2XONA

Structure of tmcbm61 in complex with beta-1,4-galactotriose at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
SRNYLKNPGFETGEFSPWRVSGDKKAVKVVKANPSSNAHQGEYAVNFWLDESFSFELSQEVELPAGVYRVGFWTHGEKGVKIALKVSDYGGNERSVEVETTGWLEWKNPEIRNIKVETGRIKITVSVEGRAGDWGFIDDFYLFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARABINOGALACTAN ENDO-1,4-BETA-GALACTOSIDASE
publication title Recognition of the Helical Structure of Beta-1,4-Galactan by a New Family of Carbohydrate-Binding Modules.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 34
structure length 145
sequence length 145
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2xonA00
4BJ0A 5DMYA 4QX1A 1UZ0A 2VQTA 2X09A 4MGQA 2V4VA 2E33A 2YC4A 2C4XA 2BGOA 3HN3A 1XNTA 2QQIA 2W1QA 4PQQA 4JKMA 3WNMA 2VMEA 2OKXA 2VZTA 1JZ3A 1W9TA 1DLCA 3EB7A 4XUNA 1L7RA 3ACFA 4ARXA 1UY1A 3F2ZA 3A23A 2YB7A 1UWWA 3GGLA 3MV01 2W1SA 2J1AA 3DECA 3W5NA 5HPOA 2J1VA 5JXJA 4ARYA 4QAWA 1JYNA 2QQMA 3MUY1 3WQBA 4Z2AA 2CDPA 5C71A 1UYXA 2JKXA 5JMOA 1EUUA 3HEIA 1OF3A 4XVHA 4P5YA 3K4DA 3I2JA 3CMGA 2B4KA 2VZSA 3VD3A 4KMQA 1PMJX 2VMCA 2BERA 3LEIA 1OF4A 1JZ7A 5EJ1B 2WQ8A 2J1UA 2XOMA 3FHAA 4TTGA 3VD9A 3IDAA 4M4PA 2LS6A 4OUEA 1P8JA 2E32A 1K3IA 2WAOA 2VZ3A 4RN5A 3NQHA 2WBKA 4DUXA 1W8NA 2J1RA 3VDBA 4P00B 3A21A 2QQLA 1OH4A 2YC2A 2PQSA 2VZVA 3VD7A 3WF3A 3C7HA 1UXXX 4HG6B 2WO1A 4JX0A 3HNMA 3MUZ1 3WSOA 4XUOA 3MV11 1R64A 3ACGA 3DYOA 3I3EA 3K4ZA 4CVUA 2W1WA 3I2FA 3PUIA 5EIYB 3VD4A 4BXSV 2QBXA 3NJVA 3THDA 2WABA 3OEAA 1JYWA 2V5DA 4QX3A 2W9XA 1LNSA 1UYYA 2LW8A 4TXWA 4MGSA 2W91A 5EJZB 3WF1A 3T0BA 2VZQA 4IUGA 1UXZA 1UY2A 1NUKA 3OGVA 4MO3M 3T0AA 4AAXA 4QPWA 3OB8A 1F4AA 2HLEA 2ZEXA 4QB6A 4JHZA 2C26A 3SEPA 1SG3A 4W4ZA 2Y6KA 3IB3A 2HYXA 2VZRA 2YG0A 2QQJA 1OD3A 4A3ZA 2C9KA 3LEKA 4MOAA 1JZ4A 2CDOA 2QQKA 5IFPA 4DUVA 4GWIA 2J1SA 1DP0A 4ZXEA 1ULPA 4D8MA 4DEVA 4OMDA 3UESA 4JKLA 4OMCA 1OT5A 4QDSA 1PMHX 1CIYA 2VMDA 2VCAA 1SHWB 5HXMA 3C7EA 5J1XA 1JHJA 2ORXA 2XQXA 1WKYA 3SKVA 2EICA 3W5MA 3GM8A 3MO4A 1XC6A 3ACHA 4A44A 3HNYM 1K12A 3UETA 1NKGA 2WUHA 3FHQA 3WNPA 1TG7A 2JD9A 4XZUG 3FN9A 2JE8A 1W9SA 1DYOA 2Y6GA 4D0QA 3ZM8A 4DUWA 3C7GA 3K75B 4XURA 3NJXA 2JDAA 4BDVB 2QQNA 3IAQA 3VD5A 1EUTA 5JR2A 2VM9A 3ETPA 2WN3A 2B9VA 3NRUA 2W95A 4CU6A 1J84A 2VZPA 5G05L 2W5FA 4QX2A 1D7PM 2VC9A 3LPGA 3T09A 3DYPA 3C8XA 2VL4A 3HOBA 5CYYA 2ZEYA 2ZEWA 4PF1A 2E31A 1US2A 3T2QA 3HJRA 3ACIA 5LA2A 5LA0A 2BBAA 1W99A 1PX4A 1W9WA 1TVGA 1GMMA 2WDBA 4UOJA 5IJRA 4GZ9A 2RV9A 4CU7A 2VCCA 2W92A 2VR4A 3I2HA 3T0DA 5IYYA 1GOFA 2Y64A 4ET7A 1CZTA 3HNBM 3K46A 4LQRA 4CUAA 5B4XA 2X05A 1UY3A 2Y6HA 2QQOA 3C7FA 1XPWA 3P1IA 2VJXA 3K4AA 3SEEA 2RJ2A 3WNOA 1W8OA 3VDAA 2ZEZA 3WF0A 1JU3A 4LKSA 4LHSA 2WO2A 1H6YA 1UY4A 2V72A 3GDBA 2VZOA 4QDRA 4ZZ5A 2Y8KA 3CIHA 5C70A 4DXSA 1JI6A 1I5PA 1SDDB 4PT6A 4GWJA 5IHRA 4E8DA 1O8SA 5JXIA 1JYVA 4OZOA 4DXTA 1CZSA 2VMFA 4RYDA 3I2GA 3AC0A 3I2KA 2J22A 3SKJE 4AG4A 4MADA 3OGSA 4BK4A 4UAPA 2ID4A 4FI9A 1JZ6A 3BGAA 1JU4A 3GXUA 4L0PA 5JUVA 2WZEA 5G04L 1CZVA 2VOTA 4DEQA 2YFUA 5B4NA 2XHNA 3LPFA 4QB1A 5C7GA 2EIDA 2J7MA 2KD7A 1KGYA 2VCBA 1H6XA 5LA1A 2DDUA 2W87A 4M4RA 4QX0A 4W50A 3MBWA 4P08A 4QB2A 5JXHA 3LQCA 3WNLA 3I3DA 1J83A 2RVAA 3FL7A 3JXSA 4P02B 3WNNA 1BHGA 1F4HA 4ZZ8A 2E26A 4KWUA 2VZ1A 1NX9A 2BGPA 3ECQA 2YFZA 1NAEA 4XUTA 1W0NA 2W46A 4QDQA 2X10A 2WO3A 2ZXQA 3UNPA 4UI9L 5LCWL 2WYSA 1XNAA 1MPXA 2J1EA 3BN6A 5FUIA 3CZUA 2EIEA 1PX3A 4A42A 3THCA 3IAPA 4A41A 4KI5M 3D3AA 2Z4FA 3I3BA 3OBAA 1US3A 3EYPA 4JKKA 1IQDC 5DQ0A 3T2PA 1JZ5A 3WF2A 4YPJA 4W8JA 1UMHA 4LPLA 2WN2A 1O59A 1GQPA 2ORZA 4A6OA 1UYZA 4E8CA 3T08A 1GOHA 5JXGA 1JZ8A 2EIBA 2VZUA 2XONA 3K77A 4A4AA 1L7QA 1JYXA 5DPNA 3LE0A 1GU3A 1WCQA 2DCJA 3HPNA 3C7OA 2VTFA 3CZJA 5A1AA 3I97A 1YQ2A 3WNKA 4XUPA 3CKHA 2W47A 2W94A 3OGRA 5F7UA 2Y6JA 2VO5A 1ULOA 2BZDA 3WEZA 5IFTA 1T2XA 3J7HA 3NNGA 3P6BA 3PUHA 1HN1A 1UMIA 1UX7A 3U37A 3ABZA 2WZ8A 2R7EB 3DYMA 3LEGA 4BK5A 3CDZB 2J1TA 3IIIA 4DXRA 1KEXA 2L9LA 3A22A 2W3JA 2WAAA 1K42A 5CZKA 3WF4A 5I0DA 4XUQA 5DN2A 2Y6LA 4ZY9A 1K45A 1O8PA 1CX1A 3OEBA 1RYYA 3I2IA 3VDCA 1GUIA 2W1UA 3T2OA 1JZ2A 2DCKA 4CUBA 4CU8A 4A45A 3OG2A 1GOGA 2VQUA 3E1F1 4CUCA 1UY0A 3CQOA 4CU9A 4OYUA 3A7QA 1GNYA
chains in the Genus database with same CATH superfamily
3RI8A 1RUG2 1RUH3 3UGGA 3DPRC 1W05A 3I3QA 5FWEA 1R082 2YC4A 3JD73 4WM7C 5F39A 5ERLA 3HN3A 1XNTA 3BUCA 3V65A 5FP7A 5JOXA 2ZGLA 2DCZA 2Q8EA 2BPA2 5E8AA 5F3IA 4JKMA 4IE4A 3V56A 4B4QA 2DFBA 3D82A 1OI6A 5J48A 4URTA 1JZ3A 4XUNA 2VPVA 3NV1A 4ARXA 3AK0A 2YB7A 1UWWA 1RVF2 2AZ5A 4HVOA 2I74A 2RMU1 4FPCA 2W1SA 4YZ3A 3B01A 2XMLA 4FOWA 4UWDA 4COYA 3DECA 5HPOA 2RS31 1SBDA 2XGXA 5A1LA 1GNZA 4X8PA 4NAMA 4XW3A 3E5XA 3KSCA 2LALA 5BNOB 5JZGC 2YZ4A 1W9FA 1UIJA 1YHFA 3OYWB 3WR0A 5C71A 4IV3B 2JKXA 4M0HA 2W08A 3HEIA 1AYN1 2E9QA 1ZRIA 3FHIB 5JPMB 1ZRCA 2ZHMA 1OFNA 3VL8A 1HJFA 2B45X 3H50A 2B4KA 3ZLIA 5FZOB 1RIRA 5GZGA 2VZSA 3VD3A 2G19A 2CTVA 3MPPG 4KMQA 3VBHB 1PO11 4AGRA 5ABJC 4XF4A 1UN1A 5EJ1B 5T3NA 3POJA 4FBFA 2WS92 3AZYA 3WLUA 2WIIB 1VRH1 5IVBA 1IKQA 1WMEA 5JSOA 1YLLA 1OC1A 2VBBA 5KHHA 4Q4Y2 1EAH1 2J1UA 1JN2P 3LA2A 5D8AC 3VD9A 4N9HA 4M4PA 5C9AA 5FDBA 2LS6A 2ZHNA 2E32A 1W6PA 2VZ3A 1S0IA 5C4WA 3SC7X 1OXCA 2WNUC 1YCIA 1S2KA 3BCWA 2R0HA 5A6YA 2BYVE 2WZR3 2YC2A 2PQSA 2VZVA 4Y5SA 3WX5A 4Y1ZA 3ZPYA 1W6NA 4RR3A 3C7HA 5FUNA 3WF3A 2E51A 3AZZA 3TYJA 3ZYIB 5FFOC 4S2GA 3VBOC 4D6SA 5E1RA 3MUZ1 3TN92 5F5IA 1ZZ8A 4YNIA 4XUOA 3MV11 5JR7B 5CBLA 1UNBA 2B8MA 4OUSA 3I4IA 2ZJCA 3I3EA 1B35C 4YLZA 5FKBA 1RJ8A 3QBQA 4CDUC 1C1LA 1RJ7A 3EJKA 4FPYA 1N3OA 2W52A 4ZU5A 1C1FA 5H9PA 3BVCA 1HXS1 4LBQB 5D1IA 5EIYB 5L7OA 3M70A 3NJVA 5AVAA 4R9DA 3OEAA 4TLFA 1KDKA 1MQTA 1W3XA 3BTZA 1QHDA 3MYXA 1GQHA 1MEC2 5KC5A 2CAUA 1JODA 1N3PA 4PBPA 5EJZB 2VUJA 4Z8BA 5KR7A 3JB4C 5KHKA 5EFUA 2I2SA 1UY2A 3J4UH 4IE5A 3T1LA 2ZHKA 4QM9A 4K8RB 3T0AA 1WCSA 2OA2A 4AAXA 3OD4A 1N47A 4QPWA 4RGGA 1F4AA 3IIAA 2HLEA 3AB0A 1ND2B 3TNPB 1DZRA 2IXKA 1PO21 2QUOA 1C8M1 2C26A 5F2SA 2OT7A 1QXRA 4BISA 2WYFA 1OLME 2R0FA 5F9TA 4YW6A 1W8TA 1SG3A 4AI0A 3V0BB 5JDBA 4Y20A 5I0TA 2HWF3 5FBZA 5A3WA 2Y6KA 2HYXA 2YG0A 3AP7A 3LZZA 5K0UC 4LOSA 1UOJA 2VOWA 2NYYA 1SBEA 4O9EA 4I02A 3ZFGC 1PVXA 1XYNA 2D44A 4NIDA 4MOAA 4Y33A 1JZ4A 3POSA 4PIZA 2JXAA 5FPVA 1BEV3 2WRAA 2YBSA 4QWNA 1YQ8A 2J1SA 3T3YA 3MICA 4ZXEA 2GC3A 3WQ1A 4YM3A 3MZHA 1I5ZA 4FFFA 4M3CF 5CVRA 2ATFA 3UESA 3ZXKA 4HKWA 4CDQA 1HQNA 3FLTA 5CADA 4YVSC 1RUJ3 1Z7S3 1ZRRA 4E9KA 1U12A 2VMDA 1QQP3 3WW3A 3ZSKA 5HXMA 2PLV2 4XHXA 2JIJA 4LA2A 3WD5A 2DV9A 1DGWX 4GB32 3BKZA 5AC93 2QKDA 1SLLA 4AVCA 1TME1 1YFUA 3MO4A 3RWKX 2IXJA 5DDJ1 3ST7A 4CCLA 1RUE3 3RZGA 3JD72 1DF0A 1VBE1 5C5TA 4A44A 2ZHLA 3OJBA 2E63A 4DOUA 3UETA 1UKRA 5CU1A 1Q8QA 2Z5WA 4CDXC 2WUHA 3FHQA 2VQ0A 4Y1UA 4AQ6A 1ND3A 4GH4B 1W9SA 3TEXA 2I07B 1DYOA 1JOBA 3C7GA 4XURA 1Z0HA 3HAGA 3VL9A 4IEOA 1LKNA 1KXGA 1UU6A 1NA1B 3LA7A 5LK5A 2VM9A 3THTA 2DVAA 5BPXA 2JDHA 3GBGA 3ATGA 4FXGB 2Y34A 4NUBA 5EXOA 4QMAA 3H8RA 5BNPC 4PIXA 2Z79A 2G9GA 3ZSLA 4IEPA 2GMEA 1MZ5A 3FLPA 4AI2A 2XBO1 1VBA1 1UQXA 5FP4A 2IUWA 4CU6A 1ZBE3 1O3TA 5L36A 2ILMA 2A6VA 2GDFA 4RFRB 5T5OA 2GNTA 2WQZC 3AKQA 5FZ0A 3LPGA 3DYPA 4QPIB 1LEMA 3C8XA 4J6GA 4I2OA 2HWE3 3SH5A 1QF3A 4L92A 3WCRA 1ULCA 2OQ7A 5J7MA 3RZKA 1DGRA 4WM8C 4PDWB 3RZLA 1US2A 4XHBA 1DGRN 4Y1YA 5LY2A 2A73B 3RS6A 3GBFA 3ZYRA 3AFGA 3RSJA 2O1QA 3TB0A 2ZTNA 1GMMA 5IJRA 2RV9A 2H0BA 3IMNA 5K7PA 2VR4A 1RC6A 1SQ4A 4XAEA 4MHRA 2CAVA 1NCQB 1VMJA 1ENQA 4AHWA 2E7AA 4WM7B 1GOFA 4EN0A 1BMV1 4I30A 3ZYBA 2WZR2 4K40A 1EPZA 4LQRA 4E4ZA 3OY8A 4KBBA 4EE2A 4Z1VA 2TEPA 4QU1A 1D4M1 1LGNA 2OPWA 1TQ5A 1IG0A 1N1YA 3ZOIA 5FMDA 4AEDB 3P1IA 4MXWA 2GNMA 4FVVA 5D21A 3VBFA 4WVMB 2YU1A 1RUD3 1SZBA 1DIWA 2CWMA 2P37A 3MW3A 2ARCA 3AM2A 1FT9A 5A3OA 5BY5A 2R1DA 5IWFA 4HMZA 3ZO0B 1W8OA 1H8VA 1XBFA 3OGGA 1FMD3 2ZGQA 1JU3A 3BODA 1AX0A 1U5IA 4LKSA 3VDAA 1OQ1A 1YNAA 2BOJA 3LDKA 3Q8FA 1W8WA 2NQYA 1F5FA 3QLQA 3ON7A 1DQ6A 2CNAA 2OVUA 1BLZA 1V6NA 2TNFA 2O0OA 3CIHA 4JVAA 3O14A 1UD1A 3ZFFC 4E27A 4CCOA 4IXLA 4CPBD 1LOGA 3CEWA 1CWPA 3H3ZA 3WP3A 2WSVA 4H7LA 1JUHA 4Z07A 4E8DA 2HH9A 5IVCA 1JYVA 4CUGA 4DXTA 3H8XA 2YGLA 2VQAA 1V6JA 5CFDA 4LBKA 3I2OA 1POV1 3D0SA 4QHOA 2PA7A 2BWAA 4XMAA 2YHJA 3I2KA 1BZWA 1VJ2A 4MUVA 3U4XA 4AG4A 1QJX1 2JDNA 3NWKA 3U10A 1QJFA 3KB5A 4CE8A 2ZCWA 3K48A 2D43A 2CHHA 3GZAA 4A7KA 1H4HA 4OI4A 2HWF2 4XFBA 4XZPA 3AKTA 2WFF3 4GWNA 2BV4A 2WNUB 3U75A 5KHIA 5LZ6A 4XJUA 1S2EA 3VBUB 4K1ZA 5B4NA 5FYSA 3BIEA 3LPFA 1RUG1 2ZX1A 1LHUA 3LDRA 3LSDA 3VDDC 1BEV2 3VB9A 1OPMA 3UGHA 4C0HA 4QB2A 1S1AA 3ZSEA 3WNLA 2BGCA 1OQEA 3VBOB 3ZN5A 4KWLA 1FOD2 1UKGA 3JXSA 4P02B 1HRI2 4AWDA 1AR73 3O1SA 2XJPA 3WNNA 1BHGA 1SLAA 1F4HA 1CAXA 1RUJ2 1Z7S2 1WW5A 1QQP2 1V6LA 2RS51 4JHTA 1IS3A 4CPBA 4IE6A 4ZPIA 5DAXA 2BJSA 3M3EA 5J96B 5AC92 2PYTA 4HKOA 3NO8A 1IG3A 5EWSA 2AREA 2X10A 4A7ZA 3Q8BA 2XDVA 3GZTB 4MSVA 1VE0A 5LB6A 3M3QA 3UNPA 1FI2A 1RUE2 2P5BA 4BQYA 1AVBA 3CJIC 1NE6A 2VW0A 5FZOA 5ISLA 2Y6FA 2XH6A 3THCA 4JRLA 4A41A 3LAGA 4B8EA 4NMIA 3VBHA 2Z4FA 1NT0A 1JOPA 3T1MA 3VZJA 4R4XA 4XBQA 4CEYA 3EYPA 4GAZA 3VZNA 4GKYA 4GULA 4PHZA 3DEMA 4Y24A 1O4TA 4HVRA 1IS4A 5FZFA 4YPJA 3ZYFA 5FK7A 2RM21 1Q8SA 5A6ZA 1QNWA 2Y0OA 4LPLA 4DO0A 2FMDA 3CF6E 4AOCA 2UYAA 2HYKA 2VCMA 5FZIA 5FZ3A 1CAVA 5IVFA 1RB8G 1H8TB 4LXLA 1RXGA 5JAXA 4A6OA 2EF6A 4PLMA 1YFWA 3CL1A 4Q4Y1 4Q4V3 4QPYA 2GN3A 1RHI1 2ZGOA 3K2OA 4XIOA 4CCNA 1AYM3 5K0UB 5JXGA 5A3LA 1ZA7A 3DKWA 1GP6A 3SH4A 1VBD3 3X29B 3ILFA 5JOZA 3WP6A 2XONA 3K77A 4XF9A 5A80A 3FX3A 4UF0B 2ADDA 1L7QA 2XJSA 2GC1A 2HWE2 3LE0A 1GWLA 5FZDA 2UWAA 3ES4A 2RG4A 3OF1A 3C7OA 2PHUA 1O5LA 3CJXA 1R1A3 3N9MA 3ZFEC 3I97A 1YQ2A 2JDMA 2XG3A 2BVVA 4K8FA 1ASJ1 1DQ2A 3CKHA 4LO6B 2W94A 3O1OA 2QQPA 4LIVA 4M3CE 1YIPA 2OIIA 2WA4A 5BNOC 2XHKA 4L2NA 1T2XA 3J7LA 3V0AA 2R073 3P6BA 4IV3C 2PMWB 1A6CA 4XIKA 4BQ1A 2GSYA 3U37A 3ABZA 2WZ8A 1UX6A 4ES8A 4MV2A 3OUIA 1BKZA 4S2FA 2J1TA 1VP6A 3IIIA 4N7UA 4YW4A 5FYCA 4CDXB 2AENA 4HN1A 4XE9A 4XJWA 1PVC3 1KEXA 4OULA 1NZCA 4XFIA 3BTYA 2W3JA 4DXZA 1XB9A 4UFIA 5CKQA 4HPKA 5A3TA 1RUD2 1S0FA 2AC1A 4M00A 2Y60A 3WF4A 4DRVA 5I0DA 1GZ9A 4ONUA 4HZFA 4Y26A 4YZ5A 3GZEA 4UBHA 4ZY9A 1RMU1 3KD4A 3V0BA 4Q4X1 1JH5A 3I2IA 1AR61 2W1UA 1R083 1UAIA 4D94A 2DCKA 1LU1A 4FPJA 4LBMA 4N7IA 2ZBJA 1EV13 1DCSA 4AE2A 4CUBA 1BK0A 5IK4A 3SMHA 2BFUS 1HV0A 3L2YA 4CCDA 2DBNA 3AJZA 3WDVA 3N9PA 1SCSA 1LOAA 5CISA 4FFHA 1G9FA 1TMF2 4IV1A 4XJ9A 2PHFA 3LB9A 1Z78A 4CUCA 2CWSA 4CU9A 1XNCA 3A7QA 3FE5A 3ZYJB 3KVBA 3WW4A 3WCSA 5LBCA 4QX1A 4FXKB 5DMYA 4MGQA 5GLZA 5A7PA 2V4VA 4QQLA 1ZZBA 1RVF3 3RJ2X 3OBTA 