2XONA

Structure of tmcbm61 in complex with beta-1,4-galactotriose at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
SRNYLKNPGFETGEFSPWRVSGDKKAVKVVKANPSSNAHQGEYAVNFWLDESFSFELSQEVELPAGVYRVGFWTHGEKGVKIALKVSDYGGNERSVEVETTGWLEWKNPEIRNIKVETGRIKITVSVEGRAGDWGFIDDFYLFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARABINOGALACTAN ENDO-1,4-BETA-GALACTOSIDASE
publication title Recognition of the Helical Structure of Beta-1,4-Galactan by a New Family of Carbohydrate-Binding Modules.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 34
structure length 145
sequence length 145
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2xonA00
3UESA 1UY3A 2WQ8A 3OBAA 5FUIA 1PMJX 4A3ZA 1CIYA 2E31A 1DYOA 4MADA 3CDZB 1F4HA 3C7HA 2B4KA 3NJXA 3I2JA 1JHJA 2C4XA 1JZ5A 4CU6A 4CUAA 2ORXA 4XUQA 1GOGA 4L0PA 2EICA 3J7HA 1CX1A 2W95A 2VCAA 4QX0A 3GDBA 3OEAA 3I3BA 2VZVA 3C7FA 3WF4A 1KEXA 2W92A 4W50A 2W1WA 1PX4A 2EIEA 3IAPA 1GQPA 3LPGA 4QDRA 3P6BA 1ULPA 3VD3A 3WF3A 2WZ8A 2WBKA 2JD9A 2C26A 2Z4FA 1GOHA 3T2PA 3A7QA 3OB8A 4XURA 1JZ8A 1JYWA 1UYXA 2W47A 2WZEA 4M4PA 4CU8A 2VZSA 5G05L 2LW8A 1UYZA 1XPWA 3SKJE 2W1QA 1GNYA 5J1XA 4A4AA 5IHRA 3DYOA 2W9XA 4BJ0A 1OD3A 3WNOA 4QB6A 2BGPA 3SKVA 4A6OA 2VZRA 4XVHA 2XQXA 2X10A 5B4XA 3HPNA 3LEIA 3HNMA 3ZM8A 2WABA 2J1UA 2WYSA 3E1F1 3OGSA 2VCCA 2E32A 1JZ3A 1NX9A 2L9LA 3BN6A 2E26A 3PUHA 3P1IA 2W5FA 3I2FA 3OG2A 1F4AA 1HN1A 2WUHA 1JYVA 1ULOA 2BGOA 3GGLA 1CZVA 2YB7A 3WNPA 3T09A 5HPOA 2YFZA 4P5YA 3T2OA 3DECA 4AAXA 3DYPA 2DCJA 3VDAA 2WAOA 1W9WA 1R64A 3NRUA 3ABZA 2VR4A 1DP0A 5DQ0A 1W0NA 1JYXA 2RJ2A 2YC2A 3OGVA 3K4ZA 3VD5A 1GUIA 1OF4A 4XZUG 3T08A 4MO3M 2XHNA 1US2A 4ZXEA 3OGRA 2ZEZA 1WKYA 1W8OA 5CYYA 3WQBA 5F7UA 5LCWL 4DXRA 1JZ6A 3CIHA 3UNPA 5EJZB 4E8DA 4BXSV 5LA1A 2YFUA 3ACFA 2CDOA 3HOBA 1UX7A 4CUBA 2VQTA 3VD4A 4FI9A 2W87A 3FHQA 3MBWA 4KWUA 3GM8A 2PQSA 4JKLA 4AG4A 4BK4A 4M4RA 2LS6A 3PUIA 4CUCA 3LQCA 3MUZ1 2J22A 1UMHA 5JMOA 2J1RA 1NKGA 4DXTA 1YQ2A 3THCA 2VZ3A 5LA0A 3WNLA 4XUPA 3K77A 2J1VA 1JZ2A 2KD7A 4PT6A 2JE8A 3A23A 1D7PM 5I0DA 3T0AA 4D8MA 4HG6B 4OUEA 1JU4A 1KGYA 3C7OA 4DEQA 3IAQA 3MV01 1W9TA 1H6YA 3UETA 2J1AA 2W3JA 5IJRA 1L7QA 2VC9A 1XC6A 4RN5A 4ZY9A 3SEPA 1DLCA 4QX3A 4DUVA 4PF1A 4QB2A 2V4VA 3T0BA 4ZZ5A 4QX2A 4ET7A 3T0DA 2HYXA 2W1SA 4LQRA 5EJ1B 1UXZA 4MGSA 2VMFA 4XUNA 2Y8KA 1P8JA 2HLEA 4MOAA 3D3AA 3K4DA 5JXIA 1RYYA 2XONA 3I3EA 2J7MA 1IQDC 4OMDA 1WCQA 1EUTA 2CDPA 4ARYA 4GWJA 2VZPA 3WF0A 2X05A 1T2XA 1SHWB 3WSOA 4KMQA 4A41A 5C7GA 4JHZA 1CZSA 2X09A 4MGQA 1PMHX 4JKKA 4P00B 1J83A 3F2ZA 4W8JA 3I2HA 4JKMA 2BZDA 4W4ZA 2WN3A 1NUKA 2WAAA 3CZJA 1W99A 3ACIA 2JKXA 3FHAA 3IB3A 1EUUA 2VMEA 5DN2A 4TXWA 3AC0A 5G04L 1H6XA 3THDA 4BDVB 3NJVA 2ZEWA 1W8NA 2VZUA 3HJRA 1K42A 3VD7A 3EYPA 4CU7A 2VTFA 3VDBA 5IFPA 4OMCA 3T2QA 1BHGA 2QQIA 2Y6HA 1JU3A 2Y6LA 2VZOA 2VZQA 2ORZA 1JI6A 2XOMA 4CU9A 2V72A 4ARXA 4OZOA 2VOTA 3LPFA 2VJXA 5LA2A 2BBAA 1UY2A 1US3A 3VD9A 3I2KA 2QQNA 1O8PA 2ZEYA 3I3DA 3VDCA 3LEKA 2VO5A 3CZUA 3I2IA 4P08A 2YG0A 1K3IA 3CMGA 5JXGA 3FL7A 3NQHA 4D0QA 3U37A 1UMIA 2DDUA 3ACGA 3C8XA 2W94A 1UZ0A 3W5MA 1UXXX 4CVUA 3I97A 2W1UA 5JUVA 5A1AA 4YPJA 3K46A 2J1SA 4QDQA 4TTGA 2QBXA 1GU3A 2VQUA 2EIDA 4UOJA 1MPXA 4RYDA 3IDAA 3JXSA 2C9KA 1JZ7A 1UYYA 1OH4A 2DCKA 4KI5M 3W5NA 2QQJA 3CKHA 2WN2A 3K75B 4QX1A 2WO3A 3HNBM 3NNGA 1J84A 1O8SA 4A42A 5JXHA 4QDSA 5EIYB 1UY0A 5B4NA 2ZEXA 5DMYA 1PX3A 3EB7A 4PQQA 5DPNA 4BK5A 2VMCA 1O59A 4XUTA 2E33A 3LE0A 3WNNA 3HN3A 4UAPA 4DUXA 4DXSA 3WF2A 2J1TA 5IFTA 1TG7A 5HXMA 1JYNA 1K45A 2QQLA 3SEEA 1UY1A 1JZ4A 2QQMA 4ZZ8A 2WO1A 4A44A 2R7EB 5JR2A 3MV11 4DEVA 2Y6KA 4LPLA 4XUOA 2Y6JA 3WEZA 5JXJA 4JX0A 1CZTA 2JDAA 4Z2AA 3LEGA 5IYYA 3OEBA 1GMMA 1I5PA 3HEIA 2VCBA 1XNAA 1OF3A 2VZTA 3I2GA 2W46A 2J1EA 4OYUA 1XNTA 2VMDA 3DYMA 4QB1A 4UI9L 1W9SA 4DUWA 1LNSA 4A45A 2YC4A 3ETPA 2VM9A 5C71A 3WF1A 2V5DA 3MO4A 3ECQA 3IIIA 3C7EA 4GZ9A 3FN9A 3HNYM 2QQOA 1K12A 1UY4A 4GWIA 3K4AA 2QQKA 1SDDB 2Y6GA 2BERA 4QAWA 4LHSA 1OT5A 2VZ1A 3BGAA 4QPWA 1L7RA 1NAEA 1UWWA 2B9VA 1SG3A 2W91A 4E8CA 2RV9A 5C70A 2OKXA 2RVAA 2Y64A 3CQOA 4IUGA 1GOFA 2VL4A 3ACHA 2WDBA 2ID4A 3A21A 2ZXQA 4LKSA 3GXUA 2WO2A 3C7GA 4P02B 3A22A 3MUY1 3WNMA 3WNKA 5CZKA 2EIBA 1TVGA
chains in the Genus database with same CATH superfamily
1ZRRA 1WCSA 3UESA 3K51A 3OBAA 1AYN2 2RHPA 4XBLA 2E7QA 2RM21 3POJA 4RD7A 2E31A 5FFOC 2OT7A 2ARBA 5A3WA 1DQ0A 3NJXA 3PU8A 5FZ3A 4ASKA 1JHJA 3NW4A 1V6NA 2ZGTA 5APAA 5E1RA 1HW5A 4CA9A 1UOJA 1SLCA 5JZGB 1W39A 3O5SA 3VBHC 1CAVB 2UWCA 1O3RA 1WCUA 1X8EA 1FI2A 3J7HA 1OUXA 3PVBB 4IDZA 2RS31 2VCAA 3N9QA 1KRIA 2CAVA 3OEAA 5E89A 2YGLA 3KCXA 3POSA 4Y1UA 5BNNC 2YYOA 5I0SA 5KHGA 1Z7S3 3MGUA 1VALA 3P6BA 4QDRA 1UZZA 1ULPA 1V6LA 3POFA 1QU0A 3LFMA 1YUDA 2BV4A 2P17A 4LBKA 3VD3A 4BH9A 2XBO1 2D5FA 3VBSC 4FOVA 3M7AA 4CP0A 1W3VA 4LBLA 1GOHA 1FV3A 3PJQA 1A8MA 4CCOA 2V09A 4IESA 4FOWA 1OA2A 3BOWA 1JYWA 1UYXA 3FC0A 2WZEA 4M4PA 2BFUL 1WCKA 3NSTA 1QHDA 3FLRA 2ZGUA 1R081 1OQDA 3ILFA 4CP2A 5IHRA 1STMA 3DYOA 3JZVA 4K1ZA 3MYXA 4FPJA 4AEDB 4L97A 3WNOA 1OHFA 4R9DA 4JZRA 4XJ9A 2BGPA 2XJVA 4WBBA 4Y5SA 4FFFA 1UU5A 1S2BA 4XVHA 3WCRA 1DU3D 3EBRA 3OPZA 5FZBA 1CVNA 3LEIA 2IUWA 5A33B 2NLRA 2HWD2 4COWA 2KR2A 2GNTA 5K9YA 3ZM8A 2WABA 2MNGA 3CF6E 1TMF2 2WYSA 1WW7A 2H6CA 3E1F1 2DF7A 2VMIA 3WW2A 1ODMA 4GD4A 2K9ZA 4EN9B 1POV1 2VTXJ 2EA7A 2CWSA 5DUXA 2ZX4A 2E26A 5DDJ3 5LY2A 3ITQA 1R093 2HWF1 2ARCA 1VP6A 3N4MA 1D0HA 1N47A 1DG6A 1VBC3 2VMGA 1RUD2 4GIQA 5C3SA 1IS4A 3WD5A 2BW8A 1UNBA 4S2DA 1F4AA 1UYPA 3JUUA 5E16A 1REEA 3V56A 4QKBA 5L73A 1O6UA 4WVWA 3BUCA 4NHXA 5EFUA 4PJYA 4QPIA 5DZGA 5EWSA 1QGLA 5H9QA 4EN7B 5FOJB 2W08A 1CZVA 3POGA 1PO23 3FLTA 1CAWA 3DL3A 3O0WA 1ZM1A 4MGYE 1FOD3 1RVF1 5IVFA 1CONA 4HPKA 4TZDA 3T2OA 2ZGLA 4AFBA 5GZCA 5L36A 2WFF3 1COV1 1SDWA 4RS5A 1S0DA 1J59A 5I0RA 2P5BA 1ZVFA 1AL23 3LOIA 4OCTA 3RQ0A 2P2KA 4NAOA 3S6PA 2F4LA 2ZX2A 4LUMA 1W9WA 3NRUA 4KU8A 1AYM1 1J1TA 3O0XA 2XG3A 4COZA 2BOJA 2PLV2 3ABZA 1DP0A 2RJLA 5JIUA 5DQ0A 3ZXKA 3BTXA 4ATEA 4FXGB 3NNMA 3OGVA 1AR83 1FYUA 2UYBA 3AKPA 4QGNA 5GLVA 5FOBB 1OF4A 2VW0A 4BQWA 5FLJA 2HWE1 2Q1FA 4AYUA 4FTEA 3AKTA 1ULCA 4C0HA 2GP3A 3LIGA 4XMAA 2Z79A 1DDLA 4MX3A 4E4DX 4WV8A 2FZ2A 4E2GA 3HMYA 2D3SA 4DXRA 2ZX0A 1OD5A 1AX2A 4EN6B 4LLOA 5H9PA 4C1WA 4XXPA 3CIHA 5A7WA 4WZFA 1M06G 1XSQA 3AMMA 4XF9A 5F3EA 1YCIA 3CEWA 5CFDC 5IK4A 2JG9A 1AXYA 3B5LB 2CDOA 3MW4A 2R061 4AF9A 3POWA 1UX7A 1W9FA 2TEPA 1UQXA 2VQTA 4QHZA 1AX1A 1AL0G 4M00A 1CAWB 5FYTA 5KHKA 3S30A 4Z2WA 4K40A 4HPKB 3FHQA 3MBWA 2ZMLA 2DVAA 1JOBA 4CXYA 4E4HA 5FPXA 3O1SA 5C8CC 1FPN1 1J3QA 5FK8A 3W20A 3ZXGA 1NLSA 2P3YA 2LS6A 4PI2A 5BNOC 4XFFA 5F6LB 2JB8A 1X9PA 2J22A 1H30A 4AFCA 2WQ4A 2IWGB 1GNZA 3PDQA 5EJ3A 3H8UA 1GLHA 4NAMA 2X5IA 3I54A 4CCMA 1JW6A 2KM2A 3GJAA 5C3OA 1LJ7A 3HR9A 2ZBJA 2J1VA 4XFBA 1OI6A 3NVCA 4C91A 4Q4V3 4XAEA 2JEMA 3IDBB 5L9VA 2PQQA 4OHXA 1REFA 1DGWA 1WWYA 3MW2A 1RINA 4PT6A 1NCQA 4BHPA 1D7PM 5C5TA 2TUNA 5FCCA 3VGIA 4D8MA 3O1TA 4AFAA 3BTAA 4LO6B 5GLZA 2PHUA 1JU4A 1KGYA 1L7LA 2VBBA 3C7OA 5FY7A 4BCUA 2QKDA 1W9TA 1ND3B 2JDMA 3UETA 1HRI3 3AYEA 1TNRA 2W3JA 2GH8A 2VOWA 3HAGA 1ND2B 3FJSA 5JMCA 2R0FA 4YGCA 2ZZQA 3B69A 5A7WB 3T0BA 3H7JA 3USUB 3ZXLA 2RM23 4ZZ5A 5T5PA 1LHVA 1RUF1 4LQRA 1UOFA 4MGSA 1W6MA 4BYYA 2O8QA 3V0AB 1JHNA 4JQTA 3GBGA 4LNVA 4I0AA 4MOAA 1H1MA 5FYSA 4Y4YA 5JXIA 1S0CA 1IQDC 4PHZA 5GZFA 3FWEA 1WCQA 5ABJA 4W6XA 5LK5A 1OOPA 1EUTA 2XUEA 2RS33 2QZ2A 2MEV1 4YW7A 4E9KA 5C4WC 3LSDA 4COVA 1IZ3A 3CO2A 1IG3A 3GHNA 4XILA 4A41A 4LBJA 4XIOA 4NR1A 3IBMA 1TME1 4TSVA 2G9GA 2XBO3 2XL7A 1CZSA 2OZ6A 3THPA 5FPVA 4AWDA 2JICA 3OD4A 1HRV2 1C3HA 3F2ZA 1XE7A 1QJU2 1MQTA 3VBUB 1RMU2 4QD2A 1ULFA 1WLTA 1NCQB 2H0VA 2WN3A 1R083 4OLLA 1NUKA 4IEVA 4P9WA 2CU5A 5JOYA 1C4RA 2Z69A 2JKXA 1GWKA 1RUH1 3S57A 1N1SA 5D8AA 1YC61 2W0XA 1VBD2 3I4IA 3WQ7A 5A1LA 1MS9A 4XF4A 3KZ4C 3RVHA 2VMEA 4MXVA 5BNPA 2GU9A 1V9U2 1W90A 2AZ5A 4TXWA 2C5DA 3JD71 4QKDA 3WG4A 4QM9A 5IUQA 5A32B 5SV8A 4GMP1 1H6XA 3THDA 4AW7A 2NZ9A 2AGSA 1QJY2 3H3LA 4MGZE 4B8EA 1ENSA 3UT0A 3OTFA 4AZZA 1SMVA 5L19A 2UY9A 2D7FA 5HCHA 4RR3A 3NNLA 4XFCA 1POV3 1RUOA 2ET7A 2X8KA 1GYKA 1S0JA 1KDMA 3GYDA 2HWF3 1W6NB 3KS7A 1HB4A 1NCRC 2QQIA 3T2QA 5L7OA 1QJX2 2FHRA 1HB2A 1POV0 2WRAA 2ZGKA 4BPZA 5ABJB 3WT3A 3ZMOA 1PVC1 4LLFA 5DAXA 2VZQA 1R1ZA 3KV6A 5DAWA 4WVZA 2V72A 1DF0A 2E7AA 5F6KA 2FMDA 2ENRA 1W28A 4DMIA 1US3A 4PIXA 3UGFA 4Q4W1 4MUVA 2H6BA 2A6ZA 5LATA 5CBLA 3I3DA 3NAPC 3LEKA 3TNQA 1RVF3 3EO6A 3I2IA 3SISA 1AF9A 1BBT1 3UKVA 4EQVA 4Q29A 3D0SA 4XXAA 2RS51 5AC92 1COV3 3U37A 3I8TA 1UMIA 3VBHA 1D4M1 1HN0A 1GANA 3ACGA 4FT8A 4TWTA 5KHHA 4F83A 4W6YA 1UXXX 1W04A 3T1LA 4GA9A 2A6WA 1PZ9A 5FKCA 1AYM3 3BIWE 5A1AA 5AVPA 5BNNA 1QQP1 4Q4X2 5LBCA 1KFUL 4IEYA 1GP6A 4QDQA 1O4ZA 4TTGA 3AYCA 2VQUA 3INAA 1XSRA 2ZMNA 2EIDA 2ZGOA 3J8F2 3VBSA 1PGL2 5AVAA 4XF1A 1JZ7A 1LAJA 5K0UB 2WC2A 5DZEA 1RUE1 1OH4A 1QF3A 1YHFA 2BWAA 2EF6A 2WWSA 3OF1A 4KI5M 4L9BA 4OUSA 4Y26A 2HWE3 3U4SA 4OVEA 3VLBB 1BZWA 1NY72 4QQOA 3V65A 3CKHA 4K7JA 1X9TA 3ZFEC 3WP5A 3RYPA 2HEVF 4H7LA 5K8SA 2AH2A 5FZ1A 2YROA 3MDPA 1WW6A 3N3HA 5HCFA 4NVPA 1EV12 1U5XA 5I91A 4X6QB 4BM8A 2JD4A 3MIEA 3ZKYA 1ZBE2 1OH3A 4LBNA 1Q43A 4HVOA 4A42A 5JXHA 4RQPB 1AYN1 5L7OB 4D6RA 1BMV2 1UY0A 5DMYA 2ZKLA 3DGTA 4NPRA 4FFIA 3ETQA 4HFSA 5DPNA 4AVCA 2R063 2BP6A 4CP1A 1LESA 1WW4A 2ZCWA 4JV4A 3WHUA 4LKDA 3BYWA 1O3TA 4DXSA 3WF2A 5DUWA 4PDWC 4X8NA 5CG9A 3POBA 5EP9A 4Q26A 2G9FA 3DPRC 5H9SA 3HN1A 1FPN3 4ZONA 1UY1A 1WLDA 3VBHB 5GLTA 2JE7A 4KG0A 4AGVA 1JZ4A 4UF0B 5IK8A 5BY5A 1E5RA 1UO9A 3OBTA 5JOZA 2TBVA 5JI9A 5FRAA 4BB3A 1QXPA 2Y34A 2VQAA 4DEVA 1PGW1 1GNHA 2Y6JA 3POIA 3WEZA 3UL2A 4ASLA 5FZOB 2R072 3VBFB 2EALA 1CZTA 3HQXA 2JDAA 3LEGA 1SCRA 4HN0A 4BMBA 3OEBA 1QJFA 3VBOB 4COYA 5F8PA 1XNAA 2VZTA 2ZZJA 2J1EA 4IV1B 2JIJA 1UMZA 3DYMA 3B7MA 3AZXA 4SLIA 3RWNA 3B94A 2GMPA 5F5CA 2R1BA 5A3LA 3J7NA 4DUWA 2X29A 5LWBA 1NE6A 1QOSA 2R30A 4XDPA 4QX8A 4XQDA 5A3NA 1IS5A 1IGOA 4YW1A 2HWD1 3MLJA 3WF1A 2HWB2 5FIXA 4CEWC 2BPA2 3EQEA 4P9LA 2ADEA 3MLLA 3OBRA 4I0BA 5JWPA 2NM1A 1RUF3 2XJQA 4KWJA 5BNQA 3JB8A 5M0TA 1MS3A 4P5HA 1LGCA 4GWIA 4JGZB 2ZGMA 5A6XA 3H1YA 3RZZA 1HB1A 2JDNA 3AB0A 1MR5A 4JAAA 4QAWA 4O9EA 4WM7B 1OT5A 3AVSA 5DZFA 3WG3A 4Q8KA 3NV4A 1GBGA 4LMFA 3WP6A 4AQ6A 3WP3A 1L7RA 1OFNA 5KXBA 1BYHA 1RUD1 3Q8AA 1DYPA 3D5OA 4HBNA 5ANQA 3WUCA 4XMIA 2MEV3 4XOGA 4PF5A 4FFGA 1AR72 3CJIB 1HJGA 4HKWA 4IUGA 2FZ1A 5CFDA 2CGOA 2VL4A 1LEDA 3OGGA 3OUHA 4MH0E 3SHRA 5FMDA 4IEOA 2VOXA 3VZLA 2WDBA 3A21A 1JN2P 2DWRA 1TME3 1OLME 3E6BA 4QPGC 5FAXA 2DU0A 5KC5A 5IVJA 4DO0A 3CNAA 3MUY1 1AXKA 4FQ4A 