2BUKA

Satellite tobacco necrosis virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
TMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
publication title Structure of Satellite Tobacco Necrosis Virus After Crystallographic Refinement at 2.5 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 46
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bukA00
4PDWB 1TME1 1ND3C 1MQTC 5BNNA 4FSJA 1K5MB 4RHV3 4RS5B 2HWC1 1PO21 5A32B 3NAPB 1BMV1 2HWD1 3CJIA 2RS53 2MEV3 2RS11 1C8NA 2BPA2 1SMVA 1R083 4CDWB 4CEYC 1WCDJ 5D8AA 1AUYA 1V9U2 5D8AC 1RUJ3 2R041 1RUG1 2BBVA 1QQP3 1E57A 4YVSB 2PLV3 3JB4C 2HWF1 3CJIB 3VBHA 1AR92 4Q4V3 1RUI3 2QQPA 4Q4X3 2RR12 4IV3A 3JD72 1VBD2 4RHV1 2WLPA 1H8TC 2RMU3 4Q4Y3 3JBG2 1RVF3 2HWB3 2Y26A 1AR73 5FMOS 2FZ1A 2WZR2 2IZWA 2RS51 1ND2C 1EAH3 2MEV1 4CDUA 1VBA3 1BEV1 1PO13 5BNPB 2WFF2 1ASJ3 1NA1B 4RQPB 1FOD2 2ZZQA 2TBVA 1RUE3 1RUJ1 1COV3 3JB8A 5L7OB 5JZGA 1QQP1 1W39A 4Q4W2 2PLV1 1RMU2 1RUC3 5CFCA 4GMP3 1VB2A 1OPOA 4Q4V1 5CFCC 4RR3C 4GMP0 4Q4X1 2WS93 5LK7B 5CFDA 1AYN2 4CEWA 2BFUL 4Q4Y1 2RMU1 1VAKA 1RVF1 1OOPA 2HWB1 4JGYA 1AR71 4N43A 3ZFEB 1RUF3 1R1A1 4JGYC 2HWC3 1PO23 1HRV2 1HXS3 1NY72 3VBOB 1RUH1 1EAH1 5K0UA 1VBB3 1QJX1 3TN93 2X5IA 4QPGC 1PO11 1AYM2 5CFDB 1ASJ1 1HRI3 4CDXA 5C8CC 4WM7B 1FPN3 1RUE1 1VBE3 1CJDA 4CDXC 1COV1 3DPRA 1VBC2 3VBSC 2R042 4N43B 1TMF2 1HX6A 1RUC1 4GMP1 1FMD2 2XBO1 1PIV3 2XPJA 4JGZA 5DDJ3 4N53B 3ZXAC 2HWF3 3VBRC 4RFT0 4GB32 1ZBE2 4GH4C 1Z7S2 4YVWB 1NCQA 4IV1C 1ND3A 4CDQC 4AEDB 1MQTA 4FTSA 1NCQC 2VQ0A 2RS33 2R063 3DPRB 1RUF1 4NWWA 4RS5C 1HXS1 1VBB1 4JGZB 1PGW2 3TN91 1MEC2 1VRH1 1R082 1HRI1 3ZFFB 1HQNA 4CEYA 1BEV3 2HWE3 1FPN1 1VBE1 1AR63 5BNNB 1R092 4CDWC 5ABJA 1C8M2 1QQP2 5J98B 5ABJC 1PIV1 5AC91 5DDJ1 1RUI2 1QJY3 1F8VA 5J96B 1GFF2 1EV12 4QPIA 4CEYB 2RMU2 2BUKA 2R061 1H8TA 2RS31 4QPIC 5D8AB 3J8F2 2R071 1V9U3 1R1A3 1EAH2 1PGL2 1ND2A 1NCRC 1RUH3 3VBHB 1VBA2 1B35C 1QJX3 4IV3B 1QJU2 5ACA2 2HWE1 1DDLA 4FTEA 1H8TB 5C9AC 1AR61 1BBT2 1NA1C 4RQPC 3JD73 1VBD3 1POV3 3VBFC 1RUD2 3JBG3 4BCUA 2RM22 1POV0 5C4WA 3IDEA 1ND2B 1PVC2 1QJY1 5C4WC 5L7OC 4RR3A 1ZBA2 3S6PA 2WS92 2XBO3 3LOBA 4CDUB 5FMOL 3VDDC 1AR82 1TME2 2GSYA 3M8LA 2WFF3 2HWC2 1PO22 1FOD3 4WM8C 1V9U1 5JZGB 1VB4A 1BMV2 3ZFEC 5CFCB 4RR3B 2HWD2 4Q4W3 1RMU3 4QPGA 3VBUC 4NWVA 2RS12 5A33A 5BNOA 1VRH3 4CEWB 5C8CA 5BNOC 3VBSA 3JD71 1CD3G 1AYN3 1OOPB 1VBD1 1POV1 4JGYB 4WM7C 3JBG1 1NG0A 1RUG2 3ZFGA 1PIV2 5DDJ2 3ZFGC 4SBVA 2HWF2 5K0UB 5AC93 2WZR1 3VBRA 2X5IB 2GH8A 4GH4A 1OHFA 1X33A 4IV1A 4CDQA 5C8CB 1F2NA 4CDXB 1AYM3 4RHV2 2WFF1 4YVWC 1FOD1 4PDWC 1K5MA 4RS5A 2R073 1K5MC 1VBC3 1RB8G 4Q4W1 2RS52 1RHI3 1D4M3 1RMU1 2MEV2 1FMD3 3NAPC 4GH4B 1BEV2 4CDQB 1M06G 1NCQB 1AR62 1ND3B 3ZFFC 1MQTB 4GB33 1AYN1 1A6CA 1ZBE3 4CDWA 1AL23 1Z7S3 3HAGA 1RUJ2 5BNNC 1X36A 2PLV2 2FZ2A 1QJY2 1HRV1 4Z92B 4YVSA 4Q4V2 1NY71 1IHMA 4Q4X2 4YVSC 3FBMA 3CJIC 1MEC3 4FTBA 4LLFA 1AYM1 4Q4Y2 2DF7A 1RVF2 2HWB2 5ABJB 4EJRA 1AR72 1R1A2 5GKAC 1VBC1 1R093 1C8M3 1TMF1 1RUH2 1RHI1 1D4M1 1NCRA 1FMD1 1B35A 1NOVA 1QJX2 1PO12 3VBHC 5FOJB 1ASJ2 2ZAHA 1AR93 4QPIB 5C9AA 4GB31 1ZBE1 4IV3C 5BNPA 2RR13 1AL21 1Z7S1 1RUE2 1NA1A 4RQPA 5BNPC 1COV2 1EV13 3VBFA 1RUC2 1QJZA 3J8F3 5L7OA 2XBO2 1NCRB 1B35B 1PGW1 3VDDA 2WZR3 2BFUS 1MEC1 5C9AB 1R081 4CDUC 1QJU3 5ACA3 2WWSA 4WM8A 3VBFB 1RUF2 1R091 1C8M1 1BBT3 1HXS2 5C4WB 3ZFEA 4Y5Z0 1VBB2 5JZGC 1RUD3 1AL0G 3VBOA 2RM23 3TN92 3VBUA 3VDDB 1RUI1 3VBOC 1PVC3 1VRH2 1HRI2 1ZBA3 1AR91 2RR11 1FPN2 4Y4YA 1VBE2 1AR83 1EV11 4WM8B 5CFDC 4CEWC 4WM7A 1TME3 3J8F1 1OOPC 5AC92 4N43C 3VBUB 2ZTNA 1HRV3 1PGL1 4QPGB 4N53A 5K0UC 2HWD3 1VBA1 5A33B 4N53C 5BNOB 1QJU1 2X5IC 2RS32 2R062 5ACA1 2RS13 4YVWA 3VBSB 4AEDA 4PDWA 2R072 4AEDC 1BBT1 3ZFGB 3DPRC 1RHI2 1D4M2 1RUD1 2R043 5A32A 1TMF3 2RM21 1RUG3 3NAPA 3VBRB 1PVC1 1ZBA1 2WS91 4JGZC 2HWE2 4IV1B 3ZFFA 1AR81 1AL22
chains in the Genus database with same CATH superfamily
2GP3A 1ZREA 5FPAA 3MIHA 3I2GA 4CCJA 5JCTA 5GLVA 1MQTC 1PMJX 4HOOA 2CNAA 2OX0A 2EAKA 1W9SA 5H9SA 2BZDA 4LKDA 3H3LA 5A32B 2W1WA 2ZHMA 3NAPB 1XNDA 1H2NA 1XNBA 2DVGA 3JQWA 3NJZA 4CE8A 1WBFA 5EV7A 3WDXA 1BVP1 4XUNA 3GXUA 2EIEA 4AVVA 3A23A 5CA6A 3S5AA 4XPVA 2RS11 2V09A 4LE4A 1GICA 1W3VA 2JDUA 5A1FA 2WA4A 3DYOA 3OGJA 3SCGA 2PAEA 4DMIA 1ZZCA 3LCPA 1KITA 3Q8AA 4COWA 2D6KA 5KHGA 5DZEA 3IB3A 1LU1A 2R041 4AF9A 1YQ5A 1RUOA 4HN1A 2D5FA 4OI1A 1E57A 3EBRA 3O1UA 2WNOA 3PJQA 3JB4C 4QXBA 4TSVA 3WG4A 3OF1A 1LHOA 3VBHA 3LFIA 2VMGA 1RUI3 3GZTB 4Q4V3 1SPPB 2VZRA 4Q4X3 2RR12 4QD2A 3VD9A 3GCWA 2O0OA 5A70A 1YUDA 4LIUA 3ZX7A 2CAVA 4LK7A 3GDBA 3J7HA 2WLPA 1H8TC 4Q4Y3 2J1TA 2OVUA 5FLJA 2FCUA 3C7EA 4DS0A 2HBUA 3WCSA 4HLTA 4MGQA 3ZYBA 5JXJA 2UYBA 1OA4A 4LO8A 3MYXA 2PAKA 3AZYA 2IZWA 2RS51 4GXLA 1CPMA 1O91A 1UYXA 3SISA 1X9TA 4I01A 1VBA3 4XW3A 1GOHA 1J3QA 1PO13 2Z79A 5DPNA 3U37A 1YIFA 3W20A 4B29A 2ZABA 1N1TA 5LW9A 4XFAA 4HKOA 2J1RA 3W21A 1RUJ1 3AZZA 4WVVA 2XUMA 3U10A 2P1BA 4GALA 1UY2A 5L7OB 5IWFA 4ZPIA 3ECQA 4UBGA 1W6PB 1GLHA 2X8KA 1VB2A 2RV9A 1JYVA 4RR3C 3HT1A 1IKPA 4HSJA 2WS93 5FK7A 1XSQA 3VLBB 4KWLA 2A6VA 