3AKSA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
molecule tags Hydrolase
total genus 55
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aksA00
1HV1A 3B7MA 4S2DA 3VZNA 3HD8B 2C1FA 3LB9A 3WXPA 3MFAA 2JEMA 2QZ3A 3WY6A 2B42B 1HV0A 1REFA 2NLRA 1XNDA 3VHNA 2F6BA 2VGDA 2JENA 2B46X 3VHOA 2DCJA 3VGIA 1UU5A 2DFCA 1XYPA 4HKLA 5HXVA 3B5LB 1QH6A 1AXKA 1H4GA 2BWAA 3MF9A 3WR0A 3MFCA 3WP5A 1H0BA 3WQ0A 1BVVA 2Z79A 3LGRA 4XQ4A 4S2FA 4S2GA 3VL9A 1M4WA 1XNCA 4H7MA 3AMQA 1UU6A 3AMNA 4S2HA 3VZOA 1OA2A 4XQDA 3VZJA 2D98A 3VZMA 3WP6A 3AKTA 1XNKA 5EJ3A 3WX5A 4HKWA 4HK9A 1OA4A 3WQ1A 3EXUA 2DFBA 2BWCA 2DCKA 3VZKA 1H1AA 3VHPA 1OLQA 2DCYA 5K9YA 4XPVA 2D97A 3AKSA 3AKRA 3AMMA 1XYNA 3WP3A 1H8VA 1T6GC 1KS4A 1REEA 3M4FA 4IXLA 2BW8A 3O7OA 2VUJA 1XYOA 2VG9A 3RI9A 1OLRA 1TE1B 1HIXA 1PVXA 2VULA 3AKQA 2B45X 1UU4A 1F5JA 3VL8A 4HK8A 2JICA 1REDA 1C5HA 3MF6A 3AKPA 1KS5A 1YNAA 3AMHA 3ZSEA 3WP4A 1QH7A 3AMPA 1XNBA 1H4HA 2QZ2A 3WT3A 2BVVA 1NLRA 5K7PA 2NQYA 1C5IA 4XQWA 3VZLA 4NPRA 1W2UA 2DCZA 1IGOA 1BK1A 1XXNA 1BCXA 1OA3A 3VLBB 1ENXA 1UKRA 3RI8A 3WQ7A 4HKOA
chains in the Genus database with same CATH superfamily
2O8OA 2XVLA 3OGVA 3Q9OA 3HJRA 4MYEA 4RR3B 4N90A 5FRAA 2C1FA 3I3MA 3D0SA 3HN3A 4Y1YA 1UOBA 3AJYA 4LBMA 4PIXA 4DO0A 3O1TA 1O3QA 2R062 2VZ1A 4CE8A 3ACIA 2PELA 3FWEA 4XFAA 2VMFA 5JSRA 3V0AB 3QACA 1BXHA 3AB0A 3OUHA 4XUNA 4O9GA 5DZFA 5A33B 1HRI3 3L2YA 1XJAA 1YHFA 2OS2A 2YC2A 5ERLA 5A7WB 5FPBA 1W6PA 4PDWA 3GHNA 3MIGA 2F17A 1TG7A 3U1XA 3KCCA 1ASJ3 4QB6A 3JUUA 3I3DA 4AI1A 4L99A 4OUEA 4SLIA 4W6WA 4EWDA 4UOJA 4A2UA 5HPOA 2DFCA 1MS3A 4Z8BA 4Y1XA 2GSYA 3OPZA 1OF3A 3M3OA 1L7RA 5T54A 4Q4W2 5BNNB 3AFGA 4WM7A 5DAXA 3MIFA 4A3XA 2VMEA 3VBUA 5I0DA 1EUTA 5F32A 3WF4A 3FHIB 4QGLA 2C0ZA 2WABA 1YQ6A 1HB2A 4YM2A 2Y0OA 1DGRA 1GR3A 1N1YA 4GWIA 4M3CB 4B29A 1GNZA 5JWPA 1PZ7A 2WWSA 1PK6C 1BEV3 2JD4A 4H7MA 1CPNA 1ZRCA 3OD4A 1NE4A 3K4ZA 1JZ5A 5J37A 3PVOA 4KG0A 1ASJ1 2LTNA 3B69A 1C8NA 3ZFGC 4BH9A 3AFKA 1OFSA 4QB1A 3AVSA 4P5HA 1GZCA 1X9PA 2QQUA 5IAVA 4CCNA 2RM23 5IK5A 2XL9A 1JU4A 2BERA 1XNKA 2O0OA 3AKTA 3QH7A 5FYHA 1QNYA 4CDXC 4R52A 3HBZA 3MYXA 2D6OX 3A0NA 3KHBA 4GIQA 3VBRA 3ZN4A 3ACGA 2LM3A 2J1SA 5ISLA 1WA4A 1VBA3 1W03A 2BWCA 4CXYA 3N9PA 4XF4A 5A7OA 5T50A 2ARBA 5JXHA 1W2NA 4AVCA 4EROA 4LKFA 1AL22 4ISRA 5IVYA 5JUVA 1BEV1 3AJZA 3PUQA 1R1A3 4HN0A 4LQRA 2WS92 4V1PA 3M3EA 2D40A 2CYFA 1GP5A 1Y9QA 2GU9A 3NWKA 4F83A 4YVSB 2IXJA 2ZMLA 1HQNA 1DFQA 1T6GC 4G4FA 3UYJA 3MIBA 4XCAA 1BMV2 5A3PA 1VBB1 4I01A 4IDZA 2NMNA 1OVPA 4GA9A 3N7MA 3FFZA 4Q0QA 4TXWA 4AEDB 1I6XA 2IXKA 1OLRA 3H8RA 2X8KA 4JCKA 1IQAA 2HWF3 2XJQA 3CNAA 2W1QA 2BP6A 4KMQA 3ZR5A 3ZXEA 1VAKA 4JGZB 2JDPA 1VBA1 1R083 3K4DA 2JICA 2VE1A 4Y5SA 1A34A 3AKPA 3OJBA 1SEFA 1U5YA 1CWPA 3AMHA 2Q8OA 4P08A 2G9GA 2IWGB 1W39A 2ET7A 1R1A1 5CB7A 3H8UA 1GV9A 3POSA 4YG6A 4ASKA 5FPXA 2ZZQA 1O59A 2NZ9A 4BIOA 1H4HA 4PI2A 1YJKA 1RMU3 3KWVA 1AR83 3MPBA 3AM2A 2W5FA 2QQVA 3LIGA 2CGOA 2W87A 5JMCA 1LESA 1OUXA 1BK1A 4LKEA 2FMDA 4A45A 4EYUA 1BCXA 3AP7A 1KFXL 5FYSA 1JZ7A 2HWF1 2ZKNA 1TEIA 3FLTA 5EZWA 4Y5Z0 3K46A 1R081 2IUWA 4QXKA 4DB5A 3ZXJA 3LB9A 1XC6A 4GALA 2ERFA 4XJWA 3CQOA 2EXKA 3T4VA 4QPIB 4JKLA 4MADA 4Q4V2 4Q4X2 3MIHA 3NV4A 1SCRA 2H0VA 2TBVA 1STMA 4BHPA 5FOJB 2R16A 3WDXA 3TRSB 5IVJA 1L7LA 1O5LA 1ODNA 5FFOC 1RMU1 2IVIB 1AR81 2MEV3 4QPGA 4XW3A 2W9XA 5FREA 4GKYA 2WQ8A 4XUPA 5JSOA 3LZZA 5SV8A 4B4RA 3M70A 1WBFA 2QQLA 5FIXA 3VBHC 4BMBA 1KEXA 5FZHA 1J3QA 3SH3A 4FFIA 4TSVA 4Y33A 3RZHA 2P17A 3ELNA 2WNUB 5A7PA 3KMHA 3CJIC 1UMIA 5A3MA 1UOJA 1NG0A 2GC1A 4N53C 5GJ6A 3AXDA 3NNMA 2PMWB 3Q8FA 5F2SA 4LBJA 3GXUA 2Y34A 4CDWA 4J25A 3CZJA 3HAGA 1RUI1 3QH6A 4YNIA 2BBAA 2CV6A 5FYBA 1GP6A 2MEV1 3IPVA 2X10A 5FUPA 4A7ZA 4XTMA 5K0UC 2XJPA 1LHOA 2EXIA 3VD5A 3ZYHA 1W04A 3GZEA 2E6VA 4WVZA 3TEXA 4DMIA 1PIV2 4YZ2A 1COV1 2QCSB 4RQPA 4CEYA 4YLZA 2XH6A 3ZN6B 2R1DA 4ITCA 3AZWA 2RR13 1G9CA 1TMF3 3VBSC 4AOCA 4QX8A 2JG8B 3USUA 1E5IA 5JMOA 3ILNA 4L8QA 4NOTA 3E5XA 2YU2A 4IV1B 5IVBA 1JYXA 3T2PA 2BYVE 2OIIA 4KBZA 4GB33 1KJRA 2ZXQA 4IGOA 3VBOB 1ND2B 2VCBA 4LKSA 1RINA 3ZXLA 5D8AC 5A32B 4F3JA 5FZ8A 1IS4A 3WCSA 2JE7A 3AX4A 2W2IA 2WKKA 2FDKA 4FTBA 3J7NA 4Q1RA 3RZZA 5BNOB 1WCQA 3AZVA 3IDBB 2RR11 3IIAA 4LR4A 1TMF1 1RUE2 5FY5A 3KZ4C 5C9AA 4U36A 4WM8B 1OHFA 1OQEA 3JBG2 4QQLA 1FNYA 4BM8A 4YM3A 2RE9A 4IUGA 1JOJA 1QQP3 3JU9A 3PJYA 4R9BA 4CUAA 5F9TA 1CX1A 3WNXA 4LHNA 4GB31 1QH7A 2UYBA 4RN5A 1Y4WA 3UJQA 1KGYA 4EZ4A 1WMEA 4XAEA 1W9TA 4UF0A 1VALA 4Y24A 4LHKA 4XBLA 5FZBA 1MVEA 4P00B 2SLIA 1D7PM 3ORJA 4LEJA 3I3EA 5LEKA 4A44A 1LTEA 1LODA 2VY0A 1LCLA 1DCSA 1OKOA 2YGMA 3PUHA 4UWDA 4FAGA 5FWJA 4HONA 4GKXA 3T09A 2E53A 2R7EB 3TN92 2XJVA 3WDWA 1CGPA 1PNGA 5FDBA 1SPPA 4JQTA 4DY3A 3NW4A 1W2AX 4QHBA 5F3EA 1CAVA 4N43B 4RL7A 3WV6A 4QB2A 4D7SA 2J1AA 1QQP1 4I0WB 1TVGA 1M06G 5FPVA 1FATA 5A1FA 4HFSA 1EAH3 3J4UH 1AL0G 3MV11 3WDUA 3BTYA 4LO5B 1WGPA 4IE6A 3KF3A 1UWWA 2FBEA 5LW9A 4YYOA 1HQWA 1QOOA 1CJDA 4P02B 4PIZA 1MS1A 3EJKA 4COYA 2ZAHA 2BZDA 2QQMA 4OUMA 2OZJA 3CEWA 2KA3A 4HANA 3VD4A 1VR3A 4CRQA 1ONAA 