2VZUA

Complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSAFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNANAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 277
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzuA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzuA03
1E71M 2ADJA 2XYLA 5BVPL 2BNQA 1T7YA 4QTIL 2IUZA 1OTSD 3RM4A 3EJZD 1MELA 5JHDB 2VJXA 7A3HA 3G08A 2YMXL 4UINH 4JG0L 1X5ZA 3MMEA 4QCFA 5T33H 2VQ1A 3RNQA 1PG7L 4ETYA 5AD0B 3MACL 1FZMA 1WEJH 5ABDE 2A74B 2QADB 5DD6B 3C9NA 3ACIA 3LKOB 3RY4A 5CLWA 5FKYA 4X6DE 1HYSC 1TMQA 3QG6A 2Z8RA 3D2UB 1Q9LA 2QLVB 2P7TA 1U92A 4R7DB 4H25B 5EUOA 2WHMA 4HV8B 1AP2B 1CLZL 1F90H 1XEDA 1NGWB 2IAND 4OTXL 3U2SA 2WZ8A 1UR9A 3KYMA 4K3DH 4YQXL 1YHTA 2YPVL 1WZLA 4ET7A 3G6JF 1G6RB 4QHMB 1QKZL 4G3YH 2X4OB 2M26A 3F7PC 3FRPG 3GKWL 4MXVE 2F54A 5F9DC 3M07A 1JZ6A 3STBA 1UCBH 4AH2A 2NZIA 4RMWA 3TESA 4YXKL 1PG7W 4M62H 5T5NF 4HBCL 3L5HA 3O8XD 3AYRA 2YKKA 1A7PH 5CHNB 5D6DC 3BH9B 4JR9L 3SGDH 2PETA 3O3DB 4XP9H 5C0GA 4NI3A 4PTTA 3O3AA 1F6AB 5BRZE 3SEPA 4WSJA 1QHOA 4I48B 3B5TA 3L3GB 3EAKA 1GGIH 4WW1B 4Y5YC 4KK9D 4YWGL 1AO7B 3DGCR 1Q94A 4L8DA 4GQRA 4M02A 3LEIA 3P9WB 4D6JA 2X4TB 4LGPB 3UC0L 2CLVB 1J05A 3BO8B 4KJQC 4Z0XB 4CD5A 1AGFB 5ADOL 3MGOB 1UXWB 4EDWH 3LY6A 4W8LA 2UV3A 5F96H 4YHOH 5EOQL 5DVKA 1YA5A 5KVGH 4WF7A 2OL3H 2ORXA 2W0KA 1WT5C 1AE6H 1ZEAL 5I9QB 5HYFA 5GS0L 5LWYL 4K3GA 4LSVH 3REWA 1FO0A 4QXUL 5DUBB 2BNRA 2XONA 5IVXA 3L9RB 3FN3A 1CLOH 3CXHJ 3FQXA 3T0EB 2HFTA 3SGJA 4D9RD 1IV8A 2CIIB 3ARDB 3G5YA 4CJ0A 3L4ZA 3IFNH 1TMCB 1KF9B 2YSSA 2G9HA 3O6KL 4JDZB 3AXHA 1U8NB 2NPLX 3C2AH 1D3CA 4UNTA 1OBAA 2BVYA 2CBUA 3SKMA 3M6DA 2WBKA 2Y2WA 1EJ6A 1QFUH 2F8OA 4YDVA 4YDJB 3RJYA 1IJ9A 4FQXA 1GUIA 1UA3A 1I85C 1UA7A 3VJ6A 1XSIA 1N2RA 3MLTB 1CPUA 4P4RA 1BGGA 5TD4A 1QSEA 3STLA 1K9TA 3D0VB 3D48R 4CVXA 2X44D 1DWIM 5L88L 4NC1E 1TZHB 1OSEA 2VXVH 1INEL 4YHYC 2K9UA 1UWTA 3WDRA 2Y9RT 1SYSB 5EFDA 4N8VB 4PBVC 5J13C 4BQ3A 4KC3B 3ZHDA 1B30A 3PV6A 1U8JB 2GHWB 4YK4C 3BH8A 1MLCA 3KJ4B 2WC7A 4HMCA 1BG4A 3WIFB 4OV6F 1S9WA 3L3HA 3HJRA 3DETD 4L4VD 1FDLH 4NO5A 3TO4B 5IR1A 1ISZA 5IM7A 5D1XB 1OD0A 4WO4B 1NQ6A 3QFJB 3SGJC 1DDHA 4M6OL 3MV9A 4W5ZA 3DVGB 3P9LA 1RIVL 1KJ3H 1R5VA 5FGRA 3UXFA 5FUOL 3MV8A 2JJTC 2C7UA 1CFQA 4JY5L 2PTUA 3CVIL 4JRWA 1QPPA 4OZIE 3UJTH 4Z7UB 1FAIL 1YY9C 4FQXC 1QNOA 4TNWK 1ONQA 1S5IL 3RWGA 1A4JA 2RVAA 4GRLB 5FECA 2UY5A 4PUEA 1RUAH 1G9NH 3MV01 3LEYL 1IFHL 3WH6A 3KS0H 1XGQA 4FN0A 4M7LL 4ODBD 5E0CA 1EHLH 1GORA 1D5ZA 1K6QL 2DQJL 3ZKXC 1D7FA 1FN4A 4JFFB 1JYNA 1CTNA 5IEHA 1F6FB 4XVJL 3F6IA 5TF1H 4U7KA 1DBAH 4D6EA 1Z5LA 2VE6A 5A6JA 3U30C 1SVCP 4XXCC 3GSNB 4UAPA 2KQMA 1JV5A 1VFUA 1A8JH 1MHHB 1HJVA 5CJBA 5FHAL 3SCVA 1ZV5A 2DL9A 1RP8A 1XH3B 1YMMB 3ZMRA 4RRPA 3VU2A 4NKMA 3T65A 5KSAB 5DSCA 3PZUA 3RKDD 2W0PA 3MUY1 3ZKND 4R9HA 3WFCH 3MKKA 2FDMA 3VWKA 3T77A 2FGLA 4HWZB 5C7XH 2VDQH 4WUUA 2Y72A 3QIWD 3DX6A 1RFDL 2XXMB 3H9YA 4AZ8A 4QRPA 3KXFA 4Z7VE 4JGJA 4X6EA 3MRJB 4WU5A 3GI9L 2NY3B 5DJ8B 1UWIA 3CJJA 1W9UA 4PV8B 3EYVA 1Q0XH 3HS0A 1TA3A 1DVFB 4N5UA 4G6JH 3GO1H 1O7SA 3HHRB 1CLVA 4X4XA 3KYKL 1GOOA 3RJXA 1Z9SA 1P7HL 3DXAD 3TBTB 1KIPB 2DTSA 1KWKA 1YEDB 5CJXA 1FVEB 1R86A 1NL0L 3UBXB 2J7GA 1QW8A 4M03A 2YD1A 1MFNA 1ZE3C 4CVZB 2NX5E 1A3LH 5GGUB 2PN5A 5LGHH 3QAZC 1N3NA 3QISA 1WFUA 3U6RA 3IJYA 3QHZH 3L6FB 1NBQA 4I18C 1MFBH 2DLTA 2BSTB 2VO5A 4PGCB 3DMMB 5ESQA 1H5BB 1EEZA 1Y0LB 4BZ1L 2D23A 3F65A 4PCTA 3ZJ8A 3QDGD 1D7PM 4BJLA 5FF6B 5GS1A 1MW1A 5E1HB 1JTOA 1FZOB 5BV7H 1IGFL 2DQDL 3CPLB 3F2ZA 4N0CD 2BOBA 5E8DL 3JWOC 3X3GH 5JW5A 1D5IH 5MENE 4ZNCD 1CQKA 3A23A 4FP8H 4QXTA 4UFMA 3A0OA 1WQVT 3FQUA 5EC2B 2Y8KA 4A3YA 3R4DA 3PWUA 4TSCL 2QSTA 1MFAH 3MRCA 5ICYB 1AKJB 1KCSH 2IPTL 1NJ9B 5BMFL 2GJXA 3BSHA 5D2LF 5CJXC 1T89A 4Y4KA 4WFEE 3QCVL 2J47A 2FECI 4OCYH 5T3XD 1NPUA 4MD4A 2P24A 4CADB 3G04A 5TF0A 1UY0A 1EEYA 3MRFA 5F6HJ 4ZTPL 1LEGA 5F9JB 3ULVE 4OCXH 1A1OB 1NCDH 3DRTA 5F9OL 4CUCA 1JE6A 3UTPD 5AYQA 4RX4D 1K85A 5EN2B 2N56A 4XHQA 2DSKA 1HHHB 3QWRD 4PJEF 4EI5B 4A6YB 1OD3A 4XCFL 4ACZB 2WWDA 2B5IB 1ZLWH 4PJFF 5F1IB 4J3TA 2V5CA 2XVPA 43C9B 2ORBL 2NY1D 5EU6B 1LO0H 4L3EE 4PCSA 4HUUB 5HJ3A 2DBJA 4XCCH 4ZAKD 1HWGB 4PV9B 4D9LH 3DUSB 4ZFOL 4AIZA 1JHLL 2BSRB 2UY2A 2JELL 4K7PY 2UY6A 2XWTB 1GPOH 1WWWX 4J8RA 3HMXL 5DQJB 3RTQB 3OHXB 5I66A 3GBDA 1EO8L 2XOTA 5AZ2L 2M2DA 5HXMA 5EBAA 1VACB 2NXYC 3BVNB 3LEXB 3P4NA 4R26L 3NACL 4U33A 2P8LA 3P73B 4TVPE 4PTVA 3C08L 1LO4H 2W92A 4I77L 2ICWI 4MNLA 4KJPC 2C3XA 4XC1L 3QPXL 2XI9A 3WNLA 2WBJA 4PD4K 2FCBA 3MS8A 1IAMA 3DBXA 3S36L 2GAZA 3HI5L 5E7BA 5A8OA 2EECA 3LKQB 4W5UA 1A0QL 3S98A 4WFHE 3HE7C 1WIOA 4PMXA 5IKCB 2YD8A 4MA7L 3VGBA 1RUPH 4DM2A 4P2RE 4WSKA 3TNMB 1FQ9C 1EGZA 3OR7B 4LDOB 1U95B 2ZSVA 1OSZB 3BQUB 3CZFA 4PJIB 4UINL 5IHLB 4N9OB 4GAJL 3FB6A 5T33L 5KSVA 3RVVC 4G42A 3N11A 4G9FB 5CEYA 1S9KC 4HH9A 4NQXB 3KPPA 2NY0B 3Q5OA 4HIJB 1KEGH 1WEJL 2VXQH 3REVB 3EBVA 2YRPA 2HFFB 3S5LB 5CPTA 2QQOA 4Z9KB 3GM0A 5ISZB 3AXXA 3PHQA 1G7QA 5GSVB 3HNTH 2UVEA 2GTWA 4HT1H 1F90L 4LPLA 3KPLA 4K3DL 3IXAB 1X4XA 