OB8A 3CHXA 3H0OA 3OTFA 5FP3A 3Q8FA 5F39A 3MDPA 4LBMA 2QDNA 3OBTA 3R4DB 1H4GA 2JG8B 2WS91 3B93A 3FHIB 1A78A 1AX2A 2R062 4LIUA 2UWCA 3TN93 3WG2A 1QF3A 3Q8EA 1NKGA 1H30A 4AEKA 4LLFA 3VKMA 2W91A 1F8VA 4XDQA 1O91A 5FP8A 3J4UH 5GLVA 2FZ2A 3AC0A 3SEPA 4AFCA 1OA3A 1X8MA 5K9YA 2ZHNA 2W95A 1O5UA 1OD5A 2LW8A 5FBJA 4AVAA 1YEWA 1OFNA 5E8AA 1GWLA 1JHJA 4XF0A 1OLQA 3ZFGB 1S0DA 2I07B 2ZPXA 5L7OC 1CJPA 3GJAA 1H2LA 4L0PA 2A73B 5C5UA 5CG8A 4YM3A 5B2GB 1FX5A 3ACGA 4QDRA 2N7GA 1RTVA 1KD7A 1SHWB 1EUUA 2RE9A 2RM21 3VDDC 1J59A 1PGW2 3RYRA 1G9DA 4WM7C 2QQMA 3RZGA 4QKNA 4MYEA 2VH9A 1UOJA 2HWD3 1GOFA 3PU8A 3ZXEA 4E4SA 3N9NA 1PO22 4QQOA 3VKNA 1ENSA 1EV12 1MEC3 1GKBA 1UAIA 1UXXX 1RITA 5KBFA 4XVHA 4I3GA 2YYOA 1PVC2 1EY2A 5CADA 3AZYA 2YC4A 2JECA 4KWUA 4Q4V3 1CPMA 3CBNA 4QHBA 3JU9A 1LHOA 3JD72 3PNAA 3SKVA 3WSOA 1O4ZA 2E9QA 5BNQA 5GZEA 1O59A 3VDCA 3F95A 1UF2C 3NMBA 2VQ0A 1D4VB 5FXVA 3K4ZA 2C26A 4CU8A 3V64A 2J7MA 5FZ9A 4CCDA 2V73A 3O5SA 1W2UA 3ZXKA 2FCVA 5APAA 2Q8DA 1DGWX 3S6PA 5JUVA 2IWGB 3HNYM 2ZGOA 4JGZB 2KD7A 2JKXA 4K3UA 3ZXJA 3KM5A 3GDBA 2CV6A 1RUJ1 3OEAA 5FO9B 3S5QA 4UFHA 3MFCA 2A6VA 1UZWA 3CMGA 4OZOA 1XNBA 2W9XA 5DAXA 1H0BA 1XYNA 1RUD1 3NNJA 1JYNA 4JX0A 2W1WA 4QB2A 2D3RA 4G9SB 5FYUA 1BEV2 4NRPA 3WP4A 5DAWA 1T2XA 4DUWA 4Z1VA 5L9BA 5DUXA 2G1MA 5FLJA 3T2OA 1UXZA 2XQXA 3JBG2 5GZCA 1AJKA 3LOBA 4AVSA 4PIYA 2BGPA 3PIGA 1N3QA 4KL1A 3PVEA 3USSA 2D98A 3D0SA 3TB0A 5A3NA 4I2OA 2QQVA 4UFIA 4FPLA 2Y0IA 1UU5A 1D2QA 1O8PA 1OVPA 2IFWA 2P5BA 3LPGA 3O0XA 2WSVA 5FFOC 4CCEA 5FY1A 3PTYA 1ZYBA 1B35B 3Q8AA 4UW3A 1JS9A 1JU3A 1ULDA 4MSVA 4LO7A 4XDPA 4Y26A 1XQNA 4DPNA 2PHLA 2FDGA 4AR2A 1L7QA 4A6OA 4HETA 1AR93 2OZ6A 4RN5A 5IUQA 3VBHB 1PIV2 5L36A 4XAEA 1YRZA 3NJZA 2JDPA 4Y20A 5BNPB 1LENA 1J3PA 5FP9A 1KDKA 1RUH1 2WO3A 4NVPA 2PHDA 4QX3A 4UW6A 2CHHA 4ZU5A 3S57A 2X5IB 1PO23 5LA0A 1YWKA 4HFSA 1NG0A 3LF7A 1JH5A 4GJYA 4Q1PA 1A34A 5JSRA 3ACFA 3VDDA 1PVC3 5JCTA 4OI2A 4XABA 3WNOA 3I3DA 1J1TA 4WM7A 2HWE2 4ZXKA 5H9RA 4AFAA 3VHNA 4QPIC 4NPMA 3QACA 4UWDA 1DU3D 1NXD1 2TUNA 5KR7A 4AQTA 2VCAA 1DQ5A 2W47A 4ZY9A 1DIWA 3MIGA 3T08A 2YGLA 1EUTA 1QDCA 1VB2A 1XSRA 2YC2A 4CCLA 1R64A 3THPA 2E26A 1RMU1 3VBUB 3HPNA 3MV11 1LKNA 5JXJA 2VNVA 3AL5A 1W9TA 2KR2A 3AZXA 4ASLA 2ZKNA 2CGPA 2J1RA 3ZYFA 3CZJA 5FY7A 1GZCA 1OBNA 1Q8OA 1BQPA 3S7IA 2WO1A 3S30A 3ZFEC 1AF9A 1DGRA 1UX7A 1V6IA 2BBAA 2DUQA 3I3EA 3UK9A 1QH7A 1WCSA 4NHLA 3LKJA 4XMIA 5GLUA 2K9ZA 3SC7X 4CDWA 2NMNA 4IL7A 2DCKA 4PJYA 1JZ3A 3O1RA 2OYZA 2ZX3A 2VAUA 3H42B 4R4ZA 1DYPA 1AXKA 1C3HA 4BQYA 2F4LA 2VZRA 1QHDA 4AG4A 1WCQA 4D6SA 2JDMA 2YZ4A 3UL2A 3POJA 4AGRA 4LQRA 4D7SA 1NA1B 5FZEA 4LLOA 2JDKA 4N7UA 4DS0A 1NT0A 5H9QA 4Q4Y1 1ZVFA 2HWC1 1WD4A 3ZYIB 2WLPA 1OQ1A 5KC6A 4TTGA 5ACA2 3NSTA 5LA9A 1W0PA 2NMOA 3WD5A 3DKQA 1ZBA3 5FWEA 5C4WC 2Y6HA 1CZVA 4XUTA 5K0UA 4PLMA 1K45A 4XW3A 3C2UA 5DN2A 4A7KA 2OPKA 1J3QA 2IUWA 3J7LA 4E4DX 4K8RB 1QEXA 4QXHA 5FKCA 4QPGA 1G9FA 4M01A 1US3A 5F5CA 1C8M1 2VNGA 2CDOA 4FPEA 5FK7A 4S2GA 4EN9B 1IQDC 2WINB 1FPN1 4QX0A 3E1F1 2IFRA 5IK5A 2HWE3 2YDEA 3AKSA 3RFRA 5K7PA 2GP5A 1WLCA 3IZOA 2QQPA 2VZVA 3I2KA 4N43B 1GSLA 1N1VA 1CAWB 3ZMNA 5JWPA 5JZGA 5F5AA 5HPOA 3GJBA 1OHFA 1NCQC 1HRV3 1OUXA 5A6XA 4N53C 4QPIA 3KZ4C 2D6OX 4NPLA 5SV5A 4DRRA 1VBC1 5FZ4A 4PDWB 4M4PA 4UYBA 4LULA 5JXGA 1NAEA 1LODA 2FDKA 1HQNA 2Q5TA 1RB8G 1AR72 2CAVA 1HN0A 3FWEA 5C3SA 2XDVA 3WQ0A 3MF6A 5A6QA 3ZX7A 1OMIA 1XOYA 1QOTA 2WS93 5CFDA 4ES8A 3AP9A 2RS11 1JZ6A 2YPJA 3IIIA 4JDMA 1OD3A 4GWMA 2A6ZA 4CCCA 1G9CA 2DFCA 1AR61 4LHKA 2ZGPA 1W6OA 2DU1A 4PT6A 1BCXA 1PZ8A 3ZFEA 4NRQA 5JAXA 1FV3A 3POBA 5IVFA 2XJVA 3C7FA 3I3MA 2WNUC 4ZZ8A 2XB6C 