2VZUA

Complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
850
structure length
850
Chain Sequence
b'GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSAFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNANAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 277
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzuA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzuA03
3WELA 4I8DA 2PO6D 3DMMB 2VLKE 4QWWD 4XP4H 3WNKA 5IJKC 3KJ6L 5HHNA 4X5WB 1H3XA 1GQLA 5DLML 1NCAH 4GMSL 1U91B 1GHRA 4XAKD 1VEOA 4XPTL 1OB0A 1EO8H 3CFDB 4OOUA 5K9OB 3AIUA 4F9PC 4WI4A 1EO5A 2XA3A 3ARGB 1PIFA 1CGSH 5AD0A 1YEDA 1XH0A 3UETA 2N1KA 3VE0B 1ZHNB 2HJFA 1H3VA 4JFEB 3MCLH 4FZ8L 3H9HA 4JFFD 5TE7L 2Q8AL 4PY7A 2WVTA 1AR1C 2CO6B 3K8LA 5K59F 3KWXA 4BFEA 1RULL 4U3XA 5MERB 1P8JA 1XNTA 4OIIL 4M6MH 5BCAA 4KAQL 1UR2A 4ZS6C 5CLWA 3P30L 3ULSB 2VLMD 3ULVH 1IGMH 3HUJA 5DHYA 4M56A 1ZTXL 4WUUB 5FECB 3TTSA 2X9YA 5E24E 1V02A 2GUOA 5E7FA 4FXKB 5C0BD 2N4IA 4PJGF 5ABFB 4MAYB 1PAMA 4MNMA 5EUOF 2OXHA 4XVHA 1K4CA 1FZOA 2EYRA 3I6LE 1GXEA 4JZNB 3RNKA 4WO4B 5BZDB 1L9MA 4PFEA 5JO5B 2B39A 5E8OA 4Z7OF 1IKFH 4ZTOL 2E27H 5L0QC 4Y4FC 3NAAL 1GZQA 1L6ZA 5DQJB 5EOQH 4HA4A 4P23D 3JWOC 4OM0H 3LN4A 2H32A 5D70H 2EO9A 4LLYB 4P9HH 2F54E 5EBGA 2DBLL 2B7DT 4RZCB 3V6FA 2E8YA 4OMDA 3D85D 1Q9WB 4Z8FL 1LDPL 4DKEH 3J7HA 3VFPA 2A73B 2HJKB 4HIXL 2VKXA 3OXRB 3S2CA 3I6KA 3L3DA 2NY2C 4E8CA 4P2OD 2W65A 3RAJH 2BMKA 3U79A 3V0VA 4YXLL 1WAWA 4CN4A 5L8JB 3A6CL 1JI6A 2VTFA 4K7PY 4FN0A 3U9PL 3EYSH 3UC0L 1Y7VA 3TBVB 1KCRL 2VMDA 4XP9H 3MRHB 2Q6WB 3RHWK 3U82B 4JFZH 1CENA 3MJ8A 5FHBH 3QUXA 1PKQA 4Y2DA 4F57H 1KT2B 4PJFA 2WKGA 4KTDH 1GW1A 3NCCB 5A6JA 2DMBA 3IJHB 1IT9L 1V3JA 4NZUH 3U1SL 3T65B 1BF2A 1ZA3B 4AK1A 1ZHKB 4M82A 1OB1B 1T4KA 1ZVHA 3SUSA 2UY5A 1T89A 4LPTA 3VFWB 1MVUB 3QI9D 5C0CB 1UZ8A 4YDLB 3GB7A 4XNMA 1MCFA 2B5IB 3ULUH 1DQJA 1MCLA 4BQ6A 1KIQB 4EDXA 3IF1A 3DVGA 4PJEB 2YHGA 4EQ2A 1JU3A 1XD1A 1IC4L 2FSEA 3FN0H 1TQCC 2E5EA 5J12C 3DARA 3NJVA 5CG0A 1BGAA 4ESKA 4MDIB 4L29B 1C8PA 2JJUA 5FUOH 3OKMA 2QMJA 4Y5XA 4OI9A 4JHAL 4HLZH 5KTEL 4PCSA 1UWRA 3T0BA 5CPTA 1F5WA 4HUUB 1NCDL 2WAHA 1KEGL 1YECL 4DWSC 4DUWA 1MJ8H 1ZEAL 3MRFA 5D7IF 1EEZA 2W0KA 2P44B 3QZWG 2UWEE 1YNTB 4OD1L 2AMGA 2PB1A 3KL0A 5KVEL 4Y4HB 4WFEE 3W9EA 4IPNB 4LEOB 4XBGA 4OYUA 4QX3A 4ZUWB 4V1DA 2Y5TB 3MJ9L 4HX1B 2W5FA 1CR9L 5IMKB 1WSST 4I13B 4OT1H 3TYFA 1JRHL 1XGZA 5I1HL 3B8SA 3MV9B 3VD3A 3BH8B 1IBGH 4QHMB 3F5JA 3HZMB 3L4YA 3GMNB 3VFMA 4NFCA 3DYMA 2H41A 4Y88A 5EFDA 2J1AA 4ET7A 4GSDH 4HWBH 4NQXB 2I60H 3O9NA 1AHWC 3FRUA 4XVUC 4F8XA 2GQHA 2Y6SC 4MNGB 1HHKB 2DQFB 2VNCA 3WJLC 2W47A 1MCWW 2V2TA 2HLAA 4UT7H 2VLLA 3LKOB 1YEJL 4HWUA 1P4BH 3HZYB 3CX5K 4AEFA 2LFGA 2E40A 3L7FA 5IUSA 4MB1A 2OJZL 1KB3A 3C9NB 1RZIA 3UTTD 1IGFL 4GS7B 1U3HD 2HTLC 1CU4H 3FB7B 1UWQA 5MEQB 1DSFH 4MVBD 3HFMH 2K7PA 2YK1H 2JCCB 3HRZA 2CESA 3IJYB 5B39A 1MHHB 2ADGA 3KXFD 1OSPH 1MLBB 5IMOB 4HIIB 2CMRH 2AK4D 1X4YA 2XTJE 4UDUB 3N17A 1HHIA 2ZCKL 5GZOC 5JUEL 4V27A 1RZ8B 3AHZA 1U8HB 1Q9KB 4R6UA 2DMKA 3U7YH 5IMMB 4XBEH 4KWUA 5CPSA 1JGDA 1RIUL 1UM5L 2B1HH 4YHZL 5F1OB 1ZE3C 2JLLA 1F58L 4QRSA 4QO1A 4L4VB 5DEFB 1MI5A 1NFIA 4JO1H 3OLDA 4K23H 4ZFZA 2P5ED 3T2NH 2UVEA 3EFDH 3WH8A 2C5DC 3MJ6A 4CU7A 2RJMA 3RZWA 2VLJE 3ZOAA 4JG0H 2VDPH 5F9OH 4LPYA 1S7TA 2HFEA 3AXLB 4OD3H 3F12A 4D8MA 5JW4M 5C07A 4URIA 3ZE1E 4HS8H 4W5ZA 4OLXH 2YPVL 3C08L 2A3EA 2BV9A 2NY6B 3TYGH 3WJJC 1N0XH 3A4XA 2FYYB 5C0RL 4ZXBC 4AG4A 1A1OB 1FGNL 2MJWA 5IYYA 5GS1C 3BPNB 3DETD 1AGBA 1ADQL 4GRWF 1QUNA 1I1AD 1R3IL 2ATKB 1UACL 3BP6A 4HV8B 4KQ3L 3OEAA 1CFNA 3QB7C 1RPQA 2EO1A 4N8PA 4QY8A 5JIHA 2VH5L 1ISXA 2EBNA 2FHCA 1ORSB 5DJZB 5AAWA 4Y4KB 1HINH 5CGYD 1XR8B 3ZDYE 2VJXA 2AXJA 3UBXI 1IC7L 1E6SM 1YEGL 3MV8E 5A16A 5GISL 3T8XA 4EOWH 5HYQB 2R1XA 2VCBA 1KJMA 1QR4A 4ZUSB 3TO2B 1CD1A 1AY1H 1HSBA 1UXZA 2CCRA 1R6VA 4QRUA 3AY4C 4PLNC 4WW1B 4BA8A 3PQYB 2A6DA 2P8MA 1C5CL 1AP2B 1VB9A 5L8LB 5LGHH 3KL5A 3WD4A 3WNMA 3BPCB 1EOKA 3DHPA 1FFPA 2BNJA 1UQZA 3FOMA 1CXEA 1L7QA 1NSNL 1KCUL 2NY5L 3S97C 2Z8WC 1YEHH 2DI9A 4KU1A 5CAYB 4P99A 4HMCA 4CADA 3F5WB 1R87A 1U9KA 1OAKL 3DXAE 2Q1EA 1MFBL 1HH9B 4CVWA 1G94A 2WIMA 1QRNE 4JDVA 2CIPA 4OFIA 2QQIA 5F88A 4BUHA 3AREB 1ZLVH 5B8CA 4L3AA 1HQRA 4XWGH 3HZVA 1OAUL 3WHXB 3P9MA 1CGVA 2HT4D 3G04B 3QOKA 1BREA 5EJZB 5IFHH 3FXYA 3QA3A 2I5YH 3FQUB 1VJZA 4LVHB 1MQQA 2WBJB 1D5ZA 2J6EA 2VKWA 3C5JB 3G9AB 1W3LA 1H3TA 3KPSA 4KKLD 3MRPB 1I9JH 3WF1A 2YSSA 1DYOA 3HE7D 3TP4A 3JWNC 4NHUA 3QFDB 2O61B 2WW5A 1J87A 4FQXC 1AD9A 4X6CE 3VXOA 1F3RB 1OPGL 3UEZA 3B9KA 3PHAA 3LDBB 1DEEB 4HZ8A 2FBJH 5E5UB 3GNRA 1IQWL 4X6BB 5ABEA 3VXUB 1JWMA 2RBLA 1U8PA 4PJ9C 2NT1A 1F90L 4MXVE 3MV01 5DT1H 2DSUA 1RIVH 2X1IA 3HE6C 1IGJB 1B0IA 3WQ8A 1BJ8A 2VXUH 1V6XA 1U30A 3HAEG 2QQKL 1IV8A 3VDAA 1EJOH 3QXAA 2ADJB 1WP6A 2GUOB 5TF1H 2EECA 4C4KO 3HNVH 5E2WH 3QDMD 3GKWL 4F3FB 2Y8KA 2ZEZA 2ZICA 4S1RL 3LS4L 3HC3H 4PRWA 1H5BB 4BK4A 2MQ3A 4MYWB 4L8SC 2AABL 2ADFH 1K4CB 1BVNP 2EDEA 1GOFA 2EYRB 2C7UA 4K9EH 3U6RB 1H4PA 4QCIA 1EMTL 2IXUA 2EKSB 4JEGB 2Q86A 2WNWA 4U6YB 