5CFCC

Crystal structure of human cardiovirus safv-3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
258
structure length
258
Chain Sequence
b'SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
molecule tags Virus
total genus 53
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcC00
5A32B 4JGZB 2HWE2 4PDWB 4SBVA 1FOD3 3VBHC 5CFDA 4YVWC 3TN91 1X36A 1PVC1 1VBD3 3ZXAC 5BNPC 1AR81 1AR92 5DDJ2 1AL0G 2GSYA 3VBFC 1HRV2 4WM8A 5D8AA 4QPIB 1ZBA1 5BNOA 4GH4A 2GH8A 1RUH3 3VBOC 4CEYA 1MEC1 4CDWB 2R062 1TME3 2X5IB 4RS5C 3VBUC 1SMVA 4RHV1 1R083 3VDDA 1QJX3 5JZGA 2Y26A 1PO22 1RUI2 4GB31 4CEWC 4CDQB 2MEV3 5ABJC 1QJU3 1TMF1 1PGW1 5ACA2 1CD3G 3JB8A 2WFF2 1RUJ2 1X33A 1FMD1 2RR11 4JGYC 1POV3 1V9U1 1B35A 1OOPA 4N43A 5CFCC 1BBT2 4IV1B 5C4WA 2PLV2 1NA1A 2ZZQA 4FTEA 2HWD3 3ZFFB 4IV3C 1VBD1 2BBVA 1BEV2 4CDXB 2R071 5AC93 2VQ0A 1ZBE1 4AEDC 1AYN2 4NWWA 1RUF1 1R093 1C8M3 1RUH1 5BNNC 4QPGA 1R1A1 1HRI3 2RS51 1COV2 5K0UB 3VDDC 5FMOL 4WM7A 1EV11 1RUD3 2HWB2 4Y5Z0 1BMV2 2RM21 2HWC1 1RUG2 5GKAC 3ZFGB 2RS31 1RUE2 1ND2A 1RUC1 1QQP1 3VBRC 2WS92 1E57A 1RVF2 3VBSA 2BFUS 3TN93 1QJU1 1MQTB 2XPJA 1PVC3 1B35C 1H8TA 1OOPC 5FOJB 3ZFEC 1NA1C 5L7OA 1NCQB 1POV1 2ZTNA 1NCRB 2WLPA 1VBE2 4RFT0 1ZBA3 2XBO2 4CDUB 1VBC1 3J8F3 4Q4V2 1ASJ3 5C9AA 1VBB1 1QJX2 5AC91 1PGL1 1RMU1 4QPGC 1VRH1 4Q4X2 5C8CB 1OPOA 3JBG2 4RHV3 1DDLA 1QJY2 1VB2A 3JD72 4GMP1 1C8M1 1AUYA 4Q4W1 1PIV1 2RS12 4GB33 1D4M1 1HRI1 5A32A 1Z7S2 4JGZA 4PDWA 2QQPA 1ND2C 3VBHB 1AL22 1FMD3 4YVWB 2HWE1 1NG0A 1K5MC 1V9U3 5BNPB 1VBA3 1RB8G 2R042 2HWF2 3VBFB 4QPIA 1AR91 2FZ1A 1FPN3 2FZ2A 2DF7A 1EAH2 2R073 1HRV1 3VBOB 1ZBE3 1W39A 1POV0 4CDWA 1RUF3 1NOVA 4N53C 4Q4Y3 1PO11 4RS5B 1RUD2 3J8F1 3VBUB 2BPA2 1R1A3 2R061 2RS53 1NY72 1AR62 1ASJ1 4FTBA 1EV13 4CEWB 4CDQA 2ZAHA 2RM23 1PO21 2HWC3 1RUI1 5ABJB 2RS33 1IHMA 2WZR2 3NAPA 1RUC3 2RMU2 1QQP3 1AR82 4JGYB 5ACA1 5CFCB 4IV1A 3LOBA 1HXS2 3ZFFA 1AR73 5CFDC 4IV3B 1BBT1 1MEC2 2PLV1 3FBMA 1VBA1 1RHI2 4AEDB 1VBC3 2BUKA 4WM8C 5D8AC 5BNOC 1FPN1 1VBB3 4GH4C 4RQPA 5BNNB 3CJIA 1RMU3 3IDEA 1VRH3 4CEYC 5K0UA 3VDDB 4GMP3 1TMF2 1OHFA 5FMOS 4Q4Y1 4Q4W3 5A33B 1COV1 1PIV3 3ZFGA 1D4M3 1A6CA 2RR12 2HWB1 1BMV1 4EJRA 5JZGC 3VBRB 3NAPC 1RUG1 1FOD2 1RUE1 4YVSA 2HWE3 1B35B 1OOPB 1RVF1 1VBD2 3ZFEB 1NA1B 1NCQA 1NCRA 1QJZA 1ND3A 4CDUA 1AR93 4N43C 5DDJ3 1RUH2 5C4WC 1HRV3 1VBE1 2XBO1 5J98B 1AR71 4FTSA 4RQPC 1PO13 4QPGB 3CJIC 1TME2 2R063 1WCDJ 1AYM1 1R082 1VB4A 1GFF2 3JBG1 1RUC2 1QJY1 3JD71 1PO23 1RUI3 4RR3A 1CJDA 2RS11 2MEV2 3VBHA 1QJU2 1ND2B 4WM7C 4LLFA 1Z7S1 4YVWA 3DPRA 5ACA3 1K5MB 4YVSC 5BNPA 1AL21 1RUJ3 3VBSC 1ND3C 1BBT3 2HWD2 2PLV3 2HWF1 1H8TC 5AC92 5L7OC 1BEV3 1EAH1 4N53B 1R092 1C8M2 4NWVA 1AYN3 4RS5A 3VBUA 1M06G 5DDJ1 1HRI2 5C9AC 4CEWA 2WWSA 4Y4YA 5LK7B 2X5IA 1NY71 1COV3 5ABJA 1F2NA 2HWB3 4RR3C 4JGYA 1RUG3 3DPRC 1RUE3 2WZR1 4GMP0 5CFCA 2RMU1 3TN92 2WS93 1RVF3 4JGZC 1PVC2 4PDWC 4IV3A 5CFDB 4Z92B 4AEDA 2WFF1 1RUJ1 1ZBA2 1HXS1 1PO12 3J8F2 1VBE3 3DPRB 2XBO3 1RHI1 4QPIC 4WM8B 5D8AB 5BNOB 5BNNA 4GH4B 1ASJ2 4CDXA 4Q4V3 4CEYB 4CDWC 3HAGA 3S6PA 1BEV1 1AYM3 4RHV2 2IZWA 5A33A 1AYN1 4Q4X3 2X5IC 3JBG3 1QJY3 3JD73 4FSJA 4GB32 3VBRA 2RS13 5JZGB 3NAPB 1PGW2 1Z7S3 4CDQC 3M8LA 1VAKA 1FMD2 2TBVA 3ZFEA 1AL23 1FOD1 1V9U2 1HX6A 1VBA2 1MQTA 2WS91 4N43B 4IV1C 2R043 1FPN2 2HWF3 5C4WB 2R072 1F8VA 1ZBE2 3ZFFC 1EAH3 1RUF2 3JB4C 4RQPB 4CDXC 3CJIB 4Q4Y2 1R1A2 2RS52 1TME1 1EV12 4Q4V1 5C8CA 1AR63 1R081 1QJX1 2RM22 5K0UC 2HWC2 2RS32 4WM7B 4Q4X1 1QQP2 1K5MA 2MEV1 3ZFGC 4YVSB 2WZR3 2RMU3 1AR83 2BFUL 5J96B 3VBSB 1ND3B 1AR72 1MQTC 1H8TB 2WFF3 1HXS3 1HQNA 3VBFA 1VBC2 1MEC3 2HWD1 5L7OB 1NCQC 1NCRC 4N53A 1RHI3 1AYM2 4CDUC 1C8NA 2R041 1VBB2 3VBOA 1PGL2 1RMU2 1R091 1VRH2 5C9AB 4BCUA 4Q4W2 1PIV2 5C8CC 1D4M2 1TMF3 4RR3B 1RUD1 2RR13 1AR61
chains in the Genus database with same CATH superfamily
2LTNA 5CBLA 4IGQA 2F17A 4D6QA 3L2HA 4D7YA 5CA6A 4OI1A 1A8DA 1NYWA 2DYCA 1WCUA 4JC1A 4SBVA 3VBHC 5LA2A 1ONAA 2O8QA 3DYPA 3NL1A 4L9BA 1SLBA 1E5RA 2VQTA 5FPBA 1FI2A 1PVC1 1VBD3 5FPUA 3ZXAC 2VO5A 4MZUA 4GKXA 4UW6A 1SFPA 2NM1A 4CU9A 5FPVA 5FYZA 1FATA 3VBFC 4K7JA 1JYNA 2GH8A 2G19A 1F5FA 1W06A 3U4XA 4D7SA 4V2WA 1NQJA 2VMFA 4CEYA 2XXZA 1UY0A 1XOYA 2JDZA 1YO8A 3Q8BA 4XW3A 3RZJA 2E32A 4FOYA 4AEJA 1LODA 4URAA 2QTWB 4RS5C 3N9QA 1JUHA 4ONUA 1OURA 1R083 3VKFC 3WG2A 5JZGA 3PHMA 2WYFA 1ULDA 4PLNA 2WIIB 1RUI2 4XTPA 5GLWA 4DXZA 2XL9A 4GB31 1ZRRA 2R49A 3J4UH 2ZACA 5DN2A 1EYBA 4CA9A 3POEA 5EHDA 2HBUA 5T54A 1TMF1 4ORFA 4MHRA 4XJAA 1PGW1 4RGAA 5I0DA 2W94A 3JB8A 5AFEA 2C6SA 3AKPA 2F6BA 4JGYC 1N47A 3PVEA 3GZTB 2NQYA 4LHKA 5JOXA 1V9U1 3A7QA 3N9NA 4OUMA 4N43A 1OOPA 5CFCC 3P3NA 4OQ8A 4IV1B 4TYSA 3HMYA 2ZZQA 3ZYPA 1R64A 4Z2AA 5FP8A 5A7WB 5A6ZA 3BODA 3KWVA 5DUWA 5C33A 2IXLA 2VD7A 1IOAA 1BEV2 2Y33A 1BJQA 3KT4A 4CCOA 1ZBE1 4NIAA 3OGRA 3CBNA 5FY1A 1UAIA 3N9OA 3ZYGA 2ZHMA 5FY8A 1WLDA 4BZ4A 2PAEA 4LK6A 4YSFA 5IVYA 5BNNC 2WINB 2B4KA 4QPGA 4LBMA 2VZSA 1BVVA 4NHLA 4IEXA 4YLZA 4HLTA 2J1AA 2IXCA 4M01A 3J7HA 3B94A 3O0XA 3JQWA 4LJHA 3W59A 2VZUA 4BH9A 2EXHA 1YQ8A 1SCRA 3H8OA 1ENXA 