2VZUA

Complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSAFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNANAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 277
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzuA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzuA03
3MRCA 1BBJB 2GSIB 1ODZA 1TVBB 1XT5A 3VXUE 2WW5A 1H6XA 1CFNA 4HMDA 1QBAA 1EGJL 2F5BL 2YD6A 4L4TE 3WF0A 1WAAE 5HVGB 4P4KC 2AAAA 4OZIE 4LLVA 2W9LA 2FB4L 3QJFB 1RZGA 3AU1A 2IPUG 3SGDI 1KCVL 3VCLA 4I5BA 5DEGA 2FJHB 2ICCA 4DVBA 2P8PB 3K77A 3MLTB 5D96B 2OZ4L 4QP0A 4KRTA 4X7CC 2JALA 3JWNC 3DVFA 2DM7A 3NIGF 1M1SA 5DHVB 5D2NA 3QUMH 1ZBVA 3LQAC 4XVTL 3DXAA 3NDZA 3DX8A 2AKRA 4PRBB 3TT1H 3FT4A 4RISL 5DSCB 4FXKB 1GZPA 1UR4A 4RYDA 2FX9L 1J8KA 4GRLA 3WUBA 1QI5A 3BUTA 2YWYA 4F7TA 3IDYB 3HE7D 1UA6H 3G04A 2A3HA 4J23A 3AMGA 1HYRC 1XRVA 5IHUL 1BZ9A 2CR3A 4FMFA 4AM0B 3O8XC 1DWFM 4L8SA 4MNHB 4YPJA 2EH8H 5C7XH 1KEML 3V5KB 4MHHI 3JV4A 4JFSA 5HHQB 2ENSA 3ME0A 5F3HA 4LBEA 2AJ3B 1W9VA 3KPRB 1ZGLB 4LQ1A 1TCRB 4X8JA 3C2AH 3MX0A 2X4UB 4F7MA 2DL9A 1JWUB 3QRFM 3MRIB 1WBYB 4OGXL 5E8NA 4HZLB 3ZO0A 2JJUA 2J7EA 3WEXA 4WFED 2WWMC 4QXTA 2DIBA 5KS9E 1J1XH 1W8OA 3HI1A 4JZJC 3O2DL 2BNUA 2EYRA 2APWA 3NZ8B 1HKMA 5BZWB 5E2UL 4TOQA 1P9MA 3Q5OA 2J25A 3V0AC 1I9JH 5DFTA 1AD9A 1CZ8H 2AV7A 4ACPA 5J11C 3C7FA 3U7BA 5KSUB 2AXGB 1A9EB 4HJJL 3HS0B 1Z0MA 5JHDB 1WEJL 2R69L 5I1CL 1CLYH 1HJWA 3U0WL 4OT1L 2VLRE 3MLSH 3HI6H 5ICYA 4YWGL 2AJYL 5IQ7H 5DHYB 2P8LA 4UILL 3B3IB 5F89B 4AEHL 3TPKA 5D1QA 2AEPL 3PL6A 4H26A 5DD3H 4YHNB 4AYFA 2ORXA 3OLIA 4U6TA 4JHWH 2QSVA 2PN5A 4GOSA 2C4XA 1UB6A 4FLSA 3MRRB 1A4KA 1LL7A 4EXPX 1PW3A 1GL4B 4X9GA 4APQC 3OLGA 1C90A 2W59A 4ZFFA 1HKIA 3QHZH 1IAOA 4Z7VA 5JXAH 3HAEA 3TCLB 4U7MA 5D1XD 1L6ZA 1EVUA 1ONQB 3QPXH 1CDJA 3ZDXE 4U6HB 4XVHA 1K6AA 4JB9L 1RIHH 4HK0A 5LGJA 1JN6A 1WC7A 2VDMH 2EIEA 3GO1H 3IJ7A 1NL0H 4LGSB 3W9DA 4EE9A 2DQEL 1KB5B 2FZ3A 1X7QA 1ZTXL 2K3TA 2ZJSH 5KVDH 1JUFB 5BVJA 1BX2A 1SY6H 2E8ZA 2IPTL 2EDXA 2YG0A 2HKFH 5EORL 2DS4A 1C5CL 2BOCA 1WZAA 5TE6H 3NCYS 5IJKC 4YN5A 4JHBA 2ZX9A 3VIOA 2Y7QB 3RUGB 4E41E 4DTGL 1DWIM 1NFDE 3KPSA 4G6ML 2Z1KA 4Z7NE 2Z31C 3FFDA 1M01A 3CAFA 4RAHA 1CVSC 2EC9U 3EFFA 3TIEA 4Y5VA 3MLYL 4XTRC 3DRQA 2RJ2A 2VQUA 1GUIA 3ARDB 2MCPH 5TDNB 4M1DH 3FQTA 1R3KB 4NQEE 1AO7E 3UTTB 1KJMA 2YZ8A 4KJPD 1C8XA 4PN2A 5JNYA 2C1OB 2E9BA 4XAWL 5EU7C 4YBLB 1T1YA 3PP4H 2EDHA 2DDQH 2OQJA 4OV5A 1CGYA 3E2HB 4GIAA 3DVIA 4HUKB 5AD0A 1LE5A 4ODVH 2RFXB 4E2OA 4K3DL 4ZTPL 1P4LA 1OAQH 2A1WH 4FQXA 5CS7A 3ZHDA 5DMKB 2W65B 3H0TA 1HDMB 3NPSC 2WMFA 2MOVA 1RJZB 4R6UA 3ZT6A 3MBEC 2P5WD 2YHGA 3R06B 1KJ2L 2E6JA 4G80A 4GI9A 1DLHA 4P4RB 5EU7E 1I3RA 1DEEB 1T03L 4LCUB 1DN0A 2V2TA 2JJSC 3PP3H 3UDWA 2G9HA 2ZOXA 1EFXB 1UVQB 1I1YA 3TA3D 1Q6CA 2WHLA 4I77H 3SE9L 1UQZA 1T0MB 3FO9A 3QA3A 2LVCA 4PRIB 3SDDB 4JEGB 1II4E 4QYOB 1B0RA 2X1XR 3SCNA 1E70M 2QL1A 1UCTA 2EYSA 5I17B 4ZXBA 2WP3O 3UPRB 3PQYE 4PJ8D 3BQUD 2VDQL 1M6OA 3B8YA 3P30L 1HIML 3EOAB 1N59B 1AMYA 2V7NB 1QEWA 5MP6H 4JCMA 3IJSA 4PGJA 5F7DA 4LKSA 2B20A 4YXHH 1Q6EA 4JFED 1E40A 3VIIA 5K59F 3B9KB 1V08A 4PLNC 3VFWB 3MMDA 2DSWA 4MJ6A 2LTQC 3A7QA 1U92B 1NC4A 1G9NL 3PXHA 4HBQA 4JGMA 3GGWB 4KY1L 3S35X 1WLHA 4WW2C 1FL3A 5ETUA 2QQQA 2NX5A 3MUIA 3VD5A 1GH7A 3KPPA 1OIMA 4K9EC 5ANMB 1A9BB 2GI7A 1NMBH 4OKVB 1RULL 1M71A 3AOFA 5EOTB 1IE5A 2R23A 3OEAA 3SDXE 4Q0XL 4S3JA 2OSLB 3O9WB 1JPFB 1CDYA 5GGQH 5KVEL 3QG6A 3HRPA 3FQRA 5C0CB 5DWUL 3VIJA 1HYSC 4X4YA 1WNOA 3D39E 2R8SL 5H35B 3SIMA 5CPSA 1TETL 1J84A 1MPAH 4WEMB 3CFBB 3RCNA 3Q6FA 4LARL 5ECJE 3PWLB 3K4DA 5IVXB 3REWA 1GC1L 4PRPA 4J6RL 2ATPB 4P5KA 4PGDB 1R3HA 4WO4D 3BP6A 2ILLA 3ZYOA 5F3BB 2CIPA 5HBFA 3U7WL 5F96L 2O93L 2DPEA 1FO0L 4YNYA 4ODTL 4NBXB 3PZ9A 4U1SB 2VMEA 3RBGA 5J06A 3F4VA 1GGYA 3SURA 1G6RB 4KKCC 3A4WA 1OF3A 3BIKA 5T33H 2GJZB 1T22A 2G2RB 1AQDB 1P69B 3VIHA 1YMMB 1LLOA 2R0KL 2JF1A 2EDLA 3CZLA 2EDJA 2BNJA 1MWAA 4WUUA 4WENB 2R2HA 4JHAH 3QCTL 5E0QA 2CRZA 3HRZB 2UWFA 5A6LA 4PJ9A 2WP3T 2EE3A 2F15A 4V1DE 1TFVA 3VRLF 4PJ5E 1QLFA 2WO3A 5AYQA 4ZAKB 1CWYA 4Z0XB 3QO0A 1K2DA 1XF3B 1E4XI 2RAMA 3IXAB 2IPUK 5JQ6H 4RBPK 1PIFA 3GTNA 3WD1A 1FNEB 2LAAA 3C8DA 4YZFF 4XZUG 1QSFA 4G7YH 3MLRH 3VX1A 3VD4A 4L29A 1BJMA 5H2BB 4WWID 5GGTA 3VJ6A 4NDMA 2QPSA 1DQMH 3S3SA 4S1RL 5CSZA 3NH7H 2VLKB 3CFCH 2ZUUA 3MRLA 1LE9B 1WCQA 3KPRD 1DBBH 2ICES 3F7VA 1I1FB 3MSPA 3IGAA 1H3XA 3C09C 2VSCA 4HKZB 3GBLA 2AI0L 3QZWB 1NCDH 5GGRA 1UXSA 4M6ML 1I1AA 1MI5E 3T0WA 2GEEA 5DQ9A 4HIHB 3TBSA 2ZXDA 3GHEL 3D2UA 2CK0H 2AS5M 2DTMH 2UUDH 1GXEA 4NO3A 5CJOH 2HT2D 2F8XC 4UFHA 5DDHA 4AXNA 5FOOA 3UAJC 2GJXA 1IQDA 2F53E 2A83B 5JPNB 2QQNA 2DT3A 3DUUA 1CU4H 5I77A 1G0DA 4Z7UA 4WI8A 4IRZL 2J8UB 4BKLB 5J13C 4J27A 3QHTC 3PWJA 4LCCC 5JHDD 2OSWA 4LRIA 2YPVL 3B9VA 1TR1A 4GW5B 4NFCA 1LD9B 5DJAB 1UM5L 2ZEYA 1Y6MR 4OZFA 4JQIL 3LMYA 3RUGF 4NQVA 3OB0H 4TSBL 3QYCA 3N9GL 3OR7B 5F6IC 2VIRA 4L4VE 4TUJA 3TF7C 2J77A 1I85A 4FQCL 5HHME 1TTGA 4HPYL 4P9ML 2I9LA 3HG1A 1NKRA 5DRZA 4NFDA 3LEKA 5I76B 5DMIL 4MDIB 5E2TH 4KXZI 1WP6A 2X89D 1UEYA 3QG7H 5EN2B 