2BUKA

Satellite tobacco necrosis virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
b'TMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
publication title Structure of Satellite Tobacco Necrosis Virus After Crystallographic Refinement at 2.5 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 46
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bukA00
5BNPB 1PO13 1VBD1 3VBUB 1VB4A 4GMP0 4JGZB 4IV3B 1VRH1 1AR71 2R071 1PIV2 1R081 5GKAC 5JZGA 5A33A 1AR92 2MEV1 4SBVA 5BNPC 4IV1A 3VBUC 1QJU3 4JGZC 1BBT1 2RMU1 4IV3C 1HXS3 1DDLA 5JZGB 5A33B 5K0UB 1RUD1 4IV1B 4Q4W1 4AEDB 1EAH3 1C8M3 1AL22 1COV2 1OOPB 5DDJ2 4Q4X3 1AR83 5JZGC 1AR63 4LLFA 1R093 4Q4Y3 4IV1C 1VBE2 4AEDC 1RUI2 3HAGA 1VBA2 1OOPC 1PGW1 3J8F3 1RUC1 2HWB3 1HQNA 1RMU2 1NY71 4WM7B 1ASJ2 5BNNB 3VBOB 3ZFFB 1RUF2 5AC93 1RUJ3 4YVSA 1TMF2 3ZFGA 4RHV2 5FMOL 4GB31 4Y5Z0 5BNOB 4WM7C 1ZBA1 2XBO2 2BPA2 1MEC1 1OHFA 1FMD2 3VBOC 1BEV2 2RR12 3ZFFC 3CJIA 3ZFGB 1B35B 1K5MB 1ND3A 1ZBE3 5BNOC 1AYM2 5C4WB 5L7OB 1VBD3 4CDWA 1AYN2 3CJIB 1RUG2 1F2NA 1VRH3 1AR73 2R073 3ZFGC 1B35C 2DF7A 1HRV2 1ND3B 1R083 1Z7S2 1K5MC 1QJY2 1IHMA 3JB8A 2MEV3 5C4WC 1RHI2 1PIV1 5L7OC 2HWC2 2X5IA 3CJIC 2RMU3 3FBMA 1AR91 3JBG2 1VBB3 1ND3C 5J98B 2BUKA 4Q4W3 4CDWC 1QQP2 2FZ1A 2RS32 2X5IB 2TBVA 1NG0A 1AL21 4RFT0 4Q4V2 3TN92 5DDJ1 1D4M3 1PVC2 2GH8A 2ZTNA 2X5IC 1TME2 2PLV2 1VBE1 1M06G 1RUI1 1RUC3 2RS13 1OPOA 2WLPA 1RMU1 1NCQA 4CDXA 1ASJ1 2HWE3 2RS53 4GB33 1RUF1 1R1A3 4RR3A 4CEWA 1ZBA3 1NCQB 1NCRA 1TMF1 4RHV1 4PDWA 1MEC3 4CDXB 4QPIA 2ZZQA 4JGYA 1EAH2 2WFF2 1C8M2 3ZXAC 4RR3B 1FMD1 2WZR2 4CEWB 1BEV1 2RR11 1NCRB 3JD73 1FOD1 1PO22 4PDWB 1NCQC 4Z92B 4QPGA 2RM22 4QPIB 4CDXC 1R092 4Q4Y2 4FSJA 1AYM1 1AYN1 1PGL2 4RR3C 1RUG1 4CEWC 1NA1A 1NCRC 4PDWC 1PIV3 1HRV1 3J8F2 1Z7S1 4QPIC 1QJY1 1RVF2 1AR93 1RHI1 2R062 2HWC1 3JBG1 5LK7B 5ACA2 3VBHA 2BFUL 1E57A 1QQP1 2RS31 1AL23 1RUH2 2R042 5DDJ3 2WWSA 3VBHB 4Q4V1 3TN91 2BBVA 3IDEA 1PVC1 1VBE3 4YVSB 1RUI3 5D8AA 1VBD2 1V9U1 4FTBA 1TME1 2PLV1 1FPN2 1HRI2 3VBHC 1RMU3 5C9AA 1QJX2 2HWF2 1ASJ3 5CFDA 4YVSC 2WS92 1RUF3 1VBB2 1VBC2 5C9AB 1TMF3 4RHV3 4BCUA 4CDWB 3ZFEA 3M8LA 4N43A 1BBT3 1FMD3 4EJRA 1BEV3 2RR13 2HWD2 1FOD3 1EAH1 2WFF1 1RUD3 5C9AC 3ZFEB 1X33A 4N43B 2WZR1 5A32A 1D4M2 1RUE2 1AYM3 1PO21 1AYN3 2RM21 1POV1 1RUG3 1COV1 4Q4Y1 1HRV3 2Y26A 1W39A 1Z7S3 3ZFEC 1PGL1 2RS12 4N43C 1QJY3 1EV12 1NOVA 1RHI3 3J8F1 2HWC3 1PO12 1RVF1 1VBA1 2VQ0A 3JBG3 3VBFA 4GMP1 1QJZA 2HWE2 2R061 2RS52 1CJDA 1R1A2 4CDQA 1F8VA 1QQP3 1X36A 2RS33 5ACA1 1MQTA 3VBFB 1QJU2 1WCDJ 1RUH1 1SMVA 5BNPA 1HXS2 4Q4V3 2R041 3TN93 4CDQB 2QQPA 4JGZA 3JD72 1MQTB 1V9U3 4FTEA 3DPRA 1TME3 2XBO1 3VBFC 1RB8G 2PLV3 2XPJA 4Q4X2 2FZ2A 4CDQC 1AR82 1FPN1 1AR62 4JGYB 1MQTC 1HRI1 3DPRB 1ND2A 1QJX1 5K0UA 2HWF1 3VBSA 3LOBA 4AEDA 3NAPA 4QPGB 2WS91 2HWB2 1OOPA 1VBB1 1VBC1 4JGYC 1ND2B 3DPRC 5ABJA 4N53C 4RQPA 3VBSB 1NA1B 1H8TA 2WFF3 5AC92 3NAPB 1RUJ2 4QPGC 2WZR3 1VB2A 2HWD1 5ABJB 1PO23 1ND2C 4RQPB 2RM23 1POV3 1H8TB 1COV3 5K0UC 3VBSC 1D4M1 3VDDA 1RUE1 1NA1C 4WM7A 3NAPC 2IZWA 3S6PA 1BMV2 5BNNA 3VBOA 5ABJC 3ZFFA 1ZBE2 5J96B 4RQPC 2RS11 3VDDB 1EV11 1H8TC 1RVF3 1VBA3 5BNOA 4GMP3 1VRH2 1AR72 2R072 2R063 5CFCA 1PO11 5C8CA 1R082 1A6CA 1AUYA 2HWE1 5ACA3 1B35A 5D8AB 4CDUA 2MEV2 2RS51 3VDDC 1R1A1 1K5MA 1BBT2 2RMU2 5CFCB 1RUH3 5C4WA 5C8CB 5BNNC 5L7OA 2R043 2ZAHA 4FTSA 1QJU1 5FOJB 4CDUB 1FOD2 5CFDB 1RUD2 1C8NA 4Q4W2 1HXS1 5D8AC 4CEYA 2XBO3 3JD71 5CFCC 5C8CC 1C8M1 4GH4A 2GSYA 1FPN3 4YVWA 4CDUC 1HRI3 5CFDC 4CEYB 4Q4X1 4WM8A 1QJX3 1VAKA 1AR81 2HWF3 1AR61 1R091 3VBRA 4GH4B 1PGW2 1RUC2 2BFUS 2WS93 5A32B 4YVWB 4RS5A 1NY72 4WM8B 1VBC3 4CEYC 2HWB1 3VBRB 5FMOS 3JB4C 4GH4C 4N53A 4RS5B 4NWVA 4YVWC 2HWD3 4GB32 4WM8C 5AC91 1ZBA2 1RUJ1 4NWWA 1RUE3 3VBRC 1MEC2 4N53B 1GFF2 1POV0 1V9U2 1AL0G 4RS5C 1HX6A 3VBUA 4Y4YA 1PVC3 4IV3A 1BMV1 1EV13 1ZBE1 1CD3G
chains in the Genus database with same CATH superfamily
1YQ5A 1U5IA 2ZAAA 2QQNA 2VZPA 1DGRN 3HIFA 3N7LA 5C3RA 1VB4A 2OQ6A 2BGCA 3OPTA 2D44A 4EWDA 5A3MA 2BVBA 4ZKTB 2R071 1F5FA 1TZOA 1G8WA 2V4AA 4L0PA 4AGRA 2Y6JA 1YQ8A 5KC6A 5GKAC 4CZSA 1J3QA 1NX9A 2V09A 2DU0A 1DGWX 3M2MA 3VBUC 4AL9A 4EYUA 1H2LA 3HR9A 4RD7A 5D1IA 1X50A 3GM8A 4CYDA 1BK0A 1JOJA 2DYCA 3Q8FA 5J48A 5FYSA 5A33B 3KWVA 2UYBA 5FUIA 3RDIA 3D4KA 4IV1B 4ZU4A 3GCXA 2GAUA 3NV3A 1C8M3 4XXAA 3T1MA 2VCMA 4AOCA 5AFBA 5F9TA 3KHBA 5DDJ2 3ZPYA 2P3IA 1LHWA 1J1LA 3AYEA 1AR83 2DFBA 2YGLA 1AR63 5JLVA 3C7OA 4P9IA 1OA4A 1ZRFA 2QDRA 4TSVA 1LHVA 2RE9A 1QOTA 1XSQA 3GF6A 1O5UA 5F5AA 3T0AA 1OOPC 4AWDA 2UYAA 4NAMA 1ZZ8A 4DRVA 2P3KA 1CJPA 4XJZA 1PGW1 3MW4A 5DZGA 4FPKA 2VM9A 1NY71 1UAIA 2D5FA 5DUWA 3G7DA 2HBUA 2WDBA 4KH9A 1UF2C 1SDDB 2CAUA 4YGCA 2EXIA 2HYXA 4Q1RA 3VKOA 1YCIA 3D5OA 2VCAA 4LBQA 3VBOB 2ET7A 2NPIA 1UN1A 2ZGOA 2VECA 5B4XA 3K4ZA 3NW4A 3ZFGA 2ZJCA 1WLDA 1OXCA 2LALA 5FMOL 4HKWA 1ONAA 3WD5A 4A7YA 3N9PA 2WWUA 2F4LA 3MIEA 4L92A 2E7AA 1Z78A 3OEAA 3PIGA 1W9SA 4BA6A 3BTXA 5EV7A 3ZFFC 1W6QB 2E7TA 3WLUA 4AVAA 3WHUA 2A75A 3KT7A 1ZBE3 2ZA9A 4C1XA 5C4WB 1QH7A 2PHWA 3MIFA 4MGQA 1VBD3 4NIIA 1AF9A 2ATFA 