2PELA

Peanut lectin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin (agglutinin)
molecule keywords PEANUT LECTIN
publication title Conformation, protein-carbohydrate interactions and a novel subunit association in the refined structure of peanut lectin-lactose complex.
pubmed doi rcsb
total genus 52
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pelA00
1W6NB 1A3KA 2A5ZA 3QLQA 1WBLA 5DZEA 1LHNA 5IK4A 1WLWA 1N3PA 1ULFA 1S0FA 2AGSA 3ILFA 3WDVA 2AR6A 1MS1A 1AXYA 1RITA 5DUUA 2D6NA 2ZHLA 4Y1YA 2C5DA 4XIKA 3AX4A 5GZDA 5T5JA 1GYKA 3FUOA 1CONA 1H30A 1F31A 1YI7A 2R1DA 4TYSA 5HCFA 2DTWA 2DURA 2YMZA 1WUVA 3UL2A 2W08A 4RA0A 3USUB 1QNYA 2ARBA 5DUWA 2ZGUA 3WLUA 1ENSA 3AYDA 3W59A 2DU0A 4GA9A 4XILA 1RIRA 4KBBA 3WOGA 3W58A 1BJQA 1I1EA 2GDFA 5H9QA 1AX1A 1EPWA 3SLIA 4HL0A 2JECA 3BOPA 5DZFA 1IS3A 3ZYPA 1UPSA 1LU2A 4ASMB 2P3JA 2E6VA 2P37A 3L2YA 2HYKA 1V6JA 4FOYA 5CB7A 1AJKA 5GZEA 3AK0A 2VU9A 1CN1A 1QNWA 1ZA4A 4YZ3A 4GWMA 3VKFC 4JC1A 3AP9A 2A6ZA 1YRZA 1Z78A 3AJYA 5KXEA 5BYNA 1DQ6A 1HDKA 4FP2A 4K1ZA 3SITA 5IK8A 1UAIA 3IM0A 5T55A 1CPMA 2GN3A 5SV8A 1LOEA 3OBRA 2CNAA 1AF9A 2WNEA 4XE9A 4YW5A 4ZXKA 1MZ5A 1LCLA 3M1HA 1QOOA 3POSA 4YFWA 2VW0A 2NM1A 1O4ZA 1ULDA 3FLRA 3CNAA 5DXDA 3V64A 2ZHNA 2B7YA 1DFQA 2AUYA 1YYNA 2DV9A 4JRAA 3VUOA 2V5YA 1LESA 1IS6A 2DUQA 5GLZA 4UW5A 4K20A 1DLLA 1LEMA 4W65A 3N7KA 4M01A 1N47A 1FX5A 1W6PB 1DHKB 3H0OA 4FPEA 1IOAA 4FPYA 2WSUA 1DGLA 3ATGA 1SLCA 4FPJA 4XJ8A 4CTEA 1QDCA 1JW6A 4YM1A 5FREA 5HCBA 3GNEA 2VUAA 2W39A 4LBLA 1W6OA 3ZXLA 1N1YA 3O0VA 4OZXA 3SNMA 2ZHKA 1FYUA 2ZGMA 1HKDA 2E7TA 5GZCA 1J1TA 4YZ2A 3BIWE 2UURA 4Y24A 4FQ4A 1DQ5A 1D0HA 1WLCA 3I8TA 3IKWA 4Y22A 4YFZA 2DVFA 1WBFA 3WDXA 5DG1A 5IK7A 4FPCA 4AGRA 4YW2A 5T5OA 4YG3A 1LJ7A 4Y1XA 3PVEA 2YXSA 4XBQA 2AENA 3D5OA 3D4KA 2A6YA 4ATEA 4Z8BA 2NZ9A 5T5LA 3N7MA 4YG6A 3AZYA 2PHWA 1UMZA 1UZYA 1W6NA 4AVTA 2LTNA 2R0FA 2JE9A 1Q8VA 3AP6A 3AP5A 4YW3A 2VW1A 2DVBA 3A0KA 4FPLA 4XHXA 2WT0A 4C1WA 3R4UA 3N35A 5T50A 2DUPA 2WQZC 3AZXA 1FV3A 1GNZA 1HQLA 3D6EA 4FQZA 4P9WA 1SBDA 4ISQA 4LBJA 1Q8PA 4PQ9A 3USUA 1OKQA 4TZDA 2Q5TA 1MR5A 2R1BA 4RL7A 4C1XA 4AGVA 1DBNA 3OJBA 2EAKA 1C1LA 3KQRA 1GV9A 4AGGA 3FFZA 1FV2A 