4CDUC 4QT6A 4YFWA 5CFCB 1Z7S3 3NSTA 1F4AA 3FUOA 2BNNA 3I2FA 3NJXA 3PIGA 3NV3A 3ZFEA 1HW5A 2WT2A 1ZZ9A 1ND3C 1QY4A 1MQTC 4Q4Y3 1EAH1 3MIEA 4EN6B 4MGIE 4FT8A 3WQ0A 1JYCA 1BVVA 3H1WA 4BISA 1CESA 2DYCA 3H0OA 2W3JA 5FZ7A 1IHMA 4GAZA 2CAUA 3ROUA 4BJ0A 4YSFA 2HWE1 1K5MC 4Y1VA 5HV0A 2X5IC 4B3NA 3NAPC 1OF4A 1BQPA 1X9TA 2O1QA 3VZOA 2CSGA 2LUWA 1WZXA 4JKKA 5F3GA 3VD7A 4E9KA 1MEC2 1Z7S1 4CDQC 4A7YA 2BJSA 1QWRA 3K2OA 3WUCA 4CTEA 4YVWB 2XJTA 2WO1A 2WAAA 1DBNA 3JQXA 4OFGA 4Q4Y1 1QJU2 1UZYA 2EXJA 3BKZA 4YG0A 3ZMOA 3RZJA 3OY8A 4LBQD 2Q5TA 2BEOA 4PIYA 5H9RA 2VQUA 2UWBA 1GQPA 2JECA 5IJRA 5FXVA 1PGW1 3BOWA 4U2AA 3LDKA 2OUHA 5BNPA 3E6BA 4OQ8A 4JC1A 3WNOA 2XLAA 2QVSB 4A6SA 4AAXA 4C0BA 3MV01 4NVPA 3RGBA 4ONUA 4FPGA 3ZSJA 3RPQA 4NWWA 2WWJA 5DAPA 1C8M3 1WMXA 4X8NA 4MG2A 4AI2A 5JZGC 1XOYA 4IXLA 5I0SA 3V0BB 4NIGA 3VDDB 1EPWA 4JQRA 4KGQA 1TE1B 3VBFC 1X8EA 1PVXA 1F4HA 1N1VA 3ILRA 4OULA 1NA1C 4IESA 4E4HA 1AYN3 1D0GA 1NZCA 1QJY2 2EA7A 4JX0A 4KL1A 2QJVA 3PMEA 3N9MA 4M3CE 5GLTA 1YNAA 1PK6B 4IEYA 2UY9A 1LULA 2CDPA 4BIFA 4EN0A 3N9LA 4LUMA 3RS6A 4UBGA 5DQ0A 5LA2A 5FZ6A 4QX0A 3ZFGB 1SLBA 4IEVA 3N36A 5FXXA 2ZOEB 4HOOA 3LDBA 2RS53 3IMNA 4N8MA 3THTA 1UYPA 1S55A 4MV2A 2B9VA 2RS32 5FP4A 5A1AA 5KXDA 4AYUA 1RUC2 4RR3A 1LNSA 2DCZA 2GP3A 4XUOA 3JB8A 1GZTA 3QOPA 2R0FA 3ZSKA 1HV1A 2Y0IA 4IEXA 3V0AA 1PGSA 4LA2A 1BLZA 1BZWA 4OZOA 5LZ6A 1AX1A 1PZ8A 5A33A 1ZBE2 2J7MA 3P1IA 5LB6A 5ABJC 5A7WA 2HWC1 3PNAA 4FPYA 4XIOA 2Q8DA 4RHV2 4BE3A 2ILMA 4UI9L 2ZA9A 4RGKA 2JDYA 4G3YC 4RD7A 2AZ5A 3T30A 2RS51 4DS0A 1C28A 2JDZA 1RUH2 3O0WA 4HPKB 4KBBA 4URAA 3UNPA 4KGGA 2F6BA 1Z78A 5A1LA 2ZGKA 2B46X 5JR7B 5BNNA 2O8QA 2EF6A 3L9JT 5FY8A 5J48A 2OVUA 2WNVB 5DMYA 3OUIA 1YEWA 2R30A 2DF7A 5F6KA 2Q1FA 4BLJA 1MZ6A 1QH6A 4DIQA 3DKWA 2AH2A 3OPTA 4M3CA 3MW2A 5JOWA 2XGXA 4IV3C 2PHDA 5IHRA 1LOCA 4DRVA 5EFUA 3NRUA 4Y1UA 4E2GA 1OVSA 1S2EA 2HKXA 2J1VA 2RDQA 5C4WC 1AUYA 4FCAA 4E27A 1PVC1 5FY1A 4WZCA 3AMQA 2XOMA 3A21A 1ULOA 1X82A 4AFMA 4GQ7A 2D5HA 3I2KA 2Y8KA 2GNTA 1ZNPA 4XQDA 4XJZA 5KHGA 3SCFA 3LSDA 2BOIA 4DXSA 4OYUA 3THCA 3SCGA 3P3NA 4R4XA 2R063 5JXGA 4NRPA 2DVFA 4JDNA 2QQOA 2FDJA 1OA4A 2D93A 2ZHNA 3D5OA 4KWKA 1S0CA 4DQAA 3HNBM 2ENRA 2DCKA 5FPUA 1IZ3A 3POYA 4LORA 1CZVA 1C57A 1OPMA 3NJVA 3SEEA 2CHHA 1IS3A 2D6KA 2JJ6A 4WZFA 4YVSA 5AC91 3FJSA 3POWA 2FZ2A 3EQEA 4O61A 1W05A 2I74A 1ULFA 4KI5M 4ATFA 1SLLA 4CUGA 3RJ2X 3BN6A 2NM1A 2ZACA 1OLME 3CMGA 4AEDA 5JXJA 3S57A 3M8LA 4KU7A 1AR71 2LRPA 3BALA 4PI0A 3CZUA 4WBBA 4Q4W3 5A3OA 5FMOS 3FN9A 5K4LA 4JGZA 3H42B 5HXMA 3WW3A 2ORXA 3M2MA 4N53B 1HIXA 4Z82A 1XRUA 3UGFA 1J84A 4W6YA 4CXXA 2YBKA 1UMZA 4ARYA 2B45X 2DU1A 1F5JA 1W28A 1GWMA 4EV0A 2BNMA 2YB7A 4D7TA 3I7DA 2XQRA 4QX3A 3ZYGA 1UAIA 3SKJE 4CU9A 1GOHA 2YXSA 3C7HA 2W1UA 3ECQA 4NRQA 3WF2A 4BLIA 1WLCA 5DG2A 3ZYBA 2WBKA 1GOGA 2PHXA 3RYKA 1RXFA 3CDZB 3AMPA 2AYHA 5JSPA 1PNFA 5K0UB 3OPWA 5IVVA 4XDQA 2Y60A 3ST7A 4AXOA 1DQ5A 5GLVA 4UFLA 4Q4W1 3ENRA 1O3SA 1DF0A 3VBSB 3J8F2 2WT0A 1EV12 4S2DA 2VD7A 3VDAA 2D6MA 4QPIA 2E32A 2BQPA 1W6QB 2QQPA 1AL23 2PXJA 4CPBA 4PLOA 1JUHA 3EBRA 4HMZA 3V65A 3POBA 1SCSA 2L9LA 4B7KA 2NLRA 4DEVA 5A6ZA 4W4ZA 5D8AB 3ZYPA 1QJX1 2A3WA 1RIRA 3UESA 3VKLA 2I45A 3DL3A 4EQVA 3OYWB 3DYOA 2WNUA 1QOTA 1D2SA 2XKPA 1FOD3 1GOFA 2VGDA 2XDVA 3WZ1A 4CEWC 4Q26A 4IGQA 1C4RA 4FP2A 4IE4A 2AACA 4LMFA 2YY1A 1H9WA 4COUA 3T0AA 4UXAA 3D6EA 5LBEA 1GMMA 1ZZ6A 3K4AA 2V5YA 4Y1ZA 2IVJA 3NNLA 4JAAA 4XMIA 1AL21 5CZKA 3W20A 1VRH2 3SNMA 2OW4A 2VZUA 1YFXA 3MO4A 2WYSA 5AVPA 4J1XA 1PO12 2ETEA 4K3UA 4DPNA 3ZSMA 2VU9A 3VB9A 2ORZA 1UIKA 1LGNA 1XNCA 1WMFA 5LA0A 1X33A 4L9BA 2B7YA 1FOD1 5IUQA 5IK4A 1ZYBA 1GFF2 4QU1A 1KDMA 2GC3A 5JIAA 3ZN6A 4QQOA 2D98A 2W95A 2D6LX 1HRV3 4DEQA 2JG8A 3RG0A 5EJ3A 3WX5A 5LBFA 2CWSA 3GALA 4Y4RA 4CCKA 4IV1A 2RHPA 5IAXA 1I5ZA 2WFF3 1ODMA 4Q4V3 3O0XA 2WZR2 5F5QA 4XDOA 3VHPA 1B35C 3EMRA 1DQ0A 3VBOA 1ND2A 1S1AA 4PQQA 5JIUA 2IZWA 2VXJA 2Y6LA 1H6YA 3DYPA 4QPWA 2P3YA 1OFNA 2FDHA 2HBTA 3G6JB 4FFHA 4HVOA 4AW7A 3AMMA 1XYNA 5A32A 3W5NA 3NNFA 1H8VA 4XJ9A 2DVBA 3PUSA 5LWBA 4FOVA 2OZ6A 4CDUB 4QHOA 5BNOA 4LBNA 3OGGA 2XVKA 4ZONA 1REEA 1R64A 1BYHA 1HRV1 1XE7A 3MICA 4A3ZA 2JIGA 4WM8A 3RI9A 2WN2A 1OUSA 3JD73 4GMP3 4BQ3A 4B7EA 3A0KA 1VIWB 2A71A 2PQSA 2WFF1 4Q4V1 5LK5A 1PZ9A 1CQ9A 2ARAA 1H9PA 2E51A 5K8SA 3GJAA 2VNVA 3KM5A 2X53S 2XR4A 2FD8A 2Q1MA 2ET1A 5C5UA 1VMFA 3H8XA 1WMDA 2WYFA 1RUF2 3DPRC 3PTRB 3RMXA 4NHYA 1YIPA 2A6YA 4CDQB 1UX6A 3BCWA 1PIV3 3VUOA 2TNFA 1WCDJ 2NYYA 3JD71 4GMP1 4Q0UA 4N43A 2ZZJA 4FFFA 1T2XA 4KNCA 3HBKA 4ES8A 3BB6A 2XLGA 1QU0A 1TME2 3CKHA 4C91A 5I8TA 5A6YA 3I2HA 4TN7A 2D44A 4NMIA 3AYDA 5F5CA 5C71A 4Q2FA 2K46A 2KR2A 3IN9A 3LPGA 5C70A 2QZ3A 4GD4A 1FMD3 2P37A 2D7FA 2QNKA 5A3LA 4EN7B 5L19A 1NCQC 1NE6A 4LOTA 4NN0A 4XE9A 5FBZA 1Y7BA 4AFAA 4QKNA 3BU0A 2D3PA 3PL0A 5KXEA 1H8TB 3P6BA 5JZGB 1PIV1 5CFCA 1ZA4A 3WNKA 4HZFA 3BYWA 1LEDA 3VBFB 4DNYA 5C8CB 1J3RA 3ZXKA 1QJFA 3PURA 1NA1B 1W6OB 3ZR6A 4META 2EAAA 3JBG3 1QDCA 3SEPA 5F5IA 3VN4A 3O12A 3T0BA 1CAUB 1ENQA 1UY4A 1UYXA 1G6NA 1JXNA 4PLNA 3TB0A 1FMD1 5BPXA 1NYWA 2YPDA 