1N1SA 1CESA 1ZNPA 2ZEWA 3CJIB 1RUG2 1W6NA 4Q5OA 4AZZA 1W28A 3O0VA 2H0VA 2WN2A 1I3HA 4LBOA 2V4VA 3VZJA 5IK8A 1Z7S2 2LS6A 1QJY2 2JKBA 4WBBA 1IHMA 1KJLA 2VZ1A 3MIDA 3PTYA 2JB8A 2DVFA 2MEV3 3OUHA 4BOWA 5LWBA 1WGPA 2ENRA 4XAAA 5FY4A 4C0HA 1LTEA 4MXWA 4UF0B 2I07B 2AYHA 1L3JA 3FBMA 1DHKB 3OD0A 1S55A 5FYVA 1MACA 1ND3C 3CNAA 3I97A 3FC0A 1K45A 4QU2A 2XG3A 5EQUA 2FDFA 1CGPA 4CDWC 2FZ1A 2VUCA 3NRUA 3MFCA 3CEWA 2XUMA 1GLHA 3NNLA 1L7QA 1NUKA 3FHQA 3DECA 4QKDA 1IPKA 2TBVA 4QPWA 3FWEA 4Q4V2 1KD7A 4Y4RA 2VTXA 1EY2A 5JMCA 2H6BA 4LHNA 1MPXA 3OBAA 4QQLA 5E8AA 5J09A 1JYNA 4MGZE 2X5IC 4HPKB 5F3CA 4DRRA 2D93A 3HJRA 2ID4A 1GZTA 4HFSA 1VBE1 1M06G 1RUI1 3KGLA 1JN2P 4BU2A 3OB8A 1RXGA 3V0BA 3LPGA 5K9YA 1NCQA 3A21A 3GBWA 1H2KA 3NJZA 5EJZB 4CDXA 4FPOB 1XXNA 4AHYA 1APNA 1S0CA 4A6SA 1MZFA 4E8CA 3WQBA 4FAHA 2HEVF 4OMDA 2VAUA 3THDA 2WLQA 4AEMA 1NCRA 1TMF1 4DUWA 4PDWA 3BKZA 1JI6A 2XHKA 1YQCA 1UXZA 3W5NA 1US2A 1XOYA 2CL2A 4J1WA 1O5LA 1C8M2 2EAAA 2ZGLA 2ADDA 1WW6A 4YPJA 4HKLA 2Y6GA 1WWYA 2OYZA 4CEWB 1BEV1 4BQ4A 5FZGA 1CAXA 1AZDA 1V6MA 1N1YA 2R49A 5KHGA 2YPDA 1F9KA 4QX5A 2Q8DA 1X9TA 1YHFA 1YUDA 2WNUA 2XL7A 4Y24A 5FYZA 3V0AA 1PGL2 3RYKA 3LEKA 5LY1A 5LW9A 3LAGA 1HB2A 1V0AA 4MYEA 4B1MA 2A3YA 3POYA 2RHPA 2J42A 3KCCA 4W50A 3WW3A 3EMRA 1PK6C 3A23A 4QPIC 1AR93 2HYKA 2VY0A 1S0DA 2BGPA 3W21A 2HWC1 2VNVA 3O1VA 3WSOA 4AFAA 4A7ZA 5I93A 5FYYA 4IEQA 4A41A 1MS9A 2N7GA 2O8QA 2E51A 3KGZA 4R9CA 4YM0A 4ATFA 4D7YA 3JQWA 5HV4A 1QF3A 2BFUL 2ZPXA 1E57A 4QKNA 4DZGA 2BOIA 1WW7A 1ZREA 3A0KA 1QJEA 2QCSB 3OUJA 3O1SA 1CONA 3T0BA 1RUH2 2VBDA 4J6GA 4S2GA 1ST8A 3ZLIA 1WCUA 3NKTA 3VBHB 1UZYA 3CJXA 5H9RA 1ENQA 3TN91 1UY1A 2F6BA 4YVSB 1GU3A 2DTYA 1VBD2 1REFA 1N47A 4X6RB 4ASKA 3EYPA 4BQ2A 3CU7A 3GCWA 3HNMA 1OLME 4K3UA 4XF9A 2ARCA 5L19A 1O7FA 1HRI2 4NRMA 1RMU3 5C9AA 5JXGA 5GZGA 5FYHA 2W1WA 1BCXA 4NHLA 1O8SA 1I5PA 1XE7A 4Y1ZA 5FPBA 3PURA 1IPSA 4IQPA 5FZAA 4MOAA 4XJWA 4JKMA 2NN8A 2OUHA 5KHKA 2WS92 1RUF3 3I2GA 4BQ3A 4OI0A 3H3ZA 2IXIA 2DVBA 4RHV3 1HKDA 3C7HA 4UBHA 4AFDA 3ZFEA 3LDRA 3ZR5A 1IQAA 3M8LA 3GHNA 3LOIA 2OA2A 3I7DA 3AP7A 5FY5A 1BBT3 3VD7A 1PNGA 2W1SA 3DEMA 4QDRA 5A3WA 3USUA 4NHXA 1G9AA 4P08A 1FMD3 5H9PA 4EJRA 4JVAA 2RR13 1UZWA 5F37A 3O0WA 1UX7A 2WFF1 4B3NA 5FPUA 1YI7A 3ZN6A 2CV6A 3U78A 2WZR1 2WNVB 1J58A 2VU9A 2RDRA 2PAMA 1QKQA 3I59B 5C70A 1AYM3 1H2NA 2VE1A 2WC2A 2D6MA 2ZGMA 3A4UA 3ZIWA 2Y8KA 4KNCA 3GZTB 4LO8A 2Z79A 4M3CB 4DOUA 4UYBA 4Q4Y1 2AR6A 3RRDA 2Y0OA 5I8YA 3ZYBA 2VCCA 5I0SA 3M4FA 5A3PA 4ES9A 1BVVA 1HRV3 1SLLA 4L11A 1S1AA 5LRSA 1KDKA 2IC1A 1EV12 3AZWA 5FP3A 1W2AX 1PMIA 4XIKA 1YLLA 1RHI3 1HLCA 2W52A 3VLBB 1Q8VA 4XFGA 2VOKA 5JR7B 2GNBA 4D69A 1SLBA 5GLTA 2B4KA 1VBA1 2VQ0A 2VXJA 3JBG3 5E88A 3ZYGA 1Q8PA 1HV1A 4MO3M 3HQRA 4E2GA 1WZXA 1JMUB 4Q0VA 2GNTA 5J3UA 2ZMLA 1RINA 1FX5A 2B8MA 2RG4A 1XE8A 5DG2A 4XEZA 1PVXA 4AI1A 1QY4A 3KS7A 4CCCA 5CG9A 1XU2A 1GICA 5FUNA 3POEA 3UT0A 1W6OB 5BXXA 2ZX0A 3AKRA 1O6UA 2D40A 2JDYA 1W6PB 1HXS2 1QH6A 1W8WA 2AGSA 2DWRA 4OUSA 2X09A 4PF5A 3QBQA 5JI9A 2Z4FA 2W2IA 1H1AA 3L2HA 3RVHA 3DPRA 2BOJA 3MO4A 4LUKA 2VZ3A 1Y4WA 1T6GC 3VBFC 2CAVA 5DAVA 1UXXX 2XH6A 3MIHA 3WG3A 2XPJA 3RZKA 1DGLA 3AYAA 3SEEA 4AHWA 2RDNA 1EUTA 4OCTA 4CDQC 5JXHA 3O1RA 3FBYA 4L99A 1W90A 1W9WA 4ZS3A 1JUHA 4MV2A 3POJA 2EXKA 1ND2A 1DZRA 2JDPA 4NIDA 2EA7A 3NNMA 1JYIA 1IZ3A 1DQ6A 4CTEA 2HWF1 4Q2FA 5I0RA 4BE3A 2VBPA 1JHJA 3IKWA 4NIAA 1VAVA 5G05L 3MUZ1 3NAPA 1OQ1A 5LATA 3U07A 2W08A 4LHSA 4CXYA 2PA7A 5BV6A 5FFOC 4JGYC 3NNGA 1OFNA 4K9SA 4XE9A 2VCBA 5EYXA 2G1MA 3VBSB 5A1FA 2WJSA 3ZO0B 1H8TA 4PT6A 4E4HA 5BNQA 3BVCA 2GU9A 3OPWA 3DYOA 2WAAA 2IXKA 1RUJ2 2GC2A 3MHZA 3N4MA 1DP0A 1JZ5A 3ON7A 2RJKA 3WDUA 2VUJA 1LJ7A 1FI2A 4DNYA 1Y9QA 3HOBA 4ISQA 4R9DA 3GBGA 3SISA 5IFPA 2RM23 4AE2A 1UL9A 3NSTA 4L97A 5FZ1A 3VDDA 5DAWA 1OF3A 2PHDA 5FZLA 3ZSLA 5A1AA 1Z0HA 5JWPA 2HKXA 5CG8A 1D0GA 1MZ5A 2DUPA 1MVEA 1GZ9A 3LDKA 4XHXA 2IZWA 2QQVA 5F8PA 3VBOA 2GMEA 5ABJC 4WVMA 3BUCA 2RS11 3LA2A 4IE7A 3D0SA 4BMEA 4QHBA 3RYRA 1TNRA 2BYVE 4CE8A 1XNBA 2G9FA 1X8MA 5FY7A 1XQNA 4UOJA 3HMYA 3THPA 1PO11 3WQ7A 4E4SA 5C8CA 4XQ4A 3LPFA 2R7EB 4U36A 3W59A 2HBTA 4F7ZA 1AUYA 5JUVA 1W6QA 1DQ2A 4YYOA 5SV8A 4INDA 4AW7A 2G9GA 2VULA 2XQRA 3UGFA 1R1A1 4MHUA 1Q43A 2VZSA 5FXVA 5I0TA 4HT1T 4AXOA 1BBT2 5FLHA 2RMU2 3P3PA 1PM4A 3PMEA 1L7RA 2PHXA 4YW6A 5C4WA 3RI9A 4AVSA 4JDNA 1F35A 4AQ6A 4DUXA 1QJU1 1UNBA 3AFGA 4CDUB 3IDCB 5CFDB 1C8NA 2OUJA 4C91A 1OH3A 5KC5A 2XBO3 3JD71 4PLNA 3ZSEA 2EIDA 2Z42A 2OZJA 1XNKA 4I01A 1SLAA 2YUEA 1E5RA 5BPXA 1GNZA 2JXAA 3E6DA 1Q8QA 2BV4A 2WT1A 4CEYB 1WMXA 4QX3A 3T2OA 4AVVA 1I5ZA 1QJX3 2P6HA 2VW2A 3AFKA 5FTTC 4KG8A 2IFRA 1XB9A 3MZHA 5FPAA 4R9BA 1R091 3VBRA 3H50A 1F4AA 4Y1YA 4W6WA 4CA9A 3W5MA 1ZZ9A 2JG9B 4OYUA 4RS5A 1ULOA 4WM8B 4OHYA 1JYWA 5A7OA 1WBFA 4QT6A 5GJ6A 4OULA 3NWKA 3N9OA 1X9PA 3KQRA 3NJVA 2HWB1 2QKDA 1EP0A 4UBGA 3TB0A 5CAZA 4Y26A 4HK9A 2XOMA 3FL7A 4GIQA 4UT5A 4NWVA 4RSUA 4HL0A 5DXDA 3AMHA 4GB32 4W4ZA 5AC91 1UU5A 1UYYA 2JEMA 5FZ4A 1A78A 1H6XA 3NV4A 1XYPA 4TXWA 3ACFA 4CCEA 1MEC2 5A3TA 4UW3A 2Y6KA 4IDZA 4N53B 5T55A 2O14A 4COYA 1CAWA 1JODA 