2PHRA 2A3YA 4R9BA 2D44A 4UW3A 3WDTA 4BMEA 4K1YA 2WKKA 5KXBA 2A75A 2D43A 4JCKA 1LHUA 3ZSKA 1LEDA 2ENRA 4XXAA 1CPNA 4P9YA 1ENRA 3IMNA 4XDQA 3A0NA 1CVNA 2P2KA 2PHTA 3NV1A 2D6PA 2A7AA 1W0PA 1AJOA 1SCSA 3B9CA 3M3QA 3AFKA 2CYFA 1MS3A 3LSDA 5GM0A 1GZWB 5DZGA 1SBEA 1S1AA 3Q9OA 4Y20B 1S0DA 1FAYA 5EYYA 1FNYA 1U0AA 1KDKA 1QOSA 1JHNA 3O0XA 3JU9A 3AP7A 3MEPA 3UJQA 4YZ1A 2ZGOA 1BXHA 2ES3A 4BMBA 2ERFA 4Q27A 3R05A 1GNHA 2SLIA 1JUIA 3SH3A 3INAA 3WDYA 1S0GA 3APBA 2DUOA 1V6KA 2R49A 1QKQA 1WW6A 2JD4A 2EXKA 1W6PA 3NV2A 2DU1A 2CL2A 4BQ1A 1IKQA 5GJ6A 1FNZA 2KM2A 1JBCA 3MW4A 4Y26A 3UJOA 1LGNA 5EYXA 1IS5A 1DYPA 5T52A 2EF6A 4IQPA 5EWSA 3AXEA 1WW5A 1WCSA 2ZGQA 3FBYA 4GWNA 4YM2A 2ZHMA 2JJ6A 5JOXA 3OYWA 2D3RA 4XMAA 5GLTA 2H0BA 4XXPA 1G9DA 2W68A 1KRIA 3ZXFA 2CWSA 1APNA 1S0BA 2ARXA 5AVAA 2A3WA 2E51A 2R0HA 1LGCA 2DWRA 3RRDA 1SLIA 4PBPA 1KJLA 3QCWA 2CY6A 1N1SA 1JXNA 1AX2A 1WD3A 3OBTA 4R9DA 4D69A 2FHRA 5H9RA 4K21A 1HQWA 4GKYA 1G9BA 1Q8SA 3TAYA 4AWDA 2A71A 1G8WA 1V6OA 4XJUA 3RQ0A 2GMEA 3ILRA 5HCAA 3AXDA 4DPNA 5JOWA 4FP3A 1DIWA 3DUIA 1BYHA 3V0AB 4XBLA 1DQ0A 3ZXKA 5E8AA 5FRAA 4ZKTB 1IS4A 2CTVA 1LOFA 2EIGA 3VV1A 5GZGA 4Q1PA 3AJZA 4Q2FA 5CNAA 1JOJA 5H9SA 3WNXA 2Z42A 4YGBA 4XHBA 3VKNA 4FOWA 2AH2A 4WV8A 4M00A 4BOWA 5KXCA 1AXKA 2GALA 5DG2A 3FLTA 1SLAA 2PHUA 3M3OA 4HANA 1G7YA 4DRVA 2GN7A 4FVVA 1WW7A 1DQ4A 2A6XA 1W6MB 2D7FA 4NO4A 2ZGRA 3NWKA 1LENA 4ITCA 5JMCA 4XOGA 3O0WA 3PJQA 3RS6A 4ATFA 4XYXA 3GALA 2UWAA 1W6QA 3SH5A 2GNBA 4Q1RA 1QMJA 1JN2P 2EXHA 2C9AA 4AYUA 1LHVA 4DS0A 2P3KA 2ZZJA 1LTEA 3MW2A 1S0CA 2I2SA 1AVBA 4YG0A 4Y1VA 1DQ1A 1LULA 2NYYA 1CJPA 1SACA 3WG2A 4YW1A 4AVSA 1GZWA 2UWCA 1GZ9A 1Q56A 4L8QA 4Y20A 3UK9A 2VY0A 4XTMA 3V65A 4BLIA 1FATA 1R1ZA 2ZGKA 1CQ9A 3WUCA 2D3PA 2ZBJA 1N1VA 2A70A 1Q8OA 2GNDA 3VKOA 1F5FA 5H9PA 1QDOA 3N36A 5F5QA 1N3QA 4BPZA 3BODA 1OFSA 3VKMA 1LOGA 3AP4A 2CWMA 4H55A 2ZACA 4R9AA 1WW4A 2V73A 2ZGTA 4FPKA 3SISA 1C57A 5GALA 3WG4A 1OQ1A 2ZKNA 3WG1A 1MZ6A 2JDZA 1A78A 5IK5A 2XG3A 3V0BB 1V6IA 1H9WA 3JUUA 3NV3A 2TEPA 1VAVA 4DQAA 1S0IA 3SH4A 2OUJA 2OUHA 2EXIA 5L73A 2WJSA 4YZ4A 1LOCA 4M3CB 1LOBA 3ENRA 4R9CA 3WHUA 4PCRA 1LU1A 3ZSLA 1MS4A 1SFYA 2ZGSA 3HN1A 3O5SA 1SLBA 3M3EA 