2V4VA

Crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'QSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYTVYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTVSGVTGKHDVYLVFKGDSGYLFNLNWFTFSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GH59 GALACTOSIDASE
publication title Analysis of the Structural and Functional Diversity of Plant Cell Wall Specific Family 6 Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2v4vA00
3K46A 2J1EA 3VD7A 3LEIA 1OH4A 1K42A 3CDZB 4LPLA 2W3JA 2EIEA 3IAPA 1T2XA 3ACGA 2VL4A 2DCJA 3WF3A 5FUIA 3C7FA 1K45A 2ZEYA 3MBWA 3WF0A 1YQ2A 3T09A 4L0PA 4CU6A 2ID4A 1NKGA 2R7EB 5I0DA 5J1XA 4XUNA 1UYXA 5LA1A 4ARXA 3T08A 3VD4A 3HNYM 3F2ZA 4DUVA 1KGYA 1WKYA 4QAWA 4UAPA 1H6XA 1EUTA 3ETPA 1JYVA 4M4PA 1EUUA 1L7RA 3ACIA 5LCWL 3BGAA 5LA2A 4IUGA 1R64A 2HYXA 2J1AA 4KI5M 2WUHA 3OB8A 1GQPA 4JX0A 4JKKA 3UNPA 3MUZ1 3I2FA 1O8PA 4HG6B 4AG4A 5C7GA 2VMFA 4KWUA 1HN1A 1H6YA 1RYYA 4LHSA 2VZOA 4E8CA 1WCQA 3D3AA 4CUCA 1UXXX 3OGRA 3E1F1 4KMQA 1JZ4A 4MADA 2VQTA 1XNAA 1UWWA 2WO1A 2J22A 4DUWA 2WN2A 2X09A 2ZEXA 2W92A 3IDAA 1US2A 2XONA 1W9WA 2C4XA 3WNLA 4RN5A 5JXJA 1UY1A 5JMOA 2VMCA 4QX1A 2Y64A 2VCCA 3GGLA 3WF4A 3WNPA 3GXUA 2V4VA 3A23A 3BN6A 1PX3A 3DYOA 5IYYA 2DDUA 3OGVA 3T2PA 4ZZ8A 2JD9A 4TTGA 2BBAA 2E33A 2WZ8A 1D7PM 4XZUG 2J1RA 3OEAA 4ET7A 3T2OA 1OT5A 2Y6GA 2XHNA 2DCKA 1CZVA 3DECA 1CZSA 2VM9A 4OYUA 2QQJA 4A44A 2JE8A 3FL7A 2BGOA 4XUTA 1UMIA 2Y6HA 3IB3A 2W95A 3CZJA 2WZEA 3IIIA 1W99A 4DEVA 3VD3A 1SHWB 3K75B 5IJRA 2LS6A 2QQOA 4JKLA 2VCBA 3I2HA 2QBXA 4QB2A 4A45A 1UZ0A 1KEXA 5JXGA 3FHAA 2B4KA 1UY0A 5C70A 1XPWA 1W8OA 1CX1A 3GDBA 3ACHA 4JHZA 3WNMA 4W50A 1US3A 2WAOA 3K4AA 5B4XA 3I3DA 4P02B 3LEKA 2BGPA 4DXSA 4OMDA 2E31A 3T2QA 2WAAA 3LPFA 3W5MA 4MGSA 3MV11 3I97A 3C7OA 2RVAA 3HEIA 2X10A 4D8MA 5IFPA 5G04L 3C8XA 4QDRA 1I5PA 2XOMA 2VQUA 3GM8A 4A42A 3PUIA 1F4AA 2Y6LA 2ZEZA 3WNNA 3I3BA 1NUKA 3C7GA 2JDAA 1W8NA 4UOJA 1W9TA 3VDAA 3VDBA 3ECQA 3PUHA 2VMEA 2BERA 2C9KA 1W9SA 2J1TA 2QQKA 3CIHA 1JHJA 2VZ3A 3U37A 2YG0A 1UYZA 2XQXA 3NJXA 2HLEA 4GZ9A 4BK4A 4BDVB 1DYOA 3K4DA 2W91A 3CQOA 4DEQA 2CDOA 2WYSA 3OG2A 2W1SA 3SEPA 3C7HA 2KD7A 4FI9A 5LA0A 1GNYA 1K3IA 4OZOA 2WDBA 5EJ1B 1JYWA 4ARYA 1UYYA 2V72A 5B4NA 4CU8A 5DN2A 4A41A 4QX0A 4AAXA 5CYYA 1OF4A 3WNKA 4E8DA 2YFZA 2OKXA 3WF2A 1JU4A 4PF1A 1O59A 3K77A 2X05A 2VZVA 5IFTA 1MPXA 2YFUA 1IQDC 2VC9A 3HPNA 4M4RA 3T0BA 1GOHA 4QDQA 3HNBM 4A6OA 2VZQA 2W1WA 4YPJA 2VZSA 1TG7A 3THCA 5HXMA 1L7QA 3SEEA 4QDSA 4ZY9A 3I3EA 1OF3A 2YC4A 4QX3A 4ZXEA 4A4AA 3LPGA 1UY4A 1GMMA 3OBAA 2QQNA 2W1UA 3EYPA 2WBKA 3VD5A 4CU9A 1PX4A 3OGSA 2Y6JA 3C7EA 1OD3A 2VZUA 2VOTA 5JUVA 4LQRA 2W47A 3ABZA 1XC6A 1PMHX 4MGQA 1UY2A 4PQQA 2LW8A 2J1SA 2CDPA 3T0DA 2RV9A 2Y6KA 1GOGA 2VZ1A 5IHRA 2WN3A 4BK5A 2QQIA 2W87A 3ACFA 1JZ6A 3VD9A 3UESA 3DYPA 3WSOA 3P6BA 2ORZA 2ORXA 4QX2A 4W4ZA 5DPNA 3FN9A 3W5NA 4CVUA 4OUEA 2C26A 1DLCA 5A1AA 2BZDA 3I2GA 2YC2A 2J7MA 2WO2A 3CZUA 3HOBA 1LNSA 4LKSA 5DQ0A 1XNTA 1GU3A 3J7HA 3LQCA 4MOAA 1ULPA 2VZTA 3NNGA 4XURA 3WNOA 1JI6A 3CMGA 3WEZA 4DXRA 1UMHA 4Z2AA 1SDDB 3THDA 2VZPA 2VCAA 2W94A 4P00B 3NRUA 1JZ5A 3ZM8A 4XUQA 5DMYA 2B9VA 4ZZ5A 1JZ7A 2J1VA 1JZ8A 2VTFA 1UY3A 2EIBA 5HPOA 1ULOA 4PT6A 2L9LA 4P5YA 2E32A 3T0AA 2WQ8A 4GWIA 3HNMA 4BJ0A 2Y8KA 5EIYB 3HN3A 4MO3M 1JU3A 3CKHA 3DYMA 2PQSA 3I2KA 5CZKA 4TXWA 2VMDA 4QPWA 2VJXA 5F7UA 3OEBA 1DP0A 1JYNA 2JKXA 3NJVA 1GOFA 1GUIA 5EJZB 1K12A 1F4HA 2W5FA 2YB7A 4DUXA 2J1UA 2QQMA 1PMJX 4XUOA 2W9XA 4A3ZA 3I2IA 2EIDA 2VO5A 1JYXA 4XVHA 3VDCA 4RYDA 3WF1A 1NX9A 3UETA 2ZXQA 3HJRA 5JR2A 3NQHA 3P1IA 1W0NA 2WO3A 4JKMA 3FHQA 3A21A 3IAQA 2Z4FA 3MV01 2EICA 1BHGA 1P8JA 3LE0A 4CUAA 4P08A 5JXIA 3WQBA 1NAEA 1UXZA 1TVGA 4GWJA 3A7QA 2W46A 4OMCA 4CU7A 4UI9L 1SG3A 5JXHA 4CUBA 1J83A 2V5DA 2WABA 1UX7A 3K4ZA 5G05L 3LEGA 3MUY1 4W8JA 1O8SA 3MO4A 3SKJE 4D0QA 3EB7A 2QQLA 3I2JA 1JZ3A 4QB6A 1CZTA 4BXSV 1CIYA 4XUPA 4QB1A 2ZEWA 1JZ2A 3SKVA 2W1QA 3A22A 2E26A 3JXSA 1J84A 2VZRA 3AC0A 4DXTA 2VR4A 5C71A 2RJ2A
chains in the Genus database with same CATH superfamily
2J1EA 5DUWA 5FPLA 2EAAA 2DFCA 1OH4A 2C6SA 5ANNA 4UYBA 4EJRA 2AC1A 1BK0A 5KXBA 5T5PA 2EIEA 1GSLA 2XKOA 2PXJA 4B4QA 3POGA 3BOPA 1WW7A 3NJZA 1FNZA 5KXDA 1VBD2 1IZ3A 4NROA 3EHKA 4NRMA 5FUIA 4K40A 4CRQA 4DZGA 1GQGA 5FZDA 2DVAA 4DMIA 2ZEYA 1ENQA 4FP3A 3KT1A 3H1YA 4R9AA 1MVEA 3IT8A 4BLIA 5DAWA 1LRHA 5FY0A 1AYN1 2ID4A 1C4RA 2JE7A 1DQ6A 4GH4A 5F6KA 5J1XA 4BU2A 5T5JA 2GC2A 2HWE1 3OYWA 5GJ6A 4D7SA 1SBDA 4QPGA 4IGQA 2XDVA 3RI8A 1RUH2 4R4ZA 1QH7A 4LK6A 5LASA 2CGPA 3ZSLA 1BBT3 4K9SA 3KGLA 2G19A 2Y38A 4DUVA 3TEYA 2UY9A 1GWMA 3QLQA 3S5AA 5F1RA 4XAAA 3VDDA 1EUTA 3MLLA 4M4PA 2XJQA 5LCWL 3LDKA 5KWRA 2ZMLA 5IUQA 2FDHA 1OPOA 5FRAA 4C8DA 3W58A 3I49A 4IUGA 1J3QA 5KR7A 1R64A 4XDQA 2RR11 2J1AA 2K46A 2WUHA 3ZX7A 4BMEA 1C1LA 4AXOA 3UNPA 2CTVA 2PN5A 3I2FA 2ERFA 4Q4W1 1E5HA 4XJWA 1PVC2 4WVWA 5L7OC 3ZIWA 4PHZA 3G7DA 3BUCA 4U36A 3JD71 1H6YA 1TME2 2P37A 1YHFA 1JOPA 2VBPA 4LHSA 2XKPA 3MPBA 1OC1A 1F9KA 5CG8A 5K9YA 4H14A 4HVQA 2WRAA 5GZCA 3AB0A 3I54A 3PLQA 4OZXA 2RDRA 3AFKA 1LB2A 1HB4A 1JZ4A 4MADA 3OBRA 4QQHA 4Y4YA 4DNYA 1UWWA 1NZIA 4LNVA 2AYHA 3IBMA 4G3YC 4UFHA 2V09A 3ZYIB 5FMDA 5E16A 2QZ2A 3B93A 4XAEA 5C3OA 3FLRA 3KHBA 2ZEXA 2W92A 2FBEA 1G7YA 4Q0VA 3ZSKA 4MGTA 1H4HA 3IDAA 4XF4A 1NQDA 3HIFA 1AL22 4DRVA 4C1WA 2CWMA 4RN5A 4LO8A 4KG0A 4LULA 1CAUA 1TE1B 3TRSB 4XJAA 2DVDA 4QX1A 3E5XA 1X8EA 1XU2A 3GGLA 5CFCA 2OUJA 1G8WA 2BQPA 3GXUA 1H8TA 4HETA 5FR3A 1S55A 4XFCA 4D7YA 4TZDA 5JZGA 2DDUA 4S2HA 4Y20A 1ZZCA 1LTEA 1Y43B 2GN3A 2JD9A 1OKOA 5FP4A 3VHOA 2VMGA 3FLTA 3OBZA 5CVRA 3SCHA 1F8VA 3POFA 4GB33 4XZUG 3S7IA 1Q8OA 2J1RA 4B29A 2SLIA 2X5IA 4ET7A 1ODMA 2ZGTA 1SQ4A 1VBB1 1OOPC 3AL5A 1ZRRA 5FOJB 2A6YA 2VM9A 1ENRA 1XQNA 3AKPA 1TMF2 2DU1A 5BNOA 1BQPA 4EROA 4HK8A 1FOD2 2XMLA 2SBAA 3GZEA 4XUTA 5JSPA 2UWBA 1UYPA 3CZJA 3WG4A 2BVVA 5EV7A 1MZEA 1EAH1 4URTA 1IGOA 2ZS6B 4BQWA 3VBOC 4K7JA 3U75A 1W6OB 2MHFA 2RMU1 5C8CB 5FQ0B 4JKLA 4AFAA 4CEYA 1ST8A 2DCTA 4GKXA 4QB2A 2VNOA 1B35A 3GZAA 3NVCA 1LOFA 5FXVA 3JZVA 4Q4Y2 2AEYA 4CCDA 5JXGA 1BMV2 2WWJA 1BEV3 4JGYC 2ZAAA 2V5YA 2B4KA 4KU8A 1C8M2 3KQ4B 3DPRB 1UY0A 1MEC1 4B8EA 4CDXC 4ES9A 1VBC3 1W6NA 1XE8A 4BIOA 3NV3A 4NIGA 2V73A 1S0IA 3ACHA 2YYOA 3PTYA 4P5HA 2WZR1 3BB6A 4RQPB 3IDBB 4AI0A 1AYM2 4NO4A 1RVF2 2AR6A 1ULEA 3WXPA 1HQLA 3LIGA 4XE9A 1XOYA 2X8KA 5AC93 5L36A 1GICA 1W6PA 4JVAA 5FYMA 3NNFA 3AJYA 3H8UA 3VUOA 4J1WA 1RHI3 3NO8A 4XFBA 5FUPA 4XTPA 3LD8A 1X50A 1Y9QA 3U11A 1HXS2 4E4SA 5IVVA 2GZWA 2JG8C 4QKBA 1MZ6A 1AR93 4L11A 5LBFA 2OYZA 2RM23 1HQWA 2Y6FA 3ZDVA 2X53S 1D4M1 2PAKA 3DEMA 4AVCA 1I5PA 3THPA 3FE5A 3AXEA 5F3IA 4RGGA 2UU8A 1I5ZA 2ZEZA 3GBGA 4XFFA 4NMIA 3VLBB 1F35A 3VHRA 1IG0A 2ET1A 3LOIA 2RS32 1W8NA 4UOJA 5C3RA 4ZS3A 3EBRA 3PUHA 4S2FA 1UZZA 4CXWA 1WLTA 2C9KA 3QCWA 3ZFEC 4H7MA 1W2TA 1SEFA 4QD2A 3VHPA 1JHJA 3KV9A 2BTVC 1O91A 3WCRA 4CXYA 2W52A 1GZWA 2XQXA 3NJXA 4WVZA 4QGLA 5EYXA 3VV1A 2D5FA 1VR3A 2R49A 3B69A 1DYOA 3K4DA 1OHFA 3CQOA 5FZ0A 4DEQA 1PZ9A 2FMYA 4K20A 1K5MA 2KD7A 5FYIA 5C5TA 5LA0A 4PDWB 3ZYBA 1CESA 1LJ7A 4FTEA 4ARYA 1NCRC 4BCUA 4CCJA 1XE7A 2QQVA 4FO9A 2E6VA 1LENA 3R0RA 3VL9A 1BYHA 4JTNA 1WBFA 2ZZJA 3PHMA 2WR9A 4AGVA 4LA2A 1AR71 4A41A 3POWA 2XBO1 2RS51 1L3JA 3P3NA 4YW1A 4DQAA 5IVYA 4HMZA 2ATFA 2VUDA 4DIQA 1CAVB 1AL0G 2YFZA 3VKMA 4R8HA 4K6BA 2FHRA 1DQ4A 5FZ1A 3SH3A 5FKBA 4Q4V2 2OUHA 3VBFB 2VZVA 2VMHA 4MHUA 3HQUA 1MPXA 3MIFA 3E6BA 2YFUA 5IVFA 2YU2A 3TNPB 3SNMA 1JW6A 5KHHA 5SV5A 5C8WA 3AMHA 4QDQA 3B9IA 4A6OA 1W8ZA 2W1WA 4YPJA 3DN7A 1ALYA 1ONAA 3SHRA 1QJY2 1YFWA 1TG7A 4LMFA 3SMHA 3O1MA 1L7QA 4B7EA 3VBRA 1J59A 1QOOA 4Y5TA 5GLVA 3TN91 3AKTA 1ULGA 2WZPP 4EE2A 4COYA 1HRI3 4CZSA 3LPGA 3VBHA 2RR12 5DXDA 5FO7B 3EYPA 4BLJA 4XJ9A 3N9NA 2P6CA 3S6PA 1OH3A 3C7EA 1UOGA 3ES4A 2VZUA 2YBKA 4CA9A 1ND3B 2WNUB 5CKMA 2W47A 3KWVA 1PMIA 4S2GA 3ZN5A 5FDBA 1DFQA 4I3PA 3V0BA 1LGBA 1JHNA 4IEXA 4PQQA 1GP6A 5T55A 2Y6KA 2VZ1A 3VBUA 1RUF1 4HSJA 2W87A 2ZHKA 4E2QA 5IK4A 1JZ6A 2GH8A 4JDNA 5F3GA 1XYPA 3DYPA 1G9CA 3I59B 3WSOA 3P6BA 5ISLA 4QX2A 5KC5A 1VBE1 1PHMA 5FPZA 1MZ5A 4Q0QA 3MW2A 4AF9A 3BOWA 5FPAA 1R1A3 2WLQA 2XVKA 3APBA 3M3IA 1OOPA 5JAXA 2E63A 5GZDA 1RUG2 4DRRA 3QACA 4FAGA 4URAA 4YVSA 3O1OA 1ZRCA 2Z5WA 1COV2 2WO2A 4IQPA 5CFDC 3LA2A 3ZYHA 3S0MA 1XNTA 5T54A 2LM3A 1HRV3 1R081 3DCQA 2JG9C 1U12A 4IEVA 1RUI3 2QNKA 4RFRB 3BU0A 3CMGA 4DXRA 1SDDB 5AVPA 3RDIA 1PIV3 3THDA 3VBOA 3AKRA 5DDJ3 1ZBE3 2QE3A 2Q1FA 4P00B 3NRUA 4JAAA 3RVHA 3ZM8A 2NLRA 5LB6A 1LESA 1UN1A 2VNVA 5LK5A 1LU2A 2G9FA 3MLJA 2B9VA 4MV2A 3O14A 5KHJA 1MS5A 4N53A 1JZ8A 4J1XA 5FCCA 2YHJA 3PVBB 4UW3A 4HZFA 1NCQB 1URXA 1U5IA 2GALA 2PLV1 3WOGA 2L9LA 5IK5A 4CDXA 1UL9A 3CJIC 2E32A 1ACCA 3PDQA 3MW4A 5I8YA 3BTAA 1WMEA 4YNIA 3HNMA 3ASIA 3O1VA 1JU3A 4YVWB 5CZKA 3I2KA 5K8SA 2ZMNA 2VMDA 4QPWA 1YYNA 1BXHA 1JUHA 4CEWA 3OUHA 1DP0A 1IG3A 2LTNA 1UNBA 2BNMA 3BTXA 3SXWA 5T50A 3FC0A 2KR2A 2W5FA 1VE0A 2YB7A 1JH5A 1AX2A 4DUXA 2D43A 4AWDA 3RYPA 1PMJX 1KRIA 1ZRIA 3ZMNA 1EAH2 4A3ZA 2EIDA 1QNWA 4LLOA 1UU6A 1VAKA 3M7AA 5JIAA 4BIFA 4Y33A 3RZKA 1LAJA 3N9LA 5GKAC 1W0OA 1QJFA 4RYDA 3H3ZA 4SLIA 3UL2A 1VBC1 1BZWA 2ZA9A 1JXNA 1N1SA 1PO22 3GBFA 1GANA 2VOVA 4EV0A 5A1LA 1A3KA 1VBD1 4B3NA 5JSOA 4ZHNA 1RUJ3 2ZXQA 2B8MA 3MGUA 2BP6A 5IVBA 3TYJA 1ENSA 2CGOA 1C57A 4AQSA 3NQHA 5JOWA 5AC91 3BCWA 2DTYA 1KXGA 1W0NA 2WO3A 3FHQA 1FXZA 1NG0A 4IETA 1SPPA 4AE2A 3RZLA 2W68A 3KCXA 5DUXA 3ZIXA 3SQOA 1A6CA 3IM0A 1P8JA 3O12A 5FAXA 4P08A 1N1TA 4AGGA 4HSLA 4HPKA 5C9AA 4CDUB 5FBJA 4FCAA 2IUWA 1DBNA 2WWUA 2P3JA 3AZYA 5FTTC 1JOJA 4OMCA 4HL0A 5GLWA 5F3EA 1UZVA 4CU7A 3ES1A 4HONA 4MVTA 1V6LA 4M3CA 4DXZA 4QHBA 5C3SA 2V5DA 5A70A 5ACA3 3V0AA 2P2KA 2OA2A 5G05L 1PNGA 3LEGA 3N7LA 4ISQA 3Q8EA 3MUY1 4COUA 3NWKA 5I8SA 1GV9A 3JB4C 2E9QA 4AL9A 4IDZA 3U10A 2PHWA 4CP9A 3WP6A 3M3CA 5FMOL 1S0EA 5LW9A 4XABA 3O5SA 2VUAA 4GA9A 4Y1VA 4CCOA 4YM0A 1O3SA 3CLPA 3I2JA 4Q1RA 4JGYB 3O1UA 1PVC1 4NN0A 1CIYA 4I30A 4NIDA 3LFIA 4XUPA 1TME1 3M3QA 2IWGB 2RJKA 3ZDSA 2FZ1A 2ZZQA 3FWEA 4X6QB 3M3OA 2WT1A 1VALA 2YDEA 3ILRA 4AVSA 4FSJA 3J9SA 3N9MA 2W1QA 4E27A 4LBMA 3I2OA 2XQRA 4NRPA 4FPEA 3B7MA 4INDA 1XSQA 1J84A 4H2AA 3D5OA 4IV3A 4V2VA 4UF0B 1AZDA 1DGWX 3JBG3 2EXIA 2F6BA 4LHLA 4N43B 2RJ2A 2I74A 1JODA 3K46A 1LHOA 1LULA 4K3UA 2LUWA 3LEIA 4HK9A 4MXWB 4NJ4A 1K42A 4LPLA 4EZ4A 1IOAA 5FMOS 4BQ5A 3AYCA 2IXJA 4N7UA 1REEA 5CU1A 3WDYA 1SLTA 1VAVA 3AKQA 4JQTA 1T2XA 3AYDA 4UW6A 1O4TA 2WSVA 2Q8DA 2XL9A 2EF6A 4CCEA 1AL21 4WM7C 3D6EA 2JJ6A 4LBQB 3IPVB 2ZX0A 3H0OA 4CDWB 1PO13 1Z7S3 2OQ7A 3MBWA 1XE0A 