2BUKA

Satellite tobacco necrosis virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
b'TMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
molecule tags Virus
publication title Structure of Satellite Tobacco Necrosis Virus After Crystallographic Refinement at 2.5 A Resolution.
pubmed doi rcsb
total genus 46
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bukA00
4GH4B 1WCDJ 4AEDC 1HXS1 1RUD3 1FOD3 2RMU2 5AC92 1VRH2 1VBE1 1ZBE3 1PO22 4WM8B 5C8CC 1VBB1 1TME1 2BFUL 2MEV1 5BNPB 1NA1A 1BMV2 1QJX3 1GFF2 4WM8A 2Y26A 1AYM1 4CDUA 4NWVA 3TN93 3J8F1 3VDDB 5CFCB 4GMP0 4CDWA 4RQPA 4Z92B 1RUE1 1ZBE2 3VBUB 2R061 4N43A 2QQPA 2RR12 1ND2A 1AL0G 5BNNA 4RFT0 4YVWA 3ZXAC 1QJX1 1EV12 1R082 3JBG1 4RQPB 5DDJ2 1OOPA 5JZGA 1X33A 2WFF2 4CEWC 2HWD1 4FTBA 1RHI1 1VBA3 1K5MC 4RHV1 5D8AB 5C9AB 2R042 1PVC2 1R092 1ASJ3 4CEYA 2HWC1 1RUJ3 2WFF3 3JB4C 1RUI2 2PLV3 5ACA1 1PIV2 5C9AA 3ZFEA 4IV1A 2WS92 2RMU1 1PVC3 1AR81 3VBOC 1ASJ2 5D8AC 1AR73 1RUH2 1Z7S1 1VBB3 1PIV3 4CEWB 2WZR1 4FTEA 1X36A 1RMU2 2PLV1 1PGW1 3CJIA 2HWB1 4QPGC 1AYM2 4CDUC 1HRI1 1HRV1 4Q4W3 4WM7B 4RQPC 4WM7C 1V9U2 1NOVA 2RMU3 1RMU3 3VBSB 1A6CA 4QPIB 1PO23 1ND3A 1TMF2 1RUF1 4CDXC 1OHFA 3VBFB 2BPA2 1FPN3 5J98B 1HQNA 5CFCA 4QPIA 1RHI3 1VBA1 1CJDA 3TN92 2RM21 2R071 3VBSA 1NCRB 3VBRA 1BEV3 1COV1 3JD71 4IV3C 1QQP2 1VBD1 1H8TB 1POV0 3NAPA 3ZFFA 2DF7A 4PDWC 1AR61 1QJU3 4FSJA 1BBT2 1EAH2 2BFUS 5ABJB 2X5IB 1AR92 3DPRB 1BEV2 1FPN1 5C9AC 1COV3 4YVSB 1E57A 2RM23 4RR3B 4CEYB 1QJY3 5BNPA 1AYN3 1FOD1 3VBOB 1RUJ2 5JZGB 1BBT3 2HWF2 4CDQC 4Q4X1 2MEV2 2WZR3 2HWB2 4IV3B 1BMV1 1RUG1 4Y4YA 2ZTNA 4Q4Y2 4N43B 4Q4V3 1QJY2 1HX6A 4RS5B 4Q4W1 1ND2B 1B35A 5FMOS 1POV3 1FMD1 1RB8G 2HWC2 2RS51 1RUD2 1VRH3 1RUH3 3VBFC 5LK7B 4Y5Z0 1RUC1 2IZWA 1W39A 3NAPB 4RS5A 1H8TA 4JGZA 1PVC1 1QJZA 3VDDA 1AR82 5C8CA 2HWD2 3NAPC 2XBO3 2RS31 3VBUC 5A33A 1AL21 1VB2A 5DDJ1 1PIV1 3S6PA 1ZBA2 2FZ1A 2RR13 5K0UC 1RVF2 4GB32 1C8M2 2HWE2 5CFDC 5J96B 1HRI3 2HWD3 1VBC2 3ZFGA 1MEC2 1VBE3 1ZBE1 1RUE2 1TME2 5C4WB 3HAGA 4AEDA 1AL22 4Q4X3 2RS11 1AR71 1NCRC 1QJU2 3IDEA 4CDQA 1OOPC 2WFF1 5JZGC 4CDUB 3JBG2 1PO11 1VBE2 4N53A 1MEC3 1AYN2 1HXS2 5L7OB 1V9U1 5FOJB 5BNOA 1EV13 1R083 2HWF3 4NWWA 3VBFA 2HWB3 4PDWB 3CJIC 4EJRA 2WS91 4IV1C 2MEV3 1OPOA 3VBOA 3ZFFB 4Q4V2 5CFDB 4JGYA 4FTSA 1EV11 1R081 1RUJ1 4Q4W2 3VBUA 1FMD3 1RUF3 1VBD2 2RR11 3DPRA 1AR62 2R063 1RUI1 2RS13 1B35B 1RUC2 2GSYA 5C8CB 3ZFEB 2WS93 1D4M3 2R072 3JD73 1BEV1 3VBSC 1NCQC 3VBRC 1R091 5C4WA 1M06G 3ZFGC 1AR83 1AR63 1NA1C 1RHI2 1RUF2 4CDXA 5A32B 4QPGB 1VBB2 1RUG2 5L7OC 5CFCC 1SMVA 1RVF3 4GB33 4GMP3 1PO13 3JD72 1HRI2 1NG0A 5A32A 1D4M1 4YVSA 5BNNC 1MQTA 1VBC3 5BNPC 1PGW2 4QPGA 1RUE3 1COV2 1RMU1 1AL23 4GH4A 1TME3 3VBHC 5BNNB 1FPN2 2RS52 1VRH1 3JBG3 1EAH1 4N53B 1NY71 1POV1 3M8LA 1HRV3 1FOD2 1QQP3 4WM8C 1RUH1 1HXS3 1VBA2 2XBO1 1R1A2 1C8M1 2BUKA 2HWE1 1NA1B 1EAH3 1ASJ1 3ZFEC 2WLPA 4JGZC 1ZBA1 1B35C 1NCQA 3VDDC 4JGYB 3J8F3 2RS33 4RR3A 5AC91 1BBT1 4CDWC 1VBC1 4CDWB 1R1A1 5A33B 1AUYA 2R062 2HWF1 4N43C 4RHV2 1ND2C 1VBD3 4YVWC 2WZR2 4GMP1 5CFDA 2R073 1DDLA 3CJIB 1ZBA3 1D4M2 3J8F2 1CD3G 1R093 1F8VA 2FZ2A 2VQ0A 3LOBA 4GH4C 4AEDB 1V9U3 4SBVA 4RHV3 1K5MB 4CEYC 1TMF3 2PLV2 5ABJC 4IV3A 1VB4A 3ZFGB 1AYN1 2R041 1NCRA 1F2NA 1H8TC 1IHMA 1OOPB 3VBRB 5AC93 4Q4V1 5D8AA 2RS53 1C8M3 2HWE3 1Z7S3 2ZAHA 1QJX2 1ND3B 1ND3C 4Q4Y1 2X5IA 1AR93 4RR3C 5K0UA 4CDXB 2WWSA 1HRV2 5BNOC 1QQP1 5ACA2 4Q4X2 4WM7A 4QPIC 3JB8A 1Z7S2 3DPRC 2RM22 1RUD1 4IV1B 1R1A3 4CDQB 1FMD2 1NCQB 2ZZQA 1TMF1 1C8NA 4LLFA 5ACA3 5DDJ3 1MQTB 1PGL1 1MEC1 2TBVA 2XPJA 1AR91 2RS32 5BNOB 2R043 2HWC3 4N53C 4RS5C 5GKAC 3ZFFC 4PDWA 1RVF1 4GB31 1RUI3 5ABJA 1RUG3 5C4WC 3VBHB 1PGL2 3TN91 4JGZB 4YVWB 1PO12 1NY72 2BBVA 4CEWA 5L7OA 1K5MA 3VBHA 1AR72 1QJU1 1QJY1 2RS12 1PO21 2XBO2 1RUC3 2GH8A 5K0UB 4JGYC 3FBMA 4YVSC 4Q4Y3 1MQTC 2X5IC 1AYM3 4BCUA 1VAKA 5FMOL
chains in the Genus database with same CATH superfamily
3VDCA 5JPMB 4Q0QA 5EJZB 1RJ8A 3M4FA 3Q8AA 4DFSA 1ZA4A 5IVVA 2RMU2 3V64A 5AC92 1Q8VA 3ZN5A 1VBE1 3BN6A 4PT6A 1PO22 4ASMB 5C8CC 4GWNA 1VBB1 1W9FA 4CYDA 2BFUL 4LITA 2ETEA 3ZYRA 1WZXA 1PX3A 2QQWA 2BGPA 2TEPA 3BVCA 1BMV2 2ZPXA 3IAPA 3POYA 3RNSA 4L92A 4XFAA 5IK7A 5I8YA 1OPMA 2WO1A 3D5OA 1O6UA 4LK7A 4I09A 5A1AA 1GFF2 2D6PA 2Y0OA 3IIAA 3MW3A 3QH6A 2NQYA 3MIDA 5K7PA 1AXYA 5EYXA 3RG0A 4ZKTB 4Z92B 1K5JA 1RUE1 3N7MA 2Y60A 2BERA 4E2GA 2CAUA 2R061 2GU9A 1UZYA 4N43A 4XUOA 5DG2A 3WDXA 2DCYA 2H6BA 4ZONA 5F6LB 5SV8A 2RR12 1ND2A 3OGJA 3T2OA 1XC6A 3UGFA 1NLRA 3SH4A 1A3KA 3WHUA 2XJVA 4YG0A 5CYYA 1EV12 1R082 3CZJA 4QGLA 2QQMA 5CKMA 5L9RA 3VKOA 1OOPA 5JZGA 1X33A 1VJ2A 2B42B 3EO6A 1WBLA 4CEWC 2FDFA 1CAUB 1UPIA 4XIOA 3LQCA 1CZSA 4XILA 1VBA3 2HBTA 3BIEA 2XWJB 1PX4A 2GH2A 4XHBA 5C9AB 1LAJA 1R64A 5FP7A 2R042 1LHOA 2WC2A 2A71A 3O12A 2JG8C 4Q1RA 2HWC1 4XQWA 2BW8A 1LU1A 3USSA 5C8WA 1UY4A 3GBFA 1RUI2 3WQ0A 1WCKA 2WT0A 1RITA 2XJPA 2PLV3 3AZXA 3WY6A 1PIV2 2EXJA 2ZHLA 2ZXQA 1BK1A 2LALA 5C9AA 3ZFEA 4IV1A 3WCRA 5CEHA 2WS92 4Y33A 1O3SA 1G9BA 2WZ8A 3WQBA 5D8AC 3BPSA 4LQRA 3H50A 1RUH2 2ZGOA 4GJYA 4AI1A 1DQ1A 