5CFCC

Crystal structure of human cardiovirus safv-3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
258
structure length
258
Chain Sequence
SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
molecule tags Virus
total genus 53
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfcC00
4CDXA 3JBG3 1BMV2 1POV3 5FOJB 1RHI3 2FZ2A 5CFCC 4CDQA 4JGZA 1ZBE1 1VBA3 1PO23 1AR73 2RS11 1FOD1 5DDJ3 1COV1 4RHV3 5BNNC 2HWB1 1RUE3 1FPN3 1RMU3 4IV3A 5A32A 1PIV1 2R073 3NAPC 2HWF1 5C8CA 5CFCA 1D4M3 4NWVA 4Y4YA 1RUC3 1VBC2 4AEDB 3VBRC 2X5IB 4QPGA 1NCRC 5BNNA 1RUF3 1RUG2 2RR13 1PGL2 1X33A 4NWWA 2WFF1 1CD3G 1V9U3 3NAPA 1ZBA1 1RUH3 1EAH3 5D8AC 1K5MB 5AC92 1OHFA 1PIV3 2RS31 4YVSC 2R063 1H8TC 1AYN1 4CDWB 5JZGC 1C8M1 4CEYA 3J8F1 3VBUC 1BEV2 1HRV2 1R1A1 3JD73 1VBD3 1QJX2 3FBMA 5D8AA 4CDXB 1AL21 2XPJA 1VBB3 2HWE1 4IV1B 4Q4X2 4RFT0 2WFF3 1PO12 4YVSA 1ZBA3 5JZGA 3HAGA 1ND2B 1E57A 4Q4V3 3VBUA 1IHMA 1Z7S2 1RUD3 1AYM1 4RQPB 5A32B 5FMOL 3CJIB 2RS51 1AYN3 1RVF2 2HWD1 4JGYC 1C8M3 5C8CB 3J8F3 3DPRC 4QPIB 1QQP2 4CDUB 4Q4W3 5LK7B 2WZR1 1R1A3 4N53B 4QPGB 5L7OA 1RUJ3 3JBG1 5ACA3 2PLV2 1TMF2 2HWE3 5FMOS 3VBOC 1RHI1 1RUI3 3LOBA 2R041 4RR3B 1QJU2 1VBA1 4WM8C 1PO21 1AR71 1NA1A 5K0UB 1NY72 2WS93 1A6CA 1QJY2 3ZFEC 4RHV1 3DPRA 5A33B 2WWSA 4YVWB 4BCUA 1RUE1 1HRI2 1FPN1 4CEWC 1RMU1 2BUKA 1B35A 3ZFGC 5C4WC 4CEYB 4WM8A 1RUC1 1VB4A 2HWC2 4WM7C 3VBSB 1TME2 1AR62 1RUF1 2RR11 3ZXAC 3VBFB 4CEWA 5ABJA 2MEV1 1AR92 2R043 3ZFFC 1V9U1 1OOPB 1VBE2 5C4WA 1RUH1 3VDDA 1BBT1 3VBHA 1EAH1 1VRH2 5BNOC 4WM7A 1R091 4N43B 2R061 1HXS2 5C9AC 5CFDC 1NCQB 1PGW2 4RS5C 1AL0G 1RUG3 4Q4X1 1R082 3JD71 5L7OB 1VBD1 5GKAC 4FTEA 1AR82 2WLPA 5BNOA 1VBB1 2MEV3 5DDJ2 3TN92 2RM21 2GH8A 5C9AA 1PVC1 1BBT3 4Q4V1 4GB31 1OPOA 4Q4Y2 2R072 3VBRA 2RMU2 1RUD1 1NCRA 1D4M2 1R093 4GH4C 2XBO2 1MQTB 5BNPA 4Q4W1 1ASJ1 1ND3B 4Q4X3 1ZBE2 5BNPB 1RUJ1 2RS12 4PDWC 5ACA1 2BPA2 1FOD2 1COV2 1RUI1 4CDQB 4JGZB 4GH4A 2RM23 2HWB2 1H8TA 1Z7S3 3S6PA 1PVC3 2WS91 3VDDB 4GB33 1PIV2 3VBHB 4FSJA 2HWF2 1FMD1 1RVF3 4SBVA 4IV3B 2BFUL 4EJRA 5CFCB 1MEC1 1ASJ3 1BMV1 2PLV3 1TMF3 1AUYA 5J98B 4AEDC 2X5IC 5BNNB 1QJU3 2BFUS 1ZBA2 1GFF2 1EV12 4FTSA 3NAPB 4JGYA 3JB8A 1NOVA 2RS32 1AYN2 1VAKA 1FMD3 3VBRB 1C8M2 4AEDA 1K5MC 3J8F2 2X5IA 3VBOA 1R1A2 1VBC1 2HWC3 4CDWC 2BBVA 1AL22 1TME3 1MEC3 4Y5Z0 1AR63 2VQ0A 2HWE2 4PDWB 4FTBA 1RUG1 3ZFEA 1PGL1 2QQPA 1AR93 5D8AB 4CDXC 1VBE3 1K5MA 4IV1C 2IZWA 3ZFGA 4YVSB 1H8TB 5JZGB 1VRH3 1AYM2 4CDWA 2GSYA 1ND2C 3VBUB 5AC91 2RS52 1DDLA 2HWD2 3JB4C 1HXS3 4RQPC 2WZR2 3CJIC 1VBC3 1BEV1 1HRV1 4IV1A 5C8CC 3ZFFA 3JBG2 1R083 4QPIC 4CDUC 1QJX1 1M06G 1VB2A 1RHI2 1AR83 1ND2A 2R042 4N53C 4QPGC 1VBA2 1PO22 3TN93 1AR72 1PO11 4RHV2 4RR3C 4RQPA 1NG0A 1RUE2 1Z7S1 1NA1B 3CJIA 1FPN2 4JGYB 4Q4Y3 5CFDA 1RMU2 5K0UC 1CJDA 2RMU3 3DPRB 5AC93 5J96B 4QPIA 4RS5A 4CDUA 2XBO3 1RVF1 4YVWC 4N53A 1B35B 1RUC2 1QQP1 3VBOB 1BEV3 1HRV3 1W39A 1ZBE3 4GMP0 4RR3A 1RUF2 4WM8B 1QJX3 2RR12 4CEYC 2FZ1A 2RS13 2MEV2 1TMF1 2PLV1 5K0UA 3ZFEB 1FOD3 1COV3 2TBVA 1V9U2 5A33A 3VBSC 1EV11 1QJU1 1PO13 1POV0 2HWB3 4CEWB 1RUH2 2ZTNA 4YVWA 5ABJB 1NY71 1QJZA 1BBT2 3VBFC 1HX6A 1EAH2 1QJY1 3ZFGB 1OOPC 5C4WB 2HWF3 1HRI1 1WCDJ 1R092 2R062 1C8NA 4WM7B 3VBSA 1QQP3 4PDWA 4N43C 3VBFA 2HWC1 3JD72 1VBD2 1NCQC 3ZFFB 1TME1 1AR61 1OOPA 1VBB2 1RB8G 2WFF2 2RM22 1EV13 1AR91 5L7OC 1VBE1 5BNOB 1PVC2 4Q4V2 1QJY3 4GB32 2RS33 2Y26A 5C9AB 4N43A 5CFDB 1HRI3 1RUD2 1NA1C 1VRH1 1SMVA 1NCQA 1HQNA 4RS5B 4GMP1 1NCRB 1HXS1 4Q4W2 1F8VA 1AL23 1ASJ2 1B35C 1PGW1 4LLFA 1POV1 1MQTC 1RUJ2 5ACA2 1R081 2ZZQA 1RUI2 1AR81 1ND3C 5DDJ1 5BNPC 3TN91 2ZAHA 2WS92 4Z92B 5ABJC 1AYM3 3IDEA 4GH4B 3M8LA 4JGZC 4CDQC 2RS53 1FMD2 2HWD3 4Q4Y1 2R071 2RMU1 1MQTA 3VDDC 4GMP3 1D4M1 3VBHC 2DF7A 1X36A 1F2NA 2XBO1 1ND3A 2WZR3 4IV3C 1MEC2
chains in the Genus database with same CATH superfamily
2VGDA 3E1F1 1AXKA 2BJSA 4LA3A 4CDXA 3OY8B 5BY5A 2ZMLA 3RMYA 3BN6A 4A44A 5CFCC 3ZXFA 4LO7A 5HBAA 5FY5A 5FZBA 2VVDA 4ZS2A 1VBA3 4XETA 1AR73 2YBSA 5EIYB 2YC2A 1FOD1 5LK5A 4D3WA 1ULPA 3NJYA 4KG8A 4MHRA 5GLWA 5CBLA 4LBQD 1DF0A 5F39A 2YZ4A 3IIAA 5FFOC 3PVBB 2BNOA 4EZHA 3B9CA 1XE7A 1OLQA 4LHKA 4ZY9A 1G9FA 4FXKB 4OI4A 4F8AA 4MGQA 2L9LA 5CFCA 1SACA 3GZAA 4INDA 4NWVA 4WVMA 4LE3A 4FPLA 1RUC3 4TSVA 1VBC2 1W8HA 5DUUA 4XUNA 4AEDB 4LIVA 1QNYA 1ST8A 3V0AA 4DXTA 1NCRC 4A42A 2XDVA 4CP9A 4XZPA 1RUF3 3IMMA 3KGLA 1CAWB 2VOXA 3O0XA 5EWSA 2ARCA 4PCRA 1F15A 1WW7A 5A7WB 1YYNA 4IW3A 2MNGA 4KWJA 5KC5A 1AZDA 4XFFA 1RUH3 4YM3A 2BQPA 4CZSA 3K4DA 1R1ZA 1Y4WA 4UW4A 4AEJA 1EAH3 1W2TA 3KZ4C 2P3KA 4NAMA 1OKOA 5D8AC 4GWIA 1IPJA 4AI0A 2GMMA 5FZEA 1UPIA 2PXJA 3ASIA 4UXAA 2J1EA 3I3DA 3GZTB 5FLIA 3RWKX 2ZBJA 5FMBA 3POGA 4RD7A 4QX5A 2ZAAA 1H8TC 3CIHA 1KXGA 4JAAA 3ZYIB 2FDGA 1WMDA 2QTWB 4CEYA 1UAIA 4CCKA 2IVIB 4BU2A 4CCJA 1BEV2 2WAOA 4MGTA 4UAPA 2E7AA 4J25A 3JD73 5T3NA 1HDKA 2ZCWA 3FBMA 5D8AA 3ZPYA 1AL21 1W2OA 3FC0A 2XPJA 5EPAA 4Q4X2 4XC9A 5E89A 4C90A 1DP0A 4FFFA 4K3UA 3NJZA 5A3OA 2FMDA 2Y8KA 3KM5A 5FZ9A 4FP2A 1BK0A 3DL3A 3MW4A 5LRSA 3LA2A 1M4WA 4Q4V3 4Q29A 2IXIA 2WNUB 5FXXA 1NT0A 