2Q8EA 3HN1A 5C8CC 4RR3B 3GZUC 3RS6A 1QH6A 2ZMKA 3HQXA 3N36A 3OD4A 4AGRA 2LROA 4CYDA 2BW8A 5A3MA 5BNPA 1BBT2 1OPMA 3PNAA 3UV9A 3R4SA 3ZFGB 4I3GA 2W0XA 4OQ8A 5C4WB 5LK7B 4NWVA 3NAPB 4IERA 2QJVA 1OFNA 1DYKA 1UKGA 4P9YA 2VE1A 1RIRA 1STMA 4P9XA 3FFZA 4YGEA 1AR83 4QKDA 4COWA 5AFBA 1VJ2A 1WMFA 1YXWA 1E5RA 1OBNA 3U4SA 4L92A 1JYVA 1AJOA 5DG2A 5CFDA 1EUUA 3BGAA 1QXPA 2JDHA 3VZJA 5LA2A 3BPSA 3NW4A 2QQWA 4YG0A 1FOD1 1PK6B 4KI5M 3W9AA 5LY1A 3VZNA 5CB7A 4FPKA 4CXXA 4JKKA 2HWF3 3OUJA 3PUSA 1NCRB 4LOTA 3QD6A 3RYRA 4PI2A 3WLUA 4GMP1 1KS5A 4HG6B 2MNGA 4FPYA 4AG4A 3NNLA 5C7GA 2HBUA 2OX0A 5KXCA 1HN1A 1ODNA 2G4IA 2Q4SA 4TLFA 1OLMA 1RUD3 2PHFA 2VZOA 4E8CA 3ZVXA 3N7JA 3GF6A 4Q4Y1 2ZGSA 3DXTA 4NPLA 2DBIA 2A6ZA 1BMV1 4ES8A 1FPN3 1SLCA 1UXXX 3AL6A 3OGRA 4LO5B 4LUMA 5FMCA 1C8M1 2Y34A 3WV6A 2PQQA 1W8FA 2VQTA 3FMGA 4FXGB 1WUVA 2XLGA 4DUWA 3S5QA 2IXIA 1RUI1 2WN2A 4LR4A 5JLVA 2ES3A 3DGTA 3BKZA 1QWRA 2XH6A 1AYM1 3T1MA 4KNCA 4E4HA 1XJAA 1RVF1 1LR5A 1AR63 1ZBE1 1D0GA 4FPJA 4GWMA 5FK7A 4XDPA 3BODA 1IKPA 3WW2A 3E6CC 1V9U3 4L8QA 5EPAA 1US2A 5BNNA 1UD1A 5JPMB 2P3YA 4XBQA 2C4XA 3WNLA 4J6GA 1M4WA 4PLNA 3RWKX 1H9WA 1OUSA 4XETA 1ND2C 5I93A 2VMCA 5JMOA 1HXS1 3MEPA 4YZ3A 3WDTA 4YW3A 4GB32 4PDWC 3TAYA 5LRRA 1NLSA 3ZR5A 3H7YA 3O0VA 3OGVA 3T2PA 3V64A 4QQLA 3BYWA 2XL7A 1DQ2A 2YC0A 2XHKA 4NR1A 2QQPA 2WZ8A 1WW6A 5GALA 4EQVA 4WV8A 3ZYRA 4OFGA 1UIJA 1NA1A 4LIUA 2WS93 1AF9A 1GZCA 2RS31 3B94A 4IEPA 4Q1PA 1H4GA 3T2OA 4COZA 2VNRA 4PIZA 2XHNA 4CCMA 3LDBA 2DCKA 2E7AA 2FMDA 3VN4A 4OHXA 1CZVA 3DECA 3EO6A 1JYIA 3J8F3 4I02A 3V56A 2VW2A 4MGZE 5K7PA 2XPJA 1WD4A 2KA3A 2O8QA 2Z69A 1UMIA 2Y6HA 3DUIA 4AEDB 1O5UA 5J37A 2W95A 1OD5A 3M4FA 1W99A 3A0NA 4BH9A 4EWEA 1KDKA 2QUOA 4LUKA 4ZKTB 2C1FA 3J7NA 3RZHA 4MH0E 1BEV2 2XWJB 1V0AA 1X33A 3K75B 3EMRA 4GAZA 2LS6A 2QQOA 4XZPA 2VCBA 2EXJA 1VBC2 2DCYA 3QH6A 3UGHA 3ILNA 1AVBA 4N9HA 1I3HA 4A45A 1RITA 5ABJB 3GJBA 1DZQA 4B1LA 4RS5A 2HWC3 1RUE3 1MS9A 3N7MA 2ADDA 4AFMA 2ZGPA 1ND3C 2WNUC 3CJIB 5FREA 1RUC3 4B1MA 3U0ZA 5FO9B 3D82A 1OUXA 3JQXA 4HVRA 5AC92 2DCZA 4K1YA 1C5IA 1CX1A 4GULA 4WVMB 4UBGA 2FCTA 4W50A 1Q8QA 1UZWA 3MFCA 4Q4V1 1RHI2 2QFEA 5T52A 4A3XA 5A3TA 2RS13 4HN1A 4LBKA 1U5XA 1QF3A 4P02B 5FZIA 1N1YA 5F5QA 5ANQA 2C24A 5D8AC 2PTMA 1QJX3 1IPSA 1VB4A 4IEUA 1MS3A 4O61A 4OMDA 1AR92 2E31A 4XFIA 2RM22 4FP2A 4CE8A 1QJY1 2GNMA 4MGSA 3NNMA 2R6QA 2R16A 4A2UA 3MV11 3ACLA 5EXOA 1MVQA 2CV6A 3N35A 3B9CA 3KCYA 3OGJA 2PA7A 4LO4B 3NKTA 1E57A 4IEZA 3C7OA 4GXLA 4IV1B 3QOPA 4KWLA 1DGRN 2X10A 5JOXA 5A3WA 1Q8PA 2PAMA 2JDKA 3ME2A 5FPVA 1FMD3 3W21A 4XJZA 5C8CA 3GM8A 5JI7A 1H0BA 1YJKA 5KHIA 5FQ0A 1DG6A 4YWAA 5JSRA 2VECA 3WNNA 4IEWA 3I3BA 1WZXA 3C7GA 2F4LA 4WZCA 4RHV3 3VDAA 3WG2A 4TWTA 1GNZA 3VDBA 3ECQA 1XNBA 2XXZA 1LOEA 1NYWA 1NCQC 3M70A 4XPVA 5FIXA 1PGL2 3DPRA 3W5MA 5J09A 2J1TA 2QQKA 3O1TA 4E4DX 1XNDA 3TEZA 3OY8B 1OFSA 4Y24A 2DWRA 1QEXA 4RQPA 1UYZA 2A1XA 2D3PA 1WGPA 1DZRA 2GP5A 4ONUA 5FYBA 4BK4A 2R063 4YVWC 1RUG1 2I2SA 3AXDA 5DZFA 4XJUA 1RB8G 4Q27A 2B7YA 2W91A 3ZFFC 4B4PA 1COV1 1PO11 1C1FA 1Z7S1 4CDQA 5A7SA 3OG2A 5FP7A 2BWCA 2Y0IA 1GNYA 1SLBA 3I8TA 1F15A 2A7AA 1KD7A 5CKNA 1VMHA 4LIVA 2R1BA 2GN7A 4FPOB 2AEZA 2ZHMA 4AAPA 2WNVA 1UYYA 1CR7A 2JE9A 2FCVA 5LA9A 3UK9A 4BPZA 4CU8A 1VP6A 3MDPA 5DN2A 5JMCA 2B39A 3KZ4C 2OVUA 4QX0A 5CYYA 1OF4A 3CEWA 3ORJA 2UWAA 4E8DA 1WW4A 1C3HA 1DYPA 1YWKA 4FPFA 2IXKA 1JU4A 1JUIA 5I0SA 3DXUA 4Y22B 4WBBA 1O59A 3V65A 4IEOA 2ZPXA 4NHMA 1KFXL 1IQDC 4FFGA 3IDEA 3DV8A 4OHYA 4G9SB 4M4RA 1SZBA 1F31A 1DQ0A 5FOBB 1QJU3 1WMDA 1CJPA 1HRI2 1QOSA 1S2KA 3AK0A 5JR7B 1HKDA 2HH9A 2QCSB 4XBLA 4XQWA 4OULA 4Q2FA 1DIWA 3LF7A 1XRUA 4GKYA 4HVOA 2XG3A 4KL1A 4ZY9A 2YC4A 1CD3G 3L2HA 1V00A 2VUJA 4X8NA 1UW8A 4XC9A 5IW0A 4CDUC 1ULDA 4ZXEA 3B00A 3CU7A 4QKFA 4YGCA 4D94A 3H7JA 5A3LA 2G9ZA 1GMMA 2IVJA 2VCMA 1EV13 2W1UA 4JQRA 2E7QA 4P9GA 4XTMA 1LOGA 2WBKA 2XB6C 1A34A 1SCSA 1PX4A 4CU9A 4D6QA 2Y6JA 4WM7B 3RYKA 1OD3A 2R0FA 3T4HB 4ASMB 4YARA 4I0AA 3GALA 2GNTA 4KBBA 1V6IA 2YBSA 3ABZA 5FMBA 1ASJ3 1O7FA 4JGZC 1IQAA 2CDPA 2GNBA 3VZOA 2CWSA 1PO21 1R1A2 5FZEA 5FZLA 3AZXA 3VD9A 3VDDB 1WCKA 5F5AA 4ISRA 3ZSEA 1BJQA 2VG9A 4YLZA 1FI2A 4AEMA 1OLRA 5F5CA 4XEZA 1CAVA 1O6UA 5FYSA 1JMUB 3FN9A 1R093 3G6JB 1OI6A 3W5NA 1W2AX 1V9U1 1HRV2 3NMBA 3VBFA 5A80A 2WFF3 1RUI2 2OS2A 2D98A 4MGIE 3UJQA 5A1AA 3I2GA 1AXZA 3AM2A 2J7MA 3MF9A 5DDJ2 3ZXJA 1CPNA 1L7LA 1ZBE2 2NQYA 4IGPA 5DQ0A 1I9RA 3MLKA 1W03A 4HKLA 4XIKA 4IE7A 2XJVA 3LQCA 4MOAA 1ULPA 2ZGUA 4LE3A 5FZ9A 4Q0UA 3IN9A 3WEZA 5FY9A 4N43C 1UMHA 4Z2AA 3MI8A 1GFF2 5EWSA 2MEV3 5DZGA 2HBTA 2VCAA 4M0HA 2VBDA 2AUYA 2BJSA 2GU9A 5HXVA 3WUCA 4ZU7A 1WA4A 4QPIC 1SFPA 4XUQA 4BZ4A 1RMU3 1ZBA3 2ARXA 2ILMA 1W90A 2JEMA 3TB0A 3VZMA 2OXBA 4ZZ5A 2J1VA 2PHUA 3VB9A 5HCBA 2WS91 2B42B 2JD4A 2NPIA 1YC61 5FP3A 2EIBA 1ND3A 2WNUA 1OSGA 3LSEA 1PM4A 2WIIB 5FUNA 4CDWC 2WNEA 4IL7A 3K2OA 4RR3C 5I0TA 1IS5A 1GBGA 4GWIA 1JBCA 1DU3D 4JCKA 3ATGA 3EXUA 1AHSA 2Y8KA 4JZRA 1FX5A 5EFUA 2WA3A 3SISA 4BJ0A 1OKQA 2HJIA 1FNYA 3I59A 4P9JA 1ZM1A 3ZFGC 1A78A 5C4WC 4LXLA 3NAPC 3VZKA 1RUH3 3NV2A 2XLFA 3IZOA 4WM8C 5K0UC 1SBFA 1GOFA 1VMJA 4LHKA 4NAOA 5F2WA 5CFCB 4UXAA 3ALQA 1K12A 5FZOB 1POQA 1NXD1 1Y9MA 4AFBA 4AVAA 1DZTA 2ZX3A 5C33A 2VQAA 1CAXA 2P1BA 2QQMA 1RUE1 1QQP3 1RUJ2 1JYXA 1ND2B 2GDFA 2EVXA 2A71A 5EP9A 4ASKA 1B09A 3BTYA 3VKFC 4D3WA 2IC1A 1PK6C 2O8OA 2NYYA 2X5IB 4R9DA 3WP5A 2CY6A 1T6GC 3LAGA 2WQ4A 4AI9A 2PFWA 1ULCA 3PL0A 2RS11 2NN8A 5L7OA 2I45A 3WD5A 2PHDA 3K48A 4UFIA 3ZYPA 2TUNA 2Q5TA 3RQ0A 5SV8A 1NCQA 3ZSJA 5CAZA 1BBT1 2BDRA 2WQZC 3AMMA 4Q0PA 2EICA 2PHXA 4NPRA 1FAYA 1D4VB 1N3PA 1RC6A 4Q4X3 5LBBA 4AFCA 5JXIA 1CWPA 4YZ1A 1UXZA 3AVRA 4DOUA 5ACA2 1EPWA 3OOXA 2ZAHA 4GWJA 4N9IA 5FYYA 1XNCA 4CEYB 3GHMA 1SG3A 1HJGA 1K5JA 3KB5A 4M0NA 2Q0AA 3PVEA 4FQZA 4CUBA 2WABA 1UX7A 4NHYA 3UGGA 4I2OA 3K4ZA 1WWYA 2O14A 4H3WA 1Y3TA 1S0BA 1H8VA 4R4XA 5CADA 3T3YA 3MO4A 1QJZA 3ETQA 4QGNA 3SKJE 3E6DA 1W8HA 4D0QA 4RGAA 3EB7A 4N7IA 3J7LA 4QM8A 1MS1A 2FCUA 4CSWA 2C9AA 3WDXA 1F2NA 3HWJA 1OXCA 1JZ3A 2D6KA 3VKLA 3AZWA 1HV1A 1CZTA 5FZ6A 4BXSV 5I0RA 5E89A 1KJLA 1W8UA 3CBNA 4JRAA 1LHWA 2WWSA 2VPVA 2ET7A 5CBLA 1KJRA 1VBA3 1ZNPA 2CNAA 3JBG2 4XACA 1CN1A 2HWB3 3P3PA 5GLZA 1UAIA 4CPBA 2A73B 2VY0A 1LGNA 3IIAA 3A22A 3JXSA 1LOCA 2JDZA 1GZ9A 1GZTA 3AC0A 3HMYA 5D8AB 1N3OA 4DXTA 4KWJA 5CA6A 1VPHA 3LZZA 4MLOA 5C71A 3WG3A 5A3NA 3OPTA 2DBNA 1VRH3 3VD7A 4CDUA 4JRLA 2WT0A 2W08A 3J4UH 2AH2A 1M06G 1PO12 1Z7S2 4MG2A 4XW3A 4GJYA 1VMFA 4AEJA 3IAPA 4IE5A 1QOTA 3ACGA 5D2AA 2BOJA 1W05A 1W6MA 2VL4A 4FOQA 4AEDC 5J3UA 2VXJA 3TBDA 3FBYA 3WF3A 4LITA 1K45A 1DGWA 3SCGA 2JDMA 4MGYE 5JWPA 1UF2C 5F3CA 3WF0A 4I0WB 4L0PA 4RFT0 1KFUL 1ENXA 1QJU1 4GB31 4X8PA 1AR82 1GZWB 3GCXA 5ABJC 4PCRA 1ZZBA 3KCCA 2XWBB 1NQJA 2D3SA 1Q3EA 4JGYA 4P9LA 1UU5A 4XUNA 5JOZA 2KXLA 4W65A 1S0JA 3VD4A 1Y7BA 1ZYBA 2OW4A 3E97A 3URFA 4DS0A 2Y60A 5JVVA 2BNOA 2D6LX 3KMHA 5FPXA 5F37A 1H6XA 3ZKUA 3ETPA 3ZYGA 4ZU5A 1L7RA 1UX6A 2HWF2 3ACIA 1WBLA 3BPZA 2GNDA 4MHRA 2CAUA 3ZFFB 2TBVA 4UF0A 5E8AA 3H8OA 1QNYA 4MSVA 3RJRA 4XXPA 4N43A 2HYXA 2YV8A 5A7OA 1GQPA 3FLPA 3LA7A 3RWNA 5KHGA 5IVEA 4JX0A 4MXWA 2Q30A 2Y0OA 4AHXA 3T30A 5LWBA 1RUD2 2FDJA 3RMYA 3QH7A 3O0XA 3FUQA 4PBPA 1O8PA 2JG8A 1Q8SA 5FZ8A 4BQYA 3LWCA 1BEV1 1FPN2 1YJLA 2G9GA 4IV1C 4KWUA 5DAVA 3HBKA 2C0ZA 1RYYA 4FTSA 1LCLA 2FDGA 1J1LA 4XFAA 2JIGA 4LBQA 5BYNA 2PELA 1LOBA 3IPVA 3WG1A 4CDWA 1YFUA 5I91A 1VIWB 2NZ9A 5EHDA 1WCQA 3HT2A 4YG3A 3D3AA 5HV0A 2BNNA 2HWD3 5L9RA 3ITQA 3E1F1 3VBRB 1AR62 3W20A 1H30A 2BRTA 5K4LA 1W9YA 5FPBA 4BISA 4UFJA 5FXWA 3ZFGA 1S2EA 1V9U2 5C4WA 3NAPA 4XCBA 3ZFEA 2BBVA 1RHI1 5FYTA 1X9PA 2YGLA 2JICA 3VKNA 4F3JA 3MIGA 1RL3A 4DPNA 3O1PA 4QT6A 2OT7A 3AMQA 3JQWA 3ST7A 1V70A 4YW4A 5L73A 3RSJA 1AR91 2XONA 1W9WA 1OQEA 2RM21 3LB9A 3OJBA 3H1MA 4AQ6A 4EWAA 3MZHA 5H9SA 5A3UA 3OD0A 4QX5A 5JXJA 3H3UA 4FVVA 2H6CA 1PK6A 3OGGA 5GZGA 2V4VA 3BN6A 4JGZB 1AXKA 3LOBA 3U1XA 2HKXA 1NCRA 4C0BA 4CTEA 3DYOA 2WS92 2LRPA 2A6WA 3FBMA 2QQUA 4ZZ8A 3D0SA 5FXXA 3WY6A 2HEWF 3WNXA 1W28A 1PGSA 5LRSA 4OI4A 1AYN3 3LCPA 3J8F2 4YRDA 2TNFA 3AYAA 4LKEA 2VXRA 3BIEA 2XUEA 2CGNA 3WW3A 3WCSA 2HYKA 2Z42A 1POV0 2HWE3 5D21A 1OT5A 2Y6GA 5EZWA 2Q1MA 3DF0A 1MR5A 1PGL1 1HW5A 1CZSA 2GMMA 1D2SA 1H9PA 2XR4A 1QDCA 2QQJA 5A33A 3OSDA 3FL7A 3IB3A 1APNA 3IIIA 3ILFA 3R05A 2IZWA 4YW2A 3GBWA 2HWC2 1RUE2 4QQ2A 3VD3A 3K3OA 2JXAA 1LGCA 4LO6B 3CJXA 1EP0A 4QHZA 1SHWB 1RUC2 4QPIB 5JI9A 1NE4A 3ROUA 3I2HA 4PBOA 4N90A 4SBVA 2QBXA 2XLAA 5C3QA 3AX4A 5JDBA 2NM1A 4IE6A 1KEXA 3AYEA 3LFMA 3W59A 1C8NA 4Q4W3 1QXRA 2OZ6A 1TEIA 4A6SA 1O4ZA 1RUOA 4B7KA 2Z2SB 2RS12 4I01A 4ASLA 4OI0A 1YI9A 2D6PA 2VTXJ 5A32B 4QPGC 3JD73 2VNGA 3MIEA 2VOWA 4BWOA 5FK8A 4DY5A 2D7FA 1YQ8A 1QJX2 4BE3A 1DF0A 3WQ1A 2R073 4JHZA 1US3A 4PLOA 3VDDC 3PMEA 3K4AA 3GHNA 1MQTB 4FPHA 5FYUA 5B4XA 3LEKA 2ZGMA 2BGPA 3MYXA 4K21A 4RD7A 5DZEA 5BY5A 5K0UB 4WM8B 4DXSA 4YZ5A 1WLCA 4Z92B 1HRI1 1BVVA 1LKNA 3LPFA 5D1IA 5A7WA 4ATEA 1QU0A 4E2GA 4XFHA 2N7GA 4UW4A 3MFAA 4XXAA 3I97A 1FMD2 4BOWA 4Y5SA 4OQ9A 2ARAA 3POYA 2MPFA 1NLQA 1HJFA 3WHTA 2R0HA 2QDNA 4AEDA 2JG9A 3CO2A 4KBZA 4Y1XA 1LEDA 1TZOA 4Y3OA 1N3QA 5G04L 5IFPA 3VKOA 4LT5A 5FZHA 5AVAA 4C91A 4RHV2 2W2IA 3INAA 4YW5A 2ZGOA 5AFEA 4FPCA 4QWNA 2XOMA 5FFOC 3LDRA 1FV3A 2VQUA 5FZAA 2CSGA 3AJZA 2FD8A 1QHDA 2UYBA 1S2BA 5LY2A 2Y6LA 4YZ4A 3PJYA 3UKTA 4D6SA 5C9AB 4BQ4A 1I6XA 3MIBA 5F8PA 3USUB 1WLWA 4DINB 2YUEA 1W9TA 1H1MA 1R1A1 2A70A 3F95A 3PUAA 4ZS2A 2R062 2Z79A 2ZABA 3CJIA 3ENRA 4PIYA 4A7KA 1W9SA 2WA4A 5E88A 4M3CB 3ZSMA 4WVMA 2VVEA 2YG0A 4XHXA 5BXXA 3EJKA 3WP3A 5JIUA 1X7NA 1HRV1 4NPMA 1ZRFA 1AX1A 2A6VA 4GZ9A 4CP9B 2H6BA 1VBB3 2CAVA 2RDQA 2JDPA 2IXLA 5FZMA 1DDLA 1PIV1 3RPQA 5DDJ1 1DQ1A 1EPZA 2CDOA 4Y4RA 4YM2A 4XF0A 2W1SA 1F5FA 3WDWA 1GR3A 3C7HA 4K8RB 5CFCC 3IKWA 1PM7A 2VW1A 5IT6A 1K3IA 1FV2A 3LA3A 3WP4A 2WDBA 4UFMA 4BQXA 1O3RA 3HBZA 3LEMA 4PIXA 2V72A 3VBSB 2RMU3 3AP9A 4I09A 2RE9A 5C3PA 1HIXA 1OMIA 4AAXA 4AZZA 3EQEA 1BCXA 2A3XA 3Q8FA 4IV3B 5I8TA 1QJU2 2OKXA 3WF2A 1UMZA 1W0PA 4IEYA 2X5IC 4XIOA 4BHPA 2JENA 3LSDA 3PUQA 2BEOA 4YM1A 1MEC3 2VC9A 1KS4A 2QZ3A 3HPNA 3T1LA 3T0BA 5BNOC 1WA6X 1POV3 3AKSA 4FT8A 5FZKA 1SLLA 2WZR3 3AP5A 1O3TA 3H9AA 1EV12 3GNEA 3PIJA 3POBA 3THCA 5HXMA 4YFWA 5IVJA 2D97A 2CYFA 3OY8A 3OPWA 5TSWA 4M3CF 2JDNA 1J58A 4NHKA 3VL8A 3FJSA 1YQ6A 4UT5A 2GC0A 2WFPA 4AK3A 4ZONA 5F5IA 4A4AA 4C1XA 1UY4A 2FQPA 1ASJ2 1U5YA 3OBAA 5CG9A 1DQ5A 4CEYC 4LE4A 4IEQA 2CL2A 4QGMA 3VD5A 4ZXKA 3OGSA 5T5OA 5BNPB 2DV9A 2BWAA 2WINB 1Q56A 4V1PA 1LOFC 2VOTA 1RUJ1 5JUVA 4LQRA 1HB1A 3S57A 