4NAMA 3RZMA 4N7UA 3IAQA 4Z92B 4UW5A 2WFPA 1U12A 2E33A 1ZZ8A 3IIIA 5G05L 3VDCA 4HN1A 1G8WA 3JQWA 1RUG3 3LFIA 1GANA 3TAYA 2C4XA 4B1MA 2GMMA 1FYUA 2XVGA 1OA2A 1BK0A 3GF6A 4LE4A 4YVWA 5FZOB 5KHIA 2DVDA 4OI1A 1QXPA 1YFYA 4PDWC 4QGNA 4B4PA 3JBG1 3FBYA 4BU2A 1CZTA 4HKWA 1HX6A 1UXZA 3NV2A 3FL7A 4P9LA 3VKFC 2VBPA 4QU2A 5ABJB 3O1OA 2QQKA 3ATGA 1XU1A 1PM4A 5FO9B 2WO3A 3WVJA 4BXSV 1OLQA 1UPIA 2VCAA 1KXGA 4WM7C 1HRI1 4XF0A 4CYDA 3V64A 4XMAA 1SBEA 3GYDA 3VBUC 4YZ1A 3P5BA 3C8XA 4HT1T 5EXOA 3WP3A 4LJHA 1RUG1 4ES9A 4EE2A 4RA0A 1QXJA 2JD9A 2WN3A 3VDDA 3B94A 5FKCA 1POV3 3ZO0B 4AGGA 4NHXA 3WG2A 4Y4YA 2VUJA 1LR5A 1FPN2 1JMUB 1JH5A 4PBPA 1A8MA 1Y43B 1RGSA 2BGOA 1RUD2 3ZYFA 3TEWA 2J1EA 2CGPA 1JOPA 4IV3B 1UU4A 4YGCA 4TWTA 2FDFA 1AXZA 1REDA 4H7LA 4AG4A 5ANNA 3UK9A 1KS5A 2AC1A 3OF1A 3ZFGA 3KVBA 3HQXA 1S0EA 5CG8A 2MHFA 3VBRC 2B39A 4ZS3A 4P14A 2B9UA 3R4SA 5FO7B 3ZDVA 2I07B 3POIA 4TLGA 4KQ7A 5C3OA 2BVVA 1LOAA 3RYRA 1AR92 5K7PA 2NQYA 1MEC3 5DUUA 1POV1 4Q27A 1H30A 3NL1A 2C26A 1VMJA 1N1TA 1W2UA 2OYZA 1XXNA 5ACA2 1X8MA 1LGBA 2QTWB 4ARXA 3W9AA 2RM21 2JKXA 4QQHA 4YFZA 4XFHA 1QJU3 4JDOA 5GZCA 3O1RA 1W9WA 3PU8A 4LPLA 1VB2A 1O7FA 1WLTA 1TNRA 1Q3EA 1R1ZA 2R0HA 3NNJA 5IT6A 4PHZA 1BKZA 2W46A 1WA6X 4M01A 2XJRA 3T3YA 5A6QA 3POGA 4ZU5A 5T5LA 1FXZA 1RHI2 1X50A 1YO8A 1LB2A 4HPKA 4NO4A 1VBD3 1D4M3 1W0OA 1URXA 4YZ3A 1XE0A 2PLV2 1UIJA 4FTEA 1NCRB 1MEC1 2D6NA 2X05A 5E16A 1LECA 2WNVA 1V00A 5AFBA 2E63A 1SLCA 2VW2A 1ZZBA 4LITA 3RMYA 3GHMA 2DCTA 3THDA 4FPFA 4DXZA 5J1XA 4A42A 2Y38A 2CGNA 3ZMNA 2GH8A 1QJU1 1WD4A 1MPXA 2W39A 5FTTC 3B5LB 1QJY3 2ZGUA 4NAOA 4OHZA 3SC7X 1H4GA 4YW6A 3SQOA 2E7QA 2ZGNA 1W8TA 4XF1A 2HWB2 1LRHA 2GNMA 3GJBA 3KV4A 1VBD1 1D4M1 1S2KA 4I0AA 5FMBA 5CYYA 3ACLA 1PX3A 3VL9A 1M4WA 1HKDA 1H6XA 2RS33 3V56A 2C5DA 5JOYA 3TEZA 5IYYA 4YM0A 2XWJB 2JWPA 5CEHA 3S5QA 3GZUC 2JDAA 3K48A 5E1RA 1W8ZA 2VAUA 3IDEA 4AVBA 1SFPA 3RJRA 3HOBA 5J36A 1WW6A 4QPGC 3JCIA 1QJY1 3I8TA 1S0GA 1FT9A 1V0AA 4XTPA 3X29B 1HDKA 1ZBE3 3ZPOA 2K9ZA 1FI2A 4F7ZA 4A4AA 4NE9A 5FZMA 2WL1A 3U11A 1OD5A 2RJ2A 1LOFC 2VZRA 2CU5A 4RHV3 5FZ9A 4B8EA 1JYIA 3SH5A 2PAKA 1UQXA 5J7MA 2OKXA 3UETA 3THPA 3J9SA 4LO7A 1RUH3 3R05A 2HH9A 2RS31 1L3JA 1RUJ3 4R9CA 3WW2A 4CEWB 4CP2A 3T0DA 3I3BA 3F2ZA 4LE3A 2ZX1A 2EICA 1WWYA 1UZWA 2RV9A 3PMSA 4WVWA 5FZGA 4QPYA 4C1WA 2V72A 2YMZA 4LBOA 4N53A 4PT6A 3WCRA 2BTVC 3L2HA 4LNVA 1LKNA 2DUQA 1ENSA 3H1MA 4GMP0 3ITQA 3JZVA 4I0BA 4JDMA 4LKDA 4O65A 5BXXA 5DAWA 5CISA 1ZBE1 1RITA 1Y9MA 5FYYA 1PGL1 2UYAA 1K45A 1YXWA 4X8PA 3FLPA 4DXRA 4ZU7A 4PF1A 3BU7A 4K1ZA 4Q8LA 4RHV1 1IKPA 4YGEA 2CL2A 2XBO3 3SMHA 4GJZA 1YC61 2WNOA 5K0UA 2IC1A 3RWKX 1VJ2A 3HVDA 4FXGB 2GNDA 2RDNA 1Q5OA 1OMIA 1RUH1 4JRAA 4SBVA 1RUJ1 2W47A 3WINE 1W8UA 5IFPA 5EJZB 1DU3D 4D6QA 2WO2A 1VPHA 5FZEA 5IVEA 1V9U3 3LA7A 3T1MA 3K51A 1HJGA 1UMHA 2VOTA 4CU8A 3VBSA 3GBWA 3K77A 4XQWA 3VZLA 4YRDA 4O7XA 3HEIA 3KB5A 2QKDA 2VXRA 1CZSA 2FHRA 1O4TA 1UD1A 2WA3A 2ZX2A 1L7QA 4LTAA 1K12A 1UNBA 1H2MA 3OBZA 3WQ7A 1W6QA 1YFWA 2W1SA 2HWD2 4HLTA 2GP5A 4GWMA 4NIDA 1JYTA 2VZQA 1N3PA 1CAWB 1B35B 1QNWA 2XBO1 3ZFFC 2GH2A 3HR9A 1XNTA 1P8JA 4A7KA 3KLSA 5D8AA 1GLHA 3U14A 4DXTA 2JEMA 5EHDA 5FZIA 3PU3A 4D8MA 3OYWA 5C9AC 1ZRRA 1V9U1 3SCHA 4PF5A 2XUEA 4XJUA 3UKTA 1YYNA 4XFBA 2K0GA 5EJ1B 3NKGA 2YBPA 4UBHA 5JI7A 2OA2A 2Q8EA 1VE0A 1W6MB 3AC0A 1V6NA 4LXLA 4HXCA 4CPBD 1SBDA 4AEKA 1GYKA 1R092 4ZXEA 3OEBA 4NRMA 4AVTA 1BBT2 5L7OC 3MF9A 5GZDA 3WR0A 1NXMA 4JRLA 5F3IA 4EN8B 3NVCA 4J6GA 3ZYIB 4LK7A 5A6XA 1SACA 2VR4A 5LA1A 2XMLA 5FP9A 4AZZA 3WHTA 2R072 2DTWA 2PN5A 4UW3A 3DCQA 5B2GB 5CNAA 3LPFA 3OEAA 1QOSA 3J8F3 2MNGA 5I8SA 5JR2A 4QHZA 1EV13 1AYM2 3E5QA 2GC0A 4ORFA 3I54A 2WSUA 1AF9A 2C9KA 3MIDA 2LW8A 5FY4A 1UY3A 1DGRN 1OQDA 2P3KA 2X29A 3F95A 2PTMA 4YW7A 1V70A 2A3XA 4K9SA 4YARA 2FDIA 1I5PA 2D5FA 4UFIA 4AHZA 5KR7A 4CVUA 4XEZA 1G7YA 1Q8VA 2PAMA 3FE5A 4CDUA 4D94A 2ZKLA 2Q8CA 2DVAA 5IK7A 3RWNA 2JKBA 1POV0 4LHLA 4MHRA 3DN7A 1J58A 3LCPA 3J8F1 4OI2A 1HB3A 4IETA 1EV11 2A6XA 2KM2A 2HBUA 4HBNA 4XZPA 1VBB2 4GWNA 1NQJA 1IG0A 4FQZA 5FYTA 1UW8A 2B5HA 3WOGA 4CP0A 3OCPA 2VNGA 1A8DA 3KCYA 4HVRA 4P9IA 4UW4A 2PA7A 1PO13 4FI9A 1GZWB 4COVA 5M0TA 3WP4A 2WZ8A 2DU0A 1QXRA 4ZPIA 1JODA 1YI9A 1K5JA 2XKOA 1SG3A 3B01A 4CDQA 5JDBA 2YROA 3ZXAC 5KBFA 1QHDA 1IQDC 4XDPA 5JOXA 1NLRA 2P6CA 5CFDC 4V2VA 4GXLA 1GU3A 5FZ3A 5BNPC 5J96B 1DYOA 1ACCA 4UFMA 1OSGA 2CTVA 1N3QA 3BTAA 2WLPA 4LUKA 1QEXA 3LDRA 4F8AA 2WZR3 2AREA 2JDKA 3HD8B 4BK5A 3AVRA 1OH3A 4Y5TA 1ZREA 3I59B 1LHWA 2HWF2 5CIRA 1HN0A 1PO22 2ZAAA 1DLLA 1R082 2XLFA 2RMU2 2J42A 1D2QA 5FZ4A 5CA6A 1W9SA 5DPNA 4I2OA 3ZN5A 1AZDA 1WKYA 2A6ZA 1H8TA 1HV0A 1REFA 2VC9A 4W65A 3BGAA 3UGGA 4AEJA 5JZGA 5BY5A 4BQXA 4XBQA 3I2JA 4AVVA 5L9VA 1I1EA 3VBFA 3LQCA 1YI7A 5C8CA 5LATA 1PMJX 1RMU2 1NA1A 1W6OA 4Z2WA 3S7EA 1C8M1 3BI3A 1CIYA 4QKDA 4NJ4A 5DUVA 2VUCA 2A6WA 4AGVA 4CDXB 2VH9A 3GZTB 4JGYC 2WZR1 3E1F1 5C5TA 5HCHA 3ES4A 2R043 3WG1A 3RZKA 1JS9A 4D0QA 1AYN1 3WSOA 3ETQA 1GBGA 3SKVA 3MBWA 4X6RB 4JTOA 2JIJA 1DDLA 3N7LA 5CADA 4XQ4A 1RUF3 2WAOA 3WF1A 2W92A 3O1UA 2BDRA 