1UO9A 2W95A 5IFTA 2WSVA 2GP3A 3HPNA 1CIYA 1DHKB 4AFBA 5IK8A 2TNFA 5A32B 5FMOL 2WN2A 3CJIB 3P6BA 5FZ4A 3AMPA 2CAUA 5BNQA 5JOZA 4MGZE 2YC4A 3CMGA 1JXNA 1WMFA 1QQP2 3AZXA 4Q4W3 4CDUB 1ZZ9A 4AI3A 1J1LA 5LK7B 4M01A 1AVBA 1AXZA 4DXZA 3BTZA 2DV9A 3THPA 3WR0A 2ZGRA 4E4HA 3THTA 5E88A 2ILMA 3LOBA 1RHI1 4Y1VA 1HB2A 2EAKA 1CONA 3RZJA 2O8QA 3NNFA 1PK6A 1PO21 2DCZA 1NA1A 1A8DA 4CPBA 2VBDA 4DEVA 4I0AA 2R1DA 3SLIA 1QJY2 4RHV1 1JZ6A 1X8MA 1ENXA 4ZKTB 2CAVA 4OHVA 5E8AA 1QOTA 1HRI2 1RUE1 4AFDA 4CP0A 2VAUA 3SC7X 4EE2A 3HQXA 1RMU1 5FQ0B 3RFRA 1N1YA 2SLIA 1STMA 4NVPA 3ZFGC 3BODA 1S0BA 4UFKA 5D21A 3VGIA 1LOBA 3CZUA 3HWJA 5DN2A 4C1XA 1MZEA 2YC0A 2A71A 4CXXA 4GALA 1W0PA 3H42B 3MF6A 5FWJA 3TEZA 1SPPA 1SBEA 1I3HA 2A3WA 2LUWA 3AXEA 1DQ1A 1MACA 1OD5A 2WBKA 1TME2 3HQRA 5FY9A 3M3QA 1RL3A 5I0UA 3U14A 4LBQA 3WQ7A 4XTMA 2BZDA 5FO7B 3T0DA 3ZXAC 2XLFA 1UPSA 4JTNA 4UBHA 3V0BA 1GOHA 1PM4A 2OYZA 2B5HA 4NPRA 5JOYA 2VTXA 1I5PA 3USSA 2Q1MA 3QLQA 1JYIA 5CIRA 2XVLA 1WCKA 2DFBA 1OC1A 3VBHA 4YZ2A 5A3WA 3OSDA 3I3QA 3RQ0A 1LEDA 1VRH2 1QGLA 4R9AA 4AVCA 2ATFA 3DYPA 3N9PA 2VZ1A 4LIUA 1MPXA 3ZYJB 4IESA 3NSTA 1IQAA 1LHWA 2KD7A 4CYDA 4YM2A 1OURA 3P3PA 1LU2A 3LAGA 1XYOA 4HL0A 1GOGA 2NN8A 3UT0A 2B7YA 2QCSB 5T55A 3H7JA 4Y4RA 1J84A 2QZ2A 4PIXA 4P9YA 4Q4X1 4UWDA 3RGBA 3H9AA 1SCRA 1VBD1 5FR3A 3MZHA 4PIZA 2P3IA 4E2GA 3OBAA 4QXHA 4MG2A 2WLPA 3ZPOA 1GNHA 1S1AA 5DDJ2 3W5NA 1ZRFA 2D6KA 2O8OA 1AJKA 1HV1A 4Y33A 4Z2WA 3TN92 2GH8A 2WNVC 1DGWA 3T2QA 4CU6A 4RGKA 1DYOA 3AL5A 3OF1A 3ZVXA 1OA2A 4GB31 1T6BX 3NWKA 3K51A 2GP5A 3AC0A 4FCAA 1QXJA 2Q8DA 1LJ7A 3OEBA 2W1UA 4L97A 4GKYA 1D4M2 2PHTA 2GZWA 1ODNA 3RPQA 1UZWA 3NV3A 5DPNA 5T5PA 2VOTA 4Y1UA 5A6XA 2JICA 2RDSA 3BCWA 2PELA 1XXNA 2UURA 5IVYA 1ND3B 1VAMA 1UL9A 2VMIA 1ZNPA 2QDRA 2ZGLA 3ENRA 2Y60A 3R05A 4Q4X3 4NHYA 1VMFA 1W8FA 3LFIA 3SEEA 2JB8A 4UFMA 2KR2A 3CDZB 3U4XA 1QDCA 5LY1A 3TOJA 4U36A 2HWB2 4QKBA 1UYPA 1HN1A 5DUXA 1AX0A 5FZHA 1WWYA 4JRLA 2C5DA 2IXCA 3DKWA 4TWTA 4AGRA 4A7ZA 4WZCA 2WS91 1CPNA 3OPTA 4GB33 5FZ0A 2E7TA 5J7MA 3AZZA 2QQNA 2ARXA 4V2WA 1GZTA 3CZJA 1KITA 1TE1B 1TZOA 4B4RA 3ZDSA 1D2QA 3JQXA 4FBFA 3ZO0B 5C70A 2C6SA 3IDCB 1ZZ7A 5GJ6A 4E2SA 3K3NA 4GWJA 1UOFA 5CKQA 2OIIA 4XF4A 5CFCB 2AACA 2GNMA 3LE0A 5IYYA 2FDFA 4BYYA 4N9HA 5HCFA 2J22A 4M3CA 2JD4A 2BYVE 1NX9A 2QVSB 3W9AA 1ENRA 3OBRA 4K1YA 3GGLA 1CN1A 1RC6A 3V0AB 1CWPA 2A75A 2X5IC 4CP9B 1YFUA 1ZBA2 4XUOA 5FRAA 3R4UA 2CWSA 4BXSV 1EV12 2YGLA 5HI0A 3O14A 5F3EA 1UZVA 1V0AA 2ZGUA 3C7HA 3FUQA 3JB8A 4JRAA 1U0AA 2PTMA 4A41A 5FZDA 1XU1A 2ADEA 2RS32 1LNSA 4MH0E 4LHNA 3K75B 3A4UA 3AK0A 3I2KA 1K3IA 5I0RA 3I8TA 4OUMA 4LT5A 1DIWA 2X5IA 3LDKA 4P9IA 5K9YA 5F6LB 1D4VB 3ETPA 2R7EB 2Y33A 4TLGA 2WZEA 2DU0A 2HBTA 4A4AA 1X82A 3MICA 2OA2A 4S2DA 2FBEA 1W6OB 1DQ0A 1XNBA 1LOFC 4LORA 4ZXKA 3TNQA 1TME3 4L99A 1O6UA 3OTFA 2I2SA 2I45A 4HN1A 4QDSA 4AXOA 1FAYA 4FTBA 1K42A 5FYVA 4XBLA 4XQ4A 4GZ9A 3L2HA 5D8AB 2VOVA 2HEYF 3PDQA 4FQZA 4IV1C 4ZZ5A 4LBKA 3GM8A 4RSUA 1H8TB 5FYIA 1NLQA 1VRH3 3NVCA 4META 3I2OA 2GNDA 3ZX7A 3EMRA 3BPSA 4OHZA 2VCBA 1T2XA 1SBFA 3MPPG 4G3YC 4XQDA 3E6BA 3MBWA 1MR5A 3CKHA 5A1LA 2VMFA 4RQPC 2LALA 2RDNA 2WZR2 1ZRIA 3FFQA 1HRV1 3CJXA 4IV1A 1BXHA 4ZU4A 4Z8BA 5C8CC 2DUOA 1QHDA 3ZFFA 3JBG2 1CX1A 3ZSJA 5AVAA 3JU9A 3CBNA 4UFHA 1LR5A 4K9SA 3I59A 2C26A 3BVCA 2JENA 4N53C 3SH4A 4QAWA 3U37A 4QPGC 4GWMA 3TN93 4QU1A 3O1TA 4JHZA 5I0TA 1NAEA 2ES3A 4RR3C 4RQPA 2GU9A 1LOEA 4XZUG 1NA1B 4QB6A 5FPVA 4A7YA 3D0SA 4IEPA 2DCJA 2D5FA 2VOWA 4FFIA 4PI2A 2VMCA 5J96B 4X8NA 4ZZ8A 1C5IA 3B69A 1RGSA 2WC2A 4QWNA 4RS5A 2CTVA 3WINE 2P6HA 4QKFA 2ZHLA 4CTEA 1WKYA 4NRMA 4YVWC 1ZYBA 4XURA 4N53A 4MUVA 3ZSEA 1OI6A 1RTVA 4KBBA 4BISA 1DGWX 3TEWA 2AGSA 2VQAA 3JQWA 2PMWB 3UL2A 1HRV3 3AP4A 4XPVA 3V64A 4UFIA 4MX3A 5L36A 3AM2A 4RR3A 1IS5A 2RR12 3K4AA 2FZ1A 4IGPA 4D7YA 1SPPB 2MEV2 1TMF1 4K21A 5E1RA 3PUAA 4YFWA 3IWZA 3QD6A 4UW3A 3RNSA 2VW0A 3PJYA 1X9TA 1EV11 4LBQB 4XXPA 5FZ3A 1QJU1 2HWB3 3VBSC 3ZYHA 4YVWA 5BV6A 5I8YA 3V0BB 1QJZA 1WD3A 1I9RA 3J7NA 4LPLA 1GWLA 1QOSA 3MGUA 4CUGA 1W6NA 3ZFGB 5AFEA 1XNTA 4ORFA 4LLOA 4EWAA 2VUDA 1G9BA 3WCSA 5DZGA 1CGPA 2DUPA 3KF3A 4WVWA 1YFXA 5FZ1A 3MI8A 2G9ZA 2FCTA 2R062 3HOBA 2QE3A 3I7DA 5JIAA 1JZ7A 3FHIB 3D0JA 4MGKE 3IBMA 5C3SA 3WHUA 1UXZA 3VBSA 4PDWA 4H2AA 2P37A 4XHBA 5IATA 4MSVA 5KXDA 2HWC1 3H3UA 3AKPA 4GA9A 4I3GA 3D6EA 4Q26A 2PHRA 1LTEA 3MYXA 1I1EA 2X09A 3C2UA 3POWA 3PTYA 5B4XA 3B9IA 4ATEA 3EBRA 2WO7A 2RM22 1EV13 4Z82A 3OD4A 3H8UA 4P02B 1JZ3A 4BK5A 3MLKA 2VBPA 1OF4A 4UFLA 3AMMA 2RS33 3HT2A 4W50A 4MZUA 3BOWA 5F2WA 3WD5A 2VW1A 3B3QE 3BIEA 4XIOA 1SMVA 2HKXA 4ISRA 4P9JA 2YU2A 3WP3A 5EQUA 1YQ2A 3WW2A 5GZGA 1OA4A 1Y3TA 1HXS1 4D8MA 5KHKA 3OUIA 4C8DA 2C9AA 3AKTA 2BNMA 5G04L 5CKMA 5FP4A 1NLRA 1ZRDA 1RUOA 4N90A 1RUJ2 5FZOA 1CAUA 1R081 5ACA2 5A7WA 1SLIA 1MS4A 1ZZCA 1VE0A 3FE5A 4CXYA 3D3AA 1AR81 1HB3A 1LULA 3KVAA 3WX5A 3MHZA 5FZFA 1KDKA 3POSA 5J09A 5JR2A 2RV9A 1S0CA 3B01A 1ZRCA 3ON7A 3WUCA 3AYEA 4B3NA 2IC1A 1JYNA 3LA7A 3IDEA 1A34A 3M8LA 4NHLA 3GJAA 3LFMA 4CDQC 3I3EA 3PVOA 4AQ6A 4Z1VA 1XOYA 1O5UA 3GZUC 5FKCA 2R071 1HJGA 