2PELA

Peanut lectin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEANUT LECTIN
publication title Conformation, protein-carbohydrate interactions and a novel subunit association in the refined structure of peanut lectin-lactose complex.
pubmed doi rcsb
molecule tags Lectin (agglutinin)
total genus 52
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pelA00
3ILRA 2UWBA 1LHOA 1KJLA 1OKQA 1S1AA 1V6JA 3FBYA 4DRRA 4IQPA 2CY6A 5JDBA 1PZ8A 2YROA 3M2MA 1ULDA 4YW5A 3D6EA 4Q27A 5FRAA 1N1VA 1S0FA 2EXJA 2RHPA 5E89A 1YIFA 5F5QA 1DQ5A 3UJQA 1VALA 1WD3A 2WLQA 3IM0A 2VW1A 3FUQA 3FLPA 5DZGA 2GNTA 4XBQA 3M3QA 5DUVA 5H9SA 4YM3A 5CA6A 2UURA 1SLIA 3AZZA 4PBOA 1HLCA 4Y20A 4C1XA 3DUIA 1YYNA 4FP3A 3N36A 5E8AA 4DS0A 4LBKA 3N7LA 1GV9A 1AX1A 5GZEA 5JOYA 3ILNA 1W6OA 5EXOA 2WSVA 4UW5A 2ZHMA 1RINA 5H9RA 3UJOA 1LOAA 5BYNA 2VH9A 4M3CF 5DUXA 1QOOA 1G9FA 4P9YA 4XJ9A 4XYXA 3JU9A 1DQ1A 2EF6A 4AYUA 1AX0A 2WJSA 3NV2A 3T2TA 2ZA9A 3A0NA 1LENA 1KDKA 1N1SA 1KJRA 1HKDA 4YFZA 5JOZA 1CJPA 3AZYA 2LTNA 3AZWA 3MEPA 3PVNA 5DUUA 5GZDA 3ZXLA 3R4SA 4ATFA 2ZMLA 1LODA 1URXA 2A3XA 4XJWA 5KXCA 1JW6A 3OY8B 1TEIA 1WBFA 1LOFC 3POSA 2UWAA 1I1EA 1DQ6A 5CBLA 2Q5TA 1QNWA 3AJYA 3M3CA 4YGBA 2UWCA 1QDOA 5GALA 3OPZA 4XBNA 1JHNA 1MZ6A 3AP4A 4GWMA 1DYKA 2R0HA 3WDXA 3INAA 1AJOA 3ZXKA 2A6VA 1A78A 2XB6C 4WVVA 1LESA 1QKQA 1LULA 3M1HA 4AVSA 3ZXFA 3QCWA 1MS9A 2ZGLA 4LBQB 1MVQA 4LBNA 3WCSA 4FPYA 2ZGNA 1QMJA 2A6WA 5HCBA 1C4RA 5GLWA 3WG1A 2GNBA 3RMYA 3ZXEA 4YG0A 4Y24A 1FNYA 4YM2A 4YZ5A 2OUJA 5DZEA 5GZGA 2NMOA 2ZHNA 2EIGA 3OYWA 1CESA 2JKBA 2ZGRA 1C1FA 1C1LA 1AX2A 2DTYA 4Q1PA 2CL2A 1JUIA 2C9AA 1UN1A 4WV8A 3ZSMA 1LECA 1DBNA 5DXDA 4BM8A 4AGVA 3HMYA 4LBOA 5DG2A 1LGBA 5IK7A 1GSLA 4UW6A 1ONAA 4JC1A 1WW7A 1SCRA 2TEPA 2DU0A 1PZ7A 1CR7A 3AP7A 1I3HA 3IMNA 3N3HA 3ZSKA 1N1TA 3V0BA 1HDKA 2DUOA 2EAKA 2ZZJA 1JYIA 5LK5A 1F5FA 3RQ0A 1Z0HA 1VIWB 2R0FA 4Y22B 4DFSA 2D3RA 1QU0A 4XXPA 3IPVB 5JOXA 1ULFA 1VLNA 2WKKA 4PF5A 1IOAA 3WNXA 1LHUA 5T5JA 2JJ6A 1GNHA 1IS3A 1DQ4A 2ARXA 2JE9A 1BKZA 4XDQA 1WUVA 3BODA 1V6OA 2ZAAA 5GZFA 2DVFA 3FLRA 1GZ9A 3POYA 3AYEA 2H0BA 3B69A 4ISRA 4XMIA 4YW3A 3WG4A 1GZWB 1DHKB 2ZGOA 3AYAA 1WLDA 3KM5A 1W6PB 4Q2FA 3VKLA 2V73A 2DURA 1WW4A 4NOTA 4BOWA 5F9TA 4ITCA 1LGCA 1BJQA 4Z8BA 4ATEA 3QLQA 3AYCA 4WVWA 1DFQA 4FPCA 2D6MA 1CN1A 4GXLA 2D6PA 3OY8A 1BYHA 1N3QA 3U4XA 1MACA 1LCLA 2W39A 3O12A 4YW4A 4BPZA 2ZHKA 1AJKA 2GN3A 2AREA 3AZVA 1CPMA 4BQ1A 1N1YA 1U0AA 1W0PA 4FPEA 1GYKA 3VKMA 1JOJA 1GLHA 1AXZA 3B3QE 3WDWA 2A3WA 3POWA 4LBJA 1LEDA 4XJUA 2VW2A 1UPSA 2E7TA 4U2AA 1WLWA 2AENA 1S0IA 3SLIA 2ES3A 2I2SA 3ZSJA 2A6XA 1CQ9A 1FX5A 1W6QA 4FPFA 4FPGA 4LBQA 1KRIA 1ULEA 2AGSA 4FQ4A 4K20A 2ZMNA 1Q8VA 1KITA 5T50A 1PZ9A 2NZ9A 4XZPA 4XIOA 2AR6A 1N3PA 2VU9A 3MPPG 2PHFA 4YM1A 5DZFA 1LHWA 1BZWA 2FHRA 2GMPA 2JECA 3SISA 3I8TA 2DTWA 1G9CA 1WW6A 1Z78A 4GA9A 5GJ6A 3UL2A 2WSUA 2W52A 4K1ZA 3PMEA 1D2SA 3USUB 2E6VA 2ZGSA 1SACA 1W6MA 1FATA 3AJZA 2ZKNA 1G9AA 3B9CA 2D44A 3GALA 2KM2A 3N7KA 5L73A 1SBEA 4R9DA 2A75A 3R05A 1ULCA 1V00A 2A6YA 1APNA 2OVUA 2B7YA 3CNAA 2PHTA 1DYPA 4DPNA 2GALA 5T55A 2NM1A 2Z42A 4YZ4A 2ZMKA 4XBLA 4XHXA 1Q8SA 3ASIA 2A6ZA 2JE7A 2P3KA 1CVNA 5EYYA 4DQAA 3PJQA 1GZWA 1LTEA 4PQ9A 3WZ1A 3ZYPA 2D7FA 1G8WA 1W6NB 1QF3A 2ZHLA 3I4IA 2YXSA 3APBA 1HQWA 3MW4A 4FPOB 5IUQA 1GKBA 5T5LA 2A70A 1Q56A 3C2UA 4Q8KA 4JRAA 2D3SA 1A3KA 4ASMB 3ENRA 4M3CB 4XIKA 4XTMA 4LBLA 4XJZA 1H9WA 3M3OA 1FV3A 1IKQA 1KDMA 1S0GA 2PHUA 3IN9A 5IK8A 3WUCA 1LU2A 2DVAA 4BMBA 1LHNA 5KXEA 4M3CE 4YZ1A 1OFSA 3WOGA 2SLIA 4AVTA 4M01A 2PHWA 3BTAA 4KBBA 1DZQA 1SLCA 3A0KA 3WDVA 1QOSA 4ISQA 5T52A 1C57A 1NLSA 1MR5A 1BQPA 1JYCA 1S0BA 3SH4A 1GZCA 2VY0A 3B01A 3FLTA 2R49A 5T5PA 1KQRA 1RIRA 2ZACA 3A4UA 3WHTA 1UKGA 1VAVA 3O0VA 1SLAA 2DU1A 4R9AA 3VV1A 4TZDA 2DWRA 1IKPA 3O0XA 1YI7A 2WT1A 3WHUA 1V6IA 2OW4A 4U36A 4PBPA 4GKYA 5GLUA 2CWMA 4ZXKA 2JD4A 5E88A 1JN2P 2YV8A 1AXKA 1SCSA 3FFZA 5AVAA 2AUYA 1WBLA 4Y1ZA 3AXDA 3PVOA 1RITA 2W08A 1LGNA 2FMDA 3V64A 1YRZA 3HR9A 2YZ4A 3R4UA 3ZSLA 5SV8A 1IS4A 1JBCA 2ZGPA 3WUDA 1MS4A 1A8DA 4YGEA 5IK5A 1YO8A 3MW2A 2P37A 1G9BA 3VUOA 2GN7A 1QGLA 2AH2A 5DG1A 2R1DA 4HL0A 2NYYA 5EWSA 4PCRA 4RA0A 2ZGTA 3ATGA 5GLVA 1Y7BA 4K21A 4MYEA 1MS3A 4FPKA 1OQ1A 4Y26A 5CNAA 3B00A 4YG6A 5HCAA 1S0JA 1AF9A 2YMZA 2VXRA 4YGDA 4BLIA 1EPWA 4Y1UA 4XHBA 3VKFC 2GNDA 3N7MA 1IS6A 4FPHA 3AZXA 2EALA 5CAZA 3N35A 3OGGA 2JDZA 3H0OA 2W68A 4R9CA 4YLZA 1QDCA 4YZ2A 5FREA 2CTVA 3NV1A 4XMAA 4D69A 1LOFA 1LU1A 4M3CA 5DUWA 3WCRA 2NP0A 2ZGQA 1SBDA 1BXHA 1MS8A 2PHXA 4H55A 3SH5A 3N7JA 1ENSA 3OYWB 4YG3A 5HCFA 3D5OA 1SFYA 4Y1VA 2C5DA 2UU8A 2ZABA 2DYCA 1HQLA 3LCPA 3ZYRA 4DRVA 5CB7A 3NWKA 2WQZC 5IK4A 3WG3A 3O5SA 1WD4A 4FVVA 4FPLA 4Y1XA 3WDUA 3AP9A 2D6LX 2OUHA 1MZ5A 4L8QA 2ZGMA 3AFKA 4UW4A 4XE9A 1N47A 1GANA 4GWNA 2DVDA 1LOEA 2PHRA 1FYUA 2D6KA 2DVGA 1Q8PA 3DGTA 1IS5A 2A5ZA 3HN1A 4FP2A 2NMNA 3WG2A 3V0BB 1DIWA 1MS0A 4Q8LA 5KXDA 4Y22A 3TAYA 2D6NA 4XJ8A 1SBFA 3IPVA 4XOGA 4YZ3A 1G86A 5JVVA 1D0HA 1FNZA 1VAMA 4FOYA 4YM0A 5GLZA 1QOTA 1H9PA 3NV3A 4FOQA 4Q1RA 4XJAA 2ERFA 3UK9A 1N3OA 3RRDA 4FOWA 1J1TA 1WLCA 2G4IA 