2V4VA

Crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
QSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYTVYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTVSGVTGKHDVYLVFKGDSGYLFNLNWFTFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GH59 GALACTOSIDASE
publication title Analysis of the Structural and Functional Diversity of Plant Cell Wall Specific Family 6 Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2v4vA00
3WNMA 1T2XA 1US2A 3ACGA 1P8JA 1SDDB 4JX0A 4IUGA 4YPJA 3VD5A 4A4AA 2WABA 3A7QA 3K46A 2V5DA 5C7GA 4HG6B 1NX9A 4LKSA 1NUKA 3GXUA 4DXRA 3GM8A 2WQ8A 1GOGA 2ORXA 3PUIA 5CYYA 4A42A 4A6OA 3E1F1 4CU9A 3I3BA 3MV11 3WF0A 3MO4A 1CZVA 2WN3A 3BN6A 4BXSV 3LEIA 4W50A 2EIBA 2VZRA 5JXIA 3SKVA 1O59A 2HYXA 3IAPA 3CDZB 3HNMA 2BZDA 1EUTA 4P02B 2QQNA 4P5YA 2WYSA 4RN5A 4E8DA 4BK5A 3ACHA 3VDBA 2XOMA 3W5MA 1GNYA 5JMOA 3DYMA 3NNGA 4MGSA 1GMMA 2CDPA 1K42A 2J1AA 2B9VA 4DUVA 4CU8A 3K4ZA 2ZEWA 1K12A 2ZEYA 4A45A 3VDCA 1OF4A 1PMJX 1UYZA 3PUHA 1YQ2A 2DDUA 3LEKA 3FN9A 5IFTA 2Y6KA 2W5FA 2X05A 4QDSA 2DCKA 2ZXQA 3T0BA 1F4AA 2ZEXA 3CZUA 3OEBA 4JHZA 3WEZA 4P00B 5JXGA 4ZZ8A 4PF1A 4UAPA 5IYYA 3AC0A 5DQ0A 3I2KA 1DYOA 4BK4A 3DECA 2CDOA 3K77A 2VMCA 1SHWB 4MGQA 5FUIA 5JXJA 4CUAA 3EYPA 1GOHA 1UXXX 2YB7A 1W99A 5EJZB 2R7EB 3WNNA 1DLCA 3IB3A 2LW8A 2VO5A 3HJRA 2WO1A 1GOFA 1D7PM 3HOBA 2XHNA 2VMEA 3HPNA 4ET7A 1ULOA 4MOAA 1OH4A 2BBAA 1CZSA 5IHRA 5DMYA 3CQOA 3OGRA 4JKLA 5HXMA 5C70A 1NKGA 3VD7A 2EICA 3WF2A 5LA0A 3NJVA 4CU6A 4A44A 4BDVB 1XC6A 4L0PA 1JZ5A 3I2JA 2QQIA 2VZTA 3DYPA 3WNKA 4GZ9A 5A1AA 5B4XA 4JKKA 2J1RA 1PX3A 4QX3A 3C7GA 4QPWA 2VC9A 3ECQA 2W1SA 5IJRA 2BGOA 4OUEA 3VD4A 4UOJA 3LQCA 3VDAA 4BJ0A 3VD9A 3D3AA 4QDRA 4TXWA 4CUBA 4A3ZA 5JUVA 1JZ8A 3I2IA 2KD7A 3HEIA 4M4RA 2B4KA 4QX0A 1JZ2A 2ZEZA 2VMFA 4AG4A 2YG0A 3HNBM 3ACFA 2VZ3A 2ID4A 1KGYA 2W46A 2VZSA 1H6YA 5F7UA 2W92A 3WNLA 3CZJA 1JZ4A 2VCAA 2EIDA 3U37A 2XONA 3WF4A 1NAEA 1BHGA 1JHJA 4QB1A 1W9TA 1CIYA 1H6XA 4XUPA 2W3JA 2W91A 4CU7A 1JZ3A 4GWJA 5IFPA 4DUWA 2JKXA 5I0DA 3OB8A 1JZ6A 3LEGA 3WQBA 1JYXA 4LHSA 3OEAA 3I3EA 4KWUA 3LE0A 2L9LA 2WZEA 5C71A 2X09A 1JYVA 4XUTA 4ZZ5A 2VZQA 4ZXEA 2WZ8A 3EB7A 2JD9A 3IDAA 5G05L 1UMIA 3OG2A 1WKYA 2YC2A 5LA2A 2YFZA 5DPNA 5CZKA 1GUIA 4CVUA 4PT6A 3K4AA 3T2OA 3C7FA 3WF3A 2V4VA 4D8MA 4DEVA 2W95A 2W1QA 2E31A 3C7OA 1JU3A 3SEEA 4OZOA 3WNPA 3VD3A 3LPGA 3UESA 3MUZ1 3T2PA 2RVAA 2WBKA 2YFUA 4GWIA 3ETPA 3MUY1 1MPXA 3A21A 4JKMA 3NRUA 2JDAA 2VOTA 1R64A 2E33A 2VR4A 3GGLA 1UZ0A 2J22A 1O8SA 2J7MA 3WSOA 4TTGA 3T2QA 3FHQA 2J1UA 1TG7A 5B4NA 3DYOA 5DN2A 2Z4FA 1O8PA 3I3DA 2PQSA 3SKJE 4KMQA 4DXSA 1OT5A 4XUQA 1I5PA 3WNOA 1PX4A 2W47A 2VJXA 1HN1A 4QB2A 2E32A 4LPLA 4XUNA 2W1UA 1TVGA 2X10A 2W94A 4E8CA 1JI6A 1IQDC 1JU4A 2VL4A 1W9WA 1XNAA 3THCA 2JE8A 2EIEA 1UXZA 3UNPA 1J83A 2Y6GA 4DXTA 2QQJA 3C8XA 2WDBA 3THDA 3IIIA 2VZUA 2VZVA 1ULPA 2VCCA 3ACIA 1DP0A 3FHAA 2QQKA 1XNTA 2VZOA 1UY0A 2Y64A 1XPWA 4XURA 5EJ1B 1W8NA 4ARYA 2V72A 2VTFA 2WAAA 4PQQA 5JXHA 3CIHA 3A23A 1JYNA 5EIYB 3LPFA 1KEXA 4CUCA 1W0NA 3F2ZA 3MV01 4XZUG 1W8OA 2BGPA 1JYWA 1US3A 1EUUA 3C7EA 2VZ1A 2Y6LA 4LQRA 4D0QA 3CMGA 2WAOA 3WF1A 1J84A 2ORZA 2W87A 2WO2A 1L7RA 2QQMA 3HN3A 3SEPA 4MO3M 4OMCA 4ARXA 3UETA 5J1XA 3P1IA 4QX1A 1WCQA 3K75B 1OF3A 3GDBA 4RYDA 4A41A 3I2FA 2RJ2A 1UX7A 2C26A 4Z2AA 3J7HA 3K4DA 1LNSA 1K3IA 5JR2A 2QBXA 1GU3A 1UYXA 1UMHA 4QAWA 3OGSA 1UWWA 3I97A 2Y6JA 3T0DA 1GQPA 1F4HA 2W9XA 4KI5M 2J1SA 2VZPA 3NJXA 1CZTA 2VM9A 4XVHA 1UYYA 2WO3A 3ZM8A 3C7HA 3P6BA 4QX2A 3MBWA 2C9KA 4XUOA 2BERA 2J1VA 2QQLA 1RYYA 3I2HA 3T08A 2YC4A 3OBAA 5LCWL 2J1TA 1L7QA 2J1EA 5G04L 2E26A 1CX1A 2C4XA 2VMDA 4MADA 2RV9A 3HNYM 4AAXA 3I2GA 2HLEA 2Y8KA 3OGVA 3T0AA 1JZ7A 3JXSA 4QB6A 4UI9L 1W9SA 1OD3A 3CKHA 2XQXA 1UY2A 4DEQA 4W4ZA 3W5NA 3ABZA 2OKXA 2WN2A 2QQOA 2WUHA 4FI9A 2Y6HA 4ZY9A 2DCJA 1UY4A 3T09A 2VQUA 5HPOA 2W1WA 1PMHX 3NQHA 2VQTA 2VCBA 1K45A 4P08A 5LA1A 4W8JA 1SG3A 3A22A 3FL7A 4OYUA 3IAQA 4OMDA 4QDQA 2LS6A 4M4PA 1UY3A 4DUXA 1UY1A 3BGAA
chains in the Genus database with same CATH superfamily
3HQRA 1YFYA 2V73A 3NNMA 5D2AA 1W0PA 3ACGA 2VMGA 3EO6A 4JX0A 1W39A 3M3CA 4AI8A 1NQDA 1SEFA 1SBEA 4F3JA 1ZBA3 4TYSA 1RJ8A 5FYYA 2AREA 5GM0A 2K9ZA 2PLV3 2WRAA 4BMBA 2WNUC 1NZCA 5FZ0A 1NUKA 4Q4Y1 2XJQA 1VAMA 4JQRA 5A33B 2X5IB 4COZA 4R9DA 2DTWA 4UBGA 2D6MA 2GH2A 2ORXA 5CYYA 4NN0A 3FHIB 1SZBA 3GHMA 1XE8A 1XRUA 2WA4A 3I3BA 3WF0A 3MO4A 4NWVA 3FLTA 4CE8A 2D5FA 3W9AA 4S2FA 5JPNB 2EIBA 1AJOA 2BEOA 2VZRA 3OPTA 1PK6A 4ISQA 3ZXDA 4HN1A 4BM8A 5JXIA 1LHWA 3IAPA 3S0MA 1QQP3 1LULA 2XBO1 3OJBA 3CL1A 4FOYA 4FO9A 5FMCA 4J25A 1NE6A 1VBD2 5KBFA 2WYSA 1AR91 3OY8A 5FP3A 1OQDA 4BK5A 3VDBA 1DG6A 2XOMA 2NPIA 1VAKA 2VW2A 1GNYA 3M3IA 3NW4A 4AFBA 4CCDA 3DYMA 5HV4A 1LGBA 2WQ4A 3BVCA 3NNGA 1LR5A 1RUJ2 1K42A 3D4KA 4B7KA 2B9VA 3ZKYA 5BNOC 1KS5A 1HXS1 2Q1MA 2EVXA 3WDWA 5C5UA 4Q4W2 3BPZA 5DAVA 2BVBA 3WVJA 2GP3A 3MLLA 5A6YA 1B35A 3H7JA 2TUNA 2WNVB 3IT8A 2G9GA 3R4SA 4OHWA 3K51A 1FATA 1OF4A 4R8HA 5B2GB 5FO9B 3PUHA 4DRVA 5FKBA 1YQ2A 3VKNA 3ZPOA 4B4QA 3VZJA 3KWVA 1Q8VA 4X6RB 1Y9GA 2ES3A 2Y6KA 4BHPA 4M3CF 1PGSA 1QJZA 3LCPA 2ZX0A 4BIFA 1RIRA 2DF7A 1GQGA 2HWC1 1S4CA 3ZFGB 4AWDA 2X05A 4PIXA 4QDSA 4AVAA 4LE4A 5ABJA 3CZUA 2QQUA 2VU9A 2NYYA 3OEBA 3WEZA 4P00B 3S30A 1PIV2 1RL3A 2NZ9A 2RG4A 4QGMA 5TSWA 4PF1A 3U10A 4FFFA 5IYYA 3AC0A 1SACA 2WSVA 2VUAA 4RL7A 2E63A 5DDJ2 1QOTA 1VALA 3DECA 1GBGA 3VDDB 2YMZA 1ND3A 1SHWB 5CG9A 1FPN3 2OIIA 3ILNA 1ZBE1 1GOHA 3N3HA 3NV1A 4DQAA 3SC7X 4FPOB 3WP4A 1H2NA 4QKBA 4QPGC 5IK8A 3E6DA 5EJZB 4JGZC 1DQ2A 2R7EB 3WNNA 1ZREA 2FMYA 4AR2A 3IB3A 1Y4WA 4CCJA 4CA9A 5JSPA 2EXIA 1FMD1 1FV3A 2HWF3 2VO5A 4QD2A 3HJRA 4GH4B 2GALA 4Q26A 1UCXA 1WBFA 4GD4A 3HOBA 1HRI3 3RWNA 2XHNA 1WCSA 2VMEA 2PXJA 4LOTA 1ULOA 5FBZA 4LKDA 3H3ZA 4LXLA 4OHXA 3GZTB 1H9WA 3AKTA 5F9TA 1Q8PA 1RMU2 4I01A 3AP7A 2AH2A 3RG0A 2R041 4A7YA 4Z82A 1DYKA 2HBUA 1ND2A 1DU3D 2KR2A 4JKLA 4QHBA 3WW4A 3PVOA 3DPRC 4E4DX 1NKGA 5JOZA 3IIAA 2W39A 3CNAA 1ST8A 4XF1A 1FV2A 2YBKA 1WD4A 4YW3A 5FYIA 2G19A 2Y34A 5CKMA 3I54A 3RZGA 4Q0SA 4AFAA 3KSCA 1BBT2 3NJVA 4OZXA 1YI9A 4PLMA 2FDGA 2TEPA 4UFJA 1UOJA 2VPVA 4XJZA 1HRV2 5FZEA 4Y26A 1U5ZA 3KT4A 4Q0PA 4PCRA 4Y33A 1V6JA 2RMU1 1OXCA 3DYPA 2WYFA 5FZIA 5DAWA 4FAHA 3EMRA 3WNKA 4XFIA 4H3WA 1BQPA 1LOCA 3MIGA 4JKKA 1S0BA 4TLGA 1BEV2 2QQPA 1S55A 3FUQA 2VC9A 2P3YA 2VW1A 4EN8B 5IATA 1O4TA 2R30A 3OGGA 5IJRA 4AFCA 2LUWA 3VDAA 4B7EA 1X7NA 5EHDA 1MZ6A 4IV3C 3TRSB 5A7QA 3AB0A 2YHJA 2R0HA 4QDRA 1SBFA 4CP0A 1TME1 3ZXJA 5AFEA 1JZ8A 1C3HA 2KD7A 3HEIA 5SV5A 4U36A 4CCKA 3RYKA 3BTYA 3NV4A 4KBBA 3D82A 4YW4A 3GCWA 5E88A 2HWD3 2BOIA 1DQ1A 2ZEZA 4XF4A 3RMYA 1MS0A 1OUXA 1TMF3 4PDWC 3FWEA 2YG0A 3ACFA 1YLLA 3VBHA 3R4DB 3LOIA 1EYBA 3AMMA 5EPAA 4E4SA 3NWKA 5C8CB 2ADEA 3N7KA 4LJHA 3LIGA 4MSVA 3PU3A 3S57A 1OLME 1G9FA 3JBG1 4Y1ZA 1YQ5A 3H3UA 4HKOA 1PK6C 1H6YA 1C28A 1XB9A 3E5UA 3FC0A 5CAZA 1ODNA 3WNLA 5F7UA 3CZJA 1JZ4A 5T3NA 5DUVA 1YIPA 4NE9A 2Z79A 4XFHA 3ZSMA 2VE1A 2XONA 4ZS2A 3WF4A 1RVF2 3KV4A 2YU2A 2XH6A 1ZRFA 2VTXJ 4XUPA 3ZR6A 2BVVA 4Q4X1 3USUB 4FQZA 2RM23 3VBUA 4GWJA 1PHMA 4UW6A 4C91A 2JEMA 2XWBB 2JKXA 2WA3A 1APNA 1NZIA 1XNKA 2R1DA 4I3PA 3PHMA 3RZKA 3TN92 5A3PA 3B93A 5AC92 4XJ9A 2CSGA 1O3TA 2GC0A 1B35C 3HBKA 4Q0UA 3T30A 1ZRIA 2P5BA 2WZEA 1XNDA 1PVC2 1QHDA 2NMOA 3D0JA 4XUTA 1GZ9A 3ATGA 4ZZ5A 3EBRA 5ACA3 3S5AA 3B3QE 2PAKA 3EXUA 3ORJA 2HWE1 2FZ1A 3EB7A 4MLOA 2JD9A 2UYBA 1BMV1 5JSRA 2ERFA 1OSGA 4ATFA 4C0HA 1UD1A 4KG8A 1RTVA 5ABJC 1EAH1 1LESA 2R063 4S2DA 1W6MB 1C1LA 5LRSA 3N9QA 2P37A 1GUIA 3MFAA 4PT6A 5CFCB 1VBC2 1GR3A 3IPVB 4HVOA 3K4AA 1F35A 2V4VA 3CJIB 4ORFA 1ND3C 2W95A 3PVBB 5FMBA 2Z42A 1OLQA 3R05A 1AX1A 4UFMA 2J42A 2F17A 2P3IA 4OZOA 2ZX4A 2VCMA 3VD3A 5IT6A 2EXJA 1OVSA 5GZEA 1ZM1A 4FFGA 5JZGB 1F31A 3C3VA 1V70A 4XQWA 5GALA 3A21A 4JKMA 5KWRA 3NRUA 1UZVA 2VOTA 2XVKA 3MDPA 5CBLA 2BNNA 2GZWA 3IZOA 2VR4A 4FXKB 1NLQA 1V0AA 2PAEA 3GGLA 4M3CE 5LBEA 1JODA 5T5JA 2GC2A 1GP5A 4NO4A 4EN6B 5L7OA 3ZLIA 1VAVA 3WSOA 1O5LA 1WMEA 4FQ4A 3T2QA 1AR71 1DZRA 1JMUB 1LHUA 1Q8OA 2PHXA 4IEWA 4O9EA 5E16A 3O14A 5IW0A 4Q4V3 3AYAA 4AL9A 2BBVA 3BIEA 1H30A 5GLUA 2Z4FA 2ZGTA 3O0VA 4HONA 5C8WA 2FDIA 1UYPA 1CAWA 3LA7A 1W6NB 1XOYA 1ND2C 1AR83 1DYPA 3URFA 2VJXA 1HN1A 4RR3B 4SBVA 4AE2A 4LPLA 5C9AA 1VPHA 1OKOA 1RUE1 5CFDA 2OQ6A 1CAVB 2YZ4A 3WG2A 1TVGA 4E8CA 2BFUL 1QJY2 3KD4A 4CDXB 1HV1A 1MEC3 1LHVA 2GNDA 3WHUA 2VL4A 1AR62 5FYSA 1XNAA 1N1VA 4GB32 3OPZA 4PI2A 1QF3A 1GNZA 3DXTA 3HIFA 2Y6GA 4EROA 1FX5A 2QQJA 4NPRA 4EN9B 1AYN1 3POYA 3JU9A 5E6HA 2VZUA 2WS91 1QJU2 3Q8FA 4CEYA 4LBLA 5FK7A 3NNJA 5A6QA 2IZWA 1HKDA 1ASJ2 1RHI3 2ADDA 2VTXA 4HANA 4D6RA 5DZEA 5A80A 2QQKA 3QBQA 5FJKA 4D69A 4XURA 2QVSB 2WZR2 1RUG1 2HEVF 1PO22 5JDBA 1PO13 4K7JA 2WAAA 1RUI3 4LT5A 5CVRA 1DGWX 1CR7A 4AI3A 5E8AA 5JXHA 3CIHA 4OI2A 2PA7A 4I0WB 2G9ZA 4FOWA 1DGRA 5SV8A 1JYNA 4RHV2 2HEYF 1G9BA 3AMQA 3LPFA 4CUCA 1GWMA 2AEYA 2JECA 1YXWA 2JD4A 3FX3A 3GBGA 2H6BA 3BI3A 3RWKX 1BCXA 4IEUA 1C1FA 4IEPA 1WMDA 1VBE2 2QZ2A 3MPBA 1JW6A 2WAOA 4ZXKA 1J84A 4QPIB 4X8NA 1NCRB 3VBHC 2B39A 3AXDA 1A3KA 5F5IA 1OOPB 4LHNA 3I59B 4Y20B 2JXAA 5A7WA 2D98A 4XHXA 4XFCA 2UWBA 1IS5A 1E5IA 2Z2SB 2IXHA 1I1EA 5C3RA 1YFXA 5BY5A 3CO2A 4Y5Z0 4BA6A 4NRPA 5DABA 1C8M1 2XUMA 1EP0A 3J7MA 4CP2A 2XR4A 3DXUA 2JDPA 4Z2AA 3J7HA 4K21A 1CQ9A 4GKXA 2VNRA 4BQ2A 1GU3A 3VBUC 2P34A 1NY71 4DPNA 3ZFEC 1UWWA 2XVGA 3N7JA 1RUH3 1ZBA2 3I97A 4Q8LA 5HCBA 5KXEA 1R092 2PLV2 4P9IA 5IAXA 2ZGLA 1N3PA 2VZPA 1AXKA 3NJXA 5J36A 3HBZA 1WGPA 3RI9A 4EN0A 4XVHA 4I02A 4CCOA 4W6WA 5FIXA 2WO3A 3ZM8A 4EWAA 1A78A 4X8PA 2E51A 2CGNA 1VBD1 1AUYA 2VXRA 4CDWB 1S0GA 5HCHA 2J1VA 3POJA 2CAVA 1QGLA 3BTXA 4JC1A 4NAMA 3I2HA 2ZBJA 1QQP2 1I3HA 5IK5A 4NIHA 5F5QA 3W59A 1VBA3 1L7QA 2ENRA 5I0UA 1ENQA 3VHRA 2OA2A 4Q4W1 3ZN6A 4HVRA 1YI7A 4JRLA 1DIWA 1X50A 2E26A 2YXSA 3MF6A 4OHZA 4P5HA 1SFNA 1YRZA 4BOWA 2GNTA 3NV2A 4MG2A 1GNHA 5F3CA 1W2AX 3POBA 4CDQB 5HBAA 1PZ7A 2HLEA 2ZGRA 2GMEA 3CF6E 2CL2A 5I8TA 2JG9A 2VBDA 5FQ0B 1STMA 1NE4A 3PMSA 1YQ8A 2GNMA 1VBB1 1JZ7A 4C8DA 3JXSA 3W58A 3J8F3 1LGCA 3N7MA 4QB6A 1RUD3 4UI9L 1QJX3 2HWB1 1QH6A 1W9SA 1H8VA 3IN9A 3RS6A 1QEXA 4OFGA 5A7SA 3ABZA 4L99A 4OI1A 4XW3A 4XJAA 1AVBA 1N1TA 1W2UA 2WUHA 4FI9A 3JD71 5L7OC 2QDNA 4RQPB 3PURA 4ZY9A 2DCJA 1ZZ6A 1ZRCA 1H2LA 4ES8A 4PF5A 1UY4A 5FZ9A 3T09A 1CN1A 2VQUA 3U1XA 4EZ4A 5LB6A 3SCHA 1I9RA 4Q27A 5HPOA 1PMHX 5H9PA 2LROA 2XJTA 1O4ZA 1D4M3 2OZ6A 3ELNA 4W8JA 4BH9A 3A22A 1REEA 2WIIB 2BWAA 3SITA 5C9AC 3WCRA 2JDUA 1FPN2 4OMDA 4QDQA 2LS6A 2PYTA 3WP5A 5CFDC 2HBTA 1VRH1 3RZLA 4JGYA 5LK7B 