4LULA 1L7QA 1CJPA 3MO4A 3DXUA 4L2NA 2RM21 5C6CA 4GZ9A 4FPCA 3VD3A 3O1OA 1H1MA 2QDRA 1YQ6A 2UU8A 2YXSA 1G8WA 5FYVA 3ZN4A 5JPMB 2VC9A 5GLUA 4CCEA 2Y6KA 3QCWA 4MHUA 1QJU1 1DQ5A 3VKLA 3O12A 4GQ7A 2VW2A 4AFCA 5FOJB 1WMDA 4AI2A 1H1IA 1O3SA 3I59A 3TB0A 3OGVA 3RFRA 2ZGTA 2XBO2 3CLPA 4CDUB 4FP2A 3FE5A 4WZFA 3ZYBA 3V0AB 2YY1A 2X29A 5FPAA 4XBNA 4I2OA 4EN7B 4V1PA 4BXSV 1SFYA 4JVAA 2NYYA 3NNMA 1VP6A 1X9TA 1CIWA 1DQ4A 2VZ3A 1OA2A 2WN2A 5AC91 1PGL1 1GNZA 1S0JA 1EP0A 1DDLA 4N7IA 2Y6JA 4GMP1 1UX6A 3OOXA 4YW3A 2D97A 4Q27A 2BRTA 3AZXA 4HETA 4CTEA 2ATFA 1N1YA 5FZAA 1Z7S2 3SLIA 2A6YA 1PMHX 1OUXA 4IEYA 2XWBB 2QQPA 4OI4A 4Y1XA 4YFWA 2VGDA 3WLUA 1AL22 3NJXA 4BHPA 5BYNA 3S5AA 1FMD3 3PIGA 1D4VB 2F4PA 4R4XA 1W8HA 5DPNA 4LHSA 1K5JA 2JE7A 2VMEA 1W6MA 3AMNA 3MDPA 3TYJA 4AAPA 3I3EA 1GQGA 4AG4A 5EXOA 2HWF2 2D98A 3I49A 2FZ1A 4IW3A 5FY5A 2NMOA 2YG0A 1EAH2 1LAJA 2R073 4M0HA 3T09A 1QH7A 4PBPA 1US3A 3NNGA 4YM2A 3ZIWA 4CU7A 1AJKA 1REEA 3I7DA 1RUF3 1UY2A 3VZNA 1QXJA 5BNQA 1DGRA 1XU2A 2ZGOA 1YYNA 1RUD2 1H30A 2YU2A 3CZUA 1JZ2A 5L9RA 1NY72 3NMBA 1ASJ1 3Q8EA 3VDAA 1G9FA 3UNPA 3DECA 3FLPA 1FAYA 3L9JT 3V56A 5F3EA 3BTXA 1W9YA 1E5SA 1IPJA 3OGSA 2I45A 4MVTA 2ET7A 2OZ6A 3I97A 3NJVA 1PO21 2HWC3 4WZCA 2OXBA 1LRHA 3HQXA 4P00B 2RS33 2WZR2 3NAPA 4XUOA 5FBJA 2IXHA 2W1SA 4AZZA 5H9RA 1AR82 3SEPA 1QGLA 5JMOA 3HEIA 1Q8PA 3N7JA 4QB2A 3B01A 3VL9A 3ZXEA 4JAAA 3MLLA 1DYOA 1CAVA 2VVEA 4UF0B 3WNXA 4GJZA 2JD4A 4IV1A 1MACA 5F6LB 5JCTA 1W8WA 1GQPA 4YZ3A 3WP3A 1CONA 5F2SA 3W21A 2ILMA 3T2PA 5KHJA 3A23A 3CL1A 3KV4A 1HXS2 2DVAA 4Z82A 1YFXA 1AR73 4QX5A 4AOCA 2LS6A 2RV9A 4IV3B 4NRQA 5FO8B 5IFTA 1JZ7A 3FBMA 1VBA1 1DGWX 2AZ5A 5FZ1A 3W20A 3LWCA 5IW0A 1C4RA 1GNYA 4MYEA 4YM0A 2Q8CA 3MF9A 5FZ6A 5T55A 4ZKTB 4PHZA 1J59A 4FPHA 4MADA 5JLVA 1FPN1 3FZ3A 4HKOA 3ILFA 3IPVB 1DGRN 1W6OB 3F2ZA 2BGPA 4LTAA 3IDEA 3P3PA 4AFDA 4CEYC 4IETA 3U07A 5LRRA 3VDDB 1VE0A 4Q5OA 2WJSA 3ILNA 3WD5A 3WT3A 5HI0A 1AX1A 4BYYA 1OHFA 5CKMA 2W1UA 3I2FA 1OKOA 4C0BA 3ALQA 3O14A 4P9LA 3MIEA 2HWB1 4YGDA 2B45X 1CPNA 4EJRA 5JZGC 5E8AA 4XC9A 2YU1A 4NIDA 2W46A 3SC7X 3USSA 3RS6A 1RUE1 2XL7A 1LHUA 3WP5A 1YQ2A 4HSLA 1O3RA 5JXJA 5GJ6A 2YC2A 4EE2A 3OEAA 4XYXA 2UWAA 4CDUA 4GA9A 3DL3A 5HCBA 4N43C 5KXDA 1SDDB 3V0AA 4LPLA 4NPMA 1RUH2 3WNMA 3E5QA 1UO9A 1OXCA 1QMJA 1GZCA 1HN1A 1ZZCA 5FZLA 5J98B 4YG6A 2VMIA 1UPIA 3ZXLA 4MGYE 5FZHA 3KMHA 3N7MA 1S0IA 3WSOA 5LRSA 1QH6A 1TME2 2VNVA 3WNKA 2VZVA 3SKVA 1SG3A 2GC1A 4Q8KA 2AACA 1RUC2 3JBG1 5SV8A 2YBSA 1ULFA 2A3WA 3JD71 5IHRA 3LFIA 3EJKA 4WVMB 1VPHA 2DUOA 5IVJA 4CCMA 1RUI3 1S4CA 1CJDA 2JXAA 2RS11 1QJEA 2ZX0A 3KF3A 4R9BA 4LXLA 4YW5A 1ND2B 4E8DA 4LLFA 2VZPA 2UWCA 4R9AA 3H7YA 2LALA 3DUIA 3KVAA 3NV1A 3T1LA 2QCSB 1K5MB 2Y34A 1FV3A 4XTMA 5JR2A 3A0KA 1VAVA 1OVPA 2JDPA 1PK6B 4LO5B 3DCQA 1UF2C 5A3OA 4AVSA 4B7KA 1ND3C 1QNWA 4HPKA 1YRZA 4AQTA 1TVGA 2HWD2 2H0VA 4K1YA 4ASLA 4DXSA 5A7PA 3U11A 2VUAA 2DU0A 3V64A 4YM3A 5FYMA 1QEXA 1BEV3 4N53B 1W6QB 4I3PA 1NZIA 2J22A 1U5YA 2VCCA 3EHKA 1M06G 1ENRA 3H8XA 3GDBA 1JOPA 4YNIA 3LGRA 1HRI2 2P6CA 4EWEA 2VNRA 3VDCA 1OLQA 1PMJX 2RE9A 5L19A 3FJSA 4LKSA 4XIKA 1Q43A 2A3XA 2X5IA 5KXCA 1XNDA 4UFHA 1W6PA 2QQJA 2Y8KA 3R4SA 2GNMA 3I2KA 2RJKA 1KITA 1BK1A 3AZVA 5CIRA 2NPIA 3EMRA 1FXZA 3MIFA 3I2HA 1BQPA 3ZVXA 5LB6A 5KC6A 4BM8A 2VPVA 2V5DA 4OVEA 2D5FA 3DPRC 4DPNA 4LIVA 4QPWA 4O61A 4AE2A 1UZVA 5FIXA 3J7MA 4GULA 1MZFA 5FTTC 2K0GA 4I0WB 4O65A 3WCRA 1Y9GA 2K2SA 4Q26A 1XXNA 2X10A 3AXDA 4IV3A 4LKFA 4XF9A 5CFDB 1URXA 4E4DX 3MFCA 2WFF1 1RUJ1 4YW4A 4JHTA 2AGSA 1GU3A 4MGSA 2JG9B 4R8HA 3UKTA 2XBO3 2OQ6A 3HQUA 4N9IA 2YBPA 3IPVA 1YFUA 1D0HA 1W6OA 2DVBA 1LOCA 3R6SA 1GV9A 4FI9A 1C1FA 2D6KA 2OIIA 4AL9A 4H2AA 3APBA 3AKRA 3GALA 5FZOB 1ZRFA 1B09A 3ZPOA 1F35A 1AYN1 2XJSA 3ZYJB 3AMQA 1N1SA 1QIQA 2ARAA 2CNAA 2LW8A 5CB7A 3WP4A 2WA3A 2QVSB 1JU4A 1LGNA 4KL1A 3MW2A 4RSUA 5A7OA 4L99A 1I9RA 3IDBB 1DYPA 3AFKA 5ERLA 4CU6A 2XGXA 2VUDA 3IIAA 3ZM8A 1LOFA 4IE6A 3OUJA 1LU1A 1CAUB 1Z7S3 3M8LA 4DOUA 3IB3A 4WVVA 3U4SA 4CP0A 3VZKA 1BYHA 2EVXA 3I3QA 1AL23 5JPNB 1Q8QA 3V0BB 3RZGA 2XHKA 3QD6A 5A1LA 4YG3A 3WG4A 3DV8A 2Q30A 1MQTA 1W0NA 1XYNA 2CYFA 2WO1A 4UWDA 2CSGA 1DFQA 3C7FA 3PU3A 5F5IA 4AHZA 2XJUA 4IV1C 4D8MA 5FREA 2HWF3 5C4WB 1DLCA 5I0SA 1NAEA 3IDCB 4XFHA 1DZQA 1GQHA 3MI8A 4KWLA 1EAH3 3MV11 4I0AA 3VB9A 1SLLA 2D5HA 4RQPB 2DWRA 2QBXA 3CJIB 4M3CE 2O14A 2L9LA 5HXMA 2PHFA 4XE9A 4Y1ZA 3HNMA 1R1A2 1X8EA 2PHWA 4HSJA 4UYBA 2RG4A 5A70A 2ZKLA 4H14A 3AKQA 4RL7A 5E16A 4XCBA 2DBIA 3ASIA 5C3RA 1EV12 2IUWA 2E33A 1R081 2CY6A 2VNGA 2VU9A 2VCBA 4NHYA 1MZ6A 2ET1A 1IS4A 4ZZ8A 3SNMA 4DZGA 1YNAA 2BOJA 4GD4A 1L7RA 1BVP1 1KDKA 4D0QA 2X8KA 4WVWA 2BERA 1HV1A 4AEMA 3AJZA 1K5MA 3WHTA 2DFCA 1NLRA 2BDRA 2N7GA 1DQ1A 2WZR3 4LBQD 4QDSA 1AR83 1PK6A 4B4RA 3B9CA 2WKKA 3KCYA 2BFUL 3J9SA 3VBSB 3RZHA 3SCGA 1HB2A 1WWYA 4BB3A 4UFJA 5AVPA 1H8TB 2BBAA 1HXS3 4BA6A 3TEYA 1N3OA 3WQ7A 3ZSLA 3VBFA 2OT7A 1APNA 1VBC2 2KD7A 3DYOA 3ILRA 3I2JA 5L7OB 3O1TA 4N53A 5GZGA 1W6QA 3K75B 4CDUC 5FXVA 5JXGA 2WNEA 1JYCA 1VBB2 3WW4A 4W6YA 4KQ7A 4KWUA 1JYWA 3B69A 3LIGA 3KM5A 4JDNA 5FK7A 2VBBA 