2V4VA

Crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
QSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYTVYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTVSGVTGKHDVYLVFKGDSGYLFNLNWFTFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analysis of the Structural and Functional Diversity of Plant Cell Wall Specific Family 6 Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
molecule keywords GH59 GALACTOSIDASE
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2v4vA00
3WF0A 2WO1A 2J1VA 1UWWA 2QQKA 3UNPA 3IAQA 3ACIA 5CYYA 2VC9A 2ZEWA 1CX1A 1GOFA 4YPJA 4ZZ8A 1KEXA 4Z2AA 4OZOA 1SG3A 2DCJA 3I2HA 3AC0A 3HNYM 4M4PA 3J7HA 4DEQA 3CIHA 4JX0A 1UXXX 2L9LA 5HPOA 4QX1A 3SEPA 2VZQA 1JI6A 2E32A 5B4NA 3I2JA 2VQTA 2WDBA 3MUY1 3K46A 2W1UA 2OKXA 2DDUA 2YC2A 3HNBM 1O8PA 2CDOA 2VCAA 4XZUG 5EJZB 4L0PA 2DCKA 5JUVA 1JZ6A 2W5FA 1KGYA 2XOMA 1I5PA 2VO5A 3C7OA 4RYDA 4XUQA 3P6BA 5EIYB 1OF3A 1GQPA 2ZEZA 3T0DA 2V4VA 3WF4A 1ULOA 2RV9A 5JMOA 3NJXA 4CUBA 2VZ1A 3VD5A 2YC4A 5IHRA 5B4XA 4KMQA 1PMHX 2J22A 1W0NA 2YB7A 5LA0A 1GOHA 3ZM8A 2QQMA 1K3IA 3DYOA 2W94A 2W91A 4XUNA 2JDAA 2QQLA 1LNSA 3THDA 1OH4A 3I3EA 2ORXA 3P1IA 1XNAA 4DUWA 4P02B 1GOGA 2VR4A 4CUAA 2W3JA 3HJRA 2WQ8A 1H6XA 3JXSA 2ID4A 2B4KA 3U37A 5DPNA 2C4XA 1SDDB 3BGAA 4MADA 1UZ0A 3WF1A 1L7RA 4M4RA 2WAOA 1WCQA 3ACGA 3T09A 2EICA 4KI5M 3EYPA 5JXGA 1HN1A 4QDRA 3PUIA 1GUIA 1H6YA 1GMMA 4ARYA 3E1F1 2VCBA 2VZOA 3ACFA 3LQCA 1JYXA 4CU8A 4UI9L 1JU4A 4CU7A 2VCCA 3DYPA 1UMHA 4XUPA 3WEZA 1W99A 4QDQA 2CDPA 1UYXA 4ZXEA 4DUVA 4UAPA 5G05L 1W8NA 2Y64A 3WQBA 3VDAA 4OYUA 4XURA 2VJXA 5IFTA 1L7QA 1XPWA 2JE8A 1UX7A 3A21A 3SKJE 4OUEA 2J1SA 5IFPA 1UY3A 1JZ5A 4MGQA 2BBAA 4QX2A 2YG0A 1UYYA 2Z4FA 3LEKA 4LQRA 5I0DA 3I3BA 4ARXA 2QQOA 3I97A 4XUOA 2QQNA 1CIYA 4UOJA 2ZXQA 3IB3A 3MO4A 3W5NA 3WSOA 5JXHA 1SHWB 2J1AA 3C7GA 4JKMA 2BZDA 1XC6A 1JYVA 2WO2A 1DP0A 2HYXA 4A42A 1R64A 5LCWL 2X10A 3WNPA 3K4DA 2J1UA 2VZ3A 1NAEA 5FUIA 1F4AA 4DXTA 3LEIA 1UYZA 3CMGA 5CZKA 3A7QA 2W47A 1CZTA 1W9TA 2WN2A 3ETPA 3WNNA 4D0QA 2W95A 1MPXA 2Y6LA 3T0AA 2E26A 2EIEA 3LE0A 4XVHA 5C70A 2J1EA 3BN6A 4TTGA 1ULPA 4QB6A 4MO3M 3HNMA 1EUTA 2W46A 4CUCA 5LA1A 3CZUA 4QAWA 2VMCA 3I2GA 2C9KA 2BGPA 1F4HA 2Y6KA 3OG2A 3SEEA 4JHZA 1PX3A 2WBKA 4ET7A 1US2A 1UMIA 1JZ3A 3OEAA 4A45A 4DXRA 1O8SA 2WZEA 3DYMA 1US3A 3VDBA 3VD3A 2VMDA 4ZY9A 2WN3A 3T2OA 3ACHA 2VZPA 4BXSV 2VOTA 3I2IA 2X09A 3A23A 1D7PM 3OGSA 5JXIA 4OMCA 3D3AA 4OMDA 3T2PA 4P08A 2VTFA 4A3ZA 3ECQA 4JKLA 3K75B 2C26A 3A22A 2W1QA 1JZ2A 4DUXA 2WYSA 4DXSA 1UY4A 5HXMA 1EUUA 1OF4A 1DLCA 4E8DA 4E8CA 4JKKA 1JYNA 3LPGA 4DEVA 4GWJA 4LPLA 4RN5A 3HOBA 4QB2A 2W1SA 2VQUA 2J1RA 2Y6HA 2QQJA 2JKXA 3C7EA 1CZSA 1W8OA 4CVUA 2JD9A 3I2FA 5JR2A 1IQDC 5LA2A 1RYYA 2YFZA 5A1AA 3CQOA 4TXWA 5DMYA 3VD4A 3OBAA 2PQSA 3OB8A 1K12A 2WUHA 1NKGA 1W9WA 2WO3A 4W50A 1P8JA 4MGSA 1K45A 2YFUA 1W9SA 4FI9A 4QB1A 3NJVA 1UY0A 3T0BA 2LS6A 4W4ZA 4GZ9A 3CDZB 2WABA 3SKVA 3WF3A 1OD3A 3IAPA 2RVAA 3T08A 1J84A 3K4ZA 1UY1A 2RJ2A 2ZEYA 3FL7A 2HLEA 2VZVA 2V5DA 4XUTA 2X05A 3FHQA 1GNYA 3WNLA 2VMEA 3FHAA 1JYWA 2WZ8A 3C8XA 1PX4A 4A4AA 3C7HA 3F2ZA 3LEGA 3LPFA 3DECA 4P00B 3WNMA 4A44A 3HEIA 4A6OA 2V72A 3MBWA 3K77A 4MOAA 3UETA 3GGLA 1TG7A 4A41A 4KWUA 2W1WA 4AAXA 2VMFA 3WNKA 2VZUA 4QDSA 4QPWA 3THCA 3W5MA 2VZRA 2R7EB 2VZTA 3MV11 3EB7A 3HN3A 2J1TA 2QQIA 3K4AA 5IJRA 4PF1A 4CU6A 3C7FA 2LW8A 4W8JA 1NX9A 3ABZA 2ORZA 5G04L 4CU9A 1BHGA 4P5YA 1JZ4A 1XNTA 5C7GA 2Y6JA 2VL4A 3HPNA 1T2XA 2XQXA 4BJ0A 1K42A 2XHNA 1TVGA 2EIBA 4IUGA 2W92A 1JZ8A 3VD9A 3FN9A 2W87A 2BGOA 3VDCA 3OGRA 3NNGA 4AG4A 2VM9A 4D8MA 3GXUA 3I3DA 3OEBA 3MUZ1 2BERA 5DN2A 4QX0A 1UY2A 4LKSA 4BK5A 1CZVA 1YQ2A 2W9XA 3GM8A 1GU3A 5JXJA 1NUKA 3MV01 1OT5A 1UXZA 1PMJX 4BK4A 3NQHA 2XONA 1DYOA 3OGVA 4PT6A 1O59A 1JHJA 5IYYA 4ZZ5A 4LHSA 3IDAA 2WAAA 3NRUA 1WKYA 1J83A 3I2KA 5F7UA 3CZJA 3CKHA 2EIDA 4QX3A 4GWIA 2B9VA 3VD7A 3WNOA 5EJ1B 2Y6GA 2Y8KA 4HG6B 2ZEXA 5DQ0A 1JU3A 3GDBA 2VZSA 2E33A 2E31A 2J7MA 3IIIA 4PQQA 5C71A 4BDVB 1JZ7A 5J1XA 3WF2A 3PUHA 2KD7A 2QBXA 3UESA 3T2QA
chains in the Genus database with same CATH superfamily
1ND3A 1XNKA 3NO8A 1C57A 3KGZA 4V2WA 1FNYA 1RUD2 3GJAA 1UWWA 1MZ5A 3ZFGC 1FT9A 5FYVA 3H50A 5CYYA 3T2PA 4HKWA 4CYDA 4MUVA 1ZZBA 1YFXA 1ZVFA 2GH2A 1RUH2 4ZZ8A 4YVWC 1GZ9A 1W06A 4Z2AA 2FDGA 3AKRA 5IAXA 1ND3B 3N7LA 1SG3A 5JPMB 4YVWA 2PYTA 1AL23 3AC0A 4PBPA 1WBLA 1D4VB 2IFRA 2PLV2 4EWAA 2VUDA 5F3IA 5FXWA 3URFA 1OKQA 5GALA 1MS3A 4MXVA 1DCSA 4LE3A 3VBSC 4RGKA 4A3XA 3DF0A 1EPWA 2HH9A 4DEQA 1R1ZA 2HWB3 1KDKA 1VBC1 1VLNA 1VBA2 1NG0A 2GMPA 2ZKLA 3MPPG 5F5CA 4AI3A 5HPOA 1WW5A 4QHOA 4F8AA 1X9TA 1JI6A 5AFBA 3MLLA 4XZPA 3K3OA 4HVOA 4YVWB 2WA4A 2VQTA 2WDBA 1OVSA 4R9BA 1YFYA 5DG1A 3A4UA 5CFCB 5CBLA 1WMXA 3N9PA 4BQ3A 4IEWA 4CZSA 2OKXA 3JBG3 4IEPA 3O14A 1AYM1 3D0SA 3HNBM 5F39A 3OGGA 4D3WA 5BNOC 1H2KA 1PM7A 5GLVA 4XZUG 5BNQA 4L0PA 1R091 1VB4A 1MZFA 1LOEA 2E6VA 2RHPA 4LO8A 2GNBA 4AVAA 2GC3A 3OOXA 2W5FA 3D5OA 4PF5A 4YM1A 1WMFA 3LB9A 3NVCA 2R0FA 4ISRA 5A33B 1PIV3 5EIYB 1XE8A 4H7LA 3AP4A 1AX2A 2DURA 2E9QA 2JEMA 3M2MA 3VBOC 2DTYA 3VZMA 2CNAA 4DPNA 5C33A 3T0DA 1EAH3 2V4VA 1C8M3 3ZIXA 2LROA 1QXJA 3NJXA 2W2IA 3POYA 1Q56A 4FFFA 4N53C 1YI7A 2AH2A 1GWMA 2CHHA 4D94A 1PM4A 1BLZA 1RUE2 2C24A 3AZVA 1HKDA 2E7AA 4Q4Y1 3RI8A 1UZVA 4NO4A 1PMHX 2RM22 2Y38A 4QPIA 4CCJA 3ETQA 4D7TA 2YU2A 3RSJA 4AR2A 4Q4W1 1AR62 4NIAA 4XDPA 2LUWA 2RR11 2HWC3 3DCQA 3TNQA 3VBOB 4ATEA 2P6HA 4QPYA 3M3IA 4CEYC 5HCFA 2ZCWA 3GF6A 3VBUC 1RUC2 5ACA2 1OH4A 5K0UC 5K8SA 1O91A 1SFYA 3P1IA 1XNAA 5FP4A 2GAUA 2RDNA 1W9YA 2Q5TA 4P02B 4XJAA 4K7JA 3BKZA 3V64A 4S2GA 5KHIA 3LF7A 3NMBA 3CEWA 3UT0A 4AI0A 1N1SA 1H6XA 2PHTA 4HK9A 2A6WA 1H8TA 3JXSA 3UKTA 4AGRA 3U37A 4GALA 2C4XA 5F5QA 1OBNA 4S2HA 4D6SA 4DQAA 4CPBA 4CCOA 1YO8A 3IMNA 4MADA 4CDXA 4Y5SA 4LUMA 2TUNA 1LKNA 3R05A 1DIWA 1Q8PA 2UY8A 2BOIA 1VBA3 3T09A 3WQ7A 4HKLA 1D4M3 4XJZA 3UGHA 2A6YA 2QQVA 1H6YA 3WOGA 3E5QA 1YQ6A 3RMXA 2FD8A 4OUMA 4XJWA 3E1F1 3VBRC 4O61A 3S57A 3BTYA 5EHDA 1RUG1 2VZOA 3POBA 2RS11 4CP2A 1B35C 1UNBA 2BPA2 1JU4A 2VXJA 1URXA 1YUDA 1J1TA 5BPXA 2WYFA 4CU7A 1AR63 2VCCA 4HZFA 1O5LA 1UMHA 4LITA 4YFWA 2OQ7A 5D1IA 3HQRA 3WEZA 3M70A 1HB2A 2BDRA 3O0XA 4XEZA 4AEDB 2CDPA 4C0HA 3H3UA 5L73A 2FZ1A 4E2QA 1W6QB 3DXTA 3WQBA 3B9CA 4OYUA 4XURA 2VJXA 4W65A 1JUIA 3I59B 5D8AA 4MHRA 3B5LB 2OUJA 4DY3A 5IFTA 5JZGA 1S1AA 2PXJA 5T5JA 1NA1A 2UU8A 1O6UA 2EXHA 2UYBA 5EZWA 5IWFA 5IFPA 4N43B 3MZHA 3IMMA 1I5ZA 2YDEA 1MS1A 3L2YA 4XF9A 5EXOA 4BYYA 1JZ5A 3S0MA 1UOGA 4GIQA 3LEKA 5GZGA 3O1UA 1DGWX 4ZHNA 5JSPA 4LQRA 5C8CC 1XNDA 2VUCA 4K6BA 4AEDA 2V4AA 2JDKA 2VW2A 1NLQA 5FYSA 1O3RA 5F8PA 2BUKA 3I97A 5FP8A 4L92A 4Z2WA 4XUOA 2JE9A 4MXWA 5FREA 5D8AB 4Y20A 5FP7A 3O1VA 2NPIA 2A73B 3MO4A 4NHXA 2RJLA 1PK6B 1PVC3 2XBO3 4LO5B 3W5NA 4Y5TA 5JI9A 2VG9A 1VAKA 1D4M2 2D5FA 4JKMA 4XFAA 3SC7X 2ZHKA 1GQGA 4O9GA 3IDEA 3M7AA 4P9LA 1JYVA 4PDWB 5EYXA 2TBVA 2NYYA 5K4LA 3RG0A 1R64A 1ENRA 5EQUA 2P4EA 4TWTA 4YRDA 2BWAA 4PI2A 3K4DA 4QQPA 2J1UA 4AAPA 2OA2A 2WL1A 4W6XA 4HSJA 3AZZA 4MXWB 4FPLA 2XWJB 3W20A 3O1SA 4AHZA 3GZEA 3LEIA 1AYN3 4CCLA 3O12A 1RUI2 2FCTA 2VE1A 4RGAA 3O1TA 1RUNA 1UW8A 5A7OA 5L9VA 5IVFA 1RGSA 3RRDA 4AVBA 2Y6FA 1G9CA 3ATGA 3H8UA 4D0QA 2W95A 1EPZA 3N7KA 4K8FA 1AR82 3CHXA 3MPBA 4QT6A 3BN6A 4TTGA 2LALA 1NCRC 5GZEA 4WM7C 5BNPA 1EUTA 4LMFA 2W39A 4ZU5A 5A3OA 2DWRA 4O7XA 4AGGA 5FP3A 4QGNA 1RHI2 5LA1A 1GANA 2PQQA 3CZUA 5F3GA 2GNDA 2D6KA 4EWDA 4IEZA 1PVXA 1GWLA 1ASJ1 3LWCA 4U2AA 5JMCA 4E27A 2FBEA 2Q1ZB 5C3QA 3OG2A 1HJGA 2DFBA 2ARBA 4JHZA 3VDDC 3WUCA 3AVSA 4IEVA 4V1PA 2WBKA 1PIV2 4XJUA 3AL6A 4YW7A 4Q4V3 3FMGA 3ST7A 5JDBA 1AJKA 4W6YA 1OA4A 3DYMA 3I8TA 4CA9A 1REDA 5ABJC 1C4RA 3ZXLA 4X6QB 3TOJA 4XF3A 3T2OA 2ZOEB 1LOFC 2YUEA 3N7MA 4ONUA 4NIHA 3GCWA 3HIFA 4QWNA 3JCIA 4BXSV 3I2IA 4BQWA 2ZMLA 5GLUA 1D7PM 1N47A 1ZA7A 3FBYA 4LR4A 1FMD3 2NP0A 4XETA 3MGUA 1SMVA 1D2SA 3R4SA 3I4IA 2OS2A 3D3AA 2VBPA 5FJHA 1RJ8A 3ILFA 3LD8A 4P08A 3WNXA 2ZBJA 3AYCA 4AEJA 5JR7B 4N53B 1JZ2A 3OY8B 1W05A 3M1HA 3FBMA 3BVCA 5K0UA 4I3PA 2QDNA 3S5QA 4PHZA 5FY5A 3POIA 4AF9A 1OF4A 2EALA 4BH9A 4GJZA 4BLJA 1RXGA 3VV1A 4JKKA 1BJQA 2A75A 5A7WA 4CDQA 2GMEA 1QJY1 3TWIA 3UKNA 1QNYA 4OHWA 5KHKA 4QPGC 4CEWA 1SBDA 1XU1A 1AXYA 4LHNA 5HCAA 4UW5A 5J98B 2GC0A 2GNTA 3FWEA 2VQUA 1YEWA 5JIAA 2QQJA 5K0UB 3C7EA 4YSFA 1W6NA 1HQLA 3KHBA 1RUH1 4CP9A 4COWA 3H8RA 4CCNA 4NIDA 1AR91 1XYOA 4YM2A 5LA2A 5A7WB 4CDQB 2HWF3 1DDLA 1SZBA 3OBAA 2PQSA 5FBJA 5BNNC 4Q4Y3 5FO9B 2XDVA 2YPDA 3AM2A 4I3GA 2RR12 4CEWB 5CB7A 3ZKYA 2QKDA 4Q2FA 3T1MA 2YFUA 4UFLA 4H3WA 3KHCA 3TYJA 4QB1A 3NJVA 3IPVB 4EWEA 1Z7S2 1ZYBA 5LBBA 5L19A 2XJPA 1ASJ3 1T6GC 1OQDA 1W6NB 2HWE2 3ILNA 2VUJA 1AJOA 1VBD2 1S2KA 3LA3A 1OPMA 2CYFA 2YROA 1XYNA 2IXJA 1QJX2 1UOJA 1X36A 1SBFA 3SKVA 2PAMA 3T08A 3K4ZA 3D0JA 1EYBA 4MYEA 1HB3A 2NMNA 2VY0A 1R093 1BEV3 2VZVA 2PHLA 3AKPA 1B35B 1VJ2A 3OTFA 1C8M2 4GMP1 4DRVA 1GNYA 3BTAA 3NKTA 3H8XA 1DQ4A 3KCXA 1JYWA 4BXFA 4ATFA 5AC91 4IEQA 5FYMA 1MVQA 4A4AA 5K9YA 1H9WA 4RSUA 3DECA 1RUF2 3E5UA 4CUGA 1H1IA 5FPBA 5J48A 2QQUA 1LOCA 5KXEA 3HEIA 4A6OA 2JG9A 3MF9A 5LBFA 2VOXA 4MOAA 2ZGSA 3UETA 5FYYA 3VUOA 1Z0HA 2ZX0A 4JV4A 1CAVB 2K9ZA 3JUUA 1TE1B 4FCAA 1LCLA 2P2KA 3PU8A 2I07B 4NRPA 4D7SA 3RYPA 2HBUA 2ZGNA 1YIFA 3CF6E 1QQP3 2ETEA 3BPSA 1LU1A 1RUH3 4MV2A 4XDOA 3VZOA 4BIFA 1QOOA 3HN3A 1Q8SA 2ZX1A 4GAZA 5HXVA 1HLCA 1U12A 4YVSB 2VTXA 1KJRA 2QQIA 4IGPA 1SPPB 3WG2A 3AMPA 4PF1A 1POV1 1I1EA 4XAAA 2B39A 5L9BA 4CU6A 1M06G 3Q8EA 3RI9A 4W8JA 1OLME 1WLCA 1RUF3 1V00A 4WVVA 4OHXA 3N9NA 3WDYA 5DAVA 3Q9OA 3A0KA 1YLLA 3KV6A 4CEYA 2VECA 3HPNA 4XJ9A 1XQNA 4RFRB 5JPNB 3HT2A 1JMUB 2BRTA 2GP5A 2R062 4K21A 4B29A 2P3YA 4QQ2A 5KHGA 1E5SA 5L9RA 4MSVA 1YFWA 4A7ZA 4YVSA 4Q4W2 1SPPA 1FATA 3FUOA 4OQ9A 4C91A 5KBFA 5FXVA 3VDCA 3OUJA 1H8TC 3NNGA 2WR9A 4GMP0 3GXUA 5JOXA 1D2QA 2X5IB 1QJU1 4QX0A 1V9U1 1OURA 1UY2A 2E53A 2VNRA 3ASIA 3BYWA 2XJRA 4LKSA 2WZPP 1GZWA 1OLMA 3QLQA 4RR3A 3ZXFA 1OQ1A 1PO23 2XXZA 1ND2B 1W8TA 3AZXA 4B7EA 3OUIA 4CRQA 2NQYA 3FC0A 1HQNA 2GDFA 2JKBA 2W9XA 2ENRA 3IDBB 4XFCA 1MVEA 2WFF2 1JZ4A 5JXJA 3PUSA 1WW4A 1R083 3RWNA 1R1A3 2JG8B 5DUXA 4HN1A 2UWCA 4BK4A 3JD71 5K7PA 5KC6A 3WG1A 1DYOA 2VNOA 1FAYA 5ISLA 1NOVA 2JIJA 1O59A 1VBD1 3H1WA 1N1YA 4HSLA 4YG6A 5ABJA 2AGSA 2W0XA 2BFUS 1LHWA 5FY7A 5AC93 4HETA 3AVRA 1EY2A 1RVF3 4KWLA 1X9PA 4FFHA 4AFDA 1J83A 3I2KA 4QXKA 2DBIA 1NY71 5FY8A 1Z7S3 2WFF1 2YGLA 4OLLA 5A3WA 3ZSKA 3VD7A 4BQYA 2G9GA 5EJ1B 1OQEA 2IC1A 4SBVA 2BNNA 3GDBA 4QX5A 4NIIA 1NA1C 3KZ4C 1JW6A 2FCUA 5FYCA 3KS7A 5JVVA 5A1LA 2GC2A 3H8OA 