1QJU3

Human rhinovirus 16 coat protein in complex with antiviral compound vp61209
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 38
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qju300
4GMP0 4JGYB 2X5IB 4IV1B 1RUE2 5D8AB 4FTEA 1X36A 5L7OA 1RUC2 3LOBA 4IV3A 4Q4X3 2BFUL 4WM7C 4Q4Y3 3VBUA 1NOVA 4Q4Y1 1RVF2 1ND3A 5L7OB 1HRV1 2HWB2 4EJRA 4IV3B 3VBUB 1V9U2 1DDLA 1QJY2 4Q4W2 1AYM2 3CJIA 1QJX3 5C9AA 1C8M3 1RUF2 1QJX1 1B35C 3TN92 4RQPC 1MEC3 5BNNA 1MEC1 3VDDC 5C9AB 1EAH1 4GH4C 1RHI3 5CFDA 3ZFEC 5BNNB 2BFUS 3J8F3 3DPRA 3J8F1 2RS13 5CFDB 4CDQC 1RUG3 2RS11 5DDJ2 4Q4Y2 1RUG1 1H8TA 3DPRB 1HRV2 4RS5A 1W39A 2FZ1A 1FPN3 1A6CA 2GH8A 1AR61 2HWC3 1FPN1 1FOD2 2HWE1 3ZFGA 2BUKA 1ND2C 1H8TB 1POV0 4RS5B 2HWD1 5K0UA 5CFCC 3ZFGB 3ZXAC 2PLV1 5K0UB 1MEC2 2RS53 1RUJ3 4JGZC 2RS51 1EAH2 1RUJ1 1NA1A 1R1A3 5ABJA 1R1A1 3VBSA 1VAKA 1WCDJ 4AEDC 1NA1B 5ABJB 2RS12 3VBSB 1RUG2 4N43A 1AR62 1RUD3 1FPN2 2HWE2 3ZFFA 1RUD1 1IHMA 4Y4YA 2ZTNA 2ZZQA 4N43B 2HWD2 1HQNA 3ZFFB 3HAGA 4CDWA 1PO13 4PDWB 1BBT1 2PLV2 1PO11 2XBO2 4YVWA 2HWF3 1COV2 2RS52 4N53A 4WM8B 1RUJ2 3VBFB 4CDWB 2RM21 1Z7S1 1R1A2 4YVWB 1ZBA3 4N53B 1ZBA1 2WWSA 3M8LA 4RFT0 4CDXC 5LK7B 1RUH3 3JD73 4GB33 5BNPC 1RUH1 3JD71 4GB31 1NCRC 4CDUC 4GMP3 4GMP1 1PVC1 1CJDA 1B35A 5J98B 4RQPA 2VQ0A 1OOPC 1BBT2 1PO12 3VDDA 2ZAHA 1B35B 1C8NA 4RQPB 4Q4X1 4Y5Z0 5DDJ3 1MQTC 1D4M3 5DDJ1 2RM22 3ZFEA 1Z7S2 3VDDB 1VBA3 1R083 1TME3 1ZBA2 1TME1 3VBRC 1NCQC 3ZFEB 4CDQA 1RUH2 3JD72 5C4WC 1C8M1 4FSJA 5JZGC 1VB4A 2R063 4CDQB 1ND2A 4Q4V3 4SBVA 4Q4V1 1PVC2 4CEWC 5CFCA 2WFF3 1RHI1 1ND2B 1AUYA 4JGYC 3VBOA 5CFCB 5FOJB 4LLFA 4Q4X2 5FMOL 1FMD3 1VBC3 2MEV3 3VBOB 1POV3 2MEV1 1POV1 4JGZB 1F8VA 2HWC1 1VB2A 4IV3C 1TME2 1AR93 1AYN3 1AR91 2R043 2RS33 2R041 1ND3C 1AR83 2RS31 1EV13 1QJX2 1EV11 1C8M2 2WLPA 1ASJ3 3CJIC 5C9AC 1RHI2 1PGW1 1SMVA 5BNOA 1CD3G 3J8F2 5FMOS 5BNNC 5AC93 5AC91 5BNOB 2IZWA 1E57A 5CFDC 2MEV2 3JBG3 3DPRC 5A33A 3JBG1 2HWC2 4QPIC 3NAPA 2WZR3 1VBE3 2WZR1 2DF7A 5BNPA 4PDWA 1AR92 2RR13 1AL23 4QPGA 2R042 5A33B 2RR11 1AL21 4RS5C 5ACA3 2RS32 1NCRA 3NAPB 5ACA1 1EV12 4WM8A 3VBFA 1NG0A 3ZFGC 5BNPB 4CEYA 4QPGB 5C8CC 3IDEA 1NCRB 5K0UC 1QQP3 2HWF1 4CDUB 1VRH3 4CEYB 1VRH1 4BCUA 1PGW2 1RB8G 1K5MC 1NY71 4WM7A 1BEV3 1NA1C 1BEV1 4Z92B 4YVSC 5ABJC 3VBSC 2R073 4WM7B 2R071 3JBG2 3VBHC 5J96B 1RUD2 3VBRA 1VBD3 1NCQA 1X33A 2WZR2 1VBD1 2GSYA 1AL22 5C4WA 5ACA2 3VBRB 4FTBA 1QJY3 1NCQB 3ZFFC 1HRI3 1QJY1 1AL0G 1HRI1 1AYM3 4RR3C 1AYM1 5C4WB 4GH4A 1RUF3 5JZGB 1VBB3 3TN93 2HWF2 1VBB1 3TN91 1D4M1 1VRH2 4CDWC 1VBA1 4GH4B 4FTSA 1R081 4YVWC 1NY72 2TBVA 1HXS3 4GB32 1BEV2 1HXS1 2R072 2R061 2FZ2A 1HRV3 1VBD2 1FOD3 2WFF1 1FOD1 5D8AC 2X5IC 4IV1C 1ND3B 1HRI2 1PGL1 4JGZA 1PO23 2WS93 1PO21 1R093 1VBB2 2WS91 1HX6A 1VBC1 1FMD1 3JB4C 1D4M2 1R091 1RUI3 2RMU3 1RUI1 2RMU1 5L7OC 3CJIB 1VBA2 1EAH3 1R082 4AEDA 3VBUC 1AYN1 1GFF2 1AR73 1HXS2 1AR81 1AR71 4AEDB 4QPIA 1F2NA 2R062 4NWVA 4Q4V2 1M06G 1ASJ1 1AR63 1OHFA 2HWE3 2WFF2 4QPIB 1TMF3 1TMF1 1ZBE3 5A32A 2BPA2 1ZBE1 5C8CA 2HWD3 1PGL2 1PO22 5A32B 2WS92 1PIV3 1FMD2 1VBC2 2PLV3 5C8CB 1R092 1PIV1 2XBO3 3VBOC 1RUI2 2RMU2 2XBO1 1K5MA 1QJU3 1COV3 4RHV3 1QJU1 4CDXA 1COV1 4RHV1 4NWWA 1VBE1 1H8TC 1AYN2 4YVSA 1K5MB 1AR82 1AR72 4CDXB 3VBHA 1BMV1 4CDUA 4YVSB 1ASJ2 3VBHB 1QQP1 1TMF2 1OOPA 1RMU3 2XPJA 4RR3A 1ZBE2 2Y26A 1RMU1 1QJZA 5AC92 1RUE3 1MQTA 1OOPB 1RUE1 2BBVA 1RUC3 4RR3B 1BBT3 5BNOC 1PIV2 1RUC1 1MQTB 1QJU2 1RVF3 4RHV2 1RVF1 1VBE2 2HWB3 2RM23 2HWB1 1Z7S3 4N43C 1OPOA 2RR12 1V9U3 5JZGA 1V9U1 1BMV2 3NAPC 4Q4W3 5GKAC 4Q4W1 4PDWC 4CEWA 4QPGC 1RUF1 1QQP2 4WM8C 3JB8A 3VBFC 3FBMA 4JGYA 2X5IA 4IV1A 5D8AA 4CEWB 1PVC3 4CEYC 2QQPA 3S6PA 1RMU2 4N53C
chains in the Genus database with same CATH superfamily
3H8OA 3AXEA 4AE2A 5HV0A 4XJZA 1FV2A 2VY0A 2RV9A 5IW0A 4OUEA 1XNDA 2CHHA 4YG6A 1JZ5A 2VOVA 4BISA 1TQ5A 2BFUL 1BVP1 2RDNA 3UT0A 2A6XA 4TLGA 1RVF2 4HT1T 1W9WA 4RD7A 4CPBD 2ATFA 4ES8A 2GC2A 2K9ZA 4I0AA 3LDKA 5F6LB 1OUSA 2J1RA 4FAGA 4NHMA 4XFFA 3O1VA 1QJY2 1CR7A 1TNFA 2VO5A 2RJ2A 4HONA 2E51A 4Q4W2 3ZSLA 3DYMA 4N9HA 5FP8A 3CJIA 5FY7A 5C9AA 4HSJA 3AYDA 4CP9A 1H4GA 3N9NA 3U37A 3BTAA 4DRVA 4MHRA 3ZO0B 2EXJA 5LATA 3VDDC 1LEMA 5C9AB 4FFFA 4AVBA 5EQUA 4GH4C 2PXJA 3KVAA 4OFGA 1KQRA 2PA7A 1PMJX 1GOHA 4COVA 1WGPA 2ES3A 4PLNA 3SHRA 1J3QA 2BU9A 2BGCA 4NHLA 3ZKUA 4CU6A 3L2HA 4NRQA 2O0OA 3V65A 2BV4A 1YRZA 2E9QA 2XWJB 3NVCA 3MLLA 4XAAA 1L3JA 5CVRA 4DS0A 1K42A 1JYCA 1TNRA 2VQAA 1S55A 3PVBB 2IVJA 5FIXA 5C71A 3KZ4C 4P14A 4RS5A 2FZ1A 4PF1A 4IEUA 3ELNA 5JOWA 4LBQA 3EYPA 2BUKA 1ND2C 2XHKA 4LUKA 3VZJA 4E4ZA 1WMDA 1HV0A 3N36A 4B1MA 5I0RA 2OQ7A 2AYHA 4RS5B 1LR5A 4BHPA 3SMHA 5CFCC 1UMIA 4LBQB 5FO8B 3WQBA 2WT0A 1E5RA 1RITA 3HQXA 4W65A 3RYKA 4X6QB 4JDNA 2VVDA 2ENRA 3BN6A 5FK7A 3UESA 3ZPYA 2EXKA 5EV7A 3E97A 1O91A 1ENSA 3LIHA 5A3NA 4FPLA 1R1A3 3ZM8A 3J7NA 1R1A1 2KM2A 3LA3A 4I01A 3VBSA 1LULA 4W6WA 4DB5A 2A7AA 1IPSA 2L9LA 2J42A 3OCPA 1A8DA 2QDNA 2OS2A 3OEBA 1LHOA 1OH4A 2UWBA 2WO7A 3VBSB 3B94A 5CG9A 3ITQA 2VMEA 1Z78A 4C91A 5J3UA 1XC6A 3MV11 1I5ZA 4TYSA 