1DCSA 4MLOA 5DAPA 4S2GA 4UBGA 5EZWA 2RMU1 1XE8A 2QDNA 2LW8A 2QKDA 2RJLA 4DFSA 3KGZA 1BZWA 1N3OA 2XBO1 5FO8B 2WZR3 5DQ0A 3WNNA 5JI7A 5CADA 3J7LA 3VZOA 2NQYA 4AYUA 3ECQA 2WUHA 3MFAA 4M4PA 2AREA 5L19A 3R4DB 3JBG3 1T6GC 4FO9A 3WG2A 2DCTA 2GALA 2A6VA 4NJ4A 4CDQA 1ZBE1 2ET7A 4M3CB 1WUVA 3ELNA 3E6CC 2RS11 1OD3A 1COV1 3O1VA 2WAAA 3LPFA 2XJVA 4LO4B 1LHVA 4E4SA 3U4SA 3KV4A 4MV2A 3ZXJA 2DDUA 2GNTA 4HETA 2ENRA 4URTA 2D3RA 3B93A 5J37A 2XGXA 5A32A 1NUKA 1PIV1 5K4LA 3OCPA 1QJFA 2GC1A 1RJ8A 2R073 2UY9A 3I2GA 2ERFA 3UKVA 1OLMA 3Q8BA 2HWF1 3I49A 2NM1A 4G4FA 5GALA 4EWDA 3MIBA 4KU7A 4DQAA 4XIKA 1JZ5A 4D7TA 4AFAA 3NKTA 4AW7A 1G6NA 2X5IB 5FKBA 3N9NA 3VLBB 1W99A 4TZDA 3H3LA 2WQZC 3O7OA 4GJYA 2RR13 4HN0A 4MO3M 4XMIA 4ASLA 4CXWA 3WF4A 5FUIA 4NWWA 4XF3A 4IQPA 1YQ8A 2W68A 3WUDA 1CD3G 1YWKA 4FPEA 4YW6A 1SEFA 4COZA 4GJZA 3OBZA 4YRDA 5GZDA 4NHMA 5DZFA 4RL7A 5FCCA 2VOKA 2JD9A 4LITA 2ZGTA 4MVTA 3TWIA 3JUUA 1BQPA 5AC92 2YG0A 1PIV3 4YGBA 2WT1A 4LOSA 4IEXA 4TYSA 4UF0B 3WG3A 2EALA 4BIFA 4D69A 5B4NA 2KXLA 2R063 1UXXX 2UYAA 2YPDA 5JZGC 1C8M1 3DF0A 2VD7A 4DEQA 3B02A 4AOCA 4Q27A 4BXFA 3J8F1 4YW1A 1O3QA 4EN8B 1W90A 2D6PA 4FPYA 3DYOA 1TEIA 3RDIA 1R1A1 1UNBA 2VQTA 3AB0A 1JU4A 4QHOA 1EYBA 1GQHA 4A6SA 1HB1A 5LA1A 5EXOA 4KGQA 2HWE1 3LSDA 4IV1B 4TXWA 2ZEZA 3TYJA 5A3PA 2BOJA 2E51A 5JZGA 4XFHA 2ZHNA 2PHLA 1G86A 4OZOA 1JHNA 1N3PA 2YYOA 4OUSA 1YQ5A 4XJ8A 3LEGA 1GU3A 1LGBA 1Z7S2 2GDFA 4Q2FA 5L9BA 3AP7A 5I8TA 2D6NA 4XMAA 5FUNA 3HIFA 1W0OA 2W94A 1URXA 4RQPB 4MADA 4MOAA 4QX3A 4UYBA 2D5HA 2RS51 5FY0A 2HWD1 2VZ3A 2O1QA 2RDRA 4JGYC 2OS2A 2VZSA 1C8M3 1SQ4A 4HK8A 5C8CB 4K6BA 4LMFA 3J8F3 3ZXDA 1OFSA 5LBEA 2JKXA 3NNLA 3SH5A 2JXAA 1OPMA 2WL1A 4FOQA 2XVKA 4FAHA 4XDQA 3ZSKA 1R1A3 4N53B 4DPNA 1DLLA 3W59A 1JN2P 4QPGB 4YM1A 1GZCA 4CCOA 1WCUA 1RUJ3 4J6GA 5F3GA 5ACA3 4Q0UA 4NIDA 2HWE3 3VBOC 4AG4A 1A3KA 3I2FA 4RR3B 1H1MA 1Q8VA 2E9QA 1VBA1 2VVEA 4HSJA 4LBLA 1AR71 2BVBA 1LB2A 3O5SA 5GLZA 1K12A 2OZJA 3BIWE 1XNAA 2BGPA 3WNLA 1AXYA 2A7AA 4BQXA 1D2SA 2WWSA 3O0VA 4YVWB 3HEIA 3HT1A 5FPUA 2BUKA 4JDOA 2LRPA 1B35A 3HN1A 3VHRA 2CHHA 4YARA 1UOBA 4MXVA 3UJQA 4IGOA 5FZ7A 4BMBA 5FZIA 4ASMB 4GXLA 1RUC1 1YJLA 4YGDA 4XF0A 5A70A 1Y7BA 4PQQA 3VBSB 1V70A 4HOOA 4OCTA 1RUF1 2V4VA 4PIYA 1RITA 3NJVA 1DLCA 5A7QA 4A6OA 3E5UA 3M3IA 5ABJA 1NXMA 3ZKUA 5C5UA 1AR92 3IDAA 5FPLA 5JUVA 1W6QA 5HV0A 2WSUA 1VBE2 2VZVA 1Q56A 5LA2A 4KI5M 2UU8A 1RUH1 1WBLA 1POQA 5EP9A 1BBT1 1EAH1 4BH9A 3KD4A 5CKNA 3GBFA 2XL7A 1UU5A 5H9RA 5K8SA 3URFA 2WZPP 2Y0OA 3SISA 4XUQA 3GF6A 4I09A 4JTOA 5CFDC 3IKWA 3U0ZA 1MS1A 4EV0A 2X29A 1H0BA 3H1MA 4R4ZA 2Y34A 3KQ4B 1AL0G 1ULDA 1AX1A 3ATGA 4FI9A 2ZJCA 4DB5A 1YCIA 3JD71 5GKAC 1QMJA 4FTEA 1ENQA 2W0XA 2W47A 3NV1A 1JUIA 3ZIXA 1JZ2A 3RMXA 4KH9A 1N1TA 1CAUB 3B00A 5FZOB 3VZNA 5A7OA 1JZ8A 3RZHA 1AHSA 2PHWA 5CA6A 3QACA 1GANA 3VD9A 4LXLA 1H6XA 5FYTA 4Q4V1 1BBT3 2AEZA 3N7JA 3TNPB 5I0SA 2XUMA 4FVVA 2J1AA 1SHWB 4Q4Y2 3AJZA 2EXHA 1FNZA 4JZRA 1NCRA 1ONAA 3IT8A 4GH4C 4Q8LA 1VIWB 3A23A 3VHPA 1BKZA 1QOOA 3SHRA 1V6LA 2UYBA 1H1AA 1APNA 1W6OA 1W8ZA 1VR3A 1YUDA 1V6NA 2YBKA 3K48A 4BK4A 1XQNA 4Q4W1 4N7UA 1YLLA 1ASJ1 1V6OA 3RI8A 4CUCA 2WLQA 1G8WA 1EPWA 1EPZA 1J3RA 3H0OA 3UK9A 2BPA2 5F5IA 5FY8A 2D6LX 4CDQB 4GH4A 4CE8A 2Y6KA 1H8TA 1Z7S3 4EN6B 2WYSA 5FZ8A 1BVP1 3Q8AA 1HJFA 1S4CA 2VZQA 2XWBB 4AK3A 4D7SA 4ES8A 4FSJA 3MV11 4K20A 3SMHA 3POFA 2AC1A 1FMD1 4RGAA 3B94A 3K4ZA 1W8TA 2BFUL 3CL1A 4QX7A 5LZ6A 4NHKA 1SDDB 1UYZA 1H30A 4YZ3A 3WP6A 1SBDA 1OKQA 5FTTC 1O5LA 3DXUA 4XQWA 2NYYA 1MEC1 1ASJ3 2JE7A 3LEKA 4JVAA 4XILA 4HVRA 5SV5A 3WDTA 1EUUA 3WOGA 3N4MA 3LWCA 2W1WA 2WO3A 3RRDA 3E97A 4GKXA 4XAEA 2CWMA 4IL7A 2R0HA 5FYHA 1GFF2 2RJKA 4IEWA 5FZKA 5DZEA 3HNYM 3C8XA 3QBQA 3LCPA 4Q0SA 4AVVA 4FPOB 2EAAA 3MW2A 5JVVA 2R1BA 1Y9MA 3U11A 3SQOA 1AYN2 1NZIA 2QQWA 1FX5A 1FMD3 1GNZA 2C4XA 2A6XA 2VMDA 3THCA 2PHXA 2D40A 4IGQA 5EJZB 5T50A 4YGEA 3UV9A 1RXGA 4ITCA 3FLPA 4LO6B 4ZS3A 1VBC1 2PYTA 2UWAA 1JYXA 1MEC3 3RZMA 4AVBA 1PHMA 4PDWB 2C1FA 1ZZ6A 2G9GA 1H9WA 3GCWA 1NKGA 4AWDA 5CNAA 1DBNA 1AR93 5FPAA 5JCTA 4LO8A 1XNDA 4QT6A 1VBE3 4IDZA 1XB9A 3ZKYA 2YBPA 3O12A 3RS6A 1OH3A 2BU9A 2ZABA 3DV8A 3CNAA 3KVBA 5FY7A 3ZFGA 2VU9A 1SLCA 4I02A 2V4AA 5JZGB 2JX9A 3C7EA 2IFWA 1AYM2 2W08A 2GSYA 4Q1RA 5IFPA 1ND2C 1DQ5A 1GNYA 1S2BA 4XACA 2Y6GA 5DAQA 2YU1A 1OF3A 3JB4C 4KL1A 4GULA 4M00A 4TN7A 4LR4A 4FPJA 4ZPIA 3VDAA 4BZ4A 5A3TA 2BGOA 2CDPA 2JDKA 3IN9A 3SKJE 1VBC3 1BEV1 1KQRA 3WDVA 4IE6A 2OUHA 3MEPA 2AUYA 1PMIA 2OW4A 2CL2A 4X6QB 1CQ9A 3WDXA 1GWKA 3NO8A 1VRBA 3C7FA 3OD0A 4QM8A 4DRRA 1M06G 1HQWA 2PQSA 3I54A 1ND2A 1GMMA 2R042 2I07B 5FZGA 1NQJA 3OPZA 5HPOA 3ACLA 3MIEA 3BTYA 2PHUA 4BQ2A 3NL1A 4WVZA 4IETA 4Y5TA 3ZDVA 4RA0A 4HKLA 2W1SA 4R8HA 3ZOIA 3BGAA 4Y26A 3T1LA 4B8EA 3KT1A 4JGYB 4Q4Y3 1FPN2 1Q8QA 1UOJA 2TEPA 1Q8PA 1UZYA 4QKDA 1CJDA 4K8RB 3LKJA 2K2SA 2Q8CA 4QKNA 4RN5A 2DWRA 1JMUB 1UX7A 2VZRA 1E5IA 2HYXA 4FFHA 3SKVA 2QQOA 4UT5A 3QCWA 1MZ6A 1B35B 4O9EA 3ZYGA 1QQP1 3GXUA 3VBOB 1BEV3 1KJRA 2LS6A 1E5RA 1JTZX 2DVAA 2VUJA 2XJQA 3M4FA 4XCAA 2WNVA 2XB6C 1W28A 2B9UA 4AQTA 2ZX3A 3S30A 1RUNA 