2DVFA 2HWF2 4BDVB 3RNSA 2P17A 3VBFB 2YY1A 4AEDC 1G6NA 5FZDA 1GQHA 1MS8A 3BB6A 3UESA 3T2QA 2AEYA 3HWJA 3U14A 1RMU2 5C3OA 1QH7A 4I09A 2C9AA 5GZDA 5M0TA 1ND3C 2PA7A 3KCCA 1X8MA 2WIIB 2XLGA 2J1VA 4HOOA 2JDHA 1NCQC 3MIFA 5FK7A 3UNPA 4XF4A 1NCQA 3IAQA 2ZS6B 3L2HA 5J37A 2JJ6A 3PUAA 1JOJA 3SCHA 2OW4A 1RVF1 3B7MA 3VB9A 5IVBA 2CTVA 4IESA 5F6LB 3VBFA 3K48A 1CX1A 2HWD2 4YPJA 2Q8DA 5JOZA 1KEXA 1QEXA 3K3NA 4IE6A 2VMIA 1GWKA 4CCCA 2DCJA 4B8EA 3PIJA 3TEZA 3LA2A 1H2LA 3V56A 3B9IA 5CFCA 3RZMA 1WA6X 1XB9A 4AGVA 4QKFA 2RDRA 1ULFA 4M4PA 5LRRA 2BVVA 3DPRB 3K51A 3QOPA 4IE4A 3KSCA 1ALYA 5FPLA 5A6YA 1WD3A 5F9TA 3NNMA 3HQXA 5ANQA 2OZJA 1UZZA 2DUPA 1BXHA 2L9LA 4FVVA 1H8VA 2AR6A 4XQDA 4PLMA 4A7YA 3K46A 3MFAA 5A33A 1I6XA 2PHXA 4O9EA 5EPAA 5I8TA 5CADA 1VP6A 2FDFA 2ZMNA 4LNVA 2A3WA 2VMHA 1O8PA 1VBB1 4XTPA 5F32A 2VCAA 1OFNA 1Q3EA 2FQPA 3KCYA 4Q0QA 5EJZB 3I3QA 2XKOA 2R042 3GYDA 1UD1A 1LHNA 3PJQA 4GKXA 2QJVA 1AR61 2VO5A 4XUQA 4RYDA 5DDJ2 3BTZA 1YIPA 2XJQA 5GJ6A 4F3JA 2ZGPA 1OF3A 5E88A 1GQPA 3B69A 2RDSA 1JYCA 1GKBA 4QM9A 3VBOA 1V9U2 1U5IA 3AK0A 3LSEA 1UKGA 3PTRB 3AP7A 4EROA 4JTNA 2IXKA 4GH4A 5GM0A 5JI7A 4CUBA 2VZ1A 3ZYJB 3VBUB 5SV8A 2GSYA 4GQ7A 1DYPA 5FZ9A 1REEA 5B4XA 1N3OA 1QOTA 2QE3A 1G9AA 3VDDB 1TQ5A 1VRBA 3LDRA 2YB7A 4NWWA 5LA0A 1UPIA 4BMBA 1CQ9A 4KQ7A 3KF3A 1OUXA 3H9AA 4EZ4A 3FLPA 4AOCA 1LGNA 3J4UH 3HQUA 4ITCA 4IXLA 2W94A 5FLHA 2W91A 5H9SA 5T50A 4A7KA 5BUVA 4Y5Z0 4GH4B 2QQLA 3PU3A 1LNSA 4CDWB 3BTXA 1AR81 2RS53 5FO7B 1HDKA 3PVOA 2YV8A 2VTXJ 3I3EA 5DZFA 3VBUA 2ZGMA 2DU0A 4G3YC 4GULA 3ZKUA 4DUWA 1J3RA 3WDVA 4TZDA 3VKLA 4R4ZA 1GOGA 2ARXA 3UK9A 4CUAA 4BHPA 2G9ZA 2A1XA 4PBOA 1PNGA 3HJRA 3DKWA 2WQ8A 3AKSA 4XMIA 5KXBA 2ID4A 2IUWA 3LSDA 4FQZA 3N36A 4YGBA 2PHRA 5DPNA 2BNOA 3PVBB 5FY4A 3UGGA 4HANA 3FJSA 4UYBA 1FMD1 4DY5A 4EN8B 5A6QA 5A7NA 4X6RB 1TME2 3DV8A 2PTMA 5T5OA 5E16A 2CGPA 4CDWA 2ZGUA 4FP3A 4M4RA 4IV1B 4CDUA 5FPAA 3ACGA 1LTEA 2ET7A 1YFUA 3EYPA 3S7EA 3OSDA 4EV0A 2C1FA 3KV9A 1DF0A 1FOD3 1EV12 1W6QA 2EA7A 1YHFA 4YWAA 5FLIA 3LCPA 4FPJA 2DVGA 1ZA4A 4Q1PA 1GMMA 5F37A 2ZACA 5FOBB 2D7FA 2E7TA 1MEC2 2ZA9A 3ACFA 1QXPA 5FZ8A 4HVRA 4XXPA 4UI9L 5FTTC 3I2OA 4N43A 2ZGOA 2I74A 4N43C 1ND2C 2WQZC 3U11A 4IV1A 4QDQA 4Q29A 5J3UA 5C4WB 1UZYA 5FQ0B 1X7NA 5FWEA 2DU1A 4QGLA 3ZFEA 4DUVA 1QJU3 4HT1T 5G05L 1AYM2 1W8NA 4FPKA 1SBEA 3S5AA 4Y20B 1ULGA 4UF0A 1PK6A 4Y3OA 4M01A 5CVRA 1PK6C 4OUEA 4FSJA 5DZGA 2XVGA 4Q0VA 1UYYA 2XR4A 1JOBA 5D21A 2R0HA 2QQWA 4AVCA 5A3PA 1MEC3 2O8QA 4DB5A 5C4WA 1VBB2 3ZFEB 5FQ0A 4MX3A 2O0OA 1TNFA 2QQOA 2VW1A 3PNAA 1QU0A 4UWDA 1LB2A 4UOJA 3IB3A 3JD72 1PMIA 4Q26A 1LEMA 5CKQA 3C7GA 2B45X 2QNKA 3AKQA 2QZ2A 2WO2A 4XIOA 5FMOS 4OZXA 4FPCA 4YZ4A 5IUQA 5CG8A 2XJUA 5FBZA 5A3LA 1S0EA 5IATA 3E6CC 2AENA 1O3QA 4DO0A 1WA4A 2RS33 3BUCA 3RWKX 3VZKA 5F3EA 1NAEA 2WNVC 3DXUA 5J96B 5FUIA 3DN7A 2Q8OA 1A3KA 4IEXA 4WVMB 3JQWA 3RJRA 1UF2C 1G9DA 1KJLA 1QKQA 3FFQA 2BW8A 3RDIA 3FFZA 3WY6A 4AW7A 1LECA 2CWSA 2XJTA 5DDJ3 5C5UA 4LO7A 3IT8A 1CZTA 1CAXB 3GHNA 5I0TA 3LOIA 2WN2A 1PO22 1UIJA 3U75A 4B7KA 3M8LA 2PHUA 3ETPA 2GP3A 2W68A 1GR3A 1YRZA 4XYXA 1O3SA 4MZUA 3POSA 4JZRA 1ZRFA 2IXLA 5C5TA 2EIEA 3VZJA 3LE0A 1F8VA 3M3QA 3M4FA 4E2GA 3J8F2 3JB8A 5C70A 4RS5C 3O1OA 4FPEA 1LULA 4QB6A 3POGA 4MO3M 3HNMA 1FPN2 4IV3B 3TBDA 2PMWB 5LB6A 1J1LA 2BNMA 3J26N 4FPGA 5EWSA 1E57A 1E5RA 2JD4A 3LGRA 4B4RA 5F3CA 2VBDA 2B9UA 4IL7A 4KH9A 1HXS2 3E6DA 4Q0SA 1UIKA 1C8NA 1DYKA 2VMCA 1A8MA 3I2GA 1AR92 2BGPA 3JBG1 3PVNA 3WXPA 4FTBA 2D98A 4LT5A 3AMHA 3HAGA 1F4HA 1RUJ2 4LLOA 1KQRA 4XMAA 3ZPOA 3SNMA 1ZNPA 2RS52 3ZSLA 1PX3A 4YG3A 4LKFA 3ZN6A 1AYN1 1TMF2 5FO8B 1UMIA 5FXXA 4QX8A 4IV3A 4NR1A 4DXRA 2WZEA 3FUQA 3NV4A 4P9GA 1WLTA 4XFFA 2DVBA 2VMDA 1GBGA 2A6ZA 4GWMA 4N53A 3VD3A 1AUYA 1VBA1 3DKQA 2D5HA 3OY8A 4HMZA 3NKGA 4ZY9A 5J7MA 1LAJA 1J59A 1V70A 5LA9A 3MIGA 4B4QA 2X09A 3B94A 1AR72 4MGZE 2WS92 1Q8OA 5JIUA 3OGSA 3ZN6B 4FBFA 2A70A 4HLTA 1UU5A 5JXIA 4CCEA 3U0ZA 4J6GA 5GLZA 4P5HA 3N9QA 2BJSA 2YXSA 1VALA 3W58A 2FZ2A 1QIQA 5I93A 4B1MA 3OGJA 3ECQA 4XE9A 1OOPB 3K75B 5FAXA 5FCCA 5IK8A 3JB4C 3WDXA 2WYSA 2I45A 4I0AA 1UY4A 3AXDA 3ITQA 5FV3A 2XMLA 4QHBA 1YQCA 4CP9B 3MIBA 3EJKA 4EE2A 5B2GB 2WNEA 1G9BA 5FIXA 1WW6A 3I7DA 2XLFA 1XJAA 1GP6A 1UN1A 5FPUA 1WW7A 3VKNA 3RZJA 4LIVA 1JH5A 1FXZA 1HW5A 3WVJA 4GKYA 4GWJA 4NRMA 1NT0A 2ADEA 4PQ9A 1V6IA 4CEWC 3AFGA 4RN5A 1S0FA 2W1SA 3IPVA 4DFSA 3KQRA 2ZTNA 1ULEA 4QXHA 2JKXA 4UFMA 2QQPA 1REFA 4DOUA 4FO9A 2NLRA 4CVUA 1KD7A 3EBRA 1ZBE3 2DVDA 1OI6A 2DV9A 4L9BA 5CEHA 1IQDC 1EAH1 1RYYA 3IWZA 2YFZA 4Y4YA 3CQOA 4TXWA 5FMCA 4FQ4A 5A1AA 2ZHMA 1PO12 5CFCC 3TEWA 1A8DA 4LOTA 1W9WA 2WO3A 4N7IA 1RUI3 4W50A 4C8DA 4MGSA 3ZSJA 3W59A 5FZIA 1B35A 5SV5A 4DRRA 1G86A 2GC1A 4N9HA 3MLJA 2F6BA 1VMJA 3AYAA 1ULDA 3NV3A 3OYWA 3QH7A 1ENSA 2ZHNA 4JDMA 4QQOA 5FY1A 2GH8A 3VGIA 1SCRA 3T3YA 4E2SA 1HXS3 2RS31 2VPVA 3INAA 2VAUA 4RHV2 1IG0A 3T0BA 3CNAA 4BQ2A 4FPHA 1G7YA 4Y1XA 1JTZX 2LS6A 1GZCA 4W4ZA 4P9WA 1AYM3 4GZ9A 4YNIA 1I9RA 1QJY3 3WF3A 3OCPA 2VU9A 1SACA 2UWAA 1V6JA 2RJ2A 3X29B 3FL7A 3JBG2 4NMIA 1X82A 4A2UA 1V9U3 3OBTA 2VH9A 4XUTA 1XU2A 4TLFA 4OHZA 3FHQA 3WNLA 4KBZA 1C5IA 5BV6A 5FZ1A 2VMEA 5EV7A 4L2NA 3C8XA 5BXXA 3LEMA 3HVDA 3NSTA 2XQRA 4IEOA 4JTOA 4KNCA 3HBKA 4URTA 4P00B 3T4VA 4A44A 2FHRA 2Y34A 4RQPB 2ARCA 3NNFA 3MBWA 2BP6A 3ZYHA 3GALA 1VIWB 1MQTA 2OPWA 1VRH3 4KWUA 5HI0A 4P14A 4HPKB 1VMHA 3H42B 3J7MA 4PIYA 4HBNA 2YU1A 3PMSA 1CPMA 4QDSA 3THCA 1AL22 2A6VA 1NQDA 4M0NA 2VVDA 3IN9A 1ST8A 4RFT0 2R7EB 5FY9A 1IS4A 2VQAA 4NHMA 3H7YA 2EXKA 1LHUA 1Q8VA 2V5YA 1C8M1 1W6PB 2J1TA 2WKKA 3I54A 3KVAA 2KR2A 2JXAA 4R52A 5T5PA 5CA6A 3K4AA 1SLCA 4JGYC 4RQPA 4BISA 2JICA 2MNGA 2LW8A 1A78A 1MQTB 3H1YA 4XCBA 1UPSA 4XF0A 3D6EA 5G04L 1NE4A 2DVAA 1HQWA 2ORZA 2X5IA 4HPKA 5GLWA 4CU9A 4UFHA 1PO21 1Q5OA 5C7GA 1GZWB 1CESA 1T2XA 2JDZA 4Y1ZA 5HV4A 1RB8G 1PGL1 1QF3A 2CAUA 2WNUB 3K2OA 3SCGA 1GNZA 2VXRA 2C0ZA 2RM21 3MW4A 2XHNA 2XLAA 4OULA 1A34A 3ZSEA 1H1AA 2W87A 3CJIC 4QM8A 4RS5A 3LDBA 1W8UA 3OGRA 4AFBA 4BPZA 1QJFA 2VM9A 1RUC1 1BBT1 4D8MA 4BQ4A 3I3DA 3MUZ1 2BERA 1BEV1 3ZR6A 2P3IA 4YW2A 4D6RA 5ABJB 3Q8AA 4XOGA 2MEV2 2G1MA 1CZVA 1APNA 2LRPA 2WNUA 2HWB1 3N35A 3WQ0A 3NJYA 1OMIA 4W6WA 5LASA 1BVP1 1AR83 2RS51 2VNVA 3PTYA 2VW0A 3MV01 4YM3A 1OT5A 2R071 2QTWB 2V73A 5FZ0A 2ARAA 5CFDC 4J25A 1VBE3 2GMMA 1LGBA 4FAHA 3N9LA 3ZFFC 2JX9A 4IV3C 3H3LA 1C1LA 3LAGA 2K0GA 3CU7A 4DNYA 3VKFC 1WCSA 4ZZ5A 2RS13 1MR5A 2JIGA 5FZ4A 1RXFA 2WAAA 2WQ4A 4IV1C 3WZ1A 1WKYA 5BYNA 5F7UA 2CGNA 5F6KA 1ZZ7A 4QX3A 1L7LA 4GWIA 4YW5A 3EQEA 5TSWA 1O7FA 2WS93 5FMOL 4BWOA 5A6ZA 2B9VA 1BK1A 1FI2A 2WC2A 2Y6GA 2R073 2ZEXA 4DZGA 5CAZA 2Z42A 4CP1A 2WLQA 3ZFFB 1NCQB 3V0BA 1LU2A 2PAEA 5C71A 4AXOA 1WUVA 1DQ6A 4MG2A 1CAUB 1BZWA 1OPOA 1PVC1 2XBO1 4WM8A 1VBE2 1Z78A 3R0RA 4Q5OA 4Q4X1 2D6PA 4LOSA 4FOYA 5DAPA 3NNLA 1T6BX 4ZONA 3RPQA 4IGQA 3DGTA 1N1VA 1QJZA 2WO1A 4Y22A 4U36A 1S2BA 1XE0A 2BU9A 4P5YA 1TME3 3DPRA 4MGTA 3ACIA 4CXWA 3LOBA 4PLOA 3QCWA 3DUIA 1RL3A 1Y9MA 2Z69A 1AX1A 4NHYA 1W28A 4WM8B 4DS0A 2VC9A 2ZEWA 3VBFC 2YBPA 5FPVA 2PLV1 5KR7A 1W39A 5CNAA 1RIRA 2DFCA 1GOFA 3NNJA 1GLHA 2WLPA 1DQ2A 2NN8A 4OZOA 1FV3A 2HWF1 3NJZA 4Y22B 3UJQA 4COVA 3BOPA 3G6JB 2JDUA 1SCSA 2E51A 1KRIA 4GB31 3HNYM 1W8ZA 3AFKA 1DBNA 2BOJA 3WG4A 1XOYA 3O0WA 4WM7B 4E4DX 5JAXA 3VHNA 3LFIA 2Z2SB 1KS4A 3FLRA 3J7HA 3N9MA 5EP9A 3JQXA 3CIHA 1ZBE1 2VVEA 5AVAA 3D8CA 1AR93 4JC1A 2JDPA 3O5SA 4PLNA 3OBZA 4JAAA 3ZLIA 1RUJ3 4KBBA 2WWSA 2E32A 4ZPIA 2JB8A 3AMQA 3S30A 4AE2A 3NAPA 3BCWA 5CU1A 1QJY2 2ILMA 4N7UA 3VKOA 1PGW1 3FLTA 3C3VA 3FZ3A 4LBQD 4WM7A 2VVFA 4R8HA 2DDUA 2UYAA 2WFPA 2OT7A 5DAWA 1BBT2 2Z79A 2J42A 5FJKA 2CDOA 1DU3D 5A32B 4XABA 2BTVC 2DCKA 3HMYA 3SH3A 1JZ6A 4BQ5A 1JN2P 3B3QE 1SLLA 4Q1RA 1Z7S1 4NPMA 1KGYA 2XOMA 3B00A 3C7OA 3NAPB 3GZAA 3VDDA 3ZSMA 1J58A 4LHKA 3U4XA 5A3TA 5ACA3 1UOFA 1LRHA 2ZEZA 4FXKB 3ZX7A 2R041 4JQRA 4RD7A 3G7DA 2BFUL 2JB4A 4BMEA 2D6LX 1BEV2 4XILA 5I8SA 3USUB 2BBVA 3WF4A 2HWC1 2D97A 4OVEA 4IEYA 4AEKA 5JMOA 1DGLA 2R1BA 5A32A 1ZBA1 4FOVA 5LY2A 3TEXA 1LOFA 2HWE1 1PZ9A 3MW3A 3BODA 4EYUA 3KD4A 4AL9A 1RUI1 4KMQA 2ES3A 1GP4A 1G8WA 4RQPC 1W0NA 2Q30A 3OPZA 1F5FA 1GOHA 1PVC2 2XBO2 1OVPA 5FKCA 3THTA 4YW3A 3ZN5A 3ZM8A 1K3IA 2H6BA 2YPJA 3USUA 2JWPA 3ZDVA 4OI2A 3KWVA 4XUNA 2B46X 3QD6A 1MS5A 2JDAA 4P9IA 5F5IA 5DABA 1H1MA 4HKOA 4CDUB 3KT1A 5FYHA 2ZAHA 1NXMA 5L7OC 4Z8BA 5CKMA 3O1RA 1ZBE2 2I2SA 5FPXA 2VR4A 4XFGA 2ET1A 5F2SA 2VUAA 1AZDA 3IBMA 2VQ0A 4FFIA 4JGZB 3VBRB 4YZ3A 2K46A 2XJSA 5FK8A 2B4KA 4P9XA 2VOVA 1BK0A 4I30A 4QMAA 1SDDB 1WMDA 2AUYA 3POJA 5I0RA 1DZQA 2RM23 1GFF2 1HX6A 3M3OA 2A7AA 3P3NA 3WF1A 3AYDA 4CDXC 1L7RA 5I0SA 4COYA 2ZABA 2F4PA 2IXIA 4CDUC 3GBFA 2CY6A 4KI5M 3R4UA 2BQPA 4KWKA 5KHJA 1RJ7A 1X8EA 3HD8B 4CSWA 4CTEA 3PUIA 1GUIA 1UU4A 1VAVA 1TMF3 4QKDA 1PNFA 3VBRA 4YLZA 4ASKA 5FUPA 2BGCA 5CFDA 4ARYA 2W08A 1J3QA 4AEMA 2IXCA 4UF0B 3VBHC 2D44A 3LQCA 1JYXA 3DEMA 4N90A 4CU8A 1TEIA 1M4WA 5LEJA 4IEUA 4AQTA 1OA2A 2CAVA 4X8PA 4LE4A 1W2NA 1W99A 2B8MA 1IPSA 1YYNA 4HXCA 4FPFA 1AR73 1NZCA 1H2NA 1ODMA 4I02A 2Y64A 1V6OA 4NOTA 5GZCA 3WP5A 3PIGA 1SDWA 4YYOA 1V6NA 4AQSA 1W6MA 1AVBA 1O4YA 1HRV2 1XPWA 1UX7A 3J9SA 3A21A 3SKJE 1GYKA 3ZXKA 4TN7A 2J1SA 4OHVA 3H0OA 2Y26A 4NE9A 3AP5A 2BBAA 4QX2A 3JZVA 4META 5FZCA 4UBHA 3R4DB 2YZ4A 5HV0A 1ZZ8A 4DXZA 1GZTA 1HB4A 2OX0A 5C3PA 5I0DA 2H0VA 3I3BA 1BBT3 2P37A 1FMD2 1IS3A 3AJZA 2VD7A 3RZLA 3RFRA 2WNVB 2Y33A 3CO2A 4WVMA 2ZXQA 5FKBA 3ZR5A 2CV6A 3WSOA 1SHWB 2J1AA 2GU9A 2BZDA 3UL2A 1JODA 1ODNA 1XC6A 3ORJA 1FYUA 4LHLA 1CAXA 3TAYA 5JCTA 2H0BA 2HYXA 3AXEA 1WMEA 2Z5WA 4GB33 5EFUA 3WNPA 5FLJA 4JDNA 1HN0A 1EAH2 1RTVA 3T2TA 3NV1A 1S55A 4HVQA 1MZ6A 4LBNA 3AP9A 1DGRA 2WNVA 4DXTA 3FX3A 2O1QA 4M0HA 1FX5A 4BLIA 1DG6A 1UYZA 3ZXJA 4R9DA 1OH3A 3CMGA 2NMOA 3PMEA 5CZKA 2VGDA 2FDKA 3ZFGB 3KM5A 3VBSA 5LWBA 1W9TA 3ME2A 4PDWC 3VL9A 2A3YA 5IK5A 4IE0A 4WVZA 3LFMA 3SXWA 1H4HA 1ONAA 1LR5A 4FPOB 5A7PA 1R092 3T0AA 1VAMA 2VCMA 4Q0PA 1JOPA 1U5XA 4XVHA 1HIXA 2J1EA 4GB32 4R9AA 1UQXA 1ULPA 3ZXEA 2QCSB 3RZHA 3RGBA 1ENXA 2Y60A 5A70A 5AC92 2R061 3OUHA 4KG8A 3ZMNA 4QXBA 5C3RA 1KITA 1W8WA 2JDMA 2YHJA 4TYSA 4XF1A 1KFUL 2RJKA 4AQ6A 4Q0UA 4CUCA 3EHKA 2G4IA 2C9KA 2WNUC 2LM3A 1AR71 2P34A 2Y6KA 4IE7A 4IW3A 2DTWA 2EVXA 4J1XA 4M00A 2XL9A 1VBC2 1RHI1 1F31A 2D3RA 5FZFA 4YG0A 4N9IA 3SH4A 4XQ4A 3EMRA 2HEVF 2R072 4SLIA 5DZEA 3TEYA 1CIWA 2P1BA 1JZ3A 3GJBA 1GV9A 4NN0A 3WQ1A 2WNOA 4OHYA 1U0AA 3ELNA 5BNOB 3VDBA 3I49A 3H7JA 3NWKA 1UX6A 4ZXKA 3ZYFA 4ES9A 4EZHA 2UWBA 1OOPA 2BWCA 1VBE1 4Z82A 1AYN2 1TMF1 4G9SB 3SH5A 3ZPYA 1OOPC 2VZPA 5IT6A 