2XHKA 1TVGA 5DABA 1APNA 4BQ2A 1UY3A 2HKXA 3AKRA 1PMJX 2AC1A 4A3ZA 4XW3A 1AHSA 2D3RA 5C8CA 5LK7B 1UZVA 2A3WA 3RWKX 1CJDA 1CQ9A 2RR12 3Q9OA 5A3MA 5BNOA 2DVBA 3AX4A 1RUH3 2D43A 2I07B 5FUPA 2JDZA 5FZGA 3WNXA 4AHXA 3E97A 4EYUA 1I3HA 1JZ5A 3HWJA 4L2NA 4NRQA 2XWJB 4CU6A 1NZCA 1SPPA 2TNFA 3GALA 4XUQA 2K2SA 3JD73 1B35B 4L0PA 1EPWA 4GMP3 1FATA 4B3NA 4CCEA 1LOAA 1G6NA 2BNNA 4QX0A 1IKQA 1XJAA 3I3BA 1GSLA 3C7FA 3WF4A 2YU2A 2VGDA 2W1WA 3PIJA 4GMP0 1PX4A 3IAPA 4HVRA 3K3NA 5IAVA 3SQOA 4BWOA 4NPMA 3AL5A 2Q8EA 4JDMA 3VB9A 1SLBA 3SNMA 1RXGA 1ZNPA 3VKOA 3WDWA 4P9YA 4M3CA 3ZXFA 2C26A 2EAKA 3FMGA 5A3OA 3TEYA 1H0BA 1YFYA 3A7QA 4N9IA 3OB8A 1PVC3 1GQGA 2DFBA 4P9XA 5T54A 5HI0A 1W03A 2PAKA 3FBMA 3ZYFA 2VZSA 1LULA 5G05L 2LW8A 4N8MA 1UYZA 2P37A 1GKBA 4BMEA 4UW5A 1DZQA 2FDHA 3LAGA 1GNYA 3NV1A 4S2HA 5J1XA 5FY0A 1XOYA 4LBOA 4JVAA 4Q4W3 3BU0A 4YZ2A 3WDUA 2JXAA 2MHFA 4QKNA 4CXXA 2ES3A 3HVDA 1BBT3 3ZIXA 5LBBA 1AVBA 3SKVA 4A6OA 3K48A 1OSGA 5J7MA 2RS53 1YFUA 4KH9A 1G9BA 1D4M3 5B4XA 2EXKA 3A0KA 3HPNA 4FTBA 1DGWX 5C4WA 3KF3A 1RJ8A 1Y9MA 2PYTA 4YM3A 4LK6A 3OGSA 1QQP3 1YXWA 5IK7A 2E32A 3LB9A 1JZ3A 3RG0A 1SLAA 1NX9A 1Q56A 5T3NA 1CIWA 1RHI2 1VIWB 3O0VA 2L9LA 4QQHA 1JODA 1CPMA 3O1RA 3BN6A 4JGYB 1H2NA 2DURA 4Z8BA 1IS3A 5C9AB 5KHJA 4K3UA 4Y22B 2RDQA 3J7LA 4CYDA 4AQSA 4KGQA 1Y43B 1EAH2 1RUE3 3SCGA 2HWC2 5EV7A 5KWRA 3L9JT 4YW5A 3JU9A 2Q8CA 5E8AA 1HN1A 4JQRA 3I7DA 1JYVA 4EJRA 1ULOA 3FZ3A 3JBG1 2FCTA 2Q1MA 3AMNA 1SLIA 4C0BA 4LHKA 2YB7A 3T09A 4XTMA 5CA6A 2YFZA 4BU2A 2VG9A 1Q8SA 1VAVA 3DECA 1ZZCA 1AYN3 3VZNA 1G7YA 2G1MA 1GZWA 1W2TA 4WVVA 2DCJA 1YI7A 2Q4SA 5JAXA 3AMPA 4GALA 4YVSB 1WUVA 5FY1A 1RUC2 4DOUA 3N7JA 3NMBA 4TN7A 2P4EA 2Q0AA 1J58A 4I30A 1W0PA 1QJEA 1DGRN 4GKYA 3WW3A 4Y1VA 4YM2A 3UYJA 4YNIA 1LHUA 1NZIA 4H55A 3U78A 1W0NA 5BNPC 2VW2A 4LKFA 2RJ2A 4Y5TA 4G3YC 4ZHNA 2P1BA 1GUIA 1NCRA 4F8AA 3VBRC 1ZBA2 3T08A 2ZGPA 5K7PA 3SCHA 2WZR2 2WS92 3OY8A 2D97A 3BVCA 5C4WB 2R49A 4ZXEA 4E27A 1AR62 4FPFA 3N9MA 3S5QA 3W58A 4NPLA 5CYYA 3ZDSA 3NAPA 5CU1A 5FZLA 4FVVA 4O65A 5LCWL 5IATA 1HRV1 4Y24A 1QJU1 3KGLA 5EJZB 1RMU1 1XYOA 4E8DA 4AGGA 3USSA 3ACFA 4LHLA 1SBFA 3MICA 1PK6C 5FP4A 4QQ2A 1DFQA 2YU1A 5GALA 1VBD1 1CAXA 2XB6C 4CUBA 5FYIA 5C33A 5FZDA 2JDKA 2A71A 2NMOA 1W2UA 3V0BB 1OURA 4QXBA 4A7ZA 2Z42A 1WBLA 2VNVA 2HWD3 3MIGA 4KWUA 3N9PA 1QJY1 4IE6A 1GZWB 4ZU5A 4BLIA 2JENA 1ZZ7A 3M3IA 5F5AA 3ZFEA 2RJKA 1V0AA 4GKXA 4CUCA 1AX0A 3HQRA 2EXJA 1UMHA 5JMOA 3AZWA 1NKGA 1IPKA 5LA0A 3WNLA 1QJX1 4DB5A 5BPXA 1RUD3 4UW6A 1LGBA 4YGDA 1VBA2 4CEYC 1NCRB 4MXWA 3TNPB 1FAYA 4KNCA 4URTA 4YG3A 4LIUA 2DCTA 3CL1A 3ILNA 3A23A 3ES4A 4RHV2 4D7SA 3VDDC 3H8XA 3T0AA 5BYNA 3OY8B 1CN1A 1W0OA 4E2QA 3P5BA 4K8RB 1ZZ9A 2JWPA 1VB2A 4EE2A 1GFF2 2J1AA 4XJ8A 5JCTA 2RG4A 4X6RB 1KDKA 4N53B 3GBWA 1V6MA 3DXTA 5F2WA 1W6PB 3DXUA 1MS4A 4GB32 4PDWA 1XC6A 4RN5A 3ZLIA 1URXA 4CE8A 2WIIB 4QX3A 4DUVA 1ASJ1 3KVBA 4CTEA 3DPRA 3SH5A 2FCUA 2VXRA 1NA1C 4QX2A 5I8SA 2PN5A 3LD8A 3MLKA 4AFDA 2CWMA 5IVYA 3W9AA 3T0DA 4Q4X1 4I02A 4WZCA 4QKFA 3O1OA 3KLSA 2W2IA 4JHTA 3MIDA 2HLEA 1PGL1 3J8F1 4XDOA 4K8FA 1OC1A 2VU9A 3AYDA 2ZTNA 4HKOA 2NP0A 1RYYA 1SACA 2J7MA 3VHNA 1PZ8A 2R041 2WKKA 4AEKA 4LT5A 4QX7A 3TYJA 2ZKNA 3AZZA 4BQ1A 2NMNA 2E51A 2YBSA 2GAUA 2NPIA 1NY71 3H0OA 4XE9A 4KBZA 5FPBA 3MZHA 2QFEA 5FYBA 4KMQA 4B4RA 3H42B 4DFSA 1EV11 5IVCA 2LALA 2I74A 1H2MA 4UFLA 1CPNA 3FX3A 1RL3A 1ZBE1 4SBVA 1VBB1 1KJLA 4LUKA 1ACCA 1BMV1 3TWIA 2UY8A 2JB4A 3UJOA 4YZ1A 4YVWC 4QPYA 2OIIA 3I2HA 4CEWA 3T4VA 4CDWC 5IVBA 4MYEA 3RNSA 2YPDA 1W99A 1UKRA 2Y0IA 4V1PA 3RZMA 5IWFA 1OKOA 5FMOS 3ZN5A 1X82A 3AFGA 3IB3A 4LBQD 3DKQA 1OBNA 4LOTA 5KHIA 4GULA 2RDRA 4YFZA 3WW1A 2PMWB 2A3YA 3RPQA 4GJZA 1RC6A 1GP4A 4HLTA 2DVDA 2C0ZA 5ERLA 5I8TA 5G04L 4ES9A 4L8QA 2WO7A 4CPBD 4IERA 2D6NA 4J1XA 1LENA 3AK0A 4FFHA 4MSVA 3WCSA 3E6CC 5A7SA 2ZEWA 2VZUA 3HJRA 4XJZA 2CY6A 3VZOA 2UU8A 1BVVA 1Q8OA 3OUIA 3N7MA 4IGPA 4I3GA 3BOPA 1JH5A 3KMHA 4QPGA 2VH9A 3VDBA 2JECA 3H50A 3TEXA 4JRAA 4OMCA 3ZXDA 2HBTA 1ZX5A 1JU3A 1RIRA 1UKGA 2Y6LA 3AFKA 5DDJ2 2RS11 3ZMNA 1C5IA 1HXS2 4JC1A 5CB7A 4N9HA 1HV1A 4UW4A 4ARXA 3Q8FA 5C6CA 2WWUA 3BCWA 2VOTA 3LPFA 2VJXA 2BBAA 3VV1A 3JBG3 1OVSA 1T6BX 3C2UA 4NWWA 4QPIB 4BQ4A 2JKBA 4QHOA 4CXWA 3E5UA 5BV6A 4P08A 3EXUA 1V00A 2HWB1 3CMGA 1LKNA 3FL7A 3NQHA 4D0QA 1G8WA 3AMQA 1O3SA 3HBKA 1YQCA 5FDBA 4RS5B 5LBEA 3C8XA 2W94A 1UZ0A 5GZEA 5I0UA 1GICA 3VL9A 2WFF2 3RI8A 3ZFGC 4AI8A 4CEWB 1H4HA 2HEYF 4EROA 3D82A 3JB4C 3LKJA 2XDVA 4HANA 5EJ1B 4XBNA 1SLLA 1AL22 2DUOA 4YW4A 3WDYA 5JLVA 1OUSA 5E88A 2DU1A 1JOPA 3DKWA 2J1SA 2QBXA 4DRVA 4BQ5A 4ZXKA 1F5FA 1MPXA 3AZVA 4RYDA 4CSWA 1FXZA 4A7YA 1RXFA 1JUHA 3IDAA 1AR71 1E5SA 3KV5A 4E4SA 1UYYA 1A3KA 3ZYHA 2C1FA 1DQ2A 4XIKA 3W5NA 1J1LA 4J25A 2D6LX 4LTAA 5FK7A 2Y60A 2VBDA 2WN2A 5FXZA 2PELA 5F2SA 1BXHA 1C1FA 4NOTA 4UW3A 3SH4A 5A6ZA 5FZAA 3WLUA 3CU7A 2WNEA 3KSCA 3HNBM 2PHLA 4Q4Y2 4JTNA 3ZYGA 3URFA 1ZRIA 1J84A 4EWDA 1HRV3 2HYKA 1QJU3 4B7KA 4YSFA 3H1WA 1HJFA 3LCPA 2A6XA 1RMU3 2PAMA 1GR3A 2A75A 2CAUA 3I59A 3N9NA 3WY6A 5B4NA 4CRQA 3KQRA 3M3QA 1MEC2 3SLIA 4R4XA 3N35A 1WMFA 4XF3A 4FPHA 2JG9B 2ZGRA 4BK5A 1U5YA 4EWEA 4M3CF 4KWKA 1C8M2 1VBD3 4M0NA 2E33A 3LE0A 3PTRB 1SFNA 3APBA 3OYWA 4G4FA 4UFMA 4Y3OA 3WNNA 3O1UA 2CHHA 5IW0A 5CVRA 1Y7BA 2G19A 3MEPA 1IOAA 4AE2A 5FO9B 1K45A 1RUJ2 3R6SA 1QJY3 1H2LA 2JIGA 3LDKA 2Y0OA 1Q8QA 2OQ7A 3PMSA 2VY0A 3NL1A 2QQMA 1JUIA 4ZZ8A 5HV4A 2DYCA 2WA3A 2HBUA 2PTMA 4JTOA 1Y9GA 3ORJA 4RFRB 2BQPA 3M3CA 2VUJA 2A6VA 2WA4A 2XKOA 3MV11 4FQZA 2IXKA 4FPGA 1LU2A 2BJSA 3DEMA 2X5IB 4H2AA 2GN3A 4PIYA 1QJX3 2AUYA 1GZCA 3M3EA 2XWBB 4UBHA 1H8TC 4XUOA 4NHLA 4Y1ZA 5KXEA 3QH6A 3ZVXA 1N3QA 1HQLA 3E5QA 3UKTA 1UW8A 4META 1UIJA 1GMMA 3WP4A 4PIZA 1T6GC 2VCBA 4Q4V2 4LBQA 3ZSKA 5JSPA 1OF3A 3HD8B 1FNZA 2W46A 3I2GA 3QBQA 1ZYBA 4OYUA 5C5UA 1ZRFA 2GN7A 4KWLA 1D2QA 4LIVA 2ZAAA 1LECA 2RMU2 1MS5A 1LNSA 1W9YA 4ZS2A 1TEIA 3NJZA 1ZRCA 4BISA 2VM9A 1ASJ3 4D69A 2V5DA 1V6JA 1YEWA 2QDNA 3MO4A 3WXPA 2GC2A 3ECQA 3IIIA 1MZ6A 4NO4A 3QCWA 3VBRA 3ZPYA 3N9LA 4LR4A 4MGIE 4MZUA 5FY8A 2IZWA 3C7EA 2CGPA 4IEQA 1DZTA 1VRH2 4Q4X3 5FMCA 4N43C 1QDCA 1W6MB 2QQKA 1RHI1 2BERA 2NQYA 3J8F3 4GJYA 4LHSA 2VZ1A 2EVXA 3BGAA 5JZGC 1PO12 3QOPA 2R043 2DTWA 1EAH1 2B39A 3LDBA 2HWC1 4YW3A 1UWWA 2B9VA 5TSWA 4BOWA 1OOPB 2W91A 1RUG2 2OKXA 5AFBA 4UT5A 4YW6A 2EAAA 3CQOA 1JYTA 1ZZBA 3ACHA 1VB4A 2FDFA 3Q8EA 2ID4A 5FP7A 1PK6A 1EV13 4LKSA 4QQLA 3WHTA 2GC1A 2WO2A 4Y20A 1Q8VA 1G9CA 1ZBE3 3NJYA 1VBB3 2Q8DA 3RZJA 3A22A 1HDKA 1QIQA 2ZPXA 3WNMA 3WNKA 3AZYA 3DCQA 1WKYA 2EIBA 1GWMA 1ZA7A 3KQ4B 5A3TA 1I6XA 2D6MA 2WQ8A 2PHFA 3UKNA 1F35A 1MQTB 1CIYA 3OOXA 1DYOA 1VAMA 1X33A 2D6OX 4I0WB 4MADA 5T50A 4I09A 5LRSA 4AEDC 4RGAA 2XLAA 1JXNA 3C7HA 3GHMA 4KQ7A 2OVUA 1W8HA 2Q8OA 1LHOA 1R082 3D6EA 5D8AB 2XJPA 2YHJA 1XU2A 2VECA 3M2MA 3PNAA 4QM8A 3X29B 5BNPB 1ZBA1 4ZKTB 2A5ZA 3ZSLA 2J42A 2OW4A 5ANNA 4ASMB 2WZR1 2EICA 1CX1A 2W95A 4CEYA 2VUCA 2XL9A 5FZMA 2VVEA 5FZHA 5IVVA 3VBRB 2DTYA 3B00A 2R32A 4ONUA 2W92A 3ON7A 4FPKA 3U14A 3VDDA 1YFWA 4HK8A 2EIEA 5DUVA 1GQPA 3LPGA 3MPBA 5A7PA 2XJSA 4AI2A 4RR3B 1Z78A 2F17A 2OPKA 4V2VA 1DQ5A 4FSJA 5A80A 4L99A 4NWVA 2WZ8A 3I3QA 2WBKA 1XQNA 3JQWA 4HZFA 1XNKA 3ZKUA 2RS13 4Y1XA 1AJKA 4XURA 1JZ8A 1WMEA 2BOIA 2W47A 5FPLA 4CU8A 1O91A 1NA1A 2UURA 5C3RA 2VAUA 2VNOA 4GQ7A 3SKJE 5SV5A 2W1QA 2ET1A 1UN1A 5F37A 2VW1A 1PK6B 4KBBA 4BJ0A 1OD3A 4W65A 1JYIA 2WT1A 3IDEA 3AP5A 4XJAA 3J9SA 4J1WA 4NUBA 2VZRA 2HWB3 4FPYA 4XFGA 3I49A 2OQ6A 3VHRA 1WW5A 2XXZA 2QQUA 3BALA 2YUEA 3KD4A 4U36A 1RUI2 2GALA 3EMRA 3RI9A 3E6DA 2B7YA 1ULDA 4D7TA 4XCAA 2J1UA 4AQTA 4NRPA 5BNNB 2NN8A 5HCBA 2FDJA 4XBQA 4YLZA 4PCRA 1X8MA 4GH4C 4HMZA 4KL1A 3PUHA 3VBSB 1XU1A 2YZ4A 3N7LA 1A8DA 2W5FA 3P1IA 4IL7A 2OYZA 5AFEA 1AR73 3LOBA 2ERFA 1PNGA 4RHV1 5CFCC 3I2FA 4YVWA 3OG2A 1K5MC 2PHDA 2WUHA 5HBAA 2GMMA 4CDWA 4XEZA 1XE8A 2QDRA 5J09A 1S2KA 2BGOA 3GGLA 4D6SA 2UYAA 1CWPA 1XXNA 4GB31 1CR7A 4XJWA 4P5YA 2YMZA 5FMBA 3UGGA 1XNDA 1OFSA 2K46A 3NWKA 3OBZA 4FP3A 2P3IA 1N3OA 2XVKA 3DYPA 1TE1B 4AAXA 1UAIA 2VE1A 5EHDA 1TMF1 5KXDA 1NA1B 1IPSA 3MF6A 1IKPA 5FPZA 3SMHA 1W8UA 2B9UA 1UCXA 2WAOA 2DUQA 2Y33A 3BPZA 4Q27A 3WQ0A 1FMD2 3O1MA 4YGEA 3IM0A 4DNYA 2VR4A 1VBE2 1SFPA 1N1TA 3IDCB 3L2YA 4QGLA 5LBFA 2CYFA 4KU7A 2O14A 4KGGA 5FYVA 4AVTA 3IT8A 4BLJA 1W06A 2ZGNA 2D98A 3WDXA 4CZSA 4J6GA 1U5IA 4YM0A 3E5XA 3D8CA 4FPOB 3VD5A 4UXAA 2IXHA 1XB9A 4IETA 4Q1PA 4XZUG 1YQ6A 3AP9A 1GV9A 4IV3C 4R9BA 2XHNA 1FPN2 1US2A 2HEWF 4IEWA 2D3PA 2LRPA 3OGRA 1O5UA 1FT9A 2ZEZA 1F8VA 3KCYA 1W8OA 1CJPA 1OPOA 4OZXA 3U75A 4EV0A 5GLWA 4YARA 1N1VA 2XLFA 3VKNA 3WQBA 5FPUA 5F7UA 4FP2A 3KHBA 2DVFA 2JE9A 3A4UA 4FPLA 5A3PA 5C9AC 5A6QA 1WCDJ 1JZ6A 5IK5A 3RZHA 5CKQA 4NIGA 3POYA 4LO7A 4BIOA 2O1QA 4CCCA 5C3PA 2EIGA 4CDUC 1D0GA 4YVWB 3W21A 3ZFGA 1RUNA 1DCSA 3M1HA 2PLV1 3HOBA 2QNKA 2WINB 3AP7A 3NKTA 1ND3C 4CDWB 2BNOA 1LGNA 1NXMA 3KHCA 3VKMA 2CSGA 3VD4A 1W6OA 1ENRA 1ND2C 2GC3A 3MW3A 3PTYA 1BQPA 3ME2A 2W87A 4LA3A 1ZRDA 1KFXL 3GM8A 3RRDA 2EXIA 5FBZA 1HQNA 1IQAA 4AG4A 2XVLA 3GCXA 4BIFA 4DXZA 4BK4A 5A1FA 4AI0A 1UD1A 3PL0A 4NJ4A 3ATGA 1RHI3 1YYNA 4M3CE 2WSUA 1MS1A 2Q5TA 4BA6A 4BQ3A 2J1RA 5DAQA 4LK7A 4XHXA 5FZEA 4DXTA 1YQ2A 1UOBA 2VZ3A 3HBZA 3SXWA 3U1XA 3O14A 1MVQA 4YRDA 4NIIA 1EAH3 4XUPA 3KVAA 2HWC3 5I0TA 1HXS1 2LTNA 2VBPA 5FO8B 1C5HA 2ZX1A 4Q0QA 1JZ2A 2DVGA 2BNMA 1A6CA 2KD7A 3QH7A 5FZ8A 1YJLA 3PUAA 3ZFFC 5I0DA 5CFDB 1C57A 2MEV2 3ZN4A 1YQ8A 1D2SA 5FZ7A 4OUEA 1QY4A 4DEQA 3IAQA 2RDSA 3KB5A 3MV01 4XJUA 5A3UA 1H6YA 3R0RA 5IJRA 5LASA 1L7QA 1LOFC 4AI9A 2PHRA 4F3JA 1DLCA 2V5YA 4AVSA 4LEJA 1LOGA 2V4VA 4QGMA 3VBUC 3VN4A 1I5ZA 4HSLA 3ROUA 2GP5A 5C8CB 4P9IA 4NMIA 4R9AA 5DAPA 4MVTA 1MZEA 4XUNA 2Y8KA 5BNOB 3RJRA 3ZN6A 4LO5B 2XUMA 4D94A 2WR9A 5DUUA 2PA7A 4CDQC 4IE4A 1RUH2 3FFQA 3LF7A 2XONA 3I3EA 4FO9A 1SPPB 4DZGA 3HQUA 1ZBA3 1H8TA 4OMDA 1UU6A 5CADA 4OHYA 2IXLA 2WZR3 2JJ6A 2CDPA 4ARYA 1JYCA 3JD72 5ACA2 2VZPA 2VXJA 2Y26A 1OA4A 1MS8A 1WMXA 2X05A 1T2XA 2GNBA 1SHWB 2R0HA 4BE3A 5FJHA 4DRRA 5F39A 3I3MA 3ZSEA 4Q4Y1 1CAUA 4U2AA 1VLNA 4LORA 4JHZA 1QOOA 4XYXA 3ZR5A 4OHVA 1JMUB 5CKNA 4MGQA 4IE7A 1NQJA 4JKKA 4P00B 4M3CB 5JOXA 1CX4A 3DN7A 1N3PA 2F4PA 4IEPA 3UJQA 1J83A 1MEC1 2V4AA 1F15A 3P3NA 2WZPP 1YNAA 1YRZA 5CNAA 4W8JA 3GJBA 4AVBA 1S0EA 3ILRA 1AZDA 1C8M1 4CUGA 5LEJA 3ZYRA 1Y3TA 2WAAA 2XH6A 3CZJA 2ZHKA 2I2SA 3ACIA 3ZPOA 4N43A 4MGKE 1BEV2 3LEMA 5DAVA 1W8TA 1MACA 3VHPA 5IVEA 4Q4W2 1PM7A 4K9SA 2XJTA 3R4UA 1RUJ1 3IIAA 1EUUA 4URAA 5JZGA 4OI4A 5FXXA 1Y9QA 3MF9A 1BBT2 1CAVA 3AC0A 4DS0A 2BFUS 3PUQA 4ATFA 4IQPA 2D40A 4NRMA 4BDVB 1ZZ8A 1ULEA 4XTPA 