4KL1A 1WD4A 5FZIA 1PNGA 2GNMA 1W8UA 4RN5A 4Y20A 2C6SA 1HDKA 4NROA 3GHNA 2OPWA 1UPSA 3ES4A 5IT6A 1KS4A 3B9IA 4LO6B 4BQ5A 2GC2A 4FFGA 3FZ3A 4K1YA 3N4MA 5K8SA 4FPFA 1Y43B 4UFLA 1R1A1 3RFRA 3ACGA 3O14A 1VAVA 5FOBB 2ZHKA 3MF6A 2WLQA 4BDVB 4H2AA 5DMYA 1ZRCA 1UD1A 4E4DX 4NMIA 2UU8A 2VVEA 3MIFA 3AP6A 3EHKA 2DVAA 3M1HA 3TN93 3SC7X 2JD4A 3M2MA 2JB8A 3OGRA 3TBDA 3KT7A 4HG6B 1GZ9A 1PZ9A 4Y20B 3RGBA 2E32A 5C8CC 5FDBA 4WM7B 1OFSA 2W87A 3IDBB 2Q5TA 1GWLA 2XR4A 1NXD1 4OCTA 3VBSC 1CAUB 1YNAA 2R042 1U5YA 1TMF2 1QNWA 1US2A 4OHYA 5JIAA 5FV3A 1S0DA 5A1AA 5EXOA 4A6SA 2IUWA 4P9IA 2XBO1 3INAA 3SHRA 1O8SA 4HETA 1H2MA 1KFXL 3ZXAC 3KV4A 2AZ5A 1GP6A 2DVDA 1JZ4A 3CF6E 4GKXA 3MDPA 5FZAA 3OGVA 4P9WA 2Q1FA 3R4DB 3W5NA 2WSVA 3N9QA 4U2AA 1ND3A 3CEWA 4CDQC 3POBA 2I45A 1KDMA 2SBAA 2R063 4Q5OA 4Y22A 4Y24A 5LBCA 2QQJA 4R9BA 2WNVB 4XJWA 3T0DA 2NLRA 3B69A 4RS5C 1LOAA 3J7LA 2P5BA 4IETA 4CZSA 1VBB1 3O1TA 1EUUA 1F9KA 1SLCA 4WBBA 4BM8A 4BOWA 3W59A 2VMHA 2WZ8A 3SQOA 3ZSEA 2ID4A 1O4TA 2K46A 4A3XA 4NPMA 3AP5A 5I0SA 1HW5A 1KFUL 3JUUA 3H9AA 1R082 2CSGA 2YROA 4QX7A 3P3NA 3AVRA 1S0IA 2D6OX 2F4LA 4OHXA 4FQ4A 4CEYA 1BEV3 2HWE3 3T1LA 2W52A 1FPN1 3MW3A 4K3UA 1IQAA 4Y22B 2V4AA 2EXJA 1ENRA 4NIIA 2Y6LA 1QOSA 2QQWA 5FLIA 5FJHA 5CG9A 4AI3A 1U5XA 5FKBA 3VDBA 4XUTA 4INDA 5IVBA 4ZU5A 2F6BA 4QHZA 1DP0A 1URXA 1OQEA 1OA2A 3ELNA 2BGOA 3B9CA 1JHNA 1BZWA 4RGGA 4K20A 3ACIA 5A3WA 1GFF2 5FY8A 4CEYB 3WD5A 5FCCA 4AVTA 5D8AB 2JECA 1YIPA 4H3WA 3FLPA 3NJVA 4B4QA 2QQOA 2P3KA 1D0GA 3E6CC 1QH7A 3MLJA 2RJ2A 4LHKA 2BV4A 4AOCA 1ND2A 4FXGB 3F95A 1PGL2 4M3CE 2PELA 1L7LA 5GLZA 1NCRC 5C7GA 3O0WA 1LOFA 1YCIA 1B35C 4Y1XA 3L9JT 1XU1A 1LOFC 1QJX3 2VZ1A 4IV3B 2LALA 4KI5M 3IWZA 3VL9A 3ZN6A 1YFUA 2WL1A 2A73B 1AR61 4AHYA 4QX1A 1PMHX 3BCWA 1DQ6A 5CIRA 4RQPC 4PI2A 3USSA 4AGVA 1XJAA 5C8WA 3BU7A 1RUD2 3N36A 4BMEA 3Q8FA 3BGAA 1YXWA 1LOBA 1EPZA 1ND2B 4A3ZA 1QJY1 1GZWA 1UY1A 1ZBA2 2KR2A 1NQJA 1VIWB 5T3NA 3FX3A 1IS4A 2QQNA 5L36A 1DGRN 3HQRA 3HIFA 3T1MA 4FVVA 2C5DA 3DEMA 2VOWA 4UW6A 5I0TA 4PJYA 4FBFA 2JDYA 3OGSA 2QQIA 4W6XA 2VY0A 2HWC2 4ZU4A 1REEA 2GP5A 4LBQB 4YW7A 5JZGB 3MIEA 2WO7A 2IXHA 3ZFEC 2HWD2 2LUWA 3NQHA 4CUGA 1DYOA 4QPGA 2JDHA 4A41A 4B8EA 2BNMA 4NWVA 5BNOA 3NWKA 5DZGA 1HJGA 4CEWB 5BNOC 3H3UA 4PLNA 4M0HA 3J26N 1CGPA 1ULCA 5GLTA 1CD3G 1VBD1 4E4SA 2XHNA 4IEPA 4JGYB 4QGNA 4YGDA 3JBG1 3ZFGA 2QZ2A 4AI2A 1O5UA 3D6EA 3S0MA 3ZFGC 4A6OA 3P5BA 3FUOA 4O9GA 2WO2A 5K0UB 4RA0A 1GSLA 2WT1A 4K7JA 1JYXA 3DN7A 4UFKA 1W8OA 4LIVA 4UFIA 2X5IB 4URAA 4GH4A 1QXPA 2VPVA 2YZ4A 1X33A 4NIGA 4IV1A 1DU3D 2WAOA 2ZCWA 1Q5OA 3BALA 3ILRA 3OGGA 1C5HA 1P8JA 2NPIA 4Y3OA 4NRQA 4DINB 2LROA 3A22A 5EFUA 4BYYA 2ZMNA 2W39A 2WRAA 4XHXA 3AFGA 1DFQA 4QQ2A 1X7NA 4LITA 4ES9A 5DXDA 2ZBJA 4C8DA 1Y3TA 2QBXA 2QVSB 5JIUA 2FDIA 4QDQA 3WT3A 1X8EA 4MYEA 5AVAA 2K0GA 3OPZA 2MEV2 1UX6A 3OYWA 2DBIA 3IPVA 4GH4B 2W47A 3AMHA 4UAPA 3UNPA 5FMBA 4Z2AA 3WF3A 3GBFA 3HQXA 1AR62 4YFWA 1FYUA 3ZFFC 3KQ4B 5GZEA 4CDWA 3BIEA 3HOBA 4EWDA 4IUGA 2WINB 3VDAA 4QX8A 3IBMA 3H1YA 4WVWA 4NIHA 2P3IA 3C8XA 3O0XA 3ZN4A 3KWVA 2CDPA 1X36A 5F3IA 2PLV2 2BWAA 1QJY2 3VL8A 4FOVA 3HNYM 2XONA 4WVZA 3H1WA 1I1EA 4CA9A 3AMQA 2VW1A 1LHVA 1SCSA 3CJIC 3RZJA 2WO1A 2RE9A 2PMWB 4FTBA 1J1LA 1AYM1 1E5IA 4CCCA 5H9RA 2B45X 1NLSA 3MW2A 2MHFA 3RWNA 3JZVA 1JZ5A 1AR72 1W0OA 2JKXA 1QXRA 3GALA 5GKAC 3RMXA 4QGMA 4AE2A 2VGDA 2GDFA 2A6XA 1XYPA 4J1XA 2H6BA 1RUH2 1RHI1 1ZX5A 1US3A 3IKWA 1FMD1 1FV3A 4AVBA 2EALA 2YFZA 3RYKA 1REDA 2P6CA 2BGCA 2GALA 2D6PA 3WNNA 2PHFA 1ASJ2 1UF2C 2R30A 1MACA 3NJYA 1WW6A 5I0RA 1UX7A 4DXRA 1R1ZA 1X50A 1ZBE1 1EUTA 1Z7S1 4Z2WA 1NA1A 5FYIA 2IWGB 4LO4B 1MVQA 2WAAA 1JU3A 5I0UA 1QHDA 5FZMA 3VBFA 1RJ7A 3MICA 2P34A 1OMIA 3ON7A 5C33A 1RUC2 1SHWB 3N7JA 1VMHA 5E8AA 3TNPB 5L73A 5A3MA 3AB0A 4MO3M 1AX1A 4IDZA 1V6MA 5C5UA 4IGOA 1YJKA 2DCJA 2FDFA 3D4KA 2JE7A 4UFMA 4UYBA 3ZKYA 3EB7A 4KG8A 4Q0VA 5F5IA 3WINE 3I97A 3WDVA 2MPFA 4MGYE 5IK5A 1Y7BA 1TG7A 2ZGKA 4DY5A 1PK6C 3GF6A 1XBFA 3B02A 4H55A 3SH3A 1KJLA 3T2QA 1O3SA 1IZ3A 2BEOA 4A4AA 3VBFB 2JKBA 3UGFA 5IFPA 2JE8A 3M4FA 1W9YA 4XXPA 4LJHA 5LASA 4KGQA 1HXS2 2VXRA 1JUHA 2Q0AA 1DG6A 1XPWA 5DAQA 4LHLA 3WG1A 3RQ0A 1RUNA 1RUD3 3VKMA 1AL0G 1SLLA 2A3YA 4OQ8A 3G7DA 1RUI1 2K2SA 1VRH2 2W3JA 1JW6A 1HQWA 2ZGLA 3D5OA 1IGOA 1ZBA3 4QX0A 5I91A 1WBLA 2A3XA 2VNGA 1Z78A 4Y4YA 2VZVA 1NZCA 3R6SA 1EV11 4AFMA 1E5HA 2XJRA 3ZSMA 5APAA 3DUIA 1I6XA 4CP0A 3GBGA 4F83A 5D1IA 3J8F1 5GALA 2ZX2A 1YHFA 4DXSA 2YUEA 5AC92 2JENA 3DECA 2VECA 4ITCA 2B39A 1S0JA 2NMOA 1NKGA 3WQ0A 5GZDA 1GOFA 2RDNA 3R4UA 4BQXA 1HRV3 1Z0HA 4YZ1A 1UO9A 5FZ8A 4N53A 1VMFA 2VZTA 3VZJA 2HWD3 4DZGA 4S2DA 1VBA1 3MHZA 5A33B 3I2FA 4N53C 1GV9A 5I8YA 1I3HA 1OF3A 2JG9C 3THTA 4A7KA 2RS32 1H1MA 5ACA1 3AP4A 4YVWA 4EN7B 5C3SA 2R6QA 5HCHA 4PDWA 5E16A 5LY2A 5F8PA 2X53S 1QGLA 4XCAA 4JKLA 4LA3A 3O12A 3KGZA 5FXZA 2XLAA 3ZSJA 4FPKA 1RHI2 4L0PA 1CQ9A 4PF1A 3W58A 3FHIB 5TSWA 3ASIA 2RM21 4FOYA 3W9AA 4BU2A 3JXSA 1ZRDA 4HZFA 3I3QA 3VBRB 4Y1ZA 3RYPA 2UWBA 3WDUA 2WS91 3H7YA 4JGZC 1FXZA 3IMNA 3KCXA 4AFAA 5FP9A 4N9HA 3H8XA 3AKRA 5FZKA 1F15A 3LKJA 4PDWB 1BCXA 1TME1 