4XOGA 2YPJA 3J26N 2VOKA 4HBNA 4X6RB 5JOYA 5FYVA 2AACA 4MGQA 2VGDA 1UY2A 4QM9A 1D4M3 2J1SA 1R092 1WMXA 2LW8A 2RV9A 3B3QE 3KT4A 3N9OA 5DAQA 4L9BA 2WN3A 5J98B 5IHRA 4R52A 3KD4A 4KU7A 2WFF2 5KBFA 4QMAA 5FXZA 2ORZA 2ORXA 1SLIA 2YU1A 1PVXA 2GSYA 5DPNA 4AHYA 4S2DA 5IVCA 5APAA 1LOAA 4CVUA 1W04A 2BGCA 4Y22A 1MZFA 2C26A 1IPKA 3B02A 3KLSA 5FKCA 1DLCA 2ZGRA 1FATA 1PGW2 4KGGA 2ZGLA 2BZDA 1YNAA 2YC2A 4AEKA 2ZX1A 2MEV2 2BU9A 2ZX2A 4FXKB 4YZ2A 3HOBA 4LLFA 5FY4A 5JPNB 1GU3A 4FAHA 5ACA1 2ENRA 1A8MA 3VGIA 5A6XA 1RMU2 1ZBA2 4XURA 1WCSA 3M2MA 4HKWA 4CP1A 1JI6A 2B5HA 1C28A 2ZKNA 1ZZ7A 1CJDA 2E7TA 3IWZA 3ZN6B 5GZEA 3FZ3A 5FWEA 2W94A 5L9BA 2A3WA 3D0JA 1JZ5A 1OURA 4PF5A 5DMYA 5LBEA 3CHXA 5LZ6A 5F39A 3NSTA 1JZ7A 3KHCA 2HEVF 4WM7A 5A7PA 3X29B 2YPDA 1S0DA 4O9EA 5FP8A 1T6BX 1FYUA 1TQ5A 3N7KA 1UY3A 5HPOA 1ULOA 1HB3A 4NWWA 4PT6A 4EN8B 1W6OA 2DTWA 2R1DA 3HT1A 3ZXLA 3OF1A 4LBLA 2VOXA 4EWDA 1AR73 1JN2P 2DURA 2RS53 2XBO3 3T0AA 4IESA 1W6QB 4GD4A 2WQ8A 4MYEA 4H55A 1NE6A 3HVDA 5EIYB 1RTVA 2XGXA 1XB9A 3HN3A 3JBG1 1R1ZA 5BNNB 3DYMA 2PQSA 3ZXGA 3POJA 4J25A 5IK8A 2AGSA 5H9RA 1Q5OA 1QQP2 1C5HA 1DGLA 2JKXA 2D3RA 2ZJCA 3NJVA 4TN7A 4EN0A 5FZ3A 2K2SA 2UY8A 2BV4A 1K5MC 1V6JA 3O1RA 1W2UA 2TEPA 2O0OA 3E5QA 2J1UA 1X36A 4FQ4A 4LHNA 3UYJA 3N4MA 4XUOA 1LU1A 1WCUA 3I2IA 3TN93 4BB3A 4PLMA 1TNFA 3AP4A 1S0CA 1LODA 1ZX5A 4KH9A 4NVPA 3N3HA 3MICA 4Z82A 4OHZA 2I07B 1REDA 2YGMA 3POIA 1NA1B 4Q8LA 4QXHA 2R071 1YLLA 2R043 5GLUA 1JS9A 3HJRA 3KF3A 1CAWB 5J36A 1X9TA 4NHXA 2ZHLA 4Q4X2 2WL1A 1YIPA 3ZPYA 4QU2A 4YFZA 4O65A 3SC7X 5HCHA 3PJQA 4JKMA 2JDUA 3I4IA 1RUF3 3A21A 1AR81 3I2DA 1EYBA 2P4EA 4AI1A 3WQ0A 1D2QA 1BHGA 1YIFA 1G9FA 1VBE3 3VBRC 3WQBA 1TNRA 3I3QA 4JDMA 5BV6A 1G86A 3MIHA 4I0BA 1RUNA 1ZA7A 4D6RA 5HBAA 4KG8A 3PVOA 1S4CA 4QX8A 3A7QA 1J3RA 3L2YA 2IFRA 4LKDA 1G9BA 4CP0A 3VBHC 2Q8OA 4UI9L 4EN6B 1JYCA 3OUIA 3R4DB 3PURA 4NAMA 2HWF1 4RS5B 5CISA 3UT0A 4FOVA 3ELNA 3AZVA 3WQ7A 2AZ5A 3RNSA 1G6NA 1KDMA 1R083 1X8MA 1YRZA 2ZGNA 5DG1A 5FZOA 3TNQA 4DFSA 4W8JA 2JIJA 4E4ZA 1O8SA 4NHLA 4PJYA 1VLNA 3ZLIA 2ZKLA 1H2NA 1UO9A 1VBA2 2H0BA 1ND2A 3VBUC 1RUD1 4XILA 2HWB2 2VUCA 2OIIA 3R4UA 4GH4B 1QJEA 3RJ2X 3OYWB 1FPN1 4C90A 4PDWA 4QPGB 4FBFA 4AW7A 1WLDA 3K3NA 4XBNA 4Y1YA 2NMOA 5CEHA 2PLV3 2ADEA 2PYTA 4ORFA 2GMEA 4LORA 1H2MA 3SKVA 2WJSA 4LEJA 3ZXEA 1VRH2 4YVSC 5L9VA 4K1ZA 1AR61 1REFA 1GP5A 1H2KA 1W2NA 2E26A 1O3QA 3SITA 2VZRA 1E5IA 3H1WA 3Q8CA 2EXKA 3ZXKA 4QX7A 2VR4A 1ZVFA 4UWDA 4AI3A 4QXKA 4UAPA 3C3VA 1S0GA 1MACA 4U2AA 4A7YA 1XNKA 3WVJA 1J3PA 1PIV2 3CDZB 3PU3A 3Q8AA 1DHKB 4ZPIA 5IATA 3I3MA 3WT3A 4HXCA 2W3JA 5DUVA 3MF6A 3DKWA 4OUMA 2IVIB 4XYXA 5FJKA 2DCJA 2V4AA 2E53A 4XMIA 4N53C 2EAKA 1AJKA 3RG0A 5F32A 2B46X 4NIIA 3C7FA 3Q9OA 2BPA2 3KS7A 4KWKA 5CNAA 4GMP0 5LEKA 4M01A 3DL3A 5F2SA 4XF3A 4XHBA 3USSA 5FWJA 3FFQA 1YQ2A 3T09A 4GQ7A 4CU6A 4JV4A 2ZGKA 4XF1A 4Z1VA 3WUDA 1PZ8A 1POV1 5C6CA 4E9KA 3SLIA 1VBD3 1NKGA 2B9UA 2R7EB 5I0DA 2BFUL 2JKBA 4L99A 1AUYA 1O4YA 1UYXA 5LA1A 4ARXA 1U5ZA 2XVGA 4ITCA 3T08A 4Q8KA 3HNYM 4CEWC 4AHWA 1GP4A 3RZGA 1OLQA 3J8F1 3AMPA 4CDQB 2PMWB 3NV4A 1WCDJ 1ZZ8A 3F2ZA 4META 1KGYA 1WKYA 4QAWA 1Z78A 4QU1A 5I0UA 3O1SA 2GAUA 3Q8BA 2WNVB 4P9WA 1MQTC 5KHKA 1W3XA 5D8AA 4AHZA 1CAUB 4AI2A 3ZR6A 1GYKA 1RXFA 2F17A 4Z8BA 3AMNA 3WDVA 5CIRA 2GMPA 1NOVA 2WSUA 1KQRA 3OB8A 4TLGA 2FDFA 1ZREA 1H8TB 4LO7A 4HKOA 5HV4A 4AFDA 5JZGB 3MUZ1 3TEWA 2JDYA 5A3OA 2HWC1 3HD8B 3OBTA 2CHHA 4Y20B 4AR2A 1RINA 3WINE 2HWD2 2BFUS 1RUC1 2VMFA 2WLPA 5HCFA 1HLCA 5DUUA 5T5LA 2IXHA 1V6NA 2RJLA 3ZN4A 2GC3A 3ZYFA 4AVBA 5A3PA 1BKZA 2B45X 3OTFA 3VHNA 1JYTA 5FZBA 2ARCA 4MX3A 5GZFA 5E6HA 4HANA 3ZOIA 4CUCA 1PVC3 1CX4A 4AI8A 1W06A 2BVBA 4KMQA 3TEXA 1HN0A 5BUVA 1WW5A 2YY1A 4IGOA 4NRQA 1NY72 1UOFA 1XNAA 1TME3 2H0VA 2OQ6A 2WO1A 3E5UA 5C9AC 1NT0A 3HR9A 2J22A 3ZXDA 1QJX1 5BNOB 2X29A 3O0WA 2X09A 4QKNA 2WYFA 3IMMA 2DUQA 2ARBA 3UKVA 4OCTA 3VZLA 1HV0A 2DF7A 1MS4A 3KQRA 4L2NA 1RGSA 2XUMA 4YVWA 4YG6A 3M3EA 4QXBA 4W6WA 5EQUA 3RZJA 1OVPA 5DABA 4XF9A 3ZFFA 2PHLA 4Q29A 1OA3A 1YFXA 1B35B 1UY1A 2D40A 3JUUA 3THTA 1FMD1 3JU9A 4OHWA 5A7QA 4V2WA 4UBHA 2Y64A 2VCCA 5J96B 3LKJA 1LECA 2UWCA 3MPPG 1SFNA 3WF4A 3LGRA 3WNPA 1AYN2 3A23A 3ZXFA 1AL23 4RSUA 1PX3A 1W6NB 2K0GA 3S30A 1NLRA 5A6YA 5IYYA 5L19A 2WO7A 4RHV1 1NZCA 2HWE2 1CGPA 1GNHA 1YO8A 3PMSA 4W6XA 4MZUA 3VBSC 4TTGA 2BBAA 2E33A 3B01A 3ZYJB 1F5JA 1FT9A 4XCAA 1D7PM 2DU0A 3WR0A 5KXEA 1OA2A 2VU9A 3FHIB 5IK7A 1Y4WA 2D6OX 3PU8A 4IV3C 4RL7A 1GLHA 3OEAA 2OPKA 1XYNA 1W6PB 2D44A 2ZBJA 4R9BA 2R061 2DYCA 1ZA4A 2XJSA 3MIDA 3GZTB 4AVVA 4OYUA 3WHUA 1QDOA 1VRBA 3T4VA 4A7ZA 4BXFA 2QKDA 2Q8CA 2JE8A 4GALA 4UW5A 4A44A 2P6HA 5KC6A 5B2GB 1LHNA 2BGOA 1E5SA 2WZEA 5LEJA 4KQ7A 1DLLA 3SH5A 4DB5A 2JECA 4Y1UA 4DEVA 4DO0A 2BOIA 5LBCA 5A1FA 2R041 5FPUA 4YW7A 4Q4W2 1DCSA 1TMF3 1Z0HA 2PAEA 1V6KA 3KVBA 3QBQA 5GLTA 1YQ5A 1FOD3 2BYVE 5IJRA 4F8AA 1SDWA 3NV1A 3JD72 5T3NA 2WNOA 2VH9A 2VVFA 3M1HA 2JWPA 1UZ0A 3UGFA 5BNPC 2R072 4GMP3 3HAGA 3DKQA 4P14A 1H1AA 2PHRA 1QY4A 1NXMA 2D93A 3FHAA 3PIGA 4LOSA 4YGBA 2HEYF 3RZZA 2A6XA 1H2LA 4JGZA 5C70A 3FX3A 1XPWA 4IE4A 1W8OA 3IDCB 3GDBA 1Q8VA 3CF6E 3L9JT 4BQ1A 3GCWA 2YZ4A 3GYDA 3FUOA 4Q4Y3 1DGRA 5GM0A 3WNMA 2EA7A 2WAOA 3PVNA 5EJ3A 2Y26A 1CAXB 4JC1A 3I3DA 1RJ7A 1IHMA 1C8M3 3H50A 4UFKA 2VD7A 2XJTA 1SBEA 5IWFA 2J42A 1MS0A 2ETEA 2RHPA 4MUVA 2A75A 5FLJA 5JCTA 3T2QA 2WAAA 3WW4A 2DFBA 4OHVA 4HT1T 1K5MB 4R9CA 1AYM3 5FJHA 1EV11 1RVF3 5H9QA 4E2SA 3U07A 4RGKA 1UCXA 3T2TA 5F6LB 3A4UA 2RDNA 5L7OB 1RJ8A 2RVAA 3HEIA 4DY3A 4LKFA 1YFYA 1YQCA 1CVNA 2ZGQA 2JB8A 4D8MA 1ASJ1 1CQ9A 4FFFA 4MXVA 2DVFA 3C8XA 4QDRA 1HXS3 2YBPA 5A6QA 4QPIA 5M0TA 4A42A 4TSVA 3PUIA 1F4AA 3AP7A 4G4FA 1PZ7A 2YROA 4FPLA 1XXNA 4YYOA 2QTWB 4NOTA 1NUKA 2Y33A 3ZXAC 1R091 1H1IA 2JDAA 4EN9B 5FLIA 2IXCA 2VMEA 1VBB2 2WFF1 4OI1A 3LIHA 2BERA 5E1RA 5A32A 1JTZX 5DAXA 2UURA 3CIHA 4RR3A 4OVEA 2RG4A 4QQOA 2VZ3A 2WT2A 1XSRA 3POEA 5FY1A 3U37A 4FFHA 2ZCWA 2RS33 4CCKA 1W3VA 3D8CA 2HLEA 5IAXA 2FDKA 5FZGA 1MQTA 1V6OA 5BNNC 4GJZA 3VBHB 4LBJA 5FZFA 4BDVB 1PGW1 4RA0A 3SH4A 3H8XA 2MEV1 1YI7A 5K0UA 4WM8A 5F9TA 3J7MA 1YEWA 2RMU2 3JB8A 3RI9A 1LHVA 3NJYA 3ZO0B 1CONA 4EZHA 1QMJA 2WYSA 1XBFA 4WVVA 3SEPA 4EYUA 5CKQA 4FI9A 1RMU1 1ZBA1 3V0BB 1J1TA 4OZOA 5EJ1B 2O1QA 4LJHA 1JYWA 1XYOA 2C5DA 3VBUB 3BI3A 1HX6A 4M00A 4QPYA 5B4NA 1JOBA 2EXHA 4LA3A 4IE0A 4NE9A 5FLHA 5C5UA 4WZFA 1SLAA 1MEC2 1W9FA 5HCAA 4IXLA 2DUOA 1SCRA 2ZHNA 4OUSA 1X82A 3BU7A 3WNKA 1GQHA 4BYYA 4YW6A 4C0HA 1NA1C 1ZZ9A 2P34A 2R32A 2VVDA 1QIQA 2WZR2 3CNAA 3K51A 4PF1A 1IPJA 2XJRA 3ZKYA 3K77A 1OOPB 2RDSA 2X05A 1QGLA 5IFTA 2GH2A 4XDOA 2G1MA 3RZMA 3O7OA 4YVSB 1D0HA 1RUH1 3WZ1A 3USUA 3KVAA 4BMBA 1CIWA 1GOHA 1UPIA 3HNBM 1BLZA 2P3IA 4Q26A 1UU4A 2VZQA 3KV6A 2VZSA 4XJ8A 2OZJA 4P9IA 4BM8A 4JTOA 1W6MB 4Q4V3 3SCFA 3SEEA 1G9AA 2A5ZA 3VBOB 4QDSA 2YXSA 3H8RA 2FDIA 3I3EA 2ZTNA 1OF3A 4AQTA 1QQP1 4IW3A 3RGBA 4QX3A 1HDKA 1O5LA 4JDOA 5DAPA 2WC2A 5ERLA 1QJY3 2UYAA 3I7DA 2QQNA 2R30A 1D4M2 3OCPA 1ZRDA 3D4KA 2IFWA 2XVLA 4LK7A 1QKQA 4N53B 4RS5C 2JX9A 4M3CE 2JB4A 4CDXB 1LEMA 4ZU4A 4YM3A 1XC6A 1PMHX 2RR13 3PTRB 4CCNA 4CUGA 3S7EA 3T0DA 4HN0A 3MHZA 1GOGA 4OI2A 5EYYA 4PI0A 4MGKE 3UJOA 4XQDA 3VBSA 4BK5A 2P17A 2QQIA 1Y9GA 3ACFA 2DUPA 3UESA 4D7TA 4GH4C 5J48A 2FZ2A 4Q4X1 3NL1A 3WW1A 4CCCA 1QXJA 1S1AA 1UPSA 4Z07A 3N9QA 4W4ZA 4D69A 4CEWB 4UFLA 4BQ3A 4AOCA 4N8MA 1BVP1 1MS8A 5A6ZA 4OUEA 2KM2A 4CCLA 3U4XA 3WX5A 3BVCA 4XMAA 2XJPA 1GWLA 2ZOEB 3GJAA 1I1EA 3CZUA 1LNSA 4LKSA 1BK1A 2JG8B 2NMNA 3J7HA 1IS6A 3JCIA 2VZTA 3NNGA 3AVSA 2QVSB 1IS4A 3WNOA 2DVBA 2DVGA 3A0KA 4YGDA 1N1VA 1RUG3 1UZYA 2VZPA 1SMVA 1COV3 3KM5A 1A8DA 4GWNA 1ZZ6A 3TOJA 2GP3A 3N9PA 3NKGA 1AR72 4CPBD 1IS3A 2XBO2 1PNFA 2RS52 2VW0A 2YMZA 2VTXA 4HFSA 5H9PA 3CL1A 4PQ9A 5FZ4A 2ZX4A 2VTFA 4XFGA 4Y5Z0 1VBA1 1OVSA 1SPPB 2VQ0A 2D6MA 2HWB1 4P5YA 2P5BA 3ZFEB 2E51A 3H42B 1HQNA 3DPRC 3KGZA 4JHTA 2D6NA 3B5LB 4HPKB 2D5HA 1V6MA 4GIQA 2AREA 5ABJA 1RXGA 3KSCA 4RQPC 1EY2A 4MO3M 2OPWA 3HQRA 3CKHA 2BUKA 1GKBA 2ZACA 5IAVA 3U14A 4YSFA 4TXWA 2VJXA 2GC1A 5F7UA 1U0AA 3OEBA 4XQ4A 1VRH1 5FP9A 1JYNA 3TN92 1TMF1 2EALA 1XU1A 1KITA 1YUDA 2WKKA 1YCIA 4OLLA 3R6SA 2AENA 4CDQC 4BQ2A 2Q1ZB 4HOOA 4QQPA 3V0AB 1GUIA 4TYSA 5EJZB 3M8LA 4L97A 1F4HA 3BIWE 1SACA 1VB2A 4O7XA 3NNJA 2W9XA 2WNVC 3OPZA 2R042 2VO5A 4FOWA 4XVHA 3VDCA 4F83A 1VAMA 1CPMA 5BPXA 1W2OA 4Y1ZA 1WD3A 4EN7B 3WF1A 1NX9A 4KGQA 3ZN6A 1RUF2 1H8TC 5FY7A 1EAH3 3UETA 5JZGC 3ON7A 5FYHA 3KF5A 5JR2A 4IV1A 5FY5A 1VBE2 3MW3A 3POSA 4K8FA 3P1IA 5A33B 3RMXA 1PO23 1UQXA 4Z2WA 2A3YA 5J7MA 1OLME 2VBBA 2Z4FA 3IAQA 3MV01 3LE0A 1IKQA 1OQDA 2XJUA 5A7NA 1ULFA 4CUAA 5FO8B 1UIKA 1UOBA 1N47A 1S0FA 1W6QA 3KV4A 3BALA 1NAEA 5BNQA 4FPGA 4H7LA 4HLTA 1UKRA 3ZMOA 1LHUA 2VMIA 3H3LA 1R082 4FFIA 1SFYA 1TVGA 1GWKA 3TWIA 2W46A 2P3KA 5LATA 4B4RA 4FTBA 5JXHA 1UOJA 4LBQD 1G9DA 1J83A 4BA6A 2LALA 4LBOA 2W39A 5FZ7A 2EIGA 3P5BA 1AXYA 2PHTA 3KT7A 4QXCA 5FZCA 3U78A 1Q43A 2K9ZA 3C2UA 4QHOA 3AP6A 2NP0A 1OA4A 2QQLA 5FBZA 2PLV2 3RFRA 1B35C 5FYZA 3WDUA 4QB6A 5FYCA 2CU5A 1AX0A 4NIHA 2HWD1 1OQ1A 3RRDA 4COVA 3AZZA 4AYUA 3BTZA 5FY8A 4QB1A 5FV3A 4NUBA 4AVTA 1W8WA 4Q5OA 2QDRA 5A7WB 1CAWA 3VBFC 4ATFA 2ZEWA 1HB2A 1JZ2A 4Q0SA 3UKNA 4W6YA 4O9GA 4FOYA 5CFDB 1W39A 3ZPOA 3KV5A 4Y26A 1NY71 4LBNA 4NIAA 4CP2A 4F7ZA 5HI0A 3IMNA 2JG9B 2VULA 3AFGA 4AQ2A 1W8TA 2F4PA 4LTAA 2VAUA
chains in the Genus database with same CATH topology
