2XONA

Structure of tmcbm61 in complex with beta-1,4-galactotriose at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
SRNYLKNPGFETGEFSPWRVSGDKKAVKVVKANPSSNAHQGEYAVNFWLDESFSFELSQEVELPAGVYRVGFWTHGEKGVKIALKVSDYGGNERSVEVETTGWLEWKNPEIRNIKVETGRIKITVSVEGRAGDWGFIDDFYLFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of the Helical Structure of Beta-1,4-Galactan by a New Family of Carbohydrate-Binding Modules.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords ARABINOGALACTAN ENDO-1,4-BETA-GALACTOSIDASE
total genus 34
structure length 145
sequence length 145
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2xonA00
4DUWA 2EIDA 3ABZA 4XVHA 4A6OA 1RYYA 2DDUA 1UY2A 5CZKA 2QQLA 2J1RA 3NJXA 3HEIA 4QAWA 2Y6HA 2VCAA 3WF4A 3T0BA 2QBXA 1GOFA 5HXMA 2VZRA 1UY3A 5EJZB 5G04L 3NRUA 4BXSV 1O8PA 4XUOA 1L7RA 3OBAA 2VR4A 3J7HA 1JHJA 3I2FA 3U37A 2DCKA 1JZ4A 3WF3A 3WNPA 3CZJA 2W47A 1JU3A 1KEXA 2VZSA 3WF1A 3MV11 4PQQA 3C7OA 3SKJE 1SDDB 4M4RA 4PF1A 2LW8A 3OGSA 3VDCA 4DUVA 2XQXA 3FHAA 2JKXA 3UNPA 3HPNA 3VD4A 3CQOA 3HJRA 3T0AA 1P8JA 1UY0A 3T08A 3SEEA 1US2A 3K77A 4UOJA 2RVAA 2YG0A 3LEKA 4HG6B 3PUIA 5JR2A 2VZ1A 1D7PM 4ARYA 4OZOA 4CU6A 3FHQA 5LA2A 3FL7A 4LPLA 2JD9A 3MUY1 2B4KA 2J1SA 3GM8A 3C7GA 4QDQA 5IJRA 3D3AA 3W5MA 5CYYA 5LA1A 3LE0A 3ACFA 1XNTA 1TG7A 3SEPA 2E32A 3NNGA 4JKLA 1NKGA 3NJVA 4CU9A 3C7EA 4OMDA 1W9WA 3WQBA 3ZM8A 1CIYA 5JMOA 1JYXA 1DLCA 3I3BA 1NAEA 2Z4FA 4QX2A 4XUPA 1XC6A 3WSOA 3WNOA 4MGQA 4UI9L 1KGYA 4QDRA 2BZDA 2VQTA 2QQIA 1UYYA 2WO1A 4KWUA 3VD5A 4KMQA 1O8SA 4IUGA 2W1UA 2W3JA 5F7UA 1F4AA 3UETA 2XOMA 3HN3A 2J1EA 2QQNA 5JUVA 5DN2A 1YQ2A 3MO4A 3LEGA 1J84A 1JZ6A 1K42A 3OG2A 4A42A 1UXZA 2J1AA 4AG4A 3BN6A 2RJ2A 3EYPA 1UYZA 2VCCA 4LQRA 4JKKA 4QB2A 4A41A 2WO3A 1JI6A 1SG3A 3THCA 3T2OA 4LHSA 1H6YA 2WO2A 5JXHA 1CZSA 3WNMA 3WEZA 5IHRA 4P5YA 3MUZ1 4QDSA 5C71A 1F4HA 2VZVA 2ZXQA 4E8CA 2VJXA 4A4AA 3A22A 3LQCA 5JXIA 1JZ8A 2YB7A 3OGVA 2EIBA 3ACHA 4QX3A 2ZEWA 4XUNA 1IQDC 2C26A 2QQJA 2W92A 3WNNA 3MV01 4JX0A 4DUXA 2VM9A 5IYYA 5G05L 4W50A 3C8XA 1H6XA 2QQMA 4BK5A 2VZUA 3I2KA 5FUIA 2BGOA 2J1VA 2E33A 5C70A 2RV9A 2XONA 2VMDA 3CIHA 4D0QA 3BGAA 1UX7A 4XZUG 1NUKA 4TTGA 3C7HA 3WF0A 1CX1A 1W9SA 2WDBA 3OEAA 2VMEA 2V5DA 2X05A 4CUBA 2VZ3A 1BHGA 3THDA 2VCBA 2QQKA 3LPGA 1ULOA 3ETPA 3VD7A 2W1SA 4DXTA 3I3DA 3P1IA 3E1F1 2J7MA 2Y6JA 3OB8A 1UMHA 1OH4A 4DEVA 1PX4A 2Y64A 4BK4A 3HNMA 1US3A 3VDBA 2VZTA 5IFPA 3IDAA 2WBKA 4DEQA 1HN1A 2DCJA 1JYNA 2W91A 1GMMA 2BBAA 3IIIA 3ECQA 4XUTA 1UWWA 4P00B 3A7QA 4W4ZA 4E8DA 1PMJX 4QX0A 3GDBA 3OGRA 5I0DA 4TXWA 2W1QA 3HOBA 2WZ8A 2VMCA 4MO3M 4UAPA 3NQHA 5IFTA 2E31A 2BERA 3C7FA 4A44A 3SKVA 4QPWA 2OKXA 2VC9A 1CZVA 3FN9A 3WNKA 2W95A 2ZEYA 5JXGA 4BDVB 3IAPA 3ACIA 3F2ZA 3IB3A 2EICA 4A3ZA 1GOHA 1UXXX 1O59A 2KD7A 3HNBM 1W0NA 4M4PA 2ORZA 3I2IA 4Z2AA 3K4ZA 5LA0A 4W8JA 5JXJA 3K75B 1EUUA 3VDAA 1XNAA 4ZXEA 4ET7A 1SHWB 2J22A 3LEIA 3T0DA 4OUEA 1K12A 1OF4A 4DXRA 5A1AA 2C4XA 2VZQA 5LCWL 1GOGA 3I2HA 2W46A 1OD3A 4QX1A 4DXSA 2X09A 4ZZ8A 1UYXA 2E26A 2HLEA 2ZEZA 1JU4A 1J83A 5HPOA 1W9TA 1L7QA 4MGSA 3LPFA 5DQ0A 2CDPA 4PT6A 4RYDA 4L0PA 2VQUA 2WUHA 1GUIA 2YFZA 2W87A 3I2JA 4QB1A 2JDAA 2L9LA 1JZ3A 1UY4A 4JHZA 2VOTA 5B4NA 1JYWA 3DYMA 3DYPA 3GXUA 2VTFA 2ID4A 3IAQA 4CUCA 2ORXA 2VL4A 1GU3A 4BJ0A 4GZ9A 5EJ1B 3K46A 2HYXA 4OMCA 1NX9A 2LS6A 3VD3A 1W99A 3CZUA 3T2QA 2W9XA 2Y6LA 4MADA 3VD9A 4YPJA 4P08A 2V4VA 3I3EA 1TVGA 2Y6GA 3JXSA 4XUQA 1DP0A 2WAOA 2YC2A 2W1WA 1XPWA 2Y6KA 1PMHX 1JZ7A 2X10A 1GQPA 5DMYA 5C7GA 2WN3A 3W5NA 1I5PA 2PQSA 4D8MA 4AAXA 3AC0A 4JKMA 2YC4A 1UZ0A 2WZEA 2BGPA 2VZOA 1JYVA 1ULPA 2W5FA 5B4XA 3UESA 1EUTA 1CZTA 2YFUA 4ZZ5A 1WCQA 4GWIA 2WABA 4QB6A 3ACGA 2V72A 2Y8KA 3I97A 3CDZB 1UY1A 4ARXA 2WN2A 3PUHA 4A45A 3K4DA 4LKSA 3MBWA 3A21A 1T2XA 4MOAA 2WYSA 3I2GA 2VZPA 1DYOA 1LNSA 2VO5A 4P02B 4CU7A 1GNYA 5J1XA 4KI5M 1W8OA 2VMFA 3CKHA 3P6BA 1WKYA 2EIEA 2B9VA 3EB7A 3A23A 3T09A 2W94A 2XHNA 3DYOA 3HNYM 1JZ5A 1K3IA 1OT5A 3WF2A 2ZEXA 3OEBA 3T2PA 2QQOA 1OF3A 2C9KA 5DPNA 2CDOA 3WNLA 1K45A 3CMGA 4OYUA 5EIYB 4CVUA 1JZ2A 1R64A 2J1TA 3DECA 3K4AA 4FI9A 3GGLA 2R7EB 4GWJA 2WQ8A 1MPXA 1UMIA 4ZY9A 1PX3A 4CUAA 4CU8A 2JE8A 2J1UA 1W8NA 4XURA 2WAAA 4RN5A
chains in the Genus database with same CATH superfamily
1XNBA 1HV1A 4SLIA 2BDRA 1OOPB 3BVCA 1N3QA 1LHUA 4A6OA 1MVQA 2GN3A 3VZNA 2DDUA 1ULCA 1W06A 5HCBA 1E5HA 4YSFA 3KT7A 3AKTA 5FBJA 2VCAA 4EWDA 5FZHA 4LLFA 3CNAA 5GALA 1AX2A 3CJXA 5FY5A 5FZBA 5HXMA 2VZRA 4AE2A 1UY3A 3HAGA 4BXSV 1O8PA 1DG6A 3VV1A 3O1SA 4XUOA 3RSJA 4FAHA 3HT2A 2PHDA 1G9BA 4OI0A 5F5AA 5FJKA 3J7HA 4AI3A 3T1LA 5HCAA 1B09A 2JJ6A 2X5IB 4Q0QA 3SCFA 4BQ3A 5JCTA 1SCSA 1PK6A 3WF3A 3NW4A 1RUE1 1C8M3 2YV8A 3CZJA 2W47A 2R16A 3AP6A 1JU3A 2IXIA 3VB9A 1KEXA 5FKCA 3B94A 1N1TA 3B00A 3OBZA 1PK6C 3BU0A 4AI9A 5T52A 4PQQA 1KXGA 4NHMA 2EXKA 4YZ3A 4AFDA 3OPZA 1UOGA 4UW6A 2LW8A 2JDZA 1VRH3 3AKSA 1TME1 3OGSA 3FHAA 5FZEA 1BXHA 2JE9A 4ONUA 3JD73 4DY5A 5JIUA 1AUYA 4BU2A 4HKOA 1P8JA 4UBGA 2O8OA 4ISQA 3SEEA 4YZ5A 3BOWA 1R081 3FUOA 4B3NA 2FMDA 1WW6A 2XH6A 1GICA 2RVAA 3VDDB 4JHTA 2YG0A 1AXKA 2BFUL 3O7OA 4HG6B 1RVF3 2JG9C 2YZ4A 3ZXAC 5HI0A 1RUD1 1JS9A 2JG8B 4CU6A 1GQHA 1QF3A 1HX6A 3RDIA 3LIGA 2VXRA 4LPLA 1UU4A 3AXDA 3ASIA 3EHKA 1PGSA 5FAXA 4ASMB 3WQ0A 2BNMA 2HWF3 2JB8A 4JVAA 3D5OA 1ND2A 3QLQA 5AVAA 2OVUA 2RE9A 4WZCA 4ZS2A 5IJRA 1WCUA 2J42A 4Q0SA 2HWD3 3THTA 1LKNA 1DYKA 1QJU1 2YROA 4LBKA 1C57A 4LK6A 2WQZC 3M3EA 3NNGA 4W65A 4IE6A 4COZA 4FO9A 1OOPA 1V70A 5FLIA 1W28A 2VOVA 4IE7A 3B3QE 4JC1A 4L99A 4TN7A 3GZAA 5JPNB 1HKDA 3FZ3A 5FPAA 3ZO0B 4QPGA 3RVHA 3WQBA 1OH3A 4BE3A 2GZWA 1R1A1 5JMOA 3I3BA 2NM1A 1BZWA 2Z4FA 3WUDA 5FP4A 4HONA 1SLIA 1VBA1 2GU9A 3LCPA 3LDBA 3VBRC 1YJKA 1AL21 3ZSLA 4DQAA 3HBZA 2D5FA 3ILFA 3A0NA 4FXGB 3RWNA 1UYYA 2XJUA 1BK0A 2N7GA 2WO1A 3VD5A 4GB31 1AL22 2A70A 2JB4A 4KMQA 5CNAA 5FFOC 2W1UA 3WXPA 2ZX0A 1SLCA 2W3JA 4OI2A 3LA7A 3VBUB 2FZ2A 4YGEA 2VW0A 4IGQA 4QD2A 4IW3A 2ZHMA 4LJHA 4Q8LA 4NRMA 1YQ2A 4UFKA 2ZGKA 3MO4A 1IOAA 5KWRA 3BIEA 4Y22B 3ZSEA 1GQGA 4XABA 2AENA 3PVBB 5L7OA 1W2AX 5A3PA 1JH5A 4A42A 1QH6A 1UXZA 2A3WA 5FLJA 3EQEA 1HB1A 3J4UH 5CKMA 1AYN3 5F39A 1C1LA 4RS5B 4NIGA 3EYPA 2VCCA 5A33B 3AK0A 4DZGA 4M3CB 2FQPA 3N9NA 1UOBA 4NE9A 4QKFA 3I59A 1ZA4A 1WCDJ 2JDYA 1SG3A 5GLWA 1QJY2 4Q5OA 2WS91 1J1TA 3VL9A 4JDNA 4B4RA 5F3GA 1HW5A 1QJEA 3OSDA 4Q4W3 1REDA 2ZMNA 4I0WB 2ERFA 4P5YA 3WDWA 4NRQA 4QDSA 5FY0A 2Z5WA 4NHLA 2RDRA 4CRQA 1HN0A 2F6BA 3B9CA 5D1IA 4Y20B 4KWLA 3VBSC 5JXIA 1AJKA 3H9AA 2RR12 4Q4X1 3J9SA 3H1WA 1LEMA 2ETEA 3HQXA 1PO21 4QX3A 2VOWA 4BQXA 1D2SA 3N7KA 3JU9A 2NZ9A 1FI2A 4XE9A 2DTWA 5FYVA 1WCSA 2EXHA 2CYFA 2DCZA 3WNNA 1PHMA 1XU1A 2F4PA 3Q8AA 4HFSA 5IYYA 5A3UA 5A3TA 3RYPA 5K7PA 2JX9A 4Y5TA 2P1BA 4I0BA 3I2KA 2IXHA 5C70A 1IGOA 2JDMA 2IVJA 2XONA 4Q4Y3 3LA3A 2OZ6A 4CSWA 3CIHA 1YXWA 2WT2A 3ETQA 4D0QA 1LHWA 3ILNA 1RUOA 1UX7A 1OMIA 4Q8KA 3JD72 3WF0A 4COYA 3M2MA 1XYNA 1V00A 1W9SA 4MV2A 4ZPIA 2WDBA 1RVF1 2YDEA 3HQUA 3PMEA 4S2FA 4HT1T 2VZ3A 3BPSA 3WW4A 1TMF3 4NHKA 4FFHA 4FOYA 4MSVA 3AP7A 3PU3A 2R071 3ETPA 3ILRA 4PIZA 1VBA2 4I30A 3WR0A 4BXFA 3VZMA 3ZLIA 1KD7A 5IK4A 2LTNA 3I3DA 4LO4B 4AWDA 2FDIA 1TQ5A 1X36A 2ET7A 2B39A 5DUVA 3O1OA 2J7MA 1W90A 4WBBA 5L9RA 3HR9A 3OB8A 4XBNA 3AL6A 3J26N 1AR91 1RTVA 2X5IC 2UWAA 4Y1VA 5JAXA 4A3XA 4N53B 4LUMA 1OHFA 3HBKA 3IDAA 1PMIA 1S0BA 1F31A 2D5HA 3SEPA 2JIGA 2QQVA 1VMJA 4DEQA 1BJQA 1V6MA 3Q8FA 1C8M1 5FMBA 4YFZA 5C4WA 5DDJ3 2RHPA 1RUH3 3U07A 1DGRN 1ZVFA 2R061 4P00B 1Q8QA 5J48A 1LTEA 1Q8PA 2Z79A 3Q9OA 2WFF2 2VU9A 3FE5A 4QU1A 4HN0A 5IVVA 1N3OA 2VBPA 4PLMA 4BLJA 3I3MA 2EF6A 3ALQA 3E6DA 4QT6A 4X6QB 3OUHA 1U5IA 3OJBA 1VAKA 2CGPA 1VPHA 3RJRA 1I1EA 2P34A 4QQLA 4GA9A 3BU7A 4QPWA 4E4DX 2JDUA 3H42B 4HOOA 2OKXA 3PVNA 1PZ9A 2IZWA 2VC9A 5FY1A 1CZVA 5C3OA 1NE4A 5JOXA 1IPKA 1W05A 2HBTA 3ZX7A 3IAPA 2UYAA 2EAAA 3F2ZA 2WNVA 4FP2A 1W9FA 1BBT1 4NUBA 3OGJA 5C33A 2K46A 4MX3A 3MGUA 1GOHA 5FQ0B 3FX3A 5FTTC 4UFJA 1CAVB 1C28A 3L2YA 4LE3A 4NIAA 3GALA 4Z2AA 1QNWA 1ZRIA 2JXAA 4Q4V2 2BVVA 5JZGB 1LU1A 1W6OB 5FZMA 1W2UA 4XZPA 2VMHA 5LA0A 4J1WA 1UMZA 1W6MB 2QE3A 4LO5B 3VUOA 4CEWA 2ZGTA 2C1FA 2D6PA 4K1YA 2XBO1 2XVGA 4I0AA 2WQ4A 2F17A 4Q4V3 1LJ7A 2WJSA 3GCWA 2VTXJ 4PIYA 2NYYA 1UW8A 2VZQA 2WR9A 2W68A 5A3MA 1CX4A 4QX1A 2CGOA 1J83A 4IGOA 5IVFA 1HXS2 4RGKA 5A7NA 3UK9A 4MGSA 5DQ0A 2AH2A 3VZJA 5C8CB 3ZFFB 4RYDA 4PT6A 1YO8A 3DXUA 2O0OA 1GWMA 2WUHA 5A80A 4PI2A 5F8PA 4OVEA 4FAGA 1JBCA 2L9LA 4DRRA 1DQ6A 1HLCA 4AEDC 3KLSA 5CFCC 4AXOA 1Y9GA 2BWCA 4HZFA 3SCHA 3AMHA 2PHRA 3NAPC 5B4NA 1FNYA 5E89A 3DYMA 1QJX1 3DYPA 3NL1A 1GP4A 2ID4A 2RMU2 4I09A 1E5SA 2RR13 3GJAA 3B5LB 3H50A 1FYUA 1N3PA 3ELNA 4UW4A 1RVF2 1S0IA 2ARBA 1MACA 4TLGA 3PIJA 3T3YA 4BJ0A 1O5LA 2EA7A 3VD3A 1S0JA 1UO9A 3CZUA 5FMOL 1WWYA 5JI9A 2K9ZA 4OFGA 1DQ5A 4YPJA 4P08A 4U2AA 3I3EA 4D6RA 2YC0A 1DFQA 3RWKX 2QUOA 3DGTA 1EPWA 4CDWA 3E97A 4N7IA 3USUA 3KWVA 4GH4A 1RHI3 4YW2A 4NHYA 2YC2A 1VLNA 2Z2SB 5DG2A 3OD4A 1XPWA 2GNMA 5F3IA 2WNVB 4QXHA 5K8SA 4XMIA 4QX7A 1ND3C 1PMHX 3D82A 1H9WA 1D4M1 2XJVA 1GQPA 1OUXA 1NLQA 5A7WA 2RDSA 2AC1A 5C7GA 2B46X 2RM22 2WN3A 5GZGA 1UYPA 3PNAA 1UL9A 3CBNA 4LO8A 1F9KA 5C5UA 1W04A 2ZJCA 1H1MA 1OXCA 1ZM1A 3OCPA 3AC0A 3WDXA 3SMHA 4EZ4A 2W39A 1ZRFA 1QJU3 2G1MA 4EZHA 1WMEA 1H4HA 1QGLA 3RZLA 5DXDA 2PQQA 2W5FA 5B4XA 3BTZA 2HYKA 4IV1C 2CSGA 4DPNA 3WG4A 1CZTA 1RMU3 3TBDA 4CYDA 1VR3A 4ZZ5A 1OURA 4GWIA 1PVC1 3NVCA 5D21A 1NE6A 3DKWA 2ET1A 4XFCA 3KD4A 3RYRA 1IG3A 1Y43B 5FUPA 3NNMA 1J59A 1CJPA 4UF0B 3J8F3 5L36A 4Y5SA 1VB4A 1QJU2 1ZBE3 1AR62 1Q8VA 1AXYA 1V6NA 4A45A 3HQRA 5A3OA 5BNPB 4M0NA 1V0AA 5E1RA 5K9YA 4FSJA 2AR6A 4XBLA 5CFDB 1O3QA 1RITA 1MEC2 3MBWA 2ZPXA 3M70A 1R083 1GZCA 5TSWA 3ZMOA 4V2WA 1AJOA 2A6WA 2XLGA 1LOBA 3QOPA 2VZPA 5EFUA 5I0SA 4RQPB 1DYOA 1AX0A 4GXLA 4MGIE 4CU7A 3MW2A 1GNYA 1COV1 4QHZA 5J1XA 2YY1A 5A6YA 1V9U1 1O4YA 2GN7A 3LB9A 1WKYA 4HVRA 4KNCA 2XWJB 4BQ4A 5FZ1A 2XHNA 4CDUC 1K3IA 1AR82 3I54A 1OT5A 4MGYE 4XCBA 3GZEA 4IE0A 2MEV1 5A3WA 2VVEA 4S2GA 3T2PA 3O1MA 5BXXA 3EO6A 3VGIA 4D69A 1K5MA 2C9KA 5F1RA 4OCTA 4L11A 5DPNA 3CMGA 1MVEA 1NLRA 3KS7A 2BOJA 4G3YC 5FZ9A 4JQTA 1YEWA 2WT1A 3DECA 1PO22 1MQTA 3K4AA 3KGLA 3MLLA 3POSA 1RINA 2R7EB 3IMMA 3JB8A 3OYWB 4D7YA 4WM7A 5D8AA 1VAVA 4CDQA 1N47A 5AFEA 1UMIA 1WLTA 1PX3A 1H8TB 1SLTA 4ZHNA 5F5QA 4JGZB 1AXZA 2J1UA 4P14A 2Q5TA 5A3LA 4IV3B 3MIEA 2HWC3 1DGLA 4QPYA 1U12A 1RUH1 1QU0A 4WM7C 1ZZCA 5D8AC 3EMRA 2Q1FA 5FP9A 1QJY3 1DBNA 3Q8EA 4PI0A 1L7LA 4XVHA 3RG0A 1LGCA 4BWOA 1FOD2 2DCTA 1QJY1 1YJLA 3E5XA 1UY2A 5CZKA 2WYFA 2VPVA 2J1RA 4NIIA 5FBZA 2ZX1A 2FHRA 4PDWA 3OPWA 2YUEA 