4DY3A

Crystal structure of escherichia coli plig, a periplasmic lysozyme inhibitor of g-type lysozyme
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRVLQTRNDARKNKTKKYNVDIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone inhibitor
molecule keywords Inhibitor of g-type lysozyme
publication title Structural characterization of the PliG lysozyme inhibitor family.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4dy3A00
3AFGA 4DZGA 4HPKB 2XVGA 1DF0A 4I3GA 5FBZA 2XVKA 1NQDA 2XVLA 1KFXL 5SV5A 1WMFA 3DF0A 2LUWA 1KFUL 3BOWA 3JQWA 1QXPA 2O8OA 4DXZA 4HPKA 1WMEA 2QFEA 4DY5A 1U5IA 1WMDA 5FAXA 1NQJA 3JQXA 4G9SB 4DY3A
chains in the Genus database with same CATH superfamily
2HWE2 2RDNA 3WG1A 1VB4A 1WBLA 2XWJB 4BLIA 2OS2A 3WNMA 4C0BA 2EIDA 1JBCA 2BTVC 1JODA 1PMJX 4U36A 3S30A 3UGHA 2OPKA 5A1LA 2BGOA 4IXLA 4RR3A 2ZABA 3ACIA 3GM8A 1GP4A 5FZOA 4GD4A 5GLZA 4QM8A 4M3CF 1AR82 4K9SA 5LA2A 5ERLA 5LWBA 3L2HA 3VBSB 5EPAA 1DQ5A 2FCVA 4L2NA 2D6OX 4BA6A 1S2BA 2EICA 3VBRA 1MACA 1A34A 5AC93 1MQTC 1RUJ3 3MIEA 2XBO3 3RZZA 3O1OA 5IW0A 3M3CA 2WAAA 1V0AA 2JX9A 3FUQA 4AI2A 4XFBA 5J1XA 4CDXB 1F4AA 4LHSA 1BBT3 2ZGTA 4CP9A 2Y0IA 3LZZA 1V6IA 1NY71 4BM8A 3PVBB 4XAAA 2QQOA 1Q56A 3PMEA 5JMCA 3T08A 4ASKA 1RVF2 2LW8A 1UY1A 3JBG1 4Z2AA 5C71A 2HWC1 4NAOA 5C3SA 4MGTA 1PMHX 1OOPC 2DCJA 1W0OA 2VMGA 4QGMA 2HJIA 5A6QA 2XJUA 4BWOA 2E32A 1NZCA 4BJ0A 1CIWA 1YLLA 3ZVXA 1QOTA 3USSA 4LORA 3M70A 3NL1A 3DKWA 2BVVA 3ZLIA 1FT9A 1QH6A 3DXUA 3ZX7A 1RUC3 1V9U2 1MS8A 2GMMA 2VUDA 1K5JA 2YYOA 3HQRA 4W8JA 4AF9A 5KXCA 1ENRA 3DKQA 3T4VA 5FZIA 4CEWA 1ZREA 5FDBA 3J26N 4L92A 1QDOA 2BBAA 4QT6A 5JR7B 4N8MA 2BBVA 1H2KA 2VE1A 3KV9A 4CYDA 4R9AA 1PIV2 3V65A 3MW2A 3AJZA 3BB6A 3WV6A 5E8AA 3NNFA 4GH4B 4PLNA 4XJ9A 1C8NA 1FPN1 4Q4W2 3ZMNA 5FWEA 2DF7A 4QB6A 3LKJA 3ILNA 4YRDA 1D2SA 2N7GA 3I2GA 1W6OA 3CJIB 3LFIA 3N35A 4AVSA 4EZHA 2QQPA 1R092 1DLCA 1SLLA 2ARCA 1J59A 2FD8A 4Q4V2 1CR7A 4NRMA 3T0BA 1HV0A 5FYUA 1RJ8A 2VOKA 2WZPP 1PZ7A 5CKNA 4JC1A 4AFMA 4EQVA 1TEIA 5CKMA 1RJ7A 3VUOA 4D6QA 2HWE1 3H9AA 4X6QB 5FZAA 2ERFA 5L9VA 3GCWA 3J7HA 4MZUA 3LCPA 4I0WB 4YGBA 1IS3A 4XUPA 3NV3A 2WO1A 4JTOA 3IM0A 4XQDA 5T54A 4SLIA 4Q4Y3 4AFCA 5FZ1A 1X7NA 3V64A 5FBJA 2AACA 5C3OA 1NCRA 4IQPA 5A1FA 2X5IB 4LEJA 5BPXA 1LOCA 1GP6A 1H6YA 1DHKB 5DAVA 3BPSA 2PA7A 4HKLA 1AR81 2PLV1 5J98B 4AGVA 4CCJA 3U37A 3TBDA 1D7PM 5I0RA 3FFZA 1X50A 4QQHA 3BTAA 5CFDA 3DECA 5FPXA 1UX6A 3V0AA 1MZ5A 4IV1A 1W2UA 3Q8AA 5F2SA 2ZTNA 3O0XA 1DZRA 1NE6A 3VD4A 1SBDA 5JSRA 2W68A 1RUNA 3ETQA 1W2AX 2BRTA 1QJX3 2ZGLA 4CUGA 3AKPA 4OHVA 4XJ8A 1W99A 4YGEA 5F6KA 1QF3A 2ES3A 4HFSA 2VXJA 4XTPA 1OUSA 2XOMA 1JN2P 4QX1A 2IVIB 2VOWA 2XUEA 5GJ6A 4NR1A 4RR3C 1UIKA 5FP3A 2CV6A 1GZCA 1B35B 1GWMA 2A73B 3U1XA 4WM7B 1RITA 5IJRA 3K3OA 2Y6HA 4AVBA 3VBFB 4M00A 4Z1VA 1C28A 1W04A 2K0GA 1JTZX 2JJ6A 5ABJA 1YEWA 2HYKA 1EPWA 3VBRC 4QHBA 4D7TA 2HBUA 2NPIA 3R4DB 1V9U1 2PHRA 4Y4RA 5FP7A 1C8M2 1W6QB 5JXIA 3WQ0A 3WF4A 3FLRA 3ZXEA 1OT5A 1U0AA 1SCRA 1ULEA 3MPPG 3LQCA 4YFWA 1STMA 1TVGA 1AHSA 1XE7A 1ALYA 4COWA 4JQRA 2X10A 4QQOA 2WQZC 2HWD2 3WNPA 2W94A 2GH8A 4RYDA 5JZGB 2R32A 1W9FA 3ZSEA 4AW7A 3PTYA 3MIHA 2PELA 5LASA 4OZXA 1REFA 3KGZA 1L3JA 2R16A 3HEIA 4Q4V1 2G9GA 1ZA4A 1SPPA 1T6BX 2ZX0A 4A44A 4D0QA 2BZDA 2HEVF 5G04L 1DBNA 1IG3A 1H1IA 3M7AA 4QXHA 4DY5A 2D5FA 2UWCA 3ZYRA 3K2OA 4YW5A 3V0BB 2NN8A 4UFJA 3WOGA 4P9GA 3N9LA 2VULA 4CEWC 3POYA 1XNDA 1LR5A 5FPZA 5DUXA 2OZ6A 3NJYA 2JIGA 3KT1A 3WW1A 4FPKA 4HANA 3ZYFA 1Q3EA 1REEA 1WCDJ 1XPWA 4XIOA 1UY0A 4HONA 4HT1T 5LA0A 3ZXDA 1GZWB 2CGPA 4ISRA 4XHBA 4YVSA 2E7AA 1W8WA 4LBMA 1H2NA 3HQXA 2VZVA 4IE0A 1S55A 4YW6A 2JG9C 2CL2A 2RS52 1LKNA 2YDEA 1RINA 5FZDA 3POEA 3EO6A 3AMQA 4P9LA 4R52A 3LEKA 3JBG3 3OF1A 4XZUG 2HWC3 1ZBA1 4RQPC 5FP4A 1I5PA 1U5IA 3OTFA 4FAHA 5C3RA 5AVPA 3THCA 1QOSA 1NA1C 1YIFA 5J96B 4F3JA 1PK6A 2VUAA 4FTBA 1F8VA 3AMPA 4HK8A 1UU5A 5FOJB 1H0BA 5FYVA 1OSGA 4A41A 2QZ3A 3BIWE 4XF4A 4Q0PA 3Q9OA 4D94A 1NCRC 2LRPA 1YJLA 5E89A 4K20A 5EV7A 1JW6A 2ZS6B 5FKBA 1GWLA 1Z7S2 1XSQA 3Q8EA 4Q0UA 5FJHA 4B1LA 1DGRN 2VZQA 2UWBA 2BDRA 3A7QA 3A21A 3CJIA 1SFNA 2AGSA 1SFYA 1AX2A 1Q8SA 1S0IA 1Y43B 5GZEA 1DQ4A 1UMIA 1S0GA 2UYBA 3V56A 3WEZA 5CFDC 4P02B 2CGNA 2NM1A 4IV1C 3J7LA 4HKOA 3T2QA 5HCAA 1GOHA 3B94A 1DFQA 1LHNA 5A3MA 4FBFA 3U14A 1C8M1 2MPFA 2LS6A 2SLIA 3ITQA 1LECA 3VBHB 4C1WA 2XKOA 4O9EA 3JB8A 4XUTA 5F3CA 2C26A 4CEYB 3JU9A 2ZEWA 3DGTA 4GZ9A 3LF7A 3AL5A 3AMMA 5HXMA 1VB2A 1W90A 3I8TA 4XFFA 2VQ0A 4M3CE 2VMCA 4QKDA 1MZFA 1I1EA 2IXKA 4K1ZA 4A42A 1ZRCA 2HWE3 3K4DA 3NNJA 1QQP2 1Y9QA 2MEV2 4Q4X1 5EZWA 3A4UA 5K0UA 1H8TB 2HBTA 5FZKA 5J3UA 4QPGA 3VL8A 2VW0A 1P8JA 1WD4A 2V72A 3MF6A 1LB2A 2V4AA 2R0HA 2GC3A 2WT1A 4IEYA 4DPNA 5ABJC 4QU1A 1S0DA 4QPYA 2E7TA 3T0DA 3WP5A 2ZGQA 3EYPA 2AR6A 5EYYA 5LBBA 2QNKA 4DY3A 2AZ5A 3FZ3A 3W5NA 3RPQA 1OVPA 1AR83 2VQTA 1CGPA 4UF0B 1F4HA 1UO9A 3MLKA 1SBEA 4FTSA 2WYFA 5I0SA 3AMNA 1Q43A 3LPFA 4ZONA 3AVSA 3M3EA 1ZYBA 4XF9A 5JMOA 3BTZA 4QHZA 1ENSA 5C8WA 2OW4A 1VBC2 3N9PA 2DVAA 2D98A 2R042 4Q0SA 2B4KA 3B9CA 4WM7A 5FCCA 4BIOA 3VBSC 4PBPA 5IUQA 2P6CA 3D5OA 2ZX1A 