4NOTA 1TEIA 5C9AB 4FOQA 4GWNA 5HXVA 3AYCA 1PIV2 1DQ0A 3NW4A 4XJ9A 1D4M2 5A1FA 3D82A 1OH3A 2QKDA 4XUPA 1CESA 1A34A 2E6VA 4KU8A 1UMIA 3ZR5A 2B46X 2VBDA 1WA4A 4PF1A 3I2OA 4XFFA 4EV0A 2JIGA 2ZJCA 1PVXA 2XUMA 2D6OX 4JGZB 5DXDA 2HEWF 3WW1A 5CFDA 2DURA 5DMYA 4B4PA 5KXBA 4LQRA 3ZYFA 1UMZA 1OC1A 3POSA 1JZ3A 1IG0A 1RINA 3CNAA 1LOAA 1AR92 5LBEA 3GXUA 3H1YA 1CN1A 4E4ZA 5DDJ2 3M1HA 1AL0G 2VM9A 3T2QA 1HRV2 1OVSA 2QQWA 1JYTA 2V73A 1RUH3 4OHWA 5BUVA 4A6OA 1WBFA 4LBOA 4XF0A 1WA6X 4A7ZA 4B29A 4BE3A 1KS4A 2VVDA 4JX0A 5FZOA 1GP5A 1N3QA 1WLTA 1F31A 2Z5WA 1H9PA 4E8CA 3GYDA 2DCYA 3ZIXA 2WO3A 3CMGA 2HEYF 3H3UA 2VJXA 4UAPA 1TME3 4Y24A 2ZPXA 3SEEA 3INAA 3H9AA 4X6QB 3WQ1A 1ZZ8A 4BU2A 4Q1RA 5GZEA 4XQDA 2FBEA 1WMXA 3CQOA 5FMCA 5GZDA 4K1ZA 4ZXKA 4HXCA 1POQA 1C3HA 3WOGA 4XJ8A 3ROUA 2W0XA 1S0FA 2CAVA 4MXWB 1K42A 1SPPB 2JX9A 4GIQA 5DG2A 4ZY9A 3S30A 1X82A 1X33A 1FMD1 2RR11 3DYMA 4W6XA 1AX0A 3CF6E 3VHNA 1POV3 1WZXA 1S0BA 3AP7A 4HVRA 3RJ2X 5FYYA 1WLWA 4AW7A 4MV2A 1TE1B 1BBT2 5GLVA 5C4WA 1MS8A 4FOVA 2IFWA 2R6QA 5C8WA 2AUYA 2P1BA 2VVFA 3SCFA 4CP2A 3WDWA 5JXIA 2XLAA 2C24A 2UYBA 2HWD3 1AXKA 2HKXA 4IV3C 3ZFFB 5KHGA 3O1RA 2BBVA 2ZABA 2R071 1XYOA 2VQ0A 4CDXB 4JHZA 1G86A 2Y6HA 4F83A 2E7QA 3EB7A 5CAZA 2NMNA 1DBNA 1RUF1 2PN5A 1LJ7A 3HBZA 3HNYM 3L2YA 2J1SA 3IMMA 4KMQA 4S2GA 4IEOA 4XBLA 1IQDC 1CWPA 1MPXA 3SH5A 1HRI3 3MIHA 2WT2A 4I0BA 4AQ6A 3VDDC 2V72A 3IIIA 5FMOL 3VZMA 2VG9A 3GJBA 1BMV2 1O6UA 1WGPA 2HWC1 2EXJA 1VAMA 1RUG2 4QPYA 1FV2A 1EPWA 2K46A 1UU4A 2DVFA 2RS31 4XF3A 4Q8LA 1NT0A 1XYPA 1Q56A 3BTYA 4EN0A 4LO4B 1I6XA 2EA7A 2WS92 1W2AX 4XDOA 4DRVA 3VBSA 5FP3A 1LOFC 1S0DA 4Y20B 1MS4A 2YGLA 4ZU4A 1H8TA 1H8VA 3I4IA 4JCKA 2NN8A 4QKNA 5HPOA 2XJTA 1WW7A 1X50A 3HIFA 2C0ZA 1UWWA 1Y43B 1CVNA 1U0AA 3JUUA 5L7OA 2D6LX 4OULA 1NCRB 2WLPA 1VBE2 5FUIA 1UU5A 5A7NA 1MS9A 1PNFA 1ULGA 3ZR6A 3T30A 4HZFA 3DKWA 2DCJA 5FJKA 4Q4V2 2W1WA 5C9AA 4K8RB 4NE9A 1QJX2 1ACCA 1DU3D 2IWGB 3OTFA 3PVNA 4K40A 1QXPA 5F8PA 1GP6A 5FZ0A 1JW6A 3N36A 4AYUA 5IVEA 4MG2A 5FYIA 1EPZA 4Q4X2 3UGFA 1OPOA 5C8CB 3M3IA 2WWUA 3JQXA 3GCWA 4J1WA 3VHRA 3ZN5A 5LZ6A 2WQZC 1C8M1 4E2SA 1AUYA 3MICA 1W99A 4N9HA 5T5LA 4CXYA 1VMJA 3HR9A 5CVRA 4CUCA 2ZXQA 1ZRDA 2Y6FA 3O1UA 3OCPA 1LESA 4XXPA 4LK7A 3WF1A 4JGZA 3V65A 3RVHA 4OHYA 3ACIA 1ND2C 1F5JA 1UZ0A 2Y0OA 4OLLA 1QNYA 1DCSA 2QJVA 4D69A 1O3QA 4YVWB 2ZGLA 3E6DA 3LIHA 1OQEA 4DMIA 2OKXA 1K5MC 4KNCA 5JWPA 4NHXA 1IGOA 3O0VA 3PUQA 3VKNA 1DIWA 3ZSKA 3OB8A 1PK6C 1J84A 1GSLA 2R042 2WBKA 2BNMA 2J42A 5IYYA 5C5TA 2BWAA 2D40A 2P5BA 4RGKA 3RPQA 3MW4A 3ZYHA 4BQ3A 3UJQA 4ZONA 1SLIA 2DF7A 5DZFA 3RI8A 2E7AA 5G05L 3VBOB 4Y26A 1W39A 1POV0 3C7HA 2IXJA 5DAXA 1DLLA 3TOJA 3I3BA 5CG8A 1HDKA 2YZ4A 2P3JA 4N53C 5IT6A 4IESA 3ZXGA 5J48A 5GLZA 3J8F1 3VBUB 1RJ8A 2D3SA 3GHMA 1R1A3 4IGOA 2SBAA 5LK5A 3NSTA 3ETQA 2R1DA 4IEUA 4Y3OA 3ZX7A 1AR62 5FPZA 3WNLA 4XF1A 3LZZA 3ON7A 4BIFA 4BQWA 1EV13 2VZQA 3H1WA 4NROA 2EICA 2GDFA 1RGSA 4QXHA 3FC0A 4EROA 4Y5SA 1RUI1 3OD0A 2VUJA 4MXWA 1W2NA 1IHMA 2ZBJA 4DNYA 4X8NA 3EO6A 4XFCA 3ZOIA 2RMU2 3BGAA 4HVOA 5FP7A 5IAVA 5LATA 4GXLA 4CP1A 5J3UA 1WMFA 2ORXA 3PUSA 2W3JA 4MO3M 4NHMA 1CAXA 5LEKA 2E31A 5IUQA 1I1EA 4HG6B 1PNGA 1W8ZA 3GM8A 1AZDA 1S2EA 2QQMA 1UYYA 1DYKA 3ZFFA 5CFDC 1SFNA 4XZUG 2JJ6A 2EAKA 4GWJA 5AVAA 2JICA 1RHI2 2ORZA 2XJQA 4AEDB 3LF7A 1VBC3 4B3NA 2A7AA 2BUKA 1C1LA 2JG9C 3PMEA 3S0MA 5HV4A 3ES4A 2DCKA 1VBB3 5DAVA 3WF3A 1JZ6A 2YV8A 4COYA 1HW5A 2ZKNA 3AYAA 3NNLA 2ZGUA 1YIFA 4COVA 3QOPA 3W5NA 1AVBA 3AM2A 4FVVA 3BI3A 1TMF2 4RFRB 2XMLA 4OMCA 3OSDA 4Q4Y1 5A33B 4E4HA 1PIV3 3R4DB 4AK3A 3VLBB 1D4M3 2BNNA 3OPWA 4QD2A 2EXIA 2WNOA 3RSJA 3N35A 4UT5A 4ISRA 5FZ4A 3NV3A 5DUVA 5A6XA 5KHIA 3PURA 4LR4A 5T5OA 5E6HA 1FOD2 2Y38A 3B7MA 3JCIA 5L73A 5J1XA 1B35B 4JRLA 4ATFA 4EWDA 1BHGA 1G9BA 1AX2A 1NA1B 2W68A 1JZ4A 2XVLA 1NCRA 1ND3A 2JENA 2B39A 3AC0A 1AR93 3PL0A 3B3QE 1W90A 1O8PA 1ALYA 5DDJ3 4AVTA 3KCXA 4A7KA 5C4WC 3I3MA 1HRV3 2FDGA 3AMHA 2XG3A 1Q3EA 2B8MA 2XBO1 3BOPA 4GJYA 3HOBA 4LIUA 3WHUA 2E9QA 4AR2A 2WABA 2WNVB 1ZX5A 4RQPC 1PO13 3U14A 3BPSA 2A71A 3CJIC 2VY0A 4KGGA 1A8MA 4MGZE 2J1RA 2VXRA 1CPMA 1IPKA 3BKZA 1UXXX 1GFF2 1H9WA 1XNAA 2CHHA 2GZWA 2YHJA 4Q2FA 2JDYA 5E88A 1GWMA 4Y4RA 5CYYA 2I74A 5T50A 5JIAA 2MEV2 1QJU2 3KGZA 5DZGA 1Z7S1 1A3KA 1M4WA 2GNBA 2XJRA 3DPRA 1YHFA 2ZHLA 2ZX2A 4YVWA 5FBZA 4LO8A 1HV0A 5EPAA 1O59A 1QXRA 2W5FA 1AL21 4P5HA 4AFBA 3UJOA 3WUCA 4BOWA 4GWMA 4XPVA 4OMDA 2DVGA 2Q1MA 1HLCA 2XJPA 4NO4A 1Y9QA 2ES3A 2VUCA 4IDZA 3VBSC 4XMAA 4XILA 4ASKA 4OZOA 2GU9A 1BBT3 1MVQA 1YCIA 3K4ZA 4PI0A 2HWF1 1H8TC 1PM4A 2ID4A 2QE3A 2QQLA 5AC92 2PELA 3S57A 4ITCA 2E51A 5L7OC 1EAH1 1R092 2QQOA 2VMGA 2VMCA 3EYPA 2QUOA 3VBUA 2YFUA 5JXHA 2GMPA 2GMMA 3MW3A 1YEWA 1W3VA 4XFIA 4XHBA 1U12A 2BV4A 3ZXJA 5C9AC 3ME2A 3FMGA 1RIRA 4Y4YA 4ZHNA 1NY71 2W91A 4QGLA 4FFIA 5LY1A 4UW4A 1V6KA 1F2NA 3B93A 3GBGA 1J3RA 2VQAA 5GLTA 3UETA 3O5SA 3NNJA 2R0FA 4I30A 4E4SA 1IQAA 1CZVA 3BB6A 2BVVA 1WW4A 2PQSA 3FFZA 1RUG3 2CTVA 4PIZA 3HT2A 4LBQB 5FZGA 4AQ2A 3LEIA 3ETPA 2WZR1 3PLQA 1KD7A 3BU0A 1OMIA 1UY4A 3C7GA 3TN92 2WS93 4JGZC 3VGIA 3AP9A 