4HETA 1X50A 1QDOA 1UX6A 4JCKA 4QQPA 2ILMA 3LIHA 4QMAA 4AHZA 3GBFA 2Q30A 5FUNA 1DQ6A 1S0BA 1K42A 1KXGA 2GSYA 3ZN6B 1ALYA 3EYPA 3O12A 4RSUA 5H9RA 5BUVA 5GJ6A 1F31A 3UV9A 1S55A 3LGRA 4EZHA 2BRTA 5IFPA 2A3XA 4NIHA 1BHGA 5K0UC 2FDKA 4M0HA 1H8TB 4RHV3 1BK0A 2VNRA 2VZOA 1S0IA 4AEMA 4HONA 2YDEA 1JI6A 2P3JA 2XOMA 3R4SA 3WDTA 1RUE2 1YLLA 1OQEA 4D7YA 3BKZA 3IPVA 1AR92 1PIV2 5LA2A 1H9PA 3J7MA 2QCSB 4CDXC 5FZFA 5JI7A 4AEDA 3LA7A 3VD9A 2QQNA 2RMU1 3S0MA 2B5HA 2ZEYA 1LOEA 1CAUB 3IMNA 1NE4A 5D1IA 4GB33 2VO5A 2YBPA 3CZUA 5F3GA 1V9U1 2I45A 5FZ6A 1YJKA 5GM0A 2YG0A 1W3XA 4RQPC 3DV8A 5FREA 5FZ9A 2ZHLA 4RL7A 5KC6A 5T52A 3MHZA 3FHIB 5A33A 1TMF3 1QJZA 1VRH1 2NYYA 4RGKA 1OA3A 2RDNA 3W5MA 1ONAA 3I97A 3R05A 3CHXA 1UZYA 3M4FA 3ZXAC 2PXJA 5JUVA 4TYSA 2JX9A 2Y38A 1IS6A 3VKLA 4OFGA 4Z82A 4N43B 3WR0A 3ZYPA 4XACA 3K46A 1PO11 2WT0A 3TEZA 3V64A 1H1IA 2XJRA 1H1AA 2A7AA 5FPAA 1RUG1 2C9KA 3N9OA 4AVAA 3MI8A 1WA4A 2DCKA 2FQPA 4GXLA 1MZFA 2XQRA 3QLQA 3AVRA 1OXCA 1S1AA 2BGCA 2DV9A 2R6QA 2ZMKA 4L11A 5F5QA 2CL2A 2SBAA 3TN92 3HT1A 4COUA 2F6BA 1QXJA 4H3WA 2ZABA 1RJ7A 4LE3A 4QX1A 4IEUA 4ZU7A 1F9KA 3NAPB 1R1A2 3MFAA 2R16A 4OUMA 5AC91 3NNGA 3Q8CA 3HT2A 3VBFC 5J3UA 1O8SA 1PGW2 4H14A 4QDSA 3VBOC 1YIFA 4B1MA 5GZDA 1LCLA 5CAZA 4DIQA 1PX3A 2WT2A 5FYMA 4XCBA 4IV1C 4HT1T 5JR7B 2PLV3 2WWJA 2VMCA 3IPVB 5ISLA 1O59A 4KG8A 4XUTA 3MIFA 3RYKA 4AHYA 1VMHA 1VE0A 1CAXB 1IPJA 1I1EA 4UAPA 4OQ8A 3QACA 1V6KA 5FTTC 3ZXEA 5JOWA 2J1TA 1TG7A 4GH4A 1IG0A 1EYBA 3EHKA 1H8VA 1JS9A 1JTZX 3OPTA 3GZAA 4G9SB 1JYNA 1CGPA 1W2OA 1MVEA 1ENQA 2QQLA 4PI0A 3SEEA 3AXEA 5CFCA 3UGHA 2IXJA 3JQXA 2VULA 2IC1A 3AXDA 4JGZC 3TBDA 3GF6A 2WQZC 3ZFEB 1K5MA 5F9TA 2WO1A 4A44A 4LO4B 4XFAA 4INDA 2XJUA 4WM7C 2R7EB 2QQVA 2X53S 1WA6X 5JR2A 1Z7S2 5EYYA 1HIXA 1UZWA 4CCJA 4AK3A 1JOJA 3WVJA 1W2AX 5JXJA 1HXS3 4LE4A 5FY4A 3W59A 5IYYA 3CJIC 2BVVA 4MXWB 1K5JA 3T30A 3IKWA 1E57A 2GNDA 3AKSA 1I5PA 5FZKA 1XNBA 3HEIA 4ZPIA 4LULA 3MIBA 1XNTA 4UYBA 2XR4A 5F3IA 1UPIA 2A6YA 2D44A 1DGLA 4QB1A 3H8OA 3LSEA 2CTVA 3H3UA 4CP9A 5J36A 3KM5A 1W9SA 4ISRA 5J98B 3FLPA 3TOJA 4PDWB 4ES8A 4PBPA 3S5AA 3TRSB 2WFPA 2Z2SB 4QXHA 5C71A 1RUI1 3KCCA 5FWJA 3DPRB 2B8MA 2P3KA 3SH3A 4D6QA 4FAGA 3BTZA 3BODA 4IV3A 3HNYM 4BZ4A 1K12A 3I2OA 2QQPA 1HV0A 2GMEA 1SDDB 2N7GA 5CISA 4QXKA 4Y4RA 5FZIA 2QZ3A 4OI1A 4AEJA 5JSRA 2LM3A 1DIWA 2VOKA 4HL0A 1WLCA 4S2GA 5FZ4A 5DG2A 2OS2A 5J37A 2R071 1TQ5A 3L2HA 3M8LA 4QPWA 4MGTA 2JG8C 4XPVA 4GH4B 1B35C 5FWEA 2VTXA 5C9AA 5EPAA 3ZYBA 4S2FA 4A2UA 1ULGA 4DQAA 1I9RA 1SG3A 2SLIA 4AGRA 4YZ5A 1R092 1NXD1 1DQ4A 5C70A 2RVAA 4GWNA 1SFYA 2Y64A 5LRRA 3GCWA 5CFCB 1VBC2 3OD0A 4CCNA 4CDUA 1GOFA 3H7YA 1XRUA 3M70A 3OPWA 4D3WA 4OHWA 3RJ2X 1K5MB 4Q4Y3 3TAYA 1OPMA 1UPSA 1MZ5A 2WYFA 1ND3A 3I2DA 1W8FA 3GZUC 3T3YA 4YFWA 2KXLA 2D93A 2E53A 2PHTA 1PO22 4EZ4A 5HXVA 1F5JA 2BEOA 1ND2A 1MEC3 1FOD2 1PMIA 3WNPA 5E6HA 5IAXA 2WJSA 4PLMA 3USUA 5FUIA 2GH2A 3ZYIB 4WM8C 1UU4A 4NHMA 1C8M3 3LWCA 3CDZB 1VPHA 1FMD1 3NNFA 3RSJA 1F4HA 5JSOA 1VBE1 3V0AA 2B4KA 3B02A 3I2JA 4ORFA 1V6OA 2C4XA 2PFWA 4CP9B 3O1VA 2A70A 5EQUA 5FLHA 1RUJ3 3OGJA 4CUAA 5FQ0A 5I93A 1XE0A 3KV9A 2ORXA 3PVOA 3BI3A 4AAPA 1GOGA 5FYZA 2JDYA 1S0GA 2BTVC 4HVQA 1AR82 3WUDA 4EN0A 1A78A 3GDBA 3OCPA 2VZVA 3WW4A 3ZFFA 1KEXA 3H8RA 4W50A 4IV3B 4PLNA 4QT6A 1BKZA 4QXCA 2W68A 4Y33A 4QHBA 1ODNA 2WNVC 1OVPA 1LR5A 1ZZ6A 1G9AA 1ZA4A 4O7XA 3VKFC 3WG1A 4JGYC 3FUOA 4QPGB 5FMOL 2QE3A 4P9JA 5DXDA 3WF3A 2BBVA 2WNUC 2VD7A 1J3PA 2JD9A 3BIEA 2Z4FA 3T2PA 3AMHA 1LOFA 4XFHA 1EP0A 2FDGA 1YO8A 2RR11 4Q2FA 5FO7B 1SLTA 5JVVA 4WVMA 3VBUA 1H9WA 1XPWA 2DCZA 3U07A 4CDUB 3H1MA 4GWMA 3KT1A 3P3PA 4BQYA 1O5LA 2RMU3 4A4AA 1FX5A 2IVIB 3S7IA 2W9XA 5CIRA 2JDPA 4HK9A 3D4KA 1DZRA 1PNFA 1V9U3 3JBG2 3FFZA 2WSVA 4QB6A 4NIAA 4A3XA 3H3ZA 4CDQA 4XFIA 2XQXA 3RGBA 2LROA 4R4ZA 4N90A 2X10A 1HX6A 2AEZA 1NLQA 3O7OA 2WLQA 5A32A 4YVSC 1WD4A 4ZU4A 1VRH3 5FYCA 3RZKA 3HNMA 1BJQA 3AJZA 4FOQA 5JPNB 2QJVA 3QD6A 4IGOA 4ZS3A 2VCCA 2MPFA 4Q0VA 1PO13 4Q8LA 4MHRA 2JDHA 3ACLA 5T5JA 1LRHA 4I3PA 3ZO0B 5FQ0B 1W6NA 1C28A 4N7UA 1Q3EA 1RUG3 4PLOA 3KWVA 3B93A 4XQWA 4UFHA 4XABA 3U4XA 1VJ2A 1OMIA 4O61A 1KS5A 2OXBA 4BQXA 2D6KA 2OA2A 4HN1A 2DFCA 3GZEA 3IN9A 3ZFFB 4XAAA 3SITA 4QX5A 3K3OA 2ZHMA 4F7ZA 1PHMA 5FY5A 1KS4A 1SEFA 4QU1A 5CEHA 1XYPA 4QU2A 5HPOA 2WLPA 4CPBA 4CCKA 5AC93 1G9DA 2VVDA 3CJXA 3WQ1A 4Z92B 1HRI2 3PIGA 1DBNA 4P14A 1RTVA 4FAHA 1HLCA 2BDRA 3I59B 3CLPA 5A70A 4NN0A 2ZHNA 5EXOA 3ZIWA 2DCYA 2AYHA 4C1XA 1O4YA 4WVMB 3VDAA 3T1MA 5BXXA 2RM22 1SZBA 1VR3A 1R64A 2XMLA 3ALQA 5F3CA 1GQHA 1ENXA 2R1DA 3OYWB 1VRBA 5GKAC 4FBFA 3D0JA 3ELNA 4YM1A 5GZGA 2ATFA 4L92A 1JYXA 2YC2A 3MFCA 4CDQB 3F95A 1QH7A 3K4ZA 5L9RA 3VL8A 5K0UA 5ACA1 1WZXA 2YPJA 2W39A 1AXZA 4MO3M 3THTA 2RS32 1LHNA 1FNYA 3IWZA 2FD8A 4A6SA 3RZLA 2ARAA 3VZJA 4CDXA 3K2OA 3VHOA 4OULA 1EY2A 4XF0A 5FYUA 4V2WA 3PVEA 1E5HA 3RMXA 2A1XA 4LA2A 3MPPG 2DUPA 2XBO2 5KR7A 2CGNA 5LW9A 4HXCA 4RQPA 4AI1A 3UNPA 5DG1A 4IXLA 1RUC1 2HH9A 3BB6A 4BXSV 1OQ1A 1SBEA 2GZWA 5LA1A 2YFUA 4LBQB 1Q8PA 5EYXA 5FBJA 1BEV1 4FXKB 4TLFA 2VOVA 4R8HA 4XC9A 3J4UH 4ITCA 1H2KA 3ENRA 4C8DA 3U0ZA 4N53C 1YI9A 3FBYA 1W8ZA 4NROA 3N36A 4UFJA 4FI9A 2QVSB 3AP4A 1SBDA 2ADDA 2ZGQA 4AXOA 3UK9A 1RUI3 3U10A 1W2NA 5F5IA 5JIAA 2PQSA 2WS91 4JKLA 5T5LA 1AR61 1ASJ2 1PZ7A 4UF0A 4AI3A 4M4RA 3PUIA 4B4PA 1NYWA 4LKEA 3HIFA 1AJOA 1OLRA 3LQCA 3B3QE 3MUZ1 4FOYA 3TB0A 1LODA 2V73A 4Q1RA 1ST8A 2R073 2Q1ZB 2PHWA 3THCA 4DPNA 1QOTA 4RFT0 1DLLA 1PGSA 2AACA 3K77A 4UWDA 5FZOA 3VBFA 3GNEA 1WGPA 1OLQA 2HWF2 3LA3A 4UFKA 2R042 1VMJA 2ZJCA 3VBOA 1G86A 1U12A 2JE8A 1AR91 1PIV1 3WOGA 5EIYB 1NOVA 3VZMA 2W52A 3A0NA 4HG6B 1VAKA 4IV1A 3BTYA 4IE0A 2IXCA 4A7KA 2B45X 2ZGSA 4CDXB 5FZCA 4Y20B 3IZOA 2JDUA 5A7QA 3DUIA 1G9FA 1EPZA 2VC9A 4IEZA 2ETEA 1W8WA 4LJHA 1RVF2 4ZY9A 3SEPA 4NE9A 5FXVA 4AHWA 1VBB2 2VCMA 3AKQA 4PF1A 3KT4A 4QB2A 1BLZA 2VPVA 4YW2A 2HJIA 4ET7A 1COV2 2DBIA 2GNMA 4YYOA 1ZREA 3PU3A 1FMD3 2BWCA 2HYXA 2AR6A 2W1SA 1UXZA 2YGMA 2VMFA 3JCIA 1LOBA 3POEA 4JGZA 1H4GA 1VBE3 2UWAA 4XZPA 5F32A 4B4QA 2ARXA 5EZWA 4Z1VA 3AL6A 4M01A 1P8JA 1WBFA 3R4DB 2KA3A 1UOGA 2BVBA 2AREA 1AYM2 4WM7A 2D6PA 3D3AA 3K4DA 1D4VB 1HB3A 1VBA1 2XPJA 1W6QA 2C24A 4IEXA 5LY1A 4Z07A 3ZYJB 4BXFA 2XLGA 3B9CA 3PJYA 1SQ4A 3CJIA 4CEYB 2Y6FA 4GWJA 4NHYA 5FP8A 3TN91 3WF0A 1BCXA 1Y4WA 4OI0A 2VNGA 3WSOA 3VDDB 2HWE2 3CBNA 3H9AA 3NV2A 3WDVA 1MS0A 3WINE 4UBGA 5C7GA 2ZAHA 1R1A1 3KV4A 1POQA 3PLQA 1HQWA 3VUOA 1UIKA 2IVJA 2X09A 1QNWA 1PMHX 1DYKA 5J48A 3B9IA 1PM4A 2OPWA 4YZ4A 4H7MA 4B1LA 1UL9A 4IGQA 2GC0A 4Q0PA 4Q0SA 1O7FA 2RR13 3RZGA 2FCVA 4JKMA 2BZDA 4B7EA 3G6JB 2E6VA 1S4CA 2RS12 4W4ZA 1XBFA 3EJKA 4QPIC 2VUAA 5LEKA 3NO8A 3FHAA 2R062 3RS6A 4LHNA 2O8OA 3ZX7A 1O3QA 2AEYA 1BVP1 4LXLA 5T55A 5T5OA 1C1LA 4C90A 5C3QA 1RB8G 2AENA 2JG8A 2CNAA 1YWKA 3B01A 1B35A 4JDOA 4K1YA 5DN2A 4Q0UA 4RS5C 1LOCA 1Q5OA 2OUJA 4YGBA 3ZR6A 5IT6A 1RGSA 2XGXA 1FV2A 3MIHA 3NJVA 4E2SA 4RGGA 3AJYA 4X8PA 1TNFA 1F2NA 2ZS6B 1W8NA 2E9QA 1Z7S1 1W05A 3VD7A 3ZDVA 1LB2A 4OQ9A 4CU7A 2VTFA 4DY5A 1KQRA 2QUOA 2FBEA 5FY9A 5FZ0A 4AVVA 1AUYA 4LOSA 2Y6HA 1W6QB 2LUWA 3LZZA 5J96B 5FR3A 3BU7A 5F1RA 4DY3A 3ZSMA 2B46X 4E4ZA 2ORZA 4LBMA 4OHZA 4MLOA 4Q5OA 4CU9A 4WM8A 1J3RA 1GZTA 4OZOA 4FPCA 4FTSA 1CESA 1KD7A 1UY2A 1V6IA 3NV3A 1L3JA 3I2KA 3ZOIA 2DBNA 1O8PA 4YWAA 5FP3A 3ST7A 4HKLA 1X36A 3VDCA 1BK1A 2RE9A 1O4TA 2O0OA 1K3IA 1SCSA 3S7EA 5HV0A 5JXGA 3LDRA 1OLMA 4Y1YA 1DQ1A 1XYNA 2DDUA 2ZA9A 4I01A 2JG9C 1IHMA 4B29A 4CVUA 3T4HB 2W1UA 1RUF2 1KJRA 4K21A 2FDIA 2VQ0A 4K6BA 4JRLA 2WNVA 4YPJA 1OKQA 3KT7A 2UWBA 3PURA 1GU3A 2PHXA 4JGYA 1QNYA 5FP9A 2P6HA 4UOJA 5DDJ1 4Y22A 2WNUA 1REDA 1R091 2YC0A 4I2OA 2JG8B 3FE5A 3JXSA 3Q8BA 5ACA3 1QEXA 5I8YA 1VBC1 4HSJA 2QQJA 1YIPA 2XVGA 2VVFA 3OJBA 4XETA 5A7NA 3LFIA 3AP6A 1PVXA 4GAZA 3K75B 2E7TA 3WG2A 2WO3A 5FV3A 1U5ZA 2B42B 2X5IC 4DINB 1PO21 3RMYA 1QH6A 1DGRA 2YXSA 5HCAA 5KXCA 1TME2 2OX0A 2P6CA 5A6YA 1FOD1 1GWLA 2IFRA 4LO8A 5LZ6A 1S0FA 3RFRA 1RUC3 4W6WA 2WFF1 4YG6A 2CV6A 3VZKA 2ZEXA 3TEWA 1B09A 1NCQC 3C3VA 3WX5A 4YVSA 1RITA 5L9BA 2G9ZA 4R52A 1QMJA 4MG2A 3ZFGB 3EB7A 1AL21 1LHWA 3BPSA 3IMMA 1BEV3 3N7KA 4PQQA 4QWNA 4WM8B 2VUDA 4TLGA 4YZ3A 1N1YA 2G4IA 3WV6A 1UF2C 4O9GA 3AM2A 2GDFA 3HN3A 5FYHA 1VMFA 2A73B 2C6SA 3PHMA 4FPEA 1W6OB 3T2TA 4DUXA 1U0AA 5HXMA 3NNJA 2E63A 5IFTA 4OI2A 2ZOEB 3RYRA 2QQWA 1M4WA 1QWRA 2D5HA 1AR81 2WS93 1QXRA 1AR63 3PUSA 3LA2A 5FKBA 4JDNA 5D21A 3KF5A 3FUQA 1YFXA 4PQ9A 5CG8A 1WMDA 2P34A 4FCAA 5FLIA 5K4LA 1GZ9A 4XQ4A 3PVNA 1V70A 2WNVB 3RDIA 2H0BA 2Y6KA 3AYAA 4IE5A 4LPLA 4N7IA 5FYYA 3ASIA 2FMYA 5ABJC 1JBCA 4JX0A 4YG0A 1OOPC 2WNUB 3OSDA 1C8NA 1NG0A 4XDQA 4AL9A 2K0GA 4Z2AA 2PAEA 3ES1A 4R9CA 2OZJA 3O1PA 1KITA 1AR93 1PIV3 5LB6A 1DHKB 2ZACA 2YV8A 1PVC2 3SC7X 1NLRA 1Z0HA 4LITA 2WL1A 4NHKA 2VMDA 5KBFA 3J26N 2IXIA 2YBKA 2VMHA 3PMEA 1WLWA 1HKDA 4ISQA 1LTEA 2Z5WA 3G7DA 4UI9L 5JPMB 3V0BA 5D2AA 4A45A 3U11A 2YC4A 4CCDA 3ETPA 4HOOA 2BU9A 5C8WA 4EWAA 3WZ1A 2IFWA 4P9GA 5FJKA 1MQTC 2RS52 3DF0A 4IW3A 4AQ2A 1NQDA 1S2EA 5B2GB 2WNOA 4CCLA 1D4M2 2ZX3A 4GZ9A 2YY1A 3FN9A 5FXWA 2QQOA 4XHBA 1UY4A 2C9AA 1TZOA 3K4AA 3OUJA 5D8AC 2Y6GA 5A7OA 1GP5A 4UFIA 4AFMA 4K20A 1LU1A 1QQP2 4Y5Z0 2BYVE 1E5IA 1XNCA 1VBA3 2QTWB 2OUHA 2XKPA 3ZSJA 4NIDA 4RA0A 1QKQA 1NAEA 3M3OA 4MV2A 5LA9A 2BUKA 4Q4V1 4E8CA 2RV9A 1LEMA 3KGZA 4MHUA 3TN93 1WD3A 1NT0A 5CKMA 3GZTB 1X7NA 4AOCA 1CD3G 4RR3C 1YQ5A 2ZXQA 3ZXJA 3GXUA 1R1A3 3C7GA 1HRI1 3NKGA 4P02B 4N53A 5GLUA 2EXHA 4EN8B 3SCFA 1W6PA 5JDBA 5L7OC 4PBOA 5CZKA 4AR2A 1A34A
chains in the Genus database with same CATH topology
