2V4VA

Crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
QSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYTVYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTVSGVTGKHDVYLVFKGDSGYLFNLNWFTFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analysis of the Structural and Functional Diversity of Plant Cell Wall Specific Family 6 Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
molecule keywords GH59 GALACTOSIDASE
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2v4vA00
2J1AA 5JUVA 3UNPA 4LKSA 3ZM8A 4E8DA 1W8OA 4GWJA 3K46A 4GWIA 1IQDC 2Y6HA 4D0QA 2QBXA 1UY0A 4XUPA 4CU8A 2X09A 2X05A 3GGLA 1P8JA 4JKMA 1J84A 1W9SA 2VZTA 2LS6A 4P00B 2W1SA 3HNBM 2VZ1A 3T0BA 4PF1A 5C7GA 4D8MA 2E26A 1XC6A 1NAEA 4HG6B 2VZOA 2BGOA 3C7HA 4PT6A 1NUKA 3ACFA 3P1IA 1JZ8A 1CX1A 3VDCA 2W1WA 3CDZB 2QQOA 2X10A 3P6BA 2CDOA 1UY2A 1UXXX 3OEBA 3T2QA 3K75B 1JYVA 2YG0A 2C26A 3I2GA 2JE8A 5JXGA 1JZ2A 4MO3M 1JHJA 5G04L 5C71A 2QQJA 2J7MA 2YFUA 2Y6JA 2VCBA 2JDAA 1OD3A 4DUWA 3WNLA 2WAAA 1JZ7A 2WYSA 1UWWA 3ABZA 1OF3A 1JU3A 2VOTA 3LEGA 4QDRA 1GNYA 2VC9A 2BGPA 1HN1A 4QX3A 4A6OA 1LNSA 2VCAA 5JXHA 1JZ5A 1T2XA 4A3ZA 2V5DA 3LPGA 1GMMA 2VZQA 3DYPA 3K4DA 5EIYB 2VZUA 4QX2A 3NJXA 2E33A 1US3A 4GZ9A 4W8JA 4YPJA 4CU9A 2JD9A 1CZVA 1KGYA 2WZ8A 2QQIA 2WO2A 1WCQA 2VR4A 2W1UA 4MOAA 3UETA 1UMIA 2R7EB 3A22A 3OGSA 1UYZA 1I5PA 5IJRA 3MUY1 1W99A 1O59A 3HNYM 2RJ2A 2VTFA 2WAOA 1D7PM 4QB6A 4CUAA 3A7QA 4A45A 2B4KA 2VL4A 2WDBA 3T09A 3OEAA 2C4XA 3ACHA 4BK5A 3WEZA 2VM9A 4KMQA 4UOJA 2WN2A 5IHRA 4JKKA 2CDPA 5JR2A 2QQNA 2VMEA 2Y6KA 2W91A 4A4AA 2VQTA 3C7EA 3I2IA 3NRUA 5DMYA 3C8XA 1OF4A 3MUZ1 3WF4A 4ARYA 3U37A 1XPWA 2L9LA 2XONA 1PMHX 4BDVB 2EIEA 4MADA 3ECQA 5JXIA 3I3EA 4A42A 1JYXA 1K45A 1O8SA 3A23A 4M4PA 3WQBA 3NJVA 4ET7A 1H6YA 3T0DA 3ACGA 4P5YA 4DXRA 5J1XA 3WF2A 4QDSA 3CIHA 3FHAA 4DXTA 2Z4FA 3D3AA 5A1AA 2VZVA 4QB1A 3WNKA 3W5NA 2ORXA 2J22A 4XUNA 4PQQA 2YC2A 1F4HA 3MV11 4XURA 3I3DA 3I2FA 3K77A 4QDQA 2Y8KA 4A44A 3VD4A 3ETPA 1WKYA 3FL7A 3MBWA 5LA1A 5G05L 2XQXA 1JYNA 1XNTA 4MGSA 3C7OA 1YQ2A 3WF1A 1RYYA 2W46A 4MGQA 3MV01 3T0AA 1GOHA 2LW8A 2WN3A 1K12A 2J1EA 5I0DA 2ZEYA 4XVHA 4LPLA 4AAXA 4OYUA 3DYOA 3CQOA 4DUVA 4OUEA 1US2A 4CU7A 2QQLA 4ZZ5A 2J1SA 4LQRA 2BBAA 4RYDA 1PX3A 4RN5A 5LA0A 5F7UA 4UI9L 3MO4A 1OH4A 1W0NA 3HOBA 4XZUG 2W95A 4QPWA 2YB7A 5FUIA 2Y6LA 4JKLA 2DDUA 4ZZ8A 3AC0A 3HJRA 4JHZA 1MPXA 4FI9A 3VD7A 3WNOA 1UY3A 3E1F1 2W9XA 1W9TA 4P02B 2J1VA 3CZUA 1K3IA 2DCJA 2VZPA 3I2KA 1PX4A 4KI5M 3T08A 2RVAA 3OGRA 1NX9A 1UMHA 1CZTA 3C7GA 1J83A 1XNAA 1GOFA 3A21A 4ZY9A 4QX0A 5DQ0A 2VMDA 3LPFA 1DLCA 2J1RA 3SEPA 2W92A 5JXJA 3I2HA 3FN9A 3THDA 3JXSA 1R64A 4TXWA 4W4ZA 2J1TA 3OBAA 4P08A 5JMOA 1OT5A 1W9WA 3WNPA 3SKJE 3C7FA 2PQSA 3CZJA 5EJ1B 3GM8A 1EUTA 1GQPA 2W47A 4CVUA 3BN6A 4OMCA 2B9VA 2XOMA 3T2OA 3VD9A 3DYMA 3BGAA 5B4XA 1JZ4A 2VZRA 3T2PA 3IB3A 1UY4A 2C9KA 1GUIA 2YFZA 3HEIA 4CUBA 1PMJX 3VDAA 4DXSA 3W5MA 4XUTA 1DYOA 2VJXA 2WBKA 3UESA 1ULPA 3HPNA 4QX1A 5C70A 1KEXA 4DUXA 4BJ0A 5DPNA 3OGVA 1UXZA 2VMFA 2EIDA 4OZOA 4BXSV 4ARXA 3WF3A 2VMCA 3VD3A 2QQKA 1GOGA 5IYYA 4UAPA 1O8PA 2RV9A 1NKGA 5DN2A 2V72A 3DECA 4ZXEA 1SDDB 2HYXA 3FHQA 2WO1A 2ID4A 3LEKA 4A41A 1F4AA 3EB7A 2DCKA 1K42A 2Y6GA 2ZEZA 3IAQA 4XUOA 4XUQA 1JYWA 2J1UA 2XHNA 3OB8A 3HN3A 1UYXA 4DEQA 1W8NA 4QAWA 2WABA 5IFTA 1EUUA 3GDBA 1JI6A 1TVGA 1DP0A 1JZ6A 2Y64A 1SG3A 2WQ8A 3K4ZA 3HNMA 2VQUA 3ACIA 2QQMA 1TG7A 2VCCA 3THCA 3SKVA 3WNMA 3I97A 4LHSA 5EJZB 3CMGA 1JU4A 2BZDA 2WO3A 4CUCA 2VZSA 2W5FA 3WNNA 3LE0A 2ORZA 2W1QA 3LEIA 3J7HA 2OKXA 3GXUA 4CU6A 2YC4A 1BHGA 2V4VA 2W3JA 2EIBA 5IFPA 2WZEA 3PUHA 5HPOA 1UX7A 1JZ3A 2EICA 3SEEA 4JX0A 2VZ3A 4IUGA 3VDBA 1CIYA 2W94A 1UYYA 1CZSA 2E31A 2BERA 2KD7A 3CKHA 5B4NA 2VO5A 3F2ZA 3LQCA 4KWUA 2ZEXA 4DEVA 3K4AA 5CZKA 2ZXQA 3IIIA 4L0PA 4M4RA 4OMDA 5HXMA 2HLEA 4Z2AA 2WUHA 3I3BA 3VD5A 2JKXA 3I2JA 3WSOA 4QB2A 1UY1A 2E32A 4W50A 1SHWB 4TTGA 3WF0A 5CYYA 3IDAA 1L7RA 1GU3A 2ZEWA 1L7QA 4BK4A 5LCWL 4AG4A 1UZ0A 3IAPA 1ULOA 3PUIA 2W87A 3NNGA 4E8CA 5LA2A 1H6XA 3EYPA 3OG2A 3NQHA
chains in the Genus database with same CATH superfamily
2VUJA 5FP9A 3INAA 4QU2A 1QJX1 1VBB3 1ZM1A 4I0BA 1LHOA 4XIOA 1W8OA 5IK4A 2JDYA 2O8QA 4BWOA 4CYDA 2F17A 5A3MA 5LEKA 5FYIA 1VE0A 3I2DA 4XF9A 2PLV1 2Y6HA 4D0QA 4EJRA 5FZ6A 1XSRA 4K40A 3LF7A 4XUPA 3VBOA 2X09A 1A8MA 3L9JT 4GB31 1OKOA 4JAAA 3SITA 1OBNA 1P8JA 1W3VA 4JKMA 3UKVA 3AFKA 1UN1A 1XE8A 1OI6A 2LS6A 4P00B 4B4PA 5IAXA 5BNPA 5KWRA 3T0BA 1OURA 3ETQA 2OT7A 5HI0A 1R1ZA 4DXZA 2XL9A 3USUB 5C7GA 4CDWA 4D8MA 4GH4C 1B09A 2GU9A 2SLIA 3LDRA 5FTTC 4AW7A 5BNOB 1XC6A 1NAEA 2WSUA 1LKNA 4JGZC 4YW5A 4AEDA 1UOGA 2GMEA 4LHLA 4ASKA 1NUKA 1XNCA 4Q8LA 2W68A 3P1IA 1JZ8A 1I5ZA 2DFBA 3AMMA 1NY72 4HKLA 4N9HA 3RZGA 1XNDA 1DU3D 3PHMA 1JXNA 1CQ9A 2WLQA 4P9LA 4OZXA 4P9WA 3GBGA 3QH7A 1WCUA 5GZCA 4Z2WA 3B9IA 2RMU3 3FHIB 3OF1A 1PZ8A 3SH3A 1YWKA 4UFKA 4YVSC 4W6WA 3AZYA 4D7TA 1RUD1 1S0IA 1LCLA 1XRUA 4CDQB 4DY3A 4NVPA 2P4EA 5CG8A 1LB2A 2DU0A 3HWJA 4E9KA 5C71A 2JG9C 1E5IA 5FYYA 1VLNA 1AYN3 2D6LX 2VCBA 1VP6A 2JENA 2Y6JA 3OY8B 4UT5A 1YJKA 3R6SA 2CU5A 4DUWA 1JOPA 3WNLA 2JDKA 3R0RA 3TOJA 5T55A 4OHYA 5D21A 3MFAA 2GAUA 1GZWA 5C4WB 2VOKA 2XKPA 2WLPA 2JDHA 3AMPA 1ULDA 4PBOA 2VC9A 2Q1ZB 2AR6A 3LKJA 3Q8BA 3K51A 4K7JA 3SISA 5FZ3A 3VLBB 4RFT0 5JXHA 1FAYA 1QF3A 4GA9A 3PVBB 1T2XA 1NCQB 1UCXA 1W6OA 1S0JA 4A3ZA 1GMMA 4XJAA 2VG9A 4XXAA 3U10A 4BISA 4ZXKA 1MS9A 4WM8A 1QOSA 4G9SB 1H8TB 3AJZA 1AR81 2VZUA 2VE1A 1X8EA 5KC6A 3LD8A 2E33A 5C8CA 3MLJA 2ZMLA 5FLJA 3EBRA 3O12A 4QKNA 4W8JA 5IUQA 2ETEA 3SC7X 4XC9A 2JJ6A 5L73A 3MLLA 4GB33 3AP9A 3U1XA 1PO21 3OPZA 1YRZA 1NCRB 2W1UA 5A3LA 1BKZA 1CAVB 3OGSA 3JD71 1N1SA 1ASJ3 2G1MA 2NQYA 1ZREA 1DQ2A 1DLLA 4FFIA 1I5PA 1R092 3FFZA 1AHSA 3C3VA 4EZ4A 5A6ZA 3T1MA 1W99A 4AVBA 4QM8A 4AVTA 2F6BA 2R30A 3HNYM 4QQOA 5AFEA 1W6OB 2VTFA 1JW6A 2BNMA 5AC92 3MPPG 4JTOA 1UZVA 1OLQA 4GMP0 5BNNC 3PU3A 4J1WA 2GN3A 3VKNA 2CL2A 4CUAA 2AUYA 3A7QA 3MEPA 1RVF3 4NIAA 3S5QA 4ZONA 1H4GA 2FDJA 3LZZA 4Q4X2 1CPNA 1MZ6A 3MF6A 5F1RA 1AYM3 3VKMA 4COUA 3AKTA 4I2OA 4CCCA 4IEZA 4IGPA 3OUJA 2A70A 3M3QA 3QBQA 4FPFA 4V2VA 4CEYB 2B45X 1RXGA 2WN2A 1FPN1 1JMUB 3LA2A 4PJYA 5CFCB 3SLIA 2VVFA 1W2OA 2Y6KA 4BM8A 5A1FA 3OYWB 1SFNA 2FDFA 3D4KA 3I2IA 3N7JA 4FTSA 3WQ1A 3FBYA 2C9AA 2YU1A 4D6SA 3MUZ1 3FBMA 2B46X 4P14A 1GWLA 5AVAA 4ARYA 1S0GA 2XONA 5GKAC 1RUF2 3HVDA 2A6XA 2XG3A 2MHFA 2YROA 5D8AA 4UXAA 4YZ5A 2W0XA 4LKEA 2EA7A 3ZYRA 1ST8A 3POBA 5JXIA 2R041 1D2QA 2W52A 4QD2A 1LOFC 5I0RA 3I3EA 1ZZ6A 4KH9A 4S2DA 1UZWA 4FPJA 4P9IA 1TEIA 1PVC3 1K45A 3E97A 5A32B 1W05A 4M4PA 2A3WA 3WQBA 1PIV2 3RYPA 4AFCA 4TLGA 4X6QB 3VBFB 3O1MA 4IEPA 2RM23 3KLSA 1UMZA 2TEPA 4XACA 4K21A 4P5YA 4UF0A 5KHHA 1AZDA 3WDUA 1DBNA 4N90A 1A78A 2CV6A 2ZGKA 4XHXA 4DXTA 4M01A 4RGAA 2WS93 1LAJA 1UNBA 3D3AA 3N9MA 3VBOB 4XDOA 1SEFA 1M4WA 3CHXA 4FPEA 4XEZA 1H8TC 2E53A 4GD4A 3T3YA 3EO6A 4LO7A 3W5NA 3KT4A 2VPVA 2J22A 2FCUA 3DPRC 4XBQA 3WNXA 3ZYHA 3IN9A 1UO9A 5FXWA 1ND2A 4XW3A 1F4HA 5C5UA 4FOQA 4Q5OA 3ZYIB 3I2FA 1YCIA 4SBVA 1G8WA 4QGNA 4QWNA 1WGPA 4AEDB 4ZU4A 5FZOB 2E7TA 4WM7A 5DZGA 2XGXA 3VD4A 4S2FA 5FZ1A 4Y22A 4GMP3 4O65A 1AX2A 4Q4W2 4PIXA 1L3JA 2QE3A 3FL7A 4XTPA 4JRAA 5ABJB 2WNVA 5DZFA 2GSYA 2JB4A 2HYKA 3DN7A 4B1LA 4M3CF 5LA1A 3ES1A 5DDJ2 2AC1A 1VB4A 1BEV1 4ATEA 4MGSA 4OQ8A 1QXRA 1JOJA 3IPVA 5FY9A 4COWA 3I7DA 5IVBA 3J8F1 3I2OA 5J3UA 1V6IA 2WFF3 1POV0 3I3QA 5HCBA 4WVMB 4GIQA 1KRIA 1Y7BA 2HWE1 4YGBA 2OW4A 1SPPB 2ZGNA 2YGLA 4EN6B 4AHWA 1UOFA 1K12A 4LBQB 5CAZA 4RSUA 5FPVA 5FZMA 3KMHA 4LOSA 5IVVA 1ZBE3 5KXDA 4AZZA 2IXHA 4LPLA 3U75A 1UZZA 2P34A 4EQVA 1N3QA 3LA7A 2Q8EA 4FOYA 2BBAA 1IPKA 4XQ4A 1NT0A 1PX3A 4RN5A 3WDWA 2DUQA 2GNTA 4Y33A 3VKOA 3ZMNA 2VUCA 2ZMNA 2Q5TA 4CDQA 2R32A 4B29A 1HV0A 3AP7A 3L2YA 4RHV2 3WW3A 5KXEA 3KGLA 4LT5A 2YB7A 4PDWA 1V9U2 3I54A 3H1YA 4KQ7A 5FBZA 2GC3A 1NQDA 3W59A 4AFAA 3I8TA 3HJRA 4QMAA 3ENRA 4UW5A 4ORFA 2YBPA 4KNCA 2ZAHA 4P5HA 4XBNA 4JHZA 5FPAA 4D7SA 4FI9A 4LBQD 1ZZCA 3WUCA 5LEJA 3HQUA 3OD4A 5AVPA 3M3CA 1UY3A 3E1F1 4DOUA 1PO23 4QKBA 1DZRA 1UU6A 1W04A 2ZX1A 5FJHA 3WVJA 1OUSA 3NMBA 5FK8A 5FZCA 1CAXA 1FMD3 4W65A 1X9TA 2JIJA 2A1XA 4B4RA 2LALA 3WG4A 2AZ5A 5JDBA 1PVC2 1D4M1 3OGRA 3DL3A 1MVQA 5M0TA 2MPFA 4LUKA 3EQEA 4ITCA 3ZXJA 1HX6A 4KG8A 2JXAA 2Q8OA 3TNPB 4A3XA 2H0BA 5FZKA 2OPWA 4QX8A 2XJVA 2DVGA 2RS11 3RSJA 3WDXA 4JGYA 3SEPA 3JB4C 1B35B 4NPMA 4QT6A 4WZCA 4X8PA 2WWSA 1DQ4A 3BOWA 4RD7A 4E27A 3GCXA 3NKGA 3PNAA 1AR61 4LIVA 2JG9B 2PN5A 5KC5A 4IV3C 3SKJE 2ARCA 3C7FA 1JYTA 5EJ1B 5CFCA 4XJ9A 2HWB2 3V65A 2FDKA 4GXLA 3ZOIA 3IDBB 3OUHA 1GQPA 1RUH1 2XKOA 1AYN2 2W47A 3OPWA 2XLAA 2JDNA 4ISQA 3IT8A 4QU1A 4AI2A 1N3PA 1MZEA 5H9SA 3FUOA 1J1TA 2B9VA 4UW4A 4Y4RA 1YQCA 4NRPA 1KS5A 3PURA 2P17A 4ONUA 5DUVA 5FOBB 1JTZX 2A6WA 2PHFA 4YVWB 3WG1A 3MPBA 2VZRA 3O0WA 4XXPA 3T2PA 2ZX2A 4URAA 1U5ZA 1RMU1 1YFYA 4GWNA 2DFCA 3IB3A 3BIWE 3DKQA 1GUIA 4FFHA 2WT2A 4E2QA 5LB6A 1WA6X 3HEIA 1PMJX 3VDAA 1J58A 1QQP2 1XNBA 3W5MA 1V6NA 4XUTA 2CGPA 4RQPA 2D7FA 2B7YA 4EN0A 3SMHA 2WBKA 4Q0PA 1ZNPA 1WZXA 4DINB 1C8M2 4M3CE 2O14A 3WLUA 3RZLA 4Z8BA 1KEXA 2PAKA 4W6YA 5DPNA 5JPNB 4OZOA 2ZCWA 4BXSV 2ZA9A 4ARXA 3WF3A 1DFQA 2VMCA 3VD3A 3ZDSA 1H2KA 3KSCA 3PUSA 4L11A 2ZZQA 5GZDA 3KCXA 4IV3B 4KG0A 3VZOA 1O3QA 3DV8A 5FQ0A 2V72A 4YGEA 3ZXKA 1ND3C 4M0HA 3M3OA 5F5IA 4TSVA 2WO1A 4K1ZA 4AR2A 4A41A 1F4AA 1K42A 2Y6GA 5BNPC 4HXCA 2ZEZA 5GLTA 5DAWA 1AYM2 4MHUA 4LKFA 4CXXA 1CD3G 1ZA4A 3WR0A 5T5LA 4DEQA 1RHI2 3OY8A 5CFCC 1Q8VA 5FFOC 1W8NA 4QAWA 3KCYA 4DFSA 2VTXJ 3WT3A 1ONAA 2A73B 1FOD3 2WABA 1Y9QA 3LCPA 1BVVA 1HRV2 4JQRA 4XDQA 5C9AA 1UKRA 2VVDA 4FP2A 3SXWA 5JZGA 1EV12 2XJTA 5JI9A 2CGOA 1CGPA 4OCTA 1SG3A 1PIV3 2A3XA 4NHMA 4BXFA 3JB8A 3K4ZA 1ZZ7A 3RG0A 4A6SA 3ACIA 2WNVB 1QKQA 1HXS1 1TG7A 2LROA 4EWDA 2Z5WA 4IE7A 3TN92 1O3SA 1F35A 3O0XA 2V5YA 1K5MA 3Q8FA 3IPVB 2UWCA 1RGSA 4XCAA 3TNQA 3CMGA 1N1YA 2XL7A 2DVBA 3Q9OA 4GJYA 2VZSA 4C0BA 2W5FA 4NHKA 1DGLA 2WNUA 1GQHA 2W1QA 3ATGA 3MICA 4QQ2A 1A3KA 5C3OA 1BMV1 2OKXA 5A7WA 3GXUA 1REDA 4YFWA 1FV2A 3NNMA 3RMXA 3NJZA 3HN1A 2VU9A 4K1YA 4ZPIA 2EIBA 5DAVA 5FOJB 3O1RA 2WZEA 4JV4A 4TYSA 4XQWA 2XLFA 4YW4A 4BMBA 3VDBA 4J25A 4AVSA 1CAUB 4NWWA 4YW6A 1ODMA 4HN0A 3SCFA 5JWPA 5FDBA 4RGGA 1HIXA 1OLRA 4AOCA 4MH0E 4DO0A 5A1LA 2VGDA 2Y0OA 4R4XA 2JEMA 4K8RB 4Q4Y1 1GSLA 4CEWB 5C6CA 2B8MA 3SCGA 4N43C 3ZR5A 4F3JA 1ZBE2 3LQCA 4C91A 4IQPA 1TMF3 1UIKA 2DV9A 4YM2A 2BFUL 3TEZA 3ZO0B 1X8MA 1R1A2 3QH6A 4R52A 1VBC2 4OULA 2AENA 4Z2AA 2ZX4A 3I3BA 3ZYJB 4IEWA 2BVVA 3MW2A 3V0BB 2QQVA 1VRH3 4W50A 1DYKA 1W8FA 4AHZA 3S5AA 