5C9AC 2OUHA 4KGQA 1H2LA 5DAVA 2QBXA 1AYM1 1HDKA 3FWEA 3AKQA 4KWKA 1GZ9A 4NHXA 3F95A 2VNGA 3MIHA 1XNCA 4JGZA 2I07B 2RR11 5GM0A 3OBAA 1X82A 2XG3A 3K2OA 3U4XA 3S5AA 4UYBA 3RMXA 3UL2A 2WZR2 1W8UA 2YMZA 1RUE2 1LENA 2G9ZA 1XB9A 4V1PA 3U37A 2WIIB 4WM8A 3DV8A 1HB4A 1OLQA 1V6KA 1XOYA 1ULFA 2XHKA 3N7MA 4MUVA 1CAUB 5K4LA 3FC0A 3URFA 1LHNA 5JDBA 1TMF1 1NYWA 1MQTB 4IDZA 2VG9A 4YFWA 1TMF2 5FZ4A 2HWB1 3HIFA 2G9FA 3OBTA 2VW2A 1C5IA 4LBQD 1AX1A 1SDDB 5IWFA 4PF1A 3SC7X 1POQA 1L3JA 2C0ZA 1XSQA 3VDCA 4DUVA 1T6BX 2XQXA 2JKXA 1G9FA 1IKPA 1UNBA 3HJRA 1ENRA 2WT0A 3IZOA 3KV9A 5IUQA 3T0AA 2D6KA 1UY0A 3UV9A 3VBOC 1ASJ3 1QH7A 5LK5A 1GBGA 1US2A 4N9HA 3BODA 3EBRA 1LGNA 2P3IA 1CAWA 5A1FA 2HH9A 4CCCA 4L8QA 1PVC2 2VUCA 3PUIA 1GNHA 1WW4A 4TLFA 4FOQA 4D6SA 5JR2A 1ENXA 2QDNA 2VW1A 2Y0IA 2R043 1O5UA 5DDJ1 1UCXA 4LTAA 5LASA 5IAXA 1LODA 3FL7A 3S7IA 3POEA 4XJ8A 2G4IA 1G9DA 1KDMA 2B4KA 3NWKA 4Z82A 4FTSA 4DOUA 1OOPC 2Q8DA 3KGZA 1OA3A 1W6NB 2R32A 5KC6A 5CYYA 2WNUA 4CP9B 2BNNA 1ODNA 1NCRC 2DU0A 3MIBA 2EIGA 1IPSA 5DABA 1TG7A 1OLME 1OQ1A 2E32A 3INAA 4FPOB 4GWMA 3DPRC 3N36A 4FPLA 4LBLA 3ZYJB 5LY1A 2QFEA 2VOXA 5I93A 2XPJA 4R9AA 4CU9A 2PTMA 2Y38A 3C7EA 3NNJA 3BKZA 2BU9A 4ZONA 3SHRA 3ZM8A 4DNYA 3UKTA 4HLTA 4Z8BA 1PIV2 1GP5A 2VCMA 4NRPA 5EZWA 2EXIA 2D97A 5LB6A 4QX2A 1OLRA 3VKFC 4XUPA 1FNZA 1PGW2 1XC6A 2PAMA 2Q30A 3WSOA 1R1A2 3ZDSA 2RS33 3UT0A 1ALYA 4MGQA 5A6QA 4FOWA 4YVWC 4CXYA 2PHFA 1BQPA 1KGYA 1PO11 4XACA 2BZDA 2VQTA 5C3RA 1O3RA 2QQIA 5FYCA 3VDDA 1IPJA 4GH4B 1RUJ2 4ZU4A 4AI2A 1VBD3 1Q43A 5CB7A 1AR61 2ZX2A 2UWBA 4IUGA 3KV4A 1F4AA 2GC3A 1LOFA 1UU6A 2LALA 3NMBA 4RR3C 3HN3A 4YW5A 5HXVA 4YYOA 1LB2A 1HRV1 3WV6A 4LBMA 4COUA 1J84A 2ARCA 2XUMA 1CD3G 5A7QA 3H1MA 3H7YA 3AL5A 1K42A 3WW1A 1YFXA 1YHFA 2J1AA 2BRTA 2CAVA 5CADA 1LOCA 2LUWA 2P2KA 3BN6A 4QPGB 5FP8A 4AG4A 2DTYA 3IKWA 3I2OA 4IEPA 4IEQA 3AYCA 4AQ2A 4KG8A 1QOSA 3MW3A 2PHUA 4QPIB 4QB2A 3M3OA 3VBHA 5F9TA 4NIDA 2ZMLA 4NIHA 1JI6A 1YIPA 3IDEA 3P3NA 4QHBA 3THCA 3T2OA 4JGYB 1SBFA 1H30A 1H1AA 2D3PA 1RJ7A 1FMD3 4NAOA 4Q29A 1BEV2 3AP5A 3RRDA 2XMLA 4MG2A 5FPVA 4HL0A 3GJBA 3MUZ1 4I3GA 1F4HA 3ZXFA 1A3KA 4QXKA 1IZ3A 1OVPA 4AVCA 5LW9A 2JG8A 4NPRA 2ZACA 1DGRA 2AYHA 1IG0A 4CDWC 1QEXA 4GH4C 2Q8CA 1HRI2 2JICA 3WG1A 1IQDC 3W58A 1HQWA 1PZ8A 1VE0A 2FCVA 2QQJA 5FY4A 2W92A 5A6ZA 5JZGC 4CZSA 5FZ0A 1JHNA 3MV01 4FPKA 2D3SA 2VM9A 3ZN4A 3CHXA 4D3WA 3IDBB 2R30A 3NJYA 3WD5A 5G05L 4YZ1A 2GAUA 1AYM3 4K40A 2ZHLA 2Q8EA 2ARXA 1LU2A 1W6OA 1H0BA 1R092 4BK5A 2VZUA 5I8TA 5ISLA 3ES4A 2ADDA 2VD7A 4XETA 1NOVA 2VMGA 3MIDA 3ZSMA 5FZKA 3LSEA 4RGGA 2VMDA 2VUDA 3WW2A 1VBD1 2QQPA 1SCRA 3BGAA 1DQ4A 2JDKA 3SH5A 4XZUG 1ACCA 1N1SA 1NUKA 4XQWA 1CX1A 3P3PA 2CGNA 4O61A 4A7YA 3AM2A 1SZBA 1TZOA 2VMEA 2V5DA 4IEWA 2B42B 2X05A 3W20A 4UXAA 1LGBA 4LBOA 3DCQA 1PIV1 3KMHA 4Q27A 1VBE1 2X5IA 1UZVA 1DU3D 1JOPA 3LPGA 3O0WA 4QMAA 2ZZQA 1BLZA 2H6CA 2ZGMA 4GALA 3AFGA 1QOTA 4HPKA 4RR3B 4E2QA 1DIWA 1ZNPA 3ZFEB 5FYMA 1Y3TA 5FZ6A 2XVKA 2Y6JA 4LHKA 1QDCA 5C4WC 2ZGQA 1WUVA 2B9UA 2DF7A 3FLPA 3NV2A 5E88A 1NA1A 4CPBD 4N7UA 3MEPA 4P5HA 4BK4A 5FPUA 2A5ZA 3HNMA 1A78A 3POYA 4QM9A 4NVPA 3VBRB 4Z1VA 4RS5C 2NMOA 4LBQB 5IFPA 2WBKA 3R05A 3RI8A 4UW3A 3A0KA 2DCJA 3OF1A 1AR63 5ACA2 4I01A 4BCUA 1GWKA 1OQEA 3B01A 1UZYA 4N9IA 4N8MA 1NG0A 1SACA 3O1UA 3BCWA 4LIUA 4LKFA 3ZXLA 4H14A 1Z78A 5I8YA 3R0RA 4XUTA 4CDUA 1I6XA 2FCUA 1RUD3 4KL1A 1PMJX 4QX0A 4K8FA 5C6CA 5FKBA 5FIXA 2CY6A 1RUF2 1QIQA 5BNPA 4ZU5A 4TXWA 1BVP1 2H0BA 4AVVA 4CXXA 1QOOA 1R1A3 4MO3M 4FCAA 2E31A 2HEYF 2WNVC 4GB32 3N7LA 5T50A 2QZ2A 2BERA 2V09A 4FTEA 4FPFA 1AZDA 2P4EA 5A3NA 4A44A 1QHDA 3P5BA 4B4QA 4XF1A 4K1ZA 4CCLA 2VULA 5IW0A 4W6WA 3WNKA 1WW7A 1ENQA 1NCQA 3GBFA 3WDYA 4OHXA 4LIVA 2CAUA 4BDVB 5J3UA 3WW3A 1YFWA 3BUCA 3M7AA 1MEC1 2JKBA 2WA4A 1OQDA 3J7LA 3O0VA 4H55A 3QD6A 2BGCA 1JN2P 4Y4RA 4MLOA 4QQ2A 4RN5A 4E9KA 1WD4A 5K0UB 1W0NA 4LR4A 2CHHA 2VVFA 3HT1A 4Y5Z0 2WC2A 2ORZA 3I2IA 1EPZA 2C9AA 1CAUA 3K4ZA 3ZMNA 4LOTA 5T55A 4MXWB 3ZPOA 5FUNA 4YW3A 4DB5A 4XDQA 3K51A 2E7QA 3LWCA 3U78A 3VZLA 4XQDA 3LSDA 1W6PB 2OXBA 1KJRA 4W8JA 3GZUC 5JXJA 4YRDA 1ASJ1 1PO12 3KVBA 3M3IA 1LOGA 3FHIB 1DGWA 2NLRA 1NQJA 1X8EA 2E7AA 3OD0A 4IEYA 5FZOB 4R4XA 1PO23 3K3OA 4KQ7A 3AMMA 1NY71 3ZVXA 2J22A 4Q1PA 3RQ0A 1N1VA 4AZZA 4XJZA 4B7KA 1VMHA 2P6HA 5BNQA 1VBC1 3U1XA 3WHTA 1CR7A 1OD3A 4PJYA 5CG8A 1VIWB 2HLEA 5FZOA 1EP0A 2KXLA 3HMYA 4FPHA 2VY0A 4BIOA 4G9SB 1U5ZA 4XF4A 4XYXA 1PO13 4P9XA 3TWIA 4GKXA 4NOTA 5GZEA 2CDPA 3M4FA 2GNTA 2O8QA 1VP6A 4IV3A 1BYHA 3MIGA 3OYWA 2YFZA 5K0UA 4DIQA 3I4IA 1SBEA 3I2JA 2JDAA 3JBG2 3RZJA 1JODA 2VAUA 3EJKA 2A6VA 1W8WA 1JZ3A 3LKJA 1UY4A 3KF5A 3MICA 5EP9A 1AYM2 3ITQA 2BJSA 1MS4A 4GMP1 4DY3A 1JYWA 4V2VA 2QJVA 3NV1A 3SCGA 1JYCA 4OUMA 4CUCA 4QGNA 1X9TA 1OVSA 2BQPA 4EN8B 1H2KA 1A34A 4QQHA 3CO2A 2ZX4A 4E2GA 3WNXA 4ATEA 3PUSA 4OMCA 4BZ4A 2IXKA 4LHLA 1NX9A 3WQ7A 2OPWA 2LS6A 3ZYRA 3TN93 2C5DA 1Y9QA 4LA3A 3T2QA 4NN0A 2IC1A 3UGHA 4QPIA 5C3PA 3RZGA 1RUNA 5FYBA 5T5JA 3ZYBA 1ZX5A 4OQ8A 4OULA 4UFLA 4XF0A 1CVNA 1TVGA 5JSPA 1SFNA 4GQ7A 1GSLA 2Y6GA 2VQAA 2A75A 4HMZA 4XFBA 4CEYC 1S0GA 4CEWB 1A6CA 3RS6A 2HWB2 4N43C 2B5HA 1RUI3 1R091 4R4ZA 1GFF2 2Y6KA 4PLNA 4BMEA 5DAWA 4LORA 4O65A 2PELA 4CDUB 4X6RB 4XFAA 2WRAA 1BKZA 4LKDA 1OD5A 4XFFA 2RJKA 4XTMA 4ISRA 2PQSA 5EQUA 1VRH1 1S0EA 2H6BA 1NA1B 4JKMA 2YC4A 4MHRA 1UZ0A 2D98A 2KA3A 1SFPA 2PN5A 3CL1A 1WBLA 2BGPA 4RGAA 1PVC3 1KS5A 2XWBB 4IEVA 5FK8A 4N43B 2WNOA 4XEZA 5JLVA 2XDVA 1OA2A 1WLDA 1TNRA 5IATA 1WD3A 3ZR6A 3QACA 2RS12 4EYUA 1X50A 1CWPA 1AR83 5ABJC 2NN8A 1IS4A 4RSUA 3LEMA 4QB6A 4H7MA 5F2SA 3SITA 4NROA 4A6SA 3RMYA 3T2TA 4QGMA 5FZGA 4WVMB 5FZ7A 2BW8A 3ACLA 2R49A 3TRSB 3CDZB 1GKBA 4GAZA 4QWNA 3VBFB 4AI8A 4Y1UA 5ANQA 4Y1ZA 1WGPA 2DBIA 2JE7A 5JI7A 3PUHA 3WG3A 1HRV2 4FVVA 3ST7A 5L7OC 4WVWA 4Y1YA 2WSVA 1M06G 2BP6A 2G9GA 1W39A 2QZ3A 1RUJ3 3A21A 1CESA 2W08A 4A2UA 4P9IA 4IEUA 3RZHA 3ON7A 4RHV3 2K0GA 1ONAA 4AFMA 1RUF3 5L9BA 1BMV2 2Y34A 1TME3 1DZQA 5IVEA 1VBC3 1NXD1 1E57A 3KB5A 4FT8A 3CKHA 1OPOA 4L2NA 3WP3A 1CPNA 3GNEA 5D2AA 5GJ6A 3JBG1 3NKGA 5I91A 3PL0A 2B9VA 4YVSA 3E6BA 5FZAA 4W6YA 3OTFA 5FO8B 1JZ5A 2XL9A 1S0FA 1W6PA 1SMVA 2WFF1 2VE1A 1ND3B 1VJ2A 4O9EA 1RUJ1 2G19A 4PF5A 3GHNA 1S2KA 2RMU1 4XDPA 2CDOA 2RDQA 2SBAA 2YGLA 1LHVA 3WCSA 2QQUA 1R64A 3U11A 3WP5A 2VUAA 3VBFA 4HKWA 1CAXB 1X9PA 1W0PA 1ND2B 3I59B 3PHMA 1MPXA 1RGSA 4ES9A 1B35B 3V0AB 4I3PA 3IPVA 2JE8A 5JR7B 3LDKA 2O14A 2D3RA 1O91A 3ATGA 1N1YA 5EWSA 3VBSB 2ARAA 4XURA 2Z42A 3H3LA 2XJTA 4Q0PA 4BHPA 5C9AA 5LEJA 1SLAA 4FFFA 5JPMB 1DZTA 1FMD1 2I74A 1OI6A 2DVBA 4OLLA 3SISA 4DUWA 2EIDA 3ABZA 4Q4Y1 5LRSA 4XCAA 1FMD2 1S55A 3N3HA 4FFIA 1AR81 5A1LA 1QQP1 4LOSA 4YGDA 4XXPA 1IKQA 3CEWA 1YWKA 1RL3A 4QX8A 2D7FA 2DYCA 1BK1A 4LITA 1FV2A 2RS52 5EJZB 2I2SA 3NRUA 1R093 1MZFA 1X8MA 1L7RA 1OFSA 1MS9A 2A7AA 3CF6E 3D6EA 3IWZA 3POIA 4YM2A 2BWAA 2TNFA 1UX6A 4Y20A 1KFXL 1GWLA 1WA6X 2OQ6A 3OY8A 4F3JA 1WMXA 5FPZA 4GMP0 1ENSA 5CVRA 1JZ4A 2FDHA 3H8UA 4JDMA 2E6VA 2XJRA 3BI3A 1W2TA 4QQOA 5J96B 4Q26A 5LBEA 4L9BA 1WA4A 3ZOIA 3BTYA 1H8VA 5A7OA 4P9GA 1GNZA 2DUPA 3MV11 2JDHA 2ZOEB 4JV4A 1VBB1 3VBOA 4E4ZA 1UIKA 3KM5A 4URTA 4DMIA 3C7OA 3ZFGB 3KHCA 3WX5A 2ZHKA 4RQPC 5I8SA 4M4RA 4FPJA 3QH7A 1R1ZA 2Y0OA 4FXKB 4IESA 5A6XA 3DXTA 5BV6A 3ZXJA 5BNOB 1QJX3 1GZTA 2GNDA 3TN91 3UNPA 3HPNA 3VD4A 1XE0A 3FBYA 3T08A 4B1MA 2A6YA 1RJ8A 5FY7A 1AYN1 4ZKTB 3TEZA 4LMFA 1FV3A 3K77A 3OGGA 4IGPA 4UFIA 3LAGA 4CP9A 4Y22A 1FPN2 3ZFEC 3PURA 1RHI1 2FCTA 3POJA 4KWJA 4XXAA 3MF6A 5IAVA 2VZ1A 3I49A 3PMSA 3DPRB 1D7PM 2R072 3I2DA 4ARYA 1WZXA 2TBVA 1SPPB 3KF3A 4R9DA 1D0HA 2ZGSA 1IHMA 3FHQA 3PVEA 4Q4X3 2UY8A 2ZCWA 4B29A 4AHXA 2XLFA 3N9QA 4K20A 1S1AA 2PYTA 2JD9A 3MFCA 4IV1B 4S2HA 5CKNA 5GZCA 3SH4A 4J1XA 4NWVA 2VECA 3L2HA 5FJHA 3U14A 4JZRA 3GM8A 1SDWA 2HBUA 3ZKUA 3C7GA 1W8FA 1GLHA 3GCXA 3W5MA 5LA1A 3LE0A 3AJYA 1AR93 4K7JA 5H9PA 2VH9A 1XNTA 2WINB 5EHDA 2D43A 4LO6B 4LBQA 5IK8A 4JKLA 5JWPA 1NKGA 3NJVA 3LOIA 3UJOA 4CCNA 2KM2A 3VHPA 3LFIA 2LROA 5EJ3A 1D0GA 5ERLA 5LEKA 3GZTB 4OMDA 1RB8G 3TNPB 4QKDA 2R062 1ULDA 1CIYA 2A3YA 4AQTA 1DLCA 3GF6A 4KH9A 4NPLA 5KHJA 2ENRA 1NAEA 2YPDA 3N9PA 4BH9A 1DQ2A 2D6NA 3WNOA 1HRI3 2OW4A 4WZFA 3D0SA 4UI9L 1RUC1 5EYXA 1UPSA 4IEZA 1MZ6A 1QXJA 3BYWA 4QPGC 4J6GA 3OUIA 2QKDA 4ZS3A 4BQWA 1O8SA 1H2NA 4LT5A 2WWUA 3AFKA 2VTXA 5F7UA 5DAPA 3UETA 5JMCA 2ZABA 4M00A 4XQ4A 3JB4C 2ZKNA 3X29B 1OLMA 2QQNA 3AJZA 4AQ6A 3KCYA 5JUVA 1UN1A 4IERA 1VBC2 5FCCA 4D94A 4MGZE 1UPIA 1NQDA 1JZ6A 5CAZA 2PAEA 1MS0A 2WZPP 1MZEA 3JQXA 2RJ2A 2C6SA 2PHLA 2EALA 3DEMA 1UYZA 4LQRA 2R1BA 1TNFA 4JKKA 4PBPA 5FO7B 4A41A 3O0XA 2WO3A 4EV0A 2YXSA 3HD8B 2ZKLA 3KQRA 2XQRA 4TYSA 4YW7A 5EPAA 1C3HA 5C8CC 2B8MA 3C3VA 4WM8C 3WZ1A 5DUUA 5FYZA 2BUKA 2WO2A 4EN7B 4IE5A 1NZCA 5JXHA 3E6CC 1KRIA 5IVJA 4LK7A 4IV1A 3BTAA 3WNMA 2P3YA 4UF0A 5IHRA 3H7JA 1AL23 4YG6A 5L73A 5LBFA 5C71A 3HN1A 3QCWA 1X7NA 2QVSB 3KZ4C 2ZGUA 2AREA 2WLPA 3AVRA 4LO7A 4OI4A 3ZR5A 3A22A 4M3CA 2XUEA 1DGWX 3OGVA 1OBNA 4XJ9A 1NA1C 2ZEWA 2YU2A 4QXBA 3TAYA 5CEHA 4IEOA 4BQYA 2B45X 2Y6FA 5H9QA 3VKMA 1RUI2 1UQXA 5H9RA 4CEWC 5DDJ2 1RMU2 2WNUB 5FPLA 1V6OA 1STMA 4JX0A 2WL1A 4S2DA 3ZYIB 4AVSA 4Z92B 4BOWA 1LESA 4MHUA 1DDLA 4W50A 1MS8A 1H4GA 3C8XA 5IVBA 3KCCA 1H6XA 2DFCA 4CXWA 2QQMA 4HSLA 5T5PA 3R4DB 3VBUA 1W6NA 1Y4WA 5FZLA 2BGOA 4HN1A 2J1VA 1S4CA 3CLPA 3NKTA 4OHZA 2XR4A 2RV9A 2YBPA 4AYUA 5FLHA 2RS32 3OY8B 3W59A 4JAAA 1LECA 5GLTA 2A6ZA 2WWJA 3BTXA 5CISA 2OIIA 1ZZBA 3AMNA 1R082 2I45A 3AZYA 5HCFA 2HKXA 3S7EA 4K21A 3MZHA 2VNVA 3ZN6A 3MI8A 3O14A 1VALA 4OQ9A 1UZWA 3TOJA 1BHGA 1NXMA 5GZFA 1SLBA 2VCBA 3Q8CA 2QQKA 1ULOA 1XNKA 2UWCA 2P6CA 4DXTA 2R073 2UY9A 5T5LA 4FP3A 5DG1A 3LOBA 2C24A 5L19A 1LOEA 1REFA 4AFBA 1DHKB 3T4HB 2DUQA 1PX4A 1SBDA 1US3A 2VBBA 4HPKB 2ZBJA 1W3XA 4YLZA 4N53C 3SQOA 3WOGA 2NP0A 1LHOA 3VHRA 3ZFGA 3T1MA 3USSA 1GMMA 4GB33 4Y26A 2R041 4JGYA 3UGFA 2BBAA 4MGTA 3KVAA 5KXBA 2OT7A 3RPQA 4BLIA 3MDPA 5FWJA 4AFAA 3A7QA 2IVIB 4YWAA 1UOJA 4M0HA 4A7ZA 3GDBA 4ORFA 1YI7A 3S57A 2MPFA 5I0DA 2Q0AA 2DV9A 4FQ4A 2W1QA 3HOBA 1NCQC 1IQAA 2WZ8A 2VMCA 4QXCA 3TEWA 3NQHA 1A8MA 1SFYA 1HRV3 2VOKA 3R4SA 2PLV1 5GKAC 3JBG3 5M0TA 1XSRA 3IM0A 4Y24A 5B2GB 3VBHC 3MPPG 1VMFA 1EV13 2ZHNA 4EE2A 2HEVF 2RDNA 2JIJA 3FN9A 4OZXA 2ZEYA 2HWF2 4FFGA 4AL9A 5JXGA 4JRAA 5E16A 4YGCA 5I0TA 3ACIA 1YIFA 2QDRA 1QQP3 1O4ZA 2ZX3A 2JG9B 4META 5H9SA 1ZZ9A 4ASKA 2EICA 4A3ZA 2F4LA 5T54A 1KDKA 5EV7A 2KD7A 1QY4A 2GH8A 1FOD1 3WINE 4CP2A 4WM7B 5D8AB 1LAJA 1QDOA 2MHFA 4RD7A 4XHBA 3FBMA 4JGZC 4E2SA 4AGVA 1H8TC 4KU7A 3MF9A 4XILA 4A7KA 1QQP2 2DUOA 4XF9A 4CCEA 3BIWE 2WFPA 