4Z07A 5C6CA 1AYM2 4XXPA 2QDNA 4XE9A 5C9AB 2D44A 5C3PA 1GANA 3P3PA 2WA4A 4YPJA 3ZXFA 1OQEA 2XUMA 4SBVA 1RVF3 3ZXKA 3EBRA 5DDJ3 1HN1A 2DVDA 3IDCB 3N9QA 5BNQA 4HETA 2XQXA 3B5LB 2VD7A 3PVEA 2QQMA 1LOEA 1LOFA 2XVKA 4BIFA 4C1XA 4IE5A 4Q8KA 3SXWA 5AFBA 3MV11 1V6LA 3AXEA 1VAVA 1ZRIA 4M3CA 5EIYB 1WCKA 3LD8A 5LBEA 5GM0A 4NHKA 3SMHA 2WNEA 4XDQA 1G9FA 3WNOA 1V9U3 3FN9A 1KS4A 2Z42A 1ZZCA 4YVSC 4IEXA 5A6XA 5FPBA 2VJXA 1JUHA 1NT0A 3CZJA 1C57A 5FZ9A 3RWKX 2VNGA 4B29A 1JYXA 5EJZB 1VE0A 3W9AA 2R062 2ARXA 3ZDSA 2VQAA 3ZYPA 2FDGA 5A7NA 1GV9A 1NG0A 5HCFA 1PIV3 1ND3A 3RJRA 5C5TA 4QB1A 4IEQA 2ID4A 4Q4W3 1AYN2 2W1QA 4XF0A 2XJSA 1MQTB 1LESA 1U5YA 2EIGA 2HKXA 2A6XA 2UU8A 3AL6A 3M8LA 3MLJA 4MGKE 2OQ7A 3ZN6A 4CCNA 4DUXA 4YGDA 4KG8A 4ATEA 3ZXJA 4BQ3A 1S0BA 3H8RA 1R093 4C91A 1AF9A 2BWCA 3D0JA 4LKDA 4LA2A 4Q4V3 3WDYA 2PHUA 4G4FA 4LNVA 4KG0A 4Q2FA 3J8F1 5IFPA 2I45A 2FHRA 5C7GA 1SMVA 1FV2A 1QQP1 1YFUA 1OC1A 1VIWB 1NYWA 2MEV1 2D3RA 4JVAA 4CVUA 1PO12 1PO21 4HOOA 1OOPB 3CJIC 4HBNA 4I0BA 3OY8B 4OCTA 5T50A 1GWKA 5FY9A 5H9PA 1CAVB 3P3NA 3O1SA 5EJ3A 1LGNA 3DEMA 4OI4A 5E6HA 4FTEA 4Q5OA 2JXAA 4MV2A 2D6PA 2IVJA 4A7YA 1KD7A 1VBE1 3PLQA 4QHOA 4LBNA 5EJ1B 1AXKA 5JUVA 2HEWF 2YHJA 4BLJA 1OA2A 2ZJCA 2JDMA 5LW9A 5CKQA 4LHNA 4XFHA 4OZOA 4IEVA 3AKTA 4FQZA 4INDA 2F4PA 3Q8FA 3AYAA 2VTFA 3PUIA 4COZA 1WBFA 1W6NB 3RMYA 2GMEA 1VBC1 1UY2A 2GNBA 5E16A 4KGGA 2QVSB 2R041 1HW5A 5K0UC 1AZDA 3CO2A 2VPVA 4XF3A 3TNPB 2A3YA 5B4NA 4UW5A 1AX0A 1ND2A 1AYM1 2PHLA 3CMGA 5A3WA 2NLRA 1A6CA 3RVHA 2X53S 5FBZA 3VKMA 1YJKA 2Y33A 1O7FA 4KL1A 2CAUA 3FWEA 3OBZA 1RUH1 3GZUC 1S2KA 4QX7A 2H0VA 3S5QA 1VR3A 2WT0A 4D6RA 5JIAA 1GICA 4EROA 1GSLA 1SLCA 1BHGA 2ZZQA 5FZLA 2YUEA 5GZDA 3HPNA 5IAXA 5A7PA 3BODA 4H55A 3OGSA 1WWYA 3H1MA 2P3YA 5JI9A 3RDIA 4MG2A 4DMIA 3HIFA 2CDPA 5T52A 1C3HA 3W21A 4ARYA 3EXUA 3Q8BA 1ONAA 3S7EA 3AYCA 1WW4A 4WM7C 4AEDB 3R6SA 2PHWA 5GLVA 3PJYA 4I3GA 3S5AA 2EF6A 2TEPA 2VO5A 2R30A 2XHKA 3DCQA 3OGGA 1IS6A 2WNVB 1VJ2A 4R9CA 3R05A 4ITCA 2BNNA 2HWD3 4OHWA 1AYN1 4BQ2A 4FT8A 3IIAA 3KF3A 3POJA 3CF6E 1DGRA 2EXKA 2WA3A 1OA3A 4XOGA 1LOFC 2YV8A 2RV9A 1QNYA 1IGOA 4Y5TA 1JH5A 1KJLA 4A3ZA 3ZXAC 1CZTA 5L19A 1OQ1A 3UGGA 3FBMA 3WDWA 2D6MA 2JB8A 3DV8A 4CDWB 2ZMLA 1D0GA 4YZ2A 5CIRA 1R64A 4RR3B 5A3LA 5JCTA 3AYEA 2WIIB 1ULPA 4DZGA 5JZGC 4X8PA 1PO11 4MLOA 4IW3A 2VBBA 4A3XA 3NKGA 5FOBB 2ZZJA 2W0XA 3MLLA 3R0RA 3THPA 2WWJA 3LA3A 1GMMA 2RDQA 2J1RA 1LEMA 4ZZ8A 2DBIA 3VBRB 1IPJA 2Q8OA 4Y1ZA 5CFCC 4CP2A 5FYIA 3U4XA 4KU8A 4NN0A 1JOJA 1S0JA 3SNMA 4AAPA 4LLFA 2RS53 4BQXA 3WY6A 3LA2A 4ZU4A 1HLCA 4AI1A 4CP9B 1F9KA 4E4SA 4XDPA 1ZZ7A 1NX9A 3JUUA 2Y6JA 3U0ZA 4JKKA 4MXWA 2ORXA 4MUVA 3HJRA 5LEKA 3ES1A 4DINB 2QCSB 4NOTA 4PLMA 2VZPA 1CAUA 1J3QA 4LBLA 1WW7A 4QPIA 4W6WA 1W0PA 4CCLA 5I0DA 3ELNA 4FSJA 1SLAA 5J09A 4P00B 3LE0A 4Y3OA 2PTMA 4DXZA 3T2TA 1CONA 4Y24A 3H42B 5A7OA 5CU1A 1BJQA 2PYTA 1LODA 1UZZA 2XXZA 1Z7S3 3OPTA 1SEFA 2ZX4A 1G7YA 4YNIA 4CDQA 2OXBA 2CSGA 1REDA 5A6YA 4IGOA 1D0HA 4KWUA 2WYSA 4QKNA 3T30A 3T2OA 1OHFA 2XONA 4CEWB 2GZWA 2XH6A 4GALA 2VTXJ 4P9JA 3LFMA 1VRH1 3FX3A 4E2QA 4TN7A 1HJFA 2A75A 4ONUA 2NMOA 5F5IA 3WINE 2XDVA 2VH9A 3VN4A 3QBQA 4TLFA 4HVQA 4UAPA 3T1LA 3RS6A 2IC1A 4XJWA 1QY4A 2OA2A 1L7LA 3DYPA 3QH7A 3A23A 3GZEA 1WKYA 2VR4A 4NHMA 3BU0A 1QHDA 1IS5A 1ND2C 1W6OB 2ETEA 2P37A 3MIBA 3H7YA 4AEMA 2NYYA 4URTA 2VMFA 5IK7A 4IEPA 3E6BA 4ARXA 4NVPA 3O1RA 3UV9A 4BK5A 4PCRA 4GB31 5FAXA 1QQP3 2MEV3 4I30A 4AR2A 2WLPA 4DXRA 1RC6A 3RWNA 4AQSA 4I3PA 3VBHC 5CB7A 5GZFA 1SDWA 4Q29A 1O6UA 4CEYC 4JRAA 1WW6A 4RN5A 4PDWB 3PL0A 1UY3A 5SV5A 2YPDA 2ZMNA 4Q1PA 2RS32 2K46A 3UKTA 2Y64A 5JOZA 2AYHA 4ZZ5A 2B5HA 4IE6A 1NCRB 4YW4A 4QDRA 1AJKA 3HD8B 4PQQA 2P6HA 4XETA 2WT2A 3T1MA 3BKZA 4NIIA 1H8TC 1MS9A 4EYUA 2P34A 4DFSA 1H1MA 2Q5TA 3B69A 2W08A 3P6BA 2CWMA 1YI7A 2E31A 2JDKA 4L8QA 1MS4A 4CPBA 1L7RA 2D6LX 1WGPA 4XCAA 1CZSA 1PHMA 3AZYA 4XDOA 1D2QA 1RUE2 5FYSA 5A80A 1ULCA 4YSFA 2CYFA 1VP6A 4CXWA 2P3IA 5CFDB 4LIVA 1VBC3 4IV1B 2IXJA 4MOAA 4XCBA 2A3XA 2R043 2ZEXA 5JXHA 3WG2A 3WDVA 2KA3A 3THDA 1JZ5A 3M3OA 1XNAA 1YUDA 1WA6X 3K51A 5FUPA 2VW1A 2Z2SB 3WD5A 4DUVA 2A5ZA 4A2UA 4CSWA 2ZPXA 1BQPA 4BHPA 4TTGA 1LOAA 1UL9A 2V5DA 1RUG3 4QQ2A 4ZY9A 4K8RB 1FPN2 1PZ8A 2RR12 2J1EA 1W6MA 4CDUB 4CP0A 3F95A 1GNYA 5IVEA 4E8CA 5LA1A 3RZGA 4TYSA 5C9AC 3SC7X 3RZMA 2HWB1 2Z4FA 3ZKYA 3PUAA 4Z92B 5FZ3A 3OJBA 4COUA 5ABJB 5L9BA 5BNOA 2WS92 3CZUA 1RUOA 2IXLA 3O12A 1HXS1 4KU7A 3NV2A 2KM2A 1ENQA 5HBAA 2MHFA 3I49A 2RVAA 1HB1A 2R063 3U4SA 1DP0A 4QU2A 3E6CC 1MZ6A 2XQRA 5CFCA 4BMBA 1JU3A 4K40A 4CDWA 3GF6A 2VAUA 2D6NA 3CHXA 5HCHA 1AYN3 4E2GA 2DV9A 4GMP1 3KWVA 3S6PA 1HKDA 1PNGA 2PLV2 2WBKA 4FFHA 2G9ZA 4GWJA 3VHPA 4QPIC 3LOBA 4F8AA 2ZCWA 2QQNA 1HQNA 3MFAA 1K3IA 1GQGA 1U5XA 3ENRA 2J1TA 2BERA 4OHZA 1LOBA 3UKNA 5CA6A 5JIUA 1PGL2 3I2JA 2QE3A 1SPPB 4DRRA 3PIGA 3KV4A 3PU8A 1PO13 3EMRA 3FLPA 4FXKB 3ZIWA 1CPNA 4K1YA 5A33A 2ET7A 5EHDA 3H8UA 2JDYA 1PGSA 4AVTA 2P3KA 4ES9A 3BIEA 1PM7A 5T3NA 3KZ4C 4AQ2A 1UAIA 4Y1YA 2RS31 4ZPIA 3HT1A 4CXYA 2Y0OA 1XU1A 1J3RA 4DXTA 2BOIA 5KHGA 3KVBA 1AUYA 2XG3A 1VAMA 4PJYA 4EWDA 