2XOMA 4HPOH 5GRVK 2ADGA 4PB9L 4EIGB 4N8PA 1J0KA 2ZIDA 2OK0H 4NQDA 1ZHLB 3T08A 3OZ9L 3MLXH 1EXUA 4JFHE 5IK3A 2XICA 1NANH 5CP7A 3DMMC 1PQZA 2BGOA 1KN2H 2Z8WC 4Y2OA 2J7DA 1X4XA 5IT2L 5C09A 2C1PA 2A73A 4JVPA 1E4WL 3HZMA 4TPRL 1RPKA 2J22A 2VSDA 4PJGB 3RTQA 3GSNA 4PB0L 5FF6B 1LJYA 1HJQA 4MAYB 2F8OA 4FA8A 2VL5A 4HQQH 1NM9A 5I30L 3BW9B 1FLRL 4F9LC 5E08H 3TLRA 1CR9L 2DSKA 1WBXB 4L9LC 1W3JA 4JKPH 4X6EA 2ZCHH 5I1DA 4J1UB 1HP5A 1EV2E 2V5MA 3ARDD 3JV6A 3VI3E 3DO7A 1DWHM 4P8VA 3SCQA 2Q76B 2Y06L 3SY0A 3WHE1 3TO4B 3KPOB 3UTTD 1OLLA 3RIFK 4Z7QE 4EKJA 2CESA 1B4JH 5E6YA 3ZT5A 3GBNL 2YPLE 3IB3A 4M1RA 3GBML 4U49A 4R2GC 1NWTA 1ZV5A 3AMCA 1F11B 4LLWA 1DQLH 5JMOC 4UFLA 3FOLB 3SCWA 3VH8B 2HFTA 2I26N 1ND0B 2Y6SC 3B2VL 4X6FA 3ZTJH 5C08B 1YPZB 4P3DB 1YMHB 5DT7A 3MJ7A 2WABA 1E9LA 5FDWB 4RGMB 4JPKL 2Z92A 4POZC 1WCGA 4MDJA 1ZT1B 3TBYB 3GKWH 4NRYB 4RSVA 4B3KA 2LFGA 2DMBA 3OV6A 4CD6A 2JCCE 1EFXD 4XURA 3V4UL 3V7AE 4NZTL 3CUFA 4Z7OE 1CICD 2QSQA 3HMXL 1FPTH 4KJWD 4XNYL 1IRAY 2OS7A 4PRID 4UI2A 3RHWK 2OR9H 3SDDD 5HYFA 4H2CA 3NIFF 3GKZA 3T0EC 4EQ3A 2ICWA 1CG9B 1UJ3A 2PBGA 4OLYL 3LRHA 3HC4H 3AHXA 1IZJA 1TTFA 3F7YB 2UY2A 1IGTA 4EI5C 4H0IA 1TPXC 1Q9OA 4HIIB 1KPUA 4HGKC 3SE8L 5E0CA 1HILA 4LSSL 1W9WA 4LHQB 3HUJE 3WS6A 1EBPA 4OD2A 5ICXA 3OMZA 5BS0E 1OB1B 2CRMA 2X40A 5EIQA 3OX8A 4K3EH 2WAGA 1DWAM 2YD4A 5HI5C 3HN3A 3QDJE 2PO6C 4QRPA 4IPLA 1FG2B 1UD3A 5DI8A 1RUKH 1LVEA 1A3RL 3B9KD 4A6OA 5LA1A 3VFVB 1LWJA 5F9DC 3U1SL 5D7IF 4XVUC 5IVXF 3O4LB 1IBGL 3LS5H 3MRKA 5JXJA 2PXYB 4G9FE 1TCMA 3FO0H 5GQBA 1YEIL 1MREL 4YDKH 5CLWA 2VDKH 1MNUL 3VFSB 3MRJB 3ULSA 1RIVH 1GQIA 1NFIB 2D31B 3ZKXB 2FDMA 5JA9A 5L2KE 4NYLA 4HUMB 3IJYB 3O0RL 5HDQH 3DVGB 1QO3A 2NY4C 1DQDH 3O9WD 3INUH 4QLJA 4ENEC 3MYJB 4I3GA 3PUHA 1YN7A 5C0CD 3HPLA 4TTGA 2VC2H 5JORA 12E8H 2D20A 3I50L 3RVVD 3QFDA 4IPNB 5EZIH 4IEFB 3QHFH 3A47A 2DSUA 2VWEC 1MRCH 3HB3D 3VG9C 1MWAH 3BWAB 1FL6B 2X1QA 3QIBA 5FD0A 3N1PC 3MFGB 3JTSA 5K9JH 1ETZA 4NHUA 2AJVH 5DK0A 5JXHA 4MZ2A 3REVA 1KTLB 5LKNA 4PRHA 2I60H 1YQ2A 4F15B 4I0KA 3GSRA 4NP4H 1VFFA 3MNWB 1E4KA 4UQDA 4ZENA 3CZJA 3H7BA 4ELME 3NA9L 3EDKA 2ZKHL 2OMBA 1GRWA 3P9MB 2C3XA 4Y4FB 4AC1X 4PMXA 2VWEE 1OAYL 4LVHB 1TMQA 1U8LA 2ED8A 3D3VE 2IAMA 1W72L 4JAMA 3V7AG 1YMMD 5GGTH 2FHBA 1OP5H 5GHWH 4WJ5A 5DUBB 5FIEA 3HI5H 4G8IB 1LG1A 3RIAF 4YX2L 4PG9B 1MVYA 2HJLA 2AERT 3CC5B 2EDEA 4UUJA 3E6FB 3RVUD 2X41A 2FWOA 3FFCE 4ZAKD 1DSFH 1C16A 3MNZA 4XPBH 5D70H 5EC2A 3BQUA 4PLJC 4Z76A 3KHOA 4GLRH 5GNXA 3QUYA 5ABGA 4BUHA 3MCLL 3U79A 3IFPB 2J8UF 3MGTB 2GIYA 2VITA 1ZLWK 3JUGA 4ZOCA 2LQRA 5IIEA 1FNGB 4JN1L 1GOGA 2QQNH 4BH7B 4DAGL 3NABL 4AT6A 2A6DA 4JFEA 3MROB 2XSBA 4QXWA 4NGHH 1KELL 1M7DA 1PY9A 1DBJL 1QYGH 2VLKD 1UD6A 3AHYA 3GXDA 4R3SB 3L2LA 1C7TA 1DBAH 4F7CA 4YDLB 1BQHG 4Y4HA 4HOZA 5HGDA 4MSWA 5B4MD 3C5SB 3GI8H 4YR6A 1UWSA 2A9NH 1OTUD 1VF8A 2HYMA 3BAEH 2AK4E 2NTSP 5EIYB 1W0WA 2CK2A 3SGKC 3FB5A 1OGTA 2J1KA 4W87A 1H3TA 1P4IH 1U8PA 4K8RD 4PJEE 3MCG1 3LEYH 1R3IH 4AG4A 1KT2B 5CSBA 2H1PH 1C7SA 2WMHA 3EBVA 5JMRA 2UZXB 1J8HA 1U2HA 1UG9A 1J88A 3CXHJ 4UT9L 5GRUL 4L8BB 1JDDA 4G8EB 2DWDB 2XI9A 4LKCA 3QUZC 2DGAA 2QQKA 5GZND 4PJGF 1RJYB 1MVFA 3PGFH 4M7KH 1HHJB 2PCPA 5FYLH 4O5LH 3VFPB 1LO2H 3F58H 1A7QL 4XVJL 1JWMA 4ACZA 2B9VA 4F3FB 1W9SA 3FXYA 4X9FA 5FA3B 5IMKB 3CXHK 1F8TL 3GSNH 2CGRL 3HPNA 1NCBH 2JEPA 3C7OA 1LEGB 1MEXL 3KWWB 4X4XB 5CHNA 3MLWL 2GVYA 1CL7H 1KXVA 1OF2A 1ADQL 4R4FH 1XF5B 2XA8H 3H9SA 3OPZH 5IF0B 1DJSA 4EUPG 1XIWB 5FHAL 3LQCA 4HZ7A 3FRPA 3QFJB 4KHTH 4P46D 4P8UA 4PS4H 4CU7A 1TVBA 2AABL 4JO4H 2YC1A 2H8PA 5SX5H 2A38A 3OKKB 1JPSL 1EOKA 1VACA 2W9XA 2HFGH 3MLUH 3TWCL 3FT3B 1DBKH 1YPZF 1HH9B 4KROB 4MD0A 3FL7A 2W61A 4M6OH 4MVBD 3EW3B 1P6AB 2YXMA 4NOBA 5FKAA 3QEGH 2W1QA 5GGUB 5IFJA 3L3OA 2EJ1A 2WSPA 3WN6A 1MCWW 4MAYD 5DMGC 3AZSA 1UM6L 5DHVA 1NOUA 3FO1B 4W70A 3WKML 2YK1L 4LSUL 5D8WA 4W81A 3MBWA 4QHNB 4WKHA 1SEQL 4MQXC 3SCOA 4FXKA 2O9OA 1PY4A 4OZGB 1J0YA 2X1IA 4LKXA 3TO4D 3ACGA 4PFEA 4DGIH 1BG4A 3O41B 1D7PM 2PW1B 4F80A 3O3EB 2EXYD 3BEWA 3VRJA 1Z5LA 4H20L 3ZDZE 1D6VL 3SJVB 4MNHA 5DZOA 2GJ6E 1IQWH 4XMLH 5IBLD 1U3HC 3IXTA 4HK3J 2HLFD 5FYJU 2EECA 1I8IB 2WLZA 3EYUL 4MJ5B 2BP3A 2BOBA 3BT2H 1R24B 5T3ZH 4PMRA 5C08D 1B2WH 2BNRA 2DYPB 5DZLA 2X4UA 4ALAH 4MJ2A 3G6DH 5CEZE 3D9AL 4JFUA 1WIOA 5HDOA 3ECQA 3WV0A 4XC3H 5A6AA 4DGYL 4GZJA 2WWCA 2ARWA 3MRFA 5ACMA 2HT4C 1KEGL 4JFFE 4I13B 5FGSA 5GS1C 3MLVH 1JHLL 3GMNB 1FP5A 2PC8A 1DDHA 3NZ8A 3AHZA 2BVEA 1WIUA 2ZOKA 1DVFA 4QCEA 5DF0A 5BVPH 2UYLB 1VFMA 2EEXA 1OAUL 5FUIA 5JDSA 1PX4A 2BVTA 1MVUA 1OM3H 4TNVF 4EN3C 1GJUA 4RFNB 1W3LA 1Q94A 1YNKH 4N0UE 5FV2A 3RU8L 3WDHA 4XUOA 3N06B 3CZKA 2VISB 5A2KH 3LB6C 1MHPL 4JLRB 3MODL 2IH3A 3B3IA 5DVLA 3QDHA 5F89A 4L8DB 2CIKA 3VXUB 5I79A 1CFVH 5IFTA 2GT9A 4YBHA 5A6BD 4NO0A 3HZKB 1MCQA 4TOYH 4UOQA 4L4TB 4XX1E 4XMPH 1I8MB 3L4TA 32C2A 5F6HJ 2VXVH 4OZIB 4LEXL 3S6CA 3UTQB 1JWSB 5A94A 2YL9A 5F9JA 4OD3L 3TCLA 1YEJL 3O4LD 1ONQA 1NGXB 1YY8A 2PXYD 3PTKA 3BIBX 4Z5RA 1J86A 1NCAL 5SV4A 1J5OL 1OGGA 5BMFL 4K2UL 1KB5A 4PLOB 1A14H 1VHPA 1YUHB 2RQ8A 