1Q5OA 1EUUA 3VDAA 2P3KA 3GHMA 2E7TA 2HWB3 4XHXA 1XNAA 2PAKA 4UT5A 4ZXEA 3SXWA 4ET7A 5F6KA 5JOWA 3LEIA 3ZKYA 1URXA 3EXUA 1K12A 3ORJA 2ZGPA 4H3WA 1OF4A 4CEYA 5KHGA 4JTNA 4N43A 4DXRA 5A1AA 2C4XA 3POFA 4LHNA 3I2HA 1JUHA 2W46A 3OPTA 5FOJB 3CJIC 3WQ1A 1UYXA 3AKRA 4GJZA 3NAPA 3V65A 4ZZ8A 2HWC1 5HPOA 1FXZA 1W9TA 5C4WB 3G7DA 1L7QA 2B7YA 1Q8SA 4RHV1 4BMBA 3LPFA 3V0BA 1QWRA 1W6MA 1ZREA 1QMJA 3POWA 4L0PA 1S0DA 3M3QA 4NJ4A 4BQ2A 3UYJA 4CCDA 5JSOA 1CAVA 2W87A 4QB1A 4AHWA 1CIWA 5ABJB 3PTRB 5JVVA 2Q1ZB 3DN7A 5BNNB 1RUH2 2OUJA 1HB2A 4AAPA 3T4VA 4JHZA 2VOTA 5LATA 3V64A 3VHOA 1UKGA 1AF9A 3GXUA 2XJQA 2VTFA 4ATFA 2OPKA 4IQPA 3IAQA 4YGBA 5FYTA 4ZXKA 2FBEA 3OUJA 2ORXA 2VL4A 1GU3A 4AFCA 2RS51 3FJSA 4LNVA 2PA7A 5FDBA 2HYXA 5FMOS 4E27A 3POBA 1UAIA 1PVXA 1W99A 3UKNA 2HJIA 1K5MB 4C90A 2RS13 2Y6LA 3NJZA 4W6XA 5GLZA 1JTZX 5FPBA 1ULEA 2P3JA 5DZGA 3VD9A 4ITCA 1NZIA 3PJQA 3RZMA 1VBB2 5HCHA 3ZXKA 5FPXA 5APAA 5IT6A 2E63A 2WNUC 1FX5A 1FPN3 4AI0A 3SH3A 1AR92 4CCKA 1I5ZA 2CV6A 4DINB 2WAOA 3VZOA 2W1WA 3PUQA 4U36A 4URAA 2JG9A 1JMUB 2ZMKA 4LA2A 3VZKA 2QTWB 5AVPA 4Q0VA 3QBQA 2FMYA 2XJPA 2XKOA 3UJQA 2X10A 3ZXEA 3ZXGA 1JZ8A 2A1XA 3UGGA 5LBBA 2VXJA 2FDJA 1J58A 1I5PA 5CIRA 5LY2A 4DS0A 1I3HA 4K8RB 1W3VA 5CFCA 1DZRA 4GIQA 2RM21 2ZGRA 1JYVA 3D8CA 2GALA 1A8DA 2PMWB 1ULPA 1RUF1 1FPN1 1VBE2 4XAAA 1MS1A 3MPBA 4FPEA 4JDOA 2YFUA 4TSVA 1MS5A 1WCQA 2VNRA 4UFHA 5I0UA 4R8HA 4HVOA 4JCKA 5FREA 3ACGA 1IS6A 4IL7A 3RZKA 2Y8KA 1LULA 3I97A 1ZBA1 1ZRRA 2CWSA 5DUWA 1UY1A 4AF9A 2AGSA 3O1PA 4JGYC 1POV1 4ARXA 2VGDA 2WN2A 4CPBA 1FT9A 3PLQA 1FOD3 2H0VA 1V6IA 3K4DA 1ULGA 4AQSA 1VBE3 4AHZA 4QPIC 5T3NA 3KSCA 4LKSA 3ZFFA 4CE8A 4EWAA 1T2XA 2DVDA 1XYPA 3W9AA 4EJRA 1XQNA 3I2GA 4QX5A 2ZGLA 3WLUA 1XJAA 4ASLA 4H7LA 1H1IA 2ADEA 2LRPA 2WNEA 1GZWB 4P9LA 1G6NA 5C8CA 1POV0 5GLUA 1TE1B 4JTOA 1F2NA 1ND3A 5HV0A 4PCRA 1W9YA 4KI5M 2DU1A 4X8PA 1RHI2 4GKYA 1W8OA 2P17A 1DQ1A 2IFRA 4FPYA 4Q4V1 1QNYA 1YUDA 2RS11 3S30A 1U5YA 3IIAA 5FYUA 4HVQA 3U0ZA 3EB7A 3A23A 3T09A 3S0MA 2SLIA 2W94A 3DYOA 3HNYM 1LEDA 3H8OA 4MXVA 1DLLA 2PHTA 2EXJA 4D6QA 3VBFC 5EYYA 4PDWB 2ZEXA 2ILMA 3OEBA 2QQOA 2D40A 1ASJ2 2R0FA 1GP6A 1XRUA 2BV4A 4OHVA 3RGBA 3IN9A 2YHJA 3LZZA 3ES1A 2MEV2 1UZZA 1Y7BA 3WNLA 1K45A 4OYUA 4XOGA 2NMNA 5FQ0A 4Q1RA 1XE7A 2DCYA 1Z7S2 4YG0A 1H2MA 2FDFA 1QKQA 2WQ8A 4YW1A 4AVTA 5JOYA 4CUAA 4ZY9A 1YQ8A 4RA0A 4XFIA 5KXEA 1DYPA 5BPXA 1OFNA 4AI1A 3BOPA 1W8NA 4BISA 1JUIA 4QKBA 4LULA 1COV2 4C1WA 4GULA 3N9LA 2WAAA 3B9IA 5FWEA 3J8F1 4RL7A 4C91A 5HBAA 4FOVA 3O12A 5A33A 2BTVC 3LIHA 4QM8A 2ATFA 4YM0A 5AC93 1PZ7A 1V6LA 2GH2A 4PBOA 1RYYA 4QU2A 4FQZA 4K6BA 4M3CF 2QQLA 1YC61 4F8AA 3NJXA 3B7MA 3HEIA 4QAWA 1MEC3 4EROA 5IK7A 3ZFEA 2Y6HA 1OUSA 2GDFA 3WF4A 4COWA 3T0BA 3HVDA 2WS92 4CUGA 1GOFA 3NV4A 5JIAA 3AZWA 3IDCB 5G04L 2XJSA 1PIV3 3JZVA 1NY72 4H2AA 4R9BA 4CCMA 3R4UA 2BEOA 3AZVA 3QH6A 1YNAA 1CN1A 2YPJA 4Q2FA 5FY9A 5F37A 3O1RA 4Z07A 2TEPA 1KS4A 2DVAA 2VR4A 1VB2A 1O3TA 5FY8A 1JHJA 3I2FA 4C8DA 2DCKA 4F83A 5CU1A 3T30A 5F5IA 4RQPA 3WNPA 2TUNA 4K3UA 4Q4X2 1RUD2 2OX0A 3HWJA 4KBBA 4YZ4A 1RUI1 4XBQA 3PU8A 1RXGA 2VZSA 1ST8A 1XBFA 3WF1A 3ZN5A 1OKQA 2WKKA 3WDTA 4XFGA 3KT1A 5ANNA 1SEFA 2DBNA 3NNFA 2RG4A 2CTVA 4AOCA 5LK7B 1S0CA 2X53S 2RS31 3SKJE 5BNNC 2Q4SA 4WVVA 5EXOA 5FOBB 2NQYA 1J1LA 2O1QA 2YBSA 1VAMA 2YU1A 3M1HA 1C8M2 3RI9A 4NO4A 1AYN2 1W03A 2PLV3 1FATA 3BALA 4RFT0 5LBCA 3CQOA 1YRZA 1HIXA 1DCSA 4LEJA 3PUAA 1E5RA 1YLLA 3NSTA 3AYEA 5IVYA 3CJIB 4XIOA 3KV6A 3N7JA 1ZRDA 2FZ1A 3C2UA 4CP1A 4UOJA 4E4HA 1HXS3 3LEKA 4EN6B 3TB0A 3V0AA 1CQ9A 2VNOA 4P9WA 4BPZA 3K3NA 1LOFC 4TZDA 3WP4A 4OZOA 2BYVE 5IVCA 1E5IA 3E5QA 5A7SA 5LA2A 3LA2A 5GLVA 1AL0G 1JXNA 5A7WB 5FXVA 3RFRA 2HWE3 5KR7A 3MUY1 3VBHB 4J25A 2GMEA 4YARA 3ZSJA 4UW5A 2J1SA 1ZBA2 4L92A 3ZPYA 1B35C 4NAMA 3ENRA 2CL2A 4QDQA 3D3AA 3AMPA 5SV8A 4XW3A 3ACFA 2AACA 3USUB 4XTPA 4R9CA 1OPMA 3WDUA 4B7EA 5K0UC 1XU2A 1HB3A 4IV3C 3AYAA 1I9RA 2XKPA 2GC1A 1PNFA 1C5HA 4FPGA 4XJUA 3N35A 3ZYHA 3B02A 2XBO3 3ZYPA 2Y60A 1ND2C 5FRAA 3VDDC 4JRLA 2R0HA 3D4KA 1W9WA 4XC9A 2BNOA 4JQRA 2GMMA 2WA3A 3NV3A 4NR1A 1J3QA 1O4TA 4SBVA 1JYXA 2WWSA 4QHOA 5LZ6A 1G8WA 5LA9A 2DFBA 1X33A 4Q4Y2 3DPRA 1AR72 4DRVA 2WZR3 4CCJA 5KXDA 5CG9A 4Y33A 1F5JA 4QDRA 1LR5A 1V6JA 1Y9MA 3LGRA 5F3EA 1EAH2 1UKRA 4KWUA 1C4RA 1BEV1 5F32A 2ZTNA 3WCRA 1U0AA 3JQWA 4CDQB 4BB3A 1UD1A 4YM1A 1PGL2 3MYXA 1BVVA 1PK6B 2HEWF 5KHKA 2JENA 3N4MA 4XJWA 1BBT3 1MS3A 2XOMA 2J1EA 5DN2A 4I02A 4M01A 4WVMA 1AHSA 1UF2C 3LEGA 3M3CA 3APBA 4UBHA 4YVSC 3DKQA 3FFZA 1DF0A 4K9SA 4UWDA 4BA6A 1S2EA 3VBUC 1CJDA 2CNAA 3WHUA 1HRI1 4BQ5A 1GV9A 3AMQA 1M4WA 3POGA 3OG2A 2R042 2D93A 3AX4A 1PM4A 4AK3A 2ES3A 2VQ0A 5CFDC 3DF0A 1V9U2 5A70A 2IUWA 5AFBA 1LCLA 1H9PA 2D6MA 3FUQA 3M8LA 4ES8A 1F15A 1W6QB 4LHSA 1H6YA 2IWGB 4G4FA 4EN9B 1ODMA 2HWD2 4IE4A 1CZSA 4XF3A 5JOZA 5CFDA 2OZJA 4INDA 3VL8A 4PQ9A 4DFSA 4CA9A 2R6QA 1ZRCA 3H3ZA 3WEZA 5FYSA 2XVLA 3TN92 3WY6A 4C0BA 4DXZA 5ABJA 3GBGA 5JZGA 1C1FA 1Q8OA 1W6QA 2VZVA 2WS93 2VJXA 2ZXQA 2NPIA 2ZGNA 3IMNA 3NNLA 3S5QA 4E8CA 5FZ8A 4YNIA 4WVZA 3RNSA 3G6JB 4A4AA 1YYNA 1CAWB 3ZSKA 1QXPA 3H3UA 3LQCA 4XIKA 2YB7A 2KR2A 1WLCA 2EIBA 3ACHA 4HK9A 2AEYA 4YVWA 3U4SA 4OHWA 5J37A 1HQLA 1WMDA 3KT4A 4XUNA 3WDVA 2C26A 1JYTA 5FO9B 4D7SA 2XL7A 4CEYB 4HSJA 4FBFA 4RR3A 3OOXA 3TEXA 4X8NA 1HJFA 4DUXA 3VN4A 1XXNA 2JG8C 3V56A 1JW6A 5J7MA 4PIXA 5KC5A 2ZA9A 3AXEA 3IPVB 3DL3A 2GC0A 4Q4W1 1W8HA 5FZDA 1Z0HA 4P9YA 1MZ5A 5FUIA 2RJLA 4KG0A 4BQ1A 2IXCA 3RJ2X 1PNGA 2E33A 1W8ZA 3AZZA 1G9CA 2V5YA 3CU7A 1HQNA 2HWE1 1O6UA 4WM8B 5A32B 3PDQA 5C8WA 1BEV3 1JOBA 1CGPA 1CONA 3VBOB 4N90A 5KBFA 5IK5A 2D6LX 4TTGA 3C7HA 3J7MA 1EV12 4P9JA 1VBD2 4BIFA 3AP4A 3OEAA 4QQPA 4CDWB 5FZ3A 1GANA 2CWMA 2WZR1 3LDRA 4HBNA 4QKNA 1K5JA 2VBDA 2OYZA 4GJYA 4HXCA 3MIFA 4COVA 4CUBA 1EV11 3THDA 3AKPA 5FMCA 1WCKA 4DO0A 2HWC2 3D0JA 4OI1A 3I3QA 1WBFA 4YVSB 3FLTA 3VD7A 1RIRA 4AEDB 2V73A 2W1SA 4AVBA 4NWWA 2A73B 2QNKA 1KFUL 3TYJA 4CP0A 4N53A 3P1IA 4D7TA 1O3SA 3E1F1 1MQTC 2JECA 4MYEA 4AHYA 3NAPB 2PLV2 4CDQC 2WSUA 4LUKA 1PGL1 2MNGA 4FPCA 1UMHA 3I8TA 3SLIA 1Q56A 1OH4A 2ZZJA 2Y64A 4YW4A 4DEVA 2UURA 5F2WA 2BBVA 3A4UA 1BCXA 1F8VA 3AZXA 4C1XA 5FXWA 3VDBA 2VZTA 2E51A 2HWF1 4IXLA 1BMV1 3OBRA 1GR3A 2OA2A 1HN1A 1JYNA 3Q8BA 2IFWA 2DVFA 4YZ2A 1RUE3 1H8TA 2OQ7A 2W91A 5FZFA 5C3SA 2XXZA 4Q0UA 5AC91 1VRH2 3IIIA 3NO8A 4Y3OA 5C9AB 3ECQA 1RXFA 1UWWA 3KHBA 4W4ZA 1RUC3 1RUG2 2GP5A 2IXJA 4XDOA 4E8DA 1SQ4A 3H8XA 5FYIA 1B35A 3OGRA 2RMU3 5DZFA 3ZYGA 1FAYA 1EAH1 3B93A 3KQ4B 1W8TA 1QJFA 2MEV3 2X8KA 3E5UA 5F5CA 2VMIA 5KXCA 5FYHA 5LRRA 2HWD1 4UAPA 5IFTA 1KITA 2AZ5A 2VUJA 1AR71 3VKLA 4CCOA 2GSYA 2E53A 1EYBA 3O1VA 2R1DA 5FXZA 3C7FA 4YVWB 2UU8A 1ZZ6A 1D2QA 3SKVA 3WT3A 3K48A 2XBO2 1D4M2 5FZCA 5KHHA 2WO7A 4NPMA 2W95A 5FMDA 4R52A 1BBT2 5FXXA 2WLQA 2QCSB 4B8EA 4LLOA 4AEJA 3TNQA 3IB3A 4EN0A 2GMPA 4HK8A 3PIGA 1VBA3 5A7PA 4YM3A 5ACA3 3MLJA 3FMGA 3J7NA 4M3CE 1UXXX 1O59A 5BUVA 3HNBM 3THPA 1NCRB 1QJZA 4EQVA 4FTBA 4M4PA 1NT0A 3AVSA 4BYYA 3BB6A 1TEIA 1HJGA 3R6SA 3ZIWA 5JSRA 2XLAA 1SPPA 3VKOA 3ZXDA 4GWNA 4PHZA 1GYKA 1XNDA 4CDXB 2EAKA 1WLWA 4XJAA 4LKEA 1KQRA 3MW4A 5T5OA 3ZFGC 5A32A 3K75B 3KCXA 4HANA 1UOFA 2BFUS 1W0OA 1SHWB 1ZZ8A 1YCIA 1WMFA 3T0DA 4GD4A 4OUEA 3N9MA 2AUYA 4MH0E 3ZYFA 5BNOA 1SLLA 3PJYA 4LXLA 5C5TA 5LCWL 1GOGA 5FV3A 2E9QA 4DXSA 5BNPC 2X09A 4Y4YA 1CAXA 2E26A 2YGMA 2WFF3 3MLKA 2ZEZA 1JU4A 4PDWC 4Y1XA 2FDGA 1VBB3 3J8F2 4OUSA 4CTEA 1UU5A 4PLOA 1QXRA 2BVBA 2P5BA 5BNOC 1CPMA 2ZAAA 2VQUA 2OS2A 2UYBA 1HXS1 1HV0A 1W2NA 2X29A 1OC1A 1GUIA 1NCRA 5E8AA 1G86A 3WVJA 3GBWA 1QJX2 5FR3A 2YBKA 5DUXA 1YQCA 2JEMA 4B1LA 5F6LB 4XMAA 2GNBA 2FD8A 5J09A 4XAEA 3ZN6B 2QQWA 1ZZ7A 4F7ZA 3ME2A 3U10A 1ZBA3 1TME2 4O9GA 5CA6A 2V4AA 4MZUA 1LOAA 5CBLA 4GZ9A 2D6OX 1RC6A 4HETA 5EJ1B 1WW5A 5ACA1 3K46A 3V0BB 3AYDA 4AEDA 1G9AA 1G7YA 2ZS6B 3ROUA 3UKVA 3RYKA 3RZZA 4MVTA 3JD71 2W9XA 5DZEA 2A6XA 1JYIA 2Y26A 1C8NA 1DQ0A 2JD4A 4MADA 1ZA7A 3L9JT 5CKQA 5BY5A 2PHWA 2CU5A 2V4VA 4C0HA 1GZWA 2JDNA 3AP9A 1D4VB 4MXWA 5FZIA 2GC2A 2A3XA 1XYOA 1OA4A 4UFMA 3VBSA 4LBNA 1RMU1 2EVXA 4LE4A 3JXSA 2AEZA 4KBZA 4XUQA 2JDPA 1DP0A 1YQ5A 2BOIA 4ZU7A 1LRHA 3WG2A 4AEMA 4Q4W2 1EAH3 1OSGA 3O5SA 3VKNA 1YI9A 4O7XA 1JZ7A 3ZDVA 1YFUA 3DUIA 1NCQB 2HWE2 3JCIA 1IS3A 5DMYA 2FDKA 2PXJA 2R063 3W5NA 2Q8OA 1AVBA 3BPZA 2ZGOA 5FYYA 4AAXA 2PHXA 2Z69A 2DURA 4HKLA 2DWRA 4XPVA 4D8MA 3TEYA 2W52A 3IBMA 4AW7A 2WZEA 4KU8A 4XFHA 2VZOA 1EY2A 1PGW1 1RUG1 5DAQA 3UESA 1W2OA 4YG3A 4QGLA 5FP7A 1EUTA 3U75A 1REEA 1RUG3 1O7FA 1RUC2 1YFYA 3IT8A 5J36A 5L9VA 2YYOA 3S6PA 3VLBB 5CFCB 3H1YA 1V9U3 4YW6A 3FLRA 2WABA 4Z2WA 1J3PA 1NLSA 3WP6A 5I0RA 2V72A 1COV3 1VRBA 1U5XA 2LM3A 3ZFFC 4MGKE 3H0OA 2JWPA 1JOJA 4LBJA 2P37A 5SV5A 5FP3A 1AR73 5BYNA 1F5FA 4OHYA 4IETA 4AGRA 3AB0A 1Z7S3 2VVDA 3GYDA 3JUUA 2K2SA 3LFMA 3VBRA 3H8RA 4MOAA 2WYSA 1PM7A 1Q3EA 3B69A 5LWBA 5C3QA 3MHZA 1IS5A 2A71A 3FFQA 4TWTA 2VO5A 1LNSA 4P02B 1APNA 2ZAHA 3N9OA 3KV5A 4B4PA 4RS5A 3LD8A 1ZBE2 1ZYBA 2W2IA 3MFAA 3WUCA 5AC92 3O1TA 1UIJA 2DVGA 1MR5A 2D44A 2VMFA 3P6BA 4BM8A 4I2OA 1YQ6A 2EIEA 2PFWA 5L7OB 4RFRB 3CJIA 1OKOA 5KHIA 5GZDA 5F3CA 5DAXA 1D4M3 1S2BA 3WF2A 2RM23 2RS53 3W21A 1OF3A 2W0XA 4EWEA 1XE8A 4IEXA 1T6GC 2XB6C 5EIYB 4CVUA 1POV3 4L97A 4GMP3 2XGXA 4CDXA 1JZ2A 2J1TA 5HV4A 4FI9A 3GGLA 1J3RA 4NMIA 4GWJA 3ZIXA 1KJLA 4KGGA 4AVAA 5J98B 4AR2A 3PTYA 4WV8A 2IXLA 4AEKA 5BNNA 1F35A 1Z7S1 3LF7A 1K5MC 4CU8A 4CDXC 4RHV2 5FK7A 2Y33A 5E6HA 2Q1MA 1ZBE1 3PVOA 4E4SA 3VHNA 2BPA2 3I7DA 4AGGA 3SNMA 2GP3A
chains in the Genus database with same CATH topology
