5CFCC

Crystal structure of human cardiovirus safv-3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
258
structure length
258
Chain Sequence
SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
total genus 53
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcC00
1VBC3 4RS5A 1RHI2 2X5IB 5L7OA 1AYN1 4N53C 5ABJA 4IV1B 2R062 4QPGB 4CDWB 5A32A 2R061 1AL0G 1VRH2 4IV1C 4QPGC 2XBO2 4YVWB 3VBFA 1VRH1 1RUE1 1VBA1 2RS13 4RHV2 1VBC2 4CDXB 2XBO1 1NY72 1AR82 1AL23 4CDXC 5FOJB 3JD72 1NY71 4FTEA 1AR81 5JZGB 4GMP3 1NG0A 1H8TB 3JD71 1NCQB 5JZGC 4NWWA 3JB8A 3FBMA 1V9U3 3VBUA 3VBRA 1NCQC 2RS12 1RUH3 1HX6A 1MQTA 1F8VA 3M8LA 1EAH3 1VBD3 1PGL1 4JGYA 3VDDA 4GMP1 1V9U2 5ACA3 1RUI3 1SMVA 1TMF3 1RUH2 4N43A 1FOD2 1RUG2 3VBUC 1EAH2 4AEDA 4CEYA 1RUD2 5DDJ3 1HRI3 1VBD2 1FOD1 1RUG1 1EAH1 2BPA2 1RUD1 1MQTC 1RUC3 4Q4Y3 1ASJ3 1RUI2 4IV3B 1TMF2 3ZFGB 1D4M3 4WM7B 2FZ2A 1RUI1 4IV3C 5BNPB 3J8F2 3ZFGC 4WM7C 3VBSB 3J8F1 1FPN3 5BNPC 2IZWA 2RMU3 1RUC2 1RVF1 4WM8B 4Q4Y2 1HXS2 3VBSC 4SBVA 4CDUB 1F2NA 1RUC1 5C4WA 1HRV3 4WM8C 1HXS1 2WLPA 5K0UB 4YVSA 4QPIA 1X33A 4CDUC 1AYM3 5K0UC 1POV3 5CFDA 1FPN2 1AR93 1ND3B 4CDWA 1R082 2X5IA 1AYN3 1ND3C 5D8AB 4IV1A 1R081 4QPGA 1AYM2 3CJIB 2R063 3IDEA 4CEWB 1AYM1 1EV12 3CJIC 4Y5Z0 4YVWA 1VRH3 1RUE3 1VBA3 1AR92 2VQ0A 4CEWC 5LK7B 2R042 1EV11 4CDXA 1AR91 3ZFEB 2R041 1AR83 1NA1B 3ZFEC 4CDWC 5JZGA 1B35A 3JD73 2BUKA 2BFUS 2X5IC 4RQPB 1H8TA 1NCQA 1NA1C 2RR13 4GH4B 5C9AB 1RUE2 1VBE3 1VBA2 4RQPC 5CFCB 5C9AC 2GSYA 5CFCC 4YVWC 2RM23 4BCUA 2WWSA 1PGW1 2RR12 1VBE2 1A6CA 2RR11 1H8TC 1VBE1 3JBG3 1FMD2 2RM22 1CJDA 1C8M1 1FOD3 1QJY3 1PGL2 1RUG3 1FMD1 4FTBA 1RUD3 2RM21 2TBVA 1RUJ2 4IV3A 1ND2B 1QJX3 3ZFGA 4WM7A 2RS33 3ZFFB 3LOBA 3JBG2 1RUJ1 5BNPA 1ND2C 3ZFFC 3JBG1 1QJY2 3J8F3 4EJRA 3VBSA 3TN91 2MEV3 1RVF3 1QJY1 3VBHB 5GKAC 4WM8A 4Q4W2 4CDUA 1HXS3 1QJX2 3VBHC 2RS32 4Q4W1 5K0UA 4RR3B 1E57A 1QJX1 1RUF2 2RS31 1PIV2 2HWE3 4PDWB 1BBT1 1PVC2 1RUF1 1OHFA 1POV0 1VB4A 2MEV2 4RFT0 1RVF2 1PIV1 1ND3A 2ZTNA 4PDWC 1PVC1 1AR63 2MEV1 1R092 1AR72 3NAPB 5D8AA 1X36A 1R083 4NWVA 1R1A3 3S6PA 3VBOB 1R091 1AR71 3NAPC 2HWB3 3CJIA 2WS93 2PLV2 5BNOB 3VBOC 4CEWA 2HWE2 2HWF2 2Y26A 5FMOS 2PLV1 5BNOC 2HWE1 1EV13 1BMV2 1AR62 2HWF1 2R043 3ZFEA 1BMV1 1R1A2 1AR61 2ZZQA 4Y4YA 1NA1A 2HWB2 1ZBA1 2WS92 1PO13 1R1A1 1BEV2 4RQPA 5D8AC 1OOPB 2HWB1 4GH4A 2WS91 5C9AA 1K5MB 1BEV1 5CFCA 1NCRB 1OOPC 1HQNA 1K5MC 1MEC3 1OPOA 2R073 5BNNB 4Q4V2 5A33B 2HWD3 1PO12 4LLFA 4Q4V1 1CD3G 1PO11 2FZ1A 4GMP0 1RMU1 1MEC2 2WFF2 4GH4C 2WZR3 1AUYA 1C8M3 2R072 1DDLA 2XPJA 1MEC1 1QJZA 2WFF1 1FMD3 2HWD2 4N53B 2R071 4Z92B 1PGW2 1VAKA 1Z7S3 1COV2 1C8NA 3DPRB 2HWD1 1QJU3 1RHI1 1COV1 1ND2A 4CDQB 3DPRC 1RUJ3 3ZFFA 5C8CB 2WZR2 5AC93 1C8M2 4CDQC 4JGZB 5C8CC 2WZR1 3TN93 4JGZC 1B35B 1Z7S2 1AYN2 4RHV1 4RS5B 3VBHA 1VBC1 1QJU2 5L7OB 1Z7S1 1B35C 4Q4W3 5ABJB 4RS5C 1QJU1 4FSJA 5L7OC 4RR3A 5A32B 5AC92 5ABJC 1BBT3 4PDWA 3HAGA 1RUF3 3TN92 3ZXAC 5AC91 3VBFB 1PIV3 1W39A 4FTSA 1PVC3 2RS11 1AL22 3VBFC 3NAPA 1AL21 2HWC3 1R093 3VBOA 1AR73 2GH8A 1ZBE3 2BBVA 5BNOA 1BBT2 1TME3 2PLV3 3VBUB 4RR3C 5FMOL 1V9U1 3VBRB 1VBB3 2HWF3 1QQP3 1RUH1 3VBRC 1MQTB 4Q4X3 2QQPA 2HWC2 1NOVA 1ZBA3 1ZBE2 1VBD1 2HWC1 5ACA2 4JGYB 3VDDB 1TME2 1OOPA 1ZBE1 1K5MA 1BEV3 1M06G 5ACA1 1RB8G 4JGYC 1VBB2 3VDDC 1TME1 1TMF1 1NCRA 1QQP2 5J98B 2ZAHA 5DDJ2 4Q4X2 4N43B 1HRI2 1VBB1 4AEDB 1QQP1 1WCDJ 4CEYB 5BNNA 4GB33 5DDJ1 1ZBA2 4Q4X1 4N43C 1HRI1 3JB4C 5A33A 1VB2A 4AEDC 2RS53 4CEYC 1ASJ2 4Q4V3 1D4M2 4Q4Y1 2BFUL 1ASJ1 1RMU3 1D4M1 5J96B 4GB32 2RMU2 1PO23 2WFF3 2DF7A 1NCRC 1GFF2 1FPN1 4N53A 2RS52 4GB31 2RMU1 3DPRA 1HRV2 1RHI3 5BNNC 2RS51 1COV3 5C4WB 1RMU2 4CDQA 1HRV1 4YVSB 5C8CA 4QPIB 5C4WC 4JGZA 5CFDB 1PO22 4YVSC 4QPIC 1POV1 2XBO3 5CFDC 1PO21 1IHMA 4RHV3
chains in the Genus database with same CATH superfamily
1BYHA 1ULCA 4EWAA 3E6BA 3KLSA 5I0TA 3ACLA 1PMJX 3LEGA 5ABJA 5FZLA 2Z69A 2R062 2D6MA 2EA7A 2GP5A 1UX6A 3ENRA 3F95A 2GNBA 4CPBA 5K9YA 2AENA 5KXDA 3C7OA 1ZNPA 4LIVA 4QPGC 4D69A 5FCCA 4P9IA 2D97A 3HD8B 3GBGA 4FAHA 1RGSA 4H2AA 4HSJA 3WDXA 2RS13 4Q27A 2V4AA 3WDWA 4NPMA 2WN3A 4PIXA 1X9TA 4UT5A 5FWJA 3WNXA 4B29A 4J1WA 4QB1A 5AVAA 1FI2A 2D3PA 1AL23 1LKNA 2B7YA 2QVSB 3UNPA 3JD72 3AP5A 1OPMA 2WLQA 4OMCA 4BQ4A 5JZGB 2B4KA 3RJRA 2QQLA 1H8TB 4XCAA 4XILA 1DF0A 5CKMA 5J36A 4QPWA 3FBMA 3VBUA 4HN0A 1W0OA 1NCQC 1ZZ9A 4FPCA 2K46A 4COWA 3QBQA 3NJZA 1VR3A 4S2DA 5A80A 5LBFA 4P9JA 1MQTA 4DQAA 4DUXA 3AMPA 1F8VA 3ZN4A 3OTFA 1EAH3 1UY1A 5LA2A 3ZN6B 3UJOA 4FO9A 4OI4A 2CYFA 2X29A 2WZEA 1UKRA 4FPJA 1PGL1 3OBAA 4XUQA 4ZXKA 1E5SA 2VD7A 4IESA 5CKQA 1OVPA 5DG2A 1W8WA 5EJ1B 3THCA 3RYKA 5D2AA 3MV11 5A7QA 4G4FA 4BU2A 1O3TA 4NPRA 2W46A 3WW2A 2ZEZA 4N43A 4YGCA 1RUG2 2AEYA 3OEBA 4GD4A 4OHXA 4UFIA 4KL1A 1LJ7A 4LBQD 5LATA 3SISA 2P4EA 1FOD1 4MHRA 4YLZA 4D0QA 2PHLA 2CAVA 1EAH1 3HJRA 1QWRA 4MGYE 5JSOA 4NIAA 2WZ8A 2DCJA 4UFLA 5FXZA 1Q3EA 1RUI2 4IV3B 1LNSA 3PNAA 4ES8A 1OQDA 4WM7B 1CVNA 1SBFA 5M0TA 4XOGA 3KCCA 2D6LX 5BNPB 3T4VA 4O65A 1KFUL 5FFOC 3THPA 3PURA 3IBMA 2A6WA 3FZ3A 1Q43A 4ASLA 3Q8EA 1S4CA 4UBHA 