2XONA

Structure of tmcbm61 in complex with beta-1,4-galactotriose at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
145
structure length
145
Chain Sequence
SRNYLKNPGFETGEFSPWRVSGDKKAVKVVKANPSSNAHQGEYAVNFWLDESFSFELSQEVELPAGVYRVGFWTHGEKGVKIALKVSDYGGNERSVEVETTGWLEWKNPEIRNIKVETGRIKITVSVEGRAGDWGFIDDFYLFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARABINOGALACTAN ENDO-1,4-BETA-GALACTOSIDASE
publication title Recognition of the Helical Structure of Beta-1,4-Galactan by a New Family of Carbohydrate-Binding Modules.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 34
structure length 145
sequence length 145
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2xonA00
4BJ0A 3C7FA 4ZXEA 1ULPA 3I3BA 3K4DA 4A4AA 4ZY9A 5DN2A 3WSOA 4P5YA 1US2A 2Y6JA 1OH4A 1GUIA 2QBXA 5A1AA 2QQNA 3IIIA 1OT5A 1TVGA 1CZVA 4GWIA 4QAWA 2J1UA 4PF1A 3WNLA 4DUWA 2W92A 1K42A 2VMCA 1NUKA 3NRUA 2XOMA 4RN5A 1ULOA 1EUTA 2WABA 2VZPA 2W95A 4E8DA 2ZXQA 2R7EB 4XUQA 2DDUA 3IB3A 4JX0A 2VO5A 2WZEA 1H6XA 2W46A 3CDZB 4W4ZA 2Z4FA 3WNKA 2Y6KA 3GGLA 4D0QA 3UNPA 4ARYA 2QQLA 3F2ZA 1UY3A 5C70A 3UETA 5HXMA 1K45A 3OEAA 1GOHA 4JHZA 1F4HA 2VQUA 4HG6B 2E32A 3I3DA 3HN3A 2EIDA 3FHQA 4XURA 1CZTA 4ARXA 4L0PA 5IJRA 5IFPA 4A3ZA 1D7PM 4CU7A 3ACIA 3J7HA 5I0DA 1J84A 5C71A 2X10A 3K77A 2ORZA 3JXSA 3MV11 3T2PA 5DMYA 1JYWA 3A23A 2YB7A 3IAQA 4RYDA 3ETPA 2ZEYA 2W1WA 3K75B 5LCWL 4OYUA 2Y64A 4CU9A 2VR4A 3LEGA 2JE8A 3C8XA 4TTGA 5JR2A 1PMHX 4MOAA 3I2IA 3WNMA 1YQ2A 1W9WA 3A21A 3HPNA 2J1AA 3DYMA 4UI9L 3OEBA 4QPWA 3FL7A 1GMMA 3WF4A 3P1IA 3LEIA 2VMEA 5JXHA 3HEIA 1EUUA 4JKLA 2WBKA 1JU3A 2VZ1A 3VDBA 3I97A 3C7OA 1JZ4A 2VC9A 5G05L 4YPJA 1SG3A 4KMQA 2JKXA 3OG2A 3W5MA 1PX3A 1JZ3A 1OF4A 3I2KA 1UYYA 3UESA 3CZJA 3AC0A 2BBAA 1UMIA 5LA0A 1SHWB 3ECQA 4BK5A 3ACGA 3MO4A 4MGQA 3C7HA 5FUIA 4GWJA 3SEEA 3VDCA 3WNNA 3MUZ1 4CUAA 1XPWA 2CDPA 3WF3A 5EJZB 2XONA 3VD3A 2RV9A 2X05A 1K3IA 1JZ6A 3I2FA 4XUPA 1W9TA 2V4VA 4QX2A 4A45A 2WAAA 1PMJX 4XUNA 5EJ1B 3E1F1 2Y6HA 4M4RA 2VZTA 4QDRA 5DPNA 1W9SA 5JXGA 3ABZA 4OZOA 2ZEXA 2VMFA 3U37A 2QQKA 1GOGA 2Y6GA 2W1QA 1LNSA 4JKKA 4UOJA 4CUCA 3LPGA 2E33A 3PUHA 2WN3A 1OF3A 3CZUA 1XNTA 3IDAA 5G04L 3LE0A 4JKMA 2ID4A 3T2OA 4OUEA 5F7UA 3MUY1 2W94A 3BN6A 2HYXA 2YC2A 3NJXA 1JYXA 4XVHA 3A7QA 4KWUA 2VZ3A 2DCKA 5B4NA 3I3EA 3MV01 3THDA 1CZSA 1W8OA 5LA1A 3WNOA 2XQXA 5EIYB 4DEVA 4MO3M 3NNGA 4QB6A 1UZ0A 3HJRA 4DUVA 3SKVA 1GNYA 2VCAA 4M4PA 5B4XA 1UYXA 4BXSV 1UX7A 3THCA 1W8NA 4QX3A 2YFUA 1W99A 4DXTA 2W91A 4Z2AA 1CX1A 2J1VA 5HPOA 3K4ZA 2QQMA 4CU6A 3W5NA 1NX9A 2BGOA 2EIEA 2W1SA 2QQOA 2W47A 2WO3A 2WDBA 3SKJE 2VM9A 2E31A 3LEKA 4ET7A 5CYYA 1JZ2A 3T09A 4LHSA 3WNPA 2EICA 4P02B 3DYPA 1UMHA 1UY2A 2ZEWA 3WQBA 4BDVB 5J1XA 3CIHA 4BK4A 1XC6A 4UAPA 3GXUA 1PX4A 3I2HA 2OKXA 1KGYA 2L9LA 3VD5A 4GZ9A 2J1RA 4XUOA 2VL4A 3ACFA 4DXSA 5JUVA 4A41A 1L7QA 2VJXA 2EIBA 4TXWA 2YFZA 2QQJA 1W0NA 1WCQA 4DXRA 1P8JA 1O8PA 4AAXA 4LPLA 1NKGA 3T08A 3WF0A 5IFTA 4QB2A 2WO2A 3HNYM 3K46A 3CKHA 1DLCA 1IQDC 2W5FA 1JZ5A 1JHJA 2C26A 2VCBA 5LA2A 2W87A 4W50A 5CZKA 2DCJA 2V72A 1US3A 3HOBA 4CUBA 1UY0A 2LW8A 2JDAA 3I2JA 1JYVA 1JU4A 2WO1A 4P08A 4D8MA 2B9VA 3SEPA 4QX1A 1H6YA 1UXXX 2RVAA 2ORXA 2VCCA 3WF2A 4A6OA 2KD7A 4ZZ8A 3T2QA 2ZEZA 3VD7A 4AG4A 4OMCA 3FHAA 2VMDA 1KEXA 5IYYA 2C4XA 3VD4A 3I2GA 1GU3A 1I5PA 2J22A 1O59A 4LKSA 4MADA 2HLEA 4QDQA 4FI9A 1NAEA 2J1EA 2RJ2A 1BHGA 2WUHA 3T0BA 1UY1A 1WKYA 4MGSA 2WZ8A 1GOFA 3IAPA 2VZQA 2XHNA 3T0AA 1F4AA 3BGAA 2BGPA 2VOTA 4XUTA 1XNAA 1OD3A 2C9KA 1MPXA 4QX0A 2PQSA 5JXIA 3OGVA 1O8SA 2YG0A 2Y6LA 3CQOA 3C7GA 1UYZA 3OB8A 3LPFA 1DP0A 1GQPA 4XZUG 3VDAA 2WAOA 3NQHA 2VZVA 1UWWA 3P6BA 2J7MA 2WQ8A 2Y8KA 1HN1A 1RYYA 3GDBA 3OBAA 4CU8A 3ZM8A 4QB1A 1TG7A 4A42A 3CMGA 2YC4A 3HNMA 2BZDA 2VZOA 4CVUA 1J83A 3EB7A 4A44A 4IUGA 4KI5M 3VD9A 2B4KA 1JI6A 3D3AA 5C7GA 4E8CA 3NJVA 3DYOA 2VQTA 3OGRA 1UXZA 2BERA 2QQIA 3HNBM 2W9XA 1L7RA 2E26A 3EYPA 4ZZ5A 3GM8A 3WF1A 1JZ7A 5JXJA 2WYSA 1R64A 4W8JA 1T2XA 3MBWA 1JYNA 2WN2A 2VZSA 2J1TA 3A22A 3ACHA 3PUIA 4PQQA 1CIYA 3FN9A 1SDDB 2VZUA 3LQCA 2X09A 3T0DA 5JMOA 1UY4A 3K4AA 2W1UA 3WEZA 4DUXA 2V5DA 1DYOA 2VZRA 1JZ8A 2LS6A 4P00B 4DEQA 2J1SA 3OGSA 1K12A 4PT6A 4QDSA 4OMDA 2VTFA 5DQ0A 2W3JA 4LQRA 2CDOA 5IHRA 3C7EA 2JD9A 3DECA
chains in the Genus database with same CATH superfamily
1FXZA 1ASJ1 3VBHB 1SCRA 5FIXA 4BJ0A 3E6BA 3ZPOA 2QQVA 1COV3 2GDFA 4PJYA 4YG6A 2WNEA 1VE0A 4YZ4A 1UF2C 1J58A 5JIUA 1N1TA 3K4DA 3KF5A 4JGYC 3RRDA 1JW6A 4IEXA 3BODA 4ZY9A 4XACA 2LTNA 4HVRA 4GXLA 3VBOB 4CA9A 5I0RA 1NA1B 4RR3A 2HH9A 1RXFA 4FXGB 1US2A 5JPMB 1Q43A 1OH4A 2D3RA 1ZZ9A 5FK8A 5A1AA 3LA7A 2VGDA 3U10A 3ZFEC 4XJUA 1TVGA 5APAA 4GWIA 1W6NB 4AFDA 3KZ4C 3AVSA 2VMCA 3SH3A 4A6SA 4CEYC 4C1WA 1NUKA 1D2SA 4JAAA 3PIJA 2DUQA 3WG4A 4TZDA 2XJUA 2VXJA 4NPLA 3U0ZA 4QWNA 2VTXA 3E5UA 3IBMA 3PJQA 2WL1A 4UXAA 1EUTA 1OFNA 1PO21 1ACCA 3BI3A 2F17A 3EQEA 1Z7S2 3LEMA 4YFZA 1W2NA 3NNMA 1DGRN 1AJOA 1WCUA 4K7JA 4PHZA 1XOYA 2R063 4QT6A 5CEHA 4QKBA 2C9AA 5F6KA 1LB2A 2DDUA 4ZU5A 3EBRA 1YHFA 1EV13 3MW4A 4EWEA 1H6XA 4GH4B 2W46A 3CDZB 2K9ZA 2Z4FA 4A7ZA 2DU0A 4NAOA 1MQTB 2DFCA 3GGLA 4Q0VA 4XJWA 5FYYA 5LBEA 1CAWB 2CY6A 2DVAA 2HWD1 3ZX7A 3F2ZA 4YW6A 5C70A 4HANA 4CDQA 1MS4A 1GZ9A 1K45A 3KV5A 1GOHA 4IV1A 1YO8A 1ENXA 4Q4W3 2VQUA 2ZZJA 2RMU2 3V0BB 2EXHA 3MEPA 4HG6B 5DDJ1 3WX5A 4WM7A 1JODA 1QF3A 4GALA 1R083 4XETA 2R041 1KFXL 4ARXA 4IV3C 5L73A 2X8KA 1KFUL 1FOD1 4IEQA 3TNQA 1T6BX 1HLCA 3OJBA 5I0SA 5IFPA 3R4SA 5D1IA 3PNAA 4QXKA 4CU7A 5K8SA 5FZHA 2A6VA 4Q1PA 1WUVA 3POYA 5M0TA 3AP6A 2B9UA 5J98B 2X10A 1O5UA 1W3XA 3JXSA 3MV11 2WZPP 3T2PA 3WQ0A 1S0JA 1VBE2 1VAKA 3OYWB 1AR83 1R1A2 1W03A 5A7SA 2W1WA 3K75B 4IXLA 5IWFA 1ZRRA 2DCYA 3FWEA 1D4VB 1QJFA 4OYUA 2WFF3 4E9KA 3AJYA 5F2WA 3LEGA 5AVPA 2IXIA 1YQCA 1LOFA 5F8PA 5CISA 4V2VA 2TNFA 2LALA 2VOXA 4CCEA 3R05A 4HN1A 3HBKA 3I2IA 4DMIA 5BYNA 3WNMA 3J7LA 1LHVA 5L9VA 4RD7A 2J1AA 4P9LA 1W0OA 1O4TA 4I3PA 4NJ4A 5CKQA 4B29A 1N3QA 3IKWA 5FYMA 1RVF3 1GMMA 1JBCA 1K5JA 3P1IA 3LEIA 1GZWB 1SEFA 2Y6FA 3AMMA 1UU5A 4H7LA 3AYCA 5LBFA 3WV6A 2LROA 1AL23 4ES9A 3MI8A 4KBZA 5JXHA 4FQZA 2ZGOA 3HEIA 4UW3A 4JKLA 1G9CA 4GJZA 3ENRA 2A3WA 3O1VA 4H3WA 2JXAA 2VMIA 4FFIA 2YXSA 4LA3A 4YW7A 4RHV2 2AZ5A 4GWNA 4FTBA 5K4LA 2WNVC 4CP9A 3OG2A 1GICA 2R073 3B5LB 3JU9A 5FZBA 1PO11 1ENSA 3KWVA 4IERA 1KRIA 1UMIA 2TBVA 2Q8OA 1BMV2 3ECQA 1DQ5A 5A3NA 4LT5A 2D6KA 1J59A 3B69A 3O0WA 4MGQA 4C91A 2WWUA 4GWJA 3SEEA 5KHKA 4LORA 1TME3 4CUAA 1DF0A 2FHRA 4Q1RA 2ZAHA 1D4M2 4MGIE 2CDPA 3GZEA 4LJHA 5A7OA 3SHRA 3WF3A 2XONA 3AZYA 4AFBA 1SZBA 2RV9A 3NV4A 1FMD3 2X05A 3N35A 3IDCB 2XHKA 5L9RA 2BJSA 5A7QA 2RJKA 4OHYA 1AYN2 1RUH2 2ADEA 1H1IA 3PU8A 4XUPA 1W9TA 4FO9A 3ORJA 2ZGKA 1AR72 1HIXA 3K3OA 5EJ1B 3SCGA 2I07B 1FV3A 3ZSKA 5C3QA 2YBKA 1JS9A 4QDRA 4L2NA 4JTNA 1LODA 4OZOA 4DPNA 4MGTA 1QJY1 2DVFA 2C24A 4PLNA 4YVSC 3PVEA 2GMPA 1RHI2 3ZN5A 3N9NA 2W1QA 1G9AA 2IXJA 4RQPA 5ACA2 1GSLA 3KSCA 4HOOA 1ODNA 2QQPA 3BTZA 2HEWF 3IPVA 2JDMA 5FMBA 3LPGA 2BFUS 1HXS3 3VKOA 2WN3A 1SMVA 1OI6A 1SDWA 2HWE3 2VNRA 4EE2A 2LM3A 2BYVE 1SCSA 3IDAA 3NAPA 3TRSB 5I93A 1NG0A 5CG9A 4JKMA 3LDKA 2B39A 3RZGA 4NO4A 2CU5A 1W6PA 3MUY1 3M3EA 1VJ2A 5FYTA 5J48A 1EP0A 5KR7A 1W6MA 2QJVA 2EIGA 5A1LA 2XJVA 4XTPA 2D98A 2AH2A 3AKQA 3NJXA 4FQ4A 4YG0A 3LKJA 3CU7A 1CGPA 4KWUA 3ELNA 3BCWA 4I09A 3VLBB 4E4ZA 4CDXB 5B4NA 5FQ0A 1WCKA 1C8M3 3ILRA 4XABA 1V0AA 3IN9A 4NIAA 1ZBA2 1OOPA 3POSA 1W8OA 4UW5A 1ND3C 2XQXA 3Q9OA 3J4UH 4QB6A 2CWMA 3GHNA 2O8OA 1Q8PA 5C8CA 3SKVA 1PHMA 4M4PA 2XDVA 3AMHA 3PMSA 5B4XA 4JDOA 4BXSV 4YVWC 4QD2A 3POJA 4MG2A 2DBNA 4QU2A 4YARA 4N53B 3WHUA 1E5SA 5E1RA 4Z07A 4CP0A 4ZKTB 1FX5A 5HPOA 4FPCA 2WZR1 1UZWA 1EV11 1RUE2 1O3QA 5L19A 2BGOA 4XEZA 1WW6A 2VW1A 4JGYA 4RS5C 4A7KA 2W1SA 4LBOA 4A2UA 1NXD1 3OBRA 4YGEA 1DZRA 5FZ7A 2QCSB 3LEKA 3UKVA 1HB3A 2BV4A 1UMZA 3A4UA 3CJIC 2HWF2 3RG0A 1BBT1 3PUQA 3U07A 3USUB 1YNAA 4I3GA 3ZFEA 5FO8B 1VRH2 4P02B 4MZUA 1E5IA 2DVGA 3AXEA 3HIFA 4FPGA 4QX8A 3VGIA 3POFA 4YSFA 1OUXA 3VKFC 2YBPA 3QOPA 3WQBA 2GALA 1CAXA 1LOGA 3MPPG 4CEYA 5FZ0A 4BDVB 1NCRB 3OD4A 4AVCA 3M1HA 1SFPA 2ZGRA 1R081 1ASJ2 1PGSA 5FYCA 4UAPA 1YEWA 3E6DA 1PX4A 2P17A 1UYPA 3BYWA 1IZ3A 5FPAA 5EZWA 4BOWA 1HKDA 2HWC3 3I3QA 2W39A 1JYCA 4LHNA 3KVAA 5DZFA 5C8WA 4DRRA 4EN0A 3AFGA 1AVBA 2YPDA 2BW8A 4JV4A 4LO7A 4XAAA 1XYPA 2JEMA 4NIIA 5FYBA 3UL2A 1SLBA 1W6QB 4QGMA 2ZMNA 4YLZA 2EIBA 1ZVFA 4PDWB 3M4FA 2YFZA 2GNDA 4LO8A 4QQOA 4TXWA 3USSA 1AR81 2ZAAA 2ERFA 4XPVA 1O3SA 3ZSJA 3HR9A 1DYPA 2QFEA 1QQP3 2GC3A 2JDYA 1XE0A 1LR5A 3T08A 4EWAA 5FPUA 4AI2A 2NM1A 1CAUA 5LRRA 3LOBA 3GCXA 2VBPA 5JOXA 2ILMA 3ZO0B 1D0HA 3MICA 2ZCWA 1X9PA 1XJAA 3IZOA 3KT1A 1RUOA 1PO22 5DUXA 1XXNA 3WDVA 2X53S 4LOSA 3ZR6A 1WA6X 3ETQA 4ISQA 5FZMA 3WP3A 4HETA 1VBB1 4M00A 4AE2A 4CCMA 4NN0A 2VU9A 2W87A 4META 4YZ5A 3NJZA 1BJQA 1FNYA 5FZKA 2DCJA 2V72A 1US3A 1AL21 4BH9A 2RS11 4OI0A 4BQ2A 3K3NA 3M70A 2LW8A 2JDAA 4Q4X2 5FZ6A 2VVFA 2FDKA 2WO1A 5GLTA 4D7SA 5LK5A 3TNPB 3UKTA 1Y4WA 2GU9A 1DG6A 1KJRA 2YHJA 5FP8A 3OY8A 2WNUB 3WUDA 3ZDVA 2DTWA 2RVAA 3WF2A 5FUNA 4BQWA 2KD7A 1V9U1 3K48A 5ISLA 2R071 4KWJA 4AQ2A 4C1XA 3NV2A 2AEYA 3APBA 1KEXA 1PNGA 5DDJ2 5IYYA 3I54A 2VTXJ 2VMGA 5I8SA 3AMNA 4UF0A 3KCXA 2R042 2CGPA 4MADA 1GR3A 1OQDA 1FOD2 4FBFA 4ZXKA 4D69A 2RJ2A 1AX0A 1BHGA 1LENA 1QJU3 2WUHA 3Q8FA 1NE4A 1W8HA 5FO7B 1WZXA 1VB2A 1T6GC 1POV3 1ULCA 3WP6A 1Q8SA 5FPZA 3AVRA 1ULDA 5J7MA 1XB9A 4XTMA 4GULA 2PAMA 3IAPA 2VZQA 3ZYHA 2AENA 2VOVA 5BV6A 5K0UC 1FI2A 2BVBA 5DAQA 1OD3A 2AC1A 1MPXA 4GD4A 2PQSA 1VBD3 3LDBA 3JB4C 1YXWA 3OGGA 5IVJA 4Q26A 1RJ8A 3ES4A 3ZVXA 5FPBA 3RYKA 5JOZA 2Y6LA 4AEDB 3TBDA 1URXA 2LRPA 4CE8A 2WNVA 2FZ1A 4J1XA 4FP2A 1F15A 4YG3A 4WVMA 1K5MC 2OZJA 3QLQA 3NQHA 4X8NA 4PI2A 4P9IA 4QPGC 5BNOC 2IC1A 1YQ6A 2QQUA 2RDSA 2JICA 1RUI3 3AYEA 4Y5TA 2JD4A 3P6BA 3WOGA 3C2UA 1V6NA 1HXS1 1PIV3 2XJQA 2A75A 1BXHA 2Y8KA 1IS4A 5EV7A 3GDBA 2HWE1 1OKOA 5GM0A 1WLTA 4NAMA 4CCNA 1OVSA 2A6ZA 3PLQA 3ZM8A 1VBC3 5KC5A 4CDWB 5FOJB 1H4HA 2ZHMA 4M01A 5FP4A 5LK7B 1OFSA 3B94A 4Q8LA 4HL0A 2YC4A 5D8AC 2CV6A 4LO6B 3WDUA 3X29B 4AHZA 4C0BA 3DGTA 1QJX1 1C57A 3FMGA 4OI2A 4ONUA 3RQ0A 3T4HB 4BYYA 2DUPA 3VD9A 3U75A 4IDZA 2D7FA 3DV8A 2RS53 5LRSA 1S0FA 5C7GA 1R093 1DGWA 1H9PA 3ZFFC 5BNNC 5F6LB 5FAXA 1QXRA 2Q0AA 3POBA 4Y20A 3NJVA 5KHGA 4U2AA 1VR3A 3WHTA 3DYOA 5A7NA 4E27A 3DCQA 4KH9A 2PMWB 1XU2A 1QGLA 2JDNA 3RVHA 4AL9A 1EPWA 1RITA 3EYPA 1H1AA 3J9SA 1JZ7A 1JUIA 1JN2P 1I1EA 4Q0QA 5IVBA 1LAJA 5A32A 1UKGA 3MBWA 4N7IA 1JYNA 1RL3A 2BRTA 4KGQA 2VZSA 1OA2A 5FO9B 4OLLA 4Y26A 3A22A 1E57A 1RUJ1 4LK7A 2JENA 3DPRC 5C3SA 1F8VA 4FPYA 