3UJQA

Galactose-specific lectin from dolichos lablab in complex with galactose
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
253
structure length
253
Chain Sequence
b'ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKEDEENKLAIFNLEGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 41
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ujqA00
2W52A 3M3CA 4FPFA 3AZYA 3B00A 2A5ZA 4YW5A 2EIGA 5SV8A 3I8TA 3HN1A 3N7LA 1LHVA 4LBMA 2E7TA 5KXBA 2DYCA 3B01A 5DUWA 4GXLA 3ILNA 1URXA 4YZ1A 5IK5A 2JE7A 2D44A 2I2SA 3NV2A 5DG2A 5GLTA 1LGBA 5DG1A 3WDTA 1S0IA 5BYNA 1AVBA 1W6QB 2CY6A 2ENRA 4LBJA 1BJQA 1AX2A 1N3PA 3R4SA 1V6MA 3WUDA 1HLCA 2NMOA 3FBYA 1LODA 4FVVA 4GA9A 1VLNA 3V65A 4FP2A 1CN1A 1ULGA 4XDQA 1FAYA 3SH4A 2A6VA 4Y26A 2DTYA 1AZDA 2RHPA 3WDWA 3UJOA 2JDZA 3HMYA 4F83A 3OBRA 2EXKA 3AX4A 3MW3A 2VW0A 3L2YA 4XE9A 1AJKA 2R16A 3WZ1A 2EAKA 3AZXA 2D6OX 5DZEA 2WT1A 3SITA 2ZAAA 1AX1A 4L8QA 3LCPA 1SLTA 5IK8A 2ZHNA 2CYFA 5GLUA 4M3CF 3RMXA 2P34A 1WLCA 3ATGA 1S0DA 5IUQA 3AK0A 3D4KA 5GALA 4FPOB 5T5PA 1LCLA 4Y22A 1WD3A 1ZA4A 4FPHA 5KXCA 2E6VA 2YV8A 2DUQA 4XJZA 1GKBA 3AP6A 4Q27A 1LOFC 2ZGRA 3VKFC 4XJ8A 2NMNA 4TYSA 1IKPA 1WLWA 3O0XA 1WW7A 1Q8PA 3ZYRA 4YZ3A 1LTEA 1LU2A 1KJRA 2UURA 3AYDA 3T2TA 2D7FA 2WNEA 4YGEA 1F31A 2ZGUA 4YFZA 1UZZA 1AXYA 2VH9A 2XB6C 4DRRA 5HCAA 3AYEA 3MEPA 3O0VA 3RQ0A 1GLHA 1LOEA 3AZVA 1HQLA 1G9BA 2JECA 1KITA 5LK5A 1CPNA 2SBAA 1WBFA 3ZSLA 1VALA 4DS0A 1LOFA 3POSA 4Q1RA 4SLIA 2YZ4A 1AF9A 4YG3A 3WG2A 3OYWA 2ZMNA 3V0AA 3IPVA 4D69A 1UN1A 4XIOA 1MS4A 3AP5A 3WDUA 3WVJA 1ONAA 2ZGQA 1AJOA 3NV1A 4BQ1A 4XBNA 1MS1A 5DUVA 3CNAA 4YZ2A 3ZSKA 1LECA 4LBQA 1FNYA 1KJLA 5H9PA 2A7AA 4ITCA 2A71A 1LU1A 3PVNA 4XTPA 2W39A 3FUOA 3VKOA 1JW6A 1S0JA 2D3SA 3WCSA 3ZPYA 4Z8BA 1W6OB 2KM2A 1JBCA 1KDMA 3AP4A 3ZXFA 3R4UA 4OZXA 1WUVA 1HKDA 4XJWA 3AXDA 5L73A 1GICA 4ATEA 1S0CA 2DUPA 2YXSA 2DUOA 3BOPA 1ULCA 3N35A 1LEDA 4XMIA 1G9AA 1GBGA 3WG1A 4Q8KA 4FOYA 4P9XA 1N47A 4PQ9A 1G7YA 2EXJA 2ZHKA 3W58A 4XMAA 1Q8VA 1D2SA 1MZ6A 3A0KA 1MS8A 1SCSA 4U2AA 1QU0A 2E7QA 2A3YA 5T54A 5GZEA 1IKQA 1KDKA 2EALA 2VY0A 3AP9A 5JVVA 4AYUA 1I3HA 4XJAA 3UL2A 3SH5A 3TAYA 1I1EA 1CR7A 1JXNA 3OJBA 1LGNA 1N1SA 1Q8OA 2NP0A 3U4XA 1O4ZA 2ARXA 4LBLA 1G9DA 1ULEA 2P37A 2PELA 4R9BA 5E89A 1LOGA 3N7KA 3MW4A 2H0BA 1DGLA 1LHUA 2P3JA 2UWBA 1HQWA 2JJ6A 3FFZA 2P3IA 1ULDA 2AR6A 4YLZA 2D43A 3MW2A 3AYAA 4H55A 2VU9A 4R9CA 3WDXA 2DTWA 1LJ7A 4Q2FA 3T1LA 3H0OA 2BQPA 4M3CA 1GZWA 1MVEA 1BQPA 5H9QA 2PHXA 5GZFA 2A70A 2TEPA 3N36A 3NWKA 4BLJA 2ZHLA 3ZSMA 5JOZA 4YM2A 1B09A 3WHUA 1LHOA 1QOSA 2D6MA 1MACA 3ASIA 4YGBA 1AX0A 5AVAA 4JRAA 1UMZA 2EF6A 1Z78A 1W6NA 3ENRA 3V0AB 4TZDA 2CL2A 4GWMA 3IPVB 2GNDA 1QDCA 2WSVA 3IKWA 1IS3A 2GMMA 1C4RA 1LEMA 4FPCA 2ARBA 3A4UA 4IQPA 4XXPA 3RSJA 4RL7A 5EYYA 4AVSA 3OBTA 1SFYA 4YW1A 1DQ2A 1QNWA 4UW3A 3SISA 4HANA 2GNMA 1FV2A 1V6JA 2ZMLA 4R9DA 4WV8A 1S0EA 1UKGA 1RIRA 2VXRA 3FLTA 4YZ4A 4ASMB 5T55A 3UK9A 1LOCA 1LENA 3WV6A 3V0BA 1FV3A 1YO8A 2DU0A 2EXHA 3O5SA 1KQRA 1NLSA 3Q9OA 4LBNA 1RITA 3WOGA 1SBFA 2AUYA 1WCSA 1YXWA 3LSDA 5GLZA 2ZA9A 1GANA 5CB7A 1SLIA 2D3PA 1BZWA 3OGGA 1RINA 1Q8SA 4YW4A 3RS6A 2ZACA 3I4IA 4Q26A 5E88A 2G4IA 2ZGSA 3POWA 1JN2P 3WDYA 2ZGTA 4LBKA 3VKMA 5DUXA 3VUOA 3WUCA 5GZDA 2A6YA 4XIKA 4YM0A 3O0WA 2DVAA 3WLUA 1BKZA 1C1FA 4FOWA 1X50A 4XOGA 2VUAA 1GZCA 2ZGMA 4DQAA 4ZXKA 1CIWA 1H30A 2PHUA 1V6IA 2WT2A 1G86A 1GNZA 3B3QE 2VW2A 3ZSJA 2YROA 3IMNA 1D0HA 3KQRA 4GKXA 1R1ZA 2NYYA 1Y7BA 1G8WA 3NV3A 2P3KA 5DXDA 2B7YA 4FP3A 4XHXA 1SLBA 2HYKA 1DQ5A 3WG4A 2DWRA 3NV4A 1QDOA 4UW4A 3BTAA 3AZWA 4YW3A 1LULA 5GJ6A 3N3HA 5IK4A 4DPNA 3VV1A 2ZGKA 5F9TA 4Y1YA 1SCRA 2OVUA 4Y20A 4CRQA 5GZCA 1W0PA 1V6OA 1FNZA 2R1DA 1IS4A 4NOTA 4AWDA 2JKBA 3ZXEA 4C1XA 5JLVA 4GKYA 4ISQA 3FUQA 1SLAA 4UW5A 1IS5A 5EXOA 1APNA 1CPMA 2CNAA 1LGCA 3HR9A 2ES3A 4GWNA 4JC1A 1CQ9A 5HCFA 1VAMA 2CTVA 1UPSA 4UW6A 3R05A 2ZABA 1N1TA 3WCRA 1H9WA 1JUIA 1KRIA 4YM1A 1W6NB 4YZ5A 1DFQA 4BLIA 2D6KA 3ZXLA 3SH3A 2R0HA 1GNHA 5CAZA 3JUUA 4AVVA 4FPKA 3UJQA 4CTEA 2WJSA 1XQNA 2E51A 3BIWE 5GLWA 1SACA 2DU1A 4XBQA 4Y1VA 4BPZA 1OFSA 5FREA 2V5YA 1VAVA 2GN7A 3ZYPA 1FATA 2PHTA 2UU8A 5HCBA 1LHNA 1WD4A 3AFKA 4W65A 1J1TA 1ULFA 1V6NA 3AXEA 3M3QA 3V0BB 4R9AA 1DLLA 3RMYA 2DVBA 4XBLA 1QKQA 3A0NA 1OQ1A 3M3EA 1HDKA 4Y22B 4AVTA 4KBBA 5F5QA 4ZKTB 4C1WA 3D6EA 5GZGA 1WW6A 1WW4A 2AENA 3IN9A 5KXDA 2R0FA 4ISRA 4YW2A 2JD4A 3TB0A 2WT0A 2ZMKA 4FPGA 2YMZA 3AJYA 1EPWA 4FPJA 1Q56A 2AGSA 1MS9A 2NN8A 4P9YA 2PHRA 2ZBJA 1SLLA 2CWSA 2C5DA 1LESA 2AH2A 2D6LX 1DYKA 1MZ5A 2CWMA 1G9FA 4XILA 3B69A 5GM0A 4FPYA 3RG0A 3SLIA 5T50A 4YGCA 3M2MA 3C2UA 3GNEA 4DRVA 2GMPA 2ZGLA 1FYUA 1YYNA 4HL0A 5IK7A 3MPPG 5DZFA 1ENQA 3OYWB 4U36A 5CNAA 1AXKA 2E53A 2R1BA 3VKLA 1Z0HA 3AYCA 4FPLA 1MR5A 1CONA 1DZQA 4P14A 1H9PA 4WZFA 4YG6A 2GALA 2XG3A 5DUUA 1S1AA 3N7MA 2GNBA 5GLVA 3GALA 4XHBA 3FLPA 4LBQD 4Y20B 1ENRA 4LBQB 1V6KA 4PBOA 3JU9A 1MS5A 2PHWA 2GNTA 3WDVA 5E8AA 1W6OA 3ZXJA 2DURA 3OY8A 4FOVA 2LALA 4XYXA 1QGLA 3AZZA 1JHNA 5IT6A 2WQZC 4K1ZA 4M01A 2YY1A 1V00A 1S0BA 1JOJA 1WW5A 3DUIA 3POYA 4PBPA 1QNYA 4RA0A 4XJ9A 3VKNA 