3AKSA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords xylanase
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
total genus 55
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aksA00
1QH6A 1UU6A 1XYNA 1UKRA 3WXPA 1NLRA 2VULA 3LB9A 3VL9A 4NPRA 3MF9A 3VHNA 3AKRA 2DFCA 1C5IA 2C1FA 1BK1A 1OA2A 3MFCA 4S2GA 1REFA 2B42B 3O7OA 4S2DA 1HV1A 4XQ4A 3VL8A 3VZNA 2VUJA 1H0BA 1ENXA 2QZ3A 2D97A 3VZJA 3VGIA 2BVVA 1UU4A 2DCZA 2Z79A 3RI9A 2F6BA 4HKLA 1TE1B 2JICA 3B7MA 1IGOA 1BVVA 1QH7A 2VGDA 1HV0A 2NLRA 4XQWA 2DFBA 1BCXA 4HKWA 4HK8A 2BW8A 3WQ0A 1C5HA 2VG9A 3B5LB 3ZSEA 1KS4A 1XYPA 3AMNA 1AXKA 4HK9A 2JENA 5HXVA 1OA4A 3WP3A 3WR0A 1YNAA 1H1AA 3EXUA 3MFAA 1UU5A 3VZLA 1REEA 3VHPA 5EJ3A 2JEMA 1OLQA 1XNBA 3WQ1A 3WX5A 4XQDA 1W2UA 3AKQA 4S2FA 3M4FA 3AKPA 3HD8B 3WP6A 1XXNA 1XNCA 4HKOA 1XYOA 2DCKA 3AMMA 1XNDA 3AMHA 2NQYA 1OA3A 1HIXA 5K7PA 2DCYA 3AKTA 3RI8A 2BWCA 3WY6A 1T6GC 4S2HA 3WT3A 4H7MA 3LGRA 1REDA 3WQ7A 1H8VA 3VHOA 2D98A 3WP5A 4IXLA 5K9YA 1M4WA 4XPVA 3VLBB 3WP4A 1XNKA 1OLRA 2B46X 3MF6A 1PVXA 3AMQA 1KS5A 1H4GA 1H4HA 3VZKA 2DCJA 3VZMA 3AMPA 2QZ2A 1F5JA 3AKSA 2BWAA 2B45X 3VZOA
chains in the Genus database with same CATH superfamily
3WUDA 1UKRA 2PHFA 3BUCA 4XTPA 4XFIA 2RJKA 3LIHA 1DYKA 5DZFA 2VC9A 2NMOA 2OUJA 1WKYA 1NXD1 2YY1A 2Q8CA 1AL22 3ECQA 3SCFA 4YZ2A 4GAZA 1AUYA 1S2KA 3UKTA 1DIWA 1UMIA 1NQJA 5LATA 4YGDA 2KD7A 3WW1A 2A7AA 3RFRA 1RUD3 3DUIA 4X6RB 4J25A 1MQTC 1H2KA 2ZGPA 1PHMA 3GHNA 4LK6A 1G7YA 1W0OA 2WZ8A 2QQVA 2B5HA 3NJYA 1AYN1 1AX2A 2RR12 5C3RA 1FXZA 4D8MA 5FYSA 5FY9A 1D4M1 2WNVB 5FXVA 4G4FA 3B7MA 4NWWA 3A4UA 4DO0A 4HLTA 2EA7A 4OMDA 1SACA 3VUOA 4M3CF 1CJDA 5I0DA 5BNQA 2VGDA 3NJXA 4ZU5A 3RZGA 1YJKA 4A3ZA 2HWF1 4MO3M 1POV3 3ZFGB 2XJUA 2XL7A 2JD9A 3SLIA 4AZZA 1OURA 1K5MB 2C6SA 2WLPA 3JB4C 4C8DA 5F37A 2DWRA 5IW0A 2R062 3NAPB 1BKZA 4PF5A 1JZ7A 1UZWA 1WWYA 4CCKA 1XYPA 1VBE2 4XOGA 2ZAAA 5ABJB 4CPBD 2ZKLA 4WVMA 5JI9A 1G6NA 4Y5TA 3T2TA 3FL7A 2JDUA 1OA4A 3WP3A 1GWMA 3MUY1 3VBUB 1SFNA 3HBZA 4LA2A 3WOGA 2VUCA 1AYN3 2TBVA 5FOBB 2OKXA 3WDTA 1BBT2 4BIFA 3CBNA 1D4M3 2P34A 2SLIA 1YO8A 3H3LA 4HPKA 4R4ZA 1Q8OA 1C1FA 3ATGA 5FYMA 5JMCA 4QXKA 2F4LA 3PL0A 2VOKA 3QACA 4RN5A 1ZZ8A 3G6JB 2HWF3 4Q27A 1UOGA 3CU7A 2PHTA 2VBPA 1NT0A 2G9GA 3D8CA 4CCCA 5AFEA 1BEV1 1PMJX 1C57A 1HIXA 2DCYA 3AKTA 2IXCA 3SH4A 4CCMA 4D7TA 1UYYA 2PFWA 2JWPA 5JDBA 5A33A 1T6GC 1JZ3A 1RUD2 1ZRDA 4O9EA 2WWSA 3T1LA 5K0UC 2D6MA 3GZTB 1UL9A 2ATFA 3NRUA 2E7QA 4H7MA 2C9KA 3LGRA 1GOGA 1VIWB 2UWCA 3OB8A 4JCKA 4RL7A 4YVSB 5A7NA 2IXKA 1OQEA 2A1XA 4HVRA 3SCHA 2BPA2 1H9WA 2WR9A 1TG7A 4IXLA 1ZZCA 2ZMNA 1AYM2 1WMDA 4KU8A 1UPSA 4XJAA 5BNPB 2N7GA 4L97A 4NPLA 2XXZA 4P00B 4GWMA 1YQ5A 3VBFC 2P3JA 3E6BA 4LEJA 4OHWA 3KV5A 4OMCA 3BTAA 1QJFA 4UW5A 3SHRA 3WDYA 4V2VA 1SBFA 1WCKA 5GALA 4YZ5A 2PQQA 3FHIB 1IS3A 3VZMA 4AI3A 4LO7A 5FQ0A 1ND3B 5B4NA 2B45X 3ZFFC 2WRAA 2YG0A 1UD1A 4AFBA 3W5NA 4NIHA 4JV4A 3SEEA 2XKPA 5FPAA 5GJ6A 2WT2A 3S30A 4YG0A 5CEHA 2PAEA 2G1MA 4COWA 3B00A 3WNLA 3DGTA 3IDCB 1BYHA 3ZPYA 4Q8LA 4LE3A 4H14A 3JD71 4D6QA 2ZMLA 4YYOA 1OKOA 4KH9A 4OUMA 5DG2A 5FY5A 1AYN2 4D0QA 5C9AA 1GFF2 4D94A 1D4M2 1PX3A 1ZYBA 4LO4B 3OPZA 4LBJA 2LM3A 4PF1A 4CDUA 5IYYA 3M3OA 4HXCA 3ZXGA 3VZNA 4QPYA 1ENXA 3VDDB 4A41A 4BWOA 3GCWA 3RI9A 3VD7A 2HWF2 3WHTA 5FXXA 4MYEA 2WDBA 2P3IA 4LULA 3VBHC 1YEWA 4GWNA 4ASMB 4IESA 4N7IA 2JKXA 4EN9B 3LFIA 3O1UA 2WNUC 1WMEA 4XQWA 2W1UA 4XAEA 2D5HA 3I2HA 1S0JA 2W46A 3HOBA 1TNRA 1F35A 3NQHA 2A3YA 5LY2A 4UXAA 3O12A 4N7UA 3ZSEA 3DXUA 1KS4A 1IOAA 1YI7A 5FZMA 1W9YA 3JD73 1UPIA 4JDNA 1W28A 5A6ZA 1POQA 2ZGOA 2SBAA 1AXKA 3LWCA 2JE9A 1XU2A 1OHFA 2X5IB 3O5SA 4JHTA 4DRRA 2R0FA 1MVEA 4J6GA 1RUH2 1LGBA 1W9FA 5JLVA 3J9SA 3J7HA 2VCBA 2HWE1 3SKVA 3VBSC 4HG6B 1UU5A 3ZYHA 1SPPB 1WW5A 4P9JA 1WW6A 3FX3A 2H6BA 4XDPA 4CDQA 1FNYA 4FPKA 1UX7A 3OGJA 1XB9A 1XNBA 2BNMA 4L0PA 5A1LA 5BNOC 5I0RA 5DZGA 1VBC2 5IVFA 4PLOA 4GALA 3T0AA 4YZ1A 3D82A 2CL2A 3ILNA 1BEV2 2HBUA 5H9RA 3AZZA 3KV4A 4OYUA 2ERFA 4RHV1 4WVVA 3RRDA 1JOBA 4XDQA 1XYOA 1D2SA 5JPMB 4CUCA 3W5MA 5FUIA 3GXUA 4XUNA 2LALA 4JGZA 4CXXA 5K7PA 4ES8A 1Y3TA 2VZ3A 4LBQB 2JE8A 3KCXA 1CONA 2J1TA 2Y8KA 3AM2A 2D6LX 2V09A 4B4QA 5L9BA 1NLQA 3K46A 5A7QA 2BBVA 2J1VA 1YFYA 3FUOA 3VBRB 3KT7A 1UZZA 4I0BA 4LUMA 4IE5A 1KRIA 2HWE3 1W6QA 5F6LB 1QDCA 3KF5A 1AX1A 5JSOA 2GC0A 4ZS2A 2VM9A 5J36A 1M4WA 2VPVA 3PMEA 4O61A 4CXYA 2FZ2A 3B3QE 4QB6A 2WNOA 1S2EA 1WUVA 2BGPA 1VBA1 3UESA 4Q1RA 2YB7A 4BOWA 4FAGA 1AJOA 5FZ4A 1U5ZA 3I8TA 3AXEA 4AFCA 4LOTA 1N1TA 2DCJA 4RHV3 2P3YA 4RSUA 1LOBA 2MEV2 4ZPIA 1ZVFA 2R16A 1X8EA 1PNGA 3PVNA 5C3PA 3JD72 5CAZA 2PLV1 4K8RB 3UGGA 3AP9A 5FP3A 4B4RA 2OIIA 2BOIA 1JS9A 2JX9A 4OUEA 1ULPA 4AW7A 2QKDA 2JDAA 4BQ4A 3DL3A 2VMFA 4MZUA 5F5IA 1S0DA 1TZOA 1U12A 1ZX5A 4DS0A 3SQOA 4N53B 5DUWA 1ENQA 4M3CE 1GQGA 4CEYA 3HPNA 2P1BA 2FQPA 2ZOEB 1ULDA 3MLLA 4E4ZA 2YV8A 1Z78A 1VBA3 3TEWA 1QIQA 3APBA 4JC1A 5GZFA 3S6PA 1YFWA 3ZXFA 3UJOA 5KHJA 4GH4A 1PGW1 2JG8A 3S5AA 3QCWA 2VY0A 3WSOA 5A3NA 5FMBA 2CWMA 3FFZA 1AR81 4NHYA 4XC9A 4YLZA 5EP9A 1VBB1 4CU7A 2VQ0A 5EIYB 5FPUA 