1OSGA 4AFDA 3AKPA 1BBT2 1GZTA 1VBB3 2ERFA 3KM5A 4LUKA 2C4XA 1OLRA 5EQUA 3RZHA 2Y38A 5FWJA 4C0BA 1QMJA 4GD4A 4NO4A 2P17A 3D4KA 2Q1MA 2PHRA 1KFXL 1DBNA 1QJU1 2GAUA 3MI8A 4R52A 2WFF2 1PZ8A 4XFHA 3FMGA 3U14A 4B1MA 3H7YA 2J42A 2OKXA 2OYZA 2VZTA 1O7FA 2EA7A 3KT4A 2D3PA 1W9TA 1R091 4NRPA 1LRHA 1L7RA 2WNVA 4NHXA 1RUH1 3ACFA 5IVYA 4KQ7A 3F2ZA 1W28A 2HWC1 2JECA 3GGLA 2X53S 2XJQA 4GH4A 1E5RA 2ZACA 4J1WA 4EWAA 1YXWA 1LCLA 1YYNA 3E6BA 2X5IC 2HKXA 4NPMA 1ND2C 3TAYA 4YGDA 5EHDA 4FQ4A 4HETA 1K5MB 1REDA 5JXJA 1PGL2 4ARYA 4AVSA 1DQ5A 2GP5A 4COVA 3MUY1 4N43A 3WQBA 1LENA 3B7MA 5H9SA 5KXEA 4IEZA 1W8HA 1GYKA 3DF0A 4Y1XA 1EUUA 2RE9A 2EAKA 1YC61 1V00A 3KWVA 4KGQA 4Y3OA 3SISA 2HEYF 3ENRA 3J8F1 1AR91 4LBLA 3E5UA 4E2GA 1QIQA 4BQWA 2BERA 4M3CA 1JW6A 4LHKA 4RS5C 4LT5A 2ARXA 1JZ7A 4AL9A 3NV2A 1HRV1 3MIFA 3ZFFB 5FLJA 4XDPA 5BV6A 2ZGNA 1PGW1 1S4CA 2XOMA 5BNNB 4PDWA 3O1VA 5FO7B 1P8JA 3NNMA 1K3IA 1DQ4A 5CG9A 2D6PA 1MZ6A 4GMP1 3AZXA 3NQHA 3OD0A 1W8NA 2JDPA 4RN5A 4EN8B 2D98A 5APAA 5A6QA 1VAVA 2MPFA 2K2SA 5FP3A 4K9SA 2FD8A 1JUIA 4RQPA 2QQLA 4UFJA 3FBYA 3R6SA 5A33A 4AFBA 3DPRA 2XUEA 1OH3A 1LTEA 2VNGA 1QOSA 4JX0A 3KGZA 1KD7A 4WM7A 3Q9OA 4Q4V2 1AYM2 3U11A 3HD8B 1VBD2 2BW8A 3VKLA 3H1WA 4BU2A 1UCXA 4WZCA 5FREA 1VRBA 5F2WA 1CVNA 2HEVF 2VW2A 3M4FA 1T6GC 2QDRA 5FZ9A 3WDYA 3KQ4B 2JG9C 2QQWA 3IDCB 4WVMA 4XAAA 5DG2A 3PUIA 2EXJA 4FAHA 2YYOA 5BUVA 3VKOA 4MG2A 4EV0A 2YDEA 2F6BA 3FLRA 3N9NA 3ZR5A 4BXSV 4OHZA 5IT6A 2WSUA 4D7TA 2JJ6A 1AL21 3JB8A 2HWB3 4NHMA 3MEPA 1D2QA 1W39A 2DUQA 2IVIB 2DFCA 3EMRA 3H8UA 4MGSA 4TXWA 1XXNA 5FYBA 2JD4A 4O61A 2KXLA 1MR5A 2OQ6A 2FZ2A 2VZQA 1N1TA 5JZGA 2Z69A 4SBVA 3OGVA 4PF5A 2Q8DA 2R072 3CJIB 2EALA 4LBOA 4LITA 4EQVA 4L99A 5FZ4A 1UW8A 3JQWA 1WMFA 4QPIC 2NM1A 3I8TA 3VLBB 2R061 1RUI2 5A70A 3EO6A 1PVC2 4FPEA 2AEYA 1W3VA 5ABJA 5F5QA 3SEPA 1YIFA 1OA3A 1OA2A 1U5ZA 4QX5A 1BVP1 1LAJA 2BP6A 3PUAA 1MS3A 4EZHA 5B2GB 3OBRA 4NHLA 3MF6A 1B09A 4LBNA 3KF5A 4YZ4A 4QX7A 5D8AA 5DAWA 3S5QA 1Y7BA 4XJZA 3WT3A 2ZGKA 3IT8A 2CGPA 3L9JT 3I59B 4ITCA 1RUC3 4OQ9A 2R1BA 5C5UA 5JOWA 2ENRA 3DKQA 4QXHA 2P34A 4MGIE 4YG6A 1IPSA 2QQKA 4YW7A 2WNUA 1NCQC 2RDSA 3V64A 4GWIA 4RL7A 1S0JA 1EV12 1DP0A 1E5SA 3R4DB 3W21A 3KLSA 1JXNA 1PGSA 5FMOS 4W6YA 3AP4A 5I0UA 5TSWA 4OMDA 3AYAA 3TOJA 4JKLA 2RJKA 5JI9A 1NCRA 4OMCA 4QDSA 2PAEA 1KJRA 1POV0 2UY9A 4KGGA 4MVTA 4Q0UA 3LIHA 2VCAA 4AEDC 1D0GA 4GQ7A 3VBOA 1SHWB 3C7EA 4BQXA 1VR3A 1DYPA 5KXCA 3SKVA 1EP0A 2EICA 4CA9A 3NNJA 5J98B 1LODA 3BALA 1BEV1 1B35A 2A5ZA 5FPLA 3ZFEB 4CDUA 4A2UA 3B00A 5T5LA 1LULA 1LOBA 1VBB2 1PM7A 1XC6A 2XVLA 3H3UA 4IGPA 1HB1A 4JGYC 3HNYM 4W6XA 4PJYA 3WG2A 5FBJA 5K4LA 1GNHA 1LHWA 3WG1A 1ZRDA 3ILNA 1NKGA 5EP9A 3KHCA 1V6IA 3WNPA 1VB4A 1TG7A 2MHFA 1CR7A 4QKNA 4UXAA 4XZUG 1HLCA 4PLOA 2R30A 4COWA 2EXHA 1JYCA 2C24A 4BQ4A 5LY1A 4YFWA 1DLLA 4MH0E 3IBMA 5AC91 2Y6GA 3USUA 3W58A 3PVBB 5IK7A 2JDAA 2AR6A 1QJY2 3FWEA 3VD5A 4YSFA 5IATA 1EUTA 2C6SA 4HK8A 5FP9A 2MEV3 1AX2A 4LO5B 3LIGA 2WN3A 3K51A 4LOTA 2B9VA 5FZCA 3NRUA 4AFCA 2PTMA 2ZGSA 2XLFA 4HKLA 2YV8A 2IXIA 3ZXLA 5J3UA 2OXBA 4XFFA 3CHXA 3O0XA 2WQ4A 3N7MA 2IXHA 1PK6B 1UOGA 1UZZA 1NXMA 1A78A 4FOVA 3OCPA 3DUIA 1D2SA 4J25A 5EYYA 1PIV1 5FK8A 3ZYPA 1AR83 2VE1A 4QKBA 2ZMLA 3BTAA 1D4VB 4OHYA 1D7PM 4ZXKA 4FOQA 4CEWC 1O3SA 4V2WA 3AP9A 5K0UA 3VBUC 2JKBA 1QY4A 3ZFGA 2VMGA 5LATA 4BIFA 2ZEWA 1REEA 4PF1A 4YW1A 1QJZA 2NPIA 5ANQA 5A3MA 3T2QA 3WP4A 3APBA 3ACIA 4CSWA 3FUQA 5LA2A 1CAUA 4X6RB 2B7YA 1X36A 2EXIA 1OD5A 4LBJA 3HT1A 5FO9B 4LMFA 3GCWA 4AHYA 4DINB 1ZBE1 4KG8A 1KRIA 2AYHA 4YM1A 3ES1A 3OPZA 2VCCA 4GJYA 4AI9A 4YVSA 4RHV3 1C28A 2VVEA 1RUF3 4Q2FA 3ZX7A 4JRAA 3MFAA 5C3SA 1VBC1 4B7KA 1LESA 3RZMA 3PUQA 4ET7A 2Y64A 1CZTA 4K3UA 4E4HA 2R041 4H3WA 4UFLA 2BBVA 4Y5Z0 3VHPA 3I49A 1GWMA 5B4XA 2X05A 3PDQA 2WZPP 1WUVA 4QXBA 1W6MA 3RNSA 2X8KA 4F8AA 1XPWA 4X6QB 4P9GA 2K9ZA 4E4SA 3MPBA 3LCPA 3LD8A 5GZFA 3FBMA 3S30A 1GZWB 4JDMA 4FPOB 3K4AA 4CDXA 4DZGA 2LTNA 3SEEA 2Y33A 1V9U1 4YVWA 2XB6C 1DYKA 1MS0A 2FZ1A 2VMIA 4OHXA 4FTBA 4BCUA 2ZEZA 1OPOA 4XBNA 1F35A 2X5IB 2FQPA 5I8TA 1H6YA 2RR11 5DAVA 5CAZA 3K3NA 1LR5A 1NQJA 5GZCA 4JC1A 2P2KA 3ITQA 4DY5A 1FNYA 2Y8KA 2E6VA 5C70A 1COV3 2HWB2 1I5PA 4I0WB 1H8TC 4PI0A 5BNPA 4G3YC 4XEZA 1HKDA 3THPA 4PT6A 2EAAA 4Q4W3 5E88A 3WVJA 4P9IA 1YJKA 2ZGTA 5IHRA 2FBEA 5JVVA 4KU8A 1FMD1 4RS5B 2LM3A 2Z42A 4YARA 1IS6A 3BPSA 3KS7A 4CDWB 4RYDA 4A3XA 4ASMB 3GZUC 3AC0A 3I2GA 3NVCA 3O0WA 4WM8A 4QPGB 4DNYA 1FOD3 1YQ6A 4QD2A 5A7SA 4AVAA 4BQ3A 5C9AC 1HRI3 3O1MA 4FI9A 1O6UA 2D6NA 4DFSA 5FZ7A 1JU4A 1JZ6A 4L0PA 5JUVA 5SV8A 4X8NA 5AFEA 5G04L 5FY4A 3WNXA 1CZVA 3GJBA 5FJKA 2YFUA 4DEQA 3ZIWA 2JDZA 2XHNA 4QB1A 3VZKA 3WW1A 1RUC2 2EIDA 1KGYA 4UBGA 4PBOA 2WWJA 4BYYA 2V73A 4LO7A 3HIFA 1RUOA 4AHXA 3TBDA 4K7JA 3FL7A 4R9AA 3VKNA 2BDRA 2P3KA 2RS33 4MXVA 4AQTA 4NAOA 1J1TA 1ZBA1 2G1MA 1YWKA 4P14A 2BU9A 5C8CB 4IERA 4QXCA 3AZWA 2HBUA 1XU1A 2QDNA 5T55A 3ZKYA 3A0KA 3JZVA 1FXZA 2VZ1A 4KWUA 2JG9B 1AYN3 2BGPA 2B46X 2SLIA 2VOXA 3OTFA 1WLDA 1WCKA 3B5LB 4HSJA 3UKTA 2VY0A 3ZMOA 3NAPC 2W46A 2WO3A 1XSQA 2FDJA 5FUPA 5BNQA 2XKPA 2P4EA 3ZXGA 1H2KA 1J59A 1MPXA 2J1EA 4P9XA 3TEZA 1GLHA 5FUIA 4K21A 1VRH3 3HMYA 3DXTA 5JOYA 1AR71 3O12A 3D3AA 2YROA 2P6CA 3I3BA 3UKNA 4BMEA 4DMIA 1U5YA 1W2AX 1WWYA 3O1UA 4YW3A 5DUVA 4JKKA 4LLFA 4COUA 4GXLA 3ZFFA 1OURA 2FMYA 2CSGA 3H42B 2E7QA 3M1HA 2W0XA 3WF2A 2QZ3A 3MLJA 5DZFA 4QKFA 3O5SA 1W6QB 2D6OX 2WJSA 2MEV2 5JWPA 4MHUA 4RGAA 3HQRA 3J26N 3N9QA 1W04A 2O14A 1C57A 1OMIA 4IEVA 3U1XA 2XJRA 3WDUA 1G9BA 1AJOA 5A3PA 5DABA 4E8CA 4Q5OA 4CP1A 1GOHA 1XNKA 4LJHA 4NVPA 4E2QA 3PJQA 2I45A 1MS5A 3JBG2 1AR82 4NPLA 5T50A 5ACA1 2O8OA 2OZJA 3B94A 1CAWB 1YI9A 3MHZA 1OLMA 3G7DA 1E57A 2QE3A 4YW5A 4TYSA 5DPNA 4QU2A 3URFA 3PTRB 1UZYA 1WCQA 1AXYA 2DCJA 2YC0A 3IPVB 3ZSMA 5HV0A 1SLBA 1R1ZA 2VTFA 4GMP0 3ORJA 2W68A 4N90A 3VDDA 3ZYHA 4Q4V1 3RJRA 2W47A 5F7UA 5IVEA 1AJKA 1G86A 1AHSA 3DN7A 4UW6A 4K1YA 4V1PA 4XPVA 5EPAA 1K5MC 5FPAA 3ZKUA 4DB5A 4IESA 1QH6A 4CCEA 4L8QA 4AVBA 1NXD1 3J7HA 2FDFA 4RHV2 1J3RA 2D5HA 5F3CA 1RUF2 5FMCA 1HN1A 3POFA 1UX7A 3OOXA 1NE4A 4JGYB 2R7EB 5IK8A 4F7ZA 4BK5A 2P1BA 1J3QA 3CDZB 3UT0A 3P3NA 2JDUA 2JDYA 2ZX3A 3ZN6A 5FZHA 3AVRA 4QQPA 1C8M3 1AXKA 1R1A1 3POWA 3ZIXA 1IPKA 4DXRA 2JG8B 4JZRA 1H2NA 3GHMA 3P5BA 3A22A 2XL7A 3GNEA 4N53C 4RGKA 1TMF3 4ORFA 3A4UA 4B29A 3N7JA 4K6BA 5LBFA 4E2SA 3OGJA 4XCBA 3OPWA 2YGMA 1W2NA 1X82A 1SDWA 5BNNC 2Y6LA 4FPHA 3WZ1A 1AZDA 2UWBA 1MZFA 4IQPA 1ZVFA 3OEBA 1RYYA 5FY8A 1FPN1 1SLCA 3OUJA 5FPBA 1MVQA 3KV6A 1BBT3 2ZKNA 4BMBA 4CU8A 1PVC1 4AVTA 1DFQA 3I59A 3N7LA 3UGFA 1ODNA 2HJIA 1COV2 1Q8OA 4R4ZA 1SFYA 1NLRA 3PTYA 2NMNA 4QGNA 2XXZA 3WHTA 4XOGA 3N4MA 4CEWB 1PZ7A 1N1SA 2VQUA 4Q4W2 3E1F1 3HN1A 1UY0A 4L97A 3ZXAC 5LEKA 1JOJA 5AFBA 1GNYA 1HIXA 1WCDJ 4AVVA 2RDRA 1ACCA 2VQTA 1TME3 3HBKA 1R081 3PVOA 2C9AA 4XBLA 4AZZA 1O91A 4ASKA 4C90A 2XJVA 1ENSA 4MYEA 2B42B 1VBE3 5FXXA 4BQ2A 1OBNA 2F4LA 4IEWA 2D6LX 1ZREA 4ZS3A 1MS4A 2G9FA 4LKFA 1KQRA 3RG0A 5FRAA 1G7YA 1GR3A 2VMEA 2KA3A 3LF7A 3U0ZA 5JCTA 5HXVA 4XDQA 1ULEA 1V6MA 2VAUA 2VOKA 4CCCA 1F5JA 5FO8B 3ZYGA 5BNOA 2VNOA 3BU0A 1PZ9A 1ZA4A 4IGOA 1RVF1 1ALYA 3OYWA 5FYMA 3ROUA 1CGPA 4IV3A 5A3NA 5FZAA 1LOCA 2J1AA 2RMU2 1H4GA 1SACA 3VBRC 4XTMA 4D6RA 4C91A 3IWZA 4CXWA 1G8WA 1X8EA 2CV6A 2RS32 2LRPA 1QDOA 4QAWA 1ZZ9A 4HK9A 4J1XA 2CDPA 2XUMA 5IK5A 4Z92B 5F37A 1UYXA 4LBQD 1H0BA 4YZ1A 4XVHA 1OF3A 2BWCA 1AYN2 1T6BX 4P5YA 3SCHA 2NN8A 4I0AA 2YY1A 3CMGA 5K8SA 1LGBA 3N3HA 3BOWA 4QGLA 3WG3A 5CFCC 2VMCA 1Q5OA 4AI3A 1W0OA 3LEIA 4META 3ZR6A 1OF4A 4JGZC 2WS91 1YUDA 4AF9A 1SPPB 4XC9A 1VRH2 4C1XA 3KV4A 5F32A 4Q0PA 2ZKLA 4TTGA 2CYFA 2ZGMA 2CGNA 3FFQA 3IDAA 2LUWA 4BH9A 4OUEA 2WAOA 2WBKA 4Y5TA 4EN9B 4LO4B 2RHPA 4AQSA 2TBVA 1VB2A 1TE1B 1ENRA 1VMHA 2CU5A 2Q4SA 4OHVA 3E6CC 4HN0A 2WFPA 3T2TA 4OLLA 3RQ0A 3VD7A 5C9AB 3WHUA 4NN0A 4AI1A 4WVVA 1HDKA 1W6PB 2GC0A 5C4WB 4HG6B 1K5JA 1YO8A 4NRMA 4OFGA 1NYWA 1VPHA 2V09A 4CP2A 4NR1A 4XFGA 3SH3A 3TN91 5JSRA 1O3RA 1ONAA 4ISRA 4LBQA 1R64A 3ACGA 3HR9A 2A6WA 3DYOA 5T52A 2OPKA 4IL7A 1SFNA 1W6NB 1WMDA 4RR3B 4ES9A 4URAA 1C5HA 3U78A 2GC2A 4AGVA 1M4WA 3RDIA 1U0AA 3LOIA 1DU3D 5F3GA 1G9DA 5H9RA 4LO8A 4B1LA 1UIKA 1ZNPA 3USSA 2DWRA 1H1MA 1RUI3 1QWRA 3VD4A 4INDA 2QBXA 3THDA 2RS13 1JYWA 2X5IA 4QX3A 4ISQA 1LNSA 1MEC1 1ND2A 3M3IA 2LW8A 5T54A 1Q8VA 1ODMA 2W91A 2Q0AA 4UFKA 1TNFA 3POYA 2YPDA 4DPNA 3IDEA 3ZXEA 3NAPB 3KVAA 3OSDA 4FP2A 2UU8A 1PK6C 1UXZA 4IUGA 1XYOA 2PQQA 2VBDA 3AYEA 3O1PA 4I3GA 3QACA 4V2VA 3RMYA 3R4SA 3OB8A 4DIQA 1MQTB 2FCUA 4EWDA 2ZEXA 4JQRA 4WV8A 1PO22 3R4UA 3R05A 4HFSA 1C8M2 1SEFA 3E6DA 4RS5A 3E97A 3JUUA 5C3OA 1QOTA 5GLUA 1QU0A 4W4ZA 5GJ6A 4YG0A 4UW4A 2ZMNA 2VW1A 3IB3A 1X7NA 2QQJA 4FPKA 4I0BA 1OD3A 3H0OA 3DL3A 2C9KA 1QKQA 3CNAA 2OX0A 3LEMA 2ZPXA 4FSJA 4IW3A 4YM2A 4UT5A 3S57A 4NE9A 1ULPA 4XABA 4DEVA 2ZOEB 1S0GA 2BTVC 3IN9A 3POGA 2FDIA 3KV9A 3TNQA 1HB4A 1CIYA 1DGLA 1OA4A 2PLV1 2RS53 2UURA 4XFCA 2JX9A 1RITA 4GB31 1JHJA 2XQXA 1FV2A 1O3QA 2AEZA 4ATEA 3K3OA 3VBSC 3MFCA 1QJY3 4EN6B 1QNYA 1TME2 1X33A 4LK7A 1X9TA 4I01A 1E5IA 4TWTA 5A6XA 3B9CA 2B5HA 3JD71 5FZ6A 1FNZA 2BRTA 1VBE2 3QOPA 1RTVA 5SV5A 1V6OA 1K12A 4LE3A 4JQTA 4LULA 2DVFA 1NA1A 1U5XA 1TEIA 3FN9A 5LASA 2JE8A 3DCQA 2MNGA 2WWUA 4I09A 5FYTA 3JCIA 2HBTA 3NSTA 3ZM8A 3RRDA 1OKOA 2F4PA 4H14A 3NJXA 1IS5A 3AMQA 2CY6A 4KBZA 2QQNA 5EYXA 1OKQA 4BDVB 2RM23 3H1YA 1OOPC 2DYCA 3ETPA 1ND3B 5FYHA 1SCRA 2R6QA 3M2MA 4N53B 1QGLA 2IWGB 4CDWC 2W95A 4QPIA 2DU0A 1F31A 2ZS6B 4TN7A 1RHI3 1F9KA 3PJYA 4QPGC 4NIGA 1QXPA 2IFRA 2BNNA 4HT1T 1J84A 4Q0SA 4ATFA 5G05L 1GQGA 4JAAA 3SQOA 4QX2A 2VC9A 1NQDA 3M3OA 3ACLA 3RZZA 3EBRA 2A3YA 1E5HA 5FXVA 2PHWA 3HOBA 1GFF2 2ZEYA 5E6HA 3ZN4A 2E31A 3O7OA 1I6XA 2A6YA 1OHFA 2WO7A 5KWRA 1NCQA 1V70A 5F3EA 1HX6A 2YMZA 4FQZA 2WA3A 4CCKA 1A8MA 1ASJ3 4ZU7A 5LA0A 2PHLA 2Q8CA 2BBAA 5A7NA 1VIWB 4RFT0 1LJ7A 4Q0VA 3TEWA 1W0PA 4OCTA 1GANA 1AR81 4GZ9A 3RI9A 4CYDA 4OUMA 3VUOA 1M06G 2W92A 5T5PA 4COZA 5C8CC 1XU2A 3I2HA 4O7XA 3AKRA 4YGBA 4AEDA 5IYYA 3KT7A 1LOFC 3VHRA 3O1RA 2WZR1 1XYPA 1BMV2 3NKGA 3SHRA 3Q8CA 4LKEA 4CUAA 4DS0A 4PLNA 1UY3A 2XQRA 5I91A 2Y6HA 2QQOA 3I2DA 2WR9A 3C7FA 4GWMA 4Y22B 3H8OA 1BVVA 3KHBA 2Q8OA 4LIUA 3IM0A 2BQPA 4IDZA 1BJQA 3KGLA 1FX5A 3R0RA 1WBFA 2JWPA 4TSVA 2RJ2A 3OY8B 5JIUA 3WNOA 3LKJA 1KS5A 4PCRA 5FV3A 4N9IA 5L73A 1KDMA 3FC0A 3RYPA 3WF0A 1RMU3 4Q4X3 3TRSB 3VBRB 3B02A 1UY4A 1X8MA 2R49A 3VBFB 4ASLA 4L9BA 4MX3A 4AFMA 4B4PA 5C33A 2V72A 3GDBA 5CKNA 2VZOA 2YXSA 1F8VA 2RS12 3JQXA 4QDRA 4AEJA 3E5QA 5LRRA 4AW7A 4DXSA 4NIIA 3NNLA 2OZ6A 5M0TA 3NW4A 5BYNA 1H2MA 4XACA 4GWJA 3VN4A 2OUJA 