2VOXA 1ZX5A 1AL0G 1DCSA 2P4EA 1HX6A 2BNOA 5FV3A 1LOEA 4YZ3A 4XZPA 4N7UA 2V72A 3H3UA 4LOSA 4Y4YA 3POSA 3C7FA 3PVEA 1ZVFA 5F2SA 1LHOA 4E2SA 3VKLA 1YIPA 3ZYHA 1MS8A 3HT2A 3WF4A 5FZHA 2DCZA 3B93A 2C24A 5EWSA 3VBUB 3F2ZA 2CU5A 3MBWA 5HCHA 2G19A 3LWCA 5KHJA 1VRH1 2WNEA 1AR71 1SFPA 3RWKX 1ODMA 4FQZA 4CCNA 1PIV2 2XJRA 1R081 4MGKE 4P9LA 3HN3A 4O9GA 1DU3D 4MH0E 3EBRA 1CVNA 4QU1A 4C90A 5JZGA 1CIWA 1DZQA 3FFZA 3EXUA 4R9AA 3VGIA 2VTFA 3VZMA 5BNPC 4PBPA 1GP5A 2JIGA 2RVAA 1QIQA 5IT6A 2ILMA 1C5IA 4IV3C 3WR0A 5C7GA 1DDLA 1UYPA 4FOWA 4FVVA 3KVBA 3FZ3A 3AX4A 4XUTA 3OY8A 5K0UB 4K8RB 1RUD1 4JAAA 4Q4W1 3R0RA 3SXWA 3V56A 3TNPB 3EO6A 4I0AA 4QQPA 2QQLA 4RGAA 3SEPA 1JYVA 1AL22 3N7JA 4LK6A 3PU3A 4FPYA 1OOPB 3P5BA 1UIKA 4Q4X3 4YNIA 2JDMA 2BZDA 3WDTA 2D5HA 4RL7A 1XSRA 4KGGA 2P6CA 4MHRA 4LR4A 2A1XA 4FXGB 5IK7A 2BWAA 2GN7A 4HK8A 5C5TA 4AEDC 2TUNA 4XZUG 3AKSA 1W0PA 3MUY1 1CAUA 4OI2A 3W9AA 1C4RA 4KWLA 4P00B 4L9BA 1RYYA 3WT3A 3T4VA 2C5DA 2CWSA 4C0BA 3D6EA 3WNKA 1RUC1 3SCHA 1HQNA 2A6WA 4YZ5A 1LECA 2Y0IA 2DUQA 3SH4A 1SLCA 2WQZC 1JYTA 1XJAA 1W9TA 3GZAA 1ASJ2 3T08A 3U4XA 4MGTA 1M4WA 3IWZA 1CAVB 1MZEA 1D2SA 4K20A 4GKXA 3B69A 3DGTA 4XHBA 3ZFFB 2LW8A 2QDNA 4AG4A 1JXNA 2J7MA 4AEKA 1QNYA 4YVSA 1REEA 4Y5Z0 4UW6A 3M3IA 1ZBA1 5L9BA 5TSWA 2P5BA 4GAZA 1WMEA 1UD1A 5IVVA 1MS0A 1UWWA 2CYFA 3O12A 2XBO2 5F5CA 3T4HB 4B4RA 1O8PA 3AP5A 2J22A 2R16A 4FI9A 1H1MA 1L7LA 1HQWA 4W8JA 5DG1A 1BJQA 2EXJA 5FMCA 3VB9A 1H8VA 1SPPA 1VLNA 3INAA 3VZOA 3WDVA 3WEZA 4D6RA 5BNOC 5JOZA 2WZPP 3K4DA 3PIJA 4LKEA 1EYBA 4DXSA 1ZRCA 4KBBA 3ZM8A 1AYN2 3GJBA 4K1ZA 3RI8A 2ZOEB 3KVAA 1F2NA 4QQHA 1FAYA 1W6MA 2VR4A 4QXBA 2R073 5A80A 3OPZA 3ZFGC 4A4AA 2EIEA 1ND3B 2DCKA 1UPIA 3IAQA 4PHZA 4QHOA 1W8ZA 1MS3A 1K5MC 4UW5A 1JZ6A 2F17A 4R52A 3U75A 2A70A 4JQTA 1C3HA 2RDSA 2YU2A 3FJSA 4H7LA 2PAKA 2LTNA 1W8NA 3GNEA 2H0BA 4EQVA 1QGLA 2D6LX 3IIIA 1J59A 1OUXA 2VNOA 4OHVA 1KFXL 5J98B 5C6CA 2VMGA 4MGSA 1VP6A 5J1XA 1JH5A 3DKWA 1LOCA 1WLWA 5AVPA 2J1TA 1QQP2 1OPMA 4P9XA 2RS32 2X5IB 5FY0A 3SITA 4AR2A 1OQEA 4O61A 2IXJA 1G9BA 2BP6A 2ZGUA 4ARXA 2BPA2 5ANNA 1OVSA 4OFGA 1JOPA 1YYNA 4XACA 1S2KA 1AX1A 5DDJ1 4DQAA 1US3A 2GH8A 4HLTA 1UX6A 3UJOA 5T50A 2DCYA 5A1LA 1TME2 3K3OA 2GZWA 3FUOA 5I8SA 3X29B 2PLV2 2WN3A 3NVCA 1ENRA 5APAA 4BJ0A 4W6YA 4EN8B 5EZWA 5GZEA 1UOJA 2PTMA 1W6OA 2QNKA 4XFBA 1YJKA 3WCRA 4NIHA 1SG3A 3RWNA 3HBKA 4XILA 3WINE 4BMBA 1WUVA 2WZ8A 4BQ5A 3T30A 4XXPA 1TE1B 2I74A 3JUUA 1YIFA 3N9LA 2C9KA 2HWE3 2J1VA 3RGBA 4EN6B 3RZMA 2RS53 3DYPA 3L9JT 4RR3A 2W9XA 4OVEA 1LOBA 4OUMA 1UOBA 1DGWA 2ZMKA 2DDUA 1DYKA 1NXMA 1CN1A 2KR2A 1CZVA 2QQMA 3N7KA 4JV4A 4ET7A 1PMJX 2D98A 1O4TA 2WT0A 2J1SA 2BNMA 3O1UA 3KV9A 1PO22 5FP4A 1NCQC 4AGGA 1W8OA 1I9RA 5LBEA 4DXTA 2GNDA 1PK6B 3J7HA 4QPIB 1DBNA 4CDXC 3DCQA 2Y6FA 3ACHA 2ES3A 3WZ1A 3E6BA 3TWIA 3SHRA 1RUG1 2JD4A 3AZZA 4YLZA 1KRIA 4FPJA 2JDZA 1NCRC 3AP4A 3MW2A 3I2OA 2BTVC 4PDWC 3H7JA 3DN7A 2GH2A 1XPWA 1Z7S1 2IVIB 4D6QA 1E5SA 1OFSA 1QJY1 3I3QA 3IZOA 1RVF2 3H7YA 3LA3A 1CX1A 2R062 1KQRA 1QHDA 2I2SA 1SBEA 2WFPA 1ULFA 3MDPA 3VBOC 2WO1A 3ZXFA 4NHKA 1JZ2A 4W6XA 1W2TA 1GWKA 4GULA 3VDAA 4QX7A 3ZMNA 1UCXA 4OQ9A 5ACA2 5HPOA 4QQOA 5T5PA 4XURA 3ZSKA 4R8HA 2WNUC 5DMYA 3UV9A 4XUQA 4BM8A 4K7JA 4JCKA 4DMIA 4A44A 3BIEA 3ABZA 2R042 2YDEA 1LRHA 4GA9A 3LB9A 3HBZA 1ZRRA 5LCWL 2TEPA 4O9EA 3ZKYA 2EAKA 3HNBM 4MZUA 4Q4V1 4QKBA 1OUSA 2W39A 2W47A 4XF3A 1QMJA 5FO7B 5GZCA 5JOYA 1RUNA 1O4ZA 3FLRA 1VBE3 4K8FA 3WOGA 1F15A 1RUI3 4IERA 3D8CA 1SBFA 4M3CF 4P02B 4XETA 5FKCA 3W20A 4FTBA 1UU6A 5A7PA 4BIFA 4LE3A 1VE0A 2F4PA 1UU4A 1FPN2 2P17A 4DXZA 2VXRA 1S2EA 5J36A 1UKRA 1GWLA 4Z8BA 2ZEYA 1CZSA 5LA9A 2MNGA 4JTNA 4NPLA 4KBZA 2W1UA 2WO3A 5IATA 5JXIA 5CFDA 4LIVA 5HXMA 5BYNA 2AZ5A 2W87A 2OZ6A 2P37A 4XQDA 1VBC2 1TMF3 3POIA 2WO7A 1HQLA 2ZEXA 3DUIA 2WWJA 3CIHA 3L2YA 4N43A 2ZGTA 5F39A 4LKSA 1H1IA 2XHNA 5IYYA 1OT5A 2DVDA 1HB3A 4Y33A 1BEV3 2EALA 2EXHA 2HWD2 5C9AC 2V5DA 2VZTA 1X33A 4GWNA 3J7LA 2JG9A 1OURA 1V00A 2KXLA 5FLIA 3UGHA 4DY5A 1RUE2 5JSRA 2AACA 4AHZA 1G7YA 2IXCA 5GZDA 5JR2A 3OD4A 1POV1 5IJRA 1COV1 2RJLA 3OGRA 4FP2A 2QE3A 5IHRA 2SBAA 3FUQA 4MUVA 5LA0A 4LPLA 5FZOA 4COZA 1BHGA 1DQ5A 3ZFEC 1PGL1 3MICA 3ES4A 3USSA 2QFEA 4AI8A 5DZEA 1UW8A 3TAYA 1U5XA 5FZKA 4HSLA 3N9MA 5IVJA 4MSVA 1BKZA 2BERA 2DU1A 1FNZA 2HWC3 2ORZA 2BRTA 2XJTA 5C8WA 1MZ6A 2A7AA 5FK8A 4P9JA 3H8OA 3ES1A 3WUDA 4YW7A 4GJYA 4GMP1 5IAXA 3JZVA 4EE2A 1QJZA 2HWE2 2ZHMA 5FKBA 2RS52 1URXA 1W05A 3GALA 3M1HA 5CISA 4ZXKA 1Y9MA 1H9PA 1MQTA 3JQXA 5F3EA 5GLZA 5FYIA 4E4ZA 5FIXA 3VBFB 1GANA 4Q1PA 1S4CA 4IE6A 4XBLA 5FBJA 1WCDJ 1W9YA 1RUH1 1SMVA 4EZHA 2ZGQA 3TN93 4CDQB 1CZTA 1VRBA 2FDKA 1RL3A 4Y22A 1AXKA 2HEWF 2QQUA 3MF6A 3S7EA 3U10A 4M00A 3WCSA 1JYXA 3OGVA 2JICA 1W0OA 1GBGA 1LOAA 1ULEA 3ZSJA 1LGNA 2YC0A 3DF0A 1NAEA 5EP9A 1N3QA 2CSGA 1AR82 2WT2A 1AR62 4JGYB 1PX4A 2WA4A 1HRI1 2J1AA 5FPXA 1JUIA 2JE7A 5K0UA 4PQQA 1G6NA 2OQ7A 3WP4A 1IS5A 1H2MA 5AVAA 3ZXJA 3OG2A 2WS91 3E97A 2QUOA 4ORFA 2W0XA 4HVRA 2E33A 3RMYA 4Q8KA 1OOPA 2XONA 4NIGA 1ENXA 1YFWA 3DPRC 1WBLA 4BWOA 4RQPA 2ZGRA 2J1EA 3THCA 4BQ1A 1BLZA 4DINB 5EXOA 