1RUD3 1EUUA 2VOKA 1RUD1 1CQ9A 3HQRA 1IHMA 4QQOA 2OZJA 3ZFFA 4BYYA 1H6YA 2XJVA 5FZLA 2BNNA 4PBOA 2JD4A 2WABA 4UFIA 3WF2A 5FLHA 3ZFFB 1JYTA 3HAGA 4LT5A 2QQJA 4KG0A 2PAEA 4FAHA 3POJA 4CDWA 3VD4A 1U12A 3Q8AA 1EYBA 4U36A 1XPWA 4LA3A 1YFXA 2HWF3 3ZN6A 3M3EA 4WM8B 3VBFB 3WUCA 1DZTA 3AC0A 3M3OA 4CDWB 4HVRA 2ZS6B 1Z7S1 4YM0A 1R1A2 2QZ2A 1OLQA 3IT8A 3RQ0A 1EPWA 2WWUA 3B02A 5FXWA 4UF0B 3AX4A 3ZN6B 4CVUA 3M8LA 2DCJA 2VQUA 1NUKA 2GALA 5LK7B 1RUH3 1KEXA 1UOJA 2WNVA 1RUH1 1S2KA 4DNYA 2NMOA 3TNQA 1J83A 2C5DA 3AYCA 2CYFA 3M4FA 5JOZA 1DGRN 2DVFA 2WNVB 5FY8A 2QBXA 2YB7A 3N7KA 3AZZA 1UCXA 3PVEA 2WYSA 2XGXA 3PHMA 1HJGA 1O5LA 1YQ8A 2JIGA 4RQPA 3A4UA 3WZ1A 5IYYA 2OUHA 5E16A 2VH9A 1YQ2A 2F17A 4RA0A 3U78A 2IXLA 2H0BA 3B9IA 4BQ4A 2VD7A 1FX5A 5FYCA 5FXXA 4RQPB 3IWZA 1V6IA 4IERA 3AL6A 5FZGA 3CMGA 3PIJA 2PHLA 1IS3A 1DYKA 2HLEA 1Z7S2 2WDBA 4AVCA 2Q8CA 1VBA3 4YLZA 1HQWA 1R083 2CWSA 2VMFA 1HLCA 2ZPXA 3I2OA 3AK0A 3I54A 2ZA9A 3VBRC 4JZRA 2VMHA 3ZXFA 1UKRA 1W8HA 4UFKA 5FMBA 1RUH2 3VB9A 4HETA 5I0DA 2YXSA 3UL2A 3M2MA 4Q29A 4G9SB 2XONA 1C8M1 2Q1ZB 4M3CE 4Q2FA 4FSJA 1DF0A 3RWNA 1Q8OA 2R063 5CNAA 4JRAA 3K4AA 1OURA 4YFWA 3OGRA 3RSJA 5C3PA 3CBNA 4CEWC 4XIOA 2IVIB 1XSRA 1AZDA 2WFF3 3W59A 4FFGA 4OHZA 4HG6B 1MS0A 4FFHA 4WBBA 4HVOA 1ZVFA 4CUAA 4LUMA 3O1MA 4A2UA 4CCJA 1CN1A 1FXZA 5A6QA 3AM2A 1O3TA 1SG3A 2D7FA 1SBEA 2MEV3 3AB0A 5I8TA 3WVJA 5T55A 2MEV1 3VD7A 1D0GA 4DUWA 2JDZA 1CPMA 2XHNA 3GZUC 2NYYA 2X05A 3RZKA 3AVRA 4IV3C 4Q0VA 2BVBA 4UWDA 4Y1ZA 4KG8A 3OYWA 1H2MA 4Z2WA 3C7EA 4EN8B 5EPAA 1C8M2 5I91A 4GJYA 1MS4A 3A23A 1OA3A 1WW5A 2VTXA 5T5LA 2CV6A 3ZDVA 4DIQA 4LXLA 3AFKA 4A3ZA 3J4UH 1XRUA 1X8EA 3OYWB 4OHVA 5L36A 4ATFA 2PELA 3T0BA 4AGRA 2MNGA 4WVVA 1ZRDA 1GNZA 1HW5A 4V2WA 1SMVA 5FY4A 4GD4A 2BTVC 2VXJA 5BNOA 3ZKYA 3VKFC 3AKSA 4H55A 2WINB 2R32A 3OTFA 2EIEA 3NRUA 4FQZA 4BA6A 3MGUA 3LPGA 4D6RA 4E4HA 3I2DA 2JX9A 2C1FA 1E5SA 5BNOB 5CFDC 4ASMB 1DZQA 2MEV2 3LPFA 2ZGRA 3NSTA 4HL0A 2EVXA 1S0CA 3WT3A 5KC5A 2JWPA 4XURA 1JYXA 2VMCA 4WVMA 2FQPA 1C4RA 2ZX4A 4PDWA 4ZS2A 1DFQA 1YIPA 4NAMA 3FHIB 5A7WA 1KDMA 5ERLA 2YROA 1HN0A 2J22A 1VIWB 3EJKA 3OD0A 4WVMB 5LASA 3ZFGC 2XVKA 3E5UA 4CEYA 1RC6A 4J1WA 1QJFA 5A7WB 2Z4FA 4ISQA 5BNQA 5K0UC 3UNPA 1AVBA 1LJ7A 1QKQA 3F2ZA 5A3MA 5B2GB 1UOFA 2RDRA 3T08A 4MGZE 4CEYB 3O1TA 2MHFA 1UF2C 2UU8A 2E31A 3POBA 4Y20A 3WF1A 1F35A 1G9AA 5J48A 1NY71 4L99A 3R6SA 4F3JA 3CJXA 3WG4A 4NIGA 2ZMLA 5FTTC 1BEV3 1NA1C 4Q5OA 1BEV1 3AMHA 4Z92B 4Y20B 2ZKLA 1Y9GA 5CKQA 1GWLA 2Y0IA 3TOJA 1OF3A 4COYA 3M1HA 4FPHA 2VCAA 1X33A 3ZIWA 4BQ5A 4LA2A 5GLZA 4LOTA 2GSYA 3ZSKA 3ABZA 2SLIA 2XDVA 2J1EA 4IXLA 3OY8A 4YW7A 2WQ4A 3DL3A 2CY6A 2XUEA 4ATEA 5LA1A 4CCCA 1RL3A 3HN3A 4IEZA 3B3QE 4GH4A 1RUF3 2H6CA 4UW5A 5JZGB 2VGDA 2BVVA 1GANA 1VBB3 3OY8B 3PUAA 2VNOA 1VBB1 3LDRA 5JOYA 1AXZA 5BXXA 5D2AA 3H50A 4M0NA 3KB5A 4XE9A 4GH4B 3OBZA 3WQ7A 4FTSA 5J1XA 2PHTA 2QFEA 1OVSA 4Z8BA 1DYPA 5HCFA 1ZZ9A 1NY72 5EYYA 4D0QA 4AVAA 1UU6A 1V00A 4G3YC 3SXWA 4NOTA 5JLVA 2A3YA 1US2A 3CLPA 4GB32 5FYUA 1WKYA 4EWEA 1BEV2 1G9DA 1W6OA 4O9EA 3S7IA 4JTNA 3ACHA 4P9XA 1LOAA 4C0HA 3C7GA 4MADA 1G9CA 2ORXA 3ACFA 4QX8A 3POSA 3LQCA 4B4RA 3W5MA 1W90A 1IQAA 1W6OB 2F4PA 4TXWA 5FKCA 5K4LA 3MIFA 4QB6A 2P5BA 2ZEXA 2XKPA 1W3VA 4AQSA 3ASIA 3ZPOA 1AX2A 2P2KA 1C28A 5F5AA 3VKLA 4FT8A 2LROA 5A1AA 1PO23 2W1QA 3E1F1 4LTAA 4PQ9A 3EHKA 1PO21 1F15A 1LNSA 2VL4A 3IPVA 5LA9A 1R093 1VBB2 1JZ4A 1VBC1 3APBA 1R091 1RUI3 1O5UA 2A5ZA 2RMU3 1RUI1 2RMU1 1X82A 3OUJA 4K6BA 2XB6C 3WNNA 4MV2A 1LHNA 1JHJA 3R0RA 3IPVB 3N9QA 4L0PA 2DCKA 3ILFA 4IETA 2DFBA 1AYN1 1IKPA 2ZJCA 3FLPA 1BK1A 1OD3A 1Q8SA 1AR73 5AFEA 4Y1VA 3NJXA 3CZUA 1ALYA 1AR71 4A44A 5T52A 4K7JA 4L2NA 1XYNA 2CGOA 4AXOA 4Y22B 3THDA 1MACA 5C7GA 5FUIA 4AQTA 4Q4V2 2E33A 3AZWA 2ZX3A 3AKRA 2YY1A 3GYDA 1ZZ6A 1W6MA 4OUMA 1M06G 1AR63 1RJ8A 1CIYA 1UU5A 4IGOA 5J7MA 5A1FA 4CTEA 3B9CA 4BM8A 2AZ5A 4QX0A 3IB3A 5A32A 2BPA2 2DWRA 1W6MB 4K1YA 2HWD3 4YPJA 3PURA 2AEZA 1QXJA 3DUIA 3LEGA 4FOVA 1CX1A 1KXGA 3K75B 5TSWA 5FZ7A 2VW1A 1PO22 3TYJA 3WF3A 5A32B 1UYYA 5IK5A 1VBC2 2WZEA 1R092 1OLME 4HANA 1JUHA 2IC1A 4HKWA 1RUI2 2RMU2 5FMCA 3VBOC 4W50A 4BQ3A 4BMBA 1LKNA 1BKZA 3LFIA 5KHHA 4LO6B 1MS3A 5LBEA 3RZZA 1G9FA 4LE3A 1VBE1 2ADEA 1XNBA 3ZSEA 1AYN2 1UZZA 3B01A 4SLIA 2JDNA 1AR72 3R4DB 3SISA 2VR4A 2VBDA 4JKMA 2UYBA 1O4ZA 4D8MA 4IGQA 2VMIA 2R0HA 3SC7X 5I0SA 3PUQA 5LBFA 4XQWA 1BQPA 4MHUA 1QQP1 1FT9A 2AREA 3ENRA 3MFCA 4C1XA 1LHUA 2A70A 5CG8A 1IG0A 3NWKA 3V64A 2AH2A 1LOEA 4N9IA 2J1SA 3SH3A 4EN7B 4DPNA 1NAEA 3JUUA 1SLBA 4K1ZA 5AC92 1XBFA 4NUBA 5C5TA 3KGLA 4ET7A 3VZOA 1H1AA 3H42B 2OVUA 2BBVA 1RUC3 1PZ7A 1BBT3 2HKXA 3H1WA 4OUSA 4XXPA 1RUC1 1UOGA 5GLVA 4C8DA 3JXSA 5F5IA 3MIBA 3GBWA 4N7UA 2O8OA 3CL1A 1N3OA 3RPQA 4OHYA 1VBE2 1ZA4A 1ZA7A 2I74A 2VULA 3K77A 4UW4A 3RGBA 3ZX7A 4E27A 2EIDA 1OPOA 1NLRA 2VZVA 5K8SA 4CUBA 4M4PA 2XWBB 1QWRA 1XNCA 2EIGA 3NAPC 4P5HA 3AP6A 4JRLA 4TN7A 1YYNA 3ZYPA 4OLLA 1X8MA 4CEWA 4COZA 1SFYA 5C3OA 5GLWA 4QPGC 5LW9A 4IE7A 1QQP2 1KD7A 1NZIA 4WM8C 3VBFC 1YXWA 3IKWA 2D6MA 3UETA 4CEWB 3I3MA 1WMFA 4YGEA 1GV9A 4AFAA 