2V4VA

Crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
QSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYTVYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTVSGVTGKHDVYLVFKGDSGYLFNLNWFTFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GH59 GALACTOSIDASE
publication title Analysis of the Structural and Functional Diversity of Plant Cell Wall Specific Family 6 Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Clostridium cellulolyticum
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2v4vA00
4LPLA 4DUWA 5JXJA 3VD4A 3J7HA 5CZKA 4ARYA 2RJ2A 3W5NA 2XONA 1RYYA 2W1UA 3LE0A 4P00B 1NKGA 1XC6A 2W1SA 4XVHA 1K3IA 2CDOA 2QQNA 3P1IA 2RVAA 3MUY1 1DP0A 3T0DA 4UI9L 1JYNA 2HLEA 1UYXA 3T08A 4D8MA 4CU8A 3LEIA 2VMEA 3IB3A 3K4AA 3WF4A 3JXSA 2BERA 2ZEXA 2HYXA 4XUTA 4CVUA 4QDRA 2Y6GA 3WEZA 2B9VA 4QB6A 1GQPA 3LPFA 3A21A 4LQRA 5LA2A 1JU4A 4QB2A 1EUUA 5A1AA 1OF3A 1UXZA 1I5PA 3LEKA 4XUQA 2JDAA 4PQQA 3CZUA 3OG2A 3HEIA 2BGOA 2WN3A 1ULOA 4QX1A 1CX1A 3I2JA 5B4XA 2QQKA 3K4ZA 2DDUA 3WNLA 5DMYA 2Y6JA 3VDBA 1OF4A 1W99A 2QQOA 4JX0A 2X09A 2YFUA 3MBWA 3NJXA 3NJVA 3CDZB 3A7QA 2YFZA 2ID4A 4RN5A 1HN1A 3FL7A 5IHRA 2VMCA 2J1EA 1O8PA 4GZ9A 2Y6KA 2OKXA 3WF2A 1J83A 4ZZ8A 3CZJA 1NUKA 3OBAA 1JZ3A 3SKVA 1TG7A 3K75B 4A42A 1KGYA 4DXRA 2JKXA 2E26A 1F4AA 2WO2A 3AC0A 2LW8A 2Y8KA 3K77A 1LNSA 2L9LA 2WABA 3C7GA 4QAWA 4A44A 5I0DA 2VTFA 5JXGA 4CU9A 1NAEA 1NX9A 1GOHA 2J22A 3HPNA 2Y64A 1PX4A 2CDPA 3CMGA 2WO3A 4ZXEA 1W8OA 3HN3A 3ZM8A 1JZ6A 4KWUA 4DXSA 1KEXA 2C9KA 1US3A 1GOGA 4XUNA 1UY4A 1W9WA 2VC9A 1CZVA 4MOAA 1UXXX 1UYYA 2EICA 2QBXA 3GXUA 3VD5A 4A4AA 4DUVA 2WZEA 3C7HA 4ZY9A 3W5MA 5C7GA 2VMFA 1WKYA 2ORXA 5F7UA 2VZPA 2KD7A 3I2FA 1UY2A 1T2XA 3UETA 4DEVA 5C71A 1GOFA 4CUCA 4AG4A 4M4RA 3MV11 3MO4A 3ETPA 3WNOA 1XPWA 5LA1A 2C4XA 3HOBA 1UMHA 4PT6A 3C7OA 2J1VA 1PMJX 2Y6LA 2V5DA 3DYPA 4P02B 2C26A 1JU3A 3E1F1 3EYPA 3T0BA 4CUAA 2B4KA 4ARXA 5JXHA 3PUIA 2YG0A 3GM8A 1SG3A 4XZUG 1UZ0A 4JKKA 2EIDA 3P6BA 1J84A 2QQMA 3NQHA 1JZ8A 1MPXA 3FHQA 2Y6HA 4QX2A 2W87A 1O8SA 2W95A 1W9TA 3OB8A 1TVGA 1O59A 2VO5A 3DYMA 2VZTA 1L7RA 3IAPA 2V72A 4OMDA 3ACGA 1R64A 2W1WA 1K45A 1DYOA 3ACHA 1K42A 1EUTA 1CIYA 3BGAA 3LEGA 4DXTA 1US2A 1UWWA 2VJXA 3THCA 3IAQA 4OMCA 4RYDA 4LHSA 5JUVA 2ZXQA 3A22A 3IIIA 4JKLA 3THDA 4MADA 1H6YA 4PF1A 5DQ0A 2JD9A 3WNMA 5HXMA 1UY0A 3D3AA 4XURA 2WO1A 2X10A 3WF0A 4P08A 1JYVA 2LS6A 2EIBA 2WAAA 3OGVA 2W5FA 2VR4A 3DECA 3DYOA 1ULPA 2VQUA 3ACFA 1JHJA 5LA0A 5EJZB 3T2OA 3IDAA 4KMQA 2VZRA 2W1QA 2VCBA 3I2IA 4QX3A 5JMOA 4ET7A 3UNPA 2VZVA 2WUHA 4MGQA 3VD7A 4BJ0A 4BDVB 5EJ1B 2J1AA 5IFPA 1UY1A 4CU6A 3OEBA 4QPWA 4DEQA 3ABZA 1YQ2A 3SEPA 4QDSA 2J1RA 3OGRA 3SKJE 5IJRA 3WQBA 4GWJA 4HG6B 2VOTA 2J1SA 1DLCA 3CKHA 4UOJA 2DCKA 2J1TA 3K46A 5JXIA 2WZ8A 4JHZA 4A45A 2ORZA 5DPNA 1CZSA 1K12A 2W92A 1GNYA 2BZDA 4OUEA 5FUIA 4XUOA 2QQIA 2VM9A 4FI9A 4UAPA 1P8JA 4OYUA 2VCAA 3MUZ1 5DN2A 3U37A 4W8JA 2PQSA 4W50A 4TTGA 1XNTA 4MGSA 2DCJA 2E32A 5EIYB 3NNGA 5LCWL 1PMHX 1W9SA 4TXWA 3PUHA 4A6OA 4D0QA 2W94A 2YC2A 1BHGA 5HPOA 2J7MA 1XNAA 4DUXA 2VQTA 3WF3A 2WBKA 4QB1A 3GDBA 2X05A 2W91A 2R7EB 4E8CA 4JKMA 3I3DA 3EB7A 2VZ3A 2WN2A 1JI6A 1OD3A 3I3EA 3F2ZA 4BK5A 3FHAA 5IFTA 4L0PA 4M4PA 3ACIA 2VCCA 4XUPA 1IQDC 4QX0A 2WQ8A 3SEEA 3I2KA 4E8DA 3WNKA 1UMIA 2XHNA 4P5YA 4AAXA 3VDCA 1D7PM 3I2GA 2VZOA 2BGPA 1OH4A 1OT5A 3ECQA 4W4ZA 2RV9A 4LKSA 4Z2AA 3WF1A 2VL4A 2E31A 3I2HA 3I97A 1PX3A 3FN9A 3MV01 5C70A 3OGSA 2XOMA 3WSOA 3BN6A 4OZOA 4ZZ5A 3UESA 2YC4A 3CQOA 3T2PA 1CZTA 4A41A 3OEAA 4CUBA 1W0NA 5J1XA 3WNPA 3GGLA 3WNNA 2W9XA 5JR2A 2VZQA 2YB7A 1GUIA 3LQCA 3T09A 2JE8A 2ZEZA 1UX7A 4CU7A 1UY3A 2W3JA 1GMMA 3K4DA 1WCQA 3I3BA 3C7EA 2XQXA 2W46A 2ZEWA 1W8NA 3C7FA 2V4VA 2WYSA 1JZ4A 2VZUA 1JZ5A 5CYYA 2BBAA 4IUGA 1JYWA 1JYXA 3T2QA 1F4HA 1JZ7A 3VD9A 3HNBM 2WAOA 5G05L 1JZ2A 3T0AA 4GWIA 4MO3M 3A23A 3C8XA 5B4NA 2QQJA 3HNMA 1UYZA 1L7QA 3CIHA 1SDDB 3VD3A 3LPGA 2J1UA 4BK4A 2W47A 3NRUA 4KI5M 1H6XA 1SHWB 2VMDA 4QDQA 2Z4FA 2QQLA 5G04L 2VZ1A 3HNYM 4A3ZA 4BXSV 3VDAA 2E33A 2EIEA 1GU3A 2VZSA 2WDBA 4YPJA 3HJRA 2ZEYA 5IYYA
chains in the Genus database with same CATH superfamily
1SLBA 3U0ZA 1RUC1 4LPLA 3GZEA 4ZPIA 2RMU2 3PNAA 5BUVA 3VD4A 5FLHA 4AFMA 5KC6A 1S0CA 2CU5A 4JGYC 4FP2A 2TUNA 5FYSA 3UJQA 3BU0A 2ZGLA 3Q9OA 2VUAA 3VDDB 3VZOA 1ULEA 4S2FA 5BNPC 1RYYA 2W1UA 5ABJB 1IPJA 2OUJA 1NKGA 3B5LB 4XJAA 2CV6A 4XVHA 2XUMA 4BWOA 1ND3B 1CPMA 3N9OA 4E4HA 1PHMA 5K0UC 2RVAA 2HWB3 3MUY1 4GB31 1DP0A 3T0DA 5DUVA 4D8MA 1B35A 3AZWA 4Y1UA 5T52A 3TN92 5FZCA 1WW5A 1XYPA 4M3CA 3WDXA 4DFSA 3QBQA 3VHRA 3HT1A 1XE0A 3AZXA 4MGKE 4CVUA 4YZ5A 4YVWC 2Y6GA 4QB6A 4LITA 4FOQA 1V0AA 2HWF3 4QPIA 5K7PA 1UOBA 1POV3 3A21A 5FKBA 4AI8A 2LROA 3ZFGA 4PDWA 2FDKA 5E6HA 3K3OA 1BXHA 3J7NA 4IE6A 5FOBB 1DFQA 2ZS6B 1W0OA 1Z7S2 4WZFA 1OF3A 1MEC2 3N36A 1PIV1 2RE9A 2WS91 1X50A 4XBQA 4Q4W2 5F39A 2CWSA 1DGRA 4XBLA 4Y20A 2H6CA 1N1TA 2CYFA 1AL0G 2HWE2 2WRAA 3LFIA 3TNPB 2RS12 3CZUA 4LO4B 4MV2A 4BLIA 4CCNA 5DUWA 1SACA 2G9ZA 5FZ7A 1VIWB 2BGCA 5FRAA 5C4WA 2PQQA 5TSWA 4OHYA 4FFFA 2IC1A 1JOJA 5FWJA 1W2NA 4S2GA 1OF4A 1W99A 5FQ0A 1YI9A 2JDKA 4CCCA 2JDPA 5C3OA 4ATEA 2GNMA 5ACA1 4Q8LA 1EAH3 2YFUA 5IAVA 3NJVA 2QE3A 1RUE3 2ET1A 4MGTA 1XNBA 2ES3A 3KV4A 1PNGA 3D6EA 1QKQA 1ULFA 3A7QA 2ID4A 1YFYA 1ZNPA 1SFYA 3A0NA 5T3NA 1D4VB 3JCIA 3KS7A 1REEA 1TME3 2VMCA 1LAJA 2DU1A 3WF2A 2K9ZA 1J83A 1PK6C 4YZ1A 3CZJA 2GMMA 4AI0A 1PO23 3SKVA 4NMIA 4KGQA 4XJUA 2DUOA 3B00A 3HN1A 4WM8C 2WO2A 5FAXA 1VBD2 1ZBA2 4MVTA 4AEMA 3RZMA 4RGAA 1ASJ3 2JJ6A 1W9YA 3IMNA 1LNSA 3BU7A 4QQOA 1RHI3 2YXSA 4UF0A 3Q8EA 1AX0A 3ES1A 3NW4A 4CDQC 4YVSA 2KXLA 1RUD2 5I0DA 3E6CC 5JXGA 3AL5A 5A1LA 2PHDA 4CU9A 3UKNA 1RXFA 2VBBA 1DGRN 4E4DX 4Q4V1 2YU2A 5FZ3A 3PDQA 2P34A 1AYN3 3VBSB 1HN0A 1HB2A 4ITCA 4RSUA 5I8TA 2I74A 3H7YA 1HLCA 1HQLA 4F8AA 2RM22 3VBRA 1FV2A 3ZFEB 1FI2A 3HPNA 1JOBA 3OPWA 2E51A 4EWDA 3BTZA 3OBRA 4YG3A 1V6LA 2GH2A 4PLNA 3I2OA 1RUOA 2WO3A 4YW4A 3WHTA 1W8OA 5EP9A 3ZM8A 5FPUA 2QZ3A 1NCQC 1FMD1 4KWUA 1TMF1 4L9BA 4YW1A 3WW2A 1WD4A 2BEOA 1BBT3 4AVBA 2CGPA 2DVAA 2AR6A 5F3IA 4BH9A 4AHYA 3VHPA 3NNLA 1CAWB 4XUNA 3BCWA 4EN7B 4UFLA 5C6CA 5FY1A 4ZU4A 3DF0A 2P4EA 5J3UA 4G4FA 5A3UA 5CFDB 2JG8C 1RINA 2BNOA 2CWMA 4XBNA 2WFPA 1UXXX 5CG8A 3ES4A 3KVAA 3OUJA 2ZX4A 4JC1A 4A4AA 4DUVA 1MS8A 3P3NA 4PBOA 5C7GA 3D8CA 3GZAA 1S2EA 4ORFA 2Z2SB 1SPPA 2RR11 4UW6A 4B3NA 5F7UA 4AAPA 1SCRA 2VBPA 4XJ8A 2KD7A 4CPBD 3RZJA 1UY2A 4QX7A 3NMBA 4P9GA 4CPBA 2VVFA 3KD4A 4AG4A 4I3GA 3MV11 3LEMA 3MO4A 1KD7A 1LGNA 4OCTA 4QHZA 3T4VA 1XPWA 3WNOA 1EPWA 1NCRC 4GULA 3IBMA 5LA1A 3HOBA 2CNAA 1UF2C 4NRQA 4GJYA 3J26N 5T54A 2WZPP 1L7LA 2OVUA 5L7OA 4LO5B 1KXGA 2NYYA 2Y6LA 1RUJ3 3D82A 3SMHA 3ZN4A 5FPXA 3NL1A 3CLPA 3QH6A 2C26A 2C9AA 2IVIB 1XOYA 1JU3A 3E1F1 3ZFEC 2Q1FA 3NVCA 4K1YA 1PGSA 3CO2A 2ZPXA 2A71A 3PUIA 3GM8A 4LOSA 4IDZA 1VAVA 3JBG1 3I4IA 4IETA 4FAGA 5IK8A 2EIDA 1ZBE1 2GZWA 3J4UH 2QQMA 3T4HB 1DQ5A 2HWC2 3E6BA 1PZ8A 4LE4A 2CAVA 4RGKA 1VBE2 4YM3A 2A6XA 4F7ZA 2XDVA 5FYTA 4HKWA 4MZUA 4ZU5A 1O59A 2VO5A 2ZBJA 3VL9A 2EAAA 4URTA 1L7RA 2WT2A 2GDFA 1GR3A 1YYNA 4B4QA 4OMDA 1R64A 4QGMA 1LU1A 1WCKA 1AX2A 4XDPA 3WG4A 2R062 1ZZ8A 2DTYA 1UAIA 5F5AA 4QPGA 1KFUL 1CIYA 2HYKA 2XJTA 4NVPA 3WDUA 2QCSB 4CEWA 5FY4A 1K5MC 2VJXA 1AYM2 3RMYA 1AR81 4I0AA 3O1RA 5KHIA 4M3CE 4FAHA 4H55A 3A22A 2VAUA 3EJKA 2X5IB 2EXIA 3OUIA 4I02A 2FDJA 5FDBA 2ARXA 5I93A 4B8EA 3S7EA 1NXD1 3DN7A 1UY0A 1VLNA 1QJU3 4XURA 3TAYA 1W39A 2X10A 4D7SA 1YFWA 3OBTA 1Q8VA 3R6SA 3R0RA 5I0RA 2WAAA 2JDZA 2D6MA 4DO0A 1AXKA 4LBLA 2VR4A 4FXGB 3UK9A 1U5YA 3VBUA 4A6SA 2RS52 1GP6A 4JDNA 4YG0A 3ACFA 4XC9A 5FYUA 3VDDA 1AR71 3NO8A 5EJZB 2BDRA 3IDAA 4AQ2A 2GNBA 2ZAHA 1VBC2 4KMQA 3FE5A 3I2IA 1PGW1 2XBO2 5JMOA 1RUI2 1UNBA 4SLIA 1W03A 3SITA 1ND3A 4MGQA 3VD7A 5FZ4A 5A7NA 4BJ0A 4DMIA 2QQVA 2XVLA 4ASMB 4C90A 2JE9A 3TBDA 3VV1A 4AZZA 4I09A 4P5HA 1UY1A 1BEV2 3OEBA 3JD71 5CKNA 1LOFC 2RS32 3N7KA 4AVVA 4DEQA 1QJEA 3ABZA 4J1XA 4WVVA 3DEMA 3MDPA 1W8FA 5D21A 2EVXA 1HXS3 1QXJA 3WQBA 4GWJA 1S55A 2IWGB 3JB4C 4FOWA 3H8UA 3N4MA 1Q5OA 2CGNA 2J1TA 2WNUA 3K46A 2Q0AA 1VALA 4D6SA 1LOCA 1W3VA 2D6LX 1ODNA 3NV4A 3UJOA 3CJXA 2ZGKA 3M7AA 5L73A 4JHZA 2VW2A 2XUEA 3SHRA 3ZXGA 4A45A 1CZSA 1GICA 1POV1 3SNMA 4W65A 1GNYA 2I45A 3POSA 3NJYA 3ZN6B 3O1PA 1DHKB 1LODA 1RUF2 2JB4A 2ZHNA 1EYBA 3IDBB 3AJZA 3MYXA 1QHDA 4JGZA 2ZGNA 4XUOA 5FZAA 3ZPOA 4AFBA 4CCOA 4FI9A 1Y9QA 1UL9A 4UAPA 3IKWA 5JIAA 1P8JA 4BLJA 4XDQA 3MI8A 1ACCA 2OPWA 3J8F3 4AXOA 2JIGA 3MUZ1 2BW8A 4YG6A 3PVBB 4WV8A 2RJLA 4J6GA 1RIRA 2OPKA 3WDTA 3W21A 2A6ZA 3PJYA 5KHJA 2BRTA 5KHKA 3O5SA 1DF0A 1R093 3MIGA 1JS9A 3O0VA 4NWVA 1X36A 2ZGQA 1W9SA 3ZFFB 1QF3A 4HLTA 4XETA 4PF5A 2V73A 4TXWA 3AYEA 2BQPA 4AI1A 4D0QA 2A3WA 3KGZA 5ISLA 3UKTA 4CDXA 4OHXA 1C8M2 4HN0A 2TNFA 1X9PA 5H9SA 5A3TA 1HB3A 1WZXA 2PAEA 3FUOA 1RUH2 4L11A 4DY5A 4CEYC 4CA9A 4LE3A 1O3SA 3RJ2X 4V2VA 1W8HA 4IGPA 4V2WA 4Z8BA 3QH7A 5JOWA 4MYEA 2SLIA 2YU1A 4JKMA 1CESA 2X29A 1V9U1 4M0HA 3USUB 2JDYA 3WHUA 1AXYA 3WP4A 3GJBA 2XLAA 3R4SA 3O1OA 3VBSA 3WD5A 2KM2A 3U10A 1MZEA 2PN5A 4GKXA 4OVEA 4UXAA 1BMV2 2Y34A 2B45X 1U5XA 2ZX1A 4NPMA 4XACA 3BVCA 2Y33A 2YDEA 5FXVA 3ACIA 2VCCA 3KT1A 4HN1A 4AE2A 4L97A 5FR3A 2WNVB 4YGEA 5GLVA 5D8AA 3BTAA 4LHKA 3KMHA 1CONA 4E8DA 5FJKA 2VOKA 1PO13 3FUQA 3JB8A 4Z07A 3FZ3A 1LHVA 4I2OA 3DPRA 3VDCA 5FZBA 1DCSA 1JODA 2WWSA 4FOVA 3N3HA 1Q8OA 3KWVA 2IUWA 3NAPC 5A3OA 4W4ZA 3VBFB 4RR3A 1DGWA 4Z2WA 2YUEA 3I2HA 4HVOA 5FCCA 5T5PA 5FXWA 1LKNA 3USSA 4AEKA 1IS5A 1H8TB 4PJYA 1W9FA 4IV3C 2ET7A 5A7QA 3J7LA 2JEMA 1RUC3 1SFPA 1ST8A 3WSOA 1ZZ9A 2WKKA 4LKEA 4EWEA 4ZZ5A 2YC4A 3POWA 4GA9A 4LK6A 3T1MA 4B4PA 5J1XA 3POFA 1BJQA 4FCAA 1G7YA 1UMZA 2PELA 3H7JA 3V0AB 1QIQA 4QKBA 4CDWA 3E5XA 3NNJA 4OHVA 1M06G 5JSPA 2K46A 3AYDA 2ARCA 3ILFA 5JR2A 5FZDA 1GUIA 2P3YA 5T5JA 3I3QA 4RHV1 5A7PA 1NE4A 2JE8A 3HMYA 1IHMA 2UY8A 1DYKA 1GZTA 2QQPA 3FLTA 3N7JA 1NQDA 2W3JA 4HVQA 3IPVB 3URFA 1RUG2 3DUIA 5CKQA 3VUOA 4GB33 2IZWA 2D5FA 1OMIA 2OS2A 4LA3A 3SCFA 2RDSA 2G9GA 3HQXA 4ZONA 2C1FA 3ZPYA 1XSRA 4IEPA 5KC5A 3C2UA 1DBNA 2NMNA 1ZZBA 2OXBA 4BU2A 1F15A 1KDMA 1W8NA 3C7FA 2WYSA 4X8NA 1R1ZA 4XQ4A 1B35B 1I3HA 5JPNB 5A80A 1UZYA 4QT6A 1JYWA 4M3CB 1HV1A 3RYRA 2MEV2 3WOGA 1JYXA 4TLGA 1OOPC 4DZGA 2XG3A 3WX5A 1JZ7A 1OLMA 1QJFA 4GD4A 1GBGA 3T3YA 5FP9A 1BEV3 2WAOA 2BVVA 2ZMLA 3WY6A 1O7FA 4BHPA 4XDOA 4EJRA 2FCUA 5HCBA 1W8ZA 2D43A 3T0AA 1PIV3 1SZBA 4HSJA 4XABA 2WS93 3KF5A 4YZ2A 3ZFGB 3DCQA 4PDWB 1WCDJ 3O0WA 2QQJA 3GZUC 3IMMA 3CIHA 1XU1A 4UFIA 5FZEA 3TN91 2JIJA 1N3OA 3POIA 1TEIA 2OX0A 2JD4A 4CYDA 3AFGA 1NY72 