3UJQA

Galactose-specific lectin from dolichos lablab in complex with galactose
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
253
structure length
253
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKEDEENKLAIFNLEGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 41
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ujqA00
1IKQA 1AZDA 3T1LA 5GLWA 3AZXA 2D3SA 4L8QA 1LHOA 4YW2A 1GYKA 1VALA 3GALA 4YLZA 2D7FA 4GALA 3BOPA 3WUCA 2DTWA 3RMXA 2D6MA 2P3IA 3AZVA 4FOVA 1ULCA 4LBNA 2NMOA 1ZM1A 4YG6A 2A3WA 2EXJA 4D69A 2JE7A 4Y22B 1FNYA 3M3CA 5DZEA 2OW4A 2ZHLA 5SV8A 4FPYA 2WSVA 4JRAA 5HCAA 1G7YA 4P9XA 3VKLA 3FUQA 1FV3A 1Q8SA 4Y22A 2P34A 1TEIA 2DUPA 1LHUA 1QU0A 2V5YA 1UN1A 1KDMA 4YW3A 3AZWA 1MS9A 1F5FA 3ILNA 5E89A 4AVVA 4K1YA 3HMYA 1JW6A 2TEPA 2EXKA 3APBA 1QF3A 4RL7A 1BQPA 1SLBA 1ENRA 3UJOA 2JDZA 2WKKA 1VAVA 1UMZA 2UWCA 3ILFA 3AZZA 1W6PB 2ZHNA 3MW2A 1ENQA 4PBOA 3O5SA 2WJSA 2ZMKA 5JVVA 1BXHA 4F83A 4FPEA 3CNAA 1KITA 1Q8VA 4ISRA 1HDKA 2GN3A 2UWAA 2ZHMA 1UKGA 4LBLA 1RINA 1UZYA 1D2SA 2SBAA 4GXLA 1SCSA 1W6PA 2VW1A 3POSA 3ZSLA 3OJBA 1LOFC 1MZ6A 4JCKA 1IS3A 2AR6A 2WNEA 4XXPA 1SACA 2DV9A 2D3PA 3T2TA 3FLPA 2D43A 3D4KA 2PHFA 4SLIA 3WHUA 1GBGA 3ZXJA 5JMCA 3SH4A 1DBNA 1ZA4A 3AJZA 5HCFA 2ERFA 4LBKA 2EIGA 4DS0A 2YMZA 2ZGNA 1BZWA 3C2UA 1DLLA 3M2MA 5H9PA 1ENSA 2W68A 5LK5A 5IK5A 1YIFA 1QMJA 3KM5A 5IK7A 1WW7A 1V00A 2ARXA 3H0OA 5FRAA 5GZGA 2W52A 4BLJA 1A3KA 1QKQA 2DVBA 2JECA 2YY1A 1YYNA 2W08A 4JC1A 1LULA 3RG0A 3RSJA 2NP0A 2VW2A 4LBQD 4YGBA 3ATGA 4FQZA 4YW4A 2P2KA 4XJWA 1CVNA 1FYUA 4XDQA 4BM8A 1MVEA 2WT2A 1MS0A 1S0CA 2WLQA 1WW4A 2P3KA 3M3EA 1LOAA 5DG2A 1DQ1A 3WG1A 4AGRA 1AX2A 1S0FA 3BTAA 2EXIA 4WZFA 1LENA 2AH2A 2KM2A 1N1TA 1F31A 3DGTA 3ASIA 1SFYA 5T54A 1G9BA 3WCSA 2CL2A 5DG1A 1LOEA 1IKPA 2NM1A 1WLDA 4Y26A 3ZXFA 1FAYA 3VUOA 2ZGMA 5GZFA 2H0BA 1C4RA 5EYYA 3LSDA 3OYWB 3OBRA 2PHUA 3ZXKA 3AYDA 2ZACA 2WSUA 3AP4A 2R1DA 3PVOA 2YV8A 3V65A 1O4YA 3HN1A 4M3CF 4YZ1A 1LOCA 5EYXA 1ONAA 3USUB 4FOWA 3B9CA 1HKDA 1DQ6A 1WW6A 4YW1A 3OYWA 4XIKA 4DQAA 4DPNA 4C1WA 1VLNA 2WT1A 3FFZA 1QDCA 1WBFA 1KJRA 3AJYA 1JXNA 3O0WA 4M3CB 1QNWA 1AXKA 5GLUA 2GN7A 4TZDA 1GZCA 4XOGA 3USUA 3AZYA 2R1BA 4Y1YA 3FLTA 5L73A 1N1YA 1OQ1A 1GLHA 4YG0A 3RMYA 2DVGA 1GZ9A 2GNTA 4M3CA 1WLWA 4AVSA 5BYNA 5KXCA 1N1SA 5JOWA 1Q8OA 2RHPA 1LGNA 1DZQA 1KRIA 4FPKA 3B01A 4R9AA 3O0VA 3V0BB 4NO4A 2UWBA 2JKBA 4Q2FA 1LESA 1C1LA 1VAMA 3B3QE 3OY8B 1IS4A 1Z78A 4K1ZA 1I3HA 4OZXA 3MEPA 4UW6A 5JOZA 3OPZA 4FPJA 2A75A 1V6MA 1N3PA 2A3YA 2FHRA 1QOSA 4LBMA 3V0BA 1WD4A 1Y7BA 1AX0A 5GM0A 3OY8A 3WDWA 1G9DA 1N1VA 1FV2A 3POYA 4FPOB 5GALA 4GA9A 4HL0A 4R9CA 5CBLA 3SNMA 2R16A 3SISA 1CQ9A 3LCPA 1JUIA 1DFQA 1DQ5A 4YZ3A 5DUWA 1JOJA 1QGLA 4Y24A 5DUUA 1DQ2A 2GMPA 1AXYA 3FUOA 4XILA 5FREA 3MW4A 1N3OA 1I1EA 4WVWA 4C1XA 1OKQA 4XBLA 3N7LA 4UW5A 1S0IA 2PHXA 3ZPYA 4YFZA 4XJ8A 3LSEA 4YM0A 1LOBA 2Q5TA 2ZMNA 4XBQA 4LBQB 3POWA 2JD4A 2JE9A 1IOAA 4K20A 4DFSA 2CWMA 4AVTA 3WG3A 5DXDA 2P3JA 3U4XA 2CWSA 2ZABA 4XZPA 1CESA 3L2YA 1APNA 2AENA 5T52A 2A6YA 5JOYA 3WDYA 2YXSA 2DYCA 3VKNA 4XTMA 1LTEA 4YM2A 2AYHA 3D6EA 4Q8LA 2ARBA 1LU1A 4XJZA 3WDUA 5F9TA 3IN9A 1JN2P 1S1AA 2OUHA 2ZGSA 1V6NA 3OGGA 4YGCA 5T50A 3TAYA 2C9AA 2E7TA 4ATFA 3IM0A 1QDOA 5DZFA 2PELA 4YW5A 4AGVA 2XB6C 2HYKA 1LOFA 1CN1A 4GKYA 1QNYA 5KXEA 3WDVA 3AYEA 2ZKNA 1YXWA 3FBYA 2PHRA 2ZBJA 4PQ9A 3AXDA 3DUIA 4XBNA 3WV6A 1DYPA 1GANA 2CNAA 2D6NA 1X50A 1MVQA 2UU8A 4Q26A 2WQZC 4XJAA 2PHWA 2W39A 3KQRA 4UW3A 1OFSA 1IS6A 3ENRA 4Y1XA 2SLIA 3V0AB 2OUJA 5GLTA 5T5OA 3AYAA 4GWMA 3O0XA 5CB7A 5T5JA 3VKOA 5GLZA 3ZVXA 4CRQA 2DUQA 2ENRA 3ZSJA 4DRVA 1VIWB 1C1FA 4Q27A 2AUYA 1LU2A 4Q1RA 4XMAA 2GNDA 4AYUA 2A5ZA 3MW3A 3V0AA 3AP9A 1V6LA 1GSLA 1LGBA 2Z42A 3NWKA 4YZ4A 1W6NB 4FPCA 3AFKA 2ZGRA 1FX5A 1MS3A 1PZ7A 2R0FA 3NV1A 1N3QA 3I4IA 3WDTA 2ES3A 3WHTA 4FOQA 4NOTA 2VUAA 2CY6A 4XJUA 4YG3A 4YZ5A 5DUXA 1AJKA 1B09A 2CYFA 2EF6A 4FQ4A 3IMNA 1W6NA 3T1MA 1LEDA 2FMDA 4H55A 1N47A 4P9WA 4PF5A 2JJ6A 4XJ9A 1PZ9A 4WVVA 1G9CA 1S0JA 2EXHA 3UK9A 3ZYPA 1W0PA 1WLCA 4WV8A 1G9AA 1SBDA 2DVDA 2ZA9A 3Q9OA 3WUDA 1PZ8A 1ULFA 2YZ4A 4BMBA 4XTPA 4YM3A 3OBTA 3WNXA 4BLIA 1MR5A 4CZSA 1GV9A 3R05A 4M00A 2VXRA 4YM1A 2DWRA 2DU0A 3MPPG 3M3OA 1NLSA 4Y1UA 2NYYA 2E51A 5IUQA 1GNHA 1GICA 4PCRA 1S0DA 4Y20B 5JOXA 2E7QA 4GKXA 4HANA 4Q1PA 1BYHA 4FOYA 1RITA 5GLVA 3PVNA 1ULEA 1DGLA 1AF9A 4GWNA 3AX4A 1KJLA 3R4UA 1H9WA 2D3RA 1WCSA 1UX6A 3D5OA 1ULDA 4Y20A 4ZKTB 1FNZA 1Q8QA 4AGGA 2P37A 3A0NA 2A7AA 2GMEA 2ZGPA 4FP3A 1JHNA 4P9YA 2DVFA 3WOGA 1XQNA 1JYCA 2ZGQA 2B7YA 4TYSA 4FVVA 4ATEA 2VU9A 1DQ0A 1DHKB 1QOTA 4R9DA 3M3QA 4YGDA 5IK4A 5H9SA 1Q56A 4FPHA 3NV4A 3PVEA 1H9PA 4XMIA 4ZXKA 3SH3A 3ZSKA 1W6MB 5GJ6A 2ZMLA 5IT6A 1YI7A 1CPMA 1O4ZA 3O12A 4XXAA 5CAZA 3V64A 2NMNA 1QOOA 2E53A 5GZCA 1FATA 1SBEA 4XHXA 1G86A 3AYCA 4U2AA 5GZDA 1G9FA 1UAIA 1GNZA 1UPSA 2A3XA 2AREA 2DURA 1W6MA 1JBCA 4Y1ZA 3N3HA 1WBLA 2DU1A 1SLIA 5T55A 3SITA 1CJPA 2ZZJA 5CA6A 5EXOA 4DRRA 4AWDA 3W58A 2DTYA 1HQLA 1LCLA 1KQRA 3BIWE 3WG4A 3PMEA 1W6OB 2A70A 1A8DA 2LALA 3A4UA 1LOGA 1BJQA 1GZWB 1AVBA 4M3CE 1CIWA 4PBPA 3BODA 