2P6HA 5LY2A 3ZXFA 1HXS3 3HT2A 3KT7A 4I3GA 2BV4A 4IE0A 1F15A 1RUI2 4L0PA 2VQAA 5FZOA 5I8YA 2MEV2 1UU6A 3SXWA 2G19A 4BQ4A 2BGCA 5FK7A 5FOBB 1WD3A 4QX7A 2DVGA 4BMEA 5FJKA 5ABJA 4N7IA 1HQLA 3TYJA 5FZ1A 3VKOA 2R041 2YC0A 1CJPA 1LHUA 2RG4A 3BTXA 1NOVA 5FMOL 2FZ1A 1COV2 5L36A 1MZEA 1OD3A 3KS7A 3EXUA 1Q8SA 1W8HA 2NN8A 3FHAA 3AYAA 3U0ZA 2A3YA 3ASIA 3I4IA 3M7AA 4CCEA 2VW1A 5A3NA 1RUF1 1NY72 4MO3M 3WLUA 2GNBA 2XPJA 1HXS1 1UOFA 5GZGA 3R4DB 1W9FA 3DECA 5FLJA 4NIHA 2A7AA 3AKRA 4XHXA 2ZHKA 3Q8CA 4C0HA 1VAMA 3WG3A 1DQ2A 3LD8A 3E6CC 3IMMA 3DF0A 2ZGTA 4AK3A 5FUNA 3N9NA 1LU1A 5FZAA 1MZ5A 1W06A 2AR6A 2ARCA 2OXBA 4IV3A 2JDUA 4HETA 4E8DA 5IVFA 1FV3A 2UURA 4NHLA 4DINB 3RZGA 5I0TA 5CAZA 1JTZX 1DQ6A 2ES3A 1A3KA 2A5ZA 3QCWA 1XE8A 2ZMKA 2V5DA 4RGAA 3AKQA 1C1LA 3J26N 1IOAA 2WA4A 3BVCA 5FZKA 3UT0A 1IKQA 2VOKA 1TMF2 3LA2A 5CKMA 3URFA 3ZOIA 4BA6A 4D6RA 1IG3A 5FYIA 1LAJA 1UZZA 2DTYA 2IXCA 3IBMA 3I2OA 2PHUA 4XJAA 4AHWA 2WDBA 1AX0A 3T2OA 1V6LA 2WQZC 1CAXB 2VVEA 4M0NA 3KT1A 4H55A 1OH4A 3ILFA 2QZ2A 3VBHB 1S2BA 4H2AA 4MLOA 1YRZA 2VNRA 2PHTA 5DABA 5LEJA 4YVSC 2QQIA 2XL7A 2ZX0A 3CJIB 4QX2A 2F4LA 5EPAA 5FJHA 3OBRA 3N9QA 4WVVA 4YG3A 1OBNA 2VVFA 4JVAA 2R061 1SQ4A 3CF6E 4A41A 5FUIA 3ZM8A 4CCCA 3IKWA 3TOJA 2Q0AA 4JGZC 1E5HA 1ALYA 1UYYA 3RDIA 4INDA 1QDOA 1NCRA 1UCXA 1CPMA 4KH9A 2B42B 5BV6A 3AZXA 3B93A 3USSA 5KHJA 1DIWA 2E7AA 4WV8A 3UKNA 4EWEA 4MUVA 4Q0SA 4RFRB 3FHQA 3UV9A 2JENA 4HSJA 1XU2A 3BPSA 1FPN3 2DCJA 3WNLA 1RUD3 3B9IA 1WLWA 5GALA 4MX3A 3CLPA 4IE7A 4AI3A 3PVEA 3ZXGA 4CU6A 5HCAA 4AHXA 4K20A 3T2QA 2GMPA 3CO2A 1Z0HA 3W5MA 1RJ7A 2IFRA 4LBKA 4XF3A 3O14A 5L9RA 3LGRA 4UAPA 1EAH2 4QQPA 1E5SA 2WS93 2IXLA 1UY0A 3MI8A 5F39A 5A7SA 1MS8A 2OPWA 3AYCA 3WF0A 4FVVA 1JU3A 2PYTA 3AYEA 4QAWA 4AR2A 1OOPC 4FPHA 3RRDA 2B8MA 5APAA 5ACA3 1FPN1 1IPSA 2HWE2 4IEQA 3TNQA 1RUD1 4G9SB 3SH4A 4OUSA 2QBXA 2WNUC 3ZFFB 1Z7S2 4QDRA 3LF7A 4HK9A 2VNOA 3ON7A 2OQ7A 2E9QA 3GZAA 3DGTA 3VKNA 3AZYA 2RDRA 1G9FA 1GSLA 4JTNA 5C9AB 4Q4Y2 5DDJ2 4QQ2A 4CEWA 4IE5A 5LY1A 1S4CA 2PLV3 2UY8A 2WS91 5DAQA 1POQA 2D97A 3TBDA 4XURA 4J1WA 4AQ2A 2IFWA 3HMYA 2C6SA 3MGUA 5F7UA 5I93A 1WLDA 3PHMA 1BMV1 1F2NA 3POEA 1J83A 1PGW2 2J1UA 5B4XA 5ACA1 3O1PA 1AX2A 1W3XA 3LOIA 3U4SA 2XWBB 5LBCA 3OSDA 1J59A 2YPJA 4I30A 2JG9C 2ZGRA 3N3HA 2VBDA 4FXKB 2VULA 5L7OB 4IERA 2ZHLA 1BVP1 4M0HA 1C1FA 2HWB3 4PBOA 1KDKA 3OTFA 1TZOA 3D3AA 3ME2A 3IWZA 2W91A 1G9BA 4Q4X3 4YW3A 2JG8C 2GN3A 2VO5A 2ZCWA 4IW3A 4GH4C 3R0RA 5T55A 5F1RA 4IV1C 4MVTA 3ZYJB 4AAPA 4MZUA 5J09A 2PQQA 5LRRA 3S0MA 4DZGA 1UKGA 2VTXA 3VBOC 2N7GA 5DG1A 2NPIA 4FPLA 1NT0A 4BPZA 4AQSA 4FBFA 3FLRA 3VLBB 1CAWA 1O3RA 2G9ZA 5FYMA 2BOJA 2HWB1 1WCKA 1ND3B 1SHWB 3QLQA 3ZIWA 1MQTB 3G7DA 4JHTA 4I02A 2DURA 4Q4X1 2YZ4A 3WQBA 1SLAA 2ZBJA 2XUMA 1YQ8A 4PCRA 4QDQA 1RYYA 2ZGPA 1JYWA 4D69A 3MFAA 4BB3A 5D21A 3K75B 4Y26A 3WY6A 1DQ1A 1T6BX 2HWC2 4AEMA 1N3OA 1US3A 1K5MB 4N9IA 2R32A 5FMCA 1RVF2 2WRAA 5A80A 2WZPP 2X5IB 3NAPB 2WLQA 1W6MA 4XYXA 3WD5A 2RS52 1VBC2 3BODA 1TQ5A 2AEYA 2JDHA 3GGLA 2QQJA 2WJSA 5D2AA 4IEWA 4XF9A 5FZDA 3TEYA 4QMAA 2LROA 2VZVA 1UZVA 2VUAA 1Y9GA 4CU7A 3KHCA 1AXKA 1LOEA 1W3VA 1AR62 2BWAA 2GAUA 3KF5A 1G9DA 3C7OA 4YW2A 3FBMA 1KRIA 4P9GA 3WW1A 5IW0A 1V6IA 1WUVA 1KD7A 2YFZA 1MS4A 1OC1A 4IQPA 3LWCA 4BQYA 3N4MA 2ZGLA 1O6UA 3AL6A 1FV2A 5CFDB 3ETPA 4K6BA 2IXHA 4ZY9A 1W0NA 3IB3A 3KQ4B 2NP0A 2YGLA 4TYSA 1VB4A 1PVC2 4DY5A 3KD4A 4RS5C 1D0HA 2D6PA 3HNMA 2ZEYA 3MW3A 1VBE2 4AVSA 5LRSA 4YZ5A 1YUDA 1RUE3 3PJQA 4HSLA 4CCMA 5CFCC 2P3IA 2ZPXA 1NLQA 3ZDSA 4CZSA 2JE8A 2VZPA 3WQ1A 4BYYA 5F6LB 3A23A 4HG6B 3U78A 4BOWA 5I91A 1E57A 5FP3A 4C8DA 1ZBA2 5HBAA 4L11A 4LULA 1Q43A 3AKSA 5FY9A 3EO6A 4LLFA 1ZRIA 1U0AA 3H3ZA 4OMDA 1OURA 2WNEA 3WHUA 3ZIXA 5AC92 3PUAA 4CXWA 2WQ4A 3HQUA 2WSVA 4FOYA 5KC6A 1MACA 3EYPA 3TN93 2B4KA 4JGYB 3T2TA 1QKQA 3BPZA 5C33A 1R093 1RUE1 5C3RA 2VG9A 1O5UA 1BBT3 1AR72 5T52A 1MVQA 1WBLA 1H2NA 2V4AA 4GWJA 1GZWA 1OXCA 4I09A 3BOPA 3KCXA 3N7JA 3ACHA 4LIVA 3C3VA 4XILA 3HN1A 4YVWC 3DUIA 4XFGA 5EYYA 4OHYA 5FYVA 1S0DA 1OPOA 2H6BA 1NLSA 2WINB 1ULEA 2VL4A 3H1YA 5EYXA 4XUQA 3ZKYA 2CAVA 2R073 3OGRA 4O9EA 3WF3A 4DUVA 2GZWA 1PMIA 5FY7A 5LK7B 3B3QE 3AL5A 3WDTA 5FKBA 3VD9A 4CSWA 4FOWA 3C7GA 3TN91 1MZFA 3V0BA 1AYM3 1YCIA 4P9XA 5CU1A 1WW5A 4CA9A 4OMCA 1R091 3WW4A 2JDMA 1ZVFA 1YQCA 2DV9A 3LEKA 4YW4A 3I59A 1BBT1 3ZYRA 1J1TA 2YV8A 1LHVA 4UW6A 2VCCA 3VDDC 4BDVB 1DQ4A 1UXXX 2YBSA 2GN7A 1PK6A 2UWAA 3S30A 2YG0A 4UT5A 4AF9A 2DUPA 3RFRA 4BQ1A 3ES1A 1QJZA 2EALA 4V2WA 4XBNA 5A7QA 4P9YA 2VZOA 3FZ3A 5C4WB 3AP9A 1S0BA 2R071 3AXEA 5CVRA 5A70A 1OQ1A 2ADDA 2ZMNA 1WCUA 4RGGA 2G1MA 2LS6A 1PX4A 2Y26A 3KV9A 2JDNA 3H3LA 3U07A 1AYM1 4AL9A 2BFUS 3HPNA 1QJX2 4CDXA 3FX3A 3C7EA 2EIDA 2VZSA 1VBB3 5FMDA 4CCLA 2YUEA 1OT5A 1ULDA 1DYKA 1XYPA 5FCCA 1DZQA 2VW0A 5JVVA 2E26A 2AUYA 3OBTA 1PHMA 4NUBA 3BTZA 3ALQA 5SV5A 4Y20B 2BPA2 2H0BA 1TNFA 1W6NB 1O3TA 4XXAA 2VMCA 2J1TA 4QD2A 4FTSA 5GLWA 1ULCA 1O8PA 4LOSA 4MSVA 3RZLA 1QMJA 5DXDA 3O1MA 3QD6A 1Q8OA 4ZXKA 3I49A 3LSEA 5G04L 2VTFA 3AMNA 1XPWA 2Z5WA 4D3WA 1FOD2 5F3CA 3VZMA 2V09A 