2ZHKA 2FQPA 2R30A 3GNEA 2VULA 3GBGA 1SDDB 4K1YA 4F7ZA 1VMHA 3PMEA 4LULA 1RC6A 2X09A 1YJLA 3T0DA 3O1MA 1S1AA 3IDEA 3MIFA 3FFQA 1D0GA 1SLAA 1QJY2 1R1A1 1UY4A 1ND2B 3IM0A 4HK9A 2XH6A 1W9FA 4IV1C 4N90A 5A33A 1C28A 2V5DA 1ZBE3 1I6XA 3KMHA 3RZKA 1PM4A 4P00B 5LY1A 3GCWA 4M0NA 3P3NA 4WM7C 3VHPA 1XYOA 4RGAA 3I2DA 1K12A 4MYEA 3SISA 1E5HA 2O8QA 1J1TA 3I4IA 4PT6A 2D93A 2JECA 1OH3A 2Q1FA 1ND3A 2XJSA 1ZREA 2XJTA 2D6MA 1F35A 2ZGNA 2VNGA 5SV8A 2Z79A 4UFIA 3U78A 2B8MA 1COV2 5EJ3A 3VB9A 2YV8A 2XVGA 4P9GA 3AZZA 3LDRA 4YVWA 5F3GA 1W8FA 2XXZA 4DS0A 5HV0A 4AI1A 1RUC3 3O0XA 3VBFC 1SBFA 3I3BA 1HW5A 2AUYA 2DTYA 3VBUB 4N9HA 2XBO3 4OQ9A 3VBRB 4BQYA 1PMIA 2O14A 4HPKA 1CD3G 1CONA 4GMP0 1K5MB 3HT1A 4P5YA 5LA9A 2E7TA 4I02A 2O1QA 1LOFC 1YI9A 1JH5A 4JRAA 4RS5A 5FLIA 5JI9A 1VMJA 2YGLA 3GALA 4TLGA 1KS5A 2RDRA 1OT5A 2WLPA 1QQP1 4OUMA 4P14A 3POWA 5T3NA 2J1UA 1PZ7A 2RR13 3WNLA 3CJIA 2HEYF 2W92A 4COWA 4CYDA 4DUWA 1W8TA 2GNBA 2WO7A 3T1LA 5EPAA 2EALA 5IUQA 4F3JA 2HWB3 3ALQA 4RN5A 4RR3B 4BA6A 4ZONA 5A3LA 1HJGA 2IVJA 2AREA 3VZOA 1HDKA 4XCAA 4QX7A 4D7TA 4CEWC 3B93A 3RZHA 3UJQA 2FZ2A 2WABA 4NRMA 2VZPA 3OGJA 3BKZA 2WZR2 4WVZA 5FXWA 1EV12 5A7PA 4MXWA 2F4LA 3AKSA 1RUH1 3CHXA 1CX4A 4XUQA 5FXZA 2DCZA 2WLQA 4JX0A 5EYYA 4EN9B 1YFYA 2ZBJA 2XJRA 3N7LA 4J25A 4AWDA 3O1SA 1JOPA 1W9YA 3TOJA 4Y22A 5EQUA 4UFHA 1BBT2 4KU7A 3NMBA 4Q4W2 4N9IA 4H7MA 1TEIA 4EZHA 1U12A 5HXMA 3TB0A 1OLMA 2DVDA 2ZGQA 5FJHA 2BVVA 1ZZ6A 3O1UA 2VUJA 5DUWA 3RNSA 2V73A 1R082 2SBAA 2D40A 1H9WA 4IL7A 3VKNA 2ZTNA 1Y9QA 3BPSA 2E32A 3I3DA 3LIHA 3PDQA 5F3CA 3CL1A 5F5IA 4BQ1A 4IE7A 4HSLA 1AR63 2D6NA 4QKDA 4YRDA 4AFCA 5IJRA 4HSJA 1POV1 4CDQB 5IVVA 4RA0A 4A3ZA 1MEC3 2WR9A 1RUG3 3S0MA 4L97A 2E7AA 3DEMA 3J7HA 1QXJA 3R0RA 5I0DA 1O3TA 1O6UA 5F3EA 1G6NA 2P1BA 1AR82 1VBD1 1XSQA 4LKFA 3GBWA 3TEZA 5C5UA 2Q1ZB 1Y3TA 4DFSA 5CAZA 4NHLA 3PVOA 5DMYA 3R4DB 4XMIA 3ZXAC 4DB5A 3IAQA 2WFF2 4RYDA 3T30A 3ETPA 4BQ5A 2ZEYA 5LCWL 4LBMA 5FJKA 4CU9A 4FSJA 1DQ4A 4XQ4A 2IZWA 2JE8A 1LHWA 1W3VA 5C4WC 3WP5A 2WT2A 1VBB2 2Y26A 1RUI1 3ZYBA 1DYKA 1RVF2 3FFZA 3A21A 3HPNA 4FAHA 3SMHA 4Q4V3 3W20A 5GZDA 4Y5Z0 1QDOA 4QPWA 1AL22 2ET7A 2RS12 3FL7A 5LASA 1WMDA 4TYSA 4HZFA 3WF4A 1G9FA 2GMMA 3VDBA 1XYNA 2YGMA 2VUAA 1SFYA 2W2IA 4FOVA 4CSWA 1RUE1 4P5HA 5K0UA 1X8MA 1W2TA 1JU3A 1V9U2 1MZFA 2ZKLA 3C7OA 3I97A 5DAWA 1JZ4A 3NNLA 5G05L 4HT1T 2R072 2GP3A 1ZRDA 2RS51 1SLCA 1OOPC 5GJ6A 4QGLA 1H8TA 4LE3A 4Q5OA 5FMOS 2JKXA 3ON7A 4SBVA 4Q8KA 1OF4A 2XWBB 3MIHA 4LO5B 2HWF1 3I2KA 5EYXA 3M7AA 1CAVA 1VRH1 4IE0A 2BBAA 2IVIB 1ZZ7A 1W28A 4PIYA 1V00A 1IKQA 2KM2A 1S0DA 1AX1A 1PK6C 4DQAA 3C7HA 5FUIA 4QQHA 2OXBA 4QPGA 3S5QA 3C3VA 4WVVA 4CP9B 3WNNA 1C1FA 1FMD2 2BFUL 2XUMA 2YZ4A 5F39A 4AR2A 2BWCA 4EN8B 1LOCA 1OBNA 2I2SA 2RS33 3L9JT 3W59A 5T5OA 1JZ6A 5FZ3A 3OD0A 3NSTA 3VUOA 5ANNA 3N36A 1C8NA 1CVNA 3CNAA 5D8AA 2E51A 2F4PA 1POQA 1U5ZA 4MV2A 1H2MA 5EP9A 1QKQA 2QTWB 3MIBA 3E1F1 3QH7A 4XHXA 4MGKE 2UY8A 4GJYA 3RJ2X 4DY3A 5CFDC 4JDMA 3ZXKA 1W9SA 2A6XA 3ABZA 1ZYBA 1ZRIA 3ZFFA 2R1BA 2VMFA 4JGZC 5BNNA 4YWAA 4FFFA 5F37A 1GOGA 1VB4A 4FT8A 3M3OA 3RYPA 4BXFA 3ZXFA 3AK0A 1ZX5A 3AZWA 4JKKA 4F8AA 1OLME 1HXS2 4UOJA 1U5IA 4D6QA 2HWE2 4EROA 3JBG1 2E33A 1RJ7A 3OSDA 3PUHA 3S6PA 1IG0A 1AR93 1OQ1A 5CA6A 1AYM3 2JDZA 1XNTA 3ZFGC 3RPQA 3NKTA 3VHRA 1EYBA 1QJX2 3RDIA 3LE0A 4CTEA 3V0AA 3QH6A 3DPRA 4RQPB 1PNFA 4Q4X1 3RWNA 4GB33 5CKNA 4GIQA 3IPVB 4UT5A 2W52A 3ZXEA 2W94A 3DL3A 3LA3A 1OURA 4CP2A 1S0BA 1NE6A 1NCQA 4H55A 2YC2A 3WG2A 1JYXA 5LEJA 1HRI3 2GMEA 3NAPB 1UU6A 4IESA 1C8M2 2VZ3A 2WA4A 4DXZA 2DCKA 2ZGSA 1H2LA 1WLDA 1FYUA 1OKQA 1WLCA 2DUOA 2RR11 2VNVA 1W6PB 3I3EA 3JD71 3NVCA 3MV01 4YZ2A 5AFEA 1QJZA 1W6MB 3OCPA 1WLWA 5EIYB 4DEVA 3ZMNA 5L7OC 4ISRA 3NNGA 2BBVA 4YM0A 1HX6A 5GLVA 1RUJ2 5IT6A 5T52A 4DUVA 2VCAA 3AM2A 4AFMA 4HVQA 1UYXA 3LFIA 3SH5A 4IEPA 1NQDA 2X5IC 4R9CA 4OVEA 5FQ0B 1WBLA 2I74A 3I59A 5FLJA 3THPA 1JUHA 4AQ6A 4E4SA 2J1VA 2P37A 3O1TA 3VBFA 3W5NA 3ILFA 3NV3A 5C8CB 4O9GA 4COUA 2QQOA 4MGYE 4OHWA 3AXDA 4B1LA 4ET7A 1C4RA 2E31A 2P3IA 5CYYA 1JZ2A 1OUSA 3E5XA 1CIWA 1UNBA 2RM23 3T09A 2DBIA 3DKQA 1RUD3 1JXNA 1MS8A 1UW8A 3H3LA 4LHLA 5FRAA 4WZFA 3ATGA 4S2FA 2RDQA 1UIJA 5CU1A 1UY2A 5FZGA 2Z42A 4JGYB 4NWWA 4AOCA 1A78A 5IVCA 3HQUA 1X7NA 2HWC2 3CIHA 4BK4A 1CN1A 1AR61 1U5YA 3J7MA 3VBSA 1STMA 3GXUA 4IEZA 3ZFEB 1UO9A 4CEWA 1KGYA 1MEC1 2L9LA 1RUG1 4R9AA 4MX3A 1MZ6A 4XUOA 2VL4A 3ACFA 2CGOA 3S57A 3ZR5A 1BVVA 4CEYB 2XL7A 4IEOA 2WA3A 1BYHA 1L7QA 1GWMA 2JG8C 1YQ5A 3DUIA 4YM1A 3RI9A 3MW2A 1QQP2 1WCQA 4XJZA 4DO0A 2VMHA 1P8JA 4UFMA 3MGUA 4W6XA 1AF9A 1O8PA 2HEVF 4AAXA 3BTAA 4LBQA 2NQYA 3TYJA 5BNQA 1WCDJ 5IFTA 3V65A 4YGBA 4M0HA 3MFCA 1PGW1 5FY8A 3HNYM 2VPVA 2OX0A 3K46A 4LO4B 3P5BA 1JYIA 1DLCA 4AXOA 3E97A 1IQDC 2IWGB 2WWSA 3T2TA 3SQOA 5JSOA 4Q4V1 3W21A 2AR6A 2A70A 2CSGA 3RSJA 2O0OA 4CPBA 1LEMA 2HBUA 2I45A 2RHPA 1L3JA 2VG9A 1QU0A 4FOYA 1TQ5A 4COYA 1BLZA 4MHUA 2JKBA 4RL7A 3WQ7A 2B9VA 1AHSA 4XFGA 3SITA 2Q1MA 1UXXX 4CXYA 1W0PA 1AXKA 2VOWA 2VCCA 5FXXA 1QHDA 4A6OA 4NHKA 4CXXA 4UW4A 2K0GA 4IV3B 3T2QA 3V56A 5IK5A 1WWYA 2WIIB 2GH2A 1OSGA 4KU8A 4OMCA 5D2AA 5T5LA 3AFKA 4ASLA 1EAH3 3ZYFA 3UGFA 3WW3A 2KR2A 2A1XA 1FNZA 1O59A 2DURA 1GKBA 3OY8B 4N43C 5C4WA 1RUNA 2P5BA 3H3UA 3VHNA 4BLIA 4CP1A 2WC2A 4YM3A 1COV1 3B9CA 2WYFA 3HMYA 1UY1A 3T0BA 2UYAA 4ITCA 1J3QA 2CAUA 2RS31 2WZ8A 3AZVA 1GOFA 1VBD2 5F5CA 1ZZ8A 2NLRA 2XHNA 4ZS3A 2PLV3 4Y1UA 3BOPA 4UF0B 3T0AA 2BGPA 5FWJA 4XUTA 2VNOA 1BK0A 1N1VA 4QX0A 5TSWA 3VN4A 3OGVA 2OPWA 3OUIA 4COZA 4CPBD 3M3QA 2YG0A 4E4DX 1GANA 1HV1A 1QJEA 3TN92 2XLFA 1UCXA 1GFF2 1UYZA 2B46X 5E88A 3V0BA 2SLIA 3OB8A 3E6CC 5A3PA 2VY0A 3SXWA 4AI0A 1RUI2 3HWJA 1RMU3 3TN93 3MIDA 2VZVA 1MVEA 1S0CA 1BQPA 2BU9A 4XJAA 1IPKA 1UWWA 1PK6A 3FUQA 3VDDC 1UL9A 5C9AC 5A3MA 4H2AA 2WQ8A 4BHPA 1VBC2 4PBPA 4B4RA 1GP4A 2R061 2WNVB 3O7OA 1S0IA 3HBZA 2FCUA 3MLLA 3N7JA 4WVMB 2RMU3 2FCVA 4NPRA 5A6XA 1TG7A 2JX9A 3CMGA 4NHYA 1SLTA 1OA3A 1RINA 2VZOA 4J1WA 1J83A 1LOEA 2A73B 2RS52 3WINE 1DCSA 1R092 1RB8G 1OQEA 1SLLA 2NMOA 2ZX0A 2Q5TA 4HK8A 2B4KA 3RMYA 1HRI1 1DGWX 3D3AA 1GBGA 2D3SA 4IEUA 4L11A 4Y5SA 4Q4W1 5E16A 2CL2A 2R16A 4X6QB 1LULA 5H9PA 2ARAA 5CFDA 3ZIXA 2XG3A 1VALA 2VQTA 3I7DA 4JGZA 5FBZA 3WY6A 2NZ9A 2BERA 4OUSA 4QHBA 2ADDA 2GSYA 2QQIA 2V4AA 4QPIC 2IFWA 2C1FA 3O14A 1VBE3 4ZZ5A 4FPJA 4W65A 3ZKYA 3RZZA 5FZEA 2WYSA 2CTVA 1VLNA 4FP3A 2QE3A 2QZ2A 4Y20B 4W6YA 1DHKB 2ES3A 2WN2A 1H4GA 4ZU7A 2GC2A 2GNTA 1GYKA 3ACHA 3PUIA 4PLOA 4PQQA 4YVSB 5GZEA 1CIYA 4AVSA 4Q4Y3 4WV8A 3ZFGA 4XQDA 1S0GA 3LQCA 1LGBA 3O1PA 4AAPA 5J36A 5IATA 2D6OX 3LAGA 4CCCA 5JMOA 5A32B 4AHWA 3ZYIB 2WFF1 4LLOA 3WEZA 1XNCA 2W68A 4KG8A 3N9LA 5FKCA 4DRVA 1O7FA 2LS6A 2H0VA 2NPIA 2RM21 1ZZBA 3INAA 1RUD1 4XAEA 2WS93 1CPMA 1UPIA 1YRZA 3GJBA 3JBG2 1SBEA 3RWKX 1YCIA 4NWVA 4JQRA 1RVF1 4OMDA 4LNVA 4QPYA 4RHV3 5CB7A 2E7QA 1H1MA 2JB8A 5A33B 3P3PA 4O7XA 5L7OA 2CDOA 2DVBA 2PQQA 3KF3A 5CKMA 4YYOA 2WQZC 3WUCA 4IEVA 2HJIA 5A3OA 4FVVA 4A3XA 2NP0A 1AUYA 4XF0A 5JMCA 2X5IA 2XBO2 3C7FA 4B4QA 2A71A 3IMNA 4AEMA 1KD7A 3LSDA 4QQLA 4AEKA 4DNYA 1UU4A 1N1SA 1ND3B 3FZ3A 2XVLA 4C0HA 4A4AA 1TNFA 1XRUA 2VVEA 1F5FA 5FZ4A 3OUJA 5A7WA 2ET1A 3UV9A 5CNAA 3ZYRA 2FDFA 4HMZA 3N9PA 1D4M3 2FMYA 5SV5A 1ZNPA 2BDRA 4NRQA 1NZIA 2RR12 5H9RA 3SCFA 4QXCA 3WW4A 4CDUC 5CADA 2QBXA 3JD72 4YVWB 1SPPA 2HBTA 2QDNA 3IIIA 4IETA 1AYN3 1CZVA 1FPN3 1HN0A 3D6EA 4QAWA 3TWIA 4AGRA 2WT0A 2HWB2 2PHFA 5FY9A 1DDLA 1QNYA 1LOBA 1K42A 1V6MA 1TME1 1QY4A 4S2DA 4D6RA 4HPKB 3NRUA 1IHMA 2JDKA 2XOMA 1ALYA 2OZ6A 4KNCA 4RS5B 1UN1A 1FMD1 3OTFA 4UFLA 3HT2A 5L36A 3H8UA 2QZ3A 3GF6A 3KT7A 3I2OA 3S5AA 1QOOA 3EJKA 2ZABA 5C6CA 1VP6A 3CJIB 4AVAA 4BMEA 1LHOA 2FMDA 4IE6A 4BB3A 5BUVA 3H0OA 1H8TC 4E8DA 2GZWA 1GQHA 2R7EB 4QMAA 3IB3A 4XILA 2Z5WA 3VZKA 2LUWA 4SLIA 1PVC3 3ZYJB 4W4ZA 4I0WB 4O65A 4L8QA 3WNKA 4LA2A 2GC1A 2JG8A 1UOFA 2PAKA 4WM8C 3UNPA 5IVYA 1AZDA 4ARYA 2A6WA 5FY7A 3N9QA 5CBLA 1UY3A 4MXWB 3FLRA 5ABJC 3OEAA 1EAH1 4JHZA 2PHRA 1F4HA 2PHTA 2RJLA 4Y24A 1RUF3 3KV6A 5LY2A 4AW7A 1XNDA 4PBOA 4Y22B 1AR62 2VVDA 1QEXA 5A6ZA 2EIDA 3KHBA 4XURA 3R6SA 1CZTA 3EO6A 1MEC2 1RUG2 1C5IA 1YIPA 4L0PA 4E2SA 3WD5A 3I8TA 3T1MA 5FCCA 5FZ1A 1DLLA 3HQRA 4FTSA 3AP9A 3ACIA 2PLV1 3MYXA 1FV2A 1PGL1 2D6LX 5FZDA 1J84A 2JG9C 5FZOA 2ORZA 3GJAA 4R4ZA 5F5AA 1V6OA 2YB7A 3A23A 2R0FA 1C8M1 3K2OA 4LKEA 5JOYA 1REDA 5GALA 4ZHNA 3BIEA 1LGCA 1JYTA 1PGW2 5FMOL 5BPXA 3ZOIA 1WCSA 1YI7A 3C8XA 1NCRA 3J8F3 4TTGA 2WQ4A 1RMU1 3TN91 3UGHA 4CCLA 4MOAA 4Q4V2 3OPZA 1WW5A 4JC1A 2UYBA 5IAVA 1MS5A 4Y4RA 5FFOC 2XKOA 1W9WA 4GMP3 4JDNA 3W58A 4AZZA 4N43A 3FLPA 4CXWA 2B7YA 1QIQA 2R1DA 1D2QA 4UI9L 5F2SA 3OEBA 4UFKA 3H1WA 4FPOB 3UYJA 3KGLA 3FC0A 1NCQC 1BVP1 1BZWA 2RG4A 5DAPA 3OF1A 1VAVA 2PHDA 1SQ4A 3POIA 4Y1VA 5BNPC 4EJRA 2C5DA 1BEV3 2VMEA 3ASIA 3OBZA 3AP5A 5FK7A 5FPXA 5I0UA 2WBKA 1SLIA 2GN7A 2VZ1A 1ASJ3 2VUCA 2VW2A 1A34A 1YIFA 2VC9A 4AVVA 4YFWA 4YPJA 1ENRA 4F83A 1O5LA 3OPTA 5LBCA 4UWDA 4XMAA 3W5MA 1PX3A 2PHUA 5HCBA 1O4YA 4TLFA 5CFCC 2CAVA 4M3CA 3ZPYA 3AP7A 1JZ3A 4LE4A 3RS6A 1B09A 3AC0A 1O91A 2NMNA 2BP6A 5JIAA 5LA0A 1SHWB 2IUWA 3KD4A 5K0UB 4QHZA 2EXJA 4LXLA 3ACGA 2PXJA 4HXCA 2DV9A 3WNXA 2BNOA 5FY1A 3D82A 1YQ8A 4FCAA 1Q8QA 3WQ1A 3ITQA 2HWC1 2YU1A 3VDDA 2RS32 3N7KA 3MUZ1 4B4PA 2D5FA 1QNWA 1ZZCA 5C9AA 2W08A 5D21A 2FDHA 3URFA 2P34A 3RGBA 3JUUA 1CAVB 2BOIA 3VD3A 4YW5A 4QGNA 5FYIA 1K3IA 2RE9A 2VOKA 5DZGA 5JWPA 1S2EA 5JZGC 1W6OA 2OPKA 5AVAA 3I2FA 5KHIA 1Y43B 2V4VA 4QPGB 5BNOB 2YC0A 1TE1B 1PMJX 2WAAA 4XUNA 2VAUA 2ZACA 2Y6HA 2A5ZA 1KQRA 3J7NA 4OHXA 1REFA 4XW3A 4XYXA 3S30A 5JXGA 4MH0E 1NT0A 2ZEXA 1IGOA 3TAYA 2QQKA 2IXLA 2Y6GA 3EMRA 2WS91 5F32A 4E2QA 1YLLA 5LEKA 2P2KA 4TN7A 5D8AB 3ZSEA 3VBSC 3QD6A 5H9QA 2HWD3 2IFRA 5I8YA 5KBFA 4QPIA 4URAA 4FXKB 2R062 1Q3EA 1AYM2 4P9WA 5C33A 2X29A 4FPEA 3ZFFB 5BNNB 4TSVA 3OPWA 4Z1VA 2QVSB 3CZUA 1CR7A 3AJZA 5KHJA 1LHUA 1XE7A 2ID4A 1NLRA 5F9TA 3T2OA 1FOD3 1HRI2 2D3PA 2ZKNA 2MHFA 4K40A 2C0ZA 2F6BA 2OA2A 2WSUA 3BN6A 4QM8A 5FP3A 3VZJA 1DQ1A 1PZ8A 2HYXA 4NPMA 4JQTA 1UX6A 2PAEA 2A7AA 2Y38A 3A7QA 2JE9A 1B35C 1Y9GA 1PVXA 3J26N 3N3HA 2XLAA 3V0AB 3DPRB 4IGOA 1IQAA 3AKTA 3VBHC 1ZA7A 2ZGTA 5T55A 5AFBA 3THDA 3T3YA 1CZSA 1UPSA 4HKWA 2ENRA 4PI0A 1QJU1 3WNOA 5LA1A 4MO3M 1GZCA 1UZ0A 3HJRA 2ZGUA 1GWLA 3VBOC 1XU1A 1NA1C 2D5HA 4XCBA 4IV1B 4ATEA 2UWCA 1DGRA 2OUHA 4XIOA 3ST7A 5IK7A 1UX7A 2KA3A 3GZAA 1W8NA 4XZPA 4WM7B 5GKAC 3MLJA 5LBBA 1GP6A 2YFUA 4DXTA 3V64A 3A0NA 4L99A 4IEYA 4Z2AA 2VXRA 4KQ7A 3A0KA 4QQ2A 4WVWA 5EXOA 1NLSA 2QQMA 3LF7A 4XDQA 1NX9A 3W9AA 2EIEA 1PVC1 2EAKA 1HRV3 2RM22 4CCDA 2W47A 3UT0A 1RUD2 2ZX3A 4INDA 