3UESA 1UY3A 2WQ8A 3OBAA 5FUIA 1PMJX 4A3ZA 1CIYA 2E31A 1DYOA 4MADA 3CDZB 1F4HA 3C7HA 2B4KA 3NJXA 3I2JA 1JHJA 2C4XA 1JZ5A 4CU6A 4CUAA 2ORXA 4XUQA 1GOGA 4L0PA 2EICA 3J7HA 1CX1A 2W95A 2VCAA 4QX0A 3GDBA 3OEAA 3I3BA 2VZVA 3C7FA 3WF4A 1KEXA 2W92A 4W50A 2W1WA 1PX4A 2EIEA 3IAPA 1GQPA 3LPGA 4QDRA 3P6BA 1ULPA 3VD3A 3WF3A 2WZ8A 2WBKA 2JD9A 2C26A 2Z4FA 1GOHA 3T2PA 3A7QA 3OB8A 4XURA 1JZ8A 1JYWA 1UYXA 2W47A 2WZEA 4M4PA 4CU8A 2VZSA 5G05L 2LW8A 1UYZA 1XPWA 3SKJE 2W1QA 1GNYA 5J1XA 4A4AA 5IHRA 3DYOA 2W9XA 4BJ0A 1OD3A 3WNOA 4QB6A 2BGPA 3SKVA 4A6OA 2VZRA 4XVHA 2XQXA 2X10A 5B4XA 3HPNA 3LEIA 3HNMA 3ZM8A 2WABA 2J1UA 2WYSA 3E1F1 3OGSA 2VCCA 2E32A 1JZ3A 1NX9A 2L9LA 3BN6A 2E26A 3PUHA 3P1IA 2W5FA 3I2FA 3OG2A 1F4AA 1HN1A 2WUHA 1JYVA 1ULOA 2BGOA 3GGLA 1CZVA 2YB7A 3WNPA 3T09A 5HPOA 2YFZA 4P5YA 3T2OA 3DECA 4AAXA 3DYPA 2DCJA 3VDAA 2WAOA 1W9WA 1R64A 3NRUA 3ABZA 2VR4A 1DP0A 5DQ0A 1W0NA 1JYXA 2RJ2A 2YC2A 3OGVA 3K4ZA 3VD5A 1GUIA 1OF4A 4XZUG 3T08A 4MO3M 2XHNA 1US2A 4ZXEA 3OGRA 2ZEZA 1WKYA 1W8OA 5CYYA 3WQBA 5F7UA 5LCWL 4DXRA 1JZ6A 3CIHA 3UNPA 5EJZB 4E8DA 4BXSV 5LA1A 2YFUA 3ACFA 2CDOA 3HOBA 1UX7A 4CUBA 2VQTA 3VD4A 4FI9A 2W87A 3FHQA 3MBWA 4KWUA 3GM8A 2PQSA 4JKLA 4AG4A 4BK4A 4M4RA 2LS6A 3PUIA 4CUCA 3LQCA 3MUZ1 2J22A 1UMHA 5JMOA 2J1RA 1NKGA 4DXTA 1YQ2A 3THCA 2VZ3A 5LA0A 3WNLA 4XUPA 3K77A 2J1VA 1JZ2A 2KD7A 4PT6A 2JE8A 3A23A 1D7PM 5I0DA 3T0AA 4D8MA 4HG6B 4OUEA 1JU4A 1KGYA 3C7OA 4DEQA 3IAQA 3MV01 1W9TA 1H6YA 3UETA 2J1AA 2W3JA 5IJRA 1L7QA 2VC9A 1XC6A 4RN5A 4ZY9A 3SEPA 1DLCA 4QX3A 4DUVA 4PF1A 4QB2A 2V4VA 3T0BA 4ZZ5A 4QX2A 4ET7A 3T0DA 2HYXA 2W1SA 4LQRA 5EJ1B 1UXZA 4MGSA 2VMFA 4XUNA 2Y8KA 1P8JA 2HLEA 4MOAA 3D3AA 3K4DA 5JXIA 1RYYA 2XONA 3I3EA 2J7MA 1IQDC 4OMDA 1WCQA 1EUTA 2CDPA 4ARYA 4GWJA 2VZPA 3WF0A 2X05A 1T2XA 1SHWB 3WSOA 4KMQA 4A41A 5C7GA 4JHZA 1CZSA 2X09A 4MGQA 1PMHX 4JKKA 4P00B 1J83A 3F2ZA 4W8JA 3I2HA 4JKMA 2BZDA 4W4ZA 2WN3A 1NUKA 2WAAA 3CZJA 1W99A 3ACIA 2JKXA 3FHAA 3IB3A 1EUUA 2VMEA 5DN2A 4TXWA 3AC0A 5G04L 1H6XA 3THDA 4BDVB 3NJVA 2ZEWA 1W8NA 2VZUA 3HJRA 1K42A 3VD7A 3EYPA 4CU7A 2VTFA 3VDBA 5IFPA 4OMCA 3T2QA 1BHGA 2QQIA 2Y6HA 1JU3A 2Y6LA 2VZOA 2VZQA 2ORZA 1JI6A 2XOMA 4CU9A 2V72A 4ARXA 4OZOA 2VOTA 3LPFA 2VJXA 5LA2A 2BBAA 1UY2A 1US3A 3VD9A 3I2KA 2QQNA 1O8PA 2ZEYA 3I3DA 3VDCA 3LEKA 2VO5A 3CZUA 3I2IA 4P08A 2YG0A 1K3IA 3CMGA 5JXGA 3FL7A 3NQHA 4D0QA 3U37A 1UMIA 2DDUA 3ACGA 3C8XA 2W94A 1UZ0A 3W5MA 1UXXX 4CVUA 3I97A 2W1UA 5JUVA 5A1AA 4YPJA 3K46A 2J1SA 4QDQA 4TTGA 2QBXA 1GU3A 2VQUA 2EIDA 4UOJA 1MPXA 4RYDA 3IDAA 3JXSA 2C9KA 1JZ7A 1UYYA 1OH4A 2DCKA 4KI5M 3W5NA 2QQJA 3CKHA 2WN2A 3K75B 4QX1A 2WO3A 3HNBM 3NNGA 1J84A 1O8SA 4A42A 5JXHA 4QDSA 5EIYB 1UY0A 5B4NA 2ZEXA 5DMYA 1PX3A 3EB7A 4PQQA 5DPNA 4BK5A 2VMCA 1O59A 4XUTA 2E33A 3LE0A 3WNNA 3HN3A 4UAPA 4DUXA 4DXSA 3WF2A 2J1TA 5IFTA 1TG7A 5HXMA 1JYNA 1K45A 2QQLA 3SEEA 1UY1A 1JZ4A 2QQMA 4ZZ8A 2WO1A 4A44A 2R7EB 5JR2A 3MV11 4DEVA 2Y6KA 4LPLA 4XUOA 2Y6JA 3WEZA 5JXJA 4JX0A 1CZTA 2JDAA 4Z2AA 3LEGA 5IYYA 3OEBA 1GMMA 1I5PA 3HEIA 2VCBA 1XNAA 1OF3A 2VZTA 3I2GA 2W46A 2J1EA 4OYUA 1XNTA 2VMDA 3DYMA 4QB1A 4UI9L 1W9SA 4DUWA 1LNSA 4A45A 2YC4A 3ETPA 2VM9A 5C71A 3WF1A 2V5DA 3MO4A 3ECQA 3IIIA 3C7EA 4GZ9A 3FN9A 3HNYM 2QQOA 1K12A 1UY4A 4GWIA 3K4AA 2QQKA 1SDDB 2Y6GA 2BERA 4QAWA 4LHSA 1OT5A 2VZ1A 3BGAA 4QPWA 1L7RA 1NAEA 1UWWA 2B9VA 1SG3A 2W91A 4E8CA 2RV9A 5C70A 2OKXA 2RVAA 2Y64A 3CQOA 4IUGA 1GOFA 2VL4A 3ACHA 2WDBA 2ID4A 3A21A 2ZXQA 4LKSA 3GXUA 2WO2A 3C7GA 4P02B 3A22A 3MUY1 3WNMA 3WNKA 5CZKA 2EIBA 1TVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UES A;  1UY3 A;  2WQ8 A;  3OBA A;  5FUI A;  1PMJ X;  4A3Z A;  1CIY A;  2E31 A;  1DYO A;  4MAD A;  3CDZ B;  1F4H A;  3C7H A;  2B4K A;  3NJX A;  3I2J A;  1JHJ A;  2C4X A;  1JZ5 A;  4CU6 A;  4CUA A;  2ORX A;  4XUQ A;  1GOG A;  4L0P A;  2EIC A;  3J7H A;  1CX1 A;  2W95 A;  2VCA A;  4QX0 A;  3GDB A;  3OEA A;  3I3B A;  2VZV A;  3C7F A;  3WF4 A;  1KEX A;  2W92 A;  4W50 A;  2W1W A;  1PX4 A;  2EIE A;  3IAP A;  1GQP A;  3LPG A;  4QDR A;  3P6B A;  1ULP A;  3VD3 A;  3WF3 A;  2WZ8 A;  2WBK A;  2JD9 A;  2C26 A;  2Z4F A;  1GOH A;  3T2P A;  3A7Q A;  3OB8 A;  4XUR A;  1JZ8 A;  1JYW A;  1UYX A;  2W47 A;  2WZE A;  4M4P A;  4CU8 A;  2VZS A;  5G05 L;  2LW8 A;  1UYZ A;  1XPW A;  3SKJ E;  2W1Q A;  1GNY A;  5J1X A;  4A4A A;  5IHR A;  3DYO A;  2W9X A;  4BJ0 A;  1OD3 A;  3WNO A;  4QB6 A;  2BGP A;  3SKV A;  4A6O A;  2VZR A;  4XVH A;  2XQX A;  2X10 A;  5B4X A;  3HPN A;  3LEI A;  3HNM A;  3ZM8 A;  2WAB A;  2J1U A;  2WYS A;  3E1F 1;  3OGS A;  2VCC A;  2E32 A;  1JZ3 A;  1NX9 A;  2L9L A;  3BN6 A;  2E26 A;  3PUH A;  3P1I A;  2W5F A;  3I2F A;  3OG2 A;  1F4A A;  1HN1 A;  2WUH A;  1JYV A;  1ULO A;  2BGO A;  3GGL A;  1CZV A;  2YB7 A;  3WNP A;  3T09 A;  5HPO A;  2YFZ A;  4P5Y A;  3T2O A;  3DEC A;  4AAX A;  3DYP A;  2DCJ A;  3VDA A;  2WAO A;  1W9W A;  1R64 A;  3NRU A;  3ABZ A;  2VR4 A;  1DP0 A;  5DQ0 A;  1W0N A;  1JYX A;  2RJ2 A;  2YC2 A;  3OGV A;  3K4Z A;  3VD5 A;  1GUI A;  1OF4 A;  4XZU G;  3T08 A;  4MO3 M;  2XHN A;  1US2 A;  4ZXE A;  3OGR A;  2ZEZ A;  1WKY A;  1W8O A;  5CYY A;  3WQB A;  5F7U A;  5LCW L;  4DXR A;  1JZ6 A;  3CIH A;  3UNP A;  5EJZ B;  4E8D A;  4BXS V;  5LA1 A;  2YFU A;  3ACF A;  2CDO A;  3HOB A;  1UX7 A;  4CUB A;  2VQT A;  3VD4 A;  4FI9 A;  2W87 A;  3FHQ A;  3MBW A;  4KWU A;  3GM8 A;  2PQS A;  4JKL A;  4AG4 A;  4BK4 A;  4M4R A;  2LS6 A;  3PUI A;  4CUC A;  3LQC A;  3MUZ 1;  2J22 A;  1UMH A;  5JMO A;  2J1R A;  1NKG A;  4DXT A;  1YQ2 A;  3THC A;  2VZ3 A;  5LA0 A;  3WNL A;  4XUP A;  3K77 A;  2J1V A;  1JZ2 A;  2KD7 A;  4PT6 A;  2JE8 A;  3A23 A;  1D7P M;  5I0D A;  3T0A A;  4D8M A;  4HG6 B;  4OUE A;  1JU4 A;  1KGY A;  3C7O A;  4DEQ A;  3IAQ A;  3MV0 1;  1W9T A;  1H6Y A;  3UET A;  2J1A A;  2W3J A;  5IJR A;  1L7Q A;  2VC9 A;  1XC6 A;  4RN5 A;  4ZY9 A;  3SEP A;  1DLC A;  4QX3 A;  4DUV A;  4PF1 A;  4QB2 A;  2V4V A;  3T0B A;  4ZZ5 A;  4QX2 A;  4ET7 A;  3T0D A;  2HYX A;  2W1S A;  4LQR A;  5EJ1 B;  1UXZ A;  4MGS A;  2VMF A;  4XUN A;  2Y8K A;  1P8J A;  2HLE A;  4MOA A;  3D3A A;  3K4D A;  5JXI A;  1RYY A;  2XON A;  3I3E A;  2J7M A;  1IQD C;  4OMD A;  1WCQ A;  1EUT A;  2CDP A;  4ARY A;  4GWJ A;  2VZP A;  3WF0 A;  2X05 A;  1T2X A;  1SHW B;  3WSO A;  4KMQ A;  4A41 A;  5C7G A;  4JHZ A;  1CZS A;  2X09 A;  4MGQ A;  1PMH X;  4JKK A;  4P00 B;  1J83 A;  3F2Z A;  4W8J A;  3I2H A;  4JKM A;  2BZD A;  4W4Z A;  2WN3 A;  1NUK A;  2WAA A;  3CZJ A;  1W99 A;  3ACI A;  2JKX A;  3FHA A;  3IB3 A;  1EUU A;  2VME A;  5DN2 A;  4TXW A;  3AC0 A;  5G04 L;  1H6X A;  3THD A;  4BDV B;  3NJV A;  2ZEW A;  1W8N A;  2VZU A;  3HJR A;  1K42 A;  3VD7 A;  3EYP A;  4CU7 A;  2VTF A;  3VDB A;  5IFP A;  4OMC A;  3T2Q A;  1BHG A;  2QQI A;  2Y6H A;  1JU3 A;  2Y6L A;  2VZO A;  2VZQ A;  2ORZ A;  1JI6 A;  2XOM A;  4CU9 A;  2V72 A;  4ARX A;  4OZO A;  2VOT A;  3LPF A;  2VJX A;  5LA2 A;  2BBA A;  1UY2 A;  1US3 A;  3VD9 A;  3I2K A;  2QQN A;  1O8P A;  2ZEY A;  3I3D A;  3VDC A;  3LEK A;  2VO5 A;  3CZU A;  3I2I A;  4P08 A;  2YG0 A;  1K3I A;  3CMG A;  5JXG A;  3FL7 A;  3NQH A;  4D0Q A;  3U37 A;  1UMI A;  2DDU A;  3ACG A;  3C8X A;  2W94 A;  1UZ0 A;  3W5M A;  1UXX X;  4CVU A;  3I97 A;  2W1U A;  5JUV A;  5A1A A;  4YPJ A;  3K46 A;  2J1S A;  4QDQ A;  4TTG A;  2QBX A;  1GU3 A;  2VQU A;  2EID A;  4UOJ A;  1MPX A;  4RYD A;  3IDA A;  3JXS A;  2C9K A;  1JZ7 A;  1UYY A;  1OH4 A;  2DCK A;  4KI5 M;  3W5N A;  2QQJ A;  3CKH A;  2WN2 A;  3K75 B;  4QX1 A;  2WO3 A;  3HNB M;  3NNG A;  1J84 A;  1O8S A;  4A42 A;  5JXH A;  4QDS A;  5EIY B;  1UY0 A;  5B4N A;  2ZEX A;  5DMY A;  1PX3 A;  3EB7 A;  4PQQ A;  5DPN A;  4BK5 A;  2VMC A;  1O59 A;  4XUT A;  2E33 A;  3LE0 A;  3WNN A;  3HN3 A;  4UAP A;  4DUX A;  4DXS A;  3WF2 A;  2J1T A;  5IFT A;  1TG7 A;  5HXM A;  1JYN A;  1K45 A;  2QQL A;  3SEE A;  1UY1 A;  1JZ4 A;  2QQM A;  4ZZ8 A;  2WO1 A;  4A44 A;  2R7E B;  5JR2 A;  3MV1 1;  4DEV A;  2Y6K A;  4LPL A;  4XUO A;  2Y6J A;  3WEZ A;  5JXJ A;  4JX0 A;  1CZT A;  2JDA A;  4Z2A A;  3LEG A;  5IYY A;  3OEB A;  1GMM A;  1I5P A;  3HEI A;  2VCB A;  1XNA A;  1OF3 A;  2VZT A;  3I2G A;  2W46 A;  2J1E A;  4OYU A;  1XNT A;  2VMD A;  3DYM A;  4QB1 A;  4UI9 L;  1W9S A;  4DUW A;  1LNS A;  4A45 A;  2YC4 A;  3ETP A;  2VM9 A;  5C71 A;  3WF1 A;  2V5D A;  3MO4 A;  3ECQ A;  3III A;  3C7E A;  4GZ9 A;  3FN9 A;  3HNY M;  2QQO A;  1K12 A;  1UY4 A;  4GWI A;  3K4A A;  2QQK A;  1SDD B;  2Y6G A;  2BER A;  4QAW A;  4LHS A;  1OT5 A;  2VZ1 A;  3BGA A;  4QPW A;  1L7R A;  1NAE A;  1UWW A;  2B9V A;  1SG3 A;  2W91 A;  4E8C A;  2RV9 A;  5C70 A;  2OKX A;  2RVA A;  2Y64 A;  3CQO A;  4IUG A;  1GOF A;  2VL4 A;  3ACH A;  2WDB A;  2ID4 A;  3A21 A;  2ZXQ A;  4LKS A;  3GXU A;  2WO2 A;  3C7G A;  4P02 B;  3A22 A;  3MUY 1;  3WNM A;  3WNK A;  5CZK A;  2EIB A;  1TVG A; 
#chains in the Genus database with same CATH topology
 1ZRR A;  1WCS A;  3UES A;  3K51 A;  3OBA A;  1AYN 2;  2RHP A;  4XBL A;  2E7Q A;  2RM2 1;  3POJ A;  4RD7 A;  2E31 A;  5FFO C;  2OT7 A;  2ARB A;  5A3W A;  1DQ0 A;  3NJX A;  3PU8 A;  5FZ3 A;  4ASK A;  1JHJ A;  3NW4 A;  1V6N A;  2ZGT A;  5APA A;  5E1R A;  1HW5 A;  4CA9 A;  1UOJ A;  1SLC A;  5JZG B;  1W39 A;  3O5S A;  3VBH C;  1CAV B;  2UWC A;  1O3R A;  1WCU A;  1X8E A;  1FI2 A;  3J7H A;  1OUX A;  3PVB B;  4IDZ A;  2RS3 1;  2VCA A;  3N9Q A;  1KRI A;  2CAV A;  3OEA A;  5E89 A;  2YGL A;  3KCX A;  3POS A;  4Y1U A;  5BNN C;  2YYO A;  5I0S A;  5KHG A;  1Z7S 3;  3MGU A;  1VAL A;  3P6B A;  4QDR A;  1UZZ A;  1ULP A;  1V6L A;  3POF A;  1QU0 A;  3LFM A;  1YUD A;  2BV4 A;  2P17 A;  4LBK A;  3VD3 A;  4BH9 A;  2XBO 1;  2D5F A;  3VBS C;  4FOV A;  3M7A A;  4CP0 A;  1W3V A;  4LBL A;  1GOH A;  1FV3 A;  3PJQ A;  1A8M A;  4CCO A;  2V09 A;  4IES A;  4FOW A;  1OA2 A;  3BOW A;  1JYW A;  1UYX A;  3FC0 A;  2WZE A;  4M4P A;  2BFU L;  1WCK A;  3NST A;  1QHD A;  3FLR A;  2ZGU A;  1R08 1;  1OQD A;  3ILF A;  4CP2 A;  5IHR A;  1STM A;  3DYO A;  3JZV A;  4K1Z A;  3MYX A;  4FPJ A;  4AED B;  4L97 A;  3WNO A;  1OHF A;  4R9D A;  4JZR A;  4XJ9 A;  2BGP A;  2XJV A;  4WBB A;  4Y5S A;  4FFF A;  1UU5 A;  1S2B A;  4XVH A;  3WCR A;  1DU3 D;  3EBR A;  3OPZ A;  5FZB A;  1CVN A;  3LEI A;  2IUW A;  5A33 B;  2NLR A;  2HWD 2;  4COW A;  2KR2 A;  2GNT A;  5K9Y A;  3ZM8 A;  2WAB A;  2MNG A;  3CF6 E;  1TMF 2;  2WYS A;  1WW7 A;  2H6C A;  3E1F 1;  2DF7 A;  2VMI A;  3WW2 A;  1ODM A;  4GD4 A;  2K9Z A;  4EN9 B;  1POV 1;  2VTX J;  2EA7 A;  2CWS A;  5DUX A;  2ZX4 A;  2E26 A;  5DDJ 3;  5LY2 A;  3ITQ A;  1R09 3;  2HWF 1;  2ARC A;  1VP6 A;  3N4M A;  1D0H A;  1N47 A;  1DG6 A;  1VBC 3;  2VMG A;  1RUD 2;  4GIQ A;  5C3S A;  1IS4 A;  3WD5 A;  2BW8 A;  1UNB A;  4S2D A;  1F4A A;  1UYP A;  3JUU A;  5E16 A;  1REE A;  3V56 A;  4QKB A;  5L73 A;  1O6U A;  4WVW A;  3BUC A;  4NHX A;  5EFU A;  4PJY A;  4QPI A;  5DZG A;  5EWS A;  1QGL A;  5H9Q A;  4EN7 B;  5FOJ B;  2W08 A;  1CZV A;  3POG A;  1PO2 3;  3FLT A;  1CAW A;  3DL3 A;  3O0W A;  1ZM1 A;  4MGY E;  1FOD 3;  1RVF 1;  5IVF A;  1CON A;  4HPK A;  4TZD A;  3T2O A;  2ZGL A;  4AFB A;  5GZC A;  5L36 A;  2WFF 3;  1COV 1;  1SDW A;  4RS5 A;  1S0D A;  1J59 A;  5I0R A;  2P5B A;  1ZVF A;  1AL2 3;  3LOI A;  4OCT A;  3RQ0 A;  2P2K A;  4NAO A;  3S6P A;  2F4L A;  2ZX2 A;  4LUM A;  1W9W A;  3NRU A;  4KU8 A;  1AYM 1;  1J1T A;  3O0X A;  2XG3 A;  4COZ A;  2BOJ A;  2PLV 2;  3ABZ A;  1DP0 A;  2RJL A;  5JIU A;  5DQ0 A;  3ZXK A;  3BTX A;  4ATE A;  4FXG B;  3NNM A;  3OGV A;  1AR8 3;  1FYU A;  2UYB A;  3AKP A;  