5FAXA 3T0DA 1J1TA 4AQ6A 1HV0A 4IQPA 4QX5A 1AF9A 3IZOA 4R9CA 1Y9MA 4MGYE 4QM8A 1NUKA 2AEYA 2JDKA 1QNWA 2PLV3 2E7TA 1Q8QA 1HRI1 3S0MA 1C5HA 4L99A 3P6BA 4K7JA 4P02B 1PGSA 2OXBA 4EYUA 4JAAA 1J1LA 1JYXA 4O9GA 4JRLA 3AMNA 1PGL1 4BK5A 4FQZA 2JENA 5HXVA 3T0BA 2VMHA 4FO9A 4LBMA 4YARA 2Y6JA 5A1FA 5FZ0A 2LW8A 5CFDB 1REEA 5I8YA 4FTBA 4LORA 3VHPA 2ARCA 1RJ8A 5FY7A 4UAPA 4RHV2 3I2DA 4LIUA 1Y7BA 1ZRRA 1AR83 4CXWA 1RHI1 1VBB3 5F5QA 3ZKYA 1VPHA 3ZVXA 2JDZA 1HB2A 3LSDA 3VBOA 4CTEA 3TNQA 1RINA 3WP6A 4AI2A 1GZWA 4B1LA 1DFQA 2Z42A 2VMDA 3WCSA 2A70A 1RJ7A 1LHNA 3N4MA 1HRI3 1UY0A 3THTA 2CAVA 1DU3D 1W39A 2QDRA 3D6EA 4BA6A 5KWRA 4RA0A 3WNMA 3PUSA 2YFUA 3LCPA 2RVAA 4HETA 4MVTA 2HEYF 1OD3A 2QCSB 4E2QA 1ODMA 2UYBA 1QOOA 2QQJA 2GC3A 1GP4A 1I5PA 1S0CA 1T2XA 2XQXA 1A8DA 4QD2A 4WBBA 1REDA 4B8EA 1BHGA 1VBA2 4FPLA 4QM9A 3THDA 5CBLA 3FLRA 1MQTB 3DXTA 4ZXEA 5I8TA 2ZPXA 5KHIA 5LA1A 1LCLA 1GZCA 4Z07A 1QY4A 2FDHA 3ZSLA 2WFPA 2EIEA 4GIQA 1Y43B 4IGQA 5A3TA 5HPOA 1KGYA 1OLME 5JXJA 4K6BA 5J1XA 4COUA 1E57A 5FCCA 1GNYA 1HN0A 1KEXA 4IEVA 3GZEA 4NPMA 1RHI3 4DIQA 5C8CA 3ROUA 4TTGA 1G9FA 2PHRA 1CAVA 2EVXA 2PLV2 4COZA 2VCCA 1OKQA 3AYDA 1N3PA 2BGOA 1URXA 2AACA 2XBO2 3BIWE 3FHQA 3H50A 2ORZA 4QQLA 3KGZA 1RL3A 3LE0A 3ZO0B 1RVF1 3P3NA 2O8OA 1NLRA 4IEUA 1Q8VA 1EAH2 4MXWA 4AVCA 4D7SA 4LBKA 1TNFA 2ZGSA 2X8KA 1X9TA 1YIFA 2ZAHA 5H9PA 1MS8A 1XSRA 2WBKA 2XWBB 1AJKA 4Q0VA 5CZKA 2R32A 4S2GA 5J09A 5C9AC 4UFLA 3N7KA 2X10A 2OUHA 1PGW2 2A75A 3POBA 5T50A 2XLFA 3IN9A 1DGRA 4P5HA 1AR82 2DU0A 4CDUC 1ULGA 1VBB2 2QZ3A 1C1LA 3T4HB 1TQ5A 5FO8B 1XRUA 2YMZA 5F8PA 2VXRA 3LEIA 5E16A 1VAMA 3PMSA 4AEDA 1MZ6A 2A5ZA 2ZGMA 5EWSA 1HRI2 2P2KA 5ERLA 4A3XA 2CU5A 2E6VA 3LPGA 4YW7A 1KD7A 4XUOA 3ES4A 4Q2FA 5TSWA 5G05L 3RMXA 3BN6A 2XWJB 3PU8A 3BKZA 1O3TA 1RVF3 1ND2B 3DYMA 1K5JA 1SLCA 1JU3A 1YXWA 2VL4A 4YGCA 3TNPB 4ET7A 3ENRA 1N47A 5LA2A 1XNTA 5DABA 1QJEA 3B5LB 3PNAA 2VXJA 1RUF1 2LTNA 3Q8CA 4MGTA 4BQ2A 2YC4A 3SMHA 2YBPA 1E5SA 5K0UB 4N43B 5T3NA 2XJTA 4JTNA 4IERA 3VKMA 4BQXA 2XJPA 3CDZB 4R4XA 4RGAA 3CZUA 1F9KA 2VTFA 3RDIA 3PU3A 2WC2A 4NHKA 4IEXA 1KQRA 1RHI2 1V70A 3OJBA 4D69A 4YW6A 4LO5B 4CDQC 1VAVA 3BPSA 2ZMKA 5DXDA 4AR2A 3WQ1A 5FWEA 3WHUA 5FZLA 5GZDA 3KF3A 4H2AA 4NRQA 3M4FA 4QAWA 4YW5A 3CHXA 4RD7A 1B35B 3WEZA 4XIKA 3POFA 3R0RA 5LW9A 4Q4W1 1VB2A 4Q4X2 2ES3A 2AR6A 1ZBE2 3KGLA 2B39A 3MW2A 2ARAA 4OLLA 1IPKA 4QX7A 1KFUL 1GP6A 1OA3A 5FP8A 4JGZC 4AI8A 1NY71 2QQKA 4DZGA 1RUF3 3KQ4B 3W21A 2Z5WA 3S57A 2HJIA 5I91A 4KG8A 2FMYA 1HQLA 2J42A 4ATEA 1ZNPA 2JDHA 2VBDA 2P5BA 5FY8A 1MVQA 5FZ9A 2GMEA 3WZ1A 1PO21 1W2OA 1KXGA 2EXJA 1SEFA 2A3WA 4LMFA 2JE7A 2W9XA 4Y1UA 4KU7A 5K9YA 1HKDA 2QQIA 1H9PA 1HW5A 2VE1A 2WT0A 3JQXA 3LSEA 3NO8A 5IAXA 1DYPA 1Q5OA 3AZXA 1ZRCA 3VDCA 5SV5A 2WN3A 1VALA 1ALYA 1DQ6A 1ENSA 1KS5A 1FV3A 2K46A 1DCSA 3OF1A 5EJ1B 1JW6A 4AOCA 1F5JA 3AVSA 4ISRA 3B93A 2EALA 3MDPA 4M4RA 4Q4W3 4ARXA 3H0OA 3KCYA 1J59A 1GSLA 1UMHA 5FK8A 1WCQA 1YCIA 3Q8BA 3SH5A 4YZ4A 1BXHA 1ZZBA 2OZJA 1AHSA 3IIIA 4L92A 3WINE 4QGMA 3ZYPA 2RMU1 3AKRA 3R6SA 5L9RA 4LBNA 3JBG1 1JZ2A 4L9BA 4ZXKA 1O5UA 2ENRA 2O8QA 4AK3A 1PO23 5BY5A 3LD8A 2ZGNA 4CEYC 2DDUA 1UY2A 1G9DA 4YSFA 3VL8A 1EUTA 2RDRA 1PZ9A 2CAUA 2NN8A 4MGKE 3ZMOA 4IV3B 3GZUC 4XJ8A 4AHYA 4FCAA 4BDVB 3K2OA 1WLTA 4GH4C 4CP9B 5BNOB 4XUQA 2XJQA 1RMU1 1ZREA 4WM7B 5F39A 5C5UA 2BV4A 2DUOA 2J1UA 5GZCA 5FY0A 1V00A 3L2HA 1PO11 2VVEA 1RUF2 1VJ2A 4EQVA 4Y20A 4RGGA 3T08A 2BEOA 3USUB 3U4XA 4MG2A 4E8DA 1CZSA 2RMU3 3GYDA 4P9IA 4D6SA 4B7KA 4QQOA 3JBG3 3OBTA 5KXDA 3WQBA 1HX6A 3P5BA 5LZ6A 4HK9A 2GMPA 4J1XA 3EB7A 4RQPB 5LK7B 1VP6A 3J8F1 4CE8A 1D7PM 4LNVA 1JZ6A 5JXGA 3FLPA 2DVDA 1QJY1 3CJIA 5T52A 2EAAA 5A3MA 2WNUA 5IFPA 1RMU3 3ACIA 2Y6LA 4Q4W2 3POJA 5A70A 4IEWA 1HRV1 2P6HA 3H9AA 4YVWA 4FQ4A 1JZ8A 1JYVA 3KHCA 3PUIA 3VBOC 2QQUA 3H3ZA 4GZ9A 4QPIB 1XXNA 5FYCA 1IQDC 1PO13 3D0JA 4FPHA 1U0AA 4MHRA 1M06G 1KFXL 2GNBA 3RYRA 3WG4A 1XJAA 2FCUA 3HBKA 3AP5A 2E51A 5GLWA 4AVVA 2VR4A 1UKGA 3AP4A 4GB31 5T55A 2PHLA 5FYTA 3LKJA 4DEVA 4FXKB 1R082 1HQWA 4M4PA 5FXZA 2JG9A 2VU9A 3MIGA 3W20A 2GC1A 3B9IA 1N1SA 2HWD1 2YGLA 4LTAA 4YG6A 1MACA 3U07A 2D40A 5FMOL 5F3GA 1JXNA 2VAUA 4PDWA 4YPJA 3WQ7A 3DCQA 4P9YA 3TN91 3NWKA 5CADA 5FDBA 3J8F3 2IC1A 5JIAA 2XLAA 1S0GA 3T4VA 1RUG1 1QJY3 3H1WA 1ZRFA 3OY8A 5LCWL 1XNKA 2FBEA 2X09A 1BBT1 3OEBA 1SDWA 2UY8A 4CP1A 5FPXA 4OULA 1HRV3 5FPVA 5JR7B 2DF7A 1OSGA 3ZM8A 5CG9A 2FDJA 3CL1A 1RYYA 1CIWA 1UNBA 3VKLA 4Y22B 4Q4Y1 3N9OA 4B1MA 2RMU2 1NG0A 4W8JA 2Q1FA 2VTXA 4KGGA 2V5DA 1UU6A 3JBG2 5D8AA 1YJLA 3ILFA 4CP2A 5JAXA 5L7OA 1YUDA 2WO7A 2JDNA 4GB33 4W6XA 4YM1A 1IG3A 1N1YA 4HT1T 3AJZA 3VL9A 1TVGA 1EP0A 1OT5A 1OPOA 2HWD3 4JRAA 1PZ8A 1JMUB 5E6HA 1SBEA 1LNSA 1OA2A 3TN93 4WVMB 1PK6A 4IUGA 3B02A 1F2NA 1XQNA 2G4IA 2XHKA 2IVJA 2C4XA 1RUG3 1GZ9A 4XCBA 1RMU2 3H3UA 1A34A 1QU0A 1AYM1 1VRH1 2DVAA 1BBT3 2PMWB 1UCXA 2J1AA 3LA3A 3VZJA 1RUI1 3HT1A 1HJFA 2HWB1 3POWA 4OUSA 3U10A 2QBXA 5A3OA 1PO12 3PDQA 3ZIWA 4YWAA 4HPKB 5CKMA 4AEDC 4BPZA 4NWVA 1OOPA 1V0AA 2BYVE 4QQPA 5HCAA 3EO6A 4CCJA 4UF0A 1W6MA 4Q4Y3 1ST8A 1HXS1 4FPFA 