2V4VA

Crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
QSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYTVYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTVSGVTGKHDVYLVFKGDSGYLFNLNWFTFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analysis of the Structural and Functional Diversity of Plant Cell Wall Specific Family 6 Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
molecule keywords GH59 GALACTOSIDASE
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2v4vA00
2Y8KA 3WF4A 4A45A 3K75B 2JKXA 5IFTA 1JU3A 3WNNA 4PQQA 2LS6A 2ID4A 2EIBA 1JYWA 3FN9A 2W91A 5C71A 4XVHA 1IQDC 4DXSA 2Y6GA 3GXUA 3LEGA 4CU9A 2QQLA 2W46A 4RYDA 1GOHA 2VMDA 1UY0A 3CIHA 3T09A 4XUOA 5A1AA 3P6BA 1ULOA 1CZVA 1XPWA 1GNYA 3WF0A 3CMGA 1OF4A 3CZJA 4W8JA 4JHZA 4QX3A 1JZ4A 2QQKA 3JXSA 2J1TA 3ACFA 1H6XA 1UMHA 3ZM8A 5EJZB 3EB7A 5J1XA 1JI6A 1DYOA 3PUHA 5B4NA 3WF2A 4M4RA 1JYXA 4KI5M 3SEEA 1KEXA 4DUXA 1PX3A 3D3AA 5G04L 3SKJE 1W9TA 2W87A 1EUUA 3OGVA 3A23A 3VD4A 4XURA 3LEKA 3WEZA 2YB7A 2JE8A 4GWIA 4PT6A 2VCBA 3I2FA 1K42A 2L9LA 1W8OA 1DLCA 3I3BA 4MADA 3OGSA 3THDA 4ZZ5A 3HNBM 3SEPA 1SG3A 2WN2A 3HNMA 4OUEA 3T0BA 2EICA 4RN5A 1PMJX 3CKHA 4CU8A 2X05A 2VZSA 2VMFA 5EJ1B 2B9VA 3DECA 2JDAA 3CQOA 4A41A 4XUPA 2J1RA 2VCAA 4FI9A 2VJXA 2BERA 3VDCA 3OEBA 3W5MA 2X09A 2ZEXA 2EIDA 1O59A 5DN2A 4ZXEA 2ZEYA 2YC4A 5CZKA 2Y6JA 1JYNA 3VDAA 1K45A 1JYVA 2V72A 2VZQA 3DYOA 3K4ZA 2BBAA 4CU6A 3FHAA 1DP0A 2CDOA 3OBAA 3HN3A 4D8MA 1JZ8A 3C8XA 3PUIA 1P8JA 5C70A 4UOJA 4BXSV 2VMEA 3CDZB 3I3DA 1J84A 1PMHX 4MOAA 3DYMA 3OEAA 2DCKA 1W0NA 5JXGA 3I97A 2V4VA 2C4XA 3MV11 2VCCA 2PQSA 4CVUA 5CYYA 3UESA 4HG6B 1CX1A 3A22A 3WF1A 2OKXA 5JR2A 2W95A 4DEQA 2VMCA 4QB6A 2W3JA 4DUVA 5IFPA 2YC2A 1MPXA 1GQPA 5EIYB 1TG7A 2X10A 1L7RA 1WKYA 4JKMA 4LQRA 3VDBA 4A42A 5FUIA 1BHGA 4QB2A 4XUTA 4M4PA 4P5YA 2VQUA 2WAAA 2VZOA 4ARYA 3ACIA 2J1AA 4UAPA 4P02B 2ZEWA 1NX9A 4UI9L 1JZ6A 3FL7A 1OT5A 4BJ0A 3ECQA 3VD9A 3WNPA 3MUZ1 1W8NA 3HNYM 4MGQA 4D0QA 4OMCA 3NJVA 2WDBA 2QQMA 2DDUA 1WCQA 3K77A 3NQHA 1TVGA 5JXHA 4MO3M 3LE0A 1EUTA 2J1SA 3I2HA 4DUWA 1JU4A 4QDQA 3UNPA 2VZVA 2ZEZA 1JZ2A 3MO4A 3BGAA 4L0PA 5LA1A 1PX4A 5LA0A 1US2A 4BK4A 4QB1A 2VQTA 4LHSA 5G05L 2WZEA 4DXRA 3C7OA 2WBKA 3K4DA 1GUIA 2W1QA 5HXMA 5F7UA 2BZDA 2JD9A 2BGOA 1SHWB 4P08A 3W5NA 1HN1A 4QDSA 1CIYA 4CUAA 2Y6KA 3F2ZA 3T2QA 5DMYA 2Z4FA 3NJXA 4MGSA 1JZ3A 1UXZA 2W47A 4QX0A 2WO2A 3IIIA 1CZTA 2R7EB 5JUVA 4GZ9A 4QPWA 1JHJA 1UY4A 4XZUG 1NKGA 2VZRA 2XHNA 4BK5A 2WABA 4JKLA 4AAXA 4XUNA 3WNLA 2VM9A 2Y6HA 3OG2A 2WQ8A 4KWUA 1W9SA 1D7PM 3SKVA 2VZUA 1GU3A 3IAPA 4PF1A 1W99A 4IUGA 1ULPA 3GGLA 4JKKA 3C7GA 2QQIA 2WYSA 4ZY9A 3HJRA 3IB3A 1O8PA 5DPNA 3T0AA 3T0DA 2ORXA 2J1VA 3E1F1 2WO1A 2VL4A 2EIEA 1F4HA 3OGRA 3K46A 3K4AA 2E31A 3BN6A 3MUY1 1XNTA 4LPLA 4OZOA 5I0DA 4E8DA 3NRUA 5JXJA 3T08A 2QBXA 2J22A 2J1UA 2VO5A 1US3A 1K3IA 1SDDB 3VD7A 3T2PA 3WNMA 2ORZA 3IAQA 4ET7A 4TTGA 2W5FA 4A3ZA 3A21A 2BGPA 4P00B 1RYYA 3WF3A 3WNOA 3MV01 3WQBA 3LEIA 1KGYA 1UMIA 1UYYA 4BDVB 4Z2AA 4A44A 1OH4A 1NAEA 3WSOA 4QAWA 3I2GA 2VZPA 3HEIA 2KD7A 2VR4A 3P1IA 5B4XA 3HOBA 3VD5A 2LW8A 3I2KA 2XOMA 2RJ2A 5JMOA 3CZUA 1I5PA 2W94A 2B4KA 2WUHA 4ZZ8A 2WAOA 2W92A 4KMQA 4A4AA 2V5DA 2E33A 1UYZA 1YQ2A 1GMMA 2VZ3A 3U37A 4DEVA 2YFZA 5LCWL 2W1SA 5HPOA 5C7GA 1JZ7A 3ETPA 2WZ8A 1UX7A 2WN3A 1W9WA 2WO3A 3MBWA 2W1UA 3C7HA 1CZSA 2W9XA 2VC9A 3LQCA 3ACGA 4TXWA 3ACHA 4W4ZA 5LA2A 4GWJA 1UYXA 2HYXA 2QQOA 5JXIA 4ARXA 5IJRA 3GDBA 3C7FA 4A6OA 3C7EA 1JZ5A 2CDPA 2HLEA 3VD3A 1R64A 2VZTA 1UWWA 1F4AA 3EYPA 2VZ1A 2XQXA 3HPNA 5IHRA 2DCJA 1T2XA 4W50A 1NUKA 3FHQA 3UETA 1LNSA 4QX1A 1UY2A 1GOGA 2Y64A 3NNGA 5IYYA 1O8SA 4OYUA 2C26A 3I2IA 2J7MA 4XUQA 1XNAA 1K12A 2Y6LA 4E8CA 2J1EA 2YG0A 1UXXX 3A7QA 4CUCA 3IDAA 3ABZA 3WNKA 3J7HA 1OD3A 2RV9A 1GOFA 2E26A 3AC0A 2QQJA 4JX0A 1J83A 4QX2A 5DQ0A 3THCA 4AG4A 4CU7A 3LPFA 1OF3A 2VOTA 2XONA 3I2JA 4QDRA 2RVAA 3OB8A 2W1WA 3LPGA 4DXTA 1UY3A 4CUBA 2E32A 2YFUA 2C9KA 2ZXQA 2VTFA 3T2OA 3DYPA 1XC6A 4LKSA 1UY1A 2QQNA 1H6YA 3I3EA 1L7QA 1UZ0A 3GM8A 4OMDA 4YPJA
chains in the Genus database with same CATH superfamily
3BOPA 3ALQA 5CFCC 1PGL2 5IATA 4I0AA 4PQQA 2LS6A 4DMIA 1JYWA 2EIBA 1X50A 5FZ1A 4AI2A 4EZ4A 2PQQA 4OQ8A 4CEWC 2CAVA 1VE0A 4PLNA 1MEC3 2PHLA 3KT1A 1R1A2 4IERA 4LITA 4KWJA 4MLOA 4CPBA 2QQLA 4R9DA 1I3HA 1FNYA 4RYDA 5GZGA 5JXHA 4HFSA 1TME2 2PELA 1JXNA 2CSGA 1DZQA 1CVNA 1QJEA 1VBE3 5A1AA 1QY4A 1SLIA 4IV1C 3VHRA 3BPZA 3ZN5A 5FQ0A 1IS4A 4FPHA 1LAJA 3MW2A 1GV9A 5GZEA 5DZFA 4MGKE 1ZRRA 1LGCA 2K46A 3MFAA 5SV5A 3NW4A 1RHI2 3VBFA 2R0HA 1U5IA 2NM1A 1E5IA 3UK9A 1YFUA 5FZ0A 4QX3A 4NPRA 4COVA 2OVUA 4AQSA 3OBZA 5ABJC 3UYJA 1H6XA 2R062 5FIXA 5JOXA 4AQ6A 4HOOA 4ZZ5A 4XBLA 2FDGA 5EJZB 2WZR2 3MIBA 2ZPXA 2GZWA 2GU9A 1DYOA 5E8AA 1A6CA 4I0BA 3VKOA 1JUIA 3VDDC 2B9UA 4Z07A 4CXWA 2DYCA 1KFXL 1AXKA 4KI5M 3D0JA 1KEXA 1N3QA 1DIWA 2Q8DA 1ZBA1 3AB0A 3VZMA 5G04L 1BCXA 1LOAA 1RUH3 2YBKA 4LR4A 2GNTA 2PA7A 4NN0A 4AK3A 5CFDA 1LGNA 5LASA 4OI2A 1YFYA 1QNWA 5FMDA 4RD7A 3S7EA 4PT6A 1OURA 2ZAAA 3D5OA 2VCBA 1X36A 1VBA3 3VBHA 1OUSA 3NL1A 3QACA 1RC6A 3O5SA 5LRRA 3WCSA 4QQPA 1C8NA 2GSYA 3WHTA 1RUJ2 1H30A 1HLCA 4LA3A 2BU9A 4FPGA 3BYWA 2ZGSA 3CJIA 1ZZ8A 3THDA 1Y43B 1QEXA 1XU2A 1SG3A 1PO12 2C1FA 2E51A 1IG0A 1REDA 2B45X 4DOUA 1T6GC 2R061 1J1TA 4RN5A 2F4LA 2RR13 4FPJA 2HWD2 4WM8B 1UF2C 5L73A 4CU8A 1VBB1 3ACLA 3PU3A 2GP3A 4Y24A 2X05A 1KFUL 2VMFA 5EJ1B 5SV8A 3ZFGB 1KD7A 3UGGA 2WR9A 4R52A 2YY1A 2VCAA 4F8AA 1D4VB 4Q27A 1FYUA 1WCUA 3VBRA 2WLPA 4E4SA 2DCTA 4IGOA 2YGLA 3W5MA 2ZJCA 3OEBA 4RFRB 2VE1A 2EIDA 3AYCA 5FY4A 1YQ8A 4FPKA 5C3RA 2R32A 3MIGA 4JGYB 5FXVA 4FFHA 4JGZB 4UWDA 1JYVA 5C3PA 4GQ7A 3T4HB 1C4RA 4OHZA 4XDOA 2PYTA 3HN3A 1JZ8A 5FOJB 3C8XA 3RJRA 5FZAA 5C70A 3BIWE 4UOJA 3MF9A 5BNNB 4BM8A 2JXAA 1RUC3 4GKXA 5JAXA 3B94A 4BQ5A 1OFNA 1YNAA 1AXYA 5KHGA 4QKFA 4XCBA 1HRV3 1HV1A 4QPIA 5FZDA 5ABJA 4IEPA 1W0NA 4YZ3A 3NKGA 2XXZA 2D93A 4XFIA 1HRV2 3SQOA 2G1MA 3I97A 2Y0OA 5CFCB 1SLCA 1MEC2 3MV11 4LLFA 2VCCA 1AR71 1AJOA 3S7IA 3O1PA 1E5HA 1VBC1 2E7QA 2G9GA 4HLTA 3S6PA 1NYWA 1XNCA 2D7FA 3U4XA 4IGQA 1R092 2CY6A 4B4QA 2K2SA 3LAGA 3KCCA 1S0CA 1CX1A 3MIDA 5FZKA 1R083 2W68A 2OKXA 1POQA 1BVVA 1WMFA 1HQWA 2W95A 2XB6C 4BWOA 4DEQA 3ZX7A 1DDLA 3VDDA 4P9GA 4QB6A 2ARAA 4MGYE 4RL7A 1RUI3 4QMAA 2KA3A 1WLWA 3NAPC 1EYBA 2P1BA 2V73A 1TG7A 4GJZA 4HN1A 1WMEA 4JQRA 1F5JA 3N9NA 5CB7A 2DCYA 4GXLA 4JKMA 4XBNA 3VDBA 5T55A 4LKFA 4JVAA 4AE2A 1YJKA 1LOFC 4P5YA 4C91A 5F9TA 4FP3A 1G8WA 2VZOA 4P9YA 5IVEA 5A1FA 1HQLA 2J1AA 2SLIA 4AI1A 4TZDA 4P02B 1NX9A 4C0BA 3IDCB 3M3OA 3V0AA 1JZ6A 4EYUA 1IKPA 1TME1 5IAVA 1B09A 4N9IA 1EPWA 1WCKA 1AYM2 4YVSC 2KR2A 4MGZE 4Q4W2 5IW0A 4GH4A 2EIGA 3WNPA 3H9AA 3KSCA 4COYA 1OOPA 4PI2A 1MVQA 3TN93 4CDXA 4MGQA 1G7YA 4UFKA 4WBBA 3NWKA 4OMCA 2RMU3 5FYHA 4CZSA 4D0QA 5C8CC 5LEKA 1HJFA 2WDBA 1SPPB 2QQMA 1NCRB 4IE6A 2XGXA 4WM7A 3VL9A 2RDQA 4COZA 4W6YA 3UJOA 2FBEA 5A3TA 1SLAA 1I1EA 1GICA 3N7LA 1HJGA 2ZHNA 1AR61 2WS93 5DUWA 1H4HA 3L9JT 3LIHA 4LBQB 4UXAA 3EMRA 4DRRA 2V5YA 1JU4A 5KHJA 3I7DA 2VMHA 4IESA 3K2OA 3UNPA 5FP9A 2VZVA 1G9AA 4BXFA 3KB5A 4NHKA 3MO4A 1RUOA 1CESA 5LA1A 1W06A 5AFBA 2UY8A 5IVCA 4UW3A 4AWDA 4COWA 1IGOA 2HWB1 2K0GA 5LA0A 5FDBA 4BK4A 1W8WA 1H2LA 4XFAA 3AMMA 3OY8A 1FATA 5FJKA 4YW7A 5HXMA 2FD8A 2X53S 2R042 5F7UA 4KGQA 2C9AA 2BZDA 4WVVA 4JC1A 4CDXC 1VR3A 2VNVA 3SH3A 1SHWB 1ULDA 3LA3A 5FY0A 3KVBA 5KC5A 1HN1A 1ZRIA 3Q8CA 2R041 4YG0A 3NV4A 4XIKA 3KS7A 3CJXA 2H0VA 5D8AB 1XU1A 2Y6KA 4GWNA 4LORA 3SMHA 1EP0A 1NY71 2XVKA 5GLZA 4JGZC 4LUMA 3DXUA 2TEPA 3E5XA 4OHWA 5LATA 3WUCA 1ZZBA 4JGYC 4KWLA 5J3UA 3VBHC 4YZ5A 5JUVA 1V6JA 1W39A 3MIFA 1XNBA 4ATEA 1D0GA 2IXCA 2XHKA 4ZKTB 4ZXKA 4YM2A 1RVF3 4OLLA 4MXWB 5A7NA 4BQWA 2RS11 1UCXA 5E6HA 2VUDA 4N53C 3GBWA 2ZAHA 1VMJA 4N7UA 4LO7A 2D43A 3FX3A 1GANA 4E2SA 2UY9A 3V65A 3P3NA 1TMF1 3AVRA 3RZJA 3A0KA 4Y22A 4AFMA 4D7SA 4AVVA 2QDRA 1CN1A 4YVSB 2HEVF 3PURA 2VVEA 1W6OA 2B5HA 4OI4A 4Y5SA 4ITCA 4WVMB 4IUGA 1BXHA 1ULPA 3ZPYA 3C7GA 5FO8B 1ENRA 2WYSA 4XIOA 1WW4A 1DQ1A 2E53A 3UJQA 3HJRA 3IB3A 1IPKA 4SBVA 5GJ6A 2R16A 1O8PA 3RMYA 3RZKA 1HRI3 3V56A 1DG6A 1W6PA 2XBO3 5K4LA 3WQ0A 1UZVA 2WO1A 3O1SA 5FY5A 1F9KA 2PTMA 3K4AA 5FZ3A 3WZ1A 1C1FA 2FDJA 4W6WA 4DB5A 3WDVA 1GZWA 1X33A 3AVSA 4E8DA 4HANA 4L2NA 1SFYA 3WX5A 1O3QA 1NE4A 5GZDA 2QBXA 5GZCA 1YO8A 3I4IA 4GJYA 3VZNA 4HONA 4YFWA 1GP5A 1DHKB 1CR7A 5EJ3A 4AOCA 3IAQA 4L9BA 1X8EA 4FQ4A 2CWSA 3UV9A 3ELNA 2W5FA 4A3ZA 4PQ9A 2QUOA 1RUG1 2ZX1A 4JHTA 4P00B 1RYYA 4RQPB 2VXJA 3V0BB 4QXHA 3WNOA 3WQBA 4HL0A 3AMHA 3LEIA 1X9TA 1U0AA 2RMU2 3A0NA 3GCWA 1UMIA 1UYYA 2W2IA 3G7DA 4QXKA 5T5OA 1LRHA 2JB8A 4B4PA 4BOWA 4CCDA 4Q4W1 4IV1A 4Z2AA 2C24A 4CDXB 4TWTA 5C3SA 5KHIA 4CA9A 4E2GA 2Y26A 5H9SA 1SPPA 3HEIA 3WP4A 3HR9A 2O1QA 3B00A 1EV13 1NXMA 3BALA 1CAWB 3NMBA 5B4XA 5I8SA 1RITA 3WLUA 4Q4X2 4LMFA 4MH0E 2LW8A 4EN7B 4QPYA 2DBNA 5CFDB 1N3PA 4FP2A 2VUCA 4IE7A 5ABJB 4FXGB 4ORFA 1YQCA 4AGRA 2D6KA 3ZKUA 3MPPG 1NLRA 5E88A 4R4ZA 3KV5A 4DRVA 3PVNA 2NP0A 1K5MB 3DPRA 3VKFC 3NKTA 3FHIB 2OW4A 5I0RA 2XKPA 2E33A 4H3WA 1UYZA 2P5BA 4N43A 4Q26A 3U37A 4DEVA 2BNOA 2YFZA 4DXZA 5C5UA 3ZOIA 3ZMOA 5C7GA 1HB4A 2WZ8A 4FTBA 4R8HA 2QQPA 5FYIA 5CFDC 3MBWA 5D2AA 2DBIA 2R043 5KBFA 1AR63 5H9RA 1CZSA 5A3LA 2XMLA 3SH4A 2G4IA 2VOVA 3LQCA 4FOQA 4OZXA 2XH6A 5DG2A 2VD7A 3OGJA 4AGVA 5FZFA 1VRH1 2BTVC 3ACHA 4HKWA 2HWD3 4NRQA 4ZS2A 4GWJA 1UYXA 3RZHA 4UW4A 4XPVA 2XWBB 3MF6A 4M3CA 4ASLA 5IVFA 2RR11 3O1VA 5D8AA 4HK9A 4XF4A 4QGLA 5KR7A 1VBA1 1LHVA 3N9PA 2W08A 2H0BA 2YDEA 1PZ7A 2XVGA 3E97A 1UMZA 1SMVA 3URFA 2Y0IA 1R64A 1UX6A 3ATGA 3DPRC 4TYSA 5F5AA 3I2OA 1Q56A 1HXS3 1QIQA 2LTNA 5DAVA 3HPNA 5C33A 5GALA 2DCJA 3IWZA 4EE2A 2BFUL 4NIHA 2YXSA 1O91A 4CTEA 1ZZCA 1I5ZA 1GOGA 2X5IA 1IS3A 2DUOA 3ZFEC 4XHBA 5I8TA 1FOD1 3BTAA 4TLGA 5A7OA 3MHZA 1QQP2 3VB9A 5JSPA 3AFGA 1EAH3 5I0TA 1AR83 2WWJA 4HBNA 2YG0A 3IKWA 1QQP3 3PIJA 2VUJA 4L11A 1FOD2 2Q4SA 2ZA9A 1W8HA 3POJA 5EYYA 3NJYA 1S4CA 1PM4A 4CDQB 1D0HA 1YQ6A 2PAMA 1LJ7A 4K8RB 3DL3A 3VBRB 1ULFA 1BLZA 1ALYA 1C8M2 1GWLA 3ZXAC 2D6MA 4A7ZA 3J9SA 1GNHA 4IEWA 2WNUB 2UWCA 4NPLA 2JG8B 4KQ7A 3WV6A 1OF3A 5FYTA 5CG8A 2VECA 3ZKYA 3B01A 3N4MA 3I2DA 3OB8A 2BV4A 5A7PA 3LPGA 4G3YC 2WNVB 2CYFA 2VTXJ 1IS5A 4O9GA 4CUBA 4FPLA 1O4TA 1N3OA 1DGLA 4TN7A 1QJX2 1VPHA 1JUHA 1H8TC 1JN2P 2XKOA 1PK6A 1OA2A 2WSUA 2VBPA 3T2OA 5LW9A 1YEWA 1CD3G 4PBOA 5BUVA 5D1IA 1BVP1 1RUI2 2ADEA 4ASKA 3I3EA 3GM8A 3LDKA 4XJUA 1OPOA 4RQPA 3WEZA 5DDJ1 1ZBA2 2YBSA 3WF4A 2MPFA 4A45A 3K75B 4W65A 1H1AA 3U78A 4BA6A 1ENQA 5HV4A 1A78A 1Z78A 2EA7A 5CKMA 5F5IA 