4QGN A;  5GLV A;  5FOB B;  1OF4 A;  2VW0 A;  4BQW A;  5FLJ A;  2HWE 1;  2Q1F A;  4AYU A;  4FTE A;  3AKT A;  1ULC A;  4C0H A;  2GP3 A;  3LIG A;  4XMA A;  2Z79 A;  1DDL A;  4MX3 A;  4E4D X;  4WV8 A;  2FZ2 A;  4E2G A;  3HMY A;  2D3S A;  4DXR A;  2ZX0 A;  1OD5 A;  1AX2 A;  4EN6 B;  4LLO A;  5H9P A;  4C1W A;  4XXP A;  3CIH A;  5A7W A;  4WZF A;  1M06 G;  1XSQ A;  3AMM A;  4XF9 A;  5F3E A;  1YCI A;  3CEW A;  5CFD C;  5IK4 A;  2JG9 A;  1AXY A;  3B5L B;  2CDO A;  3MW4 A;  2R06 1;  4AF9 A;  3POW A;  1UX7 A;  1W9F A;  2TEP A;  1UQX A;  2VQT A;  4QHZ A;  1AX1 A;  1AL0 G;  4M00 A;  1CAW B;  5FYT A;  5KHK A;  3S30 A;  4Z2W A;  4K40 A;  4HPK B;  3FHQ A;  3MBW A;  2ZML A;  2DVA A;  1JOB A;  4CXY A;  4E4H A;  5FPX A;  3O1S A;  5C8C C;  1FPN 1;  1J3Q A;  5FK8 A;  3W20 A;  3ZXG A;  1NLS A;  2P3Y A;  2LS6 A;  4PI2 A;  5BNO C;  4XFF A;  5F6L B;  2JB8 A;  1X9P A;  2J22 A;  1H30 A;  4AFC A;  2WQ4 A;  2IWG B;  1GNZ A;  3PDQ A;  5EJ3 A;  3H8U A;  1GLH A;  4NAM A;  2X5I A;  3I54 A;  4CCM A;  1JW6 A;  2KM2 A;  3GJA A;  5C3O A;  1LJ7 A;  3HR9 A;  2ZBJ A;  2J1V A;  4XFB A;  1OI6 A;  3NVC A;  4C91 A;  4Q4V 3;  4XAE A;  2JEM A;  3IDB B;  5L9V A;  2PQQ A;  4OHX A;  1REF A;  1DGW A;  1WWY A;  3MW2 A;  1RIN A;  4PT6 A;  1NCQ A;  4BHP A;  1D7P M;  5C5T A;  2TUN A;  5FCC A;  3VGI A;  4D8M A;  3O1T A;  4AFA A;  3BTA A;  4LO6 B;  5GLZ A;  2PHU A;  1JU4 A;  1KGY A;  1L7L A;  2VBB A;  3C7O A;  5FY7 A;  4BCU A;  2QKD A;  1W9T A;  1ND3 B;  2JDM A;  3UET A;  1HRI 3;  3AYE A;  1TNR A;  2W3J A;  2GH8 A;  2VOW A;  3HAG A;  1ND2 B;  3FJS A;  5JMC A;  2R0F A;  4YGC A;  2ZZQ A;  3B69 A;  5A7W B;  3T0B A;  3H7J A;  3USU B;  3ZXL A;  2RM2 3;  4ZZ5 A;  5T5P A;  1LHV A;  1RUF 1;  4LQR A;  1UOF A;  4MGS A;  1W6M A;  4BYY A;  2O8Q A;  3V0A B;  1JHN A;  4JQT A;  3GBG A;  4LNV A;  4I0A A;  4MOA A;  1H1M A;  5FYS A;  4Y4Y A;  5JXI A;  1S0C A;  1IQD C;  4PHZ A;  5GZF A;  3FWE A;  1WCQ A;  5ABJ A;  4W6X A;  5LK5 A;  1OOP A;  1EUT A;  2XUE A;  2RS3 3;  2QZ2 A;  2MEV 1;  4YW7 A;  4E9K A;  5C4W C;  3LSD A;  4COV A;  1IZ3 A;  3CO2 A;  1IG3 A;  3GHN A;  4XIL A;  4A41 A;  4LBJ A;  4XIO A;  4NR1 A;  3IBM A;  1TME 1;  4TSV A;  2G9G A;  2XBO 3;  2XL7 A;  1CZS A;  2OZ6 A;  3THP A;  5FPV A;  4AWD A;  2JIC A;  3OD4 A;  1HRV 2;  1C3H A;  3F2Z A;  1XE7 A;  1QJU 2;  1MQT A;  3VBU B;  1RMU 2;  4QD2 A;  1ULF A;  1WLT A;  1NCQ B;  2H0V A;  2WN3 A;  1R08 3;  4OLL A;  1NUK A;  4IEV A;  4P9W A;  2CU5 A;  5JOY A;  1C4R A;  2Z69 A;  2JKX A;  1GWK A;  1RUH 1;  3S57 A;  1N1S A;  5D8A A;  1YC6 1;  2W0X A;  1VBD 2;  3I4I A;  3WQ7 A;  5A1L A;  1MS9 A;  4XF4 A;  3KZ4 C;  3RVH A;  2VME A;  4MXV A;  5BNP A;  2GU9 A;  1V9U 2;  1W90 A;  2AZ5 A;  4TXW A;  2C5D A;  3JD7 1;  4QKD A;  3WG4 A;  4QM9 A;  5IUQ A;  5A32 B;  5SV8 A;  4GMP 1;  1H6X A;  3THD A;  4AW7 A;  2NZ9 A;  2AGS A;  1QJY 2;  3H3L A;  4MGZ E;  4B8E A;  1ENS A;  3UT0 A;  3OTF A;  4AZZ A;  1SMV A;  5L19 A;  2UY9 A;  2D7F A;  5HCH A;  4RR3 A;  3NNL A;  4XFC A;  1POV 3;  1RUO A;  2ET7 A;  2X8K A;  1GYK A;  1S0J A;  1KDM A;  3GYD A;  2HWF 3;  1W6N B;  3KS7 A;  1HB4 A;  1NCR C;  2QQI A;  3T2Q A;  5L7O A;  1QJX 2;  2FHR A;  1HB2 A;  1POV 0;  2WRA A;  2ZGK A;  4BPZ A;  5ABJ B;  3WT3 A;  3ZMO A;  1PVC 1;  4LLF A;  5DAX A;  2VZQ A;  1R1Z A;  3KV6 A;  5DAW A;  4WVZ A;  2V72 A;  1DF0 A;  2E7A A;  5F6K A;  2FMD A;  2ENR A;  1W28 A;  4DMI A;  1US3 A;  4PIX A;  3UGF A;  4Q4W 1;  4MUV A;  2H6B A;  2A6Z A;  5LAT A;  5CBL A;  3I3D A;  3NAP C;  3LEK A;  3TNQ A;  1RVF 3;  3EO6 A;  3I2I A;  3SIS A;  1AF9 A;  1BBT 1;  3UKV A;  4EQV A;  4Q29 A;  3D0S A;  4XXA A;  2RS5 1;  5AC9 2;  1COV 3;  3U37 A;  3I8T A;  1UMI A;  3VBH A;  1D4M 1;  1HN0 A;  1GAN A;  3ACG A;  4FT8 A;  4TWT A;  5KHH A;  4F83 A;  4W6Y A;  1UXX X;  1W04 A;  3T1L A;  4GA9 A;  2A6W A;  1PZ9 A;  5FKC A;  1AYM 3;  3BIW E;  5A1A A;  5AVP A;  5BNN A;  1QQP 1;  4Q4X 2;  5LBC A;  1KFU L;  4IEY A;  1GP6 A;  4QDQ A;  1O4Z A;  4TTG A;  3AYC A;  2VQU A;  3INA A;  1XSR A;  2ZMN A;  2EID A;  2ZGO A;  3J8F 2;  3VBS A;  1PGL 2;  5AVA A;  4XF1 A;  1JZ7 A;  1LAJ A;  5K0U B;  2WC2 A;  5DZE A;  1RUE 1;  1OH4 A;  1QF3 A;  1YHF A;  2BWA A;  2EF6 A;  2WWS A;  3OF1 A;  4KI5 M;  4L9B A;  4OUS A;  4Y26 A;  2HWE 3;  3U4S A;  4OVE A;  3VLB B;  1BZW A;  1NY7 2;  4QQO A;  3V65 A;  3CKH A;  4K7J A;  1X9T A;  3ZFE C;  3WP5 A;  3RYP A;  2HEV F;  4H7L A;  5K8S A;  2AH2 A;  5FZ1 A;  2YRO A;  3MDP A;  1WW6 A;  3N3H A;  5HCF A;  4NVP A;  1EV1 2;  1U5X A;  5I91 A;  4X6Q B;  4BM8 A;  2JD4 A;  3MIE A;  3ZKY A;  1ZBE 2;  1OH3 A;  4LBN A;  1Q43 A;  4HVO A;  4A42 A;  5JXH A;  4RQP B;  1AYN 1;  5L7O B;  4D6R A;  1BMV 2;  1UY0 A;  5DMY A;  2ZKL A;  3DGT A;  4NPR A;  4FFI A;  3ETQ A;  4HFS A;  5DPN A;  4AVC A;  2R06 3;  2BP6 A;  4CP1 A;  1LES A;  1WW4 A;  2ZCW A;  4JV4 A;  3WHU A;  4LKD A;  3BYW A;  1O3T A;  4DXS A;  3WF2 A;  5DUW A;  4PDW C;  4X8N A;  5CG9 A;  3POB A;  5EP9 A;  4Q26 A;  2G9F A;  3DPR C;  5H9S A;  3HN1 A;  1FPN 3;  4ZON A;  1UY1 A;  1WLD A;  3VBH B;  5GLT A;  2JE7 A;  4KG0 A;  4AGV A;  1JZ4 A;  4UF0 B;  5IK8 A;  5BY5 A;  1E5R A;  1UO9 A;  3OBT A;  5JOZ A;  2TBV A;  5JI9 A;  5FRA A;  4BB3 A;  1QXP A;  2Y34 A;  2VQA A;  4DEV A;  1PGW 1;  1GNH A;  2Y6J A;  3POI A;  3WEZ A;  3UL2 A;  4ASL A;  5FZO B;  2R07 2;  3VBF B;  2EAL A;  1CZT A;  3HQX A;  2JDA A;  3LEG A;  1SCR A;  4HN0 A;  4BMB A;  3OEB A;  1QJF A;  3VBO B;  4COY A;  5F8P A;  1XNA A;  2VZT A;  2ZZJ A;  2J1E A;  4IV1 B;  2JIJ A;  1UMZ A;  3DYM A;  3B7M A;  3AZX A;  4SLI A;  3RWN A;  3B94 A;  2GMP A;  5F5C A;  2R1B A;  5A3L A;  3J7N A;  4DUW A;  2X29 A;  5LWB A;  1NE6 A;  1QOS A;  2R30 A;  4XDP A;  4QX8 A;  4XQD A;  5A3N A;  1IS5 A;  1IGO A;  4YW1 A;  2HWD 1;  3MLJ A;  3WF1 A;  2HWB 2;  5FIX A;  4CEW C;  2BPA 2;  3EQE A;  4P9L A;  2ADE A;  3MLL A;  3OBR A;  4I0B A;  5JWP A;  2NM1 A;  1RUF 3;  2XJQ A;  4KWJ A;  5BNQ A;  3JB8 A;  5M0T A;  1MS3 A;  4P5H A;  1LGC A;  4GWI A;  4JGZ B;  2ZGM A;  5A6X A;  3H1Y A;  3RZZ A;  1HB1 A;  2JDN A;  3AB0 A;  1MR5 A;  4JAA A;  4QAW A;  4O9E A;  4WM7 B;  1OT5 A;  3AVS A;  5DZF A;  3WG3 A;  4Q8K A;  3NV4 A;  1GBG A;  4LMF A;  3WP6 A;  4AQ6 A;  3WP3 A;  1L7R A;  1OFN A;  5KXB A;  1BYH A;  1RUD 1;  3Q8A A;  1DYP A;  3D5O A;  4HBN A;  5ANQ A;  3WUC A;  4XMI A;  2MEV 3;  4XOG A;  4PF5 A;  4FFG A;  1AR7 2;  3CJI B;  1HJG A;  4HKW A;  4IUG A;  2FZ1 A;  5CFD A;  2CGO A;  2VL4 A;  1LED A;  3OGG A;  3OUH A;  4MH0 E;  3SHR A;  5FMD A;  4IEO A;  2VOX A;  3VZL A;  2WDB A;  3A21 A;  1JN2 P;  2DWR A;  1TME 3;  1OLM E;  3E6B A;  4QPG C;  5FAX A;  2DU0 A;  5KC5 A;  5IVJ A;  4DO0 A;  3CNA A;  3MUY 1;  1AXK A;  4FQ4 A;  2XHK A;  1TVG A;  5DAB A;  1APN A;  4BQ2 A;  1UY3 A;  2HKX A;  3AKR A;  1PMJ X;  2AC1 A;  4A3Z A;  4XW3 A;  1AHS A;  2D3R A;  5C8C A;  5LK7 B;  1UZV A;  2A3W A;  3RWK X;  1CJD A;  1CQ9 A;  2RR1 2;  3Q9O A;  5A3M A;  5BNO A;  2DVB A;  3AX4 A;  1RUH 3;  2D43 A;  2I07 B;  5FUP A;  2JDZ A;  5FZG A;  3WNX A;  4AHX A;  3E97 A;  4EYU A;  1I3H A;  1JZ5 A;  3HWJ A;  4L2N A;  4NRQ A;  2XWJ B;  4CU6 A;  1NZC A;  1SPP A;  2TNF A;  3GAL A;  4XUQ A;  2K2S A;  3JD7 3;  1B35 B;  4L0P A;  1EPW A;  4GMP 3;  1FAT A;  4B3N A;  4CCE A;  1LOA A;  1G6N A;  2BNN A;  4QX0 A;  1IKQ A;  1XJA A;  3I3B A;  1GSL A;  3C7F A;  3WF4 A;  2YU2 A;  2VGD A;  2W1W A;  3PIJ A;  4GMP 0;  1PX4 A;  3IAP A;  4HVR A;  3K3N A;  5IAV A;  3SQO A;  4BWO A;  4NPM A;  3AL5 A;  2Q8E A;  4JDM A;  3VB9 A;  1SLB A;  3SNM A;  1RXG A;  1ZNP A;  3VKO A;  3WDW A;  4P9Y A;  4M3C A;  3ZXF A;  2C26 A;  2EAK A;  3FMG A;  5A3O A;  3TEY A;  1H0B A;  1YFY A;  3A7Q A;  4N9I A;  3OB8 A;  1PVC 3;  1GQG A;  2DFB A;  4P9X A;  5T54 A;  5HI0 A;  1W03 A;  2PAK A;  3FBM A;  3ZYF A;  2VZS A;  1LUL A;  5G05 L;  2LW8 A;  4N8M A;  1UYZ A;  2P37 A;  1GKB A;  4BME A;  4UW5 A;  1DZQ A;  2FDH A;  3LAG A;  1GNY A;  3NV1 A;  4S2H A;  5J1X A;  5FY0 A;  1XOY A;  4LBO A;  4JVA A;  4Q4W 3;  3BU0 A;  4YZ2 A;  3WDU A;  2JXA A;  2MHF A;  4QKN A;  4CXX A;  2ES3 A;  3HVD A;  1BBT 3;  3ZIX A;  5LBB A;  1AVB A;  3SKV A;  4A6O A;  3K48 A;  1OSG A;  5J7M A;  2RS5 3;  1YFU A;  4KH9 A;  1G9B A;  1D4M 3;  5B4X A;  2EXK A;  3A0K A;  3HPN A;  4FTB A;  1DGW X;  5C4W A;  3KF3 A;  1RJ8 A;  1Y9M A;  2PYT A;  4YM3 A;  4LK6 A;  3OGS A;  1QQP 3;  1YXW A;  5IK7 A;  2E32 A;  3LB9 A;  1JZ3 A;  3RG0 A;  1SLA A;  1NX9 A;  1Q56 A;  5T3N A;  1CIW A;  1RHI 2;  1VIW B;  3O0V A;  2L9L A;  4QQH A;  1JOD A;  1CPM A;  3O1R A;  3BN6 A;  4JGY B;  1H2N A;  2DUR A;  4Z8B A;  1IS3 A;  5C9A B;  5KHJ A;  4K3U A;  4Y22 B;  2RDQ A;  3J7L A;  4CYD A;  4AQS A;  4KGQ A;  1Y43 B;  1EAH 2;  1RUE 3;  3SCG A;  2HWC 2;  5EV7 A;  5KWR A;  3L9J T;  4YW5 A;  3JU9 A;  2Q8C A;  5E8A A;  1HN1 A;  4JQR A;  3I7D A;  1JYV A;  4EJR A;  1ULO A;  3FZ3 A;  3JBG 1;  2FCT A;  2Q1M A;  3AMN A;  1SLI A;  4C0B A;  4LHK A;  2YB7 A;  3T09 A;  4XTM A;  5CA6 A;  2YFZ A;  4BU2 A;  2VG9 A;  1Q8S A;  1VAV A;  3DEC A;  1ZZC A;  1AYN 3;  3VZN A;  1G7Y A;  2G1M A;  1GZW A;  1W2T A;  4WVV A;  2DCJ A;  1YI7 A;  2Q4S A;  5JAX A;  3AMP A;  4GAL A;  4YVS B;  1WUV A;  5FY1 A;  1RUC 2;  4DOU A;  3N7J A;  3NMB A;  4TN7 A;  2P4E A;  2Q0A A;  1J58 A;  4I30 A;  1W0P A;  1QJE A;  1DGR N;  4GKY A;  3WW3 A;  4Y1V A;  4YM2 A;  3UYJ A;  4YNI A;  1LHU A;  1NZI A;  4H55 A;  3U78 A;  1W0N A;  5BNP C;  2VW2 A;  4LKF A;  2RJ2 A;  4Y5T A;  4G3Y C;  4ZHN A;  2P1B A;  1GUI A;  1NCR A;  4F8A A;  3VBR C;  1ZBA 2;  3T08 A;  2ZGP A;  5K7P A;  3SCH A;  2WZR 2;  2WS9 2;  3OY8 A;  2D97 A;  3BVC A;  5C4W B;  2R49 A;  4ZXE A;  4E27 A;  1AR6 2;  4FPF A;  3N9M A;  3S5Q A;  3W58 A;  4NPL A;  5CYY A;  3ZDS A;  3NAP A;  5CU1 A;  5FZL A;  4FVV A;  4O65 A;  5LCW L;  5IAT A;  1HRV 1;  4Y24 A;  1QJU 1;  3KGL A;  5EJZ B;  1RMU 1;  1XYO A;  4E8D A;  4AGG A;  3USS A;  3ACF A;  4LHL A;  1SBF A;  3MIC A;  1PK6 C;  5FP4 A;  4QQ2 A;  1DFQ A;  2YU1 A;  5GAL A;  1VBD 1;  1CAX A;  2XB6 C;  4CUB A;  5FYI A;  5C33 A;  5FZD A;  2JDK A;  2A71 A;  2NMO A;  1W2U A;  3V0B B;  1OUR A;  4QXB A;  4A7Z A;  2Z42 A;  1WBL A;  2VNV A;  2HWD 3;  3MIG A;  4KWU A;  3N9P A;  1QJY 1;  4IE6 A;  1GZW B;  4ZU5 A;  4BLI A;  2JEN A;  1ZZ7 A;  3M3I A;  5F5A A;  3ZFE A;  2RJK A;  1V0A A;  4GKX A;  4CUC A;  1AX0 A;  3HQR A;  2EXJ A;  1UMH A;  5JMO A;  3AZW A;  1NKG A;  1IPK A;  5LA0 A;  3WNL A;  1QJX 1;  4DB5 A;  5BPX A;  1RUD 3;  4UW6 