4FP3A 2O8QA 4MGTA 5F2SA 2JDMA 1HV1A 3S6PA 3OEAA 1S0DA 3J7LA 3BALA 1I5PA 2E6VA 4GMP0 5KR7A 2BDRA 2Y34A 3BU7A 4P5YA 4JQTA 5T54A 1Y9MA 1HB4A 4QB2A 4FTEA 1JN2P 1X36A 5I0UA 5L7OA 1RUC2 4IE0A 3BODA 4JX0A 5A7OA 3LOBA 2DBNA 3WCSA 4CUCA 4IV3A 2JDYA 4Q4X3 2DDUA 4WM7C 3WNOA 3I97A 1LOCA 4NHXA 3AYEA 2ZHLA 4YM1A 1F5JA 3SH5A 4XXAA 5L7OB 4LKDA 3C7FA 4CYDA 2A3XA 2I45A 1XE7A 4IEWA 2DUPA 1JMUB 2TEPA 4XJ8A 1UZ0A 4Y1YA 4XF3A 4IV3B 3T30A 4CA9A 4EJRA 1GZWA 1WBLA 1Z0HA 2E7QA 4H14A 2NLRA 2R0FA 3NV1A 4NIIA 1W06A 1ODNA 3TAYA 1QJX3 4AQ6A 4BMEA 3TEZA 1QJX1 1GZWB 1GQPA 4UI9L 5FY9A 5LRRA 2JB4A 3TN92 1D7PM 1WMXA 4RQPC 4CCEA 5BYNA 3SCHA 1J3RA 3RJRA 3N9PA 1HB2A 3U1XA 3IIIA 2QQOA 3QD6A 4GKYA 1O3SA 4NAOA 1EAH1 2Y6JA 1EUTA 2ETEA 3ME2A 1JYVA 4B7EA 2A1XA 4PT6A 5CFDA 1H8VA 3OBRA 1ULDA 2BFUS 3J8F3 5GM0A 3J8F1 2YHJA 3BIWE 1W6PA 3LZZA 3O5SA 4LIUA 4R9AA 5EYXA 3USSA 3WDTA 4TLFA 1NZCA 4XFGA 4RL7A 2FBEA 1BLZA 3LFMA 4A7YA 4CXXA 2QQLA 1U0AA 1XYPA 4LPLA 4RSUA 4N53C 4E2QA 2C6SA 4QDRA 4UXAA 1H8TA 4GAZA 2VCBA 4XEZA 4FBFA 1W6PB 2ZMKA 1FPN3 3OGVA 3QCWA 4KU8A 3PVOA 2HWC3 1FPN1 2HWE1 1AJOA 2Y6KA 5DABA 5IWFA 2C4XA 3RJ2X 1AXYA 3ZFGA 5FOBB 2EA7A 2WA3A 2VU9A 1H8TB 1POV0 2HEWF 5A3WA 4I02A 1POQA 3ZYFA 2ET1A 4UFMA 5K0UA 2N7GA 2E7TA 3ZFGB 4ARXA 4ONUA 4ZU7A 4ZKTB 4HKOA 2VOXA 3ZYBA 3M3QA 3N3HA 2YC4A 3IAQA 4OVEA 2PLV1 3WHUA 5K0UB 1W2TA 3THCA 2RS53 3FHQA 4IEPA 5I93A 3AMNA 4YYOA 2RS51 1EAH2 1W04A 3OSDA 3RI9A 4W4ZA 4BB3A 1HJFA 5KC6A 1NA1A 5EZWA 3H8XA 5EP9A 4AAXA 2W92A 4S2GA 4XPVA 4YZ5A 3Q9OA 4F83A 5EFUA 3B00A 2GMEA 1NA1B 4LBJA 2IXHA 4D7YA 2C9KA 2ID4A 4BH9A 1LGBA 4N43A 4Z2AA 2FMYA 1Q5OA 4NO4A 4R9DA 2QUOA 4LQRA 1FPN2 1UX6A 2HWE2 3Q8BA 1WCUA 1N47A 3FFQA 2EXIA 2YGLA 3MI8A 4FPOB 2VZTA 4N43B 4UYBA 5F3EA 5JR7B 1UU4A 2A6WA 1UXZA 3VZKA 5IK7A 2I2SA 1PX4A 2FCUA 1HQNA 4CXYA 1ODMA 4HN0A 4JVAA 2VZRA 2KR2A 2BRTA 2UURA 2OZ6A 1GP6A 4PJYA 4RYDA 3RMYA 3ZR5A 2HYKA 2PLV2 2ZX1A 2GH2A 4NPLA 3GJAA 2Y8KA 3QLQA 4LK7A 5JPNB 1DGRA 3EB7A 2RS52 1RXGA 2WAAA 3HNYM 4AFCA 2QQNA 2VZOA 1DCSA 1Y3TA 1X7NA 2DYCA 3HEIA 4IE5A 1C1FA 3WNPA 2P4EA 5FFOC 2WWSA 1MS8A 3FFZA 4OI2A 4BOWA 4UFHA 2VUAA 4RFT0 2XL9A 1JXNA 2ZGTA 3JD73 2QZ3A 3MIEA 5C6CA 3JD71 1UY4A 5FZKA 1YFWA 4XC9A 5T5PA 5GJ6A 1QY4A 2R49A 1QH7A 1W2AX 5FZEA 2IFWA 3OB8A 4GMP3 4YW3A 1STMA 4QKFA 1QU0A 4GMP1 5DAVA 4K3UA 1PVC1 5LK5A 3E5QA 3AZYA 5IVEA 2PHFA 3NNMA 5EXOA 5FZ3A 1ZZ8A 5DZEA 1XQNA 4DINB 2ZEWA 2FDFA 1SDWA 3PNAA 4DUVA 2JICA 1LRHA 2A73B 1LHVA 4AVVA 2ZAHA 4LULA 4WZFA 3DCQA 2JKXA 4QQLA 2WO3A 4Y5Z0 5KHJA 1YNAA 1MZEA 3E6BA 4Q1PA 4AHYA 1MQTC 2YBKA 2ZAAA 4QWNA 3W21A 4HOOA 1VMJA 2YBPA 1SPPA 4EWDA 1YI9A 3PJYA 1JU4A 3AZVA 4X8PA 5GALA 1H9PA 3BYWA 3KT4A 3ST7A 1US3A 3TBDA 4OI4A 5CZKA 2WT2A 3JD72 1SPPB 2QJVA 4QPYA 4W8JA 5FPVA 4MXVA 3WG3A 4HPKA 2A6ZA 4HMZA 3OGSA 5FPAA 5JZGC 4IL7A 1VB4A 2XJUA 2LW8A 2WSVA 3IMNA 4W6XA 4CUGA 2Y38A 4KWLA 4UT5A 5FXVA 3HJRA 1PVC2 4HPKB 2BWAA 1DYOA 3HOBA 1S2EA 3IIAA 4ZZ8A 1U5ZA 3W20A 4AW7A 2GMPA 4QKNA 2X10A 3VBOA 3ALQA 5JVVA 5T5OA 3MDPA 3KLSA 4YG0A 1C1LA 5FOJB 2J7MA 3LCPA 2CDPA 2E7AA 5F5QA 2XMLA 4LLFA 4XETA 1FMD3 1ZRFA 1JZ3A 1W8ZA 3VBOB 3WD5A 1POV3 2CGPA 3WNMA 1KDKA 5A3TA 3I3DA 1POV1 3WW4A 3OBAA 2CDOA 1M4WA 3N7MA 5F5CA 5GZDA 1F8VA 3QH7A 4HK8A 3UKVA 1HQLA 2PHDA 1V6OA 1XNKA 1AR93 1AR91 2J1VA 3K4ZA 4H2AA 4NVPA 5ANNA 2RJLA 3VV1A 4PIZA 4A7KA 3KSCA 3OUHA 3AVSA 1PVXA 3B7MA 4WV8A 4MGYE 2YYOA 2W47A 4BXSV 4BQXA 1GBGA 3T1LA 5HCHA 4R4ZA 1S0GA 5CADA 4ORFA 1ASJ3 1MS1A 3NNLA 3IBMA 4FPEA 4LO7A 3T09A 2J1TA 1SBDA 3GHNA 3L2YA 4LK6A 4Q8KA 1I6XA 4CXWA 2Q5TA 1VP6A 1SHWB 1WD3A 4P9LA 4QGMA 2W87A 5BNNC 4V1PA 4XFCA 4YARA 2LS6A 5C3RA 4I2OA 5HXVA 5JPMB 3RZGA 3AXDA 4YGDA 4EROA 1UY3A 1V0AA 2JDPA 1E57A 4AHXA 4BQ2A 5ISLA 4YZ1A 1GP4A 2CWMA 3DPRC 5A33A 4ASKA 3O1OA 5KXCA 4BPZA 4OQ9A 3NAPA 3H1YA 2OQ6A 4J6GA 2WZR3 3OGGA 4XUTA 3UJOA 3WF4A 1N3QA 2WZR1 3P3NA 5CU1A 4C1WA 4HBNA 4HVQA 1AR92 1MZFA 2RR13 4L8QA 4QDSA 5BNPA 4NE9A 1O6UA 4QPGA 2RR11 1WLDA 4RGKA 2GC0A 2VUJA 5A33B 2C26A 1NCRA 3NAPB 2MPFA 3SKVA 3ORJA 2XLFA 4WM8A 3VBFA 1NG0A 2RG4A 3K4DA 2JG8A 5BNPB 1NXD1 1H30A 1G86A 2BGOA 3FWEA 4QPGB 1W05A 2KXLA 3IDEA 4QX7A 5F37A 5E89A 4A45A 5JIUA 1NCRB 3FMGA 5A7NA 4AG4A 1ZM1A 4UF0A 5FPLA 2HWF1 2A3WA 4RFRB 2W0XA 2VZ3A 2JG8B 4Z1VA 1VRH3 3P6BA 3I2IA 1TZOA 2WN3A 4QGLA 1VRH1 4BCUA 2PHUA 2DCZA 2V72A 3NV2A 1RB8G 2PMWB 5B4XA 3OD4A 3SNMA 5LB6A 3C8XA 2CL2A 2UWAA 2WNEA 3CZJA 2JECA 5DG1A 5GZEA 2W3JA 4WM7A 5I0TA 2OPWA 2F4LA 2W9XA 1VLNA 3MZHA 4O65A 2PHWA 5LY2A 3O1RA 1UYZA 3G7DA 2R073 2XQRA 4NPRA 2Y0OA 4A6OA 4LMFA 4WM7B 1VE0A 2R071 1RJ7A 3PMSA 4Y1UA 5J96B 1RUD2 2GN7A 1VBD3 1NCQA 3MV01 2WZR2 2WZ8A 3H0OA 1VBD1 5L9BA 1JW6A 2DVAA 3IZOA 5C4WA 2B45X 1LOGA 1YFYA 4AL9A 3MICA 4MGIE 4CSWA 5JDBA 3V0BA 2P3YA 1NCQB 4FTBA 2FDJA 3FUOA 4A7ZA 2IFRA 2NZ9A 1AYM3 1DLLA 1AYM1 2TNFA 2VJXA 5C4WB 3LDBA 4Y26A 4AEMA 3V0BB 3BTZA 3WLUA 4UBHA 2HWF2 3BTYA 4XJUA 1J58A 1K5JA 4GQ7A 1VRH2 1S0EA 4MXWA 2VC9A 4QPWA 1UYPA 2YUEA 1VBA1 3BIEA 1R081 4YVWC 4D6QA 2B39A 5G04L 1U5XA 4MXWB 4FP2A 3RZLA 4K8RB 5GZFA 1QXRA 3GGLA 2D98A 5FZAA 5A3PA 1V70A 