2NMOA 1AUYA 3FN9A 2FDIA 1JHNA 3JBG1 1IQDC 4FPEA 4D7YA 1RUE3 5L19A 3GXUA 4YW3A 4XXAA 1RMU1 1EPZA 5DDJ3 3FBYA 2FMYA 3E6CC 2A1XA 3LEGA 3NAPA 3AKQA 3O0WA 4OFGA 3L2HA 1CAWA 5CU1A 4CU9A 1BMV1 4XF3A 4A7KA 1HB1A 4H7MA 4C8DA 4S2DA 4I2OA 1GOHA 1QJY1 1UY0A 3BU7A 4QX7A 1GWKA 1HIXA 1VB4A 3N9OA 3VBOA 5KXBA 4PF5A 1OSGA 2ZGTA 5CIRA 3T09A 3WW4A 1QWRA 1BMV2 1XYOA 1PIV2 1LHNA 1TE1B 2D44A 2PLV1 2WT2A 4MSVA 4XJAA 4YVSA 1OC1A 1ENXA 3D82A 4UFJA 2IXKA 2OPWA 4MVTA 4YGCA 5A7WA 1VIWB 5F39A 4NAOA 2Y38A 3T1MA 3CZJA 4RA0A 4XFGA 1MQTC 2D97A 3NO8A 4JHZA 4NHXA 2WO7A 3AZXA 4MV2A 3RYPA 1JS9A 3JXSA 5C9AB 3ACFA 3RWNA 3IDEA 1CONA 1CJDA 1MZ6A 1F15A 2WT0A 3QBQA 3NJZA 5J1XA 3JD73 5FBZA 1UKRA 5FWJA 3JBG2 4B29A 1G9BA 1RUJ1 3NNLA 1VAVA 1PGW2 2P2KA 5B4NA 4XAAA 5TSWA 1VRH2 1TNFA 4FPCA 1PK6B 1RUD2 3N9QA 4S2GA 1JYXA 3SEEA 3WR0A 1PX3A 2VVDA 1UU6A 4K9SA 3IMMA 3SKJE 1QXPA 1W9TA 4XACA 4XMAA 5A3NA 1TZOA 5I8YA 4AHZA 2BWCA 3AP6A 1VBB2 1V9U1 3JQWA 5J7MA 4NRPA 1NCQC 1BBT3 2CGPA 3GCXA 3ZXDA 4HKLA 4Y22B 2JE8A 5A7SA 3PIGA 4QPIB 3I2FA 2PHXA 5IK8A 1K42A 1QJFA 3LFMA 2L9LA 1W8OA 4A7YA 4CE8A 4RS5C 5FMBA 1PNFA 1RVF2 3AZWA 3E6DA 3I3MA 3ZMNA 2Z79A 1UOJA 3ZXEA 4QGMA 4MHUA 3ES1A 3SEPA 2WN2A 4A2UA 3AL6A 4AZZA 3T3YA 1RUC2 1AX2A 1KDMA 1AVBA 4CDWA 2VUAA 4CCNA 1V9U3 2ADDA 5FY8A 3GBGA 5M0TA 2BOJA 5FXZA 1FPN3 1RUF3 4LO6B 3WINE 3VZLA 3D0SA 1GFF2 2VZSA 1MVEA 2OX0A 3H8OA 2JG8C 4M00A 5A7QA 1MS0A 3CQOA 4Y26A 2ZABA 1RHI1 2OYZA 1QOOA 4AI8A 5FPXA 1POV3 3H8RA 2DURA 2P37A 5FMOL 4LO8A 4QX5A 4Y20B 2VJXA 1QJU3 4AAPA 4EJRA 3AYAA 4EWEA 3BKZA 4OUMA 4AVCA 1WCSA 2X09A 4N43B 3ZN4A 1W04A 4IE4A 2P17A 2WNUC 1O59A 2VPVA 3B93A 4DZGA 5JOYA 1ST8A 1XSRA 1LHUA 2ZGQA 2VOKA 2RS51 3POBA 5L9VA 5LEJA 2ZGMA 1Z7S1 3Q8BA 3VDAA 1OQ1A 2I2SA 2RJLA 4N7IA 3WG4A 2IFRA 3ZSJA 2V72A 3FJSA 3AXEA 3DYOA 3K4ZA 2ZGPA 4Q0PA 5FY9A 5FZ4A 1CJPA 1ND2A 3AM2A 3USUB 4NHYA 3FHAA 1VBE2 2QDNA 2WFF3 4GMP3 3VZKA 5L9BA 4D8MA 3IZOA 4AQTA 4WM7C 1XNDA 4L99A 4OHVA 4XFHA 1AR91 1DFQA 4BXSV 3L2YA 2E7AA 2VMEA 1SDWA 1RUE1 2BVBA 3CDZB 1J84A 4AXOA 4ONUA 2ZHMA 5FFOC 1EV11 3KCXA 2P3YA 5K0UB 4MOAA 2ETEA 1OVSA 1H8VA 2VNRA 3K3NA 3DYMA 4O61A 4WV8A 5GLUA 3ZYHA 1Y3TA 3VBUB 3U14A 1RUE2 2A6ZA 3GZTB 3V0BA 1AF9A 2O0OA 5JXGA 5F32A 4Q4W3 3BODA 4QQHA 1W05A 2GC1A 1APNA 2OQ6A 4FOVA 3U75A 3WW2A 3VLBB 1X8MA 2V4VA 4CEYC 4RR3B 4K21A 2YPJA 3OTFA 3VZOA 5C8WA 4OHYA 3UESA 2O14A 4JCKA 2IXIA 1UO9A 1PVC1 2YBPA 3OJBA 4U2AA 5IK4A 3ZSMA 2VBDA 3WP3A 2A6WA 4AGGA 3MLJA 2BOIA 4AI3A 3USSA 3FBMA 3HN1A 4FSJA 3NVCA 5FYSA 2HWB2 4CPBD 2XWJB 3DF0A 1NOVA 2HWF1 1W3XA 5IFPA 4AHXA 1MPXA 3M70A 5K7PA 1GQPA 1ZNPA 1OA3A 2Q30A 3QD6A 4N90A 4CEWB 5JLVA 1H4GA 4DS0A 1UKGA 5CG9A 4ZU4A 4CXXA 1SLBA 1WKYA 2ATFA 4LQRA 1V00A 4C0HA 1XE0A 4FBFA 4QB2A 5JSRA 2Y33A 5A3WA 4I3GA 2DVDA 5DAQA 3QH6A 4Q4V2 5J98B 4KU8A 3PJQA 3R05A 1GR3A 2ET7A 1FMD1 2BP6A 3AXDA 3GHMA 3UGHA 3EJKA 4CCOA 4UF0B 1ZA4A 5FYBA 3WNXA 1BBT1 5T5LA 2AENA 3ECQA 3J26N 2XJVA 3O0VA 3HIFA 1W6NB 1W8NA 5IK5A 2R0FA 1V6LA 4Z1VA 2ZGLA 1IPSA 1OQEA 4YRDA 4BZ4A 1BBT2 3ZFFA 5BNNA 3J7NA 4XDQA 1REFA 1Q8OA 1ULGA 1PO22 4BQ2A 3K77A 3LSDA 3WOGA 3RPQA 2WRAA 3GBFA 3R0RA 4MO3M 4YW2A 2VH9A 2GN3A 3LE0A 4DY5A 2WC2A 4DO0A 1VB2A 1MZFA 2VMIA 3MICA 4CP2A 1GQGA 1RVF1 4K3UA 3OPTA 4BISA 4BYYA 4P9XA 4QDQA 5A3OA 2DVBA 2BW8A 2BBVA 2D6LX 2ZEZA 4QQOA 3RRDA 3N3HA 4L0PA 4IV3B 1LHWA 4LO4B 3TNPB 4URTA 1PX4A 2HBTA 4XQDA 4Y1UA 3VV1A 1ND3B 5IVYA 1YWKA 1US2A 1Y9GA 5CNAA 2V09A 1LODA 3IPVA 1V6MA 1NLSA 3D4KA 3JQXA 1OUXA 2ZHLA 2WZEA 1QJU2 5E1RA 1AR82 4DXRA 1HW5A 2P3IA 2QNKA 2XQRA 3W58A 1KJRA 3WDXA 4Z92B 3LDBA 3K4DA 4LUKA 2OXBA 4RGGA 5FZ6A 4Y1ZA 2RS12 3GYDA 5F2SA 5DZEA 1Q8VA 1FAYA 1QMJA 4P08A 4ZU5A 2WNEA 5LZ6A 4CDWC 4PJYA 2TBVA 2TNFA 1WBLA 4JGYA 3MIEA 4CUAA 5D21A 3BI3A 3F2ZA 3KF3A 1PHMA 4NROA 5HCBA 2DF7A 4K1YA 3VGIA 2RS33 4XF0A 3KCYA 1UXZA 2W47A 4QX0A 4WVZA 2WO2A 1IHMA 1UW8A 2R7EB 3IIIA 2RDRA 4MX3A 1MS8A 3ILNA 1YRZA 3RNSA 1NZCA 4QPWA 1WLDA 1ZBE3 5BY5A 1JHJA 5F3CA 4HVOA 4MHRA 1NKGA 2IVIB 5C8CA 3B9IA 3ZFFB 3RMXA 1NCRA 2RMU1 4JKLA 2EXIA 4TSVA 2GC0A 3N7JA 3EQEA 4QPGB 4XUNA 1GZ9A 3WNLA 5A6QA 1CGPA 2Y6HA 3BUCA 3OG2A 5A6YA 5I93A 2IXHA 1JH5A 4KWUA 3ZSLA 3AFKA 5FZLA 4MG2A 1OH3A 2HWC3 1D7PM 4AEKA 4IE0A 2GAUA 5FKBA 3FFQA 4RSUA 1GU3A 3AJZA 3IAPA 2CWMA 5C4WC 4PF1A 3TOJA 2Q1ZB 5CA6A 4LEJA 5IVBA 4NIDA 3GGLA 2DU1A 2QQIA 4RHV1 4LKDA 1MQTA 4RHV3 4ZY9A 2RM21 2R6QA 1A3KA 1RUNA 4AHYA 4IL7A 5FP3A 2AC1A 3KV9A 3OBTA 1S2EA 3GZAA 1WGPA 4I02A 3CEWA 5DPNA 3UGFA 4J1WA 4AEDC 2ORXA 2E63A 5KHKA 3T0DA 1UPSA 3VKNA 1NA1A 2JEMA 3E1F1 4NIAA 3H3ZA 4BQYA 2VL4A 2EIEA 2HWC1 2DVFA 4LOSA 3OGRA 3HT1A 3MUY1 1Q8SA 3AYDA 3VBOB 4AVSA 4OCTA 3RG0A 5I0DA 1W8UA 3OPZA 2BWAA 1RUI1 3SISA 3WXPA 1NCRC 5FZMA 2CTVA 1F2NA 1ACCA 4FFFA 4IEVA 4JTOA 1MS9A 1PZ9A 3P3PA 1Q5OA 4S2HA 1BJQA 2IWGB 2ARXA 1DQ2A 3VD7A 5DZGA 4F7ZA 4EWDA 2RJKA 3QH7A 2WT1A 3SITA 5F6KA 2JD4A 3OOXA 3LA7A 3W59A 4ET7A 2JE9A 4NUBA 2WQ4A 3B5LB 2ZZQA 3H1MA 3WF3A 3ZN6B 5FPUA 2RR12 3K51A 4LIVA 5EXOA 4LE4A 3JB4C 3GHNA 4NHMA 4R4XA 2VW0A 2ZS6B 4AYUA 3I59B 3EXUA 2WL1A 2P6CA 1VBD1 2MEV2 5FY1A 2D3PA 1PZ8A 5ANNA 4BQ1A 1EY2A 2W39A 1QJY3 3X29B 3ZFEA 2VR4A 1N1TA 4LKEA 4N53B 1URXA 4HVRA 5FV3A 3VD5A 1VRH3 1RUD3 3ZIXA 5F3GA 4L97A 3WW1A 2NMNA 2JDMA 2B46X 2F6BA 1BEV2 1LULA 4NIIA 4H7LA 4AFBA 4BB3A 1WLTA 5C9AC 2ENRA 1GZCA 2BNNA 1J58A 1UPIA 3IIAA 3HMYA 2W94A 1W0PA 2WYFA 4IEXA 2B4KA 2WUHA 4MUVA 4WVMA 2WAOA 3WDUA 1AX1A 4KMQA 4A4AA 3ZYRA 4AI9A 1AR72 3RZLA 1GP4A 1HN0A 2VZ3A 1GKBA 2JIJA 1YC61 2W1SA 1ND3A 1VAMA 1JZ7A 1SFNA 3ETPA 3OD4A 2YGMA 2WN3A 2JG8A 3Q8FA 3IPVB 5FP4A 2W1UA 1OD5A 2OUHA 2QVSB 3H50A 4RGKA 5FZEA 2W9XA 3D8CA 5L9RA 2ARCA 1O3RA 3FWEA 3LIGA 1RINA 4QM8A 1O6UA 5FYUA 1UD1A 4NOTA 3T1LA 1FX5A 1UL9A 2W0XA 3BOWA 2HYXA 3HWJA 3NNMA 5GLTA 3T2TA 5LK7B 1H1IA 5BNOA 2FMDA 4YW6A 5HCFA 2K9ZA 1QH7A 4P14A 2EVXA 5FP8A 3DCQA 4D7TA 5CAZA 5JOZA 3FLRA 1OQDA 5JDBA 1OVPA 3MDPA 5C6CA 5T54A 5KWRA 1JZ5A 2CDPA 5T5JA 3LFIA 4XC9A 5FREA 1POV0 1A34A 1JOPA 1HRI2 2VGDA 2VZTA 1NXD1 4UF0A 4IEOA 3VBHB 1UNBA 4UT5A 2XQXA 1R1A1 5IHRA 1QKQA 2D5FA 1QJX3 3VHNA 1DQ6A 4XAEA 4W50A 4GIQA 3VBRC 1IG3A 3UKNA 3FHQA 3AP9A 4Q2FA 1YIPA 4XTPA 4FT8A 1W2TA 2Y64A 4LOTA 2W52A 1MS4A 5FYMA 1I9RA 1LEDA 3LKJA 3I2IA 3PMEA 4WM7B 3PVBB 5AC92 1ZBA3 1XNAA 5J96B 1J59A 4HZFA 4PDWA 4MZUA 3A7QA 3ZYBA 3OYWB 3AKSA 3IDAA 1W6MB 2WNVC 4ISQA 2VCMA 4RHV2 3J4UH 1BQPA 1R1A3 2QE3A 3J7HA 4B8EA 2VULA 1R081 4NE9A 4Q8KA 5L7OA 1ZRCA 3POWA 1ZRDA 2ILMA 1X7NA 4Q0SA 4LULA 1B35B 3POYA 2XJUA 4P5HA 3ZIWA 1KJLA 4LBKA 3TN92 2VQ0A 3MZHA 2B39A 2NQYA 4JX0A 5J09A 1J83A 2CV6A 4PI0A 2P6HA 4CCMA 2FDHA 1PNGA 1RB8G 4GALA 4XFCA 4QDRA 2RVAA 2PHUA 2W1WA 3V0AB 3ZXLA 3VDDB 4XTMA 1UY3A 1AR92 3PTYA 1LU1A 2B42B 2YFUA 1LEMA 3C3VA 2PLV3 2C9KA 2ZXQA 1SLTA 3DKQA 1AR93 4I01A 4NR1A 3KM5A 5AFEA 4LT5A 4CEWA 3AZYA 3DYPA 2QZ3A 4YW1A 3J7LA 2VAUA 1OLME 1O4YA 4XZPA 1YIFA 2QQNA 5CEHA 5C3OA 3ZPOA 1MZ5A 1UZ0A 1VMFA 3PUSA 4Q4V3 4YPJA 4NVPA 1X9PA 2CAUA 2Y8KA 4XBQA 1V6OA 1W8FA 3OPWA 5IFTA 4YGEA 5F2WA 3JBG3 2GC3A 5CVRA 3WNNA 1UN1A 2WSVA 1YFXA 4A3XA 1GP6A 3PNAA 2DUPA 4DXSA 4YM1A 5FYYA 1NG0A 4XW3A 1QU0A 1N1VA 4G9SB 4DINB 4YYOA 1W6PB 1LENA 2HWF2 4BMEA 2AEYA 2W46A 3POGA 2VMDA 4JQTA 3N35A 1KS4A 2XJPA 3CIHA 4XUOA 4ZONA 3O12A 1GZWB 4V2WA 1O5LA 4QD2A 3H8UA 4Z82A 4CDQA 4EWAA 1CZVA 5JPNB 4X8NA 2FHRA 4PIYA 1XPWA 1W8ZA 3DGTA 5A32B 1GNYA 5JWPA 4LBQD 1G9DA 1V70A 3WF0A 3C2UA 5FR3A 4SLIA 4AR2A 2A6XA 2IXJA 2VTXA 4YM0A 5LWBA 1ZZ6A 2ZX3A 2GALA 3FUOA 5FBJA 3B02A 3MLLA 3TRSB 2XG3A 2ZBJA 3PMSA 4IV3A 3UL2A 2MHFA 3N9LA 1F35A 1JZ4A 1GSLA 1PMIA 2QQKA 1YLLA 2J1TA 1UMHA 2AACA 1BK1A 1L3JA 3HVDA 5F8PA 2D5HA 4Q1PA 3EB7A 4YGDA 2A6YA 4YW5A 1JI6A 4XEZA 4AL9A 3U0ZA 3PUHA 4B7EA 4QXBA 3HT2A 4E4ZA 1POV1 1W6NA 2B7YA 2ZMKA 1SBDA 1YUDA 3IMNA 4M4RA 4QU1A 4CCLA 1RXFA 4FXKB 4AEJA 5T3NA 1CQ9A 1NQJA 5BNOB 4AHWA 3U11A 3D3AA 5BNNC 5E16A 5AVPA 3MLKA 3M3QA 5FUPA 1HRI1 1S0BA 2XLFA 1EUUA 1C8M3 2C5DA 3OGVA 1U5XA 4QXCA 1ONAA 4XURA 3JCIA 4E4HA 1YCIA 2A3WA 2RDNA 2YB7A 4GWIA 5GZFA 5LBFA 4GAZA 1LHOA 3W21A 1RMU2 3Q9OA 5CBLA 4NAMA 2DWRA 1C8M1 1DLCA 3WDYA 2AR6A 2DFCA 4MADA 3CF6E 1OXCA 4BQXA 2XJQA 3I8TA 4BLJA 3Q8AA 1AR81 1SQ4A 2JDZA 3MYXA 4NHLA 4OUEA 4R9CA 4BE3A 4YM3A 3HBZA 4KWKA 3S5AA 1ZBE2 3FZ3A 2D6OX 3WVJA 1N1SA 1SZBA 4XJZA 2WWSA 3OUHA 1AZDA 4EN6B 1HQNA 1S0IA 2B9VA 1D2QA 2I74A 3DECA 4CCCA 2ZACA 3ZSEA 2AH2A 1ZBE1 2BVVA 5F37A 4A41A 3RVHA 3TEWA 2J1RA 4ASMB 1R082 5FUNA 1XYNA 4FI9A 4UBGA 4X6RB 1MEC1 4ATFA 4D6RA 1RTVA 2BERA 5FZ9A 4HK8A 1R1ZA 1D4M3 4LXLA 4UFMA 3WG1A 5DN2A 3M1HA 1D4M2 1JW6A 5A3MA 5CZKA 5DDJ2 2Y6JA 3KVAA 1UU4A 5DAWA 1ASJ1 2P3KA 3FLPA 3VBSB 3WG3A 1K45A 1V0AA 2VZQA 5FZGA 3DUIA 1RUD1 2BBAA 2VW1A 1E5RA 4EQVA 3TWIA 1H8TA 2CDOA 1SCRA 3N7KA 3OBAA 4LLOA 3WT3A 2YZ4A 5DUXA 3AZVA 4J1XA 3M4FA 3HAGA 2WWUA 4BU2A 1MS1A 5FLHA 5DUUA 4AFAA 4P9IA 5K8SA 1DF0A 3I3DA 3S5QA 1H1MA 2DFBA 1PMHX 1X82A 3WP6A 3AP4A 4OUSA 3O0XA 3OEAA 2WNOA 3OYWA 4GD4A 1OHFA 2JG9B 4YVWB 4CEYA 4MGTA 4V2VA 2BEOA 1WW6A 2RDSA 1AL21 2PFWA 4K20A 5EWSA 2C4XA 5LBBA 5LRSA 4CXYA 2HH9A 4YG3A 1QNYA 4HG6B 4AW7A 1E57A 1PO23 3BIEA 1S2BA 4KH9A 1A8DA 4IEUA 4CP9A 1CPNA 5CKQA 1S2KA 3A22A 3WF1A 4A6SA 2MEV3 5JR2A 1QF3A 3BVCA 5ERLA 2VMCA 4QHOA 4CCJA 3S0MA 1PO11 2WINB 4CDUB 3KLSA 1CAXA 4DUVA 3AX4A 1VBB3 4TLFA 4O65A 3FLTA 3POFA 5L7OB 1FPN1 1RUF1 2ZGUA 5EV7A 5EIYB 2A7AA 1OPMA 1TNRA 2VNGA 3BU0A 1UAIA 1SLLA 1BHGA 5FUIA 1Q8QA 1VJ2A 2DU0A 2WNUA 4GWMA 4CP0A 2OA2A 2WAAA 2VQUA 3OUIA 4FVVA 4PLOA 5BV6A 2BJSA 1W6QB 4K8FA 3NV2A 3ZR6A 3SNMA 1LGBA 2A3YA 2BPA2 2R49A 1QQP1 1ND2B 3USUA 4EV0A 2AGSA 5FO9B 5FWEA 2H6CA 2XJTA 5ACA3 4BJ0A 4CDQC 3BTXA 2QQUA 3VD9A 3POEA 1YHFA 2EXJA 1FOD3 3HNYM 1CPMA 5FK7A 1TEIA 3NJVA 3PL0A 5DG1A 1YQ5A 1BEV1 2GMEA 2Q1MA 1PGW1 2X5IB 3LA2A 3U10A 3ZFEB 3NQHA 3BPSA 2D6NA 4EN9B 2LM3A 2PXJA 2FQPA 2JENA 1QJZA 2JDYA 2A73B 4YNIA 4BMBA 3RI8A 4XABA 5FOBB 1AHSA 5C4WB 2FCUA 1G6NA 2XUMA 4DUWA 2Q8OA 1K5MA 3DPRB 2UWAA 3CL1A 2D3RA 3VZJA 1JZ2A 5FRAA 1AL0G 4AEDB 1WCDJ 1XBFA 2XJSA 3NAPB 4CDWB 3O14A 2P34A 4YWAA 4M01A 1LOBA 5LBCA 2PHRA 5C9AA 3V64A 4QB1A 1Z7S2 2D98A 3R4SA 3MFCA 5HV0A 5G05L 3C7OA 2HJIA 1S55A 2WBKA 5JIUA 3DKWA 2DTYA 4FFGA 1XSQA 4X8PA 4FAHA 5FZ7A 1CAVA 2JD9A 2BGOA 2RHPA 4URAA 2EF6A 1LB2A 5H9QA 3VBFB 3I49A 4FO9A 3E5UA 2VW2A 4QDSA 4FOWA 1AYM3 3DXTA 3TEZA 2VU9A 5LB6A 1OI6A 1ZVFA 1D4M1 4LBMA 1QDOA 4V1PA 2Z4FA 1PGL1 1QDCA 1COV3 4M0NA 4JAAA 3SCFA 3ZXGA 5KXEA 5GM0A 4WZFA 1RUG3 5JI7A 1WZXA 2KXLA 2ZCWA 5FPLA 1G9CA 5F5QA 1IKQA 1AX0A 2CGNA 2VY0A 2DVGA 3WDWA 5A3UA 3PHMA 4JDOA 4XYXA 1WW7A 3VL8A 4XZUG 1W03A 2PAEA 2QQVA 