2HWF1 4YVSB 5FMCA 1V6OA 4UFMA 3MIGA 3AKSA 1F5FA 3B7MA 4H7MA 4S2FA 3GZTB 1NXMA 1W9SA 1RUE1 3USUA 3WF2A 2DDUA 4AFBA 2BW8A 1MS1A 2ZGSA 3E1F1 3PDQA 5C4WA 4M01A 1VBB2 5FWJA 1O91A 4C90A 1TNFA 1JYCA 1AR61 1X8EA 4EN0A 4IEOA 3MGUA 4YW1A 4FXGB 4H2AA 3BOWA 3DYOA 1PK6B 4LBQA 3VDCA 1WLCA 4CZSA 2YPJA 1ZZ8A 1UYPA 3H3ZA 3BCWA 4JQTA 4L0PA 5FREA 5A7SA 2RJ2A 4B4RA 5FY8A 5I8TA 4OUMA 2IXHA 5FY4A 2B42B 1OURA 2OUJA 3BYWA 2DVGA 3POBA 4EN9B 4E27A 3PIJA 4KGQA 4XUOA 2RR11 5K8SA 2WN2A 1G8WA 4G9SB 2PQQA 3SH5A 1VMJA 1UN1A 2W47A 4DXSA 1W03A 2G4IA 4UW3A 3ZO0B 5KC5A 2FDJA 1NLSA 4I01A 1W8OA 2GC1A 1RUD2 1XYPA 4NIAA 4I2OA 1OH4A 2ZAAA 1S2EA 2WS91 2E6VA 1GQHA 4FPGA 1E5IA 2E26A 1NUKA 2ZEYA 3DPRB 2LUWA 5C70A 3ZXGA 1HIXA 1PNFA 1ULFA 2Z79A 4S2DA 3FHQA 1PM4A 3K75B 4RL7A 4S2HA 4PDWA 1UXXX 1XYOA 2WO7A 5IWFA 1EYBA 4S2GA 3PUHA 5KXBA 2WO2A 4ES8A 1UMHA 2VMEA 1KJRA 4YZ1A 3C7GA 5DMYA 1JZ6A 3OG2A 4AEDC 5K0UB 2C0ZA 4IEUA 3CL1A 4DQAA 4QPGB 2R6QA 3TWIA 4CUBA 3AXDA 2WNVC 2WQ4A 2ZHLA 2HEYF 5D8AA 4YW7A 4Y22A 1U12A 2RE9A 5FZ0A 1IPKA 4UBGA 1YQ2A 4PIXA 1PGL1 1UY4A 1NAEA 1ZBA2 3N7KA 1YFYA 1S0EA 5F2WA 1SZBA 1GLHA 3W20A 1QJEA 1XSRA 4Y5SA 1H8VA 2WFF2 5H9SA 1CVNA 5B2GB 1DLLA 4Y33A 4QQPA 4FPHA 1W2TA 4FPEA 3WQ7A 1H2MA 5FK7A 4CDWC 3LIHA 1IQDC 3N9NA 4XW3A 4EWAA 5I8YA 2E53A 3DL3A 3ALQA 3MF9A 2DVBA 2ZHNA 3POWA 4CDUA 3SCHA 1F15A 3VHNA 1IZ3A 1K42A 1KGYA 5DZFA 3RZJA 1RB8G 1UYYA 2YFUA 1QKQA 5GZGA 4DIQA 2EXJA 3AX4A 5F8PA 2QQVA 3RG0A 3VKLA 1VBB1 4R8HA 2VOTA 1O3QA 1CX1A 2VMHA 3ECQA 1FYUA 1JYVA 4LXLA 3VZOA 4OI0A 3P5BA 1FNZA 2DURA 4FOVA 2JDZA 4COYA 4DS0A 1Y4WA 3I7DA 1BXHA 1OD3A 2CGOA 3FHAA 1HQLA 3J7MA 2YY1A 3QACA 1FI2A 3FJSA 2DUQA 4M3CB 2VVFA 1SBFA 2P4EA 3TNQA 2OKXA 1ZRDA 2VNRA 5FYCA 2I74A 4Q4X2 2ZGUA 3WP6A 1OLRA 1XRUA 4RSUA 4A4AA 4UFLA 2QJVA 3GGLA 3INAA 4CCMA 3O1MA 3UKVA 1BEV1 5IFTA 4QKFA 1CIYA 1YWKA 4L99A 5IAVA 1F35A 4ATFA 5BY5A 5KWRA 1G86A 2JICA 4XAEA 3WXPA 4CE8A 2VBDA 1RUD1 2G19A 2YZ4A 5C4WC 3CBNA 1ND3B 4CTEA 3HN1A 4GWIA 1ZNPA 1ZM1A 1YFWA 4BB3A 4NWWA 5CFCB 3LDRA 3ZN6B 3O0WA 5KR7A 4WZCA 5EXOA 3UNPA 3NJXA 1JI6A 1OKOA 1RIRA 5JLVA 2DWRA 4B4QA 1DF0A 5BNPA 2W2IA 4DO0A 2VQUA 3JD72 4QDSA 4PIYA 4YYOA 3IBMA 5F39A 2H6BA 1Z78A 2VCAA 2FBEA 2XL7A 2VCCA 4META 1US3A 2ZOEB 3MIFA 1XC6A 5DAPA 5JOWA 3MV01 2RS33 3RGBA 3WF3A 1EUTA 2ILMA 2QQJA 2RM22 3MI8A 2D43A 3OUJA 4JHZA 1MZEA 3POGA 3I97A 1OBNA 3HOBA 4LKSA 2EALA 2ADEA 4DOUA 4PBOA 2VNOA 4N43A 3J9SA 2WFF1 4BU2A 3SLIA 4YG6A 1UOJA 1UXZA 4PDWC 1KDMA 3A22A 2OVUA 3W58A 3POIA 2ZKLA 3BALA 2XVLA 4KI5M 4WVWA 4BH9A 2AEYA 3UT0A 4LOTA 1KFUL 1WUVA 2D3SA 1QGLA 3U10A 3ZSMA 5F37A 4HPKA 3ZKUA 1ND2B 3LEIA 2JKBA 4KMQA 2DTYA 1QH7A 5F5QA 3VZKA 5KHJA 2FZ1A 1XXNA 3WP4A 4ZS3A 5IK5A 5FTTC 3ZYGA 1UCXA 1FPN3 3DPRA 3U11A 2RR13 5LBFA 1W9WA 1Q8QA 3IPVA 3AK0A 4Y1VA 4ASLA 4QDQA 4XQWA 3CKHA 1CWPA 4JRLA 3WZ1A 5JXGA 1N3OA 3VKFC 1X36A 4AVCA 3GYDA 2Y6KA 1AL0G 1PX3A 1JZ8A 1APNA 3KV6A 2WS93 2EAKA 4ZXKA 3J8F2 3I2KA 5CVRA 3VD5A 3ZSKA 4MVTA 4W6YA 4AEKA 1W3XA 5TSWA 3AZZA 4JGZA 4HL0A 1PO22 3RI8A 3ZIXA 4CDUC 5CAZA 4GJZA 2JG8A 1CN1A 2WDBA 4WVZA 2D40A 2X29A 5FXVA 1YNAA 2BNMA 1LU2A 2WRAA 1ASJ2 3WW3A 4UI9L 2E51A 5CEHA 3D3AA 1VBE2 3ACGA 4YLZA 2Q30A 3OD0A 3HNYM 2JECA 4JGYA 4WM8A 5I0TA 2PLV3 3RJ2X 1JZ7A 3APBA 4LT5A 2G9FA 4UWDA 1MR5A 3VBUB 5AVAA 3PU3A 4YG0A 3T4HB 2QQWA 3LIGA 2GC2A 4NWVA 2DU0A 5A7WA 1RXFA 3N7MA 1CJPA 1FOD2 3JD71 2YGLA 3K48A 5FQ0A 3AKRA 3NNMA 4KQ7A 2HLEA 1B09A 2VG9A 5BNNA 3PUQA 5FO9B 4LO7A 3OBRA 2XLFA 1POV1 2WQ8A 2O1QA 4XZPA 5LBCA 1QXRA 3MEPA 1T2XA 2JEMA 2RM21 3ZFGA 5ANNA 1UOBA 1RUH2 2JDUA 4LO6B 3E97A 4QGNA 3ZSLA 2NQYA 3LDKA 5IVJA 3OGJA 1FMD2 1LEDA 5CISA 4YW2A 1NQDA 5BXXA 3C2UA 4R4XA 5IHRA 3LPGA 4TXWA 1CJDA 2WN3A 4Q27A 3MBWA 1OF4A 5D2AA 4CCCA 2CDOA 2D3PA 1PX4A 5DUWA 1VBB3 3AP9A 3LSDA 3E5UA 3TB0A 5IYYA 1RL3A 4MXWB 2YC2A 2WNUA 4XQ4A 4FFGA 4YG3A 1NOVA 1S1AA 4PI2A 4RHV2 5F3GA 1US2A 3ES4A 2XLAA 2Y6GA 1CD3G 1CAUB 2ORZA 4QPIB 4Y20A 4WVMA 1WMXA 3AP4A 5FPAA 1O59A 3BGAA 3WNNA 1BK0A 2VZ1A 1RMU1 1XNBA 5FZFA 1EV12 4NMIA 1MEC2 3VKOA 5IT6A 4PI0A 1AXYA 4UW6A 2YC0A 3IB3A 4N43C 4CDQB 3JB4C 1PK6C 1SFPA 3ETPA 3JXSA 4MGIE 4OULA 4LBOA 5FFOC 2CTVA 1COV1 2R1BA 5J37A 1RUD3 3AZXA 1JMUB 3OCPA 2JWPA 2ENRA 2JD9A 3ZFFA 1CX4A 1LCLA 3DYMA 5EYXA 3RYPA 1WLTA 3U07A 1UNBA 1VLNA 3KF5A 2A7AA 5FLJA 1MS3A 5DQ0A 2XPJA 1GZ9A 4LO8A 2ATFA 2VZRA 2Z69A 1EAH2 4AK3A 4AHWA 2VL4A 4EV0A 3X29B 2PHDA 2DCZA 1SACA 5HI0A 1MS5A 2WAOA 1ASJ1 3HVDA 4O65A 3ZYHA 4AFAA 3DPRC 2VC9A 2QQLA 3HT2A 2A6VA 1OLME 5F32A 1X33A 3JQWA 4BISA 3KCCA 2GH2A 4XUQA 2BNOA 3H7JA 5FPLA 1XE8A 3B02A 1RUF1 3M4FA 4LUMA 1ZBA3 5J7MA 3IT8A 4PHZA 1Z0HA 4ORFA 1FOD1 4AI3A 3LGRA 4LQRA 2GN3A 2WFF3 4QPGC 2JG8C 4KBZA 2DVFA 3TYJA 1KEXA 2GC0A 3H3LA 5JAXA 5LZ6A 4OMCA 4ZU5A 4OLLA 4AVVA 1ZBE2 3GHNA 2PAKA 4MGYE 3D0SA 3R4UA 1ZZ9A 5DABA 4CCEA 4EZ4A 4W6XA 5FP8A 2BJSA 1JXNA 3AM2A 5I8SA 4B1MA 5A3TA 1G9AA 2WZR1 3GBFA 4N7UA 1XQNA 5APAA 3PMSA 4WM8C 4RGKA 2W52A 4JGYC 4QWNA 4E4ZA 1FMD1 4CUCA 4QX2A 5FR3A 4OHYA 4FI9A 5DN2A 1GQPA 4A45A 2W87A 1TZOA 4QXBA 3CQOA 4YM3A 1VRH2 1VALA 5FXWA 5FV3A 1I6XA 3C3VA 3EHKA 1QDCA 2A6WA 2C4XA 