5CQ1A 1S7WA 4CDGC 3GMOB 1TLKA 1F3JA 5ISZB 1DQLH 1OGAD 4BS0A 1NCBH 3GI8L 3KPRD 1AR1D 3LN4B 1QLRA 2O5YL 4NO3A 5C6WH 2QLVB 4JKPH 4PUDA 2JK5A 2GK1A 3V6FB 2LV4A 2W9LA 4U1GC 2CH8A 5FA3B 4ZNEE 3VFPB 2WP3O 4U49A 1CFSA 3NGBB 3ALPA 3RUGA 5KSAA 1NUDA 1NCWL 3V5HA 4NO2B 3V0VB 2IEPA 5EBWB 3UJJL 3VPLA 2PI6A 2Y9RT 2XVLA 3RPMA 5DDHA 2F19H 3PWLA 4U3AA 3BPLC 3NSMA 3X12A 1MW3A 4CVUA 5C7XL 4HUXB 1MPAL 4U31A 1UB5A 1J1PL 3K2UL 4FFYH 3I2CH 4JRXE 1A7RL 5F6IB 4GXUN 2K1MA 3QXDB 2DT0A 2LU4A 1PKQB 4Y2DB 6FABH 2DLFH 2DT1A 2HTKC 1TCMA 1JYNA 4LL9A 2C4FU 2R39A 5KZCD 1KWGA 3PWUA 1DANT 4XNUH 4B53A 2YKLH 2QSQA 3THCA 4ZZ8A 2F61A 4FRWA 2J88L 2R8SL 1G7LA 4X6DE 1NQBA 2PYEB 1V6WA 1ZA6A 3BVNB 3OG4B 3L3IA 1FNEA 2VB5A 3QEGL 1UZ8B 3WENA 4Q7NA 4XNMB 4I0PA 4LHQB 4EDXB 2VWEE 4YGVB 5FV1L 4KI5D 5I18L 5CZVH 2NLJB 3ZM8A 5GGQH 4XVJH 3W11D 1NLDH 1LP9A 3EYUL 4C58B 3OXSA 1PQZA 5BXPA 3A6BH 4BF7A 3H6JA 1U0QA 3AU1B 5DFTA 5FGBA 4G9DA 4TTDC 3AAZA 4O58L 4PJ7B 2X42A 3H8NA 1EHXA 5J9PB 2CDGA 1GQIA 3A3HA 3ES6B 1J1XH 1CFBA 1JMZA 4GZEA 1JPSL 5D1ZB 3MV8A 3C5ZD 2CRZA 4V1DB 4UI2A 3RVXC 4WHDA 3CZFB 3WSQL 3DVNB 1B9ZA 3I75A 2R9HC 5TE6L 4JAWA 4JRYA 3VXSA 3TYFB 5C0EB 4AZGA 1ZS8B 5CIPH 2JJSC 1NC4A 3LEYH 1HJSA 1IEAA 4W7WA 1KBGL 3PWPB 1Q0YL 3MCKA 3FMGL 3G6JE 2WM0A 1WK0A 4XMLL 1RZKH 4WUUE 3WQBA 3S37X 1A7NH 5A3ID 4I2XE 3MA7A 3SDCA 5LWYH 2AEQL 2JIWA 3FRUB 3O6FC 1K12A 2BHUA 1DQMH 5F96H 1P9MC 2CXGA 2PXYA 5B8CC 2V2TB 2HLAB 5KEZA 4KY1H 4KROC 3H2WA 5FO7B 1K9FA 1A6VL 4XCFL 1J05A 1JV5A 4M7KH 1NEUA 8FABA 1NGPH 4PLOB 1QRNA 2XKNB 2YA2A 4OQ1A 1RZIB 1JZ5A 4BSWA 4FXGA 3CH1A 1RJZB 5JHDB 2YD4A 4C4KT 2B0SL 3PZIA 2ZUSA 4DEVA 3HRZB 2CITA 5B39B 3SY0B 3M7SA 2ADGB 4IMKC 4MNQA 1UVQB 1YC7A 2EYSA 5T1LD 1EDQA 3QNZA 3GJFH 3G5ZA 3WBAA 5D1QD 1HHIB 4X0VA 1OAYH 4O02H 2YC2A 1BBJA 4KMTH 1W1PA 5IHLB 1BQLH 1JGDB 1TR1A 1N5AB 1EEYA 1U8JB 5FYKH 1CQKA 4QRSB 1MI5B 1NFIB 4OM1L 2J8UB 1CZ8H 4HS6A 4YX2L 4HPYH 5LXGH 5C8JA 1KCKA 5FGCE 3I2KA 4MJ4A 2XYCA 4XVUD 5IBLC 1RY7B 2Y6SD 1XF4B 3QEHA 5DGRA 5F7HA 4KK8C 3F12B 2WSPA 2BDNH 4Z0BH 4OKVA 1T5XB 4LIQH 4M7LH 2ZKHH 4D9QE 5ACZA 3EZJB 3DX9A 3EBAA 2V3DA 3PXHA 3OKDA 4XPAL 2AEPL 2W38A 5CP7A 2IGFH 4JR9L 1FO0H 1JDDA 4KV5F 1AGBB 3RDTC 5EDXA 1GU3A 3QIWA 4OV5B 4ACZA 5F8QC 1CFNB 4PRIA 5J0BA 3JWDH 2PWDA 1LO5A 2BSED 5BOPA 1R86A 1LO2H 1QVOB 1QBBA 4MD5A 5IBTL 4X80H 5FM4A 1ISVA 1G1YA 5HGHA 5C92A 4APQC 1KPVA 4Y19D 1UKQA 2R4RL 3T8XB 2D0HA 1EUUA 5LA1A 2ICEA 2JTDA 3MRRA 1N5YL 1CD1B 1HSBB 2MNUA 3LKRB 1BZQK 2VSCA 2AQ1A 1XCTA 4W6WB 5FUZH 1RUAL 2P8MB 4PJAA 3NIDE 3JV0A 5E95B 2F9BT 4OSUL 1WCBA 2QQJA 1FFPB 4BKLB 4KRPD 4R4FL 4J8RB 4ZXBD 3D0VB 4QRPD 4S1QH 2P7TA 3GBML 1F6LL 2XTJC 3S3PA 5HI3D 4GLRI 4ZNEA 4R7DB 3CSGA 4YR6A 3RWDB 3C6LD 4YAQA 2DI8A 5IB1A 3ALGA 2DD8H 4W4ZA 2X41A 4D0CA 1Z9OA 3L5XH 3PGDB 3SPVB 3BD5A 1FGVH 4JDVB 4LVOC 2UY7A 1Q72H 5F9DC 2CSPA 4X7EC 5F88B 1RP8A 5IR1B 3NCBB 3GMQA 1HQRB 3HZVB 4U3HA 3P9MB 1GNYA 4D3CL 3VDHA 2VZSA 4M61A 2XXCB 1TETH 5HVWA 1WBXA 2XICA 1J18A 1ODAA 4TRPL 1VHPA 1DFBL 1QFHA 4CJ0A 4UFJA 1D5ZB 4H25A 3O3UN 3BEWB 1K9TA 4X6DA 2Y6HA 1LL4A 3SKJH 1ZT4B 1NH6A 3KPSB 5JXAL 3PP3H 2OTUA 5C0IA 2WV3A 2YSSB 1ZJAA 1UR1A 5KS9E 3O6KH 4FFZL 1SFSA 4RMWA 4NHUB 3NA4A 2OSLA 1TZ7A 3BP5A 1XGTB 2P47B 4RL3A 5F21B 4L9LC 3VXOB 1FZKA 4G8FA 3IVKA 3B9KB 1E4XL 4X6FA 3QRGL 4HC1A 1M04A 4KPHL 1Z0MA 1NMBL 3B9AA 4AG4L 1OGSA 3ZDXF 4YUEL 4NO5A 5DJYA 4MCYA 4CU9A 5T1DL 1BFOA 3MC0A 2W0LA 3P4OA 2H6PA 2W95A 2IC2A 3AUVA 1VFOA 4P5TC 4S0SD 4PJEF 3OTTA 2F53D 4YEFA 4C57C 3SCOA 3CH9A 4XV0A 2N56A 5I77A 2NX5D 5L88H 2APTA 4JCMA 3WQ6A 2EDOA 1A21A 1GL4B 3RX8A 3U83A 1OIMA 5JBDA 1GC1L 3VGDA 1NGXA 3EMQA 5A3HA 5AZ2L 4Y1AE 3UROR 4CDHA 4OCMC 1E28A 2DJ4A 2N7BA 2VDKL 3SDCC 5HYJD 2D7TH 2DRUA 3UG4A 2VL5B 4GMTH 5JXHA 3MUHL 4Q9QL 4QXGH 5FDWA 2EDJA 4GO6B 4OTXH 3SGDI 3BAJA 3G6JA 2EIEA 4K8RH 2DSKA 4I3SH 3QHTC 1LK3H 1HZHL 3SO3C 3U7AA 1NDMA 1QEWA 4KJYB 2EC8A 5F7NC 4WGWB 5ANME 5E6IA 4OZGA 3P11L 1JHKH 2Y07H 4FQXD 4I2XA 5KW9H 3FB6A 5ICZA 3NCEB 3ZHLA 5IKCB 2Q86B 4LSVL 1S7WB 3BCDA 4TSAL 4UINL 1KIRA 4PMXA 1UA3A 4D72A 4Z77B 4WI9A 1XD0A 3VWJB 5HVHB 2AOSA 3QWRA 2QHLA 1U8KA 4JVPA 2FBOJ 1AXSA 4ODVL 5CGTA 3IDIB 3HG1D 2I9TA 2XIBA 1DN2A 5JXEC 4KZDL 1T0MB 4BZYA 3RIAF 4HULB 5CSYA 1JGVH 2G5RA 2QQQA 4RMSA 2LW8A 1SJXA 4K3DH 1FL3A 1CFSB 3HNSH 2PKDA 4M62H 3G08A 3MBEA 4XRCA 3RUGB 3HE6D 5KSAB 3AHXA 3VRJA 5ESAA 3V5HB 1HIML 5C2UB 3PWLB 4W8JA 2DQUH 3IAGC 4OGYL 2E7LC 4QEGA 1XR9A 5IVXB 1GZJA 1RVFL 1G9NL 1OQXA 4P5MB 4GRLC 4OUUA 3GIZL 2IADB 3IJ8A 4TVPH 3IETA 4HAFA 1RD6A 5D9MA 1TVBB 4PLJC 2JCCF 2FB4L 3PWUB 2J6EL 2P1YA 3OKEA 4DEPC 1B31A 1L7TH 1VFUA 3VD4A 2WMPA 2CBUA 3L3JB 2NXZC 4GG8B 2NPLX 1G7LB 1IGCL 3SJVD 1ZA6B 1KCLA 2FX9L 1EGZA 2PNDA 3L3IB 3MGOB 3OHXA 5ITFA 1HJUA 1AXTH 3PZNA 3VCLB 4G8GE 3MBWA 5HI4C 5G05L 4I0PB 1KGCD 3UDWC 3OJMB 4PQQA 3L95A 3DWTA 4OCXL 4M8QA 4HWEH 5BROA 5HHMB 4NCC1 1CLZH 3ULVE 3C6SB 1LP9B 3OXSB 1PQZB 3CMGA 5L9DH 1KNOA 5ESVB 3W0KA 4RBPH 4WF7A 1S3KL 2KPNA 5E1HB 1XYFA 5ID1A 1LQSR 4G9DB 3AM8A 1UA7A 1D9KC 5A6SA 3AAZB 5FYJE 1WAAA 4DKFL 2A0LC 3TJHD 1CT8A 4QB1A 3PF2A 