2PYEA 4Z2GA 2IMNA 3PGDA 2NY5C 4G3YL 3EHBD 3W6LA 2WBJC 5I1AB 1PY4A 1CECA 4X99A 1YYLH 1QLRB 4F33B 3ZE0F 5I23A 2J25A 1SJEB 1UCBL 1OGBA 2YC1B 4IDJH 1T2XA 1YN6B 2ARWA 1UR2A 2VX5A 3NA9H 1TUXA 3RWJB 2VAAB 3CKHA 1ZHNB 2CR6A 3F12B 1JHJA 1OAXL 3VFNA 2RJ2A 5IBTH 1CBGA 3VFWB 1MXGA 1GHRA 2H32A 1A7PL 3KLDA 3UAJC 1JRHI 2ZUWA 5B39G 5DEZA 3RPMA 2YPKB 5HHQB 4QDRA 4HIEA 1KIRA 4XP9L 1LD9B 3OR6B 2ITDB 1MWAL 1NANH 1GC1C 4NN6C 1GGIL 4YO0A 1RAMA 4PJGE 3EMZA 1RJCA 3RDTA 1JN6B 5CEZE 2VL4A 5CD3B 5KN5B 2PR4H 4P7OA 1LP9B 1YEEH 2A6IB 3DOSA 4PMDA 2BVTA 1W0NA 3WN5B 3QQ3A 1HQRA 2LU7A 4PJCF 5EC1A 4EDWL 3JV0A 1QFOA 3VWJD 4YHOL 3WF0A 1HHGB 1I3RB 4U6XA 5KVGL 1RUKH 1DWGM 2OL3L 1V6XA 2PBGA 4RGNE 4OB5H 5HGDB 4PJ5E 1NOWA 1BVZA 3ME0A 2B8OT 4LSVL 1MCQA 4XI5D 1GGBH 2BNQD 5E4EB 4P2OA 1CLOL 5CSBA 5DMJB 4K71C 1G7LB 5JO5A 3FRPA 4RSVA 4KROD 3NTCH 2ORZA 1A6WH 3TBWA 3B83A 2D9CA 3IFNL 5K9QI 3CBWA 2VLJA 4J3SA 4X7SH 4EOWH 3C2AL 1GGCH 1I7UB 3D39B 2A6JA 1QFUL 3GJFA 5HGAA 1F8TH 3BIBX 3BAJA 2VC9A 4Z5RA 1AHWA 1RZ8B 1X5LA 4DZBB 1IEHA 4Y5XB 2OQJB 1HJQA 4RIRA 3WD3A 4HIIB 2WQ8A 3G6JA 3O81A 2CHNA 3U0PA 1E0OB 4P2QD 2XZZA 1Z3GH 2WMKA 1EEQA 2VXVL 4JANB 4L29A 3B4NA 3MBED 5C0BE 4NOBA 1LO3H 2XVNA 1BFSA 1PY9A 4DKAA 1X7QB 2IEPA 1CTOA 3BZDA 3SUWA 5DJAA 4OAWB 3WS3B 1JZ8A 3RVTC 5DI8A 1MI5E 4XBGB 3BAEH 2OTWA 5I17B 1FDLL 3QXUA 1US2A 2Y64A 4WKFA 4PYSA 4P2OC 1J0HA 2EEXA 1NWUA 5B3JE 3BPNB 1VADB 3WFEH 5F44A 1JWMA 5CSUA 4NO3B 1KYOK 1KJ3L 3BW9B 3ULVH 1OM0A 4MD5A 1HJSA 3HPLA 1F45A 3APGA 2D31B 3JWDL 4UU9B 1R3HA 1GU3A 4EUPA 3VMOA 1YUHA 3UJTL 5L2KA 3RWEB 1EJOH 3CDFA 1ZU8A 2PCPA 1GQJA 5CAYB 2PXYB 3VMNA 1TENA 5D1QD 3CCHA 1G9NL 5J9PA 3AIWA 4A3HA 2IAMA 3BKYH 1E1FA 3MODH 1QI4A 3VFMB 2D1ZA 3SDCD 1EHLL 3QUMH 4W88A 5DMKA 1MFUA 1M05A 1KJ2H 1JGEA 1XZ0B 3RVWC 4QXWA 1DBAL 4Y2OA 1NUFA 3BRGC 3KWXA 4WU7A 4JFWA 3NA4A 4ZXBA 4WCYH 3B5HA 1XC6A 1AD9B 1MQKH 2HLFC 3FW6A 2EDNA 3LV3B 1YECH 4YBQC 1S5HA 4ATLA 4U7SA 3WQ6A 3MANA 5FDYA 1XYZA 3OMZA 1UWSA 1H3VA 3SDYH 2QPUA 5EU3B 2IH3A 4ZOBA 4BQ6A 3WFCL 4R4BA 3I3DA 5CBEB 2W67A 5T1KA 4EANA 3HZVA 2D0GA 2VDQL 1HKFA 5E95B 2CERA 3UTTD 4PTUB 3JTTA 5HPCA 4MSWB 3C7HA 1T0MA 4OI9A 1FIGH 2PW2B 2J8UB 1WAWA 3DUUB 1MW2A 1XT5A 1FHDA 2RJMA 4E8CA 1OB1A 1Q0XL 2IAMC 5HPMB 3ECBA 2KH2B 4PRHB 4NM4H 4P7QA 5JQHC 4G6JL 5EPMB 4MAYA 3GO1L 1VPOH 2CKBA 5FV2A 5HHNA 1WUNT 2YPLE 5B38A 2VMEA 1R24B 3LRGA 3K46A 1MCEA 5HD8C 4KHTH 2WAGA 4U0RC 1KXTA 1JHKH 3K1DA 2DSUA 3HZKA 3WLWC 4LCYB 1HJWA 4WGVB 2CDPA 1EERB 1OWWA 5F7HA 1A3LL 1JGDB 5LGHL 4Y4HA 4ZXBC 3QRGH 1UX7A 2XIBA 1KGYA 3QHZL 4NN5C 3VXSB 4XAWH 5IMLB 4HLZH 2GDVA 1MFBL 1ZA6A 2Q3AA 3BN3B 2O93L 2O26U 5GNXA 4FS0A 5FO9A 4IRZH 5C0AD 3MUGA 4M1CD 1I5PA 1AH1A 1M71A 1LE9B 1X4YA 1TJHH 2WSPA 3CUIA 4K3HA 2PW1A 5FYJH 1QO3B 4OLVH 4ENEC 3CFKB 2VCAA 2Z92A 1HP5A 3X3GL 1D5IL 2EE9A 3OLIA 1E0WA 4FP8L 4AG4A 1KIUA 2EQDA 1KLGA 1U8MB 3WE6A 4LDEB 4ZUSB 3B9VA 1CI5A 1AQMA 4MAYC 5CEZH 3L4UA 3B2VH 4AIOA 3ROOB 1Q0YH 1MFAL 1KCSL 1UZ8B 4YHIA 1JPFA 3DSNA 2JDAA 2WPGA 1T5XB 4JHAL 4PRNA 3VWKD 3I6GA 5GS3A 4QRRA 3FHQA 3HI6H 5BVJA 3QO0B 5D7IF 2BXYA 1GMMA 3VIGA 4OCYL 5BXPA 1DBBH 3QUKB 4RZCB 3W29A 3MCKA 4Y4HC 4ZNEE 1PEWA 4IRSA 2XVGA 4HZLB 4K7FB 3UTSB 4OCXL 1IGJA 1NCDL 4ZOCA 4B53A 3B3IB 3H3BC 2NZ9D 1MAJA 3VFUA 1CXIA 1E0VA 1JWSB 3CLEH 4JFHE 4HUWB 3K4AA 4W84A 3MRQA 3QQNA 3T3PE 3TT3H 4ACPA 3VOCA 2ZIDA 1QR1A 2XKSA 4EDXB 4PMQA 4P3CH 2IADA 4NC0B 5DO2C 4DUWA 2QADC 3DYOA 5E6IA 4KKCC 1LO0L 4O4YH 5AY7A 4KRUA 5DRNB 1HILB 4XCCL 3ZDYF 3ARXA 1XV8A 4D9LL 2YRZA 4WNQA 2HLAA 1P4BH 1GPOL 1OLZA 1ZLWK 3LD8C 5JHLH 4MJIB 2X4NB 2J3SA 5I8OH 1Y7VA 4XCEA 1I9RH 3P4OA 4K8RD 1RPQA 2CDOA 2F5BL 2OYMA 1LO4L 4P5TB 3NCBB 3P30H 4WV1A 3C8KA 5H94B 1TVBA 3AMLA 5D6CA 3SDDD 1PZ2A 1KGUA 4IRSC 1WC7B 3S4SG 4P8VA 4ZUUA 1IAIH 4RFEB 1AXIB 4ZS6D 1TVHA 1MH5B 5D2LA 3OSKA 3AZRA 4MXWH 3QH3A 1YMHA 1IGYB 1BOGA 3POHA 4U1NB 4XGZA 2XQXA 1RUPL 4Y4KD 1C5CH 2EXYC 3OGOE 5DXWA 4P7NA 4X80H 3ALWA 4LAJH 1UZ6F 4L9LA 1S7UB 2EDRA 5HHOE 2E9MA 2E8ZA 2WWMC 2PF6A 5FO8A 5I9QC 1AR1D 1FP8A 3VI4E 3PDDA 2DD8H 1WGOA 1KEGL 4BF7A 4HZ6A 2VXQL 3QEQE 1CYGA 5MHSE 2P5WB 3P0VH 4Z2AA 3HAEG 1UD6A 2UY7A 1U8PA 3TFKC 3EDKA 3WEXA 3HNTL 5A6AA 3TIDB 4HT1L 2GK0B 5E08H 3FQWA 4JPKH 2PWEA 4IOIB 3TBYB 3T3ME 3WXVH 1LE5A 2J77A 2Y6KA 1KENH 4PJFA 4WV1C 3U4BH 5GZOC 2X2YA 1DE4A 43CAB 3RM9A 1T20B 1DBMH 3IETA 1WP6A 1ZT1B 1YYLL 5C0EA 5AEAA 3LKNA 5ESAB 4IDJL 2XKNA 3MFFA 4JKMA 3NA9L 4PPTA 3X17A 4LHQB 1HF6A 4B15A 4AD0A 5IBTL 5SWZD 2V2TB 2ZX5A 3CK0H 2C8NA 4HJJH 2DT2A 5J3HC 3OG6B 1H09A 4F2MA 4KDWA 3DIFA 4GKZB 4G7YH 4OZGB 5BWFA 1VGEH 1IMHC 2KPNA 5IVZB 4TSAL 1PIFA 2QR0A 1TE1A 2W0FB 2VX6A 5F1NA 5IW1A 2OLHA 4Y1AB 2FJGB 2PR4L 3KJ4C 1BP3B 1YEEL 3OJVC 1LK2A 4XUOA 1RY7B 3TV3H 3ETBF 3BISA 2HVJB 1GOWA 2FRGP 4YX2H 2Q7YA 5D1XC 4DN4H 1JYWA 4ATWA 3QHOA 1RUKL 1YN7A 2JCCF 4HWNA 1OGAD 1S3KH 1GOQA 4Z77B 2F54E 4DGVH 4OB5L 2V5SA 3FN0H 5FV1L 3VIHA 3MGTB 1GGBL 3HKFA 2YG0A 3SEEA 5E94A 2VH5H 3R0MA 4YHMH 2BCKB 1BPLB 3F7VB 1A6WL 4KTEH 4LKCA 4PRPA 4U05A 2EEBA 4YHZH 3QWOA 4RFNC 4HZ7A 2GCYA 4H88H 2PC8A 4X7SL 4EOWL 