4I02A 1FMD2 2ZX0A 3RYRA 1H1AA 1CIWA 5CYYA 1S2BA 1TME2 3IDAA 2F4LA 4Q4X3 1GU3A 1OXCA 4QPIA 3CJIA 3IAPA 4AG4A 3IDEA 2YPDA 3CEWA 2OXBA 2VUAA 3M70A 3UGHA 1OC1A 4ZKTB 1FYUA 4HBNA 3NNGA 4YW2A 1W03A 3M4FA 4E8CA 5LK7B 3EYPA 3OG2A 3GBFA 3NQHA 3UJQA 1O5UA 2JDMA 1SDWA 5FO7B 5JUVA 3JBG1 4LKSA 4PCRA 1RUI2 4E8DA 4QXBA 4GWJA 5F32A 5IW0A 3E5UA 5ACA3 3RI8A 1CAUA 1LOBA 5EZWA 4NWVA 4AGGA 2WFF2 3BODA 3DPRA 4CU8A 1LHUA 2X05A 1XE0A 4B8EA 1FOD1 2XJSA 2HWB3 3GBWA 1H8TA 2GN7A 2CAVA 4YGCA 1VBB2 4H55A 3T1LA 1HRV3 3JZVA 1FI2A 4LHKA 4EN8B 3VBUA 4FQZA 3KS7A 1UPIA 1W8TA 1YYNA 2E26A 2FCTA 5IVFA 3OSDA 1QJY1 2Z42A 1ZVFA 4HG6B 2VNOA 2VXRA 1RJ8A 2VZOA 3FLPA 2BGOA 3NL1A 3TBDA 4C8DA 5L7OC 1F8VA 2YU2A 3KHBA 1W2NA 3PU8A 2RG4A 5ABJC 3LEMA 3ZSEA 1VBA1 5F5AA 1TZOA 1TE1B 2ADDA 3ZMOA 1RUE1 2YMZA 2BNNA 4IETA 3P6BA 1ZBA2 3FMGA 4Y5TA 4OI1A 4CRQA 3WP6A 1UXXX 3T2QA 1YHFA 1KQRA 1OLME 2E9QA 3USSA 4Q0UA 3OBTA 1JYVA 2YG0A 3KWVA 2C26A 4NOTA 3I2GA 4N53A 4CDUA 2DF7A 2PMWB 1F31A 3FFQA 3KF5A 5J7MA 4YRDA 2RM22 4A7YA 2QFEA 5G04L 1OQDA 2FBEA 3IBMA 1IKPA 4FPGA 1AJOA 1VMFA 4OI4A 3W20A 2PAMA 4LO8A 4YW1A 1I9RA 4M0NA 2OQ7A 1EPWA 2G9GA 1HV1A 2QZ3A 4U2AA 1W28A 3LEGA 1GNYA 3WCRA 5IK5A 3UGFA 2WQ4A 1QQP3 4HL0A 3N9PA 1YNAA 2BTVC 3LFIA 2Q8DA 1LNSA 1OA2A 1XYOA 2A71A 2VCAA 3B3QE 1SCSA 4LMFA 1JZ5A 1OSGA 4MUVA 5L36A 3S7IA 1GNHA 2R072 4XFBA 4PDWC 5IYYA 1PGSA 5EIYB 4AQSA 1OA4A 4HSJA 3RWNA 4QX2A 3NJXA 4XDPA 2OZJA 4AL9A 2A6VA 1CESA 2HBTA 4GZ9A 1YI7A 4D3WA 1WW4A 2CY6A 1KGYA 4PF5A 4IE0A 3A0NA 1ZZ9A 4GJZA 4QPYA 1YI9A 2BVBA 2VR4A 5FYVA 1O5LA 1WLWA 3A22A 4KU8A 3APBA 4PLNA 5TSWA 5EHDA 1LR5A 4AVCA 4BPZA 1UYZA 1XU1A 2PHDA 2GDFA 3JUUA 5JMCA 3MUY1 3BPZA 4K6BA 1COV1 2ARBA 2OUJA 2XBO2 5DDJ3 5LZ6A 2C1FA 2C24A 2YV8A 3FC0A 3FX3A 2ZGOA 1ALYA 1OKQA 3QCWA 1QJX2 4LBOA 2D40A 2AEZA 2I45A 4FT8A 4K9SA 4Y24A 4B7KA 3NWKA 1D7PM 3FUQA 4QB6A 1T6BX 5FV3A 2OYZA 2RR12 5A33A 2JE9A 1JH5A 3IDCB 4K3UA 3T09A 4AWDA 5F2SA 2QUOA 1VBA3 2DUPA 2C4XA 2HWC1 2CHHA 3ACHA 4GB32 3WEZA 1R083 1DQ6A 2DVDA 3H1WA 4YARA 2C0ZA 4KMQA 4OHZA 3B5LB 4HVRA 3UKNA 5FPZA 2DBNA 3R05A 1W6QA 5IHRA 1LHWA 1REEA 3AMNA 4XMIA 1I1EA 2PA7A 4CTEA 5JR2A 3OTFA 3OGGA 1QJY3 1OUXA 3O1OA 3JCIA 2VQTA 2QTWB 3C7EA 3HAGA 1V70A 2IXKA 5DMYA 1WCKA 5FY0A 1OF4A 5JOYA 2ZKNA 5KHGA 3ZSJA 3U37A 2CAUA 2Y0IA 1XPWA 5T5PA 2WA3A 2R6QA 4QKFA 2HWD2 3VL8A 2EIEA 4F8AA 5BPXA 4A7ZA 1OMIA 3HQRA 1OOPA 2XMLA 1ENQA 2VW2A 5C8WA 5HCAA 3ECQA 5FP4A 3FLRA 3WOGA 5I93A 1AR83 1QOTA 5CVRA 5K0UC 2ZGMA 1O8SA 2QJVA 3BI3A 1REFA 4HVOA 4ZU7A 4RGKA 3P5BA 1BVP1 1HRI1 4DNYA 3O1SA 4DRVA 2ET1A 3CJIC 3AK0A 4Y1ZA 3KT7A 5JOWA 3SQOA 3ZSMA 4DQAA 5T52A 2YUEA 4FPKA 3CO2A 4GKYA 5FP7A 3IZOA 4LA2A 4DXRA 5J1XA 5FYBA 2ZKLA 2JD4A 4A2UA 3H42B 4FPHA 3T4HB 2Z4FA 5DUXA 1T6GC 1QJU3 1VJ2A 5A1AA 2VZVA 4QB1A 1WBFA 2HWC3 3WNKA 3KM5A 1AR63 3AVSA 4FAHA 2ORXA 1YQ8A 3MI8A 4XJ8A 2ZMKA 4OLLA 1Q56A 3UKTA 1WLDA 3BALA 1O3TA 5IVEA 1C1LA 1O6UA 4BQ2A 1VRH1 2YC2A 5C4WC 4XURA 3Q8AA 4BA6A 1C5HA 4N8MA 5CFDA 2ARXA 4XQDA 3BOPA 4AQ2A 1WMEA 4URTA 4MGTA 1X33A 3DPRB 4FVVA 2D6MA 4KWKA 4PI0A 3URFA 1PMIA 2VOXA 1TME3 1TMF1 3VV1A 5FIXA 1J1LA 4LBQA 2XVLA 3W58A 1IGOA 3E6CC 3MDPA 5G05L 3M1HA 1RUJ1 4NHYA 2JG8A 4L97A 3AVRA 3VKFC 5FZ0A 3JD72 4META 3ZXEA 4OHVA 5DAXA 5C9AB 1YQ2A 3RRDA 1RYYA 3WF1A 3TEYA 1B35A 1HB1A 1SQ4A 1WD3A 1X36A 3O1PA 3MV01 3T0AA 1GOHA 3D82A 4F7ZA 4LO6B 4NPRA 5E89A 2LM3A 3WDTA 5FR3A 1ODNA 1EAH2 2J1EA 3KZ4C 1BBT1 3M8LA 4YM1A 2BUKA 3FE5A 5B2GB 5KHIA 4AEJA 2JB8A 4XFFA 4XVHA 4B4QA 1BYHA 1VBE3 4B7EA 1J3PA 1PZ7A 1SBEA 1RUG1 2DUOA 4I30A 2R16A 3DYOA 4OYUA 3B00A 3AYDA 4Q0SA 1US2A 3CNAA 1G6NA 2BDRA 3AX4A 4YZ4A 3ZFGB 2QQLA 2J1SA 4RYDA 3LA3A 1Z7S2 4WBBA 2DVAA 3AP4A 5F7UA 3UV9A 5CADA 3AP6A 1W0OA 3TB0A 4IE6A 3ZSKA 2DCYA 5C8CC 1OH4A 1Q8OA 3HOBA 1ZA7A 1SLIA 4I01A 2BBVA 2FQPA 2TNFA 3LSDA 1PGL1 2XUEA 2Y6LA 4L9BA 5FZGA 5ANQA 3OBZA 4XJUA 1GZTA 1RITA 2DBIA 5FBJA 4J6GA 3BUCA 1RUF1 3LOIA 3NAPA 2ZGQA 3AKPA 1FATA 2JG8C 1LJ7A 1MPXA 1ND3B 1VBD1 3JBG3 3NV3A 3OYWA 4FQ4A 3VZNA 2D6PA 4D7YA 1FXZA 2WRAA 3VD7A 2Y33A 2W9XA 1GFF2 5FZFA 1TQ5A 5F3IA 5BNQA 2UY9A 1S0BA 1NOVA 4GWMA 4P9XA 1MACA 2O8OA 3CZUA 3FLTA 2WC2A 3MIBA 1ZYBA 3I2KA 1IQAA 5IWFA 4NIDA 1PX4A 4KI5M 1NYWA 3VDDC 5DG1A 1NX9A 1RUE3 4QQPA 2D6NA 2D5HA 1ASJ1 1HQLA 3FJSA 3ZKYA 4AF9A 3HT2A 2BGCA 1J83A 4XOGA 2JKBA 1SLCA 3PTRB 1W39A 4MV2A 1DIWA 1XNAA 1OQ1A 3W21A 1WBLA 3WD5A 4ZY9A 1HQNA 3J8F3 1QH6A 4S2HA 2RJKA 3OD0A 5FLIA 3LPFA 4LKDA 2J1RA 3O0VA 3FN9A 4TWTA 1C5IA 1W90A 2EXJA 1R093 4RR3C 1R64A 1Q5OA 1VAMA 4OHWA 4Q27A 4TXWA 4UWDA 4BB3A 5H9PA 3POJA 3PUQA 1UW8A 3OBAA 1ULFA 1M06G 5JMOA 1BXHA 2Q4SA 2VCMA 3WNPA 4NHLA 3VBRA 2WINB 3CZJA 2Q1FA 2KXLA 3GM8A 3WP4A 3H8OA 3PUAA 2IZWA 1CONA 3N9NA 3RMYA 4I0AA 4Y26A 1RUOA 2EXHA 1OHFA 1QH7A 1A8DA 1S1AA 1UPSA 2BWCA 4JGZA 5LBFA 3VHRA 4CVUA 4IL7A 4O7XA 5SV5A 3I59A 5K0UA 1LTEA 3NO8A 2DTWA 3AFGA 4YG0A 3ZIXA 1NCRA 4EE2A 3ZIWA 4Y20B 4IV1C 1JUHA 1TNRA 4EZHA 3B9CA 3CLPA 4OI0A 1JZ4A 5DDJ1 2EVXA 4FOWA 4B1MA 3VHOA 1LECA 5JOZA 5FMOL 2FZ1A 4PDWB 1J3QA 2C9KA 3J26N 2YFZA 1NY71 5AFBA 1JN2P 1YJLA 4QHOA 2XBO3 3EJKA 2G4IA 4LITA 3KD4A 1YIPA 4MXWA 2Y38A 5FYSA 4DXSA 2SBAA 2Z2SB 2FDIA 3QLQA 3KV6A 4IV3A 2JDZA 4Q4V2 3ZFGC 1D0HA 5JSOA 1V6LA 3NNLA 4CZSA 3UESA 5EFUA 2WJSA 4QX1A 1R081 1PM7A 5ANNA 5C70A 4DUXA 2QQWA 5D1IA 2EIDA 2QVSB 3WP3A 3I3MA 2YY1A 3MYXA 2DTYA 1COV3 2G9ZA 3N4MA 1S2EA 1AR92 3LDKA 2WWJA 3BVCA 4HLTA 5J37A 2JIGA 2K46A 1O8PA 1G9AA 3B94A 2RV9A 2VBBA 1APNA 1Y9MA 3DECA 3QACA 3DGTA 4ZXEA 5D8AB 1SDDB 4MLOA 4DRRA 1HN0A 5EXOA 5FZDA 3FHQA 2D98A 4O9GA 1GNZA 3WCSA 3ZKUA 2RMU2 2ID4A 2XJPA 4Z92B 1FV3A 1WMFA 3EB7A 4FFGA 1L7LA 3D0JA 3P3NA 2EAKA 3BU0A 4ZU5A 2J1UA 5LASA 3MIHA 1GANA 2BW8A 1QJU1 3DKWA 3JQWA 4XFCA 2EXKA 1E57A 1W6QB 4D6RA 3USUA 4L92A 4YLZA 4AGRA 4ASLA 5FY7A 1LESA 4AI8A 5IFTA 5DAQA 5FWEA 2ZTNA 5BNPB 1WWYA 4FAGA 1JZ6A 1NA1B 2B42B 3DCQA 1Q43A 1X82A 1Y4WA 1JOBA 2E7QA 3UYJA 2HH9A 2Z79A 4LK6A 2VQ0A 2VQUA 3VBSB 5KXBA 1DCSA 2XB6C 2VD7A 4FCAA 1GICA 1PGW2 3M3IA 4QX7A 3THCA 1AL23 1YEWA 5HV4A 3RYKA 4E4SA 4FFFA 4I0WB 1EY2A 3MLKA 3MHZA 2CWMA 1PK6B 3I97A 3JD73 2WNOA 4H2AA 2E6VA 4LHSA 5EJZB 3GZUC 1DGRA 2MEV2 2GMMA 2BZDA 1ENRA 2HEWF 4XZPA 1DG6A 5FP3A 5BV6A 5H9RA 2YBSA 3CF6E 4QM9A 4CCNA 4O9EA 2ADEA 3PVEA 5ERLA 1QGLA 1RTVA 5FXXA 1UU4A 1CR7A 1NE4A 3J7HA 4WVZA 1RUNA 5F5QA 2BOIA 4QGLA 1UZYA 4XFHA 5F5CA 3U07A 2FD8A 1DQ1A 1RUH2 2ZOEB 4RFRB 1BHGA 2V4VA 4N53C 2R1BA 3QD6A 1F2NA 1W06A 3PUHA 4O61A 3UJOA 1UX7A 3POEA 3WQ7A 4AFDA 5HPOA 4WV8A 3K2OA 4JX0A 4BCUA 4F83A 1XBFA 2WQZC 3AZWA 3O1UA 4BQXA 3H8XA 3WXPA 3ZFGA 4QXKA 4YFZA 3VHPA 5FJKA 1SACA 2PTMA 3D0SA 5K8SA 1LRHA 4H7MA 4BLJA 1NE6A 4JZRA 2GNMA 3Q8CA 3LDBA 2VO5A 4P9JA 2BPA2 5LW9A 1W0PA 3H50A 5CB7A 3ALQA 5A70A 1QQP1 1W2TA 3PIGA 2DURA 1O4YA 5CIRA 4AEMA 3IIIA 4L0PA 4M4RA 2A6ZA 4OMDA 5HXMA 2WO7A 4CEWC 3VBSC 3IKWA 1MQTA 2WUHA 3VBUC 5A32A 2JKXA 1MQTC 3WSOA 2OS2A 1PIV1 1W9YA 1QY4A 3H3UA 5GLVA 2JG8B 1ZZ8A 1U12A 1ACCA 4W6XA 4BK4A 5LCWL 5CISA 1Z7S3 1RVF1 3VBRC 1W6MB 2RHPA 5FP8A 3N7MA 3UL2A 3F95A 1VBE2 3PUIA 3ZYFA 3RZZA 2DVFA 4CCKA 4HPKB 1HJGA 2CNAA 5LA2A 1GQGA 2RS31 1S0EA 1HW5A 4RR3A 1S0CA 1N47A 1KJRA 2DWRA 2J1AA 4JCKA 1U0AA 4QQHA 4Y1XA 5FAXA 5GJ6A 1UKGA 3ZFEA 5J96B 3ZM8A 3UNPA 1WUVA 1CAVA 3N35A 2VTXA 3K46A 5D8AC 5LWBA 2YGMA 2ZGPA 4KBZA 2WNUB 4HONA 3GZAA 4HKWA 1RHI1 3KQ4B 5CNAA 2QBXA 1UY0A 1SBFA 4QPIC 2RS52 4C1WA 3AYCA 4J1XA 1LU2A 4XBLA 3N3HA 3HMYA 4XF1A 4ATFA 4UBHA 1HRV1 1RUI3 4LR4A 2W1SA 4NUBA 4Q4W1 1NZIA 5FYMA 2VZ1A 3VZLA 1DDLA 3ROUA 3T30A 1YIFA 1QHDA 1QJZA 1ULCA 2RDQA 3S30A 2BU9A 3PMEA 1AF9A 2BOJA 3AXEA 3VBUB 2VUDA 1HXS2 1OPOA 5I91A 3Q8EA 5CFDB 4PT6A 2IXJA 3J8F2 3IMNA 4LBLA 4XJWA 3TWIA 2Q0AA 3BKZA 4AVVA 1A6CA 3PVNA 5CG9A 1LGNA 4LK7A 3CDZB 4DS0A 4I3GA 3E5QA 4YVWC 5J48A 4PIYA 2Y6FA 2CDOA 4IV1B 5JIAA 1VPHA 3GALA 1UY2A 1OPMA 3KB5A 3EMRA 3TAYA 5C8CB 2ZGRA 3OEBA 3U4SA 1QNWA 1VAKA 2D44A 2QDNA 4YYOA 1Y3TA 3U11A 2JE8A 5JCTA 3VKLA 2NZ9A 2RS33 1NCQA 3MIFA 2VBDA 1DZTA 1HB4A 1JHJA 1KDKA 2KM2A 3DXUA 2QQJA 5I8YA 2FMYA 3ZFFA 4P9GA 1MVEA 2JDAA 1IHMA 1OD3A 4LBJA 2WZR3 1J3RA 2ZJCA 5FYTA 1BLZA 1UWWA 4AHXA 4AQTA 2BJSA 1OF3A 3BU7A 1JU3A 5FZHA 3GHMA 3VBHA 4QDRA 4XPVA 3OOXA 1N1VA 5GZGA 2ES3A 2A3YA 2AGSA 2WIIB 1OOPB 5FZEA 1ZBE1 4QX3A 2NMOA 1YFWA 3ZSLA 4CCOA 3AMHA 4PHZA 1H2MA 2V5DA 3LPGA 4FXGB 5A6YA 3BB6A 4UFHA 4EN9B 1VBC1 2E51A 2Z69A 2VZQA 3K4DA 3LFMA 3AL5A 3AM2A 2ZGLA 5A3OA 5BYNA 4HFSA 1D4M2 1WW6A 5IK8A 5CFDC 4YPJA 2JD9A 1FMD1 1V9U3 2WA4A 1CZVA 1W6NB 1ZBA3 2VW1A 2WZ8A 4YW3A 5LRSA 1DHKB 1FT9A 4XFAA 2D3PA 1G9FA 1VRBA 1WCQA 1F5FA 3TN93 1UMIA 2I74A 2R7EB 1RUG3 3KV4A 5JLVA 4JDNA 2PFWA 3EHKA 5IJRA 5FO8B 3SNMA 1IG3A 2YPJA 2VW0A 1O59A 2YZ4A 2ZAAA 1CPMA 2RJ2A 2EF6A 5J98B 2R073 2WAOA 1S0FA 4HANA 2LTNA 4YM0A 1EAH3 2A75A 2IVJA 5A3WA 5FPXA 4BU2A 1O4TA 1LOGA 3N9QA 3NV1A 4A45A 3B7MA 2P3IA 2VECA 2VL4A 2WDBA 4M00A 3OEAA 4YG3A 4D69A 5C3QA 1UU5A 4JDMA 2WZR2 1O91A 1OH3A 3B93A 4SLIA 5FMDA 3S0MA 1AL22 2IC1A 1KFUL 3OPTA 3ZR6A 2DCTA 1VBD3 2ZS6B 4UFIA 1GYKA 1QXPA 1LEMA 2CDPA 3BPSA 2OX0A 2W91A 4A4AA 3H0OA 1OQEA 1OOPC 1UQXA 3ZLIA 1AR93 4RQPC 4WVVA 2BNOA 3C8XA 4CEYC 4MVTA 1V00A 2L9LA 1PMHX 1MQTB 4BDVB 4IW3A 4MADA 3WV6A 1NA1C 4IEYA 1JUIA 2XJRA 3LGRA 2PHWA 3VDDA 2R043 5I0UA 1RUE2 1VMHA 2AACA 3KGZA 1MEC1 2GP3A 1C8M3 4CP0A 1LULA 3OCPA 4BE3A 4ISRA 4QHBA 3ZDVA 2R1DA 4Y3OA 5A3PA 1WMDA 3JQXA 3A23A 4LBMA 2V73A 5FMOS 2R062 2ARAA 5DXDA 4ET7A 3T0DA 4ES8A 3ACGA 2PHXA 5FY5A 2MEV3 2Q1MA 2VNRA 3ON7A 3H1MA 1AVBA 4R8HA 1UF2C 3WF2A 4BIOA 2VY0A 4E2SA 1XU2A 2K0GA 4CCLA 5EYXA 5FXVA 2JDPA 3ST7A 3H7JA 2HWF2 5CKNA 1EYBA 2Y26A 3O14A 4JGYC 5C3RA 5KBFA 4TLFA 5CKMA 4D6QA 2K9ZA 1YO8A 4XUNA 3BCWA 4JHTA 5ACA2 2P37A 3WY6A 1V6OA 4LEJA 3NSTA 3ZN5A 2UWBA 2R071 4WVMA 4Q0QA 1SMVA 4FBFA 1CX4A 3ILNA 5FZ4A 1Y9GA 4XHBA 3K3OA 1YFUA 4EROA 4QDQA 3ETPA 1Q3EA 4YVWA 3AKRA 4QPIB 1TNFA 2ZZJA 2A5ZA 4C1XA 4UFJA 4MG2A 3MBWA 3TN91 1SFPA 2XQXA 1XNTA 2KA3A 1FX5A 2PHTA 4WZFA 2PELA 4OHXA 4AFMA 1WCSA 4JTNA 4RS5B 1UD1A 3MIEA 1CAXB 2XBO1 5A3UA 4V2WA 5I0TA 1GKBA 2IVIB 2R0FA 5IK7A 2LW8A 2BYVE 2D5FA 3CJIB 3E5XA 4BLIA 3RWKX 3BTXA 4GMP1 2WS91 4KGGA 4NIIA 5FZ9A 1NG0A 5T3NA 2RR11 4LTAA 4LO5B 4NAOA 1PZ9A 1LHNA 4NR1A 4YNIA 4DUVA 4OUEA 2ILMA 1ENSA 4CU7A 1RUD2 1N1TA 2VNGA 4HSLA 5FQ0B 1QNYA 4HZFA 3ZYBA 5BNNB 3GZEA 3ZN6A 5JSPA 4BQ5A 1NZCA 4OI2A 1POV1 1KXGA 2NM1A 1V0AA 1VR3A 4OUSA 3MO4A 5FUPA 1W0NA 4XZUG 3VGIA 2W95A 1LOCA 2ERFA 2CGNA 2IWGB 3E6DA 4Q4Y2 3GZTB 5LATA 4R9BA 2BEOA 5FUIA 5FY8A 3B02A 5LY2A 4RL7A 4ES9A 1KD7A 3AC0A 2ZX3A 2GALA 2HEVF 2PAEA 5L7OB 4LO4B 3RVHA 3WNOA 