2VZUA

Complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
Total Genus 277
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
277
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSAFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNANAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 277
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzuA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzuA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzuA03
4WFFD 3HEIA 2NLJB 1I7UA 3QHTC 5EC1B 5IXEA 2B4CL 1U3YA 1ZLWK 1V3MA 5FIPA 1MCNA 3C7HA 4DUXA 4JDZB 1TCMA 2FHBA 5GGVY 3MO1B 2VDKH 2UY6A 5I1CH 1RVFH 3I02B 4R0LB 4MOAA 2VE6A 5ABDE 1LEKA 2WO1A 3VRLF 1E6OH 2EDXA 2FLBT 3OTTA 4WUUD 5BO1H 1OAYL 4NRXB 2BVYA 3KLAB 1CBVL 4KQ3L 1BZQK 2IWGA 3KS0J 4GW4B 4R0LC 4CN1A 1RIUH 3CLFH 3MUGB 4S3JA 2UWEB 4UIKL 3PZ9A 1WVZA 1ZBKA 4HIEB 1KPRB 4BQ3A 2CD0A 5K59E 2P7TA 3TNNB 2FBOJ 4JANB 3MNZB 1BEYH 4YDKL 1T4KA 4YXHL 3LAFA 3CX5K 3C60A 5IG7B 3I84A 4IJ3B 4NQSB 2ZWYA 4UQBA 3SKJE 1U93A 4JO2L 4LAQL 4AWEA 1UXZA 1JNHB 1HVXA 2OYLA 2F8OA 3ALPA 1DDHB 4W4OA 4PLNC 1ZK9A 3KWWB 3P4OA 5ECJE 3L9RB 3EOBA 5FA4B 4IJ3C 1KN2H 4OLZH 4MXQD 1RV6X 2GTWB 3MLRH 5D7KD 3MV8E 4U31A 4YPGB 2QEJA 5LWYH 2EDTA 4HA3A 5C3TA 3W38A 3BSGA 1QPXA 5BRZB 4OGZA 4U1KB 3G5XB 4HFWB 2FIRT 4ZPVB 5CINH 5F96L 1LEIB 1RYYA 4K68A 3BW9A 2CUMA 1ND0A 3WNOA 3EYSL 4OT1H 4R9HA 2ZXBA 1UHVA 1F00I 2ED8A 2FD6H 3WN5A 4DCQB 1JHKL 3U2SB 2JIXD 1A9BA 3SCWA 4WWKA 4X83A 4HWZA 3AXXA 3CH8A 5I1AB 5EBWA 3CSYA 3RWCA 3V2AR 3JWDL 2X89A 5E0FA 1QFWH 4NRYA 2C7UA 1QACA 2KBGA 2R4RL 1UC6A 4A6YB 5EULV 4MNLA 4BS0A 1TFVA 3OX8B 1LDPL 3U4EB 4TVSa 4PJDF 3TGXA 1MLCB 1DANT 4D0DB 4G7YH 1T7ZA 2QQNL 1KFAH 1IM9D 4PJHE 2ARJA 2ZG2A 4LOUC 5EOCH 2GK1A 1XF3B 1L9NA 3O2VH 4MAVA 3IDIA 4JQXA 5H35B 4X8JA 1BVKA 4IRSD 5DD0H 4J6RH 1CQKA 1DANU 4HTYA 4LHUA 5GGRB 3MV9B 1KLGB 1KJ2B 2VXVH 5SWSB 4P49A 4OI7A 4H25B 1K42A 5FGBA 2VQ1A 1KB5L 4N1CA 4F58H 5F7NC 5DEGA 5JQ6H 3IFNL 3CQOA 3PABA 4I5BA 1BHGA 2V2TB 1CL7I 2V72A 2XONA 3BIAX 1SG3A 1Z6JT 1KEMH 4PYSA 2XVKA 4NC0B 3KGRA 1RH9A 4AD1A 2DIJA 1QRNB 4EI5A 3HMXL 3BAJA 3MRBA 1KTLA 3D69B 5I1LA 5SX4H 1Y18B 2I07B 3UTQA 3EGSA 5BVJB 4XC3H 1MFBH 5GS3A 5TE4L 4L4VD 1A6TA 3NABH 5MP6L 4GBXB 4OZFH 1OLZA 5GRUH 4LFHD 4RMSA 3OMZA 1U3HB 3OAZH 4YXKL 4HEPG 4PJAA 4WV1A 5T1MB 3WQVA 4I77L 2QHAA 1QSEA 3BO8B 3JV6A 1WZMA 4NUJB 2CJUH 4LNVA 3ROOA 3WV0A 2DTMH 3SDAB 4AENA 4GBXC 4UBDC 2VZOA 1ZA6B 1AR1C 4YHYB 1U3HC 1KACB 1US3A 3DXAB 4BA0A 1R5VA 4QHUB 4HIXH 1UX7A 3NJ3A 1X5IA 2EH8L 3BQUA 3QRGL 2F54D 1TQCB 3SDAC 3VWJA 2OZ4L 2XWTA 2FO4A 4HDIB 5CZXC 1HJQA 5CEZE 2UZYB 4YHYC 3QUZC 4P8UA 3ZTJG 4J3TA 3ZT5A 1U8JA 3CDZB 1N5YH 2J62A 4F9DA 1MY5A 1N6QH 1I1AD 1QQDA 1TQCC 1PZUB 1UY4A 2ICWJ 4WFHE 3OGRA 5HYJD 1ZU8A 4DKEL 1OY3B 2EE9A 4OGYL 2D7OA 4HPHA 1RZFH 1YJDH 4AH2B 3GHBH 1OGBA 2K7QA 4W81A 4PP2A 5C09B 1BFOA 3RL1A 1F6AA 3JUGA 2ZOKB 3QFJD 3HNTL 1CGTA 2WQRA 3CU7A 1BAFH 4AISA 3WJLA 5LAXB 4RZCA 2UZXB 3GO1H 3FO2A 4JVUA 4KTDH 1FCCA 5F44A 3SDDB 5E8OB 4PRIA 1A3RL 3LEIA 3WLBB 3QNZA 3TNMB 3EJYD 3W39A 3U5UA 2YUXA 3D25B 5JIPA 5E09A 4A3ZA 2JJTC 1WT5A 4U5KA 1DQLL 4MQXC 4HOXA 1MAKA 2F5BH 4OZHE 1WIPA 1CF8L 1X3DA 2UUDH 4LBEB 2W4XA 1FJ1A 4FXGA 2LU3A 1YEIL 3C09B 1UCTA 2BOBB 1V3IA 5DJDB 4HG6B 3TESA 2WVTA 5L2KD 5ABFA 4BSWA 5HHMD 3F6IA 4P57A 4K55A 3RY6A 2P5EB 3GSNA 3QEUB 2ESVA 4QXTB 3C09C 1GGBH 1IILE 4PCTA 3H9SE 5CFHA 5M3WA 3WD5L 1AXSB 1BOGB 4XP6H 4RFEA 5F7FA 5AD0B 1MJ8L 3FO0H 4LYQA 4Z8FL 3GXUA 4GMTH 3EO9H 4BQCA 3OZ9L 3SCTA 1RPQA 3W9EA 4QX3A 4Z77A 1E40A 7A3HA 1RIHH 1C8QA 2HTKD 2F53E 3LEVH 2DWEB 4HKBA 3O3EB 5IBTL 2DIAA 3FQTB 5D72L 1ORQB 4Y1AE 1JE6A 2G9HB 4CN6A 3NN8A 4JFUA 4MTVA 4JFWA 5AY7A 1R87A 4RN5A 3PL6A 3AZSA 5FO8A 2EZ0C 4JO4L 1D5ZB 1PW3A 5SV4A 1AE6H 3QG6A 5C07E 4QNPE 4HWBH 4BH8B 3UDWA 3NFNB 4K2UL 4MNMA 5FFLA 2DD8H 3TBWA 1D5IL 1QHZA 2R9HD 1CFVH 3IKCA 3MA9L 5C0CE 3VX0A 2VZRA 2IMNA 2BVPA 3WXWL 2EJ1A 1TVBB 2Y8KA 4ZUUA 3W5MA 4L8CB 5KVEH 3RNKA 3H42L 1XSJA 1JWUA 5FKAA 3O4OB 5MEOA 1NBZB 3QDMA 1BF8A 1FYTB 3WQ6A 3EUUA 4EUPA 1FP9A 3RWHB 3VIJA 3MYJA 3WFZA 4OZIE 1F4HA 1H6YA 3GUTB 3UBXG 3DJ9A 1EEZA 3U1SH 3DHPA 1KCVH 3O4OC 3QEQD 1CXIA 1IC4H 3PGFH 5IVXE 5KVDH 1G0YR 1DBKH 4OUUA 4QCIB 4CAGA 1JD7A 1QHPA 2XZCL 3KXFD 2W67A 1KYOJ 3IDAA 4LLWB 1AY1L 3ZKND 2AEQL 5CSZB 3KYOB 3LKOA 5A40E 5I2IB 2OSLA 5C0BE 2WIIB 3V79C 2VIRB 4PFEA 4XP4L 5LGKA 3V4PL 5BXSA 4BSVA 1EHXA 1JWMB 1X5XA 4LQFH 1M7DA 2NY0B 2X70A 1EAPA 1Q9KA 3HZMA 4PD4J 4MJ6B 3QFDB 1RUPH 3BJ91 3NOIA 3VIMA 4J12A 3M17B 5GJTH 4TN9A 2HJFA 4XCFH 2E3VA 1E4NA 3LEKA 2NY0C 1V6UA 1S7SA 3RKPA 3C8KB 3PHSA 1AVAA 4UI9L 3EMZA 1FO0A 4RAVA 5GSRA 4BA8A 2EDHA 5DMGD 1XCXA 4PJDB 4DWHA 1IGCH 4JPWH 1E4IA 5DMIH 5IJKA 1A1OA 4NQCD 5IOPB 5CSYA 3MJ8A 5BJTB 2ADGB 4XPFH 2KUTA 5I9QB 4BKLA 5KSAD 3N04A 2VLJA 1HHHA 3GHEL 1I1YB 1X5LA 2B4CH 2H1PH 3GSOB 4HAFA 1U8NB 5KW9L 2CLZB 1CDJA 1EVTC 4QRRB 1P53A 5ENWA 5HHQA 3O6LL 2HN7A 5T3ZL 3TA3A 4OV5A 5I9QC 1NMCB 5BZDA 3GBML 1VDGA 3ARGD 3AHYA 2GEEA 4POUB 4WEMB 4QHNA 3TTSA 3MNWA 3WL9B 2B4CC 4NQED 4AIEA 2Y7QB 4P23B 4YC2B 1ODAA 