2DFBA 4XDPA 5IAXA 2W2IA 2IVJA 3J7NA 1W8FA 4LOSA 5F32A 4EQVA 3ZPYA 1JHJA 4Z92B 4XEZA 1NX9A 2RDQA 4C91A 5FUNA 4AEDA 1ZBA2 4QB6A 4QX8A 1HXS1 2D93A 1QDCA 3PMSA 5FY4A 3BOWA 1AHSA 4YW6A 2CDPA 4C8DA 1VBE3 2SLIA 3DPRB 3POWA 5A7WA 3SISA 4WM8B 4D7TA 4P08A 3MUZ1 4GH4B 1ASJ2 1H0BA 2VR4A 3IZOA 3PUIA 4ATEA 1BKZA 2ZZJA 4Q4V3 2ADDA 3S6PA 5FZ9A 3S5QA 4RHV2 1AYM3 1G9CA 5IK7A 2JECA 5A33A 3KT1A 1Z78A 4HN1A 3OPTA 1OD5A 4HOOA 4Q4X3 2FQPA 4Q0UA 4QU2A 4DUVA 5CISA 1O3TA 4HL0A 3DN7A 1NLQA 1ODNA 4LMFA 3FHIB 3WXPA 5IATA 1UPSA 3H3LA 2DTWA 2DV9A 4DB5A 1OBNA 5FLHA 1NXMA 3RZKA 2WFPA 3RI9A 5B4XA 2TBVA 1XE0A 1FT9A 2D6PA 4FCAA 1VMFA 5FZKA 5CU1A 2GC0A 5KBFA 1HX6A 1VBA2 1OI6A 3CKHA 3K77A 2QQVA 1FNYA 4AGGA 4XFAA 2JDMA 3C2UA 3PTYA 3CU7A 1MZ5A 5A3LA 1TZOA 2R043 1FPN2 4FPLA 1XJAA 5FAXA 1ULOA 4HVQA 3Q9OA 3DEMA 2RDRA 1OLRA 2AYHA 1DGLA 1H2KA 2JDUA 3ZFFC 1CR7A 2I2SA 1JHNA 4Q4X1 4CDXC 1Q8SA 4YZ1A 1S0GA 5LEJA 1AXYA 1GBGA 2WL1A 3AZYA 4XFBA 4DO0A 5JI7A 2RS52 3WZ1A 2WO7A 1RJ7A 3I2DA 4PJYA 5F3CA 1TME1 2RDSA 5K9YA 3WDXA 4AEKA 1PM7A 2CGNA 2BU9A 5A3MA 3VHPA 2IVIB 2GN7A 1AR63 3W9AA 4TN7A 1JN2P 3N9LA 4QX7A 4SLIA 2ZOEB 3AMMA 2BEOA 3ZMOA 1QWRA 1CGPA 1U5ZA 5FO7B 5DUUA 4XABA 1C5IA 2Q0AA 1LHWA 1QQP2 3FLTA 4YFZA 1PGSA 5CG9A 4YVSB 1GANA 2O8OA 4QX2A 5FOBB 5FXZA 3W5MA 2D3PA 2RMU3 4QHZA 4ZU7A 3NKTA 2XLGA 3T4HB 5A3UA 2B5HA 2ARXA 3FX3A 2PHXA 3M7AA 5D1IA 5C70A 1CZTA 2GP3A 1ZA4A 2ZMLA 4FPGA 4UW3A 4FPEA 2P17A 2R16A 2VULA 5FP4A 1KRIA 1EUTA 2PAMA 3KSCA 2HWD1 1NCRC 3E97A 1RHI3 4QQLA 5F6KA 2XONA 4FAHA 1FNZA 2VW0A 1C8NA 4PQ9A 3HNBM 4OFGA 1RMU2 4FQZA 4QX0A 3IM0A 2XOMA 1J58A 1VRH2 4XIOA 2ENRA 4OCTA 3D8CA 3QBQA 4MGKE 4FOWA 5JVVA 1JXNA 3MGUA 4Q4W2 1LECA 1T6BX 4IE0A 2C5DA 4W8JA 5C8CC 2J1VA 2ZEZA 1TMF3 4RR3B 2MNGA 5EWSA 3OBTA 2ETEA 3ST7A 4LBQA 5KC5A 1DG6A 3KHCA 3Q8AA 4OI0A 1S0CA 1BXHA 4XUQA 5A32B 3WVJA 5HV0A 5I8TA 5BXXA 2ZGKA 3GCXA 2HWE2 4PDWB 5FXWA 1FOD3 1W9TA 2BNOA 2W95A 2VOWA 3LOIA 4FBFA 4YVWC 3AFGA 4UF0A 4OUSA 3X29B 4AGVA 3AZWA 1R1ZA 2AH2A 2JKXA 3D5OA 3ACFA 4Y1UA 3AYDA 3FHAA 5EP9A 2Q8EA 4XBQA 3RZLA 5A80A 3IBMA 2GSYA 4QB1A 4WM8A 2Q5TA 4QPIB 4GH4A 5M0TA 2JD9A 1V6MA 1REDA 3WDTA 5A6QA 3TNQA 1ENQA 2CL2A 3NKGA 5D2AA 4HMZA 3VBOC 4HK8A 1ZRCA 2ZEYA 1MEC1 2VZ1A 5L9BA 3RWNA 5APAA 4CDWB 1H2LA 1IZ3A 2R062 4JKKA 4WVZA 2WZ8A 3DGTA 5SV5A 1AJOA 3K3NA 1O5LA 1SQ4A 4QXBA 3ATGA 3FLRA 3WV6A 3T08A 3VBUC 3RMYA 2DU1A 1RXGA 2WSVA 4QKDA 2YDEA 3VDDA 4FPYA 3H0OA 2Y26A 4RYDA 1Q8VA 2PYTA 5IFPA 2Y6LA 3CDZB 1W03A 3H42B 3VL8A 2R0HA 1OFNA 2MEV3 2J1UA 1QJU3 4E2GA 2ERFA 4LBNA 5ACA2 2ZMKA 3SCHA 2WFF2 1RUJ2 4QM8A 4Y1YA 2EF6A 3AZZA 3SXWA 3T2OA 3UGHA 4PI2A 2DCZA 2BTVC 1XQNA 1J83A 2GC2A 4OHVA 5LW9A 3I2IA 3P6BA 2PLV2 4F7ZA 2CDOA 3THCA 3BTZA 1H4GA 4FTEA 3MLKA 3TNPB 3ZKUA 1W05A 3DXTA 1VBD1 4NN0A 4AAXA 4K9SA 3T4VA 5AC93 2Z2SB 5CNAA 2BQPA 5F5CA 3TWIA 4N8MA 1AYN2 3POGA 1HKDA 1GZWB 2A6VA 2WNUB 5DAWA 2OZJA 3TEXA 2PAKA 3USUB 3KLSA 1R093 1F9KA 2WYSA 4INDA 1OKQA 3PJYA 4HN0A 4IEVA 3WF0A 5KXEA 5FQ0B 1DF0A 1R1A1 2H0BA 2P3KA 4Y22B 4BK5A 5ISLA 2TEPA 1COV2 4M3CF 1UOFA 3AVSA 1IPSA 5LBCA 1OLMA 1OQDA 1EV11 1RUD3 4L0PA 3AMPA 4RN5A 3C7OA 2RJ2A 3GZEA 4WVMA 5F5QA 2OUHA 5FLIA 4CCKA 3T0DA 4N7UA 1JYIA 4P5YA 4YM1A 1GZ9A 1ZZ9A 5IVBA 5KWRA 1T2XA 1H1AA 1ND2A 1O4YA 1ULCA 2ZX3A 4YW7A 1RVF2 2W9XA 1WW5A 1UYPA 4XURA 2BFUS 5LBFA 3HN1A 3K51A 3TN93 3U0ZA 3CJXA 4A42A 1DZTA 1B35C 1HJGA 3E5UA 1D7PM 4COWA 4LITA 3VN4A 4HONA 1NA1C 1XU1A 4FP3A 1XE8A 3IDAA 5EV7A 4LKEA 2RHPA 4RFT0 2I07B 1ZBA3 1MS0A 2VL4A 2ARCA 1JZ5A 1VBC1 3MYXA 4UFIA 4NAOA 5K7PA 1UOGA 1KFUL 3THPA 4AQSA 2OX0A 5FCCA 1ASJ3 2YB7A 4LO6B 1VBB1 3BUCA 1RITA 4KWKA 2WNVC 3TBDA 5CEHA 1ODMA 2QQNA 2VOXA 3DF0A 4IUGA 5FZ8A 1Q8OA 3LAGA 3WDUA 4A3ZA 1DP0A 4EN8B 4RHV3 1QJY2 2D3RA 4P9YA 1HJFA 4W50A 1GUIA 2UY9A 2EALA 3HT1A 4O7XA 1MZEA 1PIV1 4D6SA 3RJRA 4K20A 1X9PA 2GNTA 1D4M1 2BWCA 3R05A 2MHFA 1W9SA 4BJ0A 5A32A 1XNKA 3LDKA 2XUEA 4PDWA 3M3EA 4UBGA 4Z07A 1JTZX 1ZRIA 1HB4A 3QACA 4OYUA 3SITA 3BN6A 4TTGA 5FKCA 2WT0A 5JMCA 4META 1ZZ6A 3R0RA 4PIXA 2GALA 1NG0A 4GALA 1GWKA 1WCQA 3N7KA 2AR6A 3ACGA 1J1LA 1V6JA 1VBA3 4M0NA 4QGMA 5BNPB 2ZCWA 4FO9A 3ZSJA 1RB8G 2GC3A 4EN9B 3K4AA 4QPIA 1XB9A 2DCTA 4FFFA 1AR91 4KI5M 1XNBA 4I09A 1FPN3 2FZ2A 1GWLA 1QU0A 1UW8A 1HRV1 1ST8A 3PIJA 4CUGA 1W9WA 4YYOA 4L97A 4CDWA 2JG9A 3A4UA 1T6GC 1UZZA 3AB0A 3SMHA 3POFA 2DUQA 3AKSA 4TSVA 3FBYA 4IGPA 3GHNA 2VAUA 3AYEA 3OUIA 1PO11 1A78A 4CYDA 2BPA2 1LOBA 2OYZA 1MVEA 3WUDA 2RS53 3HN3A 1RXFA 2PXJA 1OSGA 2WSUA 3ACLA 4FTBA 1VMHA 4AHXA 1Q5OA 2YUEA 4CEWB 1NE6A 3OBAA 4WV8A 3UYJA 3D6EA 5IK8A 4PF5A 4XUNA 5ABJB 1HN0A 1PZ7A 1HIXA 1YC61 1HQWA 3HJRA 3NJYA 5F2WA 5HCAA 4C1XA 5C7GA 1RUC3 3BIWE 4LLOA 5J09A 1QQP3 5FUPA 1CAUA 4J6GA 3UESA 3NO8A 1NQDA 3GNEA 5F5AA 5JSOA 3B5LB 1JYVA 3WNOA 5LBBA 3NWKA 3V0BA 3P5BA 1NZCA 1W04A 3LOBA 5EZWA 1JH5A 3LPGA 3UGGA 2VOKA 4GKYA 3PUAA 4KU7A 4XMIA 5K8SA 2XDVA 1LCLA 1XSRA 4ZXEA 3FFQA 1BBT1 4NIGA 2WC2A 4O9GA 4XJUA 2Q8DA 1SZBA 4URTA 1RUNA 1XSQA 4AXOA 2ZX4A 2XHNA 5JOZA 4XFGA 5K4LA 1GZWA 2ZS6B 3LSDA 3LCPA 4AHWA 3USUA 3U37A 4YPJA 4RGGA 2RDNA 2FCVA 4WM8C 3NNFA 