2VZUA

Complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSAFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNANAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 277
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzuA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzuA03
1XSKA 3IFOB 2VXSH 1EHLL 2MSPA 4S3JA 4LSSL 1VKXA 4AYSA 4Q9RL 2J8UB 3K8LA 4DGIH 4QXTB 3EYFA 1ZLSL 4WCYH 2D23A 2A83B 3PIQA 5FAAA 1LVEA 2FYYA 4R4ND 2EXWD 1W9PA 3BO8A 1YEIL 2UUDH 3OBAA 3K2UL 1ETZA 1FCGA 4Z7NF 3P77B 5J4MA 4F15B 5HDBE 2JTDA 3EDFA 5D70H 5A6KA 4M00A 2ZX6A 1W72B 1ISZA 4HH9B 4FTVA 2VSCA 4LLMA 4RZCB 3TONA 1OAYL 2DIJA 2ZICA 4F58H 1LNUB 2ICEA 1CZ8H 1U8PB 3NCEB 4KVNH 1G9EA 3IJHB 3MUAA 4BKLB 1QFWM 5IFJB 3VNZA 2E4TA 4MNKA 3WV0A 3HZVA 3TJHC 4BCEA 3P40A 2WINA 1ZLSH 4X6DF 3WFHA 3EYFB 3VWKC 3QFJA 1AGDA 5DUML 3GUTB 2UY7A 3D9AL 3TT3H 1AHWA 1HKIA 5E2WH 5I1LB 1T89A 1YEIH 2FYYB 3CUFA 5C7XL 3DHJA 4DN4L 3DSFH 3RGVC 4M6OL 3U7WL 3ZJ8A 1ETZB 4DZ8B 5EBLA 1JWSB 2DDXA 1Z0MA 5FOJA 2XACC 4M7ZC 4XNQA 4NQEB 2E7BA 3DLQR 3SGEI 4ZNEE 1LILA 4ZFGH 3HZYB 4TSBH 1T1WB 2FD6L 3WXWL 4AENB 2EC9U 3AVEA 4OTXH 3T0EA 4M7KH 4JHWH 5CCKH 1XGRA 2R2EA 1YEKH 5HI4C 1X9QA 3MRKA 2XGBA 3I2KA 4UFLA 3W11D 3QUXC 4JVUA 4FK9A 1AGCA 2ZCKL 5DWUL 4OI8A 4D8MA 1AQKL 2EKJA 4P46C 1U8IB 3VA6A 3F58L 4MNLA 2W60A 1F4XH 1A6ZA 3ORJA 4OLYH 5E8OB 5GGSY 3RUGF 2ESCA 4CGTA 4MLIA 5CHNB 4M8UA 3FT3B 3NCBB 2YUVA 4PJHE 1QSZA 2F5BL 1IL1B 3L6FA 5J1AB 2EBNA 5ABHA 2O5YL 2OS7A 3VFWB 4D9LH 1YEEH 3FZUC 4WSKA 3QA3A 5BOPA 2F53E 2KKQA 3T0EB 3KPQA 4MJ5B 3CHCA 3QQNA 3CX5K 2ZNXA 5I1JH 1IGCL 2C3WA 4XP6H 5ADPH 1NGQH 2GK1B 1C1EH 5I74C 3HE7D 5J9PB 4KV5E 2XVGA 3HB3D 3MJ9H 4NRZB 5INCB 3OEBA 4JFDE 1T03H 2VISA 4W6YB 1FNLA 2HKHL 1DEEB 3NOIA 3G6JA 3C8XA 5HHPB 5GRUH 1RD6A 5CHNA 3BYTA 2BVOB 4LP4A 5DRNB 4JM2F 1T0NA 3L6FB 5J1AA 2QQKA 3X14A 3O2DA 1YYLL 5J13B 3VRJA 5BXTA 4XAKE 4DTGL 1CDGA 1X7QA 3VG0L 2A9NL 3RY6C 2VURA 3B3IB 3WBAA 5BZWA 3PWPB 3KJ4C 2CD0A 4MA7L 3S88H 2OKXA 1KCSL 2IAMB 1NBVH 3EFDH 4AW7A 3GBLA 5EO9B 1XCWA 2QSCH 4XVUC 2FB4L 3OAZK 3WS6A 4JREC 3WSUA 4DW2H 5ISZB 2PC8A 1GU3A 4OLEA 2VIRA 3L5IA 2VISB 5CZXD 3QDAA 4PREA 3ZL4L 1UD5A 1JZ3A 2FBJH 4PV9A 5C0CE 3WH6A 1JGIA 2XYCA 3AQUA 4BFIB 1JNNH 1CS6A 1X7QB 4G8EA 1L0XA 1MCNA 5ABEA 5FYKD 2AJSL 1NKGA 2J79A 1NBVL 2DN7A 3O81A 4F15C 5CD3A 5KS9B 1JFHA 3G6DH 3SDXF 1A5FL 2X4SA 3G5YB 4UQ2A 4GAJL 5JORB 4KUCD 4DW2L 3MV7A 3I75A 1OT1A 3LDBC 5IXEA 3CDGA 4LGPB 1S7UA 4X7DC 3GMOA 4M43L 4PUDA 4UZUA 4H5SA 1C5BH 5HJ3B 1JMZA 2B5IB 1Y18B 2YD1A 2DSKA 2F53D 3IGAA 4WI5A 5HGHA 4OUEA 3IFNH 5FYKU 2E33A 1V7ML 1H2JA 1NC2D 4PJ8C 1WDRA 4ONFH 3QRGL 3UPRA 5IDIA 3GH4A 1CNVA 4Y2DA 5F72S 1DL7L 4W5UA 4QNPE 3BSZH 3HUJB 1NP2A 2V3EA 4U6XB 2D3NA 3KPRA 1NCCH 3KXFA 3DJ9A 4CVXA 5DJXA 2WIIA 5A2KH 5I30H 1IEBA 1KEGH 2JK5A 5AG9A 1L7IL 1I3VA 2BNRB 4AZ7A 1SHWB 3MV7B 3G08B 2BGPA 4JFZH 2ICEB 3WKNA 2ITCB 1NX9A 3RAJL 1FZOA 4Z7UF 3HJEA 2CKBL 1YPZF 4MX7B 3EYOB 3QULB 2FL5B 2VR9A 5HGHB 4E5XA 3CH8A 5JR1H 4XVTH 3QFJB 1A1NB 5DO2D 3WFCH 2FGWL 4O4YL 2A6IB 3O6FC 4G43B 4LGRB 3MNZB 3DX8A 5H35B 5BS0B 4JCMA 2HLAB 1NJ9B 3MV9A 4UV4H 2VZPA 2W1QA 3UXFA 1XGPB 1ZT1A 2ZUTA 2VDLL 4KI5C 3U0WH 5I30L 2X1XR 2DQCL 1BGXH 2NW2B 2A73B 3TTYA 4NQEA 5K9JL 4PT6A 1NGWA 4DKAA 3S3JA 2IALB 1EEQA 4KFZC 3D0VB 1PX3A 5IHUL 3UJTL 4X6DA 4XB8A 2CKBH 1ADQH 2W0FB 3IJYB 3G9AB 1EGJH 4NKDB 1KIUA 3RHWF 1R87A 5DRXA 2EICA 1QSFE 3AS1A 2D4FA 4OLUH 1DWGM 4X6FA 2YMXL 3FONB 4JPVH 1CZSA 4PGBA 3W4RA 5I1EL 1GCYA 2HLAA 2GSIA 3W0WE 4CBPA 1R5IB 1HHGB 1NC2B 4YHPB 5CSUA 3I6LD 5DR5L 3K77A 1A6WL 1RK1B 2Y06H 4GRMA 1EHNA 4JG1H 4FQJL 3QUYD 4XI5D 4HS3A 1YN6B 3E6HB 3QA3B 3LEXB 5I8KL 1ADQL 1FG2B 1RUKL 4J6RH 4Q74A 3OKYA 1ZVSB 2V6HA 2XHNA 3OLDA 3QG6A 2IAMC 4TN9A 3BAJA 3NFSH 1WZ1H 1CLYH 4UQ3A 4HU0A 5DD0H 1UHVA 2Z1KA 5BMFL 1OARH 3VRLF 2H9GA 1TCRA 1XF3B 4PGBB 1A7RH 4PN2A 2M26A 5DR5H 5JQHC 2G5BA 2PBOA 3V0VA 4Y4FD 2G4FA 2GDVA 1RK1A 4AMCA 3F5WA 3MUHL 1BOYA 3V6FB 2EIDA 4JG1L 5AD0B 1WVZA 1J12A 5C0NC 1U8JB 5ICZA 4M9PA 4OIIH 1S7TB 3WJLC 3AXHA 1TQBC 3PWNB 5CBEA 1EO7A 5FECB 4PUBH 4XPHL 1WZLA 4OUOA 2OTPA 1CGUA 3HZKB 2VXUL 4QXGH 2NT1A 4LRNH 2CKRA 3RM4A 1CLYL 3KYNB 4NKOB 4PUEA 4FQ2H 4CD6A 4H20H 4A6YL 3SIMA 3AS3A 2J22A 4P23B 3RWDA 2Y8VA 1NDMA 3DV4A 2AXFB 1RUAH 3SE4C 4Z2HA 43C9B 3C9NB 3VGAB 2GUOA 3GSQA 3V0VB 4PV9B 4BH8A 3CFKA 3PWUB 2EIZA 5JTWA 3BKCH 5DFTA 4B7IA 4Q6YA 2FJFA 2UYLB 3ZKQD 2W95A 2H6PB 4LRNL 1WZAA 3TM6A 4LCUB 5F7KC 3BZFB 4BK5A 2X4SB 4AG4L 2PYEE 3L7EB 4UDTB 5ANMA 4LYPA 3WIFB 1DBKL 5BW7C 4H20L 4KI5F 4A6YH 3K3QA 4U31A 4H5SB 3GNML 4M1CD 1PKQE 1UACH 5CILH 2DT1A 1EX0A 3LAFA 1IE5A 3C60D 1NCAH 4BH8B 5J8OA 3VH8B 3RWIB 5ID1A 3EBVA 1A2YA 5JDSA 2GJJA 2WUCH 4WO4B 2EIZB 3Q6FB 3QI9B 3RGVA 2YSSB 3HI5H 1FNSH 1MVUB 1PJ9A 1U8KB 4G5ZH 2B4CC 5DJXB 2WKLA 3RL1A 2JB5H 1F90H 3RDTB 1DDHA 4PGEB 1LO5A 2LU3A 4WU5A 1E4XI 4WFFE 4FQ1L 3BH9A 3U7AA 3UNPA 3VFPB 1I9JH 3MRPB 1W0WB 1FVDB 1QLEH 3C2SA 1NCAL 3PZIA 1DE4B 5HYJB 2DKSA 2XN9A 1KELL 3TZVB 3WF0A 3QUXA 3RWIA 5ID1B 4XCNA 5DJYB 2YL5A 3ALWA 4BQ9A 5IB4A 3RWEB 2XWDA 