1L7IH 3DV6B 1J5OL 1XZ0A 2ARWA 5AY7A 2HTKD 4TULH 4W88A 1S8DB 1AH1A 1RZJH 1A4JA 3CDCA 3CDYA 3V0WH 4JRYB 3VXSB 1H3PH 2D3NA 1XF5A 2NTFB 4PG2A 1NC4B 2VRQA 2VSDA 4JREB 3QUYB 4BFBD 1OWWA 1PY9A 3E8UL 4LEXL 5A69A 3GJFB 3VFNA 5ETUA 3B9DA 3SKMA 1HDMA 1DBKL 3MUGA 1GCFA 4HUNB 1RHHA 4JFWA 5L6YL 1HKLL 3RILA 4AENA 2CIIB 4H2CA 4IS6A 1S9VA 4ZUTB 4JJ5A 1RU9L 2Q7YB 4PJDB 2UZYB 1OGBA 4ODSH 3BXNA 4A44A 1UYWL 2PXYB 4JM4L 4OF6A 2OR8A 4OI8A 4JPWH 2EXWC 3ARRA 4ETQA 5FA4A 5IMLA 3RKDC 5DT7A 5C9JB 3O9WA 2XVKA 4ZFMA 1RJCA 2X4QB 5GGSY 2YD3A 5E5RB 1ACYL 1QFWL 2DM4A 4AT6B 5ISZE 3CH1B 2KZWA 4EXKA 3CCHA 4E0RA 4XX6A 2XQYK 1PG7L 4NNPH 3NPSB 1JF6A 3RVXD 3O41A 1CDYA 1GPOL 3EDFA 3QNZB 3OAZH 1T7WA 1FO0B 2BVPA 3GSVB 5KVFL 2F54D 5DVKA 3ULUE 1BBJB 4OLVH 3EGSA 3FCTB 4KKAC 4ENED 5AWNL 4D1JA 4PJCE 5CS7A 5A2IH 5K9JH 3IFLH 4L8CA 4NUGL 1TFHA 1OWQA 1EEYB 4Q0XL 2J4GA 5IFJA 2EICA 2DF3A 1CF8H 3IFNL 4IRJB 1T7ZA 4XPFH 1CLCA 1YEEH 5IQ9B 4G6ML 5KS9A 4OZIF 1N6QL 1G9EA 5I1IH 5HDQL 4I5BA 1BZ9B 3ARGC 2ERJC 1KLGA 4P5YA 4IDJH 4RA0C 5B39G 5KVDL 3X3GH 2FGWL 1KJ2A 3KG5A 4OKVB 3NZ8B 4PRDB 5ACZB 1AVAA 4R26H 2IBZX 4NDMA 2IAMA 4K7FA 4Z5RB 4KRUA 3DX9B 2A1WH 4FG6D 4Z0XB 5L2KE 2PYEE 2Y7QA 5CP7B 3MSDA 5GQBA 3RBGA 3WFBL 4OUEA 4PRBB 4LQFH 1KXQA 1K4DB 4ELME 3O3EA 2X10A 4XC1L 4DVRL 1P5VA 4OLEA 1UENA 4WGVB 1E3XA 4PRIB 5I75B 2KQMA 2EPNA 1LO5B 4MLSA 3PGCA 1E0WA 3PP3K 4XGZB 4MD5B 2QR0B 1KELL 2VDML 3JTSB 4YDIL 1H5VA 4WWKD 2DDQH 1KPVB 2XWBB 4AH2B 1C5DA 4PJ7E 3N18A 5JW4R 3EW3B 1W72H 3MRRB 4R4BB 5EC2A 1G9HA 4MJIE 1KB9K 5KSBE 4P3CL 1OT5A 1DLFL 3GSRA 3IU4L 4WUKH 5IBLD 4AXNA 5MENB 4WO4C 5F9JA 5T3ZL 2R56L 1JGLH 4K07A 4KK8D 2FX7H 3U7BA 4ZQKB 1JFXA 4PJAB 2ZX9A 2GJJA 3F7YA 1D7PM 2WMGA 3G5XA 1WCBB 1E4WH 2OSWA 4H0HB 5GGVY 3U0WL 1YEKL 4LRNL 1QBLL 4Y16B 4UIKH 2QQNA 2ICES 5FCZA 1KCVH 3KNBA 4TOYL 2HN7B 4L5FH 2P7TB 4HIHA 2D03H 1UC6A 3EJZC 3BZEB 25C8H 5IHUL 4IRSD 2J1SA 1YY9D 1D6EA 4YR6B 1FNGA 2XN9B 2R2BA 4OLWH 1IAIH 1WC7B 4U1IA 4YAQB 4POYA 1N6UA 5IB1B 4LBEA 4F37F 1YDPA 2ITCB 4Z2HA 3WUWB 2C9AA 2OYPA 4D0CB 2IANB 4P8WA 3MU7A 4NHCH 5C71A 1XV8A 4R96A 2QHAA 2D7PA 4X0KA 4M43L 1V6VA 1B2WL 3UYRH 2WWDA 1QR1A 4APQD 1A2YA 1A47A 3LQAH 2Y23A 4MB4A 5FIPA 3MQIA 1E6JH 5D72H 4NQDB 4PJ8D 1RUQL 4MMXC 3SDYH 4JZJC 1CICA 4XX1G 5MEOA 5JHDE 4R5EA 1MQKH 5D6DA 2MCPH 4GXVH 3TLRA 3OGVA 4DN3L 3JV4A 3J8F7 1VACB 5LQBL 3IKCB 4YDLC 2OTUB 5C0IB 3CZUA 5SX4H 2JKXA 3ME0A 4NNXA 4G8GA 4KKNA 4M1GL 2V3GA 2VX4A 4RWHA 5DJXB 1CVSC 3OLEA 3P6BA 1RZGB 4WDIA 2XTJD 3W2DH 1OW0A 3BP5B 4PJFF 4FQIH 1S9KC 3MRCB 4G8FB 1UY4A 1ND0A 2J8UE 4FXLA 4X6FB 3WKMH 3F8UB 3EO1A 5FL1A 3R8BB 1EVTC 4LSRL 3UJTL 3PIQB 5I1KL 1FAIL 1N3NA 1XF2A 3VW3L 1QFUL 5DJYB 1NL0L 2XNAA 2EDTA 4HBCH 4P2YA 2H6PB 2VLJD 4CD5A 4G8EA 5I74C 4KTYA 3IB3A 1QSEE 1J10A 5E00A 2DLEA 5K93A 5J13C 1NGXB 3CLFH 3WY1A 4ZSOA 2YS4A 3BN6A 4AD1A 1E28B 1F4HA 5I8EA 1BEYL 1BD2E 3AS0A 4D0DA 4BH7A 2DIEA 2DQEL 5J7CC 1JRHI 3O4OC 1BQHA 4HT1L 2X09A 1QEWB 2E7CA 2G3NA 4GKSA 1I9RH 4XVSH 1B0RA 3ARUA 3QIBA 3O9WC 4OZGB 2FR4B 1N6VA 4DN4H 4WFFD 5ICZB 4U7SA 2VCAA 3KPQA 3T4AA 1VADB 1T6VN 3RM8A 3FO0L 1MCWM 3VXMB 4UV7H 4PJXB 3K77A 1U8KB 4OGZA 2I9TB 4NWUL 4PJ5A 1R24B 4GZIA 4P5TD 5HGDA 3GHBH 4JVWA 5IW1B 1CK0L 5GJTH 3MKKA 3G08B 3KPLA 4HHAA 2J75A 5ENWA 3QPQD 1LE5A 2XOTA 2XPGA 3GI9H 5B38A 7FABL 2E6QA 3QRFM 1BQCA 2E6PA 1PJ9A 5DR5H 3C8KA 5DD5H 1WBZA 1XF3B 2NNAB 3BUYA 5DRNB 1MXGA 1I9IH 3FFCD 2BNUB 3OKKA 1FQ9C 1XR9B 3RBSA 4PJCA 2W9XA 4OUUB 3RGVB 3IETB 1OD3A 4Y2OA 1IAIM 1S7VB 3X14B 3ARFA 5MI0C 3RX5A 4D8PA 4MA7H 3OKEB 5EOCJ 3BO8A 1NJ9B 4NKMA 3OGCB 3NJXA 5DC4B 5ESQB 1JGUL 4L3CB 4PTTB 5IGXH 1TG7A 1R8LA 4FQLH 1C08A 5DHVA 3OHXB 3VFRA 1I5PA 3NA9L 4TNWK 3MREB 3I50L 5IQ7H 1UWEL 2YZ1A 4X4YA 4WEBH 4W8AA 2NYYC 4WFGE 1VSCA 4YLQT 4LSQH 1JNHA 4LCIH 4H5SA 5L2KA 4CU8A 2WZEA 1K5NB 2JELL 4Q6IC 3I3EA 4HC1L 4QHKI 2ZCLL 1NMCB 4ELMA 1QSFB 1OF3A 2YJQA 1KNOB 3KPPA 5JDSB 4HIEB 4F7MA 4QHUA 2IPUG 5CJOH 1HWGB 3D25A 4PUEA 2XPKA 3SKOA 4EXPX 3MLWL 3FZUD 3IDYC 1MCRA 2I24N 3MNZA 5I1GH 2YL6A 4UFLA 3CDFA 1CS6A 4GBXD 4GRLD 4U1JA 2A83B 3RIFF 4YZFE 2CKRA 1XZ0B 2MHAA 3FTGB 4RGMC 1Q0XH 3OB8A 2X4PB 3NRUA 2P4AB 4PLJD 3MRGA 1DQQA 3D2UA 3EYFA 3P4NB 1A7QH 1A4JB 4N8CL 2D23A 5E4EB 4UBDC 4UQ3B 3TT3L 3GXFA 4GQ9H 3WFEL 2DQHL 3CUPB 3JSSA 5ETUB 3VFNB 1A3LL 3SKMB 4MA3A 1HDMB 2VDLH 1UQSB 3FKUS 3MUGB 3O2VL 2WZ8A 3OA5A 4MLIA 3KPOB 4QYOB 2IQAB 1YJDL 4AENB 1R3HA 4IS6B 4MJ5A 4JJ5B 1OARH 3K2MC 1MW2A 1AKJD 1KIPB 3D5OF 3BXNB 4WW2A 5FYLD 4LYRA 4YXKL 3BH9B 1CIYA 3SE4C 4D6FA 4F2MA 4PBVC 5FA4B 3AZRA 3VIIA 1F2XK 1T83A 2UZXB 4U1NA 2A0LD 1A1MB 4FTVE 3KJ4B 1KCSH 2O5ZH 3F5KA 4ODTH 1HOCB 3CCHB 4YPGB 2BZDA 3MLTB 4P2RE 1UA6H 1K2DA 4GKLA 2IQ9H 3V4PH 2XWDA 2V7HB 4GKZA 3UNPA 4FNLL 5F1NA 2W9DL 1C12A 2BVPB 5EWIL 5BJTB 3QQNA 5EH1A 4GI8A 4OUOA 1S7RA 3D3VE 3TNNB 5I1AB 2UVFA 4HF5H 4L8CB 5D7LB 3ULVC 1QOXA 4QOKD 4YE4H 4BM7A 2YZ8A 1B6DA 4WLCA 4P49A 5C08E 5L2JA 5HGBB 1HK6A 1CN4A 1QO3A 2Y25A 1BIIA 4R7NB 5E2TH 4I5BB 1KLGB 3K75B 4LP4A 1G0DA 3EYQD 4UILH 1KJ2B 1P7QB 3OBAA 1W72B 5I1LB 2XVPA 2EXWD 1E4JA 3WIHA 3LDBC 4JRXD 4FLQA 