2CU5A 3L2HA 4N43B 5JOWA 4CYDA 2JICA 1T2XA 3O1TA 3J9SA 2DUPA 2XL7A 4E4ZA 1EY2A 1JOJA 1P8JA 1SDDB 5CKQA 4YPJA 2CYFA 4A4AA 1XE7A 3NO8A 3A7QA 2HWF2 4AYUA 3ZXLA 1OH3A 5C7GA 4HG6B 2W2IA 1DQ5A 1HRI2 4AVCA 1VLNA 4LO6B 5I8YA 2VXJA 2E7QA 3GXUA 5C3PA 2PELA 4CEYC 2E7AA 4DXRA 1OFSA 4LLOA 2WQ8A 1GOGA 1JUHA 1W6QA 3PUIA 5D8AB 2PTMA 4CU9A 3WZ1A 2XL9A 3MV11 4Y22A 2WN3A 3HD8B 5HCFA 3ZO0B 3BN6A 3LEIA 4W50A 2XKOA 4CDUB 2D5HA 4OQ8A 2HYXA 1OMIA 4XAEA 3CDZB 1J3QA 2MPFA 3SHRA 4FP3A 1QMJA 3K3OA 3AZYA 2IWGB 4IV1B 1C8NA 2C9AA 1W6OB 2FDFA 3WOGA 4IE4A 4E8DA 1KXGA 2ZJCA 3L9JT 4AAPA 3P5BA 3GNEA 4XACA 3RRDA 2ZHMA 5I0SA 1LECA 3I49A 4MGSA 2TNFA 1R082 4M01A 3U0ZA 2MEV1 4LIVA 5EZWA 3K4ZA 4WBBA 4YGEA 1ENXA 3IDEA 4A3XA 4KGQA 1AX0A 2Q0AA 4J6GA 4A45A 2PMWB 3B69A 1S2BA 3VDCA 3BALA 2BYVE 1Z7S1 4LNVA 3O1RA 1IG3A 2OS2A 2PHFA 4PBPA 2DDUA 1VP6A 2Z5WA 1W3VA 3N9LA 3ZX7A 3X29B 2VOXA 4DZGA 3FN9A 4YM1A 4NROA 3AMPA 2W5FA 4LK7A 5EQUA 2P6CA 2E53A 3H42B 2ZXQA 2YGLA 4UBHA 5FYUA 1NCQB 2ZEXA 4Q4Y3 2R0FA 5I0TA 1COV1 1S2KA 4IEXA 4ZZ8A 3PUQA 4YVWB 4JGZA 1D0GA 1SDWA 2HWD2 1D4VB 5DQ0A 3O0WA 5C5TA 3I2KA 4XQDA 2SLIA 2VGDA 1TMF2 3THTA 2NLRA 1F5JA 5FZ8A 2VMCA 3ZYGA 4MGQA 5FUIA 2VUJA 3LSEA 5E1RA 1ACCA 4BZ4A 5JXJA 4TZDA 2XBO3 4N7IA 3ZYIB 3N9PA 5CADA 2YB7A 3N9MA 1AR93 5FP8A 3VL9A 3SMHA 1DLCA 1MQTB 4XMIA 1Q3EA 5FUNA 3ZFFB 2LW8A 4FPKA 4W65A 1AZDA 1VRBA 1S0EA 1X9PA 2Q8EA 4HK8A 5C8CA 1G9CA 2WO1A 1CAXB 1UZZA 1D7PM 2ZA9A 2BPA2 3FMGA 3VBRA 1HXS3 3ZYFA 4ET7A 3B01A 4NAOA 5DAPA 4MOAA 2RM22 3KV6A 4DXZA 4JQTA 1W8HA 4F8AA 3O1SA 2WNOA 4UW4A 1UIKA 3RZHA 1GP4A 2VVFA 2HYKA 4DNYA 2I07B 1XXNA 1HB1A 1W8ZA 2B5HA 2ZMNA 4WVVA 1YJLA 3ZKUA 5FYBA 4CEWB 2JG9C 3OGRA 5IK7A 4MUVA 4UF0B 1W8UA 2LRPA 3AZWA 5C70A 2YU1A 3O1MA 5A3LA 3MI8A 2YGMA 3TNPB 5JAXA 4GQ7A 1XE0A 2HWC3 3IWZA 3H9AA 4Y24A 3BYWA 3VD7A 3WG1A 5JOXA 5FAXA 2PHLA 3ZSLA 2BTVC 5C4WB 5ACA2 2KM2A 3WW3A 3VBOB 2WKKA 5AFBA 5FMOL 4QWNA 2OXBA 4XILA 3AJZA 5CG8A 5CB7A 5A6XA 1UOBA 1F15A 1XNBA 2DWRA 3BCWA 5LY1A 2R062 4WZCA 3KV9A 1W03A 5FREA 1RUC1 4YZ5A 3I2JA 1REFA 3E5XA 1DQ6A 4AGGA 5ISLA 3O7OA 3DF0A 1JS9A 2XJSA 2RE9A 3LFMA 5DUWA 3RYPA 1GSLA 1WLDA 1ZBE3 3BTAA 5FXXA 1PX3A 3VKMA 2ZGMA 3PU8A 5D21A 3T1MA 2IXCA 2W1SA 1UPSA 3ZPYA 2RJKA 2UY8A 1YYNA 4ZONA 1H8TB 3P3NA 1CESA 4OUEA 5A3NA 5CFCA 4HN0A 3VD4A 4GWMA 4PDWA 1S2EA 2XUEA 1FMD3 4JGYC 2OT7A 3W20A 4FFHA 5T50A 4D6QA 4ASLA 1IGOA 3RPQA 5JUVA 4CXWA 3TOJA 5HV0A 1D0HA 3GBFA 4HSJA 2EXKA 5LRRA 4E2QA 5J37A 1XYPA 4M4RA 1YIFA 2B4KA 3S7IA 3V0BB 4QX0A 4I30A 4K1ZA 2R043 3ROUA 1W6PB 1Z78A 5JZGA 4AG4A 3M7AA 3PUAA 3HNBM 5LWBA 1ZRRA 4IGPA 4Q4V2 4XQ4A 3RJRA 3BU0A 3BUCA 4MVTA 4KGGA 3GZUC 5GLWA 4FPJA 4RS5B 1EV11 2XG3A 2XQRA 4GMP1 4YVSC 3UGHA 3LDBA 2Q1FA 1GYKA 1AR61 1OA3A 1KGYA 2GN3A 3AP4A 4NPLA 4UFIA 1AR82 3SH5A 1V9U1 2ARXA 2BUKA 2IUWA 3ZDSA 2DVDA 1Y7BA 3NKGA 3OBZA 4QQ2A 4YW6A 3ENRA 4R9AA 3RNSA 2B42B 2JG8B 3KVAA 1JHJA 5IUQA 1MEC2 4IEQA 4QB1A 5FCCA 2WWJA 3ZXFA 1W6NA 3MHZA 1QJU1 2RMU3 2VG9A 3S6PA 1GZWA 2W3JA 4CU7A 1JZ3A 2VVDA 1K5MB 4BLJA 3ON7A 1FI2A 4QXHA 3K3NA 3I2OA 2DFCA 2ZGUA 3U11A 1O3RA 4NUBA 3LEGA 3UKVA 5C3OA 1UOFA 4NRQA 3WUCA 1RB8G 4R4XA 3I3EA 4E9KA 1MZ5A 1RHI2 1PM7A 2AZ5A 4MGZE 4KWUA 5T5PA 1RUF3 1X8EA 4NIIA 5C3QA 5CU1A 5FZGA 4YZ3A 4FPFA 1TME3 2VZQA 3H3LA 3PIJA 2WZ8A 1QH7A 2WINB 4QU2A 4BU2A 5JI7A 2ZHKA 5FY8A 2SBAA 2K0GA 1IG0A 1PO12 4TSVA 1RUI2 3VZLA 3U4XA 2Q30A 2G4IA 2VNOA 2YFZA 5LA2A 3U78A 2XB6C 3WUDA 5JOYA 3ZYBA 3ZYRA 3GJAA 1AHSA 1PVXA 1OUSA 2V5YA 1PGW2 4LBQD 3IBMA 4A7ZA 2ZGNA 1CPMA 2Q1ZB 3JBG3 2YBPA 4FOVA 5FZ6A 2NN8A 5K0UA 3H50A 5FZOB 3C7OA 3WG4A 5BNPB 1UKRA 3H1YA 1ZZ8A 2XJRA 1N3OA 1UNBA 1JU3A 3INAA 3KMHA 1LOEA 3N9OA 3POWA 4IEYA 3SEEA 1YFUA 2VULA 1RITA 3JQWA 4KWJA 3UESA 3MUZ1 5A3MA 1KS4A 3BOWA 4Q4X3 5EYXA 5CISA 3Q8CA 1ZNPA 3MW2A 3IMNA 1W0OA 1MPXA 1NCRA 2AUYA 1R64A 3U07A 1JOBA 2RR11 5C8CC 1R091 3AJYA 3I59A 4XBQA 3PTRB 4Y20A 4KH9A 2A5ZA 1SLLA 4BQ4A 2J22A 2BJSA 1ODMA 1O8SA 3VBRC 3O1VA 4TTGA 1LTEA 5IVVA 4LMFA 3LDKA 4G3YC 1AL21 2WFF1 2LTNA 1RUH2 3FLPA 1CWPA 5FWEA 1TE1B 5FZ1A 2AYHA 1WW5A 5DN2A 1G9AA 1LGNA 1O8PA 1S0FA 2PQSA 2RS11 2OVUA 3M2MA 4NJ4A 3CBNA 3SH3A 1I5PA 3UYJA 2D6KA 2HWE3 4HXCA 3KQ4B 4LUMA 4DOUA 3RZZA 4QB2A 2E32A 4FPEA 5A3OA 5FWJA 4UT5A 4Q29A 5FO7B 1UZWA 4XUNA 5L36A 4CP9A 2YUEA 4E4HA 1EAH3 1JI6A 2DBIA 3MW4A 5IVCA 1W9WA 2D6OX 3THCA 3UNPA 5DZGA 4P9LA 5BNQA 3E97A 4FPCA 5JSOA 4PIZA 1VBA2 1R1A1 3SH4A 1F8VA 3THDA 3IIIA 2I45A 2ZGPA 4I0AA 1BJQA 2WWUA 4BCUA 1PGL1 3VBFB 1BK0A 2BQPA 1BK1A 2CTVA 3AKQA 5FTTC 3ES1A 1XNTA 3NNLA 3RQ0A 1A8DA 1J3PA 1HV0A 1WW6A 4PHZA 4COUA 1VB2A 2VUDA 1XPWA 4XFFA 4XEZA 5CFCC 1JTZX 2BRTA 1UQXA 1OBNA 1W8NA 4ARYA 2DFBA 2HJIA 4GIQA 1RUD2 1F5FA 4QPGB 4HLTA 1QJX2 3SNMA 3C2UA 5LBFA 3A23A 4Z1VA 4CDQA 2VNVA 4H55A 1AR73 4BE3A 4D7SA 3Q9OA 4NIGA 2C6SA 1W0NA 3F2ZA 3MV01 4IGQA 5ERLA 5FKCA 3AM2A 5C3SA 4QHOA 2OYZA 2VZ1A 3BODA 1F9KA 4PIYA 3ZXAC 2ZS6B 3EHKA 4B4RA 3IKWA 5A32A 3NNFA 3MIFA 2D6NA 4GKYA 4FOQA 3WR0A 5JZGC 1VE0A 3S7EA 1REDA 4GXLA 5APAA 4DY3A 4XETA 2QQMA 5H9QA 3KZ4C 1RUE3 1O4YA 3SEPA 1JBCA 4OHVA 2OUJA 4O7XA 1J59A 1SPPB 3ZFEA 1D4M2 2N7GA 1C4RA 4QX1A 2BU9A 3DPRB 1KFXL 4M00A 4YFWA 5A7NA 4EZHA 5KXDA 5FP7A 2CWMA 4XE9A 1NQJA 5FZBA 1OKQA 2G9FA 1QJEA 1SCRA 1SLTA 4RYDA 5LY2A 1MVEA 4Y3OA 3RJ2X 4XXAA 2V4AA 1AYN3 1UX7A 3PVEA 1W2TA 3BOPA 3HT1A 3K4DA 1LRHA 1MS8A 1ULFA 4KWKA 2WS93 3D0SA 2CWSA 1UYXA 4RFRB 1UMHA 1WD3A 4GULA 3OGSA 2WC2A 4QAWA 1WLCA 2H0BA 5HI0A 3KLSA 4K8RB 2VECA 2F4LA 2Y6JA 4KBZA 3LIHA 4N53B 1R1ZA 4KI5M 2C5DA 4XBNA 1U5IA 4YARA 3O1OA 3AVSA 3OUHA 1LKNA 1W05A 2FBEA 1RUG3 2ZGOA 1ZZCA 3OSDA 2RS51 3WP3A 2G1MA 4QX2A 3VGIA 2JE9A 3AK0A 3H7YA 4AGVA 2C9KA 1DZQA 1XU1A 2BERA 3RVHA 2DUOA 5T5LA 2GMPA 3OUIA 5CKNA 1HQWA 3MLJA 4CCEA 1A6CA 4CPBA 3MICA 4IV3B 4H2AA 3FLRA 1R081 2YC4A 3OBAA 4GJZA 4LBQA 3V56A 5LCWL 2IXLA 4Y1YA 4K8FA 3RDIA 3MF9A 4B8EA 3I4IA 1WLWA 5DAQA 1G6NA 2P3KA 5DUXA 3I7DA 3RI8A 3DEMA 3N4MA 1CX1A 2C4XA 2JX9A 3JQXA 4FCAA 1AYM1 1H9PA 2YY1A 4MADA 3WQ7A 2P2KA 1BZWA 3HNYM 3DCQA 1KFUL 4WM7A 4ONUA 3K48A 5K0UC 2IFRA 3ZYHA 5C33A 1G8WA 4L9BA 3ZSJA 1AXZA 3WQ1A 3WDVA 1E57A 4S2HA 1Y43B 4YW5A 1C8M3 3TYJA 2E7TA 4XIKA 1POQA 4JV4A 4R9CA 4AVVA 4B4PA 3VBSA 2DCZA 2ZX1A 1FOD1 1YQ6A 3W21A 3NJYA 1PK6B 5DXDA 3CKHA 1FT9A 2XQXA 1UL9A 5JR7B 5FY5A 1NCRC 4W4ZA 3W5NA 2QQVA 4DY5A 2DCTA 2RS31 1GZTA 5A1LA 3HN1A 1WW7A 3BIWE 4V1PA 3AFGA 4HZFA 4Q4Y2 4AI9A 4BPZA 1H4HA 1MZFA 1ZX5A 2VVEA 4OI4A 1W9FA 2WLPA 1K5JA 2ZACA 1M4WA 3S5QA 2W1WA 3G6JB 3MLKA 4CUGA 1VBD3 3G7DA 2JDZA 3H0OA 3NQHA 4M0NA 1K45A 1FAYA 4HK9A 2R1BA 2QTWB 3FL7A 4OYUA 5L73A 3WD5A 3WDUA 1ULGA 1MR5A 1KJLA 4HPKA 2DVFA 4YVWA 2XBO2 4EWDA 3DL3A 1UY3A 1S0CA 4QM9A 4Y5TA 2VQ0A 3AVRA 1UY1A 3ETQA 2D44A 3UV9A 1PNGA 1AR92 4Q4W3 4XJ8A 4JRAA 3GZAA 4AF9A 4D6SA 1OA4A 4IUGA 2MHFA 3GALA 1TZOA 1JOPA 4XCAA 4B29A 5ABJB 3B94A 1SLCA 2X53S 4CDWC 1HXS2 5A7OA 5EWSA 2O1QA 2PHRA 1VBB3 1MQTA 2FHRA 3T2TA 4A42A 4A6OA 4J1WA 2H0VA 2YC0A 1MS5A 3PL0A 2HWB3 4QU1A 5F6LB 1CAXA 3GCXA 1ND3B 2AENA 1QIQA 3CHXA 1ZZ9A 1LOFA 2IXIA 5H9RA 4MGYE 1S0IA 2GAUA 4O61A 4AHYA 4BXSV 3EQEA 3JB8A 4Y1VA 3SKVA 3OBTA 3OYWA 4I3GA 4FBFA 2HWC2 3HNMA 2BZDA 3JD73 4P02B 2DVGA 2P4EA 4BWOA 4CDQC 3PJQA 5FO8B 4P5YA 3LSDA 4CEWA 4LO7A 4OUSA 1W8TA 4RN5A 4E27A 4XDPA 3AL6A 5A3WA 3W5MA 4LBMA 5JMOA 3B5LB 1VR3A 1N1YA 3BPSA 1DQ0A 1H1AA 2CDPA 2J1AA 4JAAA 3ZR5A 5C4WA 2ILMA 2R072 1J3RA 3V0AB 1ULEA 4AI0A 1V6KA 1W90A 3ZVXA 1K12A 1UF2C 3MIBA 4QKFA 4PLNA 1HX6A 4YW1A 3UKNA 1KITA 1VRH3 1ZBE2 3NV3A 5EV7A 4AVSA 4FTEA 2Q8CA 1PMJX 1UYZA 1ND2B 4LO8A 1QXRA 3MPPG 4BXFA 4LA2A 1DZTA 2XMLA 3LEKA 5JI9A 4TLFA 1ENRA 1GANA 3OOXA 5IFTA 5LZ6A 1FMD2 1XNCA 1RUOA 1IS3A 4OHYA 2DCKA 3NAPB 4YGBA 4URAA 4JHZA 2P1BA 2DYCA 1RJ7A 3WLUA 1B09A 1YJKA 5A33A 3UJOA 3VZMA 2X5IA 1HJGA 2IXKA 4N9HA 5FZKA 2GU9A 2R042 4XTPA 1RUJ1 4UWDA 1CD3G 3AYDA 5BPXA 1DYOA 4WM8B 4Q1RA 1TNRA 2CDOA 2OUHA 2WZPP 2ZGKA 1IS6A 3CU7A 3H1WA 3K77A 3OPWA 1H2KA 2A73B 4CUAA 4COVA 1QWRA 1W2OA 3EYPA 3KT7A 1UMZA 1UXXX 1YFWA 2PN5A 1VIWB 4BYYA 3SQOA 5K7PA 1W99A 3RMXA 2RHPA 4QGNA 4TWTA 5C6CA 2ZZQA 5BUVA 3ZMNA 1MVQA 1ZZBA 3OUJA 3Q8EA 3PIGA 3KVBA 4FPHA 2EIGA 4L11A 5FZDA 3WW1A 2A3WA 5LW9A 3HQUA 4MZUA 2O8OA 4RS5A 1DHKB 1KDMA 2MEV3 4K1YA 4GWNA 4JDMA 2RMU2 3HPNA 2B45X 4OULA 5FOBB 2EAAA 1OH4A 2BBAA 2YYOA 4L2NA 3RFRA 3ALQA 2R32A 1PIV1 4QX5A 4EQVA 4LA3A 1WA6X 3HQXA 1Z7S3 3LEMA 2HEWF 4J1XA 3TEXA 3KCCA 5IHRA 4IV1C 2XGXA 4WM7C 1FXZA 2WNVA 3CQOA 4MGTA 3VBHB 1X8MA 5FMDA 4XMAA 5DDJ1 2JJ6A 4AI1A 4K40A 4AXOA 1W04A 2C1FA 4CCCA 1K5MA 2E9QA 1RUF2 3HR9A 5EJ3A 2D3PA 4AQTA 3NKTA 2BP6A 3VBSC 2EICA 1TME2 4JCKA 4BQWA 3ZFGA 1COV3 4YGCA 1PGW1 4V2WA 2UWAA 2XJVA 3N9NA 4JDOA 4XFGA 4LR4A 1DGWA 1RC6A 2A1XA 1Y9QA 1QU0A 3IM0A 4B1MA 3LZZA 3WX5A 2FDJA 2VW0A 4QM8A 3ST7A 3VBUB 1JZ5A 1UOGA 1C57A 1GICA 2VZTA 2P17A 3JB4C 3MIEA 3NSTA 4BISA 2QUOA 3VDDA 5B4XA 3PDQA 4ASKA 4AEKA 1HQLA 4ISRA 3C7GA 4QPWA 4QX3A 3WDXA 3MIHA 2GMMA 1RMU1 3JBG2 2VAUA 4DO0A 1UO9A 2A70A 1MS3A 4YVWC 5FY9A 3FJSA 1LOAA 3LQCA 1X33A 4WVZA 4BJ0A 3VD9A 4YZ4A 3KS7A 1E5SA 5FZFA 4TXWA 3VZOA 1WCDJ 4Q4X2 4YVSA 4GH4A 2B8MA 1NA1B 4X6QB 3ITQA 3R6SA 1ENSA 5BNPA 1BBT1 4M0HA 4EYUA 4CXXA 3GZEA 4HVQA 4LHLA 5L19A 1MACA 4N90A 1O7FA 1HRV1 3A0KA 3AX4A 3HVDA 4I09A 4IESA 4P9WA 4GMP0 2CHHA 2VMFA 1MQTC 2XLGA 3O12A 5FBJA 4AVTA 2CY6A 1O91A 1S1AA 3ZN4A 1BEV1 3OCPA 4JHTA 1LAJA 1NYWA 1LOFC 3PNAA 3ZMOA 4CCNA 3OTFA 3MYXA 3LA2A 1CONA 1YCIA 1BMV2 4AGRA 2W92A 2VQAA 5EYYA 3R4UA 3T4VA 5KHHA 4MGKE 1IPSA 4XTMA 5JIAA 2EIDA 3NVCA 1GLHA 4KNCA 3U37A 3TAYA 1EAH2 1V6NA 4JDNA 3KM5A 1BHGA 1RUC3 3I3MA 2WSUA 4XXPA 4CEWC 1CIYA 1H6XA 5KHGA 3WCSA 4A2UA 1Q5OA 2CGPA 5L7OB 3QACA 4DUWA 1IKQA 4NHMA 5LBCA 1LB2A 3OB8A 3VB9A 5FPVA 1BVP1 5C4WC 5FXWA 3WQBA 1JYXA 1M06G 2JDMA 1X9TA 2XKPA 4K20A 4QQPA 5F5CA 1CAWB 4DFSA 3LE0A 2L9LA 5C71A 2VY0A 2X09A 1JYVA 2QFEA 3ZYPA 2ARBA 2ZAHA 4QQOA 5I91A 3VHPA 1O3SA 3SCFA 1POV1 5DUUA 5FY0A 1W8WA 1HLCA 2CNAA 4LITA 5IAVA 2UWCA 5JLVA 1H1IA 3MW3A 5G05L 1CJDA 3OG2A 3VBFA 1WKYA 2YC2A 4IQPA 4D3WA 4XF0A 5F32A 2D6PA 3POIA 5ANNA 4WV8A 4YVSB 2FCUA 2ZMLA 1RVF1 3TBDA 5DPNA 4GALA 1AR72 3HAGA 5LA9A 2CAUA 4HBNA 5FPZA 1H8TC 1XQNA 3WW2A 4IERA 1QNYA 1Z0HA 1OQ1A 1H4GA 4KU7A 5FZ3A 2X5IC 1EV13 4GMP3 4QGLA 2YBSA 1Y9MA 4AFDA 5FXVA 1F2NA 4MXVA 1AR63 4KG0A 3SCGA 3T2OA 4AEDB 4Z2WA 3B9CA 1V9U3 3Q8BA 5F2WA 4DEVA 3TN91 5L9VA 1U5YA 2W1QA 4Q0QA 4RSUA 5AC91 4MYEA 1RUE2 2FDKA 2UU8A 4F83A 2ZABA 2BWCA 2Q5TA 3WNPA 5FXZA 5I8SA 1PVC1 1IQAA 3D5OA 3OBRA 3LPGA 4OUMA 4YG3A 1QJU3 1O5UA 2RVAA 2R49A 2WBKA 2YFUA 3ETPA 3MUY1 4YWAA 5IK4A 5KHKA 