1WMXA 4OVEA 2Y6JA 1UZWA 3QH6A 3MPBA 1UY2A 2IZWA 2RMU3 1SQ4A 2RHPA 4MHUA 3T30A 4E4HA 1RVF1 2L9LA 5IT6A 3VBSC 4NHKA 1VIWB 4IE5A 5APAA 1Y4WA 4SBVA 3HN1A 5FK8A 3P1IA 3S7IA 2VH9A 4TLFA 1HRV3 4WM8C 1HXS1 3E5XA 4F8AA 4YVSA 2Z79A 3NWKA 4QPIA 1X33A 1XYNA 3B5LB 3DXTA 1U5YA 1CIWA 4KH9A 1K3IA 4RFRB 4XMAA 1GICA 3WNPA 1POV3 1FPN2 3FL7A 5CG8A 5CYYA 4YG0A 4Q0PA 3CO2A 2QQWA 1ND3B 3LA3A 4CDWA 2Z4FA 3SH4A 2Q8OA 5HI0A 4AVVA 2PHDA 1YI7A 1S55A 2SBAA 2ZKNA 2X5IA 1AYN3 2A75A 4C8DA 2P37A 2VNVA 2WWUA 3I2HA 5D8AB 3I2JA 4IV1A 1R081 3MPPG 1C57A 1BHGA 2ZMLA 4M01A 2OQ6A 4AE2A 1NXD1 2VR4A 1AYM2 3WF2A 2ZX1A 3CJIB 1UY3A 2R063 1IG0A 2UWBA 5ANQA 3KWVA 4I01A 2RJ2A 2EICA 5HV4A 1WLCA 4YZ4A 1CPMA 3U4SA 4FPOB 4IE7A 1DIWA 4CCNA 1XYPA 1EPZA 1ZZ6A 1RUE3 2VPVA 1AR92 5LK7B 2HEWF 2R042 3R4SA 2RV9A 1OLRA 4DXZA 4JKMA 1EV11 3RZLA 4DNYA 3LDRA 3P6BA 5T52A 5BY5A 5JPNB 2GALA 4YSFA 2B46X 1CPNA 1NA1B 3IIIA 1HIXA 3JD73 4Y5TA 4OI0A 2BFUS 4BISA 4OYUA 1W6QA 3MLJA 4GH4B 1PHMA 5C9AB 3M2MA 3IAQA 1VBE3 4IXLA 3NNMA 3V64A 3WF4A 5CFCB 5KC5A 1S0BA 2XL7A 3WF1A 1BJQA 3PU3A 2C9AA 5FK7A 1MR5A 4YVWC 4WZFA 2G19A 1BQPA 1QDOA 2XJPA 4AQ6A 2R7EB 3TEWA 2R16A 3AVSA 1W8OA 2ZGUA 4JTNA 5H9SA 2FQPA 3V65A 4K40A 1UO9A 2EIEA 3BTXA 1PGW1 2OX0A 3VD7A 4Y20A 3WG3A 4Y24A 4BK5A 4FAGA 4IE0A 4AAXA 1ODMA 2KXLA 2D44A 1CIYA 2JKBA 2AREA 5J1XA 3AMQA 3FWEA 1VBE1 2P1BA 3T0BA 4DPNA 1F15A 1AXKA 3RGBA 2RM22 1CJDA 5ISLA 4O61A 1QJY3 4EE2A 2ZGMA 3ILFA 4M3CE 1RUG3 2ZX2A 1HLCA 1EP0A 5A1LA 3BU0A 1CESA 2JICA 1LOEA 5FZOA 3H8OA 3UETA 1FNZA 4A42A 1Q8SA 4Q26A 4MGQA 1WW5A 1UAIA 3ZIXA 1GOHA 1ND2B 3ZFGA 1YRZA 4GJZA 4HMZA 5CISA 1RUJ1 2DU1A 1S0DA 4LT5A 4LR4A 5JPMB 1HV1A 1VMJA 1AVBA 2XHKA 5EYYA 3TNPB 4D7TA 4I3GA 4D3WA 4YZ5A 3AVRA 2MEV3 1J3PA 3LWCA 3N4MA 3FX3A 5AFBA 5J7MA 1QJY1 3RMXA 1ZRCA 1ENSA 2YG0A 1W2AX 3LEMA 1LGNA 4U36A 3UESA 1SFYA 3CZJA 4HK8A 3OB8A 4LBQA 4B4RA 4CXWA 3CIHA 3AZWA 5K0UA 4BQYA 4HLTA 2VC9A 4HETA 4MSVA 3GM8A 3VZNA 5L9RA 4CCMA 1RUF2 3PJQA 5FKBA 2E7AA 2BJSA 4D6RA 4CP2A 1PIV2 3GZAA 4KWJA 1UZYA 4PDWB 5JIUA 2VE1A 3KS7A 2EVXA 1S2BA 3DF0A 1I3HA 4A3ZA 1YIPA 2ERFA 2MEV1 2VW0A 3RNSA 2NQYA 3O1UA 2V5YA 3AJYA 4URAA 1LHWA 3T0DA 1WGPA 4NWVA 4LEJA 4OUEA 4IDZA 3SCFA 3SH5A 5FDBA 1AR71 2FDJA 1WW7A 2WINB 1CAUB 2WFPA 2WNUC 3MIFA 3NNGA 3WHTA 2XJQA 4JDMA 4H55A 5BNOB 3FLTA 4HBNA 5A7PA 1UQXA 5JI9A 5IK8A 1S0EA 5DG1A 1C1FA 2MPFA 5FMOS 2PLV1 4CP0A 1KJLA 4AHZA 2R30A 4X6QB 3HNMA 4JKLA 1MS5A 3WXPA 5ERLA 5KXCA 2R043 2DWRA 2VQUA 5LY1A 4L97A 3RPQA 3BKZA 2JD9A 1NAEA 3OF1A 3ZSJA 2XLFA 4K8RB 3ACFA 2EXHA 3WG2A 4DOUA 5FZCA 5B4XA 1PO13 5BV6A 3HNBM 1W03A 2HH9A 3FC0A 1OOPB 3AKPA 4KQ7A 3MZHA 1ULDA 4E2GA 1WZXA 4Q29A 4EN8B 2VZPA 4FFIA 1HQNA 3O1OA 5FPVA 3VKOA 3SEEA 4DB5A 2BGCA 3H0OA 1UPSA 4XPVA 1QY4A 4YW2A 3L2HA 4AI0A 1OXCA 3WQBA 5F6LB 3MIBA 1MS9A 4K6BA 1Q8PA 4P9LA 1F5FA 4LLFA 4HANA 4QXKA 4XAEA 3V56A 3OEAA 3WW3A 5FYCA 4HN1A 4D7YA 5J37A 3LE0A 1CAVA 1FT9A 1PO11 3F2ZA 4KMQA 4DMIA 5DUUA 5I93A 1MS0A 2YGLA 2YGMA 4I09A 2Q8EA 2UYAA 4JV4A 1MEC2 2YV8A 3NMBA 4H7LA 2EXJA 4IUGA 4C91A 1S2EA 4QX2A 3MUY1 4HVQA 1C8M3 1WBLA 4W6YA 3JU9A 5FPZA 3LKJA 1B09A 2GN7A 2HWD2 2FBEA 2DYCA 4HT1T 5FZ9A 4Z92B 1Z7S3 2XJVA 1COV2 2NM1A 1QXPA 1VRBA 3GALA 5FY0A 3T08A 1W8HA 3VL8A 3NO8A 4UW5A 4Q1PA 4YG6A 3ZFFA 4CCEA 1JXNA 2VZRA 4UFHA 2JJ6A 5C8CB 3C7HA 4I02A 3NSTA 4BE3A 2WZR2 5E6HA 2AR6A 3MIEA 2VU9A 3FUOA 4FT8A 4NIIA 1ONAA 5FO9B 3TN93 3NNJA 1KGYA 4Q0SA 5JDBA 5FY4A 3S30A 2RJLA 5DPNA 5JAXA 2QQKA 2HBUA 1IS4A 1VBC1 2JG9A 4LMFA 2GC3A 3E97A 1Z7S1 1B35C 3NQHA 4GAZA 5ABJB 4RS5C 4IE6A 3C7EA 1H1IA 5EV7A 5FMBA 4FFFA 4QQPA 1N1VA 1RC6A 2B9VA 1LEMA 5AC92 2Y64A 1T2XA 3UKTA 4Z07A 1BBT3 1LGBA 4YW1A 3FMGA 1RXGA 1RUF3 2WQZC 3ZXAC 2AC1A 5A3WA 2VMIA 4KBBA 3R6SA 1PIV3 3FFQA 4LO4B 2WAOA 2CV6A 2Q30A 2WUHA 3HN3A 2QZ3A 5AVPA 1UIJA 5HV0A 5G05L 2UWCA 4J25A 3NAPA 4LIUA 3H3UA 4MOAA 3O14A 4AI3A 1WLWA 5CB7A 4AW7A 4PIZA 3GXUA 1OKOA 3HQRA 4RGGA 4OI1A 2DUOA 2WN2A 5GLTA 3N9PA 3C3VA 1OF4A 4XYXA 2IXIA 2VUDA 1VMHA 5G04L 3IN9A 4MUVA 3VBUB 3WNLA 4BYYA 4RR3C 1JODA 1REFA 1V9U1 3DCQA 4IE4A 5FMOL 2Q4SA 4B7EA 1V6JA 1VBB3 1ULFA 4CP9A 4FPLA 4XZUG 3MF6A 5CNAA 4L99A 1MQTB 3MW3A 1IGOA 2HWC2 2LM3A 1NOVA 2ARCA 4ISRA 2WABA 1H4HA 3BIWE 3V0AA 1VBD1 5FQ0A 1NYWA 5ACA2 1KDMA 3VN4A 2BNOA 4AG4A 4UWDA 2AZ5A 5BXXA 4M4PA 4BWOA 4P9WA 2ZS6B 2QZ2A 2Q1FA 3BTYA 3VDDC 2VBPA 1KEXA 4BLIA 1LULA 3TEYA 1W2NA 4XF0A 3NJYA 3TWIA 3ILRA 2IWGB 4N43B 4Q4X2 1VBB1 3HVDA 1JUIA 3FN9A 3K48A 1ULGA 2XUEA 2IXHA 4EN7B 3N7KA 5DDJ1 1ZBA2 1LOBA 1PK6C 1WMDA 3ACIA 3GBFA 1H1MA 1R1ZA 2VMDA 4I0AA 4R9AA 1KXGA 1W9YA 5FY5A 3RI9A 1QH7A 2ZHLA 1W99A 4AZZA 3MIDA 4MLOA 4BDVB 4HXCA 3DYMA 2JDAA 3AB0A 3IB3A 4Q4Y1 3ZXLA 4V2VA 1ASJ1 3ZXFA 1OKQA 4WBBA 3WR0A 1GUIA 3ZSKA 4DXSA 1CAWA 3I54A 2CY6A 1XNDA 3B9CA 2ZGSA 3HNYM 1J1LA 4NROA 2EALA 2Y6KA 4YW3A 4F7ZA 1GBGA 1QXRA 4GB32 2ETEA 1ZA4A 5C3RA 2DF7A 3JXSA 1NCRC 3N7LA 1BLZA 4PF1A 2ZX3A 3N9QA 3MYXA 2P2KA 3N7JA 3A4UA 4XTPA 3DPRA 5BNNC 1YWKA 2R1DA 3NNLA 2AYHA 5IAVA 1COV3 2VOVA 1DLCA 2BWCA 1RMU2 3B3QE 4LO8A 4RGKA 4CDQA 2Y0IA 4YVSB 1V6KA 2DBIA 4QPIB 2PHTA 2R49A 5A6ZA 