2BUKA

Satellite tobacco necrosis virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
TMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN
publication title Structure of Satellite Tobacco Necrosis Virus After Crystallographic Refinement at 2.5 A Resolution.
pubmed doi rcsb
total genus 46
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bukA00
2VQ0A 5DDJ2 3VBUA 1NCQB 1R083 4Q4W2 1HQNA 3JBG2 2Y26A 1ASJ3 5CFCC 1AUYA 4YVWB 5C8CA 1CD3G 5C4WC 1EV11 2R072 3NAPA 1FPN3 1TMF3 3TN91 3VDDB 1GFF2 1HRI3 4AEDA 2FZ1A 1EV12 3NAPC 5GKAC 3TN92 1A6CA 1HRV1 3VBHA 4IV1C 1ND3A 5FOJB 1K5MA 1HRV2 3VBHC 3VBSC 1MEC1 4CDWB 3ZFGB 4CDQA 5L7OA 1ND3C 1ND2C 1C8NA 1VRH1 1VBB3 1MEC2 1IHMA 5L7OC 1BEV3 1VRH2 3ZFFC 1NCQA 4Z92B 1B35C 4GH4C 3LOBA 2WFF1 5J96B 2HWD3 4YVWA 1NCQC 1PGW1 1CJDA 1AYN3 2XPJA 1VAKA 2WFF2 2HWE3 1Z7S3 3CJIB 1FOD1 4GB31 1PGW2 4QPGB 4YVWC 1OPOA 3VDDA 1R091 1QQP3 1FOD2 5A33A 4GB32 1ZBA3 2GH8A 1RUF1 2RMU1 3VDDC 1R092 2MEV1 5BNPA 2WZR3 1AL21 2RS11 5CFDA 1RUF2 2RMU2 1H8TB 2MEV2 1RUC1 1AL22 1RUI3 1AR91 5ABJB 4Q4Y3 2RM23 1POV0 2RS12 5K0UA 3ZFGA 1RUC2 4CDXA 1AR92 1R081 2BUKA 1V9U3 4RS5A 1ASJ1 3J8F3 4CEYA 4CDWC 2RR13 1COV3 1PO13 3ZFGC 1R082 4EJRA 2DF7A 1AR83 1ASJ2 1RVF2 4WM8B 1ZBE3 4CDUB 1FPN1 1AR73 1TMF1 4WM7B 1HX6A 1HRI1 4Q4V3 1NY72 1RUD3 4BCUA 4CEWA 1C8M3 1FPN2 1TMF2 1HRI2 1MQTB 1VB2A 4N43B 4QPIA 5BNNB 3S6PA 3CJIC 4JGZB 5D8AB 2X5IB 4QPGC 1HXS3 1QJZA 5CFCA 1H8TA 1E57A 1VBB1 5ABJA 2WS93 4RQPB 5C4WA 1VBC3 1BEV1 2HWB3 1POV3 1H8TC 1VBB2 1VBE3 5ABJC 3HAGA 1BEV2 2HWD1 2ZTNA 1AYN1 4YVSB 2HWE1 1Z7S1 2R043 2HWD2 4IV1A 2BPA2 4JGYB 1AYN2 2RS33 1PVC3 1QQP1 1Z7S2 2HWE2 4WM8C 3VBSA 1RUG3 4N53B 4CDUC 1ZBA1 1ND2A 5A32A 4WM7C 4FTSA 1MQTA 1QQP2 2WZR1 4N43A 1NA1B 5BNOB 1ZBA2 2WZR2 1MQTC 1RUI1 1R1A3 4N43C 5D8AA 2X5IA 4Q4Y1 1WCDJ 3ZFFA 2RM21 1B35A 4Y4YA 1F2NA 4GH4A 5BNNC 2WLPA 3ZFEB 4JGZC 1RUI2 5D8AC 4Q4Y2 2X5IC 2RM22 1V9U1 1FMD3 3J8F1 2RR11 1COV1 1PO11 4PDWB 1TME3 1EAH3 1BBT3 3M8LA 1AR81 1V9U2 4Q4X3 3J8F2 1ZBE1 2RR12 1COV2 1PO12 2PLV3 4RQPC 1AR82 1AR71 4Q4V1 1ZBE2 2FZ2A 1RUD1 3ZXAC 2GSYA 1C8M1 2BBVA 2ZZQA 1AR72 2RS53 1RMU3 4Q4V2 3JB8A 4JGYA 1RUD2 4SBVA 1C8M2 4YVSC 4IV3B 1QJX3 5C9AB 4JGYC 1HXS1 3VBRB 1NA1A 1NCRB 4N53C 4CDWA 1D4M3 3VBFB 1HXS2 1NA1C 5BNOC 2WS91 1PO23 1VBC1 2HWB1 1POV1 3ZFEA 1PGL1 1VBE1 2WS92 3VBUB 1BMV1 1VBC2 2HWB2 4RHV3 3ZFEC 1PGL2 1NG0A 1VBE2 4FTEA 1BMV2 2R063 1PIV3 5C8CB 2R041 3CJIA 4PDWC 2QQPA 1RUJ3 1QJU3 1M06G 2RS31 3NAPB 4QPGA 1PVC1 1RUG1 1OHFA 2R042 3DPRB 4AEDB 2HWF3 1RHI3 2RS32 1PVC2 5FMOL 1RUG2 4NWWA 3VBOB 1AR63 2XBO3 1R1A1 5ACA3 5AC93 4GMP3 3VBRA 4IV3C 1K5MB 5C9AC 1R1A2 4CDQB 1RUE3 1FMD1 1QJY3 3VBRC 1NCRC 1VB4A 1TME1 1EAH1 5LK7B 1BBT1 3VBFC 1FMD2 1RUH3 4Q4X1 1W39A 4WM8A 1TME2 2HWC3 2PLV1 1F8VA 3JD73 1EAH2 1SMVA 4CDUA 1BBT2 4Q4X2 1RVF3 1AYM3 4WM7A 2R071 2PLV2 3VBUC 3JB4C 2RS51 1RMU1 1VBA3 2ZAHA 2RS52 3DPRA 5C8CC 1QJX1 1RMU2 5BNNA 4JGZA 5A33B 1VBD3 1X36A 4FTBA 1QJX2 3DPRC 1OOPB 1D4M1 3VBOA 4AEDC 5BNPB 4Y5Z0 5CFDB 1D4M2 5DDJ3 1PO21 3VBOC 4RQPA 4Q4W3 3JBG3 5K0UB 2BFUS 4CDXB 1PO22 4RHV1 4NWVA 1K5MC 4RS5B 4CEYB 4CDQC 2R061 4RFT0 1PIV1 2R073 4RHV2 4YVSA 5FMOS 1RUJ1 1QJU1 2R062 1PIV2 1EV13 4RR3B 4N53A 3TN93 1RUJ2 5JZGB 1QJU2 1RHI1 2HWF1 4GMP0 4CEWB 2TBVA 2WWSA 5BNOA 2HWF2 1RHI2 1DDLA 4QPIB 1AR61 2XBO1 1HRV3 5ACA1 5AC91 4GMP1 1AR62 2XBO2 1OOPA 5ACA2 5AC92 1RUE1 5CFCB 1MEC3 1QJY1 1OOPC 1VRH3 5BNPC 4PDWA 1RUE2 4LLFA 5C4WB 1RUH1 1QJY2 5CFDC 1AL0G 2HWC1 2BFUL 3JD71 3FBMA 1RUH2 1RVF1 1AYM1 5K0UC 2WFF3 2HWC2 3JD72 4CDXC 1NOVA 3IDEA 4RS5C 1AYM2 1VBA1 4CEYC 1NY71 4IV1B 1FOD3 4GB33 4RR3A 4IV3A 1VBA2 5C9AA 5JZGA 3VBHB 1R093 3VBSB 1VBD1 1ND3B 1ND2B 5A32B 4RR3C 1RUF3 2RMU3 1NCRA 1RB8G 2MEV3 1X33A 5JZGC 1AL23 1VBD2 5L7OB 3VBFA 4CEWC 5J98B 2RS13 5DDJ1 1RUC3 3ZFFB 4QPIC 1AR93 4Q4W1 3JBG1 2IZWA 1B35B 4FSJA 4GH4B
chains in the Genus database with same CATH superfamily
2VQ0A 1CZSA 3FLPA 3H42B 4O9GA 1HQWA 2J7MA 3JBG2 4Y33A 1YLLA 1PZ8A 4FPEA 4NAOA 4IE7A 1XE8A 5CFCC 3HNYM 2D5HA 4YVWB 4L92A 3THTA 2NP0A 2AENA 2EA7A 3LSEA 5FY4A 2UY9A 3D3AA 3VHRA 1N3QA 1UY1A 2JDPA 1ZA4A 2PHWA 5FP9A 3QLQA 3WQ1A 1XSRA 4CP1A 4ET7A 5C4WC 3BTAA 1X8EA 4A7KA 4MG2A 2D98A 2E63A 1FPN3 1TMF3 1GFF2 2CHHA 4XQ4A 1A34A 4XDQA 4X6QB 1WMXA 4XJ8A 3I2FA 3SH5A 5M0TA 2VZ1A 2CWSA 2PHTA 3MYXA 4HETA 3VDAA 3IPVA 3TN92 3HBKA 2R7EB 5LRSA 3N9NA 4M01A 4WZFA 1N3OA 3BVCA 3NNJA 2I74A 4R9DA 2GU9A 5FOJB 2J1TA 5I0RA 1QWRA 4I0BA 2FCUA 4FQ4A 5FIXA 1MEC1 2CL2A 2ATFA 3K4ZA 1ND2C 1U5ZA 2QQMA 4COVA 1VBB3 4IERA 4LEJA 1IHMA 1LB2A 1H2LA 4AEMA 3PTYA 2HJIA 4QXKA 1CIWA 5FZHA 4LBQB 1BJQA 3WNLA 1GWLA 1VRH2 2A3YA 2UWCA 1JUIA 2OW4A 1NCQA 2P3JA 2ZJCA 4Z92B 3I59B 5FZBA 2D40A 2A6XA 3H8OA 4GH4C 2WFF1 3WOGA 4B4RA 4ITCA 1GZWB 4K8RB 1CJDA 2WL1A 4BIFA 1W8TA 3W20A 2CAUA 2CYFA 1AYN3 1UU4A 2XPJA 1F31A 2YC4A 3CJIB 1FOD1 4FPYA 3USUB 3VZOA 2WAOA 1PGW2 1AF9A 4YZ4A 2C24A 2O14A 3VDDA 4N8MA 3ZSMA 1GNZA 1GV9A 1H4HA 1R091 4U36A 4YW5A 1CIYA 4GD4A 4MLOA 4JDOA 1WA6X 4GB32 2P6CA 1RUF1 5FJHA 2PFWA 4BQ1A 5FAXA 1REDA 1AL21 4EN9B 3MIBA 1PNGA 3AK0A 1OLMA 