3RKDD 3L3HA 3O45A 4NDMB 2IAMB 4YHKL 5DD3L 1MCBA 4YHLH 4LPLA 2PUQT 3U9UA 12E8H 3EZ8A 1IRAY 1RIHL 2Y7QB 5DVLA 5AZEH 5KSUB 2DB8A 3I6GB 1MREL 1UCBL 3QQ4A 5JORB 5DZLA 2HAZA 1UH4A 1OD7A 4WI5A 4P9HC 5ALCL 3W24A 3ZE0E 3DI2B 3GFUA 5HPCA 3ZMRA 4DQOL 4R0LA 3NH7H 4MXWL 2MPAL 4JFDB 4W8BA 4J3OC 5AAMA 1H8OA 1U8NA 3PGCB 2WN3A 5GRVL 2ESVE 2NY4B 5E1AA 3KGRA 1M05A 3SBWA 3BE1L 3DMMD 1CZ1A 3QIBC 4HBQA 5D5ME 1EXUA 1KEMH 3BD4A 1GMMA 1BD2A 2WC7A 1PLGL 4G6JL 3WHE0 4LASL 2C1PB 3PL6B 5EIIB 2HLEA 1H5BC 1FL5A 2FCBA 4N1CA 3PGFL 4QF1A 4QNPE 5HNNA 5H35B 1UKSA 3GSRB 3PG2A 3ARGD 5IW6A 3VWKA 5F9JB 1S7UA 4LAJH 4LLQA 4YH6A 3MRLA 4X98B 3OLIA 3HI6L 4JFED 3TO4A 3F7YB 1QI0A 4C55A 3ECBA 4R90L 4HAGA 4HTYA 3MACH 3LQMA 5MHSD 5HVFB 3KNBB 4JQVA 4NGHH 4ZXEA 1MFEL 3T3MF 4A6YA 3W9DB 2AI0H 5M95B 1S7SB 2AJUH 5HDOA 3ZKNC 5ALBL 3ULUC 4NN7C 3NGBC 1D6EB 1J0YA 1FNGB 2OP4L 3HKFA 4U1IB 2CK0H 1I1FA 4MTVA 4UV4L 3RVWC 1PZ5B 1RK1A 4LBEB 1AQMA 3LIZH 4L4JA 5T3XH 4WUUD 4PJDE 5BS0B 5IVZB 4OAWA 4ZFOA 3B2VL 1CL7L 4R96B 1EZVX 4UR9A 4ZFGL 4X7FC 5SWQA 4OCSL 4GWIA 3L5IA 3O2WL 3GHEL 5FM5M 1ZLSL 1CGYA 5F7MC 1A2YB 1QR1B 4WK9A 4U0QB 1HF6A 4IDLA 3WFZA 3EYOA 1F6AA 4MAYD 5I2UA 1H1NA 1QP1A 3WLWC 1KIUA 3PWNB 3RUGF 3UR8A 1CICB 1OAQL 4LIQE 3WN5C 5MEOB 4WO4D 3WFDH 4KK9C 4TNVK 3MRJB 2AXFA 4XNZB 4Z2KA 2ORBL 1O8SA 5KZ6A 1HEZA 1YN6B 1AGFB 5EC1A 1NGZA 5IVXF 4M6OH 3EOTL 1YNKL 4LSDA 4M1CD 1KJ2L 2IBZY 3LB6D 1DVFA 5D93B 4LYPA 1M7DB 2DQTH 4LHSA 4PRHA 4OFDA 4X5XB 5I0ZA 1ZGLM 3EO1B 4HFWA 3QHNA 1YEIL 2Q3ZA 5KSVB 4NQUA 1DBJH 1N3NB 3QWQB 2YUWA 4LLAA 3QNYA 2XNAB 3UG3A 2UUDH 2IFFL 4DXTA 1EEQA 5D9NA 5DMJB 3REVA 3PWJB 3BQUA 1H0IA 2BFVH 1OLLA 3K1DA 3OKOA 1LP9F 1QW8A 4NZJA 4BFIA 1R0AL 4BQ5A 3WQWA 3AIVA 4QRQB 4NQCE 1FZJA 3LH2L 4ZO6A 4ZSOB 5HPOA 4M1DH 3BZ4A 3VRIA 3PBGA 4S1SL 3EIFA 4KGLA 2A38A 3BKYL 2XY2A 3G6AA 5C0CD 4D0DB 4RMUA 4BH7B 4WW2C 1CECA 4A6OA 3WUGA 1BQHB 5JR1H 2BSSA 4LF3A 2PR4L 2HT3D 3MLUL 3CFCH 2GITA 2JJTA 1HP4A 1FVCA 1MLCA 1T83C 3ZHDA 2F8QA 1B0RB 3L6FA 4HCRH 1OD0A 2LS6A 1A14L 2OTPA 3KPQB 5GRUL 2CGRL 5DQ9A 2DIJA 3T4AB 5C09A 4YEEA 3WD1A 3AS3A 3B8YA 1LEGA 2QQNL 1CLOL 1FFOA 4DWHA 3U0TB 1MSPA 1BVKB 5IHZA 4P9ML 1M7IA 1OGTA 2BY1A 2RR3A 2V5RA 4FQQA 4WCYH 4Z95H 1VGEH 4PJ5B 3GK8H 3QCVL 4KVCL 4FTVA 4MAUL 4H1LH 3H0TB 3GZKA 5HGDB 1NOFA 4Y4HD 1TMQA 5DK2A 3CZJA 2ZNWA 4JY6A 1LWRA 1NMAL 5FHAH 4OJFH 4YHOL 4P2RA 5ENWB 3EOYG 1DTUA 2XPGB 5B38B 3SKJE 4W7UA 2N7AA 4ZYKB 1GVYA 4X7TB 3UG5A 4XMKL 2Q8BH 3BUYB 3HNBM 3VI3E 3CXDL 1RUMH 2XN9E 1FFQA 3N06B 3EDEA 3QDJA 2FIKA 4RX4D 2R23A 2WZHA 2EIBA 3EJYD 2C1OB 2FD6L 4PBXA 3ARFB 4W4NA 5C08A 1MW1A 4DVBA 1F4WL 2VZUA 4LSSH 5J1SC 2ORZA 2YD8A 4K2UH 3BO8B 1UKOA 2OI9B 4UTAL 1UXWA 4NNYA 5DHVB 3QUZB 3VFRB 1YY8B 4R0LC 1A3RL 2LAGB 3HPLA 4XURA 1JNHB 4O2EB 4H5SB 5SX5K 5D9SA 3D6GA 4PRPA 5LAXA 1RMFH 3AHYA 3SBWC 1Q94A 1EPFA 3CJJA 3VG0L 1GUIA 5EOCL 2J47A 1GOKA 3KPPB 4F7MB 2MMXA 2P8LB 5FYJL 3N04A 2DL9A 4ORGB 1R5VA 3FONA 5EU3B 1OY3B 4GKOA 1X4XA 1Z2KA 3MNZB 1LD9A 2ESVA 2OSYA 5KG9A 5KBNC 3W0WA 4DGVH 4TUKL 1GZPB 2MHAB 4L4VD 5FCUH 4ISVA 5I1EH 5EZOH 1AQDA 2ZX5A 1HI6B 5IFAL 2W61A 5CJQH 3SEPA 3LEXA 5J1XA 1QQDA 4ZAKC 5ICXB 3JXSA 2A77L 1BP3B 3DX7A 2FIRT 1ORQB 3C87A 5A2KH 4OZOA 1WLHA 4JFQB 1MJUH 5F9WB 4HU0A 5FB8A 1J12A 3DURA 3PWVB 2NY6D 5I9QC 4NN5B 4XCYA 1N59A 2AK1L 3ZHKA 5CYYA 1R64A 4B41A 1R3HB 5DS8A 3KR3L 3V5DA 2EO7A 4A42A 4Y7MA 4YN5A 4TOQA 3ROOB 3OGSA 2G9HB 3RM4A 5E7BA 1XT5A 3ZZ1A 1SYSA 1XIWC 3HMCA 1BFVH 3OWEA 2X1QA 4C7DA 4LDOB 3TT1H 4PJAF 1W9WA 2CDOA 1FPTL 4Y4KD 1N4XH 1YN7A 2NY7H 4G3YH 4N0RA 1UMIA 4W85A 35C8L 1HVXA 3CK0H 5E09A 1H49A 1HHHB 4AJ0A 5C2BL 2XG9A 4IHOA 3GGLA 2Z35A 1PDKA 3B9VA 1MUJB 4WTXA 3CUIA 2A9NL 2K9UA 4E42A 3FO1A 1EQCA 3OAYK 4N9GA 4UBDD 4NKDA 3B6SA 1SEQH 4NKQB 2HRLA 1S7RB 2E9MA 3VIHA 3PQYD 4X7SH 2WO1A 1WIUA 4PV9A 1NDGA 1PD6A 3BI9X 2V72A 2Q8XA 2OL3A 1B0WA 1SYVA 3QIUA 1EFXB 3OSKA 4J3UA 5I23A 1MWAH 1QO3B 1BIIB 1FP5A 1S9WA 3OB0H 1ZHBA 2ZNXA 1FV1A 4XWOC 3WUZA 3ROLA 5DYOA 2G2RB 3WEOA 4K94H 1T03L 4R97B 1SY6A 2V5SA 2E9JA 1M6OB 3BKCH 4XXCA 9CGTA 3EO9H 1JWSB 2ZUVA 5IJVA 1J8HE 1E4XI 4FMFA 3WFHA 5TE4L 1S78C 5DVMA 4PP2B 3SDDC 3ARED 1HSAB 1O59A 3QQ4B 4AMKH 3QUKA 2Z4QA 1LO4L 3LRGA 3V4UL 1OSZA 4G5ZH 4ODUB 3D9AL 1GGTA 4NOFA 5DRXB 1OT1A 3N1AA 2PTVA 1JHLH 4M7LT 5D7SH 2WBJD 2KZ1B 4OJYA 1A6PA 5GGRA 2I60L 3TWCH 5DMYA 4ZTPL 1J0KA 1EXUB 3TM6A 5A6BA 3I9GL 4HJGB 4WJXA 4HK0A 2DQCH 1CE6A 1DP0A 1AE6L 2X70A 1UWTA 3BPOB 3C60A 5DFWH 4AL8L 3T4YA 1Y0LA 3IYLW 2YPLA 3CFJB 1F6FB 4KI5M 4FFWC 4WTWA 1S7UB 3BRGC 5TFSH 1YEFL 3MRLB 1B4JL 1E5JA 5A8QA 4NQSB 1DSFL 4R8WL 3A6OA 4RISH 3BLKA 3SCMA 5HHOA 3WLBB 3ALXA 4PB9L 1XCQA 2YK1L 3B5GA 3RQ3A 3VWJC 1CBGA 3VXUD 5FGSA 4AIUA 4PMZA 4LFHD 2X5PA 3QFJE 3BDBA 1LO3L 1LO0L 3ARSA 3RVTC 4JN2B 1JGIA 1F02I 4A6YB 4KMQA 4OZHA 2P46B 3VM5A 1Y6NR 2P8PA 4OZGF 1TZGL 3UZEA 2OS7A 1VBUA 2EDFA 3VFTB 3WH9A 1RK1B 1KJ3L 4J4PC 1QD0A 1E9LA 3LAFA 1QHOA 1IM9B 3MA9L 4MZ2A 4OAWB 1I85C 5GGTA 1IEBB 4PJXF 3GMLA 3ZDZE 3UX9B 1NCTA 4JHWH 1P69B 4EIZC 5CKAA 1LL6A 2XSBA 4DGIL 1HHGA 3LHPL 4WHTA 4F58L 1KACB 4B5EA 5JXGA 4P0DA 1XSKA 