2WJSA 3PUQA 2JIGA 2W1SA 1PO22 4XJ9A 4BHPA 3UJQA 4X8PA 3KD4A 4CVUA 2XBO3 2A73B 5LB6A 3J9SA 2CTVA 5CFDC 1IHMA 4RHV3 2W94A 4CDWB 2D43A 2IXKA 4MGTA 1DQ4A 4YGDA 3BI3A 1RHI2 3POGA 2NMNA 2X5IB 3RSJA 5L7OA 1VJ2A 2XH6A 4E2QA 4UF0A 2O14A 2XMLA 4IV1B 1HW5A 2GNMA 3EMRA 4YYOA 4SLIA 5A32A 5IFTA 1YO8A 3IKWA 2VUAA 4QM8A 3SMHA 2WT0A 5A6YA 2ZEWA 1NXMA 4YZ2A 4LKFA 3B00A 3PJYA 1GOFA 3BB6A 3VBFA 4AFAA 4D8MA 3I2IA 1QXJA 1VRH1 2VZOA 1VBA1 2W0XA 3ES1A 3NKTA 3AM2A 3SXWA 4CU9A 4NO4A 2XBO1 2ORZA 4MYEA 3VD9A 1NLRA 1Q8OA 4LHLA 3WP5A 2PHWA 1DGRN 5FOJB 3ZSEA 1AJKA 1NY71 1O91A 2EIGA 4BQ2A 3QCWA 4JRAA 1LHUA 2WSUA 3AYDA 1O8SA 4Y26A 1K5JA 2ADEA 4GMP3 2VQTA 3VDAA 2YMZA 4ATFA 3DECA 3U0ZA 2HKXA 3WX5A 1W6QB 5JZGC 3HQXA 4L9BA 4NWWA 1LESA 3T2QA 3VBRA 2RS12 1NUKA 5LZ6A 2ID4A 5FPXA 1RUH3 5CEHA 4H7MA 3GHNA 2VW1A 1OF3A 4BA6A 2Y8KA 2ZGQA 4RN5A 1W6PA 2VMEA 4TXWA 4XHXA 4PLNA 1QJEA 1MS8A 1GR3A 2Z42A 2VTXJ 4Y1ZA 5T5PA 5KHGA 4FPGA 1W8NA 4NHMA 5FZ6A 4Y20B 1OA4A 1DCSA 1JZ8A 3TOJA 3AMMA 4GMP1 2P3JA 5ACA3 5GLUA 1SMVA 1TMF3 1ZM1A 2DFBA 2P6HA 2RVAA 2HEYF 2DVDA 4PBPA 4M3CF 2XR4A 1XU2A 1SFNA 1FOD2 2BRTA 2W5FA 1US3A 1EAH2 1QOSA 1Q56A 5AFEA 2XVKA 2Q8DA 1BKZA 4AEMA 1JZ2A 1NQJA 1CONA 4A7YA 1N1YA 1RUD1 1WUVA 2D6PA 1RUC3 5FZOB 1ST8A 4ZKTB 2ZGPA 5BUVA 1L7RA 3HBKA 1OLQA 2VL4A 2LROA 4IEVA 3PIGA 5FYZA 3H1WA 2DVGA 2YC0A 4PQQA 3CMGA 3ZFGB 4B7KA 2IXLA 3VKLA 2FZ2A 1JYCA 2BNMA 4B3NA 3O1SA 5SV5A 1W90A 4IV3C 4CYDA 4OHYA 5J3UA 4BB3A 4WM7C 5FUIA 3VHPA 4XF1A 3UKVA 2PTMA 4CSWA 5BNPC 3HPNA 1BVVA 4QDRA 1C4RA 5JIAA 4R4XA 4CP1A 2OT7A 2D6KA 4I3PA 2I45A 4W65A 1DQ1A 2GMMA 3WDYA 1HXS2 5GLVA 4AFCA 3ZN5A 5HPOA 1F2NA 1RJ8A 4LBQB 1RUC1 4OUMA 5IUQA 3APBA 5C4WA 5DXDA 5LW9A 3I3MA 1K42A 3LF7A 4XCBA 5K0UB 4C0HA 1UMIA 2YUEA 1BZWA 5HCFA 2ZHNA 5J09A 3HT2A 2ENRA 3AMNA 2JG8A 1UXXX 2B9UA 1OBNA 4QHZA 4K9SA 4WV8A 3KF5A 2Z2SB 4IEOA 4BLJA 3ZYRA 1R082 4E27A 2ZEYA 2VNGA 1SLCA 1ND3C 3IWZA 4PCRA 4PLMA 4QU1A 1RTVA 2JX9A 1EUUA 2UWAA 3T2OA 2CWSA 4Y1YA 4OQ8A 5F1RA 3S5AA 1JS9A 1N1SA 4K3UA 3WUCA 5IAXA 5EYXA 4MH0E 4HFSA 1EV12 1BK0A 2VM9A 2H6BA 3CJIC 4YVWA 1UPIA 5T5JA 3T09A 5E8AA 4CA9A 2VQ0A 3LDBA 5T3NA 2J42A 3OPZA 1TE1B 1UCXA 2N7GA 3IIAA 1PM4A 4CDXA 1RJ7A 5JSRA 1W06A 1W3VA 5GM0A 4AVBA 2DDUA 4XFGA 2OA2A 3LQCA 1OQEA 2NP0A 1UX7A 1DQ6A 1QHDA 2I07B 1SFPA 3EHKA 4HKLA 5DABA 5H9RA 1XSRA 5DZFA 4OZXA 4KG0A 2DCKA 1KS5A 1HV0A 3U10A 1NA1C 4BMBA 5B2GB 2D3RA 4P5HA 2GN3A 4QHOA 5KXEA 1RUE2 4G3YC 3KV4A 4EV0A 4XQDA 4ZPIA 3ZPOA 5C3OA 5T5LA 3T0AA 5C9AC 4Y1VA 3AKQA 2GSYA 2VNOA 5GZGA 5FMDA 4XZPA 1BVP1 5CFCC 1N47A 2YBKA 2RJKA 1KJRA 4QAWA 1JZ3A 2Q0AA 2VZSA 3MIGA 3WP6A 4A3XA 4AQSA 2K9ZA 2H0VA 3WDVA 4OUSA 2A6XA 4DUWA 1HB1A 1ZRFA 3TBDA 4ZU7A 5LRRA 1DLLA 1V6LA 1CAVB 1VBE2 3RI8A 1CZTA 1HJFA 3RMYA 2ZGOA 3OPWA 2PQSA 3DL3A 2AACA 3JBG3 1FAYA 4O7XA 1OMIA 1OD3A 2HYXA 4HZFA 1GU3A 4M0HA 4BIOA 4BJ0A 3KCXA 1FOD3 2CGPA 4PF5A 4KI5M 3DV8A 4LNVA 4CUBA 1FMD1 3LPFA 4FTBA 5C70A 2P5BA 4KU7A 3WSOA 1WCKA 1R64A 1RUJ2 4QM9A 1W8UA 1MS3A 3OPTA 4CUGA 4W6WA 1AXZA 5A1AA 3ZFFB 3ZMOA 3LOBA 4Z2WA 4GWMA 1NZCA 1XBFA 1LRHA 4WVWA 1ND2C 1ZA7A 3NRUA 3KQRA 4YZ3A 3CKHA 3JBG1 5F5CA 5F9TA 1QJY2 3LPGA 2DVFA 1UZZA 2BDRA 1UYPA 2IVJA 2VOKA 3I2DA 4IEUA 3IT8A 4UFKA 4NPLA 4XIOA 3SQOA 1RVF3 3T2PA 3PHMA 5F39A 1QKQA 4XVHA 5DAWA 5GKAC 2WNUA 2PN5A 2JG9B 1MZ6A 4CDUA 5FTTC 5I0DA 1HXS3 2PAEA 2QQIA 3HIFA 1Y9MA 1WWYA 2DUQA 1L7LA 1UW8A 1LHOA 2VBDA 3AP6A 4R52A 4EYUA 4FBFA 4G9SB 2HWE3 3ECQA 5SV8A 3ZLIA 1LB2A 3N9LA 3DGTA 4H3WA 1OHFA 1YLLA 2MEV2 5HCAA 2GC0A 4FPFA 5C3PA 4PDWC 3KQ4B 4NN0A 4YW5A 2K0GA 1W6NA 1WW6A 4IERA 2DFCA 2YZ4A 5LBCA 3O1VA 1AR72 3NAPB 1GMMA 1PMHX 3AZXA 1W9TA 1DQ2A 1X36A 3AP4A 1R083 4XFAA 3THDA 1R1A3 4LOSA 5FZ1A 1R091 1JTZX 3GHMA 1RUNA 4AQTA 2XWJB 1RYYA 2E26A 3KT4A 2VO5A 1W2TA 2P6CA 2WS93 2GZWA 3ATGA 2PLV2 2FDGA 4CEWA 5DMYA 2XL9A 1Z78A 1FXZA 4YZ1A 3H1YA 1REDA 2F4LA 1J83A 2Y26A 2PMWB 3DXUA 2WAAA 4NRMA 1JU4A 1O5LA 2HWE1 5FXXA 5A7SA 5BNOC 1EV13 4CP9B 4GZ9A 4ATEA 4P9XA 2P3YA 4AGRA 5IVFA 2BVVA 3O1PA 1H2LA 3POSA 2W47A 4K1ZA 3ZFEA 2G4IA 3BALA 1BMV1 2OPKA 4DO0A 1UOGA 3POFA 1DFQA 2W91A 3LB9A 3LSEA 1CZVA 1GV9A 2JE9A 3J7NA 3L2YA 1QGLA 5FQ0B 1SEFA 2QCSB 4ES9A 3V0AB 1N1TA 1R1A1 3ZKYA 1XE0A 4RQPA 4INDA 1WA4A 3O12A 3C8XA 3EB7A 2WS91 1GOGA 1HJGA 1BEV1 3OSDA 3EQEA 3QLQA 2XOMA 4HOOA 2EXIA 5EPAA 1OOPC 4KWLA 3L9JT 4QQLA 3H9AA 1UY0A 2WYFA 3A21A 3H42B 4JC1A 4W4ZA 3ACHA 3R05A 1WD3A 2AH2A 1MZ5A 4U2AA 4A45A 2XKPA 2VECA 3BGAA 5IFPA 1XQNA 3POBA 1DYPA 1XU1A 2R32A 4X8NA 1PGSA 5FPAA 1JYTA 5A7WA 1C5HA 1PO12 5F32A 4A41A 4E4SA 1D2SA 5LA1A 1CD3G 4ZS2A 5JR7B 4PT6A 3WINE 5FPLA 1I5PA 4XBLA 4BMEA 5DQ0A 1AF9A 4GMP0 3RZGA 2OZJA 3J7LA 4YGBA 5IJRA 3NV2A 1CAWB 4P14A 4JRLA 3KT1A 4L11A 4AR2A 1I9RA 5FP9A 1AUYA 1XNCA 3ZKUA 1QF3A 2J22A 4LULA 2OYZA 1QJZA 1ULOA 4RYDA 1LEDA 1E5IA 3SH3A 2P17A 4F83A 3RZKA 2QFEA 1JBCA 3CZUA 2EAAA 4UI9L 3PMSA 2F6BA 3DPRB 4IETA 1QJU3 2QQUA 2EIBA 2QNKA 3O0VA 3AZZA 4V2WA 1GZCA 4RSUA 2ZKLA 1J3RA 4OHZA 1E5HA 3VLBB 2VQAA 1RUJ3 3NNFA 4CDQB 4AVCA 1OT5A 2FCVA 1YUDA 4QDSA 4FXGB 3U75A 1C8M2 1ZYBA 3ZYPA 1AX1A 3I97A 3IM0A 