2ZGKA 5DUVA 5DZGA 1LHNA 3RRDA 2A71A 4ISQA 1DIWA 3VKMA 3UJQA 4ITCA 2AGSA 4R9BA 2GDFA 3WDXA 1V6KA 3ZXEA 2DUOA 2NZ9A 3IPVB 1C57A 1S0BA 4LBQA 1W6OA 5GZEA 1SCRA 2GMMA 3GNEA 1GZWA 5T5LA 1D0HA 2NN8A 3N7KA 3VKFC 4YZ2A 1NXD1 1LGCA 2ZAAA 1MS1A 2LTNA 5E8AA 1J1TA 3RS6A 1LHWA 3HR9A 4FPFA 3UL2A 4YFWA 1U0AA 3SH5A 1V6IA 1DQ4A 3IPVA 4XHBA 2EALA 2GALA 3AP6A 3AP7A 1SLLA 3N7MA 3R4SA 2C5DA 3WZ1A 2I2SA 1V6JA 4U36A 3RQ0A 3IKWA 4I30A 2DVAA 4LBOA 1GKBA 2YROA 2R49A 3JUUA 1MZ5A 2D6LX 2VW0A 1MACA 1WD3A 3ZSMA 1RIRA 4BOWA 4Q8KA 3FLRA 5EWSA 1LODA 3ZYRA 1W6QB 4XE9A 2D44A 4YGEA 5F5QA 1ULGA 3B00A 3W59A 1BKZA 1UL9A 1F9KA 1WW5A 3AXEA 3PJQA 2R0HA 4ASMB 3AP5A 4KBBA 2ZGLA 4FPGA 4Y1VA 3SLIA 1URXA 1IS5A 1G8WA 1W6QA 1YRZA 5T5PA 3A0KA 4K21A 4BQ1A 5AVAA 3AK0A 4BMEA 4XIOA 5HCBA 5KXBA 2BQPA 2A6WA 2ZGTA 2ZHKA 3NV3A 1KDKA 4RA0A 2D6KA 1HQWA 1A78A 5CNAA 2G4IA 2EAKA 3QLQA 1S0EA 1Z0HA 4FP2A 4IQPA 3JU9A 4Z8BA 2V73A 2A6VA 1LEMA 1V6OA 3N7JA 1CONA 3ILRA 4FPLA 1AX1A 3INAA 1MS8A 1SLCA 1EPWA 3WG2A 1AJOA 2E6VA 3TB0A 2D6OX 2ZGUA 1DYKA 4MYEA 1YO8A 1Q8PA 3WLUA 4BPZA 3M1HA 1SBFA 4P14A 1AXZA 5JDBA 2A6ZA 3QCWA 5H9QA 2GNMA 2XG3A 3N35A 3WCRA 2VY0A 3I8TA 4W65A 4LBJA 3N36A 5KXDA 2CTVA 4XYXA 1HLCA 1MS4A 1LECA 1SLTA 3B69A 5E88A 4M01A 1CPNA 2WT0A 1H30A 2ZGOA 3WVJA 4UW4A 1LHVA 3ZXLA 1MS5A 3VV1A 5JLVA 1LJ7A 2VH9A 1SLAA 1UZZA 5H9RA 2OVUA 3NV2A 2GNBA 5IK8A 1S0GA 1JYIA 2PHTA 1W0OA 1R1ZA 1CR7A 2D6PA 2UURA 1WUVA 2A6XA 4CTEA
chains in the Genus database with same CATH superfamily
1RHI3 1IKQA 1PMIA 5FYVA 5F5CA 4YW2A 3RI8A 1IHMA 3BVCA 4DY3A 4JAAA 4YLZA 1UYZA 2XH6A 3OEBA 4QPWA 2YDEA 3MIEA 4JV4A 5LASA 3A21A 2D7FA 4OYUA 3S0MA 4KU7A 2DTWA 2CDOA 4YW7A 1UQXA 3T4HB 4LBNA 4DXRA 4IEPA 4MH0E 4Y22B 2VR4A 2YFUA 2WLPA 4DXSA 5SV8A 3IBMA 4LOTA 2X29A 3SKVA 2WSVA 4JRAA 1D7PM 5LZ6A 1G7YA 3FHIB 4P9XA 3VKLA 2XL9A 1FV3A 4UXAA 3FBMA 1UNBA 2J1RA 4GJYA 2G19A 3ZYBA 1B35B 2XQXA 3UKTA 4S2FA 4S2GA 1H4GA 1UZ0A 5FJHA 3VZLA 1QU0A 1KDMA 3DPRB 5FYHA 4C91A 2BNMA 4IETA 1F5FA 1R092 3VHOA 4N53C 1JW6A 1K5MC 1YUDA 2EXKA 1HJGA 4RL7A 1BQPA 1SLBA 3UJOA 4EN0A 2ZX2A 5I91A 5LEKA 4DO0A 1VAVA 3SQOA 1BBT2 3NJYA 2KD7A 3T09A 4PBOA 2TUNA 3VDDC 3SCGA 5FYYA 2WJSA 5JVVA 2HWD3 4FPEA 3ZYIB 1KITA 1FPN3 4LBLA 4BU2A 1UZYA 1XE7A 3TOJA 4LO5B 5D2AA 4JGYC 5F5AA 3S30A 1LOFC 2Y0IA 4GMP3 2BNOA 1QJEA 1CAWA 4JHZA 4ZHNA 5FZCA 2AR6A 2WNEA 4KU8A 1IPSA 4XXPA 5L7OC 3I2KA 3B9IA 4N7IA 2DV9A 2JG9C 2W0XA 5C9AB 3D4KA 1DGRA 3WHUA 2VAUA 2RVAA 5JMCA 2ZPXA 3SH4A 2XBO2 3TEXA 1VMHA 2F17A 1UXZA 1OPOA 4O9EA 4PDWB 4EYUA 1BBT1 3AKSA 2VMEA 2PHLA 2YMZA 5CZKA 3AMPA 1I9RA 1W04A 4ZS2A 3RZMA 3M2MA 1ENSA 5FY1A 2P17A 5IK5A 2XVGA 3MGUA 4RD7A 5LA1A 4J6GA 4LLOA 4BLJA 2JEMA 1A3KA 1QKQA 2DVBA 2JECA 2VZTA 1YYNA 2FMYA 2RDNA 2RM21 3GGLA 3MLLA 4DEQA 4TXWA 3H9AA 3D3AA 1HRI1 2R30A 2D5FA 1NQDA 4MXWB 4QHOA 1MVEA 4IDZA 4K40A 2Y6KA 4A41A 1W9FA 5LB6A 5LA0A 1SG3A 3R0RA 2P3KA 3M3EA 1LOAA 3VBFA 2Q8CA 1DQ1A 3WG1A 4TN7A 4RN5A 3MFAA 4A4AA 1AX2A 4CPBD 1BK1A 3BTAA 2VNRA 2IXJA 1F31A 1DZRA 3ASIA 4XAEA 5FZOB 1H4HA 5LWBA 1IKPA 1UYXA 4QB1A 1SFPA 3VUOA 4AI3A 1C4RA 4P9LA 2ADDA 3LSDA 5FYBA 1M4WA 3OBRA 2PHUA 4MOAA 4CSWA 5C3PA 3AYDA 2WSUA 5F3IA 4AQ2A 3G6JB 1PGL2 2R1DA 3FL7A 2YV8A 5EJ1B 4GWJA 4LHLA 5B4XA 2JDMA 1ODNA 1W9WA 3UT0A 5FY5A 2PLV1 4AG4A 1LOCA 1V0AA 1ONAA 4QPIA 4WM8C 5DAVA 2ATFA 1HKDA 4P9JA 2YBSA 1MEC2 3OYWA 4DQAA 4C1WA 1PGW2 1QDCA 1WBFA 1JXNA 3I2DA 3KV4A 4H7MA 3LEMA 4K8RB 1ST8A 5GLUA 3OPTA 1NA1C 1VB4A 3C3VA 5FZIA 4MG2A 4YVSB 4ARYA 2W2IA 5L73A 4X6QB 1N1YA 4AFBA 3LKJA 4WM7B 2DVGA 5A7SA 5FY8A 3ZMOA 2KR2A 4AVSA 5LCWL 5JXJA 5GKAC 1BBT3 4XPVA 5JOWA 1XNKA 4JRLA 4UF0B 2QTWB 3B01A 1PX4A 3O0VA 3VZOA 5FYIA 1OQEA 1O59A 4LO7A 1ZA7A 1JOPA 1VAMA 4FTSA 4XQDA 1Z78A 2RM23 4ZY9A 1MEC1 4KI5M 3BCWA 5FPXA 5JOZA 1IPKA 1HRI3 1ASJ2 3U07A 3JD71 2WQ8A 3V0BA 5FMCA 1FOD2 1WD4A 1ZZ6A 1Y7BA 1AX0A 2QNKA 5A80A 1W9SA 4UT5A 5ACA1 1OQDA 1FV2A 1COV1 4R9CA 1EY2A 4KGGA 5BXXA 3JQXA 1F4AA 4GULA 1XU2A 4Y5Z0 2QQNA 3LCPA 5DUWA 4CA9A 1QGLA 4C0BA 2GMPA 5FREA 2JIJA 5ISLA 2ILMA 3A7QA 1AR71 4KL1A 1OKQA 3PHMA 4N53B 2YGMA 3IIIA 1K5MB 1RUE2 3EJKA 1F8VA 4YFZA 1W8TA 3VHPA 2E26A 1SFNA 3LSEA 1QWRA 2XXZA 2ZMNA 1PIV1 1OC1A 2VL4A 1JTZX 3POWA 2G9GA 2XUMA 3VDDB 2PLV3 1KEXA 1JS9A 4O7XA 4DFSA 2CWMA 2IXCA 4AI8A 4PT6A 2BWAA 2VTXJ 4OHVA 2ZABA 5FO9B 1C8NA 2AENA 5F6LB 2A6YA 1VBB2 2DYCA 4YM2A 2WAAA 4HOOA 3B5LB 1ZRCA 4XJZA 5F9TA 3VHRA 1S1AA 1V6NA 5T50A 1HB1A 4Q4X2 5L7OB 2QKDA 2JG9B 2ZEWA 3KHBA 1VJ2A 1QDOA 2D93A 4YW5A 2VUCA 4D7YA 3ZYHA 3M3IA 2WA3A 2UY8A 1SMVA 1VPHA 2HYKA 2VC9A 3VBOC 1KS5A 3C8XA 1JYTA 1S2BA 3WDVA 3AYEA 4FAGA 5I0RA 4O61A 3AMHA 5FIXA 4KWKA 2ZBJA 3WF4A 2WWSA 1J84A 3BKZA 1DYPA 1GANA 2CNAA 1MEC3 4KWJA 4Q26A 1DG6A 1AHSA 4LJHA 5JI7A 2IC1A 1YQ2A 5A6YA 1VBE2 3KQRA 4XUTA 2XPJA 1OFSA 2PAKA 3JD73 4A6OA 2Y33A 2BP6A 5T5OA 3RZZA 1RVF2 1UYYA 1XRUA 4COUA 4GWMA 4M0HA 5FK7A 1XNDA 5GLZA 2A1XA 2DUQA 3AKPA 3IB3A 5ACA3 2BGOA 1COV3 1POQA 1LU2A 4W6YA 2DF7A 2QQOA 4XMAA 3CMGA 4P00B 3T2QA 3P3NA 3BPSA 4AYUA 3AP9A 4MXWA 2FZ2A 4Z2AA 1AYM2 2Z42A 5ANQA 3WW3A 3KB5A 5FPZA 4FPCA 3AFKA 4AI9A 4E2SA 