1RUC2 2D6KA 1W9TA 5J36A 5FY4A 1AX0A 1W8ZA 3LAGA 3CU7A 2IXIA 4YG6A 4YWAA 5EYYA 2X29A 4L8QA 1RC6A 5F2WA 4WM7C 1K3IA 4N43B 5E6HA 3T08A 1STMA 1TME1 4BQ3A 4Q4V3 5GM0A 1HRI2 2EAAA 1VIWB 1D4M3 1W8UA 4Q29A 1UMHA 4N7UA 1CZTA 1SZBA 3C7GA 5FZIA 5GLZA 3SH5A 3UGGA 2KR2A 5L9RA 5LA9A 5LRRA 1PO22 4E4HA 3A21A 5LBEA 2QQUA 2NPIA 2OIIA 5FPUA 1VALA 3LIHA 2FHRA 4QX0A 3CBNA 2RS13 4COZA 1DLCA 1Z0HA 3JBG2 1R091 3I2HA 4KWLA 4KGQA 1H0BA 4W4ZA 5IVCA 2J1TA 3RNSA 1Y43B 5A6XA 3GCWA 1GWMA 5AC91 4QXCA 1D2SA 1OT5A 2D43A 2B5HA 5BY5A 4HK8A 4QXHA 3D5OA 5GLUA 4EYUA 3N9OA 1EUTA 5E16A 2RDNA 4AI1A 4Q4X1 1VBB1 4PQ9A 4I3PA 3AP5A 4X8NA 5APAA 4BQ1A 1YQ5A 3IIAA 5CU1A 1DQ5A 3VBHC 3RZHA 2BFUS 3KQRA 4DPNA 1AXZA 4BOWA 2JX9A 3T2OA 2TUNA 2YXSA 4BHPA 2JWPA 4AE2A 5A7QA 4Z82A 1TMF2 3BGAA 3NJYA 1PO12 4Q1RA 2QDRA 4KL1A 4CXYA 1POQA 4Y1YA 5EWSA 2ZACA 2ZBJA 3POFA 3RS6A 4N43A 4Q0VA 1ZRIA 2UYAA 5F37A 3V0AA 1PHMA 1SLAA 4NJ4A 4CXWA 4LIUA 4CUBA 3AZZA 1KFXL 4Q4Y3 4GH4B 4WM8B 3WW2A 2QQPA 1CWPA 1XNKA 3X29B 3TRSB 1DYOA 2F4PA 2VJXA 1ZBA1 3POWA 2H0VA 4QQLA 2PHRA 1GLHA 2TBVA 1ULPA 1X9PA 5F3CA 3ES4A 5ISLA 1W6NA 2R042 3NNFA 1BK1A 1BBT2 1W6PA 1V6JA 2VMFA 5E8AA 1RIRA 5JI7A 3D8CA 3AB0A 2GNBA 2RM21 2VMGA 1AX1A 1MS8A 1RL3A 2BWAA 2CSGA 2XWJB 3O1TA 4UAPA 1XXNA 2HWE3 3JU9A 1LGBA 2BP6A 3ZN6B 2HBUA 2I07B 2XUMA 4FXKB 1RHI3 5K7PA 1AXYA 1Z78A 1AR71 4AXOA 2JDUA 2P5BA 4NPLA 1SCRA 1ZRRA 3LEKA 1PGL2 4FPOB 1C1FA 2VOVA 2FZ2A 1S0DA 3NV2A 2GP5A 3IAQA 4ZS3A 2XR4A 2WR9A 4XUQA 3VBRB 1JYWA 4MYEA 3N7KA 3OGJA 3HQXA 1CAWB 2DYCA 2PLV2 2XHNA 3OB8A 2QKDA 5EJ3A 3J9SA 3ZFFB 5DABA 4CDUC 3RQ0A 4C0HA 1G7YA 4UW6A 4FPLA 4LOTA 4M3CA 1MS5A 1EUUA 2XPJA 1WMXA 3GDBA 3LSEA 1JI6A 3A0KA 3WG2A 1TVGA 1DP0A 2JE7A 5C9AC 4BIFA 5JZGC 1FNZA 2GZWA 3ZYGA 4WM8C 1G9DA 1H9WA 4MHRA 4MGIE 1BEV3 4CP2A 4HOOA 5A7WB 4G4FA 4LORA 2OPKA 1VB2A 5ABJA 1ASJ2 3TEWA 4YZ3A 5CBLA 2CTVA 2VCCA 3S7EA 4IEUA 1KDMA 4S2GA 4R9CA 3ACLA 1CJDA 2RDRA 4FP3A 2YBKA 4R9DA 4MX3A 3WNMA 4LBKA 4BQ4A 4U36A 2DCZA 4L99A 2YDEA 2J42A 2XDVA 4CUGA 3ZFEB 5I0SA 1UOJA 1NCRC 1PK6A 4XYXA 3ZN4A 1JU4A 2WO3A 4FPCA 3ZX7A 5IAVA 1ND3A 4CUCA 3WNNA 4NRQA 1QJX3 3LE0A 2HWE2 3MIDA 3ZYPA 5LY1A 3ZXFA 3ELNA 5T5JA 4K8FA 4RS5C 2XJUA 3LWCA 4CU6A 2YC0A 1W2AX 1IS4A 2XHKA 5FCCA 2ZGSA 4AI0A 4UBGA 2FDGA 1GZWB 4GULA 1BBT3 3PL0A 4UF0B 4B3NA 5JAXA 2PQQA 3VB9A 5IFPA 3U4XA 1JZ3A 2EICA 3OUIA 5KR7A 2X5IB 3SEEA 4NROA 2V4AA 2VH9A 3IMMA 1OLMA 3B69A 1QXJA 4IESA 2W94A 4GQ7A 4OVEA 4UFLA 3ZXAC 4HKOA 2D3SA 2JECA 4R9AA 1CZSA 4KWJA 1VBC3 2E31A 5FMCA 4BZ4A 2Q30A 5FZAA 3PIJA 3LOBA 3WHTA 1F15A 3CKHA 5B4NA 3POYA 2X5IC 1WLTA 1X7NA 4KWUA 3FZ3A 2ZEXA 4DEVA 3E6BA 1HKDA 1QU0A 4Q4V1 5BXXA 1S55A 2PHLA 4DZGA 4CA9A 1O3RA 5FYZA 3V0AB 2HLEA 1MS3A 3VN4A 2MNGA 3VD5A 1AR82 1MZ5A 1N3OA 1FNYA 4QB2A 1UY1A 1I3HA 2E32A 1KS4A 3AXDA 2UYBA 3HR9A 3VHNA 3VZKA 4MXVA 4TTGA 5GALA 5H9QA 1RUD3 3WF0A 4D94A 1H1IA 4ASMB 1PVC1 1AR91 3G7DA 3WINE 1VAVA 3I59B 1DZQA 4XAEA 5K0UB 3KHCA 1JS9A 2HWD3 1UZ0A 3PJQA 4Y22B 1ULOA 3FWEA 3HIFA 3PLQA 4WM7B 1UYPA 3IWZA 2IXCA 3VL9A 1H6XA 2UURA 1F9KA 1QDOA 2X10A 1DYPA 4MXWB 2RMU1 2BQPA 4JRLA 3KF3A 3MZHA 1JBCA 4IXLA 1AUYA 4CCEA 4GWIA 2VVEA 5L19A 1AR62 5FREA 3S6PA 4XCBA 4EWAA 1IQDC 5F6LB 1VRH2 4Y20A 4CDXA 3MW4A 3GGLA 3R4UA 2HWB1 2C6SA 5FO9B 1J84A 1W9SA 2QZ2A 1AYN1 2VZTA 3J7NA 4IDZA 4Q4W3 3HNBM 2WNUC 3BTZA 1OA3A 1FPN2 3O7OA 4PF1A 3N9LA 3VBFA 5BNOA 1RUJ2 2XLGA 3HBZA 4LUMA 1QOOA 4OUMA 1PGW1 3H9AA 3RZJA 3C7HA 3J7LA 1E5HA 1NXD1 3ACFA 3ILRA 1S4CA 1HRI3 3EXUA 3KV5A 1NLRA 3VDCA 2W2IA 5A3TA 5HXVA 2W1WA 1AL0G 1OFSA 4L2NA 2QQOA 2X53S 2RS53 2ATFA 2OA2A 4AFBA 2JICA 1WW5A 4LNVA 4CDQC 3M3EA 5GZEA 1BJQA 1G86A 4PLMA 1URXA 4UYBA 3WHUA 3ZXDA 4A7KA 1YFXA 1HXS3 1D4VB 1HLCA 1NXMA 1NLSA 5E88A 4QHZA 2ZABA 3K75B 5C4WA 5F39A 1HB3A 2XXZA 1NA1A 2IFWA 3RGBA 2ZHMA 4K20A 5JXGA 2HJIA 5FPBA 1Z7S1 4COVA 1JZ2A 4IGQA 4MO3M 1W6PB 1A34A 2FCVA 4WVWA 2WT1A 1PNFA 2J7MA 4UW3A 2CYFA 4HK9A 2EIGA 2YFUA 4IEOA 4H3WA 2B9UA 1CAWA 1ENXA 2XJQA 4AVAA 1V6MA 2WAAA 3NAPB 1JZ7A 2WYSA 1YQ6A 3ITQA 4EV0A 3ABZA 2WWUA 3BTYA 5C3SA 2VOTA 1R1A3 5D2AA 1W2UA 3DXTA 5A33B 5FKBA 1H2NA 4YZ2A 2BGPA 1VMJA 3HT1A 1LOAA 4IEVA 3CJXA 3SHRA 1HN1A 5EV7A 5FPLA 5A7SA 4A6OA 2NMNA 3K48A 2NP0A 5IVJA 1MZFA 5SV8A 2WNVC 1G9BA 5AC93 2R49A 1GV9A 3DYPA 4HN1A 1PO13 1QIQA 2VXJA 1GR3A 2D97A 3MGUA 3QOPA 5FZ8A 1WA4A 4NO4A 5JR7B 4E2GA 1IS3A 3AL6A 1E5RA 1US3A 1EV11 2EALA 4CU9A 5EPAA 5BUVA 3H8RA 4CDWB 1ND2C 2E63A 2QQIA 3POGA 2OQ6A 2P3KA 2WO2A 2XVKA 3OBRA 5C3PA 3UETA 1BEV2 4MOAA 3W9AA 4BH9A 1VBE1 2HWF3 3CL1A 4XFIA 5C33A 2XWBB 1HQWA 2WNEA 4G3YC 2RS32 2WT0A 1LENA 3GNEA 1H1MA 2GH2A 3ORJA 4AI3A 4LHNA 4LLFA 4CSWA 2YYOA 1IG0A 4AHYA 1W6MA 4HETA 5F3EA 5FYHA 4C90A 1ULGA 2PLV3 4NAMA 3GJBA 1DGWX 1H4HA 3AJYA 2B4KA 5T54A 5KHKA 2VNVA 3U78A 5A80A 2RS51 1BMV2 4JGZB 3LB9A 4N9IA 3AKQA 3U14A 4BK5A 5IT6A 1NLQA 2VM9A 4CDXB 4PLOA 4XETA 5L9VA 1ZRFA 2P6CA 1ZRCA 1RINA 4UOJA 5K9YA 4JKKA 1LOFA 1OD5A 2X8KA 3L2HA 4E4ZA 3ZXLA 2QQNA 2VMEA 4NHXA 1Q8QA 1POV3 4RHV1 3ZFFC 4MGKE 1U5IA 1ZZBA 4QX5A 4AQ6A 3NRUA 3GYDA 3AYAA 2NYYA 1V9U1 3GJAA 1RUC3 3WF4A 3V0BA 2AYHA 4CDXC 4MSVA 3AYEA 3P3PA 5T5OA 4QPGA 1LODA 2NN8A 3N36A 1C4RA 4YZ1A 2P1BA 1AXKA 2D3RA 1SLBA 2EXIA 4DY5A 1QJFA 1R082 2QNKA 1RMU3 1HJFA 1SBDA 2VOWA 3NV4A 4A42A 1MS4A 1JYXA 3PDQA 1W8WA 3V64A 3C2UA 4Y1UA 2IUWA 5FMBA 5DUWA 4Y1VA 4JC1A 3NJVA 4Z07A 2P2KA 1H6YA 3H8UA 5J09A 5FYCA 4TN7A 3PTYA 1YC61 3RJ2X 4EWEA 1GP4A 4N53B 5BNNA 2RS12 1F5JA 1GBGA 2ZHKA 2O1QA 3OJBA 4QDSA 3CIHA 3FHAA 4COYA 5GLWA 4XAAA 3D6EA 5JIUA 4Q2FA 3R4DB 4LBNA 3KVAA 3AZVA 4XMAA 5I8SA 1LOEA 5F9TA 1QJU2 1UOBA 1K5JA 5A6QA 2IFRA 2X5IA 4ZHNA 2A7AA 3M7AA 5T50A 4GKXA 4X6RB 4NIHA 4PQQA 1OFNA 3MV11 5EQUA 1J59A 3I3DA 4CPBD 3S57A 4CEYA 1FOD2 3K77A 3BIEA 3ZFEC 2LRPA 2YHJA 3VUOA 4A44A 2Y8KA 4CP9B 1QEXA 1WKYA 2NLRA 2I2SA 1UL9A 1H30A 3BTAA 3A4UA 5F6KA 5HCFA 1KITA 2AREA 1GWKA 1JYNA 1MS1A 1YLLA 4GAZA 1RMU2 3TYJA 5FZBA 2IXLA 3C7OA 4YVSB 5C5TA 5JZGB 1BZWA 2W46A 2HEYF 1V6KA 4NRMA 1EP0A 4MGQA 2MEV1 4RS5A 4IEXA 2XQRA 4CCDA 3RZKA 3H7YA 4XJZA 5KHJA 1IPSA 1BK0A 2RDSA 1VBA2 2WN3A 1C8M1 4NE9A 3VBSA 4CP1A 1AR73 3DUIA 1PNGA 1O7FA 1PK6C 3IM0A 2JG9A 3WW4A 1DGRN 2QCSB 2G19A 2OZ6A 5I0DA 5A3NA 2GMPA 3PVOA 2ZEYA 4AAXA 4HVQA 3ASIA 3ZVXA 1OVPA 1IZ3A 3ZPOA 4LE3A 2GC0A 4NN0A 3CQOA 1SLLA 2R0HA 2WL1A 2UWAA 4M3CB 4DB5A 3RPQA 4AK3A 4ZZ5A 5HV0A 4LQRA 4TZDA 2B39A 5LA0A 1JYCA 1WCDJ 2VAUA 4UI9L 4CDUB 3MF9A 4LXLA 1S2KA 2N7GA 4QPWA 3RDIA 5FLHA 3KV9A 2GC2A 1WD4A 3RZMA 5JPMB 4JKLA 2DDUA 3O5SA 4ZZ8A 1AYM1 1QDCA 2G9FA 1ULEA 1XJAA 1MS0A 3B01A 4GALA 5FYUA 3SCHA 4YSFA 1RUF3 3THPA 5F8PA 1IS5A 4PIZA 4GH4A 2ENRA 4CDWC 2P3JA 3T4VA 2FMDA 2PXJA 4H7LA 1MEC2 4Y5SA 3WQ0A 4P02B 1Q8SA 2J1VA 4LLOA 2PHUA 4QPGB 4AAPA 3H3ZA 1IPJA 1QJEA 4H14A 4XILA 2HKXA 2DCJA 2VZPA 2WZPP 3NKTA 4HMZA 2WFPA 4QGMA 1WW7A 1XOYA 2RVAA 4CCMA 4DIQA 1W9FA 4FTBA 2VBPA 2R061 2GC1A 1RVF2 2C5DA 3NVCA 4XF0A 3H3LA 4FPYA 1NCQC 5A7OA 1GOFA 4P9YA 3VZJA 4PI2A 1CN1A 5DQ0A 1U5YA 2VMDA 2Q8CA 4FSJA 5LBBA 4CCJA 2W92A 1GP6A 5JXJA 3THDA 1XSQA 4KBBA 3JXSA 1CX1A 4P08A 4XF3A 1W9WA 5EP9A 2BV4A 2PQSA 4INDA 5ACA1 1YUDA 1G9CA 3AKSA 4XIKA 1D0GA 1DQ0A 2HWC2 5DAPA 3RJRA 4IERA 5DUUA 1O4ZA 4Q26A 2WSVA 3WDYA 4LULA 3BN6A 1SFYA 4OMCA 3ME2A 2XOMA 3VD9A 3DYMA 3M2MA 1X50A 5I8TA 5FY1A 1DF0A 1CJPA 3N7LA 5B4XA 4RA0A 1NQJA 2AEYA 4CP9A 1XB9A 2P3YA 5DZEA 4UFMA 4QPGC 5FZOA 1UY4A 3SH4A 1HDKA 1XE7A 4RHV3 1GZ9A 1XQNA 3PJYA 3ILFA 2HWD1 3WX5A 3UT0A 1IS6A 3MW3A 3HD8B 1JODA 1KJLA 1UAIA 1R1A1 4LE4A 4RQPB 4AGVA 4BQYA 3WW1A 4NIGA 5IVYA 1C57A 3HPNA 1H9PA 4PBPA 4QKDA 2RE9A 2WS92 5FRAA 1IOAA 3VZMA 2ET7A 4R4ZA 3WZ1A 4BJ0A 3OGVA 1UXZA 1EPZA 1CVNA 1RUJ3 4XTMA 1LGCA 3WDVA 4OFGA 4JQTA 4OQ9A 2D6OX 4CPBA 1MEC3 1YXWA 2QQKA 3O1VA 2XH6A 3AZXA 5F3GA 1C28A 1GOGA 2CWSA 4YGDA 2ZHLA 4AYUA 1UX6A 3UK9A 4EN7B 3GHNA 5L7OA 1BQPA 3THTA 1NKGA 2GH8A 5DN2A 5FWJA 4IV1A 2AH2A 4YM3A 5HBAA 4IE4A 1SLTA 2HYXA 4FTEA 3J4UH 2PYTA 2A6YA 5FK7A 1RUI1 2DCKA 4CEWA 3NNJA 4XUOA 1RUH3 5A7PA 4IE5A 1LHVA 3HBKA 1ZX5A 4XABA 1Q8PA 3HN3A 1UYXA 1UIJA 5FZ7A 1SPPA 1XYPA 2WFF1 2O0OA 4LA3A 2XVGA 1RUC1 3TEXA 4Y5Z0 5HCHA 4YVSA 1AJKA 3MIGA 1I6XA 1H8VA 2UY8A 2WYFA 3DEMA 2WKKA 1OVSA 2Y64A 2ZPXA 5JSRA 3R4SA 3K3NA 2WQ8A 3MFCA 4AEKA 2R063 4N7IA 3HNMA 1C3HA 4Q1PA 4CE8A 2DU1A 1QJY2 4NMIA 2QQMA 1MR5A 2UU8A 2D93A 2ZHNA 5FXZA 4E4DX 3SKVA 2LUWA 3POIA 5L9BA 2W39A 5JOXA 5FZLA 2OUHA 3RFRA 4AEDC 2H6BA 1RJ7A 2H6CA 2K2SA 1GZCA 1RXFA 1K5MB 1ND2B 1W8HA 5FKCA 4LJHA 2RR13 3V56A 5LBCA 1BCXA 1W3XA 2ORZA 4XE9A 4IGOA 3LEIA 4XF4A 5A7NA 1EAH1 2VULA 1WLCA 2WZR1 4JGYB 2FDHA 2ZGTA 2VQAA 3NAPC 3POSA 1E5SA 2YC4A 3WUDA 1FPN3 3I4IA 1U5XA 1AL21 3VBOC 3J7MA 5CKQA 3WG3A 1RUG2 2W3JA 4RR3B 2RJLA 4ZS2A 4JVAA 3ZPYA 4HPKA 5GZFA 1LU1A 2VZ3A 2Y60A 4IUGA 3KT1A 5JVVA 1CIYA 5CA6A 4I09A 2VMIA 1QWRA 1UYYA 4Y4YA 4YW7A 1PO11 4MGYE 4MZUA 3KVBA 1XYNA 3U0ZA 2ZGUA 3VBHB 3G6JB 4IEQA 2BERA 2KD7A 2W08A 3KCCA 5LK5A 1LEDA 4FOVA 3I49A 1RB8G 1ZRDA 3F2ZA 3T2TA 4Z1VA 1C8NA 5DG2A 3VDDB 3K4AA 1QMJA 5CZKA 1PM4A 2ZXQA 1VBD2 1HB2A 3AMQA 5BNOC 2V09A 5FUNA 3GF6A 1GP5A 3VBFC 2Y34A 4Q8KA 3DF0A 1PVXA 1DGWA 2BRTA 3I2JA 3WP5A 4BYYA 4FO9A 3ZXGA 4DMIA 5IATA 3NW4A 1IKQA 4HT1T 3LIGA 4JDOA 2OVUA 5E1RA 1B35C 1JYIA 1SHWB 2E7AA 4MGZE 2GNDA 1L7RA 4XFGA 1K5MC 4AI9A 2ZEWA 4BMEA 1EV13 1JHNA 1L7QA 3PMSA 3RI9A 1H2LA 2P6HA 5CEHA 3BYWA 5K4LA 2W87A 2VMHA 4V1PA 1AR72 1COV2 4BQWA 5KXCA 2HWF1 4KU7A
chains in the Genus database with same CATH topology