2W47A 4Y20B 1MZFA 5EYXA 3NRUA 1JN2P 1O5UA 1H6XA 1SHWB 4BCUA 3NWKA 2OIIA 3MGUA 2IVJA 2V5YA 2WINB 2XJRA 2ZKNA 3H3ZA 2X5IA 4QGNA 4B29A 5ACA3 5C4WB 3J9SA 5FMDA 5IK5A 2VZ1A 3O1VA 1C1FA 5IATA 2XKOA 5IUQA 4A3ZA 5FZ8A 2GC1A 2DVDA 1Z7S1 3D0JA 5FQ0B 4E2GA 1MEC1 2E33A 1GU3A 2EIEA 3EQEA 4FP3A 4Q4W1 1IZ3A 2RG4A 2OYZA 4RFT0 2ZEYA 1VE0A 4CP9A 2HWE1 1XQNA 5FY5A 5HCAA 2RS11 5KBFA 3K48A 4TYSA 3ZIXA 3RZKA 4KBBA 3T2TA 4GJZA 4QPYA 3E5QA 1BK1A 2PAKA 2EALA 1OUSA 5FXXA 3WT3A 2D6KA 3ZSLA 1MS4A 2QTWB 4L92A 5CZKA 1GV9A 3AJYA 4AI3A 4Q1PA 5EQUA 1N47A 3IM0A 1W2OA 3W5NA 1OLQA 4A2UA 2HEYF 3RQ0A 4D94A 4H2AA 4BYYA 1QJY2 4UFHA 1XC6A 2JENA 3Q8FA 2W1SA 3AX4A 1H30A 4XMAA 1R082 1EV12 2QQNA 4QPIC 4XCAA 5CU1A 4UF0B 1TE1B 3AZYA 4U36A 5L9RA 1CX4A 2XWBB 1HQWA 2Z79A 4PDWC 1V70A 4YVSB 3ZFGC 4LORA 1JYNA 1RVF2 2HLEA 1UYXA 2VNGA 4JQTA 3T08A 2VPVA 4ASLA 2OW4A 4WM7A 4BQ4A 1LCLA 3ZYPA 1QOSA 2VMEA 3IB3A 3WF4A 4AW7A 1OA3A 1OC1A 3JXSA 2WQZC 1SCSA 2D6PA 3ZO0B 3RWKX 2YMZA 3H3LA 2ATFA 1VBD1 1ZBA1 3GJAA 4AGVA 2D7FA 4RQPB 3VBRB 1GSLA 1N1VA 3WEZA 4AK3A 3RZGA 2R0FA 2DBIA 1D2SA 1YNAA 1FMD3 2IXLA 1TMF3 1V6NA 4Y4RA 1HQNA 2P3KA 4O9GA 1RUD1 1NLSA 2OQ6A 4RL7A 1H1IA 1WLTA 5A3PA 1UD1A 2GMPA 4XFBA 3LEKA 1RB8G 4XUQA 1UO9A 2HH9A 2JDAA 5JOYA 4PQQA 3HQUA 3N9NA 3NJZA 3CNAA 1COV2 2IFWA 2RM21 3AVRA 4YW2A 5JPMB 5FZ0A 2XHKA 2BGOA 4QX1A 1CX1A 2PHTA 2QQKA 3RZHA 3BOPA 2P37A 4HL0A 1MS5A 3VKLA 4FTSA 2Y6JA 2RR13 1LRHA 1Y3TA 5FPZA 3VDBA 3VKNA 3ZMOA 1F35A 1OA2A 2X09A 3M1HA 3PLQA 4KQ7A 4IEOA 3ZFFA 3ZYFA 1SPPB 1UYPA 2F6BA 2RJKA 3RFRA 2LTNA 3ZYBA 1C57A 2D93A 2NN8A 1HN1A 3FL7A 4KL1A 5IHRA 5CISA 4C1WA 1AUYA 2JWPA 1O8PA 4LO6B 3S30A 2OKXA 3CU7A 1R1A2 2HBTA 4ZZ8A 4LOTA 1NUKA 1OA4A 2DCYA 3FLRA 5FY9A 3K75B 1TNFA 1KGYA 3FBMA 4WVZA 5FUNA 1GWKA 4ASKA 5L7OB 1S2KA 3UGFA 2E26A 1OKQA 3OCPA 2JDUA 5SV5A 3ATGA 1ZRCA 5I91A 4Q8KA 2L9LA 3E97A 1ZBE3 3BKZA 3C7GA 3VZJA 1VBB2 1POV0 3OY8A 1UX6A 4A44A 2HJIA 2IXCA 1YJKA 3S57A 4COYA 2JE7A 1LGBA 1AR92 1X8MA 2VTFA 3KGLA 4HFSA 1NYWA 4JQRA 5EPAA 2GN7A 4LIUA 1FV3A 4D7YA 1DG6A 3GCXA 1FOD2 1OI6A 5IVCA 1GOHA 2DCZA 2ZZJA 3I3MA 3VHNA 5AFBA 1OPMA 4XCBA 5IVEA 5I0TA 2Y64A 3RYKA 2CDPA 2DF7A 1MZ6A 3B94A 3FFZA 5H9RA 5JZGA 1SBDA 2AACA 3VBFA 3OGJA 3N9PA 4HXCA 2ZGPA 4LNVA 3HN3A 4QPGB 4ZXEA 4A3XA 1JZ6A 1UU5A 4CEWB 2VOVA 1X33A 4UFMA 3IT8A 1KEXA 2VXJA 2HWC1 3IIAA 5LK7B 4HK8A 3O1SA 1G9AA 1VBE1 1H2MA 5FWEA 3LA7A 4BMEA 2ZTNA 3R4UA 3EXUA 5CAZA 1IGOA 2F17A 1OLME 2DURA 2UU8A 3EMRA 3H1YA 2VXRA 1QJX2 4OFGA 4DRVA 1QXRA 2Q8CA 2E7QA 2R061 3WUCA 5BNOC 3N9LA 1KJRA 5BXXA 3VBOC 4DOUA 1UYYA 3GALA 3S0MA 1AR73 3WP6A 5L19A 4XF3A 1SLAA 3C7HA 3PHMA 4QXHA 4ZY9A 1AYM1 3AP4A 3VBUB 1XXNA 5FREA 1WKYA 2ZJCA 1G86A 3W59A 4X6QB 4K6BA 3IPVA 1ZVFA 1D4M2 1OVPA 2PMWB 3B9IA 3HQRA 2EF6A 1LOBA 3I2FA 4DEVA 5J09A 3BUCA 4MHUA 1SMVA 3JD73 1VRH2 3V0BA 2O14A 2P5BA 3POBA 1WA4A 4JTNA 1UMHA 2DFBA 2IXHA 4PT6A 4EROA 1W05A 3C7OA 4E2QA 2VNOA 3BIWE 2UWBA 4QMAA 4O7XA 1J1TA 3ZSKA 2FDHA 4AVSA 1JYTA 4XTMA 1CJDA 3WP3A 1WCUA 1NLQA 3B02A 5B2GB 3ZDSA 1VBC1 4AEDA 3LDBA 5FZGA 4QXKA 5BPXA 3AL6A 2XBO1 1RUI1 3U78A 4JZRA 4IGOA 1SG3A 1V6IA 2WNUB 4XZUG 5F3GA 2ZGRA 4BZ4A 1UZ0A 4MXVA 4JKKA 3WQ0A 1A6CA 1WMEA 3NQHA 3UGGA 4CEWC 1BEV1 2Y6HA 3MF6A 2RS31 1LOGA 2OZ6A 1YQCA 2QNKA 1J3PA 3N7LA 1BKZA 4MHRA 4N53A 4XILA 4IE0A 1LB2A 4NIGA 2Z69A 4DNYA 3DYMA 3MICA 1FNYA 1UN1A 2V72A 4P9JA 3M3IA 1K45A 4LMFA 4JGZB 3RSJA 4IEVA 1K42A 4NRMA 3RWNA 2EXJA 3NKGA 4RS5A 3M3EA 3AK0A 3BGAA 1GKBA 3LEGA 4WVWA 3RVHA 3ZSMA 3C3VA 1UWWA 3THCA 4XFAA 2ZX3A 3AP6A 4LO7A 3VBUC 4WBBA 5JUVA 2R16A 5A6YA 3KVBA 3VDDC 3Q8CA 4MADA 2D6NA 5F5IA 4CCEA 5DQ0A 1D0GA 4ZXKA 5ABJC 4W6WA 3PTYA 5LZ6A 3LFMA 5IVYA 2G4IA 4YW5A 1ZX5A 4C1XA 2WO1A 1ND3C 3WF0A 1PGL2 1HIXA 4P08A 2ZZQA 2NZ9A 4OI4A 2EIBA 1V6MA 4UBGA 1O6UA 3OGVA 3DYOA 3DKWA 3LGRA 4I30A 3VN4A 1IG3A 3LA3A 2E7AA 2VQUA 5JSRA 5FV3A 4UW3A 1JHJA 3ZXJA 2P17A 2VUJA 4CDXB 3T2OA 4ZS3A 1EY2A 3RRDA 3OSDA 4P9IA 5LBEA 1G8WA 4LO8A 1RXGA 4CP0A 1UPIA 4KWLA 1NA1A 2W08A 4QKNA 3UNPA 1FT9A 4K8FA 1QXPA 1V9U3 5KHGA 1GZCA 4HZFA 2WFF2 1T6GC 1O4TA 2VECA 2J1AA 5IFPA 1WMXA 5FPVA 4OHZA 2IXJA 4NN0A 4QPWA 3WXPA 1VMHA 1YQ2A 2AYHA 4NROA 4IE5A 1KS4A 2R072 3SKJE 4E2SA 4XQDA 5IJRA 1C8M1 1OQEA 2CL2A 4C8DA 2AC1A 2NLRA 5GLWA 5T5LA 5A6XA 5H9PA 4HG6B 2VOTA 2WYFA 5M0TA 4RQPA 2AENA 3KT7A 1RUH1 3CKHA 1VR3A 4AQTA 4JGZC 5DG1A 4NPRA 5BNNA 4L2NA 1VBB3 2O0OA 2VH9A 1QNYA 1QOOA 3N35A 5D8AB 5DPNA 2D97A 1TZOA 1KDKA 4LHNA 4FPYA 4AFDA 1K12A 1LEDA 3H3UA 5F2SA 3DPRB 5DAQA 3CHXA 4JHTA 1BMV1 4Y1XA 2C5DA 1D2QA 2BOJA 2D6OX 4OUMA 5F6KA 5FUIA 4RR3B 4QQ2A 5GZFA 4YFZA 5HBAA 3BTXA 2A5ZA 1Y9GA 2VMHA 2ZMKA 1Y4WA 4Q4Y2 1FNZA 4LT5A 3RJRA 5FBJA 1STMA 3MPBA 1OHFA 2W2IA 2VG9A 5CADA 3O7OA 2BPA2 4XFGA 2WZR2 3LSEA 2ZABA 4N43B 1YQ8A 4RHV3 4ZU7A 2ZMNA 3FJSA 2BU9A 2NM1A 2WNEA 3M70A 4HANA 3GYDA 5A7WA 3V56A 3WQ7A 4CDWB 1HRI2 4NIAA 2PHRA 4ES9A 2YC0A 4GIQA 1QH6A 4MGSA 5KXBA 3ENRA 5LCWL 3NNGA 2BWCA 2XH6A 4CRQA 3PUHA 3RS6A 1CR7A 4H7MA 1BHGA 2R042 2RMU3 4INDA 5HPOA 4M3CF 4O65A 1W6MA 1QQP2 2G9FA 5JVVA 5LEJA 2VQTA 4URAA 3VBSC 2WA3A 2WWUA 1RMU2 1U5IA 2PHFA 2WC2A 4GH4B 1D4M3 1VAMA 2W91A 2XJQA 5EJ3A 5JLVA 5KR7A 4R4ZA 5J7MA 4TZDA 2G19A 4E8CA 1L3JA 1Q8PA 1XYOA 1HJFA 1RJ7A 4XHXA 2YPJA 1XJAA 1OUXA 3T30A 4QU2A 3BYWA 1GWLA 1E5SA 1RUG1 3EB7A 3KT4A 3PVNA 2WN2A 1W2UA 2JX9A 1JI6A 1DDLA 4BOWA 1JYIA 3DV8A 1XNKA 4IEWA 4LK7A 3TN93 1EPZA 2ZCWA 4C0HA 2PFWA 5AC92 5DAVA 5IFTA 1A34A 4MSVA 3INAA 4L0PA 5LA9A 4EWAA 4K8RB 5GKAC 5BNPA 4XUPA 5CFDC 1IQDC 4QX0A 3TYJA 1N1SA 3S5AA 2YHJA 4W6YA 3SEEA 1NLRA 3U14A 4AI9A 3MZHA 2MEV1 1AJKA 2DWRA 3WNKA 3H8XA 5GZGA 3U4XA 5K0UA 4B7KA 1QDCA 2VU9A 2WA4A 2XHNA 2R6QA 4LTAA 4AAXA 4CCJA 1Z7S3 2VZOA 3ECQA 1OT5A 1QMJA 1SQ4A 3EO6A 4RA0A 1YJLA 1C8NA 1MEC3 2GALA 2ARBA 4BQ3A 3GF6A 4Z2AA 4LIVA 1SBFA 3I97A 4Q4W3 1OBNA 3OPZA 1QJZA 2ADDA 4IXLA 2HWE3 4JVAA 5C70A 4YVWA 3WG3A 2RS13 2XOMA 2DBNA 4FXKB 2DVBA 3PURA 3UESA 1H2KA 4HKLA 5C5UA 3WG2A 3BB6A 1NY71 2N7GA 1S0EA 3O14A 4Q0UA 5CKMA 5FY8A 4CP9B 4Z82A 1FAYA 4LXLA 3RDIA 4D69A 3AP7A 1GZ9A 1KS5A 1W6OA 2VZQA 4LBKA 4ATFA 2PHUA 1VBA2 4Q1RA 5HV4A 1O3RA 3KLSA 1JUHA 2ZEZA 3QD6A 1A8MA 2PHLA 2HEVF 2ZACA 4QM9A 1GMMA 1FYUA 3OOXA 1OLRA 2AH2A 1WBFA 1BCXA 3CJIA 1APNA 3MW4A 3WZ1A 5IVJA 1ZRDA 4IW3A 2CSGA 5CEHA 4IEZA 4Y26A 3RYPA 1GP5A 5HI0A 2XQXA 3MIHA 5FP8A 1WD3A 4Y5TA 3ZR5A 2V4VA 3MLKA 1MVEA 4Y22A 1VBD3 1ZBA3 5A1FA 1JZ5A 2BBAA 4NHYA 3ZR6A 4WM7B 3ELNA 4OQ8A 5FYYA 4IQPA 2A75A 2RDNA 4UW4A 3ZSEA 3OGGA 3MIDA 3RZLA 1AZDA 2MHFA 1QJY1 3RPQA 1RUD3 2BFUL 1PK6A 5HCHA 4FTBA 1SBEA 4PIXA 1UOJA 1WBLA 1R081 1EV11 3TEXA 5IVFA 4GWIA 2QQWA 1SLLA 2X5IC 3A23A 1FPN2 1REDA 2PLV2 2Q1ZB 2WO7A 3O0XA 4FOYA 4OZXA 4B4RA 3VD3A 1RVF1 4WM8A 5GLUA 1PVC2 1UZVA 3LPGA 2J1UA 2E7TA 2RM23 1O3TA 1I5ZA 4PI2A 5DUUA 2VD7A 4Q27A 1RC6A 5ANQA 4GALA 2XPJA 1AL22 4BK4A 3HIFA 5DDJ2 1C3HA 1IS3A 5FZFA 5J37A 4CDQA 1X8EA 3ORJA 2JG9B 4KI5M 2HKXA 2WL1A 4HMZA 3PUQA 4I0WB 5FPAA 5KXDA 1I9RA 2AUYA 4COVA 1IPKA 2BNNA 1LR5A 3WG1A 3UL2A 5LWBA 5A7SA 4XF0A 4P9YA 2WDBA 3HJRA 2Y0OA 2VOXA 5F9TA 5JR7B 2QUOA 5HV0A 5IYYA 1OD5A 1COV1 4AFAA 4P9XA 4OI2A 5F37A 1LOEA 4IV1B 4R8HA 3N9QA 3AYAA 1NCQA 1AHSA 1O4ZA 4Q0VA 3B7MA 4K20A 1ZA4A 4DXZA 3UKVA 5LY1A 2VULA 4FPJA 2HWD2 1YFUA 4NHKA 2RJ2A 4HBNA 4WM7C 4XXAA 4HSLA 2VQAA 4AEJA 1PM7A 4COZA 2XONA 5FO9B 3APBA 3VGIA 1LTEA 2JG8A 4WVMB 4XE9A 3KF3A 4P00B 3ZKYA 1CQ9A 1YC61 3B3QE 3MEPA 4GXLA 2BNMA 2CDOA 5C9AA 1ZRRA 3GHMA 4A41A 2QKDA 3OY8B 3SH3A 4AWDA 1FX5A 4R9CA 1MQTA 4Q4V2 1R1A1 1Z0HA 2VCMA 3SISA 5CIRA 4CU8A 3WUDA 1S4CA 2YZ4A 4PQ9A 4BQ1A 2UYBA 3HBKA 3L2HA 3LEIA 1REFA 5CB7A 2BERA 2HYXA 4XUTA 1C5HA 2WLPA 3PIJA 3MIBA 3JU9A 4DIQA 4M01A 4QDRA 5FP4A 3AXDA 4LBQD 4XF4A 2P1BA 4NIDA 1NCRA 4LBQA 3LPFA 1UIKA 4XYXA 1BLZA 4XPVA 1VBB1 1MS0A 2GMEA 4UBHA 2HWC3 3RGBA 3WCSA 4LQRA 5JZGB 1DQ4A 1JU4A 1VBE3 5FMOS 4QB2A 5IWFA 1HRV2 3HVDA 4YLZA 4EN8B 3IN9A 1AR91 5A1AA 4PI0A 3ITQA 3THPA 4BIOA 2XLGA 5AC93 4YYOA 4JAAA 3ZFFC 2R063 1NQJA 2GP5A 1DQ6A 2RDRA 3FHIB 4XQWA 5HXVA 2WSVA 1LOAA 2V09A 3OG2A 3HEIA 2WN3A 4N43A 3KV5A 3I2JA 5B4XA 1AYM3 3VKFC 3WW3A 5I0SA 2FZ2A 4J25A 4BQXA 5ANNA 4TLFA 2QQOA 2MNGA 2JDMA 3FX3A 1PVXA 4P9LA 4YSFA 5JWPA 4A7KA 3KCCA 2FCVA 3M4FA 1Q3EA 2VY0A 1W28A 2YFZA 3ALQA 1QJX1 5LRSA 1K5MA 4BE3A 3LDKA 2Y6KA 3O1TA 3M2MA 2NP0A 5DXDA 4Q5OA 4BPZA 3V0BB 2RS53 3OBAA 1JZ3A 1AF9A 1ULCA 1YI7A 2RMU1 1Q8QA 4PBPA 5CNAA 1AVBA 3H0OA 1H1AA 4GH4A 1OFSA 2P6HA 4K3UA 1VBA3 3OTFA 4FPOB 1VBC3 2FCTA 2JKXA 4NWWA 1F9KA 2ETEA 2XBO3 3I54A 1RUI3 5F5QA 2LW8A 2WNVC 1U0AA 2WT0A 4Q0PA 2Y8KA 4XEZA 1D4M1 3K77A 3LD8A 4YFWA 2Q4SA 3JBG2 2WABA 5JOXA 4AEDB 2OZJA 1ZM1A 3VZNA 4KNCA 4G3YC 4QAWA 5FBZA 1VRH1 2RS33 1AJOA 3VBFC 3P5BA 3ST7A 1JHNA 2WR9A 4QHBA 3DXTA 3PMEA 3DL3A 1DZTA 3A0KA 5FZIA 1PM4A 4N53B 1NX9A 4EN9B 3ZDVA 1H8TC 1W06A 5F32A 5I8SA 3BOWA 4FFHA 3PU8A 2A6WA 3LCPA 2B39A 3FWEA 4XXPA 5DABA 5FZOB 1PX4A 3CMGA 4NHMA 2YBKA 4DB5A 1GLHA 1IKPA 4GWNA 1IPSA 1LOFA 5C8CB 1NG0A 1V6OA 3AZVA 1S0IA 4RS5B 1W6QB 5F2WA 5T5OA 2ENRA 4DXSA 3WQ1A 3KHBA 1RUF3 4LBJA 2C9KA 4QU1A 1US3A 1GOGA 3VBHB 5FYBA 1VB2A 4K9SA 1NZIA 1E5HA 1LHOA 5T50A 4TN7A 4KWJA 3KM5A 3POGA 1XU2A 4MOAA 4Q4X2 4E27A 1JW6A 4Y3OA 2DCTA 4TWTA 1OQ1A 5LBCA 2EICA 2QBXA 3AFKA 2W0XA 5A6QA 1CWPA 4OHWA 3W5MA 4KU7A 3PJQA 4AHZA 4FTEA 1B35C 1PGW2 3CF6E 3SH5A 4MXWA 1NE6A 2QJVA 2ORXA 3CBNA 3WCRA 2JDNA 4GKYA 2VMGA 2XL9A 1JOPA 3B69A 1F2NA 5FXZA 3U11A 3UETA 4AGGA 1GOFA 4XIKA 4AEDC 3BPZA 4MGZE 2X8KA 1NA1B 4M4RA 3ETPA 3KV6A 2UYAA 2P6CA 3OYWA 2C4XA 2MPFA 1PGL1 2Q30A 1O5LA 4ISQA 4Q2FA 2HWB2 1C8M3 3VL8A 4AGRA 4NIHA 4QM8A 1UOGA 2J1VA 5C3RA 3PIGA 5C5TA 3OF1A 1MVQA 4XJZA 1RUH3 5EYYA 4CP1A 2IXIA 5FYZA 1K5JA 3ZXDA 4B1MA 3X29B 2FMDA 1V6KA 3L9JT 1HKDA 3EYPA 2Q1MA 4MX3A 3T0BA 4CUAA 2B4KA 2RHPA 5A7OA 2BVBA 1ONAA 5FYIA 2W52A 2HWF2 2QDRA 2ZX2A 3P6BA 2WFF1 5BNNB 1J84A 1J58A 5C4WC 1NXMA 2FBEA 1MPXA 3FHQA 3AP5A 4META 4QX2A 4XF9A 2W95A 2LALA 4P14A 3ZLIA 4PCRA 2QZ2A 1ODMA 1RTVA 4CEYA 5KWRA 2R071 5A70A 3EBRA 1VRBA 5FFOC 3IAPA 2ARAA 2W1WA 4IERA 4M0NA 1VB4A 2AEYA 2P2KA 4BQ5A 2JG9A 3ACHA 1OPOA 3TEWA 1EUTA 1LULA 5FYCA 4NIIA 4EE2A 3HD8B 2PTMA 4UFJA 4XHBA 5DAXA 1RITA 2H0VA 1POQA 3RNSA 3Q8AA 2CTVA 5FYVA 1LGCA 2GC0A 3VZMA 3IIIA 1CAUB 3WINE 3THDA 1DGLA 1HB1A 3ZYHA 1EAH2 1KJLA 4FPLA 1H6YA 4DRRA 4PF1A 5F1RA 5A7WB 1RUE2 3LAGA 5EFUA 2JD9A 1CVNA 3AMHA 3AXEA 2UURA 4QKFA 4S2DA 3VKOA 1DGWX 2ZGUA 1NA1C 4IV1A 1MS3A 2OQ7A 4QXBA 1JYVA 4YNIA 2SBAA 4R9AA 2ZGTA 1TME2 5FMOL 2NQYA 2PXJA 2DVGA 3DECA 4YVSC 1ULPA 1W90A 3NNFA 3NAPA 2HBUA 4FPKA 4DS0A 1PO22 2PHWA 5F6LB 5JAXA 3KHCA 2WZR1 