2VMDA 3M1HA 3S0MA 2IZWA 1C8M3 4EN8B 4Q8LA 4HSJA 5BNNC 1GU3A 2XJVA 3N7JA 4RHV1 1XU2A 3WNLA 1W6MB 5IVVA 2Y34A 3N9MA 3W5MA 4W50A 3LA7A 2OIIA 3VDBA 1DIWA 1UOGA 3BI3A 1UMZA 3KT4A 4P14A 1AR72 1W8ZA 4TSVA 4JDNA 3ZFGC 4GB32 4HN1A 5LK5A 5BNOB 4V1PA 4Q4X3 3FL7A 5AFEA 2B8MA 1EV11 1LJ7A 2BU9A 4IV3A 2DCKA 1MEC1 3IAPA 2ZBJA 2JE9A 4OYUA 2SBAA 3VBUA 1AR92 5T5JA 1NKGA 4ZS2A 2CWSA 3TEWA 4LIUA 4AOCA 2PMWB 3WW4A 2XMLA 2FQPA 3JQXA 4N7IA 3NJZA 3IN9A 3I59A 4YZ5A 3G6JB 5GZCA 4N53A 1HRV2 3WG4A 4AI8A 1KS5A 3IZOA 1CAXB 1V70A 5A7QA 2GU9A 2ZACA 4GULA 1UYZA 4JTNA 2PAEA 2VCMA 2YC4A 3WHUA 4PF5A 3NNGA 4UYBA 1EAH1 4LO5B 5F3EA 3WVJA 4EJRA 4JAAA 2QQKA 2A1XA 1BVVA 1JOBA 2RDRA 2NZ9A 5FK8A 5GLUA 4RGGA 1LGCA 1WCSA 2R7EB 1ND3C 4LITA 3JD73 3VZJA 4A7ZA 1ZX5A 1YQ8A 1YQ5A 3CU7A 2JKXA 1FXZA 3OYWA 4HSLA 4R4ZA 4L9BA 3C7OA 2RDSA 4U2AA 1X82A 5HCBA 4COVA 1POV3 5A33B 5CNAA 1O5LA 1WCUA 1PMIA 3VDDA 2DUPA 1QIQA 1XBFA 1XE0A 4LA3A 3ZSJA 2RM23 4CU9A 3SCGA 2BWAA 3VD9A 3HBKA 4TZDA 3ZFFC 3FC0A 2WSVA 4J25A 3BVCA 4B7KA 3MICA 4JKLA 2EA7A 5DXDA 4WBBA 4CRQA 3D4KA 4NPRA 5CADA 4M0HA 3ZR5A 3WDTA 4KWJA 3AVRA 1ZBE1 1DYPA 2HWB2 2VY0A 4QPWA 3USUB 1HB4A 1WLDA 1DU3D 3I3DA 3R4SA 4LK6A 4D7YA 4AI9A 5D1IA 5C4WB 3VDAA 3VZNA 4BYYA 1RXGA 2W46A 4CU8A 4F7ZA 4RD7A 1HXS2 3GALA 2P3JA 2F17A 2YMZA 3C8XA 4LBQB 3S7IA 2FCTA 2LTNA 4AI0A 2BUKA 2FDKA 1RUC1 3OEBA 1E5HA 1LGBA 2ZXQA 1IOAA 1X8MA 3K4ZA 4NRQA 4WV8A 5FYZA 4K21A 5F3IA 1C1FA 1NCQB 4KBBA 4FP2A 2TUNA 3VBOA 1OI6A 3AP7A 2EIEA 2ZGRA 4IE7A 2DTWA 3IIIA 3PUSA 2H6CA 3OB8A 3A0KA 2I07B 4HG6B 2J1AA 5HV4A 1OMIA 3J8F3 1AR71 2ZGOA 3IWZA 1XOYA 3ZPOA 4MADA 1LHUA 1YI9A 1DZQA 4XBNA 1PO23 4JCKA 2Y60A 3RYKA 2B45X 1DQ6A 3TEXA 5JXJA 3QH6A 1DGLA 1AR91 4LKFA 3GHMA 1Q5OA 1SLBA 5M0TA 4AAXA 4IGQA 4FPFA 2ZMKA 1GNHA 4QX8A 1ASJ3 3WF0A 3O1VA 3N3HA 4MX3A 4RA0A 1VBE3 1YXWA 3MW4A 1HRV1 3ZYBA 4HLTA 4XTMA 1ZRRA 3HQUA 2HWF2 1WW5A 2JE8A 4LOSA 3H0OA 4I02A 3VZLA 4XEZA 2GAUA 2OZJA 5D8AB 2AUYA 1W9YA 4Q0VA 4Y22B 2ARAA 2XR4A 4GWMA 5FUNA 4KWKA 1AVBA 1UU6A 4NPMA 1AR62 4YWAA 1HB3A 1N3PA 3AFGA 4LHLA 5F5CA 1S4CA 3K46A 1K12A 2XVGA 1C5IA 4NO4A 4UXAA 3VBUC 4KNCA 4BMEA 4DRVA 1AYM3 3O0VA 4A7KA 2J1VA 2WUHA 5FYMA 4IESA 1O4YA 1OVSA 1RUI2 4J1WA 3HNBM 1RUH3 2PQSA 4M4PA 2VUCA 1MS0A 1O4TA 4PF1A 3I3BA 2AENA 2GNMA 1BVP1 1FMD3 5A32A 4MGSA 1J1TA 3ST7A 4AGRA 1UWWA 5CZKA 5HXVA 2Q8CA 3KS7A 2E63A 2WO3A 3NAPA 2WZ8A 1JYWA 1EP0A 2JIJA 3BOPA 5FY5A 4K7JA 4UT5A 5H9RA 1LHWA 5EQUA 1RYYA 4XXAA 3FUOA 4RHV3 3MUZ1 4XF1A 4ASMB 1IS4A 2HYXA 3GZAA 4OHXA 5JWPA 3ZYJB 2VTXA 3FE5A 1W2NA 2VOXA 1F31A 4FPOB 1BLZA 3TN92 4RS5A 3NQHA 2WABA 1XB9A 4B8EA 1W0NA 1EV13 3HMYA 1MEC3 1ZVFA 1CAXA 1YC61 5FYYA 5IATA 3AP6A 1OFNA 2GSYA 3WF1A 2WSUA 2JENA 2YB7A 1HJGA 2JDNA 4FFIA 2ET1A 4MSVA 5FYHA 3IDBB 1OFSA 1Y3TA 1O3RA 5LRRA 4LBJA 2Q1ZB 2EXIA 4OQ9A 3RNSA 3ACLA 3RSJA 3T0AA 1VPHA 1QU0A 3MHZA 5B4XA 2BP6A 4OVEA 1JZ2A 3D6EA 1N1YA 3QD6A 5FZBA 5JI7A 5A3UA 5LATA 4XBLA 5JSOA 3J4UH 2FMYA 2W91A 3OGRA 4N9IA 4CDQC 1EAH3 1HDKA 2QKDA 4NPLA 4YM0A 5DG2A 1UZWA 3SEEA 1JYNA 1HN0A 4P5YA 4HVRA 4F83A 3HAGA 2XJPA 1G6NA 1MVQA 1PGW1 2W9XA 4LULA 2XKPA 5BNPB 4DUWA 1SLTA 2W3JA 3B9IA 4YM2A 2W95A 1NQJA 4G3YC 5E1RA 5J48A 3QCWA 2J7MA 2YGMA 3VBOC 3IDEA 5CBLA 4AZZA 2FMDA 1UF2C 5FUIA 3VGIA 1JS9A 1SHWB 3PURA 4UBHA 4AE2A 2KD7A 5FMBA 3WQ1A 5DAXA 4XFGA 1JZ3A 5FYTA 5F5AA 1F5JA 1ULGA 4MGQA 5L7OA 1GFF2 2VW2A 3ORJA 1D4VB 5FLIA 2GALA 4CP1A 2YXSA 2B39A 2QZ2A 1NE4A 1IQAA 2AH2A 4N43B 4BQ1A 1E57A 3CDZB 1GP5A 1ZBE3 1OD5A 3OPZA 4M4RA 5FXXA 2OUHA 2ZA9A 5DDJ2 5F6LB 1ODMA 1N1VA 3AP5A 4C0HA 1RUI1 3D82A 3KV5A 4MGZE 3KT7A 3OUHA 3GJAA 3LOIA 2E7QA 1NCQA 1JHNA 3C7FA 2WWSA 5DUUA 4GMP0 2V5YA 1WCQA 2CNAA 2OT7A 4ZU7A 3JZVA 1BEV2 4P9IA 4HPKB 2AEZA 1VRH3 3MW3A 3ILFA 1GUIA 5FZCA 3SEPA 3PHMA 4QD2A 1G9CA 1KDKA 1W6PA 1R082 2A6YA 5H9QA 1XJAA 5C8CA 2WR9A 2QQIA 3IPVB 5GKAC 2JD4A 3CJXA 1GYKA 3N9OA 4LK7A 3MPBA 4K3UA 3B00A 1O8SA 4CU7A 3PTRB 1V6NA 3OUIA 3TN91 1LENA 1FV3A 3BTYA 1IKQA 1AR73 3C7EA 4Z2WA 4GB33 1TQ5A 2DU1A 2Y6LA 1PVC2 4K8FA 5FXZA 2Z5WA 3DN7A 4YARA 4ZKTB 2JG9A 4HKWA 2J42A 2G1MA 2DFBA 1AR93 3M2MA 2PHFA 4JGZB 4V2WA 1M06G 5CYYA 1Q8VA 2JG8B 2ZHMA 3NAPC 3W59A 4RQPA 3FFQA 4YW3A 1KFXL 5EP9A 4FO9A 1Y9GA 4EWEA 1OA4A 2ZKNA 4AWDA 1NA1A 1VMHA 2YROA 3NO8A 1HRV3 1N3QA 2GP5A 3EJKA 1KQRA 2RS12 2GN7A 1CAWB 3DUIA 4IDZA 5BNOC 3O1TA 1NXD1 2AREA 2XJRA 1K5MA 1H4GA 4WM8B 4JGYB 4RFRB 2A6ZA 4QXKA 4WVVA 5FZ8A 3WLUA 4P9XA 2PHTA 2JDPA 3VZMA 2P17A 3UETA 3WNXA 2PXJA 3UL2A 4RS5C 3IAQA 1LOGA 5ISLA 1UZ0A 1POQA 5FMOS 5A7WB 4BQYA 1CPMA 1QNWA 4E4HA 3OBTA 3H8OA 2Y26A 4XILA 3D8CA 3BN6A 1H30A 5FQ0B 2W1SA 4IGPA 4MHUA 3WHTA 2VUJA 4CCKA 5BNNB 3HBZA 2C9KA 2BGCA 2O8QA 3SH4A 3BU7A 4H7LA 3B3QE 5D21A 3ACFA 5IK4A 2VBPA 1T6GC 3KB5A 4L11A 3RQ0A 1OH3A 1YO8A 2QDRA 3RYRA 3ZFGB 4UFHA 4OI2A 2DYCA 1BYHA 4NRPA 1HB2A 4B3NA 2W39A 3I2DA 1EPZA 3GBWA 4GA9A 5DAQA 2FZ2A 1YIPA 1KXGA 1AJOA 3AJYA 1QXJA 3G7DA 4BQ4A 2HWB3 3OEAA 3JCIA 1RVF1 3GCXA 1RTVA 1O5UA 1H2LA 5DDJ1 4YVWA 2V4VA 4LBKA 1E5SA 3GBGA 1Y7BA 1ACCA 2BVBA 4FAGA 1HXS3 2WNUB 1W9TA 2D97A 4XJUA 5FJKA 5IVCA 5FMDA 2E33A 3AKQA 3DF0A 4BXSV 3RFRA 