2WDBA 3SKJE 2VM9A 4I01A 3MZHA 3I59B 5FP9A 4CDUA 2YYOA 4JTOA 4RFRB 4B1MA 4UBHA 2IXKA 4M3CE 1VRBA 1F9KA 3VBFB 1PIV1 2EVXA 4P9YA 1Q8VA 1RUF1 1UMHA 5DABA 4EV0A 1PO13 2XR4A 3NW4A 4LBKA 4L92A 5JVVA 4GH4C 1NLQA 4XFBA 4ZU4A 3S7EA 1VBC1 1OMIA 1MQTC 3ZN6A 3MIEA 3FBMA 1J3RA 4K20A 1QXPA 1WMEA 3I2HA 4FPKA 1QOTA 5FUPA 5FZIA 4O61A 1DGLA 5HCHA 1V6JA 2PA7A 3FBYA 3VD5A 4GZ9A 2J1RA 2YY1A 4XHBA 1ND2A 5JUVA 4A41A 3BIWE 1R091 3H9AA 1QH6A 3O12A 1ZA4A 4PQ9A 1UD1A 2VJXA 4XF3A 1APNA 2QQJA 3U4XA 4DXRA 3ES1A 4CEWB 2ZGLA 5FYZA 3TEWA 4WM8A 3WG1A 2R6QA 4YW1A 1TME2 3N7MA 4LPLA 1NKGA 3WF0A 3J8F1 2DWRA 4QB2A 1N3OA 2CYFA 1O3RA 5ABJA 3QBQA 3AZXA 3IT8A 5FZ9A 3CKHA 3M2MA 1X82A 5T5JA 3WP4A 4BQXA 4NE9A 2ZMLA 5EHDA 2W5FA 4GMP1 5BY5A 1ODMA 3PTRB 4HBNA 1WMFA 2K46A 2ZHLA 3CF6E 1JHJA 1W04A 4LBQB 3VBUA 2JJ6A 3CO2A 4W50A 5CZKA 1OPOA 4V2WA 3RZMA 5DAXA 1IKPA 3HOBA 2JDHA 1BEV1 3VV1A 1UY0A 1WW7A 1FT9A 4K1ZA 3I2JA 3WXPA 1JYVA 1ZBE1 1I5ZA 3NV1A 4QXHA 1DU3D 4P08A 4IW3A 2TEPA 2R0HA 3N9OA 4QX1A 2JG9A 3ZSLA 4XFCA 1PM7A 3HD8B 1S4CA 5F3IA 5KXDA 4D94A 4QXBA 3EXUA 5J09A 5GLUA 2BGCA 1EAH2 1TZOA 1V6IA 4WZCA 3VD7A 4GAZA 2Z69A 4NRPA 4AYUA 2EXKA 1KDKA 4N8MA 4AQTA 1YYNA 4I0AA 2D43A 2C4XA 3I2GA 1GU3A 1VBA3 1I5PA 3O1OA 3RZLA 4LKSA 2VECA 3LWCA 5FMCA 3RZJA 1MS0A 4QDQA 3T4VA 3ZSMA 3E5QA 3JB8A 4TWTA 1G9DA 2VQAA 1RUC1 1RTVA 1J1LA 4K3UA 5E89A 4NHXA 2EXIA 2PLV2 3IIAA 4LKDA 1WKYA 4YGCA 2XBO1 1MS3A 4MGSA 3WZ1A 1PGL2 4P9XA 3ACLA 1JTZX 3B9IA 4AVTA 1H8VA 3OOXA 5BNPA 4IQPA 5A70A 3BGAA 2XPJA 4LBNA 1NQJA 1W06A 1DFQA 1XNAA 2C9KA 2VOTA 2XVKA 4DINB 5C4WB 3H3ZA 1TMF3 1O8SA 1LU2A 2FCTA 2JDUA 2MEV3 4Q0SA 1LU1A 1CJPA 4DIQA 1IS6A 2WZR3 3MW3A 2JIJA 1C5HA 1RMU2 1W2UA 1Z78A 2B5HA 2DF7A 3B02A 3RJRA 3CJXA 3KB5A 2HWB1 5A80A 5CFCA 2WRAA 3LPFA 5FY0A 1DP0A 4XZUG 5A6QA 2W0XA 2WAOA 2ZS6B 5BXXA 2VBDA 2BNMA 4XFHA 4GQ7A 3JQXA 2XWJB 2XMLA 1BBT3 5DG1A 2Q8DA 4COVA 5DUUA 2A6YA 4RSUA 1OOPB 1QH7A 2YDEA 1HN1A 1RYYA 1NOVA 1ONAA 2YPJA 4Q0UA 4FAGA 3LZZA 2UWAA 4N7UA 4A42A 5JR7B 4XFIA 4Z82A 3HNMA 2A3YA 2BZDA 5HCAA 4RGGA 4CVUA 1I9RA 4K6BA 1PK6B 3G6JB 4LUMA 4XBQA 4PF5A 5AC93 5JZGA 4E2GA 4KI5M 2E6VA 1GP5A 1GV9A 1JI6A 3LGRA 3PJYA 5IK8A 2DCTA 2WINB 1IS5A 4PIZA 1H0BA 5CVRA 4V1PA 1G8WA 4GKXA 3OGRA 4OULA 1UXZA 5A3UA 1L7RA 2CWSA 2NYYA 3VL9A 4AHYA 5JXJA 4D7YA 4LITA 4AGVA 1X8EA 4W8JA 4EN7B 3VKLA 5CFDB 3WVJA 2ZPXA 1YFWA 4PLMA 4Q4Y2 5LZ6A 3ZYGA 1YUDA 4Y33A 4JGZB 1CAXB 3JZVA 4CDXC 2KXLA 5EWSA 5FZLA 3FUOA 1OVPA 5GLZA 1V6LA 1VBB3 4J6GA 3FN9A 3U1XA 1OHFA 2VZUA 1MVQA 3B01A 4IE5A 4L9BA 1V70A 5JI7A 3WDXA 3D5OA 4FOWA 2FDGA 2OQ6A 2RS13 1HRV1 2W1UA 2Z2SB 3BB6A 4YW4A 2C6SA 2JB4A 1CJDA 4BZ4A 2WS92 5HBAA 1B35A 3MPBA 5E8AA 2PTMA 5FLHA 4DEQA 3ZFGB 1RXGA 1LJ7A 1LEDA 1LRHA 2PN5A 2V5YA 4N53C 3M8LA 3VBHA 1V9U3 3L2YA 1NY72 4QDSA 4LBQD 3PL0A 5KXCA 1F5JA 4QU1A 3TEYA 1F2NA 3O1RA 4KBBA 5DZEA 3IWZA 5FV3A 1LGNA 5FPVA 5IK4A 3VBOA 1CAUB 2OUJA 4ES8A 1W8ZA 1NA1A 2VUDA 3KV4A 4P9JA 3WCRA 1LESA 4YNIA 2WNOA 1KS4A 3JCIA 2JD9A 1AXZA 2UURA 1CPNA 3DECA 4FFGA 3BU0A 4K9SA 4GKYA 1IOAA 4ZXEA 1ULPA 2UWBA 3BOWA 3O5SA 4FPHA 4OHZA 4AK3A 1W6NA 2VD7A 1VMFA 5L7OB 4S2GA 3MFAA 3WDYA 1QMJA 5DN2A 1KXGA 3WSOA 1NCRC 3FX3A 1Q56A 4CCJA 2EAAA 1FPN2 2G4IA 2Y6JA 2ZMKA 1GUIA 1UZVA 4B3NA 4DY5A 2QQNA 2X5IB 3WW2A 1AJKA 4R4XA 3BU7A 3H1MA 1QJU2 4I2OA 3IMMA 4PF1A 4G3YC 1YC61 2HYKA 4KG0A 3N4MA 4CCOA 2MPFA 2PHWA 2Y0OA 4I30A 3S7IA 2D6PA 3NWKA 2DFBA 4HVOA 1RGSA 5A7WB 4EN6B 5J96B 4XQWA 4R52A 1FAYA 1ST8A 1KJLA 2WJSA 1ULOA 4PDWC 4GH4A 1W8UA 3HN1A 4IGQA 1R1ZA 1SPPB 3MLKA 1MQTA 3AX4A 5FP7A 2NN8A 3KV9A 5K7PA 1CAWA 2W95A 4OI1A 1W8WA 4CRQA 1PVC2 5FXVA 2ZXQA 2CHHA 1Z7S3 1L7LA 4NHMA 5FBJA 1REEA 4LUKA 2VO5A 3ZDSA 3ZXDA 4IEWA 2WZEA 5J37A 1CESA 4YGDA 3GHMA 1A6CA 1HB4A 1LKNA 2Y6KA 2XJPA 1YWKA 4D0QA 1H30A 1QJX3 4KWLA 5KWRA 1PIV2 1VAMA 2QQLA 3QCWA 2GAUA 4QKNA 1RUF2 1XBFA 2ARBA 3UETA 1H2KA 3POEA 2BPA2 3ZXJA 2BQPA 4MGZE 4NVPA 1VBA1 4NIGA 1AR91 2XGXA 1GWKA 1AYM1 2BTVC 1GNHA 2JG8B 3HN3A 2WNUC 3FHQA 3ZN4A 3AKPA 1UZYA 4XFAA 5C5TA 4H14A 5FZFA 4GB31 3OYWA 1DZTA 3KQRA 4NOTA 4E4HA 5I8TA 3THTA 4BWOA 5GZCA 1D7PM 4JHTA 1UKRA 3F95A 1C3HA 3U14A 4LBLA 4MHRA 4ATFA 1WGPA 1RUJ3 2UU8A 3IDBB 4XBNA 4NMIA 5FYVA 4B7EA 1TMF1 3K77A 4XXPA 5C71A 3KM5A 3AMQA 4AQSA 2MEV1 1JYWA 1OA4A 3D8CA 1UAIA 1SBDA 4XF1A 3J8F2 5JOWA 2XL9A 3LA2A 1X9TA 2ZJCA 1BK1A 3BUCA 2H0BA 3PU3A 4OHVA 2Y64A 5F1RA 1R1A3 2VR4A 2ZX4A 1GZWA 1IG3A 5FZCA 2Y60A 2ZGPA 1PMHX 2B42B 3ME2A 3PURA 5JR2A 3Q8BA 5FZOB 2QQWA 1YQ2A 3RI8A 1PZ9A 5FYHA 4ZS2A 4Z8BA 5KXEA 3DYMA 4AEDC 5C3PA 1ULEA 4BQ4A 4XDOA 1I3HA 3MF6A 3SCHA 1BEV2 4R9BA 3U11A 2ZGMA 4XOGA 3SLIA 1ZBE2 3DN7A 2QNKA 5KXBA 2ARXA 1IS3A 1V6KA 2WKKA 4Y1XA 5B2GB 4G4FA 4K21A 3LD8A 4QHOA 1EUUA 5AC91 5GZGA 3SC7X 5HXVA 3UK9A 3VKMA 3GYDA 4N43B 1UOGA 2OVUA 4ORFA 1OXCA 1XNKA 4NROA 1SG3A 1DBNA 4KMQA 3RMXA 4Z92B 2VCMA 2Q8CA 4BM8A 3WT3A 3Q8AA 1XE8A 1W2OA 1HQNA 1UYYA 2ZZQA 3CZJA 3M3CA 3UESA 4CDWC 3I49A 1X50A 3KVBA 1N3PA 4X8PA 2QDRA 4BK5A 4KL1A 2E53A 4HN0A 3VZMA 3MO4A 2B45X 1RUC2 4EYUA 5DUVA 2CNAA 2PHLA 2DU1A 1G86A 3VDCA 5JPNB 5C3OA 4M3CB 2OS2A 5LW9A 1XPWA 4I0BA 4FOQA 4XBLA 2ZOEB 5CIRA 5EJZB 3BTXA 3TEXA 4ASKA 3WLUA 5JAXA 1S2BA 4NIHA 1X36A 4BIOA 3ZIWA 1UZZA 2DYCA 4LK6A 1W05A 1U5XA 4IV3A 4KGGA 5HCFA 4QX2A 4A45A 3VDDB 1LOAA 5T54A 1OPMA 4XF4A 3B7MA 1RUH3 5C9AB 4M4RA 1WA4A 2VZTA 2VBBA 3AP4A 2YBSA 1A8MA 1G7YA 2GP5A 1RIRA 1AR73 5DPNA 1SFNA 3UJOA 2GNMA 3CLPA 3U37A 1S0EA 3AYAA 2HWD2 3PTYA 1UIKA 4MSVA 1W6OB 5A3WA 1NZCA 3PIGA 5IVEA 3WDTA 1LNSA 5CG8A 5EFUA 1RHI3 4GA9A 3VL8A 4CUCA 4HKOA 2G19A 5ACA3 3BTYA 1ZRCA 2G9FA 1ND2C 4WBBA 1QDCA 4AVBA 4XIKA 4RGKA 5I91A 3OUHA 1OF3A 3KCYA 3HAGA 5G04L 1BCXA 1Z0HA 3NO8A 1ZRFA 3G7DA 4CDXA 2BUKA 4QPIB 4Y1ZA 4OUEA 5FDBA 5F7UA 1DIWA 4C90A 1Y7BA 3SH4A 1QWRA 5I0TA 1NYWA 2BEOA 4JCKA 1U0AA 3H7JA 1HB2A 4XF9A 3FE5A 4XVHA 1WW4A 3UGGA 5T5PA 1YJKA 4CCKA 2XLGA 2RDNA 4LHKA 1JOBA 4AI3A 4LIVA 1WD4A 3MIGA 4X6RB 4LTAA 4N53A 2IXCA 3VBUC 2PFWA 1ULGA 2N7GA 3CBNA 4LLFA 4RFT0 3VBRC 2J42A 3BALA 1ZBA3 4YM2A 2YROA 2PHXA 3AB0A 1GNYA 1SACA 1IPJA 3H50A 1HQLA 2VQ0A 2Q30A 4URTA 3THCA 3HVDA 3GZTB 4QX3A 3H8XA 1W99A 2W91A 2WFPA 2GC0A 1S2KA 5A6YA 1CX1A 3K4ZA 4K8RB 3USUA 4JRLA 5DG2A 1Z7S1 1HRV2 2V09A 4CU6A 2Q8EA 3LSEA 1W39A 3AYDA 5FR3A 4RR3C 1N1YA 5IAXA 2JIGA 2UY9A 4XE9A 3KCCA 4BMBA 4YW3A 3BVCA 1RUE3 3RFRA 3EHKA 3LFMA 3ZXGA 2WO3A 2Y0IA 4AEJA 2ZHNA 1NXMA 3KS7A 5K9YA 3JQWA 4DOUA 1POV0 3FHIB 4LHSA 3WNPA 2EICA 1AXYA 5FPLA 4BISA 1PO12 1ZM1A 2PELA 3ZMOA 4KWKA 4GWMA 3N9MA 3PVBB 3DYPA 3BPZA 1VIWB 2HWF3 5L9BA 4Q29A 1W2AX 2ZEWA 4ASMB 1VRH3 1HJFA 1MZEA 4YVSA 2RMU1 4BQ3A 1MACA 1W6QA 5J1XA 1A3KA 4QQPA 4PDWA 3D0JA 3H8RA 2YUEA 1XC6A 4HLTA 2E9QA 4CDUB 2ETEA 4IGPA 3LB9A 2OKXA 3AL5A 1DQ6A 2WSVA 4AF9A 5A1FA 5HI0A 1AX2A 1OLQA 1VPHA 4DXSA 5FZ8A 2H6BA 4AFAA 5F5QA 3DXTA 1MZ5A 3R4UA 1KITA 5JSRA 5FY5A 2AACA 1DZQA 2IXHA 3ZN6B 4CZSA 4OZXA 2QKDA 3MHZA 4D6SA 1W0NA 1EY2A 2VE1A 2G9GA 4CDQC 4PCRA 1WMXA 1VBE1 3FJSA 4AI8A 4HONA 1W90A 4R9DA 1H8TB 4Y1YA 2WO2A 4BCUA 4FPFA 5HV4A 4UBGA 3WW1A 2E63A 3DF0A 4JVAA 2R49A 2JE7A 1JHNA 1TNRA 4LR4A 4B8EA 5JLVA 1JZ5A 5KC6A 4XXAA 3PHMA 4Q4Y1 2C26A 2OT7A 2WNUA 2VCBA 4JZRA 4WM8B 5FZAA 4XFFA 2Y34A 5DAVA 5ERLA 1PO23 5FREA 5FY4A 5LA2A 3HQXA 1BKZA 5FYUA 3JBG3 4Q2FA 1UOJA 3H1YA 2FDIA 1Q8OA 4A7YA 4CUBA 5ABJB 1H2NA 2BWAA 2ZX1A 3ZXLA 2XQRA 4S2HA 1JU4A 1AL0G 1MR5A 4AI9A 4BPZA 5JDBA 1KDMA 2GN3A 4D8MA 2EA7A 3NKGA 2GH8A 1H6YA 3SEPA 4Q4X3 1M4WA 2G1MA 3KLSA 3KHCA 2ORXA 3B3QE 4ZZ8A 1CQ9A 2ZEZA 4G9SB 2OYZA 4AG4A 3ZKUA 4BE3A 5IVFA 1VBA2 2H6CA 1AR92 3FHAA 4RHV1 5FKBA 2VMDA 3VHOA 2FD8A 5GLWA 4OQ8A 1NY71 2D97A 4QM9A 5ANQA 4UW6A 4BIFA 3AMPA 2YMZA 3VD4A 2OQ7A 2XUEA 3DXUA 4FFHA 4Q0PA 1E5RA 1HQWA 3NJYA 2J22A 2JG9B 4HFSA 4MXVA 1S55A 1FATA 4GB32 4XC9A 3M3IA 5DDJ3 3WG3A 1BMV1 4YW2A 1GZTA 2HLEA 3JD73 1UQXA 4FI9A 5FTTC 1NAEA 2J1EA 2D44A 3D0SA 4EWDA 3DKWA 2R043 1YFXA 3ZLIA 3VZNA 2VH9A 4AEDA 2AEZA 2WWJA 1WBFA 1F31A 4QX5A 4D3WA 2AYHA 2CGNA 4Z2WA 3H8OA 3UKNA 2G9ZA 1TMF2 1D4M1 1F4AA 5A3TA 4MUVA 1C1LA 2ARCA 2MEV2 5H9SA 4XDPA 3WR0A 5JXIA 2P6HA 2TUNA 2R32A 4UFJA 1AYN1 1FPN1 1GQGA 3MDPA 1HB1A 5KHHA 2AGSA 5JSPA 4MLOA 3CQOA 2BOJA 4QKFA 1AR71 1YFUA 3C7GA 1UOBA 3O0VA 3NNFA 4NIDA 1NCQB 5BNPB 3GZUC 1GQPA 3VDAA 3ROUA 3AKRA 3SNMA 4BU2A 3K51A 4CDWA 1XQNA 1LCLA 2JDPA 4U36A 1MS1A 2ZA9A 3WCSA 3VZLA 1RHI1 2P3KA 5IW0A 4LMFA 4DZGA 5LB6A 5ACA1 4IE4A 2ATFA 2P4EA 1N47A 2J7MA 1OLRA 3B00A 2QUOA 3OBAA 1Y9MA 1LHNA 2OW4A 4UYBA 3D4KA 4CU8A 4EQVA 5CFCB 4Y3OA 4W6WA 4EZ4A 2JWPA 4OCTA 1XNBA 1XSRA 4QB1A 4AHXA 5AC92 3U4SA 3CEWA 4FTEA 1LTEA 2XKPA 5C3RA 1ENQA 2EF6A 3QACA 1OD5A 3EB7A 2A3XA 2XB6C 4YZ3A 4A44A 4IUGA 2PYTA 2Y33A 5DXDA 1EPZA 4E8CA 2WT1A 1Q5OA 1MS9A 4B7KA 2Q4SA 3KQ4B 4PIXA 1QOSA 3Q8CA 3H42B 5FWEA 1CWPA 1LECA 4RQPC 3PVNA 3RYRA 1GLHA 3HNBM 2FDJA 4HKLA 2FBEA 5JZGB 1X33A 2W9XA 1DQ0A 2YU2A 2E26A 3GM8A 3KGZA 3WF1A 3Q8EA 4CUGA 3LIGA 1OC1A 4C8DA 1ZBA1 1A8DA 1R64A 3MF9A 1T2XA 5LATA 4BLJA 3L2HA 3NAPC 4OFGA 5LWBA 3I3MA 1WD3A 3PUSA 2J1TA 5FYSA 4FPLA 4O9EA 4Q27A 1O4ZA 3NNJA 3LCPA 2HKXA 3VBSB 2OIIA 3LOIA 2P3JA 5E6HA 4LIUA 4LEJA 4ZPIA 4LBJA 4R8HA 1JMUB 3KT4A 4NUBA 2VW0A 4NR1A 2BNNA 3K4AA 5JCTA 5FMDA 4DUXA 1JOJA 1DYOA 4XJ9A 1G9BA 2VZRA 5GZFA 1JZ8A 3GBFA 2J1SA 1QJY3 3PUAA 3OGSA 3POGA 4K8FA 4AGGA 1GNZA 3OBTA 3AL6A 4M3CF 5FOBB 1ULFA 1HV0A 4MVTA 2P3YA 5J3UA 1IPSA 3WDWA 3ZYPA 3H7YA 2K2SA 2VTFA 1J3PA 2ZX2A 4OI4A 5DQ0A 5C8CC 2W3JA 3FLTA 4LQRA 3VBRA 5IHRA 3ILNA 4XJ8A 1B35B 1K5MA 4YZ1A 3NL1A 4Y4YA 2P6CA 1DQ2A 3C7EA 5T50A 2MNGA 1M06G 5BNOA 4LOTA
chains in the Genus database with same CATH topology