2XJUA 3ELNA 3AVSA 1OUSA 1FYUA 5CFCB 4BQ5A 5CEHA 5HCAA 4JTNA 3WOGA 5GKAC 2VGDA 4JGZB 4HANA 4C1WA 1O4YA 3MLKA 3O1TA 5GLTA 3UL2A 4Q8KA 1F15A 2GN7A 3VBUA 3VZMA 2J22A 3WW2A 4DRRA 3SKJE 1PNGA 4BK4A 2QNKA 2QVSB 4LTAA 2ZAAA 3H9AA 3ZMNA 4UAPA 2ID4A 3GALA 2HWF1 2FCTA 5CFDB 2YU2A 1DQ1A 3BGAA 3GXUA 1ZZ6A 1HJGA 1KJLA 1QJU3 2JB8A 2WZEA 3AMMA 3AYDA 5FZLA 4FCAA 4NIAA 5L9RA 5K9YA 2VOTA 3MLLA 4RQPC 2VTXA 2C1FA 1R093 2WT2A 5C7GA 5F1RA 2FDGA 2J7MA 2ETEA 2PHXA 2VCBA 5LA1A 5L19A 2DDUA 4M4RA 4Q26A 4AAPA 4QX0A 1WD3A 1YQ5A 2HWC3 4G4FA 4W50A 1GSLA 4P08A 2BNOA 3LQCA 1S0CA 3I3DA 3WNKA 1WD4A 1UZWA 1FOD1 1J83A 1X9PA 2RVAA 2D3SA 1HRI1 5ANNA 1IKPA 3BB6A 3PUSA 5A7OA 1PMIA 1YQCA 1CESA 1RUJ1 1Z7S1 2JG8C 2WLQA 3KT1A 1QQP1 4LA3A 5AVPA 4ZZ8A 4OQ8A 5J37A 4XF3A 2RS52 5FXZA 4ZHNA 3ECQA 3FJSA 2AH2A 1G6NA 3VHNA 1W2TA 1NG0A 4GIQA 3UYJA 2YFZA 1NAEA 4JCKA 1IZ3A 1W0NA 3J8F3 4QDQA 2ZXQA 1AR93 5C3PA 5I0SA 1RUE1 1ENXA 1CAXB 3MGUA 1Y43B 4UI9L 5A7WB 5LCWL 4WBBA 3BN6A 4BA6A 2JB4A 3CZUA 3GHNA 3RWNA 4OI0A 1HRV3 3IDBB 1HN0A 4XTPA 1H1IA 5T5JA 4A42A 3W9AA 3IAPA 2QJVA 1XQNA 4R9BA 1I1EA 3BTXA 3KF3A 4NHYA 4B7EA 4Q29A 1Y9QA 1W06A 2PAMA 2YBPA 3VGIA 5I0RA 1H8TA 1IQDC 3JBG3 5C8WA 1SPPA 4GMP3 5DQ0A 3VZLA 1MS9A 1V6KA 3M3CA 4P9YA 4XFAA 3T2PA 3IZOA 5CA6A 4L11A 5FMBA 1UMHA 2AUYA 2RM22 3AXEA 1JMUB 2XR4A 3ZDVA 3PU8A 5KHGA 5FY9A 2WN2A 4CZSA 5FLHA 4ZU4A 1O5UA 5FCCA 3D8CA 4CEYB 5DAQA 2Q5TA 4GJZA 2K0GA 3LSEA 2CL2A 1LHOA 4UF0A 3RYRA 1GQPA 2ZGRA 4FT8A 4HBNA 1QEXA 1UYZA 1W2UA 1CPNA 5FZ8A 3T08A 1RHI2 4R9CA 2DURA 4C8DA 3SLIA 2DVBA 4SLIA 1BK1A 5I93A 1WLCA 2EIBA 1UPIA 1XOYA 3KQRA 1JTZX 2HWD3 5EZWA 4ZKTB 1CAVB 4XDOA 4QQOA 4A4AA 2XLGA 4W65A 1MZEA 1Q43A 2VVFA 1APNA 2HWE1 5DAPA 1JYXA 2IXLA 1GU3A 5FOJB 5FR3A 1IPJA 1CX4A 3A0NA 3C2UA 1POQA 2TUNA 3CZJA 1NCRC 5A1AA 4FFGA 4XXPA 1ST8A 1S2BA 1ASJ2 1AL23 2QQUA 4D69A 2VXJA 2VO5A 1YI7A 1ULOA 1WLTA 3GBWA 4QX8A 3VBSB 4Q1PA 5IFTA 2V5YA 2A6ZA 2B39A 4FTEA 1CPMA 3NNGA 4QHZA 4LEJA 4AGGA 2XLAA 3BPZA 2D93A 1GP5A 5DUUA 1W90A 3LA3A 1YFYA 3LEGA 1WLWA 4JV4A 3NAPA 2GMMA 4BPZA 5LBEA 2R063 5CG8A 3DXUA 5DG1A 3TEYA 2DTYA 3V0AB 5F5CA 5HI0A 2WC2A 3O0VA 4EJRA 4EZ4A 1K42A 1RUD1 4H7MA 5CZKA 1WCUA 2A71A 1GP4A 3PVNA 3ZXJA 1W8FA 1YFXA 1Q8PA 2JDKA 1OOPB 1RMU2 4QQHA 1JYTA 4Q4X2 2K46A 3VDCA 3RMXA 1GUIA 1I3HA 3HQXA 4FPFA 3T2OA 1AR62 2VNVA 3WDWA 4HPKB 3WXPA 3AYCA 2DVDA 4Y1VA 3ZVXA 1S0BA 2D97A 3I54A 4NWVA 4BHPA 5IVVA 2GH8A 4DQAA 4A45A 2KR2A 2QFEA 3B9IA 5F5AA 5FZKA 1AL0G 5LEJA 1TMF1 3MIHA 4NJ4A 5C4WC 3RPQA 4D7YA 1VAKA 3N7KA 3CQOA 4ZONA 4YRDA 3MF9A 4FAGA 4UYBA 1CONA 4BJ0A 2P3IA 1UZ0A 4RR3C 2X09A 2R32A 4IETA 2XJTA 1BBT1 2AACA 2E33A 1WBLA 4IV1B 2JE7A 5I8YA 2RMU3 1C5IA 2KM2A 4LNVA 1VLNA 1CD3G 3QD6A 5LW9A 2BGOA 1UZVA 1WA4A 1ULDA 1XE7A 2QQIA 5FMOL 2D6MA 4HL0A 5KXBA 2IFWA 2W1QA 2WFF1 4KWJA 4PQQA 3LWCA 1QJU2 4XQWA 3WNMA 4A7YA 2QZ2A 5FAXA 3AJYA 5A32B 2DU1A 5FYYA 1K5MA 2Q30A 3KCCA 4CTEA 5FTTC 1DLCA 2DVGA 3EB7A 1R092 1C4RA 1PNFA 2ZGPA 3C3VA 4JDNA 1QJEA 1RUH2 1UY1A 1XRUA 3VV1A 3A23A 1HB2A 2ZGUA 3MV01 2VTXJ 2HWC2 4Q1RA 5E16A 2D5FA 3WUCA 1PO13 4BB3A 5C3QA 5L7OC 3AL5A 2VULA 1LOEA 1MQTC 1SMVA 5LK7B 3W5NA 2E7TA 3VKFC 1PGL1 1A34A 2J1VA 5EV7A 4YW2A 2FCVA 4TLGA 4NOTA 1C3HA 5FY1A 4U36A 2WNVB 1W03A 2QQMA 1NZIA 5GZEA 1JYNA 2ZX0A 1EAH3 1DG6A 3NV4A 4Z2AA 3HQUA 4YVWC 2RJLA 2WNOA 1UPSA 2WLPA 4LHNA 4XMIA 4WVZA 4A6SA 5JMOA 4N53A 1BXHA 1PIV3 3K4DA 3I2JA 3NL1A 1W6OB 2G9ZA 3H7JA 1G9AA 1CIWA 3MIDA 3J8F2 1SLIA 5BNNA 2UWCA 5FPXA 5LWBA 1AR92 1PMJX 1KS4A 3IKWA 4N43B 4MGTA 2VG9A 1LEDA 4QKDA 1OQDA 1N1VA 1KFUL 1SFPA 1ZX5A 1FATA 1GBGA 3AMHA 4BXFA 1HRV2 4IGQA 1QOOA 2WQ8A 5J36A 1WGPA 5FQ0B 3SITA 2ZX4A 1N3QA 4HXCA 1PGW2 1GICA 4CCJA 3FHAA 3WDTA 3J7NA 4NROA 4XF1A 2W39A 4EYUA 1YJLA 4M3CB 2GALA 4TZDA 4DUXA 1AXZA 3WQ0A 2J1RA 1ZZ7A 4W6WA 2JICA 2Y0IA 3P3PA 3VHOA 5C3RA 4N8MA 3VDBA 1STMA 5HCHA 1J1LA 4P00B 1VBC3 3A21A 1OH4A 2ZA9A 3EQEA 5FZ1A 3T4HB 4UW3A 2WNEA 2R043 3D0JA 1UXXX 4CDQC 1HXS3 3FZ3A 1X50A 3HT2A 4HLTA 2WO1A 3ZSJA 2ZMKA 4XJAA 4Y4YA 3ME2A 5D2AA 5A7QA 1IOAA 4U2AA 4F83A 1XJAA 5LRSA 1AYM1 1OVSA 1W2OA 2Q1ZB 3HNMA 4GKXA 4IEXA 1MVEA 1VBD1 2RDQA 2D40A 4RQPB 4UFMA 4O9GA 3WSOA 1NLQA 1NY72 5A3UA 1W9YA 5HCFA 5A33B 3AX4A 2HWD2 4LK6A 2BVBA 3DPRB 2IZWA 4Y22A 1V9U3 3K4ZA 4GA9A 4BLIA 5FYIA 1GZCA 3DGTA 4K20A 4CVUA 4QM8A 2W1WA 4HONA 1ZYBA 4XILA 2UY8A 3I2FA 2RR13 4RD7A 5IAXA 1GWKA 1PO23 3FUOA 1NOVA 5HV4A 3W59A 2BOIA 4R8HA 2PHTA 3NKTA 3B93A 2WABA 4UFHA 1ND3C 3CJIA 2V5DA 3QH6A 1IHMA 1XE8A 1AL22 2W9XA 3POBA 4IEQA 3VBRA 1UYYA 5CKMA 1HQLA 3NNFA 4FFIA 1TZOA 3WF1A 2H6BA 2YPJA 2NMOA 3T0BA 5KBFA 3KCXA 4QXKA 3SXWA 2R071 1NUKA 5FP8A 4IE0A 4MO3M 1UMZA 4EWEA 2V4AA 3WG4A 2XVKA 4AEMA 1RGSA 1Y9MA 1NLSA 1ZM1A 2JE9A 2GP3A 4QB6A 4JHZA 3UKVA 3KCYA 5KC6A 3KMHA 4CP9B 1RXFA 1RUI1 2OUHA 3D6EA 5CFCA 1UOFA 2RS11 4CP0A 2R062 5GZDA 3N36A 5JZGB 5FJHA 1CN1A 2EXKA 1JHNA 4JGZA 3VZOA 3J7MA 2GH2A 3GJAA 1QH7A 3JU9A 1EYBA 3M8LA 2VZRA 3AXDA 1EPWA 3AL6A 2N7GA 4A3ZA 3ZXDA 1S0DA 4KNCA 1VAMA 5C6CA 2NZ9A 3LEKA 3ETQA 2VD7A 3BIWE 3INAA 4H55A 5ABJB 2VXRA 4AXOA 3PIGA 5CB7A 2CDOA 5FOBB 5IFPA 4LE4A 4Z2WA 5DDJ3 4DUVA 1EV11 4KL1A 4D8MA 1GKBA 1Y3TA 4FOYA 4XCAA 4AEKA 5D8AB 1URXA 2NLRA 3Q8EA 3BYWA 2H0VA 1I9RA 1OT5A 3U07A 3ZFEA 3T4VA 1ZBA3 3CBNA 1PMHX 4LUMA 4LR4A 4M0NA 3WP5A 3POEA 4AK3A 3GF6A 3LFIA 4P9JA 4NPRA 5DUXA 5J1XA 3F95A 3UJOA 2ORXA 5FKCA 2VNRA 1WKYA 3W5MA 2A7AA 3GM8A 1G9CA 1NCRB 4BIOA 2FDHA 4E4DX 1VBB1 2AGSA 3ACHA 5I8SA 1IQAA 3QH7A 1JS9A 2VMHA 5FPZA 3VBFC 4KH9A 5GLVA 4IEUA 1AUYA 4YM0A 4B3NA 5CNAA 2JD9A 5A7WA 1DDLA 1H2LA 1B35B 2ADEA 1VBA3 2DCYA 1TNRA 2XBO3 4CDUB 4KWKA 4D3WA 4D0QA 4DUWA 1GV9A 1UU5A 2GZWA 2UYBA 3K75B 4XF0A 1QJY1 4PQ9A 4D6QA 1DQ0A 4XQ4A 3AFKA 3IAQA 1PK6A 4P9LA 3ZDSA 5JR2A 1ZRFA 4EN7B 3QCWA 5L9VA 1LB2A 1PO12 1UF2C 3PVEA 4GALA 2P6HA 4MGYE 4OHWA 3UJQA 5F6LB 2VOVA 3AP6A 2ARAA 1EY2A 1XE0A 2B9UA 4DY3A 3PURA 2XKOA 5GM0A 4Q27A 3USUB 4XETA 3L2HA 2VUAA 4KG0A 1EAH2 2YUEA 3CU7A 1HQWA 3GYDA 4MLOA 2VZPA 3LFMA 3N35A 1WW6A 4MGKE 4I3PA 1PIV2 3SCFA 5ACA3 5CFDC 5KHJA 2W5FA 3POIA 3PLQA 4AFAA 3T09A 5FYUA 3T30A 1W8ZA 2VL4A 5CYYA 5JI7A 5KXDA 1F2NA 3S5AA 1H9WA 2NP0A 2YBKA 4P9WA 3HWJA 2VH9A 4HVQA 4BZ4A 1D4M3 2XL9A 3BOPA 3HJRA 5FIXA 3MIBA 1DHKB 4NRQA 2PFWA 2QTWB 1W99A 4YWAA 1PX4A 1W9WA 1TVGA 1WMXA 3ZFGB 2WDBA 3NV3A 4UOJA 1LHNA 1ZBE2 4FPLA 4CU7A 4CXYA 3WUDA 2FDKA 1HB3A 2P3YA 3GCXA 1REFA 4AHZA 3T0DA 2E53A 1RUNA 5FZGA 3ASIA 1GZWA 1CAUB 1VBC2 2DUOA 3D5OA 4QQ2A 3S7EA 4AYUA 3VBSA 3HNBM 2R042 3K46A 4QGMA 5FLIA 4BLJA 3B3QE 2G4IA 3BI3A 1HXS2 1L3JA 3PMSA 5FY0A 4RA0A 1LECA 1V0AA 1VALA 2WINB 4YVSB 4IEYA 4HSLA 2VJXA 1XNDA 4LKDA 2BUKA 4Y4RA 1DGWA 2C5DA 1BCXA 4YG3A 1OLQA 2GU9A 4HOOA 4LLOA 1Q56A 4EROA 1AX1A 4FP3A 1V9U2 2JENA 2PHDA 3PU3A 5L7OB 2F17A 5EJ3A 1W6MB 2XWBB 3HBZA 1QDCA 5FYVA 5JPNB 1S0EA 2WO2A 4LHSA 1FPN3 1POV3 2RR12 4OZXA 3BU7A 5FXWA 1LGCA 2P3JA 3RFRA 5JLVA 3VBHC 4B4RA 1QJX3 1OOPA 3N9OA 1MS1A 4YVWB 2HWB1 4ZZ5A 1H30A 1Y9GA 5HCBA 5JMCA 1JI6A 4CEYC 5IW0A 3UK9A 4CDWA 3MW2A 4YFZA 3RZJA 1SDDB 2A70A 2ES3A 5DZEA 3MIGA 2WT0A 3CLPA 4F3JA 4FTSA 4QPGA 5JSPA 3S7IA 1O8SA 2D7FA 5JXIA 4OZOA 1BYHA 1CZSA 1FMD2 1RUG3 2PELA 1UOBA 2VUCA 1VMFA 1OUXA 2IC1A 3PHMA 2CGOA 4XQDA 5BNPB 4OI2A 2VMFA 2ZZQA 4Y20B 3MDPA 2SBAA 4H2AA 1JYIA 4NHKA 1MS8A 2GMPA 2DUPA 4MADA 4QT6A 5IVJA 3OGSA 1DZQA 3ILRA 2PAKA 3I3MA 3PMEA 4KU7A 5LBBA 5L9BA 3NMBA 2ZAHA 2Y26A 2C0ZA 4XJ8A 1IGOA 2DCTA 3PIJA 1L7LA 2JIGA 1OVPA 4FPGA 5F6KA 2D6KA 2IXCA 1WW4A 4BM8A 4CCMA 1RINA 5DZGA 1RUC1 4WM8B 4ZS2A 2O8QA 3HVDA 3AKSA 2PXJA 2KD7A 3KZ4C 1H6XA 3ALQA 5C8CA 2W87A 3TWIA 1D0HA 4Z82A 5DXDA 4CDQB 5FZEA 5A32A 2DBIA 3MBWA 2R16A 2WKKA 1A3KA 5DDJ2 1Q3EA 5FZBA 2JG9A 5JXHA 1LOFA 1LHVA 1H9PA 3WQ7A 1UU4A 5HBAA 5IUQA 2RDNA 2VBPA 5CIRA 3NJZA 5H9QA 2VECA 1ZBA2 4D7SA 5FY5A 5BXXA 4AR2A 2ZZJA 3OUHA 2OS2A 4LHLA 2E26A 4Q8LA 4YZ2A 4PI2A 4AI8A 1J3PA 1NX9A 3LOBA 4PIYA 2QCSB 4XUTA 3H1MA 3B69A 3NJYA 4OVEA 5FZMA 1ZZCA 1XNAA 2WYSA 3VKMA 5J09A 4S2HA 3EHKA 2WS93 1PHMA 3PL0A 2EIEA 1H1AA 1PX3A 1W6OA 2A1XA 4LORA 3WINE 1DZTA 2A3XA 2LROA 3EXUA 1AR72 1W6QA 4KI5M 4Q4Y3 1AF9A 3OBAA 3Q8AA 4S2DA 1US3A 2XBO2 1VBA2 2DF7A 2WWSA 3LGRA 4Q0QA 3RVHA 2ET7A 5FQ0A 1PM4A 4M01A 1RL3A 1JZ5A 4W8JA 3U4SA 1CJPA 2PN5A 3N9LA 4JTOA 2MEV1 2ET1A 4G9SB 4CRQA 2JEMA 2XVGA 4NIHA 4P5HA 2XWJB 5A1FA 3OBZA 5GLWA 1CAWA 5JIAA 1O59A 2XPJA 2ORZA 4IV1C 2GNDA 5FPUA 1KITA 1CQ9A 3IPVA 3RGBA 3TN93 1JZ8A 4YYOA 3AMNA 1XSRA 3JBG1 3WV6A 2VZUA 3WY6A 1ULFA 5ACA2 1Y4WA 3ZXFA 2A75A 3AP5A 4OI1A 3G6JB 3MW4A 5GALA 4BE3A 5F8PA 2ZABA 4RSUA 4NWWA 3SNMA 3HPNA 1WW7A 4QHBA 1OFSA 2EIGA 1C8NA 1D4M2 4UW5A 3CO2A 1WA6X 1HW5A 2X29A 4XUPA 3OGRA 1ULGA 4JGYA 5IAVA 3FFZA 2QQVA 2Y6JA 4IE7A 1MEC3 1UYPA 4JDOA 2WT1A 4WZFA 1NY71 5E89A 2A3WA 4YGCA 2WNVC 2BZDA 4AQ2A 2HWD1 3PNAA 2EVXA 2H6CA 5LA9A 3WEZA 4RHV1 1HV1A 2JG8A 2HEWF 4MGZE 4YGEA 3SCGA 3VDDB 1RUF1 3S0MA 4GH4C 4BOWA 3PUHA 3ZPOA 1UMIA 3I7DA 4MXWB 3KV5A 3DYMA 4BWOA 1AR63 1YRZA 1UL9A 2GNBA 4FO9A 4XYXA 1NA1C 1R1A2 4N43C 1MACA 1W8UA 2L9LA 1CJDA 4WVWA 1S55A 3LDBA 3UV9A 2WAAA 2W2IA 3AZVA 5DUWA 1YEWA 4CP9A 3ZN6B 1SLTA 4XXAA 1BQPA 4XUQA 2ARBA 4MZUA 1LU2A 3M7AA 5DN2A 1J58A 2OW4A 5FY7A 1JBCA 2BNMA 1UO9A 1K45A 3H3LA 1O8PA 1CX1A 1FAYA 1WZXA 2IVJA 1FV3A 2WL1A 4CEWA 1FPN2 1JZ2A 3IMMA 2VUDA 2Q1FA 4CXXA 2VVDA 1A8DA 4PDWC 1QJX2 3AMPA 2ZX2A 1COV1 2DTWA 3OPTA 3OG2A 2BFUL 3WDXA 3S6PA 1O4ZA 3DV8A 2FHRA 1GOGA 3J9SA 4Q4W1 2D3RA 3W20A 5FYZA 1SBFA 3RYKA 2PLV3 1QXJA 3MIEA 2VU9A 2A6XA 4GB33 4OYUA 4O65A 1XNBA 2Z2SB 2BEOA
chains in the Genus database with same CATH topology