1CAVB 1W6MB 3QOPA 3NKTA 4LBNA 5EWSA 5FY7A 1LEMA 3RMXA 2VZRA 2W1QA 2VCBA 4WVMA 3F95A 1HRI1 4Y1ZA 3NV1A 3RZZA 4RQPC 3VBRC 2WUHA 2XJPA 4AHWA 1CAXA 3SQOA 1ASJ2 5FOJB 4FQ4A 1E57A 5LBFA 1RUG3 4BDVB 4XFFA 1RHI2 2P3IA 5BNNC 2JDHA 4LLOA 4EN0A 5DZGA 4CXXA 2VNRA 3POJA 3KQRA 2R041 1SFNA 1ZZCA 2WNOA 3DGTA 3LWCA 1QGLA 4QDSA 1D0HA 3SEPA 4JGYB 3GCWA 1AYN2 3FMGA 4CXWA 2XB6C 3TEZA 3WW4A 3AMQA 1GZWA 1RMU1 4UOJA 5E89A 2MEV3 4IE4A 2DCKA 4K7JA 4PHZA 4V1PA 5IK4A 2EAKA 4NOTA 1QWRA 2GNTA 5BNPB 3U1XA 4G9SB 2WZ8A 1Y7BA 5FO7B 4CXYA 4LUKA 2ORZA 4AI2A 1W04A 1A8DA 4PIYA 5J36A 1AR62 5APAA 4LBMA 4XOGA 5K0UB 2W92A 3PMSA 2O8QA 3MIEA 1BBT2 2DUPA 1LHNA 4MLOA 3LOBA 3AMMA 1KFXL 3TB0A 5AC91 4HETA 4NO4A 1OOPA 3O1UA 2H0BA 1C28A 1PZ7A 4FPCA 4OYUA 4XFIA 3FBYA 5BV6A 4YVWB 4QQLA 2W39A 2XJSA 3ZVXA 4A7YA 4DY3A 2YV8A 1ZYBA 3I59A 3M8LA 5DN2A 2YBPA 2LUWA 1ULDA 4HK9A 2WLQA 3D0SA 2YGLA 4W50A 5L7OC 1RGSA 3WLUA 1N3PA 1XNTA 1YFXA 3O12A 4HVRA 1W6OB 2DCJA 2JXAA 3NNMA 4PLOA 4M00A 4XJ9A 3ILNA 2BOIA 2UWCA 2A6VA 2VMIA 4NHXA 1H1MA 4AVAA 4N7IA 3UYJA 4XFCA 1QEXA 3H8OA 1DYPA 1U12A 2QQUA 2W94A 1KITA 2YC2A 1G9BA 4X6RB 4HOOA 4COWA 3KCXA 4CUGA 1DZRA 2J7MA 4DQAA 3CJIB 4IEYA 2ZGOA 1V6JA 2RS51 1RUJ2 3TOJA 5IVBA 4XAEA 1JBCA 3WV6A 3AVSA 2NPIA 2WBKA 2Q8EA 1ALYA 1VBA1 2X05A 3TWIA 2R7EB 3BALA 4Y22B 1QJY3 2AZ5A 2GP3A 3BTYA 5A33B 3ETQA 4R9BA 4OLLA 1R083 1EV13 3U07A 1IOAA 2KR2A 3I3DA 4QPGC 1QDOA 3N7MA 1HDKA 2VZ3A 4HT1T 4Y1VA 1UU6A 1OD3A 3VZLA 2A70A 2GU9A 1PK6B 1RVF3 2BTVC 1HB4A 3I3EA 4O61A 4YW3A 3F2ZA 4CP2A 3AKSA 3OD4A 4BK5A 1GNZA 1FXZA 1XB9A 1O3QA 3FHAA 3U4SA 4BXFA 5FZOA 2XL7A 4JDMA 4QWNA 3QCWA 4WM8B 4IGQA 5FZHA 2WQ8A 3ZSJA 2D3SA 1O4YA 4YM1A 5C8CA 1W6QA 4EYUA 1UMIA 1S2BA 4CDQB 3W20A 1RL3A 1D7PM 2VW1A 3I2GA 1VP6A 3HAGA 3VBHA 4GMP3 2RV9A 4AF9A 2ZKLA 2VL4A 1CJPA 1H9PA 3WF1A 1XNCA 3LA2A 1FPN1 2PLV1 5E16A 2ZHMA 1RUF1 3ME2A 1COV3 1PVC1 3GZTB 4QXCA 4AQSA 3AB0A 1QJU2 4MH0E 4OZOA 4Z92B 3CQOA 3HWJA 2AREA 1CZTA 2XJVA 3OEAA 1AL21 1W6PA 2VTXJ 4NUBA 1ND2A 5DDJ1 1Y9MA 4CUBA 3B9CA 1T6BX 3CJIC 4D6RA 1WLDA 1HW5A 3GGLA 4PLMA 5F5CA 3POEA 4P9WA 2BFUS 3WNPA 3WNNA 3ZXAC 2XVKA 1NCQB 5A32A 3LQCA 3MW3A 4CCMA 4BB3A 3AZZA 1UZZA 4GWMA 3T09A 5CA6A 1UPSA 5I0UA 4LUMA 1UX7A 3W9AA 4YARA 2NMOA 4EN6B 1H0BA 1UY3A 2WNUC 1XBFA 3BODA 3P3PA 2JG8B 1R1A3 2BUKA 3I3BA 1NZCA 3C7EA 4QKDA 5FO8B 4LULA 5C9AB 4KU8A 2W46A 2ZEWA 1HXS2 4NRPA 1MQTB 4XFHA 1J59A 1JZ4A 4HPKA 1X7NA 2VZUA 3M3OA 4IUGA 2E63A 2HWD1 2XQRA 5E1RA 2FDFA 5AFEA 1ENRA 1F4HA 2TBVA 3KCYA 4N7UA 3T2QA 1G9FA 1V00A 3VD9A 2AGSA 4UYBA 1C5IA 1Q56A 5G05L 1DQ0A 3D4KA 4NAOA 1YIFA 1NCRB 2R1DA 1AR93 2Y26A 2ZGMA 3KQ4B 3LIHA 4LBQB 2BJSA 4JCKA 4MO3M 1A78A 3KZ4C 1JZ2A 2CGOA 5FMCA 5FPBA 2Q5TA 4YGBA 3R4DB 3K3NA 5JMCA 4BA6A 1L7QA 1SDDB 1FOD3 4AVTA 2G1MA 4CDUA 4MG2A 1JTZX 2CAUA 4NAMA 2D40A 2ERFA 4IE7A 4N90A 1PZ9A 2OA2A 2W68A 2YY1A 3THTA 4OI0A 1YQ6A 1W0PA 4YGCA 5KHHA 4AYUA 4FO9A 2VMDA 3RG0A 3J8F2 4ISRA 4QDQA 1CAUA 1AR63 2Z4FA 3SLIA 1S0FA 2QQLA 4NR1A 5G04L 1S0BA 4CDXC 4JRLA 1YLLA 1YXWA 2YROA 2JECA 3HNYM 5GZEA 1HRV1 1Y43B 4W6XA 3HBZA 3VDAA 4J1WA 2VZSA 1F31A 3NSTA 1QJX3 1R092 4QX5A 1WWYA 5FZLA 3I49A 2WJSA 1YUDA 3AMPA 3MPPG 3HT2A 5LBBA 3ZYIB 3O1MA 1PNFA 1LHWA 2GAUA 1CAVA 4DUWA 5JXJA 4CCKA 5C9AC 1K5MB 3CL1A 2BBVA 3W58A 1AXZA 5IAXA 3J7HA 1MQTC 4UW5A 2A1XA 2WT1A 1W6NA 2Y38A 3E6DA 3PL0A 4ARYA 5CFCA 1WMFA 4S2HA 2CY6A 5LB6A 2E53A 1VRH3 3LE0A 2O8OA 5BNOA 5D8AC 1WLCA 1K3IA 3VBOA 3P1IA 3VLBB 1F5JA 2FMYA 1OURA 3GBWA 3M3CA 4JGYA 2EXHA 3DPRC 3GBGA 5FP3A 4Q29A 1TQ5A 2BV4A 4UI9L 2LRPA 5A3LA 5DZFA 3E5UA 3G7DA 4BQ2A 2ZA9A 5DUXA 4RR3C 3LF7A 5FZ1A 4AFCA 5BY5A 3K4AA 4C91A 2WQ4A 2ZEXA 5FP7A 2VBDA 5H9QA 5A3MA 2Q8DA 1C4RA 2B9VA 5AVPA 3QLQA 1GQPA 3V64A 1PO12 4N43C 1UW8A 5GM0A 5F8PA 5LA2A 5LW9A 4CZSA 4RD7A 4MGYE 4CDWC 1BQPA 1EUUA 5LEKA 4D6QA 1DIWA 1I5PA 1UXZA 4D3WA 2WIIB 5JI9A 1H2LA 1I1EA 4K1ZA 4GQ7A 4E4ZA 3VZKA 4EZ4A 1LJ7A 3FLPA 1RUC2 1S0JA 4FQZA 4BISA 2XVGA 1CN1A 3NV3A 1ULOA 3K4ZA 4Y24A 2A6YA 2DDUA 1WUVA 5JCTA 3WNLA 4XW3A 4I01A 2GC3A 2D3RA 5DMYA 3TEYA 4JX0A 4QX8A 5C33A 4MGIE 3WP5A 4GH4C 3VKMA 3NJXA 3MBWA 4IESA 4O9EA 4CE8A 4EQVA 1GP4A 3CDZB 1UU4A 1J3RA 1W2AX 2VW0A 2IFRA 2XJUA 4MXWB 2O1QA 1UZWA 1JMUB 5I8YA 3LB9A 1IQAA 2ZOEB 4H7LA 4RN5A 5FK8A 5JIUA 2J1EA 3DXUA 4GB32 4GZ9A 3H1WA 2DTWA 4Q4X1 3OYWB 1WLWA 1TG7A 4A42A 4DXRA 4JV4A 1YCIA 2FQPA 1ZA7A 2XXZA 3OJBA 3ZYJB 1F4AA 3AC0A 1YHFA 4KGGA 5FTTC 3IDCB 5IW0A 5ABJA 5FLJA 5A33A 1HV0A 1B09A 3H50A 2Z42A 2Y0IA 4OI1A 2WFF3 4RGGA 1JXNA 2Z5WA 2YBSA 1YEWA 2OT7A 2DFCA 1H2NA 2A7AA 1HX6A 3POYA 5LY2A 1NAEA 1PIV2 2R073 3TRSB 2WS92 2HWB1 2P3JA 1UKGA 5GJ6A 2WSUA 3KSCA 3VHOA 4CEYB 1GFF2 2J22A 2X53S 5GLZA 4EZHA 3A4UA 1OSGA 1A3KA 2GNDA 2VTXA 5C3SA 1LECA 1J3QA 4FFIA 1LENA 4N9HA 2HEWF 2HWF1 5IT6A 5C3PA 3WR0A 2GSYA 1DLLA 5ACA2 2JB8A 4PIZA 3L2YA 2PYTA 3UT0A 2F4LA 4FPHA 4LJHA 4XTPA 1WCSA 4GMP1 1UY4A 1W9WA 2VC9A 5JI7A 2ZGSA 4DINB 1S1AA 4Q4Y3 1YQ5A 1CZVA 3JQWA 3PVOA 4F83A 1ULGA 4YM0A 1G9DA 3GXUA 3PTRB 3VD5A 2WZR3 3ZXFA 4AR2A 5FY0A 1C1LA 2WZEA 4R52A 3BIEA 1XYNA 4Z1VA 3GBFA 1QU0A 4TSVA 1HRI3 2VMFA 2XGXA 3NAPB 4QHOA 4ZS2A 4Y5SA 3AMNA 3MHZA 3H8RA 2I07B 3LSDA 1IS4A 2VZPA 5IK7A 1JUIA 1EAH1 1UIJA 1UOFA 1ENXA 1OQDA 1T2XA 2D5HA 4ES8A 1RUE1 5C71A 4FSJA 4CUCA 1GQHA 3H9AA 5A3WA 4IV3B 5GALA 4X8PA 3SC7X 1CAXB 2ILMA 3J7MA 2ZHKA 2R043 3ZYRA 2RDQA 2D98A 3Q8BA 3MFCA 1QQP3 1TME1 4FVVA 4ONUA 3FC0A 1WMDA 1PMJX 2VNVA 3BPSA 1PO21 1RMU3 1W3XA 1OH3A 2V5DA 2VVEA 3DYPA 4JTOA 4P02B 1U5ZA 4Q0QA 2DVFA 1BK0A 3SH4A 4CTEA 5K8SA 2H6BA 1GZWB 4ARXA 5JXHA 2DV9A 3WVJA 2V4AA 2C0ZA 2YG0A 3SXWA 1SLTA 2JG9C 4EV0A 3IWZA 1ASJ1 5C3QA 1CPNA 2XKPA 5L36A 2R49A 4FT8A 1FMD2 1RHI1 3AP9A 1JZ8A 5DAPA 1TMF2 3MFAA 1ZZ6A 4FBFA 2B7YA 2W87A 1O8SA 1W9TA 1I6XA 3OB8A 4Q0SA 1XE8A 3ZXLA 1TVGA 4UFKA 2GH8A 2IXKA 3ZFEA 2JICA 2VZTA 2CHHA 5GZDA 3LKJA 1FOD1 1AYN1 3ACGA 1LU2A 3H42B 4YGDA 3UGHA 5KXCA 1EP0A 1BZWA 3ZMNA 1DYOA 3MF9A 2PHXA 2K2SA 4IV1C 1OOPB 2J42A 4XJWA 2DUQA 4DXTA 1CIWA 3AKRA 1US2A 4YW6A 1NT0A 3GNEA 3IAQA 3JZVA 1XE7A 4OMCA 4RYDA 4YRDA 1KQRA 2B42B 2RR12 3I59B 2ZXQA 1AR61 1CAWA 4LHSA 4JKLA 4LKFA 3ZYGA 5CVRA 1BBT1 5CFDA 3WNMA 5HXMA 2F4PA 4XIOA 5LATA 3D3AA 4COUA 1H8VA 1Z78A 4KG8A 5LK5A 3AM2A 3T1LA 3ZKUA 3JUUA 3G6JB 2LS6A 2Y6FA 3GHNA 2FZ1A 2R1BA 3LOIA 4IEXA 2W5FA 1UCXA 4K21A 3AKTA 5FMBA 2Y60A 3JQXA 4CCDA 1AX1A 4QQPA 5CG9A 5LA0A 1LESA 2EIGA 1RUNA 1IG0A 1IKQA 4IEUA 2YYOA 4QX3A 4BM8A 1W8TA 2VGDA 2JKBA 4ET7A 2VZVA 4BQYA 4FFGA 4LR4A 4BQWA 3IDEA 4Y5Z0 2FDIA 1ZBE2 2VUDA 5EJ1B 2E9QA 3FFQA 5FYHA 2QVSB 4Y1YA 5FZ9A 4CU6A 1Q43A 1SEFA 5JZGC 3IZOA 2Q8OA 4B7EA 1BVP1 4GAZA 3UV9A 1UQXA 3HR9A 2J1RA 3OGRA 1CD3G 3S7IA 5L9BA 2R0HA 2YGMA 2TEPA 4I0BA 3ZXEA 2J1SA 1RUJ1 3LZZA 2A3YA 4H14A 1DLCA 3MIFA 5J48A 2A3XA 3I2DA 3ACLA 1ZREA 1W2TA 5JXIA 4E9KA 3N9MA 1DZQA 1MACA 1AR82 3M3QA 4FPFA 5FLIA 1LHUA 1MR5A 4QPIB 3WNXA 3ZN5A 4QGLA 2VOWA 2YPDA 3PVEA 4RFRB 2XWJB 1FPN3 2PLV3 5EXOA 4L99A 5E88A 2ZX0A 2BZDA 2A73B 4OUEA 1PVC3 4UT5A 1ENSA 5T55A 1OFNA 3B01A 4XMIA 1QH7A 1M4WA 2QQIA 4CSWA 5C8WA 2VM9A 5FZMA 1DQ2A 1AL23 5DDJ3 5EZWA 1N3QA 1YRZA 5A3NA 1JYCA 1OKOA 1QNWA 2B5HA 1XNDA 2VCAA 4N9IA 2OUHA 4KBZA 5ERLA 3TNQA 2E6VA 1AR72 1W6PB 3U37A 1ND2B 2VVDA 2LM3A 4W8JA 4B1LA 2PQSA 3I7DA 5JDBA 3S6PA 4TTGA 1MS1A 2DU0A 1X82A 5A32B 1QY4A 3QACA 4H3WA 5L9VA 2E32A 5EIYB 5LRRA 1PMHX 1ZZ7A 3JD72 4K40A 4A6OA 1XRUA 5F3EA 2KA3A 1QJU1 4LA2A 5SV8A 4C0BA 2PAMA 4ZHNA 1E5IA 1WW4A 1XNAA 3WW1A 4DUXA 2ZHLA 1CGPA 3S5QA 2QFEA 3EHKA 3WF3A 3KV9A 4N53C 1BYHA 2BP6A 2HWD3 3ZXKA 3MW2A 5K9YA 4LLFA 3V65A 1WW7A 4QB1A 4LEJA 3CEWA 1QOTA 3GDBA 5E8AA 5FZKA 4AVCA 4YZ4A 4AHXA 2PA7A 4HPKB 5FUPA 4N8MA 5FIXA 4DPNA 1VAKA 4JDOA 1YWKA 2D44A 3MLLA 4KH9A 3NV2A 5C8CC 1GYKA 1IS6A 4RS5C 5K4LA 5F3CA 4MUVA 3VB9A 4Q4V3 4CCLA 3RI8A 4XAAA 1PMIA 4AOCA 1G6NA 5EV7A 1S0GA 3OPTA 2VE1A 4YM2A 1YO8A 2DYCA 3ZOIA 3VBHC 1SLIA 2WWJA 1HXS1 2B46X 2VUCA 4M4PA 1RJ8A 3WDYA 1DU3D 1ENQA 3KB5A 4LBOA 4XF1A 3ZX7A 3LIGA 4CDUB 5KXEA 2GC2A 4IEQA 3OD0A 1H9WA 2AEZA 2EA7A 3H1MA 4Q26A 1TNRA 3I2KA 4HKOA 5JOZA 4KWKA 2FD8A 3AKPA 5DZEA 1F8VA 4NE9A 4L8QA 4NHLA 4P5YA 1ND2C 5IVVA 3ZN6A 4R9DA 4I3PA 1HRV3 2BGPA 1OH4A 2B8MA 4AQ6A 4U2AA 1OVSA 3ROUA 5GZCA 4LKSA 2C24A 1GWMA 5HCFA 2E31A 3RI9A 4OULA 4BMBA 2D3PA 5CBLA 1W8UA 1PX3A 3FN9A 3MV01 4SBVA 4WZCA 3OUHA 5LASA 4A7ZA 3OGSA 1JH5A 3BN6A 2FHRA 4F3JA 4Q4Y1 2C6SA 4QQHA 3T2PA 4QD2A 5J96B 5JSOA 1W0NA 4LHLA 1SLCA 4Y4YA 3MLJA 3WDVA 3J8F1 3K51A 3OBZA 1MZ5A 1WA6X 2W9XA 1O91A 1X9TA 2YB7A 4YWAA 4NJ4A 3U75A 3B93A 3SCHA 1W6NB 3LDRA 4IV3A 1WW6A 5BNQA 3SCGA 5CFCB 2EXKA 1ZRIA 5FPLA 4CU7A 1V9U2 1N1YA 1R091 3WDWA 1NOVA 3K4DA 1WGPA 1J1LA 1WCQA 3ILRA 1FATA 4OUSA 5BNOB 3VBOB 3K2OA 1XSQA 4YZ3A 4NPLA 2K0GA 1G9CA 1QQP1 2R32A 1UKRA 4AL9A 3AKQA 5DG2A 2BYVE 1VJ2A 5FZ6A 2ADEA 5CYYA 4CDUC 2B9UA 1BVVA 1YIPA 2ZAAA 1HJGA 5FYMA 3JBG3 1GQGA 3USUA 2XR4A 3PU3A 2XMLA 1VMJA 3HNBM 5FKCA 4BIFA 3R05A 4IL7A 1VMFA 5DAWA 2QDNA 3AYCA 2R30A 4GMP0 1Q8SA 5A6ZA 4D7TA 2GN3A 1GANA 3C8XA 3PUSA 5B4NA 3HNMA 1UYZA 3ASIA 2FDGA 5AVAA 2WNVA 5D2AA 1OXCA 3ON7A 3PUAA 5D1IA 4OQ9A 3ZIWA 4FPGA 5FJHA 3BI3A 1ZRFA 4UWDA 2VQ0A 3DKQA 5J98B 5GLTA 1H4HA 1URXA 1KRIA 5BYNA 1VPHA 4E4SA 1AR83 5EHDA 1F5FA 1SDWA 1W8WA 5FK7A 4HONA 4YW7A 1PO11 1DQ1A 2UWAA 4XZPA 4RHV2 4ZKTB 1H4GA 4JRAA 1E5RA 2I2SA 2UY9A 3D5OA 4LKDA 1H8TA 4BXSV 4KG0A 1MS9A 5CFCC 4YPJA 4Y33A 4FPEA 1GNHA 4R4XA 2XLFA 2BWAA 1S0DA 4Q4X3 3I8TA 3V0AA
chains in the Genus database with same CATH topology