3K46A 2J1EA 3VD7A 3LEIA 1OH4A 1K42A 3CDZB 4LPLA 2W3JA 2EIEA 3IAPA 1T2XA 3ACGA 2VL4A 2DCJA 3WF3A 5FUIA 3C7FA 1K45A 2ZEYA 3MBWA 3WF0A 1YQ2A 3T09A 4L0PA 4CU6A 2ID4A 1NKGA 2R7EB 5I0DA 5J1XA 4XUNA 1UYXA 5LA1A 4ARXA 3T08A 3VD4A 3HNYM 3F2ZA 4DUVA 1KGYA 1WKYA 4QAWA 4UAPA 1H6XA 1EUTA 3ETPA 1JYVA 4M4PA 1EUUA 1L7RA 3ACIA 5LCWL 3BGAA 5LA2A 4IUGA 1R64A 2HYXA 2J1AA 4KI5M 2WUHA 3OB8A 1GQPA 4JX0A 4JKKA 3UNPA 3MUZ1 3I2FA 1O8PA 4HG6B 4AG4A 5C7GA 2VMFA 4KWUA 1HN1A 1H6YA 1RYYA 4LHSA 2VZOA 4E8CA 1WCQA 3D3AA 4CUCA 1UXXX 3OGRA 3E1F1 4KMQA 1JZ4A 4MADA 2VQTA 1XNAA 1UWWA 2WO1A 2J22A 4DUWA 2WN2A 2X09A 2ZEXA 2W92A 3IDAA 1US2A 2XONA 1W9WA 2C4XA 3WNLA 4RN5A 5JXJA 1UY1A 5JMOA 2VMCA 4QX1A 2Y64A 2VCCA 3GGLA 3WF4A 3WNPA 3GXUA 2V4VA 3A23A 3BN6A 1PX3A 3DYOA 5IYYA 2DDUA 3OGVA 3T2PA 4ZZ8A 2JD9A 4TTGA 2BBAA 2E33A 2WZ8A 1D7PM 4XZUG 2J1RA 3OEAA 4ET7A 3T2OA 1OT5A 2Y6GA 2XHNA 2DCKA 1CZVA 3DECA 1CZSA 2VM9A 4OYUA 2QQJA 4A44A 2JE8A 3FL7A 2BGOA 4XUTA 1UMIA 2Y6HA 3IB3A 2W95A 3CZJA 2WZEA 3IIIA 1W99A 4DEVA 3VD3A 1SHWB 3K75B 5IJRA 2LS6A 2QQOA 4JKLA 2VCBA 3I2HA 2QBXA 4QB2A 4A45A 1UZ0A 1KEXA 5JXGA 3FHAA 2B4KA 1UY0A 5C70A 1XPWA 1W8OA 1CX1A 3GDBA 3ACHA 4JHZA 3WNMA 4W50A 1US3A 2WAOA 3K4AA 5B4XA 3I3DA 4P02B 3LEKA 2BGPA 4DXSA 4OMDA 2E31A 3T2QA 2WAAA 3LPFA 3W5MA 4MGSA 3MV11 3I97A 3C7OA 2RVAA 3HEIA 2X10A 4D8MA 5IFPA 5G04L 3C8XA 4QDRA 1I5PA 2XOMA 2VQUA 3GM8A 4A42A 3PUIA 1F4AA 2Y6LA 2ZEZA 3WNNA 3I3BA 1NUKA 3C7GA 2JDAA 1W8NA 4UOJA 1W9TA 3VDAA 3VDBA 3ECQA 3PUHA 2VMEA 2BERA 2C9KA 1W9SA 2J1TA 2QQKA 3CIHA 1JHJA 2VZ3A 3U37A 2YG0A 1UYZA 2XQXA 3NJXA 2HLEA 4GZ9A 4BK4A 4BDVB 1DYOA 3K4DA 2W91A 3CQOA 4DEQA 2CDOA 2WYSA 3OG2A 2W1SA 3SEPA 3C7HA 2KD7A 4FI9A 5LA0A 1GNYA 1K3IA 4OZOA 2WDBA 5EJ1B 1JYWA 4ARYA 1UYYA 2V72A 5B4NA 4CU8A 5DN2A 4A41A 4QX0A 4AAXA 5CYYA 1OF4A 3WNKA 4E8DA 2YFZA 2OKXA 3WF2A 1JU4A 4PF1A 1O59A 3K77A 2X05A 2VZVA 5IFTA 1MPXA 2YFUA 1IQDC 2VC9A 3HPNA 4M4RA 3T0BA 1GOHA 4QDQA 3HNBM 4A6OA 2VZQA 2W1WA 4YPJA 2VZSA 1TG7A 3THCA 5HXMA 1L7QA 3SEEA 4QDSA 4ZY9A 3I3EA 1OF3A 2YC4A 4QX3A 4ZXEA 4A4AA 3LPGA 1UY4A 1GMMA 3OBAA 2QQNA 2W1UA 3EYPA 2WBKA 3VD5A 4CU9A 1PX4A 3OGSA 2Y6JA 3C7EA 1OD3A 2VZUA 2VOTA 5JUVA 4LQRA 2W47A 3ABZA 1XC6A 1PMHX 4MGQA 1UY2A 4PQQA 2LW8A 2J1SA 2CDPA 3T0DA 2RV9A 2Y6KA 1GOGA 2VZ1A 5IHRA 2WN3A 4BK5A 2QQIA 2W87A 3ACFA 1JZ6A 3VD9A 3UESA 3DYPA 3WSOA 3P6BA 2ORZA 2ORXA 4QX2A 4W4ZA 5DPNA 3FN9A 3W5NA 4CVUA 4OUEA 2C26A 1DLCA 5A1AA 2BZDA 3I2GA 2YC2A 2J7MA 2WO2A 3CZUA 3HOBA 1LNSA 4LKSA 5DQ0A 1XNTA 1GU3A 3J7HA 3LQCA 4MOAA 1ULPA 2VZTA 3NNGA 4XURA 3WNOA 1JI6A 3CMGA 3WEZA 4DXRA 1UMHA 4Z2AA 1SDDB 3THDA 2VZPA 2VCAA 2W94A 4P00B 3NRUA 1JZ5A 3ZM8A 4XUQA 5DMYA 2B9VA 4ZZ5A 1JZ7A 2J1VA 1JZ8A 2VTFA 1UY3A 2EIBA 5HPOA 1ULOA 4PT6A 2L9LA 4P5YA 2E32A 3T0AA 2WQ8A 4GWIA 3HNMA 4BJ0A 2Y8KA 5EIYB 3HN3A 4MO3M 1JU3A 3CKHA 3DYMA 2PQSA 3I2KA 5CZKA 4TXWA 2VMDA 4QPWA 2VJXA 5F7UA 3OEBA 1DP0A 1JYNA 2JKXA 3NJVA 1GOFA 1GUIA 5EJZB 1K12A 1F4HA 2W5FA 2YB7A 4DUXA 2J1UA 2QQMA 1PMJX 4XUOA 2W9XA 4A3ZA 3I2IA 2EIDA 2VO5A 1JYXA 4XVHA 3VDCA 4RYDA 3WF1A 1NX9A 3UETA 2ZXQA 3HJRA 5JR2A 3NQHA 3P1IA 1W0NA 2WO3A 4JKMA 3FHQA 3A21A 3IAQA 2Z4FA 3MV01 2EICA 1BHGA 1P8JA 3LE0A 4CUAA 4P08A 5JXIA 3WQBA 1NAEA 1UXZA 1TVGA 4GWJA 3A7QA 2W46A 4OMCA 4CU7A 4UI9L 1SG3A 5JXHA 4CUBA 1J83A 2V5DA 2WABA 1UX7A 3K4ZA 5G05L 3LEGA 3MUY1 4W8JA 1O8SA 3MO4A 3SKJE 4D0QA 3EB7A 2QQLA 3I2JA 1JZ3A 4QB6A 1CZTA 4BXSV 1CIYA 4XUPA 4QB1A 2ZEWA 1JZ2A 3SKVA 2W1QA 3A22A 2E26A 3JXSA 1J84A 2VZRA 3AC0A 4DXTA 2VR4A 5C71A 2RJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K46 A;  2J1E A;  3VD7 A;  3LEI A;  1OH4 A;  1K42 A;  3CDZ B;  4LPL A;  2W3J A;  2EIE A;  3IAP A;  1T2X A;  3ACG A;  2VL4 A;  2DCJ A;  3WF3 A;  5FUI A;  3C7F A;  1K45 A;  2ZEY A;  3MBW A;  3WF0 A;  1YQ2 A;  3T09 A;  4L0P A;  4CU6 A;  2ID4 A;  1NKG A;  2R7E B;  5I0D A;  5J1X A;  4XUN A;  1UYX A;  5LA1 A;  4ARX A;  3T08 A;  3VD4 A;  3HNY M;  3F2Z A;  4DUV A;  1KGY A;  1WKY A;  4QAW A;  4UAP A;  1H6X A;  1EUT A;  3ETP A;  1JYV A;  4M4P A;  1EUU A;  1L7R A;  3ACI A;  5LCW L;  3BGA A;  5LA2 A;  4IUG A;  1R64 A;  2HYX A;  2J1A A;  4KI5 M;  2WUH A;  3OB8 A;  1GQP A;  4JX0 A;  4JKK A;  3UNP A;  3MUZ 1;  3I2F A;  1O8P A;  4HG6 B;  4AG4 A;  5C7G A;  2VMF A;  4KWU A;  1HN1 A;  1H6Y A;  1RYY A;  4LHS A;  2VZO A;  4E8C A;  1WCQ A;  3D3A A;  4CUC A;  1UXX X;  3OGR A;  3E1F 1;  4KMQ A;  1JZ4 A;  4MAD A;  2VQT A;  1XNA A;  1UWW A;  2WO1 A;  2J22 A;  4DUW A;  2WN2 A;  2X09 A;  2ZEX A;  2W92 A;  3IDA A;  1US2 A;  2XON A;  1W9W A;  2C4X A;  3WNL A;  4RN5 A;  5JXJ A;  1UY1 A;  5JMO A;  2VMC A;  4QX1 A;  2Y64 A;  2VCC A;  3GGL A;  3WF4 A;  3WNP A;  3GXU A;  2V4V A;  3A23 A;  3BN6 A;  1PX3 A;  3DYO A;  5IYY A;  2DDU A;  3OGV A;  3T2P A;  4ZZ8 A;  2JD9 A;  4TTG A;  2BBA A;  2E33 A;  2WZ8 A;  1D7P M;  4XZU G;  2J1R A;  3OEA A;  4ET7 A;  3T2O A;  1OT5 A;  2Y6G A;  2XHN A;  2DCK A;  1CZV A;  3DEC A;  1CZS A;  2VM9 A;  4OYU A;  2QQJ A;  4A44 A;  2JE8 A;  3FL7 A;  2BGO A;  4XUT A;  1UMI A;  2Y6H A;  3IB3 A;  2W95 A;  3CZJ A;  2WZE A;  3III A;  1W99 A;  4DEV A;  3VD3 A;  1SHW B;  3K75 B;  5IJR A;  2LS6 A;  2QQO A;  4JKL A;  2VCB A;  3I2H A;  2QBX A;  4QB2 A;  4A45 A;  1UZ0 A;  1KEX A;  5JXG A;  3FHA A;  2B4K A;  1UY0 A;  5C70 A;  1XPW A;  1W8O A;  1CX1 A;  3GDB A;  3ACH A;  4JHZ A;  3WNM A;  4W50 A;  1US3 A;  2WAO A;  3K4A A;  5B4X A;  3I3D A;  4P02 B;  3LEK A;  2BGP A;  4DXS A;  4OMD A;  2E31 A;  3T2Q A;  2WAA A;  3LPF A;  3W5M A;  4MGS A;  3MV1 1;  3I97 A;  3C7O A;  2RVA A;  3HEI A;  2X10 A;  4D8M A;  5IFP A;  5G04 L;  3C8X A;  4QDR A;  1I5P A;  2XOM A;  2VQU A;  3GM8 A;  4A42 A;  3PUI A;  1F4A A;  2Y6L A;  2ZEZ A;  3WNN A;  3I3B A;  1NUK A;  3C7G A;  2JDA A;  1W8N A;  4UOJ A;  1W9T A;  3VDA A;  3VDB A;  3ECQ A;  3PUH A;  2VME A;  2BER A;  2C9K A;  1W9S A;  2J1T A;  2QQK A;  3CIH A;  1JHJ A;  2VZ3 A;  3U37 A;  2YG0 A;  1UYZ A;  2XQX A;  3NJX A;  2HLE A;  4GZ9 A;  4BK4 A;  4BDV B;  1DYO A;  3K4D A;  2W91 A;  3CQO A;  4DEQ A;  2CDO A;  2WYS A;  3OG2 A;  2W1S A;  3SEP A;  3C7H A;  2KD7 A;  4FI9 A;  5LA0 A;  1GNY A;  1K3I A;  4OZO A;  2WDB A;  5EJ1 B;  1JYW A;  4ARY A;  1UYY A;  2V72 A;  5B4N A;  4CU8 A;  5DN2 A;  4A41 A;  4QX0 A;  4AAX A;  5CYY A;  1OF4 A;  3WNK A;  4E8D A;  2YFZ A;  2OKX A;  3WF2 A;  1JU4 A;  4PF1 A;  1O59 A;  3K77 A;  2X05 A;  2VZV A;  5IFT A;  1MPX A;  2YFU A;  1IQD C;  2VC9 A;  3HPN A;  4M4R A;  3T0B A;  1GOH A;  4QDQ A;  3HNB M;  4A6O A;  2VZQ A;  2W1W A;  4YPJ A;  2VZS A;  1TG7 A;  3THC A;  5HXM A;  1L7Q A;  3SEE A;  4QDS A;  4ZY9 A;  3I3E A;  1OF3 A;  2YC4 A;  4QX3 A;  4ZXE A;  4A4A A;  3LPG A;  1UY4 A;  1GMM A;  3OBA A;  2QQN A;  2W1U A;  3EYP A;  2WBK A;  3VD5 A;  4CU9 A;  1PX4 A;  3OGS A;  2Y6J A;  3C7E A;  1OD3 A;  2VZU A;  2VOT A;  5JUV A;  4LQR A;  2W47 A;  3ABZ A;  1XC6 A;  1PMH X;  4MGQ A;  1UY2 A;  4PQQ A;  2LW8 A;  2J1S A;  2CDP A;  3T0D A;  2RV9 A;  2Y6K A;  1GOG A;  2VZ1 A;  5IHR A;  2WN3 A;  4BK5 A;  2QQI A;  2W87 A;  3ACF A;  1JZ6 A;  3VD9 A;  3UES A;  3DYP A;  3WSO A;  3P6B A;  2ORZ A;  2ORX A;  4QX2 A;  4W4Z A;  5DPN A;  3FN9 A;  3W5N A;  4CVU A;  4OUE A;  2C26 A;  1DLC A;  5A1A A;  2BZD A;  3I2G A;  2YC2 A;  2J7M A;  2WO2 A;  3CZU A;  3HOB A;  1LNS A;  4LKS A;  5DQ0 A;  1XNT A;  1GU3 A;  3J7H A;  3LQC A;  4MOA A;  1ULP A;  2VZT A;  3NNG A;  4XUR A;  3WNO A;  1JI6 A;  3CMG A;  3WEZ A;  4DXR A;  1UMH A;  4Z2A A;  1SDD B;  3THD A;  2VZP A;  2VCA A;  2W94 A;  4P00 B;  3NRU A;  1JZ5 A;  3ZM8 A;  4XUQ A;  5DMY A;  2B9V A;  4ZZ5 A;  1JZ7 A;  2J1V A;  1JZ8 A;  2VTF A;  1UY3 A;  2EIB A;  5HPO A;  1ULO A;  4PT6 A;  2L9L A;  4P5Y A;  2E32 A;  3T0A A;  2WQ8 A;  4GWI A;  3HNM A;  4BJ0 A;  2Y8K A;  5EIY B;  3HN3 A;  4MO3 M;  1JU3 A;  3CKH A;  3DYM A;  2PQS A;  3I2K A;  5CZK A;  4TXW A;  2VMD A;  4QPW A;  2VJX A;  5F7U A;  3OEB A;  1DP0 A;  1JYN A;  2JKX A;  3NJV A;  1GOF A;  1GUI A;  5EJZ B;  1K12 A;  1F4H A;  2W5F A;  2YB7 A;  4DUX A;  2J1U A;  2QQM A;  1PMJ X;  4XUO A;  2W9X A;  4A3Z A;  3I2I A;  2EID A;  2VO5 A;  1JYX A;  4XVH A;  3VDC A;  4RYD A;  3WF1 A;  1NX9 A;  3UET A;  2ZXQ A;  3HJR A;  5JR2 A;  3NQH A;  3P1I A;  1W0N A;  2WO3 A;  4JKM A;  3FHQ A;  3A21 A;  3IAQ A;  2Z4F A;  3MV0 1;  2EIC A;  1BHG A;  1P8J A;  3LE0 A;  4CUA A;  4P08 A;  5JXI A;  3WQB A;  1NAE A;  1UXZ A;  1TVG A;  4GWJ A;  3A7Q A;  2W46 A;  4OMC A;  4CU7 A;  4UI9 L;  1SG3 A;  5JXH A;  4CUB A;  1J83 A;  2V5D A;  2WAB A;  1UX7 A;  3K4Z A;  5G05 L;  3LEG A;  3MUY 1;  4W8J A;  1O8S A;  3MO4 A;  3SKJ E;  4D0Q A;  3EB7 A;  2QQL A;  3I2J A;  1JZ3 A;  4QB6 A;  1CZT A;  4BXS V;  1CIY A;  4XUP A;  4QB1 A;  2ZEW A;  1JZ2 A;  3SKV A;  2W1Q A;  3A22 A;  2E26 A;  3JXS A;  1J84 A;  2VZR A;  3AC0 A;  4DXT A;  2VR4 A;  5C71 A;  2RJ2 A; 
#chains in the Genus database with same CATH topology
 2J1E A;  5DUW A;  5FPL A;  2EAA A;  2DFC A;  1OH4 A;  2C6S A;  5ANN A;  4UYB A;  4EJR A;  2AC1 A;  1BK0 A;  5KXB A;  5T5P A;  2EIE A;  1GSL A;  2XKO A;  2PXJ A;  4B4Q A;  3POG A;  3BOP A;  1WW7 A;  3NJZ A;  1FNZ A;  5KXD A;  1VBD 2;  1IZ3 A;  4NRO A;  3EHK A;  4NRM A;  5FUI A;  4K40 A;  4CRQ A;  4DZG A;  1GQG A;  5FZD A;  2DVA A;  4DMI A;  2ZEY A;  1ENQ A;  4FP3 A;  3KT1 A;  3H1Y A;  4R9A A;  1MVE A;  3IT8 A;  4BLI A;  5DAW A;  1LRH A;  5FY0 A;  1AYN 1;  2ID4 A;  1C4R A;  2JE7 A;  1DQ6 A;  4GH4 A;  5F6K A;  5J1X A;  4BU2 A;  5T5J A;  2GC2 A;  2HWE 1;  3OYW A;  5GJ6 A;  4D7S A;  1SBD A;  4QPG A;  4IGQ A;  2XDV A;  3RI8 A;  1RUH 2;  4R4Z A;  1QH7 A;  4LK6 A;  5LAS A;  2CGP A;  3ZSL A;  1BBT 3;  4K9S A;  3KGL A;  2G19 A;  2Y38 A;  4DUV A;  3TEY A;  2UY9 A;  1GWM A;  3QLQ A;  3S5A A;  5F1R A;  4XAA A;  3VDD A;  1EUT A;  3MLL A;  4M4P A;  2XJQ A;  5LCW L;  3LDK A;  5KWR A;  2ZML A;  5IUQ A;  2FDH A;  1OPO A;  5FRA A;  4C8D A;  3W58 A;  3I49 A;  4IUG A;  1J3Q A;  5KR7 A;  1R64 A;  4XDQ A;  2RR1 1;  2J1A A;  2K46 A;  2WUH A;  3ZX7 A;  4BME A;  1C1L A;  4AXO A;  3UNP A;  2CTV A;  2PN5 A;  3I2F A;  2ERF A;  4Q4W 1;  1E5H A;  4XJW A;  1PVC 2;  4WVW A;  5L7O C;  3ZIW A;  4PHZ A;  3G7D A;  3BUC A;  4U36 A;  3JD7 1;  1H6Y A;  1TME 2;  2P37 A;  1YHF A;  1JOP A;  2VBP A;  4LHS A;  2XKP A;  3MPB A;  1OC1 A;  1F9K A;  5CG8 A;  5K9Y A;  4H14 A;  4HVQ A;  2WRA A;  5GZC A;  3AB0 A;  3I54 A;  3PLQ A;  4OZX A;  2RDR A;  3AFK A;  1LB2 A;  1HB4 A;  1JZ4 A;  4MAD A;  3OBR A;  4QQH A;  4Y4Y A;  4DNY A;  1UWW A;  1NZI A;  4LNV A;  2AYH A;  3IBM A;  4G3Y C;  4UFH A;  2V09 A;  3ZYI B;  5FMD A;  5E16 A;  2QZ2 A;  3B93 A;  4XAE A;  5C3O A;  3FLR A;  3KHB A;  2ZEX A;  2W92 A;  2FBE A;  1G7Y A;  4Q0V A;  3ZSK A;  4MGT A;  1H4H A;  3IDA A;  4XF4 A;  1NQD A;  3HIF A;  1AL2 2;  4DRV A;  4C1W A;  2CWM A;  4RN5 A;  4LO8 A;  4KG0 A;  4LUL A;  1CAU A;  1TE1 B;  3TRS B;  4XJA A;  2DVD A;  4QX1 A;  3E5X A;  1X8E A;  1XU2 A;  3GGL A;  5CFC A;  2OUJ A;  1G8W A;  2BQP A;  3GXU A;  1H8T A;  4HET A;  5FR3 A;  1S55 A;  4XFC A;  4D7Y A;  4TZD A;  5JZG A;  2DDU A;  4S2H A;  4Y20 A;  1ZZC A;  1LTE A;  1Y43 B;  2GN3 A;  2JD9 A;  1OKO A;  5FP4 A;  3VHO A;  2VMG A;  3FLT A;  3OBZ A;  5CVR A;  3SCH A;  1F8V A;  3POF A;  4GB3 3;  4XZU G;  3S7I A;  1Q8O A;  2J1R A;  4B29 A;  2SLI A;  2X5I A;  4ET7 A;  1ODM A;  2ZGT A;  1SQ4 A;  1VBB 1;  1OOP C;  3AL5 A;  1ZRR A;  5FOJ B;  2A6Y A;  2VM9 A;  1ENR A;  1XQN A;  3AKP A;  1TMF 2;  2DU1 A;  5BNO A;  1BQP A;  4ERO A;  4HK8 A;  1FOD 2;  2XML A;  2SBA A;  3GZE A;  4XUT A;  5JSP A;  2UWB A;  1UYP A;  3CZJ A;  3WG4 A;  2BVV A;  5EV7 A;  1MZE A;  1EAH 1;  4URT A;  1IGO A;  