2XICA 3M8OH 1S9XA 1W0WA 5FB8B 1GGCL 3NIYA 1FSKC 5GGTA 2BY0A 3PWVB 4TUKH 1HHIA 2GSIB 5B39A 3C7FA 2NY2D 1MHPH 3SCMD 1HK6A 1OF3A 4UFHA 4AM0A 3VMPA 5LAXA 4XZUB 3ARGA 1VERA 4FA8A 2VDOH 2W59A 4JQXA 5DQ9B 4C56B 1EEUA 5BOPA 3W4RA 3TBVB 2GJZB 5HVHB 4QT5A 2FJHB 1Z3GL 3HZYB 1HDMB 2Z91A 2BNRE 5IVXE 4JHBA 4P5KA 4GXUM 1DL7H 5GQBA 1ERNA 1NAMA 1NKGA 4W87A 3VRLE 1LO3L 3RWDA 3FY1A 1E5JA 2MMXA 4QHUA 3BZEA 4LQRA 5KBNC 3LN4B 1H49A 5KSAC 3SJVA 5EB9A 1D5BB 4ZSOA 3X14A 3BAEL 4XB7A 2EDXA 3AREB 2UY3A 4KRMB 4Q9BA 1KGXA 3WIHA 1BQHB 2KD7A 1VA9A 4QRUB 4ELKB 1JFXA 2G60H 3NIGF 1Q9KA 3BAKA 4W68A 3WFEL 2EZ0D 3WO4B 4OV5B 1HYRC 4Z6AT 3QNZA 3ULVL 5DYOA 5DS8A 4JAMA 1QSEE 5JXJA 3GMNA 4PJCA 2GY5A 1PAMA 5C0DB 1EOKA 3QPQD 3GEWB 3RGHA 1DVFC 1FNEA 2ZG3A 1BVLA 1U58A 5D9MA 3AIBA 3ARGC 1MQQA 5K9KA 1F4HA 3DHMA 4JQXC 3BKYL 1U0QA 3MODL 3S7GA 4A4AA 1UHVA 5E00A 3DHPA 1QLFB 1CFNA 3G5VA 4I0PC 3OGCA 3QUML 1W0VA 2YD6A 2CDEA 4CNIB 1KJ2L 2HN7A 1FE8H 2XY2A 1RZKH 2WNGA 3EO0A 2GK1B 3GMLB 3MV9E 4GAGH 4MNGE 1ZBVA 3DMMC 1H5BC 1JU3A 4JO2H 4K3JH 3KPNB 4WCYL 1ZS2A 4BQ2A 3EO1A 1MQKL 1KCRH 3T2QA 1DFBH 2DWDA 4NN7C 3KPRE 4OLWH 1KLUA 2XN9E 3SDYL 3CDCA 3PE9A 2V5DA 5EO9B 4EN3D 2QBXA 2WMIA 3OZOA 3MLWH 3O11B 4S3JA 4KAQH 2WUBH 4K94H 4M7ZC 5F6IC 1WLHA 3CGTA 2WMHA 2OYLA 2WYSA 3IAPA 4M8VA 1FIGL 1INDL 2EIEA 3MNVB 3BAXA 4G8GD 3AYSA 5ABGA 3VXOA 2KDGA 3L5IA 4AIEA 1JGLH 4FMKA 1AR2A 1NCWH 4NM4L 5F7KC 4EXPX 4BXSV 2J8GA 1LG2A 1VPOL 3OWEA 1J86A 2G5BA 3L4WA 4P8WA 3QDJB 4QRQA 3GNMH 3O4LB 1Q9OB 5EIQA 4KHTL 4OM0H 3PDOB 5FA3B 1JHKL 2WZPD 3VXTA 4AEHH 3GMMA 4RQQA 2GSGB 4UQBA 5GJSH 2Y36H 1L0YA 2W1UA 1WITA 3SY0B 3OJMB 5CKGA 3QRGL 2J88H 4MGQA 1UY4A 4XAWL 4U1JB 4EI5C 1RPKA 4H26A 3BXNB 3CLWA 5CP3H 3L7EA 1ZT4A 4HW6A 3ZE1E 1X6NA 3FT2B 3KXFE 5KS9B 4ORZC 4V2BA 2B1HH 4A2LA 2LTQC 4NO2A 4IRZL 4UDTB 2OR8A 4X9GA 4NSKB 5E9DD 3U4EB 3AAZA 4KUZH 5FYJL 1G7IB 4OLVL 3UYPA 3RZCD 1UYZA 2E9LA 4JL1A 1SDDB 4PREA 1TXKA 4XUNA 2Z31B 1XIWB 4ARYA 3GFUA 4M5YH 4R3SB 1U3HB 3QO1A 3RTQC 4HKJA 1E6OH 4WGWB 2WN3A 2J7FA 1A3QA 5JBEA 1IQDA 1K4CB 4XWOC 1EHXA 3FZUD 5B4NA 2P5ED 1XFPA 4X6FA 4MWFA 4PJDB 5CEZL 3B2VL 4DXRA 1UQSB 4ZFOB 1Q0YL 2CDFA 4GG6F 4E5XB 4X9YA 1GZJA 3A21A 3HI6L 1ZGLA 1UM5H 4QCIA 1E4JA 1G9HA 1PIGA 1YNKH 1C16B 5T1LA 3BP6B 5LA0A 4D71A 1L9NA 3WFZA 3ULUC 3H9ZA 5BQ7A 2Z9TA 4B3KA 2JIWA 4K23H 3N04A 2AAAA 1CZTA 1C8QA 3VXRB 3BRDA 3QDAA 2VL5A 5T1DH 3BGMA 3BZFA 4MMZC 3CLEL 3MUIA 3BQUC 2CKRA 3IDUA 3TT3L 2AJUH 2EE2A 4WKAA 3RDKA 3RA7H 4XBPA 2C1OA 4P9HH 2YD3A 15C8H 1OAYH 4N0RA 3TCLA 2NY0C 2VKXA 2Z0BA 4HGWB 4WJ5B 3B9DA 5MEPB 1ISWA 1ORQA 2ZSWA 4P3CL 2P43B 3O41B 5ANMA 1QNZL 4O4YL 3EIFA 1LWRA 4P0DA 5TDOB 1IQDC 3A6OA 3MRMA 4FFVD 3TZVA 4EBQH 4TVPD 5DK0A 5JDSB 1JAEA 1N5AA 3PTQA 1P4BL 1FO0H 2MKLC 3BC9A 2AP2A 3L2LA 1CXKA 3IKKA 4HDIB 2NW2B 3WFBH 5JHLL 3VD3A 5I8OL 3MV7E 1J8HB 5HHXH 4M9OA 1I9RL 4PRWA 3UJIH 1KT2B 1EXUB 3V5DA 2R0LH 3P30L 1UEMA 1ULOA 2D7QA 4E42A 4NNXA 3CQOA 1DANU 1KC5H 1PJ9A 3RU8H 2VB5A 1NC2A 4FTVA 4W8BA 2FO4A 3RL2B 4LCWB 4Z7QE 4HHAB 1IAIL 3QUZD 3TT1H 1CFVH 4G43B 4XRCA 4OFYA 2EXOA 4IJ3B 4ZPTA 4MXWL 4ZFFB 5D7IA 4QRRD 4F66A 3VD4A 1MAKA 3N1FC 3MUHL 1CL7I 5SX4H 3GNRA 4YFDB 4X80L 1NFIA 5JNYA 1OW0C 5ECJE 2B2XH 4PBXA 4OLZH 2R2HB 3EBAA 5IB4A 2FGZA 4YAQA 3DHUA 3MUAA 2VISA 4JFOA 3TZVC 3KZSA 2DD8L 4JHWH 2XFRA 3IGAB 4JZNB 5CGYC 2P42B 2MWCA 5EO1A 3P0VL 1P4LA 1G1YA 2FZ3B 4HJ0D 5DJDA 2CD0A 1E6RA 4ZFZA 2Z8VC 1J1XH 4M81A 5IIEB 2PO6B 3TJEH 2NXZD 2OL3B 2R23B 4XURA 3WCYA 1OPGH 1D5MA 5E08L 4JPKL 1W9TA 1QFPA 1KENL 3U4BL 3LS4H 1EAPB 3VI3E 1MREH 1S78C 3WH7A 3S4SA 1DBML 1KN2H 2F2HA 1WWCA 4ZENA 4NQSB 4D6IA 2X1WL 3LPWA 4Y5XC 2CRZA 3GMOB 3S37H 4LCCB 1EPFA 5I0ZA 1CLYH 1KELH 1YEJH 2WK2A 4WY7H 1CLCA 3CK0L 4FXKB 4HPGA 4HJJL 2DLFH 2VLKD 3W0KA 3OX8B 4G7YL 4JJ5A 1P6WA 1VGEL 1OSPH 3GZKA 3HUJB 3CIQA 5TDPA 4OCNC 2B4KA 3TV3L 1DCLA 3HAEA 4JHOA 4KI1A 2EDBA 4YX2L 4OFDA 3VGAB 1K2DB 2HH0L 3FONB 1NUNB 4ZMAT 4KXZI 4L4TB 5DTFA 5BW7A 2GEEA 5F7UA 1S3KL 4YHKH 1T22B 5J11B 3QBTB 4DGVL 2XUCA 2MOVA 2R69H 3FN0L 4ONOA 3RY6A 3RIFF 3Q0HA 4BH7B 1U3JA 3TLRA 4U1KA 1UKQA 3I6KB 3GSQB 3MOQA 4LHUG 4R0LA 2VH5L 4AEIH 4YHML 1RP9A 4GUPA 1MCRA 2J7BA 3C6LB 4YBLB 4KTEL 5DRWB 3TA3B 4YHZL 4OD2B 1XF2A 3QNYB 3PZIA 1U36A 1E6ZA 1A9EA 4F9DA 3M8OL 3JWOH 2N7AA 4HWBA 4TUKL 1R3JA 1MHPL 2O61A 1Z9OA 3DURB 2H6PB 1T1YB 1V3JA 2BZDA 3OAUH 1F3DJ 3VIJA 1K12A 1KTDB 3K80A 4RAVA 2VDOL 4WWID 4PJXB 1A6AA 1P84K 5C08E 5C0BD 5JPNB 4QX0A 3BCDA 3BUYA 4U1HB 4QGTA 2J1AA 1WSST 5IJVA 2BVOB 4N0UE 3RX8A 2W1QA 1HJXA 5ABFB 1NEZB 1DL7L 4BQCA 3PQYA 1DQTA 2WM0A 5DHYA 2VLLA 2FBJH 1TG7A 1TVDA 3SOBH 4U1SA 5BW7C 4TX8A 2VLJE 4KRPB 5ACMA 3C60B 4MJ5A 2FWOB 3W9EA 5JW4M 4POZD 3PDGA 3M17A 2V6HA 2RFXA 2D0HA 3VTRA 1MLBA 2J7DA 2XV6B 3ZO0A 4LAQH 3UTZA 2G60L 1E72M 3MLZH 1WDSA 3QA3A 4JRYB 4NKIH 3ARFA 3DGGB 3VDHA 3AIRA 5DJZB 5F8QC 1V05A 3A6CH 3G6JE 4PRAA 5C07D 3KPQA 3IU4H 4X6CF 2G41A 5HI5D 3QHMA 2JCCA 3OKOB 2B31A 3CUPB 2YL8A 3CFDB 4PG9A 3RIAF 2PTTB 4AY0A 4BFBD 3EMQA 4F37F 1FFOA 3BAIA 4K07A 2BHZA 2HJKA 3F4VA 4B7IA 5E5MA 2IQ9H 5J1AB 4RCAA 4PLJD 