4DUWA 2EIDA 3ABZA 4XVHA 4A6OA 1RYYA 2DDUA 1UY2A 5CZKA 2QQLA 2J1RA 3NJXA 3HEIA 4QAWA 2Y6HA 2VCAA 3WF4A 3T0BA 2QBXA 1GOFA 5HXMA 2VZRA 1UY3A 5EJZB 5G04L 3NRUA 4BXSV 1O8PA 4XUOA 1L7RA 3OBAA 2VR4A 3J7HA 1JHJA 3I2FA 3U37A 2DCKA 1JZ4A 3WF3A 3WNPA 3CZJA 2W47A 1JU3A 1KEXA 2VZSA 3WF1A 3MV11 4PQQA 3C7OA 3SKJE 1SDDB 4M4RA 4PF1A 2LW8A 3OGSA 3VDCA 4DUVA 2XQXA 3FHAA 2JKXA 3UNPA 3HPNA 3VD4A 3CQOA 3HJRA 3T0AA 1P8JA 1UY0A 3T08A 3SEEA 1US2A 3K77A 4UOJA 2RVAA 2YG0A 3LEKA 4HG6B 3PUIA 5JR2A 2VZ1A 1D7PM 4ARYA 4OZOA 4CU6A 3FHQA 5LA2A 3FL7A 4LPLA 2JD9A 3MUY1 2B4KA 2J1SA 3GM8A 3C7GA 4QDQA 5IJRA 3D3AA 3W5MA 5CYYA 5LA1A 3LE0A 3ACFA 1XNTA 1TG7A 3SEPA 2E32A 3NNGA 4JKLA 1NKGA 3NJVA 4CU9A 3C7EA 4OMDA 1W9WA 3WQBA 3ZM8A 1CIYA 5JMOA 1JYXA 1DLCA 3I3BA 1NAEA 2Z4FA 4QX2A 4XUPA 1XC6A 3WSOA 3WNOA 4MGQA 4UI9L 1KGYA 4QDRA 2BZDA 2VQTA 2QQIA 1UYYA 2WO1A 4KWUA 3VD5A 4KMQA 1O8SA 4IUGA 2W1UA 2W3JA 5F7UA 1F4AA 3UETA 2XOMA 3HN3A 2J1EA 2QQNA 5JUVA 5DN2A 1YQ2A 3MO4A 3LEGA 1J84A 1JZ6A 1K42A 3OG2A 4A42A 1UXZA 2J1AA 4AG4A 3BN6A 2RJ2A 3EYPA 1UYZA 2VCCA 4LQRA 4JKKA 4QB2A 4A41A 2WO3A 1JI6A 1SG3A 3THCA 3T2OA 4LHSA 1H6YA 2WO2A 5JXHA 1CZSA 3WNMA 3WEZA 5IHRA 4P5YA 3MUZ1 4QDSA 5C71A 1F4HA 2VZVA 2ZXQA 4E8CA 2VJXA 4A4AA 3A22A 3LQCA 5JXIA 1JZ8A 2YB7A 3OGVA 2EIBA 3ACHA 4QX3A 2ZEWA 4XUNA 1IQDC 2C26A 2QQJA 2W92A 3WNNA 3MV01 4JX0A 4DUXA 2VM9A 5IYYA 5G05L 4W50A 3C8XA 1H6XA 2QQMA 4BK5A 2VZUA 3I2KA 5FUIA 2BGOA 2J1VA 2E33A 5C70A 2RV9A 2XONA 2VMDA 3CIHA 4D0QA 3BGAA 1UX7A 4XZUG 1NUKA 4TTGA 3C7HA 3WF0A 1CX1A 1W9SA 2WDBA 3OEAA 2VMEA 2V5DA 2X05A 4CUBA 2VZ3A 1BHGA 3THDA 2VCBA 2QQKA 3LPGA 1ULOA 3ETPA 3VD7A 2W1SA 4DXTA 3I3DA 3P1IA 3E1F1 2J7MA 2Y6JA 3OB8A 1UMHA 1OH4A 4DEVA 1PX4A 2Y64A 4BK4A 3HNMA 1US3A 3VDBA 2VZTA 5IFPA 3IDAA 2WBKA 4DEQA 1HN1A 2DCJA 1JYNA 2W91A 1GMMA 2BBAA 3IIIA 3ECQA 4XUTA 1UWWA 4P00B 3A7QA 4W4ZA 4E8DA 1PMJX 4QX0A 3GDBA 3OGRA 5I0DA 4TXWA 2W1QA 3HOBA 2WZ8A 2VMCA 4MO3M 4UAPA 3NQHA 5IFTA 2E31A 2BERA 3C7FA 4A44A 3SKVA 4QPWA 2OKXA 2VC9A 1CZVA 3FN9A 3WNKA 2W95A 2ZEYA 5JXGA 4BDVB 3IAPA 3ACIA 3F2ZA 3IB3A 2EICA 4A3ZA 1GOHA 1UXXX 1O59A 2KD7A 3HNBM 1W0NA 4M4PA 2ORZA 3I2IA 4Z2AA 3K4ZA 5LA0A 4W8JA 5JXJA 3K75B 1EUUA 3VDAA 1XNAA 4ZXEA 4ET7A 1SHWB 2J22A 3LEIA 3T0DA 4OUEA 1K12A 1OF4A 4DXRA 5A1AA 2C4XA 2VZQA 5LCWL 1GOGA 3I2HA 2W46A 1OD3A 4QX1A 4DXSA 2X09A 4ZZ8A 1UYXA 2E26A 2HLEA 2ZEZA 1JU4A 1J83A 5HPOA 1W9TA 1L7QA 4MGSA 3LPFA 5DQ0A 2CDPA 4PT6A 4RYDA 4L0PA 2VQUA 2WUHA 1GUIA 2YFZA 2W87A 3I2JA 4QB1A 2JDAA 2L9LA 1JZ3A 1UY4A 4JHZA 2VOTA 5B4NA 1JYWA 3DYMA 3DYPA 3GXUA 2VTFA 2ID4A 3IAQA 4CUCA 2ORXA 2VL4A 1GU3A 4BJ0A 4GZ9A 5EJ1B 3K46A 2HYXA 4OMCA 1NX9A 2LS6A 3VD3A 1W99A 3CZUA 3T2QA 2W9XA 2Y6LA 4MADA 3VD9A 4YPJA 4P08A 2V4VA 3I3EA 1TVGA 2Y6GA 3JXSA 4XUQA 1DP0A 2WAOA 2YC2A 2W1WA 1XPWA 2Y6KA 1PMHX 1JZ7A 2X10A 1GQPA 5DMYA 5C7GA 2WN3A 3W5NA 1I5PA 2PQSA 4D8MA 4AAXA 3AC0A 4JKMA 2YC4A 1UZ0A 2WZEA 2BGPA 2VZOA 1JYVA 1ULPA 2W5FA 5B4XA 3UESA 1EUTA 1CZTA 2YFUA 4ZZ5A 1WCQA 4GWIA 2WABA 4QB6A 3ACGA 2V72A 2Y8KA 3I97A 3CDZB 1UY1A 4ARXA 2WN2A 3PUHA 4A45A 3K4DA 4LKSA 3MBWA 3A21A 1T2XA 4MOAA 2WYSA 3I2GA 2VZPA 1DYOA 1LNSA 2VO5A 4P02B 4CU7A 1GNYA 5J1XA 4KI5M 1W8OA 2VMFA 3CKHA 3P6BA 1WKYA 2EIEA 2B9VA 3EB7A 3A23A 3T09A 2W94A 2XHNA 3DYOA 3HNYM 1JZ5A 1K3IA 1OT5A 3WF2A 2ZEXA 3OEBA 3T2PA 2QQOA 1OF3A 2C9KA 5DPNA 2CDOA 3WNLA 1K45A 3CMGA 4OYUA 5EIYB 4CVUA 1JZ2A 1R64A 2J1TA 3DECA 3K4AA 4FI9A 3GGLA 2R7EB 4GWJA 2WQ8A 1MPXA 1UMIA 4ZY9A 1PX3A 4CUAA 4CU8A 2JE8A 2J1UA 1W8NA 4XURA 2WAAA 4RN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUW A;  2EID A;  3ABZ A;  4XVH A;  4A6O A;  1RYY A;  2DDU A;  1UY2 A;  5CZK A;  2QQL A;  2J1R A;  3NJX A;  3HEI A;  4QAW A;  2Y6H A;  2VCA A;  3WF4 A;  3T0B A;  2QBX A;  1GOF A;  5HXM A;  2VZR A;  1UY3 A;  5EJZ B;  5G04 L;  3NRU A;  4BXS V;  1O8P A;  4XUO A;  1L7R A;  3OBA A;  2VR4 A;  3J7H A;  1JHJ A;  3I2F A;  3U37 A;  2DCK A;  1JZ4 A;  3WF3 A;  3WNP A;  3CZJ A;  2W47 A;  1JU3 A;  1KEX A;  2VZS A;  3WF1 A;  3MV1 1;  4PQQ A;  3C7O A;  3SKJ E;  1SDD B;  4M4R A;  4PF1 A;  2LW8 A;  3OGS A;  3VDC A;  4DUV A;  2XQX A;  3FHA A;  2JKX A;  3UNP A;  3HPN A;  3VD4 A;  3CQO A;  3HJR A;  3T0A A;  1P8J A;  1UY0 A;  3T08 A;  3SEE A;  1US2 A;  3K77 A;  4UOJ A;  2RVA A;  2YG0 A;  3LEK A;  4HG6 B;  3PUI A;  5JR2 A;  2VZ1 A;  1D7P M;  4ARY A;  4OZO A;  4CU6 A;  3FHQ A;  5LA2 A;  3FL7 A;  4LPL A;  2JD9 A;  3MUY 1;  2B4K A;  2J1S A;  3GM8 A;  3C7G A;  4QDQ A;  5IJR A;  3D3A A;  3W5M A;  5CYY A;  5LA1 A;  3LE0 A;  3ACF A;  1XNT A;  1TG7 A;  3SEP A;  2E32 A;  3NNG A;  4JKL A;  1NKG A;  3NJV A;  4CU9 A;  3C7E A;  4OMD A;  1W9W A;  3WQB A;  3ZM8 A;  1CIY A;  5JMO A;  1JYX A;  1DLC A;  3I3B A;  1NAE A;  2Z4F A;  4QX2 A;  4XUP A;  1XC6 A;  3WSO A;  3WNO A;  4MGQ A;  4UI9 L;  1KGY A;  4QDR A;  2BZD A;  2VQT A;  2QQI A;  1UYY A;  2WO1 A;  4KWU A;  3VD5 A;  4KMQ A;  1O8S A;  4IUG A;  2W1U A;  2W3J A;  5F7U A;  1F4A A;  3UET A;  2XOM A;  3HN3 A;  2J1E A;  2QQN A;  5JUV A;  5DN2 A;  1YQ2 A;  3MO4 A;  3LEG A;  1J84 A;  1JZ6 A;  1K42 A;  3OG2 A;  4A42 A;  1UXZ A;  2J1A A;  4AG4 A;  3BN6 A;  2RJ2 A;  3EYP A;  1UYZ A;  2VCC A;  4LQR A;  4JKK A;  4QB2 A;  4A41 A;  2WO3 A;  1JI6 A;  1SG3 A;  3THC A;  3T2O A;  4LHS A;  1H6Y A;  2WO2 A;  5JXH A;  1CZS A;  3WNM A;  3WEZ A;  5IHR A;  4P5Y A;  3MUZ 1;  4QDS A;  5C71 A;  1F4H A;  2VZV A;  2ZXQ A;  4E8C A;  2VJX A;  4A4A A;  3A22 A;  3LQC A;  5JXI A;  1JZ8 A;  2YB7 A;  3OGV A;  2EIB A;  3ACH A;  4QX3 A;  2ZEW A;  4XUN A;  1IQD C;  2C26 A;  2QQJ A;  2W92 A;  3WNN A;  3MV0 1;  4JX0 A;  4DUX A;  2VM9 A;  5IYY A;  5G05 L;  4W50 A;  3C8X A;  1H6X A;  2QQM A;  4BK5 A;  2VZU A;  3I2K A;  5FUI A;  2BGO A;  2J1V A;  2E33 A;  5C70 A;  2RV9 A;  2XON A;  2VMD A;  3CIH A;  4D0Q A;  3BGA A;  1UX7 A;  4XZU G;  1NUK A;  4TTG A;  3C7H A;  3WF0 A;  1CX1 A;  1W9S A;  2WDB A;  3OEA A;  2VME A;  2V5D A;  2X05 A;  4CUB A;  2VZ3 A;  1BHG A;  3THD A;  2VCB A;  2QQK A;  3LPG A;  1ULO A;  3ETP A;  3VD7 A;  2W1S A;  4DXT A;  3I3D A;  3P1I A;  3E1F 1;  2J7M A;  2Y6J A;  3OB8 A;  1UMH A;  1OH4 A;  4DEV A;  1PX4 A;  2Y64 A;  4BK4 A;  3HNM A;  1US3 A;  3VDB A;  2VZT A;  5IFP A;  3IDA A;  2WBK A;  4DEQ A;  1HN1 A;  2DCJ A;  1JYN A;  2W91 A;  1GMM A;  2BBA A;  3III A;  3ECQ A;  4XUT A;  1UWW A;  4P00 B;  3A7Q A;  4W4Z A;  4E8D A;  1PMJ X;  4QX0 A;  3GDB A;  3OGR A;  5I0D A;  4TXW A;  2W1Q A;  3HOB A;  2WZ8 A;  2VMC A;  4MO3 M;  4UAP A;  3NQH A;  5IFT A;  2E31 A;  2BER A;  3C7F A;  4A44 A;  3SKV A;  4QPW A;  2OKX A;  2VC9 A;  1CZV A;  3FN9 A;  3WNK A;  2W95 A;  2ZEY A;  5JXG A;  4BDV B;  3IAP A;  3ACI A;  3F2Z A;  3IB3 A;  2EIC A;  4A3Z A;  1GOH A;  1UXX X;  1O59 A;  2KD7 A;  3HNB M;  1W0N A;  4M4P A;  2ORZ A;  3I2I A;  4Z2A A;  3K4Z A;  5LA0 A;  4W8J A;  5JXJ A;  3K75 B;  1EUU A;  3VDA A;  1XNA A;  4ZXE A;  4ET7 A;  1SHW B;  2J22 A;  3LEI A;  3T0D A;  4OUE A;  1K12 A;  1OF4 A;  4DXR A;  5A1A A;  2C4X A;  2VZQ A;  5LCW L;  1GOG A;  3I2H A;  2W46 A;  1OD3 A;  4QX1 A;  4DXS A;  2X09 A;  4ZZ8 A;  1UYX A;  2E26 A;  2HLE A;  2ZEZ A;  1JU4 A;  1J83 A;  5HPO A;  1W9T A;  1L7Q A;  4MGS A;  3LPF A;  5DQ0 A;  2CDP A;  4PT6 A;  4RYD A;  4L0P A;  2VQU A;  2WUH A;  1GUI A;  2YFZ A;  2W87 A;  3I2J A;  4QB1 A;  2JDA A;  2L9L A;  1JZ3 A;  1UY4 A;  4JHZ A;  2VOT A;  5B4N A;  1JYW A;  3DYM A;  3DYP A;  3GXU A;  2VTF A;  2ID4 A;  3IAQ A;  4CUC A;  2ORX A;  2VL4 A;  1GU3 A;  4BJ0 A;  4GZ9 A;  5EJ1 B;  3K46 A;  2HYX A;  4OMC A;  1NX9 A;  2LS6 A;  3VD3 A;  1W99 A;  3CZU A;  3T2Q A;  2W9X A;  2Y6L A;  4MAD A;  3VD9 A;  4YPJ A;  4P08 A;  2V4V A;  3I3E A;  1TVG A;  2Y6G A;  3JXS A;  4XUQ A;  1DP0 A;  2WAO A;  2YC2 A;  2W1W A;  1XPW A;  2Y6K A;  1PMH X;  1JZ7 A;  2X10 A;  1GQP A;  5DMY A;  5C7G A;  2WN3 A;  3W5N A;  1I5P A;  2PQS A;  4D8M A;  4AAX A;  3AC0 A;  4JKM A;  2YC4 A;  1UZ0 A;  2WZE A;  2BGP A;  2VZO A;  1JYV A;  1ULP A;  2W5F A;  5B4X A;  3UES A;  1EUT A;  1CZT A;  2YFU A;  4ZZ5 A;  1WCQ A;  4GWI A;  2WAB A;  4QB6 A;  3ACG A;  2V72 A;  2Y8K A;  3I97 A;  3CDZ B;  1UY1 A;  4ARX A;  2WN2 A;  3PUH A;  4A45 A;  3K4D A;  4LKS A;  3MBW A;  3A21 A;  1T2X A;  4MOA A;  2WYS A;  3I2G A;  2VZP A;  1DYO A;  1LNS A;  2VO5 A;  4P02 B;  4CU7 A;  1GNY A;  5J1X A;  4KI5 M;  1W8O A;  2VMF A;  3CKH A;  3P6B A;  1WKY A;  2EIE A;  2B9V A;  3EB7 A;  3A23 A;  3T09 A;  2W94 A;  2XHN A;  3DYO A;  3HNY M;  1JZ5 A;  1K3I A;  1OT5 A;  3WF2 A;  2ZEX A;  3OEB A;  3T2P A;  2QQO A;  1OF3 A;  2C9K A;  5DPN A;  2CDO A;  3WNL A;  1K45 A;  3CMG A;  4OYU A;  5EIY B;  4CVU A;  1JZ2 A;  1R64 A;  2J1T A;  3DEC A;  3K4A A;  4FI9 A;  3GGL A;  2R7E B;  4GWJ A;  2WQ8 A;  1MPX A;  1UMI A;  4ZY9 A;  1PX3 A;  4CUA A;  4CU8 A;  2JE8 A;  2J1U A;  1W8N A;  4XUR A;  2WAA A;  4RN5 A; 
#chains in the Genus database with same CATH topology
 1XNB A;  1HV1 A;  4SLI A;  2BDR A;  1OOP B;  3BVC A;  1N3Q A;  1LHU A;  4A6O A;  1MVQ A;  2GN3 A;  3VZN A;  2DDU A;  1ULC A;  1W06 A;  5HCB A;  1E5H A;  4YSF A;  3KT7 A;  3AKT A;  5FBJ A;  2VCA A;  4EWD A;  5FZH A;  4LLF A;  3CNA A;  5GAL A;  1AX2 A;  3CJX A;  5FY5 A;  5FZB A;  5HXM A;  2VZR A;  4AE2 A;  1UY3 A;  3HAG A;  4BXS V;  1O8P A;  1DG6 A;  3VV1 A;  3O1S A;  4XUO A;  3RSJ A;  4FAH A;  3HT2 A;  2PHD A;  1G9B A;  4OI0 A;  5F5A A;  5FJK A;  3J7H A;  4AI3 A;  3T1L A;  5HCA A;  1B09 A;  2JJ6 A;  2X5I B;  4Q0Q A;  3SCF A;  4BQ3 A;  5JCT A;  1SCS A;  1PK6 A;  3WF3 A;  3NW4 A;  1RUE 1;  1C8M 3;  2YV8 A;  3CZJ A;  2W47 A;  2R16 A;  3AP6 A;  1JU3 A;  2IXI A;  3VB9 A;  1KEX A;  5FKC A;  3B94 A;  1N1T A;  3B00 A;  3OBZ A;  1PK6 C;  3BU0 A;  4AI9 A;  5T52 A;  4PQQ A;  1KXG A;  4NHM A;  2EXK A;  4YZ3 A;  4AFD A;  3OPZ A;  1UOG A;  4UW6 A;  2LW8 A;  2JDZ A;  1VRH 3;  3AKS A;  1TME 1;  3OGS A;  3FHA A;  5FZE A;  1BXH A;  2JE9 A;  4ONU A;  3JD7 3;  4DY5 A;  5JIU A;  1AUY A;  4BU2 A;  4HKO A;  1P8J A;  4UBG A;  2O8O A;  4ISQ A;  3SEE A;  4YZ5 A;  3BOW A;  1R08 1;  3FUO A;  4B3N A;  2FMD A;  1WW6 A;  2XH6 A;  1GIC A;  2RVA A;  3VDD B;  4JHT A;  2YG0 A;  1AXK A;  2BFU L;  3O7O A;  4HG6 B;  1RVF 3;  2JG9 C;  2YZ4 A;  3ZXA C;  5HI0 A;  1RUD 1;  1JS9 A;  2JG8 B;  4CU6 A;  1GQH A;  1QF3 A;  1HX6 A;  3RDI A;  3LIG A;  2VXR A;  4LPL A;  1UU4 A;  3AXD A;  3ASI A;  3EHK A;  1PGS A;  5FAX A;  4ASM B;  3WQ0 A;  2BNM A;  2HWF 3;  2JB8 A;  4JVA A;  3D5O A;  1ND2 A;  3QLQ A;  5AVA A;  2OVU A;  2RE9 A;  4WZC A;  4ZS2 A;  5IJR A;  1WCU A;  2J42 A;  4Q0S A;  2HWD 3;  3THT A;  1LKN A;  1DYK A;  1QJU 1;  2YRO A;  4LBK A;  1C57 A;  4LK6 A;  2WQZ C;  3M3E A;  3NNG A;  4W65 A;  4IE6 A;  4COZ A;  4FO9 A;  1OOP A;  1V70 A;  5FLI A;  1W28 A;  2VOV A;  4IE7 A;  3B3Q E;  4JC1 A;  4L99 A;  4TN7 A;  3GZA A;  5JPN B;  1HKD A;  3FZ3 A;  5FPA A;  3ZO0 B;  4QPG A;  3RVH A;  3WQB A;  1OH3 A;  4BE3 A;  2GZW A;  1R1A 1;  5JMO A;  3I3B A;  2NM1 A;  1BZW A;  2Z4F A;  3WUD A;  5FP4 A;  4HON A;  1SLI A;  1VBA 1;  2GU9 A;  3LCP A;  3LDB A;  3VBR C;  1YJK A;  1AL2 1;  3ZSL A;  4DQA A;  3HBZ A;  2D5F A;  3ILF A;  3A0N A;  4FXG B;  3RWN A;  1UYY A;  2XJU A;  1BK0 A;  2N7G A;  2WO1 A;  3VD5 A;  4GB3 1;  1AL2 2;  2A70 A;  2JB4 A;  4KMQ A;  5CNA A;  5FFO C;  2W1U A;  3WXP A;  2ZX0 A;  1SLC A;  2W3J A;  4OI2 A;  3LA7 A;  3VBU B;  2FZ2 A;  4YGE A;  2VW0 A;  4IGQ A;  4QD2 A;  4IW3 A;  2ZHM A;  4LJH A;  4Q8L A;  4NRM A;  1YQ2 A;  4UFK A;  2ZGK A;  3MO4 A;  1IOA A;  5KWR A;  3BIE A;  4Y22 B;  3ZSE A;  1GQG A;  4XAB A;  2AEN