1CBVH 3FCTB 3VWKD 1MCEA 2M8XA 3GB7B 4IRZL 4KQ3H 4MD4A 1NMCC 3DTXA 4CW1B 1GRWA 2G41A 1QLRA 1ED3A 3ECBA 3VFNB 1VJSA 3L4ZA 3P9MB 4YC2C 4P23C 1F3DJ 1L0YA 1YEDA 2EDBA 3EKCA 5SWZE 5IP4A 4LSRL 5IHZB 4YDKH 4YXHH 3MYZA 3MNVB 3I3DA 4D0QA 4JO2H 1R3IL 4N68A 1U8MB 4KXZH 5IFHH 4U1LB 3T4AB 3B4NA 1YNTA 4EOWL 4OKVB 2MFNA 1QSVA 5DUPL 1MCFA 1NOWA 3SHSA 3MRDA 2X4NA 4OGAC 2HKFL 5EORL 2XTJB 2UY7A 4R2GD 3MX0A 1ISVA 3B5TA 4I4WB 1OW0A 1KPUA 1SJHB 4MJIB 3SO5A 4QGYA 3AS0A 4KDTA 3RWJA 4NBZB 1S78D 3L3IA 2XTJC 3MLYH 3MRNB 5A16B 3WLWD 3C5SA 12E8L 5F96H 1F97A 4L29B 1A0QL 1PX8A 1FZOA 4W7VA 3HKFA 1E4MM 3EYSH 5DFTA 5J57B 3LH2L 2WW5A 3CHEA 4FA8A 5A2KH 1JHKH 2W60A 1R86A 2BVOA 2WC4A 5DQDL 1LDSA 1BZ9A 3PHOB 1IJ9A 2ZP0T 3JWDH 4I18A 4Z7VE 2VWEC 1A6WH 3IAPA 5TF0A 1CICB 2DWDB 2R4RH 3R1GL 3V6OE 1WJ3A 8FABA 3TN0D 2ZOXA 2EKJA 4DWSB 1LDPH 4GSDL 5C0FA 3JWDC 5FYKE 1H15B 1YNKL 2HT2D 2V5TA 2QQNH 1CICC 3ZKMD 1V0NA 4DWSC 2H32A 1I7RB 5HHOB 2CLRA 4U1SA 1VFAA 1GOWA 2D7NA 4PUDA 4XVTL 4QTHB 1WB0A 4AT6B 2FGWH 3RVVD 1GGYA 2I9TA 1CLOL 5KS9A 1T89C 1VA9A 3REVB 5F88A 1FH9A 2AK4E 3D39E 3HPJB 5E0QA 5CSGA 5D9SA 4L4TE 4CMMB 5A2JH 3F6LA 1IL1A 3AIBA 3EBVA 1KB5B 3ULSB 4PMNA 3IFNH 4KK8D 4C4KT 3GKZA 3KYAA 4PJXF 4J2XA 2YG0A 2QSQA 4O2FB 1B3WA 3S4SA 3HRZA 3KYNA 4PJGE 2FECL 2GT9A 1WBXB 4XH2B 3HMXH 4ZUWB 3U46B 2XWDA 3I6KB 4Q9BA 5IMLA 4CKVX 2F74B 3X13B 2X9YA 3TIDA 1EOMA 2PB1A 5TE4H 2MNUA 3O4LB 3MLTA 2IBBA 3AXLA 4L9DA 2VSDA 1PYWA 5MP6H 4JFFB 2ZX9A 3NAAH 2V6HA 2J8UE 2ZUUA 4YXKH 3O11A 4QB6A 3PV7A 1ES0B 4I77H 4RGNB 2YMXL 1U2YA 3EO1B 5C08E 3O2WH 4LVHB 3FQUA 5E8PB 3UC0L 1JFQL 3FB6A 4KFZC 4IMKA 1FNGA 4YZFE 2H2SD 2VXQH 4RGNC 1UT9A 4RMUA 2EH8H 3QRGH 1P9MC 3VDCA 3T3PE 4QXGL 1ISZA 2OZ4H 3DWTA 4LVHC 1S5HA 5ADPL 4X9GA 2V7NA 4ETQB 3SN6N 3NIDF 1W9XA 1FFRA 1ZE3C 2NTSP 3DX6A 4PBVC 1ZT7B 2DQFA 3OJDA 1DEEB 4FQJL 2DAVA 4NZTL 3G6AB 4DM2A 2V5CA 4DKEH 4OGYH 2WC3A 4ZS6D 4D9QD 4R96B 5DC9B 4NYLA 2VN7A 5TH2A 5IFJB 1PKQA 4LX4A 1D9KB 2X4RB 4MNGB 4ONGL 1ZLVK 1PZ5B 2H3NA 4JJ5B 3QI9A 3HNTH 4PLJD 1PSKL 4M7JL 4PR5B 2N7AA 4FK9A 1T83A 3A21A 4NKOB 3WJJC 1AO7B 3TEUA 4AD5A 3VIGA 1A3RH 4POZD 4KK6D 4UQAA 1B3JA 4PG2C 5E8EA 4F7CB 3DRTA 3O2DA 1HKMA 3ZDXE 4YBQC 4M5ZL 1QR1B 1W0VA 2E6QA 1OWQA 1TZ7A 1I8LA 3GKWL 1GQJA 1GVYA 1DQLH 4OIFA 1BD2A 1CF8H 3BI9X 3KYMA 5FO7B 4Q2ZB 3C9NB 1BTCA 2X40A 1YEIH 1TE1A 1WBYB 4GI6A 1T66D 1S7WB 2WCSA 2OS7A 3PWJA 3LVEA 3QUYB 5EO9B 2OYKA 1IEAB 1M05A 4J4PD 1VENA 2EIEA 2NMSA 2W3JA 1K3IA 3VH8G 1KIRA 3FT4A 1UJ3B 3FAWA 5TF1L 3CVHB 3LKNA 5I6SA 3TO4B 1GOFA 4NBXB 1JL8A 3QUYC 4LCWE 3RIFF 4QY8A 4NKDA 5AYQA 5HHPA 3FW6A 1SMDA 1FL6B 1KTKE 2IFGA 1UJ3C 1MJ8H 3LSOB 4L3AA 4Z8FH 3AMCA 1WC7A 3TO4C 3ETBF 2XIIA 1J0JA 3OZ9H 5GRJL 2EDEA 2WUBH 4IHOB 3CD4A 4TXWA 2ADFL 2DB8A 5SWQA 4W68A 5J06A 5I1JL 5IBTH 4ZPTA 1UEMA 5FB8A 2GK0A 5D72H 1ZT4A 1Z3GL 5C0JB 3CFCL 2V4VA 3DV6B 1YMMB 5DA0B 2W63A 3EOYG 5HGGS 4JO4H 3CFBB 1G9ML 1JHTB 1B90A 4ZTOL 1U58A 4K2UH 2YPLA 3CCHB 3T3ME 4P2RB 1D5IH 2MPAL 3MA9H 2FECI 1O7SA 2ZPKL 1B3XA 2CBUA 4MLIA 4U33A 3WXWH 4NHUA 3WNKA 4G8GD 2O5XL 4E5XA 3HNMA 5A2AA 4PJCF 3H42H 1OGAD 4U1MB 4JZNA 4PJ8D 4FQIL 4JFYA 2VC2L 5FK9A 4KROD 4RGOL 1V6YA 3JSSA 4HT1L 4PGDB 3WF0A 1ZGLA 1N5AA 3U7YH 3HUJA 3QO1A 1KBBA 3L3GB 4X80L 4Z7OE 4HF5L 1WDQA 1NLBL 1NMBL 5TE7L 2G4FA 2QMJA 3GNML 1JJUA 5FM4A 2C3WA 4Z7WA 1WZAA 2B31A 4JM4L 3BP4B 2JF6A 4PRPA 4E8DA 2X4TA 5HGHB 2XZCH 3AIUA 2R8SL 1AY1H 1BIIA 2CK2A 2AEQH 4LLQA 3H9YA 1F3JA 2EIDA 4JN2A 1KBGL 3SKJL 4OB5L 4NZRL 4XP4H 5DEFA 3V4PH 4KQ4L 1R3LA 1OM0A 3L4XA 3V7AG 4WSKA 3NIGF 2DM3A 2Y6KA 3AQUA 1RZJL 3GMLB 3II1A 2BVQA 3UETA 3DROB 3HLAB 3GJFB 1J8HB 2AKRA 4WI8A 3PWPD 5B38G 1ZHBB 2M2DA 1I4FB 1HXYB 2Q6WA 4DOHB 1I9IL 1O8PA 3K74B 3GXFA 5JXEA 2DCKA 1QW8A 2H2PD 4PY8J 3OKEA 4Z78A 1CIDA 4HUWA 5D2NB 5JOPE 3FHAA 3E1F1 1D5BB 1FHDA 2AXGA 2ARWA 3PJSA 2WBJD 4XMPL 4H8VA 2A0LD 2A6JB 1N26A 5EB8A 3PV6B 5D2NC 2UY4A 1I3RA 1G9EA 3GHEH 1IKFL 1P2CA 3K0WA 4LF3A 5JORB 2PO6B 5ESVA 1E0WA 1QLEL 4NUGL 4P2OA 2CBIA 5KW9H 2WMIB 1NUDA 3O6LH 1S9KC 4HZLA 4J28A 4AIZA 2P1YA 2ZXQA 4B9YA 4JZOB 5CEYA 1I8KB 2PO6C 3VDAA 3RAJL 4OCWL 5DI8A 3FFCA 2UY5A 2C5DC 3X17A 4NP4L 4OZ4B 1BVNP 4IRZH 1UWEL 4FG6C 2D23A 4OI8A 5GZNC 1VKXB 1CU4L 1DN2A 2EKSB 2IMMA 4PJXB 3V52L 3QIUA 1NJ9B 4WJXA 1WTGT 2GQHA 4JFOB 5IESL 4F9PA 5LXGL 1H3WM 1IAKA 5J8OA 1XPWA 3V5KA 3LE0A 1I3VA 2J7BA 3Q5TA 5HYSG 4MO3M 3JBG7 5E6ID 3UTSA 1FIEA 2VZ1A 4OTXL 1MCPL 4EOWH 4H1LB 1RZIA 4AK1A 2FHFA 5DUPH 2DSKA 5ABGA 3V5HB 2HKFH 2WAHA 2J6EL 5EORH 2VT0A 5LGHL 2GJZB 4PRDB 4RSVA 3VXUB 5K59F 3HZYB 2MCG1 2V5DA 4YFLF 5JOFB 3QUXB 1ZGLP 5MERB 2J8HA 3KPOA 2IPUK 4PRBA 4PTTB 1GXEA 3SKMA 12E8H 2IEPA 1Q6DA 4P2QB 1PX3A 4XBGB 5DJ6B 1A6VL 2EICA 4JRXD 3RHWF 3QUXC 4QCFA 2ATPB 3LH2H 1CGUA 4Q9CA 1YN6A 1GMMA 3VG9B 2BK8A 3NFPA 4JVWA 1YYML 1JVKA 3A6OA 5DQDH 5EZLA 3ACHA 4LVNB 3WHXA 5T3XE 4XT1C 2A9ML 4NC2B 4M4PA 3VG9C 3VIFA 3CFKB 5LA1A 4Z5RA 1CT8B 1H3XA 1Z5LA 3R1GH 1HJSA 1AKJB 4HGWB 3VA2C 4LVNC 1QSFB 2GJPA 2V5YA 3QGVA 3GNOA 1K8IB 4GSDH 3L4WA 4QT5A 1S9YA 3QPXL 4HFUL 3T4YB 5IGXL 1YNKH 3QXUA 4NFCA 3TCLA 5E24E 4YFLI 1OQXA 5J1XA 