2EXJA 4Y1UA 3RG0A 3T1MA 2WLQA 1QOTA 4YGDA 4FOQA 4WZFA 1LHOA 1QGLA 1V00A 3OPZA 1ZM1A 5KXDA 1PZ7A 1S0JA 2SBAA 3RMYA 5IT6A 4XJ9A 1MVEA 3POYA 3NV4A 4FPFA 3C2UA 2PHFA 1MS0A 3WUDA 4LBQD 1AX0A 3WDWA 1V6LA 1UZZA 1W0OA 2VXRA 4GKXA 4YM3A 3M3CA 1GKBA 4Y1ZA 3IN9A 2A6WA 5CAZA 2DYCA 2ZMLA 4PF5A 4M3CE 2UWBA 2YY1A 2NN8A 5GZFA 2ZAAA 1ULGA 4ISRA 1NXD1 3V0AA 1YO8A 2YZ4A 1V6NA 1Q8QA 2GMMA 3HMYA 1GBGA 3PVNA 1WLDA 1N1TA 2AREA 2RHPA 3OY8B 3T2TA 2D6OX 3RMXA 1CIWA 1BKZA 1ONAA 2PELA 3M2MA 1LECA 5JLVA 4BM8A 1Z0HA 5CBLA 2D6MA 3OGGA 4YGEA 5GLUA 5LK5A 3WHTA 1YIFA 4XIOA 1N3OA 3ZSJA 2E53A 3WCRA 1UL9A 2GNTA 3MPPG 1CR7A 1A8DA 2WSVA 3WCSA 1BQPA 4MYEA 3ZVXA 1W6MA 2UU8A 3ILNA 3O12A 1DYKA 3ZXJA 3MW3A 4M3CF 4YZ5A 5JOYA 4UW6A 3B00A 1LOFC 4LBNA 1SCRA 4CRQA 2NP0A 4DRRA 1ULCA 4LBQB 3WZ1A 4WVWA 1MS9A 3IPVB 2NMNA 4U36A 1GZCA 1KQRA 1MS5A 1G9FA 3FLPA 2A3XA 3I4IA 4XJWA 3KM5A 5F9TA 2YV8A 3ZYRA 5JDBA 5GLWA 1UN1A 2D6KA 1VIWB 1VLNA 5T5PA 1RINA 3U4XA 3BTAA 1X50A 2OVUA 5T54A 5IUQA 3AYCA 3LCPA 4PBOA 4GXLA 2ZGNA 2G4IA 1VAMA 1G9AA 1GANA 4FPGA 1B09A 4P9XA 2LALA 3AYEA 1ULEA 4WVVA 1NLSA 3PMEA 2P34A 1H9PA 2DTYA 1LHWA 1GSLA 1SLLA 4P14A 2FMDA 3N7JA 3ZSMA 4GALA 5CA6A 3V0BA 1CESA 1LODA 1WD4A 3FUQA 1Y7BA 3R4SA 3TB0A 4AVVA 1LGBA 4FOVA 1S0EA 1PZ9A 3N3HA 1SLTA 1MVQA 2DVAA 3B3QE 2PHXA 1O4YA 1AZDA 1SBFA 3OYWB 4M3CA 3PVOA 2WT1A 4FPHA 3T1LA 4CZSA 1GICA 1MS8A 3ZPYA 3POWA 2VH9A 4I30A 1URXA 3ZXEA 1HLCA 1G9CA 2ZGLA 2W52A 5E88A 1JYCA 4XJZA 3RSJA 2DVGA 1QF3A 4YGCA 1QU0A 4LBMA 1C4RA 4XTPA 1IKPA 2NMOA 4XZPA 3VKLA 4DFSA 1TEIA 4FPOB 4Q8KA 2ZA9A 1UKGA 4LBKA 5DUXA 3WVJA 1GLHA 3B01A 3WDUA 2P3IA 2JE7A 1I3HA 2D6LX 1V6MA 2D3SA 3HR9A 1XQNA 2VW2A 3N7LA 4SLIA 1UX6A 1ENQA 4XBNA 2R16A 5E89A 1PZ8A 2ZMKA 1YXWA 1D2SA 3DGTA 1C1FA 2JKBA 3OY8A 1W6OB 4XMIA 4U2AA 2BQPA 2WT2A 4LBOA 3WV6A 4BLJA 4NOTA 2AYHA 3LSEA 1DQ2A 1BZWA 4Q26A 4YLZA 2DVDA 2GMPA 1LOAA 3AYAA 4YM0A 2YROA 4F83A 3AZVA 3ASIA 2OW4A 4YW4A 3WG3A 2EALA 2ZGPA 4Y22B 5GLVA 1AXZA 1KJRA 5DUVA 2E7QA 5JVVA 2GNMA 2ZABA 2XB6C 3B69A 1KITA 4UW4A 3A4UA 3AZWA 3AZZA 1MACA 5EXOA 2A6VA 1G86A 1VALA 1JYIA 1W6QB 4LBQA 1DZQA 3IPVA 4XJAA 1F9KA 5JOZA 4Q8LA 1KDMA 2ZMNA
chains in the Genus database with same CATH superfamily