A;  1LGB A;  4YGD A;  1VBA 2;  4CEY C;  1NCR B;  4MXW A;  3TNP B;  1FAY A;  4KNC A;  4URT A;  4YG3 A;  4LIU A;  2DCT A;  3CL1 A;  3ILN A;  3A23 A;  3ES4 A;  4RHV 2;  4D7S A;  3VDD C;  3H8X A;  3T0A A;  5BYN A;  3OY8 B;  1CN1 A;  1W0O A;  4E2Q A;  3P5B A;  4K8R B;  1ZZ9 A;  2JWP A;  1VB2 A;  4EE2 A;  1GFF 2;  2J1A A;  4XJ8 A;  5JCT A;  2RG4 A;  4X6R B;  1KDK A;  4N53 B;  3GBW A;  1V6M A;  3DXT A;  5F2W A;  1W6P B;  3DXU A;  1MS4 A;  4GB3 2;  4PDW A;  1XC6 A;  4RN5 A;  3ZLI A;  1URX A;  4CE8 A;  2WII B;  4QX3 A;  4DUV A;  1ASJ 1;  3KVB A;  4CTE A;  3DPR A;  3SH5 A;  2FCU A;  2VXR A;  1NA1 C;  4QX2 A;  5I8S A;  2PN5 A;  3LD8 A;  3MLK A;  4AFD A;  2CWM A;  5IVY A;  3W9A A;  3T0D A;  4Q4X 1;  4I02 A;  4WZC A;  4QKF A;  3O1O A;  3KLS A;  2W2I A;  4JHT A;  3MID A;  2HLE A;  1PGL 1;  3J8F 1;  4XDO A;  4K8F A;  1OC1 A;  2VU9 A;  3AYD A;  2ZTN A;  4HKO A;  2NP0 A;  1RYY A;  1SAC A;  2J7M A;  3VHN A;  1PZ8 A;  2R04 1;  2WKK A;  4AEK A;  4LT5 A;  4QX7 A;  3TYJ A;  2ZKN A;  3AZZ A;  4BQ1 A;  2NMN A;  2E51 A;  2YBS A;  2GAU A;  2NPI A;  1NY7 1;  3H0O A;  4XE9 A;  4KBZ A;  5FPB A;  3MZH A;  2QFE A;  5FYB A;  4KMQ A;  4B4R A;  3H42 B;  4DFS A;  1EV1 1;  5IVC A;  2LAL A;  2I74 A;  1H2M A;  4UFL A;  1CPN A;  3FX3 A;  1RL3 A;  1ZBE 1;  4SBV A;  1VBB 1;  1KJL A;  4LUK A;  1ACC A;  1BMV 1;  3TWI A;  2UY8 A;  2JB4 A;  3UJO A;  4YZ1 A;  4YVW C;  4QPY A;  2OII A;  3I2H A;  4CEW A;  3T4V A;  4CDW C;  5IVB A;  4MYE A;  3RNS A;  2YPD A;  1W99 A;  1UKR A;  2Y0I A;  4V1P A;  3RZM A;  5IWF A;  1OKO A;  5FMO S;  3ZN5 A;  1X82 A;  3AFG A;  3IB3 A;  4LBQ D;  3DKQ A;  1OBN A;  4LOT A;  5KHI A;  4GUL A;  2RDR A;  4YFZ A;  3WW1 A;  2PMW B;  2A3Y A;  3RPQ A;  4GJZ A;  1RC6 A;  1GP4 A;  4HLT A;  2DVD A;  2C0Z A;  5ERL A;  5I8T A;  5G04 L;  4ES9 A;  4L8Q A;  2WO7 A;  4CPB D;  4IER A;  2D6N A;  4J1X A;  1LEN A;  3AK0 A;  4FFH A;  4MSV A;  3WCS A;  3E6C C;  5A7S A;  2ZEW A;  2VZU A;  3HJR A;  4XJZ A;  2CY6 A;  3VZO A;  2UU8 A;  1BVV A;  1Q8O A;  3OUI A;  3N7M A;  4IGP A;  4I3G A;  3BOP A;  1JH5 A;  3KMH A;  4QPG A;  2VH9 A;  3VDB A;  2JEC A;  3H50 A;  3TEX A;  4JRA A;  4OMC A;  3ZXD A;  2HBT A;  1ZX5 A;  1JU3 A;  1RIR A;  1UKG A;  2Y6L A;  3AFK A;  5DDJ 2;  2RS1 1;  3ZMN A;  1C5I A;  1HXS 2;  4JC1 A;  5CB7 A;  4N9H A;  1HV1 A;  4UW4 A;  4ARX A;  3Q8F A;  5C6C A;  2WWU A;  3BCW A;  2VOT A;  3LPF A;  2VJX A;  2BBA A;  3VV1 A;  3JBG 3;  1OVS A;  1T6B X;  3C2U A;  4NWW A;  4QPI B;  4BQ4 A;  2JKB A;  4QHO A;  4CXW A;  3E5U A;  5BV6 A;  4P08 A;  3EXU A;  1V00 A;  2HWB 1;  3CMG A;  1LKN A;  3FL7 A;  3NQH A;  4D0Q A;  1G8W A;  3AMQ A;  1O3S A;  3HBK A;  1YQC A;  5FDB A;  4RS5 B;  5LBE A;  3C8X A;  2W94 A;  1UZ0 A;  5GZE A;  5I0U A;  1GIC A;  3VL9 A;  2WFF 2;  3RI8 A;  3ZFG C;  4AI8 A;  4CEW B;  1H4H A;  2HEY F;  4ERO A;  3D82 A;  3JB4 C;  3LKJ A;  2XDV A;  4HAN A;  5EJ1 B;  4XBN A;  1SLL A;  1AL2 2;  2DUO A;  4YW4 A;  3WDY A;  5JLV A;  1OUS A;  5E88 A;  2DU1 A;  1JOP A;  3DKW A;  2J1S A;  2QBX A;  4DRV A;  4BQ5 A;  4ZXK A;  1F5F A;  1MPX A;  3AZV A;  4RYD A;  4CSW A;  1FXZ A;  4A7Y A;  1RXF A;  1JUH A;  3IDA A;  1AR7 1;  1E5S A;  3KV5 A;  4E4S A;  1UYY A;  1A3K A;  3ZYH A;  2C1F A;  1DQ2 A;  4XIK A;  3W5N A;  1J1L A;  4J25 A;  2D6L X;  4LTA A;  5FK7 A;  2Y60 A;  2VBD A;  2WN2 A;  5FXZ A;  2PEL A;  5F2S A;  1BXH A;  1C1F A;  4NOT A;  4UW3 A;  3SH4 A;  5A6Z A;  5FZA A;  3WLU A;  3CU7 A;  2WNE A;  3KSC A;  3HNB M;  2PHL A;  4Q4Y 2;  4JTN A;  3ZYG A;  3URF A;  1ZRI A;  1J84 A;  4EWD A;  1HRV 3;  2HYK A;  1QJU 3;  4B7K A;  4YSF A;  3H1W A;  1HJF A;  3LCP A;  2A6X A;  1RMU 3;  2PAM A;  1GR3 A;  2A75 A;  2CAU A;  3I59 A;  3N9N A;  3WY6 A;  5B4N A;  4CRQ A;  3KQR A;  3M3Q A;  1MEC 2;  3SLI A;  4R4X A;  3N35 A;  1WMF A;  4XF3 A;  4FPH A;  2JG9 B;  2ZGR A;  4BK5 A;  1U5Y A;  4EWE A;  4M3C F;  4KWK A;  1C8M 2;  1VBD 3;  4M0N A;  2E33 A;  3LE0 A;  3PTR B;  1SFN A;  3APB A;  3OYW A;  4G4F A;  4UFM A;  4Y3O A;  3WNN A;  3O1U A;  2CHH A;  5IW0 A;  5CVR A;  1Y7B A;  2G19 A;  3MEP A;  1IOA A;  4AE2 A;  5FO9 B;  1K45 A;  1RUJ 2;  3R6S A;  1QJY 3;  1H2L A;  2JIG A;  3LDK A;  2Y0O A;  1Q8Q A;  2OQ7 A;  3PMS A;  2VY0 A;  3NL1 A;  2QQM A;  1JUI A;  4ZZ8 A;  5HV4 A;  2DYC A;  2WA3 A;  2HBU A;  2PTM A;  4JTO A;  1Y9G A;  3ORJ A;  4RFR B;  2BQP A;  3M3C A;  2VUJ A;  2A6V A;  2WA4 A;  2XKO A;  3MV1 1;  4FQZ A;  2IXK A;  4FPG A;  1LU2 A;  2BJS A;  3DEM A;  2X5I B;  4H2A A;  2GN3 A;  4PIY A;  1QJX 3;  2AUY A;  1GZC A;  3M3E A;  2XWB B;  4UBH A;  1H8T C;  4XUO A;  4NHL A;  4Y1Z A;  5KXE A;  3QH6 A;  3ZVX A;  1N3Q A;  1HQL A;  3E5Q A;  3UKT A;  1UW8 A;  4MET A;  1UIJ A;  1GMM A;  3WP4 A;  4PIZ A;  1T6G C;  2VCB A;  4Q4V 2;  4LBQ A;  3ZSK A;  5JSP A;  1OF3 A;  3HD8 B;  1FNZ A;  2W46 A;  3I2G A;  3QBQ A;  1ZYB A;  4OYU A;  5C5U A;  1ZRF A;  2GN7 A;  4KWL A;  1D2Q A;  4LIV A;  2ZAA A;  1LEC A;  2RMU 2;  1MS5 A;  1LNS A;  1W9Y A;  4ZS2 A;  1TEI A;  3NJZ A;  1ZRC A;  4BIS A;  2VM9 A;  1ASJ 3;  4D69 A;  2V5D A;  1V6J A;  1YEW A;  2QDN A;  3MO4 A;  3WXP A;  2GC2 A;  3ECQ A;  3III A;  1MZ6 A;  4NO4 A;  3QCW A;  3VBR A;  3ZPY A;  3N9L A;  4LR4 A;  4MGI E;  4MZU A;  5FY8 A;  2IZW A;  3C7E A;  2CGP A;  4IEQ A;  1DZT A;  1VRH 2;  4Q4X 3;  5FMC A;  4N43 C;  1QDC A;  1W6M B;  2QQK A;  1RHI 1;  2BER A;  2NQY A;  3J8F 3;  4GJY A;  4LHS A;  2VZ1 A;  2EVX A;  3BGA A;  5JZG C;  1PO1 2;  3QOP A;  2R04 3;  2DTW A;  1EAH 1;  2B39 A;  3LDB A;  2HWC 1;  4YW3 A;  1UWW A;  2B9V A;  5TSW A;  4BOW A;  1OOP B;  2W91 A;  1RUG 2;  2OKX A;  5AFB A;  4UT5 A;  4YW6 A;  2EAA A;  3CQO A;  1JYT A;  1ZZB A;  3ACH A;  1VB4 A;  2FDF A;  3Q8E A;  2ID4 A;  5FP7 A;  1PK6 A;  1EV1 3;  4LKS A;  4QQL A;  3WHT A;  2GC1 A;  2WO2 A;  4Y20 A;  1Q8V A;  1G9C A;  1ZBE 3;  3NJY A;  1VBB 3;  2Q8D A;  3RZJ A;  3A22 A;  1HDK A;  1QIQ A;  2ZPX A;  3WNM A;  3WNK A;  3AZY A;  3DCQ A;  1WKY A;  2EIB A;  1GWM A;  1ZA7 A;  3KQ4 B;  5A3T A;  1I6X A;  2D6M A;  2WQ8 A;  2PHF A;  3UKN A;  1F35 A;  1MQT B;  1CIY A;  3OOX A;  1DYO A;  1VAM A;  1X33 A;  2D6O X;  4I0W B;  4MAD A;  5T50 A;  4I09 A;  5LRS A;  4AED C;  4RGA A;  2XLA A;  1JXN A;  3C7H A;  3GHM A;  4KQ7 A;  2OVU A;  1W8H A;  2Q8O A;  1LHO A;  1R08 2;  3D6E A;  5D8A B;  2XJP A;  2YHJ A;  1XU2 A;  2VEC A;  3M2M A;  3PNA A;  4QM8 A;  3X29 B;  5BNP B;  1ZBA 1;  4ZKT B;  2A5Z A;  3ZSL A;  2J42 A;  2OW4 A;  5ANN A;  4ASM B;  2WZR 1;  2EIC A;  1CX1 A;  2W95 A;  4CEY A;  2VUC A;  2XL9 A;  5FZM A;  2VVE A;  5FZH A;  5IVV A;  3VBR B;  2DTY A;  3B00 A;  2R32 A;  4ONU A;  2W92 A;  3ON7 A;  4FPK A;  3U14 A;  3VDD A;  1YFW A;  4HK8 A;  2EIE A;  5DUV A;  1GQP A;  3LPG A;  3MPB A;  5A7P A;  2XJS A;  4AI2 A;  4RR3 B;  1Z78 A;  2F17 A;  2OPK A;  4V2V A;  1DQ5 A;  4FSJ A;  5A80 A;  4L99 A;  4NWV A;  2WZ8 A;  3I3Q A;  2WBK A;  1XQN A;  3JQW A;  4HZF A;  1XNK A;  3ZKU A;  2RS1 3;  4Y1X A;  1AJK A;  4XUR A;  1JZ8 A;  1WME A;  2BOI A;  2W47 A;  5FPL A;  4CU8 A;  1O91 A;  1NA1 A;  2UUR A;  5C3R A;  2VAU A;  2VNO A;  4GQ7 A;  3SKJ E;  5SV5 A;  2W1Q A;  2ET1 A;  1UN1 A;  5F37 A;  2VW1 A;  1PK6 B;  4KBB A;  4BJ0 A;  1OD3 A;  4W65 A;  1JYI A;  2WT1 A;  3IDE A;  3AP5 A;  4XJA A;  3J9S A;  4J1W A;  4NUB A;  2VZR A;  2HWB 3;  4FPY A;  4XFG A;  3I49 A;  2OQ6 A;  3VHR A;  1WW5 A;  2XXZ A;  2QQU A;  3BAL A;  2YUE A;  3KD4 A;  4U36 A;  1RUI 2;  2GAL A;  3EMR A;  3RI9 A;  3E6D A;  2B7Y A;  1ULD A;  4D7T A;  4XCA A;  2J1U A;  4AQT A;  4NRP A;  5BNN B;  2NN8 A;  5HCB A;  2FDJ A;  4XBQ A;  4YLZ A;  4PCR A;  1X8M A;  4GH4 C;  4HMZ A;  4KL1 A;  3PUH A;  3VBS B;  1XU1 A;  2YZ4 A;  3N7L A;  1A8D A;  2W5F A;  3P1I A;  4IL7 A;  2OYZ A;  5AFE A;  1AR7 3;  3LOB A;  2ERF A;  1PNG A;  4RHV 1;  5CFC C;  3I2F A;  4YVW A;  3OG2 A;  1K5M C;  2PHD A;  2WUH A;  5HBA A;  2GMM A;  4CDW A;  4XEZ A;  1XE8 A;  2QDR A;  5J09 A;  1S2K A;  2BGO A;  3GGL A;  4D6S A;  2UYA A;  1CWP A;  1XXN A;  4GB3 1;  1CR7 A;  4XJW A;  4P5Y A;  2YMZ A;  5FMB A;  3UGG A;  1XND A;  1OFS A;  2K46 A;  3NWK A;  3OBZ A;  4FP3 A;  2P3I A;  1N3O A;  2XVK A;  3DYP A;  1TE1 B;  4AAX A;  1UAI A;  2VE1 A;  5EHD A;  1TMF 1;  5KXD A;  1NA1 B;  1IPS A;  3MF6 A;  1IKP A;  5FPZ A;  3SMH A;  1W8U A;  2B9U A;  1UCX A;  2WAO A;  2DUQ A;  2Y33 A;  3BPZ A;  4Q27 A;  3WQ0 A;  1FMD 2;  3O1M A;  4YGE A;  3IM0 A;  4DNY A;  2VR4 A;  1VBE 2;  1SFP A;  1N1T A;  3IDC B;  3L2Y A;  4QGL A;  5LBF A;  2CYF A;  4KU7 A;  2O14 A;  4KGG A;  5FYV A;  4AVT A;  3IT8 A;  4BLJ A;  1W06 A;  2ZGN A;  2D98 A;  3WDX A;  4CZS A;  4J6G A;  1U5I A;  4YM0 A;  3E5X A;  3D8C A;  4FPO B;  3VD5 A;  4UXA A;  2IXH A;  1XB9 A;  4IET A;  4Q1P A;  4XZU G;  1YQ6 A;  3AP9 A;  1GV9 A;  4IV3 C;  4R9B A;  2XHN A;  1FPN 2;  1US2 A;  2HEW F;  4IEW A;  2D3P A;  2LRP A;  3OGR A;  1O5U A;  1FT9 A;  2ZEZ A;  1F8V A;  3KCY A;  1W8O A;  1CJP A;  1OPO A;  4OZX A;  3U75 A;  4EV0 A;  5GLW A;  4YAR A;  1N1V A;  2XLF A;  3VKN A;  3WQB A;  5FPU A;  5F7U A;  4FP2 A;  3KHB A;  2DVF A;  2JE9 A;  3A4U A;  4FPL A;  5A3P A;  5C9A C;  5A6Q A;  1WCD J;  1JZ6 A;  5IK5 A;  3RZH A;  5CKQ A;  4NIG A;  3POY A;  4LO7 A;  4BIO A;  2O1Q A;  4CCC A;  5C3P A;  2EIG A;  4CDU C;  1D0G A;  4YVW B;  3W21 A;  3ZFG A;  1RUN A;  1DCS A;  3M1H A;  2PLV 1;  3HOB A;  2QNK A;  2WIN B;  3AP7 A;  3NKT A;  1ND3 C;  4CDW B;  2BNO A;  1LGN A;  1NXM A;  3KHC A;  3VKM A;  2CSG A;  3VD4 A;  1W6O A;  1ENR A;  1ND2 C;  2GC3 A;  3MW3 A;  3PTY A;  1BQP A;  3ME2 A;  2W87 A;  4LA3 A;  1ZRD A;  1KFX L;  3GM8 A;  3RRD A;  2EXI A;  5FBZ A;  1HQN A;  1IQA A;  4AG4 A;  2XVL A;  3GCX A;  4BIF A;  4DXZ A;  4BK4 A;  5A1F A;  4AI0 A;  1UD1 A;  3PL0 A;  4NJ4 A;  3ATG A;  1RHI 3;  1YYN A;  4M3C E;  2WSU A;  1MS1 A;  2Q5T A;  4BA6 A;  4BQ3 A;  2J1R A;  5DAQ A;  4LK7 A;  4XHX A;  5FZE A;  4DXT A;  1YQ2 A;  1UOB A;  2VZ3 A;  3HBZ A;  3SXW A;  3U1X A;  3O14 A;  1MVQ A;  4YRD A;  4NII A;  1EAH 3;  4XUP A;  3KVA A;  2HWC 3;  5I0T A;  1HXS 1;  2LTN A;  2VBP A;  5FO8 B;  1C5H A;  2ZX1 A;  4Q0Q A;  1JZ2 A;  2DVG A;  2BNM A;  1A6C A;  2KD7 A;  3QH7 A;  5FZ8 A;  1YJL A;  3PUA A;  3ZFF C;  5I0D A;  5CFD B;  1C57 A;  2MEV 2;  3ZN4 A;  1YQ8 A;  1D2S A;  5FZ7 A;  4OUE A;  1QY4 A;  4DEQ A;  3IAQ A;  2RDS A;  3KB5 A;  3MV0 1;  4XJU A;  5A3U A;  1H6Y A;  3R0R A;  5IJR A;  5LAS A;  1L7Q A;  1LOF C;  4AI9 A;  2PHR A;  4F3J A;  1DLC A;  2V5Y A;  4AVS A;  4LEJ A;  1LOG A;  2V4V