1ZM1A 1MS0A 2DYCA 2WO1A 4AEKA 2WFPA 1QEXA 2RG4A 1GLHA 1V9U2 5A33A 1DYPA 1S2KA 3K46A 3A21A 2DVBA 3AJYA 5ABJB 3S5AA 3LDBA 4E2QA 2GMEA 1GP6A 1SLTA 3VBFC 4XBNA 5F3IA 1HX6A 1QJY1 1SCSA 1W6QB 1KEXA 3GALA 1LENA 4COVA 4FPHA 1OBNA 1OOPC 1HRI1 1GV9A 1UU6A 1FNYA 4C1WA 4LBNA 1R092 4AI1A 2FDHA 2B8MA 2JDYA 3DN7A 3NJXA 1IGOA 5IUQA 4CA9A 4FPFA 4OUEA 4NHXA 4XBQA 3ACFA 4O65A 5KWRA 4NR1A 1QQP3 1O91A 5FPBA 2AR6A 3LSEA 5DG2A 2DFCA 5JSRA 5CB7A 3PUQA 1UCXA 3ZN5A 4QPWA 3VBFA 4P5YA 4CRQA 5H9QA 4BQWA 1ZA4A 1TME1 1MS9A 1OOPA 1VBB2 5EFUA 2A5ZA 1GZ9A 4Q0PA 2AENA 5FYUA 5L7OC 4XJUA 1WW4A 4YYOA 1S55A 5IHRA 1S0FA 1VMHA 1PVC2 4D0QA 1IS3A 5JLVA 4OHYA 1UF2C 1QJY3 1JI6A 2W92A 3OBTA 4YG0A 2WIIB 5T54A 3BALA 1Q5OA 1V6IA 1DU3D 5CFDB 1HRI3 1RUD2 1VRH1 4YG6A 3KV9A 4ISQA 3R6SA 1JYVA 3ACGA 5T5LA 1FI2A 1WCSA 4QXBA 4DUXA 3X29B 5FYBA 1I6XA 1NCRB 2QQLA 2V72A 5LRRA 5LEKA 4XVHA 1Y43B 5FP3A 4K8FA 5JXHA 2GH2A 2QQMA 2ZACA 3QH7A 5SV8A 4P9GA 1IS4A 1POV1 4UW6A 1JH5A 4XCBA 5C71A 1O8PA 2GNBA 5JXIA 1RINA 1RUI2 4HKWA 3RZGA 1DZTA 5FBZA 2ZA9A 2EIDA 1O8SA 4BDVB 1YC61 5E16A 2YY1A 3KCXA 2DVDA 5DDJ1 4B4QA 1GZWA 2ZAHA 3TN91 4G9SB 4OHXA 3VKOA 1NQDA 4Y1XA 1AYM3 4GH4B 4LEJA 4JGZC 2D3PA 5F5QA 5FJHA 4UF0A 3GNEA 5H9PA 1LOFA 2H6BA 1V6JA 2D43A 2QQIA 3AMQA 3OGJA 3PMSA 4GAZA 4LJHA 3ROUA 1D4M1 2Y6JA 3VDDC 5C3QA 1PMJX 4I01A 4NE9A 4A3XA 3G6JB 4IE4A 1F2NA 1TG7A 1ODMA 1VAVA 5A7SA 4IV3C 2E32A 1BMV2 4RFRB 1POV3 5BPXA 2JDMA 2Q5TA 3D5OA 4JGZA 2E33A 2SBAA 2EF6A 2HJIA 4YNIA 1RJ7A 3ILNA 2JDUA 2R6QA 3IDBB 5KXBA 2ZMKA 4P14A 1Y9GA 5DDJ3 5LA9A 4N8MA 2JDNA 3K2OA 5BNNC 3PTRB 1ULGA 2F6BA 2HWB1 3I2HA 3RYRA 1FPN3 3Q8EA 2Q1FA 1LEMA 4IV3A 1D7PM 1L3JA 4DS0A 1J1TA 5FZ6A 3JZVA 3ZMNA 5JPMB 2XLGA 3NAPC 3KLSA 4M3CE 3ME2A 5A7PA 3ST7A 2RDQA 5C8CA 4N9IA 1SFYA 3OUJA 1D4M3 2FDIA 3VZKA 2PQQA 1C1FA 1SLLA 5T5JA 3VBRC 3WG1A 2NMNA 4QPGA 5GLUA 4ONUA 1S0GA 4CCDA 1HV0A 5FV3A 5BNNA 2WJSA 2JG9C 2A6WA 1RUG2 5FMDA 2QFEA 3K3OA 1PGL2 3WHTA 1X33A 2NMOA 3M3EA 1TQ5A 5CG9A 1S0DA 5ERLA 4JV4A 1O59A 3Q8CA 1JHJA 3AZWA 3MV01 1V9U3 2CYFA 4OULA 2CGOA 2WT2A 3UESA 3NAPA 1WA4A 1ZBA1 3LF7A 4EZ4A 4XABA 3BUCA 4BE3A 4KNCA 3EYPA 3CEWA 4URAA 1NYWA 3FWEA 3WQ1A 2AZ5A 3SH3A 2QZ3A 2ORXA 5CVRA 4J1XA 4MXWA 3HJRA 2RS31 3OUHA 3OYWA 2JG9A 4XJWA 2OKXA 1LOCA 1GUIA 4P5HA 4YVSC 2BVVA 4XAAA 2D3SA 2V73A 3Q9OA 4XFGA 5J48A 2WABA 2VQUA 1O4TA 3O1PA 4H7MA 1CESA 3IPVA 5I0DA 2ZZJA 5CU1A 3ZXKA 3USUA 3WEZA 4UI9L 5C6CA 5LCWL 5FPXA 1MZ5A 1GBGA 4I3PA 1QJX2 4LTAA 5FXZA 4OYUA 1YQCA 1SFNA 2BNNA 5KC6A 4JKLA 1VBB3 5A1FA 2VXRA 3DCQA 4RFT0 3E5XA 2OX0A 5IK4A 1DGRA 3GHMA 1PO12 2O0OA 2CY6A 4YVSA 4CUBA 1UKGA 1ZBA3 3QH6A 2ZOEB 3TB0A 1ND2B 2IWGB 1E57A 3S5QA 4QGLA 2Q8OA 1G9DA 1JW6A 1IHMA 3HMYA 2ZX1A 3U07A 1FV2A 3MPBA 2YB7A 3J7HA 2VG9A 1DQ4A 1DGRN 1RUD3 2WA4A 1GP5A 1H1IA 4P08A 5JI9A 5CISA 4P9LA 2Q0AA 2ZPXA 3SITA 1RVF2 2AEYA 1NE4A 4AI8A 1HB4A 1CJPA 2PFWA 3H8XA 2W9XA 3VKNA 3BYWA 2UY8A 4LKSA 1Q8SA 2J7MA 4M0NA 4CU7A 1BCXA 5LWBA 3BU0A 2WZR1 4AHYA 3M7AA 4L9BA 3O1MA 1J83A 5M0TA 1H2LA 3JBG1 4Q0QA 2PLV2 4ZU5A 5FMCA 5FMOS 1RUI3 2QQVA 3ZN6B 1AX2A 4ZONA 3EQEA 2VNGA 3FBYA 1OQEA 2WNVB 2XHKA 3VKLA 5A6YA 1C3HA 4EQVA 4LOTA 3T0BA 4YW5A 5J3UA 1NY72 2P3YA 3BOPA 4QQOA 4YLZA 1IPSA 1LGNA 3ZFEC 1LOAA 2IVJA 4Y22B 2G9FA 4Z2AA 5A33B 2JG8C 5J36A 2QNKA 4QHZA 4V2VA 2QJVA 3CHXA 3I2JA 1MS3A 1NE6A 4ARYA 2W3JA 2BRTA 4EYUA 3NMBA 2XHNA 3VDBA 2NLRA 1WLWA 3MF9A 4QXCA 5HXMA 1UW8A 3A0NA 3ZMOA 1NLSA 2VC9A 3FN9A 1LHNA 3U10A 2E6VA 2JG8A 5FO9B 2IXKA 1AR62 1O3SA 1F35A 3HNMA 2XONA 2RR11 4EN7B 1FYUA 2VZTA 3DEMA 4XF1A 3VBFB 4F83A 2JWPA 1OT5A 2MEV1 3LEIA 1F5JA 2DTWA 4UOJA 4B7EA 5JSPA 2XWJB 3MLJA 3KF5A 2DVFA 1OOPB 3ZXEA 4B29A 4Q8KA 2C24A 1PVXA 4KWKA 2ZKLA 2N7GA 1ULOA 5JR7B 4Y24A 2CU5A 2G1MA 1W03A 4Z07A 5E6HA 3VZMA 2ZEXA 4UFJA 5FREA 2IXHA 1W8NA 1ZA7A 2OPKA 4OFGA 3RI9A 1VJ2A 2K0GA 2VVFA 4LHSA 1PNFA 2B45X 2EXJA 2J1UA 1W06A 2XVGA 2K46A 5FPZA 1W8UA 1OA3A 2R061 1W6MB 1J58A 2WZ8A 2YPJA 3I3BA 4NIAA 3RZLA 3ACIA 1AF9A 3R0RA 1PGW2 4FPKA 5LB6A 4QX2A 5DAXA 1WGPA 4JX0A 1RUG3 2PHDA 4NPMA 2YGMA 4EROA 3AFGA 5L7OB 1JU3A 1QY4A 4PF5A 3UKTA 3POJA 4S2HA 4IE5A 4AVTA 1HIXA 5L73A 2MEV3 1PZ8A 3WV6A 3M1HA 5JXJA 2F17A 3MIGA 4YWAA 2RM21 1UMHA 4E8CA 2QQJA 3P1IA 4HG6B 4PT6A 1F5FA 1CX4A 5I93A 4LKFA 1GZWB 1OPOA 3ZYFA 2ZX2A 5FYZA 3H1YA 3APBA 4AVSA 4PLOA 1H2MA 1TVGA 3A22A 4XOGA 5LA0A 4OLLA 3CLPA 1X7NA 1A78A 1W9WA 1Y9QA 1LGCA 2LM3A 2Y6LA 3CO2A 3PMEA 5F37A 5FDBA 4AGVA 1N1VA 2VO5A 3T0AA 4BQ3A 3NV4A 2A3XA 2WYFA 2WINB 3CU7A 4QM9A 3ZM8A 2JE9A 1UY0A 4A2UA 4IEUA 5EJ1B 4U2AA 1RUJ1 3VZLA 5ACA1 4OZXA 2XKPA 4QQLA 1FOD2 3K77A 1XYNA 2QQKA 1H4GA 3Q8FA 3QOPA 1CAXA 2Z42A 4JGZB 5BUVA 2ID4A 2RM23 4FOWA 4PBPA 2ZGQA 1S2EA 1WBFA 5HV4A 5JSOA 4JQTA 1PNGA 3ZN4A 4CCEA 1OQ1A 2B42B 3HVDA 5A80A 3VDDB 4R9DA 4XUTA 1N3QA 2P5BA 1RVF3 3THDA 1OUSA 3UNPA 5LW9A 4IV3B 2WA3A 5F8PA 3VB9A 4WVVA 4EJRA 2YFZA 4BB3A 5AFBA 1XJAA 2VJXA 4DXSA 3BU7A 1YO8A 3T2PA 2PLV3 2ZXQA 1AUYA 1JODA 4KBZA 4Y5SA 3RVHA 4CCCA 5J98B 3WF0A 4QXKA 3S7IA 5BNNB 1YIPA 4LBOA 2NPIA 2Y6FA 1OUXA 3LIGA 4PJYA 4XF9A 1K5JA 3KT7A 1W6PA 2IXJA 2KM2A 5ISLA 1DGLA 