1B35C 3QLQA 3HNMA 5DZEA 4DO0A 5AC92 3AMPA 4G9SB 4DUXA 4QHBA 2P6CA 2BP6A 2PLV1 5DUUA 4Y1YA 5FWJA 2A73B 2C5DA 2VNOA 4CPBA 4RD7A 5T5JA 3VBRA 3BI3A 2PAKA 2Y34A 1UY0A 5FY7A 1PIV1 2HEVF 2R1DA 3PL0A 2DTWA 3NAPB 1WUVA 4Q4W3 3ELNA 1OXCA 1VBE2 1ZREA 4JHTA 4RA0A 5LB6A 3KHCA 3WLUA 3AYDA 5JPMB 5EHDA 3IIIA 3JB4C 4KBBA 3KB5A 2CV6A 1BJQA 4B4QA 1M06G 5H9QA 1PMJX 1EPWA 1VBA3 2W91A 3T4VA 5BNQA 4QPGA 3BOPA 3LF7A 4LKEA 3VB9A 1W8TA 1UPSA 1POV3 3ST7A 1ND2B 4IV3C 4CEYC 2P37A 2WS91 1QJEA 1V6JA 2HYKA 2RS51 1A34A 1ODNA 2R063 3MV01 2VU9A 4M4PA 4YZ3A 4MX3A 4A2UA 1W0NA 3U37A 3MZHA 3WP4A 5LBFA 4AI3A 2JB8A 3TN93 4QB1A 1HDKA 3ZYJB 5APAA 4OI2A 3FHAA 3WQBA 2XLAA 3ZFFA 1XYPA 3T4HB 3HEIA 1MQTC 3ZFGA 3OBRA 1GP4A 1AF9A 2WNEA 4GJZA 4ZXKA 5BNOA 2H6BA 1LCLA 1VBB1 1QOOA 2HKXA 2RDQA 2VW0A 1E57A 1NG0A 3IIAA 4RS5A 5C4WB 5DXDA 3OF1A 1NZIA 4KH9A 4PHZA 2B7YA 4NWVA 1AR63 2AUYA 2JDPA 2DV9A 3HQXA 4JRAA 2E63A 1PHMA 1MZEA 4NMIA 4GMP0 3ITQA 1RMU1 3JQWA 4K20A 4MVTA 3TRSB 1DLLA 4W65A 1CAXB 1W9WA 4M01A 4ASKA 1FX5A 1W6PB 3WNNA 2VMFA 4UOJA 4JHZA 2R7EB 1GR3A 3CZUA 2WSUA 4CXXA 2QDRA 4WVMB 2HBUA 5FZGA 2X53S 1QDCA 2ETEA 5FREA 1GWKA 1OLME 4AI2A 1F8VA 4JGYC 1W6OA 1COV1 5C5TA 1N1YA 1X82A 3O0VA 4OZXA 1FYUA 2WN3A 2X09A 2ZX1A 3BN6A 4JTNA 3AM2A 4OCTA 4CCEA 2E7TA 1B35B 2IFRA 3ON7A 4BE3A 1UPIA 3BIWE 2UURA 2AEYA 1LKNA 5FOBB 4RHV3 4QDRA 1DQ5A 3IKWA 3E1F1 4YFZA 4V2WA 1WBFA 5E1RA 3RPQA 3PJYA 5DG1A 3WDXA 4D8MA 1J58A 5LA1A 2E26A 4N9HA 5DABA 5T5OA 2FDKA 3PIGA 1LJ7A 4Y1XA 3MHZA 1PGL1 1V70A 3MUY1 4CP2A 4QM8A 4ES8A 2A6YA 2XWJB 4CCLA 4Z8BA 3OPWA 2AACA 4NHXA 4QDSA 4YG6A 5T5LA 4IESA 2PHWA 3POIA 3N9PA 5G05L 3DXUA 1UZYA 2WO3A 4AVTA 3OOXA 2Y0OA 3SC7X 2JE9A 3IAQA 2Q8OA 4FFGA 1OLQA 3AP5A 2K2SA 3L9JT 2J42A 2JKXA 2RDSA 4MADA 4XHXA 3H8XA 5IWFA 1W06A 1IPJA 4IV3B 5CZKA 2YHJA 3RNSA 4CEYB 4QXCA 3R4UA 4E4ZA 2FBEA 3J8F1 3RZMA 4P9IA 1OA2A 2CDPA 3B02A 3RYPA 1JZ8A 4BQ5A 5IYYA 3V56A 2WYFA 4XVHA 5ANNA 4LO5B 2X29A 3USUA 1Q8PA 1UU6A 4TZDA 2R1BA 5M0TA 1DBNA 3LIGA 4D7YA 4HVOA 4K6BA 1MQTB 4AGGA 5I0UA 4CUBA 1I5PA 3FFZA 4CDXA 2PHRA 3JD72 2A3YA 4JKKA 1U5XA 1CAVB 1RUC3 5A3OA 5B2GB 1RUI3 3HJRA 3LZZA 4HG6B 2WFF1 3ZSKA 1LEDA 1H0BA 2XXZA 