2R072 3FJSA 1Q3EA 2IXJA 2R061 3SCGA 4DY5A 5FYMA 1VMHA 3UJQA 2FZ2A 4P9JA 2VUDA 3MW2A 3K51A 2W91A 4XTPA 1HRV3 1VBD2 1W2UA 4PF5A 5EWSA 4EWAA 1FOD3 2BGPA 2WFF1 4PLOA 1FOD1 1LODA 1XNTA 5FO7B 1OLMA 1SBFA 4LBQD 4FOQA 1ND3B 3R4SA 3DXTA 2D3SA 2OKXA 2WNUC 5JSOA 4MO3M 5A7QA 2BW8A 1NLQA 2BYVE 2D3PA 3ETQA 2WO1A 4ITCA 3WXPA 3N9OA 5L9VA 4KBBA 3JB4C 1DQ4A 3VKNA 3H3LA 5L7OC 4XUQA 4A6SA 2P3IA 4LHLA 1VBA2 4COWA 4K40A 1R082 4LJHA 1F4AA 2NMNA 3WW2A 1W8WA 3CIHA 4S2DA 2ARAA 5DAXA 5IVYA 2HBTA 3VHPA 1CESA 3POIA 3I2JA 3W58A 3C7HA 3QACA 5AFBA 1GFF2 3I3EA 3MPPG 4DQAA 4FPCA 2ARBA 3PJQA 2A71A 5FZ4A 5FAXA 5FZ8A 4YFZA 4UFLA 3ZYRA 4PQQA 1U5IA 3N9MA 1D0HA 2R062 3GJBA 3PMEA 4AQ2A 1I1EA 5CBLA 3VL8A 3KQRA 4PIYA 1J3PA 1LGCA 3MIHA 2DCYA 3WV6A 2YC2A 3G6JB 4OULA 5LWBA 2WFF2 1TMF3 3E6CC 1UW8A 1TMF1 1RIRA 3O1SA 5C8CA 3D82A 3MYXA 5IVBA 4A41A 2D6PA 2BNOA 2GNDA 2GC1A 1OPMA 1UD1A 1ZREA 5JI9A 1OKQA 3ACIA 4S2FA 2FDGA 4AOCA 1T2XA 4IDZA 1DG6A 3B93A 5FZDA 3WW3A 5C8CB 2XBO3 2YC0A 2XBO1 1K5MA 3KCCA 1QJU3 1YWKA 1COV3 2QE3A 5GLTA 1DP0A 4FO9A 1QJU1 1WA4A 1COV1 1QXPA 4L11A 4NWWA 1DBNA 5JUVA 4RGAA 1H8TC 1NE4A 4YVSA 2VBBA 1K5MB 1FV3A 5FZFA 4GKXA 1OQDA 3QBQA 2OPKA 2RE9A 3VBHA 1GZCA 4AZZA 2BJSA 1BMV1 5FP7A 1ZX5A 2ZCWA 5FBJA 4XBQA 3WHTA 1O7FA 4YVSB 1LAJA 1RUNA 1UZYA 5JCTA 2B8MA 1H9WA 3RS6A 4K21A 3VBHB 5F7UA 3OOXA 4ES9A 4QU1A 1NE6A 1TMF2 2Z5WA 3A0KA 1WCKA 2E63A 3GZTB 3Q8FA 3I3QA 3GBGA 4RR3A 2NP0A 2X53S 1W6NB 1CIWA 2Y33A 1O8PA 1RUE3 3A0NA 2FDIA 1MQTA 4RN5A 3LIGA 1RUE1 3JQWA 3PLQA 2QQVA 4RR3B 2ZKNA 3M3CA 4E2GA 5FYIA 5A6XA 4XMIA 1GUIA 1GLHA 2C24A 3MUY1 3WP6A 5KBFA 1MQTB 1QJU2 3UV9A 1MVEA 2Y6FA 4Z07A 4PHZA 4EN0A 2RM23 3KV9A 1Q43A 4YM3A 2WJSA 2WT1A 3OPZA 4N43C 3WR0A 4AHZA 2XJTA 3ES1A 3HBZA 5JZGA 1JZ8A 1DQ2A 1BMV2 4YW2A 4AAPA 2W46A 2HJIA 2GC3A 2W1WA 4MGKE 4XABA 3PUHA 4XYXA 1CZVA 1FNZA 3BOPA 2XH6A 1W8NA 3DYOA 1RUF1 4AK3A 3WDVA 4XW3A 4L97A 4XQ4A 3T1MA 1W2NA 2AUYA 4FFIA 4QX5A 4YW1A 3VHNA 4R4XA 2VG9A 3RYRA 1JYIA 4PBPA 4MOAA 2WLQA 3KV4A 5SV5A 4GA9A 2R30A 4D3WA 1RUE2 3K3OA 3VDAA 1B09A 4XZPA 1NKGA 2XXZA 5DZFA 1W6QA 1Y7BA 4NPMA 4I30A 1FATA 3AP5A 1ONAA 3Q8CA 5FLJA 2ZGOA 5JIAA 1NOVA 1PMHX 1OBNA 1S0FA 2PN5A 1NX9A 5CEHA 4UOJA 1W6QB 3X29B 1DZRA 3ZXLA 1CJPA 2JIJA 3VLBB 5DUWA 2D93A 3VL9A 3WG1A 3HQUA 2W68A 5FJKA 1SZBA 1UY0A 5J09A 1SLLA 1G9BA 3ZYHA 1RUF2 5DAPA 4GWNA 4F7ZA 1LOBA 4QHZA 4YG3A 1GNHA 5CKMA 1MEC3 2LUWA 5BNNA 1MEC1 5FZIA 3AMMA 2ERFA 2DVDA 4XILA 2ZX0A 3CQOA 1RHI3 3NV4A 3H8UA 4Y22A 4B4PA 3O1PA 1SQ4A 4IEYA 4ARYA 3T2QA 3WUDA 4DO0A 5BNNB 1UIJA 2WBKA 2W08A 3DXUA 4QQPA 3DPRA 4XDPA 4XF0A 1CGPA 4BDVB 3I2HA 2GZWA 3OUIA 3SITA 2RS13 1Q8VA 3WDWA 1BYHA 1RUG3 2RS11 4TZDA 1AX0A 1RUG1 3DPRB 2P3JA 3S7EA 4QHBA 3NO8A 1A6CA 1AR61 4Q0SA 4WVZA 3VZLA 1SCRA 1QEXA 2D44A 1E5HA 4FVVA 5EJ3A 4JQRA 4OCTA 3P3PA 4MGQA 5IFTA 2HWD1 4YSFA 4U2AA 1W9YA 5FYBA 4E9KA 5FKBA 4LKEA 4O61A 1ZYBA 2CTVA 5FZOA 3ZXAC 5HPOA 2QQWA 1WLTA 2ORZA 1JUIA 2V4VA 3ECQA 4LBMA 4AGVA 3KF3A 1MEC2 1DHKB 1RUJ3 5KXEA 4KGGA 3RDIA 1NT0A 5FZOB 1RUJ1 1Y4WA 3AZXA 4CU7A 1D4VB 3AYAA 4NHKA 3VGIA 2DVGA 4IE6A 4XJWA 4ZZ5A 2AR6A 1QOSA 4ZPIA 3MF9A 1VAKA 3WP3A 3K3NA 1WCDJ 4BLJA 3ZOIA 5JR2A 4BE3A 4AEDC 1LCLA 2GN3A 1WA6X 3ES4A 1T6BX 1W0PA 3GCWA 2RS12 3HD8B 4IEOA 1RUG2 3IDAA 4QX1A 4JKKA 5FJHA 3TWIA 4BIOA 5FPUA 4MVTA 1AR62 3IN9A 2GNBA 1CAXA 1WCSA 4LEJA 2B9VA 2WWJA 4JAAA 3CO2A 4H3WA 4Y4YA 1F31A 3JU9A 2ZZQA 3RRDA 1LU1A 1PK6B 2G1MA 5G05L 5IVCA 2HWD2 2YPDA 1KS4A 2KD7A 3BVCA 1CAXB 3E5XA 3NNFA 5DG2A 4DMIA 4OYUA 3VHRA 2R1BA 4CRQA 4KI5M 5A3UA 1BBT1 4JKLA 4XTMA 5FP9A 3HPNA 4EQVA 2YGMA 3AP7A 4YVWA 1MS5A 1UWWA 1RUJ2 1YC61 3FLRA 3WQ1A 3ZXJA 2FCVA 3FLTA 3LA7A 1GU3A 3ZSMA 2XJRA 3I2KA 5LZ6A 2ZHMA 4BQWA 4FPKA 4YVWB 1ZBA3 3C2UA 1ZBA1 1OFSA 5C3SA 1PHMA 1WUVA 4OMCA 1BJQA 4CDXC 1W9FA 5BNPC 1PNFA 2PHXA 3EMRA 2HBUA 1PZ9A 4CCDA 5FUPA 1NCRC 1O8SA 2YPJA 4Y33A 3U14A 5KHGA 5H9RA 3I3BA 1J84A 2JG8C 3AMPA 3WNXA 2AGSA 3CKHA 1OI6A 5IVVA 2WNUA 4WVWA 3DKQA 1CJDA 4HKLA 3S57A 4LHSA 3WW1A 1B35A 2OW4A 4Q0UA 4JC1A 3TB0A 1JZ7A 4G4FA 1OOPC 2WNUB 5L73A 1F4HA 1BBT2 3UKTA 4FQ4A 1BK0A 5C3QA 5IJRA 1B35B 4UW3A 3RMXA 1C8NA 4Q4X1 1W99A 1DGWA 2UY9A 2Z42A 1NXMA 5DDJ3 2V73A 5DUVA 1D4M3 5DDJ1 2CSGA 2PAMA 4B3NA 3ZFEA 3WOGA 5FZBA 2FDKA 1SEFA 1YFUA 4C0BA 5HCBA 3VN4A 4DRRA 1N3PA 2JDUA 5HCAA 1UMHA 3VUOA 1TME3 2O14A 3ZVXA 2VCCA 1ZBA2 4JHZA 1TME1 3KQ4B 4HXCA 2VTFA 1FNYA 1NCQC 1PZ8A 2ZGSA 4IQPA 3ZFEB 5H9SA 4BU2A 4CDQA 3KT7A 4Y5TA 3UK9A 3GM8A 5C4WC 4MUVA 3DV8A 1ZZCA 2D3RA 3AKTA 5F3CA 4CDQB 1JU3A 3LF7A 3MIDA 1LESA 4SBVA 5DMYA 5JAXA 5GZCA 3FUQA 1UL9A 2EIBA 3THPA 2DFCA 5FZHA 2WIIB 4YW4A 4AI9A 1WMEA 5FYZA 1IKQA 1VJ2A 2CNAA 2EICA 2LM3A 4XVHA 5BV6A 2ZABA 3RG0A 5FO9B 4WZCA 1V6JA 5F9TA 5FPBA 5DUUA 3AJZA 4JGYC 3H8RA 4ZU4A 5JXJA 2EF6A 3BTXA 4GALA 1QH6A 4Q4X2 4CPBA 5FMOL 4FI9A 2W1SA 1WLWA 5HI0A 4DFSA 1N1YA 4ZONA 4JGZB 1RXFA 1C57A 2HWC1 1GZ9A 2C0ZA 2CGNA 1SACA 4X6RB 1TME2 3NQHA 1OA2A 2R043 3LWCA 2BNMA 1BVVA 4AFMA 2R041 1ND3C 4QKBA 5A70A 1AR83 2W94A 2WFPA 2DURA 3WSOA 3LSEA 1GSLA 1QJX2 5E6HA 3RI8A 2Y64A 4EZ4A 2YFZA 5F39A 2HYXA 