4AVAA 4GH4C 4RQPA 4QQ2A 3POJA 4Y22A 5JSRA 3CJIA 1RMU3 2Z69A 1G6NA 4CUBA 1VRH3 4JDMA 3U78A 1KDMA 3JZVA 2ZGQA 1QDOA 1W0PA 4N90A 1I5ZA 2VMHA 1GOFA 5FMOS 4Q4W3 1OD3A 3FUQA 3J26N 5BV6A 5FYTA 2DVDA 1BZWA 5LA9A 5A3PA 4FFGA 1STMA 2RR12 3IAPA 1SBEA 4QGNA 4LHLA 3O7OA 3ZSMA 4AF9A 3EBRA 1D0GA 1BMV1 5GALA 5FMDA 3VBRB 3KV9A 4ISQA 2Z4FA 3SH3A 3UL2A 4BMBA 1QKQA 1RUG1 3MLJA 3MF6A 1LEDA 1SEFA 1Y3TA 4LUKA 4TLFA 5H9PA 3I54A 3VD5A 5DAQA 5G04L 2HWE3 3CHXA 1ZZ7A 1OOPB 5FYHA 4ES9A 4XETA 1H2MA 4JQTA 3VZJA 3ZFEB 3WEZA 5J7MA 1SBFA 1QJZA 2YPDA 5F7UA 2XQXA 2D6MA 5IVCA 3J7LA 3OY8B 4FPKA 3IAQA 2XKPA 4YZ2A 4AI9A 2CWMA 2C9AA 2DUPA 1ZNPA 5T5PA 1VBE1 4BQXA 2YYOA 1AR71 4UOJA 4FXKB 4XHXA 4CCCA 3AL5A 2PFWA 4FTSA 5CZKA 2NZ9A 2FD8A 4QPGB 2VZRA 1YLLA 1O8SA 4QHBA 3KZ4C 1UMHA 2E63A 2R063 4AEDC 2O1QA 3N9MA 4G3YC 1AYM1 2KXLA 4CE8A 4O9EA 2ZGSA 1V6IA 1VB4A 4H55A 2A6ZA 4PT6A 3LFMA 5H9SA 4XJWA 4LT5A 2OVUA 4JTOA 4YWAA 4IQPA 4S2HA 1LNSA 2DDUA 2ZHNA 3B02A 4XF4A 5E89A 1REFA 3WDYA 4IXLA 5DQ0A 4QT6A 3A0NA 4FXGB 1DQ2A 4ZU5A 2IXIA 2ZAAA 5B2GB 1OH4A 4P9XA 5ACA3 4M4RA 5BNPA 1LEMA 4YVSC 4LOTA 3VV1A 2ZGNA 3H7JA 1RUJ3 4Q0SA 3KF5A 2G4IA 1JU3A 4OQ9A 2P3YA 2JE9A 2PLV3 2A6XA 4NVPA 4LKDA 3E5XA 5CKNA 3ITQA 1YFWA 3AX4A 4FAGA 4ASMB 5T5JA 4DXRA 2W08A 1ULPA 2J7MA 5FZ7A 5F3IA 2Q1FA 1C8M2 4NWVA 1AYN3 1J3PA 2JDNA 1OF3A 4CUAA 2A70A 5EJ1B 4MGQA 2GMEA 2KM2A 1CX4A 2RVAA 1W8OA 5A7QA 1W2TA 4CEWA 4NPRA 2Q8OA 2WWSA 3POYA 4WBBA 2YGMA 4JRAA 2PA7A 5LK7B 5J37A 3N9PA 1COV3 1ZA7A 4NRPA 3BTAA 5ABJA 1CZSA 3OPZA 4PIYA 1XE7A 3FHQA 4RR3C 1IS6A 1EUUA 1J3QA 3RMXA 2XVKA 1N1TA 4ARYA 3NQHA 4BLIA 4EZHA 2WQ8A 2RMU1 3FUOA 3WX5A 3VDBA 1RVF3 1SPPA 1W6MB 1PVC2 4PDWC 1RC6A 4AI0A 3KV6A 3PVBB 1AXZA 3VZOA 3GBWA 3ZSEA 1ENSA 4IEPA 3RQ0A 2ZHKA 3ZN6B 1SLAA 3O1PA 2UY8A 3AJYA 3J8F2 3OJBA 4GAZA 2LUWA 5FWEA 2CU5A 1RHI1 1OA4A 4QPIC 4KWJA 5D8AB 5BNOB 1UNBA 5LA1A 5IK4A 2XB6C 5FJHA 4CDXA 4U2AA 2E53A 2AEZA 5C5UA 2WDBA 2VMDA 3MHZA 5BPXA 2DTYA 5EYXA 3GZUC 1UYZA 4CDWC 3HAGA 1BEV1 5I91A 4LO7A 1AF9A 3AL6A 4XOGA 1VALA 1QJY3 5I0UA 4FSJA 2XH6A 4GB32 3ZDVA 3ZXDA 1S55A 3VBRA 2WO2A 5FY7A 1BLZA 3PTRB 3NAPB 3GJAA 1PGW2 2BYVE 4UFLA 3K2OA 1WLCA 4QDQA 2CWSA 4W65A 5FYUA 1CAVB 2CGPA 3WDVA 1FOD1 1V9U2 2PTMA 3ZFEA 3OGJA 2AENA 2G9FA 3ZXKA 4ARXA 4XJZA 4PLMA 3ZMNA 3OY8A 4Y20A 1V70A 5C3OA 2R30A 2JKBA 5LA0A 3URFA 1LB2A 3AP4A 1YI9A 1JUIA 5FRAA 1UY1A 3KVBA 4K6BA 4QWNA 4B4QA 4FFHA 2ADEA 1PX3A 1X7NA 1F8VA 1ZBE2 5A3WA 2OQ7A 1K45A 1H4HA 4HK9A 4H7MA 2V5YA 4PCRA 4Q29A 1TNRA 3ZXFA 4A2UA 4CPBD 3POIA 2A5ZA 4Q4Y2 1WW6A 2GAUA 2A75A 2WNUC 1YXWA 4IEZA 2RJLA 1W0OA 1CQ9A 3E1F1 4M3CB 5EQUA 3WQBA 4E2QA 2VXJA 3D4KA 4XQ4A 3WNNA 1GLHA 4TLGA 4DXTA 2UWBA 5C8CA 2HJIA 1LHVA 3VZLA 4Z1VA 1G7YA 3D0SA 1KJRA 2RM22 2EIBA 2VTXA 1U5XA 5I0RA 4WM7B 2Q4SA 2D6NA 4CCNA 2B7YA 2X53S 3NVCA 5JDBA 2MEV1 3R4UA 3H50A 5IVVA 2ZGPA 1X8MA 2OA2A 3UK9A 4CCJA 3BALA 5EJ3A 3MZHA 4Q0QA 3K46A 4MH0E 1KEXA 1L7LA 3QLQA 4J1XA 2LM3A 5JI9A 5FZBA 2P37A 5FLJA 2OUJA 2UURA 3M3OA 3NJZA 2ZGRA 3AP5A 3GBFA 3LDBA 4JKMA 4TWTA 5CKQA 1NUKA 2WAOA 5DG1A 3ZKYA 3ZYIB 3KCCA 3KHBA 3RZMA 3PNAA 3VBOA 4AVCA 5EIYB 1IS5A 5JOWA 2Z42A 1PGL2 2IFRA 1I3HA 2PHRA 3BU7A 3ZO0B 1R091 1VJ2A 2XJVA 1UY3A 2YROA 3MPBA 4AFMA 1JBCA 3WW3A 4AVVA 4DS0A 1FYUA 4QKBA 2G9ZA 3UKVA 1UKRA 2AREA 2OW4A 4XCAA 1RUD1 2VECA 4HFSA 4UXAA 4W4ZA 1GMMA 2YC0A 5FFOC 2PMWB 2RR13 4Y33A 3T2TA 4KBBA 5T52A 4ZZ5A 1K12A 5ANQA 5JUVA 4C0HA 4QKFA 3I8TA 3UV9A 4UW5A 1EY2A 2BOIA 2JIJA 3MIGA 3TN91 4IL7A 4B8EA 2H6CA 4HPKB 1X36A 4L92A 3PVOA 4LEJA 5BNPC 1AR81 1H6XA 1O4ZA 3ZN6A 5DUXA 4EN6B 5A3TA 3C7EA 3LD8A 2FDHA 3ORJA 5D8AA 3RRDA 1ZBA1 4F3JA 5BNOA 2PHTA 4XACA 3M2MA 4DY3A 3VUOA 1UOBA 2O0OA 1NE4A 2BGOA 4TZDA 2JG8B 2B42B 1UZYA 2KA3A 4PQQA 4PBOA 4D3WA 2HYXA 1LHOA 1SCSA 4CP9B 1KFXL 3WCSA 4DUWA 4MGIE 2X5IB 4XUTA 4HKLA 4P9WA 1SMVA 1W6PB 2JE8A 4RHV1 1P8JA 5F39A 3N4MA 1QJX3 2OPWA 5FZFA 3VD7A 1PO22 1GYKA 2H6BA 2K9ZA 4R4ZA 2PHDA 4YGCA 4CEWC 3MIBA 3OD4A 4G4FA 4LORA 1QY4A 4BXFA 4CDQB 2WN3A 1O91A 1OPMA 3KQRA 3LQCA 1Y7BA 2VW1A 5ABJC 5JAXA 1KXGA 4UFMA 3RYKA 5C3PA 4QAWA 3O1SA 1CD3G 5BY5A 4FPOB 1DHKB 4B7EA 2FDKA 1F4AA 1O5UA 1LTEA 1BCXA 3M70A 4U36A 1G9DA 3Q8CA 2TUNA 4DRRA 1B35A 2W52A 3MPPG 4OI2A 3PDQA 4P02B 2A3YA 5A6YA 1LR5A 5FWJA 1NA1A 1YIPA 3AP6A 3P1IA 1WMEA 5TSWA 5FDBA 4EYUA 3RYPA 2C9KA 1C28A 1ZM1A 2HYKA 3HD8B 4J25A 2WR9A 4JV4A 3LB9A 2OS2A 4P9GA 4C90A 4OHZA 1WUVA 1JZ8A 3KD4A 5FYCA 2W92A 4M3CA 2X09A 4NWWA 4CZSA 3VD4A 4I01A 3D0JA 1C8M3 4MX3A 5LASA 2WNVA 1RUH1 5A1AA 1G9AA 1ZYBA 1US2A 2OPKA 5F37A 1UKGA 1XNCA 2RS51 3GZAA 4NMIA 4MXVA 5FYSA 1D2QA 5JSPA 5K0UB 4Z2WA 4WM7A 5H9QA 3UKNA 2HWB2 1H2NA 2PHUA 4QDRA 4Y5Z0 5C3QA 1U5IA 3UT0A 4BPZA 2FDFA 3OGGA 3DKQA 3ZFGB 5GKAC 1WD3A 4S2DA 1RUE2 1RUC1 1QQP1 3VBRC 1V00A 1E57A 3OBZA 1D2SA 2HBTA 2TNFA 2VNOA 4COZA 1OFSA 1IKQA 1MQTB 3K3OA 4ZS3A 2B9VA 4A3XA 1PVC3 2XPJA 1OOPC 4BISA 5DABA 4QQOA 2VQUA 2QZ3A 3ZFEC 4DIQA 4L11A 1N3PA 2JB8A 1RUOA 4A4AA 1VLNA 1NCQB 1POV1 1JS9A 1XPWA 2ZTNA 1PZ9A 2C4XA 2WT1A 2YMZA 3TRSB 4D6RA 5IVFA 5JR7B 4MGTA 2QQIA 1F4HA 2E26A 5HBAA 3J8F3 4M4PA 1KJLA 4KG8A 1CAWB 