2X8KA 1JYCA 4BCUA 2JKBA 1F8VA 3E5QA 1LTEA 2PLV2 2VM9A 4XJ9A 5F5CA 5K0UA 5JPMB 3W9AA 3I54A 4GB32 3ASIA 1UQXA 5FAXA 3N9MA 3PJYA 5IWFA 3VBUA 1W9SA 3N7MA 3HQUA 4GB33 3SKVA 3TN91 4Y5TA 2R30A 3KZ4C 3JB8A 5FQ0B 3WCRA 5DUVA 2JG9C 3ILRA 3OUJA 4YVWC 3JD72 4RS5B 5DAXA 1RUH2 1O3TA 3VKLA 3BCWA 4IV3C 5FK8A 3RQ0A 3T0AA 1OBNA 2HWF3 5K9YA 4QWNA 3AP5A 1FI2A 1MACA 2WIIB 1RL3A 5FPVA 1BEV3 1F4HA 2ZX0A 3K46A 2E31A 3BN6A 2I45A 3N36A 4LPLA 1PVC2 4OZOA 3SLIA 1FT9A 3T30A 3ITQA 2ERFA 1GQHA 3MI8A 1RUJ3 3LOBA 4ISRA 2BDRA 1CAVB 1PVC3 3T08A 4YSFA 4LNVA 4P9WA 3SCGA 5A32A 3IDBB 1TQ5A 4QT6A 1MS5A 4FFIA 2VO5A 5JMCA 1US3A 1K3IA 1SDDB 1FMD3 1AYN1 3ROUA 1GWMA 4K1ZA 4KGGA 4Y4YA 2A6VA 5FY7A 3THTA 4AVAA 4FTEA 1ODMA 1XOYA 2Y34A 3ORJA 3D6EA 3BB6A 1HXS1 4HT1T 3MV01 1FXZA 2QJVA 1W9YA 2WLQA 1XE8A 3AKRA 3M2MA 5CFCA 1GZTA 1RUC1 4Y5Z0 1DQ5A 4N8MA 2WQZC 4A44A 4OI0A 2CNAA 1OH4A 1NAEA 4Y4RA 1CX4A 1VBE1 5A80A 3OCPA 1NT0A 3WSOA 1LOEA 4QAWA 3KHCA 2NN8A 2VZPA 2KD7A 3J8F2 4BQ3A 4LBLA 2RS13 3ZYPA 4Q4Y2 3HOBA 2CL2A 4E9KA 1WUVA 2HWD1 3PTRB 4COUA 1QOTA 5KXCA 1DLLA 2FCTA 3AL5A 3W20A 5IVJA 2XOMA 1PO21 2XLAA 2UU8A 4Q4Y1 2OUJA 5IK7A 1YXWA 2BGCA 2JE7A 1VBC3 1H9WA 3OF1A 2XBO2 2HWE1 2RE9A 2RS32 4ZZ8A 2ZZJA 2UYAA 4G4FA 2W92A 3NSTA 2AYHA 3BTYA 4YZ4A 1Z7S3 2FDKA 1YQ2A 1GMMA 2WFF2 3IN9A 1A8MA 2WJSA 3RGBA 1HRV1 2RS31 1XRUA 4IEZA 2XL9A 5BNOC 1F31A 3QOPA 1NCQA 1W9WA 4KBZA 2ZKNA 4JZRA 2YROA 2YU1A 1IOAA 2OPKA 1HB3A 2ZGKA 3C7HA 2HYKA 1KDKA 1Z0HA 3E6BA 4AEMA 2P3JA 2VC9A 4CDUA 5C3QA 1CAXB 2HKXA 3B7MA 4R9AA 3ZYJB 3LCPA 2BFUS 1H8TB 3ACGA 4W4ZA 4WVWA 3MEPA 5E89A 4YLZA 4MGIE 4YZ2A 2QKDA 4BHPA 2CHHA 1S0GA 1O5UA 1Y9QA 4ARXA 3GJBA 5IUQA 3GDBA 4A6OA 3MW4A 3O1OA 3SCHA 2NZ9A 3ZN6A 1QOSA 2D3SA 2EAKA 2XDVA 5BXXA 2HLEA 2D6PA 3FC0A 1E5SA 3F95A 1S0DA 4LIUA 1UWWA 1F4AA 3EYPA 3ZXJA 1S0FA 2G9ZA 2VZ1A 1JYIA 1J1LA 4PDWC 1OOPB 1B35C 4YG6A 4B1MA 1NUKA 1R091 4NJ4A 3ZYFA 1LNSA 3GALA 5HBAA 1UY2A 4ZPIA 4QX8A 4QPGA 1U5YA 2ZGNA 1O8SA 4OYUA 4DY3A 1PK6C 5IYYA 1Q3EA 1MZEA 1QGLA 1RJ7A 1YFWA 4H14A 4XUQA 3APBA 5GLVA 1K12A 3RZZA 3UKTA 2Y6LA 4XETA 4E8CA 2XVLA 3AK0A 1UXXX 5I0UA 4UW6A 4QU2A 4CUCA 1RJ8A 1VMHA 3HD8B 3PUAA 1S1AA 4P9LA 2BQPA 3ZDSA 3WNKA 5EYXA 2YMZA 3A4UA 1S0EA 3AMNA 3JD71 1H2NA 3H3UA 4FPYA 3TEYA 4U36A 5ACA1 1MQTB 1D2SA 1ZM1A 3NNJA 1V6IA 3KMHA 3RYRA 2ZMNA 3K48A 3WUDA 4AEDA 2VG9A 3ENRA 4D6SA 1STMA 5DXDA 4B3NA 1WBFA 4UYBA 1J3QA 5DQ0A 1KRIA 4YZ1A 3FUQA 3PDQA 2CGOA 3LPFA 5FXXA 1VBA2 5HCAA 3M7AA 2VOTA 1ULEA 4O7XA 2P4EA 1QJY2 2Z5WA 2IXLA 2NLRA 1DZTA 4KG8A 4NIGA 1GNZA 4GB31 1VAKA 2G19A 3KQ4B 1W3VA 4HSJA 4OVEA 3H1WA 5JR7B 4DXTA 3ZXKA 1I6XA 1XJAA 5J36A 1JYTA 2MEV1 4MXWA 1AYN2 2PHFA 4HN0A 2BYVE 5C8CB 5JI9A 1CWPA 4FOYA 2VTFA 2D40A 5IAXA 1DGWA 1WW5A 3GNEA 3WW3A 3POSA 3T4VA 3Q8EA 1XC6A 4LKSA 1L7LA 1LU2A 1UY1A 2PHDA 5FYCA 1ND3C 5DABA 1AL22 4AF9A 1AR73 3HQRA 3M3CA 1ZZ7A 1V6KA 1DGRN 4WM8C 4OMDA 3TBDA 1AL23 4Q8LA 2B8MA 3DV8A 1K5MC 1QXRA 4D6QA 1ZREA 1G9FA 1XB9A 3O1UA 2JKXA 4LBOA 2JDPA 1JU3A 2HWE3 3RFRA 1T6BX 5ACA2 2ID4A 3WY6A 2W91A 5C71A 4XVHA 4Q4Y3 3KHBA 1PM7A 2Y6GA 1JBCA 5T52A 2GC2A 4C1XA 1QJU1 2VNOA 3PU8A 4CUGA 2DCZA 1OLMA 1CIWA 2HBUA 3OD0A 3KV4A 1C5HA 4CDUC 1WA4A 3GJAA 1WLCA 2R1BA 2GH8A 3CHXA 3P6BA 3EBRA 5ISLA 1RMU3 4Y1VA 1K5JA 1UIKA 2EXHA 1ULOA 2HEWF 4AQ2A 3OGGA 2WFF1 2IC1A 4GMP1 5BNPA 2R072 1OFSA 1UYPA 5FZIA 2CU5A 1OOPC 4F3JA 2PAKA 2H6BA 4RS5A 1UOFA 4GH4C 3CMGA 4NRMA 2E7TA 2JX9A 5HI0A 3PVEA 4XDPA 5FMOS 1OF4A 5B2GB 2VBBA 4KNCA 4W8JA 3H1YA 1TMF2 4QQ2A 4FAGA 4Z8BA 3INAA 2QTWB 5F1RA 5FCCA 5I91A 1UZZA 5FKCA 3IT8A 3JUUA 3WG2A 3S30A 5KXDA 3ZM8A 2WA4A 3UKVA 1EAH1 1YI7A 3DN7A 4IW3A 4GULA 4LBJA 4QQLA 4X6QB 4OI1A 5AC93 1BKZA 1LECA 3TAYA 4M3CF 3VBUC 3WF2A 3RSJA 1HX6A 1Y9MA 1FV2A 4MXVA 4W6XA 1GBGA 5JVVA 4DUXA 5FZBA 1U12A 1NA1C 1WMXA 4N53A 1Q8PA 4JRAA 4RR3C 4META 2XR4A 2JDUA 4LK6A 4YARA 2W87A 5AC91 5DAPA 4I30A 1M4WA 3A23A 2RM23 3VD4A 3LEKA 4Q5OA 4Q0UA 1TME3 2BRTA 3AZZA 2JG9A 2RM22 4YVWA 4CEYB 4LBQA 3H8XA 1RIRA 5L36A 3CO2A 1W9FA 4XF9A 1O3SA 4IV1B 2YHJA 4HMZA 4IGPA 2GN7A 3I3BA 1W90A 3R4UA 4DIQA 3OGSA 5EHDA 2LROA 5L7OC 2ZGOA 5K0UC 3HNBM 3T0BA 1HV0A 3HNMA 2JIGA 2EICA 2WFPA 4FCAA 1IQAA 2ZX2A 4GMP0 3BTZA 4XQ4A 1Y4WA 3PVOA 1H2MA 3SH5A 1PMJX 2WZPP 1GLHA 2NPIA 3CKHA 4LHKA 1OLRA 2LALA 1DQ4A 4Q29A 1VALA 5FPZA 4IE5A 2JDAA 2RG4A 1IZ3A 2Q8CA 4BH9A 5J37A 3RDIA 3O7OA 2Q1FA 4CSWA 4LHNA 4XUPA 5JZGA 4JTNA 4Z2WA 1B35A 3B9CA 3ME2A 5EPAA 5FJHA 5KC6A 1C28A 2UWBA 2GNMA 3RS6A 4PBPA 3VDCA 1V6NA 4S2FA 2ZEXA 4JRLA 4Y33A 1LOFA 4DPNA 4LE3A 3WD5A 4QHZA 4ZXEA 2ZEYA 3GF6A 2YC4A 2IVJA 3RZMA 3AKPA 5IT6A 1JYNA 3TEXA 5LY2A 1C1LA 4JDMA 4Y3OA 1YJLA 2JB4A 2SBAA 3KT4A 4Y1XA 4LO5B 3TYJA 4BLIA 1CAUB 3EO6A 4CU6A 1VP6A 1DP0A 3JZVA 2XUEA 4B7KA 2ZTNA 5CKNA 4UFLA 5BNPC 1C57A 1OLQA 3ZLIA 3PUIA 1P8JA 4RGAA 5A3PA 3KQRA 4BPZA 4FPFA 5FPAA 1ZZ9A 5A70A 1DQ0A 4E27A 3LF7A 2JDKA 2JDHA 4IETA 5C5TA 1O7FA 2C6SA 2GDFA 1ENSA 2DCKA 4HVQA 5FZOA 2GMMA 2VOXA 1FMD2 2A70A 4CCKA 1DGRA 2YPDA 3GZUC 5IVVA 4Q0QA 1V9U2 3RYKA 4JV4A 1W6OB 4QPIC 3U1XA 4EN8B 2PQSA 4OQ9A 5LBEA 1O4ZA 2Z42A 1AXZA 5FLJA 4CVUA 5CYYA 1SBEA 2XLGA 5A33A 3J8F3 3KF5A 3VKMA 2XL7A 5HCHA 3H7YA 4WM8A 3ZFFC 1HB2A 2F4PA 5GLWA 4XF1A 3ZDVA 3ZFGA 3AMQA 4O9EA 4K7JA 4QKDA 2W3JA 4WZCA 2ZGRA 3U07A 4R9BA 1N47A 4XMIA 3R4DB 3KD4A 4QHBA 1N1YA 2YC2A 3O1RA 1W2UA 2R071 3ILFA 3FMGA 3R6SA 2X10A 1DU3D 2Y6FA 3GZEA 2YUEA 1SCSA 1L7RA 3OSDA 3ST7A 3TNQA 4ES9A 4PLMA 4A42A 1SBFA 1VBC2 2OIIA 4XUTA 1FNZA 4M4PA 2Q8EA 4C1WA 5LCWL 1XXNA 1EAH2 2JDNA 5CADA 2QCSB 2QQWA 1LOCA 4JGZA 1VLNA 5FO7B 4ARYA 4JDNA 3ACIA 4UAPA 4I0WB 4RQPC 2IZWA 3MGUA 1XQNA 2ZEWA 4KU7A 4UI9L 2DV9A 3FL7A 1OT5A 1OKOA 2FZ2A 1H0BA 1NY72 5FZCA 3VBFC 3I59A 3MUZ1 3OBRA 2Z69A 3FE5A 3H3LA 3ES4A 1UU5A 5FMCA 3WP5A 4D3WA 2WZR1 1H9PA 2DDUA 1WCQA 4QGNA 4QM9A 1R093 2A3XA 1TVGA 2JICA 3KGZA 3QLQA 3B69A 2VOWA 3RI9A 4ES8A 5A1LA 2XBO1 3CJIC 4FTSA 1EUTA 1KXGA 3VBSC 2J1SA 1RUG2 2I07B 1NE6A 2UURA 5CISA 3I2HA 4N9HA 3VUOA 1QJX1 2X29A 3DEMA 4CYDA 3CBNA 3I3QA 1AYM1 4D69A 1KQRA 4FPOB 1W28A 4E4DX 3BGAA 1UOGA 2HWC2 3CLPA 2ZMLA 4OHXA 3LWCA 4UBHA 2GNDA 3LDRA 3VHPA 4K6BA 3WQ1A 2V4AA 2O8QA 1ASJ2 2VQTA 4LHSA 5JZGC 4Q4X1 1MS3A 2JJ6A 3J7MA 3MIHA 4IDZA 1GUIA 2VQAA 2W1QA 1LCLA 3KT7A 5F3EA 4CRQA 5AVAA 4DFSA 5JSOA 5H9PA 4PIZA 4NMIA 4Y1YA 5A7WB 3SXWA 4Q4X3 3LSEA 4IXLA 5FXWA 2F17A 1OMIA 3W5NA 1IS6A 1PIV1 1LR5A 1VBD3 2MNGA 2ARBA 2GMPA 2OS2A 4NWVA 3WNMA 4E2QA 4J6GA 2LRPA 1CIYA 3TB0A 3T2QA 1DBNA 1OKQA 5DMYA 5LY1A 1BZWA 2WS91 3NJXA 4MGSA 3VBSA 2PHTA 3LD8A 1PIV3 3M3IA 4NO4A 1JZ3A 3O1TA 1WMDA 4XOGA 1CZTA 5I0SA 3AYEA 1NZIA 2YYOA 3AKTA 4GZ9A 4KL1A 4Q4V1 4M0HA 1UY4A 2R1DA 1AYN3 3UT0A 1WA6X 2C0ZA 2VZRA 2XHNA 4BK5A 4AFDA 2WABA 1DYKA 5EP9A 4BQ4A 4AAXA 4ZU7A 1AR62 2OZJA 3AJYA 2WQ8A 1H2KA 1ULCA 4YFZA 2JECA 5HXVA 1DYPA 4XCAA 4PDWB 4XJWA 4D94A 1ND2C 1PVXA 1JODA 4NWWA 2VZUA 2XJRA 5BNPB 3S57A 4N43C 3LGRA 1W99A 2O8OA 4JKKA 2G9FA 4INDA 1JOJA 5FP7A 1SFPA 1J3RA 2HWE2 2VXRA 2DUQA 4IEQA 3LZZA 4DQAA 5A6XA 2OT7A 2J1VA 1HXS2 1QH6A 1NCQB 3OY8B 2AZ5A 4PIXA 2PMWB 4KG0A 1BYHA 1IPJA 1DCSA 1XNTA 1W2NA 4XJ8A 3O1MA 4HXCA 4GKYA 4XFBA 1GYKA 3NRUA 5T5PA 5JXJA 4AVBA 4CP1A 3NNFA 2VVFA 3SHRA 1YYNA 2J22A 1ZYBA 2J1UA 3EHKA 5BNQA 2IUWA 3HQXA 1ZX5A 3H7JA 3M8LA 1W2AX 3T2PA 2TUNA 3NV1A 1FPN2 1RUF2 2ORZA 2YV8A 5KHHA 1QHDA 2NYYA 4M3CB 4P9JA 4YW4A 3VN4A 3ZO0B 4BIOA 1XNKA 1RGSA 4I3PA 4AFCA 4AI0A 2GH2A 4TTGA 1MR5A 5FZOB 5JIAA 3A21A 2BGPA 1C3HA 3P5BA 3RWKX 2QZ2A 1ZA7A 1KGYA 3RZGA 3WHUA 5LA9A 1TMF3 2HEYF 2QFEA 5GKAC 3ZR5A 2Q5TA 1CAUA 2N7GA 4BDVB 1ODNA 4HETA 5EFUA 2A75A 4FQZA 2PN5A 4ZS3A 1F5FA 3FFZA 3I2GA 5FTTC 3ETQA 1DGWX 2BUKA 2X5IC 4CP9B 2FDFA 3P1IA 1W0OA 1UZYA 4HPKB 4BIFA 1LESA 4PHZA 4QPGC 1UZWA 1WD4A 2J42A 3B3QE 1PGSA 4F83A 4QKNA 3I2KA 3H42B 2RJ2A 5JMOA 3M3EA 1AJKA 1SEFA 1BK0A 3K3OA 1OA4A 5JCTA 3CZUA 1I5PA 1W6MA 2ES3A 1XE7A 2KM2A 5JZGB 3CU7A 1COV2 3QCWA 2AEZA 2YC0A 3KV6A 1WD3A 2Q0AA 1HKDA 1SACA 2V5DA 2ET1A 1ASJ3 3PUQA 4PCRA 4XE9A 4H55A 4I09A 1KS5A 2RS53 3U4SA 2GP5A 3CJIB 3AMPA 5A6ZA 5HPOA 1COV1 1Q43A 2ZOEB 2A5ZA 1LOGA 1NA1B 2EAAA 2RS52 1UX7A 4XHXA 1DZRA 1RHI3 2E9QA 2WO3A 5FZ8A 4M3CE 2E6VA 3ZXFA 3JU9A 3LEMA 4Q0VA 4LA2A 5EQUA 4EN0A 1J3PA 1JMUB 3ON7A 5LK5A 3VHOA 1KITA 2WNVA 4GH4B 1RXGA 1S0JA 4GA9A 1NLQA 5JOWA 2R063 5F6LB 1VBD2 4TXWA 4LBNA 4XXPA 5LA2A 1U5ZA 2WZR3 4L8QA 1VRBA 2QQOA 5JXIA 3IBMA 5IJRA 2WS92 3C7FA 1EV12 2EXKA 5BPXA 3C7EA 1JOBA 2PHWA 4IQPA 3LB9A 1HDKA 5FLIA 4UW5A 2HWB3 4RFT0 3G6JB 5C4WA 2ZKLA 3VD3A 4HKOA 4DNYA 2WKKA 5FZHA 3ZSKA 4K40A 3KWVA 4L92A 1UOBA 2Z2SB 1JTZX 4RR3A 4XFFA 1RUH1 5FYZA 4ZHNA 3ZYGA 1T2XA 1QXJA 4XILA 1W2OA 4YGBA 3UETA 2XPJA 2OQ7A 4NPMA 4QX1A 4OULA 5D8AC 3WQ7A 1M06G 4HPKA 3NNGA 4LTAA 3ZYIB 3VBOC 2C26A 3ZFGC 1XYPA 2J7MA 4UFHA 3RJ2X 5EZWA 2LUWA 1PO13 2J1EA 2ZHKA 3ABZA 4KBBA 4IEYA 3HBKA 4XQWA 1OD3A 2IFWA 2ZX4A 5APAA 1UIJA 3AP7A 4Q1RA 2RV9A 4AVTA 1YI9A 1G86A 1GOFA 2E26A 3AC0A 4Y20A 1FV3A 5T50A 5FYVA 5BYNA 2VMGA 4LHLA 2QQJA 1NQDA 1W8TA 2UYBA 3POIA 5FPBA 3WDTA 2OZ6A 1C5IA 1LKNA 3NV3A 4QX2A 5F3IA 1WWYA 2YU2A 3ZVXA 3CNAA 3KGLA 3THCA 4AG4A 4CU7A 5A33B 4MYEA 1W6QA 5J48A 2XONA 1REEA 3LOIA 3H0OA 3I2JA 4C90A 4EROA 4LJHA 2E32A 3SC7X 3THPA 4EZHA 2R073 4HSLA 5ANQA 4LK7A 1Y7BA 2GNBA 2EALA 2AUYA 3MW3A 2Y60A 3J8F1 2A71A 2FCVA 3PLQA 4CCEA 4QKBA 1ZRFA 2AREA 2WA3A 4H2AA 4B4RA 2JWPA 2FZ1A 1H6YA 4B1LA 4UFIA 2DVAA 3MPBA 1L7QA 3IM0A 2BNMA 4J25A 2DTWA
chains in the Genus database with same CATH topology