1DGRA 2WFF3 4FT8A 4XCBA 3BI3A 2VZRA 2ZHNA 4QPGC 2WZR3 1NYWA 1NZCA 1VPHA 2R0HA 5ABJB 4AVBA 1FT9A 1ND2C 3KCXA 1IGOA 2E31A 1NZIA 3OBTA 4PLOA 3AKPA 3WP5A 3TBDA 3VDBA 1IKQA 1NA1C 1RJ8A 2XWJB 3VHPA 3URFA 3NAPC 2X10A 3IM0A 5FY1A 3H1WA 3OCPA 2XKPA 1QXPA 3ZXLA 1EPWA 3O14A 4HETA 2JDNA 3E1F1 3ZFFA 1ZBE2 4FP3A 4MLOA 5HCFA 3RZZA 5J96B 1EV11 1H8TC 2ZZJA 4HZFA 4JTOA 1C28A 5FPLA 4A7KA 1VBA3 4YW3A 1TQ5A 4B8EA 3T09A 1SLIA 1GV9A 2JG8C 1X8EA 3BB6A 3I3EA 4IE5A 4YWAA 3UESA 2QQJA 5CFCA 4RYDA 4IL7A 2VNGA 4HOOA 1A6CA 4K40A 3S5AA 2E32A 3JXSA 4XJAA 2MEV2 1YI9A 2RDQA 3VDDC 3OGGA 2FMDA 5L36A 3ST7A 2ZGNA 1J83A 3PUIA 4R4XA 2W5FA 4TWTA 4F8AA 2PQQA 3LE0A 1W3VA 2ZAHA 5JIUA 3U4SA 2WBKA 5JXJA 4XUNA 3SCFA 3WNLA 2VL4A 5FRAA 1HXS1 5D8AC 1JU4A 3WDXA 1QEXA 1V6KA 3D82A 3BPZA 3RQ0A 4BXSV 5F3IA 2IVJA 3APBA 2UY8A 1FV2A 4XFFA 4RGGA 3DYMA 1ENSA 2KD7A 2IFWA 2VH9A 4M01A 4P5YA 3UL2A 4BLJA 3B94A 1Y7BA 5C8CC 1VR3A 3GHMA 4GH4A 4JC1A 3E5UA 2VOTA 4AEJA 3ATGA 2VUAA 3IPVB 4AI9A 1AX2A 1W06A 4URTA 4YVWA 4I3GA 1VAMA 1NKGA 4D8MA 2WIIB 1FV3A 3T0DA 4ZU5A 3MIBA 3S30A 2HWF3 5C3SA 3ACGA 5JAXA 4CP9A 3HT1A 1T2XA 1XNCA 4IE0A 4PCRA 2A3XA 4CXXA 3FX3A 2BFUS 5A32B 5T52A 1K42A 1S0IA 2BNNA 3MLLA 4H2AA 3WV6A 2GDFA 2ZGSA 5A3LA 4OUEA 1VMFA 4GXLA 5CNAA 4D94A 5FZ7A 1LOGA 3H8XA 4QHZA 1NLQA 2QVSB 2NZ9A 2Y38A 4SLIA 3JB4C 1PZ7A 5H9SA 2D3RA 4H7MA 2ORXA 2O0OA 3ZN4A 4KQ7A 1CPNA 2Q1FA 4Y5SA 2KM2A 3VZNA 4AQSA 2YGMA 3WX5A 1UOFA 2ZHLA 3LA7A 2GMMA 3T1LA 3PU8A 1RUJ1 4BLIA 3I49A 5HV0A 2H6CA 3I2DA 2X8KA 4HN1A 4NWWA 4PJYA 2XVKA 3MYXA 2HJIA 3VBRC 1GFF2 1NE6A 2DVAA 3HPNA 4QXHA 4GWJA 4OHWA 3RFRA 4FPFA 3ZDVA 2E26A 4A42A 4RS5C 2XDVA 2CHHA 3GJAA 1LNSA 3AMQA 1PVC3 3R05A 5JPMB 1JZ8A 4XC9A 3I3MA 3PL0A 2VC9A 4OI1A 1IKPA 5FZ6A 4JZRA 5EIYB 5K8SA 2GNMA 1DZTA 2Y33A 2YZ4A 3A7QA 4ZXEA 4Z1VA 4C1WA 4BDVB 3ILFA 1CPMA 5BNPB 4LORA 1PO13 1HIXA 1WD4A 3I4IA 1Q5OA 4IGOA 4IV3B 4M4RA 3EJKA 1AHSA 2PHRA 3S57A 3AMMA 4CP1A 3WQ1A 5EHDA 4QGMA 4G9SB 1IG0A 2HH9A 4P5HA 2A71A 1TVGA 2C6SA 3CZJA 1AR92 4JDOA 4LE4A 2GALA 4SBVA 4IV1A 5D21A 1O91A 2YHJA 1UYZA 1QJU3 4JGZC 5A7QA 5JSOA 1BBT1 2BDRA 2RMU1 5FZDA 4RGKA 1RJ7A 4A3XA 2JDUA 2XL9A 4QGNA 2G4IA 2X29A 3OTFA 2WRAA 4NPRA 3WDYA 5KHIA 2R1BA 4GALA 3UNPA 4OQ8A 2EF6A 1SZBA 1KITA 3J4UH 3PJQA 4AEDB 1EAH3 1DQ4A 2OT7A 3K2OA 4NVPA 4P14A 1SCSA 2K9ZA 1A8DA 4CU6A 4Z2WA 2WKKA 2AREA 1G86A 4A2UA 2ZKNA 3LGRA 1GOHA 2BWCA 5JZGC 4P9YA 1R093 3MEPA 2OKXA 4AQ2A 3MW3A 4AYUA 4AAXA 1W3XA 3MLJA 5BY5A 1GWMA 4X6QB 1VBA2 4LBKA 1OSGA 1S0EA 2E6VA 4YG3A 3T2QA 1PNFA 1XC6A 2UWAA 3WNOA 4F3JA 2YBPA 2WABA 3J8F3 3NL1A 4GZ9A 5EPAA 4YZ2A 2HWB3 1RMU2 2FMYA 5FK7A 2W68A 3CHXA 2Q1MA 1QDCA 4XJUA 5FYUA 3WQ0A 1PM7A 1ZZ6A 1ZYBA 2YXSA 5BNNB 4CPBD 5CU1A 1QXJA 1W2NA 1RUF2 2VZQA 4GKYA 5SV5A 5AC93 1LOFA 1JZ3A 3RZGA 2HLEA 3B3QE 3LFMA 4RHV2 4JX0A 4PF1A 3WHTA 4HVOA 4B7KA 2PMWB 2TNFA 4GB31 3TNQA 1YJLA 2DUOA 4WM7C 3WNPA 3ZOIA 5BNOB 1LGBA 2VMFA 4FPEA 4BQYA 2P34A 5IWFA 5FP8A 3SKJE 3AVSA 1D0HA 1MEC1 1NQDA 1OHFA 1FMD2 2BQPA 4GQ7A 4S2DA 4XQWA 2RR12 3AKQA 3CJIA 4XFIA 3ZFGB 3TEYA 5I0UA 3VN4A 4LBMA 1T6BX 1K5MB 3QH7A 5JOXA 1YRZA 4HANA 3T2TA 1MS5A 2XVLA 1DIWA 1AYM2 1FNYA 2C4XA 1S0BA 4KGQA 1IS4A 4AVCA 1LB2A 3QOPA 4B7EA 1VRH3 4IEPA 1AR73 1C57A 1YEWA 1YNAA 1B35C 2DF7A 2E63A 3LFIA 4UF0A 3I2HA 1HRV2 1QNWA 1R083 4C8DA 4ARYA 1W8UA 4ONUA 3NV2A 3VKNA 2FDJA 4EROA 3JB8A 1RHI2 1PIV1 2ZACA 5L7OC 1NLRA 3WDWA 1W6NB 2VTXJ 4QPYA 1S0JA 5CA6A 2HEYF 3W58A 2Q5TA 3ALQA 4FXKB 4IEVA 3JBG2 1VBB3 5K7PA 3AMNA 1XBFA 1HN1A 1GYKA 1UMHA 1QOOA 2B7YA 4QB1A 2LRPA 5FZMA 4PLMA 4E2QA 3NO8A 3KV4A 2LM3A 4Q4W3 1Q3EA 1UQXA 2P2KA 5FYMA 5LBBA 4XFCA 2D3PA 4LITA 4HPKA 1GOFA 2CY6A 1OF4A 2B39A 1NG0A 4KMQA 5FYBA 1AL21 4G3YC 2X05A 5FWJA 5FZIA 4PIZA 1D4M3 4Z82A 3E5XA 3WXPA 1PVC2 5B2GB 5FJKA 2ZTNA 3OEBA 1H30A 5FXWA 5GALA 3ECQA 5LBFA 1VIWB 4YARA 2XLAA 3BIWE 3ILRA 3FMGA 1GKBA 2WINB 3GZEA 3LCPA 3P1IA 1ULPA 1LENA 1RUC3 3RPQA 3PHMA 5CZKA 1OPOA 4JQRA 2ADEA 2WSVA 1IS3A 3U1XA 3OUIA 1QJFA 1WW4A 4QX8A 3RJ2X 5JOWA 1PMHX 4Q0PA 2JWPA 4OHZA 3PVNA 2D97A 3C2UA 1JU3A 3IBMA 4ZPIA 5JSPA 2AH2A 1O3SA 5ANQA 1ASJ1 3GGLA 4YFWA 4F83A 1LULA 4YSFA 3IDAA 3HD8B 1Q8OA 2L9LA 5FY8A 3V0BB 4QDSA 4ITCA 3O1TA 4QKFA 4LNVA 4CEWA 1ZBA3 3N7MA 1ULCA 2PHTA 1NCQB 5FYCA 2EIBA 3KV5A 4XVHA 1RIRA 3I2IA 1OA3A 4D7TA 3POGA 2WUHA 4UFLA 4CDXB 4JGYA 4W65A 4LIUA 1EAH2 5FPVA 3ZXAC 3I54A 1N1TA 4LO6B 1NCRB 2Q0AA 2Y6HA 1FOD1 2JENA 4PDWB 5E16A 4Z92B 3K46A 3EB7A 1IS6A 2RM22 1U5ZA 5FWEA 3VDCA 4LO5B 4MADA 4YM1A 1DLCA 1R092 3WF0A 4XJ8A 4BISA 4COUA 1AYN1 3NKGA 1XYNA 5GLWA 3ZX7A 3UYJA 3PUAA 2WYSA 4RR3C 2PN5A 5KBFA 2WA3A 4AF9A 2B9UA 3ZIXA 4NROA 2VQUA 3J8F2 3O7OA 5CKQA 1SQ4A 2YB7A 1GR3A 2WNUB 3D0JA 3LQCA 4WVVA 3LEIA 4FPHA 3LSDA 5T5LA 1SBDA 1STMA 3T3YA 3FLPA 2NQYA 3FHIB 2ARBA 2VNRA 1JOBA 4Y3OA 3RZJA 3MGUA 5A70A 4LA2A 2GC1A 5G04L 1UY2A 2WQ4A 3VBHA 4MGIE 4CCMA 2QTWB 4E9KA 3MPBA 1N1VA 1QQP1 1V6OA 1WMDA 2VZUA 2RS31 3CL1A 4FQ4A 5FYTA 1F31A 4Y1VA 1AJKA 1SCRA 5A3UA 2NP0A 5DDJ3 1PX3A 4YGDA 4NHMA 4K1YA 4DIQA 1WCKA 2QBXA 4JRAA 4NPMA 3WF2A 1GZWB 5FZ0A 3DV8A 4FFFA 2JD9A 4KI5M 4TYSA 4NUBA 2QJVA 2YYOA 