2Q1MA 4WVWA 4HK8A 4SBVA 5C8WA 1F8VA 4PQ9A 1L7RA 1YFXA 4MOAA 2DCTA 2AENA 5E8AA 3U75A 1NE4A 3ZFEA 2VD7A 3J8F2 3JB8A 3N9NA 2Y6HA 4TLGA 3ZXJA 4E9KA 5CU1A 2ARXA 4CEWA 3KVBA 5A33B 3V0AA 1UQXA 1QJY2 4D7YA 4W50A 1TEIA 1RUJ1 4FFIA 2CNAA 3ZXDA 1AYM3 1VRH3 4MGIE 1NZIA 1HRV2 4Y26A 3ZSKA 2JEMA 5FMDA 4RYDA 1RUI3 1K45A 4UFIA 2HWB3 1L3JA 4KBBA 1AXZA 1JYCA 4M0HA 5A7WA 1JOJA 3PHMA 3ZYJB 1LHOA 3MO4A 2H6CA 2VQTA 3V0BB 3VKOA 4FP2A 4RFT0 5FZKA 4GB32 1HXS3 1W8UA 4N9HA 5FQ0B 3KM5A 1RB8G 2VH9A 2VW2A 2JIJA 2Y0OA 4FT8A 2HWD2 4FTEA 4YGEA 3IMNA 3OGSA 4GWJA 1QF3A 2WO3A 3TN92 3UL2A 3ZR6A 4CU8A 2BWCA 1CZTA 3FZ3A 3BCWA 1RUG2 1N3OA 1O4TA 4TN7A 4MADA 2GH2A 1W99A 4I3GA 4QX2A 2D7FA 1V6LA 3O0VA 1RUH1 1IG0A 2D43A 4XXPA 1RUJ3 1QQP1 4HFSA 1W6NA 3NMBA 3QH6A 2LROA 3O1VA 3ZXAC 1LOCA 2VZSA 1RUE1 2QE3A 2O14A 4GMP0 1ZBA1 4Q4Y2 1O3SA 1SG3A 1VBC1 2IWGB 3AMQA 5DAQA 5J37A 2AYHA 2V73A 2XJRA 5CNAA 3OYWB 3AL5A 2W68A 3PVBB 1W8FA 1QWRA 1GICA 2DUQA 2W0XA 3RMYA 3BIEA 1YI9A 2GSYA 4EN6B 2FDIA 1NCQB 3WG3A 1UYXA 1JODA 4LBQD 4NHMA 2WLQA 2P4EA 3SNMA 1ONAA 3ON7A 1AZDA 1V9U1 4V2WA 4I01A 3PTYA 4XACA 4ZONA 2IXLA 2DU1A 2Q5TA 4OI1A 1VRH2 1BK1A 3C7GA 3U78A 3V65A 5FUNA 5JXHA 1RUH3 3K77A 1RUI2 2JDMA 2PN5A 2XR4A 1QQP3 3KQRA 2H0VA 2HWB2 1CAXA 2P37A 3L2YA 1GQHA 3O7OA 4QHBA 1DLLA 3LFMA 3NV2A 3HQRA 3JCIA 3BTZA 1RUE3 4QX8A 5D1IA 3CKHA 1SLLA 1ZBA3 4EWDA 4LQRA 5CG8A 2F6BA 1HXS2 3T30A 1SQ4A 2ADEA 1VBC3 4YNIA 3RSJA 4KL1A 1BEV3 4RS5A 3RNSA 1PIV1 3A22A 3ZDSA 4QPGA 2UY9A 2MEV1 4BK4A 3I3DA 1BCXA 1OH4A 5C4WC 5C33A 3LF7A 1FI2A 2F17A 5FR3A 2C0ZA 2BQPA 1V9U3 4FPOB 4JGZB 1JTZX 5DUXA 1VR3A 2JD4A 4XMAA 2VW0A 1RUJ2 2ZX0A 3N9PA 3DPRA 1RUNA 1O59A 5IVVA 3MIEA 3IPVB 2J22A 5LASA 1SLTA 1W05A 4IGPA 2IXIA 4A42A 3BI3A 3ZSJA 1W8HA 5JWPA 3VZLA 3NVCA 3L9JT 2VOTA 5FZGA 2L9LA 4M3CA 4XUPA 3VBUA 2CTVA 3CJIC 4RR3A 4CYDA 4NAMA 1FV2A 2VCAA 5FYBA 1F31A 1SBDA 3BVCA 2WYSA 4R9AA 2VMIA 1O5LA 2D44A 5ANNA 4EJRA 5A6XA 1PIV3 4YVWC 1JUHA 2G9FA 4BXSV 2MEV3 4P9WA 3MIHA 4HKOA 3N9LA 2LRPA 4DINB 2DYCA 1G8WA 1ZZ9A 3NV4A 4HMZA 1D2QA 3AMMA 3R4SA 1OVPA 4CDWA 1F4AA 4OVEA 2ZEYA 1GKBA 5LWBA 1R1ZA 5DMYA 1H6XA 3VV1A 3FLTA 4BB3A 5FBZA 3D0SA 4C1WA 1MZ5A 3AFGA 3VB9A 3UT0A 2E26A 1J3RA 1QQP2 2JG9C 5FJKA 5HV4A 5EFUA 3Q9OA 1IKQA 2XQRA 5LBBA 1UY4A 4MGSA 4AVAA 1AL0G 1RUE2 4PDWC 1TME1 1W90A 5A80A 3OG2A 2E9QA 5JZGA 1ZBA2 4XE9A 2Q8DA 3JU9A 4YVSA 4F3JA 1OFSA 4QQHA 4FBFA 4MGZE 3KS7A 4BQ1A 3PVOA 4KQ7A 2VMCA 4LOSA 4WZCA 5GLZA 4HSJA 1O3RA 2IXJA 1HQNA 4HONA 4YM2A 1DYOA 4GH4B 2JG8B 4U36A 1DQ2A 1CAUB 5E88A 2KXLA 1CN1A 2IFWA 5FPLA 2H0BA 2G19A 3AX4A 2QVSB 2GNDA 2YFZA 3TEXA 4DUWA 1V6NA 1LAJA 1LTEA 1V9U2 4KWJA 3ALQA 1XNAA 1NAEA 1W6OB 2IUWA 5D8AC 3WXPA 4IE7A 5L7OC 4AVSA 2VULA 3LB9A 3ZYIB 4A7ZA 3NV1A 5AVAA 5FREA 2W52A 4CUGA 2XJVA 3HN1A 2EXKA 5H9SA 5A3UA 3GBFA 5F5CA 1C5IA 4UW6A 4XF4A 1YLLA 4ZU4A 3KCCA 4FFFA 1TME3 1PK6C 1UW8A 3BOWA 4XHXA 4YG3A 1MS0A 4GMP1 1DF0A 4LLFA 3ELNA 2GP3A 1GR3A 2BFUS 3RZKA 1OXCA 1KDKA 4CSWA 1PIV2 2BVVA 3BODA 1O8SA 2JXAA 2CDPA 3AP6A 3LZZA 1TE1B 1H1MA 1VRBA 1OLMA 3GJAA 1CR7A 2OPWA 3G7DA 4IETA 4NOTA 4O65A 3OCPA 5FYHA 1LOGA 4QXHA 1S1AA 4AHWA 1OOPC 3WF2A 1LENA 3A0KA 5FLIA 1X9PA 1WCDJ 1J58A 1MZFA 2XBO1 3AB0A 4M0NA 1GZWB 3KZ4C 1XU1A 5JOZA 4Y4YA 2PHWA 3S7EA 1WLWA 3WQ0A 3FHAA 4JDOA 1EAH1 4INDA 5IVCA 4UFHA 5AVPA 2ZHKA 4AHZA 1ZZ7A 3ZFEC 2BTVC 1G9BA 2R6QA 3I2GA 1KDMA 5D2AA 2FHRA 5EYYA 5FLJA 1ACCA 4C1XA 4CPBA 1KJRA 4CZSA 4CEWC 3IDAA 2GALA 1NZCA 4GMP3 3ETPA 3EXUA 1PX4A 3WNXA 5KC5A 4HVOA 3FFQA 3NNJA 4LKFA 1F4HA 5FMCA 5C3OA 2WFF2 1F5FA 1W6PA 5LBCA 2DBIA 4BIOA 5LB6A 2RDSA 1SFYA 5FRAA 5C8CB 1CAVB 2XBO3 5FV3A 2RJLA 2GC2A 3MICA 4QWNA 1NQDA 4NIAA 3Q8FA 2VBBA 5APAA 1I6XA 4UYBA 4XIOA 4NIDA 3M70A 2DCKA 3KB5A 4NHXA 3SISA 1EAH3 2WS92 3POYA 4GQ7A 5CVRA 4ORFA 3OSDA 3WG2A 1MZEA 4MXWB 2ZZJA 2ZBJA 3M3CA 3AC0A 1TME2 3RI8A 1MS9A 1QJU1 4QMAA 1QEXA 3CIHA 2XVKA 1QNYA 1WA6X 2ADDA 4FPCA 3IBMA 1JN2P 1UZYA 1FOD1 3VHRA 3WP5A 4Z1VA 4XZUG 5CA6A 4QDQA 4A4AA 2RM21 4DB5A 4MX3A 4Z92B 2HKXA 5F3CA 1CAWA 2K0GA 4IEQA 4LO8A 5CYYA 3WP4A 5BNNA 4EN8B 4CCOA 3H1YA 2BDRA 3CNAA 4AGRA 4QHZA 2XPJA 5L19A 3FBMA 2Y6FA 1PVXA 2B9UA 3LDKA 1H4HA 4AEDB 5KR7A 5CFCA 5AC91 2VQUA 1J83A 1UAIA 2WWUA 2NZ9A 4AEJA 1ASJ1 5C3QA 2AGSA 1SCSA 3MIFA 2VW1A 2EXHA 4XTMA 4AQTA 3MBWA 2OVUA 3IM0A 1KITA 4Q4X1 3ZMNA 4AFAA 1DLCA 1ZBE1 4FTSA 4CCDA 3UETA 1QJU3 3WNKA 5LA0A 4MGQA 1U5IA 1OMIA 4HANA 4E4SA 3H8XA 1GP5A 1DGWX 1CD3G 1UOFA 3PIJA 1QOTA 2C24A 4LBOA 2WAAA 1RIRA 1V6OA 1FOD3 2X29A 3BPZA 1HLCA 3J26N 3ME2A 3MGUA 2VTXJ 3ZN6B 5A6YA 1YC61 1UXZA 3D5OA 3GJBA 2VZOA 3I59A 2RM23 3KSCA 2GN7A 3I3BA 4DY3A 4I0WB 4ITCA 2Y60A 1O4ZA 2VNRA 1H2LA 4YW1A 2CDOA 2HEWF 4XF1A 5LBFA 3BGAA 1YHFA 2HYXA 1FATA 4LA3A 2RDQA 2ZGQA 3QD6A 4BE3A 1ULCA 2V5YA 2JICA 4E2SA 4HSLA 4I02A 5AC93 3LOIA 1IGOA 3FE5A 1COV1 2NP0A 2KR2A 2GNTA 2JB4A 1QH7A 3AL6A 1ASJ3 4RS5C 1BMV1 4QPGC 2VZUA 4HKWA 3VKNA 4Q4X3 4GKXA 3I4IA 3LIGA 1ZBE3 4JQTA 1T6BX 1CX4A 5F9TA 3NJVA 1D0GA 1DQ1A 2JECA 2B8MA 4URTA 1X8MA 4MXVA 4OZOA 2WSVA 3MUZ1 1H8TA 1AR92 3CO2A 4FI9A 4HL0A 2PXJA 2XVLA 1GANA 1W3XA 