1AVAA 3MOBH 3ALFA 1FE8L 3O0RH 1RVFH 3JTSA 1RZKL 4EIGB 3SIMA 5JDJA 3W5NA 1B0GB 2A77H 4WFGD 4GAGL 5IBLC 3EYQC 5DEGB 3O6MH 3GSWB 2BSSB 3RGVD 4PJHF 1YEKH 4JO2L 1A6TB 4K3JL 1A6PA 4NYLA 3N06B 5IB2B 3WSOA 1D6EB 3UMTA 1KCRL 1DFBL 1A64A 1YEGH 1I9JH 5L2KE 1XH1A 4OLWL 3U9UA 4LHJB 2AXHA 4XNMA 1D6VH 3QUYD 5DD3H 2EE3A 2P1YA 3ARFC 3MLWL 4PJ7F 2ZUUA 3ULSB 4KAQL 2WUBL 4K94L 3VXUD 5K9QG 4CCEA 4HG6B 4C58B 1RZ7L 4OGAC 5H35B 3A22A 1SFSA 3IANA 3QIBD 3BDYH 3OKYA 2Y5TB 8FABA 5BV7B 5D7LD 2KZWA 1EBPA 3IAQA 1BQLH 4DVBA 4OUUB 1NCUA 1JGLL 1NDGA 5IBUB 1NCWL 3S36X 1P7QD 5DURD 5BRZB 3BLKA 5CILH 3LMYA 2HTKC 3VNZA 1CZ8L 2F74B 2OWCA 4LYRA 3UG5A 4BSJA 3U7AA 4PP1C 3GNML 4I5BB 5GXBB 4WKHA 4RNRA 4OM0L 3G6DL 3MMWA 4AEHL 4N90E 3NFPB 4NHUB 5DK3A 1AQ0A 2NY5H 5ACZB 2XACC 5GJSL 2Y36L 4O51B 2VKWA 4BUGA 3T1WA 2E4TA 4C4KO 3PJSA 3IJ8A 4HS6A 2OK0H 2V3DA 4NKDA 1T1ZB 4WJXA 3PF2A 4BSWA 5HYSG 4NSBA 2VZQA 4U1MA 2F9BT 2CITA 3KEHA 2WO3A 1I1AD 2VDPH 2D9QB 3DWTA 1VBUA 3RUGF 3JV4B 3W39A 5LXGH 3B9KD 4OFVA 1UKTA 4NQEB 4F7TA 2AVGA 4FHBD 3TVMB 2A9NH 2H8PA 1EAJA 4KUZL 2DWEA 2WWKO 4MCZA 4KDTA 3DV4A 4HMEA 4DEPB 1OVZA 1QNPA 4CVUA 3BJ91 4A45A 1WZ1H 4M5YL 3V5HA 2WHKA 4IIQB 3P0YH 4QLRA 5ITFB 4XZBA 1E6OL 4DK6A 4OFPA 3IK2A 4UNIA 4N9GA 4WTZG 3NN8A 1RZGA 2J7EA 3DYPA 5FM8A 4OIFA 3IRZA 2EE6A 4FQHA 5I2IA 1KJVB 2CK0H 3PHAA 4JRXE 4LF3B 4CN4A 1QLEH 4Z7OE 4PJAA 4Y16B 3K8LA 4JGUA 3PABA 1S9VB 4WFFE 4H7VA 3L3IB 3C7GA 4O2EA 3AZSA 4ZXOA 1UM5L 4X7TA 1R3IH 1YNKL 1RJZB 3UERA 3DVFA 4QB2A 4OF8A 3SKUD 3WFLA 1A2YA 4U3HA 2V5YA 5EOCJ 1WJ3A 2PI6A 4JY4B 4K23L 3D87B 4MA8H 2AEIT 2H32H 1B4JH 1C12B 2F15A 2HMIC 4KI5F 1QHPA 4MO3M 1MF2H 4JFDD 5T1DL 3CSYA 2XFXA 4NO0A 2AEPH 1CE6B 4JVPA 1FFNA 4PY8I 2HT4C 3F7QA 6CGTA 2AJUL 5CZKA 3SKJH 3RA7L 1NP0A 4XMPH 4P9HL 15C8L 1OAYL 5JBFA 4P9MH 4J23A 2AV7A 2CCRA 1T5WA 4MA1B 1UXZA 3U7WH 1HEZB 2CEQA 4UIMB 3LKRB 3ZM8A 3GXFA 3ESUF 5D70H 4LVNB 4EBQL 4N0YH 3OG2A 5DGQA 3EYOB 5K59F 2VLRB 3FOMB 3THCA 4OBRA 5GS0C 4ODUB 1FO0L 4Y2DB 1C8PA 1KXQA 3GJEA 1MJJA 5GGRB 1QRND 1UQZA 3WFBL 4WRLA 4GS7B 1QI5A 5HHXL 5BZDA 3V2AR 1ODAA 3UJIL 2Z4QB 4PLOB 4P23A 3O6FA 2R0LL 2J5LC 1I3UA 2Q8BH 5JW3H 4QOKB 3GSOB 1KC5L 2DL2A 1P2CB 2N7BA 1IC7L 3RU8L 3GJFH 1N6QH 1HHJA 2ZWLT 2PYFA 5C0JB 3TT1L 1CFVL 4GG6A 3K74B 1JD9A 2ZZUT 4ALAH 2A3BA 3OLGA 4LYPA 3AOFA 3P2TA 3NZ8B 1WV7T 3VDBA 1NM9A 5F3HB 2E6JA 3I6LD 3SDAA 1KWGA 1A5FL 5E1AA 1N8ZA 4POUB 3C6SB 3VXNA 2V3GA 4AD2A 4M61A 5MHSD 1AGCB 2B2XL 4FQ1H 5KG9A 2WKLA 2XHYA 4ZE4A 3BYTA 1BZ9A 1T04A 5DD1L 4OLZL 5E8PB 3FO2A 4X5WA 5BXFB 4ZXLA 4JHWL 5AG9A 1PBYA 1E3ZA 1KOAA 4Y4FA 4PR5A 4P59H 3WL0A 5T3ZD 1J1XL 3OGSA 3TJEL 1UWEH 2EKJA 2H9GA 3FFCB 2P48B 1GRWA 1OPGL 3IFOB 4Y19D 1T66C 3B5GA 1OIMA 2DSVA 3Q6FB 3O6FC 3MXWH 5D2LE 5A3HA 1LNUA 4XB8A 1MREL 1XGUA 4WIQA 2DQIH 1KN2L 3P9MA 1X4ZA 3EJYD 4KJQD 4EUPH 4TTUA 5ILTH 1B0RA 4NKQB 5F88B 3MSPA 1RURH 3AFLA 3S37L 2WP3T 1CLYL 1DYOA 1YEJL 3EMCA 4LLYA 4WY7L 5F7LB 2YOCA 4JZOB 2VIRA 1EK3A 2DLFL 3LPGA 3ZKMC 2ZWYA 4MD0A 4IDLA 1MHCA 2A6KA 1OSPL 2P44B 2X7LA 4PJEE 3S35H 1UD2A 1N26A 3O6AA 2XA3A 1HQ4B 3CFEA 5D71H 5SWSE 3B6SA 2ZCKH 4ZUVA 5MENB 2OP4H 4G9DB 5LCVH 5DUMH 1V6UA 4PJFE 2BMKA 3AREC 3CSPA 4MZ3A 3I2IA 4LLVA 4M6MH 4ZPVB 3IF1A 4NQVA 2WINA 4NUJB 4Y4FC 4Z7UE 2DDUA 1WF5A 4LCUA 4YHKL 4V1DA 1U91B 3WO4C 2R69L 3WDIA 3V7MA 4DUXA 3G5ZA 2Z4FA 1KFWA 3PWJA 4HK3N 4MVBC 3TBSA 3KLHC 4OSUH 4AEIL 1JPST 1WBXB 3W11D 4PJ9A 2W9EH 1L7RA 2SEBA 3VG9C 3UNPA 1QNRA 3EJJX 3GI8H 4E41A 3LN5B 3AHTA 2YUWA 4LMQI 3V52L 4WWKA 5EBWB 1EO5A 5DJXA 2ICWJ 1I9IH 1BYDA 1SYVB 1UKSA 4TQEH 2OXGA 5ERWA 3V9FA 4F58H 1EFXD 2FHCA 1KPUB 3WELA 4KTDH 3OAUL 1JNHA 1G1CA 3OKLA 2CKBH 1ESWA 1BLNA 3T09A 3SPVB 4GXVL 1IM9A 4GW1A 1H6XA 3QEGH 1OT5A 2A3AA 2FR4A 1YMME 1YDPB 2VDRH 1NEUA 4ZFMA 3X13A 1OGGA 3PNWB 5ECUA 1X9QA 1VKXA 3BWAB 3T4AB 3X11B 3QUMB 1FHGA 1Q72H 4J27A 1OAUH 4L3EB 4KVNH 4L4OA 1KJ2B 1EQCA 2YEZA 2FBJL 2CLRA 3SOBL 4H41A 1O6IA 1MRFL 1YY9D 5CWSA 2WMFA 1HOCB 3WD0A 4UTAH 2DYPA 1QVOA 4LHUA 4PYGA 4HUXA 4JREC 2ICWA 3UTOA 4DK3A 1VGKB 5F7DB 4LAQL 1BQSA 2ZXDA 1VFBA 4PJ9C 1D9KB 3MLZL 4NKIL 2W60B 1U8HB 5EWIH 3V79C 3ABZA 3PTKA 4WWKC 2B4CH 3A6CL 4O58H 3VXMD 2VVNA 1J7VR 3IU4L 4AG4H 1FVDA 3CSGA 5KZCD 1NSNH 2F5AH 3H0TB 3CPUA 1K42A 3ZE0E 4XPTH 3ARBB 2R1WB 5CPQA 5HY9A 2YD7A 3T8XA 1HKMA 5IFPA 4MCYA 5IESH 1RK0B 3Q6GH 5SWQB 3S5LG 4P2RB 4OGXH 3S96A 5CZXD 1CFTA 3SJVE 1V0LA 1N5YH 2IQ9L 4ZSOE 1E6XM 3BP7B 1HX0A 1F4AA 1BHGA 3MOBL 4NP4H 5CBAB 4UTBH 2NNAA 3O0RL 4JFEA 1RVFL 5CD5C 2AJXH 3NFNA 3QNXA 4QHKI 4PF1A 2EDOA 4XZWA 4M7LT 2A77L 5IQ9A 4U1GB 3KPRD 4XX6A 3O6ML 4X8JA 4D0CA 3PUHA 1YEKL 5I15H 4PJCE 5D96B 1UM4H 4BFIA 5I1DA 4OT1H 3W0WD 2G2RA 1YEGL 3V6BR 2Y6SC 1I9JL 3H9SD 1JNLH 5JOFB 1I4FB 1D6VL 5DD3L 4WDIA 2X1OA 4QF1B 2Z31C 5JMOA 1XIWC 4P46B 4NZJA 2JB6B 4Q0XH 2EO1A 3CZKA 3JUYA 3G6LA 4R97C 3PQYD 1ZJAA 1BBJB 3AI0A 1BREA 1U8OB 2AGJH 4XB3A 1ZVSB 4I0CC 3VFVA 2XT1B 3BDYL 3FT3A 4ONHA 2J8HA 4S2SB 1J83A 5DMYA 1BQLL 3LQAH 4QFUA 3EDEA 1ZMYA 4PMNA 1ZWIB 1E4KA 5CILL 4XP5H 4XVUC 5FOOA 3NGBB 5D1ZA 1II4E 4PJGB 5GGVY 2L7UA 4Y89A 5BOZG 5IB5B 