2ZS6 B;  4BQW A;  3VBO C;  4K7J A;  3U75 A;  1W6O B;  2MHF A;  2RMU 1;  5C8C B;  5FQ0 B;  4JKL A;  4AFA A;  4CEY A;  1ST8 A;  2DCT A;  4GKX A;  4QB2 A;  2VNO A;  1B35 A;  3GZA A;  3NVC A;  1LOF A;  5FXV A;  3JZV A;  4Q4Y 2;  2AEY A;  4CCD A;  5JXG A;  1BMV 2;  2WWJ A;  1BEV 3;  4JGY C;  2ZAA A;  2V5Y A;  2B4K A;  4KU8 A;  1C8M 2;  3KQ4 B;  3DPR B;  1UY0 A;  1MEC 1;  4B8E A;  4CDX C;  4ES9 A;  1VBC 3;  1W6N A;  1XE8 A;  4BIO A;  3NV3 A;  4NIG A;  2V73 A;  1S0I A;  3ACH A;  2YYO A;  3PTY A;  4P5H A;  2WZR 1;  3BB6 A;  4RQP B;  3IDB B;  4AI0 A;  1AYM 2;  4NO4 A;  1RVF 2;  2AR6 A;  1ULE A;  3WXP A;  1HQL A;  3LIG A;  4XE9 A;  1XOY A;  2X8K A;  5AC9 3;  5L36 A;  1GIC A;  1W6P A;  4JVA A;  5FYM A;  3NNF A;  3AJY A;  3H8U A;  3VUO A;  4J1W A;  1RHI 3;  3NO8 A;  4XFB A;  5FUP A;  4XTP A;  3LD8 A;  1X50 A;  1Y9Q A;  3U11 A;  1HXS 2;  4E4S A;  5IVV A;  2GZW A;  2JG8 C;  4QKB A;  1MZ6 A;  1AR9 3;  4L11 A;  5LBF A;  2OYZ A;  2RM2 3;  1HQW A;  2Y6F A;  3ZDV A;  2X53 S;  1D4M 1;  2PAK A;  3DEM A;  4AVC A;  1I5P A;  3THP A;  3FE5 A;  3AXE A;  5F3I A;  4RGG A;  2UU8 A;  1I5Z A;  2ZEZ A;  3GBG A;  4XFF A;  4NMI A;  3VLB B;  1F35 A;  3VHR A;  1IG0 A;  2ET1 A;  3LOI A;  2RS3 2;  1W8N A;  4UOJ A;  5C3R A;  4ZS3 A;  3EBR A;  3PUH A;  4S2F A;  1UZZ A;  4CXW A;  1WLT A;  2C9K A;  3QCW A;  3ZFE C;  4H7M A;  1W2T A;  1SEF A;  4QD2 A;  3VHP A;  1JHJ A;  3KV9 A;  2BTV C;  1O91 A;  3WCR A;  4CXY A;  2W52 A;  1GZW A;  2XQX A;  3NJX A;  4WVZ A;  4QGL A;  5EYX A;  3VV1 A;  2D5F A;  1VR3 A;  2R49 A;  3B69 A;  1DYO A;  3K4D A;  1OHF A;  3CQO A;  5FZ0 A;  4DEQ A;  1PZ9 A;  2FMY A;  4K20 A;  1K5M A;  2KD7 A;  5FYI A;  5C5T A;  5LA0 A;  4PDW B;  3ZYB A;  1CES A;  1LJ7 A;  4FTE A;  4ARY A;  1NCR C;  4BCU A;  4CCJ A;  1XE7 A;  2QQV A;  4FO9 A;  2E6V A;  1LEN A;  3R0R A;  3VL9 A;  1BYH A;  4JTN A;  1WBF A;  2ZZJ A;  3PHM A;  2WR9 A;  4AGV A;  4LA2 A;  1AR7 1;  4A41 A;  3POW A;  2XBO 1;  2RS5 1;  1L3J A;  3P3N A;  4YW1 A;  4DQA A;  5IVY A;  4HMZ A;  2ATF A;  2VUD A;  4DIQ A;  1CAV B;  1AL0 G;  2YFZ A;  3VKM A;  4R8H A;  4K6B A;  2FHR A;  1DQ4 A;  5FZ1 A;  3SH3 A;  5FKB A;  4Q4V 2;  2OUH A;  3VBF B;  2VZV A;  2VMH A;  4MHU A;  3HQU A;  1MPX A;  3MIF A;  3E6B A;  2YFU A;  5IVF A;  2YU2 A;  3TNP B;  3SNM A;  1JW6 A;  5KHH A;  5SV5 A;  5C8W A;  3AMH A;  4QDQ A;  3B9I A;  4A6O A;  1W8Z A;  2W1W A;  4YPJ A;  3DN7 A;  1ALY A;  1ONA A;  3SHR A;  1QJY 2;  1YFW A;  1TG7 A;  4LMF A;  3SMH A;  3O1M A;  1L7Q A;  4B7E A;  3VBR A;  1J59 A;  1QOO A;  4Y5T A;  5GLV A;  3TN9 1;  3AKT A;  1ULG A;  2WZP P;  4EE2 A;  4COY A;  1HRI 3;  4CZS A;  3LPG A;  3VBH A;  2RR1 2;  5DXD A;  5FO7 B;  3EYP A;  4BLJ A;  4XJ9 A;  3N9N A;  2P6C A;  3S6P A;  1OH3 A;  3C7E A;  1UOG A;  3ES4 A;  2VZU A;  2YBK A;  4CA9 A;  1ND3 B;  2WNU B;  5CKM A;  2W47 A;  3KWV A;  1PMI A;  4S2G A;  3ZN5 A;  5FDB A;  1DFQ A;  4I3P A;  3V0B A;  1LGB A;  1JHN A;  4IEX A;  4PQQ A;  1GP6 A;  5T55 A;  2Y6K A;  2VZ1 A;  3VBU A;  1RUF 1;  4HSJ A;  2W87 A;  2ZHK A;  4E2Q A;  5IK4 A;  1JZ6 A;  2GH8 A;  4JDN A;  5F3G A;  1XYP A;  3DYP A;  1G9C A;  3I59 B;  3WSO A;  3P6B A;  5ISL A;  4QX2 A;  5KC5 A;  1VBE 1;  1PHM A;  5FPZ A;  1MZ5 A;  4Q0Q A;  3MW2 A;  4AF9 A;  3BOW A;  5FPA A;  1R1A 3;  2WLQ A;  2XVK A;  3APB A;  3M3I A;  1OOP A;  5JAX A;  2E63 A;  5GZD A;  1RUG 2;  4DRR A;  3QAC A;  4FAG A;  4URA A;  4YVS A;  3O1O A;  1ZRC A;  2Z5W A;  1COV 2;  2WO2 A;  4IQP A;  5CFD C;  3LA2 A;  3ZYH A;  3S0M A;  1XNT A;  5T54 A;  2LM3 A;  1HRV 3;  1R08 1;  3DCQ A;  2JG9 C;  1U12 A;  4IEV A;  1RUI 3;  2QNK A;  4RFR B;  3BU0 A;  3CMG A;  4DXR A;  1SDD B;  5AVP A;  3RDI A;  1PIV 3;  3THD A;  3VBO A;  3AKR A;  5DDJ 3;  1ZBE 3;  2QE3 A;  2Q1F A;  4P00 B;  3NRU A;  4JAA A;  3RVH A;  3ZM8 A;  2NLR A;  5LB6 A;  1LES A;  1UN1 A;  2VNV A;  5LK5 A;  1LU2 A;  2G9F A;  3MLJ A;  2B9V A;  4MV2 A;  3O14 A;  5KHJ A;  1MS5 A;  4N53 A;  1JZ8 A;  4J1X A;  5FCC A;  2YHJ A;  3PVB B;  4UW3 A;  4HZF A;  1NCQ B;  1URX A;  1U5I A;  2GAL A;  2PLV 1;  3WOG A;  2L9L A;  5IK5 A;  4CDX A;  1UL9 A;  3CJI C;  2E32 A;  1ACC A;  3PDQ A;  3MW4 A;  5I8Y A;  3BTA A;  1WME A;  4YNI A;  3HNM A;  3ASI A;  3O1V A;  1JU3 A;  4YVW B;  5CZK A;  3I2K A;  5K8S A;  2ZMN A;  2VMD A;  4QPW A;  1YYN A;  1BXH A;  1JUH A;  4CEW A;  3OUH A;  1DP0 A;  1IG3 A;  2LTN A;  1UNB A;  2BNM A;  3BTX A;  3SXW A;  5T50 A;  3FC0 A;  2KR2 A;  2W5F A;  1VE0 A;  2YB7 A;  1JH5 A;  1AX2 A;  4DUX A;  2D43 A;  4AWD A;  3RYP A;  1PMJ X;  1KRI A;  1ZRI A;  3ZMN A;  1EAH 2;  4A3Z A;  2EID A;  1QNW A;  4LLO A;  1UU6 A;  1VAK A;  3M7A A;  5JIA A;  4BIF A;  4Y33 A;  3RZK A;  1LAJ A;  3N9L A;  5GKA C;  1W0O A;  1QJF A;  4RYD A;  3H3Z A;  4SLI A;  3UL2 A;  1VBC 1;  1BZW A;  2ZA9 A;  1JXN A;  1N1S A;  1PO2 2;  3GBF A;  1GAN A;  2VOV A;  4EV0 A;  5A1L A;  1A3K A;  1VBD 1;  4B3N A;  5JSO A;  4ZHN A;  1RUJ 3;  2ZXQ A;  2B8M A;  3MGU A;  2BP6 A;  5IVB A;  3TYJ A;  1ENS A;  2CGO A;  1C57 A;  4AQS A;  3NQH A;  5JOW A;  5AC9 1;  3BCW A;  2DTY A;  1KXG A;  1W0N A;  2WO3 A;  3FHQ A;  1FXZ A;  1NG0 A;  4IET A;  1SPP A;  4AE2 A;  3RZL A;  2W68 A;  3KCX A;  5DUX A;  3ZIX A;  3SQO A;  1A6C A;  3IM0 A;  1P8J A;  3O12 A;  5FAX A;  4P08 A;  1N1T A;  4AGG A;  4HSL A;  4HPK A;  5C9A A;  4CDU B;  5FBJ A;  4FCA A;  2IUW A;  1DBN A;  2WWU A;  2P3J A;  3AZY A;  5FTT C;  1JOJ A;  4OMC A;  4HL0 A;  5GLW A;  5F3E A;  1UZV A;  4CU7 A;  3ES1 A;  4HON A;  4MVT A;  1V6L A;  4M3C A;  4DXZ A;  4QHB A;  5C3S A;  2V5D A;  5A70 A;  5ACA 3;  3V0A A;  2P2K A;  2OA2 A;  5G05 L;  1PNG A;  3LEG A;  3N7L A;  4ISQ A;  3Q8E A;  3MUY 1;  4COU A;  3NWK A;  5I8S A;  1GV9 A;  3JB4 C;  2E9Q A;  4AL9 A;  4IDZ A;  3U10 A;  2PHW A;  4CP9 A;  3WP6 A;  3M3C A;  5FMO L;  1S0E A;  5LW9 A;  4XAB A;  3O5S A;  2VUA A;  4GA9 A;  4Y1V A;  4CCO A;  4YM0 A;  1O3S A;  3CLP A;  3I2J A;  4Q1R A;  4JGY B;  3O1U A;  1PVC 1;  4NN0 A;  1CIY A;  4I30 A;  4NID A;  3LFI A;  4XUP A;  1TME 1;  3M3Q A;  2IWG B;  2RJK A;  3ZDS A;  2FZ1 A;  2ZZQ A;  3FWE A;  4X6Q B;  3M3O A;  2WT1 A;  1VAL A;  2YDE A;  3ILR A;  4AVS A;  4FSJ A;  3J9S A;  3N9M A;  2W1Q A;  4E27 A;  4LBM A;  3I2O A;  2XQR A;  4NRP A;  4FPE A;  3B7M A;  4IND A;  1XSQ A;  1J84 A;  4H2A A;  3D5O A;  4IV3 A;  4V2V A;  4UF0 B;  1AZD A;  1DGW X;  3JBG 3;  2EXI A;  2F6B A;  4LHL A;  4N43 B;  2RJ2 A;  2I74 A;  1JOD A;  3K46 A;  1LHO A;  1LUL A;  4K3U A;  2LUW A;  3LEI A;  4HK9 A;  4MXW B;  4NJ4 A;  1K42 A;  4LPL A;  4EZ4 A;  1IOA A;  5FMO S;  4BQ5 A;  3AYC A;  2IXJ A;  4N7U A;  1REE A;  5CU1 A;  3WDY A;  1SLT A;  1VAV A;  3AKQ A;  4JQT A;  1T2X A;  3AYD A;  4UW6 A;  1O4T A;  2WSV A;  2Q8D A;  2XL9 A;  2EF6 A;  4CCE A;  1AL2 1;  4WM7 C;  3D6E A;  2JJ6 A;  4LBQ B;  3IPV B;  2ZX0 A;  3H0O A;  4CDW B;  1PO1 3;  1Z7S 3;  2OQ7 A;  3MBW A;  1XE0 A;  2Q8E A;  3HN1 A;  5C8C C;  4RR3 B;  3GZU C;  3RS6 A;  1QH6 A;  2ZMK A;  3HQX A;  3N36 A;  3OD4 A;  4AGR A;  2LRO A;  4CYD A;  2BW8 A;  5A3M A;  5BNP A;  1BBT 2;  1OPM A;  3PNA A;  3UV9 A;  3R4S A;  3ZFG B;  4I3G A;  2W0X A;  4OQ8 A;  5C4W B;  5LK7 B;  4NWV A;  3NAP B;  4IER A;  2QJV A;  1OFN A;  1DYK A;  1UKG A;  4P9Y A;  2VE1 A;  1RIR A;  1STM A;  4P9X A;  3FFZ A;  4YGE A;  1AR8 3;  4QKD A;  4COW A;  5AFB A;  1VJ2 A;  1WMF A;  1YXW A;  1E5R A;  1OBN A;  3U4S A;  4L92 A;  1JYV A;  1AJO A;  5DG2 A;  5CFD A;  1EUU A;  3BGA A;  1QXP A;  2JDH A;  3VZJ A;  5LA2 A;  3BPS A;  3NW4 A;  2QQW A;  4YG0 A;  1FOD 1;  1PK6 B;  4KI5 M;  3W9A A;  5LY1 A;  3VZN A;  5CB7 A;  4FPK A;  4CXX A;  4JKK A;  2HWF 3;  3OUJ A;  3PUS A;  1NCR B;  4LOT A;  3QD6 A;  3RYR A;  4PI2 A;  3WLU A;  4GMP 1;  1KS5 A;  4HG6 B;  2MNG A;  4FPY A;  4AG4 A;  3NNL A;  5C7G A;  2HBU A;  2OX0 A;  5KXC A;  1HN1 A;  1ODN A;  2G4I A;  2Q4S A;  4TLF A;  1OLM A;  1RUD 3;  2PHF A;  2VZO A;  4E8C A;  3ZVX A;  3N7J A;  3GF6 A;  4Q4Y 1;  2ZGS A;  3DXT A;  4NPL A;  2DBI A;  2A6Z A;  1BMV 1;  4ES8 A;  1FPN 3;  1SLC A;  1UXX X;  3AL6 A;  3OGR A;  4LO5 B;  4LUM A;  5FMC A;  1C8M 1;  2Y34 A;  3WV6 A;  2PQQ A;  1W8F A;  2VQT A;  3FMG A;  4FXG B;  1WUV A;  2XLG A;  4DUW A;  3S5Q A;  2IXI A;  1RUI 1;  2WN2 A;  4LR4 A;  5JLV A;  2ES3 A;  3DGT A;  3BKZ A;  1QWR A;  2XH6 A;  1AYM 1;  3T1M A;  4KNC A;  4E4H A;  1XJA A;  1RVF 1;  1LR5 A;  1AR6 3;  1ZBE 1;  1D0G A;  4FPJ A;  4GWM A;  5FK7 A;  4XDP A;  3BOD A;  1IKP A;  3WW2 A;  3E6C C;  1V9U 3;  4L8Q A;  5EPA A;  1US2 A;  5BNN A;  1UD1 A;  5JPM B;  2P3Y A;  4XBQ A;  2C4X A;  3WNL A;  4J6G A;  1M4W A;  4PLN A;  3RWK X;  1H9W A;  1OUS A;  4XET A;  1ND2 C;  5I93 A;  2VMC A;  5JMO A;  1HXS 1;  3MEP A;  4YZ3 A;  3WDT A;  4YW3 A;  4GB3 2;  4PDW C;  3TAY A;  5LRR A;  1NLS A;  3ZR5 A;  3H7Y A;  3O0V A;  3OGV A;  3T2P A;  3V64 A;  4QQL A;  3BYW A;  2XL7 A;  1DQ2 A;  2YC0 A;  2XHK A;  4NR1 A;  2QQP A;  2WZ8 A;  1WW6 A;  5GAL A;  4EQV A;  4WV8 A;  3ZYR A;  4OFG A;  1UIJ A;  1NA1 A;  4LIU A;  2WS9 3;  1AF9 A;  1GZC A;  2RS3 1;  3B94 A;  4IEP A;  4Q1P A;  1H4G A;  3T2O A;  4COZ A;  2VNR A;  4PIZ A;  2XHN A;  4CCM A;  3LDB A;  2DCK A;  2E7A A;  2FMD A;  3VN4 A;  4OHX A;  1CZV A;  3DEC A;  3EO6 A;  1JYI A;  3J8F 3;  4I02 A;  3V56 A;  2VW2 A;  4MGZ E;  5K7P A;  2XPJ A;  1WD4 A;  2KA3 A;  2O8Q A;  2Z69 A;  1UMI A;  2Y6H A;  3DUI A;  4AED B;  1O5U A;  5J37 A;  2W95 A;  1OD5 A;  3M4F A;  1W99 A;  3A0N A;  4BH9 A;  4EWE A;  1KDK A;  2QUO A;  4LUK A;  4ZKT B;  2C1F A;  3J7N A;  3RZH A;  4MH0 E;  1BEV 2;  2XWJ B;  1V0A A;  1X33 A;  3K75 B;  3EMR A;  4GAZ A;  2LS6 A;  2QQO A;  4XZP A;  2VCB A;  2EXJ A;  1VBC 2;  2DCY A;  3QH6 A;  3UGH A;  3ILN A;  1AVB A;  4N9H A;  1I3H A;  4A45 A;  1RIT A;  5ABJ B;  3GJB A;  1DZQ A;  4B1L A;  4RS5 A;  2HWC 3;  1RUE 3;  1MS9 A;  3N7M A;  2ADD A;  4AFM A;  2ZGP A;  1ND3 C;  2WNU C;  3CJI B;  5FRE A;  1RUC 3;  4B1M A;  3U0Z A;  5FO9 B;  3D82 A;  1OUX A;  3JQX A;  4HVR A;  5AC9 2;  2DCZ A;  4K1Y A;  1C5I A;  1CX1 A;  4GUL A;  4WVM B;  4UBG A;  2FCT A;  4W50 A;  1Q8Q A;  1UZW A;  3MFC A;  4Q4V 1;  1RHI 2;  2QFE A;  5T52 A;  4A3X A;  5A3T A;  2RS1 3;  4HN1 A;  4LBK A;  1U5X A;  1QF3 A;  4P02 B;  5FZI A;  1N1Y A;  5F5Q A;  5ANQ A;  2C24 A;  5D8A C;  2PTM A;  1QJX 3;  1IPS A;  1VB4 A;  4IEU A;  1MS3 A;  4O61 A;  4OMD A;  1AR9 2;  2E31 A;  4XFI A;  2RM2 2;  4FP2 A;  4CE8 A;  1QJY 1;  2GNM A;  4MGS A;  3NNM A;  2R6Q A;  2R16 A;  