2B46X 2VZPA 1W2OA 2Z2SB 1N1SA 3ZYJB 3NKTA 1H2KA 2E26A 1VMFA 1IOAA 2ILMA 2QDRA 4YWAA 4INDA 2VNGA 1PGW1 4CP2A 1XOYA 1QDCA 1CD3G 3K2OA 4NN0A 4NR1A 5APAA 3J8F2 3I2FA 4KMQA 4A4AA 2XKOA 3BPSA 4Y24A 2GNTA 4KWKA 5E8AA 5HXMA 1VPHA 2JEMA 4DUXA 1C5HA 3T4VA 4FCAA 1V6KA 3KV5A 4IEVA 1VAVA 4GZ9A 1TVGA 1ZZBA 3JBG3 3LOIA 5FZMA 3SEEA 3WQ0A 4I3GA 3JBG1 5HV4A 2HWC2 4ZHNA 4B7KA 4QM9A 3I2GA 1FI2A 3GBFA 3HWJA 1RUOA 2DF7A 2YU2A 2ZGKA 3U10A 4E8CA 2NN8A 2ARXA 2R042 5E1RA 4Q0QA 5F3GA 1R1ZA 2D97A 4B1LA 3IAPA 5D21A 5FZ6A 4YW6A 5IK8A 5C8CC 3TEWA 1R64A 2OX0A 1OQ1A 2QKDA 3H3ZA 3N9LA 4CDUB 3C7OA 1FAYA 4LBNA 5T5JA 1YQ6A 3KCXA 1GYKA 1PGW2 1UPSA 2VVEA 4M3CA 1A3KA 3C3VA 4NMIA 4LITA 1K5MC 1UXXX 3ILNA 5CKNA 1LB2A 1JYWA 4E8DA 2XJSA 4ZS3A 4M3CB 1K12A 3RZJA 2FMDA 3NNGA 4UAPA 2YU1A 4YVSC 1XE8A 5ABJC 1OSGA 3ON7A 4LBLA 5FYTA 3DF0A 3JBG2 4YW5A 3VBHC 1QDOA 3KHCA 1WD4A 3HNMA 5IVFA 1XB9A 4FOYA 1LTEA 5AVAA 3U75A 4AI2A 1WBFA 1L7QA 2ZGMA 1DU3D 3CDZB 2A6YA 1Q56A 1IS4A 3O0VA 5JSRA 5IAXA 4YNIA 1QJY3 1S4CA 1QJY1 1AL0G 4KNCA 1GOGA 5EJZB 4RR3C 4LORA 2V5DA 4AI1A 3KT1A 3V56A 4LKFA 1KJLA 3BKZA 5FRAA 5SV8A 1HB3A 4LE4A 3WEZA 2GU9A 2XLGA 4IGPA 4L92A 1PGSA 2D40A 2VW0A 1W8UA 2JB8A 2WN2A 4TSVA 2I07B 5FZ9A 1DQ1A 1XSQA 2TBVA 1HXS3 1O4TA 1QHDA 3ZN5A 1HXS1 4CCMA 4NIAA 1MZ5A 1JOJA 1ZRIA 3D4KA 3EXUA 4XUOA 5F32A 2NPIA 3VZNA 2V4AA 1SLTA 4XUPA 2VUCA 3M7AA 5C8WA 1BZWA 2B9UA 2W52A 4XHXA 3UGHA 2R7EB 3LEKA 4Q26A 3ZDSA 3J7MA 2EAKA 1QOOA 1HN1A 2VZ1A 2XVLA 1CX4A 4LO8A 3USUA 4HFSA 4MG2A 1LOFC 3URFA 3N7JA 1URXA 3CF6E 5DZGA 4HZFA 1ZZ7A 2XOMA 3LEMA 3P5BA 4GWJA 3USUB 1A8MA 1D2QA 4BWOA 2YZ4A 1HX6A 1FMD1 1W3XA 1RGSA 2V09A 2XJQA 4I3PA 3DYPA 1NQDA 2IUWA 2R1DA 3ZXKA 1H1IA 4P9GA 5JOXA 3FL7A 4P00B 3CJIB 2C9AA 3RZHA 4AEDA 1IS5A 3KMHA 3H9AA 1EY2A 1MPXA 3DECA 1S2BA 5EJ1B 1GOFA 3J26N 4BIFA 3RNSA 4CP9B 4IUGA 4AI0A 1A34A 4P02B 1XNAA 4LBOA 3HIFA 4Y3OA 1HXS2 3MFAA 4AEDB 3D5OA 1UY2A 3IDCB 4CZSA 2GDFA 4QPIA 1SLAA 3LKJA 1WW6A 1V6MA 4XBNA 5FYVA 5T3NA 4XFBA 1IG3A 3T2OA 2D6LX 5DN2A 3I59A 2WC2A 1ASJ1 2P37A 1HIXA 1VALA 1OHFA 4QPIB 4NIHA 5IT6A 1PX3A 3WX5A 1LENA 1ZRRA 3GDBA 4CP1A 3POEA 1ZBE3 3I59B 5FYYA 2Q1MA 1ZBE1 2OA2A 2FDHA 4ASLA 4HN1A 3WG2A 4KL1A 5IK4A 3KV6A 3I49A 1X9TA 1JOPA 2R6QA 2X29A 4YM2A 3MF6A 3KCYA 4LIVA 3RZMA 3QH6A 3ZMNA 1HDKA 1FMD2 3KF5A 4D7SA 5DAWA 5BUVA 3T2PA 3KS7A 4DZGA 4RHV3 4CDXA 4RHV1 2JG9A 3B5LB 4V2VA 2Q30A 1CPNA 1SFPA 3CNAA 1H1MA 3PTRB 5FREA 4CDXB 3VZMA 2JG9B 3KVBA 1AX1A 2WUHA 4LHKA 4PI2A 2PYTA 2P1BA 1JYNA 3BU0A 4YRDA 2TUNA 1ASJ2 3GZAA 2ZGUA 5K9YA 3HNBM 3OG2A 4M3CF 3U0ZA 4LBKA 4YGCA 1OOPA 2VAUA 2D6KA 2Z69A 2ZMNA 1ZBE2 4QM8A 3U07A 3VD3A 1QJZA 3CHXA 1OF4A 2JDHA 5JMCA 4AVTA 4FXGB 4S2HA 2JENA 2UYAA 3S0MA 1OOPB 1JI6A 1ULPA 4QQHA 5HBAA 1QNYA 4EE2A 5A6ZA 3U4SA 4XBLA 1TG7A 2D5FA 3WINE 3Q8EA 4JHTA 4DXZA 4Y5SA 4FXKB 5BPXA 2G9GA 4LKSA 4RHV2 2WO2A 2HWB3 1IS6A 1UAIA 2HWB1 1Z7S3 2KA3A 3R05A 2QQIA 4FPYA 1PK6C 2Q0AA 2RR12 2VTXJ 2VNRA 3AMQA 1V9U3 4DY3A 5IATA 3HR9A 1SLCA 1V9U1 5FZCA 1XU2A 3I7DA 5CFDB 2BOJA 4MX3A 1X50A 3SCFA 1H2LA 4E2SA 3AKPA 1G8WA 2JE8A 2K0GA 1OT5A 1MS9A 3BI3A 3N4MA 5FYHA 4DXRA 3JB8A 4X8NA 2DVBA 4JGYA 2X5IA 3EBRA 4IV1A 1IPJA 3HMYA 5D8AA 4OHWA 4XJ9A 1JODA 1A78A 1REDA 3EQEA 4IESA 1NYWA 4R9CA 4XCBA 1KGYA 3VDCA 4JGYB 2X5IB 2G9ZA 2JE9A 4IV1B 3K46A 4R8HA 5D8AB 4OI1A 4BZ4A 2WSUA 3BPZA 4KGQA 5A7PA 5FPXA 4KWUA 3S5QA 4R52A 1Y43B 1OVPA 3IM0A 4Q4Y3 3VBUA 1JZ6A 3NJZA 4Q4Y1 4OMDA 3ZSJA 1K45A 1ND3A 1HRV1 2HWB2 2V5YA 3PU8A 1DIWA 3PUSA 3KWVA 1DQ6A 1J1LA 4LOSA 5J36A 1UPIA 4KH9A 4AI8A 3VBUB 1V9U2 3KHBA 3MBWA 3PUIA 4AFDA 1DDLA 3HBKA 1QMJA 2YMZA 1GQHA 3N7LA 3FHAA 4Q0PA 4H7MA 1AYM2 1KJRA 4EZHA 1DQ0A 2ZHKA 1F5FA 3FX3A 1K3IA 3VD9A 3ACLA 1C8M3 2J1UA 3B69A 3POGA 4AYUA 1AHSA 1B35C 2ZGPA 4QU2A 4GXLA 5LBCA 4Q1RA 4D94A 1KS5A 1X9PA 1O4YA 5FYSA 5A6YA 2SBAA 3OJBA 2NM1A 3WDXA 4QAWA 4K20A 1PMIA 3A7QA 3HT1A 3ZFEC 2XL7A 2VOTA 3KD4A 3AJYA 1XYOA 2VMDA 2H6BA 2B7YA 1UY1A 4JDMA 1UZVA 4CDQC 5GLUA 2GNMA 4Q4Y2 1LEDA 3AKQA 1HRV2 1JTZX 2GP5A 1QGLA 1W39A 1OD5A 2B42B 2YFUA 2GH8A 3O0XA 4O7XA 4QXHA 1FOD2 2VZQA 3O1UA 1ULEA 4MH0E 1YIFA 1F9KA 4DXTA 2IWGB 5GZGA 4XFIA 3ZXGA 2BWCA 4YZ3A 3RYPA 5A3OA 1L7RA 5IUQA 1W03A 2AC1A 5IAVA 4R9BA 2DBIA 2RDQA 1OA4A 5F3IA 5L19A 5JXHA 1WWYA 2Y6HA 3FC0A 2FD8A 2WQZC 1U5YA 3A22A 1GMMA 4NRPA 1LU2A 1WLCA 4XDQA 1D2SA 2D6OX 1GR3A 1UIKA 2EXHA 3H1MA 1H4HA 4J1XA 4JGZC 1GICA 2VZSA 4D6SA 3SH4A 3TEYA 5ABJA 2VW2A 1OFNA 1QJEA 3A21A 4FPGA 4CCOA 4M0HA 4OZXA 1GP5A 1CWPA 4XACA 4CP0A 1UYXA 3JZVA 3O0WA 3O12A 5FWJA 2P17A 5ABJB 2DCTA 3KM5A 4XZUG 3GZEA 4A42A 1CVNA 4E4DX 5A3LA 2Y60A 1IPKA 4MSVA 1W6NA 2QNKA 3UGGA 2BQPA 1GKBA 1UNBA 3PIGA 4PI0A 3OPTA 2ZTNA 4MLOA 4O9GA 4BQYA 3EO6A 1DGWX 2XVGA 5K7PA 1W8TA 3ZXEA 4ISRA 1GZTA 1YJLA 3PU3A 3WP4A 1JH5A 1QOTA 2DTYA 3MUZ1 2UWCA 1WW7A 4J25A 2ARCA 1PO13 2BEOA 2G9FA 1UQXA 4MGSA 1W9TA 4PDWB 1PO11 1UN1A 1APNA 2XBO2 4XDOA 5LBBA 4FOWA 2XG3A 2AEYA 1COV2 4N53A 3F95A 1QIQA 1AF9A 1WW4A 2HEYF 2VBPA 2J1AA 4OHXA 2RM21 4NJ4A 1E5IA 2P3KA 2IXIA 3D6EA 3I4IA 4OI0A 2X8KA 3FBYA 3GF6A 1CAVA 2WL1A 4N53B 3KGZA 4N90A 