3U10A 4XDOA 1PZ7A 4UAPA 4ZONA 5FZ8A 1AR73 3I4IA 1UY4A 3WDTA 4BQ2A 4RFT0 4XF1A 4FXKB 1QQP1 5BNQA 4XJUA 4YG3A 5J96B 1W6NA 2PHDA 5A7OA 4CDWC 1LEDA 1PIV3 4URTA 4OHWA 5F3CA 4BK4A 5JSPA 2WO3A 3OTFA 1OD5A 4WVVA 5KHIA 1J3PA 3ZYPA 1X8MA 2J22A 2XWBB 4WM8B 1PZ8A 2BWCA 1GFF2 4BMBA 4XTPA 5TSWA 3D0JA 1D2QA 3OBTA 3WNXA 1AYM1 5FY9A 4YM1A 1NA1B 3MPPG 2DU0A 1V9U2 2B9UA 4RS5C 3ZFGC 2E51A 5IUQA 3BUCA 4PCRA 5FP7A 2BERA 2H6BA 4Y20B 5JOXA 2ORZA 2Y38A 2GC0A 1BYHA 5FZ4A 1ZBE1 4FOYA 1RITA 1ULPA 2R072 4YVSA 2FCUA 4QGMA 4AQTA 1NX9A 1S2KA 3BOWA 5IW0A 3T0BA 2VPVA 3BN6A 1UY1A 4CE8A 1EV11 4ZKTB 2D3RA 1UX6A 2WABA 1ULDA 2W95A 2BU9A 3LIHA 3U75A 1UOFA 4JDOA 4MGTA 2A7AA 3IDBB 3O1MA 2GMEA 5FPVA 2RMU1 4FP3A 1JHNA 2DVFA 4BJ0A 1UCXA 2ZGQA 4TYSA 3MIHA 4BQ4A 4DZGA 4P9GA 3LQCA 5IK4A 3WD5A 4OI4A 3T2OA 1OLME 5IVVA 1KFUL 3O1PA 3OGJA 3LFIA 2B39A 3HEIA 5BPXA 4XCAA 2J1SA 3HNMA 4I0AA 4BDVB 1CPMA 1U5XA 2P6HA 1UD1A 4XXAA 5L9BA 4DB5A 1QOOA 2V72A 1FATA 1SBEA 2R071 4Y4RA 3AVSA 2W94A 1QQP3 4ARXA 1UAIA 4PIZA 5DDJ1 2PAEA 1JBCA 5I8YA 3LA2A 5C8WA 1S55A 5T55A 3PLQA 4DEVA 2ZZJA 3SXWA 4BH9A 2XJSA 5BNNA 1LCLA 5FP4A 3ZFEA 5AFEA 4NE9A 1JZ8A 2A70A 1A8DA 1F5JA 4E8CA 1LOGA 4LO6B 1AVBA 4N53A 2C6SA 4NPRA 2XLFA 2VULA 2CGPA 5DUVA 4ORFA 5I93A 5FXXA 4NWWA 1Y4WA 5HI0A 5A7QA 4R9BA 4IEVA 4N9IA 4HFSA 1AYM3 3LFMA 4S2HA 5EJ3A 3FC0A 4HK8A 3ZXEA 4DUWA 1W6OA 4XEZA 1NCRA 1GZWA 1OOPB 1D0HA 3N7KA 3FFQA 3E6BA 4JVAA 5T3NA 5T5LA 2Q8EA 4CEWA 4YZ2A 3DECA 3MDPA 5IYYA 3AMQA 3THTA 1HIXA 3G7DA 5FLIA 1AYN1 1JOBA 4B4PA 2FDKA 4QKDA 2VM9A 4YFWA 1V6IA 1ZBE3 3I2GA 2EALA 2GALA 3JB4C 4LUKA 4QXHA 5A3NA 3URFA 3AP7A 1UY0A 2WN2A 1OA4A 4E4DX 1EPZA 2C5DA 1EV13 4CUGA 4HONA 2I2SA 2Y6HA 4FFHA 4PIXA 4U36A 3VHNA 1OT5A 2DVAA 4LBOA 3WW4A 2YBPA 1GKBA 2YROA 3F95A 3ZXDA 2WFPA 4BWOA 1PNFA 4GB31 2YYOA 2RMU3 4WBBA 3AL5A 2VW0A 4XQWA 1IG0A 4CCJA 1FI2A 3ZSMA 3ACIA 4CXYA 4BOWA 4IGQA 4Q8KA 1RUC1 3FLRA 4JTOA 1T6GC 5F6KA 3GBGA 4XF9A 1NZCA 3OG2A 1W6QB 1ZX5A 3HBZA 2XGXA 4YGEA 4IE7A 1ULGA 5D8AB 3B00A 3NAPA 4XF3A 4H3WA 2R0HA 3U1XA 2JDNA 3N9LA 1RXGA 5HXMA 4FPGA 5FQ0B 1GQPA 2R073 5K4LA 3SLIA 2OX0A 3T30A 4DXZA 3LF7A 3HN3A 3VBFC 1CX1A 3ZIWA 5DDJ3 4UFIA 5I8SA 3TN92 5AVAA 4XIOA 3ZDSA 3IZOA 2VMFA 4FSJA 3RI9A 4XAAA 2RS12 4OFGA 3M7AA 4XUOA 4CDWB 1WCDJ 1GNYA 4H14A 4CDQB 1SHWB 2AEZA 3MIGA 4AL9A 4M4RA 1S0EA 1Z0HA 5FZAA 1NY72 4IEZA 2A6VA 3KVAA 3O1VA 1CONA 3LGRA 5EV7A 5ABJA 1TNFA 2DBNA 3FE5A 3INAA 1NE4A 3EYPA 3QACA 4E4ZA 5J98B 3TB0A 2D6OX 1XSRA 2VZUA 2WYSA 3NNFA 1DYKA 4LEJA 4QPIC 2LS6A 1H1AA 2JDHA 3KF3A 4FFGA 5BNPB 3QH6A 1AYN3 1W8FA 2D5HA 2JDKA 2ZS6B 3M1HA 1LKNA 4RS5B 3TN91 2HYXA 3ZFGB 1AXZA 1AUYA 1OA2A 1O3TA 2BVVA 3QCWA 5H9QA 1UPIA 4GZ9A 2GNMA 2RS11 3RZKA 3N35A 4W6WA 2VY0A 4OUMA 4BQ5A 1W9YA 3HT1A 4CP2A 4O9GA 1ZZ9A 2CTVA 1ND3A 4XYXA 4J25A 4QKFA 5LBFA 1M06G 4NIGA 1OKOA 4NIHA 2WT0A 1H30A 3I2FA 2LW8A 5AVPA 4F8AA 3ME2A 1QJY2 1LHVA 4GB33 4AW7A 1XSQA 1W3VA 4LHSA 5EZWA 1SLAA 1W8WA 1C8M1 1RUC3 3ZXAC 1OA3A 2WAOA 4Q0VA 4AEJA 2GNBA 2IXIA 4QX1A 1S0GA 1JYIA 2VOVA 5FO8B 1CR7A 2HWB1 1YFXA 5IJRA 2H6CA 1YQ5A 1W0NA 3ZXGA 2RE9A 3T1LA 1XXNA 3KGLA 5GLWA 4D7TA 2VZ3A 2CGNA 4L8QA 1UMHA 5CG9A 2JB8A 4CCOA 1VALA 5DAWA 3LA3A 4JTNA 5FMOL 1J58A 1RUI2 3I3DA 4XUPA 4NRQA 3HQUA 1OPMA 4GALA 4INDA 1NKGA 2D97A 4NRPA 3RMXA 1NQJA 2PFWA 5K7PA 2D6MA 3FMGA 1POV1 3BB6A 4D69A 3M4FA 3RFRA 3Q8CA 4HKLA 3M3CA 2OW4A 3A23A 1XNAA 2B9VA 2ZHLA 4MX3A 4FPYA 4AAPA 3L2HA 4MO3M 1OF4A 1W03A 5HCAA 1POV0 5EJZB 3VDAA 3FUQA 4LIVA 1JH5A 3S7IA 3J8F2 2VCMA 2JENA 2WZR1 3KT1A 4XW3A 3N9QA 1LHUA 5E16A 3MF9A 1C3HA 3DYOA 3AZWA 1MS9A 3I3QA 2VNVA 3ILNA 2FDGA 1W2NA 3HMYA 1R082 1RUI1 2WUHA 5D21A 1QF3A 1WCUA 3TN93 1YQ8A 5FR3A 2WKKA 3LE0A 1UMZA 4PI2A 3ZOIA 2GH8A 4R4ZA 2R041 5G04L 2RS13 2OKXA 1ENQA 3O5SA 5EP9A 1OOPA 1CAWB 1O6UA 2UYAA 4OUSA 4ISRA 1D4VB 1Q8VA 1HDKA 2GN3A 2UWAA 3SHRA 3I3EA 4GXLA 1US2A 1W6PA 3POSA 2KXLA 2JG8A 3H1YA 3I49A 2P3YA 1XBFA 2HBTA 2PN5A 1RUD2 3NW4A 4LOSA 3BYWA 5CKMA 4YPJA 2N7GA 1IS3A 3ACHA 5D1IA 5J37A 1C8M3 3U37A 3EB7A 2HWC2 5F1RA 3ZX7A 3HOBA 2MEV1 2D3PA 4K6BA 2Q8DA 3HNBM 3B7MA 3PUQA 4SLIA 2HWB3 3POGA 1YLLA 3KF5A 4WVZA 4NIAA 5J1XA 5KR7A 3NL1A 4QHBA 3OB8A 4C90A 4LBKA 2EIGA 4DS0A 5FY7A 3K2OA 1BZWA 5AC92 4GH4A 4NAMA 4G4FA 4YYOA 2BJSA 1VRBA 3Q8BA 1JZ4A 3KM5A 3H0OA 1V00A 3H1MA 3WNKA 2W52A 1POV3 5D8AA 5CFDA 2W08A 3RG0A 3RSJA 2QZ3A 2VW2A 4LBQD 4YGBA 3ATGA 4FQZA 2YPDA 4COVA 1O8SA 2P2KA 3JXSA 5FQ0A 5JXIA 5FYUA 1FYUA 2WS92 2Y26A 4XDQA 4XF0A 4A7ZA 5FPUA 1E57A 1EUTA 1S0CA 3KV6A 1EUUA 3CZUA 4TTGA 3CL1A 4EWEA 1ND2B 1Q3EA 2WZR3 3B94A 3DCQA 2VO5A 3OCPA 3FN9A 2WNOA 1V70A 4WZFA 5BY5A 1DGRN 4YWAA 1AR81 2AH2A 3LDRA 1G9BA 4CDQA 2K0GA 2BFUL 4YRDA 1LOEA 1AR91 4Y26A 1FAYA 2Q30A 5GZFA 3MIDA 4QPIB 1P8JA 2H0BA 2R043 3OYWB 4ASKA 5C70A 3K4DA 3U11A 4W8JA 2WYFA 1IGOA 3S5AA 3AP4A 4IW3A 1TQ5A 4QB2A 1GWKA 3H8XA 2WS91 3HN1A 4CCMA 1HB4A 2ZX4A 3KCYA 4YZ1A 5BNPA 4BCUA 1K12A 3B9CA 3RZGA 1PM4A 4XIKA 1PX3A 1NAEA 2WQ4A 2WT1A 4OCTA 1KJRA 2CV6A 2YC0A 1CJDA 4XACA 2MEV3 4HK9A 3PIGA 3USUA 2WZPP 1NT0A 3AZYA 4CEYA 4TZDA 4Y1YA 3FLTA 2BV4A 5EFUA 4CUBA 2RDRA 2VOWA 