3MOQA 5I73C 3FQWB 1RUPH 4Y5XC 1QNPA 3QIBB 4GZIA 4AZ6A 4GT7A 1M6OA 1ZL1A 4RYDA 3CUGA 5DN2A 4BUGA 5DRZB 2QBWA 4D6HA 4MA1B 1RFDL 3IJYA 4FQPA 3AOFA 2G5RA 4X9HA 1W0WA 4WHDA 4NZTL 3OAYK 1FORH 1YY8A 3RY4A 5C2BH 1QVOB 2WBKA 5D96C 4KJPD 3O0RH 1KUMA 4FQXB 5I1AB 3V6BR 3GBMH 1HINH 2GSIB 1XAUA 2H8PA 3MR9B 4HJJL 2OJZL 3LIZH 3RVTC 3HOBA 3KYMA 1I8LA 1O6IA 3QDME 1SY6H 1B3VA 2GKIA 1A7QH 5L7XL 5FDYA 2WK2A 3K8MA 1EMTL 1OAQL 2EQDA 2A9MH 4D6EA 5D2NE 2V9QA 1IT0A 1W72H 3U9UA 1HX0A 4KHTL 3HZVB 3PXJA 3HU7A 2LAAA 1BD2D 1ISWA 1TZIA 5EC1B 2Q7YB 5BV7L 4FLOA 4BQ5A 1BPVA 3GMRA 3A6OA 5E5UB 3RZCD 1PD6A 2DIEA 2XVKA 4M61A 1C92A 2OYPA 4FQHA 2QQOA 4URTB 3WS6C 5IVXB 3ZDZF 1HN1A 2BDNH 3QEQE 4HJJH 5E5MA 1G0CA 2RQ8A 3WFEL 4RISH 3QWQB 3VGAC 4HK0B 4PJ5A 2MQ0A 5AUMB 1KIQB 1IAIM 1RUMH 5CGYC 4WTXA 4LVEA 5AD0A 4H25B 1PW3A 4AEHH 4C56E 5AAWA 1S7TA 3FL7A 3VDCA 1KPVB 4NDMB 4IRJB 4M6MH 1T1WA 4AENA 3CVIL 1Z5LA 3VXOA 3KWWA 2OYMA 3WLBB 4J4PC 1OTTC 3MRKB 4YK4C 4R4BB 3GMRB 5C2UB 1GC1C 5MP6H 2BCKA 5D7JD 3PDOA 1XHGA 1QUNA 1D9KD 4M03A 4L4VD 1FSKB 2DS4A 5E03A 3A3HA 1BD2B 4H1LA 2FJGB 4LBEB 2J8OA 3FFDB 1S9XB 2OSLB 4B5EA 1OF4A 3SQOL 3KYKL 3CIVA 1B6DA 3PXHA 2OLDA 5E4IA 3T2PA 1TJHL 4KROC 3P9MB 2CR6A 2A6KA 4ENEC 5I23A 3CVIH 1RURL 3HNSH 3UYPA 5K9OA 2DI8A 4FTVD 1I8MB 1SHMA 3EJYC 2WYSA 2B39A 5FA3B 1WBXA 5B39G 2X4QB 4LK4A 1H15B 1E0OB 3QPXL 4F7MB 4Y5VB 4ZQKA 4JM2D 4ZFOA 1OW0A 4PJCE 5IG7B 3RDTC 1BYBA 1FBIL 3NABL 3BW9A 3BLPX 3GXIA 3V6OA 3H7LA 2NR6D 1R85A 2R29L 1Y6MR 1PMHX 1DEEA 1D5ZB 4CJ1A 2ADGA 2ZCLH 2FX8L 4X6DE 3NFNB 2XRAH 3WD4A 4KTEH 3L2LA 4GW4B 1KB9J 2HVMA 3VGBA 2UY3A 2JALA 5D2LA 5GISH 4JHOA 4APQA 4PMRA 3P4MA 1N4XL 3GSUB 3OGCA 4U7SA 1RY7B 4MAUH 5DD3H 2GTWB 1LEIB 3SDYH 2DM7A 3BPCA 3VFUB 3RL1B 5DJCB 3BKJL 2XKSA 2NXZB 5F6HJ 1H1NA 1KIPA 4HS8L 3V4UH 1NOFA 1A9EA 4MQ7A 3VW3H 3IKKA 3GRWA 2WUHA 4NNYA 4AWEA 1CGTA 3GSRB 4N90E 4R8WH 5C0DA 2BJMH 2XRAL 4KTEL 3LEGA 4O2EB 2ITDA 4P3WA 1SY6A 1UCBL 3MROB 5D96B 4NM8H 1QSFB 4X0KB 4BFIA 1V3KA 1BM3H 4HBCH 4BQ2A 4QXUL 4MDIB 5SV4A 4DWSD 2PTTA 4JFWA 2AAAA 4HPOL 1ZGLM 3HZMB 3CPLA 4LNRA 4XPAL 2GTWA 1LEIA 2QHLA 3LOWA 3MRHB 3QUZB 5M95B 4K8RL 1JYXA 1ODUA 1A7OH 4Y89A 5J6GB 1P2CB 1S5HA 2BNQB 3BIBX 4OGXL 4F7PA 2WP3T 4DCQA 5F7HA 2H3NB 4OGZA 3W5NA 3RWGA 1FRGH 2JJTA 1MSPA 5DK0A 3TYGL 2GTZB 5GHWH 5I3DA 3MMEB 3D2UB 3D85B 5IW3A 1GSMA 3SE3C 4QX0A 1HZHH 4MNJA 4ONOA 5E2WL 1F11A 4FQCH 3GIZH 5LKNA 2ILLA 1B90A 4QRRD 3W37A 1HJSA 4HCRA 5F9AC 3X12A 1DQLH 1TQCB 5EORL 1AQHA 3BN3B 1BZ7A 4XPFH 4LSRH 3N1PC 1AD9B 3RQ3A 1MIEH 4GSDL 5DFVD 3RM9A 3BC9A 1GGCH 3N1MC 1BQHB 2ADIB 3B9KB 3MO1A 4J28A 3H9HA 5KSUA 1Q0YH 2CIIB 1T1YA 2J12B 4ZXBD 2VUOA 4O9HL 2LU7A 3RVVC 5DT1H 3HMXA 1KJ2B 3GHBL 1RK0A 9CGTA 4MXQD 4MXWL 4YGVA 1NLDH 4R26H 3WMCA 1Q9OA 1FG9C 1WCGA 3WCYA 1JPTL 1F11B 2BVPA 1JF5A 4MCYA 4L3AA 4WTZG 4QY8A 5HHOB 2C3XA 3IDYB 1OP5K 4XPFL 3SE4A 4AAXA 4DGVL 4ZS7H 4PJ5B 3KL5A 4W6XB 1EEYB 1UVQB 2HP4A 2BMKA 2A0LC 2KQNA 2YWYA 1P7KA 3QP3A 4P4RA 4WEBL 1SR0A 1SJEB 3M17A 4EN3C 1I1YA 4GLRI 3WY1A 1FNEB 5C71A 1KN2H 3WLBA 3MLTB 5H37G 5JHDA 2WAHA 2P8PB 5E8PA 5A3IC 4ZSOA 1IRAY 3RVVD 4W87A 4IEFB 5F44A 2UWEE 3PDOB 2KZ1B 3C5JB 4NKMB 4X6FB 4M1GH 1OH4A 1S46A 3PTQA 3C6LC 2VLKA 3DRTB 1KR1A 1HHGA 1NC2A 4YHPA 1ZLWK 2R8SH 4N8CH 5CGYD 5JQ6H 2DH2A 5IHRA 3HN3A 4A44A 3LS5H 5E8DL 4PMVA 3QRFM 1KWGA 2AK4A 3FMGH 1KB5H 2E3VA 5SWQA 5ICXA 4X7TB 1MAKA 3WH9A 4P4RB 1VFMA 4P9HC 5E56A 5CG0A 2A9NH 4YPGB 3CZEA 1FG2A 5E99L 5FYLH 3OKDB 4PJ9C 4PB0H 1XGYH 3QG6B 3DX6A 2E7MA 4QCIB 5AYUH 5C8JA 5SX5H 3VFGL 1NQ6A 4LQRA 2YBRA 2QSCL 4QWWD 1ZB5A 4NN7C 4G8IA 1LO4H 2NXZC 3C5JA 4NKMA 4NC1E 4OFYD 4H7VA 4HWBA 4FABL 5C70A 3SCTA 5A6MA 3QG7H 1Q6FA 4RMRA 5A1AA 4Y4HB 4NYLA 2NY4B 1BIIB 4UIMA 4U1SA 5F7YC 1C5DB 1OM3L 4UUJA 3RTQC 2AK4B 2F8VA 4L4TA 3IFLL 4TTDC 3NMEA 5D2LB 5FYLL 4N0CD 3IANA 3TNNA 4J23A 1MYRA 2QEJA 1IKFH 2IXVA 3LH2H 5T5NG 3UBXB 3BWUC 1B2WH 3VFUA 2RAMA 3ZE0E 4K94C 1URLA 5HPMB 3BD5A 4GAJH 2WIMA 1J0JA 1LO4L 4AT6B 3LEYH 4AZCB 1TJGH 2P5EB 1HYSD 1L7QA 2AQ1A 2ZUMA 5IT2L 4TRPH 3KDMA 2XPGA 5I8OH 5LWYL 5HVFB 4WUUD 1I4FB 2A6DA 3ILQD 3IDJB 2VSDA 5D4QA 4JQIL 3RVTD 5IMLA 3QHMA 4PJ8A 1I3GL 2N1KA 3K7UA 1FFQA 4ONFL 2GYSA 4NI3A 4D72A 5IQ9B 2RCSH 2V17H 2R1XA 4TVPE 2JJSA 4LSUH 3F12A 3QEQA 1NUGA 5J6GA 4P5TD 2R2CA 3PWPD 3LEYL 3QIWA 1H3XA 2CPCA 3RZCA 2WCGA 4ERSH 2P5EA 5BQ7A 4TTGA 3RVWD 3QDMB 1BG4A 5E0FA 3NA9H 1FE8L 1M1SA 2VITB 4P8WA 2XOMA 5T3XD 3D2UA 1P53A 3WFDH 3UROR 3VWKB 5IB3A 1EBPA 4L0PA 3S34L 1ZT4A 2BVUA 4AZ8A 1UEMA 1YC7A 2EKSA 3K75B 3N0PB 5EBMB 2FDMA 4H26A 3UJIL 5JW5B 1JPSH 4LPWA 2EPKX 3EZ8A 4NFBA 5ITFB 2Y6GA 3KJ6H 5C0RL 1ADQA 1H49A 1UWIA 2VX5A 3F12B 3QEQB 1VFAB 3QNYB 4M7ZB 3MO1B 1AQ0A 4HZLA 3TPKA 4ZNEA 4C83A 4ERSL 4OJFH 1OHQA 1INQA 3MRDA 2CK2A 5IHUH 4PCTA 1U8LB 1FHGA 4LAJH 4HKJA 1CFVH 1IQWL 2RGSA 4XNMB 1SDDB 2QADC 5L2KE 1XZ0B 4Q9BA 1CG9A 4FXGB 1MCDA 2AV7B 4POUB 1NWTA 1I7TA 4K3GA 1U0QA 3QUXB 4OCLC 3OAUH 1QTYT 1YEDB 1F45A 3RTQD 1QZ1A 2VB5A 3TNMA 4D6CA 3CGTA 4OZGB 5D70L 3UTSB 4F3FB 2MPAH 5SWZE 3FQWA 3NZ8A 2YC4A 5FUCC 1G84A 1A6UH 2B2XL 5DQ9B 