2XHNA 4E2QA 2WNVC 2Y64A 4NHKA 1ST8A 3C7FA 4QKFA 1PO23 1CD3G 1ZX5A 2P5BA 1UO9A 1WW4A 1IS5A 2OQ6A 2VOVA 3T08A 1EY2A 3U10A 2TUNA 2RMU3 5AFEA 4OLLA 2IXIA 4A6OA 4AI8A 1U5XA 5FXZA 2DCYA 2XB6C 1RUNA 2EIEA 2PAEA 4K7JA 1H2LA 5B4NA 1SMVA 5GZFA 1RUC3 4FPCA 4WVMB 2VJXA 3NKTA 3MUY1 5GKAC 4Y22B 3GDBA 5JI9A 4YGBA 4FAHA 5HCFA 1PO21 3K3OA 1HRV2 4QX1A 2RMU1 1JW6A 4AI0A 5C8WA 1O4YA 1G9AA 1C5HA 5A7NA 1CAXA 2WFF2 2QE3A 3H3UA 5LASA 4FOQA 3GNEA 4CCOA 5DN2A 3ZSEA 3VBHA 1RUI3 3AP5A 5CKNA 1OOPB 2QDNA 3P3PA 3S7IA 5FP7A 3TWIA 1RUC1 5TSWA 4CDWC 1Q8QA 3CJIA 2QUOA 2Z42A 1NKGA 2VBBA 3ZLIA 1LOFA 3VD3A 4XJ8A 3I2DA 5FQ0B 3U37A 1RL3A 5C3PA 1X7NA 4MH0E 1UKRA 3OD0A 1COV3 4XFFA 3RI8A 1KQRA 3PVBB 4R8HA 5I0UA 2W0XA 3JD72 3MEPA 4LO8A 2WIIB 3CHXA 1F9KA 3NJZA 4K8FA 4BQ2A 2Y6KA 1LHNA 3WXPA 1CONA 1Q56A 2P34A 3KGZA 4Z2AA 4NIAA 1AJOA 4RQPC 4CEYC 2OT7A 3KQRA 4FPEA 3PVNA 4LA3A 3E97A 5CG9A 3VHNA 2GC2A 4AGRA 1EUUA 3OUJA 1JZ8A 4FO9A 3HT1A 1NUKA 4MXWB 1JN2P 2HEVF 2TEPA 1O8SA 1RXGA 1LEMA 1S0JA 2JB8A 2JG9B 1GUIA 2X09A 1SDDB 4LT5A 3B9CA 3GCWA 3VGIA 4M4PA 4LBLA 3UJOA 4R9AA 1QJEA 3AP4A 3M3CA 5FAXA 4RYDA 4UFKA 2EAKA 5EV7A 4XABA 1G86A 2RS12 1NY71 3KV5A 4GH4B 4QDSA 4BK4A 1XBFA 3NV1A 1UYZA 2A6VA 1UZ0A 3D8CA 2CNAA 2Y6HA 1CVNA 2ZTNA 4UFJA 3H7YA 1FMD2 5FK8A 4M4RA 4HL0A 1GNHA 2WC2A 4AI9A 2YDEA 3WEZA 1F35A 4S2HA 4W6XA 3ZFFA 3BUCA 5EIYB 4LBQB 4XAAA 2VECA 5F8PA 5L9BA 3INAA 2RVAA 5C3QA 3Q8EA 4ZKTB 1SZBA 5LBBA 4RFT0 1SLTA 2ZS6B 4KWJA 4ZHNA 5JOZA 5T5JA 4EZHA 1O91A 3NNGA 1H1AA 2W1WA 3WNMA 1C3HA 4ASMB 5E88A 3TNPB 4CP9B 4URTA 5FY0A 3O5SA 1RB8G 4MGTA 3DPRB 4NHMA 4XFCA 2C24A 4K1YA 1HRI2 4JV4A 1FAYA 4XXPA 5FBJA 5ANQA 4TTGA 3N35A 5C7GA 3WG4A 1HJFA 2E7TA 3POFA 4Q29A 1RUG2 2VMIA 5GLUA 5L7OA 2AEZA 3M4FA 4ASLA 3LIHA 3U4XA 3ZSLA 1ASJ2 1XYOA 1RTVA 2ZX3A 3CU7A 4QM9A 2F4PA 1J1LA 3DEMA 4P5YA 3PLQA 4YPJA 1NZIA 2H6CA 5A3TA 4JHZA 4Q0PA 1SLIA 4BQ5A 4HK8A 4Z07A 4LK6A 1BHGA 2CDOA 3HIFA 3O1SA 5C6CA 1VRBA 5DUWA 1GICA 4ZZ8A 2DDUA 4Q0VA 4COZA 1DYPA 3ZFEC 5F37A 3DXUA 1XNAA 3Q8BA 1DLCA 1NCQB 2ATFA 2RDSA 4CUCA 5KXBA 2ZEWA 3I3QA 4M00A 2EIBA 1OKQA 2HWE3 3AZZA 2A1XA 4RS5B 3MHZA 1YQ2A 1BEV2 3T4HB 4GZ9A 1CIWA 1NQDA 5JLVA 1IGOA 1ND3A 5FO8B 1MS5A 1MQTA 3GBFA 4UFHA 1UX7A 2A75A 3B00A 3S5AA 2FCUA 2FCTA 2WWUA 4KWUA 4DFSA 2RM22 3DV8A 1JUIA 1SFYA 2HYKA 2QQWA 2XONA 5DDJ3 1VRH3 4IL7A 2WT1A 4B1LA 2VQ0A 1K5MA 1H1IA 1VBA2 2X5IA 1W9YA 3NAPA 4DRRA 1JI6A 1VAVA 2KD7A 5A3WA 2AENA 1X36A 2ZABA 3BIWE 3D0JA 3VDBA 2YC4A 1GP4A 4R9DA 1GZ9A 5C3SA 1R1A2 2HEYF 5IATA 1QIQA 2P2KA 1ZRFA 4NPLA 3VHOA 1W6PB 2VMGA 5EP9A 4PDWB 1MS9A 5DUXA 2NMOA 4QXCA 1EYBA 4FQ4A 2VZTA 4E4ZA 1V6JA 1FX5A 2FQPA 2YYOA 3QBQA 2VUDA 4MGSA 4W8JA 5KHHA 5DDJ1 3O1VA 1VRH1 2RJKA 3ABZA 5IFTA 3EHKA 4WM7B 1PO11 3WP5A 5CFDA 5IVCA 4FPJA 3ZVXA 3VBUB 1UPSA 3OBAA 3R6SA 2RJLA 4GULA 3WNNA 2GDFA 5FR3A 1YFUA 1VBD2 1D4M2 2EVXA 1ULGA 1XB9A 3GCXA 2P4EA 1ZRDA 1F5FA 5E89A 3RNSA 3AP6A 4AE2A 1W90A 2YU1A 2Y33A 1H8TC 2R49A 4OQ9A 1AR82 3KT4A 3H8OA 1GWKA 1H1MA 3VZJA 2G9FA 3LOBA 2ZGOA 3J7MA 3PUIA 4QWNA 5J3UA 1CAUA 4Z1VA 5DZEA 5C8CC 3OB8A 1GNYA 2Y6GA 4DUWA 3FFQA 2HJIA 2PHRA 2WR9A 4IEPA 4RR3C 1UF2C 4XZUG 5DZGA 4B4QA 2J22A 1O4ZA 1HN1A 1GQHA 2BVBA 4MHUA 2HWC3 3H9AA 3VBRB 2W94A 4QGMA 3IZOA 1HLCA 4K8RB 1RUOA 4M3CF 1RVF3 5K9YA 1GKBA 2W08A 1UL9A 2D3RA 2ID4A 4XC9A 4YW1A 3I97A 3SLIA 5BNQA 3NMBA 2VQTA 4JGYA 1VBC3 4H3WA 1CN1A 5GZEA 2P3JA 3H7JA 2V73A 5FYUA 2KXLA 3UL2A 1JHNA 4YM1A 5FLHA 4MXVA 1KS4A 2CY6A 1KFUL 3I2GA 3CIHA 2I2SA 3ZXDA 3KVAA 3D82A 1AR63 3CJXA 5T5OA 1TME3 2XG3A 2G4IA 2ZGSA 4NPMA 2ADEA 5BNNC 2GMEA 2QQNA 3DKQA 3MF6A 1PGL2 4OHWA 5IWFA 5CKQA 1V6MA 1RVF1 4NWVA 3N9OA 3A4UA 4EN9B 2LALA 3KGLA 1V6KA 5FZ0A 2E31A 3IDAA 4BCUA 1VBC1 2ZGMA 1AXYA 1PVC3 3WT3A 1RUJ2 5FPAA 1VBE3 4ZZ5A 1ZA7A 1AHSA 2O14A 2UWCA 3LE0A 2A73B 3MZHA 1K42A 3WNPA 1OI6A 5H9QA 5JAXA 4EJRA 1RJ8A 1SBFA 1DGLA 2ZEXA 1AR61 3RSJA 1CR7A 1TME1 2XXZA 4BXFA 1YIFA 3B7MA 1IPKA 2Z4FA 4BQWA 2PHLA 3I2IA 5HV4A 2SBAA 1D4VB 5AVAA 5C4WA 4COWA 2RR12 1ZBA3 2XJSA 1EPZA 4MGZE 2DBNA 3U75A 3VKMA 3Q8AA 2XBO2 4AFCA 5JXIA 3HNYM 5FXWA 1MR5A 2OPKA 4QXHA 2FCVA 4DOUA 1N47A 5AC93 1GWLA 1XNDA 4XCBA 4D6SA 5KC5A 3MLKA 4ET7A 1H2KA 1A78A 3MPPG 1VBE1 4GB32 3WDVA 1JZ4A 1V9U2 2PHWA 3PIJA 4Q8KA 2DUOA 3KSCA 1YJLA 4QPGB 1AR73 1UU5A 3MUZ1 2BU9A 1KJLA 2P1BA 3KV6A 3NO8A 4Y20A 4BZ4A 1VMHA 5HXVA 5A3UA 1W6NA 3JB4C 3LEGA 4ISQA 4AEDC 4TZDA 4C90A 2AGSA 3GBGA 1ZBA1 3HQRA 3RVHA 3MFCA 1JZ3A 1H0BA 5I0RA 2R6QA 4QXBA 4OHVA 4CP1A 1QQP2 4CDWB 3VV1A 4QX5A 1XSRA 4Q1PA 1MS0A 2BBVA 1LOBA 5JPMB 3PTYA 1W99A 5EQUA 1NCRC 1B09A 3IPVB 5E8AA 1W8WA 1UOGA 5KHKA 4MGYE 5F5AA 4XOGA 1XSQA 1RC6A 5T3NA 3LEIA 4KWLA 3C2UA 1F8VA 4FFGA 1UY1A 2J1RA 3J7HA 3LEMA 1ZZ7A 2VPVA 2VMHA 2VMDA 3MDPA 1W8OA 5FV3A 4RQPB 4CEYB 1W2OA 1LU2A 1F31A 4ZU4A 1LENA 4YGDA 3RYPA 3LFMA 4AFBA 2ARXA 2BNOA 2C9AA 3M3QA 1UN1A 4IEZA 3USUB 4OI0A 3CL1A 3A22A 4QPIC 2ZHMA 4QM8A 2PHFA 3NJYA 1APNA 4WVMA 1W8NA 5FZCA 3RQ0A 4D7YA 1AR93 1CX4A 1E5RA 1QJX3 2Q30A 4Y22A 2QFEA 4LLOA 5LA9A 5L73A 1NX9A 4CUBA 5FLIA 1DG6A 1HB4A 3MLJA 3OOXA 2WZEA 4AQ6A 4TLFA 