A;  3PVB B;  5L7O A;  1W2A X;  5A3P A;  1JH5 A;  4A42 A;  1QH6 A;  1UXZ A;  2A3W A;  5FLJ A;  3EQE A;  1HB1 A;  3J4U H;  5CKM A;  1AYN 3;  5F39 A;  1C1L A;  4RS5 B;  4NIG A;  3EYP A;  2VCC A;  5A33 B;  3AK0 A;  4DZG A;  4M3C B;  2FQP A;  3N9N A;  1UOB A;  4NE9 A;  4QKF A;  3I59 A;  1ZA4 A;  1WCD J;  2JDY A;  1SG3 A;  5GLW A;  1QJY 2;  4Q5O A;  2WS9 1;  1J1T A;  3VL9 A;  4JDN A;  4B4R A;  5F3G A;  1HW5 A;  1QJE A;  3OSD A;  4Q4W 3;  1RED A;  2ZMN A;  4I0W B;  2ERF A;  4P5Y A;  3WDW A;  4NRQ A;  4QDS A;  5FY0 A;  2Z5W A;  4NHL A;  2RDR A;  4CRQ A;  1HN0 A;  2F6B A;  3B9C A;  5D1I A;  4Y20 B;  4KWL A;  3VBS C;  5JXI A;  1AJK A;  3H9A A;  2RR1 2;  4Q4X 1;  3J9S A;  3H1W A;  1LEM A;  2ETE A;  3HQX A;  1PO2 1;  4QX3 A;  2VOW A;  4BQX A;  1D2S A;  3N7K A;  3JU9 A;  2NZ9 A;  1FI2 A;  4XE9 A;  2DTW A;  5FYV A;  1WCS A;  2EXH A;  2CYF A;  2DCZ A;  3WNN A;  1PHM A;  1XU1 A;  2F4P A;  3Q8A A;  4HFS A;  5IYY A;  5A3U A;  5A3T A;  3RYP A;  5K7P A;  2JX9 A;  4Y5T A;  2P1B A;  4I0B A;  3I2K A;  2IXH A;  5C70 A;  1IGO A;  2JDM A;  2IVJ A;  2XON A;  4Q4Y 3;  3LA3 A;  2OZ6 A;  4CSW A;  3CIH A;  1YXW A;  2WT2 A;  3ETQ A;  4D0Q A;  1LHW A;  3ILN A;  1RUO A;  1UX7 A;  1OMI A;  4Q8K A;  3JD7 2;  3WF0 A;  4COY A;  3M2M A;  1XYN A;  1V00 A;  1W9S A;  4MV2 A;  4ZPI A;  2WDB A;  1RVF 1;  2YDE A;  3HQU A;  3PME A;  4S2F A;  4HT1 T;  2VZ3 A;  3BPS A;  3WW4 A;  1TMF 3;  4NHK A;  4FFH A;  4FOY A;  4MSV A;  3AP7 A;  3PU3 A;  2R07 1;  3ETP A;  3ILR A;  4PIZ A;  1VBA 2;  4I30 A;  3WR0 A;  4BXF A;  3VZM A;  3ZLI A;  1KD7 A;  5IK4 A;  2LTN A;  3I3D A;  4LO4 B;  4AWD A;  2FDI A;  1TQ5 A;  1X36 A;  2ET7 A;  2B39 A;  5DUV A;  3O1O A;  2J7M A;  1W90 A;  4WBB A;  5L9R A;  3HR9 A;  3OB8 A;  4XBN A;  3AL6 A;  3J26 N;  1AR9 1;  1RTV A;  2X5I C;  2UWA A;  4Y1V A;  5JAX A;  4A3X A;  4N53 B;  4LUM A;  1OHF A;  3HBK A;  3IDA A;  1PMI A;  1S0B A;  1F31 A;  2D5H A;  3SEP A;  2JIG A;  2QQV A;  1VMJ A;  4DEQ A;  1BJQ A;  1V6M A;  3Q8F A;  1C8M 1;  5FMB A;  4YFZ A;  5C4W A;  5DDJ 3;  2RHP A;  1RUH 3;  3U07 A;  1DGR N;  1ZVF A;  2R06 1;  4P00 B;  1Q8Q A;  5J48 A;  1LTE A;  1Q8P A;  2Z79 A;  3Q9O A;  2WFF 2;  2VU9 A;  3FE5 A;  4QU1 A;  4HN0 A;  5IVV A;  1N3O A;  2VBP A;  4PLM A;  4BLJ A;  3I3M A;  2EF6 A;  3ALQ A;  3E6D A;  4QT6 A;  4X6Q B;  3OUH A;  1U5I A;  3OJB A;  1VAK A;  2CGP A;  1VPH A;  3RJR A;  1I1E A;  2P34 A;  4QQL A;  4GA9 A;  3BU7 A;  4QPW A;  4E4D X;  2JDU A;  3H42 B;  4HOO A;  2OKX A;  3PVN A;  1PZ9 A;  2IZW A;  2VC9 A;  5FY1 A;  1CZV A;  5C3O A;  1NE4 A;  5JOX A;  1IPK A;  1W05 A;  2HBT A;  3ZX7 A;  3IAP A;  2UYA A;  2EAA A;  3F2Z A;  2WNV A;  4FP2 A;  1W9F A;  1BBT 1;  4NUB A;  3OGJ A;  5C33 A;  2K46 A;  4MX3 A;  3MGU A;  1GOH A;  5FQ0 B;  3FX3 A;  5FTT C;  4UFJ A;  1CAV B;  1C28 A;  3L2Y A;  4LE3 A;  4NIA A;  3GAL A;  4Z2A A;  1QNW A;  1ZRI A;  2JXA A;  4Q4V 2;  2BVV A;  5JZG B;  1LU1 A;  1W6O B;  5FZM A;  1W2U A;  4XZP A;  2VMH A;  5LA0 A;  4J1W A;  1UMZ A;  1W6M B;  2QE3 A;  4LO5 B;  3VUO A;  4CEW A;  2ZGT A;  2C1F A;  2D6P A;  4K1Y A;  2XBO 1;  2XVG A;  4I0A A;  2WQ4 A;  2F17 A;  4Q4V 3;  1LJ7 A;  2WJS A;  3GCW A;  2VTX J;  4PIY A;  2NYY A;  1UW8 A;  2VZQ A;  2WR9 A;  2W68 A;  5A3M A;  1CX4 A;  4QX1 A;  2CGO A;  1J83 A;  4IGO A;  5IVF A;  1HXS 2;  4RGK A;  5A7N A;  3UK9 A;  4MGS A;  5DQ0 A;  2AH2 A;  3VZJ A;  5C8C B;  3ZFF B;  4RYD A;  4PT6 A;  1YO8 A;  3DXU A;  2O0O A;  1GWM A;  2WUH A;  5A80 A;  4PI2 A;  5F8P A;  4OVE A;  4FAG A;  1JBC A;  2L9L A;  4DRR A;  1DQ6 A;  1HLC A;  4AED C;  3KLS A;  5CFC C;  4AXO A;  1Y9G A;  2BWC A;  4HZF A;  3SCH A;  3AMH A;  2PHR A;  3NAP C;  5B4N A;  1FNY A;  5E89 A;  3DYM A;  1QJX 1;  3DYP A;  3NL1 A;  1GP4 A;  2ID4 A;  2RMU 2;  4I09 A;  1E5S A;  2RR1 3;  3GJA A;  3B5L B;  3H50 A;  1FYU A;  1N3P A;  3ELN A;  4UW4 A;  1RVF 2;  1S0I A;  2ARB A;  1MAC A;  4TLG A;  3PIJ A;  3T3Y A;  4BJ0 A;  1O5L A;  2EA7 A;  3VD3 A;  1S0J A;  1UO9 A;  3CZU A;  5FMO L;  1WWY A;  5JI9 A;  2K9Z A;  4OFG A;  1DQ5 A;  4YPJ A;  4P08 A;  4U2A A;  3I3E A;  4D6R A;  2YC0 A;  1DFQ A;  3RWK X;  2QUO A;  3DGT A;  1EPW A;  4CDW A;  3E97 A;  4N7I A;  3USU A;  3KWV A;  4GH4 A;  1RHI 3;  4YW2 A;  4NHY A;  2YC2 A;  1VLN A;  2Z2S B;  5DG2 A;  3OD4 A;  1XPW A;  2GNM A;  5F3I A;  2WNV B;  4QXH A;  5K8S A;  4XMI A;  4QX7 A;  1ND3 C;  1PMH X;  3D82 A;  1H9W A;  1D4M 1;  2XJV A;  1GQP A;  1OUX A;  1NLQ A;  5A7W A;  2RDS A;  2AC1 A;  5C7G A;  2B46 X;  2RM2 2;  2WN3 A;  5GZG A;  1UYP A;  3PNA A;  1UL9 A;  3CBN A;  4LO8 A;  1F9K A;  5C5U A;  1W04 A;  2ZJC A;  1H1M A;  1OXC A;  1ZM1 A;  3OCP A;  3AC0 A;  3WDX A;  3SMH A;  4EZ4 A;  2W39 A;  1ZRF A;  1QJU 3;  2G1M A;  4EZH A;  1WME A;  1H4H A;  1QGL A;  3RZL A;  5DXD A;  2PQQ A;  2W5F A;  5B4X A;  3BTZ A;  2HYK A;  4IV1 C;  2CSG A;  4DPN A;  3WG4 A;  1CZT A;  1RMU 3;  3TBD A;  4CYD A;  1VR3 A;  4ZZ5 A;  1OUR A;  4GWI A;  1PVC 1;  3NVC A;  5D21 A;  1NE6 A;  3DKW A;  2ET1 A;  4XFC A;  3KD4 A;  3RYR A;  1IG3 A;  1Y43 B;  5FUP A;  3NNM A;  1J59 A;  1CJP A;  4UF0 B;  3J8F 3;  5L36 A;  4Y5S A;  1VB4 A;  1QJU 2;  1ZBE 3;  1AR6 2;  1Q8V A;  1AXY A;  1V6N A;  4A45 A;  3HQR A;  5A3O A;  5BNP B;  4M0N A;  1V0A A;  5E1R A;  5K9Y A;  4FSJ A;  2AR6 A;  4XBL A;  5CFD B;  1O3Q A;  1RIT A;  1MEC 2;  3MBW A;  2ZPX A;  3M70 A;  1R08 3;  1GZC A;  5TSW A;  3ZMO A;  4V2W A;  1AJO A;  2A6W A;  2XLG A;  1LOB A;  3QOP A;  2VZP A;  5EFU A;  5I0S A;  4RQP B;  1DYO A;  1AX0 A;  4GXL A;  4MGI E;  4CU7 A;  3MW2 A;  1GNY A;  1COV 1;  4QHZ A;  5J1X A;  2YY1 A;  5A6Y A;  1V9U 1;  1O4Y A;  2GN7 A;  3LB9 A;  1WKY A;  4HVR A;  4KNC A;  2XWJ B;  4BQ4 A;  5FZ1 A;  2XHN A;  4CDU C;  1K3I A;  1AR8 2;  3I54 A;  1OT5 A;  4MGY E;  4XCB A;  3GZE A;  4IE0 A;  2MEV 1;  5A3W A;  2VVE A;  4S2G A;  3T2P A;  3O1M A;  5BXX A;  3EO6 A;  3VGI A;  4D69 A;  1K5M A;  2C9K A;  5F1R A;  4OCT A;  4L11 A;  5DPN A;  3CMG A;  1MVE A;  1NLR A;  3KS7 A;  2BOJ A;  4G3Y C;  5FZ9 A;  4JQT A;  1YEW A;  2WT1 A;  3DEC A;  1PO2 2;  1MQT A;  3K4A A;  3KGL A;  3MLL A;  3POS A;  1RIN A;  2R7E B;  3IMM A;  3JB8 A;  3OYW B;  4D7Y A;  4WM7 A;  5D8A A;  1VAV A;  4CDQ A;  1N47 A;  5AFE A;  1UMI A;  1WLT A;  1PX3 A;  1H8T B;  1SLT A;  4ZHN A;  5F5Q A;  4JGZ B;  1AXZ A;  2J1U A;  4P14 A;  2Q5T A;  5A3L A;  4IV3 B;  3MIE A;  2HWC 3;  1DGL A;  4QPY A;  1U12 A;  1RUH 1;  1QU0 A;  4WM7 C;  1ZZC A;  5D8A C;  3EMR A;  2Q1F A;  5FP9 A;  1QJY 3;  1DBN A;  3Q8E A;  4PI0 A;  1L7L A;  4XVH A;  3RG0 A;  1LGC A;  4BWO A;  1FOD 2;  2DCT A;  1QJY 1;  1YJL A;  3E5X A;  1UY2 A;  5CZK A;  2WYF A;  2VPV A;  2J1R A;  4NII A;  5FBZ A;  2ZX1 A;  2FHR A;  4PDW A;  3OPW A;  2YUE A;  5C9A C;  2OUH A;  4KGQ A;  1H2L A;  5DAV A;  2QBX A;  1AYM 1;  1HDK A;  3FWE A;  3AKQ A;  4KWK A;  1GZ9 A;  4NHX A;  3F95 A;  2VNG A;  3MIH A;  1XNC A;  4JGZ A;  2I07 B;  2RR1 1;  5GM0 A;  3OBA A;  1X82 A;  2XG3 A;  3K2O A;  3U4X A;  3S5A A;  4UYB A;  3RMX A;  3UL2 A;  2WZR 2;  1W8U A;  2YMZ A;  1RUE 2;  1LEN A;  2G9Z A;  1XB9 A;  4V1P A;  3U37 A;  2WII B;  4WM8 A;  3DV8 A;  1HB4 A;  1OLQ A;  1V6K A;  1XOY A;  1ULF A;  2XHK A;  3N7M A;  4MUV A;  1CAU B;  5K4L A;  3FC0 A;  3URF A;  1LHN A;  5JDB A;  1TMF 1;  1NYW A;  1MQT B;  4IDZ A;  2VG9 A;  4YFW A;  1TMF 2;  5FZ4 A;  2HWB 1;  3HIF A;  2G9F A;  3OBT A;  2VW2 A;  1C5I A;  4LBQ D;  1AX1 A;  1SDD B;  5IWF A;  4PF1 A;  3SC7 X;  1POQ A;  1L3J A;  2C0Z A;  1XSQ A;  3VDC A;  4DUV A;  1T6B X;  2XQX A;  2JKX A;  1G9F A;  1IKP A;  1UNB A;  3HJR A;  1ENR A;  2WT0 A;  3IZO A;  3KV9 A;  5IUQ A;  3T0A A;  2D6K A;  1UY0 A;  3UV9 A;  3VBO C;  1ASJ 3;  1QH7 A;  5LK5 A;  1GBG A;  1US2 A;  4N9H A;  3BOD A;  3EBR A;  1LGN A;  2P3I A;  1CAW A;  5A1F A;  2HH9 A;  4CCC A;  4L8Q A;  1PVC 2;  2VUC A;  3PUI A;  1GNH A;  1WW4 A;  4TLF A;  4FOQ A;  4D6S A;  5JR2 A;  1ENX A;  2QDN A;  2VW1 A;  2Y0I A;  2R04 3;  1O5U A;  5DDJ 1;  1UCX A;  4LTA A;  5LAS A;  5IAX A;  1LOD A;  3FL7 A;  3S7I A;  3POE A;  4XJ8 A;  2G4I A;  1G9D A;  1KDM A;  2B4K A;  3NWK A;  4Z82 A;  4FTS A;  4DOU A;  1OOP C;  2Q8D A;  3KGZ A;  1OA3 A;  1W6N B;  2R32 A;  5KC6 A;  5CYY A;  2WNU A;  4CP9 B;  2BNN A;  1ODN A;  1NCR C;  2DU0 A;  3MIB A;  2EIG A;  1IPS A;  5DAB A;  1TG7 A;  1OLM E;  1OQ1 A;  2E32 A;  3INA A;  4FPO B;  4GWM A;  3DPR C;  3N36 A;  4FPL A;  4LBL A;  3ZYJ B;  5LY1 A;  2QFE A;  2VOX A;  5I93 A;  2XPJ A;  4R9A A;  4CU9 A;  2PTM A;  2Y38 A;  3C7E A;  3NNJ A;  3BKZ A;  2BU9 A;  4ZON A;  3SHR A;  3ZM8 A;  4DNY A;  3UKT A;  4HLT A;  4Z8B A;  1PIV 2;  1GP5 A;  2VCM A;  4NRP A;  5EZW A;  2EXI A;  2D97 A;  5LB6 A;  4QX2 A;  1OLR A;  3VKF C;  4XUP A;  1FNZ A;  1PGW 2;  1XC6 A;  2PAM A;  2Q30 A;  3WSO A;  1R1A 2;  3ZDS A;  2RS3 3;  3UT0 A;  1ALY A;  4MGQ A;  5A6Q A;  4FOW A;  4YVW C;  4CXY A;  2PHF A;  1BQP A;  1KGY A;  1PO1 1;  4XAC A;  2BZD A;  2VQT A;  5C3R A;  1O3R A;  2QQI A;  5FYC A;  3VDD A;  1IPJ A;  4GH4 B;  1RUJ 2;  4ZU4 A;  4AI2 A;  1VBD 3;  1Q43 A;  5CB7 A;  1AR6 1;  2ZX2 A;  2UWB A;  4IUG A;  3KV4 A;  1F4A A;  2GC3 A;  1LOF A;  1UU6 A;  2LAL A;  3NMB A;  4RR3 C;  3HN3 A;  4YW5 A;  5HXV A;  4YYO A;  1LB2 A;  1HRV 1;  3WV6 A;  4LBM A;  4COU A;  1J84 A;  2ARC A;  2XUM A;  1CD3 G;  5A7Q A;  3H1M A;  3H7Y A;  3AL5 A;  1K42 A;  3WW1 A;  1YFX A;  1YHF A;  2J1A A;  2BRT A;  2CAV A;  5CAD A;  1LOC A;  2LUW A;  2P2K A;  3BN6 A;  4QPG B;  5FP8 A;  4AG4 A;  2DTY A;  3IKW A;  3I2O A;  4IEP A;  4IEQ A;  3AYC A;  4AQ2 A;  4KG8 A;  1QOS A;  3MW3 A;  2PHU A;  4QPI B;  4QB2 A;  3M3O A;  3VBH A;  5F9T A;  4NID A;  2ZML A;  4NIH A;  1JI6 A;  1YIP A;  3IDE A;  3P3N A;  4QHB A;  3THC A;  3T2O A;  4JGY B;  1SBF A;  1H30 A;  1H1A A;  2D3P A;  1RJ7 A;  1FMD 3;  4NAO A;  4Q29 A;  1BEV 2;  3AP5 A;  3RRD A;  2XML A;  4MG2 A;  5FPV A;  4HL0 A;  3GJB A;  3MUZ 1;  4I3G A;  1F4H A;  3ZXF A;  1A3K A;  4QXK A;  1IZ3 A;  1OVP A;  4AVC A;  5LW9 A;  2JG8 A;  4NPR A;  2ZAC A;  1DGR A;  2AYH A;  1IG0 A;  4CDW C;  1QEX A;  4GH4 C;  2Q8C A;  1HRI 2;  2JIC A;  3WG1 A;  1IQD C;  3W58 A;  1HQW A;  1PZ8 A;  1VE0 A;  2FCV A;  2QQJ A;  5FY4 A;  2W92 A;  5A6Z A;  5JZG C;  4CZS A;  5FZ0 A;  1JHN A;  3MV0 1;  4FPK A;  2D3S A;  2VM9 A;  3ZN4 A;  3CHX A;  4D3W A;  3IDB B;  2R30 A;  3NJY A;  3WD5 A;  5G05 L;  4YZ1 A;  2GAU A;  1AYM 3;  4K40 A;  2ZHL A;  2Q8E A;  2ARX A;  1LU2 A;  1W6O A;  1H0B A;  1R09 2;  4BK5 A;  2VZU A;  