2Y06L 1N0XH 3KNBB 1PEZA 2APFA 3E3QC 2X9WA 1KQYA 4JFHE 1IAOA 4RAVA 4Y16A 4J6RL 5K9KB 3SPVA 1MXGA 2EEXA 3AS0A 2YK1L 3NRUA 1H8NA 1OW0C 3LKSB 3CUIA 5F71A 1K8DA 4YFEA 4NM4L 1QSVA 2BNQE 4ELKB 1I1AD 4Z95H 3G6JE 3L1OL 3O4OB 2HFTA 2F19H 2DDQH 4UAOC 1WISA 2PO6D 4F9LC 2QSQA 5I17B 5FGBA 5SWQB 1ZGLP 1R3LA 4KTYA 5D93B 3MBXL 1VRXA 1XD1A 4DFHA 3MPCA 5DQJA 1ITXA 1RIHH 2BY1A 5EU4B 1I1FB 1OCWL 3C2AH 4OZ4B 5FO9B 5KVEL 4DXRA 2EYRA 5IUSA 3TA9A 5TFSL 4WDIB 2YD4A 1FH5H 4X99B 1HQRB 4RRPG 2D2OA 3HAEG 2HJKB 2J1RA 4Z2KA 1MJ7H 5F7UA 3TTQA 4Z7WF 4AD2A 4R96A 1R3IH 3FO9B 1J84A 2ZUSA 4HGWB 4FXKB 3AISA 4Z7VB 1C5DA 4GXUN 1D9KB 4W86A 3T0EC 1H3VA 1NGYA 1JF1B 1NMBL 3B2VL 2UY6A 4QLRA 2ORXA 2E27L 2Z93B 3VWJA 5I74B 5JXGA 4QX1A 3PL6B 1NGQL 3EHBD 1V02E 4B3LA 2O9PA 1EDQA 4W84A 2ZUYA 4D71A 4CRPA 4JY5H 4OZ4A 5FO9A 1PZ5A 1MQKL 5IW6A 3LDBB 2MJWA 1FQ9C 3MBED 3IETB 3TYFB 5HI5C 5JOEA 2XPGB 4H1LB 4OM0L 3OMZA 1UACL 3I6KA 2B1AH 3BDXA 5J13C 4HGWA 1LE9B 3GB7B 1H3TA 1RUQH 1KIRA 5D8JH 2VE6B 2X1OA 4IRSD 4U33A 5C0AD 4WRLA 5EBGA 4Z7VA 2P5WE 1ZTXL 3MJ9A 4D9RD 1OD9A 4M48H 4PJ8B 3KJ4B 3SE3A 4YHKL 1WTLA 4ZOAA 2WUCL 4QYOB 4FP8L 4HKXA 3BSGA 4UU9B 4GJTB 2K3TA 3GO1L 3S3SA 2EDWA 1M7IB 1KCKA 1NFDE 4Q6IA 4MS8D 5HHXL 4XVSL 2JB5L 2VLJE 2WO3A 4UZSA 5KW9H 1F4AA 4MNHB 1NAMH 1B9ZA 1Y0LB 1UWRA 1R86A 5E9DD 2NX5B 3CU7A 3OKMB 4MB1A 3VDBA 3GSOA 5DD6B 1FL6B 2WANA 4UOZA 3DIFB 2H32B 4CKQA 2ADGB 3K1DA 1FAIL 4DWSC 2RGLA 3AMLA 4FFVC 5TF0A 4IPNB 2OJEB 1FPTH 1EEZA 3NACH 2JIXA 2PF6A 3P4MB 3BRDA 1QNZL 5A2JH 2UY5A 4ZSOE 4WJ5A 4LMQE 4BZYA 4A45A 2D0GA 5JPMB 2N7AA 2VMCA 4UCFA 3MGOB 4D1IA 3L3IA 1ZSDA 1BD2E 4Y5XA 4K9EC 5EZIH 4BQBA 3CZFA 1WEJH 1UR1A 1KIPB 3WEOA 4NRSA 5DC0A 1VKXB 3AZSA 4WCYL 1RAMA 4QNPF 1HIZA 2W9EH 4D6GA 4D3CL 5TQ2L 4IMKC 2M8XA 4OZGF 4B50A 2OQJA 4Y4KD 3SUVA 3JTTA 2FZ3B 1NP0A 4L4VE 4LLQB 3MNVA 1DSFL 1QSFA 4ZFFA 3QEUB 1HVXA 4KU1A 4OD3H 3V5DA 4GQQA 4IMLA 3MZGB 3RDKA 5C6TH 3CX5J 4UZGA 1BWWA 3D87B 5T3XL 3UTSA 5I16B 1E4IA 5EB8A 1UA7A 5A6SA 3U1SL 4XX1E 4OOUA 1FCCA 3NZ8B 4F58L 1S8DB 4JG0H 3QCTH 3C08L 1BFVH 5DQ9A 3CZFB 5CZXC 2NY3B 5ITBH 5F7LB 1MLCB 1OAZL 4C57C 4BA8A 3NIDF 2JCCE 4OFDA 5ABDE 2X4RB 1ZLUK 4XVTL 1TVDA 2VZOA 3DUHA 1J0HA 5KZCD 5BV7H 1OD0A 2OZ4L 1YYMH 2YD9A 3JTTB 1OAKL 5HGDA 2VL4A 4ZFFB 2GY7B 3PWVA 1S9YA 5BZDB 3MSDA 1NL0H 2CKBA 3BUTA 5I15L 5FKAA 2R56L 1AKJD 4ZPTB 5J6HB 1BZ7B 4P3DA 4YAQB 4JFXB 2LTQC 5J89A 5T1KD 2Y64A 3CKHA 3DMMB 2AJZA 4PP1C 2FR4B 5FYKL 2ZPKH 1D9KC 4JHWL 4EK7A 1FJ1A 2AQ2A 1FDLH 4KI1A 2JELH 4XZUA 1AI1L 4TVPL 1I7UB 5DHXB 3D39D 1JHTA 3QWRA 1E0XA 5EU4A 4JPVL 4V28A 4LLWA 5H8DA 1XCTA 2ED8A 2EXOA 3SKOB 1E28B 3T3ME 1QSEE 3TIDA 1VJZA 4MCYB 4QY8B 5C0EA 3FT3A 3VPLA 3CSPA 3LHPL 1EJ6A 3L4YA 4JRYB 2AJZB 4H04A 1CLXA 2YN5A 4XNYL 2J7CA 1LO0L 3SUWA 4YLQT 5BRZB 5KSAD 4XUOA 1CWVA 1E6PA 2XQYK 2Z93A 5T3ZE 1I7UA 3QUXD 3VFOB 3HG1A 1IFHH 2RR3A 5FEBA 3MJ9L 4CDGC 5AYQA 5JHLH 3LQAH 3ACFA 5IFAL 2PYEA 3VFTA 3BEVA 1A7RL 1KLGA 3SKOA 3OB0K 1OPGH 4OM1L 4M3KB 5IMOA 2IGFH 5JXEA 5SWSB 3VX1A 2HTLD 3RX5A 2OYLA 1R6VA 3EOAB 3Q6GL 1JG9A 5A16B 3LQAC 1LE9A 4FQQB 3DURA 1T5WB 4I5BA 4CMHB 3SE9L 3CLWA 3PHOA 3LKOA 2PWGA 3V4VL 5BZWB 5IB2B 5L2KA 4Z6AT 4WO4C 1QI0A 3CZGA 3RGVD 3IXAB 2IAMA 2ZWYA 4P00B 1C8XA 4P3CH 4ZAKA 5KAQF 4ACZA 1GOKA 1CBVH 3DX6B 3MRFA 3VFMA 5JHLL 4M9OA 3WH8A 4NWUL 5E6ZA 5IW1A 4OQ1A 3OKLA 1HCFX 2EXYD 4P23C 5B8CC 2GQHA 1U8OA 4JFQA 3HMXL 1MJ8H 3QQ9D 1CPUA 4NYLB 1JHJA 1VB9A 4S10A 4FQQA 3GGLA 2XVLA 2EEBA 5E7FA 2AJSH 3CH1A 4U1NB 2IBBA 2NXYC 2J74A 2WXDM 1XSJA 5F9DC 5L2KB 4QHMA 3T2NL 4IS6A 5BYWA 1A5FH 2V38A 1CQKA 4HCRL 5CKAA 1JPFA 2N56A 4P7QA 2HJLB 3O9WD 3UYOD 1HWGB 5JPMA 2YA1A 3MRFB 1LNUA 4WI6A 5FOBB 3OKLB 2X5PA 1MREL 1P6AB 3A6CL 1U3YA 4JFYA 2YPLB 3DVIA 5HJ3A 2IFFL 2NY3C 4LOUD 1T1XA 2UZYB 3NCMA 3U4BL 3TTOA 1U8OB 2AEIT 4JFQB 1FRGL 2WBWB 1WP6A 4JQVA 4LPLA 4PJBE 1P7QA 2YA2A 4O5LH 3VTRA 1TFHA 5BWFA 1MWAL 4JGMA 3ULUD 4HU8A 3TA3A 3STLA 3O6MH 3CH1B 4MNGE 5FYJE 3EKCA 2Y8KA 3V5DB 3BVNB 1NCCL 4FQXC 4U7KA 2JD9A 3KPRB 3WQBA 3WJJC 1GQIA 2E0PA 2HRPL 3DBXA 1L7IH 4JFDB 1AD0A 1X5JA 4K3DL 4D9RE 5I1KL 3HC3H 2YL6A 2DRUA 5LQBH 1N7ML 1GOHA 3IF1A 3L7FA 3MTRA 2NW3A 3KZSA 3EOTL 4JFYB 2QQLH 1UY4A 2VR4A 3ARBD 1KN4L 3QULA 2RBLA 4JRYE 1E3XA 2J47A 1RI8A 2RJMA 3JUYA 1AKJA 4PV8A 1I5PA 5ILTH 3CVHB 1T22B 5DJZB 5J1TC 4G43A 4YQXL 4LSDA 1EA9C 2P4AB 1I1AC 3KGRA 4YHOL 5IF0B 4C59B 1QOKA 4EUPB 3PP3H 3TJEL 2FO4B 5BZDA 4PTMA 1BGXL 3S98A 3CMJA 4FTVE 1F6AA 3MLSH 2EEAA 4H88L 2FEEI 3ARVA 3BCFA 3SDCD 3VI3F 5CLTA 3HE6C 3RIFF 4OLWL 2KL6A 4EI6B 2VX6A 4H0GA 4MA1C 4HZLB 3MXWH 3S6TA 1N64L 2YL9A 5FOOA 4AEFA 3QXAB 1RIVL 1XH3B 5TPWH 2DIAA 2ZE0A 3ACIA 4EN3A 4PY8I 2WCSA 5DPNA 2IXUA 1S5IL 4PJDF 5J9PA 3O0RL 3C8DA 1YMMA 5DJZA 4EBQH 1EAPA 2HN7B 4KKCD 5I18L 3DROB 3CFDA 4KK9D 3PDDA 5KSVB 3P4OB 3D2UD 4X6EB 5IEKA 1BVKB 2YC2A 3M7SA 3C6LA 3QR2A 4GRWF 2OYKA 1BQSA 5T1KB 4BM7A 4Y4HD 3ARFB 1LWJA 3OJDA 2CGRH 3X14B 2DBLL 1QG3A 1U92B 3P9WB 5GJTH 3MO4A 3EMQA 2YKLL 1FH7A 1A7QL 4ATLA 4XNXH 4WFEE 3MX0A 5E8DH 3MXWL 4JE4B 2UVEA 3PWPA 1FN4B 4J1UA 4OLZH 1RIVH 5TPWL 3PQYE 5LVEA 