5I8YA 1MZ6A 1KFXL 4GB33 3LA2A 4QD2A 2RJKA 1KRIA 4GB31 1JBCA 4BJ0A 4MZUA 1CAVB 2PAKA 4M01A 1XU1A 2HEVF 3H7JA 4LO4B 4QB1A 5CB7A 3WP5A 5M0TA 4LR4A 4YGBA 5IHRA 3MW3A 4AR2A 4CDUC 5I8SA 1LOFA 2WRAA 3OPWA 1LGNA 2FHRA 4XMAA 3T3YA 3BB6A 1XXNA 4QDQA 4XOGA 4CU9A 1JHNA 4IEQA 4IE4A 4MYEA 5J98B 2O1QA 4META 2DV9A 3HVDA 2VQ0A 3MEPA 2VOWA 1MVQA 2RDSA 3H7YA 3UGFA 4TTGA 2JDKA 1PO12 2G4IA 5FZ1A 3VDDA 5FPZA 2WZPP 1OQEA 2VM9A 1BHGA 2X09A 1CZSA 2VZUA 2VXRA 4KU7A 4XFAA 4URTA 2RM22 2AACA 5DPNA 3VDDB 5EIYB 5ANQA 2YBSA 4K8FA 5DUXA 2ZGNA 1C3HA 2YG0A 1UMZA 4QX3A 3THTA 3WF0A 4DOUA 3SLIA 3MPBA 1HKDA 5FDBA 2ZHNA 5KHKA 2JJ6A 1YI7A 5DQ0A 4BXFA 1JOBA 3LEIA 1ND2A 4Q27A 3M70A 2G19A 3GCXA 4Q4V3 1TEIA 4F8AA 5LRSA 4Q4V1 5LEKA 3LE0A 5A1LA 2QQKA 4XIKA 2WQ8A 4ZXEA 4HLTA 4KBZA 2E32A 3SEPA 3W9AA 5H9PA 5CFCA 1MR5A 2Q8EA 3T0AA 1RHI1 3UKNA 1ND2B 5LA0A 2JXAA 1AUYA 4P08A 3U4XA 2CAUA 2P6HA 3LAGA 4JTOA 3AFGA 3ZYIB 5CFCB 3ROUA 4JV4A 2OXBA 4QGNA 1C5IA 4AEJA 4AWDA 4GULA 1VBC3 4XF4A 2NQYA 5C33A 2YDEA 3T2TA 3J9SA 2ZGLA 4P9IA 3WDUA 1NQJA 1GNYA 2VCMA 1J1TA 2GAUA 1VB2A 4A3XA 1EP0A 1YCIA 3ILRA 5FK8A 3CEWA 2AENA 5B4NA 2DUQA 2IXCA 1AYN3 4H7LA 2W2IA 3NNJA 1QF3A 2RS33 4LNVA 4EV0A 1L7LA 1YO8A 2ADDA 1EV13 2CAVA 2JE7A 2RS31 4KWJA 3AL5A 3M3IA 1EV11 1LECA 2W5FA 3BCWA 2WLPA 3ZYGA 2ZXQA 3E6DA 3POYA 1CONA 4Y1XA 5DAQA 5FY0A 3N35A 2P6CA 1W0NA 5FBZA 3ZLIA 1IZ3A 2QVSB 3CJIC 5FLIA 1CAUA 4ZXKA 5LEJA 5C9AC 3ZIXA 2BZDA 2VVFA 4QX2A 1RHI2 4D69A 3ACGA 1SLIA 3ATGA 2BERA 1OUXA 3TEXA 4K9SA 3O7OA 3DGTA 3BGAA 3ETPA 1N1TA 5FMOS 4B8EA 1CAUB 2VPVA 3OBTA 4LHNA 4AF9A 5AC93 2D5HA 5AC91 5KXBA 3JCIA 3WNKA 2D6NA 5T50A 5CISA 2IZWA 2ZZJA 5E88A 4CU8A 1PK6A 2IXKA 1JS9A 2P34A 3V0AA 2HH9A 3CU7A 2PQQA 4XAEA 3PDQA 3ZXDA 4CCKA 5FP3A 1DQ5A 4QPIC 2W1UA 3DN7A 1VBE3 1G6NA 4BK5A 1AL23 2WR9A 2E53A 3K48A 3V0AB 4M00A 1AL21 4RS5C 5ACA3 2RS32 4BK4A 4W6YA 5JSPA 2CU5A 2PQSA 5ACA1 5KWRA 2ZX2A 1EV12 1V6NA 3IDBB 3NW4A 4M4RA 5DXDA 5F8PA 2ZACA 1Y9QA 5JWPA 4XF1A 2LTNA 4N8MA 4AHWA 4CE8A 1BCXA 4GWIA 3TRSB 2WAOA 1GQGA 1QQP3 5FMDA 1T6GC 4D7TA 3D8CA 1ULGA 4GWMA 3S30A 3POWA 1FYUA 2DU1A 1SDDB 2LALA 2ZGQA 4Z82A 5JI7A 4DXSA 2XJPA 5LY1A 5KHIA 1Q8PA 3LD8A 3AP9A 1O3QA 1S0JA 2GMMA 2B4KA 1Q8QA 4TWTA 1S1AA 2W39A 4OQ8A 4NIDA 1V6LA 2JG9C 5CIRA 5FV3A 1UZWA 4GIQA 1SFNA 5FUNA 3MHZA 3WNLA 4FPJA 4QQ2A 2H0VA 2QTWB 2Y6GA 3NMBA 3WCRA 3VBSC 2ZOEB 1CAWA 3POFA 5FY5A 4P9WA 5FZ0A 3VBRA 4C90A 4EYUA 1S0BA 4HSLA 5JXIA 5IVJA 3HN1A 5KXDA 2Q1FA 5IFPA 1CAWB 2QQMA 1AL22 2D43A 2Q4SA 5ACA2 3VBRB 3NKGA 4E4SA 3ZFFC 5LA2A 3L9JT 3PL0A 1HRI3 2A6VA 3NJVA 1J59A 1HRI1 5F2WA 5A80A 1OKOA 2QQUA 2A75A 3O14A 5FWEA 2XUMA 4NRMA 1I9RA 3TN93 4RGGA 1W0OA 3TN91 2ZBJA 3H3UA 1D4M1 4XJAA 4YZ2A 4XFHA 4AEKA 1ZNPA 4CDWC 1O3RA 1YUDA 3MLKA 2WKKA 4QXBA 2GP3A 5D1IA 1OMIA 2OIIA 4AFBA 4KQ7A 4COUA 3W5NA 4XUNA 4CCNA 1LHWA 1SCSA 2XR4A 1UOBA 2OYZA 4N7IA 1N1VA 2Z79A 1DGLA 2QCSB 2VNVA 1YQCA 2WNVC 3FE5A 3J7HA 3OF1A 4QHOA 5FCCA 1TE1B 1W28A 2RHPA 3UYJA 3IMMA 4DEVA 3OGJA 4FPFA 4XQDA 3VDBA 3GHMA 2VE1A 4I0WB 2PTMA 5F1RA 3T0DA 5D8AC 2X5IC 4IV1C 1OC1A 2YV8A 2XLAA 1YHFA 1HRI2 3FZ3A 1PGL1 3RVHA 4JGZA 5CAZA 1YQ5A 5C70A 3NJYA 3D0JA 1NLSA 3FN9A 4DEQA 4OZOA 2WS93 3ZR6A 4B4QA 3VKMA 3P1IA 2WS91 5DDJ2 1O59A 1D4M2 1H6XA 3I8TA 2OUJA 3ZN4A 2LRPA 1XJAA 2RVAA 4JCKA 1EAH3 4PCRA 4Q8LA 1IGOA 3VBUC 3PTYA 1ST8A 1YJKA 1W9SA 1RINA 4QXKA 3WDYA 3JQXA 2ZEYA 2FCTA 3D3AA 1AR81 1ULCA 2DTWA 1PNGA 1ULFA 1F2NA 3TNPB 5JXGA 3MIGA 1OH3A 4NWVA 4XHBA 4JDOA 1ENQA 2Q8OA 3SQOA 4P9YA 1REFA 2HWE3 2JD9A 1BXHA 1KITA 1VAMA 2R16A 5FY1A 4AI3A 5BY5A 5CYYA 1WCQA 4AGGA 1P8JA 1PGL2 5J37A 1CZTA 2DU0A 3BUCA 2UY8A 1RTVA 2WYFA 4I09A 1ZRCA 5H9QA 2WS92 1PIV3 3INAA 1ACCA 4L9BA 2PLV3 4XCAA 5FR3A 1PIV1 1JZ2A 2VQTA 4LLOA 5AVPA 2VECA 4Y4RA 3NV3A 4EN6B 3WY6A 1ENXA 3AP4A 4HK9A 2WA4A 1AJKA 4NHYA 3RFRA 1W8OA 4IEXA 3HT2A 3S5AA 1IQDC 1AR82 4QMAA 3R4UA 5F6KA 4CDUA 3D0SA 1HB1A 3MO4A 1DLCA 3PVNA 2EALA 2Q8DA 3VKOA 1PM7A 3MW4A 3QOPA 4XF9A 2BBAA 4UBGA 4BQ1A 4IW3A 4QT6A 4URAA 1UO9A 1S0IA 1XE0A 1RMU3 2XPJA 1GWKA 3NL1A 2Y26A 1EPZA 1RMU1 5LCWL 4LO5B 3ZMOA 4BLIA 3MLJA 4YZ4A 4EN9B 1G7YA 2Y6LA 2F6BA 1H2NA 1PM4A 1GWMA 1REEA 2ET7A 3GXUA 5FXZA 3T4HB 3VD5A 2ZEZA 1YEWA 2WNOA 1PIV2 1YLLA 5BNOC 2K46A 3BOWA 3LSDA 3VHOA 1QNWA 5L9RA 1RVF3 1UX7A 1RVF1 1RYYA 1ENRA 2DUOA 4PLMA 5C5UA 5FP4A 2PFWA 4PIXA 2K2SA 4I0BA 4CCLA 2EAAA 4ZY9A 4GJZA 1OLRA 1KFUL 4QKDA 4UFJA 3SKJE 1OXCA 5JMOA 4Q4W3 4AVSA 5GKAC 1VRBA 2BP6A 3DEMA 4Q4W1 5A7SA 2XQXA 4PDWC 3GNEA 4NROA 4QXCA 3LB9A 2VMGA 3RWKX 3DKWA 3LGRA 5FQ0A 1H0BA 4ZU5A 4B29A 2PHRA 1VR3A 1AXKA 3FBMA 2JDAA 2JKBA 1WZXA 5EHDA 3U11A 1ULOA 1PVC3 2OT7A 4CEYC 2B5HA 1UKGA 4UW6A 2QQPA 5FQ0B 2W95A 1RMU2 2BOIA 1I3HA 1W8FA 5CA6A 3GALA
chains in the Genus database with same CATH topology