5K9QG 3W37A 1VEPA 2BSTA 4PR5A 3IU3A 5HHVH 1VKXA 3UMTA 4P57B 3F2ZA 3W39A 1E72M 3BGMA 4KJWD 4RMTA 2XRAL 2IPTL 5ISZD 1KXHA 4PTVA 1D6VH 5EC1B 3FB8B 4PJBB 2VLRB 5JOEA 3P4MA 3EBVA 3UAJC 4LOUD 4M5ZH 1CVRA 4I18B 2ICWA 1V8HA 1OWRM 1OBAA 3WIHL 3VXPA 1DVFB 1MHPL 3TA3A 1FYTA 1RZKC 4H8WH 1II4E 1P84K 4PRHB 5CZXC 2A3BA 3E2HB 1E6RA 3MSGA 3BKMH 5C6TH 1HP5A 4HFWB 2PYFB 5E4IA 1BPLB 1N7ML 1UFUA 2Y6GA 3NDZA 5BRZE 3SCRA 4RN5A 4WKHA 3OKNB 2GJZB 3QUMH 3QNYB 3PJSB 4PYHA 2XZCL 2BNQB 1A3QA 1E15A 3PHOA 1A22B 1US3A 1A0QH 4Y2DD 5AUMA 4Y5YC 2V7NA 3OG6B 1IKNA 5JOPD 4BFIB 4YHEA 5DFVC 1OCWH 3U4EA 3UPCA 1WGOA 4H1LB 1CDBA 3MJ7A 3VH8B 1UYXA 5I3DA 3BIAX 5HBFA 3QAZB 5HGAA 2X1XR 3C7EA 3VRIB 3CFBB 4P4KB 1MEXL 2PYED 4Q6YA 1LVEA 4JREC 3QUYC 1WAAF 1UUQA 4QRRB 4H41A 4H26A 1E56A 3L1OL 5HYEA 1E6ZA 4F33B 1OL0A 2AJVH 3S36H 2BSSB 4JFPB 2BY2A 1MCHA 1XMWA 2GITB 1FVCB 1B2YA 1MLCB 3VDBA 1NFDE 1CLYH 3L6FB 4CD7A 2NY1C 3ZKXC 2J77A 4UQDA 4E4PA 2DIBA 1LEGB 2OWXA 1MFVA 2G5BA 3ZJ7A 5D7KE 4NWTH 4HQQH 1QNRA 2RCSH 1OGTB 4A6YL 4FQQB 2J1UA 5GJSL 4H20L 4GXUM 1GGCH 1ES0A 4H88H 4JGJA 1XEDA 2VVNA 3OX8B 4LU5H 3T1WA 4W8LA 2KBGA 5DK2B 3G5VA 1BQHG 1RJLB 4AZCA 5B4XA 3BKJL 3FT4A 5D1ZD 3NPSC 1YYMH 4JM2C 2BJML 4V1DD 2VR5A 1QFWI 5CCKL 4ZFOL 3WEMA 2NY0B 4TX8A 4PT6A 1W0VA 2VC2H 3WEXA 2R0LH 2ICWJ 3JZ7A 1OTUC 3HOBA 1T0NB 3PWPD 3TH4T 2XONA 3JWDC 4NM8L 3T3PF 2FIKB 4JCLA 2AXGA 5I66B 1MIML 3M8OL 2R0ZH 4FZEL 1HKJA 4U1MB 5HD8C 3LPWA 4IRJC 4XPGH 5DD6B 2A6JB 2Y36L 5D2NA 1UH3A 4RNRB 4XHQA 1ISZA 1XYZA 1TJGH 3UPRA 1FSKC 3BD3A 5B38G 5JR2A 4PGCB 1BF8A 4O2CA 3UESA 3DRTA 4NNYB 2BXYA 4UNTA 2JB5L 3WDRA 3HZKA 1BFTA 2AGJL 3ARBA 4LDEB 4S1DC 5D1XC 4FLSA 5I8KH 3HPLB 2Y5EA 4JFFE 3WL0A 2XIIA 1J8HA 4PRPB 5JHDD 5LAXB 4UOW1 4DXRA 1Q94B 4FP8L 1T2XA 5E99L 2D22A 4YPJA 1N8ZA 3T1FB 3SGJC 1MCNA 3TH2T 3O11A 5I75C 2V3FA 1R5VB 3FONB 3QP3A 4PGDA 1KEXA 3IDNB 3L3GA 1RZFH 3VVGA 2VLME 2ZUWA 2CDFB 3O3BA 2W87A 5T5NG 3W0WB 5LA2A 5CJBA 3IRPX 5A6AA 3OB0K 1Z32X 1ZVSB 4WHYH 4NO0A 1BG9A 5IJRA 1JIBA 5C0BE 3TN0B 1IAOA 1QQDB 1IJ9A 2A6KA 1TVPA 2VDOL 3NCJL 2ZX6A 3DX7B 5E9AA 4ONGH 2CHNA 2EXYC 2RV9A 4A4AA 1IGIL 1ECEA 1HILB 5GRJH 4NQVA 4LKCA 4ZFFB 3NIFE 5BVPH 5DMIH 4DM2A 5GS0L 1DBBL 4XCYB 5A8NA 3ZE2E 4AZ5A 3I02B 1BJMA 5AG8A 1G7PB 4P3DB 2EZ0C 5C0AA 5JPMA 1ZBWA 4WENB 3GBDA 2CLRB 2D3VA 1IE5A 1OAXH 1INDL 1QRKA 3W4RA 4XAWL 4HGMA 1U6AL 2B2XL 3OR7A 2GJ6A 1TPXB 3I2CL 2EDKA 3BP7A 1UZ1A 3A67H 1TCRB 2DQDH 3VGAB 2EJ1A 4OLUH 5F71A 1YN7B 1WFUA 2V5CA 3CUJA 4O4YH 3QDGE 4JN1H 5H37H 4NN6B 3QDHA 4OF7A 2WW8A 5DJDB 4L1HA 4E5XA 3VXRE 1CXIA 1A9EB 4TUJA 1CI5A 1KTDB 1NP0A 4TVUA 2Z35B 2VAAA 2P24A 1JF1B 4Z7WB 2PWHA 3RZCC 4U5IA 4D71A 2UY6A 5T5FH 2ARJQ 3NFSL 2GDUA 1OD8A 2V17H 2YN3A 3GSXB 4N9GB 3O2LA 4QP0A 4NKDB 1RQ5A 4G42B 4LCWA 3ZJ6A 5EMYA 2Z92A 1FNSH 1AC6A 15C8H 1NC2A 3ZIZA 3Q3GB 1YMMB 2OL3B 2P49B 2ZXQA 4PUBH 1SYVB 3QIUB 1RUPL 1JPGB 2DT3A 5IT2L 7A3HA 1KPUA 3VFOA 5EU7E 1S9WB 1ZHBB 1I7ZB 4DKDC 4K8RC 4OFYA 5DYOB 1T1XB 3RNQA 4J3VA 4OCYH 3CSYB 1Q9LA 5FIEA 3QG6B 2XWEA 3NIGF 5IJVB 3UJIL 4GLRH 1G6RH 3PDOA 2CR3A 2Y06H 1Z9MA 1VFMA 1AQKL 1VFBA 4X5LA 1TNNA 2Z4QB 3WMCA 5C0FA 3LY6A 4JPIB 1OSZB 4JY5H 1CBVL 5SWSB 1RAMA 1CPUA 3MODL 5JQHC 3WF3A 2BERA 1QNZH 4NJ9L 2ID5A 1FNHA 3IDXL 1H3GA 1I8IA 1LNUA 2CKBH 1W91A 1XCXA 3EMCA 5FO9B 4OB5H 1BTCA 2GKIA 1X5XA 5GGRB 4AIXA 4CMMB 1AGCB 1F13A 1E4KC 1SM3H 2E7HA 4PJHE 3KPSD 1A6AA 4GG6E 1KTKE 1DANU 3MRIA 4HK0B 5I17A 2EXOA 1OAZH 1UEYA 3BDXA 2X70B 4HH9A 3C60B 4NCC2 2XT1B 4TPRH 4TQEH 3T4YB 32C2A 3ZSSA 2ZWYA 1LDSA 2VIRB 2YPLB 5DD0H 5ICYB 1BMGA 2IH1B 4LLWA 2OTWA 1WB0A 2K7QA 1ZB5A 1QFOA 2Z93A 1CFQB 3ZO0A 1MCPH 3B9KD 2BRQA 4K7PH 3P0VH 5EU6E 2BK8A 3M07A 5HHOB 1I1XA 4AC1X 4F15C 5JNYA 1XCQB 1KB5A 2D7QA 1WTLA 4FQHA 4BQ2A 4Q58C 4GRWH 3IDMA 3FQXB 3RX7A 2PCPA 5I19H 1S78D 4P7LA 3C8DA 1H09A 1OAYL 4LHUA 4W70A 1EQPA 4WV1A 3UTTE 4KUCD 4MQ7A 3ZR6A 4UMGA 3HI5L 3KXFE 3ACHA 1GJUA 2CRIA 3WXVL 4LSUL 3IDJB 4I3RL 5DEGB 2AK4E 3QH3B 1EGJA 3ZYJA 3GMLB 3QR2A 1BVLA 4ZOAA 4MSWB 5SWZB 3NZHL 4NT6B 5IB3A 5C0DA 3D39A 4M7LL 1GGBL 3C8HA 2Q76A 2YRZA 1UJ3C 1PSKH 3SGKA 2QKIA 4A45A 5DURB 3I3DA 3V0AC 1QNOA 1UWGH 2P5EE 3FT3A 1VKXB 2OL3L 4LMQI 3W39B 3BGMB 3GSNA 3RVVC 2F5AL 4M81A 4JGUA 3KWWA 1UXSA 3FB5A 1OOAA 4L8BA 2CO7B 3QPXL 3VWJD 1NEZA 1GGIL 3IFOA 4BCEA 5A40E 3U57A 3MLSL 2E9IA 3QXTA 2WCGA 3JXAA 3QCUH 2ICWB 1ZANL 3RA7L 3LEGA 1SY6L 5BV7H 1NAEA 4C7FA 3MS8A 3FHAA 1UHVA 4V2XA 3VXPB 5FOOA 3BAIA 1NMCC 4NM4H 3TA3B 1FYTB 5CINH 5JMOA 5IBUG 1YNLL 3LEVH 2AV7B 1F4XH 3U46A 1MWOA 2O9PA 3N1QC 4YXHH 3RWEB 5BW7A 2IMMA 3NFNB 1IGYA 2ED8A 4WI3A 1T7XA 2WWKT 1KENH 2DJUA 5I15L 2FWOB 3QHFL 4DUXA 1JN6A 1XGUA 3PHOB 5BVJA 3F6IA 1J1OH 5AUMB 1HH6A 1Q38A 2E3ZA 2V7NB 4QTIL 5FOJA 3IFPB 1AJ7L 4ONFH 3SE8H 3U4EB 5D9OA 4ARYA 2CNCA 3G6DL 1PZ3A 3MJ7B 1J86A 1K42A 5IESH 3C2AH 5C0BA 4MDJA 1G9MH 2D31B 1BZ7A 1JPTL 1YUHA 3TIEA 4IJ3B 1JWUB 4I48A 3CVIH 1NANI 3EDKA 3MROB 4H26B 2GFBB 1IC5L 5FM5O 1BGXH 5DTFA 4I0PD 3D0LA 2OBGA 4O5LL 1KBKA 4U7MA 4P23A 3VRLE 5EUOB 2HFFB 1RURL 2YD6A 5HHMD 3MNWB 4ZO7A 2WMIA 3TIDA 5T3XE 3S96A 2YPKA 1B3XA 