4MHUA 4Y24A 4BQ5A 2DVBA 3HN3A 3DPRC 4AAPA 1V6MA 3WR0A 1I1EA 2VZPA 5EYXA 2EICA 4B7EA 5HV0A 1FPN1 1X82A 5DAPA 2FMDA 2CHHA 2ZEZA 2BVBA 4AFMA 4Q8KA 1DHKB 1GBGA 5FYIA 3E5UA 3T1MA 3VBUC 2XUMA 4JKMA 4QDRA 4RR3C 2Y38A 5EHDA 3AZYA 4UBHA 5F5AA 4XQDA 4W4ZA 2O0OA 5A3LA 2PA7A 4XFHA 1COV3 3U4SA 5K4LA 4A44A 4LIVA 3RGBA 2XG3A 3X29B 1ENRA 4B29A 3HD8B 3D3AA 3LQCA 1CZVA 1OFNA 5LEJA 2ZS6B 2CWSA 4IEOA 4QX0A 1QJU2 1LHUA 3C7FA 5LA9A 1LECA 3MHZA 3KVAA 4CDWC 2WKKA 5E89A 1UOJA 2XLGA 3AZVA 3OBRA 3V64A 4F7ZA 1DQ5A 1UZVA 1FOD2 5CKQA 2ZGLA 4BZ4A 3HJRA 5DDJ1 5T5PA 2RM22 1UXXX 4KWKA 5A32B 4N8MA 4TYSA 4BJ0A 3ST7A 2VUAA 3AP7A 5DUVA 2OYZA 1HB4A 1VMFA 3HEIA 4ZU7A 2D6NA 1LEDA 3VD5A 3O0WA 1H2MA 1FPN3 3BALA 3VDBA 5JZGC 3VBFB 5IJRA 4A6OA 5FWJA 3FBYA 2MHFA 1LRHA 3P3PA 2IZWA 5T54A 3VLBB 4YVSC 4AWDA 5AC92 4OHZA 4DUXA 5C7GA 2WQ4A 1ASJ2 4PLMA 5IFTA 3UNPA 2KA3A 3ZKUA 5A7PA 4XUTA 3KV9A 3HNBM 1WLDA 3ZFFB 4ZS3A 5A3PA 1C3HA 3NW4A 3TB0A 4ZZ5A 1U5XA 2QUOA 1L7LA 3WF4A 2PTMA 2VZRA 4FPJA 3UYJA 1JYWA 3J7MA 4TWTA 3BTYA 1VMJA 1IS6A 4TSVA 5DPNA 1ND3C 2Z2SB 3INAA 3VHNA 3KT4A 5DDJ3 4BHPA 3NNFA 1R081 4CP0A 2C1FA 4LITA 2HWC2 2WL1A 1SLAA 2YBKA 1UY3A 3AYAA 2NMNA 2WA4A 1RUC1 2TUNA 1QJZA 3RYKA 1W9SA 2PAMA 4ONUA 2UURA 3I2JA 3MW4A 4Q5OA 3VBHB 3BTXA 2TNFA 3FN9A 1H0BA 5J96B 1COV2 1NXMA 3W58A 2DCZA 4YW3A 1LHVA 5FZ3A 1BMV2 4HKLA 4CU9A 3AYEA 2WNUB 1GU3A 5JPNB 3VDDC 3RZLA 3A7QA 4IV1A 2PYTA 1D4VB 1VLNA 1HB3A 2WO1A 3AJYA 1UYPA 2C26A 2K2SA 2UU8A 2YPDA 3K4AA 2NPIA 4N90A 4I2OA 1W2NA 2ZEXA 1Q8SA 4BH9A 4BLJA 2IVIB 4PHZA 3N7MA 1R083 3PLQA 1LULA 4P14A 2YBSA 3CJXA 1FPN2 1YQCA 2JG9B 5EQUA 3D4KA 2WWJA 3VBSB 2E53A 1X36A 4F8AA 3H7YA 5AFBA 3GNEA 5JXIA 4IEZA 3MPPG 1RUC3 1E5HA 1MR5A 3WNNA 1R1A1 1GNHA 2WNEA 1POV0 3J4UH 1YQ8A 3ZX7A 1CPMA 2X5IC 2Y26A 4XF3A 5FUPA 5BXXA 4ASLA 3HVDA 2A6YA 4Y1VA 3ZYRA 5FZFA 2ZHNA 3OY8B 2D6OX 3T3YA 1DQ0A 2ZABA 2GMMA 4BMBA 1W2UA 2HBTA 5ISLA 5C4WA 2E63A 4EROA 3I3EA 2I2SA 1NOVA 2XB6C 3ZR5A 2GP5A 4K20A 1PM7A 4OZXA 2XL9A 3TAYA 1OQ1A 3NSTA 5DDJ2 1CGPA 2VZ1A 1S4CA 2UWBA 3MYXA 4XAAA 4PIXA 2E31A 3SC7X 4QX3A 3K48A 3HWJA 1RXGA 4IEPA 4PIYA 1JOPA 4XHBA 4COYA 4AQ2A 5J98B 1BQPA 4FSJA 2Q4SA 2WZR1 1Q3EA 2DVFA 1W8OA 3A23A 3WDXA 2E7AA 1R1A3 3OGRA 2UYAA 1PK6B 3MV01 1CX1A 5FZIA 1SMVA 1A3KA 4LO6B 4AYUA 2BRTA 1GMMA 5IUQA 1HB1A 1IKPA 1QMJA 1A6CA 1CIYA 2VNOA 2XMLA 2ZXQA 3HQXA 5BNNC 4PLNA 4UW3A 1A8MA 3IWZA 1JI6A 1YYNA 4OHYA 2P17A 4DNYA 1L7QA 1YFUA 3MV11 2BNNA 4LK7A 5FP4A 2CGOA 4CDXA 1XSQA 2VECA 1H4GA 1W3VA 2W87A 3DYOA 4QHOA 5CFCC 3AMPA 2XDVA 1QKQA 3DV8A 3WG1A 3H8RA 2ET7A 1W6MB 3O1SA 1QJX2 3FUQA 3VZOA 5JCTA 4JTOA 4JGYA 1WMXA 2C9AA 1SCRA 3W9AA 4LBLA 1S0BA 2ZGUA 1DZQA 2VNGA 1WD4A 2WQZC 4H3WA 3DN7A 1RUC2 4YZ3A 3HIFA 3ZIXA 3WF1A 2ILMA 3M2MA 4PJYA 3ZFEB 2WZR3 3MI8A 3RPQA 2QFEA 1NKGA 3AZWA 5FKBA 4X8NA 1Z7S1 4LHLA 1V6JA 2WSUA 1B09A 3V0AB 1QXJA 5JOXA 5A7SA 1CWPA 2YPJA 1GYKA 1Y9QA 4KGQA 4TZDA 2VMEA 1QOSA 2EIBA 1W8NA 2VCMA 5EPAA 2QJVA 4WM8A 5I0TA 2JB8A 2Z79A 4OQ9A 3WV6A 1JH5A 2VZVA 3M3EA 2WABA 2W91A 3OD0A 4K1ZA 1EPWA 1XE7A 5KC6A 2VMGA 4Y5SA 2YU1A 3KWVA 5FFOC 2Y34A 2ZX3A 3CLPA 3B01A 4QXBA 4WM7A 3POEA 2HH9A 5J7MA 5FY4A 3IDBB 2ZX4A 2CSGA 1OQDA 2TEPA 4IE4A 4WVZA 4IL7A 1S55A 2RS51 3OUIA 1ULOA 2BUKA 1W2TA 4XFAA 3URFA 1H2NA 5FZHA 1R1A2 5DUUA 3WF0A 1RUOA 4L11A 3I49A 1H8TC 3ZN5A 3NV3A 3RZHA 1UIJA 1AR71 3LA7A 1AR61 1Z7S3 4QGLA 3E6DA 4X6QB 2VO5A 4XJUA 5FP9A 2EAKA 4BQWA 2R1BA 4NROA 2JDYA 4LE4A 4W6YA 1H1AA 2WN2A 3K75B 3KMHA 1XE8A 5FO9B 3BB6A 1S0FA 4M01A 4MSVA 2PHDA 4D3WA 1S0EA 1W6NB 1IS5A 3DF0A 5B2GB 4YM0A 4NE9A 2VNVA 3UJQA 5CKNA 5JSRA 1SDDB 4RQPA 5IAVA 4UBGA 5B4XA 3ACFA 1YQ2A 5CFDC 3J7NA 2RS31 2DURA 1W9TA 4QT6A 3THPA 2D6KA 4AEMA 5I0UA 4DMIA 2O1QA 4S2FA 3ES1A 4E2GA 1NA1A 3I2KA 4BMEA 3GCXA 2Y6GA 1JBCA 2BBAA 4ISQA 1ZM1A 2OX0A 3PUQA 3I7DA 4K21A 2RE9A 3BU0A 1IZ3A 3POGA 2AUYA 3HQUA 4ZY9A 2ZKNA 4QPIA 2RS53 3VD3A 2B7YA 2WZR2 3IMMA 4DXZA 4PIZA 3ILRA 3PVEA 2ZCWA 4H55A 5FZCA 2A6WA 3E1F1 1AR73 1OI6A 1AR63 3NNMA 1NCRA 4Y1ZA 5C5TA 1LODA 5A6QA 3I3MA 2WA3A 4AXOA 2XOMA 2D98A 4Z8BA 3O1OA 2PQSA 2JIGA 2R072 4OI4A 5A3WA 1CAXB 4A6SA 1CESA 4OCTA 1R64A 1W9WA 3MF6A 4LHNA 4PI2A 2W5FA 2GH8A 2RS33 3N7JA 1RC6A 1O8PA 2CGPA 2CGNA 1DQ4A 2QQNA 4XJWA 5JOWA 4XABA 1JU4A 1NE6A 2OPKA 2QQLA 4XBNA 5FKCA 1G86A 1LKNA 2XGXA 4XCAA 3PURA 1A78A 3QOPA 4RS5B 4QPGB 5K8SA 5HXMA 1LU2A 5IVYA 2W1WA 1SLBA 2V72A 4OFGA 1US3A 3H8OA 1VB4A 2D3PA 4Y22A 2I74A 2BGCA 2WZEA 1Z7S2 3OBAA 2D6PA 4I30A 3I54A 1IPSA 1HJGA 2Q0AA 3MF9A 5FZOA 3T2PA 4QB1A 4XBLA 5C9AB 4AHXA 1CVNA 2RS11 3GBWA 2X05A 1AX0A 3OTFA 5DG1A 3DPRB 3IAQA 2ZEWA 4PQQA 4CDUB 3LDBA 1REFA 1NYWA 1JUIA 4FPGA 3OPTA 3FMGA 2VVFA 3QLQA 5GZGA 4QB2A 4K1YA 1W2AX 3I2IA 4XFGA 4Y4RA 1J3QA 4KMQA 1UIKA 1AVBA 3EBRA 4K40A 1IS4A 3C7OA 2A6ZA 4M3CB 4NRMA 1GWKA 1OUSA 1E5IA 4RR3B 1YIPA 4QXCA 2MPFA 5EV7A 2OS2A 2R042 1US2A 2E32A 2ET1A 4JQRA 3E6CC 4IV1C 1BVVA 2RS52 2Z69A 3S7IA 1GUIA 4Q29A 1Q8PA 3ZXLA 3B69A 4OHXA 4CU6A 5HI0A 1GZTA 2YGMA 3ZPOA 1AR72 2QNKA 5DAWA 5F1RA 1AR62 4ZHNA 1CPNA 2VG9A 4CDWB 3U0ZA 1UWWA 4AI9A 1ND2C 2RS13 5DAVA 4G9SB 