1W2TA 2BW8A 4FP3A 4W50A 2UU8A 4X6QB 3POJA 4AWDA 1J3PA 4YWAA 5GM0A 2Z69A 1ZM1A 4XHBA 3DYMA 3VL8A 3S6PA 5F2WA 1DZRA 2CWMA 2DBIA 2VCMA 4XUTA 1RHI3 4E2SA 1OOPA 1S0IA 1JYNA 2VOXA 1DP0A 4OCTA 4E4DX 1Y3TA 2VM9A 3SHRA 1AR91 1OLMA 1V6OA 4AHYA 3W21A 1ULPA 1W0PA 1XNBA 3LAGA 3VHRA 2WO7A 5FQ0A 2JE9A 4P9WA 5JPNB 1NXD1 2ZGQA 3E6DA 1DGWA 3OGSA 1C5IA 3MLLA 1U5ZA 4UF0B 1S0FA 1LGCA 3OG2A 3H50A 1PMHX 1VP6A 3EB7A 4I3PA 3APBA 3DXTA 4LHSA 4NROA 3FMGA 1OA3A 4MOAA 2Q1ZB 1SFNA 2XJUA 2BGPA 1QF3A 5GLZA 3PDQA 1XQNA 4ATEA 3VZNA 2FMYA 2D3SA 3GM8A 4Y3OA 5D1IA 4BWOA 1DGWX 1RHI1 1YQ5A 1SPPB 3N7KA 1U5IA 5FZLA 4K21A 1FNZA 5FZFA 1JHJA 5HCBA 1JOBA 4OI4A 4EWAA 1AVBA 2PLV1 1CAVB 4MXWA 5BUVA 3IAPA 3FUQA 5JCTA 2FDGA 2Y6JA 3W58A 2JG9A 2XQXA 1VLNA 3O0VA 1YLLA 4YZ4A 1DHKB 1ND2C 2K2SA 2JX9A 4R4ZA 5CBLA 1I9RA 1LOGA 5LCWL 4AVAA 5FPLA 1N1SA 3LA3A 5IK8A 1C8M2 4GH4A 4HKLA 1B35A 3BIEA 1AJKA 4OZXA 2OX0A 3ZPYA 4H14A 5H9PA 2VOWA 3WUDA 2Y6FA 5FPZA 5BNOC 3ZFEB 4GJYA 4JZRA 3MW4A 4Q5OA 4UYBA 3NQHA 1AYN2 4WM8C 4XVHA 2Z79A 2HEWF 1WW7A 4S2FA 5DAVA 4CCJA 1K3IA 2DWRA 3K3NA 4S2GA 1SDWA 4ZS2A 4HVQA 2EIGA 3LKJA 4XACA 3IT8A 2MPFA 4LO6B 4XIKA 4LBQA 2XHKA 5FYZA 5KXCA 4L2NA 2ZJCA 4PLMA 2EXHA 1Q8PA 3CBNA 2HYXA 2JXAA 4FPKA 5FWEA 4IEOA 4PJYA 5T5PA 5H9SA 5FYCA 2ZEZA 3J7LA 5J98B 2W52A 3WP6A 3FC0A 5BYNA 5FP8A 2VVDA 3R4UA 4QKBA 4MGQA 4XFIA 3M1HA 1IS6A 4NR1A 2R042 3IDCB 4L97A 4CP9A 2DFBA 3UKVA 3A7QA 3DPRA 3VZKA 4OVEA 4KU8A 4N43C 2OUJA 1W8FA 5EWSA 4FSJA 2D43A 4XPVA 2ZX4A 3OY8B 2WUHA 1HB1A 3HWJA 4CCDA 2GALA 1EP0A 4IGPA 1HXS2 3UGHA 4E4SA 2W68A 3SITA 4LO4B 4L92A 3D4KA 1A6CA 5BNPB 4JKMA 3JXSA 2QDRA 4IEUA 1LJ7A 4C1XA 3IM0A 3OGJA 4MGKE 5HI0A 1ZZCA 3O7OA 1GQGA 1DZTA 2BUKA 2Q4SA 4NIIA 2R1BA 3T1LA 3ZKUA 3M3IA 2HWD3 2Z2SB 2RS13 2JB4A 3ZX7A 4PQ9A 4KG8A 1I3HA 3ACFA 1JYVA 1IPJA 1JZ2A 3E5UA 4OHXA 5E6HA 1US2A 1BJQA 4LIUA 1NCQA 4YW5A 1WCSA 2YFUA 1QGLA 2YHJA 2PFWA 4XETA 2BRTA 1YWKA 4FPOB 4P9JA 1ENRA 4E8CA 4RS5A 1KITA 1PM7A 3WDYA 4N9HA 4RSUA 2V4VA 3AK0A 1JBCA 1UY2A 2VZ3A 2VTXJ 3SISA 4AFDA 4K40A 4NPRA 4DUXA 5KWRA 2HLEA 1JZ6A 2HWD1 2BFUL 1NAEA 2RS11 3B02A 1ENXA 2A70A 3W59A 4AQTA 4HKOA
chains in the Genus database with same CATH topology
2O8OA 2XVLA 3Q9OA 4MYEA 4RR3B 5FRAA 4N90A 2C1FA 3D0SA 4Y1YA 4LBMA 3AJYA 4PIXA 1O3QA 2R062 2PELA 3FWEA 4XFAA 5JSRA 3V0AB 3QACA 1BXHA 3AB0A 5DZFA 4O9GA 5A33B 1HRI3 3L2YA 1YHFA 1W6PA 4PDWA 3GHNA 3MIGA 3KCCA 1ASJ3 4AI1A 3JUUA 4EWDA 4L99A 4SLIA 4W6WA 4A2UA 2DFCA 1MS3A 4Z8BA 4Y1XA 2GSYA 3OPZA 3M3OA 5T54A 4Q4W2 5BNNB 3AFGA 4WM7A 3MIFA 3VBUA 3FHIB 4QGLA 2C0ZA 4YM2A 2Y0OA 1DGRA 1GR3A 1N1YA 4M3CB 4B29A 1GNZA 5JWPA 1PZ7A 2WWSA 1PK6C 1BEV3 2JD4A 4H7MA 1CPNA 1ZRCA 3OD4A 1NE4A 5J37A 3PVOA 4KG0A 1ASJ1 2LTNA 3B69A 1C8NA 3ZFGC 4BH9A 3AFKA 1OFSA 4P5HA 1GZCA 2RM23 5IK5A 2XL9A 2O0OA 1XNKA 3AKTA 3QH7A 4CDXC 1QNYA 4R52A 3HBZA 3MYXA 2D6OX 3A0NA 4GIQA 3VBRA 3ZN4A 2LM3A 1WA4A 1VBA3 2BWCA 4XF4A 5T50A 2ARBA 4AVCA 4EROA 1AL22 4ISRA 1BEV1 3AJZA 1R1A3 4HN0A 4V1PA 2WS92 3M3EA 2D40A 2CYFA 1Y9QA 3NWKA 2GU9A 4F83A 4YVSB 2IXJA 2ZMLA 1HQNA 1DFQA 1T6GC 4G4FA 3MIBA 1BMV2 1VBB1 4I01A 2NMNA 4GA9A 3N7MA 3FFZA 4Q0QA 4AEDB 1I6XA 2IXKA 1OLRA 2X8KA 4JCKA 1IQAA 2HWF3 2XJQA 3CNAA 3ZXEA 1VAKA 4JGZB 1VBA1 1R083 2JICA 3AKPA 3OJBA 1SEFA 1U5YA 3AMHA 2Q8OA 2G9GA 2IWGB 1W39A 2ET7A 1R1A1 5CB7A 3H8UA 1GV9A 3POSA 4YG6A 5FPXA 2ZZQA 2NZ9A 4BIOA 1H4HA 1YJKA 1RMU3 1AR83 3MPBA 3AM2A 2CGOA 5JMCA 1LESA 1BK1A 2FMDA 1BCXA 3AP7A 1KFXL 2HWF1 2ZKNA 1TEIA 3FLTA 5EZWA 4Y5Z0 1R081 4QXKA 4DB5A 3ZXJA 3LB9A 4GALA 2ERFA 4XJWA 2EXKA 4QPIB 4Q4V2 4Q4X2 3MIHA 3NV4A 1SCRA 2H0VA 2TBVA 4BHPA 5FOJB 2R16A 3WDXA 3TRSB 1O5LA 5FFOC 1RMU1 1AR81 2MEV3 4QPGA 4XW3A 5FREA 4GKYA 5JSOA 3LZZA 5SV8A 4B4RA 3M70A 1WBFA 3VBHC 4BMBA 1J3QA 3SH3A 4TSVA 2P17A 3ELNA 2WNUB 3KMHA 3CJIC 5A3MA 1NG0A 2GC1A 4N53C 5GJ6A 3AXDA 4LBJA 4CDWA 3HAGA 1RUI1 3QH6A 4YNIA 2CV6A 2MEV1 3IPVA 4A7ZA 4XTMA 5K0UC 2XJPA 1LHOA 2EXIA 2E6VA 4WVZA 4DMIA 4YZ2A 1PIV2 1COV1 2QCSB 4RQPA 4CEYA 4YLZA 2XH6A 3ZN6B 2R1DA 4ITCA 3AZWA 2RR13 1G9CA 1TMF3 3VBSC 3USUA 2JG8B 3ILNA 4L8QA 4NOTA 3E5XA 4IV1B 2BYVE 2OIIA 4GB33 1KJRA 3VBOB 1ND2B 1RINA 3ZXLA 5D8AC 5A32B 4F3JA 1IS4A 3WCSA 2JE7A 3AX4A 2WKKA 4FTBA 4Q1RA 3RZZA 5BNOB 3AZVA 3IDBB 2RR11 3IIAA 4LR4A 1TMF1 1RUE2 3KZ4C 5C9AA 4U36A 4WM8B 1OHFA 1OQEA 3JBG2 4QQLA 1FNYA 4BM8A 4YM3A 2RE9A 1JOJA 1QQP3 3JU9A 3PJYA 4R9BA 5F9TA 3WNXA 4LHNA 4GB31 1QH7A 2UYBA 3UJQA 1WMEA 1VALA 4Y24A 4LHKA 4XBLA 1MVEA 2SLIA 4LEJA 5LEKA 1LTEA 1LODA 2VY0A 1LCLA 2YGMA 4FAGA 4GKXA 2E53A 3TN92 2XJVA 3WDWA 1CGPA 1PNGA 5FDBA 4DY3A 3NW4A 4QHBA 1CAVA 4N43B 4RL7A 3WV6A 4D7SA 1QQP1 4I0WB 1M06G 1FATA 4HFSA 1EAH3 3J4UH 1AL0G 3WDUA 4LO5B 1WGPA 2FBEA 4YYOA 1HQWA 1QOOA 1CJDA 4PIZA 1MS1A 3EJKA 4COYA 2ZAHA 4OUMA 2OZJA 3CEWA 2KA3A 4HANA 1VR3A 4CRQA 1ONAA 4CDUC 4QT6A 4YFWA 5CFCB 1Z7S3 3NSTA 3FUOA 2BNNA 3ZFEA 3NV3A 1HW5A 2WT2A 1ZZ9A 1ND3C 1QY4A 1MQTC 4Q4Y3 1EAH1 3MIEA 4EN6B 4MGIE 4FT8A 3WQ0A 1JYCA 1BVVA 3H1WA 1CESA 2DYCA 3H0OA 1IHMA 2CAUA 3ROUA 4YSFA 2HWE1 1K5MC 4Y1VA 2X5IC 4B3NA 3NAPC 1BQPA 2O1QA 