4IEOA 4YARA 4HSLA 4RQPA 4YG0A 5LK7B 4M3CA 5IAXA 1WLWA 3LDKA 4QXKA 3ZKUA 5F39A 1BMV1 2VQUA 5C6CA 2K46A 1NYWA 1RJ7A 1KRIA 3RYRA 1LR5A 4RGGA 3V0BB 4NO4A 2UWBA 3JB8A 4Q2FA 2ORXA 1LESA 5FK8A 1RC6A 4K1ZA 4NRMA 1QXJA 3EQEA 3J26N 4OZXA 4UW6A 5BNOB 2JD9A 3OPZA 4FPJA 5FYMA 1UYPA 2CGOA 1FMD1 2RV9A 4BXFA 2CAUA 2A3YA 2FHRA 1QOSA 5A3OA 3GF6A 2W5FA 4ZU7A 3O1TA 1RUJ1 3D0SA 1OVPA 4LK6A 5IHRA 1QH7A 2GAUA 2EIBA 4LITA 4UFJA 3UKVA 5KWRA 2R16A 2ZCWA 5IVBA 1AR83 4EJRA 2Z69A 3NNGA 4YZ3A 2VZVA 1GQHA 5BNNC 3ZFEC 5DUUA 2VQ0A 1UMIA 3FUOA 4IE0A 4MVTA 3MW4A 3BTYA 1AR93 1N3OA 3WQ7A 5FZHA 3I2OA 4UW5A 5FDBA 4IUGA 2VNGA 2WO2A 2BOIA 3NSTA 4YM0A 1LOBA 3ETQA 2Q5TA 2WS93 1NCRC 3ON7A 2JD4A 4CEWC 5A6XA 3FJSA 3RDIA 3K75B 3SMHA 1XOYA 3POBA 4YVWA 1XPWA 5DXDA 5FOBB 3U4XA 5A3LA 2DDUA 1QJZA 3L2YA 1HB3A 4LQRA 1Q43A 1KGYA 5T52A 5JOYA 3WDYA 3KMHA 5C5TA 4AGGA 2VMIA 2VMCA 3D6EA 3H1WA 5FWEA 2JX9A 3IN9A 2BGCA 1XE0A 4QDRA 3TAYA 2OQ7A 1R091 2C9AA 1Y9MA 1JHJA 4N8MA 4HBNA 1WMFA 2HLEA 3ST7A 1QNYA 4ASLA 4DINB 2ZKNA 3POIA 5F2WA 5JUVA 2XJTA 4JZRA 3WV6A 2BZDA 3R6SA 2QBXA 3E6DA 4E4SA 4B3NA 2WQZC 3NAPC 2PHWA 4XJAA 2W39A 1FMD3 1UOGA 4D3WA 2D40A 3ENRA 1CAXA 1YFUA 2JE8A 2YFZA 3WNOA 2Z2SB 2OUJA 2W1SA 5GLTA 5CB7A 1RUJ3 2RS52 1NUKA 3WXPA 3BTZA 4UBHA 4OHXA 3ZVXA 2GP5A 3MIBA 2ENRA 4COYA 3ZSJA 3OGVA 4DRVA 1QXPA 4CCCA 2AUYA 3GXUA 4Q1RA 4E2QA 1PGSA 3VD5A 3AMNA 4MGQA 4ET7A 4JKMA 2XBO1 3V0AA 1CGPA 1V6LA 1GSLA 1LGBA 1VBD2 3NWKA 4KWUA 1W8NA 1W6NB 4LE4A 3IWZA 4GD4A 4XFGA 1L7LA 1ND2A 4COZA 2Y64A 5C71A 5FPBA 3HD8B 3GDBA 4PLNA 1VR3A 4RSUA 5DUXA 4YZ5A 1B09A 4FQ4A 3MIFA 4MGKE 3TWIA 5ABJC 5B4NA 2PTMA 2GH2A 4DOUA 4XFBA 4A45A 4OUEA 4P9WA 4EN9B 3WW2A 1AR62 1JYVA 1WKYA 3WNNA 2QQLA 4HSJA 1G9CA 3E6CC 4IEQA 1O3RA 1W0PA 3THDA 4WV8A 3PURA 2DVDA 5JIAA 2ZA9A 4G9SB 4D6SA 3Q9OA 1H8TA 1JZ5A 4Q4W2 2YZ4A 4RGAA 2WNVA 1W3XA 3I7DA 3CU7A 2BGPA 4DIQA 4EE2A 4CZSA 1GV9A 1Y3TA 4M00A 3UGHA 3VZKA 1NLQA 1OVSA 4AK3A 1ND3C 2DWRA 1R093 2FBEA 2ZZQA 1HJFA 4Y1UA 4E4HA 3PL0A 2J1AA 3VD9A 4HVRA 1GNHA 2G9ZA 3OPWA 1S0DA 4IESA 5A70A 4QPYA 1C28A 1CZVA 4GKXA 3EO6A 1LB2A 4Q1PA 2QJVA 3HWJA 3MV01 3WX5A 1ULEA 5F7UA 4AEKA 4RYDA 1PGL1 3C7GA 4GWNA 3AX4A 4QX5A 3HVDA 4A3XA 3J9SA 1GR3A 1H9WA 1PVC2 3C7HA 3U4SA 2P37A 3A0NA 1HV1A 1CIYA 3VB9A 1H2MA 1UOBA 2ZGPA 1PK6A 1PGW1 2QQVA 2EIEA 4LE3A 4P9YA 3POEA 3WOGA 3H42B 3O1OA 1JYCA 4MGYE 3UKNA 1YIPA 4ATEA 3CEWA 2PQSA 4R9DA 3O14A 3OOXA 4Y5SA 3VL9A 4EN6B 1Q56A 5BNOA 3ECQA 4FPHA 4IGPA 4MLOA 1TMF2 3ZSKA 3SH3A 2XBO3 3PU8A 5IT6A 1YI7A 5CAZA 3O12A 1YNAA 1YQCA 1OURA 3CKHA 5GZCA 4XHXA 3Q8EA 5BNNB 3ZFEB 2FCTA 4EN8B 1G86A 1G9FA 2P6CA 4NN0A 4Y1ZA 1X36A 2P1BA 3OF1A 1PVC1 4I0WB 5A33A 4BIOA 3SITA 3RWNA 3OBAA 1IPJA 3TYJA 1F35A 1KQRA 2VTXA 1ASJ1 3WG4A 2VCAA 3LPFA 4QKBA 1TZOA 1W6OB 1FOD1 1NCRB 1GZWB 4CEWB 3K3NA 1CIWA 1F2NA 2GC2A 3LB9A 4N9HA 3ZKYA 4AI1A 4NIIA 3BODA 1JUHA 3SEPA 2ETEA 2F6BA 4HETA 2A71A 4ISQA 2G1MA 4ZS3A 2ZAHA 5LA9A 1I5PA 2AGSA 4ITCA 3VKMA 3WDXA 1V6KA 5FZ9A 1OOPC 5GZEA 2GMMA 3CO2A 2HWF2 2QCSB 1WLTA 2NN8A 3T4VA 3WP4A 1LGCA 1DP0A 5FZ1A 2EICA 4BYYA 3J4UH 4M4PA 2W92A 1ZRIA 3KZ4C 4FPFA 3N9NA 2JG8C 3KLSA 4DY5A 5IFTA 4XHBA 1RUE1 2CHHA 2O8OA 4LORA 3AP6A 1OMIA 2VZPA 4IXLA 4CPBA 4D7SA 4YSFA 5IFPA 1UIKA 3P6BA 4MV2A 3N7MA 2VGDA 3S57A 3RJ2X 4LO4B 1V6JA 4AXOA 3RQ0A 3IKWA 4I30A 4IERA 5DABA 2BPA2 3NNMA 4Z1VA 4BIFA 4OQ9A 5FYCA 3BU7A 3VLBB 3KV5A 3W5MA 3NAPB 3D82A 4GH4C 2XJVA 5A1AA 2Q0AA 1W8HA 3GZEA 1VBB1 3PU3A 1DU3D 1H2NA 4NROA 3H3LA 5EWSA 2YC2A 1UU5A 1CAVB 2QQJA 5D8AC 5F5QA 5F5IA 2GU9A 4Q4X1 5CFDC 1D4M2 1BKZA 2I45A 4CCLA 3AXEA 4P5HA 5DPNA 5DQ0A 4Y1VA 4Y33A 2Z5WA 1WMXA 4QXCA 4QB6A 5IVEA 1YRZA 3MZHA 2JIGA 1MQTA 5A7PA 4BE3A 5C3SA 4BQXA 1PVC3 4K21A 4BQ1A 3AK0A 4BMEA 1UO9A 2ZHKA 2R7EB 3NV3A 4CU9A 5ABJB 1ASJ3 1KDKA 1VBE1 4CDQC 1FOD3 5CNAA 1RVF1 2VMDA 2IXKA 2NLRA 4CP1A 1HXS2 1UU6A 2PA7A 4ZZ8A 4NUBA 3JU9A 5JCTA 1JZ2A 1V6OA 2VZOA 2WZEA 4MADA 4FPLA 4OMCA 2E31A 1EPWA 3KSCA 1AJOA 2J1VA 4CU6A 2ARAA 1ZZBA 5BNPC 4LA3A 1ND3B 4CDUA 3WLUA 4BPZA 1SBFA 4SBVA 4P14A 2OA2A 5LEJA 1QJU2 1RUE3 4HKOA 3CLPA 5F2SA 5JXGA 1Y9QA 1VMFA 1OUXA 5F8PA 1J59A 2RJLA 4NJ4A 4W65A 4LBJA 4CEYC 3KGZA 3MF6A 1HLCA 1MS4A 4M01A 4RQPC 3BALA 3MUZ1 3RWKX 4NWVA 4UW4A 2Y6FA 3AKRA 3CZJA 3ZXLA 4J1XA 4LXLA 3VBSB 4B29A 2EA7A 4XABA 3WINE 5JLVA 1RUOA 1LJ7A 3ACLA 1VBB3 1UZZA 2R32A 3JBG2 4QD2A 3GHMA 3NV2A 3P1IA 5EHDA 1ENXA 2XHNA 4GQ7A 4Q0SA 1W0OA 4Q4X3 2UURA 1V9U1 1RUF2 2O0OA 3CJIA 2IXHA 3GHNA 1W8ZA 1YC61 3AZXA 5J3UA 5KBFA 3X29B 1H2LA 2BVBA 1R1A2 1I6XA 1TME2 4W4ZA 3UYJA 3BOPA 5FZ7A 1VMJA 1W8OA 1ZVFA 2P3IA 4FOVA 4XUQA 1ZM1A 3PTYA 2JE7A 1FNYA 3K4ZA 2R062 1VBE3 3LIGA 4KH9A 5L19A 3GCWA 3LAGA 2QQIA 1JU3A 2ZTNA 3JBG1 1RVF3 1S4CA 1UOJA 3M70A 5FLJA 3POJA 2ZX3A 1D0GA 1HQNA 1L7RA 5F3GA 2X05A 4E8DA 3T3YA 3VZNA 1TEIA 2DUPA 1K42A 3ZLIA 1UN1A 4YW3A 1VB2A 4XETA 1R1A1 4AVVA 2QQMA 3KS7A 1VBA2 2RS32 2TEPA 3E5QA 3NKGA 4I09A 3T2PA 3ZN4A 2HWE2 4Q29A 4YVWC 5J36A 2WO7A 1S2EA 2C26A 2JDZA 2VUDA 2VTFA 4LKDA 4PLOA 4DXTA 3KHCA 1NXMA 1X9PA 4K8FA 3AZZA 1W6PB 5JZGC 1RTVA 3DN7A 2JG8B 3RJRA 1RMU2 2ZMKA 4F83A 2XLGA 1K5JA 