3HD8B 5A3PA 4AEDB 3NRUA 5EQUA 1ENQA 5C9AC 3WHUA 3RG0A 4AVCA 1XU2A 4XJZA 5BY5A 3ROUA 2RMU2 4JRAA 5DDJ2 3AJYA 1LOAA 2A6WA 3FLTA 5C6CA 2VY0A 3ZXLA 5FPXA 1ZZ7A 2AEYA 1GMMA 1W8NA 3JQXA 4U2AA 4A7ZA 3OCPA 4PI0A 1RUH2 2RVAA 4JGYC 5A32A 5JOXA 3FLRA 2G4IA 2GMMA 4RD7A 2D6PA 4A41A 1S0BA 4DXZA 1AL22 4AE2A 1RUI1 3BU0A 4WM8C 1W6OB 4RSUA 4LPLA 5HBAA 2XJPA 3I8TA 3CKHA 3VHOA 5T54A 2HLEA 4RGGA 2QVSB 1SLLA 3ZM8A 1PM7A 2HYKA 2XLGA 2XLFA 5EZWA 1KFUL 4FT8A 3U37A 3M8LA 1US2A 3ZIWA 5FBZA 2XONA 5A7PA 4KWKA 5FPVA 3GZUC 2FQPA 4UFLA 5EJZB 4BPZA 4DY5A 3PIJA 4NIAA 4CUBA 2WNEA 5JVVA 5GZDA 4OLLA 3THTA 4IDZA 4JHTA 2D6MA 4P9JA 4XCBA 1ZZ9A 2KA3A 4SLIA 3LIGA 2ZOEB 1YXWA 4RFRB 1ULGA 3L2HA 1H1AA 3LEMA 4BQ4A 3CIHA 2CWSA 1RUJ3 5HCAA 4OI0A 3A7QA 4LA3A 1LU2A 1NCRB 1AR73 1T6BX 2I45A 1R091 4UW5A 4XEZA 5IK7A 4BWOA 5FWJA 2UU8A 1LRHA 1W06A 1RYYA 1SPPA 3MYXA 2CSGA 4FPCA 4YM0A 1X36A 4JV4A 1GLHA 2GNBA 3V0AA 2VZ3A 2PYTA 1D0GA 2VQTA 3SITA 4COZA 3MF9A 3GZTB 2QQLA 4AYUA 5FXXA 2IVIB 3DCQA 3O7OA 4JC1A 2Y6KA 1NX9A 2BFUL 2FDJA 3DXUA 2P3YA 3LFMA 1QQP2 3AB0A 3M3QA 2Q4SA 3I2DA 1GP6A 2WNUA 1PZ7A 2LRPA 1E57A 2VBBA 4LO5B 5DXDA 2VZUA 2WT2A 5C9AA 1NE6A 2JDNA 5EFUA 5ABJA 5KWRA 3H8RA 1RUH3 4YG0A 4CEWC 1YQ8A 4IESA 2VOKA 2V4AA 1C8M2 2HWB1 2ZGKA 1HV0A 1JU4A 2HEVF 1BK0A 3KV6A 1AL23 1I5PA 1LOEA 2WQ4A 3VUOA 4YVWC 2J42A 1IKPA 1DDLA 1ULPA 2AGSA 4N90A 4DIQA 4YGBA 4C1WA 3WCSA 2ZA9A 4MGZE 4JGYA 2K46A 4IGPA 5F3IA 3I97A 3JCIA 2XKPA 4PBOA 3WNKA 1E5HA 1U5YA 3VD7A 1JI6A 3SH3A 3WF2A 1SCRA 4WM8A 1DP0A 5IAXA 1XXNA 1QDOA 2R0FA 4DFSA 4XIOA 2X09A 4CU7A 3IMNA 5AVAA 3LQCA 2XMLA 3PU3A 4A42A 5ISLA 1CAXB 1XYOA 1FOD2 3DEMA 5CG9A 3AYCA 2WNOA 4AI8A 1XBFA 4C90A 4Y3OA 5DZFA 3ZSKA 3WQBA 1JUIA 2OXBA 1PX3A 1ND2C 4OCTA 4BZ4A 1TQ5A 2FDHA 2D6KA 1VAMA 5BYNA 1VRBA 1NXMA 1YI7A 4F7ZA 2TEPA 5JOZA 3OPZA 4H3WA 3T1LA 4AI9A 4CDUB 1V6MA 2Q0AA 5LA1A 3IDBB 4Z82A 3H3UA 3OY8A 1OQEA 2ZMLA 4XFBA 1K5MA 3A22A 4Q4Y3 2HWC3 3GCXA 4XUNA 2AR6A 1MS8A 1JUHA 4BQ5A 5FQ0A 3MW4A 4P14A 4KG8A 3UGGA 1W6PB 1MEC1 2IXJA 1RUG2 3OD4A 3EXUA 2WA4A 4GMP0 4XFFA 4IEQA 4AQ6A 3LPFA 5FZKA 1MQTC 2RDRA 3URFA 3NJYA 3W58A 1ALYA 1QQP3 5T3NA 4YZ2A 5LZ6A 5JSOA 4P00B 2C0ZA 1C8NA 3GF6A 4Y24A 1JXNA 3DYPA 4Q27A 4D0QA 1I1EA 3ZFFC 3OYWA 1VLNA 4CCNA 1O3QA 5BUVA 4QDSA 3S5AA 1OF4A 2VTXA 1XNAA 3GALA 1AX0A 1C8M3 2VJXA 5KHKA 2DCZA 3SLIA 1ULCA 2P4EA 2UYBA 3ASIA 1FPN3 1K5MB 1UY3A 2E7QA 4YFWA 1U5IA 2ARAA 5BPXA 1CWPA 2QQWA 2YHJA 1UU4A 4Z07A 3WG1A 5FTTC 1Y43B 4YVSC 3RSJA 3M3CA 2RDQA 3ME2A 2RS51 1W04A 2XJRA 1LHNA 4CEWA 1WLTA 3ZN6B 2HEYF 2CY6A 5CKNA 3E6CC 2VW0A 2W39A 1BBT2 3IAQA 3RZMA 4WVWA 2A3WA 3CZUA 4YVWA 4E2GA 2YY1A 5JSPA 1ND3C 3KV5A 4ZS3A 2R061 3MEPA 4H2AA 2R072 1XRUA 1MPXA 4K1YA 3ZKUA 1WMXA 3BU7A 1VBC3 2G9FA 4LO4B 4BISA 4OMDA 1LEDA 4IV1C 4R4XA 3VZOA 3RGBA 1FOD3 3BB6A 3JUUA 3AK0A 4LBQA 5LEKA 4BXFA 3N9MA 4LOSA 5A80A 2YFZA 2XH6A 1YO8A 4OUSA 1CONA 1MACA 1OI6A 3B9CA 5J7MA 4A3XA 4UBHA 4AQSA 5T5LA 1CAUA 4BLIA 4QD2A 1QJU2 1UW8A 3MIEA 1PO12 4AHWA 5BNOC 1QU0A 2MEV2 2PN5A 4Y1XA 5JPNB 2OVUA 2EXHA 3M70A 4A44A 1D0HA 2BJSA 4K20A 3VB9A 3W21A 5LW9A 1UCXA 1RL3A 1S0IA 2X29A 3O1VA 5CISA 1PGW1 2LUWA 4NUBA 4QKFA 1A8DA 2LS6A 4GZ9A 5EJ3A 2JB4A 3LDKA 4IEWA 4EN8B 4AVVA 1UKRA 3FX3A 1N1TA 2FBEA 3N36A 5FLHA 4DXTA 1YQ2A 2QKDA 1PO21 4IGOA 4PBPA 2ILMA 4CTEA 5C7GA 1EV11 4DUXA 3S7EA 3ZSLA 3ORJA 5JR2A 3RYPA 4GQ7A 1FXZA 1H4HA 1QJX2 1W99A 2JG9B 4AAXA 4D7YA 1PVC1 1HLCA 4QXKA 2ATFA 2DTWA 2VR4A 1GWKA 2F17A 3HQRA 1REFA 3J7MA 4NHMA 3USUA 2JG8C 3LDBA 1ZZBA 2ZHKA 2VNRA 3LA3A 3JD71 4Y22B 3WP5A 5AFEA 5D2AA 2JX9A 4B7KA 3NV3A 4NMIA 4JCKA 5DMYA 3OD0A 1RUI3 4XQDA 5J36A 4DO0A 1SFNA 