2YY1A 1V6LA 4ZKTB 2VUAA 3LSEA 4FQZA 2WT2A 2CWSA 4SLIA 1V6NA 1W6PA 1ENQA 4FOVA 2R1BA 2WT0A 4P9WA 1JXNA 4RL7A 4UW3A 3V0AB 1SLBA 4YW1A 4YGCA 4R9BA 1LOCA 2D43A 2E53A 1O4YA 1DGLA 2GMMA 2XG3A 2HYKA 1H30A 2EXKA 2R16A 4BLJA 4CZSA 1ULGA 4HANA 2GDFA 3PVEA 5T54A 2A71A 2E51A 4W65A 5JMCA 1LOBA 4C1WA 1CONA 1F9KA 1O4ZA 4CRQA 1WW5A 2ZGKA 4GALA 2P3JA 2WNEA 3WLUA 1UZYA 1FAYA 1LEMA 1QNYA 2ZGUA 3D4KA 4P9XA 4TYSA 1UL9A 1YXWA 2D6OX 1DQ0A 1GBGA 5T5OA 5IT6A 2DUQA 3RSJA 1Q8QA 1ENRA 3ZPYA 1NXD1 3O0WA 3OBTA 4M00A 5H9QA 5GLTA 2VW0A 2PELA 1LJ7A 4Y1YA 3LSDA 3Q9OA 3TB0A 1S0CA 2BQPA 4CTEA 5KXBA 1UZZA 1S0DA 1W6QB 4NO4A 4Y20B 3WDYA 4OZXA 3IKWA 1CIWA 1UMZA 1X50A 2ZBJA 3MW3A 4WZFA 3WVJA 2SBAA 3L2YA 3GNEA 2CNAA 4LBMA 3RMXA 4F83A 2AYHA 1W6OB 3VKNA 2P3IA 3NV4A 3W58A 3BIWE 5JOWA 3OJBA 3AXEA 2A3YA 2P34A 3SITA 1F31A 1LOGA 2V5YA 3V65A 3AP6A 1SLTA 5GM0A 5JLVA 1B09A 1GICA 4AGGA 3USUA 2ENRA 1LHVA 3JUUA 1MS5A 1SLLA 1AZDA 4Q26A 1GNZA 1AVBA 2D3PA 3AX4A 4XTPA 3AK0A 3WV6A 4BMEA 4AGRA 1MS1A 1MVEA 2EXIA 3WDTA 1W6MB 3FUOA 5EYXA 1CPNA 3RS6A 1S0EA 1UAIA 1G7YA 2DUPA 2LALA 4K1YA 4AVVA 3AYDA 3RG0A 3AP5A 4YW2A 1G9DA 1V6KA 3ZXJA 3SH3A 2NN8A 3ZVXA 1XQNA 1Q8OA 3OBRA 3BOPA 4FPJA 4XILA 4GKXA 3VKOA 1DQ2A 1ZA4A 2DVBA 3SNMA 4I30A 1FV2A 3KQRA 4XXAA 5GZCA 2GNMA 1R1ZA 1V6MA 1ZM1A 2ARBA 2E7QA 3M3EA 4JCKA 2GMEA 5H9PA 1DLLA 1W6NA 2EXHA 3T1LA 4YFWA 1W0OA 4LBQD 4AWDA 2P2KA 3V0AA 2A7AA 2DV9A 2CYFA 3W59A 1AXYA 3ILFA 4P14A 1UX6A 3T1MA 1WCSA
chains in the Genus database with same CATH superfamily
1RUH2 1V6JA 5ACA1 1MEC3 4XDOA 1COV2 5FZAA 2CY6A 2F17A 5A3PA 5JDBA 2D40A 1POV1 3ACIA 3H8XA 4XFGA 2FDKA 4IV1A 1RUI1 4YW5A 5FRAA 1N1VA 1T2XA 1S0FA 2EXJA 1CGPA 2RHPA 4LIVA 5E89A 3MF9A 1YIFA 4ZY9A 1KFXL 4CPBA 2Z4FA 4XF1A 4Q0UA 2IXHA 2XJSA 3UJQA 2WZPP 3W5MA 3FLPA 4XBQA 1L7QA 5H9SA 5CA6A 2ZCWA 3AZZA 1HLCA 5HV4A 3ZFEA 3SEPA 4CP0A 4LBKA 4CDQA 2Y38A 1GV9A 5EQUA 5FP9A 4PDWC 5J36A 1AX1A 1LKNA 5JOYA 5FXZA 2XUEA 3ZN6B 1RXGA 3D8CA 4I09A 5JZGC 5H9RA 2CHHA 3MV11 5FYUA 4H14A 3LA3A 3UJOA 1D4M2 1PIV3 1QOOA 3LD8A 4XYXA 4I02A 2X05A 2YFZA 5G05L 5A3OA 1DQ1A 1HRI3 3DECA 3JBG1 1AX0A 2J1AA 3ZN5A 5L7OB 1HXS2 1QXRA 3TNPB 2WWJA 1F35A 2WA4A 3KGLA 1LENA 5FBZA 1NT0A 2V4AA 4XF9A 3TEYA 3THCA 4LUMA 1AR92 4FSJA 5DUUA 3VBSC 2LTNA 4E2GA 2YUEA 2ZEWA 3PVNA 4JGZA 5C3RA 3CJIC 2P1BA 5JIUA 3BPSA 4JGYC 1ZZ6A 4COZA 3LB9A 4NIGA 2LUWA 3RJ2X 3POSA 3USSA 1OA4A 1H6YA 2UWAA 2IXIA 2VZOA 3PUSA 2R072 1PGW2 4CEWA 2XWJB 3IAQA 1QNWA 1ASJ2 3POJA 3T2PA 4AHYA 5FQ0A 1W9TA 1A34A 1EP0A 4WM7A 4BK4A 4OHVA 2R0HA 3I3EA 2NQYA 4N43A 3T09A 1PK6C 4CP9B 1HQNA 1RVF1 2BBAA 4BCUA 2WNUA 3ZXFA 4CCJA 1MS9A 2F6BA 5LY1A 1ZBA1 1MVQA 3I2OA 2A6WA 4XFFA 3R0RA 1C4RA 3ACFA 3HNYM 2VMEA 3ZXEA 3BU0A 4EYUA 1FNYA 1W2AX 4YM2A 3BB6A 4YZ5A 5F7UA 3PVBB 2ARCA 4W50A 1BBT2 1NA1C 4CDXC 1MQTB 2DTYA 1VP6A 1VBA1 2C9AA 1QJX3 3O1RA 1DBNA 2G1MA 4AGVA 1RUD2 5J96B 5IVEA 3EQEA 3HMYA 3OBAA 2V09A 1R093 3MI8A 3GM8A 2KA3A 1W8FA 2YHJA 4UW6A 3ZIWA 1JODA 1ONAA 4JC1A 1WW7A 5A7OA 1JZ8A 1W8NA 2ZTNA 2BFUL 1UU5A 1PZ7A 1CR7A 3CF6E 1VBE2 2QTWB 1Y9GA 4L9BA 4QHZA 1I3HA 4OHXA 3J26N 3ZN6A 4NMIA 1IG0A 3H9AA 3TOJA 3ZSKA 5KBFA 1VJ2A 1AYM3 1VBC1 2ZZJA 1JYIA 3C7FA 1REDA 1F5FA 3TEXA 1IGOA 1Z0HA 2XLFA 3EXUA 4Y22B 4DFSA 2WFF1 1ULOA 2D3RA 4XPVA 4OHYA 3IPVB 3PU3A 4B4QA 2X5IB 1VLNA 4QXHA 2VULA 1PX4A 2ARXA 3WD5A 4XDQA 4CA9A 5L7OA 1O8SA 5GZFA 3ZMOA 1WA6X 2K0GA 1GZ9A 1LR5A 3AYEA 3I2KA 1XYOA 2H0BA 4ISRA 4SBVA 1FOD3 1BVP1 2HEYF 1X8MA 4WM7C 5K9YA 1RL3A 1XNDA 2WWUA 4Q2FA 4Y4RA 5FJKA 2DURA 5ACA3 5F9TA 4OYUA 1BJQA 4ATEA 1POV3 2JG8C 2X8KA 1NY71 4JZRA 4NIIA 5IAXA 3MIGA 1RUI3 2WZR1 2D6PA 2RDSA 1OA3A 4A6SA 4QD2A 4KG0A 3O12A 5D21A 4AE2A 2OYZA 4K8RB 1REEA 4BB3A 2GN3A 3WINE 2YU1A 4XURA 5JUVA 4FAHA 1XNAA 1U0AA 2G9GA 1XU1A 3K48A 4FPEA 1RUF2 2VNGA 4CP9A 3B02A 2A3WA 2VJXA 4RSUA 1JTZX 2JDHA 2VW2A 3OPWA 4U2AA 2E32A 1WLWA 3WEZA 1S0IA 3PHMA 3S57A 3PJYA 4XCBA 4FXKB 4FPGA 4D7YA 1QJY3 3IDEA 3OD0A 3POEA 5A33B 4FQ4A 5EJ1B 1O3SA 4K20A 2IXKA 4CEYB 4YSFA 1PZ9A 3MHZA 1ZRFA 1TNFA 1MQTA 5A1FA 2GU9A 4DUVA 3OBZA 4QM9A 2AR6A 3X29B 3JBG3 4QX8A 3B7MA 5FPVA 1CX4A 3I3DA 2VMCA 2PHFA 4UWDA 4YM1A 4MSVA 4KBZA 4BXSV 2GMPA 4LHKA 4QM8A 1WW6A 1WLTA 2W1UA 4GA9A 5ISLA 2J1UA 3USUB 2XJTA 2E6VA 5FYMA 5FK7A 5G04L 2H6BA 2ZGSA 3SMHA 1PGSA 5FZEA 3WP5A 1ZYBA 4RS5A 1W6MA 4GH4C 3ZFGB 1FATA 4AZZA 2ZKNA 5ANQA 4XCAA 4OI2A 2VCMA 2BW8A 2D44A 2YFUA 5D1IA 2V4VA 3VZMA 2RS11 5L73A 1DGRA 1SBEA 2EIDA 3R05A 4MG2A 1VBD2 3P3NA 4P9GA 1ULCA 2X5IA 4Q4Y2 5F2WA 5FIXA 3P6BA 4AW7A 5F5AA 2XPJA 1H1AA 1EUTA 2J1SA 3WF0A 4QU1A 5C6CA 1WCKA 2VZTA 2B7YA 3CNAA 2PHTA 4UBGA 3ZFFB 4TTGA 3KB5A 3PMSA 2ZMKA 3LEIA 4XBLA 5I93A 1RVF3 4XHXA 5FV3A 3OOXA 3TN91 2A6ZA 4HFSA 5D8AB 4QX5A 4PQ9A 3TYJA 4NUBA 3QOPA 4AK3A 2GC1A 3OGVA 5FY7A 3APBA 2OQ6A 1HQWA 4FPOB 4YVWB 3ZYBA 2PHLA 4H7MA 1VB2A 1Q56A 3HJRA 3C2UA 3HN3A 3M7AA 3AVRA 4CUAA 2O8OA 2XHKA 5CKMA 2D3SA 1OA2A 2VO5A 1H4GA 3UKVA 1HJGA 2O1QA 4XQ4A 3K4AA 4LT5A 3AMQA 1VBA3 3G7DA 4M3CB 4LBLA 1E5RA 4MUVA 4QQHA 3JB8A 5IW0A 2KXLA 1FV3A 1IKQA 4B7EA 2VOWA 1S0GA 2PHUA 4IUGA 3VZJA 5IK8A 2PHDA 1LU2A 2XVKA 2DVAA 