2X4NB 1JUFA 3A6CH 4H88L 5IVZB 5CPQA 4P4KB 5GNYA 5DD6B 3TNMA 4MB1A 1WZMA 1CK0L 3EFDH 1CFTB 3CVIL 1NGWB 5E00B 1SMDA 2P47B 1SJVA 2YRPA 3FN3A 2W95A 1JNLH 1QG3A 4K8RL 4ONFH 3N13A 4XCEB 2RVAA 4ODXB 2Q8BL 1F2XK 2J1SA 4Z77B 4OOUA 4NN6C 2FGWH 3X3FH 2R4SH 4FN0A 4G43B 5I1HL 1Q0XL 4UT6L 1MW1A 1L7RA 1R3KA 4PY7B 5GISL 4M8QA 5EJ1B 4NQCA 5ADPH 3SGJC 3S37X 5KS9B 5KTEH 3WH5A 1US2A 3WFZA 2HKHL 3DOSA 4U1KB 2N4IA 2IALA 1TFHA 4MA7H 3SDYL 1E27A 4PJIA 4Y4FD 2AXHA 4QTIH 1CE1H 2G5BB 1C5BL 3RX8A 4P08A 1NAKL 4JZNA 5A3IC 2VI0A 1ZA6A 3RA7L 4N9OB 2DLEA 1DEEA 4LCUA 5BROA 1UR2A 1KOAA 4ODBD 2DQUL 1C08B 2FECI 1MHHA 1S9YB 5IHLB 2BHUA 4PJHA 1ISWA 1T0MA 1EO5A 4IMLA 3D5HA 4I48B 1M04A 3FQNB 1YYMH 5DEZA 4PJCE 1FGVH 3OKMB 5EU6E 5J11B 1CX1A 4BSWA 5I17A 3U9UB 1OAKH 4Z18A 3RWGA 1BIHA 1UM4H 4GH7B 4R8WH 2IANE 3EOAA 4P7RA 2V6HA 2V7NA 2GUOB 5C9JB 4KK8D 5D93C 2JE8A 3ULUL 4AG4H 2MNUA 4XX1G 1D5BB 4LCWA 2D03L 3ZE0E 2DJ4A 4WCYH 5ACLA 4H04A 1P4BH 5LVEA 2FYYA 4APQB 3LD8C 2MKLC 3M46A 4EEEA 3VFWA 3FQUB 5GS0H 4GKNA 3V52L 1RZKL 4UFIA 2QQKH 4E41B 1HQ4A 4RX4D 4X5LA 3K1KC 1NFDB 3ZT7A 3MRDA 1XZ0B 1S46A 5GRXG 4GAJL 1NAMB 3IJ9A 1FVDB 1BJ8A 3DO3A 4F58H 3MJ8A 4Z2GA 4C56B 2QEJA 4LAQL 2JJWA 3OKLB 2BERA 3MZGB 2XZQL 4JPWH 1NEZB 1GNYA 1MFBH 5EOTA 2ZX5A 4U3AA 4JGJA 3DRTA 1A6TA 3PF2A 2D7TL 5D71H 3I75A 5DUPH 4P2YA 1QPKA 2IEPA 2O5YH 3CTTA 3BO8A 3F5JA 2D9QB 2W9EL 1ESWA 3H9HB 1BEYL 5F9OL 4FTVE 5E9AA 1NGYA 2E7LC 3AM8C 4RRPA 2NY7L 1OINA 2Y72A 4XCYB 5D7LB 3TOPA 4UNTA 2NR6D 5D7IA 1MRDL 3PWLA 1S7RA 4WI7A 1KR1A 2YSSA 1MQKL 5AYUH 3SN6N 3GRWL 4PGDA 4NWUH 4BFIB 3P73B 2V7HB 2EKSA 4BDVB 1V3JA 4WI5A 2OX5A 1ZLUH 2AV1A 1XIWD 3QR3A 3NPSB 1JK8B 3PV6A 4P9HH 3BH8B 2H2SC 2JELH 3HNTL 4N8CL 1G6RA 3MBEB 3QFJD 4MS8D 3WKZA 1DFBL 2BNQE 4F33A 3FO2B 5LGHH 4OUEA 1CENA 1XCQB 3PQYB 4M5YL 8FABB 1JGEB 4X99B 2ZOLA 2GTZB 5F1IB 4BQ9A 5EO9A 1U3ZA 2IWGA 4KROD 3WE6B 4TUKH 4HEPG 4MOAA 5I2UA 3EGSB 1EGZA 1MFNA 1UC6A 3CZGA 3HRZA 1AGFB 4XZUB 2BSTB 2BVOB 3GMOB 3U82B 3BN9C 2V5RA 1V8HA 5EIIB 1Q9KA 4XPFL 4PUBH 4GKZB 3RDTD 4P99A 4ARYA 1CBVH 3WIFB 3N18A 1T1XA 3B6SB 4OF8A 1L0QA 1T5XA 4ZAKA 3LSOA 1XF3A 4S1QH 2B8OT 5B38G 3B4NA 5JXED 1N7MH 2NZ9D 4OFIA 3TN0C 4JGUA 4NIKB 4RGOL 3RPIB 1OGAA 3W81A 2WKLA 3SJVD 2BFVL 3WFEL 1N5AB 4F79A 1LMKA 2IGFL 3KJ6H 4F7EA 3C9NB 3IAGC 1CIYA 1CF8H 3BMWA 3O6ML 4HWEH 1DN2A 4XZWA 3NCYP 3MXWH 3VXOB 2LTQB 2DYPD 4OIIH 3TEUA 1I1FA 3IDXL 4XP5H 1JF5A 1T7VA 1WAAF 2AJXH 4OZIF 5BYWA 3D39B 3AFLA 4WW2B 5C8JB 3CMJA 3UC0L 5GZOD 4PBGA 5LBSH 4NF7A 2OL3L 3SCSA 4HIHA 3QNZA 4FF5A 3MV9E 2RJMA 1HX0A 1KCUL 3R1GH 1UB5A 3H7LA 4P5TC 2A83A 3LRSA 4TNWF 4NQXB 4D9QD 1BWMA 3VW3H 2J8UA 4NJ9L 4ZDHA 3BPOC 1NLDH 1QI3A 4WEBH 1S7TB 3QO1B 4W4NA 3VWKC 2FBOJ 1H3VA 3CH9A 3T09A 1G7PB 1EUUA 1MCPH 1F3DJ 3UESA 3VXUD 4MDPA 1MAKA 2DQDL 3OR7A 4HXAL 2X4QB 3A67H 4HJGB 4L4TD 3MOBL 1UA7A 4ZPTA 1R5IB 4HDIA 4D72A 5E24E 1GOOA 1ZS8B 1P2CB 4MDIA 2EO7A 3WFCL 1AGBA 5EN2A 4X9BA 4CUAA 3RKDD 4KKBC 4PV9B 4LMQI 4RGNE 3TJHD 4PT6A 3M8OL 4QRQA 2XWDA 5K93A 4V1DB 4PJ5B 4YE4L 1DQQA 2ZCLL 4YAQB 5KS9F 5E5MB 2QHRH 2QPUA 4GG8B 3G6JA 1ZHLA 3WO3B 2H9GB 4P4KD 5I3DA 3X12B 2FEDC 3BGFC 1JFQL 1YYLH 2B4CH 5GGVL 2ESVA 1TLKA 4OCMC 1NMCC 4JY5H 3CUHA 1NCCL 4FZEL 1F4XH 3QXWA 4P2OC 4PJGA 5KSBE 2IBZY 1BQLL 1R6VA 3MO4A 3EMCA 3M1BB 1JGVL 5EU4A 3KYOA 2WQRA 4D3CH 1A0QH 4DZBA 5L2JB 3LN4A 3JZ7A 4JPVH 1MFEH 1IT9H 1ITBB 2G60H 4PMZA 3V5HB 4HIEB 4UB0H 4KKLC 4GMTL 1UA3A 4WV1A 3KPOA 1A6PA 4WVRA 1PFCA 2F61A 1EHLL 1LDPL 1MI5B 4PJDA 5DQDL 1IM9B 3O3AA 5JW4Q 2H6PB 3MRNB 3ZHLA 5D2NC 3ZDXF 1UCBH 1RVFL 1BAGA 4K68A 4WHCA 4ZSOA 4NO2B 4KGLA 1J9CT 2MKWA 4OTXH 3ARBA 4JE4B 4KDVA 4XXDA 5TF1H 2YIHA 2F53B 1LEIB 4GRLC 3QXDA 2XM2A 4P3DA 2R0WL 4Q2ZB 2CDFB 3FB6B 1SJHA 4M5ZL 1PZ5A 3ETBF 2C7UB 4YC2C 3TBYA 4ZE5A 2WWMD 4L8SC 4Z7WB 5IG7B 1TZHA 5E2VH 5ISZB 4LASL 7A3HA 1H6YA 5D2NE 1ULVA 4QHLB 1V3HA 1C92A 2G3NA 1J05A 2I07A 3DXAE 4Q9QH 5DO2C 2GW5A 2WBKA 4L4VB 4D6EA 3OZPA 5HHMB 1GPOL 4HGWB 4XNQA 1U2YA 1RUML 5F7HA 5I15H 5J13B 4DGVH 1MHEB 3K4ZA 4LCCB 1CG9A 3GSUB 4XMKH 1A2YB 3DECA 3I2CH 2APTA 3F7YA 5F7WC 4HIIA 3MANA 3ZZ1A 3F7RA 4QRTA 3C5ZD 1EAPA 4FI9A 4NO5A 1OB1A 3N1QC 1P9MC 3MLZH 5K33A 1W32A 1FG2A 4YHYC 5FM5O 4M48L 4APQD 3QCUL 5DHXB 1QFPA 1A6AB 2C3WA 2WAHA 1J1PL 3VFVA 4Q74A 1NCTA 4AY1A 3NYDA 1AQ0A 4E41D 3W39B 1Q9WB 2BMKA 4GAGL 1OGSA 4Y5XA 3HU7A 2PXYA 2X9XA 3K74B 3Q1SH 3SKNA 1EJOL 5AWNH 3PL6C 1Y6KR 3PN8A 1PGRB 5IMOB 5ITFB 4HLZH 3DMMB 4CVZA 5EH1A 4C56D 3V0VB 4ZUTA 1MJ8L 3IIIA 1QW9A 4JFYA 2O9RA 3HMWL 5KW9L 3I02A 4AENB 2GFBA 1AO7D 2VZSA 4K7PX 3C2SA 3S98A 1JXJA 4X7DC 3IJYA 2ADJA 5ALBL 3JWOL 5B39G 1UWWA 2YPLB 3CPLA 1AP2B 5L88L 3BC9A 4MX7A 1IGCH 3MYJA 5F9WC 1KJVA 2EYTB 1INQB 5GRVL 3RWFB 1FHLA 3PWVA 2FECL 5EIVA 1TJHH 4L9LB 4K3JH 4OZ4B 1QSZA 1BM3L 4DVRL 2VH5H 2EIDA 4D0BA 5D7LD 4GQRA 3EJYC 4M82A 2NZIA 2HH0L 1MAML 1JNJA 4Z7VE 3B2UC 4HU0A 3GJEB 5HHXH 2AW2A 3OGRA 4R2GB 2JCCB 1KTLA 1NDGB 3ZOAA 3NMEA 4LLDA 4O4YL 1BGAA 3VNZA 3WH7A 2AOSA 3ILPA 1EGJA 2E9LA 1XD0A 3T2QA 2XA3A 1NWUA 1BWWA 1HE7A 5IOPB 2Y6GA 3P9MA 1EDQA 3MBED 1N0XL 3SCTA 4I2XB 