5AAMA 1SVZA 5ICZA 5JW4Q 2X4OA 3L4XA 3MYJA 4NNYB 4JFPB 4R5EA 3T4YB 2MPAL 2NY5L 2WN2A 2YBRA 3NYDA 2FYYB 3KPOA 4P3DB 5HDBE 3WXWH 1U41A 1J0IA 1GOIA 4XNZB 2E7LC 4GG8B 2OK0L 3WUFA 4RGNB 5ABHA 3KPSA 4PJ5B 4F8QA 4LFHD 4ZOAA 4PQQA 1L0PA 2HJLA 2IALA 4NPYA 3LAFA 3J7HA 2VDPL 5TDNA 4AENA 5LQBH 1P1ZA 2ZCHH 4WW1A 3ZKSD 1IM3A 5LXGL 2BXZA 2WMGA 5KSBF 1MWAA 2NY6D 2X4TA 2PF0A 2VRQA 2A9NL 3R1GH 5I75B 5IOPA 5BXTA 3ARPA 3WS6A 1AGFA 5C6TH 1LEIA 3V4PH 4PJHA 1BWWA 1CD0A 2CPUA 1WZ1L 2QBWA 3HNYM 4LGSB 3P0YL 5EDXA 4RBPH 3HPJB 3DVIA 1KJMB 2GJRA 4JZ5A 5DUBA 2Q76A 5DVOA 1E4KC 3RPIB 5EIYB 1CGXA 1CU4H 3E6FA 4DWSD 4JFYB 2KKQA 5DJ6A 2CK0L 2NW3A 4PJ7A 1QLEL 4PFEA 4U1IA 4OCWH 2HJFA 2V9QA 2O9PA 1H11A 4P4KB 5HYIA 1R3IL 2GUOB 4W8JA 5FYKE 2WMPA 2HVKA 5IJKA 3K77A 4GKLA 5HYSA 1UM6H 2XTJB 4IJ3C 3AB0B 1MI5B 2Z35B 5GZND 4LKXA 3WD5H 1JF1A 1AD0B 1B4JL 2NY4B 4UQ2B 4RA0C 3HC0B 1XD1A 1RV6X 1MF2L 2EIBA 3ZTJH 1WTLA 2AEPL 3MRLA 2WO2A 2XGIA 2NXYD 1F97A 1DHKA 1SHWB 4DXSA 1L6ZA 1FNSH 1ORSA 3SKJL 4WI5A 4XMPL 3WS6C 5D7KE 1AIFB 2VDMH 4P9ML 4MDJA 1TZIB 1PZUB 1Q1JH 4YC2C 1DLHB 3U7WL 4LX4A 4PMVA 4WTZA 1RHHB 3CDZB 4XUPA 4ZZ5A 3GMQB 2G3JA 3KS0J 3JZ7A 5D70L 3D6GA 5CKAA 1F11A 5ADPH 3QXAA 2VITA 4N0YL 4P3WA 4YHNA 3PL6A 1VFOA 3HE7D 2OTUA 4GW4B 3KJ6H 4M24A 1M7DB 3T0WA 2H2PC 1XF5A 4CW1A 3GMRA 1R3KB 2WVSA 3C7EA 1OP5H 1H8SA 4GAYA 4PT6A 2Q8BL 3D3VA 3QQ4B 4LVHB 3IB4A 1NC4D 3JUZA 5JW3L 6FABH 4UAOB 3HZMB 5GGTH 2UZXB 5IHUH 3EGSB 4X6BA 1CDJA 5TE6H 5JLZA 5A16A 5I76A 3ES6A 1N6QL 2DGAA 1QFWH 3TN0D 4TOYL 2N4IA 3RL1B 1CN4A 5ANME 5INDB 2VMFA 4ALAL 2XG5A 3IDXH 4J4PD 1G7PB 2EDEA 2F53A 1KIQB 5J12C 1UD4A 4LCIH 1G5AA 3QUXB 3DVNB 1QNSA 3GJFK 3I02A 1RJLB 1CXFA 3FCTB 2DSZA 1OAQH 1T7VA 4H04A 1NAMH 4FQ1L 3GSNA 1K45A 3MJ7B 1M04A 5EZLA 3PL6C 2G4FA 3D85A 4OIIH 2H26B 3RI5F 2ZOKA 2DQFA 3IDJA 4P59L 3WIHH 4FTVE 2YPLB 3C6LC 4GWIA 5I16A 3TA3C 1UWEL 1J0KA 1NUDA 3IDYC 1K3ZA 1Y6MR 3MXWL 2AJ3A 1C5DA 4L8CA 5DQ0A 5EU7C 3GHEH 1V02E 1C1EH 4AZHA 2DQIL 4P5MA 3TWCH 2V5TA 1E4NA 5D7IE 4XUYA 2MCPH 3JWDC 3MRGB 4XPBH 1T7XA 1PZ5A 5ILTL 3UPAA 4H5SB 4XC3H 1L0QA 1RURL 2MTPA 3QJFB 5C2BH 5J6GA 2RCSH 3SE4A 4AQ1B 1CK0H 2MJWA 1Q6FA 1ES0B 4OI7A 3K4DA 2VZUA 2WLZA 4MNQA 4GLRH 4YJZL 2ENSA 3SHSA 3S35L 3QR3A 2NR6C 2EBNA 3OV6A 4HK0B 5D71L 5FEBA 4CVZA 1A22B 4GQQA 2CRIA 1R5WA 2YD2A 2ZCKL 1I7ZB 1U8IB 4ZUWA 5KSUA 3A6BH 1AJ7H 2OP4L 1I8IA 4B5EA 5LCVL 2AJYH 3MO1B 5DUML 1U8QA 1FYTD 2JIXA 3C60C 1OD7A 2Z1SA 1NOUA 2XVLA 4KI5C 1CZSA 2JALA 4KK6C 4M6ML 1R3LB 2EDQA 1TJGL 2AK4D 3QI9A 1E6JH 2Q86B 5DRZA 3MLSH 3ZDYE 3WHXB 1HZHH 5EO0B 4JFSA 3IFPA 5FM5M 3CIHA 3QOKA 4FFZH 2OZ4A 5ALBH 3JSSA 4OSUL 3WH9A 3ARRA 1HH6B 3EW3B 3NCFB 1MCWW 2W9EL 4C7FA 5F72S 5GRVL 1A9BA 3GI8L 2ZP0T 4X0NA 3TYFA 2XWJB 4PJ8B 4D9QD 4AZ6A 1FNGB 1I9IL 1DUZB 1P9MA 2MFNA 1KB9J 3OEBA 4TQEL 2QTEA 3SE4C 3RVTD 3D9AH 4F58L 3WNNA 4M5ZH 2X4PA 1N64H 5DDHA 2CKBL 5GRVK 3WL9B 1BJ1H 4HUVA 5C0CA 2DQUH 4WW2B 1VENA 3QEGL 4LARH 4ZFGH 4IS6A 2QQKA 4FQCL 1H9VA 3N13A 2VDRL 1W72A 2CSPA 3B2UD 3S8WA 4CADA 3OLDA 5EIVA 4UOW0 1Q72L 1MCOH 2CIKA 5AYIA 2BNUA 1UZ6E 1CG9A 1NGZA 4KVNL 5F7NC 1S7RB 2B9VA 4BH8A 4GI9A 5EA0H 2RQ8A 5I1HH 1R85A 4P57A 5DFVD 5HGBA 4UTAL 1JVKA 2B20A 3F7YB 4GBXA 4MNMA 4FI9A 4DFIA 3KPMA 2W1WA 3WEOA 4NRZB 1ODUA 3HPNA 4QRSB 1YNTB 5GJTH 4D8MA 3X12B 1ZSDA 5ENWB 2GJ6A 3TJHD 2QSQA 2X4RB 3U82B 4LQFH 3NIFF 5EWIL 4ELMF 3ZOAA 3ILPA 1YY8A 2B4CL 4O58L 2BDNH 1P9MC 4AG4L 2OSLB 2F5AL 1AXSA 1QSFA 2F19H 4LPXA 4LNVA 5EU5B 4XPTL 3C5ZD 4HFUH 1OF2B 2OBGA 4RFOH 5H2BB 5DQJA 3CFBA 1PX8A 5BJTA 3VXSE 2DJUA 2LFGA 5CUSH 3BDBA 3IVKB 3GBEA 4AZGA 5IESL 5BZWA 3WYRA 3Q6GL 1FJ1A 1IL1B 3FL7A 4OGXL 5DJYB 3BEVB 5AUMA 1N5YL 3VRIA 3V6ZB 3BGFC 4NP4L 3WBDA 4ZO6A 4UTBL 2CR3A 1T0NB 5HHOB 1J9CT 1FFPA 1T3FB 1S7VB 2AJXL 3KYNA 4RMQA 3JV6B 4GZJA 3LKPB 3QDME 4CGTA 5B4XA 3HE6A 2XTLA 4LP5A 3PWPA 2VCCA 5FO7A 5I15L 4CBPA 1OH4A 1TCRB 5D4YA 1UM4L 4IRJD 5GGSB 4OT1L 1GIGH 2XM2A 4D6CA 1IM9D 1WTGT 3ARZA 4QGYA 3FJTA 5HGHA 1JNLL 5I30H 2D7NA 1BFTA 1B4RA 4KKLC 2W65B 5E8NA 2ADGB 4DEPC 3RCNA 2IH1B 3N1PC 4OLXH 1MHEA 2ADJB 4Q0XL 4APQD 3GZAA 2MCG1 2BNQB 1HHKA 2EDTA 4TVDA 3TIEA 2BVPA 3WQ4A 5D7SH 3G08B 4Y5YB 2AGJL 2OYKA 1MVYA 3MMEB 2VQ1B 3DROA 4OZFG 3D0LA 3RNQB 1EGJA 3S5LA 35C8H 3UTSE 4Y16C 3LQAL 4JN1H 4N90D 1FZMB 4G6KH 3VIIA 4XP5L 1GPFA 3THMH 3C9NB 5KOMC 4URTB 2RBLA 1NAEA 1O7VA 3QG6B 5EUOB 1Q9LB 2P7TB 1U92B 5HVFB 1E4XH 5K93A 5JOPD 3U2SB 1BD2D 3HE6C 3KYMB 4OI8A 4JDTH 3VFTA 4HOWA 1HSBA 3QIUA 4W8AA 3WXWL 4XCNA 1WFTA 3CU1A 3LZFH 5D7JA 1ZT7A 2NYYC 4R27A 2F54B 1JF6A 4AH2B 3H3PH 3K81A 1FORH 2B0SL 1GAFH 2DQHH 4XZUG 5CSGA 5LQBL 2WKGA 2ZCHL 2P8MA 2W95A 3WF1A 4O2FA 4QB6A 4N0FA 2IWGA 4J28A 1TPXB 4MA1C 4JFED 5C0GB 1W3KA 4PTTB 3NIGE 3R1GL 2E3VA 4KJYA 3V4UH 2A6IA 3FB5A 4DXTA 3WQWA 5C6TL 1JIBA 5CINH 3V4PL 2EYSA 3MROA 1Q94B 4AXNA 1HHGA 1I3RA 3P40A 5HYJA 4ZQKA 1J05B 4YHYB 1YJDH 4H1LG 4OFIA 5DJ2A 4PRIA 2E6PA 3IJSA 4OCMC 3CZGA 3VD7A 4HCRA 4UT9H 2O9OA 1CU4L 1TQBB 5JHDD 1ISXA 3ESVF 4YK4B 2ARJA 1JI1A 1BQHG 2HKHH 4OCWL 1UYXA 3REWB 1FO0B 2DKSA 1AGBA 2BNRB 2V3EA 5IVXB 4RBPK 