3AXEA 4AE2A 4XJZA 1FV2A 2VY0A 1XNDA 4YG6A 2VOVA 1TQ5A 2BFUL 1BVP1 2A6XA 1RVF2 4HT1T 4RD7A 2ATFA 4ES8A 2GC2A 2K9ZA 4I0AA 4FAGA 4XFFA 1QJY2 1CR7A 1TNFA 4Q4W2 3ZSLA 2E51A 4N9HA 3CJIA 5C9AA 4HSJA 3AYDA 1H4GA 3BTAA 4DRVA 3ZO0B 2EXJA 3VDDC 1LEMA 5C9AB 4AVBA 4GH4C 4OFGA 1KQRA 2PA7A 4COVA 1WGPA 2ES3A 4PLNA 3SHRA 1J3QA 2BGCA 4NHLA 3L2HA 3V65A 2O0OA 1YRZA 2E9QA 2XWJB 3NVCA 3MLLA 5CVRA 1L3JA 4DS0A 1JYCA 1TNRA 2VQAA 1S55A 3PVBB 3KZ4C 4P14A 4RS5A 2FZ1A 4IEUA 3ELNA 5JOWA 4LBQA 2BUKA 1ND2C 2XHKA 4LUKA 3VZJA 4E4ZA 1WMDA 1HV0A 3N36A 5I0RA 4RS5B 2AYHA 4BHPA 1LR5A 3SMHA 5CFCC 4LBQB 5FO8B 2WT0A 1RITA 3HQXA 4W65A 3RYKA 4X6QB 4JDNA 2VVDA 2ENRA 3ZPYA 2EXKA 5EV7A 3E97A 1O91A 1ENSA 4FPLA 1R1A3 1R1A1 2KM2A 3LA3A 4I01A 3VBSA 1LULA 4W6WA 4DB5A 2A7AA 3OCPA 1A8DA 2QDNA 1LHOA 2UWBA 3VBSB 3B94A 5CG9A 5J3UA 4C91A 1Z78A 1I5ZA 4TYSA 1RUD3 3ZFFA 2VOKA 1RUD1 1CQ9A 4QQOA 1IHMA 4BYYA 2OZJA 2XJVA 2BNNA 4PBOA 2JD4A 5FLHA 3ZFFB 3HAGA 4LT5A 4KG0A 2PAEA 4FAHA 4CDWA 1U12A 1EYBA 4U36A 4LA3A 1YFXA 2HWF3 3ZN6A 3M3EA 4WM8B 3VBFB 3WUCA 1DZTA 3M3OA 4CDWB 4HVRA 2ZS6B 1Z7S1 4YM0A 1R1A2 2QZ2A 1OLQA 3IT8A 3RQ0A 1EPWA 3B02A 3ZN6B 3AX4A 3M8LA 2DCJA 2GALA 5LK7B 1RUH3 2WNVA 1RUH1 1S2KA 4DNYA 2NMOA 3TNQA 2C5DA 3AYCA 2CYFA 3M4FA 5JOZA 1DGRN 2DVFA 2WNVB 3N7KA 3AZZA 1UCXA 3PVEA 2XGXA 3PHMA 1O5LA 4RQPA 3A4UA 3WZ1A 2OUHA 5E16A 2VH9A 4RA0A 2IXLA 2H0BA 3B9IA 1FX5A 4RQPB 3IWZA 1V6IA 4IERA 2PHLA 1IS3A 1DYKA 1Z7S2 4AVCA 1VBA3 4YLZA 1HQWA 1R083 2CWSA 1HLCA 2ZPXA 3AK0A 3I54A 2ZA9A 3VBRC 2VMHA 3ZXFA 1UKRA 1RUH2 4HETA 2YXSA 3UL2A 3M2MA 4Q29A 4G9SB 4M3CE 1C8M1 2Q1ZB 4FSJA 4Q2FA 1DF0A 3RWNA 1Q8OA 2R063 5CNAA 4JRAA 4YFWA 3RSJA 4CEWC 4XIOA 1AZDA 2WFF3 3W59A 4OHZA 1MS0A 4WBBA 4HVOA 1ZVFA 4LUMA 4A2UA 1CN1A 1FXZA 3AM2A 1O3TA 2D7FA 1SBEA 2MEV3 3AB0A 5I8TA 3WVJA 5T55A 2MEV1 1D0GA 2JDZA 1CPMA 3GZUC 2NYYA 4IV3C 4Q0VA 2BVBA 4Y1ZA 4KG8A 3OYWA 1H2MA 4Z2WA 4EN8B 1C8M2 5I91A 1MS4A 1OA3A 1WW5A 5T5LA 2CV6A 3AFKA 3J4UH 1XRUA 1X8EA 3OYWB 4OHVA 5L36A 4ATFA 2PELA 4AGRA 2MNGA 4WVVA 1ZRDA 1GNZA 1HW5A 1SMVA 5BNOA 2BTVC 3VKFC 3AKSA 4H55A 2WINB 2R32A 3OTFA 4BA6A 4FQZA 3MGUA 3I2DA 2JX9A 2C1FA 5BNOB 5CFDC 4ASMB 1DZQA 2MEV2 2ZGRA 3NSTA 4HL0A 2EVXA 1S0CA 3WT3A 5KC5A 4WVMA 2FQPA 1C4RA 2ZX4A 4PDWA 1DFQA 1YIPA 3FHIB 1KDMA 2YROA 1VIWB 3EJKA 3OD0A 4WVMB 3ZFGC 2XVKA 3E5UA 4CEYA 1RC6A 4J1WA 4ISQA 5BNQA 5K0UC 1AVBA 1LJ7A 1QKQA 5A3MA 5B2GB 4MGZE 4CEYB 2MHFA 1UF2C 2UU8A 4Y20A 1G9AA 5J48A 1NY71 4L99A 3R6SA 4F3JA 3CJXA 3WG4A 2ZMLA 5FTTC 1BEV3 1NA1C 1BEV1 3AMHA 4Z92B 4Y20B 2ZKLA 2Y0IA 3TOJA 4COYA 3M1HA 4FPHA 1X33A 3ZIWA 4LA2A 5GLZA 2GSYA 3ZSKA 2SLIA 4IXLA 3OY8A 2WQ4A 3DL3A 2CY6A 4ATEA 1RL3A 4IEZA 3B3QE 4GH4A 1RUF3 2H6CA 4UW5A 5JZGB 2VGDA 2BVVA 1GANA 1VBB3 3OY8B 2VNOA 1VBB1 5JOYA 1AXZA 5BXXA 3H50A 4M0NA 3KB5A 4XE9A 4GH4B 3WQ7A 4FTSA 2PHTA 2QFEA 4Z8BA 1DYPA 5HCFA 1ZZ9A 1NY72 5EYYA 4AVAA 1UU6A 1V00A 4G3YC 3SXWA 4NOTA 5JLVA 2A3YA 3CLPA 4EWEA 4GB32 1G9DA 1BEV2 1W6OA 4O9EA 3S7IA 4JTNA 4P9XA 4C0HA 1LOAA 1G9CA 3POSA 4B4RA 1IQAA 1W6OB 2F4PA 3MIFA 2XKPA 4AQSA 3ASIA 1AX2A 2P2KA 1C28A 3VKLA 4FT8A 1PO23 4LTAA 4PQ9A 3EHKA 1PO21 3IPVA 1R093 1VBB2 1VBC1 3APBA 2RMU3 1R091 1O5UA 1RUI3 2A5ZA 1RUI1 2RMU1 1X82A 4K6BA 2XB6C 4MV2A 1LHNA 3R0RA 3IPVB 2DCKA 3ILFA 4IETA 2DFBA 1AYN1 1IKPA 2ZJCA 3FLPA 1BK1A 5AFEA 1Q8SA 1AR73 4Y1VA 1ALYA 1AR71 5T52A 4K7JA 4L2NA 1XYNA 2CGOA 4AXOA 4Y22B 1MACA 4AQTA 4Q4V2 3AZWA 2ZX3A 3AKRA 2YY1A 3GYDA 1ZZ6A 1W6MA 4OUMA 1M06G 1AR63 1RJ8A 1UU5A 5J7MA 4CTEA 3B9CA 4BM8A 2AZ5A 5A32A 2BPA2 2DWRA 1W6MB 4K1YA 2HWD3 1QXJA 3DUIA 4FOVA 1KXGA 5TSWA 2VW1A 1PO22 3TYJA 5A32B 5IK5A 1VBC2 4HANA 1R092 1JUHA 2IC1A 4HKWA 1RUI2 2RMU2 3VBOC 4BMBA 1LKNA 1BKZA 5KHHA 4LO6B 1MS3A 3RZZA 1G9FA 4LE3A 1VBE1 1XNBA 3ZSEA 1AYN2 1UZZA 3B01A 4SLIA 1AR72 3R4DB 3SISA 2UYBA 1O4ZA 2VMIA 2R0HA 5I0SA 4XQWA 1BQPA 1QQP1 1FT9A 2AREA 3ENRA 3MFCA 4C1XA 1LHUA 2A70A 5CG8A 3NWKA 3V64A 2AH2A 1LOEA 4N9IA 3SH3A 4EN7B 4DPNA 3JUUA 1SLBA 4K1ZA 5AC92 3KGLA 3VZOA 1H1AA 2BBVA 2OVUA 1RUC3 1PZ7A 1BBT3 2HKXA 3H1WA 4OUSA 4XXPA 1RUC1 5GLVA 3MIBA 3GBWA 4N7UA 2O8OA 3CL1A 1N3OA 3RPQA 4OHYA 1VBE2 1ZA4A 2I74A 2VULA 4E27A 4UW4A 3ZX7A 1OPOA 1NLRA 5K8SA 2XWBB 1QWRA 1XNCA 2EIGA 3NAPC 4P5HA 3AP6A 4JRLA 3ZYPA 1YYNA 4OLLA 1X8MA 4CEWA 4COZA 1SFYA 5GLWA 4QPGC 1QQP2 1KD7A 4WM8C 3VBFC 1YXWA 3IKWA 2D6MA 4CEWB 1WMFA 4YGEA 1GV9A 4AFAA 4FP3A 2O8QA 1HV1A 3S6PA 1S0DA 3BALA 2E6VA 4GMP0 5T54A 3BU7A 4FTEA 1JN2P 1X36A 5I0UA 5L7OA 1RUC2 3BODA 3LOBA 3WCSA 4IV3A 4Q4X3 4WM7C 1LOCA 3AYEA 2ZHLA 4YM1A 1F5JA 3SH5A 4XXAA 5L7OB 4CYDA 2A3XA 2I45A 1XE7A 4IEWA 2DUPA 4XJ8A 2TEPA 4Y1YA 4EJRA 4XF3A 4IV3B 1GZWA 1WBLA 1Z0HA 2E7QA 4H14A 2NLRA 2R0FA 3NV1A 3TAYA 1QJX3 4AQ6A 4BMEA 1QJX1 1GZWB 5LRRA 5BYNA 3TN92 4RQPC 3SCHA 1J3RA 3RJRA 3QD6A 4GKYA 1O3SA 1EAH1 3ME2A 2ETEA 4B7EA 5CFDA 1H8VA 3OBRA 1ULDA 2BFUS 3J8F3 5GM0A 3J8F1 2YHJA 3BIWE 1W6PA 3LZZA 3O5SA 4R9AA 5EYXA 3USSA 3WDTA 4TLFA 1NZCA 4XFGA 4RL7A 2FBEA 4A7YA 5CFDB 4E2QA 1U0AA 1XYPA 4RSUA 4UXAA 1H8TA 4XEZA 4FBFA 1W6PB 2ZMKA 1FPN3 3QCWA 4KU8A 3PVOA 2HWC3 1FPN1 2HWE1 1AJOA 3RJ2X 3ZFGA 1AXYA 5FOBB 2EA7A 2WA3A 2VU9A 1H8TB 1POV0 2HEWF 4I02A 2ET1A 5K0UA 2N7GA 2E7TA 3ZFGB 4ONUA 4ZU7A 4ZKTB 4HKOA 2VOXA 3M3QA 3N3HA 4OVEA 2PLV1 3WHUA 5K0UB 2RS53 4IEPA 5I93A 3AMNA 4YYOA 2RS51 1EAH2 3RI9A 5KC6A 1NA1A 5EZWA 4S2GA 4XPVA 4YZ5A 3Q9OA 4F83A 5EFUA 3B00A 2GMEA 1NA1B 4LBJA 