3J4UH 5T52A 3OBRA 1DZTA 1H8TB 2FHRA 3A22A 4CTEA 2VOKA 4EN7B 4AK3A 1AR91 2QZ2A 4XFGA 5IWFA 3WD5A 1BVP1 3NSTA 1LU2A 1POV0 1UMIA 1I6XA 3LDBA 5DZEA 3ZFGA 2HBTA 2DDUA 3GHMA 2ZABA 4HXCA 4GZ9A 3P6BA 2B9UA 4XABA 3MF6A 1G9CA 1ASJ1 4LO8A 5CVRA 4CDWC 2RR13 4CEYA 3D4KA 1WGPA 4EJRA 1XXNA 2RHPA 4KWLA 2EXIA 2WNEA 1SG3A 1RVF2 4ZS2A 4HT1T 1WD3A 3W5NA 4XVHA 1BHGA 4CDUB 1KDKA 3VKLA 3CL1A 3H0OA 3PVBB 4FPFA 4CCKA 4DO0A 4LKSA 1LEDA 4OHVA 1JYNA 1NY72 2UYBA 1IG3A 4O9EA 1I5ZA 4GULA 4D69A 3THPA 4LOTA 1NQJA 3AKSA 3WF0A 1ULCA 3IDCB 2QQVA 3UESA 4QPIA 4CUAA 2E7QA 5BNNB 1BKZA 4PT6A 4JGZB 1PK6C 2YC0A 1U5YA 4OLLA 4Z2WA 2EXKA 4FOWA 1J1LA 1Y3TA 2TUNA 3PIJA 4P9YA 3ON7A 4FQZA 4V2VA 4BMEA 3OGSA 5A6QA 3RMYA 1AXZA 4M4PA 3PMEA 3MFCA 5DG1A 2WYFA 5FZGA 4B29A 1O8PA 3KS7A 4HK8A 2JXAA 1F35A 5D1IA 5FY8A 5KC6A 3V56A 4PBPA 1OA2A 3JU9A 2F4LA 1YRZA 4CCDA 1UN1A 1VBC3 1BEV1 5FZCA 1UPIA 5DMYA 4LPLA 4TYSA 2LTNA 4XIKA 4YFZA 5ABJC 3FUQA 4XUOA 3HAGA 2VMGA 3IB3A 3K2OA 1UCXA 2CDOA 4ZONA 2ZGLA 5KXCA 4NIGA 3OD0A 4FOYA 5ERLA 1W6OB 4QQHA 5DAPA 3E6DA 1Z7S1 4WZCA 4OQ8A 1O91A 2HWD2 3AKRA 1SFYA 4FPGA 4AE2A 4HSJA 2HWE2 2UURA 3U4XA 4ZU4A 2WWJA 1TEIA 3VBSA 2Y64A 2Y33A 1N3PA 5FK8A 4CUBA 4LKFA 3T4VA 3BB6A 1MQTA 1HB2A 1OBNA 1HV1A 1QQP2 2WZR1 2Y6KA 5DQ0A 5FMBA 1MVEA 5FUIA 3W21A 4LITA 4P9LA 5FPUA 2AR6A 2EICA 2JJ6A 4N43C 4Y20A 2X5IA 1WCDJ 5F3CA 2RM21 2BNOA 1ZM1A 3DXUA 1B35A 4Y4YA 4QQLA 4AZZA 1LGNA 1QJFA 2EIEA 2WLPA 3ZN6B 3FUOA 5F8PA 1RUI2 4B7KA 2J1RA 1W8HA 2YBSA 3HNBM 2VOXA 4Q4Y2 5BUVA 1OQEA 3AC0A 3J8F1 4Y1YA 1X82A 3NJXA 1COV1 1UXXX 1O3RA 1NZCA 1EAH3 4E27A 5C7GA 2WN2A 5JI9A 2YBPA 4NHMA 1V9U2 1KFUL 3VZMA 2CNAA 1DLLA 1PO12 1H2KA 1UMHA 4RQPC 2AEZA 2R0FA 2QFEA 1IKQA 2B4KA 3GNEA 3NV2A 4UBGA 4AWDA 2FDKA 2JE7A 3R4SA 4KQ7A 2DU1A 4CE8A 4XXPA 4FFGA 4XURA 1H0BA 3KCCA 1QXJA 3ZXAC 2QE3A 3T1LA 2BBVA 5K9YA 1NLSA 2ZGMA 5HXVA 4ASKA 2ZGPA 4W50A 5F3EA 2K2SA 1OD3A 2JD9A 2VBDA 1T2XA 1UKRA 4LT5A 1C8M2 3ACIA 2XKPA 4YVSC 4Z82A 1CAWB 1KS5A 1ZZ7A 4CRQA 1RIRA 2BDRA 4BQWA 1G8WA 2WO1A 4DXSA 2BTVC 5CBLA 1NA1A 1NCRB 1CWPA 2F4PA 2Y6GA 3OGVA 5DZGA 4QGNA 3FFQA 1S2EA 1DFQA 4HOOA 5IJRA 3VBFB 5F32A 2ZAAA 3NWKA 1SACA 3AFKA 4FT8A 4P9IA 4IGOA 5IVYA 4ZXEA 4FVVA 5HV0A 3WUDA 2HWB1 3ZFEA 2QQKA 2PAKA 4J25A 1PGL1 5A3OA 4NIIA 5KHJA 1VBE1 5FYCA 1GNYA 2DU0A 1BMV1 2W92A 5IVCA 3RZMA 3VZLA 3FE5A 3I8TA 3WY6A 3OSDA 1NKGA 1AVBA 3R0RA 3TOJA 1JZ3A 2FMDA 3WNNA 1DQ2A 1VMHA 3JQXA 1PIV3 3H1WA 1O5LA 5GALA 2WNVC 3T08A 1S0GA 1UY2A 3MEPA 4LO6B 2B9VA 3ITQA 2RS31 4QPGA 1W8UA 4RA0A 3KV5A 4DY5A 2ZGTA 1PVC1 4P08A 3AKQA 4S2GA 5A7WA 2JENA 4JDNA 1RUG1 2R042 1SLAA 3M3QA 4UF0B 3FC0A 3U75A 1POQA 5GZEA 5LA2A 2QQOA 4Q1PA 3NNMA 3K51A 5FZAA 3D0JA 3AMPA 5J36A 3K4AA 4AEJA 2EXJA 2H0VA 1AR63 5CEHA 3TB0A 4LUKA 1CAVA 1VRBA 4A3ZA 1C1FA 1W8FA 5ACA3 3QD6A 3GM8A 5AC93 1WLCA 2A3XA 3AYAA 2K9ZA 3CJXA 1OF3A 4IV3C 3SCFA 3ZN5A 2C1FA 5F39A 2WAAA 3V0BA 1VP6A 3POJA 1ODMA 3LIHA 5FUPA 1TG7A 1RUE3 1W8NA 3U0ZA 3P3PA 1FMD1 3SEEA 5JXIA 2RDQA 5K4LA 5A3MA 3NO8A 2RJ2A 1VB4A 1IS6A 3BODA 3LGRA 1ALYA 2EVXA 4DQAA 1AJKA 2DYCA 1PM7A 3GF6A 3O12A 1I9RA 5CYYA 4Q4X1 3LPGA 4LE4A 4WM8A 1F8VA 1ULOA 2PLV1 1SMVA 1BBT2 4EQVA 2AZ5A 5AFBA 4XJZA 1RVF3 4WM7A 5APAA 1U12A 1V6JA 2RJKA 2R071 4MGZE 5GM0A 3JB4C 2A75A 2PN5A 3FHIB 2NZ9A 1X8MA 3BCWA 2PHLA 1DU3D 2RS51 1FNZA 3WNPA 2W0XA 1YIFA 3KGLA 5T55A 3H3UA 3A21A 4NPRA 4MHRA 1W8WA 3OUIA 1WCQA 1DQ5A 2GH2A 3GXUA 5FXVA 1XNCA 1UX6A 1A8MA 3DPRA 4AVAA 1NX9A 3N9PA 3BOPA 3WZ1A 1V0AA 5A33B 5BXXA 4GA9A 5IK8A 1WMEA 3JQWA 2VW2A 3HJRA 3IDAA 2VQAA 4FPLA 4GALA 2IVJA 4AW7A 4C91A 5DXDA 3RZKA 1VE0A 1CAXB 3AL5A 5FV3A 5H9QA 2XVLA 4DEQA 3RJ2X 5CFDB 4IXLA 5EIYB 2P6HA 2AC1A 2G9ZA 3UKNA 3GBGA 1D4M2 2RV9A 3SCGA 3VD5A 3VBOC 1ZRCA 1WCSA 4R52A 3B9IA 2VBBA 2D93A 3AZXA 4QX7A 4ZZ8A 5IFPA 3BTYA 3V0AA 3S7EA 1UO9A 3AB0A 5I8YA 2P3YA 3OYWB 1SDDB 3UYJA 1XQNA 4JKKA 4QWNA 4R4XA 1HB3A 4TLGA 4RS5B 1D2QA 1RUOA 4NRPA 4GWIA 2BERA 4LBJA 1P8JA 2HLEA 2WWUA 4AAXA 4XJ9A 3AKPA 2XB6C 3WF3A 3VDBA 1AX1A 2D6KA 2ZGKA 4XILA 4MVTA 4GWNA 1LHVA 4O61A 4AF9A 5A1FA 1MZEA 3KVBA 4PQ9A 2R062 2VCAA 4N7UA 3MUZ1 1HIXA 1OVPA 1EUTA 5A6YA 2DCKA 2JE8A 4FOQA 3S0MA 5EPAA 4N53A 2P4EA 3MIHA 2O8OA 4AHXA 4B4QA 3SH3A 5JZGB 5LBFA 2JE9A 1BQPA 3BN6A 1GQPA 1QOOA 2NMNA 3WNMA 4TSVA 4ZZ5A 1G86A 5I0UA 1MS0A 3CBNA 2WT1A 4Y5SA 3ZYIB 4EROA 5FDBA 2IXJA 5LBBA 5A7PA 2JG8A 2RVAA 5H9RA 3H9AA 3M7AA 4GMP1 4KNCA 4CCLA 2XBO2 3IM0A 4OUSA 3VD3A 3ORJA 3WDUA 3WLUA 5J1XA 5CFCB 3E1F1 1MEC3 1RXGA 1MPXA 1OA3A 4Q0PA 3UV9A 4YW1A 2TEPA 3M1HA 1QJY1 4NRQA 3VN4A 5IT6A 3QCWA 1NZIA 1W2NA 3LWCA 5FXXA 3ZYHA 3SHRA 1O3TA 2QJVA 4KI5M 2K0GA 4E4HA 5C4WB 5EQUA 2KD7A 4C0BA 4DIQA 3JD71 3IT8A 1BLZA 1JH5A 3PIGA 1CONA 2Q0AA 4MGYE 2ZOEB 5A80A 1CJPA 4LHLA 1RUH2 1WMDA 3RZJA 3N4MA 4JHTA 1HJFA 4JHZA 3RWKX 2WFF3 3SISA 4XF1A 3RJRA 5JXJA 1QOTA 2GNDA 4LMFA 2AUYA 3HBZA 2A6VA 4XZPA 3O0WA 1FAYA 1E5SA 4S2HA 2GMEA 1APNA 1KJRA 1AYM2 2I2SA 5CKQA 3TAYA 4AGGA 3O1VA 1FXZA 4CEYC 1UYZA 3HR9A 5LW9A 4LKEA 1FOD3 1RXFA 1VMJA 3ILNA 4COYA 3RMXA 2IC1A 1VBA2 1N1TA 3J7HA 4BDVB 1R093 5CB7A 1VBD1 4RL7A 2W95A 5A1AA 4NHLA 3ZN4A 2ZACA 