3WF0A 1MQTA 4RQPC 5DABA 3POEA 4KU8A 5LB6A 3U4SA 2VE1A 1C5HA 5DG2A 4N9HA 2WNVC 2Y6FA 4Q4W2 5FMOL 2FHRA 3FFZA 1QNWA 3RRDA 4XHBA 3CU7A 1WLWA 4IEZA 1XE0A 3AMQA 3WY6A 4BJ0A 5EV7A 3WHTA 1AHSA 3BI3A 1TE1B 4YW4A 3CJIB 3KCYA 1BBT3 1WMDA 1TEIA 4HN0A 3CEWA 3UKNA 3VBSC 4TN7A 4E2QA 3T2PA 2QTWB 4A2UA 1BEV1 1WW7A 4EJRA 1SBDA 1W9WA 2JDHA 1RUC2 2J1UA 4QB6A 5FREA 2PFWA 2R073 4YVSA 4CDXB 4ZKTB 3JBG1 2CU5A 4Q4X2 2Y33A 1KS4A 3BALA 2JWPA 3DXTA 4YW1A 1ND3A 3AJZA 3ZXDA 1OKQA 2YB7A 1V6OA 1F5JA 3C7OA 5IVVA 1AVBA 1UX6A 1S2KA 4DQAA 4FP3A 4Z2WA 3SKJE 4W8JA 2VOVA 2BOJA 2XWJB 4IV1A 2VTXJ 1QJU3 4XJ8A 3IDAA 2MEV3 2ZKLA 4LBKA 4NIIA 2GH2A 4QQ2A 3WNPA 2RR12 1CGPA 4HVOA 2Y6JA 5LK5A 4PIXA 3CJXA 1MS3A 5EJ1B 1OPOA 4SBVA 4E4ZA 4QHOA 1PIV1 2A1XA 2RDSA 1W2TA 1X8EA 1REEA 3K46A 2P6HA 2R042 5BNNB 1HB4A 4LBQD 1OOPB 2D3PA 4IEPA 4L8QA 1RXGA 3LSDA 3MLKA 4BM8A 5BNOA 3RPQA 1JZ4A 2ZGMA 4MG2A 1LECA 3ZDSA 4FXGB 2P3JA 5A7NA 2XOMA 4KH9A 1QJX3 1WBFA 2VGDA 3MIDA 2LALA 1FMD1 3KHCA 2BNNA 2HWE1 2ETEA 4L97A 1UWWA 1Q8PA 1VB4A 2VVDA 2XGXA 1W8OA 1Y4WA 2EIBA 5LCWL 3DPRB 1N1YA 3DV8A 1RHI2 4M4RA 2BRTA 2QQIA 5JR7B 3VV1A 1NE4A 1RUF1 5A3TA 4FFFA 3D8CA 3AYEA 2VL4A 3NNFA 2VMEA 4B8EA 2JB8A 1PGL2 4FTBA 5IAVA 4PQ9A 5CFCB 1GQHA 1IKQA 3ILNA 3O12A 4XJ9A 2PXJA 2EXKA 3RYKA 1B35C 2BDRA 4YW5A 2W0XA 1S0JA 1LOCA 2MPFA 3D3AA 3GHMA 4RQPA 4YLZA 4YZ3A 3U10A 3M3IA 3WEZA 2ZEXA 2WNVA 3CQOA 4XBNA 4M3CE 4E8DA 1AYM2 1YJKA 2RDNA 3DYOA 1Y9MA 2EIGA 1TME2 3NQHA 4XUPA 2DYCA 3IWZA 2EA7A 1RUC3 3D82A 3R4UA 2NLRA 3AYAA 3I7DA 2O0OA 3BIWE 1YFYA 4HOOA 4JDOA 1Y9QA 2J1TA 4AFBA 1F9KA 1X7NA 1XYPA 5FZBA 4Q4X3 2JE8A 3H1WA 3VBSA 2GNMA 3R0RA 1W0NA 3NJVA 4FSJA 4M0HA 3ZOIA 4HK9A 4GA9A 4META 2L9LA 2F4PA 1GZWA 4GKXA 5ACA1 3R4SA 1NY72 3OSDA 1OC1A 2GP3A 4CVUA 2B5HA 5GZGA 1WCKA 1QXJA 4YW6A 1HB2A 4ATFA 2CWMA 5IT6A 4YYOA 2ZABA 1FT9A 4O9GA 2WT1A 1RUE2 1IPKA 2RR13 3KHBA 4EWEA 1GP4A 3ZSMA 4XTPA 2VCMA 3SISA 2Q8OA 4IEOA 5LY1A 1ULEA 1YJLA 3AVSA 1C28A 5FOJB 3HN3A 1QJZA 3K4AA 5DZEA 4OHWA 1LGNA 5CAZA 4Q26A 4CUCA 2TBVA 1GBGA 2Y38A 3LB9A 4FAGA 3IT8A 3PJYA 3W20A 1VPHA 4QT6A 1EPWA 1JHNA 1O5LA 3QD6A 4TSVA 3ZYHA 1ODNA 3RJ2X 3U75A 4FTSA 2O8OA 2OT7A 1SACA 2I74A 3OBZA 5FY4A 3VN4A 4P9XA 4FOWA 4AXOA 3LSEA 4CXWA 3FC0A 1LOFA 2GNTA 2X05A 2E31A 4P9YA 1CJDA 4GB32 4HT1T 3IDEA 5J98B 2RS53 3T0DA 2XXZA 2W1QA 3SHRA 3WDYA 4WVVA 4LO8A 1F4AA 1AR71 2V5DA 4NN0A 3K77A 3VBFC 3V56A 3VKFC 4W6YA 5I8SA 4MXWA 1AYN2 4XDOA 4COWA 2R063 2WKKA 1XPWA 4QU1A 4AEMA 3Q9OA 4W65A 4Y5Z0 5FCCA 1AYM3 4FO9A 4NROA 4WVMA 3ILFA 1H1IA 4P9LA 5KXBA 1TME3 3MPBA 1TMF2 2ET1A 3AFKA 3FJSA 5FPAA 1X82A 1UZZA 1Y9GA 5AVPA 4LBJA 2YU1A 5C3OA 3PMEA 1BMV1 4KGQA 5FYIA 2UYAA 5A1FA 5IVBA 2VZ1A 1YFUA 3ZYPA 5HXVA 3POYA 1OQDA 2IXLA 4PIZA 4RS5C 3LFIA 1RJ7A 4W50A 2RMU1 1UMIA 5DDJ1 2ADEA 5DG1A 3U14A 4N43C 1W2OA 3VD5A 2B7YA 3GBFA 4ARYA 5L7OA 3IDCB 4QMAA 1D4M1 2VW1A 2AH2A 1S0GA 1DGRN 4DUVA 1PMIA 1VBE2 1I3HA 4QXBA 1EV13 2A70A 4GH4C 3UKVA 1AL21 1OKOA 5I0DA 3A0NA 1XNCA 4AI3A 3K51A 1FMD2 3H3LA 1UY2A 4BQ3A 1H2NA 3OJBA 1YFXA 2B39A 1KITA 4RR3C 4CDQC 4HK8A 2D6LX 1E5SA 3TRSB 3JD73 3RWNA 2A75A 4L92A 4YW3A 2W1UA 4QGMA 1S0EA 4Y33A 4X6QB 2WZR2 2O8QA 3AP7A 4IV3C 4R9CA 5LRSA 2BTVC 3AP5A 5CA6A 1RUF2 1UY1A 1FV2A 2W5FA 5KHHA 4FXKB 2XBO2 4ZHNA 2Z42A 5FPZA 1U5ZA 3OG2A 3SEEA 1KXGA 4XILA 5D8AC 3ZSJA 1PX4A 4P9WA 2QQUA 3HN1A 1WW6A 4LO6B 3AVRA 4GIQA 5FZ1A 5FMDA 3RI8A 3PTRB 1V0AA 1S2EA 2B4KA 3OPTA 5DUVA 4D7TA 2J1EA 3HMYA 4Y20B 2C4XA 4A3ZA 4N9IA 2GC3A 1WBLA 2PHWA 3RI9A 3RNSA 4GB33 1UL9A 1XE7A 1QWRA 3PVBB 3VDDB 2JJ6A 5FUPA 4WM7B 4W6XA 1ZRRA 2A6YA 3DUIA 3A23A 3VBOC 1BEV3 4BDVB 4CP1A 5M0TA 2V09A 3POGA 