4OHZA 1Q8QA 1UNBA 1VBB3 2UWAA 2V4VA 4MXWB 1GQPA 3DCQA 1RMU2 3NQHA 4EWDA 4E4ZA 2CWSA 1ULDA 5FO8B 4P00B 3TYJA 1G9DA 4JHTA 5J36A 4BLJA 1AF9A 2BNOA 4COYA 3FE5A 3V0BA 1UY1A 2XHNA 2YXSA 1Q8OA 4M3CB 4Y26A 2RMU3 2D6OX 2WSUA 3RDIA 1RMU3 3VBSB 1U12A 2OPKA 3IBMA 1CAVB 4J1WA 4JDNA 2FD8A 4IE6A 2OUHA 4JDMA 2ZS6B 5FUIA 2C0ZA 1TMF2 1MS9A 3HT1A 1RUF1 2JDZA 1KXGA 4PI0A 1UOFA 3OOXA 3IAQA 2WT1A 3I59B 4N9HA 3EB7A 3FJSA 3WT3A 2WYSA 2A3YA 4QKDA 1YNAA 4ATEA 2ZX2A 2OIIA 1C5HA 2EXHA 4LKSA 1YJKA 3T2TA 1CJDA 5A3MA 1PGSA 3J4UH 3VBSA 4EN6B 4ZU7A 3VBRA 1UZ0A 1JYCA 1Y9GA 2QNKA 4IV3C 1YJLA 4FQZA 4QD2A 1QQP2 2VD7A 1Y3TA 5FPZA 4PDWC 1UU5A 5LEKA 4FPJA 1EP0A 3MIHA 3N7KA 1EAH2 5CVRA 2VH9A 3HBKA 3WV6A 4A7KA 2CTVA 1NE4A 4DRRA 1Q5OA 1LOCA 2OW4A 4KWLA 3AVRA 1H4HA 1COV3 2XUEA 4XJAA 1D2QA 1E57A 4XQDA 4CEYB 2CYFA 1LEMA 2DU1A 3WDTA 4FXGB 3VBOB 4F8AA 3K48A 3DECA 1JZ7A 3FHIB 2WT2A 3OGSA 4XUPA 4MG2A 5L73A 3M3QA 3V65A 2HWF2 4I0AA 1K3IA 5IW0A 4CP9A 4CCMA 4B4QA 4Q4X1 2OZJA 1K42A 2HLEA 1BVP1 4M4PA 3WW2A 4M3CA 4IV3B 5FXWA 2BOIA 4PIYA 1DGWX 3NWKA 3HD8B 4DS0A 2B5HA 3BUCA 2JE9A 1YFUA 2BP6A 4NN0A 5FZ6A 4CA9A 5HV4A 2D3SA 2NYYA 3T3YA 1DGRN 2I45A 1FMD1 2EXIA 4NHYA 1J83A 3HPNA 2Z2SB 2XQXA 5FZGA 1RUD2 2AREA 2NLRA 3I3EA 3KV4A 1S0FA 3AP9A 5C3SA 1RUC1 2IZWA 4XE9A 4IXLA 3U14A 1OUXA 3OYWA 3VHPA 5LBEA 1UYYA 1BJQA 4MH0E 1OA3A 4RS5A 5F8PA 4HK8A 4QHOA 5FQ0B 4LBKA 3ZSJA 1JZ4A 1DQ6A 1H2KA 3FLRA 1AR82 3HIFA 4QDSA 3VDDA 4FAHA 1MR5A 3MICA 5E89A 3PURA 3BU0A 2PQSA 1O4YA 4Q29A 4H7MA 2RS31 2FHRA 4O65A 2QUOA 3VBUC 4FPKA 3MFAA 4ZY9A 5A33A 5JPNB 1JYIA 5KHJA 3IDCB 2R16A 2GC2A 5C33A 4LUKA 2WA3A 5K0UC 2DVDA 1IG3A 2RR13 2V09A 2IXHA 1Z0HA 2WNVB 5GLWA 4RSUA 4GD4A 3O1OA 1NLQA 1C8M2 1F5JA 4FCAA 5JR2A 4DXTA 1CAUA 4AEMA 1OF3A 2HWD3 1VBC2 4AYUA 3BTYA 5FBZA 5D21A 2R32A 1HW5A 2Y6JA 1WD4A 3I3QA 5I0TA 3ZVXA 3E1F1 5KHIA 2HBUA 5C4WB 5C3PA 1ULCA 2RS11 4PLNA 1QXRA 3IDEA 2X53S 4LE4A 2B7YA 4YM2A 2WFF1 4ZXKA 1VLNA 5B2GB 3OPWA 2Q4SA 2XJQA 1BZWA 1AX1A 4JQRA 5F39A 2ZEWA 1RXGA 4AG4A 3JBG2 1O91A 2D6KA 1HJGA 1VRBA 5IUQA 1VBE2 4YLZA 1WW4A 1FV2A 4P9GA 1ACCA 2FDIA 1W6PA 3DYPA 1GR3A 3K3OA 1MEC3 5L7OB 3FHAA 2VNOA 1V9U1 2VMFA 1ZZ8A 1OC1A 3M1HA 4D3WA 3I2FA 3S7EA 5T5JA 5E88A 3VBFA 3ZDSA 2NP0A 3RYRA 4K7JA 3TEZA 1YIPA 4QDRA 1S4CA 4AI0A 1SCSA 2HWB3 3SCGA 4EJRA 2D3RA 4DUXA 2WYFA 4P9YA 1SLIA 4YZ4A 3WZ1A 4QB6A 2VOVA 5J48A 3QBQA 3AMNA 3S5QA 2CHHA 1DQ5A 3UV9A 3B93A 1G9AA 2K9ZA 4GXLA 5CBLA 1N1TA 4URAA 1PK6C 3HEIA 1JYTA 5GALA 4JGYA 3TEXA 4ORFA 4Q4W2 1CAVA 3ZIWA 1S2EA 4B7KA 5LCWL 1W6OB 5JOWA 2O14A 2ZOEB 1CIWA 2LROA 3LDBA 3WNLA 5IK4A 2CGPA 1B35B 3PUHA 4XYXA 2ZGMA 5F5AA 3KD4A 4M01A 2YGLA 4P14A 3P5BA 4R52A 3SXWA 3IDAA 1NQDA 1NCQC 5FMBA 2EAKA 2JICA 2WDBA 5JSRA 1UXXX 4YGCA 1M06G 3LWCA 3M2MA 1AR83 4D6SA 2QQOA 3JUUA 3PVBB 4X6RB 1W0NA 4CP9B 1NYWA 2CL2A 2P17A 2ADEA 2JIJA 5CFCC 3GBWA 2RDNA 4FPFA 4NVPA 1PO13 2CDPA 4UBGA 1NG0A 2V5DA 4YW2A 4HKWA 3I2OA 3GCWA 3PNAA 3DF0A 1HN0A 5LA9A 1D4M1 4JAAA 4B1MA 2VU9A 5BNPC 1UU4A 5FV3A 5FUNA 4UFIA 3UESA 1PGW2 1W9TA 5CIRA 1G8WA 3DYOA 3I3DA 1AJOA 1LTEA 1QWRA 3A22A 4MXVA 5AFEA 5C71A 2JIGA 3VBHC 3ME2A 1FPN2 1YCIA 2YBPA 1GWMA 4K8FA 5CNAA 1V6NA 2BGCA 3VD4A 1G6NA 1K45A 3JBG3 3FFZA 3WR0A 2FDHA 4IE5A 3H42B 2PHRA 1JUIA 2G4IA 1A78A 3MZHA 2RG4A 1W6OA 1FOD2 5F2WA 1VPHA 2E7TA 2ZHNA 3SKVA 3THCA 5A70A 5F9TA 3R4SA 4GWIA 1S0DA 1BCXA 4WM8C 4QX8A 3R0RA 2QCSB 4UAPA 1JMUB 3KF5A 2XBO1 2FCVA 4XF1A 1YI7A 3AVSA 3L2HA 1ULEA 1W03A 2HWE1 1WLWA 1YFYA 3MLKA 4GALA 5FY4A 1FYUA 1UF2C 1EAH3 5GLZA 4XQ4A 3ZFEC 1OKOA 2WLPA 2OZ6A 4JGZC 1PM4A 3ATGA 3C7GA 1IQAA 4YPJA 2XB6C 3IWZA 1SFYA 1YEWA 2Q8OA 4P9WA 4AVCA 1O7FA 3JZVA 1UYZA 3WDWA 5F3EA 4Z2WA 1QOTA 1X8EA 2YMZA 3J7NA 3PJYA 5JXIA 1BBT1 2W87A 3ES4A 3OGGA 1EPWA 1YI9A 4LO7A 4COUA 3BI3A 1P8JA 3AB0A 5F3CA 1R1A1 5A33B 2KR2A 4N43C 5C3OA 2HWF1 3JQXA 4YFZA 4XBNA 1MVEA 1ND2C 4XJ8A 3WNPA 3SEPA 5IATA 2ARBA 3PUQA 3O5SA 2R073 3T4HB 5SV5A 3WNMA 2GMMA 1DDLA 3U1XA 1D4M2 3KCYA 3O14A 4FFFA 3WF3A 3POGA 1WCQA 4KGGA 1XRUA 1Q3EA 1CD3G 1R093 4YRDA 3T30A 1IZ3A 5IVJA 1F8VA 4PCRA 2VECA 2XGXA 5HV0A 3LOBA 4A3ZA 3ZYBA 4IW3A 2Q8EA 3ZYGA 4YZ5A 3OF1A 5LB6A 3TNQA 4QXCA 1ZA7A 3NRUA 3MIEA 2OT7A 2OUJA 3CLPA 3F2ZA 3OCPA 4BZ4A 1DBNA 5HCHA 2JG8A 2VZ3A 1TMF3 1UU6A 5E6HA 5F6KA 3WD5A 4E8CA 3U78A 3APBA 2A75A 3WG2A 3WSOA 4F7ZA 2Q8CA 1URXA 5FZKA 1GBGA 5DABA 4IV3A 5ABJC 4QKFA 4XTMA 4BK5A 4YW1A 3T2QA 4SLIA 1VB4A 5A6QA 2R0FA 3AZVA 1RL3A 4QDQA 2BU9A 3B69A 5FZEA 3VBRB 1L7LA 5FYIA 1SHWB 1ZNPA 3LE0A 4MO3M 4Q1PA 2F6BA 5D8AA 2RS53 1F5FA 2AACA 2OX0A 4IE0A 4Y20B 2HWE3 3ROUA 1B09A 1W6QA 1LODA 5DN2A 1QJX2 4O61A 1YRZA 1W2NA 1UYXA 1US2A 1ND3C 3MDPA 2VMDA 4CXXA 5IAXA 2EXKA 2X5IA 3OBRA 2AH2A 5A1LA 2Y64A 1JZ5A 1LENA 4HPKA 4NRPA 2VMHA 5BY5A 2BRTA 1WLCA 3ZSMA 5BNOC 3K4AA 1L7QA 2D5HA 4U36A 1ENSA 1WD3A 1RXFA 3GGLA 2JDUA 4B4RA 4P5YA 2DWRA 1RUD1 2DBNA 1N1YA 1R1A3 1HDKA 3N9MA 5FAXA 3UKVA 4BB3A 1FMD2 5EHDA 3Q9OA 1GZCA 4BWOA 4CSWA 4JDOA 4LJHA 4QMAA 4YWAA 1DCSA 3UGGA 4XCBA 3RGBA 4O9GA 4AVTA 1YIFA 5DDJ3 1MQTB 3I2GA 4BDVB 1JYXA 1ENQA 2TBVA 3VKFC 1LHVA 2PN5A 4EWEA 3HR9A 4BIOA 5IVEA 2IXCA 