4BJ0A 3C7FA 4ZXEA 1ULPA 3I3BA 3K4DA 4A4AA 4ZY9A 5DN2A 3WSOA 4P5YA 1US2A 2Y6JA 1OH4A 1GUIA 2QBXA 5A1AA 2QQNA 3IIIA 1OT5A 1TVGA 1CZVA 4GWIA 4QAWA 2J1UA 4PF1A 3WNLA 4DUWA 2W92A 1K42A 2VMCA 1NUKA 3NRUA 2XOMA 4RN5A 1ULOA 1EUTA 2WABA 2VZPA 2W95A 4E8DA 2ZXQA 2R7EB 4XUQA 2DDUA 3IB3A 4JX0A 2VO5A 2WZEA 1H6XA 2W46A 3CDZB 4W4ZA 2Z4FA 3WNKA 2Y6KA 3GGLA 4D0QA 3UNPA 4ARYA 2QQLA 3F2ZA 1UY3A 5C70A 3UETA 5HXMA 1K45A 3OEAA 1GOHA 4JHZA 1F4HA 2VQUA 4HG6B 2E32A 3I3DA 3HN3A 2EIDA 3FHQA 4XURA 1CZTA 4ARXA 4L0PA 5IJRA 5IFPA 4A3ZA 1D7PM 4CU7A 3ACIA 3J7HA 5I0DA 1J84A 5C71A 2X10A 3K77A 2ORZA 3JXSA 3MV11 3T2PA 5DMYA 1JYWA 3A23A 2YB7A 3IAQA 4RYDA 3ETPA 2ZEYA 2W1WA 3K75B 5LCWL 4OYUA 2Y64A 4CU9A 2VR4A 3LEGA 2JE8A 3C8XA 4TTGA 5JR2A 1PMHX 4MOAA 3I2IA 3WNMA 1YQ2A 1W9WA 3A21A 3HPNA 2J1AA 3DYMA 4UI9L 3OEBA 4QPWA 3FL7A 1GMMA 3WF4A 3P1IA 3LEIA 2VMEA 5JXHA 3HEIA 1EUUA 4JKLA 2WBKA 1JU3A 2VZ1A 3VDBA 3I97A 3C7OA 1JZ4A 2VC9A 5G05L 4YPJA 1SG3A 4KMQA 2JKXA 3OG2A 3W5MA 1PX3A 1JZ3A 1OF4A 3I2KA 1UYYA 3UESA 3CZJA 3AC0A 2BBAA 1UMIA 5LA0A 1SHWB 3ECQA 4BK5A 3ACGA 3MO4A 4MGQA 3C7HA 5FUIA 4GWJA 3SEEA 3VDCA 3WNNA 3MUZ1 4CUAA 1XPWA 2CDPA 3WF3A 5EJZB 2XONA 3VD3A 2RV9A 2X05A 1K3IA 1JZ6A 3I2FA 4XUPA 1W9TA 2V4VA 4QX2A 4A45A 2WAAA 1PMJX 4XUNA 5EJ1B 3E1F1 2Y6HA 4M4RA 2VZTA 4QDRA 5DPNA 1W9SA 5JXGA 3ABZA 4OZOA 2ZEXA 2VMFA 3U37A 2QQKA 1GOGA 2Y6GA 2W1QA 1LNSA 4JKKA 4UOJA 4CUCA 3LPGA 2E33A 3PUHA 2WN3A 1OF3A 3CZUA 1XNTA 3IDAA 5G04L 3LE0A 4JKMA 2ID4A 3T2OA 4OUEA 5F7UA 3MUY1 2W94A 3BN6A 2HYXA 2YC2A 3NJXA 1JYXA 4XVHA 3A7QA 4KWUA 2VZ3A 2DCKA 5B4NA 3I3EA 3MV01 3THDA 1CZSA 1W8OA 5LA1A 3WNOA 2XQXA 5EIYB 4DEVA 4MO3M 3NNGA 4QB6A 1UZ0A 3HJRA 4DUVA 3SKVA 1GNYA 2VCAA 4M4PA 5B4XA 1UYXA 4BXSV 1UX7A 3THCA 1W8NA 4QX3A 2YFUA 1W99A 4DXTA 2W91A 4Z2AA 1CX1A 2J1VA 5HPOA 3K4ZA 2QQMA 4CU6A 3W5NA 1NX9A 2BGOA 2EIEA 2W1SA 2QQOA 2W47A 2WO3A 2WDBA 3SKJE 2VM9A 2E31A 3LEKA 4ET7A 5CYYA 1JZ2A 3T09A 4LHSA 3WNPA 2EICA 4P02B 3DYPA 1UMHA 1UY2A 2ZEWA 3WQBA 4BDVB 5J1XA 3CIHA 4BK4A 1XC6A 4UAPA 3GXUA 1PX4A 3I2HA 2OKXA 1KGYA 2L9LA 3VD5A 4GZ9A 2J1RA 4XUOA 2VL4A 3ACFA 4DXSA 5JUVA 4A41A 1L7QA 2VJXA 2EIBA 4TXWA 2YFZA 2QQJA 1W0NA 1WCQA 4DXRA 1P8JA 1O8PA 4AAXA 4LPLA 1NKGA 3T08A 3WF0A 5IFTA 4QB2A 2WO2A 3HNYM 3K46A 3CKHA 1DLCA 1IQDC 2W5FA 1JZ5A 1JHJA 2C26A 2VCBA 5LA2A 2W87A 4W50A 5CZKA 2DCJA 2V72A 1US3A 3HOBA 4CUBA 1UY0A 2LW8A 2JDAA 3I2JA 1JYVA 1JU4A 2WO1A 4P08A 4D8MA 2B9VA 3SEPA 4QX1A 1H6YA 1UXXX 2RVAA 2ORXA 2VCCA 3WF2A 4A6OA 2KD7A 4ZZ8A 3T2QA 2ZEZA 3VD7A 4AG4A 4OMCA 3FHAA 2VMDA 1KEXA 5IYYA 2C4XA 3VD4A 3I2GA 1GU3A 1I5PA 2J22A 1O59A 4LKSA 4MADA 2HLEA 4QDQA 4FI9A 1NAEA 2J1EA 2RJ2A 1BHGA 2WUHA 3T0BA 1UY1A 1WKYA 4MGSA 2WZ8A 1GOFA 3IAPA 2VZQA 2XHNA 3T0AA 1F4AA 3BGAA 2BGPA 2VOTA 4XUTA 1XNAA 1OD3A 2C9KA 1MPXA 4QX0A 2PQSA 5JXIA 3OGVA 1O8SA 2YG0A 2Y6LA 3CQOA 3C7GA 1UYZA 3OB8A 3LPFA 1DP0A 1GQPA 4XZUG 3VDAA 2WAOA 3NQHA 2VZVA 1UWWA 3P6BA 2J7MA 2WQ8A 2Y8KA 1HN1A 1RYYA 3GDBA 3OBAA 4CU8A 3ZM8A 4QB1A 1TG7A 4A42A 3CMGA 2YC4A 3HNMA 2BZDA 2VZOA 4CVUA 1J83A 3EB7A 4A44A 4IUGA 4KI5M 3VD9A 2B4KA 1JI6A 3D3AA 5C7GA 4E8CA 3NJVA 3DYOA 2VQTA 3OGRA 1UXZA 2BERA 2QQIA 3HNBM 2W9XA 1L7RA 2E26A 3EYPA 4ZZ5A 3GM8A 3WF1A 1JZ7A 5JXJA 2WYSA 1R64A 4W8JA 1T2XA 3MBWA 1JYNA 2WN2A 2VZSA 2J1TA 3A22A 3ACHA 3PUIA 4PQQA 1CIYA 3FN9A 1SDDB 2VZUA 3LQCA 2X09A 3T0DA 5JMOA 1UY4A 3K4AA 2W1UA 3WEZA 4DUXA 2V5DA 1DYOA 2VZRA 1JZ8A 2LS6A 4P00B 4DEQA 2J1SA 3OGSA 1K12A 4PT6A 4QDSA 4OMDA 2VTFA 5DQ0A 2W3JA 4LQRA 2CDOA 5IHRA 3C7EA 2JD9A 3DECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ0 A;  3C7F A;  4ZXE A;  1ULP A;  3I3B A;  3K4D A;  4A4A A;  4ZY9 A;  5DN2 A;  3WSO A;  4P5Y A;  1US2 A;  2Y6J A;  1OH4 A;  1GUI A;  2QBX A;  5A1A A;  2QQN A;  3III A;  1OT5 A;  1TVG A;  1CZV A;  4GWI A;  4QAW A;  2J1U A;  4PF1 A;  3WNL A;  4DUW A;  2W92 A;  1K42 A;  2VMC A;  1NUK A;  3NRU A;  2XOM A;  4RN5 A;  1ULO A;  1EUT A;  2WAB A;  2VZP A;  2W95 A;  4E8D A;  2ZXQ A;  2R7E B;  4XUQ A;  2DDU A;  3IB3 A;  4JX0 A;  2VO5 A;  2WZE A;  1H6X A;  2W46 A;  3CDZ B;  4W4Z A;  2Z4F A;  3WNK A;  2Y6K A;  3GGL A;  4D0Q A;  3UNP A;  4ARY A;  2QQL A;  3F2Z A;  1UY3 A;  5C70 A;  3UET A;  5HXM A;  1K45 A;  3OEA A;  1GOH A;  4JHZ A;  1F4H A;  2VQU A;  4HG6 B;  2E32 A;  3I3D A;  3HN3 A;  2EID A;  3FHQ A;  4XUR A;  1CZT A;  4ARX A;  4L0P A;  5IJR A;  5IFP A;  4A3Z A;  1D7P M;  4CU7 A;  3ACI A;  3J7H A;  5I0D A;  1J84 A;  5C71 A;  2X10 A;  3K77 A;  2ORZ A;  3JXS A;  3MV1 1;  3T2P A;  5DMY A;  1JYW A;  3A23 A;  2YB7 A;  3IAQ A;  4RYD A;  3ETP A;  2ZEY A;  2W1W A;  3K75 B;  5LCW L;  4OYU A;  2Y64 A;  4CU9 A;  2VR4 A;  3LEG A;  2JE8 A;  3C8X A;  4TTG A;  5JR2 A;  1PMH X;  4MOA A;  3I2I A;  3WNM A;  1YQ2 A;  1W9W A;  3A21 A;  3HPN A;  2J1A A;  3DYM A;  4UI9 L;  3OEB A;  4QPW A;  3FL7 A;  1GMM A;  3WF4 A;  3P1I A;  3LEI A;  2VME A;  5JXH A;  3HEI A;  1EUU A;  4JKL A;  2WBK A;  1JU3 A;  2VZ1 A;  3VDB A;  3I97 A;  3C7O A;  1JZ4 A;  2VC9 A;  5G05 L;  4YPJ A;  1SG3 A;  4KMQ A;  2JKX A;  3OG2 A;  3W5M A;  1PX3 A;  1JZ3 A;  1OF4 A;  3I2K A;  1UYY A;  3UES A;  3CZJ A;  3AC0 A;  2BBA A;  1UMI A;  5LA0 A;  1SHW B;  3ECQ A;  4BK5 A;  3ACG A;  3MO4 A;  4MGQ A;  3C7H A;  5FUI A;  4GWJ A;  3SEE A;  3VDC A;  3WNN A;  3MUZ 1;  4CUA A;  1XPW A;  2CDP A;  3WF3 A;  5EJZ B;  2XON A;  3VD3 A;  2RV9 A;  2X05 A;  1K3I A;  1JZ6 A;  3I2F A;  4XUP A;  1W9T A;  2V4V A;  4QX2 A;  4A45 A;  2WAA A;  1PMJ X;  4XUN A;  5EJ1 B;  3E1F 1;  2Y6H A;  4M4R A;  2VZT A;  4QDR A;  5DPN A;  1W9S A;  5JXG A;  3ABZ A;  4OZO A;  2ZEX A;  2VMF A;  3U37 A;  2QQK A;  1GOG A;  2Y6G A;  2W1Q A;  1LNS A;  4JKK A;  4UOJ A;  4CUC A;  3LPG A;  2E33 A;  3PUH A;  2WN3 A;  1OF3 A;  3CZU A;  1XNT A;  3IDA A;  5G04 L;  3LE0 A;  4JKM A;  2ID4 A;  3T2O A;  4OUE A;  5F7U A;  3MUY 1;  2W94 A;  3BN6 A;  2HYX A;  2YC2 A;  3NJX A;  1JYX A;  4XVH A;  3A7Q A;  4KWU A;  2VZ3 A;  2DCK A;  5B4N A;  3I3E A;  3MV0 1;  3THD A;  1CZS A;  1W8O A;  5LA1 A;  3WNO A;  2XQX A;  5EIY B;  4DEV A;  4MO3 M;  3NNG A;  4QB6 A;  1UZ0 A;  3HJR A;  4DUV A;  3SKV A;  1GNY A;  2VCA A;  4M4P A;  5B4X A;  1UYX A;  4BXS V;  1UX7 A;  3THC A;  1W8N A;  4QX3 A;  2YFU A;  1W99 A;  4DXT A;  2W91 A;  4Z2A A;  1CX1 A;  2J1V A;  5HPO A;  3K4Z A;  2QQM A;  4CU6 A;  3W5N A;  1NX9 A;  2BGO A;  2EIE A;  2W1S A;  2QQO A;  2W47 A;  2WO3 A;  2WDB A;  3SKJ E;  2VM9 A;  2E31 A;  3LEK A;  4ET7 A;  5CYY A;  1JZ2 A;  3T09 A;  4LHS A;  3WNP A;  2EIC A;  4P02 B;  3DYP A;  1UMH A;  1UY2 A;  2ZEW A;  3WQB A;  4BDV B;  5J1X A;  3CIH A;  4BK4 A;  1XC6 A;  4UAP A;  3GXU A;  1PX4 A;  3I2H A;  2OKX A;  1KGY A;  2L9L A;  3VD5 A;  4GZ9 A;  2J1R A;  4XUO A;  2VL4 A;  3ACF A;  4DXS A;  5JUV A;  4A41 A;  1L7Q A;  2VJX A;  2EIB A;  4TXW A;  2YFZ A;  2QQJ A;  1W0N A;  1WCQ A;  4DXR A;  1P8J A;  1O8P A;  4AAX A;  4LPL A;  1NKG A;  3T08 A;  3WF0 A;  5IFT A;  4QB2 A;  2WO2 A;  3HNY M;  3K46 A;  3CKH A;  1DLC A;  1IQD C;  2W5F A;  1JZ5 A;  1JHJ A;  2C26 A;  2VCB A;  5LA2 A;  2W87 A;  4W50 A;  5CZK A;  2DCJ A;  2V72 A;  1US3 A;  3HOB A;  4CUB A;  1UY0 A;  2LW8 A;  2JDA A;  3I2J A;  1JYV A;  1JU4 A;  2WO1 A;  4P08 A;  4D8M A;  2B9V A;  3SEP A;  4QX1 A;  1H6Y A;  1UXX X;  2RVA A;  2ORX A;  2VCC A;  3WF2 A;  4A6O A;  2KD7 A;  4ZZ8 A;  3T2Q A;  2ZEZ A;  3VD7 A;  4AG4 A;  4OMC A;  3FHA A;  2VMD A;  1KEX A;  5IYY A;  2C4X A;  3VD4 A;  3I2G A;  1GU3 A;  1I5P A;  2J22 A;  1O59 A;  4LKS A;  4MAD A;  2HLE A;  4QDQ A;  4FI9 A;  1NAE A;  2J1E A;  2RJ2 A;  1BHG A;  2WUH A;  3T0B A;  1UY1 A;  1WKY A;  4MGS A;  2WZ8 A;  1GOF A;  3IAP A;  2VZQ A;  2XHN A;  3T0A A;  1F4A A;  3BGA A;  2BGP A;  2VOT A;  4XUT A;  1XNA A;  1OD3 A;  2C9K A;  1MPX A;  4QX0 A;  2PQS A;  5JXI A;  3OGV A;  1O8S A;  2YG0 A;  2Y6L A;  3CQO A;  3C7G A;  1UYZ A;  3OB8 A;  3LPF A;  1DP0 A;  1GQP A;  4XZU G;  3VDA A;  2WAO A;  3NQH A;  2VZV A;  1UWW A;  3P6B A;  2J7M A;  2WQ8 A;  2Y8K A;  1HN1 A;  1RYY A;  3GDB A;  3OBA A;  4CU8 A;  3ZM8 A;  4QB1 A;  1TG7 A;  4A42 A;  3CMG A;  2YC4 A;  3HNM A;  2BZD A;  2VZO A;  4CVU A;  1J83 A;  3EB7 A;  4A44 A;  4IUG A;  4KI5 M;  3VD9 A;  2B4K A;  1JI6 A;  3D3A A;  5C7G A;  4E8C A;  3NJV A;  3DYO A;  2VQT A;  3OGR A;  1UXZ A;  2BER A;  2QQI A;  3HNB M;  2W9X A;  1L7R A;  2E26 A;  3EYP A;  4ZZ5 A;  3GM8 A;  3WF1 A;  1JZ7 A;  5JXJ A;  2WYS A;  1R64 A;  4W8J A;  1T2X A;  3MBW A;  1JYN A;  2WN2 A;  2VZS A;  2J1T A;  3A22 A;  3ACH A;  3PUI A;  4PQQ A;  1CIY A;  3FN9 A;  1SDD B;  2VZU A;  3LQC A;  2X09 A;  3T0D A;  5JMO A;  1UY4 A;  3K4A A;  2W1U A;  3WEZ A;  4DUX A;  2V5D A;  1DYO A;  2VZR A;  1JZ8 A;  2LS6 A;  4P00 B;  4DEQ A;  2J1S A;  3OGS A;  1K12 A;  4PT6 A;  4QDS A;  4OMD A;  2VTF A;  5DQ0 A;  2W3J A;  4LQR A;  2CDO A;  5IHR A;  3C7E A;  2JD9 A;  3DEC A; 
#chains in the Genus database with same CATH topology
 1FXZ A;  1ASJ 1;  3VBH B;  1SCR A;  5FIX A;  4BJ0 A;  3E6B A;  3ZPO A;  2QQV A;  1COV 3;  2GDF A;  4PJY A;  4YG6 A;  2WNE A;  1VE0 A;  4YZ4 A;  1UF2 C;  1J58 A;  5JIU A;  1N1T A;  3K4D A;  3KF5 A;  4JGY C;  3RRD A;  1JW6 A;  4IEX A;  3BOD A;  4ZY9 A;  4XAC A;  2LTN A;  4HVR A;  4GXL A;  3VBO B;  4CA9 A;  5I0R A;  1NA1 B;  4RR3 A;  2HH9 A;  1RXF A;  4FXG B;  1US2 A;  5JPM B;  1Q43 A;  1OH4 A;  2D3R A;  1ZZ9 A;  5FK8 A;  5A1A A;  3LA7 A;  2VGD A;  3U10 A;  3ZFE C;  4XJU A;  1TVG A;  5APA A;  4GWI A;  1W6N B;  4AFD A;  3KZ4 C;  3AVS A;  2VMC A;  3SH3 A;  4A6S A;  4CEY C;  4C1W A;  1NUK A;  1D2S A;  4JAA A;  3PIJ A;  2DUQ A;  3WG4 A;  4TZD A;  2XJU A;  2VXJ A;  4NPL A;  3U0Z A;  4QWN A;  2VTX A;  3E5U A;  3IBM A;  3PJQ A;  2WL1 A;  4UXA A;  1EUT A;  1OFN A;  1PO2 1;  1ACC A;  3BI3 A;  2F17 A;  3EQE A;  1Z7S 2;  3LEM A;  4YFZ A;  1W2N A;  3NNM A;  1DGR N;  1AJO A;  1WCU A;  4K7J A;  4PHZ A;  1XOY A;  2R06 3;  4QT6 A;  5CEH A;  4QKB A;  2C9A A;  5F6K A;  1LB2 A;  2DDU A;  4ZU5 A;  3EBR A;  1YHF A;  1EV1 3;  3MW4 A;  4EWE A;  1H6X A;  4GH4 B;  2W46 A;  3CDZ B;  2K9Z A;  2Z4F A;  4A7Z A;  2DU0 A;  4NAO A;  1MQT B;  2DFC A;  3GGL A;  4Q0V A;  4XJW A;  5FYY A;  5LBE A;  1CAW B;  2CY6 A;  2DVA A;  2HWD 1;  3ZX7 A;  3F2Z A;  4YW6 A;  5C70 A;  4HAN A;  4CDQ A;  1MS4 A;  1GZ9 A;  1K45 A;  3KV5 A;  1GOH A;  4IV1 A;  1YO8 A;  1ENX A;  4Q4W 3;  2VQU A;  2ZZJ A;  2RMU 2;  3V0B B;  2EXH A;  3MEP A;  4HG6 B;  5DDJ 1;  3WX5 A;  4WM7 A;  1JOD A;  1QF3 A;  4GAL A;  1R08 3;  4XET A;  2R04 1;  1KFX L;  4ARX A;  4IV3 C;  5L73 A;  2X8K A;  1KFU L;  1FOD 1;  4IEQ A;  3TNQ A;  1T6B X;  1HLC A;  3OJB A;  5I0S A;  5IFP A;  3R4S A;  5D1I A;  3PNA A;  4QXK A;  4CU7 A;  5K8S A;  5FZH A;  2A6V A;  4Q1P A;  1WUV A;  3POY A;  5M0T A;  3AP6 A;  2B9U A;  5J98 B;  2X10 A;  1O5U A;  1W3X A;  3JXS A;  3MV1 1;  2WZP P;  3T2P A;  3WQ0 A;  1S0J A;  1VBE 2;  1VAK A;  3OYW B;  1AR8 3;  1R1A 2;  1W03 A;  5A7S A;  2W1W A;  3K75 B;  4IXL A;  5IWF A;  1ZRR A;  2DCY A;  3FWE A;  1D4V B;  1QJF A;  4OYU A;  2WFF 3;  4E9K A;  3AJY A;  5F2W A;  3LEG A;  5AVP A;  2IXI A;  1YQC A;  1LOF A;  5F8P A;  5CIS A;  4V2V A;  2TNF A;  2LAL A;  2VOX A;  4CCE A;  3R05 A;  4HN1 A;  3HBK A;  3I2I A;  4DMI A;  5BYN A;  3WNM A;  3J7L A;  1LHV A;  5L9V A;  4RD7 A;  2J1A A;  4P9L A;  1W0O A;  1O4T A;  4I3P A;  4NJ4 A;  5CKQ A;  4B29 A;  1N3Q A;  3IKW A;  5FYM A;  1RVF 3;  1GMM A;  1JBC A;  1K5J A;  3P1I A;  3LEI A;  1GZW B;  1SEF A;  2Y6F A;  3AMM A;  1UU5 A;  4H7L A;  3AYC A;  5LBF A;  3WV6 A;  2LRO A;  1AL2 