3O2VH 3NFSL 2CKNA 4V1DA 4GKZB 3AHYA 5KZCB 1UT9A 2AXGA 1KJMA 4WTWA 4JPIB 3SPVB 4K8RC 5EIQA 1DHKA 4NO0B 2VLJB 2QV2A 4OYUA 1BEYH 1ZOXA 3QHNA 7TAAA 3R1GH 3WXVH 4LHUD 2BNRE 3L3GA 3QO0A 1K8DB 3QNXA 1I8LC 1WCQA 1I85C 3ULUC 1U93B 1KXTB 1KR0A 2VOTA 5JIKA 4XURA 2VVNA 2XUCA 3ZHLA 4EEEA 4IRSC 2YKLH 4M93B 2VDPL 4QXWA 1U92A 3U46A 4AEHL 1FH9A 2G9HA 5I8EB 3N9GH 4PUBL 5I17A 3SGJC 3RTQA 4ZS6D 4O00A 5FECA 4OQTA 1WV7T 1FN4A 2MOVA 2O5ZL 4J1UB 2YD5A 4M1DL 2QHRL 3LV3B 1WWCA 1RPQA 5CSZB 4ZAKB 4AM0B 4ACZB 3U36B 3U4EB 4JPIA 3MCG1 3KYNA 3S37L 2JKXA 3X3GH 1FSKC 2QLYA 1I1FA 1CZVA 4ZO7A 5L8LB 2IANE 3L95B 3NCYP 3V7AE 3VMPA 4R2GD 4WDIA 3HNBM 2EDFA 3I9GL 2WMHA 3QO0B 3I2HA 5DMYA 2ADFH 3QNXB 4LPYA 2ATKA 4KROB 4NSKA 5GGSA 4L1HA 4YEEA 2JCCA 2EDYA 3OB0H 3L4UA 1RURH 3HNSL 4UBDC 3HNYM 5BO1L 3TVMB 2BVDA 2FJFB 3QWRD 4M4RA 1DZBA 2QHRH 4LLYB 5I0ZA 2V17L 4POZC 4ZXBB 5IESH 1IJ9A 3ARZA 3SDAD 3X11A 1FBIH 5KSAB 1FZOB 5D7IE 3WS3B 1VEOA 3BUYB 1J11A 4FFZH 1UYQA 2FJHB 1VA9A 5JA9A 5GJSH 3CXDL 1OF3A 3HPJB 3IFPA 1ZK9A 4C56D 3NA9L 1FE8H 5ECJE 1UWQA 5I1DB 1CE1L 5DGRA 5BRZE 3P0VH 4B3KA 2IWGA 3DX8B 4EXPX 5H35A 2NX5D 4E41E 1A7NH 4P9MH 1NJ9A 3MV9B 3LQCA 1KPRA 4U7MA 3TVMA 3H9SE 1U8KA 2YR3A 4KKCC 5LBSL 3GJFK 1NQBA 4MB3A 1QPPA 3FQUA 4MYWB 3LQZB 5GS2H 3RDTA 2CBIA 1ZJBA 1OQOA 3M6DA 3BAEL 4K7PL 2HFGL 4MQXC 5F88B 1F6LL 3DHUA 3B9KC 3IF1B 4MNHA 3DHMA 3VW3L 5CJXC 4A6YA 5B38B 3QEHB 1A21A 1G6VK 2FJHA 3IDIB 4P4KD 4G7YH 3HPJA 5IWLC 4I0PC 1AKJB 4PV8B 1CVSC 3RJQB 4MAZA 2W94A 4UI2A 1NMCC 3LEVH 1OGSA 3ES6B 4HK3J 5DJAA 3DWTA 1JUFA 2PXYA 3A6BH 1CDJA 3G6AB 1B3YA 3UO1L 4YHGA 2XV6B 3E1F1 3H8NA 4HIXH 4QX2A 5AWNL 3QIBA 1MJUH 1HILB 5T3ZH 1U8PA 4NGHL 1YN6A 3HUJF 3KLAB 5C86A 1HXJA 1MPXA 4GXVH 2EH8H 5FA4B 4AY0A 3ZE2E 5I8CB 1LK2A 2OL3A 3C5ZA 2FZ3A 2HWZL 2NY0B 3WNMA 1TQCC 3QEUA 3WNLA 2ID4A 2H8PB 1R3HB 2VLLB 4YEFA 2CJUH 2ARJQ 2EE6A 1U3JA 2DMKA 3C6LB 3F7PC 4JRXA 2IANB 3VFVA 1G6RL 3X13A 2YPLE 2VDRH 2XIBA 3QQ9C 3S3PA 4NQVA 4WV1A 4AZGA 3RKDC 2Z4QB 3MREB 1F4YL 3EDDA 5CJOL 4OZIF 4ZZ5A 4PRDB 1HH9B 1KQZA 5BS0E 2J2ZA 4GKZA 4PJ9B 2AXGB 4EIZC 3OHXA 4ZAKC 3GBNH 1IT9H 4UAPA 2XSBA 1AY1L 1JPTH 4X6CA 5T3XE 2DQEH 2R0ZL 3ARED 1OCWH 4P23A 4I0KA 5FUCE 5IBLD 5HYEA 3HR6A 3PUIA 2R4SL 4MGQA 3RWJB 1CGWA 1FGVH 1M01A 4U1KB 5AUMA 4M1RA 4Y4HC 3F4VA 4M5ZL 1UY2A 3ILQC 1H3WM 4NRYB 2UY2A 2QSVA 4LCIH 4YHMH 3KWWB 2EXYC 4P23D 3GEWB 4XZUB 3RKPA 2Z0BA 2PTVA 4S11A 5GS0D 1HH9A 4MNGA 4LCUA 3STZB 1UWTA 1U3HB 5MP6L 4G6AC 4BQ3A 3X3FL 4X9FA 1WJ3A 2Y23A 3WIFA 2CERA 3WMSA 3Q1SH 1MCJA 5IBTL 1W8OA 1JWUA 4XXCA 1MWOA 2NTSP 1G1YA 3EMZA 2FJGA 1HHHA 1IAKA 5F7DA 2DLEA 1MFDH 1HH6B 5C0EB 3ETBF 1ZGLA 3QXVA 3HNMA 4JQVC 3VH8A 2XY2A 1KB5L 5I19L 1J8KA 4G9FA 5BXFB 3GHEL 4XB3A 3B6SA 4JRYA 2ARJB 3AXIA 3OLIA 2DQIH 1FOBA 1SMOA 2J8HA 1FO0B 4GKNB 5C0IB 1ZTXH 1AMYA 2DQXA 2YSSA 1PPIA 3NA4A 2D0HA 3IU3A 5E99H 2GI7A 3ZO9A 3ROLB 1H15A 5EO9A 1RVFH 1XT5A 3STZA 4ZXBA 5HYJD 3NABH 1V0LA 4CL7A 3S7GA 4LKXB 2MCPH 1NAML 4HKBB 3T8XA 2NY4C 2ZCLL 3QG7L 4PJXA 3FCTB 5DA4A 1L4IA 3OX8B 5SWSA 1HH6A 1DE4A 5HYJA 2AGJL 3VUPA 4LLVA 3RWHA 4XHJD 4DWSA 3CLEH 2W1UA 3KPMB 3NZHH 3F7VA 5JXIA 2ARJA 4WFHE 1E56A 2IMNA 5IB4B 2CETA 5HGGS 1CDHA 2E9BA 3P73A 3IVKB 4XP4H 5KS9A 4LGXA 3BJLA 5C07A 2ZWZA 5IJRA 4Y1AD 5C0AE 2OTUA 2P46B 4UQ2B 1B2WL 4NZRL 5F6IB 2ZUUA 2PN5A 5IHZB 1YECL 1M6OB 3QUML 1X5AA 2HT2D 2JF6A 1CZ8L 5DRZA 5F88A 3GTNA 3IK2A 3O6LL 3HE6A 1TZHA 4DAGL 3VXUE 4YZFE 2M2DA 3T2QA 3GXFA 5FKPB 3K4DA 2XWEA 4KROD 2BHYA 4KJQD 2AGJH 4IMKA 4X4ZA 3MRGB 3PQYA 3MROA 4JFDD 3LN4A 3V7MA 2YRZA 5D7LD 4P5YA 1BF8A 5C7XH 5DJ2A 4U1NA 5B38G 1OP3H 2AEQH 4KAQL 2H2SD 3ALGA 4HA3A 2AXHA 2BVEA 3T3MF 3HZMA 2AP2A 2AW2A 1JPGA 2W1NA 3CU1A 3HLAA 1GC1H 2X0YA 2BNRA 2GJ6E 5C09D 3L9RA 1NLBH 4G8GA 1W9TA 3QHZL 4JDTH 3KPSA 4KZEH 3V5KA 1VACA 3IFOA 2ZXDA 4UQBA 1KTRL 1T1XB 2EDLA 3SURA 3MYZA 2FL5A 2J8UA 5CCKL 1XYZA 4FQLH 2NZ9C 4G6MH 3INUL 2D3LA 2VN4A 1A1NA 4UMGA 4WI7A 3VFNB 1A7PL 3AXLB 4X7EC 1BGGA 2G8ZA 2E9WA 3Q48A 4ZTOL 1MCBA 4PJFB 3SBWC 4QX3A 4XCEB 2YN3A 2YLLA 1IMHC 1XGPA 1ZT1B 2HAZA 1Q6EA 2J6EH 2AJVL 4NHCH 2NW2A 4Z2GA 2NY6C 1X5IA 4F7EA 2R56H 3VXRE 1JRHI 3RZCC 2O26U 3TPUA 4JDTL 3MODL 3D0VA 3MREA 1TZGL 5DT1L 5I66A 4NKDA 4EI5B 4Z7VF 1KGWA 4J2XA 1NLDL 4R26L 4RFEA 3GZAA 3H3PH 4YGVB 2X70B 1FHDA 1AHWB 1TA3A 4OKDA 4JY4B 5GS1B 3H9SD 1GHRA 2P43B 5AG8A 5C0CD 1A3LH 4HUXA 3ARXA 1LF1A 3CJJA 1M71A 3OZ9H 3BP7B 4GRMB 1A6UL 2B2XH 2FEDC 1KG0B 3KPNB 5EZOH 1D5BB 2SEBB 3T4AA 5DK2B 4FHBD 4ZE5A 1YYLH 3SJVD 3CFIC 5D2NA 5L9DH 2WKGA 1Z9SA 3UTTE 5K9OB 5FF6B 3M17B 3TV3L 1FVEB 4Y8AA 2VR5A 2HRLA 4U3HA 3FHAA 5L0QC 2CBVA 3PZMA 4KK6C 5JHDB 4E41A 1UA6H 3H3PL 5L2KD 2ZZUT 3EHBC 1UEYA 3WDIA 2I25N 4IHOB 1QI5A 4FG6C 1AGCB 1U36A 4M1GL 1YMMB 2IADA 5FV1L 1R3JA 1NFIA 3DROA 4U49A 4GOSA 4X80L 1A8JH 2G5BB 2ZKHL 1J8HD 5JO5A 1N6UA 4W70A 5FYKE 4JZ5A 3O4OC 2P48B 1HKKA 3W6LA 3UYRH 5F7DB 3LS5L 3AXXA 3BP7A 12E8L 3OJMB 4EZMA 5TH2B 3GNRA 5C3TA 3ZT6A 1D5BA 2SEBA 1QFUL 4K94H 1Q38A 3T4AB 3SCWA 5BXFA 1G7HA 4M4PA 1WDPA 4U6VH 2HLFD 3CFEA 3ECBB 3NVQA 1JNNL 5HDQH 1OINA 4PSRA 3QH3B 