3VZOA 2LUWA 4E9KA 1MEC2 1Z7S1 4CDQC 4A7YA 1QWRA 3WUCA 4CTEA 4YVWB 2XJTA 3JQXA 1DBNA 4OFGA 4Q4Y1 1QJU2 1UZYA 2EXJA 4YG0A 3ZMOA 3OY8A 4LBQD 2Q5TA 2BEOA 4PIYA 5H9RA 2UWBA 2JECA 1PGW1 3BOWA 4U2AA 5BNPA 2OUHA 3E6BA 4JC1A 2XLAA 2QVSB 4C0BA 4NVPA 4ONUA 4FPGA 3ZSJA 3RPQA 4NWWA 1C8M3 4X8NA 4AI2A 5JZGC 4IXLA 5I0SA 3V0BB 3VDDB 1EPWA 4JQRA 4KGQA 1TE1B 3VBFC 1X8EA 1PVXA 1N1VA 3ILRA 4OULA 1NA1C 4IESA 1AYN3 1D0GA 1NZCA 1QJY2 2EA7A 4KL1A 2QJVA 3PMEA 4M3CE 5GLTA 1YNAA 1PK6B 4IEYA 2UY9A 1LULA 4BIFA 4EN0A 4LUMA 3RS6A 4UBGA 3ZFGB 1SLBA 4IEVA 3N36A 2ZOEB 3THTA 2RS53 3IMNA 1S55A 4MV2A 2RS32 5KXDA 4AYUA 1RUC2 4RR3A 2DCZA 3JB8A 3QOPA 2R0FA 3ZSKA 2Y0IA 1HV1A 4IEXA 3V0AA 1PGSA 4LA2A 1BZWA 1AX1A 1PZ8A 5A33A 1ZBE2 5ABJC 2HWC1 3PNAA 4FPYA 4XIOA 4RHV2 4BE3A 2ILMA 2ZA9A 4G3YC 4RD7A 2AZ5A 2RS51 4DS0A 1C28A 2JDZA 1RUH2 3O0WA 4HPKB 4KBBA 4KGGA 2F6BA 1Z78A 2ZGKA 2B46X 5JR7B 5BNNA 2O8QA 2EF6A 3L9JT 5J48A 2OVUA 2WNVB 2R30A 2DF7A 5F6KA 4BLJA 1MZ6A 1QH6A 3DKWA 2AH2A 4M3CA 3MW2A 5JOWA 2XGXA 4IV3C 2PHDA 1LOCA 4DRVA 5EFUA 4Y1UA 4E2GA 2HKXA 5C4WC 1AUYA 4FCAA 4E27A 1PVC1 4WZCA 3AMQA 1X82A 4AFMA 4GQ7A 2D5HA 2GNTA 1ZNPA 4XQDA 4XJZA 5KHGA 3SCFA 3LSDA 3SCGA 3P3NA 4R4XA 2R063 2DVFA 4JDNA 1OA4A 2D93A 2ZHNA 3D5OA 4KWKA 1S0CA 4DQAA 2ENRA 2DCKA 1IZ3A 3POYA 4BOWA 1C57A 1OPMA 2D6KA 1IS3A 2JJ6A 4WZFA 5AC91 4YVSA 3FJSA 3POWA 2FZ2A 3EQEA 2I74A 1ULFA 4ATFA 1SLLA 3RJ2X 2NM1A 2ZACA 4AEDA 3M8LA 4KU7A 1AR71 3BALA 4WBBA 4Q4W3 5FMOS 4JGZA 3WW3A 3M2MA 4N53B 1HIXA 4Z82A 1XRUA 4W6YA 1UMZA 2B45X 2DU1A 1F5JA 4EV0A 2BNMA 4D7TA 3I7DA 3ZYGA 1UAIA 2YXSA 3ECQA 4BLIA 1WLCA 5DG2A 2PHXA 3RYKA 5K0UB 3AMPA 2AYHA 5JSPA 1PNFA 4XDQA 3ST7A 4AXOA 1DQ5A 5GLVA 4Q4W1 3ENRA 1O3SA 1DF0A 3VBSB 3J8F2 2WT0A 1EV12 4S2DA 2D6MA 4QPIA 2BQPA 1W6QB 2QQPA 1AL23 4PLOA 1JUHA 3EBRA 4HMZA 3V65A 1SCSA 4B7KA 2NLRA 5D8AB 3ZYPA 1QJX1 2A3WA 1RIRA 3VKLA 2I45A 3DL3A 3OYWB 2WNUA 1QOTA 1D2SA 2XKPA 1FOD3 2VGDA 3WZ1A 4CEWC 4Q26A 1C4RA 4FP2A 2YY1A 1H9WA 4COUA 4UXAA 3D6EA 1ZZ6A 2V5YA 4Y1ZA 4JAAA 4XMIA 1AL21 1VRH2 3SNMA 2OW4A 1YFXA 5AVPA 4J1XA 1PO12 2ETEA 4K3UA 4DPNA 3ZSMA 2VU9A 1UIKA 1LGNA 1XNCA 1WMFA 1X33A 4L9BA 2B7YA 1FOD1 5IUQA 5IK4A 1ZYBA 1GFF2 1KDMA 2GC3A 5JIAA 3ZN6A 4QQOA 2D98A 2D6LX 1HRV3 2JG8A 3RG0A 5EJ3A 3WX5A 2CWSA 3GALA 4IV1A 2RHPA 1I5ZA 2WFF3 4Q4V3 3O0XA 2WZR2 5F5QA 3VHPA 1B35C 3VBOA 1DQ0A 5JIUA 1ND2A 1S1AA 2IZWA 1OFNA 3G6JB 4HVOA 5A32A 4AW7A 3AMMA 1XYNA 1H8VA 4XJ9A 2DVBA 4FOVA 2OZ6A 4CDUB 5BNOA 4LBNA 3OGGA 2XVKA 1REEA 1BYHA 1HRV1 1XE7A 3MICA 4WM8A 3RI9A 3JD73 4GMP3 4B7EA 3A0KA 1VIWB 2A71A 2WFF1 4Q4V1 5LK5A 1PZ9A 1CQ9A 1H9PA 2E51A 5K8SA 3KM5A 2X53S 2Q1MA 2ET1A 1WMDA 1RUF2 3DPRC 3RMXA 1YIPA 2A6YA 4CDQB 1UX6A 3BCWA 1PIV3 3VUOA 2TNFA 1WCDJ 2NYYA 3JD71 4GMP1 4Q0UA 4N43A 2ZZJA 4KNCA 4ES8A 3BB6A 2XLGA 1QU0A 1TME2 4C91A 5I8TA 2D44A 3AYDA 4Q2FA 3IN9A 2QZ3A 1FMD3 2P37A 2D7FA 2QNKA 5A3LA 4EN7B 5L19A 1NCQC 1NE6A 4NN0A 4XE9A 5FBZA 1Y7BA 4AFAA 2D3PA 5KXEA 1H8TB 5JZGB 1PIV1 5CFCA 1ZA4A 4HZFA 1LEDA 3VBFB 4DNYA 5C8CB 1J3RA 3ZXKA 1NA1B 1W6OB 4META 2EAAA 3JBG3 1QDCA 3VN4A 3O12A 1CAUB 1ENQA 1G6NA 1JXNA 4PLNA 3TB0A 1FMD1 5BPXA 1NYWA 4N7UA 4Z92B 4UW5A 2WFPA 1U12A 1ZZ8A 4HN1A 1G8WA 3JQWA 1RUG3 3TAYA 1GANA 2GMMA 1FYUA 2XVGA 1OA2A 3GF6A 4LE4A 4YVWA 5KHIA 2DVDA 4OI1A 1QXPA 1YFYA 4PDWC 4QGNA 4B4PA 3JBG1 3FBYA 3VKFC 4HKWA 1HX6A 5ABJB 3NV2A 4P9LA 4QU2A 3ATGA 1XU1A 5FO9B 3WVJA 1OLQA 1UPIA 1KXGA 4WM7C 1HRI1 4XF0A 4CYDA 3V64A 4XMAA 1SBEA 3GYDA 3VBUC 4YZ1A 4HT1T 5EXOA 3WP3A 1RUG1 4ES9A 4RA0A 1QXJA 3VDDA 3B94A 4AGGA 1POV3 3ZO0B 3WG2A 4Y4YA 2VUJA 1LR5A 1FPN2 1JH5A 4PBPA 1A8MA 1Y43B 1RGSA 1RUD2 2CGPA 4IV3B 1UU4A 4YGCA 4TWTA 1AXZA 1REDA 4H7LA 4AG4A 3UK9A 1KS5A 3OF1A 3ZFGA 3HQXA 1S0EA 5CG8A 2MHFA 3VBRC 2B39A 4P14A 2B9UA 3R4SA 5FO7B 2I07B 4KQ7A 2BVVA 1LOAA 3RYRA 1AR92 5K7PA 2NQYA 1MEC3 5DUUA 1POV1 4Q27A 1H30A 3NL1A 1N1TA 1W2UA 2OYZA 1XXNA 5ACA2 1X8MA 1LGBA 3W9AA 2RM21 4QQHA 4YFZA 4XFHA 1QJU3 4JDOA 5GZCA 1VB2A 1O7FA 1WLTA 1TNRA 1Q3EA 1R1ZA 2R0HA 5IT6A 1BKZA 4M01A 2XJRA 4ZU5A 5T5LA 1FXZA 1RHI2 1X50A 1YO8A 1LB2A 4HPKA 4NO4A 1VBD3 1D4M3 1W0OA 1URXA 4YZ3A 2PLV2 1UIJA 4FTEA 1NCRB 1MEC1 2D6NA 5AFBA 5E16A 1LECA 2WNVA 1V00A 2E63A 1SLCA 2VW2A 1ZZBA 3RMYA 4DXZA 3GHMA 2DCTA 4FPFA 2Y38A 2CGNA 3ZMNA 2GH8A 1QJU1 1WD4A 2W39A 5FTTC 3B5LB 1QJY3 2ZGUA 4OHZA 1H4GA 2E7QA 2ZGNA 4XF1A 2HWB2 1LRHA 2GNMA 1VBD1 1D4M1 1S2KA 4I0AA 3ACLA 3VL9A 1M4WA 1HKDA 2RS33 3V56A 2C5DA 5JOYA 4YM0A 2XWJB 3GZUC 5E1RA 3K48A 4AVBA 3IDEA 3RJRA 5J36A 1WW6A 4QPGC 3JCIA 1QJY1 3I8TA 1S0GA 1FT9A 4XTPA 3X29B 1HDKA 1ZBE3 2K9ZA 1FI2A 4F7ZA 2WL1A 3U11A 1OD5A 1LOFC 4RHV3 4B8EA 1JYIA 3SH5A 2PAKA 5J7MA 3THPA 3J9SA 4LO7A 1RUH3 3R05A 2RS31 1L3JA 1RUJ3 4R9CA 3WW2A 4CEWB 4CP2A 4LE3A 2ZX1A 4WVWA 3PMSA 4QPYA 4C1WA 4N53A 2YMZA 4LBOA 3WCRA 2BTVC 3L2HA 4LNVA 1LKNA 2DUQA 1ENSA 3H1MA 4GMP0 3JZVA 4I0BA 4JDMA 5BXXA 4A3XA 1ZBE1 1RITA 1PGL1 2UYAA 1YXWA 4X8PA 3FLPA 4ZU7A 3BU7A 4K1ZA 4Q8LA 4RHV1 1IKPA 4YGEA 2CL2A 2XBO3 3SMHA 5K0UA 2IC1A 1VJ2A 4FXGB 2GNDA 4JRAA 1Q5OA 1OMIA 1RUH1 4SBVA 1RUJ1 3WINE 1DU3D 1V9U3 