1G9DA 2C4XA 1ND2B 4Q1RA 2A7AA 1QH7A 3N7KA 3L2HA 5F3GA 1RUF3 1PNFA 5T50A 2EIGA 3T2TA 1RB8G 3U4SA 3MF9A 4PI2A 4AI1A 4QMAA 4HKLA 1ZRRA 1AL23 5IVVA 2CDPA 4IDZA 1AXKA 1SBEA 1UOJA 5A3TA 4UBHA 4S2DA 5FYHA 4IE5A 5B2GB 5FY7A 5LEKA 4HBNA 1XYNA 1UY3A 4QPIC 1AR93 4XTPA 3JBG1 1D2SA 1BYHA 5A3NA 4GH4B 2PQSA 4MHUA 3OBAA 5DDJ2 3TEZA 4Q2FA 3VBUA 5FPAA 5FMCA 2XH6A 3B93A 4LIVA 2Y0OA 4Q4W2 1UOGA 5FY0A 4MXWB 1QJEA 1ASJ3 3ZM8A 2WA3A 4G4FA 4WV8A 3U07A 5FLIA 4K3UA 4CCNA 5DAWA 3FHQA 5FYYA 5C8CA 4LKDA 1ULPA 3I3QA 2BZDA 3MO4A 4PBOA 2JX9A 3ST7A 4CP2A 4EE2A 2R072 3NAPA 3SCHA 4PIZA 1LEMA 4DS0A 1QY4A 4KWUA 3TN91 2VCBA 2ZX2A 2VZTA 4AEDA 2FZ1A 1K3IA 3PLQA 3RZLA 5CG8A 4URTA 1XNDA 5A3UA 2D6MA 4FPHA 3DKWA 4CU7A 3BKZA 2UU8A 1N47A 3OCPA 4J1XA 4OI0A 2WSVA 3ZYRA 2VQUA 1W6QA 1K45A 4PLNA 3IWZA 4IL7A 4INDA 3VBHA 3CZJA 3RI8A 2BGOA 3WG2A 5FZ6A 1ND3A 4OUMA 2OS2A 1C57A 2XGXA 1J58A 4IETA 1WZXA 2WIIB 3O5SA 3ZKUA 2Y0IA 3WP6A 3VBSC 1GKBA 2W3JA 4CDWB 5L7OA 1JZ2A 4OZXA 4EZHA 1E5HA 1KFXL 3B02A 1UKGA 2B46X 4LBOA 1PMHX 5GZGA 1S0EA 1NYWA 5FZ1A 4QGLA 5DPNA 1VRH1 2YPJA 1Q43A 5JSPA 2FDIA 4KGQA 4MXVA 3OPWA 4MSVA 5J09A 4FO9A 1BEV3 1SPPA 1DZRA 2DUOA 2JG9C 4NPMA 5GLVA 2NQYA 3BU0A 3L9JT 4XQDA 1XOYA 2ZEXA 2XHNA 1B35C 1WLTA 2P1BA 4QHBA 5ANNA 3WDVA 4WVMA 4AHYA 5T5LA 1SQ4A 5J96B 4MX3A 3C8XA 1F4HA 4JVAA 4OYUA 3PUQA 4AYUA 2ZEWA 4YVWA 1LU1A 5F5QA 1PGW1 4UFHA 3T2PA 4IW3A 2BW8A 1LGCA 4AVSA 1YQ5A 1JZ4A 1Z7S3 5JR2A 1PK6B 1DYKA 2JKBA 4GB31 4LORA 4OHYA 5EHDA 1B09A 4Y24A 4YZ5A 3POWA 4UW5A 2DCJA 1JN2P 5FMDA 2BNNA 3VKNA 5KR7A 2Y6FA 3H8XA 3WINE 4FAHA 2FMYA 2VD7A 2Q8OA 3A23A 1ZVFA 5FREA 1F5FA 3OJBA 2WZR3 3PDQA 5BNPA 1QKQA 4IGQA 1S1AA 1BCXA 1CZVA 2A70A 1ZZ8A 4MADA 1F9KA 2QDNA 1TNFA 2RMU2 4H7LA 4YG0A 3RDIA 2MEV2 4AAPA 2ZXQA 3K3NA 5ABJB 4D7SA 1OA4A 2RM23 2RS12 1SZBA 4PJYA 4NOTA 5K0UA 1QDCA 3PVNA 3M3EA 1RUC2 4CDXA 4XOGA 1GANA 2VUCA 3DEMA 4KU7A 4ORFA 3J8F3 5FZ3A 2ADDA 1COV3 1OURA 3CQOA 1R082 1JBCA 2AACA 2DF7A 2QDRA 2V4AA 4A42A 2I07B 1H8VA 1LJ7A 3ZMNA 2LW8A 3DGTA 4QX2A 5F5AA 1R64A 4QDRA 1UOBA 1XU1A 4UAPA 5KXEA 4BXSV 1GOHA 1OVSA 2WNUA 2C6SA 1O4ZA 2NN8A 1V6IA 4GJYA 4GQ7A 4XCBA 4B1LA 4DZGA 1WCUA 2JDUA 4FPKA 1QNWA 2YG0A 3Q8BA 3O0VA 4H3WA 2CAVA 4BCUA 1J84A 1LOFA 3OGJA 1S0JA 4CEWA 1WA4A 5F1RA 4B4PA 5JSOA 3USUA 3EHKA 1HRI2 1W6PB 4YG6A 4N43B 3KZ4C 4NHYA 4CCJA 3RQ0A 2NMOA 3AP5A 2ET7A 2FCVA 2VMEA 4LO5B 4I3GA 4QX3A 3S6PA 3GZEA 4FCAA 2XMLA 4QKBA 5LATA 3AMNA 2V73A 4QPGC 5FY1A 1ODNA 4F7ZA 1YCIA 3CF6E 5JIUA 2A73B 1QJZA 4AR2A 1W6MB 4QPWA 1AX0A 1U0AA 4XUQA 2VOTA 1Q56A 3WNXA 2KXLA 5I0TA 1H8TA 3C2UA 4COUA 4NIAA 2E9QA 1BK1A 5LBEA 2DWRA 1H9PA 5IVFA 2YU1A 4RQPB 2Z42A 3WCSA 4BQ5A 5JOZA 3MIFA 2HWB3 1C5HA 5JOWA 1EPWA 1PX4A 4YM1A 2Y60A 1W05A 4F3JA 1VBE3 1UWWA 3MGUA 4KG8A 5J3UA 1LHOA 2VNGA 4E4SA 4AFBA 2HWD1 1LOAA 4YG3A 2JB8A 4UW6A 3PMSA 2XL9A 1PX3A 4HVQA 1GSLA 4YVSB 2HWE1 1CAUB 4C8DA 4EWDA 2WRAA 4IV1A 4YGBA 3WP3A 4A3XA 2BPA2 5J37A 2XG3A 4Y26A 3NV4A 2RS33 4JTOA 1JZ8A 5AVPA 2TNFA 1PVC3 1QQP1 4WM8C 2IFWA 1UU5A 1RUG3 2QQWA 3ES4A 3MFAA 2QBXA 4QU1A 3BPSA 3POSA 1OFNA 3SQOA 2I45A 5LRRA 4WM7C 3K48A 3U14A 4NHXA 4AI0A 4C1XA 5CA6A 2JDMA 2WO3A 2ZPXA 2OYZA 1NLRA 1ZBA2 3B9CA 4AI2A 4DNYA 1S0BA 4Y22B 1AJOA 1DBNA 4E8CA 3OF1A 1RUI1 2WR9A 4Q4Y1 1J1TA 2XDVA 3GGLA 4AQ6A 3LOIA 4B7EA 3KM5A 1F2NA 2YPDA 3A7QA 2DVFA 4HLTA 2LS6A 4I3PA 5D8AC 1VR3A 2ILMA 2W9XA 2WZEA 3LKJA 3O14A 3PUHA 1V9U1 1FMD3 4CU9A 3R4DB 2WNVB 4ZHNA 2H6CA 1PO11 2VVEA 2W52A 1TVGA 2QVSB 4XMAA 5FR3A 3NJVA 4E4ZA 4XETA 4AXOA 5T54A 2ZMLA 2PAMA 4Q4X3 2YU2A 4BWOA 4K1ZA 2D44A 4WVVA 1W9WA 2PLV3 4LBLA 3O1PA 4K9SA 2UY8A 1AR82 1I3HA 1ZBE2 2VZUA 2XJQA 4RSUA 3N9QA 4MZUA 3LSDA 4QM8A 2B8MA 4A6OA 4W6XA 1C8M1 2GSYA 3Q8AA 1E5IA 1AR72 2B42B 1L7RA 2HKXA 2RS53 2XQRA 4XYXA 4Q4V2 1TZOA 3NL1A 1RUD2 5J7MA 1Q8QA 2RDNA 4XIOA 4IV3B 1LOGA 2ZHNA 2MHFA 2VVFA 3H8RA 2AYHA 4I30A 3C7HA 4JGYC 2XUMA 2ZA9A 4IE4A 2E7TA 3OEAA 3RZZA 3WCRA 2OUHA 4L8QA 3AYDA 4N53C 5E6HA 4OMDA 2GZWA 4BQYA 2PHXA 1HXS2 5F5CA 1JMUB 2DCYA 1H1IA 3I3EA 3KVAA 5DABA 5DAVA 5A6XA 1C3HA 1JU3A 5L9VA 1C4RA 4HANA 2Q4SA 3PJQA 4O7XA 3CEWA 5CG9A 2GMMA 2WS92 4ARYA 4XEZA 3MUY1 1Y9QA 2IXLA 3LIGA 1NG0A 2LUWA 4LA2A 4KBZA 4EWAA 4NIHA 5EWSA 1QF3A 2ZX1A 5FJKA 1US2A 3MLLA 2R041 1HV0A 3BOWA 4FFHA 4XJUA 5I0DA 3AJZA 2VH9A 4I2OA 1NE4A 3CLPA 4B1MA 2RDSA 2XJRA 3AP6A 1YQ2A 4LO4B 5GLZA 2HBUA 4MGSA 2Y34A 2YY1A 4PLOA 1PM4A 2GDFA 2V72A 4LNVA 2XKOA 2VPVA 1UQXA 1V70A 3HQRA 2D5FA 3KT4A 2HH9A 1VLNA 3GDBA 1JZ7A 2EAKA 3IPVB 3KGZA 4URAA 3VBOB 1OT5A 3DL3A 4M3CA 2BU9A 1W6NA 4U2AA 3IMNA 5F2WA 4AGRA 4BQXA 3N36A 4L99A 4GMP3 3LEKA 2E51A 4X8NA 2GC1A 5AFEA 1O4YA 2PTMA 5CISA 4YW4A 1R1A2 3A4UA 1WD4A 4M3CE 5HCBA 2V4VA 1T6GC 2E6VA 2A1XA 1QJY3 1QMJA 3VBRC 4GWMA 1URXA 3MHZA 3O1OA 1EPZA 4ASLA 1BBT1 2VBPA 3PUAA 4XQWA 3ACGA 3IIIA 2WINB 1PZ9A 3U1XA 3WR0A 3DUIA 4A7ZA 1TME2 3OEBA 4BU2A 3JD73 3SLIA 4DY3A 5LZ6A 4OI1A 2VCMA 3ZYFA 5HBAA 4BQ2A 4BQ3A 1ZRDA 3C3VA 1XB9A 4YWAA 3S5QA 1LOBA 3E97A 3VBUC 3WEZA 3MIEA 3H50A 2YMZA 5KHHA 4CA9A 3AYCA 4JDMA 4AFCA 1CESA 5LY2A 1Y4WA 3WX5A 3ZX7A 1UOFA 5A70A 2ZAHA 4NAMA 4PCRA 4LBMA 