3TV3H 4PRHA 4YXKL 4Y16C 5FF6A 3KPQB 4MJ5A 2ZSVB 3HZKA 4Y2DD 4ZODA 1CDCA 2DL2A 5JW4M 3MV9E 5C8JB 15C8L 3P0GB 1KFWA 5CMAB 4LPUA 3UEZA 5A2FA 1KACB 2YBRB 2HMIC 3DYPA 3UEQA 4IIQB 1WWAX 1SQ2N 1CU4L 3CLFH 2BRRL 4FABH 3W53A 4O02L 1IQDA 4LPCA 3NTCH 2ZUVA 3GSWA 4TSCH 5BS0D 3FCTA 2WV3A 1MCHA 1N5AA 1IC4L 4O2EA 2ITDB 5J3HC 4E8CA 3M46A 3NSXA 1UOKA 3V52H 5IROC 1NKRA 1UFUA 1A0QH 3MRIA 5TDOA 1G7HB 3WUWB 4C4KO 4G8GD 1E6JH 2UV3A 2VCBA 2PTTB 3ZDYF 2G3IA 1BYDA 5A3HA 3UBXA 5LGHL 1FYTD 4BFBD 3D6GA 4ZUVA 5DHVH 4F7PB 4NZUL 2E9JA 4FQIH 4GW5B 4JFOB 1IQDB 5B4MD 1VSCA 4DQOL 4UQAA 4ZFMA 3GSXA 2DMCA 4KRTA 3VD7A 2B1AL 1OIFA 4JFFD 4N5EC 1XGQB 4NQCA 1HKJA 1A0QL 3LN4B 4YHKH 2XWJB 5TDOB 4P0DA 4L4VA 1IM3A 5CZVL 3RGVB 2XM2A 4FF5A 3MACH 1M04A 1MOEA 3WJJA 3TN0D 2J7EA 2QADD 4HC1H 1WICA 1BHGA 2VJXA 5C07D 3CD4A 3ZYOA 5ADOL 1QBLH 4NBXB 2XA8H 1ED3B 3BH9B 3V8OA 1W0VA 4PB9H 5F9OL 4D8PA 1N7MH 1X4XA 4LCYB 3W9EA 1CXKA 1U6AH 3TFKD 3VXQB 5A2IH 3Q3GB 1OTUC 3SOBH 5J7CC 2P42B 1WZKA 3NN8B 1K3ZA 4PRPA 3NPZB 4HWNA 4LHJB 1CIDA 1LWHA 1D7FA 1OP5H 5DO8A 5I1DA 2H41A 1AHWC 1TTFA 4P2QD 2DSVA 3MXVL 4EIGB 4HLJA 1DUZA 2R4RL 2BVPB 3RWEA 1QNZH 4MJIB 3CO4A 5HHOA 3HUJA 4MVBC 1LO3H 3KXFB 4CVXB 3ARTA 4Q6IC 3HJRA 2BMKB 4XT1C 1IEBB 3C7EA 4U6HB 3FB7A 2VI0A 3PV7A 1PZUB 2LTQB 3G08A 1P7KB 4PB9L 4OJFL 2W47A 2BFGA 1U6AL 5F9JA 1MFVA 2DH3A 3IDIA 4IDJH 5IMMA 4LHUG 3I50H 4NCC2 4QRPD 5C6WH 5L0QB 3I97A 3JWNC 2WMKA 3BDBA 3NN8A 1N3NB 4PGCB 3T77A 5IM7A 4XXDA 1XIWD 1RZKC 2J78A 2HT3C 3ES6A 1DUZB 2MQ3A 5I71C 1YEFL 4P46A 2VLKB 3DRTA 3ULVC 1DQQA 4NPYB 3DNKA 3KYMB 1S9WA 1X6LA 2D7TH 3Q5YA 5D7LE 3FN0L 4Z8FL 1HILA 4OMDA 3QZWG 4WWKB 3MNWB 2GEEA 4GG6E 1WDSA 4GAGH 2DQDL 5HYJE 1WE5A 5ISZD 4X0VA 1FH8A 3C5SB 2LVCA 1S7WB 1Q9LA 4TUOB 3GBDA 4YPJA 2RFXB 4LF3A 2V72A 4A42A 1F3JB 1G9NL 2MANA 3OL2A 5FA4A 3S37X 4WHCA 3IRZA 1OAKH 5JBEA 5IM7B 1JI2A 2FX9H 5C0AA 4YHEA 4DKEH 3FNDA 3EOYG 5GGVH 1ZXQA 3WXVL 3B9AA 1F97A 1BIIA 1JHLL 2HTLC 4FFWD 1S9WB 1FC2D 3FT4A 4LEOB 3VU2A 5GPRA 4TVCA 1V0KA 4GH7B 3CFBB 1MPAH 4QTHB 2X42A 5INDB 4GAGL 1L0QA 2BSED 2F54E 5JIIA 4HS3B 3BKCL 2Z4QA 3E6HA 3MBXH 2BXZA 3SGJA 2FRGP 1G9ML 2NXZD 1EIBA 2VN7A 4L9DA 2V2TA 3VIJA 3ZHDA 4EKJA 1F00I 25C8L 4UI9L 4Z7QE 5CSGA 3OHXB 4XPBL 3PZ9A 2UWEA 3SDXB 1ZAGA 2EYRB 1IGMH 4UQ3B 5DZNA 4X6CB 3S37H 4JM4L 1JZ2A 4AD1A 3TO2A 4I9WD 1TCRB 1XF3A 4QAWA 4MOAA 4W7VA 5GRUL 5B39B 4J3VA 5CILL 2ATPB 4OCXH 3QOKA 3FT4B 4LEOA 1D9KA 1YQ2A 4G42A 4BFGA 5FUIA 3UESA 3K0WA 5INDA 1UH2A 1W1TA 5LA1A 3B2VH 3CFJB 1KCSH 2X4QA 3HI5L 5DMJB 1YMHB 3QJHB 2NXYB 5JLZB 2V2TB 4NO3B 3O3UN 3ARWA 4XGZB 1OGTB 1BYCA 1U91B 2D24A 2AJ3A 4JL1A 1V3MA 5FM8A 4JY5L 1A7BA 3B4NA 3UTQA 4JVWA 1Q1JL 2E7HA 4G6KH 3WUEA 3QDMA 4TXEA 3JVGA 1OAUL 3RBGA 5E24E 3OGRA 1KIRB 2G41A 1SJHA 3KXFD 3CFKB 3IDNB 5EBWA 3TVMD 2NR6C 1P5UA 5AZ2H 1IM3B 3V4PH 2VC2L 1O5DT 4XNUL 2OP4L 4H26B 1A7NL 4P9ML 3AHTA 1JNEA 5JW5A 3GO1H 3PHAA 3G6LA 1B3JA 3NPSB 1T66C 4JO3L 3MRQB 4LCWE 4Z2LA 1MCSA 4XCYB 4KV5F 5FGCB 4XGZA 2R2HB 1QKZL 4GG8B 5D7KE 5KW9L 4AC1X 3L7EA 4UDTA 5ANMB 4TUKL 5B8CB 1QW9A 5DZLA 5JBDA 1W3KA 2WQ8A 3MRDB 1YY9C 5AC5A 3DO7A 3HMXH 2PCPA 1UYXA 1MEXL 2XZZA 1AR1D 1FAIH 1VF8A 4PJXB 4P2YA 1DBAH 3TH2T 1PYWA 4MB4A 4UR9A 4KZDL 5SX4H 3QSKB 2DLTA 3NACL 1KULA 5A94A 1FAKT 3F7VB 2QSTA 2VC2H 2R9HC 4F3FA 2XQYG 3P73B 3QDGA 2R0KL 4DVBA 3OGVA 5C07B 3UO1H 2KPNA 3O6KL 1OTSC 3BESR 2XGIA 4P2RD 3MGOA 3MLPA 5A40E 4GG8A 1UM6L 2OXHA 4A2MA 4URIA 1BQUA 1LO5B 5B8CA 1CT8B 5KVDH 1A4KA 1EPFA 1ERNA 3H7BA 1IAOB 1L8NA 2GTZA 2J62A 3EYUH 2Q7NA 3QCVH 4HD9A 4CN4A 3V95A 3MMEA 2FLBT 5F9WB 4DGYL 2OQJB 4PRHE 5F1NA 5CP3H 4XXDB 5IGXL 4MJ4A 4LHSA 4TTDD 2R0KH 2HRPH 2OWXA 1OGBA 2CLRB 1S3KH 4JG0L 4NPYA 3QCTL 4ELKA 4B41A 5EOQL 3U5YA 1JPGB 1UM6H 5DRWA 5MEQA 2F58L 1PKQA 3DOSA 3S4SG 5HDRA 3WYRA 3I3DA 3WN6A 4RMWA 3OQ3B 4TX8A 1TQBB 3QUKA 2YL8A 1EGJL 4X98B 2EDRA 4W81A 1H4PA 2HA1A 5D2LE 1A14H 1UH3A 2OZ4H 1YYML 3CZJA 3U7VA 4OOZA 2J4WL 4FNLH 3RU8H 4XMLL 1I1AB 3TA3C 4LCCB 1CQYA 3VRLE 1VESA 5M5DA 1IT9L 4FQXA 1MHPH 4Z2IA 3BKMH 2BNUB 3SCQA 1GJUA 4PJFA 1GL4B 3QXWA 4N0FB 2YFZA 5DVMA 1XC6A 4A4AA 2BSRB 1G0YR 2R4SH 4GMSL 2EDEA 4V27A 3POCA 3E8UL 4JGUA 3SQOH 3KYKH 3JUGA 3G5VB 1FFOA 1FYTB 2YC1B 1JF1A 1KCVL 3ESUF 3WJLA 4XZUG 3QUKB 2WM0A 4DKFH 3GI9H 1I1YB 1A3QA 1W0NA 5IVXF 4UDUA 3IT8D 1DANU 3HS0A 5A3ID 2CXKA 2J4WH 2P8PA 4FNLL 2OWCA 2B0SL 1FLTX 4DM2A 4ZSOB 2J7GA 5SWZB 4N0UE 1CLOH 3MJGX 2PKDA 3UTSD 2NY5L 4I2XE 4XXCC 5DI8A 3SDDD 3ARFC 1MRCH 2A0LD 2FDBP 4EQ3A 5B39A 1OOAA 2VMDA 3W5MA 1SJVA 5E2VL 4JL2A 4LARL 3A67H 3UJJH 5DK2A 5ICXB 1S7SB 1UM5L 4QRTB 5F7MC 4BZ2L 4MAVA 4HDIA 2UZIL 4OLZL 4HOWA 1Z5LB 4UU9A 1JYNA 3LMJL 4MD0A 1IGIL 4MAUL 2IUZA 4NO3A 4QCIA 3HG1B 2P8LA 3TT1L 4A41A 3WIJA 2DQHL 1KTDB 2GY5A 3CMGA 5JOPE 3PHQB 3WUBA 5KN5B 1KLFA 2BCKB 2IADB 4ZXBC 4L8CB 3OKMA 4HS8H 4UTBL 3V4UL 4AXNA 4Y4FA 5IMOB 1BJ8A 5KVFL 3OKKA 5JO5B 1JDCA 3NH7H 4JO4H 3EOAA 1HIMH 5CBAB 2V3FA 4R8WL 3OR7B 4ISVB 5EO1B 2VDPH 4OCRH 3DURB 1V3JA 5MENA 2D9QB 3LKOB 4RAUB 3P9MA 2A6KB 2BY2A 2UZIH 3CFEB 3ECBA 3MLWH 3KPOB 4KK8C 1BX2B 3F7QA 4LVHB 5IV2A 