2ZZQA 4K3UA 4LBQB 1RUE3 2A71A 3PL0A 1U5ZA 3A23A 1LODA 2K2SA 1YQ8A 4UW6A 1W8FA 4INDA 4BQXA 1RUD3 4TLGA 4L11A 1XNCA 5FZGA 4OMDA 1X50A 2R063 4OFGA 3P3PA 1R1A1 2VTFA 1G9FA 1F2NA 1LJ7A 2YC0A 1XSQA 4LBLA 4NJ4A 3WUDA 4UFJA 4A3ZA 5FDBA 3WX5A 2WWUA 1JYTA 4FTSA 2XVLA 5FZMA 3A22A 5F2WA 2W1QA 5KWRA 4Z07A 3J8F1 1IQAA 4OI4A 1S2EA 4DXSA 4EQVA 5DXDA 1EUUA 1YQ5A 4LBQA 1CN1A 2XKPA 3ILRA 4KL1A 3WW3A 5C9AC 1W2AX 3U10A 1E5HA 5C9AA 1JYNA 4QD2A 3LPGA 2CU5A 4NUBA 4ZS3A 3DPRC 4Q8LA 4QPGA 2N7GA 3RQ0A 1POV0 3VHPA 1Y43B 3OYWB 3QACA 2J1RA 1W8OA 3L9JT 5H9PA 2OPKA 5I0UA 1VE0A 4FXGB 3U4SA 2HEWF 4FP2A 1CPNA 3KVBA 2JE7A 2VBBA 4NWVA 2ZGQA 2YBKA 5C9AB 3THPA 5LK7B 5DMYA 1K12A 2WUHA 2Q8CA 1O4TA 1AHSA 1NKGA 3VBHA 1FV2A 1POV3 4F7ZA 5JSOA 4MLOA 1C5HA 4WZCA 2ADDA 1K45A 4NRQA 1W9SA 3MIEA 2DUQA 4AHYA 5FP9A 2WT2A 3SITA 3MDPA 5DUUA 3QBQA 1YJKA 1YNAA 1DQ0A 3QH6A 4FTEA 2FDHA 5F5AA 4CCMA 2OVUA 3ZFEC 5FOJB 4H55A 1JS9A 2VULA 2B42B 1ZZ6A 2WSVA 3CDZB 4LORA 3S7IA 4AI1A 1Y4WA 1QMJA 4JQTA 1J84A 1BQPA 3ACLA 4MH0E 3VBHB 2V5DA 4M3CE 4XQWA 4M3CF 2OXBA 2X05A 3PDQA 1LHVA 1WGPA 2PFWA 1MEC1 4Q8KA 3FHAA 2WZ8A 3HBZA 2AREA 1SLTA 3PJYA 4K40A 3F2ZA 3U1XA 3UYJA 2RR13 2AZ5A 2WZR1 2XJVA 3LPFA 3JU9A 1PHMA 4ORFA 1W6PA 1DQ5A 1QNWA 4LK6A 4QXCA 3Q8FA 3WNMA 4BZ4A 4AFMA 5JSRA 2ATFA 2V72A 5KC5A 5ANNA 2JG9C 3GGLA 3IIAA 4FOWA 3ZDSA 1H4GA 1UYPA 1VBD3 1MQTC 2HWD3 2VMFA 2WFF3 2ZGKA 1ENQA 2VZUA 3KV4A 3APBA 5A3NA 3WW1A 4Q4W3 3ENRA 4CP0A 5E6HA 1IPJA 4GH4C 1ZRCA 4QKBA 2VZRA 5IVCA 4WVWA 3E6BA 3MIDA 3T4HB 5CG9A 3MV11 3EB7A 4BQ1A 2ZGTA 4J1WA 4XJ8A 1STMA 3RZGA 2RMU3 3RVHA 1RC6A 1NXD1 4QPIC 5IJRA 3C2UA 3C7FA 4RS5B 1MZEA 1W04A 5F1RA 3AJYA 1MS9A 4K1ZA 4YFZA 1FOD1 3BOWA 5KXDA 2F17A 1BHGA 1J3PA 1R082 1AXKA 1NYWA 1S0CA 2HWB2 2E63A 1N1TA 2TEPA 2VL4A 1R1A2 4K1YA 4XCAA 2G19A 2XQXA 3IDCB 5FYUA 3VZLA 4LBKA 3VL8A 1WLDA 4BJ0A 4FT8A 4XBLA 1TZOA 1SFNA 4NPRA 1TVGA 5APAA 1RMU1 4IUGA 5DUWA 3W9AA 3VD9A 1C1FA 2FCVA 3UV9A 3FN9A 2P5BA 3ZVXA 4BA6A 2GN7A 4XFBA 3U78A 4AG4A 2Q4SA 1YWKA 2XHKA 5FZOB 3SCFA 3POWA 3OEBA 3N3HA 4IQPA 5FMDA 2ZAAA 1RUF1 2A3XA 4HN0A 1KXGA 2XWBB 1V6LA 1CVNA 1H9PA 2WWJA 4OI1A 4RR3C 3POFA 2XB6C 4UW3A 3NL1A 5EYYA 4ZU7A 3GM8A 4CCKA 4ZU4A 3WLUA 5A80A 5A7SA 2Q1MA 4QGMA 4X8NA 5IVJA 1WCKA 2HWE3 1IS6A 1UO9A 1DFQA 5I8YA 1VBC3 1OD5A 1W90A 4MVTA 2B7YA 4AFAA 1CJPA 3ON7A 2MPFA 3AMMA 5I91A 3RYKA 1HRV3 3ES1A 4Q4V2 4YGEA 5JLVA 1LEDA 3OGVA 2JDYA 4YZ1A 3ZFFA 3V0BB 1MACA 1W2UA 5GKAC 1NY72 2RMU2 5IYYA 1CAUA 2HJIA 1XXNA 3CBNA 5T54A 3IDAA 1W2TA 3NRUA 1QQP1 1V6KA 5FYZA 1XBFA 2ZPXA 1PGW2 2EIDA 2ERFA 2BVBA 5FZBA 3GBWA 4JGZC 4LA3A 4QU2A 2D43A 4BB3A 3ES4A 1JHNA 3WNOA 5JZGC 1ASJ2 4NIGA 4HG6B 2QZ3A 1ULCA 1JU3A 2VZSA 2ZX2A 2E33A 3O0VA 3VN4A 4PQQA 4WBBA 3V65A 3WG3A 5FZAA 4WZFA 5J1XA 3WF2A 3ZN4A 1NLRA 2R16A 1W0PA 3PUHA 1VR3A 1VBB3 2GNMA 3PURA 4FOQA 4AVSA 4OQ8A 3USSA 2D6NA 1W2OA 1IGOA 2QBXA 1HJFA 3MIHA 5T5LA 4P9YA 5H9QA 3WF0A 4M3CB 3WHTA 1KDMA 1LENA 1HRI1 1IHMA 3U07A 4AI2A 1W9FA 2QQKA 5J36A 4XACA 2KXLA 5FZKA 1UU6A 3O1PA 1HV0A 2EXJA 1EP0A 2C6SA 4LO6B 2WT1A 1QJU2 4XW3A 4AWDA 4CXYA 1LESA 1XRUA 1XE7A 4RA0A 4NROA 2XGXA 4EJRA 3AB0A 4OCTA 1LOBA 1W0OA 1IKPA 1ZBA3 4XC9A 5FPZA 1CD3G 1BMV1 5LBCA 1NE6A 4S2DA 3I2HA 1YCIA 4M3CA 1UKRA 3I2DA 4RL7A 1RVF2 2IFWA 2UURA 1K5MC 1RUE1 2BYVE 2PELA 2EIGA 4Q4Y2 3LZZA 5IVVA 1QXRA 2ZKNA 2ZMKA 2IZWA 4XHBA 4ZS2A 2R30A 1RHI3 4XXAA 3WDWA 5HCHA 1OA3A 3M3CA 4JX0A 3PHMA 4RGGA 4V2VA 4D7YA 1UMZA 1W6OB 4DINB 1UXXX 4QX1A 3SEPA 1DGWA 2VZQA 5ERLA 2IWGB 2D93A 5B4NA 3I2JA 2PN5A 4COZA 1QH6A 1QQP2 3MUY1 2AYHA 3NAPC 1Y3TA 1QDCA 2W1UA 3GZTB 3OPTA 1CAWA 3V0AA 3AKTA 4FPYA 1XSRA 2Y0IA 5L36A 1NLSA 2KM2A 1U5YA 2YC2A 3N7JA 1VPHA 4XIKA 2MHFA 1QY4A 2G9FA 3KMHA 4L99A 4NHLA 2WS91 1W6OA 2WZR2 5JUVA 1ACCA 4RHV3 5LK5A 5LEKA 1RINA 4GMP3 4XAEA 1GICA 1FPN1 2E7QA 5FZHA 4AVTA 1I5PA 4AFCA 2WA3A 4D6QA 3P6BA 3V0AB 1CAWB 1LOAA 3MLKA 4ISQA 1B09A 1HB1A 4LXLA 4Y1YA 3WDUA 3TN91 1EV11 3BI3A 1CWPA 1K5JA 1S0GA 5DUVA 1ULOA 1NZIA 1A6CA 2RV9A 4UBGA 3WHUA 4OI0A 4KGQA 4I01A 2OZ6A 1WCDJ 4XFIA 3VD5A 2YC4A 4R4XA 5AVPA 4AZZA 1ZREA 5IHRA 2XH6A 4BOWA 4R9CA 4AK3A 2XUEA 5AFEA 3GBGA 2D3PA 3ALQA 2A6XA 4AVVA 1JBCA 2J22A 2WJSA 3JD73 5LATA 2QQMA 2CL2A 4AQ2A 3IM0A 1JXNA 1X33A 1DQ1A 4LIUA 3DYOA 4XBQA 1EV13 4MGKE 3EO6A 4EN6B 4YW1A 4LULA 3THDA 1SEFA 4QX7A 4NAOA 2ORXA 1FPN3 4E4HA 1Y9QA 4EN0A 5GLTA 4QPIB 2W3JA 1CX4A 2WZR3 4S2FA 1COV1 5CFDB 4C0BA 3D4KA 3W21A 5CKNA 3BGAA 1C28A 5IK7A 1PZ7A 1F35A 2SBAA 2P3KA 2V09A 1DZTA 4I2OA 1UZ0A 4H14A 3VHOA 3OPWA 1OHFA 3PLQA 2R49A 2XVKA 2WAOA 1WCQA 3J7NA 2EICA 2GZWA 5JXGA 3FHIB 1WWYA 1HN1A 5LW9A 4YM0A 4QDRA 4LBMA 4ZKTB 2QVSB 1QGLA 3H1MA 4PIZA 1HRV1 2YYOA 5CIRA 1IKQA 1H8TB 1PO13 5BNNA 1O5UA 1OSGA 1W6MB 4IERA 4I0WB 2AACA 5A3UA 1ZBA2 2VCBA 4HFSA 4XBNA 4YW6A 1XNBA 2BEOA 1W8HA 2DYCA 4CDXB 1PGL2 2C5DA 1OC1A 1VB2A 2XG3A 3DYPA 4XUPA 3B01A 3TRSB 3LIHA 5HCBA 4LKEA 1H2MA 1UYXA 5C8CB 5IVYA 4ZXEA 2DBNA 1L3JA 4UAPA 3T30A 3VDAA 3SHRA 4GD4A 4KU8A 4HK8A 5BNNB 3J7LA 4LUKA 2ZZJA 4COUA 3MHZA 1L7QA 3GNEA 5D8AC 2JE8A 5LRSA 1UZWA 1CJDA 3FE5A 3ZYPA 3LKJA 3BIEA 4EN9B 4ASMB 4Q27A 1UY3A 4URAA 4NHKA 4MGQA 2YG0A 3ROUA 1LGCA 5T3NA 2Z4FA 1HRI3 2FMDA 2HEYF 1RUJ1 2BV4A 1DHKB 1WLWA 2IVIB 3GZUC 4KG0A 4PI0A 5GZFA 3WR0A 5C8CA 2Q0AA 4ARXA 3PUQA 2F4LA 3HN1A 3OF1A 4JVAA 1HXS1 3WINE 5IVEA 1YJLA 2FMYA 4JGYB 4Z92B 2QQNA 5FUNA 1CIYA 2IVJA 3I59A 5JZGB 4QU1A 4I0BA 4C1XA 2R1DA 5JXHA 4L8QA 1NA1B 4QQHA 5DDJ1 2Q8EA 2CWMA 3ZFGA 5C6CA 2P3JA 5FYIA 4GJYA 2NM1A 5IAVA 3VBSB 1BCXA 1DP0A 4A42A 3I3MA 1OLRA 4P9JA 1AL0G 1Q8QA 3T1LA 4L97A 5LCWL 3OD4A 2X10A 4YZ2A 3CLPA 5FZ6A 2EAKA 4XTMA 5J09A 1DLLA 3B02A 2VZ3A 2QUOA 3OD0A 2XPJA 2PHFA 4OUSA 4JGYA 1OFSA 4GA9A 1F4AA 2OUHA 1JUHA 2R32A 1IG3A 1FNZA 1HRI2 2R043 2VOKA 4KU7A 4Q4X2 1F5JA 4CCDA 3A7QA 2ZJCA 1AL21 5A6XA 3NV2A 4RHV1 2D40A 2W47A 4PDWA 3POEA 2NZ9A 5FFOC 1D4M1 4YGCA 5IW0A 3P5BA 4JRLA 1O4ZA 3WD5A 3MFCA 1CGPA 4B1LA 3WNNA 4E9KA 1HV1A 1MPXA 3KF5A 2Y6LA 2ZGRA 5ACA1 1W3XA 4YVSC 2E26A 3UGFA 1GP5A 2D6OX 3Q8CA 3SMHA 1FOD2 5FZ7A 1QDOA 3KQ4B 4B4PA 1NCRA 5BNPC 2JDNA 1W03A 3AL5A 3D82A 4CE8A 5T52A 1ZRDA 4MGYE 4XFHA 2EXIA 2WT0A 4LBOA 2W46A 5BNOA 5FZ3A 1KFXL 4ES8A 3HT1A 2JECA 3CL1A 3GHMA 4MGIE 1SLAA 4QAWA 3O1MA 3KV5A 3ZO0B 4AHXA 4F83A 4K8RB 2X8KA 1O3TA 3RZKA 3IKWA 4LK7A 3NW4A 4IGOA 3SEEA 4B3NA 4LEJA 2JENA 3LIGA 2ZGLA 1NCRB 4LO4B 1S0IA 4HL0A 4ET7A 1US2A 4XPVA 4G4FA 5BNPB 1BYHA 1ZM1A 3OEAA 4A45A 4FAGA 3KGLA 2MEV1 4JRAA 1O8SA 3TB0A 1NQJA 1US3A 1GSLA 1RUG2 1QOSA 4PJYA 1OUSA 2WN3A 2CSGA 1OKOA 2KA3A 3ACHA 5L7OB 3ZYBA 4BM8A 1ZZCA 4UFKA 3CJXA 1Y9GA 4PCRA 2VOTA 3N9OA 3ZYRA 5IK4A 2JG8C 4Q4V1 4LKDA 3ZYGA 3AYEA 2D3SA 1BKZA 4OMCA 5HBAA 1V0AA 2WO7A 5E1RA 4HONA 2HWD1 4QPGB 2X53S 3ZXAC 1E5IA 2AEZA 2C26A 4JKLA 4WM8C 3HR9A 4DUXA 5HXMA 4XHXA 3AMNA 2HBTA 5L7OA 3WT3A 2YBSA 1DLCA 4E8DA 3BALA 3ZXDA 4E8CA 3MEPA 2DUOA 4Y1UA 2PHDA 5JOYA 1D0HA 3AP6A 1AX0A 1WCUA 2VOWA 4LBJA 1SLBA 4CDQC 1RUD1 4Q4X3 3PVEA 4Y4RA 1WZXA 4DEVA 1PZ8A 3AZYA 4LPLA 2VMGA 3WW2A 3HOBA 4BIOA 4QB2A 2HYKA 3RS6A 5C3SA 1GNHA 1ZRRA 3ZMOA 1DZRA 2Y6HA 3KT4A 4GWNA 4UW4A 5DAXA 1BVVA 1CZSA 1ZZ9A 4FFGA 4IETA 4PIXA 1VRH2 5T55A 2R6QA 4NVPA 4Z1VA 4UXAA 5JOWA 2JD9A 4ASLA 1C3HA 3I2FA 5JR2A 2ZX4A 4IDZA 4K20A 4AHWA 4N8MA 5FZLA 4DIQA 3VD4A 4QHZA 1K5MA 5CISA 3OB8A 1QWRA 1SQ4A 3LA7A 1JYIA 1P8JA 4TSVA 1Y7BA 4LLFA 1WBFA 3AZWA 4JDOA 4H7MA 5FY0A 2QFEA 4FI9A 2XUMA 3VZNA 3BPZA 5A7QA 3SQOA 1UY0A 4XDQA 2FDIA 4GXLA 2Q1FA 3WV6A 5KHHA 4BK5A 3WCSA 2GN3A 2AC1A 5A1FA 1QHDA 5LZ6A 2O14A 5FRAA 2WSUA 2WABA 4LA2A 1OD3A 3IAPA 4C1WA 1K5MB 2RVAA 1TNRA 1QJEA 3LDKA 2RS32 4O65A 1UY1A 1KS5A 2ZEYA 3TN92 2WRAA 2HLEA 2ZHLA 4JHTA 2RS12 3WP4A 4H2AA 3J8F3 1COV3 1POQA 1CONA 1IPKA 1RITA 4AI8A 4BCUA 3F95A 2YGMA 4BU2A 4YARA 1N3PA 1PX4A 3C7HA 3VHRA 1UAIA 1IS5A 3LEGA 1YC61 3VKMA 4DMIA 1RUOA 3O7OA 5C8WA 1YI9A 1S0DA 1IZ3A 3OBRA 1RMU3 1YXWA 3N4MA 3BIWE 3ZOIA 5LY1A 1DGRN 3RZZA 1SLIA 3K77A 1UCXA 1WD4A 2RMU1 1F9KA 2QDRA 1TG7A 1QJX1 4Y33A 5FXZA 4A41A 4D69A 1S0BA 3WW4A 2W1WA 4AAXA 2X29A 3WNKA 2D6MA 3Q8BA 5FWJA 5E8AA 4QPWA 3W5MA 2RDQA 1BMV2 3M3EA 4IE5A 2VZTA 3H3ZA 5FYTA 4WV8A 3TN93 4AYUA 4E4ZA 1PO11 4YZ5A 4A6SA 2DF7A 1RUG3 3B93A 5EJ3A 1F15A 2JG9B 2OQ6A 3RJ2X 1VRH1 2WINB 5E89A 1ZX5A 4Y1VA 1VMFA 4QQLA 1OXCA 2DCZA 3UJOA 2UY9A 2HWC2 1NX9A 2IXHA 1CAVA 2W52A 3IZOA 5FZOA 1UL9A 3ABZA 3WCRA 2RG4A 4CXXA 3ZYIB 3ZIWA 4LJHA 2YMZA 2X5IC 1XNTA 5DG2A 2Y6JA 3SISA 4LTAA 2H6CA 2B5HA 4UT5A 4YGDA 2EAAA 4CPBD 4KGGA 1K42A 3WDTA 2EIBA 2W92A 3AX4A 1JZ8A 5LBEA 4QKNA 3WP3A 2EF6A 3UKVA 2BGOA 4JCKA 3CJIA 2PHWA 5KXCA 5FMBA 3MI8A 1AF9A 2TNFA 5DAQA 5DN2A 1PGSA 4CDWC 3GCXA 5FZEA 2FDJA 1Q43A 2Y0OA 3E97A 2OYZA 1ZRIA 1YQ2A 3WP6A 1H0BA 1S0JA 2DCTA 5JWPA 1GU3A 4E4SA 1NUKA 3A0NA 3KB5A 2SLIA 2HKXA 1D0GA 1UOBA 2GALA 1N3QA 4UFIA 3R6SA 4C90A 3DL3A 5FYBA 4NAMA 2LTNA 1UXZA 1PMJX 3CJIB 5D2AA 2ZX3A 3E5XA 3NQHA 2XONA 4EN7B 5A3MA 1OLQA 1XYPA 3MICA 3SLIA 4PT6A 1IOAA 1V6MA 1JHJA 1LHOA 4LHSA 4RR3B 1I3HA 4YW4A 1ND2A 2RE9A 3VLBB 5FR3A 2PLV3 3S6PA 3KLSA 4CEYB 2P6CA 3ZXGA 3BU7A 3CZJA 2DCYA 2XL7A 1AXZA 3CKHA 3MW2A 4JGZA 1CR7A 1H30A 3OJBA 2JG8A 2MEV3 4BE3A 3TNPB 1R081 2PAKA 2A5ZA 1QJX3 1PIV1 1RUC3 2Y8KA 2OIIA 3KT7A 5DQ0A 4AI9A 4K9SA 1MS4A 1S4CA 2E31A 2J7MA 3EXUA 3MYXA 1LOGA 1MS0A 3IIIA 5BY5A 4KWJA 3BU0A 1W3VA 1SFPA 1TME1 4Y24A 3RMYA 5H9RA 2VNGA 1JZ7A 4Y26A 3MF6A 5C4WC 4NPLA 4MHUA 2CGOA 2KD7A 3RYRA 2O8OA 1COV2
chains in the Genus database with same CATH topology