5HCFA 5JAXA 2OPKA 4F3JA 3RI9A 5BNNA 4IE4A 3K51A 1K5MB 2EF6A 2OYZA 3TAYA 2Y33A 3TNQA 4L9BA 1BMV1 2PHUA 3ACFA 2XG3A 1XB9A 3WNPA 5GJ6A 3APBA 2YDEA 3SNMA 3WX5A 1OI6A 2MEV3 2IFWA 4AHXA 1OSGA 5DQ0A 5A1LA 4PIXA 4ES8A 1SMVA 4Y26A 4OI2A 5JPMB 1GR3A 3T30A 3K3NA 1WCDJ 4P9JA 2JIJA 4XC9A 1SBEA 1ULOA 4XF4A 4MXWB 4MSVA 4EN6B 2B9UA 4CTEA 2BBVA 1XXNA 2VE1A 3BIWE 2QDRA 2PLV3 2Q8CA 4XBLA 5A6YA 4X8PA 4A44A 5FUNA 3LZZA 4BQ4A 2KM2A 2DVBA 3POWA 3FMGA 3NW4A 4M3CA 2RJLA 2Q8OA 2ZX0A 3VZNA 1POQA 3RJRA 2IVJA 2XJTA 2PYTA 4LBOA 1CAXB 2XJSA 3K75B 3ZXLA 1W03A 2YV8A 1JZ3A 4Q0QA 4HK8A 4D0QA 4RHV1 3SEEA 4AR2A 2CTVA 3WQ7A 3E1F1 1SZBA 3NNLA 2Y26A 5SV5A 2EIDA 3KHBA 4CCLA 1AR73 1KXGA 4PLMA 4COVA 1H1IA 1JTZX 1NE4A 4IE6A 3ABZA 5LATA 1GQPA 2WZR2 3NV3A 2ARBA 4L92A 4PI0A 4BE3A 3IIAA 1HJFA 4ATEA 2R7EB 4W8JA 1BVVA 2CWMA 1SLTA 4QQLA 4XJAA 4CDUA 1CESA 1BEV1 3KF5A 3SLIA 3THCA 4CCNA 4FFIA 5BNPB 2HBTA 2WFF2 1ASJ3 1N1SA 2PHLA 4YM2A 3WHTA 1FOD2 4XDPA 2ZZQA 2WT0A 2PXJA 4Q2FA 1JBCA 4BIOA 3DKWA 3PLQA 1BYHA 1LR5A 4XBQA 5F32A 4B4RA 3JB8A 1QQP1 3H8OA 1RUC3 2ET7A 3EO6A 4GMP3 4XBNA 5EHDA 2VNOA 3WDWA 4AFDA 3WW2A 3EMRA 3KM5A 3LAGA 3J4UH 4R9DA 5FYUA 3WW3A 1I5ZA 5B4NA 3AK0A 1NQDA 2GNDA 4FXKB 4P5HA 3WEZA 5FPUA 2BFUL 2XMLA 2RMU1 3D8CA 3R0RA 1UKRA 1RVF1 4DY3A 4QKDA 1OOPA 2HWB1 4LE3A 4C0BA 5J48A 4Y1UA 3BI3A 1W0PA 5ABJC 4ZY9A 4Z8BA 1FI2A 4QB6A 1PMIA 1PO23 1GWKA 4ET7A 5CISA 3O1VA 4DFSA 1HXS3 1NY72 3VBOB 3ZLIA 1AVBA 3AMNA 4KWKA 1EAH1 5F6LB 5BUVA 3J9SA 4N8MA 3ZDVA 2C26A 2J22A 4P14A 2BVBA 4AYUA 1O3RA 1QJX1 1YYNA 4DPNA 3HQUA 3FE5A 1DF0A 4QKNA 2JDMA 4OUMA 1O3TA 2AEYA 2JG8B 3RG0A 2RDRA 4MLOA 2LW8A 1RINA 2WNUC 3CL1A 3I7DA 4CDXA 1DGLA 1OUXA 2R0HA 2VW2A 4AI0A 2E31A 1RUE1 3QBQA 3ZMOA 4CDXC 1COV1 1VBC2 2DUPA 3T08A 1UWWA 4Q0PA 5LBBA 1HX6A 2VJXA 5FYVA 5LBEA 2VZPA 3E6DA 3NRUA 4FT8A 4IGQA 3PIJA 3B3QE 4HMZA 1PIV3 2W1QA 4NHXA 4XF9A 3DGTA 4UFHA 5DDJ3 1S55A 4YW5A 5H9QA 2HWF3 4P08A 2UY9A 1K5JA 1FT9A 1WLCA 2ENRA 3DYMA 5A7WA 4RFT0 3O1RA 4BMBA 1U5IA 2QE3A 4BXFA 4XFCA 4E8CA 1NCQA 3Q9OA 2HEVF 3AYCA 5E1RA 5CBLA 3KV5A 1V70A 4AEDB 1MQTA 1KEXA 1NCQC 1W8HA 3ENRA 2IVIB 2RS33 4XMIA 2ES3A 5FP4A 1JU4A 1UL9A 5LB6A 1LODA 1RUF1 4JC1A 5A3PA 3ALQA 1GP4A 4MHUA 4UT5A 1C4RA 2OQ7A 4FPHA 2P3YA 2QZ3A 2BGPA 1H4GA 4MV2A 3NV1A 3VKNA 1YC61 1PGW2 2DVFA 1JH5A 1G9BA 4D6RA 2GAUA 1SFYA 1UIJA 2ZACA 3NJXA 1HRI1 1KDKA 4JRAA 5LA1A 2Q8EA 3FHQA 1W8NA 4QQPA 5EJ3A 1BK0A 4IW3A 5T5OA 5FYTA 5IUQA 4LBQD 3UYJA 5I93A 4YG0A 2BNOA 1VBE1 4NE9A 4QAWA 2K9ZA 3MBWA 4IEZA 1O4YA 1NXMA 1WW5A 5ABJA 4WV8A 5FYZA 4XETA 2Y0OA 1QQP2 4NHYA 3K4AA 2OUHA 4P00B 4BLIA 2ZGNA 2X05A 1Q8VA 5JVVA 2VNRA 3UKVA 4HVQA 2UWCA 3AXEA 1YQ6A 3WF0A 3AXDA 1WGPA 1IOAA 3KV6A 3R4SA 3LF7A 4MUVA 2VC9A 2Y6JA 4QPIA 2NYYA 4TXWA 4XJZA 2JDPA 2RMU2 5JLVA 2NP0A 1ZZ7A 3T4VA 3UESA 1H8TA 4QPIC 5KHKA 5J7MA 2GC3A 3AJZA 3RI8A 3AFKA 3PUSA 1O8PA 1PHMA 1H6XA 3POEA 1YEWA 5BPXA 3V56A 5GZCA 5LZ6A 5FZBA 2JJ6A 1UXZA 3E5QA 1WLWA 3HNMA 5BNQA 1EAH2 2VTFA 4R4XA 4AI8A 2ZGQA 2J1UA 3OBAA 4N90A 3VBHB 2DU1A 3I49A 3VD3A 2G1MA 4JDOA 4KQ7A 3OBRA 2W5FA 1D2QA 1YQCA 2DCTA 1W8ZA 3VDCA 1LB2A 1DDLA 2NN8A 3FC0A 4LOSA 4FTEA 1H8TB 3TOJA 5C9AC 1KD7A 1X82A 2G4IA 4LULA 1ENQA 1BBT2 2WDBA 5A7NA 1EY2A 4IESA 4I0BA 1POV3 3ZMNA 2QQMA 1K3IA 3V0AB 5FTTC 1GYKA 5T55A 2W95A 5FPBA 5C4WA 4DO0A 4B7EA 1IG0A 3EXUA 3IDEA 4QXCA 2ZGRA 3CLPA 1PVC2 1XRUA 2DBNA 4OHVA 5C4WC 4RR3A 3VZOA 3S6PA 4LMFA 5L7OC 2FMDA 4GWNA 3TEWA 3VKFC 4AQTA 1LHNA 1JXNA 3ZXGA 5JPNB 5IVEA 4QKBA 1AR82 2DYCA 4XF0A 4BWOA 4OHWA 4IEOA 1ZA4A 1OURA 1UXXX 1EP0A 5KBFA 1HB3A 1VP6A 4IGPA 1AHSA 1Y9GA 4A7ZA 1HIXA 2WFF3 2WWUA 2WZEA 3ACHA 3M7AA 2BNNA 2ZOEB 1FOD3 2WNEA 3P1IA 4WM8C 4XURA 3KMHA 1ODNA 1OF4A 3S5QA 3ZOIA 3CBNA 1V9U1 1QIQA 4MZUA 4AGGA 2A7AA 2WR9A 4RR3B 4CSWA 5BY5A 1ZZ8A 2VQAA 3RS6A 3CNAA 4BJ0A 5F2WA 3ROUA 1PZ7A 4F8AA 1PM7A 4OZXA 4QT6A 3VBUC 1WMDA 4R9AA 5FFOC 1O7FA 3CQOA 4HANA 2DCZA 1YI9A 2RS12 3BODA 3CJXA 4YW1A 2AC1A 3ME2A 5C8CA 4E27A 2BW8A 3LSEA 4LKSA 3OSDA 4Y33A 1CIWA 5GLWA 1AF9A 2WA3A 3VBSA 3JD71 2YGLA 2O8QA 5CEHA 1JHJA 4FPYA 3NKGA 4C1XA 4WM7C 2J7MA 2ZX3A 4NUBA 1NG0A 5F5CA 3DF0A 1MZ6A 4YGEA 4ISRA 3VUOA 2JEMA 4PT6A 5FXWA 1TEIA 4JDNA 4YGBA 4I30A 4IEQA 3ZYHA 3RZKA 1MS0A 1J3RA 1DQ5A 2HJIA 4CU9A 2R32A 4Z07A 5I8TA 2G9ZA 1AX2A 2ETEA 1CZSA 5C8CB 4CDQA 1QKQA 5FY5A 2WUHA 3PU3A 3ES1A 1ENSA 1X9PA 4CPBA 2QKDA 2JDNA 2NZ9A 4QPYA 4YZ2A 1JZ7A 1XNAA 2JWPA 1UMIA 2E7QA 1OLMA 1DQ4A 3JU9A 4QX2A 1JS9A 3AP9A 3BPZA 4RS5A 2R073 2VUCA 3KVAA 4TTGA 1XE7A 5IJRA 2WNVC 1VBC3 2XJVA 3OJBA 4NR1A 2VR4A 2XJUA 1JI6A 4PIYA 2RS52 2VQTA 3I8TA 4Q4W1 1D4M3 1RMU1 3OEBA 3PU8A 4QU2A 5GLUA 4D7TA 4YM0A 2AR6A 1ALYA 4BQYA 3FL7A 3KQRA 4CDQB 2C4XA 2OS2A 1ND3B 1CR7A 1AXYA 1AYN1 3B00A 1IS6A 1G8WA 3PDQA 2WQ8A 5A6ZA 1RUJ2 4YSFA 3WF2A 3VHNA 3SH4A 4D3WA 3MGUA 4D6QA 1S2BA 1VR3A 1RIRA 1HRV1 4JKKA 1PZ8A 4YVSA 3RSJA 5HV4A 4G3YC 4YVSC 1CZVA 2XB6C 3GZAA 3FBMA 1OH3A 5CU1A 5FZ4A 5J36A 1N3QA 4WZFA 1XNCA 3B7MA 5GZGA 2DF7A 3LPFA 3DL3A 3LOIA 3OUIA 1LRHA 4LUKA 5A7PA 4GULA 4RFRB 4W50A 5AFEA 4Q8LA 3POYA 1R1A2 3ZDSA 4YZ3A 4S2GA 5C3RA 4U36A 1QOTA 2D97A 3I54A 1C5IA 