1VMHA 2VJXA 1U5YA 3EMRA 4HN1A 4PT6A 1V6IA 1OD5A 2ORXA 3WLUA 2XUEA 3RZZA 2PHXA 4R52A 4IGOA 2WYFA 2Y0IA 2QTWB 4FP3A 1F15A 2QDNA 3USSA 5LEKA 5JR2A 1P8JA 4CDQB 1UO9A 2RS32 4XDOA 5JZGB 2ZGKA 3VD9A 2R0HA 4N43C 2UWAA 3W59A 3ZOIA 1H1IA 4D6RA 2W47A 4N9IA 4P5YA 4UFMA 3K3OA 4Y33A 2WNVA 1OLQA 3SITA 4C90A 3LA2A 4FOWA 4Q0UA 3U1XA 4Q0PA 2R49A 3IAPA 3FJSA 4DFSA 1FMD1 3B9CA 4GKYA 4I09A 5EJZB 1UOBA 4LKDA 2XKOA 3A21A 3AKPA 1R091 3NKGA 4KBZA 3PUHA 4FOYA 3ZFGA 2DUPA 1O7FA 4DQAA 3V0BA 1K5MA 3RZMA 1APNA 1C4RA 5LY1A 3NAPA 1JHNA 1B35C 1JZ5A 3NJZA 3M7AA 3U11A 1X33A 3H8UA 4EN0A 2XONA 3WVJA 5C6CA 5ABJA 4P9LA 1S0IA 1W6QB 4A7KA 4O7XA 3WF3A 1GV9A 5FZ7A 1RGSA 2Q8EA 2KM2A 5KHGA 1I9RA 4EV0A 3H7JA 4Z2AA 5F6KA 3NKTA 4AEKA 2YZ4A 4JZRA 5HCHA 4CUAA 3WNOA 4BISA 3MLKA 4LHSA 1LOAA 2WFF1 1DZTA 4QX1A 3UKVA 1LHWA 2A6XA 4UWDA 1FMD3 5FZ1A 3EHKA 5BUVA 1KJLA 2GN3A 1R093 3DECA 4CDXC 2FCVA 3ZYBA 3AKSA 2BWAA 2ZX1A 2BJSA 3KHBA 5LK5A 4CCEA 3K4ZA 2RS12 1PMHX 3OYWA 4UOJA 3PUAA 3ZDVA 1VAKA 5IK5A 1C8NA 1WW7A 4JGYC 4ES9A 1C8M1 2WS91 4NPRA 2ZA9A 1EUUA 1FAYA 4KI5M 2WIIB 1NCQA 4PCRA 1DGWA 2DFCA 2J1EA 5FZ8A 3GBGA 2ZACA 5A1AA 3E5XA 5GZEA 2J1RA 3OD4A 4CEYB 3LEKA 1RTVA 2XVGA 4L8QA 3RWNA 4JKKA 2CYFA 2QQPA 4DXRA 1AXYA 2BFUL 4Y3OA 1LU1A 2B42B 1HV1A 4YW2A 4LJHA 1XC6A 4XQ4A 5BNPA 5L36A 3IB3A 2WFF3 2XH6A 4WZFA 4GJYA 2E33A 5FZEA 1W6PB 4WM8C 4LR4A 2YC2A 1ZZ6A 3HR9A 3DYPA 4PBPA 3ZLIA 1DG6A 1GOHA 1MPXA 4RFRB 1OVSA 1DP0A 3HNYM 4IEYA 4XF0A 4IV3C 5I8SA 3WCRA 1GLHA 1ND3A 2RV9A 2OW4A 2Q8OA 1PNFA 3IDEA 4NIIA 5FYZA 4WM7C 5SV8A 4Z2WA 4NIGA 3ITQA 1C8M3 2WINB 2WS93 1LR5A 2VVDA 4XBQA 5T5LA 2VOXA 4AAXA 4JVAA 4AVTA 1OBNA 2BOJA 4AL9A 4KNCA 2Z4FA 1SZBA 4H7LA 1H6YA 1Q43A 4XFBA 2WO2A 5H9QA 1X7NA 1W06A 1Q56A 1ZRIA 3HNMA 4XETA 2ETEA 2F4PA 2VOVA 3IPVA 1FMD2 3VDDA 3O1PA 4UT5A 2LS6A 1CAWB 3UGHA 5BNNB 4K3UA 1R092 4RQPC 3WDVA 5GM0A 5JVVA 3WW4A 3VBOB 3WX5A 2V4VA 1C28A 3ABZA 3WUCA 5KXCA 4BYYA 4GJZA 3AKQA 2IXHA 4UI9L 1NA1C 3JXSA 3RQ0A 5CFCB 2A3XA 4FFHA 4TLFA 2WUHA 3UK9A 3EJKA 2VOWA 1UZ0A 4FXGB 1OH3A 3RJ2X 4XVHA 1MEC1 4QPIC 3AMHA 5DZEA 1I5ZA 3N3HA 1W03A 2IFRA 2K9ZA 4NMIA 3O1RA 2PAKA 1UF2C 4NJ4A 1JYIA 1AR91 1PVC1 2X5IA 5IATA 4S2HA 1NCRC 3N36A 4V1PA 1H30A 4QKNA 2FDFA 4OQ8A 2WJSA 2QQOA 4MH0E 2PHUA 3HAGA 3MIDA 1SPPA 2WQ8A 4CUBA 2NYYA 2OT7A 3I59B 3TEYA 5L73A 1DZRA 4EZ4A 3Q8EA 4UFKA 4Y5Z0 2PELA 4LPLA 4B4PA 1UMZA 3KD4A 2FDGA 2FCTA 3TOJA 3M3QA 3O1MA 4XILA 1GOFA 3KT1A 1WA4A 3C7EA 1C8M2 5F3IA 1J84A 1CAUA 1FNZA 2ZZQA 1LJ7A 1NLSA 1Z0HA 1X50A 4JX0A 4C91A 1XYNA 3UV9A 3WDWA 4DXSA 1MEC3 5HCFA 5GLVA 4LBQA 3O14A 4FPEA 1UN1A 1SLIA 4E8CA 1LOFA 1W6OA 3GALA 1AR93 1PVC3 2HLEA 1H8TB 2JJ6A 5LBEA 4EWAA 3VBRA 5IVEA 4W65A 3AXDA 3LEMA 3QBQA 5F2SA 2I07B 3CEWA 2XHNA 2HWE2 5FK7A 4AGGA 5FXWA 2Y64A 1E5RA 3R05A 2WT1A 1STMA 2ARBA 1CJPA 4YFZA 5JUVA 3K3NA 3LEGA 2CV6A 2VUJA 2BERA 2YXSA 4YW4A 3ZYFA 4EN7B 1UU4A 2B9VA 4WV8A 4RGKA 1WCUA 4R8HA 4DPNA 4COVA 5HCBA 4FPYA 5L9VA 2DTYA 4I3PA 1WBFA 1OPMA 1WMFA 5DN2A 4TXWA 5IK8A 3OPWA 2W95A 3UKNA 4DEQA 1FX5A 1D0HA 4XJ9A 4BXFA 4NRPA 3GM8A 1DGRN 3THCA 2VQAA 5I0SA 2G9ZA 3H1MA 2GU9A 1QXRA 2D5FA 3I2FA 4R9BA 3RWKX 3N7LA 4C0HA 3A0NA 3IKWA 2D3RA 2EIDA 4YRDA 4UFJA 4N53A 2EF6A 3SKJE 1JYTA 4AGVA 4DRVA 2HWC1 5IHRA 1YNAA 3K51A 4HBNA 1VBD1 1DBNA 3MFAA 4QU1A 5I93A 3CMGA 2BZDA 5CB7A 4LUKA 4AE2A 4X8PA 1PM4A 1SHWB 2WNVC 2VZQA 3T2OA 2J1SA 4AVBA 1YWKA 4JHZA 1LGNA 4IW3A 4QKBA 4AI1A 5JIUA 4MUVA 1MEC2 5F3EA 2AEZA 2A73B 3C3VA 1XNCA 2W39A 3TBDA 3ZFGC 1RITA 2GZWA 4Q0SA 1ZA4A 1K5MC 1PVC2 1WD3A 1YRZA 2V4AA 3NAPC 1XNDA 5FPBA 3RVHA 1FT9A 3M1HA 5ANQA 4G3YC 4XJZA 2W3JA 2W2IA 5ABJC 2W1QA 4XW3A 3HMYA 1WZXA 4FFGA 4FVVA 3WT3A 2HWC3 3AK0A 4B3NA 1VBD3 2YROA 5M0TA 1H8VA 3C8XA 4ZZ8A 3LOBA 5CFDA 2RHPA 4EZHA 1JZ4A 1O3QA 1NX9A 2BU9A 5FYVA 4NAOA 3WW2A 2RJ2A 1LGCA 4QDSA 4BQYA 1BK0A 1O6UA 3LPFA 2X53S 5C3SA 5EZWA 5T5JA 2HEVF 3RYPA 1W04A 1EV11 1HN1A 3CZJA 4DY5A 2OA2A 3O0XA 4LT5A 4JDMA 4YFWA 4LHKA 2AC1A 1QGLA 4IV1B 2XJSA 4ARYA 5IT6A 3I2OA 2R30A 5CISA 3GDBA 5FLHA 3OEAA 3M3IA 3IT8A 5FTTC 1QH6A 4CRQA 4GA9A 4GD4A 3ZXKA 2JKBA 1MS1A 1WW4A 2W92A 5G04L 1WBLA 5FZBA 3AYCA 3F95A 4J1WA 3TYJA 5F32A 1NCQC 1O91A 3U37A 1PGL2 5KXBA 2ID4A 2YYOA 5JSPA 1GQPA 3MFCA 4PBOA 1WLCA 1OUXA 1J3PA 4Q1PA 4FAHA 1MQTA 4Q26A 2I45A 2J7MA 1LOEA 4S2DA 3ZN6A 4DUVA 3WD5A 1ULFA 5BNPC 2AREA 1N3QA 5F2WA 3RJRA 3VGIA 4OI2A 4M00A 5IK4A 3FWEA 1EV13 2FZ1A 3AVRA 4NHLA 4QPWA 5C70A 2VZTA 1K12A 3VKFC 5C4WB 5GKAC 5BYNA 2DVGA 3EYPA 3MIBA 3POIA 4Y20B 2NLRA 5GLTA 5IVBA 3PJQA 1QJX1 1CQ9A 4XYXA 3ZXEA 3VD4A 4K9SA 4YM3A 5J3UA 5JOYA 5KHKA 5KHHA 1Y4WA 1FYUA 1VBD2 2ZTNA 5DAXA 4CA9A 3N9QA 1LESA 1PZ7A 3OGGA 5A7OA 2C5DA 3P1IA 1N1VA 3O1TA 3BOPA 1DDLA 2R1DA 3I3QA 3Q8AA 3ACHA 1BJQA 3CJIB 1ULEA 1TMF1 4E27A 5FY1A 3JUUA 2WZPP 1EYBA 3POSA 3CF6E 5EJ3A 4GWIA 2BP6A 3OGVA 3AFKA 2ZJCA 4YVWB 4ATFA 4AQSA 2B4KA 5JI7A 2QQWA 5FJHA 1I3HA 1W0PA 2A71A 3SCGA 5ACA1 2BNOA 3ASIA 4CDXB 4CVUA 4QGNA 2YU2A 1ND2A 3DKQA 1BZWA 1QDOA 3GHMA 4XF9A 1QJX3 1RVF2 2AZ5A 1SFPA 4CCNA 4AFDA 1G9CA 1LEMA 4W6WA 2DV9A 4EE2A 5HBAA 4JGYB 2NQYA 4HOOA 1S2BA 