4LBOA 1GSLA 1GV9A 2UWAA 4MYEA 3QCWA 3ZVXA 2Q5TA 1LOBA 2ZGPA 4K21A 1A8DA 5T5LA 1BYHA 1W6MA 1Q8QA 5JMCA 1W6PA 4M00A 2VW1A 4FOQA 1JYIA 4AGRA 1A78A 5CA6A 4AGGA 5JOYA 3PMEA 4Y1XA 3USUA 1WBLA 4DFSA 2A6ZA 3LSEA 1UZYA 2LTNA 4Y1UA 4JCKA 2NM1A 1JYCA 2WKKA 4K20A 1VIWB 3AJZA 1YRZA 2EXIA 3DGTA 3RRDA 1DBNA 1GZ9A 3AP7A 4BM8A 1ZM1A 1PZ8A 2AREA 1MS0A 1AXZA 3D5OA 3KM5A 1DQ1A 4XXAA 1QF3A 1NXD1 3INAA 5H9RA 3WG3A 2ERFA 4WVWA 5FRAA 3M3OA 1PZ7A 1DQ6A 2ZGNA 4Y24A 2W08A 1S0FA 2OUHA 2OUJA 1W6QA 1LOAA 4YM3A 2NZ9A 4Y1ZA 2JE9A 1FX5A 2DVFA 1CVNA 1IOAA 4M3CB 1GZWB 5KXEA 1F5FA 2GN3A 2GMEA 1QOTA 2FMDA 4YGDA 5T5OA 4FPEA 3OPZA 1SBEA 2A3WA 2A3XA 4Q1PA 2DVGA 1QOOA 4CZSA 3PVEA 3V64A 4XJUA 1LHWA 1U0AA 1UAIA 4Q8LA 2R49A 2P2KA 2FHRA 4ATFA 1C57A 2DV9A 1DQ0A 3WHTA 2V73A 1DHKB 1SLCA 3QLQA 1A3KA 5T52A 4YFWA 1OKQA 1TEIA 3N7JA 2W68A 2ZGOA 4FQZA 2ZHMA 4M3CE 1DIWA 1N3OA 5JDBA 1N3QA 2Z42A 5JOWA 4FQ4A 4GALA 3PJQA 2D3RA 2A6XA 5H9SA 1DQ4A 2A75A 3OY8B 3IM0A 2WSUA 3W59A 3APBA 3PVOA 1CESA 3T1MA 4BMEA 4BOWA 1SBDA 1W0OA 2D6PA 1MVQA 1UL9A 4PF5A 1V6LA 3FLRA 1G9CA 5EYXA 5JOXA 5T5JA 1F9KA 4AGVA 1N1YA 1YIFA 4NO4A 1YI7A 1IS6A 2A6WA 2UWCA 1DYPA 4P9WA 3B9CA 4WVVA 1GYKA 3O12A 1W6MB 4I30A 2OW4A 1ENSA 1W6PB 2AYHA 4YG0A 1PZ9A 3ILFA 1WLDA 4PCRA 5EWSA 2C9AA 1MS3A 2WLQA 4BMBA 1N1VA 1CJPA 1UX6A 2ZKNA 4XZPA 3BODA 1BXHA 2GDFA 2ZZJA 3WNXA 2D6NA 3USUB 4K1YA 2DVDA 1C1LA 3ZXKA 5CBLA 5DZGA 3ILRA 2PHFA 3M1HA 1S0GA 3SNMA 1O4YA 4XTMA 2SLIA 1QMJA
chains in the Genus database with same CATH superfamily
4IV3A 5KBFA 4AI3A 3I2IA 2EIGA 4YW5A 3S30A 2BTVC 3K75B 1GNYA 1QXRA 2E7TA 4JDOA 5KXBA 2XJVA 3U1XA 5DUWA 3UKTA 1H8TA 5LY2A 1QQP1 2OZ6A 1W9YA 2D44A 1Z7S2 2JE7A 3HIFA 4ORFA 1RUG2 1E5SA 1SFNA 3T4VA 3RJRA 2BUKA 2ENRA 1BJQA 1N3PA 4LBJA 5TSWA 3R4SA 1V6MA 4P08A 4RQPA 4WVMA 5A7SA 2NMOA 3WUDA 3U14A 3HJRA 5C3SA 3OUHA 4IE4A 5C5TA 4IE0A 4NVPA 4QU2A 2ZEWA 1FAYA 5JIUA 2FDIA 3OPWA 3OGSA 4ZS3A 3ZDSA 5A6QA 1T6BX 1VBD1 3KV4A 4JV4A 4QGMA 5F3IA 4AQ2A 1LB2A 2IXHA 3UJOA 2JDZA 1VAKA 3O1SA 2ATFA 5FYSA 4BIFA 4AQSA 1DF0A 2BNMA 2EXKA 1JZ4A 3K4ZA 3LZZA 1AR62 1AJKA 4XEZA 3SITA 4NN0A 1ZBA1 4F7ZA 1S2EA 1RMU1 1W8TA 5DN2A 1BK0A 2HWB2 3J26N 5DDJ3 3MZHA 3TWIA 4SBVA 3ROUA 3D82A 5GLUA 3VZOA 3TEZA 3RMXA 2P34A 3ATGA 1K3IA 4E4SA 3D4KA 5GALA 4PLOA 4Y22A 5KXCA 1OBNA 2E6VA 2DUQA 3B9IA 3HT2A 3I2JA 4IE6A 3KV9A 4AHWA 3WW4A 1LOFC 3ZPOA 1HX6A 1ULPA 5FYIA 4H3WA 2XJQA 3LIGA 4FTBA 2NPIA 3OPTA 4LKDA 1YIPA 1WLWA 4AAPA 3U10A 3I59A 2WZR3 3UYJA 1VRH2 2CU5A 1LTEA 3HNYM 4P9IA 3I49A 5EJ1B 4K40A 2PQQA 2UYAA 2D7FA 4YGEA 3NSTA 5C9AB 5FMCA 4D6SA 3VDAA 2QFEA 3HQRA 5A7OA 1NA1C 1OD5A 5HCAA 2C26A 2JDHA 3KMHA 4TTGA 1R081 1XE7A 2ZX2A 1VP6A 1W04A 2WWJA 1LOEA 3WF3A 2JECA 5LK5A 2YDEA 1VALA 2WABA 4R52A 1LOFA 4SLIA 4AK3A 2Y6LA 2ZX0A 4LKSA 2WZEA 3V0AA 4N7IA 2VTFA 2BJSA 2E26A 3Q8EA 1MZFA 1UN1A 4XIOA 3AP5A 1QQP3 4N53B 4BQ1A 3IAQA 1AJOA 3NV1A 1F2NA 4Q0PA 2F4PA 1H2KA 4QPGA 2XJSA 3KS7A 3R0RA 5DUVA 2X53S 3JBG2 5D21A 3ZSKA 5H9PA 1C8M3 3GHMA 4HN1A 3WW1A 2VQ0A 2XWBB 4FT8A 1LU1A 3PVNA 4G9SB 4XW3A 4IV1C 3FUOA 5FV3A 2ADDA 1W6OB 3FZ3A 3AP4A 1L7RA 1PO23 3LE0A 4RR3B 2OYZA 1RVF2 4XJWA 1XB9A 3ZO0B 1GICA 2DUPA 2MEV1 2R073 3I3MA 1ULCA 2QVSB 3BKZA 5JXIA 2WAOA 5K4LA 4AVBA 3THDA 1ZBA3 1E5HA 4PQ9A 1N47A 3DN7A 1RMU3 3W58A 1I5ZA 1TZOA 4W6YA 1MS8A 1SCSA 2WNUB 5HPOA 2QQUA 4QAWA 1W8UA 2RE9A 2EA7A 4IV1A 3FHQA 5GZEA 5I8TA 1KDKA 3W20A 3RDIA 4OI0A 2VY0A 3ZYJB 4FTSA 2Q4SA 3DCQA 1ZBE2 3H1YA 1RUI1 3SH5A 3OJBA 4AEDC 1LGNA 4QDRA 2NP0A 1MZEA 4PT6A 1O4ZA 3U4XA 4MH0E 4AQ6A 2VOXA 1WCDJ 3OB8A 4CCEA 5C4WB 5C6CA 4QPYA 5DABA 1LOGA 2Z79A 3H50A 3MW4A 1DGLA 4AZZA 5A1FA 2VG9A 1HQWA 2JJ6A 3J8F2 4NPRA 3KD4A 1AR92 1HIXA 1HRV2 3USSA 5IATA 1ULDA 2V09A 1XC6A 2D43A 3MW2A 5JPMB 4H55A 2YHJA 2VU9A 1AYN3 2G1MA 2JB8A 1Y4WA 1R083 1AYM1 4E4DX 2HBTA 4WM7A 1OI6A 1MVEA 2OPKA 1QXPA 2A70A 2VZRA 1RUC1 5I93A 1XNTA 5FQ0B 3U07A 3ZSMA 4M4PA 1BBT2 2D6MA 4OI2A 2W91A 1W06A 1KEXA 5AVAA 4ZU5A 1UMZA 3HT1A 4A41A 1Q43A 1H2NA 1HXS2 1TVGA 2IFRA 1XYOA 4LXLA 4XURA 5A32B 1US2A 1LEMA 2GMMA 2JIGA 4FPCA 3A4UA 1ZRDA 1NAEA 4CVUA 1V9U1 4A3XA 2KR2A 1J1LA 2QBXA 3AMQA 1DQ2A 3LIHA 1OUXA 5FXVA 1FV2A 4R9DA 2R7EB 1UKGA 2NQYA 3MIDA 4K3UA 1OC1A 1XSRA 3FLTA 4ASMB 2FDFA 2VNVA 1H4GA 3KT7A 3ACGA 3OUIA 5CFDC 3O1RA 1LOCA 3WV6A 3AVSA 3LFMA 2EXHA 3O5SA 2WLPA 4LBNA 3WOGA 3PHMA 3LSDA 1AR82 4OUEA 1YXWA 4PDWC 4MZUA 5HV0A 3S57A 2B9VA 1UYXA 1NXMA 1UYPA 5J1XA 3S0MA 1VBA1 3T3YA 2XHKA 4UFHA 2F17A 4PF1A 1TMF2 4O7XA 3RS6A 2ZACA 4Q26A 5E88A 2VZVA 2LUWA 3UESA 3F95A 1RUD2 5A7PA 3MLKA 4LBKA 4MLOA 3I2HA 3VKMA 1OT5A 2DFBA 2VTXA 4IEPA 5GZDA 4KWKA 5IFPA 4DIQA 4XIKA 1RUI3 1IPJA 2ZZQA 3J7NA 3WF0A 5CFDA 2D98A 4KG8A 1C1FA 5FPBA 4XETA 3OTFA 1GZCA 2ZGMA 4ZXKA 5ABJB 3LWCA 2KXLA 4PDWA 5JPNB 5J98B 5CU1A 2GH8A 1FPN2 1S55A 4CP9B 1VBE2 1PK6B 2Y0IA 2BFUL 2XH6A 2OIIA 2WWUA 3IMNA 3VBRB 3URFA 1G8WA 1Y7BA 3NV3A 3TEWA 5FBZA 5IW0A 2RS12 3LOIA 1NZIA 4D6RA 2B7YA 4FP3A 2HYKA 3CIHA 2DWRA 5FTTC 5LEKA 4Z2WA 3UGFA 3TEXA 3GCWA 3SEEA 3BPZA 4TLGA 5F1RA 5LASA 4MOAA 3LGRA 3LF7A 1AYM3 4CXWA 5FWJA 2ZX4A 5F3EA 5GJ6A 1UO9A 4OHYA 4LIUA 