4LPLA 4DUWA 5JXJA 3VD4A 3J7HA 5CZKA 4ARYA 2RJ2A 3W5NA 2XONA 1RYYA 2W1UA 3LE0A 4P00B 1NKGA 1XC6A 2W1SA 4XVHA 1K3IA 2CDOA 2QQNA 3P1IA 2RVAA 3MUY1 1DP0A 3T0DA 4UI9L 1JYNA 2HLEA 1UYXA 3T08A 4D8MA 4CU8A 3LEIA 2VMEA 3IB3A 3K4AA 3WF4A 3JXSA 2BERA 2ZEXA 2HYXA 4XUTA 4CVUA 4QDRA 2Y6GA 3WEZA 2B9VA 4QB6A 1GQPA 3LPFA 3A21A 4LQRA 5LA2A 1JU4A 4QB2A 1EUUA 5A1AA 1OF3A 1UXZA 1I5PA 3LEKA 4XUQA 2JDAA 4PQQA 3CZUA 3OG2A 3HEIA 2BGOA 2WN3A 1ULOA 4QX1A 1CX1A 3I2JA 5B4XA 2QQKA 3K4ZA 2DDUA 3WNLA 5DMYA 2Y6JA 3VDBA 1OF4A 1W99A 2QQOA 4JX0A 2X09A 2YFUA 3MBWA 3NJXA 3NJVA 3CDZB 3A7QA 2YFZA 2ID4A 4RN5A 1HN1A 3FL7A 5IHRA 2VMCA 2J1EA 1O8PA 4GZ9A 2Y6KA 2OKXA 3WF2A 1J83A 4ZZ8A 3CZJA 1NUKA 3OBAA 1JZ3A 3SKVA 1TG7A 3K75B 4A42A 1KGYA 4DXRA 2JKXA 2E26A 1F4AA 2WO2A 3AC0A 2LW8A 2Y8KA 3K77A 1LNSA 2L9LA 2WABA 3C7GA 4QAWA 4A44A 5I0DA 2VTFA 5JXGA 4CU9A 1NAEA 1NX9A 1GOHA 2J22A 3HPNA 2Y64A 1PX4A 2CDPA 3CMGA 2WO3A 4ZXEA 1W8OA 3HN3A 3ZM8A 1JZ6A 4KWUA 4DXSA 1KEXA 2C9KA 1US3A 1GOGA 4XUNA 1UY4A 1W9WA 2VC9A 1CZVA 4MOAA 1UXXX 1UYYA 2EICA 2QBXA 3GXUA 3VD5A 4A4AA 4DUVA 2WZEA 3C7HA 4ZY9A 3W5MA 5C7GA 2VMFA 1WKYA 2ORXA 5F7UA 2VZPA 2KD7A 3I2FA 1UY2A 1T2XA 3UETA 4DEVA 5C71A 1GOFA 4CUCA 4AG4A 4M4RA 3MV11 3MO4A 3ETPA 3WNOA 1XPWA 5LA1A 2C4XA 3HOBA 1UMHA 4PT6A 3C7OA 2J1VA 1PMJX 2Y6LA 2V5DA 3DYPA 4P02B 2C26A 1JU3A 3E1F1 3EYPA 3T0BA 4CUAA 2B4KA 4ARXA 5JXHA 3PUIA 2YG0A 3GM8A 1SG3A 4XZUG 1UZ0A 4JKKA 2EIDA 3P6BA 1J84A 2QQMA 3NQHA 1JZ8A 1MPXA 3FHQA 2Y6HA 4QX2A 2W87A 1O8SA 2W95A 1W9TA 3OB8A 1TVGA 1O59A 2VO5A 3DYMA 2VZTA 1L7RA 3IAPA 2V72A 4OMDA 3ACGA 1R64A 2W1WA 1K45A 1DYOA 3ACHA 1K42A 1EUTA 1CIYA 3BGAA 3LEGA 4DXTA 1US2A 1UWWA 2VJXA 3THCA 3IAQA 4OMCA 4RYDA 4LHSA 5JUVA 2ZXQA 3A22A 3IIIA 4JKLA 3THDA 4MADA 1H6YA 4PF1A 5DQ0A 2JD9A 3WNMA 5HXMA 1UY0A 3D3AA 4XURA 2WO1A 2X10A 3WF0A 4P08A 1JYVA 2LS6A 2EIBA 2WAAA 3OGVA 2W5FA 2VR4A 3DECA 3DYOA 1ULPA 2VQUA 3ACFA 1JHJA 5LA0A 5EJZB 3T2OA 3IDAA 4KMQA 2VZRA 2W1QA 2VCBA 3I2IA 4QX3A 5JMOA 4ET7A 3UNPA 2VZVA 2WUHA 4MGQA 3VD7A 4BJ0A 4BDVB 5EJ1B 2J1AA 5IFPA 1UY1A 4CU6A 3OEBA 4QPWA 4DEQA 3ABZA 1YQ2A 3SEPA 4QDSA 2J1RA 3OGRA 3SKJE 5IJRA 3WQBA 4GWJA 4HG6B 2VOTA 2J1SA 1DLCA 3CKHA 4UOJA 2DCKA 2J1TA 3K46A 5JXIA 2WZ8A 4JHZA 4A45A 2ORZA 5DPNA 1CZSA 1K12A 2W92A 1GNYA 2BZDA 4OUEA 5FUIA 4XUOA 2QQIA 2VM9A 4FI9A 4UAPA 1P8JA 4OYUA 2VCAA 3MUZ1 5DN2A 3U37A 4W8JA 2PQSA 4W50A 4TTGA 1XNTA 4MGSA 2DCJA 2E32A 5EIYB 3NNGA 5LCWL 1PMHX 1W9SA 4TXWA 3PUHA 4A6OA 4D0QA 2W94A 2YC2A 1BHGA 5HPOA 2J7MA 1XNAA 4DUXA 2VQTA 3WF3A 2WBKA 4QB1A 3GDBA 2X05A 2W91A 2R7EB 4E8CA 4JKMA 3I3DA 3EB7A 2VZ3A 2WN2A 1JI6A 1OD3A 3I3EA 3F2ZA 4BK5A 3FHAA 5IFTA 4L0PA 4M4PA 3ACIA 2VCCA 4XUPA 1IQDC 4QX0A 2WQ8A 3SEEA 3I2KA 4E8DA 3WNKA 1UMIA 2XHNA 4P5YA 4AAXA 3VDCA 1D7PM 3I2GA 2VZOA 2BGPA 1OH4A 1OT5A 3ECQA 4W4ZA 2RV9A 4LKSA 4Z2AA 3WF1A 2VL4A 2E31A 3I2HA 3I97A 1PX3A 3FN9A 3MV01 5C70A 3OGSA 2XOMA 3WSOA 3BN6A 4OZOA 4ZZ5A 3UESA 2YC4A 3CQOA 3T2PA 1CZTA 4A41A 3OEAA 4CUBA 1W0NA 5J1XA 3WNPA 3GGLA 3WNNA 2W9XA 5JR2A 2VZQA 2YB7A 1GUIA 3LQCA 3T09A 2JE8A 2ZEZA 1UX7A 4CU7A 1UY3A 2W3JA 1GMMA 3K4DA 1WCQA 3I3BA 3C7EA 2XQXA 2W46A 2ZEWA 1W8NA 3C7FA 2V4VA 2WYSA 1JZ4A 2VZUA 1JZ5A 5CYYA 2BBAA 4IUGA 1JYWA 1JYXA 3T2QA 1F4HA 1JZ7A 3VD9A 3HNBM 2WAOA 5G05L 1JZ2A 3T0AA 4GWIA 4MO3M 3A23A 3C8XA 5B4NA 2QQJA 3HNMA 1UYZA 1L7QA 3CIHA 1SDDB 3VD3A 3LPGA 2J1UA 4BK4A 2W47A 3NRUA 4KI5M 1H6XA 1SHWB 2VMDA 4QDQA 2Z4FA 2QQLA 5G04L 2VZ1A 3HNYM 4A3ZA 4BXSV 3VDAA 2E33A 2EIEA 1GU3A 2VZSA 2WDBA 4YPJA 3HJRA 2ZEYA 5IYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPL A;  4DUW A;  5JXJ A;  3VD4 A;  3J7H A;  5CZK A;  4ARY A;  2RJ2 A;  3W5N A;  2XON A;  1RYY A;  2W1U A;  3LE0 A;  4P00 B;  1NKG A;  1XC6 A;  2W1S A;  4XVH A;  1K3I A;  2CDO A;  2QQN A;  3P1I A;  2RVA A;  3MUY 1;  1DP0 A;  3T0D A;  4UI9 L;  1JYN A;  2HLE A;  1UYX A;  3T08 A;  4D8M A;  4CU8 A;  3LEI A;  2VME A;  3IB3 A;  3K4A A;  3WF4 A;  3JXS A;  2BER A;  2ZEX A;  2HYX A;  4XUT A;  4CVU A;  4QDR A;  2Y6G A;  3WEZ A;  2B9V A;  4QB6 A;  1GQP A;  3LPF A;  3A21 A;  4LQR A;  5LA2 A;  1JU4 A;  4QB2 A;  1EUU A;  5A1A A;  1OF3 A;  1UXZ A;  1I5P A;  3LEK A;  4XUQ A;  2JDA A;  4PQQ A;  3CZU A;  3OG2 A;  3HEI A;  2BGO A;  2WN3 A;  1ULO A;  4QX1 A;  1CX1 A;  3I2J A;  5B4X A;  2QQK A;  3K4Z A;  2DDU A;  3WNL A;  5DMY A;  2Y6J A;  3VDB A;  1OF4 A;  1W99 A;  2QQO A;  4JX0 A;  2X09 A;  2YFU A;  3MBW A;  3NJX A;  3NJV A;  3CDZ B;  3A7Q A;  2YFZ A;  2ID4 A;  4RN5 A;  1HN1 A;  3FL7 A;  5IHR A;  2VMC A;  2J1E A;  1O8P A;  4GZ9 A;  2Y6K A;  2OKX A;  3WF2 A;  1J83 A;  4ZZ8 A;  3CZJ A;  1NUK A;  3OBA A;  1JZ3 A;  3SKV A;  1TG7 A;  3K75 B;  4A42 A;  1KGY A;  4DXR A;  2JKX A;  2E26 A;  1F4A A;  2WO2 A;  3AC0 A;  2LW8 A;  2Y8K A;  3K77 A;  1LNS A;  2L9L A;  2WAB A;  3C7G A;  4QAW A;  4A44 A;  5I0D A;  2VTF A;  5JXG A;  4CU9 A;  1NAE A;  1NX9 A;  1GOH A;  2J22 A;  3HPN A;  2Y64 A;  1PX4 A;  2CDP A;  3CMG A;  2WO3 A;  4ZXE A;  1W8O A;  3HN3 A;  3ZM8 A;  1JZ6 A;  4KWU A;  4DXS A;  1KEX A;  2C9K A;  1US3 A;  1GOG A;  4XUN A;  1UY4 A;  1W9W A;  2VC9 A;  1CZV A;  4MOA A;  1UXX X;  1UYY A;  2EIC A;  2QBX A;  3GXU A;  3VD5 A;  4A4A A;  4DUV A;  2WZE A;  3C7H A;  4ZY9 A;  3W5M A;  5C7G A;  2VMF A;  1WKY A;  2ORX A;  5F7U A;  2VZP A;  2KD7 A;  3I2F A;  1UY2 A;  1T2X A;  3UET A;  4DEV A;  5C71 A;  1GOF A;  4CUC A;  4AG4 A;  4M4R A;  3MV1 1;  3MO4 A;  3ETP A;  3WNO A;  1XPW A;  5LA1 A;  2C4X A;  3HOB A;  1UMH A;  4PT6 A;  3C7O A;  2J1V A;  1PMJ X;  2Y6L A;  2V5D A;  3DYP A;  4P02 B;  2C26 A;  1JU3 A;  3E1F 1;  3EYP A;  3T0B A;  4CUA A;  2B4K A;  4ARX A;  5JXH A;  3PUI A;  2YG0 A;  3GM8 A;  1SG3 A;  4XZU G;  1UZ0 A;  4JKK A;  2EID A;  3P6B A;  1J84 A;  2QQM A;  3NQH A;  1JZ8 A;  1MPX A;  3FHQ A;  2Y6H A;  4QX2 A;  2W87 A;  1O8S A;  2W95 A;  1W9T A;  3OB8 A;  1TVG A;  1O59 A;  2VO5 A;  3DYM A;  2VZT A;  1L7R A;  3IAP A;  2V72 A;  4OMD A;  3ACG A;  1R64 A;  2W1W A;  1K45 A;  1DYO A;  3ACH A;  1K42 A;  1EUT A;  1CIY A;  3BGA A;  3LEG A;  4DXT A;  1US2 A;  1UWW A;  2VJX A;  3THC A;  3IAQ A;  4OMC A;  4RYD A;  4LHS A;  5JUV A;  2ZXQ A;  3A22 A;  3III A;  4JKL A;  3THD A;  4MAD A;  1H6Y A;  4PF1 A;  5DQ0 A;  2JD9 A;  3WNM A;  5HXM A;  1UY0 A;  3D3A A;  4XUR A;  2WO1 A;  2X10 A;  3WF0 A;  4P08 A;  1JYV A;  2LS6 A;  2EIB A;  2WAA A;  3OGV A;  2W5F A;  2VR4 A;  3DEC A;  3DYO A;  1ULP A;  2VQU A;  3ACF A;  1JHJ A;  5LA0 A;  5EJZ B;  3T2O A;  3IDA A;  4KMQ A;  2VZR A;  2W1Q A;  2VCB A;  3I2I A;  4QX3 A;  5JMO A;  4ET7 A;  3UNP A;  2VZV A;  2WUH A;  4MGQ A;  3VD7 A;  4BJ0 A;  4BDV B;  5EJ1 B;  2J1A A;  5IFP A;  1UY1 A;  4CU6 A;  3OEB A;  4QPW A;  4DEQ A;  3ABZ A;  1YQ2 A;  3SEP A;  4QDS A;  2J1R A;  3OGR A;  3SKJ E;  5IJR A;  3WQB A;  4GWJ A;  4HG6 B;  2VOT A;  2J1S A;  1DLC A;  3CKH A;  4UOJ A;  2DCK A;  2J1T A;  3K46 A;  5JXI A;  2WZ8 A;  4JHZ A;  4A45 A;  2ORZ A;  5DPN A;  1CZS A;  1K12 A;  2W92 A;  1GNY A;  2BZD A;  4OUE A;  5FUI A;  4XUO A;  2QQI A;  2VM9 A;  4FI9 A;  4UAP A;  1P8J A;  4OYU A;  2VCA A;  3MUZ 1;  5DN2 A;  3U37 A;  4W8J A;  2PQS A;  4W50 A;  4TTG A;  1XNT A;  4MGS A;  2DCJ A;  2E32 A;  5EIY B;  3NNG A;  5LCW L;  1PMH X;  1W9S A;  4TXW A;  3PUH A;  4A6O A;  4D0Q A;  2W94 A;  2YC2 A;  1BHG A;  5HPO A;  2J7M A;  1XNA A;  4DUX A;  2VQT A;  3WF3 A;  2WBK A;  4QB1 A;  3GDB A;  2X05 A;  2W91 A;  2R7E B;  4E8C A;  4JKM A;  3I3D A;  3EB7 A;  2VZ3 A;  2WN2 A;  1JI6 A;  1OD3 A;  3I3E A;  3F2Z A;  4BK5 A;  3FHA A;  5IFT A;  4L0P A;  4M4P A;  3ACI A;  2VCC A;  4XUP A;  1IQD C;  4QX0 A;  2WQ8 A;  3SEE A;  3I2K A;  4E8D A;  3WNK A;  1UMI A;  2XHN A;  4P5Y A;  4AAX A;  3VDC A;  1D7P M;  3I2G A;  2VZO A;  2BGP A;  1OH4 A;  1OT5 A;  3ECQ A;  4W4Z A;  2RV9 A;  4LKS A;  4Z2A A;  3WF1 A;  2VL4 A;  2E31 A;  3I2H A;  3I97 A;  1PX3 A;  3FN9 A;  3MV0 1;  5C70 A;  3OGS A;  2XOM A;  3WSO A;  3BN6 A;  4OZO A;  4ZZ5 A;  3UES A;  2YC4 A;  3CQO A;  3T2P A;  1CZT A;  4A41 A;  3OEA A;  4CUB A;  1W0N A;  5J1X A;  3WNP A;  3GGL A;  3WNN A;  2W9X A;  5JR2 A;  2VZQ A;  2YB7 A;  1GUI A;  3LQC A;  3T09 A;  2JE8 A;  2ZEZ A;  1UX7 A;  4CU7 A;  1UY3 A;  2W3J A;  1GMM A;  3K4D A;  1WCQ A;  3I3B A;  3C7E A;  2XQX A;  2W46 A;  2ZEW A;  1W8N A;  3C7F A;  2V4V A;  2WYS A;  1JZ4 A;  2VZU A;  1JZ5 A;  5CYY A;  2BBA A;  4IUG A;  1JYW A;  1JYX A;  3T2Q A;  1F4H A;  1JZ7 A;  3VD9 A;  3HNB M;  2WAO A;  5G05 L;  1JZ2 A;  3T0A A;  4GWI A;  4MO3 M;  3A23 A;  3C8X A;  5B4N A;  2QQJ A;  3HNM A;  1UYZ A;  1L7Q A;  3CIH A;  1SDD B;  3VD3 A;  3LPG A;  2J1U A;  4BK4 A;  2W47 A;  3NRU A;  4KI5 M;  1H6X A;  1SHW B;  2VMD A;  4QDQ A;  2Z4F A;  2QQL A;  5G04 L;  2VZ1 A;  3HNY M;  4A3Z A;  4BXS V;  3VDA A;  2E33 A;  2EIE A;  1GU3 A;  2VZS A;  2WDB A;  4YPJ A;  3HJR A;  2ZEY A;  5IYY A; 
#chains in the Genus database with same CATH topology
 1SLB A;  3U0Z A;  1RUC 1;  4LPL A;  3GZE A;  4ZPI A;  2RMU 2;  3PNA A;  5BUV A;  3VD4 A;  5FLH A;  4AFM A;  5KC6 A;  1S0C A;  2CU5 A;  4JGY C;  4FP2 A;  2TUN A;  5FYS A;  3UJQ A;  3BU0 A;  2ZGL A;  3Q9O A;  2VUA A;  3VDD B;  3VZO A;  1ULE A;  4S2F A;  5BNP C;  1RYY A;  2W1U A;  5ABJ B;  1IPJ A;  2OUJ A;  1NKG A;  3B5L B;  4XJA A;  2CV6 A;  4XVH A;  2XUM A;  4BWO A;  1ND3 B;  1CPM A;  3N9O A;  4E4H A;  1PHM A;  5K0U C;  2RVA A;  2HWB 3;  3MUY 1;  4GB3 1;  1DP0 A;  3T0D A;  5DUV A;  4D8M A;  1B35 A;  3AZW A;  4Y1U A;  5T52 A;  3TN9 2;  5FZC A;  1WW5 A;  1XYP A;  4M3C A;  3WDX A;  4DFS A;  3QBQ A;  3VHR A;  3HT1 A;  1XE0 A;  3AZX A;  4MGK E;  4CVU A;  4YZ5 A;  4YVW C;  2Y6G A;  4QB6 A;  4LIT A;  4FOQ A;  1V0A A;  2HWF 3;  4QPI A;  5K7P A;  1UOB A;  1POV 3;  3A21 A;  5FKB A;  4AI8 A;  2LRO A;  3ZFG A;  4PDW A;  2FDK A;  5E6H A;  3K3O A;  1BXH A;  3J7N A;  4IE6 A;  5FOB B;  1DFQ A;  2ZS6 B;  1W0O A;  1Z7S 2;  4WZF A;  1OF3 A;  1MEC 2;  3N36 A;  1PIV 1;  2RE9 A;  2WS9 1;  1X50 A;  4XBQ A;  4Q4W 2;  5F39 A;  2CWS A;  1DGR A;  4XBL A;  4Y20 A;  2H6C A;  1N1T A;  2CYF A;  1AL0 G;  2HWE 2;  2WRA A;  3LFI A;  3TNP B;  2RS1 2;  3CZU A;  4LO4 B;  4MV2 A;  4BLI A;  4CCN A;  5DUW A;  1SAC A;  2G9Z A;  5FZ7 A;  1VIW B;  2BGC A;  5FRA A;  5C4W A;  2PQQ A;  5TSW A;  4OHY A;  4FFF A;  2IC1 A;  1JOJ A;  5FWJ A;  1W2N A;  4S2G A;  1OF4 A;  1W99 A;  5FQ0 A;  1YI9 A;  2JDK A;  4CCC A;  2JDP A;  5C3O A;  4ATE A;  2GNM A;  5ACA 1;  4Q8L A;  1EAH 3;  2YFU A;  5IAV A;  3NJV A;  2QE3 A;  1RUE 3;  2ET1 A;  4MGT A;  1XNB A;  2ES3 A;  3KV4 A;  1PNG A;  3D6E A;  1QKQ A;  1ULF A;  3A7Q A;  2ID4 A;  1YFY A;  1ZNP A;  1SFY A;  3A0N A;  5T3N A;  1D4V B;  3JCI A;  3KS7 A;  1REE A;  1TME 3;  2VMC A;  1LAJ A;  2DU1 A;  3WF2 A;  2K9Z A;  1J83 A;  1PK6 C;  4YZ1 A;  3CZJ A;  2GMM A;  4AI0 A;  1PO2 3;  3SKV A;  4NMI A;  4KGQ A;  4XJU A;  2DUO A;  3B00 A;  3HN1 A;  4WM8 C;  2WO2 A;  5FAX A;  1VBD 2;  1ZBA 2;  4MVT A;  4AEM A;  3RZM A;  4RGA A;  1ASJ 3;  2JJ6 A;  1W9Y A;  3IMN A;  1LNS A;  3BU7 A;  4QQO A;  1RHI 3;  2YXS A;  4UF0 A;  3Q8E A;  1AX0 A;  3ES1 A;  3NW4 A;  4CDQ C;  4YVS A;  2KXL A;  1RUD 2;  5I0D A;  3E6C C;  5JXG A;  3AL5 A;  5A1L A;  2PHD A;  4CU9 A;  3UKN A;  1RXF A;  2VBB A;  1DGR N;  4E4D X;  4Q4V 1;  2YU2 A;  5FZ3 A;  3PDQ A;  2P34 A;  1AYN 3;  3VBS B;  1HN0 A;  1HB2 A;  4ITC A;  4RSU A;  5I8T A;  2I74 A;  3H7Y A;  1HLC A;  1HQL A;  4F8A A;  2RM2 2;  3VBR A;  1FV2 A;  3ZFE B;  1FI2 A;  3HPN A;  1JOB A;  3OPW A;  2E51 A;  4EWD A;  3BTZ A;  3OBR A;  4YG3 A;  1V6L A;  2GH2 A;  4PLN A;  3I2O A;  1RUO A;  2WO3 A;  4YW4 A;  3WHT A;  1W8O A;  5EP9 