3;  4ES9 A;  3MI8 A;  4KBZ A;  5JXH A;  4FQZ A;  2ZGO A;  3HEI A;  4UW3 A;  4JKL A;  1G9C A;  4GJZ A;  3ENR A;  2A3W A;  3O1V A;  4H3W A;  2JXA A;  2VMI A;  4FFI A;  2YXS A;  4LA3 A;  4YW7 A;  4RHV 2;  2AZ5 A;  4GWN A;  4FTB A;  5K4L A;  2WNV C;  4CP9 A;  3OG2 A;  1GIC A;  2R07 3;  3B5L B;  3JU9 A;  5FZB A;  1PO1 1;  1ENS A;  3KWV A;  4IER A;  1KRI A;  1UMI A;  2TBV A;  2Q8O A;  1BMV 2;  3ECQ A;  1DQ5 A;  5A3N A;  4LT5 A;  2D6K A;  1J59 A;  3B69 A;  3O0W A;  4MGQ A;  4C91 A;  2WWU A;  4GWJ A;  3SEE A;  5KHK A;  4LOR A;  1TME 3;  4CUA A;  1DF0 A;  2FHR A;  4Q1R A;  2ZAH A;  1D4M 2;  4MGI E;  2CDP A;  3GZE A;  4LJH A;  5A7O A;  3SHR A;  3WF3 A;  2XON A;  3AZY A;  4AFB A;  1SZB A;  2RV9 A;  3NV4 A;  1FMD 3;  2X05 A;  3N35 A;  3IDC B;  2XHK A;  5L9R A;  2BJS A;  5A7Q A;  2RJK A;  4OHY A;  1AYN 2;  1RUH 2;  2ADE A;  1H1I A;  3PU8 A;  4XUP A;  1W9T A;  4FO9 A;  3ORJ A;  2ZGK A;  1AR7 2;  1HIX A;  3K3O A;  5EJ1 B;  3SCG A;  2I07 B;  1FV3 A;  3ZSK A;  5C3Q A;  2YBK A;  1JS9 A;  4QDR A;  4L2N A;  4JTN A;  1LOD A;  4OZO A;  4DPN A;  4MGT A;  1QJY 1;  2DVF A;  2C24 A;  4PLN A;  4YVS C;  3PVE A;  2GMP A;  1RHI 2;  3ZN5 A;  3N9N A;  2W1Q A;  1G9A A;  2IXJ A;  4RQP A;  5ACA 2;  1GSL A;  3KSC A;  4HOO A;  1ODN A;  2QQP A;  3BTZ A;  2HEW F;  3IPV A;  2JDM A;  5FMB A;  3LPG A;  2BFU S;  1HXS 3;  3VKO A;  2WN3 A;  1SMV A;  1OI6 A;  1SDW A;  2HWE 3;  2VNR A;  4EE2 A;  2LM3 A;  2BYV E;  1SCS A;  3IDA A;  3NAP A;  3TRS B;  5I93 A;  1NG0 A;  5CG9 A;  4JKM A;  3LDK A;  2B39 A;  3RZG A;  4NO4 A;  2CU5 A;  1W6P A;  3MUY 1;  3M3E A;  1VJ2 A;  5FYT A;  5J48 A;  1EP0 A;  5KR7 A;  1W6M A;  2QJV A;  2EIG A;  5A1L A;  2XJV A;  4XTP A;  2D98 A;  2AH2 A;  3AKQ A;  3NJX A;  4FQ4 A;  4YG0 A;  3LKJ A;  3CU7 A;  1CGP A;  4KWU A;  3ELN A;  3BCW A;  4I09 A;  3VLB B;  4E4Z A;  4CDX B;  5B4N A;  5FQ0 A;  1WCK A;  1C8M 3;  3ILR A;  4XAB A;  1V0A A;  3IN9 A;  4NIA A;  1ZBA 2;  1OOP A;  3POS A;  1W8O A;  4UW5 A;  1ND3 C;  2XQX A;  3Q9O A;  3J4U H;  4QB6 A;  2CWM A;  3GHN A;  2O8O A;  1Q8P A;  5C8C A;  3SKV A;  1PHM A;  4M4P A;  2XDV A;  3AMH A;  3PMS A;  5B4X A;  4JDO A;  4BXS V;  4YVW C;  4QD2 A;  3POJ A;  4MG2 A;  2DBN A;  4QU2 A;  4YAR A;  4N53 B;  3WHU A;  1E5S A;  5E1R A;  4Z07 A;  4CP0 A;  4ZKT B;  1FX5 A;  5HPO A;  4FPC A;  2WZR 1;  1UZW A;  1EV1 1;  1RUE 2;  1O3Q A;  5L19 A;  2BGO A;  4XEZ A;  1WW6 A;  2VW1 A;  4JGY A;  4RS5 C;  4A7K A;  2W1S A;  4LBO A;  4A2U A;  1NXD 1;  3OBR A;  4YGE A;  1DZR A;  5FZ7 A;  2QCS B;  3LEK A;  3UKV A;  1HB3 A;  2BV4 A;  1UMZ A;  3A4U A;  3CJI C;  2HWF 2;  3RG0 A;  1BBT 1;  3PUQ A;  3U07 A;  3USU B;  1YNA A;  4I3G A;  3ZFE A;  5FO8 B;  1VRH 2;  4P02 B;  4MZU A;  1E5I A;  2DVG A;  3AXE A;  3HIF A;  4FPG A;  4QX8 A;  3VGI A;  3POF A;  4YSF A;  1OUX A;  3VKF C;  2YBP A;  3QOP A;  3WQB A;  2GAL A;  1CAX A;  1LOG A;  3MPP G;  4CEY A;  5FZ0 A;  4BDV B;  1NCR B;  3OD4 A;  4AVC A;  3M1H A;  1SFP A;  2ZGR A;  1R08 1;  1ASJ 2;  1PGS A;  5FYC A;  4UAP A;  1YEW A;  3E6D A;  1PX4 A;  2P17 A;  1UYP A;  3BYW A;  1IZ3 A;  5FPA A;  5EZW A;  4BOW A;  1HKD A;  2HWC 3;  3I3Q A;  2W39 A;  1JYC A;  4LHN A;  3KVA A;  5DZF A;  5C8W A;  4DRR A;  4EN0 A;  3AFG A;  1AVB A;  2YPD A;  2BW8 A;  4JV4 A;  4LO7 A;  4XAA A;  1XYP A;  2JEM A;  4NII A;  5FYB A;  3UL2 A;  1SLB A;  1W6Q B;  4QGM A;  2ZMN A;  4YLZ A;  2EIB A;  1ZVF A;  4PDW B;  3M4F A;  2YFZ A;  2GND A;  4LO8 A;  4QQO A;  4TXW A;  3USS A;  1AR8 1;  2ZAA A;  2ERF A;  4XPV A;  1O3S A;  3ZSJ A;  3HR9 A;  1DYP A;  2QFE A;  1QQP 3;  2GC3 A;  2JDY A;  1XE0 A;  1LR5 A;  3T08 A;  4EWA A;  5FPU A;  4AI2 A;  2NM1 A;  1CAU A;  5LRR A;  3LOB A;  3GCX A;  2VBP A;  5JOX A;  2ILM A;  3ZO0 B;  1D0H A;  3MIC A;  2ZCW A;  1X9P A;  1XJA A;  3IZO A;  3KT1 A;  1RUO A;  1PO2 2;  5DUX A;  1XXN A;  3WDV A;  2X53 S;  4LOS A;  3ZR6 A;  1WA6 X;  3ETQ A;  4ISQ A;  5FZM A;  3WP3 A;  4HET A;  1VBB 1;  4M00 A;  4AE2 A;  4CCM A;  4NN0 A;  2VU9 A;  2W87 A;  4MET A;  4YZ5 A;  3NJZ A;  1BJQ A;  1FNY A;  5FZK A;  2DCJ A;  2V72 A;  1US3 A;  1AL2 1;  4BH9 A;  2RS1 1;  4OI0 A;  4BQ2 A;  3K3N A;  3M70 A;  2LW8 A;  2JDA A;  4Q4X 2;  5FZ6 A;  2VVF A;  2FDK A;  2WO1 A;  5GLT A;  4D7S A;  5LK5 A;  3TNP B;  3UKT A;  1Y4W A;  2GU9 A;  1DG6 A;  1KJR A;  2YHJ A;  5FP8 A;  3OY8 A;  2WNU B;  3WUD A;  3ZDV A;  2DTW A;  2RVA A;  3WF2 A;  5FUN A;  4BQW A;  2KD7 A;  1V9U 1;  3K48 A;  5ISL A;  2R07 1;  4KWJ A;  4AQ2 A;  4C1X A;  3NV2 A;  2AEY A;  3APB A;  1KEX A;  1PNG A;  5DDJ 2;  5IYY A;  3I54 A;  2VTX J;  2VMG A;  5I8S A;  3AMN A;  4UF0 A;  3KCX A;  2R04 2;  2CGP A;  4MAD A;  1GR3 A;  1OQD A;  1FOD 2;  4FBF A;  4ZXK A;  4D69 A;  2RJ2 A;  1AX0 A;  1BHG A;  1LEN A;  1QJU 3;  2WUH A;  3Q8F A;  1NE4 A;  1W8H A;  5FO7 B;  1WZX A;  1VB2 A;  1T6G C;  1POV 3;  1ULC A;  3WP6 A;  1Q8S A;  5FPZ A;  3AVR A;  1ULD A;  5J7M A;  1XB9 A;  4XTM A;  4GUL A;  2PAM A;  3IAP A;  2VZQ A;  3ZYH A;  2AEN A;  2VOV A;  5BV6 A;  5K0U C;  1FI2 A;  2BVB A;  5DAQ A;  1OD3 A;  2AC1 A;  1MPX A;  4GD4 A;  2PQS A;  1VBD 3;  3LDB A;  3JB4 C;  1YXW A;  3OGG A;  5IVJ A;  4Q26 A;  1RJ8 A;  3ES4 A;  3ZVX A;  5FPB A;  3RYK A;  5JOZ A;  2Y6L A;  4AED B;  3TBD A;  1URX A;  2LRP A;  4CE8 A;  2WNV A;  2FZ1 A;  4J1X A;  4FP2 A;  1F15 A;  4YG3 A;  4WVM A;  1K5M C;  2OZJ A;  3QLQ A;  3NQH A;  4X8N A;  4PI2 A;  4P9I A;  4QPG C;  5BNO C;  2IC1 A;  1YQ6 A;  2QQU A;  2RDS A;  2JIC A;  1RUI 3;  3AYE A;  4Y5T A;  2JD4 A;  3P6B A;  3WOG A;  3C2U A;  1V6N A;  1HXS 1;  1PIV 3;  2XJQ A;  2A75 A;  1BXH A;  2Y8K A;  1IS4 A;  5EV7 A;  3GDB A;  2HWE 1;  1OKO A;  5GM0 A;  1WLT A;  4NAM A;  4CCN A;  1OVS A;  2A6Z A;  3PLQ A;  3ZM8 A;  1VBC 3;  5KC5 A;  4CDW B;  5FOJ B;  1H4H A;  2ZHM A;  4M01 A;  5FP4 A;  5LK7 B;  1OFS A;  3B94 A;  4Q8L A;  4HL0 A;  2YC4 A;  5D8A C;  2CV6 A;  4LO6 B;  3WDU A;  3X29 B;  4AHZ A;  4C0B A;  3DGT A;  1QJX 1;  1C57 A;  3FMG A;  4OI2 A;  4ONU A;  3RQ0 A;  3T4H B;  4BYY A;  2DUP A;  3VD9 A;  3U75 A;  4IDZ A;  2D7F A;  3DV8 A;  2RS5 3;  5LRS A;  1S0F A;  5C7G A;  1R09 3;  1DGW A;  1H9P A;  3ZFF C;  5BNN C;  5F6L B;  5FAX A;  1QXR A;  2Q0A A;  3POB A;  4Y20 A;  3NJV A;  5KHG A;  4U2A A;  1VR3 A;  3WHT A;  3DYO A;  5A7N A;  4E27 A;  3DCQ A;  4KH9 A;  2PMW B;  1XU2 A;  1QGL A;  2JDN A;  3RVH A;  4AL9 A;  1EPW A;  1RIT A;  3EYP A;  1H1A A;  3J9S A;  1JZ7 A;  1JUI A;  1JN2 P;  1I1E A;  4Q0Q A;  5IVB A;  1LAJ A;  5A32 A;  1UKG A;  3MBW A;  4N7I A;  1JYN A;  1RL3 A;  2BRT A;  4KGQ A;  2VZS A;  1OA2 A;  5FO9 B;  4OLL A;  4Y26 A;  3A22 A;  1E57 A;  1RUJ 1;  4LK7 A;  2JEN A;  3DPR C;  5C3S A;  1F8V A;  4FPY A;  2ZHK A;  2FQP A;  2R30 A;  3GNE A;  2VUL A;  3GBG A;  1SDD B;  4K1Y A;  4F7Z A;  1VMH A;  3PME A;  4LUL A;  1RC6 A;  2X09 A;  1YJL A;  3T0D A;  3O1M A;  1S1A A;  3IDE A;  3MIF A;  3FFQ A;  1D0G A;  1SLA A;  1QJY 2;  1R1A 1;  1UY4 A;  1ND2 B;  3IM0 A;  4HK9 A;  2XH6 A;  1W9F A;  4IV1 C;  4N90 A;  5A33 A;  1C28 A;  2V5D A;  1ZBE 3;  1I6X A;  3KMH A;  3RZK A;  1PM4 A;  4P00 B;  5LY1 A;  3GCW A;  4M0N A;  3P3N A;  4WM7 C;  3VHP A;  1XYO A;  4RGA A;  3I2D A;  1K12 A;  4MYE A;  3SIS A;  1E5H A;  2O8Q A;  1J1T A;  3I4I A;  4PT6 A;  2D93 A;  2JEC A;  1OH3 A;  2Q1F A;  1ND3 A;  2XJS A;  1ZRE A;  2XJT A;  2D6M A;  1F35 A;  2ZGN A;  2VNG A;  5SV8 A;  2Z79 A;  4UFI A;  3U78 A;  2B8M A;  1COV 2;  5EJ3 A;  3VB9 A;  2YV8 A;  2XVG A;  4P9G A;  3AZZ A;  3LDR A;  4YVW A;  5F3G A;  1W8F A;  2XXZ A;  4DS0 A;  5HV0 A;  4AI1 A;  1RUC 3;  3O0X A;  3VBF C;  1SBF A;  3I3B A;  1HW5 A;  2AUY A;  2DTY A;  3VBU B;  4N9H A;  2XBO 3;  4OQ9 A;  3VBR B;  4BQY A;  1PMI A;  2O14 A;  4HPK A;  1CD3 G;  1CON A;  4GMP 0;  1K5M B;  3HT1 A;  4P5Y A;  5LA9 A;  2E7T A;  4I02 A;  2O1Q A;  1LOF C;  1YI9 A;  1JH5 A;  4JRA A;  4RS5 A;  5FLI A;  5JI9 A;  1VMJ A;  2YGL A;  3GAL A;  4TLG A;  1KS5 A;  2RDR A;  1OT5 A;  2WLP A;  1QQP 1;  4OUM A;  4P14 A;  3POW A;  5T3N A;  2J1U A;  1PZ7 A;  2RR1 3;  3WNL A;  3CJI A;  2HEY F;  2W92 A;  4COW A;  4CYD A;  4DUW A;  1W8T A;  2GNB A;  2WO7 A;  3T1L A;  5EPA A;  2EAL A;  5IUQ A;  4F3J A;  2HWB 3;  3ALQ A;  4RN5 A;  4RR3 B;  4BA6 A;  4ZON A;  5A3L A;  1HJG A;  2IVJ A;  2ARE A;  3VZO A;  1HDK A;  4XCA A;  4QX7 A;  4D7T A;  4CEW C;  3B93 A;  3RZH A;  3UJQ A;  2FZ2 A;  2WAB A;  4NRM A;  2VZP A;  3OGJ A;  3BKZ A;  2WZR 2;  4WVZ A;  5FXW A;  1EV1 2;  5A7P A;  4MXW A;  2F4L A;  3AKS A;  1RUH 1;  3CHX A;  1CX4 A;  4XUQ A;  5FXZ A;  2DCZ A;  2WLQ A;  4JX0 A;  5EYY A;  4EN9 B;  1YFY A;  2ZBJ A;  2XJR A;  3N7L A;  4J25 A;  4AWD A;  3O1S A;  1JOP A;  1W9Y A;  3TOJ A;  4Y22 A;  5EQU A;  4UFH A;  1BBT 2;  4KU7 A;  3NMB A;  4Q4W 2;  4N9I A;  4H7M A;  1TEI A;  4EZH A;  1U12 A;  5HXM A;  3TB0 A;  1OLM A;  2DVD A;  2ZGQ A;  5FJH A;  2BVV A;  1ZZ6 A;  3O1U A;  2VUJ A;  5DUW A;  3RNS A;  2V73 A;  1R08 2;  2SBA A;  2D40 A;  1H9W A;  4IL7 A;  3VKN A;  2ZTN A;  1Y9Q A;  3BPS A;  2E32 A;  3I3D A;  3LIH A;  3PDQ A;  5F3C A;  3CL1 A;  5F5I A;  4BQ1 A;  4IE7 A;  4HSL A;  1AR6 3;  2D6N A;  4QKD A;  4YRD A;  4AFC A;  5IJR A;  4HSJ A;  1POV 1;  4CDQ B;  5IVV A;  4RA0 A;  4A3Z A;  1MEC 3;  2WR9 A;  1RUG 3;  3S0M A;  4L97 A;  2E7A A;  3DEM A;  3J7H A;  1QXJ A;  3R0R A;  5I0D A;  1O3T A;  1O6U A;  5F3E A;  1G6N A;  2P1B A;  1AR8 2;  1VBD 1;  1XSQ A;  4LKF A;  3GBW A;  3TEZ A;  5C5U A;  2Q1Z B;  1Y3T A;  4DFS A;  5CAZ A;  4NHL A;  3PVO A;  5DMY A;  3R4D B;  4XMI A;  3ZXA C;  4DB5 A;  3IAQ A;  2WFF 2;  4RYD A;  3T30 A;  3ETP A;  4BQ5 A;  2ZEY A;  5LCW L;  4LBM A;  5FJK A;  4CU9 A;  4FSJ A;  1DQ4 A;  4XQ4 A;  2IZW A;  2JE8 A;  1LHW A;  1W3V A;  5C4W C;  3WP5 A;  2WT2 A;  1VBB 2;  2Y26 A;  1RUI 1;  3ZYB A;  1DYK A;  1RVF 2;  3FFZ A;  3A21 A;  3HPN A;  4FAH A;  3SMH A;  4Q4V 3;  3W20 A;  5GZD A;  4Y5Z 0;  1QDO A;  4QPW A;  1AL2 2;  2ET7 A;  2RS1 2;  3FL7 A;  5LAS A;  1WMD A;  4TYS A;  4HZF A;  3WF4 A;  1G9F A;  2GMM A;  3VDB A;  1XYN A;  2YGM A;  2VUA A;  1SFY A;  2W2I A;  4FOV A;  4CSW A;  1RUE 1;  4P5H A;  5K0U A;  1X8M A;  1W2T A;  1JU3 A;  1V9U 2;  1MZF A;  2ZKL A;  3C7O A;  3I97 A;  5DAW A;  1JZ4 A;  3NNL A;  5G05 L;  4HT1 T;  2R07 2;  2GP3 A;  1ZRD A;  2RS5 1;  1SLC A;  1OOP C;  5GJ6 A;  4QGL A;  1H8T A;  4LE3 A;  4Q5O A;  5FMO S;  2JKX A;  3ON7 A;  4SBV A;  4Q8K A;  1OF4 A;  2XWB B;  3MIH A;  4LO5 B;  2HWF 1;  3I2K A;  5EYX A;  3M7A A;  1CAV A;  1VRH 1;  4IE0 A;  2BBA A;  