3FL7A 1RMU2 1ZNPA 5C8CC 4QX5A 4UW4A 5C3QA 1UW8A 2GC0A 4UF0A 1DGWX 3UL2A 4EWEA 5ANQA 2DV9A 2JDKA 1IS5A 1VBD3 1LTEA 3ILRA 3KQRA 5A1LA 1X36A 4UFMA 4HK9A 4EV0A 2OXBA 1QJX2 5I93A 4QKDA 1UY4A 1XNBA 1VJ2A 3TNQA 1D4M1 1DIWA 1GZTA 4YZ3A 5SV8A 3VGIA 4AEDC 1RINA 5JXHA 3UT0A 4DOUA 1OKQA 3ZXJA 3C7GA 4NHKA 4YW7A 3NJYA 3POGA 1UNBA 1A78A 4OULA 3GZUC 4GKXA 1YNAA 2ORXA 4QXHA 3T2OA 5E88A 4BISA 4JZRA 1CPMA 5FZ9A 3JBG3 2Q1MA 2VNVA 2X10A 2WQZC 1JYXA 4D7YA 3D5OA 1PO22 5FYVA 3SKVA 4A6SA 4MGQA 2KA3A 3GHNA 1ENSA 2ZKNA 4HG6B 1LR5A 3RYRA 3VKOA 4CEYB 3AJYA 4QD2A 2JDHA 4DB5A 3RG0A 2R061 2BV4A 3I97A 4QB1A 4RFT0 3CU7A 3BIEA 4RHV2 3RZHA 2ZHMA 1NUKA 1YI9A 2XVKA 3N9LA 2ZGOA 4IEZA 4Y4RA 5FMOS 3ZSJA 1WW7A 3O1RA 3THDA 1WW6A 3I2OA 2BWCA 2HEYF 3NV1A 2ZGUA 3ROUA 5CIRA 3NMBA 3I4IA 4BZ4A 2Q30A 4KL1A 4BK4A 3TN93 1RUJ2 1QJU2 4P02B 2B5HA 2VZPA 4PIYA 5FKCA 1SHWB 2ARBA 5A7SA 3ZLIA 2TBVA 4BXFA 5C8WA 5BNOA 2HWF2 1RHI2 1DDLA 2CGOA 4QPIB 1O6UA 1PVXA 3H8UA 4PF1A 3IDBB 4Q27A 2XBO1 4DPNA 4AI9A 4YFWA 3K46A 5FK7A 4BE3A 4FPJA 5IVBA 4QB6A 1IKPA 3AZVA 4V1PA 2FDJA 3PNAA 3W9AA 4E2SA 3I3BA 5GZDA 4A45A 2X53S 2WC2A 1HQLA 3E6BA 4BLIA 4CCCA 4AVBA 4DXTA 4ASMB 1CAXA 3GCXA 2VUDA 3LA7A 3KV9A 2ZEYA 3ZSLA 2GC2A 1S55A 1ZZBA 1W2TA 5C3PA 1IS4A 1OQDA 1OOPC 3O1TA 1VRH3 5BNPC 3KB5A 1UY0A 4PDWA 5FLHA 5FP8A 3POYA 3CMGA 1KGYA 1RUH1 4QAWA 1QH6A 2ARCA 1OLQA 4JV4A 2BFUL 2PHDA 1EUUA 2WT0A 3FBMA 3KQ4B 4F83A 2VW1A 5BYNA 1MZFA 4ISRA 2GMPA 4KG0A 4HN0A 1AYM1 2ZBJA 4WVWA 3BIWE 4Z8BA 5K0UC 5CU1A 1BVVA 2HWC2 3AL6A 2E26A 1ULEA 1W8ZA 4IQPA 4CDXC 2DTWA 1NOVA 1Q3EA 1WBLA 2G9FA 2YXSA 3K77A 1CQ9A 1XYPA 3D8CA 4X8PA 3T3YA 3MZHA 5FO7B 1VBA1 1SLLA 1O59A 2BJSA 3VKFC 3ZR6A 2L9LA 4GB33 2OVUA 4QQ2A 4AFAA 4RD7A 4DMIA 5C9AA 5JZGA 3VBSB 4FOVA 3WG3A 5IK4A 3HVDA 3MIGA 4PLMA 3BU7A 1C1LA 4UYBA 3SITA 1H9WA 2WNUC 4RR3C 1NXMA 4M3CF 2NLRA 1QU0A 1YJKA 1STMA 5FCCA 2E31A 3RSJA 4OQ9A 3J7NA 1UZVA 3AXEA 3I2DA 5JOXA 2QZ3A 3SMHA 1LOFC 4CEWC 3ACFA 5FQ0A 2WT2A 2JG9B 5DDJ1 5C5TA 1W3VA 2VG9A 1S0FA 4Y20B 3G6JB 3B01A 4Q4W1 2IZWA 1B35B 4MH0E 3N9OA 2VUJA 5A7QA 2DUPA 4K8FA 4CCOA 1KD7A 2Y6LA 1WCKA 1YYNA 5FPBA 2WJSA 3WP4A 1W2UA 1OUXA 3F2ZA 4GXLA 1EYBA 2W2IA 3ZYGA 1XPWA 4QDSA 5SV5A 2GN3A 2R6QA 3LEGA 3LPFA 1AUYA 4PI0A 3BTXA 5FP7A 5KBFA 3GJBA 3HN1A 4HZFA 1CD3G 2ZS6B 3ENRA 1O8SA 3VB9A 3FN9A 4NE9A 3CIHA 5A6ZA 2YHJA 1EV12 1LCLA 2PELA 1GU3A 4GJZA 4YGCA 4KH9A 1Q8OA 3KF5A 4IGPA 1JODA 3N3HA 1YQCA 5CNAA 4DFSA 1A6CA 1KITA 4QT6A 2OKXA 5E1RA 2VOVA 1W8OA 2DBIA 1C5IA 2RJLA 2SBAA 5EFUA 4HVOA 4IV1C 1UZ0A 5FYZA 3HEIA 4AHWA 4KWJA 1K5MA 4QXBA 1HRV2 2DCZA 3LAGA 2QCSB 4BQ4A 4CDQA 3VD9A 4R4ZA 5HCFA 1HW5A 5CKMA 3Q8CA 3MPPG 3ZDVA 2VXRA 3QOPA 2VZOA 1J83A 4N9IA 3I3DA 2MNGA 3NNGA 4IEOA 3T4HB 4BA6A 1CR7A 2PMWB 1UIJA 2CY6A 3R4UA 2P3KA 3POBA 4LIUA 4QHZA 4B8EA 4FAGA 3KF3A 3POEA 1OF4A 1IG0A 1N1YA 2G1MA 1DCSA 4FPOB 4UFKA 4XMIA 5F2SA 2N7GA 3ILFA 5JR7B 3LOBA 1YFYA 3MLJA 1UX7A 5KC5A 4P00B 2NM1A 2HWD3 2LM3A 3N7MA 4XZUG 1NCQC 2J22A 3WG4A 1QEXA 5EP9A 4KGGA 4NROA 2NPIA 1US3A 1VAKA 1D4VB 3THCA 4E8DA 2HWE3 4DUXA 1JHJA 1PHMA 2XJUA 4XBQA 4UT5A 2P5BA 1JOPA 4BPZA 3W59A 3AXDA 1YFUA 2G4IA 1R1ZA 1OPOA 4QPGB 5DZFA 5FYIA 5JPMB 2VAUA 4OVEA 4EZ4A 1ENQA 5JI7A 1QQP3 2VOWA 1X9TA 3D82A 3H1MA 4CZSA 4JAAA 2RE9A 2BOIA 2GH8A 2RMU1 1ONAA 3VDDC 2MEV1 1UZYA 1WKYA 4MUVA 5K8SA 3HIFA 1XYOA 2CGNA 2AEYA 2RS11 2DUQA 4YGEA 3MW2A 1ZREA 2XL7A 1BXHA 1Q8SA 1QHDA 1SLBA 4YLZA 1RUC1 1RUI3 4NN0A 2K46A 4XHBA 3AP4A 4Q4Y3 4G9SB 2OT7A 5A3WA 3ZXFA 1UAIA 3NKTA 3V0BB 2G19A 4I0AA 1R081 2VMCA 3ACHA 3HN3A 1ZYBA 5FYMA 1V9U3 2P34A 4HSLA 5DUXA 3ZFGC 1GICA 1PO13 3FWEA 1NT0A 1LECA 2ENRA 1W0PA 3X29B 3POIA 3IBMA 1HJGA 3EB7A 3N9MA 1MS4A 1YQ6A 3AZZA 3MPBA 4WM8B 3SNMA 3USSA 3VHPA 2WBKA 4OMCA 4R8HA 2ZX3A 3VZKA 4OI2A 1CGPA 4Q0VA 3OBTA 2OPWA 3ZDSA 1T6BX 2XXZA 3S57A 5LY1A 4WM7B 2F17A 1UD1A 4GKYA 1HRI1 4IEUA 3V65A 3E5QA 5C3RA 5F3IA 3WDXA 4RFRB 5IHRA 3JXSA 1CPNA 1H6XA 4HONA 1C8M3 2D6LX 3D6EA 1FPN2 1TMF2 5FYBA 4KWKA 1OI6A 3AP7A 4YM0A 1CVNA 2BOJA 2J1EA 2E53A 3RGBA 1S0IA 2A6ZA 4N7IA 4LHSA 2OA2A 3KV6A 5IVJA 4P9XA 1QDOA 2XOMA 5D8AB 1ENXA 3MLKA 4I01A 2Q8EA 3IN9A 4LE3A 2YV8A 1K5JA 5FPXA 3TNPB 3FFZA 3VD7A 4QU2A 4FP3A 1DYPA 1G6NA 4XJAA 3HQXA 4ZY9A 1S2KA 3VL8A 1XNKA 1RC6A 3N7LA 1W03A 3DYPA 4D6QA 5HCHA 5FZDA 3HQUA 3I2JA 3J7LA 4TXWA 3UJQA 5IUQA 5JPNB 5K7PA 4FXGB 3RYPA 5ABJA 1W9SA 1ZA7A 1KEXA 4SLIA 4XACA 4F8AA 5JXGA 5IK7A 1ST8A 2H6BA 5B4XA 2ZCWA 3K4DA 3QH7A 2P2KA 1VBB2 2Q5TA 2F6BA 3VZJA 3E6CC 4YM2A 1FX5A 5FZOA 3LFIA 3Q8EA 2DVAA 3WQBA 2VU9A 1O5UA 4I0WB 3ZXKA 4AHZA 3ZXEA 3HWJA 5JOYA 1TE1B 4YW2A 1SFPA 3M2MA 1M4WA 4HPKB 3MI8A 4D6RA 3ZXDA 2R043 4CUGA 2VY0A 3K3OA 4JGYB 1ZRIA 2W87A 5GJ6A 1AYN2 1UYPA 3ZXGA 1JI6A 1PMIA 3J9SA 2A71A 5I8TA 2QQIA 4N53B 3WVJA 1W06A 2EF6A 4NRMA 2CV6A 4CP9A 1ZBA1 5LWBA 5CADA 2JDYA 5C3OA 1GYKA 4BHPA 5A32A 5DN2A 2W1UA 3ECQA 3I3MA 2V09A 3OY8A 4I02A 4QDQA 1CZTA 4N43A 4FTSA 1ZZ6A 3H1YA 1SLCA 4AEKA 2C9AA 2WYSA 5DUWA 4I09A 4TN7A 4UFLA 4AI8A 1MQTC 5DAQA 2XHKA 1QXRA 2BNMA 3ZFFA 1KRIA 3AYEA 3WF1A 4GWJA 2Z69A 4NPLA 2WO2A 4GIQA 1IS3A 2J1UA 1IPSA 1ZZCA 2X5IC 1W90A 