A;  3ZM8 A;  5FPU A;  2QZ3 A;  1NCQ C;  1FMD 1;  4KWU A;  1TMF 1;  4L9B A;  4YW1 A;  3WW2 A;  1WD4 A;  2BEO A;  1BBT 3;  4AVB A;  2CGP A;  2DVA A;  2AR6 A;  5F3I A;  4BH9 A;  4AHY A;  3VHP A;  3NNL A;  1CAW B;  4XUN A;  3BCW A;  4EN7 B;  4UFL A;  5C6C A;  5FY1 A;  4ZU4 A;  3DF0 A;  2P4E A;  5J3U A;  4G4F A;  5A3U A;  5CFD B;  2JG8 C;  1RIN A;  2BNO A;  2CWM A;  4XBN A;  2WFP A;  1UXX X;  5CG8 A;  3ES4 A;  3KVA A;  3OUJ A;  2ZX4 A;  4JC1 A;  4A4A A;  4DUV A;  1MS8 A;  3P3N A;  4PBO A;  5C7G A;  3D8C A;  3GZA A;  1S2E A;  4ORF A;  2Z2S B;  1SPP A;  2RR1 1;  4UW6 A;  4B3N A;  5F7U A;  4AAP A;  1SCR A;  2VBP A;  4XJ8 A;  2KD7 A;  4CPB D;  3RZJ A;  1UY2 A;  4QX7 A;  3NMB A;  4P9G A;  4CPB A;  2VVF A;  3KD4 A;  4AG4 A;  4I3G A;  3MV1 1;  3LEM A;  3MO4 A;  1KD7 A;  1LGN A;  4OCT A;  4QHZ A;  3T4V A;  1XPW A;  3WNO A;  1EPW A;  1NCR C;  4GUL A;  3IBM A;  5LA1 A;  3HOB A;  2CNA A;  1UF2 C;  4NRQ A;  4GJY A;  3J26 N;  5T54 A;  2WZP P;  1L7L A;  2OVU A;  5L7O A;  4LO5 B;  1KXG A;  2NYY A;  2Y6L A;  1RUJ 3;  3D82 A;  3SMH A;  3ZN4 A;  5FPX A;  3NL1 A;  3CLP A;  3QH6 A;  2C26 A;  2C9A A;  2IVI B;  1XOY A;  1JU3 A;  3E1F 1;  3ZFE C;  2Q1F A;  3NVC A;  4K1Y A;  1PGS A;  3CO2 A;  2ZPX A;  2A71 A;  3PUI A;  3GM8 A;  4LOS A;  4IDZ A;  1VAV A;  3JBG 1;  3I4I A;  4IET A;  4FAG A;  5IK8 A;  2EID A;  1ZBE 1;  2GZW A;  3J4U H;  2QQM A;  3T4H B;  1DQ5 A;  2HWC 2;  3E6B A;  1PZ8 A;  4LE4 A;  2CAV A;  4RGK A;  1VBE 2;  4YM3 A;  2A6X A;  4F7Z A;  2XDV A;  5FYT A;  4HKW A;  4MZU A;  4ZU5 A;  1O59 A;  2VO5 A;  2ZBJ A;  3VL9 A;  2EAA A;  4URT A;  1L7R A;  2WT2 A;  2GDF A;  1GR3 A;  1YYN A;  4B4Q A;  4OMD A;  1R64 A;  4QGM A;  1LU1 A;  1WCK A;  1AX2 A;  4XDP A;  3WG4 A;  2R06 2;  1ZZ8 A;  2DTY A;  1UAI A;  5F5A A;  4QPG A;  1KFU L;  1CIY A;  2HYK A;  2XJT A;  4NVP A;  3WDU A;  2QCS B;  4CEW A;  5FY4 A;  1K5M C;  2VJX A;  1AYM 2;  3RMY A;  1AR8 1;  4I0A A;  3O1R A;  5KHI A;  4M3C E;  4FAH A;  4H55 A;  3A22 A;  2VAU A;  3EJK A;  2X5I B;  2EXI A;  3OUI A;  4I02 A;  2FDJ A;  5FDB A;  2ARX A;  5I93 A;  4B8E A;  3S7E A;  1NXD 1;  3DN7 A;  1UY0 A;  1VLN A;  1QJU 3;  4XUR A;  3TAY A;  1W39 A;  2X10 A;  4D7S A;  1YFW A;  3OBT A;  1Q8V A;  3R6S A;  3R0R A;  5I0R A;  2WAA A;  2JDZ A;  2D6M A;  4DO0 A;  1AXK A;  4LBL A;  2VR4 A;  4FXG B;  3UK9 A;  1U5Y A;  3VBU A;  4A6S A;  2RS5 2;  1GP6 A;  4JDN A;  4YG0 A;  3ACF A;  4XC9 A;  5FYU A;  3VDD A;  1AR7 1;  3NO8 A;  5EJZ B;  2BDR A;  3IDA A;  4AQ2 A;  2GNB A;  2ZAH A;  1VBC 2;  4KMQ A;  3FE5 A;  3I2I A;  1PGW 1;  2XBO 2;  5JMO A;  1RUI 2;  1UNB A;  4SLI A;  1W03 A;  3SIT A;  1ND3 A;  4MGQ A;  3VD7 A;  5FZ4 A;  5A7N A;  4BJ0 A;  4DMI A;  2QQV A;  2XVL A;  4ASM B;  4C90 A;  2JE9 A;  3TBD A;  3VV1 A;  4AZZ A;  4I09 A;  4P5H A;  1UY1 A;  1BEV 2;  3OEB A;  3JD7 1;  5CKN A;  1LOF C;  2RS3 2;  3N7K A;  4AVV A;  4DEQ A;  1QJE A;  3ABZ A;  4J1X A;  4WVV A;  3DEM A;  3MDP A;  1W8F A;  5D21 A;  2EVX A;  1HXS 3;  1QXJ A;  3WQB A;  4GWJ A;  1S55 A;  2IWG B;  3JB4 C;  4FOW A;  3H8U A;  3N4M A;  1Q5O A;  2CGN A;  2J1T A;  2WNU A;  3K46 A;  2Q0A A;  1VAL A;  4D6S A;  1LOC A;  1W3V A;  2D6L X;  1ODN A;  3NV4 A;  3UJO A;  3CJX A;  2ZGK A;  3M7A A;  5L73 A;  4JHZ A;  2VW2 A;  2XUE A;  3SHR A;  3ZXG A;  4A45 A;  1CZS A;  1GIC A;  1POV 1;  3SNM A;  4W65 A;  1GNY A;  2I45 A;  3POS A;  3NJY A;  3ZN6 B;  3O1P A;  1DHK B;  1LOD A;  1RUF 2;  2JB4 A;  2ZHN A;  1EYB A;  3IDB B;  3AJZ A;  3MYX A;  1QHD A;  4JGZ A;  2ZGN A;  4XUO A;  5FZA A;  3ZPO A;  4AFB A;  4CCO A;  4FI9 A;  1Y9Q A;  1UL9 A;  4UAP A;  3IKW A;  5JIA A;  1P8J A;  4BLJ A;  4XDQ A;  3MI8 A;  1ACC A;  2OPW A;  3J8F 3;  4AXO A;  2JIG A;  3MUZ 1;  2BW8 A;  4YG6 A;  3PVB B;  4WV8 A;  2RJL A;  4J6G A;  1RIR A;  2OPK A;  3WDT A;  3W21 A;  2A6Z A;  3PJY A;  5KHJ A;  2BRT A;  5KHK A;  3O5S A;  1DF0 A;  1R09 3;  3MIG A;  1JS9 A;  3O0V A;  4NWV A;  1X36 A;  2ZGQ A;  1W9S A;  3ZFF B;  1QF3 A;  4HLT A;  4XET A;  4PF5 A;  2V73 A;  4TXW A;  3AYE A;  2BQP A;  4AI1 A;  4D0Q A;  2A3W A;  3KGZ A;  5ISL A;  3UKT A;  4CDX A;  4OHX A;  1C8M 2;  4HN0 A;  2TNF A;  1X9P A;  5H9S A;  5A3T A;  1HB3 A;  1WZX A;  2PAE A;  3FUO A;  1RUH 2;  4L11 A;  4DY5 A;  4CEY C;  4CA9 A;  4LE3 A;  1O3S A;  3RJ2 X;  4V2V A;  1W8H A;  4IGP A;  4V2W A;  4Z8B A;  3QH7 A;  5JOW A;  4MYE A;  2SLI A;  2YU1 A;  4JKM A;  1CES A;  2X29 A;  1V9U 1;  4M0H A;  3USU B;  2JDY A;  3WHU A;  1AXY A;  3WP4 A;  3GJB A;  2XLA A;  3R4S A;  3O1O A;  3VBS A;  3WD5 A;  2KM2 A;  3U10 A;  1MZE A;  2PN5 A;  4GKX A;  4OVE A;  4UXA A;  1BMV 2;  2Y34 A;  2B45 X;  1U5X A;  2ZX1 A;  4NPM A;  4XAC A;  3BVC A;  2Y33 A;  2YDE A;  5FXV A;  3ACI A;  2VCC A;  3KT1 A;  4HN1 A;  4AE2 A;  4L97 A;  5FR3 A;  2WNV B;  4YGE A;  5GLV A;  5D8A A;  3BTA A;  4LHK A;  3KMH A;  1CON A;  4E8D A;  5FJK A;  2VOK A;  1PO1 3;  3FUQ A;  3JB8 A;  4Z07 A;  3FZ3 A;  1LHV A;  4I2O A;  3DPR A;  3VDC A;  5FZB A;  1DCS A;  1JOD A;  2WWS A;  4FOV A;  3N3H A;  1Q8O A;  3KWV A;  2IUW A;  3NAP C;  5A3O A;  4W4Z A;  3VBF B;  4RR3 A;  1DGW A;  4Z2W A;  2YUE A;  3I2H A;  4HVO A;  5FCC A;  5T5P A;  5FXW A;  1LKN A;  3USS A;  4AEK A;  1IS5 A;  1H8T B;  4PJY A;  1W9F A;  4IV3 C;  2ET7 A;  5A7Q A;  3J7L A;  2JEM A;  1RUC 3;  1SFP A;  1ST8 A;  3WSO A;  1ZZ9 A;  2WKK A;  4LKE A;  4EWE A;  4ZZ5 A;  2YC4 A;  3POW A;  4GA9 A;  4LK6 A;  3T1M A;  4B4P A;  5J1X A;  3POF A;  1BJQ A;  4FCA A;  1G7Y A;  1UMZ A;  2PEL A;  3H7J A;  3V0A B;  1QIQ A;  4QKB A;  4CDW A;  3E5X A;  3NNJ A;  4OHV A;  1M06 G;  5JSP A;  2K46 A;  3AYD A;  2ARC A;  3ILF A;  5JR2 A;  5FZD A;  1GUI A;  2P3Y A;  5T5J A;  3I3Q A;  4RHV 1;  5A7P A;  1NE4 A;  2JE8 A;  3HMY A;  1IHM A;  2UY8 A;  1DYK A;  1GZT A;  2QQP A;  3FLT A;  3N7J A;  1NQD A;  2W3J A;  4HVQ A;  3IPV B;  3URF A;  1RUG 2;  3DUI A;  5CKQ A;  3VUO A;  4GB3 3;  2IZW A;  2D5F A;  1OMI A;  2OS2 A;  4LA3 A;  3SCF A;  2RDS A;  2G9G A;  3HQX A;  4ZON A;  2C1F A;  3ZPY A;  1XSR A;  4IEP A;  5KC5 A;  3C2U A;  1DBN A;  2NMN A;  1ZZB A;  2OXB A;  4BU2 A;  1F15 A;  1KDM A;  1W8N A;  3C7F A;  2WYS A;  4X8N A;  1R1Z A;  4XQ4 A;  1B35 B;  1I3H A;  5JPN B;  5A80 A;  1UZY A;  4QT6 A;  1JYW A;  4M3C B;  1HV1 A;  3RYR A;  2MEV 2;  3WOG A;  1JYX A;  4TLG A;  1OOP C;  4DZG A;  2XG3 A;  3WX5 A;  1JZ7 A;  1OLM A;  1QJF A;  4GD4 A;  1GBG A;  3T3Y A;  5FP9 A;  1BEV 3;  2WAO A;  2BVV A;  2ZML A;  3WY6 A;  1O7F A;  4BHP A;  4XDO A;  4EJR A;  2FCU A;  5HCB A;  1W8Z A;  2D43 A;  3T0A A;  1PIV 3;  1SZB A;  4HSJ A;  4XAB A;  2WS9 3;  3KF5 A;  4YZ2 A;  3ZFG B;  3DCQ A;  4PDW B;  1WCD J;  3O0W A;  2QQJ A;  3GZU C;  3IMM A;  3CIH A;  1XU1 A;  4UFI A;  5FZE A;  3TN9 1;  2JIJ A;  1N3O A;  3POI A;  1TEI A;  2OX0 A;  2JD4 A;  4CYD A;  3AFG A;  1NY7 2;  2W47 A;  4Y20 B;  1MZF A;  5EYX A;  3NRU A;  1JN2 P;  1O5U A;  1H6X A;  1SHW B;  4BCU A;  3NWK A;  2OII A;  3MGU A;  2IVJ A;  2V5Y A;  2WIN B;  2XJR A;  2ZKN A;  3H3Z A;  2X5I A;  4QGN A;  4B29 A;  5ACA 3;  5C4W B;  3J9S A;  5FMD A;  5IK5 A;  2VZ1 A;  3O1V A;  1C1F A;  5IAT A;  2XKO A;  5IUQ A;  4A3Z A;  5FZ8 A;  2GC1 A;  2DVD A;  1Z7S 1;  3D0J A;  5FQ0 B;  4E2G A;  1MEC 1;  2E33 A;  1GU3 A;  2EIE A;  3EQE A;  4FP3 A;  4Q4W 1;  1IZ3 A;  2RG4 A;  2OYZ A;  4RFT 0;  2ZEY A;  1VE0 A;  4CP9 A;  2HWE 1;  1XQN A;  5FY5 A;  5HCA A;  2RS1 1;  5KBF A;  3K48 A;  4TYS A;  3ZIX A;  3RZK A;  4KBB A;  3T2T A;  4GJZ A;  4QPY A;  3E5Q A;  1BK1 A;  2PAK A;  2EAL A;  1OUS A;  5FXX A;  3WT3 A;  2D6K A;  3ZSL A;  1MS4 A;  2QTW B;  4L92 A;  5CZK A;  1GV9 A;  3AJY A;  4AI3 A;  4Q1P A;  5EQU A;  1N47 A;  3IM0 A;  1W2O A;  3W5N A;  1OLQ A;  4A2U A;  2HEY F;  3RQ0 A;  4D94 A;  4H2A A;  4BYY A;  1QJY 2;  4UFH A;  1XC6 A;  2JEN A;  3Q8F A;  2W1S A;  3AX4 A;  1H30 A;  4XMA A;  1R08 2;  1EV1 2;  2QQN A;  4QPI C;  4XCA A;  5CU1 A;  4UF0 B;  1TE1 B;  3AZY A;  4U36 A;  5L9R A;  1CX4 A;  2XWB B;  1HQW A;  2Z79 A;  4PDW C;  1V70 A;  4YVS B;  3ZFG C;  4LOR A;  1JYN A;  1RVF 2;  2HLE A;  1UYX A;  2VNG A;  4JQT A;  3T08 A;  2VPV A;  4ASL A;  2OW4 A;  4WM7 A;  4BQ4 A;  1LCL A;  3ZYP A;  1QOS A;  2VME A;  3IB3 A;  3WF4 A;  4AW7 A;  1OA3 A;  1OC1 A;  3JXS A;  2WQZ C;  1SCS A;  2D6P A;  3ZO0 B;  3RWK X;  2YMZ A;  3H3L A;  2ATF A;  1VBD 1;  1ZBA 1;  3GJA A;  4AGV A;  2D7F A;  4RQP B;  3VBR B;  1GSL A;  1N1V A;  3WEZ A;  4AK3 A;  3RZG A;  2R0F A;  2DBI A;  1D2S A;  1YNA A;  1FMD 3;  2IXL A;  1TMF 3;  1V6N A;  4Y4R A;  1HQN A;  2P3K A;  4O9G A;  1RUD 1;  1NLS A;  2OQ6 A;  4RL7 A;  1H1I A;  1WLT A;  5A3P A;  1UD1 A;  2GMP A;  4XFB A;  3LEK A;  1RB8 G;  4XUQ A;  1UO9 A;  2HH9 A;  2JDA A;  5JOY A;  4PQQ A;  3HQU A;  3N9N A;  3NJZ A;  3CNA A;  1COV 2;  2IFW A;  2RM2 1;  3AVR A;  4YW2 A;  5JPM B;  5FZ0 A;  2XHK A;  2BGO A;  4QX1 A;  1CX1 A;  2PHT A;  2QQK A;  3RZH A;  3BOP A;  2P37 A;  4HL0 A;  1MS5 A;  3VKL A;  4FTS A;  2Y6J A;  2RR1 3;  1LRH A;  1Y3T A;  5FPZ A;  3VDB A;  3VKN A;  3ZMO A;  1F35 A;  1OA2 A;  2X09 A;  3M1H A;  3PLQ A;  4KQ7 A;  4IEO A;  3ZFF A;  3ZYF A;  1SPP B;  1UYP A;  2F6B A;  2RJK A;  3RFR A;  2LTN A;  3ZYB A;  1C57 A;  2D93 A;  2NN8 A;  1HN1 A;  3FL7 A;  4KL1 A;  5IHR A;  5CIS A;  4C1W A;  1AUY A;  2JWP A;  1O8P A;  4LO6 B;  3S30 A;  2OKX A;  3CU7 A;  1R1A 2;  2HBT A;  4ZZ8 A;  4LOT A;  1NUK A;  1OA4 A;  2DCY A;  3FLR A;  5FY9 A;  3K75 B;  1TNF A;  1KGY A;  3FBM A;  4WVZ A;  5FUN A;  1GWK A;  4ASK A;  5L7O B;  1S2K A;  3UGF A;  2E26 A;  1OKQ A;  3OCP A;  2JDU A;  5SV5 A;  3ATG A;  1ZRC A;  5I91 A;  4Q8K A;  2L9L A;  3E97 A;  1ZBE 3;  3BKZ A;  3C7G A;  3VZJ A;  1VBB 2;  1POV 0;  3OY8 A;  1UX6 A;  4A44 A;  2HJI A;  2IXC A;  1YJK A;  3S57 A;  4COY A;  2JE7 A;  1LGB A;  1AR9 2;  1X8M A;  2VTF A;  3KGL A;  4HFS A;  1NYW A;  4JQR A;  5EPA A;  2GN7 A;  4LIU A;  1FV3 A;  4D7Y A;  1DG6 A;  3GCX A;  1FOD 2;  1OI6 A;  5IVC A;  1GOH A;  2DCZ A;  2ZZJ A;  3I3M A;  3VHN A;  5AFB A;  1OPM A;  4XCB A;  5IVE A;  5I0T A;  2Y64 A;  3RYK A;  2CDP A;  2DF7 A;  1MZ6 A;  3B94 A;  3FFZ A;  5H9R A;  5JZG A;  1SBD A;  2AAC A;  3VBF A;  3OGJ A;  3N9P A;  4HXC A;  2ZGP A;  4LNV A;  3HN3 A;  4QPG B;  4ZXE A;  4A3X A;  1JZ6 A;  1UU5 A;  4CEW B;  2VOV A;  1X33 A;  4UFM A;  3IT8 A;  1KEX A;  2VXJ A;  2HWC 1;  3IIA A;  5LK7 B;  4HK8 A;  3O1S A;  1G9A A;  1VBE 1;  1H2M A;  5FWE A;  3LA7 A;  4BME A;  2ZTN A;  3R4U A;  3EXU A;  5CAZ A;  1IGO A;  2F17 