5FYUA 1IQAA 5FYYA 4MLOA 4IDZA 3WY6A 4PDWB 4CCLA 5K0UA 3VN4A 1XBFA 4N43A 4BCUA 5KBFA 4E4HA 2W1SA 3TRSB 3ZN4A 4MV2A 2ZHMA 4R9DA 3VHOA 1TMF3 5A32A 2OQ7A 2R7EB 2DBNA 2GDFA 1EV12 4NUBA 4OHVA 2RDNA 4FOQA 4XPVA 2CY6A 5FIXA 3WNPA 4AG4A 4EWEA 1OLRA 2YC0A 1Y9GA 2B46X 4KG0A 3VBFA 5FBJA 4DXTA 1XOYA 2D93A 3PIGA 4WM8B 4SLIA 2W94A 1OC1A 2MNGA 4QQ2A 1XE0A 4FOVA 5ACA3 1MS3A 1B35A 4HZFA 4L2NA 3SH3A 3LDRA 1YQ6A 5D8AB 5KXEA 5L7OB 5FZAA 3MLJA 2JG8C 4NR1A 3ZFFA 3GGLA 2EIGA 2ZX2A 1MS4A 5FP7A 4XFCA 5E1RA 3NNGA 4Z82A 4Q4V1 5DQ0A 4A2UA 2EXIA 1W0NA 1WCSA 3C2UA 3JQWA 3LAGA 4QKFA 1LOFC 2D3SA 3VDAA 4F83A 5F7UA 3NNLA 5D21A 5FO7B 3VBRC 3H42B 3MPBA 1WGPA 3T2QA 2VUDA 3ACGA 3DEMA 4PI0A 1AL21 4KWLA 4IE6A 3U14A 1UY1A 2ZGRA 4XEZA 4ZKTB 4E4DX 2R071 4P9XA 3N9MA 3V56A 3MW3A 5T5OA 4U2AA 1K42A 1VE0A 2GNMA 3ETQA 2D97A 2RG4A 1OOPB 3J7LA 3OUJA 4GXLA 3VBHA 2P3KA 3OBZA 4UF0B 5BV6A 1EPZA 1PMIA 2RR11 3E97A 3KV6A 4HN0A 3SEPA 1NA1B 1UYZA 4XZPA 4BU2A 2FDKA 4URAA 3OOXA 2DFBA 5J48A 5C71A 2Y33A 2BW8A 4DOUA 1JYNA 4K8FA 3EQEA 4XXAA 1BLZA 4Q4V3 4BLIA 1NY72 4CEWB 1OF3A 3T09A 5IWFA 3QH7A 4Q0QA 5IK7A 4Y1YA 1TMF2 3IIAA 1G9AA 4LLOA 4NN0A 5CIRA 1GWLA 4UW4A 4XURA 4QU2A 2R061 2ZHLA 1NCRB 4N53C 5BPXA 5IVJA 3GF6A 3ACLA 4JKLA 1PO22 1AL23 3OUHA 4KWUA 1W8TA 3WDUA 3VBSA 1MS5A 1VBE1 2R073 4A7YA 3K4DA 1QXPA 3R4UA 4BM8A 3MZHA 3PTRB 1OF4A 2P6CA 3I97A 5A7WB 5ACA2 1K3IA 2YDEA 3C7HA 2OZ6A 3DKWA 4IV3A 4AF9A 1W8WA 3GZAA 5BNOA 4CP9A 2OQ6A 2QQMA 4I0AA 4IE0A 1XPWA 1GNZA 4XFFA 1HDKA 2RR13 3S5QA 2R041 2Y6KA 3TWIA 1V6KA 2Q1ZB 5JMOA 5LRSA 3CQOA 3ZSMA 1DGLA 3R4DB 5FPZA 4LKSA 1O4YA 2WAOA 3RG0A 4HVQA 5C8CC 5FOJB 3M8LA 1IPJA 3USUA 1BVP1 5LRRA 1EY2A 3WW3A 2NM1A 4OI0A 4BQ3A 4XMIA 4LKEA 3KLSA 1QHDA 5FZOB 1UX6A 3SXWA 4ASKA 4C0BA 3ORJA 2ZGTA 4LXLA 4Y1XA 1RXFA 2Q30A 3TEZA 2R063 3RZJA 3B94A 2GAUA 4NO4A 4P9GA 4NVPA 4AI0A 1W8ZA 2YUEA 3MEPA 1VBE3 3PJYA 5FMOS 1ZA7A 2W08A 1RUD1 3UGFA 4P08A 1JHJA 5FZDA 3HT2A 3E5QA 1IHMA 3RS6A 2A6VA 5EXOA 4META 5GLUA 1ODNA 3ZYGA 1LB2A 5FZ6A 3JZVA 2LUWA 3BYWA 4A45A 3F2ZA 4GULA 2R043 2AH2A 2DTWA 2JDPA 3VZKA 3N35A 4Q4V2 3NL1A 2QZ2A 3FC0A 4QKDA 2HYKA 2YHJA 3BU7A 4YGBA 2FD8A 1POV1
chains in the Genus database with same CATH topology
3WUDA 1UKRA 2PHFA 4XTPA 4XFIA 2RJKA 1DYKA 5DZFA 2NMOA 2OUJA 1NXD1 2YY1A 1AL22 3ECQA 3SCFA 4YZ2A 1AUYA 1S2KA 3UKTA 1DIWA 1NQJA 4YGDA 3WW1A 2A7AA 1RUD3 3DUIA 4X6RB 1MQTC 1H2KA 2ZGPA 1PHMA 3GHNA 1G7YA 1W0OA 2B5HA 1AYN1 1AX2A 2RR12 1FXZA 1D4M1 2WNVB 4G4FA 3B7MA 4NWWA 3A4UA 4HLTA 2EA7A 1SACA 3VUOA 4M3CF 1CJDA 5BNQA 2VGDA 4ZU5A 1YJKA 2HWF1 1POV3 3ZFGB 2XJUA 2XL7A 3SLIA 1K5MB 2WLPA 3JB4C 2DWRA 2R062 3NAPB 1BKZA 4PF5A 1XYPA 1VBE2 4XOGA 2ZAAA 5ABJB 2ZKLA 4WVMA 5JI9A 1G6NA 3T2TA 1OA4A 3WP3A 3VBUB 1SFNA 3HBZA 4LA2A 3WOGA 1AYN3 2TBVA 5FOBB 3WDTA 1BBT2 4BIFA 1D4M3 2P34A 2SLIA 1YO8A 4HPKA 4R4ZA 1Q8OA 1C1FA 3ATGA 5JMCA 4QXKA 2VOKA 3QACA 1ZZ8A 3G6JB 2HWF3 4Q27A 3CU7A 2PHTA 2G9GA 3D8CA 5AFEA 1BEV1 1C57A 1HIXA 2DCYA 3AKTA 2IXCA 3SH4A 4D7TA 2PFWA 5JDBA 5A33A 1T6GC 1RUD2 1ZRDA 4O9EA 2WWSA 3T1LA 5K0UC 2D6MA 3GZTB 1UL9A 2ATFA 4H7MA 2E7QA 3LGRA 1VIWB 4JCKA 2UWCA 4YVSB 4RL7A 2IXKA 1OQEA 4HVRA 3SCHA 2BPA2 1H9WA 4IXLA 1ZZCA 2ZMNA 1AYM2 1WMDA 4KU8A 1UPSA 4XJAA 5BNPB 2N7GA 4L97A 4GWMA 3VBFC 2P3JA 3E6BA 4LEJA 4OHWA 3SHRA 3BTAA 4UW5A 3WDYA 1SBFA 1WCKA 5GALA 4YZ5A 2PQQA 3FHIB 1IS3A 3VZMA 4AI3A 4LO7A 5FQ0A 1ND3B 2B45X 3ZFFC 4AFBA 1UD1A 4JV4A 2XKPA 5GJ6A 3S30A 2WT2A 4YG0A 2PAEA 4COWA 3B00A 3DGTA 3IDCB 1BYHA 3ZPYA 4Q8LA 4LE3A 4H14A 3JD71 2ZMLA 4YYOA 4KH9A 4OUMA 5DG2A 1AYN2 5C9AA 1GFF2 4D94A 1D4M2 1ZYBA 4LO4B 3OPZA 4LBJA 2LM3A 4CDUA 3M3OA 3ZXGA 3VZNA 4QPYA 1ENXA 3VDDB 4BWOA 3RI9A 2HWF2 3WHTA 4MYEA 4LULA 2P3IA 3VBHC 4GWNA 4ASMB 4IESA 4N7IA 4EN9B 2WNUC 1WMEA 4XQWA 2D5HA 1S0JA 1TNRA 2A3YA 4UXAA 3O12A 4N7UA 3ZSEA 1KS4A 1IOAA 1YI7A 3JD73 1UPIA 4JDNA 3O5SA 2ZGOA 2SBAA 1AXKA 3LWCA 2JE9A 1XU2A 1OHFA 2X5IB 4DRRA 2R0FA 1MVEA 4J6GA 1RUH2 1LGBA 5JLVA 3J9SA 2HWE1 3VBSC 1UU5A 1WW5A 4P9JA 1WW6A 3FX3A 2H6BA 4CDQA 1FNYA 4FPKA 3OGJA 1XNBA 2BNMA 5BNOC 5I0RA 5DZGA 1VBC2 4PLOA 4GALA 4YZ1A 3D82A 2CL2A 3ILNA 1BEV2 5H9RA 3AZZA 4RHV1 2ERFA 4WVVA 3RRDA 4XDQA 1XYOA 1D2SA 5JPMB 2LALA 4JGZA 5K7PA 4ES8A 1Y3TA 4LBQB 3KCXA 1CONA 4B4QA 3AM2A 2D6LX 2V09A 2BBVA 1YFYA 3FUOA 3VBRB 3KT7A 1UZZA 4I0BA 4LUMA 1KRIA 2HWE3 1W6QA 5F6LB 1QDCA 1AX1A 5JSOA 2GC0A 5J36A 1M4WA 2VPVA 3PMEA 2FZ2A 3B3QE 1WUVA 1VBA1 4Q1RA 4BOWA 4FAGA 1AJOA 1U5ZA 3I8TA 3AXEA 4AFCA 1N1TA 2DCJA 4RHV3 4RSUA 1LOBA 2MEV2 1ZVFA 2R16A 1X8EA 1PNGA 3PVNA 3JD72 5CAZA 2PLV1 3AP9A 4B4RA 2OIIA 2JX9A 4AW7A 2QKDA 3DL3A 4MZUA 1S0DA 1U12A 1ZX5A 4DS0A 4N53B 5DUWA 1ENQA 4M3CE 1GQGA 4CEYA 2FQPA 2ZOEB 1ULDA 3MLLA 4E4ZA 2YV8A 1Z78A 1VBA3 5GZFA 3APBA 4JC1A 3ZXFA 3S6PA 1YFWA 5KHJA 3UJOA 4GH4A 1PGW1 2JG8A 3QCWA 2VY0A 2CWMA 3FFZA 1AR81 4YLZA 1VBB1 2VQ0A 5FAXA 1J1TA 4AQ6A 1HV0A 4IQPA 4QX5A 1AF9A 4R9CA 4MGYE 4QM8A 1QNWA 2PLV3 2E7TA 1Q8QA 1HRI1 3S0MA 1C5HA 4L99A 4K7JA 1PGSA 4JAAA 1J1LA 4O9GA 4JRLA 3AMNA 1PGL1 4FQZA 2JENA 5HXVA 2VMHA 4FO9A 4LBMA 4YARA 5CFDB 1REEA 5I8YA 4FTBA 3VHPA 