4A2U A;  3MV1 1;  3ACL A;  5EXO A;  1MVQ A;  2CV6 A;  3N35 A;  3B9C A;  3KCY A;  3OGJ A;  2PA7 A;  4LO4 B;  3NKT A;  1E57 A;  4IEZ A;  3C7O A;  4GXL A;  4IV1 B;  3QOP A;  4KWL A;  1DGR N;  2X10 A;  5JOX A;  5A3W A;  1Q8P A;  2PAM A;  2JDK A;  3ME2 A;  5FPV A;  1FMD 3;  3W21 A;  4XJZ A;  5C8C A;  3GM8 A;  5JI7 A;  1H0B A;  1YJK A;  5KHI A;  5FQ0 A;  1DG6 A;  4YWA A;  5JSR A;  2VEC A;  3WNN A;  4IEW A;  3I3B A;  1WZX A;  3C7G A;  2F4L A;  4WZC A;  4RHV 3;  3VDA A;  3WG2 A;  4TWT A;  1GNZ A;  3VDB A;  3ECQ A;  1XNB A;  2XXZ A;  1LOE A;  1NYW A;  1NCQ C;  3M70 A;  4XPV A;  5FIX A;  1PGL 2;  3DPR A;  3W5M A;  5J09 A;  2J1T A;  2QQK A;  3O1T A;  4E4D X;  1XND A;  3TEZ A;  3OY8 B;  1OFS A;  4Y24 A;  2DWR A;  1QEX A;  4RQP A;  1UYZ A;  2A1X A;  2D3P A;  1WGP A;  1DZR A;  2GP5 A;  4ONU A;  5FYB A;  4BK4 A;  2R06 3;  4YVW C;  1RUG 1;  2I2S A;  3AXD A;  5DZF A;  4XJU A;  1RB8 G;  4Q27 A;  2B7Y A;  2W91 A;  3ZFF C;  4B4P A;  1COV 1;  1PO1 1;  1C1F A;  1Z7S 1;  4CDQ A;  5A7S A;  3OG2 A;  5FP7 A;  2BWC A;  2Y0I A;  1GNY A;  1SLB A;  3I8T A;  1F15 A;  2A7A A;  1KD7 A;  5CKN A;  1VMH A;  4LIV A;  2R1B A;  2GN7 A;  4FPO B;  2AEZ A;  2ZHM A;  4AAP A;  2WNV A;  1UYY A;  1CR7 A;  2JE9 A;  2FCV A;  5LA9 A;  3UK9 A;  4BPZ A;  4CU8 A;  1VP6 A;  3MDP A;  5DN2 A;  5JMC A;  2B39 A;  3KZ4 C;  2OVU A;  4QX0 A;  5CYY A;  1OF4 A;  3CEW A;  3ORJ A;  2UWA A;  4E8D A;  1WW4 A;  1C3H A;  1DYP A;  1YWK A;  4FPF A;  2IXK A;  1JU4 A;  1JUI A;  5I0S A;  3DXU A;  4Y22 B;  4WBB A;  1O59 A;  3V65 A;  4IEO A;  2ZPX A;  4NHM A;  1KFX L;  1IQD C;  4FFG A;  3IDE A;  3DV8 A;  4OHY A;  4G9S B;  4M4R A;  1SZB A;  1F31 A;  1DQ0 A;  5FOB B;  1QJU 3;  1WMD A;  1CJP A;  1HRI 2;  1QOS A;  1S2K A;  3AK0 A;  5JR7 B;  1HKD A;  2HH9 A;  2QCS B;  4XBL A;  4XQW A;  4OUL A;  4Q2F A;  1DIW A;  3LF7 A;  1XRU A;  4GKY A;  4HVO A;  2XG3 A;  4KL1 A;  4ZY9 A;  2YC4 A;  1CD3 G;  3L2H A;  1V00 A;  2VUJ A;  4X8N A;  1UW8 A;  4XC9 A;  5IW0 A;  4CDU C;  1ULD A;  4ZXE A;  3B00 A;  3CU7 A;  4QKF A;  4YGC A;  4D94 A;  3H7J A;  5A3L A;  2G9Z A;  1GMM A;  2IVJ A;  2VCM A;  1EV1 3;  2W1U A;  4JQR A;  2E7Q A;  4P9G A;  4XTM A;  1LOG A;  2WBK A;  2XB6 C;  1A34 A;  1SCS A;  1PX4 A;  4CU9 A;  4D6Q A;  2Y6J A;  4WM7 B;  3RYK A;  1OD3 A;  2R0F A;  3T4H B;  4ASM B;  4YAR A;  4I0A A;  3GAL A;  2GNT A;  4KBB A;  1V6I A;  2YBS A;  3ABZ A;  5FMB A;  1ASJ 3;  1O7F A;  4JGZ C;  1IQA A;  2CDP A;  2GNB A;  3VZO A;  2CWS A;  1PO2 1;  1R1A 2;  5FZE A;  5FZL A;  3AZX A;  3VD9 A;  3VDD B;  1WCK A;  5F5A A;  4ISR A;  3ZSE A;  1BJQ A;  2VG9 A;  4YLZ A;  1FI2 A;  4AEM A;  1OLR A;  5F5C A;  4XEZ A;  1CAV A;  1O6U A;  5FYS A;  1JMU B;  3FN9 A;  1R09 3;  3G6J B;  1OI6 A;  3W5N A;  1W2A X;  1V9U 1;  1HRV 2;  3NMB A;  3VBF A;  5A80 A;  2WFF 3;  1RUI 2;  2OS2 A;  2D98 A;  4MGI E;  3UJQ A;  5A1A A;  3I2G A;  1AXZ A;  3AM2 A;  2J7M A;  3MF9 A;  5DDJ 2;  3ZXJ A;  1CPN A;  1L7L A;  1ZBE 2;  2NQY A;  4IGP A;  5DQ0 A;  1I9R A;  3MLK A;  1W03 A;  4HKL A;  4XIK A;  4IE7 A;  2XJV A;  3LQC A;  4MOA A;  1ULP A;  2ZGU A;  4LE3 A;  5FZ9 A;  4Q0U A;  3IN9 A;  3WEZ A;  5FY9 A;  4N43 C;  1UMH A;  4Z2A A;  3MI8 A;  1GFF 2;  5EWS A;  2MEV 3;  5DZG A;  2HBT A;  2VCA A;  4M0H A;  2VBD A;  2AUY A;  2BJS A;  2GU9 A;  5HXV A;  3WUC A;  4ZU7 A;  1WA4 A;  4QPI C;  1SFP A;  4XUQ A;  4BZ4 A;  1RMU 3;  1ZBA 3;  2ARX A;  2ILM A;  1W90 A;  2JEM A;  3TB0 A;  3VZM A;  2OXB A;  4ZZ5 A;  2J1V A;  2PHU A;  3VB9 A;  5HCB A;  2WS9 1;  2B42 B;  2JD4 A;  2NPI A;  1YC6 1;  5FP3 A;  2EIB A;  1ND3 A;  2WNU A;  1OSG A;  3LSE A;  1PM4 A;  2WII B;  5FUN A;  4CDW C;  2WNE A;  4IL7 A;  3K2O A;  4RR3 C;  5I0T A;  1IS5 A;  1GBG A;  4GWI A;  1JBC A;  1DU3 D;  4JCK A;  3ATG A;  3EXU A;  1AHS A;  2Y8K A;  4JZR A;  1FX5 A;  5EFU A;  2WA3 A;  3SIS A;  4BJ0 A;  1OKQ A;  2HJI A;  1FNY A;  3I59 A;  4P9J A;  1ZM1 A;  3ZFG C;  1A78 A;  5C4W C;  4LXL A;  3NAP C;  3VZK A;  1RUH 3;  3NV2 A;  2XLF A;  3IZO A;  4WM8 C;  5K0U C;  1SBF A;  1GOF A;  1VMJ A;  4LHK A;  4NAO A;  5F2W A;  5CFC B;  4UXA A;  3ALQ A;  1K12 A;  5FZO B;  1POQ A;  1NXD 1;  1Y9M A;  4AFB A;  4AVA A;  1DZT A;  2ZX3 A;  5C33 A;  2VQA A;  1CAX A;  2P1B A;  2QQM A;  1RUE 1;  1QQP 3;  1RUJ 2;  1JYX A;  1ND2 B;  2GDF A;  2EVX A;  2A71 A;  5EP9 A;  4ASK A;  1B09 A;  3BTY A;  3VKF C;  4D3W A;  2IC1 A;  1PK6 C;  2O8O A;  2NYY A;  2X5I B;  4R9D A;  3WP5 A;  2CY6 A;  1T6G C;  3LAG A;  2WQ4 A;  4AI9 A;  2PFW A;  1ULC A;  3PL0 A;  2RS1 1;  2NN8 A;  5L7O A;  2I45 A;  3WD5 A;  2PHD A;  3K48 A;  4UFI A;  3ZYP A;  2TUN A;  2Q5T A;  3RQ0 A;  5SV8 A;  1NCQ A;  3ZSJ A;  5CAZ A;  1BBT 1;  2BDR A;  2WQZ C;  3AMM A;  4Q0P A;  2EIC A;  2PHX A;  4NPR A;  1FAY A;  1D4V B;  1N3P A;  1RC6 A;  4Q4X 3;  5LBB A;  4AFC A;  5JXI A;  1CWP A;  4YZ1 A;  1UXZ A;  3AVR A;  4DOU A;  5ACA 2;  1EPW A;  3OOX A;  2ZAH A;  4GWJ A;  4N9I A;  5FYY A;  1XNC A;  4CEY B;  3GHM A;  1SG3 A;  1HJG A;  1K5J A;  3KB5 A;  4M0N A;  2Q0A A;  3PVE A;  4FQZ A;  4CUB A;  2WAB A;  1UX7 A;  4NHY A;  3UGG A;  4I2O A;  3K4Z A;  1WWY A;  2O14 A;  4H3W A;  1Y3T A;  1S0B A;  1H8V A;  4R4X A;  5CAD A;  3T3Y A;  3MO4 A;  1QJZ A;  3ETQ A;  4QGN A;  3SKJ E;  3E6D A;  1W8H A;  4D0Q A;  4RGA A;  3EB7 A;  4N7I A;  3J7L A;  4QM8 A;  1MS1 A;  2FCU A;  4CSW A;  2C9A A;  3WDX A;  1F2N A;  3HWJ A;  1OXC A;  1JZ3 A;  2D6K A;  3VKL A;  3AZW A;  1HV1 A;  1CZT A;  5FZ6 A;  4BXS V;  5I0R A;  5E89 A;  1KJL A;  1W8U A;  3CBN A;  4JRA A;  1LHW A;  2WWS A;  2VPV A;  2ET7 A;  5CBL A;  1KJR A;  1VBA 3;  1ZNP A;  2CNA A;  3JBG 2;  4XAC A;  1CN1 A;  2HWB 3;  3P3P A;  5GLZ A;  1UAI A;  4CPB A;  2A73 B;  2VY0 A;  1LGN A;  3IIA A;  3A22 A;  3JXS A;  1LOC A;  2JDZ A;  1GZ9 A;  1GZT A;  3AC0 A;  3HMY A;  5D8A B;  1N3O A;  4DXT A;  4KWJ A;  5CA6 A;  1VPH A;  3LZZ A;  4MLO A;  5C71 A;  3WG3 A;  5A3N A;  3OPT A;  2DBN A;  1VRH 3;  3VD7 A;  4CDU A;  4JRL A;  2WT0 A;  2W08 A;  3J4U H;  2AH2 A;  1M06 G;  1PO1 2;  1Z7S 2;  4MG2 A;  4XW3 A;  4GJY A;  1VMF A;  4AEJ A;  3IAP A;  4IE5 A;  1QOT A;  3ACG A;  5D2A A;  2BOJ A;  1W05 A;  1W6M A;  2VL4 A;  4FOQ A;  4AED C;  5J3U A;  2VXJ A;  3TBD A;  3FBY A;  3WF3 A;  4LIT A;  1K45 A;  1DGW A;  3SCG A;  2JDM A;  4MGY E;  5JWP A;  1UF2 C;  5F3C A;  3WF0 A;  4I0W B;  4L0P A;  4RFT 0;  1KFU L;  1ENX A;  1QJU 1;  4GB3 1;  4X8P A;  1AR8 2;  1GZW B;  3GCX A;  5ABJ C;  4PCR A;  1ZZB A;  3KCC A;  2XWB B;  1NQJ A;  2D3S A;  1Q3E A;  4JGY A;  4P9L A;  1UU5 A;  4XUN A;  5JOZ A;  2KXL A;  4W65 A;  1S0J A;  3VD4 A;  1Y7B A;  1ZYB A;  2OW4 A;  3E97 A;  3URF A;  4DS0 A;  2Y60 A;  5JVV A;  2BNO A;  2D6L X;  3KMH A;  5FPX A;  5F37 A;  1H6X A;  3ZKU A;  3ETP A;  3ZYG A;  4ZU5 A;  1L7R A;  1UX6 A;  2HWF 2;  3ACI A;  1WBL A;  3BPZ A;  2GND A;  4MHR A;  2CAU A;  3ZFF B;  2TBV A;  4UF0 A;  5E8A A;  3H8O A;  1QNY A;  4MSV A;  3RJR A;  4XXP A;  4N43 A;  2HYX A;  2YV8 A;  5A7O A;  1GQP A;  3FLP A;  3LA7 A;  3RWN A;  5KHG A;  5IVE A;  4JX0 A;  4MXW A;  2Q30 A;  2Y0O A;  4AHX A;  3T30 A;  5LWB A;  1RUD 2;  2FDJ A;  3RMY A;  3QH7 A;  3O0X A;  3FUQ A;  4PBP A;  1O8P A;  2JG8 A;  1Q8S A;  5FZ8 A;  4BQY A;  3LWC A;  1BEV 1;  1FPN 2;  1YJL A;  2G9G A;  4IV1 C;  4KWU A;  5DAV A;  3HBK A;  2C0Z A;  1RYY A;  4FTS A;  1LCL A;  2FDG A;  1J1L A;  4XFA A;  2JIG A;  4LBQ A;  5BYN A;  2PEL A;  1LOB A;  3IPV A;  3WG1 A;  4CDW A;  1YFU A;  5I91 A;  1VIW B;  2NZ9 A;  5EHD A;  1WCQ A;  3HT2 A;  4YG3 A;  3D3A A;  5HV0 A;  2BNN A;  2HWD 3;  5L9R A;  3ITQ A;  3E1F 1;  3VBR B;  1AR6 2;  3W20 A;  1H30 A;  2BRT A;  5K4L A;  1W9Y A;  5FPB A;  4BIS A;  4UFJ A;  5FXW A;  3ZFG A;  1S2E A;  1V9U 2;  5C4W A;  3NAP A;  4XCB A;  3ZFE A;  2BBV A;  1RHI 1;  5FYT A;  1X9P A;  2YGL A;  2JIC A;  3VKN A;  4F3J A;  3MIG A;  1RL3 A;  4DPN A;  3O1P A;  4QT6 A;  2OT7 A;  3AMQ A;  3JQW A;  3ST7 A;  1V70 A;  4YW4 A;  5L73 A;  3RSJ A;  1AR9 1;  2XON A;  1W9W A;  1OQE A;  2RM2 1;  3LB9 A;  3OJB A;  3H1M A;  4AQ6 A;  4EWA A;  3MZH A;  5H9S A;  5A3U A;  3OD0 A;  4QX5 A;  5JXJ A;  3H3U A;  4FVV A;  2H6C A;  1PK6 A;  3OGG A;  5GZG A;  2V4V A;  3BN6 A;  4JGZ B;  1AXK A;  3LOB A;  3U1X A;  2HKX A;  1NCR A;  4C0B A;  4CTE A;  3DYO A;  2WS9 2;  2LRP A;  2A6W A;  3FBM A;  2QQU A;  4ZZ8 A;  3D0S A;  5FXX A;  3WY6 A;  2HEW F;  3WNX A;  1W28 A;  1PGS A;  5LRS A;  4OI4 A;  1AYN 3;  3LCP A;  3J8F 2;  4YRD A;  2TNF A;  3AYA A;  4LKE A;  2VXR A;  3BIE A;  2XUE A;  2CGN A;  3WW3 A;  3WCS A;  2HYK A;  2Z42 A;  1POV 0;  2HWE 3;  5D21 A;  1OT5 A;  2Y6G A;  5EZW A;  2Q1M A;  3DF0 A;  1MR5 A;  1PGL 1;  1HW5 A;  1CZS A;  2GMM A;  1D2S A;  1H9P A;  2XR4 A;  1QDC A;  2QQJ A;  5A33 A;  3OSD A;  3FL7 A;  3IB3 A;  1APN A;  3III A;  3ILF A;  3R05 A;  2IZW A;  4YW2 A;  3GBW A;  2HWC 2;  1RUE 2;  4QQ2 A;  3VD3 A;  3K3O A;  2JXA A;  1LGC A;  4LO6 B;  3CJX A;  1EP0 A;  4QHZ A;  1SHW B;  1RUC 2;  4QPI B;  5JI9 A;  1NE4 A;  3ROU A;  3I2H A;  4PBO A;  4N90 A;  4SBV A;  2QBX A;  2XLA A;  5C3Q A;  3AX4 A;  5JDB A;  2NM1 A;  4IE6 A;  1KEX A;  3AYE A;  3LFM A;  3W59 A;  1C8N A;  4Q4W 3;  1QXR A;  2OZ6 A;  1TEI A;  4A6S A;  1O4Z A;  1RUO A;  4B7K A;  2Z2S B;  2RS1 2;  4I01 A;  4ASL A;  4OI0 A;  1YI9 A;  2D6P A;  2VTX J;  5A32 B;  4QPG C;  3JD7 3;  2VNG A;  3MIE A;  2VOW A;  4BWO A;  5FK8 A;  4DY5 A;  2D7F A;  1YQ8 A;  1QJX 2;  4BE3 A;  1DF0 A;  3WQ1 A;  2R07 3;  4JHZ A;  1US3 A;  4PLO A;  3VDD C;  3PME A;  3K4A A;  3GHN A;  1MQT B;  4FPH A;  5FYU A;  5B4X A;  3LEK A;  2ZGM A;  2BGP A;  3MYX A;  4K21 A;  4RD7 A;  5DZE A;  5BY5 A;  5K0U B;  4WM8 B;  4DXS A;  4YZ5 A;  1WLC A;  4Z92 B;  1HRI 1;  1BVV A;  1LKN A;  3LPF A;  5D1I A;  5A7W A;  4ATE A;  1QU0 A;  4E2G A;  4XFH A;  2N7G A;  4UW4 A;  3MFA A;  4XXA A;  3I97 A;  1FMD 2;  4BOW A;  4Y5S A;  4OQ9 A;  2ARA A;  3POY A;  2MPF A;  1NLQ A;  1HJF A;  3WHT A;  2R0H A;  2QDN A;  4AED A;  2JG9 A;  3CO2 A;  4KBZ A;  4Y1X A;  1LED A;  1TZO A;  4Y3O A;  1N3Q A;  5G04 L;  5IFP A;  3VKO A;  4LT5 A;  5FZH A;  5AVA A;  4C91 A;  4RHV 2;  2W2I A;  3INA A;  4YW5 A;  2ZGO A;  5AFE A;  4FPC A;  4QWN A;  2XOM A;  5FFO C;  3LDR A;  1FV3 A;  2VQU A;  5FZA A;  2CSG A;  3AJZ A;  2FD8 A;  1QHD A;  2UYB A;  1S2B A;  5LY2 A;  2Y6L A;  4YZ4 A;  3PJY A;  3UKT A;  4D6S A;  5C9A B;  4BQ4 A;  1I6X A;  3MIB A;  5F8P A;  3USU B;  1WLW A;  4DIN B;  2YUE A;  1W9T A;  1H1M A;  1R1A 1;  2A70 A;  