5FXVA 3SCFA 3PTRB 5I0UA 3RYPA 2OQ6A 1RINA 3WEZA 2F4PA 1SCSA 2IVJA 2VW1A 4L0PA 4QM8A 3ZSLA 4AHYA 5A3MA 3OJBA 2VD7A 3PUIA 4KNCA 3I2IA 3IMMA 3ELNA 4JCKA 5EIYB 1SACA 3FHQA 1GZTA 1ODMA 2WBKA 4GH4B 1CWPA 2W47A 2D43A 3I3BA 3RVHA 1VBA1 2RS31 3LDBA 1V9U3 1GBGA 3NNJA 4NMIA 3ZXJA 4FTEA 1ZA4A 2QVSB 3DKQA 3NMBA 4D8MA 4LO8A 2ERFA 5CFDB 1JZ3A 5IAVA 3RZJA 2A73B 2ZGNA 1DLLA 2V4AA 5H9PA 1U12A 5A7WB 5LK5A 2XHKA 3MICA 4Y5TA 3S5QA 3WF0A 4QHZA 1QMJA 1J1LA 1WW7A 2XJUA 2ARXA 4N7UA 1CAVA 2JB4A 2YY1A 4CP0A 5JPNB 1RXFA 3FWEA 4Q4V2 4FO9A 2IFRA 5FZMA 5L36A 2FD8A 3EBRA 1CVNA 5FKBA 2DCYA 3CJXA 2WT2A 3JBG3 3VL8A 5C8CA 1MS0A 2WLQA 3ZYGA 1ND2C 5AFBA 1JU4A 3H3ZA 1J83A 1C5HA 4EWAA 1ZZCA 1ZNPA 2YGLA 3AC0A 4I01A 1S0FA 4GIQA 5C4WA 2EAAA 3HPNA 2KM2A 1R1A3 3DGTA 3SKJE 3WCSA 4QQLA 4F7ZA 4ZZ5A 4MGIE 4GJZA 1VP6A 5DG1A 1K3IA 3ZXFA 2GSYA 1X82A 1H8TC 1XNCA 2VJXA 4MZUA 2WNVC 1ACCA 4Q4V1 3ZXKA 2AC1A 1BLZA 1TE1B 4KQ7A 2XLAA 1OLMA 3PVOA 1VBC2 3V65A 1O4YA 2VG9A 4M3CF 3AL6A 5EYXA 3USUB 1NZIA 3ZR6A 4FOWA 4CEYB 4YW1A 1DQ6A 1WW6A 3WNLA 2YU1A 1VLNA 1OSGA 3AVRA 1NY71 3FFZA 3IT8A 4RQPB 4XFHA 3UNPA 1UIJA 3O0WA 3PJYA 1QNWA 4M3CB 2IVIB 2X53S 2HH9A 1Z7S2 4JHTA 3ZR5A 2OPWA 3WSOA 3I3MA 1GZCA 3AM2A 2BDRA 4W6XA 3ABZA 2AACA 3OUIA 1VBA3 2RS33 4IGOA 4EV0A 4Q4Y2 4JQRA 1UY2A 2WL1A 1OQ1A 1GLHA 5JXHA 5FP3A 1GZ9A 4EZ4A 5KHGA 5KXCA 2VE1A 3VBSA 1O5UA 5FZ6A 1A8MA 1LGNA 1PK6C 3HJRA 4AOCA 5JI9A 1A34A 4R9AA 3ZO0B 3B93A 5FAXA 5F32A 3I54A 3KT7A 1O3QA 3B3QE 4AVBA 1OD3A 1YFWA 1W9TA 3KCCA 5BNOC 3MEPA 2VVFA 3HIFA 4TWTA 4IV1A 1N3PA 1WCQA 1QJY1 4L92A 3LEKA 4LBMA 1DDLA 4CXWA 3HBKA 3OY8A 4Z07A 5FZ0A 1LRHA 4D0QA 2DCJA 4KGQA 1G9DA 4Q4Y1 4KWLA 3POYA 4FPOB 1GOGA 3HQRA 2XKOA 2CAVA 2WFF2 3SNMA 5M0TA 4QU2A 1CQ9A 5CVRA 1GP5A 5LRRA 1DQ5A 4IEUA 1JOJA 1UF2C 4Y24A 4QWNA 1DQ2A 5C3QA 3RZHA 4Q5OA 1GQGA 2WIIB 3OSDA 4XFCA 2O14A 1W90A 4M0NA 4AFAA 4NHKA 2W91A 4E2GA 1I1EA 3N7LA 4Z2WA 4OVEA 4FTBA 2PHXA 4IE6A 4YVWB 2JDPA 4Q4V3 4YW6A 2VOXA 1NCQA 3HT2A 2XDVA 1JMUB 4HN0A 4XBQA 3SC7X 5JZGB 4LBQB 2ZEZA 2XL7A 1WWYA 2ADEA 2QQWA 3H8UA 5EPAA 4B4RA 2PQQA 5J7MA 4W50A 1R64A 4K20A 3LOIA 4QQPA 4LT5A 5JSOA 5F3EA 3OGRA 4NR1A 3WG3A 5J09A 5FXWA 2ZKLA 3D8CA 2CWSA 3J8F1 1CESA 3HQXA 1APNA 3HAGA 1GP4A 2UY9A 5FOJB 2NP0A 3VKNA 4XTMA 1LTEA 1Y43B 2Y0OA 3C7EA 4C8DA 2VZRA 1LU1A 1JN2P 2OUHA 1OUSA 2ZGSA 4CDXA 3VD4A 2E7TA 2DBIA 2IXLA 1R081 1RHI2 4ATFA 5DZFA 5FUIA 5C3OA 4JKLA 3GZAA 5C33A 5A6ZA 2X5IC 2RJKA 4GKYA 3FBYA 4LTAA 1CAXB 2PHRA 1GWMA 3E1F1 3GZUC 3K77A 3DUIA 4XBNA 2QZ2A 2VBDA 3WP6A 4A7KA 4RR3A 3A22A 2PAMA 1QHDA 2FCVA 2D6NA 1X50A 2Z4FA 4NHYA 1L7QA 1MVQA 1UKRA 4LPLA 4P5YA 4CCEA 3TEZA 5FPLA 4Z92B 4FI9A 4UW3A 3OBZA 2C9KA 4XCBA 4BZ4A 1QJY3 1IS6A 4N43A 4Y1XA 2PMWB 2ZEXA 3V0AB 4K9SA 1GMMA 1RUD1 5ERLA 5A7WA 4CYDA 4CRQA 2HWC1 1MQTC 4IEYA 4Q4Y3 4CCNA 1MPXA 3WF2A 1VIWB 2I74A 3POFA 1E5HA 3WF1A 3MW3A 4OLLA 3K3OA 4YZ4A 3WP3A 2ZGRA 1Q5OA 4IE4A 5AC91 3ORJA 5LY1A 1RUI3 4TSVA 4FOQA 4NOTA 2VUAA 4A6SA 1AJKA 2EF6A 2CYFA 3DXTA 2VBPA 1H8TB 2UYBA 3IMNA 5KC5A 3AMMA 2IWGB 3T1MA 2HWD2 2WNVB 2FMDA 3DXUA 3VZMA 1VRH2 4H55A 2B46X 1FPN2 1N47A 3MUY1 4NHXA 4OULA 1QJFA 1W2OA 4BXSV 2JJ6A 2C24A 1PZ9A 5FCCA 3T0DA 3H7YA 4CDUC 1SBDA 1G9AA 4QQ2A 4JQTA 2CSGA 1RUH2 4O65A 1ULFA 3K46A 3J8F3 2Q4SA 4ES9A 3C7FA 1PM7A 1BEV2 2J7MA 1OBNA 1MR5A 1OXCA 3MFCA 4XFFA 3ZN6A 5BUVA 2VXRA 4D6QA 4WVMA 4MSVA 4XQ4A 4AEMA 3M3OA 5SV5A 1NLSA 4PIYA 1R083 2XWJB 3LWCA 1GICA 4HLTA 1YFYA 3ITQA 4QDQA 2E7QA 2OXBA 5GLVA 3PVNA 4LUMA 1PK6B 1VRH1 2OZ6A 2W87A 3ZFFA 4QQOA 4ES8A 1BCXA 1OH4A 1W2UA 1KJLA 4EZHA 3D5OA 4LKEA 4COWA 5FUNA 4NPMA 1FNZA 1Q8QA 4JGZA 3BU0A 3CJIC 3VBUB 1RUH1 3THCA 4BISA 1K45A 2F4LA 4HVOA 4HZFA 4X8NA 3WY6A 4AFMA 4EWDA 2V5DA 1OHFA 1RUD3 2P5BA 1BEV1 3USSA 4HKWA 3WQ1A 2B7YA 4FVVA 2VU9A 2HWC3 2DFBA 4H2AA 2WDBA 4Y3OA 1DHKB 1QOTA 3M3QA 3JQWA 1E5IA 3VBRA 3NV4A 1O7FA 3PVEA 1H9PA 1YWKA 4XMIA 1REFA 2Y6JA 4AVCA 5A33B 3FX3A 1O4ZA 2NMNA 4ZU5A 4UBGA 3VGIA 5AC93 3NJXA 2VBBA 3AYCA 4U2AA 5GZDA 3RGBA 1UPSA 1GNZA 2A3XA 3I59B 1W6MA 3ZN5A 1WBLA 2DU1A 1SLIA 1OLQA 2ZJCA 1CJPA 3CF6E 3GJBA 4LHKA 2OPKA 2L9LA 4AQSA 3PNAA 5KHKA 4P9IA 4AWDA 2DTYA 1HQLA 3BIWE 5CADA 2OYZA 5FWJA 4AEDA 4HXCA 2LALA 1BJQA 1H8VA 1OLRA 2BBVA 5ANNA 4CU8A 3H8RA 4KMQA 4PBPA 4TLFA 3ZYJB 3FZ3A 4D6RA 1I5ZA 2ZOEB 1DYOA 5A3UA 5DZGA 3NJZA 4NPLA 2GC3A 4QPGB 3RRDA 1DIWA 2HEWF 5IK8A 2GDFA 5IATA 5JZGA 3Q8FA 2DUOA 2NZ9A 4LBQA 1C57A 4BQ3A 1RUG2 4IL7A 2ET7A 4PI0A 1FT9A 2WNUA 3VDCA 4JDNA 4PJYA 5J48A 4AQ6A 2Q8OA 1AL0G 1MS1A 1OFNA 4I2OA 2LTNA 4IV3A 1WCKA 5E8AA 1J1TA 1HN1A 1H1IA 1LHWA 1STMA 1XU1A 1ZBA2 2HEYF 2R6QA 1U0AA 1DQ4A 3IPVA 4QKNA 3DL3A 2X5IB 3NKTA 3TEWA 1VRH3 1SLLA 5DAPA 2VUJA 2RR12 2C4XA 3J7LA 2RM22 4URAA 3UGGA 3GBFA 1RUH3 4LULA 1HRI2 3AKQA 1OF3A 5JWPA 4L9BA 1MZ5A 2XQRA 1H6YA 1MACA 3HNYM 1BEV3 4HMZA 1DGWX 1HN0A 1RIRA 4AR2A 2DCTA 4Y4YA 1RUG1 2LM3A 1CAUA 2ID4A 4XZUG 2X8KA 1LODA 1UU4A 3ZSEA 1QJX2 4LMFA 1ZYBA 3H50A 4UI9L 3TBDA 1MQTB 3PUHA 3OD0A 1LNSA 3W59A 3O1UA 4UOJA 1E5RA 1ZBA1 4ASMB 3PJQA 5BV6A 3AP5A 5FP9A 2YHJA 5FV3A 3H8OA 2ZGLA 1URXA 5C8CC 4OMDA 5DAXA 5LATA 1U5IA 4JKKA 5I0DA 