4I01A 3U07A 2VMIA 1SZBA 1CIWA 4UFKA 2GNDA 3JBG3 3LZZA 1HRI1 4K21A 5F6LB 3T0AA 1Z7S2 3ZMOA 3AP4A 3VBFA 5I91A 2DBNA 4HPKA 1H2KA 4QPWA 5IK8A 4QM8A 4M0NA 1CAVA 4HSJA 1XU1A 3KV9A 5FY9A 4LJHA 3VKLA 2FZ1A 5A1LA 1KQRA 4M3CF 1D2SA 1HQWA 1MZEA 3LOIA 4K1ZA 1QQP1 4MO3M 1C1LA 1UPSA 5FV3A 1M4WA 3PHMA 2FMDA 2VXJA 3MICA 4L11A 4UF0A 2VMDA 1VMJA 4C8DA 4CDWB 1AXYA 5A7QA 3WF3A 4A45A 1TG7A 5F5IA 1YNAA 3JXSA 4Q0VA 3I59A 1PIV3 2VD7A 3SH4A 2CL2A 1V6NA 2Y0OA 4PF5A 4EZHA 3I2FA 4RS5A 1VBE3 4FI9A 4RGKA 5J37A 3C8XA 4YM1A 5C3PA 1NCRC 2LROA 3HVDA 1PGL1 1FMD3 1F4HA 4F8AA 2R16A 2C5DA 4NR1A 5F37A 4DRVA 3FUQA 4MH0E 1NQJA 2WZPP 2WLQA 2Y60A 1W8ZA 4GH4A 4QX1A 1MS9A 1DZRA 2WZR3 3ON7A 5CVRA 3RZHA 4CA9A 1JYTA 3GBGA 1HJGA 1RUF3 3VD9A 3AZZA 4NWVA 2XBO3 1QIQA 4UAPA 2J22A 5K0UB 4CDQA 3CF6E 4DEQA 3S0MA 1W6QA 5FP7A 2WRAA 1SDDB 3CLPA 3WDUA 2HH9A 5FZDA 4IV3A 4QPGB 1FOD1 4Q0SA 4V2WA 5GLZA 4HZFA 2WJSA 5FZIA 1LHVA 3ES1A 1HB1A 1OA4A 1W8WA 2YC0A 1PMJX 2ID4A 3OF1A 4GULA 5FYVA 3WX5A 5D8AA 1LU1A 5KXDA 2EVXA 2XHNA 5JXIA 1W9YA 5K4LA 1RC6A 5FZHA 2WWJA 4MADA 1DQ6A 5EXOA 4QQLA 3SH5A 2QQOA 1JZ2A 3TEZA 3VZLA 1BMV2 2ZHMA 5A7WA 5A33A 2BVVA 5JZGB 1Z7S3 3PUQA 3NO8A 5A6ZA 2O14A 4HLTA 4UOJA 3LE0A 1UOGA 2R1DA 4QQHA 3VBOA 2E6VA 4FOYA 2W87A 4QPIB 2YGMA 1UQXA 3WQ7A 5ACA3 1RUG1 1EAH1 2EXIA 3KVAA 1RUNA 4NAOA 3RVHA 5CIRA 4HG6B 1DF0A 5FRAA 3AXEA 2VU9A 2OUHA 4XJUA 1O3TA 1Q43A 4X8NA 1D4M2 3I3QA 1W6NA 5CFDB 1AUYA 3N9OA 4HN1A 1UPIA 2RJ2A 2D40A 4QM9A 1UYPA 2Q1ZB 4QX5A 1VMFA 4M3CA 3KD4A 5FUNA 3M4FA 4EQVA 4CCJA 2HYXA 2ZS6B 4CEYC 2DF7A 1YUDA 3B94A 5LRRA 5C4WA 3ZFEB 4KBZA 3IIAA 2PAKA 5CYYA 5IHRA 2BFUS 4O65A 4BIFA 4XUQA 1MS0A 2YBKA 2UY8A 1VMHA 3FFQA 4V2VA 4A4AA 3UGHA 2GMPA 3NAPC 5IWFA 3WOGA 4LBNA 5A3WA 4XBQA 2WN2A 2SLIA 3RQ0A 3NNGA 1GQGA 4FTEA 1BBT1 1W6MA 2D7FA 4ATEA 1STMA 2RJLA 1CVNA 4XZUG 1SFPA 2OQ6A 3Q8BA 1GICA 4ZPIA 5J3UA 4Q1RA 2WO2A 5A32B 5I0SA 2JDZA 3O14A 3ZYRA 1F2NA 2R071 2Y6LA 3MIFA 4R52A 1H6YA 4RGAA 5T52A 2A71A 4E4HA 3H8XA 3OPWA 3LD8A 2C24A 2WFPA 5L9RA 1I6XA 1UOFA 1LOGA 1JN2P 4RHV2 3TBDA 2P3IA 1NCQA 1ZZCA 2OIIA 2GU9A 4QGLA 3WDTA 4AZZA 4N53A 2PLV2 5FZ0A 3WNLA 2WYFA 3BTAA 4CXYA 2DCYA 4H7LA 2NQYA 1HRI2 2ZX0A 1OVSA 2Q1MA 4MHUA 4NAMA 4XURA 3W9AA 3B3QE 3ILRA 1LOBA 1QJU1 1IS5A 1PO11 2WT0A 4XIKA 2MEV1 5ERLA 4NHXA 5CKMA 4BQ2A 4WBBA 5L9VA 3R05A 4JZRA 1A6CA 2H6CA 5HV0A 2A6XA 3O1OA 4CYDA 2WFF2 5JPMB 2Y34A 1MZ6A 5T55A 3SCGA 2DWRA 2ZGSA 2RMU3 3WDWA 5DDJ3 1E5RA 3EO6A 3EB7A 4S2DA 5EIYB 3NL1A 3WW1A 5F3CA 1H2MA 1QJX1 1W3VA 4PI2A 1U0AA 2JDUA 1GOHA 4XUOA 4JAAA 1J1LA 4YW7A 4XXPA 4DY3A 4LUMA 1D4M3 3IPVA 4AHYA 4OHYA 1JZ5A 1HJFA 1V00A 2D44A 3P6BA 4N53B 3QLQA 4MLOA 4YFZA 3W5NA 2JE7A 1H8TC 1SPPB 2OX0A 2XJSA 2JD9A 4Y1UA 3VBRC 4HKLA 1APNA 2XL7A 2DV9A 2ZGLA 5FLIA 2QQKA 5FJHA 3JB4C 1ZZ6A 4OUMA 1RGSA 3T3YA 3ACHA 1HXS2 1E5IA 2NPIA 1SBEA 2VTFA 1ZBE1 4HSLA 3U78A 3ENRA 1ACCA 2ARBA 4HKOA 1UD1A 3KSCA 2WAOA 2YBSA 4Q4W1 4CP9A 5AFBA 1R1ZA 4CEYA 1IOAA 3AYDA 3VL8A 2WC2A 1HV1A 3LEIA 3D0JA 3WG4A 2IXIA 3AMNA 5FZOA 4KG0A 2WNUB 1GNZA 4MX3A 5C3RA 4IE0A 1LAJA 2CAUA 1H1MA 5C9AB 1KRIA 3FBYA 4EYUA 1W9FA 5ABJB 3N7JA 3NAPA 1G86A 1RUC1 5CBLA 2DURA 3RMYA 1UZYA 2H0BA 5LASA 3THCA 1COV2 2JG9C 4Q0PA 3HQUA 3BPZA 1W03A 3QCWA 2ZX4A 4Q4X1 4LHLA 4C1XA 2BNMA 1LEMA 1R1A2 4RHV3 4CE8A 1YIPA 4JGYB 3GM8A 1VP6A 2KXLA 3POWA 2BVBA 2PLV3 5F2WA 4GMP1 3ATGA 4KQ7A 5DAPA 1FI2A 3KQRA 3PUIA 4ISRA 3ZXFA 1N47A 1HRI3 3I2JA 3WINE 1YQ5A 2F6BA 4I0BA 4WM8B 2XJQA 1F15A 4RFT0 3LA2A 3OOXA 5F2SA 5T50A 1LESA 4OI4A 5A6YA 1W8TA 1PNGA 2RR11 3WP3A 1ZRIA 1EAH2 4GJZA 2AREA 3KCCA 4XTMA 4QWNA 1PK6C 4DXSA 2WFF3 2R041 5DZGA 1RUOA 3OUHA 5L19A 4B4PA 