4P3CL 2ESVA 4M1DH 3O3EB 1MW1A 3H0TA 3KPRE 5SWZD 3TF7C 5JMRA 2J7MA 1ZBKA 2R2HA 1ZSDB 4Y5XB 4OCSL 3X3GL 1KTDA 5CJ8A 3DVGA 2Y4SA 3D3VE 1T4KA 3GNMH 4L8CA 5DS8A 4QLKA 4OGXH 3ZSTA 1UQYA 4RCAA 3RI5F 4CVZA 1A6VL 2PCPB 4DAGH 2VDML 3OKKB 3QISA 5F6HI 3S96B 4IRSA 5GHWL 1V3LA 3FHQA 4MTVA 4PTXA 2EDQA 3OJVC 3OR7A 4ISVA 4XCFH 5GGQH 5F9WC 1XV8A 3QB7C 5M17A 4I0PB 5MENB 1NGXB 4G5ZL 5T1MB 1N5YH 1NMCB 1H9VA 5D7IF 1MF2H 5FCUL 5D9NA 1OWQA 4UV7H 1QLRA 4OSUH 4LSRL 3SJVE 1T0MB 1LEKA 2V5YA 3ROOB 5FOBA 1AFVH 4RQQA 4ZD3H 2IFFH 2JEPA 4E9LA 5ACLA 5BXSA 4J12A 4HUUA 2A3HA 1JGLH 4UT9L 4ESKA 1QLEL 4X7FC 3KPSD 2AK4E 7CGTA 3OKOA 4MDJA 3VM5A 1R64A 3MS8A 3GMPB 4JX0A 2Y7QB 3TA3B 3K8KA 5EPMA 4YNYB 5HHMB 4MDIA 5CGMA 5FDWB 1W32A 3MA9L 3THML 3T2OA 4OSUL 1W99A 4ZXLA 2AV1A 4LNRB 2AJVH 4NHCL 2X1PA 4ZXEA 1YHTA 4I13B 1GOOA 2YD7A 5HPCA 3D3AA 4RSVA 1AR1C 3BRGC 5FB8A 4NP4L 2GFTA 3EYSL 1KN4H 4FRWA 4D8PB 4JRYD 4HUUB 4LCYA 1FORL 4HUVB 1FYHB 1LDSA 4QB1A 5CJQL 5CXPA 2I07B 1J9CT 2YD6A 4YHOH 3NCJH 1VBUA 4OKVB 1MRDL 5KEZA 4BJLA 3PNWA 2FSEB 3W2DL 3A6BL 2ESVD 5DFAA 1C5CH 3WD2A 1W9SA 3WN5B 3KL0A 4GWJA 1V03A 3QFJD 4UB0L 5DQDH 3T65A 2BSRA 3MLXL 4AZIA 1TETL 4ZUUB 3BE1H 1A1MA 4GBXA 1J7VR 2VT0A 4U6HA 4WIWA 4O58L 4EI6A 2C1OA 3L5JA 5FK9B 1CDUA 2YXFA 2EC8A 4TNWK 2CIIA 1T1YB 5L9DL 1OWRM 1RZKH 1QSED 1S9VA 1J88A 4ZO8A 3R8BB 3ULUH 5IMMB 2GK0A 4QHLB 2NY0C 4J4PD 4AEEA 5I18H 1XGUA 1LGVA 1EAPB 2HN7A 1FV1A 4HH8A 1K4DB 2PYEB 1Q9OB 4PJFF 3VFTB 4HKZA 3W2DH 1HSAA 3I6GB 3FTGA 4MAYD 1RZFL 2CJUL 5KSVA 4X6EA 3LPOA 2XG9A 1DQQB 4BJ0A 5T1KA 3OGSA 3KLDA 1UY0A 3BE1L 3JVGC 5A16A 2NY2D 2Z92A 4X5WB 5F7FA 3OPZL 2UVFA 1A3RL 4JM2A 1GXEA 5FXCH 2ZEYA 3U5UA 3IXAA 3JV4A 1SJEA 4ONHB 4XTRD 5E9DB 4HXAH 4YXKH 2HTKD 3P3YA 1XIWC 4W68A 2AJXH 4ODVH 1K9DA 1F4WH 2D7MA 4PJBF 1AY1H 3TOPA 3U4AA 3REVA 5KN5A 5E00A 2Y2WA 3R1GL 3WBEA 4HKZB 2QMKA 5ESAA 3A23A 4X99A 4GI9A 3OZPA 3GH5A 3CMOH 3FTGB 4JFUA 2EE2A 3GXMA 3V6OC 4R96B 3SKJL 3BEWA 4JO2L 4FXKA 1JI1A 1YEHL 4U1MB 5CBAA 1O8PA 2QLVB 3HR5B 1AGEB 1T20A 3OPZH 4NUJB 3TBWA 1DLHB 8CGTA 5K9QI 4WU7B 1R0AH 3DGGB 1V5JA 3BZEA 3OKDA 4AM0A 2N4IA 4TSAH 3U4EA 3A4WA 5BRQA 1UJTA 4NQDD 4BFEA 3SDXA 1NAKH 3I9GH 4Y16D 4LDLB 2WC4A 2X4NA 1NAMB 2APTA 5T3ZD 1HHJB 3TO2B 1E4NA 1DUYA 6A3HA 2LE9A 2W67A 3K46A 1NC4A 1ROWA 3SKJH 1HQ4A 2ATPA 4NSKB 4PTUA 2C3GA 5GGSB 4XP5L 1V3IA 5A43C 5EIYB 1D6EA 1C7TA 2OMBA 3ZE0F 4TUFA 3TO4B 3JWOC 2KUTA 5T1MA 3CFJA 2D7OA 5CZVH 2WUBL 5DD3L 1JAKA 5ABGA 4LLYA 4W85A 3DVFA 4EOWH 1X5XA 1OSPH 2O9OA 1RVFL 3SKNB 4V2BA 5JXAL 5D1QA 4LRIA 3X11B 1FFNB 3ROOA 1W9XA 1J0ZA 4F7TB 5J57B 5IVOA 2NX5A 2HKFH 4J3SA 5GJSL 1NAMA 2X4NB 1XRVA 3KDMB 1NC4B 3IFPB 1B0RB 3HNVL 1XH1A 1X4YA 2BHUA 2CESA 1CE1H 1T3FA 4P4KB 2EYTA 1MJJA 4F2MA 4PLNC 3SOBL 1SJHB 3VVGA 4J27A 3C7GA 5EA0L 1EEZB 1JDAA 2WW8A 3R0MA 3MXVH 5T5FH 3ZT5A 4MAYA 5AEAA 3BDYH 2HT4D 1C8QA 3MV8E 4AG4A 2GJ6B 4WFGD 4YHYB 2GJXB 2GFBB 2DLIA 3I02A 2YDSA 5D1QB 3BN9C 3EW3B 3JWOL 2WABA 3WKZA 1JZ7A 2VX4A 1U2HA 1XH3A 3DO7B 4PMYA 1B6UA 5EU6D 4EDWH 2A2QT 4PJBA 3SDAB 2IC2A 4WLCA 1T1ZB 5FKYA 2X9YA 4JRXD 1HZHL 3V0AC 2HMID 1FP5A 3LEVL 4FQCL 1JNJA 4CD4A 3QHOA 2MTPA 5BXPA 3VXTA 4OKVA 5DJAB 1HI6B 1JUFB 2PXYB 5HXMA 1ZT4B 3BDYL 3CDCA 4MAYB 5ERWA 1NEZB 5C0JB 4APQD 1YEFH 3EIFA 1MJUL 2PWDA 5EZLA 1S8DA 3OJDB 3T65B 4JZNB 2YRPA 4P7NA 2D7TL 3QNYA 1VFAA 1Q0YL 3MGTB 5DJDB 4ELMA 2WMPA 4WWKD 5IHLB 1NC4D 3S36X 3VIGA 1K9EA 1E4XL 1CFNB 1INQB 3ZJ6A 4M7LT 4LPVA 1OTSD 3ZKMC 1KJMB 4MXWH 1MCFA 5I8CA 3QXUA 3M8OH 1WUNT 1KTKE 3ZKND 1A7PH 2BXYA 3IB4A 4TULL 4YWGL 2MKWA 4MJIE 1FV1B 5I1IH 5HGDB 4LAQH 5I78A 4OUUB 3FT2A 3S9DB 3VXTB 4A3YA 1S7VA 4ZTOH 3Q2CA 2DQTH 3HI1B 5ALCL 5TFSH 1EHXA 1AVAA 5FGCE 3QXDA 3QHFL 5E8EB 2VZVA 3VJ6A 5FKAB 4JRXB 5ICYB 3FOLB 5GGVL 1UD2A 1H5VA 1GPFA 2ERJB 2I5YL 2MWCA 2DBJA 1E6QM 3MODH 1D6VH 4UNTA 3RTQB 2FD6H 4W8JA 1AE6H 1MPAL 4J3UA 5CJOH 1AQDB 4XH2B 1W9WA 4NHUB 4EI5C 4PPTA 1RZIB 1G9MH 1O7SA 4PJ9A 3MU7A 5DD1H 4Y5YA 2BERA 5GS1C 2ZCKH 25C8H 2DQEL 4MJID 4HF5H 4CDHA 2C4FT 3MUJA 4PJCA 5D9SA 3FT2B 1LO2H 1G01A 3S36L 4XVJH 4N0FA 3KHQA 4YE4H 3FQRA 2FWOB 1U42A 4U1KA 2ATKB 4RGNE 4OD1H 3M1BB 2D20A 2O5YH 1AGEA 2QQKH 4EDXA 4JANA 4LCIL 4YHML 1FFOB 5DVKA 4OV5A 3PZQA 4RBPH 4C7DA 4TNWF 4ZOBA 4QOKD 4ZNCD 1R3LB 1VADB 1XGYL 1AGFB 4F7CA 3WQVA 3FRPA 2Q8BH 1KGUA 5DD1L 1CWYA 5DQJB 2BFVH 4PLKD 4OD2A 3OEAA 2DCJA 4PJGF 5CEXA 3P6BA 5HHXH 5SWZA 2GW5A 1JWUB 3PQYD 1KLGB 1Q1JH 3MMUA 3HC4H 2VZRA 1H0GA 4XRCB 2ZKHH 5M94B 4AIXA 3BH4A 3DETD 4G6KL 4GI8A 5H2BA 3FRUB 1ZGLB 4OCYL 2CIPA 5EIVA 1WBZB 1T04A 3LVEA 4HW6A 1ZA3A 1T5WA 1VBRA 4I5BB 1HHKB 5EU5A 4QEGA 2E7CA 5D2NC 1D6EB 5KANG 4JANB 4XUTA 2MFNA 4C55A 4P59L 2W61A 1AXSA 3B5GA 2WNGA 2DDUA 3QI9D 3ULVL 1TMQA 4PLJC 3ACHA 4FA8A 5HNNA 4MD0B 3NCOA 4JO3H 4R4FL 4MCZA 1PSKL 3SKNA 4IIQC 1LMKA 2LAGB 4YHYC 2ORZA 1FL5A 1J5OL 4GRLD 3ZE2F 1FFNA 1RH9A 3B8SA 2R1YB 1HHIB 1PY4A 4YBLC 4HT1H 5DMGD 3NTCL 2BBAA 4N8PA 1NANI 4PTTB 2FBJL 4HG4J 4JQIH 1T04B 1JTTA 5EO1A 2QADB 3KPMA 5ENWB 3HKFA 1EZVX 5LA2A 1N6QH 2V5CA 3NIYA 4LIQL 1YPZE 4QHMB 5H94A 4QRRA 2WDBA 2ESVB 4NZRH 