1RJ8A 4RHV2 3I2DA 1Y7BA 1ZRRA 1AR83 1RHI1 1VBB3 5F5QA 4CTEA 3ZVXA 2JDZA 3VBOA 3LSDA 3TNQA 1RINA 3WP6A 4AI2A 1GZWA 1DFQA 2Z42A 3WCSA 2A70A 1RJ7A 1LHNA 3N4MA 1HRI3 3THTA 2CAVA 1DU3D 1W39A 2QDRA 3D6EA 4BA6A 5KWRA 4RA0A 3LCPA 4HETA 4MVTA 2HEYF 2QCSB 4E2QA 2UYBA 1QOOA 2GC3A 1S0CA 1A8DA 4QD2A 4WBBA 1REDA 4B8EA 1VBA2 4FPLA 4QM9A 5CBLA 3FLRA 1MQTB 5I8TA 2ZPXA 5KHIA 1LCLA 1GZCA 4Z07A 1QY4A 3ZSLA 2WFPA 4GIQA 1Y43B 4K6BA 4COUA 1E57A 5FCCA 4IEVA 1RHI3 5C8CA 1G9FA 2PHRA 1CAVA 2EVXA 2PLV2 4COZA 1OKQA 3AYDA 1N3PA 1URXA 2XBO2 3BIWE 3ROUA 3H50A 4QQLA 3KGZA 1RL3A 3ZO0B 1RVF1 3P3NA 2O8OA 1NLRA 4IEUA 1Q8VA 1EAH2 4MXWA 4AVCA 4D7SA 4LBKA 1TNFA 2ZGSA 2X8KA 2ZAHA 1YIFA 5H9PA 1MS8A 2XWBB 1AJKA 4Q0VA 2R32A 4S2GA 5J09A 5C9AC 3N7KA 2OUHA 1PGW2 2A75A 5T50A 2XLFA 3IN9A 1DGRA 4P5HA 1AR82 2DU0A 4CDUC 1ULGA 1VBB2 2QZ3A 1C1LA 1TQ5A 5FO8B 1XRUA 2YMZA 2VXRA 5E16A 1VAMA 3PMSA 4AEDA 1MZ6A 2A5ZA 2ZGMA 5EWSA 1HRI2 2P2KA 4A3XA 2E6VA 1KD7A 3ES4A 4Q2FA 5TSWA 3RMXA 1O3TA 2XWJB 1RVF3 1ND2B 1SLCA 1YXWA 4YGCA 3TNPB 3ENRA 1N47A 3B5LB 3PNAA 1RUF1 2LTNA 3SMHA 5K0UB 4N43B 5T3NA 2XJTA 4JTNA 4IERA 3VKMA 2XJPA 4R4XA 4RGAA 1F9KA 3RDIA 2WC2A 4NHKA 4IEXA 1KQRA 1RHI2 1V70A 3OJBA 4D69A 4LO5B 4CDQC 1VAVA 5DXDA 2ZMKA 3WQ1A 3WHUA 5GZDA 3M4FA 4YW5A 4RD7A 1B35B 4XIKA 3R0RA 4Q4W1 1VB2A 4Q4X2 2ES3A 2AR6A 1ZBE2 3KGLA 2B39A 3MW2A 4OLLA 1IPKA 1KFUL 1OA3A 4AI8A 4JGZC 4DZGA 1NY71 1RUF3 2Z5WA 2HJIA 5I91A 4KG8A 2FMYA 1HQLA 4ATEA 1ZNPA 1MVQA 3WZ1A 2GMEA 1PO21 1KXGA 2EXJA 1SEFA 2A3WA 2JE7A 4Y1UA 4KU7A 5K9YA 1HKDA 2WT0A 1H9PA 1HW5A 3JQXA 3LSEA 3NO8A 1DYPA 1Q5OA 3AZXA 1ZRCA 5SV5A 1VALA 1ALYA 1DQ6A 1ENSA 1KS5A 1FV3A 3OF1A 1JW6A 1F5JA 4ISRA 3B93A 2EALA 3MDPA 4Q4W3 3H0OA 3KCYA 1J59A 1GSLA 1YCIA 3SH5A 4YZ4A 1BXHA 1ZZBA 2OZJA 1AHSA 4L92A 3WINE 4QGMA 3ZYPA 2RMU1 3AKRA 3R6SA 4LBNA 3JBG1 4L9BA 4ZXKA 1O5UA 2ENRA 2O8QA 4AK3A 1PO23 5BY5A 2ZGNA 4CEYC 1G9DA 4YSFA 3VL8A 1PZ9A 2CAUA 2NN8A 4MGKE 3ZMOA 4IV3B 3GZUC 4XJ8A 4AHYA 4FCAA 4GH4C 1WLTA 5BNOB 2XJQA 1RMU1 1ZREA 4WM7B 2DUOA 5GZCA 1V00A 3L2HA 1PO11 2VVEA 1RUF2 1VJ2A 4Y20A 4RGGA 3USUB 2BEOA 3U4XA 2RMU3 3GYDA 4P9IA 4B7KA 4QQOA 3JBG3 3OBTA 5KXDA 1HX6A 4HK9A 2GMPA 4J1XA 4RQPB 5LK7B 1VP6A 3J8F1 4LNVA 3FLPA 2DVDA 1QJY1 3CJIA 5T52A 2EAAA 5A3MA 2WNUA 1RMU3 4Q4W2 4IEWA 1HRV1 4YVWA 3H9AA 4FQ4A 3VBOC 3H3ZA 4QPIB 1XXNA 1PO13 3D0JA 4FPHA 1U0AA 1M06G 1KFXL 2GNBA 3RYRA 3WG4A 3AP5A 2E51A 5GLWA 4AVVA 1UKGA 3AP4A 4GB31 5T55A 2PHLA 3LKJA 4FXKB 1R082 1HQWA 2JG9A 2VU9A 3MIGA 2GC1A 3B9IA 1N1SA 2HWD1 2YGLA 4LTAA 4YG6A 1MACA 3U07A 2D40A 5FMOL 1JXNA 4PDWA 3WQ7A 4P9YA 3TN91 5CADA 3NWKA 5FDBA 3J8F3 2IC1A 5JIAA 2XLAA 1S0GA 1RUG1 1QJY3 3H1WA 1ZRFA 3OY8A 1XNKA 2FBEA 1BBT1 1SDWA 2UY8A 4CP1A 5FPXA 4OULA 1HRV3 5JR7B 2DF7A 1OSGA 5CG9A 3CL1A 1CIWA 3VKLA 4Y22B 4Q4Y1 2RMU2 1NG0A 4KGGA 3JBG2 1UU6A 5D8AA 4CP2A 1YJLA 3ILFA 5JAXA 5L7OA 1YUDA 4W6XA 4YM1A 4GB33 3VL9A 1N1YA 4HT1T 3AJZA 1EP0A 1OPOA 2HWD3 4JRAA 1PZ8A 1SBEA 1OA2A 3TN93 4WVMB 1PK6A 3B02A 1F2NA 1XQNA 2G4IA 2XHKA 1RUG3 1GZ9A 1RMU2 3H3UA 1QU0A 1AYM1 1VRH1 2DVAA 1BBT3 1UCXA 3LA3A 3VZJA 1RUI1 3HT1A 2HWB1 3POWA 4OUSA 3U10A 3ZIWA 1PO12 4HPKB 4AEDC 4BPZA 4NWVA 1OOPA 4QQPA 2BYVE 5HCAA 3EO6A 1W6MA 4Q4Y3 1HXS1 4FPFA 2Q1MA 4WVWA 4HK8A 4SBVA 5C8WA 1F8VA 4PQ9A 1YFXA 2DCTA 2AENA 5E8AA 1NE4A 3ZFEA 3ZXJA 3J8F2 3JB8A 4E9KA 5A33B 5CU1A 2ARXA 4CEWA 3V0AA 1QJY2 4D7YA 1TEIA 1RUJ1 3ZXDA 2CNAA 1AYM3 1VRH3 4MGIE 1HRV2 4Y26A 3ZSKA 2JEMA 1RUI3 2HWB3 1L3JA 4KBBA 1AXZA 1JYCA 4M0HA 1JOJA 3PHMA 3ZYJB 1LHOA 2H6CA 3V0BB 3VKOA 4FP2A 4RFT0 4GB32 1HXS3 4N9HA 5FQ0B 3KM5A 1RB8G 2VH9A 2VW2A 2Y0OA 4FT8A 2HWD2 4FTEA 4YGEA 3IMNA 1QF3A 3TN92 3UL2A 2BWCA 3FZ3A 3BCWA 1RUG2 1N3OA 1O4TA 2GH2A 4I3GA 2D7FA 1V6LA 3O0VA 1RUH1 2D43A 4XXPA 1RUJ3 1QQP1 4HFSA 1W6NA 3QH6A 3ZXAC 1LOCA 1RUE1 2QE3A 4GMP0 1ZBA1 4Q4Y2 1O3SA 1VBC1 2IWGB 3AMQA 5J37A 2AYHA 2V73A 2XJRA 5CNAA 3OYWB 2W68A 3PVBB 1QWRA 1GICA 2DUQA 2W0XA 3RMYA 1YI9A 2GSYA 4EN6B 1NCQB 3WG3A 4LBQD 4NHMA 2WLQA 3SNMA 1ONAA 1AZDA 1V9U1 4I01A 3PTYA 2IXLA 2DU1A 2Q5TA 4OI1A 1VRH2 1BK1A 3V65A 1RUH3 3KQRA 1RUI2 2PN5A 3L2YA 1QQP3 2H0VA 2HWB2 1CAXA 2P37A 1GQHA 3O7OA 4QHBA 1DLLA 3NV2A 3JCIA 1RUE3 5D1IA 1SLLA 1ZBA3 4EWDA 5CG8A 2F6BA 1HXS2 1SQ4A 1VBC3 4YNIA 3RSJA 4KL1A 1BEV3 4RS5A 3RNSA 1PIV1 3ZDSA 4QPGA 2UY9A 2MEV1 1BCXA 5C4WC 5C33A 1FI2A 2C0ZA 2BQPA 1V9U3 4FPOB 4JGZB 1JTZX 5DUXA 1VR3A 2JD4A 4XMAA 2VW0A 1RUJ2 2ZX0A 3DPRA 3MIEA 3IPVB 1SLTA 2IXIA 3ZSJA 5JWPA 3VZLA 3NVCA 3L9JT 4M3CA 3VBUA 2CTVA 3CJIC 4RR3A 4CYDA 1FV2A 1F31A 1SBDA 4R9AA 2VMIA 1O5LA 2D44A 4EJRA 1PIV3 4YVWC 1JUHA 2G9FA 2MEV3 4P9WA 3MIHA 4HKOA 4DINB 2DYCA 1G8WA 1ZZ9A 3NV4A 4HMZA 1D2QA 3AMMA 3R4SA 4CDWA 4OVEA 1GKBA 1R1ZA 3VV1A 3FLTA 4C1WA 5FBZA 3D0SA 1MZ5A 3AFGA 1J3RA 1QQP2 2JG9C 5EFUA 3Q9OA 1IKQA 4AVAA 1AL0G 1RUE2 4PDWC 1TME1 5JZGA 2E9QA 1ZBA2 4XE9A 3JU9A 4YVSA 4F3JA 1OFSA 4QQHA 4FBFA 4MGZE 3KS7A 4BQ1A 3PVOA 4KQ7A 1O3RA 4WZCA 5GLZA 4HSJA 2IXJA 1HQNA 4YM2A 4GH4B 2JG8B 4U36A 1DQ2A 1CAUB 5E88A 2KXLA 1CN1A 2IFWA 2H0BA 3AX4A 2QVSB 2GNDA 1V6NA 1LTEA 1V9U2 4KWJA 3ALQA 1W6OB 