2XLFA 1C57A 2VE1A 2Y64A 1YUDA 1OUSA 3BYWA 4LA2A 1GOGA 1RMU1 4Q1PA 2WWJA 2XVGA 3ENRA 4KBZA 4P9IA 1VRH1 2GN3A 4QPGC 1E5HA 2QZ2A 4DY5A 5FV3A 3JBG2 1LULA 1VB2A 3JD72 4IEQA 4P14A 4IE4A 3ABZA 3C3VA 3MV01 4Q4W1 1SLTA 2RS12 3H1MA 4GB33 1ULEA 1HRI1 3MIDA 3LKJA 3QH6A 1ZZBA 2GP5A 4AFAA 1S0EA 4DQAA 3EQEA 1MR5A 1W3XA 4I02A 5C3SA 4YW2A 3VBHB 3HWJA 3ACHA 3NV4A 3RDIA 1LHNA 1WCKA 3LEKA 2PQQA 1W8UA 2JB4A 2HWE1 3IN9A 1Y9MA 3KB5A 5D21A 1V9U3 4JKLA 3LA2A 4LBLA 2A1XA 2FMDA 4CXXA 2P34A 4UBHA 4HT1T 3KT7A 5FYBA 4NAMA 3THDA 4NRMA 3VBFB 2VOVA 3LEMA 2EAAA 5FZDA 3G7DA 2QFEA 5J36A 2WA4A 2GNDA 2JG8A 1ZBE3 1HB3A 3N7LA 1LGCA 1DQ6A 5I8SA 3RNSA 5LWBA 4BQ5A 3B9IA 4CSWA 1VR3A 4CP9A 4EWAA 1NOVA 1V6OA 3U10A 4IE5A 4DUXA 5E1RA 3VD9A 3LDRA 4Q4Y3 4RS5B 3FL7A 4BQ2A 4NJ4A 1V6LA 2R061 4JTNA 3ZLIA 2DBNA 2W87A 4LA3A 4CDQA 4L8QA 2ZAHA 4QX3A 1Z0HA 1WCSA 2RM23 3IT8A 2JDAA 3OUHA 1QOTA 4KH9A 3CEWA 3KV5A 4AVBA 1V0AA 4AI3A 3SH4A 2AC1A 1K3IA 2VZOA 2NP0A 1JMUB 1UL9A 2CV6A 2R32A 4JGYB 3RYRA 4QXCA 2FDIA 4Y5TA 2YC4A 5FKBA 5ACA1 5F1RA 5I8YA 1L3JA 5CFCB 3BVCA 1UXZA 3K48A 3N3HA 1YWKA 1LKNA 2J1TA 1UX7A 3B00A 5JIUA 1YJLA 1KGYA 2YBKA 3AK0A 1MEC2 4E27A 2PLV1 2WRAA 1JOJA 4KG0A 4CVUA 3LE0A 1KQRA 2AEYA 1YQ5A 4MUVA 4QQPA 5F9TA 4NIHA 2CGOA 1NKGA 2BW8A 3AKTA 4S2FA 5D8AC 2VTFA 3KS7A 5DAPA 5FZCA 5BNOC 5BNNB 2VCMA 5FZIA 1V6NA 5GZFA 1RTVA 2QNKA 4QQHA 4IE7A 3PJQA 1LENA 5FZMA 5K0UA 3WP6A 5GZCA 4GMP3 1QF3A 1W28A 4QMAA 2HH9A 1WD4A 3E6BA 4H7LA 1COV1 2VOTA 4MSVA 2X05A 4EZ4A 3ZFGA 4BWOA 1A6CA 4MOAA 4DFSA 4YW1A 4B1LA 1SDWA 4E9KA 3RGBA 2BVBA 3TEZA 5FZEA 4X8PA 2JDHA 4A7YA 3LPFA 3NAPC 1O4TA 1OF4A 2WZEA 4OUEA 4AI8A 4BK4A 3H8UA 3LA3A 3TEWA 3D3AA 1NLSA 3QH7A 3PU8A 4X6RB 4YVSA 1RVF1 4JZRA 1VBD2 2KR2A 1XRUA 3CZJA 3T3YA 4HANA 3WY6A 3O1MA 1NCQA 4K3UA 2G1MA 2J1EA 5FK8A 5EJZB 5L9VA 4Q0PA 3WW2A 3FWEA 4Z8BA 3JXSA 4P9JA 1VIWB 4CRQA 5CADA 3F95A 4C1WA 1CX1A 4H3WA 2MPFA 1CAWA 2P6HA 3OYWB 3OEBA 4CU8A 2IC1A 1W6NB 4DEVA 3WNPA 3LEGA 1LU2A 4YRDA 4A45A 4AHYA 3OG2A 3Q8FA 2EIDA 4AWDA 4QHOA 1YI7A 3O0WA 5ANNA 1WCDJ 1OT5A 4W6WA 4LUMA 1R082 3HQRA 4QX1A 1GR3A 2VBPA 5F3GA 5KHKA 2JDKA 2C26A 1QJY1 3ZYRA 1MS3A 3CIHA 2LRPA 3I3DA 1LOEA 2P3IA 4HKWA 1PO23 4OZXA 4RR3A 4XAAA 4OHXA 2FDJA 2EIGA 4KGQA 3VBHA 1JODA 3AXEA 3GF6A 2CAUA 1UQXA 4FQ4A 4WM7C 3A21A 4XZPA 3WINE 4A41A 4LNVA 1GZTA 4JQRA 4B1MA 2D43A 4BQ4A 1UZWA 2QQKA 3TAYA 4G9SB 1QHDA 4LE3A 1RL3A 5FO9B 3IMNA 3CO2A 1I5PA 1HB1A 2W39A 5L36A 2QDNA 5IK5A 1N1VA 1SBDA 4AGRA 4LHNA 3H8RA 2HLEA 4NR1A 2WQ4A 4YZ5A 5DZEA 1C5HA 1JOBA 2FCUA 4YGBA 1LGBA 2BGCA 1PZ8A 5T3NA 4XVHA 4RS5A 5FPXA 1S2KA 5DDJ1 4BQYA 2V4VA 1F15A 4ET7A 4M00A 1GICA 1GOHA 3K4DA 3T0BA 1UD1A 1DZRA 1W2OA 5FY9A 2A6WA 1IS3A 4R52A 5KR7A 2HWB3 3I2GA 4BIOA 1W2UA 3S7IA 2QQUA 2BP6A 2W47A 4JGYA 3VKOA 3VKMA 2ARBA 4A44A 1RUE3 4GMP0 5A7SA 5CFCA 4PLOA 4BMEA 2WLQA 3WQ0A 1W8NA 4YGEA 5EYYA 2XQRA 1MS1A 1ZVFA 5FR3A 2Y6GA 5IWFA 3S7EA 2EIEA 4FT8A 5AFBA 3THTA 4K21A 4UI9L 1ZREA 1E5IA 4NUBA 2VH9A 5EFUA 3M3QA 3ECQA 2XR4A 3WF4A 1PO12 5FPLA 4LBJA 4TXWA 1TNFA 3SQOA 2Z79A 1S2BA 5BNNA 1JI6A 1PHMA 1UN1A 2FMYA 3EXUA 1TG7A 2WNUA 4I3GA 1Y4WA 2JG8C 1S1AA 4CEYB 3HBKA 4XQWA 5FXXA 2WZPP 3LSEA 1KS5A 1NXD1 1W9FA 3PUHA 4FPFA 5FY0A 2YPJA 4R9CA 1BK0A 1FX5A 1VRBA 2IZWA 3NV2A 4IEWA 4RA0A 2D44A 4Y1VA 5LCWL 5FQ0A 2X5IC 3JBG3 3VHOA 1XC6A 4YZ4A 3JD73 3T1MA 4ES8A 2Y60A 2UYAA 2Y0IA 5FP9A 4QXKA 5I93A 2RS13 3GGLA 3IKWA 3SHRA 3U1XA 2R7EB 5JZGB 4NPLA 4HBNA 4CDQC 1VAKA 4XDQA 1IG3A 4CCLA 1FMD2 1UYXA 5FMBA 1CAXB 4QU1A 2V09A 2G9GA 4Q0VA 3JU9A 2E7TA 1OA3A 2YFZA 3A22A 3WG3A 5HCHA 1IKPA 4R9DA 4A6SA 2WS91 4N43B 2Q1ZB 1YJKA 2HEVF 1UU6A 3G6JB 3OYWA 1OQ1A 4QM9A 5A3NA 3NRUA 5JOYA 2BJSA 1HQLA 2R072 1W6NA 4RD7A 3M3CA 1CIYA 2BZDA 3ELNA 3E6CC 4NHKA 3FN9A 3SKJE 1RUF2 3JB4C 1LOGA 3WF2A 1GKBA 2VZTA 3POBA 3AVRA 5IJRA 3KQ4B 4XAEA 5KHHA 1UIJA 1PMIA 3U75A 1WKYA 2ZMNA 3OF1A 1J1TA 3RG0A 3MBWA 2F4LA 4Q4V1 5I0TA 4DINB 1MS5A 1OLME 1UOJA 3ZDSA 2JWPA 1QJX1 2ZA9A 2EXKA 2JEMA 2W1QA 2HWC2 5K0UC 4BLJA 2ZGMA 3BCWA 5B4NA 2RS32 5LY2A 1QOOA 1PX4A 2ZEWA 3MEPA 1XNTA 1SACA 2V4AA 3LA7A 4IERA 2WUHA 3M4FA 4YARA 3BIEA 1GNHA 3ZFGC 2IXKA 3IWZA 1YQCA 2D7FA 1H6YA 1DGWA 3BPZA 3ES1A 1SHWB 2LROA 3MFAA 4ZPIA 3RZZA 4AI1A 4BDVB 3O1VA 1SLCA 2P4EA 2PHLA 1YFYA 3T0AA 4BQ1A 5J96B 3RWKX 2VTXJ 1ND3B 2C1FA 2XKOA 1AR72 4LE4A 5HCFA 1MQTC 4V2VA 1QJFA 4D94A 4UFKA 2WFF3 4GWIA 4ZS2A 5C71A 1HQNA 4CPBA 2ZX1A 2VCAA 3KGLA 4F8AA 3I59B 1QOSA 1MEC3 3HPNA 5GM0A 1NCQC 1XBFA 1AYM2 4COUA 1O7FA 2WAAA 2R041 3W58A 1RYYA 2ZEXA 3H3ZA 2FCTA 4CXWA 1GP4A 4JDOA 1JYXA 1UCXA 2NLRA 4MLOA 4K8FA 3MUY1 4XXAA 5FZ3A 3OBRA 3HVDA 4CCDA 1UIKA 4BCUA 1WBLA 2XWJB 4DEQA 2GH2A 2B9UA 4YG0A 2R1BA 4NIIA 2P2KA 3WR0A 3WG1A 2A73B 1TQ5A 1W8TA 2FHRA 4LBKA 3C8XA 4FPJA 1AR61
chains in the Genus database with same CATH topology