3LPGA 5F1RA 4GKYA 5DABA 4JRLA 3MF9A 1YFYA 1NCRA 3VZKA 3BUCA 2QFEA 5AFBA 4HL0A 1IPJA 1B35A 1M4WA 4K21A 1XE0A 1C28A 3PUHA 4NN0A 2IXIA 5C70A 1HN1A 2VU9A 1QNYA 2G19A 2CY6A 2VOVA 1S1AA 3RZGA 4GB31 2VXJA 1XC6A 1SG3A 4IV3C 5FBJA 2RR13 1AL21 4F7ZA 1GZCA 2HEYF 4RQPA 2V4VA 3KCCA 3OPTA 4YW2A 3LWCA 5FUIA 4BZ4A 3K2OA 3I59A 2XWJB 1OVPA 3C2UA 5FY9A 2XBO2 1NCRB 3O5SA 4UXAA 4BISA 1B35B 1N1YA 3AKTA 5DAWA 1IQDC 1MZ5A 4N9IA 2FDKA 3LA2A 1UU5A 3N3HA 1MEC1 3KB5A 4IEYA 4YLZA 4IEVA 1UZZA 5DG2A 3BTXA 1KJRA 3ZN6B 1WUVA 5FXXA 2ZKLA 1VPHA 3LEGA 1S0EA 1ULFA 3RMYA 3WP6A 3FHAA 4CU7A 1JYNA 2Y34A 3AJYA 1R091 5KR7A 1C8M1 3MO4A 1BBT3 2KD7A 1VJ2A 3ZFEA 5CKMA 4Y5Z0 3V65A 1GNYA 1VBB2 1X8MA 4OMCA 2WQ4A 1GZWB 3HN3A 4LHNA 4B4PA 5JZGC 5B4XA 2ZZJA 3QCWA 4BA6A 1PVC3 3K77A 1U0AA 2I07B 5AVPA 1AR91 1UN1A 5J37A 3ITQA 2E7AA 1AX0A 4OMDA 5EQUA 1FPN2 1PNFA 4XMAA 1AR83 1V0AA 4UI9L 4QPWA 4UW5A 3SITA 5CFDC 4CEWC 1Q3EA 2Y6FA 2ZJCA 4H7LA 3SCHA 4META 2EIBA 3AZVA 2JD9A 4EYUA 2ZPXA 5B2GB 3RZHA 5FZEA 1WA4A 1DZRA 1WCKA 5FP3A 3QOPA 3AKSA 4N43C 4QKFA 5K4LA 4XABA 1MPXA 2VMEA 3HD8B 4QPGB 5K0UC 3PMSA 5BV6A 4UF0A 5BNOB 1NE6A 4AZZA 5ANQA 4E8DA 4M01A 5DN2A 1QJU1 2X5IC 2RS13 4JAAA 1JYWA 1ONAA 2HYXA 5JI9A 2D3RA 4FFHA 3HT2A 4XHBA 2PAMA 3N9NA 1JYCA 3ZYPA 3HEIA 2DU0A 4LKFA 3B01A 2XLFA 3ZFGB 3DPRC 2IXLA 4XCBA 2R043 1TMF3 2BP6A 5JOXA 4EQVA 5IK7A 2ARCA 1KRIA 3ZPYA 3WNKA 2W08A 4UF0B 3RNSA 4P9LA 4IV1B 2OIIA 2R1DA 3ZFFA 1AL22 3OUHA 5FYBA 5FIXA 3VHPA 5F5AA 4A42A 1LOGA 1GANA 2B5HA 2BRTA 2CAUA 2DTYA 1L3JA 3V0AA 2UYAA 4FSJA 4H14A 1J83A 1NYWA 2AENA 4NRMA 2A75A 4FOQA 1PO21 4YW3A 5EZWA 1JOPA 3B5LB 1W90A 3L2YA 3AL5A 2FMYA 4NHMA 4URTA 2PA7A 1LGBA 1QXJA 1CPNA 2VBPA 3NKTA 3GYDA 1TNRA 3OYWB 3L2HA 3CJIA 2JDAA 3IPVB 2RS53 4EROA 1Q56A 2XQRA 1ZRIA 3AC0A 1S0FA 1C8NA 3T2TA 5CAZA 1UMZA 1ULEA 2PTMA 1R083 3ZIWA 4DXTA 4CDWB 1JZ8A 1WCSA 2PQQA 3AMMA 5CVRA 4Q0UA 5FZOA 4EZHA 1E5SA 2VOTA 3MUY1 4FAGA 2YB7A 2EA7A 2GN7A 4CVUA 4XFFA 1AUYA 2CGPA 2D3SA 1S2KA 4CU8A 1RUJ3 3IDCB 4IE0A 2C9KA 1RUG1 2ZEWA 4OZOA 1WLDA 3MLLA 4CCKA 2VMCA 4YPJA 4XEZA 1JUIA 3H8UA 2HWF1 3AVSA 3UJOA 3CJIB 3HMYA 1CVNA 4XQ4A 5F3EA 1AR92 4ASMB 2NM1A 2NMNA 4NPLA 1H9PA 4LLOA 5F3GA 4LR4A 2B7YA 4I3PA 3OOXA 4XFGA 5FPLA 1UOFA 3BTAA 5A80A 2EXKA 2ZGUA 2A6WA 4MXVA 4QQOA 1VBD2 5GM0A 3WUDA 3VD5A 3ST7A 1GP5A 2RDQA 3JBG2 2WJSA 4JCKA 5FYCA 4IE5A 1AXKA 1J84A 2DV9A 3WDTA 5JR2A 3ETPA 2FZ1A 5FMOS 3G6JB 2Y38A 3BB6A 1QF3A 1DGRA 1ODMA 2QDNA 3WXPA 1XE8A 2XHKA 3ZXDA 2QTWB 2P2KA 1OD3A 4CXWA 1PK6A 3FWEA 4JTNA 5FKCA 3LIGA 5FZ7A 4QU1A 4DOUA 5HPOA 1NA1B 2WFPA 3WOGA 5F9TA 2VOXA 1S0GA 3E5UA 5DZFA 3WG3A 5FQ0A 3WCRA 3DXTA 2ZEYA 4E2SA 2ATFA 1GU3A 3PVOA 5D2AA 4AEJA 3KS7A 4XFIA 1REFA 5F3CA 2B42B 5CFCA 4I0WB 1ZA7A 2WN3A 1OPOA 2GNBA 2D6LX 4Q4V1 4TWTA 5FP8A 3ZSKA 5CFCC 3RDIA 4Q4X1 4YRDA 1PX3A 3RRDA 4BXSV 5HXVA 1Q8SA 2CL2A 1C57A 3IMMA 4CP1A 2VZ3A 3MZHA 1G9CA 2D3PA 4Q4Y1 5JXIA 1YI7A 1HV0A 1O6UA 1VAKA 3N7KA 4YARA 4IEXA 4WVMA 4KNCA 3VGIA 3LSDA 1HV1A 3HWJA 4LBMA 3VKLA 3AZXA 4QXHA 4EWEA 1W2TA 2HWC3 3D0JA 1Q8OA 2ORZA 4FQZA 4OHZA 3TEXA 1IS5A 1MZFA 3I2JA 4HVRA 4LEJA 2FD8A 1ULGA 1UZWA 3I3DA 3OG2A 1VBB3 1AJKA 4Y5TA 1C3HA 4QMAA 2JG9A 2W0XA 1DHKB 1LECA 1PO11 1AYM2 4I09A 5LA0A 4C90A 3MUZ1 4PBOA 3PTRB 3S57A 1UYYA 3LB9A 4MX3A 1MS4A 2G9GA 1FPN3 3SEPA 2VULA 4JV4A 3T0AA 1CJDA 4PQQA 1ZYBA 2JDKA 5F37A 1V6OA 4TN7A 1KS5A 3EYPA 4BK5A 2WWJA 3MV11 4ZXKA 4CP9A 5FP7A 2VVFA 2R0FA 1J58A 1NAEA 3RVHA 1WCQA 3EQEA 3WNXA 4OUSA 4DUWA 3M3CA 1FMD2 4JQRA 3GM8A 2D5HA 4PHZA 2XPJA 1LGCA 3IZOA 3FBYA 3MPPG 4JGZA 3NNGA 3POJA 4N53B 4IERA 4QX3A 4CUCA 1KGYA 4E2GA 2JG9B 3VBRC 4AEKA 4B7KA 4QM8A 1ZBE2 4AI9A 3WDYA 1OLME 2WZPP 1Z7S2 1N3OA 4S2HA 4YVWB 2W91A 5A3NA 3T0BA 5L19A 4X8NA 4EZ4A 1A3KA 4RD7A 1EPWA 2VQ0A 2PHRA 2YXSA 5FY4A 4CCEA 1A8DA 1UPIA 3T2OA 2W1SA 3PUIA 1A78A 4CP9B 5H9PA 2DUOA 4Q8KA 4LQRA 4CU6A 2RVAA 2BBAA 2XH6A 1WW4A 4P9XA 4L99A 3GGLA 3GNEA 4JGZB 3D82A 3C7FA 4JKMA 3PVBB 4XYXA 2W92A 2C24A 3TN91 4KBZA 1BK1A 1GZTA 2AUYA 4Q27A 4AI1A 1HQNA 3TEZA 2WO3A 4ORFA 3HBZA 5FJKA 3RZLA 4E4HA 3ILNA 4IQPA 3EJKA 4R8HA 1AR63 4M00A 2VUJA 3ZYIB 5BNNB 4AHZA 4CXXA 1LESA 3C7GA 3THPA 3C3VA 2CDOA 2RJKA 4XF1A 4W65A 1MZEA 2J1EA 1ZRRA 1JOJA 3M3IA 3TB0A 4MHRA 2EIGA 4OLLA 1IKQA 4FFFA 4DQAA 2DUQA 1RUI2 4ONUA 3UT0A 1QJY3 4KH9A 3MLKA 1N47A 3ZN5A 4XQDA 3KGLA 2YC2A 1O59A 4AXOA 3FFZA 2PN5A 1EV12 4DNYA 4YM1A 1Y9QA 4AAXA 2BUKA 2R061 2FDGA 3K3OA 3CKHA 2Z4FA 2P3JA 1NT0A 2AYHA 1HB2A 3J8F2 2VNVA 2R071 2W9XA 4OULA 1DGWA 4UW3A 4YW4A 5FZLA 2YPJA 4YWAA 3A21A 4XXAA 4YGCA 1U5ZA 2Y60A 4ZONA 4BLJA 5LEKA 5E89A 3U78A 3CHXA 2WABA 5DG1A 4NHLA 4XAEA 1RUH3 1VBA2 2DWRA 4UW4A 4HPKA 2XVKA 2ZEZA 4M3CB 1QDOA 3WF4A 2HWE1 5ACA2 3VV1A 5GZFA 3I2KA 4EV0A 2WKKA 1ENXA 1A8MA 4DIQA 1VBD3 2VH9A 2FCTA 3TYJA 4D7SA 3QH7A 2FDHA 5C71A 1LOEA 2R49A 4AQ6A 1V6KA 1FNYA 3JBG3 3PTYA 2RM22 4BCUA 1W8TA 2A6YA 3UL2A 5C3QA 3KCYA 1XYOA 2WS92 5HV0A 3U4XA 1TNFA 3KSCA 3V64A 4CDUB 3VDDC 3E97A 1TE1B 1TME2 2GMEA 1R64A 2GSYA 3KT1A 3VN4A 3M8LA 4LNVA 4XFBA 4XUPA 4E4ZA 2W2IA 5M0TA 5ISLA 2VCBA 2FHRA 4CXYA 2D43A 4AHWA 1JMUB 3D0SA 5LA9A 3HVDA 