A;  1OLM E;  2DUR A;  2UU8 A;  3EMR A;  3H1Y A;  2VXR A;  1QJX 2;  4OFG A;  4DRV A;  1QXR A;  2Q8C A;  2E7Q A;  2R06 1;  3WUC A;  5BNO C;  3N9L A;  1KJR A;  5BXX A;  3VBO C;  4DOU A;  1UYY A;  3GAL A;  3S0M A;  1AR7 3;  3WP6 A;  5L19 A;  4XF3 A;  1SLA A;  3C7H A;  3PHM A;  4QXH A;  4ZY9 A;  1AYM 1;  3AP4 A;  3VBU B;  1XXN A;  5FRE A;  1WKY A;  2ZJC A;  1G86 A;  3W59 A;  4X6Q B;  4K6B A;  3IPV A;  1ZVF A;  1D4M 2;  1OVP A;  2PMW B;  3B9I A;  3HQR A;  2EF6 A;  1LOB A;  3I2F A;  4DEV A;  5J09 A;  3BUC A;  4MHU A;  1SMV A;  3JD7 3;  1VRH 2;  3V0B A;  2O14 A;  2P5B A;  3POB A;  1WA4 A;  4JTN A;  1UMH A;  2DFB A;  2IXH A;  4PT6 A;  4ERO A;  1W05 A;  3C7O A;  4E2Q A;  2VNO A;  3BIW E;  2UWB A;  4QMA A;  4O7X A;  1J1T A;  3ZSK A;  2FDH A;  4AVS A;  1JYT A;  4XTM A;  1CJD A;  3WP3 A;  1WCU A;  1NLQ A;  3B02 A;  5B2G B;  3ZDS A;  1VBC 1;  4AED A;  3LDB A;  5FZG A;  4QXK A;  5BPX A;  3AL6 A;  2XBO 1;  1RUI 1;  3U78 A;  4JZR A;  4IGO A;  1SG3 A;  1V6I A;  2WNU B;  4XZU G;  5F3G A;  2ZGR A;  4BZ4 A;  1UZ0 A;  4MXV A;  4JKK A;  3WQ0 A;  1A6C A;  1WME A;  3NQH A;  3UGG A;  4CEW C;  1BEV 1;  2Y6H A;  3MF6 A;  2RS3 1;  1LOG A;  2OZ6 A;  1YQC A;  2QNK A;  1J3P A;  3N7L A;  1BKZ A;  4MHR A;  4N53 A;  4XIL A;  4IE0 A;  1LB2 A;  4NIG A;  2Z69 A;  4DNY A;  3DYM A;  3MIC A;  1FNY A;  1UN1 A;  2V72 A;  4P9J A;  3M3I A;  1K45 A;  4LMF A;  4JGZ B;  3RSJ A;  4IEV A;  1K42 A;  4NRM A;  3RWN A;  2EXJ A;  3NKG A;  4RS5 A;  3M3E A;  3AK0 A;  3BGA A;  1GKB A;  3LEG A;  4WVW A;  3RVH A;  3ZSM A;  3C3V A;  1UWW A;  3THC A;  4XFA A;  2ZX3 A;  3AP6 A;  4LO7 A;  3VBU C;  4WBB A;  5JUV A;  2R16 A;  5A6Y A;  3KVB A;  3VDD C;  3Q8C A;  4MAD A;  2D6N A;  5F5I A;  4CCE A;  5DQ0 A;  1D0G A;  4ZXK A;  5ABJ C;  4W6W A;  3PTY A;  5LZ6 A;  3LFM A;  5IVY A;  2G4I A;  4YW5 A;  1ZX5 A;  4C1X A;  2WO1 A;  1ND3 C;  3WF0 A;  1PGL 2;  1HIX A;  4P08 A;  2ZZQ A;  2NZ9 A;  4OI4 A;  2EIB A;  1V6M A;  4UBG A;  1O6U A;  3OGV A;  3DYO A;  3DKW A;  3LGR A;  4I30 A;  3VN4 A;  1IG3 A;  3LA3 A;  2E7A A;  2VQU A;  5JSR A;  5FV3 A;  4UW3 A;  1JHJ A;  3ZXJ A;  2P17 A;  2VUJ A;  4CDX B;  3T2O A;  4ZS3 A;  1EY2 A;  3RRD A;  3OSD A;  4P9I A;  5LBE A;  1G8W A;  4LO8 A;  1RXG A;  4CP0 A;  1UPI A;  4KWL A;  1NA1 A;  2W08 A;  4QKN A;  3UNP A;  1FT9 A;  4K8F A;  1QXP A;  1V9U 3;  5KHG A;  1GZC A;  4HZF A;  2WFF 2;  1T6G C;  1O4T A;  2VEC A;  2J1A A;  5IFP A;  1WMX A;  5FPV A;  4OHZ A;  2IXJ A;  4NN0 A;  4QPW A;  3WXP A;  1VMH A;  1YQ2 A;  2AYH A;  4NRO A;  4IE5 A;  1KS4 A;  2R07 2;  3SKJ E;  4E2S A;  4XQD A;  5IJR A;  1C8M 1;  1OQE A;  2CL2 A;  4C8D A;  2AC1 A;  2NLR A;  5GLW A;  5T5L A;  5A6X A;  5H9P A;  4HG6 B;  2VOT A;  2WYF A;  5M0T A;  4RQP A;  2AEN A;  3KT7 A;  1RUH 1;  3CKH A;  1VR3 A;  4AQT A;  4JGZ C;  5DG1 A;  4NPR A;  5BNN A;  4L2N A;  1VBB 3;  2O0O A;  2VH9 A;  1QNY A;  1QOO A;  3N35 A;  5D8A B;  5DPN A;  2D97 A;  1TZO A;  1KDK A;  4LHN A;  4FPY A;  4AFD A;  1K12 A;  1LED A;  3H3U A;  5F2S A;  3DPR B;  5DAQ A;  3CHX A;  4JHT A;  1BMV 1;  4Y1X A;  2C5D A;  1D2Q A;  2BOJ A;  2D6O X;  4OUM A;  5F6K A;  5FUI A;  4RR3 B;  4QQ2 A;  5GZF A;  4YFZ A;  5HBA A;  3BTX A;  2A5Z A;  1Y9G A;  2VMH A;  2ZMK A;  1Y4W A;  4Q4Y 2;  1FNZ A;  4LT5 A;  3RJR A;  5FBJ A;  1STM A;  3MPB A;  1OHF A;  2W2I A;  2VG9 A;  5CAD A;  3O7O A;  2BPA 2;  4XFG A;  2WZR 2;  3LSE A;  2ZAB A;  4N43 B;  1YQ8 A;  4RHV 3;  4ZU7 A;  2ZMN A;  3FJS A;  2BU9 A;  2NM1 A;  2WNE A;  3M70 A;  4HAN A;  3GYD A;  5A7W A;  3V56 A;  3WQ7 A;  4CDW B;  1HRI 2;  4NIA A;  2PHR A;  4ES9 A;  2YC0 A;  4GIQ A;  1QH6 A;  4MGS A;  5KXB A;  3ENR A;  5LCW L;  3NNG A;  2BWC A;  2XH6 A;  4CRQ A;  3PUH A;  3RS6 A;  1CR7 A;  4H7M A;  1BHG A;  2R04 2;  2RMU 3;  4IND A;  5HPO A;  4M3C F;  4O65 A;  1W6M A;  1QQP 2;  2G9F A;  5JVV A;  5LEJ A;  2VQT A;  4URA A;  3VBS C;  2WA3 A;  2WWU A;  1RMU 2;  1U5I A;  2PHF A;  2WC2 A;  4GH4 B;  1D4M 3;  1VAM A;  2W91 A;  2XJQ A;  5EJ3 A;  5JLV A;  5KR7 A;  4R4Z A;  5J7M A;  4TZD A;  2G19 A;  4E8C A;  1L3J A;  1Q8P A;  1XYO A;  1HJF A;  1RJ7 A;  4XHX A;  2YPJ A;  1XJA A;  1OUX A;  3T30 A;  4QU2 A;  3BYW A;  1GWL A;  1E5S A;  1RUG 1;  3EB7 A;  3KT4 A;  3PVN A;  2WN2 A;  1W2U A;  2JX9 A;  1JI6 A;  1DDL A;  4BOW A;  1JYI A;  3DV8 A;  1XNK A;  4IEW A;  4LK7 A;  3TN9 3;  1EPZ A;  2ZCW A;  4C0H A;  2PFW A;  5AC9 2;  5DAV A;  5IFT A;  1A34 A;  4MSV A;  3INA A;  4L0P A;  5LA9 A;  4EWA A;  4K8R B;  5GKA C;  5BNP A;  4XUP A;  5CFD C;  1IQD C;  4QX0 A;  3TYJ A;  1N1S A;  3S5A A;  2YHJ A;  4W6Y A;  3SEE A;  1NLR A;  3U14 A;  4AI9 A;  3MZH A;  2MEV 1;  1AJK A;  2DWR A;  3WNK A;  3H8X A;  5GZG A;  3U4X A;  5K0U A;  4B7K A;  1QDC A;  2VU9 A;  2WA4 A;  2XHN A;  2R6Q A;  4LTA A;  4AAX A;  4CCJ A;  1Z7S 3;  2VZO A;  3ECQ A;  1OT5 A;  1QMJ A;  1SQ4 A;  3EO6 A;  4RA0 A;  1YJL A;  1C8N A;  1MEC 3;  2GAL A;  2ARB A;  4BQ3 A;  3GF6 A;  4Z2A A;  4LIV A;  1SBF A;  3I97 A;  4Q4W 3;  1OBN A;  3OPZ A;  1QJZ A;  2ADD A;  4IXL A;  2HWE 3;  4JVA A;  5C70 A;  4YVW A;  3WG3 A;  2RS1 3;  2XOM A;  2DBN A;  4FXK B;  2DVB A;  3PUR A;  3UES A;  1H2K A;  4HKL A;  5C5U A;  3WG2 A;  3BB6 A;  1NY7 1;  2N7G A;  1S0E A;  3O14 A;  4Q0U A;  5CKM A;  5FY8 A;  4CP9 B;  4Z82 A;  1FAY A;  4LXL A;  3RDI A;  4D69 A;  3AP7 A;  1GZ9 A;  1KS5 A;  1W6O A;  2VZQ A;  4LBK A;  4ATF A;  2PHU A;  1VBA 2;  4Q1R A;  5HV4 A;  1O3R A;  3KLS A;  1JUH A;  2ZEZ A;  3QD6 A;  1A8M A;  2PHL A;  2HEV F;  2ZAC A;  4QM9 A;  1GMM A;  1FYU A;  3OOX A;  1OLR A;  2AH2 A;  1WBF A;  1BCX A;  3CJI A;  1APN A;  3MW4 A;  3WZ1 A;  5IVJ A;  1ZRD A;  4IW3 A;  2CSG A;  5CEH A;  4IEZ A;  4Y26 A;  3RYP A;  1GP5 A;  5HI0 A;  2XQX A;  3MIH A;  5FP8 A;  1WD3 A;  4Y5T A;  3ZR5 A;  2V4V A;  3MLK A;  1MVE A;  4Y22 A;  1VBD 3;  1ZBA 3;  5A1F A;  1JZ5 A;  2BBA A;  4NHY A;  3ZR6 A;  4WM7 B;  3ELN A;  4OQ8 A;  5FYY A;  4IQP A;  2A75 A;  2RDN A;  4UW4 A;  3ZSE A;  3OGG A;  3MID A;  3RZL A;  1AZD A;  2MHF A;  1QJY 1;  3RPQ A;  1RUD 3;  2BFU L;  1PK6 A;  5HCH A;  4FTB A;  1SBE A;  4PIX A;  1UOJ A;  1WBL A;  1R08 1;  1EV1 1;  3TEX A;  5IVF A;  4GWI A;  2QQW A;  1SLL A;  2X5I C;  3A23 A;  1FPN 2;  1RED A;  2PLV 2;  2Q1Z B;  2WO7 A;  3O0X A;  4FOY A;  4OZX A;  4B4R A;  3VD3 A;  1RVF 1;  4WM8 A;  5GLU A;  1PVC 2;  1UZV A;  3LPG A;  2J1U A;  2E7T A;  2RM2 3;  1O3T A;  1I5Z A;  4PI2 A;  5DUU A;  2VD7 A;  4Q27 A;  1RC6 A;  5ANQ A;  4GAL A;  2XPJ A;  1AL2 2;  4BK4 A;  3HIF A;  5DDJ 2;  1C3H A;  1IS3 A;  5FZF A;  5J37 A;  4CDQ A;  1X8E A;  3ORJ A;  2JG9 B;  4KI5 M;  2HKX A;  2WL1 A;  4HMZ A;  3PUQ A;  4I0W B;  5FPA A;  5KXD A;  1I9R A;  2AUY A;  4COV A;  1IPK A;  2BNN A;  1LR5 A;  3WG1 A;  3UL2 A;  5LWB A;  5A7S A;  4XF0 A;  4P9Y A;  2WDB A;  3HJR A;  2Y0O A;  2VOX A;  5F9T A;  5JR7 B;  2QUO A;  5HV0 A;  5IYY A;  1OD5 A;  1COV 1;  4AFA A;  4P9X A;  4OI2 A;  5F37 A;  1LOE A;  4IV1 B;  4R8H A;  3N9Q A;  3AYA A;  1NCQ A;  1AHS A;  1O4Z A;  4Q0V A;  3B7M A;  4K20 A;  1ZA4 A;  4DXZ A;  3UKV A;  5LY1 A;  2VUL A;  4FPJ A;  2HWD 2;  1YFU A;  4NHK A;  2RJ2 A;  4HBN A;  4WM7 C;  4XXA A;  4HSL A;  2VQA A;  4AEJ A;  1PM7 A;  4COZ A;  2XON A;  5FO9 B;  3APB A;  3VGI A;  1LTE A;  2JG8 A;  4WVM B;  4XE9 A;  3KF3 A;  4P00 B;  3ZKY A;  1CQ9 A;  1YC6 1;  3B3Q E;  3MEP A;  4GXL A;  2BNM A;  2CDO A;  5C9A A;  1ZRR A;  3GHM A;  4A41 A;  2QKD A;  3OY8 B;  3SH3 A;  4AWD A;  1FX5 A;  4R9C A;  1MQT A;  4Q4V 2;  1R1A 1;  1Z0H A;  2VCM A;  3SIS A;  5CIR A;  4CU8 A;  3WUD A;  1S4C A;  2YZ4 A;  4PQ9 A;  4BQ1 A;  2UYB A;  3HBK A;  3L2H A;  3LEI A;  1REF A;  5CB7 A;  2BER A;  2HYX A;  4XUT A;  1C5H A;  2WLP A;  3PIJ A;  3MIB A;  3JU9 A;  4DIQ A;  4M01 A;  4QDR A;  5FP4 A;  3AXD A;  4LBQ D;  4XF4 A;  2P1B A;  4NID A;  1NCR A;  4LBQ A;  3LPF A;  1UIK A;  4XYX A;  1BLZ A;  4XPV A;  1VBB 1;  1MS0 A;  2GME A;  4UBH A;  2HWC 3;  3RGB A;  3WCS A;  4LQR A;  5JZG B;  1DQ4 A;  1JU4 A;  1VBE 3;  5FMO S;  4QB2 A;  5IWF A;  1HRV 2;  3HVD A;  4YLZ A;  4EN8 B;  3IN9 A;  1AR9 1;  5A1A A;  4PI0 A;  3ITQ A;  3THP A;  4BIO A;  2XLG A;  5AC9 3;  4YYO A;  4JAA A;  3ZFF C;  2R06 3;  1NQJ A;  2GP5 A;  1DQ6 A;  2RDR A;  3FHI B;  4XQW A;  5HXV A;  2WSV A;  1LOA A;  2V09 A;  3OG2 A;  3HEI A;  2WN3 A;  4N43 A;  3KV5 A;  3I2J A;  5B4X A;  1AYM 3;  3VKF C;  3WW3 A;  5I0S A;  2FZ2 A;  4J25 A;  4BQX A;  5ANN A;  4TLF A;  2QQO A;  2MNG A;  2JDM A;  3FX3 A;  1PVX A;  4P9L A;  4YSF A;  5JWP A;  4A7K A;  3KCC A;  2FCV A;  3M4F A;  1Q3E A;  2VY0 A;  1W28 A;  2YFZ A;  3ALQ A;  1QJX 1;  5LRS A;  1K5M A;  4BE3 A;  3LDK A;  2Y6K A;  3O1T A;  3M2M A;  2NP0 A;  5DXD A;  4Q5O A;  4BPZ A;  3V0B B;  2RS5 3;  3OBA A;  1JZ3 A;  1AF9 A;  1ULC A;  1YI7 A;  2RMU 1;  1Q8Q A;  4PBP A;  5CNA A;  1AVB A;  3H0O A;  1H1A A;  4GH4 A;  1OFS A;  2P6H A;  4K3U A;  1VBA 3;  3OTF A;  4FPO B;  1VBC 3;  2FCT A;  2JKX A;  4NWW A;  1F9K A;  2ETE A;  2XBO 3;  3I54 A;  1RUI 3;  5F5Q A;  2LW8 A;  2WNV C;  1U0A A;  2WT0 A;  4Q0P A;  2Y8K A;  4XEZ A;  1D4M 1;  3K77 A;  3LD8 A;  4YFW A;  2Q4S A;  3JBG 2;  2WAB A;  5JOX A;  4AED B;  2OZJ A;  1ZM1 A;  3VZN A;  4KNC A;  4G3Y C;  4QAW A;  5FBZ A;  1VRH 1;  2RS3 3;  1AJO A;  3VBF C;  3P5B A;  3ST7 A;  1JHN A;  2WR9 A;  4QHB A;  3DXT A;  3PME A;  3DL3 A;  1DZT A;  3A0K A;  5FZI A;  1PM4 A;  4N53 B;  1NX9 A;  4EN9 B;  3ZDV A;  1H8T C;  1W06 A;  5F32 A;  5I8S A;  3BOW A;  4FFH A;  3PU8 A;  2A6W A;  3LCP A;  2B39 A;  3FWE A;  4XXP A;  5DAB A;  5FZO B;  1PX4 A;  3CMG A;  4NHM A;  2YBK A;  4DB5 A;  1GLH A;  1IKP A;  4GWN A;  1IPS A;  1LOF A;  5C8C B;  1NG0 A;  1V6O A;  3AZV A;  1S0I A;  4RS5 B;  1W6Q B;  5F2W A;  5T5O A;  2ENR A;  4DXS A;  3WQ1 A;  3KHB A;  1RUF 3;  4LBJ A;  2C9K A;  4QU1 A;  1US3 A;  1GOG A;  3VBH B;  5FYB A;  1VB2 A;  4K9S A;  1NZI A;  1E5H A;  1LHO A;  5T50 A;  4TN7 A;  4KWJ A;  3KM5 A;  3POG A;  1XU2 A;  4MOA A;  4Q4X 2;  4E27 A;  1JW6 A;  4Y3O A;  2DCT A;  4TWT A;  1OQ1 A;  5LBC A;  2EIC A;  2QBX A;  3AFK A;  2W0X A;  5A6Q A;  1CWP A;  4OHW A;  3W5M A;  4KU7 A;  3PJQ A;  4AHZ A;  4FTE A;  1B35 C;  1PGW 2;  3CF6 E;  3SH5 A;  4MXW A;  1NE6 A;  2QJV A;  2ORX A;  3CBN A;  3WCR A;  2JDN A;  4GKY A;  2VMG A;  2XL9 A;  1JOP A;  3B69 A;  1F2N A;  5FXZ A;  3U11 A;  3UET A;  4AGG A;  1GOF A;  4XIK A;  4AED C;  3BPZ A;  4MGZ E;  2X8K A;  1NA1 B;  4M4R A;  3ETP A;  3KV6 A;  2UYA A;  2P6C A;  3OYW A;  2C4X