5GZFA 3HT1A 3MLJA 1K42A 1Q5OA 5LK7B 3HAGA 1SMVA 4FOVA 3K4DA 1XNKA 3NKTA 3KF3A 3ZPOA 3GHNA 5FZGA 2HKXA 1IZ3A 3ZLIA 2FMYA 4CP0A 2BWAA 2ZEYA 1ENXA 2GC2A 3MW2A 4Y1ZA 5HI0A 2DVAA 1KJLA 1RHI1 3OY8B 3FL7A 4IE6A 1PMHX 2W94A 2QZ2A 3DYMA 1HXS3 3HNMA 5FQ0B 4QXCA 1VE0A 4S2HA 2QQJA 4MGQA 2VQAA 1QNYA 4YZ5A 3BTZA 4C0HA 3VBRA 1G6NA 4BMBA 2PHFA 4GXLA 2NZ9A 4X8PA 4F3JA 3C7EA 1VAKA 2E51A 2EIDA 2WQ8A 2XJTA 1V9U2 3MLLA 2JIGA 2ENRA 3IBMA 4PF1A 2JXAA 2VMCA 1UMZA 2BZDA 3FZ3A 5C8CC 3DF0A 5HCFA 3RZKA 1AYM1 2WN3A 3OYWB 5FZAA 4XBLA 1ST8A 1TME1 2W52A 3UETA 2YBPA 2BYVE 3TNQA 1DQ4A 2A3XA 2UURA 1DCSA 2WDBA 4LORA 2E7AA 4JKKA 4NE9A 5FMOS 1UNBA 5FY5A 2JICA 4ZU7A 4WZCA 1DGWA 1OURA 4IERA 4FVVA 2GSYA 3E5XA 3RZLA 2WWUA 3WLUA 3AXDA 1NLQA 3L2YA 1UZ0A 4S2FA 1DYKA 2DUOA 4IEYA 3V0BA 3CL1A 1RVF2 5LBBA 4BK4A 4CEWB 2RS31 4LTAA 5JMOA 5KHJA 1ND2A 3N7LA 1FYUA 5FDBA 2ZHLA 1NY71 3DPRC 4AK3A 3D4KA 5F1RA 4LK6A 5C33A 4OQ9A 4YVWB 3KT4A 1C1FA 2IXKA 2VUDA 3B5LB 3LIHA 3QOPA 3TEXA 2IXHA 3OGJA 1KJRA 3PL0A 1BVVA 1RUE1 1I9RA 4AQ2A 2PHRA 2VXRA 5GKAC 5CFCC 1YI9A 1RUG3 2VUCA 1EAH3 5HV4A 2B9UA 3H3ZA 2UWAA 5I93A 3OEBA 1AZDA 5FXWA 4EWAA 2Z2SB 1Q56A 4LBQB 5EWSA 3M2MA 3CDZB 2GC0A 1WUVA 3P3PA 4C0BA 5IFPA 5T5PA 3WV6A 3AZWA 4E2SA 1UU6A 3T1MA 1GUIA 2QBXA 3E6DA 1CAUB 4XF1A 2EXJA 4KI5M 5JIUA 1I5ZA 1PK6A 5GALA 3AKRA 1W3XA 1ZBE2 1VBD2 4OFGA 5CEHA 3T2QA 2EIEA 1S1AA 3GBWA 5HXMA 3ZFGC 4WZFA 2R7EB 1H8VA 5FXZA 4B4QA 4MGTA 3ZFFA 5F6KA 4GKYA 3WF4A 1GFF2 1QJEA 1R082 3K2OA 2AACA 2VC9A 4QQPA 5E6HA 4GB31 4B7EA 3KQ4B 3HEIA 1GZTA 1N3PA 1Y7BA 2VMFA 1SLCA 4ZONA 3USUB 5A7OA 5LEJA 4LKDA 1V9U3 1O3RA 1AYN1 1F5FA 1JYIA 4XXAA 3R6SA 3AM2A 5CB7A 2R6QA 1MQTB 4FFIA 2GH8A 5FYSA 1TMF1 2EAAA 4D69A 1IQAA 3TYJA 1M06G 2ZBJA 4P9IA 2XUEA 3TN92 2P17A 4DOUA 4P02B 2FD8A 1MVQA 4Z92B 1XNTA 2VUAA 5C8CA 3O1SA 2ZGNA 3J7NA 4JVAA 1GWMA 3ACLA 2C6SA 3ZXAC 3MIHA 1REDA 4XE9A 1PO13 4BA6A 1IGOA 3J7HA 1NUKA 1PZ9A 4D3WA 1URXA 3EJKA 1MS5A 4XC9A 5E16A 4YPJA 5SV8A 4D94A 3ZYJB 3ABZA 4XQWA 2ZEWA 4QB1A 5DQ0A 3NV2A 2EICA 2ZJCA 1PM4A 4JRLA 1XNDA 4URTA 4JGZC 2PHUA 5FMCA 5FR3A 3EBRA 5IFTA 1SLAA 4ARXA 4X6RB 2P2KA 5F5QA 3CO2A 1VBE1 5IVEA 1A3KA 4YVSB 2GC1A 4Q8KA 2DCJA 3OBAA 2VW2A 2YU2A 2E63A 3KMHA 2H0VA 2BU9A 1QJY2 1RIRA 2P3KA 5IVYA 5FYCA 3ZPYA 3RDIA 1CD3G 2XG3A 3TEWA 2HWD2 5EYYA 3WF1A 1ND3B 4LMFA 1ULFA 1GV9A 1EYBA 2PELA 4LKFA 2QUOA 1ODMA 4OVEA 2WBKA 2WZR1 2VZPA 2EAKA 3HBKA 4AEJA 5HCHA 2BUKA 1SG3A 4IW3A 4IV1B 3BVCA 3VZKA 1DZQA 2DVFA 4Q4V2 1QOOA 1X33A 4Q8LA 2XBO1 1SCSA 1YC61 4V1PA 2JG8A 1ZBE3 4TLFA 3E5QA 3J9SA 4D8MA 1J84A 1G8WA 2BP6A 2P34A 1RINA 1LTEA 1WGPA 3H1MA 4YM2A 1WA6X 4F83A 4LHNA 4LOTA 2Q8CA 5F8PA 5AC91 2PHTA 4Q4W3 3TOJA 1ZRCA 1R083 4QHZA 5BNOB 2PQSA 1JZ8A 2WZ8A 5IATA 3F2ZA 2XVLA 4AL9A 1K3IA 4JDNA 4IUGA 4E9KA 1VBA1 5FZ6A 3ZFGA 1QH6A 1W9SA 4A7YA 4EN6B 2WA3A 2QZ3A 3VBHC 2V72A 5JOWA 5BNPC 2VVFA 1T6GC 3KT1A 4MZUA 4XFGA 4XJAA 3VHRA 5DPNA 1SLBA 5EYXA 3FHAA 1HW5A 2X5IC 4AI1A 3HT2A 4R8HA 4UXAA 1H9PA 3L9JT 3GCWA 1VAVA 4PHZA 1Z7S1 3K75B 1K5JA 2XUMA 4Y4YA 3HOBA 1UY0A 5T5OA 4ISQA 4IE5A 4LIVA 5A3MA 1FNZA 2ZGRA 5FIXA 3MIBA 3SQOA 2GDFA 3B9IA 1CN1A 2RS32 4GMP3 1OUSA 2Z69A 3AKQA 1AR82 2AZ5A 3MW3A 4FQ4A 4K9SA 1POV0 4L99A 1LNSA 2LTNA 2CYFA 4UI9L 3C7GA 4XQ4A 3E5UA 1HB3A 2WZEA 3G7DA 4RQPB 1X9PA 4U36A 2D97A 3M3OA 3VBUC 2PQQA 4YSFA 1G9BA 5K8SA 4GAZA 1IS4A 2WNVB 3P3NA 4IXLA 3ZR6A 3GXUA 5I0TA 1BZWA 1LB2A 3I54A 5FAXA 4BU2A 1Q3EA 2R043 4BIOA 1W2AX 2GALA 3GZAA 1FAYA 2Z79A 4O7XA 3PDQA 2EALA 4EROA 2JDAA 1SQ4A 4HVRA 3WCRA 4TLGA 3OGVA 1AR92 1ZA7A 3WP6A 2DVDA 1QJY3 3VL9A 1WCUA 3VBSB 4JGZA 4YZ1A 4LKSA 2YUEA 3LA7A 2BERA 1H6XA 3MFAA 