5H9SA 2E33A 3CJXA 2RDNA 3USUA 2ZGSA 3VKOA 1JN2P 1UZ0A 4KWLA 4RS5C 4AQ2A 4YNIA 1Q8QA 1OPOA 3DV8A 5FOJB 1QKQA 3TEYA 2J7MA 4E2GA 2WS92 5CIRA 1QOSA 1VJ2A 5FYCA 2J1UA 2I2SA 1TG7A 1QY4A 1VBC1 4ITCA 4QT6A 5KXBA 1C5HA 2FDHA 2JIJA 4HMZA 2WNVC 4GA9A 2EA7A 5BNNB 2ZX2A 4S2GA 4XUQA 4COYA 3WNOA 3LGRA 1PX4A 3QLQA 1Q8SA 5LEJA 1RUG2 4MXWB 4YSFA 1K5MC 4LLFA 3H8OA 1SFPA 3QH6A 1V6MA 1OC1A 3TEWA 2B9UA 2QJVA 2W1UA 4N53A 2W94A 1NXD1 5LK5A 3ZFGC 1RXFA 4XCBA 3N7LA 4KU8A 2JE8A 2EIEA 1UXZA 1WLTA 3IDCB 1OVPA 1W6MA 4WZFA 1XU2A 3JUUA 1J83A 2B46X 1H0BA 1C5IA 1MS9A 2BGCA 2GC3A 4DXTA 4I2OA 3C8XA 1UKGA 2GSYA 2OQ7A 1XJAA 1MS4A 4URTA 4H7LA 3LWCA 1JUIA 3IPVA 5FYZA 1XSRA 3L2YA 1HB4A 5JCTA 1UIJA 3CJIA 2VZVA 3VDDC 3QCWA 3LB9A 1N3QA 1RINA 3QD6A 5FRAA 4A6SA 1DP0A 4H14A 2VZOA 4K6BA 2PQQA 2Q8DA 1UY0A 4MGIE 3I8TA 3VKFC 2Y64A 2XWJB 4LKEA 2BNMA 1RGSA 2RR13 1C8M2 2JKBA 1R093 1XYOA 3AXEA 3DKWA 2PHTA 1ZYBA 2VMHA 2VTFA 3FBMA 4AFMA 4BQXA 4CZSA 1ZRDA 4PQQA 1UX6A 4LHKA 3OD4A 1QJY1 5EIYB 4GH4C 5KC6A 4CCMA 1NY72 1AL23 2UURA 2WFF3 1G86A 5J98B 5LBBA 4CRQA 2R16A 2R6QA 1W8OA 5BNPC 4GB31 4B3NA 4AHWA 2VUCA 5FR3A 5JMCA 3KF3A 2BGPA 4IEVA 1JYWA 4YM3A 1EUUA 2RS13 3C7EA 2Y6LA 3WG3A 4LQRA 1CAUB 4RGAA 2JWPA 1WCKA 3ZN6B 2D7FA 1URXA 3CMGA 4Q1PA 4NHLA 4WVMB 3CEWA 2W87A 2WO2A 4NMIA 3M3OA 5F37A 1ASJ1 4RR3A 2BOJA 2ZX3A 4QKDA 2JG9B 4PQ9A 1CAVA 2E6VA 1S0DA 4IE5A 1WCQA 3POFA 1QDCA 4XC9A 5A70A 4CDXA 4NR1A 4XPVA 4QKNA 5FZCA 2WZR1 4A41A 2YPDA 2W08A 1PO21 5BYNA 5GJ6A 2DV9A 3VL8A 1GQHA 1R1A3 2C26A 4LBOA 4XDOA 5FP4A 5LATA 3DN7A 4L97A 1K3IA 5FPUA 1AJKA 1WA4A 4RHV1 5FYTA 4XJWA 4NOTA 1L7LA 3PVNA 4AW7A 2FCVA 1GQPA 2AR6A 4Z07A 2J1SA 4JVAA 1J1LA 2A6XA 1CZTA 1VBE1 1VBB2 1LHOA 1SMVA 2VH9A 4ASMB 2ARAA 3C7HA 4CPBD 5EP9A 2HWB2 2Y38A 4EN7B 2NM1A 2LM3A 4R9BA 4K3UA 1UU5A 2ZHNA 2VOVA 1WW4A 2WNUB 3B9IA 4YFZA 1IHMA 1RYYA 4JGYB 2IVJA 3VBFC 4UW5A 2IC1A 3JD72 1YNAA 3T08A 3FE5A 1V6LA 2Z69A 4C1WA 2R071 2J1TA 3PMEA 4U2AA 2QCSB 1S0JA 2KA3A 3J26N 4N9IA 4FXGB 3USSA 5G04L 3KHBA 4HT1T 2F6BA 1IZ3A 4NHKA 4O9GA 4PJYA 3H8XA 1VB4A 3OF1A 5GLZA 4MHUA 2XLAA 4IETA 4QPIA 2IVIB 2RV9A 4LBKA 1ZBA1 4AAXA 3UL2A 4BQYA 3AMNA 1OOPA 2PLV1 4C0BA 2Y8KA 4XFBA 3ZIWA 3V65A 1W6QB 2D97A 4M3CB 3OGVA 1AXYA 3ZIXA 3T0AA 3M1HA 1U0AA 1VRH2 3PTYA 4Y22B 3UJQA 1GP6A 3FFQA 2DBNA 3KCYA 4I0BA 3LAGA 3VZKA 3PJYA 1GWLA 1YUDA 5BNOB 3MGUA 4UW3A 1OD3A 3V0AA 4FAGA 1UY2A 4XYXA 5JVVA 5IVJA 4DEQA 5KHIA 4HFSA 4BLIA 2OKXA 2WJSA 4XF3A 2PFWA 2WO7A 3GJBA 4P9GA 2O8QA 1QQP1 3IMMA 2Y6HA 4LE3A 4LUKA 2A6YA 4JZRA 3M3EA 4V2VA 3NL1A 1IPKA 1RUNA 1OA2A 3E6CC 3O1PA 3ILFA 3N35A 2D6LX 3AKRA 2B7YA 2RS53 4LEJA 2ATFA 4QX8A 1KDKA 5A7PA 3U75A 5I93A 3THPA 2VCBA 2QNKA 3NAPA 1HB3A 3UGFA 1LEDA 4UYBA 1SG3A 1UN1A 4CDWA 3M3QA 2PAMA 3AL5A 4EV0A 3IAQA 3FUOA 1R083 1LOBA 4DB5A 3AKSA 4N53C 1MZEA 1AF9A 4DUXA 4XAAA 2I74A 4Y1XA 4ES9A 2VNGA 3OEAA 3WNMA 1US2A 4WM8A 3TEZA 2IFWA 2BNOA 4G9SB 4QX7A 1AYM3 3VD5A 2WABA 1WUVA 3AZXA 3K46A 5F3IA 2V5DA 4QQLA 4CXYA 4AEJA 2MEV2 3J8F2 5DG1A 4LULA 1NX9A 5FYHA 4LKSA 2ET1A 4IXLA 2A3XA 2Y0OA 4UFLA 4XDQA 1WMFA 1LEMA 2QE3A 4JGZB 4AQ6A 3VUOA 1E5RA 2A3YA 3GM8A 1V6IA 3CJIC 4IE7A 1RUF1 5FP9A 1IS4A 4LOSA 1Z7S2 3E1F1 5FQ0A 4ZS3A 3HWJA 1FOD3 3AZZA 4SLIA 1CZVA 5GZDA 4CSWA 5FLJA 4BQ3A 2BDRA 1ALYA 1U5XA 3N36A 4QXKA 3WDYA 1CX4A 1O59A 4OQ9A 3UT0A 5LEKA 2RS33 4XZPA 1TNFA 1FPN1 4PLOA 2WL1A 1EUTA 4ZPIA 3TNQA 3AMHA 4RGGA 2QQNA 3H8RA 2CGOA 3O0XA 4F7ZA 4MX3A 2YPJA 1PNFA 1UPIA 1COV2 3LOBA 5DAXA 1J1TA 4RQPA 1MS1A 2F4PA 2JDKA 1GWKA 2GH8A 2IXJA 4GAZA 3ACHA 1GKBA 3JZVA 3E6BA 4AI2A 4Y4RA 2BFUS 1OURA 4UFKA 1GMMA 3VBRB 3LA3A 4NIAA 2HWF1 1KJRA 1WBLA 4N7UA 4DUVA 3KHCA 4CU8A 1HRI1 4XFAA 1SBDA 2X8KA 3M4FA 2ZEWA 1V6OA 4FT8A 2HKXA 2ZEYA 3M70A 4DMIA 2A71A 1FNYA 1OD5A 2TBVA 4L92A 4RR3C 5FFOC 4HL0A 4IDZA 4YZ2A 3WP6A 1UU6A 2GC1A 4GJYA 1DBNA 1OFNA 1HIXA 4CDXC 4UXAA 1ZA7A 4N43A 4NHYA 2EALA 2Y6FA 4NHXA 4NPMA 4IEOA 5KR7A 4FP2A 2GNBA 1JYCA 5L9RA 3GBWA 1NOVA 4R4ZA 3T0BA 3BTZA 2VBPA 1F4AA 1YO8A 5FLIA 1GFF2 1BLZA 4XJUA 1SCSA 5FY7A 5JXGA 2JDHA 1WCUA 4CCLA 1KD7A 5KXCA 2AEZA 1YQCA 1YWKA 4UAPA 2V09A 4LBNA 3ME2A 5D8AA 2ARCA 2JE7A 4BK4A 1JXNA 4OVEA 5F5AA 3ZSKA 1NA1A 1H2MA 1DQ4A 4EE2A 3POSA 4Y5SA 1WMXA 2A7AA 4TN7A 4CDUA 1VMFA 2Q4SA 4QMAA 3Q8AA 5FK8A 2JENA 1TQ5A 3AKPA 4YYOA 4Q0VA 3VKLA 4Z8BA 5JWPA 3BKZA 4PDWB 1X82A 2ZPXA 4IV1A 4DINB 4ZU4A 1W6OA 1W8FA 3AYEA 3AP9A 4IW3A 3ASIA 5HCAA 4AOCA 1LCLA 5FZ4A 1RUC2 4KL1A 4LBJA 1GOFA 3KF5A 1Q43A 1T6BX 3KB5A 2QKDA 4R52A 2JB8A 1SLIA 2AC1A 3POEA 2XVLA 4COWA 1CZSA 2D43A 1HQNA 3KQRA 4QPIC 1VMJA 1H1MA 4LK6A 4PI0A 5DMYA 2HWD1 1OOPC 2Y33A 5FPBA 4XOGA 4XHBA 1W9YA 3MZHA 3FBYA 1EPZA 3P3PA 3OY8B 1TMF1 3VZNA 5HXMA 4ZU5A 1AX2A 1ONAA 1VMHA 2XJPA 2ZKLA 4ZKTB 4RFT0 4DRRA 4FPLA 2VOKA 2RDQA 3WF2A 2A6ZA 3OD0A 4YZ1A 1SLBA 5LA0A 1V00A 1XBFA 2Y60A 4XBLA 2XXZA 4Z92B 1NCQA 4N8MA 2NQYA 3KCXA 1B35B 5KC5A 4CU6A 1T6GC 2XDVA 4A44A 4BDVB 1GZWB 1RUJ3 1XC6A 4L0PA 3T3YA 3VHOA 5A1FA 1ZVFA 2QQIA 4W6YA 2RDRA 4LTAA 4P14A 3WINE 2RM21 4GZ9A 3LDRA 5A1AA 1EV12 4AQSA 1IKPA 2J1RA 3D6EA 3J7LA 1J58A 3R0RA 3ECQA 3NAPC 4NRMA 4Q5OA 5FZMA 1GV9A 1V9U2 2VBBA 3BB6A 3GYDA 3WT3A 3RZMA 5T55A 2BGOA 3B02A 3GF6A 1LENA 4UOJA 2P6HA 3TB0A 4YG0A 3MIDA 5F2SA 3O5SA 2FZ2A 4HKLA 3ZFFA 1BKZA 4AEDA 2ZMKA 3D3AA 4MV2A 2BV4A 3RGBA 3DKQA 3KGZA 4WM8C 3V64A 4CUBA 4A3ZA 5FZAA 5ACA1 3I2IA 4AHZA 4XIOA 4C90A 1PIV3 5T54A 3PUSA 1X36A 5FPXA 3TWIA 5A6ZA 3ES4A 4OCTA 5D1IA 1JZ2A 4FTSA 2ZCWA 4QXBA 2C24A 3FZ3A 3U4SA 2R061 5DDJ3 4Q8KA 5FY4A 1CIWA 5CA6A 2VZ3A 2ID4A 4LO4B 2AGSA 4UF0A 5K0UB 4NWWA 1QOOA 2W46A 3QH7A 4EJRA 1GZCA 1PZ8A 1OLRA 2JDNA 2OZJA 2VZSA 3VBOA 3ILRA 1HB2A 2FD8A 1E5HA 3SISA 4LORA 3O1UA 2VCAA 4YRDA 2RDSA 3WV6A 1NAEA 1W9TA 4HSLA 1NXMA 5FY1A 4DIQA 4RQPC 1QNWA 2X29A 5BNNA 4W6XA 3UK9A 2W91A 5IVEA 2D3SA 4MXWA 1KRIA 5E89A 1OI6A 2ZGQA 2JIGA 1DFQA 5IFPA 1L3JA 4UFHA 5J3UA 4YG6A 5I0DA 2ZZJA 5M0TA 5AVPA 4DS0A 1RMU3 3D8CA 1W2NA 4WVWA 1JZ6A 2NP0A 2QDRA 3UKTA 5T5OA 4HETA 5FV3A 2GDFA 4LHSA 5GLTA 2C0ZA 3GHNA 3I3QA 1POV0 4Q4V1 2OX0A 4LO5B 1ULDA 3PLQA 2DCYA 1H8TA 1DCSA 1W06A 2NMNA 4QHZA 4YW2A 1OPMA 3KV5A 2XLFA 4HOOA 5IVYA 5GZGA 2ZOEB 4ZXEA 4N43C 1AR81 3LD8A 4META 1BBT3 2RR12 3IDAA 4AHXA 4CP9B 2DVAA 1HW5A 1UMIA 3J7NA 4EWEA 5J7MA 3RZJA 1ULCA 1HRV3 4Y1UA 3V0BA 1MEC1 2WNEA 5CZKA 1AL22 2WFF2 3OGJA 4CVUA 1DDLA 1W6PA 3AZVA 2FCTA 3K2OA 3KT1A 1Y3TA 3MFCA 4P9YA 5GZFA 2RS12 1BVVA 4NIDA 1BEV3 3VV1A 5D8AC 2D40A 1XYNA 3C7FA 2VD7A 5ANQA 5F8PA 3WF3A 2A6WA 4CP1A 4D8MA 1NA1C 4O65A 4AVBA 1CGPA 5FLHA 4FPYA 2E31A 5J48A 4CDUC 4KQ7A 1OLMA 1RHI1 3WQ0A 4Y4YA 1QXJA 3WDTA 1CAUA 3ZSEA 5JIUA 3U14A 3T2PA 3EJKA 5JPMB 2JG8A 4GWIA 4WVMA 3ZDVA 4H7MA 1SQ4A 5IVFA 1OHFA 2JDAA 2K2SA 5FZLA 1PO11 1D2QA 1R1A2 1RUI1 2DU1A 5EXOA 4XABA 4JTNA 3JCIA 4YM0A 3J4UH 1U12A 4ZHNA 2W0XA 2OW4A 2RJLA 3A4UA 4AK3A 2BW8A 1PGL2 2DVBA 3FHQA 5A32B 1BYHA 5B4NA 3DYOA 5F1RA 5DZFA 1W28A 3I3DA 4LIUA 3SKJE 4CTEA 4KMQA 4DXSA 1OT5A 5IWFA 3FFZA 2WWSA 1POV3 3AP5A 5L9BA 2VMIA 2W47A 3ZYJB 3E5QA 3ZFEB 1LOGA 5F3EA 3WNXA 5FUPA 4A7KA 1JYTA 4FFIA 2X10A 1UAIA 5CNAA 1DGLA 1RVF3 1IQDC 1JU4A 1I6XA 1OQEA 4IE6A 1W3XA 1NCQC 1RXGA 3IDBB 2EF6A 4FSJA 4RGKA 4PBOA 4INDA 4RD7A 5J96B 4XF9A 3ACLA 1CJPA 2P3JA 2YROA 4YW7A 1UU4A 2WDBA 3ZN5A 4MHRA 1QJFA 4ATEA 4OI0A 2WNUA 3TN93 5AC93 5A3UA 4Q2FA 2WLQA 5F39A 2WR9A 1WZXA 4IGOA 2D3RA 1RUH1 4BIOA 5FZOA 1ULPA 2VCCA 3ACIA 5J09A 1IPJA 1PVC3 2QZ3A 1BXHA 3B00A 3FHAA 3NJZA 4FVVA 2AACA 2EAKA 4LKFA 3H8UA 2A75A 3QOPA 5FZHA 3RYRA 1FYUA 3HT2A 1N47A 4AEMA 4BMEA 5EJ1B 4C1XA 4BQ5A 2DUQA 4FPGA 1O6UA 3CLPA 3KGLA 1DF0A 2ZHLA 2ZKNA 2V72A 2DURA 3ZFFC 1XSQA 4AEDC 1JYIA 2Y0IA 3AP6A 5F3GA 1JHNA 5F6KA 5FZ7A 4AZZA 1WWYA 4YM2A 1KEXA 4LBQB 3ZXGA 4M3CA 1G7YA 2JDYA 1A34A 1CVNA 2YDEA 4XZUG 2HWE2 3VN4A 1VBC3 2WT0A 5GZCA 3WXPA 3LKJA 5GLVA 5KHJA 1US3A 4MH0E 1N1SA 3ZXEA 4D0QA 2ZTNA 1VBA1 5BNOA 5FMOS 4FTBA 2A6VA 2FQPA 3H1MA 3WF1A 2ORZA 5CEHA 1L7RA 2O0OA 3HN3A 2RS52 4NVPA 1G9DA 1KQRA 4WM7B 2PHDA 4MO3M 2DTYA 4OMCA 3UETA 1NLSA 4ARXA 5J1XA 5I0RA 3LFIA 5K9YA 3P1IA 5BV6A 3UGGA 4BB3A 3K75B 1TEIA 1YC61 2EXHA 4P9JA 5HXVA 3SLIA 1UW8A 1OF3A 3VBOC 2WT2A 3GDBA 4K9SA 3VBSB 4YGDA 4IEZA 1LODA 1PZ9A 3T4HB 3I2FA 3J8F1 2RJ2A 1RUD1 1PMIA 1LNSA 1QJX1 3WY6A 5A3TA 5BNNC 3APBA 3VLBB 4B1LA 5JR2A 2QBXA 4IE0A 2QQWA 1AYM2 1PM4A 5C9AB 1QXPA 2MNGA 2OPWA 2WQZC 5CFDB 4QQHA 5AVAA 3T0DA 1F4HA 1YHFA 2W9XA 3LF7A 4ZU7A 1LHNA 2Q8OA 1DGRN 3NMBA 4BQ1A 2VM9A 5DG2A 1UYYA 2O14A 3AYCA 4HKWA 3A0NA 4G4FA 3P6BA 4YLZA 4OLLA 1FOD2 2PHWA 3SXWA 3MBWA 1O3QA 4XUOA 2UY9A 1QJY3 1HDKA 1NG0A 1D4M1 4L8QA 4D7TA 2ZAAA 4QPGA 2QQLA 4HPKB 4CEYB 1NT0A 5EFUA 4JTOA 1NLRA 1D2SA 2KXLA 2RS32 4GB33 2ET7A 2XJUA 1LU2A 3DGTA 1FNZA 1ZZ7A 5FPLA 2J1EA 2GN7A 1HN0A 5LASA 3ZOIA 4D94A 2VMDA 1LJ7A 1ASJ3 2CV6A 3VHNA 3I2GA 5FJHA 3DUIA 4IL7A 1AYN2 1ZA4A 4E2SA 3AFKA 1SLAA 1SPPA 4QPYA 3I2DA 5GKAC 1IOAA 2Y26A 2WZR3 3DPRA 1EPWA 1PO23 4D7YA 1JH5A 3ZXKA 2WT1A 2FMDA 2JG8C 3OYWB 4RHV3 2XHKA 5FDBA 2K46A 2HH9A 4QXCA 2JB4A 2WFPA 2LALA 2WN2A 3POGA 1I5ZA 3T1LA 1SFYA 2QQOA 4RA0A 2H6CA 5A7WB 5T52A 3MEPA 1AL0G 3RSJA 1Q56A 2OPKA 3F95A 5K8SA 1LU1A 2VOWA 5BXXA 2XPJA 2W68A 1VBE3 1DLLA 1UZYA 2D93A 5FYMA 2W52A 2ETEA 1YEWA 2DU0A 2YV8A 3BU7A 2GP5A 2UYAA 5K4LA 1A8MA 4P9XA 1HJFA 2VQTA 5FYVA 5IVBA 3M8LA 4P08A 5LA1A 1CPNA 5FPAA 3WHTA 3B7MA 4M4PA 2R073 3HMYA 1QDOA 4IV3A 2PHUA 3BGAA
chains in the Genus database with same CATH topology