2J1AA 5JUVA 3UNPA 4LKSA 3ZM8A 4E8DA 1W8OA 4GWJA 3K46A 4GWIA 1IQDC 2Y6HA 4D0QA 2QBXA 1UY0A 4XUPA 4CU8A 2X09A 2X05A 3GGLA 1P8JA 4JKMA 1J84A 1W9SA 2VZTA 2LS6A 4P00B 2W1SA 3HNBM 2VZ1A 3T0BA 4PF1A 5C7GA 4D8MA 2E26A 1XC6A 1NAEA 4HG6B 2VZOA 2BGOA 3C7HA 4PT6A 1NUKA 3ACFA 3P1IA 1JZ8A 1CX1A 3VDCA 2W1WA 3CDZB 2QQOA 2X10A 3P6BA 2CDOA 1UY2A 1UXXX 3OEBA 3T2QA 3K75B 1JYVA 2YG0A 2C26A 3I2GA 2JE8A 5JXGA 1JZ2A 4MO3M 1JHJA 5G04L 5C71A 2QQJA 2J7MA 2YFUA 2Y6JA 2VCBA 2JDAA 1OD3A 4DUWA 3WNLA 2WAAA 1JZ7A 2WYSA 1UWWA 3ABZA 1OF3A 1JU3A 2VOTA 3LEGA 4QDRA 1GNYA 2VC9A 2BGPA 1HN1A 4QX3A 4A6OA 1LNSA 2VCAA 5JXHA 1JZ5A 1T2XA 4A3ZA 2V5DA 3LPGA 1GMMA 2VZQA 3DYPA 3K4DA 5EIYB 2VZUA 4QX2A 3NJXA 2E33A 1US3A 4GZ9A 4W8JA 4YPJA 4CU9A 2JD9A 1CZVA 1KGYA 2WZ8A 2QQIA 2WO2A 1WCQA 2VR4A 2W1UA 4MOAA 3UETA 1UMIA 2R7EB 3A22A 3OGSA 1UYZA 1I5PA 5IJRA 3MUY1 1W99A 1O59A 3HNYM 2RJ2A 2VTFA 2WAOA 1D7PM 4QB6A 4CUAA 3A7QA 4A45A 2B4KA 2VL4A 2WDBA 3T09A 3OEAA 2C4XA 3ACHA 4BK5A 3WEZA 2VM9A 4KMQA 4UOJA 2WN2A 5IHRA 4JKKA 2CDPA 5JR2A 2QQNA 2VMEA 2Y6KA 2W91A 4A4AA 2VQTA 3C7EA 3I2IA 3NRUA 5DMYA 3C8XA 1OF4A 3MUZ1 3WF4A 4ARYA 3U37A 1XPWA 2L9LA 2XONA 1PMHX 4BDVB 2EIEA 4MADA 3ECQA 5JXIA 3I3EA 4A42A 1JYXA 1K45A 1O8SA 3A23A 4M4PA 3WQBA 3NJVA 4ET7A 1H6YA 3T0DA 3ACGA 4P5YA 4DXRA 5J1XA 3WF2A 4QDSA 3CIHA 3FHAA 4DXTA 2Z4FA 3D3AA 5A1AA 2VZVA 4QB1A 3WNKA 3W5NA 2ORXA 2J22A 4XUNA 4PQQA 2YC2A 1F4HA 3MV11 4XURA 3I3DA 3I2FA 3K77A 4QDQA 2Y8KA 4A44A 3VD4A 3ETPA 1WKYA 3FL7A 3MBWA 5LA1A 5G05L 2XQXA 1JYNA 1XNTA 4MGSA 3C7OA 1YQ2A 3WF1A 1RYYA 2W46A 4MGQA 3MV01 3T0AA 1GOHA 2LW8A 2WN3A 1K12A 2J1EA 5I0DA 2ZEYA 4XVHA 4LPLA 4AAXA 4OYUA 3DYOA 3CQOA 4DUVA 4OUEA 1US2A 4CU7A 2QQLA 4ZZ5A 2J1SA 4LQRA 2BBAA 4RYDA 1PX3A 4RN5A 5LA0A 5F7UA 4UI9L 3MO4A 1OH4A 1W0NA 3HOBA 4XZUG 2W95A 4QPWA 2YB7A 5FUIA 2Y6LA 4JKLA 2DDUA 4ZZ8A 3AC0A 3HJRA 4JHZA 1MPXA 4FI9A 3VD7A 3WNOA 1UY3A 3E1F1 2W9XA 1W9TA 4P02B 2J1VA 3CZUA 1K3IA 2DCJA 2VZPA 3I2KA 1PX4A 4KI5M 3T08A 2RVAA 3OGRA 1NX9A 1UMHA 1CZTA 3C7GA 1J83A 1XNAA 1GOFA 3A21A 4ZY9A 4QX0A 5DQ0A 2VMDA 3LPFA 1DLCA 2J1RA 3SEPA 2W92A 5JXJA 3I2HA 3FN9A 3THDA 3JXSA 1R64A 4TXWA 4W4ZA 2J1TA 3OBAA 4P08A 5JMOA 1OT5A 1W9WA 3WNPA 3SKJE 3C7FA 2PQSA 3CZJA 5EJ1B 3GM8A 1EUTA 1GQPA 2W47A 4CVUA 3BN6A 4OMCA 2B9VA 2XOMA 3T2OA 3VD9A 3DYMA 3BGAA 5B4XA 1JZ4A 2VZRA 3T2PA 3IB3A 1UY4A 2C9KA 1GUIA 2YFZA 3HEIA 4CUBA 1PMJX 3VDAA 4DXSA 3W5MA 4XUTA 1DYOA 2VJXA 2WBKA 3UESA 1ULPA 3HPNA 4QX1A 5C70A 1KEXA 4DUXA 4BJ0A 5DPNA 3OGVA 1UXZA 2VMFA 2EIDA 4OZOA 4BXSV 4ARXA 3WF3A 2VMCA 3VD3A 2QQKA 1GOGA 5IYYA 4UAPA 1O8PA 2RV9A 1NKGA 5DN2A 2V72A 3DECA 4ZXEA 1SDDB 2HYXA 3FHQA 2WO1A 2ID4A 3LEKA 4A41A 1F4AA 3EB7A 2DCKA 1K42A 2Y6GA 2ZEZA 3IAQA 4XUOA 4XUQA 1JYWA 2J1UA 2XHNA 3OB8A 3HN3A 1UYXA 4DEQA 1W8NA 4QAWA 2WABA 5IFTA 1EUUA 3GDBA 1JI6A 1TVGA 1DP0A 1JZ6A 2Y64A 1SG3A 2WQ8A 3K4ZA 3HNMA 2VQUA 3ACIA 2QQMA 1TG7A 2VCCA 3THCA 3SKVA 3WNMA 3I97A 4LHSA 5EJZB 3CMGA 1JU4A 2BZDA 2WO3A 4CUCA 2VZSA 2W5FA 3WNNA 3LE0A 2ORZA 2W1QA 3LEIA 3J7HA 2OKXA 3GXUA 4CU6A 2YC4A 1BHGA 2V4VA 2W3JA 2EIBA 5IFPA 2WZEA 3PUHA 5HPOA 1UX7A 1JZ3A 2EICA 3SEEA 4JX0A 2VZ3A 4IUGA 3VDBA 1CIYA 2W94A 1UYYA 1CZSA 2E31A 2BERA 2KD7A 3CKHA 5B4NA 2VO5A 3F2ZA 3LQCA 4KWUA 2ZEXA 4DEVA 3K4AA 5CZKA 2ZXQA 3IIIA 4L0PA 4M4RA 4OMDA 5HXMA 2HLEA 4Z2AA 2WUHA 3I3BA 3VD5A 2JKXA 3I2JA 3WSOA 4QB2A 1UY1A 2E32A 4W50A 1SHWB 4TTGA 3WF0A 5CYYA 3IDAA 1L7RA 1GU3A 2ZEWA 1L7QA 4BK4A 5LCWL 4AG4A 1UZ0A 3IAPA 1ULOA 3PUIA 2W87A 3NNGA 4E8CA 5LA2A 1H6XA 3EYPA 3OG2A 3NQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1A A;  5JUV A;  3UNP A;  4LKS A;  3ZM8 A;  4E8D A;  1W8O A;  4GWJ A;  3K46 A;  4GWI A;  1IQD C;  2Y6H A;  4D0Q A;  2QBX A;  1UY0 A;  4XUP A;  4CU8 A;  2X09 A;  2X05 A;  3GGL A;  1P8J A;  4JKM A;  1J84 A;  1W9S A;  2VZT A;  2LS6 A;  4P00 B;  2W1S A;  3HNB M;  2VZ1 A;  3T0B A;  4PF1 A;  5C7G A;  4D8M A;  2E26 A;  1XC6 A;  1NAE A;  4HG6 B;  2VZO A;  2BGO A;  3C7H A;  4PT6 A;  1NUK A;  3ACF A;  3P1I A;  1JZ8 A;  1CX1 A;  3VDC A;  2W1W A;  3CDZ B;  2QQO A;  2X10 A;  3P6B A;  2CDO A;  1UY2 A;  1UXX X;  3OEB A;  3T2Q A;  3K75 B;  1JYV A;  2YG0 A;  2C26 A;  3I2G A;  2JE8 A;  5JXG A;  1JZ2 A;  4MO3 M;  1JHJ A;  5G04 L;  5C71 A;  2QQJ A;  2J7M A;  2YFU A;  2Y6J A;  2VCB A;  2JDA A;  1OD3 A;  4DUW A;  3WNL A;  2WAA A;  1JZ7 A;  2WYS A;  1UWW A;  3ABZ A;  1OF3 A;  1JU3 A;  2VOT A;  3LEG A;  4QDR A;  1GNY A;  2VC9 A;  2BGP A;  1HN1 A;  4QX3 A;  4A6O A;  1LNS A;  2VCA A;  5JXH A;  1JZ5 A;  1T2X A;  4A3Z A;  2V5D A;  3LPG A;  1GMM A;  2VZQ A;  3DYP A;  3K4D A;  5EIY B;  2VZU A;  4QX2 A;  3NJX A;  2E33 A;  1US3 A;  4GZ9 A;  4W8J A;  4YPJ A;  4CU9 A;  2JD9 A;  1CZV A;  1KGY A;  2WZ8 A;  2QQI A;  2WO2 A;  1WCQ A;  2VR4 A;  2W1U A;  4MOA A;  3UET A;  1UMI A;  2R7E B;  3A22 A;  3OGS A;  1UYZ A;  1I5P A;  5IJR A;  3MUY 1;  1W99 A;  1O59 A;  3HNY M;  2RJ2 A;  2VTF A;  2WAO A;  1D7P M;  4QB6 A;  4CUA A;  3A7Q A;  4A45 A;  2B4K A;  2VL4 A;  2WDB A;  3T09 A;  3OEA A;  2C4X A;  3ACH A;  4BK5 A;  3WEZ A;  2VM9 A;  4KMQ A;  4UOJ A;  2WN2 A;  5IHR A;  4JKK A;  2CDP A;  5JR2 A;  2QQN A;  2VME A;  2Y6K A;  2W91 A;  4A4A A;  2VQT A;  3C7E A;  3I2I A;  3NRU A;  5DMY A;  3C8X A;  1OF4 A;  3MUZ 1;  3WF4 A;  4ARY A;  3U37 A;  1XPW A;  2L9L A;  2XON A;  1PMH X;  4BDV B;  2EIE A;  4MAD A;  3ECQ A;  5JXI A;  3I3E A;  4A42 A;  1JYX A;  1K45 A;  1O8S A;  3A23 A;  4M4P A;  3WQB A;  3NJV A;  4ET7 A;  1H6Y A;  3T0D A;  3ACG A;  4P5Y A;  4DXR A;  5J1X A;  3WF2 A;  4QDS A;  3CIH A;  3FHA A;  4DXT A;  2Z4F A;  3D3A A;  5A1A A;  2VZV A;  4QB1 A;  3WNK A;  3W5N A;  2ORX A;  2J22 A;  4XUN A;  4PQQ A;  2YC2 A;  1F4H A;  3MV1 1;  4XUR A;  3I3D A;  3I2F A;  3K77 A;  4QDQ A;  2Y8K A;  4A44 A;  3VD4 A;  3ETP A;  1WKY A;  3FL7 A;  3MBW A;  5LA1 A;  5G05 L;  2XQX A;  1JYN A;  1XNT A;  4MGS A;  3C7O A;  1YQ2 A;  3WF1 A;  1RYY A;  2W46 A;  4MGQ A;  3MV0 1;  3T0A A;  1GOH A;  2LW8 A;  2WN3 A;  1K12 A;  2J1E A;  5I0D A;  2ZEY A;  4XVH A;  4LPL A;  4AAX A;  4OYU A;  3DYO A;  3CQO A;  4DUV A;  4OUE A;  1US2 A;  4CU7 A;  2QQL A;  4ZZ5 A;  2J1S A;  4LQR A;  2BBA A;  4RYD A;  1PX3 A;  4RN5 A;  5LA0 A;  5F7U A;  4UI9 L;  3MO4 A;  1OH4 A;  1W0N A;  3HOB A;  4XZU G;  2W95 A;  4QPW A;  2YB7 A;  5FUI A;  2Y6L A;  4JKL A;  2DDU A;  4ZZ8 A;  3AC0 A;  3HJR A;  4JHZ A;  1MPX A;  4FI9 A;  3VD7 A;  3WNO A;  1UY3 A;  3E1F 1;  2W9X A;  1W9T A;  4P02 B;  2J1V A;  3CZU A;  1K3I A;  2DCJ A;  2VZP A;  3I2K A;  1PX4 A;  4KI5 M;  3T08 A;  2RVA A;  3OGR A;  1NX9 A;  1UMH A;  1CZT A;  3C7G A;  1J83 A;  1XNA A;  1GOF A;  3A21 A;  4ZY9 A;  4QX0 A;  5DQ0 A;  2VMD A;  3LPF A;  1DLC A;  2J1R A;  3SEP A;  2W92 A;  5JXJ A;  3I2H A;  3FN9 A;  3THD A;  3JXS A;  1R64 A;  4TXW A;  4W4Z A;  2J1T A;  3OBA A;  4P08 A;  5JMO A;  1OT5 A;  1W9W A;  3WNP A;  3SKJ E;  3C7F A;  2PQS A;  3CZJ A;  5EJ1 B;  3GM8 A;  1EUT A;  1GQP A;  2W47 A;  4CVU A;  3BN6 A;  4OMC A;  2B9V A;  2XOM A;  3T2O A;  3VD9 A;  3DYM A;  3BGA A;  5B4X A;  1JZ4 A;  2VZR A;  3T2P A;  3IB3 A;  1UY4 A;  2C9K A;  1GUI A;  2YFZ A;  3HEI A;  4CUB A;  1PMJ X;  3VDA A;  4DXS A;  3W5M A;  4XUT A;  1DYO A;  2VJX A;  2WBK A;  3UES A;  1ULP A;  3HPN A;  4QX1 A;  5C70 A;  1KEX A;  4DUX A;  4BJ0 A;  5DPN A;  3OGV A;  1UXZ A;  2VMF A;  2EID A;  4OZO A;  4BXS V;  4ARX A;  3WF3 A;  2VMC A;  3VD3 A;  2QQK A;  1GOG A;  5IYY A;  4UAP A;  1O8P A;  2RV9 A;  1NKG A;  5DN2 A;  2V72 A;  3DEC A;  4ZXE A;  1SDD B;  2HYX A;  3FHQ A;  2WO1 A;  2ID4 A;  3LEK A;  4A41 A;  1F4A A;  3EB7 A;  2DCK A;  1K42 A;  2Y6G A;  2ZEZ A;  3IAQ A;  4XUO A;  4XUQ A;  1JYW A;  2J1U A;  2XHN A;  3OB8 A;  3HN3 A;  1UYX A;  4DEQ A;  1W8N A;  4QAW A;  2WAB A;  5IFT A;  1EUU A;  3GDB A;  1JI6 A;  1TVG A;  1DP0 A;  1JZ6 A;  2Y64 A;  1SG3 A;  2WQ8 A;  3K4Z A;  3HNM A;  2VQU A;  3ACI A;  2QQM A;  1TG7 A;  2VCC A;  3THC A;  3SKV A;  3WNM A;  3I97 A;  4LHS A;  5EJZ B;  3CMG A;  1JU4 A;  2BZD A;  2WO3 A;  4CUC A;  2VZS A;  2W5F A;  3WNN A;  3LE0 A;  2ORZ A;  2W1Q A;  3LEI A;  3J7H A;  2OKX A;  3GXU A;  4CU6 A;  2YC4 A;  1BHG A;  2V4V A;  2W3J A;  2EIB A;  5IFP A;  2WZE A;  3PUH A;  5HPO A;  1UX7 A;  1JZ3 A;  2EIC A;  3SEE A;  4JX0 A;  2VZ3 A;  4IUG A;  3VDB A;  1CIY A;  2W94 A;  1UYY A;  1CZS A;  2E31 A;  2BER A;  2KD7 A;  3CKH A;  5B4N A;  2VO5 A;  3F2Z A;  3LQC A;  4KWU A;  2ZEX A;  4DEV A;  3K4A A;  5CZK A;  2ZXQ A;  3III A;  4L0P A;  4M4R A;  4OMD A;  5HXM A;  2HLE A;  4Z2A A;  2WUH A;  3I3B A;  3VD5 A;  2JKX A;  3I2J A;  3WSO A;  4QB2 A;  1UY1 A;  2E32 A;  4W50 A;  1SHW B;  4TTG A;  3WF0 A;  5CYY A;  3IDA A;  1L7R A;  1GU3 A;  2ZEW A;  1L7Q A;  4BK4 A;  5LCW L;  4AG4 A;  1UZ0 A;  3IAP A;  1ULO A;  3PUI A;  2W87 A;  3NNG A;  4E8C A;  5LA2 A;  1H6X A;  3EYP A;  3OG2 A;  3NQH A; 
#chains in the Genus database with same CATH topology
 2VUJ A;  5FP9 A;  3INA A;  4QU2 A;  1QJX 1;  1VBB 3;  1ZM1 A;  4I0B A;  1LHO A;  4XIO A;  1W8O A;  5IK4 A;  2JDY A;  2O8Q A;  4BWO A;  4CYD A;  2F17 A;  5A3M A;  5LEK A;  5FYI A;  1VE0 A;  3I2D A;  4XF9 A;  2PLV 1;  2Y6H A;  4D0Q A;  4EJR A;  5FZ6 A;  1XSR A;  4K40 A;  3LF7 A;  4XUP A;  3VBO A;  2X09 A;  1A8M A;  3L9J T;  4GB3 1;  1OKO A;  4JAA A;  3SIT A;  1OBN A;  1P8J A;  1W3V A;  4JKM A;  3UKV A;  3AFK A;  1UN1 A;  1XE8 A;  1OI6 A;  2LS6 A;  4P00 B;  4B4P A;  5IAX A;  5BNP A;  5KWR A;  3T0B A;  1OUR A;  3ETQ A;  2OT7 A;  5HI0 A;  1R1Z A;  4DXZ A;  2XL9 A;  3USU B;  5C7G A;  4CDW A;  4D8M A;  4GH4 C;  1B09 A;  2GU9 A;  2SLI A;  3LDR A;  5FTT C;  4AW7 A;  5BNO B;  1XC6 A;  1NAE A;  2WSU A;  1LKN A;  4JGZ C;  4YW5 A;  4AED A;  1UOG A;  2GME A;  4LHL A;  4ASK A;  1NUK A;  1XNC A;  4Q8L A;  2W68 A;  3P1I A;  1JZ8 A;  1I5Z A;  2DFB A;  3AMM A;  1NY7 2;  4HKL A;  4N9H A;  3RZG A;  1XND A;  1DU3 D;  3PHM A;  1JXN A;  1CQ9 A;  2WLQ A;  4P9L A;  4OZX A;  4P9W A;  3GBG A;  3QH7 A;  1WCU A;  5GZC A;  4Z2W A;  3B9I A;  2RMU 3;  3FHI B;  3OF1 A;  1PZ8 A;  3SH3 A;  1YWK A;  4UFK A;  4YVS C;  4W6W A;  3AZY A;  4D7T A;  1RUD 1;  1S0I A;  1LCL A;  1XRU A;  4CDQ B;  4DY3 A;  4NVP A;  2P4E A;  5CG8 A;  1LB2 A;  2DU0 A;  3HWJ A;  4E9K A;  5C71 A;  2JG9 C;  1E5I A;  5FYY A;  1VLN A;  1AYN 3;  2D6L X;  2VCB A;  1VP6 A;  2JEN A;  2Y6J A;  3OY8 B;  4UT5 A;  1YJK A;  3R6S A;  2CU5 A;  4DUW A;  1JOP A;  3WNL A;  2JDK A;  3R0R A;  3TOJ A;  5T55 A;  4OHY A;  5D21 A;  3MFA A;  2GAU A;  1GZW A;  5C4W B;  2VOK A;  2XKP A;  2WLP A;  2JDH A;  3AMP A;  1ULD A;  4PBO A;  2VC9 A;  2Q1Z B;  2AR6 A;  3LKJ A;  3Q8B A;  3K51 A;  4K7J A;  3SIS A;  5FZ3 A;  3VLB B;  4RFT 0;  5JXH A;  1FAY A;  1QF3 A;  4GA9 A;  3PVB B;  1T2X A;  1NCQ B;  1UCX A;  1W6O A;  1S0J A;  4A3Z A;  1GMM A;  4XJA A;  2VG9 A;  4XXA A;  3U10 A;  4BIS A;  4ZXK A;  1MS9 A;  4WM8 A;  1QOS A;  4G9S B;  1H8T B;  3AJZ A;  1AR8 1;  2VZU A;  2VE1 A;  1X8E A;  5KC6 A;  3LD8 A;  2E33 A;  5C8C A;  3MLJ A;  2ZML A;  5FLJ A;  3EBR A;  3O12 A;  4QKN A;  4W8J A;  5IUQ A;  2ETE A;  3SC7 X;  4XC9 A;  2JJ6 A;  5L73 A;  3MLL A;  4GB3 3;  3AP9 A;  3U1X A;  1PO2 1;  3OPZ A;  1YRZ A;  1NCR B;  2W1U A;  5A3L A;  1BKZ A;  1CAV B;  3OGS A;  3JD7 1;  1N1S A;  1ASJ 3;  2G1M A;  2NQY A;  1ZRE A;  1DQ2 A;  1DLL A;  4FFI A;  1I5P A;  1R09 2;  3FFZ A;  1AHS A;  3C3V A;  4EZ4 A;  5A6Z A;  3T1M A;  1W99 A;  4AVB A;  4QM8 A;  4AVT A;  2F6B A;  2R30 A;  3HNY M;  4QQO A;  5AFE A;  1W6O B;  2VTF A;  1JW6 A;  2BNM A;  5AC9 2;  3MPP G;  4JTO A;  1UZV A;  1OLQ A;  4GMP 0;  5BNN C;  3PU3 A;  4J1W A;  2GN3 A;  3VKN A;  2CL2 A;  4CUA A;  