1GQGA 1DQ2A 4HXCA 1VMJA 5G04L 5IK8A 1O5LA 3T3YA 4IEUA 4ZZ8A 4NPRA 4ASKA 3I2OA 1VB4A 2GC0A 1BMV2 1QDCA 2BYVE 4LPLA 3LQCA 2LTNA 4LTAA 4YFZA 5A6XA 3N9PA 2XJPA 1G6NA 2WSUA 1W6NA 2YYOA 4S2FA 3RJ2X 1RC6A 1WKYA 5L9BA 4AEMA 4EN9B 4LBJA 3WG2A 1VRH3 2HYKA 1HB4A 2OQ6A 2WNUA 4MVTA 1YLLA 4Y1VA 3MV01 1BHGA 2DFBA 1V6LA 4R52A 1OT5A 4GJYA 1UZVA 2JG8C 3VKOA 4XJ8A 4AW7A 1OOPB 5FZ1A 2KXLA 1LEMA 4M3CF 3P3PA 4LO5B 4CUAA 3WV6A 1W2AX 4FAHA 1CAVA 3UKTA 4D69A 2XKOA 1F5JA 1QOOA 1UOJA 4FPOB 1O3QA 4SBVA 2YFUA 1HN0A 1YQ8A 4NO4A 3ZYGA 5AC93 1XSRA 4GZ9A 4XDQA 4KMQA 3D3AA 4D7YA 1A34A 4W6WA 5DAPA 2Q1MA 2G9FA 1BQPA 3K4ZA 2XLGA 1F2NA 3K4DA 3MPBA 3QD6A 4X6QB 1H8VA 4CDXB 3GCXA 1AYM3 4RHV2 4XIKA 1XYNA 1GKBA 3T4HB 1SACA 2JE9A 2BQPA 4GWIA 5KHIA 1LHUA 2UY8A 5KXEA 3LDRA 2PFWA 5ANNA 3X29B 4PQ9A 3AMPA 3CO2A 4M4PA 2XJQA 4XILA 4DRVA 3FJSA 1OKOA 3I2IA 4JX0A 3OTFA 3DCQA 1RYYA 1RHI3 3WW1A 5DAVA 2TEPA 2XVGA 3GBWA 4AFBA 3NAPC 1FMD3 1QJFA 1WA6X 5F2SA 5JOWA 3PUAA 5A7WB 1S4CA 4BB3A 2BU9A 4MGKE 1BEV2 5T5PA 3BYWA 4AQ2A 4E9KA 1MVEA 2VZSA 1LTEA 3QH6A 4K1ZA 1NCQB 3ILFA 4XAAA 1H0BA 4ZHNA 2Q4SA 2D6NA 3AL6A 5JOZA 1MQTB 1ZM1A 1ZZ9A 1ZBE3 1A6CA 4MGTA 3ORJA 4TLGA 1Z7S3 3M70A 5J1XA 4TZDA 3ZSLA 2W68A 5JOYA 4PF5A 2ARXA 1VLNA 2E63A 1FV2A 2HEWF 2QQUA 2VG9A 5FZDA 4AFCA 1AJOA 4MGIE 3AKQA 1L7QA 2C1FA 3ACLA 4QWNA 3OBZA 4QDSA 2QJVA 1JZ2A 3B94A 4MADA 2JXAA 2X09A 4Z92B 2GU9A 1UQXA 4IE7A 1YFXA 2D40A 4XF3A 2Q8DA 1MS9A 1IHMA 4N7UA 1BXHA 2LRPA 3OD4A 4OUEA 2GN3A 1SPPA 4ARXA 5K9YA 2B46X 2WYFA 1GBGA 1XNKA 3O1MA 2VW0A 4XUQA 4GD4A 3RPQA 4DB5A 1RVF2 3IN9A 4MG2A 4LKEA 2GZWA 2HWB2 2I74A 4DEQA 5ABJB 3VZMA 3WUCA 2XKPA 3KT4A 4P5YA 5FK8A 5C5TA 1UU6A 1TMF1 1S0CA 2YPDA 1SDWA 4B1LA 4JHZA 5LRSA 5KC6A 2BDRA 3A0NA 3BKZA 1NOVA 1QJX2 2E7TA 4EN0A 4JHTA 1WMEA 1GUIA 3VBHC 5FOJB 4IEWA 1K12A 2V72A 4QPIB 1UZ0A 5C9AA 4KBBA 2VZOA 2ZMKA 4DUXA 1RUE2 2DTWA 1COV2 1EV13 3NSTA 4XE9A 1LAJA 1V6NA 1V00A 3LEMA 3FLTA 1QJZA 1K42A 2VMIA 3J8F3 4D8MA 2GMMA 2OZJA 3JCIA 4G4FA 1HKDA 4W6YA 2DURA 5L7OA 1W6PA 5CZKA 1OUSA 5F7UA 4Q0SA 4TYSA 3BOPA 2BOJA 5F39A 4BIFA 4KWUA 4A7YA 4LBKA 3BVCA 2VMDA 2WZR3 4R9CA 1DBNA 1W06A 2BWCA 2D98A 4R4ZA 5IVJA 1OXCA 1UY3A 2A5ZA 4Z82A 3MEPA 5C9AB 1DQ0A 1R081 3ZPOA 3O1OA 2BTVC 2VQUA 5LWBA 2VMFA 5ACA3 2W94A 1OD5A 1LULA 2WWSA 1Q8QA 4WM8A 1RUF2 1TQ5A 3UK9A 4HN0A 3WZ1A 3FUQA 2OT7A 3S30A 3TEYA 1UYPA 2HLEA 5C4WB 2J1SA 2EXIA 1D2SA 3ZXJA 4QDRA 3WSOA 1JYIA 2RM23 3VBUA 4ISQA 1JOBA 3Q8EA 4LBLA 3U1XA 3WR0A 4Y1YA 3H3ZA 4FP2A 5EJ1B 1HRI2 3NVCA 2Z69A 2B9VA 4BQ3A 5KWRA 1ULDA 3N9OA 2O8OA 3K46A 1PX4A 1VBE2 3PUQA 3U11A 1W28A 1DLLA 3AP7A 4WM8B 3PHMA 1CX1A 4WM7A 1TME3 3U75A 4HK9A 2GH2A 4AG4A 5F6KA 1CAUA 1SDDB 1FAYA 3K48A 3JQXA 3OEAA 4QB1A 3N9LA 5SV8A 1NLQA 1MS5A 1QH6A 2JB4A 2ZGSA 3HN1A 3WP3A 4GA9A 1J59A 1GQHA 2GC1A 4NAMA 3VBUB 3POFA 2ZTNA 2ZHNA 4AVCA 1PGL1 5T52A 2YMZA 4I3GA 5HCAA 4DXZA 1ZRFA 1OFNA 1SFNA 2WN2A 5C3PA 3PL0A 5JSRA 1LOCA 4FPLA 4WZCA 4RGAA 2VUDA 1ZZ6A 1GNHA 3VBSB 1W2OA 3KZ4C 4IL7A 2WT2A 2Z42A 4QM9A 5JXHA 3KF3A 2WNVA 4UFJA 1VRBA 5DAXA 5FYYA 3PIGA 1SLAA 1ZVFA 5KHJA 1RUD1 2P37A 3IAPA 4NRPA 4XOGA 5DUWA 2JIGA 4AL9A 4J25A 2VZQA 5CG8A 1LKNA 3VHRA 5IATA 1PGSA 1ZBA1 4OI0A 3DYPA 3NV4A 2JICA 3VHOA 3CMGA 1H9WA 5I0DA 1WZXA 3C7OA 1DYKA 4K8FA 4GWMA 4CYDA 3WNLA 4I0AA 2Z2SB 2XXZA 3H0OA 3FN9A 1SLIA 3AKPA 4HVOA 1APNA 2CHHA 2TUNA 3HPNA 4DEVA 4KU8A 3I3EA 4COUA 2IXCA 1W3XA 2LM3A 4ZXEA 2VAUA 1ND3C 5LEJA 2OW4A 5FZ6A 4LT5A 2WC2A 3ZXEA 4QGLA 4RHV3 3H7JA 4RS5B 5DUVA 2ZMLA 2WYSA 1O4ZA 2HWC1 3RZMA 4ATFA 2D44A 3Q8CA 2VTXA 2Y6GA 3BTZA 2I2SA 4COZA 4E2QA 3OY8A 3PMEA 2HWD1 4XFHA 2QQKA 4RL7A 4RYDA 2ZGMA 5LCWL 1Q8PA 1SEFA 5A6QA 2BPA2 1G9DA 3M3QA 1W9WA 4O7XA 5IAVA 4MGZE 3NV2A 5KXBA 3WY6A 2XOMA 4CEYC 4KG0A 2AREA 2UWAA 3NMBA 4O65A 2R1BA 5D8AA 3IIIA 4NIAA 1V9U2 5D8AC 4OFGA 5JDBA 1UY4A 1UY0A 4GQ7A 1XU2A 1QU0A 2ADDA 2ADEA 1QQP3 4YVSB 1OPMA 3OY8B 4Y4RA 2MNGA 4K9SA 1QWRA 1LCLA 5A7QA 3VB9A 3ZXFA 1JZ6A 3Q8BA 4J6GA 4XVHA 5IAXA 2QQPA 4LO7A 4PIZA 4IV3A 3VZLA 3U14A 1UW8A 2ZHLA 1OA3A 2YC0A 4ARYA 3JD72 4L97A 2RMU3 5CB7A 1RVF3 3J7NA 5IVYA 1UZYA 2HWB3 4LBNA 1H1AA 4LUMA 3OCPA 5FXVA 2V73A 3S7IA 1RL3A 2V5DA 1ACCA 2JX9A 4N7IA 4NVPA 1ND2C 1EAH3 2Y64A 2YGMA 4QHOA 3WP5A 3GZUC 4AVAA 5FO8B 2MEV1 2ZGTA 5E6HA 3ZYJB 4O9EA 5FRAA 4M4RA 1I9RA 4NOTA 4Q1PA 1T6BX 2IFRA 1WLTA 4XJUA 4RQPB 3ZVXA 2CGOA 1IPKA 2TBVA 4Q26A 3I59B 1RUE3 5FWJA 1COV3 3OBTA 3HNBM 4LBQA 5JZGA 1W39A 4Q4W2 1LJ7A 5FO9B 2PLV1 1RMU2 2P17A 3UETA 2WQZC 4OVEA 1OQDA 5IFTA 3H50A 4H7MA 4FO9A 1YWKA 1UOGA 2YBKA 5LA2A 4BQ1A 4XTMA 4FPCA 4DRRA 1SFPA 4GMP0 5FAXA 4CCMA 4SLIA 1Y9MA 3QACA 4J1WA 4YZ5A 5LK7B 5J3UA 4V2VA 4O61A 1FATA 5CFDA 1AYN2 4CEWA 3V0BA 4C1WA 1YQ2A 5CYYA 2NQYA 1LEDA 2OKXA 1AXZA 1D0HA 4M0NA 4AAPA 3AZWA 5JUVA 2FBEA 4NJ4A 1DZQA 4JGYA 2SLIA 1AR71 4N43A 5FZ3A 3ZFEB 1RUF3 2HKXA 2XWBB 4JGYC 5D21A 1HRV2 1N1VA 2ZGPA 2RG4A 4L2NA 1D7PM 3KV9A 4YYOA 1RUH1 5FZHA 2XVLA 5K0UA 4HBNA 2Q30A 1T2XA 1MS3A 3MFAA 1IPSA 3IM0A 2X5IA 4QPGC 4XZUG 5IVCA 3U4SA 1NLRA 1ASJ1 1HRI3 4RSUA 5CFDB 3V0BB 5HBAA 1MS1A 1UNBA 3SCFA 1SQ4A 2C9AA 1BLZA 4A2UA 5A3LA 1VBE3 1OLQA 