3KCXA 1H1AA 4E2QA 4QQPA 4A41A 1MS5A 2QNKA 5FO8B 1NQDA 5HPOA 1G9BA 3R05A 4XPVA 5JDBA 3LA3A 4AVCA 4CU8A 3GJAA 3ZYBA 4C0HA 3UK9A 1BBT3 1HLCA 1OLRA 1XU2A 3M8LA 1AR81 3C7FA 3IAPA 4PIXA 5T5OA 5KXBA 4XFHA 4E4DX 1IGOA 1ZBE1 2RR12 4LULA 3ZSEA 3MBWA 4OFGA 1GOFA 1IQAA 1CX4A 3U10A 1AR71 5HXMA 4HL0A 4XDOA 5FFOC 4Q4V1 5L36A 2DURA 1LAJA 1RUD1 4FPCA 3DF0A 2E7AA 4AL9A 3BGAA 2VTXJ 3URFA 1SCSA 4Q8KA 2ARXA 4SBVA 3A0KA 5T3NA 1UZZA 5LCWL 1L7LA 1WLWA 1FV2A 3AX4A 3VLBB 2P37A 3LEMA 4QM9A 4J6GA 3WW4A 3T0DA 2P3IA 4IE6A 5FYSA 1J3PA 1HXS1 2VE1A 1SLIA 4XAAA 5C3SA 3VBRB 4XW3A 4LJHA 4CYDA 1VALA 4HKWA 1D4M3 5FTTC 4Q0SA 5GLWA 2JEMA 2A3WA 3ZIXA 1V6LA 2QQNA 1NA1C 4G3YC 2ID4A 4ZPIA 5BNOC 2WS91 1ULGA 2BVVA 4LK6A 4A7YA 1POV1 4FI9A 1AZDA 3CNAA 3PVEA 4LBQA 1CX1A 1A3KA 3GALA 1QGLA 1BZWA 3VBUB 3AZYA 1WWYA 3I59A 5FYTA 1VBC2 5KWRA 4Q26A 5L19A 5DUUA 3NKGA 5L9BA 3ZFEC 4WBBA 1YXWA 3MV11 5A7NA 1JZ5A 1GZWA 3NQHA 2R063 5DUVA 2LROA 3PUIA 4XUPA 1H30A 5C8CB 5H9SA 4IEYA 3CJIA 4PDWC 2C0ZA 4D8MA 1UU6A 4COZA 5FBZA 3HMYA 5HV4A 3LDRA 1ZRFA 1SFNA 1V00A 2BVBA 3NAPB 3TWIA 1AXYA 1SBFA 3KMHA 1LOEA 1XC6A 2YBKA 3LQCA 4MGKE 4P9GA 4AEDB 5F7UA 2JDZA 2VO5A 4XFAA 3SH4A 2GNTA 4IEVA 4K7JA 5D2AA 3NNFA 1YJLA 5JLVA 1VPHA 2R32A 1EY2A 4NWWA 1W6QB 5F37A 4TTGA 2XBO3 3MIDA 1R1A1 4W6WA 2ZMKA 2D6OX 2YDEA 2JICA 4JRLA 4QB2A 4P9JA 3AP9A 3PURA 1O7FA 2VJXA 5C9AC 3KD4A 3B5LB 2W46A 3RYKA 5I0SA 4MO3M 1SDWA 3LD8A 4R9AA 4IEXA 5IYYA 3HD8B 1TME1 1OH4A 5LK7B 1L7QA 5LASA 2D3PA 4RYDA 4CXWA 2DFCA 3SXWA 5FO9B 1RUH3 2VVDA 1SPPB 4LK7A 1LESA 4W6YA 4LHKA 4XFIA 1EAH2 4CDUA 1DGWA 4WVZA 3T2QA 2XJVA 3JCIA 4AGVA 5L73A 4DUVA 2LALA 4WVMB 1AYM3 2A6YA 2BBAA 5GZFA 3UETA 2XJTA 1RJ8A 2DVGA 4MYEA 2X29A 1KXGA 3KLSA 3PU3A 1YEWA 1W9YA 5EZWA 2P17A 4NUBA 4YPJA 1RMU1 4A4AA 1NLQA 1VBA3 5FZLA 3KSCA 1S0CA 1GNHA 4ZU7A 1QJX1 5BNNA 3RVHA 4JGZA 1YFWA 1W9TA 2WKKA 5FXZA 2QUOA 4FTBA 4MGIE 5C6CA 2JD4A 1JYVA 3WT3A 4QQOA 1XRUA 3DPRC 3DV8A 1OOPB 3A0NA 3NRUA 3OG2A 3VBOA 1YI7A 2PHRA 5FPVA 3ZO0B 5BNPB 2AGSA 1WLDA 4Y5Z0 1CN1A 4FFIA 1ULFA 3ZPOA 4CCEA 3QBQA 4E2GA 5DG2A 1JYCA 2VNOA 4NIDA 4YZ1A 5FP4A 2YFZA 3C7EA 3H7YA 4JQRA 5DDJ3 3I49A 1PO21 2ES3A 1VIWB 1LHUA 1DGLA 3BI3A 1YUDA 4Q4W3 2Y38A 4CUCA 4L2NA 5K0UB 2BFUS 2ADEA 4XJWA 2VGDA 1DHKB 1WW5A 2XUEA 1N1SA 4CDXB 4Q0QA 4XUNA 1X50A 3PJYA 4RHV1 4NWVA 1K5MC 5I91A 1BK0A 4CDQC 1HDKA 2BRTA 4L11A 3R6SA 3VHOA 3GZTB 2R073 2R1DA 1W6OA 1W28A 4YGDA 1JXNA 1NXD1 3LA2A 1RUJ1 5ISLA 2PAEA 1QJU1 2VULA 4W4ZA 4X6RB 3VZNA 3M3OA 3T0BA 1PIV2 2BP6A 1EP0A 2W1SA 3K75B 4XF3A 2WNUB 4RR3B 1OH3A 2ERFA 3RWNA 1GLHA 2HWF1 1RHI1 3PHMA 4CEWB 2OQ6A 2W47A 2XLGA 4HN1A 4LO7A 2WWSA 1WMFA 1OD5A 2FBEA 4QX8A 2O0OA 1D0HA 3UGFA 3JUUA 3H3ZA 5BY5A 1KJLA 2R16A 1Y9MA 2PA7A 3Q8FA 3UGGA 4EYUA 3FJSA 2FDGA 1AR62 1SLTA 3BPZA 4E9KA 3NJZA 2Q1FA 3CZUA 3J26N 3N7JA 3WW1A 3ZN6A 4BOWA 5AC92 5ACA2 2JG8C 5IAVA 4OHZA 3I54A 3MV01 5IK5A 3CDZB 4UOJA 3O1UA 1XBFA 4FXKB 3ZKYA 1O3QA 1DQ1A 4S2FA 4DRVA 5C33A 5DAXA 2Z4FA 2RDRA 1RUE2 4LOSA 1MS3A 1YIPA 4HVRA 1OLME 3DN7A 1AL0G 2HWC1 3HNMA 2ZHKA 4PF5A 4LHNA 3ACLA 2GALA 1S4CA 5IFTA 1V6OA 2G9GA 4CSWA 4QKFA 3ME2A 4IEQA 1OKOA 3ATGA 3OUHA 1JHNA 5FZ7A 4AI3A 3W5MA 1JYWA 4PQQA 5FLJA 1QOSA 2ZHLA 1XNAA 3IDEA 4BYYA 4D94A 3S30A 1V6MA 4D0QA 4IV1B 5A7OA 3Q9OA 3UKVA 1RITA 1C28A 2C5DA 2HEWF 4XF0A 5LB6A 2X8KA 3UNPA 1CAWA 4ATEA 2VZVA 3J7MA 1QXPA 3LDKA 5FZMA 1ULDA 4LQRA 2WO7A 2HYXA 3IIAA 2VR4A 1DF0A 1GP6A 1NCRA 2RMU3 2FQPA 4B3NA 5JMCA 4CVUA 2MEV3 1H4GA 3ZYJB 2EALA 2W39A 2DTYA 3VBFA 1SCRA 2RS13 3B00A 1REEA 2ZKLA 4PHZA 2GAUA 1RUC3 1LNSA 3U37A 4M00A 3LZZA 4FSJA 2J1AA 5F6KA 4Z2AA 3O7OA 4OI4A 1K12A 1MS1A 3GYDA 1OMIA 3QH6A 1NCQB 1R083 4JQTA 1HQNA 3H3LA 4BIOA 4YZ2A 1YO8A 5I8SA 1W0OA 2Y26A 5EJZB 3PTRB 1YWKA 4XF4A 1K42A 1VAMA 2C26A 2D6PA 2OIIA 5EV7A 1E5RA 1NAEA 3AVRA 3GBFA 3DKQA 1EV11 5FZKA 4HMZA 1YQ8A 4D7TA 3ZR5A 4DEVA 3GBWA 3KWVA 2JIGA 3VDDB 2QTWB 1HRI3 2PYTA 4UI9L 4XTMA 1FI2A 1DQ6A 4Y5TA 3NAPC 2D97A 1ZX5A 1HKDA 1F15A 1OFSA 5GKAC 5FRAA 3RI9A 1JUHA 2QQLA 2YC2A 4K1YA 5FWEA 2HYKA 5LA1A 3B69A 3OPTA 1HRV1 3I2KA 5B4NA 2QQJA 4K6BA 2V5DA 3D0SA 1G9FA 5FZFA 1IOAA 5FY9A 5GZCA 1ACCA 2D43A 4CXXA 3VBHC 1H2NA 1OC1A 3B3QE 2EIDA 4K20A 3ZFGB 4CPBA 1N1VA 1ND3C 2WZ8A 1Z0HA 2YFUA 2JG9A 1C8NA 2IXKA 3ETPA 2KR2A 2DCTA 2GP5A 1SBDA 3KHBA 1MEC2 3W58A 5L7OC 2VCCA 3M3IA 5IVEA 1KQRA 1GOGA 2CGPA 1LULA 4Z07A 4YM3A 3ZFFC 3IAQA 1XJAA 5FY5A 3AFGA 2ET1A 4Q8LA 4AVVA 3ZPYA 2BGPA 4ISQA 4NO4A 5CAZA 2XQXA 3CO2A 2XR4A 2ZZJA 1SEFA 2RG4A 4IEPA 4L9BA 4XHXA 3FLRA 3S5AA 4Y1VA 3PU8A 3WF2A 2WFF2 2XJPA 3KT1A 4LXLA 2WDBA 3RPQA 3P5BA 4AQTA 1NE6A 4KBBA 4YVWC 4KMQA 3H7JA 3M4FA 3UKTA 5JUVA 3I2GA 2BYVE 3AZWA 1FOD2 5A33A 4L97A 3RFRA 5E16A 1O4TA 2X09A 1ZBA3 2WSUA 2OZ6A 1R092 3MDPA 3SC7X 2YGMA 5EJ3A 1IPJA 4H14A 4P5YA 2ZGQA 4M3CB 1HB4A 1QIQA 1RUF2 1X7NA 1W6NB 2D3SA 1Y43B 2QQUA 5CFDA 2WLQA 2XLFA 2JECA 1AL22 1OSGA 5BNQA 2ETEA 2PHFA 5T5JA 4BM8A 1WUVA 2HEVF 1ENRA 5FKBA 1MACA 3OYWA 4JCKA 1YFXA 1AR92 2ZMNA 5FXWA 3TEXA 4AFDA 1U5IA 2BUKA 5C71A 2VUAA 4RS5A 3OD4A 3ALQA 2B7YA 3DYMA 2WQ4A 1UF2C 2OZJA 2VQTA 4QHOA 3ZSKA 5BV6A 4AQ2A 1AR83 