2AUY A;  3A7Q A;  3MEP A;  1RVF 3;  4NIA A;  3S5Q A;  4ZON A;  1H4G A;  2FDJ A;  3LZZ A;  4Q4X 2;  1CPN A;  1MZ6 A;  3MF6 A;  5F1R A;  1AYM 3;  3VKM A;  4COU A;  3AKT A;  4I2O A;  4CCC A;  4IEZ A;  4IGP A;  3OUJ A;  2A70 A;  3M3Q A;  3QBQ A;  4FPF A;  4V2V A;  4CEY B;  2B45 X;  1RXG A;  2WN2 A;  1FPN 1;  1JMU B;  3LA2 A;  4PJY A;  5CFC B;  3SLI A;  2VVF A;  1W2O A;  2Y6K A;  4BM8 A;  5A1F A;  3OYW B;  1SFN A;  2FDF A;  3D4K A;  3I2I A;  3N7J A;  4FTS A;  3WQ1 A;  3FBY A;  2C9A A;  2YU1 A;  4D6S A;  3MUZ 1;  3FBM A;  2B46 X;  4P14 A;  1GWL A;  5AVA A;  4ARY A;  1S0G A;  2XON A;  5GKA C;  1RUF 2;  3HVD A;  2A6X A;  2XG3 A;  2MHF A;  2YRO A;  5D8A A;  4UXA A;  4YZ5 A;  2W0X A;  4LKE A;  2EA7 A;  3ZYR A;  1ST8 A;  3POB A;  5JXI A;  2R04 1;  1D2Q A;  2W52 A;  4QD2 A;  1LOF C;  5I0R A;  3I3E A;  1ZZ6 A;  4KH9 A;  4S2D A;  1UZW A;  4FPJ A;  4P9I A;  1TEI A;  1PVC 3;  1K45 A;  3E97 A;  5A32 B;  1W05 A;  4M4P A;  2A3W A;  3WQB A;  1PIV 2;  3RYP A;  4AFC A;  4TLG A;  4X6Q B;  3VBF B;  3O1M A;  4IEP A;  2RM2 3;  3KLS A;  1UMZ A;  2TEP A;  4XAC A;  4K21 A;  4P5Y A;  4UF0 A;  5KHH A;  1AZD A;  3WDU A;  1DBN A;  4N90 A;  1A78 A;  2CV6 A;  2ZGK A;  4XHX A;  4DXT A;  4M01 A;  4RGA A;  2WS9 3;  1LAJ A;  1UNB A;  3D3A A;  3N9M A;  3VBO B;  4XDO A;  1SEF A;  1M4W A;  3CHX A;  4FPE A;  4XEZ A;  1H8T C;  2E53 A;  4GD4 A;  3T3Y A;  3EO6 A;  4LO7 A;  3W5N A;  3KT4 A;  2VPV A;  2J22 A;  2FCU A;  3DPR C;  4XBQ A;  3WNX A;  3ZYH A;  3IN9 A;  1UO9 A;  5FXW A;  1ND2 A;  4XW3 A;  1F4H A;  5C5U A;  4FOQ A;  4Q5O A;  3ZYI B;  3I2F A;  1YCI A;  4SBV A;  1G8W A;  4QGN A;  4QWN A;  1WGP A;  4AED B;  4ZU4 A;  5FZO B;  2E7T A;  4WM7 A;  5DZG A;  2XGX A;  3VD4 A;  4S2F A;  5FZ1 A;  4Y22 A;  4GMP 3;  4O65 A;  1AX2 A;  4Q4W 2;  4PIX A;  1L3J A;  2QE3 A;  3FL7 A;  4XTP A;  4JRA A;  5ABJ B;  2WNV A;  5DZF A;  2GSY A;  2JB4 A;  2HYK A;  3DN7 A;  4B1L A;  4M3C F;  5LA1 A;  3ES1 A;  5DDJ 2;  2AC1 A;  1VB4 A;  1BEV 1;  4ATE A;  4MGS A;  4OQ8 A;  1QXR A;  1JOJ A;  3IPV A;  5FY9 A;  4COW A;  3I7D A;  5IVB A;  3J8F 1;  3I2O A;  5J3U A;  1V6I A;  2WFF 3;  1POV 0;  3I3Q A;  5HCB A;  4WVM B;  4GIQ A;  1KRI A;  1Y7B A;  2HWE 1;  4YGB A;  2OW4 A;  1SPP B;  2ZGN A;  2YGL A;  4EN6 B;  4AHW A;  1UOF A;  1K12 A;  4LBQ B;  5CAZ A;  4RSU A;  5FPV A;  5FZM A;  3KMH A;  4LOS A;  5IVV A;  1ZBE 3;  5KXD A;  4AZZ A;  2IXH A;  4LPL A;  3U75 A;  1UZZ A;  2P34 A;  4EQV A;  1N3Q A;  3LA7 A;  2Q8E A;  4FOY A;  2BBA A;  1IPK A;  4XQ4 A;  1NT0 A;  1PX3 A;  4RN5 A;  3WDW A;  2DUQ A;  2GNT A;  4Y33 A;  3VKO A;  3ZMN A;  2VUC A;  2ZMN A;  2Q5T A;  4CDQ A;  2R32 A;  4B29 A;  1HV0 A;  3AP7 A;  3L2Y A;  4RHV 2;  3WW3 A;  5KXE A;  3KGL A;  4LT5 A;  2YB7 A;  4PDW A;  1V9U 2;  3I54 A;  3H1Y A;  4KQ7 A;  5FBZ A;  2GC3 A;  1NQD A;  3W59 A;  4AFA A;  3I8T A;  3HJR A;  4QMA A;  3ENR A;  4UW5 A;  4ORF A;  2YBP A;  4KNC A;  2ZAH A;  4P5H A;  4XBN A;  4JHZ A;  5FPA A;  4D7S A;  4FI9 A;  4LBQ D;  1ZZC A;  3WUC A;  5LEJ A;  3HQU A;  3OD4 A;  5AVP A;  3M3C A;  1UY3 A;  3E1F 1;  4DOU A;  1PO2 3;  4QKB A;  1DZR A;  1UU6 A;  1W04 A;  2ZX1 A;  5FJH A;  3WVJ A;  1OUS A;  3NMB A;  5FK8 A;  5FZC A;  1CAX A;  1FMD 3;  4W65 A;  1X9T A;  2JIJ A;  2A1X A;  4B4R A;  2LAL A;  3WG4 A;  2AZ5 A;  5JDB A;  1PVC 2;  1D4M 1;  3OGR A;  3DL3 A;  1MVQ A;  5M0T A;  2MPF A;  4LUK A;  3EQE A;  4ITC A;  3ZXJ A;  1HX6 A;  4KG8 A;  2JXA A;  2Q8O A;  3TNP B;  4A3X A;  2H0B A;  5FZK A;  2OPW A;  4QX8 A;  2XJV A;  2DVG A;  2RS1 1;  3RSJ A;  3WDX A;  4JGY A;  3SEP A;  3JB4 C;  1B35 B;  4NPM A;  4QT6 A;  4WZC A;  4X8P A;  2WWS A;  1DQ4 A;  3BOW A;  4RD7 A;  4E27 A;  3GCX A;  3NKG A;  3PNA A;  1AR6 1;  4LIV A;  2JG9 B;  2PN5 A;  5KC5 A;  4IV3 C;  3SKJ E;  2ARC A;  3C7F A;  1JYT A;  5EJ1 B;  5CFC A;  4XJ9 A;  2HWB 2;  3V65 A;  2FDK A;  4GXL A;  3ZOI A;  3IDB B;  3OUH A;  1GQP A;  1RUH 1;  2XKO A;  1AYN 2;  2W47 A;  3OPW A;  2XLA A;  2JDN A;  4ISQ A;  3IT8 A;  4QU1 A;  4AI2 A;  1N3P A;  1MZE A;  5H9S A;  3FUO A;  1J1T A;  2B9V A;  4UW4 A;  4Y4R A;  1YQC A;  4NRP A;  1KS5 A;  3PUR A;  2P17 A;  4ONU A;  5DUV A;  5FOB B;  1JTZ X;  2A6W A;  2PHF A;  4YVW B;  3WG1 A;  3MPB A;  2VZR A;  3O0W A;  4XXP A;  3T2P A;  2ZX2 A;  4URA A;  1U5Z A;  1RMU 1;  1YFY A;  4GWN A;  2DFC A;  3IB3 A;  3BIW E;  3DKQ A;  1GUI A;  4FFH A;  2WT2 A;  4E2Q A;  5LB6 A;  1WA6 X;  3HEI A;  1PMJ X;  3VDA A;  1J58 A;  1QQP 2;  1XNB A;  3W5M A;  1V6N A;  4XUT A;  2CGP A;  4RQP A;  2D7F A;  2B7Y A;  4EN0 A;  3SMH A;  2WBK A;  4Q0P A;  1ZNP A;  1WZX A;  4DIN B;  1C8M 2;  4M3C E;  2O14 A;  3WLU A;  3RZL A;  4Z8B A;  1KEX A;  2PAK A;  4W6Y A;  5DPN A;  5JPN B;  4OZO A;  2ZCW A;  4BXS V;  2ZA9 A;  4ARX A;  3WF3 A;  1DFQ A;  2VMC A;  3VD3 A;  3ZDS A;  1H2K A;  3KSC A;  3PUS A;  4L11 A;  2ZZQ A;  5GZD A;  3KCX A;  4IV3 B;  4KG0 A;  3VZO A;  1O3Q A;  3DV8 A;  5FQ0 A;  2V72 A;  4YGE A;  3ZXK A;  1ND3 C;  4M0H A;  3M3O A;  5F5I A;  4TSV A;  2WO1 A;  4K1Z A;  4AR2 A;  4A41 A;  1F4A A;  1K42 A;  2Y6G A;  5BNP C;  4HXC A;  2ZEZ A;  5GLT A;  5DAW A;  1AYM 2;  4MHU A;  4LKF A;  4CXX A;  1CD3 G;  1ZA4 A;  3WR0 A;  5T5L A;  4DEQ A;  1RHI 2;  3OY8 A;  5CFC C;  1Q8V A;  5FFO C;  1W8N A;  4QAW A;  3KCY A;  4DFS A;  2VTX J;  3WT3 A;  1ONA A;  2A73 B;  1FOD 3;  2WAB A;  1Y9Q A;  3LCP A;  1BVV A;  1HRV 2;  4JQR A;  4XDQ A;  5C9A A;  1UKR A;  2VVD A;  4FP2 A;  3SXW A;  5JZG A;  1EV1 2;  2XJT A;  5JI9 A;  2CGO A;  1CGP A;  4OCT A;  1SG3 A;  1PIV 3;  2A3X A;  4NHM A;  4BXF A;  3JB8 A;  3K4Z A;  1ZZ7 A;  3RG0 A;  4A6S A;  3ACI A;  2WNV B;  1QKQ A;  1HXS 1;  1TG7 A;  2LRO A;  4EWD A;  2Z5W A;  4IE7 A;  3TN9 2;  1O3S A;  1F35 A;  3O0X A;  2V5Y A;  1K5M A;  3Q8F A;  3IPV B;  2UWC A;  1RGS A;  4XCA A;  3TNQ A;  3CMG A;  1N1Y A;  2XL7 A;  2DVB A;  3Q9O A;  4GJY A;  2VZS A;  4C0B A;  2W5F A;  4NHK A;  1DGL A;  2WNU A;  1GQH A;  2W1Q A;  3ATG A;  3MIC A;  4QQ2 A;  1A3K A;  5C3O A;  1BMV 1;  2OKX A;  5A7W A;  3GXU A;  1RED A;  4YFW A;  1FV2 A;  3NNM A;  3RMX A;  3NJZ A;  3HN1 A;  2VU9 A;  4K1Y A;  4ZPI A;  2EIB A;  5DAV A;  5FOJ B;  3O1R A;  2WZE A;  4JV4 A;  4TYS A;  4XQW A;  2XLF A;  4YW4 A;  4BMB A;  3VDB A;  4J25 A;  4AVS A;  1CAU B;  4NWW A;  4YW6 A;  1ODM A;  4HN0 A;  3SCF A;  5JWP A;  5FDB A;  4RGG A;  1HIX A;  1OLR A;  4AOC A;  4MH0 E;  4DO0 A;  5A1L A;  2VGD A;  2Y0O A;  4R4X A;  2JEM A;  4K8R B;  4Q4Y 1;  1GSL A;  4CEW B;  5C6C A;  2B8M A;  3SCG A;  4N43 C;  3ZR5 A;  4F3J A;  1ZBE 2;  3LQC A;  4C91 A;  4IQP A;  1TMF 3;  1UIK A;  2DV9 A;  4YM2 A;  2BFU L;  3TEZ A;  3ZO0 B;  1X8M A;  1R1A 2;  3QH6 A;  4R52 A;  1VBC 2;  4OUL A;  2AEN A;  4Z2A A;  2ZX4 A;  3I3B A;  3ZYJ B;  4IEW A;  2BVV A;  3MW2 A;  3V0B B;  2QQV A;  1VRH 3;  4W50 A;  1DYK A;  1W8F A;  4AHZ A;  3S5A A;  4I02 A;  1FMD 2;  2ZX0 A;  3RYR A;  1H1A A;  1CIW A;  5CYY A;  1S2B A;  1TME 2;  3IDA A;  2F4L A;  4Q4X 3;  1GU3 A;  1OXC A;  4QPI A;  3CJI A;  3IAP A;  4AG4 A;  3IDE A;  2YPD A;  3CEW A;  2OXB A;  2VUA A;  3M70 A;  3UGH A;  1OC1 A;  4ZKT B;  1FYU A;  4HBN A;  3NNG A;  4YW2 A;  1W03 A;  3M4F A;  4E8C A;  5LK7 B;  3EYP A;  3OG2 A;  3GBF A;  3NQH A;  3UJQ A;  1O5U A;  2JDM A;  1SDW A;  5FO7 B;  5JUV A;  3JBG 1;  4LKS A;  4PCR A;  1RUI 2;  4E8D A;  4QXB A;  4GWJ A;  5F32 A;  5IW0 A;  3E5U A;  5ACA 3;  3RI8 A;  1CAU A;  1LOB A;  5EZW A;  4NWV A;  4AGG A;  2WFF 2;  3BOD A;  3DPR A;  4CU8 A;  1LHU A;  2X05 A;  1XE0 A;  4B8E A;  1FOD 1;  2XJS A;  2HWB 3;  3GBW A;  1H8T A;  2GN7 A;  2CAV A;  4YGC A;  1VBB 2;  4H55 A;  3T1L A;  1HRV 3;  3JZV A;  1FI2 A;  4LHK A;  4EN8 B;  3VBU A;  4FQZ A;  3KS7 A;  1UPI A;  1W8T A;  1YYN A;  2E26 A;  2FCT A;  5IVF A;  3OSD A;  1QJY 1;  2Z42 A;  1ZVF A;  4HG6 B;  2VNO A;  2VXR A;  1RJ8 A;  2VZO A;  3FLP A;  2BGO A;  3NL1 A;  3TBD A;  4C8D A;  5L7O C;  1F8V A;  2YU2 A;  3KHB A;  1W2N A;  3PU8 A;  2RG4 A;  5ABJ C;  3LEM A;  3ZSE A;  1VBA 1;  5F5A A;  1TZO A;  1TE1 B;  2ADD A;  3ZMO A;  1RUE 1;  2YMZ A;  2BNN A;  4IET A;  3P6B A;  1ZBA 2;  3FMG A;  4Y5T A;  4OI1 A;  4CRQ A;  3WP6 A;  1UXX X;  3T2Q A;  1YHF A;  1KQR A;  1OLM E;  2E9Q A;  3USS A;  4Q0U A;  3OBT A;  1JYV A;  2YG0 A;  3KWV A;  2C26 A;  4NOT A;  3I2G A;  4N53 A;  4CDU A;  2DF7 A;  2PMW B;  1F31 A;  3FFQ A;  3KF5 A;  5J7M A;  4YRD A;  2RM2 2;  4A7Y A;  2QFE A;  5G04 L;  1OQD A;  2FBE A;  3IBM A;  1IKP A;  4FPG A;  1AJO A;  1VMF A;  4OI4 A;  3W20 A;  2PAM A;  4LO8 A;  4YW1 A;  1I9R A;  4M0N A;  2OQ7 A;  1EPW A;  2G9G A;  1HV1 A;  2QZ3 A;  4U2A A;  1W28 A;  3LEG A;  1GNY A;  3WCR A;  5IK5 A;  3UGF A;  2WQ4 A;  1QQP 3;  4HL0 A;  3N9P A;  1YNA A;  2BTV C;  3LFI A;  2Q8D A;  1LNS A;  1OA2 A;  1XYO A;  2A71 A;  2VCA A;  3B3Q E;  1SCS A;  4LMF A;  1JZ5 A;  1OSG A;  4MUV A;  5L36 A;  3S7I A;  1GNH A;  2R07 2;  4XFB A;  4PDW C;  5IYY A;  1PGS A;  5EIY B;  4AQS A;  1OA4 A;  4HSJ A;  3RWN A;  4QX2 A;  3NJX A;  4XDP A;  2OZJ A;  4AL9 A;  2A6V A;  1CES A;  2HBT A;  4GZ9 A;  1YI7 A;  4D3W A;  1WW4 A;  2CY6 A;  1KGY A;  4PF5 A;  4IE0 A;  3A0N A;  1ZZ9 A;  4GJZ A;  4QPY A;  1YI9 A;  2BVB A;  2VR4 A;  5FYV A;  1O5L A;  1WLW A;  3A22 A;  4KU8 A;  3APB A;  4PLN A;  5TSW A;  5EHD A;  1LR5 A;  4AVC A;  4BPZ A;  1UYZ A;  1XU1 A;  2PHD A;  2GDF A;  3JUU A;  5JMC A;  3MUY 1;  3BPZ A;  4K6B A;  1COV 1;  2ARB A;  2OUJ A;  2XBO 2;  5DDJ 3;  5LZ6 A;  2C1F A;  2C24 A;  2YV8 A;  3FC0 A;  3FX3 A;  2ZGO A;  1ALY A;  1OKQ A;  3QCW A;  1QJX 2;  4LBO A;  2D40 A;  2AEZ A;  2I45 A;  4FT8 A;  4K9S A;  4Y24 A;  4B7K A;  3NWK A;  1D7P M;  3FUQ A;  4QB6 A;  1T6B X;  5FV3 A;  2OYZ A;  2RR1 2;  5A33 A;  2JE9 A;  1JH5 A;  3IDC B;  4K3U A;  3T09 A;  4AWD A;  5F2S A;  2QUO A;  1VBA 3;  2DUP A;  2C4X A;  2HWC 1;  2CHH A;  3ACH A;  4GB3 2;  3WEZ A;  1R08 3;  1DQ6 A;  2DVD A;  3H1W A;  4YAR A;  2C0Z A;  4KMQ A;  4OHZ A;  3B5L B;  4HVR A;  3UKN A;  5FPZ A;  2DBN A;  3R05 A;  1W6Q A;  5IHR A;  1LHW A;  1REE A;  3AMN A;  4XMI A;  1I1E A;  2PA7 A;  4CTE A;  5JR2 A;  3OTF A;  3OGG A;  1QJY 3;  1OUX A;  3O1O A;  3JCI A;  2VQT A;  2QTW B;  3C7E A;  3HAG A;  1V70 A;  2IXK A;  5DMY A;  1WCK A;  5FY0 A;  1OF4 A;  5JOY A;  2ZKN A;  5KHG A;  3ZSJ A;  3U37 A;  2CAU A;  2Y0I A;  1XPW A;  5T5P A;  2WA3 A;  2R6Q A;  4QKF A;  2HWD 2;  3VL8 A;  2EIE A;  4F8A A;  5BPX A;  4A7Z A;  1OMI A;  3HQR A;  1OOP A;  2XML A;  1ENQ A;  2VW2 A;  5C8W A;  5HCA A;  