2Y8KA 3WF4A 4A45A 3K75B 2JKXA 5IFTA 1JU3A 3WNNA 4PQQA 2LS6A 2ID4A 2EIBA 1JYWA 3FN9A 2W91A 5C71A 4XVHA 1IQDC 4DXSA 2Y6GA 3GXUA 3LEGA 4CU9A 2QQLA 2W46A 4RYDA 1GOHA 2VMDA 1UY0A 3CIHA 3T09A 4XUOA 5A1AA 3P6BA 1ULOA 1CZVA 1XPWA 1GNYA 3WF0A 3CMGA 1OF4A 3CZJA 4W8JA 4JHZA 4QX3A 1JZ4A 2QQKA 3JXSA 2J1TA 3ACFA 1H6XA 1UMHA 3ZM8A 5EJZB 3EB7A 5J1XA 1JI6A 1DYOA 3PUHA 5B4NA 3WF2A 4M4RA 1JYXA 4KI5M 3SEEA 1KEXA 4DUXA 1PX3A 3D3AA 5G04L 3SKJE 1W9TA 2W87A 1EUUA 3OGVA 3A23A 3VD4A 4XURA 3LEKA 3WEZA 2YB7A 2JE8A 4GWIA 4PT6A 2VCBA 3I2FA 1K42A 2L9LA 1W8OA 1DLCA 3I3BA 4MADA 3OGSA 3THDA 4ZZ5A 3HNBM 3SEPA 1SG3A 2WN2A 3HNMA 4OUEA 3T0BA 2EICA 4RN5A 1PMJX 3CKHA 4CU8A 2X05A 2VZSA 2VMFA 5EJ1B 2B9VA 3DECA 2JDAA 3CQOA 4A41A 4XUPA 2J1RA 2VCAA 4FI9A 2VJXA 2BERA 3VDCA 3OEBA 3W5MA 2X09A 2ZEXA 2EIDA 1O59A 5DN2A 4ZXEA 2ZEYA 2YC4A 5CZKA 2Y6JA 1JYNA 3VDAA 1K45A 1JYVA 2V72A 2VZQA 3DYOA 3K4ZA 2BBAA 4CU6A 3FHAA 1DP0A 2CDOA 3OBAA 3HN3A 4D8MA 1JZ8A 3C8XA 3PUIA 1P8JA 5C70A 4UOJA 4BXSV 2VMEA 3CDZB 3I3DA 1J84A 1PMHX 4MOAA 3DYMA 3OEAA 2DCKA 1W0NA 5JXGA 3I97A 2V4VA 2C4XA 3MV11 2VCCA 2PQSA 4CVUA 5CYYA 3UESA 4HG6B 1CX1A 3A22A 3WF1A 2OKXA 5JR2A 2W95A 4DEQA 2VMCA 4QB6A 2W3JA 4DUVA 5IFPA 2YC2A 1MPXA 1GQPA 5EIYB 1TG7A 2X10A 1L7RA 1WKYA 4JKMA 4LQRA 3VDBA 4A42A 5FUIA 1BHGA 4QB2A 4XUTA 4M4PA 4P5YA 2VQUA 2WAAA 2VZOA 4ARYA 3ACIA 2J1AA 4UAPA 4P02B 2ZEWA 1NX9A 4UI9L 1JZ6A 3FL7A 1OT5A 4BJ0A 3ECQA 3VD9A 3WNPA 3MUZ1 1W8NA 3HNYM 4MGQA 4D0QA 4OMCA 3NJVA 2WDBA 2QQMA 2DDUA 1WCQA 3K77A 3NQHA 1TVGA 5JXHA 4MO3M 3LE0A 1EUTA 2J1SA 3I2HA 4DUWA 1JU4A 4QDQA 3UNPA 2VZVA 2ZEZA 1JZ2A 3MO4A 3BGAA 4L0PA 5LA1A 1PX4A 5LA0A 1US2A 4BK4A 4QB1A 2VQTA 4LHSA 5G05L 2WZEA 4DXRA 3C7OA 2WBKA 3K4DA 1GUIA 2W1QA 5HXMA 5F7UA 2BZDA 2JD9A 2BGOA 1SHWB 4P08A 3W5NA 1HN1A 4QDSA 1CIYA 4CUAA 2Y6KA 3F2ZA 3T2QA 5DMYA 2Z4FA 3NJXA 4MGSA 1JZ3A 1UXZA 2W47A 4QX0A 2WO2A 3IIIA 1CZTA 2R7EB 5JUVA 4GZ9A 4QPWA 1JHJA 1UY4A 4XZUG 1NKGA 2VZRA 2XHNA 4BK5A 2WABA 4JKLA 4AAXA 4XUNA 3WNLA 2VM9A 2Y6HA 3OG2A 2WQ8A 4KWUA 1W9SA 1D7PM 3SKVA 2VZUA 1GU3A 3IAPA 4PF1A 1W99A 4IUGA 1ULPA 3GGLA 4JKKA 3C7GA 2QQIA 2WYSA 4ZY9A 3HJRA 3IB3A 1O8PA 5DPNA 3T0AA 3T0DA 2ORXA 2J1VA 3E1F1 2WO1A 2VL4A 2EIEA 1F4HA 3OGRA 3K46A 3K4AA 2E31A 3BN6A 3MUY1 1XNTA 4LPLA 4OZOA 5I0DA 4E8DA 3NRUA 5JXJA 3T08A 2QBXA 2J22A 2J1UA 2VO5A 1US3A 1K3IA 1SDDB 3VD7A 3T2PA 3WNMA 2ORZA 3IAQA 4ET7A 4TTGA 2W5FA 4A3ZA 3A21A 2BGPA 4P00B 1RYYA 3WF3A 3WNOA 3MV01 3WQBA 3LEIA 1KGYA 1UMIA 1UYYA 4BDVB 4Z2AA 4A44A 1OH4A 1NAEA 3WSOA 4QAWA 3I2GA 2VZPA 3HEIA 2KD7A 2VR4A 3P1IA 5B4XA 3HOBA 3VD5A 2LW8A 3I2KA 2XOMA 2RJ2A 5JMOA 3CZUA 1I5PA 2W94A 2B4KA 2WUHA 4ZZ8A 2WAOA 2W92A 4KMQA 4A4AA 2V5DA 2E33A 1UYZA 1YQ2A 1GMMA 2VZ3A 3U37A 4DEVA 2YFZA 5LCWL 2W1SA 5HPOA 5C7GA 1JZ7A 3ETPA 2WZ8A 1UX7A 2WN3A 1W9WA 2WO3A 3MBWA 2W1UA 3C7HA 1CZSA 2W9XA 2VC9A 3LQCA 3ACGA 4TXWA 3ACHA 4W4ZA 5LA2A 4GWJA 1UYXA 2HYXA 2QQOA 5JXIA 4ARXA 5IJRA 3GDBA 3C7FA 4A6OA 3C7EA 1JZ5A 2CDPA 2HLEA 3VD3A 1R64A 2VZTA 1UWWA 1F4AA 3EYPA 2VZ1A 2XQXA 3HPNA 5IHRA 2DCJA 1T2XA 4W50A 1NUKA 3FHQA 3UETA 1LNSA 4QX1A 1UY2A 1GOGA 2Y64A 3NNGA 5IYYA 1O8SA 4OYUA 2C26A 3I2IA 2J7MA 4XUQA 1XNAA 1K12A 2Y6LA 4E8CA 2J1EA 2YG0A 1UXXX 3A7QA 4CUCA 3IDAA 3ABZA 3WNKA 3J7HA 1OD3A 2RV9A 1GOFA 2E26A 3AC0A 2QQJA 4JX0A 1J83A 4QX2A 5DQ0A 3THCA 4AG4A 4CU7A 3LPFA 1OF3A 2VOTA 2XONA 3I2JA 4QDRA 2RVAA 3OB8A 2W1WA 3LPGA 4DXTA 1UY3A 4CUBA 2E32A 2YFUA 2C9KA 2ZXQA 2VTFA 3T2OA 3DYPA 1XC6A 4LKSA 1UY1A 2QQNA 1H6YA 3I3EA 1L7QA 1UZ0A 3GM8A 4OMDA 4YPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8K A;  3WF4 A;  4A45 A;  3K75 B;  2JKX A;  5IFT A;  1JU3 A;  3WNN A;  4PQQ A;  2LS6 A;  2ID4 A;  2EIB A;  1JYW A;  3FN9 A;  2W91 A;  5C71 A;  4XVH A;  1IQD C;  4DXS A;  2Y6G A;  3GXU A;  3LEG A;  4CU9 A;  2QQL A;  2W46 A;  4RYD A;  1GOH A;  2VMD A;  1UY0 A;  3CIH A;  3T09 A;  4XUO A;  5A1A A;  3P6B A;  1ULO A;  1CZV A;  1XPW A;  1GNY A;  3WF0 A;  3CMG A;  1OF4 A;  3CZJ A;  4W8J A;  4JHZ A;  4QX3 A;  1JZ4 A;  2QQK A;  3JXS A;  2J1T A;  3ACF A;  1H6X A;  1UMH A;  3ZM8 A;  5EJZ B;  3EB7 A;  5J1X A;  1JI6 A;  1DYO A;  3PUH A;  5B4N A;  3WF2 A;  4M4R A;  1JYX A;  4KI5 M;  3SEE A;  1KEX A;  4DUX A;  1PX3 A;  3D3A A;  5G04 L;  3SKJ E;  1W9T A;  2W87 A;  1EUU A;  3OGV A;  3A23 A;  3VD4 A;  4XUR A;  3LEK A;  3WEZ A;  2YB7 A;  2JE8 A;  4GWI A;  4PT6 A;  2VCB A;  3I2F A;  1K42 A;  2L9L A;  1W8O A;  1DLC A;  3I3B A;  4MAD A;  3OGS A;  3THD A;  4ZZ5 A;  3HNB M;  3SEP A;  1SG3 A;  2WN2 A;  3HNM A;  4OUE A;  3T0B A;  2EIC A;  4RN5 A;  1PMJ X;  3CKH A;  4CU8 A;  2X05 A;  2VZS A;  2VMF A;  5EJ1 B;  2B9V A;  3DEC A;  2JDA A;  3CQO A;  4A41 A;  4XUP A;  2J1R A;  2VCA A;  4FI9 A;  2VJX A;  2BER A;  3VDC A;  3OEB A;  3W5M A;  2X09 A;  2ZEX A;  2EID A;  1O59 A;  5DN2 A;  4ZXE A;  2ZEY A;  2YC4 A;  5CZK A;  2Y6J A;  1JYN A;  3VDA A;  1K45 A;  1JYV A;  2V72 A;  2VZQ A;  3DYO A;  3K4Z A;  2BBA A;  4CU6 A;  3FHA A;  1DP0 A;  2CDO A;  3OBA A;  3HN3 A;  4D8M A;  1JZ8 A;  3C8X A;  3PUI A;  1P8J A;  5C70 A;  4UOJ A;  4BXS V;  2VME A;  3CDZ B;  3I3D A;  1J84 A;  1PMH X;  4MOA A;  3DYM A;  3OEA A;  2DCK A;  1W0N A;  5JXG A;  3I97 A;  2V4V A;  2C4X A;  3MV1 1;  2VCC A;  2PQS A;  4CVU A;  5CYY A;  3UES A;  4HG6 B;  1CX1 A;  3A22 A;  3WF1 A;  2OKX A;  5JR2 A;  2W95 A;  4DEQ A;  2VMC A;  4QB6 A;  2W3J A;  4DUV A;  5IFP A;  2YC2 A;  1MPX A;  1GQP A;  5EIY B;  1TG7 A;  2X10 A;  1L7R A;  1WKY A;  4JKM A;  4LQR A;  3VDB A;  4A42 A;  5FUI A;  1BHG A;  4QB2 A;  4XUT A;  4M4P A;  4P5Y A;  2VQU A;  2WAA A;  2VZO A;  4ARY A;  3ACI A;  2J1A A;  4UAP A;  4P02 B;  2ZEW A;  1NX9 A;  4UI9 L;  1JZ6 A;  3FL7 A;  1OT5 A;  4BJ0 A;  3ECQ A;  3VD9 A;  3WNP A;  3MUZ 1;  1W8N A;  3HNY M;  4MGQ A;  4D0Q A;  4OMC A;  3NJV A;  2WDB A;  2QQM A;  2DDU A;  1WCQ A;  3K77 A;  3NQH A;  1TVG A;  5JXH A;  4MO3 M;  3LE0 A;  1EUT A;  2J1S A;  3I2H A;  4DUW A;  1JU4 A;  4QDQ A;  3UNP A;  2VZV A;  2ZEZ A;  1JZ2 A;  3MO4 A;  3BGA A;  4L0P A;  5LA1 A;  1PX4 A;  5LA0 A;  1US2 A;  4BK4 A;  4QB1 A;  2VQT A;  4LHS A;  5G05 L;  2WZE A;  4DXR A;  3C7O A;  2WBK A;  3K4D A;  1GUI A;  2W1Q A;  5HXM A;  5F7U A;  2BZD A;  2JD9 A;  2BGO A;  1SHW B;  4P08 A;  3W5N A;  1HN1 A;  4QDS A;  1CIY A;  4CUA A;  2Y6K A;  3F2Z A;  3T2Q A;  5DMY A;  2Z4F A;  3NJX A;  4MGS A;  1JZ3 A;  1UXZ A;  2W47 A;  4QX0 A;  2WO2 A;  3III A;  1CZT A;  2R7E B;  5JUV A;  4GZ9 A;  4QPW A;  1JHJ A;  1UY4 A;  4XZU G;  1NKG A;  2VZR A;  2XHN A;  4BK5 A;  2WAB A;  4JKL A;  4AAX A;  4XUN A;  3WNL A;  2VM9 A;  2Y6H A;  3OG2 A;  2WQ8 A;  4KWU A;  1W9S A;  1D7P M;  3SKV A;  2VZU A;  1GU3 A;  3IAP A;  4PF1 A;  1W99 A;  4IUG A;  1ULP A;  3GGL A;  4JKK A;  3C7G A;  2QQI A;  2WYS A;  4ZY9 A;  3HJR A;  3IB3 A;  1O8P A;  5DPN A;  3T0A A;  3T0D A;  2ORX A;  2J1V A;  3E1F 1;  2WO1 A;  2VL4 A;  2EIE A;  1F4H A;  3OGR A;  3K46 A;  3K4A A;  2E31 A;  3BN6 A;  3MUY 1;  1XNT A;  4LPL A;  4OZO A;  5I0D A;  4E8D A;  3NRU A;  5JXJ A;  3T08 A;  2QBX A;  2J22 A;  2J1U A;  2VO5 A;  1US3 A;  1K3I A;  1SDD B;  3VD7 A;  3T2P A;  3WNM A;  2ORZ A;  3IAQ A;  4ET7 A;  4TTG A;  2W5F A;  4A3Z A;  3A21 A;  2BGP A;  4P00 B;  1RYY A;  3WF3 A;  3WNO A;  3MV0 1;  3WQB A;  3LEI A;  1KGY A;  1UMI A;  1UYY A;  4BDV B;  4Z2A A;  4A44 A;  1OH4 A;  1NAE A;  3WSO A;  4QAW A;  3I2G A;  2VZP A;  3HEI A;  2KD7 A;  2VR4 A;  3P1I A;  5B4X A;  3HOB A;  3VD5 A;  2LW8 A;  3I2K A;  2XOM A;  2RJ2 A;  5JMO A;  3CZU A;  1I5P A;  2W94 A;  2B4K A;  2WUH A;  4ZZ8 A;  2WAO A;  2W92 A;  4KMQ A;  4A4A A;  2V5D A;  2E33 A;  1UYZ A;  1YQ2 A;  1GMM A;  2VZ3 A;  3U37 A;  4DEV A;  2YFZ A;  5LCW L;  2W1S A;  5HPO A;  5C7G A;  1JZ7 A;  3ETP A;  2WZ8 A;  1UX7 A;  2WN3 A;  1W9W A;  2WO3 A;  3MBW A;  2W1U A;  3C7H A;  1CZS A;  2W9X A;  2VC9 A;  3LQC A;  3ACG A;  4TXW A;  3ACH A;  4W4Z A;  5LA2 A;  4GWJ A;  1UYX A;  2HYX A;  2QQO A;  5JXI A;  4ARX A;  5IJR A;  3GDB A;  3C7F A;  4A6O A;  3C7E A;  1JZ5 A;  2CDP A;  2HLE A;  3VD3 A;  1R64 A;  2VZT A;  1UWW A;  1F4A A;  3EYP A;  2VZ1 A;  2XQX A;  3HPN A;  5IHR A;  2DCJ A;  1T2X A;  4W50 A;  1NUK A;  3FHQ A;  3UET A;  1LNS A;  4QX1 A;  1UY2 A;  1GOG A;  2Y64 A;  3NNG A;  5IYY A;  1O8S A;  4OYU A;  2C26 A;  3I2I A;  2J7M A;  4XUQ A;  1XNA A;  1K12 A;  2Y6L A;  4E8C A;  2J1E A;  2YG0 A;  1UXX X;  3A7Q A;  4CUC A;  3IDA A;  3ABZ A;  3WNK A;  3J7H A;  1OD3 A;  2RV9 A;  1GOF A;  2E26 A;  3AC0 A;  2QQJ A;  4JX0 A;  1J83 A;  4QX2 A;  5DQ0 A;  3THC A;  4AG4 A;  4CU7 A;  3LPF A;  1OF3 A;  2VOT A;  2XON A;  3I2J A;  4QDR A;  2RVA A;  3OB8 A;  2W1W A;  3LPG A;  4DXT A;  1UY3 A;  4CUB A;  2E32 A;  2YFU A;  2C9K A;  2ZXQ A;  2VTF A;  3T2O A;  3DYP A;  1XC6 A;  4LKS A;  1UY1 A;  2QQN A;  1H6Y A;  3I3E A;  1L7Q A;  1UZ0 A;  3GM8 A;  4OMD A;  4YPJ A; 
#chains in the Genus database with same CATH topology
 3BOP A;  3ALQ A;  5CFC C;  1PGL 2;  5IAT A;  4I0A A;  4PQQ A;  2LS6 A;  4DMI A;  1JYW A;  2EIB A;  1X50 A;  5FZ1 A;  4AI2 A;  4EZ4 A;  2PQQ A;  4OQ8 A;  4CEW C;  2CAV A;  1VE0 A;  4PLN A;  1MEC 3;  2PHL A;  3KT1 A;  1R1A 2;  4IER A;  4LIT A;  4KWJ A;  4MLO A;  4CPB A;  2QQL A;  4R9D A;  1I3H A;  1FNY A;  4RYD A;  5GZG A;  5JXH A;  4HFS A;  1TME 2;  2PEL A;  1JXN A;  2CSG A;  1DZQ A;  1CVN A;  1QJE A;  1VBE 3;  5A1A A;  1QY4 A;  1SLI A;  4IV1 C;  3VHR A;  3BPZ A;  3ZN5 A;  5FQ0 A;  1IS4 A;  4FPH A;  1LAJ A;  3MW2 A;  1GV9 A;  5GZE A;  5DZF A;  4MGK E;  1ZRR A;  1LGC A;  2K46 A;  3MFA A;  5SV5 A;  3NW4 A;  1RHI 2;  3VBF A;  2R0H A;  1U5I A;  2NM1 A;  1E5I A;  3UK9 A;  1YFU A;  5FZ0 A;  4QX3 A;  4NPR A;  4COV A;  2OVU A;  4AQS A;  3OBZ A;  5ABJ C;  3UYJ A;  1H6X A;  2R06 2;  5FIX A;  5JOX A;  4AQ6 A;  4HOO A;  4ZZ5 A;  4XBL A;  2FDG A;  5EJZ B;  2WZR 2;  3MIB A;  2ZPX A;  2GZW A;  2GU9 A;  1DYO A;  5E8A A;  1A6C A;  4I0B A;  3VKO A;  1JUI A;  3VDD C;  2B9U A;  4Z07 A;  4CXW A;  2DYC A;  1KFX L;  1AXK A;  4KI5 M;  3D0J A;  1KEX A;  1N3Q A;  1DIW A;  2Q8D A;  1ZBA 1;  3AB0 A;  3VZM A;  5G04 L;  1BCX A;  1LOA A;  1RUH 3;  2YBK A;  4LR4 A;  2GNT A;  2PA7 A;  4NN0 A;  4AK3 A;  5CFD A;  1LGN A;  5LAS A;  4OI2 A;  1YFY A;  1QNW A;  5FMD A;  4RD7 A;  3S7E A;  4PT6 A;  1OUR A;  2ZAA A;  3D5O A;  2VCB A;  1X36 A;  1VBA 3;  3VBH A;  1OUS A;  3NL1 A;  3QAC A;  1RC6 A;  3O5S A;  5LRR A;  3WCS A;  4QQP A;  1C8N A;  2GSY A;  3WHT A;  1RUJ 2;  1H30 A;  1HLC A;  4LA3 A;  2BU9 A;  4FPG A;  3BYW A;  2ZGS A;  3CJI A;  1ZZ8 A;  3THD A;  1Y43 B;  1QEX A;  1XU2 A;  1SG3 A;  1PO1 2;  2C1F A;  2E51 A;  1IG0 A;  1RED A;  2B45 X;  4DOU A;  1T6G C;  2R06 1;  1J1T A;  4RN5 A;  2F4L A;  2RR1 3;  4FPJ A;  2HWD 2;  4WM8 B;  1UF2 C;  5L73 A;  4CU8 A;  1VBB 1;  3ACL A;  3PU3 A;  2GP3 A;  4Y24 A;  2X05 A;  1KFU L;  2VMF A;  5EJ1 B;  5SV8 A;  3ZFG B;  1KD7 A;  3UGG A;  2WR9 A;  4R52 A;  2YY1 A;  2VCA A;  4F8A A;  1D4V B;  4Q27 A;  1FYU A;  1WCU A;  3VBR A;  2WLP A;  4E4S A;  2DCT A;  4IGO A;  2YGL A;  3W5M A;  2ZJC A;  3OEB A;  4RFR B;  2VE1 A;  2EID A;  3AYC A;  5FY4 A;  1YQ8 A;  4FPK A;  5C3R A;  2R32 A;  3MIG A;  4JGY B;  5FXV A;  4FFH A;  4JGZ B;  4UWD A;  1JYV A;  5C3P A;  4GQ7 A;  3T4H B;  1C4R A;  4OHZ A;  4XDO A;  2PYT A;  3HN3 A;  1JZ8 A;  5FOJ B;  3C8X A;  3RJR A;  5FZA A;  5C70 A;  3BIW E;  4UOJ A;  3MF9 A;  5BNN B;  4BM8 A;  2JXA A;  1RUC 3;  4GKX A;  5JAX A;  3B94 A;  4BQ5 A;  1OFN A;  1YNA A;  1AXY A;  5KHG A;  4QKF A;  4XCB A;  1HRV 3;  1HV1 A;  4QPI A;  5FZD A;  5ABJ A;  4IEP A;  1W0N A;  4YZ3 A;  3NKG A;  2XXZ A;  2D93 A;  4XFI A;  1HRV 2;  3SQO A;  