2JDHA 5L36A 1G9DA 5FMOL 4CU6A 4MHRA 4Y20B 4WVMB 2VNVA 4ZXEA 4GJYA 3AZWA 2IXCA 5BYNA 4KH9A 3VB9A 1EUUA 4Q26A 3MFCA 1DQ1A 1NLRA 2H0BA 3UESA 4GWNA 1DGWX 1H9WA 4GMP3 4NE9A 3AMHA 5IVBA 5L7OC 1R081 3RZHA 1MVEA 5LB6A 3E6DA 1GKBA 5FPUA 2Y8KA 3O5SA 2AC1A 5GLWA 1D4M2 1PIV1 3WT3A 1LTEA 3PNAA 2HH9A 1RGSA 1W3VA 1W8FA 4LKEA 4Q4W1 2VXRA 4D8MA 2A3WA 2VZOA 3WCSA 2X09A 1FNYA 1PVC1 3VBSA 3ZFFB 2XB6C 5ANQA 1ENXA 4AG4A 1NCQC 4E4DX 1O3TA 1R091 1YHFA 1YQ6A 1LHVA 2R1DA 3EQEA 3LWCA 2Q4SA 1AX1A 5FPVA 5KHKA 1J84A 1I3HA 3HN3A 4DEVA 5KHHA 2KXLA 5KBFA 5DPNA 1TMF2 1HQWA 4GKXA 1WMEA 4K6BA 2PHXA 1V6KA 4XBQA 4XVHA 4CDXA 2RS11 4EN7B 3LSEA 1TME2 3K4AA 4FQ4A 3O1PA 2HWF3 2YU2A 1R1ZA 2BV4A 4CCDA 1QJY2 3KD4A 5C8CC 5CG9A 4XMIA 5A3NA 1UX7A 2W1WA 5J36A 1UKGA 3URFA 1ULOA 2YU1A 2A71A 3A0NA 1RUE3 2XWBB 5K9YA 1V6JA 3KCYA 1GOGA 4XJZA 4XMAA 5FY1A 5KHIA 4MH0E 1DG6A 1AR63 3KMHA 3NKTA 3Q8CA 2VZUA 2WLQA 1K45A 3AYDA 4LE4A 3UJOA 1DDLA 2R49A 1JYIA 2LM3A 2QTWB 5L9RA 4FPYA 3FBYA 3LAGA 4Y26A 3L9JT 2YBKA 1TE1B 5DUVA 3NRUA 1AXZA 1RUI3 3PVNA 4GKYA 4JX0A 4MO3M 5D8AC 3KGLA 3UJQA 2WC2A 1LULA 1RMU2 2EXHA 2JE7A 3E5XA 3NVCA 4J6GA 2D93A 4P08A 1AL22 1K5MC 3IDAA 3H50A 3O1UA 5LY1A 5A70A 5BUVA 3ON7A 4QX5A 2QQUA 1W8UA 5EFUA 5IVFA 2FDIA 2UURA 1COV2 3T3YA 4GH4A 4Y5Z0 1KRIA 1WMFA 1YRZA 4CPBD 4OI1A 3TEZA 1R1A2 4P9YA 2WJSA 4BCUA 2J1UA 5A3OA 2C9AA 3FMGA 3T2PA 3RZLA 3MIDA 3U78A 2NP0A 3ATGA 4XIKA 2VM9A 3IMMA 3SCFA 3TN93 2RMU2 4JV4A 3ZFEB 3LDBA 4XHXA 1VRBA 5KC6A 5LK7B 1VBD2 4HMZA 2IFWA 1HRI2 2VGDA 2WZEA 3I3QA 2NMNA 1UZVA 3NSTA 1QJU2 2GP3A 1CAWA 2BFUS 4RFT0 5FZ7A 1OQDA 1Q8OA 2C1FA 2R072 4IV3B 4IE4A 4FFFA 5C3QA 1I9RA 4OQ8A 2VU9A 4V2VA 3EB7A 4LHKA 3O14A 3M3IA 5G05L 1D4M1 1J58A 4LR4A 2X5IA 4PQ9A 5FIXA 1H4HA 4H14A 2B9UA 3I2IA 2HWD1 4GAZA 2DUOA 3WNKA 4YVWC 4AQTA 4EN6B 1RUF2 1DYOA 2RG4A 2XLGA 1OF3A 3I59B 4AHYA 4DB5A 5A1AA 1VBA2 4N53B 3KHCA 4KWLA 4Q1RA 2YBPA 2EIBA 4AGGA 5ACA2 1UIJA 4XURA 4BZ4A 4BE3A 1WZXA 2CAVA 4Z82A 3UYJA 2ZX2A 4O7XA 4CCOA 3WDXA 1BK1A 1X9TA 1TMF1 5GALA 5FYBA 2B46X 1ODNA 4HN0A 4NHXA 1UPSA 2W92A 4AFDA 4R9BA 3H1YA 2WZR2 1TME1 5FZGA 3OYWB 1QJY1 3VHOA 3O7OA 2ZGNA 3WX5A 2XHNA 3VDDB 4NIGA 1U5ZA 2WKKA 1UKRA 2BFUL 1B35A 4P9WA 2BYVE 4FOQA 2UWAA 3OGVA 5BNPC 5I93A 3OPWA 2ZGMA 4BXFA 4CXXA 3VBFA 3E5QA 4O9GA 1ZZ6A 4OUEA 2RS51 4O61A 1IPSA 4FCAA 1OUXA 1L7QA 4Q0QA 4H3WA 4OMDA 3ABZA 4DEQA 3NV1A 2DBNA 1C1LA 1RUG2 1RHI2 2DCTA 4XJAA 1FX5A 1SCSA 1W6QA 4PLOA 5JOXA 5FRAA 3ZOIA 3CNAA 3LB9A 1UYXA 4CDXC 4AVAA 1GZTA 4AXOA 4YZ3A 5LA9A 1AL21 1TNRA 3I3EA 2WINB 4GXLA 4YM1A 1A8DA 2RJLA 3AC0A 1QEXA 3SHRA 4UFIA 2MNGA 1BEV3 3POFA 3BPZA 1Y9MA 1G9BA 2IUWA 1Q8PA 5FY7A 1CZVA 3WCRA 3KQRA 4NUBA 3VLBB 1W06A 2RHPA 2VVEA 2VVDA 4FOWA 5JZGA 3I2FA 1Z7S1 1E5RA 2X8KA 2F4LA 2YG0A 3NWKA 5KXDA 3VKNA 1R083 2ZX3A 4QGLA 1R1A1 3OSDA 3GJBA 4JDMA 3SH3A 4PIZA 3WG3A 3N36A 2IXIA 3VBOB 2Q1FA 4FP3A 4XPVA 2VZTA 1QJZA 2RMU1 1J83A 4E2SA 4YFZA 5JOYA 1POV0 2Y6FA 4W65A 1VBD1 1JU4A 1HRI1 1PVC3 2XL9A 4LBQD 3V0BA 1QJU1 1DZTA 4MYEA 2R071 2P2KA 4XYXA 1NLQA 2WNOA 1I5ZA 1NZIA 5DZGA 1GBGA 5CG8A 2Q8EA 4GH4C 4AYUA 1GZWA 4UOJA 5AC92 1RUJ2 1YCIA 4NHYA 1UD1A 1H9PA 2XBO2 4NIDA 2RS13 1YFXA 4XFAA 1QOOA 3GNEA 1PZ9A 5C33A 1VBA1 1ZZBA 2VOVA 2GNDA 4QX3A 4XFIA 4QMAA 3WP3A 4BK4A 1UQXA 3VD7A 1BBT2 3RRDA 4FPCA 4JGZC 5FZ6A 5ACA1 4X8NA 2OX0A 1X9PA 5FKCA 3FLTA 5EWSA 1URXA 4E8DA 4HVOA 4ET7A 2VZSA 3P1IA 4GQ7A 4X6RB 1IHMA 4BQ5A 3ZN4A 2CU5A 4XABA 3N7LA 2Q1MA 2QUOA 5JPMB 4ZHNA 2O8OA 3VL9A 3H3UA 2I2SA 4WZFA 3WR0A 1FAYA 2FDFA 3QLQA 2X5IC 3K77A 4XACA 5I0UA 1QMJA 1HX6A 1XNCA 2D7FA 1UZYA 1RUC2 2EAAA 4FPLA 4XUNA 3NJVA 1LAJA 3RI9A 4IEZA 3HR9A 5A32B 2OPWA 1DQ0A 3MYXA 2O14A 4D69A 1BCXA 2J22A 2PN5A 4M0NA 1KITA 4JZRA 4QQLA 5F7UA 3ZFEA 3K3NA 3NAPB 1O8PA 2YFZA 4Y1UA 3CEWA 5LY2A 1RUG1 1RHI1 4N9HA 3ZYIB 3VBHA 5C5UA 1QXPA 1IKPA 4TLGA 1W8NA 1UPIA 4CEYA 1ZRFA 2FCUA 1TG7A 1A8MA 1OLMA 4P5HA 4AL9A 3WUCA 2WL1A 5FY0A 1DYKA 1YQCA 1QJFA 4LPLA 3TAYA 4CUAA 2ZAHA 3KVAA 1OKQA 1JOPA 1W2OA 2VZ3A 3NW4A 4N90A 3SQOA 4RS5B 1B35C 1DQ2A 1H8TA 1JUIA 2ZHKA 3FHIB 1WLWA 3WDUA 2BPA2 2GNTA 2PAMA 3ZXLA 2WNUC 3VBFC 2V73A 1UW8A 2R061 3THTA 4LTAA 3NNLA 2A70A 2DCYA 4Q4Y2 1LRHA 1D4M3 3S57A 3CLPA 1JYTA 4FPJA 5HV0A 4A6SA 4AEJA 3AB0A 1S0FA 5JSPA 2JDAA 4QX0A 4JKMA 4UF0A 3B93A 2VMIA 3WQBA 2QFEA 4FVVA 5FP9A 1SDDB 4E9KA 1W8HA 4RGAA 4QAWA 3H8XA 4NROA 4UFKA 2IWGB 2XJTA 4B4PA 2EVXA 3IKWA 2B7YA 4JDOA 1TMF3 3C7HA 4BDVB 2C5DA 3VD3A 5FZOB 1WD3A 2W1UA 5FZHA 3MDPA 3TRSB 1FATA 1SLIA 5T5PA 5AC91 1RUJ1 2V09A 3ILRA 5JVVA 2XBO1 2ADDA 1QJX2 1TME3 2B9VA 5FZEA 2UY9A 1CQ9A 1QJY3 3L2YA 1W8TA 5C9AA 3AFKA 4DNYA 1BBT1 3POSA 2O0OA 4BPZA 3N4MA 4QB2A 2P1BA 4HK9A 4NAMA 1BMV2 2TNFA 3KCXA 2ZGPA 3SITA 2GDFA 1N47A 1J3PA 1UOFA 2BQPA 1WA4A 4AQ6A 5A3PA 5LCWL 5L73A 3VHRA 4TWTA 3NV4A 3SKJE 1M4WA 4HXCA 4A6OA 5A6ZA 1PVXA 5L7OB 1C5HA 1HV1A 2C24A 3ZN5A 2WFPA 3B01A 3OBAA 1O4ZA 2ZEZA 4QXCA 3ZPYA 4AHXA 5LEJA 5DAWA 1LU1A 4OFGA 1CESA 1XNTA 2OQ6A 2UYAA 3IMNA 4QM9A 3WUDA 1BKZA 3KSCA 3OOXA 2R0FA 4IL7A 3I4IA 3UK9A 3BTXA 2WWUA 3KQ4B 1MPXA 1RMU3 3AZVA 5K7PA 1YYNA 1AL23 4LUKA 5DG1A 4Z8BA 4QKBA 5T5OA 