4OHZA 2VOTA 4NIDA 4GD4A 1GZWB 4AI2A 2ES3A 4IE4A 4DZGA 1NA1C 4HVQA 3NV1A 1RHI3 2XWBB 2VCBA 3VD3A 4C91A 2VO5A 5FYBA 4FPYA 3PUAA 4CZSA 5F7UA 4IGQA 1PHMA 2CNAA 3PMSA 3J8F2 1K12A 3JB8A 4OZXA 4B1MA 2DVBA 1CPNA 5IW0A 5FPBA 1IS3A 1MZ5A 3UV9A 4LHSA 1HKDA 2BOIA 3H8UA 4NWWA 5IYYA 1VALA 2TNFA 1YHFA 2BQPA 4CDWC 4G3YC 1TVGA 3H8OA 4IEXA 4EN7B 5LY2A 4MOAA 1GOGA 3FHQA 5FO8B 2WR9A 3HR9A 4UBGA 2BNOA 4YG3A 4QKDA 1HQLA 1B35A 4Q29A 5KHGA 4PCRA 5FUIA 1XC6A 3ZIXA 3M3EA 2XJUA 3N3HA 2W68A 5FY8A 1HIXA 2XPJA 2ZMNA 1DLLA 2YROA 2ZGTA 5BXXA 3T30A 3VBHA 2VQUA 2ARCA 4JQRA 4EE2A 5BNPA 3WNNA 3OUJA 4HKWA 1XJAA 5FYZA 1GU3A 2QNKA 1DQ2A 3ITQA 3Q8CA 2X5IA 1B09A 2RS33 2VMGA 1AR83 4AAPA
chains in the Genus database with same CATH topology
1TNFA 4COUA 3K48A 4ORFA 3C3VA 4L9BA 4Q2FA 1QY4A 2ZZQA 4BMEA 5K0UC 4MXWB 1OSGA 3WUDA 2NYYA 4LT5A 1BKZA 2ZGUA 1RUE3 5CNAA 4PDWC 1YFWA 1OA2A 4QPGC 4WVMB 4BCUA 2X53S 1ZBA2 4XFHA 2ERFA 4AWDA 1ZRDA 4QPYA 3G6JB 3VBUA 3U11A 5CU1A 3MPPG 3FMGA 3AP6A 2C9AA 1NYWA 4KU7A 3POSA 4LE4A 3GNEA 2EF6A 2R0HA 3E97A 3WG3A 3ETQA 4RA0A 3TNPB 4OHXA 2HWF2 3DN7A 2AUYA 5JZGC 3RMXA 4AEDC 5L7OB 5AC92 1SFYA 3J8F3 2ZAHA 1EP0A 3B69A 4N7IA 3DL3A 1VBA2 2G9GA 4LA2A 2ZMKA 1NA1A 3SXWA 4RHV1 4YGCA 1HRV2 1X50A 5CFDC 1AYN3 3WNXA 2CGOA 2PLV1 3VHPA 2JEMA 4AF9A 4XHXA 4YRDA 1NLSA 4RL7A 1UIJA 4IEUA 4LUKA 4FPOB 5I8TA 1TMF3 2WS92 4TZDA 3SNMA 2I2SA 3A4UA 3ZSEA 4IETA 4WV8A 2IXCA 1VRH1 2PA7A 2WFF1 4YZ4A 3M7AA 1CQ9A 2BEOA 3INAA 4EWDA 3LWCA 2OW4A 3WW4A 2BBVA 1BXHA 2HEWF 2VMHA 2ZTNA 4HANA 1WW5A 1BVP1 1WD3A 2C1FA 4Y1YA 1CX4A 1AXZA 1O3SA 1UN1A 1SBFA 2ARXA 4HBNA 4N43A 2RM22 2B45X 1CAWA 1NQDA 5JDBA 4I30A 1O4YA 1IHMA 2XVKA 3VBFB 4G4FA 1HXS1 2XHKA 4HPKB 5IK4A 2D43A 1WMFA 1GR3A 1CAVB 1MS1A 5KXEA 1V6LA 4PDWA 1Z0HA 3A0KA 4XF9A 1V70A 2D93A 4COVA 3ZVXA 1HDKA 2WL1A 1QXPA 4AW7A 1ZRFA 4RR3A 2CGNA 2K0GA 3ST7A 2HWF3 4DMIA 3KLSA 4MGIE 3I59B 5AC93 1C5IA 3SCHA 2VUJA 4RS5B 2VOXA 4XOGA 3JZVA 4FPKA 3OBRA 3ZN4A 1VBA3 3MI8A 1COV1 4I09A 4IEVA 4WVZA 4K40A 3RZZA 2DFBA 2W08A 4JTOA 4AEDA 4EN0A 4YW2A 1VIWB 1R1A1 4LBOA 3HQXA 1U5XA 2ZX1A 1QKQA 2D5HA 1IS6A 2R32A 1POV3 1RUJ2 3PJQA 2GMEA 4GH4B 4KBBA 4I0AA 3WT3A 1RUD2 1DGLA 2ZACA 3NV4A 3FBMA 4RR3B 1MVEA 4CDQB 4E27A 1FNYA 1W6QB 3AKTA 5DUWA 4IV3B 3VGIA 2VVEA 4AFMA 4BOWA 2K2SA 2IC1A 2YV8A 4AHXA 5E89A 5D8AB 4KWJA 1SLIA 2NM1A 1VBB1 3LAGA 3H1YA 5ABJC 3H50A 4TWTA 2QJVA 3FLPA 5A33B 1A8MA 2RM23 4OULA 2D6NA 2DVGA 4K7JA 2D3SA 3FE5A 1GYKA 4LR4A 3VBOB 1Q8SA 1U12A 4XFCA 3N35A 4CDUC 2A7AA 5JIAA 1BK1A 1NCRA 4YG6A 1V9U1 1W6NB 1LULA 1Y3TA 4L2NA 3N7KA 1KDMA 3H7YA 4M3CB 2BGCA 3WUCA 3KGLA 2Z5WA 5C4WB 2E53A 1GZ9A 1RMU2 2AENA 2JENA 3M1HA 3U0ZA 4Z8BA 4FOQA 4BH9A 2HJIA 5C8WA 1O4TA 1YIFA 4XZPA 4NOTA 3V65A 1N1SA 4AGVA 4NPRA 4J1WA 4DNYA 3CNAA 5F9TA 1RVF1 2B42B 1LCLA 2UY9A 4K6BA 3ELNA 3VKOA 1W6MB 1VRH2 4XFIA 1K5MC 1RUD3 4BQ1A 3B7MA 4FPHA 3WW3A 1DFQA 3EHKA 3WW2A 1OLRA 1V6JA 3VZMA 1W39A 1KS5A 2GAUA 3EQEA 3AZVA 2VPVA 4COYA 3AMMA 2HWC2 1NCQB 2XLAA 3N7MA 4Q4Y2 1DQ0A 2AYHA 1YLLA 2QCSB 1UKGA 3JQWA 3T2TA 1OFSA 1JYCA 3NKGA 3KT7A 4PLOA 5JLVA 1JOJA 3BOWA 1VBD1 3KB5A 3AKPA 4XF3A 4DINB 4MGKE 2ZCWA 1QMJA 1DBNA 1S55A 1CAXA 4H55A 4H7MA 4ZU4A 1R081 5D1IA 2GN3A 4XYXA 3PVOA 4B4RA 2NN8A 1ASJ1 3BCWA 4B29A 2OUJA 2WWSA 3WDXA 3HWJA 5TSWA 4J6GA 2E7TA 4Q0QA 4R9BA 4YGDA 2DUPA 3KGZA 1FPN2 5BV6A 1V6KA 1Q8QA 1EPZA 1GANA 3APBA 3IPVB 3OGGA 4Q0UA 4FAHA 1CR7A 4FPGA 5GM0A 2DTYA 3GYDA 3TWIA 4FP2A 3ZN5A 4CDUA 5JI9A 3AMPA 5A3LA 1NOVA 1PGSA 1C4RA 2JKBA 3IM0A 4XPVA 1RMU3 4MV2A 3TN91 1W6PA 4I02A 1VBC2 3UJQA 2R30A 4GWNA 2WIIB 1FATA 4CEYB 1ZZ8A 1WCDJ 1XE8A 3PLQA 2PAMA 2RS12 3BODA 3HBZA 