2DVDA 3UGHA 1ASJ2 1ZBE3 5FOBB 4H7MA 2IXIA 4EN6B 3APBA 4IE0A 2CWMA 1Q8PA 4TLFA 2B39A 1FPN1 1AR73 1LGBA 1TMF1 4YW6A 2VMDA 1HX6A 4Q4V3 4DXRA 3ASIA 4MGTA 3EMRA 3VL9A 1VAVA 3FBYA 1RUD3 3WSOA 3BTZA 3U11A 1GZ9A 1OUSA 1XE0A 1ZZ9A 1GBGA 1KS4A 2NYYA 1MQTB 1D0GA 1VB2A 2VM9A 4Y1ZA 1KDMA 4XBNA 4OHXA 5FBJA 1FYUA 4FP2A 5IW0A 4BH9A 4HFSA 2PHUA 1LOCA 2BEOA 4LTAA 4DXZA 3CJIC 5C5UA 5JCTA 4NR1A 2X5IB 2X05A 2XVGA 5JMOA 3O1SA 1J3QA 1LHNA 1HXS3 1MVQA 2R30A 4GAZA 1UMZA 3NVCA 4COWA 2H0BA 1Q5OA 5CFCA 1GP4A 2IFRA 3U78A 4AQSA 5HCAA 2D6NA 1XSQA 4D3WA 5F6LB 1E57A 3DCQA 5JSRA 1VBB1 5J48A 1HB1A 4UWDA 1DYOA 2AREA 2WS93 5C4WA 4YYOA 4P5HA 4RGGA 3EXUA 3BUCA 1POV3 1GR3A 5CKNA 1H8TC 1RL3A 2VL4A 5G05L 3OB8A 4RGKA 4LBQD 2MPFA 5CZKA 1BEV2 4C90A 3WV6A 2PQQA 4ATFA 2Y6JA 2GC3A 3WHTA 2ZTNA 3POFA 2ORZA 3GCWA 5T5PA 3NW4A 1AYN1 2UWAA 3UJOA 5JAXA 3ZOIA 1XE7A 3N35A 2UYAA 4Y3OA 1RUNA 2Q1ZB 2R0HA 3FMGA 2D7FA 4LR4A 3PVOA 1GQHA 1Z7S2 2YYOA 2EXHA 1W2AX 3FZ3A 4CDUC 4AOCA 2VZSA 4H55A 4XFCA 1ND2A 4Y1XA 4YRDA 5GLUA 2VZQA 4K21A 1LRHA 3TBDA 1NA1B 5BNOB 3RZGA 5JWPA 3LFMA 3DECA 2IWGB 4META 4MV2A 4D6SA 4JX0A 5TSWA 1DQ0A 4CP0A 1UIKA 1PGSA 2WZR2 1JOBA 1R1A3 5D8AA 5JVVA 3WQ7A 3WHUA 4LBKA 3OTFA 4GH4A 3E5XA 5BNNC 2Q8DA 3ZFEB 1MS9A 3MICA 4JGZC 4O65A 5KHIA 2RM22 2O1QA 2WABA 3E5UA 2WN3A 4Q5OA 4MXWA 2SLIA 2RR11 4YARA 1JYTA 4M0HA 2FD8A 4PDWB 1AX2A 1TME3 2VZ3A 1LKNA 2YUEA 4AVTA 1JZ6A 4A44A 2BQPA 3WF4A 3J8F2 4A2UA 1COV2 3TRSB 1JTZX 5EXOA 3PUSA 2Z79A 1DZQA 1D7PM 2IXHA 2VMIA 4M0NA 1QNYA 1O3SA 4AG4A 2V5YA 5A7WB 1H1MA 3BYWA 2XWJB 4QGMA 2FZ2A 3F95A 3VUOA 5LEJA 4HPKA 2ZZQA 5F9TA 3ZYPA 4FFFA 1RMU3 3JB8A 4JGYA 1GMMA 3FX3A 4TWTA 3AKTA 3RRDA 3I2HA 1L3JA 3TEWA 3ZXLA 1QJX3 3CKHA 5C9AB 4DUWA 1CAVB 3ZMOA 1W99A 3INAA 4KU8A 5FUNA 3T1MA 4Q29A 5F5IA 1JW6A 1GP5A 3KV4A 1UPSA 1LODA 1V6KA 2WUHA 3HOBA 2R49A 4CDWA 2Q8CA 1W3XA 1GUIA 3EO6A 4NJ4A 3HT1A 3OGGA 4CXYA 5FP3A 4YW3A 1S2BA 2XONA 5FQ0B 4ZS3A 4N90A 5FZ8A 1TNRA 1UYXA 2ZGSA 2WNOA 1PO23 1UL9A 1VBC1 4EN8B 1G7YA 3RS6A 3OUJA 3AMHA 1V6NA 3L2YA 4XC9A 1DP0A 3DYOA 5FPLA 1JS9A 2GP3A 4UW3A 4ZKTB 2HWB2 3KCYA 4RHV3 1PGL2 4N9HA 1G9AA 1VBE2 2JIJA 4ARXA 4FTEA 1XNTA 1BMV2 2JDNA 3PL0A 3SEPA 3WNOA 2VMHA 1PK6A 2QQPA 1RUJ3 1QJU3 3WP5A 1M06G 3P1IA 1YHFA 5KHKA 5FZIA 3DPRB 1OHFA 1REFA 1FNYA 2D3RA 3LEIA 3M70A 2HWF3 1RHI3 2GNBA 3OPZA 2RS32 3LB9A 4HKOA 1DQ4A 2VC9A 1PVC2 1GQGA 1MR5A 3WDYA 3WW3A 2Z2SB 2KM2A 2JWPA 1RUG2 1AHSA 5FMOL 3T30A 4OZOA 5D21A 4LLOA 4UFIA 4JTNA 2VNRA 3HT2A 4OUEA 5H9PA 3EQEA 2W94A 1S0DA 2IUWA 2XJSA 5A3PA 2A5ZA 2WA4A 1H6YA 3VBRA 4JKLA 1GZCA 3QACA 4R9CA 1K5MB 2ZX0A 4BMBA 1Z78A 4QXCA 4ES8A 3EBRA 3NNLA 4CDQB 3V0AB 4MOAA 5EJ1B 4AFMA 3WDTA 2Y8KA 5HI0A 1PMJX 1DLCA 1NCRC 2DVBA 2W5FA 4FBFA 3O0XA 3LCPA 1EAH1 2W1WA 3JZVA 3VBFC 1FMD2 4UXAA 4BLJA 3VV1A 1W39A 4BB3A 2PXJA 2HWC3 3RNSA 4XFBA 3TYJA 2R1BA 2CSGA 3T09A 3EJKA 4XE9A 3WDWA 2FCTA 4Q4X2 5EYXA 4XF9A 2Z5WA 4Y1UA 2PLV2 3O1MA 1RGSA 2BWAA 3V64A 1I5PA 4Q0UA 1FATA 4DRRA 4K40A 1IZ3A 4L0PA 4CCMA 4QKNA 3C7OA 1W6PA 2BGCA 4J1WA 3B7MA 3GZAA 1RYYA 2JDAA 2VECA 2RS52 1UYYA 1OXCA 4UFJA 2CTVA 1Y7BA 2JB4A 1I1EA 3ABZA 3AVSA 2VTXA 2JG8B 1X9PA 1WW4A 2OX0A 2ZX4A 3KT7A 4ZXKA 5E89A 1DGRA 3OBZA 5LBCA 1W6MA 1MS8A 1W0NA 3B94A 2C9KA 4EN0A 3IMMA 1YC61 5LA9A 2J1SA 4LBNA 2ZGRA 2WZPP 1UXZA 1A8DA 2J1VA 4QPYA 3LF7A 3LE0A 4RQPA 4W8JA 2FDHA 5FYUA 3VD4A 1VMFA 5KXDA 1W9FA 2O8QA 2ZEZA 4RN5A 1LHWA 5AVAA 1TQ5A 3SKJE 2JKXA 2VXJA 2VZRA 2DFBA 1HN1A 3OGRA 3ETQA 4BK5A 3BALA 3M3CA 5LA0A 4JKMA 1PIV1 2VTFA 3P3NA 3G7DA 4YVSA 1Q8VA 1CAUA 1OQ1A 4XFFA 1F4AA 1W2OA 4ZU5A 2ARAA 2J42A 5A3LA 3IZOA 2YZ4A 1EV13 3VKMA 1GWMA 3OOXA 2W91A 5EYYA 4LUMA 1UZWA 4P9WA 4NVPA 4H2AA 2WFPA 3I2IA 3NV3A 1F5JA 4XAEA 5FZ0A 3WW2A 2CU5A 4JRAA 4GMP0 4YSFA 2GN7A 1J59A 3VDCA 1GWKA 2YB7A 4JC1A 5FZEA 1AR61 4XCAA 3CHXA 4IEWA 4OHWA 4Y22A 2OQ7A 4BJ0A 2GNMA 1HRV3 3FHAA 5ACA1 5AC91 5IATA 3AMQA 3VHNA 3HPNA 2IVIB 2UWBA 2YROA 3EYPA 3MW3A 4XBLA 3IKWA 2E33A 1OOPA 3S7IA 3ELNA 3I7DA 1RTVA 4QX0A 4C1WA 1IQDC 1RUE1 5FWJA 5L9RA 2B45X 1Y9GA 2VW0A 5C70A 4QX1A 5E8AA 2EAAA 2WNVA 4XUTA 4CPBD 2LRPA 1J3RA 4LLFA 1W04A 1QJY2 4R9BA 5FPZA 5CFDC 5IAXA 1DGRN 2A6WA 2E32A 3AMMA 1MZ6A 4XDPA 5JIAA 1FV3A 2FDFA 5FZOB 3KHCA 4M4RA 3DXTA 1RVF1 1LENA 4YNIA 4LA3A 4ONUA 4XXAA 5BPXA 3JD72 1DG6A 2ZGNA 2AH2A 3MW4A 4ES9A 4P14A 5G04L 4TZDA 2YGLA 2Y6HA 4RS5C 3WXPA 2OUJA 2W1QA 2XLAA 3ES1A 3ZIWA 3ZVXA 1NY71 5GLTA 1IPKA 1U5XA 4OCTA 1RJ7A 1HN0A 3WUCA 4RR3A 2XWBB 2DBNA 4IV3A 5KHGA 3WG1A 1MZ5A 2W08A 3VBHB 1JU4A 4W65A 4CP9B 2WQ8A 1ND3B 1OPMA 1JOJA 4V2WA 5A32B 2IXCA 5FZ4A 3WNKA 1FT9A 2VMFA 3OY8B 1JYIA 4NMIA 3T0AA 1H2MA 1X33A 4CU6A 1VBD2 5JZGC 5L7OB 1PZ7A 5LK5A 4IUGA 5J98B 3TEYA 2OPKA 3WQ0A 2QKDA 2W68A 3AM2A 4IESA 4DINB 3ZFFB 2EIBA 4Z1VA 1WBFA 4RGAA 3FLTA
chains in the Genus database with same CATH topology