3KZ4C 4XXAA 1CPNA 2E33A 1OUSA 3D3AA 4XPVA 2OZJA 1CVNA 1OA4A 2Z2SB 1W0PA 1AJOA 1SCSA 1VBD3 2VM9A 3B9CA 1JZ4A 1M4WA 2XKOA 2W2IA 4JDMA 4S2GA 2VR4A 1MS3A 3LSDA 2Y8KA 2YFZA 1OLMA 3B93A 1GP6A 1SBEA 4Y20B 3ZR5A 5KR7A 1PK6A 1RXGA 1S0DA 4J1WA 4LMFA 1FNYA 5EYYA 1QOSA 2ZEWA 1K5MA 5JSOA 5LASA 2QQWA 2MNGA 2QVSB 4IE0A 3UJQA 1FMD1 4Z92B 1AYM2 4BMBA 1IPSA 4HN1A 3MIEA 4HETA 1XPWA 4AHZA 4DUWA 3BCWA 4EWDA 3KGLA 1V6KA 1XNTA 1UU4A 2EXKA 5C9AB 2E7AA 4BCUA 3DYMA 3MF6A 2DU1A 5FZHA 1J1LA 5GJ6A 4HPKB 4Y26A 3UJOA 3WEZA 2QDNA 5FR3A 1PO11 1SQ4A 1IS5A 4Y5SA 1RUH3 4XFBA 4JRLA 5EWSA 4EWEA 1WW5A 1EY2A 4PLNA 5A3LA 4MO3M 2ZHMA 1TMF1 2BEOA 3ES1A 4PLOA 4XMAA 5A7QA 3WNLA 4XXPA 1H2KA 3SEPA 3OEAA 3ZYHA 3ZXFA 4XF0A 1S0BA 1ZBE1 2ARXA 2Z69A 3WF0A 2E51A 4AFBA 2UY9A 1SMVA 2ORZA 4Z2AA 4J6GA 5D8AA 2DWRA 3BKZA 4PBPA 1PMHX 5ABJA 1AR73 1KJLA 4JDNA 2BOIA 4MGIE 2LROA 2VMGA 3BGAA 2XL9A 1XNAA 2IXCA 5A32A 4BQ2A 1Q8SA 3TAYA 4CDWC 1RUF1 1E5HA 2A71A 1V6OA 5F2SA 4E27A 2FMYA 4XJUA 1CJDA 3ILRA 3SCGA 5HCAA 5JOWA 4NUBA 1CGPA 4BIOA 2K46A 4XBLA 3USSA 4UAPA 5F7UA 4LIVA 3ECQA 3I2GA 1JYWA 3KV9A 1VR3A 3J4UH 1IS4A 1LOFA 1RUJ1 1AR92 4Q1PA 5CNAA 5H9SA 1W05A 1TME1 1RTVA 3DPRC 4XUQA 4I0BA 4MG2A 1H6XA 1COV2 3HQRA 1BLZA 1OT5A 5DG2A 1BEV3 3FLTA 5IVFA 2PHUA 3W20A 1ZRDA 1SHWB 4DRVA 4PQQA 4B29A 2GN7A 5FZEA 1VJ2A 3MIHA 1DQ4A 4PIZA 1W6MB 4XF1A 2PAMA 3NWKA 1W2AX 1FOD3 4ITCA 5JMCA 3O0WA 1H6YA 3AKPA 5FPXA 2QQNA 5K9YA 4QPIB 2WZR1 5F3GA 2ZEXA 2UWAA 3GALA 3HAGA 4DNYA 5IVEA 3NNJA 1W6QA 4NHLA 3CDZB 3ZN5A 5F5AA 2G19A 4J25A 2C9AA 4UFJA 4OI0A 4Q4Y1 2VECA 4UFLA 4AYUA 4DS0A 2P3KA 3ZMNA 1QJFA 4RR3A 2I2SA 1JYNA 2WNUA 1DQ1A 1LULA 2NYYA 5L7OB 3CQOA 2UWCA 2RS31 4OUEA 2HWC2 3H3LA 1FPN2 2VY0A 5FUIA 3H1YA 2MEV3 4N43B 1XNBA 3WUCA 3HNBM 2Q30A 3E6DA 2ZBJA 3BTZA 1SFPA 2C26A 1F5FA 2JENA 1VMJA 3CEWA 1RYYA 4RQPC 2ILMA 5F5QA 5FK8A 2YGMA 3J8F2 4GH4C 5A3WA 2Q1FA 3BODA 1OFSA 3M4FA 3N9QA 3AP4A 2XKPA 3WX5A 2CWMA 3ZXGA 2BDRA 1GWMA 2HWD1 1W03A 5F6LB 2BJSA 1PX3A 4CEWA 4Q4V2 4AOCA 4NRPA 1AL0G 1V6IA 2Y6HA 3TWIA 2Q8EA 1H9WA 4A7KA 2TEPA 3WINE 4AQSA 2CU5A 3DECA 4I3GA 5LW9A 3POFA 4IE7A 3MIGA 5ACA3 4M3CB 1UXXX 5LRRA 2GP5A 5DDJ3 4QKDA 3ZSLA 1BBT2 1MS4A 1NA1A 3FHQA 