5I8T A;  5ISL A;  3ES4 A;  2ADD A;  2VD7 A;  4XET A;  1NOV A;  2VMG A;  3MID A;  3ZSM A;  5FZK A;  3LSE A;  4RGG A;  2VMD A;  2VUD A;  3WW2 A;  1VBD 1;  2QQP A;  1SCR A;  3BGA A;  1DQ4 A;  2JDK A;  3SH5 A;  4XZU G;  1ACC A;  1N1S A;  1NUK A;  4XQW A;  1CX1 A;  3P3P A;  2CGN A;  4O61 A;  4A7Y A;  3AM2 A;  1SZB A;  1TZO A;  2VME A;  2V5D A;  4IEW A;  2B42 B;  2X05 A;  3W20 A;  4UXA A;  1LGB A;  4LBO A;  3DCQ A;  1PIV 1;  3KMH A;  4Q27 A;  1VBE 1;  2X5I A;  1UZV A;  1DU3 D;  1JOP A;  3LPG A;  3O0W A;  4QMA A;  2ZZQ A;  1BLZ A;  2H6C A;  2ZGM A;  4GAL A;  3AFG A;  1QOT A;  4HPK A;  4RR3 B;  4E2Q A;  1DIW A;  1ZNP A;  3ZFE B;  5FYM A;  1Y3T A;  5FZ6 A;  2XVK A;  2Y6J A;  4LHK A;  1QDC A;  5C4W C;  2ZGQ A;  1WUV A;  2B9U A;  2DF7 A;  3FLP A;  3NV2 A;  5E88 A;  1NA1 A;  4CPB D;  4N7U A;  3MEP A;  4P5H A;  4BK4 A;  5FPU A;  2A5Z A;  3HNM A;  1A78 A;  3POY A;  4QM9 A;  4NVP A;  3VBR B;  4Z1V A;  4RS5 C;  2NMO A;  4LBQ B;  5IFP A;  2WBK A;  3R05 A;  3RI8 A;  4UW3 A;  3A0K A;  2DCJ A;  3OF1 A;  1AR6 3;  5ACA 2;  4I01 A;  4BCU A;  1GWK A;  1OQE A;  3B01 A;  1UZY A;  4N9I A;  4N8M A;  1NG0 A;  1SAC A;  3O1U A;  3BCW A;  4LIU A;  4LKF A;  3ZXL A;  4H14 A;  1Z78 A;  5I8Y A;  3R0R A;  4XUT A;  4CDU A;  1I6X A;  2FCU A;  1RUD 3;  4KL1 A;  1PMJ X;  4QX0 A;  4K8F A;  5C6C A;  5FKB A;  5FIX A;  2CY6 A;  1RUF 2;  1QIQ A;  5BNP A;  4ZU5 A;  4TXW A;  1BVP 1;  2H0B A;  4AVV A;  4CXX A;  1QOO A;  1R1A 3;  4MO3 M;  4FCA A;  2E31 A;  2HEY F;  2WNV C;  4GB3 2;  3N7L A;  5T50 A;  2QZ2 A;  2BER A;  2V09 A;  4FTE A;  4FPF A;  1AZD A;  2P4E A;  5A3N A;  4A44 A;  1QHD A;  3P5B A;  4B4Q A;  4XF1 A;  4K1Z A;  4CCL A;  2VUL A;  5IW0 A;  4W6W A;  3WNK A;  1WW7 A;  1ENQ A;  1NCQ A;  3GBF A;  3WDY A;  4OHX A;  4LIV A;  2CAU A;  4BDV B;  5J3U A;  3WW3 A;  1YFW A;  3BUC A;  3M7A A;  1MEC 1;  2JKB A;  2WA4 A;  1OQD A;  3J7L A;  3O0V A;  4H55 A;  3QD6 A;  2BGC A;  1JN2 P;  4Y4R A;  4MLO A;  4QQ2 A;  4RN5 A;  4E9K A;  1WD4 A;  5K0U B;  1W0N A;  4LR4 A;  2CHH A;  2VVF A;  3HT1 A;  4Y5Z 0;  2WC2 A;  2ORZ A;  3I2I A;  1EPZ A;  2C9A A;  1CAU A;  3K4Z A;  3ZMN A;  4LOT A;  5T55 A;  4MXW B;  3ZPO A;  5FUN A;  4YW3 A;  4DB5 A;  4XDQ A;  3K51 A;  2E7Q A;  3LWC A;  3U78 A;  3VZL A;  4XQD A;  3LSD A;  1W6P B;  2OXB A;  1KJR A;  4W8J A;  3GZU C;  5JXJ A;  4YRD A;  1ASJ 1;  1PO1 2;  3KVB A;  3M3I A;  1LOG A;  3FHI B;  1DGW A;  2NLR A;  1NQJ A;  1X8E A;  2E7A A;  3OD0 A;  4IEY A;  5FZO B;  4R4X A;  1PO2 3;  3K3O A;  4KQ7 A;  3AMM A;  1NY7 1;  3ZVX A;  2J22 A;  4Q1P A;  3RQ0 A;  1N1V A;  4AZZ A;  4XJZ A;  4B7K A;  1VMH A;  2P6H A;  5BNQ A;  1VBC 1;  3U1X A;  3WHT A;  1CR7 A;  1OD3 A;  4PJY A;  5CG8 A;  1VIW B;  2HLE A;  5FZO A;  1EP0 A;  2KXL A;  3HMY A;  4FPH A;  2VY0 A;  4BIO A;  4G9S B;  1U5Z A;  4XF4 A;  4XYX A;  1PO1 3;  4P9X A;  3TWI A;  4GKX A;  4NOT A;  5GZE A;  2CDP A;  3M4F A;  2GNT A;  2O8Q A;  1VP6 A;  4IV3 A;  1BYH A;  3MIG A;  3OYW A;  2YFZ A;  5K0U A;  4DIQ A;  3I4I A;  1SBE A;  3I2J A;  2JDA A;  3JBG 2;  3RZJ A;  1JOD A;  2VAU A;  3EJK A;  2A6V A;  1W8W A;  1JZ3 A;  3LKJ A;  1UY4 A;  3KF5 A;  3MIC A;  5EP9 A;  1AYM 2;  3ITQ A;  2BJS A;  1MS4 A;  4GMP 1;  4DY3 A;  1JYW A;  4V2V A;  2QJV A;  3NV1 A;  3SCG A;  1JYC A;  4OUM A;  4CUC A;  4QGN A;  1X9T A;  1OVS A;  2BQP A;  4EN8 B;  1H2K A;  1A34 A;  4QQH A;  3CO2 A;  2ZX4 A;  4E2G A;  3WNX A;  4ATE A;  3PUS A;  4OMC A;  4BZ4 A;  2IXK A;  4LHL A;  1NX9 A;  3WQ7 A;  2OPW A;  2LS6 A;  3ZYR A;  3TN9 3;  2C5D A;  1Y9Q A;  4LA3 A;  3T2Q A;  4NN0 A;  2IC1 A;  3UGH A;  4QPI A;  5C3P A;  3RZG A;  1RUN A;  5FYB A;  5T5J A;  3ZYB A;  1ZX5 A;  4OQ8 A;  4OUL A;  4UFL A;  4XF0 A;  1CVN A;  1TVG A;  5JSP A;  1SFN A;  4GQ7 A;  1GSL A;  2Y6G A;  2VQA A;  2A75 A;  4HMZ A;  4XFB A;  4CEY C;  1S0G A;  4CEW B;  1A6C A;  3RS6 A;  2HWB 2;  4N43 C;  2B5H A;  1RUI 3;  1R09 1;  4R4Z A;  1GFF 2;  2Y6K A;  4PLN A;  4BME A;  5DAW A;  4LOR A;  4O65 A;  2PEL A;  4CDU B;  4X6R B;  4XFA A;  2WRA A;  1BKZ A;  4LKD A;  1OD5 A;  4XFF A;  2RJK A;  4XTM A;  4ISR A;  2PQS A;  5EQU A;  1VRH 1;  1S0E A;  2H6B A;  1NA1 B;  4JKM A;  2YC4 A;  4MHR A;  1UZ0 A;  2D98 A;  2KA3 A;  1SFP A;  2PN5 A;  3CL1 A;  1WBL A;  2BGP A;  4RGA A;  1PVC 3;  1KS5 A;  2XWB B;  4IEV A;  5FK8 A;  4N43 B;  2WNO A;  4XEZ A;  5JLV A;  2XDV A;  1OA2 A;  1WLD A;  1TNR A;  5IAT A;  1WD3 A;  3ZR6 A;  3QAC A;  2RS1 2;  4EYU A;  1X50 A;  1CWP A;  1AR8 3;  5ABJ C;  2NN8 A;  1IS4 A;  4RSU A;  3LEM A;  4QB6 A;  4H7M A;  5F2S A;  3SIT A;  4NRO A;  4A6S A;  3RMY A;  3T2T A;  4QGM A;  5FZG A;  4WVM B;  5FZ7 A;  2BW8 A;  3ACL A;  2R49 A;  3TRS B;  3CDZ B;  1GKB A;  4GAZ A;  4QWN A;  3VBF B;  4AI8 A;  4Y1U A;  5ANQ A;  4Y1Z A;  1WGP A;  2DBI A;  2JE7 A;  5JI7 A;  3PUH A;  3WG3 A;  1HRV 2;  4FVV A;  3ST7 A;  5L7O C;  4WVW A;  4Y1Y A;  2WSV A;  1M06 G;  2BP6 A;  2G9G A;  1W39 A;  2QZ3 A;  1RUJ 3;  3A21 A;  1CES A;  2W08 A;  4A2U A;  4P9I A;  4IEU A;  3RZH A;  3ON7 A;  4RHV 3;  2K0G A;  1ONA A;  4AFM A;  1RUF 3;  5L9B A;  1BMV 2;  2Y34 A;  1TME 3;  1DZQ A;  5IVE A;  1VBC 3;  1NXD 1;  1E57 A;  3KB5 A;  4FT8 A;  3CKH A;  1OPO A;  4L2N A;  3WP3 A;  1CPN A;  3GNE A;  5D2A A;  5GJ6 A;  3JBG 1;  3NKG A;  5I91 A;  3PL0 A;  2B9V A;  4YVS A;  3E6B A;  5FZA A;  4W6Y A;  3OTF A;  5FO8 B;  1JZ5 A;  2XL9 A;  1S0F A;  1W6P A;  1SMV A;  2WFF 1;  2VE1 A;  1ND3 B;  1VJ2 A;  4O9E A;  1RUJ 1;  2G19 A;  4PF5 A;  3GHN A;  1S2K A;  2RMU 1;  4XDP A;  2CDO A;  2RDQ A;  2SBA A;  2YGL A;  1LHV A;  3WCS A;  2QQU A;  1R64 A;  3U11 A;  3WP5 A;  2VUA A;  3VBF A;  4HKW A;  1CAX B;  1X9P A;  1W0P A;  1ND2 B;  3I59 B;  3PHM A;  1MPX A;  1RGS A;  4ES9 A;  1B35 B;  3V0A B;  4I3P A;  3IPV A;  2JE8 A;  5JR7 B;  3LDK A;  2O14 A;  2D3R A;  1O91 A;  3ATG A;  1N1Y A;  5EWS A;  3VBS B;  2ARA A;  4XUR A;  2Z42 A;  3H3L A;  2XJT A;  4Q0P A;  4BHP A;  5C9A A;  5LEJ A;  1SLA A;  4FFF A;  5JPM B;  1DZT A;  1FMD 1;  2I74 A;  1OI6 A;  2DVB A;  4OLL A;  3SIS A;  4DUW A;  2EID A;  3ABZ A;  4Q4Y 1;  5LRS A;  4XCA A;  1FMD 2;  1S55 A;  3N3H A;  4FFI A;  1AR8 1;  5A1L A;  1QQP 1;  4LOS A;  4YGD A;  4XXP A;  1IKQ A;  3CEW A;  1YWK A;  1RL3 A;  4QX8 A;  2D7F A;  2DYC A;  1BK1 A;  4LIT A;  1FV2 A;  2RS5 2;  5EJZ B;  2I2S A;  3NRU A;  1R09 3;  1MZF A;  1X8M A;  1L7R A;  1OFS A;  1MS9 A;  2A7A A;  3CF6 E;  3D6E A;  3IWZ A;  3POI A;  4YM2 A;  2BWA A;  2TNF A;  1UX6 A;  4Y20 A;  1KFX L;  1GWL A;  1WA6 X;  2OQ6 A;  3OY8 A;  4F3J A;  1WMX A;  5FPZ A;  4GMP 0;  1ENS A;  5CVR A;  1JZ4 A;  2FDH A;  3H8U A;  4JDM A;  2E6V A;  2XJR A;  3BI3 A;  1W2T A;  4QQO A;  5J96 B;  4Q26 A;  5LBE A;  4L9B A;  1WA4 A;  3ZOI A;  3BTY A;  1H8V A;  5A7O A;  4P9G A;  1GNZ A;  2DUP A;  3MV1 1;  2JDH A;  2ZOE B;  4JV4 A;  1VBB 1;  3VBO A;  4E4Z A;  1UIK A;  3KM5 A;  4URT A;  4DMI A;  3C7O A;  3ZFG B;  3KHC A;  3WX5 A;  2ZHK A;  4RQP C;  5I8S A;  4M4R A;  4FPJ A;  3QH7 A;  1R1Z A;  2Y0O A;  4FXK B;  4IES A;  5A6X A;  3DXT A;  5BV6 A;  3ZXJ A;  5BNO B;  1QJX 3;  1GZT A;  2GND A;  3TN9 1;  3UNP A;  3HPN A;  3VD4 A;  1XE0 A;  3FBY A;  3T08 A;  4B1M A;  2A6Y A;  1RJ8 A;  5FY7 A;  1AYN 1;  4ZKT B;  3TEZ A;  4LMF A;  1FV3 A;  3K77 A;  3OGG A;  4IGP A;  4UFI A;  3LAG A;  4CP9 A;  4Y22 A;  1FPN 2;  3ZFE C;  3PUR A;  1RHI 1;  2FCT A;  3POJ A;  4KWJ A;  4XXA A;  3MF6 A;  5IAV A;  2VZ1 A;  3I49 A;  3PMS A;  3DPR B;  1D7P M;  2R07 2;  3I2D A;  4ARY A;  1WZX A;  2TBV A;  1SPP B;  3KF3 A;  4R9D A;  1D0H A;  2ZGS A;  1IHM A;  3FHQ A;  3PVE A;  4Q4X 3;  2UY8 A;  2ZCW A;  4B29 A;  4AHX A;  2XLF A;  3N9Q A;  4K20 A;  1S1A A;  2PYT A;  2JD9 A;  3MFC A;  4IV1 B;  4S2H A;  5CKN A;  5GZC A;  3SH4 A;  4J1X A;  4NWV A;  2VEC A;  3L2H A;  5FJH A;  3U14 A;  4JZR A;  3GM8 A;  1SDW A;  2HBU A;  3ZKU A;  3C7G A;  1W8F A;  1GLH A;  3GCX A;  3W5M A;  5LA1 A;  3LE0 A;  3AJY A;  1AR9 3;  4K7J A;  5H9P A;  2VH9 A;  1XNT A;  2WIN B;  5EHD A;  2D43 A;  4LO6 B;  4LBQ A;  5IK8 A;  4JKL A;  5JWP A;  1NKG A;  3NJV A;  3LOI A;  3UJO A;  4CCN A;  2KM2 A;  3VHP A;  3LFI A;  2LRO A;  5EJ3 A;  1D0G A;  5ERL A;  5LEK A;  3GZT B;  4OMD A;  1RB8 G;  3TNP B;  4QKD A;  2R06 2;  1ULD A;  1CIY A;  2A3Y A;  4AQT A;  1DLC A;  3GF6 A;  4KH9 A;  4NPL A;  5KHJ A;  2ENR A;  1NAE A;  2YPD A;  3N9P A;  4BH9 A;  1DQ2 A;  2D6N A;  3WNO A;  1HRI 3;  2OW4 A;  4WZF A;  3D0S A;  4UI9 L;  1RUC 1;  5EYX A;  1UPS A;  4IEZ A;  1MZ6 A;  1QXJ A;  3BYW A;  4QPG C;  4J6G A;  3OUI A;  2QKD A;  4ZS3 A;  4BQW A;  1O8S A;  1H2N A;  4LT5 A;  2WWU A;  3AFK A;  2VTX A;  5F7U A;  5DAP A;  3UET A;  5JMC A;  2ZAB A;  4M00 A;  4XQ4 A;  3JB4 C;  2ZKN A;  3X29 B;  1OLM A;  2QQN A;  3AJZ A;  4AQ6 A;  3KCY A;  5JUV A;  1UN1 A;  4IER A;  1VBC 2;  5FCC A;  4D94 A;  4MGZ E;  1UPI A;  1NQD A;  1JZ6 A;  5CAZ A;  2PAE A;  1MS0 A;  2WZP P;  1MZE A;  3JQX A;  2RJ2 A;  2C6S A;  2PHL A;  2EAL A;  3DEM A;  1UYZ A;  4LQR A;  2R1B A;  1TNF A;  4JKK A;  4PBP A;  5FO7 B;  4A41 A;  3O0X A;  2WO3 A;  4EV0 A;  2YXS A;  3HD8 B;  2ZKL A;  3KQR A;  2XQR A;  4TYS A;  4YW7 A;  5EPA A;  1C3H A;  5C8C C;  2B8M A;  3C3V A;  4WM8 C;  3WZ1 A;  5DUU A;  5FYZ A;  2BUK A;  2WO2 A;  4EN7 B;  4IE5 A;  1NZC A;  5JXH A;  3E6C C;  1KRI A;  5IVJ A;  4LK7 A;  4IV1 A;  3BTA A;  3WNM A;  2P3Y A;  4UF0 A;  5IHR A;  3H7J A;  1AL2 3;  4YG6 A;  5L73 A;  5LBF A;  5C71 A;  3HN1 A;  3QCW A;  1X7N A;  2QVS B;  3KZ4 C;  2ZGU A;  2ARE A;  2WLP A;  3AVR A;  4LO7 A;  4OI4 A;  3ZR5 A;  3A22 A;  4M3C A;  2XUE A;  1DGW X;  3OGV A;  1OBN A;  4XJ9 A;  1NA1 C;  2ZEW A;  2YU2 A;  4QXB A;  3TAY A;  5CEH A;  4IEO A;  4BQY A;  2B45 X;  2Y6F A;  5H9Q A;  3VKM A;  1RUI 2;  1UQX A;  5H9R A;  4CEW C;  5DDJ 2;  1RMU 2;  2WNU B;  5FPL A;  1V6O A;  1STM A;  4JX0 A;  2WL1 A;  4S2D A;  3ZYI B;  4AVS A;  4Z92 B;  4BOW A;  1LES A;  4MHU A;  1DDL A;  4W50 A;  1MS8 A;  1H4G A;  3C8X A;  5IVB A;  3KCC A;  1H6X A;  2DFC A;  4CXW A;  2QQM A;  4HSL A;  5T5P A;  3R4D B;  3VBU A;  1W6N A;  1Y4W A;  5FZL A;  2BGO A;  4HN1 A;  2J1V A;  1S4C A;  3CLP A;  3NKT A;  4OHZ A;  2XR4 A;  2RV9 A;  2YBP A;  4AYU A;  5FLH A;  2RS3 2;  3OY8 B;  3W59 A;  4JAA A;  1LEC A;  5GLT A;  2A6Z A;  2WWJ A;  3BTX A;  5CIS A;  2OII A;  1ZZB A;  3AMN A;  1R08 2;  2I45 A;  3AZY A;  5HCF A;  2HKX A;  3S7E A;  4K21 A;  3MZH A;  2VNV A;  3ZN6 A;  3MI8 A;  3O14 A;  1VAL A;  4OQ9 A;  1UZW A;  3TOJ A;  1BHG A;  1NXM A;  5GZF