2G1M A;  3I97 A;  2Y0O A;  5CFC B;  1SLC A;  1MEC 2;  3MV1 1;  4LLF A;  2VCC A;  1AR7 1;  1AJO A;  3S7I A;  3O1P A;  1E5H A;  1VBC 1;  2E7Q A;  2G9G A;  4HLT A;  3S6P A;  1NYW A;  1XNC A;  2D7F A;  3U4X A;  4IGQ A;  1R09 2;  2CY6 A;  4B4Q A;  2K2S A;  3LAG A;  3KCC A;  1S0C A;  1CX1 A;  3MID A;  5FZK A;  1R08 3;  2W68 A;  2OKX A;  1POQ A;  1BVV A;  1WMF A;  1HQW A;  2W95 A;  2XB6 C;  4BWO A;  4DEQ A;  3ZX7 A;  1DDL A;  3VDD A;  4P9G A;  4QB6 A;  2ARA A;  4MGY E;  4RL7 A;  1RUI 3;  4QMA A;  2KA3 A;  1WLW A;  3NAP C;  1EYB A;  2P1B A;  2V73 A;  1TG7 A;  4GJZ A;  4HN1 A;  1WME A;  4JQR A;  1F5J A;  3N9N A;  5CB7 A;  2DCY A;  4GXL A;  4JKM A;  4XBN A;  3VDB A;  5T55 A;  4LKF A;  4JVA A;  4AE2 A;  1YJK A;  1LOF C;  4P5Y A;  4C91 A;  5F9T A;  4FP3 A;  1G8W A;  2VZO A;  4P9Y A;  5IVE A;  5A1F A;  1HQL A;  2J1A A;  2SLI A;  4AI1 A;  4TZD A;  4P02 B;  1NX9 A;  4C0B A;  3IDC B;  3M3O A;  3V0A A;  1JZ6 A;  4EYU A;  1IKP A;  1TME 1;  5IAV A;  1B09 A;  4N9I A;  1EPW A;  1WCK A;  1AYM 2;  4YVS C;  2KR2 A;  4MGZ E;  4Q4W 2;  5IW0 A;  4GH4 A;  2EIG A;  3WNP A;  3H9A A;  3KSC A;  4COY A;  1OOP A;  4PI2 A;  1MVQ A;  3TN9 3;  4CDX A;  4MGQ A;  1G7Y A;  4UFK A;  4WBB A;  3NWK A;  4OMC A;  2RMU 3;  5FYH A;  4CZS A;  4D0Q A;  5C8C C;  5LEK A;  1HJF A;  2WDB A;  1SPP B;  2QQM A;  1NCR B;  4IE6 A;  2XGX A;  4WM7 A;  3VL9 A;  2RDQ A;  4COZ A;  4W6Y A;  3UJO A;  2FBE A;  5A3T A;  1SLA A;  1I1E A;  1GIC A;  3N7L A;  1HJG A;  2ZHN A;  1AR6 1;  2WS9 3;  5DUW A;  1H4H A;  3L9J T;  3LIH A;  4LBQ B;  4UXA A;  3EMR A;  4DRR A;  2V5Y A;  1JU4 A;  5KHJ A;  3I7D A;  2VMH A;  4IES A;  3K2O A;  3UNP A;  5FP9 A;  2VZV A;  1G9A A;  4BXF A;  3KB5 A;  4NHK A;  3MO4 A;  1RUO A;  1CES A;  5LA1 A;  1W06 A;  5AFB A;  2UY8 A;  5IVC A;  4UW3 A;  4AWD A;  4COW A;  1IGO A;  2HWB 1;  2K0G A;  5LA0 A;  5FDB A;  4BK4 A;  1W8W A;  1H2L A;  4XFA A;  3AMM A;  3OY8 A;  1FAT A;  5FJK A;  4YW7 A;  5HXM A;  2FD8 A;  2X53 S;  2R04 2;  5F7U A;  4KGQ A;  2C9A A;  2BZD A;  4WVV A;  4JC1 A;  4CDX C;  1VR3 A;  2VNV A;  3SH3 A;  1SHW B;  1ULD A;  3LA3 A;  5FY0 A;  3KVB A;  5KC5 A;  1HN1 A;  1ZRI A;  3Q8C A;  2R04 1;  4YG0 A;  3NV4 A;  4XIK A;  3KS7 A;  3CJX A;  2H0V A;  5D8A B;  1XU1 A;  2Y6K A;  4GWN A;  4LOR A;  3SMH A;  1EP0 A;  1NY7 1;  2XVK A;  5GLZ A;  4JGZ C;  4LUM A;  3DXU A;  2TEP A;  3E5X A;  4OHW A;  5LAT A;  3WUC A;  1ZZB A;  4JGY C;  4KWL A;  5J3U A;  3VBH C;  4YZ5 A;  5JUV A;  1V6J A;  1W39 A;  3MIF A;  1XNB A;  4ATE A;  1D0G A;  2IXC A;  2XHK A;  4ZKT B;  4ZXK A;  4YM2 A;  1RVF 3;  4OLL A;  4MXW B;  5A7N A;  4BQW A;  2RS1 1;  1UCX A;  5E6H A;  2VUD A;  4N53 C;  3GBW A;  2ZAH A;  1VMJ A;  4N7U A;  4LO7 A;  2D43 A;  3FX3 A;  1GAN A;  4E2S A;  2UY9 A;  3V65 A;  3P3N A;  1TMF 1;  3AVR A;  3RZJ A;  3A0K A;  4Y22 A;  4AFM A;  4D7S A;  4AVV A;  2QDR A;  1CN1 A;  4YVS B;  2HEV F;  3PUR A;  2VVE A;  1W6O A;  2B5H A;  4OI4 A;  4Y5S A;  4ITC A;  4WVM B;  4IUG A;  1BXH A;  1ULP A;  3ZPY A;  3C7G A;  5FO8 B;  1ENR A;  2WYS A;  4XIO A;  1WW4 A;  1DQ1 A;  2E53 A;  3UJQ A;  3HJR A;  3IB3 A;  1IPK A;  4SBV A;  5GJ6 A;  2R16 A;  1O8P A;  3RMY A;  3RZK A;  1HRI 3;  3V56 A;  1DG6 A;  1W6P A;  2XBO 3;  5K4L A;  3WQ0 A;  1UZV A;  2WO1 A;  3O1S A;  5FY5 A;  1F9K A;  2PTM A;  3K4A A;  5FZ3 A;  3WZ1 A;  1C1F A;  2FDJ A;  4W6W A;  4DB5 A;  3WDV A;  1GZW A;  1X33 A;  3AVS A;  4E8D A;  4HAN A;  4L2N A;  1SFY A;  3WX5 A;  1O3Q A;  1NE4 A;  5GZD A;  2QBX A;  5GZC A;  1YO8 A;  3I4I A;  4GJY A;  3VZN A;  4HON A;  4YFW A;  1GP5 A;  1DHK B;  1CR7 A;  5EJ3 A;  4AOC A;  3IAQ A;  4L9B A;  1X8E A;  4FQ4 A;  2CWS A;  3UV9 A;  3ELN A;  2W5F A;  4A3Z A;  4PQ9 A;  2QUO A;  1RUG 1;  2ZX1 A;  4JHT A;  4P00 B;  1RYY A;  4RQP B;  2VXJ A;  3V0B B;  4QXH A;  3WNO A;  3WQB A;  4HL0 A;  3AMH A;  3LEI A;  1X9T A;  1U0A A;  2RMU 2;  3A0N A;  3GCW A;  1UMI A;  1UYY A;  2W2I A;  3G7D A;  4QXK A;  5T5O A;  1LRH A;  2JB8 A;  4B4P A;  4BOW A;  4CCD A;  4Q4W 1;  4IV1 A;  4Z2A A;  2C24 A;  4CDX B;  4TWT A;  5C3S A;  5KHI A;  4CA9 A;  4E2G A;  2Y26 A;  5H9S A;  1SPP A;  3HEI A;  3WP4 A;  3HR9 A;  2O1Q A;  3B00 A;  1EV1 3;  1NXM A;  3BAL A;  1CAW B;  3NMB A;  5B4X A;  5I8S A;  1RIT A;  3WLU A;  4Q4X 2;  4LMF A;  4MH0 E;  2LW8 A;  4EN7 B;  4QPY A;  2DBN A;  5CFD B;  1N3P A;  4FP2 A;  2VUC A;  4IE7 A;  5ABJ B;  4FXG B;  4ORF A;  1YQC A;  4AGR A;  2D6K A;  3ZKU A;  3MPP G;  1NLR A;  5E88 A;  4R4Z A;  3KV5 A;  4DRV A;  3PVN A;  2NP0 A;  1K5M B;  3DPR A;  3VKF C;  3NKT A;  3FHI B;  2OW4 A;  5I0R A;  2XKP A;  2E33 A;  4H3W A;  1UYZ A;  2P5B A;  4N43 A;  4Q26 A;  3U37 A;  4DEV A;  2BNO A;  2YFZ A;  4DXZ A;  5C5U A;  3ZOI A;  3ZMO A;  5C7G A;  1HB4 A;  2WZ8 A;  4FTB A;  4R8H A;  2QQP A;  5FYI A;  5CFD C;  3MBW A;  5D2A A;  2DBI A;  2R04 3;  5KBF A;  1AR6 3;  5H9R A;  1CZS A;  5A3L A;  2XML A;  3SH4 A;  2G4I A;  2VOV A;  3LQC A;  4FOQ A;  4OZX A;  2XH6 A;  5DG2 A;  2VD7 A;  3OGJ A;  4AGV A;  5FZF A;  1VRH 1;  2BTV C;  3ACH A;  4HKW A;  2HWD 3;  4NRQ A;  4ZS2 A;  4GWJ A;  1UYX A;  3RZH A;  4UW4 A;  4XPV A;  2XWB B;  3MF6 A;  4M3C A;  4ASL A;  5IVF A;  2RR1 1;  3O1V A;  5D8A A;  4HK9 A;  4XF4 A;  4QGL A;  5KR7 A;  1VBA 1;  1LHV A;  3N9P A;  2W08 A;  2H0B A;  2YDE A;  1PZ7 A;  2XVG A;  3E97 A;  1UMZ A;  1SMV A;  3URF A;  2Y0I A;  1R64 A;  1UX6 A;  3ATG A;  3DPR C;  4TYS A;  5F5A A;  3I2O A;  1Q56 A;  1HXS 3;  1QIQ A;  2LTN A;  5DAV A;  3HPN A;  5C33 A;  5GAL A;  2DCJ A;  3IWZ A;  4EE2 A;  2BFU L;  4NIH A;  2YXS A;  1O91 A;  4CTE A;  1ZZC A;  1I5Z A;  1GOG A;  2X5I A;  1IS3 A;  2DUO A;  3ZFE C;  4XHB A;  5I8T A;  1FOD 1;  3BTA A;  4TLG A;  5A7O A;  3MHZ A;  1QQP 2;  3VB9 A;  5JSP A;  3AFG A;  1EAH 3;  5I0T A;  1AR8 3;  2WWJ A;  4HBN A;  2YG0 A;  3IKW A;  1QQP 3;  3PIJ A;  2VUJ A;  4L11 A;  1FOD 2;  2Q4S A;  2ZA9 A;  1W8H A;  3POJ A;  5EYY A;  3NJY A;  1S4C A;  1PM4 A;  4CDQ B;  1D0H A;  1YQ6 A;  2PAM A;  1LJ7 A;  4K8R B;  3DL3 A;  3VBR B;  1ULF A;  1BLZ A;  1ALY A;  1C8M 2;  1GWL A;  3ZXA C;  2D6M A;  4A7Z A;  3J9S A;  1GNH A;  4IEW A;  2WNU B;  2UWC A;  4NPL A;  2JG8 B;  4KQ7 A;  3WV6 A;  1OF3 A;  5FYT A;  5CG8 A;  2VEC A;  3ZKY A;  3B01 A;  3N4M A;  3I2D A;  3OB8 A;  2BV4 A;  5A7P A;  3LPG A;  4G3Y C;  2WNV B;  2CYF A;  2VTX J;  1IS5 A;  4O9G A;  4CUB A;  4FPL A;  1O4T A;  1N3O A;  1DGL A;  4TN7 A;  1QJX 2;  1VPH A;  1JUH A;  1H8T C;  1JN2 P;  2XKO A;  1PK6 A;  1OA2 A;  2WSU A;  2VBP A;  3T2O A;  5LW9 A;  1YEW A;  1CD3 G;  4PBO A;  5BUV A;  5D1I A;  1BVP 1;  1RUI 2;  2ADE A;  4ASK A;  3I3E A;  3GM8 A;  3LDK A;  4XJU A;  1OPO A;  4RQP A;  3WEZ A;  5DDJ 1;  1ZBA 2;  2YBS A;  3WF4 A;  2MPF A;  4A45 A;  3K75 B;  4W65 A;  1H1A A;  3U78 A;  4BA6 A;  1ENQ A;  5HV4 A;  1A78 A;  1Z78 A;  2EA7 A;  5CKM A;  5F5I A;  2NMO A;  1AUY A;  3FN9 A;  2FDI A;  1JHN A;  3JBG 1;  1IQD C;  4FPE A;  4D7Y A;  1RUE 3;  5L19 A;  3GXU A;  4YW3 A;  4XXA A;  1RMU 1;  1EPZ A;  5DDJ 3;  3FBY A;  2FMY A;  3E6C C;  2A1X A;  3LEG A;  3NAP A;  3AKQ A;  3O0W A;  4OFG A;  3L2H A;  1CAW A;  5CU1 A;  4CU9 A;  1BMV 1;  4XF3 A;  4A7K A;  1HB1 A;  4H7M A;  4C8D A;  4S2D A;  4I2O A;  1GOH A;  1QJY 1;  1UY0 A;  3BU7 A;  4QX7 A;  1GWK A;  1HIX A;  1VB4 A;  3N9O A;  3VBO A;  5KXB A;  4PF5 A;  1OSG A;  2ZGT A;  5CIR A;  3T09 A;  3WW4 A;  1QWR A;  1BMV 2;  1XYO A;  1PIV 2;  1LHN A;  1TE1 B;  2D44 A;  2PLV 1;  2WT2 A;  4MSV A;  4XJA A;  4YVS A;  1OC1 A;  1ENX A;  3D82 A;  4UFJ A;  2IXK A;  2OPW A;  4MVT A;  4YGC A;  5A7W A;  1VIW B;  5F39 A;  4NAO A;  2Y38 A;  3T1M A;  3CZJ A;  4RA0 A;  4XFG A;  1MQT C;  2D97 A;  3NO8 A;  4JHZ A;  4NHX A;  2WO7 A;  3AZX A;  4MV2 A;  3RYP A;  1JS9 A;  3JXS A;  5C9A B;  3ACF A;  3RWN A;  3IDE A;  1CON A;  1CJD A;  1MZ6 A;  1F15 A;  2WT0 A;  3QBQ A;  3NJZ A;  5J1X A;  3JD7 3;  5FBZ A;  1UKR A;  5FWJ A;  3JBG 2;  4B29 A;  1G9B A;  1RUJ 1;  3NNL A;  1VAV A;  1PGW 2;  2P2K A;  5B4N A;  4XAA A;  5TSW A;  1VRH 2;  1TNF A;  4FPC A;  1PK6 B;  1RUD 2;  3N9Q A;  4S2G A;  1JYX A;  3SEE A;  3WR0 A;  1PX3 A;  2VVD A;  1UU6 A;  4K9S A;  3IMM A;  3SKJ E;  1QXP A;  1W9T A;  4XAC A;  4XMA A;  5A3N A;  1TZO A;  5I8Y A;  4AHZ A;  2BWC A;  3AP6 A;  1VBB 2;  1V9U 1;  3JQW A;  5J7M A;  4NRP A;  1NCQ C;  1BBT 3;  2CGP A;  3GCX A;  3ZXD A;  4HKL A;  4Y22 B;  2JE8 A;  5A7S A;  3PIG A;  4QPI B;  3I2F A;  2PHX A;  5IK8 A;  1K42 A;  1QJF A;  3LFM A;  2L9L A;  1W8O A;  4A7Y A;  4CE8 A;  4RS5 C;  5FMB A;  1PNF A;  1RVF 2;  3AZW A;  3E6D A;  3I3M A;  3ZMN A;  2Z79 A;  1UOJ A;  3ZXE A;  4QGM A;  4MHU A;  3ES1 A;  3SEP A;  2WN2 A;  4A2U A;  3AL6 A;  4AZZ A;  3T3Y A;  1RUC 2;  1AX2 A;  1KDM A;  1AVB A;  4CDW A;  2VUA A;  4CCN A;  1V9U 3;  2ADD A;  5FY8 A;  3GBG A;  5M0T A;  2BOJ A;  5FXZ A;  1FPN 3;  1RUF 3;  4LO6 B;  3WIN E;  3VZL A;  3D0S A;  1GFF 2;  2VZS A;  1MVE A;  2OX0 A;  3H8O A;  2JG8 C;  4M00 A;  5A7Q A;  1MS0 A;  3CQO A;  4Y26 A;  2ZAB A;  1RHI 1;  2OYZ A;  1QOO A;  4AI8 A;  5FPX A;  1POV 3;  3H8R A;  2DUR A;  2P37 A;  5FMO L;  4LO8 A;  4QX5 A;  4Y20 B;  2VJX A;  1QJU 3;  4AAP A;  4EJR A;  3AYA A;  4EWE A;  3BKZ A;  4OUM A;  4AVC A;  1WCS A;  2X09 A;  4N43 B;  3ZN4 A;  1W04 A;  4IE4 A;  2P17 A;  2WNU C;  1O59 A;  2VPV A;  3B93 A;  4DZG A;  5JOY A;  1ST8 A;  1XSR A;  1LHU A;  2ZGQ A;  2VOK A;  2RS5 1;  3POB A;  5L9V A;  5LEJ A;  2ZGM A;  1Z7S 1;  3Q8B A;  3VDA A;  1OQ1 A;  2I2S A;  2RJL A;  4N7I A;  3WG4 A;  2IFR A;  3ZSJ A;  2V72 A;  3FJS A;  3AXE A;  3DYO A;  3K4Z A;  2ZGP A;  4Q0P A;  5FY9 A;  5FZ4 A;  1CJP A;  1ND2 A;  3AM2 A;  3USU B;  4NHY A;  3FHA A;  1VBE 2;  2QDN A;  2WFF 3;  4GMP 3;  3VZK A;  5L9B A;  4D8M A;  3IZO A;  4AQT A;  4WM7 C;  1XND A;  4L99 A;  4OHV A;  4XFH A;  1AR9 1;  1DFQ A;  4BXS V;  3L2Y A;  2E7A A;  2VME A;  1SDW A;  1RUE 1;  2BVB A;  3CDZ B;  1J84 A;  4AXO A;  4ONU A;  2ZHM A;  5FFO C;  1EV1 1;  3KCX A;  2P3Y A;  5K0U B;  4MOA A;  2ETE A;  1OVS A;  1H8V A;  2VNR A;  3K3N A;  3DYM A;  4O61 A;  4WV8 A;  5GLU A;  3ZYH A;  1Y3T A;  3VBU B;  3U14 A;  1RUE 2;  2A6Z A;  3GZT B;  3V0B A;  1AF9 A;  2O0O A;  5JXG A;  5F32 A;  4Q4W 3;  3BOD A;  4QQH A;  1W05 A;  2GC1 A;  1APN A;  2OQ6 A;  4FOV A;  3U75 A;  3WW2 A;  3VLB B;  1X8M A;  2V4V A;  4CEY C;  4RR3 B;  4K21 A;  2YPJ A;  3OTF A;  3VZO A;  5C8W A;  4OHY A;  3UES A;  2O14 A;  4JCK A;  2IXI A;  1UO9 A;  1PVC 1;  2YBP A;  3OJB A;  4U2A A;  