3AKQA 2WAOA 3RG0A 4UFKA 4DMIA 1QOTA 4G4FA 5F5CA 4FOQA 2XJQA 4IEVA 1LHOA 4WZFA 1ZRRA 3F95A 5F39A 1J3RA 5IT6A 1MVEA 5JR7B 4DOUA 5A70A 1BMV1 4LBQD 2J7MA 1AX0A 3BIEA 3DPRB 4NVPA 3VD4A 2VXRA 4YNIA 1RUD3 1V9U3 4IE5A 4A45A 2WZ8A 4XEZA 4XF9A 3V0AA 4CU8A 1T2XA 3I2JA 5GZFA 4B8EA 3ZPOA 1RC6A 4A41A 4DINB 4CPBD 1NXD1 1YO8A 3LEMA 3S7IA 1GBGA 4H2AA 5J09A 5FZFA 1VRH3 5FP9A 3I59A 2Y6GA 1H2LA 2RJLA 1ONAA 2D40A 4H14A 4YW7A 2B46X 5SV5A 1LECA 4LHKA 2I07B 4Y5Z0 1RHI1 2G9GA 3OGGA 5LK5A 3WHTA 1YIFA 5A3NA 2E9QA 2BFUL 2VMEA 3ZSJA 2E53A 1TMF2 4AI8A 2QFEA 2C4XA 2GNTA 3HWJA 3VDDB 1W2OA 4N53C 3WCSA 5I0SA 5IAXA 3WW2A 4IGQA 4QQHA 1ZBE2 4M3CF 1F4HA 3J7HA 2OKXA 4UW6A 1CAUA 2WC2A 3HNYM 4GD4A 1R091 1Z7S1 4M0HA 4QM9A 3N9NA 4UBHA 3ZFEC 4BWOA 4DRRA 1ULCA 2NP0A 3WZ1A 1YC61 2NMNA 2QTWB 4RQPB 1GZCA 1G9FA 3I4IA 2A3XA 3UKNA 5JDBA 3RVHA 2B4KA 5FCCA 2R30A 2YU2A 5ISLA 1LB2A 5A6ZA 5CISA 1X50A 2VVEA 4A7YA 4CCKA 4KGGA 5AFBA 1JZ6A 3K77A 1ASJ1 4CDQA 4IEQA 5KHIA 2ZGNA 4URAA 4YRDA 3GHMA 1JH5A 5FQ0A 4XAEA 1ZA7A 1GANA 1B09A 1NAEA 1Q3EA 2LALA 3CJXA 5A7SA 2JG8C 1BK0A 2QJVA 2Y6KA 2O8QA 3RYKA 1H9PA 2RM21 1LHWA 2CGNA 4Q29A 3QD6A 5BNNA 1BHGA 1GSLA 3MF9A 1PVC1 5L9BA 2VL4A 5CG9A 3VBOA 2FMDA 1OPMA 3N7JA 4GAZA 4Q0SA 2VBDA 3OTFA 4QX3A 4XFGA 5CA6A 3V0BA 2LUWA 3FUQA 5FP7A 1AR83 4OHWA 4EYUA 4A6SA 1PZ9A 4UFIA 3WHUA 1OHFA 2XQRA 5FZOB 2OPWA 2RDNA 5L9VA 1LAJA 2WZR2 1AZDA 3OYWB 5FPVA 3S0MA 3UESA 1ND3A 2WT1A 4W50A 5FTTC 2JG9A 2JIGA 1URXA 1ZX5A 4KMQA 1HLCA 4Q4Y2 5JUVA 3H8RA 1G9CA 1W2UA 1CD3G 3UV9A 2JIJA 4CU9A 1PO23 5E88A 4YPJA 3RSJA 2DVGA 5KHGA 2P17A 2Y6JA 2VPVA 1O3TA 4LK7A 4XUNA 3SEEA 4C0BA 3DXTA 4B1MA 2Q8DA 3LD8A 1C4RA 4OLLA 4XTPA 4DFSA 4XZPA 5CFCA 2W3JA 5FZKA 2ZA9A 3VHNA 2Y0IA 2W94A 3WVJA 5JAXA 3QH7A 2PLV3 4ZPIA 4RN5A 3VGIA 4B3NA 4N53B 4MGTA 2QQOA 4TLGA 1OQDA 3HR9A 2Y26A 4DB5A 2VW2A 3SQOA 2BERA 4SLIA 1AR62 5EIYB 1V0AA 2VUDA 4FBFA 4CCMA 4GMP1 4OYUA 1O3QA 2HWD2 2YYOA 2DCYA 2V09A 2JKBA 3OY8A 4NIGA 3ACLA 3ZFEB 1C8M1 1RB8G 4U2AA 2WT2A 5FYSA 4H3WA 1NLQA 4BLJA 2YPJA 1FXZA 2PTMA 4NOTA 5FYCA 5FYMA 3EBRA 3K2OA 3N9MA 3KSCA 3WF3A 2RS11 4LKSA 4NROA 1OH3A 2QUOA 2YU1A 5CFDC 4F83A 2YROA 3CKHA 5F3IA 2OW4A 4YW4A 1K12A 3WG3A 4BQ4A 