3H42H 3D85A 4KHXL 1W1TA 4U7KA 1RK0B 2G5BB 2MWCA 4GAFB 3RJXA 5E9DB 4ONOA 1A6TB 1T7YA 4L1DA 4P2OA 5JXJA 3SDAC 3ARWA 1JK8B 4CVXA 3HPJA 3LN5B 2J74A 4X9IA 1M1SA 4CW1A 3OKLA 1SEBA 1CFTB 2YD1A 5GGTL 2ZUMA 2YOCA 3AIQA 2XZQL 1TJIL 5JA8B 1HL9A 4JRYD 3VXSD 5KVGL 4KVNL 3R8QA 1UKTA 1H0DB 3WEXB 1NC4D 1L0YA 5ELIA 3QUYD 5I6XB 3X11A 1WICA 1CDIA 1MRFH 2ITDB 3TVMC 5T3ZD 1A02N 3T04D 3NCMA 3U30B 3RL1B 3W6LA 5C0GA 2AXGB 4XUQA 4WRLA 5DJCB 1MJJB 4QXTA 2DN7A 2R29H 4E41B 4LARL 5B3JF 1A7PL 2BNRA 2NY1D 5FYKD 3H9YA 1WDPA 5D2NB 3V6ZB 3UPRB 4R2GC 2PXYD 3JTTA 3RJYA 4H8HA 5CBEA 3L4ZA 2VZOA 5F7EH 3ZYZA 4C56E 4OCWH 4Z7NF 3KYKH 1MIEH 3MFFA 3GM8A 3BCFA 3RI5F 3JV6A 1P4IL 5BMFL 4HKXB 3N1GC 5C1MB 3L3OA 5E8PA 5DUPL 3VUPA 2DAVA 3V8CA 1NWTA 1JPFA 4HZAA 1YYLL 4HDIA 4JFHD 2ZEXA 1N8ZB 3CC5B 1OLZA 2FO4B 3O11B 2F58H 2AVGA 1HNYA 5E8EB 2J7FA 4AEIH 1NKRA 5DUML 1GHFL 4AIZA 4YQXL 5A8PA 2W4XA 3VJ6B 3S3SA 1XGPA 4TSCL 3AIEA 1OTUD 3FQRB 5KW9L 1L0QA 5CP3A 5ERWA 1KOAA 4XUPA 1MY5A 5A1AA 4EI5C 4IRJD 5F97E 1XH1A 5BXFA 3QDME 4QCFA 4D6EA 2Z31A 1IAOB 2A6KB 5BQ7B 4AM0A 3LQAC 3CU7A 2OLDA 2XWTB 4Z7UB 3TZVC 1JGVL 5CEZL 4LKCB 5HVGB 4M80A 1TMCB 3WMSA 3SQOL 4S1DD 3KJ6H 2EEDA 5DLMH 2FJGA 4GMSH 3V95A 4WNQA 3L9RA 3KYNA 4XPTH 1A1NA 1ZLWH 3KPRE 3O3DB 4HP5A 1DN0A 4G9FE 1U8QB 4XB7A 5C0AB 5JPMB 3DUSA 4JPVL 3NBNA 4ZG1A 3ARZA 3UTTA 4PRID 1U3HA 3BIBX 5DJAA 2RAMA 4QFUA 4S3JA 1S9YA 4FZ8H 5DFAA 5TE7H 2Q8AH 5CEYA 2J22A 4N5ED 2PO6C 1MFUA 5J11B 1JHTB 3ILPA 1RULH 5DWUL 1JAEA 5BO1L 2AK4A 4OIIH 4BQ8A 5D7JC 1WZMA 1CL7I 3MV7B 4PJIB 1G6RB 4KAQH 4PMYA 1G1CA 3K4ZA 5J1AA 3DRQA 5HYSB 1TZIB 3P30H 4FHBD 1MFAL 1P7KB 5MEND 4U1HA 4P2QB 5CSGA 5D4QA 3ET9F 3C7HA 1ZTXH 4XPBL 5E5MA 3NN8A 2EDNA 4QT5B 4KDTC 2XZAL 4LXFA 4Z7VA 4AW7A 1W9TA 4Y16D 4X6EB 2K3TA 3SOBL 3VFOB 4ELKA 3D1MC 4XP1L 1WBYB 2JB6A 5MEPA 2VZTA 2PWFA 4KI5E 3MUJA 2XIDA 4EAMA 5LCWL 2BGPA 2XN9D 4P8UA 4JO2L 4ZTOH 3O3AB 3MLVL 1UM4L 3NAAH 4YBLB 1E5NA 3VX0A 2IAND 4HKBA 1V7ML 1W2VA 4G43A 4GW4B 1I1AA 3HR5A 2CRYA 2DBLH 4PJBF 4KH2A 1V3KA 4Z8FH 1LDPH 2VUOA 5HYIA 2ATPA 3WYRA 4HIXH 4NQEB 43C9A 3RZCD 4GRWB 1UG9A 4NQDD 2FL5A 1KGUA 4YXLH 4RE4A 3K4AA 1LNUB 3QJHA 2HKHL 3A6CH 2J7CA 2QSCL 1HE7A 3RJQB 4CVZA 3L4UA 4XZBA 2J4WL 1KXVA 4LAQL 3N9KA 4PGZA 5EU5A 3UC0H 3U9PH 5C86A 4P02B 1KCRH 5GS3A 5I1JL 1RYYA 2R4SL 3SCVA 3MRIB 5IEKA 2CBIA 1IZJA 3NFPA 4HH9B 3TNMA 5EIYB 1RH9A 1ZXQA 3DC0A 3IB4A 5HXMA 5A2CA 4Y5VA 3EDJA 3H7BA 2XQYG 4L3EA 4LLWB 1IT9H 4K8RD 3KVQA 3U1SH 1OP5K 3WDJA 1R85A 4X7CC 4L0PA 4JFOB 4UTBL 2P45B 1LG2A 1X5ZA 4BH8B 4RFEB 2L0DA 3ARXA 5F1IA 4YDVA 1G7IA 3IDMB 2PCPB 3H9SB 4XHJD 3HAEH 5EFIB 4WFHD 2IF7A 1UYQA 4FF5A 4FI9A 4WI6A 4Q2ZA 2GVYA 1IC4H 3WD0A 5K9QI 3NABL 1NM9A 1B3JA 1R3KB 4WV1B 1U58A 3VO0A 1F2QA 3RPIA 4C59B 5DEZA 3W6MA 4UAOC 1P6FA 1T3FA 1M4KA 4JHAH 3BWUC 3STLB 4RQQA 5KTEH 4X4ZA 4HEPG 4XPFL 1V5JA 1YPZE 4AQ1B 4EN3B 1NCDH 1W9BM 1WE5A 2YBUA 3QI9C 1KEGH 1YECH 3WXWL 5EU7C 1ZEAH 4OD1H 3B43A 2J7HA 5KVEH 3ZLQC 4ZS7L 1XFPA 4QXWA 5DRWA 3ZT6A 5IB3B 1C93A 3SHSA 3CPLB 5EB9A 3D39B 2Y1VA 2AAVA 1Q9OB 2ZCHL 3MJ9H 4JLRB 1R5WB 3UTSA 3EAKA 1P4LA 3EYPA 2APWA 4TVPD 5DSCA 2NT0A 1I3RA 1CR9H 4JDTL 1X9QA 1JRHH 2VDQL 4KQ4L 4NZRL 3HE7A 3GTNA 3KWWB 1UXSB 2NCMA 3VD5A 5I1HH 3G6LA 3KS0H 5ID0A 3VXMD 5GRZA 1U8IA 1NEZB 3QUZC 1GOWA 2OX5A 2X4OB 3SE9L 1CEOA 4ZZ5A 2A3HA 4NPYA 1CGXA 4K3GA 4V2BA 2RGMA 4WKAA 2GCYB 4NSKB 2GY7B 1MCKA 2I9LA 3OZ9L 2A9ML 4HZLB 3CZKA 1YMME 5D96C 43CAA 2WHJA 3OMZA 1QACA 2EDLA 4N8VA 4J6RL 4Q7DA 1I8MB 4AD4A 4DOHB 1IGYB 1YEJH 4P2CG 3SCSA 3T77B 3AS2A 5B4NA 2OJZH 1DL7L 3LSOA 3T2QA 2DWEB 1IGFH 1XGUB 1W0WA 3RGVD 1OM3L 2GK2A 2D20A 1OTTD 4CN1A 4HUWA 3KHOA 5IJKA 3PTMA 4K55A 5E8DL 1KV3A 3Q0HA 3QDMA 3T0EE 4C83B 3BEVA 3TGXA 1BZ7B 2ZCKH 1YUHB 3TIEB 5JUEH 4F9PA 5F9WC 4XB8A 6CGTA 5I24A 1RIUH 1UM5H 3LD8C 3GBLA 3D0LB 1D5BA 3QO0A 4NN5C 4YHZH 2Q20A 4KRLB 1F58H 4D0BA 1WV7T 4FMKA 1GIGL 4MVBC 1U8LA 3MXVL 1OGAA 4J3XA 1RUKL 4X8XA 2UWFA 2ZSWA 3TIDB 4HG4K 3S96B 1QSFD 5DI8A 1KB5L 2V2WA 2YPKB 4QRPE 1TFVA 3IGAB 3VFGL 5FOBA 3I3BA 2X8RA 4HZ7A 1NFKA 1WCQA 4N68A 4OKDA 1HIZA 2HRPL 2YPVH 3C08H 3RVUD 1CWYA 2CBJA 5C0RH 4LNRA 2DPEA 3MRKA 1FGNH 1XGYL 2MCPL 1AO7B 1ADQH 4M5YL 4Z76B 4O9HL 4EKXA 1SEBB 1R3IH 1UACH 1VEMA 4KQ3H 3ELAT 3UEQA 1VF8A 2DQXA 1EGJL 2GK0A 1CGUA 2VH5H 1H41A 3ABZA 4IISA 3BZFB 3X11B 2QBXA 5EIQA 4JY4A 1JUFA 4BA0A 1K8IA 3QXUA 5JW3L 1ZLWK 5C0GB 1IC7H 1YEGH 2XA8L 3S88H 4Y4FA 2J1TA 1TZHB 3MRNA 5GISH 4E8DA 3NCYS 1KN2H 2X7LA 3DETC 3GSNL 5BZWA 4Z7WF 3IDUA 2BNRB 4KKCD 1I1AC 4X9HA 5GSRA 2ZWLT 3RIKA 2IFGA 1NQ6A 2YIHA 3BYYA 1S7XA 3A0OA 1C5CH 3BGFC 4J1UA 4TTGA 1TJHL 3HCVB 3OR6A 3GSWA 4WU7A 5CGYC 2WABA 4QHKJ 3S6CA 4F79A 1FHDA 2HFGL 1WJ3A 1JTTA 3SKNA 1PYWA 1NSNH 1JZ6A 4LLUA 5E70A 1KCUH 2BX5A 2NY5H 3L3OB 1A4KA 3WFCL 1KXVC 1JPFB 5CBAA 4IIQC 5I1DA 1T2QL 1DR9A 2F53E 2PW2B 3FO9B 4JKLA 5L7XL 3AYSA 4P8VA 5EBLB 5EU4B 4K3EL 3V6OE 1OAKH 2DQGL 2XFXA 2NX5E 4FQ1L 4AIZB 5C0JA 4HJJL 4PP1D 1MFBH 3C5ZA 4G7YL 1BAGA 1FL6B 3DVIA 3RWIA 3SDXA 5D7LD 1AGEB 2XXMB 2ZUXA 3DHUA 4NYLB 4POUB 4BSJA 1Q6EA 2CLZA 1JYVA 1OAUH 5K59E 1XAUA 3BPOC 3GH5A 