1L3JA 1MR5A 2PAEA 1AR62 3SCFA 4FPJA 1VRH3 1LHWA 1WA4A 1OPMA 3NAPB 2DU0A 4XJWA 1NZCA 3LCPA 3X29B 5J48A 4NHKA 3VZNA 4AVBA 5FOBB 1LHUA 3CJIC 4KWLA 3N4MA 1QJY1 1VBB2 2WQZC 1DZTA 1SDWA 2HWD1 3B01A 1C57A 2WSUA 2YXSA 4LBLA 3W59A 2XVGA 4I3PA 4CDXC 2ZX2A 1LGCA 3UKTA 2OA2A 3LGRA 3ZN6A 1WLDA 4YARA 3AMHA 4LEJA 2QFEA 1HX6A 4Q4V1 4K8FA 2IZWA 1H8TA 3D6EA 3MGUA 2D5FA 1RUI2 2JE9A 4CRQA 4ES9A 4BLJA 1ENRA 5HCBA 3RJRA 2VULA 4W6WA 2JD4A 1S0FA 4NO4A 2NP0A 4J1XA 2VG9A 2R49A 5BNNC 1OOPC 4FQZA 3HIFA 1AJOA 2H6BA 1LGBA 2OZJA 3NWKA 4AGGA 3B00A 1N3OA 3U4XA 1COV3 4HL0A 1LR5A 5J96B 1R1A3 1QXRA 5GLTA 4EV0A 1O7FA 1PVXA 3ZO0B 1TNRA 1WMEA 2MHFA 1AR81 1H8TB 1IPJA 2JG9A 3VBRB 3WZ1A 4R9AA 3RS6A 2A3YA 4MVTA 1YCIA 4ONUA 2O1QA 4P9GA 4UW4A 1R092 3WDVA 4O9EA 4CP2A 2RS13 1LJ7A 4LE3A 4Y22A 5KC5A 1DQ1A 4MXVA 1AR63 4DB5A 5J09A 4FCAA 4XF4A 1W0OA 1H9WA 3WR0A 5E1RA 2ZAAA 2RHPA 2B8MA 1DG6A 3IKWA 3AFGA 4I0WB 1WW4A 3B02A 4ITCA 4HMZA 4FPFA 1UIKA 2GZWA 2Q30A 5T5JA 1AR91 4H14A 4AI0A 5L73A 1MZFA 1QOSA 1VBB3 5KHIA 2CTVA 2Y26A 3V0BB 4PLNA 4QGNA 2GN7A 4BHPA 1ND2B 4QU2A 3CJIA 3SMHA 1J58A 1G7YA 3J8F1 4P5HA 5I0UA 1CESA 1ASJ2 1JBCA 3ZXGA 1BJQA 2ZGQA 4CDXA 3WXPA 2HWB2 1AX1A 1Q8VA 1RJ8A 1VR3A 5DUUA 2A5ZA 3ALQA 4AFDA 1ZNPA 2P37A 1G9AA 1DHKB 2PTMA 4B3NA 3VLBB 3WVJA 1S2BA 3TAYA 4BYYA 2BWCA 2QE3A 4MUVA 1JTZX 1PK6B 2VECA 3AX4A 1ZX5A 4OHVA 2ET7A 4AVTA 5E88A 2B46X 1ZM1A 2VNOA 2KM2A 3ZFFB 3DGTA 2XL9A 3NVCA 5BNNA 4YNIA 3BOPA 1OOPA 5GLWA 4OI1A 3O0WA 1GNHA 1RVF3 3H7JA 3IN9A 3H9AA 2QDRA 2VOWA 3FUOA 2LM3A 3O0VA 4INDA 4R9DA 4AHZA 1ZREA 4MGYE 2DCTA 1R093 2R1BA 3KS7A 2MNGA 3E6BA 1SEFA 5KXCA 1Z78A 4M00A 3DPRA 1PNFA 2XKOA 2X8KA 1ZBA1 2UWBA 4JTNA 3KCXA 3I4IA 1KFXL 4ASMB 4XETA 3DKWA 3ECQA 1MEC2 5C8CB 3WQ1A 3QBQA 2YMZA 5CFCA 3VZJA 5JI7A 5JMCA 3NW4A 5H9PA 4BE3A 4Y1VA 3PVNA 1VBD3 2V5YA 3QH7A 4KNCA 2HWF1 4YGEA 1BYHA 2PHXA 1ONAA 3D5OA 2ZZJA 4IQPA 3J26N 1LOFC 3ZYGA 5FO7B 3ES4A 5GJ6A 1YYNA 1ZA4A 1VJ2A 1ASJ3 1J3RA 2BW8A 2HWB3 1SLTA 4TYSA 5I0RA 2RJKA 5JOYA 4LNVA 1MS4A 1NLRA 5I8YA 1QGLA 1JW6A 4XFAA 2SBAA 1HRV1 1AL0G 3UJOA 4XMAA 1F31A 1POV1 2RS52 3QH6A 5H9SA 4KGGA 4GALA 1S0CA 3H0OA 3OTFA 3MDPA 4LBMA 2QDNA 3OBTA 3R4DB 1H4GA 2JG8B 2WS91 3B93A 3FHIB 1A78A 1AX2A 2R062 2UWCA 3TN93 3WG2A 1QF3A 1H30A 4AEKA 4LLFA 3VKMA 1F8VA 4XDQA 1O91A 5GLVA 3J4UH 2FZ2A 4AFCA 1OA3A 1X8MA 5K9YA 2ZHNA 1O5UA 1OD5A 4AVAA 1OFNA 5E8AA 4XF0A 1OLQA 3ZFGB 1S0DA 2I07B 2ZPXA 5L7OC 1CJPA 1H2LA 2A73B 5CG8A 4YM3A 5B2GB 1FX5A 2N7GA 1RTVA 1KD7A 2RM21 2RE9A 3VDDC 1J59A 1PGW2 3RYRA 1G9DA 4WM7C 4MYEA 2VH9A 2HWD3 3ZXEA 4E4SA 1PO22 4QQOA 3VKNA 1ENSA 1EV12 1MEC3 1GKBA 1UAIA 1RITA 5KBFA 4I3GA 2YYOA 1PVC2 1EY2A 5CADA 3AZYA 2JECA 4Q4V3 1CPMA 4QHBA 3JU9A 1LHOA 3JD72 3PNAA 1O4ZA 2E9QA 5BNQA 5GZEA 1UF2C 2VQ0A 1D4VB 3V64A 2V73A 3O5SA 1W2UA 3ZXKA 1DGWX 3S6PA 2IWGB 4JGZB 2ZGOA 4K3UA 3ZXJA 3KM5A 2CV6A 1RUJ1 5FO9B 3MFCA 2A6VA 1XNBA 1H0BA 1XYNA 1RUD1 3WP4A 2D3RA 4G9SB 1BEV2 4Z1VA 5DUXA 5FLJA 3JBG2 3LOBA 5GZCA 1AJKA 4AVSA 4PIYA 1N3QA 4KL1A 3PVEA 3USSA 2D98A 3D0SA 3TB0A 4I2OA 4FPLA 2Y0IA 1UU5A 1D2QA 2IFWA 5FFOC 3O0XA 2WSVA 3PTYA 1ZYBA 1B35B 4UW3A 4MSVA 1ULDA 4Y26A 4LO7A 1XQNA 4DPNA 2PHLA 4HETA 1AR93 2OZ6A 5IUQA 3VBHB 1PIV2 5L36A 1YRZA 3NJZA 4Y20A 5BNPB 1LENA 1J3PA 1KDKA 1RUH1 4NVPA 4UW6A 2PHDA 4ZU5A 2X5IB 1PO23 1YWKA 4HFSA 1NG0A 1JH5A 4Q1PA 5JSRA 3VDDA 1PVC3 5JCTA 4OI2A 1J1TA 4WM7A 2HWE2 4ZXKA 5H9RA 4AFAA 3VHNA 4QPIC 3QACA 1DU3D 1NXD1 2TUNA 4AQTA 1DQ5A 1DIWA 3MIGA 2YGLA 1QDCA 1VB2A 3THPA 3VBUB 1RMU1 1LKNA 3AZXA 4ASLA 2ZKNA 2CGPA 1GZCA 1Q8OA 3S7IA 1BQPA 3S30A 3ZFEC 1AF9A 1DGRA 1V6IA 2DUQA 3UK9A 1QH7A 1WCSA 4NHLA 3LKJA 