A;  1SLB A;  2VCB A;  3Q8C A;  2QQK A;  1ULO A;  1XNK A;  2UWC A;  2P6C A;  4DXT A;  2R07 3;  2UY9 A;  5T5L A;  4FP3 A;  5DG1 A;  3LOB A;  2C24 A;  5L19 A;  1LOE A;  1REF A;  4AFB A;  1DHK B;  3T4H B;  2DUQ A;  1PX4 A;  1SBD A;  1US3 A;  2VBB A;  4HPK B;  2ZBJ A;  1W3X A;  4YLZ A;  4N53 C;  3SQO A;  3WOG A;  2NP0 A;  1LHO A;  3VHR A;  3ZFG A;  3T1M A;  3USS A;  1GMM A;  4GB3 3;  4Y26 A;  2R04 1;  4JGY A;  3UGF A;  2BBA A;  4MGT A;  3KVA A;  5KXB A;  2OT7 A;  3RPQ A;  4BLI A;  3MDP A;  5FWJ A;  4AFA A;  3A7Q A;  2IVI B;  4YWA A;  1UOJ A;  4M0H A;  4A7Z A;  3GDB A;  4ORF A;  1YI7 A;  3S57 A;  2MPF A;  5I0D A;  2Q0A A;  2DV9 A;  4FQ4 A;  2W1Q A;  3HOB A;  1NCQ C;  1IQA A;  2WZ8 A;  2VMC A;  4QXC A;  3TEW A;  3NQH A;  1A8M A;  1SFY A;  1HRV 3;  2VOK A;  3R4S A;  2PLV 1;  5GKA C;  3JBG 3;  5M0T A;  1XSR A;  3IM0 A;  4Y24 A;  5B2G B;  3VBH C;  3MPP G;  1VMF A;  1EV1 3;  2ZHN A;  4EE2 A;  2HEV F;  2RDN A;  2JIJ A;  3FN9 A;  4OZX A;  2ZEY A;  2HWF 2;  4FFG A;  4AL9 A;  5JXG A;  4JRA A;  5E16 A;  4YGC A;  5I0T A;  3ACI A;  1YIF A;  2QDR A;  1QQP 3;  1O4Z A;  2ZX3 A;  2JG9 B;  4MET A;  5H9S A;  1ZZ9 A;  4ASK A;  2EIC A;  4A3Z A;  2F4L A;  5T54 A;  1KDK A;  5EV7 A;  2KD7 A;  1QY4 A;  2GH8 A;  1FOD 1;  3WIN E;  4CP2 A;  4WM7 B;  5D8A B;  1LAJ A;  1QDO A;  2MHF A;  4RD7 A;  4XHB A;  3FBM A;  4JGZ C;  4E2S A;  4AGV A;  1H8T C;  4KU7 A;  3MF9 A;  4XIL A;  4A7K A;  1QQP 2;  2DUO A;  4XF9 A;  4CCE A;  3BIW E;  2WFP A;  1Q5O A;  1EUU A;  3VDA A;  2P3K A;  3GHM A;  2E7T A;  2HWB 3;  4XHX A;  1XNA A;  2PAK A;  4UT5 A;  4ZXE A;  3SXW A;  4ET7 A;  5F6K A;  5JOW A;  3LEI A;  3ZKY A;  1URX A;  3EXU A;  1K12 A;  3ORJ A;  2ZGP A;  4H3W A;  1OF4 A;  4CEY A;  5KHG A;  4JTN A;  4N43 A;  4DXR A;  5A1A A;  2C4X A;  3POF A;  4LHN A;  3I2H A;  1JUH A;  2W46 A;  3OPT A;  5FOJ B;  3CJI C;  3WQ1 A;  1UYX A;  3AKR A;  4GJZ A;  3NAP A;  3V65 A;  4ZZ8 A;  2HWC 1;  5HPO A;  1FXZ A;  1W9T A;  5C4W B;  3G7D A;  1L7Q A;  2B7Y A;  1Q8S A;  4RHV 1;  4BMB A;  3LPF A;  3V0B A;  1QWR A;  1W6M A;  1ZRE A;  1QMJ A;  3POW A;  4L0P A;  1S0D A;  3M3Q A;  4NJ4 A;  4BQ2 A;  3UYJ A;  4CCD A;  5JSO A;  1CAV A;  2W87 A;  4QB1 A;  4AHW A;  1CIW A;  5ABJ B;  3PTR B;  5JVV A;  2Q1Z B;  3DN7 A;  5BNN B;  1RUH 2;  2OUJ A;  1HB2 A;  4AAP A;  3T4V A;  4JHZ A;  2VOT A;  5LAT A;  3V64 A;  3VHO A;  1UKG A;  1AF9 A;  3GXU A;  2XJQ A;  2VTF A;  4ATF A;  2OPK A;  4IQP A;  3IAQ A;  4YGB A;  5FYT A;  4ZXK A;  2FBE A;  3OUJ A;  2ORX A;  2VL4 A;  1GU3 A;  4AFC A;  2RS5 1;  3FJS A;  4LNV A;  2PA7 A;  5FDB A;  2HYX A;  5FMO S;  4E27 A;  3POB A;  1UAI A;  1PVX A;  1W99 A;  3UKN A;  2HJI A;  1K5M B;  4C90 A;  2RS1 3;  2Y6L A;  3NJZ A;  4W6X A;  5GLZ A;  1JTZ X;  5FPB A;  1ULE A;  2P3J A;  5DZG A;  3VD9 A;  4ITC A;  1NZI A;  3PJQ A;  3RZM A;  1VBB 2;  5HCH A;  3ZXK A;  5FPX A;  5APA A;  5IT6 A;  2E63 A;  2WNU C;  1FX5 A;  1FPN 3;  4AI0 A;  3SH3 A;  1AR9 2;  4CCK A;  1I5Z A;  2CV6 A;  4DIN B;  2WAO A;  3VZO A;  2W1W A;  3PUQ A;  4U36 A;  4URA A;  2JG9 A;  1JMU B;  2ZMK A;  4LA2 A;  3VZK A;  2QTW B;  5AVP A;  4Q0V A;  3QBQ A;  2FMY A;  2XJP A;  2XKO A;  3UJQ A;  2X10 A;  3ZXE A;  3ZXG A;  1JZ8 A;  2A1X A;  3UGG A;  5LBB A;  2VXJ A;  2FDJ A;  1J58 A;  1I5P A;  5CIR A;  5LY2 A;  4DS0 A;  1I3H A;  4K8R B;  1W3V A;  5CFC A;  1DZR A;  4GIQ A;  2RM2 1;  2ZGR A;  1JYV A;  3D8C A;  2GAL A;  1A8D A;  2PMW B;  1ULP A;  1RUF 1;  1FPN 1;  1VBE 2;  4XAA A;  1MS1 A;  3MPB A;  4FPE A;  4JDO A;  2YFU A;  4TSV A;  1MS5 A;  1WCQ A;  2VNR A;  4UFH A;  5I0U A;  4R8H A;  4HVO A;  4JCK A;  5FRE A;  3ACG A;  1IS6 A;  4IL7 A;  3RZK A;  2Y8K A;  1LUL A;  3I97 A;  1ZBA 1;  1ZRR A;  2CWS A;  5DUW A;  1UY1 A;  4AF9 A;  2AGS A;  3O1P A;  4JGY C;  1POV 1;  4ARX A;  2VGD A;  2WN2 A;  4CPB A;  1FT9 A;  3PLQ A;  1FOD 3;  2H0V A;  1V6I A;  3K4D A;  1ULG A;  4AQS A;  1VBE 3;  4AHZ A;  4QPI C;  5T3N A;  3KSC A;  4LKS A;  3ZFF A;  4CE8 A;  4EWA A;  1T2X A;  2DVD A;  1XYP A;  3W9A A;  4EJR A;  1XQN A;  3I2G A;  4QX5 A;  2ZGL A;  3WLU A;  1XJA A;  4ASL A;  4H7L A;  1H1I A;  2ADE A;  2LRP A;  2WNE A;  1GZW B;  4P9L A;  1G6N A;  5C8C A;  1POV 0;  5GLU A;  1TE1 B;  4JTO A;  1F2N A;  1ND3 A;  5HV0 A;  4PCR A;  1W9Y A;  4KI5 M;  2DU1 A;  4X8P A;  1RHI 2;  4GKY A;  1W8O A;  2P17 A;  1DQ1 A;  2IFR A;  4FPY A;  4Q4V 1;  1QNY A;  1YUD A;  2RS1 1;  3S30 A;  1U5Y A;  3IIA A;  5FYU A;  4HVQ A;  3U0Z A;  3EB7 A;  3A23 A;  3T09 A;  3S0M A;  2SLI A;  2W94 A;  3DYO A;  3HNY M;  1LED A;  3H8O A;  4MXV A;  1DLL A;  2PHT A;  2EXJ A;  4D6Q A;  3VBF C;  5EYY A;  4PDW B;  2ZEX A;  2ILM A;  3OEB A;  2QQO A;  2D40 A;  1ASJ 2;  2R0F A;  1GP6 A;  1XRU A;  2BV4 A;  4OHV A;  3RGB A;  3IN9 A;  2YHJ A;  3LZZ A;  3ES1 A;  2MEV 2;  1UZZ A;  1Y7B A;  3WNL A;  1K45 A;  4OYU A;  4XOG A;  2NMN A;  5FQ0 A;  4Q1R A;  1XE7 A;  2DCY A;  1Z7S 2;  4YG0 A;  1H2M A;  2FDF A;  1QKQ A;  2WQ8 A;  4YW1 A;  4AVT A;  5JOY A;  4CUA A;  4ZY9 A;  1YQ8 A;  4RA0 A;  4XFI A;  5KXE A;  1DYP A;  5BPX A;  1OFN A;  4AI1 A;  3BOP A;  1W8N A;  4BIS A;  1JUI A;  4QKB A;  4LUL A;  1COV 2;  4C1W A;  4GUL A;  3N9L A;  2WAA A;  3B9I A;  5FWE A;  3J8F 1;  4RL7 A;  4C91 A;  5HBA A;  4FOV A;  3O12 A;  5A33 A;  2BTV C;  3LIH A;  4QM8 A;  2ATF A;  4YM0 A;  5AC9 3;  1PZ7 A;  1V6L A;  2GH2 A;  4PBO A;  1RYY A;  4QU2 A;  4FQZ A;  4K6B A;  4M3C F;  2QQL A;  1YC6 1;  4F8A A;  3NJX A;  3B7M A;  3HEI A;  4QAW A;  1MEC 3;  4ERO A;  5IK7 A;  3ZFE A;  2Y6H A;  1OUS A;  2GDF A;  3WF4 A;  4COW A;  3T0B A;  3HVD A;  2WS9 2;  4CUG A;  1GOF A;  3NV4 A;  5JIA A;  3AZW A;  3IDC B;  5G04 L;  2XJS A;  1PIV 3;  3JZV A;  1NY7 2;  4H2A A;  4R9B A;  4CCM A;  3R4U A;  2BEO A;  3AZV A;  3QH6 A;  1YNA A;  1CN1 A;  2YPJ A;  4Q2F A;  5FY9 A;  5F37 A;  3O1R A;  4Z07 A;  2TEP A;  1KS4 A;  2DVA A;  2VR4 A;  1VB2 A;  1O3T A;  5FY8 A;  1JHJ A;  3I2F A;  4C8D A;  2DCK A;  4F83 A;  5CU1 A;  3T30 A;  5F5I A;  4RQP A;  3WNP A;  2TUN A;  4K3U A;  4Q4X 2;  1RUD 2;  2OX0 A;  3HWJ A;  4KBB A;  4YZ4 A;  1RUI 1;  4XBQ A;  3PU8 A;  1RXG A;  2VZS A;  1ST8 A;  1XBF A;  3WF1 A;  3ZN5 A;  1OKQ A;  2WKK A;  3WDT A;  4XFG A;  3KT1 A;  5ANN A;  1SEF A;  2DBN A;  3NNF A;  2RG4 A;  2CTV A;  4AOC A;  5LK7 B;  1S0C A;  2X53 S;  2RS3 1;  3SKJ E;  5BNN C;  2Q4S A;  4WVV A;  5EXO A;  5FOB B;  2NQY A;  1J1L A;  2O1Q A;  2YBS A;  1VAM A;  2YU1 A;  3M1H A;  1C8M 2;  3RI9 A;  4NO4 A;  1AYN 2;  1W03 A;  2PLV 3;  1FAT A;  3BAL A;  4RFT 0;  5LBC A;  3CQO A;  1YRZ A;  1HIX A;  1DCS A;  4LEJ A;  3PUA A;  1E5R A;  1YLL A;  3NST A;  3AYE A;  5IVY A;  3CJI B;  4XIO A;  3KV6 A;  3N7J A;  1ZRD A;  2FZ1 A;  3C2U A;  4CP1 A;  4UOJ A;  4E4H A;  1HXS 3;  3LEK A;  4EN6 B;  3TB0 A;  3V0A A;  1CQ9 A;  2VNO A;  4P9W A;  4BPZ A;  3K3N A;  1LOF C;  4TZD A;  3WP4 A;  4OZO A;  2BYV E;  5IVC A;  1E5I A;  3E5Q A;  5A7S A;  5LA2 A;  3LA2 A;  5GLV A;  1AL0 G;  1JXN A;  5A7W B;  5FXV A;  3RFR A;  2HWE 3;  5KR7 A;  3MUY 1;  3VBH B;  4J25 A;  2GME A;  4YAR A;  3ZSJ A;  4UW5 A;  2J1S A;  1ZBA 2;  4L92 A;  3ZPY A;  1B35 C;  4NAM A;  3ENR A;  2CL2 A;  4QDQ A;  3D3A A;  3AMP A;  5SV8 A;  4XW3 A;  3ACF A;  2AAC A;  3USU B;  4XTP A;  4R9C A;  1OPM A;  3WDU A;  4B7E A;  5K0U C;  1XU2 A;  1HB3 A;  4IV3 C;  3AYA A;  1I9R A;  2XKP A;  2GC1 A;  1PNF A;  1C5H A;  4FPG A;  4XJU A;  3N35 A;  3ZYH A;  3B02 A;  2XBO 3;  3ZYP A;  2Y60 A;  1ND2 C;  5FRA A;  3VDD C;  4JRL A;  2R0H A;  3D4K A;  1W9W A;  4XC9 A;  2BNO A;  4JQR A;  2GMM A;  2WA3 A;  3NV3 A;  4NR1 A;  1J3Q A;  1O4T A;  4SBV A;  1JYX A;  2WWS A;  4QHO A;  5LZ6 A;  1G8W A;  5LA9 A;  2DFB A;  1X33 A;  4Q4Y 2;  3DPR A;  1AR7 2;  4DRV A;  2WZR 3;  4CCJ A;  5KXD A;  5CG9 A;  4Y33 A;  1F5J A;  4QDR A;  1LR5 A;  1V6J A;  1Y9M A;  3LGR A;  5F3E A;  1EAH 2;  1UKR A;  4KWU A;  1C4R A;  1BEV 1;  5F32 A;  2ZTN A;  3WCR A;  1U0A A;  3JQW A;  4CDQ B;  4BB3 A;  1UD1 A;  4YM1 A;  1PGL 2;  3MYX A;  1BVV A;  1PK6 B;  2HEW F;  5KHK A;  2JEN A;  3N4M A;  4XJW A;  1BBT 3;  1MS3 A;  2XOM A;  2J1E A;  5DN2 A;  4I02 A;  4M01 A;  4WVM A;  1AHS A;  1UF2 C;  3LEG A;  3M3C A;  3APB A;  4UBH A;  4YVS C;  3DKQ A;  3FFZ A;  1DF0 A;  4K9S A;  4UWD A;  4BA6 A;  1S2E A;  3VBU C;  1CJD A;  2CNA A;  3WHU A;  1HRI 1;  4BQ5 A;  1GV9 A;  3AMQ A;  1M4W A;  3POG A;  3OG2 A;  2R04 2;  2D93 A;  3AX4 A;  1PM4 A;  4AK3 A;  2ES3 A;  2VQ0 A;  5CFD C;  3DF0 A;  1V9U 2;  5A70 A;  2IUW A;  5AFB A;  1LCL A;  1H9P A;  2D6M A;  3FUQ A;  3M8L A;  4ES8 A;  1F15 A;  1W6Q B;  4LHS A;  1H6Y A;  2IWG B;  4G4F A;  4EN9 B;  1ODM A;  2HWD 2;  4IE4 A;  1CZS A;  4XF3 A;  5JOZ A;  5CFD A;  2OZJ A;  4IND A;  3VL8 A;  4PQ9 A;  4DFS A;  4CA9 A;  2R6Q A;  1ZRC A;  3H3Z A;  3WEZ A;  5FYS A;  2XVL A;  3TN9 2;  3WY6 A;  4C0B A;  4DXZ A;  5ABJ A;  3GBG A;  5JZG A;  1C1F A;  1Q8O A;  1W6Q A;  2VZV A;  2WS9 3;  2VJX A;  2ZXQ A;  2NPI A;  2ZGN A;  3IMN A;  3NNL A;  3S5Q A;  4E8C A;  5FZ8 A;  4YNI A;  4WVZ A;  3RNS A;  3G6J B;  4A4A A;  1YYN A;  1CAW B;  3ZSK A;  1QXP A;  3H3U A;  3LQC A;  4XIK A;  2YB7 A;  2KR2 A;  1WLC A;  2EIB A;  3ACH A;  4HK9 A;  2AEY A;  4YVW A;  3U4S A;  4OHW A;  5J37 A;  1HQL A;  1WMD A;  3KT4 A;  4XUN A;  3WDV A;  2C26 A;  1JYT A;  5FO9 B;  4D7S A;  2XL7 A;  4CEY B;  4HSJ A;  4FBF A;  4RR3 A;  3OOX A;  3TEX A;  4X8N A;  1HJF A;  4DUX A;  3VN4 A;  1XXN A;  2JG8 C;  3V56 A;  1JW6 A;  5J7M A;  4PIX A;  5KC5 A;  2ZA9 A;  3AXE A;  3IPV B;  3DL3 A;  2GC0 A;  4Q4W 1;  1W8H A;  5FZD A;  1Z0H A;  4P9Y A;  1MZ5 A;  5FUI A;  2RJL A;  4KG0 A;  4BQ1 A;  2IXC A;  3RJ2 X;  1PNG A;  2E33 A;  1W8Z A;  3AZZ A;  1G9C A;  2V5Y A;  3CU7 A;  1HQN A;  2HWE 1;  1O6U A;  4WM8 B;  5A32 B;  3PDQ A;  5C8W A;  1BEV 3;  1JOB A;  1CGP A;  1CON A;  3VBO B;  4N90 A;  5KBF A;  5IK5 A;  2D6L X;  4TTG A;  3C7H A;  3J7M A;  1EV1 2;  4P9J A;  1VBD 2;  4BIF A;  3AP4 A;  3OEA A;  4QQP A;  4CDW B;  5FZ3 A;  1GAN A;  2CWM A;  2WZR 1;  3LDR A;  4HBN A;  4QKN A;  1K5J A;  2VBD A;  2OYZ A;  4GJY A;  4HXC A;  3MIF A;  4COV A;  4CUB A;  1EV1 1;  3THD A;  3AKP A;  5FMC A;  1WCK A;  4DO0 A;  2HWC 2;  3D0J A;  4OI1 A;  3I3Q A;  1WBF A;  4YVS B;  3FLT A;  3VD7 A;  1RIR A;  4AED B;  2V73 A;  2W1S A;  4AVB A;  4NWW A;  2A73 B;  2QNK A;  1KFU L;  3TYJ A;  4CP0 A;  4N53 A;  3P1I A;  4D7T A;  1O3S A;  3E1F 1;  1MQT C;  2JEC A;  4MYE A;  4AHY A;  3NAP B;  2PLV 2;  4CDQ C;  2WSU A;  4LUK A;  1PGL 1;  