1SCRA 4CRQA 1RUC3 1V6OA 2VMIA 3IT8A 4QX0A 2RS33 2R1DA 2RR13 3THPA 5A3OA 4C1XA 2O8QA 5A7QA 4EE2A 3MO4A 1SLAA 3KCYA 3KCCA 4UW5A 3SXWA 4QX3A 1APNA 5E16A 4LHKA 1OURA 1UY0A 3GDBA 4CA9A 4UAPA 1QJU2 5FY9A 2ZABA 5FZ3A 1PGL2 1N1TA 1H9WA 1R092 1MQTB 3K3NA 3O7OA 4E4HA 1KRIA 4YM1A 1VJ2A 2JWPA 3KT4A 5APAA 4QXKA 1ZRRA 2YPDA 3ZXLA 2WRAA 3SH3A 2R0HA 4GULA 4XUNA 1AL23 1X8EA 1FOD2 1NZCA 3UJQA 5IVEA 3HEIA 5JZGB 5BY5A 3ELNA 1XU2A 3OEBA 2E51A 2B45X 1SACA 2BNOA 1R1A3 4UWDA 1JZ6A 5AC92 5I0SA 3BOWA 2CGPA 4F8AA 5FREA 2AEZA 2GN7A 3ZYPA 2UU8A 1H4HA 5C9AC 1WD4A 5FZFA 1KFXL 1D4VB 2IUWA 1HB4A 4R9AA 1DLLA 2P6CA 4INDA 3C7OA 3BB6A 1WCUA 2B8MA 3VBSC 1UYYA 1OVPA 1UQXA 3KCXA 4YVSB 4AI8A 3ZIWA 5F5QA 3FFQA 4JHTA 3BPSA 3AVRA 1ND2C 4V1PA 5GZGA 1NQJA 4B29A 5FLIA 5FK8A 2FDGA 1BEV1 2WO7A 1OPMA 3TB0A 4AI1A 4BZ4A 5BXXA 4YSFA 4FPGA 4N53C 5JR7B 2YMZA 3AJYA 5C9AA 2WNVB 2XLGA 3G7DA 3MHZA 4XF3A 4P9YA 3DYMA 2CWSA 2N7GA 2PAMA 4LO7A 3THTA 3T08A 4R4ZA 3VBSA 3LFIA 2HWD3 2CWMA 1G9FA 1ASJ2 3B69A 4XILA 2BPA2 4FPYA 3RG0A 5T50A 4YGCA 1ND2A 3C2UA 4CPBA 2XJUA 1PHMA 1O8SA 2W1WA 4HL0A 4AF9A 5CISA 1F8VA 3Q8FA 1UCXA 3N9PA 4QQPA 4U36A 4N53A 5FZ4A 1LNSA 1AXKA 1XYPA 2R1BA 4D8MA 3AYCA 1E5RA 4FPLA 4WZFA 4AE2A 4EYUA 3N7MA 2E33A 3VB9A 3GALA 5IVJA 3ALQA 4A7YA 3LEKA 4ZU4A 2WNUC 2W87A 4GB31 3JU9A 1MS5A 4RS5B 5I0TA 5BUVA 1HB2A 1PO11 1W6OA 5FYUA 3OY8A 1W3VA 3ZXJA 2W9XA 4UFIA 5FYVA 2VQUA 5A3WA 2VOVA 1OOPB 1JHJA 1BCXA 2O14A 4M01A 3RZZA 4GAZA 3SHRA 4CU7A 1JOJA 1WW5A 2C1FA 1DZRA 4QB6A 5FYHA 3POYA 5C4WC 3NO8A 2BWCA 4Y5SA 4BXFA 5FLJA 1GSLA 2LM3A 3N9OA 3E6CC 3QCWA 3WNLA 3PLQA 3FMGA 1LOBA 2ZGPA 4V2VA 3OD0A 4D6QA 2WNUA 3SC7X 4Q4Y3 1KS5A 1Q8QA 3IBMA 1W6PA 3TN91 3VBOC 5JMCA 1DGRN 1IPKA 4YNIA 2VW1A 4XCAA 5ACA1 4AGRA 1A78A 1K42A 1G6NA 4N9IA 2JDYA 4AHXA 4XABA 1NY71 4DFSA 2ZXQA 1XNDA 3GCXA 3WP5A 5L19A 4HSJA 1JYCA 3QH6A 3PTYA 1PIV3 5C4WA 5FP4A 3DGTA 1CWPA 3IIIA 3IB3A 1YNAA 1UX7A 2Y6JA 1QJEA 1BEV3 1ZM1A 2HWB1 1PM4A 2XUEA 4XF4A 2WBKA 2PFWA 1POV1 1W8NA 3AFGA 3VBOA 1DQ1A 3ZYBA 4LK6A 3UGHA 1QF3A 5FZ0A 5H9RA 2Y0OA 3R4DB 1UXXX 2VUJA 4HONA 1ZX5A 1H1AA 5IHRA 1UY4A 1K45A 4MXWB 1W6QA 1LOAA 1ZZ7A 3CEWA 2DVFA 1BHGA 4LLOA 1GZWB 2GN3A 2RJ2A 4XQ4A 2FDKA 5FPVA 1PM7A 5K0UC 2B9UA 1HN0A 4CPBD 2JICA 4ZHNA 1CZSA 1XNCA 3PVEA 4CZSA 3RVHA 1YQ8A 4Q8LA 1WWYA 3TNPB 4JRLA 4ATFA 5A32A 2X10A 1C57A 1I6XA 2DV9A 5FZ9A 3RYKA 1RUF2 3RWNA 4ARXA 4B4QA 4BQ5A 3W9AA 2R063 3GZAA 1ODMA 5FKBA 4YFWA 3AMHA 3N7JA 4XQDA 2DCJA 4I0WB 4M3CE 4RN5A 5AFEA 1PO13 1VBC1 4OFGA 3ZN6B 4I09A 4IEZA 3ON7A 1OPOA 3FWEA 2A6XA 4CCJA 4RHV1 5K0UA 5LCWL 1AUYA 4J1XA 3T09A 2YC4A 4BQ4A 3VL8A 3IM0A 2WSUA 5EV7A 5F5CA 5ABJC 4BMEA 3T1MA 1NE6A 5BNQA 1SBDA 1Z7S3 1RUG3 1RXGA 2XWJB 1PK6C 2D6PA 5CIRA 4BQYA 1UL9A 1OVSA 4AEMA 1BMV1 4A42A 3VBRC 1G9CA 5EYXA 5JOXA 2FQPA 1OLRA 3ZSEA 4BE3A 2OT7A 2VL4A 5M0TA 1XBFA 4KGQA 4EROA 3AKSA 1UZ0A 1TME2 1YWKA 3B9CA 4P9WA 2J1SA 4S2DA 2JDKA 1ENSA 2ZX3A 4IE7A 2WR9A 5EWSA 4AR2A 4PCRA 2C9AA 3N9MA 1HRI1 1N1VA 4D0QA 3MPBA 4GWJA 2GP5A 4B1LA 1PMHX 4HN0A 5CZKA 2GDFA 3KWVA 1Y9GA 1MEC2 1AR63 1H2MA 1PK6A 3AL6A 3ZXKA 3IDBB 4ZONA 4CEWB 4ZXEA 3SNMA 1A34A 1POV0 2HWB3 3WP3A 5FR3A 1QMJA 3KHCA 5CEHA 1POV3 2UY8A 4NRQA 3I3EA 3KHBA 1OA3A 3M3CA 4NAOA 2JDUA 4OCTA 5F6LB 5A7WB 5A3MA 4M4RA 3PU3A 2HWF1 3V56A 4A7ZA 5HXMA 3I8TA 4AFBA 4AFCA 4LOSA 1LHVA 1ZBE1 3L2HA 4LBMA 2VULA 1UMIA 4PQQA 2EAAA 5FMBA 3ETQA 5JZGC 3WNPA 1URXA 4YZ1A 1FMD2 3NV2A 5DG2A 3WDTA 2YPJA 4CCDA 1LGBA 2VOWA 1S0IA 4FFGA 3ZOIA 2C9KA 4PLNA 5JMOA 2HJIA 4LHSA 4DO0A 4MGQA 5A7NA 1VRH3 3FBYA 4CCNA 2XDVA 1JI6A 3VD9A 4H2AA 2UYBA 3V65A 1QJY1 2XOMA 4JGYB 4XUOA 2Y26A 1RUJ2 3HN3A 4YVWB 1QJX2 1S4CA 2A6VA 2VNGA 4NRPA 1TNRA 4Y26A 3VHPA 4IUGA 1AZDA 2RHPA 4ZY9A 2O0OA 4YVSC 4IDZA 3SKJE 5JZGA 4QHOA 2I74A 3AX4A 3L2YA 4GH4B 1XNAA 2WFF1 3AZXA 4TLFA 3AB0A 5DZEA 1AX1A 2XJPA 4RHV3 3PUSA 5A3LA 2VBPA 3KGZA 5AFBA 1SLTA 2WNVC 2OQ6A 3D3AA 3ES4A 1MPXA 2HBUA 4M3CF 2QE3A 2LRPA 3BCWA 3LQCA 3VGIA 1HJGA 4QQHA 4W6XA 1EPZA 1OHFA 5T5PA 1WD3A 4YVSA 4NHLA 2RS52 5LEJA 1EAH2 1W05A 2YYOA 3IIAA 3JD71 2VQTA 4Q4W2 4BQ2A 3Q8CA 4LQRA 1SFPA 1HRI3 3O0XA 1NLRA 4IL7A 1RVF3 1ZZ9A 2WNVA 4YZ3A 4FFHA 1PX3A 2HEWF 1KJRA 3BU7A 4I2OA 4YFZA 3VZMA 1P8JA 3HQUA 3OG2A 1AXYA 2GC2A 4DRRA 3TYJA 3C7GA 2JKXA 3AYEA 5IAXA 3SMHA 1C8NA 2ARAA 1OLME 3OOXA 4AHZA 1OUSA 2LW8A 3MIHA 4DEQA 1Y3TA 2VTXJ 1KITA 4EN8B 2DBIA 3VDDB 1WBFA 4K8RB 4CDWB 2KD7A 1K5JA 2RMU2 3ZYIB 2QQVA 1AF9A 2IXCA 2J22A 1ZBE3 2Q0AA 1PX4A 3WP6A 3HOBA 3IPVA 4XFBA 3RZHA 1VMHA 4FFIA 1MS4A 1ONAA 5LATA 1I9RA 4WZCA 1LECA 4ARYA 2A7AA 4ITCA 1CAXB 5I8YA 3AKRA 3MLLA 3ES1A 3POGA 1IPSA 3O1OA 1S2KA 1WMXA 2Y6HA 5F3CA 1UY3A 2CV6A 3ZFEA 1JW6A 4Z8BA 3ZPYA 1W8OA 1JBCA 5F32A 3C7HA 3D0JA 1WUVA 5L73A 3WQBA 1POQA 3H8XA 4EWEA 3N35A 1GBGA 1BBT3 2Q1FA 2AZ5A 4P9XA 3ZXAC 4EWAA 2EXJA 5K8SA 4XMAA 2Z2SB 1D2SA 3A0KA 5FAXA 3G6JB 3H1WA 2E7QA 3JB4C 2VUDA 4U2AA 1VB4A 1HXS3 2XJTA 4B7KA 2A3YA 2VZSA 3CKHA 1PGL1 2EALA 2MHFA 4E2SA 2WZR1 3LB9A 1GFF2 3FE5A 1RJ7A 3MIEA 3C8XA 4HG6B 4K8FA 1FI2A 2R30A 3UL2A 4ES9A 4IEUA 1SHWB 1UU6A 5EFUA 1CR7A 1JXNA 5LW9A 2RM22 1Q8OA 4YW7A 5FP7A 