4XMIA 5GLUA 2K9ZA 4CDWA 4FBFA 2NMNA 4IL7A 2DCKA 4PJYA 2OYZA 2ZX3A 4R4ZA 1DYPA 1AXKA 1C3HA 4AG4A 1QHDA 2YZ4A 3UL2A 4AGRA 4D7SA 1NA1B 4LLOA 4N7UA 4DS0A 5H9QA 4Q4Y1 1ZVFA 2HWC1 1WD4A 3ZYIB 2WLPA 1OQ1A 5KC6A 5ACA2 3NSTA 1W0PA 2NMOA 3WD5A 1ZBA3 5C4WC 5K0UA 4PLMA 4XW3A 4A7KA 3C2UA 2OPKA 1J3QA 4E4DX 4QPGA 1G9FA 4M01A 1C8M1 2VNGA 4FPEA 4S2GA 4EN9B 2WINB 1FPN1 3MZHA 2IFRA 5IK5A 2HWE3 2YDEA 3AKSA 5K7PA 2QQPA 1WLCA 4N43B 1GSLA 1N1VA 1CAWB 3ZMNA 5JWPA 5JZGA 1OHFA 1NCQC 1HRV3 4N53C 4QPIA 3KZ4C 2D6OX 5SV5A 4DRRA 1VBC1 4PDWB 4LULA 1LODA 1HQNA 2Q5TA 1RB8G 1AR72 2CAVA 3FWEA 3WQ0A 3MF6A 3ZX7A 1OMIA 1QOTA 2WS93 5CFDA 4ES8A 3AP9A 2RS11 2YPJA 4JDMA 4GWMA 2A6ZA 1G9CA 2DFCA 1AR61 4LHKA 2ZGPA 1W6OA 2DU1A 1BCXA 1PZ8A 3ZFEA 5JAXA 1FV3A 2XJVA 2WNUC 2XB6C 3HD8B 4AEDB 1ENQA 5C9AC 3WHUA 3RG0A 4AVCA 1XU2A 4XJZA 5BY5A 3ROUA 2RMU2 4JRAA 5DDJ2 3AJYA 1LOAA 2A6WA 3FLTA 5C6CA 2VY0A 3ZXLA 5FPXA 1ZZ7A 3JQXA 4A7ZA 4U2AA 3OCPA 1RUH2 4JGYC 5JOXA 5A32A 3FLRA 2G4IA 2GMMA 4RD7A 2D6PA 1S0BA 4DXZA 1AL22 4AE2A 1RUI1 4WM8C 1W6OB 4RSUA 5HBAA 2XJPA 3I8TA 3VHOA 5T54A 4RGGA 2QVSB 1SLLA 1PM7A 2HYKA 2XLGA 2XLFA 5EZWA 1KFUL 4FT8A 3M8LA 3ZIWA 5FBZA 4KWKA 3GZUC 2FQPA 4BPZA 4DY5A 2WNEA 5JVVA 5GZDA 4OLLA 3THTA 2D6MA 4P9JA 1ZZ9A 2KA3A 4SLIA 2ZOEB 1YXWA 1ULGA 3L2HA 1H1AA 2CWSA 1RUJ3 5HCAA 4OI0A 4LA3A 1LU2A 1NCRB 1AR73 2I45A 1R091 4UW5A 4XEZA 5IK7A 4BWOA 2UU8A 1LRHA 3MYXA 4FPCA 4YM0A 1X36A 4JV4A 1GLHA 2GNBA 3V0AA 2PYTA 1D0GA 3SITA 4COZA 3MF9A 3GZTB 4AYUA 3O7OA 4JC1A 2BFUL 1QQP2 3AB0A 3M3QA 2Q4SA 3I2DA 2WNUA 1PZ7A 1E57A 5DXDA 4LO5B 2WT2A 5C9AA 1NE6A 5EFUA 5KWRA 5ABJA 1RUH3 4YG0A 4CEWC 4IESA 2VOKA 1C8M2 2HWB1 2ZGKA 1HV0A 2HEVF 1AL23 1LOEA 2WQ4A 3VUOA 4YVWC 1IKPA 1DDLA 2AGSA 4N90A 4YGBA 4C1WA 3WCSA 2ZA9A 4MGZE 4JGYA 3JCIA 2XKPA 4PBOA 1U5YA 3SH3A 1SCRA 4WM8A 1XXNA 1QDOA 2R0FA 4DFSA 4XIOA 3IMNA 5AVAA 1CAXB 1XYOA 1FOD2 5CG9A 3AYCA 4AI8A 4C90A 5DZFA 3ZSKA 1JUIA 1ND2C 4BZ4A 1TQ5A 2D6KA 1VAMA 5BYNA 1NXMA 1YI7A 4F7ZA 2TEPA 5JOZA 3OPZA 4H3WA 3T1LA 4CDUB 1V6MA 2Q0AA 3IDBB 4Z82A 3H3UA 3OY8A 1OQEA 2ZMLA 4XFBA 1K5MA 4Q4Y3 2HWC3 2AR6A 1MS8A 1JUHA 5FQ0A 3MW4A 4P14A 4KG8A 1W6PB 1MEC1 2IXJA 1RUG2 3OD4A 3EXUA 2WA4A 4GMP0 4XFFA 4IEQA 4AQ6A 1MQTC 3URFA 3W58A 4YZ2A 1ALYA 1QQP3 5T3NA 5JSOA 2C0ZA 1C8NA 3GF6A 4Y24A 1JXNA 4Q27A 1I1EA 3ZFFC 3OYWA 1VLNA 1O3QA 5BUVA 3GALA 1AX0A 1C8M3 5KHKA 2DCZA 3SLIA 1ULCA 2UYBA 3ASIA 1FPN3 1K5MB 2E7QA 4YFWA 5BPXA 1U5IA 2YHJA 1UU4A 4Z07A 3WG1A 5FTTC 1Y43B 4YVSC 3RSJA 3M3CA 1PGL1 3ME2A 2RS51 4CEWA 2XJRA 1LHNA 1WLTA 3ZN6B 2HEYF 2CY6A 3E6CC 2VW0A 2W39A 1BBT2 4WVWA 2A3WA 4YVWA 4E2GA 2YY1A 5JSPA 1ND3C 2R061 3MEPA 2R072 1XRUA 4K1YA 3BU7A 1VBC3 2G9FA 4LO4B 1LEDA 4IV1C 4R4XA 3VZOA 1FOD3 3BB6A 3JUUA 3AK0A 4LBQA 5LEKA 2XH6A 1YO8A 4OUSA 1CONA 1MACA 1OI6A 3B9CA 5J7MA 4A3XA 4UBHA 4AQSA 5T5LA 1CAUA 4BLIA 4QD2A 1QJU2 1UW8A 3MIEA 1PO12 4AHWA 5BNOC 1QU0A 2MEV2 2PN5A 4Y1XA 5JPNB 2OVUA 2EXHA 3M70A 1D0HA 4K20A 1UCXA 1RL3A 1S0IA 2X29A 1PGW1 2LUWA 1A8DA 4EN8B 5EJ3A 4IEWA 4AVVA 1UKRA 3FX3A 1N1TA 2FBEA 3N36A 5FLHA 2QKDA 1PO21 4PBPA 2ILMA 4CTEA 1EV11 3S7EA 3ZSLA 3RYPA 4GQ7A 1FXZA 1H4HA 1QJX2 2JG9B 4D7YA 1PVC1 1HLCA 4QXKA 2ATFA 2DTWA 4NHMA 1REFA 3USUA 2JG8C 1ZZBA 2ZHKA 2VNRA 3LA3A 3JD71 4Y22B 3WP5A 5AFEA 2JX9A 4B7KA 3NV3A 4JCKA 3OD0A 1RUI3 4XQDA 5J36A 1SFNA 1MQTA 4RQPC 4KU8A 1C5HA 5DG2A 4N9HA 2WNVC 4Q4W2 5FMOL 2FHRA 3FFZA 1QNWA 3RRDA 4XHBA 3CU7A 1WLWA 4IEZA 3AMQA 3WY6A 5EV7A 3WHTA 1AHSA 1TE1B 4YW4A 3CJIB 3KCYA 1BBT3 1WMDA 1TEIA 4HN0A 3CEWA 3UKNA 3VBSC 4E2QA 4A2UA 1BEV1 1WW7A 4EJRA 1SBDA 1RUC2 5FREA 2PFWA 2R073 4YVSA 4CDXB 4ZKTB 3JBG1 4Q4X2 1KS4A 3BALA