3WNMA 1T2XA 1US2A 3ACGA 1P8JA 1SDDB 4JX0A 4IUGA 4YPJA 3VD5A 4A4AA 2WABA 3A7QA 3K46A 2V5DA 5C7GA 4HG6B 1NX9A 4LKSA 1NUKA 3GXUA 4DXRA 3GM8A 2WQ8A 1GOGA 2ORXA 3PUIA 5CYYA 4A42A 4A6OA 3E1F1 4CU9A 3I3BA 3MV11 3WF0A 3MO4A 1CZVA 2WN3A 3BN6A 4BXSV 3LEIA 4W50A 2EIBA 2VZRA 5JXIA 3SKVA 1O59A 2HYXA 3IAPA 3CDZB 3HNMA 2BZDA 1EUTA 4P02B 2QQNA 4P5YA 2WYSA 4RN5A 4E8DA 4BK5A 3ACHA 3VDBA 2XOMA 3W5MA 1GNYA 5JMOA 3DYMA 3NNGA 4MGSA 1GMMA 2CDPA 1K42A 2J1AA 2B9VA 4DUVA 4CU8A 3K4ZA 2ZEWA 1K12A 2ZEYA 4A45A 3VDCA 1OF4A 1PMJX 1UYZA 3PUHA 1YQ2A 2DDUA 3LEKA 3FN9A 5IFTA 2Y6KA 2W5FA 2X05A 4QDSA 2DCKA 2ZXQA 3T0BA 1F4AA 2ZEXA 3CZUA 3OEBA 4JHZA 3WEZA 4P00B 5JXGA 4ZZ8A 4PF1A 4UAPA 5IYYA 3AC0A 5DQ0A 3I2KA 1DYOA 4BK4A 3DECA 2CDOA 3K77A 2VMCA 1SHWB 4MGQA 5FUIA 5JXJA 4CUAA 3EYPA 1GOHA 1UXXX 2YB7A 1W99A 5EJZB 2R7EB 3WNNA 1DLCA 3IB3A 2LW8A 2VO5A 3HJRA 2WO1A 1GOFA 1D7PM 3HOBA 2XHNA 2VMEA 3HPNA 4ET7A 1ULOA 4MOAA 1OH4A 2BBAA 1CZSA 5IHRA 5DMYA 3CQOA 3OGRA 4JKLA 5HXMA 5C70A 1NKGA 3VD7A 2EICA 3WF2A 5LA0A 3NJVA 4CU6A 4A44A 4BDVB 1XC6A 4L0PA 1JZ5A 3I2JA 2QQIA 2VZTA 3DYPA 3WNKA 4GZ9A 5A1AA 5B4XA 4JKKA 2J1RA 1PX3A 4QX3A 3C7GA 4QPWA 2VC9A 3ECQA 2W1SA 5IJRA 2BGOA 4OUEA 3VD4A 4UOJA 3LQCA 3VDAA 4BJ0A 3VD9A 3D3AA 4QDRA 4TXWA 4CUBA 4A3ZA 5JUVA 1JZ8A 3I2IA 2KD7A 3HEIA 4M4RA 2B4KA 4QX0A 1JZ2A 2ZEZA 2VMFA 4AG4A 2YG0A 3HNBM 3ACFA 2VZ3A 2ID4A 1KGYA 2W46A 2VZSA 1H6YA 5F7UA 2W92A 3WNLA 3CZJA 1JZ4A 2VCAA 2EIDA 3U37A 2XONA 3WF4A 1NAEA 1BHGA 1JHJA 4QB1A 1W9TA 1CIYA 1H6XA 4XUPA 2W3JA 2W91A 4CU7A 1JZ3A 4GWJA 5IFPA 4DUWA 2JKXA 5I0DA 3OB8A 1JZ6A 3LEGA 3WQBA 1JYXA 4LHSA 3OEAA 3I3EA 4KWUA 3LE0A 2L9LA 2WZEA 5C71A 2X09A 1JYVA 4XUTA 4ZZ5A 2VZQA 4ZXEA 2WZ8A 3EB7A 2JD9A 3IDAA 5G05L 1UMIA 3OG2A 1WKYA 2YC2A 5LA2A 2YFZA 5DPNA 5CZKA 1GUIA 4CVUA 4PT6A 3K4AA 3T2OA 3C7FA 3WF3A 2V4VA 4D8MA 4DEVA 2W95A 2W1QA 2E31A 3C7OA 1JU3A 3SEEA 4OZOA 3WNPA 3VD3A 3LPGA 3UESA 3MUZ1 3T2PA 2RVAA 2WBKA 2YFUA 4GWIA 3ETPA 3MUY1 1MPXA 3A21A 4JKMA 3NRUA 2JDAA 2VOTA 1R64A 2E33A 2VR4A 3GGLA 1UZ0A 2J22A 1O8SA 2J7MA 3WSOA 4TTGA 3T2QA 3FHQA 2J1UA 1TG7A 5B4NA 3DYOA 5DN2A 2Z4FA 1O8PA 3I3DA 2PQSA 3SKJE 4KMQA 4DXSA 1OT5A 4XUQA 1I5PA 3WNOA 1PX4A 2W47A 2VJXA 1HN1A 4QB2A 2E32A 4LPLA 4XUNA 2W1UA 1TVGA 2X10A 2W94A 4E8CA 1JI6A 1IQDC 1JU4A 2VL4A 1W9WA 1XNAA 3THCA 2JE8A 2EIEA 1UXZA 3UNPA 1J83A 2Y6GA 4DXTA 2QQJA 3C8XA 2WDBA 3THDA 3IIIA 2VZUA 2VZVA 1ULPA 2VCCA 3ACIA 1DP0A 3FHAA 2QQKA 1XNTA 2VZOA 1UY0A 2Y64A 1XPWA 4XURA 5EJ1B 1W8NA 4ARYA 2V72A 2VTFA 2WAAA 4PQQA 5JXHA 3CIHA 3A23A 1JYNA 5EIYB 3LPFA 1KEXA 4CUCA 1W0NA 3F2ZA 3MV01 4XZUG 1W8OA 2BGPA 1JYWA 1US3A 1EUUA 3C7EA 2VZ1A 2Y6LA 4LQRA 4D0QA 3CMGA 2WAOA 3WF1A 1J84A 2ORZA 2W87A 2WO2A 1L7RA 2QQMA 3HN3A 3SEPA 4MO3M 4OMCA 4ARXA 3UETA 5J1XA 3P1IA 4QX1A 1WCQA 3K75B 1OF3A 3GDBA 4RYDA 4A41A 3I2FA 2RJ2A 1UX7A 2C26A 4Z2AA 3J7HA 3K4DA 1LNSA 1K3IA 5JR2A 2QBXA 1GU3A 1UYXA 1UMHA 4QAWA 3OGSA 1UWWA 3I97A 2Y6JA 3T0DA 1GQPA 1F4HA 2W9XA 4KI5M 2J1SA 2VZPA 3NJXA 1CZTA 2VM9A 4XVHA 1UYYA 2WO3A 3ZM8A 3C7HA 3P6BA 4QX2A 3MBWA 2C9KA 4XUOA 2BERA 2J1VA 2QQLA 1RYYA 3I2HA 3T08A 2YC4A 3OBAA 5LCWL 2J1TA 1L7QA 2J1EA 5G04L 2E26A 1CX1A 2C4XA 2VMDA 4MADA 2RV9A 3HNYM 4AAXA 3I2GA 2HLEA 2Y8KA 3OGVA 3T0AA 1JZ7A 3JXSA 4QB6A 4UI9L 1W9SA 1OD3A 3CKHA 2XQXA 1UY2A 4DEQA 4W4ZA 3W5NA 3ABZA 2OKXA 2WN2A 2QQOA 2WUHA 4FI9A 2Y6HA 4ZY9A 2DCJA 1UY4A 3T09A 2VQUA 5HPOA 2W1WA 1PMHX 3NQHA 2VQTA 2VCBA 1K45A 4P08A 5LA1A 4W8JA 1SG3A 3A22A 3FL7A 4OYUA 3IAQA 4OMDA 4QDQA 2LS6A 4M4PA 1UY3A 4DUXA 1UY1A 3BGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNM A;  1T2X A;  1US2 A;  3ACG A;  1P8J A;  1SDD B;  4JX0 A;  4IUG A;  4YPJ A;  3VD5 A;  4A4A A;  2WAB A;  3A7Q A;  3K46 A;  2V5D A;  5C7G A;  4HG6 B;  1NX9 A;  4LKS A;  1NUK A;  3GXU A;  4DXR A;  3GM8 A;  2WQ8 A;  1GOG A;  2ORX A;  3PUI A;  5CYY A;  4A42 A;  4A6O A;  3E1F 1;  4CU9 A;  3I3B A;  3MV1 1;  3WF0 A;  3MO4 A;  1CZV A;  2WN3 A;  3BN6 A;  4BXS V;  3LEI A;  4W50 A;  2EIB A;  2VZR A;  5JXI A;  3SKV A;  1O59 A;  2HYX A;  3IAP A;  3CDZ B;  3HNM A;  2BZD A;  1EUT A;  4P02 B;  2QQN A;  4P5Y A;  2WYS A;  4RN5 A;  4E8D A;  4BK5 A;  3ACH A;  3VDB A;  2XOM A;  3W5M A;  1GNY A;  5JMO A;  3DYM A;  3NNG A;  4MGS A;  1GMM A;  2CDP A;  1K42 A;  2J1A A;  2B9V A;  4DUV A;  4CU8 A;  3K4Z A;  2ZEW A;  1K12 A;  2ZEY A;  4A45 A;  3VDC A;  1OF4 A;  1PMJ X;  1UYZ A;  3PUH A;  1YQ2 A;  2DDU A;  3LEK A;  3FN9 A;  5IFT A;  2Y6K A;  2W5F A;  2X05 A;  4QDS A;  2DCK A;  2ZXQ A;  3T0B A;  1F4A A;  2ZEX A;  3CZU A;  3OEB A;  4JHZ A;  3WEZ A;  4P00 B;  5JXG A;  4ZZ8 A;  4PF1 A;  4UAP A;  5IYY A;  3AC0 A;  5DQ0 A;  3I2K A;  1DYO A;  4BK4 A;  3DEC A;  2CDO A;  3K77 A;  2VMC A;  1SHW B;  4MGQ A;  5FUI A;  5JXJ A;  4CUA A;  3EYP A;  1GOH A;  1UXX X;  2YB7 A;  1W99 A;  5EJZ B;  2R7E B;  3WNN A;  1DLC A;  3IB3 A;  2LW8 A;  2VO5 A;  3HJR A;  2WO1 A;  1GOF A;  1D7P M;  3HOB A;  2XHN A;  2VME A;  3HPN A;  4ET7 A;  1ULO A;  4MOA A;  1OH4 A;  2BBA A;  1CZS A;  5IHR A;  5DMY A;  3CQO A;  3OGR A;  4JKL A;  5HXM A;  5C70 A;  1NKG A;  3VD7 A;  2EIC A;  3WF2 A;  5LA0 A;  3NJV A;  4CU6 A;  4A44 A;  4BDV B;  1XC6 A;  4L0P A;  1JZ5 A;  3I2J A;  2QQI A;  2VZT A;  3DYP A;  3WNK A;  4GZ9 A;  5A1A A;  5B4X A;  4JKK A;  2J1R A;  1PX3 A;  4QX3 A;  3C7G A;  4QPW A;  2VC9 A;  3ECQ A;  2W1S A;  5IJR A;  2BGO A;  4OUE A;  3VD4 A;  4UOJ A;  3LQC A;  3VDA A;  4BJ0 A;  3VD9 A;  3D3A A;  4QDR A;  4TXW A;  4CUB A;  4A3Z A;  5JUV A;  1JZ8 A;  3I2I A;  2KD7 A;  3HEI A;  4M4R A;  2B4K A;  4QX0 A;  1JZ2 A;  2ZEZ A;  2VMF A;  4AG4 A;  2YG0 A;  3HNB M;  3ACF A;  2VZ3 A;  2ID4 A;  1KGY A;  2W46 A;  2VZS A;  1H6Y A;  5F7U A;  2W92 A;  3WNL A;  3CZJ A;  1JZ4 A;  2VCA A;  2EID A;  3U37 A;  2XON A;  3WF4 A;  1NAE A;  1BHG A;  1JHJ A;  4QB1 A;  1W9T A;  1CIY A;  1H6X A;  4XUP A;  2W3J A;  2W91 A;  4CU7 A;  1JZ3 A;  4GWJ A;  5IFP A;  4DUW A;  2JKX A;  5I0D A;  3OB8 A;  1JZ6 A;  3LEG A;  3WQB A;  1JYX A;  4LHS A;  3OEA A;  3I3E A;  4KWU A;  3LE0 A;  2L9L A;  2WZE A;  5C71 A;  2X09 A;  1JYV A;  4XUT A;  4ZZ5 A;  2VZQ A;  4ZXE A;  2WZ8 A;  3EB7 A;  2JD9 A;  3IDA A;  5G05 L;  1UMI A;  3OG2 A;  1WKY A;  2YC2 A;  5LA2 A;  2YFZ A;  5DPN A;  5CZK A;  1GUI A;  4CVU A;  4PT6 A;  3K4A A;  3T2O A;  3C7F A;  3WF3 A;  2V4V A;  4D8M A;  4DEV A;  2W95 A;  2W1Q A;  2E31 A;  3C7O A;  1JU3 A;  3SEE A;  4OZO A;  3WNP A;  3VD3 A;  3LPG A;  3UES A;  3MUZ 1;  3T2P A;  2RVA A;  2WBK A;  2YFU A;  4GWI A;  3ETP A;  3MUY 1;  1MPX A;  3A21 A;  4JKM A;  3NRU A;  2JDA A;  2VOT A;  1R64 A;  2E33 A;  2VR4 A;  3GGL A;  1UZ0 A;  2J22 A;  1O8S A;  2J7M A;  3WSO A;  4TTG A;  3T2Q A;  3FHQ A;  2J1U A;  1TG7 A;  5B4N A;  3DYO A;  5DN2 A;  2Z4F A;  1O8P A;  3I3D A;  2PQS A;  3SKJ E;  4KMQ A;  4DXS A;  1OT5 A;  4XUQ A;  1I5P A;  3WNO A;  1PX4 A;  2W47 A;  2VJX A;  1HN1 A;  4QB2 A;  2E32 A;  4LPL A;  4XUN A;  2W1U A;  1TVG A;  2X10 A;  2W94 A;  4E8C A;  1JI6 A;  1IQD C;  1JU4 A;  2VL4 A;  1W9W A;  1XNA A;  3THC A;  2JE8 A;  2EIE A;  1UXZ A;  3UNP A;  1J83 A;  2Y6G A;  4DXT A;  2QQJ A;  3C8X A;  2WDB A;  3THD A;  3III A;  2VZU A;  2VZV A;  1ULP A;  2VCC A;  3ACI A;  1DP0 A;  3FHA A;  2QQK A;  1XNT A;  2VZO A;  1UY0 A;  2Y64 A;  1XPW A;  4XUR A;  5EJ1 B;  1W8N A;  4ARY A;  2V72 A;  2VTF A;  2WAA A;  4PQQ A;  5JXH A;  3CIH A;  3A23 A;  1JYN A;  5EIY B;  3LPF A;  1KEX A;  4CUC A;  1W0N A;  3F2Z A;  3MV0 1;  4XZU G;  1W8O A;  2BGP A;  1JYW A;  1US3 A;  1EUU A;  3C7E A;  2VZ1 A;  2Y6L A;  4LQR A;  4D0Q A;  3CMG A;  2WAO A;  3WF1 A;  1J84 A;  2ORZ A;  2W87 A;  2WO2 A;  1L7R A;  2QQM A;  3HN3 A;  3SEP A;  4MO3 M;  4OMC A;  4ARX A;  3UET A;  5J1X A;  3P1I A;  4QX1 A;  1WCQ A;  3K75 B;  1OF3 A;  3GDB A;  4RYD A;  4A41 A;  3I2F A;  2RJ2 A;  1UX7 A;  2C26 A;  4Z2A A;  3J7H A;  3K4D A;  1LNS A;  1K3I A;  5JR2 A;  2QBX A;  1GU3 A;  1UYX A;  1UMH A;  4QAW A;  3OGS A;  1UWW A;  3I97 A;  2Y6J A;  3T0D A;  1GQP A;  1F4H A;  2W9X A;  4KI5 M;  2J1S A;  2VZP A;  3NJX A;  1CZT A;  2VM9 A;  4XVH A;  1UYY A;  2WO3 A;  3ZM8 A;  3C7H A;  3P6B A;  4QX2 A;  3MBW A;  2C9K A;  4XUO A;  2BER A;  2J1V A;  2QQL A;  1RYY A;  3I2H A;  3T08 A;  2YC4 A;  3OBA A;  5LCW L;  2J1T A;  1L7Q A;  2J1E A;  5G04 L;  2E26 A;  1CX1 A;  2C4X A;  2VMD A;  4MAD A;  2RV9 A;  3HNY M;  4AAX A;  3I2G A;  2HLE A;  2Y8K A;  3OGV A;  3T0A A;  1JZ7 A;  3JXS A;  4QB6 A;  4UI9 L;  1W9S A;  1OD3 A;  3CKH A;  2XQX A;  1UY2 A;  4DEQ A;  4W4Z A;  3W5N A;  3ABZ A;  2OKX A;  2WN2 A;  2QQO A;  2WUH A;  4FI9 A;  2Y6H A;  4ZY9 A;  2DCJ A;  1UY4 A;  3T09 A;  2VQU A;  5HPO A;  2W1W A;  1PMH X;  3NQH A;  2VQT A;  2VCB A;  1K45 A;  4P08 A;  5LA1 A;  4W8J A;  1SG3 A;  3A22 A;  3FL7 A;  4OYU A;  3IAQ A;  4OMD A;  4QDQ A;  2LS6 A;  4M4P A;  1UY3 A;  4DUX A;  1UY1 A;  3BGA A; 
#chains in the Genus database with same CATH topology
 3HQR A;  1YFY A;  2V73 A;  3NNM A;  5D2A A;  1W0P A;  3ACG A;  2VMG A;  3EO6 A;  4JX0 A;  1W39 A;  3M3C A;  4AI8 A;  1NQD A;  1SEF A;  1SBE A;  4F3J A;  1ZBA 3;  4TYS A;  1RJ8 A;  5FYY A;  2ARE A;  5GM0 A;  2K9Z A;  2PLV 3;  2WRA A;  4BMB A;  2WNU C;  1NZC A;  5FZ0 A;  1NUK A;  4Q4Y 1;  2XJQ A;  1VAM A;  4JQR A;  5A33 B;  2X5I B;  4COZ A;  4R9D A;  2DTW A;  4UBG A;  2D6M A;  2GH2 A;  2ORX A;  5CYY A;  4NN0 A;  3FHI B;  1SZB A;  3GHM A;  1XE8 A;  1XRU A;  2WA4 A;  3I3B A;  3WF0 A;  3MO4 A;  4NWV A;  3FLT A;  4CE8 A;  2D5F A;  3W9A A;  4S2F A;  5JPN B;  2EIB A;  1AJO A;  2BEO A;  2VZR A;  3OPT A;  1PK6 A;  4ISQ A;  3ZXD A;  4HN1 A;  4BM8 A;  5JXI A;  1LHW A;  3IAP A;  3S0M A;  1QQP 3;  1LUL A;  2XBO 1;  3OJB A;  3CL1 A;  4FOY A;  4FO9 A;  5FMC A;  4J25 A;  1NE6 A;  1VBD 2;  5KBF A;  2WYS A;  1AR9 1;  3OY8 A;  5FP3 A;  1OQD A;  4BK5 A;  3VDB A;  1DG6 A;  2XOM A;  2NPI A;  1VAK A;  2VW2 A;  1GNY A;  3M3I A;  3NW4 A;  4AFB A;  4CCD A;  3DYM A;  5HV4 A;  1LGB A;  2WQ4 A;  3BVC A;  3NNG A;  1LR5 A;  1RUJ 2;  1K42 A;  3D4K A;  4B7K A;  2B9V A;  3ZKY A;  5BNO C;  1KS5 A;  1HXS 1;  2Q1M A;  2EVX A;  3WDW A;  5C5U A;  4Q4W 2;  3BPZ A;  5DAV A;  2BVB A;  3WVJ A;  2GP3 A;  3MLL A;  5A6Y A;  1B35 A;  3H7J A;  2TUN A;  2WNV B;  3IT8 A;  2G9G A;  3R4S A;  4OHW A;  3K51 A;  1FAT A;  1OF4 A;  4R8H A;  5B2G B;  5FO9 B;  3PUH A;  4DRV A;  5FKB A;  1YQ2 A;  3VKN A;  3ZPO A;  4B4Q A;  3VZJ A;  3KWV A;  1Q8V A;  4X6R B;  1Y9G A;  2ES3 A;  2Y6K A;  4BHP A;  4M3C F;  1PGS A;  1QJZ A;  3LCP A;  2ZX0 A;  4BIF A;  1RIR A;  2DF7 A;  1GQG A;  2HWC 1;  1S4C A;  3ZFG B;  4AWD A;  2X05 A;  4PIX A;  4QDS A;  4AVA A;  4LE4 A;  5ABJ A;  3CZU A;  2QQU A;  2VU9 A;  2NYY A;  3OEB A;  3WEZ A;  4P00 B;  3S30 A;  1PIV 2;  1RL3 A;  2NZ9 A;  2RG4 A;  4QGM A;  5TSW A;  4PF1 A;  3U10 A;  4FFF A;  5IYY A;  3AC0 A;  1SAC A;  2WSV A;  2VUA A;  4RL7 A;  2E63 A;  5DDJ 2;  1QOT A;  1VAL A;  3DEC A;  1GBG A;  3VDD B;  2YMZ A;  1ND3 A;  1SHW B;  5CG9 A;  1FPN 3;  2OII A;  3ILN A;  1ZBE 1;  1GOH A;  3N3H A;  3NV1 A;  4DQA A;  3SC7 X;  4FPO B;  3WP4 A;  1H2N A;  4QKB A;  4QPG C;  5IK8 A;  3E6D A;  5EJZ B;  4JGZ C;  1DQ2 A;  2R7E B;  3WNN A;  1ZRE A;  2FMY A;  4AR2 A;  3IB3 A;  1Y4W A;  4CCJ A;  4CA9 A;  5JSP A;  2EXI A;  1FMD 1;  1FV3 A;  2HWF 3;  2VO5 A;  4QD2 A;  3HJR A;  4GH4 B;  2GAL A;  4Q26 A;  1UCX A;  1WBF A;  4GD4 A;  3HOB A;  1HRI 3;  3RWN A;  2XHN A;  1WCS A;  2VME A;  2PXJ A;  4LOT A;  1ULO A;  5FBZ A;  4LKD A;  3H3Z A;  4LXL A;  4OHX A;  3GZT B;  1H9W A;  3AKT A;  5F9T A;  1Q8P A;  1RMU 2;  4I01 A;  3AP7 A;  2AH2 A;  3RG0 A;  2R04 1;  4A7Y A;  4Z82 A;  1DYK A;  2HBU A;  1ND2 A;  1DU3 D;  2KR2 A;  