1VMJA 1IKQA 1X9PA 2RJKA 2VMIA 1XBFA 2CV6A 4RS5C 4GA9A 2B39A 2XL7A 3WP6A 5IFPA 4PDWA 3CZUA 1W99A 1MZ6A 1JU3A 1UAIA 4QGNA 2GC0A 3AL6A 4JGZB 3OB8A 4QQHA 5E16A 3ZXLA 4XFFA 2ZGLA 5JLVA 3W58A 3SCHA 1Y9QA 2JDNA 1UN1A 1IPKA 1KJRA 4META 2PAMA 3BCWA 4YM1A 4DB5A 1LOEA 5L7OA 3POFA 4PQ9A 2RS12 3WCSA 4UW6A 4KBBA 3VD9A 3KCXA 2VGDA 2XBO2 5K0UB 4LBQA 1E5IA 1OQ1A 2GNTA 4EWAA 3MYXA 2ORXA 4Q4Y3 1TQ5A 3JU9A 1ZREA 4UFKA 1UPSA 5FMDA 1YWKA 2MHFA 5A7SA 1AYM3 2IXLA 4WVZA 3HQRA 5FP8A 2JDHA 3OD0A 1X82A 5FY8A 4IEQA 3SQOA 3AL5A 1HXS1 2A73B 3INAA 3ZSLA 1FV3A 1PM7A 2UYBA 2R1DA 3PL0A 4XF0A 3O1PA 1PNFA 5A3UA 2Q1ZB 3IMMA 4AQ2A 1ZBE3 3ZSKA 1C5IA 1DLLA 4ONUA 5BNPB 1J84A 1REDA 5FY5A 4EN7B 2ZX0A 5FYHA 3N7LA 4KI5M 4TYSA 1QJX3 4J6GA 5C70A 4D69A 2DVGA 5IVCA 1OI6A 1BKZA 1UMIA 1WGPA 2BQPA 2Y26A 5E8AA 1QJFA 4CDUA 1KQRA 4E4SA 5A3LA 3RRDA 4Y1YA 5KR7A 3H7YA 3W9AA 4AWDA 5CFCB 3F95A 2ET7A 4CDWA 5DXDA 2JE7A 1ZBE2 3ZIXA 4OI4A 4FO9A 4I0BA 2OXBA 3SCFA 1W8OA 5T55A 1U5IA 1W8HA 3OJBA 1JUHA 5EP9A 2E26A 1CAXA 2WNUA 3RYKA 5EFUA 3VKLA 4BIFA 3DL3A 2Y33A 3VD7A 3O1RA 3N9OA 3O1SA 4HVOA 3GCXA 3MO4A 2WO2A 5FZCA 4HSLA 4YW5A 1H9PA 1UMHA 4GWJA 1RHI1 3PUAA 4Z82A 1LCLA 5LY2A 4CUCA 1C4RA 1ZVFA 2LRPA 4CUGA 1RGSA 4E8DA 1PVC2 5E1RA 3O1TA 4NPMA 4JX0A 1DQ0A 1R092 2VVFA 4N7IA 3PJQA 4N7UA 1HB2A 4CEYA 2P4EA 2WWUA 4OMCA 1PK6B 2G9ZA 4L97A 1RUJ3 1F4HA 4ES8A 2YPDA 5DG1A 4Z07A 3H8XA 3MEPA 1SQ4A 2A1XA 4QWNA 3K77A 5FXXA 1H6XA 3V0AA 1KRIA 4JRLA 1WWYA 3FN9A 4H3WA 5FK7A 2QZ2A 4Y1ZA 1DIWA 4W6WA 1ASJ2 2JG8B 3ETQA 3Q8BA 1AR73 2AYHA 4LTAA 3R4DB 3OEBA 1NUKA 2VR4A 1OD5A 4XPVA 4BXSV 4LIVA 1UIKA 5FRAA 4G9SB 4I0WB 4QGMA 3CNAA 1WMEA 4LPLA 2DU0A 2ARAA 1PGW1 2IC1A 1ZZ9A 2HWB1 1ULGA 2VVDA 3M3IA 2VUAA 3J9SA 4ET7A 1ZRRA 5A3TA 3N9QA 5F5IA 4ATFA 4DQAA 2XLGA 3KWVA 4WM7C 3KVAA 1YQ5A 2VG9A 3LPFA 4AL9A 3IDBB 3CQOA 3WP5A 4FQ4A 2DVBA 3EMRA 3D8CA 4FFIA 2Y38A 5DUXA 5CG9A 1PO23 2GN7A 4K40A 2A6YA 5H9RA 3J7HA 2I74A 5A7PA 3VBFB 3LIHA 5FFOC 1FPN3 2VULA 4XFCA 1C28A 1HQNA 2VAUA 5G05L 5GZEA 2B45X 1VE0A 2PQQA 4QPIA 1VBA1 4U2AA 3UYJA 1IPSA 3FWEA 1RIRA 1W6NA 1NCRB 1HQLA 2ZHMA 1QY4A 2A6XA 5FLHA 1H8TB 1GUIA 3NAPA 3THTA 2DV9A 1MS1A 3NV3A 4UBHA 3ZFFA 2XH6A 1H1MA 1BVVA 3N9PA 5K8SA 4QQLA 4PBPA 4FSJA 1BBT2 1IS4A 5FXVA 3WNNA 3ZXFA 2Z4FA 2X5IB 1MPXA 4QPYA 2X8KA 2R1BA 4KQ7A 4KG0A 2QTWB 3FFQA 2L9LA 1GICA 1W9WA 2YUEA 5C9AC 5EQUA 2OQ7A 5C5TA 4E9KA 4JVAA 4D7YA 4OQ8A 2QZ3A 2Y0IA 1VMFA 1QJY3 2ZGRA 5BNPA 2O0OA 2WZEA 4IEXA 5T54A 1OLQA 1AYN3 2VUJA 3AX4A 3LA7A 3ZXJA 4E2SA 2K0GA 1QXJA 5LY1A 2K2SA 4P9LA 4J1XA 3H8RA 4M3CE 3V0BB 2OA2A 2VOWA 1DZTA 1Z78A 2J1SA 2JDMA 2MEV2 1GNZA 1OMIA 2GMEA 4CP2A 5JXGA 3RQ0A 1JBCA 5T3NA 4Y4YA 2FDKA 5LW9A 1DG6A 1LGBA 4XMIA 1QJY2 3I2JA 4HOOA 1A8DA 2PHTA 5C3RA 3ZKUA 1W28A 1AHSA 1XNBA 1OH3A 4TTGA 1RB8G 2QKDA 1LHNA 2GC3A 3GZTB 1BYHA 4LKDA 2HWC2 3ZMOA 1DYPA 2RS51 1GOHA 4RD7A 5FZ8A 3A21A 1VRH3 3NNGA 2IFWA 3WDUA 3ZR5A 4BA6A 2ORZA 4QM9A 2EVXA 5A6XA 1OFSA 4NHKA 5A80A 4AVSA 5CAZA 2E53A 4YG6A 3K4ZA 4JGZA 1WW7A 2VOTA 3BODA 4MSVA 1UMZA 2YV8A 4ASLA 2ZACA 1NE6A 1EY2A 2JB4A 4UYBA 2R30A 4PLMA 4QB2A 2VTXJ 2ZGTA 3LEMA 3ZN6B 3AKQA 2VQTA 5JUVA 1U5XA 1SZBA 3OEAA 2BVBA 2P3JA 4MOAA 1CQ9A 1N3OA 2W2IA 4GB32 3WG1A 3BGAA 5J96B 3RZGA 4NHMA 4LO4B 3B00A 3LEIA 4COWA 5D2AA 2YROA 4LR4A 3N9NA 3ZFGA 3OY8B 3CIHA 1MEC2 1QGLA 1VBE3 2E7QA 2VTFA 2MPFA 4FOWA 5FYMA 3ITQA 5IHRA 3HAGA 4AEDA 2OS2A 2Q8DA 4Q4X3 4Y4RA 3WHTA 1NCRC 2PXJA 2XWBB 2FMYA 2WQ4A 3AP6A 4FI9A 4M00A 1CPNA 4NAOA 3OUJA 3UK9A 5IT6A 1SFNA 3T09A 1YYNA 1JYNA 3WW3A 3J7LA 2YGMA 4XBLA 1JHJA 4XFIA 1T6BX 4DINB 4A7ZA 5BV6A 4FPHA 3JCIA 4N8MA 5GLVA 1AYN2 1UL9A 3PTRB 1ENRA 3MIGA 2WJSA 1H2MA 4MGZE 2HWF3 1CN1A 3RWNA 5CB7A 4EN9B 2BWCA 3B9CA 3OUHA 4PDWB 3RZJA 3KHBA 2WS91 2MEV3 2VZTA 2NPIA 1OPOA 4P02B 1Q8SA 2WSVA 3GJAA 3VBOA 2WN2A 2ZEZA 2V72A 2XVKA 2W92A 4K6BA 3O1UA 3LFMA 3ZFFB 2AENA 5JXHA 4Q4V2 5FTTC 3NJZA 1UZVA 1LULA 2WNVA 1C57A 1QKQA 5CFDB 4F83A 1EV11 1R081 3VBUA 1E5HA 1V6IA 2RR11 2Z42A 1W8ZA 5CG8A 2XMLA 2F4PA 3PU3A 3V0AB 4CZSA 1W6QB 2WNEA 5JSPA 5DAWA 4RGAA 1GQGA 3WNKA 2DFBA 5C4WA 4A41A 1XNAA 1RUF2 4CDXA 1L7RA 4XAEA 4HZFA 3WUCA 2W94A 5LBBA 4QPGB 3BU7A 1VBB2 1RUG2 4LBMA 1XQNA 2C6SA 4OCTA 1WCSA 1CZTA 1RVF3 1YUDA 4AHWA 5FYYA 1IS5A 1JZ3A 3JD72 3RZKA 1DF0A 4LEJA 4AAXA 2VCMA 2CSGA 2EIGA 2YY1A 5BXXA 2DTWA 1ST8A 5GLTA 4AFDA 2YC0A 4IETA 5F37A 3H3UA 1LGNA 4QPGA 3KF3A 4UF0A 1COV2 3CBNA 1RMU1 4FPOB 4GH4A 1HKDA 2VNVA 1GP4A 1TME3 1WKYA 2GALA 1W8UA 4FBFA 4XABA 1WBFA 2W46A 4LBOA 1PHMA 1KEXA 4TWTA 4N53B 2EF6A 5F1RA 1JOJA 5LA0A 2A5ZA 4DXSA 4D94A 1HRV3 3AZYA 1QQP3 1GU3A 2UYAA 5CA6A 4A44A 2YFUA 3FHQA 3MUY1 4NMIA 4PLOA 5I0RA 2A6WA 2QDRA 1E5RA 2RVAA 1RUH1 1HXS3 3NKGA 3OUIA 4LHKA 2BYVE 1WLTA 1CVNA 5CKQA 2JKBA 1R1A2 3KS7A 3LIGA 3ECQA 2JD4A 3G7DA 1BXHA 2EIDA 4Y1XA 4DPNA 3ZDVA 5IVFA 1UOGA 4XETA 1LR5A 1ZBA1 5FKCA 2DURA 3B7MA 4OMDA 1B35C 1LOAA 5F7UA 1NCQA 1DZQA 4HN1A 4KNCA 5HPOA 5L19A 5IK5A 2ZMLA 3CO2A 4RR3A 4UXAA 2HKXA 1VAVA 2HEVF 3MGUA 4CDWC 2RHPA 4HONA 4CDWB 1D7PM 3OG2A 4WVWA 1AUYA 4Z1VA 1W2TA 4XEZA 1GWKA 1VBD3 3ILNA 3DKQA 3L2YA 3SEEA 4UW4A 3DKWA 4CP0A 