1ULEA 3CJIB 4O9EA 2P37A 2PELA 2WN2A 5A33B 3H3ZA 4QXBA 1Q5OA 1GWLA 2H0BA 1QIQA 4NAMA 2G9ZA 3WY6A 1GUIA 4S2FA 2BBAA 4GD4A 1RXFA 3GGLA 2P3IA 1OH4A 3SEPA 2RDNA 5FKCA 1AR83 2AR6A 5F5IA 5BNPC 4COYA 5C3PA 4QKDA 3WNMA 5FMOL 1O3TA 3WDXA 1LJ7A 1IQDC 1TMF3 2YGMA 3WX5A 2XKPA 3J7HA 4Y4RA 5FZ1A 1GZWA 1BQPA 4E8DA 2ID4A 1RUD3 5GZFA 3FX3A 3I97A 1JZ2A 1C8M1 1F35A 4BLJA 2WUHA 2VNRA 2V4AA 4BJ0A 1UOGA 5A80A 3WHUA 4LMFA 1LHOA 2B5HA 3ASIA 4QB2A 3N4MA 4YGBA 1AX0A 3FHIB 2EF6A 1J83A 4LUKA 1W6NA 2HWE2 2VCBA 4KQ7A 1PO21 1RHI2 4GWMA 2WSVA 1E5IA 2ZEXA 4RGAA 1VBE3 1ALYA 3RSJA 1IG3A 4IQPA 3WSOA 3FN9A 3PJYA 4XXPA 3PVBB 2R071 2Q8DA 3RZJA 5F3GA 2RS13 4AVSA 2I07B 3ZXGA 5CKNA 3RZLA 3OBTA 2XJRA 3SISA 1QNWA 2PLV2 2IC1A 3MFCA 5L7OB 2E63A 2Y64A 4CCOA 2ZPXA 1RIRA 2VXRA 5FYBA 3FBMA 3DPRB 4J25A 4LA3A 5T55A 2WO3A 2P17A 5FYMA 4MV2A 4HBNA 3V0BA 1FV3A 1YO8A 1KQRA 3KB5A 3MUZ1 1M4WA 1RITA 2K2SA 3ITQA 1WCSA 4AL9A 5HBAA 1RC6A 2JDAA 2ZA9A 1HJFA 1PGW1 4HKWA 4QHZA 1VBB2 1W03A 4X6RB 1Q8SA 1IHMA 2EICA 2ZGSA 2A1XA 1QJU3 4EN6B 4C91A 1R093 5L9BA 1PNGA 4L92A 3WNOA 2A6YA 4YM0A 4MX3A 1Q3EA 3O0WA 1NLQA 2BU9A 1BKZA 1AR72 4XOGA 4MVTA 5IFTA 4DQAA 1FOD3 4D7TA 1CIWA 1ZZ6A 1AYN1 5LA9A 4CEYB 2WT2A 1G86A 4L9BA 2XBO2 5BNPB 1EV12 1UW8A 3RGBA 2YROA 5AC93 4JGYC 5A7WA 2VMCA 1ODNA 4YVWC 3ZDVA 3KGLA 3LA2A 1REFA 3WG4A 2WC2A 3NV4A 1AL0G 1RUNA 4NHYA 3MV01 1UOJA 4CUCA 2UY9A 3DECA 1AHSA 3BTAA 4UW4A 3PUHA 3I2FA 3ZFGB 2RG4A 3ZKYA 5CG9A 2FCUA 3T2OA 4DPNA 5C71A 4GH4C 1W2UA 4NHMA 4Y1YA 4MG2A 5AVPA 4CDXC 1B35B 1W0PA 1NA1A 2JD9A 2WS91 2YGLA 3GBGA 3POFA 4NWVA 4NOTA 4EQVA 3W5NA 4NIDA 4QWNA 4GKYA 3FUQA 2J1AA 1IS5A 2W1QA 2PHLA 1CQ9A 1X8MA 4HKOA 4JGYA 5C3RA 3I2GA 2WYSA 3K2OA 3R05A 3DYPA 4YVWA 4HMZA 5E6HA 5KWRA 3BUCA 3WCRA 4LHNA 4YZ5A 1J58A 1DG6A 2ZTNA 2JG9B 1ASJ3 4XFIA 4DXSA 4GH4A 3JUUA 4AVVA 4CDXA 4CTEA 2WJSA 4DINB 1LKNA 3BIWE 1HV1A 3QH7A 4L2NA 1GWMA 3WW3A 4N8MA 4IE5A 4XBQA 4Y1VA 3AMPA 1XYNA 4URTA 1NCRB 1VMJA 4MSVA 5HCBA 1UMHA 3PUAA 4CSWA 1DGWX 3AFKA 3MGUA 3AXEA 3PTRB 4GZ9A 3VBHB 2Y8KA 4ZS2A 3A0NA 3J7LA 1OQ1A 3VDDC 5LA2A 4CDWC 4XQWA 4LULA 1JYNA 2QQLA 3VHOA 2E31A 3I2KA 4HPKB 5CKQA 2YFZA 1CIYA 1WW6A 5JSPA 1WW4A 1YJLA 1EYBA 2AENA 3IN9A 2R0FA 3JCIA 1W28A 4HKLA 3FJSA 1O91A 4H14A 1RUH2 4FPJA 2X09A 3ZX7A 2EIDA 2NN8A 3VBUB 2PHRA 3ZR5A 1YLLA 4LPLA 2QNKA 4IERA 4AEDA 2HKXA 4JTNA 1M06G 4XAEA 4CCCA 2HEYF 3VDDA 3WNKA 4EWDA 2RS31 1QXJA 2FMYA 2RR11 2Z69A 5GM0A 4CDWA 1TME1 3GHNA 2GMPA 2ZGLA 1FYUA 4QXCA 3I3BA 4COWA 4YWAA 2X8KA 1T2XA 3NNMA 2XLFA 1T6GC 1JH5A 1OH3A 2XQRA 4D7YA 3UKVA 4JTOA 1UD1A 1WLTA 4JVAA 4PJYA 1TQ5A 3VD7A 3T0BA 3LEGA 1MEC1 1Z0HA 3HQXA 1MR5A 2WS93 5FY0A 5C5UA 5JXGA 1EP0A 4CDUB 5KHJA 5FZCA 4LO6B 4Y20B 1AL21 1ZYBA 1V6KA 4LBQB 2ORZA 3H7JA 3LDKA 4DY3A 3WDVA 5E8AA 2VMGA 1O5UA 4ZU7A 1R1A1 2VVEA 4H7MA 5JSOA 4J6GA 1L7LA 1UNBA 2J7MA 2WQZC 1OQEA 2VGDA 1EUTA 2HWC2 1X36A 1X9PA 2WNOA 4ASKA 3CJIC 3DUIA 4GQ7A 3ZM8A 1O6UA 1QNYA 5A3NA 1RUE2 4A7KA 1A8DA 4AHYA 4Q29A 1NX9A 5A3PA 2YU2A 2P1BA 4MHUA 4M00A 3ACHA 1HB1A 5FZ8A 1W9WA 1I5PA 5CA6A 5JOYA 2FDJA 4LE4A 5FY8A 5DAWA 1UZYA 2PXJA 4Y1UA 4AXOA 1F5JA 5JUVA 2WZPP 5J09A 5FZOB 2QDNA 4KWJA 1O7FA 5LBEA 3RRDA 4BIOA 4URAA 2HWD1 3NJYA 5JXHA 4BK4A 3I3DA 2BFUS 1MS0A 3CHXA 4PHZA 1K5MB 3INAA 1NXD1 3H42B 3WG3A 2VCAA 2WQ4A 4BISA 4Y24A 5FO8B 1S0FA 1YCIA 1SZBA 5J7MA 3O1VA 1LRHA 1VPHA 4K7JA 4KBZA 5J96B 2JE9A 1EAH1 4Q4V2 1TME3 5FXZA 5L7OC 4M3CB 1F5FA 2Z5WA 1QOTA 2QQJA 2WDBA 3DPRC 4K9SA 5T5OA 4QXHA 4YGDA 4COVA 2HEVF 4IEOA 2YBPA 1ZA7A 3OPZA 5KC6A 2BV4A 2IFWA 3LEIA 3PIJA 1YI9A 4Q0VA 1JU4A 1MEC3 5KR7A 2XMLA 1OQDA 3BGAA 1ENXA 4OQ9A 5JR2A 1DHKB 1SLCA 3QLQA 5T52A 2OKXA 4E2QA 1OKQA 1QEXA 1TEIA 4JKKA 3VHRA 1ULOA 3B02A 4FQZA 1H0BA 2QQOA 1DIWA 2RJLA 5JDBA 2Z42A 1NCQB 2IXKA 4HXCA 3DPRA 4Q4Y1 1F15A 1GOGA 5CYYA 5FZAA 4AG4A 4P9JA 1HQNA 4HSLA 3W59A 1JZ5A 4BOWA 5BV6A 3NW4A 4WBBA 4KWUA 5C3QA 5IVCA 1MVQA 4PF5A 5F8PA 2Y6FA 4QDQA 3T2PA 2VZ3A 3BALA 3PU8A 3HPNA 1W90A 5EJ3A 1F9KA 4ZZ8A 2RJKA 1PIV1 1REDA 4AQTA 5T3NA 1D4M2 3OGVA 4NO4A 1YI7A 1IS6A 2A6WA 3NAPB 1DYPA 2ETEA 4LEJA 4WVVA 3O1PA 4KWLA 1RUJ3 4LE3A 1W6MB 4I30A 2OW4A 4MO3M 1QJX3 4XUPA 5FZKA 4YG0A 4CU8A 4DNYA 1YQ2A 2VMHA 3KV6A 1UX6A 3ZLIA 1XOYA 1US3A 4XZPA 3ACLA 1B35C 1U5ZA 3BODA 2ZZJA 4JGZB 2JE8A 1YQCA 3USUB 3UETA 3ST7A 4K1YA 5J36A 3B5LB 3K4DA 3ILRA 5DAPA 1QQP2 4LHLA 1O4YA 1REEA 3NNGA 4RR3C 1VRBA 3AZYA 2OS2A 2P6HA 3B00A 3MF6A 5SV8A 1JU3A 4QX2A 3N7LA 1TG7A 2JG9C 2P4EA 3WQ1A 3B01A 3KLSA 1VBD2 1B35A 1EAH3 2RM21 2G9FA 2BOJA 4NJ4A 5IK5A 5GLTA 4KMQA 2R061 1UY2A 5DG1A 5IJRA 3OUJA 2B46X 1AVBA 5BYNA 1JODA 2CY6A 1AX2A 2B39A 1JZ3A 3VDBA 3PMSA 1HLCA 1NCRC 4N43B 4GA9A 1VLNA 3GM8A 2TNFA 4QU1A 4RR3A 4FP2A 4L99A 4MGSA 1CN1A 4XDQA 4NUBA 3H1MA 2R32A 2JXAA 4IGQA 3QOPA 4YPJA 5G04L 4CU6A 2VOTA 2VVDA 2ZCWA 4XDOA 3GZEA 3WDWA 1Z7S1 4F83A 1RUG1 3IAPA 3OBRA 1YQ5A 3I7DA 2RMU3 2VW0A 5E1RA 2R16A 3U0ZA 2EAKA 2WT1A 3O1MA 2ZAAA 4L8QA 3LCPA 3WQ0A 4LR4A 2PA7A 3KSCA 2IXLA 4JZRA 2XHNA 4OHWA 4BA6A 2HWE1 2ZHNA 4GJZA 2CYFA 4IEXA 5IK8A 1XSQA 3Q8BA 5F5AA 3VBUC 3GJAA 4Y5TA 3GJBA 1S0DA 2EIEA 2W5FA 3KVBA 1CD3G 