3UGFA 5C8CC 1OSGA 1X82A 1HDKA 3E5UA 5FYSA 5CA6A 1P8JA 3T1MA 4Y22A 5F5AA 1Z7S2 5CVRA 3T1LA 1W28A 2A1XA 3VBHA 3N35A 2FDHA 4LITA 1V00A 1OURA 3HT1A 5L7OB 1LHVA 5TSWA 3N9MA 3E6CC 4IEQA 4C0BA 4UF0B 1H6YA 1LGCA 1QJU1 4IW3A 4RR3A 2IXCA 5FBZA 2NPIA 3A0KA 4QX7A 5A32B 1PNGA 4CCJA 5ABJC 5FBJA 3THTA 3OUJA 5A7OA 4RGAA 5IVBA 3DUIA 3HAGA 3TN92 1H1AA 2VGDA 1SLAA 3MUZ1 3VBFB 4BK4A 4EZ4A 3QD6A 4LA3A 4LBNA 4AEKA 4XDQA 3IMMA 1MS4A 3ZSLA 4NE9A 1W9SA 3WOGA 1GP6A 4AFBA 4IQPA 4IL7A 3SCHA 2VVFA 4JDOA 3J26N 1AR73 3VBOA 3MV01 2RE9A 4AHXA 2VULA 2E31A 2GH8A 3IPVA 2LW8A 1GZ9A 1KITA 1ZBE3 2Y6LA 3HEIA 3K2OA 3Q9OA 4UW6A 1D2QA 1VALA 4HVRA 3I49A 1BBT2 1ALYA 1TME3 1WCQA 2PLV3 3OJBA 1LOFA 3N7MA 1ZZBA 3VBRB 3WP4A 3PL0A 3EJKA 5FXWA 1O6UA 2OUHA 5FZMA 4MXWA 5JSPA 5EWSA 1W6PB 1O3QA 1NQDA 3K51A 1ZVFA 4TSVA 2PELA 5FYBA 3OBRA 3I8TA 4UW3A 1LENA 4CXXA 4LBOA 3TAYA 4FFHA 2HJIA 2PYTA 4LE4A 5FZ3A 3AFGA 2A3XA 1DZRA 1ZBE1 5HCHA 1K5MA 3BIEA 5C71A 4BXFA 4XHBA 4F3JA 1RB8G 1GYKA 1QIQA 1VBB2 1TME1 2ATFA 3K3OA 1NCRA 4QKBA 4QX3A 4YRDA 4C90A 5C33A 1GLHA 2ZAHA 3JUUA 5DDJ2 4QXBA 5EHDA 1F9KA 5F2WA 1X9PA 2JB4A 3Q8CA 4PQ9A 5BNNA 4O9GA 2X8KA 2OXBA 1OC1A 3KF3A 3POJA 4GWIA 4N43C 4QX8A 1HRI1 2WNVA 4QXCA 2O1QA 3JB4C 3OG2A 2QDNA 5FP4A 5LRSA 2RS53 4QDQA 1ASJ2 4CTEA 3W5NA 5I91A 3LFIA 5CG9A 1KD7A 5A7NA 2FCTA 2C1FA 3H8RA 1WCUA 2BFUL 3VZLA 5IVCA 3ZSMA 1JUHA 3AXDA 1O3RA 5HXMA 2OUJA 1D4M1 3ABZA 4WVZA 3HOBA 4AHYA 5FY9A 1UIKA 4S2FA 3KCYA 2BEOA 1AXYA 2OIIA 1PNFA 1S0IA 5DAQA 2VZTA 4FQZA 1H6XA 4N7IA 4A7ZA 1FPN1 5DZGA 4ZU4A 1H0BA 2VZ3A 3OGJA 4QGLA 1YHFA 5F5QA 5KHHA 4A7KA 4LBLA 4XUPA 4BOWA 2RS51 2OS2A 2IXJA 2GP3A 2R0HA 2QTWB 4XDOA 5C4WB 2ZAAA 3IDAA 4LHSA 3ZXJA 1TZOA 4A6SA 2G1MA 4XF4A 2H0BA 3MGUA 1NLSA 4OHVA 4BQ1A 2XQRA 2WA3A 1W0NA 2J1EA 4NHLA 5FYMA 5KC6A 4JHZA 4JGZA 2JG8B 4YVSC 3H7JA 4QXHA 1JHNA 4QPIC 4AWDA 5I0SA 5FZAA 2YBSA 2WL1A 1XNTA 3ETPA 4ZXEA 5FY8A 1Y7BA 1HN0A 3O1MA 1JYVA 1VBC3 1JW6A 3UYJA 3ZMNA 1WLDA 1KRIA 2WWJA 1PX4A 2A70A 1LOCA 1Z0HA 2QQJA 2QBXA 1ACCA 1UY4A 3AK0A 2JDKA 4N53C 4QKNA 4E4ZA 4GIQA 4LJHA 3D3AA 2R1BA 5FZFA 3E5QA 5CAZA 4NHXA 1UOJA 3WG1A 4UBGA 4IV1C 1AL0G 1VRH2 1ENXA 2XBO2 4YVWB 3AX4A 3FLRA 2Y38A 5L19A 2B8MA 1RL3A 4RHV2 5IHRA 2ZGNA 3ZXKA 1KS4A 4CDXB 1CN1A 4CE8A 1NY72 3BPZA 3I2FA 4QD2A 1EY2A 3I3QA 3B69A 4LLOA 3DEMA 4AQ2A 1GP4A 1YNAA 4HVOA 1F5JA 4UFMA 4FTEA 1AR81 3RRDA 4ET7A 3NVCA 1NG0A 5FREA 4OCTA 4AYUA 3RZHA 1UOFA 5KHJA 3JB8A 3ZIWA 1JYNA 1V9U3 3NW4A 2O0OA 1IOAA 5EQUA 4AEJA 5JWPA 4J1XA 5L73A 1V0AA 3AP9A 4QX1A 4JDNA 1HX6A 4A44A 4K8FA 1DZTA 1W6OA 3ETQA 3VHNA 2ZJCA 1NLQA 2PHXA 1OD5A 3MLLA 1RIRA 3GZTB 3R0RA 1VBD3 4EZHA 2J1UA 1HN1A 3T3YA 1DP0A 4JGYA 1TNRA 3WP3A 3ALQA 1CAXA 4OMDA 1LOAA 3LCPA 1D0HA 1RITA 2C26A 4NAMA 4FI9A 1RUH2 1MZEA 2CSGA 4ORFA 2ADDA 2CWMA 2WNEA 3I3DA 1VPHA 3HBZA 3PU8A 5FZ7A 3JQXA 1RUD2 5DDJ3 2YPJA 2TNFA 1UYXA 3CEWA 4A2UA 3WQ1A 1AZDA 2EIDA 2KD7A 4AGVA 2JXAA 2BOIA 1W9FA 4META 3SEPA 5CADA 2BPA2 2XKOA 4ZHNA 4Q4Y3 5A6XA 1VP6A 1ASJ3 5DN2A 4QT6A 2XQXA 4BQ3A 1TMF2 3M3IA 2PHRA 3H3ZA 1W3XA 3Q8AA 1Y9QA 1PX3A 1VLNA 3RZZA 1JOBA 3LIHA 1IS6A 3PUHA 3WQ0A 3ZFGC 5E16A 3CHXA 1DBNA 3W20A 2DUPA 1DG6A 4FQ4A 1M4WA 2UY9A 4XMIA 3J8F1 3ACGA 3IDBB 4N9HA 1RUC2 1CX1A 2WNUB 1JZ7A 3EYPA 4CDUB 1RUOA 2WO3A 1GANA 2ZXQA 5FO7B 4BXSV 5I0UA 4QHBA 3ME2A 3EXUA 1O4ZA 4TYSA 1Q8QA 4MVTA 2WYSA 3UK9A 4LO7A 1W8FA 5I8SA 4AVAA 3GJBA 5FYVA 3VKMA 5K0UC 3UGGA 2V5DA 4LTAA 1QU0A 2QQOA 4LORA 1S0GA 3E6DA 3N3HA 3ON7A 3NKGA 2LTNA 4D6QA 5JXHA 1W6NB 1GSLA 2WQ8A 3A0NA 2JECA 4Y5SA 4N8MA 5BPXA 3FE5A 2W1UA 5GZFA 3O7OA 3B93A 1JHJA 3U14A 4QPGA 5KXBA 1A8MA 5FXVA 1IPKA 3K46A 3LD8A 1FATA 4MO3M 2HBTA 3KV9A 3WLUA 4CEWB 2HLEA 4XW3A 2AUYA 3TYJA 3U37A 2P3KA 1IKQA 2WKKA 3LSDA 4XJAA 4AFMA 1VRH3 2VCMA 1IS3A 3RS6A 1VBA3 4EN9B 4W50A 4FFGA 3PVEA 2G9GA 1Y9GA 3ZFEB 4DXRA 1U5IA 4XDPA 3I59A 2ZX0A 1VE0A 3J7MA 1XNBA 4LKDA 5GZCA 1POQA 2RDSA 1IQDC 3FLPA 2E33A 4LA2A 4DFSA 3IDCB 2VXJA 2BUKA 3AXEA 4RQPB 4ITCA 1NCQA 2RR13 4YG3A 2BERA 4NUBA 1V70A 4P9GA 2VZUA 4DY3A 5F7UA 4XUNA 3BU7A 5F8PA 1Y3TA 3WZ1A 3A7QA 1W05A 3ZVXA 2YHJA 4CUAA 1TNFA 3NV3A 3ITQA 2AGSA 3M70A 2DV9A 4GJYA 1XNKA 5FWEA 4QQOA 4XXPA 4FP2A 2X05A 4XURA 2J1SA 4BCUA 4D94A 4DEVA 1CQ9A 1DQ5A 3OUHA 5A7WB 1DGWA 5J48A 4YWAA 1K45A 2IUWA 4MX3A 4XJ8A 5A3UA 1REEA 4ZY9A 4E2SA 4AI2A 1TG7A 4WVVA 2Y60A 1O59A 4ZZ5A 4UYBA 1O3SA 4N90A 1ZZ7A 5K7PA 5GZEA 2RR11 2AEZA 2OZ6A 1H8TC 1F4HA 3OUIA 5JXIA 4FPHA 2EF6A 1FMD2 2QQVA 3H8XA 3RZMA 1O5UA 3PIJA 4JAAA 1HKDA 1PGL2 2VVEA 3OBTA 2W95A 4E9KA 5JXJA 4HG6B 2GMPA 2JD4A 1RUD3 2O8QA 2V72A 2VZQA 2ZACA 4JCKA 4B4QA 3O1RA 2TBVA 1H30A 2E7TA 3E1F1 2HYKA 1WD4A 3M3OA 1JH5A 2IFWA 3BCWA 3INAA 4O9EA 4QB2A 3W58A 1QJX3 3H1MA 2RS33 5FZGA 2MHFA 3JBG2 4NRQA 1GQPA 4HONA 2ARBA 2XHNA 2DTYA 4XFFA 4PLOA 3ZFFC 2ILMA 5F3EA 1UWWA 3AKRA 4YW4A 3RWNA 4GALA 2VOWA 3VBSA 3SNMA 4BQ5A 4LBKA 1YQ2A 4Y22B 4ASMB 4KG8A 3JCIA 2JB8A 3POYA 3WT3A 3VBHB 4WM8A 3BPSA 2VOXA 4LUKA 2VOTA 1UN1A 2A3WA 2VCCA 4QX5A 3KSCA 1JYWA 3ZYGA 5IK5A 2PA7A 3VD5A 4Q4W1 3ZYFA 2YY1A 1MACA 3CQOA 1G9AA 4RR3B 3KGZA 3FUQA 3J4UH 1H2KA 1VAVA 1E57A 