3FQXB 4JJHA 4HBQA 1A02N 4NQCA 2COQA 2K3TA 4NQDA 3G5YB 1CICA 2C5DC 1G7MA 5D7JC 2QADD 4ARXA 1UM6L 2G9HB 2YSSB 5DUPH 3GXUA 3EDDA 1BVNP 3D2UD 2EDKA 3DECA 3SKMB 3MJ6A 3WD5L 2APTA 4YDVB 2X6MA 1UWQA 5CFHA 4WI4A 5I71C 4FQXB 1ED3A 4MOAA 3BP4A 3VJ6B 5E8EA 3FQRA 1N2RB 2Q20A 4P4RB 3QWQB 1QSEB 2YR3A 3P11H 3STLB 4UZSA 1LWJA 2ESVA 4CVXB 2VDML 4OKVA 4OM1H 3S88H 1UD3A 2DIEA 3MLYH 1Q1JL 1H2JA 1OB0A 3HAEH 4OAWA 3ZKXB 5E03A 1A47A 1ZLUK 4F9LA 5ADPL 2Q87A 3NH7H 1JZ4A 3PV6B 3FQTA 3U30B 2QQIA 1MLCB 1RH9A 1DEDA 5KSBA 4KKAD 1T7WA 3JVGC 1S9WB 3L3HB 1AO7D 1ZOXA 4NO5B 4J3XA 1HI6A 1OL0A 5IR1B 4N68A 5IM7B 1DTUA 2JIEA 4OZGE 2VZ3A 1E5NA 3U0TA 5A2KH 2J1TA 4WHYG 3MV9B 4Q2ZA 4X9IA 4MNGB 3P9LB 1CICC 6FABL 1Q6EA 5GGTL 1R5VB 4QYOA 5IHUL 4HWBH 1CXEA 2UZYB 4XUTA 5A6LA 5TE6L 3MV8B 4LRIA 1AI1L 4N8PA 3O2DA 2C7UB 1CFQB 2BHYA 1OARL 2I24N 1XH0A 1QFWL 1OP5K 4UUJA 5H37G 2V2XA 5F71A 3T0ED 2XN9B 3OB8A 1GONA 3IDXL 1ONQB 3ARDD 3RWGB 1A4JB 5FECB 3HNVH 2IF7A 3KL3A 3VFPA 3NSMA 2XQYK 4LCIL 2XFYA 3HG1E 5DWUH 5FYLH 1K3IA 5GZOD 1XGQB 3HB3C 1WCQA 4B50A 1OAQL 1D5ZB 1NAML 3K75B 4FMVA 1FN4B 4D0BA 4LASH 3PZTA 1XD0A 5IEHB 4F9LC 4Q9CA 2V7HA 2LU4A 1GOGA 1UR8A 2AKRA 1Z5LB 2VE6B 1E4LA 3GB7A 4OIIL 1JV5B 3QAZB 3WIHL 5J3HD 2EYRA 1WZAA 4IOFC 5DF0A 5FK9A 3WNMA 3MRBA 1QFHA 1F3DH 4NKMB 3T65B 2IANA 5EUOF 5DSCB 3GHEL 1CDBA 4JY6A 4H0GA 5K9OA 3TWCL 4MB3A 4MSWA 5DQDH 2HTLC 4LRIC 5DC9B 2MCPL 3T1FA 1FZKA 3VWKB 4LBEA 1OQXA 4XMLH 3T77B 3TO4D 4WUUB 4XC3L 3DX6B 1Y6NR 4XWGH 5D1XD 1XNAA 4WO4D 2C9KA 3QFJD 4QRPB 3KXFB 4LLUA 4FLOA 4X6EB 3RWFA 2E9BA 1K9EA 4WU5B 2RCSL 5JZ7C 3IRPX 5C09A 2J4GA 1CK0L 3O8XA 4FQPA 3BMWA 3EOAA 3EYVB 3HS0B 2EC9U 1TA3B 5D93B 4X4XB 1UADC 3EJZC 3Q1SH 5MERA 2K1MA 2VM9A 3A6BL 1AJ7L 1NOFA 5CG0A 2AJYL 4MGXA 1I1YA 3MRHA 5GGRY 4GRLD 5C7GA 4JCMA 4JO1H 2AOSA 2YDSA 1E6JL 3MLSL 1N3NB 1LF1A 1HZHL 3U6RB 2DI7A 3IJYB 3MV11 5IF0A 3UYRH 4ZYKA 4OJYA 4JFFD 4TSAH 4FFZL 4PRDA 5ESQB 3QXDA 1EEZB 1FHLA 2ZUVA 5ALBL 1E1EA 4I9WE 4L9DA 2X9WA 4Z95L 5EBMA 5GS1B 4DEVA 4XBEH 3D1MC 3V5KA 1GCFA 3ARBC 2A6DA 4AD1A 1PG7H 2CGRH 4NFBA 4NFCA 3U9PH 3OXSA 4UB0H 2BOBB 5JW5B 4JFQA 2BY2A 4UFLA 3ROOA 4YXHH 4M5ZL 4XHJC 1N64L 3O8XC 1UZ8A 3FQUB 2BP3A 2DQUL 2LU3A 4LARL 3PWUB 4ZFGL 2QEJA 2X70A 3MRCB 3RWHA 1MRCH 2GJXB 4KK9C 2HRLA 3K8KA 4XNUH 4W81A 2NY3D 2PTVA 1MCOL 5D96C 1UXXX 3CDGA 2DCJA 4S11A 1S7QA 4MD4B 4MQ7A 2P24B 2V3FA 3D5HA 5EA0L 5I1HL 5CSYA 5A6KA 4E41E 3G04B 1EEYB 5KTEH 3CD4A 5C3LD 3MRFB 1LEGB 2YUVA 4A42A 5M3WA 4L4VA 3MV7B 5J1TC 3DRTB 5KAQF 3W81A 5GJTL 5IG7A 4MYWB 2H3NA 3WF4A 3O4LE 3C09B 4LQFL 3BKCH 1G6VK 1TFHA 4XPAL 2EJ1A 2BDNL 2IJ0C 5ADOH 3PWNA 3DMMD 3QI9D 4J3OC 2F19L 1OY3B 1UYQA 5HHME 4HFUL 4RFOL 2V5RA 3NGBC 2MANA 1CR9H 4MQXC 1JPSH 3SCWA 5HJ3B 2ERJB 4MJIA 1KPRA 4HA1A 2ZEWA 4QDSA 4AIZB 4I13B 4YR6A 4QP0A 3SUTA 1ITCA 4G8FA 4J8RB 1J5OH 4UQAA 3GIVA 5B4MD 5I66B 1KGCD 4F7CA 4BQ4A 1SBBA 4W7VA 3AISA 3W38A 3P4NB 2CBIA 2ZUQC 4E4PA 2P8LB 3QG7H 7CGTA 1FL3A 1RU9H 3RJDA 2IQAA 2Y6GA 2WBJB 4Q22A 1AKJD 1Z0MA 2V5MA 3DBXB 1UENA 2XNAA 2EIZA 2Q8XA 3DETC 1JBJA 1GIGL 2DS4A 5T3ZL 5FDWA 5I75C 4PJDE 2BVQA 5KANI 3O45A 3GSRA 3ACFA 4OLXL 4EVNA 4JIEA 1LEKA 4N42A 2ZSVB 5LBSH 3O3EA 4KK5C 5JA8B 5D7SL 3CZFB 1BSIA 3QIWA 5JORA 3FB6B 5I1KH 1DLFH 5KSVB 4G42B 4H8UA 2AXGB 4AYSA 4W4OA 2CO7B 1CDYA 2V9TA 2YRLA 35C8L 4EI5D 5CEYB 3KPPB 5IB1B 2FX8H 3IAGC 3CFCH 4JN1L 1V6WA 3C8HA 5EOCH 3WF3A 3VFSA 4G6KL 5I79A 2VR5A 4TTDC 4W93A 2GJ6D 2VZVA 4M4RA 3THML 2W5FA 4ELMA 4QTHA 2JK5A 3PHQB 1G7QB 4ZO9A 3DXAA 5A6BA 3DX9A 2GTWB 4MXQD 1E4XL 3CX2A 1ZT1A 5EU6D 2XTJC 3JWNC 2FLRT 3KPLB 4X0VA 3C5JA 4HU8A 2XFFA 2DMCA 2PYEB 4JDTL 2I26N 2NY4C 3PGDB 4UBDD 3LZFL 2VXTH 2O5ZH 3GBLA 4X99B 3RTQD 2J74A 1ZS8A 2GQHA 2KBGA 3TTYA 3CLFH 3H3PL 1FORL 3OQ3B 1GAFL 1M1SA 2DQHL 5JXGA 4QB1A 1W9SA 5DJ0A 3EZJB 2H32B 2XVKA 5F1OB 2WMJA 3QDGA 4HIEB 2OSXA 1KIRB 3ZKNC 4GW5A 1IGIH 3W27A 5IFAH 1XF3A 3V4UL 3MJGX 2F58H 4XVJH 4YO0B 4OZFA 5IV2A 5CINL 4E0RA 2G3IA 3QIWC 3RDTB 1NEZG 3DO7A 4OZHF 4XAKD 3ULUD 3GXIA 4W4OC 1U2CA 4DGYH 4X6CE 5FL1A 1U8LA 1YJDL 3WSUA 3ZT5A 1PLGH 3TCXA 3QQ3B 1HQRB 3EOBA 4B41A 5EC1B 4UT9L 4U6XB 2KZ1B 3VVGA 5FYKD 1MCDA 3KPSE 3K4ZA 5MI0C 3MC0A 2HKHL 4UAOC 5F21B 5L0QB 1DWHM 1MFVA 4RN5A 4HU0A 4TSBH 2XZQH 4G9FD 2DRUA 4P2OB 2D7MA 4PIRF 2ZPKH 1DQJA 5JO5B 3PWVA 2OCFD 4L8SA 2FDBP 3L7FA 4W86A 2XRAH 4OCLC 3TBWB 2LW8A 1E70M 3CIVA 3MNZA 3SCTA 2VLJB 5DUPL 4KRNA 5ISZD 3CMOH 3QDHA 2PQSA 1X6LA 2XSAA 2A6JB 2C4FT 3GJFB 5HGAB 4X6DF 5D7KD 3W6MA 2WC3A 4Z5RB 1AHWB 1I8KA 4RX4A 1R64A 1DQMH 3IDMA 3QWRA 1FIEA 3MUZ1 4RIRB 3MA7A 2X10A 2Q1EA 3W53A 3G6JB 3P11L 4DM1A 3U0PB 4PJ7E 3ZLQC 3DLQR 4OM1L 3S88L 4H1LA 3MLYL 5IB3A 1JHTA 1K4DA 4L29B 5JOEA 4GRMA 2WCSA 1NGQH 1D5BA 3WBAA 1M7XA 3RAJH 3HMWH 4DCQA 3IKCA 1UQYA 4ZAKA 3NH7L 5DJAB 1INQA 5CJ5A 4QRUA 4ELKA 4LK4A 1ETZA 5DI8B 3HI1A 1N7MH 1G0DA 3LCYA 2OTWB 5BS0A 3AIVA 1UR1A 4R7NA 3RMEA 4UOQA 2IXVA 1AQDA 2E9WA 1SEBA 1BYCA 3HUJE 5TH2A 1JWMB 1BTCA 3RVXD 4HWBL 2E31A 4MD5B 2GI7A 3HPLB 2FEEL 5D5MF 4OUEA 3QULA 1W8OA 3O3UN 1YPZF 4EUPB 1YUHB 3P6BA 5L2KB 1G0CA 4MLIA 3FTGA 