2X8KA 3KV5A 1JS9A 1OLME 3ZXGA 1RYYA 2W52A 3NAPB 4JGYA 4PBOA 4BWOA 1WMXA 4XHXA 2VULA 1NOVA 1ULCA 2FCUA 2K9ZA 3A0KA 4RGGA 5ANQA 2CV6A 1SZBA 2Z2SB 4N7IA 4OI2A 3ZYPA 1VAKA 3VD5A 3VBRB 1QU0A 3VZJA 1KFXL 3IAQA 3AX4A 1K5MC 3I3MA 3UGHA 4TTGA 4MXWB 4YPJA 3OYWB 2VNRA 3ILRA 2JG9B 4LK7A 4HSLA 2ZMNA 4KWUA 3VBOA 5GLTA 4QMAA 4AI2A 2ZHKA 4FXGB 2WRAA 4CDWC 1QF3A 4BQ5A 4A45A 2BBVA 4W6WA 2OZ6A 1AL22 1IG0A 3IPVB 4HVQA 3SXWA 3J9SA 1AR63 3USUB 3WQ0A 3ZSMA 4IXLA 5D2AA 5FLHA 5GM0A 3VD7A 1I5ZA 1JOBA 1PMHX 1SFPA 2QQPA 5JDBA 2VTXJ 3WDUA 4JQRA 4CDXC 2VNOA 2VR4A 4COYA 1CZTA 2ETEA 1K5MA 1RIRA 3KCYA 3WT3A 1KRIA 3WCRA 4YVSB 1QJEA 2ZX4A 1LU1A 2PAKA 3KSCA 4E4DX 4CDWA 3NNJA 2KA3A 2WQ4A 2EXIA 1DG6A 4IEQA 5AC91 3WNMA 4O7XA 2BBAA 1LHOA 3OB8A 5FBJA 5T52A 3TEYA 1PX3A 4IUGA 5A7NA 2H0BA 3AKRA 4MHUA 4NROA 4NUBA 5KXEA 3MFCA 2E63A 1XU2A 2G4IA 5EJ3A 3ZSLA 1S0EA 1XSRA 3RZKA 4AFMA 1UN1A 5JIUA 5JMOA 1C5HA 4XFAA 1ULEA 4QPIC 4Y3OA 1VMJA 1RHI2 3GCXA 2ZHMA 4QQPA 4AFCA 2J42A 5FLJA 4CU8A 1H2KA 1ZRRA 3ZLIA 1W0NA 5EYXA 1UX6A 1PO22 1U5ZA 2FMYA 5H9SA 4AF9A 3BPZA 4RHV2 5CZKA 2YHJA 3AZYA 4FFGA 5I91A 4QX0A 1RUE2 1Z7S1 1UY2A 4XFCA 5CFDA 5I8SA 1W2AX 1RMU2 1KFUL 1UMZA 1OQDA 5K0UC 3LPGA 5AC93 1F4HA 2WQ8A 4NRPA 4HFSA 4QPIA 3TEXA 5IVFA 3TRSB 2PA7A 5G05L 4JKMA 5BYNA 1Q43A 1UZZA 3HN3A 2EICA 1IKPA 3KS7A 3R4SA 5HCAA 4X6RB 5FAXA 4AQSA 4DY5A 1VPHA 3PVNA 1O3RA 1LESA 1N47A 4XDOA 3AP6A 1WD4A 4XJZA 3VD4A 3N9MA 5IT6A 5CYYA 2FCVA 5IVJA 1YEWA 1WLCA 2W91A 3AMHA 3KWVA 4CEYC 2IFRA 1L7LA 2BW8A 2V09A 5D1IA 1V6KA 5K0UA 3ZFEB 4AZZA 1FOD3 4Y1YA 4QDRA 2TBVA 2EIBA 2JG8B 2FD8A 3OPWA 2GC2A 1S0JA 1POV0 2RJ2A 1W8WA 2ZTNA 3FZ3A 4XJ9A 2FDJA 2I74A 4HVOA 5EHDA 4BM8A 5DAWA 4E4ZA 3PJQA 4NN0A 4QU2A 2X05A 2D93A 1YI7A 4FT8A 1GOFA 1UY1A 2W5FA 4NIGA 3H8OA 4HPKA 5FYSA 4PF1A 3NQHA 5CG8A 3AYCA 3ITQA 5C5TA 1JYCA 5F2SA 4CCMA 2CDOA 5FIXA 1J3PA 3MW3A 4ASKA 3PLQA 4COWA 3D8CA 5C3PA 4BQYA 1Z78A 2PAEA 3ABZA 3EXUA 3CF6E 4BJ0A 4N43C 1DZQA 2ARAA 5A6QA 1CAVA 2UWCA 1VBD2 1NCQC 3NNMA 1UQXA 2B39A 4E27A 2Q1ZB 3C7GA 1IS6A 5FP7A 3LQCA 3T2OA 1SLBA 1W3VA 3FLRA 4LQRA 3LD8A 1CZSA 2DVGA 2WFF2 4B7KA 1ZREA 2VY0A 1AR91 5FXWA 5FY4A 4IEOA 4FOYA 1VBE1 1DQ2A 3I2DA 4HANA 3BTXA 4Y20B 2A73B 5FXVA 4D6RA 2HYKA 1DZRA 4GB32 5DXDA 1V6MA 3TBDA 1W3XA 1W8OA 3FHAA 4N43A 3POIA 1PK6C 1R64A 3WDWA 3T4VA 1NA1C 2ZGOA 3EO6A 3WW3A 5B2GB 1NCQA 3PU3A 3PVEA 1HQNA 3E5QA 3PUIA 4OHWA 2J1SA 2ORZA 4GMP1 2W46A 2VL4A 3AMNA 2VXJA 2ZX0A 4LHLA 3ZYBA 1F8VA 1UOGA 3T2TA 1AL23 4QGNA 1LODA 3FX3A 1ULFA 4R9BA 5F5AA 1CVNA 3OOXA 4C91A 2BWCA 4HKOA 2V5YA 3RWNA 3J26N 1MQTC 3N9QA 4GQ7A 3SCHA 3OGVA 4W65A 1HKDA 2VW2A 1WLDA 3F95A 5BNPC 3H50A 2RE9A 2J1VA 3HBZA 2WS92 1E5HA 4Q0VA 1CAXB 5FP9A 2GAUA 4DIQA 4Z92B 1QNWA 3JXSA 2Z69A 4Q4Y1 1PZ9A 3OJBA 1JYTA 1OFNA 1MQTA 1XRUA 2PHFA 2WDBA 3J7MA 4GMP3 4LNVA 4GWNA 3AVRA 3VBHC 1YFWA 1G9AA 2XOMA 2P34A 3O1OA 2DF7A 1X36A 4AAPA 5KHHA 1JYWA 1UWWA 4CDUC 2YFUA 5BNPA 2E7QA 5JMCA 5FWEA 4CUAA 2VCCA 4LK6A 1W2NA 5FOJB 3DECA 1RHI3 2QQUA 1KD7A 5FK8A 5C8WA 2FZ2A 3WF3A 2DTYA 2ZGSA 1CR7A 1PO23 5IVCA 3PU8A 1GR3A 1ZZBA 4RHV3 4BHPA 5C33A 4PLMA 3N7LA 4J1WA 3RJRA 2WWJA 1RUE3 5IVEA 1W6PB 4FP3A 2JDZA 1HN0A 1RMU3 2XJRA 4DUVA 2QBXA 4FQ4A 2JKBA 1W9SA 1BYHA 4YW4A 1D0HA 3AFKA 4Y4YA 3UJOA 4QQHA 4DXRA 3DXTA 5L9VA 1YJKA 3NW4A 3S0MA 3N36A 4L0PA 2P17A 4DOUA 3SCFA 5IK5A 1QXRA 5FZCA 1V00A 1GP4A 1OLRA 2JB4A 4IEYA 3I4IA 4DO0A 3KHCA 2NP0A 1EY2A 3ZN6A 1OH4A 2Y64A 4CU9A 4W8JA 5DAVA 3UGFA 2JJ6A 2WFF1 2IXLA 2DBIA 2WKKA 5CEHA 5IW0A 3WP5A 2X53S 1HQLA 1QWRA 2LROA 2JDHA 4YG3A 2R0FA 3FMGA 3LZZA 4Y22A 2ZGMA 1W2UA 2E31A 1JOJA 1K5MB 2AYHA 1U12A 4X8PA 1OHFA 4WBBA 2RHPA 2YUEA 2ZKNA 2JDPA 4NAOA 1BVVA 1AYN1 4CDWB 4KU8A 4LBMA 1P8JA 2D6MA 3VHNA 3VKFC 2ZS6B 2ARBA 1L7QA 4LBJA 3MO4A 3PHMA 3VBUC 4JCKA 4WV8A 4ARXA 1HRV2 1YRZA 2BP6A 3AZVA 3HD8B 4KWLA 3D4KA 2JDAA 4EN9B 2OPWA 5EV7A 3O1SA 1PZ7A 1UYYA 1VBD3 2VCMA 3SEPA 4B1LA 1NZCA 4CDXB 1F4AA 2XJSA 4E8DA 1XBFA 5KBFA 1UZ0A 2A70A 2C9KA 1J3QA 2V5DA 2WO2A 3N9OA 4HT1T 4Q1PA 3AYAA 3NKGA 4AVAA 2WFF3 4A7KA 1O3TA 3AXDA 2JEMA 2XG3A 3LB9A 3OGRA 4R52A 2P3JA 3HAGA 1WLTA 1YQ6A 1H4HA 5FJKA 2B46X 1X9PA 3WXPA 4DRVA 5GLVA 4BQ1A 4NPLA 4CVUA 3O0WA 3FHQA 4L11A 5FZAA 1REEA 1C1LA 4OI1A 3T30A 3VBUA 3POYA 4JKKA 4QB1A 4HMZA 1AYM1 1JOPA 1D0GA 3ZR5A 3RSJA 1IZ3A 1AYN3 2D97A 2C0ZA 1W6MA 2CGPA 3U75A 3ZIWA 2Z5WA 1OSGA 4YGCA 2ZGKA 3PL0A 4R4XA 3DPRC 4QPIB 1FATA 1UIKA 4WVMB 3RZZA 3WZ1A 3ACHA 4C0BA 5ANNA 2BOIA 4Y1ZA 2W2IA 2YDEA 1UIJA 4NIIA 4LA2A 4AHZA 5HCHA 4M4RA 3BB6A 3ETQA 5L7OA 1O4ZA 3GHNA 5HXVA 1TMF2 3IB3A 3W58A 1QH6A 1MS5A 4LUMA 5F32A 4BPZA 2W39A 4MGSA 1UKRA 1VP6A 2HH9A 2R041 2B4KA 1G9CA 1QJU2 2VMHA 3WF1A 4WM8C 5K0UB 2GMPA 2YMZA 3C7OA 3N9LA 5F9TA 1H9PA 1A6CA 2PAMA 2P2KA 2VTFA 2BEOA 2WS93 3DPRA 1DFQA 5IAXA 1BK1A 4S2FA 4BCUA 2BTVC 1SLAA 2XJUA 3CQOA 4I2OA 1FPN1 5BXXA 3WY6A 4COUA 3DUIA 3HQUA 4QQ2A 4CEWC 2LTNA 4XEZA 4HXCA 2R49A 2DCYA 2PN5A 4FPGA 1K45A 3FUOA 4YW7A 1KJLA 1LHUA 1QDOA 4HPKB 2XLAA 3WQBA 3WNOA 5C4WC 4CEYB 4BMEA 2ZGNA 4ET7A 1PGSA 2A6YA 4WM8A 3WNXA 4XYXA 4YZ1A 4YM0A 1VB4A 1KGYA 2HWC2 3S57A 1S0IA 