3WF0A 2WO1A 2J1VA 1UWWA 2QQKA 3UNPA 3IAQA 3ACIA 5CYYA 2VC9A 2ZEWA 1CX1A 1GOFA 4YPJA 4ZZ8A 1KEXA 4Z2AA 4OZOA 1SG3A 2DCJA 3I2HA 3AC0A 3HNYM 4M4PA 3J7HA 4DEQA 3CIHA 4JX0A 1UXXX 2L9LA 5HPOA 4QX1A 3SEPA 2VZQA 1JI6A 2E32A 5B4NA 3I2JA 2VQTA 2WDBA 3MUY1 3K46A 2W1UA 2OKXA 2DDUA 2YC2A 3HNBM 1O8PA 2CDOA 2VCAA 4XZUG 5EJZB 4L0PA 2DCKA 5JUVA 1JZ6A 2W5FA 1KGYA 2XOMA 1I5PA 2VO5A 3C7OA 4RYDA 4XUQA 3P6BA 5EIYB 1OF3A 1GQPA 2ZEZA 3T0DA 2V4VA 3WF4A 1ULOA 2RV9A 5JMOA 3NJXA 4CUBA 2VZ1A 3VD5A 2YC4A 5IHRA 5B4XA 4KMQA 1PMHX 2J22A 1W0NA 2YB7A 5LA0A 1GOHA 3ZM8A 2QQMA 1K3IA 3DYOA 2W94A 2W91A 4XUNA 2JDAA 2QQLA 1LNSA 3THDA 1OH4A 3I3EA 2ORXA 3P1IA 1XNAA 4DUWA 4P02B 1GOGA 2VR4A 4CUAA 2W3JA 3HJRA 2WQ8A 1H6XA 3JXSA 2ID4A 2B4KA 3U37A 5DPNA 2C4XA 1SDDB 3BGAA 4MADA 1UZ0A 3WF1A 1L7RA 4M4RA 2WAOA 1WCQA 3ACGA 3T09A 2EICA 4KI5M 3EYPA 5JXGA 1HN1A 4QDRA 3PUIA 1GUIA 1H6YA 1GMMA 4ARYA 3E1F1 2VCBA 2VZOA 3ACFA 3LQCA 1JYXA 4CU8A 4UI9L 1JU4A 4CU7A 2VCCA 3DYPA 1UMHA 4XUPA 3WEZA 1W99A 4QDQA 2CDPA 1UYXA 4ZXEA 4DUVA 4UAPA 5G05L 1W8NA 2Y64A 3WQBA 3VDAA 4OYUA 4XURA 2VJXA 5IFTA 1L7QA 1XPWA 2JE8A 1UX7A 3A21A 3SKJE 4OUEA 2J1SA 5IFPA 1UY3A 1JZ5A 4MGQA 2BBAA 4QX2A 2YG0A 1UYYA 2Z4FA 3LEKA 4LQRA 5I0DA 3I3BA 4ARXA 2QQOA 3I97A 4XUOA 2QQNA 1CIYA 4UOJA 2ZXQA 3IB3A 3MO4A 3W5NA 3WSOA 5JXHA 1SHWB 2J1AA 3C7GA 4JKMA 2BZDA 1XC6A 1JYVA 2WO2A 1DP0A 2HYXA 4A42A 1R64A 5LCWL 2X10A 3WNPA 3K4DA 2J1UA 2VZ3A 1NAEA 5FUIA 1F4AA 4DXTA 3LEIA 1UYZA 3CMGA 5CZKA 3A7QA 2W47A 1CZTA 1W9TA 2WN2A 3ETPA 3WNNA 4D0QA 2W95A 1MPXA 2Y6LA 3T0AA 2E26A 2EIEA 3LE0A 4XVHA 5C70A 2J1EA 3BN6A 4TTGA 1ULPA 4QB6A 4MO3M 3HNMA 1EUTA 2W46A 4CUCA 5LA1A 3CZUA 4QAWA 2VMCA 3I2GA 2C9KA 2BGPA 1F4HA 2Y6KA 3OG2A 3SEEA 4JHZA 1PX3A 2WBKA 4ET7A 1US2A 1UMIA 1JZ3A 3OEAA 4A45A 4DXRA 1O8SA 2WZEA 3DYMA 1US3A 3VDBA 3VD3A 2VMDA 4ZY9A 2WN3A 3T2OA 3ACHA 2VZPA 4BXSV 2VOTA 3I2IA 2X09A 3A23A 1D7PM 3OGSA 5JXIA 4OMCA 3D3AA 4OMDA 3T2PA 4P08A 2VTFA 4A3ZA 3ECQA 4JKLA 3K75B 2C26A 3A22A 2W1QA 1JZ2A 4DUXA 2WYSA 4DXSA 1UY4A 5HXMA 1EUUA 1OF4A 1DLCA 4E8DA 4E8CA 4JKKA 1JYNA 3LPGA 4DEVA 4GWJA 4LPLA 4RN5A 3HOBA 4QB2A 2W1SA 2VQUA 2J1RA 2Y6HA 2QQJA 2JKXA 3C7EA 1CZSA 1W8OA 4CVUA 2JD9A 3I2FA 5JR2A 1IQDC 5LA2A 1RYYA 2YFZA 5A1AA 3CQOA 4TXWA 5DMYA 3VD4A 3OBAA 2PQSA 3OB8A 1K12A 2WUHA 1NKGA 1W9WA 2WO3A 4W50A 1P8JA 4MGSA 1K45A 2YFUA 1W9SA 4FI9A 4QB1A 3NJVA 1UY0A 3T0BA 2LS6A 4W4ZA 4GZ9A 3CDZB 2WABA 3SKVA 3WF3A 1OD3A 3IAPA 2RVAA 3T08A 1J84A 3K4ZA 1UY1A 2RJ2A 2ZEYA 3FL7A 2HLEA 2VZVA 2V5DA 4XUTA 2X05A 3FHQA 1GNYA 3WNLA 2VMEA 3FHAA 1JYWA 2WZ8A 3C8XA 1PX4A 4A4AA 3C7HA 3F2ZA 3LEGA 3LPFA 3DECA 4P00B 3WNMA 4A44A 3HEIA 4A6OA 2V72A 3MBWA 3K77A 4MOAA 3UETA 3GGLA 1TG7A 4A41A 4KWUA 2W1WA 4AAXA 2VMFA 3WNKA 2VZUA 4QDSA 4QPWA 3THCA 3W5MA 2VZRA 2R7EB 2VZTA 3MV11 3EB7A 3HN3A 2J1TA 2QQIA 3K4AA 5IJRA 4PF1A 4CU6A 3C7FA 2LW8A 4W8JA 1NX9A 3ABZA 2ORZA 5G04L 4CU9A 1BHGA 4P5YA 1JZ4A 1XNTA 5C7GA 2Y6JA 2VL4A 3HPNA 1T2XA 2XQXA 4BJ0A 1K42A 2XHNA 1TVGA 2EIBA 4IUGA 2W92A 1JZ8A 3VD9A 3FN9A 2W87A 2BGOA 3VDCA 3OGRA 3NNGA 4AG4A 2VM9A 4D8MA 3GXUA 3I3DA 3OEBA 3MUZ1 2BERA 5DN2A 4QX0A 1UY2A 4LKSA 4BK5A 1CZVA 1YQ2A 2W9XA 3GM8A 1GU3A 5JXJA 1NUKA 3MV01 1OT5A 1UXZA 1PMJX 4BK4A 3NQHA 2XONA 1DYOA 3OGVA 4PT6A 1O59A 1JHJA 5IYYA 4ZZ5A 4LHSA 3IDAA 2WAAA 3NRUA 1WKYA 1J83A 3I2KA 5F7UA 3CZJA 3CKHA 2EIDA 4QX3A 4GWIA 2B9VA 3VD7A 3WNOA 5EJ1B 2Y6GA 2Y8KA 4HG6B 2ZEXA 5DQ0A 1JU3A 3GDBA 2VZSA 2E33A 2E31A 2J7MA 3IIIA 4PQQA 5C71A 4BDVB 1JZ7A 5J1XA 3WF2A 3PUHA 2KD7A 2QBXA 3UESA 3T2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WF0 A;  2WO1 A;  2J1V A;  1UWW A;  2QQK A;  3UNP A;  3IAQ A;  3ACI A;  5CYY A;  2VC9 A;  2ZEW A;  1CX1 A;  1GOF A;  4YPJ A;  4ZZ8 A;  1KEX A;  4Z2A A;  4OZO A;  1SG3 A;  2DCJ A;  3I2H A;  3AC0 A;  3HNY M;  4M4P A;  3J7H A;  4DEQ A;  3CIH A;  4JX0 A;  1UXX X;  2L9L A;  5HPO A;  4QX1 A;  3SEP A;  2VZQ A;  1JI6 A;  2E32 A;  5B4N A;  3I2J A;  2VQT A;  2WDB A;  3MUY 1;  3K46 A;  2W1U A;  2OKX A;  2DDU A;  2YC2 A;  3HNB M;  1O8P A;  2CDO A;  2VCA A;  4XZU G;  5EJZ B;  4L0P A;  2DCK A;  5JUV A;  1JZ6 A;  2W5F A;  1KGY A;  2XOM A;  1I5P A;  2VO5 A;  3C7O A;  4RYD A;  4XUQ A;  3P6B A;  5EIY B;  1OF3 A;  1GQP A;  2ZEZ A;  3T0D A;  2V4V A;  3WF4 A;  1ULO A;  2RV9 A;  5JMO A;  3NJX A;  4CUB A;  2VZ1 A;  3VD5 A;  2YC4 A;  5IHR A;  5B4X A;  4KMQ A;  1PMH X;  2J22 A;  1W0N A;  2YB7 A;  5LA0 A;  1GOH A;  3ZM8 A;  2QQM A;  1K3I A;  3DYO A;  2W94 A;  2W91 A;  4XUN A;  2JDA A;  2QQL A;  1LNS A;  3THD A;  1OH4 A;  3I3E A;  2ORX A;  3P1I A;  1XNA A;  4DUW A;  4P02 B;  1GOG A;  2VR4 A;  4CUA A;  2W3J A;  3HJR A;  2WQ8 A;  1H6X A;  3JXS A;  2ID4 A;  2B4K A;  3U37 A;  5DPN A;  2C4X A;  1SDD B;  3BGA A;  4MAD A;  1UZ0 A;  3WF1 A;  1L7R A;  4M4R A;  2WAO A;  1WCQ A;  3ACG A;  3T09 A;  2EIC A;  4KI5 M;  3EYP A;  5JXG A;  1HN1 A;  4QDR A;  3PUI A;  1GUI A;  1H6Y A;  1GMM A;  4ARY A;  3E1F 1;  2VCB A;  2VZO A;  3ACF A;  3LQC A;  1JYX A;  4CU8 A;  4UI9 L;  1JU4 A;  4CU7 A;  2VCC A;  3DYP A;  1UMH A;  4XUP A;  3WEZ A;  1W99 A;  4QDQ A;  2CDP A;  1UYX A;  4ZXE A;  4DUV A;  4UAP A;  5G05 L;  1W8N A;  2Y64 A;  3WQB A;  3VDA A;  4OYU A;  4XUR A;  2VJX A;  5IFT A;  1L7Q A;  1XPW A;  2JE8 A;  1UX7 A;  3A21 A;  3SKJ E;  4OUE A;  2J1S A;  5IFP A;  1UY3 A;  1JZ5 A;  4MGQ A;  2BBA A;  4QX2 A;  2YG0 A;  1UYY A;  2Z4F A;  3LEK A;  4LQR A;  5I0D A;  3I3B A;  4ARX A;  2QQO A;  3I97 A;  4XUO A;  2QQN A;  1CIY A;  4UOJ A;  2ZXQ A;  3IB3 A;  3MO4 A;  3W5N A;  3WSO A;  5JXH A;  1SHW B;  2J1A A;  3C7G A;  4JKM A;  2BZD A;  1XC6 A;  1JYV A;  2WO2 A;  1DP0 A;  2HYX A;  4A42 A;  1R64 A;  5LCW L;  2X10 A;  3WNP A;  3K4D A;  2J1U A;  2VZ3 A;  1NAE A;  5FUI A;  1F4A A;  4DXT A;  3LEI A;  1UYZ A;  3CMG A;  5CZK A;  3A7Q A;  2W47 A;  1CZT A;  1W9T A;  2WN2 A;  3ETP A;  3WNN A;  4D0Q A;  2W95 A;  1MPX A;  2Y6L A;  3T0A A;  2E26 A;  2EIE A;  3LE0 A;  4XVH A;  5C70 A;  2J1E A;  3BN6 A;  4TTG A;  1ULP A;  4QB6 A;  4MO3 M;  3HNM A;  1EUT A;  2W46 A;  4CUC A;  5LA1 A;  3CZU A;  4QAW A;  2VMC A;  3I2G A;  2C9K A;  2BGP A;  1F4H A;  2Y6K A;  3OG2 A;  3SEE A;  4JHZ A;  1PX3 A;  2WBK A;  4ET7 A;  1US2 A;  1UMI A;  1JZ3 A;  3OEA A;  4A45 A;  4DXR A;  1O8S A;  2WZE A;  3DYM A;  1US3 A;  3VDB A;  3VD3 A;  2VMD A;  4ZY9 A;  2WN3 A;  3T2O A;  3ACH A;  2VZP A;  4BXS V;  2VOT A;  3I2I A;  2X09 A;  3A23 A;  1D7P M;  3OGS A;  5JXI A;  4OMC A;  3D3A A;  4OMD A;  3T2P A;  4P08 A;  2VTF A;  4A3Z A;  3ECQ A;  4JKL A;  3K75 B;  2C26 A;  3A22 A;  2W1Q A;  1JZ2 A;  4DUX A;  2WYS A;  4DXS A;  1UY4 A;  5HXM A;  1EUU A;  1OF4 A;  1DLC A;  4E8D A;  4E8C A;  4JKK A;  1JYN A;  3LPG A;  4DEV A;  4GWJ A;  4LPL A;  4RN5 A;  3HOB A;  4QB2 A;  2W1S A;  2VQU A;  2J1R A;  2Y6H A;  2QQJ A;  2JKX A;  3C7E A;  1CZS A;  1W8O A;  4CVU A;  2JD9 A;  3I2F A;  5JR2 A;  1IQD C;  5LA2 A;  1RYY A;  2YFZ A;  5A1A A;  3CQO A;  4TXW A;  5DMY A;  3VD4 A;  3OBA A;  2PQS A;  3OB8 A;  1K12 A;  2WUH A;  1NKG A;  1W9W A;  2WO3 A;  4W50 A;  1P8J A;  4MGS A;  1K45 A;  2YFU A;  1W9S A;  4FI9 A;  4QB1 A;  3NJV A;  1UY0 A;  3T0B A;  2LS6 A;  4W4Z A;  4GZ9 A;  3CDZ B;  2WAB A;  3SKV A;  3WF3 A;  1OD3 A;  3IAP A;  2RVA A;  3T08 A;  1J84 A;  3K4Z A;  1UY1 A;  2RJ2 A;  2ZEY A;  3FL7 A;  2HLE A;  2VZV A;  2V5D A;  4XUT A;  2X05 A;  3FHQ A;  1GNY A;  3WNL A;  2VME A;  3FHA A;  1JYW A;  2WZ8 A;  3C8X A;  1PX4 A;  4A4A A;  3C7H A;  3F2Z A;  3LEG A;  3LPF A;  3DEC A;  4P00 B;  3WNM A;  4A44 A;  3HEI A;  4A6O A;  2V72 A;  3MBW A;  3K77 A;  4MOA A;  3UET A;  3GGL A;  1TG7 A;  4A41 A;  4KWU A;  2W1W A;  4AAX A;  2VMF A;  3WNK A;  2VZU A;  4QDS A;  4QPW A;  3THC A;  3W5M A;  2VZR A;  2R7E B;  2VZT A;  3MV1 1;  3EB7 A;  3HN3 A;  2J1T A;  2QQI A;  3K4A A;  5IJR A;  4PF1 A;  4CU6 A;  3C7F A;  2LW8 A;  4W8J A;  1NX9 A;  3ABZ A;  2ORZ A;  5G04 L;  4CU9 A;  1BHG A;  4P5Y A;  1JZ4 A;  1XNT A;  5C7G A;  2Y6J A;  2VL4 A;  3HPN A;  1T2X A;  2XQX A;  4BJ0 A;  1K42 A;  2XHN A;  1TVG A;  2EIB A;  4IUG A;  2W92 A;  1JZ8 A;  3VD9 A;  3FN9 A;  2W87 A;  2BGO A;  3VDC A;  3OGR A;  3NNG A;  4AG4 A;  2VM9 A;  4D8M A;  3GXU A;  3I3D A;  3OEB A;  3MUZ 1;  2BER A;  5DN2 A;  4QX0 A;  1UY2 A;  4LKS A;  4BK5 A;  1CZV A;  1YQ2 A;  2W9X A;  3GM8 A;  1GU3 A;  5JXJ A;  1NUK A;  3MV0 1;  1OT5 A;  1UXZ A;  1PMJ X;  4BK4 A;  3NQH A;  2XON A;  1DYO A;  3OGV A;  4PT6 A;  1O59 A;  1JHJ A;  5IYY A;  4ZZ5 A;  4LHS A;  3IDA A;  2WAA A;  3NRU A;  1WKY A;  1J83 A;  3I2K A;  5F7U A;  3CZJ A;  3CKH A;  2EID A;  4QX3 A;  4GWI A;  2B9V A;  3VD7 A;  3WNO A;  5EJ1 B;  2Y6G A;  2Y8K A;  4HG6 B;  2ZEX A;  5DQ0 A;  1JU3 A;  3GDB A;  2VZS A;  2E33 A;  2E31 A;  2J7M A;  3III A;  4PQQ A;  5C71 A;  4BDV B;  1JZ7 A;  5J1X A;  3WF2 A;  3PUH A;  2KD7 A;  2QBX A;  3UES A;  3T2Q A; 
#chains in the Genus database with same CATH topology
 1ND3 A;  1XNK A;  3NO8 A;  1C57 A;  3KGZ A;  4V2W A;  1FNY A;  1RUD 2;  3GJA A;  1UWW A;  1MZ5 A;  3ZFG C;  1FT9 A;  5FYV A;  3H50 A;  5CYY A;  3T2P A;  4HKW A;  4CYD A;  4MUV A;  1ZZB A;  1YFX A;  1ZVF A;  2GH2 A;  1RUH 2;  4ZZ8 A;  4YVW C;  1GZ9 A;  1W06 A;  4Z2A A;  2FDG A;  3AKR A;  5IAX A;  1ND3 B;  3N7L A;  1SG3 A;  5JPM B;  4YVW A;  2PYT A;  1AL2 3;  3AC0 A;  4PBP A;  1WBL A;  1D4V B;  2IFR A;  2PLV 2;  4EWA A;  2VUD A;  5F3I A;  5FXW A;  3URF A;  1OKQ A;  5GAL A;  1MS3 A;  4MXV A;  1DCS A;  4LE3 A;  3VBS C;  4RGK A;  4A3X A;  3DF0 A;  1EPW A;  2HH9 A;  4DEQ A;  1R1Z A;  2HWB 3;  1KDK A;  1VBC 1;  1VLN A;  1VBA 2;  1NG0 A;  2GMP A;  2ZKL A;  3MPP G;  5F5C A;  4AI3 A;  5HPO A;  1WW5 A;  4QHO A;  4F8A A;  1X9T A;  1JI6 A;  5AFB A;  3MLL A;  4XZP A;  3K3O A;  4HVO A;  4YVW B;  2WA4 A;  2VQT A;  2WDB A;  1OVS A;  4R9B A;  1YFY A;  5DG1 A;  3A4U A;  5CFC B;  5CBL A;  1WMX A;  3N9P A;  4BQ3 A;  4IEW A;  4CZS A;  2OKX A;  3JBG 3;  4IEP A;  3O14 A;  1AYM 1;  3D0S A;  3HNB M;  5F39 A;  3OGG A;  4D3W A;  5BNO C;  1H2K A;  1PM7 A;  5GLV A;  4XZU G;  5BNQ A;  4L0P A;  1R09 1;  1VB4 A;  1MZF A;  1LOE A;  2E6V A;  2RHP A;  4LO8 A;  2GNB A;  4AVA A;  2GC3 A;  3OOX A;  2W5F A;  3D5O A;  4PF5 A;  4YM1 A;  1WMF A;  3LB9 A;  3NVC A;  2R0F A;  4ISR A;  5A33 B;  1PIV 3;  5EIY B;  1XE8 A;  4H7L A;  3AP4 A;  1AX2 A;  2DUR A;  2E9Q A;  2JEM A;  3M2M A;  3VBO C;  2DTY A;  3VZM A;  2CNA A;  4DPN A;  5C33 A;  3T0D A;  1EAH 3;  2V4V A;  1C8M 3;  3ZIX A;  2LRO A;  1QXJ A;  3NJX A;  2W2I A;  3POY A;  1Q56 A;  4FFF A;  4N53 C;  1YI7 A;  2AH2 A;  1GWM A;  2CHH A;  4D94 A;  1PM4 A;  1BLZ A;  1RUE 2;  2C24 A;  3AZV A;  1HKD A;  2E7A A;  4Q4Y 1;  3RI8 A;  1UZV A;  4NO4 A;  1PMH X;  2RM2 2;  2Y38 A;  4QPI A;  4CCJ A;  3ETQ A;  4D7T A;  2YU2 A;  3RSJ A;  4AR2 A;  4Q4W 1;  1AR6 2;  4NIA A;  4XDP A;  2LUW A;  2RR1 1;  2HWC 3;  3DCQ A;  3TNQ A;  3VBO B;  4ATE A;  2P6H A;  4QPY A;  3M3I A;  4CEY C;  5HCF A;  2ZCW A;  3GF6 A;  3VBU C;  1RUC 2;  5ACA 2;  1OH4 A;  5K0U C;  5K8S A;  1O91 A;  1SFY A;  3P1I A;  1XNA A;  5FP4 A;  2GAU A;  2RDN A;  1W9Y A;  2Q5T A;  4P02 B;  4XJA A;  4K7J A;  3BKZ A;  3V64 A;  4S2G A;  5KHI A;  3LF7 A;  3NMB A;  3CEW A;  3UT0 A;  4AI0 A;  1N1S A;  1H6X A;  2PHT A;  4HK9 A;  2A6W A;  1H8T A;  3JXS A;  3UKT A;  4AGR A;  3U37 A;  4GAL A;  2C4X A;  5F5Q A;  1OBN A;  4S2H A;  4D6S A;  4DQA A;  4CPB A;  4CCO A;  1YO8 A;  3IMN A;  4MAD A;  4CDX A;  4Y5S A;  4LUM A;  2TUN A;  1LKN A;  3R05 A;  1DIW A;  1Q8P A;  2UY8 A;  2BOI A;  1VBA 3;  3T09 A;  3WQ7 A;  4HKL A;  1D4M 3;  4XJZ A;  3UGH A;  2A6Y A;  2QQV A;  1H6Y A;  3WOG A;  3E5Q A;  1YQ6 A;  