3JCIA 4QGNA 2XHNA 1J1LA 2CAVA 4LO4B 2SLIA 5KHJA 4LIUA 3AFGA 3MIFA 1WKYA 3BU7A 3BTAA 3ON7A 4KBBA 2VVEA 1OD3A 5FO7B 1VBC3 1QOSA 5A33A 4MGQA 3VBRB 1BMV2 1AL21 1WZXA 2B39A 1MR5A 2WFF3 5FO8B 3N9OA 3WQBA 1BQPA 4CEYA 2FDIA 4JKKA 1S0BA 4Q4V3 3SH4A 2BDRA 1GZCA 3B01A 3MZHA 1BCXA 3WHTA 5T5PA 1R081 1OHFA 5A7QA 1OOPB 1VAVA 4LQRA 1D4VB 1SLAA 5J1XA 2DU1A 4K6BA 1V9U2 2IZWA 3MIBA 4BA6A 2RM21 3ZIXA 1AYN1 1NLRA 5GLUA 1ZRCA 3PUIA 1SCSA 1W9SA 2Y26A 3OEAA 4Y1ZA 1WBLA 2JDAA 1LGNA 2J1TA 4FI9A 3V64A 4CCDA 2YZ4A 2B4KA 3WUDA 3PURA 1A8DA 3EMRA 4NN0A 1YO8A 2PXJA 5FYCA 2WL1A 3MW2A 5FZ0A 2HWD2 1W04A 1WGPA 4CXWA 1RJ7A 1UU6A 1PO12 5DG1A 4FFHA 1K42A 2C24A 5FY1A 3J8F2 4AF9A 4P9LA 4RGKA 5EWSA 3ZFFA 2RR12 1GP4A 2ID4A 2ZGTA 1W9WA 2XDVA 3M4FA 3E97A 4FPKA 1OQ1A 1UF2C 4A42A 4CUBA 5A3UA 4NHYA 1Q3EA 1EPZA 5HCAA 1S0JA 1UOFA 2YMZA 5D8AA 3WNKA 1H1MA 4CUGA 5A3MA 1EPWA 4Y1UA 5BNNC 5JXJA 4UAPA 4QT6A 2RMU2 3GHNA 5FZ7A 3OGGA 1YLLA 2W68A 3E5UA 2Z2SB 4KWJA 5CKQA 4LLFA 4MZUA 1POV0 4N90A 1KS4A 5FP8A 4D69A 3BUCA 4BH9A 4M3CA 5K7PA 4AI2A 3WCRA 1RUJ2 2ZGQA 3O1PA 4QX2A 2J22A 5LWBA 1HV0A 4K40A 2RJ2A 4XC9A 1TQ5A 4D0QA 1RHI3 1PGL2 4KL1A 3SKVA 5C8WA 3U37A 1W90A 5C3SA 3AVSA 4DRVA 5CB7A 3UGFA 1WD4A 5J48A 3E6DA 2HWC1 2D6LX 1ST8A 4L8QA 2PAEA 3LQCA 4E8CA 3AFKA 4UW4A 5ABJC 1LOEA 2ETEA 3VBRA 3U0ZA 4P00B 5CZKA 3WG2A 4FP2A 3V0BB 1AR71 1MS0A 1SPPB 5CFCC 3TAYA 1OOPA 1PHMA 4XJ8A 3WF1A 1G86A 4A7ZA 1FNZA 4DZGA 5FYSA 4LR4A 3TN93 1POQA 1DGWX 2WFPA 4FTBA 3VBHC 4NWWA 1N3OA 3RRDA 3H42B 2W91A 2EIBA 3S0MA 4FOWA 1J1TA 5JSPA 5BNOB 1WLCA 3BALA 2YY1A 2VUAA 1RMU3 3KV4A 3ZYGA 1DLCA 2CWSA 3FL7A 4HG6B 4SLIA 1V6NA 5FMDA 4CCKA 4FOVA 4JTOA 3V0AB 1OD5A 1YIPA 4NAMA 1XE0A 2VZPA 3WNNA 4CU6A 4EZ4A 2QDNA 2Q8EA 3TRSB 2HYKA 4M4PA 4BLJA 1M06G 1XYNA 2GDFA 3PVEA 4W65A 5EHDA 1AR83 1F9KA 1JYXA 5J98B 4CRQA 1XE7A 1WW5A 3H3LA 1RUOA 1GUIA 2P3JA 2ZX1A 3W21A 3WLUA 1GFF2 1UL9A 4DIQA 2Y0IA 1GBGA 3HBKA 2Q8OA 4P02B 3VBFB 3ZPYA 1NXD1 2VZQA 3O0WA 5FYYA 2Q8CA 2WS91 1WMXA 3PUHA 3MICA 5LEJA 4IEVA 1AL23 2Z79A 4KH9A 4QKNA 4NIAA 2BQPA 3HWJA 4CTEA 5KXBA 5FZLA 1Z7S2 1RUC1 5FZFA 3G6JB 1R083 1CIWA 1UY4A 2HWB1 3HQXA 4LHLA 3WVJA 2SBAA 1QJU1 5F5CA 2CNAA 4LBMA 2RM23 1BEV3 4E4ZA 2QQMA 1W99A 3NV4A 1AYN3 5LB6A 5FPXA 1O3TA 3AXEA 2P34A 2PFWA 3LIGA 1XNTA 4PHZA 1X7NA 2V5YA 3ITQA 2BV4A 5HV0A 2X29A 3J7HA 5E16A 5FY4A 5FK8A 3NJZA 4AFCA 3WV6A 3CQOA 4LOSA 4R4ZA 2I07B 3LIHA 4N9IA 4AGRA 5JPMB 1MS1A 1MVEA 4N53B 3RS6A 3EHKA 4JKMA 3O1UA 4WZCA 2LALA 1SPPA 4K1YA 1HW5A 4B3NA 2CGNA 4BQ2A 2CDOA 4XUOA 3BIEA 1ND2C 3ZVXA 2Y6LA 1Q8OA 2WQ8A 1F8VA 2FQPA 5FMOL 3JXSA 1ZA4A 1QIQA 2OPWA 1JU4A 1UIKA 2IUWA 3SNMA 4OMDA 5BNOA 3O1SA 3VBOC 2WDBA 4ORFA 4XXAA 4XETA 1C8M1 1ZM1A 3D82A 4GB32 2VG9A 1L7LA 1W6NA 3V0AA 3T1LA 3WQ7A 4LBQD 4BYYA 1C8NA 2ET1A 3OUJA 3NRUA 4IV3C 4TSVA 1NYWA 2GC2A 1SDWA 1JYTA 5EPAA 2R32A 2YC0A 4XVHA 4D7SA 1WCSA 3NV3A 4RHV2 5IVBA 2UWBA 1LHOA 1KJLA 4GJZA 5FTTC 4DRRA 1UZ0A 2XQXA 4IQPA 3AKPA 4NWVA 4HK9A 4A6OA 2QQOA 4KMQA 1PZ8A 4AEDB 1RUE2 2JB4A 2YROA 3M2MA 2BTVC 4URAA 1KEXA 2HWC3 3B94A 4CCLA 3D6EA 5HI0A 1S2KA 1UIJA 4GULA 3VBFA 2CSGA 3I2GA 1QXJA 3H50A 5F5QA 1GQPA 4Z92B 1DQ5A 4XUPA 4BXFA 1WD3A 3IM0A 3FUQA 3NAPA 4AAXA 3LFMA 3RYPA 2GNTA 4KWKA 4YM3A 4NHLA 3GXUA 4PBOA 1XSQA 1AR73 3NJXA 4Q4X2 2WIIB 1YQ8A 3IDAA 3H3UA 1RUH1 4MXVA 2WNVC 2VECA 1K5MC 2VL4A 4COYA 4Q0QA 1COV1 1C5IA 5ANNA 2BYVE 3T4VA 3NO8A 4UW5A 5KHHA 1RINA 4IEOA 4JDOA 1ZBE2 4QQOA 4M3CF 4OMCA 4NHKA 1WMEA 1G9FA 1UCXA 4D6SA 4HVOA 2LRPA 2XJVA 4CXXA 2WO7A 4IEUA 4AFDA 1SMVA 3WR0A 3VDCA 3T2TA 2ZA9A 1EYBA 1UWWA 1YNAA 5IFTA 3W5NA 4RN5A 3UNPA 2J42A 4N53A 4YPJA 1KDKA 2H6CA 2XH6A 3CO2A 1WMFA 3VL9A 4E4DX 5I0SA 3MIEA 2VQUA 3ZXLA 1UNBA 3VBUC 2XWBB 2ZMLA 4ATFA 4S2FA 1WA4A 1URXA 4QDQA 2R042 3HAGA 1JW6A 5A7SA 1H2LA 1YQCA 3OY8B 1D4M1 1TEIA 1WBFA 5AC92 1LOFC 4DUXA 4F7ZA 2ILMA 3CMGA 1DQ6A 4YVSB 5DDJ1 3UYJA 4O7XA 3AJYA 3JD72 4I3PA 2HLEA 2CU5A 2BUKA 3J9SA 2WS93 1UW8A 5FZOB 1QDOA 1X9TA 4RGAA 1OPOA 1LB2A 1AJOA 1NCQC 1B35B 1A78A 3CJXA 1RUC3 4JDNA 4XUNA 3M1HA 4YWAA 2HWB3 3Q8AA 4R52A 3NAPC 3QCWA 1AR91 4LO7A 1QJU3 5A7WB 3WCSA 1YHFA 1R1A2 4PJYA 2BERA 3RMYA 4YG0A 3T08A 1BHGA 4Y24A 3WF2A 4AVBA 2OUJA 3BTZA 2NMOA 3CKHA 3NVCA 2R071 1PGW1 1ODMA 1CESA 2IXLA 3OYWA 3WT3A 1C1LA 1AX2A 1ASJ1 1OI6A 2W87A 4R4XA 1JUIA 5DAXA 3VD9A 1UYYA 2VMDA 3BPZA 2C4XA 3KF3A 2JKXA 4BM8A 4ZU4A 5DG2A 2YDEA 3FHIB 1SFPA 1GSLA 1O91A 2V72A 4TLFA 4ZXEA 2JG9B 2B9VA 3R6SA 4L2NA 5A7NA 5CADA 1SCRA 1K5JA 2JB8A 2TEPA 4PQQA 3AP7A 4L11A 5A32A 1PNFA 1N1TA 2XBO2 3RQ0A 4MGSA 4OI0A 4NVPA 1VIWB 3F2ZA 2R0FA 1JYWA 4XXPA 1KFUL 4AQTA 4P08A 5JOXA 1BBT1 1ULFA 2HWF3 4OCTA 3WNXA 1IOAA 3ZR5A 4P9JA 3LDRA 1IS3A 3PIGA 2RDNA 1RUD1 4ZONA 3BODA 1XE8A 5FYZA 5C8CA 2ZAAA 4XFCA 3FLRA 3D0SA 2VZSA 5LA9A 2VXJA 5CU1A 3WG4A 3AYAA 2P17A 3VKLA 2V73A 3M70A 4BOWA 1VBE1 1VBB3 5K8SA 1EY2A 2JXAA 4ITCA 2R063 3LKJA 4DEVA 5FUIA 5B2GB 1DFQA 4FPCA 4PF1A 3FMGA 1HB3A 3OUHA 2QQLA 3OY8A 4YYOA 5I8TA 1HN0A 3PTRB 4XFBA 4BQXA 5CG8A 4ASKA 4ZS2A 1QHDA 2W39A 4YVSA 1OH4A 2ZHKA 4LJHA 4CPBD 5HCHA 4CU9A 5FZOA 2AREA 3AZVA 2RDQA 4LK6A 1EV12 1W0PA 1W2NA 