3WUFA 3L95A 1G1YA 4QO1A 5EPMA 4ET7A 5JUEH 3PQYD 3SOBH 3TGXA 1IAIH 4G8FA 3KPSE 1JNNL 1U6AL 5DUBA 4DJMA 1Q4NX 1B9ZA 4G8IA 4JFOB 1BFVH 1QW8A 4JZOB 4GW4B 5BS0B 2ICEB 2QSCL 4FQXC 1CTNA 4KAQL 4WW2F 5CEXA 2Q86A 3QDJB 5B8CA 3GSOB 4QLLA 5F6HI 3OXRB 5I8CA 4LYRA 4R97C 1Q8MA 2ZX8A 4EI5B 1TPXB 1KJ3H 3OG6B 3UDWC 3PZNA 2HTKC 4NC0B 3CDFA 1QFWH 4ZPVB 1BQHB 4G9FB 3MGTA 1KNOA 4PTTB 2A74B 4XCNA 1GGCL 2GFTA 3GHBL 1GHRA 2BVPB 4H8UA 2XZAH 3DGGA 1H3PH 4LSTL 2IXVA 1H15B 1DL7H 2PO6B 1YJDL 5GGSB 4BZ2L 1U8OA 2WHMA 2H26A 4X98B 4LHUB 3U30C 1R5VB 5L2KB 1NSNH 2Y2WA 3CLEH 1AXTL 3MRBB 2DCKA 4R90L 1YEKH 2VXTH 1QFUL 3HHRB 4QXGL 1VFUA 5CMAB 1FRGH 1NH6A 1UHVA 3WNMA 3D39D 3X11B 1KXQA 4HHAB 5DC9B 4P5YA 2HISA 4OLZH 4FQ2L 4BZYA 3EYFB 3P1IA 1F58L 1Q72H 2NW2B 2EPKX 2X4RA 1KB9K 4R0LC 1NGZA 2P7TB 4XVSH 2ZG2A 3L6FB 2DBLH 2VDRH 5IB1B 4OM1L 1CFSB 5IKCB 1HYSD 3BCFA 3P4OA 1U3YA 3GK8H 4L8BA 5DJ2B 2W87A 2L0DA 2SEBB 3NIYA 5BQ7A 4G8EA 2RGMA 3DGCR 4WF7A 5I19H 1A02N 2AJUH 5I1IL 2IQAA 4ELMB 5EOCH 3L3DB 2CYGA 1EHAA 3QHOA 1RJYA 4JFXB 4W4OA 3LQMA 3HAEG 3VG9B 1HHJA 1ZWIB 4N9GB 4AK1A 3D3VB 2QR0A 4BSVA 3UYRH 2V5SA 2DQCH 3IRZA 4PLKD 4ZFGH 1NMAL 3LPFA 1FNFA 1F90L 3O45B 2X8RA 2NX5E 1FGNL 3OAYK 3NNGA 3GH4A 1XF5A 1CIUA 1F3JB 2EC8A 4H0HB 5DEFB 1XIWA 3H42L 4KKCD 4V1DD 1M03A 1C1EL 4PJ5D 4ZY9A 3TJEL 4ZO8A 2ENYA 2WHKA 3FFCB 3WH9A 4J3XA 1SVCP 1AFVL 1QZ1A 2WUHA 1OSPH 2ADIA 4B7LA 5DK2A 3OKKA 4M43L 2V9QA 3WFHB 4LF3B 1WV7T 2AAVA 1D9KC 3CFDB 1HH9A 5DQJA 5EA0L 5T5FL 4XNXL 1K45A 3BPCA 4PRWA 1JNHB 4KK9C 2DJUA 3MRGB 2YUVA 5M03A 4EQ2A 1D5IH 4Y1AB 3E8UH 3UEZA 3WUWA 2PNDA 5EO1B 3WELA 4ZEPA 5GGUA 5D1ZA 4Z7WF 4ONGL 4DW2H 5C0RH 4NKMA 4X80L 3BGAA 1IKFL 2Y4SA 5HGGS 4PRPE 2V3EA 1OAXH 3RJDA 4HXBL 2ZSWA 4OF0A 4YGAB 1YY9C 3MA9L 4LFHG 1LO5B 4HMCA 3DI2B 5CUSH 4FQHB 4AJ0A 2PW1A 4MMXC 4GO8A 5LWYL 2X0HA 5CJXA 3OKEA 1MI5D 1VGKB 5E99H 4NI3A 1W99A 3MV8A 1IM9D 1NCWH 5E9DB 1KJ2A 4K07A 5FYJE 4HKJB 2W0KA 4PJEB 4HA4A 3W38A 1E15A 1I8IA 2BXYA 1KUMA 4P2CG 2XHYA 2F53D 5AG8A 1WFTA 5TQ2H 4QLRA 4RWYL 3GMPA 3E6HB 1JHTA 4I3RL 4WUUE 1FZJB 1PG7H 3BUYB 4KJYA 5GRYA 1NLBH 4HWBA 1XV8A 2AK1H 3MCKB 3O11B 5FO9B 5MEQB 5ISZD 1A6UL 4RE4A 3LIZL 2AXFB 4I8DA 5C0DB 2JIXA 3SKJL 3W0KA 4G6FB 3V8CA 4MXWH 1SYTA 2VUOA 3GMNA 3UAJD 1MLBB 4L4VD 1ZBCA 25C8H 3ELAT 3DHUA 2IQ9H 2VABA 5HHMD 2QMKA 3QB7C 1JMXA 4DK6A 2A9MH 1BAFH 1E3XA 3IF1A 1WE5A 1BZQK 1QSFE 3IFOB 4EOWH 1A7OH 5FM8A 3AREA 3V0WL 5J1AB 3QUZB 1I1AC 3RX7A 4Z7QF 2Q6WB 1JP5A 5D6CA 5BV7L 4OUUB 1ITXA 2NW3B 3BKYH 5HNNA 4G42B 1PD6A 1X5FA 2IG2L 1R7OA 5HVFB 1HINH 2J4WH 3OJDB 4L8DA 1ZT4A 1RK1A 4MAUL 1E6ZA 5I1KH 2FR4A 4PYHA 3IFNH 3TM6A 5LA2A 2PKDA 4JKKA 5DXWA 4LRIC 5TFSH 3UTQA 1MCOH 1XGYH 3L4XA 3UZQA 5F88A 4LPVA 2QMJA 3B9DA 3LQZA 5FM5M 3IU3B 4F7PB 1JPTH 3MMEB 4LSPH 1Q0YL 3VWJC 1H4PA 3Q5YA 3T2PA 1D2KA 5D5MB 3MBXL 1PAMA 2JCCF 3RIKA 3B5TA 4Z7OF 1RU9L 1W2VA 1I85C 2DLTA 2R56H 3DMMD 5F1NB 5D6DA 5EBMA 4Z7UE 4AZIA 1UH2A 1YUHA 5IVZA 3SGEI 3UNPA 3C6SB 1MUJA 4JY4B 3V95A 3L9RB 1EGJH 1UWUA 3C5JB 2YPLD 1NGWA 1PKOA 3P77B 4QNPE 2FB4H 4A2MA 4GS7C 4OIFA 4NKQB 2GJ6B 1ZA3B 1KCVH 1EJ6A 2VDLL 2NQCA 3BGMB 4AIZB 4K71C 2IXUA 2OZ4H 2QLYA 1ZK9A 2Z0BA 3HG1E 1FO0A 4WGVB 4G43A 3BAYA 3FMGL 4XVTH 4A6YB 4URIA 3II1A 1IEBB 4JFQA 4X7EC 4RISH 3SQOH 4R2GD 3O8XA 2JLLA 5IJVB 1O7AA 2HJFB 1U3HB 5CZXC 1AQMA 4O2FA 4NQDE 4ZYKA 5IUSA 5IHUH 3CCHB 4OCYL 1TZ7A 3DARA 2Y6SD 4N1EA 4PF1A 1AC6A 1QNOA 2B7DT 4G8GB 3BKML 4POZD 5C09E 3WYRA 3CJJA 1J18A 1TG7A 2X10A 1L7QA 1A64A 1NDMB 2GQHA 4OGXH 1C08A 5H37H 5GS1B 4JZJA 5HI3C 1K4CA 4JCLA 4OLXL 5BS0D 4I48A 3QDJD 3FB7B 3FQNA 5EC1B 1Y0LA 2X9YA 4OLVL 1ZVSA 1T2JA 3U9UA 2BS9A 2DKMA 4EN3B 4GW1A 1E6OL 4EI5D 4WY7L 4LPCA 2OM5A 3VGAC 3GZAA 1QLRA 2OTUB 1UQSB 4HJJH 3VXQA 1WEJH 6A3HA 5DJCB 2R69H 3ROOA 1HI6B 5I1CH 4G9FD 1RZJH 3ULVH 4HTYA 3U0WH 3I6LE 1BIIB 3ALXA 1D5ZA 4C83B 4WUKL 5HI5D 2AJYH 4WKFA 5IW6A 2PO6D 4OGAC 4UILH 1NX9A 4ELMF 4HS6B 2ZUQC 2AEPH 4LHUD 1UOKA 4OIBA 5CQ1A 1WBZB 4WHDA 4APQA 5HXMA 2VNCA 4FQJH 5L2KD 4OQTL 5CCKH 2YEZA 3FQUA 4XVUD 4WFEE 3LPGA 3MO1B 4M8VA 4FLQA 3NJVA 4E41A 1CXLA 4RDQG 3CPUA 4HT1H 5J9PB 5TDPB 3DX6A 1O5DT 4P57A 3IYLW 4NKDB 3ZR5A 5CGMA 3S34H 1NAMA 3ZJ8A 1FVDA 3L5XL 4C56A 2BRRL 3HPJB 4HWUA 3DV4A 2DQEH 1MW2A 4OZFG 1CCZA 3FCTB 1ZTXH 3HC0A 2I5YL 1ZJBA 1NEZA 2Q7YB 1VADB 5IJKA 2AQ1A 1UY3A 3S35L 3K3QA 1G7LB 1VKXA 2NT1A 1GU3A 1S5HA 4OJFL 5EORH 3PHQA 1C5CH 2JTDA 2Z31A 4NN6B 4OJYA 1ZANL 3IU4H 1RHHB 1U95B 2EZ0C 1HOCB 4D1JA 4UZUA 4DTGH 3RDKA 3T2NL 3ZJKA 1GIGL 1FFPB 4QRPE 5DS8B 4JN2A 5D7LA 1AH1A 4ORGB 4N8VA 2YD7A 3WL9A 3D3VD 4CRPA 1UD2A 1FG9C 5J1SC 1IAKA 3ZKSD 4BFIA 3GIZL 2WBWB 4KMQA 4XAWH 2I9TA 5CKGA 2HLAB 3LKNB 1RJLB 3CFEA 2E7CA 5A8OA 4N1CA 4PJCB 4I0PC 5F7MC 1E0WA 3FFCD 3MBEA 1I5PA 5C0EB 3ZE2E 4PJEF 3D5OF 1D7FA 4QX3A 3A3HA 4DWSC 3TYFA 1FJ1A 3EOTL 4J3UA 1JF1B 1I7TB 1XCQA 3ZM8A 1AQKH 4NBYB 4X99A 1G7HB 3WQ4A 2JJSA 1KJ2H 1JDCA 1F4WH 1SYSA 4OI9A 1VPOH 1MQRA 2CKSA 1ZLVK 1QSEA 3PGCA 4Y0GA 3VMOA 5B38B 3EGSA 1RFDL 4Y1AD 1WFOA 2BSTA 2J6EL 3W24A 3QCVL 1RZ8B 4PRNB 2GJRA 4GRMA 5DD0L 3KLAA 3SE9H 5EIIA 