2D98A 2VZPA 1UYXA 2VZUA 4WM7C 5JOWA 1UU4A 3L9JT 1UY3A 2F4PA 2JIGA 4F3JA 3LIHA 3PUSA 4XW3A 3T09A 1CAVB 2OQ6A 2Q30A 4CEWA 5JPNB 4OI0A 2R043 4XDPA 2GC3A 1C57A 3M3OA 3ZFFC 1V9U1 2HEVF 4GIQA 1LKNA 4L92A 4XJAA 3VDCA 1C28A 1GQGA 2X10A 5C4WA 2BV4A 3GBGA 3VDDA 4FAGA 4IEVA 2DURA 1QIQA 4D6QA 1HLCA 3KMHA 5BNOC 1L7RA 5LBFA 4WM7A 4C0HA 3PUHA 3ORJA 2FQPA 5KXCA 1R091 3D82A 4N43B 3DYMA 3B7MA 1H2NA 1HXS2 4AL9A 5C9AC 1FV3A 1NCQB 3BI3A 5FZMA 3GJBA 4LULA 5F7UA 1YXWA 4HK9A 5F3CA 1CZVA 1F9KA 2GC0A 3AKQA 1LRHA 1NXD1 4RS5C 3HNBM 4YSFA 1GICA 1O7FA 2XJPA 1WCQA 4NOTA 5IJRA 2Y38A 2VM9A 1R082 5K7PA 2D7FA 3WW1A 5IK7A 5A3UA 4DMIA 1AR82 2ZEWA 5BNOA 1VBB1 1Q8OA 4O61A 4YZ4A 2E26A 1ZVFA 2Z79A 3IMNA 4CCLA 1PK6B 3N7KA 1EP0A 2OQ7A 5FUPA 5C9AA 4I0WB 5KHIA 1MVEA 3WP4A 1PVC1 4YZ5A 4QX1A 4AQ2A 4OMDA 1U5XA 1X8EA 2R072 4LE4A 2WT0A 5LATA 3FL7A 3H8RA 2WNEA 3VBRA 2RMU2 3AP9A 1RUD1 3EB7A 1UD1A 1R093 3U1XA 3WNKA 5LY2A 2UWBA 4P9XA 1W9FA 2XJTA 4SLIA 2XBO2 5FOBB 1VLNA 2FDKA 4ZU7A 4BOWA 1XYPA 1MQTB 5A3LA 2JECA 3KCCA 2WWUA 2Y0IA 5FYYA 2DU1A 1GQPA 4DUWA 3AL6A 1C4RA 2A6ZA 3VHOA 1MVQA 2W1QA 2R32A 1ZBE2 1B09A 2E53A 4HBNA 5BNPB 4KGGA 5LBCA 5C7GA 1U5IA 2RS12 4PDWC 2P4EA 4BLJA 3WVJA 1QXPA 1COV2 1RUI1 2OUJA 3I2IA 4QDQA 3MIHA 4BLIA 2R30A 4AAXA 5FY1A 3F2ZA 3WNPA 4FPCA 2DUQA 3S6PA 2XXZA 1A8MA 1PVC3 1W9TA 4M3CF 1PIV2 2JE8A 3VBHB 4D6SA 2EVXA 3OGGA 3V56A 3FJSA 4EWEA 2HWF2 1IQDC 1MZFA 1ZZ8A 4QPYA 1KS4A 4RYDA 4W6YA 4SBVA 3SCGA 4DNYA 4ZHNA 3O1RA 1G7YA 2QUOA 4F7ZA 4D94A 3OY8A 5DABA 2VECA 3P3NA 2EA7A 4IE0A 1H6YA 2VH9A 3GBWA 4DZGA 5EYYA 2B9VA 3RG0A 3VL8A 2F4LA 3RJ2X 4AE2A 3JCIA 4LKEA 2GN3A 4IEZA 2VUCA 1TMF3 3OG2A 3T1MA 1BMV1 4FOVA 3T08A 3V65A 4AEDC 3INAA 5C3OA 4H7LA 4W4ZA 4XFBA 1WMEA 2VPVA 1WZXA 3G7DA 4XXAA 1QJU3 2BFUS 2GN7A 3I97A 2D6OX 3EHKA 4H3WA 3WG4A 2ZGPA 5IVBA 3BTAA 4ATFA 4ZXEA 2WNOA 3ES1A 2EXKA 3BKZA 2XH6A 1DQ6A 3W21A 4YFZA 1REFA 5A6ZA 4P00B 4WZFA 4FTSA 3ALQA 3MUZ1 3IM0A 1YNAA 5LBBA 3A7QA 2XKOA 3MLLA 3PNAA 4UW5A 4A3ZA 3GDBA 3NNGA 2XMLA 1WA6X 1W05A 1TNRA 4QB2A 5LEJA 4B1MA 1JBCA 1C8M2 1XNKA 4H55A 4AEDA 2YV8A 2VBBA 2YROA 3J8F2 3MUY1 3T4HB 1CIWA 5KR7A 5F5CA 2HEWF 1YIFA 5DUWA 1R1A2 2MPFA 1CAWA 2HWC3 4OQ9A 1JUHA 4NMIA 2J1RA 3MDPA 4JDMA 3L2YA 4Y5Z0 2VQ0A 2HWE2 2VMEA 1RUG1 3HBKA 3ZFEA 2WR9A 1PGL1 1O4YA 4I30A 5KHJA 2HLEA 2JIJA 4HLTA 4AGGA 4AEMA 2BWAA 2OXBA 4K40A 5FK7A 3WSOA 1BJQA 4JDNA 1US2A 3VUOA 2IZWA 4OQ8A 1J59A 2R16A 3M3CA 2VE1A 1HW5A 1X50A 3FLTA 4XFIA 3PURA 4QHBA 3UGGA 4QX8A 3H1WA 1WW6A 1GWMA 2J1TA 2P1BA 3VBUB 2RS52 5FP8A 1DDLA 2HWD2 2WNUC 4EN0A 4BQ4A 1VALA 1LCLA 2W87A 4OVEA 1HXS3 1YHFA 4W6XA 2OT7A 2NZ9A 1OVSA 2WN3A 2CGNA 3VL9A 2Z4FA 3AYDA 2VUAA 3CJIC 1ENSA 2MHFA 2BDRA 3NV2A 1LOGA 4YW2A 4PHZA 3TAYA 3NRUA 1Q3EA 1R083 2RVAA 3VV1A 1QJX1 3FFZA 1PX4A 1VB2A 2FHRA 3H3ZA 4NO4A 4PLNA 1AR83 4AI9A 2HBUA 1US3A 3E6DA 1GKBA 4XE9A 1YFYA 1VBA2 2A1XA 2WNUA 1AR72 1PO11 3KQRA 4Y20A 2Q8EA 4NRQA 3ES4A 3N3HA 3KV6A 5JXGA 4K7JA 1IPKA 1Z0HA 2DCKA 3ILFA 1NG0A 1UY4A 2H6CA 4IERA 3CJIA 3AVSA 4CP2A 4LUKA 2DBNA 1BLZA 2XQRA 5IAVA 4I0BA 2RMU3 3DPRB 2CNAA 1F31A 1ALYA 3HR9A 4AR2A 5A1AA 4CDUA 1BHGA 1REDA 3GYDA 3VN4A 5A3NA 5J1XA 1WW5A 1RVF1 2XBO3 1JZ4A 5JWPA 1RUC2 5A3MA 5CAZA 3KB5A 4V1PA 4QGMA 3VD3A 1W39A 3OGSA 5IVVA 2ET1A 1ZBE3 1SDWA 4GMP0 4M0HA 1RUF2 4WM8B 1QJX3 4YW3A 4CCNA 5IWFA 2VZOA 1CPMA 2RS13 2PLV1 3ZYRA 3PIJA 1COV3 5C3RA 5KHGA 3MIFA 3DGTA 4OMCA 3J4UH 5F1RA 5JAXA 1PO13 3N35A 2BERA 4BA6A 1RUH2 3IZOA 4CEWB 5GZEA 1NY71 1BBT2 4KQ7A 1EAH2 4AHWA 4LO5B 5FQ0A 1SG3A 3C3VA 2VCAA 3EJKA 4E9KA 5AVPA 5C4WB 2HWF3 3RYKA 3ZXLA 1TNFA 1QKQA 1WCDJ 4MYEA 4TLFA 3IAPA 3O1UA 3IIIA 1LECA 1ZX5A 3MIDA 5LASA 3UYJA 5DMYA 5L9RA 1C8NA 4K1ZA 4WM7B 3RYPA 1OVPA 5DUVA 3KT4A 1AJOA 5HCBA 3M2MA 3P5BA 3LEMA 4JC1A 4DY3A 3JD72 4XTPA 4NIHA 1OMIA 4IE7A 3ZFFB 4PQ9A 3UETA 1XE0A 1AR61 3WDYA 2EIEA 1RB8G 3KHBA 1DYKA 3ZR6A 3I59B 2ZEYA 3OEAA 1U5YA 2Q4SA 1FXZA 3LA3A 1FT9A 2TUNA 3PIGA 2IUWA 1OXCA 3POBA 5BNOB 4Q4V2 5T5OA 3B5LB 5DG1A 3VKMA 2ADDA 2O14A 2BGCA 2Y26A 4XUPA 5FYCA 3T3YA 1PM7A 4H14A 5C9AB 1ACCA 5GZFA 5TSWA 1W9YA 1QH7A 1IOAA 2XUEA 1YI9A 1KDMA 2XL9A 1XSQA 4HONA 4HZFA 3U78A 4Q5OA 2VNVA 4RS5B 1LAJA 2P6CA 4P9WA 1IG3A 1XC6A 2XQXA 2A3YA 2G19A 3LGRA 4LKDA 1RXFA 3LOIA 4Q4W2 1N1SA 2OVUA 1ASJ2 4MGYE 3POEA 1B35C 1PGW1 2VMGA 4LLFA 1W04A 2Y6HA 5F6KA 5FZLA 3WW4A 1XNCA 4PI0A 4KMQA 2D44A 4R9CA 3SNMA 1KS5A 2ZZQA 4CP1A 4L8QA 2XR4A 3S7EA 1GYKA 1EUTA 1ND3C 5FYMA 1E5SA 4B4PA 1GSLA 2CSGA 3LDRA 3AP5A 2H0VA 2EIGA 4KG0A 1H8VA 3M70A 4O9GA 5ABJC 3W5MA 3WLUA 4BIOA 3GZEA 1W6NB 4QD2A 2RS53 1FMD2 2HWD3 5JOXA 5APAA 3WF2A 4CPBD 2AH2A 4GD4A 3N7MA 3UKNA 1UMIA 3W20A 5GZCA 3DKQA 2YXSA 4L2NA 1ND3A 1IKQA 1XPWA 1MS8A 3AKSA 4AHXA 4CSWA 4JHTA 4ES9A 3H7YA 4DINB 4MGIE 1MEC2
chains in the Genus database with same CATH topology