4BJ0A 5DMYA 4QX1A 1UZ0A 2VQTA 2X09A 4MGQA 2V4VA 2E33A 2YC4A 2C4XA 2BGOA 3HN3A 1XNTA 2QQIA 2W1QA 4PQQA 4JKMA 3WNMA 2VMEA 2OKXA 2VZTA 1JZ3A 1W9TA 1DLCA 3EB7A 4XUNA 1L7RA 3ACFA 4ARXA 1UY1A 3F2ZA 3A23A 2YB7A 1UWWA 3GGLA 3MV01 2W1SA 2J1AA 3DECA 3W5NA 5HPOA 2J1VA 5JXJA 4ARYA 4QAWA 1JYNA 2QQMA 3MUY1 3WQBA 4Z2AA 2CDPA 5C71A 1UYXA 2JKXA 5JMOA 1EUUA 3HEIA 1OF3A 4XVHA 4P5YA 3K4DA 3I2JA 3CMGA 2B4KA 2VZSA 3VD3A 4KMQA 1PMJX 2VMCA 2BERA 3LEIA 1OF4A 1JZ7A 5EJ1B 2WQ8A 2J1UA 2XOMA 3FHAA 4TTGA 3VD9A 3IDAA 4M4PA 2LS6A 4OUEA 1P8JA 2E32A 1K3IA 2WAOA 2VZ3A 4RN5A 3NQHA 2WBKA 4DUXA 1W8NA 2J1RA 3VDBA 4P00B 3A21A 2QQLA 1OH4A 2YC2A 2PQSA 2VZVA 3VD7A 3WF3A 3C7HA 1UXXX 4HG6B 2WO1A 4JX0A 3HNMA 3MUZ1 3WSOA 4XUOA 3MV11 1R64A 3ACGA 3DYOA 3I3EA 3K4ZA 4CVUA 2W1WA 3I2FA 3PUIA 5EIYB 3VD4A 4BXSV 2QBXA 3NJVA 3THDA 2WABA 3OEAA 1JYWA 2V5DA 4QX3A 2W9XA 1LNSA 1UYYA 2LW8A 4TXWA 4MGSA 2W91A 5EJZB 3WF1A 3T0BA 2VZQA 4IUGA 1UXZA 1UY2A 1NUKA 3OGVA 4MO3M 3T0AA 4AAXA 4QPWA 3OB8A 1F4AA 2HLEA 2ZEXA 4QB6A 4JHZA 2C26A 3SEPA 1SG3A 4W4ZA 2Y6KA 3IB3A 2HYXA 2VZRA 2YG0A 2QQJA 1OD3A 4A3ZA 2C9KA 3LEKA 4MOAA 1JZ4A 2CDOA 2QQKA 5IFPA 4DUVA 4GWIA 2J1SA 1DP0A 4ZXEA 1ULPA 4D8MA 4DEVA 4OMDA 3UESA 4JKLA 4OMCA 1OT5A 4QDSA 1PMHX 1CIYA 2VMDA 2VCAA 1SHWB 5HXMA 3C7EA 5J1XA 1JHJA 2ORXA 2XQXA 1WKYA 3SKVA 2EICA 3W5MA 3GM8A 3MO4A 1XC6A 3ACHA 4A44A 3HNYM 1K12A 3UETA 1NKGA 2WUHA 3FHQA 3WNPA 1TG7A 2JD9A 4XZUG 3FN9A 2JE8A 1W9SA 1DYOA 2Y6GA 4D0QA 3ZM8A 4DUWA 3C7GA 3K75B 4XURA 3NJXA 2JDAA 4BDVB 2QQNA 3IAQA 3VD5A 1EUTA 5JR2A 2VM9A 3ETPA 2WN3A 2B9VA 3NRUA 2W95A 4CU6A 1J84A 2VZPA 5G05L 2W5FA 4QX2A 1D7PM 2VC9A 3LPGA 3T09A 3DYPA 3C8XA 2VL4A 3HOBA 5CYYA 2ZEYA 2ZEWA 4PF1A 2E31A 1US2A 3T2QA 3HJRA 3ACIA 5LA2A 5LA0A 2BBAA 1W99A 1PX4A 1W9WA 1TVGA 1GMMA 2WDBA 4UOJA 5IJRA 4GZ9A 2RV9A 4CU7A 2VCCA 2W92A 2VR4A 3I2HA 3T0DA 5IYYA 1GOFA 2Y64A 4ET7A 1CZTA 3HNBM 3K46A 4LQRA 4CUAA 5B4XA 2X05A 1UY3A 2Y6HA 2QQOA 3C7FA 1XPWA 3P1IA 2VJXA 3K4AA 3SEEA 2RJ2A 3WNOA 1W8OA 3VDAA 2ZEZA 3WF0A 1JU3A 4LKSA 4LHSA 2WO2A 1H6YA 1UY4A 2V72A 3GDBA 2VZOA 4QDRA 4ZZ5A 2Y8KA 3CIHA 5C70A 4DXSA 1JI6A 1I5PA 1SDDB 4PT6A 4GWJA 5IHRA 4E8DA 1O8SA 5JXIA 1JYVA 4OZOA 4DXTA 1CZSA 2VMFA 4RYDA 3I2GA 3AC0A 3I2KA 2J22A 3SKJE 4AG4A 4MADA 3OGSA 4BK4A 4UAPA 2ID4A 4FI9A 1JZ6A 3BGAA 1JU4A 3GXUA 4L0PA 5JUVA 2WZEA 5G04L 1CZVA 2VOTA 4DEQA 2YFUA 5B4NA 2XHNA 3LPFA 4QB1A 5C7GA 2EIDA 2J7MA 2KD7A 1KGYA 2VCBA 1H6XA 5LA1A 2DDUA 2W87A 4M4RA 4QX0A 4W50A 3MBWA 4P08A 4QB2A 5JXHA 3LQCA 3WNLA 3I3DA 1J83A 2RVAA 3FL7A 3JXSA 4P02B 3WNNA 1BHGA 1F4HA 4ZZ8A 2E26A 4KWUA 2VZ1A 1NX9A 2BGPA 3ECQA 2YFZA 1NAEA 4XUTA 1W0NA 2W46A 4QDQA 2X10A 2WO3A 2ZXQA 3UNPA 4UI9L 5LCWL 2WYSA 1XNAA 1MPXA 2J1EA 3BN6A 5FUIA 3CZUA 2EIEA 1PX3A 4A42A 3THCA 3IAPA 4A41A 4KI5M 3D3AA 2Z4FA 3I3BA 3OBAA 1US3A 3EYPA 4JKKA 1IQDC 5DQ0A 3T2PA 1JZ5A 3WF2A 4YPJA 4W8JA 1UMHA 4LPLA 2WN2A 1O59A 1GQPA 2ORZA 4A6OA 1UYZA 4E8CA 3T08A 1GOHA 5JXGA 1JZ8A 2EIBA 2VZUA 2XONA 3K77A 4A4AA 1L7QA 1JYXA 5DPNA 3LE0A 1GU3A 1WCQA 2DCJA 3HPNA 3C7OA 2VTFA 3CZJA 5A1AA 3I97A 1YQ2A 3WNKA 4XUPA 3CKHA 2W47A 2W94A 3OGRA 5F7UA 2Y6JA 2VO5A 1ULOA 2BZDA 3WEZA 5IFTA 1T2XA 3J7HA 3NNGA 3P6BA 3PUHA 1HN1A 1UMIA 1UX7A 3U37A 3ABZA 2WZ8A 2R7EB 3DYMA 3LEGA 4BK5A 3CDZB 2J1TA 3IIIA 4DXRA 1KEXA 2L9LA 3A22A 2W3JA 2WAAA 1K42A 5CZKA 3WF4A 5I0DA 4XUQA 5DN2A 2Y6LA 4ZY9A 1K45A 1O8PA 1CX1A 3OEBA 1RYYA 3I2IA 3VDCA 1GUIA 2W1UA 3T2OA 1JZ2A 2DCKA 4CUBA 4CU8A 4A45A 3OG2A 1GOGA 2VQUA 3E1F1 4CUCA 1UY0A 3CQOA 4CU9A 4OYUA 3A7QA 1GNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ0 A;  5DMY A;  4QX1 A;  1UZ0 A;  2VQT A;  2X09 A;  4MGQ A;  2V4V A;  2E33 A;  2YC4 A;  2C4X A;  2BGO A;  3HN3 A;  1XNT A;  2QQI A;  2W1Q A;  4PQQ A;  4JKM A;  3WNM A;  2VME A;  2OKX A;  2VZT A;  1JZ3 A;  1W9T A;  1DLC A;  3EB7 A;  4XUN A;  1L7R A;  3ACF A;  4ARX A;  1UY1 A;  3F2Z A;  3A23 A;  2YB7 A;  1UWW A;  3GGL A;  3MV0 1;  2W1S A;  2J1A A;  3DEC A;  3W5N A;  5HPO A;  2J1V A;  5JXJ A;  4ARY A;  4QAW A;  1JYN A;  2QQM A;  3MUY 1;  3WQB A;  4Z2A A;  2CDP A;  5C71 A;  1UYX A;  2JKX A;  5JMO A;  1EUU A;  3HEI A;  1OF3 A;  4XVH A;  4P5Y A;  3K4D A;  3I2J A;  3CMG A;  2B4K A;  2VZS A;  3VD3 A;  4KMQ A;  1PMJ X;  2VMC A;  2BER A;  3LEI A;  1OF4 A;  1JZ7 A;  5EJ1 B;  2WQ8 A;  2J1U A;  2XOM A;  3FHA A;  4TTG A;  3VD9 A;  3IDA A;  4M4P A;  2LS6 A;  4OUE A;  1P8J A;  2E32 A;  1K3I A;  2WAO A;  2VZ3 A;  4RN5 A;  3NQH A;  2WBK A;  4DUX A;  1W8N A;  2J1R A;  3VDB A;  4P00 B;  3A21 A;  2QQL A;  1OH4 A;  2YC2 A;  2PQS A;  2VZV A;  3VD7 A;  3WF3 A;  3C7H A;  1UXX X;  4HG6 B;  2WO1 A;  4JX0 A;  3HNM A;  3MUZ 1;  3WSO A;  4XUO A;  3MV1 1;  1R64 A;  3ACG A;  3DYO A;  3I3E A;  3K4Z A;  4CVU A;  2W1W A;  3I2F A;  3PUI A;  5EIY B;  3VD4 A;  4BXS V;  2QBX A;  3NJV A;  3THD A;  2WAB A;  3OEA A;  1JYW A;  2V5D A;  4QX3 A;  2W9X A;  1LNS A;  1UYY A;  2LW8 A;  4TXW A;  4MGS A;  2W91 A;  5EJZ B;  3WF1 A;  3T0B A;  2VZQ A;  4IUG A;  1UXZ A;  1UY2 A;  1NUK A;  3OGV A;  4MO3 M;  3T0A A;  4AAX A;  4QPW A;  3OB8 A;  1F4A A;  2HLE A;  2ZEX A;  4QB6 A;  4JHZ A;  2C26 A;  3SEP A;  1SG3 A;  4W4Z A;  2Y6K A;  3IB3 A;  2HYX A;  2VZR A;  2YG0 A;  2QQJ A;  1OD3 A;  4A3Z A;  2C9K A;  3LEK A;  4MOA A;  1JZ4 A;  2CDO A;  2QQK A;  5IFP A;  4DUV A;  4GWI A;  2J1S A;  1DP0 A;  4ZXE A;  1ULP A;  4D8M A;  4DEV A;  4OMD A;  3UES A;  4JKL A;  4OMC A;  1OT5 A;  4QDS A;  1PMH X;  1CIY A;  2VMD A;  2VCA A;  1SHW B;  5HXM A;  3C7E A;  5J1X A;  1JHJ A;  2ORX A;  2XQX A;  1WKY A;  3SKV A;  2EIC A;  3W5M A;  3GM8 A;  3MO4 A;  1XC6 A;  3ACH A;  4A44 A;  3HNY M;  1K12 A;  3UET A;  1NKG A;  2WUH A;  3FHQ A;  3WNP A;  1TG7 A;  2JD9 A;  4XZU G;  3FN9 A;  2JE8 A;  1W9S A;  1DYO A;  2Y6G A;  4D0Q A;  3ZM8 A;  4DUW A;  3C7G A;  3K75 B;  4XUR A;  3NJX A;  2JDA A;  4BDV B;  2QQN A;  3IAQ A;  3VD5 A;  1EUT A;  5JR2 A;  2VM9 A;  3ETP A;  2WN3 A;  2B9V A;  3NRU A;  2W95 A;  4CU6 A;  1J84 A;  2VZP A;  5G05 L;  2W5F A;  4QX2 A;  1D7P M;  2VC9 A;  3LPG A;  3T09 A;  3DYP A;  3C8X A;  2VL4 A;  3HOB A;  5CYY A;  2ZEY A;  2ZEW A;  4PF1 A;  2E31 A;  1US2 A;  3T2Q A;  3HJR A;  3ACI A;  5LA2 A;  5LA0 A;  2BBA A;  1W99 A;  1PX4 A;  1W9W A;  1TVG A;  1GMM A;  2WDB A;  4UOJ A;  5IJR A;  4GZ9 A;  2RV9 A;  4CU7 A;  2VCC A;  2W92 A;  2VR4 A;  3I2H A;  3T0D A;  5IYY A;  1GOF A;  2Y64 A;  4ET7 A;  1CZT A;  3HNB M;  3K46 A;  4LQR A;  4CUA A;  5B4X A;  2X05 A;  1UY3 A;  2Y6H A;  2QQO A;  3C7F A;  1XPW A;  3P1I A;  2VJX A;  3K4A A;  3SEE A;  2RJ2 A;  3WNO A;  1W8O A;  3VDA A;  2ZEZ A;  3WF0 A;  1JU3 A;  4LKS A;  4LHS A;  2WO2 A;  1H6Y A;  1UY4 A;  2V72 A;  3GDB A;  2VZO A;  4QDR A;  4ZZ5 A;  2Y8K A;  3CIH A;  5C70 A;  4DXS A;  1JI6 A;  1I5P A;  1SDD B;  4PT6 A;  4GWJ A;  5IHR A;  4E8D A;  1O8S A;  5JXI A;  1JYV A;  4OZO A;  4DXT A;  1CZS A;  2VMF A;  4RYD A;  3I2G A;  3AC0 A;  3I2K A;  2J22 A;  3SKJ E;  4AG4 A;  4MAD A;  3OGS A;  4BK4 A;  4UAP A;  2ID4 A;  4FI9 A;  1JZ6 A;  3BGA A;  1JU4 A;  3GXU A;  4L0P A;  5JUV A;  2WZE A;  5G04 L;  1CZV A;  2VOT A;  4DEQ A;  2YFU A;  5B4N A;  2XHN A;  3LPF A;  4QB1 A;  5C7G A;  2EID A;  2J7M A;  2KD7 A;  1KGY A;  2VCB A;  1H6X A;  5LA1 A;  2DDU A;  2W87 A;  4M4R A;  4QX0 A;  4W50 A;  3MBW A;  4P08 A;  4QB2 A;  5JXH A;  3LQC A;  3WNL A;  3I3D A;  1J83 A;  2RVA A;  3FL7 A;  3JXS A;  4P02 B;  3WNN A;  1BHG A;  1F4H A;  4ZZ8 A;  2E26 A;  4KWU A;  2VZ1 A;  1NX9 A;  2BGP A;  3ECQ A;  2YFZ A;  1NAE A;  4XUT A;  1W0N A;  2W46 A;  4QDQ A;  2X10 A;  2WO3 A;  2ZXQ A;  3UNP A;  4UI9 L;  5LCW L;  2WYS A;  1XNA A;  1MPX A;  2J1E A;  3BN6 A;  5FUI A;  3CZU A;  2EIE A;  1PX3 A;  4A42 A;  3THC A;  3IAP A;  4A41 A;  4KI5 M;  3D3A A;  2Z4F A;  3I3B A;  3OBA A;  1US3 A;  3EYP A;  4JKK A;  1IQD C;  5DQ0 A;  3T2P A;  1JZ5 A;  3WF2 A;  4YPJ A;  4W8J A;  1UMH A;  4LPL A;  2WN2 A;  1O59 A;  1GQP A;  2ORZ A;  4A6O A;  1UYZ A;  4E8C A;  3T08 A;  1GOH A;  5JXG A;  1JZ8 A;  2EIB A;  2VZU A;  2XON A;  3K77 A;  4A4A A;  1L7Q A;  1JYX A;  5DPN A;  3LE0 A;  1GU3 A;  1WCQ A;  2DCJ A;  3HPN A;  3C7O A;  2VTF A;  3CZJ A;  5A1A A;  3I97 A;  1YQ2 A;  3WNK A;  4XUP A;  3CKH A;  2W47 A;  2W94 A;  3OGR A;  5F7U A;  2Y6J A;  2VO5 A;  1ULO A;  2BZD A;  3WEZ A;  5IFT A;  1T2X A;  3J7H A;  3NNG A;  3P6B A;  3PUH A;  1HN1 A;  1UMI A;  1UX7 A;  3U37 A;  3ABZ A;  2WZ8 A;  2R7E B;  3DYM A;  3LEG A;  4BK5 A;  3CDZ B;  2J1T A;  3III A;  4DXR A;  1KEX A;  2L9L A;  3A22 A;  2W3J A;  2WAA A;  1K42 A;  5CZK A;  3WF4 A;  5I0D A;  4XUQ A;  5DN2 A;  2Y6L A;  4ZY9 A;  1K45 A;  1O8P A;  1CX1 A;  3OEB A;  1RYY A;  3I2I A;  3VDC A;  1GUI A;  2W1U A;  3T2O A;  1JZ2 A;  2DCK A;  4CUB A;  4CU8 A;  4A45 A;  3OG2 A;  1GOG A;  2VQU A;  3E1F 1;  4CUC A;  1UY0 A;  3CQO A;  4CU9 A;  4OYU A;  3A7Q A;  1GNY A; 
#chains in the Genus database with same CATH topology
 3RI8 A;  1RUG 2;  1RUH 3;  3UGG A;  3DPR C;  1W05 A;  3I3Q A;  5FWE A;  1R08 2;  2YC4 A;  3JD7 3;  4WM7 C;  5F39 A;  5ERL A;  3HN3 A;  1XNT A;  3BUC A;  3V65 A;  5FP7 A;  5JOX A;  2ZGL A;  2DCZ A;  2Q8E A;  2BPA 2;  5E8A A;  5F3I A;  4JKM A;  4IE4 A;  3V56 A;  4B4Q A;  2DFB A;  3D82 A;  1OI6 A;  5J48 A;  4URT A;  1JZ3 A;  4XUN A;  2VPV A;  3NV1 A;  4ARX A;  3AK0 A;  2YB7 A;  1UWW A;  1RVF 2;  2AZ5 A;  4HVO A;  2I74 A;  2RMU 1;  4FPC A;  2W1S A;  4YZ3 A;  3B01 A;  2XML A;  4FOW A;  4UWD A;  4COY A;  3DEC A;  5HPO A;  2RS3 1;  1SBD A;  2XGX A;  5A1L A;  1GNZ A;  4X8P A;  4NAM A;  4XW3 A;  3E5X A;  3KSC A;  2LAL A;  5BNO B;  5JZG C;  2YZ4 A;  1W9F A;  1UIJ A;  1YHF A;  3OYW B;  3WR0 A;  5C71 A;  4IV3 B;  2JKX A;  4M0H A;  2W08 A;  3HEI A;  1AYN 1;  2E9Q A;  1ZRI A;  3FHI B;  5JPM B;  1ZRC A;  2ZHM A;  1OFN A;  3VL8 A;  1HJF A;  2B45 X;  3H50 A;  2B4K A;  3ZLI A;  5FZO B;  1RIR A;  5GZG A;  2VZS A;  3VD3 A;  2G19 A;  2CTV A;  3MPP G;  4KMQ A;  3VBH B;  1PO1 1;  4AGR A;  5ABJ C;  4XF4 A;  1UN1 A;  5EJ1 B;  5T3N A;  3POJ A;  4FBF A;  2WS9 2;  3AZY A;  3WLU A;  2WII B;  1VRH 1;  5IVB A;  1IKQ A;  1WME A;  5JSO A;  1YLL A;  1OC1 A;  2VBB A;  5KHH A;  4Q4Y 2;  1EAH 1;  2J1U A;  1JN2 P;  3LA2 A;  5D8A C;  3VD9 A;  4N9H A;  4M4P A;  5C9A A;  5FDB A;  2LS6 A;  2ZHN A;  2E32 A;  1W6P A;  2VZ3 A;  1S0I A;  5C4W A;  3SC7 X;  1OXC A;  2WNU C;  1YCI A;  1S2K A;  3BCW A;  2R0H A;  5A6Y A;  2BYV E;  2WZR 3;  2YC2 A;  2PQS A;  2VZV A;  4Y5S A;  3WX5 A;  4Y1Z A;  3ZPY A;  1W6N A;  4RR3 A;  3C7H A;  5FUN A;  3WF3 A;  2E51 A;  3AZZ A;  3TYJ A;  3ZYI B;  5FFO C;  4S2G A;  3VBO C;  4D6S A;  5E1R A;  3MUZ 1;  3TN9 2;  5F5I A;  1ZZ8 A;  4YNI A;  4XUO A;  3MV1 1;  5JR7 B;  5CBL A;  1UNB A;  2B8M A;  4OUS A;  3I4I A;  2ZJC A;  3I3E A;  1B35 C;  4YLZ A;  5FKB A;  1RJ8 A;  3QBQ A;  4CDU C;  1C1L A;  1RJ7 A;  3EJK A;  4FPY A;  1N3O A;  2W52 A;  4ZU5 A;  1C1F A;  5H9P A;  3BVC A;  1HXS 1;  4LBQ B;  5D1I A;  5EIY B;  5L7O A;  3M70 A;  3NJV A;  5AVA A;  4R9D A;  3OEA A;  4TLF A;  1KDK A;  1MQT A;  1W3X A;  3BTZ A;  1QHD A;  3MYX A;  1GQH A;  1MEC 2;  5KC5 A;  2CAU A;  1JOD A;  1N3P A;  4PBP A;  5EJZ B;  2VUJ A;  4Z8B A;  5KR7 A;  3JB4 C;  5KHK A;  5EFU A;  2I2S A;  1UY2 A;  3J4U H;  4IE5 A;  3T1L A;  2ZHK A;  4QM9 A;  4K8R B;  3T0A A;  1WCS A;  2OA2 A;  4AAX A;  3OD4 A;  1N47 A;  4QPW A;  4RGG A;  1F4A A;  3IIA A;  2HLE A;  3AB0 A;  1ND2 B;  3TNP B;  1DZR A;  2IXK A;  1PO2 1;  2QUO A;  1C8M 1;  2C26 A;  5F2S A;  2OT7 A;  1QXR A;  4BIS A;  2WYF A;  1OLM E;  2R0F A;  5F9T A;  4YW6 A;  1W8T A;  