2IVI B;  1ZZ7 A;  1W28 A;  4PIY A;  1V00 A;  1IKQ A;  2KM2 A;  1S0D A;  1AX1 A;  1PK6 C;  4DQA A;  3C7H A;  5FUI A;  4QQH A;  2OXB A;  4QPG A;  3S5Q A;  3C3V A;  4WVV A;  4CP9 B;  3WNN A;  1C1F A;  1FMD 2;  2BFU L;  2XUM A;  2YZ4 A;  5F39 A;  4AR2 A;  2BWC A;  4EN8 B;  1LOC A;  1OBN A;  2I2S A;  2RS3 3;  3L9J T;  3W59 A;  5T5O A;  1JZ6 A;  5FZ3 A;  3OD0 A;  3NST A;  3VUO A;  5ANN A;  3N36 A;  1C8N A;  1CVN A;  3CNA A;  5D8A A;  2E51 A;  2F4P A;  1POQ A;  1U5Z A;  4MV2 A;  1H2M A;  5EP9 A;  1QKQ A;  2QTW B;  3MIB A;  3E1F 1;  3QH7 A;  4XHX A;  4MGK E;  2UY8 A;  4GJY A;  3RJ2 X;  4DY3 A;  5CFD C;  4JDM A;  3ZXK A;  1W9S A;  2A6X A;  3ABZ A;  1ZYB A;  1ZRI A;  3ZFF A;  2R1B A;  2VMF A;  4JGZ C;  5BNN A;  4YWA A;  4FFF A;  5F37 A;  1GOG A;  1VB4 A;  4FT8 A;  3M3O A;  3RYP A;  4BXF A;  3ZXF A;  3AK0 A;  1ZX5 A;  3AZW A;  4JKK A;  4F8A A;  1OLM E;  1HXS 2;  4UOJ A;  1U5I A;  4D6Q A;  2HWE 2;  4ERO A;  3JBG 1;  2E33 A;  1RJ7 A;  3OSD A;  3PUH A;  3S6P A;  1IG0 A;  1AR9 3;  1OQ1 A;  5CA6 A;  1AYM 3;  2JDZ A;  1XNT A;  3ZFG C;  3RPQ A;  3NKT A;  3VHR A;  1EYB A;  1QJX 2;  3RDI A;  3LE0 A;  4CTE A;  3V0A A;  3QH6 A;  3DPR A;  4RQP B;  1PNF A;  4Q4X 1;  3RWN A;  4GB3 3;  5CKN A;  4GIQ A;  3IPV B;  4UT5 A;  2W52 A;  3ZXE A;  2W94 A;  3DL3 A;  3LA3 A;  1OUR A;  4CP2 A;  1S0B A;  1NE6 A;  1NCQ A;  4H55 A;  2YC2 A;  3WG2 A;  1JYX A;  5LEJ A;  1HRI 3;  2GME A;  3NAP B;  1UU6 A;  4IES A;  1C8M 2;  2VZ3 A;  2WA4 A;  4DXZ A;  2DCK A;  2ZGS A;  1H2L A;  1WLD A;  1FYU A;  1OKQ A;  1WLC A;  2DUO A;  2RR1 1;  2VNV A;  1W6P B;  3I3E A;  3JD7 1;  3NVC A;  3MV0 1;  4YZ2 A;  5AFE A;  1QJZ A;  1W6M B;  3OCP A;  1WLW A;  5EIY B;  4DEV A;  3ZMN A;  5L7O C;  4ISR A;  3NNG A;  2BBV A;  4YM0 A;  1HX6 A;  5GLV A;  1RUJ 2;  5IT6 A;  5T52 A;  4DUV A;  2VCA A;  3AM2 A;  4AFM A;  4HVQ A;  1UYX A;  3LFI A;  3SH5 A;  4IEP A;  1NQD A;  2X5I C;  4R9C A;  4OVE A;  5FQ0 B;  1WBL A;  2I74 A;  3I59 A;  5FLJ A;  3THP A;  1JUH A;  4AQ6 A;  4E4S A;  2J1V A;  2P37 A;  3O1T A;  3VBF A;  3W5N A;  3ILF A;  3NV3 A;  5C8C B;  4O9G A;  4COU A;  2QQO A;  4MGY E;  4OHW A;  3AXD A;  4B1L A;  4ET7 A;  1C4R A;  2E31 A;  2P3I A;  5CYY A;  1JZ2 A;  1OUS A;  3E5X A;  1CIW A;  1UNB A;  2RM2 3;  3T09 A;  2DBI A;  3DKQ A;  1RUD 3;  1JXN A;  1MS8 A;  1UW8 A;  3H3L A;  4LHL A;  5FRA A;  4WZF A;  3ATG A;  4S2F A;  2RDQ A;  1UIJ A;  5CU1 A;  1UY2 A;  5FZG A;  2Z42 A;  4JGY B;  4NWW A;  4AOC A;  1A78 A;  5IVC A;  3HQU A;  1X7N A;  2HWC 2;  3CIH A;  4BK4 A;  1CN1 A;  1AR6 1;  1U5Y A;  3J7M A;  3VBS A;  1STM A;  3GXU A;  4IEZ A;  3ZFE B;  1UO9 A;  4CEW A;  1KGY A;  1MEC 1;  2L9L A;  1RUG 1;  4R9A A;  4MX3 A;  1MZ6 A;  4XUO A;  2VL4 A;  3ACF A;  2CGO A;  3S57 A;  3ZR5 A;  1BVV A;  4CEY B;  2XL7 A;  4IEO A;  2WA3 A;  1BYH A;  1L7Q A;  1GWM A;  2JG8 C;  1YQ5 A;  3DUI A;  4YM1 A;  3RI9 A;  3MW2 A;  1QQP 2;  1WCQ A;  4XJZ A;  4DO0 A;  2VMH A;  1P8J A;  4UFM A;  3MGU A;  4W6X A;  1AF9 A;  1O8P A;  2HEV F;  4AAX A;  3BTA A;  4LBQ A;  2NQY A;  3TYJ A;  5BNQ A;  1WCD J;  5IFT A;  3V65 A;  4YGB A;  4M0H A;  3MFC A;  1PGW 1;  5FY8 A;  3HNY M;  2VPV A;  2OX0 A;  3K46 A;  4LO4 B;  3P5B A;  1JYI A;  1DLC A;  4AXO A;  3E97 A;  1IQD C;  2IWG B;  2WWS A;  3T2T A;  3SQO A;  5JSO A;  4Q4V 1;  3W21 A;  2AR6 A;  2A70 A;  2CSG A;  3RSJ A;  2O0O A;  4CPB A;  1LEM A;  2HBU A;  2I45 A;  2RHP A;  1L3J A;  2VG9 A;  1QU0 A;  4FOY A;  1TQ5 A;  4COY A;  1BLZ A;  4MHU A;  2JKB A;  4RL7 A;  3WQ7 A;  2B9V A;  1AHS A;  4XFG A;  3SIT A;  2Q1M A;  1UXX X;  4CXY A;  1W0P A;  1AXK A;  2VOW A;  2VCC A;  5FXX A;  1QHD A;  4A6O A;  4NHK A;  4CXX A;  4UW4 A;  2K0G A;  4IV3 B;  3T2Q A;  3V56 A;  5IK5 A;  1WWY A;  2WII B;  2GH2 A;  1OSG A;  4KU8 A;  4OMC A;  5D2A A;  5T5L A;  3AFK A;  4ASL A;  1EAH 3;  3ZYF A;  3UGF A;  3WW3 A;  2KR2 A;  2A1X A;  1FNZ A;  1O59 A;  2DUR A;  1GKB A;  3OY8 B;  4N43 C;  5C4W A;  1RUN A;  2P5B A;  3H3U A;  3VHN A;  4BLI A;  4CP1 A;  2WC2 A;  4YM3 A;  1COV 1;  3B9C A;  2WYF A;  3HMY A;  1UY1 A;  3T0B A;  2UYA A;  4ITC A;  1J3Q A;  2CAU A;  2RS3 1;  2WZ8 A;  3AZV A;  1GOF A;  1VBD 2;  5F5C A;  1ZZ8 A;  2NLR A;  2XHN A;  4ZS3 A;  2PLV 3;  4Y1U A;  3BOP A;  4UF0 B;  3T0A A;  2BGP A;  5FWJ A;  4XUT A;  2VNO A;  1BK0 A;  1N1V A;  4QX0 A;  5TSW A;  3VN4 A;  3OGV A;  2OPW A;  3OUI A;  4COZ A;  4CPB D;  3M3Q A;  2YG0 A;  4E4D X;  1GAN A;  1HV1 A;  1QJE A;  3TN9 2;  2XLF A;  1UCX A;  1GFF 2;  1UYZ A;  2B46 X;  5E88 A;  3V0B A;  2SLI A;  3OB8 A;  3E6C C;  5A3P A;  2VY0 A;  3SXW A;  4AI0 A;  1RUI 2;  3HWJ A;  1RMU 3;  3TN9 3;  3MID A;  2VZV A;  1MVE A;  1S0C A;  1BQP A;  2BU9 A;  4XJA A;  1IPK A;  1UWW A;  1PK6 A;  3FUQ A;  3VDD C;  1UL9 A;  5C9A C;  5A3M A;  4H2A A;  2WQ8 A;  4BHP A;  1VBC 2;  4PBP A;  4B4R A;  1GP4 A;  2R06 1;  2WNV B;  3O7O A;  1S0I A;  3HBZ A;  2FCU A;  3MLL A;  3N7J A;  4WVM B;  2RMU 3;  2FCV A;  4NPR A;  5A6X A;  1TG7 A;  2JX9 A;  3CMG A;  4NHY A;  1SLT A;  1OA3 A;  1RIN A;  2VZO A;  4J1W A;  1J83 A;  1LOE A;  2A73 B;  2RS5 2;  3WIN E;  1DCS A;  1R09 2;  1RB8 G;  1OQE A;  1SLL A;  2NMO A;  2ZX0 A;  2Q5T A;  4HK8 A;  2B4K A;  3RMY A;  1HRI 1;  1DGW X;  3D3A A;  1GBG A;  2D3S A;  4IEU A;  4L11 A;  4Y5S A;  4Q4W 1;  5E16 A;  2CL2 A;  2R16 A;  4X6Q B;  1LUL A;  5H9P A;  2ARA A;  5CFD A;  3ZIX A;  2XG3 A;  1VAL A;  2VQT A;  3I7D A;  4JGZ A;  5FBZ A;  3WY6 A;  2NZ9 A;  2BER A;  4OUS A;  4QHB A;  2ADD A;  2GSY A;  2QQI A;  2V4A A;  4QPI C;  2IFW A;  2C1F A;  3O14 A;  1VBE 3;  4ZZ5 A;  4FPJ A;  4W65 A;  3ZKY A;  3RZZ A;  5FZE A;  2WYS A;  2CTV A;  1VLN A;  4FP3 A;  2QE3 A;  2QZ2 A;  4Y20 B;  4W6Y A;  1DHK B;  2ES3 A;  2WN2 A;  1H4G A;  4ZU7 A;  2GC2 A;  2GNT A;  1GYK A;  3ACH A;  3PUI A;  4PLO A;  4PQQ A;  4YVS B;  5GZE A;  1CIY A;  4AVS A;  4Q4Y 3;  4WV8 A;  3ZFG A;  4XQD A;  1S0G A;  3LQC A;  1LGB A;  3O1P A;  4AAP A;  5J36 A;  5IAT A;  2D6O X;  3LAG A;  4CCC A;  5JMO A;  5A32 B;  4AHW A;  3ZYI B;  2WFF 1;  4LLO A;  3WEZ A;  1XNC A;  2W68 A;  4KG8 A;  3N9L A;  5FKC A;  4DRV A;  1O7F A;  2LS6 A;  2H0V A;  2NPI A;  2RM2 1;  1ZZB A;  3INA A;  1RUD 1;  4XAE A;  2WS9 3;  1CPM A;  1UPI A;  1YRZ A;  3GJB A;  3JBG 2;  1SBE A;  3RWK X;  1YCI A;  4NWV A;  4JQR A;  1RVF 1;  4OMD A;  4LNV A;  4QPY A;  4RHV 3;  5CB7 A;  2E7Q A;  1H1M A;  2JB8 A;  5A33 B;  3P3P A;  4O7X A;  5L7O A;  2CDO A;  2DVB A;  2PQQ A;  3KF3 A;  5CKM A;  4YYO A;  2WQZ C;  3WUC A;  4IEV A;  2HJI A;  5A3O A;  4FVV A;  4A3X A;  2NP0 A;  1AUY A;  4XF0 A;  5JMC A;  2X5I A;  2XBO 2;  3C7F A;  4B4Q A;  2A71 A;  3IMN A;  4AEM A;  1KD7 A;  3LSD A;  4QQL A;  4AEK A;  4DNY A;  1UU4 A;  1N1S A;  1ND3 B;  3FZ3 A;  2XVL A;  4C0H A;  4A4A A;  1TNF A;  1XRU A;  2VVE A;  1F5F A;  5FZ4 A;  3OUJ A;  5A7W A;  2ET1 A;  3UV9 A;  5CNA A;  3ZYR A;  2FDF A;  4HMZ A;  3N9P A;  1D4M 3;  2FMY A;  5SV5 A;  1ZNP A;  2BDR A;  4NRQ A;  1NZI A;  2RR1 2;  5H9R A;  3SCF A;  4QXC A;  3WW4 A;  4CDU C;  5CAD A;  2QBX A;  3JD7 2;  4YVW B;  1SPP A;  2HBT A;  2QDN A;  3III A;  4IET A;  1AYN 3;  1CZV A;  1FPN 3;  1HN0 A;  3D6E A;  4QAW A;  3TWI A;  4AGR A;  2WT0 A;  2HWB 2;  2PHF A;  5FY9 A;  1DDL A;  1QNY A;  1LOB A;  1K42 A;  1V6M A;  1TME 1;  1QY4 A;  4S2D A;  4D6R A;  4HPK B;  3NRU A;  1IHM A;  2JDK A;  2XOM A;  1ALY A;  2OZ6 A;  4KNC A;  4RS5 B;  1UN1 A;  1FMD 1;  3OTF A;  4UFL A;  3HT2 A;  5L36 A;  3H8U A;  2QZ3 A;  3GF6 A;  3KT7 A;  3I2O A;  3S5A A;  1QOO A;  3EJK A;  2ZAB A;  5C6C A;  1VP6 A;  3CJI B;  4AVA A;  4BME A;  1LHO A;  2FMD A;  4IE6 A;  4BB3 A;  5BUV A;  3H0O A;  1H8T C;  4E8D A;  2GZW A;  1GQH A;  2R7E B;  4QMA A;  3IB3 A;  4XIL A;  2Z5W A;  3VZK A;  2LUW A;  4SLI A;  1PVC 3;  3ZYJ B;  4W4Z A;  4I0W B;  4O65 A;  4L8Q A;  3WNK A;  4LA2 A;  2GC1 A;  2JG8 A;  1UOF A;  2PAK A;  4WM8 C;  3UNP A;  5IVY A;  1AZD A;  4ARY A;  2A6W A;  5FY7 A;  3N9Q A;  5CBL A;  1UY3 A;  4MXW B;  3FLR A;  5ABJ C;  3OEA A;  1EAH 1;  4JHZ A;  2PHR A;  1F4H A;  2PHT A;  2RJL A;  4Y24 A;  1RUF 3;  3KV6 A;  5LY2 A;  4AW7 A;  1XND A;  4PBO A;  4Y22 B;  1AR6 2;  2VVD A;  1QEX A;  5A6Z A;  2EID A;  3KHB A;  4XUR A;  3R6S A;  1CZT A;  3EO6 A;  1MEC 2;  1RUG 2;  1C5I A;  1YIP A;  4L0P A;  4E2S A;  3WD5 A;  3I8T A;  3T1M A;  5FCC A;  5FZ1 A;  1DLL A;  3HQR A;  4FTS A;  3AP9 A;  3ACI A;  2PLV 1;  3MYX A;  1FV2 A;  1PGL 1;  2D6L X;  5FZD A;  1J84 A;  2JG9 C;  5FZO A;  2ORZ A;  3GJA A;  4R4Z A;  5F5A A;  1V6O A;  2YB7 A;  3A23 A;  2R0F A;  1C8M 1;  3K2O A;  4LKE A;  5JOY A;  1RED A;  5GAL A;  4ZHN A;  3BIE A;  1LGC A;  1JYT A;  1PGW 2;  5FMO L;  5BPX A;  3ZOI A;  1WCS A;  1YI7 A;  3C8X A;  1NCR A;  3J8F 3;  4TTG A;  2WQ4 A;  1RMU 1;  3TN9 1;  3UGH A;  4CCL A;  4MOA A;  4Q4V 2;  3OPZ A;  1WW5 A;  4JC1 A;  2UYB A;  5IAV A;  1MS5 A;  4Y4R A;  5FFO C;  2XKO A;  1W9W A;  4GMP 3;  4JDN A;  3W58 A;  4AZZ A;  4N43 A;  3FLP A;  4CXW A;  2B7Y A;  1QIQ A;  2R1D A;  1D2Q A;  4UI9 L;  5F2S A;  3OEB A;  4UFK A;  3H1W A;  4FPO B;  3UYJ A;  3KGL A;  3FC0 A;  1NCQ C;  1BVP 1;  1BZW A;  2RG4 A;  5DAP A;  3OF1 A;  1VAV A;  2PHD A;  1SQ4 A;  3POI A;  4Y1V A;  5BNP C;  4EJR A;  2C5D A;  1BEV 3;  2VME A;  3ASI A;  3OBZ A;  3AP5 A;  5FK7 A;  5FPX A;  5I0U A;  2WBK A;  1SLI A;  2GN7 A;  2VZ1 A;  1ASJ 3;  2VUC A;  2VW2 A;  1A34 A;  1YIF A;  2VC9 A;  4AVV A;  4YFW A;  4YPJ A;  1ENR A;  4F83 A;  1O5L A;  3OPT A;  5LBC A;  4UWD A;  4XMA A;  3W5M A;  1PX3 A;  2PHU A;  5HCB A;  1O4Y A;  4TLF A;  5CFC C;  2CAV A;  4M3C A;  3ZPY A;  3AP7 A;  1JZ3 A;  4LE4 A;  3RS6 A;  1B09 A;  3AC0 A;  1O91 A;  2NMN A;  2BP6 A;  5JIA A;  5LA0 A;  1SHW B;  2IUW A;  3KD4 A;  5K0U B;  4QHZ A;  2EXJ A;  4LXL A;  3ACG A;  2PXJ A;  4HXC A;  2DV9 A;  3WNX A;  2BNO A;  5FY1 A;  3D82 A;  1YQ8 A;  4FCA A;  1Q8Q A;  3WQ1 A;  3ITQ A;  2HWC 1;  2YU1 A;  3VDD A;  2RS3 2;  3N7K A;  3MUZ 1;  4B4P A;  2D5F A;  1QNW A;  1ZZC A;  5C9A A;  2W08 A;  5D21 A;  2FDH A;  3URF A;  2P34 A;  3RGB A;  3JUU A;  1CAV B;  2BOI A;  3VD3 A;  4YW5 A;  4QGN A;  5FYI A;  1K3I A;  2RE9 A;  2VOK A;  5DZG A;  5JWP A;  1S2E A;  5JZG C;  1W6O A;  2OPK A;  5AVA A;  3I2F A;  5KHI A;  1Y43 B;  2V4V A;  4QPG B;  5BNO B;  2YC0 A;  1TE1 B;  1PMJ X;  2WAA A;  4XUN A;  2VAU A;  2ZAC A;  2Y6H A;  2A5Z A;  1KQR A;  3J7N A;  4OHX A;  1REF A;  4XW3 A;  4XYX A;  3S30 A;  5JXG A;  4MH0 E;  1NT0 A;  2ZEX A;  1IGO A;  3TAY A;  2QQK A;  2IXL A;  2Y6G A;  