2VGDA 4CDXA 1AXKA 4LA3A 5BY5A 3OY8B 2ZMLA 3RMYA 5CFCC 3ZXFA 4LO7A 5HBAA 2VVDA 1VBA3 4XETA 1AR73 5LK5A 1FOD1 4D3WA 4KG8A 5GLWA 5CBLA 4LBQD 1DF0A 2YZ4A 3IIAA 5FFOC 3PVBB 2BNOA 3B9CA 1XE7A 1OLQA 4LHKA 1G9FA 4FXKB 4OI4A 4F8AA 5CFCA 1SACA 3GZAA 4INDA 4NWVA 4WVMA 4LE3A 4FPLA 1RUC3 4TSVA 1VBC2 5DUUA 4AEDB 1QNYA 3V0AA 1NCRC 4XZPA 1RUF3 3KGLA 1CAWB 2VOXA 3O0XA 5EWSA 4PCRA 1WW7A 5KC5A 1YYNA 2MNGA 4KWJA 1AZDA 4XFFA 1RUH3 4YM3A 2BQPA 4CZSA 1R1ZA 4UW4A 4AEJA 1EAH3 3KZ4C 2P3KA 5D8AC 1IPJA 4AI0A 2GMMA 1UPIA 3ASIA 4UXAA 5FLIA 3GZTB 2ZBJA 4RD7A 4QX5A 2ZAAA 1H8TC 1KXGA 4JAAA 3ZYIB 1WMDA 4CEYA 1UAIA 1BEV2 2E7AA 3JD73 5T3NA 1HDKA 2ZCWA 3FBMA 5D8AA 3ZPYA 1AL21 2XPJA 3FC0A 4Q4X2 4C90A 5E89A 4K3UA 3NJZA 2FMDA 3KM5A 4FP2A 3MW4A 3DL3A 5LRSA 3LA2A 1M4WA 4Q4V3 4Q29A 2IXIA 2WNUB 2WSVA 1DHKB 4AFBA 5IK8A 2TNFA 5A32B 5FMOL 3CJIB 3AMPA 2CAUA 5BNQA 5JOZA 4MGZE 1JXNA 1WMFA 1QQP2 3AZXA 4Q4W3 4CDUB 1ZZ9A 4AI3A 1J1LA 5LK7B 4M01A 1AVBA 1AXZA 4DXZA 2DV9A 3THPA 3WR0A 2ZGRA 3THTA 5E88A 2ILMA 3LOBA 1RHI1 4Y1VA 2EAKA 1CONA 2O8QA 1PK6A 1PO21 2DCZA 1NA1A 1A8DA 4I0AA 2R1DA 3SLIA 1QJY2 4RHV1 1X8MA 1ENXA 4ZKTB 2CAVA 4OHVA 5E8AA 1QOTA 1HRI2 1RUE1 4AFDA 4CP0A 3HQXA 1RMU1 5FQ0B 1N1YA 2SLIA 4NVPA 3ZFGC 3BODA 1S0BA 3VGIA 1LOBA 3HWJA 4C1XA 1MZEA 2YC0A 2A71A 4GALA 1W0PA 3MF6A 1SBEA 1I3HA 2A3WA 2LUWA 3AXEA 1DQ1A 1MACA 1OD5A 1TME2 3M3QA 1RL3A 5I0UA 4LBQA 3WQ7A 4XTMA 5FO7B 3ZXAC 2XLFA 1UPSA 4JTNA 4UBHA 3V0BA 2OYZA 2B5HA 4NPRA 5JOYA 3USSA 2Q1MA 3QLQA 1JYIA 5CIRA 2XVLA 1WCKA 2DFBA 3VBHA 4YZ2A 3RQ0A 1LEDA 1VRH2 1QGLA 4R9AA 4AVCA 2ATFA 3ZYJB 4IESA 3NSTA 1IQAA 1LHWA 4CYDA 4YM2A 3P3PA 1LU2A 3LAGA 1XYOA 4HL0A 2NN8A 2B7YA 2QCSB 5T55A 3H7JA 2QZ2A 4PIXA 4P9YA 4Q4X1 3H9AA 1SCRA 1VBD1 3MZHA 4PIZA 2P3IA 4E2GA 2WLPA 1GNHA 1S1AA 5DDJ2 1ZRFA 2D6KA 2O8OA 1AJKA 1HV1A 4Z2WA 3TN92 2GH8A 2WNVC 1DGWA 3OF1A 3ZVXA 1OA2A 4GB31 3NWKA 3K51A 4FCAA 1QXJA 1LJ7A 4L97A 4GKYA 1D4M2 2PHTA 2GZWA 3RPQA 3NV3A 5T5PA 4Y1UA 2JICA 3BCWA 2PELA 1XXNA 2UURA 1ND3B 1VAMA 1UL9A 2VMIA 1ZNPA 2QDRA 2ZGLA 3ENRA 4Q4X3 3R05A 3U4XA 1QDCA 3TOJA 4U36A 2HWB2 5DUXA 1AX0A 4JRLA 4TWTA 2C5DA 2IXCA 3DKWA 4AGRA 4A7ZA 4WZCA 2WS91 1CPNA 4GB33 5J7MA 2E7TA 3AZZA 2ARXA 1KITA 1TE1B 4B4RA 3ZDSA 1D2QA 3JQXA 4FBFA 3ZO0B 5GJ6A 3IDCB 1ZZ7A 4E2SA 2OIIA 4XF4A 5CFCB 2GNMA 4BYYA 4N9HA 5HCFA 4M3CA 2JD4A 2BYVE 2QVSB 3W9AA 1ENRA 3OBRA 4K1YA 3V0AB 1CN1A 1RC6A 2A75A 2X5IC 1YFUA 1ZBA2 5FRAA 3R4UA 2CWSA 1EV12 2YGLA 5HI0A 3O14A 2ZGUA 3FUQA 3JB8A 4JRAA 1U0AA 2PTMA 1XU1A 2RS32 4MH0E 4LHNA 3A4UA 3AK0A 5I0RA 3I8TA 4OUMA 4LT5A 1DIWA 2X5IA 4P9IA 5K9YA 5F6LB 1D4VB 2DU0A 1X82A 3MICA 2OA2A 4S2DA 2FBEA 1W6OB 1DQ0A 1XNBA 1LOFC 4ZXKA 3TNQA 1TME3 4L99A 3OTFA 4HN1A 2I2SA 2I45A 4AXOA 4FTBA 1FAYA 4XBLA 4XQ4A 3L2HA 5D8AB 2VOVA 2HEYF 4FQZA 4IV1C 4LBKA 4RSUA 1H8TB 1VRH3 3NVCA 4META 2GNDA 3ZX7A 4OHZA 1SBFA 3MPPG 4G3YC 4XQDA 3E6BA 1MR5A 4RQPC 2LALA 2WZR2 3FFQA 1HRV1 3CJXA 4IV1A 1BXHA 4ZU4A 4Z8BA 5C8CC 2DUOA 1QHDA 3ZFFA 3JBG2 3ZSJA 5AVAA 3JU9A 1LR5A 4K9SA 3I59A 3SH4A 2JENA 4N53C 4QPGC 4GWMA 3TN93 5I0TA 2ES3A 4RR3C 4RQPA 2GU9A 1LOEA 1NA1B 4A7YA 3D0SA 4IEPA 2DCJA 2D5FA 2VOWA 5J96B 4X8NA 1C5IA 3B69A 1RGSA 2WC2A 4RS5A 3WINE 2CTVA 2ZHLA 4CTEA 4YVWC 1ZYBA 4N53A 4MUVA 3ZSEA 1OI6A 1RTVA 4KBBA 1DGWX 2AGSA 2VQAA 3JQWA 3UL2A 1HRV3 3AP4A 4XPVA 3V64A 4MX3A 5L36A 3AM2A 4RR3A 1IS5A 2RR12 2FZ1A 4D7YA 2MEV2 1TMF1 4K21A 5E1RA 4YFWA 3IWZA 3QD6A 4UW3A 3RNSA 2VW0A 3PJYA 4LBQB 1EV11 4XXPA 3VBSC 1QJU1 2HWB3 4YVWA 5BV6A 5I8YA 3V0BB 1QJZA 1WD3A 1I9RA 1QOSA 3MGUA 1W6NA 3ZFGB 5AFEA 4ORFA 4LLOA 4EWAA 1G9BA 3WCSA 5DZGA 1CGPA 2DUPA 4WVWA 1YFXA 3MI8A 2R062 2QE3A 3I7DA 5JIAA 3FHIB 3D0JA 4MGKE 3IBMA 3WHUA 3VBSA 4PDWA 2P37A 4XHBA 4MSVA 5KXDA 2HWC1 3H3UA 3AKPA 4GA9A 4I3GA 3D6EA 4Q26A 2PHRA 1LTEA 3MYXA 1I1EA 3POWA 3C2UA 3PTYA 3B9IA 4ATEA 3EBRA 2RM22 1EV13 4Z82A 3OD4A 3H8UA 3MLKA 3AMMA 2RS33 3HT2A 3WD5A 4MZUA 3BOWA 2VW1A 3B3QE 4XIOA 1SMVA 2HKXA 4ISRA 4P9JA 3WP3A 5GZGA 3WW2A 1OA4A 1Y3TA 1HXS1 5KHKA 2C9AA 3AKTA 2BNMA 1NLRA 1ZRDA 1RUOA 4N90A 1RUJ2 5ACA2 1CAUA 1R081 1SLIA 1MS4A 1ZZCA 3FE5A 1AR81 1LULA 3WX5A 5J09A 1KDKA 3POSA 1S0CA 3B01A 1ZRCA 3WUCA 3AYEA 4B3NA 2IC1A 3LA7A 3IDEA 3M8LA 4NHLA 4CDQC 4Z1VA 3PVOA 4AQ6A 1O5UA 3GZUC 3RS6A 2R071 4MLOA 5EZWA 4S2GA 4UBGA 2RMU1 1XE8A 2QDNA 2QKDA 2RJLA 4DFSA 3KGZA 1BZWA 1N3OA 2XBO1 5FO8B 2WZR3 5JI7A 5CADA 3VZOA 2NQYA 4AYUA 3ECQA 3MFAA 5L19A 2AREA 3R4DB 3JBG3 1T6GC 4FO9A 3WG2A 2DCTA 2GALA 2A6VA 4CDQA 1ZBE1 2ET7A 4M3CB 1WUVA 3ELNA 3E6CC 2RS11 1COV1 2XJVA 4LO4B 1LHVA 4E4SA 4MV2A 3ZXJA 2GNTA 4HETA 2ENRA 4URTA 2D3RA 3B93A 5J37A 2XGXA 5A32A 1PIV1 3OCPA 2GC1A 1RJ8A 2R073 2UY9A 3UKVA 2ERFA 2HWF1 2NM1A 4G4FA 5GALA 4EWDA 3MIBA 4KU7A 4DQAA 4XIKA 4D7TA 4AFAA 3NKTA 4AW7A 1G6NA 2X5IB 3VLBB 4TZDA 2WQZC 3O7OA 2RR13 4HN0A 4XMIA 4ASLA 4NWWA 4XF3A 4IQPA 2W68A 3WUDA 1CD3G 1YWKA 4FPEA 1SEFA 4COZA 4YRDA 5GZDA 4NHMA 5DZFA 4RL7A 5FCCA 2VOKA 4MVTA 2ZGTA 3TWIA 3JUUA 1BQPA 5AC92 1PIV3 4YGBA 2WT1A 4TYSA 4IEXA 4BIFA 4D69A 3WG3A 2EALA 2KXLA 2R063 2UYAA 5JZGC 1C8M1 3DF0A 3B02A 4Q27A 3J8F1 4YW1A 1O3QA 4EN8B 2D6PA 4FPYA 1TEIA 3RDIA 1R1A1 3AB0A 1EYBA 1GQHA 5EXOA 4KGQA 2HWE1 3LSDA 4IV1B 3TYJA 2E51A 5JZGA 4XFHA 2ZHNA 2PHLA 1G86A 1JHNA 1N3PA 2YYOA 4OUSA 4XJ8A 4Q2FA 1LGBA 1Z7S2 2GDFA 3AP7A 5I8TA 2D6NA 4XMAA 3HIFA 1W0OA 1URXA 4RQPB 2D5HA 2RS51 2HWD1 2O1QA 4JGYC 4HK8A 1C8M3 1SQ4A 