1QJX1 2RS31 3SKJE 4Q8KA 2BTVC 3MICA 1SBEA 4YW6A 3KVAA 2PHFA 2WNOA 1ZZ8A 1UYYA 2BBAA 1RVF2 1NE4A 2BV4A 1XPWA 3OCPA 2YXSA 4CU8A 3AYAA 1PVC1 1WKYA 1AR63 4P5YA 3MIHA 1R092 2JDUA 3MF9A 1YJKA 2JEMA 1GWMA 2W9XA 3GDBA 3QACA 3LDKA 2XDVA 1C3HA 2VXRA 3S6PA 3VBOB 3HMYA 4AEDC 5IVJA 4Y33A 3PUSA 4LKEA 3NAPC 3IPVB 5T5OA 1W6MA 2HWB3 3NV1A 4QPYA 4HL0A 1GNYA 4X6RB 2ZOEB 3USSA 2HWE2 1X8EA 2XJTA 3WW4A 1JMUB 2D93A 1OLMA 5A3LA 5FJKA 5FV3A 3WNOA 1JZ4A 1BMV2 3GCXA 4Y1XA 2BW8A 2HWF1 4MXWB 3DKQA 1O8PA 1XRUA 1YFYA 3ZYBA 2BU9A 1OUXA 5HCBA 1R1A2 1AR61 2UY8A 2ZZQA 5D1IA 5FZ8A 5T55A 4LBMA 5I8YA 1ZBA1 2WS92 4OZOA 2EAKA 1Q5OA 5FRAA 1BEV2 5A3NA 3V0BA 1GNZA 3M4FA 5D8AC 2HWB1 1QDCA 1K5MB 5FP8A 4CCLA 3TEZA 2D5FA 3NJVA 3U78A 1NCRB 2ZEXA 3C7FA 3ZPYA 3MFCA 3MLKA 1E5RA 4NR1A 2IC1A 4TTGA 2VCAA 4L2NA 3ZXDA 3VL9A 4WVMA 2R073 2D6OX 4S2GA 4MXVA 5BNNB 5L36A 2E63A 2E51A 1US2A 2NMOA 4AF9A 2D6NA 5KHKA 2WNVB 2WO7A 1XJAA 4R8HA 3KHBA 5HBAA 1UU4A 4Q4V1 1Y43B 2VMCA 5F37A 4XAAA 1GQGA 3IAPA 5EP9A 1HQWA 3FHAA 3PUAA 5FYHA 4GWNA 2PAKA 4XUTA 4ZZ8A 1RMU1 2D40A 1QOTA 1PM7A 2VNRA 3ZDSA 3OOXA 4GH4C 3POEA 2J7MA 5DAPA 1IQAA 2QJVA 1DDLA 4DZGA 3RG0A 2WFF1 1IZ3A 1FMD3 1VMFA 3KZ4C 4V1PA 3ZXGA 2R071 3UKNA 1PGW2 3K75B 1VAKA 3GF6A 2F17A 4EROA 3M1HA 2CL2A 3BTAA 4N7UA 5IATA 1SLTA 2QQNA 5FYTA 1RHI1 2W08A 5FYUA 5EFUA 2JDNA 2CDPA 2QKDA 3POIA 3DPRC 2QQMA 3AP7A 5F6KA 5C5TA 4BM8A 1ZZCA 2YBPA 5GALA 4CDQC 2YFUA 2FD8A 4JGZB 4P00B 1G6NA 5CU1A 1GZTA 2GNDA 4S2HA 3K3NA 1JOJA 4GQ7A 3N9OA 1AYN2 4BQWA 4CCKA 1G9BA 4DEQA 3ELNA 2YYOA 3BUCA 4MGSA 1QJU2 1UXZA 3LAGA 3MBWA 5LEJA 3B9IA 3I7DA 3ORJA 4XIKA 4JQTA 4NMIA 3WD5A 2KA3A 1G9CA 1C1LA 4FSJA 5L7OC 1ENQA 3TEXA 5C5UA 1D7PM 2XLAA 3FHQA 2W52A 2XG3A 4I30A 5IYYA 5JCTA 2W3JA 3IMNA 4QMAA 1H4GA 2W2IA 1YFXA 3CJXA 2E7QA 5DAVA 3USUA 1W8ZA 4KWUA 3O0WA 2XGXA 1GWLA 1C28A 5F2SA 2RS11 4UW4A 3U4XA 2W1QA 4GKYA 3VBFC 4COUA 1XOYA 3UV9A 1ZRDA 2NZ9A 5DUVA 2ZGTA 4Y4RA 4EN6B 1AL21 1R093 2VMFA 1TQ5A 1DHKB 4FOQA 4QQ2A 4YM2A 2IVIB 3LA2A 2TUNA 2VJXA 4C1WA 5KHIA 3CU7A 2BBVA 3GBWA 1EPWA 1PVXA 3SC7X 5LA0A 2XXZA 1WLTA 3D82A 4JZRA 3WEZA 1LAJA 1OA3A 5FPUA 4XBQA 2WO1A 3TRSB 4HK9A 1QQP3 4MGKE 4DXTA 1A3KA 5C6CA 3CL1A 1A34A 1QH6A 3VBRC 3OGVA 1W6OB 2DTWA 2QQPA 5A70A 5FZ4A 1LU2A 2DVBA 4AAPA 3RWKX 1MVEA 1DYKA 4XFHA 1ZBE2 2UYBA 1N3PA 2VZVA 4XJZA 5FLIA 2WDBA 1WCSA 1IPSA 4JGYB 1TME2 4QKFA 1UZVA 1CAXB 5FYIA 1BEV3 3D0JA 4XF3A 2D5HA 1GZWA 5LBBA 4A6OA 5EIYB 5J98B 4GULA 3UT0A 3OGRA 4COVA 1J84A 5L9VA 2VUJA 1HRI2 4Q2FA 1NT0A 1QQP1 1WCDJ 4PJYA 4YNIA 2JDZA 2JENA 2E9QA 3OYWA 4NHYA 4AI1A 3TNQA 4TWTA 5A33A 1YFUA 4AFDA 2DCYA 3M7AA 4GXLA 1XE7A 2W87A 3ST7A 1D4M2 2VTXA 5H9PA 4YFZA 5FZEA 4H14A 4KNCA 4KU8A 4TZDA 4HPKA 2WT1A 2OKXA 4BZ4A 1LU1A 3J7HA 3N9NA 4M0NA 1W8TA 5GLWA 4Q0UA 4N53A 4XABA 4FVVA 2RS52 5FP3A 3OGGA 3WNMA 1YQ5A 1A8DA 2RMU1 3LEKA 2W39A 2WSVA 4JTOA 2B42B 1IPJA 3JQWA 3AYCA 2LRPA 1HRV1 1TVGA 1SDWA 3GGLA 3EO6A 5C4WC 5FYYA 4E8CA 1UU6A 5KR7A 3AFKA 2MNGA 5FO8B 4GKXA 1X7NA 4RD7A 1POV1 1YQ8A 2KR2A 3S57A 4Q0VA 4XJUA 2XONA 2JG8C 1B35A 4XJWA 2SLIA 3SKVA 2C9KA 3WUDA 4RS5A 3FBYA 4LQRA 5LY2A 3WCRA 3AC0A 1AYN1 4LXLA 1UZ0A 1OUSA 3DN7A 1SPPA 1I5ZA 3A22A 3BYWA 3WQ7A 2ZX4A 4QB6A 4QPGB 3S7EA 3VHRA 1X50A 3NV4A 4Q8LA 4URTA 3T2TA 3P5BA 3B94A 2R061 4UAPA 5E89A 3ZYJB 2A6ZA 4R4ZA 3VGIA 1GNHA 2J1TA 5E1RA 5JOZA 2JDHA 2QUOA 4XQ4A 3KVBA 3D5OA 1RUE1 1YC61 4AVSA 4FPKA 1VBC2 4FOVA 2VY0A 3WF3A 1AR82 3LA7A 3AL5A 3I59B 1BXHA 1XE8A 4NRPA 4Y1UA 5LEKA 4CDXC 1W0PA 5FJHA 5DZEA 5K8SA 5DAXA 3VV1A 3PVBB 3W21A 1QOOA 1HB4A 3JD71 1NCQB 4YPJA 3K77A 2ZPXA 4XXAA 3PUIA 4XC9A 3W59A 2ZGKA 4IEWA 2YFZA 3IZOA 4W8JA 3H7YA 4NVPA 3I4IA 4TLGA 3AZVA 2Y0OA 2YC2A 4AOCA 2A5ZA 3M8LA 2A6VA 1XB9A 4MADA 3UL2A 4HKWA 4LUMA 2J1AA 2WR9A 4NIDA 1ODNA 1W04A 2LS6A 3VUOA 2YU1A 2XVLA 1CR7A 1EUTA 3PVOA 3VDDA 2WIIB 2ZBJA 1V9U2 2NN8A 2D98A 3G7DA 1RUI3 2V73A 4LHNA 4OFGA 2Q1ZB 3DYOA 1PZ9A 2ZCWA 4M3CA 1G9FA 4Q0QA 1UOBA 2CDOA 4W6XA 5FKCA 5FPBA 1SDDB 5HXVA 1PK6A 1CZSA 1UKGA 5JI7A 3AYEA 3TB0A 3VBUC 4AEDA 4CEYA 1S1AA 4LKSA 2D7FA 4Z82A 1HRI3 1VBD2 2V4VA 2R0FA 4QGMA 1QNWA 1RUG1 1UF2C 2GAUA 3MW2A 5F3IA 1MQTC 2V09A 5JUVA 1NZIA 1SHWB 3B01A 1YCIA 3D4KA 3R4DB 4I0BA 2O8OA 2XB6C 1F4AA 3OY8A 2CNAA 2WQ4A 1D4M3 4FOWA 2UURA 1H2MA 5EJZB 3BOWA 1RUI1 2TEPA 3PTYA 3J8F2 2A71A 3PLQA 3WY6A 1V6IA 1YEWA 4WZCA 5FY1A 1JYIA 3VBSB 1MS1A 1FPN3 2P3IA 1J1TA 1CX4A 2ZZJA 5BYNA 2XUMA 2Y34A 1JYXA 4RL7A 4WM8B 2Q1MA 4Q4Y2 4R9BA 4LK7A 2BWAA 1EYBA 1XXNA 3X29B 4ZS3A 2DU0A 2ARXA 4KBZA 4OLLA 3Q8BA 1YYNA 2WLPA 2X09A 4CDUC 5FUPA 3I3EA 1AYM3 4MGIE 1GWKA 4NJ4A 3CBNA 3RQ0A 2ARAA 2WO2A 4HKOA 1G8WA 4AGGA 5CFDA 2JKXA 1URXA 3CNAA 1STMA 5FZKA 5IWFA 1S0CA 5LBEA 2ORXA 1AR93 5LCWL 1OFSA 1SLLA 1UU5A 1H8VA 1O4YA 4L8QA 5GJ6A 1SBDA 5FY7A 4AXOA 3VDCA 2ZMKA 3ROUA 1U12A 2JDMA 2XJRA 1ZREA 1H9PA 2JIJA 2UU8A 1W6MB 4J6GA 4BQXA 4L92A 3RFRA 4I2OA 3H50A 2JE7A 4OQ9A 3IDEA 1SACA 1JU3A 2DURA 3SCGA 1XNAA 4P9YA 1AYM1 4AK3A 1ULEA 4Y5Z0 4MV2A 4D7SA 4C1XA 2JWPA 1CJPA 4K1YA 2ZHMA 4CEWC 1JI6A 2H6CA 3I2GA 3KMHA 2NLRA 3H3LA 3MI8A 2ZGLA 4IGPA 1AR91 4KWKA 3OD4A 3U07A 