1S5HB 3H7LA 4RAUB 2Z31B 4JFYB 4POZC 5BRZD 4NIKB 1MNUL 5JIKA 3RJDA 4AM0B 1X1NA 1UD2A 1P7QD 4LKXB 3B4NA 1CTNA 1RV6X 3CFIC 3VGEA 2IAMD 2FJGB 2G3IA 3GSUB 4WNQB 1UR0A 1AD0A 5EOTA 2J1VA 1DN0B 2YEZA 4HW6A 1LK2B 4M02A 3DUSB 4XUOA 2R2HA 3QHOA 2XG5A 3M17A 1SBSL 4HKZA 4PJGE 3BJLA 4BZ2L 2VX7A 1OPGH 2XYLA 4JFDD 2VXSL 3SQBA 4P8XA 4CRPA 2BOCA 5EUOE 2XJ7A 1KUMA 1S9YB 3PTKA 4S0TD 2SEBB 1OH4A 3A47A 1E0VA 4MNHA 1IQWH 2NY4D 1YPZA 1A5FL 4Z7OE 5T1LA 4KKLC 3ILPB 2WANA 2VZ1A 3K4DA 1BHGA 1RJYA 5E03A 1ZJBA 3GEWB 5D1QA 5L8KB 4GOSA 1VCAA 4EI5D 1F90H 3VD9A 1FORL 3PL6D 4OZHF 3PZTA 1HXYA 4YK4C 3DRQB 4A2MA 4NRYA 4WEBL 2GJXA 1JFQL 4U1HB 4K71B 3V7AE 2QQKH 4TYUA 4PRAB 5C3TA 5IROA 4XXDA 3RWGA 2DWDA 2R1YA 1QSZA 4F7TB 1X5HA 4Z7VB 4HGKC 2A3AA 3D69B 3WJLA 3GKWH 4CUBA 3SJVE 3CFKA 2F8OA 4KHTL 1ULOA 2J8GA 2DICA 4S1RH 4ELKB 3VFUB 3LS4H 3RP1A 5M7QA 4I18C 1C16A 2JB6B 5EO0B 2AABH 1UY1A 2WN2A 1KGCE 1FZMB 1EMTH 1E55A 4B7LA 2BHZA 4GW1B 5FYJU 2AQ2A 1Q0XL 4HFUL 4TN9A 2CERA 5E94A 1SMAA 3S34L 5BS0D 5GZNC 3BWAA 3EB7A 4D9LL 4RFNC 2O5YH 1X5IA 3FN3A 3QEQA 1EXPA 1QOKA 5CWSB 5D7JD 3UTQB 2WHMA 43C9B 4BZ1L 2FL5B 4DZBA 1NCWH 1WT5A 3HAEB 3S3JA 5DPNA 1CICD 3UJJH 4Z2GA 2ED9A 2VX6A 4ZMAT 3QJHB 2UYLA 4FFVC 1HWHB 4Y19A 3QAZC 5EO9A 1ZWIA 4JFVA 4Z2JA 2G75B 1UZ0A 4YIQA 5C7XH 1T04A 3ECQA 4YO0A 5J3HC 4CMHB 1MPAH 3K2UH 1J1PH 2GTWB 1HKFA 2H1PL 3PNWA 1A7RH 2J78A 1JZ3A 3DX8A 5KJRL 2X4TA 3NFPB 5DQDL 3DROB 2EDQA 4Y5VB 4OZFA 5D7IE 3Q1SL 3BRFA 4L3EB 1F42A 3WJJA 4EQ3A 5D4YA 2Y24A 2J88H 2R8SH 1N2RA 4ZXBA 2GSGA 1T21B 4QRPA 5GS1A 2APFA 5I71B 4ZUVA 2Y72A 3HI1B 3QEGH 4N0UE 4XP5L 4YDVB 1G7IB 3GIVA 1US2A 4V2CB 3U4BL 5E8NA 5D8JL 1W0YT 5J57B 1O7SA 1VDGA 1C8XA 3CSBA 2XM2A 1SMDA 3EOBA 2AJYL 3EYUH 1U58B 3GMPA 3TBSB 3CTTA 3RPIB 3TBWA 3VFVA 2NY0C 4RQQB 2J5LC 1BFSA 4O58H 3BOVA 5LG1A 1KJVB 1I8KA 3CHEA 2YL9A 2GI7A 3ALWA 4KXZI 4X8JB 1DE4A 2IPKA 3AY4A 3MOAL 4KI5C 5DRWB 1FH5L 1HXMA 4HG6B 1WWBX 1JPSH 3W11C 3PDDA 1YA5A 5E2UL 1LE9A 4LHUG 3ILQC 3TPUB 2W07A 4LLDA 3UTSB 3WSQH 3PTQA 1P4LB 5DSCB 5TE6H 1I3RB 2XUCA 3L5JA 2VXVL 3QDGD 5HPMA 3GH7A 1DLCA 1MAML 5I8CB 1LEIA 1A9BB 4DCQA 2XQBL 3VXRD 1KBGH 5ID0B 4JFSA 1Q0YH 1U8IB 3FMGH 4J12A 1UXXX 4PREB 4TUOA 4P2QE 4XMLH 4PJ5D 4XNYL 4XNQA 5GGSA 3AMDA 1UB6A 1MFDL 3C5ZC 3P0YL 2H26B 4I1NB 2AEQH 2ZSVA 2NTSP 2YG0A 1UWXH 2H32H 3GKZA 5FFLA 4QDRA 2RGSA 3P2TA 1A6VH 4XCFH 1IQDC 1D5MA 1ERNA 1ZKAA 5DK0A 4MAVA 4ZPVA 1C8QA 3LSOB 2PBOA 1NEZG 4MMZC 5D2LA 3VTRA 2O92A 1JXKA 3WNNA 3RWHB 5A3IC 2GSIA 3TTOA 5DXWA 2B0SH 4HXAL 5HYJA 2AERT 3ARFD 4UFKA 2ZPKL 3LKNB 1CGWA 1GHSA 1VFAB 1LMKA 2E7MA 2DLGA 3MRBB 2QQLA 3ZSTA 3UTZA 1CQYA 5DJ8A 2D24A 3Q6GL 3RIAK 2WUHA 3WO4B 4W4OA 5BXSA 4GRWE 4QB6A 1W99A 5FKAA 3O8XB 5AG9A 2AI0L 3QUZD 4FQXA 4KTEL 3Q5YA 3JUGA 1D5BB 3IXTB 4NOBA 5F9AC 3TBTA 4OM1H 5INDB 1J0HA 2VXTL 5BWFA 5HHQB 4QDMA 1EH9A 2NY3B 2R1WA 2X4UA 3UO1L 1A7OL 3Q6FB 3S35H 1VAHA 2MOVA 4HUVB 1LWHA 2ZSWB 4MJ6A 3RTQB 3U7WL 3HG1A 5C3LD 3VNZA 4M3JA 1NAKL 1ROWA 3GSQA 4PJGA 5D1QC 2XZZA 4PJ9A 5FOBB 4Z7UF 1CLXA 4P00B 5F89A 4GO9A 4HPOL 3HE6A 4K94C 4YHIB 4NN6C 4XPAH 3RWJA 4EK7A 3GMMA 2AJSL 1HL8A 2AEPH 3MLRL 4GQQA 4F66A 4JR9H 1IZKA 2HJLA 2LTQC 4ZDHA 1DLHA 5IROC 3CO4A 4S2SA 3EO0A 1Z5LB 3N1MC 5EU6D 1CG9A 3H9SE 1NGQL 2GK0B 3F6LA 3NVQA 1AXIB 4EBQL 5CD5C 2HYXA 2XV6B 3SCNA 4EZMA 4PBGA 3VIMA 3MBXH 4L8SA 1AGDA 1ITCA 5IBTH 4JY4B 4HLJA 4PTWA 4AISA 2B4CL 2GAZA 3T2PA 2X9XA 3QR3A 5L0QB 1QI3A 4Y4FB 5E0FA 1K45A 4OF5A 4AWEA 2R4RH 3DGGB 3WIIL 2X7LB 1J0IA 5HJ3B 4PJIF 4R3SA 1N5YH 2WZIA 3ZJ8A 2DTML 1IGTB 5INCA 3IS1X 4XCEB 3AMGA 5F3HA 3WN6A 4HUKB 5C9KA 4ACYA 3WMBA 4GW5B 1RUAH 4LVNB 1UOKA 1V0NA 1E4IA 3OR6B 4OSUH 3GSWB 4G6KL 2NY2B 2J7GA 1KXTB 4TSBL 1WT5C 2VLKA 1I9EA 2X2YA 3DO3A 1UYYA 4XBPA 5E56A 3SKNB 4R4FH 4PYGA 3T0EC 5GSVB 3GBMH 1I3GL 1IAKA 4UB0L 2HG5A 2OXGA 2AJXL 3GRWA 2NZ9D 1B0GA 2P43B 4P5KA 2BOBA 2E33A 1DQDL 5I1DB 2DM2A 1ZSDB 3AVEA 4WHCA 4RE2A 2HKFL 4GH7B 4L4OA 1N64L 1IILE 1V6YA 4G8IB 3SDXB 1WPCA 1FBIL 5LJYH 4KRPC 4MOAA 1NAMA 5JQ6L 1EFXD 3E6FA 4D3CH 5HI3C 2V6HA 3X13A 1G0YR 1IM3A 4MS8D 5D7IA 3C6LC 5CSBA 4IUGA 1CLVA 1DFBH 4J3TA 4XUTA 2EPMX 2JJVA 4WFFE 3M46A 3B9EA 3AHVA 1M03A 1XH2A 3F4VA 2JF7A 5JXAH 2WB5A 3MRDA 2FJFA 3GBNL 1DUYB 2ESCA 4NBYB 1KWKA 1MHEA 4UQEA 4KRMB 5H8DA 4FFZH 1JMXA 1F45A 3NCYP 4JGMA 3PDGA 4MQSB 3PHQA 5DMGD 1JNNL 1HYRC 3AISA 2ADIA 3M17B 1J0ZA 4DWSB 3CLEL 2D9CA 5HDBF 5DO8A 1LG1A 1E4XH 2BOCB 5IB4A 3ZYIA 1R3JB 3QRGH 4KPHH 4U1SB 1NMBH 3T0DA 4AG4H 1T5WA 4YUEH 4L4TB 1FIGH 3QISA 2OK0L 5T1DH 1RJYB 1TDQA 5D71L 4XUNA 1T20B 2F54A 2OZ4A 4OF8A 5T3XD 2GJRA 2JJSA 3FFCE 4J3WA 3L3KB 4RGNE 2QF8A 1HXYB 2P5WB 4POZD 2GJXB 1WEJL 3T08A 1GC1H 4PD4J 1I7RA 3AFBA 5AZ2H 3LKPB 5JPNB 5CD3A 1AO7E 2VDKH 4OLYL 4P46B 4XXDB 1FP8A 3O4LB 1QBML 3JWOL 2DWDB 1AHWB 3O6FA 3MGAA 1VESA 4Q9QH 4PB0L 1P9MA 3ZTNL 5FF6A 3CFKB 2FEEL 3LKSA 5DO2C 3PZMA 4D94A 1HZHH 3FAXA 4AY0A 4OZIB 3Q48A 3V6OC 4HJ0C 4IBLT 4BQ3A 2AJZA 3P11H 1WWWX 3OAUL 1JG9A 5D9PA 3H9ZA 2JALA 1AR2A 2G60L 1M01A 4LSVH 1I7TA 2LQRA 4P59L 4TSAH 2IWGA 3GMRB 4UINH 4MDOA 3MPCA 2EDRA 1ISYA 5E94B 3DYOA 1IM9D 