3EMR A;  2WS9 1;  5F32 A;  4E2Q A;  1YLL A;  5LEK A;  2P2K A;  4TN7 A;  5D8A B;  3ZSE A;  3VBS C;  3QD6 A;  5H9Q A;  2HWD 3;  2IFR A;  5I8Y A;  5KBF A;  4QPI A;  4URA A;  4FXK B;  2R06 2;  1Q3E A;  1AYM 2;  4P9W A;  5C33 A;  2X29 A;  4FPE A;  3ZFF B;  5BNN B;  4TSV A;  3OPW A;  4Z1V A;  2QVS B;  3CZU A;  1CR7 A;  3AJZ A;  5KHJ A;  1LHU A;  1XE7 A;  2ID4 A;  1NLR A;  5F9T A;  3T2O A;  1FOD 3;  1HRI 2;  2D3P A;  2ZKN A;  2MHF A;  4K40 A;  2C0Z A;  2F6B A;  2OA2 A;  2WSU A;  3BN6 A;  4QM8 A;  5FP3 A;  3VZJ A;  1DQ1 A;  1PZ8 A;  2HYX A;  4NPM A;  4JQT A;  1UX6 A;  2PAE A;  2A7A A;  2Y38 A;  3A7Q A;  2JE9 A;  1B35 C;  1Y9G A;  1PVX A;  3J26 N;  3N3H A;  2XLA A;  3V0A B;  3DPR B;  4IGO A;  1IQA A;  3AKT A;  3VBH C;  1ZA7 A;  2ZGT A;  5T55 A;  5AFB A;  3THD A;  3T3Y A;  1CZS A;  1UPS A;  4HKW A;  2ENR A;  4PI0 A;  1QJU 1;  3WNO A;  5LA1 A;  4MO3 M;  1GZC A;  1UZ0 A;  3HJR A;  2ZGU A;  1GWL A;  3VBO C;  1XU1 A;  1NA1 C;  2D5H A;  4XCB A;  4IV1 B;  4ATE A;  2UWC A;  1DGR A;  2OUH A;  4XIO A;  3ST7 A;  5IK7 A;  1UX7 A;  2KA3 A;  3GZA A;  1W8N A;  4XZP A;  4WM7 B;  5GKA C;  3MLJ A;  5LBB A;  1GP6 A;  2YFU A;  4DXT A;  3V64 A;  3A0N A;  4L99 A;  4IEY A;  4Z2A A;  2VXR A;  4KQ7 A;  3A0K A;  4QQ2 A;  4WVW A;  5EXO A;  1NLS A;  2QQM A;  3LF7 A;  4XDQ A;  1NX9 A;  3W9A A;  2EIE A;  1PVC 1;  2EAK A;  1HRV 3;  2RM2 2;  4CCD A;  2W47 A;  3UT0 A;  1RUD 2;  2ZX3 A;  4IND A;  2WDB A;  3SKJ E;  2VM9 A;  4I01 A;  3MZH A;  3I59 B;  5FP9 A;  4CDU A;  2YYO A;  4JTO A;  4RFR B;  4B1M A;  4UBH A;  2IXK A;  4M3C E;  1VRB A;  1F9K A;  3VBF B;  1PIV 1;  2EVX A;  4P9Y A;  1Q8V A;  1RUF 1;  1UMH A;  5DAB A;  4EV0 A;  1PO1 3;  2XR4 A;  3NW4 A;  4LBK A;  4L92 A;  5JVV A;  4GH4 C;  1NLQ A;  4XFB A;  4ZU4 A;  3S7E A;  1VBC 1;  1OMI A;  1MQT C;  3ZN6 A;  3MIE A;  3FBM A;  1J3R A;  4K20 A;  1QXP A;  1WME A;  3I2H A;  4FPK A;  1QOT A;  5FUP A;  5FZI A;  4O61 A;  1DGL A;  5HCH A;  1V6J A;  2PA7 A;  3FBY A;  3VD5 A;  4GZ9 A;  2J1R A;  2YY1 A;  4XHB A;  1ND2 A;  5JUV A;  4A41 A;  3BIW E;  1R09 1;  3H9A A;  1QH6 A;  3O12 A;  1ZA4 A;  4PQ9 A;  1UD1 A;  2VJX A;  4XF3 A;  1APN A;  2QQJ A;  3U4X A;  4DXR A;  3ES1 A;  4CEW B;  2ZGL A;  5FYZ A;  3TEW A;  4WM8 A;  3WG1 A;  2R6Q A;  4YW1 A;  1TME 2;  3N7M A;  4LPL A;  1NKG A;  3WF0 A;  3J8F 1;  2DWR A;  4QB2 A;  1N3O A;  2CYF A;  1O3R A;  5ABJ A;  3QBQ A;  3AZX A;  3IT8 A;  5FZ9 A;  3CKH A;  3M2M A;  1X82 A;  5T5J A;  3WP4 A;  4BQX A;  4NE9 A;  2ZML A;  5EHD A;  2W5F A;  4GMP 1;  5BY5 A;  1ODM A;  3PTR B;  4HBN A;  1WMF A;  2K46 A;  2ZHL A;  3CF6 E;  1JHJ A;  1W04 A;  4LBQ B;  3VBU A;  2JJ6 A;  3CO2 A;  4W50 A;  5CZK A;  1OPO A;  4V2W A;  3RZM A;  5DAX A;  1IKP A;  3HOB A;  2JDH A;  1BEV 1;  3VV1 A;  1UY0 A;  1WW7 A;  1FT9 A;  4K1Z A;  3I2J A;  3WXP A;  1JYV A;  1ZBE 1;  1I5Z A;  3NV1 A;  4QXH A;  1DU3 D;  4P08 A;  4IW3 A;  2TEP A;  2R0H A;  3N9O A;  4QX1 A;  2JG9 A;  3ZSL A;  4XFC A;  1PM7 A;  3HD8 B;  1S4C A;  5F3I A;  5KXD A;  4D94 A;  4QXB A;  3EXU A;  5J09 A;  5GLU A;  2BGC A;  1EAH 2;  1TZO A;  1V6I A;  4WZC A;  3VD7 A;  4GAZ A;  2Z69 A;  4NRP A;  4AYU A;  2EXK A;  1KDK A;  4N8M A;  4AQT A;  1YYN A;  4I0A A;  2D43 A;  2C4X A;  3I2G A;  1GU3 A;  1VBA 3;  1I5P A;  3O1O A;  3RZL A;  4LKS A;  2VEC A;  3LWC A;  5FMC A;  3RZJ A;  1MS0 A;  4QDQ A;  3T4V A;  3ZSM A;  3E5Q A;  3JB8 A;  4TWT A;  1G9D A;  2VQA A;  1RUC 1;  1RTV A;  1J1L A;  4K3U A;  5E89 A;  4NHX A;  2EXI A;  2PLV 2;  3IIA A;  4LKD A;  1WKY A;  4YGC A;  2XBO 1;  1MS3 A;  4MGS A;  3WZ1 A;  1PGL 2;  4P9X A;  3ACL A;  1JTZ X;  3B9I A;  4AVT A;  1H8V A;  3OOX A;  5BNP A;  4IQP A;  5A70 A;  3BGA A;  2XPJ A;  4LBN A;  1NQJ A;  1W06 A;  1DFQ A;  1XNA A;  2C9K A;  2VOT A;  2XVK A;  4DIN B;  5C4W B;  3H3Z A;  1TMF 3;  1O8S A;  1LU2 A;  2FCT A;  2JDU A;  2MEV 3;  4Q0S A;  1LU1 A;  1CJP A;  4DIQ A;  1IS6 A;  2WZR 3;  3MW3 A;  2JIJ A;  1C5H A;  1RMU 2;  1W2U A;  1Z78 A;  2B5H A;  2DF7 A;  3B02 A;  3RJR A;  3CJX A;  3KB5 A;  2HWB 1;  5A80 A;  5CFC A;  2WRA A;  3LPF A;  5FY0 A;  1DP0 A;  4XZU G;  5A6Q A;  2W0X A;  2WAO A;  2ZS6 B;  5BXX A;  2VBD A;  2BNM A;  4XFH A;  4GQ7 A;  3JQX A;  2XWJ B;  2XML A;  1BBT 3;  5DG1 A;  2Q8D A;  4COV A;  5DUU A;  2A6Y A;  4RSU A;  1OOP B;  1QH7 A;  2YDE A;  1HN1 A;  1RYY A;  1NOV A;  1ONA A;  2YPJ A;  4Q0U A;  4FAG A;  3LZZ A;  2UWA A;  4N7U A;  4A42 A;  5JR7 B;  4XFI A;  4Z82 A;  3HNM A;  2A3Y A;  2BZD A;  5HCA A;  4RGG A;  4CVU A;  1I9R A;  4K6B A;  1PK6 B;  3G6J B;  4LUM A;  4XBQ A;  4PF5 A;  5AC9 3;  5JZG A;  4E2G A;  4KI5 M;  2E6V A;  1GP5 A;  1GV9 A;  1JI6 A;  3LGR A;  3PJY A;  5IK8 A;  2DCT A;  2WIN B;  1IS5 A;  4PIZ A;  1H0B A;  5CVR A;  4V1P A;  1G8W A;  4GKX A;  3OGR A;  4OUL A;  1UXZ A;  5A3U A;  1L7R A;  2CWS A;  2NYY A;  3VL9 A;  4AHY A;  5JXJ A;  4D7Y A;  4LIT A;  4AGV A;  1X8E A;  4W8J A;  4EN7 B;  3VKL A;  5CFD B;  3WVJ A;  2ZPX A;  1YFW A;  4PLM A;  4Q4Y 2;  5LZ6 A;  3ZYG A;  1YUD A;  4Y33 A;  4JGZ B;  1CAX B;  3JZV A;  4CDX C;  2KXL A;  5EWS A;  5FZL A;  3FUO A;  1OVP A;  5GLZ A;  1V6L A;  1VBB 3;  4J6G A;  3FN9 A;  3U1X A;  1OHF A;  2VZU A;  1MVQ A;  3B01 A;  4IE5 A;  4L9B A;  1V70 A;  5JI7 A;  3WDX A;  3D5O A;  4FOW A;  2FDG A;  2OQ6 A;  2RS1 3;  1HRV 1;  2W1U A;  2Z2S B;  3BB6 A;  4YW4 A;  2C6S A;  2JB4 A;  1CJD A;  4BZ4 A;  2WS9 2;  5HBA A;  1B35 A;  3MPB A;  5E8A A;  2PTM A;  5FLH A;  4DEQ A;  3ZFG B;  1RXG A;  1LJ7 A;  1LED A;  1LRH A;  2PN5 A;  2V5Y A;  4N53 C;  3M8L A;  3VBH A;  1V9U 3;  3L2Y A;  1NY7 2;  4QDS A;  4LBQ D;  3PL0 A;  5KXC A;  1F5J A;  4QU1 A;  3TEY A;  1F2N A;  3O1R A;  4KBB A;  5DZE A;  3IWZ A;  5FV3 A;  1LGN A;  5FPV A;  5IK4 A;  3VBO A;  1CAU B;  2OUJ A;  4ES8 A;  1W8Z A;  1NA1 A;  2VUD A;  3KV4 A;  4P9J A;  3WCR A;  1LES A;  4YNI A;  2WNO A;  1KS4 A;  3JCI A;  2JD9 A;  1AXZ A;  2UUR A;  1CPN A;  3DEC A;  4FFG A;  3BU0 A;  4K9S A;  4GKY A;  1IOA A;  4ZXE A;  1ULP A;  2UWB A;  3BOW A;  3O5S A;  4FPH A;  4OHZ A;  4AK3 A;  1W6N A;  2VD7 A;  1VMF A;  5L7O B;  4S2G A;  3MFA A;  3WDY A;  1QMJ A;  5DN2 A;  1KXG A;  3WSO A;  1NCR C;  3FX3 A;  1Q56 A;  4CCJ A;  2EAA A;  1FPN 2;  2G4I A;  2Y6J A;  2ZMK A;  1GUI A;  1UZV A;  4B3N A;  4DY5 A;  2QQN A;  2X5I B;  3WW2 A;  1AJK A;  4R4X A;  3BU7 A;  3H1M A;  1QJU 2;  4I2O A;  3IMM A;  4PF1 A;  4G3Y C;  1YC6 1;  2HYK A;  4KG0 A;  3N4M A;  4CCO A;  2MPF A;  2PHW A;  2Y0O A;  4I30 A;  3S7I A;  2D6P A;  3NWK A;  2DFB A;  4HVO A;  1RGS A;  5A7W B;  4EN6 B;  5J96 B;  4XQW A;  4R52 A;  1FAY A;  1ST8 A;  1KJL A;  2WJS A;  1ULO A;  4PDW C;  4GH4 A;  1W8U A;  3HN1 A;  4IGQ A;  1R1Z A;  1SPP B;  3MLK A;  1MQT A;  3AX4 A;  5FP7 A;  2NN8 A;  3KV9 A;  5K7P A;  1CAW A;  2W95 A;  4OI1 A;  1W8W A;  4CRQ A;  1PVC 2;  5FXV A;  2ZXQ A;  2CHH A;  1Z7S 3;  1L7L A;  4NHM A;  5FBJ A;  1REE A;  4LUK A;  2VO5 A;  3ZDS A;  3ZXD A;  4IEW A;  2WZE A;  5J37 A;  1CES A;  4YGD A;  3GHM A;  1A6C A;  1HB4 A;  1LKN A;  2Y6K A;  2XJP A;  1YWK A;  4D0Q A;  1H30 A;  1QJX 3;  4KWL A;  5KWR A;  1PIV 2;  1VAM A;  2QQL A;  3QCW A;  2GAU A;  4QKN A;  1RUF 2;  1XBF A;  2ARB A;  3UET A;  1H2K A;  3POE A;  2BPA 2;  3ZXJ A;  2BQP A;  4MGZ E;  4NVP A;  1VBA 1;  4NIG A;  1AR9 1;  2XGX A;  1GWK A;  1AYM 1;  2BTV C;  1GNH A;  2JG8 B;  3HN3 A;  2WNU C;  3FHQ A;  3ZN4 A;  3AKP A;  1UZY A;  4XFA A;  5C5T A;  4H14 A;  5FZF A;  4GB3 1;  3OYW A;  1DZT A;  3KQR A;  4NOT A;  4E4H A;  5I8T A;  3THT A;  4BWO A;  5GZC A;  1D7P M;  4JHT A;  1UKR A;  3F95 A;  1C3H A;  3U14 A;  4LBL A;  4MHR A;  4ATF A;  1WGP A;  1RUJ 3;  2UU8 A;  3IDB B;  4XBN A;  4NMI A;  5FYV A;  4B7E A;  1TMF 1;  3K77 A;  4XXP A;  5C71 A;  3KM5 A;  3AMQ A;  4AQS A;  2MEV 1;  1JYW A;  1OA4 A;  3D8C A;  1UAI A;  1SBD A;  4XF1 A;  3J8F 2;  5JOW A;  2XL9 A;  3LA2 A;  1X9T A;  2ZJC A;  1BK1 A;  3BUC A;  2H0B A;  3PU3 A;  4OHV A;  2Y64 A;  5F1R A;  1R1A 3;  2VR4 A;  2ZX4 A;  1GZW A;  1IG3 A;  5FZC A;  2Y60 A;  2ZGP A;  1PMH X;  2B42 B;  3ME2 A;  3PUR A;  5JR2 A;  3Q8B A;  5FZO B;  2QQW A;  1YQ2 A;  3RI8 A;  1PZ9 A;  5FYH A;  4ZS2 A;  4Z8B A;  5KXE A;  3DYM A;  4AED C;  5C3P A;  1ULE A;  4BQ4 A;  4XDO A;  1I3H A;  3MF6 A;  3SCH A;  1BEV 2;  4R9B A;  3U11 A;  2ZGM A;  4XOG A;  3SLI A;  1ZBE 2;  3DN7 A;  2QNK A;  5KXB A;  2ARX A;  1IS3 A;  1V6K A;  2WKK A;  4Y1X A;  5B2G B;  4G4F A;  4K21 A;  3LD8 A;  4QHO A;  1EUU A;  5AC9 1;  5GZG A;  3SC7 X;  5HXV A;  3UK9 A;  3VKM A;  3GYD A;  4N43 B;  1UOG A;  2OVU A;  4ORF A;  1OXC A;  1XNK A;  4NRO A;  1SG3 A;  1DBN A;  4KMQ A;  3RMX A;  4Z92 B;  2VCM A;  2Q8C A;  4BM8 A;  3WT3 A;  3Q8A A;  1XE8 A;  1W2O A;  1HQN A;  1UYY A;  2ZZQ A;  3CZJ A;  3M3C A;  3UES A;  4CDW C;  3I49 A;  1X50 A;  3KVB A;  1N3P A;  4X8P A;  2QDR A;  4BK5 A;  4KL1 A;  2E53 A;  4HN0 A;  3VZM A;  3MO4 A;  2B45 X;  1RUC 2;  4EYU A;  5DUV A;  2CNA A;  2PHL A;  2DU1 A;  1G86 A;  3VDC A;  5JPN B;  5C3O A;  4M3C B;  2OS2 A;  5LW9 A;  1XPW A;  4I0B A;  4FOQ A;  4XBL A;  2ZOE B;  5CIR A;  5EJZ B;  3BTX A;  3TEX A;  4ASK A;  3WLU A;  5JAX A;  1S2B A;  4NIH A;  1X36 A;  4BIO A;  3ZIW A;  1UZZ A;  2DYC A;  4LK6 A;  1W05 A;  1U5X A;  4IV3 A;  4KGG A;  5HCF A;  4QX2 A;  4A45 A;  3VDD B;  1LOA A;  5T54 A;  1OPM A;  4XF4 A;  3B7M A;  1RUH 3;  5C9A B;  4M4R A;  1WA4 A;  2VZT A;  2VBB A;  3AP4 A;  2YBS A;  1A8M A;  1G7Y A;  2GP5 A;  1RIR A;  1AR7 3;  5DPN A;  1SFN A;  3UJO A;  2GNM A;  3CLP A;  3U37 A;  1S0E A;  3AYA A;  2HWD 2;  3PTY A;  1UIK A;  4MSV A;  1W6O B;  5A3W A;  1NZC A;  3PIG A;  5IVE A;  3WDT A;  1LNS A;  5CG8 A;  5EFU A;  1RHI 3;  4GA9 A;  3VL8 A;  4CUC A;  4HKO A;  2G19 A;  5ACA 3;  3BTY A;  1ZRC A;  2G9F A;  1ND2 C;  4WBB A;  1QDC A;  4AVB A;  4XIK A;  4RGK A;  5I91 A;  3OUH A;  1OF3 A;  3KCY A;  3HAG A;  5G04 L;  1BCX A;  1Z0H A;  3NO8 A;  1ZRF A;  3G7D A;  4CDX A;  2BUK A;  4QPI B;  4Y1Z A;  4OUE A;  5FDB A;  5F7U A;  1DIW A;  4C90 A;  1Y7B A;  3SH4 A;  1QWR A;  5I0T A;  1NYW A;  2BEO A;  4JCK A;  1U0A A;  3H7J A;  1HB2 A;  4XF9 A;  3FE5 A;  4XVH A;  1WW4 A;  3UGG A;  5T5P A;  1YJK A;  4CCK A;  2XLG A;  2RDN A;  4LHK A;  1JOB A;  4AI3 A;  4LIV A;  1WD4 A;  3MIG A;  4X6R B;  4LTA A;  4N53 A;  2IXC A;  3VBU C;  2PFW A;  1ULG A;  2N7G A;  3CBN A;  4LLF A;  4RFT 0;  3VBR C;  2J42 A;  3BAL A;  1ZBA 3;  4YM2 A;  2YRO A;  2PHX A;  3AB0 A;  1GNY A;  1SAC A;  1IPJ A;  3H50 A;  1HQL A;  2VQ0 A;  2Q30 A;  4URT