3BKCL 3SKOA 1BIHA 5CEZL 4JZ5A 5J3HD 3VFSB 2W95A 1XF5A 1T21B 4LKXA 4ODHL 4XVTH 4PRWA 4A2MA 1CLOH 5FYJU 4ZE4A 1WDPA 1A1NA 3RVXC 5JMRA 2XWJB 4XBPB 2X4PB 2OTUA 1C5CH 2E8ZA 5I1EL 3JV0A 1F11B 4RISL 3MMEB 1XEDA 1MI5A 4PYHA 2Q86B 1BGGA 4PJHF 1QTYT 4GRLB 3FFDA 4GS7B 2QBWA 4WKHA 5K9KB 3L3KB 4NDMB 4MD0A 32C2B 5JDJA 2CKBA 4GRLC 4EDXA 3DGGA 3O3AA 4GS7C 4X7DC 1G6RA 2ICEA 3L3OB 1MWAA 3BXWA 5KZ6A 4LPTA 4YUEL 1J86A 3T0ED 4W85A 1U8LB 1X5GA 5C0NC 5HYQA 4HWNA 1O59A 3VGGA 4DQOL 1MCKA 4DK6A 2DF3A 1AH1A 2DQCL 1W0YT 2YMXH 1BP3B 5IEKA 5DDHA 3QIWB 3BT2L 1JTPA 2EYRB 4GW1B 2NX5E 3UC0H 2W1NA 3AREA 1JFQH 2OL3A 2FGLA 5F97E 2OX5A 1OGTA 2VERN 4U6TA 4B41A 1HILA 3QO0B 2VR4A 1CDUA 2NW3A 3QIWC 4QXGH 1GOHA 2R69L 2BNQD 5ADPH 3BN3B 4LLMB 5JBEA 1FFPA 1C08A 1I8MA 5HI4C 3BSHA 3OEBA 2WPGA 4EK7A 4LHUG 2X41A 1LNUB 4PJCB 1QNOA 1DFBL 3I02A 4R0LA 4FQJH 4NZTH 2VAAB 1FRGL 1EFQA 1IGFL 5F3BB 4PMRA 4PRHB 3WYRA 3CZFB 3IVKA 1E72M 3PTKA 1DL7L 4G6AC 1URLA 1GOKA 4TSAL 4D2NA 4U6YB 3U4BL 3FY1A 4XC1L 4HIEA 4M7JH 2WZIA 3VO0A 1KPRA 3VXQB 3L95B 2D9QB 2VAJA 2J7CA 3C7OA 2AJXL 4RAUB 3SGDH 5C0AD 5LVEA 5EB9A 4FTVE 1JD9A 2X8RA 1IGIL 4M5ZH 1NC4D 3BAKA 4FLOA 1DDHA 2JJSA 3GKWH 3OZPA 1T1ZB 4Y4HB 3L9RA 5EUKB 2ARJQ 5FA4A 5M03A 4OUEA 1QSEE 5HVHB 2JIWA 3OGCA 4G6FD 4YPGA 4R8WL 1CIUA 4ENED 3B9KD 2R0ZL 3V4VL 4CADA 4MXQC 2Z1SA 3S6CA 3OF6D 4HFWA 5TF1H 3CX5J 5HVHC 4ZPVA 1P4LB 3OR7B 5AC4A 1LEIA 4W87A 4LSTL 4Y4KD 5IMMB 4W50A 2IQAB 3LQZB 1KF9B 3LPFA 3TBYB 4JFEE 5DRNB 4OZHF 3U2SA 3NZ8B 5GRJH 5I1AA 2C3GA 4UDTA 5FHAL 4R4BB 2BDNL 1MJ7H 3S36L 5I1JH 1U41A 1Q9WB 4U1IB 3W0WE 3BAWA 1SM3L 3LQAC 3VD4A 2NT1A 3KPLB 3DUUB 1Z3GH 1A4KA 3CFCH 5KN5A 5J1AA 2WYSA 2RCSL 3U4EA 5GXBB 1G9MH 3VXMD 1MLCA 3W28A 4KKAC 4OIBA 4ZTOH 3QOMA 2YPVL 4RDQF 2OQJB 4N0YL 2DLEA 5BV7B 2OTWB 4L1HA 1AJ7L 1WAWA 4PRIE 5DJZB 2MPAH 3ZDZE 4KVNL 3HR5B 2ZPKH 4GG8A 1HQ4B 3HE6D 4NO0A 4KZEL 1G9MC 4CD4A 2AVGA 2XG4A 3P1IA 2O5XH 5HBFA 5BV7C 3RDTD 1QLFB 1T0NB 3POHA 1BFVL 1MAJA 1XGTA 4FQIH 4KKLC 2GUOB 2O5YH 2VC2H 4JM2D 4S1DC 4KJWC 1HP5A 4RGOH 1MCWW 4HT1H 4QXUL 1KGXA 5EUOA 4H25A 2FB4H 4YO0A 2W65A 4OF0A 4QNPF 5IQ7L 3ZJ6A 1A7OL 2GCYB 3ACIA 1R3JB 4X80H 4HF5H 4RQQB 1NLBH 1FQ9C 1NMBH 3C08H 3GNMH 4ZFOA 2KD7A 2ESVE 2VN4A 3SE9L 2V2TA 2YC1A 2DSVA 3E3QE 4JM4H 5I15L 4M1CD 4L3EE 4HOWA 3S37X 1HHJA 1D7PM 2QSVA 1QRNA 3EDDA 1Q72L 1QI4A 2R8SH 3DMMD 2IBZX 1BF2A 1Y18A 5ICXB 1KBGH 1T3FA 3RM9A 1WO2A 2I07A 4OB5H 4M5YL 1NAML 2FJFA 3FB5B 2R2HB 4FTVD 4LCUB 4OZIF 1DWGM 1AHWB 3D5HA 5IBUG 1C1EL 1Z9MA 3SUVA 3BP6A 1RZJH 4TTDD 4GBXA 3DPBA 3MGOA 4OZFA 2ZUXA 2W0PA 2AK1L 3RZCD 5IVXF 1VEPA 4NZCA 2DKUA 3MV8B 1UXWA 3G9AB 3QBTB 4FN0A 4NUJA 4DEQA 1PZ2A 1FFQA 4HSQA 1G7IB 1I9IH 1RZJC 3ZR5A 3JTSA 5DJYA 2G3MA 3QUZA 1ZANL 1UD4A 4LGXA 1K5NB 3WF2A 1UD6A 5TDPA 1Z0MA 5DGRA 4HDIA 3WDPP 4XMPH 4EIZC 3U57A 4P9HL 5IDIA 5IVOA 4EI6B 5JXJA 3QHNA 3WNLA 4OZGE 5FV2A 2WHJA 2DLIA 1IKFH 3GSXA 5KSUA 2E27L 3QDME 4ZXOA 3Q5YA 4FRWA 4MLSA 4NUGH 4EUPG 1G0CA 5JLZB 1M7XA 1E27A 1MFUA 4HU0A 1A4JB 2IAMA 3N1MC 5ALBL 3I2IA 4AH2A 2ZUTA 5CSUA 3WBAA 2ZOKA 3ARUA 4NP4H 5KOMC 1B4JL 1UWEH 4NOBA 2WVVA 1CU4H 5I1DB 3IFPA 1MH5A 3KNBB 2BFGA 4ODUB 1S7RA 4XCEA 1G84A 3V52H 3TA9A 3ALGA 3BH4A 1ECEA 2J7FA 2XNAA 5J56B 3OKMA 5KSBA 5IESH 4CCDA 5LXGH 1E4JA 2CXGA 3TH4T 4NNYB 4JFPA 1UZ8B 2VXTL 1MJJB 3CC5A 1JI6A 1TQBB 5IJVB 4HKZA 4WI9A 3DUSA 1B0GA 3EJYC 4LBEA 4OTXH 3GZAA 5ITBL 4L8SB 1C93A 1TQBC 5D9OA 2K7PA 3PZGA 1JDCA 1HHGB 3QNXA 5FO9B 1ORSB 3V4UH 1IGYA 3QEUA 3DBXA 4TTGA 1G7MA 5IKCB 1XGQA 4L8SC 2EC9T 4X7TA 3P0VL 1JPTH 3R0NA 5AWNL 2GY7B 1BOGA 3ZHDA 3HZVB 4ZAKA 1T1XB 3QDGD 1A3HA 3FQXB 1A6VH 1UKTA 2ZX8A 2HAZA 3S35L 5MEND 4PMUA 1KXHA 4P3DA 1IM3B 5BWFA 4XXCC 4M6AA 1C16B 2EC9U 1KQZA 1R5WB 4N0RA 1YYMH 3ZYJA 1TG7A 3O3EA 3FQTA 2G3NA 1MCHA 2A9MH 4LSDA 2G9HA 4L4PA 3PZQA 2XZQL 4ZY9A 1MW3A 3WNNA 4F57L 4AMKL 1KN4H 4BH8A 4X4YB 4GRMB 4ZS7H 4HWBA 2Q20A 4UNIA 3QPXH 4HFUH 5IGXH 5CEXA 1MLBB 3BKCH 5D8JL 5L88L 1CCZA 3W82A 4KI5D 2DCJA 5DMJB 4XPHL 1TVBA 3A4WA 4FFWC 5E6YA 3B3IA 3T2NH 4ODHH 3NFSL 4MNQA 2CKNA 4N8PA 3DETD 2J12B 4LARH 4Z7VF 4ZXBA 1G0XA 4OCXL 5JXIA 3PBGA 3MFGB 5E9DE 4QDRA 5DJ0A 5C9JB 4M03A 1UR0A 5HPMA 2EC8A 5I1EH 3B5GA 1UR1A 2E31A 4U1HB 2J77A 2CDFA 2VVSA 3QJHB 2GJJA 2ZUYA 2V5RA 5KVFL 1EA9C 4LLWA 5FEBA 3KJ4B 2LQRA 3KYOA 5FDYA 4UQEA 3UP1A 1MQKL 5E6ZA 3QQ4A 1V0LA 1IV8A 1CZ8H 1M71B 2MHAB 1E1FA 1ODUA 5DEZA 3JUZA 2BNRE 4OZHB 4YUEH 3QFDA 4WW2F 1OTTC 2UYLB 3ULVD 4IOFD 4NZJA 2W38A 4Y4FB 3MCG1 4RMRA 1TCRB 4DQOH 3KS0H 1GHFL 2DQCH 4OD1L 4GWJA 4LCIL 2PYED 1Y6NR 4PJGF 4Y4FC 4ZO9A 3BT2H 4HPOL 2PXYA 5HSFA 3H9SB 4C4KO 4OGXL 3NCOA 1J5OL 3WCYA 4WUKL 43CAB 1I85A 2BXYA 4P99A 5EU6A 3EZ8A 5IOPA 4LPXA 5BJTA 5DK0B 2R69H 5T1KD 1KQYA 3C6SB 2XA8L 1BVLA 1NQBA 2B7DT 5KS9E 3C5ZB 4HG4K 2PUQT 1U8NA 3MOBL 2CLZA 2J8UF 2Z91B 3LRHA 4QRRA 3VOCA 2F53B 4GXUN 5KSAC 1LE5A 3AIWA 3HJRA 1ISXA 4Y1AB 4P7OA 1GGCH 3TFKD 5EBAA 1JI1A 4UQ2B 4PF1A 5ECUA 3C5ZC 2Y06L 2A6KB 1HEZB 1ESWA 4P23A 3AOFA 5GGSY 3FTGB 4R27A 5C07B 1EBAA 3FCTA 4YZFF 1DL7H 1SY6L 5FDWB 4YX2L 3U4BH 3S4SG 3T3PF 4XC1H 4GAYB 2VRAA 3KWXA 3P9MA 5C0CB 