1XJAA 5C7GA 3CDZB 3RS6A 2WZR2 2ENRA 1H0BA 2ERFA 4AE2A 1XB9A 3KT1A 4QQOA 4BMBA 2YFZA 3LEGA 5JMCA 3BTXA 2AR6A 3WNOA 5CKNA 5EV7A 4AW7A 4A6SA 5GZCA 5LBFA 1VP6A 1KD7A 4H7LA 2FZ2A 3LSEA 3VD5A 1V9U3 2J1EA 2OKXA 4YM0A 2W47A 1X9TA 4LBJA 3M7AA 5KXDA 2B4KA 4CEYC 2NM1A 3AJZA 2PLV2 3AFGA 4LKFA 2DUOA 3I59A 3I2KA 3TEYA 2VMEA 3RZHA 2IXKA 2JDPA 2R0HA 4V2WA 3QCWA 2WNOA 1I6XA 5HXVA 3WLUA 4W8JA 2RDQA 1FAYA 3ZYHA 1ZZBA 4WZFA 2ZGNA 4YGBA 3ZFGB 4AI8A 4AI3A 1QOOA 4AHZA 1I1EA 1KFUL 4BQ4A 2CY6A 1W6MA 3A4UA 2XLFA 1GZWA 1IHMA 3IPVA 4EN0A 3SHRA 1OA4A 4Q4V1 4KG8A 1H2LA 4S2GA 4NR1A 4LA2A 4Y3OA 4OUEA 2VOXA 1HV1A 2P5BA 4YW4A 5FYCA 2HEYF 4MGSA 2VOKA 3PVEA 4R4ZA 4F3JA 4MLOA 1W9YA 4RYDA 3ASIA 5I91A 5M0TA 4NIIA 4BU2A 2IWGB 1S2KA 4DEQA 2MNGA 2VO5A 3MLLA 4FPLA 4GZ9A 1AR93 3ILRA 2WWSA 2J7MA 3I2HA 4N90A 4Q4X2 1XSQA 4WM7A 4AXOA 3JB8A 2XJSA 3DPRC 2RM22 2YZ4A 1LOFA 4IV1B 2Y6HA 2LS6A 2ET1A 2VNRA 4NPRA 4R4XA 3VHRA 5LK5A 5JCTA 3A0NA 1X8MA 2XJUA 3UNPA 3PHMA 2W1QA 1VMHA 3C7HA 4LK6A 4AI9A 2ARCA 1ZRDA 1AXZA 2CDOA 2PELA 1SBDA 3KSCA 3GZAA 3GZUC 2HH9A 2C5DA 4X8PA 5FZOB 2ZA9A 3CEWA 3NKTA 3VV1A 2OVUA 4ZXEA 2ZGSA 2R043 3P1IA 4MHRA 2HWC3 2K46A 4N53C 3MHZA 5GKAC 1CESA 3ZFFC 3K4DA 5I0SA 2E9QA 4GKYA 4EN8B 4P5HA 3FMGA 4MGKE 4GB31 3OGRA 1IG0A 5ABJA 4D0QA 1RUG3 2YBKA 2ZGPA 2ATFA 1PGL2 2D5FA 1CAXB 2EIBA 2WNUB 3RVHA 1J1TA 5JOYA 1E5SA 1PO12 1NY72 1M4WA 4QKNA 3UGHA 4B8EA 5FQ0A 3H0OA 1K5MA 4NAMA 3KGLA 2BV4A 3AMMA 4UFLA 4LLOA 5FJHA 5LEJA 2C1FA 1VR3A 2ZEXA 1QJU1 3SNMA 1QJY1 4QM8A 1PO21 1N1VA 3UT0A 3MI8A 4RA0A 2GH8A 2IXIA 1HV0A 4KMQA 4UFHA 4YGDA 3FBMA 4PI2A 4JKKA 2VE1A 2J1RA 4R9DA 4XJUA 4YVSC 5TSWA 1MQTC 3AFKA 5FYBA 2X5IC 2A3XA 1TE1B 2VBBA 3S5AA 1YQCA 1XU1A 1U5ZA 3S30A 3WDVA 4GH4B 4AEDC 3HNYM 3KQRA 4BXFA 2V5YA 4Q2FA 4DUWA 1RUD3 1FOD3 2DCKA 5LZ6A 3DV8A 1UO9A 3RI8A 3FLPA 4CCKA 5JSOA 1RINA 4A7YA 2W1UA 4QQ2A 1TME1 3TEWA 1NA1A 1S55A 4HSJA 5LATA 4C90A 4C1WA 5KC6A 5J09A 1POQA 3WXPA 1OLRA 1ODMA 2R7EB 3KLSA 1H8VA 4I02A 2LUWA 1H2NA 3MLJA 3ZN4A 4CP1A 2GNMA 1IKPA 1ZM1A 1AYM1 3WG3A 4NWVA 3TN93 4HLTA 3J8F1 3VDDB 4ARXA 4GMP0 2C9KA 4RQPA 4LORA 3L9JT 1FNYA 3NO8A 3TB0A 5HBAA 4NIGA 5A3PA 2QQPA 1FNZA 1W0PA 1GSLA 2VZQA 2WQ8A 4ITCA 5FDBA 1GWLA 1EPZA 1QH6A 4RFT0 3T4VA 2W9XA 4Y1VA 4CUBA 4IE7A 1UWWA 1J3RA 3IN9A 1W06A 2D98A 3B01A 3JBG1 4RQPB 5DDJ2 3OPTA 1TVGA 4TSVA 5IFTA 1Y7BA 4JQTA 4XIKA 1GZWB 2PFWA 3ZX7A 2WFF2 5GJ6A 2D43A 3CKHA 3HN3A 3AMPA 2HWD1 4FTBA 1QEXA 1YQ2A 4XFHA 1PVXA 4MUVA 5D8AB 4QU1A 3VGIA 2VZUA 4COVA 1VALA 3R4UA 1DP0A 5C3QA 1XNTA 1UKRA 1QJEA 1ASJ3 3BOWA 2EALA 4UI9L 3VKMA 5LA2A 5T52A 5K4LA 1UZZA 4QT6A 4FOQA 1MVQA 2VZSA 2WFF3 4FOVA 3ZN6A 3WQ1A 2NMOA 1ZYBA 1QF3A 2VCCA 4Q5OA 5ACA1 1REEA 2I2SA 4CVUA 3J7MA 1JI6A 1QDCA 1TEIA 4HG6B 5I8TA 3VDAA 1BQPA 5J37A 4OI2A 3IM0A 5FZAA 4AFCA 1H9WA 1S0IA 5FLJA 4DOUA 2UWBA 5DQ0A 1MACA 1Z7S1 4Y5TA 3RSJA 3I3MA 4CEWB 2IVJA 4I2OA 1SBFA 3PMSA 2WZR1 4MV2A 2PLV1 1V6JA 3LCPA 3BKZA 4QPGC 4CXYA 1RYYA 2VQAA 4AFAA 5HXMA 4CDUC 1ENXA 1HRV1 4FPCA 1SFPA 3EQEA 5FPBA 3AKRA 4TXWA 3K51A 3VZLA 4TLGA 2Y34A 1O3TA 4UF0B 4TLFA 1A6CA 2Y6FA 2W0XA 2UURA 5IAVA 2J1VA 1O5UA 2QE3A 2TNFA 5FZBA 2V73A 1KJLA 2JKXA 3HN1A 2R49A 4Q0UA 1OHFA 3ZLIA 3U10A 1XYOA 2BPA2 4BMEA 5J98B 4LNVA 3DN7A 4DMIA 5CFCA 1C3HA 4AK3A 1RHI3 5KHKA 4FFGA 2RM21 4E4HA 4HN0A 4PHZA 5EZWA 1XU2A 3KVBA 1COV1 2DCZA 4GQ7A 5FZHA 2A6ZA 3AYAA 4M0HA 5FYTA 1AVBA 1POV0 1IOAA 1LKNA 4K21A 3U4SA 4AVVA 4YYOA 2WA4A 4LXLA 5C5UA 3HMYA 5KC5A 5L36A 1JOBA 1T2XA 1YXWA 2BFUS 2PHLA 3DUIA 4AAPA 5ABJB 3NNJA 5JIAA 3OGVA 3DPRB 4KU8A 4ZPIA 2EIEA 2DBIA 1FPN1 1PZ9A 5L9VA 5L9BA 4K1ZA 4WBBA 1LU2A 4OZXA 5FY0A 2HJIA 3NJYA 4XF3A 3LDKA 3ZSEA 1IGOA 4RR3B 4C0BA 5FWEA 4O9EA 1J58A 1LESA 4UWDA 1W2UA 3E6BA 2QQKA 1RUJ2 1DFQA 2GN3A 1BBT3 3D4KA 4LO5B 3DEMA 1WMXA 4BQ2A 3PUSA 4CDQC 4C0HA 2WZR3 2HWB2 4W50A 1HJFA 2KM2A 4XXPA 5EWSA 4M3CF 1RUG1 2P37A 3HQXA 3I8TA 1CAWB 5FUPA 5A7WB 2LW8A 4Q4Y2 4R9BA 4N43B 3FX3A 4RS5B 1V6OA 2Q1MA 1AXKA 1G7YA 1OKQA 1ND2B 4S2FA 5FMOS 3U07A 3OYWB 3KV6A 4FT8A 2G9FA 2H0VA 1V0AA 2B46X 4XUQA 3AYCA 2PHWA 4D7SA 2E6VA 4G3YC 2D6MA 1RUH3 2WO7A 3LSDA 3X29B 3KV9A 5LK7B 1UQXA 3NL1A 5FZ3A 2BOJA 2WIIB 1HB1A 4LO6B 3K2OA 2P1BA 1W39A 2QQVA 3NAPB 3PIGA 5JI7A 4Z2AA 1D4VB 2BBAA 3BTAA 3KZ4C 1GNHA 1W2AX 5HCBA 1RUOA 5FO7B 3GHNA 1GP6A 2UWCA 5DZEA 4WV8A 1UY2A 3SMHA 5C8CA 3VDBA 2XHKA 2ZAAA 2DUQA 3WOGA 3WP3A 2HWD2 3NAPC 2XLAA 3TBDA 2VQUA 3KB5A 4UW3A 3ACLA 3RJRA 3KT4A 2CGNA 1D0GA 1AL21 3QH7A 1VB2A 5DDJ1 1PIV1 4Y20A 5FY9A 1ZBA2 3NNMA 4L9BA 3LKJA 1Y9MA 4JCKA 4M4RA 1KS4A 3I54A 1HRI3 2QQIA 2R6QA 2XVGA 2VZPA 3MV11 3PVOA 3A7QA 4IE4A 4Q0SA 4WVMA 4YARA 4XDOA 4NJ4A 4NROA 5AVAA 3V56A 3ZPOA 3M70A 4BQYA 3E6CC 1ZBE1 3ORJA 2X09A 1AZDA 1AL22 2JENA 2OPWA 1AR71 1RTVA 1TNFA 2FCUA 4NIHA 1OOPC 5JZGC 3RI9A 5EJ1B 3T0AA 1PMJX 1QDOA 4K20A 1Q8PA 5CU1A 4JKLA 4LHNA 1GLHA 3PIJA 4WVMB 1US3A 3R05A 1JU4A 2BZDA 1XNKA 2W1SA 1QNWA 4G4FA 4PJYA 1NQJA 1CJPA 5KWRA 2VC9A 2Q1FA 1JODA 4N53A 3RMXA 4A6OA 4NO4A 3VKNA 3TNPB 1U0AA 1SLBA 4Y22A 1TZOA 3E5QA 1UW8A 2Q30A 5BNOA 1HB4A 4NWWA 3WEZA 5A6ZA 2XOMA 5ANQA 4LBNA 2Z5WA 4AEKA 2DFCA 5KHHA 2XVLA 