2R041 3LEIA 3NJXA 5FZIA 3CDZB 1FX5A 1AR83 4QX0A 1AJOA 3H8UA 2VCBA 2YU2A 3NL1A 3ZFEC 4CDWC 4P08A 4Q5OA 2XLGA 2BVBA 1LCLA 3ZXEA 5JZGA 4LPLA 3WHUA 4IGOA 4QKDA 2VG9A 2X5IC 2BQPA 2DCTA 2K2SA 1H8TA 4XF9A 4YM3A 3V0BB 1KFXL 5A3TA 4YARA 1UL9A 5JMCA 3VHOA 2FDFA 1VBA2 2GU9A 4RQPC 4FCAA 1QJFA 2PHUA 3PDQA 5LASA 3RZJA 2VMHA 3GZEA 5IVYA 5KBFA 4KGGA 1V6NA 2B5HA 2G9FA 1G9DA 3VZOA 2C6SA 1SCRA 4WVMB 2E32A 3AJZA 2LUWA 1PMIA 2RM23 3ZN6A 4QQHA 1HQLA 4MG2A 5FOBB 5I8TA 1BCXA 3VD3A 3RYRA 5B4NA 1W9WA 4XE9A 2CAUA 3VKFC 2GH2A 2WWSA 1MVQA 2Z5WA 2PFWA 4FOYA 5FZ0A 3ZR6A 2RR12 4AI8A 3HR9A 4N9IA 1A6CA 3B02A 2RG4A 1U5XA 2Q8CA 1AX0A 5IK7A 3O1TA 1QNYA 5F5IA 2QDRA 3D8CA 4FP3A 4FXKB 1YXWA 1YIFA 1LR5A 4EN0A 3JZVA 3EBRA 1SLBA 4JX0A 5T50A 1C8M1 4EWEA 4MZUA 2E6VA 4E4DX 2D3SA 1IG3A 2Y33A 3WDUA 2GNTA 5T54A 4LE3A 4CUCA 1A78A 4ZONA 4CEYC 2RM21 2W68A 3HWJA 5JVVA 2FDKA 1XC6A 1OI6A 4IEYA 4XUOA 1I6XA 3LOIA 1JN2P 4IV3A 1T6GC 2BP6A 2Y6FA 2BNNA 1UYZA 4WM7A 2I74A 2ZHKA 3UGHA 4B8EA 1QEXA 4COZA 5BNPA 5A3OA 1WMEA 1XSQA 2WC2A 3U11A 4CZSA 2ET7A 4XETA 2BYVE 3J8F3 4EJRA 4E8DA 1ZX5A 1RXFA 3TN91 3VB9A 2C0ZA 1SCSA 2XVGA 3I2OA 1UNBA 1LTEA 3I3BA 5JR2A 4Q4W2 1MPXA 3I2KA 3P3NA 5CKNA 3MHZA 3KV5A 2BZDA 1QJX2 3VBHC 4AI9A 2RS32 5A3MA 3WVJA 4JHTA 2RDRA 4M4RA 4PI0A 1OH3A 3B7MA 3PTRB 1WBFA 4YM0A 5BNQA 4Y3OA 4YFWA 2BOJA 4D6SA 4IEPA 5C7GA 5JLVA 1BBT1 4CRQA 1PVC2 3KV6A 1RUF1 1DZQA 1POV0 1VB4A 4RFT0 4XTMA 3USUB 3QH7A 1PIV1 3FHIB 1ND3A 2Q5TA 2R6QA 2ZTNA 3PMEA 1IKPA 1IS5A 1L3JA 2RDNA 2GC1A 2VBBA 4XFCA 3MEPA 5D8AA 3VZJA 4ZU5A 3AZYA 3WNNA 3VZKA 3C7GA 2J1VA 2DVAA 3CJIA 4I0WB 5JOXA 5H9QA 3VBOC 4ARXA 3LZZA 4Z8BA 2VUCA 4A4AA 4COYA 2HWF2 1BK1A 1PZ8A 4L0PA 3GCWA 1VAMA 4IEZA 2G9ZA 3WW1A 5I0RA 1AR62 1LOFC 5CBLA 1LHNA 3POWA 1SG3A 4JKKA 5FZBA 2ZA9A 3QOPA 4CCDA 4YM1A 1DGRA 2C5DA 2NYYA 2VW2A 2PAMA 2ZGRA 4Y4YA 4BIFA 1NA1A 2C24A 3WG4A 2HWB2 4UFJA 4KGQA 3S5QA 1KDKA 3RJ2X 2FHRA 2BGOA 4IEXA 2E53A 1JZ5A 2J1RA 4ISQA 4GH4A 4XQWA 5C9AA 1YFWA 1GZWB 2YPDA 3BVCA 1TEIA 5CFCA 4AL9A 1K5MC 2WT2A 3KGLA 4LHKA 5EJ3A 1MEC3 1S0JA 4BPZA 4EQVA 1OPOA 5JMOA 2ZMNA 3OYWB 5D21A 5LK5A 1K12A 4Q4V2 3SITA 5A33B 2HEVF 2HWD3 1W2OA 1H9WA 3U1XA 3T4HB 3WNKA 2W92A 3ZR5A 1C5IA 1SLIA 3DKWA 4NIHA 2WRAA 2XJSA 1UMZA 2WNVC 3URFA 5JOYA 1N3OA 5CIRA 2FZ1A 4HSLA 4R9DA 4M00A 1UD1A 2IFRA 4Z2AA 5FR3A 5KWRA 3LIGA 1O7FA 5LA9A 3AKSA 3RVHA 1JZ6A 2WFF2 4HPKB 2WZR3 1DU3D 2R072 1DQ0A 4XEZA 2XPJA 1MEC1 4LK6A 1DGWX 3D0SA 3ZM8A 2FDIA 3M3CA 1OQ1A 5FAXA 1ENRA 4N53B 4XFIA 3KT7A 2CGOA 3VKNA 1H2NA 3ASIA 4JQRA 3ZO0B 4CPBD 3OD0A 2BGPA 1C8NA 2HWD1 3M3QA 4B1LA 3N36A 5C3QA 1LODA 5GZDA 1COV1 2YROA 5F3CA 1ND2A 5DUXA 3G6JB 4ONUA 4IGQA 2EXKA 4MGZE 1D4VB 1JOPA 1V6MA 1YI9A 4UOJA 5IK4A 5AC93 1V6OA 1S2KA 5IVVA 1AHSA 1CGPA 4CU6A 3R4UA 4LO5B 1PZ7A 4PHZA 2WZR1 1GKBA 4TN7A 5ANNA 5A1FA 5C3SA 3K4AA 4JGZC 1B35B 1DGLA 2PQQA 2OVUA 1J59A 4RHV1 4RS5B 2B45X 5GLZA 2VVDA 5FUNA 2A3YA 4K21A 3K4ZA 1LOGA 5FLJA 4NIGA 1SPPB 3MW4A 4Q4W3 1I1EA 3ZOIA 2RDQA 1T6BX 2Y6HA 2ET1A 2GMEA 2JE8A 4XBNA 1S0FA 3SHRA 1FV2A 4DINB 5F3GA 2FMYA 1XYOA 2B39A 4GWJA 3W5MA 2A6YA 4Q1RA 4QWNA 4CCCA 2JDPA 2C4XA 1YQ6A 2W1WA 3CLPA 4PDWA 3LGRA 4CCOA 5AC91 3O5SA 3BOPA 1WA6X 1YQCA 1W39A 2JDYA 4FTSA 1PVC3 3WF0A 3S0MA 1J3QA 1FYUA 3FJSA 1AL22 3VDBA 3RDIA 5A3PA 4JVAA 2Y6GA 3DYPA 4PBOA 3HQUA 4NOTA 3AMHA 3MDPA 1APNA 2HWC3 4PIYA 5IW0A 2OQ7A 4CU7A 5L9BA 1MZFA 2ZABA 4GA9A 5CZKA 1CAUA 5FIXA 3D6EA 2JG9C 5EZWA 3GNEA 4CXYA 3P3PA 3OBZA 5BNOA 1L7QA 1O4TA 1ULPA 1NKGA 1OFNA 4OI2A 4XACA 3SLIA 4ASKA 3AKTA 1HB3A 2VTFA 3BN6A 1GQHA 3WDTA 3W9AA 2I2SA 5FLHA 1NX9A 1FNYA 2A7AA 3MO4A 2HWF3 4QU2A 3KM5A 1RUH1 5FMCA 4Z1VA 4OHWA 5IVEA 1U5ZA 1Q8VA 2CHHA 4Q4X3 1OLME 4YGEA 5FZHA 3RYPA 4RA0A 2YC4A 4BH9A 2YDEA 1OH4A 5FZDA 2X10A 4DUVA 1F31A 1NE6A 2OW4A 3VZMA 1ZBA3 2WBKA 3LFMA 4DRRA 3CF6E 2HWC1 2VAUA 2QE3A 3FFZA 5EXOA 4NAOA 3VDDB 2DBNA 1OOPA 1GP5A 2FCUA 1UMHA 4FPYA 2GC2A 4LO6B 1M06G 3WV6A 1ZRRA 2CU5A 3ZYIB 5ACA1 4JGYC 5A6QA 1HB2A 1SZBA 1TMF1 4B1MA 1QQP2 4M3CB 4XFBA 3KHCA 4DRVA 4UXAA 4EWDA 1F35A 3MFAA 5JOWA 1PK6B 3KB5A 3M3EA 2X53S 1N3QA 4PI2A 4AEDB 4CEYB 2XJUA 1W2UA 4GB33 3ZYHA 2XWBB 3WCSA 1DYOA 3ZX7A 4Q4X1 1CWPA 2WA4A 3GYDA 1RINA 1VB2A 5DUWA 4K20A 4Q4V3 2OPWA 1G7YA 1AX2A 4QGNA 1J58A 1ZRIA 3OGSA 2YB7A 3OY8B 1RMU3 5LWBA 1LECA 1KQRA 1X8MA 3A23A 5JXGA 3AL6A 1QMJA 3BODA 5J96B 1OA2A 4DY5A 3VD4A 4LOTA 2RMU2 4R9CA 1PO23 2KM2A 2WFF3 4LBJA 3O0XA 1WMFA 1U0AA 1GFF2 3K4DA 2CGNA 2PXJA 1G86A 1OVSA 4GB31 2P34A 3ES4A 3PVNA 1YJLA 5K4LA 4AVTA 1WW4A 1HRV2 1RHI3 3C2UA 4AHWA 2DCZA 4DIQA 3GJAA 2FMDA 2GDFA 4K7JA 2ES3A 3ILNA 4DS0A 1D0GA 2VZ1A 2LALA 2WZPP 2VMGA 5C8CA 3BTZA 4ARYA 5E88A 1FV3A 4YW7A 4B4PA 3GZUC 3Q8FA 5CFDB 5FP7A 4FPEA 3ZDVA 2F4PA 4OULA 1PO21 4P02B 5C8WA
chains in the Genus database with same CATH topology