3RMX A;  2FD8 A;  4OUM A;  4XJW A;  3E1F 1;  3VBR C;  4O61 A;  3S57 A;  3BTY A;  5EHD A;  1RUG 1;  2VZO A;  3POB A;  2RS1 1;  4CP2 A;  1B35 C;  1UNB A;  2BPA 2;  1JU4 A;  2VXJ A;  1URX A;  1YUD A;  1J1T A;  5BPX A;  2WYF A;  4CU7 A;  1AR6 3;  2VCC A;  4HZF A;  1O5L A;  1UMH A;  4LIT A;  4YFW A;  2OQ7 A;  5D1I A;  3HQR A;  3WEZ A;  3M70 A;  1HB2 A;  2BDR A;  3O0X A;  4XEZ A;  4AED B;  2CDP A;  4C0H A;  3H3U A;  5L73 A;  2FZ1 A;  4E2Q A;  1W6Q B;  3DXT A;  3WQB A;  3B9C A;  4OYU A;  4XUR A;  2VJX A;  4W65 A;  1JUI A;  3I59 B;  5D8A A;  4MHR A;  3B5L B;  2OUJ A;  4DY3 A;  5IFT A;  5JZG A;  1S1A A;  2PXJ A;  5T5J A;  1NA1 A;  2UU8 A;  1O6U A;  2EXH A;  2UYB A;  5EZW A;  5IWF A;  5IFP A;  4N43 B;  3MZH A;  3IMM A;  1I5Z A;  2YDE A;  1MS1 A;  3L2Y A;  4XF9 A;  5EXO A;  4BYY A;  1JZ5 A;  3S0M A;  1UOG A;  4GIQ A;  3LEK A;  5GZG A;  3O1U A;  1DGW X;  4ZHN A;  5JSP A;  4LQR A;  5C8C C;  1XND A;  2VUC A;  4K6B A;  4AED A;  2V4A A;  2JDK A;  2VW2 A;  1NLQ A;  5FYS A;  1O3R A;  5F8P A;  2BUK A;  3I97 A;  5FP8 A;  4L92 A;  4Z2W A;  4XUO A;  2JE9 A;  4MXW A;  5FRE A;  5D8A B;  4Y20 A;  5FP7 A;  3O1V A;  2NPI A;  2A73 B;  3MO4 A;  4NHX A;  2RJL A;  1PK6 B;  1PVC 3;  2XBO 3;  4LO5 B;  3W5N A;  4Y5T A;  5JI9 A;  2VG9 A;  1VAK A;  1D4M 2;  2D5F A;  4JKM A;  4XFA A;  3SC7 X;  2ZHK A;  1GQG A;  4O9G A;  3IDE A;  3M7A A;  4P9L A;  1JYV A;  4PDW B;  5EYX A;  2TBV A;  2NYY A;  5K4L A;  3RG0 A;  1R64 A;  1ENR A;  5EQU A;  2P4E A;  4TWT A;  4YRD A;  2BWA A;  4PI2 A;  3K4D A;  4QQP A;  2J1U A;  4AAP A;  2OA2 A;  2WL1 A;  4W6X A;  4HSJ A;  3AZZ A;  4MXW B;  4FPL A;  2XWJ B;  3W20 A;  3O1S A;  4AHZ A;  3GZE A;  3LEI A;  1AYN 3;  4CCL A;  3O12 A;  1RUI 2;  2FCT A;  2VE1 A;  4RGA A;  3O1T A;  1RUN A;  1UW8 A;  5A7O A;  5L9V A;  5IVF A;  1RGS A;  3RRD A;  4AVB A;  2Y6F A;  1G9C A;  3ATG A;  3H8U A;  4D0Q A;  2W95 A;  1EPZ A;  3N7K A;  4K8F A;  1AR8 2;  3CHX A;  3MPB A;  4QT6 A;  3BN6 A;  4TTG A;  2LAL A;  1NCR C;  5GZE A;  4WM7 C;  5BNP A;  1EUT A;  4LMF A;  2W39 A;  4ZU5 A;  5A3O A;  2DWR A;  4O7X A;  4AGG A;  5FP3 A;  4QGN A;  1RHI 2;  5LA1 A;  1GAN A;  2PQQ A;  3CZU A;  5F3G A;  2GND A;  2D6K A;  4EWD A;  4IEZ A;  1PVX A;  1GWL A;  1ASJ 1;  3LWC A;  4U2A A;  5JMC A;  4E27 A;  2FBE A;  2Q1Z B;  5C3Q A;  3OG2 A;  1HJG A;  2DFB A;  2ARB A;  4JHZ A;  3VDD C;  3WUC A;  3AVS A;  4IEV A;  4V1P A;  2WBK A;  1PIV 2;  4XJU A;  3AL6 A;  4YW7 A;  4Q4V 3;  3FMG A;  3ST7 A;  5JDB A;  1AJK A;  4W6Y A;  1OA4 A;  3DYM A;  3I8T A;  4CA9 A;  1RED A;  5ABJ C;  1C4R A;  3ZXL A;  4X6Q B;  3TOJ A;  4XF3 A;  3T2O A;  2ZOE B;  1LOF C;  2YUE A;  3N7M A;  4ONU A;  4NIH A;  3GCW A;  3HIF A;  4QWN A;  3JCI A;  4BXS V;  3I2I A;  4BQW A;  2ZML A;  5GLU A;  1D7P M;  1N47 A;  1ZA7 A;  3FBY A;  4LR4 A;  1FMD 3;  2NP0 A;  4XET A;  3MGU A;  1SMV A;  1D2S A;  3R4S A;  3I4I A;  2OS2 A;  3D3A A;  2VBP A;  5FJH A;  1RJ8 A;  3ILF A;  3LD8 A;  4P08 A;  3WNX A;  2ZBJ A;  3AYC A;  4AEJ A;  5JR7 B;  4N53 B;  1JZ2 A;  3OY8 B;  1W05 A;  3M1H A;  3FBM A;  3BVC A;  5K0U A;  4I3P A;  2QDN A;  3S5Q A;  4PHZ A;  5FY5 A;  3POI A;  4AF9 A;  1OF4 A;  2EAL A;  4BH9 A;  4GJZ A;  4BLJ A;  1RXG A;  3VV1 A;  4JKK A;  1BJQ A;  2A75 A;  5A7W A;  4CDQ A;  2GME A;  1QJY 1;  3TWI A;  3UKN A;  1QNY A;  4OHW A;  5KHK A;  4QPG C;  4CEW A;  1SBD A;  1XU1 A;  1AXY A;  4LHN A;  5HCA A;  4UW5 A;  5J98 B;  2GC0 A;  2GNT A;  3FWE A;  2VQU A;  1YEW A;  5JIA A;  2QQJ A;  5K0U B;  3C7E A;  4YSF A;  1W6N A;  1HQL A;  3KHB A;  1RUH 1;  4CP9 A;  4COW A;  3H8R A;  4CCN A;  4NID A;  1AR9 1;  1XYO A;  4YM2 A;  5LA2 A;  5A7W B;  4CDQ B;  2HWF 3;  1DDL A;  1SZB A;  3OBA A;  2PQS A;  5FBJ A;  5BNN C;  4Q4Y 3;  5FO9 B;  2XDV A;  2YPD A;  3AM2 A;  4I3G A;  2RR1 2;  4CEW B;  5CB7 A;  3ZKY A;  2QKD A;  4Q2F A;  3T1M A;  2YFU A;  4UFL A;  4H3W A;  3KHC A;  3TYJ A;  4QB1 A;  3NJV A;  3IPV B;  4EWE A;  1Z7S 2;  1ZYB A;  5LBB A;  5L19 A;  2XJP A;  1ASJ 3;  1T6G C;  1OQD A;  1W6N B;  2HWE 2;  3ILN A;  2VUJ A;  1AJO A;  1VBD 2;  1S2K A;  3LA3 A;  1OPM A;  2CYF A;  2YRO A;  1XYN A;  2IXJ A;  1QJX 2;  1UOJ A;  1X36 A;  1SBF A;  3SKV A;  2PAM A;  3T08 A;  3K4Z A;  3D0J A;  1EYB A;  4MYE A;  1HB3 A;  2NMN A;  2VY0 A;  1R09 3;  1BEV 3;  2VZV A;  2PHL A;  3AKP A;  1B35 B;  1VJ2 A;  3OTF A;  1C8M 2;  4GMP 1;  4DRV A;  1GNY A;  3BTA A;  3NKT A;  3H8X A;  1DQ4 A;  3KCX A;  1JYW A;  4BXF A;  4ATF A;  5AC9 1;  4IEQ A;  5FYM A;  1MVQ A;  4A4A A;  5K9Y A;  1H9W A;  4RSU A;  3DEC A;  1RUF 2;  3E5U A;  4CUG A;  1H1I A;  5FPB A;  5J48 A;  2QQU A;  1LOC A;  5KXE A;  3HEI A;  4A6O A;  2JG9 A;  3MF9 A;  5LBF A;  2VOX A;  4MOA A;  2ZGS A;  3UET A;  5FYY A;  3VUO A;  1Z0H A;  2ZX0 A;  4JV4 A;  1CAV B;  2K9Z A;  3JUU A;  1TE1 B;  4FCA A;  1LCL A;  2P2K A;  3PU8 A;  2I07 B;  4NRP A;  4D7S A;  3RYP A;  2HBU A;  2ZGN A;  1YIF A;  3CF6 E;  1QQP 3;  2ETE A;  3BPS A;  1LU1 A;  1RUH 3;  4MV2 A;  4XDO A;  3VZO A;  4BIF A;  1QOO A;  3HN3 A;  1Q8S A;  2ZX1 A;  4GAZ A;  5HXV A;  1HLC A;  1U12 A;  4YVS B;  2VTX A;  1KJR A;  2QQI A;  4IGP A;  1SPP B;  3WG2 A;  3AMP A;  4PF1 A;  1POV 1;  1I1E A;  4XAA A;  2B39 A;  5L9B A;  4CU6 A;  1M06 G;  3Q8E A;  3RI9 A;  4W8J A;  1OLM E;  1WLC A;  1RUF 3;  1V00 A;  4WVV A;  4OHX A;  3N9N A;  3WDY A;  5DAV A;  3Q9O A;  3A0K A;  1YLL A;  3KV6 A;  4CEY A;  2VEC A;  3HPN A;  4XJ9 A;  1XQN A;  4RFR B;  5JPN B;  3HT2 A;  1JMU B;  2BRT A;  2GP5 A;  2R06 2;  4K21 A;  4B29 A;  2P3Y A;  4QQ2 A;  5KHG A;  1E5S A;  5L9R A;  4MSV A;  1YFW A;  4A7Z A;  4YVS A;  4Q4W 2;  1SPP A;  1FAT A;  3FUO A;  4OQ9 A;  4C91 A;  5KBF A;  5FXV A;  3VDC A;  3OUJ A;  1H8T C;  3NNG A;  2WR9 A;  4GMP 0;  3GXU A;  5JOX A;  1D2Q A;  2X5I B;  1QJU 1;  4QX0 A;  1V9U 1;  1OUR A;  1UY2 A;  2E53 A;  2VNR A;  3ASI A;  3BYW A;  2XJR A;  4LKS A;  2WZP P;  1GZW A;  1OLM A;  3QLQ A;  4RR3 A;  3ZXF A;  1OQ1 A;  1PO2 3;  2XXZ A;  1ND2 B;  1W8T A;  3AZX A;  4B7E A;  3OUI A;  4CRQ A;  2NQY A;  3FC0 A;  1HQN A;  2GDF A;  2JKB A;  2W9X A;  2ENR A;  3IDB B;  4XFC A;  1MVE A;  2WFF 2;  1JZ4 A;  5JXJ A;  3PUS A;  1WW4 A;  1R08 3;  3RWN A;  1R1A 3;  2JG8 B;  5DUX A;  4HN1 A;  2UWC A;  4BK4 A;  3JD7 1;  5K7P A;  5KC6 A;  3WG1 A;  1DYO A;  2VNO A;  1FAY A;  5ISL A;  1NOV A;  2JIJ A;  1O59 A;  1VBD 1;  3H1W A;  1N1Y A;  4HSL A;  4YG6 A;  5ABJ A;  2AGS A;  2W0X A;  2BFU S;  1LHW A;  5FY7 A;  5AC9 3;  4HET A;  3AVR A;  1EY2 A;  1RVF 3;  4KWL A;  1X9P A;  4FFH A;  4AFD A;  1J83 A;  3I2K A;  4QXK A;  2DBI A;  1NY7 1;  5FY8 A;  1Z7S 3;  2WFF 1;  2YGL A;  4OLL A;  5A3W A;  3ZSK A;  3VD7 A;  4BQY A;  2G9G A;  5EJ1 B;  1OQE A;  2IC1 A;  4SBV A;  2BNN A;  3GDB A;  4QX5 A;  4NII A;  1NA1 C;  3KZ4 C;  1JW6 A;  2FCU A;  5FYC A;  3KS7 A;  5JVV A;  5A1L A;  2GC2 A;  3H8O A;  2DVF A;  2HWF 2;  4BDV B;  3RNS A;  2P17 A;  3VBF B;  2YY1 A;  4AED C;  1G6N A;  5FZD A;  1GQH A;  1MS8 A;  3BB6 A;  3UES A;  3T2Q A;  2AEY A;  3HWJ A;  3U14 A;  1RMU 2;  5C3O A;  1QH7 A;  4I09 A;  2C9A A;  5GZD A;  5M0T A;  1ND3 C;  2PA7 A;  3KCC A;  1X8M A;  2WII B;  2XLG A;  2J1V A;  4HOO A;  2JDH A;  1NCQ C;  3MIF A;  5FK7 A;  3UNP A;  4XF4 A;  1NCQ A;  3IAQ A;  2ZS6 B;  3L2H A;  5J37 A;  2JJ6 A;  3PUA A;  1JOJ A;  3SCH A;  2OW4 A;  1RVF 1;  3B7M A;  3VB9 A;  5IVB A;  2CTV A;  4IES A;  5F6L B;  3VBF A;  3K48 A;  1CX1 A;  2HWD 2;  4YPJ A;  2Q8D A;  5JOZ A;  1KEX A;  1QEX A;  3K3N A;  4IE6 A;  2VMI A;  1GWK A;  4CCC A;  2DCJ A;  4B8E A;  3PIJ A;  3TEZ A;  3LA2 A;  1H2L A;  3V56 A;  3B9I A;  5CFC A;  3RZM A;  1WA6 X;  1XB9 A;  4AGV A;  4QKF A;  2RDR A;  1ULF A;  4M4P A;  5LRR A;  2BVV A;  3DPR B;  3K51 A;  3QOP A;  4IE4 A;  3KSC A;  1ALY A;  5FPL A;  5A6Y A;  1WD3 A;  5F9T A;  3NNM A;  3HQX A;  5ANQ A;  2OZJ A;  1UZZ A;  2DUP A;  1BXH A;  2L9L A;  4FVV A;  1H8V A;  2AR6 A;  4XQD A;  4PLM A;  4A7Y A;  3K46 A;  3MFA A;  5A33 A;  1I6X A;  2PHX A;  4O9E A;  5EPA A;  5I8T A;  5CAD A;  1VP6 A;  2FDF A;  2ZMN A;  4LNV A;  2A3W A;  2VMH A;  1O8P A;  1VBB 1;  4XTP A;  5F32 A;  2VCA A;  1OFN A;  1Q3E A;  2FQP A;  3KCY A;  4Q0Q A;  5EJZ B;  3I3Q A;  2XKO A;  2R04 2;  3GYD A;  1UD1 A;  1LHN A;  3PJQ A;  4GKX A;  2QJV A;  1AR6 1;  2VO5 A;  4XUQ A;  4RYD A;  5DDJ 2;  3BTZ A;  1YIP A;  2XJQ A;  5GJ6 A;  4F3J A;  2ZGP A;  1OF3 A;  5E88 A;  1GQP A;  3B69 A;  2RDS A;  1JYC A;  1GKB A;  4QM9 A;  3VBO A;  1V9U 2;  1U5I A;  3AK0 A;  3LSE A;  1UKG A;  3PTR B;  3AP7 A;  4ERO A;  4JTN A;  2IXK A;  4GH4 A;  5GM0 A;  5JI7 A;  4CUB A;  2VZ1 A;  3ZYJ B;  3VBU B;  5SV8 A;  2GSY A;  4GQ7 A;  1DYP A;  5FZ9 A;  1REE A;  5B4X A;  1N3O A;  1QOT A;  2QE3 A;  1G9A A;  3VDD B;  1TQ5 A;  1VRB A;  3LDR A;  2YB7 A;  4NWW A;  5LA0 A;  1UPI A;  4BMB A;  1CQ9 A;  4KQ7 A;  3KF3 A;  1OUX A;  3H9A A;  4EZ4 A;  3FLP A;  4AOC A;  1LGN A;  3J4U H;  3HQU A;  4ITC A;  4IXL A;  2W94 A;  5FLH A;  2W91 A;  5H9S A;  5T50 A;  4A7K A;  5BUV A;  4Y5Z 0;  4GH4 B;  2QQL A;  3PU3 A;  1LNS A;  4CDW B;  3BTX A;  1AR8 1;  2RS5 3;  5FO7 B;  1HDK A;  3PVO A;  2YV8 A;  2VTX J;  3I3E A;  5DZF A;  3VBU A;  2ZGM A;  2DU0 A;  4G3Y C;  4GUL A;  3ZKU A;  4DUW A;  1J3R A;  3WDV A;  4TZD A;  3VKL A;  4R4Z A;  1GOG A;  2ARX A;  3UK9 A;  4CUA A;  4BHP A;  2G9Z A;  2A1X A;  4PBO A;  1PNG A;  3HJR A;  3DKW A;  2WQ8 A;  3AKS A;  4XMI A;  5KXB A;  2ID4 A;  2IUW A;  3LSD A;  4FQZ A;  3N36 A;  4YGB A;  2PHR A;  5DPN A;  2BNO A;  3PVB B;  5FY4 A;  3UGG A;  4HAN A;  3FJS A;  4UYB A;  1FMD 1;  4DY5 A;  4EN8 B;  5A6Q A;  5A7N A;  4X6R B;  1TME 2;  3DV8 A;  2PTM A;  5T5O A;  5E16 A;  2CGP A;  4CDW A;  2ZGU A;  4FP3 A;  4M4R A;  4IV1 B;  4CDU A;  5FPA A;  3ACG A;  1LTE A;  2ET7 A;  1YFU A;  3EYP A;  3S7E A;  3OSD A;  4EV0 A;  2C1F A;  3KV9 A;  1DF0 A;  1FOD 3;  1EV1 2;  1W6Q A;  2EA7 A;  1YHF A;  4YWA A;  5FLI A;  3LCP A;  4FPJ A;  2DVG A;  1ZA4 A;  4Q1P A;  1GMM A;  5F37 A;  2ZAC A;  5FOB B;  2D7F A;  2E7T A;  1MEC 2;  2ZA9 A;  3ACF A;  1QXP A;  5FZ8 A;  4HVR A;  4XXP A;  4UI9 L;  5FTT C;  3I2O A;  4N43 A;  2ZGO A;  2I74 A;  4N43 C;  1ND2 C;  2WQZ C;  3U11 A;  4IV1 A;  4QDQ A;  4Q29 A;  5J3U A;  5C4W B;  1UZY A;  5FQ0 B;  1X7N A;  5FWE A;  2DU1 A;  4QGL A;  3ZFE A;  4DUV A;  1QJU 3;  4HT1 T;  5G05 L;  1AYM 2;  1W8N A;  4FPK A;  1SBE A;  3S5A A;  4Y20 B;  1ULG A;  4UF0 A;  1PK6 A;  4Y3O A;  4M01 A;  5CVR A;  1PK6 C;  4OUE A;  4FSJ A;  5DZG A;  2XVG