2ZMKA 4GIQA 3VL9A 1UOJA 4YM3A 5I93A 3CJIC 4BISA 2PHFA 2FDJA 4CU8A 3KHCA 2WLQA 3H9AA 2GMPA 2P6HA 4IV1C 1N3PA 2GC1A 2VZ1A 4KL1A 5FLIA 4MVTA 3VLBB 2FMDA 3AKTA 3ZR6A 4C1XA 1W3XA 4LIUA 3IMNA 1YFXA 4MGQA 5FWJA 1HQWA 4FTSA 1GNYA 3D0SA 1FMD3 4HKOA 3SH3A 1WMDA 1CX4A 3DPRA 4RN5A 1AR62 2R063 1QU0A 2Z69A 3B9IA 3HT2A 4QKBA 4IGOA 4XMAA 4CU7A 2WWJA 1OH4A 2O8QA 5DAXA 3ZFEB 4K1YA 3H3LA 2WS93 4O7XA 1XOYA 1JTZX 1BEV1 2R072 3JD73 3OY8A 4GJZA 3RFRA 1L3JA 1R091 1NXD1 1NAEA 3MBWA 4R8HA 5A1FA 1UOBA 1NA1C 1AR63 1RHI2 2PHUA 4N9IA 3RJ2X 3ZFGC 4JC1A 3N4MA 3IKWA 2DCTA 3ST7A 2E33A 2YG0A 4QX3A 4YG3A 5A3WA 1OVPA 2HEWF 4XURA 5A32B 5T50A 1A34A 2F4LA 5L7OC 1SMVA 1IPJA 2ZKNA 3H7JA 4GMP3 1V6MA 3AZWA 1DU3D 3DYMA 4W4ZA 2EA7A 5DUWA 2QQJA 3WQ7A 2D44A 1N1SA 5A32A 4QX0A 4MGIE 4UW5A 3T08A 2VCBA 3CF6E 3AMHA 3DGTA 4C8DA 3AP4A 1RUE3 4W65A 5IWFA 1AL23 2VZVA 3NJVA 3PU8A 4AF9A 5BNNB 3SISA 4CXWA 4LBQB 4BYYA 1VRH1 2XXZA 4RFRB 2FCTA 4BM8A 4TZDA 2E32A 1EAH1 3UETA 5HCAA 5FP3A 4EYUA 1NKGA 1POV1 5FYUA 5LRRA 3GBGA 2QFEA 4DRVA 1GKBA 5DAVA 1V6LA 2ZKLA 5EPAA 4QX7A 5F2SA 4IQPA 1EYBA 2D40A 3GHMA 5DAQA 4DXRA 2VMCA 2JB8A 3POSA 1VBA2 1YFWA 5LWBA 3IPVB 2BUKA 3VHOA 2AEYA 3MIBA 3ILFA 4OVEA 1LGCA 2AEZA 2E31A 4ZZ5A 4E2QA 3CU7A 3WVJA 4A42A 1XYPA 2WUHA 4HANA 4CCDA 2DUPA 2XG3A 3HJRA 4QXBA 4HKLA 1CONA 2PYTA 4FP2A 4LHLA 4NRQA 3RMYA 1W04A 3C7FA 4MYEA 1K12A 2C24A 2GP3A 2NN8A 1VBC1 5APAA 4D8MA 1F4AA 2TUNA 2XONA 1SLLA 3KM5A 4QAWA 5ERLA 1JN2P 2R062 3GZEA 4NPLA 2P3IA 1PZ8A 1CZVA 2GNDA 4HBNA 4HPKB 4RHV2 2GDFA 2JXAA 1REFA 2ZGQA 1KDMA 2GZWA 3VL8A 3CMGA 2ILMA 4GMP1 5CFDA 1UXZA 2VMGA 3NJXA 5G04L 1ZBA3 2G19A 4ZS3A 5JXJA 5FJKA 5I0DA 4ZHNA 4JTOA 1YQ6A 5KXEA 1LHWA 4OHVA 3Q8FA 4QU2A 4D7TA 3ON7A 3H8UA 1JW6A 2C9AA 1JYWA 4GH4C 2QQLA 4AEDB 5B4XA 4IEVA 4ZU5A 3VUOA 3ZYPA 3AM2A 3AK0A 3WW4A 4CU9A 3NW4A 4LO8A 1K5MB 3DXTA 2C26A 1PZ7A 3GF6A 3A0KA 4ZS2A 1F31A 2IUWA 3WX5A 4AGRA 2VNGA 1H1AA 1C1LA 2JWPA 1AX0A 4AQSA 5ISLA 1CAWA 5FZDA 1AYN1 1RUNA 3O1MA 2W52A 2R041 4NRMA 5CISA 3MV01 1ONAA 3D6EA 1FATA 1H8TC 3KCCA 2W08A 2WBKA 4QQPA 5FKBA 5AC93 1VIWB 1FI2A 1V00A 2W5FA 4CCNA 2JECA 2LTNA 3AXEA 5FZ4A 3TAYA 4KWKA 1Z7S3 4MXWA 1OLME 2ZAHA 5JWPA 3WG4A 1ND3B 1JXNA 3D0JA 4H14A 5F5CA 1OUSA 1KFXL 4RR3C 3OTFA 1LJ7A 2VW0A 1HRV2 1ODNA 2NMNA 1V70A 3USUA 5ACA2 2WABA 5B4NA 3MF6A 4EROA 4QPIC 4OI0A 4OFGA 4IERA 2IVIB 4IL7A 1DHKB 3PMEA 1BHGA 4CDQB 5A7OA 1NCQB 3NNLA 4QXKA 2JDKA 5FPAA 1JYVA 3LGRA 1ZX5A 2ZABA 3K46A 4LLFA 4XDQA 4UFJA 5BPXA 5ACA3 1UX7A 2WR9A 5EJ3A 4HK9A 4QHBA 3RZMA 1MEC1 3Q8CA 5A7NA 3W5MA 3I7DA 4XW3A 5FZ7A 5FXZA 2E51A 2XKOA 3PVNA 3SITA 1AR91 1U5YA 3OSDA 2RS32 5BNOB 4YW3A 1GQHA 2XJRA 1S0BA 4Y22B 5FREA 5JIUA 3UJQA 1QIQA 1CR7A 3LA2A 4LE3A 2RDRA 1CWPA 2QQNA 3FUOA 2Y6LA 1C1FA 2ZBJA 3W5NA 1W6MB 3C2UA 4JTNA 2VBPA 4Q26A 1APNA 2WFPA 1NLSA 5DAPA 3U4XA 3TN91 3P3PA 4S2DA 5FMCA 5FO9B 4YVWB 3JXSA 2HYKA 1I5PA 4CEWA 4AFMA 2X10A 1LOBA 4HETA 2XL9A 4QX1A 5A3OA 2A3WA 3VN4A 4ZZ8A 1JHNA 3IIIA 3ACIA 4K3UA 4D6QA 2H6CA 4OZOA 3AYDA 4Q0PA 3B5LB 4AHYA 4DUVA 3BYWA 4XJ9A 1W6NB 1GMMA 3JQWA 1AJKA 2Y6KA 5A6YA 3HNMA 3S57A 4PIZA 3FBYA 4AFBA 2XQRA 2WRAA 3POBA 2HYXA 2P34A 4NIAA 1W90A 4P9JA 2PHDA 5FZ0A 1JZ8A 4BCUA 2P2KA 2ADDA 4BQ3A 3AKSA 1WCDJ 1J1LA 2FQPA 2ZGUA 5A7WA 4OYUA 4BK4A 3VZMA 1GZ9A 2RJLA 3AMQA 1VRH2 2A7AA 2DVAA 3T0DA 1LOFC 1O5LA 1VAMA 4WM8B 1ZRFA 4XUTA 2WO3A 2ZMNA 5FPLA 5HI0A 2MEV1 5EYYA 1WW6A 2XUMA 3ZPYA 3MF9A 1D0HA 1DYOA 2JG9B 5FZ1A 4QX5A 3VZJA 3FC0A 2WAAA 5AFBA 4CUAA 1BK0A 4I01A 4KWUA 2FBEA 4JV4A 1LB2A 3LA3A 4Y5SA 4E4DX 5IYYA 4WM8A 5F32A 4B4PA 4AEJA 2YBSA 2SLIA 5FCCA 2J1TA 5DPNA 2JG9C 2VL4A 5ANNA 2BTVC 4CU6A 2DTYA 3E6DA 3H1MA 3VBUB 1XSRA 3ACFA 3ACHA 3C7OA 2PHXA 1SBEA 4XUNA 3BALA 2JE8A 1AL0G 1SEFA 5BNNA 1KDKA 1F9KA 4BLIA 4YVWA 1H4GA 4PF5A 2ZCWA 5KXCA 5FYZA 3SKJE 3UKNA 4C91A 3ZXAC 1QJX1 2Y6GA 4YZ1A 5JR7B 1WMFA 2ZGKA 4CE8A 5GM0A 3H1WA 4FPYA 5FP4A 4P9IA 5LRSA 3N3HA 3LD8A 3VZOA 3U0ZA 1YC61 4IGQA 4YFWA 3VZKA 1A8MA 1DZRA 3K3NA 1CIYA 2CU5A 2JEMA 3TWIA 1O4ZA 1K5MC 1JOPA 3POEA 4RHV1 1J59A 5A3NA 1OVSA 3MW2A 2A6VA 3ETPA 5FIXA 3RYPA 2DVFA 2VUDA 1MZEA 3LPGA 2PAEA 1W8WA 3C8XA 4UT5A 3O0WA 4OQ9A 3JB4C 1NZCA 3H3ZA 4ARYA 5GZFA 4A2UA 3I2IA 4XAAA 3ZYFA 3O7OA 5FY1A 1OBNA 3ES1A 4YGEA 2VCAA 5KHGA 4AGVA 4GWMA 4W6XA 3WINE 4CPBA 4BH9A 1N47A 2RMU1 3HBZA 1PVC3 1AR81 4NOTA 3VBOC 3HVDA 1W6PB 4FVVA 1I3HA 4BQ1A 4E27A 2JDAA 1WA6X 2WNVC 5CADA 3THPA 1PIV3 4LT5A 2B8MA 1JH5A 2P6CA 3MFCA 4FTEA 1X36A 2WINB 3B94A 4CCOA 3P6BA 1PNGA 3CJIA 1PMHX 5LBCA 2YB7A 1AYM2 1HRI1 1W05A 1LOGA 1S0GA 2KXLA 2W91A 2DYCA 2VZRA 5K9YA 4Q4W3 1N3QA 4WM7B 3NV4A 4RQPC 1V9U2 3EBRA 3USUB 1NOVA 2AGSA 1LEDA 3ZMNA 2RDSA 2XJTA 3MUZ1 3QD6A 1S0EA 4DIQA 1YLLA 4FP3A 4QPIB 3I2DA 2A70A 1ND3A 4LBQD 3GNEA 4AOCA 5H9QA 2E63A 3AZZA 4ZU4A 4CDXC 1DQ2A 3ZXEA 4ISQA 4YSFA 1OURA 4XFGA 2I07B 4RL7A 3CJXA 3TN92 3ZXDA 2R071 1SLTA 5EIYB 1BEV3 3JD71 3LOIA 3WF0A 3MW4A 2VW2A 3GDBA 1VBD1 2GP5A 4FPGA 1W8NA 1GANA 2DF7A 3T1LA 1AR61 5C6CA 2YC4A 1QJU3 2ZX1A 1UY0A 3ZXKA 5BYNA 5F3IA 3G6JB 2OYZA 4QB1A 1QNYA 1EUTA 3MIFA 1NXMA 1OF4A 4DEVA 1Q56A 3MPPG 1AR92 4FFHA 1BEV2 