5T55A 4LLOA 4LO4B 2JB4A 1VAKA 2ARBA 4IEWA 4YGCA 4AHZA 1COV3 5JPNB 5KXEA 3T09A 4NJ4A 2E9QA 1MQTA 2PFWA 4I09A 1A78A 4IUGA 1F2NA 4D3WA 1A3KA 2VCBA 2XGXA 3ZDVA 1R1A3 3WSOA 1BZWA 4LMFA 1OPMA 1W6PB 3QOPA 5K4LA 5C8CB 2F6BA 4PT6A 2RMU3 1JZ4A 3UGFA 1GR3A 3CIHA 3MUY1 4XFCA 3VV1A 1SQ4A 1VBD3 1EY2A 1HRI3 2FDHA 4LJHA 1PGW2 1QJU3 1OOPA 3PJQA 4YZ4A 5E88A 4C8DA 3OY8A 4D6SA 1N1TA 2J1SA 4URAA 3BUCA 1CAVA 2R073 5DZEA 3ME2A 2JG9B 4LE3A 5FLHA 3U75A 3ASIA 4D7SA 4HZFA 4Q4Y1 3KHBA 1V6MA 5FO7B 4B7EA 3ZFEC 4BQWA 4RQPB 1SG3A 1JHJA 1WMDA 3HWJA 3MO4A 1RUF3 3I2HA 4Y4YA 3RMXA 1ULDA 2Q8DA 3WW2A 4JHTA 1NA1B 4OUSA 1VBA3 5GLTA 1FOD3 1DGWA 1XNKA 1XYNA 4IV3C 5ACA3 2D6KA 1K5MB 3SKVA 1W05A 1NY72 2ZGKA 1GNZA 3TEYA 2K9ZA 1W6NA 3HNMA 5FO8B 1LNSA 3I54A 2LROA 1GOFA 2L9LA 3JBG2 4XC9A 2GMPA 2HWC2 1J1LA 2OYZA 4W4ZA 4NIHA 1LHOA 5BV6A 3MZHA 2WZR3 1QJX1 4N53C 2C6SA 2RJKA 3M3QA 4R9DA 3F2ZA 2X05A 1V00A 3TOJA 5HPOA 4BOWA 3LEGA 5FZMA 3ZR6A 1OLQA 1UU4A 5IVYA 4NHLA 4FOYA 3V0AB 3DXTA 5LRSA 1ST8A 3OD4A 5JDBA 3J7NA 2UY8A 4I0AA 2TBVA 1BMV1 3GDBA 1H1AA 4IETA 2QBXA 5F1RA 2KR2A 2BEOA 2DFCA 2Y38A 3NMBA 3RZKA 4CA9A 3PVOA 4UW4A 1S0CA 2BOJA 4J1XA 1W39A 3H1WA 3VDDC 2Q0AA 1DCSA 1W28A 2IFRA 4L97A 1H6XA 1RHI3 2YBSA 2K2SA 1C4RA 1OXCA 2VECA 4MXVA 4ISQA 4GIQA 5SV8A 3LEMA 3KLSA 4YVWB 3KM5A 5FZ4A 4AEDA 1VMFA 2CY6A 2W5FA 3SISA 3ACHA 4EE2A 1N1SA 1IG0A 1OPOA 2XJQA 3I3MA 3I2OA 5T5LA 1O3SA 5F9TA 5IK8A 2WNVA 2LALA 3GXUA 3ROUA 2P5BA 3ZMOA 3ZM8A 1ZA7A 2D5HA 2BGPA 5I91A 4IERA 4Y1XA 1QWRA 5JR2A 2CHHA
chains in the Genus database with same CATH topology
2HWE2 3WG1A 1VB4A 1WBLA 2XWJB 4BLIA 4C0BA 1JBCA 2BTVC 3S30A 4U36A 2OPKA 4IXLA 4RR3A 2ZABA 5GLZA 4QM8A 4M3CF 1AR82 4K9SA 3L2HA 3VBSB 1DQ5A 4L2NA 2D6OX 4BA6A 1S2BA 3VBRA 1MACA 5AC93 1MQTC 1RUJ3 3MIEA 2XBO3 3RZZA 3M3CA 3FUQA 2JX9A 4AI2A 4XFBA 4CDXB 1BBT3 2ZGTA 2Y0IA 3LZZA 1V6IA 1NY71 4BM8A 3PVBB 3PMEA 1Q56A 5JMCA 1RVF2 3JBG1 2HWC1 2DCJA 1OOPC 1W0OA 2VMGA 4QGMA 2HJIA 2XJUA 4BWOA 1NZCA 1CIWA 1YLLA 3ZVXA 1QOTA 3USSA 3M70A 3NL1A 3DKWA 2BVVA 1FT9A 1QH6A 3ZX7A 1RUC3 1V9U2 1MS8A 2GMMA 2YYOA 4AF9A 5KXCA 1ENRA 4CEWA 1ZREA 5FDBA 3J26N 4L92A 1QDOA 4QT6A 5JR7B 2BBVA 1H2KA 4CYDA 4R9AA 1PIV2 3V65A 3MW2A 3AJZA 3BB6A 3WV6A 5E8AA 4GH4B 4PLNA 4XJ9A 1C8NA 1FPN1 4Q4W2 3ZMNA 2DF7A 3LKJA 3ILNA 4YRDA 1D2SA 2N7GA 1W6OA 3CJIB 4AVSA 3N35A 2QQPA 1R092 1SLLA 1J59A 4Q4V2 1CR7A 1HV0A 1RJ8A 2VOKA 2WZPP 1PZ7A 4JC1A 4AFMA 1TEIA 1RJ7A 3VUOA 2HWE1 3H9AA 4X6QB 2ERFA 4MZUA 3LCPA 4I0WB 4YGBA 1IS3A 3NV3A 4JTOA 3IM0A 4XQDA 5T54A 4SLIA 4Q4Y3 4AFCA 1X7NA 3V64A 1NCRA 4IQPA 2X5IB 4LEJA 5BPXA 1LOCA 1DHKB 2PA7A 4HKLA 1AR81 2PLV1 5J98B 4AGVA 3TBDA 5I0RA 3FFZA 1X50A 4QQHA 3BTAA 5CFDA 5FPXA 1UX6A 3V0AA 1MZ5A 4IV1A 1W2UA 2ZTNA 3O0XA 1DZRA 1NE6A 1SBDA 5JSRA 2W68A 1RUNA 3ETQA 2ZGLA 1QJX3 3AKPA 4OHVA 4XJ8A 4YGEA 5F6KA 1QF3A 2ES3A 4HFSA 4XTPA 1JN2P 2VOWA 5GJ6A 4NR1A 4RR3C 1UIKA 2CV6A 1GZCA 1B35B 2A73B 4WM7B 1RITA 4AVBA 3VBFB 4M00A 4Z1VA 1C28A 2K0GA 1JTZX 2JJ6A 5ABJA 2HYKA 1EPWA 3VBRC 4QHBA 4D7TA 2NPIA 3R4DB 1V9U1 2PHRA 1C8M2 1W6QB 3WQ0A 3FLRA 3ZXEA 1U0AA 1SCRA 1ULEA 3MPPG 4YFWA 1AHSA 1XE7A 1ALYA 4COWA 4JQRA 4QQOA 2WQZC 2HWD2 2GH8A 5JZGB 2R32A 3ZSEA 4AW7A 3PTYA 3MIHA 2PELA 4OZXA 1REFA 3KGZA 1L3JA 2R16A 4Q4V1 2G9GA 1ZA4A 2ZX0A 2HEVF 1DBNA 1H1IA 3M7AA 4DY5A 2D5FA 2UWCA 3ZYRA 3V0BB 4YW5A 2NN8A 3WOGA 4P9GA 4CEWC 2VULA 3POYA 1XNDA 1LR5A 5FPZA 5DUXA 2OZ6A 3KT1A 3WW1A 4FPKA 4HANA 1Q3EA 1REEA 1WCDJ 4XIOA 4HT1T 3ZXDA 1GZWB 2CGPA 4ISRA 4XHBA 4YVSA 2E7AA 4LBMA 1H2NA 3HQXA 1S55A 2JG9C 2CL2A 2RS52 1LKNA 2YDEA 1RINA 3EO6A 3AMQA 4P9LA 4R52A 3JBG3 3OF1A 2HWC3 1ZBA1 4RQPC 1U5IA 3OTFA 4FAHA 5AVPA 1QOSA 1NA1C 1YIFA 5J96B 4F3JA 1PK6A 2VUAA 4FTBA 1F8VA 3AMPA 4HK8A 1UU5A 5FOJB 1H0BA 1OSGA 2QZ3A 3BIWE 4XF4A 4Q0PA 3Q9OA 4D94A 1NCRC 1YJLA 5E89A 4K20A 5EV7A 1JW6A 2ZS6B 1Z7S2 4Q0UA 1DGRN 2UWBA 3CJIA 1SFNA 2AGSA 1SFYA 1AX2A 1Q8SA 1S0IA 1Y43B 5GZEA 1DQ4A 1S0GA 2UYBA 3V56A 5CFDC 2CGNA 2NM1A 4IV1C 4HKOA 5HCAA 3B94A 1DFQA 1LHNA 5A3MA 4FBFA 1C8M1 2MPFA 2SLIA 3VBHB 1LECA 4C1WA 2XKOA 4O9EA 3JB8A 4CEYB 3JU9A 3DGTA 3AMMA 1VB2A 1I1EA 3I8TA 4XFFA 2VQ0A 4M3CE 1MZFA 2IXKA 4K1ZA 1ZRCA 2HWE3 1QQP2 1Y9QA 2MEV2 4Q4X1 5EZWA 3A4UA 5K0UA 1H8TB 5J3UA 4QPGA 3VL8A 2VW0A 1WD4A 1LB2A 3MF6A 2R0HA 2GC3A 2WT1A 4IEYA 4DPNA 5ABJC 1S0DA 4QPYA 2E7TA 3WP5A 2ZGQA 2AR6A 5EYYA 4DY3A 2QNKA 2AZ5A 3FZ3A 3RPQA 1AR83 1CGPA 3MLKA 1SBEA 4FTSA 5I0SA 3AMNA 1Q43A 3M3EA 1ZYBA 4XF9A 1ENSA 5C8WA 2OW4A 1VBC2 2DVAA 2D98A 2R042 4Q0SA 3B9CA 4WM7A 5FCCA 4BIOA 3VBSC 4PBPA 5IUQA 3D5OA 2ZX1A 4Z07A 5C6CA 1AYM2 4XXPA 2QDNA 4XE9A 5C9AB 2D44A 1GANA 3P3PA 2WA4A 3ZXFA 1OQEA 2XUMA 4SBVA 1RVF3 3ZXKA 3EBRA 5DDJ3 2DVDA 3IDCB 5BNQA 4HETA 3B5LB 3PVEA 1LOEA 1LOFA 2XVKA 4BIFA 4C1XA 4Q8KA 3SXWA 5AFBA 1V6LA 3AXEA 1VAVA 4M3CA 1WCKA 5GM0A 4NHKA 3SMHA 2WNEA 4XDQA 1G9FA 1V9U3 1KS4A 2Z42A 1ZZCA 4YVSC 4IEXA 1JUHA 1C57A 2VNGA 4B29A 3W9AA 3ZDSA 2R062 2ARXA 2VQAA 3ZYPA 1GV9A 1NG0A 5HCFA 1PIV3 1ND3A 3RJRA 4IEQA 4Q4W3 4XF0A 1AYN2 5CFCA 2XJSA 1MQTB 1LESA 1U5YA 2EIGA 2HKXA 2A6XA 2UU8A 3M8LA 3MLJA 4MGKE 3ZN6A 4KG8A 4ATEA 