3AK0A 1WGPA 4G3YC 2PAEA 4FPOB 4E4ZA 2Y34A 1JZ8A 1LCLA 4CE8A 1ZA4A 4BYYA 2BRTA 4NROA 2YV8A 4RSUA 4XJZA 1AR61 5C8CB 1J3PA 2CHHA 2W2IA 3AP6A 4D7SA 2ZGRA 3JXSA 5DAVA 4XJ8A 2NMNA 3PUIA 3WR0A 1IKPA 1Q8PA 3ZYRA 4W8JA 3T0DA 1LU2A 2UURA 3AYDA 3PUQA 2WNEA 5EPAA 4GMP1 3EHKA 2ZGUA 1BK1A 4ZZ5A 1UU5A 2BW8A 2VH9A 2VZTA 1DYOA 2IVJA 4A2UA 4BWOA 4K6BA 4DY5A 3MEPA 5KHGA 5LBBA 3O0VA 5FQ0A 3RQ0A 3RWKX 3AZVA 1HQLA 1OF4A 4Y33A 1IG0A 3ZSLA 1CPNA 2PTMA 2SBAA 2D40A 1GMMA 2PN5A 3E5UA 4BH9A 1A8MA 4DS0A 3POSA 5HI0A 2YZ4A 3AL5A 3WG2A 1VRH1 4N9HA 1XE0A 4ZPIA 5LBCA 5FOJB 1GQHA 2WWSA 4DZGA 1D7PM 2RM23 3VBFB 2ZGQA 4QD2A 3LOBA 5FLHA 1MS1A 2XBO1 1EV11 1FXZA 3CNAA 4I3PA 4YZ2A 2MEV2 2VBDA 4LBQA 1X82A 4OVEA 1U5XA 2HLEA 1YFXA 1YFWA 2W39A 2HH9A 3VKOA 4A3ZA 4DEVA 3WCSA 3H8UA 4XAAA 2QZ2A 3ZXFA 2Q1ZB 1ZRIA 4XUQA 4CXYA 4Q4X2 4ATEA 1S0CA 4RGGA 1NOVA 3JBG1 2YXSA 3AKTA 2WA4A 2JDNA 3BOPA 4LOTA 1J84A 4XMIA 1G9AA 4PI0A 4Q8KA 5JI7A 2ZHKA 1K5MC 2HWE3 1QU0A 3N9QA 1PVXA 1W9TA 3H7YA 2DCZA 5T54A 1RHI3 1IKQA 3HD8B 2W0XA 4A6OA 2P3YA 2VD7A 4QGLA 1JYXA 4Z92B 2XXZA 1RVF1 3AP9A 5JVVA 3NQHA 4E2GA 3NNFA 4XJAA 5FZGA 5B4XA 3JZVA 5ABJA 3TAYA 3Q8AA 3C7EA 5FZOA 4CP9A 1N1SA 4LBLA 5FP3A 1U5IA 4META 1UOBA 2PLV3 2XONA 3VBRA 3BTXA 2FDHA 1QHDA 1W8HA 3POJA 5LRRA 1NKGA 2GC1A 5EP9A 1JZ7A 4R9BA 3S7IA 3LDBA 2BYVE 5FO7B 3DKWA 4Z82A 1MQTC 1K5MA 4OHZA 2W95A 4GMP0 2LROA 1XXNA 5I0UA 1RGSA 4GMP3 3AYAA 1V0AA 3U4SA 5HXVA 1KS4A 4QMAA 5KHIA 1WKYA 4KU7A 1SPPB 4P9GA 4OMCA 1OD3A 1VBB3 1O59A 2H6CA 2R042 3EB7A 1HV0A 4Q2FA 4LJHA 1C28A 2J1UA 4M3CA 4OUMA 4XF0A 1NCQC 5H9QA 3VD5A 4Q0QA 3NRUA 4CDQB 5HV4A 1V9U2 3LA7A 3N36A 2ZHLA 5JOZA 3J8F1 1B09A 1AR91 1HRV1 2K9ZA 1MQTA 1AR73 4JRAA 5IVVA 2BERA 2LS6A 5DAQA 1XJAA 4DUVA 1O8PA 3ENRA 3V0AB 2QKDA 2Q8EA 2RDRA 3LD8A 4XFGA 2XBO3 2GNDA 1EV13 1JTZX 1QDCA 3IKWA 4NHXA 4AVAA 1PGSA 5A70A 1JOBA 4FAHA 2ARBA 5FPXA 3ZMOA 3D8CA 2D5HA 1W9SA 2R6QA 3NAPC 4QPGB 2VNOA 2ZEYA 1VBA2 5EYYA 5FWEA 3RFRA 4BQXA 1NCQA 3SCFA 5JWPA 3A23A 1BBT1 1Y9MA 4UW3A 4YW1A 4HANA 2ZMLA 1V6JA 1H8VA 2GSYA 2X5IB 2ZKLA 2DCTA 4YZ4A 4YYOA 3UK9A 1HXS1 4JGZC 1XRUA 2YC0A 2DU0A 3ACIA 1WA6X 3Q9OA 3JBG3 3NMBA 1J59A 1SBFA 1YQ6A 4KNCA 2J42A 3RJ2X 3BYWA 5A1LA 1SLIA 3RPQA 2D3PA 1BZWA 3DL3A 3EJKA 2DF7A 4ONUA 3EBRA 1RINA 4HVOA 3SCGA 3NAPA 4XACA 3I4IA 4Q0UA 2JDPA 5BPXA 3POWA 2ADEA 1JN2P 3WDYA 2ZGTA 4OULA 2Q8CA 3MIFA 4OHXA 3WD5A 3VZJA 5J48A 5GKAC 5A6XA 5FZ6A 4W50A 3DXUA 3CMGA 2HWC1 2DVAA 2CAVA 1AR81 2VMFA 3MI8A 4HZFA 4JGZA 4FOWA 2VVFA 4TSVA 2VUAA 1UIJA 5IWFA 4AW7A 1XNBA 2G9GA 3N9LA 5FY7A 1V6IA 1GNZA 5JSRA 4RS5C 2MNGA 1TMF1 2DCKA 2VW2A 3RI9A 3RZMA 1GP4A 3P3PA 4N43C 5BNOB 3KQRA 3WEZA 1RUD1 1R1ZA 1SDDB 2NYYA 4FTEA 2P3KA 3AM2A 2GC3A 2VECA 4HETA 1OOPC 5LRSA 1DGRA 1DQ5A 4P02B 2OZJA 4NIAA 1W8ZA 1W2AX 3SCHA 2PYTA 3M8LA 1GWKA 3LA3A 2AEYA 4QT6A 2XUMA 1HN1A 2WFPA 5DMYA 3WF4A 4WM8B 2FZ1A 3DV8A 3N3HA 4PIXA 3VV1A 3ZYGA 5F9TA 1FPN1 2OVUA 5GZCA 1VBE1 3W5MA 1CAUB 1FNZA 3EYPA 5JLVA 4QDSA 4RS5A 2JKBA 2C4XA 3J8F3 3ZXEA 3ZYHA 4WM7B 3RYRA 1OSGA 1AR93 1HRV3 1PMIA 3CJXA 2RS11 3LPGA 4MGKE 4N43A 4NPMA 2P5BA 4I3GA 2CNAA 4QX8A 1LGCA 3HR9A 2ES3A 4GWNA 3H3UA 2CAUA 1VAMA 2DBNA 2CTVA 4UW6A 2Y33A 1OOPA 4QX5A 1GP5A 5HCFA 4CP1A 3WINE 4DUXA 2C6SA 5L9RA 2BNNA 4CUGA 3OSDA 1PMJX 2BOIA 3DXTA 3A22A 3ZIXA 1DFQA 1ZNPA 2VZPA 3I3QA 3IZOA 3EXUA 2JG8B 3PNAA 4KL1A 2QQNA 3SKVA 4Q4V1 4BQ3A 2A73B 4A6SA 4CU9A 1CGPA 2YBKA 4LITA 4NE9A 2VJXA 1XQNA 1ZRCA 4AI0A 5FJKA 2DU1A 4D94A 4I01A 4BPZA 1QJU1 2V5YA 4P5HA 4HLTA 1W8FA 1FATA 2PHTA 1R091 2YUEA 1LHNA 4OI1A 5CKMA 1HB3A 1V6NA 1ULFA 3M3QA 4NR1A 1O3QA 4QQ2A 4Q5OA 5A1AA 1EUUA 3BVCA 2DVBA 4XBLA 5FIXA 1FOD1 1OLMA 5LBFA 3VZLA 4FFFA 4NRMA 1XU1A 2GAUA 4KBBA 4GIQA 4CUAA 4ZKTB 3D6EA 4QPIB 4Y3OA 4LO4B 2Y6GA 4LO5B 5AC91 4CCLA 5G05L 5KXDA 3MUY1 4BHPA 3ORJA 3HNMA 4V2WA 4YW2A 2HWC3 3VZKA 2WT0A 2ZMKA 3BN6A 3VBFC 1EPWA 4CCMA 5I0DA 4MXWA 4P00B 1RUE3 4LKEA 2YU1A 2AGSA 1QJFA 4X8PA 1SLLA 3K3OA 2C5DA 1LESA 4LKFA 4MHRA 2AH2A 5FMOS 3MFAA 4UT5A 5EJZB 3AKQA 4LTAA 2TUNA 3WF2A 4CP0A 1H1MA 4IGOA 4P5YA 3M2MA 3S6PA 4GB32 4I02A 4MGYE 3LDRA 2VZ1A 3MPPG 4IEQA 1PO12 4JHZA 5DZFA 4E9KA 1ENQA 3OYWB 4AI2A 3BTZA 1H6YA 4IETA 5DQ0A 3VBFA 2BVVA 4OZOA 5FZHA 5I8SA 3GBFA 1FPN3 4MGTA 2JX9A 2E53A 5CBLA 1FT9A 3RMYA 3I54A 4P14A 3J9SA 1H9PA 2WL1A 1YUDA 2GALA 2XG3A 5DUUA 3DYOA 3BIEA 1L7QA 1ASJ1 1NQDA 1NUKA 3ZN6A 3P6BA 4OLLA 4X8NA 5FUPA 2XVLA 3MV11 4P9LA 3ZMNA 5K9YA 4NIHA 3TN92 4LIVA 2DURA 2VOKA 4FOVA 3HVDA 1GU3A 1QGLA 4B1MA 5ACA2 1W3XA 2DDUA 1JHNA 5F6KA 5IT6A 4HK9A 2YY1A 4CEWC 1V00A 1NY72 1S0BA 2QQMA 4KI5M 4Q4V3 1KGYA 3WF1A 1R64A 4PBPA 3THCA 4IEWA 4RA0A 4AVCA 2FCVA 2UWAA 4MYEA 4L11A 1Y43B 3ZVXA 2Y6KA 1GP6A 1ZVFA 4K21A 5T5LA 3VD4A 1OXCA 1JYIA 2BDRA 1CAWB 2J1TA 4AGGA 3PMEA 1NT0A 2PHDA 5KHKA 2WZ8A 3WP4A 1UZWA 2A6ZA 1HW5A 4AEJA 3LSEA 3B94A 4CEWA 4JCKA 2NM1A 1DZTA 2WKKA 4KGGA 4CDQC 1K12A 1VIWB 2XQXA 3MF9A 1BLZA 1YRZA 4HVRA 4QM9A 3ZFFB 5I0RA 5FO9B 4G4FA 3AP7A 4BM8A 5FZLA 3M3IA 1IZ3A 2AREA 5CG8A 1AXZA 3CZJA 3KM5A 4CYDA 4N7UA 4BB3A 2GU9A 3M70A 4OUSA 2JDMA 2BZDA 2ERFA 3ACFA 1SPPA 5A6YA 1OA2A 2MPFA 