4JKL A;  4QHB A;  3WW4 A;  3PVO A;  3DPR C;  4E4D X;  1NKG A;  5JOZ A;  3IIA A;  2W39 A;  3CNA A;  1ST8 A;  4XF1 A;  1FV2 A;  2YBK A;  1WD4 A;  4YW3 A;  5FYI A;  2G19 A;  2Y34 A;  5CKM A;  3I54 A;  3RZG A;  4Q0S A;  4AFA A;  3KSC A;  1BBT 2;  3NJV A;  4OZX A;  1YI9 A;  4PLM A;  2FDG A;  2TEP A;  4UFJ A;  1UOJ A;  2VPV A;  4XJZ A;  1HRV 2;  5FZE A;  4Y26 A;  1U5Z A;  3KT4 A;  4Q0P A;  4PCR A;  4Y33 A;  1V6J A;  2RMU 1;  1OXC A;  3DYP A;  2WYF A;  5FZI A;  5DAW A;  4FAH A;  3EMR A;  3WNK A;  4XFI A;  4H3W A;  1BQP A;  1LOC A;  3MIG A;  4JKK A;  1S0B A;  4TLG A;  1BEV 2;  2QQP A;  1S55 A;  3FUQ A;  2VC9 A;  2P3Y A;  2VW1 A;  4EN8 B;  5IAT A;  1O4T A;  2R30 A;  3OGG A;  5IJR A;  4AFC A;  2LUW A;  3VDA A;  4B7E A;  1X7N A;  5EHD A;  1MZ6 A;  4IV3 C;  3TRS B;  5A7Q A;  3AB0 A;  2YHJ A;  2R0H A;  4QDR A;  1SBF A;  4CP0 A;  1TME 1;  3ZXJ A;  5AFE A;  1JZ8 A;  1C3H A;  2KD7 A;  3HEI A;  5SV5 A;  4U36 A;  4CCK A;  3RYK A;  3BTY A;  3NV4 A;  4KBB A;  3D82 A;  4YW4 A;  3GCW A;  5E88 A;  2HWD 3;  2BOI A;  1DQ1 A;  2ZEZ A;  4XF4 A;  3RMY A;  1MS0 A;  1OUX A;  1TMF 3;  4PDW C;  3FWE A;  2YG0 A;  3ACF A;  1YLL A;  3VBH A;  3R4D B;  3LOI A;  1EYB A;  3AMM A;  5EPA A;  4E4S A;  3NWK A;  5C8C B;  2ADE A;  3N7K A;  4LJH A;  3LIG A;  4MSV A;  3PU3 A;  3S57 A;  1OLM E;  1G9F A;  3JBG 1;  4Y1Z A;  1YQ5 A;  3H3U A;  4HKO A;  1PK6 C;  1H6Y A;  1C28 A;  1XB9 A;  3E5U A;  3FC0 A;  5CAZ A;  1ODN A;  3WNL A;  5F7U A;  3CZJ A;  1JZ4 A;  5T3N A;  5DUV A;  1YIP A;  4NE9 A;  2Z79 A;  4XFH A;  3ZSM A;  2VE1 A;  2XON A;  4ZS2 A;  3WF4 A;  1RVF 2;  3KV4 A;  2YU2 A;  2XH6 A;  1ZRF A;  2VTX J;  4XUP A;  3ZR6 A;  2BVV A;  4Q4X 1;  3USU B;  4FQZ A;  2RM2 3;  3VBU A;  4GWJ A;  1PHM A;  4UW6 A;  4C91 A;  2JEM A;  2XWB B;  2JKX A;  2WA3 A;  1APN A;  1NZI A;  1XNK A;  2R1D A;  4I3P A;  3PHM A;  3RZK A;  3TN9 2;  5A3P A;  3B93 A;  5AC9 2;  4XJ9 A;  2CSG A;  1O3T A;  2GC0 A;  1B35 C;  3HBK A;  4Q0U A;  3T30 A;  1ZRI A;  2P5B A;  2WZE A;  1XND A;  1PVC 2;  1QHD A;  2NMO A;  3D0J A;  4XUT A;  1GZ9 A;  3ATG A;  4ZZ5 A;  3EBR A;  5ACA 3;  3S5A A;  3B3Q E;  2PAK A;  3EXU A;  3ORJ A;  2HWE 1;  2FZ1 A;  3EB7 A;  4MLO A;  2JD9 A;  2UYB A;  1BMV 1;  5JSR A;  2ERF A;  1OSG A;  4ATF A;  4C0H A;  1UD1 A;  4KG8 A;  1RTV A;  5ABJ C;  1EAH 1;  1LES A;  2R06 3;  4S2D A;  1W6M B;  1C1L A;  5LRS A;  3N9Q A;  2P37 A;  1GUI A;  3MFA A;  4PT6 A;  5CFC B;  1VBC 2;  1GR3 A;  3IPV B;  4HVO A;  3K4A A;  1F35 A;  2V4V A;  3CJI B;  4ORF A;  1ND3 C;  2W95 A;  3PVB B;  5FMB A;  2Z42 A;  1OLQ A;  3R05 A;  1AX1 A;  4UFM A;  2J42 A;  2F17 A;  2P3I A;  4OZO A;  2ZX4 A;  2VCM A;  3VD3 A;  5IT6 A;  2EXJ A;  1OVS A;  5GZE A;  1ZM1 A;  4FFG A;  5JZG B;  1F31 A;  3C3V A;  1V70 A;  4XQW A;  5GAL A;  3A21 A;  4JKM A;  5KWR A;  3NRU A;  1UZV A;  2VOT A;  2XVK A;  3MDP A;  5CBL A;  2BNN A;  2GZW A;  3IZO A;  2VR4 A;  4FXK B;  1NLQ A;  1V0A A;  2PAE A;  3GGL A;  4M3C E;  5LBE A;  1JOD A;  5T5J A;  2GC2 A;  1GP5 A;  4NO4 A;  4EN6 B;  5L7O A;  3ZLI A;  1VAV A;  3WSO A;  1O5L A;  1WME A;  4FQ4 A;  3T2Q A;  1AR7 1;  1DZR A;  1JMU B;  1LHU A;  1Q8O A;  2PHX A;  4IEW A;  4O9E A;  5E16 A;  3O14 A;  5IW0 A;  4Q4V 3;  3AYA A;  4AL9 A;  2BBV A;  3BIE A;  1H30 A;  5GLU A;  2Z4F A;  2ZGT A;  3O0V A;  4HON A;  5C8W A;  2FDI A;  1UYP A;  1CAW A;  3LA7 A;  1W6N B;  1XOY A;  1ND2 C;  1AR8 3;  1DYP A;  3URF A;  2VJX A;  1HN1 A;  4RR3 B;  4SBV A;  4AE2 A;  4LPL A;  5C9A A;  1VPH A;  1OKO A;  1RUE 1;  5CFD A;  2OQ6 A;  1CAV B;  2YZ4 A;  3WG2 A;  1TVG A;  4E8C A;  2BFU L;  1QJY 2;  3KD4 A;  4CDX B;  1HV1 A;  1MEC 3;  1LHV A;  2GND A;  3WHU A;  2VL4 A;  1AR6 2;  5FYS A;  1XNA A;  1N1V A;  4GB3 2;  3OPZ A;  4PI2 A;  1QF3 A;  1GNZ A;  3DXT A;  3HIF A;  2Y6G A;  4ERO A;  1FX5 A;  2QQJ A;  4NPR A;  4EN9 B;  1AYN 1;  3POY A;  3JU9 A;  5E6H A;  2VZU A;  2WS9 1;  1QJU 2;  3Q8F A;  4CEY A;  4LBL A;  5FK7 A;  3NNJ A;  5A6Q A;  2IZW A;  1HKD A;  1ASJ 2;  1RHI 3;  2ADD A;  2VTX A;  4HAN A;  4D6R A;  5DZE A;  5A80 A;  2QQK A;  3QBQ A;  5FJK A;  4D69 A;  4XUR A;  2QVS B;  2WZR 2;  1RUG 1;  2HEV F;  1PO2 2;  5JDB A;  1PO1 3;  4K7J A;  2WAA A;  1RUI 3;  4LT5 A;  5CVR A;  1DGW X;  1CR7 A;  4AI3 A;  5E8A A;  5JXH A;  3CIH A;  4OI2 A;  2PA7 A;  4I0W B;  2G9Z A;  4FOW A;  1DGR A;  5SV8 A;  1JYN A;  4RHV 2;  2HEY F;  1G9B A;  3AMQ A;  3LPF A;  4CUC A;  1GWM A;  2AEY A;  2JEC A;  1YXW A;  2JD4 A;  3FX3 A;  3GBG A;  2H6B A;  3BI3 A;  3RWK X;  1BCX A;  4IEU A;  1C1F A;  4IEP A;  1WMD A;  1VBE 2;  2QZ2 A;  3MPB A;  1JW6 A;  2WAO A;  4ZXK A;  1J84 A;  4QPI B;  4X8N A;  1NCR B;  3VBH C;  2B39 A;  3AXD A;  1A3K A;  5F5I A;  1OOP B;  4LHN A;  3I59 B;  4Y20 B;  2JXA A;  5A7W A;  2D98 A;  4XHX A;  4XFC A;  2UWB A;  1IS5 A;  1E5I A;  2Z2S B;  2IXH A;  1I1E A;  5C3R A;  1YFX A;  5BY5 A;  3CO2 A;  4Y5Z 0;  4BA6 A;  4NRP A;  5DAB A;  1C8M 1;  2XUM A;  1EP0 A;  3J7M A;  4CP2 A;  2XR4 A;  3DXU A;  2JDP A;  4Z2A A;  3J7H A;  4K21 A;  1CQ9 A;  4GKX A;  2VNR A;  4BQ2 A;  1GU3 A;  3VBU C;  2P34 A;  1NY7 1;  4DPN A;  3ZFE C;  1UWW A;  2XVG A;  3N7J A;  1RUH 3;  1ZBA 2;  3I97 A;  4Q8L A;  5HCB A;  5KXE A;  1R09 2;  2PLV 2;  4P9I A;  5IAX A;  2ZGL A;  1N3P A;  2VZP A;  1AXK A;  3NJX A;  5J36 A;  3HBZ A;  1WGP A;  3RI9 A;  4EN0 A;  4XVH A;  4I02 A;  4CCO A;  4W6W A;  5FIX A;  2WO3 A;  3ZM8 A;  4EWA A;  1A78 A;  4X8P A;  2E51 A;  2CGN A;  1VBD 1;  1AUY A;  2VXR A;  4CDW B;  1S0G A;  5HCH A;  2J1V A;  3POJ A;  2CAV A;  1QGL A;  3BTX A;  4JC1 A;  4NAM A;  3I2H A;  2ZBJ A;  1QQP 2;  1I3H A;  5IK5 A;  4NIH A;  5F5Q A;  3W59 A;  1VBA 3;  1L7Q A;  2ENR A;  5I0U A;  1ENQ A;  3VHR A;  2OA2 A;  4Q4W 1;  3ZN6 A;  4HVR A;  1YI7 A;  4JRL A;  1DIW A;  1X50 A;  2E26 A;  2YXS A;  3MF6 A;  4OHZ A;  4P5H A;  1SFN A;  1YRZ A;  4BOW A;  2GNT A;  3NV2 A;  4MG2 A;  1GNH A;  5F3C A;  1W2A X;  3POB A;  4CDQ B;  5HBA A;  1PZ7 A;  2HLE A;  2ZGR A;  2GME A;  3CF6 E;  2CL2 A;  5I8T A;  2JG9 A;  2VBD A;  5FQ0 B;  1STM A;  1NE4 A;  3PMS A;  1YQ8 A;  2GNM A;  1VBB 1;  1JZ7 A;  4C8D A;  3JXS A;  3W58 A;  3J8F 3;  1LGC A;  3N7M A;  4QB6 A;  1RUD 3;  4UI9 L;  1QJX 3;  2HWB 1;  1QH6 A;  1W9S A;  1H8V A;  3IN9 A;  3RS6 A;  1QEX A;  4OFG A;  5A7S A;  3ABZ A;  4L99 A;  4OI1 A;  4XW3 A;  4XJA A;  1AVB A;  1N1T A;  1W2U A;  2WUH A;  4FI9 A;  3JD7 1;  5L7O C;  2QDN A;  4RQP B;  3PUR A;  4ZY9 A;  2DCJ A;  1ZZ6 A;  1ZRC A;  1H2L A;  4ES8 A;  4PF5 A;  1UY4 A;  5FZ9 A;  3T09 A;  1CN1 A;  2VQU A;  3U1X A;  4EZ4 A;  5LB6 A;  3SCH A;  1I9R A;  4Q27 A;  5HPO A;  1PMH X;  5H9P A;  2LRO A;  2XJT A;  1O4Z A;  1D4M 3;  2OZ6 A;  3ELN A;  4W8J A;  4BH9 A;  3A22 A;  1REE A;  2WII B;  2BWA A;  3SIT A;  5C9A C;  3WCR A;  2JDU A;  1FPN 2;  4OMD A;  4QDQ A;  2LS6 A;  2PYT A;  3WP5 A;  5CFD C;  2HBT A;  1VRH 1;  3RZL A;  4JGY A;  5LK7 B;  2CU5 A;  3L2H A;  4N43 B;  5JOW A;  4CYD A;  2JIC A;  1T2X A;  3O1T A;  3J9S A;  2DUP A;  2XL7 A;  4E4Z A;  1EY2 A;  1JOJ A;  1P8J A;  1SDD B;  5CKQ A;  4YPJ A;  2CYF A;  4A4A A;  1XE7 A;  3NO8 A;  3A7Q A;  2HWF 2;  4AYU A;  3ZXL A;  1OH3 A;  5C7G A;  4HG6 B;  2W2I A;  1DQ5 A;  1HRI 2;  4AVC A;  1VLN A;  4LO6 B;  5I8Y A;  2VXJ A;  2E7Q A;  3GXU A;  5C3P A;  2PEL A;  4CEY C;  2E7A A;  4DXR A;  1OFS A;  4LLO A;  2WQ8 A;  1GOG A;  1JUH A;  1W6Q A;  3PUI A;  5D8A B;  2PTM A;  4CU9 A;  3WZ1 A;  2XL9 A;  3MV1 1;  4Y22 A;  2WN3 A;  3HD8 B;  5HCF A;  3ZO0 B;  3BN6 A;  3LEI A;  4W50 A;  2XKO A;  4CDU B;  2D5H A;  4OQ8 A;  2HYX A;  1OMI A;  4XAE A;  3CDZ B;  1J3Q A;  2MPF A;  3SHR A;  4FP3 A;  1QMJ A;  3K3O A;  3AZY A;  2IWG B;  4IV1 B;  1C8N A;  2C9A A;  1W6O B;  2FDF A;  3WOG A;  4IE4 A;  4E8D A;  1KXG A;  2ZJC A;  3L9J T;  4AAP A;  3P5B A;  3GNE A;  4XAC A;  3RRD A;  2ZHM A;  5I0S A;  1LEC A;  3I49 A;  4MGS A;  2TNF A;  1R08 2;  4M01 A;  3U0Z A;  2MEV 1;  4LIV A;  5EZW A;  3K4Z A;  4WBB A;  4YGE A;  1ENX A;  3IDE A;  4A3X A;  4KGQ A;  1AX0 A;  2Q0A A;  4J6G A;  4A45 A;  2PMW B;  3B69 A;  1S2B A;  3VDC A;  3BAL A;  2BYV E;  1Z7S 1;  4LNV A;  3O1R A;  1IG3 A;  2OS2 A;  2PHF A;  4PBP A;  2DDU A;  1VP6 A;  2Z5W A;  1W3V A;  3N9L A;  3ZX7 A;  3X29 B;  2VOX A;  4DZG A;  3FN9 A;  4YM1 A;  4NRO A;  3AMP A;  2W5F A;  4LK7 A;  5EQU A;  2P6C A;  2E53 A;  3H42 B;  2ZXQ A;  2YGL A;  4UBH A;  5FYU A;  1NCQ B;  2ZEX A;  4Q4Y 3;  2R0F A;  5I0T A;  1COV 1;  1S2K A;  4IEX A;  4ZZ8 A;  3PUQ A;  4YVW B;  4JGZ A;  1D0G A;  1SDW A;  2HWD 2;  1D4V B;  5DQ0 A;  3O0W A;  5C5T A;  3I2K A;  4XQD A;  2SLI A;  2VGD A;  1TMF 2;  3THT A;  2NLR A;  1F5J A;  5FZ8 A;  2VMC A;  3ZYG A;  4MGQ A;  5FUI A;  2VUJ A;  3LSE A;  5E1R A;  1ACC A;  4BZ4 A;  5JXJ A;  4TZD A;  2XBO 3;  4N7I A;  3ZYI B;  3N9P A;  5CAD A;  2YB7 A;  3N9M A;  1AR9 3;  5FP8 A;  3VL9 A;  3SMH A;  1DLC A;  1MQT B;  4XMI A;  1Q3E A;  5FUN A;  3ZFF B;  2LW8 A;  4FPK A;  4W65 A;  1AZD A;  1VRB A;  1S0E A;  1X9P A;  2Q8E A;  4HK8 A;  5C8C A;  1G9C A;  2WO1 A;  1CAX B;  1UZZ A;  1D7P M;  2ZA9 A;  2BPA 2;  3FMG A;  3VBR A;  1HXS 3;  3ZYF A;  4ET7 A;  3B01 A;  4NAO A;  5DAP A;  4MOA A;  2RM2 2;  3KV6 A;  4DXZ A;  4JQT A;  1W8H A;  4F8A A;  3O1S A;  2WNO A;  4UW4 A;  1UIK A;  3RZH A;  1GP4 A;  2VVF A;  2HYK A;  4DNY A;  2I07 B;  1XXN A;  1HB1 A;  1W8Z A;  2B5H A;  2ZMN A;  4WVV A;  1YJL A;  3ZKU A;  5FYB A;  4CEW B;  2JG9 C;  3OGR A;  5IK7 A;  4MUV A;  4UF0 B;  1W8U A;  2LRP A;  3AZW A;  5C70 A;  2YU1 A;  3O1M A;  5A3L A;  3MI8 A;  2YGM A;  3TNP B;  5JAX A;  4GQ7 A;  1XE0 A;  2HWC 3;  3IWZ A;  3H9A A;  4Y24 A;  3BYW A;  3VD7 A;  3WG1 A;  5JOX A;  5FAX A;  2PHL A;  3ZSL A;  2BTV C;  5C4W B;  5ACA 2;  2KM2 A;  3WW3 A;  3VBO B;  2WKK A;  5AFB A;  5FMO L;  4QWN A;  2OXB A;  4XIL A;  3AJZ A;  5CG8 A;  5CB7 A;  5A6X A;  1UOB A;  1F15 A;  1XNB A;  2DWR A;  3BCW A;  5LY1 A;  2R06 2;  4WZC A;  3KV9 A;  1W03 A;  5FRE A;  1RUC 1;  4YZ5 A;  3I2J A;  1REF A;  3E5X A;  1DQ6 A;  4AGG A;  5ISL A;  3O7O A;  3DF0 A;  1JS9 A;  2XJS A;  2RE9 A;  3LFM A;  5DUW A;  3RYP A;  1GSL A;  1WLD A;  1ZBE 3;  3BTA A;  5FXX A;  1PX3 A;  3VKM A;  2ZGM A;  3PU8 A;  5D21 A;  3T1M A;  2IXC A;  2W1S A;  1UPS A;  3ZPY A;  2RJK A;  2UY8 A;  1YYN A;  4ZON A;  1H8T B;  3P3N A;  1CES A;  4OUE A;  5A3N A;  5CFC A;  4HN0 A;  3VD4 A;  4GWM A;  4PDW A;  1S2E A;  2XUE A;  1FMD 3;  4JGY C;  2OT7 A;  3W20 A;  4FFH A;  5T50 A;  4D6Q A;  4ASL A;  