3WL1A 3QUMB 3VFRB 1QUNA 4OCSL 4NCC1 4Q6IB 2X4OB 3KPLB 3FNDA 3APGA 4HWBH 4WTXA 2L7UA 4PLJD 5H8DA 3EO0A 3TO2A 1CZVA 5JPMB 4PRHE 4QHKI 2G3JA 1BZ7B 2BHZA 2D4FA 3G5VB 1QKZL 1SMOA 1UXWA 4IIQA 5D93B 2VDQH 2Z91B 2QADC 1HIMH 3TH4T 3MRHB 4Y4KC 5E9DD 2WBGA 3PDOB 2VRJA 4L3AA 5FYKL 2J3SA 3LD8B 4Q7DA 1IGML 1O59A 3LN5B 4AY0A 35C8L 2ZPKL 4LLQB 4NKOB 5GSVA 4OI8A 4HH9A 3HMXA 5A6SA 3QUYC 4PBWD 2A77L 4DUVA 4BSJA 4UIMA 5DRWA 4FTVB 1IKNA 2HMIC 4ZUVB 3O9NA 1YEGL 1A3LL 4G6FD 4DKAA 4KY1H 1CFQB 4HS3B 2VKXA 5I74C 1GPFA 1TNMA 5D5MF 3TV3L 1S7XB 4W5ZA 2CBIA 3ARTA 1T0PB 3C08H 1YQVH 3RJXA 5FOBA 4MQ7B 2E6PA 1RULH 2ARJQ 3DX9A 1A1MA 3VXTB 4R9HA 2GK1B 4M03A 4Q0XH 1H9VA 3QUZD 3OLEA 3MV11 4UU9A 5IM7B 5KVEH 3Q2CA 3H2WA 4OCRL 1BOGB 1K5NA 3KPMB 3ZDZF 2D22A 2DQHL 1JD7A 1TETH 2BNQB 1T4KA 1KXTA 3T77A 4HUVA 4JREB 2X4QA 3L5IA 1G9HA 8A3HA 4KRPC 3C8KA 4HJGA 1NQ6A 2X5PA 4LARH 4MA8L 1MH5A 4GT7A 4TVSa 1N2RB 1ZS8A 1P2CA 4P8WA 4XXCA 3ZTNL 5GS0C 4J6RH 3VVGA 3MYZA 1XH2A 3U7WH 5F96H 4CVXB 1FO0H 4ODTH 4HIJB 1KACB 3HNVL 1NBZB 5HBBA 4HX1A 2XNAA 2HVKB 3S2CA 1FDLL 2CUMA 4GG8A 3EJZD 1J8HE 1XGUA 2V2XB 2EXWD 5B3JF 5LXGH 3QXTA 5A8MA 5FL0A 2OYKA 2K7QA 4ZUSB 4OBSA 2R0KH 1OHQA 4CUBA 5K59E 2GJ6D 4MCYA 5DMGD 3L4UA 2WAAA 4AIOA 1KWKA 5HI4C 1U8MB 3N1AA 2H2PC 4JPIA 4J3VA 3ALGA 3QDMB 2ITCB 5IESH 5L2JA 1P8JA 1B3VA 4UNVA 5LAXB 4BH8A 1NUGA 1EO7A 1O8SA 3NGBC 3V5HA 4NNXB 4OGYL 3PXJA 1LP9B 5ESAB 3STLA 4F9JA 1TUXA 3U2SA 3VUPA 3TN0B 3W0WA 3H9SE 1U3HD 2X4SB 2H6PA 1W72A 4J3OC 4MXQC 15C8L 1HHGB 2BJMH 2CDEB 3MV9B 2EKJA 5IQ9A 4QRRA 4NO2A 1M7IB 5DJXA 3PHOB 1OQOA 4P9HC 3LEIA 2QHAA 4G8GD 1LEIA 2W60B 2FX7L 4S1RH 3WNOA 1BFTA 4JR9L 3BKJL 3R0MA 1NEUA 4YDIL 1FNLA 3CNKA 2YR3A 3RGVA 1Z32X 5FKPA 2HT4D 4Z7WA 5IG7A 1VIWA 4CCCA 2QF8A 1EEUA 5ISZA 4PBXA 2AI0H 2QV4A 4CW1A 1XGQB 1NOFA 1S7SB 2VAJA 3THCA 2YLLA 5BXFB 4WHTA 3VIGA 4P5TB 3H3PH 1JFHA 3GHEH 5K9KB 1R5WB 5B4NA 4E9LA 3WDJA 1QOXA 5DLML 1D6EA 4LCCA 3ORJA 5I8KH 1V05A 5EZLB 3N17A 2C8NA 4EN3D 3GSUA 1A2YA 4E42A 1AE6H 1DANU 1U58A 4IRZH 4GZIA 4B3LA 5IFHL 4AIXA 3LB6D 2YPVH 3ROLB 2WIIA 1UM5H 4ETQA 3BMVA 1XSKA 1DVFC 3LV3A 4JQIH 4P7NA 5EOQL 4TUOA 2BNRE 1EIBA 1GGTA 2B1HL 4L1DA 2FO4B 4L8CB 3D0LA 4HKXA 4TSBH 2GHWB 3GMRB 2ZG3A 3K4AA 4FQCH 5IBUG 4WHYG 1A6AA 3FZUC 4C4KT 2E26A 1C8QA 4HPYH 2HVMA 3VRLE 4A41A 4KDTA 4Y19B 5KSBB 4UTFA 1VB9A 3WDQA 1VCAA 1Q9WA 3SKMA 2PR4L 5DMIH 4NRXB 5B39B 3N50A 4ODHL 2HRPL 1V6WA 5DRNB 4ZFZB 1QA9B 1QBLL 3T1FA 2CRIA 3OSKA 1ISVA 3DMMA 4Q97A 1R86A 4ZD3L 3NJXA 2O5XL 1G7QA 3HR5A 3OZ9H 4PJCF 3CUIA 3SCMA 5I66B 1NMCB 4P5MB 1QACA 3SO3C 3B8SA 5TE4H 1N64L 3FB8B 4P2OB 4WFHE 5CD5C 5D4YA 3PZOA 1TZIB 5DD5L 1OWWA 2O9TA 3MRCB 1E4WH 4TPRH 3KYMA 4HGMA 1PDKA 3QWRA 4F9LA 4PB0H 2E31A 2DSZA 1T3FA 4QRSA 1G9EA 4WRLA 5E5UB 4OCLC 2VVSA 3F5KA 3ZE0F 1FLRH 1RUAL 4LLVB 4PJFA 2DL2A 2WMPA 1RZGB 1CR9H 1Z9SA 4KV5F 3DHJA 4I5BB 5DEGB 4DVBB 1B0GA 5TJWK 3FRPG 4HPGA 2Y06H 4CCEA 4D6JA 7FABL 4DEPC 5M3WA 4PGEA 5D2NB 1UY2A 3GBNH 3GBMH 3F7QA 2Z4QB 1KPRB 2AKRB 2A2QT 3DX8B 3FT4B 3WD5L 4C7DA 4GRLB 1UYWL 1IM3A 2VDNL 1TVDA 4F7TB 1HWGB 3FHQA 1BHGA 1IC5L 5EUKA 1J7VR 3B2VH 4I2XA 5BRZA 43CAA 2F9BT 5KVFL 4YC2B 4M7LL 3BDYL 2E7HA 4L8SB 4MCZA 1W9BM 3RWCA 2BX5A 1HIZA 3C7HA 4JPKH 1T04A 3RVTC 1VGEL 2B4CC 3JV4B 4X6CF 1G84A 3BHBA 5F3HB 3SQBA 4LBEB 3ZR6A 2XZZA 4JDVA 3V4UH 4WU7A 4Z2AA 4NZTH 3KAAA 4X8JB 3HMXH 4XNYH 1FYHB 4UV7H 3T0EA 3PHAA 3OXRA 5E8NB 4NQCE 2NY5C 3BSGA 3WEXB 1PMHX 1UUQA 4EI5A 3IS0X 2CDGA 4QXTB 3HKFA 4OFKA 3HI1B 1UR8A 2BNUB 2EYRB 1KQYA 3GIVB 2D3LA 1ULOA 1OWRM 2AGJL 4PJIE 5CEYB 2BVPA 5F1OB 3SE8H 4CD5A 4LSSH 5M94B 4H1LH 2AV7B 3SCRA 4KTYA 4YHYB 5CEZL 1INEL 3UJTL 4L4PA 1R5VA 2ZUWA 2CKRA 5FOJA 1JGLL 3KZSA 5I78A 1FN4A 3E1F1 4WDIA 2P8LB 4Q22A 1RZ7L 3U1SH 4FG6D 5D1QB 4PJHE 3PL6B 3DSNA 3X11A 4FTVD 5DGQA 4MZ3A 4YHKL 1AY1L 1IBGH 2P49B 1UB6B 1KB3A 4D8PA 3RVWC 1A4KB 2CLRA 2R29L 5E70A 1ISYA 3KLDA 1YEIH 1MREH 2DAVA 3VXRA 3W82A 3M7SA 4ZFFB 1MNUH 5I75C 4Z7VB 4Z95L 4NPYA 1KPVA 5IB1A 2QQLL 3DYOA 5F9WB 4HK0B 1JN6B 1WC7B 3O0RH 4HOXA 4BK5A 3W9DB 3NACL 4LCWE 2FZ3B 1X7QB 1CFBA 4KK6C 2ZE0A 1OW0A 4GSDL 5BVJB 1BX2B 3WLWC 4ELMA 4YHGA 5ALCL 1U8HB 2BNQD 2YD9A 3BD5A 4HV8B 3VFNA 1C8YA 5T5NG 1JTPA 4GRWH 3SCUA 2XG4A 3GFUA 3NAAL 4NN5C 2FBJL 2DN7A 1MJ7L 5EFDA 3FFDB 3EFFB 1LP9F 4NHCL 3O45A 3QQ3A 4Y5VB 3NIFE 1NCNA 2ATKA 2DI9A 3DRQB 2YKLL 4WLCA 2H2SD 3MACL 1QR4A 3DYPA 1KJMB 1A7RH 5JNYB 3S97C 1T1YB 2OQJB 3LDBC 2C4FU 5I2IA 2MQCA 3L5JA 4OV5B 2ADFL 3HFML 4HUXB 3WFHA 5AD0B 1LE5B 1W72H 1MFUA 5GRJH 1UEMA 1P4LB 1HP4A 3MRGA 4FQXB 2Z9TA 4FABL 3BN9D 4Y1AA 1CD9B 5HYQA 3BFOA 2Y6JA 4P00B 3FAXA 4YX2H 4G80B 2DT2A 5D7IE 3QDMD 4IOSD 1DLHB 4R97B 4NJAL 5FA4B 2FO1A 1I3RB 5EWIH 5F7FA 1DN0B 2V2TB 2WHJA 2G9HB 5KAQF 1CLOL 3CFKA 4ZFMA 4X6DA 1IVLA 1LO5A 3JUZA 4NN7C 3TN0D 1NKOA 1JL8A 2P24B 3FO9B 3QA3B 5DFVC 5CD3A 4LX4A 4X5XB 3RL2B 1B0RB 1OPGL 1YDPA 1VGKA 2OJZL 2RCSH 3MCLH 3BSHA 4TX8A 5E9DA 2XWTA 4TTDC 3MLPA 1LGVA 3AB0C 2UVFA 3MV9D 3U30B 4JN1H 4XPAL 2VJXA 1ZEAL 1M6OB 4DAGH 5IB5A 1X4ZA 4HJ0C 4ISVA 1QEWB 3WS3A 4PTWA 4RAVA 1DBJH 3IJSB 2Q7NA 3ARPA 