1SG3 A;  4AI0 A;  3V0B B;  5JDB A;  4Y20 A;  5I0T A;  2HWF 3;  5FBZ A;  5A3W A;  2Y6K A;  2HYX A;  2YG0 A;  3AP7 A;  3LZZ A;  5K0U C;  4LOS A;  1UOJ A;  2VOW A;  2NYY A;  1SBE A;  4O9E A;  4I02 A;  3ZFG C;  1PVX A;  1XYN A;  2D44 A;  4NID A;  4MOA A;  4Y33 A;  1JZ4 A;  3POS A;  4PIZ A;  2JXA A;  5FPV A;  1BEV 3;  2WRA A;  2YBS A;  4QWN A;  1YQ8 A;  2J1S A;  3T3Y A;  3MIC A;  4ZXE A;  2GC3 A;  3WQ1 A;  4YM3 A;  3MZH A;  1I5Z A;  4FFF A;  4M3C F;  5CVR A;  2ATF A;  3UES A;  3ZXK A;  4HKW A;  4CDQ A;  1HQN A;  3FLT A;  5CAD A;  4YVS C;  1RUJ 3;  1Z7S 3;  1ZRR A;  4E9K A;  1U12 A;  2VMD A;  1QQP 3;  3WW3 A;  3ZSK A;  5HXM A;  2PLV 2;  4XHX A;  2JIJ A;  4LA2 A;  3WD5 A;  2DV9 A;  1DGW X;  4GB3 2;  3BKZ A;  5AC9 3;  2QKD A;  1SLL A;  4AVC A;  1TME 1;  1YFU A;  3MO4 A;  3RWK X;  2IXJ A;  5DDJ 1;  3ST7 A;  4CCL A;  1RUE 3;  3RZG A;  3JD7 2;  1DF0 A;  1VBE 1;  5C5T A;  4A44 A;  2ZHL A;  3OJB A;  2E63 A;  4DOU A;  3UET A;  1UKR A;  5CU1 A;  1Q8Q A;  2Z5W A;  4CDX C;  2WUH A;  3FHQ A;  2VQ0 A;  4Y1U A;  4AQ6 A;  1ND3 A;  4GH4 B;  1W9S A;  3TEX A;  2I07 B;  1DYO A;  1JOB A;  3C7G A;  4XUR A;  1Z0H A;  3HAG A;  3VL9 A;  4IEO A;  1LKN A;  1KXG A;  1UU6 A;  1NA1 B;  3LA7 A;  5LK5 A;  2VM9 A;  3THT A;  2DVA A;  5BPX A;  2JDH A;  3GBG A;  3ATG A;  4FXG B;  2Y34 A;  4NUB A;  5EXO A;  4QMA A;  3H8R A;  5BNP C;  4PIX A;  2Z79 A;  2G9G A;  3ZSL A;  4IEP A;  2GME A;  1MZ5 A;  3FLP A;  4AI2 A;  2XBO 1;  1VBA 1;  1UQX A;  5FP4 A;  2IUW A;  4CU6 A;  1ZBE 3;  1O3T A;  5L36 A;  2ILM A;  2A6V A;  2GDF A;  4RFR B;  5T5O A;  2GNT A;  2WQZ C;  3AKQ A;  5FZ0 A;  3LPG A;  3DYP A;  4QPI B;  1LEM A;  3C8X A;  4J6G A;  4I2O A;  2HWE 3;  3SH5 A;  1QF3 A;  4L92 A;  3WCR A;  1ULC A;  2OQ7 A;  5J7M A;  3RZK A;  1DGR A;  4WM8 C;  4PDW B;  3RZL A;  1US2 A;  4XHB A;  1DGR N;  4Y1Y A;  5LY2 A;  2A73 B;  3RS6 A;  3GBF A;  3ZYR A;  3AFG A;  3RSJ A;  2O1Q A;  3TB0 A;  2ZTN A;  1GMM A;  5IJR A;  2RV9 A;  2H0B A;  3IMN A;  5K7P A;  2VR4 A;  1RC6 A;  1SQ4 A;  4XAE A;  4MHR A;  2CAV A;  1NCQ B;  1VMJ A;  1ENQ A;  4AHW A;  2E7A A;  4WM7 B;  1GOF A;  4EN0 A;  1BMV 1;  4I30 A;  3ZYB A;  2WZR 2;  4K40 A;  1EPZ A;  4LQR A;  4E4Z A;  3OY8 A;  4KBB A;  4EE2 A;  4Z1V A;  2TEP A;  4QU1 A;  1D4M 1;  1LGN A;  2OPW A;  1TQ5 A;  1IG0 A;  1N1Y A;  3ZOI A;  5FMD A;  4AED B;  3P1I A;  4MXW A;  2GNM A;  4FVV A;  5D21 A;  3VBF A;  4WVM B;  2YU1 A;  1RUD 3;  1SZB A;  1DIW A;  2CWM A;  2P37 A;  3MW3 A;  2ARC A;  3AM2 A;  1FT9 A;  5A3O A;  5BY5 A;  2R1D A;  5IWF A;  4HMZ A;  3ZO0 B;  1W8O A;  1H8V A;  1XBF A;  3OGG A;  1FMD 3;  2ZGQ A;  1JU3 A;  3BOD A;  1AX0 A;  1U5I A;  4LKS A;  3VDA A;  1OQ1 A;  1YNA A;  2BOJ A;  3LDK A;  3Q8F A;  1W8W A;  2NQY A;  1F5F A;  3QLQ A;  3ON7 A;  1DQ6 A;  2CNA A;  2OVU A;  1BLZ A;  1V6N A;  2TNF A;  2O0O A;  3CIH A;  4JVA A;  3O14 A;  1UD1 A;  3ZFF C;  4E27 A;  4CCO A;  4IXL A;  4CPB D;  1LOG A;  3CEW A;  1CWP A;  3H3Z A;  3WP3 A;  2WSV A;  4H7L A;  1JUH A;  4Z07 A;  4E8D A;  2HH9 A;  5IVC A;  1JYV A;  4CUG A;  4DXT A;  3H8X A;  2YGL A;  2VQA A;  1V6J A;  5CFD A;  4LBK A;  3I2O A;  1POV 1;  3D0S A;  4QHO A;  2PA7 A;  2BWA A;  4XMA A;  2YHJ A;  3I2K A;  1BZW A;  1VJ2 A;  4MUV A;  3U4X A;  4AG4 A;  1QJX 1;  2JDN A;  3NWK A;  3U10 A;  1QJF A;  3KB5 A;  4CE8 A;  2ZCW A;  3K48 A;  2D43 A;  2CHH A;  3GZA A;  4A7K A;  1H4H A;  4OI4 A;  2HWF 2;  4XFB A;  4XZP A;  3AKT A;  2WFF 3;  4GWN A;  2BV4 A;  2WNU B;  3U75 A;  5KHI A;  5LZ6 A;  4XJU A;  1S2E A;  3VBU B;  4K1Z A;  5B4N A;  5FYS A;  3BIE A;  3LPF A;  1RUG 1;  2ZX1 A;  1LHU A;  3LDR A;  3LSD A;  3VDD C;  1BEV 2;  3VB9 A;  1OPM A;  3UGH A;  4C0H A;  4QB2 A;  1S1A A;  3ZSE A;  3WNL A;  2BGC A;  1OQE A;  3VBO B;  3ZN5 A;  4KWL A;  1FOD 2;  1UKG A;  3JXS A;  4P02 B;  1HRI 2;  4AWD A;  1AR7 3;  3O1S A;  2XJP A;  3WNN A;  1BHG A;  1SLA A;  1F4H A;  1CAX A;  1RUJ 2;  1Z7S 2;  1WW5 A;  1QQP 2;  1V6L A;  2RS5 1;  4JHT A;  1IS3 A;  4CPB A;  4IE6 A;  4ZPI A;  5DAX A;  2BJS A;  3M3E A;  5J96 B;  5AC9 2;  2PYT A;  4HKO A;  3NO8 A;  1IG3 A;  5EWS A;  2ARE A;  2X10 A;  4A7Z A;  3Q8B A;  2XDV A;  3GZT B;  4MSV A;  1VE0 A;  5LB6 A;  3M3Q A;  3UNP A;  1FI2 A;  1RUE 2;  2P5B A;  4BQY A;  1AVB A;  3CJI C;  1NE6 A;  2VW0 A;  5FZO A;  5ISL A;  2Y6F A;  2XH6 A;  3THC A;  4JRL A;  4A41 A;  3LAG A;  4B8E A;  4NMI A;  3VBH A;  2Z4F A;  1NT0 A;  1JOP A;  3T1M A;  3VZJ A;  4R4X A;  4XBQ A;  4CEY A;  3EYP A;  4GAZ A;  3VZN A;  4GKY A;  4GUL A;  4PHZ A;  3DEM A;  4Y24 A;  1O4T A;  4HVR A;  1IS4 A;  5FZF A;  4YPJ A;  3ZYF A;  5FK7 A;  2RM2 1;  1Q8S A;  5A6Z A;  1QNW A;  2Y0O A;  4LPL A;  4DO0 A;  2FMD A;  3CF6 E;  4AOC A;  2UYA A;  2HYK A;  2VCM A;  5FZI A;  5FZ3 A;  1CAV A;  5IVF A;  1RB8 G;  1H8T B;  4LXL A;  1RXG A;  5JAX A;  4A6O A;  2EF6 A;  4PLM A;  1YFW A;  3CL1 A;  4Q4Y 1;  4Q4V 3;  4QPY A;  2GN3 A;  1RHI 1;  2ZGO A;  3K2O A;  4XIO A;  4CCN A;  1AYM 3;  5K0U B;  5JXG A;  5A3L A;  1ZA7 A;  3DKW A;  1GP6 A;  3SH4 A;  1VBD 3;  3X29 B;  3ILF A;  5JOZ A;  3WP6 A;  2XON A;  3K77 A;  4XF9 A;  5A80 A;  3FX3 A;  4UF0 B;  2ADD A;  1L7Q A;  2XJS A;  2GC1 A;  2HWE 2;  3LE0 A;  1GWL A;  5FZD A;  2UWA A;  3ES4 A;  2RG4 A;  3OF1 A;  3C7O A;  2PHU A;  1O5L A;  3CJX A;  1R1A 3;  3N9M A;  3ZFE C;  3I97 A;  1YQ2 A;  2JDM A;  2XG3 A;  2BVV A;  4K8F A;  1ASJ 1;  1DQ2 A;  3CKH A;  4LO6 B;  2W94 A;  3O1O A;  2QQP A;  4LIV A;  4M3C E;  1YIP A;  2OII A;  2WA4 A;  5BNO C;  2XHK A;  4L2N A;  1T2X A;  3J7L A;  3V0A A;  2R07 3;  3P6B A;  4IV3 C;  2PMW B;  1A6C A;  4XIK A;  4BQ1 A;  2GSY A;  3U37 A;  3ABZ A;  2WZ8 A;  1UX6 A;  4ES8 A;  4MV2 A;  3OUI A;  1BKZ A;  4S2F A;  2J1T A;  1VP6 A;  3III A;  4N7U A;  4YW4 A;  5FYC A;  4CDX B;  2AEN A;  4HN1 A;  4XE9 A;  4XJW A;  1PVC 3;  1KEX A;  4OUL A;  1NZC A;  4XFI A;  3BTY A;  2W3J A;  4DXZ A;  1XB9 A;  4UFI A;  5CKQ A;  4HPK A;  5A3T A;  1RUD 2;  1S0F A;  2AC1 A;  4M00 A;  2Y60 A;  3WF4 A;  4DRV A;  5I0D A;  1GZ9 A;  4ONU A;  4HZF A;  4Y26 A;  4YZ5 A;  3GZE A;  4UBH A;  4ZY9 A;  1RMU 1;  3KD4 A;  3V0B A;  4Q4X 1;  1JH5 A;  3I2I A;  1AR6 1;  2W1U A;  1R08 3;  1UAI A;  4D94 A;  2DCK A;  1LU1 A;  4FPJ A;  4LBM A;  4N7I A;  2ZBJ A;  1EV1 3;  1DCS A;  4AE2 A;  4CUB A;  1BK0 A;  5IK4 A;  3SMH A;  2BFU S;  1HV0 A;  3L2Y A;  4CCD A;  2DBN A;  3AJZ A;  3WDV A;  3N9P A;  1SCS A;  1LOA A;  5CIS A;  4FFH A;  1G9F A;  1TMF 2;  4IV1 A;  4XJ9 A;  2PHF A;  3LB9 A;  1Z78 A;  4CUC A;  2CWS A;  4CU9 A;  1XNC A;  3A7Q A;  3FE5 A;  3ZYJ B;  3KVB A;  3WW4 A;  3WCS A;  5LBC A;  4QX1 A;  4FXK B;  5DMY A;  4MGQ A;  5GLZ A;  5A7P A;  2V4V A;  4QQL A;  1ZZB A;  1RVF 3;  3RJ2 X;  3OBT A;  1OSG A;  4AFD A;  3AKP A;  1BBT 2;  1GZT A;  1VBB 3;  2ERF A;  3KM5 A;  4LUK A;  2C4X A;  1OLR A;  5EQU A;  3RZH A;  2Y38 A;  5FWJ A;  4C0B A;  1QMJ A;  4GD4 A;  4NO4 A;  2P17 A;  3D4K A;  2Q1M A;  2PHR A;  1KFX L;  1DBN A;  1QJU 1;  2GAU A;  3MI8 A;  4R52 A;  2WFF 2;  1PZ8 A;  4XFH A;  3FMG A;  3U14 A;  4B1M A;  3H7Y A;  2J42 A;  2OKX A;  2OYZ A;  2VZT A;  1O7F A;  2EA7 A;  3KT4 A;  2D3P A;  1W9T A;  1R09 1;  4NRP A;  1LRH A;  1L7R A;  2WNV A;  4NHX A;  1RUH 1;  3ACF A;  5IVY A;  4KQ7 A;  3F2Z A;  1W28 A;  2HWC 1;  2JEC A;  3GGL A;  2X53 S;  2XJQ A;  4GH4 A;  1E5R A;  2ZAC A;  4J1W A;  4EWA A;  1YXW A;  1LCL A;  1YYN A;  3E6B A;  2X5I C;  2HKX A;  4NPM A;  1ND2 C;  3TAY A;  4YGD A;  5EHD A;  4FQ4 A;  4HET A;  1K5M B;  1RED A;  5JXJ A;  1PGL 2;  4ARY A;  4AVS A;  1DQ5 A;  2GP5 A;  4COV A;  3MUY 1;  4N43 A;  3WQB A;  1LEN A;  3B7M A;  5H9S A;  5KXE A;  4IEZ A;  1W8H A;  1GYK A;  3DF0 A;  4Y1X A;  1EUU A;  2RE9 A;  2EAK A;  1YC6 1;  1V00 A;  3KWV A;  4KGQ A;  4Y3O A;  3SIS A;  2HEY F;  3ENR A;  3J8F 1;  1AR9 1;  4LBL A;  3E5U A;  4E2G A;  1QIQ A;  4BQW A;  2BER A;  4M3C A;  1JW6 A;  4LHK A;  4RS5 C;  4LT5 A;  2ARX A;  1JZ7 A;  4AL9 A;  3NV2 A;  1HRV 1;  3MIF A;  3ZFF B;  5FLJ A;  4XDP A;  5BV6 A;  2ZGN A;  1PGW 1;  1S4C A;  2XOM A;  5BNN B;  4PDW A;  3O1V A;  5FO7 B;  1P8J A;  3NNM A;  1K3I A;  1DQ4 A;  5CG9 A;  2D6P A;  1MZ6 A;  4GMP 1;  3AZX A;  3NQH A;  3OD0 A;  1W8N A;  2JDP A;  4RN5 A;  4EN8 B;  2D98 A;  5APA A;  5A6Q A;  1VAV A;  2MPF A;  2K2S A;  5FP3 A;  4K9S A;  2FD8 A;  1JUI A;  4RQP A;  2QQL A;  4UFJ A;  3FBY A;  3R6S A;  5A33 A;  4AFB A;  3DPR A;  2XUE A;  1OH3 A;  1LTE A;  2VNG A;  1QOS A;  4JX0 A;  3KGZ A;  1KD7 A;  4WM7 A;  3Q9O A;  4Q4V 2;  1AYM 2;  3U11 A;  3HD8 B;  1VBD 2;  2BW8 A;  3VKL A;  3H1W A;  4BU2 A;  1UCX A;  4WZC A;  5FRE A;  1VRB A;  5F2W A;  1CVN A;  2HEV F;  2VW2 A;  3M4F A;  1T6G C;  2QDR A;  5FZ9 A;  3WDY A;  3KQ4 B;  2JG9 C;  2QQW A;  3IDC B;  4WVM A;  4XAA A;  5DG2 A;  3PUI A;  2EXJ A;  4FAH A;  2YYO A;  5BUV A;  3VKO A;  4MG2 A;  4EV0 A;  2YDE A;  2F6B A;  3FLR A;  3N9N A;  3ZR5 A;  4BXS V;  4OHZ A;  5IT6 A;  2WSU A;  4D7T A;  2JJ6 A;  1AL2 1;  3JB8 A;  2HWB 3;  4NHM A;  3MEP A;  1D2Q A;  1W39 A;  2DUQ A;  2IVI B;  2DFC A;  3EMR A;  3H8U A;  4MGS A;  4TXW A;  1XXN A;  5FYB A;  2JD4 A;  4O61 A;  2KXL A;  1MR5 A;  2OQ6 A;  2FZ2 A;  2VZQ A;  1N1T A;  5JZG A;  2Z69 A;  4SBV A;  3OGV A;  4PF5 A;  2Q8D A;  2R07 2;  3CJI B;  2EAL A;  4LBO A;  4LIT A;  4EQV A;  4L99 A;  5FZ4 A;  1UW8 A;  3JQW A;  1WMF A;  4QPI C;  2NM1 A;  3I8T A;  3VLB B;  2R06 1;  1RUI 2;  5A70 A;  3EO6 A;  1PVC 2;  4FPE A;  2AEY A;  1W3V A;  5ABJ A;  5F5Q A;  3SEP A;  1YIF A;  1OA3 A;  1OA2 A;  1U5Z A;  4QX5 A;  1BVP 1;  1LAJ A;  2BP6 A;  3PUA A;  1MS3 A;  4EZH A;  5B2G B;  3OBR A;  4NHL A;  3MF6 A;  1B09 A;  4LBN A;  3KF5 A;  4YZ4 A;  4QX7 A;  5D8A A;  5DAW A;  3S5Q A;  1Y7B A;  4XJZ A;  3WT3 A;  2ZGK A;  3IT8 A;  2CGP A;  3L9J T;  3I59 B;  4ITC A;  1RUC 3;  4OQ9 A;  2R1B A;  5C5U A;  5JOW A;  2ENR A;  3DKQ A;  4QXH A;  2P34 A;  4MGI E;  4YG6 A;  1IPS A;  2QQK A;  4YW7 A;  2WNU A;  1NCQ C;  2RDS A;  3V64 A;  4GWI A;  4RL7 A;  1S0J A;  1EV1 2;  1DP0 A;  1E5S A;  3R4D B;  3W21 A;  3KLS A;  1JXN A;  1PGS A;  5FMO S;  4W6Y A;  3AP4 A;  5I0U A;  5TSW A;  4OMD A;  3AYA A;  3TOJ A;  4JKL A;  2RJK A;  5JI9 A;  1NCR A;  4OMC A;  4QDS A;  2PAE A;  1KJR A;  1POV 0;  2UY9 A;  4KGG A;  4MVT A;  4Q0U A;  3LIH A;  2VCA A;  4AED C;  1D0G A;  4GQ7 A;  3VBO A;  1SHW B;  3C7E A;  4BQX A;  1VR3 A;  1DYP A;  5KXC A;  3SKV A;  1EP0 A;  2EIC A;  4CA9 A;  3NNJ A;  5J98 B;  1LOD A;  3BAL A;  1BEV 1;  1B35 A;  2A5Z A;  5FPL A;  3ZFE