2XVGA 4QPGC 2OUHA 2VR4A 1YFUA 4NIIA 1D4M3 4YM3A 2NZ9A 4Y1ZA 1VB2A 3AC0A 1W0NA 5FUIA 3H8RA 1WMDA 4CDQA 1CVNA 1IOAA 2B42B 5KXEA 4IESA 2X5IC 5FY1A 2GMEA 1QH6A 3VBSB 3UNPA 1KD7A 1E57A 1VBC2 4XFFA 3S7EA 3OCPA 3WQ7A 1BVVA 4Q1PA 1SBEA 2A3WA 1ND2B 1QOOA 2DVGA 3NJVA 4RHV2 4IEVA 1UAIA 3S5QA 5A3UA 1ZRFA 2VC9A 2P2KA 5DPNA 4XF9A 2VMEA 2V5DA 4JKMA 4NHKA 1PVC2 2V73A 5EQUA 4PI2A 2XVKA 1BMV2 1CX4A 2PQSA 2W68A 2F4LA 2ZHMA 2V4VA 1COV2 1W39A 2CGNA 1N3QA 5FCCA 4R8HA 2X5IA 3ME2A 3GZUC 2ET7A 5FYTA 4DUWA 4FQ4A 5JOWA 2D3RA 5FZBA 5FY4A 5H9SA 2BGPA 1DQ4A 2A75A 4L0PA 3IDEA 3KF5A 3OY8B 2JB4A 1VBD3 2WQ8A 4DOUA 1DLCA 1W8WA 3APBA 1HRI2 1CESA 1RUF1 1H2LA 3PVOA 4JQTA 2Q8OA 5FDBA 1CAVB 2X05A 4XCBA 1UF2C 1V6LA 3FLRA 3NKTA 5BNOC 2F6BA 1DCSA 3M7AA 5FFOC 1YIFA 2CGOA 4UFMA 3UT0A 5F7UA 2UWCA 4QX7A 4UF0B 1JYVA 1W9FA 3O12A 3NNLA 3AMMA 1UY1A 1O4TA 1W6PB 1PZ9A 5FBJA 5J3UA 1GR3A 1MS3A 2WLQA 4WM8C 4BMBA 1JS9A 2HWF2 4QHBA 2ZKNA 2OX0A 4Q4X1 3VZNA 1BXHA 2YG0A 3A21A 2DVDA 4WM7C 2I45A 3VHNA 1ZREA 4J1WA 5DZGA 3LEMA 4A45A 3M1HA 5BNOA 2XR4A 4JQRA 2VAUA 4XTMA 4XDPA 4R4XA 4IEYA 2W52A 4FPFA 2W47A 2A5ZA 3TRSB 5C8WA 4LLFA 4CP2A 3VBOB 3FC0A 3HN1A 2WO2A 1QJY2 2RDSA 3EMRA 4KH9A 5FPUA 2JG8C 2WYFA 2DYCA 3GYDA 4HOOA 4WM8A 4OYUA 4QKFA 4GXLA 2ARCA 3ILNA 1GQGA 3X29B 4TXWA 1CAUA 3ETPA 1CAXA 2I2SA 1DU3D 3MIBA 3K48A 3BI3A 1W6QB 2VZQA 4AFDA 2QQWA 3L9JT 2WFF2 2Z4FA 5F2WA 2BVBA 4FVVA 1LODA 2BEOA 2WAAA 2QTWB 1ULGA 3E6BA 2CDOA 3SH4A 3ZYFA 2DTYA 4JAAA 2R041 2VZUA 2JG8A 1FMD1 3HMYA 2J1RA 5LWBA 5KHHA 4QPIC 3E5XA 1NG0A 3TNQA 4MUVA 3MW3A 2DCYA 4XE9A 4DMIA 5IYYA 3WZ1A 2D6OX 4QPWA 3JD72 5ERLA 5JIAA 1GQPA 2RV9A 3U78A 4E8CA 3IMMA 4QKBA 4XUTA 3T30A 5ISLA 1UKRA 1RUJ1 1QJX1 1RUF3 5K0UB 1EY2A 3K46A 1WLCA 4HFSA 5IUQA 4BCUA 2C0ZA 2MEV3 2VCMA 4FAGA 3CJIA 4IGPA 4FPHA 5A33A 1QH7A 1WCKA 3P3NA 4ES8A 1SEFA 2E7AA 4QPIA 4A44A 1GKBA 2W46A 2ZOEB 3EO6A 5ANNA 4MXVA 2WA3A 4Q27A 4CXXA 4DXRA 3VKFC 3KQ4B 3E97A 3MYXA 2D97A 2QZ3A 4TYSA 1LAJA 1WW7A 2G19A 4Q4X3 3RYPA 1DDLA 3OD4A 4PLMA 4O61A 4S2HA 3A7QA 3T2TA 2EVXA 3T4HB 1F31A 3FHAA 5BNNB 4UYBA 1UZZA 2ET1A 2RS51 2XB6C 2ZX1A 3ABZA 1RUOA 5FP9A 4XZUG 1LR5A 3VD3A 1GLHA 2ZEZA 5F37A 4Q4W1 1G9BA 4QX1A 2QDRA 3MIGA 3R6SA 4O9GA 2QQIA 4DXTA 2QJVA 4Q1RA 2GZWA 4YG3A 1JOPA 1W2NA 2QCSB 3OYWA 2ZMNA 2H0VA 3QD6A 3RNSA 5DDJ2 4D69A 5JXJA 2VM9A 5FYYA 3WDUA 3WVJA 5D8AB 4XBNA 3UV9A 3H8OA 5FP8A 4BDVB 4EN7B 4OI4A 4JKLA 1FNYA 1KJLA 1GOHA 4FO9A 3P5BA 5L7OA 2RMU1 2A71A 3VN4A 1J3QA 1VMFA 3RI8A 4XTPA 3PDQA 2K46A 4TZDA 1S0JA 2D3SA 3S5AA 2J1EA 1JYWA 2KM2A 3TOJA 1KDMA 3R4UA 2R043 2VMDA 4CEYC 1FMD3 4MGIE 4I0BA 1HKDA 4OZXA 2WZR2 3ZFFC 4RYDA 3AXDA 3KF3A 4C8DA 2X29A 4TN7A 5L9VA 5EHDA 4A4AA 4FCAA 5IVFA 2DUOA 1WA4A 3F2ZA 1V9U3 5C70A 1X33A 1RTVA 1LEDA 2Q30A 3C7FA 4EZ4A 1OKOA 4GWIA 3WG1A 4FOYA 3E5QA 1G7YA 2ZAHA 1Q8VA 4XC9A 1IGOA 1MZ6A 1SDWA 1WCQA 3MLJA 1CAWA 3K51A 3ZFGC 4XFHA 5LZ6A 2W1UA 5FY5A 3MDPA 4KU8A 2ORXA 1I3HA 3JQWA 4AYUA 1SG3A 3GXUA 4CEYA 2NLRA 1NYWA 2CSGA 5FZIA 5BNPA 1I1EA 4C90A 1VBA3 1ZZ8A 3ZFFA 2VXJA 2BBVA 2ARXA 1G9DA 3QACA 4AFMA 3OF1A 4YW6A 5E89A 1XE8A 3KZ4C 3N7KA 2YC2A 3NJZA 3PURA 1C8M2 1LHUA 2P3JA 2UWBA 3UGGA 3FFZA 2CDPA 3CZUA 2W3JA 3ZFGA 3GBWA 5FPLA 2IZWA 1QWRA 2L9LA 4YLZA 3BTYA 2RS53 1GOFA 3LKJA 4R9CA 2OQ7A 2DTWA 4XF1A 1PO22 2VQAA 1X9TA 3T1LA 1ZZCA 2JIJA 1ND3B 3H0OA 2BQPA 4Q4W3 1DGWA 2QQKA 5FK7A 2PHXA 1VE0A 4O65A 4EV0A 5IVBA 2R072 2TEPA 3NWKA 4YM2A 1ZBA2 4DXZA 1QOSA 2W92A 1RMU2 1MACA 4UBHA 1OMIA 3IDCB 3WW2A 3VBHC 5JAXA 1Z78A 2XGXA 2CL2A 2JG9A 3IPVB 4IW3A 1IS3A 1H6XA 4GJYA 1D0GA 4FBFA 4DRVA 1C4RA 4Y4YA 1UZVA 4RL7A 5JI9A 2E9QA 4QM8A 3KVAA 1PGW2 3N9NA 4NMIA 3DKQA 4QQOA 5CADA 4AAXA 1SFYA 1UWWA 3KT1A 1UOFA 2GNMA 4WV8A 1NCRA 1S0EA 5F39A 2RVAA 1VR3A 3P1IA 1UU4A 4NWWA 5CFCB 2DFCA 4FXKB 1O5LA 5C33A 4BQWA 3ZFEB 4M0NA 1LENA 3NL1A 4AEKA 1RHI1 3VBHA 1NLSA 1CAVA 2QQPA 2AUYA 5GLZA 1GANA 1H1IA 5CB7A 1AYN2 2WIIB 4HPKA 5A6ZA 3OGGA 1R082 1XPWA 2PLV1 4YW4A 4UF0A 2VCCA 2KA3A 2G4IA 1C5HA 4Q0SA 5DUXA 3ZKUA 2VO5A 3VUOA 3WUCA 1STMA 1W99A 4HT1T 3LAGA 4LO8A 2JENA 4LORA 5FUNA 5LY1A 3KV5A 1V70A 3WLUA 3VBUA 1OFNA 4CDUC 4UOJA 1X50A 2PAKA 3HWJA 1JMUB 4F3JA 3SQOA 1H30A 2PHUA 1VBB1 3B3QE 4ET7A 3ZSJA 3OEAA 2WS92 3O1TA 1W2OA 1D0HA 3ZN4A 1UXZA 4GKXA 2H6BA 4MADA 2XL9A 2XL7A 3PIGA 5DAXA 5DXDA 4UXAA 5A3TA 4Y5Z0 4XHXA 1RB8G 1SLBA 2OPWA 4EZHA 4IV3B 5B4NA 1QDOA 4PIZA 2C24A 2JEMA 4UI9L 1AR71 3T2QA 3AZWA 5B2GB 4YW3A 4FI9A 4CDUA 1LULA 5EIYB 2IXJA 5J37A 3T0AA 4BXSV 2ZGKA 3AMNA 4Y20A 3RZKA 1H8TB 2IVIB 1C5IA 1Y9QA 3FL7A 1IS4A 4AWDA 2Q1MA 4ISQA 2OXBA 5EXOA 4CCKA 1CPMA 5HCHA 2RDQA 4RQPB 4JC1A 4WVMB 4N90A 3NKGA 1WZXA 4B8EA 2XPJA 1L3JA 1UPSA 4M0HA 3OGJA 1JUIA 4H7LA 4TWTA 1O3SA 1W6NB 5FPAA 4OMDA 1RUI2 4I0AA 4BLIA 2D6KA 2FD8A 5LK7B 3CQOA 1O3RA 3OBZA 4DB5A 1GNHA 5CAZA 3HBKA 4EJRA 1KXGA 4FPKA 1DP0A 4GB33 1F4HA 1XNKA 5GLWA 4UFLA 5ANQA 2GP3A 4UFJA 1BVP1 1OFSA 1VAVA 5LA0A 1S2BA 4Z07A 5BNNC 4W65A 1J1TA 3V0BB 5F2SA 2XKOA 1WMEA 1PVC1 3HBZA 1QKQA 5FZDA 5IAVA 1AYM2 3M3EA 1ST8A 5D2AA 1HDKA 4Y22B 4AVTA 3TBDA 2BGOA 1COV1 3JQXA 3TN93 4C1WA 1RUC2 5LB6A 3ZXDA 1YJKA 2RS32 