2NYYD 3BUYA 3SGKA 3I6GA 4PP2B 3L5WA 4D0CB 5KSBF 4CBPA 3TBVA 3RM4A 1MLBA 1I3UA 4MJ6B 4P5TD 4W6WB 2FL5B 2QV2A 1ZB5A 2QKIB 4AD0A 1OGAE 5ETUB 3UTPE 3U4BL 1HCVA 2NX5B 4G6JL 1FZKB 3QUZA 5HHOB 3EZ8A 3KPPB 3NOIA 3QUML 2A6JA 4UT9H 4OUUA 1CDUA 2NW3A 1FFRA 4QLKA 4M4PA 1M71B 5BXPA 2WMJA 3OJDA 4HWZA 5L6YH 2CETA 3AQUA 5L9DH 4MAZA 5FUCC 5A3HA 3QEHA 1MFCH 4JVWA 1HXJA 1A7QH 4XVJH 3FQRB 4IRSC 1EZVY 4JFPB 2VERN 4X4YB 5IROC 1AGCA 3QHNA 1F8TH 2CGRH 2EH8L 1BF8A 4KKBD 1PG7X 4PP1C 3IKCA 1FFOA 4Y19D 2EIZA 1BFOB 3CX5J 3IU3A 4F7PA 1GORA 5DJYA 1NANI 2OP4L 4OZHB 4N0CC 3Q6FB 1UT9A 1AR1C 1HH6A 5D5MA 2BSRA 1G9ML 1K42A 1R7AA 2J74A 2UV3A 4LIQE 5FHAH 5FUCE 3REWB 1LL4A 4PRPB 1UFUA 1AXSA 1R3HB 1UKQA 2J8UE 3BP6B 3CDCA 2FEDD 2EXOA 1U8NA 4JY4A 2AJSH 2V5DA 3WH8A 4YNYB 1D9KB 2AABH 4RRPG 1CDCA 2DICA 5C6WH 3U36B 1JPSH 3CX5K 4P2OD 3TWCH 3KDMA 4GXVL 4A2LA 5I1JH 3BIKB 4KPHL 4MNQA 2JK5B 1KCLA 1T22B 1SYVA 3MGAA 1RV6X 2P43B 3BH9A 4UTBL 4JJHA 3MKKA 3T2OA 4KKLD 1UM6H 2ZSVA 4M6NL 2MJWA 3WKMH 4LSUH 1IARB 1BYCA 4A6YA 1MWAB 1E56A 4WUUB 2R2HB 1IEBA 5ELIA 1SEQH 1J11A 3ZDYE 1R0AL 1GAFL 1Z2KA 2ZUVA 5IQ7L 5J3HC 2O5ZH 4PJXA 1U3HA 1SHWB 1QHOA 1DEDA 4WW1A 3G6JE 5E8DH 2WSKA 4CL7A 4UTAH 2WUCL 1D6VH 3QO0B 2YD1A 2XYLA 3GBDA 2EDNA 4GRLD 4LVNB 3WSOA 4G8GA 4WV1C 2ESVE 1QSFB 3EYUH 3S37L 3QHZL 3SBWA 5JXAL 1CLVA 4L29B 5TPWL 3QPXL 5D7KD 1BPLB 4PJGE 1NUKA 2IH1B 3VJ6B 1T20A 3ARUA 2A3EA 3M6DA 1NDMA 2VDML 4YFLI 4DGYH 5GS1A 4FFWC 5KVDL 3UTOA 1RMFL 2ZJSL 5DO2D 1K6QL 3X17A 1KEGH 5FXCH 4JG0L 3ZLQC 3F7VB 1JHLH 2HKFL 3IGAB 2R7EB 1W1TA 3O3UN 3HLAA 3CIHA 4U6YA 2J1UA 5TE6L 1QVOA 4U05A 4BS0A 5GGRB 3AIWA 1UXSB 4EN3A 3F65A 1ODAA 1MIEL 1RZIB 1I1AB 4PJDE 1B1YA 5DQ9B 4Z7VF 5JLZA 3TBSB 3FW6A 3D2UB 2XQBL 2C3VB 5D4QA 2YC2A 4ZSOE 5DDHB 2X4PA 3RU8H 1TITA 2GJXB 1DWGM 3IDMA 2MCPL 3DUUB 4M1DL 1MHPH 3MODH 1AGEB 1FAIL 3PWJB 4D1IA 4HS6A 1XF2A 1O7SA 1BVLA 2K1MA 1T0NA 1ORQA 2M8XA 4NZUL 1XR8A 1X5XA 4LEXH 4AL8L 3VWJB 1IT0A 4NQVB 3T3PF 2EEBA 1LDSA 5D1QD 3PL6D 2VIRB 4TUJB 5TDPA 4OD3H 4AIUA 1YEJH 3P3YA 4LAJH 3P11L 3CUGA 4NKDA 2I9LB 4UOW0 4TX6A 3HG1B 1KG0A 3ZJ6A 1J5OH 5BMFH 2W38A 4K2UH 1OT5A 4H88H 2Q7YA 1CGWA 2ADGB 2BVDA 5FGBC 1ZJAA 3BXNA 3D6GA 1CK0H 2VQTA 1HL8A 4Y5XC 3CVIH 4K71B 4NQDB 1RHHA 1U95A 2ED7A 1DWJM 1EXUB 5IK3B 2WINA 4G9DA 5CP7B 2VDOL 2Q8BH 5C0IA 3EJYD 4ORGA 4DWHA 5C09B 2C1PB 5JIPA 2A73B 4XPGH 3HZMB 3B2UD 3NCFB 2YDRA 5A8QA 4AD2A 3RTQB 3GSNB 1RK0A 3RWEB 4UT6H 1BECA 4DOHB 4RAUB 5GISH 3SE3A 4LVOC 2VR5A 3NSNA 3RO8A 2VL5B 2DT0A 3OHXA 3PBGA 1YHTA 4YXHL 3RY4A 2N56A 2HLAA 4X6EB 1JF6A 5I1DB 4WI4A 1N8ZA 5L7XL 5FDYA 2IMMA 2HKHH 3DO7B 1QRKA 4TQEL 2A3AA 3MV7B 4QDQA 1KQZA 3GJFB 1GOKA 4ZE4A 3SDYH 5ADOL 2UZYB 4KRUA 5ESVA 5JIIA 3DPBA 1C5DB 1XH3A 5HDRA 1LG2A 2GDVA 3VFGH 1HEZB 3B5HA 4LLWB 1CE6A 2CJUL 5J4MA 4XX6A 2A6IA 4LFHD 5AUMA 2R0LL 4FQXD 4FXGB 4X6FB 3QQ4B 2WNWA 1NMBL 3MJ7B 3QT2A 1BREA 5D9NA 4I1NB 2Z92B 3FQWA 4GLRI 4PTVA 1PEZA 4MDJB 2X4OA 2ERJC 5T3XL 4GQPH 2CEQA 3VGAB 4YFLF 5JPMA 2HTKD 1B30A 5CBEA 5GS3A 1BYDA 1L0PA 2HP4A 1KGWA 3BAKA 3G5VA 5IVNA 3CBWA 1AKJA 2ZXQA 2ZUSA 1MPAL 4U3XA 4XWOC 5B8CC 3PDOA 2QQMA 2ICWB 1QPXA 4XAKD 2ZUQB 1TZGL 3ULUH 1UJ3B 1IGIL 2D03H 1UWGL 1WWBX 3BP4A 2HRLA 3LN5A 1IGTB 1EK3A 1UYXA 3BAJA 1KPUB 2PWEA 5C0NC 2PYEA 1GHFL 1KCRH 1GGUA 4YHOL 4X6CA 3V52H 1RZKH 4HZAA 4LLMA 2BBAA 3OX8B 3BRGC 2ZCKH 2CMRL 4GMSL 3GNOA 3LKRA 4QRPB 4ZUVA 3S8WA 5DI8B 4GAJH 4HS3A 1U8QA 4OZHF 1E55A 3BRDA 5EBGA 2ESCA 1WDQA 2XY1A 3P9LA 4LAQH 5C0GA 2ED9A 3GMLB 4MQ7A 6FABL 2WWKT 3MRKB 2YKKA 4YK4C 4U0RC 5SWQA 2NX5D 3RZWA 2V17H 2X4TA 2YMXL 4LHJB 3AM8A 3ULSB 5GRWA 4AAXA 4LPUA 2ORBL 1CXEA 2W9EH 3WN5C 4HMEA 1BOGA 1BEYH 4PMYA 1RZJC 1IAIM 1U8JA 4WGWB 3ULVC 4NYLB 1FNSL 4LSVL 4HA1A 4OLUL 1GONA 1PVHA 2NY7H 1QO3B 1DZBA 4BFEA 1CL7I 3HCVA 4G7YL 4QF1A 5MHSD 1MRDH 1KXQE 5BRPA 3HPLB 1Z3GL 3EMZA 1N2RA 5JORB 1MQKH 2LAGB 1HZHL 3GRWH 4R5EA 3MREB 3AUVA 1URLA 2W47A 3RWDA 3QFDB 3KG5A 4I0PB 4K94L 4W4OC 4AZGA 4HIJA 3BKCL 3ULVE 3L3KA 1P6WA 1U9KA 3VFOB 4MLSA 3JTSB 4PRPD 4CNIA 1QFWM 3HNTH 4N8CH 1ETZB 4HSQA 1SY6A 4NHUB 5DK0B 3LE0A 3REVB 4WWKC 1E0OB 2V2XA 4PRHB 3RI5F 4X7FC 1DFBH 1J1OL 1D9KD 3GSRB 1US3A 4KK9D 4M5YH 5F21B 2EDTA 4ZUSA 3H7BB 3DURA 1NGQL 4F66A 4KQ3H 2X0YA 1F6LL 5J6HB 3N0PB 5CJOL 4Q9RL 2VL4A 1U8LB 1K8IA 2VZRA 4UT7L 2IAMB 2W07A 3QDMA 3G9AB 2D3NA 1LO4L 1YN6A 2WVTA 5DVNA 4IJ3C 2J62A 5LAXA 4XPFH 5DTFB 3OGCA 2NW0A 1YY9D 4KUCF 4NNXA 3QH3A 4B53A 4KRMB 1LP9A 1PG7W 4WUUD 5C0JA 2FJGA 5KVGH 2QADB 2HJLB 2ICWI 1S7QA 4Y4KB 4OD1H 5D1ZC 4HG4J 5A69A 4MNGB 4P59L 4UUJB 2XIBA 1HSBA 2FWOB 4RGOH 5FAAA 3PNWB 3T0DA 5JOEA 1HHGA 1A5FL 1C16B 3MNZB 2BFVH 3WFEH 1OH4A 5EC2B 2VT0A 1M7IA 3PHOA 4RDQF 2IGFH 4Z76B 3QUYB 1TVPA 3CHEA 1S7VA 3FN0H 3LS4L 2W60A 1HJXA 1QSFD 3O6MH 1KIQA 3EB7A 2VITB 4M3JA 2AQ3A 1EEQA 5CJXC 4HG4K 3MOQA 2VZOA 3IDXH 2XPGA 4UV4L 2OK0L 3QDGA 2A6DB 3U46A 5I74B 1XGQA 1M7DB 3UC0H 4QXUL 2F74B 2MCG1 5JW4R 5BXFA 2OL3H 2WZPD 4Y4HB 3KJ4C 5HGDB 4MSWB 5IDIA 2EEAA 3STBA 5K9KA 2CIIB 4YR6B 3RL1A 1KCUH 1IGJA 5EZLA 3LPPA 3I6KB 1W0WB 1I1AD 3TBTB 5H37G 3VWKA 3FB5B 