3BPSA 4XQWA 3DPRA 3PJYA 4N43B 1NX9A 3UV9A 1RUC1 1W6OA 3A4UA 4GMP1 1V6JA 3E5XA 4CUBA 3IDAA 4ZKTB 5FR3A 2VUAA 1CX4A 1H30A 2ZXQA 3N7LA 1RGSA 3RZZA 4LXLA 1RITA 5FY1A 1EYBA 2ZX1A 1DQ1A 2DCKA 3SKJE 2IC1A 1OQ1A 3OUJA 4GB32 4HKWA 5T50A 1JN2P 4GH4C 2VBDA 4QX5A 3THDA 3O0VA 4AGRA 2QNKA 4IV1C 3LIHA 5T5JA 4FTSA 3IT8A 3H8RA 3FFQA 2N7GA 1PVXA 2X10A 3DPRB 1QJEA 2V5YA 2EAAA 5FZ0A 5IW0A 3T09A 2YBPA 4I2OA 2IXJA 2A1XA 4ZU7A 1W6OB 4NWWA 1UAIA 2YU1A 4ZS3A 2JDZA 1HXS1 5FWEA 3LFMA 4BQWA 4TLFA 3PNAA 2ARAA 4HONA 3SMHA 3RYRA 1MEC2 4LORA 1OVSA 3ATGA 2XDVA 2EXHA 1VRH1 3ZFFB 3URFA 1WCUA 2QUOA 3OB8A 1HB1A 4BPZA 2OXBA 1Y4WA 4Z1VA 2PQSA 4YG3A 1D4VB 1HLCA 3N35A 2E53A 4HFSA 1R092 5FZFA 5KHHA 5FMCA 1CONA 1C8M2 2E6VA 3HBKA 1QEXA 5DUUA 3SXWA 4QQHA 4CDWC 2OZ6A 5J98B 3UKNA 1DIWA 2RHPA 3I2DA 4KGGA 1W6QA 4XACA 5JMOA 2ZA9A 1PIV1 1UIKA 2H0BA 2J1AA 2Y8KA 5AC91 5DDJ1 3I3BA 3CU7A 2OUJA 3CZUA 2J1VA 5JR7B 5G05L 5J09A 1RXFA 1DZTA 1DYPA 1F8VA 5J96B 5JSPA 3LA7A 3O1SA 4FPGA 2FQPA 2KA3A 2RS31 3AYEA 5FZOB 4IXLA 1T6GC 4UBHA 1I5PA 1S0BA 1STMA 2Y6KA 2ZKNA 5EYYA 1W6QB 3ZR6A 2C0ZA 3OPWA 1W99A 3O7OA 1V9U3 1R1A3 2PHWA 3N7MA 4HKLA 4BHPA 2VCCA 2VO5A 5JWPA 4ASLA 5IK4A 4XUOA 4MOAA 1CZTA 4LOTA 3PVEA 1Q43A 1QJU2 2P4EA 5FPVA 5FUPA 3UJQA 1OLRA 2RDSA 3NNJA 1G86A 2ILMA 5HCBA 2DFCA 2YY1A 1IG3A 2VCAA 5FYSA 2F4PA 1NA1C 4KWJA 4YW6A 3JD73 3N9MA 3LGRA 3TRSB 2ERFA 2BJSA 3VBFC 4ZZ5A 4BQ2A 3OD0A 1RTVA 1POV0 1OBNA 1SBDA 1VAMA 3MIBA 3C7HA 4K6BA 2F17A 1H6YA 1W2UA 1W8WA 2A3WA 3CIHA 3PURA 5JSOA 2XBO3 4CP2A 3LOBA 4OQ9A 3POSA 1RJ8A 1WMXA 4MGSA 4EE2A 2L9LA 5T54A 1DCSA 2VM9A 5FMOL 1FNZA 1PK6B 1XOYA 1YO8A 2TNFA 2BERA 4LHSA 5FQ0B 4FOWA 1G9AA 4P9YA 3LD8A 3R05A 3AYDA 1LENA 4A45A 1PO22 1GWMA 2AACA 2HH9A 5FO7B 3WQBA 4Y5SA 3MI8A 2VCMA 1F5FA 3U0ZA 3WVJA 5CFCB 4YM3A 2VVDA 2WIIB 2BOIA 3LEIA 4Q4W3 1RMU3 2B8MA 3FLRA 3J7MA 4AK3A 2GNTA 5A33A 3ZO0B 3ETQA 4FPJA 1RXGA 2O14A 3I2HA 5EIYB 2CV6A 5BXXA 3UGGA 2O1QA 3MIGA 4QB2A 5FPXA 3WNOA 3B93A 1W0NA 5CKQA 4GWJA 1AYN3 1AZDA 4WVMB 1POV1 5HXMA 5DUXA 2CYFA 1W04A 5JI7A 5IVVA 1W2NA 4V2WA 2X29A 5A3OA 1RUG2 3HR9A 1PIV2 3I4IA 5LBFA 1C1LA 1MS8A 5DDJ2 3UGHA 1K45A 2YG0A 2HWF2 2CWSA 3BU0A 3P6BA 2WZR1 3VBRA 4AQSA 3U07A 4MH0E 3LA3A 2GH8A 1SLBA 1OHFA 3MW4A 1CIYA 4X6RB 2A6ZA 4L11A 2Y0IA 2YBSA 2YU2A 2WFF1 3CZJA 2LS6A 4YVWC 5FZ9A 5EJZB 1FOD1 1UYZA 2B4KA 1VALA 3QLQA 4LA2A 4PDWC 1K5MA 1F4AA 1LU2A 2D93A 4D94A 2Z5WA 4PBPA 4B1MA 1K5MC 4JDMA 1ZZBA 1S2EA 3A0KA 1WMFA 1UKGA 3USUA 2FDJA 1OKQA 4P9GA 3WW4A 1RB8G 2GMPA 1IS3A 1J3PA 4UOJA 3H1MA 3NL1A 2W1UA 4YZ4A 4UWDA 2QQLA 2QCSB 3I3MA 3W5MA 3KD4A 5A3TA 3BOWA 1OC1A 1WW7A 2VTXJ 5ERLA 5FY0A 4C0HA 3KLSA 1M06G 2VZUA 5LRRA 1WD3A 3T2PA 4GB33 2YHJA 3PVNA 5FY7A 1L7RA 1UMHA 1AL23 3ZR5A 4CCDA 1F4HA 2H6CA 2XL7A 3HAGA 3AYAA 1UCXA 2EICA 4KU7A 1TVGA 4HSLA 4COYA 4BH9A 4NIDA 4C91A 5BNNC 4Q1RA 1F35A 4G9SB 4JQTA 1PM4A 4MXWA 5CNAA 5E88A 3WLUA 2FZ2A 3USUB 2J42A 1JYTA 1YFWA 4FI9A 4Q4V2 1CN1A 3ZYRA 4P02B 1NY71 4Q4X2 1CWPA 3LE0A 4PCRA 3ZIXA 4RGKA 1YRZA 3POIA 2IXKA 3ZKUA 1GMMA 3SH5A 1FX5A 2ET1A 5CKNA 4EWAA 4K40A 1MEC3 3H42B 3GJAA 5A7SA 3AX4A 2WBKA 2AGSA 4LLFA 5LY1A 4Q4Y2 1YJLA 2P6HA 2XL9A 3WQ1A 1CAXA 5C6CA 5KXCA 2AH2A 4EJRA 3ZYFA 1V6IA 1ST8A 2VOKA 1VBC1 1R093 3S7EA 1C8M3 1B09A 1SCRA 1SBFA 3WP4A 1D4M1 4QHBA 3WNMA 3WF1A 3BN6A 4Q29A 5FYMA 1PO12 3NNMA 2D6MA 1N3PA 2VL4A 2A70A 2DDUA 2ZAHA 1W6MA 1AR93 3M3EA 5JMCA 4NHKA 2E9QA 5BNPA 1OH4A 1W9TA 2YC4A 3SKVA 5JXGA 5BNPC 2ZAAA 1GNZA 1DGWX 2E33A 3NNFA 4I02A 5BYNA 1JODA 4GJZA 4XJ9A 4D6SA 3MIDA 1KQRA 3E6BA 5HI0A 5I8SA 1UOBA 2PHDA 4GAZA 3VD4A 1W05A 4NAOA 1G7YA 2D7FA 3DKQA 4CPBD 4HPKB 1HQLA 1PGW1 4HT1T 1G9FA 3VDDA 2BFUS 2ORXA 1J1TA 1W6MB 4PLOA 2XQXA 4CCOA 2AEZA 3LDBA 2ZS6B 4CDUC 1C1FA 2OA2A 5C3OA 5K7PA 5FBZA 1QJU3 3LEKA 1F31A 5L9VA 5FZGA 2E51A 3AM2A 5F5QA 5IVFA 1XQNA 3GHMA 4JTOA 1W8FA 1MR5A 5IHRA 3IAQA 5EWSA 5FYHA 3BTYA 1NZIA 3TWIA 4EN8B 4W4ZA 2E26A 5FREA 3VBOA 2BVVA 3TN92 3VDDB 2PHTA 1QY4A 4DUVA 3VBOC 4YG6A 1QMJA 1LHWA 2VD7A 4K8RB 4ZS2A 5CADA 1BKZA 1TZOA 2DCYA 1LNSA 2ZEXA 1CAWA 1E5RA 5EYXA 4BK4A 2ZGOA 4OYUA 4XDOA 2CU5A 2RR11 4CRQA 2Q1ZB 2JG8A 4XZPA 4AWDA 2EVXA 1ZNPA 4JVAA 3WHUA 3HJRA 4LK6A 3ZM8A 2R16A 4B3NA 2ZX4A 5T5LA 4XIOA 3LDKA 1U12A 1NUKA 1OOPC 4V1PA 4QXKA 5FPZA 1H2LA 1LGNA 3A7QA 4GIQA 5FMDA 4AVSA 2W46A 1DLCA 1W6NB 3POGA 1UU4A 3ZXKA 5EPAA 3O1PA 1GOGA 2UURA 4L8QA 1CAWB 3KVBA 2FCVA 1ULPA 2WNUB 3CDZB 3GZEA 2XUEA 4XTPA 2QQVA 3F2ZA 1XNTA 5A3UA 2R062 4YNIA 4FCAA 4JZRA 5LK5A 4AEDA 3DXUA 2CGNA 2R072 3GJBA 4AEDC 1BBT1 1CJPA 2PHXA 2H0VA 1CAVB 4FPEA 3RWKX 1H2KA 1VE0A 5IYYA 5EP9A 1W9FA 1D4M2 3DV8A 3KHCA 5KXDA 5A32A 1BJQA 4OI4A 2Y6HA 2A71A 1RUG3 4FP3A 3NAPA 5A7OA 1PVC1 2XGXA 5FLHA 3MFCA 5L9RA 5KC5A 3M3OA 2VBBA 1WWYA 2HWE2 3NO8A 3VD7A 5FZCA 1AR81 1H4HA
chains in the Genus database with same CATH topology