4LSUL 2DLHA 3U1SH 3MV7E 2XN9D 4E42A 4MCZB 4HA4A 4PTVA 2J7DA 5IFHL 4Q6IB 2XT1B 4HP5A 4GBXC 2V5DA 3VXME 2ZXAA 1MQPA 4M43H 1Y0LA 3DYMA 2VDQL 5EC2B 5EZJB 1ZLVH 1VCAA 5CFHA 3OIHA 4PTTA 3POHA 1FL6A 3IFNL 4F9JA 3BHBA 4F8TA 4EVNA 5IROA 4NQDE 1WFNA 3L3HA 2R9HD 3FKUS 1UWSA 3JSSA 2AEQL 3QUMA 4FZEL 4N8VA 3RNKA 4JFTA 1E4MM 1V02A 3BSZL 2JIXB 1SVZA 1NL0L 5ERWB 5C0JA 1VFOA 3MUGB 3O9WB 2BP3A 1UM4L 1YC8A 1HXYB 4JDVB 1I7RB 5SV3A 4NQVB 1ONQB 5GS2D 1HJXA 4XCCH 1ZANL 1MCQA 4Q9QH 4BKLA 4ELMB 4RWYL 1EOKA 1VACB 1A6AA 5TE4H 1UADC 2F61A 3ZYJA 5EUKB 1N59B 1XR8B 1MY7A 2P5WA 3ZSSA 5F96H 1V6WA 3ILPA 3CHDA 3BHBB 1J1XL 1ZLWH 3CPUA 3OAUL 3RUGB 3FJTA 1YNLH 5IF0A 4FZEH 2R0LL 4K2UL 2LU4A 3PTMA 2X1IA 1A9BA 4XHQA 4UV4L 3FAWA 3RRQA 4ODUB 3QT2A 2ZNWA 2WMJA 5CSYA 3O3BB 3G04A 2F2HA 5MEND 4LSVL 4C58B 5D7SL 5IKCB 5DQ0A 1CEOA 3LHPH 5EUOE 3AHZA 3TPUB 2I24N 3CUHA 4HHAA 4F9LA 2F54A 1P7HL 5FGBC 2NNAB 1IBGL 1YEGL 4MNGB 1EOMA 4YDIH 1H8OA 2ORBL 2YK1H 1TA3B 1BGAA 1FVCB 1RU9H 5C3LD 5KOMC 5I71B 2ZJSL 3MV8B 1MNUH 5A2BA 2FSEA 5HDBF 3PWVB 5KBNC 4CU9A 1IGJA 4PRHD 4N5ED 1YEJL 1OPGL 4OM1H 1N2RA 3RVXD 3WD0A 3WN5A 3L1OH 1ZE3C 3ARFA 1WAAF 4Z8FH 4F79A 1QI3A 3W29A 4BXSV 2DPEA 4FQJH 1KWKA 2DYPD 3VFWA 1NM9A 2Y07H 3ARBB 1S9KC 2C1OB 3MFFA 4JJ5B 1H6YA 4HHAB 1FJ1B 5EOCJ 3IKCA 5EIIB 1UA3A 3JUZA 5BOZG 1C12A 5GRZA 2W91A 1AGFA 1IKNC 5IB5A 5HI3D 2FIRT 4TUJA 4F33A 3BP6B 2H26B 4NO0D 3LPGA 4G6AD 2IMMA 4K9EH 1RU9L 1RZJC 2ZX5A 1AXIB 4NWUH 5DD0L 3TT1H 4W93A 1KJVA 5CEXB 4NRZA 2WMIA 1BLNB 3I84A 3MUZ1 4LLWB 3UTPD 1E27A 3CDZB 5FYLD 4WGVB 4UFHA 12E8H 3ZDXE 1U93A 4HGMA 1UXWA 5CWSB 4Y4FC 5IJKA 3UPCA 2BVOA 5E8NB 4M6NH 4RNRA 4Z78B 2B1HH 4LLVB 4JKKA 3RWHB 4DWSB 2DQGL 4U6VL 5HDQL 4OT1H 4B53A 4L1DA 3NCYS 4QDQA 4LLDA 1QBBA 2ZSVA 8A3HA 1MQQA 2J7LA 15C8H 2VKXA 4NQSA 4XZBA 1FFRA 1U8QB 2BX5A 3NPSC 4PJAE 5CMAA 5IQ7L 3BP4A 2GK2A 2VXQH 2EH7L 3L95A 4O02H 2HFFB 4JM4H 2VZ1A 2HLFC 4HWZA 4LSPH 3BQUC 1HHIA 4JHZA 1HL9A 1E71M 1S7RA 3SCMA 2W9DL 5CEYB 5HD8C 5F97E 5FCSH 3GM8A 4W6WB 1A6VH 4G9FD 1LP9E 3ZYIA 3WIIH 4DXSA 3MRIB 3GMQB 3HFML 3CK0L 1UWGH 1E6JL 3LMYA 4LOUC 4F57H 2YPVH 1K85A 3ET9F 5IB2A 5FYJL 4KTDH 3HG1D 1GZQB 5A2AA 3VIFA 5TE7H 3KPLB 4RBPK 1N82A 1IGFH 3OXSA 1WKYA 1OGGA 1FHLA 3HC3L 3VX0A 2GT9B 3MJ7A 3GMOB 1AFVL 4KQ3L 5HYFA 1MWAB 5AY7A 4ZOCA 3GZKA 2EE3A 3EOTH 1FC1A 1UKTA 1Y18A 3MRNA 2W62A 1U8MB 1GAFL 1CECA 5ILTL 3G6JF 4PGZA 1FPTL 4XBEH 1J1OH 5EOTB 1GZPB 2YJQA 4MA3B 5AZ2L 3V4PL 1EGZA 4HWBH 4LEXL 3TO4A 5C07E 3OTTA 2QF8A 1BJMA 5F7WC 3BT2L 4U3XA 4XWGL 3T0WA 4NC1C 5F9OH 3VIIA 2A74A 2KDGA 3X17A 1ED3A 1LL6A 3CIQA 1IAII 4M8QA 3RZWA 1OD7A 1MWAA 1G6RA 3OF6A 3VD4A 1EO5A 3MRBA 3PHSA 3MRNB 4PRPB 4XC3L 1CXLA 2I9TA 4UFIA 1MHCB 1GJIA 4NRXA 1DSFH 4ATWA 4Y5YC 2KH2B 3DARA 4PJEE 3LKRB 4KK9C 4HUXB 4TOYH 4Z7OF 1KGCD 3ZJKA 4ZS6C 2PWHA 32C2B 2VRJA 1J0KA 1YNTA 4AL8L 2BGOA 3I3BA 4KRPC 2XZAL 1E6OL 4UB0H 4KMQA 4AIZA 4DKDC 4YHLL 3KLAA 2FHCA 4XNXL 4YH6A 2QQQA 4M8QB 1MFBL 4HG6B 4PEEA 2W0FA 6FABL 1X5YA 3MSPA 5IK3A 3PWJB 2VX7A 3KL3A 5GGRY 3O2VL 4NZTH 5DRXB 1BVLA 1HKLH 3MRBB 1GOQA 3ULUL 2OL3B 5TDNA 4XX6A 1MCIA 1MHCA 4K8RD 1ZHNA 3CHEA 3NAAL 4N0UA 3PP4L 2K1MA 2XTJC 1MW0A 1GGUA 5EZLB 5J0BA 2QKIB 1N8ZA 2P8MB 5FYKH 4NJ9L 1KXQA 3BJ91 4ODHH 3MNWA 5I0DA 3ULUF 2R69H 3MGTA 5DJDA 4OIAA 3IU4L 4CMHC 4HFUH 2NT0A 2JELL 2X4PB 3I85A 4P2RE 2RFXA 5IK3B 2JE8A 3QXAA 1W3JA 4NBYB 2XFYA 3N11A 5D6DC 1F3JA 3O3DA 1L0YA 2I60L 3IDMA 1CZ1A 3N13A 3AU1B 1XIWA 4U1IB 1UXZA 4IIQA 4DKEL 5C0AB 1MHPL 1Z0NA 1VGEL 4NF7A 3QUYC 4XI5C 2XIIA 3CFDB 1WB0A 3ARGC 5HY9B 3VM7A 1E4KA 1JHLH 3EYQD 3GXDA 4PJ5E 2Q86A 4MJ2A 3VXMA 1N5AB 3FOLA 5JXEC 4U1HA 2G3NA 4R7DB 4C56A 5EOCH 3PWNA 1UR8A 3WF3A 3SCSA 1KCVH 1KLUB 1RZ8A 3QFJE 1CICA 4R7NB 1AQDA 4XH2A 1JFQL 5BO1H 4W88A 1Z32X 4OGAC 2DQUH 3D0LA 2CK0H 3BOVA 3P4NB 4UTFA 1ZEAH 1NOUA 4NQSB 2DSZA 1U8QA 2XM1A 3IDMB 3LQAL 3TBSB 2UWEB 5FHAH 5IESL 3BP4B 1CLOL 1NFDA 2VLJA 4GW5A 4JFOA 1WF5A 3V9FA 3TZVD 4GO8A 5EU6E 4FFZL 1S7RB 4LFHG 3Q5TA 3SCMB 4I3RL 2D31A 2AK1H 3CFCH 5E2VH 1CIUA 3VXNA 4RGOL 5C08E 3N1FC 4G9FB 1PGRB 3MCKA 3WDRA 1B0WA 3NJVA 5M3WA 1GOWA 5CGTA 1G0XA 4L4VB 3ZTNL 4GKNA 1AXTH 4MHHI 4XB7A 4ZTPL 4Z2JA 5EN2A 3T0XA 5CEZH 1VADA 4F7CB 2CK0L 2EDBA 3LEKA 1X6NA 3UZQA 5JPNA 3LV3A 3GSNL 3BZFA 3PDGA 1KXVC 1RYYA 4Y19E 2RB8A 4AEIH 5G05L 2R2BA 1SBBA 2WHKA 3V6OE 3BP5B 2K9UA 2VRAA 1DQDH 4QGTA 2R29H 4XRCA 3VXQA 2NY3D 1EHLH 1JTOA 1F2XK 2FX8H 5H2BB 3O8XA 2C9KA 2HFEA 1NWUA 3AMKA 1HHKA 5EU5B 3WEMA 1AXTL 4WW2F 1A22B 3MLWL 4AIOA 1B3ZA 4TVPD 5C6PB 4O2FB 5CEZL 5D7JA 4ZAKD 1U95A 4MSWB 1XMWA 4X4ME 4HIXL 1K9TA 1LQ0A 1NGZB 4XAWL 4OCSH 3ZLQC 4GLRH 5GGRA 3EGSA 3FW6A 1E9LA 2A74B 4NGHH 3HE6B 2CHOA 3U82B 3FY1A 3MOBH 5F1OB 5JNYA 2PO6A 1DBAL 1NCWL 5F9JB 2VDMH 1AO7B 4QTIL 2OM5A 4OAWA 4GXVL 3NCCB 2YG0A 5JXJA 1UR9A 1MWAH 1N3NA 2NY1D 2BHZA 2CDOA 1QNSA 1FIGL 4WKHA 2Y5TB 4GW1A 1CGSH 3NBNA 3AMCA 3DETC 1JFXA 4QO1A 4PYSA 3Q5OA 1WWWX 2WWKT 4O2FA 2EDJA 3TESA 3O6KH 4G8FB 4GZEA 3MANA 3HLAB 1YNTB 3WN5C 4XAWH 3IS0X 4NFCA 3VG9B 3LQZA 4G8GB 5GQBA 1V05A 2QQIA 1T7WA 4N0RA 4WFHD 4I3GA 4LDEB 