1YNLL 1OGTB 3MV8E 4NJ9H 5IBUB 3WXWL 1JTTA 1U8PB 5CG0A 3D2UD 4X4MA 4TTUA 4R7NB 2Q87A 5E08L 4M1GL 1B3XA 4Q9CA 2N7AA 1NBVH 4KC3B 4E0RA 1JPGA 1J8HB 2WVUA 1ROWA 1RD6A 3BD3A 1A1NA 3UERA 2FO4A 3OR6A 2DQDH 5GGVY 4HXAH 1JGUL 3RM9A 4YPGA 3AREC 3MOBH 4LKCB 1UQYA 4ZFOL 3VWJD 4Y19A 5C07B 1T66D 1V03A 2PCPB 2Y5EA 3WFCH 3RIAK 1JWMB 5DRNA 2O61A 4ZFZA 4ACZB 3T3ME 3ES6A 3AFBA 3M8OH 2VUYA 2WN2A 4BK4A 3HG1D 4P2RA 4YE4H 1YEHH 3NFSH 5GS2H 3PJSA 3A4XA 3D87B 5CHNB 1JZ2A 4JX0A 1ED3A 1OF2B 4P5MA 3H9SB 5F7NC 1KLUB 4YHML 1JFQH 1OGBA 4MB5A 4KKAD 3HZVB 3VXMA 5IR1A 1XF1A 4NQDD 1HKJA 1NCCH 4FZEH 3SPVB 3BPLC 2BC4B 4NSKB 1BQLH 2YC1B 4K7PL 2H8PB 5D6DC 1OTSC 1JGVH 3NGBB 3VDHA 4IHOA 1VACB 4CDHA 5FYLD 1GW1A 4HBCL 4MB3A 3WHXA 4MD0B 5C09D 2B4KA 2YLAA 5EFIA 1B2YA 2XQYK 6CGTA 2B0SL 4XP4L 3RTQD 4GMTH 5FKAB 5IFJB 3QUKA 3L3OB 2DF3A 3SUSA 5JW5A 1AC0A 5CZXD 4ZUWA 1F4HA 2EDOA 2Y64A 1NGPL 1EHLH 4I18A 4EVNA 1LDPH 2Z4QA 3VD3A 1KPRA 1UY0A 3F5LA 1RVFH 4LKXB 2DLFL 2XG5A 2XRAL 3MV7D 2D24A 5TDOA 3SCVA 3WUWG 4LPTA 3VFMA 2EPMX 5AG9A 1Q6DA 1MPXA 3BEWB 3VRJB 1Z5LB 2UZIH 3L3HA 2XTJC 2R0WH 2E7BA 5AZ2L 2XWEA 3IXTB 4KGJA 1TVHA 4M5ZH 5I8OL 4RBPH 2W3JA 3IETA 4P2QB 5D1XC 3U7YL 3I6LD 2BOBB 4LASH 1TVNA 1DANT 2WBJA 2BNRB 3O6LH 4UI9L 4N0YH 4CU9A 2W5FA 1CD0A 5C1MB 3ARWA 1JV5A 1RUMH 4GO9A 1JDAA 3IDGA 3MRFB 4LLUB 2XTJE 5FYJL 5HOSA 1J0HA 3AIEA 2CLVB 1OCWL 4DN3L 3U4EA 1DDHB 2G3IA 3GIVA 2DM3A 4A45A 4PCTA 3CU7A 1UADC 2ZOKB 1DVFB 3W2DH 5HSFA 5CEYA 5EZIL 4ZZ5A 3QHFL 4UIKL 3U7AA 2WCSA 1V0LA 5EBWA 1GYAA 4XNMB 5JDSB 3D69B 3PDDA 1MVUB 4RMWA 3OTTA 5K9JL 1Q94B 5T3ZD 3ZE2F 4JFDA 3CVHA 1IEHA 2EQDA 3MRPA 3G5XB 3QCUH 1K8DA 2JKXA 3KL5A 2IH3B 2H41A 1F6AA 1JIBA 1E6SM 3M07A 1R3JA 1PKQB 2CIKB 2E3ZA 2HJKA 2GT9B 4NO0B 4GAGH 4QRPD 3VE0B 3FN9A 4GKLA 32C2B 1EJOH 3RWHB 2VXSL 3D85A 1EMTH 4LHSA 5MEOA 4YHIA 2WIMA 3SO3B 5F9JB 2JF7A 1MJ8H 1F45A 2Q20A 3HMWH 4S2SA 5KW9H 1HSAB 1YY8B 5I1AA 2WMIA 2Q1EA 3OXSA 4Z5RB 5ALBH 1YNTB 2EZ0D 3JWOH 5SV3A 1XSIA 5L88H 4NM4L 3TBWA 3TNMB 2P8MA 2WNGA 2HFFB 3UR7A 4G7VL 1U8HA 4D9LL 1F4AA 4DN4L 1MFDL 4DVRH 4HV8A 4U2ZA 2G8ZA 1HHIA 1T21A 2DQJL 4DEPB 2HH0H 3V9FA 4U1JA 1MAMH 5C6TL 4PRAA 4KK5C 4HC1L 2QQNL 5HGHB 4JRXB 5HYSA 1RAMA 4HZ8A 5IEHA 1KULA 2V2WA 3GB7A 5LG1A 3PWPA 5LCWL 4O4YH 4C56E 5M5DA 4I0PD 5KANG 3K1DA 4QPWA 5KSVA 2C7FA 3L4VA 5FO7A 1KC5L 3WD4A 1B0WA 5I16A 4M8QB 1UWEL 1MCKA 1ZHBB 3QIBD 5J12C 4NQCB 2VXQL 3KXFA 4POUB 1CDHA 4XUTA 3BE1H 2A9NL 1N0XH 4PRHD 2Y36L 4NUJA 4OLWL 1T89C 3UETA 4HUXA 2IFGA 3V6BR 5A6KA 2J7BA 2IALB 3G08B 4TNVK 4XRCB 1BFNA 1E27B 4PJIB 2WN3A 4G5ZL 5D7LE 3VOCA 3LEYL 2C9AA 4GXUM 3TH3T 1EEZA 1MSPA 4W86A 4JZNB 5CINL 2A6KA 2IAMD 2QSCH 1QLEH 4PREB 1ZA6B 3TYGL 4TUFA 5FA4A 3IANA 4ZS6C 4OM0L 2F5AL 4Z6AT 1L9MA 1I4FA 1FSKC 1KR0A 5E4EC 2RGSA 5HGBA 3IS1X 1MHHB 3EO1A 2VE6B 4CMMA 2DH3A 2QADD 4PJHB 2P24A 4IMLB 4B9YA 4X5XA 3RL2A 4Y4KD 4HKBB 1CNVA 1LO2L 1TNNA 5KOMC 4BSWB 3WL0A 4PY8J 1GGCH 4LMQE 3GHBH 3D18A 3QULB 4LSTH 3RWGB 4UNIA 1YJDH 4JO3L 5C2BL 3T65A 4BZ2H 3QUYD 5A2FA 3L5HA 1QSEE 2VR9A 3WIHL 4IIQC 4R4FL 1CYGA 3MSDA 3T0VA 1V02A 2EO1A 4LCWB 5BZDB 2HMID 2DIAA 4R90H 1QFUH 4QXGH 3AXIA 4PP2A 1E72M 2FYYB 3OIHA 4D0CA 4BA0A 1W9TA 2IPKA 1ZE3C 4R0LA 2UY5A 4GKNB 1H2JA 4FQ2H 4WI6A 4LCYA 4Y4HD 5AYIA 1F58H 2N1KA 1HQ4B 3BLKA 1LQ0A 2FL5A 3DROA 4M6OL 3VTRA 1T2QH 3MRDB 4DKEH 4XP9H 3RY5A 4RFEA 2QKIA 4ZG1A 1IKNC 2HN7A 2VCCA 4XHQA 2DEPA 1FZKA 4CJ1A 3VD9A 5HHOA 4OM1H 3MJ8B 4PIRF 4X9IA 2E9WA 4DKFL 4OF7A 3QHMA 3N1MC 3RWJA 1MQPA 5I1IH 4WFFD 1VEOA 3DRTB 1A6TB 3AIUA 5HJ3B 3PZQA 1J8HD 2LVEA 4NN5B 3I75B 4DGIL 2WB5A 4AEEA 2HT3C 3BO8B 1FVCA 1GOWA 4JFPA 3AYRA 5GS0D 4OIAA 3I97A 1JNEA 3U0TB 1IQWL 1NGYB 1NMAH 1U8KA 3IDYC 1E0XA 5AY7A 1BFOA 2CKBA 2C4FT 1NEZG 1F90H 3C60A 1AD0B 4NNYA 4OZHA 1QP1A 5LQBL 2WQ8A 1FGNH 3LEVL 5D7IB 3OF6D 1S7RB 4W84A 3WF4A 1B2WL 3KPQB 1CI5A 1YECH 2YSSB 3H42H 1C1EH 4KZEL 3V2AR 3W11C 3LDBB 3TJEH 3NCJL 1P7HL 2DQXA 2EKSB 2Y9RT 1D9KA 4XXCC 1RZFL 3H9SD 2AV1B 3U36A 1UYQA 4N8VG 3F6LA 3PV6B 3MLVL 5HI4D 5J56B 2H2PD 3BCDA 4DK3A 1UACH 5GNZA 2JK5A 4F33B 4Z78A 1OSZA 5IWLC 2LE9A 1KGXA 3WNLA 5DA4A 2ZOLB 4XV0A 4GQ9H 2CH8A 2CUIA 5EO9B 1OM3L 4F8QA 5IFPA 1KTDA 4NN7B 5DJDB 2AJZA 4Q6YA 4KI5C 5CILL 5E8PA 4HXBH 3QOMA 1B6DA 2FIKB 3QQNA 2KPNA 3MA9H 5FL1A 3KL3A 1GMMA 1EQPA 4XBGA 1Q9KB 4E5XA 4MXQD 3AB0B 1NC2B 4FQLL 5IMLA 1T1XB 4DM2A 1T5XB 3LSOB 1F42A 3LRGA 5EULV 4XMPL 1A47A 5F72S 2VXVL 4URTB 2CNCA 4M61A 3DSFH 4H8WL 4NC1C 1EDTA 4KI5E 1VDGA 5D8JH 5HDLA 2BGPA 4NCC2 4RWYH 4GRWE 1OGAB 2IH1A 5LYRA 4L4OA 3P6BA 4W8JA 4F7EB 1C91A 4P2QD 1CLCA 2D7QA 1EZVX 4S11A 5EBLB 3A6CL 2X44D 1A6UH 2IFFL 2MANA 1ZLWH 3C6LA 3CVHH 3SKJH 1XHGA 2BNRD 5AEAA 2VZ3A 3O6FA 1SDDB 1MCLA 2HWZL 4NC1E 3W0WE 2YL8A 5AZEL 1JNLL 5D8ZA 1M53A 1CXFA 3MUHL 1S3KH 1RZIA 2H3NA 3RGVC 1PZ3A 3WIJA 1G7MA 3MQIA 5E2WL 2FGWL 1QNQA 3EBAA 1X5IA 3QNZB 4AMKH 3W28A 4QRRE 3E0GA 3V0WH 2C3VA 3VXPA 4S1SL 5T5NF 5T1LA 3MRMB 1DVFD 4XPTL 1UB5B 4FQIL 5BV7H 4Y16A 3LRSB 4X7SL 3OAUL 4MXVF 3ZKNC 4GG6B 1WFNA 1AGEA 4RNRB 4ZDHB 1G01A 3FZUD 3GNPA 4RMRA 4XB8A 1BVZA 4Z7WE 1UZ6F 