1BYHA 1ULCA 4EWAA 3E6BA 3KLSA 5I0TA 3ACLA 5ABJA 2Z69A 2R062 2D6MA 2EA7A 1UX6A 3ENRA 2GNBA 5K9YA 2AENA 5KXDA 1ZNPA 4QPGC 4D69A 5FCCA 4P9IA 2D97A 3HD8B 3GBGA 4FAHA 1RGSA 4HSJA 3WDXA 2RS13 4Q27A 3WDWA 4PIXA 3WNXA 4B29A 4J1WA 5AVAA 1FI2A 2D3PA 1AL23 1LKNA 2B7YA 2QVSB 3JD72 3AP5A 1OPMA 2WLQA 5JZGB 3RJRA 1H8TB 4XILA 1DF0A 5J36A 3FBMA 3VBUA 4HN0A 1W0OA 1NCQC 1ZZ9A 4FPCA 4COWA 3QBQA 3NJZA 1VR3A 4S2DA 4P9JA 1MQTA 4DQAA 3AMPA 1F8VA 3ZN4A 3OTFA 1EAH3 3ZN6B 3UJOA 4FO9A 4OI4A 2CYFA 2X29A 1PGL1 1UKRA 4FPJA 4ZXKA 4IESA 5DG2A 3RYKA 4G4FA 1O3TA 4NPRA 4N43A 4YGCA 1RUG2 4OHXA 4KL1A 1LJ7A 4LBQD 3SISA 1FOD1 4YLZA 2PHLA 2CAVA 1EAH1 1QWRA 4MGYE 5JSOA 2DCJA 1Q3EA 1RUI2 4IV3B 3PNAA 4ES8A 1OQDA 4WM7B 1CVNA 1SBFA 4XOGA 3KCCA 2D6LX 5BNPB 1KFUL 5FFOC 3THPA 3IBMA 2A6WA 3FZ3A 1Q43A 4ASLA 4UBHA 4OVEA 3QH6A 3MPBA 2IZWA 2RMU3 1SQ4A 2RHPA 5IT6A 1RVF1 3VBSC 4NHKA 1VIWB 4SBVA 3HN1A 3S7IA 2VH9A 4TLFA 1HRV3 4WM8C 1HXS1 3E5XA 4F8AA 4YVSA 2Z79A 3NWKA 4QPIA 1X33A 1XYNA 3B5LB 4KH9A 1U5YA 1CIWA 4XMAA 1GICA 1POV3 1FPN2 5CG8A 4YG0A 4Q0PA 3CO2A 1ND3B 3LA3A 4CDWA 3SH4A 2Q8OA 5HI0A 4AVVA 2PHDA 1YI7A 1S55A 2SBAA 2ZKNA 2X5IA 1AYN3 2A75A 2P37A 5D8AB 4IV1A 4AE2A 1R081 3MPPG 1C57A 4M01A 2ZMLA 1NXD1 1AYM2 2ZX1A 3CJIB 2R063 2UWBA 4I01A 1WLCA 4YZ4A 1CPMA 4FPOB 1DIWA 1XYPA 1EPZA 1ZZ6A 1RUE3 2VPVA 1AR92 5LK7B 2HEWF 2R042 3R4SA 4DXZA 1OLRA 1EV11 4DNYA 5T52A 5BY5A 5JPNB 2GALA 4YSFA 2B46X 1CPNA 1NA1B 1HIXA 3JD73 4OI0A 2BFUS 1W6QA 3MLJA 4GH4B 1PHMA 5C9AB 3M2MA 1VBE3 4IXLA 3V64A 5CFCB 5KC5A 1S0BA 2XL7A 1BJQA 2C9AA 1MR5A 4YVWC 4WZFA 1BQPA 1QDOA 2XJPA 4AQ6A 2R16A 4JTNA 2ZGUA 5H9SA 2FQPA 3V65A 4K40A 1PGW1 4Y20A 3WG3A 4Y24A 4FAGA 2KXLA 2D44A 2JKBA 2AREA 3AMQA 3FWEA 1VBE1 4DPNA 1AXKA 2RM22 1CJDA 1QJY3 2ZGMA 3ILFA 4M3CE 1RUG3 2ZX2A 1HLCA 1EP0A 1CESA 2JICA 1LOEA 1FNZA 1Q8SA 4Q26A 1WW5A 1UAIA 3ZIXA 1ND2B 3ZFGA 1YRZA 4HMZA 1RUJ1 2DU1A 1S0DA 4LT5A 4LR4A 5JPMB 1HV1A 1AVBA 2XHKA 5EYYA 3TNPB 4D7TA 4I3GA 4YZ5A 2MEV3 1J3PA 3LWCA 3N4MA 3FX3A 5AFBA 5J7MA 1QJY1 3RMXA 1ZRCA 1ENSA 4U36A 1LGNA 1SFYA 4HK8A 4LBQA 4B4RA 3AZWA 5K0UA 4HLTA 4HETA 4MSVA 3VZNA 1RUF2 3PJQA 2E7AA 4CP2A 1PIV2 3GZAA 4KWJA 1UZYA 4PDWB 5JIUA 3KS7A 2EVXA 1S2BA 3DF0A 1I3HA 1YIPA 2ERFA 2VW0A 2MEV1 3RNSA 2NQYA 2V5YA 3AJYA 1LHWA 1WGPA 4NWVA 4LEJA 3SH5A 5FDBA 3SCFA 1AR71 3MIFA 1WW7A 2WINB 1CAUB 2WFPA 2WNUC 3WHTA 2XJQA 4JDMA 4H55A 5BNOB 3FLTA 4HBNA 5JI9A 5IK8A 1S0EA 5DG1A 1C1FA 2MPFA 5FMOS 2PLV1 4CP0A 1KJLA 4AHZA 2R30A 4X6QB 1MS5A 3WXPA 5KXCA 2R043 2DWRA 4L97A 3RPQA 3OF1A 3ZSJA 2XLFA 2EXHA 3WG2A 4DOUA 5BV6A 1PO13 3FC0A 1OOPB 3AKPA 4KQ7A 3MZHA 1ULDA 4E2GA 4Q29A 4EN8B 1HQNA 3VKOA 4DB5A 2BGCA 3H0OA 1UPSA 4XPVA 1QY4A 4YW2A 3L2HA 4AI0A 5F6LB 3MIBA 1MS9A 4K6BA 1Q8PA 4P9LA 1F5FA 4LLFA 4HANA 4QXKA 3V56A 3WW3A 4D7YA 4HN1A 5J37A 1CAVA 1FT9A 1PO11 4DMIA 5DUUA 5I93A 1MS0A 2YGLA 2YGMA 4I09A 2UYAA 4JV4A 1MEC2 2YV8A 4H7LA 2EXJA 4C91A 4HVQA 1C8M3 1WBLA 4W6YA 3JU9A 5FPZA 3LKJA 1B09A 2GN7A 2HWD2 2FBEA 2DYCA 4HT1T 4Z92B 1Z7S3 2XJVA 1COV2 2NM1A 1QXPA 3GALA 3VL8A 3NO8A 4UW5A 4Q1PA 4YG6A 3ZFFA 1JXNA 5C8CB 2JJ6A 4I02A 3NSTA 4BE3A 2WZR2 2AR6A 3MIEA 2VU9A 3FUOA 4FT8A 5FO9B 1ONAA 3TN93 4Q0SA 5JDBA 3S30A 2RJLA 5JAXA 1IS4A 1VBC1 2JG9A 2GC3A 3E97A 1Z7S1 1B35C 5ABJB 4RS5C 1H1IA 5EV7A 4QQPA 1N1VA 1RC6A 1LEMA 5AC92 3UKTA 4Z07A 1BBT3 1LGBA 4YW1A 3FMGA 1RUF3 2WQZC 3ZXAC 2VMIA 4KBBA 3R6SA 1PIV3 3FFQA 4LO4B 2CV6A 2Q30A 2QZ3A 5AVPA 1UIJA 2UWCA 3NAPA 3H3UA 3O14A 4AI3A 1WLWA 5CB7A 4AW7A 4PIZA 4RGGA 4OI1A 2DUOA 5GLTA 3C3VA 4XYXA 2IXIA 3IN9A 4MUVA 3VBUB 4BYYA 4RR3C 1REFA 1V9U1 5FMOL 4B7EA 2Q4SA 1V6JA 1VBB3 1ULFA 4FPLA 3MF6A 5CNAA 4L99A 1MQTB 3MW3A 1IGOA 2HWC2 2LM3A 1NOVA 4ISRA 1H4HA 3BIWE 3V0AA 1VBD1 5FQ0A 1NYWA 5ACA2 1KDMA 3VN4A 2BNOA 4AG4A 2AZ5A 5BXXA 4BWOA 4P9WA 2ZS6B 2QZ2A 3VDDC 4BLIA 1LULA 4XF0A 3TWIA 3ILRA 2IWGB 4N43B 4Q4X2 1VBB1 1JUIA 3K48A 1ULGA 2IXHA 4EN7B 3N7KA 5DDJ1 1ZBA2 1LOBA 1PK6C 1WMDA 3GBFA 4I0AA 1H1MA 1R1ZA 4R9AA 3RI9A 4AEDC 1KXGA 4CEYC 1QH7A 2ZHLA 3MIDA 4MLOA 3AB0A 4Q4Y1 3ZXLA 1ASJ1 3ZXFA 1OKQA 4WBBA 3ZSKA 1CAWA 3I54A 2CY6A 1XNDA 3B9CA 2ZGSA 1J1LA 2EALA 4YW3A 4F7ZA 1GBGA 1QXRA 4GB32 2ETEA 1ZA4A 2DF7A 1NCRC 3N7LA 2ZX3A 3MYXA 2P2KA 3N7JA 3A4UA 4XTPA 3DPRA 5BNNC 1YWKA 2R1DA 2AYHA 1COV3 2VOVA 3B3QE 2BWCA 1RMU2 4LO8A 4CDQA 2Y0IA 4YVSB 1V6KA 4QPIB 2PHTA 2R49A 2WJSA 1PO22 4XJ9A 4BHPA 3UJQA 4X8PA 3KD4A 2XBO3 2A73B 3J9SA 2CTVA 5CFDC 1IHMA 4RHV3 4CDWB 2D43A 2IXKA 1DQ4A 4YGDA 1RHI2 2NMNA 2X5IB 3RSJA 5L7OA 1VJ2A 2XH6A 4E2QA 4IV1B 1HW5A 2GNMA 4YYOA 4SLIA 5A32A 1YO8A 3IKWA 2VUAA 4QM8A 3SMHA 2WT0A 1NXMA 4YZ2A 3B00A 3PJYA 3BB6A 3VBFA 4AFAA 1QXJA 1VRH1 1VBA1 2W0XA 3ES1A 3NKTA 3AM2A 3SXWA 4NO4A 2XBO1 4MYEA 1NLRA 1Q8OA 4LHLA 3WP5A 2PHWA 1DGRN 5FOJB 3ZSEA 1AJKA 1NY71 1O91A 2EIGA 3QCWA 4JRAA 1LHUA 2WSUA 3AYDA 4Y26A 4GMP3 2YMZA 4ATFA 3U0ZA 2HKXA 3WX5A 1W6QB 5JZGC 3HQXA 4L9BA 4NWWA 1LESA 3VBRA 2RS12 5FPXA 1RUH3 4H7MA 3GHNA 2VW1A 4BA6A 2ZGQA 1W6PA 4XHXA 4PLNA 1MS8A 1GR3A 2Z42A 4Y1ZA 5T5PA 5KHGA 4FPGA 4NHMA 4Y20B 1OA4A 3TOJA 3AMMA 4GMP1 2P3JA 5ACA3 5GLUA 1SMVA 1TMF3 1ZM1A 2DFBA 2HEYF 2DVDA 4PBPA 4M3CF 1XU2A 1SFNA 1FOD2 1EAH2 1QOSA 1Q56A 5AFEA 2XVKA 1BKZA 4AEMA 1NQJA 1CONA 4A7YA 1N1YA 1RUD1 1WUVA 2D6PA 1RUC3 4ZKTB 2ZGPA 5BUVA 1OLQA 4IEVA 3H1WA 2DVGA 2YC0A 3ZFGB 4B7KA 2IXLA 3VKLA 2FZ2A 1JYCA 2BNMA 4B3NA 5SV5A 4IV3C 4CYDA 4OHYA 5J3UA 4WM7C 3VHPA 