5T5PA 4C0HA 2RR11 3A0KA 1KFXL 1T6BX 2XJRA 2KA3A 2C1FA 1IQDC 4Q0QA 5KXBA 2A6WA 2RDSA 2ZGTA 5FZGA 5C4WC 3LA7A 1CX4A 3GYDA 4RA0A 3P5BA 2PLV2 4EROA 2WWUA 5E6HA 1NLRA 5LBCA 1GUIA 3QLQA 4QGLA 2RS51 1QJX1 2WC2A 5CFCA 4Z8BA 4CDUB 1LEMA 1RJ8A 3N7JA 1BHGA 2X09A 4HPKA 1TNRA 1XC6A 1AX1A 5FZEA 3ROUA 5F37A 1REDA 1UZWA 3CDZB 1MS8A 1SLCA 4CCDA 3J7HA 2HEVF 4V1PA 1VBD1 3WG2A 3DKWA 3NNLA 2W1QA 1PMJX 2D98A 5B2GB 1YO8A 1Q8PA 3MLJA 4AGVA 1WA6X 3DYMA 5DMYA 4OQ8A 2LROA 2BEOA 3VBHA 4A44A 1E5SA 4N90A 5FPAA 5APAA 3WCRA 3N9PA 2VQTA 4UWDA 5K0UA 4E27A 2XJQA 3N36A 1CD3G 1XJAA 4D94A 2ZX0A 5LBBA 3B69A 1AR61 5E88A 1CPNA 4B7KA 1IZ3A 1SZBA 3N9OA 3U78A 2BBAA 3TNPB 3O1RA 5DN2A 3JD72 3OGSA 4ZU4A 3VBSC 3WF3A 4Q4W1 1MS5A 3CJIB 3GZTB 3N9MA 4AZZA 4QAWA 2MPFA 1RUG3 4MXVA 2OVUA 2WN3A 5H9RA 1SDDB 4CVUA 5HV4A 5HPOA 5ACA2 2MNGA 5A32A 1COV2 2DCKA 1DZTA 3PMSA 3IIAA 4Q8LA 5EQUA 3VBUA 2B5HA 3EMRA 3TEYA 1ZBA3 1AZDA 3S6PA 4B8EA 2D3SA 4IV1C 1LHOA 1GYKA 1L3JA 3W21A 3GALA 5A1LA 1AR72 1ZREA 1PO22 3QD6A 4KG0A 1DLCA 5FJKA 3UGFA 2B45X 2RR13 5HXVA 3WUCA 4HVQA 5JAXA 2B4KA 4AVTA 4NIDA 3K4AA 3AZVA 1ULCA 4JX0A 2H0VA 2NMOA 4PQQA 4YG6A 2A3WA 2EXJA 2HBUA 3KT4A 4MHUA 2OZJA 1PIV2 1FXZA 3VN4A 5DZEA 4CXXA 2W1WA 2RDQA 3UETA 4FXGB 2DFCA 4LA2A 2RS53 1QJX3 1X8EA 1W2TA 3I59A 1VE0A 1Q8SA 4LHNA 4Y22A 2P34A 2TNFA 4RHV2 1CZTA 2V5YA 3MBWA 4OHZA 1NCQC 1TMF1 4XDPA 1VBD3 3NVCA 5E89A 1REEA 1PO21 1BK0A 4K1YA 5KHHA 5CIRA 1B35A 1TVGA 3APBA 2E9QA 2Y8KA 1ENRA 5FMOS 4CP9B 2Q1ZB 4QPGA 4LKSA 2UWCA 2XONA 3ILFA 3DPRA 5FZ3A 2ZHNA 3MW2A 4QQHA 2CU5A 1U5ZA 5JSRA 1BXHA 3CNAA 3O1SA 4CDXC 5I0SA 1AR63 1UKGA 2ZHMA 4AHZA 1BVP1 1D2SA 2SBAA 5FMDA 4HG6B 5A3WA 3ES4A 4Q4W3 4JGYB 1MZ6A 4NAOA 4RHV1 1EYBA 2X5IA 2E63A 4PHZA 3S7EA 4QX3A 4CUAA 3E97A 1AL22 2IUWA 3FLPA 3T2TA 2ZX1A 1J3RA 4RR3C 2HWF1 2PHFA 4NVPA 4AAXA 4Q0UA 4AHXA 5JR7B 1DBNA 1YI9A 3AJZA 5HCFA 1PMHX 2BW8A 3W5NA 3C2UA 4N43C 2EIDA 3RPQA 1KD7A 2W68A 3I2HA 4J1WA 5C9AA 1QQP2 2VZQA 2QQPA 1YIFA 4ONUA 5IK7A 5FYTA 5FRAA 5LA2A 5C8CB 5GZGA 4PDWA 2DCZA 3V56A 4BHPA 5HV0A 1JYWA 1LULA 4XURA 4UYBA 4YW4A 4XJWA 3THPA 5C4WB 4LK7A 3NRUA 2C0ZA 5A7NA 4BM8A 1QY4A 4PLMA 1EAH2 5L9VA 1KXGA 1WW4A 1AL21 5CG8A 4UFMA 5DG2A 2J1TA 1W28A 3SEEA 3GJAA 4AGRA 3VD7A 2EXIA 1TMF3 1D4M1 1LENA 4QGNA 1N1TA 5I0TA 2XJPA 1SFYA 4KBZA 5T54A 1YCIA 3TRSB 1PO23 2CL2A 1A6CA 2NM1A 1RB8G 1WLDA 2VVEA 5FKCA 2ZGMA 1ZRRA 2OT7A 4MHRA 4XVHA 1ZBE2 5EYYA 1QEXA 4L99A 1IQAA 4R52A 4YNIA 5IVYA 4IE5A 2Y6GA 5FZOA 2ZACA 4X6RB 4A2UA 4QX0A 2NQYA 4L97A 4S2DA 1EV12 2E33A 1O3SA 1JZ6A 1EAH1 2JDUA 4QMAA 4DPNA 1HXS1 2RMU2 4RHV3 3AJYA 1O5LA 2JDAA 1AXKA 1W8UA 4OI1A 2GN7A 3WNPA 2GC1A 2VOTA 4JC1A 5CKNA 2P4EA 4XOGA 3ZFFC 5IWFA 3AB0A 1O8PA 2R1BA 2HWF3 4BA6A 2J1UA 1CZSA 2QDRA 1PHMA 2BFUS 2WZ8A 4LNVA 3RMYA 3Q8AA 4JGZC 3ZMNA 3E5XA 2GNTA 5BYNA 3T08A 1N1SA 2BRTA 4L2NA 1RYYA 1Q8OA 2RHPA 1DZQA 1H0BA 1QJU1 1SDWA 2PYTA 4FPKA 4IV1B 5KC6A 4L11A 3MI8A 2JKBA 4TLGA 5DDJ2 1C1LA 4WM7A 3OY8B 1IS4A 5I8TA 3VBRC 1I3HA 1ZRDA 3SCHA 4UF0A 2A75A 3UESA 1V6MA 3DV8A 2GP3A 1O4TA 4FT8A 4PF1A 1YQ6A 5IVFA 3KCXA 5GM0A 3ZYFA 4A42A 1AL23 4QM9A 5IVJA 3GCXA 1W05A 2Y60A 3WDWA 4B7EA 4XUNA 1N1VA 5GALA 4GA9A 1ZZ8A 4HL0A 5CBLA 2FQPA 3SISA 1D4M3 1HW5A 2RJ2A 5LBEA 1RUF1 1JUIA 1DFQA 5FZDA 4WZCA 2VCCA 4AE2A 1NCQB 4NHMA 4XILA 1AXYA 4MGSA 4OZOA 1SPPB 3J7MA 1TME1 2VXJA 3DYPA 4AEDC 1UY3A 2E7AA 3WQBA 1AYN2 4WVWA 4C1XA 4XBLA 5CU1A 3I97A 1HRV2 1S0IA 5FMBA 3ZPYA 2AEYA 5HCHA 4XJ8A 3OUHA 3ZDVA 3MO4A 2Q1MA 3QOPA 2WNUC 2R061 2JE9A 4UFLA 4B4QA 1IOAA 3EXUA 1EAH3 3GM8A 1NE6A 4DUXA 1K5MA 3WP5A 4IV3C 4CDXB 4CP9A 2WR9A 4GB32 3T0AA 1F15A 1HXS3 2O8QA 1X7NA 1XNTA 2P3JA 3BGAA 4Q0PA 4AHWA 1JZ7A 4XZPA 3ZM8A 4BK5A 4LKFA 2IZWA 2YUEA 4AFCA 5FZKA 5CYYA 1RUC2 2YXSA 3VDDA 1KS4A 3WUDA 4BQWA 2AYHA 4FFFA 2ARBA 3WDUA 1HV0A 1GOFA 1GWLA 3OGGA 1QXRA 1RGSA 3B02A 4YGCA 3LZZA 5K9YA 3GBWA 3U0ZA 3BIEA 3BPZA 5JMOA 5FYSA 5C5UA 3IM0A 4RR3B 1TG7A 1YJLA 2B42B 1HRV1 2PELA 1W39A 2HWE1 2XB6C 3QBQA 4HN1A 4JGYA 5FTTC 5C7GA 3VBOB 1LOFA 1CN1A 3IDEA 2AZ5A 1QJU3 5KXEA 1YXWA 3W20A 4N43B 5L7OA 4I3GA 2J1EA 3H3UA 3AXDA 1RMU1 2FZ1A 2JG9A 2OS2A 4META 4PQ9A 3LOBA 3I2JA 2YC4A 3U14A 2UU8A 5FZFA 3BTXA 3F2ZA 5LRSA 2BOJA 2O1QA 2SLIA 4AI0A 4ZXEA 4CUCA 3AYAA 4OHYA 3PIJA 3O0XA 5T5JA 3VKOA 3ZPOA 4HT1T 2JICA 3WR0A 1C1FA 4Q27A 4P08A 1GU3A 2GNDA 2A5ZA 2VZ1A 3PVBB 5KHJA 4DUVA 3OUJA 1RUF3 4ZPIA 3IAQA 5CEHA 1Y9GA 4CU7A 4DNYA 1FX5A 1MS3A 2R0FA 1TME3 3NV1A 1DGWA 3PDQA 3W9AA 1N3QA 1BVVA 1GOHA 2FDJA 2ES3A 3WHTA 3WT3A 3ZIXA 1XB9A 3CIHA 2CY6A 1SQ4A 5CFCC 1ULOA 2XOMA 3BI3A 5IVCA 3CHXA 3M8LA 3KWVA 3DEMA 2QUOA 4K7JA 4QX2A 5C3RA 3IDCB 2OIIA 2R063 3TNQA 3CBNA 4JDMA 4PF5A 2QFEA 3ZN6B 4F3JA 4XJ9A 5JPMB 3KV9A 3P3PA 1S0JA 1QH6A 4WVMB 2EXHA 3UK9A 1WLCA 5FUPA 1ALYA 2XKPA 5L9RA 5FY0A 3ACGA 4EQVA 1JODA 1WGPA 1QIQA 4YM3A 3VBHC 4BLIA 1C8M2 3RNSA 3R4DB 5FZBA 2YU2A 3R05A 4Z82A 5LY2A 5K0UC 2WRAA 2WA4A 3LEIA 3NQHA 2K2SA 4AVAA 2HWB2 3WW1A 2NYYA 4WM8A 3ZFFB 5FBZA 3O7OA 4AF9A 1YEWA 1H1MA 4I3PA 1HRV3 2HWE3 2VMGA 2VMHA 4OI2A 2V09A 4EN7B 4R4XA 2CDPA 4HANA 4QXBA 4JGZB 1YHFA 4BQYA 1MZEA 3LD8A 1NA1A 