3ECQ A;  5FP4 A;  3FLR A;  3WOG A;  5I93 A;  1AR8 3;  1QOT A;  5CVR A;  5K0U C;  2ZGM A;  1O8S A;  2QJV A;  3BI3 A;  1REF A;  4HVO A;  4ZU7 A;  4RGK A;  3P5B A;  1BVP 1;  1HRI 1;  4DNY A;  3O1S A;  4DRV A;  2ET1 A;  3CJI C;  3AK0 A;  4Y1Z A;  3KT7 A;  5JOW A;  3SQO A;  3ZSM A;  4DQA A;  5T52 A;  2YUE A;  4FPK A;  3CO2 A;  4GKY A;  5FP7 A;  3IZO A;  4LA2 A;  4DXR A;  5J1X A;  5FYB A;  2ZKL A;  2JD4 A;  4A2U A;  3H42 B;  4FPH A;  3T4H B;  2Z4F A;  5DUX A;  1T6G C;  1QJU 3;  1VJ2 A;  5A1A A;  2VZV A;  4QB1 A;  1WBF A;  2HWC 3;  3WNK A;  3KM5 A;  1AR6 3;  3AVS A;  4FAH A;  2ORX A;  1YQ8 A;  3MI8 A;  4XJ8 A;  2ZMK A;  4OLL A;  1Q56 A;  3UKT A;  1WLD A;  3BAL A;  1O3T A;  5IVE A;  1C1L A;  1O6U A;  4BQ2 A;  1VRH 1;  2YC2 A;  5C4W C;  4XUR A;  3Q8A A;  4BA6 A;  1C5H A;  4N8M A;  5CFD A;  2ARX A;  4XQD A;  3BOP A;  4AQ2 A;  1WME A;  4URT A;  4MGT A;  1X33 A;  3DPR B;  4FVV A;  2D6M A;  4KWK A;  4PI0 A;  3URF A;  1PMI A;  2VOX A;  1TME 3;  1TMF 1;  3VV1 A;  5FIX A;  1J1L A;  4LBQ A;  2XVL A;  3W58 A;  1IGO A;  3E6C C;  3MDP A;  5G05 L;  3M1H A;  1RUJ 1;  4NHY A;  2JG8 A;  4L97 A;  3AVR A;  3VKF C;  5FZ0 A;  3JD7 2;  4MET A;  3ZXE A;  4OHV A;  5DAX A;  5C9A B;  1YQ2 A;  3RRD A;  1RYY A;  3WF1 A;  3TEY A;  1B35 A;  1HB1 A;  1SQ4 A;  1WD3 A;  1X36 A;  3O1P A;  3MV0 1;  3T0A A;  1GOH A;  3D82 A;  4F7Z A;  4LO6 B;  4NPR A;  5E89 A;  2LM3 A;  3WDT A;  5FR3 A;  1ODN A;  1EAH 2;  2J1E A;  3KZ4 C;  1BBT 1;  3M8L A;  4YM1 A;  2BUK A;  3FE5 A;  5B2G B;  5KHI A;  4AEJ A;  2JB8 A;  4XFF A;  4XVH A;  4B4Q A;  1BYH A;  1VBE 3;  4B7E A;  1J3P A;  1PZ7 A;  1SBE A;  1RUG 1;  2DUO A;  4I30 A;  2R16 A;  3DYO A;  4OYU A;  3B00 A;  3AYD A;  4Q0S A;  1US2 A;  3CNA A;  1G6N A;  2BDR A;  3AX4 A;  4YZ4 A;  3ZFG B;  2QQL A;  2J1S A;  4RYD A;  3LA3 A;  1Z7S 2;  4WBB A;  2DVA A;  3AP4 A;  5F7U A;  3UV9 A;  5CAD A;  3AP6 A;  1W0O A;  3TB0 A;  4IE6 A;  3ZSK A;  2DCY A;  5C8C C;  1OH4 A;  1Q8O A;  3HOB A;  1ZA7 A;  1SLI A;  4I01 A;  2BBV A;  2FQP A;  2TNF A;  3LSD A;  1PGL 1;  2XUE A;  2Y6L A;  4L9B A;  5FZG A;  5ANQ A;  3OBZ A;  4XJU A;  1GZT A;  1RIT A;  2DBI A;  5FBJ A;  4J6G A;  3BUC A;  1RUF 1;  3LOI A;  3NAP A;  2ZGQ A;  3AKP A;  1FAT A;  2JG8 C;  1LJ7 A;  1MPX A;  1ND3 B;  1VBD 1;  3JBG 3;  3NV3 A;  3OYW A;  4FQ4 A;  3VZN A;  2D6P A;  4D7Y A;  1FXZ A;  2WRA A;  3VD7 A;  2Y33 A;  2W9X A;  1GFF 2;  5FZF A;  1TQ5 A;  5F3I A;  5BNQ A;  2UY9 A;  1S0B A;  1NOV A;  4GWM A;  4P9X A;  1MAC A;  2O8O A;  3CZU A;  3FLT A;  2WC2 A;  3MIB A;  1ZYB A;  3I2K A;  1IQA A;  5IWF A;  4NID A;  1PX4 A;  4KI5 M;  1NYW A;  3VDD C;  5DG1 A;  1NX9 A;  1RUE 3;  4QQP A;  2D6N A;  2D5H A;  1ASJ 1;  1HQL A;  3FJS A;  3ZKY A;  4AF9 A;  3HT2 A;  2BGC A;  1J83 A;  4XOG A;  2JKB A;  1SLC A;  3PTR B;  1W39 A;  4MV2 A;  1DIW A;  1XNA A;  1OQ1 A;  3W21 A;  1WBL A;  3WD5 A;  4ZY9 A;  1HQN A;  3J8F 3;  1QH6 A;  4S2H A;  2RJK A;  3OD0 A;  5FLI A;  3LPF A;  4LKD A;  2J1R A;  3O0V A;  3FN9 A;  4TWT A;  1C5I A;  1W90 A;  2EXJ A;  1R09 3;  4RR3 C;  1R64 A;  1Q5O A;  1VAM A;  4OHW A;  4Q27 A;  4TXW A;  4UWD A;  4BB3 A;  5H9P A;  3POJ A;  3PUQ A;  1UW8 A;  3OBA A;  1ULF A;  1M06 G;  5JMO A;  1BXH A;  2Q4S A;  2VCM A;  3WNP A;  4NHL A;  3VBR A;  2WIN B;  3CZJ A;  2Q1F A;  2KXL A;  3GM8 A;  3WP4 A;  3H8O A;  3PUA A;  2IZW A;  1CON A;  3N9N A;  3RMY A;  4I0A A;  4Y26 A;  1RUO A;  2EXH A;  1OHF A;  1QH7 A;  1A8D A;  1S1A A;  1UPS A;  2BWC A;  4JGZ A;  5LBF A;  3VHR A;  4CVU A;  4IL7 A;  4O7X A;  5SV5 A;  3I59 A;  5K0U A;  1LTE A;  3NO8 A;  2DTW A;  3AFG A;  4YG0 A;  3ZIX A;  1NCR A;  4EE2 A;  3ZIW A;  4Y20 B;  4IV1 C;  1JUH A;  1TNR A;  4EZH A;  3B9C A;  3CLP A;  4OI0 A;  1JZ4 A;  5DDJ 1;  2EVX A;  4FOW A;  4B1M A;  3VHO A;  1LEC A;  5JOZ A;  5FMO L;  2FZ1 A;  4PDW B;  1J3Q A;  2C9K A;  3J26 N;  2YFZ A;  1NY7 1;  5AFB A;  1JN2 P;  1YJL A;  4QHO A;  2XBO 3;  3EJK A;  2G4I A;  4LIT A;  3KD4 A;  1YIP A;  4MXW A;  2Y38 A;  5FYS A;  4DXS A;  2SBA A;  2Z2S B;  2FDI A;  3QLQ A;  3KV6 A;  4IV3 A;  2JDZ A;  4Q4V 2;  3ZFG C;  1D0H A;  5JSO A;  1V6L A;  3NNL A;  4CZS A;  3UES A;  5EFU A;  2WJS A;  4QX1 A;  1R08 1;  1PM7 A;  5ANN A;  5C70 A;  4DUX A;  2QQW A;  5D1I A;  2EID A;  2QVS B;  3WP3 A;  3I3M A;  2YY1 A;  3MYX A;  2DTY A;  1COV 3;  2G9Z A;  3N4M A;  1S2E A;  1AR9 2;  3LDK A;  2WWJ A;  3BVC A;  4HLT A;  5J37 A;  2JIG A;  2K46 A;  1O8P A;  1G9A A;  3B94 A;  2RV9 A;  2VBB A;  1APN A;  1Y9M A;  3DEC A;  3QAC A;  3DGT A;  4ZXE A;  5D8A B;  1SDD B;  4MLO A;  4DRR A;  1HN0 A;  5EXO A;  5FZD A;  3FHQ A;  2D98 A;  4O9G A;  1GNZ A;  3WCS A;  3ZKU A;  2RMU 2;  2ID4 A;  2XJP A;  4Z92 B;  1FV3 A;  1WMF A;  3EB7 A;  4FFG A;  1L7L A;  3D0J A;  3P3N A;  2EAK A;  3BU0 A;  4ZU5 A;  2J1U A;  5LAS A;  3MIH A;  1GAN A;  2BW8 A;  1QJU 1;  3DKW A;  3JQW A;  4XFC A;  2EXK A;  1E57 A;  1W6Q B;  4D6R A;  3USU A;  4L92 A;  4YLZ A;  4AGR A;  4ASL A;  5FY7 A;  1LES A;  4AI8 A;  5IFT A;  5DAQ A;  5FWE A;  2ZTN A;  5BNP B;  1WWY A;  4FAG A;  1JZ6 A;  1NA1 B;  2B42 B;  3DCQ A;  1Q43 A;  1X82 A;  1Y4W A;  1JOB A;  2E7Q A;  3UYJ A;  2HH9 A;  2Z79 A;  4LK6 A;  2VQ0 A;  2VQU A;  3VBS B;  5KXB A;  1DCS A;  2XB6 C;  2VD7 A;  4FCA A;  1GIC A;  1PGW 2;  3M3I A;  4QX7 A;  3THC A;  1AL2 3;  1YEW A;  5HV4 A;  3RYK A;  4E4S A;  4FFF A;  4I0W B;  1EY2 A;  3MLK A;  3MHZ A;  2CWM A;  1PK6 B;  3I97 A;  3JD7 3;  2WNO A;  4H2A A;  2E6V A;  4LHS A;  5EJZ B;  3GZU C;  1DGR A;  2MEV 2;  2GMM A;  2BZD A;  1ENR A;  2HEW F;  4XZP A;  1DG6 A;  5FP3 A;  5BV6 A;  5H9R A;  2YBS A;  3CF6 E;  4QM9 A;  4CCN A;  4O9E A;  2ADE A;  3PVE A;  5ERL A;  1QGL A;  1RTV A;  5FXX A;  1UU4 A;  1CR7 A;  1NE4 A;  3J7H A;  4WVZ A;  1RUN A;  5F5Q A;  2BOI A;  4QGL A;  1UZY A;  4XFH A;  5F5C A;  3U07 A;  2FD8 A;  1DQ1 A;  1RUH 2;  2ZOE B;  4RFR B;  1BHG A;  2V4V A;  4N53 C;  2R1B A;  3QD6 A;  1F2N A;  1W06 A;  3PUH A;  4O61 A;  3UJO A;  1UX7 A;  3POE A;  3WQ7 A;  4AFD A;  5HPO A;  4WV8 A;  3K2O A;  4JX0 A;  4BCU A;  4F83 A;  1XBF A;  2WQZ C;  3AZW A;  3O1U A;  4BQX A;  3H8X A;  3WXP A;  3ZFG A;  4QXK A;  4YFZ A;  3VHP A;  5FJK A;  1SAC A;  2PTM A;  3D0S A;  5K8S A;  1LRH A;  4H7M A;  4BLJ A;  1NE6 A;  4JZR A;  2GNM A;  3Q8C A;  3LDB A;  2VO5 A;  4P9J A;  2BPA 2;  5LW9 A;  1W0P A;  3H50 A;  5CB7 A;  3ALQ A;  5A70 A;  1QQP 1;  1W2T A;  3PIG A;  2DUR A;  1O4Y A;  5CIR A;  4AEM A;  3III A;  4L0P A;  4M4R A;  2A6Z A;  4OMD A;  5HXM A;  2WO7 A;  4CEW C;  3VBS C;  3IKW A;  1MQT A;  2WUH A;  3VBU C;  5A32 A;  2JKX A;  1MQT C;  3WSO A;  2OS2 A;  1PIV 1;  1W9Y A;  1QY4 A;  3H3U A;  5GLV A;  2JG8 B;  1ZZ8 A;  1U12 A;  1ACC A;  4W6X A;  4BK4 A;  5LCW L;  5CIS A;  1Z7S 3;  1RVF 1;  3VBR C;  1W6M B;  2RHP A;  5FP8 A;  3N7M A;  3UL2 A;  3F95 A;  1VBE 2;  3PUI A;  3ZYF A;  3RZZ A;  2DVF A;  4CCK A;  4HPK B;  1HJG A;  2CNA A;  5LA2 A;  1GQG A;  2RS3 1;  1S0E A;  1HW5 A;  4RR3 A;  1S0C A;  1N47 A;  1KJR A;  2DWR A;  2J1A A;  4JCK A;  1U0A A;  4QQH A;  4Y1X A;  5FAX A;  5GJ6 A;  1UKG A;  3ZFE A;  5J96 B;  3ZM8 A;  3UNP A;  1WUV A;  1CAV A;  3N35 A;  2VTX A;  3K46 A;  5D8A C;  5LWB A;  2YGM A;  2ZGP A;  4KBZ A;  2WNU B;  4HON A;  3GZA A;  4HKW A;  1RHI 1;  3KQ4 B;  5CNA A;  2QBX A;  1UY0 A;  1SBF A;  4QPI C;  2RS5 2;  4C1W A;  3AYC A;  4J1X A;  1LU2 A;  4XBL A;  3N3H A;  3HMY A;  4XF1 A;  4ATF A;  4UBH A;  1HRV 1;  1RUI 3;  4LR4 A;  2W1S A;  4NUB A;  4Q4W 1;  1NZI A;  5FYM A;  2VZ1 A;  3VZL A;  1DDL A;  3ROU A;  3T30 A;  1YIF A;  1QHD A;  1QJZ A;  1ULC A;  2RDQ A;  3S30 A;  2BU9 A;  3PME A;  1AF9 A;  2BOJ A;  3AXE A;  3VBU B;  2VUD A;  1HXS 2;  1OPO A;  5I91 A;  3Q8E A;  5CFD B;  4PT6 A;  2IXJ A;  3J8F 2;  3IMN A;  4LBL A;  4XJW A;  3TWI A;  2Q0A A;  3BKZ A;  4AVV A;  1A6C A;  3PVN A;  5CG9 A;  1LGN A;  4LK7 A;  3CDZ B;  4DS0 A;  4I3G A;  3E5Q A;  4YVW C;  5J48 A;  4PIY A;  2Y6F A;  2CDO A;  4IV1 B;  5JIA A;  1VPH A;  3GAL A;  1UY2 A;  1OPM A;  3KB5 A;  3EMR A;  3TAY A;  5C8C B;  2ZGR A;  3OEB A;  3U4S A;  1QNW A;  1VAK A;  2D44 A;  2QDN A;  4YYO A;  1Y3T A;  3U11 A;  2JE8 A;  5JCT A;  3VKL A;  2NZ9 A;  2RS3 3;  1NCQ A;  3MIF A;  2VBD A;  1DZT A;  1HB4 A;  1JHJ A;  1KDK A;  2KM2 A;  3DXU A;  2QQJ A;  5I8Y A;  2FMY A;  3ZFF A;  4P9G A;  1MVE A;  2JDA A;  1IHM A;  1OD3 A;  4LBJ A;  2WZR 3;  1J3R A;  2ZJC A;  5FYT A;  1BLZ A;  1UWW A;  4AHX A;  4AQT A;  2BJS A;  1OF3 A;  3BU7 A;  1JU3 A;  5FZH A;  3GHM A;  3VBH A;  4QDR A;  4XPV A;  3OOX A;  1N1V A;  5GZG A;  2ES3 A;  2A3Y A;  2AGS A;  2WII B;  1OOP B;  5FZE A;  1ZBE 1;  4QX3 A;  2NMO A;  1YFW A;  3ZSL A;  4CCO A;  3AMH A;  4PHZ A;  1H2M A;  2V5D A;  3LPG A;  4FXG B;  5A6Y A;  3BB6 A;  4UFH A;  4EN9 B;  1VBC 1;  2E51 A;  2Z69 A;  2VZQ A;  3K4D A;  3LFM A;  3AL5 A;  3AM2 A;  2ZGL A;  5A3O A;  5BYN A;  4HFS A;  1D4M 2;  1WW6 A;  5IK8 A;  5CFD C;  4YPJ A;  2JD9 A;  1FMD 1;  1V9U 3;  2WA4 A;  1CZV A;  1W6N B;  1ZBA 3;  2VW1 A;  2WZ8 A;  4YW3 A;  5LRS A;  1DHK B;  1FT9 A;  4XFA A;  2D3P A;  1G9F A;  1VRB A;  1WCQ A;  1F5F A;  3TN9 3;  1UMI A;  2I74 A;  2R7E B;  1RUG 3;  3KV4 A;  5JLV A;  4JDN A;  2PFW A;  3EHK A;  5IJR A;  5FO8 B;  3SNM A;  1IG3 A;  2YPJ A;  2VW0 A;  1O59 A;  2YZ4 A;  2ZAA A;  1CPM A;  2RJ2 A;  2EF6 A;  5J98 B;  2R07 3;  2WAO A;  1S0F A;  4HAN A;  2LTN A;  4YM0 A;  1EAH 3;  2A75 A;  2IVJ A;  5A3W A;  5FPX A;  4BU2 A;  1O4T A;  1LOG A;  3N9Q A;  3NV1 A;  4A45 A;  3B7M A;  2P3I A;  2VEC A;  2VL4 A;  2WDB A;  4M00 A;  3OEA A;  4YG3 A;  4D69 A;  5C3Q A;  1UU5 A;  4JDM A;  2WZR 2;  1O91 A;  1OH3 A;  3B93 A;  4SLI A;  5FMD A;  3S0M A;  1AL2 2;  2IC1 A;  1KFU L;  3OPT A;  3ZR6 A;  2DCT A;  1VBD 3;  2ZS6 B;  4UFI A;  1GYK A;  1QXP A;  1LEM A;  2CDP A;  3BPS A;  2OX0 A;  2W91 A;  4A4A A;  3H0O A;  1OQE A;  1OOP C;  1UQX A;  3ZLI A;  1AR9 3;  4RQP C;  4WVV A;  2BNO A;  3C8X A;  4CEY C;  4MVT A;  1V00 A;  2L9L A;  1PMH X;  1MQT B;  4BDV B;  4IW3 A;  4MAD A;  3WV6 A;  1NA1 C;  4IEY A;  1JUI A;  2XJR A;  3LGR A;  2PHW A;  3VDD A;  2R04 3;  5I0U A;  1RUE 2;  1VMH A;  2AAC A;  3KGZ A;  1MEC 1;  2GP3 A;  1C8M 3;  4CP0 A;  1LUL A;  3OCP A;  4BE3 A;  4ISR A;  4QHB A;  3ZDV A;  2R1D A;  4Y3O A;  5A3P A;  1WMD A;  3JQX A;  3A23 A;  4LBM A;  2V73 A;  5FMO S;  2R06 2;  2ARA A;  5DXD A;  4ET7 A;  3T0D A;  4ES8 A;  3ACG A;  2PHX A;  5FY5 A;  2MEV 3;  2Q1M A;  2VNR A;  3ON7 A;  3H1M A;  1AVB