5CIRA 2VW0A 1HB1A 3E6CC 1TNFA 4MGYE 2FDHA 1W2UA 1LR5A 1WCSA 1V9U1 1TME1 3H3LA 1WLCA 4B1LA 3BTZA 5L9RA 2PLV1 1W8HA 5DPNA 1LODA 1Y3TA 4UFHA 1UY0A 1W03A 2XKOA 2GP3A 4XMAA 1QJX2 4XJ9A 1C5HA 3VKFC 2JDHA 4FAGA 2WO2A 4N7IA 4AI0A 2FCUA 1VMHA 2GC3A 3WP3A 1A8MA 2ZX4A 1N3OA 1JYCA 1VBB2 5C9AB 2YY1A 5FZ3A 4DO0A 4BCUA 4CDWB 3NJYA 5FREA 3N35A 3CKHA 2WNVA 2ZXQA 2A6YA 3I59A 2XJSA 3AVRA 4H3WA 4UW4A 1UMIA 4Y20B 2W46A 3TYJA 3VL9A 3KM5A 4IGPA 4M3CA 2VJXA 3LSEA 3V65A 4R4ZA 2WNOA 3ZFEB 2J1UA 3U0ZA 1HN0A 1W04A 5A32A 4LULA 3WF3A 1D4M2 1MS1A 3IN9A 4YW4A 1PO21 4I0WB 3LEGA 2ZCWA 3AL6A 1RUG3 4DS0A 3OOXA 3R4SA 3WNMA 3LDBA 3AYDA 4TLFA 3WNXA 2JJ6A 4FO9A 3AP6A 5DUXA 3ZN6B 3BCWA 4BB3A 2Y26A 1W39A 1Z7S3 4N43C 4LBJA 3H8RA 1QJY3 1G9FA 1SEFA 3CF6E 4UWDA 1SACA 4LBNA 1J1TA 4K6BA 4PIYA 1O59A 2OVUA 2IWGB 4S2HA 5C3OA 2XLFA 1KXGA 4L8QA 5F6KA 3BOPA 4RN5A 4NE9A 4Z07A 1RVF1 2IUWA 2Q8EA 5T54A 2WAOA 4AGVA 5I91A 2XQXA 5F32A 4QAWA 3MFAA 2R061 1OQDA 2JECA 4EZ4A 1B09A 1W6PA 3VKMA 1CJDA 4CUCA 4DEVA 2GC0A 3NNFA 5ACA1 2P3YA 4BPZA 3AZYA 3K51A 5L73A 3CZUA 4EWAA 3Q8EA 5FP7A 4ZU7A 3LEMA 3PTRB 5BNPA 2FBEA 4Q4V3 2R041 2VZOA 4IEYA 1W99A 3PNAA 4LEJA 4BH9A 3LIHA 2QQPA 5C71A 2NMNA 4QX0A 4GWIA 2RJ2A 4NRPA 3FFQA 4FTEA 1BK1A 1GQPA 2O8OA 4Q26A 1K3IA 2R32A 4QQ2A 4UFMA 2XVGA 4Q4X2 4AAPA 1AJOA 4ZZ8A 2DBIA 1KDMA 4BIOA 1YFYA 1EUUA 3BTYA 3WG2A 1BQPA 1FPN1 3OGJA 1UPSA 4LHKA 5DAXA 1MQTC 3VHNA 3DPRB 3ZYFA 4UXAA 4B4QA 4KU8A 4UAPA 2QZ3A 5I0DA 5A33A 1HJGA 5A6XA 4A3ZA 4DPNA 4CXWA 3VBSA 2FCVA 1OD5A 2Y64A 3LOBA 4Q0QA 4S2FA 4D6SA 4AEDA 1GP4A 5JIAA 4QPGB 4XUOA 2IXHA 2QQKA 2XJPA 1LKNA 2YC4A 3C3VA 1LGCA 1OH4A 2XXZA 5T5JA 1VBC1 1ND2B 2R0FA 4YM3A 3ITQA 4DFSA 1ZZCA 4LUMA 5FMDA 2XJQA 2Q8CA 4CUAA 1NA1B 4ZS2A 3NAPB 2VOVA 4JDMA 2ERFA 4UFJA 3HEIA 4EN7B 2HWD1 1TG7A 2PHUA 4IEZA 3K3NA 3VD3A 3Q8BA 2ARXA 3M3OA 5HI0A 1POV3 1UMZA 1H8TB 1COV3 2E53A 2OW4A 5D2AA 5K0UC 1RUE1 3QCWA 3VD4A 4FOVA 4BYYA 5GM0A 2JG8B 5CB7A 1FATA 5JMOA 5J37A 1YXWA 2BVVA 4CSWA 3S6PA 1ZZBA 5FZBA 3ZXGA 1KEXA 5BNNA 1BMV2 1Q56A 1KFUL 4E8DA 3AC0A 2XJUA 4RQPC 2VVFA 3B00A 3VV1A 4BHPA 3ROUA 3VDDB 4A45A 3R4UA 3J26N 1IQDC 3WW2A 1OLMA 4LOTA 3UKTA 5BNOA 3RZHA 4GMP3 3ZDSA 3PUQA 2PYTA 2W1QA 1S0GA 1JTZX 2R072 2UWBA 2ZX1A 4OHXA 5JI7A 2UURA 1OMIA 1KGYA 3T2PA 5FR3A 1UYXA 3IMNA 4WVMB 4Q0SA 3POFA 1IPJA 3SH5A 2QZ2A 3UK9A 2HWE1 4B4PA 5D8AB 4CDUA 5IVCA 2RS51 1ULDA 2ZHKA 4M4PA 1K5MA 4G4FA 1PZ8A 2XMLA 1KS4A 1RUH3 4XYXA 3VUOA 5C8CB 3BU0A 4WV8A 3H8UA 4BK5A 4FTSA 2ZGKA 4LLOA 4XDPA 3AJZA 2I45A 3RZLA 3MI8A 1QDOA 1IG3A 2UWCA 1WD3A 2VMCA 4CEYA 1DG6A 4XBNA 5CVRA 4ZZ5A 5LEKA 4MG2A 4KG0A 5CFCC 4JHZA 4XW3A 1G9DA 1O4YA 3ZVXA 1C8M1 3DL3A 2GSYA 1A34A 4CCLA 3OSDA 3GYDA 1HRI3 1NE4A 2LROA 3MLKA 4NJ4A 4P9GA 4WM8A 4ZHNA 3RS6A 2C9AA 2YFUA 1VAKA 3M7AA 3O0XA 1AR81 4LTAA 4META 1AR61 2EVXA 1D4VB 2CGPA 1CX4A 4NAOA 5FO8B 1PGW2 1GZCA 2WS93 1HB4A 4DY3A 4AFCA 1NY72 4FBFA 1QXRA 3H42B 2YV8A 3M70A 1D7PM 4XF1A 2FDIA 4UFIA 2BU9A 4IXLA 3AYCA 5FAXA 1XNDA 1WKYA 3VBRB 4M3CE 2WR9A 5FMOS 2DV9A 4EN9B 4GH4C 1LESA 3AMPA 4N53A 3TOJA 3UJQA 1VALA 3A22A 4RS5B 5F1RA 4JKLA 4CUBA 4KWKA 4YVWC 5FZFA 1GMMA 4LMFA 4MVTA 3THTA 4LQRA 4IETA 5DABA 2W3JA 4PBOA 4HBNA 4IEWA 1GNHA 1LCLA 4YGBA 1POV0 3EHKA 4FPCA 2NYYA 2YBKA 3B9IA 5J7MA 2VUDA 3VZLA 5JPNB 3VBUA 4YGEA 4COVA 4Q0UA 4E27A 5JDBA 2DVGA 5FXXA 1S2BA 2CWMA 4E4DX 3AKTA 3KZ4C 1EV13 4COWA 5LY2A 2C26A 5F7UA 1CAWB 1ZBE1 3KHCA 4ATEA 1VBD1 5FXZA 4GMP0 2VG9A 4GJZA 4JGZB 3QH6A 5C5UA 1OI6A 1QOSA 5FCCA 1F5JA 5FUPA 4GD4A 3E5QA 4IEUA 3M3QA 4CU7A 4UI9L 4H55A 1RUOA 2MEV1 1VMJA 5FZEA 2AUYA 4XF0A 3J7MA 4D7SA 2CGOA 3CO2A 3IB3A 2R30A 3I2JA 3ZXEA 1X7NA 1HXS3 4D3WA 2K2SA 2Q1ZB 5JZGB 3QLQA 5A7WB 3AXEA 4IEXA 5M0TA 2FQPA 4JRLA 3PLQA 2J1RA 2JDAA 2YG0A 4K21A 3SLIA 1COV2 4PI0A 1AXYA 1PHMA 1YO8A 4WZCA 3GZUC 3ZSMA 4DEQA 5I8TA 1ZA4A 3NV1A 3OY8B 5FLJA 3SKVA 2D6PA 5LEJA 1N3PA 1WA6X 4LLFA 5FY9A 4Q4Y3 1VJ2A 2Z69A 4NO4A 4IV1C 1VBE2 3RG0A 5CADA 5GZFA 1RUI2 2Q8OA 3KLSA 3HAGA 4CU9A 1CAVA 1DLLA 2W91A 2XWBB 5DAQA 2FD8A 1MVQA 3SC7X 1RXFA 1W8FA 4H14A 3HWJA 5IVEA 3N36A 4WM7B 1V6JA 2GP5A 4YW2A 1CAUB 3U11A 3KSCA 4BK4A 1GZWA 1WW5A 4ASLA 1O3QA 1XRUA 3D3AA 3ORJA 2ZEZA 1E5IA 4L2NA 1GNYA 4YW1A 1RUJ3 2JIJA 2NMOA 1TMF2 3O1PA 2VMDA 5A7SA 3SH3A 3SNMA 4EWEA 5KXEA 5DQ0A 3RNSA 3ELNA 3UGGA 1K12A 1OLRA 2DTWA 2MHFA 3PDQA 3V64A 3AJYA 4Y1UA 2Q4SA 3FE5A 4IGQA 4IW3A 5F5IA 1I6XA 1BEV2 2JE9A 2LUWA 5K4LA 5E89A 2YROA 2XUEA 1B35B 2ZMNA 3OYWB 3H9AA 3AK0A 4IESA 2ZABA 1LHUA 1ND3A 2VQAA 4XBQA 2W92A 5F6LB 3AP9A 2PHFA 5FMBA 4X8NA 3ETQA 5L7OB 4CDWA 2MPFA 2JX9A 3G6JB 2NLRA 4CP2A 1LOFC 1XU1A 4NOTA 4XUPA 3K75B 2AEZA 1SLTA 1SPPB 3MV11 5A7NA 5LA2A 5EJ1B 4Y20A 3B01A 3KT4A 5KR7A 1C1LA 3RJRA 4XTPA 2XLGA 2P3JA 3JCIA 3NJXA 2VMHA 4KL1A 5C4WC 3MIGA 2ET1A 1W6MB 2HWC2 2JDKA 2X5IA 3CJIC 1U5YA 3OBRA 2RMU3 4ES8A 4AQTA 1IOAA 1AR91 2YBSA 3Q8AA 4IUGA 4CCJA 1BVP1 3ASIA 1OVPA 1RC6A 4J25A 1X82A 3VD5A 2ZS6B 1LU1A 5T5OA 3ZR6A 5HBAA 2BUKA 1D2QA 3OF1A 3PUHA 1DYPA 3S5QA 3WG4A 4HMZA 1LEDA 2Z5WA 4FFIA 1RITA 4QB2A 3AM2A 3UKVA 2BEOA 1BYHA 3WVJA 2GMPA 4RFT0 3K4AA 4ZY9A 1ZZ7A 3F95A 3J9SA 