1U5IA 1YEWA 1AXZA 5GLVA 4R4ZA 2Q0AA 1O5LA 2ZABA 1HRI1 2BWCA 5EPAA 4UBGA 2RS53 2XOMA 5A1FA 1IG0A 1MEC2 2DCZA 3A4UA 3AZZA 3J7NA 3N9OA 5EXOA 2A6VA 4I01A 3NKGA 1A6CA 1VALA 1WKYA 1HRV3 1WWYA 3IPVA 4XJAA 3UT0A 4AI0A 3JB8A 3VBHC 4LO7A 3O1VA 1KDMA 5C8CC 4Q5OA 1AYN2 5IK4A 2J1UA 2WBKA 4PIYA 1ULFA 1YQ6A 2AGSA 2KXLA 3CHXA 1W90A 3FL7A 2BTVC 2ZHLA 1ULPA 3BUCA 2XWBB 1GYKA 3UGHA 4FSJA 1VBE1 3A22A 4HBNA 5E6HA 1CONA 1YI7A 3GJBA 4TYSA 4URTA 3TBDA 2J1EA 2YMZA 3AFGA 1HX6A 1ZZ9A 2HWB3 5FYHA 3D0SA 2XJRA 1XYOA 4QPYA 4ARXA 5A33B 5KC6A 4BZ4A 2ARBA 3P6BA 2D5HA 3NO8A 5DUWA 3WNPA 3W59A 1RHI2 1O3RA 4GA9A 1RIRA 1C5IA 4FTSA 1I1EA 2X5IA 3LEGA 1NCRB 1POV0 2CHHA 4HL0A 3GXUA 3WP6A 5DZFA 3ZYPA 2HWE3 2IXJA 4ASMB 4KGQA 3KVBA 5K0UB 3L2YA 4QT6A 4EN9B 1AJKA 5GZEA 5J48A 2VGDA 1QNWA 1ZA4A 4GWMA 3S5QA 4ZZ8A 5JIUA 3PHMA 3PNAA 2A6ZA 1YRZA 1C8NA 2BW8A 2OYZA 4YVSA 3MO4A 5KHHA 5BYNA 4FI9A 2FZ1A 5KXEA 3TNQA 1UAIA 2R073 5T55A 4MGZE 1ZZCA 4X8NA 4OZOA 4YVWB 1LOEA 3FHIB 5KWRA 4XE9A 4I0AA 5JSRA 3POSA 1RJ8A 3K51A 4YFWA 1O4ZA 1ULDA 2ZXQA 2DCJA 4F8AA 3IDCB 1YYNA 3LDRA 3VUOA 3CF6E 3AMNA 4CDUC 3OBAA 4W6YA 3VBFA 4N8MA 2Q8CA 3VBSA 2LM3A 3OUIA 2HYXA 4AW7A 5A1LA 5FYIA 1DHKB 4FPYA 4EZHA 1IOAA 4LNVA 2RM22 3M7AA 3N9LA 5LBEA 3TEZA 3BTXA 5FMBA 2GAUA 1RUNA 2BWAA 4FPJA 4W6WA 3A7QA 2WAAA 5HCBA 4IGPA 1TNFA 2VUAA 1OUXA 2W39A 3POJA 4LBLA 4AL9A 5KBFA 3DEMA 3SNMA 4J1XA 3VBHB 1E5SA 2PQQA 4YSFA 5FZMA 3O1MA 3GZUC 2R041 4KG8A 5GZCA 4AEDA 4Q0PA 1GOFA 2QCSB 3RJ2X 4F3JA 2HEWF 1XSRA 4WM8C 3CLPA 4Y24A 3FJSA 4H7MA 3UGGA 4UT5A 3I8TA 4Y22A 1WLCA 4WM7C 3O1TA 4YYOA 1CX4A 4AGRA 2XVKA 4XFIA 1WMEA 2XGXA 3MGUA 2YXSA 4XBQA 4LLOA 3D5OA 2VUCA 5BNPC 2BGOA 3URFA 4IE6A 3KHBA 2WDBA 3WSOA 2W46A 3AZYA 4XUPA 5FYYA 1KFUL 1AR72 1SPPB 1IPKA 2W1WA 1NT0A 1Q8VA 3LEIA 4FFHA 2VW1A 4M4RA 1WCKA 4ZS2A 2IXLA 2WNOA 2BNNA 2JDYA 4B7EA 1QJX3 1VBC3 3J7LA 4QKNA 2WT0A 4OUMA 4C1WA 1FMD3 1XNCA 2L9LA 3I7DA 3MLKA 5T50A 2DUPA 2WQZC 5FK7A 1GNZA 1HQLA 3NAPA 3QACA 3RYRA 4FQZA 5DAQA 4P9WA 3TEYA 1JU4A 2E32A 2VC9A 1QJY3 4LO8A 1EV11 1MR5A 4RL7A 4AGVA 3JD71 2RS12 5L36A 3T09A 1ZBA1 3KQRA 5FXZA 3IDBB 1FV2A 3WDTA 3KLSA 4R9BA 4BMEA 1OC1A 5IVVA 2BV4A 2C9KA 2WKKA 5EP9A 1ND2A 2FCTA 