2RR12 5ACA3 4COZA 3MICA 1A6CA 4B4PA 4MGZE 4ISRA 2JD4A 1CZTA 4B3NA 4BU2A 4XPVA 4UBGA 3CO2A 3I59B 5D8AC 1Q56A 3IDAA 3JB8A 1OA4A 5BNNA 3VL9A 4B4RA 1MS9A 4FSJA 2ZS6B 2ZBJA 5L36A 1ZZBA 1PNFA 1KFUL 5FOBB 1UYZA 5KC5A 4UFKA 4HVQA 2D6LX 1DYKA 1TE1B 1MZ5A 2VBBA 2Y38A 5FZEA 1F4AA 4AFAA 3E6DA 3SLIA 2WO1A 1AL22 3E1F1 3GNEA 3K77A 2WN3A 1YYNA 4QQLA 5IK7A 3O14A 1RUH1 4LUMA 1R1A2 1U5YA 4QB1A 3D0SA 3CLPA 4QKNA 5C3OA 4NIGA 3POIA 5CNAA 5D8AA 5IK4A 2O8OA 4JX0A 3VKLA 2PMWB 3U11A 3CL1A 1CONA 1DZQA 2E32A 1GZTA 4RFT0 4YG6A 5K7PA 5GLVA 1S1AA 2GNBA 4W6WA 2V72A 4XHBA 3WT3A 3FLPA 4LBQD 1ENRA 2VZOA 1NA1B 4YARA 4WVZA 3POEA 2XLAA 4PBOA 2PHWA 5SV5A 4ASLA 2GNTA 2FZ2A 2LALA 4XYXA 3AZZA 3OBAA 5I91A 4RGKA 3DF0A 4K1ZA 3WXPA 3WNNA 4C0HA 3H9AA 4AOCA 5FZMA 1SQ4A 3ECQA 2OA2A 4W4ZA 4OHVA 4PIYA 4XJ9A 4KG0A 5FPZA 3AKPA 1CZVA 4LBOA 1GV9A 3VKNA 3TEYA 4RFRB 2GC0A 2Q5TA 4B7EA 1VBC3 2EIBA 2BP6A 3B93A 1SMVA 2J1VA 3VDCA 1JUHA 1BYHA 3OGRA 4CDXB 1W6MA 5FZ7A 2HWD2 2GH2A 4C0BA 1ACCA 4FOQA 1W2TA 1YFYA 4E27A 4IV1B 1RJ8A 4Y1XA 1PVC3 1WBLA 3USUA 1ND3C 4X6QB 5LA1A 1TNFA 3H3LA 5JCTA 4S2GA 2LTNA 3UKNA 1CX1A 1RUE1 3GZTB 2AACA 2YB7A 4K20A 3AJZA 1COV3 3GF6A 1OF3A 2YFUA 4LK7A 2D5FA 2EXIA 3RZGA 1DBNA 3NNJA 1GZ9A 2IXIA 2FBEA 3I2OA 1NE4A 1PZ8A 3CU7A 3POBA 3I2DA 3D5OA 3O1UA 1C3HA 1J3RA 1OLQA 4XXAA 3U75A 1RL3A 4JDMA 5FXXA 2BGCA 4WVWA 3B7MA 5FRAA 3M3OA 4BK5A 2D93A 1PZ7A 1DQ6A 2ZGNA 2W08A 1ND3A 2OUJA 3ZR6A 1QY4A 1FX5A 1IQAA 4AEDB 4EN9B 5FJHA 3DEMA 3VLBB 1WMFA 5CFCC 5FXWA 1JYTA 2FMDA 3EQEA 2BWAA 3ZFEC 1RUH3 2VUCA 4FPEA 2HWF3 2A3XA 4LT5A 4OQ8A 4Q4Y2 3V64A 4XJUA 1LHWA 5FMDA 5IVYA 1U0AA 1YC61 2R49A 1UPIA 3BU0A 1UIKA 2VE1A 4EN0A 2FHRA 5C8CC 1DQ0A 4RD7A 2IWGB 3WHTA 4D3WA 2Y60A 4Z2AA 3C3VA 3J4UH 2FCTA 1A3KA 3HAGA 2ZGOA 5D1IA 1N3OA 1PIV2 2W1SA 3NVCA 3MBWA 4NPLA 2K0GA 4LA2A 5CFCA 2QUOA 4GALA 3PJQA 2WINB 1QJY3 3NJXA 1BEV2 3J7MA 5C7GA 5FYZA 5DDJ1 1YEWA 4HK8A 2TBVA 2B4KA 1RYYA 1W0OA 2W94A 3U37A 3M4FA 3PL0A 4CUBA 5C8CA 4XVHA 5EZWA 4COUA 3ZN5A 2WFF3 5T5JA 4XFCA 4AGVA 1N1YA 4Z1VA 3CBNA 2ZJCA 4QGNA 2VPVA 4IV3C 1GYKA 3LPFA 4XFAA 1D2QA 5FYCA 2AYHA 1YHFA 4YRDA 3ILFA 1WLDA 4IXLA 4LNVA 2AC1A 1CJPA 3W21A 4AI9A 2O1QA 5CVRA 4JDNA 5CFDB 1H8TC 3WNXA 2D6NA 3IWZA 1QJZA 3QBQA 2YBSA 1C1LA 3CDZB 2ILMA 4FXGB 3K4AA 3JD73 4PDWB 2PHFA 1D4M1 1CJDA 1U12A 1S0GA 2HYXA 3HNBM 2R062 1X7NA 3CF6E 4RQPC 4L97A 2SLIA
chains in the Genus database with same CATH topology
4IV3A 5KBFA 4AI3A 4YW5A 2EIGA 3S30A 2BTVC 1QXRA 2E7TA 4JDOA 5KXBA 2XJVA 5DUWA 3UKTA 1H8TA 1QQP1 2OZ6A 2JE7A 2D44A 1Z7S2 3HIFA 4ORFA 1RUG2 1SFNA 3RJRA 2BUKA 2ENRA 1BJQA 1N3PA 4LBJA 5TSWA 3R4SA 1V6MA 4RQPA 4WVMA 3WUDA 2NMOA 4NVPA 4QU2A 1FAYA 5JIUA 3ZDSA 4JV4A 1VBD1 1LB2A 4QGMA 4AQ2A 2IXHA 3UJOA 2JDZA 1VAKA 2ATFA 4BIFA 4AQSA 1DF0A 2BNMA 2EXKA 3LZZA 1AR62 1AJKA 4XEZA 3SITA 4NN0A 1ZBA1 4F7ZA 1RMU1 2HWB2 3J26N 5DDJ3 3MZHA 3TWIA 4SBVA 3ROUA 3D82A 5GLUA 3VZOA 3RMXA 2P34A 3ATGA 4E4SA 3D4KA 5GALA 4PLOA 4Y22A 5KXCA 2E6VA 2DUQA 3B9IA 3HT2A 4AHWA 3WW4A 1LOFC 1HX6A 4FTBA 4H3WA 2XJQA 2NPIA 1YIPA 1WLWA 3U10A 3I59A 2WZR3 1VRH2 1LTEA 4P9IA 4K40A 2PQQA 2UYAA 2D7FA 4YGEA 3NSTA 5C9AB 2QFEA 1NA1C 1OD5A 5HCAA 3KMHA 1R081 1XE7A 2ZX2A 1VP6A 1LOEA 2JECA 5LK5A 2YDEA 1VALA 4R52A 1LOFA 4SLIA 4AK3A 2ZX0A 3V0AA 4N7IA 1MZFA 1UN1A 4XIOA 3AP5A 1QQP3 4N53B 4BQ1A 4Q0PA 1AJOA 3NV1A 1F2NA 2F4PA 1H2KA 4QPGA 2XJSA 3KS7A 3R0RA 5DUVA 2X53S 3JBG2 3ZSKA 5H9PA 1C8M3 3GHMA 4HN1A 3WW1A 2VQ0A 2XWBB 4FT8A 1LU1A 3PVNA 4G9SB 4XW3A 4IV1C 3FUOA 1W6OB 3FZ3A 3AP4A 1PO23 4RR3B 2OYZA 1RVF2 4XJWA 3ZO0B 1GICA 2DUPA 2MEV1 2R073 1ULCA 2QVSB 4AVBA 1ZBA3 4PQ9A 1N47A 3DN7A 1RMU3 3W58A 1I5ZA 4W6YA 1MS8A 1SCSA 2WNUB 2RE9A 2EA7A 4IV1A 5GZEA 5I8TA 1KDKA 3RDIA 4OI0A 2VY0A 3ZYJB 4FTSA 2Q4SA 1ZBE2 3H1YA 1RUI1 3SH5A 3OJBA 4AEDC 1LGNA 2NP0A 1MZEA 3U4XA 1O4ZA 4MH0E 4AQ6A 2VOXA 1WCDJ 5C4WB 5C6CA 4QPYA 1LOGA 2Z79A 3H50A 3MW4A 1DGLA 2VG9A 1HQWA 2JJ6A 3J8F2 4NPRA 3KD4A 1AR92 1HIXA 1HRV2 3USSA 1ULDA 2V09A 2D43A 3MW2A 5JPMB 4H55A 2YHJA 2VU9A 1AYN3 1R083 1AYM1 4E4DX 4WM7A 1OI6A 1MVEA 2OPKA 1QXPA 2A70A 1RUC1 5I93A 5FQ0B 3U07A 3ZSMA 1BBT2 2D6MA 4OI2A 5AVAA 4ZU5A 1UMZA 3HT1A 1Q43A 1H2NA 1HXS2 2IFRA 1XYOA 5A32B 1ZRDA 2GMMA 1LEMA 4FPCA 3A4UA 1V9U1 4A3XA 1J1LA 3AMQA 1DQ2A 1FV2A 4R9DA 1UKGA 2NQYA 3MIDA 4K3UA 3FLTA 4ASMB 3KT7A 1H4GA 5CFDC 1LOCA 3WV6A 2EXHA 3O5SA 2WLPA 4LBNA 3WOGA 3PHMA 3LSDA 1AR82 1YXWA 4PDWC 4MZUA 1NXMA 3S0MA 1VBA1 2XHKA 1TMF2 3RS6A 2ZACA 4Q26A 5E88A 2LUWA 1RUD2 3MLKA 4LBKA 4MLOA 3VKMA 2DFBA 4IEPA 5GZDA 4KWKA 4XIKA 1RUI3 1IPJA 2ZZQA 5CFDA 2D98A 4KG8A 1C1FA 4XETA 3OTFA 1GZCA 2ZGMA 4ZXKA 5ABJB 3LWCA 2KXLA 4PDWA 5JPNB 5J98B 5CU1A 2GH8A 1FPN2 1S55A 1VBE2 1PK6B 2Y0IA 2BFUL 2XH6A 2OIIA 3IMNA 3VBRB 3URFA 1G8WA 1Y7BA 3NV3A 5FBZA 2RS12 3LOIA 2B7YA 4FP3A 2HYKA 2DWRA 5FTTC 4Z2WA 3BPZA 5F1RA 3LGRA 1AYM3 2ZX4A 5GJ6A 4OHYA 1SCRA 4CRQA 1RUC3 1V6OA 2VMIA 3IT8A 2RS33 2R1DA 2RR13 3THPA 4C1XA 2O8QA 1SLAA 3KCYA 3KCCA 4UW5A 3SXWA 1APNA 5E16A 4LHKA 1QJU2 1PGL2 2ZABA 1N1TA 1H9WA 1R092 1MQTB 3O7OA 1KRIA 4YM1A 1VJ2A 3KT4A 4QXKA 1ZRRA 3ZXLA 3SH3A 2R0HA 4GULA 