B;  4CDU A;  4A2U A;  3B00 A;  5T5L A;  1LUL A;  1LOB A;  1VBB 2;  1PM7 A;  1XC6 A;  2XVL A;  3H3U A;  4IGP A;  1HB1 A;  4JGY C;  3HNY M;  4W6X A;  4PJY A;  3WG2 A;  5FBJ A;  5K4L A;  1GNH A;  1LHW A;  3WG1 A;  1ZRD A;  3ILN A;  1NKG A;  5EP9 A;  3KHC A;  1V6I A;  3WNP A;  1VB4 A;  1TG7 A;  2MHF A;  1CR7 A;  4QKN A;  4UXA A;  4XZU G;  1HLC A;  4PLO A;  2R30 A;  4COW A;  2EXH A;  1JYC A;  2C24 A;  4BQ4 A;  5LY1 A;  4YFW A;  1DLL A;  4MH0 E;  3IBM A;  5AC9 1;  2Y6G A;  3USU A;  3W58 A;  3PVB B;  5IK7 A;  2JDA A;  2AR6 A;  1QJY 2;  3FWE A;  3VD5 A;  4YSF A;  5IAT A;  1EUT A;  2C6S A;  4HK8 A;  5FP9 A;  2MEV 3;  1AX2 A;  4LO5 B;  3LIG A;  2WN3 A;  3K51 A;  4LOT A;  2B9V A;  5FZC A;  3NRU A;  4AFC A;  2PTM A;  2ZGS A;  2XLF A;  4HKL A;  2YV8 A;  2IXI A;  3ZXL A;  5J3U A;  2OXB A;  4XFF A;  3CHX A;  3O0X A;  2WQ4 A;  3N7M A;  2IXH A;  1PK6 B;  1UOG A;  1UZZ A;  1NXM A;  1A78 A;  4FOV A;  3OCP A;  3DUI A;  1D2S A;  4J25 A;  5EYY A;  1PIV 1;  5FK8 A;  3ZYP A;  1AR8 3;  2VE1 A;  4QKB A;  2ZML A;  3BTA A;  1D4V B;  4OHY A;  1D7P M;  4ZXK A;  4FOQ A;  4CEW C;  1O3S A;  4V2W A;  3AP9 A;  5K0U A;  3VBU C;  2JKB A;  1QY4 A;  3ZFG A;  2VMG A;  5LAT A;  4BIF A;  2ZEW A;  1REE A;  4PF1 A;  4YW1 A;  1QJZ A;  2NPI A;  5ANQ A;  5A3M A;  3T2Q A;  3WP4 A;  3APB A;  3ACI A;  4CSW A;  3FUQ A;  5LA2 A;  1CAU A;  4X6R B;  2B7Y A;  1X36 A;  2EXI A;  1OD5 A;  4LBJ A;  3HT1 A;  5FO9 B;  4LMF A;  3GCW A;  4AHY A;  4DIN B;  1ZBE 1;  4KG8 A;  1KRI A;  2AYH A;  4YM1 A;  3ES1 A;  3OPZ A;  2VCC A;  4GJY A;  4AI9 A;  4YVS A;  4RHV 3;  1C28 A;  2VVE A;  1RUF 3;  4Q2F A;  3ZX7 A;  4JRA A;  3MFA A;  5C3S A;  1VBC 1;  4B7K A;  1LES A;  3RZM A;  3PUQ A;  4ET7 A;  2Y64 A;  1CZT A;  4K3U A;  4E4H A;  2R04 1;  4H3W A;  4UFL A;  2BBV A;  4Y5Z 0;  3VHP A;  3I49 A;  1GWM A;  5B4X A;  2X05 A;  3PDQ A;  2WZP P;  1WUV A;  4QXB A;  1W6M A;  3RNS A;  2X8K A;  4F8A A;  1XPW A;  4X6Q B;  4P9G A;  2K9Z A;  4E4S A;  3MPB A;  3LCP A;  3LD8 A;  5GZF A;  3FBM A;  3S30 A;  1GZW B;  4JDM A;  4FPO B;  3K4A A;  4CDX A;  4DZG A;  2LTN A;  3SEE A;  2Y33 A;  1V9U 1;  4YVW A;  2XB6 C;  1DYK A;  1MS0 A;  2FZ1 A;  2VMI A;  4OHX A;  4FTB A;  4BCU A;  2ZEZ A;  1OPO A;  4XBN A;  1F35 A;  2X5I B;  2FQP A;  5I8T A;  1H6Y A;  2RR1 1;  5DAV A;  5CAZ A;  3K3N A;  1LR5 A;  1NQJ A;  5GZC A;  4JC1 A;  2P2K A;  3ITQ A;  4DY5 A;  1FNY A;  2Y8K A;  2E6V A;  5C70 A;  1COV 3;  2HWB 2;  1I5P A;  4I0W B;  1H8T C;  4PI0 A;  5BNP A;  4G3Y C;  4XEZ A;  1HKD A;  3THP A;  4PT6 A;  2EAA A;  4Q4W 3;  5E88 A;  3WVJ A;  4P9I A;  1YJK A;  2ZGT A;  5IHR A;  2FBE A;  5JVV A;  4KU8 A;  1FMD 1;  4RS5 B;  2LM3 A;  2Z42 A;  4YAR A;  1IS6 A;  3BPS A;  3KS7 A;  4CDW B;  4RYD A;  4A3X A;  4ASM B;  3GZU C;  3AC0 A;  3I2G A;  3NVC A;  3O0W A;  4WM8 A;  4QPG B;  4DNY A;  1FOD 3;  1YQ6 A;  4QD2 A;  5A7S A;  4AVA A;  4BQ3 A;  5C9A C;  1HRI 3;  3O1M A;  4FI9 A;  1O6U A;  2D6N A;  4DFS A;  5FZ7 A;  1JU4 A;  1JZ6 A;  4L0P A;  5JUV A;  5SV8 A;  4X8N A;  5AFE A;  5G04 L;  5FY4 A;  3WNX A;  1CZV A;  3GJB A;  5FJK A;  2YFU A;  4DEQ A;  3ZIW A;  2JDZ A;  2XHN A;  4QB1 A;  3VZK A;  3WW1 A;  1RUC 2;  2EID A;  1KGY A;  4UBG A;  4PBO A;  2WWJ A;  4BYY A;  2V73 A;  4LO7 A;  3HIF A;  1RUO A;  4AHX A;  3TBD A;  4K7J A;  3FL7 A;  4R9A A;  3VKN A;  2BDR A;  2P3K A;  2RS3 3;  4MXV A;  4AQT A;  4NAO A;  1J1T A;  1ZBA 1;  2G1M A;  1YWK A;  4P14 A;  2BU9 A;  5C8C B;  4IER A;  4QXC A;  3AZW A;  2HBU A;  1XU1 A;  2QDN A;  5T55 A;  3ZKY A;  3A0K A;  3JZV A;  1FXZ A;  2VZ1 A;  4KWU A;  2JG9 B;  1AYN 3;  2BGP A;  2B46 X;  2SLI A;  2VOX A;  3OTF A;  1WLD A;  1WCK A;  3B5L B;  4HSJ A;  3UKT A;  2VY0 A;  3ZMO A;  3NAP C;  2W46 A;  2WO3 A;  1XSQ A;  2FDJ A;  5FUP A;  5BNQ A;  2XKP A;  2P4E A;  3ZXG A;  1H2K A;  1J59 A;  1MPX A;  2J1E A;  4P9X A;  3TEZ A;  1GLH A;  5FUI A;  4K21 A;  1VRH 3;  3HMY A;  3DXT A;  5JOY A;  1AR7 1;  3O12 A;  3D3A A;  2YRO A;  2P6C A;  3I3B A;  3UKN A;  4BME A;  4DMI A;  1U5Y A;  1W2A X;  1WWY A;  3O1U A;  4YW3 A;  5DUV A;  4JKK A;  4LLF A;  4COU A;  4GXL A;  3ZFF A;  1OUR A;  2FMY A;  2CSG A;  3H42 B;  2E7Q A;  3M1H A;  2W0X A;  3WF2 A;  2QZ3 A;  3MLJ A;  5DZF A;  4QKF A;  3O5S A;  1W6Q B;  2D6O X;  2WJS A;  2MEV 2;  5JWP A;  4MHU A;  4RGA A;  3HQR A;  3J26 N;  3N9Q A;  1W04 A;  2O14 A;  1C57 A;  1OMI A;  4IEV A;  3U1X A;  2XJR A;  3WDU A;  1G9B A;  1AJO A;  5A3P A;  5DAB A;  4E8C A;  4Q5O A;  4CP1 A;  1GOH A;  1XNK A;  4LJH A;  4NVP A;  4E2Q A;  3PJQ A;  2I45 A;  1MS5 A;  3JBG 2;  1AR8 2;  4NPL A;  5T50 A;  5ACA 1;  2O8O A;  2OZJ A;  3B94 A;  1CAW B;  1YI9 A;  3MHZ A;  1OLM A;  3G7D A;  1E57 A;  2QE3 A;  4YW5 A;  4TYS A;  5DPN A;  4QU2 A;  3URF A;  3PTR B;  1UZY A;  1WCQ A;  1AXY A;  2DCJ A;  2YC0 A;  3IPV B;  3ZSM A;  5HV0 A;  1SLB A;  1R1Z A;  2VTF A;  4GMP 0;  3ORJ A;  2W68 A;  4N90 A;  3VDD A;  3ZYH A;  4Q4V 1;  3RJR A;  2W47 A;  5F7U A;  5IVE A;  1AJK A;  1G86 A;  1AHS A;  3DN7 A;  4UW6 A;  4K1Y A;  4V1P A;  4XPV A;  5EPA A;  1K5M C;  5FPA A;  3ZKU A;  4DB5 A;  4IES A;  1QH6 A;  4CCE A;  4L8Q A;  4AVB A;  1NXD 1;  3J7H A;  2FDF A;  4RHV 2;  1J3R A;  2D5H A;  5F3C A;  1RUF 2;  5FMC A;  1HN1 A;  3POF A;  1UX7 A;  3OOX A;  1NE4 A;  4JGY B;  2R7E B;  5IK8 A;  4F7Z A;  4BK5 A;  2P1B A;  1J3Q A;  3CDZ B;  3UT0 A;  3P3N A;  2JDU A;  2JDY A;  2ZX3 A;  3ZN6 A;  5FZH A;  3AVR A;  4QQP A;  1C8M 3;  1AXK A;  1R1A 1;  3POW A;  3ZIX A;  1IPK A;  4DXR A;  2JG8 B;  4JZR A;  1H2N A;  3GHM A;  3P5B A;  3A22 A;  2XL7 A;  3GNE A;  4N53 C;  4RGK A;  1TMF 3;  4ORF A;  3A4U A;  4B29 A;  3N7J A;  4K6B A;  5LBF A;  4E2S A;  3OGJ A;  4XCB A;  3OPW A;  2YGM A;  1W2N A;  1X82 A;  1SDW A;  5BNN C;  2Y6L A;  4FPH A;  3WZ1 A;  1AZD A;  2UWB A;  1MZF A;  4IQP A;  1ZVF A;  3OEB A;  1RYY A;  5FY8 A;  1FPN 1;  1SLC A;  3OUJ A;  5FPB A;  1MVQ A;  3KV6 A;  1BBT 3;  2ZKN A;  4BMB A;  4CU8 A;  1PVC 1;  4AVT A;  1DFQ A;  3I59 A;  3N7L A;  3UGF A;  1ODN A;  2HJI A;  1COV 2;  1Q8O A;  4R4Z A;  1SFY A;  1NLR A;  3PTY A;  2NMN A;  4QGN A;  2XXZ A;  3WHT A;  4XOG A;  3N4M A;  4CEW B;  1PZ7 A;  1N1S A;  2VQU A;  4Q4W 2;  3E1F 1;  3HN1 A;  1UY0 A;  4L97 A;  3ZXA C;  5LEK A;  1JOJ A;  5AFB A;  1GNY A;  1HIX A;  1WCD J;  4AVV A;  2RDR A;  1ACC A;  2VQT A;  1TME 3;  3HBK A;  1R08 1;  3PVO A;  2C9A A;  4XBL A;  4AZZ A;  1O91 A;  4ASK A;  4C90 A;  2XJV A;  1ENS A;  4MYE A;  2B42 B;  1VBE 3;  5FXX A;  4BQ2 A;  1OBN A;  2F4L A;  4IEW A;  2D6L X;  1ZRE A;  4ZS3 A;  1MS4 A;  2G9F A;  4LKF A;  1KQR A;  3RG0 A;  5FRA A;  1G7Y A;  1GR3 A;  2VME A;  2KA3 A;  3LF7 A;  3U0Z A;  5JCT A;  5HXV A;  4XDQ A;  1ULE A;  1V6M A;  2VAU A;  2VOK A;  4CCC A;  1F5J A;  5FO8 B;  3ZYG A;  5BNO A;  2VNO A;  3BU0 A;  1PZ9 A;  1ZA4 A;  4IGO A;  1RVF 1;  1ALY A;  3OYW A;  5FYM A;  3ROU A;  1CGP A;  4IV3 A;  5A3N A;  5FZA A;  1LOC A;  2J1A A;  2RMU 2;  1H4G A;  1SAC A;  3VBR C;  4XTM A;  4D6R A;  4C91 A;  3IWZ A;  4CXW A;  1G8W A;  1X8E A;  2CV6 A;  2RS3 2;  2LRP A;  1QDO A;  4QAW A;  1ZZ9 A;  4HK9 A;  4J1X A;  2CDP A;  2XUM A;  5IK5 A;  4Z92 B;  5F37 A;  1UYX A;  4LBQ D;  1H0B A;  4YZ1 A;  4XVH A;  1OF3 A;  2BWC A;  1AYN 2;  1T6B X;  4P5Y A;  3SCH A;  2NN8 A;  4I0A A;  2YY1 A;  3CMG A;  5K8S A;  1LGB A;  3N3H A;  3BOW A;  4QGL A;  3WG3 A;  5CFC C;  2VMC A;  1Q5O A;  4AI3 A;  1W0O A;  3LEI A;  4MET A;  3ZR6 A;  1OF4 A;  4JGZ C;  2WS9 1;  1YUD A;  4AF9 A;  1SPP B;  4XC9 A;  1VRH 2;  4C1X A;  3KV4 A;  5F32 A;  4Q0P A;  2ZKL A;  4TTG A;  2CYF A;  2ZGM A;  2CGN A;  3FFQ A;  3IDA A;  2LUW A;  4BH9 A;  4OUE A;  2WAO A;  2WBK A;  4Y5T A;  4EN9 B;  4LO4 B;  2RHP A;  4AQS A;  2TBV A;  1VB2 A;  1TE1 B;  1ENR A;  1VMH A;  2CU5 A;  2Q4S A;  4OHV A;  3E6C C;  4HN0 A;  2WFP A;  3T2T A;  4OLL A;  3RQ0 A;  3VD7 A;  5C9A B;  3WHU A;  4NN0 A;  4AI1 A;  4WVV A;  1HDK A;  1W6P B;  2GC0 A;  5C4W B;  4HG6 B;  1K5J A;  1YO8 A;  4NRM A;  4OFG A;  1NYW A;  1VPH A;  2V09 A;  4CP2 A;  4NR1 A;  4XFG A;  3SH3 A;  3TN9 1;  5JSR A;  1O3R A;  1ONA A;  4ISR A;  4LBQ A;  1R64 A;  3ACG A;  3HR9 A;  2A6W A;  3DYO A;  5T52 A;  2OPK A;  4IL7 A;  1SFN A;  1W6N B;  1WMD A;  4RR3 B;  4ES9 A;  4URA A;  1C5H A;  3U78 A;  2GC2 A;  4AGV A;  1M4W A;  3RDI A;  1U0A A;  3LOI A;  1DU3 D;  5F3G A;  1G9D A;  5H9R A;  4LO8 A;  4B1L A;  1UIK A;  1ZNP A;  3USS A;  2DWR A;  1H1M A;  1RUI 3;  1QWR A;  3VD4 A;  4IND A;  2QBX A;  3THD A;  2RS1 3;  1JYW A;  2X5I A;  4QX3 A;  4ISQ A;  1LNS A;  1MEC 1;  1ND2 A;  3M3I A;  2LW8 A;  5T54 A;  1Q8V A;  1ODM A;  2W91 A;  2Q0A A;  4UFK A;  1TNF A;  3POY A;  2YPD A;  4DPN A;  3IDE A;  3ZXE A;  3NAP B;  3KVA A;  3OSD A;  4FP2 A;  2UU8 A;  1PK6 C;  1UXZ A;  4IUG A;  1XYO A;  2PQQ A;  2VBD A;  3AYE A;  3O1P A;  4I3G A;  3QAC A;  4V2V A;  3RMY A;  3R4S A;  3OB8 A;  4DIQ A;  1MQT B;  2FCU A;  4EWD A;  2ZEX A;  4JQR A;  4WV8 A;  1PO2 2;  3R4U A;  3R05 A;  4HFS A;  1C8M 2;  1SEF A;  3E6D A;  4RS5 A;  3E97 A;  3JUU A;  5C3O A;  1QOT A;  5GLU A;  1QU0 A;  4W4Z A;  5GJ6 A;  4YG0 A;  4UW4 A;  2ZMN A;  2VW1 A;  3IB3 A;  1X7N A;  2QQJ A;  4FPK A;  4I0B A;  1OD3 A;  3H0O A;  3DL3 A;  2C9K A;  1QKQ A;  3CNA A;  2OX0 A;  3LEM A;  2ZPX A;  4FSJ A;  4IW3 A;  4YM2 A;  4UT5 A;  3S57 A;  4NE9 A;  1ULP A;  4XAB A;  4DEV A;  2ZOE B;  1S0G A;  2BTV C;  3IN9 A;  3POG A;  2FDI A;  3KV9 A;  3TNQ A;  1HB4 A;  1CIY A;  1DGL A;  1OA4 A;  2PLV 1;  2RS5 3;  2UUR A;  4XFC A;  2JX9 A;  1RIT A;  4GB3 1;  1JHJ A;  2XQX A;  1FV2 A;  1O3Q A;  2AEZ A;  4ATE A;  3K3O A;  3VBS C;  3MFC A;  1QJY 3;  4EN6 B;  1QNY A;  1TME 2;  1X33 A;  4LK7 A;  1X9T A;  4I01 A;  1E5I A;  4TWT A;  5A6X A;  3B9C A;  2B5H A;  3JD7 1;  5FZ6 A;  1FNZ A;  2BRT A;  1VBE 2;  3QOP A;  1RTV A;  5SV5 A;  1V6O A;  1K12 A;  4LE3 A;  4JQT A;  4LUL A;  2DVF A;  1NA1 A;  1U5X A;  1TEI A;  3FN9 A;  5LAS A;  2JE8 A;  3DCQ A;  2MNG A;  2WWU A;  4I09 A;  5FYT A;  3JCI A;  2HBT A;  3NST A;  3ZM8 A;  3RRD A;  1OKO A;  2F4P A;  4H14 A;  3NJX A;  1IS5 A;  3AMQ A;  2CY6 A;  4KBZ A;  2QQN A;  5EYX A;  1OKQ A;  4BDV B;  2RM2 3;  3H1Y A;  1OOP C;  2DYC A;  3ETP A;  1ND3 B;  5FYH A;  1SCR A;  2R6Q A;  3M2M A;  4N53 B;  1QGL A;  2IWG B;  4CDW C;  2W95 A;  4QPI A;  2DU0 A;  1F31 A;  2ZS6 B;  4TN7 A;  1RHI 3;  1F9K A;  3PJY A;  4QPG C;  4NIG A;  1QXP A;  2IFR A;  2BNN A;  4HT1 T;  1J84 A;  4Q0S A;  4ATF A;  5G05 L;  1GQG A;  4JAA A;  3SQO A;  4QX2 A;  2VC9 