4NNPH 4L4TE 1OT1A 4R4ND 3MA9H 1NQBA 2PCPB 1LK3H 2DPEA 4P00B 3HNVL 3RUGE 5C71A 3CCHB 5J9PB 3U0WH 2IAMB 5DWUL 5FYLL 1VFAA 3D39D 3BPCA 3MQIA 5DMKB 1M05B 4LYQA 3M1BA 3IIIA 1JGEB 4C7DA 2ZNXA 4LASL 4U0RB 4U6TA 1T6VN 2NY1C 3D3VE 1NH6A 4ZAKC 5EU7E 4EZMA 4HXBH 3MMUA 4WU7B 4ZXBB 4D0QA 2OWWA 1S9YA 2BERA 2BX5A 1S5HB 4BA8A 5IMMA 4PJ8C 2VLME 5DZOA 5CSZA 5IDIA 1GZPA 4NCC2 2F53E 4BKLA 2IH3B 5DQDL 4R4BB 1S46A 3OKNA 4XMLL 3N17A 1NARA 5T1KB 3HZVB 3G5XA 4LNRA 1ZHLA 4XWGL 4U7MA 5DZLA 2VNCA 3JTTB 1XNTA 1SMDA 4GAFB 1T0MB 1JWUA 2Q6WA 3PTMA 3QDJA 4DGIH 3OF6A 4KI5E 2E3ZA 1OB1B 4DKEH 4DWHA 3ECBB 4J3WA 4XV0A 2EXWD 4MAYB 1QPKA 2CKBB 2E32A 4Y7MA 5HHNB 3Q1SL 1SEQH 3TH3T 5B38B 3WFDH 3EYFA 1RZKC 4LEOB 2GFTA 1WWBX 3NNGA 4AJ0A 3EFFA 4JRYE 1KXTB 3IYLW 3HZKB 4OZIF 4U1JA 4O9HH 1JYVA 2PXYD 2ZXBA 3BXNA 3W9DA 2MNUA 2GYSA 4JO1L 3OKMA 3VWJA 4Y4HB 2FEDD 3UYRL 2OM5A 4PLKD 4L8BA 2ZG2A 3IXTA 1ZA6B 5A2FA 5K59E 2VCBA 3QQ9C 4HIHA 3WH5A 1J9YA 3JUGA 4X4MA 4RMRA 5FO9B 1TQCC 2WVVB 1BAGA 3VINA 3QR2A 3LQZA 4MS8D 4K94C 3MUGB 4HS3A 4XBEL 3STZA 1SMAA 4MNQE 1M71B 4GAJH 2PW1B 2JF1A 1JRHH 4LLQA 2CGRL 2DQCH 2ADIA 2Z92B 2HG5A 3U9PL 1OM3H 4M3KB 1M6OA 4UB0L 3WNOA 4CKVX 2A83A 1RZIA 3VD5A 1IAIM 4YXHL 5TJWK 1FC1A 3AS3A 1KLGB 3UZEA 3RNKA 3WE6B 4Q9QH 5D9OA 3BIAX 3KR3H 1A6UH 4MLSA 1LO2H 1PBGA 2V2WA 4YHIB 1PFCA 1JPFB 1MCJA 2WB5A 1MRCL 3LD8B 4P2QA 3PP4H 1B0WA 3IJHB 4XNUL 4PRNB 4M8QA 3I6GB 4LSQL 4QRRB 4XPFH 5BVJB 4Z7VF 2EDFA 2DLHA 3BPLC 3BSGA 1R7OA 3MBEA 4PRHD 1N0XH 3E1F1 1EUTA 2HKFH 4G6FB 3MCKB 4IM8A 2AJZA 5C09D 1OAXH 3V0VA 3THDA 5KTEL 1MQRA 4IRSB 4TULH 1MVUA 1IGJB 5CQ1A 3G9AB 4XI5C 4BK5A 5HOSA 4JFUA 3VFUB 1MWAH 1UEYA 5DEFA 2ZICA 4KROC 4LPVA 1X3DA 1J10A 1QP1A 3HNMA 4QDQA 5C0CE 3AMCA 3MRQB 1H1NA 3VXSD 3AIUA 3BKCL 3GNOA 5HGGS 5IBLD 1QR1B 2XIIA 3SN6N 1VSCA 4YZFF 2IADB 2QKIB 4QY8A 1D5XA 1V3HA 3BMVA 4HOZA 5E6IB 1E6PA 1CR9L 1QBLH 1JPSL 1KB5A 4NZDA 4HEME 4WNQB 4GQ9H 4XX1E 5D1QA 2HLAB 3IDIA 4GXUN 4P48A 3ZHLA 1J5OL 1MEXH 3SDCA 3U79A 2J6EA 4NQEE 4XCEB 1KTRL 3P4OB 4FZEH 4X4ZA 3QG7L 1B3XA 3ZE2F 5H8DA 1X5JA 1O59A 3MBEC 4POYA 1B90A 4OGAD 4WV1B 1J8KA 1TVNA 1RU9L 5DJCA 3QZWG 4HF5H 1HN1A 2E26A 3C8KB 1TVBB 3LQMA 5D6CB 4G43A 3GSXB 3ARUA 3UR7A 4TUJA 1WAAF 2EDHA 4QWWD 2DM2A 1TPXC 1N59A 2HFEA 4ZUUB 1QSFE 5CJOH 4LU5L 2CIPA 4CD4A 1TVHB 4JFTA 5D2LB 2A1WL 1VEOA 5GISH 2FBOJ 4ONFL 3QH3B 1YMHB 2X1QA 1BOGB 3C7OA 4P9HC 4XGZB 4PMOA 2X1XR 2Z93A 3WL1A 2ZE0A 2ZUYA 5LBSL 5F6HI 1P69B 1JUFA 4L9LB 3SCPA 3UTTA 2DLIA 2R0ZH 1TQBC 5I1KL 1DLFL 1TITA 5CEXA 5TFSH 4MJ4A 3AUVA 2PO6A 2FX8L 3CFCL 5D1QC 2WC4A 5EOCL 3PWPE 5I24A 5IWLA 1F5WA 4PJEB 5IK3A 2CDGB 5SWSB 1U8PB 3WEXB 4UCFA 4GRWF 4QEGA 1KG0A 2VR9A 3FQWB 1LE5B 2A73B 4PJFB 1DE4B 3JWDH 3ET9F 2W38A 1XYFA 1XH2A 4Y5VA 4AT6A 2HYXA 2VXTL 3IETB 5C0IA 2O5ZL 4RFNB 4NCDA 2IBGA 5C0EB 2YFZA 1KR1A 4MJID 3AIEA 3CLFL 3LKNB 3K2UH 1S8DA 2E6QA 1W0YT 1FSKB 2XKNB 3MFFB 3T2NH 3V8OA 5LGJA 1W9DM 2QHLA 3DRQA 2O5XL 4NQUA 4XNYH 2VLRE 4P5TD 2WAAA 4F2MB 5C0AA 4KTYA 3DIFB 1VFMA 3IB3A 1IGIL 4FZ8H 5IFAL 2QR0B 1JMXA 2F58L 1NGYA 5F1NB 4TTGA 2HVMA 5IW1B 4QOKE 4ZUTA 4DGYL 4P02B 1JZ3A 3K1KC 3CH1A 1LK2B 2XZAH 2CBJA 2ZX7A 1MPAH 4J3UA 1PLGL 1BAFH 2HMID 3ZKQD 1CIUA 4S1SH 2Q7YB 4JAWA 5IWLC 2EPLX 1YN7B 2ZX6A 1I9EA 3VKKA 3V95A 2UUDH 4X0KA 2I9TA 5A43C 4TSBL 2XZQL 3MRIA 3SE9H 2OTPA 5E94B 2ZPKL 1H3PH 4FABH 4N1HB 2XRAL 5KVEH 3S35X 4LKCB 4PRPB 2P5WD 1MCFA 3F7RA 3QWOB 2GCYB 2CLZA 1S9XB 1W0WB 3CMOL 1HHIB 5B39B 5GS2H 1YZZA 5HYJE 1CT8A 1WBYA 4BS0A 4LVOB 4AM0B 1L7TH 5MEQA 5LAXB 4JPVH 4U3XA 3T04D 3ARGB 4PRIE 1DQML 2EYTA 4FG6D 3RM8A 2Y7QA 5A6BD 4M1CC 5FGSA 4E9LA 1M03A 3FFCE 5ABFA 3X3FH 4HEPG 1ZAGA 2OR7A 4NM8H 2E7MA 1MFDL 4UDUA 4MZ2A 4IEFB 4MB4A 1V0MA 4I0PB 4QT5B 2O9RA 3PGCA 3FAXA 2Z91B 4W50A 4P5KB 1NGQL 4X9BA 4DQOH 1NAMB 3RAJL 2VZPA 3VIFA 5EIIA 3RWDB 1A1NA 3HMWL 1HE7A 5J0BA 3BZEB 3RILA 4HJGA 2ICCA 3TYGH 2FECL 3SJVB 3U36A 4ZSOB 3X14B 1N7ML 3QXTA 2OZ4H 5FKPB 4Y1AD 4H0HB 4HLZG 2ZWZA 5I8CA 1UH3A 3NSXA 3VWKC 3A67H 5GHWH 4NN7B 4F9PA 4OZHA 1Q9KB 4OD3L 1QA9A 3QNZB 5DYOB 4FQQA 4L4JA 5DS8B 3KE0A 1OTTD 4JAMB 4G6AD 5J89A 3PXJA 3GMNB 4PJCB 3SDDA 4M7ZB 5F6IB 2ESVE 1UYYA 3Q3GA 4CU7A 5JIWA 1BZ7A 3GGWA 3FO1A 1FNEB 2CPCA 5D93C 1WICA 1JD7A 1BVLB 1CWVA 1U58B 2NZ9C 4NNPL 5B21A 3MA9L 1LK3L 5K9KB 4GXPA 5J1AA 2B1AH 2QQKH 4WEBH 3U0WL 1T66D 1W72H 4JHAH 3V7AE 1I7RA 2IPUG 5HI3D 2BGOA 4PGEB 3VDAA 4HA4A 5E00B 5KSBE 1CFNB 3G5VB 2CBVA 2DF3A 3OGCB 1IGTA 1W0VB 2FX9H 5B3NA 2CDEB 3GSWA 3U37A 1CZ1A 5JQ6H 4MDOA 3K8MA 2HN7B 2WAOA 2C3GA 5A2CA 3QJHA 1ND0A 4JM2F 3PZGA 3EO0B 3AROA 3IT8D 4X6DA 5K9JH 2D7PA 1XMWA 2DEPA 4PS4H 1N82A 3QHTC 4C56D 4HXBL 4YE4L 1UWRA 3MR9A 2VVSA 3BAWA 1C08A 4JX0A 5GS1C 3ZKMD 2VR4A 3EO1B 5E24E 2DWDB 1NDMA 2ILLA 2RAMA 2LTQB 3RRQA 1N6VA 1RYYA 2WMIB 3U5YA 4XH2A 1B2YA 5AZEH 3SDDC 4HD9A 3WDJA 2DAVA 3ARED 3TPUA 1DEEB 2ICEA 3GK8H 3AHVA 3NPSB 4IBLT 5BRZA 3CVHL 5I1GH 2ZEXA 1QI2A 5JXIA 4Z78A 5DVNA 1NBYA 5BS0D 5SWZA 4DGIL 3VXOB 3WHE1 5B3JF 2HRPH 4DKEL 1RIUH 1T89C 4Y4KC 5I8KL 5L9DH 2M1KA 5ACZA 2F5BH 1SJXA 1SEQL 3RIFK 4DKDC 3WFDL 5A2LH 4QRQB 