5E6HA 3TN92 5B4NA 5DUVA 1W9FA 3HQXA 4LK7A 4AVTA 1ZA7A 3KF3A 2VPVA 2OXBA 4I30A 5CYYA 2VVDA 1WA4A 3J7NA 4FOYA 5A3NA 3GXUA 4HG6B 2G9ZA 4XPVA 2PQSA 4CCOA 2W95A 2E9QA 3BPSA 3I8TA 2RS13 1HDKA 3WUCA 2AC1A 4TN7A 3OGSA 3GDBA 4MXVA 2SLIA 2WLPA 1CWPA 5IVYA 1RMU1 5FQ0B 1J3PA 3ZMOA 4V2VA 3KMHA 5C33A 3ACIA 1UIJA 1NXD1 3VHOA 3PVBB 3UKNA 2CNAA 3TEZA 1PGSA 1YWKA 5T3NA 4HONA 4GB33 3IAPA 1RUF1 1R1A3 2WSUA 2XJVA 1DF0A 1OKQA 1W2OA 2PAEA 2Y34A 1H4GA 3IT8A 4I02A 5FP9A 4CU8A 4IEOA 4RHV1 3VZKA 2Z2SB 3C7GA 3ETPA 4NR1A 4XMIA 5FZCA 1MEC3 1UY4A 1PK6A 4QPIA 1ALYA 2YMZA 2ZZQA 1S0FA 2VMIA 2WFF2 1ZRDA 5FZ9A 4PQ9A 4RR3B 1GSLA 1FMD1 2WZR2 1RGSA 2EICA 2RR11 3JD73 4LJHA 4CCDA 2FHRA 2A5ZA 4QD2A 4I2OA 4QMAA 1AX0A 4QPGA 1HJFA 1YQ2A 1DFQA 2JB4A 2Y60A 3CLPA 4Q4Y2 4ISRA 4AHXA 4FSJA 1AYM1 1ULGA 4RFRB 4XFHA 1J84A 2DBNA 1QWRA 4O65A 2OX0A 5GLVA 2ZGPA 5A6YA 2VMEA 1OA2A 4CEWC 1NA1A 4HN0A 3ZXDA 4DUVA 1PIV3 1Q8SA 2A6VA 1HRV1 3O5SA 4XCAA 3N3HA 3WW1A 4LO7A 1NQJA 5FO9B 3R4DB 3PMSA 3B5LB 4GWMA 1RHI1 1UO9A 5A6ZA 3UETA 1K5JA 5CBLA 4U2AA 4J1XA 2ZX3A 3WF1A 5ISLA 3MF9A 3FHAA 3JBG1 4UFKA 5A6QA 2JG8A 2D3SA 5LK7B 1XYOA 2WZEA 4QM8A 2A73B 2B45X 3U37A 3B02A 4XF4A 3Q8CA 3PVOA 4M0HA 5H9QA 3M3EA 2CDPA 2UU8A 2NM1A 4OI4A 3WY6A 1AL23 2VGDA 5LBCA 1C1FA 3BYWA 4Y5TA 1CQ9A 1R64A 2WWSA 3CDZB 4WVZA 5CKMA 2XB6C 4CVUA 5IFTA 2VD7A 3LZZA 5ERLA 3SMHA 3RMXA 4LBQB 2BBVA 3IDEA 1HV0A 1PVC1 3OJBA 2D6OX 3BU7A 1H9WA 3ZXKA 3HN1A 5FPZA 4XDQA 4DB5A 3O1MA 1OKOA 5D8AA 2AENA 4QXCA 5GLUA 5F3GA 2QQWA 4V1PA 1V6NA 5KXDA 4CRQA 3LD8A 2V73A 3VBHC 1UY3A 1EPZA 2YC2A 3BN6A 2DFCA 2HWF2 2PELA 1ASJ3 2R6QA 4YVSC 4LBLA 2YPJA 4D0QA 3S0MA 3HNYM 4N8MA 3IDBB 2WQ8A 1LHNA 5DN2A 3AZXA 3C8XA 3H1YA 1U12A 1UZVA 4N90A 4AI3A 1H6YA 4HVQA 1YC61 4XDOA 4QX1A 4DXRA 3AZVA 1UZ0A 3IIAA 4XAEA 4HKOA 1EAH1 1AXZA 1FOD3 1RUD3 1PZ9A 4Q8LA 4FOQA 1LU2A 3SCGA 5KXBA 2PFWA 4N43B 2D43A 4MXWB 2DCTA 2DURA 3GBFA 1ZRIA 4X8PA 2VW1A 3I2KA 3BTAA 1LEMA 1AYN3 2A6ZA 5E1RA 2RM21 2KA3A 4BZ4A 4N9HA 4YG6A 4FPLA 1W0NA 2D6KA 1Y43B 5KXCA 2BBAA 3A0NA 1ODNA 4I0BA 1OC1A 1R1ZA 3JU9A 2RS12 5IW0A 5IAVA 2D7FA 2WNVC 1MR5A 3POWA 1NOVA 1UZZA 3WG1A 1Y9GA 1MS4A 4NN0A 3J8F1 3AL5A 3NNJA 1V6LA 2OPWA 1PO12 4EV0A 2AEYA 1CIYA 4CUGA 4TZDA 4QDQA 1F4HA 5FZOB 2ZBJA 2CGNA 3VBFA 3BALA 4YFZA 1WLTA 3DKQA 1JZ4A 3U14A 3K48A 3QACA 4I09A 1AVBA 3ZYPA 2OPKA 3VL8A 4PI2A 1R1A2 4CDQA 1F8VA 1QQP3 4QWNA 1X36A 2RS33 2QQIA 3MV01 5EYYA 1ACCA 2BGOA 3R6SA 3POBA 1QJU2 4KU7A 5IK4A 5IK5A 3RSJA 1SFYA 4Y1XA 3TRSB 3ZPOA 4YG0A 3ILNA 2YU1A 4AI2A 4PIXA 3LKJA 4JGZA 2PXJA 3JD72 5FDBA 1MQTB 5FZ8A 2EIGA 1H0BA 5LASA 1KS5A 1V9U3 1QU0A 1TME3 2XR4A 4FFHA 2XBO1 4YZ4A 4AFMA 1RB8G 2PLV3 5C3PA 2BW8A 2VQTA 4OZXA 4XOGA 2FZ2A 1TEIA 2ARAA 4Q27A 5AFEA 1SFNA 2K0GA 4KWJA 3Q9OA 4Q29A 4CPBA 4Y22B 4URAA 3WP6A 1QJX1 3KCYA 1JZ7A 3C7EA 3P3NA 4OZOA 5A7WA 3ZN5A 1CAXB 3SQOA 1XNTA 3FN9A 1H4HA 3KT1A 3WNNA 3N9NA 4AK3A 4OMCA 2HWB2 1BXHA 2R1DA 3BODA 1VBB1 3NMBA 1XNAA 2FCTA 5ABJA 4V2WA 4NMIA 2A6XA 3V0AB 4N53C 3PJYA 4LT5A 3I3BA 5AC92 5CEHA 3IMMA 1LAJA 4ZONA 1XE0A 2DCJA 4YZ1A 1VB2A 4B29A 2C0ZA 1GP6A 1UOGA 3ZYJB 4OLLA 1PO23 3S7IA 2VBBA 1DYOA 4XFAA 3K77A 4RQPB 4LKDA 3BGAA 5IUQA 4LKFA 5F2WA 3VBSC 1D4M1 1WMFA 3AB0A 5A3OA 4WM7A 3ZYIB 2B5HA 1DQ1A 1KJRA 1E5HA 2JKXA 4QGLA 2RV9A 5IVBA 4N9IA 5KWRA 1P8JA 2OIIA 2D6NA 4TLGA 2FDGA 3ACLA 2CTVA 1GOGA 4BQXA 4KWUA 1RVF3 1O3TA 3TEXA 1J3RA 3O1OA 4NRQA 1VRH2 1AR72 2R063 1RTVA 3HQUA 4FCAA 5EFUA 3OBZA 1R082 3LF7A 4A6OA 5C3QA 1REDA 4TTGA 2P1BA 2WYFA 4AFBA 1B35A 2VO5A 4LXLA 5ACA3 4M0NA 3OYWA 5DAPA 1GUIA 5HCBA 3WW4A 5IVFA 2B42B 3DXTA 1BZWA 2CDOA 2VOWA 1OD3A 1JBCA 3N9QA 4FPGA 4HSJA 5EJ3A 5CFCB 3KD4A 3ZKUA 5BNNC 1NLSA 5L7OA 2R043 3CMGA 5LK5A 3ZYRA 1OBNA 2WL1A 5FOJB 4YRDA 1FOD2 3IPVA 1RUD2 4Q4W2 4Z2AA 1DQ0A 5HCAA 1FXZA 1GQHA 4YW5A 5L9VA 3P6BA 3KF5A 2PHLA 5KHHA 4LA3A 2VVEA 4LBQD 4P9WA 2Y6LA 1FPN3 2GN3A 3RYPA 4CP0A 3B9CA 5FBZA 4CDUC 5CFDC 4Q4X1 2ETEA 1G9CA 3USUB 2E7QA 4QB6A 3M3CA 2B46X 3ENRA 1WCQA 1ZM1A 1CR7A 1V6IA 1JW6A 3EQEA 2BJSA 2Q30A 3LIGA 4GH4B 4WZFA 4LHLA 3HVDA 1NT0A 4ASMB 1RUC2 3H0OA 3ME2A 1GQGA 3B7MA 3QD6A 4YVWB 2A3WA 2ZKLA 1VBC3 3MPPG 3PUSA 3H1MA 4QXKA 2VZVA 4CEYC 5LA1A 3BOWA 5DUUA 3VHRA 5CKNA 1JHNA 2JE8A 1POQA 5LZ6A 4CP9B 1A3KA 4LO4B 3VD9A 1FYUA 4QM9A 4IE4A 1JS9A 4YM2A 4BXFA 1YFUA 5DZFA 1SHWB 3DXUA 3I2FA 2JG9C 5JVVA 1W8TA 1V70A 2IXLA 1U0AA 2OS2A 3CQOA 2HWD3 4EN0A 1I1EA 3TEWA 4WM8C 2C1FA 5BUVA 3AXDA 2X53S 1ZBA2 4MX3A 3KV6A 4I3PA 4BQWA 4XABA 1UKGA 4RA0A 1RUE3 4XTMA 4O7XA 1O3RA 3KB5A 2W94A 1YFXA 2V5YA 2K46A 1V9U2 3I3DA 1SDWA 2O1QA 5FQ0A 4HXCA 5HXVA 1YQ6A 2UY9A 3FLTA 5LB6A 5FOBB 4NHYA 4XIOA 2B9VA 3NQHA 5LRRA 5JCTA 2XGXA 4QX2A 2YFZA 4IV3A 5F5QA 4CCKA 4JHTA 4FFGA 1BMV1 2ZX2A 1HW5A 1OLQA 2QQOA 3KQ4B 4JKKA 4WVWA 5FJHA 1CD3G 3CBNA
chains in the Genus database with same CATH topology