A;  1NQD A;  3M3O A;  3ACL A;  3RZZ A;  3EBR A;  2A3Y A;  1E5H A;  5FXV A;  2PHW A;  3HOB A;  1GFF 2;  2ZEY A;  5E6H A;  3ZN4 A;  2E31 A;  3O7O A;  1I6X A;  2A6Y A;  1OHF A;  2WO7 A;  5KWR A;  1NCQ A;  1V70 A;  5F3E A;  1HX6 A;  2YMZ A;  4FQZ A;  2WA3 A;  4CCK A;  1A8M A;  1ASJ 3;  4ZU7 A;  5LA0 A;  2PHL A;  2Q8C A;  2BBA A;  5A7N A;  1VIW B;  4RFT 0;  1LJ7 A;  4Q0V A;  3TEW A;  1W0P A;  4OCT A;  1GAN A;  1AR8 1;  4GZ9 A;  3RI9 A;  4CYD A;  4OUM A;  3VUO A;  1M06 G;  2W92 A;  5T5P A;  4COZ A;  5C8C C;  1XU2 A;  3I2H A;  4O7X A;  3AKR A;  4YGB A;  4AED A;  5IYY A;  3KT7 A;  1LOF C;  3VHR A;  3O1R A;  2WZR 1;  1XYP A;  1BMV 2;  3NKG A;  3SHR A;  3Q8C A;  4LKE A;  4CUA A;  4DS0 A;  4PLN A;  1UY3 A;  2XQR A;  5I91 A;  2Y6H A;  2QQO A;  3I2D A;  2WR9 A;  3C7F A;  4GWM A;  4Y22 B;  3H8O A;  1BVV A;  3KHB A;  2Q8O A;  4LIU A;  3IM0 A;  2BQP A;  4IDZ A;  1BJQ A;  3KGL A;  1FX5 A;  3R0R A;  1WBF A;  2JWP A;  4TSV A;  2RJ2 A;  3OY8 B;  5JIU A;  3WNO A;  3LKJ A;  1KS5 A;  4PCR A;  5FV3 A;  4N9I A;  5L73 A;  1KDM A;  3FC0 A;  3RYP A;  3WF0 A;  1RMU 3;  4Q4X 3;  3TRS B;  3VBR B;  3B02 A;  1UY4 A;  1X8M A;  2R49 A;  3VBF B;  4ASL A;  4L9B A;  4MX3 A;  4AFM A;  4B4P A;  5C33 A;  2V72 A;  3GDB A;  5CKN A;  2VZO A;  2YXS A;  1F8V A;  2RS1 2;  3JQX A;  4QDR A;  4AEJ A;  3E5Q A;  5LRR A;  4AW7 A;  4DXS A;  4NII A;  3NNL A;  2OZ6 A;  5M0T A;  3NW4 A;  5BYN A;  1H2M A;  4XAC A;  4GWJ A;  3VN4 A;  2OUJ A;  2XJU A;  3ELN A;  3AVS A;  1OUS A;  1FYU A;  5CFC B;  4BQ5 A;  5CEH A;  5HCA A;  4JTN A;  3WOG A;  5GKA C;  2VGD A;  4JGZ B;  4HAN A;  4C1W A;  1O4Y A;  3MLK A;  3O1T A;  5GLT A;  3UL2 A;  4Q8K A;  1F15 A;  2GN7 A;  3VBU A;  3VZM A;  2J22 A;  3WW2 A;  4DRR A;  3SKJ E;  1PNG A;  4BK4 A;  2QNK A;  2QVS B;  4LTA A;  2ZAA A;  3H9A A;  3ZMN A;  4UAP A;  2ID4 A;  3GAL A;  2HWF 1;  2FCT A;  5CFD B;  2YU2 A;  1DQ1 A;  3BGA A;  3GXU A;  1ZZ6 A;  1HJG A;  1KJL A;  1QJU 3;  2JB8 A;  2WZE A;  3AMM A;  3AYD A;  5FZL A;  4FCA A;  4NIA A;  5L9R A;  5K9Y A;  2VOT A;  3MLL A;  4RQP C;  2VTX A;  2C1F A;  1R09 3;  2WT2 A;  5C7G A;  5F1R A;  2FDG A;  2J7M A;  2ETE A;  2PHX A;  2VCB A;  5LA1 A;  5L19 A;  2DDU A;  4M4R A;  4Q26 A;  4AAP A;  4QX0 A;  1WD3 A;  1YQ5 A;  2HWC 3;  4G4F A;  4W50 A;  1GSL A;  4P08 A;  2BNO A;  3LQC A;  1S0C A;  3I3D A;  3WNK A;  1WD4 A;  1UZW A;  1FOD 1;  1J83 A;  1X9P A;  2RVA A;  2D3S A;  1HRI 1;  5ANN A;  1IKP A;  3BB6 A;  3PUS A;  5A7O A;  1PMI A;  1YQC A;  1CES A;  1RUJ 1;  1Z7S 1;  2JG8 C;  2WLQ A;  3KT1 A;  1QQP 1;  4LA3 A;  5AVP A;  4ZZ8 A;  4OQ8 A;  5J37 A;  4XF3 A;  2RS5 2;  5FXZ A;  4ZHN A;  3ECQ A;  3FJS A;  2AH2 A;  1G6N A;  3VHN A;  1W2T A;  1NG0 A;  4GIQ A;  3UYJ A;  2YFZ A;  1NAE A;  4JCK A;  1IZ3 A;  1W0N A;  3J8F 3;  4QDQ A;  2ZXQ A;  1AR9 3;  5C3P A;  5I0S A;  1RUE 1;  1ENX A;  1CAX B;  3MGU A;  1Y43 B;  4UI9 L;  5A7W B;  5LCW L;  4WBB A;  3BN6 A;  4BA6 A;  2JB4 A;  3CZU A;  3GHN A;  3RWN A;  4OI0 A;  1HRV 3;  3IDB B;  1HN0 A;  4XTP A;  1H1I A;  5T5J A;  4A42 A;  3W9A A;  3IAP A;  2QJV A;  1XQN A;  4R9B A;  1I1E A;  3BTX A;  3KF3 A;  4NHY A;  4B7E A;  4Q29 A;  1Y9Q A;  1W06 A;  2PAM A;  2YBP A;  3VGI A;  5I0R A;  1H8T A;  1IQD C;  3JBG 3;  5C8W A;  1SPP A;  4GMP 3;  5DQ0 A;  3VZL A;  1MS9 A;  1V6K A;  3M3C A;  4P9Y A;  4XFA A;  3T2P A;  3IZO A;  5CA6 A;  4L11 A;  5FMB A;  1UMH A;  2AUY A;  2RM2 2;  3AXE A;  1JMU B;  2XR4 A;  3ZDV A;  3PU8 A;  5KHG A;  5FY9 A;  2WN2 A;  4CZS A;  5FLH A;  4ZU4 A;  1O5U A;  5FCC A;  3D8C A;  4CEY B;  5DAQ A;  2Q5T A;  4GJZ A;  2K0G A;  3LSE A;  2CL2 A;  1LHO A;  4UF0 A;  3RYR A;  1GQP A;  2ZGR A;  4FT8 A;  4HBN A;  1QEX A;  1UYZ A;  1W2U A;  1CPN A;  5FZ8 A;  3T08 A;  1RHI 2;  4R9C A;  2DUR A;  4C8D A;  3SLI A;  2DVB A;  4SLI A;  1BK1 A;  5I93 A;  1WLC A;  2EIB A;  1UPI A;  1XOY A;  3KQR A;  1JTZ X;  2HWD 3;  5EZW A;  4ZKT B;  1CAV B;  4XDO A;  4QQO A;  4A4A A;  2XLG A;  4W65 A;  1MZE A;  1Q43 A;  2VVF A;  1APN A;  2HWE 1;  5DAP A;  1JYX A;  2IXL A;  1GU3 A;  5FOJ B;  5FR3 A;  1IPJ A;  1CX4 A;  3A0N A;  3C2U A;  1POQ A;  2TUN A;  3CZJ A;  1NCR C;  5A1A A;  4FFG A;  4XXP A;  1ST8 A;  1S2B A;  1ASJ 2;  1AL2 3;  2QQU A;  4D69 A;  2VXJ A;  2VO5 A;  1YI7 A;  1ULO A;  1WLT A;  3GBW A;  4QX8 A;  3VBS B;  4Q1P A;  5IFT A;  2V5Y A;  2A6Z A;  2B39 A;  4FTE A;  1CPM A;  3NNG A;  4QHZ A;  4LEJ A;  4AGG A;  2XLA A;  3BPZ A;  2D93 A;  1GP5 A;  5DUU A;  1W90 A;  3LA3 A;  1YFY A;  3LEG A;  1WLW A;  4JV4 A;  3NAP A;  2GMM A;  4BPZ A;  5LBE A;  2R06 3;  5CG8 A;  3DXU A;  5DG1 A;  3TEY A;  2DTY A;  3V0A B;  5F5C A;  5HI0 A;  2WC2 A;  3O0V A;  4EJR A;  4EZ4 A;  1K42 A;  1RUD 1;  4H7M A;  5CZK A;  1WCU A;  2A71 A;  1GP4 A;  3PVN A;  3ZXJ A;  1W8F A;  1YFX A;  1Q8P A;  2JDK A;  1OOP B;  1RMU 2;  4QQH A;  1JYT A;  4Q4X 2;  2K46 A;  3VDC A;  3RMX A;  1GUI A;  1I3H A;  3HQX A;  4FPF A;  3T2O A;  1AR6 2;  2VNV A;  3WDW A;  4HPK B;  3WXP A;  3AYC A;  2DVD A;  4Y1V A;  3ZVX A;  1S0B A;  2D97 A;  3I54 A;  4NWV A;  4BHP A;  5IVV A;  2GH8 A;  4DQA A;  4A45 A;  2KR2 A;  2QFE A;  3B9I A;  5F5A A;  5FZK A;  1AL0 G;  5LEJ A;  1TMF 1;  3MIH A;  4NJ4 A;  5C4W C;  3RPQ A;  4D7Y A;  1VAK A;  3N7K A;  3CQO A;  4ZON A;  4YRD A;  3MF9 A;  4FAG A;  4UYB A;  1CON A;  4BJ0 A;  2P3I A;  1UZ0 A;  4RR3 C;  2X09 A;  2R32 A;  4IET A;  2XJT A;  1BBT 1;  2AAC A;  2E33 A;  1WBL A;  4IV1 B;  2JE7 A;  5I8Y A;  2RMU 3;  1C5I A;  2KM2 A;  4LNV A;  1VLN A;  1CD3 G;  3QD6 A;  5LW9 A;  2BGO A;  1UZV A;  1WA4 A;  1ULD A;  1XE7 A;  2QQI A;  5FMO L;  2D6M A;  4HL0 A;  5KXB A;  2IFW A;  2W1Q A;  2WFF 1;  4KWJ A;  4PQQ A;  3LWC A;  1QJU 2;  4XQW A;  3WNM A;  4A7Y A;  2QZ2 A;  5FAX A;  3AJY A;  5A32 B;  2DU1 A;  5FYY A;  1K5M A;  2Q30 A;  3KCC A;  4CTE A;  5FTT C;  1DLC A;  2DVG A;  3EB7 A;  1R09 2;  1C4R A;  1PNF A;  2ZGP A;  3C3V A;  4JDN A;  1QJE A;  1RUH 2;  1UY1 A;  1XRU A;  3VV1 A;  3A23 A;  1HB2 A;  2ZGU A;  3MV0 1;  2VTX J;  2HWC 2;  4Q1R A;  5E16 A;  2D5F A;  3WUC A;  1PO1 3;  4BB3 A;  5C3Q A;  5L7O C;  3AL5 A;  2VUL A;  1LOE A;  1MQT C;  1SMV A;  5LK7 B;  3W5N A;  2E7T A;  3VKF C;  1PGL 1;  1A34 A;  2J1V A;  5EV7 A;  4YW2 A;  2FCV A;  4TLG A;  4NOT A;  1C3H A;  5FY1 A;  4U36 A;  2WNV B;  1W03 A;  2QQM A;  1NZI A;  5GZE A;  1JYN A;  2ZX0 A;  1EAH 3;  1DG6 A;  3NV4 A;  4Z2A A;  3HQU A;  4YVW C;  2RJL A;  2WNO A;  1UPS A;  2WLP A;  4LHN A;  4XMI A;  4WVZ A;  4A6S A;  5JMO A;  4N53 A;  1BXH A;  1PIV 3;  3K4D A;  3I2J A;  3NL1 A;  1W6O B;  2G9Z A;  3H7J A;  1G9A A;  1CIW A;  3MID A;  3J8F 2;  1SLI A;  5BNN A;  2UWC A;  5FPX A;  5LWB A;  1AR9 2;  1PMJ X;  1KS4 A;  3IKW A;  4N43 B;  4MGT A;  2VG9 A;  1LED A;  4QKD A;  1OQD A;  1N1V A;  1KFU L;  1SFP A;  1ZX5 A;  1FAT A;  1GBG A;  3AMH A;  4BXF A;  1HRV 2;  4IGQ A;  1QOO A;  2WQ8 A;  5J36 A;  1WGP A;  5FQ0 B;  3SIT A;  2ZX4 A;  1N3Q A;  4HXC A;  1PGW 2;  1GIC A;  4CCJ A;  3FHA A;  3WDT A;  3J7N A;  4NRO A;  4XF1 A;  2W39 A;  4EYU A;  1YJL A;  4M3C B;  2GAL A;  4TZD A;  4DUX A;  1AXZ A;  3WQ0 A;  2J1R A;  1ZZ7 A;  4W6W A;  2JIC A;  2Y0I A;  3P3P A;  3VHO A;  5C3R A;  4N8M A;  3VDB A;  1STM A;  5HCH A;  1J1L A;  4P00 B;  1VBC 3;  3A21 A;  1OH4 A;  2ZA9 A;  3EQE A;  5FZ1 A;  3T4H B;  4UW3 A;  2WNE A;  2R04 3;  3D0J A;  1UXX X;  4CDQ C;  1HXS 3;  3FZ3 A;  1X50 A;  3HT2 A;  4HLT A;  2WO1 A;  3ZSJ A;  2ZMK A;  4XJA A;  4Y4Y A;  3ME2 A;  5D2A A;  5A7Q A;  1IOA A;  4U2A A;  4F83 A;  1XJA A;  5LRS A;  1AYM 1;  1OVS A;  1W2O A;  2Q1Z B;  3HNM A;  4GKX A;  4IEX A;  1MVE A;  1VBD 1;  2RDQ A;  2D40 A;  4RQP B;  4UFM A;  4O9G A;  3WSO A;  1NLQ A;  1NY7 2;  5A3U A;  1W9Y A;  5HCF A;  5A33 B;  3AX4 A;  2HWD 2;  4LK6 A;  2BVB A;  3DPR B;  2IZW A;  4Y22 A;  1V9U 3;  3K4Z A;  4GA9 A;  4BLI A;  5FYI A;  1GZC A;  3DGT A;  4K20 A;  4CVU A;  4QM8 A;  2W1W A;  4HON A;  1ZYB A;  4XIL A;  2UY8 A;  3I2F A;  2RR1 3;  4RD7 A;  5IAX A;  1GWK A;  1PO2 3;  3FUO A;  1NOV A;  5HV4 A;  3W59 A;  2BOI A;  4R8H A;  2PHT A;  3NKT A;  3B93 A;  2WAB A;  4UFH A;  1ND3 C;  3CJI A;  2V5D A;  3QH6 A;  1IHM A;  1XE8 A;  1AL2 2;  2W9X A;  3POB A;  4IEQ A;  3VBR A;  1UYY A;  5CKM A;  1HQL A;  3NNF A;  4FFI A;  1TZO A;  3WF1 A;  2H6B A;  2YPJ A;  2NMO A;  3T0B A;  5KBF A;  3KCX A;  4QXK A;  3SXW A;  2R07 1;  1NUK A;  5FP8 A;  4IE0 A;  4MO3 M;  1UMZ A;  4EWE A;  2V4A A;  3WG4 A;  2XVK A;  4AEM A;  1RGS A;  1Y9M A;  1NLS A;  1ZM1 A;  2JE9 A;  2GP3 A;  4QB6 A;  4JHZ A;  3UKV A;  3KCY A;  5KC6 A;  3KMH A;  4CP9 B;  1RXF A;  1RUI 1;  2OUH A;  3D6E A;  5CFC A;  1UOF A;  2RS1 1;  4CP0 A;  2R06 2;  5GZD A;  3N36 A;  5JZG B;  5FJH A;  1CN1 A;  2EXK A;  1JHN A;  4JGZ A;  3VZO A;  3J7M A;  2GH2 A;  3GJA A;  1QH7 A;  3JU9 A;  1EYB A;  3M8L A;  2VZR A;  3AXD A;  1EPW A;  3AL6 A;  2N7G A;  4A3Z A;  3ZXD A;  1S0D A;  4KNC A;  1VAM A;  5C6C A;  2NZ9 A;  3LEK A;  3ETQ A;  2VD7 A;  3BIW E;  3INA A;  4H55 A;  5ABJ B;  2VXR A;  4AXO A;  3PIG A;  5CB7 A;  2CDO A;  5FOB B;  5IFP A;  4LE4 A;  4Z2W A;  5DDJ 3;  4DUV A;  1EV1 1;  4KL1 A;  4D8M A;  1GKB A;  1Y3T A;  4FOY A;  4XCA A;  4AEK A;  5D8A B;  1URX A;  2NLR A;  3Q8E A;  3BYW A;  2H0V A;  1I9R A;  1OT5 A;  3U07 A;  3ZFE A;  3T4V A;  1ZBA 3;  3CBN A;  1PMH X;  4LUM A;  4LR4 A;  4M0N A;  3WP5 A;  3POE A;  4AK3 A;  3GF6 A;  3LFI A;  4P9J A;  4NPR A;  5DUX A;  5J1X A;  3F95 A;  3UJO A;  2ORX A;  5FKC A;  2VNR A;  1WKY A;  3W5M A;  2A7A A;  3GM8 A;  1G9C A;  1NCR B;  4BIO A;  2FDH A;  4E4D X;  1VBB 1;  2AGS A;  3ACH A;  5I8S A;  1IQA A;  3QH7 A;  1JS9 A;  2VMH A;  5FPZ A;  3VBF C;  4KH9 A;  5GLV A;  4IEU A;  1AUY A;  4YM0 A;  4B3N A;  5CNA A;  2JD9 A;  5A7W A;  1DDL A;  1H2L A;  1B35 B;  2ADE A;  1VBA 3;  2DCY A;  1TNR A;  2XBO 3;  4CDU B;  4KWK A;  4D3W A;  4D0Q A;  4DUW A;  1GV9 A;  1UU5 A;  2GZW A;  2UYB A;  3K75 B;  4XF0 A;  1QJY 1;  4PQ9 A;  4D6Q A;  1DQ0 A;  4XQ4 A;  3AFK A;  3IAQ A;  1PK6 A;  4P9L A;  3ZDS A;  5JR2 A;  1ZRF A;  4EN7 B;  3QCW A;  5L9V A;  1LB2 A;  1PO1 2;  1UF2 C;  3PVE A;  4GAL A;  2P6H A;  4MGY E;  4OHW A;  3UJQ A;  5F6L B;  2VOV A;  3AP6 A;  2ARA A;  1EY2 A;  1XE0 A;  2B9U A;  4DY3 A;  3PUR A;  2XKO A;  5GM0 A;  4Q27 A;  3USU B;  4XET A;  3L2H A;  2VUA A;  4KG0 A;  1EAH 2;  2YUE A;  3CU7 A;  1HQW A;  3GYD A;  4MLO A;  2VZP A;  3LFM A;  3N35 A;  1WW6 A;  4MGK E;  4I3P A;  1PIV 2;  3SCF A;  5ACA 3;  5CFD C;  5KHJ A;  2W5F A;  3POI A;  