3LA7A 3T1MA 3K51A 3VBSA 3GBWA 4XQWA 3VZLA 4YRDA 3KB5A 2QKDA 2VXRA 2WA3A 1O4TA 1UD1A 2FHRA 2ZX2A 4LTAA 3WQ7A 4OI0A 1H2MA 1W6QA 1YFWA 2HWD2 4HLTA 4GWMA 1N3PA 2XBO1 1B35B 1CAWB 1QNWA 3ZFFC 2GH2A 3HR9A 4A7KA 3KLSA 5D8AA 1GLHA 2JEMA 3OYWA 5C9AC 1ZRRA 1V9U1 3SCHA 4PF5A 4XJUA 3UKTA 1YYNA 4XFBA 2K0GA 3NKGA 4UBHA 5JI7A 2OA2A 1W6MB 1V6NA 1SBDA 4AEKA 1GYKA 1R092 4AVTA 1BBT2 5L7OC 3MF9A 5GZDA 3WR0A 1NXMA 4JRLA 4EN8B 3NVCA 4J6GA 3ZYIB 1SACA 3WHTA 2R072 2DTWA 2PN5A 4UW3A 5B2GB 5CNAA 1QOSA 3J8F3 2MNGA 5I8SA 1EV13 1AYM2 3E5QA 2GC0A 4ORFA 3I54A 2WSUA 1AF9A 3MIDA 1DGRN 1OQDA 2P3KA 2X29A 2PTMA 1V70A 2A3XA 4K9SA 4YARA 2D5FA 4AHZA 4XEZA 1G7YA 1Q8VA 2PAMA 3FE5A 4CDUA 4D94A 2ZKLA 2DVAA 5IK7A 3RWNA 2JKBA 1POV0 4LHLA 3DN7A 1J58A 3LCPA 3J8F1 4OI2A 4IETA 1EV11 2A6XA 2KM2A 4HBNA 4XZPA 1VBB2 4GWNA 1NQJA 4FQZA 1UW8A 2B5HA 3WOGA 4CP0A 3OCPA 2VNGA 1A8DA 3KCYA 4HVRA 4P9IA 4UW4A 2PA7A 1PO13 4COVA 1GZWB 3WP4A 2DU0A 1QXRA 1YI9A 2XKOA 4CDQA 3B01A 5JDBA 2YROA 3ZXAC 5KBFA 1QHDA 5JOXA 1NLRA 5CFDC 4GXLA 5J96B 5BNPC 1OSGA 2CTVA 1N3QA 3BTAA 2WLPA 4LUKA 4F8AA 2WZR3 2AREA 3HD8B 1ZREA 3I59B 1LHWA 2HWF2 5CIRA 1PO22 2ZAAA 1DLLA 1R082 2XLFA 2RMU2 1D2QA 5CA6A 4I2OA 3ZN5A 1AZDA 2A6ZA 1H8TA 1HV0A 1REFA 4W65A 4AEJA 5JZGA 5BY5A 4XBQA 4AVVA 1I1EA 3VBFA 1YI7A 5C8CA 1RMU2 1NA1A 1W6OA 4Z2WA 3S7EA 1C8M1 5DUVA 2A6WA 4AGVA 4CDXB 2VH9A 3GZTB 4JGYC 2WZR1 3ES4A 2R043 3WG1A 1AYN1 3ETQA 1GBGA 4X6RB 4JTOA 1DDLA 3N7LA 5CADA 4XQ4A 1RUF3 3ZXFA 1HXS3 3HT2A 3KT7A 4I3GA 1RUI2 2VQAA 5I8YA 2MEV2 1UU6A 3SXWA 2BGCA 5FOBB 1WD3A 2DVGA 4BMEA 5ABJA 4N7IA 1HQLA 3TYJA 3VKOA 2R041 2YC0A 1CJPA 1LHUA 1NOVA 5FMOL 2FZ1A 1COV2 5L36A 1MZEA 3KS7A 3EXUA 1Q8SA 2NN8A 3AYAA 3U0ZA 2A3YA 3ASIA 3I4IA 3M7AA 2VW1A 1RUF1 1NY72 3WLUA 2GNBA 2XPJA 1HXS1 5GZGA 3R4DB 5FLJA 2A7AA 3AKRA 4XHXA 2ZHKA 4C0HA 1VAMA 3WG3A 1DQ2A 3E6CC 3DF0A 2ZGTA 4AK3A 1LU1A 1MZ5A 2AR6A 4IV3A 4HETA 1FV3A 2UURA 4NHLA 4DINB 5I0TA 5CAZA 1JTZX 1DQ6A 2ES3A 1A3KA 2A5ZA 3QCWA 1XE8A 2ZMKA 4RGAA 3AKQA 1C1LA 3J26N 1IOAA 2WA4A 4BA6A 1IKQA 2VOKA 1TMF2 3LA2A 3URFA 1UZZA 2DTYA 2IXCA 3IBMA 2PHUA 4XJAA 4AHWA 1AX0A 1V6LA 2WQZC 1CAXB 2VVEA 4M0NA 3KT1A 4H55A 3ILFA 2QZ2A 3VBHB 1S2BA 4MLOA 1YRZA 2VNRA 2PHTA 5LEJA 4YVSC 2XL7A 2ZX0A 3CJIB 3OBRA 4WVVA 4YG3A 4JVAA 2VVFA 2R061 1SQ4A 3CF6E 3IKWA 3TOJA 2Q0AA 4JGZC 1ALYA 3RDIA 4INDA 1QDOA 1NCRA 1UCXA 1CPMA 4KH9A 2B42B 5BV6A 3AZXA 3B93A 3USSA 5KHJA 1DIWA 2E7AA 4WV8A 3UKNA 4EWEA 4MUVA 4Q0SA 3UV9A 2JENA 4HSJA 1XU2A 1FPN3 2DCJA 1RUD3 3B9IA 1WLWA 5GALA 4MX3A 3CLPA 4AI3A 3PVEA 3ZXGA 5HCAA 4AHXA 4K20A 2GMPA 3CO2A 1Z0HA 1RJ7A 2IFRA 4LBKA 4XF3A 3O14A 3LGRA 1EAH2 4QQPA 2WS93 2IXLA 3MI8A 1MS8A 3AYCA 4FVVA 2PYTA 3AYEA 1OOPC 4FPHA 3RRDA 2B8MA 5ACA3 1FPN1 2HWE2 4IEQA 3TNQA 1RUD1 4G9SB 3SH4A 4OUSA 2WNUC 3ZFFB 1Z7S2 4HK9A 2VNOA 2E9QA 3GZAA 3DGTA 3VKNA 3AZYA 1G9FA 1GSLA 4JTNA 5C9AB 4Q4Y2 5DDJ2 4QQ2A 4CEWA 2PLV3 2UY8A 2WS91 2D97A 3TBDA 4J1WA 4AQ2A 2IFWA 3HMYA 3MGUA 5I93A 1WLDA 3PHMA 1BMV1 1F2NA 5ACA1 1PGW2 1AX2A 3LOIA 2XWBB 1J59A 2YPJA 4I30A 2JG9C 2ZGRA 3N3HA 4FXKB 5L7OB 2VULA 4IERA 2ZHLA 1BVP1 4M0HA 1C1FA 2HWB3 4PBOA 1KDKA 3OTFA 3ME2A 3IWZA 1G9BA 4Q4X3 4YW3A 2JG8C 2GN3A 2ZCWA 4GH4C 3R0RA 5T55A 5F1RA 4IV1C 4MVTA 3ZYJB 4MZUA 5J09A 2PQQA 5LRRA 3S0MA 4DZGA 1UKGA 3VBOC 2N7GA 5DG1A 2NPIA 4FPLA 4BPZA 4AQSA 4FBFA 3FLRA 3VLBB 1CAWA 1O3RA 2HWB1 1WCKA 1ND3B 3QLQA 3ZIWA 1MQTB 3G7DA 4I02A 2DURA 4Q4X1 2YZ4A 1SLAA 2ZBJA 2XUMA 4PCRA 2ZGPA 4D69A 3MFAA 4Y26A 3WY6A 1DQ1A 2HWC2 4AEMA 1N3OA 4N9IA 1K5MB 2R32A 2WZPP 1RVF2 2X5IB 3NAPB 2WLQA 1W6MA 4XYXA 3WD5A 2RS52 1VBC2 3BODA 1TQ5A 2WJSA 4IEWA 4XF9A 4QMAA 2VUAA 1AXKA 1LOEA 1AR62 2BWAA 2GAUA 1G9DA 4YW2A 3FBMA 1KRIA 4P9GA 3WW1A 1V6IA 1WUVA 1KD7A 1MS4A 4IQPA 3N4MA 3LWCA 2ZGLA 1FV2A 5CFDB 4K6BA 2IXHA 2NP0A 2YGLA 4TYSA 1VB4A 1PVC2 4DY5A 3KD4A 4RS5C 1D0HA 2D6PA 3MW3A 1VBE2 4AVSA 5LRSA 4YZ5A 1YUDA 1RUE3 3PJQA 4HSLA 5CFCC 2P3IA 2ZPXA 3ZDSA 4CZSA 3WQ1A 4BYYA 5F6LB 5I91A 1E57A 1ZBA2 5HBAA 4L11A 4LULA 1Q43A 3AKSA 3EO6A 4LLFA 1U0AA 3H3ZA 3ZIXA 2WNEA 5AC92 3WHUA 2WQ4A 2WSVA 4FOYA 5KC6A 1MACA 3TN93 4JGYB 3T2TA 1QKQA 3BPZA 5C33A 1R093 1RUE1 2VG9A 1O5UA 1BBT3 1AR72 5T52A 1MVQA 1WBLA 1H2NA 1GZWA 4I09A 3BOPA 3KCXA 3N7JA 4XILA 4YVWC 3C3VA 3HN1A 3DUIA 4XFGA 5EYYA 4OHYA 1S0DA 1OPOA 2H6BA 1NLSA 2WINB 1ULEA 3H1YA 5EYXA 2CAVA 2R073 4O9EA 2GZWA 1PMIA 5LK7B 3B3QE 3WDTA 4FOWA 3TN91 3V0BA 1MZFA 1AYM3 1YCIA 4P9XA 5CU1A 1WW5A 1R091 3WW4A 1ZVFA 2DV9A 4YW4A 3ZYRA 3I59A 1BBT1 1J1TA 2YV8A 1LHVA 4UW6A 3VDDC 1DQ4A 2GN7A 1PK6A 2UWAA 3S30A 4AF9A 2DUPA 4BQ1A 3ES1A 1QJZA 2EALA 4XBNA 5JI9A 4P9YA 3FZ3A 5C4WB 3AP9A 1S0BA 2R071 3AXEA 5CVRA 1OQ1A 2ZMNA 4RGGA 2Y26A 3U07A 1AYM1 2BFUS 1QJX2 4CDXA 3FX3A 1VBB3 2YUEA 1ULDA 1XYPA 1DYKA 5FCCA 1DZQA 2VW0A 5JVVA 2AUYA 3OBTA 1PHMA 3ALQA 5SV5A 4Y20B 2BPA2 2H0BA 1TNFA 1W6NB 1O3TA 4XXAA 4QD2A 4FTSA 5GLWA 1ULCA 4MSVA 1QMJA 5DXDA 3QD6A 1Q8OA 4ZXKA 3LSEA 3AMNA 2Z5WA 4D3WA 1FOD2 3VZMA 2V09A 4E2QA 2WNVC 4NHKA 1PO23 1CD3G 1ZX5A 2VOVA 1WW4A 1IS5A 3U10A 1EY2A 2TUNA 2RMU3 5AFEA 4OLLA 2IXIA 4AI8A 1U5XA