1U5IA 2ZAAA 3HIFA 3N7LA 1DGRN 1VB4A 2BGCA 4EWDA 2D44A 5A3MA 2BVBA 4ZKTB 2R071 1F5FA 4AGRA 1G8WA 5KC6A 5GKAC 4CZSA 1J3QA 2V09A 2DU0A 1DGWX 3M2MA 3VBUC 1H2LA 3HR9A 4RD7A 5D1IA 1X50A 4CYDA 1JOJA 2DYCA 5J48A 5A33B 2UYBA 3RDIA 3D4KA 4IV1B 4ZU4A 2GAUA 3NV3A 1C8M3 4XXAA 3T1MA 5AFBA 5F9TA 5DDJ2 3ZPYA 2P3IA 1LHWA 1J1LA 3AYEA 1AR83 2DFBA 2YGLA 1AR63 5JLVA 4P9IA 1OA4A 1ZRFA 2QDRA 4TSVA 1LHVA 2RE9A 1QOTA 3GF6A 1O5UA 1OOPC 4AWDA 2UYAA 1ZZ8A 4DRVA 2P3KA 1CJPA 4XJZA 1PGW1 3MW4A 5DZGA 4FPKA 1NY71 1UAIA 2D5FA 5DUWA 3G7DA 4KH9A 1UF2C 2CAUA 4YGCA 2EXIA 4Q1RA 3VKOA 1YCIA 3D5OA 4LBQA 3VBOB 2ET7A 2NPIA 1UN1A 2ZGOA 2VECA 3NW4A 3ZFGA 2ZJCA 1WLDA 2LALA 5FMOL 4HKWA 1ONAA 3WD5A 4A7YA 3MIEA 4L92A 2E7AA 1Z78A 4BA6A 5EV7A 3ZFFC 1W6QB 2E7TA 3WLUA 4AVAA 3WHUA 2A75A 3KT7A 1ZBE3 2ZA9A 4C1XA 5C4WB 1QH7A 2PHWA 3MIFA 1VBD3 1AF9A 2ATFA 1N1SA 1CESA 1ZNPA 3CJIB 1RUG2 1W6NA 3O0VA 2H0VA 1I3HA 4LBOA 3VZJA 5IK8A 1Z7S2 1QJY2 2JKBA 4WBBA 1IHMA 1KJLA 3MIDA 3PTYA 4BOWA 2DVFA 2MEV3 1WGPA 2ENRA 4C0HA 1LTEA 4MXWA 2I07B 2AYHA 1L3JA 3FBMA 1DHKB 3OD0A 1S55A 1MACA 1ND3C 3CNAA 3FC0A 4QU2A 2XG3A 1CGPA 4CDWC 2FZ1A 3MFCA 3CEWA 2XUMA 1GLHA 1IPKA 2TBVA 3FWEA 4Q4V2 1KD7A 1EY2A 5JMCA 2H6BA 4LHNA 4QQLA 5E8AA 5J09A 4MGZE 2X5IC 4HPKB 4DRRA 2D93A 4HFSA 1VBE1 1M06G 1RUI1 3KGLA 1JN2P 3V0BA 5K9YA 1NCQA 3GBWA 1H2KA 3NJZA 4CDXA 4FPOB 1XXNA 4AHYA 1APNA 1S0CA 1MZFA 4FAHA 2HEVF 2WLQA 4AEMA 1NCRA 1TMF1 4PDWA 2XHKA 2CL2A 4J1WA 1O5LA 1C8M2 2EAAA 2ZGLA 1WW6A 4HKLA 2OYZA 4CEWB 1BEV1 1CAXA 1AZDA 1V6MA 1N1YA 2R49A 5KHGA 1F9KA 4QX5A 1YUDA 1YHFA 2WNUA 2XL7A 4Y24A 3V0AA 1PGL2 3RYKA 3LAGA 4MYEA 2A3YA 3POYA 2RHPA 3KCCA 3WW3A 1PK6C 4QPIC 1AR93 2HYKA 2VY0A 1S0DA 2HWC1 4AFAA 4A7ZA 5I93A 4IEQA 1MS9A 2N7GA 2O8QA 2E51A 3KGZA 4R9CA 4YM0A 4ATFA 4D7YA 3JQWA 1QF3A 2BFUL 2ZPXA 1E57A 4DZGA 1WW7A 1ZREA 3A0KA 2QCSB 1CONA 1RUH2 4J6GA 4S2GA 3NKTA 3VBHB 1UZYA 3CJXA 5H9RA 1ENQA 3TN91 2F6BA 4YVSB 2DTYA 1VBD2 1REFA 1N47A 4X6RB 3CU7A 4K3UA 4XF9A 5L19A 1O7FA 1HRI2 1RMU3 5C9AA 5GZGA 1BCXA 4NHLA 1XE7A 4Y1ZA 4IQPA 4XJWA 2NN8A 2OUHA 5KHKA 2WS92 1RUF3 4OI0A 3H3ZA 2IXIA 2DVBA 4RHV3 1HKDA 4UBHA 4AFDA 3ZFEA 1IQAA 3M8LA 3GHNA 3LOIA 2OA2A 3I7DA 3AP7A 1BBT3 1PNGA 3USUA 1G9AA 1FMD3 5H9PA 4EJRA 4JVAA 2RR13 3O0WA 4B3NA 2WFF1 1YI7A 3ZN6A 2CV6A 2WZR1 2WNVB 1J58A 2VU9A 2PAMA 1QKQA 3I59B 1AYM3 1H2NA 2WC2A 2ZGMA 2D6MA 3A4UA 3ZIWA 4KNCA 3GZTB 4LO8A 2Z79A 4M3CB 4DOUA 4Q4Y1 2AR6A 3RRDA 2Y0OA 5I8YA 5I0SA 3M4FA 4ES9A 1BVVA 1HRV3 1SLLA 4L11A 1S1AA 5LRSA 1KDKA 2IC1A 1EV12 3AZWA 1PMIA 4XIKA 1YLLA 1RHI3 1HLCA 2W52A 3VLBB 1Q8VA 4XFGA 2VOKA 5JR7B 2GNBA 4D69A 1SLBA 5GLTA 1VBA1 2VQ0A 3JBG3 4E2GA 5E88A 3ZYGA 1Q8PA 1HV1A 5J3UA 4Q0VA 2GNTA 2ZMLA 1RINA 1FX5A 2B8MA 5DG2A 1XE8A 4XEZA 1PVXA 4AI1A 1QY4A 3KS7A 5CG9A 1XU2A 1GICA 1W6OB 5BXXA 2ZX0A 3AKRA 2D40A 1W6PB 1HXS2 1QH6A 2AGSA 2DWRA 4OUSA 4PF5A 5JI9A 3QBQA 1H1AA 3L2HA 3DPRA 4LUKA 1T6GC 3VBFC 2CAVA 2XH6A 3MIHA 3WG3A 2XPJA 1DGLA 3AYAA 4AHWA 4CDQC 3FBYA 4L99A 1JUHA 4MV2A 2EXKA 1ND2A 1DZRA 2EA7A 1JYIA 1IZ3A 1DQ6A 4CTEA 2HWF1 4Q2FA 5I0RA 4BE3A 3IKWA 3U07A 1VAVA 3NAPA 1OQ1A 2W08A 2PA7A 5BV6A 5FFOC 4JGYC 1OFNA 4K9SA 4XE9A 5EYXA 3VBSB 2WJSA 3ZO0B 1H8TA 5BNQA 2GU9A 2IXKA 1RUJ2 2GC2A 3N4MA 2RJKA 3WDUA 2VUJA 1LJ7A 1FI2A 4DNYA 1Y9QA 4R9DA 4ISQA 3GBGA 3SISA 2RM23 4AE2A 1UL9A 3NSTA 4L97A 3VDDA 2PHDA 3ZSLA 5JWPA 5CG8A 1Z0HA 2HKXA 1D0GA 1MZ5A 2DUPA 1MVEA 1GZ9A 4XHXA 2IZWA 3VBOA 2GMEA 5ABJC 4WVMA 2RS11 3LA2A 3D0SA 4BMEA 4QHBA 3RYRA 1TNRA 2BYVE 1XNBA 2G9FA 1X8MA 1XQNA 3HMYA 3THPA 1PO11 3WQ7A 4E4SA 5C8CA 4XQ4A 4U36A 3W59A 4F7ZA 1AUYA 1W6QA 1DQ2A 4YYOA 5SV8A 4INDA 4AW7A 2G9GA 2VULA 1R1A1 5I0TA 1Q43A 4HT1T 4AXOA 1BBT2 5FLHA 2RMU2 3P3PA 3PMEA 5LEKA 2PHXA 5C4WA 3RI9A 4AVSA 4JDNA 4AQ6A 1QJU1 4CDUB 3AFGA 5CFDB 3IDCB 1C8NA 2OUJA 4C91A 5KC5A 2XBO3 3JD71 4PLNA 3ZSEA 2Z42A 2OZJA 1XNKA 4I01A 1SLAA 2YUEA 5BPXA 1GNZA 2JXAA 3E6DA 1Q8QA 2WT1A 4CEYB 4AVVA 1I5ZA 1QJX3 2VW2A 3AFKA 5FTTC 4KG8A 2IFRA 3MZHA 4R9BA 1R091 3VBRA 3H50A 4Y1YA 4W6WA 1ZZ9A 2JG9B 4RS5A 4WM8B 4OHYA 1WBFA 4QT6A 5GJ6A 4OULA 3NWKA 3KQRA 2HWB1 2QKDA 1EP0A 4UBGA 3TB0A 5CAZA 4Y26A 4HK9A 4GIQA 4NWVA 4RSUA 4HL0A 5DXDA 3AMHA 4GB32 5AC91 1UU5A 2JEMA 1A78A 3NV4A 1XYPA 1MEC2 4UW3A 4N53B 5T55A 4COYA 1CAWA 2VOXA 1ZX5A 1AL0G 1HX6A 2BNOA 1LOEA 4YZ3A 4XZPA 4N7UA 3H3UA 4Y4YA 3POSA 3PVEA 1ZVFA 1LHOA 4E2SA 3VKLA 1YIPA 1MS8A 3HT2A 2DCZA 3B93A 5EWSA 3VBUB 3LWCA 5KHJA 1VRH1 2WNEA 1AR71 4FQZA 1PIV2 2XJRA 1R081 4MGKE 4P9LA 4O9GA 1DU3D 4MH0E 3EBRA 1CVNA 4C90A 5JZGA 1CIWA 1DZQA 3FFZA 3EXUA 4R9AA 3VGIA 3VZMA 5BNPC 5IT6A 4PBPA 2ILMA 1C5IA 4IV3C 3WR0A 1DDLA 4FOWA 4FVVA 3FZ3A 3AX4A 3OY8A 5K0UB 1RUD1 4JAAA 4Q4W1 3R0RA 3SXWA 3V56A 3TNPB 3EO6A 4I0AA 4QQPA 4RGAA 1AL22 3N7JA 4FPYA 1OOPB 1UIKA 4Q4X3 4YNIA 3WDTA 2D5HA 4RL7A 4KGGA 4LR4A 5IK7A 4FXGB 2BWAA 2GN7A 4HK8A 4AEDC 2TUNA 3AKSA 1W0PA 4OI2A 1CAUA 3W9AA 1C4RA 4KWLA 4L9BA 3WT3A 2C5DA 2CWSA 4C0BA 3D6EA 1RUC1 3SCHA 1HQNA 2A6WA 4YZ5A 1LECA 2Y0IA 2DUQA 3SH4A 1SLCA 2WQZC 3GZAA 1ASJ2 3U4XA 1M4WA 3IWZA 1CAVB 1MZEA 1D2SA 4K20A 4GKXA 3B69A 3DGTA 4XHBA 3ZFFB 2QDNA 4AG4A 1JXNA 4AEKA 1QNYA 4YVSA 1REEA 4Y5Z0 4UW6A 3M3IA 1ZBA1 5TSWA 1WMEA 1UD1A 1MS0A 3O12A 2CYFA 2XBO2 4B4RA 3AP5A 2R16A 1H1MA 5DG1A 1HQWA 1BJQA 2EXJA 1H8VA 3INAA 1VLNA 3VZOA 3WDVA 5JOZA 5BNOC 2WZPP 1EYBA 1ZRCA 4KBBA 1AYN2 4K1ZA 3RI8A 2ZOEB 4QQHA 1F2NA 1FAYA 1W6MA 2R073 