4XF1A 3UKVA 2PTMA 5BNPC 1BVVA 1C4RA 5JIAA 4R4XA 4CP1A 2D6KA 4I3PA 2I45A 4W65A 1DQ1A 2GMMA 3WDYA 1HXS2 5GLVA 4AFCA 3ZN5A 1F2NA 1RJ8A 4LBQB 1RUC1 4OUMA 5IUQA 3APBA 5C4WA 5DXDA 5K0UB 4C0HA 2YUEA 1BZWA 5HCFA 2ZHNA 5J09A 3HT2A 2ENRA 3AMNA 2JG8A 2B9UA 4K9SA 4WV8A 2Z2SB 4IEOA 4BLJA 3ZYRA 1R082 4E27A 2VNGA 1SLCA 1ND3C 3IWZA 4PCRA 4PLMA 1RTVA 2JX9A 2UWAA 2CWSA 4Y1YA 5F1RA 1N1SA 4K3UA 3WUCA 5EYXA 4MH0E 4HFSA 1EV12 3CJIC 5T5JA 2H6BA 4YVWA 1UPIA 5E8AA 2VQ0A 5T3NA 3OPZA 1TE1B 1UCXA 2N7GA 3IIAA 4CDXA 1RJ7A 5JSRA 5GM0A 4AVBA 4XFGA 2OA2A 2NP0A 1OQEA 1DQ6A 1QHDA 2I07B 5H9RA 3EHKA 4HKLA 5DZFA 4OZXA 4KG0A 2DCKA 1KS5A 1HV0A 3U10A 1NA1C 4BMBA 5B2GB 2D3RA 4P5HA 2GN3A 5KXEA 1RUE2 4G3YC 4EV0A 4XQDA 5T5LA 5C9AC 4Y1VA 3AKQA 2GSYA 2VNOA 5GZGA 4XZPA 1BVP1 5CFCC 1N47A 2RJKA 1KJRA 2Q0AA 3MIGA 3WP6A 4A3XA 4AQSA 2K9ZA 2H0VA 3WDVA 4OUSA 2A6XA 1ZRFA 3TBDA 4ZU7A 5LRRA 1DLLA 1V6LA 1CAVB 1VBE2 3RI8A 3RMYA 2ZGOA 3DL3A 3JBG3 1FAYA 1OMIA 4HZFA 4M0HA 4BIOA 3KCXA 1FOD3 2CGPA 4PF5A 3DV8A 4LNVA 1FMD1 4FTBA 4KU7A 1WCKA 1RUJ2 4QM9A 1MS3A 4W6WA 1AXZA 3ZFFB 3ZMOA 3LOBA 4Z2WA 4GWMA 1NZCA 1LRHA 4WVWA 1ND2C 4YZ3A 3KQRA 3JBG1 5F9TA 1QJY2 2DVFA 1UZZA 3I2DA 2VOKA 4IEUA 3IT8A 4XIOA 1RVF3 3PHMA 1QKQA 5GKAC 2WNUA 2PN5A 2JG9B 1MZ6A 4CDUA 5FTTC 1HXS3 2PAEA 3HIFA 2DUQA 1UW8A 1LHOA 3AP6A 4R52A 4FBFA 4G9SB 2HWE3 3ECQA 5SV8A 1LB2A 3DGTA 4H3WA 1OHFA 1YLLA 2MEV2 5HCAA 2GC0A 4FPFA 4PDWC 4NN0A 4YW5A 2K0GA 1W6NA 1WW6A 4IERA 2DFCA 2YZ4A 1AR72 3NAPB 3AZXA 1DQ2A 1X36A 3AP4A 1R083 4XFAA 1R1A3 1R091 1JTZX 3GHMA 1RUNA 4AQTA 2XWJB 3WW2A 3KT4A 5JCTA 2WS93 2GZWA 3ATGA 2PLV2 4CEWA 2XL9A 1Z78A 1FXZA 4YZ1A 3H1YA 1REDA 2Y26A 5BNOC 1O5LA 2HWE1 1EV13 4ATEA 4P9XA 4AGRA 2BVVA 1H2LA 3POSA 4K1ZA 3ZFEA 2G4IA 3BALA 1BMV1 2OPKA 1DFQA 3LB9A 3LSEA 1GV9A 2JE9A 3L2YA 1QGLA 5FQ0B 1SEFA 2QCSB 4ES9A 3V0AB 1N1TA 1R1A1 4RQPA 4INDA 1WA4A 3O12A 2WS91 1BEV1 3EQEA 3QLQA 2EXIA 1OOPC 4KWLA 3L9JT 4QQLA 3H9AA 1KRIA 4JC1A 3R05A 1WD3A 2AH2A 1MZ5A 4U2AA 2XKPA 2VECA 1XQNA 1DYPA 1XU1A 2R32A 4X8NA 1PGSA 1C5HA 1PO12 4E4SA 1D2SA 1CD3G 5JR7B 3WINE 4XBLA 4BMEA 1AF9A 4GMP0 2OZJA 4YGBA 3NV2A 1CAWB 4P14A 4JRLA 3KT1A 4L11A 1I9RA 1AUYA 1XNCA 1QF3A 4LULA 2OYZA 1QJZA 1LEDA 3SH3A 2P17A 4F83A 2QFEA 1JBCA 2EAAA 3PMSA 2F6BA 3DPRB 4IETA 1QJU3 2QNKA 3O0VA 3AZZA 1GZCA 4RSUA 2ZKLA 1J3RA 4OHZA 3VLBB 4CDQB 2VQAA 1RUJ3 4AVCA 1YUDA 4FXGB 1C8M2 1ZYBA 3ZYPA 1AX1A 3IM0A 5C8CC 1OSGA 1X82A 1HDKA 3E5UA 5CA6A 3T1MA 4Y22A 1Z7S2 5CVRA 3T1LA 3VBHA 3N35A 1V00A 3HT1A 5L7OB 1LHVA 5TSWA 3E6CC 4IEQA 4C0BA 1LGCA 1QJU1 4RR3A 2IXCA 5FBZA 2NPIA 3A0KA 5A32B 1PNGA 5ABJC 3THTA 4RGAA 3DUIA 3HAGA 3TN92 1H1AA 2VGDA 1SLAA 3VBFB 3QD6A 4LA3A 4LBNA 4AEKA 4XDQA 1MS4A 3ZSLA 4AFBA 3WOGA 4IQPA 4IL7A 3SCHA 2VVFA 4JDOA 3J26N 1AR73 3VBOA 4AHXA 2RE9A 2VULA 2GH8A 3IPVA 1GZ9A 1KITA 1ZBE3 3Q9OA 4UW6A 4D3WA 1D2QA 1VALA 4HVRA 1BBT2 1ALYA 1TME3 2PLV3 3OJBA 1LOFA 3N7MA 1ZZBA 3VBRB 3WP4A 3EJKA 2OUHA 4MXWA 5JSPA 5EWSA 1W6PB 1O3QA 1NQDA 3K51A 1ZVFA 4TSVA 2PELA 3OBRA 3I8TA 4UW3A 1LENA 4LBOA 3TAYA 2HJIA 2PYTA 4LE4A 3AFGA 2A3XA 1DZRA 1ZBE1 1K5MA 4XHBA 4F3JA 1RB8G 1GYKA 1VBB2 1TME1 2ATFA 5C33A 1NCRA 4YRDA 4C90A 1GLHA 2ZAHA 3JUUA 5DDJ2 1F9KA 4PQ9A 5BNNA 4O9GA 2X8KA 4N43C 3WR0A 1HRI1 2WNVA 5LRSA 2O1QA 3JB4C 2QDNA 2RS53 1ASJ2 4CTEA 5I91A 5CG9A 1KD7A 2C1FA 2BFUL 3VZLA 3ZSMA 1JUHA 3AXDA 1O3RA 2OUJA 1D4M1 4WVZA 4AHYA 1UIKA 4S2FA 3KCYA 2BEOA 1AXYA 2OIIA 1PNFA 1S0IA 4FQZA 4N7IA 4A7ZA 1FPN1 5DZGA 4ZU4A 1H0BA 3OGJA 4QGLA 1YHFA 5F5QA 5KHHA 4A7KA 4LBLA 4BOWA 2RS51 2R0HA 2IXJA 5C4WB 2ZAAA 3ZXJA 4XF4A 2H0BA 3MGUA 1NLSA 4OHVA 4BQ1A 5KC6A 2WA3A 4NHLA 4JGZA 2JG8B 4YVSC 3H7JA 4AWDA 1JHNA 4QPIC 5I0SA 2WL1A 1Y7BA 1VBC3 1JW6A 3ZMNA 1WLDA 2A70A 1LOCA 1Z0HA 3AK0A 4N53C 4E4ZA 4GIQA 2R1BA 3E5QA 5CAZA 3WG1A 4UBGA 4IV1C 1AL0G 1VRH2 1ENXA 2XBO2 4YVWB 3AX4A 3FLRA 2Y38A 5L19A 2B8MA 1RL3A 4RHV2 2ZGNA 3ZXKA 1KS4A 4CDXB 1CN1A 1NY72 3BPZA 4QD2A 1EY2A 4LLOA 3B69A 4AQ2A 1YNAA 4HVOA 1F5JA 4FTEA 1AR81 3RRDA 3NVCA 1NG0A 5FREA 4AYUA 5KHJA 3JB8A 3ZIWA 1V9U3 3NW4A 2O0OA 1IOAA 4AEJA 5JWPA 4J1XA 5L73A 3AP9A 4JDNA 1HX6A 4K8FA 1DZTA 1W6OA 3ETQA 3VHNA 2ZJCA 2PHXA 1OD5A 3MLLA 1RIRA 3GZTB 3R0RA 1VBD3 4JGYA 1TNRA 3WP3A 3ALQA 1CAXA 1LOAA 3LCPA 1D0HA 1RITA 1RUH2 1MZEA 4ORFA 2CWMA 2WNEA 3HBZA 3JQXA 1RUD2 5DDJ3 2YPJA 2TNFA 3CEWA 4A2UA 3WQ1A 1AZDA 4AGVA 2JXAA 4META 5CADA 2BPA2 2XKOA 4Q4Y3 1VP6A 1ASJ3 4QT6A 1TMF2 3M3IA 2PHRA 3H3ZA 1Y9QA 3RZZA 1VLNA 1IS6A 3ZFGC 3WQ0A 5E16A 1DBNA 2DUPA 1DG6A 4FQ4A 1M4WA 2UY9A 4XMIA 3J8F1 3IDBB 4N9HA 1RUC2 2WNUB 4CDUB 1RUOA 1GANA 5FO7B 5I0UA 4QHBA 3ME2A 3EXUA 1O4ZA 4TYSA 1Q8QA 4MVTA 3UK9A 4LO7A 5I8SA 4AVAA 3VKMA 5K0UC 4LTAA 1QU0A 1S0GA 3E6DA 3N3HA 3NKGA 2LTNA 1W6NB 1GSLA 3A0NA 2JECA 5BPXA 3FE5A 5GZFA 3O7OA 3B93A 4QPGA 5KXBA 1A8MA 1IPKA 1FATA 3WLUA 4CEWB 4XW3A 2AUYA 3TYJA 2P3KA 1IKQA 2WKKA 3LSDA 4XJAA 4AFMA 1VRH3 3RS6A 1IS3A 4EN9B 1VBA3 3PVEA 2G9GA 3ZFEB 1U5IA 3I59A 2ZX0A 1XNBA 5GZCA 3FLPA 4LA2A 4DFSA 3IDCB 2BUKA 3AXEA 4RQPB 4ITCA 1NCQA 2RR13 4YG3A 1V70A 4P9GA 4DY3A 3BU7A 1Y3TA 3WZ1A 3ZVXA 2YHJA 1TNFA 3NV3A 2AGS