4NBYB 5D7JD 2XM1A 5TFSL 1MQQA 2AJXH 3TT1L 3LN5B 1OAUL 5HHNB 1AFVL 3HTLX 1CFBA 2H26A 4HUVB 2YLLA 3CUIA 1IGIH 1U8MA 2F15A 4EANA 1TITA 2YKLL 3IRPX 1VFBA 1VERA 4OKVA 4OZIB 4ZXEA 1ZGLM 1TZHB 1OOAA 1KT2A 3BRGC 4F7PB 3LKRA 2QV4A 4HIJA 4HIHA 4P0DA 1SJHA 4R8WH 3VGEA 5IVXB 3WD2A 2R0ZH 3V4VH 1Q9OB 4ORZC 1KPVB 1KUMA 2FJGA 4LQ1A 4WHDA 3FQNB 4BQ9A 1KENL 4R4FH 5GZOC 1EX0A 4DAGL 5FUCE 3BWUC 3SOBL 5KOVC 5DO2C 3BPLB 3ZDXF 2M1KA 2C4XA 4LSTH 5C0BB 3ALFA 4EKXA 4XI5D 3NPZB 1H5BA 4UI2A 1ULPA 1P69B 3IANA 1GGUA 1NBYB 4GO9A 4O9HH 1XGUA 1BWWA 1MCOH 3VIHA 2BNRD 2BDNH 2OJEB 3I6LD 2BSTA 4PV9B 3S36H 3CGTA 3QDAA 3R8BB 2EPNA 1JZ8A 1SM3H 3T09A 4QLKA 2DWDA 2BBAA 1PKQE 1M4KA 5ICZA 3S97C 5DFVC 4Y2OA 4NCDA 1SFSA 3DRQA 4U05A 2RCSH 3F5LA 3ZZ1A 1H15A 4Y2DB 2HT3C 1MIEL 2YPVH 4JFQB 4N0YH 2QQNA 2WLYA 1AJ7H 4MNJA 5DJ8A 3TVMB 3C8XA 4LPCA 4UTBL 4LPLA 5DQ0A 3DX9B 4KVNH 4L9LB 3KG5A 4YFEA 1XGYL 4KZEH 4Y2DC 4UINL 1P4IL 3V6FB 4PGEA 5K9JL 2JD9A 2P4AB 2F19L 4YK4B 1BFVH 1LO3L 1CG9A 2ADIB 4PJEA 4N5EC 3TVMC 2VOTA 4OFIA 3REVA 1BD2E 4L9LC 2D31A 4ZDHB 3H0TB 4QXUH 4AL8L 1B2YA 3NQHA 2EDQA 1S9VB 3ACFA 1JGLL 3ILQD 4J3UA 2NY7H 4YK4C 5IQ7H 4P5MA 1A7OH 4D8PB 1OD0A 3HC3H 2A83B 3VRJA 1J9YA 1V6XA 2W87A 2J25A 5LBSL 1OD8A 3N50A 3T3MF 4HQQL 3SE9H 2OXGA 2WXDM 3WFLA 5I15H 4A3YA 4J23A 4G6ML 2ZEWA 4G9FE 3KPRD 1E73M 2O61B 1Q72H 3PZVA 4Z2AA 1F4XH 4OMDA 2WM0A 1HXMA 3HMXA 5SWZB 5CUSL 3AZRA 3WIFB 1YEHL 2E6PA 1CWYA 1J11A 4M5YH 4KTEL 4OCNC 1NAMH 2V9RA 4XWGL 3GJEB 2CDEB 4UZGA 1NAMB 4OV6F 1Q9LB 3I75B 1C1EH 4Z7OF 4WO4D 4JFFA 4TYUA 1PEZA 1JCKA 1UB5B 2PW2B 2AK1H 1CXKA 1IAOA 1ES0A 3AISA 5JZ7D 5CJ8A 2R1XB 4PTXA 2W9EL 1EDGA 5CGYC 1VBRA 4X9IA 4OLVH 3D0LB 5I77A 1JXJA 3KPSA 1AGBB 3F5WB 3WUFA 3OKOB 1N6UA 3V0WL 4NQUA 5FV1L 4V2BA 2BC4B 2XVGA 5EFIB 4G9DB 5ETUB 3SY0B 3RGVD 4PLKD 3BGMB 2OZ4A 3VFWB 3H7BB 4P9HH 3RI5K 2VI0A 2AJ3A 2ZSWB 4WHYH 5GRVK 4XPTL 2E27H 3X11B 2W46A 5DHYA 1BX2B 3Q2CA 1U2CA 4U0RB 3G6AA 1DVFD 2VMFA 4Z7VB 2Z35B 2GAZB 2Q7NA 5B8CA 3RDKA 3HUJE 1VGEL 2W0FB 4P9HC 4PGBB 1CPUA 2IANA 5ALBH 4WHTB 4PN2A 2J2ZA 4POYA 2BSED 4R96A 4YXLL 3VKKA 4HMDA 4CNIB 4Z7WE 2ZG1A 4PRPE 4U0RC 3MV7D 5DS8B 5DZLA 2XSAA 4JJ5A 3BN9D 4PG2A 1TZGL 1B4JH 4GKZB 1H3UA 5MHSE 2OWCA 3V6OC 1Y7VA 1E6ZA 4AZGA 1ZVHA 2WBKA 1S46A 4X5XB 3BKYL 1S9XB 1XGPB 5FECB 3DSFL 2EDWA 1HOCB 2XG5A 5DRWB 4Q7DA 1ZWIA 4F7CA 3ZQ9A 4ONOA 4MZ3A 3O9WD 4M1DL 2O92A 3UX9B 4C59B 2DQUL 2VXTH 5GGQL 1MQRA 1XH2A 5A2CA 3MRQA 2YD1A 1BGXL 3IXAB 1UH3A 5EMYA 2AK4B 3D39B 5D8WA 5FO7A 4Q2ZA 4L4TB 4LLDB 5ITBH 4WW2B 2ADJA 5EC2B 4P4KB 1S7WA 5HDLA 2YBUA 4FABL 4XUPA 1TNMA 3RVWD 2D03L 1FNFA 1FG2B 2X7LB 1KGCE 3ARFB 4A6OA 2EEDA 4AZBA 2EYTA 5D6DC 3BKJL 3E6HB 4RMQA 4WW2C 4P4KC 3A23A 2EO7A 3P0VH 4PJGB 4Q7NA 2V9QA 5JMOC 5EPMB 2AJZA 1YNLL 3HG1D 5AWNH 5E70A 3ARFC 4UFKA 4HAGA 3RMEA 2QR0A 2R23B 1AQMA 3LOWA 4R4NC 2YPKB 1RZKL 3LSOA 5MI0B 3S35H 1IQDB 3LD8C 3WIJA 1JZ7A 4QOKA 2HYXA 3IU4H 1G7JB 1G9NC 3W2DL 4KJPD 3GMQA 3IB3A 2VISA 4YHKH 3WUEA 2ID5A 2J8UB 3Q6FB 4YGVB 1QHOA 1IQDC 2EE2A 5BXFB 1UXSB 1ZHLB 4PJ9D 4GZIA 3FFCE 1CZVA 1FVCA 1YMMA 1U8QA 4F57H 5C08B 4W84A 4N9OB 4AMKH 1JHTA 1UYZA 1EFXB 3A4AA 1OP3H 4D6IA 1XF4B 2HFFB 1QO3A 2A74B 4NQXA 3VFTB 4Z2HA 2CR6A 3IETA 2VLKA 3AB0B 4E0RB 4RBPH 4HD9A 4XNMA 5D7SH 2CRIA 3L5HA 5D8JH 5IK3B 5F71A 5L88H 1J18A 4U2YA 1WNOA 3U0TB 3MRRB 2GSIA 3UPAA 5JHLL 3ARWA 3SCVA 1RIVL 4U1MA 3AB0C 3UTSE 3V5DA 1LEGB 5I73B 2IJ0C 4GG6E 3CUJA 3MROA 4OCXH 3B83A 5C0EB 4PJ5E 4Z0XB 3VXRD 3TC9A 4OKDA 2CRZA 4P5KB 3QXAB 4KROC 1D6EB 4GO8A 1RZ8B 3RWGA 4CD5A 5I73C 3BP4A 4TUKL 4M8UA 4ONFH 5HGDB 1JNLL 1M04A 5KVFH 3ARBB 3PP3K 1OAQL 4XRCB 4HX1A 5D1ZA 5MHSD 2VLRA 4XB3A 5ALCH 5ACLA 3AAZB 1MQKH 2VDQL 3MJ7B 5D1XD 3RX5A 4APQB 4YEEA 1RP8A 2VKWA 5KANI 1UH2A 1SJXA 1Z9SA 3M6DA 3PWVB 2CETA 2JK5B 3AXHA 1JV5A 1A6ZB 2VRQA 4PRNA 5E94A 1U8PB 3M7SA 4JFDD 4APQC 3OB0H 4MAYD 1UR9A 5C7GA 1J8HA 1LQSR 5DJXB 1HXYA 3QA3B 3W5NA 1R24A 4OD1H 5F7WC 4LCIH 3OLGA 4HPOH 1AGDA 1F3DH 2VDLL 2O26U 4J3XA 5D2NA 5B4MD 4PMYA 4OGXH 4LCWB 2BHZA 1D5BA 1FNSL 1J5OH 5LG1A 5CGMA 1UR2A 4WUKH 3I2KA 5D9NA 4MA3A 1WUNT 3VUPA 1E4KA 2XA8H 1H8NA 1RHHA 2GTZB 2Y2WA 4BFEA 2PO6A 3MOBH 3UCQA 5A6BA 5DSCB 5CP3H 3QXDB 5IHBA 1QFWM 1PMHX 3M1BA 4N8VA 4JZOA 1I8KA 2X4QB 4NT6B 4ZSOE 4HV8A 2Y06H 4MDJA 3KYKL 3IDXL 4OZ4A 1I7ZB 1SY6H 4F7EB 1VKXA 1EZVX 4YX2H 2BV9A 1I7TA 2EKSA 2JIEA 1NJ9A 4M9PA 1CK0L 3CZ8A 4V1DE 4S2SB 1BYAA 2RQ8A 2F5AL 4CBPA 2PWDA 3W37A 1ZJBA 3FOLB 3IFLL 5GSVB 1OAUH 1AFVH 1CQYA 4F37K 5A1AA 3Q48A 1FNHA 4NQDE 3SE4A 4FQPA 4LKCB 1CGWA 3LN9A 4AZ6A 2P5WA 4Q6IA 1TVHA 1REIA 1LE9A 4PJ5D 5E1AB 3QDJA 2VDPL 1A6UL 4Y0GA 3GSNL 2CYGA 2FH6A 4M8QA 1V05A 4X6BA 3O2LA 2CBJA 2ITDB 5JOFA 1R7AA 1HQRA 4D9RD 5MERA 4XTRD 1T1WA 1U8OB 4WCYL 5FIEA 4DAGH 3SOBH 4EN3A 2JF7A 1W72L 4YHNB 2AP2A 1ZLSL 1ITBB 4CVXB 4TSCL 1X5AA 2CKRA 1XF2A 1NBQA 1P6FA 1FE8L 4QRPE 3QB7C 4YHIA 3CIHA 3MKKA 5B38B 5ERWB 4XVUC 5D93B 1CT8A 5INCB 1AKJA 1UYWL 1FZJB 1JPFA 2WP3T 3O8XA 5ADOL 1WIOA 3TM6A 1EDTA 4C56D 3EYUL 3EYOB 1MIEH 5D93C 4W5UA 2ZUVA 3D85D 3ARZA 4HXAL 4D1JA 2BSRA 6TAAA 4UTBH 2Q7YB 3WD1A 4AYSA 3VFSA 1TTUA 4FQXB 