A;  4Q0V A;  1UYY A;  2XR4 A;  1JOB A;  5D21 A;  2R0H A;  2QQW A;  4AVC A;  5A3P A;  1MEC 3;  2O8Q A;  4DB5 A;  5C4W A;  1VBB 2;  3ZFE B;  5FQ0 A;  4MX3 A;  2O0O A;  1TNF A;  2QQO A;  2VW1 A;  3PNA A;  1QU0 A;  4UWD A;  1LB2 A;  4UOJ A;  3IB3 A;  3JD7 2;  1PMI A;  4Q26 A;  1LEM A;  5CKQ A;  3C7G A;  2B45 X;  2QNK A;  3AKQ A;  2QZ2 A;  2WO2 A;  4XIO A;  5FMO S;  4OZX A;  4FPC A;  4YZ4 A;  5IUQ A;  5CG8 A;  2XJU A;  5FBZ A;  5A3L A;  1S0E A;  5IAT A;  3E6C C;  2AEN A;  1O3Q A;  4DO0 A;  1WA4 A;  2RS3 3;  3BUC A;  3RWK X;  3VZK A;  5F3E A;  1NAE A;  2WNV C;  3DXU A;  5J96 B;  5FUI A;  3DN7 A;  2Q8O A;  1A3K A;  4IEX A;  4WVM B;  3JQW A;  3RJR A;  1UF2 C;  1G9D A;  1KJL A;  1QKQ A;  3FFQ A;  2BW8 A;  3RDI A;  3FFZ A;  3WY6 A;  4AW7 A;  1LEC A;  2CWS A;  2XJT A;  5DDJ 3;  5C5U A;  4LO7 A;  3IT8 A;  1CZT A;  1CAX B;  3GHN A;  5I0T A;  3LOI A;  2WN2 A;  1PO2 2;  1UIJ A;  3U75 A;  4B7K A;  3M8L A;  2PHU A;  3ETP A;  2GP3 A;  2W68 A;  1GR3 A;  1YRZ A;  4XYX A;  1O3S A;  4MZU A;  3POS A;  4JZR A;  1ZRF A;  2IXL A;  5C5T A;  2EIE A;  3VZJ A;  3LE0 A;  1F8V A;  3M3Q A;  3M4F A;  4E2G A;  3J8F 2;  3JB8 A;  5C70 A;  4RS5 C;  3O1O A;  4FPE A;  1LUL A;  4QB6 A;  3POG A;  4MO3 M;  3HNM A;  1FPN 2;  4IV3 B;  3TBD A;  2PMW B;  5LB6 A;  1J1L A;  2BNM A;  3J26 N;  4FPG A;  5EWS A;  1E57 A;  1E5R A;  2JD4 A;  3LGR A;  4B4R A;  5F3C A;  2VBD A;  2B9U A;  4IL7 A;  4KH9 A;  1HXS 2;  3E6D A;  4Q0S A;  1UIK A;  1C8N A;  1DYK A;  2VMC A;  1A8M A;  3I2G A;  1AR9 2;  2BGP A;  3JBG 1;  3PVN A;  3WXP A;  4FTB A;  2D98 A;  4LT5 A;  3AMH A;  3HAG A;  1F4H A;  1RUJ 2;  4LLO A;  1KQR A;  4XMA A;  3ZPO A;  3SNM A;  1ZNP A;  2RS5 2;  3ZSL A;  1PX3 A;  4YG3 A;  4LKF A;  3ZN6 A;  1AYN 1;  1TMF 2;  5FO8 B;  1UMI A;  5FXX A;  4QX8 A;  4IV3 A;  4NR1 A;  4DXR A;  2WZE A;  3FUQ A;  3NV4 A;  4P9G A;  1WLT A;  4XFF A;  2DVB A;  2VMD A;  1GBG A;  2A6Z A;  4GWM A;  4N53 A;  3VD3 A;  1AUY A;  1VBA 1;  3DKQ A;  2D5H A;  3OY8 A;  4HMZ A;  3NKG A;  4ZY9 A;  5J7M A;  1LAJ A;  1J59 A;  1V70 A;  5LA9 A;  3MIG A;  4B4Q A;  2X09 A;  3B94 A;  1AR7 2;  4MGZ E;  2WS9 2;  1Q8O A;  5JIU A;  3OGS A;  3ZN6 B;  4FBF A;  2A70 A;  4HLT A;  1UU5 A;  5JXI A;  4CCE A;  3U0Z A;  4J6G A;  5GLZ A;  4P5H A;  3N9Q A;  2BJS A;  2YXS A;  1VAL A;  3W58 A;  2FZ2 A;  1QIQ A;  5I93 A;  4B1M A;  3OGJ A;  3ECQ A;  4XE9 A;  1OOP B;  3K75 B;  5FAX A;  5FCC A;  5IK8 A;  3JB4 C;  3WDX A;  2WYS A;  2I45 A;  4I0A A;  1UY4 A;  3AXD A;  3ITQ A;  5FV3 A;  2XML A;  4QHB A;  1YQC A;  4CP9 B;  3MIB A;  3EJK A;  4EE2 A;  5B2G B;  2WNE A;  1G9B A;  5FIX A;  1WW6 A;  3I7D A;  2XLF A;  1XJA A;  1GP6 A;  1UN1 A;  5FPU A;  1WW7 A;  3VKN A;  3RZJ A;  4LIV A;  1JH5 A;  1FXZ A;  1HW5 A;  3WVJ A;  4GKY A;  4GWJ A;  4NRM A;  1NT0 A;  2ADE A;  4PQ9 A;  1V6I A;  4CEW C;  3AFG A;  4RN5 A;  1S0F A;  2W1S A;  3IPV A;  4DFS A;  3KQR A;  2ZTN A;  1ULE A;  4QXH A;  2JKX A;  4UFM A;  2QQP A;  1REF A;  4DOU A;  4FO9 A;  2NLR A;  4CVU A;  1KD7 A;  3EBR A;  1ZBE 3;  2DVD A;  1OI6 A;  2DV9 A;  4L9B A;  5CEH A;  1IQD C;  1EAH 1;  1RYY A;  3IWZ A;  2YFZ A;  4Y4Y A;  3CQO A;  4TXW A;  5FMC A;  4FQ4 A;  5A1A A;  2ZHM A;  1PO1 2;  5CFC C;  3TEW A;  1A8D A;  4LOT A;  1W9W A;  2WO3 A;  4N7I A;  1RUI 3;  4W50 A;  4C8D A;  4MGS A;  3ZSJ A;  3W59 A;  5FZI A;  1B35 A;  5SV5 A;  4DRR A;  1G86 A;  2GC1 A;  4N9H A;  3MLJ A;  2F6B A;  1VMJ A;  3AYA A;  1ULD A;  3NV3 A;  3OYW A;  3QH7 A;  1ENS A;  2ZHN A;  4JDM A;  4QQO A;  5FY1 A;  2GH8 A;  3VGI A;  1SCR A;  3T3Y A;  4E2S A;  1HXS 3;  2RS3 1;  2VPV A;  3INA A;  2VAU A;  4RHV 2;  1IG0 A;  3T0B A;  3CNA A;  4BQ2 A;  4FPH A;  1G7Y A;  4Y1X A;  1JTZ X;  2LS6 A;  1GZC A;  4W4Z A;  4P9W A;  1AYM 3;  4GZ9 A;  4YNI A;  1I9R A;  1QJY 3;  3WF3 A;  3OCP A;  2VU9 A;  1SAC A;  2UWA A;  1V6J A;  2RJ2 A;  3X29 B;  3FL7 A;  3JBG 2;  4NMI A;  1X82 A;  4A2U A;  1V9U 3;  3OBT A;  2VH9 A;  4XUT A;  1XU2 A;  4TLF A;  4OHZ A;  3FHQ A;  3WNL A;  4KBZ A;  1C5I A;  5BV6 A;  5FZ1 A;  2VME A;  5EV7 A;  4L2N A;  3C8X A;  5BXX A;  3LEM A;  3HVD A;  3NST A;  2XQR A;  4IEO A;  4JTO A;  4KNC A;  3HBK A;  4URT A;  4P00 B;  3T4V A;  4A44 A;  2FHR A;  2Y34 A;  4RQP B;  2ARC A;  3NNF A;  3MBW A;  2BP6 A;  3ZYH A;  3GAL A;  1VIW B;  1MQT A;  2OPW A;  1VRH 3;  4KWU A;  5HI0 A;  4P14 A;  4HPK B;  1VMH A;  3H42 B;  3J7M A;  4PIY A;  4HBN A;  2YU1 A;  3PMS A;  1CPM A;  4QDS A;  3THC A;  1AL2 2;  2A6V A;  1NQD A;  4M0N A;  2VVD A;  3IN9 A;  1ST8 A;  4RFT 0;  2R7E B;  5FY9 A;  1IS4 A;  2VQA A;  4NHM A;  3H7Y A;  2EXK A;  1LHU A;  1Q8V A;  2V5Y A;  1C8M 1;  1W6P B;  2J1T A;  2WKK A;  3I54 A;  3KVA A;  2KR2 A;  2JXA A;  4R52 A;  5T5P A;  5CA6 A;  3K4A A;  1SLC A;  4JGY C;  4RQP A;  4BIS A;  2JIC A;  2MNG A;  2LW8 A;  1A78 A;  1MQT B;  3H1Y A;  4XCB A;  1UPS A;  4XF0 A;  3D6E A;  5G04 L;  1NE4 A;  2DVA A;  1HQW A;  2ORZ A;  2X5I A;  4HPK A;  5GLW A;  4CU9 A;  4UFH A;  1PO2 1;  1Q5O A;  5C7G A;  1GZW B;  1CES A;  1T2X A;  2JDZ A;  4Y1Z A;  5HV4 A;  1RB8 G;  1PGL 1;  1QF3 A;  2CAU A;  2WNU B;  3K2O A;  3SCG A;  1GNZ A;  2VXR A;  2C0Z A;  2RM2 1;  3MW4 A;  2XHN A;  2XLA A;  4OUL A;  1A34 A;  3ZSE A;  1H1A A;  2W87 A;  3CJI C;  4QM8 A;  4RS5 A;  3LDB A;  1W8U A;  3OGR A;  4AFB A;  4BPZ A;  1QJF A;  2VM9 A;  1RUC 1;  1BBT 1;  4D8M A;  4BQ4 A;  3I3D A;  3MUZ 1;  2BER A;  1BEV 1;  3ZR6 A;  2P3I A;  4YW2 A;  4D6R A;  5ABJ B;  3Q8A A;  4XOG A;  2MEV 2;  2G1M A;  1CZV A;  1APN A;  2LRP A;  2WNU A;  2HWB 1;  3N35 A;  3WQ0 A;  3NJY A;  1OMI A;  4W6W A;  5LAS A;  1BVP 1;  1AR8 3;  2RS5 1;  2VNV A;  3PTY A;  2VW0 A;  3MV0 1;  4YM3 A;  1OT5 A;  2R07 1;  2QTW B;  2V73 A;  5FZ0 A;  2ARA A;  5CFD C;  4J25 A;  1VBE 3;  2GMM A;  1LGB A;  4FAH A;  3N9L A;  3ZFF C;  2JX9 A;  4IV3 C;  3H3L A;  1C1L A;  3LAG A;  2K0G A;  3CU7 A;  4DNY A;  3VKF C;  1WCS A;  4ZZ5 A;  2RS1 3;  1MR5 A;  2JIG A;  5FZ4 A;  1RXF A;  2WAA A;  2WQ4 A;  4IV1 C;  3WZ1 A;  1WKY A;  5BYN A;  5F7U A;  2CGN A;  5F6K A;  1ZZ7 A;  4QX3 A;  1L7L A;  4GWI A;  4YW5 A;  3EQE A;  5TSW A;  1O7F A;  2WS9 3;  5FMO L;  4BWO A;  5A6Z A;  2B9V A;  1BK1 A;  1FI2 A;  2WC2 A;  2Y6G A;  2R07 3;  2ZEX A;  4DZG A;  5CAZ A;  2Z42 A;  4CP1 A;  2WLQ A;  3ZFF B;  1NCQ B;  3V0B A;  1LU2 A;  2PAE A;  5C71 A;  4AXO A;  1WUV A;  1DQ6 A;  4MG2 A;  1CAU B;  1BZW A;  1OPO A;  1PVC 1;  2XBO 1;  4WM8 A;  1VBE 2;  1Z78 A;  3R0R A;  4Q5O A;  4Q4X 1;  2D6P A;  4LOS A;  4FOY A;  5DAP A;  3NNL A;  1T6B X;  4ZON A;  3RPQ A;  4IGQ A;  3DGT A;  1N1V A;  1QJZ A;  2WO1 A;  4Y22 A;  4U36 A;  1S2B A;  1XE0 A;  2BU9 A;  4P5Y A;  1TME 3;  3DPR A;  4MGT A;  3ACI A;  4CXW A;  3LOB A;  4PLO A;  3QCW A;  3DUI A;  1RL3 A;  1Y9M A;  2Z69 A;  1AX1 A;  4NHY A;  1W28 A;  4WM8 B;  4DS0 A;  2VC9 A;  2ZEW A;  3VBF C;  2YBP A;  5FPV A;  2PLV 1;  5KR7 A;  1W39 A;  5CNA A;  1RIR A;  2DFC A;  1GOF A;  3NNJ A;  1GLH A;  2WLP A;  1DQ2 A;  2NN8 A;  4OZO A;  1FV3 A;  2HWF 1;  3NJZ A;  4Y22 B;  3UJQ A;  4COV A;  3BOP A;  3G6J B;  2JDU A;  1SCS A;  2E51 A;  1KRI A;  4GB3 1;  3HNY M;  1W8Z A;  3AFK A;  1DBN A;  2BOJ A;  3WG4 A;  1XOY A;  3O0W A;  4WM7 B;  4E4D X;  5JAX A;  3VHN A;  3LFI A;  2Z2S B;  1KS4 A;  3FLR A;  3J7H A;  3N9M A;  5EP9 A;  3JQX A;  3CIH A;  1ZBE 1;  2VVE A;  5AVA A;  3D8C A;  1AR9 3;  4JC1 A;  2JDP A;  3O5S A;  4PLN A;  3OBZ A;  4JAA A;  3ZLI A;  1RUJ 3;  4KBB A;  2WWS A;  2E32 A;  4ZPI A;  2JB8 A;  3AMQ A;  3S30 A;  4AE2 A;  3NAP A;  3BCW A;  5CU1 A;  1QJY 2;  2ILM A;  4N7U A;  3VKO A;  1PGW 1;  3FLT A;  3C3V A;  3FZ3 A;  4LBQ D;  4WM7 A;  2VVF A;  4R8H A;  2DDU A;  2UYA A;  2WFP A;  2OT7 A;  5DAW A;  1BBT 2;  2Z79 A;  2J42 A;  5FJK A;  2CDO A;  1DU3 D;  5A32 B;  4XAB A;  2BTV C;  2DCK A;  3HMY A;  3SH3 A;  1JZ6 A;  4BQ5 A;  1JN2 P;  3B3Q E;  1SLL A;  4Q1R A;  1Z7S 1;  4NPM A;  1KGY A;  2XOM A;  3B00 A;  3C7O A;  3NAP B;  3GZA A;  3VDD A;  3ZSM A;  1J58 A;  4LHK A;  3U4X A;  5A3T A;  5ACA 3;  1UOF A;  1LRH A;  2ZEZ A;  4FXK B;  3ZX7 A;  2R04 1;  4JQR A;  4RD7 A;  3G7D A;  2BFU L;  2JB4 A;  4BME A;  2D6L X;  1BEV 2;  4XIL A;  5I8S A;  3USU B;  2BBV A;  3WF4 A;  2HWC 1;  2D97 A;  4OVE A;  4IEY A;  4AEK A;  5JMO A;  1DGL A;  2R1B A;  5A32 A;  1ZBA 1;  4FOV A;  5LY2 A;  3TEX A;  1LOF A;  2HWE 1;  1PZ9 A;  3MW3 A;  3BOD A;  4EYU A;  3KD4 A;  4AL9 A;  1RUI 1;  4KMQ A;  2ES3 A;  1GP4 A;  1G8W A;  4RQP C;  1W0N A;  2Q30 A;  3OPZ A;  1F5F A;  1GOH A;  1PVC 2;  2XBO 2;  1OVP A;  5FKC A;  3THT A;  4YW3 A;  3ZN5 A;  3ZM8 A;  1K3I A;  2H6B A;  2YPJ A;  3USU A;  2JWP A;  3ZDV A;  4OI2 A;  3KWV A;  4XUN A;  2B46 X;  3QD6 A;  1MS5 A;  2JDA A;  4P9I A;  5F5I A;  5DAB A;  1H1M A;  4HKO A;  4CDU B;  3KT1 A;  5FYH A;  2ZAH A;  1NXM A;  5L7O C;  4Z8B A;  5CKM A;  3O1R A;  1ZBE 2;  2I2S A;  5FPX A;  2VR4 A;  4XFG A;  2ET1 A;  5F2S A;  2VUA A;  1AZD A;  3IBM A;  2VQ0 A;  4FFI A;  4JGZ B;  3VBR B;  4YZ3 A;  2K46 A;  2XJS A;  5FK8 A;  2B4K A;  4P9X A;  2VOV A;  1BK0 A;  4I30 A;  4QMA A;  1SDD B;  1WMD A;  2AUY A;  3POJ A;  5I0R A;  1DZQ A;  2RM2 3;  1GFF 2;  1HX6 A;  3M3O A;  2A7A A;  3P3N A;  3WF1 A;  3AYD A;  4CDX C;  1L7R A;  5I0S A;  4COY A;  2ZAB A;  2F4P A;  2IXI A;  4CDU C;  3GBF A;  2CY6 A;  4KI5 M;  3R4U A;  2BQP A;  4KWK A;  5KHJ A;  1RJ7 A;  1X8E A;  3HD8 B;  4CSW A;  4CTE A;  3PUI A;  1GUI A;  1UU4 A;  1VAV A;  1TMF 3;  4QKD A;  1PNF A;  3VBR A;  4YLZ A;  4ASK A;  5FUP A;  2BGC A;  5CFD A;  4ARY A;  2W08 A;  1J3Q A;  4AEM A;  2IXC A;  4UF0 B;  3VBH C;  2D44 A;  3LQC A;  1JYX A;  3DEM A;  4N90 A;  4CU8 A;  1TEI A;  1M4W A;  5LEJ A;  4IEU A;  4AQT A;  1OA2 A;  2CAV A;  4X8P A;  4LE4 A;  1W2N A;  1W99 A;  2B8M A;  1IPS A;  1YYN A;  4HXC A;  4FPF A;  1AR7 3;  1NZC A;  1H2N A;  1ODM A;  4I02 A;  2Y64 A;  1V6O A;  4NOT A;  5GZC A;  3WP5 A;  3PIG A;  1SDW A;  4YYO A;  1V6N A;  4AQS A;  1W6M A;  1AVB A;  1O4Y A;  1HRV 2;  1XPW A;  1UX7 A;  3J9S A;  3A21 A;  3SKJ E;  1GYK A;  3ZXK A;  4TN7 A;  2J1S A;  4OHV A;  3H0O A;  2Y26 A;  4NE9 A;  3AP5 A;  2BBA A;  4QX2 A;  3JZV A;  4MET A;  5FZC A;  4UBH A;  3R4D B;  2YZ4 A;  5HV0 A;  1ZZ8 A;  4DXZ A;  1GZT A;  1HB4 A;  2OX0 A;  5C3P A;  5I0D A;  2H0V A;  3I3B A;  1BBT 3;  2P37 A;  1FMD 2;  1IS3 A;  3AJZ A;  2VD7 A;  3RZL A;  3RFR A;  2WNV B;  2Y33 A;  3CO2 A;  4WVM A;  2ZXQ A;  5FKB A;  3ZR5 A;  2CV6 A;  3WSO A;  1SHW B;  2J1A A;  2GU9 A;  2BZD A;  3UL2 