A;  2MPF A;  1PGL 1;  2Q30 A;  1O5L A;  4ISQ A;  4Q2F A;  2HWB 2;  1C8M 3;  3VL8 A;  4AGR A;  4NIH A;  4QM8 A;  1UOG A;  2J1V A;  5C3R A;  3PIG A;  5C5T A;  3OF1 A;  1MVQ A;  4XJZ A;  1RUH 3;  5EYY A;  4CP1 A;  2IXI A;  5FYZ A;  1K5J A;  3ZXD A;  4B1M A;  3X29 B;  2FMD A;  1V6K A;  3L9J T;  1HKD A;  3EYP A;  2Q1M A;  4MX3 A;  3T0B A;  4CUA A;  2B4K A;  2RHP A;  5A7O A;  2BVB A;  1ONA A;  5FYI A;  2W52 A;  2HWF 2;  2QDR A;  2ZX2 A;  3P6B A;  2WFF 1;  5BNN B;  1J84 A;  1J58 A;  5C4W C;  1NXM A;  2FBE A;  1MPX A;  3FHQ A;  3AP5 A;  4MET A;  4QX2 A;  4XF9 A;  2W95 A;  2LAL A;  4P14 A;  3ZLI A;  4PCR A;  2QZ2 A;  1ODM A;  1RTV A;  4CEY A;  5KWR A;  2R07 1;  5A70 A;  3EBR A;  1VRB A;  5FFO C;  3IAP A;  2ARA A;  2W1W A;  4IER A;  4M0N A;  1VB4 A;  2AEY A;  2P2K A;  4BQ5 A;  2JG9 A;  3ACH A;  1OPO A;  3TEW A;  1EUT A;  1LUL A;  5FYC A;  4NII A;  4EE2 A;  3HD8 B;  2PTM A;  4UFJ A;  4XHB A;  5DAX A;  1RIT A;  2H0V A;  1POQ A;  3RNS A;  3Q8A A;  2CTV A;  5FYV A;  1LGC A;  2GC0 A;  3VZM A;  3III A;  1CAU B;  3WIN E;  3THD A;  1DGL A;  1HB1 A;  3ZYH A;  1EAH 2;  1KJL A;  4FPL A;  1H6Y A;  4DRR A;  4PF1 A;  5F1R A;  5A7W B;  1RUE 2;  3LAG A;  5EFU A;  2JD9 A;  1CVN A;  3AMH A;  3AXE A;  2UUR A;  4QKF A;  4S2D A;  3VKO A;  1DGW X;  2ZGU A;  1NA1 C;  4IV1 A;  1MS3 A;  2OQ7 A;  4QXB A;  1JYV A;  4YNI A;  2SBA A;  4R9A A;  2ZGT A;  1TME 2;  5FMO L;  2NQY A;  2PXJ A;  2DVG A;  3DEC A;  4YVS C;  1ULP A;  1W90 A;  3NNF A;  3NAP A;  2HBU A;  4FPK A;  4DS0 A;  1PO2 2;  2PHW A;  5F6L B;  5JAX A;  3KHC A;  2WZR 1;  1CAV B;  1W6M B;  3QOP A;  3NKT A;  4LBN A;  5EWS A;  5FY7 A;  1LEM A;  3RMX A;  2VZR A;  2W1Q A;  2VCB A;  4WVM A;  3F95 A;  1HRI 1;  4Y1Z A;  3NV1 A;  3RZZ A;  4RQP C;  3VBR C;  2WUH A;  2XJP A;  4AHW A;  1CAX A;  3SQO A;  1ASJ 2;  5FOJ B;  4FQ4 A;  1E57 A;  5LBF A;  1RUG 3;  4BDV B;  4XFF A;  1RHI 2;  2P3I A;  5BNN C;  2JDH A;  4LLO A;  4EN0 A;  5DZG A;  4CXX A;  2VNR A;  3POJ A;  3KQR A;  2R04 1;  1SFN A;  1ZZC A;  2WNO A;  3DGT A;  3LWC A;  1QGL A;  4QDS A;  1D0H A;  3SEP A;  4JGY B;  3GCW A;  1AYN 2;  3FMG A;  4CXW A;  2XB6 C;  3TEZ A;  3WW4 A;  3AMQ A;  1GZW A;  1RMU 1;  4UOJ A;  5E89 A;  2MEV 3;  4IE4 A;  2DCK A;  4K7J A;  4PHZ A;  4V1P A;  5IK4 A;  2EAK A;  4NOT A;  1QWR A;  2GNT A;  5BNP B;  3U1X A;  4G9S B;  2WZ8 A;  1Y7B A;  5FO7 B;  4CXY A;  4LUK A;  2ORZ A;  4AI2 A;  1W04 A;  1A8D A;  4PIY A;  5J36 A;  1AR6 2;  5APA A;  4LBM A;  4XOG A;  5K0U B;  2W92 A;  3PMS A;  2O8Q A;  3MIE A;  1BBT 2;  2DUP A;  1LHN A;  4MLO A;  3LOB A;  3AMM A;  1KFX L;  3TB0 A;  5AC9 1;  4HET A;  4NO4 A;  1OOP A;  3O1U A;  2H0B A;  1C28 A;  1PZ7 A;  4FPC A;  4OYU A;  4XFI A;  3FBY A;  5BV6 A;  4YVW B;  4QQL A;  2W39 A;  2XJS A;  3ZVX A;  4A7Y A;  4DY3 A;  2YV8 A;  1ZYB A;  3I59 A;  3M8L A;  5DN2 A;  2YBP A;  2LUW A;  1ULD A;  4HK9 A;  2WLQ A;  3D0S A;  2YGL A;  4W50 A;  5L7O C;  1RGS A;  3WLU A;  1N3P A;  1XNT A;  1YFX A;  3O12 A;  4HVR A;  1W6O B;  2DCJ A;  2JXA A;  3NNM A;  4PLO A;  4M00 A;  4XJ9 A;  3ILN A;  2BOI A;  2UWC A;  2A6V A;  2VMI A;  4NHX A;  1H1M A;  4AVA A;  4N7I A;  3UYJ A;  4XFC A;  1QEX A;  3H8O A;  1DYP A;  1U12 A;  2QQU A;  2W94 A;  1KIT A;  2YC2 A;  1G9B A;  4X6R B;  4HOO A;  4COW A;  3KCX A;  4CUG A;  1DZR A;  2J7M A;  4DQA A;  3CJI B;  4IEY A;  2ZGO A;  1V6J A;  2RS5 1;  1RUJ 2;  3TOJ A;  5IVB A;  4XAE A;  1JBC A;  3WV6 A;  3AVS A;  2NPI A;  2WBK A;  2Q8E A;  1ALY A;  1VBA 1;  2X05 A;  3TWI A;  2R7E B;  3BAL A;  4Y22 B;  1QJY 3;  2AZ5 A;  2GP3 A;  3BTY A;  5A33 B;  3ETQ A;  4R9B A;  4OLL A;  1R08 3;  1EV1 3;  3U07 A;  1IOA A;  2KR2 A;  3I3D A;  4QPG C;  1QDO A;  3N7M A;  1HDK A;  2VZ3 A;  4HT1 T;  4Y1V A;  1UU6 A;  1OD3 A;  3VZL A;  2A70 A;  2GU9 A;  1PK6 B;  1RVF 3;  2BTV C;  1HB4 A;  3I3E A;  4O61 A;  4YW3 A;  3F2Z A;  4CP2 A;  3AKS A;  3OD4 A;  4BK5 A;  1GNZ A;  1FXZ A;  1XB9 A;  1O3Q A;  3FHA A;  3U4S A;  4BXF A;  5FZO A;  2XL7 A;  4JDM A;  4QWN A;  3QCW A;  4WM8 B;  4IGQ A;  5FZH A;  2WQ8 A;  3ZSJ A;  2D3S A;  1O4Y A;  4YM1 A;  5C8C A;  1W6Q A;  4EYU A;  1UMI A;  1S2B A;  4CDQ B;  3W20 A;  1RL3 A;  1D7P M;  2VW1 A;  3I2G A;  1VP6 A;  3HAG A;  3VBH A;  4GMP 3;  2RV9 A;  4AF9 A;  2ZKL A;  2VL4 A;  1CJP A;  1H9P A;  3WF1 A;  1XNC A;  3LA2 A;  1FPN 1;  2PLV 1;  5E16 A;  2ZHM A;  1RUF 1;  3ME2 A;  1COV 3;  1PVC 1;  3GZT B;  4QXC A;  4AQS A;  3AB0 A;  1QJU 2;  4MH0 E;  4OZO A;  4Z92 B;  3CQO A;  3HWJ A;  2ARE A;  1CZT A;  2XJV A;  3OEA A;  1AL2 1;  1W6P A;  2VTX J;  4NUB A;  1ND2 A;  5DDJ 1;  1Y9M A;  4CUB A;  3B9C A;  1T6B X;  3CJI C;  4D6R A;  1WLD A;  1HW5 A;  3GGL A;  4PLM A;  5F5C A;  3POE A;  4P9W A;  2BFU S;  3WNP A;  3WNN A;  3ZXA C;  2XVK A;  1NCQ B;  5A32 A;  3LQC A;  3MW3 A;  4CCM A;  4BB3 A;  3AZZ A;  1UZZ A;  4GWM A;  3T09 A;  5CA6 A;  1UPS A;  5I0U A;  4LUM A;  1UX7 A;  3W9A A;  4YAR A;  2NMO A;  4EN6 B;  1H0B A;  1UY3 A;  2WNU C;  1XBF A;  3BOD A;  3P3P A;  2JG8 B;  1R1A 3;  2BUK A;  3I3B A;  1NZC A;  3C7E A;  4QKD A;  5FO8 B;  4LUL A;  5C9A B;  4KU8 A;  2W46 A;  2ZEW A;  1HXS 2;  4NRP A;  1MQT B;  4XFH A;  1J59 A;  1JZ4 A;  4HPK A;  1X7N A;  2VZU A;  3M3O A;  4IUG A;  2E63 A;  2HWD 1;  2XQR A;  5E1R A;  2FDF A;  5AFE A;  1ENR A;  1F4H A;  2TBV A;  3KCY A;  4N7U A;  3T2Q A;  1G9F A;  1V00 A;  3VD9 A;  2AGS A;  4UYB A;  1C5I A;  1Q56 A;  5G05 L;  1DQ0 A;  3D4K A;  4NAO A;  1YIF A;  1NCR B;  2R1D A;  1AR9 3;  2Y26 A;  2ZGM A;  3KQ4 B;  3LIH A;  4LBQ B;  2BJS A;  4JCK A;  4MO3 M;  1A78 A;  3KZ4 C;  1JZ2 A;  2CGO A;  5FMC A;  5FPB A;  2Q5T A;  4YGB A;  3R4D B;  3K3N A;  5JMC A;  4BA6 A;  1L7Q A;  1SDD B;  1FOD 3;  4AVT A;  2G1M A;  4CDU A;  4MG2 A;  1JTZ X;  2CAU A;  4NAM A;  2D40 A;  2ERF A;  4IE7 A;  4N90 A;  1PZ9 A;  2OA2 A;  2W68 A;  2YY1 A;  3THT A;  4OI0 A;  1YQ6 A;  1W0P A;  4YGC A;  5KHH A;  4AYU A;  4FO9 A;  2VMD A;  3RG0 A;  3J8F 2;  4ISR A;  4QDQ A;  1CAU A;  1AR6 3;  2Z4F A;  3SLI A;  1S0F A;  2QQL A;  4NR1 A;  5G04 L;  1S0B A;  4CDX C;  4JRL A;  1YLL A;  1YXW A;  2YRO A;  2JEC A;  3HNY M;  5GZE A;  1HRV 1;  1Y43 B;  4W6X A;  3HBZ A;  3VDA A;  4J1W A;  2VZS A;  1F31 A;  3NST A;  1QJX 3;  1R09 2;  4QX5 A;  1WWY A;  5FZL A;  3I49 A;  2WJS A;  1YUD A;  3AMP A;  3MPP G;  3HT2 A;  5LBB A;  3ZYI B;  3O1M A;  1PNF A;  1LHW A;  2GAU A;  1CAV A;  4DUW A;  5JXJ A;  4CCK A;  5C9A C;  1K5M B;  3CL1 A;  2BBV A;  3W58 A;  1AXZ A;  5IAX A;  3J7H A;  1MQT C;  4UW5 A;  2A1X A;  2WT1 A;  1W6N A;  2Y38 A;  3E6D A;  3PL0 A;  4ARY A;  5CFC A;  1WMF A;  4S2H A;  2CY6 A;  5LB6 A;  2E53 A;  1VRH 3;  3LE0 A;  2O8O A;  5BNO A;  5D8A C;  1WLC A;  1K3I A;  3VBO A;  3P1I A;  3VLB B;  1F5J A;  2FMY A;  1OUR A;  3GBW A;  3M3C A;  4JGY A;  2EXH A;  3DPR C;  3GBG A;  5FP3 A;  4Q29 A;  1TQ5 A;  2BV4 A;  4UI9 L;  2LRP A;  5A3L A;  5DZF A;  3E5U A;  3G7D A;  4BQ2 A;  2ZA9 A;  5DUX A;  4RR3 C;  3LF7 A;  5FZ1 A;  4AFC A;  5BY5 A;  3K4A A;  4C91 A;  2WQ4 A;  2ZEX A;  5FP7 A;  2VBD A;  5H9Q A;  5A3M A;  2Q8D A;  1C4R A;  2B9V A;  5AVP A;  3QLQ A;  1GQP A;  3V64 A;  1PO1 2;  4N43 C;  1UW8 A;  5GM0 A;  5F8P A;  5LA2 A;  5LW9 A;  4CZS A;  4RD7 A;  4MGY E;  4CDW C;  1BQP A;  1EUU A;  5LEK A;  4D6Q A;  1DIW A;  1I5P A;  1UXZ A;  4D3W A;  2WII B;  5JI9 A;  1H2L A;  1I1E A;  4K1Z A;  4GQ7 A;  4E4Z A;  3VZK A;  4EZ4 A;  1LJ7 A;  3FLP A;  1RUC 2;  1S0J A;  4FQZ A;  4BIS A;  2XVG A;  1CN1 A;  3NV3 A;  1ULO A;  3K4Z A;  4Y24 A;  2A6Y A;  2DDU A;  1WUV A;  5JCT A;  3WNL A;  4XW3 A;  4I01 A;  2GC3 A;  2D3R A;  5DMY A;  3TEY A;  4JX0 A;  4QX8 A;  5C33 A;  4MGI E;  3WP5 A;  4GH4 C;  3VKM A;  3NJX A;  3MBW A;  4IES A;  4O9E A;  4CE8 A;  4EQV A;  1GP4 A;  3CDZ B;  1UU4 A;  1J3R A;  1W2A X;  2VW0 A;  2IFR A;  2XJU A;  4MXW B;  2O1Q A;  1UZW A;  1JMU B;  5I8Y A;  3LB9 A;  1IQA A;  2ZOE B;  4H7L A;  4RN5 A;  5FK8 A;  5JIU A;  2J1E A;  3DXU A;  4GB3 2;  4GZ9 A;  3H1W A;  2DTW A;  4Q4X 1;  3OYW B;  1WLW A;  1TG7 A;  4A42 A;  4DXR A;  4JV4 A;  1YCI A;  2FQP A;  1ZA7 A;  2XXZ A;  3OJB A;  3ZYJ B;  1F4A A;  3AC0 A;  1YHF A;  4KGG A;  5FTT C;  3IDC B;  5IW0 A;  5ABJ A;  5FLJ A;  5A33 A;  1HV0 A;  1B09 A;  3H50 A;  2Z42 A;  2Y0I A;  4OI1 A;  2WFF 3;  4RGG A;  1JXN A;  2Z5W A;  2YBS A;  1YEW A;  2OT7 A;  2DFC A;  1H2N A;  2A7A A;  1HX6 A;  3POY A;  5LY2 A;  1NAE A;  1PIV 2;  2R07 3;  3TRS B;  2WS9 2;  2HWB 1;  2P3J A;  1UKG A;  5GJ6 A;  2WSU A;  3KSC A;  3VHO A;  4CEY B;  1GFF 2;  2J22 A;  2X53 S;  5GLZ A;  4EZH A;  3A4U A;  1OSG A;  1A3K A;  2GND A;  2VTX A;  5C3S A;  1LEC A;  1J3Q A;  4FFI A;  1LEN A;  4N9H A;  2HEW F;  2HWF 1;  5IT6 A;  5C3P A;  3WR0 A;  2GSY A;  1DLL A;  5ACA 2;  2JB8 A;  4PIZ A;  3L2Y A;  2PYT A;  3UT0 A;  2F4L A;  4FPH A;  4LJH A;  4XTP A;  1WCS A;  4GMP 1;  1UY4 A;  1W9W A;  2VC9 A;  5JI7 A;  2ZGS A;  4DIN B;  1S1A A;  4Q4Y 3;  1YQ5 A;  1CZV A;  3JQW A;  3PVO A;  4F83 A;  1ULG A;  4YM0 A;  1G9D A;  3GXU A;  3PTR B;  3VD5 A;  2WZR 3;  3ZXF A;  4AR2 A;  5FY0 A;  1C1L A;  2WZE A;  4R52 A;  3BIE A;  1XYN A;  4Z1V A;  3GBF A;  1QU0 A;  4TSV A;  1HRI 3;  2VMF A;  2XGX A;  3NAP B;  4QHO A;  4ZS2 A;  4Y5S A;  3AMN A;  3MHZ A;  3H8R A;  2I07 B;  3LSD A;  1IS4 A;  2VZP A;  5IK7 A;  1JUI A;  1EAH 1;  1UIJ A;  1UOF A;  1ENX A;  1OQD A;  1T2X A;  2D5H A;  4ES8 A;  1RUE 1;  5C71 A;  4FSJ A;  4CUC A;  1GQH A;  3H9A A;  5A3W A;  4IV3 B;  5GAL A;  4X8P A;  3SC7 X;  1CAX B;  2ILM A;  3J7M A;  2ZHK A;  2R04 3;  3ZYR A;  2RDQ A;  2D98 A;  3Q8B A;  3MFC A;  1QQP 3;  1TME 1;  4FVV A;  4ONU A;  3FC0 A;  1WMD A;  1PMJ X;  2VNV A;  3BPS A;  1PO2 1;  1RMU 3;  1W3X A;  1OH3 A;  2V5D A;  2VVE A;  3DYP A;  4JTO A;  4P02 B;  1U5Z A;  4Q0Q A;  2DVF A;  1BK0 A;  3SH4 A;  4CTE A;  5K8S A;  2H6B A;  1GZW B;  4ARX A;  5JXH A;  2DV9 A;  3WVJ A;  2V4A A;  2C0Z A;  2YG0 A;  3SXW A;  1SLT A;  2JG9 C;  4EV0 A;  3IWZ A;  1ASJ 1;  5C3Q A;  1CPN A;  2XKP A;  5L36 A;  2R49 A;  4FT8 A;  1FMD 2;  1RHI 1;  3AP9 A;  1JZ8 A;  5DAP A;  1TMF 2;  3MFA A;  1ZZ6 A;  4FBF A;  2B7Y A;  2W87 A;  1O8S A;  1W9T A;  1I6X A;  3OB8 A;  4Q0S A;  1XE8 A;  3ZXL A;  1TVG A;  4UFK A;  2GH8 A;  2IXK A;  3ZFE A;  2JIC A;  2VZT A;  2CHH A;  5GZD A;  3LKJ A;  1FOD 1;  1AYN 1;  3ACG A;  1LU2 A;  3H42 B;  4YGD A;  3UGH A;  5KXC A;  1EP0 A;  1BZW A;  3ZMN A;  1DYO A;  3MF9 A;  2PHX A;  2K2S A;  4IV1 C;  1OOP B;  2J42 A;  4XJW A;  2DUQ A;  4DXT