2LTNA 5CBLA 3L2HA 4D7YA 5CA6A 4OI1A 1A8DA 1NYWA 2DYCA 4JC1A 4SBVA 3VBHC 1ONAA 2O8QA 3NL1A 4L9BA 1SLBA 1FI2A 1PVC1 1VBD3 3ZXAC 4MZUA 4GKXA 4UW6A 2NM1A 1FATA 3VBFC 4K7JA 2GH8A 1F5FA 3U4XA 4D7SA 1NQJA 4CEYA 2JDZA 1YO8A 4XW3A 4FOYA 4AEJA 1LODA 4RS5C 1JUHA 4ONUA 1R083 3VKFC 3WG2A 5JZGA 3PHMA 4DXZA 1ULDA 4PLNA 2WIIB 1RUI2 4XTPA 5GLWA 2XL9A 4GB31 1ZRRA 2R49A 3J4UH 2ZACA 1EYBA 5T54A 1TMF1 4ORFA 4XJAA 1PGW1 4RGAA 3JB8A 5AFEA 3AKPA 2F6BA 4JGYC 1N47A 3PVEA 3GZTB 2NQYA 4LHKA 5JOXA 1V9U1 4OUMA 4N43A 1OOPA 5CFCC 3P3NA 4IV1B 4TYSA 3HMYA 2ZZQA 3ZYPA 3BODA 5DUWA 5C33A 2IXLA 1IOAA 1BEV2 1BJQA 3KT4A 1ZBE1 1UAIA 3ZYGA 2ZHMA 1WLDA 4BZ4A 2PAEA 4YSFA 5BNNC 2WINB 4QPGA 4LBMA 4NHLA 1BVVA 4YLZA 4IEXA 4HLTA 2IXCA 4M01A 3B94A 3O0XA 3JQWA 3W59A 4BH9A 2EXHA 1SCRA 1ENXA 4LULA 1CJPA 4L2NA 2RM21 5C6CA 4FPCA 1H1MA 2QDRA 2UU8A 2YXSA 1G8WA 3ZN4A 5JPMB 5GLUA 3QCWA 1QJU1 1DQ5A 3VKLA 3O12A 4GQ7A 2VW2A 4AFCA 5FOJB 1WMDA 4AI2A 1H1IA 1O3SA 3I59A 3TB0A 2ZGTA 2XBO2 3CLPA 4CDUB 4FP2A 3FE5A 4WZFA 3V0AB 2YY1A 2X29A 4XBNA 4I2OA 4EN7B 4V1PA 1SFYA 4JVAA 2NYYA 1VP6A 1CIWA 1DQ4A 5AC91 1OA2A 1PGL1 1GNZA 1S0JA 1EP0A 1DDLA 4N7IA 4GMP1 1UX6A 4YW3A 2D97A 4Q27A 3AZXA 4HETA 4CTEA 2ATFA 1N1YA 1Z7S2 3SLIA 2A6YA 4IEYA 2XWBB 2QQPA 4OI4A 4Y1XA 4YFWA 2VGDA 3WLUA 1AL22 4BHPA 5BYNA 1FMD3 1D4VB 2F4PA 4R4XA 2JE7A 3AMNA 1W6MA 3TYJA 3MDPA 1GQGA 4AG4A 5EXOA 2HWF2 2D98A 2FZ1A 2NMOA 1EAH2 2R073 4M0HA 1QH7A 4PBPA 4YM2A 3ZIWA 1AJKA 1REEA 3I7DA 1RUF3 1QXJA 5BNQA 1DGRA 1XU2A 2ZGOA 1YYNA 1RUD2 1H30A 1NY72 1ASJ1 1G9FA 3FLPA 1FAYA 3L9JT 3V56A 1IPJA 4MVTA 2I45A 2ET7A 2OZ6A 1PO21 2HWC3 4WZCA 1LRHA 3HQXA 2RS33 2WZR2 3NAPA 2IXHA 5H9RA 1AR82 1QGLA 3ZXEA 1Q8PA 3N7JA 3VL9A 3B01A 4JAAA 3MLLA 1CAVA 2VVEA 3WNXA 4IV1A 2JD4A 5F6LB 1MACA 5JCTA 4YZ3A 3WP3A 1CONA 2ILMA 5KHJA 3CL1A 4Z82A 1HXS2 2DVAA 1YFXA 1AR73 4QX5A 4IV3B 5FO8B 3FBMA 1VBA1 1DGWX 2AZ5A 3LWCA 1C4RA 4MYEA 4YM0A 3MF9A 4ZKTB 5T55A 1J59A 4FPHA 5JLVA 1FPN1 3FZ3A 4HKOA 3ILFA 3IPVB 1DGRN 1W6OB 3E6CC 4AFDA 4LTAA 3IDEA 3P3PA 4CEYC 4IETA 3U07A 5LRRA 3VDDB 3WD5A 2WJSA 3ILNA 3WT3A 5HI0A 1AX1A 1OHFA 4C0BA 3ALQA 3O14A 4P9LA 3MIEA 2HWB1 4YGDA 2B45X 1CPNA 4EJRA 5JZGC 5E8AA 3USSA 3RS6A 1RUE1 2XL7A 1LHUA 3WP5A 4HSLA 1O3RA 5GJ6A 4XYXA 2UWAA 4CDUA 4GA9A 3DL3A 5HCBA 4N43C 5KXDA 3V0AA 1RUH2 3E5QA 1ZZCA 1QMJA 1GZCA 5J98B 4YG6A 2VMIA 1UPIA 3ZXLA 4MGYE 3KMHA 3N7MA 1S0IA 5LRSA 1QH6A 1TME2 2GC1A 4Q8KA 3JBG1 1RUC2 5SV8A 3JD71 1ULFA 2A3WA 3EJKA 4WVMB 2DUOA 1RUI3 2JXAA 1CJDA 3SXWA 2RS11 2ZX0A 4R9BA 4YW5A 1ND2B 4LLFA 2UWCA 4R9AA 3H7YA 2LALA 3DUIA 3NV1A 3T1LA 2QCSB 1K5MB 1FV3A 4XTMA 3A0KA 1VAVA 1PK6B 4LO5B 4AVSA 1UF2C 4B7KA 1ND3C 1QNWA 4HPKA 1YRZA 4AQTA 2HWD2 2H0VA 4K1YA 4ASLA 3U11A 2VUAA 2DU0A 3V64A 4YM3A 1BEV3 4N53B 1W6QB 4I3PA 1U5YA 3EHKA 1M06G 1ENRA 4YNIA 3LGRA 1HRI2 4EWEA 2VNRA 1OLQA 2RE9A 5L19A 3FJSA 4XIKA 1Q43A 2A3XA 2X5IA 5KXCA 1XNDA 1W6PA 3R4SA 2GNMA 2RJKA 1KITA 1BK1A 3AZVA 5CIRA 2NPIA 1FXZA 3MIFA 1BQPA 3ZVXA 5KC6A 4BM8A 2VPVA 4OVEA 2D5FA 3DPRC 4DPNA 4AE2A 4GULA 1MZFA 5FTTC 2K0GA 4I0WB 3WCRA 2K2SA 4Q26A 4XF9A 1XXNA 3AXDA 4IV3A 5CFDB 1URXA 4E4DX 3MFCA 2WFF1 1RUJ1 4YW4A 2AGSA 2JG9B 4R8HA 3UKTA 2XBO3 4N9IA 3IPVA 1YFUA 1D0HA 1W6OA 2DVBA 1LOCA 3R6SA 1GV9A 1C1FA 2D6KA 2OIIA 3APBA 3AKRA 3GALA 1ZRFA 1B09A 2XJSA 1AYN1 3ZYJB 3AMQA 1N1SA 2CNAA 5CB7A 3WP4A 4CP0A 2WA3A 2QVSB 1LGNA 4KL1A 3MW2A 4RSUA 4L99A 1I9RA 3IDBB 1DYPA 3AFKA 2XGXA 3IIAA 1LOFA 1LU1A 1CAUB 1Z7S3 3M8LA 4DOUA 4WVVA 3VZKA 1BYHA 2EVXA 3V0BB 1AL23 5JPNB 1Q8QA 2XHKA 3QD6A 4YG3A 3WG4A 3DV8A 2Q30A 1MQTA 1XYNA 2CYFA 1DFQA 4AHZA 2XJUA 4IV1C 5FREA 2HWF3 5C4WB 5I0SA 3IDCB 4XFHA 1DZQA 1GQHA 3MI8A 4KWLA 1EAH3 4I0AA 1SLLA 2D5HA 4RQPB 2DWRA 3CJIB 4M3CE 2PHFA 4XE9A 4Y1ZA 4HSJA 1R1A2 1X8EA 2PHWA 2ZKLA 4H14A 3AKQA 4RL7A 5E16A 3ASIA 1EV12 2VNGA 2VU9A 1R081 2CY6A 1MZ6A 2ET1A 1IS4A 3SNMA 4DZGA 1YNAA 1BVP1 1KDKA 2X8KA 4WVWA 1HV1A 4AEMA 3AJZA 1K5MA 3WHTA 2DFCA 1NLRA 2N7GA 4LBQD 1DQ1A 2WZR3 1AR83 1PK6A 4B4RA 3B9CA 2WKKA 3KCYA 2BFUL 3J9SA 3VBSB 3SCGA 5AVPA 1H8TB 1HXS3 4BA6A 1N3OA 3WQ7A 3ZSLA 3VBFA 1APNA 1VBC2 3ILRA 5L7OB 4N53A 5GZGA 1W6QA 4CDUC 2WNEA 1JYCA 1VBB2 3WW4A 4W6YA 4KQ7A 3B69A 3KM5A 4JDNA 4NOTA 1TEIA 5C9AB 4FOQA 4GWNA 5HXVA 3AYCA 1PIV2 1DQ0A 3NW4A 4XJ9A 1D4M2 3D82A 2QKDA 1CESA 2E6VA 4KU8A 2B46X 1WA4A 4XFFA 4EV0A 2ZJCA 1PVXA 2XUMA 2D6OX 4JGZB 5DXDA 2HEWF 3WW1A 5CFDA 2DURA 4B4PA 5KXBA 1UMZA 3POSA 1RINA 3CNAA 1LOAA 1AR92 3H1YA 1CN1A 4E4ZA 5DDJ2 3M1HA 1AL0G 1HRV2 2V73A 1RUH3 4OHWA 5BUVA 1WBFA 4LBOA 4XF0A 4A7ZA 4B29A 4BE3A 1KS4A 2VVDA 1N3QA 1WLTA 1F31A 2Z5WA 1H9PA 3GYDA 2DCYA 3ZIXA 2HEYF 3H3UA 1TME3 4Y24A 2ZPXA 3INAA 3H9AA 4X6QB 3WQ1A 1ZZ8A 4Q1RA 5GZEA 4XQDA 2FBEA 5GZDA 4K1ZA 4ZXKA 1C3HA 3WOGA 4XJ8A 3ROUA 2W0XA 1S0FA 2CAVA 4MXWB 2JX9A 4GIQA 5DG2A 3S30A 1X82A 1X33A 1FMD1 2RR11 4W6XA 1AX0A 3CF6E 3VHNA 1POV3 4HVRA 1S0BA 3AP7A 3RJ2X 1WLWA 4AW7A 4MV2A 1TE1B 1BBT2 5GLVA 5C4WA 1MS8A 4FOVA 2IFWA 2R6QA 5C8WA 2AUYA 2VVFA 4CP2A 3SCFA 3WDWA 2XLAA 2UYBA 2HWD3 1AXKA 2HKXA 4IV3C 3ZFFB 5KHGA 2BBVA 2ZABA 2R071 1XYOA 2VQ0A 4CDXB 1G86A 4F83A 2E7QA 5CAZA 2NMNA 1DBNA 1RUF1 2PN5A 1LJ7A 3HBZA 3L2YA 4S2GA 4IEOA 4XBLA 3SH5A 1HRI3 3MIHA 2WT2A 4I0BA 4AQ6A 3VDDC 5FMOL 3VZMA 2VG9A 1BMV2 1WGPA 2HWC1 2EXJA 1VAMA 1RUG2 4QPYA 1EPWA 1FV2A 1UU4A 2DVFA 2RS31 4XF3A 4Q8LA 1XYPA 1Q56A 4EN0A 4LO4B 1I6XA 2EA7A 2WS92 4DRVA 3VBSA 1LOFC 