2IXHA 4D7YA 4BH9A 1LGBA 4N43A 2FMYA 1Q5OA 4NO4A 4R9DA 2QUOA 1FPN2 1UX6A 2HWE2 1N47A 3FFQA 2EXIA 2YGLA 3MI8A 4FPOB 4N43B 4BZ4A 5JR7B 1UU4A 2A6WA 3VZKA 5IK7A 2I2SA 1HQNA 4HN0A 4JVAA 2UURA 2OZ6A 4PJYA 3RMYA 2HYKA 2PLV2 2ZX1A 2GH2A 3QLQA 5JPNB 1DGRA 2RS52 4AFCA 1Y3TA 1X7NA 2DYCA 1C1FA 5FFOC 2WWSA 1MS8A 3FFZA 4OI2A 4BOWA 2VUAA 4RFT0 2XL9A 1JXNA 2ZGTA 3JD73 2QZ3A 3MIEA 5C6CA 3JD71 1YFWA 5T5PA 5GJ6A 1QY4A 2R49A 1QH7A 2IFWA 4GMP3 4YW3A 1QU0A 4GMP1 4K3UA 1PVC1 5LK5A 3E5QA 3AZYA 2PHFA 5EXOA 1ZZ8A 5DZEA 1XQNA 4DINB 1SDWA 3PNAA 2JICA 1LRHA 2A73B 1LHVA 4AVVA 2ZAHA 4LULA 4WZFA 4QQLA 4Y5Z0 5KHJA 1YNAA 1MZEA 3E6BA 4Q1PA 4AHYA 1MQTC 2ZAAA 4EWDA 1YI9A 3PJYA 3AZVA 4X8PA 5GALA 1H9PA 3KT4A 3ST7A 3TBDA 4OI4A 2WT2A 3JD72 2QJVA 4QPYA 4MXVA 3WG3A 4HPKA 2A6ZA 4HMZA 5JZGC 4IL7A 1VB4A 2XJUA 2WSVA 3IMNA 4W6XA 2Y38A 4KWLA 1PVC2 4HPKB 2BWAA 3IIAA 1U5ZA 4AW7A 2GMPA 3VBOA 3ALQA 5JVVA 5T5OA 3MDPA 3KLSA 4YG0A 1C1LA 5FOJB 3LCPA 2E7AA 5F5QA 4LLFA 4XETA 1FMD3 1ZRFA 3VBOB 3WD5A 1POV3 2CGPA 1KDKA 1POV1 3WW4A 1M4WA 3N7MA 5GZDA 1F8VA 3QH7A 4HK8A 3UKVA 1HQLA 2PHDA 1V6OA 1XNKA 1AR93 1AR91 3VV1A 4NVPA 4A7KA 2RJLA 4PIZA 3KSCA 1PVXA 3B7MA 4WV8A 4MGYE 2YYOA 1GBGA 3T1LA 4R4ZA 1S0GA 5CADA 4ORFA 1ASJ3 1MS1A 4FPEA 3IBMA 4LO7A 1SBDA 3GHNA 3L2YA 4Q8KA 1I6XA 2Q5TA 1VP6A 1WD3A 4P9LA 4QGMA 5BNNC 4V1PA 4XFCA 4YARA 4I2OA 5HXVA 5JPMB 3AXDA 4YGDA 4EROA 1E57A 4AHXA 4YZ1A 2CWMA 3DPRC 5A33A 5KXCA 4BPZA 3NAPA 3H1YA 4J6GA 3UJOA 2WZR3 3OGGA 1N3QA 2WZR1 3P3NA 5CU1A 4C1WA 4HBNA 4HVQA 1AR92 1MZFA 2RR13 4L8QA 5BNPA 5CA6A 4QPGA 5A33B 2RR11 1WLDA 2GC0A 2VUJA 1NCRA 3NAPB 2MPFA 4WM8A 2XLFA 3VBFA 1NG0A 2JG8A 5BNPB 1NXD1 1H30A 1G86A 3FWEA 4QPGB 2KXLA 3IDEA 5E89A 5JIUA 1NCRB 3FMGA 4AG4A 1ZM1A 2HWF1 2A3WA 2W0XA 4Z1VA 2JG8B 1VRH3 4QGLA 1VRH1 4BCUA 2PHUA 2DCZA 3NV2A 1RB8G 3SNMA 3OD4A 2CL2A 2UWAA 2WNEA 5DG1A 2JECA 5GZEA 4WM7A 5I0TA 1VLNA 3MZHA 2PHWA 3G7DA 4NPRA 2R073 5K7PA 2Y0OA 4WM7B 2R071 3PMSA 1RJ7A 4Y1UA 5J96B 1RUD2 2GN7A 1VBD3 1NCQA 2WZR2 3H0OA 1VBD1 1JW6A 2DVAA 5C4WA 2B45X 1LOGA 1YFYA 5JDBA 3MICA 4MGIE 3V0BA 4FTBA 1NCQB 3FUOA 4A7ZA 2IFRA 2NZ9A 1AYM3 1DLLA 1AYM1 2TNFA 5C4WB 4Y26A 4AEMA 3V0BB 3WLUA 4UBHA 2HWF2 4XJUA 1J58A 4GQ7A 1VRH2 1S0EA 4MXWA 2YUEA 1VBA1 1R081 4YVWC 2B39A 1U5XA 4MXWB 4FP2A 5GZFA 1QXRA 2D98A 1V70A 2R072 3FJSA 1Q3EA 2IXJA 2R061 3SCGA 4DY5A 3UJQA 2FZ2A 4P9JA 3MW2A 3K51A 4XTPA 1HRV3 1VBD2 1W2UA 4PF5A 5EWSA 4EWAA 1FOD3 2WFF1 4PLOA 1FOD1 1LODA 5FO7B 1SBFA 4LBQD 4FOQA 1ND3B 3R4SA 2D3SA 2WNUC 5JSOA 2BW8A 4ITCA 2BYVE 2D3PA 3ETQA 3WXPA 4KBBA 3JB4C 1DQ4A 3VKNA 5L7OC 2P3IA 4LHLA 1VBA2 4COWA 4K40A 1R082 2NMNA 3WW2A 4S2DA 3VHPA 1CESA 3W58A 3QACA 5AFBA 1GFF2 3MPPG 4DQAA 4FPCA 2ARBA 3PJQA 2A71A 5FAXA 4YFZA 3ZYRA 1U5IA 1D0HA 2R062 3PMEA 4AQ2A 1I1EA 5CBLA 3VL8A 3KQRA 4PIYA 1J3PA 1LGCA 3MIHA 2DCYA 3WV6A 3G6JB 4OULA 2WFF2 1TMF3 3E6CC 1UW8A 1TMF1 1RIRA 5C8CA 3D82A 3MYXA 2D6PA 2BNOA 2GNDA 2GC1A 1OPMA 1UD1A 1ZREA 5JI9A 1OKQA 4S2FA 5C8CB 1DG6A 3B93A 3WW3A 2XBO3 2YC0A 2XBO1 1K5MA 3KCCA 1QJU3 1YWKA 1COV3 2QE3A 5GLTA 4FO9A 1QJU1 1WA4A 1COV1 1QXPA 4L11A 4NWWA 1DBNA 4RGAA 1H8TC 1NE4A 4YVSA 1K5MB 1FV3A 4GKXA 1OQDA 3QBQA 2OPKA 2RE9A 3VBHA 1GZCA 1BMV1 1ZX5A 2ZCWA 4XBQA 3WHTA 1O7FA 4YVSB 1RUNA 1UZYA 5JCTA 2B8MA 1H9WA 3RS6A 4K21A 3VBHB 4ES9A 1NE6A 1TMF2 2Z5WA 3A0KA 1WCKA 2E63A 3GZTB 4RR3A 3GBGA 2NP0A 2X53S 1W6NB 1CIWA 3A0NA 1RUE3 1MQTA 1RUE1 3JQWA 3PLQA 4RR3B 2ZKNA 3M3CA 4E2GA 4XMIA 1GLHA 3WP6A 5KBFA 1MQTB 1QJU2 3UV9A 1MVEA 4Z07A 4EN0A 2RM23 1Q43A 4YM3A 2WJSA 2WT1A 3OPZA 4N43C 3WR0A 4AHZA 2XJTA 3ES1A 3HBZA 5JZGA 1DQ2A 1BMV2 4YW2A 2HJIA 2GC3A 4MGKE 4XYXA 1FNZA 3BOPA 2XH6A 1RUF1 4AK3A 3WDVA 4XW3A 4L97A 4XQ4A 3T1MA 2AUYA 4QX5A 4YW1A 3VHNA 4R4XA 2VG9A 3RYRA 1JYIA 4PBPA 2WLQA 5SV5A 4GA9A 2R30A 4D3WA 1RUE2 1B09A 4XZPA 5DZFA 1W6QA 1Y7BA 4I30A 1FATA 3AP5A 1ONAA 5FLJA 2ZGOA 5JIAA 1NOVA 1S0FA 2PN5A 1W6QB 3X29B 1DZRA 3ZXLA 1CJPA 3VLBB 5DUWA 2D93A 3VL9A 3WG1A 2W68A 5J09A 1SLLA 1G9BA 1RUF2 4GWNA 4F7ZA 1LOBA 4YG3A 1GNHA 1MEC3 2LUWA 5BNNA 1MEC1 3AMMA 2ERFA 2DVDA 4XILA 2ZX0A 1RHI3 3NV4A 3H8UA 4Y22A 4B4PA 1SQ4A 4IEYA 3WUDA 5BNNB 1UIJA 4QQPA 2W08A 3DPRA 4XF0A 1CGPA 2GZWA 3SITA 2RS13 1Q8VA 3WDWA 1BYHA 1RUG3 2RS11 4TZDA 1AX0A 1RUG1 3DPRB 2P3JA 3S7EA 4QHBA 3NO8A 1A6CA 1AR61 4Q0SA 4WVZA 3VZLA 1SCRA 2D44A 4FVVA 5EJ3A 4JQRA 3P3PA 2HWD1 4YSFA 4U2AA 4E9KA 1ZYBA 2CTVA 3ZXAC 1WLTA 1JUIA 3ECQA 4LBMA 4AGVA 1MEC2 1DHKB 1RUJ3 5KXEA 4KGGA 3RDIA 1RUJ1 3AZXA 1D4VB 3AYAA 4NHKA 3VGIA 2DVGA 4XJWA 2AR6A 1QOSA 3MF9A 1VAKA 3WP3A 1WCDJ 4BLJA 4BE3A 4AEDC 1LCLA 2GN3A 3ES4A 1W0PA 2RS12 3HD8B 4IEOA 1RUG2 4BIOA 3TWIA 4MVTA 1AR62 3IN9A 2GNBA 1CAXA 1WCSA 4LEJA 4JAAA 3CO2A 4H3WA 4Y4YA 1F31A 3JU9A 2ZZQA 3RRDA 1LU1A 1PK6B 2HWD2 1KS4A 1CAXB 3E5XA 5DG2A 4DMIA 3VHRA 2R1BA 4CRQA 1BBT1 4XTMA 2YGMA 3AP7A 4YVWA 1MS5A 1RUJ2 3FLRA 3WQ1A 3ZXJA 3FLTA 3LA7A 3ZSMA 2XJRA 2ZHMA 4FPKA 4YVWB 1ZBA3 3C2UA 1ZBA1 1OFSA 1PHMA 1WUVA 1BJQA 4CDXC 5BNPC 1PNFA 2PHXA 1PZ9A 1NCRC 2YPJA 5KHGA 5H9RA 2JG8C 3AMPA 3WNXA 2AGSA 1OI6A 2WNUA 4WVWA 1CJDA 4HKLA 3WW1A 1B35A