A;  4R8H A;  1UF2 C;  3WF2 A;  4BIO A;  2VY0 A;  4E2S A;  1XU2 A;  2K0G A;  4CCL A;  5EYX A;  5FXV A;  2JDP A;  3ST7 A;  3H7J A;  2HWF 2;  5CKN A;  1EYB A;  2Y26 A;  3O14 A;  4JGY C;  5C3R A;  5KBF A;  4TLF A;  5CKM A;  4D6Q A;  2K9Z A;  1YO8 A;  4XUN A;  3BCW A;  4JHT A;  5ACA 2;  2P37 A;  3WY6 A;  1V6O A;  4LEJ A;  3NST A;  3ZN5 A;  2UWB A;  2R07 1;  4WVM A;  4Q0Q A;  1SMV A;  4FBF A;  1CX4 A;  3ILN A;  5FZ4 A;  1Y9G A;  4XHB A;  3K3O A;  1YFU A;  4ERO A;  4QDQ A;  3ETP A;  1Q3E A;  4YVW A;  3AKR A;  4QPI B;  1TNF A;  2ZZJ A;  2A5Z A;  4C1X A;  4UFJ A;  4MG2 A;  3MBW A;  3TN9 1;  1SFP A;  2XQX A;  1XNT A;  2KA3 A;  1FX5 A;  2PHT A;  4WZF A;  2PEL A;  4OHX A;  4AFM A;  1WCS A;  4JTN A;  4RS5 B;  1UD1 A;  3MIE A;  1CAX B;  2XBO 1;  5A3U A;  4V2W A;  5I0T A;  1GKB A;  2IVI B;  2R0F A;  5IK7 A;  2LW8 A;  2BYV E;  2D5F A;  3CJI B;  3E5X A;  4BLI A;  3RWK X;  3BTX A;  4GMP 1;  2WS9 1;  4KGG A;  4NII A;  5FZ9 A;  1NG0 A;  5T3N A;  2RR1 1;  4LTA A;  4LO5 B;  4NAO A;  1PZ9 A;  1LHN A;  4NR1 A;  4YNI A;  4DUV A;  4OUE A;  2ILM A;  1ENS A;  4CU7 A;  1RUD 2;  1N1T A;  2VNG A;  4HSL A;  5FQ0 B;  1QNY A;  4HZF A;  3ZYB A;  5BNN B;  3GZE A;  3ZN6 A;  5JSP A;  4BQ5 A;  1NZC A;  4OI2 A;  1POV 1;  1KXG A;  2NM1 A;  1V0A A;  1VR3 A;  4OUS A;  3MO4 A;  5FUP A;  1W0N A;  4XZU G;  3VGI A;  2W95 A;  1LOC A;  2ERF A;  2CGN A;  2IWG B;  3E6D A;  4Q4Y 2;  3GZT B;  5LAT A;  4R9B A;  2BEO A;  5FUI A;  5FY8 A;  3B02 A;  5LY2 A;  4RL7 A;  4ES9 A;  1KD7 A;  3AC0 A;  2ZX3 A;  2GAL A;  2HEV F;  2PAE A;  5L7O B;  4LO4 B;  3RVH A;  3WNO A;  1RUC 2;  2D6K A;  1W9T A;  5J36 A;  5FY4 A;  1AX0 A;  1W8Z A;  3LAG A;  3CU7 A;  2IXI A;  4YG6 A;  4YWA A;  5EYY A;  2X29 A;  4L8Q A;  1RC6 A;  5F2W A;  4WM7 C;  1K3I A;  4N43 B;  5E6H A;  3T08 A;  1STM A;  1TME 1;  4BQ3 A;  4Q4V 3;  5GM0 A;  1HRI 2;  2EAA A;  1VIW B;  1D4M 3;  1W8U A;  4Q29 A;  1UMH A;  4N7U A;  1CZT A;  1SZB A;  3C7G A;  5FZI A;  5GLZ A;  3SH5 A;  3UGG A;  2KR2 A;  5L9R A;  5LA9 A;  5LRR A;  1PO2 2;  4E4H A;  3A21 A;  5LBE A;  2QQU A;  2NPI A;  2OII A;  5FPU A;  1VAL A;  3LIH A;  2FHR A;  4QX0 A;  3CBN A;  2RS1 3;  4COZ A;  1DLC A;  1Z0H A;  3JBG 2;  1R09 1;  3I2H A;  4KWL A;  4KGQ A;  1H0B A;  4W4Z A;  5IVC A;  2J1T A;  3RNS A;  1Y43 B;  5A6X A;  3GCW A;  1GWM A;  5AC9 1;  4QXC A;  1D2S A;  1OT5 A;  2D43 A;  2B5H A;  5BY5 A;  4HK8 A;  4QXH A;  3D5O A;  5GLU A;  4EYU A;  3N9O A;  1EUT A;  5E16 A;  2RDN A;  4AI1 A;  4Q4X 1;  1VBB 1;  4PQ9 A;  4I3P A;  3AP5 A;  4X8N A;  5APA A;  4BQ1 A;  1YQ5 A;  3IIA A;  5CU1 A;  1DQ5 A;  3VBH C;  3RZH A;  2BFU S;  3KQR A;  4DPN A;  1AXZ A;  4BOW A;  2JX9 A;  3T2O A;  2TUN A;  2YXS A;  4BHP A;  2JWP A;  4AE2 A;  5A7Q A;  4Z82 A;  1TMF 2;  3BGA A;  3NJY A;  1PO1 2;  4Q1R A;  2QDR A;  4KL1 A;  4CXY A;  1POQ A;  4Y1Y A;  5EWS A;  2ZAC A;  2ZBJ A;  3POF A;  3RS6 A;  4N43 A;  4Q0V A;  1ZRI A;  2UYA A;  5F37 A;  3V0A A;  1PHM A;  1SLA A;  4NJ4 A;  4CXW A;  4LIU A;  4CUB A;  3AZZ A;  1KFX L;  4Q4Y 3;  4GH4 B;  4WM8 B;  3WW2 A;  2QQP A;  1CWP A;  1XNK A;  3X29 B;  3TRS B;  1DYO A;  2F4P A;  2VJX A;  1ZBA 1;  3POW A;  2H0V A;  4QQL A;  2PHR A;  1GLH A;  2TBV A;  1ULP A;  1X9P A;  5F3C A;  3ES4 A;  5ISL A;  1W6N A;  2R04 2;  3NNF A;  1BK1 A;  1BBT 2;  1W6P A;  1V6J A;  2VMF A;  5E8A A;  1RIR A;  5JI7 A;  3D8C A;  3AB0 A;  2GNB A;  2RM2 1;  2VMG A;  1AX1 A;  1MS8 A;  1RL3 A;  2BWA A;  2CSG A;  2XWJ B;  3O1T A;  4UAP A;  1XXN A;  2HWE 3;  3JU9 A;  1LGB A;  2BP6 A;  3ZN6 B;  2HBU A;  2I07 B;  2XUM A;  4FXK B;  1RHI 3;  5K7P A;  1AXY A;  1Z78 A;  1AR7 1;  4AXO A;  2JDU A;  2P5B A;  4NPL A;  1SCR A;  1ZRR A;  3LEK A;  1PGL 2;  4FPO B;  1C1F A;  2VOV A;  2FZ2 A;  1S0D A;  3NV2 A;  2GP5 A;  3IAQ A;  4ZS3 A;  2XR4 A;  2WR9 A;  4XUQ A;  3VBR B;  1JYW A;  4MYE A;  3N7K A;  3OGJ A;  3HQX A;  1CAW B;  2DYC A;  2PLV 2;  2XHN A;  3OB8 A;  2QKD A;  5EJ3 A;  3J9S A;  3ZFF B;  5DAB A;  4CDU C;  3RQ0 A;  4C0H A;  1G7Y A;  4UW6 A;  4FPL A;  4LOT A;  4M3C A;  1MS5 A;  1EUU A;  2XPJ A;  1WMX A;  3GDB A;  3LSE A;  1JI6 A;  3A0K A;  3WG2 A;  1TVG A;  1DP0 A;  2JE7 A;  5C9A C;  4BIF A;  5JZG C;  1FNZ A;  2GZW A;  3ZYG A;  4WM8 C;  1G9D A;  1H9W A;  4MHR A;  4MGI E;  1BEV 3;  4CP2 A;  4HOO A;  5A7W B;  4G4F A;  4LOR A;  2OPK A;  1VB2 A;  5ABJ A;  1ASJ 2;  3TEW A;  4YZ3 A;  5CBL A;  2CTV A;  2VCC A;  3S7E A;  4IEU A;  1KDM A;  4S2G A;  4R9C A;  3ACL A;  1CJD A;  2RDR A;  4FP3 A;  2YBK A;  4R9D A;  4MX3 A;  3WNM A;  4LBK A;  4BQ4 A;  4U36 A;  2DCZ A;  4L99 A;  2YDE A;  2J42 A;  2XDV A;  4CUG A;  3ZFE B;  5I0S A;  1UOJ A;  1NCR C;  1PK6 A;  4XYX A;  3ZN4 A;  1JU4 A;  2WO3 A;  4FPC A;  3ZX7 A;  5IAV A;  1ND3 A;  4CUC A;  3WNN A;  4NRQ A;  1QJX 3;  3LE0 A;  2HWE 2;  3MID A;  3ZYP A;  5LY1 A;  3ZXF A;  3ELN A;  5T5J A;  4K8F A;  4RS5 C;  2XJU A;  3LWC A;  4CU6 A;  2YC0 A;  1W2A X;  1IS4 A;  2XHK A;  5FCC A;  2ZGS A;  4AI0 A;  4UBG A;  2FDG A;  1GZW B;  4GUL A;  1BBT 3;  3PL0 A;  4UF0 B;  4B3N A;  5JAX A;  2PQQ A;  3VB9 A;  5IFP A;  3U4X A;  1JZ3 A;  2EIC A;  3OUI A;  5KR7 A;  2X5I B;  3SEE A;  4NRO A;  2V4A A;  2VH9 A;  3IMM A;  1OLM A;  3B69 A;  1QXJ A;  4IES A;  2W94 A;  4GQ7 A;  4OVE A;  4UFL A;  3ZXA C;  4HKO A;  2D3S A;  2JEC A;  4R9A A;  1CZS A;  4KWJ A;  1VBC 3;  2E31 A;  5FMC A;  4BZ4 A;  2Q30 A;  5FZA A;  3PIJ A;  3LOB A;  3WHT A;  1F15 A;  3CKH A;  5B4N A;  3POY A;  2X5I C;  1WLT A;  1X7N A;  4KWU A;  3FZ3 A;  2ZEX A;  4DEV A;  3E6B A;  1HKD A;  1QU0 A;  4Q4V 1;  5BXX A;  1S55 A;  2PHL A;  4DZG A;  4CA9 A;  1O3R A;  5FYZ A;  3V0A B;  2HLE A;  1MS3 A;  3VN4 A;  2MNG A;  3VD5 A;  1AR8 2;  1MZ5 A;  1N3O A;  1FNY A;  4QB2 A;  1UY1 A;  1I3H A;  2E32 A;  1KS4 A;  3AXD A;  2UYB A;  3HR9 A;  3VHN A;  3VZK A;  4MXV A;  4TTG A;  5GAL A;  5H9Q A;  1RUD 3;  3WF0 A;  4D94 A;  1H1I A;  4ASM B;  1PVC 1;  1AR9 1;  3G7D A;  3WIN E;  1VAV A;  3I59 B;  1DZQ A;  4XAE A;  5K0U B;  3KHC A;  1JS9 A;  2HWD 3;  1UZ0 A;  3PJQ A;  4Y22 B;  1ULO A;  3FWE A;  3HIF A;  3PLQ A;  4WM7 B;  1UYP A;  3IWZ A;  2IXC A;  3VL9 A;  1H6X A;  2UUR A;  1F9K A;  1QDO A;  2X10 A;  1DYP A;  4MXW B;  2RMU 1;  2BQP A;  4JRL A;  3KF3 A;  3MZH A;  1JBC A;  4IXL A;  1AUY A;  4CCE A;  4GWI A;  2VVE A;  5L19 A;  1AR6 2;  5FRE A;  3S6P A;  4XCB A;  4EWA A;  1IQD C;  5F6L B;  1VRH 2;  4Y20 A;  4CDX A;  3MW4 A;  3GGL A;  3R4U A;  2HWB 1;  2C6S A;  5FO9 B;  1J84 A;  1W9S A;  2QZ2 A;  1AYN 1;  2VZT A;  3J7N A;  4IDZ A;  4Q4W 3;  3HNB M;  2WNU C;  3BTZ A;  1OA3 A;  1FPN 2;  3O7O A;  4PF1 A;  3N9L A;  3VBF A;  5BNO A;  1RUJ 2;  2XLG A;  3HBZ A;  4LUM A;  1QOO A;  4OUM A;  1PGW 1;  3H9A A;  3RZJ A;  3C7H A;  3J7L A;  1E5H A;  1NXD 1;  3ACF A;  3ILR A;  1S4C A;  1HRI 3;  3EXU A;  3KV5 A;  1NLR A;  3VDC A;  2W2I A;  5A3T A;  5HXV A;  2W1W A;  1AL0 G;  1OFS A;  4L2N A;  2QQO A;  2X53 S;  2RS5 3;  2ATF A;  2OA2 A;  4AFB A;  2JIC A;  1WW5 A;  4LNV A;  4CDQ C;  3M3E A;  5GZE A;  1BJQ A;  1G86 A;  4PLM A;  1URX A;  4UYB A;  3WHU A;  3ZXD A;  4A7K A;  1YFX A;  1HXS 3;  1D4V B;  1HLC A;  1NXM A;  1NLS A;  5E88 A;  4QHZ A;  2ZAB A;  3K75 B;  5C4W A;  5F39 A;  1HB3 A;  2XXZ A;  1NA1 A;  2IFW A;  3RGB A;  2ZHM A;  4K20 A;  5JXG A;  2HJI A;  5FPB A;  1Z7S 1;  4COV A;  1JZ2 A;  4IGQ A;  4MO3 M;  1W6P B;  1A34 A;  2FCV A;  4WVW A;  2WT1 A;  1PNF A;  2J7M A;  4UW3 A;  2CYF A;  4HK9 A;  2EIG A;  2YFU A;  4IEO A;  4H3W A;  2B9U A;  1CAW A;  1ENX A;  2XJQ A;  4AVA A;  1V6M A;  2WAA A;  3NAP B;  1JZ7 A;  2WYS A;  1YQ6 A;  3ITQ A;  4EV0 A;  3ABZ A;  2WWU A;  3BTY A;  5C3S A;  2VOT A;  1R1A 3;  5D2A A;  1W2U A;  3DXT A;  5A33 B;  5FKB A;  1H2N A;  4YZ2 A;  2BGP A;  1VMJ A;  3HT1 A;  1LOA A;  4IEV A;  3CJX A;  3SHR A;  1HN1 A;  5EV7 A;  5FPL A;  5A7S A;  4A6O A;  2NMN A;  3K48 A;  2NP0 A;  5IVJ A;  1MZF A;  5SV8 A;  2WNV C;  1G9B A;  5AC9 3;  2R49 A;  1GV9 A;  3DYP A;  4HN1 A;  1PO1 3;  1QIQ A;  2VXJ A;  1GR3 A;  2D97 A;  3MGU A;  3QOP A;  5FZ8 A;  1WA4 A;  4NO4 A;  5JR7 B;  4E2G A;  1IS3 A;  3AL6 A;  1E5R A;  1US3 A;  1EV1 1;  2EAL A;  4CU9 A;  5EPA A;  5BUV A;  3H8R A;  4CDW B;  1ND2 C;  2E63 A;  2QQI A;  3POG A;  2OQ6 A;  2P3K A;  2WO2 A;  2XVK A;  3OBR A;  5C3P A;  3UET A;  1BEV 2;  4MOA A;  3W9A A;  4BH9 A;  1VBE 1;  2HWF 3;  3CL1 A;  4XFI A;  5C33 A;  2XWB B;  1HQW A;  2WNE A;  4G3Y C;  2RS3 2;  2WT0 A;  1LEN A;  3GNE A;  1H1M A;  2GH2 A;  3ORJ A;  4AI3 A;  4LHN A;  4LLF A;  4CSW A;  2YYO A;  1IG0 A;  4AHY A;  1W6M A;  4HET A;  5F3E A;  5FYH A;  4C90 A;  1ULG A;  2PLV 3;  4NAM A;  3GJB A;  1DGW X;  1H4H A;  3AJY A;  2B4K A;  5T54 A;  5KHK A;  2VNV A;  3U78 A;  5A80 A;  2RS5 1;  1BMV 2;  4JGZ B;  3LB9 A;  4N9I A;  3AKQ A;  3U14 A;  4BK5 A;  5IT6 A;  1NLQ A;  2VM9 A;  4CDX B;  4PLO A;  4XET A;  5L9V A;  1ZRF A;  2P6C A;  1ZRC A;  1RIN A;  4UOJ A;  5K9Y A;  4JKK A;  1LOF A;  1OD5 A;  2X8K A;  3L2H A;  4E4Z A;  3ZXL A;  2QQN A;  2VME A;  4NHX A;  1Q8Q A;  1POV 3;  4RHV 1;  3ZFF C;  4MGK E;  1U5I A;  1ZZB A;  4QX5 A;  4AQ6 A;  3NRU A;  3GYD A;  3AYA A;  2NYY A;  1V9U 1;  3GJA A;  1RUC 3;  3WF4 A;  3V0B A;  2AYH A;  4CDX C;  4MSV A;  3AYE A;  3P3P A;  5T5O A;  4QPG A;  1LOD A;  2NN8 A;  3N36 A;  1C4R A;  4YZ1 A;  2P1B A;  1AXK A;  2D3R A;  1SLB A;  2EXI A;  4DY5 A;  1QJF A;  1R08 2;  2QNK A;  1RMU 3;  1HJF A;  1SBD A;  2VOW A;  3NV4 A;  4A42 A;  1MS4 A;  1JYX A;  3PDQ A;  1W8W A;  3V64 A;  3C2U A;  4Y1U A;  2IUW A;  5FMB A;  5DUW A;  4Y1V A;  4JC1 A;  3NJV A;  4Z07 A;  2P2K A;  1H6Y A;  3H8U A;  5J09 A;  5FYC A;  4TN7 A;  3PTY A;  1YC6 1;  3RJ2 X;  4EWE A;  1GP4 A;  4N53 B;  5BNN A;  2RS1 2;  1F5J A;  1GBG A;  2ZHK A;  2O1Q A;  3OJB A;  4QDS A;  3CIH A;  3FHA A;  4COY A;  5GLW A;  4XAA A;  3D6E A;  5JIU A;  4Q2F A;  3R4D B;  4LBN A;  3KVA A;  3AZV A;  4XMA A;  5I8S A;  1LOE A;  5F9T A;  1QJU 2;  1UOB A;  1K5J A;  5A6Q A;  2IFR A;  2X5I A;  4ZHN A;  2A7A A;  3M7A A;  5T50 A;  4GKX A;  4X6R B;  4NIH A;  4PQQ A;  1OFN A;  3MV1 1;  5EQU A;  1J59 A;  3I3D A;  4CPB D;  3S57 A;  4CEY A;  1FOD 2;  3K77 A;  3BIE A;  3ZFE C;  2LRP A;  2YHJ A;  3VUO A;  4A44 A;  2Y8K A;  4CP9 B;  1QEX A;  1WKY A;  2NLR A;  2I2S A;  1UL9 A;  1H30 A;  3BTA A;  3A4U A;  5F6K A;  5HCF A;  1KIT A;  2ARE A;  1GWK A;  1JYN A;  1MS1 A;  1YLL A;  4GAZ A;  1RMU 2;  3TYJ A;  5FZB A;  2IXL A;  3C7O A;  4YVS B;  5C5T A;  5JZG B;  1BZW A;  