3PLQ A;  4AFA A;  3T09 A;  5FYU A;  3T30 A;  1W8Z A;  2VL4 A;  5CYY A;  5JI7 A;  5KXD A;  1F2N A;  3S5A A;  1H9W A;  2NP0 A;  2YBK A;  4P9W A;  3HWJ A;  2VH9 A;  4HVQ A;  4BZ4 A;  1D4M 3;  2XL9 A;  3BOP A;  3HJR A;  5FIX A;  3MIB A;  1DHK B;  4NRQ A;  2PFW A;  2QTW B;  1W99 A;  4YWA A;  1PX4 A;  1W9W A;  1TVG A;  1WMX A;  3ZFG B;  2WDB A;  3NV3 A;  4UOJ A;  1LHN A;  1ZBE 2;  4FPL A;  4CU7 A;  4CXY A;  3WUD A;  2FDK A;  1HB3 A;  2P3Y A;  3GCX A;  1REF A;  4AHZ A;  3T0D A;  2E53 A;  1RUN A;  5FZG A;  3ASI A;  1GZW A;  1CAU B;  1VBC 2;  2DUO A;  3D5O A;  4QQ2 A;  3S7E A;  4AYU A;  3VBS A;  3HNB M;  2R04 2;  3K46 A;  4QGM A;  5FLI A;  4BLJ A;  3B3Q E;  2G4I A;  3BI3 A;  1HXS 2;  1L3J A;  3PMS A;  5FY0 A;  4RA0 A;  1LEC A;  1V0A A;  1VAL A;  2WIN B;  4YVS B;  4IEY A;  4HSL A;  2VJX A;  1XND A;  4LKD A;  2BUK A;  4Y4R A;  1DGW A;  2C5D A;  1BCX A;  4YG3 A;  1OLQ A;  2GU9 A;  4HOO A;  4LLO A;  1Q56 A;  4ERO A;  1AX1 A;  4FP3 A;  1V9U 2;  2JEN A;  2PHD A;  3PU3 A;  5L7O B;  2F17 A;  5EJ3 A;  1W6M B;  2XWB B;  3HBZ A;  1QDC A;  5FYV A;  5JPN B;  1S0E A;  2WO2 A;  4LHS A;  1FPN 3;  1POV 3;  2RR1 2;  4OZX A;  3BU7 A;  5FXW A;  1LGC A;  2P3J A;  3RFR A;  5JLV A;  3VBH C;  4B4R A;  1QJX 3;  1OOP A;  3N9O A;  1MS1 A;  4YVW B;  2HWB 1;  4ZZ5 A;  1H30 A;  1Y9G A;  5HCB A;  5JMC A;  1JI6 A;  4CEY C;  5IW0 A;  3UK9 A;  4CDW A;  3MW2 A;  4YFZ A;  3RZJ A;  1SDD B;  2A70 A;  2ES3 A;  5DZE A;  3MIG A;  2WT0 A;  3CLP A;  4F3J A;  4FTS A;  4QPG A;  5JSP A;  3S7I A;  1O8S A;  2D7F A;  5JXI A;  4OZO A;  1BYH A;  1CZS A;  1FMD 2;  1RUG 3;  2PEL A;  1UOB A;  2VUC A;  1VMF A;  1OUX A;  2IC1 A;  3PHM A;  2CGO A;  4XQD A;  5BNP B;  4OI2 A;  2VMF A;  2ZZQ A;  4Y20 B;  3MDP A;  2SBA A;  4H2A A;  1JYI A;  4NHK A;  1MS8 A;  2GMP A;  2DUP A;  4MAD A;  4QT6 A;  5IVJ A;  3OGS A;  1DZQ A;  3ILR A;  2PAK A;  3I3M A;  3PME A;  4KU7 A;  5LBB A;  5L9B A;  3NMB A;  2ZAH A;  2Y26 A;  2C0Z A;  4XJ8 A;  1IGO A;  2DCT A;  3PIJ A;  1L7L A;  2JIG A;  1OVP A;  4FPG A;  5F6K A;  2D6K A;  2IXC A;  1WW4 A;  4BM8 A;  4CCM A;  1RIN A;  5DZG A;  1RUC 1;  4WM8 B;  4ZS2 A;  2O8Q A;  3HVD A;  3AKS A;  2PXJ A;  2KD7 A;  3KZ4 C;  1H6X A;  3ALQ A;  5C8C A;  2W87 A;  3TWI A;  1D0H A;  4Z82 A;  5DXD A;  4CDQ B;  5FZE A;  5A32 A;  2DBI A;  3MBW A;  2R16 A;  2WKK A;  1A3K A;  5DDJ 2;  1Q3E A;  5FZB A;  2JG9 A;  5JXH A;  1LOF A;  1LHV A;  1H9P A;  3WQ7 A;  1UU4 A;  5HBA A;  5IUQ A;  2RDN A;  2VBP A;  5CIR A;  3NJZ A;  5H9Q A;  2VEC A;  1ZBA 2;  4D7S A;  5FY5 A;  5BXX A;  4AR2 A;  2ZZJ A;  3OUH A;  2OS2 A;  4LHL A;  2E26 A;  4Q8L A;  4YZ2 A;  4PI2 A;  4AI8 A;  1J3P A;  1NX9 A;  3LOB A;  4PIY A;  2QCS B;  4XUT A;  3H1M A;  3B69 A;  3NJY A;  4OVE A;  5FZM A;  1ZZC A;  1XNA A;  2WYS A;  3VKM A;  5J09 A;  4S2H A;  3EHK A;  2WS9 3;  1PHM A;  3PL0 A;  2EIE A;  1H1A A;  1PX3 A;  1W6O A;  2A1X A;  4LOR A;  3WIN E;  1DZT A;  2A3X A;  2LRO A;  3EXU A;  1AR7 2;  1W6Q A;  4KI5 M;  4Q4Y 3;  1AF9 A;  3OBA A;  3Q8A A;  4S2D A;  1US3 A;  2XBO 2;  1VBA 2;  2DF7 A;  2WWS A;  3LGR A;  4Q0Q A;  3RVH A;  2ET7 A;  5FQ0 A;  1PM4 A;  4M01 A;  1RL3 A;  1JZ5 A;  4W8J A;  3U4S A;  1CJP A;  2PN5 A;  3N9L A;  4JTO A;  2MEV 1;  2ET1 A;  4G9S B;  4CRQ A;  2JEM A;  2XVG A;  4NIH A;  4P5H A;  2XWJ B;  5A1F A;  3OBZ A;  5GLW A;  1CAW A;  5JIA A;  1O59 A;  2XPJ A;  2ORZ A;  4IV1 C;  2GND A;  5FPU A;  1KIT A;  1CQ9 A;  3IPV A;  3RGB A;  3TN9 3;  1JZ8 A;  4YYO A;  3AMN A;  1XSR A;  3JBG 1;  3WV6 A;  2VZU A;  3WY6 A;  1ULF A;  5ACA 2;  1Y4W A;  3ZXF A;  2A75 A;  3AP5 A;  4OI1 A;  3G6J B;  3MW4 A;  5GAL A;  4BE3 A;  5F8P A;  2ZAB A;  4RSU A;  4NWW A;  3SNM A;  3HPN A;  1WW7 A;  4QHB A;  1OFS A;  2EIG A;  1C8N A;  1D4M 2;  4UW5 A;  3CO2 A;  1WA6 X;  1HW5 A;  2X29 A;  4XUP A;  3OGR A;  1ULG A;  4JGY A;  5IAV A;  3FFZ A;  2QQV A;  2Y6J A;  4IE7 A;  1MEC 3;  1UYP A;  4JDO A;  2WT1 A;  4WZF A;  1NY7 1;  5E89 A;  2A3W A;  4YGC A;  2WNV C;  2BZD A;  4AQ2 A;  2HWD 1;  3PNA A;  2EVX A;  2H6C A;  5LA9 A;  3WEZ A;  4RHV 1;  1HV1 A;  2JG8 A;  2HEW F;  4MGZ E;  4YGE A;  3SCG A;  3VDD B;  1RUF 1;  3S0M A;  4GH4 C;  4BOW A;  3PUH A;  3ZPO A;  1UMI A;  3I7D A;  4MXW B;  3KV5 A;  3DYM A;  4BWO A;  1AR6 3;  1YRZ A;  1UL9 A;  2GNB A;  4FO9 A;  4XYX A;  1NA1 C;  1R1A 2;  4N43 C;  1MAC A;  1W8U A;  2L9L A;  1CJD A;  4WVW A;  1S55 A;  3LDB A;  3UV9 A;  2WAA A;  2W2I A;  3AZV A;  5DUW A;  1YEW A;  4CP9 A;  3ZN6 B;  1SLT A;  4XXA A;  1BQP A;  4XUQ A;  2ARB A;  4MZU A;  1LU2 A;  3M7A A;  5DN2 A;  1J58 A;  2OW4 A;  5FY7 A;  1JBC A;  2BNM A;  1UO9 A;  1K45 A;  3H3L A;  1O8P A;  1CX1 A;  1FAY A;  1WZX A;  2IVJ A;  1FV3 A;  2WL1 A;  4CEW A;  1FPN 2;  1JZ2 A;  3IMM A;  2VUD A;  2Q1F A;  4CXX A;  2VVD A;  1A8D A;  4PDW C;  1QJX 2;  3AMP A;  2ZX2 A;  1COV 1;  2DTW A;  3OPT A;  3OG2 A;  2BFU L;  3WDX A;  3S6P A;  1O4Z A;  3DV8 A;  2FHR A;  1GOG A;  3J9S A;  4Q4W 1;  2D3R A;  3W20 A;  5FYZ A;  1SBF A;  3RYK A;  2PLV 3;  1QXJ A;  3MIE A;  2VU9 A;  2A6X A;  4GB3 3;  4OYU A;  4O65 A;  1XNB A;  2Z2S B;  2BEO A; 
#chains in the Genus database with same CATH homology
 4BJ0 A;  5DMY A;  4QX1 A;  1UZ0 A;  2VQT A;  2X09 A;  4MGQ A;  2V4V A;  2E33 A;  2YC4 A;  2C4X A;  2BGO A;  3HN3 A;  1XNT A;  2QQI A;  2W1Q A;  4PQQ A;  4JKM A;  3WNM A;  2VME A;  2OKX A;  2VZT A;  1JZ3 A;  1W9T A;  1DLC A;  3EB7 A;  4XUN A;  1L7R A;  3ACF A;  4ARX A;  1UY1 A;  3F2Z A;  3A23 A;  2YB7 A;  1UWW A;  3GGL A;  3MV0 1;  2W1S A;  2J1A A;  3DEC A;  3W5N A;  5HPO A;  2J1V A;  5JXJ A;  4ARY A;  4QAW A;  1JYN A;  2QQM A;  3MUY 1;  3WQB A;  4Z2A A;  2CDP A;  5C71 A;  1UYX A;  2JKX A;  5JMO A;  1EUU A;  3HEI A;  1OF3 A;  4XVH A;  4P5Y A;  3K4D A;  3I2J A;  3CMG A;  2B4K A;  2VZS A;  3VD3 A;  4KMQ A;  1PMJ X;  2VMC A;  2BER A;  3LEI A;  1OF4 A;  1JZ7 A;  5EJ1 B;  2WQ8 A;  2J1U A;  2XOM A;  3FHA A;  4TTG A;  3VD9 A;  3IDA A;  4M4P A;  2LS6 A;  4OUE A;  1P8J A;  2E32 A;  1K3I A;  2WAO A;  2VZ3 A;  4RN5 A;  3NQH A;  2WBK A;  4DUX A;  1W8N A;  2J1R A;  3VDB A;  4P00 B;  3A21 A;  2QQL A;  1OH4 A;  2YC2 A;  2PQS A;  2VZV A;  3VD7 A;  3WF3 A;  3C7H A;  1UXX X;  4HG6 B;  2WO1 A;  4JX0 A;  3HNM A;  3MUZ 1;  3WSO A;  4XUO A;  3MV1 1;  1R64 A;  3ACG A;  3DYO A;  3I3E A;  3K4Z A;  4CVU A;  2W1W A;  3I2F A;  3PUI A;  5EIY B;  3VD4 A;  4BXS V;  2QBX A;  3NJV A;  3THD A;  2WAB A;  3OEA A;  1JYW A;  2V5D A;  4QX3 A;  2W9X A;  1LNS A;  1UYY A;  2LW8 A;  4TXW A;  4MGS A;  2W91 A;  5EJZ B;  3WF1 A;  3T0B A;  2VZQ A;  4IUG A;  1UXZ A;  1UY2 A;  1NUK A;  3OGV A;  4MO3 M;  3T0A A;  4AAX A;  4QPW A;  3OB8 A;  1F4A A;  2HLE A;  2ZEX A;  4QB6 A;  4JHZ A;  2C26 A;  3SEP A;  1SG3 A;  4W4Z A;  2Y6K A;  3IB3 A;  2HYX A;  2VZR A;  2YG0 A;  2QQJ A;  1OD3 A;  4A3Z A;  2C9K A;  3LEK A;  4MOA A;  1JZ4 A;  2CDO A;  2QQK A;  5IFP A;  4DUV A;  4GWI A;  2J1S A;  1DP0 A;  4ZXE A;  1ULP A;  4D8M A;  4DEV A;  4OMD A;  3UES A;  4JKL A;  4OMC A;  1OT5 A;  4QDS A;  1PMH X;  1CIY A;  2VMD A;  2VCA A;  1SHW B;  5HXM A;  3C7E A;  5J1X A;  1JHJ A;  2ORX A;  2XQX A;  1WKY A;  3SKV A;  2EIC A;  3W5M A;  3GM8 A;  3MO4 A;  1XC6 A;  3ACH A;  4A44 A;  3HNY M;  1K12 A;  3UET A;  1NKG A;  2WUH A;  3FHQ A;  3WNP A;  1TG7 A;  2JD9 A;  4XZU G;  3FN9 A;  2JE8 A;  1W9S A;  1DYO A;  2Y6G A;  4D0Q A;  3ZM8 A;  4DUW A;  3C7G A;  3K75 B;  4XUR A;  3NJX A;  2JDA A;  4BDV B;  2QQN A;  3IAQ A;  3VD5 A;  1EUT A;  5JR2 A;  2VM9 A;  3ETP A;  2WN3 A;  2B9V A;  3NRU A;  2W95 A;  4CU6 A;  1J84 A;  2VZP A;  5G05 L;  2W5F A;  4QX2 A;  1D7P M;  2VC9 A;  3LPG A;  3T09 A;  3DYP A;  3C8X A;  2VL4 A;  3HOB A;  5CYY A;  2ZEY A;  2ZEW A;  4PF1 A;  2E31 A;  1US2 A;  3T2Q A;  3HJR A;  3ACI A;  5LA2 A;  5LA0 A;  2BBA A;  1W99 A;  1PX4 A;  1W9W A;  1TVG A;  1GMM A;  2WDB A;  4UOJ A;  5IJR A;  4GZ9 A;  2RV9 A;  4CU7 A;  2VCC A;  2W92 A;  2VR4 A;  3I2H A;  3T0D A;  5IYY A;  1GOF A;  2Y64 A;  4ET7 A;  1CZT A;  3HNB M;  3K46 A;  4LQR A;  4CUA A;  5B4X A;  2X05 A;  1UY3 A;  2Y6H A;  2QQO A;  3C7F A;  1XPW A;  3P1I A;  2VJX A;  3K4A A;  3SEE A;  2RJ2 A;  3WNO A;  1W8O A;  3VDA A;  2ZEZ A;  3WF0 A;  1JU3 A;  4LKS A;  4LHS A;  2WO2 A;  1H6Y A;  1UY4 A;  2V72 A;  3GDB A;  2VZO A;  4QDR A;  4ZZ5 A;  2Y8K A;  3CIH A;  5C70 A;  4DXS A;  1JI6 A;  1I5P A;  1SDD B;  4PT6 A;  4GWJ A;  5IHR A;  4E8D A;  1O8S A;  5JXI A;  1JYV A;  4OZO A;  4DXT A;  1CZS A;  2VMF A;  4RYD A;  3I2G A;  3AC0 A;  3I2K A;  2J22 A;  3SKJ E;  4AG4 A;  4MAD A;  3OGS A;  4BK4 A;  4UAP A;  2ID4 A;  4FI9 A;  1JZ6 A;  3BGA A;  1JU4 A;  3GXU A;  4L0P A;  5JUV A;  2WZE A;  5G04 L;  1CZV A;  2VOT A;  4DEQ A;  2YFU A;  5B4N A;  2XHN A;  3LPF A;  4QB1 A;  5C7G A;  2EID A;  2J7M A;  2KD7 A;  1KGY A;  2VCB A;  1H6X A;  5LA1 A;  2DDU A;  2W87 A;  4M4R A;  4QX0 A;  4W50 A;  3MBW A;  4P08 A;  4QB2 A;  5JXH A;  3LQC A;  3WNL A;  3I3D A;  1J83 A;  2RVA A;  3FL7 A;  3JXS A;  4P02 B;  3WNN A;  1BHG A;  1F4H A;  4ZZ8 A;  2E26 A;  4KWU A;  2VZ1 A;  1NX9 A;  2BGP A;  3ECQ A;  2YFZ A;  1NAE A;  4XUT A;  1W0N A;  2W46 A;  4QDQ A;  2X10 A;  2WO3 A;  2ZXQ A;  3UNP A;  4UI9 L;  5LCW L;  2WYS A;  1XNA A;  1MPX A;  2J1E A;  3BN6 A;  5FUI A;  3CZU A;  2EIE A;  1PX3 A;  4A42 A;  3THC A;  3IAP A;  4A41 A;  4KI5 M;  3D3A A;  2Z4F A;  3I3B A;  3OBA A;  1US3 A;  3EYP A;  4JKK A;  1IQD C;  5DQ0 A;  3T2P A;  1JZ5 A;  3WF2 A;  4YPJ A;  4W8J A;  1UMH A;  4LPL A;  2WN2 A;  1O59 A;  1GQP A;  2ORZ A;  4A6O A;  1UYZ A;  4E8C A;  3T08 A;  1GOH A;  5JXG A;  1JZ8 A;  2EIB A;  2VZU A;  2XON A;  3K77 A;  4A4A A;  1L7Q A;  1JYX A;  5DPN A;  3LE0 A;  1GU3 A;  1WCQ A;  2DCJ A;  3HPN A;  3C7O A;  2VTF A;  3CZJ A;  5A1A A;  3I97 A;  1YQ2 A;  3WNK A;  4XUP A;  3CKH A;  2W47 A;  2W94 A;  3OGR A;  5F7U A;  2Y6J A;  2VO5 A;  1ULO A;  2BZD A;  3WEZ A;  5IFT A;  1T2X A;  3J7H A;  3NNG A;  3P6B A;  3PUH A;  1HN1 A;  1UMI A;  1UX7 A;  3U37 A;  3ABZ A;  2WZ8 A;  2R7E B;  3DYM A;  3LEG A;  4BK5 A;  3CDZ B;  2J1T A;  3III A;  4DXR A;  1KEX A;  2L9L A;  3A22 A;  2W3J A;  2WAA A;  1K42 A;  5CZK A;  3WF4 A;  5I0D A;  4XUQ A;  5DN2 A;  2Y6L A;  4ZY9 A;  1K45 A;  1O8P A;  1CX1 A;  3OEB A;  1RYY A;  3I2I A;  3VDC A;  1GUI A;  2W1U A;  3T2O A;  1JZ2 A;  2DCK A;  4CUB A;  4CU8 A;  4A45 A;  3OG2 A;  1GOG A;  2VQU A;  3E1F 1;  4CUC A;  1UY0 A;  3CQO A;  4CU9 A;  4OYU A;  3A7Q A;  1GNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...