A;  4QGM A;  3VBU C;  3VN4 A;  1I5Z A;  4HSL A;  3ROU A;  2GP5 A;  5C8C B;  4P9I A;  4NMI A;  4R9A A;  5DAP A;  4MVT A;  1MZE A;  4XUN A;  2Y8K A;  5BNO B;  3RJR A;  3ZN6 A;  4LO5 B;  2XUM A;  4D94 A;  2WR9 A;  5DUU A;  2PA7 A;  4CDQ C;  4IE4 A;  1RUH 2;  3FFQ A;  3LF7 A;  2XON A;  3I3E A;  4FO9 A;  1SPP B;  4DZG A;  3HQU A;  1ZBA 3;  1H8T A;  4OMD A;  1UU6 A;  5CAD A;  4OHY A;  2IXL A;  2WZR 3;  2JJ6 A;  2CDP A;  4ARY A;  1JYC A;  3JD7 2;  5ACA 2;  2VZP A;  2VXJ A;  2Y26 A;  1OA4 A;  1MS8 A;  1WMX A;  2X05 A;  1T2X A;  2GNB A;  1SHW B;  2R0H A;  4BE3 A;  5FJH A;  4DRR A;  5F39 A;  3I3M A;  3ZSE A;  4Q4Y 1;  1CAU A;  4U2A A;  1VLN A;  4LOR A;  4JHZ A;  1QOO A;  4XYX A;  3ZR5 A;  4OHV A;  1JMU B;  5CKN A;  4MGQ A;  4IE7 A;  1NQJ A;  4JKK A;  4P00 B;  4M3C B;  5JOX A;  1CX4 A;  3DN7 A;  1N3P A;  2F4P A;  4IEP A;  3UJQ A;  1J83 A;  1MEC 1;  2V4A A;  1F15 A;  3P3N A;  2WZP P;  1YNA A;  1YRZ A;  5CNA A;  4W8J A;  3GJB A;  4AVB A;  1S0E A;  3ILR A;  1AZD A;  1C8M 1;  4CUG A;  5LEJ A;  3ZYR A;  1Y3T A;  2WAA A;  2XH6 A;  3CZJ A;  2ZHK A;  2I2S A;  3ACI A;  3ZPO A;  4N43 A;  4MGK E;  1BEV 2;  3LEM A;  5DAV A;  1W8T A;  1MAC A;  3VHP A;  5IVE A;  4Q4W 2;  1PM7 A;  4K9S A;  2XJT A;  3R4U A;  1RUJ 1;  3IIA A;  1EUU A;  4URA A;  5JZG A;  4OI4 A;  5FXX A;  1Y9Q A;  3MF9 A;  1BBT 2;  1CAV A;  3AC0 A;  4DS0 A;  2BFU S;  3PUQ A;  4ATF A;  4IQP A;  2D40 A;  4NRM A;  4BDV B;  1ZZ8 A;  1ULE A;  4XTP A;  4HET A;  1X50 A;  1QDO A;  1UX6 A;  4JCK A;  4QQP A;  2ILM A;  3LIH A;  4QMA A;  4AHZ A;  3GBF A;  2Q30 A;  5FUN A;  1DQ6 A;  1S0B A;  1K42 A;  1KXG A;  2GSY A;  3ZN6 B;  1ALY A;  3EYP A;  3O12 A;  4RSU A;  5H9R A;  5BUV A;  5GJ6 A;  1F31 A;  3UV9 A;  1S55 A;  3LGR A;  4EZH A;  2BRT A;  5IFP A;  2A3X A;  4NIH A;  1BHG A;  5K0U C;  2FDK A;  4M0H A;  1H8T B;  4RHV 3;  1BK0 A;  2VNR A;  2VZO A;  1S0I A;  4AEM A;  4HON A;  2YDE A;  1JI6 A;  2P3J A;  2XOM A;  3R4S A;  3WDT A;  1RUE 2;  1YLL A;  1OQE A;  4D7Y A;  3BKZ A;  3IPV A;  1AR9 2;  1PIV 2;  5LA2 A;  1H9P A;  3J7M A;  2QCS B;  4CDX C;  5FZF A;  5JI7 A;  4AED A;  3LA7 A;  3VD9 A;  2QQN A;  2RMU 1;  3S0M A;  2B5H A;  2ZEY A;  1LOE A;  1CAU B;  3IMN A;  1NE4 A;  5D1I A;  4GB3 3;  2VO5 A;  2YBP A;  3CZU A;  5F3G A;  1V9U 1;  2I45 A;  5FZ6 A;  1YJK A;  5GM0 A;  2YG0 A;  1W3X A;  4RQP C;  3DV8 A;  5FRE A;  5FZ9 A;  2ZHL A;  4RL7 A;  5KC6 A;  5T52 A;  3MHZ A;  3FHI B;  5A33 A;  1TMF 3;  1QJZ A;  1VRH 1;  2NYY A;  4RGK A;  1OA3 A;  2RDN A;  3W5M A;  1ONA A;  3I97 A;  3R05 A;  3CHX A;  1UZY A;  3M4F A;  3ZXA C;  2PXJ A;  5JUV A;  4TYS A;  2JX9 A;  2Y38 A;  1IS6 A;  3VKL A;  4OFG A;  4Z82 A;  4N43 B;  3WR0 A;  3ZYP A;  4XAC A;  3K46 A;  1PO1 1;  2WT0 A;  3TEZ A;  3V64 A;  1H1I A;  2XJR A;  1H1A A;  2A7A A;  5FPA A;  1RUG 1;  2C9K A;  3N9O A;  4AVA A;  3MI8 A;  1WA4 A;  2DCK A;  2FQP A;  4GXL A;  1MZF A;  2XQR A;  3QLQ A;  3AVR A;  1OXC A;  1S1A A;  2BGC A;  2DV9 A;  2R6Q A;  2ZMK A;  4L11 A;  5F5Q A;  2CL2 A;  2SBA A;  3TN9 2;  3HT1 A;  4COU A;  2F6B A;  1QXJ A;  4H3W A;  2ZAB A;  1RJ7 A;  4LE3 A;  4QX1 A;  4IEU A;  4ZU7 A;  1F9K A;  3NAP B;  1R1A 2;  3MFA A;  2R16 A;  4OUM A;  5AC9 1;  3NNG A;  3Q8C A;  3HT2 A;  3VBF C;  5J3U A;  1O8S A;  1PGW 2;  4H14 A;  4QDS A;  3VBO C;  1YIF A;  4B1M A;  5GZD A;  1LCL A;  5CAZ A;  4DIQ A;  1PX3 A;  2WT2 A;  5FYM A;  4XCB A;  4IV1 C;  4HT1 T;  5JR7 B;  2PLV 3;  2WWJ A;  2VMC A;  3IPV B;  5ISL A;  1O59 A;  4KG8 A;  4XUT A;  3MIF A;  3RYK A;  4AHY A;  1VMH A;  1VE0 A;  1CAX B;  1IPJ A;  1I1E A;  4UAP A;  4OQ8 A;  3QAC A;  1V6K A;  5FTT C;  3ZXE A;  5JOW A;  2J1T A;  1TG7 A;  4GH4 A;  1IG0 A;  1EYB A;  3EHK A;  1H8V A;  1JS9 A;  1JTZ X;  3OPT A;  3GZA A;  4G9S B;  1JYN A;  1CGP A;  1W2O A;  1MVE A;  1ENQ A;  2QQL A;  4PI0 A;  3SEE A;  3AXE A;  5CFC A;  3UGH A;  2IXJ A;  3JQX A;  2VUL A;  2IC1 A;  3AXD A;  4JGZ C;  3TBD A;  3GF6 A;  2WQZ C;  3ZFE B;  1K5M A;  5F9T A;  2WO1 A;  4A44 A;  4LO4 B;  4XFA A;  4IND A;  2XJU A;  4WM7 C;  2R7E B;  2QQV A;  2X53 S;  1WA6 X;  5JR2 A;  1Z7S 2;  5EYY A;  1HIX A;  1UZW A;  4CCJ A;  4AK3 A;  1JOJ A;  3WVJ A;  1W2A X;  5JXJ A;  1HXS 3;  4LE4 A;  5FY4 A;  3W59 A;  5IYY A;  3CJI C;  2BVV A;  4MXW B;  1K5J A;  3T30 A;  3IKW A;  1E57 A;  2GND A;  3AKS A;  1I5P A;  5FZK A;  1XNB A;  3HEI A;  4ZPI A;  4LUL A;  3MIB A;  1XNT A;  4UYB A;  2XR4 A;  5F3I A;  1UPI A;  2A6Y A;  2D44 A;  1DGL A;  4QB1 A;  3H8O A;  3LSE A;  2CTV A;  3H3U A;  4CP9 A;  5J36 A;  3KM5 A;  1W9S A;  4ISR A;  5J98 B;  3FLP A;  3TOJ A;  4PDW B;  4ES8 A;  4PBP A;  3S5A A;  3TRS B;  2WFP A;  2Z2S B;  4QXH A;  5C71 A;  1RUI 1;  3KCC A;  5FWJ A;  3DPR B;  2B8M A;  2P3K A;  3SH3 A;  4D6Q A;  4FAG A;  3BTZ A;  3BOD A;  4IV3 A;  3HNY M;  4BZ4 A;  1K12 A;  3I2O A;  2QQP A;  1HV0 A;  2GME A;  1SDD B;  2N7G A;  5CIS A;  4QXK A;  4Y4R A;  5FZI A;  2QZ3 A;  4OI1 A;  4AEJ A;  5JSR A;  2LM3 A;  1DIW A;  2VOK A;  4HL0 A;  1WLC A;  4S2G A;  5FZ4 A;  5DG2 A;  2OS2 A;  5J37 A;  2R07 1;  1TQ5 A;  3L2H A;  3M8L A;  4QPW A;  4MGT A;  2JG8 C;  4XPV A;  4GH4 B;  1B35 C;  5FWE A;  2VTX A;  5C9A A;  5EPA A;  3ZYB A;  4S2F A;  4A2U A;  1ULG A;  4DQA A;  1I9R A;  1SG3 A;  2SLI A;  4AGR A;  4YZ5 A;  1R09 2;  1NXD 1;  1DQ4 A;  5C70 A;  2RVA A;  4GWN A;  1SFY A;  2Y64 A;  5LRR A;  3GCW A;  5CFC B;  1VBC 2;  3OD0 A;  4CCN A;  4CDU A;  1GOF A;  3H7Y A;  1XRU A;  3M70 A;  3OPW A;  4D3W A;  4OHW A;  3RJ2 X;  1K5M B;  4Q4Y 3;  3TAY A;  1OPM A;  1UPS A;  1MZ5 A;  2WYF A;  1ND3 A;  3I2D A;  1W8F A;  3GZU C;  3T3Y A;  4YFW A;  2KXL A;  2D93 A;  2E53 A;  2PHT A;  1PO2 2;  4EZ4 A;  5HXV A;  1F5J A;  2BEO A;  1ND2 A;  1MEC 3;  1FOD 2;  1PMI A;  3WNP A;  5E6H A;  5IAX A;  2WJS A;  4PLM A;  3USU A;  5FUI A;  2GH2 A;  3ZYI B;  4WM8 C;  1UU4 A;  4NHM A;  1C8M 3;  3LWC A;  3CDZ B;  1VPH A;  1FMD 1;  3NNF A;  3RSJ A;  1F4H A;  5JSO A;  1VBE 1;  3V0A A;  2B4K A;  3B02 A;  3I2J A;  4ORF A;  1V6O A;  2C4X A;  2PFW A;  4CP9 B;  3O1V A;  2A70 A;  5EQU A;  5FLH A;  1RUJ 3;  3OGJ A;  4CUA A;  5FQ0 A;  5I93 A;  1XE0 A;  3KV9 A;  2ORX A;  3PVO A;  3BI3 A;  4AAP A;  1GOG A;  5FYZ A;  2JDY A;  1S0G A;  2BTV C;  4HVQ A;  1AR8 2;  3WUD A;  4EN0 A;  1A78 A;  3GDB A;  3OCP A;  2VZV A;  3WW4 A;  3ZFF A;  1KEX A;  3H8R A;  4W50 A;  4IV3 B;  4PLN A;  4QT6 A;  1BKZ A;  4QXC A;  2W68 A;  4Y33 A;  4QHB A;  1ODN A;  2WNV C;  1OVP A;  1LR5 A;  1ZZ6 A;  1G9A A;  1ZA4 A;  4O7X A;  3VKF C;  3WG1 A;  4JGY C;  3FUO A;  4QPG B;  5FMO L;  2QE3 A;  4P9J A;  5DXD A;  3WF3 A;  2BBV A;  2WNU C;  2VD7 A;  1J3P A;  2JD9 A;  3BIE A;  2Z4F A;  3T2P A;  3AMH A;  1LOF A;  4XFH A;  1EP0 A;  2FDG A;  1YO8 A;  2RR1 1;  4Q2F A;  5FO7 B;  1SLT A;  5JVV A;  4WVM A;  3VBU A;  1H9W A;  1XPW A;  2DCZ A;  3U07 A;  4CDU B;  3H1M A;  4GWM A;  3KT1 A;  3P3P A;  4BQY A;  1O5L A;  2RMU 3;  4A4A A;  1FX5 A;  2IVI B;  3S7I A;  2W9X A;  5CIR A;  2JDP A;  4HK9 A;  3D4K A;  1DZR A;  1PNF A;  1V9U 3;  3JBG 2;  3FFZ A;  2WSV A;  4QB6 A;  4NIA A;  4A3X A;  3H3Z A;  4CDQ A;  4XFI A;  2XQX A;  3RGB A;  2LRO A;  4R4Z A;  4N90 A;  2X10 A;  1HX6 A;  2AEZ A;  1NLQ A;  3O7O A;  2WLQ A;  5A32 A;  4YVS C;  1WD4 A;  4ZU4 A;  1VRH 3;  5FYC A;  3RZK A;  3HNM A;  1BJQ A;  3AJZ A;  4FOQ A;  5JPN B;  2QJV A;  3QD6 A;  4IGO A;  4ZS3 A;  2VCC A;  2MPF A;  4Q0V A;  1PO1 3;  4Q8L A;  4MHR A;  2JDH A;  3ACL A;  5T5J A;  1LRH A;  4I3P A;  3ZO0 B;  5FQ0 B;  1W6N A;  1C28 A;  4N7U A;  1Q3E A;  1RUG 3;  4PLO A;  3KWV A;  3B93 A;  4XQW A;  4UFH A;  4XAB A;  3U4X A;  1VJ2 A;  1OMI A;  4O61 A;  1KS5 A;  2OXB A;  4BQX A;  2D6K A;  2OA2 A;  4HN1 A;  2DFC A;  3GZE A;  3IN9 A;  3ZFF B;  4XAA A;  3SIT A;  4QX5 A;  3K3O A;  2ZHM A;  4F7Z A;  1PHM A;  5FY5 A;  1KS4 A;  1SEF A;  4QU1 A;  5CEH A;  1XYP A;  4QU2 A;  5HPO A;  2WLP A;  4CPB A;  4CCK A;  5AC9 3;  1G9D A;  2VVD A;  3CJX A;  3WQ1 A;  4Z92 B;  1HRI 2;  3PIG A;  1DBN A;  4P14 A;  1RTV A;  4FAH A;  1HLC A;  2BDR A;  3I59 B;  3CLP A;  5A70 A;  4NN0 A;  2ZHN A;  5EXO A;  3ZIW A;  2DCY A;  2AYH A;  4C1X A;  1O4Y A;  4WVM B;  3VDA A;  3T1M A;  5BXX A;  2RM2 2;  1SZB A;  1VR3 A;  1R64 A;  2XML A;  3ALQ A;  5F3C A;  1GQH A;  1ENX A;  2R1D A;  3OYW B;  1VRB A;  5GKA C;  4FBF A;  3D0J A;  3ELN A;  4YM1 A;  5GZG A;  2ATF A;  4L92 A;  1JYX A;  2YC2 A;  3MFC A;  4CDQ B;  3F95 A;  1QH7 A;  3K4Z A;  5L9R A;  3VL8 A;  5K0U A;  5ACA 1;  1WZX A;  2YPJ A;  2W39 A;  1AXZ A;  4MO3 M;  3THT A;  2RS3 2;  1LHN A;  1FNY A;  3IWZ A;  2FD8 A;  4A6S A;  3RZL A;  2ARA A;  3VZJ A;  4CDX A;  3K2O A;  3VHO A;  4OUL A;  1EY2 A;  4XF0 A;  5FYU A;  4V2W A;  3PVE A;  1E5H A;  3RMX A;  2A1X A;  4LA2 A;  3MPP G;  2DUP A;  2XBO 2;  5KR7 A;  2CGN A;  5LW9 A;  4HXC A;  4RQP A;  4AI1 A;  3UNP A;  5DG1 A;  4IXL A;  1RUC 1;  2HH9 A;  3BB6 A;  4BXS V;  1OQ1 A;  1SBE A;  2GZW A;  5LA1 A;  2YFU A;  4LBQ B;  1Q8P A;  5EYX A;  5FBJ A;  1BEV 1;  4FXK B;  4TLF A;  2VOV A;  4R8H A;  4XC9 A;  3J4U H;  4ITC A;  1H2K A;  3ENR A;  4C8D A;  3U0Z A;  4N53 C;  1YI9 A;  3FBY A;  1W8Z A;  4NRO A;  3N36 A;  4UFJ A;  4FI9 A;  2QVS B;  3AP4 A;  1SBD A;  2ADD A;  2ZGQ A;  4AXO A;  3UK9 A;  1RUI 3;  3U10 A;  1W2N A;  5F5I A;  5JIA A;  2PQS A;  2WS9 1;  4JKL A;  5T5L A;  1AR6 1;  1ASJ 2;  1PZ7 A;  4UF0 A;  4AI3 A;  4M4R A;  3PUI A;  4B4P A;  1NYW A;  4LKE A;  3HIF A;  1AJO A;  1OLR A;  3LQC A;  3B3Q E;  3MUZ 1;  4FOY A;  3TB0 A;  1LOD A;  2V73 A;  4Q1R A;  1ST8 A;  2R07 3;  2Q1Z B;  2PHW A;  3THC A;  4DPN A;  1QOT A;  4RFT 0;  1DLL A;  1PGS A;  2AAC A;  3K77 A;  4UWD A;  5FZO A;  3VBF A;  3GNE A;  1WGP A;  1OLQ A;  2HWF 2;  3LA3 A;  4UFK A;  2R04 2;  1VMJ A;  2ZJC A;  3VBO A;  1G86 A;  1U12 A;  2JE8 A;  1AR9 1;  1PIV 1;  3WOG A;  5EIY B;  1NOV A;  3VZM A;  2W52 A;  3A0N A;  4HG6 B;  1VAK A;  4IV1 A;  3BTY A;  4IE0 A;  2IXC A;  4A7K A;  2B45 X;  2ZGS A;  4CDX B;  5FZC A;  4Y20 B;  3IZO A;  2JDU A;  5A7Q A;  3DUI A;  1G9F A;  1EPZ A;  2VC9 A;  4IEZ A;  2ETE A;  1W8W A;  4LJH A;  1RVF 2;  4ZY9 A;  3SEP A;  4NE9 A;  5FXV A;  4AHW A;  1VBB 2;  2VCM A;  3AKQ A;  4PF1 A;  3KT4 A;  4QB2 A;  1BLZ A;  2VPV A;  4YW2 A;  2HJI A;  4ET7 A;  1COV 2;  2DBI A;  2GNM A;  4YYO A;  1ZRE A;  3PU3 A;  1FMD 3;  2BWC A;  2HYX A;  2AR6 A;  2W1S A;  1UXZ A;  2YGM A;  2VMF A;  3JCI A;  1LOB A;  3POE A;  4JGZ A;  1H4G A;  1VBE 3;  2UWA A;  4XZP A;  5F32 A;  4B4Q A;  2ARX A;  5EZW A;  