1JZ6A 1XGYH 1T21A 4UINH 4TX8A 1P4IH 2V7HB 3O6FD 3MLWL 4UTFA 2OYPA 2BS9A 5I0DA 1MW1A 2F19H 4Y19D 1W3KA 1LO3H 3TZVB 3O0RL 1W2PA 4MQTB 2XWJA 1OT2A 1N7ML 1NANH 2FBJL 4N0FA 5KBNC 1R64A 2H8PB 2X4PA 1T04A 3DIFB 4FQXC 4AL8H 4XVJL 4HH9A 5DMYA 2Z8SA 2DM7A 3VIOA 3SCOA 1QD0A 1JGLH 3OKLA 3RCNA 3TZVC 2DH3A 1FLRL 3EYVB 5LBSH 4S3KA 4MPKA 4HQQH 4GRLA 4WJ5B 4Y8DC 1K45A 3ZDZF 4XHQA 3GH4A 3VD3A 4NNXA 4NKMA 4G6MH 4TNVF 1JGDA 1XF1A 4LP4A 3WS6C 3BPCA 4ZOCA 4NDMA 32C2A 3HZKA 1TZIA 1UB6A 1YUHA 5CUSH 3BHBB 5D9MA 2EECA 2OSXA 4Y16D 1H49A 2YD4A 3I2HA 5HYSB 4KTEH 4P46B 1H09A 1V03A 1NC2B 3HE7D 4XWGH 3GSQA 3RWEB 3MCKA 3HB3C 4HS8L 2HLAA 3OAZK 4A42A 3IJSA 5ANMA 2JLLA 2WWMD 3OAYH 1HIZA 3VXSA 1UR4A 4P46C 3UYRH 5C6PB 1UWTA 1D5XA 2W9EH 2I9LB 4R7NB 3QIWA 4GW1A 4WFED 4LHQB 1BVZA 5EBGA 4X6FB 5KSVB 2BSSA 3GMMB 3Q5OA 3V0WH 4YBHA 1CDHA 1EEYA 3SEEA 5E2JA 5M94B 1LO5B 2HG5B 1I7UB 3BDXA 4KPHL 1IGTB 1W9BM 4XPTH 2FIKB 1MFDL 3SKNB 5EUOE 2VE6B 4L0PA 4WUUA 3D3VE 1LEKB 3PUCA 2L4OA 2VAAA 4JRYD 5F3BA 1VGEH 1YN7A 3LMJL 4YHOL 1PBYA 4YXLH 3CZFA 1OLLA 4M82A 3PZUA 2AS5M 3EYFA 1C5DB 4GI9A 2GY5A 2NR6D 3SKUD 5CMAA 1EQCA 1TZGH 2MMXA 3L95A 3AS2A 3SDXA 3BKYH 3QG7L 4OZGF 1G7QA 3DSFH 2ZXAA 3C60B 3SQBA 4IDLA 4EXPX 1UMIA 4UOQA 3LY6A 4ZD3L 1DWAM 3UG3A 1U93B 2RGLA 2FNBA 2JJUA 4M1DH 4YWGL 4AD0A 2DQUH 3HC4L 7FABH 5GGQH 4P08A 2K1MA 3P4OB 1EUUA 1BGXH 3EOBB 3QDHA 3UTZA 4OZFG 3DYPA 4K23L 1NEZB 3PIQB 4FI9A 1MPAL 1S7TA 4XHJD 3OGOE 2D03H 4HC1L 3AZTA 3MQIA 2ATKA 5JR2A 3BKJH 1J84A 5TQ2L 1E6JH 3KLHD 5IMMA 1YC8A 2V3EA 3CZUA 3LQZA 2JIXA 3WN5B 3TBYA 3P11L 1RZKH 3A4XA 3LB6C 4WWKB 4HWZB 2PWEA 3S5LA 3CSYB 3RWCB 3GBDA 3W2DH 1CGXA 4R4BA 4NHCL 4NRYB 3WN5C 4U1IA 4WWKC 1RZKC 3GM0A 3ULUD 4UIMB 4NN6B 4BQ8A 4JGUA 2XPKA 1S7VA 5JBFA 1N3NA 1HSBB 2NX5B 2OQJA 3RTQD 5TDNA 2OTWA 2ARJB 4NN6C 2GK1B 4OBSA 5I1GL 3IDIB 5IFTA 5CJOL 2IBZY 1B31A 2X1QA 4IRSA 3WD3A 3HC0A 2WHKA 2XQYK 4X8JB 4HLJA 1BVKB 5JHLH 1JGEA 2ESCA 1AMYA 1T0NA 1A1MA 2CERA 1RIVH 3HE6C 4FFVC 4LHUB 3ZL4H 4HHAA 3AJ7A 4OD2B 3WKML 1UWUA 3RDTC 4GAJL 2MCPL 2VQ1B 1PIFA 2UZIL 2NCMA 2WWDA 2GCYA 2AQ2A 2XT1B 3L3JA 1K8DA 1R8LA 1E6RA 3PABB 1FSKC 4I5BB 3VIKA 5CXPA 2GI7A 3T0DA 1NFKA 3MANA 4TUKH 1FVDB 2EXOA 2AXJA 3BPNB 3NCBB 3LPPA 3VFGL 1OAQH 3MOQA 1KTLB 4GW5A 5I1LB 4PMZA 4M1CC 4K71B 5GJSH 1OP9A 1E28A 2VDQH 3UTQB 3EGSB 4OLYL 1N59A 1MIMH 4FTVB 3PHQA 4L4VA 4I0CC 1DCLA 1PLGH 1T2QL 3BPNC 2CGRL 3FB5A 4QLJA 4LCUA 2WSPA 4HGMA 4GQPH 3WO4B 4LLUB 4K71C 1OTSD 3TPUA 4E8CA 4WV1B 1QSEB 5AG8A 3JV6B 3O3DB 1CE1H 3ROOB 2D4FA 5C6TH 3EFFA 3WO4C 4AENB 1NWUA 1G7IA 5CGTA 3RZWA 5DZNA 4JVPA 5E0CA 4WV1C 5F93C 3L4VA 2VDLH 1HX0A 2F54A 3BQUB 8CGTA 3VWJB 1FNSH 5EU7E 5DVLA 2IF7A 4PMXA 3D0VA 1U8JB 4JFEB 4MNQE 3BQUC 2P46B 1DE4A 3VWJC 4XBEL 5HYJA 5JLZA 3NCYS 2Z31D 3WO3B 3WQ4A 1T2JA 3W0WB 1A4JA 1PDKA 3RY4A 2FO1A 4Z7NE 1XFPA 3RPKA 1BFOB 1F6AB 4P7LA 1YEEL 1L6ZA 3QFJA 4JZJA 1JRHI 3KYKH 3O45B 3IDXH 1A6AB 4RZCB 2NXYB 5I1DA 3KNBA 3FO2B 3STZA 4PJHA 4PRIB 2EXWD 3UPRB 4JHWL 2GJ6D 2B39A 1CBGA 3PE9A 1CK0H 3QNZB 4AMCA 5KS9F 1LK3L 2F5AH 1XZ0A 2OP4L 3DNKA 3W39B 3WJLC 3IFLH 4TVPD 2NXYC 1MJJA 3TLRA 1PG7L 1TTFA 3ARXA 4KKCD 4HZAA 1FJ1B 2Z93A 2VH5L 4FXGB 4OF6A 5B4NA 5GNZA 3WFEL 5FAAA 5L2KA 4Z2GA 3HAEH 3WFDL 1WT5C 2VDPH 1A6UH 5HDBE 4P57B 1HHGA 3F7PC 3GSNB 2J6EA 2ESVB 2XXMB 1LJYA 2XTLA 2XGBA 4L3EB 4UDUA 4XXCA 3RY6C 4GLRH 4JB9L 5EU6E 3RX7A 4M80A 1W72H 3E3QC 2HVJB 1ZLSH 3CX2A 1S3KL 4Z77B 4TSCH 2QPSA 1P84K 2N7BA 5IBUB 1C16A 1R5WA 4HKBB 4AXNA 1I3GL 3EBAA 3VGAB 1YEJH 1FE8H 4JJHA 2WC7A 1WPCA 4NGHL 3FQWB 5I8CA 5BW7C 1OP5K 1QFHA 2ORXA 3QG6B 1UYWH 4DZ8A 4LGPB 3VGAC 3GIVA 3BCDA 4KAQL 5ADOH 2L7UA 3DVNB 2OM5A 2YXFA 3LIZL 4LGRB 4X4ME 1HYSC 2X42A 3IU3A 2M26A 3TBWB 3EYUH 3IKCB 2XSBA 2G3JA 3SDCB 1YECH 3BESR 4DKAA 4HXAH 2YRZA 5AG9A 4A45A 5F7MC 4HH8A 1L9MA 3RNKB 4OZGB 1JWUB 5FKAB 5MEOB 3QDMB 3MLWH 4YHML 3SDCC 2DYPD 2A3AA 1WSST 2J1SA 4EUPB 2X1XR 4GRWH 3O0RH 3MYJB 4BUHA 5BCAA 1N7MH 2FBJH 1XD1A 1EEZB 5C9JA 1UKSA 4LSUL 2PWHA 4EI5D 4XVJH 1AR2A 3RKDC 1DLCA 4U1JA 5CILL 2W92A 4U1GC 4OUUB 3KXFA 1FLRH 1MF2L 3WD0A 3QJHA 1YA5A 1BQLL 5E2VL 3U9UA 3QWQB 2OYMA 1PJ9A 5HYEA 2YDRA 2YWZA 3MGTB 4ZG1A 4X0NA 3UR7A 3T0WA 3LKOB 5M95B 1MVUB 1HKLL 4ERSL 2OSLB 1ZS2A 3PP4L 1BJ1J 1J0KA 4BSVB 1NAKL 4W93A 2X70B 1EAPB 3FL7A 5C9KA 3HZMB 3VFMB 1ZLUK 5F7KC 4YBLB 4OZHA 1FGNH 4F9LA 1O0VA 2UYLA 4QCEA 1WEJL 2HJFB 3DX7A 1FC1A 1LD9B 1J87A 1S7SB 2NT0A 5HDRA 3M45A 25C8L 1UG6A 3G08A 4JHAL 4YBLC 1DN0B 4P4RA 4EDWL 2I27N 2R2EB 3BZEA 1AP2A 2F2HA 2Y24A 1UR8A 1FO0B 5F89A 1ZLWH 4RAVB 5GSRB 1K9FA 2NW0A 3HI5H 1D6VL 1TA3A 1X4XA 3BH9A 5L7XL 4NQCA 1IAMA 3WDHA 3GM8A 3PWUB 1A1OB 1WE5A 4UOZA 3MJ8B 5GGUB 5KSAA 4BKLB 1HHHB 4CUBA 3DHUA 4KPHH 3NACL 4PJEE 5IJKC 5ENWB 5HHQB 2HN7B 1T5XA 3W4RA 3TA3B 4OV5B 4NO5A 5BZDB 1MFDH 2Z8VC 3QJFB 4Z0BL 4C58B 4Y1AA 3ZOAA 1CXLA 1UD5A 4NQEA 1NCCL 5FYKU 3LMJH 5ESQB 2A6KA 4YHOH 1HEZA 5KZCD 5F7LB 2MQCA 5CD5C 3TA3C 2AW2A 3DTXB 2B20A 1IMHC 5FDWA 2PF0A 1QLRB 1ED3B 3ECBB 3O6KL 4U3XA 4LP5A 3B2UD 1GU3A 2CIKB 2MQ0A 4WEBL 3ES6B 1RZ7L 1INDH 1F4YL 4HG4J 1JF5A 1WV7T 2H6PA 4E41D 3QG7H 