5C8CB 4K6BA 3J8F3 3ZXDA 1OFSA 3SH5A 2JXAA 1OPMA 2WL1A 4FOQA 2XVKA 4FAHA 4XDQA 3ZSKA 1R1A3 4N53B 4DPNA 1DLLA 3W59A 1JN2P 4QPGB 4YM1A 1GZCA 1RUJ3 4J6GA 5ACA3 4Q0UA 2HWE3 3VBOC 4AG4A 1A3KA 4RR3B 1H1MA 1Q8VA 2E9QA 1VBA1 2VVEA 4HSJA 4LBLA 1AR71 2BVBA 1LB2A 3O5SA 5GLZA 2OZJA 3BIWE 1AXYA 2A7AA 1D2SA 2WWSA 3O0VA 4YVWB 3HT1A 2BUKA 4JDOA 1B35A 3HN1A 3VHRA 4YARA 4MXVA 3UJQA 4BMBA 4ASMB 4GXLA 1RUC1 1YJLA 4YGDA 4XF0A 1Y7BA 3VBSB 1V70A 1RUF1 4PIYA 1RITA 5ABJA 3E5UA 3M3IA 1NXMA 1AR92 1W6QA 2WSUA 1VBE2 1Q56A 2UU8A 1RUH1 1WBLA 1BBT1 1EAH1 4BH9A 3KD4A 3GBFA 2XL7A 1UU5A 5H9RA 5K8SA 3URFA 2WZPP 2Y0OA 3SISA 3GF6A 4I09A 4JTOA 5CFDC 3IKWA 3U0ZA 1MS1A 4EV0A 2X29A 1H0BA 3H1MA 4R4ZA 1AL0G 1ULDA 1AX1A 3ATGA 2ZJCA 4DB5A 1YCIA 3JD71 5GKAC 1QMJA 4FTEA 1ENQA 2W0XA 3NV1A 1JUIA 3ZIXA 3RMXA 4KH9A 1N1TA 1CAUB 3B00A 3VZNA 1AHSA 2PHWA 5CA6A 3QACA 1GANA 3TNPB 4Q4V1 1BBT3 3N7JA 5I0SA 2XUMA 4FVVA 4Q4Y2 3AJZA 2EXHA 1FNZA 1NCRA 1ONAA 3IT8A 4GH4C 4Q8LA 1VIWB 3VHPA 1BKZA 1QOOA 3SHRA 1V6LA 2UYBA 1H1AA 1APNA 1W6OA 4DOUA 1VR3A 1YUDA 1V6NA 3K48A 1XQNA 4Q4W1 4N7UA 1YLLA 1ASJ1 1V6OA 3RI8A 2WLQA 1G8WA 1EPWA 1EPZA 1J3RA 3H0OA 3UK9A 2BPA2 2D6LX 4CDQB 4GH4A 1H8TA 1Z7S3 4EN6B 1BVP1 2XWBB 4AK3A 4D7SA 4ES8A 4FSJA 4K20A 3SMHA 1FMD1 4RGAA 3B94A 2BFUL 3CL1A 4NHKA 1H30A 4YZ3A 3WP6A 1SBDA 1OKQA 5FTTC 1O5LA 4XQWA 2NYYA 1MEC1 1ASJ3 2JE7A 4JVAA 4XILA 5SV5A 4HVRA 3WDTA 3WOGA 3N4MA 3LWCA 3RRDA 3E97A 4GKXA 2CWMA 4IL7A 2R0HA 1GFF2 2RJKA 4IEWA 5DZEA 3QBQA 3LCPA 4Q0SA 4AVVA 4FPOB 2EAAA 3MW2A 5JVVA 2R1BA 3U11A 1AYN2 1FX5A 1FMD3 1GNZA 2A6XA 2PHXA 2D40A 5T50A 4YGEA 3UV9A 4ITCA 3FLPA 4LO6B 1VBC1 2PYTA 2UWAA 1MEC3 4AVBA 1PHMA 4PDWB 2C1FA 1ZZ6A 2G9GA 1H9WA 4AWDA 5CNAA 1DBNA 1AR93 5JCTA 4LO8A 1XNDA 4QT6A 1VBE3 3O12A 2ZABA 3DV8A 3CNAA 3ZFGA 2VU9A 1SLCA 4I02A 5JZGB 2JX9A 2IFWA 1AYM2 2W08A 2GSYA 4Q1RA 1ND2C 1DQ5A 1S2BA 3JB4C 4KL1A 4GULA 4M00A 4BZ4A 4LR4A 4FPJA 3IN9A 1VBC3 1BEV1 1KQRA 3WDVA 2OUHA 3MEPA 2AUYA 1PMIA 2OW4A 2CL2A 4X6QB 1CQ9A 3WDXA 3NO8A 3OD0A 4QM8A 4DRRA 1M06G 1HQWA 3I54A 1ND2A 2R042 2I07B 1NQJA 3OPZA 3ACLA 3MIEA 2PHUA 3NL1A 4WVZA 4IETA 4RA0A 4HKLA 4R8HA 3T1LA 4Y26A 4B8EA 3KT1A 4JGYB 4Q4Y3 1FPN2 1Q8QA 2TEPA 1Q8PA 1UZYA 1CJDA 3LKJA 2K2SA 2DWRA 3QCWA 1MZ6A 1B35B 4O9EA 3ZYGA 1QQP1 3VBOB 1BEV3 1KJRA 1JTZX 2DVAA 2VUJA 2XJQA 3M4FA 2WNVA 2XB6C 2B9UA 4AQTA 2ZX3A 3S30A 1RUNA 1ZM1A 1MS0A 2DYCA 4AEKA 2WFPA 1GLHA 1V9U2 5A33A 1DYPA 1S2KA 2DVBA 3AJYA 5ABJB 4E2QA 1SLTA 2GMEA 3VBFC 4XBNA 1HX6A 1QJY1 1SCSA 1W6QB 3GALA 4COVA 1LENA 4FPHA 1OOPC 1HRI1 1GV9A 1UU6A 1FNYA 4C1WA 4LBNA 1R092 4AI1A 2B8MA 3DN7A 1IGOA 5IUQA 4FPFA 4XBQA 4NR1A 1QQP3 1O91A 2AR6A 3LSEA 5DG2A 2DFCA 5JSRA 5CB7A 3ZN5A 1UCXA 3VBFA 4CRQA 5H9QA 1ZA4A 1TME1 1MS9A 1OOPA 1VBB2 5EFUA 2A5ZA 1GZ9A 4Q0PA 2AENA 5L7OC 4XJUA 1WW4A 4YYOA 1S55A 1S0FA 1PVC2 1IS3A 5JLVA 4OHYA 1UF2C 1QJY3 3OBTA 4YG0A 2WIIB 5T54A 3BALA 1Q5OA 1V6IA 1DU3D 5CFDB 1HRI3 1RUD2 1VRH1 4YG6A 4ISQA 3R6SA 5T5LA 1FI2A 1WCSA 3X29B 1I6XA 1NCRB 5LRRA 5LEKA 1Y43B 4K8FA 2GH2A 2ZACA 3QH7A 5SV8A 4P9GA 1IS4A 1POV1 4UW6A 1JH5A 2GNBA 1RINA 1RUI2 4HKWA 1DZTA 5FBZA 2ZA9A 5E16A 2YY1A 3KCXA 2DVDA 5DDJ1 4B4QA 1GZWA 2ZAHA 3TN91 4G9SB 4OHXA 3VKOA 1NQDA 4Y1XA 1AYM3 4GH4B 4LEJA 4JGZC 2D3PA 5F5QA 3GNEA 5H9PA 1LOFA 2H6BA 1V6JA 2D43A 3AMQA 3OGJA 3PMSA 3ROUA 3VDDC 5KWRA 1D4M1 4A3XA 4I01A 3G6JB 1F2NA 1VAVA 4IV3C 1BMV2 1POV3 5BPXA 2Q5TA 3D5OA 4JGZA 2SBAA 2EF6A 2HJIA 4YNIA 1RJ7A 3ILNA 3IDBB 2R6QA 5KXBA 2ZMKA 4P14A 5DDJ3 5BNNC 1ULGA 2F6BA 2HWB1 3RYRA 1FPN3 1LEMA 4IV3A 1L3JA 4DS0A 1J1TA 3JZVA 3ZMNA 5JPMB 2XLGA 3NAPC 3KLSA 4M3CE 3ME2A 3ST7A 5C8CA 4N9IA 1SFYA 1D4M3 3VZKA 2PQQA 1C1FA 1SLLA 5T5JA 3VBRC 3WG1A 2NMNA 4QPGA 5GLUA 4ONUA 1S0GA 1HV0A 5BNNA 2WJSA 2JG9C 2A6WA 1RUG2 2QFEA 1PGL2 3WHTA 1X33A 2NMOA 3M3EA 1TQ5A 5CG9A 1S0DA 4JV4A 3AZWA 1V9U3 2CYFA 4OULA 2CGOA 2WT2A 3NAPA 1WA4A 1ZBA1 4BE3A 4KNCA 3CEWA 1NYWA 3FWEA 3WQ1A 2AZ5A 3SH3A 2QZ3A 5CVRA 4J1XA 4MXWA 3OYWA 2RS31 4XJWA 2JG9A 1LOCA 4YVSC 4P5HA 2BVVA 2D3SA 2V73A 3Q9OA 4XFGA 5J48A 1O4TA 4H7MA 1CESA 3IPVA 2ZZJA 5CU1A 3ZXKA 3USUA 5C6CA 5FPXA 1MZ5A 1GBGA 4I3PA 1QJX2 4LTAA 1SFNA 2BNNA 5KC6A 1VBB3 2VXRA 4RFT0 3E5XA 5IK4A 1DGRA 3GHMA 1PO12 2O0OA 2CY6A 4YVSA 1UKGA 1ZBA3 3QH6A 2ZOEB 3TB0A 1ND2B 2IWGB 1E57A 4QGLA 2Q8OA 1G9DA 1JW6A 1IHMA 3HMYA 2ZX1A 3U07A 1FV2A 3MPBA 2VG9A 1DQ4A 1DGRN 1RUD3 2WA4A 5JI9A 1H1IA 4P9LA 2Q0AA 2ZPXA 3SITA 1RVF2 1NE4A 4AI8A 2PFWA 1CJPA 3VKNA 2UY8A 1Q8SA 4M0NA 1BCXA 2WZR1 4AHYA 3M7AA 4L9BA 1H2LA 3JBG1 4Q0QA 2PLV2 4ZU5A 5FMOS 1RUI3 3ZN6B 1AX2A 3EQEA 2VNGA 3FBYA 1OQEA 2WNVB 2XHKA 3VKLA 1C3HA 4YW5A 5J3UA 1NY72 3BOPA 4QQOA 4YLZA 1LGNA 3ZFEC 1LOAA 5A33B 4Y22B 2G9FA 2JG8C 5J36A 2QNKA 2QJVA 1MS3A 1NE6A 2NLRA 1WLWA 3MF9A 1UW8A 3A0NA 3ZMOA 1NLSA 1LHNA 3U10A 2E6VA 2JG8A 5FO9B 2IXKA 1AR62 1O3SA 2RR11 4EN7B 1FYUA 4F83A 4XF1A 3VBFB 2MEV1 1F5JA 2DTWA 4B7EA 5JSPA 2XWJB 3MLJA 2DVFA 1OOPB 3ZXEA 4B29A 4Q8KA 1PVXA 4KWKA 2ZKLA 2N7GA 5JR7B 4Y24A 4Z07A 3VZMA 5FREA 2IXHA 2OPKA 4OFGA 3RI9A 1VJ2A 2K0GA 2VVFA 1PNFA 2B45X 2EXJA 2XVGA 5FPZA 1OA3A 2R061 1W6MB 1J58A