1IGO A;  3RPQ A;  5JUV A;  4CXW A;  3TOJ A;  5HV0 A;  1D0H A;  3GBF A;  4HSJ A;  2EXK A;  5LRR A;  4E2Q A;  5J37 A;  1XYP A;  4M4R A;  1YIF A;  2B4K A;  3S7I A;  3V0B B;  4QX0 A;  4I30 A;  4K1Z A;  2R04 3;  3ROU A;  1W6P B;  1Z78 A;  5JZG A;  4AG4 A;  3M7A A;  3PUA A;  3HNB M;  5LWB A;  1ZRR A;  4IGP A;  4Q4V 2;  4XQ4 A;  3RJR A;  3BU0 A;  3BUC A;  4MVT A;  4KGG A;  3GZU C;  5GLW A;  4FPJ A;  4RS5 B;  1EV1 1;  2XG3 A;  2XQR A;  4GMP 1;  4YVS C;  3UGH A;  3LDB A;  2Q1F A;  1GYK A;  1AR6 1;  1OA3 A;  1KGY A;  2GN3 A;  3AP4 A;  4NPL A;  4UFI A;  1AR8 2;  3SH5 A;  1V9U 1;  2ARX A;  2BUK A;  2IUW A;  3ZDS A;  2DVD A;  1Y7B A;  3NKG A;  3OBZ A;  4QQ2 A;  4YW6 A;  3ENR A;  4R9A A;  3RNS A;  2B42 B;  2JG8 B;  3KVA A;  1JHJ A;  5IUQ A;  1MEC 2;  4IEQ A;  4QB1 A;  5FCC A;  2WWJ A;  3ZXF A;  1W6N A;  3MHZ A;  1QJU 1;  2RMU 3;  2VG9 A;  3S6P A;  1GZW A;  2W3J A;  4CU7 A;  1JZ3 A;  2VVD A;  1K5M B;  4BLJ A;  3ON7 A;  1FI2 A;  4QXH A;  3K3N A;  3I2O A;  2DFC A;  2ZGU A;  3U11 A;  1O3R A;  4NUB A;  3LEG A;  3UKV A;  5C3O A;  1UOF A;  4NRQ A;  3WUC A;  1RB8 G;  4R4X A;  3I3E A;  4E9K A;  1MZ5 A;  1RHI 2;  1PM7 A;  2AZ5 A;  4MGZ E;  4KWU A;  5T5P A;  1RUF 3;  1X8E A;  4NII A;  5C3Q A;  5CU1 A;  5FZG A;  4YZ3 A;  4FPF A;  1TME 3;  2VZQ A;  3H3L A;  3PIJ A;  2WZ8 A;  1QH7 A;  2WIN B;  4QU2 A;  4BU2 A;  5JI7 A;  2ZHK A;  5FY8 A;  2SBA A;  2K0G A;  1IG0 A;  1PO1 2;  4TSV A;  1RUI 2;  3VZL A;  3U4X A;  2Q30 A;  2G4I A;  2VNO A;  2YFZ A;  5LA2 A;  3U78 A;  2XB6 C;  3WUD A;  5JOY A;  3ZYB A;  3ZYR A;  3GJA A;  1AHS A;  1PVX A;  1OUS A;  2V5Y A;  1PGW 2;  4LBQ D;  3IBM A;  4A7Z A;  2ZGN A;  1CPM A;  2Q1Z B;  3JBG 3;  2YBP A;  4FOV A;  5FZ6 A;  2NN8 A;  5K0U A;  3H50 A;  5FZO B;  3C7O A;  3WG4 A;  5BNP B;  1UKR A;  3H1Y A;  1ZZ8 A;  2XJR A;  1N3O A;  1UNB A;  1JU3 A;  3INA A;  3KMH A;  1LOE A;  3N9O A;  3POW A;  4IEY A;  3SEE A;  1YFU A;  2VUL A;  1RIT A;  3JQW A;  4KWJ A;  3UES A;  3MUZ 1;  5A3M A;  1KS4 A;  3BOW A;  4Q4X 3;  5EYX A;  5CIS A;  3Q8C A;  1ZNP A;  3MW2 A;  3IMN A;  1W0O A;  1MPX A;  1NCR A;  2AUY A;  1R64 A;  3U07 A;  1JOB A;  2RR1 1;  5C8C C;  1R09 1;  3AJY A;  3I59 A;  4XBQ A;  3PTR B;  4Y20 A;  4KH9 A;  2A5Z A;  1SLL A;  4BQ4 A;  2J22 A;  2BJS A;  1ODM A;  1O8S A;  3VBR C;  3O1V A;  4TTG A;  1LTE A;  5IVV A;  4LMF A;  3LDK A;  4G3Y C;  1AL2 1;  2WFF 1;  2LTN A;  1RUH 2;  3FLP A;  1CWP A;  5FWE A;  1TE1 B;  5FZ1 A;  2AYH A;  1WW5 A;  5DN2 A;  1G9A A;  1LGN A;  1O8P A;  1S0F A;  2PQS A;  2RS1 1;  2OVU A;  3M2M A;  4NJ4 A;  3CBN A;  3SH3 A;  1I5P A;  3UYJ A;  2D6K A;  2HWE 3;  4HXC A;  3KQ4 B;  4LUM A;  4DOU A;  3RZZ A;  4QB2 A;  2E32 A;  4FPE A;  5A3O A;  5FWJ A;  4UT5 A;  4Q29 A;  5FO7 B;  1UZW A;  4XUN A;  5L36 A;  4CP9 A;  2YUE A;  4E4H A;  1EAH 3;  1JI6 A;  2DBI A;  3MW4 A;  5IVC A;  1W9W A;  2D6O X;  3THC A;  3UNP A;  5DZG A;  4P9L A;  5BNQ A;  3E97 A;  4FPC A;  5JSO A;  4PIZ A;  1VBA 2;  1R1A 1;  3SH4 A;  1F8V A;  3THD A;  3III A;  2I45 A;  2ZGP A;  4I0A A;  1BJQ A;  2WWU A;  4BCU A;  1PGL 1;  3VBF B;  1BK0 A;  2BQP A;  1BK1 A;  2CTV A;  3AKQ A;  5FTT C;  3ES1 A;  1XNT A;  3NNL A;  3RQ0 A;  1A8D A;  1J3P A;  1HV0 A;  1WW6 A;  4PHZ A;  4COU A;  1VB2 A;  2VUD A;  1XPW A;  4XFF A;  4XEZ A;  5CFC C;  1JTZ X;  2BRT A;  1UQX A;  1OBN A;  1W8N A;  4ARY A;  2DFB A;  2HJI A;  4GIQ A;  1RUD 2;  1F5F A;  4QPG B;  4HLT A;  1QJX 2;  3SNM A;  3C2U A;  5LBF A;  3A23 A;  4Z1V A;  4CDQ A;  2VNV A;  4H55 A;  1AR7 3;  4BE3 A;  4D7S A;  3Q9O A;  4NIG A;  2C6S A;  1W0N A;  3F2Z A;  3MV0 1;  4IGQ A;  5ERL A;  5FKC A;  3AM2 A;  5C3S A;  4QHO A;  2OYZ A;  2VZ1 A;  3BOD A;  1F9K A;  4PIY A;  3ZXA C;  2ZS6 B;  3EHK A;  4B4R A;  3IKW A;  5A32 A;  3NNF A;  3MIF A;  2D6N A;  4GKY A;  4FOQ A;  3WR0 A;  5JZG C;  1VE0 A;  3S7E A;  1RED A;  4GXL A;  5APA A;  4DY3 A;  4XET A;  2QQM A;  5H9Q A;  3KZ4 C;  1RUE 3;  1O4Y A;  3SEP A;  1JBC A;  4OHV A;  2OUJ A;  4O7X A;  1J59 A;  1SPP B;  3ZFE A;  1D4M 2;  2N7G A;  1C4R A;  4QX1 A;  2BU9 A;  3DPR B;  1KFX L;  4M00 A;  4YFW A;  5A7N A;  4EZH A;  5KXD A;  5FP7 A;  2CWM A;  4XE9 A;  1NQJ A;  5FZB A;  1OKQ A;  2G9F A;  1QJE A;  1SCR A;  1SLT A;  4RYD A;  5LY2 A;  1MVE A;  4Y3O A;  3RJ2 X;  4XXA A;  2V4A A;  1AYN 3;  1UX7 A;  3PVE A;  1W2T A;  3BOP A;  3HT1 A;  3K4D A;  1LRH A;  1MS8 A;  1ULF A;  4KWK A;  2WS9 3;  3D0S A;  2CWS A;  1UYX A;  4RFR B;  1UMH A;  1WD3 A;  4GUL A;  3OGS A;  2WC2 A;  4QAW A;  1WLC A;  2H0B A;  5HI0 A;  3KLS A;  4K8R B;  2VEC A;  2F4L A;  2Y6J A;  4KBZ A;  3LIH A;  4N53 B;  1R1Z A;  4KI5 M;  2C5D A;  4XBN A;  1U5I A;  4YAR A;  3O1O A;  3AVS A;  3OUH A;  1LKN A;  1W05 A;  2FBE A;  1RUG 3;  2ZGO A;  1ZZC A;  3OSD A;  2RS5 1;  3WP3 A;  2G1M A;  4QX2 A;  3VGI A;  2JE9 A;  3AK0 A;  3H7Y A;  4AGV A;  2C9K A;  1DZQ A;  1XU1 A;  2BER A;  3RVH A;  2DUO A;  5T5L A;  2GMP A;  3OUI A;  5CKN A;  1HQW A;  3MLJ A;  4CCE A;  1A6C A;  4CPB A;  3MIC A;  4IV3 B;  4H2A A;  3FLR A;  1R08 1;  2YC4 A;  3OBA A;  4GJZ A;  4LBQ A;  3V56 A;  5LCW L;  2IXL A;  4Y1Y A;  4K8F A;  3RDI A;  3MF9 A;  4B8E A;  3I4I A;  1WLW A;  5DAQ A;  1G6N A;  2P3K A;  5DUX A;  3I7D A;  3RI8 A;  3DEM A;  3N4M A;  1CX1 A;  2C4X A;  2JX9 A;  3JQX A;  4FCA A;  1AYM 1;  1H9P A;  2YY1 A;  4MAD A;  3WQ7 A;  2P2K A;  1BZW A;  3HNY M;  3DCQ A;  1KFU L;  4WM7 A;  4ONU A;  3K48 A;  5K0U C;  2IFR A;  3ZYH A;  5C33 A;  1G8W A;  4L9B A;  3ZSJ A;  1AXZ A;  3WQ1 A;  3WDV A;  1E57 A;  4S2H A;  1Y43 B;  4YW5 A;  1C8M 3;  3TYJ A;  2E7T A;  4XIK A;  1POQ A;  4JV4 A;  4R9C A;  4AVV A;  4B4P A;  3VBS A;  2DCZ A;  2ZX1 A;  1FOD 1;  1YQ6 A;  3W21 A;  3NJY A;  1PK6 B;  5DXD A;  3CKH A;  1FT9 A;  2XQX A;  1UL9 A;  5JR7 B;  5FY5 A;  1NCR C;  4W4Z A;  3W5N A;  2QQV A;  4DY5 A;  2DCT A;  2RS3 1;  1GZT A;  5A1L A;  3HN1 A;  1WW7 A;  3BIW E;  4V1P A;  3AFG A;  4HZF A;  4Q4Y 2;  4AI9 A;  4BPZ A;  1H4H A;  1MZF A;  1ZX5 A;  2VVE A;  4OI4 A;  1W9F A;  2WLP A;  1K5J A;  2ZAC A;  1M4W A;  3S5Q A;  2W1W A;  3G6J B;  3MLK A;  4CUG A;  1VBD 3;  3G7D A;  2JDZ A;  3H0O A;  3NQH A;  4M0N A;  1K45 A;  1FAY A;  4HK9 A;  2R1B A;  2QTW B;  3FL7 A;  4OYU A;  5L73 A;  3WD5 A;  3WDU A;  1ULG A;  1MR5 A;  1KJL A;  4HPK A;  2DVF A;  4YVW A;  2XBO 2;  4EWD A;  3DL3 A;  1UY3 A;  1S0C A;  4QM9 A;  4Y5T A;  2VQ0 A;  3AVR A;  1UY1 A;  3ETQ A;  2D44 A;  3UV9 A;  1PNG A;  1AR9 2;  4Q4W 3;  4XJ8 A;  4JRA A;  3GZA A;  4AF9 A;  4D6S A;  1OA4 A;  4IUG A;  2MHF A;  3GAL A;  1TZO A;  1JOP A;  4XCA A;  4B29 A;  5ABJ B;  3B94 A;  1SLC A;  2X53 S;  4CDW C;  1HXS 2;  5A7O A;  5EWS A;  2O1Q A;  2PHR A;  1VBB 3;  1MQT A;  2FHR A;  3T2T A;  4A42 A;  4A6O A;  4J1W A;  2H0V A;  2YC0 A;  1MS5 A;  3PL0 A;  2HWB 3;  4QU1 A;  5F6L B;  1CAX A;  3GCX A;  1ND3 B;  2AEN A;  1QIQ A;  3CHX A;  1ZZ9 A;  1LOF A;  2IXI A;  5H9R A;  4MGY E;  1S0I A;  2GAU A;  4O61 A;  4AHY A;  4BXS V;  3EQE A;  3JB8 A;  4Y1V A;  3SKV A;  3OBT A;  3OYW A;  4I3G A;  4FBF A;  2HWC 2;  3HNM A;  2BZD A;  3JD7 3;  4P02 B;  2DVG A;  2P4E A;  4BWO A;  4CDQ C;  3PJQ A;  5FO8 B;  4P5Y A;  3LSD A;  4CEW A;  4LO7 A;  4OUS A;  1W8T A;  4RN5 A;  4E27 A;  4XDP A;  3AL6 A;  5A3W A;  3W5M A;  4LBM A;  5JMO A;  3B5L B;  1VR3 A;  1N1Y A;  3BPS A;  1DQ0 A;  1H1A A;  2CDP A;  2J1A A;  4JAA A;  3ZR5 A;  5C4W A;  2ILM A;  2R07 2;  1J3R A;  3V0A B;  1ULE A;  4AI0 A;  1V6K A;  1W90 A;  3ZVX A;  1K12 A;  1UF2 C;  3MIB A;  4QKF A;  4PLN A;  1HX6 A;  4YW1 A;  3UKN A;  1KIT A;  1VRH 3;  1ZBE 2;  3NV3 A;  5EV7 A;  4AVS A;  4FTE A;  2Q8C A;  1PMJ X;  1UYZ A;  1ND2 B;  4LO8 A;  1QXR A;  3MPP G;  4BXF A;  4LA2 A;  1DZT A;  2XML A;  3LEK A;  5JI9 A;  4TLF A;  1ENR A;  1GAN A;  3OOX A;  5IFT A;  5LZ6 A;  1FMD 2;  1XNC A;  1RUO A;  1IS3 A;  4OHY A;  2DCK A;  3NAP B;  4YGB A;  4URA A;  4JHZ A;  2P1B A;  2DYC A;  1RJ7 A;  3WLU A;  1B09 A;  1YJK A;  5A33 A;  3UJO A;  3VZM A;  2X5I A;  1HJG A;  2IXK A;  4N9H A;  5FZK A;  2GU9 A;  2R04 2;  4XTP A;  1RUJ 1;  4UWD A;  1CD3 G;  3AYD A;  5BPX A;  1DYO A;  4WM8 B;  4Q1R A;  1TNR A;  2CDO A;  2OUH A;  2WZP P;  2ZGK A;  1IS6 A;  3CU7 A;  3H1W A;  3K77 A;  3OPW A;  1H2K A;  2A73 B;  4CUA A;  4COV A;  1QWR A;  1W2O A;  3EYP A;  3KT7 A;  1UMZ A;  1UXX X;  1YFW A;  2PN5 A;  1VIW B;  4BYY A;  3SQO A;  5K7P A;  1W99 A;  3RMX A;  2RHP A;  4QGN A;  4TWT A;  5C6C A;  2ZZQ A;  5BUV A;  3ZMN A;  1MVQ A;  1ZZB A;  3OUJ A;  3Q8E A;  3PIG A;  3KVB A;  4FPH A;  2EIG A;  4L11 A;  5FZD A;  3WW1 A;  2A3W A;  5LW9 A;  3HQU A;  4MZU A;  2O8O A;  4RS5 A;  1DHK B;  1KDM A;  2MEV 3;  4K1Y A;  4GWN A;  4JDM A;  2RMU 2;  3HPN A;  2B45 X;  4OUL A;  5FOB B;  2EAA A;  1OH4 A;  2BBA A;  2YYO A;  4L2N A;  3RFR A;  3ALQ A;  2R32 A;  1PIV 1;  4QX5 A;  4EQV A;  4LA3 A;  1WA6 X;  3HQX A;  1Z7S 3;  3LEM A;  2HEW F;  4J1X A;  3TEX A;  3KCC A;  5IHR A;  4IV1 C;  2XGX A;  4WM7 C;  1FXZ A;  2WNV A;  3CQO A;  4MGT A;  3VBH B;  1X8M A;  5FMD A;  4XMA A;  5DDJ 1;  2JJ6 A;  4AI1 A;  4K40 A;  4AXO A;  1W04 A;  2C1F A;  4CCC A;  1K5M A;  2E9Q A;  1RUF 2;  3HR9 A;  5EJ3 A;  2D3P A;  4AQT A;  3NKT A;  2BP6 A;  3VBS C;  2EIC A;  1TME 2;  4JCK A;  4BQW A;  3ZFG A;  1COV 3;  4YGC A;  1PGW 1;  4V2W A;  2UWA A;  2XJV A;  3N9N A;  4JDO A;  4XFG A;  4LR4 A;  1DGW A;  1RC6 A;  2A1X A;  1Y9Q A;  1QU0 A;  3IM0 A;  4B1M A;  3LZZ A;  3WX5 A;  2FDJ A;  2VW0 A;  4QM8 A;  3ST7 A;  3VBU B;  1JZ5 A;  1UOG A;  1C57 A;  1GIC A;  2VZT A;  2P17 A;  3JB4 C;  3MIE A;  3NST A;  4BIS A;  2QUO A;  3VDD A;  5B4X A;  3PDQ A;  4ASK A;  4AEK A;  1HQL A;  4ISR A;  3C7G A;  4QPW A;  4QX3 A;  3WDX A;  3MIH A;  2GMM A;  1RMU 1;  3JBG 2;  2VAU A;  4DO0 A;  1UO9 A;  2A70 A;  1MS3 A;  4YVW C;  5FY9 A;  3FJS A;  1LOA A;  3LQC A;  1X33 A;  4WVZ A;  4BJ0 A;  3VD9 A;  4YZ4 A;  3KS7 A;  1E5S A;  5FZF A;  4TXW A;  3VZO A;  1WCD J;  4Q4X 2;  4YVS A;  4GH4 A;  2B8M A;  1NA1 B;  4X6Q B;  3ITQ A;  3R6S A;  1ENS A;  5BNP A;  1BBT 1;  4M0H A;  4EYU A;  4CXX A;  3GZE A;  4HVQ A;  4LHL A;  5L19 A;  1MAC A;  4N90 A;  1O7F A;  1HRV 1;  3A0K A;  3AX4 A;  3HVD A;  4I09 A;  4IES A;  4P9W A;  4GMP 0;  2CHH A;  2VMF A;  1MQT C;  2XLG A;  3O12 A;  5FBJ A;  4AVT A;  2CY6 A;  1O91 A;  1S1A A;  3ZN4 A;  1BEV 1;  3OCP A;  4JHT A;  1LAJ A;  1NYW A;  1LOF C;  3PNA A;  3ZMO A;  4CCN A;  3OTF A;  3MYX A;  3LA2 A;  1CON A;  1YCI A;  1BMV 2;  4AGR A;  2W92 A;  2VQA A;  