A;  1JOD A;  1ODN A;  1XC6 A;  3ORJ A;  1FYU A;  4LHL A;  1CAX A;  3TAY A;  5JCT A;  2H0B A;  2HYX A;  3AXE A;  1WME A;  2Z5W A;  4GB3 3;  5EFU A;  3WNP A;  5FLJ A;  4JDN A;  1HN0 A;  1EAH 2;  1RTV A;  3T2T A;  3NV1 A;  1S55 A;  4HVQ A;  1MZ6 A;  4LBN A;  3AP9 A;  1DGR A;  2WNV A;  4DXT A;  3FX3 A;  2O1Q A;  4M0H A;  1FX5 A;  4BLI A;  1DG6 A;  1UYZ A;  3ZXJ A;  4R9D A;  1OH3 A;  3CMG A;  2NMO A;  3PME A;  5CZK A;  2VGD A;  2FDK A;  3ZFG B;  3KM5 A;  3VBS A;  5LWB A;  1W9T A;  3ME2 A;  4PDW C;  3VL9 A;  2A3Y A;  5IK5 A;  4IE0 A;  4WVZ A;  3LFM A;  3SXW A;  1H4H A;  1ONA A;  1LR5 A;  4FPO B;  5A7P A;  1R09 2;  3T0A A;  1VAM A;  2VCM A;  4Q0P A;  1JOP A;  1U5X A;  4XVH A;  1HIX A;  2J1E A;  4GB3 2;  4R9A A;  1UQX A;  1ULP A;  3ZXE A;  2QCS B;  3RZH A;  3RGB A;  1ENX A;  2Y60 A;  5A70 A;  5AC9 2;  2R06 1;  3OUH A;  4KG8 A;  3ZMN A;  4QXB A;  5C3R A;  1KIT A;  1W8W A;  2JDM A;  2YHJ A;  4TYS A;  4XF1 A;  1KFU L;  2RJK A;  4AQ6 A;  4Q0U A;  4CUC A;  3EHK A;  2G4I A;  2C9K A;  2WNU C;  2LM3 A;  1AR7 1;  2P34 A;  2Y6K A;  4IE7 A;  4IW3 A;  2DTW A;  2EVX A;  4J1X A;  4M00 A;  2XL9 A;  1VBC 2;  1RHI 1;  1F31 A;  2D3R A;  5FZF A;  4YG0 A;  4N9I A;  3SH4 A;  4XQ4 A;  3EMR A;  2HEV F;  2R07 2;  4SLI A;  5DZE A;  3TEY A;  1CIW A;  2P1B A;  1JZ3 A;  3GJB A;  1GV9 A;  4NN0 A;  3WQ1 A;  2WNO A;  4OHY A;  1U0A A;  3ELN A;  5BNO B;  3VDB A;  3I49 A;  3H7J A;  3NWK A;  1UX6 A;  4ZXK A;  3ZYF A;  4ES9 A;  4EZH A;  2UWB A;  1OOP A;  2BWC A;  1VBE 1;  4Z82 A;  1AYN 2;  1TMF 1;  4G9S B;  3SH5 A;  3ZPY A;  1OOP C;  2VZP A;  5IT6 A;  2ZZQ A;  4K3U A;  4LBQ B;  1RUE 3;  2A71 A;  3PL0 A;  1U5Z A;  3A23 A;  1LOD A;  2K2S A;  1YQ8 A;  4UW6 A;  1W8F A;  4IND A;  4BQX A;  1RUD 3;  4TLG A;  4L11 A;  1XNC A;  5FZG A;  4OMD A;  1X50 A;  2R06 3;  4OFG A;  3P3P A;  1R1A 1;  2VTF A;  1G9F A;  1F2N A;  1LJ7 A;  2YC0 A;  1XSQ A;  4LBL A;  4NJ4 A;  3WUD A;  4UFJ A;  4A3Z A;  5FDB A;  3WX5 A;  2WWU A;  1JYT A;  4FTS A;  2XVL A;  5FZM A;  3A22 A;  5F2W A;  2W1Q A;  5KWR A;  4Z07 A;  3J8F 1;  1IQA A;  4OI4 A;  1S2E A;  4DXS A;  4EQV A;  5DXD A;  1EUU A;  1YQ5 A;  4LBQ A;  1CN1 A;  2XKP A;  3ILR A;  4KL1 A;  3WW3 A;  5C9A C;  1W2A X;  3U10 A;  1E5H A;  5C9A A;  1JYN A;  4QD2 A;  3LPG A;  2CU5 A;  4NUB A;  4ZS3 A;  3DPR C;  4Q8L A;  4QPG A;  2N7G A;  3RQ0 A;  1POV 0;  3VHP A;  1Y43 B;  3OYW B;  3QAC A;  2J1R A;  1W8O A;  3L9J T;  5H9P A;  2OPK A;  5I0U A;  1VE0 A;  4FXG B;  3U4S A;  2HEW F;  4FP2 A;  1CPN A;  3KVB A;  2JE7 A;  2VBB A;  4NWV A;  2ZGQ A;  2YBK A;  5C9A B;  3THP A;  5LK7 B;  5DMY A;  1K12 A;  2WUH A;  2Q8C A;  1O4T A;  1AHS A;  1NKG A;  3VBH A;  1FV2 A;  1POV 3;  4F7Z A;  5JSO A;  4MLO A;  1C5H A;  4WZC A;  2ADD A;  1K45 A;  4NRQ A;  1W9S A;  3MIE A;  2DUQ A;  4AHY A;  5FP9 A;  2WT2 A;  3SIT A;  3MDP A;  5DUU A;  3QBQ A;  1YJK A;  1YNA A;  1DQ0 A;  3QH6 A;  4FTE A;  2FDH A;  5F5A A;  4CCM A;  2OVU A;  3ZFE C;  5FOJ B;  4H55 A;  1JS9 A;  2VUL A;  2B42 B;  1ZZ6 A;  2WSV A;  3CDZ B;  4LOR A;  3S7I A;  4AI1 A;  1Y4W A;  1QMJ A;  4JQT A;  1J84 A;  1BQP A;  3ACL A;  4MH0 E;  3VBH B;  2V5D A;  4M3C E;  4XQW A;  4M3C F;  2OXB A;  2X05 A;  3PDQ A;  1LHV A;  1WGP A;  2PFW A;  1MEC 1;  4Q8K A;  3FHA A;  2WZ8 A;  3HBZ A;  2ARE A;  1SLT A;  3PJY A;  4K40 A;  3F2Z A;  3U1X A;  3UYJ A;  2RR1 3;  2AZ5 A;  2WZR 1;  2XJV A;  3LPF A;  3JU9 A;  1PHM A;  4ORF A;  1W6P A;  1DQ5 A;  1QNW A;  4LK6 A;  4QXC A;  3Q8F A;  3WNM A;  4BZ4 A;  4AFM A;  5JSR A;  2ATF A;  2V72 A;  5KC5 A;  5ANN A;  2JG9 C;  3GGL A;  3IIA A;  4FOW A;  3ZDS A;  1H4G A;  1UYP A;  1VBD 3;  1MQT C;  2HWD 3;  2VMF A;  2WFF 3;  2ZGK A;  1ENQ A;  2VZU A;  3KV4 A;  3APB A;  5A3N A;  3WW1 A;  4Q4W 3;  3ENR A;  4CP0 A;  5E6H A;  1IPJ A;  4GH4 C;  1ZRC A;  4QKB A;  2VZR A;  5IVC A;  4WVW A;  3E6B A;  3MID A;  3T4H B;  5CG9 A;  3MV1 1;  3EB7 A;  4BQ1 A;  2ZGT A;  4J1W A;  4XJ8 A;  1STM A;  3RZG A;  2RMU 3;  3RVH A;  1RC6 A;  1NXD 1;  4QPI C;  5IJR A;  3C2U A;  3C7F A;  4RS5 B;  1MZE A;  1W04 A;  5F1R A;  3AJY A;  1MS9 A;  4K1Z A;  4YFZ A;  1FOD 1;  3BOW A;  5KXD A;  2F17 A;  1BHG A;  1J3P A;  1R08 2;  1AXK A;  1NYW A;  1S0C A;  2HWB 2;  2E63 A;  1N1T A;  2TEP A;  2VL4 A;  1R1A 2;  4K1Y A;  4XCA A;  2G19 A;  2XQX A;  3IDC B;  5FYU A;  3VZL A;  4LBK A;  3VL8 A;  1WLD A;  4BJ0 A;  4FT8 A;  4XBL A;  1TZO A;  1SFN A;  4NPR A;  1TVG A;  5APA A;  1RMU 1;  4IUG A;  5DUW A;  3W9A A;  3VD9 A;  1C1F A;  2FCV A;  3UV9 A;  3FN9 A;  2P5B A;  3ZVX A;  4BA6 A;  2GN7 A;  4XFB A;  3U78 A;  4AG4 A;  2Q4S A;  1YWK A;  2XHK A;  5FZO B;  3SCF A;  3POW A;  3OEB A;  3N3H A;  4IQP A;  5FMD A;  2ZAA A;  1RUF 1;  2A3X A;  4HN0 A;  1KXG A;  2XWB B;  1V6L A;  1CVN A;  1H9P A;  2WWJ A;  4OI1 A;  4RR3 C;  3POF A;  2XB6 C;  4UW3 A;  3NL1 A;  5EYY A;  4ZU7 A;  3GM8 A;  4CCK A;  4ZU4 A;  3WLU A;  5A80 A;  5A7S A;  2Q1M A;  4QGM A;  4X8N A;  5IVJ A;  1WCK A;  2HWE 3;  1IS6 A;  1UO9 A;  1DFQ A;  5I8Y A;  1VBC 3;  1OD5 A;  1W90 A;  4MVT A;  2B7Y A;  4AFA A;  1CJP A;  3ON7 A;  2MPF A;  3AMM A;  5I91 A;  3RYK A;  1HRV 3;  3ES1 A;  4Q4V 2;  4YGE A;  5JLV A;  1LED A;  3OGV A;  2JDY A;  4YZ1 A;  3ZFF A;  3V0B B;  1MAC A;  1W2U A;  5GKA C;  1NY7 2;  2RMU 2;  5IYY A;  1CAU A;  2HJI A;  1XXN A;  3CBN A;  5T54 A;  3IDA A;  1W2T A;  3NRU A;  1QQP 1;  1V6K A;  5FYZ A;  1XBF A;  2ZPX A;  1PGW 2;  2EID A;  2ERF A;  2BVB A;  5FZB A;  3GBW A;  4JGZ C;  4LA3 A;  4QU2 A;  2D43 A;  4BB3 A;  3ES4 A;  1JHN A;  3WNO A;  5JZG C;  1ASJ 2;  4NIG A;  4HG6 B;  2QZ3 A;  1ULC A;  1JU3 A;  2VZS A;  2ZX2 A;  2E33 A;  3O0V A;  3VN4 A;  4PQQ A;  4WBB A;  3V65 A;  3WG3 A;  5FZA A;  4WZF A;  5J1X A;  3WF2 A;  3ZN4 A;  1NLR A;  2R16 A;  1W0P A;  3PUH A;  1VR3 A;  1VBB 3;  2GNM A;  3PUR A;  4FOQ A;  4AVS A;  4OQ8 A;  3USS A;  2D6N A;  1W2O A;  1IGO A;  2QBX A;  1HJF A;  3MIH A;  5T5L A;  4P9Y A;  5H9Q A;  3WF0 A;  4M3C B;  3WHT A;  1KDM A;  1LEN A;  1HRI 1;  1IHM A;  3U07 A;  4AI2 A;  1W9F A;  2QQK A;  5J36 A;  4XAC A;  2KXL A;  5FZK A;  1UU6 A;  3O1P A;  1HV0 A;  2EXJ A;  1EP0 A;  2C6S A;  4LO6 B;  2WT1 A;  1QJU 2;  4XW3 A;  4AWD A;  4CXY A;  1LES A;  1XRU A;  1XE7 A;  4RA0 A;  4NRO A;  2XGX A;  4EJR A;  3AB0 A;  4OCT A;  1LOB A;  1W0O A;  1IKP A;  1ZBA 3;  4XC9 A;  5FPZ A;  1CD3 G;  1BMV 1;  5LBC A;  1NE6 A;  4S2D A;  3I2H A;  1YCI A;  4M3C A;  1UKR A;  3I2D A;  4RL7 A;  1RVF 2;  2IFW A;  2UUR A;  1K5M C;  1RUE 1;  2BYV E;  2PEL A;  2EIG A;  4Q4Y 2;  3LZZ A;  5IVV A;  1QXR A;  2ZKN A;  2ZMK A;  2IZW A;  4XHB A;  4ZS2 A;  2R30 A;  1RHI 3;  4XXA A;  3WDW A;  5HCH A;  1OA3 A;  3M3C A;  4JX0 A;  3PHM A;  4RGG A;  4V2V A;  4D7Y A;  1UMZ A;  1W6O B;  4DIN B;  1UXX X;  4QX1 A;  3SEP A;  1DGW A;  2VZQ A;  5ERL A;  2IWG B;  2D93 A;  5B4N A;  3I2J A;  2PN5 A;  4COZ A;  1QH6 A;  1QQP 2;  3MUY 1;  2AYH A;  3NAP C;  1Y3T A;  1QDC A;  2W1U A;  3GZT B;  3OPT A;  1CAW A;  3V0A A;  3AKT A;  4FPY A;  1XSR A;  2Y0I A;  5L36 A;  1NLS A;  2KM2 A;  1U5Y A;  2YC2 A;  3N7J A;  1VPH A;  4XIK A;  2MHF A;  1QY4 A;  2G9F A;  3KMH A;  4L99 A;  4NHL A;  2WS9 1;  1W6O A;  2WZR 2;  5JUV A;  1ACC A;  4RHV 3;  5LK5 A;  5LEK A;  1RIN A;  4GMP 3;  4XAE A;  1GIC A;  1FPN 1;  2E7Q A;  5FZH A;  4AVT A;  1I5P A;  4AFC A;  2WA3 A;  4D6Q A;  3P6B A;  3V0A B;  1CAW B;  1LOA A;  3MLK A;  4ISQ A;  1B09 A;  1HB1 A;  4LXL A;  4Y1Y A;  3WDU A;  3TN9 1;  1EV1 1;  3BI3 A;  1CWP A;  1K5J A;  1S0G A;  5DUV A;  1ULO A;  1NZI A;  1A6C A;  2RV9 A;  4UBG A;  3WHU A;  4OI0 A;  4KGQ A;  4I01 A;  2OZ6 A;  1WCD J;  4XFI A;  3VD5 A;  2YC4 A;  4R4X A;  5AVP A;  4AZZ A;  1ZRE A;  5IHR A;  2XH6 A;  4BOW A;  4R9C A;  4AK3 A;  2XUE A;  5AFE A;  3GBG A;  2D3P A;  3ALQ A;  2A6X A;  4AVV A;  1JBC A;  2J22 A;  2WJS A;  3JD7 3;  5LAT A;  2QQM A;  2CL2 A;  4AQ2 A;  3IM0 A;  1JXN A;  1X33 A;  1DQ1 A;  4LIU A;  3DYO A;  4XBQ A;  1EV1 3;  4MGK E;  3EO6 A;  4EN6 B;  4YW1 A;  4LUL A;  3THD A;  1SEF A;  4QX7 A;  4NAO A;  2ORX A;  1FPN 3;  4E4H A;  1Y9Q A;  4EN0 A;  5GLT A;  4QPI B;  2W3J A;  1CX4 A;  2WZR 3;  4S2F A;  1COV 1;  5CFD B;  4C0B A;  3D4K A;  3W21 A;  5CKN A;  3BGA A;  1C28 A;  5IK7 A;  1PZ7 A;  1F35 A;  2SBA A;  2P3K A;  2V09 A;  1DZT A;  4I2O A;  1UZ0 A;  4H14 A;  3VHO A;  3OPW A;  1OHF A;  3PLQ A;  2R49 A;  2XVK A;  2WAO A;  1WCQ A;  3J7N A;  2EIC A;  2GZW A;  5JXG A;  3FHI B;  1WWY A;  1HN1 A;  5LW9 A;  4YM0 A;  4QDR A;  4LBM A;  4ZKT B;  2QVS B;  1QGL A;  3H1M A;  4PIZ A;  1HRV 1;  2YYO A;  5CIR A;  1IKQ A;  1H8T B;  1PO1 3;  5BNN A;  1O5U A;  1OSG A;  1W6M B;  4IER A;  4I0W B;  2AAC A;  5A3U A;  1ZBA 2;  2VCB A;  4HFS A;  4XBN A;  4YW6 A;  1XNB A;  2BEO A;  1W8H A;  2DYC A;  4CDX B;  1PGL 2;  2C5D A;  1OC1 A;  1VB2 A;  2XG3 A;  3DYP A;  4XUP A;  3B01 A;  3TRS B;  3LIH A;  5HCB A;  4LKE A;  1H2M A;  1UYX A;  5C8C B;  5IVY A;  4ZXE A;  2DBN A;  1L3J A;  4UAP A;  3T30 A;  3VDA A;  3SHR A;  4GD4 A;  4KU8 A;  4HK8 A;  5BNN B;  3J7L A;  4LUK A;  2ZZJ A;  4COU A;  3MHZ A;  1L7Q A;  3GNE A;  5D8A C;  2JE8 A;  5LRS A;  1UZW A;  1CJD A;  3FE5 A;  3ZYP A;  3LKJ A;  3BIE A;  4EN9 B;  4ASM B;  4Q27 A;  1UY3 A;  4URA A;  4NHK A;  4MGQ A;  2YG0 A;  3ROU A;  1LGC A;  5T3N A;  2Z4F A;  1HRI 3;  2FMD A;  2HEY F;  1RUJ 1;  2BV4 A;  1DHK B;  1WLW A;  2IVI B;  3GZU C;  4KG0 A;  4PI0 A;  5GZF A;  3WR0 A;  5C8C A;  2Q0A A;  4ARX A;  3PUQ A;  2F4L A;  3HN1 A;  3OF1 A;  4JVA A;  1HXS 1;  3WIN E;  5IVE A;  1YJL A;  2FMY A;  4JGY B;  4Z92 B;  2QQN A;  5FUN A;  1CIY A;  2IVJ A;  3I59 A;  5JZG B;  4QU1 A;  4I0B A;  4C1X A;  2R1D A;  5JXH A;  4L8Q A;  1NA1 B;  4QQH A;  5DDJ 1;  2Q8E A;  2CWM A;  3ZFG A;  5C6C A;  2P3J A;  5FYI A;  4GJY A;  2NM1 A;  5IAV A;  3VBS B;  1BCX A;  1DP0 A;  4A42 A;  3I3M A;  1OLR A;  4P9J A;  1AL0 G;  1Q8Q A;  3T1L A;  4L97 A;  5LCW L;  3OD4 A;  2X10 A;  4YZ2 A;  3CLP A;  5FZ6 A;  2EAK A;  4XTM A;  5J09 A;  1DLL A;  3B02 A;  2VZ3 A;  2QUO A;  3OD0 A;  2XPJ A;  2PHF A;  4OUS A;  4JGY A;  1OFS A;  4GA9 A;  1F4A A;  2OUH A;  1JUH A;  2R32 A;  1IG3 A;  1FNZ A;  1HRI 2;  2R04 3;  2VOK A;  4KU7 A;  4Q4X 2;  1F5J A;  4CCD A;  3A7Q A;  2ZJC A;  1AL2 1;  5A6X A;  3NV2 A;  4RHV 1;  2D40 A;  2W47 A;  4PDW A;  3POE A;  2NZ9 A;  5FFO C;  1D4M 1;  4YGC A;  5IW0 A;  3P5B A;  4JRL A;  1O4Z A;  3WD5 A;  3MFC A;  1CGP A;  4B1L A;  3WNN A;  4E9K A;  1HV1 A;  1MPX A;  3KF5 A;  2Y6L A;  