3ZXJA 1S0BA 1R093 4C91A 1AF9A 2BWCA 3D0JA 4Q4V3 4LA2A 3WDYA 2PHUA 4G4FA 4LNVA 4KG0A 4Q2FA 3J8F1 2I45A 2FHRA 1SMVA 1FV2A 1QQP1 1YFUA 1VIWB 2MEV1 1NYWA 4JVAA 2D3RA 1PO12 1PO21 1OOPB 3CJIC 4HBNA 4I0BA 3OY8B 5T50A 5H9PA 1CAVB 3P3NA 5EJ3A 1LGNA 4OI4A 4FTEA 2JXAA 4MV2A 2D6PA 4A7YA 1KD7A 1VBE1 3PLQA 4LBNA 1AXKA 2HEWF 2YHJA 4BLJA 1OA2A 2ZJCA 4LHNA 4XFHA 4IEVA 3AKTA 4FQZA 4INDA 2F4PA 3AYAA 4COZA 1WBFA 1W6NB 3RMYA 2GMEA 1VBC1 2GNBA 5E16A 4KGGA 2QVSB 2R041 1HW5A 5K0UC 1AZDA 3CO2A 2VPVA 4XF3A 3TNPB 2A3YA 4UW5A 1AX0A 1ND2A 1AYM1 2PHLA 2NLRA 1A6CA 2X53S 5FBZA 3VKMA 1YJKA 1O7FA 4KL1A 2CAUA 3FWEA 1RUH1 3GZUC 1S2KA 2H0VA 1VR3A 2WT0A 5JIAA 1GICA 4EROA 1GSLA 1SLCA 2ZZQA 2YUEA 5GZDA 3BODA 4H55A 3H1MA 5JI9A 3RDIA 4DMIA 3HIFA 5T52A 1C3HA 3EXUA 1ONAA 3S7EA 3AYCA 1WW4A 4WM7C 4AEDB 3R6SA 2PHWA 5GLVA 3PJYA 4I3GA 2EF6A 2TEPA 2XHKA 2R30A 3OGGA 1IS6A 2WNVB 1VJ2A 4R9CA 3R05A 4ITCA 2BNNA 2HWD3 4OHWA 1AYN1 4FT8A 3IIAA 3CF6E 1DGRA 2EXKA 2WA3A 1OA3A 4XOGA 1LOFC 2YV8A 1QNYA 1IGOA 1JH5A 1KJLA 3ZXAC 5L19A 1OQ1A 3FBMA 3WDWA 2D6MA 3DV8A 4CDWB 2ZMLA 1D0GA 4YZ2A 5CIRA 5JCTA 4RR3B 5A3LA 3AYEA 2WIIB 4DZGA 5JZGC 4X8PA 1PO11 4MLOA 4A3XA 3NKGA 5FOBB 2ZZJA 2W0XA 3MLLA 3R0RA 3THPA 3LA3A 1LEMA 3VBRB 1IPJA 2Q8OA 4Y1ZA 5CFCC 4CP2A 3U4XA 4KU8A 4NN0A 1JOJA 1S0JA 3SNMA 4LLFA 2RS53 3WY6A 3LA2A 4ZU4A 1HLCA 4AI1A 4E4SA 1F9KA 1ZZ7A 3U0ZA 3JUUA 4MXWA 4MUVA 5LEKA 3ES1A 4DINB 2QCSB 4NOTA 4PLMA 1CAUA 1J3QA 4LBLA 1WW7A 4QPIA 4W6WA 1W0PA 4FSJA 3ELNA 1SLAA 5J09A 2PTMA 4DXZA 3T2TA 1CONA 4Y24A 5CU1A 1BJQA 2PYTA 1LODA 1UZZA 1Z7S3 1SEFA 2ZX4A 1G7YA 4YNIA 4CDQA 1REDA 1D0HA 1OHFA 4CEWB 2GZWA 2XH6A 4GALA 4P9JA 4E2QA 1VRH1 3FX3A 2A75A 4ONUA 2NMOA 3WINE 2VH9A 3VN4A 3QBQA 4TLFA 4HVQA 3T1LA 3RS6A 2IC1A 4XJWA 1QY4A 2OA2A 3QH7A 4NHMA 1QHDA 1IS5A 1ND2C 1W6OB 2ETEA 2P37A 3MIBA 3H7YA 4AEMA 2NYYA 4URTA 5IK7A 4IEPA 3E6BA 4NVPA 3UV9A 4PCRA 4GB31 5FAXA 1QQP3 2MEV3 4I30A 2WLPA 1RC6A 3RWNA 4AQSA 4I3PA 3VBHC 5CB7A 5GZFA 1SDWA 4Q29A 4CEYC 4JRAA 1WW6A 4PDWB 2ZMNA 4Q1PA 2RS32 3UKTA 5JOZA 2AYHA 2B5HA 4YW4A 1NCRB 1AJKA 3HD8B 4XETA 2WT2A 3T1MA 1H8TC 1MS9A 2P34A 4DFSA 1H1MA 2Q5TA 3B69A 2W08A 2CWMA 1YI7A 4L8QA 1MS4A 2D6LX 1WGPA 1PHMA 3AZYA 1D2QA 1RUE2 1ULCA 4YSFA 2CYFA 1VP6A 2P3IA 5CFDB 1VBC3 4IV1B 2IXJA 2A3XA 2R043 3WG2A 3WDVA 2KA3A 3M3OA 1YUDA 3K51A 2VW1A 2Z2SB 3WD5A 2A5ZA 4A2UA 2ZPXA 1BQPA 4BHPA 1LOAA 1UL9A 4QQ2A 1RUG3 1FPN2 1PZ8A 2RR12 1W6MA 4CDUB 4CP0A 4TYSA 5C9AC 2HWB1 4Z92B 5ABJB 3OJBA 4COUA 1RUOA 5BNOA 2WS92 2IXLA 3O12A 1HXS1 4KU7A 3NV2A 2KM2A 1ENQA 5HBAA 2MHFA 2R063 4QU2A 3E6CC 1MZ6A 4BMBA 4K40A 4CDWA 3GF6A 2D6NA 1AYN3 4E2GA 2DV9A 4GMP1 3S6PA 1HKDA 1PNGA 2PLV2 3VHPA 4QPIC 3LOBA 4F8AA 2ZCWA 1HQNA 3MFAA 1GQGA 1U5XA 3ENRA 4OHZA 1LOBA 3UKNA 5CA6A 5JIUA 1PGL2 2QE3A 4DRRA 1PO13 3FLPA 4FXKB 3ZIWA 1CPNA 4K1YA 5A33A 2ET7A 3H8UA 1PGSA 4AVTA 2P3KA 4ES9A 1PM7A 5T3NA 3KZ4C 4AQ2A 1UAIA 4Y1YA 2RS31 3HT1A 2Y0OA 1XU1A 1J3RA 5KHGA 1AUYA 2XG3A 1VAMA 4PJYA 4EWDA 2HWF1 4YVSB 1V6OA 3MIGA 3AKSA 1F5FA 3B7MA 4H7MA 4S2FA 3GZTB 1NXMA 1RUE1 3USUA 4AFBA 2BW8A 1MS1A 2ZGSA 5C4WA 4M01A 1VBB2 1O91A 4C90A 1TNFA 1JYCA 1AR61 1X8EA 4EN0A 4IEOA 3MGUA 4YW1A 4FXGB 3BOWA 4LBQA 1PK6B 1WLCA 4CZSA 2YPJA 1ZZ8A 3H3ZA 3BCWA 5FREA 5I8TA 4B4RA 4OUMA 2IXHA 2B42B 2OUJA 2DVGA 4EN9B 4E27A 4KGQA 2RR11 5K8SA 1G8WA 4G9SB 2PQQA 3SH5A 1UN1A 2G4IA 4UW3A 3ZO0B 5KC5A 1NLSA 4I01A 2GC1A 1RUD2 1XYPA 4I2OA 2ZAAA 2WS91 2E6VA 1GQHA 4FPGA 4YGDA 3DPRB 2LUWA 3ZXGA 1HIXA 1PNFA 1ULFA 2Z79A 4S2DA 4RL7A 4S2HA 4PDWA 1XYOA 1EYBA 4S2GA 5KXBA 4ES8A 1KJRA 4YZ1A 4AEDC 5K0UB 2C0ZA 4IEUA 3CL1A 4DQAA 4QPGB 2R6QA 3TWIA 3AXDA 2WNVC 2WQ4A 2ZHLA 2HEYF 5D8AA 4Y22A 1U12A 2RE9A 1IPKA 4UBGA 4PIXA 1PGL1 1ZBA2 3N7KA 1YFYA 1S0EA 1GLHA 1H8VA 2WFF2 5H9SA 1CVNA 5B2GB 1DLLA 4QQPA 4FPHA 3WQ7A 4FPEA 1H2MA 4CDWC 4EWAA 5I8YA 4XW3A 2E53A 3DL3A 3ALQA 3MF9A 2DVBA 2ZHNA 3POWA 4CDUA 3SCHA 3VHNA 1IZ3A 5DZFA 1RB8G 1QKQA 5GZGA 2EXJA 3AX4A 3VKLA 3RG0A 1VBB1 4R8HA 1O3QA 2VMHA 3ECQA 1FYUA 3VZOA 4OI0A 1FNZA 2DURA 4FOVA 2JDZA 4COYA 4DS0A 3I7DA 1BXHA 2CGOA 1HQLA 2YY1A 3QACA 1FI2A 3FJSA 2DUQA 4M3CB 2VVFA 1SBFA 3TNQA 1ZRDA 2VNRA 2I74A 4Q4X2 2ZGUA 3WP6A 1OLRA 1XRUA 4RSUA 2QJVA 3INAA 3UKVA 1BEV1 5BY5A 1YWKA 4L99A 4ATFA 5KWRA 1G86A 2JICA 3WXPA 2YZ4A 1RUD1 5C4WC 1ND3B 4CTEA 3HN1A 1ZNPA 1ZM1A 1YFWA 4NWWA 5CFCB 3ZN6B 3O0WA 4WZCA 5EXOA 1RIRA 5JLVA 2DWRA 4B4QA 1DF0A 5BNPA 3JD72 4PIYA 4YYOA 3IBMA 2H6BA 1Z78A 2FBEA 2XL7A 4META 3MIFA 2ZOEB 5JOWA 2RS33 2ILMA 2RM22 3MI8A 2D43A 1MZEA 2EALA 4DOUA 4PBOA 2VNOA 4N43A 3J9SA 2WFF1 3SLIA 4YG6A 4PDWC 1KDMA 2OVUA 3W58A 2ZKLA 3BALA 2XVLA 4WVWA 4BH9A 1KFUL 1WUVA 2D3SA 1QGLA 3U10A 3ZSMA 4HPKA 1ND2B 2JKBA 2DTYA 1QH7A 5F5QA 3VZKA 5KHJA 2FZ1A 1XXNA 3WP4A 5IK5A 5FTTC 3ZYGA 1UCXA 1FPN3 3DPRA 3U11A 2RR13 1Q8QA 3IPVA 3AK0A 4Y1VA 4ASLA 4XQWA 4JRLA 3WZ1A 1N3OA 3VKFC 1X36A 4AVCA 3GYDA 1AL0G 1APNA 4ZXKA 2WS93 2EAKA 3J8F2 5CVRA 3ZSKA 4MVTA 4W6YA 4AEKA 5TSWA 3AZZA 4JGZA 4HL0A 1PO22 3RI8A 3ZIXA 4CDUC 5CAZA 2JG8A 1CN1A 4WVZA 2D40A 2X29A 1YNAA 2BNMA 1LU2A 1ASJ2 3WW3A 2E51A 1VBE2 4YLZA 2Q30A 3OD0A 4WM8A 2JECA 4JGYA 