5IK4 A;  3ZSM A;  2VBD A;  3WP3 A;  2A6W A;  4AGG A;  3MLJ A;  2BOI A;  4AI3 A;  3USS A;  3FBM A;  3HN1 A;  4FSJ A;  3NVC A;  5FYS A;  2HWB 2;  4CPB D;  2XWJ B;  3DF0 A;  1NOV A;  2HWF 1;  1W3X A;  5IFP A;  4AHX A;  1MPX A;  3M70 A;  5K7P A;  1GQP A;  1ZNP A;  1OA3 A;  2Q30 A;  3QD6 A;  4N90 A;  4CEW B;  5JLV A;  1H4G A;  4DS0 A;  1UKG A;  5CG9 A;  4ZU4 A;  4CXX A;  1SLB A;  1WKY A;  2ATF A;  4LQR A;  1V00 A;  4C0H A;  1XE0 A;  4FBF A;  4QB2 A;  5JSR A;  2Y33 A;  5A3W A;  4I3G A;  2DVD A;  5DAQ A;  3QH6 A;  4Q4V 2;  5J98 B;  4KU8 A;  3PJQ A;  3R05 A;  1GR3 A;  2ET7 A;  1FMD 1;  2BP6 A;  3AXD A;  3GHM A;  3UGH A;  3EJK A;  4CCO A;  4UF0 B;  1ZA4 A;  5FYB A;  3WNX A;  1BBT 1;  5T5L A;  2AEN A;  3ECQ A;  3J26 N;  2XJV A;  3O0V A;  3HIF A;  1W6N B;  1W8N A;  5IK5 A;  2R0F A;  1V6L A;  4Z1V A;  2ZGL A;  1IPS A;  1OQE A;  4YRD A;  4BZ4 A;  1BBT 2;  3ZFF A;  5BNN A;  3J7N A;  4XDQ A;  1REF A;  1Q8O A;  1ULG A;  1PO2 2;  4BQ2 A;  3K77 A;  3LSD A;  3WOG A;  3RPQ A;  2WRA A;  3GBF A;  3R0R A;  4MO3 M;  4YW2 A;  2VH9 A;  2GN3 A;  3LE0 A;  4DY5 A;  2WC2 A;  4DO0 A;  1VB2 A;  1MZF A;  2VMI A;  3MIC A;  4CP2 A;  1GQG A;  1RVF 1;  4K3U A;  3OPT A;  4BIS A;  4BYY A;  4P9X A;  4QDQ A;  5A3O A;  2DVB A;  2BW8 A;  2BBV A;  2D6L X;  2ZEZ A;  4QQO A;  3RRD A;  3N3H A;  4L0P A;  4IV3 B;  1LHW A;  4LO4 B;  3TNP B;  4URT A;  1PX4 A;  2HBT A;  4XQD A;  4Y1U A;  3VV1 A;  1ND3 B;  5IVY A;  1YWK A;  1US2 A;  1Y9G A;  5CNA A;  2V09 A;  1LOD A;  3IPV A;  1V6M A;  1NLS A;  3D4K A;  3JQX A;  1OUX A;  2ZHL A;  2WZE A;  1QJU 2;  5E1R A;  1AR8 2;  4DXR A;  1HW5 A;  2P3I A;  2QNK A;  2XQR A;  3W58 A;  1KJR A;  3WDX A;  4Z92 B;  3LDB A;  3K4D A;  4LUK A;  2OXB A;  4RGG A;  5FZ6 A;  4Y1Z A;  2RS1 2;  3GYD A;  5F2S A;  5DZE A;  1Q8V A;  1FAY A;  1QMJ A;  4P08 A;  4ZU5 A;  2WNE A;  5LZ6 A;  4CDW C;  4PJY A;  2TBV A;  2TNF A;  1WBL A;  4JGY A;  3MIE A;  4CUA A;  5D21 A;  3BI3 A;  3F2Z A;  3KF3 A;  1PHM A;  4NRO A;  5HCB A;  2DF7 A;  4K1Y A;  3VGI A;  2RS3 3;  4XF0 A;  3KCY A;  1UXZ A;  2W47 A;  4QX0 A;  4WVZ A;  2WO2 A;  1IHM A;  1UW8 A;  2R7E B;  3III A;  2RDR A;  4MX3 A;  1MS8 A;  3ILN A;  1YRZ A;  3RNS A;  1NZC A;  4QPW A;  1WLD A;  1ZBE 3;  5BY5 A;  1JHJ A;  5F3C A;  4HVO A;  4MHR A;  1NKG A;  2IVI B;  5C8C A;  3B9I A;  3ZFF B;  3RMX A;  1NCR A;  2RMU 1;  4JKL A;  2EXI A;  4TSV A;  2GC0 A;  3N7J A;  3EQE A;  4QPG B;  4XUN A;  1GZ9 A;  3WNL A;  5A6Q A;  1CGP A;  2Y6H A;  3BUC A;  3OG2 A;  5A6Y A;  5I93 A;  2IXH A;  1JH5 A;  4KWU A;  3ZSL A;  3AFK A;  5FZL A;  4MG2 A;  1OH3 A;  2HWC 3;  1D7P M;  4AEK A;  4IE0 A;  2GAU A;  5FKB A;  3FFQ A;  4RSU A;  1GU3 A;  3AJZ A;  3IAP A;  2CWM A;  5C4W C;  4PF1 A;  3TOJ A;  2Q1Z B;  5CA6 A;  4LEJ A;  5IVB A;  4NID A;  3GGL A;  2DU1 A;  2QQI A;  4RHV 1;  4LKD A;  1MQT A;  4RHV 3;  4ZY9 A;  2RM2 1;  2R6Q A;  1A3K A;  1RUN A;  4AHY A;  4IL7 A;  5FP3 A;  2AC1 A;  3KV9 A;  3OBT A;  1S2E A;  3GZA A;  1WGP A;  4I02 A;  3CEW A;  5DPN A;  3UGF A;  4J1W A;  4AED C;  2ORX A;  2E63 A;  5KHK A;  3T0D A;  1UPS A;  3VKN A;  1NA1 A;  2JEM A;  3E1F 1;  4NIA A;  3H3Z A;  4BQY A;  2VL4 A;  2EIE A;  2HWC 1;  2DVF A;  4LOS A;  3OGR A;  3HT1 A;  3MUY 1;  1Q8S A;  3AYD A;  3VBO B;  4AVS A;  4OCT A;  3RG0 A;  5I0D A;  1W8U A;  3OPZ A;  2BWA A;  1RUI 1;  3SIS A;  3WXP A;  1NCR C;  5FZM A;  2CTV A;  1F2N A;  1ACC A;  4FFF A;  4IEV A;  4JTO A;  1MS9 A;  1PZ9 A;  3P3P A;  1Q5O A;  4S2H A;  1BJQ A;  2IWG B;  2ARX A;  1DQ2 A;  3VD7 A;  5DZG A;  4F7Z A;  4EWD A;  2RJK A;  3QH7 A;  2WT1 A;  3SIT A;  5F6K A;  2JD4 A;  3OOX A;  3LA7 A;  3W59 A;  4ET7 A;  2JE9 A;  4NUB A;  2WQ4 A;  3B5L B;  2ZZQ A;  3H1M A;  3WF3 A;  3ZN6 B;  5FPU A;  2RR1 2;  3K51 A;  4LIV A;  5EXO A;  4LE4 A;  3JB4 C;  3GHN A;  4NHM A;  4R4X A;  2VW0 A;  2ZS6 B;  4AYU A;  3I59 B;  3EXU A;  2WL1 A;  2P6C A;  1VBD 1;  2MEV 2;  5FY1 A;  2D3P A;  1PZ8 A;  5ANN A;  4BQ1 A;  1EY2 A;  2W39 A;  1QJY 3;  3X29 B;  3ZFE A;  2VR4 A;  1N1T A;  4LKE A;  4N53 B;  1URX A;  4HVR A;  5FV3 A;  3VD5 A;  1VRH 3;  1RUD 3;  3ZIX A;  5F3G A;  4L97 A;  3WW1 A;  2NMN A;  2JDM A;  2B46 X;  2F6B A;  1BEV 2;  1LUL A;  4NII A;  4H7L A;  4AFB A;  4BB3 A;  1WLT A;  5C9A C;  2ENR A;  1GZC A;  2BNN A;  1J58 A;  1UPI A;  3IIA A;  3HMY A;  2W94 A;  1W0P A;  2WYF A;  4IEX A;  2B4K A;  2WUH A;  4MUV A;  4WVM A;  2WAO A;  3WDU A;  1AX1 A;  4KMQ A;  4A4A A;  3ZYR A;  4AI9 A;  1AR7 2;  3RZL A;  1GP4 A;  1HN0 A;  2VZ3 A;  1GKB A;  2JIJ A;  1YC6 1;  2W1S A;  1ND3 A;  1VAM A;  1JZ7 A;  1SFN A;  3ETP A;  3OD4 A;  2YGM A;  2WN3 A;  2JG8 A;  3Q8F A;  3IPV B;  5FP4 A;  2W1U A;  1OD5 A;  2OUH A;  2QVS B;  3H50 A;  4RGK A;  5FZE A;  2W9X A;  3D8C A;  5L9R A;  2ARC A;  1O3R A;  3FWE A;  3LIG A;  1RIN A;  4QM8 A;  1O6U A;  5FYU A;  1UD1 A;  4NOT A;  3T1L A;  1FX5 A;  1UL9 A;  2W0X A;  3BOW A;  2HYX A;  3HWJ A;  3NNM A;  5GLT A;  3T2T A;  5LK7 B;  1H1I A;  5BNO A;  2FMD A;  4YW6 A;  5HCF A;  2K9Z A;  1QH7 A;  4P14 A;  2EVX A;  5FP8 A;  3DCQ A;  4D7T A;  5CAZ A;  5JOZ A;  3FLR A;  1OQD A;  5JDB A;  1OVP A;  3MDP A;  5C6C A;  5T54 A;  5KWR A;  1JZ5 A;  2CDP A;  5T5J A;  3LFI A;  4XC9 A;  5FRE A;  1POV 0;  1A34 A;  1JOP A;  1HRI 2;  2VGD A;  2VZT A;  1NXD 1;  4UF0 A;  4IEO A;  3VBH B;  1UNB A;  4UT5 A;  2XQX A;  1R1A 1;  5IHR A;  1QKQ A;  2D5F A;  1QJX 3;  3VHN A;  1DQ6 A;  4XAE A;  4W50 A;  4GIQ A;  3VBR C;  1IG3 A;  3UKN A;  3FHQ A;  3AP9 A;  4Q2F A;  1YIP A;  4XTP A;  4FT8 A;  1W2T A;  2Y64 A;  4LOT A;  2W52 A;  1MS4 A;  5FYM A;  1I9R A;  1LED A;  3LKJ A;  3I2I A;  3PME A;  4WM7 B;  3PVB B;  5AC9 2;  1ZBA 3;  1XNA A;  5J96 B;  1J59 A;  4HZF A;  4PDW A;  4MZU A;  3A7Q A;  3ZYB A;  3OYW B;  3AKS A;  3IDA A;  1W6M B;  2WNV C;  4ISQ A;  2VCM A;  4RHV 2;  3J4U H;  1BQP A;  1R1A 3;  2QE3 A;  3J7H A;  4B8E A;  2VUL A;  1R08 1;  4NE9 A;  4Q8K A;  5L7O A;  1ZRC A;  3POW A;  1ZRD A;  2ILM A;  1X7N A;  4Q0S A;  4LUL A;  1B35 B;  3POY A;  2XJU A;  4P5H A;  3ZIW A;  1KJL A;  4LBK A;  3TN9 2;  2VQ0 A;  3MZH A;  2B39 A;  2NQY A;  4JX0 A;  5J09 A;  1J83 A;  2CV6 A;  4PI0 A;  2P6H A;  4CCM A;  2FDH A;  1PNG A;  1RB8 G;  4GAL A;  4XFC A;  4QDR A;  2RVA A;  2PHU A;  2W1W A;  3V0A B;  3ZXL A;  3VDD B;  4XTM A;  1UY3 A;  1AR9 2;  3PTY A;  1LU1 A;  2B42 B;  2YFU A;  1LEM A;  3C3V A;  2PLV 3;  2C9K A;  2ZXQ A;  1SLT A;  3DKQ A;  1AR9 3;  4I01 A;  4NR1 A;  3KM5 A;  5AFE A;  4LT5 A;  4CEW A;  3AZY A;  3DYP A;  2QZ3 A;  4YW1 A;  3J7L A;  2VAU A;  1OLM E;  1O4Y A;  4XZP A;  1YIF A;  2QQN A;  5CEH A;  5C3O A;  3ZPO A;  1MZ5 A;  1UZ0 A;  1VMF A;  3PUS A;  4Q4V 3;  4YPJ A;  4NVP A;  1X9P A;  2CAU A;  2Y8K A;  4XBQ A;  1V6O A;  1W8F A;  3OPW A;  5IFT A;  4YGE A;  5F2W A;  3JBG 3;  2GC3 A;  5CVR A;  3WNN A;  1UN1 A;  2WSV A;  1YFX A;  4A3X A;  1GP6 A;  3PNA A;  2DUP A;  4DXS A;  4YM1 A;  5FYY A;  1NG0 A;  4XW3 A;  1QU0 A;  1N1V A;  4G9S B;  4DIN B;  4YYO A;  1W6P B;  1LEN A;  2HWF 2;  4BME A;  2AEY A;  2W46 A;  3POG A;  2VMD A;  4JQT A;  3N35 A;  1KS4 A;  2XJP A;  3CIH A;  4XUO A;  4ZON A;  3O12 A;  1GZW B;  4V2W A;  1O5L A;  4QD2 A;  3H8U A;  4Z82 A;  4CDQ A;  4EWA A;  1CZV A;  5JPN B;  4X8N A;  2FHR A;  4PIY A;  1XPW A;  1W8Z A;  3DGT A;  5A32 B;  1GNY A;  5JWP A;  4LBQ D;  1G9D A;  1V70 A;  3WF0 A;  3C2U A;  5FR3 A;  4SLI A;  4AR2 A;  2A6X A;  2IXJ A;  2VTX A;  4YM0 A;  5LWB A;  1ZZ6 A;  2ZX3 A;  2GAL A;  3FUO A;  5FBJ A;  3B02 A;  3MLL A;  3TRS B;  2XG3 A;  2ZBJ A;  3PMS A;  4IV3 A;  3UL2 A;  2MHF A;  3N9L A;  1F35 A;  1JZ4 A;  1GSL A;  1PMI A;  2QQK A;  1YLL A;  2J1T A;  1UMH A;  2AAC A;  1BK1 A;  1L3J A;  3HVD A;  5F8P A;  2D5H A;  4Q1P A;  3EB7 A;  4YGD A;  2A6Y A;  4YW5 A;  1JI6 A;  4XEZ A;  4AL9 A;  3U0Z A;  3PUH A;  4B7E A;  4QXB A;  3HT2 A;  4E4Z A;  1POV 1;  1W6N A;  2B7Y A;  2ZMK A;  1SBD A;  1YUD A;  3IMN A;  4M4R A;  4QU1 A;  4CCL A;  1RXF A;  4FXK B;  4AEJ A;  5T3N A;  1CQ9 A;  1NQJ A;  5BNO B;  4AHW A;  3U11 A;  3D3A A;  5BNN C;  5E16 A;  5AVP A;  3MLK A;  3M3Q A;  5FUP A;  1HRI 1;  1S0B A;  2XLF A;  1EUU A;  1C8M 3;  2C5D A;  3OGV A;  1U5X A;  4QXC A;  1ONA A;  4XUR A;  3JCI A;  4E4H A;  1YCI A;  2A3W A;  2RDN A;  2YB7 A;  4GWI A;  5GZF A;  5LBF A;  4GAZ A;  1LHO A;  3W21 A;  1RMU 2;  3Q9O A;  5CBL A;  4NAM A;  2DWR A;  1C8M 1;  1DLC A;  3WDY A;  2AR6 A;  2DFC A;  4MAD A;  3CF6 E;  1OXC A;  4BQX A;  2XJQ A;  3I8T A;  4BLJ A;  3Q8A A;  1AR8 1;  1SQ4 A;  2JDZ A;  3MYX A;  4NHL A;  4OUE A;  4R9C A;  4BE3 A;  4YM3 A;  3HBZ A;  4KWK A;  3S5A A;  1ZBE 2;  3FZ3 A;  2D6O X;  3WVJ A;  1N1S A;  1SZB A;  4XJZ A;  2WWS A;  3OUH A;  1AZD A;  4EN6 B;  1HQN A;  1S0I A;  2B9V A;  1D2Q A;  2I74 A;  3DEC A;  4CCC A;  2ZAC A;  3ZSE A;  2AH2 A;  1ZBE 1;  2BVV A;  5F37 A;  4A41 A;  3RVH A;  3TEW A;  2J1R A;  4ASM B;  1R08 2;  5FUN A;  1XYN A;  4FI9 A;  4UBG A;  4X6R B;  1MEC 1;  4ATF A;  4D6R A;  1RTV A;  2BER A;  5FZ9 A;  4HK8 A;  1R1Z A;  1D4M 3;  4LXL A;  4UFM A;  3WG1 A;  5DN2 A;  3M1H A;  1D4M 2;  1JW6 A;  5A3M A;  5CZK A;  5DDJ 2;  2Y6J A;  3KVA A;  1UU4 A;  5DAW A;  1ASJ 1;  2P3K A;  3FLP A;  3VBS B;  3WG3 A;  1K45 A;  1V0A A;  2VZQ A;  5FZG A;  3DUI A;  1RUD 1;  2BBA A;  2VW1 A;  1E5R A;  4EQV A;  3TWI A;  1H8T A;  2CDO A;  1SCR A;  3N7K A;  3OBA A;  4LLO A;  3WT3 A;  2YZ4 A;  5DUX A;  3AZV A;  4J1X A;  3M4F A;  3HAG A;  2WWU A;  4BU2 A;  1MS1 A;  5FLH A;  5DUU A;  4AFA A;  4P9I A;  5K8S A;  1DF0 A;  3I3D A;  3S5Q A;  1H1M A;  2DFB A;  1PMH X;  1X82 A;  3WP6 A;  3AP4 A;  4OUS A;  3O0X A;  3OEA A;  2WNO A;  3OYW A;  4GD4 A;  1OHF A;  2JG9 B;  4YVW B;  4CEY A;  4MGT A;  4V2V A;  2BEO A;  1WW6 A;  2RDS A;  1AL2 1;  2PFW A;  4K20 A;  5EWS A;  2C4X A;  5LBB A;  5LRS A;  4CXY A;  2HH9 A;  4YG3 A;  1QNY A;  4HG6 B;  4AW7 A;  1E57 A;  1PO2 3;  3BIE A;  1S2B A;  4KH9 A;  1A8D A;  4IEU A;  4CP9 A;  1CPN A;  5CKQ A;  1S2K A;  3A22 A;  3WF1 A;  4A6S A;  2MEV 3;  5JR2 A;  1QF3 A;  3BVC A;  5ERL A;  2VMC A;  4QHO A;  4CCJ A;  3S0M A;  1PO1 1;  2WIN B;  4CDU B;  3KLS A;  1CAX A;  4DUV A;  3AX4 A;  1VBB 3;  4TLF A;  4O65 A;  3FLT A;  3POF A;  5L7O B;  1FPN 1;  1RUF 1;  2ZGU A;  5EV7 A;  5EIY B;  2A7A A;  1OPM A;  1TNR A;  2VNG A;  3BU0 A;  1UAI A;  1SLL A;  1BHG A;  5FUI A;  1Q8Q A;  1VJ2 A;  2DU0 A;  2WNU A;  4GWM A;  4CP0 A;  2OA2 A;  2WAA A;  2VQU A;  3OUI A;  4FVV A;  4PLO A;  5BV6 A;  2BJS A;  1W6Q