3P1IA 1B35A 5A3LA 1PGL1 1JOJA 3B3QE 1YQ5A 5F39A 2XJRA 4AI0A 2VBDA 4LBJA 4NPLA 1PO21 4XJUA 2ZZQA 1RUH3 1OC1A 1ZZCA 1COV3 3RYRA 3DPRC 2A6XA 1CQ9A 3KZ4C 4FXGB 4FPFA 5A7WA 5A80A 5JAXA 1KRIA 5FLIA 5LA1A 2QQWA 3DEMA 1RB8G 2AGSA 1GQGA 1Q8VA 4IW3A 3ZKYA 1RUNA 1HIXA 4LHSA 3CZUA 4TWTA 4XZPA 1VMJA 2UY8A 5KHGA 4WVMB 4TXWA 2WQ4A 3MV01 4EN0A 2WYFA 1RC6A 2GC0A 2VU9A 4DEQA 4G4FA 3T0DA 4WM8A 1RUF1 1PIV2 4L97A 4PI0A 1Z78A 4HVRA 2W52A 3PMEA 5DPNA 1W0NA 2A1XA 3ZYHA 5C4WC 3RZJA 2JG9A 5C8CC 4OZOA 1SACA 3NMBA 2JDYA 4IERA 5FPLA 3AJZA 4AFBA 1W8ZA 2BRTA 4HPKA 2DCTA 1X82A 2VVDA 4CU7A 3ZLIA 1CAUA 3U07A 1NE4A 1YFYA 5DDJ3 2BWCA 1W03A 1V00A 1UQXA 2DBIA 2P6CA 3GYDA 5FYBA 2K46A 4DPNA 2IFRA 3FHAA 2GALA 2XL7A 5T55A 1YQ2A 2NM1A 3VHOA 4AQSA 1H4HA 1ZZBA 5IFPA 4EN7B 1Q8SA 3KF5A 4IV1C 5BNPB 3WZ1A 3ZM8A 4OHWA 3DCQA 5FY5A 1G8WA 2G19A 3HQUA 2ZHLA 1OKOA 3NJYA 5IUQA 1GKBA 5T5LA 4CDWB 5DMYA 2A70A 5FJHA 1V0AA 3BYWA 3LZZA 2C9KA 5EJ3A 5LK7B 2FCTA 2DCKA 2VUDA 2R073 2B8MA 1NLQA 3URFA 1A3KA 1RXFA 1VBD1 4Q4Y1 1ASJ3 3ZFEC 3ENRA 4CDQC 3HOBA 2H0VA 1PMIA 1ACCA 4XJZA 3J7LA 1Y9QA 1ZRRA 4Y33A 3OGSA 2W9XA 3QH7A 4M3CE 1AUYA 1KD7A 4QDSA 1RGSA 3WOGA 1QJX2 4M01A 2PHWA 4NHXA 1EUUA 4UFIA 1GZTA 4WM8C 5K4LA 4UFHA 1TME2 1W2OA 4Y5Z0 1R092 3KLSA 4JQRA 4MV2A 5T52A 1VRH3 5FO9B 1TMF3 1C57A 2X53S 1W3VA 5C7GA 2Y6FA 3KMHA 3QD6A 4QX1A 4HN1A 1D7PM 4PLMA 3AKTA 4Z2WA 3A4UA 1XB9A 4JGZC 4WVMA 3O0VA 5A1LA 4IGOA 2JICA 1RUD3 4YNIA 4B4PA 4E2QA 4R9AA 3VV1A 3LOBA 4OFGA 2OKXA 4JAAA 2CGPA 3ROUA 5IVVA 5FXXA 2WR9A 2WT1A 4XQDA 1V6IA 2OW4A 3ACGA 4OUMA 4QX7A 3WHUA 4PBPA 4B1LA 4CEWC 4M0HA 3HQRA 5FLJA 1VBE3 2JD4A 2ZXQA 4G9SB 5AVAA 2CV6A 5CFDB 1AXKA 2ZOEB 3KVBA 3AXDA 2RS32 2W08A 2FMDA 1YRZA 3MPBA 2QQNA 3HR9A 2GH2A 4FFIA 3WQ0A 4F3JA 2VR4A 4N43C 5SV8A 4HMZA 4KQ7A 2UYAA 1MS4A 1OH3A 3NW4A 3H1WA 2GP3A 2CDPA 4YGEA 2WNUC 4OQ8A 5LA2A 2W94A 1J58A 2EIEA 2VNRA 1D0GA 4QMAA 5I8YA 2NYYA 3LEGA 4RA0A 4JQTA 2QQKA 1RUI2 1MS3A 4Y26A 1AR62 1V9U1 2WZEA 1OF3A 4YG6A 5BNPA 3MUZ1 1PO23 5B4XA 4Q5OA 4C0HA 2VXRA 4XUTA 4XHBA 4ZHNA 5K0UB 4AXOA 4CDWA 3N7MA 5F6KA 3PLQA 1I6XA 1RUG1 4IE5A 3C7EA 2JDZA 3H0OA 1QDCA 3RNSA 1NX9A 3KCYA 4A3ZA 5KC5A 2HWD1 3N4MA 1LU1A 1DF0A 1PO11 4MH0E 4BZ4A 3J8F1 2NP0A 1QJY2 2VMIA 2WAAA 3EB7A 3IDCB 2RR11 3ALQA 4GAZA 1A6CA 2PHXA 5FOJB 1IZ3A 4H55A 3SH5A 5FYHA 1RUF3 2XMLA 3N7JA 5HCFA 3ZN4A 2K9ZA 4FCAA 1SFYA 1JUHA 2X09A 3THTA 2UU8A 1HQLA 1U5ZA 4S2GA 4LTAA 3NWKA 1KXGA 2WQZC 1Y4WA 3RGBA 3T0AA 1LAJA 4FVVA 2QE3A 3WDUA 4BDVB 1J3PA 3AP9A 5CEHA 5FDBA 2RMU1 3WSOA 2QQPA 3ETQA 3P5BA 5C9AB 5L7OC 2FBEA 2ZGMA 2XONA 2K2SA 1WCDJ 3GJAA 1GANA 2DVDA 4IE7A 1TNRA 3O1TA 4E4HA 3MYXA 2XLAA 1QY4A 3C7GA 3I59B 1Q8PA 2ET7A 3DGTA 4LK7A 4X8NA 3MBWA 1DU3D 1IS5A 1O8PA 5FPAA 1DIWA 1PVXA 1RUJ1 1YJKA 2KR2A 4CSWA 3CHXA 4Y22A 2E63A 4PIXA 3ZYFA 2D6NA 5AFBA 4XOGA 3IPVA 2BGPA 4ZZ5A 5I0DA 1DZRA 1VAMA 1H8TB 1H6XA 1ZX5A 1NQDA 1QOTA 1H9PA 1PMHX 2VE1A 3EBRA 4Q1RA 2ERFA 2BWAA 4ARXA 3NQHA 4M0NA 3JQWA 3LOIA 2OXBA 5F2SA 5FZ3A 4RR3B 5CFDA 1WMDA 2ARAA 1V6LA 4AFMA 3LSEA 1OVPA 4ZKTB 4FQZA 2DCJA 2WC2A 2O14A 2WT2A 3CEWA 2W2IA 4B4RA 4E9KA 4E8DA 5FPBA 3TEWA 1RVF2 1ZBA3 2Q8DA 2Y60A 1SLBA 5FYTA 2J1RA 2QKDA 2ZX0A 3I2IA 1VBD3 3K3NA 1LOCA 4R9BA 4AAPA 1JYNA 5CG9A 2MEV2 1O4YA 1DGLA 1XC6A 2GMMA 2VD7A 2XG3A 1FPN2 1H30A 1CAWB 1HRV1 2EXKA 2R16A 2VZ1A 3DL3A 3NL1A 4BHPA 2VGDA 1R64A 4P9IA 5JMCA 2B45X 4C1WA 4I0AA 1C28A 1O4ZA 3VD4A 5CVRA 5C5TA 4JRLA 4MHRA 1OMIA 2BFUS 2WNEA 4P9XA 2ZGUA 1H2NA 4KI5M 5LATA 3CBNA 2D6OX 2Z5WA 2W47A 1MQTC 1UOBA 5L9RA 1W39A 2QBXA 2DUQA 2OX0A 1SZBA 4I0BA 5K0UA 5IT6A 1Q8QA 4AHZA 5IVFA 4CU8A 1F5JA 3VZKA 2JIGA 4TN7A 5C3OA 2W1QA 5IVCA 2VW0A 1SQ4A 1O4TA 1YQ6A 4OUEA 5FKBA 2WYSA 4GZ9A 5FZ9A 1I5PA 4DB5A 1V70A 1W6QB 4NO4A 1Y3TA 3KV9A 4RS5C 3ZPOA 1UMZA 1X50A 1C5HA 1GWMA 2C6SA 2I45A 2XKOA 3CDZB 3KWVA 4QPIB 4AI3A 4QU2A 4XFAA 2VCAA 2AYHA 5IAVA 3RVHA 4Q4V2 1FMD2 3BIWE 2QQJA 2WINB 3LEMA 3ELNA 1DP0A 2X5IC 1LOGA 3GCWA 5FBJA 1B09A 4ZU5A 4DUWA 4IEWA 3USUA 3B9IA 4E2SA 5C9AA 2WN2A 5FXVA 4Y4YA 5FZ8A 1AZDA 1GNZA 1AVBA 3AX4A 1YCIA 1T6GC 3AK0A 5A3WA 1J3QA 3ZFGA 4BMEA 3WDTA 2EXIA 5A6QA 1F15A 1Z7S1 3I59A 2VZUA 4DO0A 1UAIA 3BKZA 3ABZA 5HXMA 2WZR3 1TE1B 3THPA 1GOFA 1DGWA 2ZEXA 4AVVA 1LRHA 2RS52 3A21A 1S2EA 4UT5A 4GWJA 1V9U3 3AP5A 4YW2A 1G9DA 1FT9A 1H8TA 1V6KA 1HV1A 1X36A 5FCCA 5FKCA 5A6YA 2VBBA 3OF1A 3AM2A 3HNMA 4GKXA 1NCRB 1DQ2A 1W06A 1NXMA 1QXPA 2HBTA 3IZOA 3VZNA 1H2MA 3KQRA 1RUG3 4K3UA 4L92A 4QX3A 1R1ZA 1V6MA 2ARBA 2E7QA 1H2KA 5H9PA 1DLLA 1QH6A 2EXHA 1W0OA 1GWLA 1UXXX 2A7AA 2HWD3 4UFMA 4YVWA 1AXYA 5JIAA 3ZXGA 1PO13 3LF7A 4Z07A 3J8F3 3T1MA 5EZWA 1CAWA 2FDHA 1MZEA 3GZAA 2WABA 3VDDB 4QPGB 2P6HA 3BVCA 5JI7A 2VCCA 4CEYC 1J59A 2QFEA 4EN6B 4EQVA 1M4WA 2R7EB 1C3HA 1ULDA 3MUY1 3RFRA 1CAVB 4IEYA 4LE3A 4QHOA 4DY5A 4Q0PA 4XFHA 1RHI2 4XFIA 1TG7A 4CDUB 1NZCA 3FWEA 4GB31 2ZX4A 1VALA 3A22A 3KCCA 1OPMA 2HKXA 2WLQA 3T30A 5C3PA 1XOYA 5KWRA 2W46A 5DUVA 2UURA 4J25A 4C1XA 5EP9A 4A2UA 3DUIA 1RUJ3 3J7NA 2RS13 2BOJA 2OS2A 3ZFGC 4RHV1 4RQPB 4QPIA 3C7OA 4AEJA 5FY8A 5GZEA 5FZ6A 2XL9A 2VZRA 3ILNA 2B9UA 4V1PA 3RWNA 5CYYA 2VBPA 