3ZFGC 3OPZA 1ND3B 2DCKA 1UPIA 4UW5A 1MS3A 1K5MC 4R52A 2A70A 1C3HA 3FJSA 4H7LA 2PAKA 2LTNA 3GNEA 2H0BA 1QGLA 2D6LX 1J59A 2VNOA 4OHVA 1KFXL 5J98B 5C6CA 2VMGA 1VP6A 1JH5A 3DKWA 1LOCA 1WLWA 5AVPA 1QQP2 1OPMA 4P9XA 2RS32 2X5IB 3SITA 1OQEA 1G9BA 2IXJA 2ZGUA 2BPA2 4OFGA 1YYNA 1S2KA 1AX1A 5DDJ1 4DQAA 4HLTA 2GH8A 1UX6A 3UJOA 5T50A 2DCYA 1TME2 5I8SA 2GZWA 3FUOA 3X29B 2PLV2 3NVCA 4EN8B 1ENRA 4W6YA 5EZWA 5GZEA 2PTMA 1W6OA 2QNKA 4XFBA 1YJKA 3WCRA 3RWNA 4XILA 3WINE 4BMBA 1WUVA 4XXPA 1TE1B 2I74A 3JUUA 1YIFA 4EN6B 2HWE3 2RS53 3L9JT 4RR3A 4OVEA 1LOBA 4OUMA 1DGWA 2ZMKA 1DYKA 1NXMA 1CN1A 3N7KA 4JV4A 2D98A 1O4TA 2WT0A 2BNMA 1PO22 1NCQC 4AGGA 1I9RA 2GNDA 1PK6B 4QPIB 1DBNA 4CDXC 2ES3A 3WZ1A 3E6BA 3TWIA 3SHRA 1RUG1 2JD4A 3AZZA 4YLZA 1KRIA 4FPJA 2JDZA 1NCRC 3AP4A 3MW2A 2BTVC 4PDWC 3H7JA 3DN7A 2GH2A 1Z7S1 1OFSA 1QJY1 1RVF2 3H7YA 3LA3A 2R062 1KQRA 1QHDA 2I2SA 1SBEA 2WFPA 1ULFA 3MDPA 3ZXFA 4NHKA 4W6XA 4GULA 3ZMNA 1UCXA 5ACA2 4QQOA 5T5PA 3ZSKA 4R8HA 2WNUC 3UV9A 4BM8A 4K7JA 4JCKA 4DMIA 2R042 2YDEA 1LRHA 4GA9A 3LB9A 3HBZA 1ZRRA 2TEPA 4O9EA 2EAKA 4Q4V1 4MZUA 5FO7B 1RUNA 2W39A 5GZCA 4XF3A 1QMJA 5JOYA 1O4ZA 3FLRA 1VBE3 4K8FA 3WOGA 1RUI3 4IERA 3D8CA 1SBFA 4M3CF 4XETA 4FTBA 1UU6A 4BIFA 4LE3A 2F4PA 1UU4A 1FPN2 2P17A 4DXZA 2VXRA 5J36A 1UKRA 4Z8BA 2MNGA 4JTNA 5CFDA 5BYNA 2AZ5A 2OZ6A 2P37A 4XQDA 1VBC2 1TMF3 1HQLA 3DUIA 3L2YA 4N43A 2ZGTA 1H1IA 2DVDA 1BEV3 2EALA 2EXHA 2HWD2 5C9AC 1X33A 4GWNA 2JG9A 2KXLA 1V00A 5FLIA 4DY5A 1RUE2 5JSRA 4AHZA 1G7YA 2IXCA 5GZDA 3OD4A 1POV1 1COV1 2RJLA 4FP2A 2QE3A 2SBAA 3FUQA 4MUVA 4COZA 3ZFEC 1DQ5A 1PGL1 3MICA 3ES4A 3USSA 2QFEA 4AI8A 5DZEA 1UW8A 3TAYA 1U5XA 4HSLA 4MSVA 1BKZA 2DU1A 1FNZA 2HWC3 2XJTA 5C8WA 1MZ6A 2A7AA 4P9JA 3ES1A 3WUDA 4GMP1 3JZVA 1QJZA 2HWE2 2ZHMA 2RS52 1URXA 3GALA 3M1HA 4ZXKA 1H9PA 1MQTA 3JQXA 5GLZA 4E4ZA 3VBFB 1GANA 4Q1PA 4XBLA 1WCDJ 1RUH1 1SMVA 2ZGQA 3TN93 4CDQB 1RL3A 4Y22A 1AXKA 2HEWF 3MF6A 3S7EA 3U10A 3WCSA 4M00A 2JICA 1W0OA 1GBGA 1LOAA 1ULEA 3ZSJA 1LGNA 2YC0A 3DF0A 1N3QA 1AR82 2WT2A 1AR62 4JGYB 2WA4A 1HRI1 5FPXA 1JUIA 2JE7A 5K0UA 1G6NA 3WP4A 1IS5A 1H2MA 5AVAA 3ZXJA 2WS91 3E97A 2QUOA 4ORFA 2W0XA 4HVRA 3RMYA 4Q8KA 1OOPA 1ENXA 1YFWA 3DPRC 1WBLA 4BWOA 4RQPA 2ZGRA 4BQ1A 4DINB 5EXOA 1DGRA 2WFF3 4FT8A 2ZHNA 4QPGC 2WZR3 1NYWA 1NZCA 2R0HA 5ABJB 4AVBA 1FT9A 1ND2C 3KCXA 1IGOA 3OBTA 4PLOA 3AKPA 3WP5A 3TBDA 1IKQA 1NA1C 1RJ8A 2XWJB 3VHPA 3URFA 3NAPC 3IM0A 3H1WA 3OCPA 2XKPA 1QXPA 3ZXLA 1EPWA 3O14A 4HETA 3ZFFA 1ZBE2 4FP3A 4MLOA 5HCFA 3RZZA 5J96B 1EV11 1H8TC 2ZZJA 4HZFA 4JTOA 1C28A 4A7KA 1VBA3 4YW3A 1TQ5A 4B8EA 1SLIA 1GV9A 2JG8C 1X8EA 3BB6A 5CFCA 4IL7A 2VNGA 1A6CA 4K40A 4XJAA 2MEV2 1YI9A 3VDDC 3OGGA 2FMDA 5L36A 3ST7A 2ZGNA 4R4XA 4TWTA 4F8AA 2PQQA 2ZAHA 5JIUA 3SCFA 5FRAA 1HXS1 5D8AC 3WDXA 1V6KA 3D82A 3BPZA 3RQ0A 3APBA 2UY8A 1FV2A 4XFFA 4RGGA 1ENSA 3UL2A 2IFWA 2VH9A 4M01A 4BLJA 3B94A 1Y7BA 5C8CC 1VR3A 3GHMA 4GH4A 4JC1A 3E5UA 4AEJA 3ATGA 2VUAA 3IPVB 1AX2A 4URTA 4YVWA 4I3GA 1VAMA 2WIIB 1FV3A 4ZU5A 3MIBA 3S30A 2HWF3 5JAXA 3HT1A 1XNCA 4PCRA 2A3XA 3FX3A 2BFUS 5A32B 5T52A 1S0IA 2BNNA 3MLLA 3WV6A 2GDFA 2ZGSA 5A3LA 4D94A 4GXLA 5CNAA 1LOGA 4SLIA 2QVSB 2Y38A 2NZ9A 3JB4C 1PZ7A 5H9SA 2D3RA 4H7MA 2O0OA 3ZN4A 4KQ7A 1CPNA 2KM2A 3VZNA 4AQSA 2YGMA 3WX5A 2ZHLA 3LA7A 2GMMA 3T1LA 4BLIA 1RUJ1 2H6CA 3I2DA 2X8KA 4HN1A 4NWWA 4PJYA 2XVKA 3MYXA 2HJIA 3VBRC 1GFF2 1NE6A 2DVAA 4OHWA 4FPFA 4RS5C 3AMQA 5JPMB 1PVC3 3R05A 4OI1A 1IKPA 5K8SA 2GNMA 1DZTA 2YZ4A 4Z1VA 4C1WA 3ILFA 1CPMA 5BNPB 1PO13 1HIXA 1WD4A 3I4IA 1Q5OA 4IV3B 3EJKA 1AHSA 2PHRA 3AMMA 4CP1A 3WQ1A 4QGMA 4G9SB 4P5HA 2A71A 4LE4A 5A33A 4JDOA 1AR92 4SBVA 2GALA 4IV1A 1O91A 2YHJA 5JSOA 1QJU3 4JGZC 1BBT1 2RMU1 1RJ7A 4A3XA 2XL9A 4QGNA 2G4IA 2X29A 3OTFA 3WDYA 4NPRA 5KHIA 2R1BA 4GALA 2EF6A 3PJQA 1KITA 3J4UH 4AEDB 1EAH3 1DQ4A 4NVPA 4P14A 1SCSA 2K9ZA 1A8DA 4Z2WA 2WKKA 2AREA 1G86A 4A2UA 2ZKNA 3LGRA 2BWCA 5JZGC 4P9YA 1R093 3MEPA 4AQ2A 3MW3A 4AYUA 3MLJA 5BY5A 4X6QB 1VBA2 4LBKA 1OSGA 1S0EA 2E6VA 4YG3A 1PNFA 2UWAA 4F3JA 3NL1A 3J8F3 4YZ2A 2HWB3 1RMU2 2FMYA 2W68A 2Q1MA 1QDCA 4XJUA 3WQ0A 1PM7A 1ZZ6A 1ZYBA 2YXSA 5BNNB 5CU1A 1QXJA 5AC93 1RUF2 4GKYA 5SV5A 1LOFA 3B3QE 4RHV2 3WHTA 4HVOA 4B7KA 2TNFA 4GB31 5BNOB 3TNQA 1YJLA 2DUOA 4WM7C 1LGBA 4FPEA 2P34A 1D0HA 1MEC1 1NQDA 1OHFA 1FMD2 2BQPA 4GQ7A 4S2DA 4XQWA 2RR12 3AKQA 3CJIA 4XFIA 3ZFGB 5I0UA 3VN4A 4LBMA 1K5MB 3QH7A 5JOXA 1YRZA 4HANA 3T2TA 1MS5A 2XVLA 1DIWA 1AYM2 1FNYA 1S0BA 4KGQA 1IS4A 4AVCA 1LB2A 3QOPA 4B7EA 1VRH3 4IEPA 1AR73 1C57A 1YNAA 2E63A 1B35C 2DF7A 1HRV2 1QNWA 1R083 4ONUA 3NV2A 3VKNA 4EROA 3JB8A 1RHI2 1PIV1 2ZACA 5L7OC 1NLRA 3WDWA 1W6NB 4QPYA 5CA6A 1S0JA 2HEYF 3W58A 2Q5TA 3ALQA 4FXKB 4IEVA 3JBG2 1VBB3 5K7PA 3AMNA 1GYKA 2B7YA 1QOOA 4E2QA 4PLMA 3NO8A 2LM3A 4Q4W3 1Q3EA 2P2KA 4XFCA 2D3PA 4HPKA 2CY6A 2B39A 1NG0A 1AL21 4G3YC 4PIZA 1D4M3 4Z82A 3E5XA 3WXPA 1PVC2 5B2GB 2ZTNA 1H30A 5GALA 3ECQA 1VIWB 4YARA 2XLAA 3BIWE 3ILRA 3FMGA 1GKBA 2WINB 3LCPA 1LENA 1RUC3 3RPQA 3PHMA 1OPOA 4JQRA 2WSVA 1IS3A 5JOWA 1WW4A 3RJ2X 4Q0PA 4OHZA 3PVNA 2D97A 3C2UA 3IBMA 5JSPA 2AH2A 1O3SA 1ASJ1 4YFWA