5JOXA 3BIWE 1O8PA 3IB3A 2OQ6A 4AR2A 4IGPA 4YVSB 4YW6A 3E97A 1YQ8A 2YYOA 3CHXA 2RM23 1R1ZA 1UIJA 4FXKB 1SDDB 3KT7A 3IZOA 5FZMA 4LUMA 2NZ9A 1FOD1 4NHXA 5JZGB 3A23A 2VY0A 1TG7A 3SC7X 5F3GA 4JHZA 5JMOA 4YW7A 4HVQA 2UU8A 3EXUA 4WVVA 4L0PA 1GZTA 3GJBA 4L8QA 4AZZA 4BE3A 4NUBA 4XJZA 1BMV1 1LHUA 1G9FA 2ZTNA 2QBXA 4GULA 2EAAA 2ZEYA 4DXZA 2J42A 3GXUA 1V6KA 2SBAA 1BLZA 3QACA 2PA7A 4Q4V3 2D93A 1HX6A 4QPWA 4Q4W1 1B35A 3BPZA 1POV3 5LA1A 2W1WA 2F17A 2VJXA 4HL0A 1G9CA 2O1QA 3ZM8A 5JAXA 1HLCA 5AVPA 1UX6A 3BB6A 5BUVA 2RJ2A 2O8OA 3O0XA 4HFSA 4IEOA 3VBFC 3QLQA 4Y5Z0 1OQDA 2E7AA 2QDNA 2P3KA 3AYEA 1XPWA 3EJKA 3I3BA 4BJ0A 5JOZA 4NE9A 4I3PA 2UY9A 4AVBA 5FZ9A 1H8TA 1J3QA 1ULFA 1FX5A 1HN1A 2IFRA 2JX9A 3WDYA 4A45A 1XYNA 1PVC1 3ZYJB 1QJZA 2B9UA 4S2HA 1STMA 2QJVA 4AVAA 1IQDC 4OUMA 1PK6A 1FT9A 2XBO3 4XCAA 1W2OA 4TN7A 1ULPA 1DLCA 5IJRA 2BNNA 4QX2A 1UZWA 3LF7A 3VB9A 3O1VA 2WZPP 4BQ5A 3OBAA 5JVVA 2N7GA 3S6PA 1HB3A 4NIDA 2FZ1A 4RGKA 4ES9A 2ES3A 1X7NA 2W3JA 4K9SA 2GNBA 1RVF2 2VZOA 2HWE2 3AJYA 5CFDC 4XTPA 3THDA 5I0UA 1ZRCA 4HT1T 1CX1A 2AC1A 3O0VA 4JZRA 4P08A 5IVYA 3ENRA 4URTA 2VW1A 2WNUC 3LDRA 3N35A 4JRAA 3GM8A 1H6YA 1RUE2 4J25A 4D6RA 1TME2 4OULA 3ABZA 2Z79A 4IESA 4LBLA 4EE2A 1QJU2 4RGGA 4CDQA 1O3RA 1JZ6A 4Q0VA 3LZZA 5EXOA 4CCCA 1W8TA 4CDUB 5FK8A 5DMYA 2G9GA 4HVRA 3ZXGA 1PO11 3SLIA 3VZNA 1QH7A 2AZ5A 2X29A 4Q27A 4XHXA 1YO8A 1AX2A 1HXS2 2YDEA 3DXUA 3M3CA 3E5XA 3ZOIA 1O8SA 2YHJA 3FL7A 4DZGA 5FOJB 5FPUA 3I49A 1O3QA 1IS3A 4Q8KA 1EV13 1GYKA 1JS9A 1R083 4FOYA 2D6NA 3NMBA 4LMFA 4H2AA 4OLLA 2J22A 3T1MA 3BTZA 1SLCA 3MPBA 4DNYA 4A3XA 3H8OA 4AQTA 3LEKA 4WZCA 5DZGA 5J1XA 3SH5A 1DYKA 3WF4A 5FYSA 1KGYA 2ZX3A 3B02A 2KA3A 1KITA 3OPZA 3ZKYA 4MGYE 4BOWA 3LB9A 4LKEA 4L99A 3RZLA 1XNDA 1X50A 3LAGA 1MZ5A 2VM9A 4OHXA 1RUJ1 3HQUA 3VHNA 4FAGA 5FR3A 5J3UA 4XACA 2W68A 3WP4A 1RUF3 2VBDA 1VBD2 1SPPA 3WF1A 2C4XA 1OXCA 4OHWA 4B3NA 4Y24A 3AXDA 1RUI1 2RS13 1G86A 3ELNA 3K75B 2YPJA 4BHPA 3GALA 5H9SA 1RUC2 3U37A 2GSYA 4Q8LA 3U11A 5C8CB 1OFNA 1D4M3 4IEUA 2D3PA 3AC0A 4KWJA 2RE9A 1Y4WA 4OUSA 3VBSC 3VBRC 1DQ4A 4KGQA 5HCFA 5JDBA 2W39A 3D82A 2ZJCA 3WF2A 2B9VA 4GKXA 1GOFA 2JJ6A 3PUIA 2EICA 5I8SA 1S1AA 3UL2A 4IDZA 2WAOA 2XKPA 1NZIA 4GB33 4MHUA 2JG9A 3NNFA 4H55A 3KGZA 4LHSA 4ASKA 2YU1A 1HRI2 2ID4A 4XBQA 2WKKA 2WQZC 2D6LX 4I3GA 3RZZA 4YVSA 3KQ4B 4XJWA 5BNNC 1MQTA 1VBC3 4R9CA 3W20A 1LECA 2GAUA 3ZO0B 1MS5A 1RC6A 2ARXA 3ACGA 1DGLA 1DGWA 1WA4A 3ALQA 1DGRA 1WW5A 2CWMA 1MS4A 3HOBA 4IEWA 4EZHA 2G1MA 3OD4A 3WW1A 2RS52 2PTMA 2W95A 3NSTA 3POIA 2QQUA 4QHZA 4YZ3A 2V4AA 5A7QA 2LM3A 5FZIA 1JZ2A 1UY3A 1NY71 3ZYIB 3M8LA 3P3NA 1WUVA 1CPMA 1EUUA 1OD3A 1XE0A 2VUCA 3KMHA 3NV1A 4L11A 1YHFA 4QXHA 1NX9A 3J26N 5DZFA 3UJOA 3AP7A 1W0OA 2D97A 3T0BA 4K8RB 4XOGA 4BQWA 4IEYA 1TNRA 3PTYA 4COZA 1C8M1 3EYPA 1NA1B 4B29A 1ASJ1 1SLAA 4EQVA 3R6SA 5IK8A 3UKTA 4IUGA 4LULA 2H0BA 1GOGA 3GYDA 2RV9A 4DO0A 3VDDC 1OLMA 3W21A 5GZDA 3WUDA 4JGYB 5T5OA 1CGPA 3J8F3 4PF1A 2BWAA 2PMWB 1S2BA 2RS33 3N7JA 5DUUA 5AC91 1MS8A 3FUQA 4X6QB 1ZRIA 4XZPA 4I30A 3HWJA 1F15A 2ZZJA 5IVBA 3Q8EA 4YVWC 5FZLA 4R9AA 2DCJA 4V1PA 1OSGA 3I4IA 2BVVA 3NV2A 3PDQA 4B7EA 4XXAA 3CJIB 3H1YA 3J8F2 5D1IA 4W6YA 5KXBA 2PAKA 1OQEA 2QVSB 4MGTA 1ZZ6A 2IXJA 1QMJA 1XE7A 1SCRA 4XF4A 2XR4A 3N9LA 4XZUG 4CCLA 2BEOA 2VQ0A 1PMIA 4EZ4A 3OBZA 2J1AA 4SBVA 4DY5A 4RHV3 1W8FA 2X05A 2Q0AA 4IEZA 1Y43B 3I97A 4LOTA 2BNMA 3FZ3A 5DUVA 1O4TA 3QOPA 3AKPA 4A4AA 2UY8A 2P3YA 1LNSA 2VXRA 2JDYA 3EHKA 3S0MA 3M3OA 1ULOA 5CZKA 4JKMA 1SACA 2VVEA 3N36A 1GV9A 1OA2A 4PQQA 1QOSA 4EV0A 4MADA 1J3PA 1NCRA 1F2NA 1OOPB 1UYPA 2WN3A 1D2SA 3C3VA 4AGGA 2FDGA 1KS5A 2BJSA 2CNAA 3AP5A 3CL1A 2CAVA 1UKGA 5BNQA 1T6GC 4DY3A 2Y8KA 4MZUA 2YU2A 4LA3A 4XDPA 3E5UA 3KV5A 2VTXA 1C8M3 4XVHA 3S7IA 2AUYA 3T2PA 1XXNA 4Z8BA 4UOJA 1H30A 5FZFA 4CPBD 5JI9A 1Q43A 4B1LA 4Q4Y1 4MX3A 5K0UA 4CDXB 2VXJA 3TOJA 4AHXA 2CGOA 5T5PA 1QQP1 1WLDA 3POJA 2D7FA 3M3EA 4BQXA 1Z7S2 5GZGA 5FZOA 1MS3A 4OI1A 5FPVA 5FPXA 4CCEA 1H1IA 3PLQA 3FLTA 5LASA 2Q5TA 2DDUA 3RPQA 4XC9A 3B3QE 4BPZA 4CRQA 2ZZQA 1TMF1 1C8NA 3OBTA 1I5ZA 3IT8A 4P9XA 2BDRA 1PGL1 3BOPA 3WNXA 4Y1UA 1ALYA 2XPJA 1IS6A 2WL1A 2VPVA 4YNIA 3U75A 5KBFA 3D3AA 1LRHA 4HXCA 1XNCA 4KU7A 5FYVA 2ZX4A 4NHLA 4AI2A 2KD7A 4M0NA 5H9PA 1UCXA 4IEPA 3W59A 4FPEA 1SG3A 3C7EA 4ISRA 2BGOA 4PIXA 4X8NA 4KBZA 1RVF1 1RUI3 3POWA 1W3VA 4UFMA 5C4WC 4INDA 3VBHB 1UD1A 1S0JA 4V2VA 1ZZ7A 1OT5A 5FP9A 2J1UA 1F35A 3LFIA 3TRSB 2BBVA 4KH9A 1QHDA 5FY7A 1O59A 1MZFA 4L2NA 1W9SA 1RJ7A 1ZZCA 4HMZA 2ZHKA 3NVCA 3HNBM 4AQ6A 1WCUA 3VBHA 4CCJA 2JD9A 5T5LA 1AR72 1HIXA 5GLUA 1GP5A 1NT0A 2YC2A 4GAZA 1SPPB 1RUC3 3URFA 4YZ2A 4XF9A 1QXPA 4JGYC 4XFBA 3VD3A 4OHYA 2XDVA 1FXZA 4CTEA 3RWKX 1SDWA 4LOSA 5FBJA 5FOBB 1VAKA 4PBOA 5J7MA 1S0CA 1I9RA 1MS0A 5F5QA 5FMOL 1XE8A
chains in the Genus database with same CATH topology