3PGCA 3WENA 1E4XL 4ZD3H 3WEZA 3WNMA 4OFYD 5SX5H 1S7UA 4ZO8A 2O9RA 5B3JE 4YWGH 4HUVA 2VVNA 4LEOA 3UMTA 4DXTA 4V2XA 3HC4H 2LU4A 4N8CL 1IT9L 5ABEA 1YNTB 1GSMA 3HUJF 1JG9A 1DQQA 4OZIA 5E9DB 1XR9A 5F9JA 4DM1A 2DL2A 5C2UB 3MRDB 2X4NB 3OWEA 5JXAL 2D0FA 4Z7WF 1GQIA 3IJ8A 1TZHA 4K23H 2FEDD 2C1OB 1WBZA 4F7PA 1MPAH 5EFDA 1KPUB 5FA3A 1KXQE 4PRAA 4XPGL 4KRPD 1GCYA 3I9GL 3RWJB 2F8QA 3KPSE 1JNDA 3L3IB 4ZNCD 3PTMA 3C5SB 1J1OL 3BD3A 5J6GA 5TQ2H 1I1FA 3D1MC 1YY9D 3ARDB 3IXTA 3MJ9H 1E15A 4KDTC 1MCBA 3PL6D 3P11H 5F72S 2W60B 5A2IH 1NBYA 2BVOB 1QR4A 4XWOD 2X1IA 3ARDC 3D3AA 1DUYA 1BZ9B 2ZCLL 5A8NA 2FL5A 1EAJA 5ID0A 2P24A 4LASL 3SJVD 4YR6B 2IANE 3TN0A 4ZQKA 2CLVA 2YUWA 3S98A 4BZYA 1BG4A 2E7BA 1G01A 3VG0L 3QWRD 1ZV5A 5IB2A 4M61A 4Y5YA 2EXYD 1QVOA 1LO2H 1U3JA 2AAVA 3GNRA 5F70A 1PKOA 1KG0A 3PDOB 2H32B 3EYPA 1B30A 3GFUA 2CLRB 5I1GH 3A22A 3BD5A 4U1SB 5CJOH 1VFAB 3SGEI 3ZE2E 5CD3A 2R7EB 3JWOC 2I9TB 5KS9B 1IARB 3H7LA 4I13B 4HUMB 4FP8L 2ADIA 3P4NB 1FOBA 1S9VA 4D0BA 3QHOA 3MBED 3SO3C 2XUCA 2MCPH 4X9YA 1IL1B 4DEPB 2UZIH 3GI8L 2W94A 2A77H 3SUWA 1GL4B 2VDOL 4OF3A 1KCRL 5DTFA 1V6WA 3OJ2C 1PY9A 3W11C 4HJGB 3S4SB 1BBDL 1BREA 4R6UA 4DEPC 3KYNB 2AJUL 1MRDH 4A41A 1CI5A 4YNYA 1UWIA 1GPFA 5SWZA 5IMLB 1KULA 5IHLB 1OD9A 4WI4A 2WWKO 2BHYA 4GG6F 1JZ4A 4OLYH 4RFNC 2WMGA 3TIDB 2ICWA 5FCZA 1T2QH 3MLTB 3GJEA 4QOKE 1NAMA 3GJFK 1Q9LA 1PYWB 3INUL 4CCEA 4OBRA 5FYLD 1D2KA 1UB5A 35C8L 3G6JE 4PGCA 3PWLA 2R1XA 5FM8A 2CPCA 4C83A 2HKHL 2V5MA 3VFOA 3FQUB 5HD8D 5GS0L 3D0LA 2VLJD 3FB6B 3C87A 3MRGA 1R5IA 4GFTB 3GBLA 2VLKE 2PBGA 5CAYB 1ZEAL 3MXVL 4LSVL 4KKBC 1EUTA 3ALXA 1S5HB 3SY0A 3GMOA 2V7NB 3H7BA 4FZEL 2BJML 3RVTD 4D0CA 2VSCA 5F9AC 2X4UA 4L8DA 2BY0A 3LV3B 5FUCC 5F7YC 3DX6B 5H2BA 1B0RA 2DQFB 4XBEH 2QMKA 3OJDB 3AYSA 3EMCA 3K8MA 1OWWA 1MSPA 3VM5A 2W0FA 4PGBA 2ZX6A 4ZYKA 3V6OA 1PKQB 5I5RA 4U1NA 4XZWA 1OARL 1RIUL 1YEEH 5HDOA 1YEGL 2E33A 3QI9B 4HW6A 4DXSA 2OI9B 2NY5C 4Y7MA 4U7SA 5F7UA 2EDNA 3F7VA 1UEYA 1QA9A 2DM2A 1NCDL 2VLRE 2GUYA 4NSBA 5JDSA 3P3YA 4X5XA 2QQJA 4JHWH 2V3DA 4WKFA 4M62L 3HS0A 3QI9C 3Q6GL 2APFA 1LK3H 2NNAA 2OP4H 3DRTB 3SEPA 5F1SA 4PV8B 1WQVT 3DV4A 1W0VB 1NWSA 5A6JA 4PYGA 1PG7H 1GONA 5D7IA 3T2QA 2DJUA 3IXAA 1BD2B 1KSRA 3O9WC 2VDRL 2AK4A 3D39A 2VH5H 4LLDA 5D6DA 3MLRL 4WW2A 2VMCA 4P4KA 1I8LC 2ZSVA 3PWJB 3GSVA 3WFDH 4J4PA 1K9DA 5JMOA 1A6PA 1M05B 2NY4D 3TBVB 1KXTA 2XV6B 3ARFA 1PZ3A 1KIRB 3DHMA 5IB3A 5MEQB 5D4YA 5KAQF 2MTPA 2WN2A 5CINL 2HT4C 5ID1A 2XZZA 3LKQB 1UY1A 1XGZA 4G9FB 4PJGA 4NKDB 5EPMA 1LG1A 2C9KA 3MRCA 4JB9H 4NCC2 4Z2IA 5JA8B 1V08A 2XN9D 1WC7B 2QTEA 5DJCA 1FNAA 1S3KH 1TIUA 1TLKA 3LRGA 1CECA 4UT9L 4BELD 5J0BA 5B4XA 1I3GH 4ZPTB 5FB8B 3RU8L 4FQLL 1ZT4B 2J8UA 2OR8A 3Q6FA 4XZUA 4QTIL 4NGHH 4N8VG 3QUML 2DI9A 3T0BA 3TH2T 3MPCA 5C08A 1ZL1A 2VX5A 1U58B 2D3VA 4KAQH 3F5KA 1XIWD 1KFAL 3LIZH 4GKLA 2AV1A 3IDMA 4F7TA 4KMLB 2VRKA 4OIIL 3L3DB 3O2VL 4L3CB 4E0RA 1UQZA 4G8GA 2APTA 3BGFB 4X0VA 5IK3A 5DUBB 1W9DM 3U0TA 4E5XB 4J6RL 1OGAA 1HHKA 4XCCL 4PJ8A 4OYUA 3O6AA 3AYRA 5I2UA 4JZNB 3EZJB 2GJXA 4JFYB 5G04L 3SUTA 5FK9B 1ULVA 4YHMH 3BGFC 1UADC 1P7QD 1PMJX 2P5WE 4PS4L 3I2CL 3MZGB 3MRPA 4Z0XA 1ZGLB 1N5AB 3QDJE 3HUJB 3T1WA 4P5KA 4LSUH 5I78A 3ZO0A 5J12B 5CILH 3PQYD 4JHBA 3N17A 4Z7WB 3HJEA 5CS7A 4PRPB 2X4TB 3Q1SL 4AG4L 5TPWL 5I79A 1MF2H 5HGDA 3BCFA 1BQLH 2VZ3A 3T0AA 3IDYB 5E2VH 2WBGA 4UZSA 3BVNA 4OQ1A 4LLQB 3RIFK 1F3JB 1UWSA 2XVPA 3M8OL 1CD8A 3PP4H 1SYSA 1H41A 3BJLA 1NBVL 1R3LB 3IDYC 1V02A 3PWVA 2X9XA 4BDVB 2JK5A 1U8PA 1W0WA 2BVQB 5EU3B 3ZHKA 4JFHE 1BLIA 3PWPA 1JNNL 1YDPB 2QPUA 1WEJH 1V0KA 3DO3A 1I9RL 1IVLA 2Q6WB 1DP0A 4JHAH 4C7GA 1W9WA 3E0GA 4EDWH 3OKEB 3ARSA 4J3WA 4Z78B 2WWCA 3IS0X 1U3ZA 5B3NA 1H2JA 4N90E 1V3LA 1EZVY 4HIXL 3P73A 2Q76A 3KZSA 2WBJA 1D6VH 2AXGB 3PJSB 2UVFA 5L7XH 2VZSA 5T1DL 1J7VR 4WSJA 4I3GA 4X6EB 3MMDA 3HNSL 2IPKA 4IRJD 1I3RB 4KDVA 2EDDA 1GH7A 4LF3B 3THMH 5ESVB 1B88A 3NACH 2AABL 2HTLC 4P2OB 4X7FC 1IZKA 1UJTA 5DSCA 1RAMA 2YOCA 5CBAA 5CP3A 2LW8A 2XYLA 4Z0BH 2NY6D 5CEYB 3GHBL 1NCCH 2X4QA 3FFCB 4P2OC 1E4WL 1Y6MR 3THCA 1GORA 1JPSL 5ITFA 4YAQB 1G0DA 1V3KA 4F7EA 1YZZA 3O6KH 1IT0A 1SY6A 2DH2A 4UFLA 4KTDL 4FXKB 3PZNA 1NWTA 4W6XB 1RZ7H 4KC3B 4TVPL 1F4YH 4S2SA 1IAKB 4XCNA 4YEFA 3FOLA 3V5KB 5GSVA 1E4XH 1UG9A 5E6IA 2G5BA 5EUOF 3UTSB 2F5BL 1Q1JL 4GAGL 4GG6B 1SEBB 1IT9H 4N8CH 4Q9RL 1GYAA 4I0PD 4JY5L 4LYRA 4UMGA 2XY2A 3WIIL 4MADA 1RZIB 2E9JA 5ANME 1RUQL 3VXSE 2HLFC 1T0MB 3I97A 5JW4R 3JXAA 4XP1L 4BFIA 4P7QA 3MA7A 1GGBL 4XPGH 1A7RL 3I9GH 1JF1A 1G9HA 1FH5L 4F80A 4PRBB 1J1OH 4JDVA 3SKMB 5CYYA 4JRXA 3VTRA 4WFFE 4JL1A 4HU8A 1V3HA 2BNJA 2W1UA 3ZKQD 3NJXA 1HKFA 4YIQA 4CVXA 5I0ZA 1YN6B 2WHMA 1KB9K 2X2YA 5FF6A 1QVBA 1RIHL 4JG1H 3CK0L 1SBSL 4OFKA 4B3LA 1S8DA 3WHXB 2ZCLH 5GS2D 4K9EL 1CD1B 4OCSL 2YPLD 4LASH 4AEFA 4JFHD 5ERWA 2J8GA 2WABA 3WE6A 4PUEA 3AFLA 4CDHA 4ZFFA 1FZJA 1ZAGA 2E0PA 1DJSA 4MA7L 1IAIL 1S9YB 3VG0H 5GPRA 1OTUD 4KJQC 1QI2A 4P5TD 3SKOB 4FQHB 5HI5D 3SDXE 3WFBL 4ACPA 4YDIL 2AV7A 4UQCA 2NY2D 1FCGA 2Q7YA 5SX4I 1NKRA 5T1LD 1PX4A 4CJ0A 1XF5B 4QX0A 4MWFA 3U4AA 2CKSA 2GSJA 4OF7A 3T0VA 1MHHA 