2ZGR A;  5ACA 1;  1W3X A;  4YVS C;  2E26 A;  3UGF A;  1GP5 A;  2D6O X;  3Q8C A;  3SMH A;  1FOD 2;  5FZ7 A;  1QDO A;  3KQ4 B;  4B4P A;  1NCR A;  5BNP C;  2JDN A;  1W03 A;  3AL5 A;  3D82 A;  4CE8 A;  5T52 A;  1ZRD A;  4MGY E;  4XFH A;  2EXI A;  2WT0 A;  4LBO A;  2W46 A;  5BNO A;  5FZ3 A;  1KFX L;  4ES8 A;  3HT1 A;  2JEC A;  3CL1 A;  3GHM A;  4MGI E;  1SLA A;  4QAW A;  3O1M A;  3KV5 A;  3ZO0 B;  4AHX A;  4F83 A;  4K8R B;  2X8K A;  1O3T A;  3RZK A;  3IKW A;  4LK7 A;  3NW4 A;  4IGO A;  3SEE A;  4B3N A;  4LEJ A;  2JEN A;  3LIG A;  2ZGL A;  1NCR B;  4LO4 B;  1S0I A;  4HL0 A;  4ET7 A;  1US2 A;  4XPV A;  4G4F A;  5BNP B;  1BYH A;  1ZM1 A;  3OEA A;  4A45 A;  4FAG A;  3KGL A;  2MEV 1;  4JRA A;  1O8S A;  3TB0 A;  1NQJ A;  1US3 A;  1GSL A;  1RUG 2;  1QOS A;  4PJY A;  1OUS A;  2WN3 A;  2CSG A;  1OKO A;  2KA3 A;  3ACH A;  5L7O B;  3ZYB A;  4BM8 A;  1ZZC A;  4UFK A;  3CJX A;  1Y9G A;  4PCR A;  2VOT A;  3N9O A;  3ZYR A;  5IK4 A;  2JG8 C;  4Q4V 1;  4LKD A;  3ZYG A;  3AYE A;  2D3S A;  1BKZ A;  4OMC A;  5HBA A;  1V0A A;  2WO7 A;  5E1R A;  4HON A;  2HWD 1;  4QPG B;  2X53 S;  3ZXA C;  1E5I A;  2AEZ A;  2C26 A;  4JKL A;  4WM8 C;  3HR9 A;  4DUX A;  5HXM A;  4XHX A;  3AMN A;  2HBT A;  5L7O A;  3WT3 A;  2YBS A;  1DLC A;  4E8D A;  3BAL A;  3ZXD A;  4E8C A;  3MEP A;  2DUO A;  4Y1U A;  2PHD A;  5JOY A;  1D0H A;  3AP6 A;  1AX0 A;  1WCU A;  2VOW A;  4LBJ A;  1SLB A;  4CDQ C;  1RUD 1;  4Q4X 3;  3PVE A;  4Y4R A;  1WZX A;  4DEV A;  1PZ8 A;  3AZY A;  4LPL A;  2VMG A;  3WW2 A;  3HOB A;  4BIO A;  4QB2 A;  2HYK A;  3RS6 A;  5C3S A;  1GNH A;  1ZRR A;  3ZMO A;  1DZR A;  2Y6H A;  3KT4 A;  4GWN A;  4UW4 A;  5DAX A;  1BVV A;  1CZS A;  1ZZ9 A;  4FFG A;  4IET A;  4PIX A;  1VRH 2;  5T55 A;  2R6Q A;  4NVP A;  4Z1V A;  4UXA A;  5JOW A;  2JD9 A;  4ASL A;  1C3H A;  3I2F A;  5JR2 A;  2ZX4 A;  4IDZ A;  4K20 A;  4AHW A;  4N8M A;  5FZL A;  4DIQ A;  3VD4 A;  4QHZ A;  1K5M A;  5CIS A;  3OB8 A;  1QWR A;  1SQ4 A;  3LA7 A;  1JYI A;  1P8J A;  4TSV A;  1Y7B A;  4LLF A;  1WBF A;  3AZW A;  4JDO A;  4H7M A;  5FY0 A;  2QFE A;  4FI9 A;  2XUM A;  3VZN A;  3BPZ A;  5A7Q A;  3SQO A;  1UY0 A;  4XDQ A;  2FDI A;  4GXL A;  2Q1F A;  3WV6 A;  5KHH A;  4BK5 A;  3WCS A;  2GN3 A;  2AC1 A;  5A1F A;  1QHD A;  5LZ6 A;  2O14 A;  5FRA A;  2WSU A;  2WAB A;  4LA2 A;  1OD3 A;  3IAP A;  4C1W A;  1K5M B;  2RVA A;  1TNR A;  1QJE A;  3LDK A;  2RS3 2;  4O65 A;  1UY1 A;  1KS5 A;  2ZEY A;  3TN9 2;  2WRA A;  2HLE A;  2ZHL A;  4JHT A;  2RS1 2;  3WP4 A;  4H2A A;  3J8F 3;  1COV 3;  1POQ A;  1CON A;  1IPK A;  1RIT A;  4AI8 A;  4BCU A;  3F95 A;  2YGM A;  4BU2 A;  4YAR A;  1N3P A;  1PX4 A;  3C7H A;  3VHR A;  1UAI A;  1IS5 A;  3LEG A;  1YC6 1;  3VKM A;  4DMI A;  1RUO A;  3O7O A;  5C8W A;  1YI9 A;  1S0D A;  1IZ3 A;  3OBR A;  1RMU 3;  1YXW A;  3N4M A;  3BIW E;  3ZOI A;  5LY1 A;  1DGR N;  3RZZ A;  1SLI A;  3K77 A;  1UCX A;  1WD4 A;  2RMU 1;  1F9K A;  2QDR A;  1TG7 A;  1QJX 1;  4Y33 A;  5FXZ A;  4A41 A;  4D69 A;  1S0B A;  3WW4 A;  2W1W A;  4AAX A;  2X29 A;  3WNK A;  2D6M A;  3Q8B A;  5FWJ A;  5E8A A;  4QPW A;  3W5M A;  2RDQ A;  1BMV 2;  3M3E A;  4IE5 A;  2VZT A;  3H3Z A;  5FYT A;  4WV8 A;  3TN9 3;  4AYU A;  4E4Z A;  1PO1 1;  4YZ5 A;  4A6S A;  2DF7 A;  1RUG 3;  3B93 A;  5EJ3 A;  1F15 A;  2JG9 B;  2OQ6 A;  3RJ2 X;  1VRH 1;  2WIN B;  5E89 A;  1ZX5 A;  4Y1V A;  1VMF A;  4QQL A;  1OXC A;  2DCZ A;  3UJO A;  2UY9 A;  2HWC 2;  1NX9 A;  2IXH A;  1CAV A;  2W52 A;  3IZO A;  5FZO A;  1UL9 A;  3ABZ A;  3WCR A;  2RG4 A;  4CXX A;  3ZYI B;  3ZIW A;  4LJH A;  2YMZ A;  2X5I C;  1XNT A;  5DG2 A;  2Y6J A;  3SIS A;  4LTA A;  2H6C A;  2B5H A;  4UT5 A;  4YGD A;  2EAA A;  4CPB D;  4KGG A;  1K42 A;  3WDT A;  2EIB A;  2W92 A;  3AX4 A;  1JZ8 A;  5LBE A;  4QKN A;  3WP3 A;  2EF6 A;  3UKV A;  2BGO A;  4JCK A;  3CJI A;  2PHW A;  5KXC A;  5FMB A;  3MI8 A;  1AF9 A;  2TNF A;  5DAQ A;  5DN2 A;  1PGS A;  4CDW C;  3GCX A;  5FZE A;  2FDJ A;  1Q43 A;  2Y0O A;  3E97 A;  2OYZ A;  1ZRI A;  1YQ2 A;  3WP6 A;  1H0B A;  1S0J A;  2DCT A;  5JWP A;  1GU3 A;  4E4S A;  1NUK A;  3A0N A;  3KB5 A;  2SLI A;  2HKX A;  1D0G A;  1UOB A;  2GAL A;  1N3Q A;  4UFI A;  3R6S A;  4C90 A;  3DL3 A;  5FYB A;  4NAM A;  2LTN A;  1UXZ A;  1PMJ X;  3CJI B;  5D2A A;  2ZX3 A;  3E5X A;  3NQH A;  2XON A;  4EN7 B;  5A3M A;  1OLQ A;  1XYP A;  3MIC A;  3SLI A;  4PT6 A;  1IOA A;  1V6M A;  1JHJ A;  1LHO A;  4LHS A;  4RR3 B;  1I3H A;  4YW4 A;  1ND2 A;  2RE9 A;  3VLB B;  5FR3 A;  2PLV 3;  3S6P A;  3KLS A;  4CEY B;  2P6C A;  3ZXG A;  3BU7 A;  3CZJ A;  2DCY A;  2XL7 A;  1AXZ A;  3CKH A;  3MW2 A;  4JGZ A;  1CR7 A;  1H30 A;  3OJB A;  2JG8 A;  2MEV 3;  4BE3 A;  3TNP B;  1R08 1;  2PAK A;  2A5Z A;  1QJX 3;  1PIV 1;  1RUC 3;  2Y8K A;  2OII A;  3KT7 A;  5DQ0 A;  4AI9 A;  4K9S A;  1MS4 A;  1S4C A;  2E31 A;  2J7M A;  3EXU A;  3MYX A;  1LOG A;  1MS0 A;  3III A;  5BY5 A;  4KWJ A;  3BU0 A;  1W3V A;  1SFP A;  1TME 1;  4Y24 A;  3RMY A;  5H9R A;  2VNG A;  1JZ7 A;  4Y26 A;  3MF6 A;  5C4W C;  4NPL A;  4MHU A;  2CGO A;  2KD7 A;  3RYR A;  2O8O A;  1COV 2; 
#chains in the Genus database with same CATH homology
 3WF0 A;  2WO1 A;  2J1V A;  1UWW A;  2QQK A;  3UNP A;  3IAQ A;  3ACI A;  5CYY A;  2VC9 A;  2ZEW A;  1CX1 A;  1GOF A;  4YPJ A;  4ZZ8 A;  1KEX A;  4Z2A A;  4OZO A;  1SG3 A;  2DCJ A;  3I2H A;  3AC0 A;  3HNY M;  4M4P A;  3J7H A;  4DEQ A;  3CIH A;  4JX0 A;  1UXX X;  2L9L A;  5HPO A;  4QX1 A;  3SEP A;  2VZQ A;  1JI6 A;  2E32 A;  5B4N A;  3I2J A;  2VQT A;  2WDB A;  3MUY 1;  3K46 A;  2W1U A;  2OKX A;  2DDU A;  2YC2 A;  3HNB M;  1O8P A;  2CDO A;  2VCA A;  4XZU G;  5EJZ B;  4L0P A;  2DCK A;  5JUV A;  1JZ6 A;  2W5F A;  1KGY A;  2XOM A;  1I5P A;  2VO5 A;  3C7O A;  4RYD A;  4XUQ A;  3P6B A;  5EIY B;  1OF3 A;  1GQP A;  2ZEZ A;  3T0D A;  2V4V A;  3WF4 A;  1ULO A;  2RV9 A;  5JMO A;  3NJX A;  4CUB A;  2VZ1 A;  3VD5 A;  2YC4 A;  5IHR A;  5B4X A;  4KMQ A;  1PMH X;  2J22 A;  1W0N A;  2YB7 A;  5LA0 A;  1GOH A;  3ZM8 A;  2QQM A;  1K3I A;  3DYO A;  2W94 A;  2W91 A;  4XUN A;  2JDA A;  2QQL A;  1LNS A;  3THD A;  1OH4 A;  3I3E A;  2ORX A;  3P1I A;  1XNA A;  4DUW A;  4P02 B;  1GOG A;  2VR4 A;  4CUA A;  2W3J A;  3HJR A;  2WQ8 A;  1H6X A;  3JXS A;  2ID4 A;  2B4K A;  3U37 A;  5DPN A;  2C4X A;  1SDD B;  3BGA A;  4MAD A;  1UZ0 A;  3WF1 A;  1L7R A;  4M4R A;  2WAO A;  1WCQ A;  3ACG A;  3T09 A;  2EIC A;  4KI5 M;  3EYP A;  5JXG A;  1HN1 A;  4QDR A;  3PUI A;  1GUI A;  1H6Y A;  1GMM A;  4ARY A;  3E1F 1;  2VCB A;  2VZO A;  3ACF A;  3LQC A;  1JYX A;  4CU8 A;  4UI9 L;  1JU4 A;  4CU7 A;  2VCC A;  3DYP A;  1UMH A;  4XUP A;  3WEZ A;  1W99 A;  4QDQ A;  2CDP A;  1UYX A;  4ZXE A;  4DUV A;  4UAP A;  5G05 L;  1W8N A;  2Y64 A;  3WQB A;  3VDA A;  4OYU A;  4XUR A;  2VJX A;  5IFT A;  1L7Q A;  1XPW A;  2JE8 A;  1UX7 A;  3A21 A;  3SKJ E;  4OUE A;  2J1S A;  5IFP A;  1UY3 A;  1JZ5 A;  4MGQ A;  2BBA A;  4QX2 A;  2YG0 A;  1UYY A;  2Z4F A;  3LEK A;  4LQR A;  5I0D A;  3I3B A;  4ARX A;  2QQO A;  3I97 A;  4XUO A;  2QQN A;  1CIY A;  4UOJ A;  2ZXQ A;  3IB3 A;  3MO4 A;  3W5N A;  3WSO A;  5JXH A;  1SHW B;  2J1A A;  3C7G A;  4JKM A;  2BZD A;  1XC6 A;  1JYV A;  2WO2 A;  1DP0 A;  2HYX A;  4A42 A;  1R64 A;  5LCW L;  2X10 A;  3WNP A;  3K4D A;  2J1U A;  2VZ3 A;  1NAE A;  5FUI A;  1F4A A;  4DXT A;  3LEI A;  1UYZ A;  3CMG A;  5CZK A;  3A7Q A;  2W47 A;  1CZT A;  1W9T A;  2WN2 A;  3ETP A;  3WNN A;  4D0Q A;  2W95 A;  1MPX A;  2Y6L A;  3T0A A;  2E26 A;  2EIE A;  3LE0 A;  4XVH A;  5C70 A;  2J1E A;  3BN6 A;  4TTG A;  1ULP A;  4QB6 A;  4MO3 M;  3HNM A;  1EUT A;  2W46 A;  4CUC A;  5LA1 A;  3CZU A;  4QAW A;  2VMC A;  3I2G A;  2C9K A;  2BGP A;  1F4H A;  2Y6K A;  3OG2 A;  3SEE A;  4JHZ A;  1PX3 A;  2WBK A;  4ET7 A;  1US2 A;  1UMI A;  1JZ3 A;  3OEA A;  4A45 A;  4DXR A;  1O8S A;  2WZE A;  3DYM A;  1US3 A;  3VDB A;  3VD3 A;  2VMD A;  4ZY9 A;  2WN3 A;  3T2O A;  3ACH A;  2VZP A;  4BXS V;  2VOT A;  3I2I A;  2X09 A;  3A23 A;  1D7P M;  3OGS A;  5JXI A;  4OMC A;  3D3A A;  4OMD A;  3T2P A;  4P08 A;  2VTF A;  4A3Z A;  3ECQ A;  4JKL A;  3K75 B;  2C26 A;  3A22 A;  2W1Q A;  1JZ2 A;  4DUX A;  2WYS A;  4DXS A;  1UY4 A;  5HXM A;  1EUU A;  1OF4 A;  1DLC A;  4E8D A;  4E8C A;  4JKK A;  1JYN A;  3LPG A;  4DEV A;  4GWJ A;  4LPL A;  4RN5 A;  3HOB A;  4QB2 A;  2W1S A;  2VQU A;  2J1R A;  2Y6H A;  2QQJ A;  2JKX A;  3C7E A;  1CZS A;  1W8O A;  4CVU A;  2JD9 A;  3I2F A;  5JR2 A;  1IQD C;  5LA2 A;  1RYY A;  2YFZ A;  5A1A A;  3CQO A;  4TXW A;  5DMY A;  3VD4 A;  3OBA A;  2PQS A;  3OB8 A;  1K12 A;  2WUH A;  1NKG A;  1W9W A;  2WO3 A;  4W50 A;  1P8J A;  4MGS A;  1K45 A;  2YFU A;  1W9S A;  4FI9 A;  4QB1 A;  3NJV A;  1UY0 A;  3T0B A;  2LS6 A;  4W4Z A;  4GZ9 A;  3CDZ B;  2WAB A;  3SKV A;  3WF3 A;  1OD3 A;  3IAP A;  2RVA A;  3T08 A;  1J84 A;  3K4Z A;  1UY1 A;  2RJ2 A;  2ZEY A;  3FL7 A;  2HLE A;  2VZV A;  2V5D A;  4XUT A;  2X05 A;  3FHQ A;  1GNY A;  3WNL A;  2VME A;  3FHA A;  1JYW A;  2WZ8 A;  3C8X A;  1PX4 A;  4A4A A;  3C7H A;  3F2Z A;  3LEG A;  3LPF A;  3DEC A;  4P00 B;  3WNM A;  4A44 A;  3HEI A;  4A6O A;  2V72 A;  3MBW A;  3K77 A;  4MOA A;  3UET A;  3GGL A;  1TG7 A;  4A41 A;  4KWU A;  2W1W A;  4AAX A;  2VMF A;  3WNK A;  2VZU A;  4QDS A;  4QPW A;  3THC A;  3W5M A;  2VZR A;  2R7E B;  2VZT A;  3MV1 1;  3EB7 A;  3HN3 A;  2J1T A;  2QQI A;  3K4A A;  5IJR A;  4PF1 A;  4CU6 A;  3C7F A;  2LW8 A;  4W8J A;  1NX9 A;  3ABZ A;  2ORZ A;  5G04 L;  4CU9 A;  1BHG A;  4P5Y A;  1JZ4 A;  1XNT A;  5C7G A;  2Y6J A;  2VL4 A;  3HPN A;  1T2X A;  2XQX A;  4BJ0 A;  1K42 A;  2XHN A;  1TVG A;  2EIB A;  4IUG A;  2W92 A;  1JZ8 A;  3VD9 A;  3FN9 A;  2W87 A;  2BGO A;  3VDC A;  3OGR A;  3NNG A;  4AG4 A;  2VM9 A;  4D8M A;  3GXU A;  3I3D A;  3OEB A;  3MUZ 1;  2BER A;  5DN2 A;  4QX0 A;  1UY2 A;  4LKS A;  4BK5 A;  1CZV A;  1YQ2 A;  2W9X A;  3GM8 A;  1GU3 A;  5JXJ A;  1NUK A;  3MV0 1;  1OT5 A;  1UXZ A;  1PMJ X;  4BK4 A;  3NQH A;  2XON A;  1DYO A;  3OGV A;  4PT6 A;  1O59 A;  1JHJ A;  5IYY A;  4ZZ5 A;  4LHS A;  3IDA A;  2WAA A;  3NRU A;  1WKY A;  1J83 A;  3I2K A;  5F7U A;  3CZJ A;  3CKH A;  2EID A;  4QX3 A;  4GWI A;  2B9V A;  3VD7 A;  3WNO A;  5EJ1 B;  2Y6G A;  2Y8K A;  4HG6 B;  2ZEX A;  5DQ0 A;  1JU3 A;  3GDB A;  2VZS A;  2E33 A;  2E31 A;  2J7M A;  3III A;  4PQQ A;  5C71 A;  4BDV B;  1JZ7 A;  5J1X A;  3WF2 A;  3PUH A;  2KD7 A;  2QBX A;  3UES A;  3T2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...