5JPMB 4Q0QA 4DFSA 1RJ8A 3M4FA 1ZA4A 2RMU2 3V64A 5AC92 1Q8VA 3ZN5A 1VBE1 1PO22 4ASMB 5C8CC 4GWNA 1VBB1 4CYDA 2BFUL 3ZYRA 2ETEA 2TEPA 1BMV2 2ZPXA 3POYA 3RNSA 4L92A 4XFAA 5IK7A 5I8YA 1OPMA 3D5OA 4I09A 1GFF2 2D6PA 2Y0OA 3IIAA 3MW3A 3QH6A 2NQYA 3MIDA 5K7PA 1AXYA 5EYXA 3RG0A 4ZKTB 4Z92B 1RUE1 3N7MA 4E2GA 2CAUA 2R061 2GU9A 1UZYA 4N43A 3WDXA 5DG2A 2DCYA 2H6BA 5F6LB 5SV8A 2RR12 1ND2A 3OGJA 1NLRA 3SH4A 1A3KA 3WHUA 2XJVA 4YG0A 1EV12 1R082 4QGLA 3VKOA 1OOPA 5JZGA 1X33A 1VJ2A 2B42B 3EO6A 1WBLA 4CEWC 1CAUB 1UPIA 4XIOA 4XILA 1VBA3 2XWJB 4XHBA 2GH2A 5C9AB 2R042 1LHOA 2WC2A 2A71A 3O12A 2JG8C 4Q1RA 2HWC1 4XQWA 2BW8A 1LU1A 3USSA 5C8WA 3GBFA 1RUI2 3WQ0A 1WCKA 2WT0A 1RITA 2XJPA 2PLV3 3AZXA 3WY6A 1PIV2 2EXJA 2ZHLA 5C9AA 1BK1A 2LALA 3ZFEA 4IV1A 3WCRA 2WS92 1O3SA 1G9BA 5D8AC 3H50A 1RUH2 2ZGOA 4AI1A 1DQ1A 4OHZA 1Q8QA 1VBB3 2UWAA 4MXWB 1RMU2 4EWDA 4E4ZA 2CWSA 1ULDA 5FO8B 3TYJA 1G9DA 5J36A 4BLJA 1AF9A 2BNOA 4COYA 3FE5A 3V0BA 2YXSA 1Q8OA 4M3CB 4Y26A 2RMU3 2D6OX 2WSUA 3RDIA 1RMU3 3VBSB 1U12A 2OPKA 3IBMA 1CAVB 4J1WA 4JDNA 2OUHA 4JDMA 2ZS6B 2C0ZA 1TMF2 1MS9A 3HT1A 1RUF1 2JDZA 1KXGA 2WT1A 3I59B 4N9HA 3FJSA 3WT3A 2A3YA 4ATEA 1YNAA 2ZX2A 2OIIA 1C5HA 2EXHA 1YJKA 3T2TA 1CJDA 5A3MA 1PGSA 3J4UH 3VBSA 4EN6B 4ZU7A 3VBRA 2QNKA 1JYCA 4IV3C 1YJLA 4FQZA 4QD2A 1QQP2 1Y3TA 5FPZA 4PDWC 1UU5A 5LEKA 4FPJA 1EP0A 3MIHA 3N7KA 1EAH2 5CVRA 2VH9A 3WV6A 4A7KA 2CTVA 1NE4A 4DRRA 1Q5OA 1LOCA 2OW4A 4KWLA 1H4HA 1COV3 4XJAA 1D2QA 1E57A 4XQDA 4CEYB 2CYFA 1LEMA 2DU1A 3WDTA 4FXGB 3VBOB 4F8AA 3K48A 3FHIB 2WT2A 5L73A 3M3QA 3V65A 2HWF2 4I0AA 4B4QA 4Q4X1 2OZJA 3WW2A 1BVP1 4M3CA 4IV3B 4PIYA 1DGWX 3NWKA 3HD8B 4DS0A 2B5HA 2JE9A 1YFUA 4NN0A 2D3SA 2NYYA 1DGRN 2I45A 1FMD1 2EXIA 2Z2SB 1RUD2 2AREA 2NLRA 1S0FA 3AP9A 1RUC1 2IZWA 4XE9A 4IXLA 3OYWA 3VHPA 1BJQA 4MH0E 1OA3A 4RS5A 4HK8A 5FQ0B 4LBKA 3ZSJA 1DQ6A 1H2KA 3FLRA 1AR82 3HIFA 3VDDA 4FAHA 1MR5A 3MICA 5E89A 1O4YA 4Q29A 4H7MA 2RS31 2FHRA 2QUOA 3VBUC 4FPKA 3MFAA 5A33A 5JPNB 1JYIA 5KHJA 3IDCB 2R16A 2GC2A 5C33A 4LUKA 2WA3A 5K0UC 2DVDA 2RR13 2V09A 2IXHA 1Z0HA 2WNVB 5GLWA 4RSUA 1C8M2 1F5JA 4FCAA 1CAUA 4AEMA 2HWD3 1VBC2 4AYUA 5FBZA 5I0TA 2R32A 1HW5A 3ZVXA 1WD4A 5KHIA 5C4WB 1ULCA 2RS11 4PLNA 1QXRA 3IDEA 2X53S 4LE4A 2B7YA 4YM2A 2WFF1 4ZXKA 1VLNA 5B2GB 2Q4SA 2XJQA 1BZWA 1AX1A 4JQRA 4AG4A 3JBG2 1O91A 2D6KA 5IUQA 1VBE2 4YLZA 1WW4A 1FV2A 4P9GA 1W6PA 1GR3A 1MEC3 5L7OB 2VNOA 1V9U1 1ZZ8A 3M1HA 4D3WA 3S7EA 5T5JA 5E88A 3VBFA 3ZDSA 2NP0A 3RYRA 4K7JA 1YIPA 4AI0A 1SCSA 2HWB3 3SCGA 4EJRA 2D3RA 4P9YA 1SLIA 4YZ4A 3WZ1A 2VOVA 5J48A 3QBQA 3AMNA 3UV9A 1DQ5A 3B93A 1G9AA 2K9ZA 4GXLA 5CBLA 1N1TA 1PK6C 5GALA 4JGYA 4ORFA 4Q4W2 1CAVA 3ZIWA 4B7KA 1W6OB 5JOWA 2ZOEB 1CIWA 5IK4A 2CGPA 1B35B 4XYXA 2ZGMA 3KD4A 4M01A 2YGLA 4P14A 4R52A 3SXWA 1NQDA 1NCQC 2EAKA 2JICA 5JSRA 4YGCA 1M06G 3LWCA 3M2MA 1AR83 3JUUA 3PVBB 4X6RB 1NYWA 2CL2A 2P17A 5CFCC 3GBWA 4FPFA 4NVPA 1PO13 4UBGA 1NG0A 4YW2A 4HKWA 3PNAA 3DF0A 1D4M1 4JAAA 2VU9A 5BNPC 1UU4A 1PGW2 5CIRA 1G8WA 1AJOA 1LTEA 1QWRA 4MXVA 5AFEA 3VBHC 3ME2A 1FPN2 1YCIA 4K8FA 5CNAA 1V6NA 2BGCA 1G6NA 3JBG3 3FFZA 3WR0A 2PHRA 1JUIA 2G4IA 1A78A 3MZHA 1W6OA 1FOD2 2ZHNA 2E7TA 5F9TA 3R4SA 1S0DA 1BCXA 4WM8C 3R0RA 2QCSB 2XBO1 4XF1A 1YI7A 3L2HA 1ULEA 1WLWA 2HWE1 3MLKA 1YFYA 3U10A 4GALA 1FYUA 1UF2C 1EAH3 5GLZA 4XQ4A 3ZFEC 2WLPA 2OZ6A 4JGZC 3ATGA 1IQAA 2XB6C 3IWZA 1SFYA 2Q8OA 4P9WA 4AVCA 1O7FA 3JZVA 3WDWA 4Z2WA 1QOTA 1X8EA 2YMZA 3PJYA 1BBT1 3ES4A 3OGGA 1EPWA 1YI9A 4LO7A 4COUA 3AB0A 1R1A1 5A33B 4N43C 2HWF1 3JQXA 4YFZA 4XBNA 1MVEA 1ND2C 4XJ8A 2ARBA 3O5SA 2R073 5SV5A 2GMMA 1DDLA 1D4M2 3KCYA 3O14A 4KGGA 1XRUA 1Q3EA 1CD3G 1R093 4YRDA 1F8VA 1IZ3A 4PCRA 2VECA 2XGXA 3LOBA 3ZYGA 4YZ5A 3OF1A 3TNQA 3MIEA 2OUJA 3CLPA 3OCPA 4BZ4A 1DBNA 2JG8A 1TMF3 1UU6A 5F6KA 3WD5A 3APBA 2A75A 3WG2A 4F7ZA 1URXA 5ABJC 1GBGA 4IV3A 4XTMA 4YW1A 4SLIA 1VB4A 2R0FA 3AZVA 1RL3A 3B69A 3VBRB 1ZNPA 4Q1PA 2F6BA 5D8AA 2RS53 1F5FA 4Y20B 2HWE3 3ROUA 1B09A 1W6QA 1LODA 1QJX2 1YRZA 3MDPA 1ND3C 2EXKA 2X5IA 3OBRA 2AH2A 1LENA 4HPKA 2VMHA 5BY5A 1WLCA 3ZSMA 5BNOC 2D5HA 4U36A 1ENSA 1WD3A 4B4RA 2DWRA 1RUD1 1N1YA 1R1A3 1HDKA 5FAXA 3UKVA 1FMD2 3Q9OA 1GZCA 4BWOA 4JDOA 4QMAA 4O9GA 4AVTA 1YIFA 5DDJ3 1MQTB 1ENQA 2TBVA 3VKFC 1LHVA 2PN5A 4EWEA 3HR9A 4BIOA 2IXCA 2VMIA 1IKQA 2RJKA 4RS5C 2CV6A 4GA9A 2B39A 2XL7A 3WP6A 4PDWA 1MZ6A 1UAIA 4QGNA 2GC0A 4QQHA 4JGZB 5E16A 3ZXLA 5JLVA 4XFFA 2ZGLA 3W58A 3SCHA 1Y9QA 1UN1A 1IPKA 1KJRA 4META 2PAMA 3BCWA 4YM1A 4DB5A 1LOEA 5L7OA 4PQ9A 2RS12 3WCSA 4UW6A 4KBBA 3KCXA 2VGDA 2XBO2 5K0UB 4LBQA 1OQ1A 2GNTA 4EWAA 3MYXA 4Q4Y3 1TQ5A 3JU9A 1ZREA 1UPSA 1YWKA 2MHFA 1AYM3 2IXLA 4WVZA 3OD0A 1X82A 4IEQA 1HXS1 2A73B 3INAA 3ZSLA 1FV3A 1PM7A 2UYBA 2R1DA 4XF0A 1PNFA 2Q1ZB 4AQ2A 1ZBE3 3ZSKA 1C5IA 1DLLA 4ONUA 5BNPB 1REDA 4EN7B 2ZX0A 3N7LA 4TYSA 1QJX3 4J6GA 4D69A 2DVGA 1OI6A 1BKZA 2BQPA 1WGPA 2Y26A 5E8AA 4CDUA 4E4SA 5A3LA 1KQRA 3RRDA 4Y1YA 3H7YA 3W9AA 4AWDA 5CFCB 2ET7A 4CDWA 5DXDA 2JE7A 1ZBE2 3ZIXA 4OI4A 4FO9A 4I0BA 3SCFA 5T55A 1U5IA 3OJBA 1JUHA 1CAXA 2WNUA 3RYKA 3VKLA 4BIFA 3DL3A 4HVOA 4HSLA 4YW5A 1H9PA 1RHI1 4Z82A 1LCLA 1C4RA 1ZVFA 1RGSA 1PVC2 5E1RA 1DQ0A 1R092 2VVFA 4N7IA 3PJQA 4N7UA 4CEYA 1PK6B 4L97A 1RUJ3 4ES8A 5DG1A 4Z07A 3MEPA 1SQ4A 3V0AA 1KRIA 4JRLA 4H3WA 2QZ2A 4Y1ZA 1DIWA 4W6WA 1ASJ2 2JG8B 3ETQA 1AR73 2AYHA 4LTAA 3R4DB 1OD5A 4XPVA 1UIKA 5FRAA 4G9SB 4I0WB 4QGMA 3CNAA 