5EYY A;  3R4U A;  3T4V A;  5KHH A;  4MGK E;  1IPS A;  4XTM A;  5JIA A;  2EID A;  3NVC A;  1GLH A;  4KNC A;  3U37 A;  3TAY A;  1EAH 2;  1V6N A;  4JDN A;  3KM5 A;  1BHG A;  1RUC 3;  3I3M A;  2WSU A;  4XXP A;  4CEW C;  1CIY A;  1H6X A;  5KHG A;  3WCS A;  4A2U A;  1Q5O A;  2CGP A;  5L7O B;  3QAC A;  4DUW A;  1IKQ A;  4NHM A;  5LBC A;  1LB2 A;  3OB8 A;  3VB9 A;  5FPV A;  1BVP 1;  5C4W C;  5FXW A;  3WQB A;  1JYX A;  1M06 G;  2JDM A;  1X9T A;  2XKP A;  4K20 A;  4QQP A;  5F5C A;  1CAW B;  4DFS A;  3LE0 A;  2L9L A;  5C71 A;  2VY0 A;  2X09 A;  1JYV A;  2QFE A;  3ZYP A;  2ARB A;  2ZAH A;  4QQO A;  5I91 A;  3VHP A;  1O3S A;  3SCF A;  1POV 1;  5DUU A;  5FY0 A;  1W8W A;  1HLC A;  2CNA A;  4LIT A;  5IAV A;  2UWC A;  5JLV A;  1H1I A;  3MW3 A;  5G05 L;  1CJD A;  3OG2 A;  3VBF A;  1WKY A;  2YC2 A;  4IQP A;  4D3W A;  4XF0 A;  5F32 A;  2D6P A;  3POI A;  5ANN A;  4WV8 A;  4YVS B;  2FCU A;  2ZML A;  1RVF 1;  3TBD A;  5DPN A;  4GAL A;  1AR7 2;  3HAG A;  5LA9 A;  2CAU A;  4HBN A;  5FPZ A;  1H8T C;  1XQN A;  3WW2 A;  4IER A;  1QNY A;  1Z0H A;  1OQ1 A;  1H4G A;  4KU7 A;  5FZ3 A;  2X5I C;  1EV1 3;  4GMP 3;  4QGL A;  2YBS A;  1Y9M A;  4AFD A;  5FXV A;  1F2N A;  4MXV A;  1AR6 3;  4KG0 A;  3SCG A;  3T2O A;  4AED B;  4Z2W A;  3B9C A;  1V9U 3;  3Q8B A;  5F2W A;  4DEV A;  3TN9 1;  5L9V A;  1U5Y A;  2W1Q A;  4Q0Q A;  4RSU A;  5AC9 1;  4MYE A;  1RUE 2;  2FDK A;  2UU8 A;  4F83 A;  2ZAB A;  2BWC A;  2Q5T A;  3WNP A;  5FXZ A;  5I8S A;  1PVC 1;  1IQA A;  3D5O A;  3OBR A;  3LPG A;  4OUM A;  4YG3 A;  1QJU 3;  1O5U A;  2RVA A;  2R49 A;  2WBK A;  2YFU A;  3ETP A;  3MUY 1;  4YWA A;  5IK4 A;  5KHK A;  5H9S A;  2E33 A;  3CJX A;  2RDN A;  3USU A;  2ZGS A;  3VKO A;  1JN2 P;  1UZ0 A;  4KWL A;  4RS5 C;  4AQ2 A;  4YNI A;  1Q8Q A;  1OPO A;  3DV8 A;  5FOJ B;  1QKQ A;  3TEY A;  2J7M A;  4E2G A;  2WS9 2;  5CIR A;  1QOS A;  1VJ2 A;  5FYC A;  2J1U A;  2I2S A;  1TG7 A;  1QY4 A;  1VBC 1;  4ITC A;  4QT6 A;  5KXB A;  1C5H A;  2FDH A;  2JIJ A;  4HMZ A;  2WNV C;  4GA9 A;  2EA7 A;  5BNN B;  2ZX2 A;  4S2G A;  4XUQ A;  4COY A;  3WNO A;  3LGR A;  1PX4 A;  3QLQ A;  1Q8S A;  5LEJ A;  1RUG 2;  4MXW B;  4YSF A;  1K5M C;  4LLF A;  3H8O A;  1SFP A;  3QH6 A;  1V6M A;  1OC1 A;  3TEW A;  2B9U A;  2QJV A;  2W1U A;  4N53 A;  2W94 A;  1NXD 1;  5LK5 A;  3ZFG C;  1RXF A;  4XCB A;  3N7L A;  4KU8 A;  2JE8 A;  2EIE A;  1UXZ A;  1WLT A;  3IDC B;  1OVP A;  1W6M A;  4WZF A;  1XU2 A;  3JUU A;  1J83 A;  2B46 X;  1H0B A;  1C5I A;  1MS9 A;  2BGC A;  2GC3 A;  4DXT A;  4I2O A;  3C8X A;  1UKG A;  2GSY A;  2OQ7 A;  1XJA A;  1MS4 A;  4URT A;  4H7L A;  3LWC A;  1JUI A;  3IPV A;  5FYZ A;  1XSR A;  3L2Y A;  1HB4 A;  5JCT A;  1UIJ A;  3CJI A;  2VZV A;  3VDD C;  3QCW A;  3LB9 A;  1N3Q A;  1RIN A;  3QD6 A;  5FRA A;  4A6S A;  1DP0 A;  4H14 A;  2VZO A;  4K6B A;  2PQQ A;  2Q8D A;  1UY0 A;  4MGI E;  3I8T A;  3VKF C;  2Y64 A;  2XWJ B;  4LKE A;  2BNM A;  1RGS A;  2RR1 3;  1C8M 2;  2JKB A;  1R09 3;  1XYO A;  3AXE A;  3DKW A;  2PHT A;  1ZYB A;  2VMH A;  2VTF A;  3FBM A;  4AFM A;  4BQX A;  4CZS A;  1ZRD A;  4PQQ A;  1UX6 A;  4LHK A;  3OD4 A;  1QJY 1;  5EIY B;  4GH4 C;  5KC6 A;  4CCM A;  1NY7 2;  1AL2 3;  2UUR A;  2WFF 3;  1G86 A;  5J98 B;  5LBB A;  4CRQ A;  2R16 A;  2R6Q A;  1W8O A;  5BNP C;  4GB3 1;  4B3N A;  4AHW A;  2VUC A;  5FR3 A;  5JMC A;  3KF3 A;  2BGP A;  4IEV A;  1JYW A;  4YM3 A;  1EUU A;  2RS1 3;  3C7E A;  2Y6L A;  3WG3 A;  4LQR A;  1CAU B;  4RGA A;  2JWP A;  1WCK A;  3ZN6 B;  2D7F A;  1URX A;  3CMG A;  4Q1P A;  4NHL A;  4WVM B;  3CEW A;  2W87 A;  2WO2 A;  4NMI A;  3M3O A;  5F37 A;  1ASJ 1;  4RR3 A;  2BOJ A;  2ZX3 A;  4QKD A;  2JG9 B;  4PQ9 A;  1CAV A;  2E6V A;  1S0D A;  4IE5 A;  1WCQ A;  3POF A;  1QDC A;  4XC9 A;  5A70 A;  4CDX A;  4NR1 A;  4XPV A;  4QKN A;  5FZC A;  2WZR 1;  4A41 A;  2YPD A;  2W08 A;  1PO2 1;  5BYN A;  5GJ6 A;  2DV9 A;  3VL8 A;  1GQH A;  1R1A 3;  2C26 A;  4LBO A;  4XDO A;  5FP4 A;  5LAT A;  3DN7 A;  4L97 A;  1K3I A;  5FPU A;  1AJK A;  1WA4 A;  4RHV 1;  5FYT A;  4XJW A;  4NOT A;  1L7L A;  3PVN A;  4AW7 A;  2FCV A;  1GQP A;  2AR6 A;  4Z07 A;  2J1S A;  4JVA A;  1J1L A;  2A6X A;  1CZT A;  1VBE 1;  1VBB 2;  1LHO A;  1SMV A;  2VH9 A;  4ASM B;  2ARA A;  3C7H A;  4CPB D;  5EP9 A;  2HWB 2;  2Y38 A;  4EN7 B;  2NM1 A;  2LM3 A;  4R9B A;  4K3U A;  1UU5 A;  2ZHN A;  2VOV A;  1WW4 A;  2WNU B;  3B9I A;  4YFZ A;  1IHM A;  1RYY A;  4JGY B;  2IVJ A;  3VBF C;  4UW5 A;  2IC1 A;  3JD7 2;  1YNA A;  3T08 A;  3FE5 A;  1V6L A;  2Z69 A;  4C1W A;  2R07 1;  2J1T A;  3PME A;  4U2A A;  2QCS B;  1S0J A;  2KA3 A;  3J26 N;  4N9I A;  4FXG B;  3USS A;  5G04 L;  3KHB A;  4HT1 T;  2F6B A;  1IZ3 A;  4NHK A;  4O9G A;  4PJY A;  3H8X A;  1VB4 A;  3OF1 A;  5GLZ A;  4MHU A;  2XLA A;  4IET A;  4QPI A;  2IVI B;  2RV9 A;  4LBK A;  1ZBA 1;  4AAX A;  3UL2 A;  4BQY A;  3AMN A;  1OOP A;  2PLV 1;  4C0B A;  2Y8K A;  4XFB A;  3ZIW A;  3V65 A;  1W6Q B;  2D97 A;  4M3C B;  3OGV A;  1AXY A;  3ZIX A;  3T0A A;  3M1H A;  1U0A A;  1VRH 2;  3PTY A;  4Y22 B;  3UJQ A;  1GP6 A;  3FFQ A;  2DBN A;  3KCY A;  4I0B A;  3LAG A;  3VZK A;  3PJY A;  1GWL A;  1YUD A;  5BNO B;  3MGU A;  4UW3 A;  1OD3 A;  3V0A A;  4FAG A;  1UY2 A;  4XYX A;  5JVV A;  5IVJ A;  4DEQ A;  5KHI A;  4HFS A;  4BLI A;  2OKX A;  2WJS A;  4XF3 A;  2PFW A;  2WO7 A;  3GJB A;  4P9G A;  2O8Q A;  1QQP 1;  3IMM A;  2Y6H A;  4LE3 A;  4LUK A;  2A6Y A;  4JZR A;  3M3E A;  4V2V A;  3NL1 A;  1IPK A;  1RUN A;  1OA2 A;  3E6C C;  3O1P A;  3ILF A;  3N35 A;  2D6L X;  3AKR A;  2B7Y A;  2RS5 3;  4LEJ A;  2ATF A;  4QX8 A;  1KDK A;  5A7P A;  3U75 A;  5I93 A;  3THP A;  2VCB A;  2QNK A;  3NAP A;  1HB3 A;  3UGF A;  1LED A;  4UYB A;  1SG3 A;  1UN1 A;  4CDW A;  3M3Q A;  2PAM A;  3AL5 A;  4EV0 A;  3IAQ A;  3FUO A;  1R08 3;  1LOB A;  4DB5 A;  3AKS A;  4N53 C;  1MZE A;  1AF9 A;  4DUX A;  4XAA A;  2I74 A;  4Y1X A;  4ES9 A;  2VNG A;  3OEA A;  3WNM A;  1US2 A;  4WM8 A;  3TEZ A;  2IFW A;  2BNO A;  4G9S B;  4QX7 A;  1AYM 3;  3VD5 A;  2WAB A;  1WUV A;  3AZX A;  3K46 A;  5F3I A;  2V5D A;  4QQL A;  4CXY A;  4AEJ A;  2MEV 2;  3J8F 2;  5DG1 A;  4LUL A;  1NX9 A;  5FYH A;  4LKS A;  2ET1 A;  4IXL A;  2A3X A;  2Y0O A;  4UFL A;  4XDQ A;  1WMF A;  1LEM A;  2QE3 A;  4JGZ B;  4AQ6 A;  3VUO A;  1E5R A;  2A3Y A;  3GM8 A;  1V6I A;  3CJI C;  4IE7 A;  1RUF 1;  5FP9 A;  1IS4 A;  4LOS A;  1Z7S 2;  3E1F 1;  5FQ0 A;  4ZS3 A;  3HWJ A;  1FOD 3;  3AZZ A;  4SLI A;  1CZV A;  5GZD A;  4CSW A;  5FLJ A;  4BQ3 A;  2BDR A;  1ALY A;  1U5X A;  3N36 A;  4QXK A;  3WDY A;  1CX4 A;  1O59 A;  4OQ9 A;  3UT0 A;  5LEK A;  2RS3 3;  4XZP A;  1TNF A;  1FPN 1;  4PLO A;  2WL1 A;  1EUT A;  4ZPI A;  3TNQ A;  3AMH A;  4RGG A;  2QQN A;  3H8R A;  2CGO A;  3O0X A;  4F7Z A;  4MX3 A;  2YPJ A;  1PNF A;  1UPI A;  1COV 2;  3LOB A;  5DAX A;  1J1T A;  4RQP A;  1MS1 A;  2F4P A;  2JDK A;  1GWK A;  2GH8 A;  2IXJ A;  4GAZ A;  3ACH A;  1GKB A;  3JZV A;  3E6B A;  4AI2 A;  4Y4R A;  2BFU S;  1OUR A;  4UFK A;  1GMM A;  3VBR B;  3LA3 A;  4NIA A;  2HWF 1;  1KJR A;  1WBL A;  4N7U A;  4DUV A;  3KHC A;  4CU8 A;  1HRI 1;  4XFA A;  1SBD A;  2X8K A;  3M4F A;  2ZEW A;  1V6O A;  4FT8 A;  2HKX A;  2ZEY A;  3M70 A;  4DMI A;  2A71 A;  1FNY A;  1OD5 A;  2TBV A;  4L92 A;  4RR3 C;  5FFO C;  4HL0 A;  4IDZ A;  4YZ2 A;  3WP6 A;  1UU6 A;  2GC1 A;  4GJY A;  1DBN A;  1OFN A;  1HIX A;  4CDX C;  4UXA A;  1ZA7 A;  4N43 A;  4NHY A;  2EAL A;  2Y6F A;  4NHX A;  4NPM A;  4IEO A;  5KR7 A;  4FP2 A;  2GNB A;  1JYC A;  5L9R A;  3GBW A;  1NOV A;  4R4Z A;  3T0B A;  3BTZ A;  2VBP A;  1F4A A;  1YO8 A;  5FLI A;  1GFF 2;  1BLZ A;  4XJU A;  1SCS A;  5FY7 A;  5JXG A;  2JDH A;  1WCU A;  4CCL A;  1KD7 A;  5KXC A;  2AEZ A;  1YQC A;  1YWK A;  4UAP A;  2V09 A;  4LBN A;  3ME2 A;  5D8A A;  2ARC A;  2JE7 A;  4BK4 A;  1JXN A;  4OVE A;  5F5A A;  3ZSK A;  1NA1 A;  1H2M A;  1DQ4 A;  4EE2 A;  3POS A;  4Y5S A;  1WMX A;  2A7A A;  4TN7 A;  4CDU A;  1VMF A;  2Q4S A;  4QMA A;  3Q8A A;  5FK8 A;  2JEN A;  1TQ5 A;  3AKP A;  4YYO A;  4Q0V A;  3VKL A;  4Z8B A;  5JWP A;  3BKZ A;  4PDW B;  1X82 A;  2ZPX A;  4IV1 A;  4DIN B;  4ZU4 A;  1W6O A;  1W8F A;  3AYE A;  3AP9 A;  4IW3 A;  3ASI A;  5HCA A;  4AOC A;  1LCL A;  5FZ4 A;  1RUC 2;  4KL1 A;  4LBJ A;  1GOF A;  3KF5 A;  1Q43 A;  1T6B X;  3KB5 A;  2QKD A;  4R52 A;  2JB8 A;  1SLI A;  2AC1 A;  3POE A;  2XVL A;  4COW A;  1CZS A;  2D43 A;  1HQN A;  3KQR A;  4QPI C;  1VMJ A;  1H1M A;  4LK6 A;  4PI0 A;  5DMY A;  2HWD 1;  1OOP C;  2Y33 A;  5FPB A;  4XOG A;  4XHB A;  1W9Y A;  3MZH A;  3FBY A;  1EPZ A;  3P3P A;  3OY8 B;  1TMF 1;  3VZN A;  5HXM A;  4ZU5 A;  1AX2 A;  1ONA A;  1VMH A;  2XJP A;  2ZKL A;  4ZKT B;  4RFT 0;  4DRR A;  4FPL A;  2VOK A;  2RDQ A;  3WF2 A;  2A6Z A;  3OD0 A;  4YZ1 A;  1SLB A;  5LA0 A;  1V00 A;  1XBF A;  2Y60 A;  4XBL A;  2XXZ A;  4Z92 B;  1NCQ A;  4N8M A;  2NQY A;  3KCX A;  1B35 B;  5KC5 A;  4CU6 A;  1T6G C;  2XDV A;  4A44 A;  4BDV B;  1GZW B;  1RUJ 3;  1XC6 A;  4L0P A;  3T3Y A;  3VHO A;  5A1F A;  1ZVF A;  2QQI A;  4W6Y A;  2RDR A;  4LTA A;  4P14 A;  3WIN E;  2RM2 1;  4GZ9 A;  3LDR A;  5A1A A;  1EV1 2;  4AQS A;  1IKP A;  2J1R A;  3D6E A;  3J7L A;  1J58 A;  3R0R A;  3ECQ A;  3NAP C;  4NRM A;  4Q5O A;  5FZM A;  1GV9 A;  1V9U 2;  2VBB A;  3BB6 A;  3GYD A;  3WT3 A;  3RZM A;  5T55 A;  2BGO A;  3B02 A;  3GF6 A;  1LEN A;  4UOJ A;  2P6H A;  3TB0 A;  4YG0 A;  3MID A;  5F2S A;  3O5S A;  2FZ2 A;  4HKL A;  3ZFF A;  1BKZ A;  4AED A;  2ZMK A;  3D3A A;  4MV2 A;  2BV4 A;  3RGB A;  3DKQ A;  3KGZ A;  4WM8 C;  3V64 A;  4CUB A;  4A3Z A;  5FZA A;  5ACA 1;  3I2I A;  4AHZ A;  4XIO A;  4C90 A;  1PIV 3;  5T54 A;  3PUS A;  1X36 A;  5FPX A;  3TWI A;  5A6Z A;  3ES4 A;  4OCT A;  5D1I A;  1JZ2 A;  4FTS A;  2ZCW A;  4QXB A;  2C24 A;  3FZ3 A;  3U4S A;  2R06 1;  5DDJ 3;  4Q8K A;  5FY4 A;  1CIW A;  5CA6 A;  2VZ3 A;  2ID4 A;  4LO4 B;  2AGS A;  4UF0 A;  5K0U B;  4NWW A;  1QOO A;  2W46 A;  3QH7 A;  4EJR A;  1GZC A;  1PZ8 A;  1OLR A;  2JDN A;  2OZJ A;  2VZS A;  3VBO A;  3ILR A;  1HB2 A;  2FD8 A;  1E5H A;  3SIS A;  4LOR A;  3O1U A;  2VCA A;  4YRD A;  2RDS A;  3WV6 A;  1NAE A;  1W9T A;  4HSL A;  1NXM A;  5FY1 A;  4DIQ A;  4RQP C;  1QNW A;  2X29 A;  5BNN A;  4W6X A;  3UK9 A;  2W91 A;  5IVE A;  2D3S A;  4MXW A;  1KRI A;  5E89 A;  1OI6 A;  2ZGQ A;  2JIG A;  1DFQ A;  5IFP A;  1L3J A;  4UFH A;  5J3U A;  4YG6 A;  5I0D A;  2ZZJ A;  5M0T A;  5AVP A;  4DS0 A;  1RMU 3;  3D8C A;  