2MNG A;  4FPC A;  1UMH A;  3I8T A;  3SLI A;  1Q56 A;  1OH4 A;  2ZZJ A;  2Y64 A;  4YW4 A;  4DEV A;  2UUR A;  5F2W A;  2BBV A;  3A4U A;  1BCX A;  1F8V A;  3AZX A;  4C1X A;  5FXW A;  3VDB A;  2VZT A;  2E51 A;  2HWF 1;  4IXL A;  1BMV 1;  3OBR A;  1GR3 A;  2OA2 A;  1HN1 A;  1JYN A;  3Q8B A;  2IFW A;  2DVF A;  4YZ2 A;  1RUE 3;  1H8T A;  2OQ7 A;  2W91 A;  5FZF A;  5C3S A;  2XXZ A;  4Q0U A;  5AC9 1;  1VRH 2;  3III A;  3NO8 A;  4Y3O A;  5C9A B;  3ECQ A;  1RXF A;  1UWW A;  3KHB A;  4W4Z A;  1RUC 3;  1RUG 2;  2GP5 A;  2IXJ A;  4XDO A;  4E8D A;  1SQ4 A;  3H8X A;  5FYI A;  1B35 A;  3OGR A;  2RMU 3;  5DZF A;  3ZYG A;  1FAY A;  1EAH 1;  3B93 A;  3KQ4 B;  1W8T A;  1QJF A;  2MEV 3;  2X8K A;  3E5U A;  5F5C A;  2VMI A;  5KXC A;  5FYH A;  5LRR A;  2HWD 1;  4UAP A;  5IFT A;  1KIT A;  2AZ5 A;  2VUJ A;  1AR7 1;  3VKL A;  4CCO A;  2GSY A;  2E53 A;  1EYB A;  3O1V A;  2R1D A;  5FXZ A;  3C7F A;  4YVW B;  2UU8 A;  1ZZ6 A;  1D2Q A;  3SKV A;  3WT3 A;  3K48 A;  2XBO 2;  1D4M 2;  5FZC A;  5KHH A;  2WO7 A;  4NPM A;  2W95 A;  5FMD A;  4R52 A;  1BBT 2;  5FXX A;  2WLQ A;  2QCS B;  4B8E A;  4LLO A;  4AEJ A;  3TNQ A;  3IB3 A;  4EN0 A;  2GMP A;  4HK8 A;  3PIG A;  1VBA 3;  5A7P A;  4YM3 A;  5ACA 3;  3MLJ A;  3FMG A;  3J7N A;  4M3C E;  1UXX X;  1O59 A;  5BUV A;  3HNB M;  3THP A;  1NCR B;  1QJZ A;  4EQV A;  4FTB A;  4M4P A;  1NT0 A;  3AVS A;  4BYY A;  3BB6 A;  1TEI A;  1HJG A;  3R6S A;  3ZIW A;  5JSR A;  2XLA A;  1SPP A;  3VKO A;  3ZXD A;  4GWN A;  4PHZ A;  1GYK A;  1XND A;  4CDX B;  2EAK A;  1WLW A;  4XJA A;  4LKE A;  1KQR A;  3MW4 A;  5T5O A;  3ZFG C;  5A32 A;  3K75 B;  3KCX A;  4HAN A;  1UOF A;  2BFU S;  1W0O A;  1SHW B;  1ZZ8 A;  1YCI A;  1WMF A;  3T0D A;  4GD4 A;  4OUE A;  3N9M A;  2AUY A;  4MH0 E;  3ZYF A;  5BNO A;  1SLL A;  3PJY A;  4LXL A;  5C5T A;  5LCW L;  1GOG A;  5FV3 A;  2E9Q A;  4DXS A;  5BNP C;  2X09 A;  4Y4Y A;  1CAX A;  2E26 A;  2YGM A;  2WFF 3;  3MLK A;  2ZEZ A;  1JU4 A;  4PDW C;  4Y1X A;  2FDG A;  1VBB 3;  3J8F 2;  4OUS A;  4CTE A;  1UU5 A;  4PLO A;  1QXR A;  2BVB A;  2P5B A;  5BNO C;  1CPM A;  2ZAA A;  2VQU A;  2OS2 A;  2UYB A;  1HXS 1;  1HV0 A;  1W2N A;  2X29 A;  1OC1 A;  1GUI A;  1NCR A;  5E8A A;  1G86 A;  3WVJ A;  3GBW A;  1QJX 2;  5FR3 A;  2YBK A;  5DUX A;  1YQC A;  2JEM A;  4B1L A;  5F6L B;  4XMA A;  2GNB A;  2FD8 A;  5J09 A;  4XAE A;  3ZN6 B;  2QQW A;  1ZZ7 A;  4F7Z A;  3ME2 A;  3U10 A;  1ZBA 3;  1TME 2;  4O9G A;  5CA6 A;  2V4A A;  4MZU A;  1LOA A;  5CBL A;  4GZ9 A;  2D6O X;  1RC6 A;  4HET A;  5EJ1 B;  1WW5 A;  5ACA 1;  3K46 A;  3V0B B;  3AYD A;  4AED A;  1G9A A;  1G7Y A;  2ZS6 B;  3ROU A;  3UKV A;  3RYK A;  3RZZ A;  4MVT A;  3JD7 1;  2W9X A;  5DZE A;  2A6X A;  1JYI A;  2Y26 A;  1C8N A;  1DQ0 A;  2JD4 A;  4MAD A;  1ZA7 A;  3L9J T;  5CKQ A;  5BY5 A;  2PHW A;  2CU5 A;  2V4V A;  4C0H A;  1GZW A;  2JDN A;  3AP9 A;  1D4V B;  4MXW A;  5FZI A;  2GC2 A;  2A3X A;  1XYO A;  1OA4 A;  4UFM A;  3VBS A;  4LBN A;  1RMU 1;  2EVX A;  4LE4 A;  3JXS A;  2AEZ A;  4KBZ A;  4XUQ A;  2JDP A;  1DP0 A;  1YQ5 A;  2BOI A;  4ZU7 A;  1LRH A;  3WG2 A;  4AEM A;  4Q4W 2;  1EAH 3;  1OSG A;  3O5S A;  3VKN A;  1YI9 A;  4O7X A;  1JZ7 A;  3ZDV A;  1YFU A;  3DUI A;  1NCQ B;  2HWE 2;  3JCI A;  1IS3 A;  5DMY A;  2FDK A;  2PXJ A;  2R06 3;  3W5N A;  2Q8O A;  1AVB A;  3BPZ A;  2ZGO A;  5FYY A;  4AAX A;  2PHX A;  2Z69 A;  2DUR A;  4HKL A;  2DWR A;  4XPV A;  4D8M A;  3TEY A;  2W52 A;  3IBM A;  4AW7 A;  2WZE A;  4KU8 A;  4XFH A;  2VZO A;  1EY2 A;  1PGW 1;  1RUG 1;  5DAQ A;  3UES A;  1W2O A;  4YG3 A;  4QGL A;  5FP7 A;  1EUT A;  3U75 A;  1REE A;  1RUG 3;  1O7F A;  1RUC 2;  1YFY A;  3IT8 A;  5J36 A;  5L9V A;  2YYO A;  3S6P A;  3VLB B;  5CFC B;  3H1Y A;  1V9U 3;  4YW6 A;  3FLR A;  2WAB A;  4Z2W A;  1J3P A;  1NLS A;  3WP6 A;  5I0R A;  2V72 A;  1COV 3;  1VRB A;  1U5X A;  2LM3 A;  3ZFF C;  4MGK E;  3H0O A;  2JWP A;  1JOJ A;  4LBJ A;  2P37 A;  5SV5 A;  5FP3 A;  1AR7 3;  5BYN A;  1F5F A;  4OHY A;  4IET A;  4AGR A;  3AB0 A;  1Z7S 3;  2VVD A;  3GYD A;  3JUU A;  2K2S A;  3LFM A;  3VBR A;  3H8R A;  4MOA A;  2WYS A;  1PM7 A;  1Q3E A;  3B69 A;  5LWB A;  5C3Q A;  3MHZ A;  1IS5 A;  2A71 A;  3FFQ A;  4TWT A;  2VO5 A;  1LNS A;  4P02 B;  1APN A;  2ZAH A;  3N9O A;  3KV5 A;  4B4P A;  4RS5 A;  3LD8 A;  1ZBE 2;  1ZYB A;  2W2I A;  3MFA A;  3WUC A;  5AC9 2;  3O1T A;  1UIJ A;  2DVG A;  1MR5 A;  2D44 A;  2VMF A;  3P6B A;  4BM8 A;  4I2O A;  1YQ6 A;  2EIE A;  2PFW A;  5L7O B;  4RFR B;  3CJI A;  1OKO A;  5KHI A;  5GZD A;  5F3C A;  5DAX A;  1D4M 3;  1S2B A;  3WF2 A;  2RM2 3;  2RS5 3;  3W21 A;  1OF3 A;  2W0X A;  4EWE A;  1XE8 A;  4IEX A;  1T6G C;  2XB6 C;  5EIY B;  4CVU A;  1POV 3;  4L97 A;  4GMP 3;  2XGX A;  4CDX A;  1JZ2 A;  2J1T A;  5HV4 A;  4FI9 A;  3GGL A;  1J3R A;  4NMI A;  4GWJ A;  3ZIX A;  1KJL A;  4KGG A;  4AVA A;  5J98 B;  4AR2 A;  3PTY A;  4WV8 A;  2IXL A;  4AEK A;  5BNN A;  1F35 A;  1Z7S 1;  3LF7 A;  1K5M C;  4CU8 A;  4CDX C;  4RHV 2;  5FK7 A;  2Y33 A;  5E6H A;  2Q1M A;  1ZBE 1;  3PVO A;  4E4S A;  3VHN A;  2BPA 2;  3I7D A;  4AGG A;  3SNM A;  2GP3 A; 
#chains in the Genus database with same CATH homology
 4DUW A;  2EID A;  3ABZ A;  4XVH A;  4A6O A;  1RYY A;  2DDU A;  1UY2 A;  5CZK A;  2QQL A;  2J1R A;  3NJX A;  3HEI A;  4QAW A;  2Y6H A;  2VCA A;  3WF4 A;  3T0B A;  2QBX A;  1GOF A;  5HXM A;  2VZR A;  1UY3 A;  5EJZ B;  5G04 L;  3NRU A;  4BXS V;  1O8P A;  4XUO A;  1L7R A;  3OBA A;  2VR4 A;  3J7H A;  1JHJ A;  3I2F A;  3U37 A;  2DCK A;  1JZ4 A;  3WF3 A;  3WNP A;  3CZJ A;  2W47 A;  1JU3 A;  1KEX A;  2VZS A;  3WF1 A;  3MV1 1;  4PQQ A;  3C7O A;  3SKJ E;  1SDD B;  4M4R A;  4PF1 A;  2LW8 A;  3OGS A;  3VDC A;  4DUV A;  2XQX A;  3FHA A;  2JKX A;  3UNP A;  3HPN A;  3VD4 A;  3CQO A;  3HJR A;  3T0A A;  1P8J A;  1UY0 A;  3T08 A;  3SEE A;  1US2 A;  3K77 A;  4UOJ A;  2RVA A;  2YG0 A;  3LEK A;  4HG6 B;  3PUI A;  5JR2 A;  2VZ1 A;  1D7P M;  4ARY A;  4OZO A;  4CU6 A;  3FHQ A;  5LA2 A;  3FL7 A;  4LPL A;  2JD9 A;  3MUY 1;  2B4K A;  2J1S A;  3GM8 A;  3C7G A;  4QDQ A;  5IJR A;  3D3A A;  3W5M A;  5CYY A;  5LA1 A;  3LE0 A;  3ACF A;  1XNT A;  1TG7 A;  3SEP A;  2E32 A;  3NNG A;  4JKL A;  1NKG A;  3NJV A;  4CU9 A;  3C7E A;  4OMD A;  1W9W A;  3WQB A;  3ZM8 A;  1CIY A;  5JMO A;  1JYX A;  1DLC A;  3I3B A;  1NAE A;  2Z4F A;  4QX2 A;  4XUP A;  1XC6 A;  3WSO A;  3WNO A;  4MGQ A;  4UI9 L;  1KGY A;  4QDR A;  2BZD A;  2VQT A;  2QQI A;  1UYY A;  2WO1 A;  4KWU A;  3VD5 A;  4KMQ A;  1O8S A;  4IUG A;  2W1U A;  2W3J A;  5F7U A;  1F4A A;  3UET A;  2XOM A;  3HN3 A;  2J1E A;  2QQN A;  5JUV A;  5DN2 A;  1YQ2 A;  3MO4 A;  3LEG A;  1J84 A;  1JZ6 A;  1K42 A;  3OG2 A;  4A42 A;  1UXZ A;  2J1A A;  4AG4 A;  3BN6 A;  2RJ2 A;  3EYP A;  1UYZ A;  2VCC A;  4LQR A;  4JKK A;  4QB2 A;  4A41 A;  2WO3 A;  1JI6 A;  1SG3 A;  3THC A;  3T2O A;  4LHS A;  1H6Y A;  2WO2 A;  5JXH A;  1CZS A;  3WNM A;  3WEZ A;  5IHR A;  4P5Y A;  3MUZ 1;  4QDS A;  5C71 A;  1F4H A;  2VZV A;  2ZXQ A;  4E8C A;  2VJX A;  4A4A A;  3A22 A;  3LQC A;  5JXI A;  1JZ8 A;  2YB7 A;  3OGV A;  2EIB A;  3ACH A;  4QX3 A;  2ZEW A;  4XUN A;  1IQD C;  2C26 A;  2QQJ A;  2W92 A;  3WNN A;  3MV0 1;  4JX0 A;  4DUX A;  2VM9 A;  5IYY A;  5G05 L;  4W50 A;  3C8X A;  1H6X A;  2QQM A;  4BK5 A;  2VZU A;  3I2K A;  5FUI A;  2BGO A;  2J1V A;  2E33 A;  5C70 A;  2RV9 A;  2XON A;  2VMD A;  3CIH A;  4D0Q A;  3BGA A;  1UX7 A;  4XZU G;  1NUK A;  4TTG A;  3C7H A;  3WF0 A;  1CX1 A;  1W9S A;  2WDB A;  3OEA A;  2VME A;  2V5D A;  2X05 A;  4CUB A;  2VZ3 A;  1BHG A;  3THD A;  2VCB A;  2QQK A;  3LPG A;  1ULO A;  3ETP A;  3VD7 A;  2W1S A;  4DXT A;  3I3D A;  3P1I A;  3E1F 1;  2J7M A;  2Y6J A;  3OB8 A;  1UMH A;  1OH4 A;  4DEV A;  1PX4 A;  2Y64 A;  4BK4 A;  3HNM A;  1US3 A;  3VDB A;  2VZT A;  5IFP A;  3IDA A;  2WBK A;  4DEQ A;  1HN1 A;  2DCJ A;  1JYN A;  2W91 A;  1GMM A;  2BBA A;  3III A;  3ECQ A;  4XUT A;  1UWW A;  4P00 B;  3A7Q A;  4W4Z A;  4E8D A;  1PMJ X;  4QX0 A;  3GDB A;  3OGR A;  5I0D A;  4TXW A;  2W1Q A;  3HOB A;  2WZ8 A;  2VMC A;  4MO3 M;  4UAP A;  3NQH A;  5IFT A;  2E31 A;  2BER A;  3C7F A;  4A44 A;  3SKV A;  4QPW A;  2OKX A;  2VC9 A;  1CZV A;  3FN9 A;  3WNK A;  2W95 A;  2ZEY A;  5JXG A;  4BDV B;  3IAP A;  3ACI A;  3F2Z A;  3IB3 A;  2EIC A;  4A3Z A;  1GOH A;  1UXX X;  1O59 A;  2KD7 A;  3HNB M;  1W0N A;  4M4P A;  2ORZ A;  3I2I A;  4Z2A A;  3K4Z A;  5LA0 A;  4W8J A;  5JXJ A;  3K75 B;  1EUU A;  3VDA A;  1XNA A;  4ZXE A;  4ET7 A;  1SHW B;  2J22 A;  3LEI A;  3T0D A;  4OUE A;  1K12 A;  1OF4 A;  4DXR A;  5A1A A;  2C4X A;  2VZQ A;  5LCW L;  1GOG A;  3I2H A;  2W46 A;  1OD3 A;  4QX1 A;  4DXS A;  2X09 A;  4ZZ8 A;  1UYX A;  2E26 A;  2HLE A;  2ZEZ A;  1JU4 A;  1J83 A;  5HPO A;  1W9T A;  1L7Q A;  4MGS A;  3LPF A;  5DQ0 A;  2CDP A;  4PT6 A;  4RYD A;  4L0P A;  2VQU A;  2WUH A;  1GUI A;  2YFZ A;  2W87 A;  3I2J A;  4QB1 A;  2JDA A;  2L9L A;  1JZ3 A;  1UY4 A;  4JHZ A;  2VOT A;  5B4N A;  1JYW A;  3DYM A;  3DYP A;  3GXU A;  2VTF A;  2ID4 A;  3IAQ A;  4CUC A;  2ORX A;  2VL4 A;  1GU3 A;  4BJ0 A;  4GZ9 A;  5EJ1 B;  3K46 A;  2HYX A;  4OMC A;  1NX9 A;  2LS6 A;  3VD3 A;  1W99 A;  3CZU A;  3T2Q A;  2W9X A;  2Y6L A;  4MAD A;  3VD9 A;  4YPJ A;  4P08 A;  2V4V A;  3I3E A;  1TVG A;  2Y6G A;  3JXS A;  4XUQ A;  1DP0 A;  2WAO A;  2YC2 A;  2W1W A;  1XPW A;  2Y6K A;  1PMH X;  1JZ7 A;  2X10 A;  1GQP A;  5DMY A;  5C7G A;  2WN3 A;  3W5N A;  1I5P A;  2PQS A;  4D8M A;  4AAX A;  3AC0 A;  4JKM A;  2YC4 A;  1UZ0 A;  2WZE A;  2BGP A;  2VZO A;  1JYV A;  1ULP A;  2W5F A;  5B4X A;  3UES A;  1EUT A;  1CZT A;  2YFU A;  4ZZ5 A;  1WCQ A;  4GWI A;  2WAB A;  4QB6 A;  3ACG A;  2V72 A;  2Y8K A;  3I97 A;  3CDZ B;  1UY1 A;  4ARX A;  2WN2 A;  3PUH A;  4A45 A;  3K4D A;  4LKS A;  3MBW A;  3A21 A;  1T2X A;  4MOA A;  2WYS A;  3I2G A;  2VZP A;  1DYO A;  1LNS A;  2VO5 A;  4P02 B;  4CU7 A;  1GNY A;  5J1X A;  4KI5 M;  1W8O A;  2VMF A;  3CKH A;  3P6B A;  1WKY A;  2EIE A;  2B9V A;  3EB7 A;  3A23 A;  3T09 A;  2W94 A;  2XHN A;  3DYO A;  3HNY M;  1JZ5 A;  1K3I A;  1OT5 A;  3WF2 A;  2ZEX A;  3OEB A;  3T2P A;  2QQO A;  1OF3 A;  2C9K A;  5DPN A;  2CDO A;  3WNL A;  1K45 A;  3CMG A;  4OYU A;  5EIY B;  4CVU A;  1JZ2 A;  1R64 A;  2J1T A;  3DEC A;  3K4A A;  4FI9 A;  3GGL A;  2R7E B;  4GWJ A;  2WQ8 A;  1MPX A;  1UMI A;  4ZY9 A;  1PX3 A;  4CUA A;  4CU8 A;  2JE8 A;  2J1U A;  1W8N A;  4XUR A;  2WAA A;  4RN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...