A;  1CIW A;  3AKR A;  1US2 A;  4YW6 A;  1NT0 A;  3GNE A;  3IAQ A;  3JZV A;  1XE7 A;  4OMC A;  4RYD A;  4YRD A;  1KQR A;  2B42 B;  2RR1 2;  3I59 B;  2ZXQ A;  1AR6 1;  1CAW A;  4LHS A;  4JKL A;  4LKF A;  3ZYG A;  5CVR A;  1BBT 1;  5CFD A;  3WNM A;  5HXM A;  2F4P A;  4XIO A;  5LAT A;  3D3A A;  4COU A;  1H8V A;  1Z78 A;  4KG8 A;  5LK5 A;  3AM2 A;  3T1L A;  3ZKU A;  3JUU A;  3G6J B;  2LS6 A;  2Y6F A;  3GHN A;  2FZ1 A;  2R1B A;  3LOI A;  4IEX A;  2W5F A;  1UCX A;  4K21 A;  3AKT A;  5FMB A;  2Y60 A;  3JQX A;  4CCD A;  1AX1 A;  4QQP A;  5CG9 A;  5LA0 A;  1LES A;  2EIG A;  1RUN A;  1IG0 A;  1IKQ A;  4IEU A;  2YYO A;  4QX3 A;  4BM8 A;  1W8T A;  2VGD A;  2JKB A;  4ET7 A;  2VZV A;  4BQY A;  4FFG A;  4LR4 A;  4BQW A;  3IDE A;  4Y5Z 0;  2FDI A;  1ZBE 2;  2VUD A;  5EJ1 B;  2E9Q A;  3FFQ A;  5FYH A;  2QVS B;  4Y1Y A;  5FZ9 A;  4CU6 A;  1Q43 A;  1SEF A;  5JZG C;  3IZO A;  2Q8O A;  4B7E A;  1BVP 1;  4GAZ A;  3UV9 A;  1UQX A;  3HR9 A;  2J1R A;  3OGR A;  1CD3 G;  3S7I A;  5L9B A;  2R0H A;  2YGM A;  2TEP A;  4I0B A;  3ZXE A;  2J1S A;  1RUJ 1;  3LZZ A;  2A3Y A;  4H14 A;  1DLC A;  3MIF A;  5J48 A;  2A3X A;  3I2D A;  3ACL A;  1ZRE A;  1W2T A;  5JXI A;  4E9K A;  3N9M A;  1DZQ A;  1MAC A;  1AR8 2;  3M3Q A;  4FPF A;  5FLI A;  1LHU A;  1MR5 A;  4QPI B;  3WNX A;  3ZN5 A;  4QGL A;  2VOW A;  2YPD A;  3PVE A;  4RFR B;  2XWJ B;  1FPN 3;  2PLV 3;  5EXO A;  4L99 A;  5E88 A;  2ZX0 A;  2BZD A;  2A73 B;  4OUE A;  1PVC 3;  4UT5 A;  1ENS A;  5T55 A;  1OFN A;  3B01 A;  4XMI A;  1QH7 A;  1M4W A;  2QQI A;  4CSW A;  5C8W A;  2VM9 A;  5FZM A;  1DQ2 A;  1AL2 3;  5DDJ 3;  5EZW A;  1N3Q A;  1YRZ A;  5A3N A;  1JYC A;  1OKO A;  1QNW A;  2B5H A;  1XND A;  2VCA A;  4N9I A;  2OUH A;  4KBZ A;  5ERL A;  3TNQ A;  2E6V A;  1AR7 2;  1W6P B;  3U37 A;  1ND2 B;  2VVD A;  2LM3 A;  4W8J A;  4B1L A;  2PQS A;  3I7D A;  5JDB A;  3S6P A;  4TTG A;  1MS1 A;  2DU0 A;  1X82 A;  5A32 B;  1QY4 A;  3QAC A;  4H3W A;  5L9V A;  2E32 A;  5EIY B;  5LRR A;  1PMH X;  1ZZ7 A;  3JD7 2;  4K40 A;  4A6O A;  1XRU A;  5F3E A;  2KA3 A;  1QJU 1;  4LA2 A;  5SV8 A;  4C0B A;  2PAM A;  4ZHN A;  1E5I A;  1WW4 A;  1XNA A;  3WW1 A;  4DUX A;  2ZHL A;  1CGP A;  3S5Q A;  2QFE A;  3EHK A;  3WF3 A;  3KV9 A;  4N53 C;  1BYH A;  2BP6 A;  2HWD 3;  3ZXK A;  3MW2 A;  5K9Y A;  4LLF A;  3V65 A;  1WW7 A;  4QB1 A;  4LEJ A;  3CEW A;  1QOT A;  3GDB A;  5E8A A;  5FZK A;  4AVC A;  4YZ4 A;  4AHX A;  2PA7 A;  4HPK B;  5FUP A;  4N8M A;  5FIX A;  4DPN A;  1VAK A;  4JDO A;  1YWK A;  2D44 A;  3MLL A;  4KH9 A;  3NV2 A;  5C8C C;  1GYK A;  1IS6 A;  4RS5 C;  5K4L A;  5F3C A;  4MUV A;  3VB9 A;  4Q4V 3;  4CCL A;  3RI8 A;  4XAA A;  1PMI A;  4AOC A;  1G6N A;  5EV7 A;  1S0G A;  3OPT A;  2VE1 A;  4YM2 A;  1YO8 A;  2DYC A;  3ZOI A;  3VBH C;  1SLI A;  2WWJ A;  1HXS 1;  2B46 X;  2VUC A;  4M4P A;  1RJ8 A;  3WDY A;  1DU3 D;  1ENQ A;  3KB5 A;  4LBO A;  4XF1 A;  3ZX7 A;  3LIG A;  4CDU B;  5KXE A;  2GC2 A;  4IEQ A;  3OD0 A;  1H9W A;  2AEZ A;  2EA7 A;  3H1M A;  4Q26 A;  1TNR A;  3I2K A;  4HKO A;  5JOZ A;  4KWK A;  2FD8 A;  3AKP A;  5DZE A;  1F8V A;  4NE9 A;  4L8Q A;  4NHL A;  4P5Y A;  1ND2 C;  5IVV A;  3ZN6 A;  4R9D A;  4I3P A;  1HRV 3;  2BGP A;  1OH4 A;  2B8M A;  4AQ6 A;  4U2A A;  1OVS A;  3ROU A;  5GZC A;  4LKS A;  2C24 A;  1GWM A;  5HCF A;  2E31 A;  3RI9 A;  4OUL A;  4BMB A;  2D3P A;  5CBL A;  1W8U A;  1PX3 A;  3FN9 A;  3MV0 1;  4SBV A;  4WZC A;  3OUH A;  5LAS A;  4A7Z A;  3OGS A;  1JH5 A;  3BN6 A;  2FHR A;  4F3J A;  4Q4Y 1;  2C6S A;  4QQH A;  3T2P A;  4QD2 A;  5J96 B;  5JSO A;  1W0N A;  4LHL A;  1SLC A;  4Y4Y A;  3MLJ A;  3WDV A;  3J8F 1;  3K51 A;  3OBZ A;  1MZ5 A;  1WA6 X;  2W9X A;  1O91 A;  1X9T A;  2YB7 A;  4YWA A;  4NJ4 A;  3U75 A;  3B93 A;  3SCH A;  1W6N B;  3LDR A;  4IV3 A;  1WW6 A;  5BNQ A;  3SCG A;  5CFC B;  2EXK A;  1ZRI A;  5FPL A;  4CU7 A;  1V9U 2;  1N1Y A;  1R09 1;  3WDW A;  1NOV A;  3K4D A;  1WGP A;  1J1L A;  1WCQ A;  3ILR A;  1FAT A;  4OUS A;  5BNO B;  3VBO B;  3K2O A;  1XSQ A;  4YZ3 A;  4NPL A;  2K0G A;  1G9C A;  1QQP 1;  2R32 A;  1UKR A;  4AL9 A;  3AKQ A;  5DG2 A;  2BYV E;  1VJ2 A;  5FZ6 A;  2ADE A;  5CYY A;  4CDU C;  2B9U A;  1BVV A;  1YIP A;  2ZAA A;  1HJG A;  5FYM A;  3JBG 3;  1GQG A;  3USU A;  2XR4 A;  3PU3 A;  2XML A;  1VMJ A;  3HNB M;  5FKC A;  4BIF A;  3R05 A;  4IL7 A;  1VMF A;  5DAW A;  2QDN A;  3AYC A;  2R30 A;  4GMP 0;  1Q8S A;  5A6Z A;  4D7T A;  2GN3 A;  1GAN A;  3C8X A;  3PUS A;  5B4N A;  3HNM A;  1UYZ A;  3ASI A;  2FDG A;  5AVA A;  2WNV A;  5D2A A;  1OXC A;  3ON7 A;  3PUA A;  5D1I A;  4OQ9 A;  3ZIW A;  4FPG A;  5FJH A;  3BI3 A;  1ZRF A;  4UWD A;  2VQ0 A;  3DKQ A;  5J98 B;  5GLT A;  1H4H A;  1URX A;  1KRI A;  5BYN A;  1VPH A;  4E4S A;  1AR8 3;  5EHD A;  1F5F A;  1SDW A;  1W8W A;  5FK7 A;  4HON A;  4YW7 A;  1PO1 1;  1DQ1 A;  2UWA A;  4XZP A;  4RHV 2;  4ZKT B;  1H4G A;  4JRA A;  1E5R A;  2I2S A;  2UY9 A;  3D5O A;  4LKD A;  1H8T A;  4BXS V;  4KG0 A;  1MS9 A;  5CFC C;  4YPJ A;  4Y33 A;  4FPE A;  1GNH A;  4R4X A;  2XLF A;  2BWA A;  1S0D A;  4Q4X 3;  3I8T A;  3V0A A; 
#chains in the Genus database with same CATH homology
 4LPL A;  4DUW A;  5JXJ A;  3VD4 A;  3J7H A;  5CZK A;  4ARY A;  2RJ2 A;  3W5N A;  2XON A;  1RYY A;  2W1U A;  3LE0 A;  4P00 B;  1NKG A;  1XC6 A;  2W1S A;  4XVH A;  1K3I A;  2CDO A;  2QQN A;  3P1I A;  2RVA A;  3MUY 1;  1DP0 A;  3T0D A;  4UI9 L;  1JYN A;  2HLE A;  1UYX A;  3T08 A;  4D8M A;  4CU8 A;  3LEI A;  2VME A;  3IB3 A;  3K4A A;  3WF4 A;  3JXS A;  2BER A;  2ZEX A;  2HYX A;  4XUT A;  4CVU A;  4QDR A;  2Y6G A;  3WEZ A;  2B9V A;  4QB6 A;  1GQP A;  3LPF A;  3A21 A;  4LQR A;  5LA2 A;  1JU4 A;  4QB2 A;  1EUU A;  5A1A A;  1OF3 A;  1UXZ A;  1I5P A;  3LEK A;  4XUQ A;  2JDA A;  4PQQ A;  3CZU A;  3OG2 A;  3HEI A;  2BGO A;  2WN3 A;  1ULO A;  4QX1 A;  1CX1 A;  3I2J A;  5B4X A;  2QQK A;  3K4Z A;  2DDU A;  3WNL A;  5DMY A;  2Y6J A;  3VDB A;  1OF4 A;  1W99 A;  2QQO A;  4JX0 A;  2X09 A;  2YFU A;  3MBW A;  3NJX A;  3NJV A;  3CDZ B;  3A7Q A;  2YFZ A;  2ID4 A;  4RN5 A;  1HN1 A;  3FL7 A;  5IHR A;  2VMC A;  2J1E A;  1O8P A;  4GZ9 A;  2Y6K A;  2OKX A;  3WF2 A;  1J83 A;  4ZZ8 A;  3CZJ A;  1NUK A;  3OBA A;  1JZ3 A;  3SKV A;  1TG7 A;  3K75 B;  4A42 A;  1KGY A;  4DXR A;  2JKX A;  2E26 A;  1F4A A;  2WO2 A;  3AC0 A;  2LW8 A;  2Y8K A;  3K77 A;  1LNS A;  2L9L A;  2WAB A;  3C7G A;  4QAW A;  4A44 A;  5I0D A;  2VTF A;  5JXG A;  4CU9 A;  1NAE A;  1NX9 A;  1GOH A;  2J22 A;  3HPN A;  2Y64 A;  1PX4 A;  2CDP A;  3CMG A;  2WO3 A;  4ZXE A;  1W8O A;  3HN3 A;  3ZM8 A;  1JZ6 A;  4KWU A;  4DXS A;  1KEX A;  2C9K A;  1US3 A;  1GOG A;  4XUN A;  1UY4 A;  1W9W A;  2VC9 A;  1CZV A;  4MOA A;  1UXX X;  1UYY A;  2EIC A;  2QBX A;  3GXU A;  3VD5 A;  4A4A A;  4DUV A;  2WZE A;  3C7H A;  4ZY9 A;  3W5M A;  5C7G A;  2VMF A;  1WKY A;  2ORX A;  5F7U A;  2VZP A;  2KD7 A;  3I2F A;  1UY2 A;  1T2X A;  3UET A;  4DEV A;  5C71 A;  1GOF A;  4CUC A;  4AG4 A;  4M4R A;  3MV1 1;  3MO4 A;  3ETP A;  3WNO A;  1XPW A;  5LA1 A;  2C4X A;  3HOB A;  1UMH A;  4PT6 A;  3C7O A;  2J1V A;  1PMJ X;  2Y6L A;  2V5D A;  3DYP A;  4P02 B;  2C26 A;  1JU3 A;  3E1F 1;  3EYP A;  3T0B A;  4CUA A;  2B4K A;  4ARX A;  5JXH A;  3PUI A;  2YG0 A;  3GM8 A;  1SG3 A;  4XZU G;  1UZ0 A;  4JKK A;  2EID A;  3P6B A;  1J84 A;  2QQM A;  3NQH A;  1JZ8 A;  1MPX A;  3FHQ A;  2Y6H A;  4QX2 A;  2W87 A;  1O8S A;  2W95 A;  1W9T A;  3OB8 A;  1TVG A;  1O59 A;  2VO5 A;  3DYM A;  2VZT A;  1L7R A;  3IAP A;  2V72 A;  4OMD A;  3ACG A;  1R64 A;  2W1W A;  1K45 A;  1DYO A;  3ACH A;  1K42 A;  1EUT A;  1CIY A;  3BGA A;  3LEG A;  4DXT A;  1US2 A;  1UWW A;  2VJX A;  3THC A;  3IAQ A;  4OMC A;  4RYD A;  4LHS A;  5JUV A;  2ZXQ A;  3A22 A;  3III A;  4JKL A;  3THD A;  4MAD A;  1H6Y A;  4PF1 A;  5DQ0 A;  2JD9 A;  3WNM A;  5HXM A;  1UY0 A;  3D3A A;  4XUR A;  2WO1 A;  2X10 A;  3WF0 A;  4P08 A;  1JYV A;  2LS6 A;  2EIB A;  2WAA A;  3OGV A;  2W5F A;  2VR4 A;  3DEC A;  3DYO A;  1ULP A;  2VQU A;  3ACF A;  1JHJ A;  5LA0 A;  5EJZ B;  3T2O A;  3IDA A;  4KMQ A;  2VZR A;  2W1Q A;  2VCB A;  3I2I A;  4QX3 A;  5JMO A;  4ET7 A;  3UNP A;  2VZV A;  2WUH A;  4MGQ A;  3VD7 A;  4BJ0 A;  4BDV B;  5EJ1 B;  2J1A A;  5IFP A;  1UY1 A;  4CU6 A;  3OEB A;  4QPW A;  4DEQ A;  3ABZ A;  1YQ2 A;  3SEP A;  4QDS A;  2J1R A;  3OGR A;  3SKJ E;  5IJR A;  3WQB A;  4GWJ A;  4HG6 B;  2VOT A;  2J1S A;  1DLC A;  3CKH A;  4UOJ A;  2DCK A;  2J1T A;  3K46 A;  5JXI A;  2WZ8 A;  4JHZ A;  4A45 A;  2ORZ A;  5DPN A;  1CZS A;  1K12 A;  2W92 A;  1GNY A;  2BZD A;  4OUE A;  5FUI A;  4XUO A;  2QQI A;  2VM9 A;  4FI9 A;  4UAP A;  1P8J A;  4OYU A;  2VCA A;  3MUZ 1;  5DN2 A;  3U37 A;  4W8J A;  2PQS A;  4W50 A;  4TTG A;  1XNT A;  4MGS A;  2DCJ A;  2E32 A;  5EIY B;  3NNG A;  5LCW L;  1PMH X;  1W9S A;  4TXW A;  3PUH A;  4A6O A;  4D0Q A;  2W94 A;  2YC2 A;  1BHG A;  5HPO A;  2J7M A;  1XNA A;  4DUX A;  2VQT A;  3WF3 A;  2WBK A;  4QB1 A;  3GDB A;  2X05 A;  2W91 A;  2R7E B;  4E8C A;  4JKM A;  3I3D A;  3EB7 A;  2VZ3 A;  2WN2 A;  1JI6 A;  1OD3 A;  3I3E A;  3F2Z A;  4BK5 A;  3FHA A;  5IFT A;  4L0P A;  4M4P A;  3ACI A;  2VCC A;  4XUP A;  1IQD C;  4QX0 A;  2WQ8 A;  3SEE A;  3I2K A;  4E8D A;  3WNK A;  1UMI A;  2XHN A;  4P5Y A;  4AAX A;  3VDC A;  1D7P M;  3I2G A;  2VZO A;  2BGP A;  1OH4 A;  1OT5 A;  3ECQ A;  4W4Z A;  2RV9 A;  4LKS A;  4Z2A A;  3WF1 A;  2VL4 A;  2E31 A;  3I2H A;  3I97 A;  1PX3 A;  3FN9 A;  3MV0 1;  5C70 A;  3OGS A;  2XOM A;  3WSO A;  3BN6 A;  4OZO A;  4ZZ5 A;  3UES A;  2YC4 A;  3CQO A;  3T2P A;  1CZT A;  4A41 A;  3OEA A;  4CUB A;  1W0N A;  5J1X A;  3WNP A;  3GGL A;  3WNN A;  2W9X A;  5JR2 A;  2VZQ A;  2YB7 A;  1GUI A;  3LQC A;  3T09 A;  2JE8 A;  2ZEZ A;  1UX7 A;  4CU7 A;  1UY3 A;  2W3J A;  1GMM A;  3K4D A;  1WCQ A;  3I3B A;  3C7E A;  2XQX A;  2W46 A;  2ZEW A;  1W8N A;  3C7F A;  2V4V A;  2WYS A;  1JZ4 A;  2VZU A;  1JZ5 A;  5CYY A;  2BBA A;  4IUG A;  1JYW A;  1JYX A;  3T2Q A;  1F4H A;  1JZ7 A;  3VD9 A;  3HNB M;  2WAO A;  5G05 L;  1JZ2 A;  3T0A A;  4GWI A;  4MO3 M;  3A23 A;  3C8X A;  5B4N A;  2QQJ A;  3HNM A;  1UYZ A;  1L7Q A;  3CIH A;  1SDD B;  3VD3 A;  3LPG A;  2J1U A;  4BK4 A;  2W47 A;  3NRU A;  4KI5 M;  1H6X A;  1SHW B;  2VMD A;  4QDQ A;  2Z4F A;  2QQL A;  5G04 L;  2VZ1 A;  3HNY M;  4A3Z A;  4BXS V;  3VDA A;  2E33 A;  2EIE A;  1GU3 A;  2VZS A;  2WDB A;  4YPJ A;  3HJR A;  2ZEY A;  5IYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...