3F95 A;  3PUA A;  4ZS2 A;  2R06 2;  2Z79 A;  2ZAB A;  3CJI A;  3ENR A;  4PIY A;  4A7K A;  1W9S A;  2WA4 A;  5E88 A;  4M3C B;  3ZSM A;  4WVM A;  2VVE A;  2YG0 A;  4XHX A;  5BXX A;  3EJK A;  3WP3 A;  5JIU A;  1X7N A;  1HRV 1;  4NPM A;  1ZRF A;  1AX1 A;  2A6V A;  4GZ9 A;  4CP9 B;  2H6B A;  1VBB 3;  2CAV A;  2RDQ A;  2JDP A;  2IXL A;  5FZM A;  1DDL A;  1PIV 1;  3RPQ A;  5DDJ 1;  1DQ1 A;  1EPZ A;  2CDO A;  4Y4R A;  4YM2 A;  4XF0 A;  2W1S A;  1F5F A;  3WDW A;  1GR3 A;  3C7H A;  4K8R B;  5CFC C;  3IKW A;  1PM7 A;  2VW1 A;  5IT6 A;  1K3I A;  1FV2 A;  3LA3 A;  3WP4 A;  2WDB A;  4UFM A;  4BQX A;  1O3R A;  3HBZ A;  3LEM A;  4PIX A;  2V72 A;  3VBS B;  2RMU 3;  3AP9 A;  4I09 A;  2RE9 A;  5C3P A;  1HIX A;  1OMI A;  4AAX A;  4AZZ A;  3EQE A;  1BCX A;  2A3X A;  3Q8F A;  4IV3 B;  5I8T A;  1QJU 2;  2OKX A;  3WF2 A;  1UMZ A;  1W0P A;  4IEY A;  2X5I C;  4XIO A;  4BHP A;  2JEN A;  3LSD A;  3PUQ A;  2BEO A;  4YM1 A;  1MEC 3;  2VC9 A;  1KS4 A;  2QZ3 A;  3HPN A;  3T1L A;  3T0B A;  5BNO C;  1WA6 X;  1POV 3;  3AKS A;  4FT8 A;  5FZK A;  1SLL A;  2WZR 3;  3AP5 A;  1O3T A;  3H9A A;  1EV1 2;  3GNE A;  3PIJ A;  3POB A;  3THC A;  5HXM A;  4YFW A;  5IVJ A;  2D97 A;  2CYF A;  3OY8 A;  3OPW A;  5TSW A;  4M3C F;  2JDN A;  1J58 A;  4NHK A;  3VL8 A;  3FJS A;  1YQ6 A;  4UT5 A;  2GC0 A;  2WFP A;  4AK3 A;  4ZON A;  5F5I A;  4A4A A;  4C1X A;  1UY4 A;  2FQP A;  1ASJ 2;  1U5Y A;  3OBA A;  5CG9 A;  1DQ5 A;  4CEY C;  4LE4 A;  4IEQ A;  2CL2 A;  4QGM A;  3VD5 A;  4ZXK A;  3OGS A;  5T5O A;  5BNP B;  2DV9 A;  2BWA A;  2WIN B;  1Q56 A;  4V1P A;  1LOF C;  2VOT A;  1RUJ 1;  5JUV A;  4LQR A;  1HB1 A;  3S57 A;  4XOG A;  2YPJ A;  3J26 N;  2VOK A;  4HBN A;  4X6R B;  5JOY A;  5FYV A;  2AAC A;  4MGQ A;  2VGD A;  1UY2 A;  4QM9 A;  1D4M 3;  2J1S A;  1R09 2;  1WMX A;  2LW8 A;  2RV9 A;  3B3Q E;  3KT4 A;  3N9O A;  5DAQ A;  4L9B A;  2WN3 A;  5J98 B;  5IHR A;  4R52 A;  3KD4 A;  4KU7 A;  2WFF 2;  5KBF A;  4QMA A;  5FXZ A;  2ORZ A;  2ORX A;  1SLI A;  2YU1 A;  1PVX A;  2GSY A;  5DPN A;  4AHY A;  4S2D A;  5IVC A;  5APA A;  1LOA A;  4CVU A;  1W04 A;  2BGC A;  4Y22 A;  1MZF A;  2C26 A;  1IPK A;  3B02 A;  3KLS A;  5FKC A;  1DLC A;  2ZGR A;  1FAT A;  1PGW 2;  4KGG A;  2ZGL A;  2BZD A;  1YNA A;  2YC2 A;  4AEK A;  2ZX1 A;  2MEV 2;  2BU9 A;  2ZX2 A;  4FXK B;  4YZ2 A;  3HOB A;  4LLF A;  5FY4 A;  5JPN B;  1GU3 A;  4FAH A;  5ACA 1;  2ENR A;  1A8M A;  3VGI A;  5A6X A;  1RMU 2;  1ZBA 2;  4XUR A;  1WCS A;  3M2M A;  4HKW A;  4CP1 A;  1JI6 A;  2B5H A;  1C28 A;  2ZKN A;  1ZZ7 A;  1CJD A;  2E7T A;  3IWZ A;  3ZN6 B;  5GZE A;  3FZ3 A;  5FWE A;  2W94 A;  5L9B A;  2A3W A;  3D0J A;  1JZ5 A;  1OUR A;  4PF5 A;  5DMY A;  5LBE A;  3CHX A;  5LZ6 A;  5F39 A;  3NST A;  1JZ7 A;  3KHC A;  2HEV F;  4WM7 A;  5A7P A;  3X29 B;  2YPD A;  1S0D A;  4O9E A;  5FP8 A;  1T6B X;  1FYU A;  1TQ5 A;  3N7K A;  1UY3 A;  5HPO A;  1ULO A;  1HB3 A;  4NWW A;  4PT6 A;  4EN8 B;  1W6O A;  2DTW A;  2R1D A;  3HT1 A;  3ZXL A;  3OF1 A;  4LBL A;  2VOX A;  4EWD A;  1AR7 3;  1JN2 P;  2DUR A;  2RS5 3;  2XBO 3;  3T0A A;  4IES A;  1W6Q B;  4GD4 A;  2WQ8 A;  4MYE A;  4H55 A;  1NE6 A;  3HVD A;  5EIY B;  1RTV A;  2XGX A;  1XB9 A;  3HN3 A;  3JBG 1;  1R1Z A;  5BNN B;  3DYM A;  2PQS A;  3ZXG A;  3POJ A;  4J25 A;  5IK8 A;  2AGS A;  5H9R A;  1Q5O A;  1QQP 2;  1C5H A;  1DGL A;  2JKX A;  2D3R A;  2ZJC A;  3NJV A;  4TN7 A;  4EN0 A;  5FZ3 A;  2K2S A;  2UY8 A;  2BV4 A;  1K5M C;  1V6J A;  3O1R A;  1W2U A;  2TEP A;  2O0O A;  3E5Q A;  2J1U A;  1X36 A;  4FQ4 A;  4LHN A;  3UYJ A;  3N4M A;  4XUO A;  1LU1 A;  1WCU A;  3I2I A;  3TN9 3;  4BB3 A;  4PLM A;  1TNF A;  3AP4 A;  1S0C A;  1LOD A;  1ZX5 A;  4KH9 A;  4NVP A;  3N3H A;  3MIC A;  4Z82 A;  4OHZ A;  2I07 B;  1RED A;  2YGM A;  3POI A;  1NA1 B;  4Q8L A;  4QXH A;  2R07 1;  1YLL A;  2R04 3;  5GLU A;  1JS9 A;  3HJR A;  3KF3 A;  1CAW B;  5J36 A;  1X9T A;  4NHX A;  2ZHL A;  4Q4X 2;  2WL1 A;  1YIP A;  3ZPY A;  4QU2 A;  4YFZ A;  4O65 A;  3SC7 X;  5HCH A;  3PJQ A;  4JKM A;  2JDU A;  3I4I A;  1RUF 3;  3A21 A;  1AR8 1;  3I2D A;  1EYB A;  2P4E A;  4AI1 A;  3WQ0 A;  1D2Q A;  1BHG A;  1YIF A;  1G9F A;  1VBE 3;  3VBR C;  3WQB A;  1TNR A;  3I3Q A;  4JDM A;  5BV6 A;  1G86 A;  3MIH A;  4I0B A;  1RUN A;  1ZA7 A;  4D6R A;  5HBA A;  4KG8 A;  3PVO A;  1S4C A;  4QX8 A;  3A7Q A;  1J3R A;  3L2Y A;  2IFR A;  4LKD A;  1G9B A;  4CP0 A;  3VBH C;  2Q8O A;  4UI9 L;  4EN6 B;  1JYC A;  3OUI A;  3R4D B;  3PUR A;  4NAM A;  2HWF 1;  4RS5 B;  5CIS A;  3UT0 A;  4FOV A;  3ELN A;  3AZV A;  3WQ7 A;  2AZ5 A;  3RNS A;  1G6N A;  1KDM A;  1R08 3;  1X8M A;  1YRZ A;  2ZGN A;  5DG1 A;  5FZO A;  3TNQ A;  4DFS A;  4W8J A;  2JIJ A;  4E4Z A;  1O8S A;  4NHL A;  4PJY A;  1VLN A;  3ZLI A;  2ZKL A;  1H2N A;  1UO9 A;  1VBA 2;  2H0B A;  1ND2 A;  3VBU C;  1RUD 1;  4XIL A;  2HWB 2;  2VUC A;  2OII A;  3R4U A;  4GH4 B;  1QJE A;  3RJ2 X;  3OYW B;  1FPN 1;  4C90 A;  4PDW A;  4QPG B;  4FBF A;  4AW7 A;  1WLD A;  3K3N A;  4XBN A;  4Y1Y A;  2NMO A;  5CEH A;  2PLV 3;  2ADE A;  2PYT A;  4ORF A;  2GME A;  4LOR A;  1H2M A;  3SKV A;  2WJS A;  4LEJ A;  3ZXE A;  1VRH 2;  4YVS C;  5L9V A;  4K1Z A;  1AR6 1;  1REF A;  1GP5 A;  1H2K A;  1W2N A;  2E26 A;  1O3Q A;  3SIT A;  2VZR A;  1E5I A;  3H1W A;  3Q8C A;  2EXK A;  3ZXK A;  4QX7 A;  2VR4 A;  1ZVF A;  4UWD A;  4AI3 A;  4QXK A;  4UAP A;  3C3V A;  1S0G A;  1MAC A;  4U2A A;  4A7Y A;  1XNK A;  3WVJ A;  1J3P A;  1PIV 2;  3CDZ B;  3PU3 A;  3Q8A A;  1DHK B;  4ZPI A;  5IAT A;  3I3M A;  3WT3 A;  4HXC A;  2W3J A;  5DUV A;  3MF6 A;  3DKW A;  4OUM A;  2IVI B;  4XYX A;  5FJK A;  2DCJ A;  2V4A A;  2E53 A;  4XMI A;  4N53 C;  2EAK A;  1AJK A;  3RG0 A;  5F32 A;  2B46 X;  4NII A;  3C7F A;  3Q9O A;  2BPA 2;  3KS7 A;  4KWK A;  5CNA A;  4GMP 0;  5LEK A;  4M01 A;  3DL3 A;  5F2S A;  4XF3 A;  4XHB A;  3USS A;  5FWJ A;  3FFQ A;  1YQ2 A;  3T09 A;  4GQ7 A;  4CU6 A;  4JV4 A;  2ZGK A;  4XF1 A;  4Z1V A;  3WUD A;  1PZ8 A;  1POV 1;  5C6C A;  4E9K A;  3SLI A;  1VBD 3;  1NKG A;  2B9U A;  2R7E B;  5I0D A;  2BFU L;  2JKB A;  4L99 A;  1AUY A;  1O4Y A;  1UYX A;  5LA1 A;  4ARX A;  1U5Z A;  2XVG A;  4ITC A;  3T08 A;  4Q8K A;  3HNY M;  4CEW C;  4AHW A;  1GP4 A;  3RZG A;  1OLQ A;  3J8F 1;  3AMP A;  4CDQ B;  2PMW B;  3NV4 A;  1WCD J;  1ZZ8 A;  3F2Z A;  4MET A;  1KGY A;  1WKY A;  4QAW A;  1Z78 A;  4QU1 A;  5I0U A;  3O1S A;  2GAU A;  3Q8B A;  2WNV B;  4P9W A;  1MQT C;  5KHK A;  1W3X A;  5D8A A;  4AHZ A;  1CAU B;  4AI2 A;  3ZR6 A;  1GYK A;  1RXF A;  2F17 A;  4Z8B A;  3AMN A;  3WDV A;  5CIR A;  2GMP A;  1NOV A;  2WSU A;  1KQR A;  3OB8 A;  4TLG A;  2FDF A;  1ZRE A;  1H8T B;  4LO7 A;  4HKO A;  5HV4 A;  4AFD A;  5JZG B;  3MUZ 1;  3TEW A;  2JDY A;  5A3O A;  2HWC 1;  3HD8 B;  3OBT A;  2CHH A;  4Y20 B;  4AR2 A;  1RIN A;  3WIN E;  2HWD 2;  2BFU S;  1RUC 1;  2VMF A;  2WLP A;  5HCF A;  1HLC A;  5DUU A;  5T5L A;  2IXH A;  1V6N A;  2RJL A;  3ZN4 A;  2GC3 A;  3ZYF A;  4AVB A;  5A3P A;  1BKZ A;  2B45 X;  3OTF A;  3VHN A;  1JYT A;  5FZB A;  2ARC A;  4MX3 A;  5GZF A;  5E6H A;  4HAN A;  3ZOI A;  4CUC A;  1PVC 3;  1CX4 A;  4AI8 A;  1W06 A;  2BVB A;  4KMQ A;  3TEX A;  1HN0 A;  5BUV A;  1WW5 A;  2YY1 A;  4IGO A;  4NRQ A;  1NY7 2;  1UOF A;  1XNA A;  1TME 3;  2H0V A;  2OQ6 A;  2WO1 A;  3E5U A;  5C9A C;  1NT0 A;  3HR9 A;  2J22 A;  3ZXD A;  1QJX 1;  5BNO B;  2X29 A;  3O0W A;  2X09 A;  4QKN A;  2WYF A;  3IMM A;  2DUQ A;  2ARB A;  3UKV A;  4OCT A;  3VZL A;  1HV0 A;  2DF7 A;  1MS4 A;  3KQR A;  4L2N A;  1RGS A;  2XUM A;  4YVW A;  4YG6 A;  3M3E A;  4QXB A;  4W6W A;  5EQU A;  3RZJ A;  1OVP A;  5DAB A;  4XF9 A;  3ZFF A;  2PHL A;  4Q29 A;  1OA3 A;  1YFX A;  1B35 B;  1UY1 A;  2D40 A;  3JUU A;  3THT A;  1FMD 1;  3JU9 A;  4OHW A;  5A7Q A;  4V2W A;  4UBH A;  2Y64 A;  2VCC A;  5J96 B;  3LKJ A;  1LEC A;  2UWC A;  3MPP G;  1SFN A;  3WF4 A;  3LGR A;  3WNP A;  1AYN 2;  3A23 A;  3ZXF A;  1AL2 3;  4RSU A;  1PX3 A;  1W6N B;  2K0G A;  3S30 A;  1NLR A;  5A6Y A;  5IYY A;  5L19 A;  2WO7 A;  4RHV 1;  1NZC A;  2HWE 2;  1CGP A;  1GNH A;  1YO8 A;  3PMS A;  4W6X A;  4MZU A;  3VBS C;  4TTG A;  2BBA A;  2E33 A;  3B01 A;  3ZYJ B;  1F5J A;  1FT9 A;  4XCA A;  1D7P M;  2DU0 A;  3WR0 A;  5KXE A;  1OA2 A;  2VU9 A;  3FHI B;  5IK7 A;  1Y4W A;  2D6O X;  3PU8 A;  4IV3 C;  4RL7 A;  1GLH A;  3OEA A;  2OPK A;  1XYN A;  1W6P B;  2D44 A;  2ZBJ A;  4R9B A;  2R06 1;  2DYC A;  1ZA4 A;  2XJS A;  3MID A;  3GZT B;  4AVV A;  4OYU A;  3WHU A;  1QDO A;  1VRB A;  3T4V A;  4A7Z A;  4BXF A;  2QKD A;  2Q8C A;  2JE8 A;  4GAL A;  4UW5 A;  4A44 A;  2P6H A;  5KC6 A;  5B2G B;  1LHN A;  2BGO A;  1E5S A;  2WZE A;  5LEJ A;  4KQ7 A;  1DLL A;  3SH5 A;  4DB5 A;  2JEC A;  4Y1U A;  4DEV A;  4DO0 A;  2BOI A;  5LBC A;  5A1F A;  2R04 1;  5FPU A;  4YW7 A;  4Q4W 2;  1DCS A;  1TMF 3;  1Z0H A;  2PAE A;  1V6K A;  3KVB A;  3QBQ A;  5GLT A;  1YQ5 A;  1FOD 3;  2BYV E;  5IJR A;  4F8A A;  1SDW A;  3NV1 A;  3JD7 2;  5T3N A;  2WNO A;  2VH9 A;  2VVF A;  3M1H A;  2JWP A;  1UZ0 A;  3UGF A;  5BNP C;  2R07 2;  4GMP 3;  3HAG A;  3DKQ A;  4P14 A;  1H1A A;  2PHR A;  1QY4 A;  1NXM A;  2D93 A;  3FHA A;  3PIG A;  4LOS A;  4YGB A;  2HEY F;  3RZZ A;  2A6X A;  1H2L A;  4JGZ A;  5C70 A;  3FX3 A;  1XPW A;  4IE4 A;  1W8O A;  3IDC B;  3GDB A;  1Q8V A;  3CF6 E;  3L9J T;  4BQ1 A;  3GCW A;  2YZ4 A;  3GYD A;  3FUO A;  4Q4Y 3;  1DGR A;  5GM0 A;  3WNM A;  2EA7 A;  2WAO A;  3PVN A;  5EJ3 A;  2Y26 A;  1CAX B;  4JC1 A;  3I3D A;  1RJ7 A;  1IHM A;  1C8M 3;  3H50 A;  4UFK A;  2VD7 A;  2XJT A;  1SBE A;  5IWF A;  2J42 A;  1MS0 A;  2ETE A;  2RHP A;  4MUV A;  2A75 A;  5FLJ A;  5JCT A;  3T2Q A;  2WAA A;  3WW4 A;  2DFB A;  4OHV A;  4HT1 T;  1K5M B;  4R9C A;  1AYM 3;  5FJH A;  1EV1 1;  1RVF 3;  5H9Q A;  4E2S A;  3U07 A;  4RGK A;  1UCX A;  3T2T A;  5F6L B;  3A4U A;  2RDN A;  5L7O B;  1RJ8 A;  2RVA A;  3HEI A;  4DY3 A;  4LKF A;  1YFY A;  1YQC A;  1CVN A;  2ZGQ A;  2JB8 A;  4D8M A;  1ASJ 1;  1CQ9 A;  4FFF A;  4MXV A;  2DVF A;  3C8X A;  4QDR A;  1HXS 3;  2YBP A;  5A6Q A;  4QPI A;  5M0T A;  4A42 A;  4TSV A;  3PUI A;  1F4A A;  3AP7 A;  4G4F A;  1PZ7 A;  2YRO A;  4FPL A;  1XXN A;  4YYO A;  2QTW B;  4NOT A;  1NUK A;  2Y33 A;  3ZXA C;  1R09 1;  1H1I A;  2JDA A;  4EN9 B;  5FLI A;  2IXC A;  2VME A;  1VBB 2;  2WFF 1;  4OI1 A;  3LIH A;  2BER A;  5E1R A;  5A32 A;  1JTZ X;  5DAX A;  2UUR A;  3CIH A;  4RR3 A;  4OVE A;  2RG4 A;  4QQO A;  2VZ3 A;  2WT2 A;  1XSR A;  3POE