2W46 A;  2HEY F;  1V6K A;  4NRM A;  1EP0 A;  4MGQ A;  2MEV 1;  4RS5 A;  4IEX A;  2XQR A;  4CCD A;  3RZK A;  3H7Y A;  4XJZ A;  5KHJ A;  1IPS A;  1BK0 A;  2RDS A;  1VBA 2;  2WN3 A;  1C8M 1;  4NE9 A;  3VBS A;  4CP1 A;  1AR7 3;  3DUI A;  1PNG A;  1O7F A;  1PK6 C;  3IM0 A;  2JG9 A;  3WW4 A;  1DGR N;  2QCS B;  2G19 A;  2OZ6 A;  5I0D A;  5A3N A;  2GMP A;  3PVO A;  2ZEY A;  4AAX A;  4HVQ A;  3ASI A;  3ZVX A;  1OVP A;  1IZ3 A;  3ZPO A;  4LE3 A;  2GC0 A;  4NN0 A;  3CQO A;  1SLL A;  2R0H A;  2WL1 A;  2UWA A;  4M3C B;  4DB5 A;  3RPQ A;  4AK3 A;  4ZZ5 A;  5HV0 A;  4LQR A;  4TZD A;  2B39 A;  5LA0 A;  1JYC A;  1WCD J;  2VAU A;  4UI9 L;  4CDU B;  3MF9 A;  4LXL A;  1S2K A;  2N7G A;  4QPW A;  3RDI A;  5FLH A;  3KV9 A;  2GC2 A;  1WD4 A;  3RZM A;  5JPM B;  4JKL A;  2DDU A;  3O5S A;  4ZZ8 A;  1AYM 1;  1QDC A;  2G9F A;  1ULE A;  1XJA A;  1MS0 A;  3B01 A;  4GAL A;  5FYU A;  3SCH A;  4YSF A;  1RUF 3;  3THP A;  5F8P A;  1IS5 A;  4PIZ A;  4GH4 A;  2ENR A;  4CDW C;  2P3J A;  3T4V A;  2FMD A;  2PXJ A;  4H7L A;  1MEC 2;  4Y5S A;  3WQ0 A;  4P02 B;  1Q8S A;  2J1V A;  4LLO A;  2PHU A;  4QPG B;  4AAP A;  3H3Z A;  1IPJ A;  1QJE A;  4H14 A;  4XIL A;  2HKX A;  2DCJ A;  2VZP A;  2WZP P;  3NKT A;  4HMZ A;  2WFP A;  4QGM A;  1WW7 A;  1XOY A;  2RVA A;  4CCM A;  4DIQ A;  1W9F A;  4FTB A;  2VBP A;  2R06 1;  2GC1 A;  1RVF 2;  2C5D A;  3NVC A;  4XF0 A;  3H3L A;  4FPY A;  1NCQ C;  5A7O A;  1GOF A;  4P9Y A;  3VZJ A;  4PI2 A;  1CN1 A;  5DQ0 A;  1U5Y A;  2VMD A;  2Q8C A;  4FSJ A;  5LBB A;  4CCJ A;  2W92 A;  1GP6 A;  5JXJ A;  3THD A;  1XSQ A;  4KBB A;  3JXS A;  1CX1 A;  4P08 A;  4XF3 A;  1W9W A;  5EP9 A;  2BV4 A;  2PQS A;  4IND A;  5ACA 1;  1YUD A;  1G9C A;  3AKS A;  4XIK A;  1D0G A;  1DQ0 A;  2HWC 2;  5DAP A;  3RJR A;  4IER A;  5DUU A;  1O4Z A;  4Q26 A;  2WSV A;  3WDY A;  4LUL A;  3BN6 A;  1SFY A;  4OMC A;  3ME2 A;  2XOM A;  3VD9 A;  3DYM A;  3M2M A;  1X50 A;  5I8T A;  5FY1 A;  1DF0 A;  1CJP A;  3N7L A;  5B4X A;  4RA0 A;  1NQJ A;  2AEY A;  4CP9 A;  1XB9 A;  2P3Y A;  5DZE A;  4UFM A;  4QPG C;  5FZO A;  1UY4 A;  3SH4 A;  1HDK A;  1XE7 A;  4RHV 3;  1GZ9 A;  1XQN A;  3PJY A;  3ILF A;  2HWD 1;  3WX5 A;  3UT0 A;  1IS6 A;  3MW3 A;  3HD8 B;  1JOD A;  1KJL A;  1UAI A;  1R1A 1;  4LE4 A;  4RQP B;  4AGV A;  4BQY A;  3WW1 A;  4NIG A;  5IVY A;  1C57 A;  3HPN A;  1H9P A;  4PBP A;  4QKD A;  2RE9 A;  2WS9 2;  5FRA A;  1IOA A;  3VZM A;  2ET7 A;  4R4Z A;  3WZ1 A;  4BJ0 A;  3OGV A;  1UXZ A;  1EPZ A;  1CVN A;  1RUJ 3;  4XTM A;  1LGC A;  3WDV A;  4OFG A;  4JQT A;  4OQ9 A;  2D6O X;  4CPB A;  1MEC 3;  1YXW A;  2QQK A;  3O1V A;  2XH6 A;  3AZX A;  5F3G A;  1C28 A;  1GOG A;  2CWS A;  4YGD A;  2ZHL A;  4AYU A;  1UX6 A;  3UK9 A;  4EN7 B;  3GHN A;  5L7O A;  1BQP A;  3THT A;  1NKG A;  2GH8 A;  5DN2 A;  5FWJ A;  4IV1 A;  2AH2 A;  4YM3 A;  5HBA A;  4IE4 A;  1SLT A;  2HYX A;  4FTE A;  3J4U H;  2PYT A;  2A6Y A;  5FK7 A;  1RUI 1;  2DCK A;  4CEW A;  3NNJ A;  4XUO A;  1RUH 3;  5A7P A;  4IE5 A;  1LHV A;  3HBK A;  1ZX5 A;  4XAB A;  1Q8P A;  3HN3 A;  1UYX A;  1UIJ A;  5FZ7 A;  1SPP A;  1XYP A;  2WFF 1;  2O0O A;  4LA3 A;  2XVG A;  1RUC 1;  3TEX A;  4Y5Z 0;  5HCH A;  4YVS A;  1AJK A;  3MIG A;  1I6X A;  1H8V A;  2UY8 A;  2WYF A;  3DEM A;  2WKK A;  1OVS A;  2Y64 A;  2ZPX A;  5JSR A;  3R4S A;  3K3N A;  2WQ8 A;  3MFC A;  4AEK A;  2R06 3;  4N7I A;  3HNM A;  1C3H A;  4Q1P A;  4CE8 A;  2DU1 A;  1QJY 2;  4NMI A;  2QQM A;  1MR5 A;  2UU8 A;  2D93 A;  2ZHN A;  5FXZ A;  4E4D X;  3SKV A;  2LUW A;  3POI A;  5L9B A;  2W39 A;  5JOX A;  5FZL A;  2OUH A;  3RFR A;  4AED C;  2H6B A;  1RJ7 A;  2H6C A;  2K2S A;  1GZC A;  1RXF A;  1K5M B;  1ND2 B;  1W8H A;  5FKC A;  4LJH A;  2RR1 3;  3V56 A;  5LBC A;  1BCX A;  1W3X A;  2ORZ A;  4XE9 A;  4IGO A;  3LEI A;  4XF4 A;  5A7N A;  1EAH 1;  2VUL A;  1WLC A;  2WZR 1;  4JGY B;  2FDH A;  2ZGT A;  2VQA A;  3NAP C;  3POS A;  1E5S A;  2YC4 A;  3WUD A;  1FPN 3;  3I4I A;  1U5X A;  1AL2 1;  3VBO C;  3J7M A;  5CKQ A;  3WG3 A;  1RUG 2;  2W3J A;  4RR3 B;  2RJL A;  4ZS2 A;  4JVA A;  3ZPY A;  4HPK A;  5GZF A;  1LU1 A;  2VZ3 A;  2Y60 A;  4IUG A;  3KT1 A;  5JVV A;  1CIY A;  5CA6 A;  4I09 A;  2VMI A;  1QWR A;  1UYY A;  4Y4Y A;  4YW7 A;  1PO1 1;  4MGY E;  4MZU A;  3KVB A;  1XYN A;  3U0Z A;  2ZGU A;  3VBH B;  3G6J B;  4IEQ A;  2BER A;  2KD7 A;  2W08 A;  3KCC A;  5LK5 A;  1LED A;  4FOV A;  3I49 A;  1RB8 G;  1ZRD A;  3F2Z A;  3T2T A;  4Z1V A;  1C8N A;  5DG2 A;  3VDD B;  3K4A A;  1QMJ A;  5CZK A;  1PM4 A;  2ZXQ A;  1VBD 2;  1HB2 A;  3AMQ A;  5BNO C;  2V09 A;  5FUN A;  3GF6 A;  1GP5 A;  3VBF C;  2Y34 A;  4Q8K A;  3DF0 A;  1PVX A;  1DGW A;  2BRT A;  3I2J A;  3WP5 A;  4BYY A;  4FO9 A;  3ZXG A;  4DMI A;  5IAT A;  3NW4 A;  1IKQ A;  4HT1 T;  3LIG A;  4JDO A;  2OVU A;  5E1R A;  1B35 C;  1JYI A;  1SHW B;  2E7A A;  4MGZ E;  2GND A;  1L7R A;  4XFG A;  1K5M C;  4AI9 A;  2ZEW A;  4BME A;  1EV1 3;  1JHN A;  1L7Q A;  3PMS A;  3RI9 A;  1H2L A;  2P6H A;  5CEH A;  3BYW A;  5K4L A;  2W87 A;  2VMH A;  4V1P A;  1AR7 2;  1COV 2;  4BQW A;  5KXC A;  2HWF 1;  4KU7 A; 
#chains in the Genus database with same CATH homology
 2J1A A;  5JUV A;  3UNP A;  4LKS A;  3ZM8 A;  4E8D A;  1W8O A;  4GWJ A;  3K46 A;  4GWI A;  1IQD C;  2Y6H A;  4D0Q A;  2QBX A;  1UY0 A;  4XUP A;  4CU8 A;  2X09 A;  2X05 A;  3GGL A;  1P8J A;  4JKM A;  1J84 A;  1W9S A;  2VZT A;  2LS6 A;  4P00 B;  2W1S A;  3HNB M;  2VZ1 A;  3T0B A;  4PF1 A;  5C7G A;  4D8M A;  2E26 A;  1XC6 A;  1NAE A;  4HG6 B;  2VZO A;  2BGO A;  3C7H A;  4PT6 A;  1NUK A;  3ACF A;  3P1I A;  1JZ8 A;  1CX1 A;  3VDC A;  2W1W A;  3CDZ B;  2QQO A;  2X10 A;  3P6B A;  2CDO A;  1UY2 A;  1UXX X;  3OEB A;  3T2Q A;  3K75 B;  1JYV A;  2YG0 A;  2C26 A;  3I2G A;  2JE8 A;  5JXG A;  1JZ2 A;  4MO3 M;  1JHJ A;  5G04 L;  5C71 A;  2QQJ A;  2J7M A;  2YFU A;  2Y6J A;  2VCB A;  2JDA A;  1OD3 A;  4DUW A;  3WNL A;  2WAA A;  1JZ7 A;  2WYS A;  1UWW A;  3ABZ A;  1OF3 A;  1JU3 A;  2VOT A;  3LEG A;  4QDR A;  1GNY A;  2VC9 A;  2BGP A;  1HN1 A;  4QX3 A;  4A6O A;  1LNS A;  2VCA A;  5JXH A;  1JZ5 A;  1T2X A;  4A3Z A;  2V5D A;  3LPG A;  1GMM A;  2VZQ A;  3DYP A;  3K4D A;  5EIY B;  2VZU A;  4QX2 A;  3NJX A;  2E33 A;  1US3 A;  4GZ9 A;  4W8J A;  4YPJ A;  4CU9 A;  2JD9 A;  1CZV A;  1KGY A;  2WZ8 A;  2QQI A;  2WO2 A;  1WCQ A;  2VR4 A;  2W1U A;  4MOA A;  3UET A;  1UMI A;  2R7E B;  3A22 A;  3OGS A;  1UYZ A;  1I5P A;  5IJR A;  3MUY 1;  1W99 A;  1O59 A;  3HNY M;  2RJ2 A;  2VTF A;  2WAO A;  1D7P M;  4QB6 A;  4CUA A;  3A7Q A;  4A45 A;  2B4K A;  2VL4 A;  2WDB A;  3T09 A;  3OEA A;  2C4X A;  3ACH A;  4BK5 A;  3WEZ A;  2VM9 A;  4KMQ A;  4UOJ A;  2WN2 A;  5IHR A;  4JKK A;  2CDP A;  5JR2 A;  2QQN A;  2VME A;  2Y6K A;  2W91 A;  4A4A A;  2VQT A;  3C7E A;  3I2I A;  3NRU A;  5DMY A;  3C8X A;  1OF4 A;  3MUZ 1;  3WF4 A;  4ARY A;  3U37 A;  1XPW A;  2L9L A;  2XON A;  1PMH X;  4BDV B;  2EIE A;  4MAD A;  3ECQ A;  5JXI A;  3I3E A;  4A42 A;  1JYX A;  1K45 A;  1O8S A;  3A23 A;  4M4P A;  3WQB A;  3NJV A;  4ET7 A;  1H6Y A;  3T0D A;  3ACG A;  4P5Y A;  4DXR A;  5J1X A;  3WF2 A;  4QDS A;  3CIH A;  3FHA A;  4DXT A;  2Z4F A;  3D3A A;  5A1A A;  2VZV A;  4QB1 A;  3WNK A;  3W5N A;  2ORX A;  2J22 A;  4XUN A;  4PQQ A;  2YC2 A;  1F4H A;  3MV1 1;  4XUR A;  3I3D A;  3I2F A;  3K77 A;  4QDQ A;  2Y8K A;  4A44 A;  3VD4 A;  3ETP A;  1WKY A;  3FL7 A;  3MBW A;  5LA1 A;  5G05 L;  2XQX A;  1JYN A;  1XNT A;  4MGS A;  3C7O A;  1YQ2 A;  3WF1 A;  1RYY A;  2W46 A;  4MGQ A;  3MV0 1;  3T0A A;  1GOH A;  2LW8 A;  2WN3 A;  1K12 A;  2J1E A;  5I0D A;  2ZEY A;  4XVH A;  4LPL A;  4AAX A;  4OYU A;  3DYO A;  3CQO A;  4DUV A;  4OUE A;  1US2 A;  4CU7 A;  2QQL A;  4ZZ5 A;  2J1S A;  4LQR A;  2BBA A;  4RYD A;  1PX3 A;  4RN5 A;  5LA0 A;  5F7U A;  4UI9 L;  3MO4 A;  1OH4 A;  1W0N A;  3HOB A;  4XZU G;  2W95 A;  4QPW A;  2YB7 A;  5FUI A;  2Y6L A;  4JKL A;  2DDU A;  4ZZ8 A;  3AC0 A;  3HJR A;  4JHZ A;  1MPX A;  4FI9 A;  3VD7 A;  3WNO A;  1UY3 A;  3E1F 1;  2W9X A;  1W9T A;  4P02 B;  2J1V A;  3CZU A;  1K3I A;  2DCJ A;  2VZP A;  3I2K A;  1PX4 A;  4KI5 M;  3T08 A;  2RVA A;  3OGR A;  1NX9 A;  1UMH A;  1CZT A;  3C7G A;  1J83 A;  1XNA A;  1GOF A;  3A21 A;  4ZY9 A;  4QX0 A;  5DQ0 A;  2VMD A;  3LPF A;  1DLC A;  2J1R A;  3SEP A;  2W92 A;  5JXJ A;  3I2H A;  3FN9 A;  3THD A;  3JXS A;  1R64 A;  4TXW A;  4W4Z A;  2J1T A;  3OBA A;  4P08 A;  5JMO A;  1OT5 A;  1W9W A;  3WNP A;  3SKJ E;  3C7F A;  2PQS A;  3CZJ A;  5EJ1 B;  3GM8 A;  1EUT A;  1GQP A;  2W47 A;  4CVU A;  3BN6 A;  4OMC A;  2B9V A;  2XOM A;  3T2O A;  3VD9 A;  3DYM A;  3BGA A;  5B4X A;  1JZ4 A;  2VZR A;  3T2P A;  3IB3 A;  1UY4 A;  2C9K A;  1GUI A;  2YFZ A;  3HEI A;  4CUB A;  1PMJ X;  3VDA A;  4DXS A;  3W5M A;  4XUT A;  1DYO A;  2VJX A;  2WBK A;  3UES A;  1ULP A;  3HPN A;  4QX1 A;  5C70 A;  1KEX A;  4DUX A;  4BJ0 A;  5DPN A;  3OGV A;  1UXZ A;  2VMF A;  2EID A;  4OZO A;  4BXS V;  4ARX A;  3WF3 A;  2VMC A;  3VD3 A;  2QQK A;  1GOG A;  5IYY A;  4UAP A;  1O8P A;  2RV9 A;  1NKG A;  5DN2 A;  2V72 A;  3DEC A;  4ZXE A;  1SDD B;  2HYX A;  3FHQ A;  2WO1 A;  2ID4 A;  3LEK A;  4A41 A;  1F4A A;  3EB7 A;  2DCK A;  1K42 A;  2Y6G A;  2ZEZ A;  3IAQ A;  4XUO A;  4XUQ A;  1JYW A;  2J1U A;  2XHN A;  3OB8 A;  3HN3 A;  1UYX A;  4DEQ A;  1W8N A;  4QAW A;  2WAB A;  5IFT A;  1EUU A;  3GDB A;  1JI6 A;  1TVG A;  1DP0 A;  1JZ6 A;  2Y64 A;  1SG3 A;  2WQ8 A;  3K4Z A;  3HNM A;  2VQU A;  3ACI A;  2QQM A;  1TG7 A;  2VCC A;  3THC A;  3SKV A;  3WNM A;  3I97 A;  4LHS A;  5EJZ B;  3CMG A;  1JU4 A;  2BZD A;  2WO3 A;  4CUC A;  2VZS A;  2W5F A;  3WNN A;  3LE0 A;  2ORZ A;  2W1Q A;  3LEI A;  3J7H A;  2OKX A;  3GXU A;  4CU6 A;  2YC4 A;  1BHG A;  2V4V A;  2W3J A;  2EIB A;  5IFP A;  2WZE A;  3PUH A;  5HPO A;  1UX7 A;  1JZ3 A;  2EIC A;  3SEE A;  4JX0 A;  2VZ3 A;  4IUG A;  3VDB A;  1CIY A;  2W94 A;  1UYY A;  1CZS A;  2E31 A;  2BER A;  2KD7 A;  3CKH A;  5B4N A;  2VO5 A;  3F2Z A;  3LQC A;  4KWU A;  2ZEX A;  4DEV A;  3K4A A;  5CZK A;  2ZXQ A;  3III A;  4L0P A;  4M4R A;  4OMD A;  5HXM A;  2HLE A;  4Z2A A;  2WUH A;  3I3B A;  3VD5 A;  2JKX A;  3I2J A;  3WSO A;  4QB2 A;  1UY1 A;  2E32 A;  4W50 A;  1SHW B;  4TTG A;  3WF0 A;  5CYY A;  3IDA A;  1L7R A;  1GU3 A;  2ZEW A;  1L7Q A;  4BK4 A;  5LCW L;  4AG4 A;  1UZ0 A;  3IAP A;  1ULO A;  3PUI A;  2W87 A;  3NNG A;  4E8C A;  5LA2 A;  1H6X A;  3EYP A;  3OG2 A;  3NQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...