4QX3A 4KY1H 3MRNA 1R5IA 4F8XA 1BFOA 1UGNA 2D3VA 3RO8A 3O3BA 5D5MA 3VXTB 1A4KA 1FH5H 3GMMB 4RQQB 5KJRH 1AR1C 4O9HL 5E2JA 1YPZA 4R96B 3SUVA 4ZS7H 5HDQH 5EU4A 4I9WD 1L9MA 3B8SA 1NCCH 1OGAA 1NBZA 4UNVA 4H26B 5EBLA 3C09C 5CMAA 4PG2A 3TNNA 3L7EB 4Q7DA 1ZT4B 1UVQA 1FGNH 4NO2B 5L2JA 1G9ML 2GJPA 1NCNA 2C3WA 3TF7C 3AAZB 1JRHL 3GIZH 5ITFA 4FXGA 2DQCL 2ERJC 3HC4H 3MLUH 1OM3L 1EGJH 3N1MC 4PREB 5IROA 4JVWA 1GYAA 3ACHA 5C0FA 1XGPA 4PJBF 3QO1B 5AWNH 4S10A 3SCMA 2NMSA 3F5WA 5I3DA 1E4MM 4HKJB 1IQDB 4Q9QL 2FH8A 1I8MA 3KR3L 3VD9A 1A6UL 1X5XA 4X6FB 4HK3J 4MWFB 1LO2L 2W9LA 4BA0A 2CDFB 1A7NH 4UNUA 2R9HD 4DW2H 5DK2A 2L4OA 3PP4L 5ABEA 1VF8A 1UWXH 4XPFL 1ZGLB 4QCIB 4JLRA 1XGTA 4JKPH 5ETUA 2XIDA 4D9RE 1N0XL 5T1LB 4JO3H 2HKFL 5FYJE 5BXRA 5BQ7B 1PX3A 3HRZA 4WLCA 1MIMH 4N1CA 3QDJD 4TULL 3OF6D 1RK1A 4PG2C 2FD6H 4F3FA 2R2EA 4MPKA 1TR1A 2N1KA 5HBFA 3RIAK 1V6YA 1S7TA 4GJTB 5E5RB 2GT9A 2VL5B 3BGMB 3BZFB 4F37K 3P4MA 1H5VA 2XPKA 3EYUH 4OZIA 5CD5D 4U6HA 3UTQA 1LQSR 4XBPB 2C1OB 1GOFA 3TCLB 5IROC 3RBGA 1ORQB 2ZSWB 3TO2A 2WBGA 2H45A 1SY6A 3FOMA 1UB5A 2NY2C 3VIPA 3SCMC 5ANMB 4AQOA 4HCRH 1NLBH 1QBLL 1BIIA 4PP2A 2FIKA 4XP6H 1OAZH 4P7RA 3MRMB 1FL6A 4D6DA 2P8PA 3TZVB 4GQ9L 1J88A 2Y6SD 1EZVX 5DK0B 1C8XA 5TGBA 2ZXAA 3RWCA 1N5AB 4GIAA 5BRQA 3I50H 1MEXL 2X5PA 2Z31D 1XIWD 3GUTA 4L4VE 1U3HD 3MPCA 4FZEL 3TONA 3V5DB 4RE3A 5FHBH 5JW4N 4MQSB 4E42B 1IC5H 4HF5L 4NNXB 2IGFL 1ZVHA 3C2SA 3SCSA 3H9HA 2IBZX 1WKYA 2DTMH 1MCCA 1U2YA 1NC2B 4FTVB 2A3EA 3GM8A 2FO4B 3TPKA 3P77A 1GOKA 2YWYA 1PYWA 5CJOL 4ETQA 4XRCB 4ZPTB 5F70A 5GISL 2EZ0C 3RDTC 2WHJA 5GSRA 4Z7VA 3WQBA 4EN3A 2JJWA 5D7IB 3GGLA 2ESCA 3L3KA 4QNPF 4F8TA 1NFIB 4NDMA 4DKFH 5JNYB 2R0ZL 3VXRD 5TFSL 3ILQD 5IB4B 4TVSa 1CE1H 1FG2A 2XTJE 5J56B 2XM1A 4YAQB 1OLLA 2VISB 4JFOB 4G8GA 5L0QC 3TTQA 1K5NA 1KPVA 2AQ2A 4S1DD 5EO1B 1P4LB 3LRSA 5D2NA 5DJDB 3I2JA 1B3WA 4ZFZB 1BWMA 5C1MB 2ATPB 4U1LA 4IPLA 2NX5A 3DJ9A 4FLQA 3IFLH 3QZWA 1H0GA 3CHFA 1D5MB 4BFEA 2P49B 2I07A 4HG4K 3O2DH 1WIPA 2C9AA 3BEWA 1AHWC 1CGSL 3MJ9A 5FUZH 5F89A 1KCLA 4MNKA 3K2UL 1J8HD 3T2NL 5GRXG 4L3CA 1BLIA 2APFA 1NFDF 4XNYL 2HFGH 4JM4L 5I73B 3JV5A 1YYMH 3U46B 1E9LA 1G0XA 3VUPA 3WUWG 1F13A 5E9DA 2X4QA 4JJ5B 4FZ8L 1JI6A 4LCWD 3GSNL 3NIFE 5GPRA 3RZCA 1OCWH 4TRPH 3MRPA 4Z7WF 3DXAE 1UD8A 1V08A 1WAAA 3U7YH 5TDPB 5B8CA 2XZAL 3I75A 4BCEA 1MPAL 3GSUA 3HAEB 1BAFL 2IPKA 4S1SL 4V2CB 5KZCB 4Z76A 5D2NC 5DTFB 4I3GA 2P5EA 3PHOA 5GIRA 4ZDHA 4HUNB 2J1RA 5TE7H 5C8BB 2ZOLA 1FLRH 3OL2A 3SE9L 4U1KB 1UH4A 1JFQL 4R0LB 1H3PL 2XGBA 4FABL 4GUPB 1UY1A 1YEIH 3QDGE 5KVEL 1JGVH 1XF2B 2CKNA 2PNDA 4WTWA 2J2ZA 4PMZA 5HTSA 1A9EB 1INDH 2UUDK 2PO6D 3H7BA 2ADFH 4A2MA 4B9YA 2YL9A 5C9JA 1R3JB 1J84A 4Z18A 2O61B 4OMDA 1FP9A 3NIDF 1L7TL 4JDVA 1JJUA 4JPVL 2X4UA 5KANG 4QPWA 5M94B 4RAVB 4U2YA 3NCOA 5CP7A 3BWAA 4NBYB 3X3FL 1A6AB 4PGBA 5I1LA 4NM8L 4F9JA 3HFMH 1YQ2A 1ZVYA 3BD3A 2APVA 5IJVB 3BPOB 5B8CC 1VESA 2PWFA 4DQOL 1HVXA 3BI9X 1IAKA 4ZOEA 1CWYA 5DHYB 2VLLB 4RE4A 5T3XE 3FZUC 4U1SB 1WDQA 3TYGL 3OJDB 4MJ5B 3W9EB 2OZ4L 4YH6A 4PB9H 4YHPA 2ENYA 3HR5A 3M17B 3SE3A 2RFXB 1WZKA 3A67L 1MLBB 4ZXEA 5GHWL 3QDMB 4X9HA 1ZXQA 3UTPE 3IS0X 3ZDZF 2EKSA 3KDMA 2IFGA 3DI2B 3QA3B 4KQ4H 3UBXI 1HSAA 3MRDA 4L4TD 3ARFB 3I3BA 5EZJA 3SCRA 2R1WA 3DUHA 3CUHA 2XPGA 1MOEA 3KPQB 1A14H 1RK0A 2AABH 2JCCB 2JLLA 2CUIA 4XCYA 3GH7A 4I4WA 5LVEA 4NRRA 1EFQA 2JEPA 2ZX9A 3QUZA 1PQZA 3BGAA 3HN3A 4PG9B 3BP7A 3C6LD 2B1AL 4ORGB 2QQKL 3TA3D 4WEBL 2V17H 1FFOB 4WIWA 1W72L 3NAAH 5IW6B 4HIXH 2F8XC 4D0DB 4TUFA 1DZBA 2HJKB 3WD2A 1W8NA 3L3DA 3T0BA 2FX9L 2W66A 5FM5O 5JQ6L 2NY6B 3JTSB 4X7CC 1OP3H 1LWHA 2FL5A 2LV4A 4ISVA 3OKEB 5K9JL 3BOVA 2UZIH 3MZGB 2NTFB 2W9XA 4AW7A 4PS4L 4UIKH 4M7JH 4NYLB 3SE3C 2FB4H 32C2A 4X8XA 3MX0A 3FAWA 1QQDA 3U9UB 1MRDH 5ESVA 4XNMB 3CHEA 2B4CC 4U6YA 4ZY9A 5A1AA 5AZEL 4GLRI 4KRPD 1G7HA 1KB9K 3EOTH 3GK8L 1QNZH 4KK6D 4YLQT 3L2MA 1T4KA 3WO3B 1TLKA 1I7TA 2EH8H 3AU1A 1CL7H 3QUZC 4I2XA 5I1GL 2UWEF 3WKZA 5A94A 1W32A 1T6WA 2R1XA 1WBZA 4JEGB 4JRYD 4QHNA 4DVBB 1JCKA 2HRPL 1KSRA 1RIUL 2VLKA 1NDGB 5C0ND 3DTXA 3UX9B 5L9DL 1JP5A 1H0IA 4KY1L 4Z2HA 4RNRB 2DJSA 1FH5L 3SQBA 5KJRL 1HKIA 3AGVA 1ISYA 1ITBB 4YNYA 1H6YA 2R1YA 4ZS7L 5HDQL 4MA3A 1ZGLP 5DVMA 4HS6B 4HJ0C 2OSWA 4NKDB 1DQQA 1NCCL 1PPIA 5EUKA 4BSWB 1WE5A 1HCFX 4PY7A 4U1MB 4JFVA 4LIQH 1FGNL 3OPZH 3W39B 1FV1A 4IHOA 1X5IA 1B6UA 2J79A 4JM2A 4F7TB 1O7AA 5JTWA 2XWBA 5E6IC 5F7EH 4GT7A 3GIZL 3UCQA 2DWEB 3HC4L 4MCZB 3MLUL 5M17A 3DV4B 1EGJL 4HKZA 2UYLB 4AK1A 4AY1A 1IZKA 4HGMA 1UWGH 4J6RH 3V5HB 4CCCA 1JF5A 3LQAC 5AWNL 1JNJA 4GKNA 4N9GB 1MCPH 3NN8B 1RZGB 12E8H 4OOUA 4U3CA 5C0BA 4FQHB 5I2IB 3MMDA 1A7NL 3AFBA 4DW2L 1H4PA 3NABH 4Q6IA 3SGEI 1ULVA 3UG3A 2FH6A 2OR9H 4KXZH 3PABB 4RAUA 3DYMA 4O2EB 4F15C 2BNQE 4X7TB 2FHBA 4LGRB 3ARYA 4W70A 5DMGD 3MSGA 4JKPL 2J5LB 5BRZD 4JO3L 4DTGH 1A2YB 1MIML 3D69A 1T1WA 1MIEH 2F8VA 1W9PA 4EI6A 2FD6L 1E6NA 1UWXK 3LEGA 2QL1A 4XP4H 1IC4H 2BSED 2W4XA 3CSYB 3HMCA 2XFXB 4DEQA 3FQNA 4NO0B 3UR8A 2V72A 4L9LC 3VDCA 1FFNB 3EYUL 4OZFH 1KTLA 5EUOE 2CNCA 1ZHKA 4PYHA 4AZ7A 3MLVH 3PIQA