1UZVA 1H2KA 1DGLA 1RMU3 2ARCA 1W2AX 1AF9A 1VBC1 2V4VA 1PO12 3R4UA 4Y20A 1WCSA 2VECA 4I0BA 3VBUC 1PVXA 3VBRB 3KD4A 4FBFA 1X33A 5K8SA 2XMLA 1US3A 1XQNA 1U5YA 2BNNA 3PUAA 2W46A 1Z7S1 1DQ0A 2WZR2 1RUNA 2Z79A 1UXXX 4YGDA 5H9SA 4ZXKA 1W6MB 2E32A 2VCBA 5GJ6A 2EVXA 2ZMLA 5JIUA 4H7LA 3V64A 3JZVA 1UW8A 2E53A 4XC9A 4XFIA 5E1RA 5A3TA 4QU1A 4G3YC 5G05L 2WINB 4A3ZA 2BTVC 5FO7B 4AEDB 3NJVA 1UX7A 5A3PA 4XFAA 2AREA 2DURA 3VZJA 2R042 1PO11 4B1LA 1HX6A 4KG8A 4A7YA 2Q1FA 1WMEA 2PXJA 3C7OA 3DF0A 3N3HA 2FDHA 4QX8A 5CA6A 1C5IA 2I07B 5EXOA 2YB7A 4DRRA 5A1FA 5FYZA 5A6QA 1PNGA 3W58A 3FHAA 1SPPA 2IFWA 2YPJA 3EHKA 3OD4A 3PMEA 4M3CE 2X10A 4QX7A 1XE8A 3A4UA 2WNUB 1B35C 4AI2A 4DMIA 2YG0A 4RGKA 1J3QA 2XVKA 1OH3A 2VOKA 2ZGKA 3ACFA 4IV3B 2G9FA 1HB2A 1LHNA 2J42A 2ZXQA 3DPRC 4QPGC 3UJQA 4NHLA 2WFF1 4RFRB 1DCSA 2MEV2 3IPVB 1S0BA 5JR2A 1XYNA 4XF4A 1SCRA 3GNEA 1O91A 1RL3A 1F4HA 4K3UA 4GWIA 3UV9A 3VKFC 1NXD1 2ZAAA 4UFKA 2QQUA 1ZRFA 2JKXA 3HR9A 5DAQA 4X8PA 3RS6A 3UL2A 2W1UA 3SH5A 4E9KA 3MV11 3VDBA 1WA4A 4OI0A 3R4SA 1VBC3 2WO1A 3WZ1A 1XYOA 1CAUB 2LRPA 2VQAA 2QE3A 2R49A 3VBOA 3JUUA 2QDNA 2W3JA 2D6LX 4IEXA 2YBKA 5CISA 3MPBA 1WD3A 1NG0A 1UWWA 5C9AC 3ALQA 4LLFA 1Z7S3 2VZSA 4FFIA 5CKQA 2B8MA 2VVDA 4AFDA 3CQOA 3K51A 4PDWC 4XE9A 3ZYRA 1W99A 2D44A 3PUSA 1AR82 5FFOC 1RHI1 3MLKA 1UL9A 1F9KA 1WW5A 3MYXA 2JXAA 4V2VA 3WNMA 3RYKA 2Y6LA 4KBBA 1WZXA 1WMDA 1GP6A 1T2XA 1AR92 4FCAA 2JDYA 5FY4A 1IS5A 1VAKA 1G8WA 1W6QA 3WQ0A 3RZLA 3NO8A 2BUKA 2RG4A 3VBFB 1PO13 4UFHA 5HCBA 3ES1A 4GAZA 2BQPA 5CFCB 2W9XA 5FP8A 1JYNA 1EP0A 2HJIA 4HPKB 4LIUA 4MUVA 5LW9A 1LAJA 1NOVA 2D6KA 2NPIA 3JCIA 1HQWA 2HKXA 1A78A 2G4IA 1H6XA 2EAKA 2XUEA 3QH7A 2JWPA 2XR4A 4B1MA 4P02B 1ZZ7A 4FP2A 2LUWA 4IQPA 5FXZA 2V73A 1JYXA 3ILRA 2XVLA 2WFF3 3H7JA 3LPGA 4QDSA 4CDWA 4QT6A 3KVBA 2WWJA 3VBHB 2E6VA 5K0UB 1G6NA 5FZLA 1X9TA 2ZGUA 4CCKA 4MYEA 3OEAA 1JI6A 3J7NA 1XNBA 1SEFA 1BMV2 4BB3A 2FDIA 2ZEYA 5JDBA 2FDFA 2A6ZA 3AKTA 1IG3A 1XYPA 2XG3A 3IDAA 3L9JT 3E5UA 3I8TA 2HWD1 2MHFA 5KXDA 4V2WA 4I02A 1FPN1 3N4MA 4LR4A 2VNOA 1LECA 1SLTA 4RS5A 3ZFGA 1DF0A 1OI6A 3AFGA 5A32B 5FLHA 2ZGOA 1FMD2 3MHZA 2K9ZA 3WVJA 5HBAA 2GZWA 4IEWA 4MGZE 3VV1A 4YVSC 3IAPA 4GMP1 1RUJ2 2VH9A 3LEGA 3ETPA 4R8HA 5FBJA 2Y34A 3K48A 3VD3A 4WM7C 2TBVA 4FAHA 2QQKA 1MZFA 1W06A 2PHTA 1R1ZA 2D6PA 4CTEA 1WUVA 2A6XA 2BYVE 1YJKA 3KQ4B 2ET1A 4GMP0
chains in the Genus database with same CATH topology
1RHI3 1IKQA 1PMIA 4YW2A 3RI8A 1IHMA 4DY3A 4JAAA 4YLZA 2XH6A 2YDEA 3MIEA 4JV4A 2D7FA 3S0MA 4KU7A 2DTWA 4LBNA 4IEPA 4MH0E 4Y22B 2WLPA 5SV8A 3IBMA 2X29A 2WSVA 4JRAA 1G7YA 3FHIB 4P9XA 3VKLA 2XL9A 1FV3A 4UXAA 3FBMA 1B35B 3UKTA 4S2FA 4S2GA 1H4GA 3VZLA 1QU0A 1KDMA 3DPRB 4C91A 2BNMA 4IETA 1F5FA 1R092 3VHOA 4N53C 1JW6A 1K5MC 1YUDA 2EXKA 4RL7A 1BQPA 1SLBA 3UJOA 4EN0A 2ZX2A 5I91A 5LEKA 1VAVA 1BBT2 4PBOA 2TUNA 3VDDC 3SCGA 2WJSA 5JVVA 2HWD3 4FPEA 3ZYIB 1KITA 1FPN3 4LBLA 1UZYA 1XE7A 3TOJA 4LO5B 4JGYC 3S30A 1LOFC 2Y0IA 4GMP3 2BNOA 1CAWA 2AR6A 2WNEA 4KU8A 4XXPA 5L7OC 3B9IA 4N7IA 2DV9A 2JG9C 2W0XA 5C9AB 3D4KA 1DGRA 3WHUA 5JMCA 2ZPXA 3SH4A 2XBO2 4O9EA 4PDWB 1OPOA 1BBT1 3AKSA 2PHLA 2YMZA 3AMPA 1I9RA 3M2MA 1ENSA 2P17A 5IK5A 2XVGA 3MGUA 4RD7A 4J6GA 4LLOA 4BLJA 2JEMA 1A3KA 1QKQA 2DVBA 2JECA 3MLLA 1YYNA 2FMYA 2RM21 4JC1A 3H9AA 4MXWB 1HRI1 2R30A 2D5FA 1NQDA 1MVEA 4K40A 3R0RA 2P3KA 3M3EA 1LOAA 3VBFA 1DQ1A 3WG1A 3MFAA 1AX2A 1BK1A 3BTAA 2VNRA 2IXJA 1F31A 1DZRA 3ASIA 1H4HA 1IKPA 3VUOA 4AI3A 1C4RA 4P9LA 3LSDA 1M4WA 3OBRA 2PHUA 3AYDA 2WSUA 4AQ2A 3G6JB 1PGL2 2R1DA 2YV8A 4LHLA 4AG4A 2PLV1 1LOCA 1ONAA 4QPIA 4WM8C 2ATFA 1HKDA 4P9JA 1MEC2 3OYWA 4DQAA 4C1WA 1PGW2 1QDCA 1WBFA 1JXNA 3I2DA 4H7MA 5GLUA 1NA1C 1VB4A 3C3VA 4YVSB 5L73A 4X6QB 1N1YA 4AFBA 3LKJA 4WM7B 2DVGA 3ZMOA 4AVSA 5GKAC 1BBT3 4XPVA 5JOWA 1XNKA 4JRLA 3B01A 3O0VA 3VZOA 1OQEA 4LO7A 4FTSA 1VAMA 4XQDA 1Z78A 2RM23 1MEC1 5FPXA 3BCWA 5JOZA 1IPKA 1HRI3 1ASJ2 3U07A 3JD71 3V0BA 1FOD2 1WD4A 1ZZ6A 1Y7BA 1AX0A 2QNKA 5ACA1 1OQDA 1FV2A 1COV1 4R9CA 1EY2A 4KGGA 5BXXA 3JQXA 4GULA 1XU2A 4Y5Z0 3LCPA 5DUWA 1QGLA 4C0BA 2GMPA 5FREA 2ILMA 1AR71 4KL1A 1OKQA 3PHMA 4N53B 2YGMA 1K5MB 1RUE2 3EJKA 1F8VA 4YFZA 3VHPA 1SFNA 3LSEA 1QWRA 2ZMNA 1PIV1 1JTZX 3POWA 2G9GA 2XUMA 3VDDB 2PLV3 4DFSA 2CWMA 2IXCA 4AI8A 2BWAA 4OHVA 2ZABA 5FO9B 1C8NA 2AENA 5F6LB 2A6YA 1VBB2 2DYCA 4YM2A 3B5LB 1ZRCA 4XJZA 5F9TA 3VHRA 1S1AA 1V6NA 5T50A 5L7OB 4Q4X2 2QKDA 2JG9B 1VJ2A 1QDOA 2D93A 4YW5A 4D7YA 3M3IA 2WA3A 2UY8A 1SMVA 2HYKA 3VBOC 1KS5A 1S2BA 3WDVA 3AYEA 4FAGA 5I0RA 3AMHA 4KWKA 2ZBJA 2WWSA 1DYPA 1GANA 2CNAA 1MEC3 4KWJA 4Q26A 1DG6A 1AHSA 5JI7A 2IC1A 1VBE2 3KQRA 2XPJA 1OFSA 2PAKA 3JD73 3RZZA 5T5OA 1RVF2 4COUA 1XRUA 4GWMA 4M0HA 1XNDA 5GLZA 2DUQA 3AKPA 5ACA3 1COV3 1LU2A 4W6YA 2DF7A 4XMAA 2FZ2A 4AYUA 3P3NA 3AP9A 4MXWA 1AYM2 2Z42A 3WW3A 3KB5A 5FPZA 4FPCA 3AFKA 4E2SA 3U10A 1PZ7A 1AR73 3I4IA 3WDTA 4RFT0 4XF1A 4FXKB 1QQP1 5BNQA 4XJUA 4YG3A 5J96B 1W6NA 2PHDA 4CDWC 1LEDA 1PIV3 4URTA 4OHWA 5JSPA 3OTFA 1OD5A 4WVVA 5KHIA 1J3PA 3ZYPA 1X8MA 2XWBB 4WM8B 1PZ8A 2BWCA 1GFF2 4BMBA 4XTPA 5TSWA 3D0JA 1D2QA 3OBTA 3WNXA 1AYM1 