5GGRB 2NZIA 2W0LA 3IXTB 2NMSA 3MOBL 1A4KB 5DJ0B 4ZFGL 1F4YH 3C5SA 5EC2A 5EBAA 1YN7A 5HHQB 3B5TA 4OTXL 1E4XH 5GZOD 4LF3B 4DGYH 5HVWA 1BQLH 2FLRT 4KMTH 1TNMA 4I4WA 2EDOA 4B7LA 4LFHD 3VFNA 1V7NH 3NGBC 4QDRA 2E40A 1UR2A 4N9GB 1SM3L 1XFPA 4PRID 1RJZA 1SEBB 4PG9A 3QWOB 3PWLA 3QUMB 4TULH 4N8VB 4YWGH 5I1IL 4QCFA 5BRPA 3QUYB 5HBFA 5DSCA 1H11A 1AQKH 3ARGB 3T0BA 3G6AA 2CLRA 3QHFH 2WC3A 3LN5A 4HWUA 4OZFG 5DRWB 3ALFA 3CFBA 4HMCA 4U6YA 2C0HA 2I5YH 1ONQA 3DX9A 1K9FA 1F13A 1FLRL 1LP9A 2EPLX 5I66B 1A6AB 1GGBL 3MCLH 5E1HB 2Q7YA 5EC1A 3DTXA 3QAZB 3O3DB 2WPGA 1IGCH 5ADPL 4M61B 4JY4A 3P4LA 5GS1A 4FQHB 4LL9A 1RJZB 2EC9T 3WF1A 1BWMA 4Y0GA 1WO2A 1NDGB 4PR5A 3ARQA 2VDKL 1R3HA 2VLLA 3SCMC 1YUHA 2ZOKA 4HK0A 1PMJX 3FQTA 3S36H 3KPNA 3VXMB 3ZKNC 3MLYH 4B16A 5GJTL 4UFMA 1I85A 4NZJA 3X13B 1VHPA 3F6IA 3QPQD 1QFWI 4P46D 2YC1A 3DX9B 2MKLC 4DTGH 2QQKL 2VYRE 4JKMA 4NUGL 4W89A 1KCLA 3DTXB 4MA7H 3S88L 1OGTA 3RA7H 1FNGB 4Q97A 3UTQB 5E2UL 2ZEXA 2OBGA 3U6RA 4UBDD 5C9KA 1BQCA 5KSAC 3IDGA 1RZFH 2P1YA 2ZUQC 2VLKE 1XF5B 4KK5C 2YA0A 5C0GB 4L3EA 3FFDA 3RWJA 1DBJH 1CD9B 3UPAA 5F21B 5F3HA 3WO3B 3ZL4H 4OCYH 1KXHA 3QDMD 3N9GL 1KJ3L 2AERT 1VERA 5EBWB 3FO2B 5HHOD 4ZENA 5ID0B 4NRYA 3IAPA 4PRHB 5D7KD 4RAHA 3OKNB 3LMJH 2CKSA 5IVZB 2PTUA 4P59H 5EN2B 3TO4C 2V3DA 3VFRB 1R8LA 1FZJA 1ZHKA 1W9BM 5AYUL 3AHVA 3BP6A 1F4WL 3PZTA 2X05A 3DX7B 2E9LA 3PHQA 5IG7A 4RX4D 4AD0A 4L3CB 4YDVB 3BW9B 1BLNA 1UYWL 5DEZA 1QO3A 2XG5A 4NFDA 4PBVC 1DBBL 4JO4L 1RIUL 4GRWE 1B0GB 2XWTB 5L2JA 1HL8A 2X8RA 5IR1A 1IAKB 1UXWB 5CWSA 1PZ3A 1MCLA 5E5RB 5D8ZA 2F53B 2OWWA 1KJ3H 3JV5A 4FI9A 4L4TE 1V7MH 2WWMC 4GKLA 2IEPA 2X09A 2APXA 3FO2A 2YDQA 3QRGH 4PJEB 2IH1B 3U37A 4R4NC 1A47A 1Z6JT 4JKLA 3OKNA 4MD5B 3WNNA 3IU3B 4DVBB 4LIQH 5ELIA 1KBKA 2VQTA 1VPOH 3H0TB 3BPCB 1JGEB 5T1DH 3THDA 4J3XA 4FLSA 4LXFA 3JTSB 4QRSB 1F3RB 1LG2A 4ZMAT 1G5AA 1ZBVA 2XONA 5D7LB 4PYGA 3NFPB 5IT2H 5I8OL 4NNYB 1MI5A 4HIHA 5C0DB 4XCFL 3CZUA 4YJZL 1T2JA 3MLUL 4MS8C 3RIAF 4I0PA 3WSOA 5F1NB 1I1CA 4UT6L 3N06B 3WFBL 1MF2L 5FCUH 3U79A 5T33L 3W28A 4IJ3C 3KE0A 2PXYC 5EG6C 3IVKA 1OSPL 1QLRB 1MUJA 3CPLB 3PV6A 1GZQA 3ZOAA 1LEKB 4PJCF 4JN1L 2J8UF 2YKKA 2ZCHH 1BOGB 1OLZA 5T1LB 1OTTD 3B9KD 1E4WL 3MJ7B 1TZHB 3RWGB 4Q9QL 4X98A 2W0PA 4G7YL 3UJTH 3OKOB 1KYOJ 1CL7L 1HWHB 2EJ1A 3Q3GA 1U2CA 1MAMH 1EDTA 3LEIA 3KAAA 1IC7L 1QEWA 3S35H 1P6FA 2DTML 3V2AR 2N7BA 3DI2B 1F3DJ 4N9GA 4HWEL 3C5ZC 5FYLE 5JIHA 4PG9B 1JU3A 4MJIA 3DRQB 4L8BA 2GCYB 3UJIH 5DSCB 4CUAA 5M03A 1MW2A 3FOMA 5D1QC 1ULOA 4RRPA 4PRAB 5EU6A 3LN5B 1HNYA 1BQHA 5EZOL 3HRZA 2HTKC 2BNQD 4PJXE 5KSUB 2ERJC 4U6YB 1CDBA 3ARPA 1UG6A 1KB5B 4WV1C 4RDQG 1ECEA 4OZIE 3KPSB 2H2PD 4EXKA 3SDAC 2EH8L 3BQUD 5D6CB 3KS0H 3PZNA 1IM9B 3S97C 1KJ2A 1MAML 2WZPD 1KNOB 2DT3A 3B9EA 2JCCF 3NCJL 2CDFA 4PGCA 3T77B 4U2ZA 3HEIA 4DN3H 1SBSH 3MRJB 4MAYC 5DI8B 1MNUL 3GNPA 4PR5B 4XCEA 5DC9B 4EI5D 2P45B 3VNYA 1G6RH 4NQCD 4IPLA 3B2UD 4OF7A 5GIRB 2ENYA 32C2A 3U9PL 2W4XA 4ZUUA 1JZ8A 1UKPA 4F7EB 3P1IA 2JIEA 1LP9F 4D6IA 1IC5L 3K2MC 2NW0A 1UD8A 2K7PA 1RZKL 3DYOA 1M7DA 3HI6L 1O7AA 4NQCE 1HCVA 2GK0B 2EZ0C 1IKNA 3FB8A 4C54A 1XGUB 2AKRB 2X89A 3IRPX 5FUOH 5I1HH 3PTKA 4PMDA 1KEXA 2AJUH 2X70A 4OFIA 4OF3A 1KXVA 5DHYB 3ABZA 3U6RB 1HKFA 3MRJA 2ZOXA 1NKOA 2FIKB 5CS7A 1QFHA 2EPMX 3E6FA 1F02I 2AEWA 4G8GE 4R90H 4Z95L 4L3EB 3U9PH 4JZOB 5GIRA 5IJKC 3DMMD 5F3HB 2VZUA 1X1NA 2F19L 5JW4N 2V4VA 4NRRA 1TVHB 3GSVB 5GGTA 4CVUA 4X7TA 4JM2B 3RVXC 2PWFA 4W4OC 3KPOA 1GNYA 4LASH 1I3UA 3HI6H 3GYCA 5MEOA 1M7DB 1B1YA 1RJLB 1RULL 4MMXC 2QR0B 2WNWA 3PG2A 1FZJB 1ZHKB 2PR4H 2HG5A 1DVFD 3OGOE 3VDHA 5F6IC 2VXTL 2JEQA 5E00B 2WO2A 1I1WA 2DM2A 1R3JB 3CMOL 4XWOD 3BAIA 4YDLC 1HP5A 4D9QD 1MJ7L 4FQIL 4CVZB 3E6FB 2R0WL 4YE4L 2H1PL 1PQZA 1IVLA 5GZND 3U2SB 4U1MA 4YHNA 1FGNH 4RA3A 1WBYB 1SJXA 4U1HB 3MLRL 4YC2C 4L4TB 4OF6A 3RHWK 4HOXA 4KDWA 4PJGE 2MCG1 1NPUA 5DMGC 5C0FB 3CK0H 1HYSC 1ZJAA 2OXGA 1QOXA 2E27H 4UNVA 4CU8A 4ZE4A 1DEDA 1S78D 4KTDL 1U91A 1IGYA 4AYFA 4HC1L 4X7SL 4WHTB 1NWRA 2Y9RT 1NFDB 3C7OA 4U1LB 3HC4L 1HHJA 2PNDA 5ETUA 1WLHA 5D7LA 1OT2A 5T5NF 2QMJA 4NO2B 1QI4A 3ZR6A 1I4FA 1MI5B 3GSWB 3U2SA 3T1WA 1P84K 2VDOL 4CD8A 3IDJA 2L7UA 3ARYA 3VXNB 4BSVA 4D9QE 4Z7UB 5F89A 2DTSA 3IDNA 4JFEA 1HE7A 2ZX7A 1TCMA 2WUBH 4PY8J 4J3TA 2HJFA 4JCLA 2WVVA 1QPXA 2WQRA 4XCYA 1P1ZA 2XA3A 1PSKH 4AD3A 5JXHA 4AH2B 4WI3A 3B83A 2NY6B 1XD0A 3O6LH 5FYJD 3EJZC 3NNGA 3RZCB 3EO9L 2CLZB 4Q9RH 5JDJA 1BP3B 1P4LB 4RFOL 4HUVA 5D9PA 5AAMA 3DXAB 3CZLA 4KRMB 1RFDH 4ODTL 2I07A 3B9VA 3NJXA 1P9MC 4M7LL 3BH8A 4R3SB 3BWAB 3VGHA 1MHEB 1HVQA 5IYYA 2XWJA 3LN9A 2J1SA 1UWEL 1QBML 4R5EA 1SG3A 1KBBA 5D7JB 4UILH 4XMPH 2GAZA 5ITFA 1ZS8B 2EDDA 3FOMB 4Q0XL 4YHZL 2WAGA 1VJSA 1P1ZB 1A1MB 1NGZA 4GBXB 4KVNL 3QHZH 3VXUD 4K3EH 5H37H 2WN2A 1PY9A 3KVQA 5EUOA 5FK9A 3F5KA 3EGSB 1KGYA 4B15A 1KT2A 1W0VB 2DQDH 2CCRA 4HEME 4RFOH 1GHFL 8FABB 1QR1B 2KD7A 5A6BA 2NQCA 2W9EL 1MFBH 3W9EB 5TQ2H 2WVSA 1AO7A 4GRLC 4G9DA 1T1ZA 2VLKD 1CK0H 3WNOA 4GAFB 1JHKL 2AV7A 4DN4H 3DSFL 2Y5TA 3DECA 3BH8B 4R3SA 5FUZH 3BAWA 4E2OA 4OD3L 1I1XA 4MNMA 3RJXA 1UWEH 3LE0A