5EXOA 3M8LA 2ZHMA 1RUE1 2NPIA 4Z1VA 3VL8A 5BYNA 2PLV2 5DAQA 4QHBA 2D5FA 5EV7A 5DUXA 3U78A 5LZ6A 2VUJA 3SCHA 3ZFFC 4MLOA 1GOGA 4BU2A 1XXNA 2LW8A 3AMPA 4AHWA 4DNYA 3JU9A 3VDBA 2WJSA 3MF6A 3NV2A 3A0NA 4CUCA 3HNBM 3I3BA 5D8AC 2QCSB 1KGYA 2VOVA 4Q4X1 1HRV3 1N1SA 3IBMA 1RMU2 1PX3A 4QKFA 5LBBA 4D3WA 1ZZ7A 5JOZA 1CJPA 3AZYA 3MEPA 4YVWC 5GZDA 1W8TA 4HK8A 4D8MA 3O1OA 1GOHA 3R4SA 5IHRA 2A3XA 5SV5A 5KXCA 1PVC2 2CGOA 4J6GA 1ZBE1 5JCTA 3E6CC 4A45A 4CCNA 5JXHA 1NCRA 4KWLA 4D6RA 3POFA 5CBLA 5LCWL 2Q5TA 1AR82 3K4ZA 4H7LA 1S2BA 3B5LB 4YGBA 1TZOA 2UWCA 5F3GA 3FE5A 5GALA 1OUXA 4XBNA 1JHNA 1MZ6A 3AP4A 1W8UA 1DYKA 4JHZA 4URTA 3WDXA 4NJ4A 2XB6C 1E5HA 1LESA 4QB2A 4AVSA 3ZXAC 1HX6A 2DCYA 2WUHA 2ZGLA 4B7KA 4JHTA 2PYTA 3GHMA 1AL22 4LBQB 3MLLA 2IC1A 4FPYA 2ZGNA 1QMJA 5HCBA 3VBRC 1CX1A 5GLWA 3U1XA 1CZTA 1I5ZA 2R041 1GMMA 2RG4A 2WN3A 3R4DB 4DXRA 5J7MA 3TEZA 3BTXA 1ALYA 1CD3G 1UD1A 4Q4W2 5AC91 2ZHNA 5GZGA 2ZGRA 1C1FA 2VQAA 3ACLA 3BOWA 3JD71 4QPYA 3ZKUA 1OOPC 1UN1A 4WV8A 3ZSMA 1DCSA 3VB9A 1BEV2 1LECA 3AKRA 3H7YA 3WXPA 4CDUA 3SKJE 2WNOA 2E33A 4YRDA 4A7KA 2MPFA 4NROA 4LBOA 5BY5A 1LGBA 5FPZA 5FZCA 2BOIA 3RZZA 1EAH2 3H8OA 1VRBA 2OIIA 3SQOA 3LDKA 4A41A 3OUIA 2DU0A 4XABA 1UXZA 3IMNA 5LY2A 1R1A1 3FHQA 3MLJA 3N3HA 3V0BA 2EAKA 2HWE2 3H3ZA 3I2JA 3RPQA 1U5XA 2RDRA 2VQ0A 2YBKA 2XKPA 2TUNA 2WKKA 3J7MA 1OQEA 1S4CA 1REFA 1LHUA 4OLLA 4PF5A 5T5JA 2JJ6A 4CXYA 1O3RA 3AB0A 4IL7A 1DQ4A 2FZ2A 3HBZA 1WUVA 5L9BA 5DN2A 4BQ4A 2XOMA 5I0TA 1NQJA 3POYA 1DG6A 2XQRA 4YW3A 4QX0A 2ZGOA 1DHKB 2VCBA 5BNQA 2XJQA 3KM5A 1W6PB 5EIYB 1XJAA 4HN0A 4NOTA 2JWPA 2FCUA 2C26A 1YEWA 4WVWA 2XBO1 5LBFA 4V2WA 2YC2A 2D6MA 1CN1A 1PNGA 1S55A 4GXLA 2OPKA 3E6BA 2E7AA 2VZVA 1MACA 4HZFA 1YC61 2JDUA 4LA3A 1GWKA 1UOGA 2XJUA 4GB33 1CPMA 4MGKE 4HETA 4LNVA 1Y43B 1L7RA 1CIYA 1GYKA 1VR3A 1Q43A 1W3XA 1GLHA 4AVAA 4HKLA 2Y6KA 3POWA 2VC9A 1LEDA 4RHV3 2ZAHA 1UPSA 2E7TA 2VTXA 2AENA 1UKRA 3SEEA 3SLIA 2IVIB 1QJFA 3ZSJA 2OT7A 4LBQA 1FX5A 5DABA 1RUE3 2IVJA 3U75A 4LO8A 2ZMNA 3IIIA 4IEZA 1KITA 1QQP2 2BEOA 5IVJA 3I2DA 4CCMA 4ZU7A 3AC0A 4XIOA 5A6XA 3PDQA 1N3PA 2HEVF 2AEZA 3GBWA 5F8PA 1F4HA 5FZ4A 1EV11 5DZFA 3SHRA 2JECA 2YU2A 2FHRA 1ULPA 3AMMA 3SISA 3I8TA 3GCXA 4Q4X3 1NZIA 1D2SA 3H1YA 4D6QA 5BNOC 5C5UA 3I3MA 2UY9A 4PDWB 1ODNA 2QDRA 3AL5A 1ZBE3 3B9CA 3GALA 1NAEA 3N7KA 2Q1MA 5JZGB 4I2OA 2BU9A 4R9DA 3WNMA 1JI6A 3GDBA 3NKGA 3UKNA 1JOBA 2Y6HA 4GQ7A 2OZ6A 3ZX7A 1APNA 1J84A 2OVUA 2WO1A 3K46A 3ECQA 4DXZA 1OQDA 1W2UA 5LASA 5FUNA 3ASIA 5AFEA 3D3AA 2JE7A 3K77A 1CVNA 5EYYA 1GNYA 1W2TA 3PJQA 1HXS1 1LTEA 4DQAA 2PTMA 3JB4C 2QUOA 2WS92 2D7FA 3VBFC 3WNLA 4BWOA 4AG4A 3I4IA 4EZHA 2YXSA 2BNNA 3DF0A 3VBSB 4XACA 4W8JA 2ZKLA 3CJIB 3F95A 4W6WA 4Q8KA 2LROA 2D93A 4JGYB 4JRAA 5AC93 4NHMA 4S2DA 1JMUB 4HONA 4QPWA 4LITA 3JD73 1AL0G 2HEWF 3S7EA 3A23A 4AEDA 4XTMA 5HXVA 2B5HA 3OSDA 3M3OA 1KDMA 2P3YA 2TBVA 3IN9A 4BJ0A 4QXKA 2VAUA 1F4AA 1LHNA 2JIJA 2A73B 4BMBA 5KXEA 2PAKA 1GP5A 1PK6B 2ADEA 2EA7A 1OFSA 3LFIA 4FO9A 4AVTA 1IHMA 4QAWA 1R1A3 3QH6A 1DGRN 1SLCA 3A0KA 3H8UA 4COWA 4Y5TA 2JDMA 5F3CA 1NLSA 4N53C 2X10A 1HJFA 5KHKA 1JYCA 2E9QA 4N8MA 4KU7A 4IESA 2W92A 3ES4A 3AKQA 1NA1B 2R49A 1KQRA 1RIRA 2ZACA 1YWKA 5FZMA 3S5QA 4CDXB 4R8HA 3C3VA 3EJKA 2J1EA 1I9RA 3AKSA 4NE9A 2RV9A 1C8M3 3O0XA 3S30A 3HPNA 2HWF2 5FZBA 4U36A 4FFGA 4QQLA 4GKYA 4ZXKA 2HJIA 4BIFA 3POBA 4NPMA 1JN2P 3HT2A 4META 4E4SA 1UO9A 3UGGA 2AUYA 1TME1 3PVOA 4PDWA 1R091 2XBO3 4L99A 3TWIA 2JDPA 3RDIA 1IQDC 2D97A 4OULA 5CKNA 2GAUA 3NNMA 2DBNA 5JZGA 5IK5A 1O5LA 2P37A 4EROA 1VBB2 2YBSA 4IE6A 4ET7A 1K45A 3U4SA 4W6XA 2BZDA 1VE0A 2R062 4HL0A 5L9VA 5FWJA 3J4UH 3MIDA 4PCRA 3ATGA 5GLVA 4K21A 1UY1A 4MYEA 3PNAA 1MEC2 4AI1A 4AEDC 2R30A 3B00A 5JR7B 5FP3A 2IFWA 3U10A 3ETPA 4B8EA 4XQWA 4EJRA 4WM7B 4YGDA 4BLIA 4CCCA 4YW7A 3VKFC 3UT0A 2W3JA 1TVGA 4GIQA 4JDMA 4ZZ8A 2RS31 3VBSA 3VHRA 1IS6A 4FPHA 2EALA 5CAZA 2BVVA 1MPXA 2JG8B 4JGYA 3VDAA 3Q8CA 4YZ2A 5IYYA 4XMAA 4X8PA 5DUWA 3WW1A 1SFNA 5FFOC 4XF4A 3RZLA 2FDGA 2Q30A 3I49A 1BXHA 1EV13 1MS8A 4RFRB 1AR61 5C33A 1ENSA 4UFKA 4YG3A 5FLHA 3D5OA 4QXBA 1W28A 3BN6A 4JVAA 1PK6A 2ZABA 3FC0A 4QKDA 4MHUA 5LRRA 5TSWA 5IK4A 3BI3A 1O3QA 2VTFA 3DXTA 4I3GA 3K51A 4Y1XA 2VOXA 4MXWB 2OUHA 1MZ5A 3WQ1A 1NKGA 1NUKA 2OQ7A 4YW6A 4XE9A 1N47A 4MGTA 1HRI2 3JQXA 3EYPA 1FYUA 3IDBB 2WRAA 2LM3A 2VOTA 2YC4A 3N9QA 4I0WB 3MIHA 2A5ZA 4HBNA 2JDKA 5J3UA 1D4M3 1NA1A 1QJY1 5FZHA 4A3XA 4CDXA 4LORA 4EWDA 1SBFA 4YZ3A 3DKWA 5FYIA 4UFLA 1D0HA 1STMA 3WNOA 4S2HA 1H8VA 3KSCA 5DDJ2 1US3A 3GJBA 1HXS3 3UK9A 1UU4A 4NPRA 4YVSC 4ARYA 4PLOA 4FTSA 2G4IA 4I01A 4GWIA 2DF7A 3FBMA 4GH4B 4HXCA 1AR93 1XNKA 2YPDA 4Q29A 4LE4A 1ENQA 4UW3A 1JXNA 1B35C 4HOOA 4O9EA 1ZREA 2XXZA 4UF0B 4GMP1 2FZ1A 4YGCA 4YW1A 3VGIA 2EICA 2BPA2 2D43A 3IT8A 2E53A 2O0OA 4CZSA 2YB7A 3ME2A 1ULGA 4RYDA 4BIOA 2E51A 1LOBA 4IEPA 1CONA 4DXTA 2ZGKA 3WF3A 4K7JA 1UZYA 1FAYA 1LEMA 1QNYA 3D4KA 2FCVA 3VHNA 5A6ZA 1BK1A 5APAA 1CZSA 5IJRA 5T5OA 1P8JA 4KGQA 3T3YA 5LEKA 3MFAA 3DN7A 3RSJA 4Y3OA 5F1RA 3RI9A 4M00A 5H9QA 4OI1A 2PN5A 2L9LA 5M0TA 4BQYA 5GLTA 2Q1ZB 2VMHA 2ZJCA 2JG8A 2PELA 3AL6A 1LJ7A 