B;  4K8F A;  3NV2 A;  3ZR6 A;  3SNM A;  1LGB A;  2A3Y A;  2BPA 2;  2R49 A;  1QQP 1;  1ND2 B;  3USU A;  4EV0 A;  2AGS A;  5FO9 B;  5FWE A;  2H6C A;  2XJT A;  5ACA 3;  4BJ0 A;  4CDQ C;  3BTX A;  2QQU A;  3VD9 A;  3POE A;  1YHF A;  2EXJ A;  1FOD 3;  3HNY M;  1CPM A;  5FK7 A;  1TEI A;  3NJV A;  3PL0 A;  5DG1 A;  1YQ5 A;  1BEV 1;  2GME A;  2Q1M A;  1PGW 1;  2X5I B;  3LA2 A;  3U10 A;  3ZFE B;  3NQH A;  3BPS A;  2D6N A;  4EN9 B;  2LM3 A;  2PXJ A;  2FQP A;  2JEN A;  1QJZ A;  2JDY A;  2A73 B;  4YNI A;  4BMB A;  3RI8 A;  4XAB A;  5FOB B;  1AHS A;  5C4W B;  2FCU A;  1G6N A;  2XUM A;  4DUW A;  2Q8O A;  1K5M A;  3DPR B;  2UWA A;  3CL1 A;  2D3R A;  3VZJ A;  1JZ2 A;  5FRA A;  1AL0 G;  4AED B;  1WCD J;  1XBF A;  2XJS A;  3NAP B;  4CDW B;  3O14 A;  2P34 A;  4YWA A;  4M01 A;  1LOB A;  5LBC A;  2PHR A;  5C9A A;  3V64 A;  4QB1 A;  1Z7S 2;  2D98 A;  3R4S A;  3MFC A;  5HV0 A;  5G05 L;  3C7O A;  2HJI A;  1S55 A;  2WBK A;  5JIU A;  3DKW A;  2DTY A;  4FFG A;  1XSQ A;  4X8P A;  4FAH A;  5FZ7 A;  1CAV A;  2JD9 A;  2BGO A;  2RHP A;  4URA A;  2EF6 A;  1LB2 A;  5H9Q A;  3VBF B;  3I49 A;  4FO9 A;  3E5U A;  2VW2 A;  4QDS A;  4FOW A;  1AYM 3;  3DXT A;  3TEZ A;  2VU9 A;  5LB6 A;  1OI6 A;  1ZVF A;  1D4M 1;  4LBM A;  1QDO A;  4V1P A;  2Z4F A;  1PGL 1;  1QDC A;  1COV 3;  4M0N A;  4JAA A;  3SCF A;  3ZXG A;  5KXE A;  5GM0 A;  4WZF A;  1RUG 3;  5JI7 A;  1WZX A;  2KXL A;  2ZCW A;  5FPL A;  1G9C A;  5F5Q A;  1IKQ A;  1AX0 A;  2CGN A;  2VY0 A;  2DVG A;  3WDW A;  5A3U A;  3PHM A;  4JDO A;  4XYX A;  1WW7 A;  3VL8 A;  4XZU G;  1W03 A;  2PAE A;  2QQV A;  2X8K A;  1JYC A;  4BCU A;  2JKB A;  1F8V A;  3E5Q A;  1LTE A;  2PLV 2;  2VM9 A;  4XJ9 A;  5F5C A;  5K0U A;  5JPM B;  3W9A A;  3I54 A;  4GB3 2;  3ASI A;  1UQX A;  5FAX A;  3N9M A;  3PJY A;  5IWF A;  3VBU A;  1W9S A;  3N7M A;  3HQU A;  4GB3 3;  3SKV A;  3TN9 1;  4Y5T A;  2R30 A;  3KZ4 C;  3JB8 A;  5FQ0 B;  3WCR A;  5DUV A;  2JG9 C;  3ILR A;  3OUJ A;  4YVW C;  3JD7 2;  4RS5 B;  5DAX A;  1RUH 2;  1O3T A;  3VKL A;  3BCW A;  4IV3 C;  5FK8 A;  3RQ0 A;  3T0A A;  1OBN A;  2HWF 3;  5K9Y A;  4QWN A;  3AP5 A;  1FI2 A;  1MAC A;  2WII B;  1RL3 A;  5FPV A;  1BEV 3;  1F4H A;  2ZX0 A;  3K46 A;  2E31 A;  3BN6 A;  2I45 A;  3N36 A;  4LPL A;  1PVC 2;  4OZO A;  3SLI A;  1FT9 A;  3T30 A;  3ITQ A;  2ERF A;  1GQH A;  3MI8 A;  1RUJ 3;  3LOB A;  4ISR A;  2BDR A;  1CAV B;  1PVC 3;  3T08 A;  4YSF A;  4LNV A;  4P9W A;  3SCG A;  5A32 A;  3IDB B;  1TQ5 A;  4QT6 A;  1MS5 A;  4FFI A;  2VO5 A;  5JMC A;  1US3 A;  1K3I A;  1SDD B;  1FMD 3;  1AYN 1;  3ROU A;  1GWM A;  4K1Z A;  4KGG A;  4Y4Y A;  2A6V A;  5FY7 A;  3THT A;  4AVA A;  4FTE A;  1ODM A;  1XOY A;  2Y34 A;  3ORJ A;  3D6E A;  3BB6 A;  1HXS 1;  4HT1 T;  3MV0 1;  1FXZ A;  2QJV A;  1W9Y A;  2WLQ A;  1XE8 A;  3AKR A;  3M2M A;  5CFC A;  1GZT A;  1RUC 1;  4Y5Z 0;  1DQ5 A;  4N8M A;  2WQZ C;  4A44 A;  4OI0 A;  2CNA A;  1OH4 A;  1NAE A;  4Y4R A;  1CX4 A;  1VBE 1;  5A80 A;  3OCP A;  1NT0 A;  3WSO A;  1LOE A;  4QAW A;  3KHC A;  2NN8 A;  2VZP A;  2KD7 A;  3J8F 2;  4BQ3 A;  4LBL A;  2RS1 3;  3ZYP A;  4Q4Y 2;  3HOB A;  2CL2 A;  4E9K A;  1WUV A;  2HWD 1;  3PTR B;  4COU A;  1QOT A;  5KXC A;  1DLL A;  2FCT A;  3AL5 A;  3W20 A;  5IVJ A;  2XOM A;  1PO2 1;  2XLA A;  2UU8 A;  4Q4Y 1;  2OUJ A;  5IK7 A;  1YXW A;  2BGC A;  2JE7 A;  1VBC 3;  1H9W A;  3OF1 A;  2XBO 2;  2HWE 1;  2RE9 A;  2RS3 2;  4ZZ8 A;  2ZZJ A;  2UYA A;  4G4F A;  2W92 A;  3NST A;  2AYH A;  3BTY A;  4YZ4 A;  1Z7S 3;  2FDK A;  1YQ2 A;  1GMM A;  2WFF 2;  3IN9 A;  1A8M A;  2WJS A;  3RGB A;  1HRV 1;  2RS3 1;  1XRU A;  4IEZ A;  2XL9 A;  5BNO C;  1F31 A;  3QOP A;  1NCQ A;  1W9W A;  4KBZ A;  2ZKN A;  4JZR A;  2YRO A;  2YU1 A;  1IOA A;  2OPK A;  1HB3 A;  2ZGK A;  3C7H A;  2HYK A;  1KDK A;  1Z0H A;  3E6B A;  4AEM A;  2P3J A;  2VC9 A;  4CDU A;  5C3Q A;  1CAX B;  2HKX A;  3B7M A;  4R9A A;  3ZYJ B;  3LCP A;  2BFU S;  1H8T B;  3ACG A;  4W4Z A;  4WVW A;  3MEP A;  5E89 A;  4YLZ A;  4MGI E;  4YZ2 A;  2QKD A;  4BHP A;  2CHH A;  1S0G A;  1O5U A;  1Y9Q A;  4ARX A;  3GJB A;  5IUQ A;  3GDB A;  4A6O A;  3MW4 A;  3O1O A;  3SCH A;  2NZ9 A;  3ZN6 A;  1QOS A;  2D3S A;  2EAK A;  2XDV A;  5BXX A;  2HLE A;  2D6P A;  3FC0 A;  1E5S A;  3F95 A;  1S0D A;  4LIU A;  1UWW A;  1F4A A;  3EYP A;  3ZXJ A;  1S0F A;  2G9Z A;  2VZ1 A;  1JYI A;  1J1L A;  4PDW C;  1OOP B;  1B35 C;  4YG6 A;  4B1M A;  1NUK A;  1R09 1;  4NJ4 A;  3ZYF A;  1LNS A;  3GAL A;  5HBA A;  1UY2 A;  4ZPI A;  4QX8 A;  4QPG A;  1U5Y A;  2ZGN A;  1O8S A;  4OYU A;  4DY3 A;  1PK6 C;  5IYY A;  1Q3E A;  1MZE A;  1QGL A;  1RJ7 A;  1YFW A;  4H14 A;  4XUQ A;  3APB A;  5GLV A;  1K12 A;  3RZZ A;  3UKT A;  2Y6L A;  4XET A;  4E8C A;  2XVL A;  3AK0 A;  1UXX X;  5I0U A;  4UW6 A;  4QU2 A;  4CUC A;  1RJ8 A;  1VMH A;  3HD8 B;  3PUA A;  1S1A A;  4P9L A;  2BQP A;  3ZDS A;  3WNK A;  5EYX A;  2YMZ A;  3A4U A;  1S0E A;  3AMN A;  3JD7 1;  1H2N A;  3H3U A;  4FPY A;  3TEY A;  4U36 A;  5ACA 1;  1MQT B;  1D2S A;  1ZM1 A;  3NNJ A;  1V6I A;  3KMH A;  3RYR A;  2ZMN A;  3K48 A;  3WUD A;  4AED A;  2VG9 A;  3ENR A;  4D6S A;  1STM A;  5DXD A;  4B3N A;  1WBF A;  4UYB A;  1J3Q A;  5DQ0 A;  1KRI A;  4YZ1 A;  3FUQ A;  3PDQ A;  2CGO A;  3LPF A;  5FXX A;  1VBA 2;  5HCA A;  3M7A A;  2VOT A;  1ULE A;  4O7X A;  2P4E A;  1QJY 2;  2Z5W A;  2IXL A;  2NLR A;  1DZT A;  4KG8 A;  4NIG A;  1GNZ A;  4GB3 1;  1VAK A;  2G19 A;  3KQ4 B;  1W3V A;  4HSJ A;  4OVE A;  3H1W A;  5JR7 B;  4DXT A;  3ZXK A;  1I6X A;  1XJA A;  5J36 A;  1JYT A;  2MEV 1;  4MXW A;  1AYN 2;  2PHF A;  4HN0 A;  2BYV E;  5C8C B;  5JI9 A;  1CWP A;  4FOY A;  2VTF A;  2D40 A;  5IAX A;  1DGW A;  1WW5 A;  3GNE A;  3WW3 A;  3POS A;  3T4V A;  3Q8E A;  1XC6 A;  4LKS A;  1L7L A;  1LU2 A;  1UY1 A;  2PHD A;  5FYC A;  1ND3 C;  5DAB A;  1AL2 2;  4AF9 A;  1AR7 3;  3HQR A;  3M3C A;  1ZZ7 A;  1V6K A;  1DGR N;  4WM8 C;  4OMD A;  3TBD A;  1AL2 3;  4Q8L A;  2B8M A;  3DV8 A;  1K5M C;  1QXR A;  4D6Q A;  1ZRE A;  1G9F A;  1XB9 A;  3O1U A;  2JKX A;  4LBO A;  2JDP A;  1JU3 A;  2HWE 3;  3RFR A;  1T6B X;  5ACA 2;  2ID4 A;  3WY6 A;  2W91 A;  5C71 A;  4XVH A;  4Q4Y 3;  3KHB A;  1PM7 A;  2Y6G A;  1JBC A;  5T52 A;  2GC2 A;  4C1X A;  1QJU 1;  2VNO A;  3PU8 A;  4CUG A;  2DCZ A;  1OLM A;  1CIW A;  2HBU A;  3OD0 A;  3KV4 A;  1C5H A;  4CDU C;  1WA4 A;  3GJA A;  1WLC A;  2R1B A;  2GH8 A;  3CHX A;  3P6B A;  3EBR A;  5ISL A;  1RMU 3;  4Y1V A;  1K5J A;  1UIK A;  2EXH A;  1ULO A;  2HEW F;  4AQ2 A;  3OGG A;  2WFF 1;  2IC1 A;  4GMP 1;  5BNP A;  2R07 2;  1OFS A;  1UYP A;  5FZI A;  2CU5 A;  1OOP C;  4F3J A;  2PAK A;  2H6B A;  4RS5 A;  1UOF A;  4GH4 C;  3CMG A;  4NRM A;  2E7T A;  2JX9 A;  5HI0 A;  3PVE A;  4XDP A;  5FMO S;  1OF4 A;  5B2G B;  2VBB A;  4KNC A;  4W8J A;  3H1Y A;  1TMF 2;  4QQ2 A;  4FAG A;  4Z8B A;  3INA A;  2QTW B;  5F1R A;  5FCC A;  5I91 A;  1UZZ A;  5FKC A;  3IT8 A;  3JUU A;  3WG2 A;  3S30 A;  5KXD A;  3ZM8 A;  2WA4 A;  3UKV A;  1EAH 1;  1YI7 A;  3DN7 A;  4IW3 A;  4GUL A;  4LBJ A;  4QQL A;  4X6Q B;  4OI1 A;  5AC9 3;  1BKZ A;  1LEC A;  3TAY A;  4M3C F;  3VBU C;  3WF2 A;  3RSJ A;  1HX6 A;  1Y9M A;  1FV2 A;  4MXV A;  4W6X A;  1GBG A;  5JVV A;  4DUX A;  5FZB A;  1U12 A;  1NA1 C;  1WMX A;  4N53 A;  1Q8P A;  4JRA A;  4RR3 C;  4MET A;  2XR4 A;  2JDU A;  4LK6 A;  4YAR A;  2W87 A;  5AC9 1;  5DAP A;  4I30 A;  1M4W A;  3A23 A;  2RM2 3;  3VD4 A;  3LEK A;  4Q5O A;  4Q0U A;  1TME 3;  2BRT A;  3AZZ A;  2JG9 A;  2RM2 2;  4YVW A;  4CEY B;  4LBQ A;  3H8X A;  1RIR A;  5L36 A;  3CO2 A;  1W9F A;  4XF9 A;  1O3S A;  4IV1 B;  2YHJ A;  4HMZ A;  4IGP A;  2GN7 A;  3I3B A;  1W90 A;  3R4U A;  4DIQ A;  3OGS A;  5EHD A;  2LRO A;  5L7O C;  2ZGO A;  5K0U C;  3HNB M;  3T0B A;  1HV0 A;  3HNM A;  2JIG A;  2EIC A;  2WFP A;  4FCA A;  1IQA A;  2ZX2 A;  4GMP 0;  3BTZ A;  4XQ4 A;  1Y4W A;  3PVO A;  1H2M A;  3SH5 A;  1PMJ X;  2WZP P;  1GLH A;  2NPI A;  3CKH A;  4LHK A;  1OLR A;  2LAL A;  1DQ4 A;  4Q29 A;  1VAL A;  5FPZ A;  4IE5 A;  2JDA A;  2RG4 A;  1IZ3 A;  2Q8C A;  4BH9 A;  5J37 A;  3RDI A;  3O7O A;  2Q1F A;  4CSW A;  4LHN A;  4XUP A;  5JZG A;  4JTN A;  4Z2W A;  1B35 A;  3B9C A;  3ME2 A;  5EPA A;  5FJH A;  5KC6 A;  1C28 A;  2UWB A;  2GNM A;  3RS6 A;  4PBP A;  3VDC A;  1V6N A;  4S2F A;  2ZEX A;  4JRL A;  4Y33 A;  1LOF A;  4DPN A;  4LE3 A;  3WD5 A;  4QHZ A;  4ZXE A;  2ZEY A;  3GF6 A;  2YC4 A;  2IVJ A;  3RZM A;  3AKP A;  5IT6 A;  1JYN A;  3TEX A;  5LY2 A;  1C1L A;  4JDM A;  4Y3O A;  1YJL A;  2JB4 A;  2SBA A;  3KT4 A;  4Y1X A;  4LO5 B;  3TYJ A;  4BLI A;  1CAU B;  3EO6 A;  4CU6 A;  1VP6 A;  1DP0 A;  3JZV A;  2XUE A;  4B7K A;  2ZTN A;  5CKN A;  4UFL A;  5BNP C;  1C57 A;  1OLQ A;  3ZLI A;  3PUI A;  1P8J A;  4RGA A;  5A3P A;  3KQR A;  4BPZ A;  4FPF A;  5FPA A;  1ZZ9 A;  5A70 A;  1DQ0 A;  4E27 A;  3LF7 A;  2JDK A;  2JDH A;  4IET A;  5C5T A;  1O7F A;  2C6S A;  2GDF A;  1ENS A;  2DCK A;  4HVQ A;  5FZO A;  2GMM A;  2VOX A;  1FMD 2;  2A70 A;  4CCK A;  1DGR A;  2YPD A;  3GZU C;  5IVV A;  4Q0Q A;  1V9U 2;  3RYK A;  4JV4 A;  1W6O B;  4QPI C;  3U1X A;  4EN8 B;  2PQS A;  4OQ9 A;  5LBE A;  1O4Z A;  2Z42 A;  1AXZ A;  5FLJ A;  4CVU A;  5CYY A;  1SBE A;  2XLG A;  5A33 A;  3J8F 3;  3KF5 A;  3VKM A;  2XL7 A;  5HCH A;  3H7Y A;  4WM8 A;  3ZFF C;  1HB2 A;  2F4P A;  5GLW A;  4XF1 A;  3ZDV A;  3ZFG A;  3AMQ A;  4O9E A;  4K7J A;  4QKD A;  2W3J A;  4WZC A;  2ZGR A;  3U07 A;  4R9B A;  1N47 A;  4XMI A;  3R4D B;  3KD4 A;  4QHB A;  1N1Y A;  2YC2 A;  3O1R A;  1W2U A;  2R07 1;  3ILF A;  3FMG A;  3R6S A;  2X10 A;  1DU3 D;  2Y6F A;  3GZE A;  2YUE A;  1SCS A;  1L7R A;  3OSD A;  3ST7 A;  3TNQ A;  4ES9 A;  4PLM A;  4A42 A;  1SBF A;  1VBC 2;  2OII A;  4XUT A;  1FNZ A;  4M4P A;  2Q8E A;  4C1W A;  5LCW L;  1XXN A;  1EAH 2;  2JDN A;  5CAD A;  2QCS B;  2QQW A;  1LOC A;  4JGZ A;  1VLN A;  5FO7 B;  4ARY A;  4JDN A;  3ACI A;  4UAP A;  4I0W B;  4RQP C;  2IZW A;  3MGU A;  1XQN A;  2ZEW A;  4KU7 A;  4UI9 L;  2DV9 A;  3FL7 A;  1OT5 A;  1OKO A;  2FZ2 A;  1H0B A;  1NY7 2;  5FZC A;  3VBF C;  3I59 A;  3MUZ 1;  3OBR A;  2Z69 A;  3FE5 A;  3H3L A;  3ES4 A;  1UU5 A;  5FMC A;  3WP5 A;  4D3W A;  2WZR 1;  1H9P A;  2DDU A;  1WCQ A;  4QGN A;  4QM9 A;  1R09 3;  2A3X A;  1TVG A;  2JIC A;  3KGZ A;  3QLQ A;  3B69 A;  2VOW A;  3RI9 A;  4ES8 A;  5A1L A;  2XBO 1;  3CJI C;  4FTS A;  1EUT A;  1KXG A;  3VBS C;  2J1S A;  1RUG 2;  2I07 B;  1NE6 A;  2UUR A;  5CIS A;  3I2H A;  4N9H A;  