2VQ0A 3FLPA 4O9GA 1HQWA 3JBG2 1YLLA 1PZ8A 4FPEA 1XE8A 5CFCC 2D5HA 4YVWB 4L92A 3THTA 2NP0A 2AENA 2EA7A 3LSEA 3VHRA 2UY9A 1N3QA 2PHWA 1ZA4A 3WQ1A 3QLQA 4CP1A 5C4WC 3BTAA 1X8EA 4A7KA 2D98A 2E63A 1FPN3 1TMF3 1GFF2 4XQ4A 4XDQA 4X6QB 4XJ8A 3SH5A 2CWSA 2PHTA 3MYXA 4HETA 3IPVA 3TN92 5LRSA 4M01A 4WZFA 1N3OA 2I74A 4R9DA 2GU9A 5FOJB 5I0RA 1QWRA 4I0BA 4FQ4A 1MEC1 2CL2A 2ATFA 1ND2C 1U5ZA 4COVA 1VBB3 4IERA 4LEJA 1IHMA 1LB2A 1H2LA 4AEMA 3PTYA 2HJIA 4QXKA 1CIWA 4LBQB 1BJQA 1VRH2 2A3YA 2UWCA 1JUIA 2OW4A 1NCQA 2P3JA 2ZJCA 4Z92B 3I59B 2D40A 2A6XA 4GH4C 2WFF1 3WOGA 4B4RA 4ITCA 1GZWB 1CJDA 2WL1A 4BIFA 2CAUA 2CYFA 1AYN3 1UU4A 2XPJA 1F31A 3CJIB 1FOD1 4FPYA 3USUB 3VZOA 1PGW2 1AF9A 4YZ4A 3VDDA 3ZSMA 1GNZA 1GV9A 1H4HA 1R091 4U36A 4YW5A 4MLOA 4JDOA 4GB32 1RUF1 2PFWA 4BQ1A 5FAXA 1REDA 1AL21 4EN9B 3MIBA 1PNGA 3AK0A 3J4UH 5T52A 3OBRA 1DZTA 1H8TB 2FHRA 4CTEA 4EN7B 2VOKA 4AK3A 1AR91 2QZ2A 4XFGA 3WD5A 1BVP1 3NSTA 1LU2A 1POV0 1I6XA 5DZEA 3ZFGA 3GHMA 2ZABA 2B9UA 3MF6A 1G9CA 1ASJ1 4LO8A 5CVRA 4CDWC 2RR13 4CEYA 3D4KA 1WGPA 4EJRA 1XXNA 2RHPA 4KWLA 2EXIA 2WNEA 1RVF2 4HT1T 1WD3A 4CDUB 1KDKA 3VKLA 3CL1A 3H0OA 3PVBB 4FPFA 1LEDA 4OHVA 1NY72 2UYBA 4O9EA 1I5ZA 4GULA 4D69A 3THPA 1NQJA 3AKSA 1ULCA 3IDCB 4QPIA 2E7QA 5BNNB 1BKZA 4JGZB 1PK6C 2YC0A 1U5YA 4OLLA 4Z2WA 2EXKA 4FOWA 1J1LA 1Y3TA 2TUNA 4P9YA 4BMEA 4FQZA 3RMYA 1AXZA 3PMEA 3MFCA 5DG1A 4B29A 3KS7A 4HK8A 2JXAA 5D1IA 5KC6A 3V56A 4PBPA 1OA2A 3JU9A 1YRZA 1UN1A 1VBC3 1BEV1 1UPIA 4TYSA 2LTNA 4XIKA 4YFZA 5ABJC 3FUQA 3HAGA 2VMGA 1UCXA 2ZGLA 5KXCA 3OD0A 4FOYA 1W6OB 4QQHA 3E6DA 1Z7S1 4WZCA 1O91A 2HWD2 3AKRA 1SFYA 4FPGA 4AE2A 4HSJA 2HWE2 2UURA 3U4XA 4ZU4A 1TEIA 3VBSA 1N3PA 3BB6A 1MQTA 1QQP2 1HV1A 2WZR1 1MVEA 4P9LA 2AR6A 2JJ6A 4N43C 4Y20A 2X5IA 1WCDJ 2RM21 2BNOA 1ZM1A 1B35A 4Y4YA 4QQLA 1LGNA 2WLPA 3ZN6B 3FUOA 1RUI2 4B7KA 5BUVA 4Q4Y2 2VOXA 1OQEA 3J8F1 4Y1YA 1X82A 1COV1 1O3RA 1NZCA 1EAH3 4E27A 5JI9A 4NHMA 1V9U2 1KFUL 3VZMA 2CNAA 1DLLA 1PO12 1H2KA 4RQPC 2R0FA 2QFEA 1IKQA 3GNEA 3NV2A 4UBGA 4AWDA 2JE7A 3R4SA 4KQ7A 2DU1A 4XXPA 1H0BA 3KCCA 1QXJA 3ZXAC 2QE3A 3T1LA 2BBVA 5K9YA 1NLSA 2ZGMA 5HXVA 2ZGPA 2K2SA 1UKRA 4LT5A 1C8M2 4YVSC 2XKPA 4Z82A 1CAWB 1KS5A 1ZZ7A 4CRQA 1RIRA 1G8WA 5CBLA 2BTVC 1NA1A 1NCRB 2F4PA 5DZGA 4QGNA 3FFQA 1DFQA 3VBFB 2ZAAA 3NWKA 1SACA 3AFKA 4FT8A 4P9IA 4FVVA 3WUDA 2HWB1 3ZFEA 2PAKA 1PGL1 5KHJA 1VBE1 2DU0A 1BMV1 3VZLA 3FE5A 3I8TA 3WY6A 1AVBA 3R0RA 3TOJA 2FMDA 1DQ2A 3JQXA 1PIV3 3H1WA 1O5LA 5GALA 2WNVC 1S0GA 3MEPA 4LO6B 4RA0A 2RS31 4QPGA 5JPMB 2ZGTA 1PVC1 4S2GA 3AKQA 2JENA 4JDNA 1RUG1 2R042 1SLAA 3M3QA 3FC0A 5GZEA 4Q1PA 3K51A 3D0JA 3AMPA 5J36A 4AEJA 2EXJA 2H0VA 1AR63 3TB0A 4LUKA 1CAVA 1C1FA 5ACA3 3QD6A 5AC93 1WLCA 2A3XA 3AYAA 2K9ZA 3CJXA 4IV3C 3SCFA 3ZN5A 2C1FA 3V0BA 1VP6A 3U0ZA 1RUE3 3P3PA 1FMD1 5A3MA 3NO8A 1VB4A 1IS6A 3BODA 3LGRA 1ALYA 2EVXA 4DQAA 1AJKA 2DYCA 1PM7A 3GF6A 3O12A 1I9RA 4Q4X1 4LE4A 4WM8A 1F8VA 2PLV1 1SMVA 1BBT2 2AZ5A 5AFBA 4XJZA 1RVF3 4WM7A 1U12A 1V6JA 2RJKA 2R071 4MGZE 5GM0A 3JB4C 2A75A 2PN5A 3FHIB 2NZ9A 1X8MA 3BCWA 2PHLA 1DU3D 2RS51 1FNZA 2W0XA 1YIFA 3KGLA 5T55A 3H3UA 4NPRA 1DQ5A 2GH2A 1XNCA 1UX6A 1A8MA 3DPRA 4AVAA 3BOPA 3WZ1A 5A33B 5BXXA 4GA9A 5IK8A 1WMEA 3JQWA 2VW2A 4GALA 2VQAA 4FPLA 4AW7A 4C91A 5DXDA 1CAXB 5H9QA 2XVLA 3RJ2X 5CFDB 4IXLA 3UKNA 3GBGA 1D4M2 3SCGA 3VBOC 1ZRCA 1WCSA 4R52A 3B9IA 2D93A 3AZXA 3V0AA 3S7EA 3AB0A 5I8YA 3OYWB 1XQNA 4R4XA 4RS5B 1D2QA 1RUOA 4LBJA 4XJ9A 3AKPA 2XB6C 1AX1A 2D6KA 2ZGKA 4XILA 4MVTA 4GWNA 1LHVA 4AF9A 1MZEA 4PQ9A 2R062 4N7UA 1HIXA 2DCKA 4FOQA 3S0MA 4N53A 4AHXA 3MIHA 2O8OA 4B4QA 5JZGB 3SH3A 2JE9A 1BQPA 1QOOA 2NMNA 4TSVA 1G86A 5I0UA 1MS0A 2WT1A 3ZYIB 4EROA 5FDBA 2IXJA 2JG8A 5H9RA 3H9AA 3M7AA 4GMP1 4KNCA 2XBO2 3IM0A 4OUSA 3WDUA 3WLUA 5CFCB 4Q0PA 1MEC3 1OA3A 3UV9A 4YW1A 2TEPA 3M1HA 1QJY1 3VN4A 5IT6A 3QCWA 3LWCA 3SHRA 1O3TA 2QJVA 2K0GA 5C4WB 4C0BA 3JD71 3IT8A 1JH5A 1CONA 2Q0AA 4MGYE 2ZOEB 1CJPA 4LHLA 1RUH2 1WMDA 3N4MA 2WFF3 3SISA 4XF1A 3RJRA 1QOTA 2GNDA 4XZPA 2AUYA 3HBZA 2A6VA 3O0WA 1FAYA 4S2HA 2GMEA 1APNA 1KJRA 1AYM2 2I2SA 4AGGA 3TAYA 1FXZA 4CEYC 3HR9A 1FOD3 3ILNA 4COYA 3RMXA 2IC1A 1VBA2 1N1TA 1R093 5CB7A 1VBD1 4RL7A 4NHLA 3ZN4A 2ZACA 1G9DA 4Q1RA 1ND2B 2A7AA 1QH7A 3N7KA 3L2HA 5T50A 1RUF3 1PNFA 3T2TA 2EIGA 1RB8G 3MF9A 4AI1A 4QMAA 4HKLA 1ZRRA 1AL23 1AXKA 1SBEA 4UBHA 4S2DA 5B2GB 5LEKA 4HBNA 1XYNA 4QPIC 1AR93 4XTPA 3JBG1 1D2SA 1BYHA 4GH4B 5DDJ2 4Q2FA 3VBUA 2XH6A 3B93A 4Q4W2 2Y0OA 4MXWB 1ASJ3 2WA3A 4G4FA 4WV8A 3U07A 5FLIA 4K3UA 5C8CA 4PBOA 3ST7A 4CP2A 2JX9A 2R072 3NAPA 3SCHA 4PIZA 1LEMA 4DS0A 1QY4A 3TN91 2ZX2A 4AEDA 5CG8A 2FZ1A 3PLQA 4URTA 1XNDA 2D6MA 4FPHA 3DKWA 2UU8A 1N47A 3OCPA 4J1XA 4OI0A 2WSVA 3ZYRA 1W6QA 4PLNA 3IWZA 4IL7A 4INDA 3VBHA 3RI8A 3WG2A 1ND3A 4OUMA 4IETA 1C57A 2XGXA 1J58A 2WIIB 3O5SA 2Y0IA 3WP6A 3VBSC 1GKBA 4CDWB 5L7OA 4OZXA 3B02A 1KFXL 4LBOA 1UKGA 2B46X 5GZGA 1S0EA 1NYWA 4QGLA 1VRH1 2YPJA 1Q43A 5JSPA 4KGQA 4MXVA 4MSVA 5J09A 4FO9A 1BEV3 1DZRA 2DUOA 2JG9C 5GLVA 2NQYA 3L9JT 4XQDA 1B35C 1WLTA 4QHBA 3WDVA 4WVMA 4AHYA 5T5LA 1SQ4A 5J96B 4MX3A 4JVAA 4AYUA 4YVWA 1LU1A 5F5QA 1PGW1 2BW8A 1LGCA 4AVSA 1Z7S3 1PK6B 1DYKA 2JKBA 4GB31 4OHYA 1B09A 4Y24A 4YZ5A 3POWA 4UW5A 2DCJA 1JN2P 2BNNA 3VKNA 3WINE 4FAHA 2FMYA 2Q8OA 1ZVFA 5FREA 1F5FA 3OJBA 2WZR3 5BNPA 1QKQA 1S1AA 1BCXA 2A70A 1ZZ8A 1F9KA 2QDNA 1TNFA 2RMU2 4H7LA 4YG0A 3RDIA 2MEV2 5ABJB 