1AL23 1X8EA 1FOD2 1NZCA 3UJQA 5JZGB 5BY5A 3ELNA 1XU2A 2E51A 2B45X 1SACA 2BNOA 1R1A3 2CGPA 5AC92 5I0SA 3BOWA 4F8AA 5FREA 2GN7A 3ZYPA 2UU8A 1H4HA 5C9AC 1WD4A 1KFXL 1D4VB 4R9AA 1DLLA 4INDA 3BB6A 2B8MA 3VBSC 4AI8A 3KCXA 4YVSB 3ZIWA 5F5QA 3FFQA 1ND2C 4V1PA 5GZGA 1NQJA 4B29A 5FLIA 1BEV1 1OPMA 3TB0A 4AI1A 4BZ4A 5BXXA 4YSFA 4FPGA 4N53C 5JR7B 2YMZA 3AJYA 5C9AA 2WNVB 2XLGA 3G7DA 4XF3A 4P9YA 2CWSA 2N7GA 2PAMA 4LO7A 3THTA 4R4ZA 3VBSA 2HWD3 2CWMA 1G9FA 1ASJ2 3B69A 4XILA 2BPA2 4FPYA 3RG0A 5T50A 4YGCA 1ND2A 3C2UA 2XJUA 1PHMA 4AF9A 4HL0A 1F8VA 1UCXA 4QQPA 4U36A 4N53A 1AXKA 1XYPA 2R1BA 3AYCA 4FPLA 4WZFA 4AE2A 3N7MA 3GALA 3ALQA 4A7YA 4ZU4A 2WNUC 4GB31 3JU9A 1MS5A 4RS5B 5I0TA 5BUVA 1PO11 1W6OA 3ZXJA 3OY8A 2VOVA 1OOPB 1BCXA 3RZZA 4M01A 3SHRA 1JOJA 1WW5A 2C1FA 1DZRA 3POYA 5C4WC 3NO8A 2BWCA 5FLJA 1GSLA 2LM3A 3E6CC 3QCWA 3PLQA 3FMGA 1LOBA 2ZGPA 3OD0A 2WNUA 4Q4Y3 1KS5A 1Q8QA 3IBMA 1W6PA 3TN91 3VBOC 5JMCA 1DGRN 1IPKA 4YNIA 2VW1A 5ACA1 4AGRA 1A78A 1G6NA 4N9IA 4AHXA 1NY71 4DFSA 1XNDA 3WP5A 5L19A 4HSJA 1JYCA 3QH6A 3PTYA 1PIV3 5C4WA 3DGTA 1YNAA 1BEV3 1ZM1A 2HWB1 4XF4A 3VBOA 2PFWA 1POV1 3AFGA 1DQ1A 1QF3A 5H9RA 2Y0OA 3R4DB 2VUJA 1ZX5A 1H1AA 4MXWB 1W6QA 1LOAA 1ZZ7A 3CEWA 2DVFA 4LLOA 1GZWB 2GN3A 4XQ4A 1PM7A 5K0UC 2B9UA 2JICA 1XNCA 3PVEA 4CZSA 4Q8LA 3TNPB 4JRLA 4ATFA 5A32A 1C57A 1I6XA 2DV9A 3RYKA 1RUF2 3RWNA 4B4QA 3W9AA 2R063 3GZAA 4YFWA 3AMHA 3N7JA 4XQDA 2DCJA 4I0WB 4M3CE 5AFEA 1PO13 1VBC1 4OFGA 3ZN6B 4I09A 4IEZA 1OPOA 3FWEA 2A6XA 4RHV1 5K0UA 1AUYA 4J1XA 3VL8A 3IM0A 2WSUA 5EV7A 5ABJC 4BMEA 3T1MA 1NE6A 5BNQA 1SBDA 1Z7S3 1RUG3 2XWJB 1PK6C 2D6PA 5CIRA 1UL9A 1BMV1 4AEMA 1G9CA 3VBRC 5EYXA 5JOXA 2FQPA 1OLRA 3ZSEA 4BE3A 4KGQA 4EROA 3AKSA 1TME2 1YWKA 3B9CA 4P9WA 4S2DA 1ENSA 2ZX3A 5EWSA 4PCRA 2C9AA 1HRI1 1N1VA 3MPBA 4HN0A 2GDFA 1MEC2 1AR63 1H2MA 1PK6A 3ZXKA 3IDBB 4CEWB 3SNMA 1POV0 2HWB3 3WP3A 1QMJA 1POV3 2UY8A 5F6LB 1OA3A 3M3CA 5A3MA 3V56A 2HWF1 4A7ZA 3I8TA 4AFBA 4AFCA 1LHVA 1ZBE1 3L2HA 4LBMA 2VULA 2EAAA 3ETQA 5JZGC 1URXA 4YZ1A 1FMD2 3NV2A 5DG2A 3WDTA 2YPJA 1LGBA 2VOWA 1S0IA 4PLNA 2HJIA 1VRH3 3FBYA 2UYBA 3V65A 1QJY1 4JGYB 2Y26A 1RUJ2 4YVWB 1QJX2 2A6VA 2VNGA 4Y26A 1TNRA 3VHPA 1AZDA 2RHPA 2O0OA 4YVSC 5JZGA 2I74A 3AX4A 3L2YA 4GH4B 2WFF1 3AZXA 4TLFA 3AB0A 5DZEA 1AX1A 2XJPA 4RHV3 5A3LA 3KGZA 5AFBA 1SLTA 2WNVC 3ES4A 4M3CF 2QE3A 3BCWA 3VGIA 4QQHA 4W6XA 1EPZA 1OHFA 5T5PA 1WD3A 4YVSA 4NHLA 2RS52 5LEJA 1EAH2 2YYOA 3IIAA 3JD71 4Q4W2 1HRI3 3O0XA 1NLRA 4IL7A 1RVF3 1ZZ9A 2WNVA 4YZ3A 2HEWF 1KJRA 3BU7A 4I2OA 4YFZA 3VZMA 1AXYA 2GC2A 4DRRA 3TYJA 3AYEA 3SMHA 1C8NA 4AHZA 3MIHA 1Y3TA 1KITA 4EN8B 3VDDB 1WBFA 4CDWB 2RMU2 3ZYIB 1AF9A 2IXCA 2Q0AA 1ZBE3 3WP6A 3IPVA 4XFBA 1MS4A 1ONAA 1I9RA 4WZCA 1LECA 2A7AA 4ITCA 1CAXB 5I8YA 3AKRA 3MLLA 3ES1A 1S2KA 2CV6A 3ZFEA 1JW6A 4Z8BA 3ZPYA 1JBCA 3D0JA 1WUVA 5L73A 4EWEA 3N35A 1GBGA 1BBT3 2AZ5A 4P9XA 3ZXAC 4EWAA 2EXJA 5K8SA 4XMAA 2Z2SB 1D2SA 3A0KA 5FAXA 3G6JB 3H1WA 2E7QA 3JB4C 4U2AA 1VB4A 1HXS3 2XJTA 4B7KA 2A3YA 1PGL1 2EALA 2MHFA 4E2SA 2WZR1 3LB9A 1GFF2 3FE5A 1RJ7A 3MIEA 4K8FA 3UL2A 1FI2A 2R30A 4ES9A 4IEUA 1UU6A 5EFUA 1CR7A 1JXNA 2RM22 1Q8OA 1ULEA 3CJIB 4O9EA 2P37A 2PELA 5A33B 3H3ZA 1Q5OA 2H0BA 3WY6A 4S2FA 2P3IA 1AR83 2AR6A 4COYA 5FMOL 1O3TA 3WDXA 1LJ7A 1TMF3 2YGMA 3WX5A 2XKPA 1GZWA 1BQPA 5GZFA 1RUD3 3FX3A 1C8M1 4BLJA 2VNRA 3WHUA 3N4MA 1LHOA 2B5HA 3ASIA 4YGBA 1AX0A 3FHIB 2EF6A 4LUKA 1W6NA 2HWE2 4KQ7A 1PO21 1RHI2 4GWMA 2WSVA 4RGAA 1VBE3 1ALYA 3RSJA 4IQPA 4XXPA 3PJYA 3PVBB 2R071 4AVSA 2RS13 2I07B 3ZXGA 3OBTA 2XJRA 3SISA 1QNWA 2PLV2 2IC1A 3MFCA 5L7OB 2E63A 2ZPXA 1RIRA 2VXRA 3FBMA 3DPRB 4LA3A 5T55A 2P17A 4MV2A 4HBNA 3V0BA 1FV3A 1YO8A 1KQRA 3KB5A 1M4WA 1RITA 2K2SA 5HBAA 1WCSA 1RC6A 2ZA9A 1PGW1 4HKWA 1VBB2 4X6RB 1Q8SA 1IHMA 2ZGSA 1QJU3 4EN6B 4C91A 1R093 1PNGA 4L92A 2A6YA 4YM0A 4MX3A 1Q3EA 3O0WA 1BKZA 1AR72 4XOGA 4MVTA 4DQAA 1FOD3 4D7TA 1CIWA 1ZZ6A 1AYN1 4CEYB 2WT2A 1G86A 4L9BA 2XBO2 5BNPB 1EV12 1UW8A 2YROA 5AC93 4JGYC 4YVWC 3KGLA 3LA2A 1REFA 3WG4A 2WC2A 3NV4A 1AL0G 1RUNA 2UY9A 1AHSA 3BTAA 4UW4A 3ZFGB 5CG9A 4DPNA 4GH4C 1W2UA 4NHMA 4Y1YA 5AVPA 4CDXC 1B35B 1W0PA 1NA1A 2YGLA 2WS91 3GBGA 4NWVA 4NOTA 4GKYA 3FUQA 1IS5A 2PHLA 1CQ9A 1X8MA 4HKOA 4JGYA 4YVWA 3R05A 4HMZA 5KWRA 3WCRA 4LHNA 4YZ5A 1J58A 1DG6A 2ZTNA 2JG9B 1ASJ3 4XFIA 4GH4A 3JUUA 4AVVA 4CDXA 4CTEA 2WJSA 4DINB 1LKNA 3BIWE 1HV1A 3QH7A 4L2NA 3WW3A 4XBQA 4Y1VA 3AMPA 1XYNA 4URTA 1NCRB 4MSVA 5HCBA 1DGWX 3AFKA 3MGUA 3AXEA 3VBHB 3A0NA 1OQ1A 3VDDC 4CDWC 4XQWA 4LULA 3VHOA 4HPKB 1WW6A 5JSPA 1WW4A 1YJLA 1EYBA 2AENA 3IN9A 2R0FA 3JCIA 4HKLA 3FJSA 1O91A 4H14A 1RUH2 4FPJA 3ZX7A 2NN8A 3VBUB 2PHRA 1YLLA 2QNKA 4IERA 4AEDA 2HKXA 4JTNA 1M06G 2HEYF 3VDDA 4EWDA 4HVQA 2RS31 1QXJA 2FMYA 2RR11 2Z69A 5GM0A 4CDWA 1TME1 3GHNA 2GMPA 2ZGLA 1FYUA 4COWA 2X8KA 2XLFA 1T6GC 1JH5A 4D7YA 3UKVA 4JTOA 1UD1A 1WLTA 4JVAA 4PJYA 1TQ5A 1MEC1 1Z0HA 3HQXA 1MR5A 2WS93 1EP0A 4CDUB 5KHJA 4LO6B 4Y20B 1AL21 1ZYBA 1V6KA 4LBQB 3H7JA 4DY3A 3WDVA 5E8AA 2VMGA 1O5UA 4ZU7A 1R1A1 2VVEA 4H7MA 5JSOA 4J6GA 2WQZC 1OQEA 2VGDA 2HWC2 1X36A 3CJIC 3DUIA 4GQ7A 1QNYA 1RUE2