4WFHD 3ARFC 5ISZE 1XGTA 2RHEA 3O2WL 5DZNA 3VWJA 2XZCL 3PUCA 4PMOA 1GGIL 2FLBT 4KUZH 1CD1B 4N5UA 5GJSL 2OWXA 4Z8FL 4NO0D 2J8OA 2YD2A 1Q0YH 4JO2L 2R2EA 4XZBA 2G41A 4ZPTB 3MBXH 2YOCA 4HDIB 3IVKA 1GNXA 1C12B 2VKWA 5CXPA 1J10A 1AGBB 3MPCA 5CD5D 1GCYA 3OL2A 4IOFC 4KDTC 4QRQB 1E3ZA 4ORZC 1KGCE 4Z2IA 3WJJC 2G75B 3QRGL 3L3GA 1DQQB 3QUXA 2J47A 2DTSA 3G6JB 1HNGA 1CICC 3LKPB 1FIEA 1MXDA 4UFJA 2YXFA 2VDLH 4PJIF 4XUPA 3ESUF 3VDAA 4CDGC 1IGFL 4ERSL 2JEQA 1G7JA 5EZJB 2ESVB 3SCMC 5HHNA 1OOAA 4YXLL 4R8WL 2X9WA 1A7PH 3AXLA 4QB6A 4NZRH 3RWEA 3FMGH 2J5LC 3BZEA 2WC3A 3CH1A 4RAUA 3TESA 1L9NA 2D7NA 5EU4B 3KYOB 4CD7A 9CGTA 4DZBB 3PZVA 3LN4B 2EDFA 4JRXD 1WB0A 3AMKA 3I3DA 4OFPA 4PJHF 1UGNA 5DUML 1OD3A 4UDUA 3N85L 1IAII 4WV1B 4OCYH 4MNJA 4S3KA 3MV7A 1DBML 1UH3A 3GJFA 3TA9A 4NQCD 3ESVF 2QQKL 1WDPA 1CZTA 1WO2A 5T1KA 2BCKA 1C5DA 5HPCA 1KFAL 4ODSH 1FP9A 3MXVH 4PJDB 4Y8AA 3BKMH 4TNWK 2Q8XA 3O3AB 3RVTD 1HEZA 2GK0A 3WFDL 1GOFA 1HVXA 1BBDL 3TPUA 2JF6A 4ZSOB 5F7EL 3ARBB 4FXGA 4XXDB 2LU4A 1IL1A 3QQ4A 4L3CA 1FORL 4GBXA 3QXDB 3WO4C 4PJFE 5DA0B 1ZMYA 4JPWL 3WY1A 1A8JH 4OLXH 1MJUH 3UCQA 1SJHB 1PZ5B 4HS8L 1QFWI 3NFNB 1S78C 1TZHB 4K23L 2P5EA 4OLVH 1N0LA 3QIWA 4QCIA 1AHWA 4NUGL 3SO5A 4U1LA 1G0YR 3NZHL 2XGBA 1E6OH 1VFAB 2I07B 4WY7H 3SE4C 3EJJX 4O2EA 2DQTH 4XNQB 1WJ3A 3D25A 2LS6A 2JB6A 1IAMA 1X5ZA 2PYFA 5MEPB 4OMCA 3QNXB 2YD5A 4I2XE 3RVVC 5BRZE 4WUKH 3UPAA 4Y5YC 4Q7NA 5AYUL 4MGXA 2EBNA 3EDFA 4J3WA 2GJJA 3HB3C 4NWUL 4YQXL 4M81A 3HNMA 5BOPA 2E40A 5AYBA 4QRTB 4MD5B 4OQTH 5E7FA 4XBPB 3R0NA 1EAPB 1SEBB 4NO5B 4LCWD 4D9RE 3BESR 1WCBA 1WWCA 4PJAA 4OCWH 3RVWD 3T0EE 1M4KA 4HFWA 3ZL4L 3WF2A 1WFUA 5LGHL 3SUUA 5HHPB 4PSPA 3G5ZA 1Q38A 3NBNA 4PGCA 5J0BA 3KE0A 2JD9A 3CK0L 3N12A 2R0ZL 3X3GL 4BYHA 1LK2A 3RWIA 2BMKB 2CKBH 1PSKL 3GMLA 4Y5XB 2I5YH 2N7BA 4QOKB 3SKNB 1SVZA 4KK6D 4L4JA 2ZX7A 3CHFA 4OJFH 3WLWD 4CVZB 4PUBL 4ZUTB 1SBSL 2XXMB 1ZANH 4QCFA 4JFYB 5A6JA 2P42B 5EFFA 1EQCA 3I02B 2GFBB 1BP3B 3T2NH 1U8IA 3PV7A 2ADJB 5DVOA 2XFXA 3CPLB 2BV9A 1N7ML 4MX7B 4LVOB 5IHBA 3RVXC 2NCMA 1KJVB 3GSXA 2GSGB 3BYTA 4WKAA 3OKDB 3PWVB 4XPHL 5INCA 4EDWL 3P0VL 4MWFA 1OW0C 4X0NA 1DUZA 3KJ6L 3MREA 1ZSDA 4D0BB 3GIZH 3TNNB 2DKSA 4I0PA 2WZIA 3VXRE 1DHKA 4CU8A 3VFOA 3SDCA 5FEBA 3WQBA 2D2OA 3LPWA 4DWSA 5HYEA 4HA3A 1I1RA 5DJ8B 1CGSL 4LLDB 3ILPB 4YJZL 2XWJA 3EOTH 1VJZA 3DVNA 1XCXA 5DR5H 4DCQB 4B9ZA 1BGXH 4QX2A 1ZOXA 5ID0A 3VI4F 1EERB 2F54A 1MRFL 5J6HA 2PWDA 4XUYA 2ID5A 3L95B 3UJJH 1RFDH 1L8NA 4ZXLA 5EPMB 2O92A 2ERJB 4DEQA 2XVLA 1X4YA 3QCVH 3CZFB 4G8FB 4M3KB 1AQHA 3UR8A 5DTFA 4EZMA 5KVMC 3PUIA 4OCSH 4UCFA 1TDQA 2DH2A 2NT0A 1BJ1H 4PR5A 1ORSB 2Q3AA 1KB5L 2CKNA 2Z8SA 5DFVD 3KR3L 2BDNL 2VB5A 3MV01 4UAOC 1MCPL 1MQQA 5CEXB 4A3YA 2Q86B 5B8CB 2PTTA 4Y4KA 5IMMA 1ZGLM 1H5BC 4MNGA 4TTDD 2EPLX 1NC2D 4O2CB 4CVUA 1KCKA 5DJZA 3PNWA 5I8CB 3A67L 4XHJC 1XH1A 1QTYT 3KNBB 4HJ0D 5FYKH 5BWFA 2ZWZA 2FSEA 4GG6F 4LLYA 5C0BA 3BN6A 2VQ1A 3JXSA 1KNOB 2R1YA 35C8H 2ZPKH 4XCNB 3W6LA 1OGAD 3AS3A 3UTPD 3DGGB 4Y1AE 3DV6A 4M7JL 2YN5A 2A77H 3W26A 2QHRL 4KI5M 1HCFX 1U8OB 2R2BA 2H26B 3WSQL 3U5YA 3BZFA 4PYSA 2OYPA 2F74A 4UBDC 2GY5A 1KN4L 3U0PB 1YEGH 1A3LH 4P46C 3VG0L 4X6DE 2B4CL 3LH2L 1EA9C 2CIIA 4Y89A 4JDZB 4JY5L 4YK4B 4U0RB 3KS0J 5EUOB 1F4XL 5JDJA 5JZ7C 4UZSA 3I6KA 3TBTA 1V7ML 5E9DE 4LHUG 3WHE0 4MVBC 3ZDYF 3WN5B 2X4RB 2XACC 4R7NA 3I2GA 1FZMA 1NGZB 2F58L 4FOMA 1X3DA 4NM8H 4U7SA 1QVBA 2W1WA 4MAYC 1FNAA 3PABB 2HLEA 4UB0L 3PZIA 3G6JF 3OJ2C 4OCRH 4XP1H 4ZO6A 1WGOA 3ULUC 4OB5L 5A95A 3Q0HA 3P4OB 3JWDL 2Z35A 1I7RB 5BQ7B 4PP1D 3TO4C 2IQAB 2ZG1A 1P7QB 2FLRT 5C07A 3KHQA 4N0CD 1H11A 2EXYC 3ZTNH 5LA0A 1RZKC 2QR0B 4BSVB 3OF6A 2VMCA 4WWKB 4I4WA 1E4XL 4W4ZA 1FDLH 1A4JA 5DRXA 5SX4H 4ZQKA 4TSCL 5ERWA 2NNAA 2E6QA 2FGLA 1KLUA 1CLZL 3S36X 4BQ6A 5E2JA 3K2UH 4PJDF 1MIML 3HZVA 2BY1A 4PY8I 3GJFH 1EEYA 2YFZA 3SPVA 1XGPA 3BZ4A 2BY0A 1JRHI 2BC4A 4NSKA 2YUZA 4IJ3B 5I15L 1XGRB 2ADIB 2DM4A 3MUGA 5DK2B 7TAAA 4YHPB 4PMVA 4JFTA 3C8HA 4X5WB 2ESVD 3M17A 5DQJB 2F8QA 3BPCB 3TIDA 2X7LA 1FE8L 1A6WL 4OGYH 4JG1L 3KPTA 2YC4A 3WUWB 5D1ZB 5DVMA 2VTFA 2XN9A 1W0NA 4NKMB 5D5ME 4M24A 5IVOA 1V7NL 1CECA 2WC7A 1FBIH 3LKSA 1N5YL 4GINA 4EUPH 2ZSWB 4BZ1L 3FT2B 15C8H 4HAFA 4JHZA 5EU3A 3WNKA 1JHJA 1XCTA 4RFOL 3OKEB 3EO9L 2FX7H 4JR9H 3EYVA 3MV8B 1KJ2B 1MCNA 4BUGA 4NC2B 4MPKA 4MNQE 5CZVH 5FCSH 4YDIH 5AWNL 4J2XA 2EDQA 2L7JA 4P2QA 3O3BA 3ARBD 5EO0A 5IB3A 1QFOA 3S88L 2CITA 4TRPL 3W9EB 4Y7EA 3GMPB 1JHTB 1JE6A 2MQ0A 4GPNA 3FTGB 4RE3A 5MI0C 3SBWC 1FH7A 4KJYB 3X13A 4X0VA 1LK3H 4H25A 4XWGL 1QBML 1N26A 3SKOA 4GAFB 4JL1A 1MQ8A 1IGCL 1G6RL 4LLUA 5D7SL 4PJXE 2JIXB 1MY7A 2CLVA 5E6IA 3NN8A 4KTDL 4QRUA 3UP1A 2IJ0C 5IYYA 2X2YA 2VH5L 5IFHH 2VABB 1H3UA 3S96A 5B3JE 3KYKH 4X0KA 4G8GE 3IF1B 4IS6A 2CPCA 3S4SB 1F3RB 4XNMA 1FQ9C 3SUWA 4R4NC 2MWCA 3D69A 3G6AA 5HHXL 5EOQH 5IGXL 3AREB 4XUNA 3MRQA 3V4PL 2FD6L 4N68A 5D6CB 2NXZC 4M9OA 2R1WB 2OJEB 3G5XA 5A2IH 4QKXB 2GSJA 2W9DL 1MFAH 1PKQA 1ZT4B 1RK1B 3MUJA 1I9IH 4P0DA 2FR4B 2PR4H 2CHOA 3CFJB 3VE0A 4ODHH 2HRPH 4QHMA 3FJTA 3RWHA 1QBLH 4KJQC 3PZTA 5F88B 3LQZB