3VUO A;  1QJX 1;  2X29 A;  3DEM A;  4CYD A;  3CBN A;  3I3Q A;  1AYM 1;  4D69 A;  1KQR A;  4FPO B;  1W28 A;  4E4D X;  3BGA A;  1UOG A;  2HWC 2;  3CLP A;  2ZML A;  4OHX A;  3LWC A;  4UBH A;  2GND A;  3LDR A;  3VHP A;  4K6B A;  3WQ1 A;  2V4A A;  2O8Q A;  1ASJ 2;  2VQT A;  4LHS A;  5JZG C;  4Q4X 1;  1MS3 A;  2JJ6 A;  3J7M A;  3MIH A;  4IDZ A;  1GUI A;  2VQA A;  2W1Q A;  1LCL A;  3KT7 A;  5F3E A;  4CRQ A;  5AVA A;  4DFS A;  5JSO A;  5H9P A;  4PIZ A;  4NMI A;  4Y1Y A;  5A7W B;  3SXW A;  4Q4X 3;  3LSE A;  4IXL A;  5FXW A;  2F17 A;  1OMI A;  3W5N A;  1IS6 A;  1PIV 1;  1LR5 A;  1VBD 3;  2MNG A;  2ARB A;  2GMP A;  2OS2 A;  4NWV A;  3WNM A;  4E2Q A;  4J6G A;  2LRP A;  1CIY A;  3TB0 A;  3T2Q A;  1DBN A;  1OKQ A;  5DMY A;  5LY1 A;  1BZW A;  2WS9 1;  3NJX A;  4MGS A;  3VBS A;  2PHT A;  3LD8 A;  1PIV 3;  3M3I A;  4NO4 A;  1JZ3 A;  3O1T A;  1WMD A;  4XOG A;  1CZT A;  5I0S A;  3AYE A;  1NZI A;  2YYO A;  3AKT A;  4GZ9 A;  4KL1 A;  4Q4V 1;  4M0H A;  1UY4 A;  2R1D A;  1AYN 3;  3UT0 A;  1WA6 X;  2C0Z A;  2VZR A;  2XHN A;  4BK5 A;  4AFD A;  2WAB A;  1DYK A;  5EP9 A;  4BQ4 A;  4AAX A;  4ZU7 A;  1AR6 2;  2OZJ A;  3AJY A;  2WQ8 A;  1H2K A;  1ULC A;  4YFZ A;  2JEC A;  5HXV A;  1DYP A;  4XCA A;  4PDW B;  4XJW A;  4D94 A;  1ND2 C;  1PVX A;  1JOD A;  4NWW A;  2VZU A;  2XJR A;  5BNP B;  3S57 A;  4N43 C;  3LGR A;  1W99 A;  2O8O A;  4JKK A;  2G9F A;  4IND A;  1JOJ A;  5FP7 A;  1SFP A;  1J3R A;  2HWE 2;  2VXR A;  2DUQ A;  4IEQ A;  3LZZ A;  4DQA A;  5A6X A;  2OT7 A;  2J1V A;  1HXS 2;  1QH6 A;  1NCQ B;  3OY8 B;  2AZ5 A;  4PIX A;  2PMW B;  4KG0 A;  1BYH A;  1IPJ A;  1DCS A;  1XNT A;  1W2N A;  4XJ8 A;  3O1M A;  4HXC A;  4GKY A;  4XFB A;  1GYK A;  3NRU A;  5T5P A;  5JXJ A;  4AVB A;  4CP1 A;  3NNF A;  2VVF A;  3SHR A;  1YYN A;  2J22 A;  1ZYB A;  2J1U A;  3EHK A;  5BNQ A;  2IUW A;  3HQX A;  1ZX5 A;  3H7J A;  3M8L A;  1W2A X;  3T2P A;  2TUN A;  3NV1 A;  1FPN 2;  1RUF 2;  2ORZ A;  2YV8 A;  5KHH A;  1QHD A;  2NYY A;  4M3C B;  4P9J A;  4YW4 A;  3VN4 A;  3ZO0 B;  4BIO A;  1XNK A;  1RGS A;  4I3P A;  4AFC A;  4AI0 A;  2GH2 A;  4TTG A;  1MR5 A;  5FZO B;  5JIA A;  3A21 A;  2BGP A;  1C3H A;  3P5B A;  3RWK X;  2QZ2 A;  1ZA7 A;  1KGY A;  3RZG A;  3WHU A;  5LA9 A;  1TMF 3;  2HEY F;  2QFE A;  5GKA C;  3ZR5 A;  2Q5T A;  1CAU A;  2N7G A;  4BDV B;  1ODN A;  4HET A;  5EFU A;  2A75 A;  4FQZ A;  2PN5 A;  4ZS3 A;  1F5F A;  3FFZ A;  3I2G A;  5FTT C;  3ETQ A;  1DGW X;  2BUK A;  2X5I C;  4CP9 B;  2FDF A;  3P1I A;  1W0O A;  1UZY A;  4HPK B;  4BIF A;  1LES A;  4PHZ A;  4QPG C;  1UZW A;  1WD4 A;  2J42 A;  3B3Q E;  1PGS A;  4F83 A;  4QKN A;  3I2K A;  3H42 B;  2RJ2 A;  5JMO A;  3M3E A;  1AJK A;  1SEF A;  1BK0 A;  3K3O A;  1OA4 A;  5JCT A;  3CZU A;  1I5P A;  1W6M A;  2ES3 A;  1XE7 A;  2KM2 A;  5JZG B;  3CU7 A;  1COV 2;  3QCW A;  2AEZ A;  2YC0 A;  3KV6 A;  1WD3 A;  2Q0A A;  1HKD A;  1SAC A;  2V5D A;  2ET1 A;  1ASJ 3;  3PUQ A;  4PCR A;  4XE9 A;  4H55 A;  4I09 A;  1KS5 A;  2RS5 3;  3U4S A;  2GP5 A;  3CJI B;  3AMP A;  5A6Z A;  5HPO A;  1COV 1;  1Q43 A;  2ZOE B;  2A5Z A;  1LOG A;  1NA1 B;  2EAA A;  2RS5 2;  1UX7 A;  4XHX A;  1DZR A;  1RHI 3;  2E9Q A;  2WO3 A;  5FZ8 A;  4M3C E;  2E6V A;  3ZXF A;  3JU9 A;  3LEM A;  4Q0V A;  4LA2 A;  5EQU A;  4EN0 A;  1J3P A;  1JMU B;  3ON7 A;  5LK5 A;  3VHO A;  1KIT A;  2WNV A;  4GH4 B;  1RXG A;  1S0J A;  4GA9 A;  1NLQ A;  5JOW A;  2R06 3;  5F6L B;  1VBD 2;  4TXW A;  4LBN A;  4XXP A;  5LA2 A;  1U5Z A;  2WZR 3;  4L8Q A;  1VRB A;  2QQO A;  5JXI A;  3IBM A;  5IJR A;  2WS9 2;  3C7F A;  1EV1 2;  2EXK A;  5BPX A;  3C7E A;  1JOB A;  2PHW A;  4IQP A;  3LB9 A;  1HDK A;  5FLI A;  4UW5 A;  2HWB 3;  4RFT 0;  3G6J B;  5C4W A;  2ZKL A;  3VD3 A;  4HKO A;  4DNY A;  2WKK A;  5FZH A;  3ZSK A;  4K40 A;  3KWV A;  4L92 A;  1UOB A;  2Z2S B;  1JTZ X;  4RR3 A;  4XFF A;  1RUH 1;  5FYZ A;  4ZHN A;  3ZYG A;  1T2X A;  1QXJ A;  4XIL A;  1W2O A;  4YGB A;  3UET A;  2XPJ A;  2OQ7 A;  4NPM A;  4QX1 A;  4OUL A;  5D8A C;  3WQ7 A;  1M06 G;  4HPK A;  3NNG A;  4LTA A;  3ZYI B;  3VBO C;  2C26 A;  3ZFG C;  1XYP A;  2J7M A;  4UFH A;  3RJ2 X;  5EZW A;  2LUW A;  1PO1 3;  2J1E A;  2ZHK A;  3ABZ A;  4KBB A;  4IEY A;  3HBK A;  4XQW A;  1OD3 A;  2IFW A;  2ZX4 A;  5APA A;  1UIJ A;  3AP7 A;  4Q1R A;  2RV9 A;  4AVT A;  1YI9 A;  1G86 A;  1GOF A;  2E26 A;  3AC0 A;  4Y20 A;  1FV3 A;  5T50 A;  5FYV A;  5BYN A;  2VMG A;  4LHL A;  2QQJ A;  1NQD A;  1W8T A;  2UYB A;  3POI A;  5FPB A;  3WDT A;  2OZ6 A;  1C5I A;  1LKN A;  3NV3 A;  4QX2 A;  5F3I A;  1WWY A;  2YU2 A;  3ZVX A;  3CNA A;  3KGL A;  3THC A;  4AG4 A;  4CU7 A;  5A33 B;  4MYE A;  1W6Q A;  5J48 A;  2XON A;  1REE A;  3LOI A;  3H0O A;  3I2J A;  4C90 A;  4ERO A;  4LJH A;  2E32 A;  3SC7 X;  3THP A;  4EZH A;  2R07 3;  4HSL A;  5ANQ A;  4LK7 A;  1Y7B A;  2GNB A;  2EAL A;  2AUY A;  3MW3 A;  2Y60 A;  3J8F 1;  2A71 A;  2FCV A;  3PLQ A;  4CCE A;  4QKB A;  1ZRF A;  2ARE A;  2WA3 A;  4H2A A;  4B4R A;  2JWP A;  2FZ1 A;  1H6Y A;  4B1L A;  4UFI A;  2DVA A;  3MPB A;  1L7Q A;  3IM0 A;  2BNM A;  4J25 A;  2DTW A; 
#chains in the Genus database with same CATH homology
 2Y8K A;  3WF4 A;  4A45 A;  3K75 B;  2JKX A;  5IFT A;  1JU3 A;  3WNN A;  4PQQ A;  2LS6 A;  2ID4 A;  2EIB A;  1JYW A;  3FN9 A;  2W91 A;  5C71 A;  4XVH A;  1IQD C;  4DXS A;  2Y6G A;  3GXU A;  3LEG A;  4CU9 A;  2QQL A;  2W46 A;  4RYD A;  1GOH A;  2VMD A;  1UY0 A;  3CIH A;  3T09 A;  4XUO A;  5A1A A;  3P6B A;  1ULO A;  1CZV A;  1XPW A;  1GNY A;  3WF0 A;  3CMG A;  1OF4 A;  3CZJ A;  4W8J A;  4JHZ A;  4QX3 A;  1JZ4 A;  2QQK A;  3JXS A;  2J1T A;  3ACF A;  1H6X A;  1UMH A;  3ZM8 A;  5EJZ B;  3EB7 A;  5J1X A;  1JI6 A;  1DYO A;  3PUH A;  5B4N A;  3WF2 A;  4M4R A;  1JYX A;  4KI5 M;  3SEE A;  1KEX A;  4DUX A;  1PX3 A;  3D3A A;  5G04 L;  3SKJ E;  1W9T A;  2W87 A;  1EUU A;  3OGV A;  3A23 A;  3VD4 A;  4XUR A;  3LEK A;  3WEZ A;  2YB7 A;  2JE8 A;  4GWI A;  4PT6 A;  2VCB A;  3I2F A;  1K42 A;  2L9L A;  1W8O A;  1DLC A;  3I3B A;  4MAD A;  3OGS A;  3THD A;  4ZZ5 A;  3HNB M;  3SEP A;  1SG3 A;  2WN2 A;  3HNM A;  4OUE A;  3T0B A;  2EIC A;  4RN5 A;  1PMJ X;  3CKH A;  4CU8 A;  2X05 A;  2VZS A;  2VMF A;  5EJ1 B;  2B9V A;  3DEC A;  2JDA A;  3CQO A;  4A41 A;  4XUP A;  2J1R A;  2VCA A;  4FI9 A;  2VJX A;  2BER A;  3VDC A;  3OEB A;  3W5M A;  2X09 A;  2ZEX A;  2EID A;  1O59 A;  5DN2 A;  4ZXE A;  2ZEY A;  2YC4 A;  5CZK A;  2Y6J A;  1JYN A;  3VDA A;  1K45 A;  1JYV A;  2V72 A;  2VZQ A;  3DYO A;  3K4Z A;  2BBA A;  4CU6 A;  3FHA A;  1DP0 A;  2CDO A;  3OBA A;  3HN3 A;  4D8M A;  1JZ8 A;  3C8X A;  3PUI A;  1P8J A;  5C70 A;  4UOJ A;  4BXS V;  2VME A;  3CDZ B;  3I3D A;  1J84 A;  1PMH X;  4MOA A;  3DYM A;  3OEA A;  2DCK A;  1W0N A;  5JXG A;  3I97 A;  2V4V A;  2C4X A;  3MV1 1;  2VCC A;  2PQS A;  4CVU A;  5CYY A;  3UES A;  4HG6 B;  1CX1 A;  3A22 A;  3WF1 A;  2OKX A;  5JR2 A;  2W95 A;  4DEQ A;  2VMC A;  4QB6 A;  2W3J A;  4DUV A;  5IFP A;  2YC2 A;  1MPX A;  1GQP A;  5EIY B;  1TG7 A;  2X10 A;  1L7R A;  1WKY A;  4JKM A;  4LQR A;  3VDB A;  4A42 A;  5FUI A;  1BHG A;  4QB2 A;  4XUT A;  4M4P A;  4P5Y A;  2VQU A;  2WAA A;  2VZO A;  4ARY A;  3ACI A;  2J1A A;  4UAP A;  4P02 B;  2ZEW A;  1NX9 A;  4UI9 L;  1JZ6 A;  3FL7 A;  1OT5 A;  4BJ0 A;  3ECQ A;  3VD9 A;  3WNP A;  3MUZ 1;  1W8N A;  3HNY M;  4MGQ A;  4D0Q A;  4OMC A;  3NJV A;  2WDB A;  2QQM A;  2DDU A;  1WCQ A;  3K77 A;  3NQH A;  1TVG A;  5JXH A;  4MO3 M;  3LE0 A;  1EUT A;  2J1S A;  3I2H A;  4DUW A;  1JU4 A;  4QDQ A;  3UNP A;  2VZV A;  2ZEZ A;  1JZ2 A;  3MO4 A;  3BGA A;  4L0P A;  5LA1 A;  1PX4 A;  5LA0 A;  1US2 A;  4BK4 A;  4QB1 A;  2VQT A;  4LHS A;  5G05 L;  2WZE A;  4DXR A;  3C7O A;  2WBK A;  3K4D A;  1GUI A;  2W1Q A;  5HXM A;  5F7U A;  2BZD A;  2JD9 A;  2BGO A;  1SHW B;  4P08 A;  3W5N A;  1HN1 A;  4QDS A;  1CIY A;  4CUA A;  2Y6K A;  3F2Z A;  3T2Q A;  5DMY A;  2Z4F A;  3NJX A;  4MGS A;  1JZ3 A;  1UXZ A;  2W47 A;  4QX0 A;  2WO2 A;  3III A;  1CZT A;  2R7E B;  5JUV A;  4GZ9 A;  4QPW A;  1JHJ A;  1UY4 A;  4XZU G;  1NKG A;  2VZR A;  2XHN A;  4BK5 A;  2WAB A;  4JKL A;  4AAX A;  4XUN A;  3WNL A;  2VM9 A;  2Y6H A;  3OG2 A;  2WQ8 A;  4KWU A;  1W9S A;  1D7P M;  3SKV A;  2VZU A;  1GU3 A;  3IAP A;  4PF1 A;  1W99 A;  4IUG A;  1ULP A;  3GGL A;  4JKK A;  3C7G A;  2QQI A;  2WYS A;  4ZY9 A;  3HJR A;  3IB3 A;  1O8P A;  5DPN A;  3T0A A;  3T0D A;  2ORX A;  2J1V A;  3E1F 1;  2WO1 A;  2VL4 A;  2EIE A;  1F4H A;  3OGR A;  3K46 A;  3K4A A;  2E31 A;  3BN6 A;  3MUY 1;  1XNT A;  4LPL A;  4OZO A;  5I0D A;  4E8D A;  3NRU A;  5JXJ A;  3T08 A;  2QBX A;  2J22 A;  2J1U A;  2VO5 A;  1US3 A;  1K3I A;  1SDD B;  3VD7 A;  3T2P A;  3WNM A;  2ORZ A;  3IAQ A;  4ET7 A;  4TTG A;  2W5F A;  4A3Z A;  3A21 A;  2BGP A;  4P00 B;  1RYY A;  3WF3 A;  3WNO A;  3MV0 1;  3WQB A;  3LEI A;  1KGY A;  1UMI A;  1UYY A;  4BDV B;  4Z2A A;  4A44 A;  1OH4 A;  1NAE A;  3WSO A;  4QAW A;  3I2G A;  2VZP A;  3HEI A;  2KD7 A;  2VR4 A;  3P1I A;  5B4X A;  3HOB A;  3VD5 A;  2LW8 A;  3I2K A;  2XOM A;  2RJ2 A;  5JMO A;  3CZU A;  1I5P A;  2W94 A;  2B4K A;  2WUH A;  4ZZ8 A;  2WAO A;  2W92 A;  4KMQ A;  4A4A A;  2V5D A;  2E33 A;  1UYZ A;  1YQ2 A;  1GMM A;  2VZ3 A;  3U37 A;  4DEV A;  2YFZ A;  5LCW L;  2W1S A;  5HPO A;  5C7G A;  1JZ7 A;  3ETP A;  2WZ8 A;  1UX7 A;  2WN3 A;  1W9W A;  2WO3 A;  3MBW A;  2W1U A;  3C7H A;  1CZS A;  2W9X A;  2VC9 A;  3LQC A;  3ACG A;  4TXW A;  3ACH A;  4W4Z A;  5LA2 A;  4GWJ A;  1UYX A;  2HYX A;  2QQO A;  5JXI A;  4ARX A;  5IJR A;  3GDB A;  3C7F A;  4A6O A;  3C7E A;  1JZ5 A;  2CDP A;  2HLE A;  3VD3 A;  1R64 A;  2VZT A;  1UWW A;  1F4A A;  3EYP A;  2VZ1 A;  2XQX A;  3HPN A;  5IHR A;  2DCJ A;  1T2X A;  4W50 A;  1NUK A;  3FHQ A;  3UET A;  1LNS A;  4QX1 A;  1UY2 A;  1GOG A;  2Y64 A;  3NNG A;  5IYY A;  1O8S A;  4OYU A;  2C26 A;  3I2I A;  2J7M A;  4XUQ A;  1XNA A;  1K12 A;  2Y6L A;  4E8C A;  2J1E A;  2YG0 A;  1UXX X;  3A7Q A;  4CUC A;  3IDA A;  3ABZ A;  3WNK A;  3J7H A;  1OD3 A;  2RV9 A;  1GOF A;  2E26 A;  3AC0 A;  2QQJ A;  4JX0 A;  1J83 A;  4QX2 A;  5DQ0 A;  3THC A;  4AG4 A;  4CU7 A;  3LPF A;  1OF3 A;  2VOT A;  2XON A;  3I2J A;  4QDR A;  2RVA A;  3OB8 A;  2W1W A;  3LPG A;  4DXT A;  1UY3 A;  4CUB A;  2E32 A;  2YFU A;  2C9K A;  2ZXQ A;  2VTF A;  3T2O A;  3DYP A;  1XC6 A;  4LKS A;  1UY1 A;  2QQN A;  1H6Y A;  3I3E A;  1L7Q A;  1UZ0 A;  3GM8 A;  4OMD A;  4YPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...