4YM1A 1NA1B 3MPPG 2DU0A 1V9U2 2B9UA 4RS5C 3ZFGC 2E51A 5IUQA 4PCRA 2H6BA 4Y20B 5JOXA 2Y38A 2GC0A 1BYHA 1ZBE1 4FOYA 1RITA 2R072 4YVSA 4QGMA 4AQTA 3BOWA 1S2KA 2VPVA 1EV11 4ZKTB 2D3RA 1UX6A 1ULDA 4JDOA 2A7AA 3IDBB 2GMEA 2RMU1 4FP3A 1JHNA 2DVFA 1UCXA 2ZGQA 4TYSA 3MIHA 4DZGA 4P9GA 5IK4A 3WD5A 4OI4A 1KFUL 3OGJA 2B39A 5BPXA 4I0AA 1CPMA 1U5XA 4XXAA 1UD1A 4DB5A 1QOOA 1FATA 1SBEA 2R071 1QQP3 1UAIA 4PIZA 5DDJ1 2PAEA 1JBCA 5I8YA 3LA2A 5C8WA 1S55A 5T55A 3PLQA 2ZZJA 3SXWA 4BH9A 2XJSA 5BNNA 1LCLA 3ZFEA 5AFEA 2A70A 1A8DA 1F5JA 1LOGA 4LO6B 1AVBA 4N53A 4NPRA 2XLFA 2VULA 2CGPA 5DUVA 4ORFA 5I93A 4NWWA 5HI0A 4R9BA 4IEVA 4N9IA 4HFSA 1AYM3 4S2HA 5EJ3A 3ZXEA 3FC0A 4HK8A 1W6OA 4XEZA 1NCRA 1GZWA 1OOPB 1D0HA 3N7KA 3FFQA 3E6BA 4JVAA 5T3NA 5T5LA 4CEWA 4YZ2A 3MDPA 3AMQA 3THTA 1HIXA 3G7DA 5FLIA 1AYN1 4B4PA 4YFWA 1V6IA 1ZBE3 2EALA 2GALA 3JB4C 4LUKA 3URFA 3AP7A 1OA4A 4E4DX 1EPZA 2C5DA 1EV13 2I2SA 4PIXA 4U36A 3VHNA 2DVAA 4LBOA 3WW4A 1GKBA 2YROA 3ZXDA 2WFPA 1PNFA 4GB31 2YYOA 2RMU3 4WBBA 2VW0A 4XQWA 1FI2A 3ZSMA 4BOWA 4Q8KA 1RUC1 3FLRA 4JTOA 1T6GC 5F6KA 3GBGA 4XF9A 1NZCA 1W6QB 1ZX5A 3HBZA 2XGXA 4YGEA 1ULGA 5D8AB 3B00A 3NAPA 4XF3A 4H3WA 2R0HA 4FPGA 5FQ0B 2R073 3SLIA 4DXZA 3VBFC 3ZIWA 5DDJ3 3TN92 5I8SA 5AVAA 4XIOA 3ZDSA 4FSJA 3RI9A 2RS12 4OFGA 3M7AA 4CDWB 1WCDJ 4H14A 4CDQB 3MIGA 1S0EA 1Z0HA 1NY72 4IEZA 2A6VA 1CONA 3LGRA 5EV7A 5ABJA 1TNFA 3INAA 3FE5A 1NE4A 3QACA 4E4ZA 5J98B 3TB0A 2D6OX 1DYKA 4LEJA 4QPIC 1H1AA 5BNPB 3QH6A 1AYN3 2D5HA 4BWOA 3M1HA 2ZS6B 4RS5B 1LKNA 3TN91 3ZFGB 1AXZA 1AUYA 1OA2A 1O3TA 2BVVA 3QCWA 5H9QA 1UPIA 2GNMA 2RS11 3N35A 4W6WA 2VY0A 4OUMA 3HT1A 4CP2A 4O9GA 1ZZ9A 2CTVA 1ND3A 4XYXA 1M06G 2WT0A 1H30A 5AVPA 4F8AA 3ME2A 1QJY2 1LHVA 4GB33 4AW7A 5EZWA 1SLAA 1C8M1 1RUC3 3ZXAC 1OA3A 4Q0VA 4AEJA 2GNBA 2IXIA 1S0GA 1JYIA 2VOVA 5FO8B 1CR7A 2HWB1 1YFXA 2H6CA 3ZXGA 2RE9A 3T1LA 1XXNA 3KGLA 5GLWA 4D7TA 4L8QA 2CGNA 5CG9A 1VALA 3LA3A 4JTNA 5FMOL 1J58A 1RUI2 2BBVA 1OPMA 4GALA 4INDA 2D97A 3RMXA 1NQJA 2PFWA 5K7PA 2D6MA 3FMGA 1POV1 3BB6A 4D69A 3M4FA 4HKLA 3M3CA 2OW4A 2ZHLA 4MX3A 4FPYA 3L2HA 5HCAA 1POV0 3FUQA 1JH5A 3S7IA 3J8F2 3KT1A 2JENA 2WZR1 4XW3A 1LHUA 5E16A 3MF9A 1C3HA 3AZWA 1MS9A 3ILNA 3HMYA 1R082 1RUI1 1QF3A 3TN93 2WKKA 1UMZA 2GH8A 4R4ZA 2R041 2RS13 1ENQA 3O5SA 1OOPA 1CAWB 2UYAA 4OUSA 4ISRA 1D4VB 1Q8VA 1HDKA 2GN3A 2UWAA 3SHRA 4GXLA 1W6PA 3POSA 2KXLA 2JG8A 3H1YA 2PN5A 3NW4A 1RUD2 2N7GA 1IS3A 5J37A 5D1IA 1C8M3 2HWC2 5F1RA 3ZX7A 4K6BA 2MEV1 2D3PA 3B7MA 4SLIA 2HWB3 1YLLA 4WVZA 3NL1A 4QHBA 4C90A 4LBKA 2EIGA 4DS0A 1BZWA 5AC92 4GH4A 4G4FA 4YYOA 3KM5A 3H0OA 1V00A 3H1MA 2W52A 1POV3 5D8AA 5CFDA 2W08A 3RG0A 3RSJA 2QZ3A 2VW2A 4LBQD 4YGBA 3ATGA 4FQZA 4COVA 2P2KA 5FQ0A 1FYUA 2WS92 2Y26A 4XDQA 4XF0A 4A7ZA 1E57A 1S0CA 3CL1A 4EWEA 1ND2B 1Q3EA 2WZR3 3B94A 3OCPA 1V70A 4WZFA 5BY5A 1DGRN 1AR81 2AH2A 1G9BA 4CDQA 2K0GA 2BFUL 4YRDA 1LOEA 1AR91 4Y26A 1FAYA 2Q30A 5GZFA 3MIDA 4QPIB 2H0BA 2R043 3OYWB 3U11A 1IGOA 3AP4A 1TQ5A 2WS91 3HN1A 2ZX4A 3KCYA 4YZ1A 5BNPA 4BCUA 3B9CA 4XIKA 2WT1A 2WQ4A 1KJRA 2CV6A 2YC0A 1CJDA 2MEV3 4HK9A 3USUA 4TZDA 2WZPP 3AZYA 4CEYA 4Y1YA 3FLTA 5EFUA 2VOWA 4IEOA 4YARA 4HSLA 4RQPA 4YG0A 5LK7B 4M3CA 1WLWA 4QXKA 1BMV1 5C6CA 1NYWA 1RJ7A 1KRIA 3RYRA 1LR5A 4RGGA 3V0BB 4NO4A 2UWBA 3JB8A 4Q2FA 1LESA 1RC6A 4K1ZA 1QXJA 3EQEA 3J26N 4OZXA 4UW6A 5BNOB 3OPZA 4FPJA 2CGOA 1FMD1 2CAUA 2A3YA 2FHRA 1QOSA 3GF6A 4ZU7A 1RUJ1 3D0SA 1QH7A 2GAUA 3UKVA 5KWRA 2R16A 2ZCWA 1AR83 4EJRA 2Z69A 4YZ3A 5BNNC 1GQHA 3ZFEC 5DUUA 2VQ0A 3FUOA 4MVTA 3MW4A 1AR93 1N3OA 3WQ7A 4UW5A 5FDBA 2VNGA 3NSTA 4YM0A 1LOBA 3ETQA 2Q5TA 2WS93 1NCRC 2JD4A 4CEWC 3FJSA 3RDIA 3SMHA 4YVWA 5DXDA 5FOBB 3U4XA 5A3LA 1QJZA 3L2YA 1Q43A 5JOYA 5T52A 3WDYA 3KMHA 4AGGA 2VMIA 3D6EA 3H1WA 2JX9A 3IN9A 2BGCA 3TAYA 1R091 2C9AA 4HBNA 1WMFA 3ST7A 1QNYA 4ASLA 4DINB 2ZKNA 2XJTA 3WV6A 3R6SA 3E6DA 4E4SA 4B3NA 2WQZC 3NAPC 2PHWA 4XJAA 2W39A 1FMD3 4D3WA 2D40A 3ENRA 1CAXA 1YFUA 2Z2SB 2OUJA 5GLTA 5CB7A 1RUJ3 2RS52 3WXPA 4UBHA 4OHXA 3ZVXA 3MIBA 2ENRA 4COYA 3ZSJA 4DRVA 1QXPA 4E2QA 2AUYA 4Q1RA 1PGSA 3AMNA 3V0AA 2XBO1 1CGPA 1V6LA 1GSLA 1LGBA 1VBD2 3NWKA 1W6NB 4LE4A 3IWZA 4XFGA 1ND2A 4COZA 3HD8B 4PLNA 4YZ5A 1VR3A 4RSUA 5DUXA 1B09A 4FQ4A 3MIFA 4MGKE 3TWIA 5ABJC 2PTMA 2GH2A 4DOUA 4XFBA 4EN9B 4P9WA 3WW2A 1AR62 4HSJA 1G9CA 3E6CC 4IEQA 1O3RA 1W0PA 4WV8A 2DVDA 5JIAA 2ZA9A 4G9SB 3Q9OA 1H8TA 4Q4W2 2YZ4A 4RGAA 2WNVA 3I7DA 3CU7A 4CZSA 1GV9A 1Y3TA 4M00A 3VZKA 4AK3A 1ND3C 2DWRA 1R093 2FBEA 2ZZQA 4Y1UA 4HVRA 1GNHA 1S0DA 4IESA 4QPYA 1C28A 4GKXA 3EO6A 1LB2A 4Q1PA 2QJVA 3HWJA 3WX5A 1ULEA 4AEKA 1PGL1 4GWNA 3AX4A 4QX5A 4A3XA 3J9SA 1GR3A 1H9WA 1PVC2 2P37A 3A0NA 1HV1A 3LOBA 1H2MA 2ZGPA 4LE3A 1PK6A 1PGW1 4P9YA 3WOGA 1JYCA 4MGYE 3UKNA 1YIPA 4ATEA 3CEWA 4R9DA 3O14A 4EN6B 3VL9A 1Q56A 5BNOA 3ECQA 4FPHA 4MLOA 1TMF2 3ZSKA 3SH3A 2XBO3 5IT6A 1YI7A 5CAZA 3O12A 1YNAA 5GZCA 4XHXA 5BNNB 3ZFEB 4EN8B 1G86A 1G9FA 4NN0A 4Y1ZA 1X36A 3OF1A 4I0WB 1PVC1 5A33A 4BIOA 3SITA 3RWNA 1IPJA 3TYJA 1KQRA 1ASJ1 3WG4A 1W6OB 1FOD1 1NCRB 1GZWB 4CEWB 1CIWA 1F2NA 2GC2A 3LB9A 4N9HA 4AI1A 3BODA 1JUHA 2ETEA