4Z1V A;  3AL6 A;  4M01 A;  1P8J A;  1WBF A;  3R4D B;  2KA3 A;  1UOG A;  2BVB A;  2ARE A;  1AYM 2;  4WM7 A;  2D6P A;  3D3A A;  3K4D A;  1D4V B;  1HB3 A;  1VBA 1;  2XPJ A;  1W6Q A;  2C24 A;  4IEX A;  5LY1 A;  4Z07 A;  3ZYJ B;  4BXF A;  2XLG A;  3B9C A;  3PJY A;  1SQ4 A;  3CJI A;  4CEY B;  2Y6F A;  4GWJ A;  4NHY A;  5FP8 A;  3TN9 1;  3WF0 A;  1BCX A;  1Y4W A;  4OI0 A;  2VNG A;  3WSO A;  3VDD B;  2HWE 2;  3CBN A;  3H9A A;  3NV2 A;  3WDV A;  1MS0 A;  3WIN E;  4UBG A;  5C7G A;  2ZAH A;  1R1A 1;  3KV4 A;  1POQ A;  3PLQ A;  1HQW A;  3VUO A;  1UIK A;  2IVJ A;  2X09 A;  1QNW A;  1PMH X;  1DYK A;  5J48 A;  3B9I A;  1PM4 A;  2OPW A;  4YZ4 A;  4H7M A;  4B1L A;  1UL9 A;  4IGQ A;  2GC0 A;  4Q0P A;  4Q0S A;  1O7F A;  2RR1 3;  3RZG A;  2FCV A;  4JKM A;  2BZD A;  4B7E A;  3G6J B;  2E6V A;  1S4C A;  2RS1 2;  4W4Z A;  1XBF A;  3EJK A;  4QPI C;  2VUA A;  5LEK A;  3NO8 A;  3FHA A;  2R06 2;  3RS6 A;  4LHN A;  2O8O A;  3ZX7 A;  1O3Q A;  2AEY A;  1BVP 1;  4LXL A;  5T55 A;  5T5O A;  1C1L A;  4C90 A;  5C3Q A;  1RB8 G;  2AEN A;  2JG8 A;  2CNA A;  1YWK A;  3B01 A;  1B35 A;  4JDO A;  4K1Y A;  5DN2 A;  4Q0U A;  4RS5 C;  1LOC A;  1Q5O A;  2OUJ A;  4YGB A;  3ZR6 A;  5IT6 A;  1RGS A;  2XGX A;  1FV2 A;  3MIH A;  3NJV A;  4E2S A;  4RGG A;  3AJY A;  4X8P A;  1TNF A;  1F2N A;  2ZS6 B;  1W8N A;  2E9Q A;  1Z7S 1;  1W05 A;  3VD7 A;  3ZDV A;  1LB2 A;  4OQ9 A;  4CU7 A;  2VTF A;  4DY5 A;  1KQR A;  2QUO A;  2FBE A;  5FY9 A;  5FZ0 A;  4AVV A;  1AUY A;  4LOS A;  2Y6H A;  1W6Q B;  2LUW A;  3LZZ A;  5J96 B;  5FR3 A;  3BU7 A;  5F1R A;  4DY3 A;  3ZSM A;  2B46 X;  4E4Z A;  2ORZ A;  4LBM A;  4OHZ A;  4MLO A;  4Q5O A;  4CU9 A;  4WM8 A;  1J3R A;  1GZT A;  4OZO A;  4FPC A;  4FTS A;  1CES A;  1KD7 A;  1UY2 A;  1V6I A;  3NV3 A;  1L3J A;  3I2K A;  3ZOI A;  2DBN A;  1O8P A;  4YWA A;  5FP3 A;  3ST7 A;  4HKL A;  1X36 A;  3VDC A;  1BK1 A;  2RE9 A;  1O4T A;  2O0O A;  1K3I A;  1SCS A;  3S7E A;  5HV0 A;  5JXG A;  3LDR A;  1OLM A;  4Y1Y A;  1DQ1 A;  1XYN A;  2DDU A;  2ZA9 A;  4I01 A;  2JG9 C;  1IHM A;  4B29 A;  4CVU A;  3T4H B;  2W1U A;  1RUF 2;  1KJR A;  4K21 A;  2FDI A;  2VQ0 A;  4K6B A;  4JRL A;  2WNV A;  4YPJ A;  1OKQ A;  3KT7 A;  2UWB A;  3PUR A;  1GU3 A;  2PHX A;  4JGY A;  1QNY A;  5FP9 A;  2P6H A;  4UOJ A;  5DDJ 1;  4Y22 A;  2WNU A;  1RED A;  1R09 1;  2YC0 A;  4I2O A;  2JG8 B;  3FE5 A;  3JXS A;  3Q8B A;  5ACA 3;  1QEX A;  5I8Y A;  1VBC 1;  4HSJ A;  2QQJ A;  1YIP A;  2XVG A;  2VVF A;  3OJB A;  4XET A;  5A7N A;  3LFI A;  3AP6 A;  1PVX A;  4GAZ A;  3K75 B;  2E7T A;  3WG2 A;  2WO3 A;  5FV3 A;  1U5Z A;  2B42 B;  2X5I C;  4DIN B;  1PO2 1;  3RMY A;  1QH6 A;  1DGR A;  2YXS A;  5HCA A;  5KXC A;  1TME 2;  2OX0 A;  2P6C A;  5A6Y A;  1FOD 1;  1GWL A;  2IFR A;  4LO8 A;  5LZ6 A;  1S0F A;  3RFR A;  1RUC 3;  4W6W A;  2WFF 1;  4YG6 A;  2CV6 A;  3VZK A;  2ZEX A;  3TEW A;  1B09 A;  1NCQ C;  3C3V A;  3WX5 A;  4YVS A;  1RIT A;  5L9B A;  2G9Z A;  4R52 A;  1QMJ A;  4MG2 A;  3ZFG B;  3EB7 A;  1AL2 1;  1LHW A;  3BPS A;  3IMM A;  1BEV 3;  3N7K A;  4PQQ A;  4QWN A;  4WM8 B;  2VUD A;  4TLG A;  4YZ3 A;  1N1Y A;  2G4I A;  3WV6 A;  1UF2 C;  4O9G A;  3AM2 A;  2GDF A;  3HN3 A;  5FYH A;  1VMF A;  2A73 B;  2C6S A;  3PHM A;  4FPE A;  1W6O B;  3T2T A;  4DUX A;  1U0A A;  5HXM A;  3NNJ A;  2E63 A;  5IFT A;  4OI2 A;  2ZOE B;  3RYR A;  2QQW A;  1M4W A;  1QWR A;  2D5H A;  1AR8 1;  2WS9 3;  1QXR A;  1AR6 3;  3PUS A;  3LA2 A;  5FKB A;  4JDN A;  5D21 A;  3KF5 A;  3FUQ A;  1YFX A;  4PQ9 A;  5CG8 A;  1WMD A;  2P34 A;  4FCA A;  5FLI A;  5K4L A;  1GZ9 A;  4XQ4 A;  3PVN A;  1V70 A;  2WNV B;  3RDI A;  2H0B A;  2Y6K A;  3AYA A;  4IE5 A;  4LPL A;  4N7I A;  5FYY A;  3ASI A;  2FMY A;  5ABJ C;  1JBC A;  4JX0 A;  4YG0 A;  1OOP C;  2WNU B;  3OSD A;  1C8N A;  1NG0 A;  4XDQ A;  4AL9 A;  2K0G A;  4Z2A A;  2PAE A;  3ES1 A;  4R9C A;  2OZJ A;  3O1P A;  1KIT A;  1AR9 3;  1PIV 3;  5LB6 A;  1DHK B;  2ZAC A;  2YV8 A;  1PVC 2;  3SC7 X;  1NLR A;  1Z0H A;  4LIT A;  2WL1 A;  4NHK A;  2VMD A;  5KBF A;  3J26 N;  2IXI A;  2YBK A;  2VMH A;  3PME A;  1WLW A;  1HKD A;  4ISQ A;  1LTE A;  2Z5W A;  3G7D A;  4UI9 L;  5JPM B;  3V0B A;  5D2A A;  4A45 A;  3U11 A;  2YC4 A;  4CCD A;  3ETP A;  4HOO A;  2BU9 A;  5C8W A;  4EWA A;  3WZ1 A;  2IFW A;  4P9G A;  5FJK A;  1MQT C;  2RS5 2;  3DF0 A;  4IW3 A;  4AQ2 A;  1NQD A;  1S2E A;  5B2G B;  2WNO A;  4CCL A;  1D4M 2;  2ZX3 A;  4GZ9 A;  2YY1 A;  3FN9 A;  5FXW A;  2QQO A;  4XHB A;  1UY4 A;  2C9A A;  1TZO A;  3K4A A;  3OUJ A;  5D8A C;  2Y6G A;  5A7O A;  1GP5 A;  4UFI A;  4AFM A;  4K20 A;  1LU1 A;  1QQP 2;  4Y5Z 0;  2BYV E;  1E5I A;  1XNC A;  1VBA 3;  2QTW B;  2OUH A;  2XKP A;  3ZSJ A;  4NID A;  4RA0 A;  1QKQ A;  1NAE A;  3M3O A;  4MV2 A;  5LA9 A;  2BUK A;  4Q4V 1;  4E8C A;  2RV9 A;  1LEM A;  3KGZ A;  4MHU A;  3TN9 3;  1WD3 A;  1NT0 A;  5CKM A;  3GZT B;  1X7N A;  4AOC A;  1CD3 G;  4RR3 C;  1YQ5 A;  2ZXQ A;  3ZXJ A;  3GXU A;  1R1A 3;  3C7G A;  1HRI 1;  3NKG A;  4P02 B;  4N53 A;  5GLU A;  2EXH A;  4EN8 B;  3SCF A;  1W6P A;  5JDB A;  5L7O C;  4PBO A;  5CZK A;  4AR2 A;  1A34 A; 
#chains in the Genus database with same CATH homology
 3UES A;  1UY3 A;  2WQ8 A;  3OBA A;  5FUI A;  1PMJ X;  4A3Z A;  1CIY A;  2E31 A;  1DYO A;  4MAD A;  3CDZ B;  1F4H A;  3C7H A;  2B4K A;  3NJX A;  3I2J A;  1JHJ A;  2C4X A;  1JZ5 A;  4CU6 A;  4CUA A;  2ORX A;  4XUQ A;  1GOG A;  4L0P A;  2EIC A;  3J7H A;  1CX1 A;  2W95 A;  2VCA A;  4QX0 A;  3GDB A;  3OEA A;  3I3B A;  2VZV A;  3C7F A;  3WF4 A;  1KEX A;  2W92 A;  4W50 A;  2W1W A;  1PX4 A;  2EIE A;  3IAP A;  1GQP A;  3LPG A;  4QDR A;  3P6B A;  1ULP A;  3VD3 A;  3WF3 A;  2WZ8 A;  2WBK A;  2JD9 A;  2C26 A;  2Z4F A;  1GOH A;  3T2P A;  3A7Q A;  3OB8 A;  4XUR A;  1JZ8 A;  1JYW A;  1UYX A;  2W47 A;  2WZE A;  4M4P A;  4CU8 A;  2VZS A;  5G05 L;  2LW8 A;  1UYZ A;  1XPW A;  3SKJ E;  2W1Q A;  1GNY A;  5J1X A;  4A4A A;  5IHR A;  3DYO A;  2W9X A;  4BJ0 A;  1OD3 A;  3WNO A;  4QB6 A;  2BGP A;  3SKV A;  4A6O A;  2VZR A;  4XVH A;  2XQX A;  2X10 A;  5B4X A;  3HPN A;  3LEI A;  3HNM A;  3ZM8 A;  2WAB A;  2J1U A;  2WYS A;  3E1F 1;  3OGS A;  2VCC A;  2E32 A;  1JZ3 A;  1NX9 A;  2L9L A;  3BN6 A;  2E26 A;  3PUH A;  3P1I A;  2W5F A;  3I2F A;  3OG2 A;  1F4A A;  1HN1 A;  2WUH A;  1JYV A;  1ULO A;  2BGO A;  3GGL A;  1CZV A;  2YB7 A;  3WNP A;  3T09 A;  5HPO A;  2YFZ A;  4P5Y A;  3T2O A;  3DEC A;  4AAX A;  3DYP A;  2DCJ A;  3VDA A;  2WAO A;  1W9W A;  1R64 A;  3NRU A;  3ABZ A;  2VR4 A;  1DP0 A;  5DQ0 A;  1W0N A;  1JYX A;  2RJ2 A;  2YC2 A;  3OGV A;  3K4Z A;  3VD5 A;  1GUI A;  1OF4 A;  4XZU G;  3T08 A;  4MO3 M;  2XHN A;  1US2 A;  4ZXE A;  3OGR A;  2ZEZ A;  1WKY A;  1W8O A;  5CYY A;  3WQB A;  5F7U A;  5LCW L;  4DXR A;  1JZ6 A;  3CIH A;  3UNP A;  5EJZ B;  4E8D A;  4BXS V;  5LA1 A;  2YFU A;  3ACF A;  2CDO A;  3HOB A;  1UX7 A;  4CUB A;  2VQT A;  3VD4 A;  4FI9 A;  2W87 A;  3FHQ A;  3MBW A;  4KWU A;  3GM8 A;  2PQS A;  4JKL A;  4AG4 A;  4BK4 A;  4M4R A;  2LS6 A;  3PUI A;  4CUC A;  3LQC A;  3MUZ 1;  2J22 A;  1UMH A;  5JMO A;  2J1R A;  1NKG A;  4DXT A;  1YQ2 A;  3THC A;  2VZ3 A;  5LA0 A;  3WNL A;  4XUP A;  3K77 A;  2J1V A;  1JZ2 A;  2KD7 A;  4PT6 A;  2JE8 A;  3A23 A;  1D7P M;  5I0D A;  3T0A A;  4D8M A;  4HG6 B;  4OUE A;  1JU4 A;  1KGY A;  3C7O A;  4DEQ A;  3IAQ A;  3MV0 1;  1W9T A;  1H6Y A;  3UET A;  2J1A A;  2W3J A;  5IJR A;  1L7Q A;  2VC9 A;  1XC6 A;  4RN5 A;  4ZY9 A;  3SEP A;  1DLC A;  4QX3 A;  4DUV A;  4PF1 A;  4QB2 A;  2V4V A;  3T0B A;  4ZZ5 A;  4QX2 A;  4ET7 A;  3T0D A;  2HYX A;  2W1S A;  4LQR A;  5EJ1 B;  1UXZ A;  4MGS A;  2VMF A;  4XUN A;  2Y8K A;  1P8J A;  2HLE A;  4MOA A;  3D3A A;  3K4D A;  5JXI A;  1RYY A;  2XON A;  3I3E A;  2J7M A;  1IQD C;  4OMD A;  1WCQ A;  1EUT A;  2CDP A;  4ARY A;  4GWJ A;  2VZP A;  3WF0 A;  2X05 A;  1T2X A;  1SHW B;  3WSO A;  4KMQ A;  4A41 A;  5C7G A;  4JHZ A;  1CZS A;  2X09 A;  4MGQ A;  1PMH X;  4JKK A;  4P00 B;  1J83 A;  3F2Z A;  4W8J A;  3I2H A;  4JKM A;  2BZD A;  4W4Z A;  2WN3 A;  1NUK A;  2WAA A;  3CZJ A;  1W99 A;  3ACI A;  2JKX A;  3FHA A;  3IB3 A;  1EUU A;  2VME A;  5DN2 A;  4TXW A;  3AC0 A;  5G04 L;  1H6X A;  3THD A;  4BDV B;  3NJV A;  2ZEW A;  1W8N A;  2VZU A;  3HJR A;  1K42 A;  3VD7 A;  3EYP A;  4CU7 A;  2VTF A;  3VDB A;  5IFP A;  4OMC A;  3T2Q A;  1BHG A;  2QQI A;  2Y6H A;  1JU3 A;  2Y6L A;  2VZO A;  2VZQ A;  2ORZ A;  1JI6 A;  2XOM A;  4CU9 A;  2V72 A;  4ARX A;  4OZO A;  2VOT A;  3LPF A;  2VJX A;  5LA2 A;  2BBA A;  1UY2 A;  1US3 A;  3VD9 A;  3I2K A;  2QQN A;  1O8P A;  2ZEY A;  3I3D A;  3VDC A;  3LEK A;  2VO5 A;  3CZU A;  3I2I A;  4P08 A;  2YG0 A;  1K3I A;  3CMG A;  5JXG A;  3FL7 A;  3NQH A;  4D0Q A;  3U37 A;  1UMI A;  2DDU A;  3ACG A;  3C8X A;  2W94 A;  1UZ0 A;  3W5M A;  1UXX X;  4CVU A;  3I97 A;  2W1U A;  5JUV A;  5A1A A;  4YPJ A;  3K46 A;  2J1S A;  4QDQ A;  4TTG A;  2QBX A;  1GU3 A;  2VQU A;  2EID A;  4UOJ A;  1MPX A;  4RYD A;  3IDA A;  3JXS A;  2C9K A;  1JZ7 A;  1UYY A;  1OH4 A;  2DCK A;  4KI5 M;  3W5N A;  2QQJ A;  3CKH A;  2WN2 A;  3K75 B;  4QX1 A;  2WO3 A;  3HNB M;  3NNG A;  1J84 A;  1O8S A;  4A42 A;  5JXH A;  4QDS A;  5EIY B;  1UY0 A;  5B4N A;  2ZEX A;  5DMY A;  1PX3 A;  3EB7 A;  4PQQ A;  5DPN A;  4BK5 A;  2VMC A;  1O59 A;  4XUT A;  2E33 A;  3LE0 A;  3WNN A;  3HN3 A;  4UAP A;  4DUX A;  4DXS A;  3WF2 A;  2J1T A;  5IFT A;  1TG7 A;  5HXM A;  1JYN A;  1K45 A;  2QQL A;  3SEE A;  1UY1 A;  1JZ4 A;  2QQM A;  4ZZ8 A;  2WO1 A;  4A44 A;  2R7E B;  5JR2 A;  3MV1 1;  4DEV A;  2Y6K A;  4LPL A;  4XUO A;  2Y6J A;  3WEZ A;  5JXJ A;  4JX0 A;  1CZT A;  2JDA A;  4Z2A A;  3LEG A;  5IYY A;  3OEB A;  1GMM A;  1I5P A;  3HEI A;  2VCB A;  1XNA A;  1OF3 A;  2VZT A;  3I2G A;  2W46 A;  2J1E A;  4OYU A;  1XNT A;  2VMD A;  3DYM A;  4QB1 A;  4UI9 L;  1W9S A;  4DUW A;  1LNS A;  4A45 A;  2YC4 A;  3ETP A;  2VM9 A;  5C71 A;  3WF1 A;  2V5D A;  3MO4 A;  3ECQ A;  3III A;  3C7E A;  4GZ9 A;  3FN9 A;  3HNY M;  2QQO A;  1K12 A;  1UY4 A;  4GWI A;  3K4A A;  2QQK A;  1SDD B;  2Y6G A;  2BER A;  4QAW A;  4LHS A;  1OT5 A;  2VZ1 A;  3BGA A;  4QPW A;  1L7R A;  1NAE A;  1UWW A;  2B9V A;  1SG3 A;  2W91 A;  4E8C A;  2RV9 A;  5C70 A;  2OKX A;  2RVA A;  2Y64 A;  3CQO A;  4IUG A;  1GOF A;  2VL4 A;  3ACH A;  2WDB A;  2ID4 A;  3A21 A;  2ZXQ A;  4LKS A;  3GXU A;  2WO2 A;  3C7G A;  4P02 B;  3A22 A;  3MUY 1;  3WNM A;  3WNK A;  5CZK A;  2EIB A;  1TVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...