A;  5FY1 A;  3U37 A;  4FFH A;  2ZCW A;  2RS3 3;  4CCK A;  1W3V A;  3D8C A;  2HLE A;  5IAX A;  2FDK A;  5FZG A;  1MQT A;  1V6O A;  5BNN C;  4GJZ A;  3VBH B;  4LBJ A;  5FZF A;  4BDV B;  1PGW 1;  4RA0 A;  3SH4 A;  3H8X A;  2MEV 1;  1YI7 A;  5K0U A;  4WM8 A;  5F9T A;  3J7M A;  1YEW A;  2RMU 2;  3JB8 A;  3RI9 A;  1LHV A;  3NJY A;  3ZO0 B;  1CON A;  4EZH A;  1QMJ A;  2WYS A;  1XBF A;  4WVV A;  3SEP A;  4EYU A;  5CKQ A;  4FI9 A;  1RMU 1;  1ZBA 1;  3V0B B;  1J1T A;  4OZO A;  5EJ1 B;  2O1Q A;  4LJH A;  1JYW A;  1XYO A;  2C5D A;  3VBU B;  3BI3 A;  1HX6 A;  4M00 A;  4QPY A;  5B4N A;  1JOB A;  2EXH A;  4LA3 A;  4IE0 A;  4NE9 A;  5FLH A;  5C5U A;  4WZF A;  1SLA A;  1MEC 2;  1W9F A;  5HCA A;  4IXL A;  2DUO A;  1SCR A;  2ZHN A;  4OUS A;  1X82 A;  3BU7 A;  3WNK A;  1GQH A;  4BYY A;  4YW6 A;  4C0H A;  1NA1 C;  1ZZ9 A;  2P34 A;  2R32 A;  2VVD A;  1QIQ A;  2WZR 2;  3CNA A;  3K51 A;  4PF1 A;  1IPJ A;  2XJR A;  3ZKY A;  3K77 A;  1OOP B;  2RDS A;  2X05 A;  1QGL A;  5IFT A;  2GH2 A;  4XDO A;  2G1M A;  3RZM A;  3O7O A;  4YVS B;  1D0H A;  1RUH 1;  3WZ1 A;  3USU A;  3KVA A;  4BMB A;  1CIW A;  1GOH A;  1UPI A;  3HNB M;  1BLZ A;  2P3I A;  4Q26 A;  1UU4 A;  2VZQ A;  3KV6 A;  2VZS A;  4XJ8 A;  2OZJ A;  4P9I A;  4BM8 A;  4JTO A;  1W6M B;  4Q4V 3;  3SCF A;  3SEE A;  1G9A A;  2A5Z A;  3VBO B;  4QDS A;  2YXS A;  3H8R A;  2FDI A;  3I3E A;  2ZTN A;  1OF3 A;  4AQT A;  1QQP 1;  4IW3 A;  3RGB A;  4QX3 A;  1HDK A;  1O5L A;  4JDO A;  5DAP A;  2WC2 A;  5ERL A;  1QJY 3;  2UYA A;  3I7D A;  2QQN A;  2R30 A;  1D4M 2;  3OCP A;  1ZRD A;  3D4K A;  2IFW A;  2XVL A;  4LK7 A;  1QKQ A;  4N53 B;  4RS5 C;  2JX9 A;  4M3C E;  2JB4 A;  4CDX B;  1LEM A;  4ZU4 A;  4YM3 A;  1XC6 A;  1PMH X;  2RR1 3;  3PTR B;  4CCN A;  4CUG A;  3S7E A;  3T0D A;  4HN0 A;  3MHZ A;  1GOG A;  4OI2 A;  5EYY A;  4PI0 A;  4MGK E;  3UJO A;  4XQD A;  3VBS A;  4BK5 A;  2P17 A;  2QQI A;  1Y9G A;  3ACF A;  2DUP A;  3UES A;  4D7T A;  4GH4 C;  5J48 A;  2FZ2 A;  4Q4X 1;  3NL1 A;  3WW1 A;  4CCC A;  1QXJ A;  1S1A A;  1UPS A;  4Z07 A;  3N9Q A;  4W4Z A;  4D69 A;  4CEW B;  4UFL A;  4BQ3 A;  4AOC A;  4N8M A;  1BVP 1;  1MS8 A;  5A6Z A;  4OUE A;  2KM2 A;  4CCL A;  3U4X A;  3WX5 A;  3BVC A;  4XMA A;  2XJP A;  1GWL A;  2ZOE B;  3GJA A;  1I1E A;  3CZU A;  1LNS A;  4LKS A;  1BK1 A;  2JG8 B;  2NMN A;  3J7H A;  1IS6 A;  3JCI A;  2VZT A;  3NNG A;  3AVS A;  2QVS B;  1IS4 A;  3WNO A;  2DVB A;  2DVG A;  3A0K A;  4YGD A;  1N1V A;  1RUG 3;  1UZY A;  2VZP A;  1SMV A;  1COV 3;  3KM5 A;  1A8D A;  4GWN A;  1ZZ6 A;  3TOJ A;  2GP3 A;  3N9P A;  3NKG A;  1AR7 2;  4CPB D;  1IS3 A;  2XBO 2;  1PNF A;  2RS5 2;  2VW0 A;  2YMZ A;  2VTX A;  4HFS A;  5H9P A;  3CL1 A;  4PQ9 A;  5FZ4 A;  2ZX4 A;  2VTF A;  4XFG A;  4Y5Z 0;  1VBA 1;  1OVS A;  1SPP B;  2VQ0 A;  2D6M A;  2HWB 1;  4P5Y A;  2P5B A;  3ZFE B;  2E51 A;  3H42 B;  1HQN A;  3DPR C;  3KGZ A;  4JHT A;  2D6N A;  3B5L B;  4HPK B;  2D5H A;  1V6M A;  4GIQ A;  2ARE A;  5ABJ A;  1RXG A;  3KSC A;  4RQP C;  1EY2 A;  4MO3 M;  2OPW A;  3HQR A;  3CKH A;  2BUK A;  1GKB A;  2ZAC A;  5IAV A;  3U14 A;  4YSF A;  4TXW A;  2VJX A;  2GC1 A;  5F7U A;  1U0A A;  3OEB A;  4XQ4 A;  1VRH 1;  5FP9 A;  1JYN A;  3TN9 2;  1TMF 1;  2EAL A;  1XU1 A;  1KIT A;  1YUD A;  2WKK A;  1YCI A;  4OLL A;  3R6S A;  2AEN A;  4CDQ C;  4BQ2 A;  2Q1Z B;  4HOO A;  4QQP A;  3V0A B;  1GUI A;  4TYS A;  5EJZ B;  3M8L A;  4L97 A;  1F4H A;  3BIW E;  1SAC A;  1VB2 A;  4O7X A;  3NNJ A;  2W9X A;  2WNV C;  3OPZ A;  2R04 2;  2VO5 A;  4FOW A;  4XVH A;  3VDC A;  4F83 A;  1VAM A;  1CPM A;  5BPX A;  1W2O A;  4Y1Z A;  1WD3 A;  4EN7 B;  3WF1 A;  1NX9 A;  4KGQ A;  3ZN6 A;  1RUF 2;  1H8T C;  5FY7 A;  1EAH 3;  3UET A;  5JZG C;  3ON7 A;  5FYH A;  3KF5 A;  5JR2 A;  4IV1 A;  5FY5 A;  1VBE 2;  3MW3 A;  3POS A;  4K8F A;  3P1I A;  5A33 B;  3RMX A;  1PO2 3;  1UQX A;  4Z2W A;  2A3Y A;  5J7M A;  1OLM E;  2VBB A;  2Z4F A;  3IAQ A;  3MV0 1;  3LE0 A;  1IKQ A;  1OQD A;  2XJU A;  5A7N A;  1ULF A;  4CUA A;  5FO8 B;  1UIK A;  1UOB A;  1N47 A;  1S0F A;  1W6Q A;  3KV4 A;  3BAL A;  1NAE A;  5BNQ A;  4FPG A;  4H7L A;  4HLT A;  1UKR A;  3ZMO A;  1LHU A;  2VMI A;  3H3L A;  1R08 2;  4FFI A;  1SFY A;  1TVG A;  1GWK A;  3TWI A;  2W46 A;  2P3K A;  5LAT A;  4B4R A;  4FTB A;  5JXH A;  1UOJ A;  4LBQ D;  1G9D A;  1J83 A;  4BA6 A;  2LAL A;  4LBO A;  2W39 A;  5FZ7 A;  2EIG A;  3P5B A;  1AXY A;  2PHT A;  3KT7 A;  4QXC A;  5FZC A;  3U78 A;  1Q43 A;  2K9Z A;  3C2U A;  4QHO A;  3AP6 A;  2NP0 A;  1OA4 A;  2QQL A;  5FBZ A;  2PLV 2;  3RFR A;  1B35 C;  5FYZ A;  3WDU A;  4QB6 A;  5FYC A;  2CU5 A;  1AX0 A;  4NIH A;  2HWD 1;  1OQ1 A;  3RRD A;  4COV A;  3AZZ A;  4AYU A;  3BTZ A;  5FY8 A;  4QB1 A;  5FV3 A;  4NUB A;  4AVT A;  1W8W A;  4Q5O A;  2QDR A;  5A7W B;  1CAW A;  3VBF C;  4ATF A;  2ZEW A;  1HB2 A;  1JZ2 A;  4Q0S A;  3UKN A;  4W6Y A;  4O9G A;  4FOY A;  5CFD B;  1W39 A;  3ZPO A;  3KV5 A;  4Y26 A;  1NY7 1;  4LBN A;  4NIA A;  4CP2 A;  4F7Z A;  5HI0 A;  3IMN A;  2JG9 B;  2VUL A;  3AFG A;  4AQ2 A;  1W8T A;  2F4P A;  4LTA A;  2VAU A; 
#chains in the Genus database with same CATH homology
 3K46 A;  2J1E A;  3VD7 A;  3LEI A;  1OH4 A;  1K42 A;  3CDZ B;  4LPL A;  2W3J A;  2EIE A;  3IAP A;  1T2X A;  3ACG A;  2VL4 A;  2DCJ A;  3WF3 A;  5FUI A;  3C7F A;  1K45 A;  2ZEY A;  3MBW A;  3WF0 A;  1YQ2 A;  3T09 A;  4L0P A;  4CU6 A;  2ID4 A;  1NKG A;  2R7E B;  5I0D A;  5J1X A;  4XUN A;  1UYX A;  5LA1 A;  4ARX A;  3T08 A;  3VD4 A;  3HNY M;  3F2Z A;  4DUV A;  1KGY A;  1WKY A;  4QAW A;  4UAP A;  1H6X A;  1EUT A;  3ETP A;  1JYV A;  4M4P A;  1EUU A;  1L7R A;  3ACI A;  5LCW L;  3BGA A;  5LA2 A;  4IUG A;  1R64 A;  2HYX A;  2J1A A;  4KI5 M;  2WUH A;  3OB8 A;  1GQP A;  4JX0 A;  4JKK A;  3UNP A;  3MUZ 1;  3I2F A;  1O8P A;  4HG6 B;  4AG4 A;  5C7G A;  2VMF A;  4KWU A;  1HN1 A;  1H6Y A;  1RYY A;  4LHS A;  2VZO A;  4E8C A;  1WCQ A;  3D3A A;  4CUC A;  1UXX X;  3OGR A;  3E1F 1;  4KMQ A;  1JZ4 A;  4MAD A;  2VQT A;  1XNA A;  1UWW A;  2WO1 A;  2J22 A;  4DUW A;  2WN2 A;  2X09 A;  2ZEX A;  2W92 A;  3IDA A;  1US2 A;  2XON A;  1W9W A;  2C4X A;  3WNL A;  4RN5 A;  5JXJ A;  1UY1 A;  5JMO A;  2VMC A;  4QX1 A;  2Y64 A;  2VCC A;  3GGL A;  3WF4 A;  3WNP A;  3GXU A;  2V4V A;  3A23 A;  3BN6 A;  1PX3 A;  3DYO A;  5IYY A;  2DDU A;  3OGV A;  3T2P A;  4ZZ8 A;  2JD9 A;  4TTG A;  2BBA A;  2E33 A;  2WZ8 A;  1D7P M;  4XZU G;  2J1R A;  3OEA A;  4ET7 A;  3T2O A;  1OT5 A;  2Y6G A;  2XHN A;  2DCK A;  1CZV A;  3DEC A;  1CZS A;  2VM9 A;  4OYU A;  2QQJ A;  4A44 A;  2JE8 A;  3FL7 A;  2BGO A;  4XUT A;  1UMI A;  2Y6H A;  3IB3 A;  2W95 A;  3CZJ A;  2WZE A;  3III A;  1W99 A;  4DEV A;  3VD3 A;  1SHW B;  3K75 B;  5IJR A;  2LS6 A;  2QQO A;  4JKL A;  2VCB A;  3I2H A;  2QBX A;  4QB2 A;  4A45 A;  1UZ0 A;  1KEX A;  5JXG A;  3FHA A;  2B4K A;  1UY0 A;  5C70 A;  1XPW A;  1W8O A;  1CX1 A;  3GDB A;  3ACH A;  4JHZ A;  3WNM A;  4W50 A;  1US3 A;  2WAO A;  3K4A A;  5B4X A;  3I3D A;  4P02 B;  3LEK A;  2BGP A;  4DXS A;  4OMD A;  2E31 A;  3T2Q A;  2WAA A;  3LPF A;  3W5M A;  4MGS A;  3MV1 1;  3I97 A;  3C7O A;  2RVA A;  3HEI A;  2X10 A;  4D8M A;  5IFP A;  5G04 L;  3C8X A;  4QDR A;  1I5P A;  2XOM A;  2VQU A;  3GM8 A;  4A42 A;  3PUI A;  1F4A A;  2Y6L A;  2ZEZ A;  3WNN A;  3I3B A;  1NUK A;  3C7G A;  2JDA A;  1W8N A;  4UOJ A;  1W9T A;  3VDA A;  3VDB A;  3ECQ A;  3PUH A;  2VME A;  2BER A;  2C9K A;  1W9S A;  2J1T A;  2QQK A;  3CIH A;  1JHJ A;  2VZ3 A;  3U37 A;  2YG0 A;  1UYZ A;  2XQX A;  3NJX A;  2HLE A;  4GZ9 A;  4BK4 A;  4BDV B;  1DYO A;  3K4D A;  2W91 A;  3CQO A;  4DEQ A;  2CDO A;  2WYS A;  3OG2 A;  2W1S A;  3SEP A;  3C7H A;  2KD7 A;  4FI9 A;  5LA0 A;  1GNY A;  1K3I A;  4OZO A;  2WDB A;  5EJ1 B;  1JYW A;  4ARY A;  1UYY A;  2V72 A;  5B4N A;  4CU8 A;  5DN2 A;  4A41 A;  4QX0 A;  4AAX A;  5CYY A;  1OF4 A;  3WNK A;  4E8D A;  2YFZ A;  2OKX A;  3WF2 A;  1JU4 A;  4PF1 A;  1O59 A;  3K77 A;  2X05 A;  2VZV A;  5IFT A;  1MPX A;  2YFU A;  1IQD C;  2VC9 A;  3HPN A;  4M4R A;  3T0B A;  1GOH A;  4QDQ A;  3HNB M;  4A6O A;  2VZQ A;  2W1W A;  4YPJ A;  2VZS A;  1TG7 A;  3THC A;  5HXM A;  1L7Q A;  3SEE A;  4QDS A;  4ZY9 A;  3I3E A;  1OF3 A;  2YC4 A;  4QX3 A;  4ZXE A;  4A4A A;  3LPG A;  1UY4 A;  1GMM A;  3OBA A;  2QQN A;  2W1U A;  3EYP A;  2WBK A;  3VD5 A;  4CU9 A;  1PX4 A;  3OGS A;  2Y6J A;  3C7E A;  1OD3 A;  2VZU A;  2VOT A;  5JUV A;  4LQR A;  2W47 A;  3ABZ A;  1XC6 A;  1PMH X;  4MGQ A;  1UY2 A;  4PQQ A;  2LW8 A;  2J1S A;  2CDP A;  3T0D A;  2RV9 A;  2Y6K A;  1GOG A;  2VZ1 A;  5IHR A;  2WN3 A;  4BK5 A;  2QQI A;  2W87 A;  3ACF A;  1JZ6 A;  3VD9 A;  3UES A;  3DYP A;  3WSO A;  3P6B A;  2ORZ A;  2ORX A;  4QX2 A;  4W4Z A;  5DPN A;  3FN9 A;  3W5N A;  4CVU A;  4OUE A;  2C26 A;  1DLC A;  5A1A A;  2BZD A;  3I2G A;  2YC2 A;  2J7M A;  2WO2 A;  3CZU A;  3HOB A;  1LNS A;  4LKS A;  5DQ0 A;  1XNT A;  1GU3 A;  3J7H A;  3LQC A;  4MOA A;  1ULP A;  2VZT A;  3NNG A;  4XUR A;  3WNO A;  1JI6 A;  3CMG A;  3WEZ A;  4DXR A;  1UMH A;  4Z2A A;  1SDD B;  3THD A;  2VZP A;  2VCA A;  2W94 A;  4P00 B;  3NRU A;  1JZ5 A;  3ZM8 A;  4XUQ A;  5DMY A;  2B9V A;  4ZZ5 A;  1JZ7 A;  2J1V A;  1JZ8 A;  2VTF A;  1UY3 A;  2EIB A;  5HPO A;  1ULO A;  4PT6 A;  2L9L A;  4P5Y A;  2E32 A;  3T0A A;  2WQ8 A;  4GWI A;  3HNM A;  4BJ0 A;  2Y8K A;  5EIY B;  3HN3 A;  4MO3 M;  1JU3 A;  3CKH A;  3DYM A;  2PQS A;  3I2K A;  5CZK A;  4TXW A;  2VMD A;  4QPW A;  2VJX A;  5F7U A;  3OEB A;  1DP0 A;  1JYN A;  2JKX A;  3NJV A;  1GOF A;  1GUI A;  5EJZ B;  1K12 A;  1F4H A;  2W5F A;  2YB7 A;  4DUX A;  2J1U A;  2QQM A;  1PMJ X;  4XUO A;  2W9X A;  4A3Z A;  3I2I A;  2EID A;  2VO5 A;  1JYX A;  4XVH A;  3VDC A;  4RYD A;  3WF1 A;  1NX9 A;  3UET A;  2ZXQ A;  3HJR A;  5JR2 A;  3NQH A;  3P1I A;  1W0N A;  2WO3 A;  4JKM A;  3FHQ A;  3A21 A;  3IAQ A;  2Z4F A;  3MV0 1;  2EIC A;  1BHG A;  1P8J A;  3LE0 A;  4CUA A;  4P08 A;  5JXI A;  3WQB A;  1NAE A;  1UXZ A;  1TVG A;  4GWJ A;  3A7Q A;  2W46 A;  4OMC A;  4CU7 A;  4UI9 L;  1SG3 A;  5JXH A;  4CUB A;  1J83 A;  2V5D A;  2WAB A;  1UX7 A;  3K4Z A;  5G05 L;  3LEG A;  3MUY 1;  4W8J A;  1O8S A;  3MO4 A;  3SKJ E;  4D0Q A;  3EB7 A;  2QQL A;  3I2J A;  1JZ3 A;  4QB6 A;  1CZT A;  4BXS V;  1CIY A;  4XUP A;  4QB1 A;  2ZEW A;  1JZ2 A;  3SKV A;  2W1Q A;  3A22 A;  2E26 A;  3JXS A;  1J84 A;  2VZR A;  3AC0 A;  4DXT A;  2VR4 A;  5C71 A;  2RJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...