1KULA 4TX6A 1JZ8A 5HHNB 3LKQA 4IMKA 4CU6A 2XQXA 4ODVH 1CZSA 1QYGH 3QEQB 2APXA 4KZDH 4NKOA 4JFUA 4PTUA 4W4OC 2VISA 2EQDA 4E41D 1G6VK 2Q7NA 2BVDA 5EB8A 1HIMH 5AD0B 1YEDB 4C56D 2OKXA 1UWWA 2DMCA 3D18A 2HJFB 4QLRA 1ZWIB 2E26A 2FH6A 3H9HB 4PY7B 2CLVA 2YFZA 4YIQB 4OGYH 1T04B 1FH7A 4YO0B 1H11A 4P7OA 2EDWA 2X4SA 1RVFH 1G9NH 1G84A 4IMLA 2VLRD 3PNWB 3GIZH 3VXTA 4F37K 2UWEA 2J3SA 3MRQA 3NSNA 4PTXA 2PW1A 5IDIA 4OGXL 5BRPA 4OZFB 2R69L 4RMVA 2WVSA 3VI4F 1N4XL 2J6EH 1UWXK 1S9XA 4AD5A 5FK9A 3N9GL 4PRHD 4UZSA 1IGCH 3HUJB 3BDYL 2W1QA 3DHMA 3D5HA 5DHYB 1F4AA 1ULVA 5GRWA 5TDNA 2FX9H 3R0NA 1R5IA 4ZUVB 3VA2C 3S9DB 3RDTA 5FYLE 5GZND 3O6ML 1CE1L 5CSZA 3GIVB 2VITA 2BNQD 3E1F1 5E8NB 4OCXH 1JYWA 3BN3B 3INUL 4X7SL 4X9YA 1FZOB 2J8FA 2HMID 4LCCA 1JI2A 3ARVA 3RNKB 3SIMA 3TBWB 4YFLF 5TQ2L 3N11A 3VFVB 5E8OB 1S3KH 4APQA 2DLHA 4FFVD 4W5UA 1R3LA 1GZQB 4P4KD 2X6MA 4DKFH 2X9WA 1ZU8A 4PJ8A 2H32B 4XPHL 1ED3A 4QRRD 4G9FD 5J3HD 3VMPA 2IPKB 2YC4A 1X6LA 3VG9C 5JLZA 3MUZ1 3U30C 1OINA 4XVTL 5CSUA 3D48R 1J5OH 1CIUA 3EOAA 1D5XA 3AROA 1LE9B 5FEBA 3I6KB 4QOKE 3L3DB 4JZ5A 2HT2C 2W65B 5EIVA 2BMKB 1G7QA 4KJPC 4PV8A 5HPMB 4HD9A 2BXZA 2A2QT 3B2UC 5DMKA 4K68A 2W63A 5IG7A 4IEFB 4EUPA 3E8UH 1D2KA 3TJHC 3R0MA 3TPKA 4LEXH 3CUHA 1E40A 3KDMA 1DBKH 3KLAA 1V0LA 3QQ9D 4ZOBA 2CKNA 1CTOA 3MJ8B 4XNQB 3KPTA 3QUXB 5GGSB 5L6YH 2CBVA 1HKLH 1UB6B 4AIEA 1NBYA 2ICWI 3S36X 1RU9H 2DT2A 1F11A 3CVHA 4PJFB 2ZSVB 1LQ0A 1UH2A 1UYWH 4JM4H 2NY0D 2VLJA 3M1BA 1GQKA 1Z9LA 1LHZA 3V52L 1T4KB 2BP3A 1D5MB 4QHNA 5DK0B 1HCFX 3GB7B 1DQJB 5D2LB 1QFWH 4DXSA 3IF1B 1QNQA 3DVGB 5TH2A 2D7OA 1PG7H 3O2DA 3EMZA 3WD2A 2ZIDA 2FSEB 2X4RA 2V5MA 3ILQD 4MQXD 4OCRL 1GPOH 1FE8L 1B90A 1KFAL 3OKMB 5HY9A 4Y5XB 5KVFH 4N8VG 1KC5L 4KV5E 2BY3A 5FKAB 4M7ZC 4ZD3L 5AWNH 3OF6A 1UT9A 1BLNA 4L9LA 3MRFB 4NUGH 1EEZB 2IH3A 4Q0XH 1C1EL 1TNMA 3KE0A 4JFEE 2VAJA 3ALFA 3THML 3IFNH 4HS3A 3W9EB 1MFCH 4G6MH 2D3LA 3JV5A 2X4UB 4PRPD 4PRNA 4XBGB 1N6QH 2DSWA 5HDQH 1S7QA 5MHSE 4RE3A 4MJ6B 2YBRA 1MY7A 2VABA 4M6NL 4XT1C 3GSQB 5KVDH 1M71A 5CJXA 2FGWH 3WIFA 4P5TA 2BVQA 3UZQA 4PJ9B 3GXIA 4UDTA 2CD0A 4ENEC 3P77A 5J11C 3HE6B 4MA8H 3CHCA 3W0WD 4QTHA 3VFMB 3WFBH 3S4SA 1XF1A 2V5TA 1GUVA 1HJVA 2HJLB 4AZ8A 2YXFA 3W25A 1MHCA 1URLA 3F7PC 5LCVL 4XC1H 1NBVL 3PV6A 1JZ7A 4DVRH 3F7VA 4PY8J 4QXUL 1EAPA 3TN0D 2WWMC 4M48L 4M8UA 3SCUA 4F9LC 4WTZA 4FQPA 3D87B 4MADA 2ZJSL 2VLLB 2WO3A 1GCYA 4CNIA 2ZX7A 3DXAA 1D3CA 3L7FB 5F70A 5T1MA 4A2LA 4DK6A 1NCCL 4FG6C 1KELH 2VDMH 2BY0A 4YDIH 4U6VL 1NOWA 2DLIA 1MRCL 1LEKA 5FXCH 1UX7A 4PCTA 5TPWL 5IB2A 3K1KC 4R3SB 4P3CH 5INCB 1F4YL 1DLFH 3IU4H 4Z7QF 5T3ZH 3ZO9A 5JXEA 2R56H 4AZBA 3HNYM 1DDHA 4U1GB 2NW2A 3IRZA 3U0WH 1YEKH 4LRNH 1QBLH 2VLKB 1QPXA 4Z7VF 4WWKC 4XBPB 4MXQD 4TOYH 3HLAA 2AW2A 4PS4L 4ZFZB 3BPLB 2HG5B 1WUNT 4JKMA 1EDTA 4DZ8A 3FQWA 1JNDA 2BOBB 2E7LA 4WU5A 2WHLA 1FNAA 2EH8L 3GNML 1S7TB 2HFEB 4GBXA 4GRLA 1ONQA 1E6QM 3DVFA 3C09C 4X6CA 5CD5D 2C0HA 1X7QA 5C07B 5EPMA 5FKPA 2B4KA 4HXBL 1Q6CA 4M43H 2L9LA 1YMMD 1ZLVK 1B2WH 3QIUD 2QQLL 1UKPA 2UY4A 4Y8AA 3E6FB 3WS6C 3ZDXE 5C0CE 1MCCA 5C7GA 3ZR5A 4QRTA 4RWYL 5JDJA 4O2FA 1RUQH 4IRSC 3LE0A 1YY9C 1CCZA 3BP6B 1DZBA 3L7EA 4M9PA 3UDWA 4PJEE 4QY8B 3HS0A 1ACZA 3S5LA 1LNSA 4JVUA 3AXIA 5LGJA 4RIRA 4RCAA 4AQOA 4LU5L 4W84A 3HB3D 1QFWM 1SG3A 4DN3H 2PQSA 5LQBH 2VE6A 2W0FA 1AKJA 3MRDB 4LCCC 4OFVA 1UR8A 2XTKA 5M03A 3K3QA 1XSIA 1MHEB 2AV1A 4M1GH 5A16B 3UP1A 3T0ED 3QYCA 3DBXA 4KK6C 1VJSA 2R1XB 1D9KA 4TVSa 1KJMB 5IOPA 4U0RC 4PJ8C 3CIHA 1W3JA 5SWSD 7TAAA 1BAFL 4ZENA 3HRPA 3W27A 4QRUB 1T7VA 5TJWK 5IB4B 4JPKL 5BV7C 4I4WA 2A6DB 1JE6A 5DJ6A 4LSRH 3UJTH 4EN3C 5I1KH 1FAIH 2WUBL 3VW3H 1QFUH 1NL0H 2OR9L 3FOMB 1TJGL 5TQ0L 3MV9E 4UT6L 5D8ZA 3C60D 4W6XB 4XNXL 2WBGA 2YPLD 1OF2A 2FATL 3S37L 4CADB 1BECA 4EVNA 5C6PB 4D2NA 2VERN 3OGOE 3U2SA 5GGVL 5HHOD 1BEYH 4MNGE 3O6FB 4KRNA 4JG1L 2DQEH 1G9MC 3LKSB 5B8CB 2VVSA 4HT1H 2HWZL 4KROB 4HOXA 3I2FA 4M93C 4JRXA 3F58L 1T1YA 3RWCA 2BVTA 1JNLL 1KN4L 3EFFA 1UWUA 2W66A 1KF9B 3QA3B 1YC8A 1MH5A 1ZT7A 4N0FA 2WCAA 1I7TB 1JTOA 5I73B 2JCCE 4ODWA 3ZYOA 3FO0H 4UI9L 1PEWA 1NUFA 4K7PX 3BJ91 4URTB 4JFTA 1NKOA 4M7JL 3GRWL 5ABDE 5ADPL 4GPNA 4NWUH 2YWYA 2QJDA 3TJEL 5SWZD 1I4FA 2IBBA 2Z4FA 2LVCA 5IFTA 2EKJA 1QLEL 1CK0H 5E0QA 4J7RA 4NP4L 2DDUA 1WO2A 5IVOA 1AD9B 4X5WA 3BAXA 3BYTA 1HNGA 4L4VE 3CBWA 5DURD 7FABH 2VRJA 3MLZH 3CFDA 1QW9A 1NAML 5K9OA 4DAGL 1OT2A 1QSVA 3QCTL 5K9KA 3NIYA 1E73M 2XG4A 3ARGA 1VGKA 1PMHX 1OAXL 3TCXA 4IMLB 1JWMB 3RY6C 5DO2D 2JDAA 1U8PB 5CJXC 3LEKA 1ZHNA 2UWEB 2QHRL 3MRQB 2PW1B 1UY0A 1U3JA 4HJ0D 1R7OA 1S9XB 3QPQC 4DGYL 3TA3D 1FYTD 1MELA 2X0YA 5MERA 3AZTA 1JGUH 1C8YA 4KRTA 1BJ1J 4ODHL 3KEHA 3E3QE 2ZOLA 3QXAB 1PBYA 3RDTB 3NA9H 5JIIA 4LSTL 2VDNL 3I50H 4NRSA 4XC3L 1UWEH 2F8XC 2O5XL 4JKKA 4RGNC 4MA1C 1VENA 2VITB 1KYOJ 5FV2A 2Y6KA 3QO1A 3ULSA 2JIXA 2PF0A 2JELH 2R0WL 1MRDL 5DVOA 1ZLUH 4WUUA 4NKIL 5FECA 3VINA 4HC1H 2ZCLH 2C7UB 3AQUA 5A8OA 4OZFG 4QCIB 4PMNA 1E6XM 5DC9B 2A6IA 3ARDC 4NJAL 4KJQD 1F3JB 1EX0A 4Z18A 2OZ4L 1YQVL 3RMEA 3MLWH 1ED3B 1QLRB 5T33L 4JZNA 4NO3B 2VZ3A 1NLBL 2JK5B 2LU3