1WMEA 2DU0A 1PGW1 2IC1A 1ZZ9A 2HWB1 1ULGA 2VVDA 3M3IA 2VUAA 3J9SA 1ZRRA 4ATFA 4DQAA 2XLGA 4WM7C 2VG9A 3IDBB 3WP5A 4FQ4A 2DVBA 3D8CA 5CG9A 2Y38A 5DUXA 1PO23 2GN7A 4K40A 2A6YA 5H9RA 2I74A 3VBFB 5FFOC 1FPN3 2VULA 4XFCA 1C28A 1HQNA 5GZEA 2B45X 2PQQA 4QPIA 1VBA1 4U2AA 3FWEA 1RIRA 1W6NA 1NCRB 1HQLA 2ZHMA 1QY4A 2A6XA 5FLHA 1H8TB 3NAPA 3THTA 2DV9A 1MS1A 3NV3A 4UBHA 3ZFFA 2XH6A 1H1MA 1BVVA 5K8SA 4QQLA 4PBPA 4FSJA 1BBT2 1IS4A 3ZXFA 2X5IB 4QPYA 2X8KA 2R1BA 4KQ7A 4KG0A 3FFQA 1GICA 2YUEA 5C9AC 4E9KA 4JVAA 4D7YA 2QZ3A 2Y0IA 1QJY3 2ZGRA 5BNPA 2O0OA 4IEXA 5T54A 1OLQA 1AYN3 2VUJA 3AX4A 3LA7A 3ZXJA 4E2SA 2K0GA 1QXJA 2K2SA 4P9LA 4J1XA 4M3CE 3V0BB 2OA2A 2VOWA 1DZTA 1Z78A 2MEV2 1GNZA 1OMIA 2GMEA 4CP2A 3RQ0A 1JBCA 5T3NA 4Y4YA 1DG6A 1LGBA 4XMIA 1QJY2 1A8DA 2PHTA 1AHSA 1XNBA 1RB8G 2QKDA 1LHNA 2GC3A 3GZTB 1BYHA 2HWC2 3ZMOA 1DYPA 2RS51 4RD7A 1VRH3 2IFWA 3WDUA 4BA6A 4QM9A 2EVXA 1OFSA 4NHKA 4AVSA 2E53A 4YG6A 4JGZA 1WW7A 3BODA 4MSVA 1UMZA 2YV8A 4ASLA 2ZACA 1NE6A 1EY2A 2R30A 4PLMA 2ZGTA 3ZN6B 3AKQA 1U5XA 2BVBA 2P3JA 1CQ9A 1N3OA 4GB32 3WG1A 5J96B 4NHMA 4LO4B 3B00A 4COWA 2YROA 4LR4A 3ZFGA 3OY8B 1MEC2 1QGLA 1VBE3 2E7QA 2MPFA 4FOWA 3HAGA 4AEDA 4Q4X3 3WHTA 1NCRC 2XWBB 2FMYA 2WQ4A 3AP6A 4M00A 1CPNA 3UK9A 5IT6A 1SFNA 1YYNA 3WW3A 2YGMA 4XBLA 4XFIA 4DINB 4A7ZA 5BV6A 4FPHA 3JCIA 5GLVA 1AYN2 1UL9A 1ENRA 3MIGA 2WJSA 1H2MA 4MGZE 2HWF3 1CN1A 3RWNA 5CB7A 4EN9B 2BWCA 3B9CA 4PDWB 2WS91 2MEV3 2NPIA 1OPOA 1Q8SA 2WSVA 3VBOA 2XVKA 4K6BA 3ZFFB 2AENA 4Q4V2 5FTTC 3NJZA 1LULA 2WNVA 1C57A 1QKQA 5CFDB 4F83A 1EV11 1R081 3VBUA 1V6IA 2RR11 2Z42A 5CG8A 2F4PA 3V0AB 4CZSA 2WNEA 1W6QB 5JSPA 4RGAA 1GQGA 2DFBA 5C4WA 1RUF2 4CDXA 3WUCA 4HZFA 4QPGB 3BU7A 1VBB2 1RUG2 4LBMA 1XQNA 1WCSA 1RVF3 1YUDA 4AHWA 1IS5A 3JD72 1DF0A 4LEJA 2EIGA 2YY1A 5BXXA 2DTWA 5GLTA 4AFDA 2YC0A 4IETA 3H3UA 1LGNA 4QPGA 1COV2 1RMU1 4FPOB 4GH4A 1HKDA 1TME3 2GALA 4FBFA 1WBFA 4LBOA 1PHMA 4TWTA 4N53B 2EF6A 5F1RA 1JOJA 2A5ZA 4D94A 1HRV3 3AZYA 1QQP3 2UYAA 5CA6A 5I0RA 4PLOA 2A6WA 2QDRA 1RUH1 1HXS3 3NKGA 4LHKA 2BYVE 1WLTA 1CVNA 2JKBA 1R1A2 3KS7A 3ECQA 2JD4A 3G7DA 1BXHA 4Y1XA 4DPNA 4XETA 1LR5A 1ZBA1 2DURA 3B7MA 1B35C 1LOAA 5L19A 1NCQA 1DZQA 4HN1A 4KNCA 5IK5A 2ZMLA 3CO2A 4RR3A 4UXAA 2HKXA 1VAVA 2HEVF 3MGUA 4CDWC 2RHPA 4CDWB 4WVWA 1AUYA 4Z1VA 4XEZA 5CAZA 1VBD3 3ILNA 3L2YA 4CP0A 4UW4A 3DKWA 3RS6A 2WZR2 2ENRA 1H0BA 2ERFA 4AE2A 3KT1A 4QQOA 4BMBA 5JMCA 2AR6A 5EV7A 4AW7A 5GZCA 1VP6A 1KD7A 4H7LA 2FZ2A 3LSEA 1V9U3 4YM0A 4LBJA 3M7AA 5KXDA 4CEYC 2NM1A 3AJZA 2PLV2 3AFGA 2DUOA 3I59A 2IXKA 2R0HA 3QCWA 3WLUA 1I6XA 5HXVA 1FAYA 1ZZBA 4WZFA 2ZGNA 4YGBA 3ZFGB 4AI8A 4AI3A 1QOOA 4AHZA 1I1EA 1KFUL 2CY6A 1W6MA 3A4UA 2XLFA 1GZWA 1IHMA 3IPVA 4EN0A 3SHRA 1OA4A 4Q4V1 4KG8A 1H2LA 4S2GA 4NR1A 4LA2A 2VOXA 1HV1A 4YW4A 2HEYF 4R4ZA 2VOKA 3PVEA 4F3JA 4MLOA 3ASIA 5I91A 2IWGB 1S2KA 2MNGA 3MLLA 4FPLA 1AR93 3ILRA 2WWSA 4N90A 4Q4X2 4WM7A 4AXOA 3JB8A 2XJSA 3DPRC 2RM22 2YZ4A 1LOFA 4IV1B 4NPRA 4R4XA 2ET1A 2VNRA 4Y24A 3VHRA 5LK5A 5JCTA 3A0NA 1X8MA 2XJUA 3PHMA 1ZRDA 1AXZA 2PELA 1SBDA 3KSCA 3GZAA 3GZUC 2C5DA 4X8PA 2ZA9A 3CEWA 3NKTA 3VV1A 2OVUA 2ZGSA 2R043 2HWC3 4N53C 5GKAC 1CESA 3ZFFC 5I0SA 2E9QA 4GKYA 4EN8B 4P5HA 3FMGA 4MGKE 4GB31 5ABJA 1RUG3 2ZGPA 2ATFA 1PGL2 2D5FA 1CAXB 2WNUB 1J1TA 5JOYA 1PO12 1NY72 1M4WA 4B8EA 5FQ0A 3H0OA 1K5MA 3KGLA 3AMMA 5LEJA 4LLOA 1VR3A 2C1FA 3SNMA 1QJU1 1QJY1 4QM8A 1PO21 1N1VA 3MI8A 4RA0A 2GH8A 2IXIA 1HV0A 4YGDA 3FBMA 4YVSC 4R9DA 4XJUA 5TSWA 1MQTC 3AFKA 2X5IC 2A3XA 1TE1B 1XU1A 1U5ZA 3S30A 3WDVA 4GH4B 4AEDC 3KQRA 2V5YA 4Q2FA 1RUD3 1FOD3 2DCKA 3DV8A 3RI8A 3FLPA 5JSOA 1RINA 4A7YA 4QQ2A 1TME1 1NA1A 1S55A 4HSJA 4C90A 4C1WA 5KC6A 5J09A 3WXPA 1OLRA 4I02A 3KLSA 1H8VA 2LUWA 1H2NA 3MLJA 3ZN4A 4CP1A 2GNMA 1IKPA 1ZM1A 1AYM1 3WG3A 4NWVA 3TN93 4HLTA 3J8F1 3VDDB 4GMP0 4RQPA 3L9JT 1FNYA 3NO8A 3TB0A 5HBAA 2QQPA 1FNZA 1W0PA 1GSLA 5FDBA 4ITCA 1QH6A 1EPZA 4RFT0 4Y1VA 1J3RA 3IN9A 2D98A 3B01A 3JBG1 4RQPB 5DDJ2 4TSVA 1Y7BA 4XIKA 1GZWB 2PFWA 3ZX7A 2WFF2 5GJ6A 2D43A 3AMPA 2HWD1 4FTBA 4XFHA 1PVXA 4MUVA 5D8AB 3VGIA 4COVA 1VALA 3R4UA 1UKRA 1ASJ3 3BOWA 2EALA 3VKMA 5T52A 1UZZA 4QT6A 4FOQA 1MVQA 2WFF3 4FOVA 3ZN6A 3WQ1A 2NMOA 1ZYBA 1QF3A 5ACA1 1REEA 2I2SA 1QDCA 1TEIA 5I8TA 1BQPA 5J37A 4OI2A 3IM0A 4AFCA 1H9WA 1S0IA 5FLJA 4DOUA 2UWBA 1MACA 1Z7S1 3RSJA 4CEWB 4I2OA 1SBFA 3PMSA 2WZR1 4MV2A 2PLV1 1V6JA 3LCPA 4QPGC 2VQAA 4AFAA 4CDUC 1ENXA 1HRV1 4FPCA 3EQEA 3AKRA 3K51A 3VZLA 1O3TA 4TLFA 1A6CA 2W0XA 2UURA 1O5UA 2QE3A 2TNFA 2V73A 1KJLA 3HN1A 2R49A 4Q0UA 1OHFA 1XYOA 2BPA2 4BMEA 5J98B 4LNVA 3DN7A 4DMIA 5CFCA 1C3HA 4AK3A 1RHI3 5KHKA 2RM21 4HN0A 5EZWA 1XU2A 1COV1 2DCZA 4GQ7A 2A6ZA 3AYAA 4M0HA 1AVBA 1POV0 1IOAA 1LKNA 4K21A 4AVVA 4YYOA 2WA4A 3HMYA 5KC5A 5L36A 1YXWA 2BFUS 2PHLA 3DUIA 5ABJB 5JIAA 3DPRB 4KU8A 1FPN1 1PZ9A 4K1ZA 4WBBA 1LU2A 4OZXA 2HJIA 4XF3A 3ZSEA 1IGOA 4RR3B 4C0BA 4O9EA 1J58A 1LESA 1W2UA 3E6BA 1RUJ2 1DFQA 2GN3A 1BBT3 3D4KA 4LO5B 4CDQC 4C0HA 2WZR3 2HWB2 2KM2A 4XXPA 5EWSA 4M3CF 1RUG1 2P37A 3HQXA 3I8TA 1CAWB 4Q4Y2 4R9BA 4N43B 3FX3A 4RS5B 1V6OA 2Q1MA 1AXKA 1G7YA 1OKQA 1ND2B 4S2FA