1ZREA 3MIHA 5JCTA 5GLVA 1MQTC 2CNAA 2EAKA 5H9SA 5A32B 2ZHMA 3NAPB 1XNDA 1H2NA 1XNBA 2DVGA 3JQWA 3NJZA 1WBFA 5EV7A 3WDXA 1BVP1 4AVVA 5CA6A 4XPVA 2RS11 2V09A 4LE4A 1GICA 2WA4A 3OGJA 3SCGA 2PAEA 4DMIA 1ZZCA 3LCPA 1KITA 4COWA 2D6KA 5KHGA 5DZEA 1LU1A 2R041 4AF9A 1RUOA 4HN1A 2D5FA 4OI1A 1E57A 3EBRA 3PJQA 3JB4C 4TSVA 3WG4A 3OF1A 1LHOA 3VBHA 2VMGA 1RUI3 3GZTB 4Q4V3 4Q4X3 2RR12 4QD2A 2O0OA 1YUDA 3ZX7A 2CAVA 2WLPA 1H8TC 4Q4Y3 2OVUA 5FLJA 4DS0A 3WCSA 4HLTA 2UYBA 1OA4A 4LO8A 3MYXA 2PAKA 3AZYA 2IZWA 2RS51 4GXLA 1CPMA 1O91A 3SISA 4I01A 1VBA3 4XW3A 1J3QA 1PO13 2Z79A 1YIFA 4B29A 2ZABA 1N1TA 4XFAA 4HKOA 1RUJ1 3AZZA 4WVVA 2XUMA 3U10A 4GALA 5L7OB 3ECQA 4UBGA 1W6PB 1GLHA 2X8KA 1VB2A 4RR3C 3HT1A 1IKPA 4HSJA 2WS93 3VLBB 4KWLA 2A6VA 4KL1A 1WD4A 1PNGA 2GNMA 4Y20A 1HDKA 3GHNA 1UPSA 3ES4A 5IT6A 1KS4A 3B9IA 4LO6B 2GC2A 4K1YA 3FZ3A 3N4MA 5K8SA 4FPFA 1Y43B 1R1A1 5FOBB 3O14A 1VAVA 2ZHKA 3MF6A 2WLQA 1ZRCA 1UD1A 4E4DX 2UU8A 2VVEA 3MIFA 3AP6A 3EHKA 2DVAA 3M1HA 3TN93 2JD4A 3M2MA 3TBDA 3KT7A 1GZ9A 1PZ9A 4Y20B 5C8CC 5FDBA 4WM7B 1OFSA 3IDBB 2Q5TA 1NXD1 3VBSC 1CAUB 1YNAA 2R042 1U5YA 1TMF2 1QNWA 4OHYA 5JIAA 1S0DA 5EXOA 4P9IA 2XBO1 3INAA 3SHRA 4HETA 1H2MA 1KFXL 3ZXAC 2AZ5A 2DVDA 3CF6E 4GKXA 3MDPA 4P9WA 3R4DB 2WSVA 4U2AA 1ND3A 3CEWA 4CDQC 2I45A 1KDMA 2SBAA 2R063 4Y22A 4Y24A 4R9BA 2WNVB 4XJWA 2NLRA 3B69A 4RS5C 1LOAA 4IETA 4CZSA 1VBB1 1F9KA 1SLCA 4WBBA 4BM8A 4BOWA 3W59A 2VMHA 4A3XA 3ZSEA 1O4TA 3AP5A 5I0SA 1HW5A 1KFUL 3JUUA 3H9AA 1R082 2YROA 3P3NA 1S0IA 2D6OX 4OHXA 4FQ4A 4CEYA 1BEV3 2HWE3 3T1LA 2W52A 1FPN1 3MW3A 4K3UA 1IQAA 4Y22B 2EXJA 1ENRA 1QOSA 5FLIA 5CG9A 4AI3A 1U5XA 4INDA 4ZU5A 2F6BA 1URXA 1OQEA 1OA2A 3ELNA 3B9CA 1JHNA 1BZWA 4RGGA 4K20A 1GFF2 4CEYB 3WD5A 5FCCA 4AVTA 5D8AB 2JECA 1YIPA 4H3WA 3FLPA 4B4QA 2P3KA 1D0GA 3E6CC 1QH7A 3MLJA 4LHKA 1PGL2 1ND2A 4FXGB 4M3CE 2PELA 5GLZA 1NCRC 3O0WA 1LOFA 1YCIA 1B35C 4Y1XA 3L9JT 1XU1A 1LOFC 1QJX3 4IV3B 2LALA 3IWZA 3VL9A 3ZN6A 1YFUA 2WL1A 2A73B 1AR61 4AHYA 3BCWA 1DQ6A 5CIRA 4RQPC 3USSA 4AGVA 5C8WA 3BU7A 1RUD2 3N36A 4BMEA 1YXWA 1LOBA 1EPZA 1ND2B 1QJY1 1GZWA 1ZBA2 1NQJA 1VIWB 5T3NA 3FX3A 1IS4A 5L36A 1DGRN 3HIFA 3T1MA 4FVVA 2C5DA 4UW6A 2VOWA 5I0TA 4PJYA 4FBFA 4W6XA 2VY0A 2HWC2 4ZU4A 1REEA 4LBQB 5JZGB 3MIEA 2IXHA 3ZFEC 2HWD2 2LUWA 4QPGA 4B8EA 2BNMA 4NWVA 5BNOA 3NWKA 5DZGA 4CEWB 5BNOC 3H3UA 4PLNA 4M0HA 3J26N 1CGPA 1ULCA 5GLTA 1CD3G 1VBD1 4E4SA 4IEPA 4JGYB 4QGNA 4YGDA 3JBG1 3ZFGA 2QZ2A 4AI2A 1O5UA 3D6EA 3S0MA 3ZFGC 3FUOA 4O9GA 5K0UB 4RA0A 1GSLA 2WT1A 4K7JA 3DN7A 2X5IB 4GH4A 1QXPA 2VPVA 2YZ4A 1X33A 4IV1A 1DU3D 2ZCWA 3BALA 1Q5OA 3OGGA 3ILRA 1C5HA 2NPIA 4DINB 5EFUA 4BYYA 2ZMNA 2W39A 4XHXA 3AFGA 1DFQA 4QQ2A 1X7NA 4ES9A 5DXDA 2ZBJA 1Y3TA 2QVSB 5JIUA 3WT3A 1X8EA 4MYEA 5AVAA 2K0GA 3OPZA 2MEV2 1UX6A 3OYWA 3IPVA 4GH4B 3AMHA 3GBFA 3HQXA 1AR62 4YFWA 1FYUA 3ZFFC 5GZEA 4CDWA 4EWDA 2WINB 3IBMA 3H1YA 4WVWA 2P3IA 3O0XA 3ZN4A 1X36A 2PLV2 2BWAA 1QJY2 3VL8A 4FOVA 4WVZA 3H1WA 1I1EA 3AMQA 2VW1A 1LHVA 1SCSA 3CJIC 2RE9A 4FTBA 1J1LA 1AYM1 5H9RA 2B45X 1NLSA 3MW2A 2MHFA 3RWNA 3JZVA 1AR72 1W0OA 1QXRA 3GALA 5GKAC 3RMXA 4QGMA 4AE2A 2VGDA 2GDFA 2A6XA 1XYPA 4J1XA 2H6BA 1RUH2 1RHI1 1ZX5A 3IKWA 1FMD1 1FV3A 4AVBA 2EALA 3RYKA 1REDA 2BGCA 2GALA 2D6PA 2PHFA 1ASJ2 1UF2C 2R30A 1MACA 1WW6A 5I0RA 1R1ZA 1X50A 1ZBE1 1Z7S1 4Z2WA 1NA1A 2IWGB 4LO4B 1MVQA 5I0UA 1QHDA 3VBFA 1RJ7A 3MICA 2P34A 1OMIA 5C33A 1RUC2 3N7JA 5E8AA 3TNPB 5L73A 5A3MA 3AB0A 1AX1A 1V6MA 1YJKA 2DCJA 3D4KA 2JE7A 4KG8A 4Q0VA 3WINE 3WDVA 2MPFA 4MGYE 5IK5A 1Y7BA 2ZGKA 4DY5A 1PK6C 3GF6A 4H55A 3B02A 3SH3A 1KJLA 1O3SA 1IZ3A 2BEOA 3VBFB 2JKBA 3M4FA 4XXPA 4KGQA 1HXS2 2VXRA 1JUHA 2Q0AA 1DG6A 4LHLA 3WG1A 3RQ0A 1RUNA 1RUD3 3VKMA 1AL0G 1SLLA 2A3YA 3G7DA 1RUI1 2K2SA 1VRH2 2ZGLA 1JW6A 1HQWA 3D5OA 5I91A 1IGOA 1ZBA3 1WBLA 2A3XA 2VNGA 1Z78A 4Y4YA 1NZCA 3R6SA 1EV11 4AFMA 2XJRA 3ZSMA 3DUIA 1I6XA 4CP0A 3GBGA 4F83A 5D1IA 3J8F1 5GALA 2ZX2A 1YHFA 2YUEA 5AC92 2JENA 2VECA 4ITCA 2B39A 1S0JA 2NMOA 3WQ0A 5GZDA 3R4UA 1HRV3 1Z0HA 4YZ1A 4N53A 3VZJA 2HWD3 4DZGA 4S2DA 1VBA1 5A33B 4N53C 1GV9A 5I8YA 1I3HA 2JG9C 3THTA 4A7KA 2RS32 1H1MA 5ACA1 3AP4A 4YVWA 4EN7B 2R6QA 4PDWA 5E16A 2X53S 1QGLA 4LA3A 3O12A 3KGZA 3ZSJA 2XLAA 4FPKA 1RHI2 3W58A 1CQ9A 3FHIB 5TSWA 3ASIA 2RM21 4FOYA 3W9AA 1ZRDA 4HZFA 3VBRB 4Y1ZA 3RYPA 2UWBA 3WDUA 2WS91 3H7YA 4JGZC 1FXZA 3IMNA 3KCXA 4AFAA 4N9HA 3AKRA 3LKJA 4PDWB 1BCXA 1TME1 5HCFA 5JAXA 2OPKA 4F3JA 3RI9A 5BNNA 3K51A 1K5MB 2EF6A 2OYZA 3TAYA 3TNQA 4L9BA 1BMV1 2PHUA 2XG3A 5GJ6A 3APBA 2YDEA 3SNMA 3WX5A 1OI6A 2MEV3 2IFWA 4AHXA 1OSGA 4PIXA 4ES8A 1SMVA 4Y26A 4OI2A 5JPMB 1GR3A 1WCDJ 4P9JA 1SBEA 4XF4A 4MXWB 4MSVA 4EN6B 2B9UA 4CTEA 2BBVA 1XXNA 3BIWE 2QDRA 2PLV3 4XBLA 4X8PA 3LZZA 2KM2A 2DVBA 3POWA 3FMGA 3NW4A 4M3CA 2RJLA 2Q8OA 2ZX0A 3VZNA 3RJRA 2XJTA 2PYTA 4LBOA 1CAXB 2XJSA 3ZXLA 2YV8A 4Q0QA 4HK8A 4RHV1 2CTVA 3WQ7A 2Y26A 5SV5A 1AR73 1KXGA 4PLMA 4COVA 1H1IA 1JTZX 1NE4A 2WZR2 3NV3A 2ARBA 4L92A 4BE3A 3IIAA 4ATEA 1BVVA 2CWMA 1SLTA 4QQLA 4XJAA 4CDUA 1CESA 1BEV1 3SLIA 5BNPB 2WFF2 1ASJ3 1N1SA 2PHLA 4YM2A 1FOD2 2ZZQA 2WT0A 4Q2FA 1JBCA 4BIOA 3DKWA 3PLQA 1BYHA 1LR5A 4XBQA 4B4RA 3JB8A 1QQP1 1RUC3 2ET7A 3EO6A 4GMP3 4XBNA 2VNOA 3WDWA 4AFDA 3WW2A 3KM5A 3LAGA 3J4UH 4R9DA 3WW3A 1I5ZA 3AK0A 1NQDA 2GNDA 4FXKB 4P5HA 2BFUL 2RMU1 3D8CA 3R0RA 1UKRA 1RVF1 4DY3A 1OOPA 2HWB1 4LE3A 4C0BA 5J48A 4Y1UA 1W0PA 4Z8BA 1FI2A 