1W2N A;  4WVW A;  1JZ6 A;  2NP0 A;  2QDR A;  3UKT A;  5T5O A;  4HET A;  5FV3 A;  2GDF A;  4LHS A;  5GLT A;  2C0Z A;  3GHN A;  3I3Q A;  1POV 0;  4Q4V 1;  2OX0 A;  4LO5 B;  1ULD A;  3PLQ A;  2DCY A;  1H8T A;  1DCS A;  1W06 A;  2NMN A;  4QHZ A;  4YW2 A;  1OPM A;  3KV5 A;  2XLF A;  4HOO A;  5IVY A;  5GZG A;  2ZOE B;  4ZXE A;  4N43 C;  1AR8 1;  3LD8 A;  4MET A;  1BBT 3;  2RR1 2;  3IDA A;  4AHX A;  4CP9 B;  2DVA A;  1HW5 A;  1UMI A;  3J7N A;  4EWE A;  5J7M A;  3RZJ A;  1ULC A;  1HRV 3;  4Y1U A;  3V0B A;  1MEC 1;  2WNE A;  5CZK A;  1AL2 2;  2WFF 2;  3OGJ A;  4CVU A;  1DDL A;  1W6P A;  3AZV A;  2FCT A;  3K2O A;  3KT1 A;  1Y3T A;  3MFC A;  4P9Y A;  5GZF A;  2RS1 2;  1BVV A;  4NID A;  1BEV 3;  3VV1 A;  5D8A C;  2D40 A;  1XYN A;  3C7F A;  2VD7 A;  5ANQ A;  5F8P A;  3WF3 A;  2A6W A;  4CP1 A;  4D8M A;  1NA1 C;  4O65 A;  4AVB A;  1CGP A;  5FLH A;  4FPY A;  2E31 A;  5J48 A;  4CDU C;  4KQ7 A;  1OLM A;  1RHI 1;  3WQ0 A;  4Y4Y A;  1QXJ A;  3WDT A;  1CAU A;  3ZSE A;  5JIU A;  3U14 A;  3T2P A;  3EJK A;  5JPM B;  2JG8 A;  4GWI A;  4WVM A;  3ZDV A;  4H7M A;  1SQ4 A;  5IVF A;  1OHF A;  2JDA A;  2K2S A;  5FZL A;  1PO1 1;  1D2Q A;  1R1A 2;  1RUI 1;  2DU1 A;  5EXO A;  4XAB A;  4JTN A;  3JCI A;  4YM0 A;  3J4U H;  1U12 A;  4ZHN A;  2W0X A;  2OW4 A;  2RJL A;  3A4U A;  4AK3 A;  2BW8 A;  1PGL 2;  2DVB A;  3FHQ A;  5A32 B;  1BYH A;  5B4N A;  3DYO A;  5F1R A;  5DZF A;  1W28 A;  3I3D A;  4LIU A;  3SKJ E;  4CTE A;  4KMQ A;  4DXS A;  1OT5 A;  5IWF A;  3FFZ A;  2WWS A;  1POV 3;  3AP5 A;  5L9B A;  2VMI A;  2W47 A;  3ZYJ B;  3E5Q A;  3ZFE B;  1LOG A;  5F3E A;  3WNX A;  5FUP A;  4A7K A;  1JYT A;  4FFI A;  2X10 A;  1UAI A;  5CNA A;  1DGL A;  1RVF 3;  1IQD C;  1JU4 A;  1I6X A;  1OQE A;  4IE6 A;  1W3X A;  1NCQ C;  1RXG A;  3IDB B;  2EF6 A;  4FSJ A;  4RGK A;  4PBO A;  4IND A;  4RD7 A;  5J96 B;  4XF9 A;  3ACL A;  1CJP A;  2P3J A;  2YRO A;  4YW7 A;  1UU4 A;  2WDB A;  3ZN5 A;  4MHR A;  1QJF A;  4ATE A;  4OI0 A;  2WNU A;  3TN9 3;  5AC9 3;  5A3U A;  4Q2F A;  2WLQ A;  5F39 A;  2WR9 A;  1WZX A;  4IGO A;  2D3R A;  1RUH 1;  4BIO A;  5FZO A;  1ULP A;  2VCC A;  3ACI A;  5J09 A;  1IPJ A;  1PVC 3;  2QZ3 A;  1BXH A;  3B00 A;  3FHA A;  3NJZ A;  4FVV A;  2AAC A;  2EAK A;  4LKF A;  3H8U A;  2A75 A;  3QOP A;  5FZH A;  3RYR A;  1FYU A;  3HT2 A;  1N47 A;  4AEM A;  4BME A;  5EJ1 B;  4C1X A;  4BQ5 A;  2DUQ A;  4FPG A;  1O6U A;  3CLP A;  3KGL A;  1DF0 A;  2ZHL A;  2ZKN A;  2V72 A;  2DUR A;  3ZFF C;  1XSQ A;  4AED C;  1JYI A;  2Y0I A;  3AP6 A;  5F3G A;  1JHN A;  5F6K A;  5FZ7 A;  4AZZ A;  1WWY A;  4YM2 A;  1KEX A;  4LBQ B;  3ZXG A;  4M3C A;  1G7Y A;  2JDY A;  1A34 A;  1CVN A;  2YDE A;  4XZU G;  2HWE 2;  3VN4 A;  1VBC 3;  2WT0 A;  5GZC A;  3WXP A;  3LKJ A;  5GLV A;  5KHJ A;  1US3 A;  4MH0 E;  1N1S A;  3ZXE A;  4D0Q A;  2ZTN A;  1VBA 1;  5BNO A;  5FMO S;  4FTB A;  2A6V A;  2FQP A;  3H1M A;  3WF1 A;  2ORZ A;  5CEH A;  1L7R A;  2O0O A;  3HN3 A;  2RS5 2;  4NVP A;  1G9D A;  1KQR A;  4WM7 B;  2PHD A;  4MO3 M;  2DTY A;  4OMC A;  3UET A;  1NLS A;  4ARX A;  5J1X A;  5I0R A;  3LFI A;  5K9Y A;  3P1I A;  5BV6 A;  3UGG A;  4BB3 A;  3K75 B;  1TEI A;  1YC6 1;  2EXH A;  4P9J A;  5HXV A;  3SLI A;  1UW8 A;  1OF3 A;  3VBO C;  2WT2 A;  3GDB A;  4K9S A;  3VBS B;  4YGD A;  4IEZ A;  1LOD A;  1PZ9 A;  3T4H B;  3I2F A;  3J8F 1;  2RJ2 A;  1RUD 1;  1PMI A;  1LNS A;  1QJX 1;  3WY6 A;  5A3T A;  5BNN C;  3APB A;  3VLB B;  4B1L A;  5JR2 A;  2QBX A;  4IE0 A;  2QQW A;  1AYM 2;  1PM4 A;  5C9A B;  1QXP A;  2MNG A;  2OPW A;  2WQZ C;  5CFD B;  4QQH A;  5AVA A;  3T0D A;  1F4H A;  1YHF A;  2W9X A;  3LF7 A;  4ZU7 A;  1LHN A;  2Q8O A;  1DGR N;  3NMB A;  4BQ1 A;  2VM9 A;  5DG2 A;  1UYY A;  2O14 A;  3AYC A;  4HKW A;  3A0N A;  4G4F A;  3P6B A;  4YLZ A;  4OLL A;  1FOD 2;  2PHW A;  3SXW A;  3MBW A;  1O3Q A;  4XUO A;  2UY9 A;  1QJY 3;  1HDK A;  1NG0 A;  1D4M 1;  4L8Q A;  4D7T A;  2ZAA A;  4QPG A;  2QQL A;  4HPK B;  4CEY B;  1NT0 A;  5EFU A;  4JTO A;  1NLR A;  1D2S A;  2KXL A;  2RS3 2;  4GB3 3;  2ET7 A;  2XJU A;  1LU2 A;  3DGT A;  1FNZ A;  1ZZ7 A;  5FPL A;  2J1E A;  2GN7 A;  1HN0 A;  5LAS A;  3ZOI A;  4D94 A;  2VMD A;  1LJ7 A;  1ASJ 3;  2CV6 A;  3VHN A;  3I2G A;  5FJH A;  3DUI A;  4IL7 A;  1AYN 2;  1ZA4 A;  4E2S A;  3AFK A;  1SLA A;  1SPP A;  4QPY A;  3I2D A;  5GKA C;  1IOA A;  2Y26 A;  2WZR 3;  3DPR A;  1EPW A;  1PO2 3;  4D7Y A;  1JH5 A;  3ZXK A;  2WT1 A;  2FMD A;  2JG8 C;  3OYW B;  4RHV 3;  2XHK A;  5FDB A;  2K46 A;  2HH9 A;  4QXC A;  2JB4 A;  2WFP A;  2LAL A;  2WN2 A;  3POG A;  1I5Z A;  3T1L A;  1SFY A;  2QQO A;  4RA0 A;  2H6C A;  5A7W B;  5T52 A;  3MEP A;  1AL0 G;  3RSJ A;  1Q56 A;  2OPK A;  3F95 A;  5K8S A;  1LU1 A;  2VOW A;  5BXX A;  2XPJ A;  2W68 A;  1VBE 3;  1DLL A;  1UZY A;  2D93 A;  5FYM A;  2W52 A;  2ETE A;  1YEW A;  2DU0 A;  2YV8 A;  3BU7 A;  2GP5 A;  2UYA A;  5K4L A;  1A8M A;  4P9X A;  1HJF A;  2VQT A;  5FYV A;  5IVB A;  3M8L A;  4P08 A;  5LA1 A;  1CPN A;  5FPA A;  3WHT A;  3B7M A;  4M4P A;  2R07 3;  3HMY A;  1QDO A;  4IV3 A;  2PHU A;  3BGA A; 
#chains in the Genus database with same CATH homology
 3WNM A;  1T2X A;  1US2 A;  3ACG A;  1P8J A;  1SDD B;  4JX0 A;  4IUG A;  4YPJ A;  3VD5 A;  4A4A A;  2WAB A;  3A7Q A;  3K46 A;  2V5D A;  5C7G A;  4HG6 B;  1NX9 A;  4LKS A;  1NUK A;  3GXU A;  4DXR A;  3GM8 A;  2WQ8 A;  1GOG A;  2ORX A;  3PUI A;  5CYY A;  4A42 A;  4A6O A;  3E1F 1;  4CU9 A;  3I3B A;  3MV1 1;  3WF0 A;  3MO4 A;  1CZV A;  2WN3 A;  3BN6 A;  4BXS V;  3LEI A;  4W50 A;  2EIB A;  2VZR A;  5JXI A;  3SKV A;  1O59 A;  2HYX A;  3IAP A;  3CDZ B;  3HNM A;  2BZD A;  1EUT A;  4P02 B;  2QQN A;  4P5Y A;  2WYS A;  4RN5 A;  4E8D A;  4BK5 A;  3ACH A;  3VDB A;  2XOM A;  3W5M A;  1GNY A;  5JMO A;  3DYM A;  3NNG A;  4MGS A;  1GMM A;  2CDP A;  1K42 A;  2J1A A;  2B9V A;  4DUV A;  4CU8 A;  3K4Z A;  2ZEW A;  1K12 A;  2ZEY A;  4A45 A;  3VDC A;  1OF4 A;  1PMJ X;  1UYZ A;  3PUH A;  1YQ2 A;  2DDU A;  3LEK A;  3FN9 A;  5IFT A;  2Y6K A;  2W5F A;  2X05 A;  4QDS A;  2DCK A;  2ZXQ A;  3T0B A;  1F4A A;  2ZEX A;  3CZU A;  3OEB A;  4JHZ A;  3WEZ A;  4P00 B;  5JXG A;  4ZZ8 A;  4PF1 A;  4UAP A;  5IYY A;  3AC0 A;  5DQ0 A;  3I2K A;  1DYO A;  4BK4 A;  3DEC A;  2CDO A;  3K77 A;  2VMC A;  1SHW B;  4MGQ A;  5FUI A;  5JXJ A;  4CUA A;  3EYP A;  1GOH A;  1UXX X;  2YB7 A;  1W99 A;  5EJZ B;  2R7E B;  3WNN A;  1DLC A;  3IB3 A;  2LW8 A;  2VO5 A;  3HJR A;  2WO1 A;  1GOF A;  1D7P M;  3HOB A;  2XHN A;  2VME A;  3HPN A;  4ET7 A;  1ULO A;  4MOA A;  1OH4 A;  2BBA A;  1CZS A;  5IHR A;  5DMY A;  3CQO A;  3OGR A;  4JKL A;  5HXM A;  5C70 A;  1NKG A;  3VD7 A;  2EIC A;  3WF2 A;  5LA0 A;  3NJV A;  4CU6 A;  4A44 A;  4BDV B;  1XC6 A;  4L0P A;  1JZ5 A;  3I2J A;  2QQI A;  2VZT A;  3DYP A;  3WNK A;  4GZ9 A;  5A1A A;  5B4X A;  4JKK A;  2J1R A;  1PX3 A;  4QX3 A;  3C7G A;  4QPW A;  2VC9 A;  3ECQ A;  2W1S A;  5IJR A;  2BGO A;  4OUE A;  3VD4 A;  4UOJ A;  3LQC A;  3VDA A;  4BJ0 A;  3VD9 A;  3D3A A;  4QDR A;  4TXW A;  4CUB A;  4A3Z A;  5JUV A;  1JZ8 A;  3I2I A;  2KD7 A;  3HEI A;  4M4R A;  2B4K A;  4QX0 A;  1JZ2 A;  2ZEZ A;  2VMF A;  4AG4 A;  2YG0 A;  3HNB M;  3ACF A;  2VZ3 A;  2ID4 A;  1KGY A;  2W46 A;  2VZS A;  1H6Y A;  5F7U A;  2W92 A;  3WNL A;  3CZJ A;  1JZ4 A;  2VCA A;  2EID A;  3U37 A;  2XON A;  3WF4 A;  1NAE A;  1BHG A;  1JHJ A;  4QB1 A;  1W9T A;  1CIY A;  1H6X A;  4XUP A;  2W3J A;  2W91 A;  4CU7 A;  1JZ3 A;  4GWJ A;  5IFP A;  4DUW A;  2JKX A;  5I0D A;  3OB8 A;  1JZ6 A;  3LEG A;  3WQB A;  1JYX A;  4LHS A;  3OEA A;  3I3E A;  4KWU A;  3LE0 A;  2L9L A;  2WZE A;  5C71 A;  2X09 A;  1JYV A;  4XUT A;  4ZZ5 A;  2VZQ A;  4ZXE A;  2WZ8 A;  3EB7 A;  2JD9 A;  3IDA A;  5G05 L;  1UMI A;  3OG2 A;  1WKY A;  2YC2 A;  5LA2 A;  2YFZ A;  5DPN A;  5CZK A;  1GUI A;  4CVU A;  4PT6 A;  3K4A A;  3T2O A;  3C7F A;  3WF3 A;  2V4V A;  4D8M A;  4DEV A;  2W95 A;  2W1Q A;  2E31 A;  3C7O A;  1JU3 A;  3SEE A;  4OZO A;  3WNP A;  3VD3 A;  3LPG A;  3UES A;  3MUZ 1;  3T2P A;  2RVA A;  2WBK A;  2YFU A;  4GWI A;  3ETP A;  3MUY 1;  1MPX A;  3A21 A;  4JKM A;  3NRU A;  2JDA A;  2VOT A;  1R64 A;  2E33 A;  2VR4 A;  3GGL A;  1UZ0 A;  2J22 A;  1O8S A;  2J7M A;  3WSO A;  4TTG A;  3T2Q A;  3FHQ A;  2J1U A;  1TG7 A;  5B4N A;  3DYO A;  5DN2 A;  2Z4F A;  1O8P A;  3I3D A;  2PQS A;  3SKJ E;  4KMQ A;  4DXS A;  1OT5 A;  4XUQ A;  1I5P A;  3WNO A;  1PX4 A;  2W47 A;  2VJX A;  1HN1 A;  4QB2 A;  2E32 A;  4LPL A;  4XUN A;  2W1U A;  1TVG A;  2X10 A;  2W94 A;  4E8C A;  1JI6 A;  1IQD C;  1JU4 A;  2VL4 A;  1W9W A;  1XNA A;  3THC A;  2JE8 A;  2EIE A;  1UXZ A;  3UNP A;  1J83 A;  2Y6G A;  4DXT A;  2QQJ A;  3C8X A;  2WDB A;  3THD A;  3III A;  2VZU A;  2VZV A;  1ULP A;  2VCC A;  3ACI A;  1DP0 A;  3FHA A;  2QQK A;  1XNT A;  2VZO A;  1UY0 A;  2Y64 A;  1XPW A;  4XUR A;  5EJ1 B;  1W8N A;  4ARY A;  2V72 A;  2VTF A;  2WAA A;  4PQQ A;  5JXH A;  3CIH A;  3A23 A;  1JYN A;  5EIY B;  3LPF A;  1KEX A;  4CUC A;  1W0N A;  3F2Z A;  3MV0 1;  4XZU G;  1W8O A;  2BGP A;  1JYW A;  1US3 A;  1EUU A;  3C7E A;  2VZ1 A;  2Y6L A;  4LQR A;  4D0Q A;  3CMG A;  2WAO A;  3WF1 A;  1J84 A;  2ORZ A;  2W87 A;  2WO2 A;  1L7R A;  2QQM A;  3HN3 A;  3SEP A;  4MO3 M;  4OMC A;  4ARX A;  3UET A;  5J1X A;  3P1I A;  4QX1 A;  1WCQ A;  3K75 B;  1OF3 A;  3GDB A;  4RYD A;  4A41 A;  3I2F A;  2RJ2 A;  1UX7 A;  2C26 A;  4Z2A A;  3J7H A;  3K4D A;  1LNS A;  1K3I A;  5JR2 A;  2QBX A;  1GU3 A;  1UYX A;  1UMH A;  4QAW A;  3OGS A;  1UWW A;  3I97 A;  2Y6J A;  3T0D A;  1GQP A;  1F4H A;  2W9X A;  4KI5 M;  2J1S A;  2VZP A;  3NJX A;  1CZT A;  2VM9 A;  4XVH A;  1UYY A;  2WO3 A;  3ZM8 A;  3C7H A;  3P6B A;  4QX2 A;  3MBW A;  2C9K A;  4XUO A;  2BER A;  2J1V A;  2QQL A;  1RYY A;  3I2H A;  3T08 A;  2YC4 A;  3OBA A;  5LCW L;  2J1T A;  1L7Q A;  2J1E A;  5G04 L;  2E26 A;  1CX1 A;  2C4X A;  2VMD A;  4MAD A;  2RV9 A;  3HNY M;  4AAX A;  3I2G A;  2HLE A;  2Y8K A;  3OGV A;  3T0A A;  1JZ7 A;  3JXS A;  4QB6 A;  4UI9 L;  1W9S A;  1OD3 A;  3CKH A;  2XQX A;  1UY2 A;  4DEQ A;  4W4Z A;  3W5N A;  3ABZ A;  2OKX A;  2WN2 A;  2QQO A;  2WUH A;  4FI9 A;  2Y6H A;  4ZY9 A;  2DCJ A;  1UY4 A;  3T09 A;  2VQU A;  5HPO A;  2W1W A;  1PMH X;  3NQH A;  2VQT A;  2VCB A;  1K45 A;  4P08 A;  5LA1 A;  4W8J A;  1SG3 A;  3A22 A;  3FL7 A;  4OYU A;  3IAQ A;  4OMD A;  4QDQ A;  2LS6 A;  4M4P A;  1UY3 A;  4DUX A;  1UY1 A;  3BGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...