4UI9L 3TB0A 3WW2A 4CCOA 1S0CA 4FBFA 1OVSA 4RD7A 4Y20B 3WY6A 2JG9C 2MEV1 4TLGA 2ZEYA 1FPN1 1IG3A 4LKSA 2ZBJA 4LXLA 3SXWA 1JZ4A 1BBT3 4LHNA 1VRH2 3WP3A 3MFCA 1TMF2 3RMXA 2WLPA 3CU7A 1OLRA 1W6OB 3VKNA 4CCEA 4DOUA 1X8EA 1AYM2 3OJBA 2A3YA 2AEYA 1PMJX 4BQ3A 1F31A 5FZ1A 3V65A 4LPLA 2AC1A 5GM0A 1JS9A 1TME3 4MXWA 1GICA 4M4RA 4O9GA 2B46X 2ENRA 3GF6A 1MS5A 1XNBA 4XTPA 1BVVA 1WCQA 1J83A 2ZPXA 1W6MB 4QXCA 5EYXA 1CPNA 2WO2A 1S0EA 4HLTA 1G7YA 3RYKA 4XZUG 2EVXA 1FOD2 2JD9A 5FR3A 1BMV1 1SG3A 1UZWA 5BV6A 3E5QA 3RG0A 3C7HA 3KHCA 5ACA2 4Q4V1 4ZS3A 3ZXJA 3SH3A 1FMD1 5T3NA 2NN8A 4QQ2A 4B29A 2YPJA 5F37A 3RZMA 4FPJA 3BTYA 3KHBA 1XBFA 2DDUA 1QH7A 4E27A 2DVBA 4IDZA 2RS33 2WZ8A 3KT7A 4I30A 3H7JA 3I7DA 3KS7A 4UXAA 1FV2A 4BQWA 5GZCA 4GH4A 3ES1A 1W9FA 2GNMA 5FUPA 4JCKA 2GMEA 2WWSA 1PO22 4PI2A 5BPXA 4AWDA 4UF0A 2DV9A 2CYFA 4C91A 3OTFA 4AQ2A 1UX6A 5IWFA 1DDLA 2C1FA 3NNFA 3GGLA 4JX0A 2RS51 4EN9B 3ILRA 4DMIA 1S1AA 1AR63 1OKQA 3FBYA 5J09A 4OI4A 2VZ3A 4MX3A 3S5AA 2BVBA 4MGYE 1E57A 3KT4A 5I0RA 3OB8A 5I91A 3UV9A 4COUA 4Q27A 5BNNB 3U11A 2ATFA 1RYYA 1ZRIA 3SCFA 2IWGB 5C71A 4XAAA 3K4DA 3JBG2 2VW1A 3KV6A 4J1WA 4QQPA 5DZGA 4AI9A 4EV0A 2YGMA 2ORZA 1W05A 1JHJA 3M3QA 3RJRA 1SLIA 5FP4A 5JSRA 4Y20A 1JZ2A 2PQQA 1YYNA 3LEKA 4FP3A 3N36A 2VVFA 5E8AA 4DS0A 3N7LA 2WAOA 5AVPA 3THDA 1W6OA 2Y6JA 2WSVA 3OGJA 2P4EA 1LOAA 2NLRA 3N9LA 2VH9A 3KGZA 4BISA 4IEQA 4P9YA 4RS5B 4XJ9A 1RHI1 4N7UA 1K3IA 1OLQA 3IMMA 5DQ0A 2EF6A 4AYUA 1JYVA 5ABJB 1BK0A 2GSYA 4GMP3 5BNPC 2XGXA 5EFUA 3IB3A 4J1XA 5JWPA 2DCZA 5I8SA 1KJRA 1HKDA 1HB1A 3FFQA 4LLOA 2PAMA 5F32A 4YFZA 4Q4Y3 2JDNA 3AZWA 4CDWC 5CFCB 1T6BX 1ZBA2 4IE0A 1OFNA 1YUDA 4AI8A 4NIHA 1LODA 4Y5SA 3I2FA 1LNSA 5FZGA 4XJWA 4L0PA 3O1MA 1VMHA 3I2HA 2PLV1 3VBHB 3HT1A 4MGIE 5C3QA 2VNVA 4IE4A 3U14A 4CVUA 1I1EA 1UOJA 1OSGA 2E31A 1VBA2 3D0JA 3M3CA 4DY3A 3KVAA 2JE8A 3OPZA 1W8OA 2YYOA 2IXJA 1ND3B 4GWMA 3INAA 3ZXKA 2A6VA 4LKDA 1PM4A 2MEV3 1OLME 3HD8B 4WVVA 1FPN3 1QKQA 1LULA 3N9MA 1RMU1 4K8FA 2VMFA 3I54A 4LBNA 1OBNA 2VM9A 4PIZA 2PMWB 5LA0A 3WG1A 2VOKA 3MO4A 2GNBA 4HSJA 1VBC2 1PVC1 4XW3A 3DXUA 3CZJA 5DZEA 2WFF2 2EIGA 2QQVA 2JKBA 4Q1PA 4PIYA 1AR81 5E6HA 5BNNA 2CL2A 1O59A 2XR4A 5DXDA 2N7GA 3HIFA 3GBGA 1CJDA 3ZDSA 5IK7A 3Q8FA 4HKWA 2C0ZA 1YFWA 1IPSA 5CFDC 4IGQA 5HPOA 3VN4A 3L2HA 3ZO0B 1FI2A 3ZOIA 5A70A 3OPTA 4LO5B 2DFCA 4JKLA 1FMD3 1HDKA 2DUOA 2Y6GA 3M3IA 1NY72 4D94A 5LK5A 4KU8A 2XVLA 2RVAA 3ORJA 2WZR2 4Q4W1 3RZHA 2RJLA 3GZEA 1QU0A 2BJSA 3WW4A 4LULA 4CYDA 3FJSA 1Q5OA 2J1VA 1GNHA 2BNMA 3L9JT 1BEV1 4GD4A 4JTNA 4KGGA 5EJZB 3UKTA 2JE9A 3BCWA 1BKZA 4H2AA 3UETA 1XNCA 1ZA7A 4RR3A 5ABJA 1V6OA 5KC6A 2DVFA 3KD4A 1UY3A 3B69A 3KV5A 2ZEZA 1EAH1 4XMIA 3O1VA 4ES8A 1GZWB 3IWZA 1WLDA 1YJLA 2YG0A 2RS53 5ERLA 5FMCA 1RUG2 5K0UC 3ST7A 1ENXA 1WW4A 4MO3M 5CFCA 4LEJA 1LGCA 1UMHA 4JV4A 4D7TA 4XUQA 4Z8BA 2FDFA 3IAPA 3QLQA 3AYCA 2HWE1 3P3PA 2RR13 4FFFA 5JMOA 1ND2B 3KT1A 2GZWA 1BYHA 1N3QA 5FYVA 5DAWA 3VBHA 3U4XA 1LCLA 2KD7A 3RI8A 2GP5A 4YW4A 4BPZA 4Q0SA 1AJKA 3VBOB 2QQIA 3QACA 2W1SA 4AR2A 1BLZA 4BQ1A 1JZ5A 2RMU3 1N1YA 3PL0A 1ND3A 1ZVFA 1U5IA 3VKMA 3WP6A 1AXZA 3WDWA 2RE9A 2WBKA 4LMFA 2QZ2A 1DZTA 4IV3B 3TBDA 3DYMA 2JENA 3WW3A 4OHZA 3E1F1 5JXIA 1W8HA 4XEZA 2ES3A 5C9AC 2I2SA 1QWRA 1UY0A 1W6QA 2GH8A 1WCUA 1CZVA 2Y0OA 4QB1A 5D2AA 1VAKA 2G9ZA 3FN9A 1F2NA 1ULEA 5FOBB 2XJPA 3GZTB 5DAVA 2HH9A 2RS12 4G3YC 4MOAA 3HVDA 5T50A 5JPNB 3PU8A 2NZ9A 3H1MA 2JX9A 4LO6B 4DXSA 3LPFA 1H8TC 4LKEA 3MPPG 5JXGA 4X6QB 1LHWA 1BZWA 2TNFA 3OG2A 4IXLA 3VLBB 2DTWA 1G9CA 2W0XA 3VZOA 5GJ6A 2Y34A 3TN92 2WSUA 3UL2A 4K1ZA 3B93A 3WX5A 5JSOA 1D2QA 1XSRA 2HBUA 3LPGA 4RR3C 4OVEA 4NR1A 2PQSA 4WVZA 2WNVB 1K5MB 1UY2A 1XPWA 3MDPA 4AVCA 1G9AA 2PLV3 3LDBA 4QGMA 2KM2A 1HRV2 1QQP1 2VUCA 4LKFA 2A75A 4BE3A 5C70A 1YFUA 1IPKA 4IGPA 2FMYA 4O61A 3TNQA 4BK5A 2A6YA 1E5IA 1W9YA 4AL9A 4WBBA 1XRUA 1DYPA 1ZZ9A 1RTVA 4NRMA 4HKOA 4YZ4A 2Z42A 3DKQA 1G6NA 2QZ3A 3T0BA 2VMGA 4N9HA 4QWNA 4DINB 5KR7A 2P3KA 1DYOA 2ORXA 1GZWA 4GMP0 2I74A 2QQUA 3FZ3A 3S7IA 1ND3C 3QBQA 4P5HA 3ZYPA 1W6NB 1QF3A 3DYOA 5BUVA 3LE0A 3LAGA 2YGLA 3MW4A 4AEKA 3VBUB 1PVC3 2QNKA 4RGGA 3OEBA 3PUAA 5F5IA 3FX3A 1ND2A 3VDDA 2IXCA 4QPGA 4MGZE 4ASMB 2MNGA 4XIKA 2Z69A 4QPIC 2F4PA 4XF0A 4FTEA 3BGAA 1JZ6A 1R082 1CAXB 1H9WA 3VBOA 4A44A 5F3EA 3T2QA 3WUCA 1CAVA 2VTXJ 1YI9A 4YZ1A 2RM22 1NCQB 5HBAA 1AYN2 3SC7X 4IV3A 1Z7S3 1X33A 2FDJA 3NAPB 1UYPA 1IQAA 4FT8A 4YARA 4EWAA 1DZQA 1OF4A 2RJKA 2R6QA 3WDVA 4LOTA 1NE6A 4ISQA 4INDA 4RQPA 4Q4W3 4XAEA 1Y9MA 1HB4A 3C8XA 4NRQA 4Q0VA 3N9NA 2VY0A 5JI9A 1CWPA 4EN8B 3FLTA 3LA7A 4HSLA 4HVQA 3Q8BA 5FWEA 1UKGA 1L3JA 3SCGA 1GR3A 2BGOA 1NOVA 2G9FA 4B1MA 3WF4A 3NNGA 1GP6A 4TZDA 2DWRA 1SEFA 2BP6A 2BBVA 3DYPA 1O6UA 1IKPA 1EAH3 5JR2A 1MZFA 1YI7A 3MGUA 3WNPA 1NCRC 3DV8A 2CWMA 2W1WA 3LA2A 5E88A 2YV8A 3FFZA 5L36A 1QJEA 4UYBA 4F8AA 1RITA 2EAAA 2HWE3 1K5MA 2WNVA 3E5XA 5A7PA 1JU3A 3R4UA 4O65A 3ZSLA 4Z2AA 1IS4A 1JBCA 1X9PA 2ZGPA 4C90A 2ZX2A 4PT6A 2JEMA 2YBPA 4W6YA 4N7IA 1G9BA 3VUOA 5LRSA 2FD8A 2GN7A 1QGLA 1JZ3A 1US2A 1OURA 2AH2A 2PA7A 3LGRA 2R1DA 3VDDC 4NIDA 2D5HA 1UX7A 3I3QA 4QPGC 1Y7BA 1VB4A 