3WXPA 5D8AC 5L7OC 4AVSA 2VULA 3LB9A 3ZYIB 4A7ZA 3NV1A 5AVAA 5FREA 2W52A 2XJVA 3HN1A 2EXKA 5H9SA 3GBFA 1C5IA 4UW6A 4XF4A 1YLLA 4ZU4A 3KCCA 1TME3 1PK6C 1UW8A 3BOWA 4XHXA 4YG3A 1MS0A 4GMP1 1DF0A 4LLFA 3ELNA 1GR3A 2BFUS 1KDKA 1PIV2 2BVVA 3BODA 2JXAA 3AP6A 3LZZA 1TE1B 1H1MA 1CR7A 4IETA 3G7DA 4NOTA 3OCPA 1LOGA 4AHWA 1S1AA 1OOPC 1LENA 3A0KA 5FLIA 3AB0A 1WCDJ 1J58A 1MZFA 2XBO1 4M0NA 1GZWB 3KZ4C 1XU1A 5JOZA 4Y4YA 2PHWA 3S7EA 1WLWA 3WQ0A 4JDOA 1EAH1 4INDA 5AVPA 2ZHKA 4AHZA 1ZZ7A 3ZFEC 2BTVC 1G9BA 2R6QA 1KDMA 5EYYA 2FHRA 4C1XA 5FLJA 4CEWC 1RUNA 1KJRA 4CZSA 2GALA 1NZCA 4GMP3 3EXUA 5KC5A 3WNXA 4HVOA 3FFQA 2WFF2 1F5FA 1W6PA 4BIOA 1SFYA 5FRAA 5C8CB 1CAVB 2XBO3 2RJLA 2GC2A 3MICA 1NQDA 1I6XA 4XIOA 3M70A 2DCKA 3KB5A 3SISA 1EAH3 2WS92 3POYA 4GQ7A 5CVRA 4ORFA 3WG2A 1MZEA 4MXWB 2ZZJA 2ZBJA 3M3CA 3RI8A 1TME2 1MS9A 1QJU1 4QMAA 2XVKA 1QNYA 4FPCA 3IBMA 1JN2P 1UZYA 1FOD1 3VHRA 3WP5A 4Z1VA 5CA6A 2RM21 4DB5A 4MX3A 4Z92B 2HKXA 1CAWA 2K0GA 4IEQA 4LO8A 5BNNA 3WP4A 4EN8B 3H1YA 3CNAA 4AGRA 2XPJA 5L19A 3FBMA 1PVXA 2B9UA 1H4HA 4AEDB 5CFCA 5AC91 1UAIA 2NZ9A 4AEJA 1ASJ1 2AGSA 1SCSA 3MIFA 2VW1A 2EXHA 4XTMA 4AQTA 2OVUA 3IM0A 1KITA 4Q4X1 3ZMNA 4AFAA 1ZBE1 4FTSA 1QJU3 1U5IA 1OMIA 4HANA 4E4SA 1DGWX 1CD3G 1QOTA 4LBOA 1RIRA 1V6OA 1FOD3 2X29A 3BPZA 1HLCA 3J26N 3ME2A 3MGUA 3ZN6B 3D5OA 3I59A 2RM23 3KSCA 2GN7A 4DY3A 4I0WB 4ITCA 1O4ZA 2VNRA 1H2LA 4YW1A 2HEWF 4XF1A 1YHFA 1FATA 4LA3A 2ZGQA 3QD6A 4BE3A 1ULCA 2V5YA 2JICA 4E2SA 4HSLA 4I02A 5AC93 3LOIA 1IGOA 3FE5A 1COV1 2NP0A 2GNTA 1QH7A 1ASJ3 4RS5C 1BMV1 4QPGC 4HKWA 3VKNA 4Q4X3 4GKXA 3I4IA 1ZBE3 5F9TA 1CX4A 1D0GA 1DQ1A 2JECA 2B8MA 4URTA 1X8MA 4MXVA 2WSVA 1H8TA 1AR92 3CO2A 4HL0A 2XVLA 1GANA 4Y24A 2DVBA 3DPRC 1V6MA 3WR0A 1I1EA 5EYXA 4B7EA 1FPN1 1X82A 2FMDA 2BVBA 4AFMA 4Q8KA 1DHKB 1GBGA 3E5UA 3T1MA 3VBUC 2XUMA 4RR3C 2Y38A 3AZYA 4UBHA 4XQDA 2O0OA 5A3LA 2PA7A 4XFHA 1COV3 2XG3A 3X29B 1ENRA 4B29A 3HD8B 1OFNA 5LEJA 2ZS6B 2CWSA 4IEOA 1QJU2 1LHUA 1LECA 4CDWC 2WKKA 5E89A 2XLGA 3OBRA 3AZVA 3V64A 4F7ZA 1DQ5A 1FOD2 2ZGLA 4BZ4A 5DDJ1 5T5PA 2RM22 4KWKA 5A32B 4TYSA 3ST7A 2VUAA 3AP7A 5DUVA 2OYZA 4ZU7A 2D6NA 1LEDA 3O0WA 1H2MA 1FPN3 3BALA 5JZGC 3VBFB 3FBYA 2MHFA 1LRHA 3P3PA 2IZWA 5T54A 3VLBB 4YVSC 4AWDA 5AC92 4OHZA 2WQ4A 1ASJ2 4PLMA 2KA3A 3ZFFB 1WLDA 1C3HA 3NW4A 3TB0A 1U5XA 2QUOA 2PTMA 4FPJA 4TWTA 1IS6A 4TSVA 1ND3C 2Z2SB 3INAA 3VHNA 3KT4A 5DDJ3 4BHPA 1R081 4CP0A 2C1FA 2HWC2 2WL1A 1SLAA 3AYAA 2NMNA 2WA4A 1RUC1 2TUNA 1QJZA 3RYKA 2PAMA 4ONUA 2UURA 3VBHB 3MW4A 2TNFA 1H0BA 5J96B 1COV2 1NXMA 3W58A 2DCZA 4YW3A 1LHVA 1BMV2 4HKLA 3AYEA 2WNUB 5JPNB 3VDDC 4IV1A 2PYTA 1D4VB 1VLNA 3AJYA 2K2SA 2UU8A 2NPIA 4N90A 4I2OA 1Q8SA 4BH9A 4BLJA 3N7MA 1R083 3PLQA 1LULA 4P14A 3CJXA 1FPN2 2JG9B 3D4KA 3VBSB 2E53A 1X36A 4F8AA 3H7YA 5AFBA 3GNEA 4IEZA 3MPPG 1RUC3 1MR5A 1R1A1 1GNHA 2WNEA 1POV0 3J4UH 3ZX7A 1CPMA 2X5IC 2Y26A 4XF3A 5BXXA 4ASLA 4Y1VA 2A6YA 3ZYRA 2ZHNA 3OY8B 2D6OX 1DQ0A 2ZABA 2GMMA 4BMBA 1W2UA 5C4WA 2E63A 4EROA 2I2SA 1NOVA 2XB6C 4K20A 1PM7A 4OZXA 2XL9A 3TAYA 1OQ1A 3NSTA 5DDJ2 1CGPA 2UWBA 3MYXA 4PIXA 3K48A 3HWJA 4IEPA 4PIYA 4XHBA 4COYA 4AQ2A 5J98B 1BQPA 4FSJA 2Q4SA 2WZR1 1Q3EA 2DVFA 3WDXA 2E7AA 1R1A3 2UYAA 1PK6B 1SMVA 1A3KA 4LO6B 4AYUA 5IUQA 1IKPA 1QMJA 1A6CA 2VNOA 3HQXA 5BNNC 4PLNA 4UW3A 1A8MA 3IWZA 1YYNA 4OHYA 2P17A 4DNYA 1YFUA 2BNNA 2CGOA 4CDXA 2VECA 1H4GA 5CFCC 3AMPA 1QKQA 3DV8A 3WG1A 2ET7A 1W6MB 1QJX2 3FUQA 3VZOA 5JCTA 4JTOA 4JGYA 2C9AA 1SCRA 3W9AA 4LBLA 1S0BA 2ZGUA 1DZQA 2VNGA 1WD4A 2WQZC 4H3WA 3DN7A 1RUC2 4YZ3A 3HIFA 3ZIXA 2ILMA 3M2MA 4PJYA 3ZFEB 2WZR3 3MI8A 3RPQA 2QFEA 3AZWA 4X8NA 1Z7S1 4LHLA 1V6JA 2WSUA 1B09A 3V0AB 1QXJA 5JOXA 2YPJA 1GYKA 1Y9QA 4KGQA 4TZDA 1QOSA 2QJVA 4WM8A 5I0TA 2Z79A 3WV6A 1JH5A 3M3EA 3OD0A 4K1ZA 1EPWA 1XE7A 5KC6A 2VMGA 5FFOC 2ZX3A 3CLPA 3B01A 4WM7A 5J7MA 3IDBB 2ZX4A 1OQDA 2TEPA 4WVZA 4IL7A 1S55A 2RS51 2BUKA 4XFAA 3URFA 1H2NA 1RUOA 1R1A2 5DUUA 4L11A 1H8TC 3ZN5A 3NV3A 1UIJA 1AR71 3LA7A 1AR61 1Z7S3 4QGLA 3E6DA 4X6QB 4XJUA 2EAKA 2R1BA 4LE4A 4W6YA 1H1AA 3KMHA 1XE8A 5FO9B 3BB6A 1S0FA 4M01A 4MSVA 2PHDA 4D3WA 1S0EA 1W6NB 1IS5A 3DF0A 5B2GB 4YM0A 3UJQA 5JSRA 4RQPA 4UBGA 5CFDC 2RS31 2DURA 4QT6A 3THPA 4AEMA 2D6KA 5I0UA 4DMIA 2O1QA 4S2FA 3ES1A 4E2GA 1NA1A 4BMEA 1JBCA 4ISQA 1ZM1A 3I7DA 4K21A 2RE9A 1IZ3A 2AUYA 2ZKNA 4QPIA 2RS53 2B7YA 2WZR2 4DXZA 4PIZA 3ILRA 3PVEA 2ZCWA 4H55A 2A6WA 1AR73 1OI6A 1AR63 4Y1ZA 1NCRA 1LODA 2WA3A 4AXOA 2D98A 4Z8BA 2R072 4OI4A 1CAXB 1CESA 3MF6A 4LHNA 2GH8A 2RS33 3N7JA 1RC6A 2CGPA 2CGNA 1DQ4A 4XJWA 5JOWA 1NE6A 2OPKA 4XBNA 1G86A 1LKNA 2XGXA 1A78A 3QOPA 4RS5B 4QPGB 5K8SA 1LU2A 1SLBA 4OFGA 1VB4A 2D3PA 4Y22A 2I74A 2BGCA 1Z7S2 2D6PA 4I30A 3I54A 3MF9A 2Q0AA 4XBLA 5C9AB 4AHXA 1CVNA 2RS11 3GBWA 1AX0A 3OTFA 5DG1A 3DPRB 4CDUB 1REFA 1NYWA 1JUIA 4FPGA 3FMGA 2VVFA 3QLQA 5GZGA 4K1YA 4XFGA 1J3QA 1UIKA 1AVBA 3EBRA 4K40A 1IS4A 4M3CB 2A6ZA 4RR3B 1YIPA 2MPFA 5EV7A 2R042 2ET1A 4JQRA 3E6CC 4IV1C 1BVVA 2RS52 2Z69A 3S7IA 4Q29A 1Q8PA 3ZXLA 3B69A 4OHXA 5HI0A 2YGMA 1AR72 2QNKA 1AR62 5F1RA 1CPNA 2VG9A 4CDWB 3U0ZA 1ND2C 2RS13