A;  3THC A;  3HVD A;  3GZT B;  4QX3 A;  3H8X A;  1W99 A;  2W91 A;  2WFP A;  2GC0 A;  1S2K A;  5A6Y A;  1CX1 A;  3K4Z A;  4K8R B;  3USU A;  4JRL A;  5DG2 A;  1Z7S 1;  1HRV 2;  2V09 A;  4CU6 A;  2Q8E A;  3LSE A;  1W39 A;  3AYD A;  5FR3 A;  4RR3 C;  1N1Y A;  5IAX A;  2JIG A;  2UY9 A;  4XE9 A;  3KCC A;  4BMB A;  4YW3 A;  3BVC A;  1RUE 3;  3RFR A;  3EHK A;  3LFM A;  3ZXG A;  2WO3 A;  2Y0I A;  4AEJ A;  2ZHN A;  1NXM A;  3KS7 A;  5K9Y A;  3JQW A;  4DOU A;  1POV 0;  3FHI B;  4LHS A;  3WNP A;  2EIC A;  1AXY A;  5FPL A;  4BIS A;  1PO1 2;  1ZM1 A;  2PEL A;  3ZMO A;  4KWK A;  4GWM A;  3N9M A;  3PVB B;  3DYP A;  3BPZ A;  1VIW B;  2HWF 3;  5L9B A;  4Q29 A;  1W2A X;  2ZEW A;  4ASM B;  1VRH 3;  1HJF A;  1MZE A;  4YVS A;  2RMU 1;  4BQ3 A;  1MAC A;  1W6Q A;  5J1X A;  1A3K A;  4QQP A;  4PDW A;  3D0J A;  3H8R A;  2YUE A;  1XC6 A;  4HLT A;  2E9Q A;  4CDU B;  2ETE A;  4IGP A;  3LB9 A;  2OKX A;  3AL5 A;  1DQ6 A;  2WSV A;  4AF9 A;  5A1F A;  5HI0 A;  1AX2 A;  1OLQ A;  1VPH A;  4DXS A;  5FZ8 A;  2H6B A;  4AFA A;  5F5Q A;  3DXT A;  1MZ5 A;  3R4U A;  1KIT A;  5JSR A;  5FY5 A;  2AAC A;  1DZQ A;  2IXH A;  3ZN6 B;  4CZS A;  4OZX A;  2QKD A;  3MHZ A;  4D6S A;  1W0N A;  1EY2 A;  2VE1 A;  2G9G A;  4CDQ C;  4PCR A;  1WMX A;  1VBE 1;  3FJS A;  4AI8 A;  4HON A;  1W90 A;  4R9D A;  1H8T B;  4Y1Y A;  2WO2 A;  4BCU A;  4FPF A;  5HV4 A;  4UBG A;  3WW1 A;  2E63 A;  3DF0 A;  4JVA A;  2R49 A;  2JE7 A;  1JHN A;  1TNR A;  4LR4 A;  4B8E A;  5JLV A;  1JZ5 A;  5KC6 A;  4XXA A;  3PHM A;  4Q4Y 1;  2C26 A;  2OT7 A;  2WNU A;  2VCB A;  4JZR A;  4WM8 B;  5FZA A;  4XFF A;  2Y34 A;  5DAV A;  5ERL A;  1PO2 3;  5FRE A;  5FY4 A;  5LA2 A;  3HQX A;  1BKZ A;  5FYU A;  3JBG 3;  4Q2F A;  1UOJ A;  3H1Y A;  2FDI A;  1Q8O A;  4A7Y A;  4CUB A;  5ABJ B;  1H2N A;  2BWA A;  2ZX1 A;  3ZXL A;  2XQR A;  4S2H A;  1JU4 A;  1AL0 G;  1MR5 A;  4AI9 A;  4BPZ A;  5JDB A;  1KDM A;  2GN3 A;  4D8M A;  2EA7 A;  3NKG A;  2GH8 A;  1H6Y A;  3SEP A;  4Q4X 3;  1M4W A;  2G1M A;  3KLS A;  3KHC A;  2ORX A;  3B3Q E;  4ZZ8 A;  1CQ9 A;  2ZEZ A;  4G9S B;  2OYZ A;  4AG4 A;  3ZKU A;  4BE3 A;  5IVF A;  1VBA 2;  2H6C A;  1AR9 2;  3FHA A;  4RHV 1;  5FKB A;  2VMD A;  3VHO A;  2FD8 A;  5GLW A;  4OQ8 A;  1NY7 1;  2D97 A;  4QM9 A;  5ANQ A;  4UW6 A;  4BIF A;  3AMP A;  2YMZ A;  3VD4 A;  2OQ7 A;  2XUE A;  3DXU A;  4FFH A;  4Q0P A;  1E5R A;  1HQW A;  3NJY A;  2J22 A;  2JG9 B;  4HFS A;  4MXV A;  1S55 A;  1FAT A;  4GB3 2;  4XC9 A;  3M3I A;  5DDJ 3;  3WG3 A;  1BMV 1;  4YW2 A;  1GZT A;  2HLE A;  3JD7 3;  1UQX A;  4FI9 A;  5FTT C;  1NAE A;  2J1E A;  2D44 A;  3D0S A;  4EWD A;  3DKW A;  2R04 3;  1YFX A;  3ZLI A;  3VZN A;  2VH9 A;  4AED A;  2AEZ A;  2WWJ A;  1WBF A;  1F31 A;  4QX5 A;  4D3W A;  2AYH A;  2CGN A;  4Z2W A;  3H8O A;  3UKN A;  2G9Z A;  1TMF 2;  1D4M 1;  1F4A A;  5A3T A;  4MUV A;  1C1L A;  2ARC A;  2MEV 2;  5H9S A;  4XDP A;  3WR0 A;  5JXI A;  2P6H A;  2TUN A;  2R32 A;  4UFJ A;  1AYN 1;  1FPN 1;  1GQG A;  3MDP A;  1HB1 A;  5KHH A;  2AGS A;  5JSP A;  4MLO A;  3CQO A;  2BOJ A;  4QKF A;  1AR7 1;  1YFU A;  3C7G A;  1UOB A;  3O0V A;  3NNF A;  4NID A;  1NCQ B;  5BNP B;  3GZU C;  1GQP A;  3VDA A;  3ROU A;  3AKR A;  3SNM A;  4BU2 A;  3K51 A;  4CDW A;  1XQN A;  1LCL A;  2JDP A;  4U36 A;  1MS1 A;  2ZA9 A;  3WCS A;  3VZL A;  1RHI 1;  2P3K A;  5IW0 A;  4LMF A;  4DZG A;  5LB6 A;  5ACA 1;  4IE4 A;  2ATF A;  2P4E A;  1N47 A;  2J7M A;  1OLR A;  3B00 A;  2QUO A;  3OBA A;  1Y9M A;  1LHN A;  2OW4 A;  4UYB A;  3D4K A;  4CU8 A;  4EQV A;  5CFC B;  4Y3O A;  4W6W A;  4EZ4 A;  2JWP A;  4OCT A;  1XNB A;  1XSR A;  4QB1 A;  4AHX A;  5AC9 2;  3U4S A;  3CEW A;  4FTE A;  1LTE A;  2XKP A;  5C3R A;  1ENQ A;  2EF6 A;  3QAC A;  1OD5 A;  3EB7 A;  2A3X A;  2XB6 C;  4YZ3 A;  4A44 A;  4IUG A;  2PYT A;  2Y33 A;  5DXD A;  1EPZ A;  4E8C A;  2WT1 A;  1Q5O A;  1MS9 A;  4B7K A;  2Q4S A;  3KQ4 B;  4PIX A;  1QOS A;  3Q8C A;  3H42 B;  5FWE A;  1CWP A;  1LEC A;  4RQP C;  3PVN A;  3RYR A;  1GLH A;  3HNB M;  2FDJ A;  4HKL A;  2FBE A;  5JZG B;  1X33 A;  2W9X A;  1DQ0 A;  2YU2 A;  2E26 A;  3GM8 A;  3KGZ A;  3WF1 A;  3Q8E A;  4CUG A;  3LIG A;  1OC1 A;  4C8D A;  1ZBA 1;  1A8D A;  1R64 A;  3MF9 A;  1T2X A;  5LAT A;  4BLJ A;  3L2H A;  3NAP C;  4OFG A;  5LWB A;  3I3M A;  1WD3 A;  3PUS A;  2J1T A;  5FYS A;  4FPL A;  4O9E A;  4Q27 A;  1O4Z A;  3NNJ A;  3LCP A;  2HKX A;  3VBS B;  2OII A;  3LOI A;  2P3J A;  5E6H A;  4LIU A;  4LEJ A;  4ZPI A;  4LBJ A;  4R8H A;  1JMU B;  3KT4 A;  4NUB A;  2VW0 A;  4NR1 A;  2BNN A;  3K4A A;  5JCT A;  5FMD A;  4DUX A;  1JOJ A;  1DYO A;  4XJ9 A;  1G9B A;  2VZR A;  5GZF A;  1JZ8 A;  3GBF A;  2J1S A;  1QJY 3;  3PUA A;  3OGS A;  3POG A;  4K8F A;  4AGG A;  1GNZ A;  3OBT A;  3AL6 A;  4M3C F;  5FOB B;  1ULF A;  1HV0 A;  4MVT A;  2P3Y A;  5J3U A;  1IPS A;  3WDW A;  3ZYP A;  3H7Y A;  2K2S A;  2VTF A;  1J3P A;  2ZX2 A;  4OI4 A;  5DQ0 A;  5C8C C;  2W3J A;  3FLT A;  4LQR A;  3VBR A;  5IHR A;  3ILN A;  4XJ8 A;  1B35 B;  1K5M A;  4YZ1 A;  3NL1 A;  4Y4Y A;  2P6C A;  1DQ2 A;  3C7E A;  5T50 A;  2MNG A;  1M06 G;  5BNO A;  4LOT A; 
#chains in the Genus database with same CATH homology
 4BJ0 A;  3C7F A;  4ZXE A;  1ULP A;  3I3B A;  3K4D A;  4A4A A;  4ZY9 A;  5DN2 A;  3WSO A;  4P5Y A;  1US2 A;  2Y6J A;  1OH4 A;  1GUI A;  2QBX A;  5A1A A;  2QQN A;  3III A;  1OT5 A;  1TVG A;  1CZV A;  4GWI A;  4QAW A;  2J1U A;  4PF1 A;  3WNL A;  4DUW A;  2W92 A;  1K42 A;  2VMC A;  1NUK A;  3NRU A;  2XOM A;  4RN5 A;  1ULO A;  1EUT A;  2WAB A;  2VZP A;  2W95 A;  4E8D A;  2ZXQ A;  2R7E B;  4XUQ A;  2DDU A;  3IB3 A;  4JX0 A;  2VO5 A;  2WZE A;  1H6X A;  2W46 A;  3CDZ B;  4W4Z A;  2Z4F A;  3WNK A;  2Y6K A;  3GGL A;  4D0Q A;  3UNP A;  4ARY A;  2QQL A;  3F2Z A;  1UY3 A;  5C70 A;  3UET A;  5HXM A;  1K45 A;  3OEA A;  1GOH A;  4JHZ A;  1F4H A;  2VQU A;  4HG6 B;  2E32 A;  3I3D A;  3HN3 A;  2EID A;  3FHQ A;  4XUR A;  1CZT A;  4ARX A;  4L0P A;  5IJR A;  5IFP A;  4A3Z A;  1D7P M;  4CU7 A;  3ACI A;  3J7H A;  5I0D A;  1J84 A;  5C71 A;  2X10 A;  3K77 A;  2ORZ A;  3JXS A;  3MV1 1;  3T2P A;  5DMY A;  1JYW A;  3A23 A;  2YB7 A;  3IAQ A;  4RYD A;  3ETP A;  2ZEY A;  2W1W A;  3K75 B;  5LCW L;  4OYU A;  2Y64 A;  4CU9 A;  2VR4 A;  3LEG A;  2JE8 A;  3C8X A;  4TTG A;  5JR2 A;  1PMH X;  4MOA A;  3I2I A;  3WNM A;  1YQ2 A;  1W9W A;  3A21 A;  3HPN A;  2J1A A;  3DYM A;  4UI9 L;  3OEB A;  4QPW A;  3FL7 A;  1GMM A;  3WF4 A;  3P1I A;  3LEI A;  2VME A;  5JXH A;  3HEI A;  1EUU A;  4JKL A;  2WBK A;  1JU3 A;  2VZ1 A;  3VDB A;  3I97 A;  3C7O A;  1JZ4 A;  2VC9 A;  5G05 L;  4YPJ A;  1SG3 A;  4KMQ A;  2JKX A;  3OG2 A;  3W5M A;  1PX3 A;  1JZ3 A;  1OF4 A;  3I2K A;  1UYY A;  3UES A;  3CZJ A;  3AC0 A;  2BBA A;  1UMI A;  5LA0 A;  1SHW B;  3ECQ A;  4BK5 A;  3ACG A;  3MO4 A;  4MGQ A;  3C7H A;  5FUI A;  4GWJ A;  3SEE A;  3VDC A;  3WNN A;  3MUZ 1;  4CUA A;  1XPW A;  2CDP A;  3WF3 A;  5EJZ B;  2XON A;  3VD3 A;  2RV9 A;  2X05 A;  1K3I A;  1JZ6 A;  3I2F A;  4XUP A;  1W9T A;  2V4V A;  4QX2 A;  4A45 A;  2WAA A;  1PMJ X;  4XUN A;  5EJ1 B;  3E1F 1;  2Y6H A;  4M4R A;  2VZT A;  4QDR A;  5DPN A;  1W9S A;  5JXG A;  3ABZ A;  4OZO A;  2ZEX A;  2VMF A;  3U37 A;  2QQK A;  1GOG A;  2Y6G A;  2W1Q A;  1LNS A;  4JKK A;  4UOJ A;  4CUC A;  3LPG A;  2E33 A;  3PUH A;  2WN3 A;  1OF3 A;  3CZU A;  1XNT A;  3IDA A;  5G04 L;  3LE0 A;  4JKM A;  2ID4 A;  3T2O A;  4OUE A;  5F7U A;  3MUY 1;  2W94 A;  3BN6 A;  2HYX A;  2YC2 A;  3NJX A;  1JYX A;  4XVH A;  3A7Q A;  4KWU A;  2VZ3 A;  2DCK A;  5B4N A;  3I3E A;  3MV0 1;  3THD A;  1CZS A;  1W8O A;  5LA1 A;  3WNO A;  2XQX A;  5EIY B;  4DEV A;  4MO3 M;  3NNG A;  4QB6 A;  1UZ0 A;  3HJR A;  4DUV A;  3SKV A;  1GNY A;  2VCA A;  4M4P A;  5B4X A;  1UYX A;  4BXS V;  1UX7 A;  3THC A;  1W8N A;  4QX3 A;  2YFU A;  1W99 A;  4DXT A;  2W91 A;  4Z2A A;  1CX1 A;  2J1V A;  5HPO A;  3K4Z A;  2QQM A;  4CU6 A;  3W5N A;  1NX9 A;  2BGO A;  2EIE A;  2W1S A;  2QQO A;  2W47 A;  2WO3 A;  2WDB A;  3SKJ E;  2VM9 A;  2E31 A;  3LEK A;  4ET7 A;  5CYY A;  1JZ2 A;  3T09 A;  4LHS A;  3WNP A;  2EIC A;  4P02 B;  3DYP A;  1UMH A;  1UY2 A;  2ZEW A;  3WQB A;  4BDV B;  5J1X A;  3CIH A;  4BK4 A;  1XC6 A;  4UAP A;  3GXU A;  1PX4 A;  3I2H A;  2OKX A;  1KGY A;  2L9L A;  3VD5 A;  4GZ9 A;  2J1R A;  4XUO A;  2VL4 A;  3ACF A;  4DXS A;  5JUV A;  4A41 A;  1L7Q A;  2VJX A;  2EIB A;  4TXW A;  2YFZ A;  2QQJ A;  1W0N A;  1WCQ A;  4DXR A;  1P8J A;  1O8P A;  4AAX A;  4LPL A;  1NKG A;  3T08 A;  3WF0 A;  5IFT A;  4QB2 A;  2WO2 A;  3HNY M;  3K46 A;  3CKH A;  1DLC A;  1IQD C;  2W5F A;  1JZ5 A;  1JHJ A;  2C26 A;  2VCB A;  5LA2 A;  2W87 A;  4W50 A;  5CZK A;  2DCJ A;  2V72 A;  1US3 A;  3HOB A;  4CUB A;  1UY0 A;  2LW8 A;  2JDA A;  3I2J A;  1JYV A;  1JU4 A;  2WO1 A;  4P08 A;  4D8M A;  2B9V A;  3SEP A;  4QX1 A;  1H6Y A;  1UXX X;  2RVA A;  2ORX A;  2VCC A;  3WF2 A;  4A6O A;  2KD7 A;  4ZZ8 A;  3T2Q A;  2ZEZ A;  3VD7 A;  4AG4 A;  4OMC A;  3FHA A;  2VMD A;  1KEX A;  5IYY A;  2C4X A;  3VD4 A;  3I2G A;  1GU3 A;  1I5P A;  2J22 A;  1O59 A;  4LKS A;  4MAD A;  2HLE A;  4QDQ A;  4FI9 A;  1NAE A;  2J1E A;  2RJ2 A;  1BHG A;  2WUH A;  3T0B A;  1UY1 A;  1WKY A;  4MGS A;  2WZ8 A;  1GOF A;  3IAP A;  2VZQ A;  2XHN A;  3T0A A;  1F4A A;  3BGA A;  2BGP A;  2VOT A;  4XUT A;  1XNA A;  1OD3 A;  2C9K A;  1MPX A;  4QX0 A;  2PQS A;  5JXI A;  3OGV A;  1O8S A;  2YG0 A;  2Y6L A;  3CQO A;  3C7G A;  1UYZ A;  3OB8 A;  3LPF A;  1DP0 A;  1GQP A;  4XZU G;  3VDA A;  2WAO A;  3NQH A;  2VZV A;  1UWW A;  3P6B A;  2J7M A;  2WQ8 A;  2Y8K A;  1HN1 A;  1RYY A;  3GDB A;  3OBA A;  4CU8 A;  3ZM8 A;  4QB1 A;  1TG7 A;  4A42 A;  3CMG A;  2YC4 A;  3HNM A;  2BZD A;  2VZO A;  4CVU A;  1J83 A;  3EB7 A;  4A44 A;  4IUG A;  4KI5 M;  3VD9 A;  2B4K A;  1JI6 A;  3D3A A;  5C7G A;  4E8C A;  3NJV A;  3DYO A;  2VQT A;  3OGR A;  1UXZ A;  2BER A;  2QQI A;  3HNB M;  2W9X A;  1L7R A;  2E26 A;  3EYP A;  4ZZ5 A;  3GM8 A;  3WF1 A;  1JZ7 A;  5JXJ A;  2WYS A;  1R64 A;  4W8J A;  1T2X A;  3MBW A;  1JYN A;  2WN2 A;  2VZS A;  2J1T A;  3A22 A;  3ACH A;  3PUI A;  4PQQ A;  1CIY A;  3FN9 A;  1SDD B;  2VZU A;  3LQC A;  2X09 A;  3T0D A;  5JMO A;  1UY4 A;  3K4A A;  2W1U A;  3WEZ A;  4DUX A;  2V5D A;  1DYO A;  2VZR A;  1JZ8 A;  2LS6 A;  4P00 B;  4DEQ A;  2J1S A;  3OGS A;  1K12 A;  4PT6 A;  4QDS A;  4OMD A;  2VTF A;  5DQ0 A;  2W3J A;  4LQR A;  2CDO A;  5IHR A;  3C7E A;  2JD9 A;  3DEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...