5CNAA 1OLMA 2O8QA 3W20A 1QEXA 1OXCA 2HWF1 4LA2A 5FZKA 1AF9A 3Q8EA 2BNOA 3V56A 3VZLA 3RZGA 4KNCA 3POIA 3AMNA 2HWC2 3UESA 4UFJA 4ZPIA 1IPJA 4CDUC 5A1AA 2GNDA 2ADDA 4OQ9A 2Y64A 3AZXA 3VBUA 3N35A 4R9CA 3KCXA 4YLZA 5LBCA 5FREA 5FZIA 4FAGA 2CTVA 1VBB1 3NV1A 1LOFA 3GZUC 2R061 4RQPC 1AR72 3T4HB 1CAXA 1SBDA 1JOPA 1O5UA 4LUKA 4QDRA 3NJVA 5F6LB 1MEC1 3K2OA 3ACHA 3OYWB 4IETA 2W95A 2AACA 4Y1VA 5E1RA 3NKTA 3A7QA 2C5DA 1NCQA 5DAPA 3ZYRA 2DYCA 3LCPA 3IIAA 2VQTA 3WG3A 3O5SA 3VD3A 4FPLA 1SHWB 1XU2A 3DPRB 1ZRDA 4MVTA 4GWNA 2VPVA 1UYXA 3LWCA 2DFBA 3NNLA 1XYPA 3RZKA 2PHRA 1QQP3 3EO6A 1O7FA 2D6KA 2W5FA 4C0BA 2DVGA 4KWUA 5LBEA 1OT5A 4ES9A 5FPUA 5A32B 3ZYIB 2P5BA 1ZNPA 3HN1A 2WO3A 2NMNA 4CE8A 4Q8LA 3K75B 5FP7A 4COVA 5KXDA 3MLKA 3OGRA 5JVVA 4FOYA 5B4NA 2D98A 2LS6A 4OUSA 4YM0A 3PIJA 5GLZA 1YFXA 4FOQA 4QKBA 3O7OA 4XJAA 1UYZA 4W4ZA 4KG8A 5IVYA 2QJVA 5C4WB 1PIV1 3I97A 1SDDB 4K9SA 4AEMA 5C8CB 2Y33A 3NSTA 5A3NA 1JZ7A 2CAUA 1W6PA 3S6PA 2R1BA 2WT0A 5L19A 4P9WA 1HRI1 4RL7A 4X6RB 2Q0AA 4AHXA 4A7YA 2HYXA 4PLNA 3PUQA 4HT1T 3UGHA 2GC3A 3CL1A 5A3TA 1U12A 2XLGA 2R043 4IEXA 1RUC2 4NAOA 5FAXA 2HWB2 4HANA 1ZZ8A 2XVGA 2A71A 5T54A 5IATA 5J37A 1QJU2 2J7MA 1VMFA 4UBHA 3PTYA 4GALA 2WA3A 4GJYA 4TYSA 4EE2A 3OCPA 4IV1B 1PM7A 1YXWA 2OA2A 1DQ0A 4AOCA 3H8RA 4QGLA 4EWEA 4RFT0 1ENRA 1A8MA 2ZS6B 3OBTA 2V5DA 4H3WA 5CISA 2VNOA 3CIHA 4ASLA 1HN1A 3RWKX 2AZ5A 4Y1YA 3LSDA 3Q9OA 5FMBA 4ONUA 5FMOS 1UZZA 1S0DA 4C8DA 3K3OA 3ZFEB 3WDYA 4OZXA 3IKWA 1GU3A 2Y8KA 3MW3A 4WZFA 3ZR6A 1W8WA 4CDQB 5KHIA 5GKAC 1OUSA 3L2YA 3NNJA 3GNEA 2Q4SA 4AQ6A 4F83A 5FXWA 4V2VA 2P3IA 3W58A 5JOWA 3SITA 5CIRA 3VD7A 1H0BA 3AP6A 1SLTA 2F4LA 2ZX3A 4NRPA 4AFAA 5JLVA 4WM8B 4AGGA 2Q1FA 1LHVA 3DPRA 3JUUA 1C8M2 1QJX1 1SLLA 4Q26A 2D3PA 3N9PA 2E26A 5FY0A 5LW9A 3ZSEA 5FZDA 3FUOA 1K12A 3HEIA 1RJ8A 4HPKB 2DUPA 1GQHA 1UMIA 4CP2A 3AYDA 1NG0A 1CAUB 4JGZB 1VRH1 3T2OA 1WWYA 1TMF1 1H1IA 2OZJA 3O14A 1KS5A 5F3IA 5I0UA 3VD5A 4A4AA 4Z82A 4CP1A 1UPIA 3CLPA 3ZDVA 2QVSB 3ZYJB 3GBFA 1JH5A 1AYM1 1XQNA 2BGCA 3ZMNA 2UYBA 3OBRA 3BOPA 1J3RA 4XILA 5BXXA 3VKOA 3ZXDA 1UZVA 4CEWB 5C4WA 3KQ4B 1E5SA 5FQ0B 5FY9A 3WP4A 4P5YA 2B42B 3M3EA 3POGA 1U5YA 3W9AA 3VHPA 4BQ5A 4XF3A 1FXZA 1VPHA 4QB6A 4N43B 4UOJA 4YFWA 2P2KA 3W59A 2XUMA 3ILFA 3JZVA 4P14A 1AHSA 2MHFA 3CJIA 3AMHA 2WNUB 1FOD1 1QJZA 3OD4A 4MADA 4XDPA 1HB2A
chains in the Genus database with same CATH topology
1RUH2 1V6JA 5ACA1 1MEC3 1COV2 2CY6A 5JDBA 2D40A 1POV1 4XFGA 4IV1A 1RUI1 4YW5A 5FRAA 1N1VA 1S0FA 2EXJA 1CGPA 2RHPA 5E89A 3MF9A 1YIFA 1KFXL 4XF1A 4Q0UA 2IXHA 2XJSA 3UJQA 2WZPP 3FLPA 4XBQA 5H9SA 5CA6A 2ZCWA 3AZZA 1HLCA 3ZFEA 4CP0A 4LBKA 4CDQA 2Y38A 1GV9A 5J36A 4PDWC 1AX1A 1LKNA 5JOYA 3ZN6B 3D8CA 4I09A 5JZGC 5H9RA 4H14A 3LA3A 3UJOA 1D4M2 1PIV3 1QOOA 4XYXA 4I02A 1DQ1A 1HRI3 5L7OB 3JBG1 1AX0A 3ZN5A 1HXS2 1QXRA 3TNPB 2WA4A 3KGLA 1LENA 5FBZA 4XF9A 4LUMA 1AR92 4FSJA 5DUUA 3VBSC 2LTNA 4E2GA 2YUEA 3PVNA 4JGZA 3CJIC 5JIUA 4JGYC 1ZZ6A 4COZA 3LB9A 2LUWA 3RJ2X 3POSA 3USSA 1OA4A 2UWAA 2IXIA 4CEWA 2R072 1PGW2 2XWJB 1QNWA 1ASJ2 4AHYA 5FQ0A 1EP0A 4WM7A 4OHVA 2R0HA 2NQYA 4N43A 1PK6C 1HQNA 1RVF1 4BCUA 2WNUA 3ZXFA 1MS9A 2F6BA 1ZBA1 1MVQA 2A6WA 4XFFA 3R0RA 1C4RA 3ZXEA 4YZ5A 1FNYA 4YM2A 3BB6A 3PVBB 1BBT2 1NA1C 4CDXC 1MQTB 2DTYA 1VP6A 1VBA1 2C9AA 1QJX3 1DBNA 4AGVA 1RUD2 5J96B 3EQEA 3HMYA 2V09A 1R093 3MI8A 2KA3A 2YHJA 4UW6A 3ZIWA 1ONAA 4JC1A 1WW7A 2ZTNA 3CF6E 2BFUL 1UU5A 1PZ7A 1CR7A 4RS5B 1VBE2 4L9BA 1I3HA 4OHXA 3J26N 3ZN6A 3TOJA 3ZSKA 3H9AA 5KBFA 1VJ2A 1AYM3 1VBC1 2ZZJA 1JYIA 1REDA 1F5FA 1IGOA 1Z0HA 2XLFA 3EXUA 4Y22B 4DFSA 2WFF1 2D3RA 4XPVA 4OHYA 3IPVB 4B4QA 2X5IB 1VLNA 2VULA 2ARXA 3WD5A 4XDQA 5L7OA 5GZFA 3ZMOA 2K0GA 1GZ9A 1LR5A 3AYEA 2XPJA 1XYOA 2H0BA 4ISRA 4SBVA 1FOD3 1BVP1 2HEYF 1X8MA 4WM7C 5K9YA 1RL3A 1XNDA 4Q2FA 2DURA 5ACA3 5F9TA 1BJQA 4ATEA 1POV3 2JG8C 2X8KA 1NY71 3MIGA 1RUI3 2WZR1 2D6PA 1OA3A 4QD2A 4KG0A 3O12A 4AE2A 2OYZA 1REEA 2GN3A 3WINE 4FAHA 1U0AA 2G9GA 1XU1A 3K48A 4FPEA 1RUF2 2VNGA 3B02A 2A3WA 4RSUA 1JTZX 2VW2A 4U2AA 1WLWA 1S0IA 3PHMA 3PJYA 4FXKB 4FPGA 4D7YA 1QJY3 3IDEA 3OD0A 5A33B 4FQ4A 1O3SA 4K20A 2IXKA 4CEYB 4YSFA 1PZ9A 1ZRFA 1TNFA 1MQTA 2GU9A 4QM9A 2AR6A 3X29B 3JBG3 3B7MA 1CX4A 2PHFA 4YM1A 4MSVA 2GMPA 4LHKA 4QM8A 1WW6A 1WLTA 4GA9A 3USUB 2XJTA 2E6VA 3SMHA 2H6BA 2ZGSA 1PGSA 3WP5A 1ZYBA 4RS5A 1W6MA 4GH4C 3ZFGB 1FATA 2ZKNA 4OI2A 2BW8A 2D44A 5D1IA 3VZMA 2RS11 5L73A 1DGRA 1SBEA 3R05A 1VBD2 3P3NA 4P9GA 1ULCA 2X5IA 4Q4Y2 4AW7A 1H1AA 5C6CA 1WCKA 3CNAA 2B7YA 3ZFFB 2PHTA 4UBGA 3KB5A 3PMSA 2ZMKA 4XBLA 5I93A 1RVF3 4XHXA 3TN91 2A6ZA 4HFSA 5D8AB 4QX5A 4PQ9A 3TYJA 3QOPA 4AK3A 2GC1A 3APBA 4FPOB 1HQWA 4YVWB 2PHLA 4H7MA 1VB2A 1Q56A 3C2UA 3M7AA 2O8OA 2XHKA 2D3SA 1OA2A 1H4GA 3UKVA 2O1QA 4XQ4A 4LT5A 3AMQA 1VBA3 3G7DA 4M3CB 4LBLA 4MUVA 4QQHA 3JB8A 2KXLA 1FV3A 1IKQA 4B7EA 2VOWA 1S0GA 2PHUA 3VZJA 5IK8A 2PHDA 1LU2A 2XVKA 2DVAA 3JCIA 4QGNA 1J1LA 2CAVA 4LO4B 2SLIA 5KHJA 3AFGA 3MIFA 3BTAA 3BU7A 4KBBA 5FO7B 2VVEA 1VBC3 1QOSA 5A33A 3VBRB 1BMV2 1AL21 2B39A 2WFF3 1MR5A 5FO8B 1BQPA 4CEYA 4Q4V3 1S0BA 3SH4A 3MZHA 1GZCA 3B01A 1BCXA 3WHTA 