1PMIA 1PO23 4DFSA 1HXS3 1NY72 3VBOB 5BUVA 1AVBA 3AMNA 4KWKA 1EAH1 5F6LB 3J9SA 4AYUA 4P14A 2BVBA 1O3RA 1QJX1 1YYNA 4DPNA 3FE5A 1DF0A 4OUMA 1O3TA 2JG8B 3RG0A 4MLOA 3CL1A 1RINA 2WNUC 3I7DA 4CDXA 1DGLA 2R0HA 2VW2A 4AI0A 3ZMOA 1RUE1 3QBQA 4CDXC 1COV1 1VBC2 2DUPA 4Q0PA 1HX6A 3E6DA 4FT8A 3B3QE 4HMZA 1PIV3 4XF9A 3DGTA 5DDJ3 1S55A 4YW5A 5H9QA 2HWF3 2UY9A 1FT9A 1WLCA 2ENRA 4RFT0 4BMBA 1U5IA 2QE3A 4XFCA 1NCQA 3Q9OA 2HEVF 3AYCA 5E1RA 5CBLA 4AEDB 1V70A 1MQTA 1NCQC 3ENRA 2RS33 4XMIA 2ES3A 1UL9A 1LODA 1RUF1 4JC1A 3ALQA 1C4RA 4FPHA 2QZ3A 1H4GA 4MV2A 3NV1A 3VKNA 1PGW2 2DVFA 1JH5A 1G9BA 2GAUA 1SFYA 1UIJA 2ZACA 1HRI1 1KDKA 4JRAA 4QQPA 5EJ3A 5T5OA 5IUQA 4LBQD 5I93A 4YG0A 2BNOA 1VBE1 2K9ZA 4IEZA 1O4YA 1NXMA 1WW5A 5ABJA 4WV8A 4XETA 2Y0OA 1QQP2 4BLIA 5ABJC 2OUHA 2ZGNA 1Q8VA 5JVVA 2VNRA 3UKVA 4HVQA 2UWCA 3AXEA 3AXDA 1WGPA 1IOAA 3R4SA 4MUVA 4QPIA 2NYYA 4XJZA 5JLVA 2NP0A 2RMU2 1ZZ7A 1H8TA 4QPIC 5KHKA 5J7MA 2GC3A 3AJZA 3RI8A 3AFKA 1PHMA 3V56A 5BPXA 5GZCA 2JJ6A 3E5QA 1WLWA 5BNQA 1EAH2 4R4XA 4AI8A 2ZGQA 4N90A 3VBHB 2DU1A 4JDOA 4KQ7A 3OBRA 1LB2A 1D2QA 2DCTA 1DDLA 2NN8A 3FC0A 4FTEA 1H8TB 3TOJA 5C9AC 1KD7A 1X82A 2G4IA 4LULA 1ENQA 1BBT2 1EY2A 4IESA 4I0BA 1POV3 3ZMNA 5FTTC 1GYKA 5T55A 5C4WA 4B7EA 3IDEA 3EXUA 2ZGRA 3CLPA 1PVC2 1XRUA 4OHVA 5C4WC 5L7OC 4RR3A 3VZOA 3S6PA 2FMDA 4GWNA 3VKFC 4AQTA 1LHNA 1JXNA 3ZXGA 5JPNB 4BWOA 1AR82 2DYCA 4XF0A 4OHWA 4IEOA 1ZA4A 1EP0A 5KBFA 1VP6A 1AHSA 4A7ZA 1HIXA 2WFF3 3M7AA 2BNNA 2ZOEB 1FOD3 2WNEA 4WM8C 3KMHA 1V9U1 4MZUA 4AGGA 2A7AA 4RR3B 1ZZ8A 2VQAA 3RS6A 3CNAA 4F8AA 3ROUA 1PZ7A 1PM7A 4OZXA 4QT6A 3VBUC 1WMDA 4R9AA 5FFOC 1O7FA 4HANA 2DCZA 1YI9A 2RS12 3BODA 3CJXA 4YW1A 3ME2A 5C8CA 4E27A 2BW8A 3LSEA 5GLWA 1CIWA 1AF9A 2WA3A 3VBSA 3JD71 2YGLA 2O8QA 4FPYA 3NKGA 4C1XA 4WM7C 2ZX3A 1NG0A 3DF0A 1MZ6A 4ISRA 3VUOA 2JEMA 1TEIA 4JDNA 4YGBA 4I30A 4IEQA 1MS0A 1J3RA 1DQ5A 2HJIA 2R32A 4Z07A 5I8TA 1AX2A 2ETEA 5C8CB 4CDQA 1QKQA 3ES1A 1ENSA 4YZ2A 2QKDA 2NZ9A 4QPYA 2E7QA 1DQ4A 3JU9A 3AP9A 3BPZA 4RS5A 2R073 1XE7A 2WNVC 1VBC3 2XJVA 3OJBA 4NR1A 2XJUA 4PIYA 2RS52 3I8TA 4Q4W1 4QU2A 1D4M3 1RMU1 3RNSA 4D7TA 5GLUA 4YM0A 2AR6A 1ALYA 3KQRA 4CDQB 1ND3B 1CR7A 1AXYA 1AYN1 3B00A 1IS6A 1G8WA 1RUJ2 4YSFA 3VHNA 3SH4A 4D3WA 3MGUA 1S2BA 1VR3A 1RIRA 1HRV1 1PZ8A 4YVSA 3RSJA 4G3YC 4YVSC 2XB6C 3GZAA 3FBMA 5CU1A 5J36A 1N3QA 4WZFA 1XNCA 3B7MA 5GZGA 2DF7A 3DL3A 3LOIA 1LRHA 4LUKA 4GULA 5AFEA 4Q8LA 3POYA 1R1A2 3ZDSA 4YZ3A 4S2GA 4U36A 1QOTA 2D97A 3I54A 1C5IA 5F1RA 4GKYA 4JRLA 3MF9A 1YFYA 1NCRA 3VZKA 2QFEA 5AFBA 4HL0A 1IPJA 1B35A 1M4WA 4K21A 1C28A 4NN0A 2IXIA 2VU9A 1QNYA 2CY6A 2VOVA 1S1AA 4GB31 4IV3C 2RR13 1AL21 4F7ZA 1GZCA 2HEYF 4RQPA 3KCCA 4YW2A 3LWCA 4BZ4A 3I59A 2XWJB 3C2UA 2XBO2 1NCRB 3O5SA 4UXAA 1B35B 1N1YA 3AKTA 4N9IA 1MZ5A 3LA2A 1UU5A 3N3HA 1MEC1 3KB5A 4IEYA 4YLZA 4IEVA 1UZZA 5DG2A 1KJRA 3ZN6B 1WUVA 2ZKLA 1S0EA 1ULFA 3RMYA 3WP6A 3AJYA 1R091 1C8M1 1BBT3 1VJ2A 3ZFEA 4Y5Z0 3V65A 1VBB2 1X8MA 2WQ4A 1GZWB 4LHNA 4B4PA 5JZGC 2ZZJA 3QCWA 4BA6A 1PVC3 1U0AA 2I07B 5AVPA 1AR91 1UN1A 5J37A 2E7AA 1AX0A 1FPN2 1PNFA 4XMAA 1AR83 5CFDC 4UW5A 3SITA 4CEWC 1Q3EA 2ZJCA 4H7LA 3SCHA 4META 3AZVA 2ZPXA 5B2GB 1WA4A 1DZRA 1WCKA 3QOPA 3AKSA 4N43C 3HD8B 4QPGB 5K0UC 3PMSA 5BV6A 5BNOB 1NE6A 4M01A 1QJU1 2X5IC 2RS13 4JAAA 1ONAA 5JI9A 2D3RA 3HT2A 4XHBA 2PAMA 1JYCA 3ZYPA 2DU0A 3B01A 2XLFA 3ZFGB 3DPRC 2IXLA 2R043 1TMF3 5JOXA 5IK7A 1KRIA 3ZPYA 2W08A 4P9LA 4IV1B 2OIIA 2R1DA 3ZFFA 1AL22 3VHPA 1LOGA 1GANA 2B5HA 2CAUA 2DTYA 1L3JA 3V0AA 2UYAA 4FSJA 4H14A 1NYWA 2AENA 2A75A 4FOQA 1PO21 4YW3A 5EZWA 3B5LB 3L2YA 2FMYA 4NHMA 4URTA 2PA7A 1LGBA 1QXJA 1CPNA 3NKTA 3GYDA 1TNRA 3OYWB 3L2HA 3CJIA 3IPVB 2RS53 4EROA 1Q56A 3T2TA 1S0FA 1C8NA 5CAZA 1UMZA 1ULEA 2PTMA 1R083 3ZIWA 4CDWB 1WCSA 2PQQA 3AMMA 5CVRA 4Q0UA 4FAGA 2EA7A 2GN7A 4XFFA 1AUYA 2CGPA 2D3SA 1S2KA 1RUJ3 3IDCB 1RUG1 1WLDA 3MLLA 4XEZA 1JUIA 3H8UA 2HWF1 3UJOA 3CJIB 3HMYA 1CVNA 4XQ4A 4ASMB 1AR92 2NM1A 2NMNA 1H9PA 4LLOA 4LR4A 2B7YA 4I3PA 4XFGA 3BTAA 2EXKA 2ZGUA 2A6WA 4MXVA 4QQOA 1VBD2 5GM0A 3WUDA 3ST7A 3JBG2 2WJSA 4JCKA 1AXKA 2DV9A 3WDTA 5FMOS 2FZ1A 3G6JB 2Y38A 3BB6A 1QF3A 1DGRA 2QDNA 3WXPA 1XE8A 2XHKA 3ZXDA 2P2KA 1PK6A 3FWEA 4JTNA 4DOUA 1NA1B 2WFPA 3WOGA 5F9TA 2VOXA 1S0GA 3E5UA 5DZFA 3WG3A 5FQ0A 3WCRA 4E2SA 2ATFA 3PVOA 4AEJA 3KS7A 4XFIA 1REFA 2B42B 5CFCA 4I0WB 3ZSKA 1OPOA 2GNBA 2D6LX 4Q4V1 4TWTA 5CFCC 3RDIA 4Q4X1 4YRDA 3RRDA 5HXVA 1Q8SA 2CL2A 1C57A 4CP1A 3MZHA 1G9CA 2D3PA 4Q4Y1 1YI7A 1HV0A 1VAKA 3N7KA 4YARA 4IEXA 4WVMA 4KNCA 3VGIA 3LSDA 1HV1A 3HWJA 4LBMA 3VKLA 3AZXA 4EWEA 2HWC3 3D0JA 1Q8OA 4FQZA 4OHZA 1IS5A 1MZFA 4HVRA 4LEJA 1ULGA 1VBB3 1AJKA 1C3HA 4QMAA 2JG9A 2W0XA 1DHKB 1LECA 1PO11 1AYM2 4I09A 4C90A 4PBOA 4MX3A 3LB9A 1MS4A 2G9GA 1FPN3 2VULA 4JV4A 1CJDA 1ZYBA 1V6OA 1KS5A 4ZXKA 2VVFA 2R0FA 1J58A 3EQEA 3WNXA 4OUSA 3M3CA 1FMD2 4JQRA 2D5HA 2XPJA 1LGCA 5BY5A 3FBYA 3MPPG 4JGZA 4N53B 4IERA 4E2GA 2JG9B 3VBRC 4AEKA 4B7KA 4QM8A 1ZBE2 3WDYA 2WZPP 1Z7S2 1N3OA 4S2HA 4YVWB 5L19A 4X8NA 1A3KA 4RD7A 1EPWA 2VQ0A 2PHRA 2YXSA 1A8DA 1UPIA 1A78A 5H9PA 2DUOA 4Q8KA 2XH6A 1WW4A 4P9XA 4L99A