3RJ2X 5I0TA 2PLV3 3APBA 4LT5A 2G9FA 1MR5A 3VBUB 5AVAA 4YG0A 2GC2A 4NWVA 2DU0A 3N7MA 1CJPA 1FOD2 3JD71 2YGLA 3K48A 5FQ0A 3AKRA 4KQ7A 1B09A 2VG9A 5BNNA 5FO9B 4LO7A 3OBRA 2XLFA 1POV1 2O1QA 4XZPA 1QXRA 3MEPA 2RM21 2JEMA 3ZFGA 1RUH2 4LO6B 3E97A 4QGNA 3ZSLA 2NQYA 3OGJA 1FMD2 1LEDA 4YW2A 1NQDA 5BXXA 3C2UA 4R4XA 1CJDA 4Q27A 2D3PA 5DUWA 1VBB3 3AP9A 3LSDA 3E5UA 3TB0A 1RL3A 4MXWB 2WNUA 4XQ4A 4YG3A 1NOVA 1S1AA 4RHV2 3ES4A 2XLAA 1CD3G 1CAUB 4QPIB 4Y20A 4WVMA 3AP4A 1RMU1 1XNBA 1EV12 1MEC2 3VKOA 5IT6A 1AXYA 4UW6A 2YC0A 4CDQB 4N43C 3JB4C 1PK6C 4MGIE 4OULA 4LBOA 5FFOC 2CTVA 1COV1 2R1BA 5J37A 1RUD3 3AZXA 3OCPA 2ENRA 3ZFFA 1CX4A 1LCLA 5EYXA 3RYPA 1WLTA 3U07A 1VLNA 5FLJA 2A7AA 1MS3A 2XPJA 1GZ9A 4LO8A 2ATFA 2Z69A 1EAH2 4AK3A 4AHWA 4EV0A 3X29B 2PHDA 2DCZA 1SACA 5HI0A 1MS5A 1ASJ1 4AFAA 3DPRC 3HT2A 2A6VA 1X33A 3JQWA 3KCCA 2GH2A 2BNOA 3H7JA 1XE8A 3B02A 1RUF1 3M4FA 4LUMA 1ZBA3 5J7MA 3IT8A 1Z0HA 4ORFA 1FOD1 4AI3A 3LGRA 2GN3A 2WFF3 4QPGC 2JG8C 2DVFA 3TYJA 2GC0A 5JAXA 4ZU5A 4OLLA 4AVVA 1ZBE2 3GHNA 2PAKA 4MGYE 3D0SA 3R4UA 1ZZ9A 4W6XA 5I8SA 1JXNA 3AM2A 1G9AA 2WZR1 3GBFA 4N7UA 1XQNA 3PMSA 4WM8C 4E4ZA 2W52A 4JGYC 4OHYA 1FMD1 4YM3A 1VRH2 1VALA 1I6XA 3C3VA 3EHKA 1QDCA 2A6WA 3M1HA 3S0MA 2IZWA 1C8M3 4EN8B 4Q8LA 4HSJA 5BNNC 4RHV1 2XJVA 3N7JA 1XU2A 1W6MB 3LA7A 2OIIA 1DIWA 1UMZA 3KT4A 4P14A 1AR72 4TSVA 4JDNA 3ZFGC 4GB32 4HN1A 5LK5A 5BNOB 4V1PA 4Q4X3 5AFEA 2B8MA 1EV11 1LJ7A 4IV3A 2DCKA 1MEC1 2ZBJA 2JE9A 2SBAA 3VBUA 1AR92 5T5JA 2CWSA 3WW4A 2FQPA 3JQXA 4N7IA 3NJZA 3IN9A 3I59A 4YZ5A 3G6JB 5GZCA 4N53A 1HRV2 3WG4A 4AI8A 1KS5A 1CAXB 1V70A 2GU9A 2ZACA 4GULA 4JTNA 2PAEA 3WHUA 4PF5A 4EJRA 1EAH1 4LO5B 3WVJA 4JAAA 2NZ9A 1BVVA 5GLUA 4RGGA 1LGCA 1WCSA 1ND3C 3JD73 3VZJA 4A7ZA 1ZX5A 3CU7A 4R4ZA 4HSLA 1FXZA 3OYWA 4L9BA 4U2AA 5HCBA 1X82A 4COVA 1POV3 5A33B 5CNAA 1O5LA 1PMIA 3VDDA 2DUPA 4LA3A 3ZSJA 2RM23 3SCGA 2BWAA 4TZDA 3ZFFC 3FC0A 2WSVA 4B7KA 3MICA 2EA7A 5DXDA 4WBBA 4CRQA 3D4KA 4NPRA 5CADA 4M0HA 3WDTA 4KWJA 1ZBE1 1DYPA 2HWB2 2VY0A 3USUB 1WLDA 1DU3D 4D7YA 3R4SA 5D1IA 5C4WB 4BYYA 3VZNA 4F7ZA 4RD7A 1HXS2 3GALA 2P3JA 2YMZA 4LBQB 3S7IA 2LTNA 4AI0A 2BUKA 1RUC1 1LGBA 1IOAA 1X8MA 4WV8A 4K21A 1C1FA 1NCQB 4KBBA 4FP2A 2TUNA 3VBOA 1OI6A 3AP7A 2ZGRA 2DTWA 2H6CA 3A0KA 2I07B 1OMIA 3J8F3 1AR71 2ZGOA 3IWZA 1LHUA 1YI9A 1DZQA 4XBNA 1PO23 4JCKA 3RYKA 2B45X 1DQ6A 3QH6A 1DGLA 1AR91 3GHMA 1Q5OA 1SLBA 4FPFA 2ZMKA 1GNHA 1ASJ3 3N3HA 4MX3A 4RA0A 1VBE3 1YXWA 3MW4A 1HRV1 4HLTA 4XTMA 1ZRRA 2HWF2 1WW5A 3H0OA 4I02A 3VZLA 4XEZA 2GAUA 2OZJA 5D8AB 2AUYA 4Q0VA 4Y22B 4GWMA 4KWKA 1AVBA 1UU6A 1AR62 1N3PA 3AFGA 4LHLA 2XVGA 3VBUC 1C5IA 4NO4A 4UXAA 4KNCA 4BMEA 4DRVA 1AYM3 3O0VA 4A7KA 4IESA 1O4YA 1RUI2 4J1WA 1RUH3 1MS0A 1O4TA 1BVP1 1FMD3 2AENA 2GNMA 5A32A 1J1TA 3ST7A 4AGRA 5HXVA 3KS7A 2E63A 3NAPA 1EP0A 3BOPA 4K7JA 5H9RA 1LHWA 4XXAA 3FUOA 4RHV3 4XF1A 4ASMB 1IS4A 4OHXA 3GZAA 5JWPA 3ZYJB 3FE5A 2VOXA 1F31A 4FPOB 3TN92 4RS5A 4B8EA 1EV13 3HMYA 1MEC3 1ZVFA 1CAXA 3AP6A 1OFNA 2GSYA 2WSUA 2JENA 4MSVA 2ET1A 3IDBB 1OFSA 1Y3TA 1O3RA 5LRRA 4LBJA 2Q1ZB 2EXIA 3RNSA 3ACLA 3RSJA 1QU0A 4OVEA 3D6EA 1N1YA 3QD6A 5JI7A 4XBLA 5JSOA 3J4UH 2FMYA 4N9IA 4CDQC 1EAH3 1HDKA 2QKDA 4YM0A 5DG2A 4HVRA 4F83A 3HAGA 2XJPA 1G6NA 1MVQA 1PGW1 4LULA 2XKPA 5BNPB 1SLTA 3B9IA 4YM2A 1NQJA 4G3YC 5E1RA 5J48A 3QCWA 2YGMA 3VBOC 3IDEA 5CBLA 2FMDA 1UF2C 3VGIA 4UBHA 4AE2A 3WQ1A 4XFGA 5L7OA 1F5JA 1ULGA 1GFF2 2VW2A 5FLIA 1D4VB 2GALA 4CP1A 2YXSA 2B39A 2QZ2A 1NE4A 1IQAA 2AH2A 4N43B 4BQ1A 1E57A 1ZBE3 1OD5A 3OPZA 2OUHA 2ZA9A 5DDJ2 5F6LB 1N1VA 3AP5A 4C0HA 1RUI1 3D82A 4MGZE 3KT7A 3LOIA 2E7QA 1NCQA 1JHNA 2WWSA 5DUUA 4GMP0 2V5YA 2CNAA 4ZU7A 3JZVA 1BEV2 4P9IA 4HPKB 1VRH3 3MW3A 3ILFA 3PHMA 4QD2A 1G9CA 1KDKA 1W6PA 1R082 2A6YA 5H9QA 5C8CA 3IPVB 5GKAC 2JD4A 3CJXA 1GYKA 3MPBA 4K3UA 3B00A 1V6NA 3TN91 1LENA 1FV3A 1IKQA 1AR73 4Z2WA 4GB33 1TQ5A 2DU1A 1PVC2 4K8FA 2Z5WA 3DN7A 4YARA 4ZKTB 2JG9A 4HKWA 2DFBA 1AR93 3M2MA 2PHFA 4JGZB 1M06G 1Q8VA 2JG8B 2ZHMA 3NAPC 3W59A 4RQPA 3FFQA 4YW3A 1KFXL 4FO9A 4EWEA 1OA4A 2ZKNA 4AWDA 2YROA 1NA1A 3NO8A 1HRV3 1N3QA 3EJKA 1KQRA 2RS12 2GN7A 1CAWB 3DUIA 5BNOC 1NXD1 2AREA 2XJRA 1K5MA 1H4GA 4WM8B 4JGYB 3WLUA 2A6ZA 4QXKA 4WVVA 4P9XA 2PHTA 3VZMA 2P17A 3WNXA 3UL2A 4RS5C 1LOGA 5FMOS 1CPMA 1QNWA 3OBTA 2Y26A 4XILA 3D8CA 5FQ0B 1H30A 3WHTA 2VUJA 5BNNB 3HBZA 2BGCA 2O8QA 3SH4A 3BU7A 4H7LA 3B3QE 5IK4A 1T6GC 3KB5A 4L11A 3RQ0A 1YO8A 2QDRA 3RYRA 3ZFGB 4OI2A 2DYCA 1BYHA 4B3NA 2W39A 3I2DA 1EPZA 3GBWA 4GA9A 2FZ2A 1YIPA 1KXGA 1AJOA 3AJYA 1QXJA 3G7DA 2HWB3 3JCIA 1RVF1 1RTVA 1O5UA 1H2LA 5DDJ1 4YVWA 4LBKA 3GBGA 1Y7BA 2BVBA 4FAGA 1HXS3 2WNUB 2D97A 4XJUA 3AKQA 3DF0A 5L36A 1G9DA 5FMOL 4Y20B 4WVMB 3AZWA 2IXCA 5BYNA 4KH9A 5L7OC 4Q26A 3MFCA 1DQ1A 1NLRA 2H0BA 4GWNA 1DGWX 1H9WA 4GMP3 3AMHA 1R081 1MVEA 3E6DA 1GKBA 3O5SA 5GLWA 1D4M2 1PIV1 3WT3A 1LTEA 3PNAA 1RGSA 4Q4W1 2VXRA 2A3WA 3WCSA 1FNYA 1PVC1 3VBSA 3ZFFB 2XB6C 1ENXA 4AG4A 1NCQC 4E4DX 1O3TA 1R091 1YHFA 2R1DA 1LHVA 3EQEA 3LWCA 2Q4SA 1AX1A 5KHKA 1I3HA 5KHHA 2KXLA 5KBFA 1TMF2 1HQWA 4GKXA 1WMEA 4K6BA 2PHXA 1V6KA 4XBQA 4CDXA 2RS11 4EN7B 3LSEA 1TME2