2F8XC 5I66B 4FP8H 3TZVA 3UYOD 1FNEA 2OTUB 3LCYA 3RVUD 1I8IA 1J0YA 4CGTA 5D7KE 1H3TA 2P47B 4CVZB 4PMQA 2UY2A 4QHLA 4JY6A 1IC4L 4ZSOB 4UNUA 3GI8H 5JUEL 5EIIA 2APBA 2VDOH 3WS6A 4OFVA 1KCRH 1HNYA 3AIEA 3VIPA 4HMCA 1W2KT 5DURB 1BBDH 1I5PA 2AJUH 1BZ7B 3KPMB 3WH6A 3F58L 1LWRA 1T7WA 1YEKL 4HK3J 5IW3A 4V1DB 2XTKA 2D4DA 4WENB 1Q6EA 4Z95L 1FYHB 4EDXB 3DGGB 4Y7EA 3OR6A 5EZJA 3RHWK 3BHBA 3TJHC 1OGSA 2YD5A 2ICEB 1MWAB 4P46A 5BS0E 3T0EA 2A6IA 1J05A 2C3VA 4NQDB 5JXED 3WDQA 1X9QA 3S5LG 5IFPA 3CFJA 5HYQB 1TVNA 3ESVF 3DECA 3UEZA 1YMHA 35C8H 4OLEA 1R85A 2WCAA 1FP8A 1M6OA 3MLSL 1NMAL 5DQ9A 2HKHH 5GS0H 3AREB 3NIFE 2OL3B 5IMKA 2ZOLA 2B8OT 5D7LD 1OGTB 5CHNA 2VXSL 2QL1A 3GMMA 2NW3B 1ZEAH 3EJZC 3MXVH 4Q74A 2L7JA 3N1PC 1QW9A 1LO5A 2HG5A 3AREC 2FZ3A 5GS0C 1FFPB 4FZEH 2BJMH 1C08B 1QBML 2H1PL 3CJJA 1I8MB 4JRWA 2HMID 1IGTA 3WD4A 2X5PA 3QIBD 1ZLVH 5HDQL 2FIKA 4QRPB 3SKNA 4UCFA 3IGAA 5C70A 5D1QB 3QIUD 4X5WB 2G3IA 3IVKB 1MHEA 1OARH 5JPMA 4PMDA 1M53A 1C5DA 1YEGH 3SE8L 4KK9D 5D1QC 4ML4A 4CJ1A 1TJHL 2BVTA 9CGTA 3RBGA 1NCDH 5C0AA 3S96B 4BH7B 2D1ZA 4J3OC 4M62H 4K8RD 3Q6GH 2C7FA 4BQ4A 4L4VE 3ARYA 5CJ5A 1HH6A 5EFFA 1HDMA 1MELA 1GOIA 5IFHL 1PGRB 1XAUA 2D9CA 5A8PA 4Z7NF 2ZX7A 2VDRH 3N1GC 1WFNA 3QCVL 1CGYA 3OGCB 4X99A 3AICA 1NEZA 3EYQC 4NQVB 2JJSC 3PIQA 3RGHA 4JGMA 4RRPA 5GHWH 4CADB 5IVNA 4L8BA 2FH8A 2DQJL 1ZB5A 2DDXA 5EZIH 1ODZA 3PF2A 1YYLL 5DJAA 3MLYL 2F54E 4Y5XA 1WK0A 4Y4KA 1BYCA 5JHDD 3BH8A 5DFWH 5FKYA 3MTRA 4KK5D 3F65A 2XPGA 4X0KA 1HJXA 4U2ZA 4Z2JA 4IIQB 5DHVH 4F9JA 4MCZB 3K8LA 4AZ7A 5DHVB 2LS6A 1QI5A 3LEYL 2EE3A 5K33A 3BDYH 1JBJA 4M6ML 1Z9OA 1N8ZB 5HYJE 4UDTB 1Q0XL 3SCMD 5BS0D 4EIGB 2WKGA 1WFOA 4UT9H 3LS5L 4IIQC 5HDBF 3ULUH 1A6WL 1A7NL 3ZSSA 3QAZB 1C7TA 3RU8H 4FQLH 4WFGD 3ZT7A 1CFQA 1U95B 4QTIH 1A4KB 5KN5B 3QUMH 5J1AB 4UIMA 3WS3B 1MJUL 3QFJE 2YL9A 3VXMA 1P7KB 1V5JA 1HSBA 2NX5A 2NZ9D 3QAZC 4W86A 4D6EA 3NIYA 5BVPL 1F8TL 4OIIH 3HE6A 5IHSA 3SKVA 1QNPA 4GG8B 3CUGA 3N18A 4NO0B 4D72A 1RZGA 3RDTA 1X6LA 2FGWL 4O4YL 1MUJA 1UD8A 1MI5D 2FX8L 4XCCH 3D2UD 1XGTB 3G6DL 4U4BA 3H9HB 1ISYA 2G75A 4TUFA 4JHZA 4OD2A 2N56A 4PS4H 5EUOB 3UZQA 2XI9A 3I2CH 3D3VB 4O00A 5L2KE 4YO0B 3ZJ8A 1UVQA 2W65B 5HHME 4O02L 3F5JA 4OM1L 4W4ZA 2JCCA 1CN4A 4ZFOB 3TBTA 2XFXA 4X98B 2G60L 2YC1B 2J88L 2OR9L 3Q1SH 3UTTD 4AG4H 5TPWH 1FVDA 3K7UA 1HHJB 1AD9A 3IAQA 4QO1A 5DRZA 3DMMA 3UAJD 4LIQL 2P43B 4HULB 3FNDA 2ZJSL 1T3FB 4X7EC 3M8OH 4NRZA 4MNKA 2YL6A 4FTVA 1UZ1A 1K6AA 2QADD 2FJFB 3UTPD 2BMKB 1NBVH 1TJIL 5FYLL 2J7GA 4U6VL 1CZTA 5EU5A 3BP6B 4LLUA 3NAAL 4QLLA 3MGOB 2WN3A 4OZFB 1NGWA 4M24A 1BOYA 1JNNH 2RIKA 1EH9A 1I9RH 1NCAL 1L0QA 3LDBB 1UXWB 3O3DA 3Q0HA 2OBGA 4GT7A 3O2WL 3PZTA 3KHQA 3JTSB 3WMSA 5DJYB 3QUZB 4MS8C 3X3GL 3RL2A 5IUSA 2ZEXA 1XRVA 2VXQL 5FCUL 2GHWB 4MB4A 3LDBC 4MQ7A 3MZTA 4PJIE 3V95A 3ARVA 5TDPB 2I60H 4UQ9A 3KPTA 5JNYA 5T1DH 1YPZA 1AXTL 1RJYB 4DVBB 1PEWA 1TUXA 3HNSH 3OQ3B 4JFEA 3GSXB 5KSUB 4K94L 4FQ1L 2WV3A 4DFHA 2NYYD 4R26L 5D5ME 4KXZI 3VXTB 3AU1A 2AABH 1C8YA 3BUYA 1E27B 1DLHA 2IAMB 3W0WA 1SQ2N 3QEQE 4QXWA 2D2OA 1E4WH 5T5FL 1VGKB 3KXFE 1JPSH 3O45A 2IAMC 3E8UL 4RMVA 2WVVB 1B3VA 3GXIA 1VESA 1A6AA 1MH5B 3IFPB 1YJDC 1S7RB 4Q58C 4XCEB 4H5SA 3UPRA 2AQ3A 2XNAB 3OKMB 5KSBB 1QI0A 4TVPH 1EVUA 4RL3A 4PJEF 2QKIB 4JFPB 1UZ6E 2KPNA 1EJ6A 3CC5B 4HKZB 4M93B 3CKHA 3DUSB 1B0GB 5BRZD 1Q1JH 4GAGH 5EU4A 1LK2A 4Q9RH 5D2LA 4JY5H 3WIIH 1EOKA 4XNQB 1H6XA 1RUQH 2J3SA 3HAEA 4M93C 3QNXB 1F58L 4XP1H 2NY1B 2HJLB 4KV5E 1IGYB 4WLCA 1JN6A 3DBXB 1G7MB 4D6GA 4G6KL 1XGQB 1P4BL 4IPNB 4X7TB 1A7RH 4L3EA 4CU6A 3P9LA 1FH5H 1X4YA 4NQCE 2NY1C 3QDGA 4ZAKB 4RDQG 5MENA 5B3JF 1W72A 3EIFA 2HVJA 4P3DB 4K07A 5F6HI 2WUBL 4LOUD 2A3EA 3CK0H 3TWCL 1SBSH 3UROR 5BW7A 4KH2A 2FGZA 4GZ9A 5A95A 4WU5A 4ZAKC 4X6CE 1UMHA 2NXZB 2EPLX 3N0PB 1FZMA 1E1EA 3EO0A 4K9EH 3RBSA 4P9ML 4OCSH 1MREL 3OG4B 3FQWA 4NQEE 3W26A 3NRUA 3CXDL 3LRSA 5A8MA 4OF5A 4MB1A 1I1CA 2NXZC 1KGYA 2D7QA 4MA7H 2FEEL 3DVNA 3B6SA 1IAIH 4HP5A 2CUIA 4K9EC 4F8QA 5CEXB 1LL7A 4YN5A 1KLUA 4Y89A 2ORBL 3MV9D 3SDCA 1P84J 5SWSD 3WFBH 4YDIH 3BZFB 4I9WE 5I8EA 3B3IB 5FYJD 2XXCB 3TO2A 1G6VK 4MNQB 4KUCF 4OZGA 3S36X 1PBGA 4ZXBB 5EIVA 3OGVA 5JR1H 5EU7C 4XMLH 1D5MA 1RK0A 1B4RA 2CCRA 2Y9RT 5DJ0B 3U7YL 5IW6B 1KR0A 1CLCA 1QRND 5HPMB 1L4IA 3IYLW 4ZXBC 2DI7A 4HK3N 5F9OH 3H2WA 5JUEH 1W1VA 2CDFB 1CZSA 5FGSA 3C6LB 1HJWA 4D6JA 1KTDA 3MGTA 4P7RA 1UUQA 3C8DA 4WTZG 3E2HC 2IXVA 4N5UA 1OCWL 1MVUA 4GBXD 4IEFB 4UBDD 3F58H 1YEKH 4HJ0C 3ZE2F 1AR1D 3QQ4B 3C6LC 1U3HD 4BXSV 4Z95H 5I75C 3KPNA 3L6FB 4W6YB 3NUKA 2PBOA 3SDAD 3VFMA 4HZ7A 5CZXD 3WEXA 2CDOA 4LPUA 3K2UL 3DXAD 1NX9A 2PNDA 4GINA 5FOOA 1LD9A 1JUFA 2MKWA 5EOTA 1UWWA 3IJHA 2PYEA 1DN0A 3IDJA 3MLSH 1NMAH 2R2EA 5FHBL 1DBAL 2DLHA 3VRIA 2PXYB 1GUIA 5I1IL 1CLZL 4M48L 3ZLQC 5HY9B 2VXSH 3KDMA 4JKKA 3PWUA 2HISA 3GH7A 5EU6B 3WL0A 5T1KA 5GGUA 2NPLX 2PXYC 2Y6HA 2P8LA 1BVLB 3KPPA 5AAMA 1JYVA 4M00A 3QPQC 5C09D 4WGWB 1QBMH 3VXPA 1CENA 2YBRA 4U3AA 1I85C 3PDGA 2PC8A 1LE5B 5I3DA 1H3PL 3G6JF 4HKXB 5HDQH 1WZLA 3QJFA 4FLRA 2X09A 6FABH 1V8HA 2IALA 3SDDD 4MQXD 5LA0A 1JZ2A 5ESQA 2D0GA 4GKNA 4M4RA 