5T5PA 1R081 1OHFA 1OOPB 1VAVA 1D4VB 1SLAA 2DU1A 4K6BA 1V9U2 2IZWA 3MIBA 4BA6A 2RM21 3ZIXA 1AYN1 1NLRA 5GLUA 1ZRCA 1SCSA 2Y26A 4Y1ZA 1WBLA 1LGNA 3V64A 2YZ4A 3WUDA 1A8DA 4NN0A 1YO8A 2WL1A 3MW2A 1WGPA 2HWD2 1RJ7A 1UU6A 1PO12 5DG1A 4AF9A 3J8F2 4P9LA 5EWSA 3ZFFA 2RR12 2ZGTA 3M4FA 5I0SA 3E97A 4FPKA 1OQ1A 1UF2C 1Q3EA 1EPZA 5HCAA 1S0JA 2YMZA 5D8AA 5A3MA 1H1MA 1EPWA 4Y1UA 5BNNC 4QT6A 2RMU2 3GHNA 3OGGA 1YLLA 2W68A 3E5UA 2Z2SB 4KWJA 4LLFA 4MZUA 1POV0 4N90A 1KS4A 4D69A 4BH9A 4M3CA 5K7PA 4AI2A 3WCRA 1RUJ2 2ZGQA 1HV0A 4K40A 1PGL2 1TQ5A 1RHI3 4KL1A 5C8WA 4DRVA 5CB7A 1WD4A 5J48A 3E6DA 2HWC1 2D6LX 4L8QA 2PAEA 3AFKA 4UW4A 5ABJC 1LOEA 2ETEA 3VBRA 3U0ZA 3WG2A 4FP2A 3V0BB 1AR71 1MS0A 5CFCC 3TAYA 1OOPA 1PHMA 4XJ8A 4A7ZA 1G86A 1FNZA 4DZGA 4LR4A 3TN93 1DGWX 2WFPA 4FTBA 3VBHC 4NWWA 1N3OA 3RRDA 3S0MA 4FOWA 1J1TA 5JSPA 5BNOB 1WLCA 3BALA 2YY1A 2VUAA 1RMU3 3ZYGA 2CWSA 4SLIA 1V6NA 4FOVA 4JTOA 3V0AB 1OD5A 1YIPA 2QDNA 3TRSB 2HYKA 4BLJA 1M06G 1XYNA 2GDFA 3PVEA 4W65A 1AR83 1F9KA 5J98B 4CRQA 1XE7A 1WW5A 1RUOA 2P3JA 2ZX1A 3WLUA 1GFF2 1UL9A 2Y0IA 1GBGA 2Q8OA 3VBFB 3ZPYA 1NXD1 3O0WA 2WS91 3MICA 5LEJA 4IEVA 1AL23 2Z79A 4KH9A 2BQPA 3HWJA 4CTEA 5KXBA 1Z7S2 1RUC1 3G6JB 1R083 1CIWA 2HWB1 3HQXA 4LHLA 3WVJA 2SBAA 1QJU1 2CNAA 4LBMA 2RM23 1BEV3 4E4ZA 3NV4A 1AYN3 5FPXA 3AXEA 2P34A 2PFWA 1X7NA 2V5YA 2X29A 5E16A 3NJZA 4AFCA 3WV6A 4R4ZA 2I07B 4N9IA 5JPMB 4AGRA 1MS1A 1MVEA 4N53B 3RS6A 3EHKA 4WZCA 2LALA 4K1YA 1HW5A 4B3NA 2CGNA 1ND2C 3ZVXA 1Q8OA 1F8VA 2FQPA 5FMOL 1ZA4A 1UIKA 3SNMA 5BNOA 3VBOC 4ORFA 4XXAA 4XETA 1C8M1 1ZM1A 3D82A 4GB32 2VG9A 1W6NA 3V0AA 3T1LA 3WQ7A 4LBQD 4BYYA 1C8NA 2ET1A 4TSVA 4IV3C 1NYWA 2GC2A 1SDWA 2R32A 2YC0A 4D7SA 1WCSA 3NV3A 4RHV2 2UWBA 1LHOA 1KJLA 5FTTC 4DRRA 4IQPA 4NWVA 3AKPA 4HK9A 1PZ8A 4AEDB 1RUE2 2YROA 3M2MA 2BTVC 2HWC3 3B94A 5HI0A 3D6EA 1S2KA 1UIJA 4GULA 3VBFA 1QXJA 3H50A 5F5QA 1DQ5A 1WD3A 3IM0A 3FUQA 3NAPA 3RYPA 2GNTA 4KWKA 4YM3A 4NHLA 4PBOA 1AR73 4Q4X2 2WIIB 3H3UA 1RUH1 4MXVA 2WNVC 2VECA 1K5MC 4COYA 4Q0QA 1COV1 1C5IA 2BYVE 3NO8A 4UW5A 1RINA 4IEOA 4JDOA 1ZBE2 4QQOA 4M3CF 4NHKA 1WMEA 1G9FA 1UCXA 4HVOA 2XJVA 4IEUA 4AFDA 1SMVA 3WR0A 3T2TA 2ZA9A 1EYBA 1YNAA 4N53A 1KDKA 2H6CA 2XH6A 3CO2A 1WMFA 3VL9A 4E4DX 3MIEA 3ZXLA 3VBUC 2XWBB 2ZMLA 4ATFA 4S2FA 1WA4A 1URXA 2R042 3HAGA 1JW6A 1H2LA 3OY8B 1D4M1 1TEIA 1WBFA 5AC92 1LOFC 4F7ZA 2ILMA 1DQ6A 4YVSB 5DDJ1 3AJYA 3JD72 4I3PA 2BUKA 3J9SA 2WS93 1UW8A 1QDOA 4RGAA 1OPOA 1LB2A 1AJOA 1NCQC 1B35B 1A78A 3CJXA 1RUC3 4JDNA 3M1HA 2HWB3 4R52A 3NAPC 3QCWA 1AR91 4LO7A 1QJU3 3WCSA 1YHFA 1R1A2 4PJYA 3RMYA 4YG0A 4Y24A 4AVBA 2OUJA 2NMOA 3NVCA 2R071 1PGW1 2IXLA 1CESA 3OYWA 3WT3A 1C1LA 1AX2A 1ASJ1 1OI6A 4R4XA 1JUIA 3BPZA 4BM8A 4ZU4A 5DG2A 2YDEA 3FHIB 1GSLA 1O91A 4TLFA 2JG9B 3R6SA 5CADA 4L2NA 1SCRA 2TEPA 3AP7A 5A32A 1PNFA 1N1TA 2XBO2 3RQ0A 4OI0A 4NVPA 1VIWB 2R0FA 4XXPA 1KFUL 4AQTA 5JOXA 1BBT1 1ULFA 2HWF3 3WNXA 1IOAA 4P9JA 1IS3A 1RUD1 3BODA 1XE8A 5C8CA 2ZAAA 4XFCA 3FLRA 3D0SA 5CU1A 3WG4A 3AYAA 2P17A 3VKLA 2V73A 3M70A 4BOWA 1VBE1 1VBB3 5K8SA 1EY2A 2JXAA 4ITCA 2R063 3LKJA 5B2GB 1DFQA 4FPCA 3FMGA 3OY8A 4YYOA 5I8TA 5CG8A 4XFBA 1QHDA 2W39A 4YVSA 2ZHKA 2AREA 3AZVA 1EV12 1W0PA 1B35A 5A3LA 1PGL1 1JOJA 3B3QE 4AI0A 2XJRA 4LBJA 1PO21 4XJUA 2ZZQA 1RUH3 1ZZCA 1COV3 3RYRA 3DPRC 2A6XA 1CQ9A 3KZ4C 4FXGB 4FPFA 5JAXA 1KRIA 5FLIA 1RB8G 2AGSA 1GQGA 1Q8VA 1RUNA 1HIXA 4TWTA 4XZPA 2UY8A 5KHGA 4WVMB 2WQ4A 4EN0A 1RC6A 2GC0A 2VU9A 4G4FA 4WM8A 1RUF1 1PIV2 4L97A 1Z78A 4HVRA 2W52A 3PMEA 5C4WC 2JG9A 5C8CC 1SACA 4IERA 3AJZA 4AFBA 4HPKA 2DCTA 1X82A 2VVDA 1CAUA 3U07A 1NE4A 1YFYA 5DDJ3 2BWCA 1V00A 3GYDA 4DPNA 2IFRA 2GALA 2XL7A 5T55A 2NM1A 4AQSA 3VHOA 1H4HA 1ZZBA 4EN7B 1Q8SA 4IV1C 5BNPB 3WZ1A 4OHWA 1G8WA 2ZHLA 5IUQA 4CDWB 5T5LA 1GKBA 2A70A 3LZZA 5EJ3A 5LK7B 2DCKA 2R073 2B8MA 3URFA 1A3KA 1VBD1 4Q4Y1 3ZFEC 1ASJ3 3ENRA 4CDQC 2H0VA 1PMIA 4XJZA 1Y9QA 1ZRRA 3QH7A 4M3CE 1AUYA 1KD7A 1RGSA 3WOGA 1QJX2 4M01A 2PHWA 4WM8C 1TME2 4Y5Z0 1R092 3KLSA 4JQRA 4MV2A 5T52A 1VRH3 5FO9B 1TMF3 1C57A 2X53S 3KMHA 3QD6A 4HN1A 4PLMA 3AKTA 4Z2WA 3A4UA 4JGZC 4WVMA 3O0VA 2JICA 1RUD3 4YNIA 4B4PA 4E2QA 4R9AA 3VV1A 3LOBA 4OFGA 4JAAA 2CGPA 3ROUA 2WT1A 4XQDA 3WHUA 1V6IA 2OW4A 4OUMA 4CEWC 4PBPA 4M0HA 5FLJA 1VBE3 2JD4A 4G9SB 5AVAA 2CV6A 5CFDB 1AXKA 2ZOEB 3AXDA 2RS32 2W08A 2FMDA 1YRZA 3MPBA 3HR9A 2GH2A 3WQ0A 4F3JA 4N43C 5SV8A 4HMZA 4KQ7A 2UYAA 1MS4A 3NW4A 3H1WA 4YGEA 2WNUC 1J58A 2VNRA 1D0GA 4QMAA 5I8YA 2NYYA 4RA0A 1RUI2 1MS3A 4Y26A 1AR62 1V9U1 4YG6A 5BNPA 1PO23 4C0HA 2VXRA 4XHBA 5K0UB 4AXOA 4CDWA 3N7MA 5F6KA 3PLQA 1I6XA 1RUG1 2JDZA 3H0OA 1QDCA 3RNSA 3KCYA 5KC5A 2HWD1 1LU1A 1DF0A 1PO11 4MH0E 4BZ4A 3J8F1 2NP0A 1QJY2 2VMIA 3IDCB 5FOJB 2RR11 3ALQA 1A6CA 2PHXA 1IZ3A 4H55A 3SH5A 1RUF3 3N7JA 5HCFA 3ZN4A 2K9ZA 4FCAA 1SFYA 1JUHA 3THTA 2UU8A 1HQLA 1U5ZA 4S2GA 4LTAA 3NWKA 1KXGA 2WQZC 4FVVA 2QE3A 3WDUA 1J3PA 3AP9A 5FDBA 2RMU1 2QQPA 3ETQA 5C9AB 5L7OC 2FBEA 2ZGMA 2K2SA 1WCDJ 1GANA 2DVDA 1TNRA 3MYXA 2XLAA 1QY4A 4X8NA 3I59B 1Q8PA 2ET7A 3DGTA 1DU3D 1IS5A 1DIWA 1PVXA 1RUJ1 1YJKA 4Y22A 2E63A 4PIXA 2D6NA 5AFBA 4XOGA 3IPVA 1