1S0DA 4Y20B 1MS4A 2YGLA 4ZU4A 1H8TA 1H8VA 3I4IA 4JCKA 2NN8A 2XJTA 1WW7A 1X50A 3HIFA 2C0ZA 1Y43B 1CVNA 1U0AA 3JUUA 5L7OA 2D6LX 4OULA 1NCRB 2WLPA 1VBE2 1UU5A 1MS9A 1PNFA 1ULGA 4HZFA 3DKWA 2DCJA 4Q4V2 5C9AA 1QJX2 1DU3D 2IWGB 3OTFA 3PVNA 4K40A 4AYUA 1QXPA 1JW6A 3N36A 1EPZA 4Q4X2 5C8CB 1OPOA 3M3IA 3JQXA 3VHRA 3ZN5A 4J1WA 2WQZC 1C8M1 4E2SA 1AUYA 3MICA 4N9HA 5T5LA 3HR9A 5CVRA 1ZRDA 3OCPA 1LESA 4XXPA 4JGZA 3V65A 4OHYA 1ND2C 1F5JA 2Y0OA 4OLLA 1QNYA 2QJVA 4D69A 1O3QA 4YVWB 2ZGLA 3E6DA 1OQEA 4DMIA 1K5MC 4KNCA 5JWPA 1IGOA 3O0VA 3VKNA 1DIWA 3ZSKA 1PK6C 1GSLA 2R042 2BNMA 2BWAA 2D40A 3RPQA 3MW4A 3UJQA 1SLIA 2DF7A 5DZFA 3RI8A 2E7AA 3VBOB 4Y26A 1W39A 1POV0 3TOJA 2IXJA 1DLLA 5CG8A 1HDKA 2YZ4A 2P3JA 4N53C 5IT6A 4IESA 3ZXGA 5J48A 5GLZA 3J8F1 3VBUB 1RJ8A 2D3SA 3GHMA 1R1A3 5LK5A 2SBAA 3NSTA 3ETQA 2R1DA 4IEUA 3ZX7A 1AR62 5FPZA 4XF1A 3LZZA 4BIFA 1EV13 3H1WA 2GDFA 1RGSA 4EROA 3FC0A 1RUI1 3OD0A 2VUJA 4MXWA 1IHMA 2ZBJA 4DNYA 4X8NA 3EO6A 4XFCA 2RMU2 4HVOA 4GXLA 4CP1A 5J3UA 1WMFA 4NHMA 1CAXA 5LEKA 5IUQA 1I1EA 1PNGA 1AZDA 1DYKA 3ZFFA 5CFDC 1SFNA 2JJ6A 2EAKA 5AVAA 2JICA 1RHI2 2XJQA 4AEDB 1VBC3 4B3NA 2A7AA 2BUKA 1C1LA 2JG9C 3PMEA 3S0MA 3ES4A 2DCKA 1VBB3 2YV8A 4COYA 1HW5A 2ZKNA 3AYAA 2ZGUA 1YIFA 4COVA 3QOPA 1AVBA 3AM2A 4FVVA 1TMF2 4Q4Y1 5A33B 1PIV3 3R4DB 3VLBB 1D4M3 2BNNA 4QD2A 2EXIA 3RSJA 3N35A 4ISRA 3NV3A 5DUVA 5KHIA 4LR4A 5T5OA 1FOD2 2Y38A 3B7MA 3JCIA 5L73A 1B35B 4JRLA 4ATFA 4EWDA 1G9BA 1AX2A 1NA1B 2W68A 2XVLA 1NCRA 1ND3A 2JENA 2B39A 1AR93 3B3QE 1ALYA 5DDJ3 4AVTA 3KCXA 4A7KA 5C4WC 1HRV3 3AMHA 2XG3A 1Q3EA 2B8MA 2XBO1 3BOPA 3WHUA 2E9QA 2WNVB 1ZX5A 4RQPC 1PO13 2A71A 3CJIC 2VY0A 4KGGA 1A8MA 4MGZE 2VXRA 1CPMA 1IPKA 1GFF2 1H9WA 2GZWA 2YHJA 4Q2FA 5E88A 5T50A 2I74A 5JIAA 2MEV2 1QJU2 3KGZA 5DZGA 1Z7S1 1A3KA 1M4WA 2GNBA 2XJRA 3DPRA 1YHFA 2ZHLA 2ZX2A 4YVWA 5FBZA 4LO8A 1HV0A 1QXRA 1AL21 4P5HA 4AFBA 3UJOA 3WUCA 4BOWA 4GWMA 4XPVA 2DVGA 2Q1MA 1HLCA 2XJPA 4NO4A 1Y9QA 2ES3A 3VBSC 4XMAA 4XILA 1MVQA 1BBT3 1YCIA 2GU9A 2HWF1 1H8TC 2QE3A 5AC92 2PELA 4ITCA 2E51A 5L7OC 1EAH1 1R092 2VMGA 3VBUA 2QUOA 2GMPA 2GMMA 3MW3A 4XFIA 4XHBA 3ZXJA 1U12A 5C9AC 3ME2A 3FMGA 1RIRA 4Y4YA 1NY71 4QGLA 4UW4A 1V6KA 1F2NA 3B93A 3GBGA 1J3RA 2VQAA 5GLTA 3O5SA 4E4SA 2R0FA 4I30A 1IQAA 3BB6A 2BVVA 1WW4A 3FFZA 1RUG3 2CTVA 4PIZA 3HT2A 4LBQB 4AQ2A 2WZR1 3PLQA 1KD7A 1OMIA 3TN92 2WS93 4JGZC 3VGIA 3AP9A 2DFBA 3ZPYA 4Z92B 4XEZA 4C91A 4AEDA 1ZBA2 3VZNA 1HXS1 2D93A 1QDCA 3PMSA 3BOWA 1AHSA 1VBE3 2SLIA 3DPRB 3POWA 3SISA 4WM8B 4D7TA 4GH4B 1ASJ2 1H0BA 4ATEA 1BKZA 2ZZJA 4Q4V3 3S6PA 1G9CA 4RHV2 1AYM3 5IK7A 2JECA 5A33A 3KT1A 1Z78A 4HN1A 4Q4X3 1OD5A 4QU2A 2FQPA 4Q0UA 1O3TA 4HL0A 3DN7A 3FHIB 3WXPA 1UPSA 2DTWA 2DV9A 4DB5A 5FLHA 1NXMA 2WFPA 3RI9A 2TBVA 2D6PA 1FT9A 4FCAA 5KBFA 5CU1A 2GC0A 1HX6A 1VBA2 1OI6A 1FNYA 4AGGA 4XFAA 3C2UA 3PTYA 3CU7A 1MZ5A 5A3LA 4FPLA 2R043 1FPN2 4HVQA 5FAXA 3Q9OA 1OLRA 2AYHA 1DGLA 1H2KA 3ZFFC 1CR7A 2I2SA 1JHNA 4CDXC 1Q8SA 4YZ1A 1S0GA 5LEJA 1AXYA 1GBGA 2WL1A 3AZYA 4XFBA 5JI7A 2RS52 3WZ1A 1RJ7A 3I2DA 4PJYA 1TME1 5K9YA 3WDXA 4AEKA 1PM7A 2CGNA 5A3MA 3VHPA 1AR63 2GN7A 3W9AA 1JN2P 4SLIA 2ZOEB 3AMMA 2BEOA 3ZMOA 1QWRA 1CGPA 1U5ZA 5FO7B 5DUUA 1C5IA 2Q0AA 1LHWA 1QQP2 3FLTA 4YFZA 1PGSA 5CG9A 4YVSB 1GANA 2O8OA 5FOBB 2D3PA 2RMU3 4ZU7A 3NKTA 2XLGA 2B5HA 2ARXA 3FX3A 2PHXA 3M7AA 5D1IA 1ZA4A 2ZMLA 4FPGA 4UW3A 4FPEA 2P17A 2R16A 2VULA 1KRIA 2PAMA 3KSCA 2HWD1 1NCRC 3E97A 1RHI3 4QQLA 5F6KA 4FAHA 1FNZA 2VW0A 1C8NA 4PQ9A 4OFGA 1RMU2 4FQZA 3IM0A 1J58A 1VRH2 4XIOA 2ENRA 3D8CA 3QBQA 4MGKE 4FOWA 5JVVA 1JXNA 3MGUA 4Q4W2 1LECA 2C5DA 5C8CC 1TMF3 4RR3B 2MNGA 5EWSA 3OBTA 2ETEA 3ST7A 4LBQA 5KC5A 1DG6A 4OI0A 1S0CA 1BXHA 5A32B 3WVJA 5I8TA 5BXXA 2ZGKA 2HWE2 4PDWB 1FOD3 2BNOA 3LOIA 2VOWA 4FBFA 4YVWC 3AFGA 4OUSA 3X29B 4AGVA 3AZWA 1R1ZA 2AH2A 3D5OA 4Y1UA 3AYDA 4XBQA 3IBMA 2GSYA 4WM8A 2Q5TA 4QPIB 4GH4A 3WDTA 1V6MA 1REDA 3TNQA 1ENQA 2CL2A 3NKGA 4HMZA 3VBOC 4HK8A 1ZRCA 1MEC1 4CDWB 3RWNA 1H2LA 1IZ3A 2R062 4WVZA 5SV5A 3DGTA 1AJOA 1O5LA 1SQ4A 3ATGA 3FLRA 3WV6A 3VBUC 3RMYA 2DU1A 2WSVA 2YDEA 3VDDA 4FPYA 3H0OA 2Y26A 1Q8VA 2PYTA 3VL8A 2R0HA 1OFNA 2MEV3 1QJU3 4E2GA 2ERFA 4LBNA 5ACA2 2ZMKA 3SCHA 2WFF2 1RUJ2 4QM8A 4Y1YA 2EF6A 3AZZA 2DCZA 2BTVC 1XQNA 2GC2A 4OHVA 2PLV2 4F7ZA 1H4GA 4FTEA 3MLKA 3TNPB 1VBD1 4NN0A 4K9SA 5AC93 2Z2SB 5CNAA 2BQPA 3TWIA 4AEDC 1AYN2 1HKDA 1GZWB 2A6VA 2WNUB 2OZJA 2PAKA 3USUB 3KLSA 1R093 1F9KA 4INDA 1OKQA 3PJYA 4HN0A 4IEVA 5KXEA 5FQ0B 1DF0A 1R1A1 2H0BA 2P3KA 4Y22B 2TEPA 1COV2 4M3CF 1OQDA 1EV11 1RUD3 3AMPA 4WVMA 5F5QA 2OUHA 5FLIA 1JYIA 4N7UA 4YM1A 1GZ9A 1ZZ9A 5KWRA 1H1AA 1ND2A 1O4YA 1ULCA 2ZX3A 1RVF2 1WW5A 2BFUS 3HN1A 3K51A 3TN93 3U0ZA 3CJXA 1DZTA 1B35C 3E5UA 4COWA 3VN4A 1NA1C 1XU1A 4FP3A 1XE8A 5EV7A 2RHPA 4RFT0 2I07B 1ZBA3 1MS0A 1VBC1 3MYXA 5K7PA 1KFUL 3THPA 4AQSA 5FCCA 1ASJ3 4LO6B 1VBB1 1RITA 4KWKA 2WNVC 3TBDA 5J09A 2VOXA 3DF0A 1Q8OA 3LAGA 3WDUA 4EN8B 4RHV3 1QJY2 2D3RA 4P9YA 2UY9A 2EALA 3HT1A 1MZEA 1PIV1 3RJRA 4K20A 2GNTA 1D4M1 2BWCA 3R05A 2MHFA 5A32A 1XNKA 4PDWA 3M3EA 4UBGA 4Z07A 1JTZX 3QACA 3SITA 2WT0A 5JMCA