4H0HB 3M07A 5DK2A 5F1NA 2Z8RA 3W27A 1X5HA 1GQLA 3SE8H 2CIKA 3GSUA 1E6NA 5D7JA 2OJZL 2J1AA 3ES6A 1TJHH 4Y88A 2W9XA 4XZBA 4E4PA 4OCYL 1EERB 3MFFA 3HCVA 4I9WD 3RIAF 1VAHA 2H26B 3MLVH 2BXZA 4U7KA 2P5ED 1VFBB 1E5JA 4PQQA 5E9DA 2YLAA 2CMRL 3MR9B 3L4YA 1JWSB 3QCVH 5DC0A 1KT2B 3MREA 5I74B 3GEWB 2C1OA 3LKRB 4HIJB 2NY3B 4HIHB 2FJGB 2DQJH 4HC1A 2VLMD 2FEEI 2XKUA 4ODWA 5I74C 4A44A 4U7MA 1YYLH 5J6HB 1UENA 1JK8A 3NH7L 4MSWA 2NY3C 3W53A 3ARDA 1S7XB 1H5BB 3MJ9A 1QNZL 1CDIA 2XYCA 1QZ1A 4WI6A 1F90L 3LEYH 1XGUB 4PJ7E 5JW4N 4UFMA 4HBCH 4M6MH 5EO0A 4BQBA 5B39A 2BNRA 5DT7A 4WHYG 5DXWA 2HLEA 1Q0XH 4UV7L 1H5BC 2WINB 4ISVA 2BSTB 3LS5H 1A7NH 4D9QE 4YR6A 2IXUA 4IUGA 1TENA 4YDLB 4PIRF 4M8VA 5ICZB 4N0UA 4HJJL 3W6MA 1MJUH 3DRQB 4MX7A 1OP3K 4O58L 3BX7C 1FHLA 3TJEL 4PJFA 1QEWA 1S7QA 4LVEA 2V38A 2IBGA 4YDLC 1FYTD 1DBML 5BVPH 1F8TH 1EEQA 3FT2A 5DJ8B 4ZOEA 3PDOA 3VINA 3S35X 3C2AH 2AJSH 3EMQA 3IJ7A 4UU9B 2YHGA 4CU8A 1EPFA 1FFOA 2E7LA 1B9ZA 2WMFA 4PGEB 4O4YH 1O5DT 3PNWA 2FX8H 3WN6A 3BWAA 4PJEB 1CG9B 3G6DH 3FRUA 5D7IE 2XQXA 5HPCA 2D31B 3P4NA 4HWEL 3L4UA 3O3BA 4XVSL 1C5CL 4UQ3A 1UXXX 1HE7A 3PGDB 1FN4A 3STLA 4O02H 4P5MB 3P2TA 4OM1H 1L8NA 5A2BA 3EJJX 3VRJB 4W4NA 5GRYA 2VURA 1W9UA 2D24A 2G60H 2J88H 4NF7A 4HJGA 4RA0C 2OR9H 2NY0D 3KPRA 5C0GA 1EQPA 4K3EL 3OJMB 4LIQH 4PP1C 5CBEA 4DUVA 1HXMB 1OB1B 2A9NL 3CPLB 1ZS8B 2ZJSH 3P4LA 3WUGA 4B0MM 1MFEL 1WCBA 3H8NA 2VX6A 1TJIH 2CO6B 5FYLH 4U6VH 4WO4A 5F1KC 3ZE1E 4D1IA 3CFEB 4O2EA 2OMBA 1E70M 3MLUL 4XZUG 1IAOB 2ICCA 4YH6A 5I71B 1QPKA 1KCLA 1NCAH 1LHZA 5TQ0L 1VF8A 1G1YA 5JO5A 4CN4A 5L8KB 2DSUA 3KPSB 1FLTX 3X3GH 3V6BR 5I71C 2VABA 5FCUH 4QRRD 5E1HB 4JHOA 4Q0XL 3AS3A 4G8GE 3RGVA 4CUAA 3WEOA 2FWOA 4RAHA 3WMBA 1AXTH 1OGAE 2AJ3B 4RE4A 3LV3A 3FHQA 5EIYB 3GSRA 4K94H 4FQ1H 4NKIL 4R26H 3VILA 3L5IA 5DHYB 3B8YA 1H5VA 1W0NA 1CZ1A 3OXRA 5B8CB 3MCLL 2DPEA 3IJ9A 4F8TA 2IANB 4DJMA 1W99A 3RPIA 4UR9A 1F4WL 4YDJA 1K2DA 3MV7A 1DHKA 5T5FH 3VCLB 1RJLB 1KJVA 4X7SH 1VACA 5B8CC 3E8UH 4OGAD 4H8UA 1XH0A 3OG6B 1JGIA 5JXGA 4O2CA 3CIQA 3O9WA 1ZWIB 3MJGX 2YA0A 2R0KL 3FZUC 4UFHA 4PV8A 2XTJD 1V02E 5DMKA 3WNPA 3MRQB 4MJID 3WDRA 2A6DB 2WMHA 2Y36L 4N1HB 1TR1A 5JW3H 3PWPE 5HJ3B 1B3YA 1OT1A 1NP0A 3WEMA 2Q8XA 2ADJB 3HPLA 2XIDA 4LSQL 1GZPB 1AGFA 3TBVA 1F58H 1VADA 1RURL 2X10A 3G9VA 5JPNA 5DJ2B 2EYTB 3DLQR 5MEQA 4G6KH 1P4BH 4DZBB 1XCTA 3LN4A 3LKQA 4G9FA 2AJZB 2QR0B 4AD4A 4I2XA 5E5MA 1SJVA 5HBBA 2WHLA 2XVLA 1K9EA 1CICD 1AD0B 3SDYL 4MNGE 2HA1A 4HKJA 4QOKB 2E32A 4DWSD 3TWCH 4RGMC 4TRPL 3GMQB 1MJ7L 2VISB 3QISA 5E56A 1B1YA 2Y6GA 4UNVA 4PJ9A 4P9MH 3WSQL 1MREH 3G6JB 4N0CC 3ZYZA 3SIMA 1MFAL 1FVCB 3CXDH 3X14B 1U8QB 5HHOD 1E43A 3QQ9C 4XNZB 2W1SA 4RE2A 2P8PB 1VIWA 3OKKA 1OCQA 4RX4D 4I8DA 5J1TC 4XAKD 5DO8A 4Z7UA 1QO3B 3K77A 1X5KA 4NQXB 5HVFB 3IETB 2VLKB 3U7WL 3L3DA 1BJ1H 2R1YA 4XNZC 4L3CA 2ORBH 4XNMB 4XX1E 3STBA 4XX1G 5DUBA 2GSIB 2YRPA 2Q87A 4D8MA 2E9WA 4UOJA 1OAZL 4RIRB 3V5DB 2O5YL 4M7ZC 3O6ML 3S3SA 5I6XB 3MROB 4L4OA 4BSJA 1GOMA 2FB4L 3MRJA 3QXWA 2RBLA 1I9EA 3NTCL 4GQQA 1MAML 3HHRB 3RWGB 3C08L 3TP4A 4OLUH 5IM7A 1EGJH 4ZENA 5I6XC 1LG2A 1NGQH 3BN6A 1XYZA 3SDXF 2QLVB 1UKOA 3CU1A 3O4LD 3GYCA 1FH8A 4HX1B 5D1ZB 2VLRB 4JRXE 2B2XL 3FT3B 4JFFD 1OCWH 1JHLL 3DYMA 4KI1A 1Q38A 4DGIL 3N1FC 4RGND 1TJGL 4AIXA 1JV5B 5D1ZC 1NKGA 4PRNB 5E94B 1PG7W 5EU3A 4AYFA 1IC7L 4MAYA 3RILA 4G42B 3WQ8A 4P2RE 4G43B 3K2UH 3VMPA 1YDPA 2P49B 3JVGA 3IFOB 1JZ3A 2BFVL 4OSUH 4JE4B 3TV3L 1BLNA 3EDJA 3R8QA 5JIIA 1R24B 4CL7A 4I3RL 1OSPL 2YC2A 1EMTL 5CKGA 3WMCA 5FHBH 1DBAH 1AGDB 5I1IH 1CLZH 2AMGA 4M48H 5DRXA 1J83A 1W1PA 1JDAA 4MA3B 3SGDI 4X6EA 1OGGA 1P6WA 4OJYA 1R6VA 5IVZA 3EDKA 1RHHB 5E2WL 4D6DA 4X9FA 1LP9E 1D9KD 3U83A 1E6XM 2EE6A 1H3PH 1E4KC 1M7IA 3AY4A 4YBQD 3ZIZA 3M1BB 4N8VB 1AO7D 3F7QA 1BYBA 4HV8B 3UTOA 3NIFF 3VVGA 4MDJB 4I0KA 4HIIA 4YAQA 4Y8AA 4PTMA 1I7TB 3QR2A 5C71A 1T22B 4W8JA 1WCGA 2IH3B 4FXKA 2JB6A 2OJZH 2Z9TA 1YHTA 2SEBA 2ZCKL 4CD7A 1EO7A 4IOSD 4QWWC 1Z32X 2GVYA 1UH4A 3CDGB 4OCYH 1WWCA 3CUPB 4LDEB 3QUYD 3DI2B 3T0EE 4KY1L 3OPZL 1NLDL 4C57C 1AIFA 4GG6A 2YK1H 1SEBA 2P5WB 4Q6IB 1TVHB 5LKNA 5H94A 4PJ5A 1LE9B 3CHDA 3TO4D 2CMRH 3QDJB 1OWRM 3K2MC 1T0MA 3JTTB 3SE4C 2PN5A 4M8QB 3TBSA 3V4UL 4X6BB 4PBWD 4QDMA 4JO3L 2AXFA 4Q6IC 3G5ZA 1RD6A 2X1PA 5F1OB 4JN1L 2OK0L 1HQRB 3A6BL 1J0ZA 4PY7A 3OEAA 1ZHKA 1T1WB 1JPTL 3KAAA 4XGZA 3PZMA 1C12A 3BIKA 4EN3B 5GRZA 3NH7H 4ESKA 4A6YL 2BNQE 4MAZA 1INQA 4UOW0 3BYTA 4JKWA 1QNZH 3AIQA 2ZX5A 5KANG 4JKPL 1YMMD 1I3UA 1F90H 4EN3C 4HZ6A 4MZ2A 2Z8WC 1XF2B 3D18B 4LGSB 5DD6B 4YHIB 4YHEA 4UV7H 1NFIB 1MW0A 3WHE1 1CD1A 1UQYA 1XYFA 4LLVB 1NQ6A 4P2RD 4AQOA 5F8QC 3ZO9A 2OTPA 1GW1A 1TMQA 5F9WB 3K4DA 3RY5A 1JPFB 2XFRA 1KN4L 3O8XB 4HJJH 1KNOA 1OAKL 4ZS7L 2PWGA 3V0VA 4O58H 4HUXA 3LS4H 2LFGA 1ZOXA 1KJ2L 3TJEH 4LDOB 5F9WC 3D85A 3S34L 1KB9J 3S3PA 1DBMH 4FQHA 4GXPA 3F12A 4K7PL 3O8XC 5C0AE 5A6AA 1VEOA 2BSRB 3QZWA 2VC9A 1BWMA 3O6FA 3T2NL 4LARL 1JPGB 4Y19A 2CDGA 5A69A 1T03L 5I66A 4XXDA 1V7NL 2H41A 4N0FB 4V2CB 2EBNA 4LEXL 4HWEH 4XVSH 1T04B 2ID4A 2VMDA 4CVZA 4HH9B 3AHXA 3OKLB 2VR9A 1NEZG 2C8NA 4ZSOA 2WSKA