4D7SA 1OA4A 2RM23 2RS12 4PJYA 4NOTA 5K0UA 1QDCA 3PVNA 3M3EA 1RUC2 4CDXA 4XOGA 1GANA 4KU7A 4ORFA 3J8F3 1COV3 1R082 1JBCA 2DF7A 2QDRA 2I07B 1LJ7A 1H8VA 3ZMNA 3DGTA 1XU1A 5KXEA 4GQ7A 2WNUA 1O4ZA 2NN8A 1V6IA 4DZGA 4FPKA 1QNWA 4H3WA 3O0VA 4BCUA 2CAVA 1LOFA 4CEWA 3OGJA 1S0JA 1WA4A 5F1RA 4B4PA 5JSOA 3USUA 3EHKA 1HRI2 1W6PB 4YG6A 4N43B 3KZ4C 3RQ0A 2NMOA 3AP5A 2ET7A 4LO5B 4I3GA 3S6PA 4FCAA 3AMNA 2V73A 4QPGC 4F7ZA 1YCIA 3CF6E 5JIUA 2A73B 1QJZA 1W6MB 1AX0A 1U0AA 1Q56A 3WNXA 2KXLA 5I0TA 1H8TA 3C2UA 4COUA 2E9QA 1BK1A 2DWRA 1H9PA 4RQPB 2Z42A 3WCSA 5JOZA 3MIFA 2HWB3 1C5HA 5JOWA 1EPWA 4YM1A 4F3JA 1VBE3 3MGUA 4KG8A 5J3UA 1LHOA 2VNGA 4E4SA 4AFBA 2HWD1 1LOAA 4YG3A 4UW6A 3PMSA 2XL9A 4HVQA 1GSLA 4YVSB 2HWE1 1CAUB 4EWDA 4IV1A 4YGBA 3WP3A 4A3XA 2BPA2 5J37A 2XG3A 4Y26A 3NV4A 2RS33 4JTOA 5AVPA 2TNFA 1PVC3 1QQP1 4WM8C 2IFWA 1UU5A 1RUG3 3ES4A 3MFAA 3POSA 1OFNA 2I45A 5LRRA 4WM7C 3K48A 4AI0A 4C1XA 5CA6A 2OYZA 2ZPXA 1NLRA 1ZBA2 3B9CA 4AI2A 4DNYA 1S0BA 4Y22B 1AJOA 1DBNA 3OF1A 1RUI1 4Q4Y1 1J1TA 4AQ6A 3LOIA 4B7EA 3KM5A 1F2NA 4HLTA 2DVFA 4I3PA 5D8AC 1VR3A 2ILMA 3LKJA 3O14A 1V9U1 1FMD3 3R4DB 2WNVB 2H6CA 1PO11 2VVEA 2W52A 2QVSB 4XMAA 4E4ZA 4XETA 4AXOA 5T54A 2ZMLA 2PAMA 4Q4X3 4BWOA 4K1ZA 2D44A 4WVVA 2PLV3 4LBLA 4K9SA 2UY8A 1AR82 1I3HA 1ZBE2 2XJQA 4RSUA 4MZUA 3LSDA 4QM8A 2B8MA 4W6XA 1C8M1 2GSYA 4XYXA 2B42B 1AR72 2HKXA 2RS53 4Q4V2 3NL1A 1RUD2 5J7MA 1Q8QA 4XIOA 4IV3B 1LOGA 2ZHNA 2MHFA 2VVFA 2AYHA 4I30A 4JGYC 2XUMA 2ZA9A 2E7TA 3RZZA 3WCRA 2OUHA 4L8QA 3AYDA 4N53C 2GZWA 2PHXA 1HXS2 2DCYA 1H1IA 1C3HA 1C4RA 4HANA 2Q4SA 3PJQA 3CEWA 5CG9A 2GMMA 2WS92 4XEZA 1Y9QA 2IXLA 4LA2A 1NG0A 2LUWA 4EWAA 5EWSA 1QF3A 2ZX1A 3MLLA 2R041 1HV0A 3BOWA 4XJUA 3AJZA 2VH9A 4I2OA 1NE4A 3CLPA 2XJRA 3AP6A 4LO4B 5GLZA 2YY1A 4PLOA 2GDFA 4LNVA 2XKOA 2VPVA 1V70A 2D5FA 3KT4A 1VLNA 2EAKA 3IPVB 3KGZA 3VBOB 3DL3A 4M3CA 1W6NA 4U2AA 3IMNA 4AGRA 3N36A 4L99A 4GMP3 2E51A 4X8NA 2GC1A 5AFEA 1O4YA 2PTMA 4YW4A 1R1A2 3A4UA 1WD4A 4M3CE 5HCBA 1T6GC 2E6VA 1QJY3 1QMJA 3VBRC 4GWMA 1URXA 1EPZA 4ASLA 1BBT1 4XQWA 2WINB 1PZ9A 3WR0A 3DUIA 4A7ZA 1TME2 3JD73 3SLIA 4DY3A 4OI1A 5HBAA 1ZRDA 3C3VA 1LOBA 3E97A 3VBUC 3MIEA 3H50A 2YMZA 5KHHA 3AYCA 4JDMA 4AFCA 1CESA 3WX5A 3ZX7A 2ZAHA 4PCRA 4LBMA 5C8CC 1RMU2 1ZNPA 4QX5A 4UW4A 1UW8A 2GC0A 4EWEA 1DGWX 3UL2A 2DV9A 1IS5A 1VBD3 1LTEA 3ILRA 3KQRA 1X36A 4HK9A 4EV0A 1QJX2 5I93A 1XNBA 1VJ2A 3TNQA 1D4M1 1DIWA 4YZ3A 3VGIA 5SV8A 4AEDC 1RINA 4DOUA 1OKQA 3ZXJA 4NHKA 4OULA 1A78A 3GZUC 4GKXA 1YNAA 5E88A 1CPMA 3JBG3 2Q1MA 2WQZC 4D7YA 3D5OA 1PO22 2KA3A 3GHNA 1ENSA 2ZKNA 1LR5A 3RYRA 3VKOA 4CEYB 3AJYA 4QD2A 4DB5A 3RG0A 2R061 4RFT0 3CU7A 4RHV2 2ZHMA 1YI9A 2XVKA 4IEZA 2ZGOA 5FMOS 3ZSJA 1WW7A 1WW6A 2BWCA 2HEYF 3NV1A 2ZGUA 3ROUA 5CIRA 3I4IA 4BZ4A 2Q30A 4KL1A 3TN93 1RUJ2 1QJU2 2B5HA 4PIYA 2ARBA 2TBVA 5C8WA 5BNOA 2HWF2 1RHI2 1DDLA 2CGOA 4QPIB 1PVXA 3H8UA 3IDBB 4Q27A 2XBO1 4DPNA 4YFWA 4BE3A 4FPJA 1IKPA 3AZVA 4V1PA 3PNAA 3W9AA 4E2SA 5GZDA 2X53S 2WC2A 1HQLA 3E6BA 4BLIA 4AVBA 4ASMB 1CAXA 3LA7A 3ZSLA 2GC2A 1S55A 1ZZBA 1IS4A 1OQDA 1OOPC 1VRH3 5BNPC 3KB5A 4PDWA 5FLHA 3POYA 1RUH1 1QH6A 1OLQA 4JV4A 2BFUL 2PHDA 2WT0A 3FBMA 4F83A 5BYNA 2VW1A 1MZFA 4ISRA 2GMPA 4KG0A 4HN0A 1AYM1 2ZBJA 4WVWA 3BIWE 4Z8BA 5K0UC 5CU1A 1BVVA 2HWC2 1ULEA 4CDXC 4IQPA 2DTWA 1NOVA 1Q3EA 2YXSA 1WBLA 2G9FA 4X8PA 1CQ9A 1XYPA 3D8CA 3MZHA 5FO7B 1VBA1 1SLLA 3VKFC 4GB33 2OVUA 4QQ2A 4AFAA 4RD7A 4DMIA 5C9AA 5JZGA 3VBSB 4FOVA 3WG3A 5IK4A 3MIGA 4PLMA 3BU7A 1C1LA 3SITA 1H9WA 2WNUC 4RR3C 1NXMA 4M3CF 2NLRA 1QU0A 1YJKA 5FCCA 3RSJA 3I2DA 3AXEA 5JOXA 2QZ3A 3SMHA 1LOFC 4CEWC 5FQ0A 2WT2A 2JG9B 5DDJ1 2VG9A 1S0FA 4Y20B 3G6JB 3B01A 4Q4W1 2IZWA 1B35B 4MH0E 2VUJA 2DUPA 4K8FA 1KD7A 1WCKA 1YYNA 2WJSA 3WP4A 1W2UA 4GXLA 3ZYGA 1EYBA 5SV5A 2GN3A 2R6QA 1AUYA 5KBFA 3HN1A 4HZFA 1CD3G 2ZS6B 3ENRA 2YHJA 1EV12 1LCLA 2PELA 4YGCA 4KH9A 1Q8OA 3N3HA 5CNAA 4DFSA 1A6CA 1KITA 4QT6A 5E1RA 2VOVA 2SBAA 5EFUA 1C5IA 2RJLA 4HVOA 4IV1C 4AHWA 4KWJA 1K5MA 1HRV2 2DCZA 3LAGA 2QCSB 4CDQA 4R4ZA 5HCFA 1HW5A 3MPPG 2VXRA 3QOPA 4N9IA 4IEOA 2MNGA 4BA6A 1CR7A 1UIJA 2CY6A 3R4UA 2P3KA 4FAGA 4B8EA 1N1YA 4FPOB 4XMIA 2N7GA 3ILFA 5JR7B 3LOBA 1YFYA 3MLJA 5KC5A 2NM1A 2HWD3 2LM3A 3N7MA 1NCQC 3WG4A 4KGGA 2NPIA 1VAKA 1D4VB 2HWE3 1PHMA 2XJUA 4XBQA 4BPZA 3W59A 3AXDA 1YFUA 2G4IA 1R1ZA 1OPOA 4QPGB 5DZFA 4OVEA 1ENQA 5JI7A 1QQP3 2VOWA 3D82A 3H1MA 4CZSA 4JAAA 2RE9A 2GH8A 2RMU1 1ONAA 3VDDC 2MEV1 1UZYA 4MUVA 5K8SA 3HIFA 1XYOA 2CGNA 4YGEA 2RS11 2DUQA 3MW2A 1ZREA 2XL7A 1BXHA 1Q8SA 1QHDA 1SLBA 4YLZA 1RUC1 1RUI3 4NN0A 4XHBA 3AP4A 4Q4Y3 4G9SB 3ZXFA 3V0BB 1UAIA 3NKTA 4I0AA 1R081 1ZYBA 1V9U3 2P34A 4HSLA 5DUXA 3ZFGC 1GICA 1PO13 3FWEA 2ENRA 1LECA 1W0PA 3X29B 3IBMA 1MS4A 3AZZA 3MPBA 4WM8B 3SNMA 3USSA 3VHPA 4R8HA 1CGPA 2ZX3A 3VZKA 4OI2A 4Q0VA 3OBTA 3ZDSA 4WM7B 1UD1A 4GKYA 1HRI1 4IEUA 3V65A 3E5QA 3WDXA 1CPNA 1C8M3 2D6LX 3D6EA 1FPN2 1TMF2 4KWKA 1OI6A 3AP7A 4YM0A 1CVNA 2E53A 1S0IA 2A6ZA 4N7IA 2OA2A 4P9XA 1QDOA 5D8AB 1ENXA 3MLKA 4I01A 3IN9A 4LE3A 2YV8A 5FPXA 3TNPB 3FFZA 4QU2A 4FP3A 1DYPA 1G6NA 4XJAA 3HQXA 3VL8A 1S2KA 1XNKA 1RC6A 3N7LA