1HRI2 5KXBA 5T3NA 2GP3A 2RR11 3IMNA 2QQKA 4HSJA 4C0HA 5A7OA 2VUJA 4CDUB 1HXS3 2A7AA 1F15A 3TEXA 1OQEA 2JDNA 2K9ZA 5FDBA 2OX0A 3M3QA 4PDWB 5DN2A 5LY1A 5C3RA 5CADA 4KWKA 1AYM1 4QPGC 2VZ3A 1KDKA 5C3PA 1ZRFA 1OOPB 3FN9A 1UXZA 3EYPA 3AP7A 4YARA 2XBO3 3KGZA 5C4WA 1OURA 1J83A 2ZGOA 4Q8LA 5FZCA 2O14A 4AZZA 5IFTA 1UIKA 4AF9A 3HT1A 5CIRA 2JDMA 3ZKUA 2SLIA 4UYBA 4WM8B 3SH3A 3WDYA 1S0GA 2XJPA 4XFHA 1JZ3A 5J7MA 1CAXA 2ADDA 4CUCA 1W6PA 3K48A 4WM7B 2CL2A 3EO6A 3ZFFC 1US3A 3AKRA 3E5XA 3ZFGC 1EPZA 1TME3 3GBFA 2WO7A 4WVMA 4JDOA 1KS5A 3N4MA 4QAWA 1RXFA 1UQXA 4GB31 4GWNA 3FBYA 3RI9A 3T2PA 5CEHA 5JI9A 5JOXA 2JJ6A 1ZZ8A 2H0BA 3S5AA 1B35A 3LA2A 2ZTNA 3PURA 4BQYA 4QXKA 2FDGA 3SMHA 2QQJA 5AVAA 4XUTA 3CBNA 4TSVA 2R0HA 1UY2A 1LGCA 5ACA2 1QQP2 2EIDA 3ZMOA 1NY71 3H9AA 2IUWA 3KV4A 1WD3A 5H9RA 4K3UA 1Q43A 4AWDA 2OIIA 3S30A 3U1XA 3G7DA 1QJU3 2BVBA 4Q0UA 3RQ0A 2GMEA 3DF0A 4QHOA 4E2GA 2Z4FA 2RS33 3DUIA 3GDBA 4HOOA 5ANQA 3V0AB 1DQ0A 1AR91 3WP5A 2JXAA 4NIAA 5FRAA 1SFNA 1D4M1 1W9YA 1LR5A 2K0GA 2CTVA 3B5LB 5GZGA 3VV1A 4CEYA 4CU6A 1JOJA 2JDKA 4MV2A 3WNXA 5C6CA 2Z42A 4YGBA 1ZZBA 2VAUA 2BRTA 1R083 1HQNA 2AH2A 3C3VA 4FOWA 4MXVA 4QQOA 4Y3OA 1AXKA 5FYTA 5L9RA 4BOWA 4ZU4A 4LQRA 2EIBA 2WWUA 2YGLA 2C1FA 3KQ4B 3I54A 1XBFA 2R042 2QQIA 2W9XA 5CU1A 2IXIA 2ZGRA 1MQTA 1LENA 1QH7A 4RFRB 1W9SA 3POBA 2IVIB 1NOVA 4HK8A 5C7GA 3MI8A 1S2BA 3Q8BA 5EJ1B 5A7NA 5LK7B 3RZJA 4S2DA 2JB4A 3CIHA 1QMJA 2I45A 3WW1A 2VZVA 1LHVA 4KWJA 1H4HA 5FY8A 1H4GA 1O7FA 5I93A 1S0CA 4OFGA 2HWC1 1AVBA 1FPN1 4Y1VA 3W5NA 1W39A 3B7MA 3NJXA 2OQ6A 1SDWA 1T6BX 2MHFA 4YW1A 1GZ9A 4Y20A 1UOBA 4LKDA 5FUPA 4CDXC 2Q4SA 4XTMA 4B4RA 2WIIB 4EWAA 1O6UA 2D3PA 3NJYA 3NJZA 4QX2A 2AC1A 3OUHA 2A70A 4FCAA 2GNDA 4GQ7A 5D2AA 3VKOA 4E8CA 1RUG1 1PM4A 1QDOA 1YQCA 5L19A 1H2NA 3MIBA 4BPZA 3U14A 2P3YA 4Q4V1 4H55A 5F6KA 2V73A 5C9AA 2CGPA 1EV12 1OQ1A 3WG1A 1MZ6A 2JDZA 3VL9A 1GZTA 2HH9A 4Y4RA 2XLGA 1PK6C 1UMIA 4HPKA 4JQTA 1ZBA2 2RDRA 1NZCA 1S0IA 2H6CA 3EMRA 4NPRA 5FZ0A 1BBT1 1J3QA 2EXIA 5L73A 4DXZA 3T08A 5EZWA 1LOBA 1LRHA 4R9CA 2WRAA 2VCCA 4P02B 5FPUA 1QEXA 1X9PA 3I2HA 1SFYA 4D7SA 2ZGSA 2RR12 4R52A 5C8WA 2EXJA 4PI2A 4YGDA 2BZDA 3S7EA 1JHJA 4LUKA 3OPZA 1R093 3RMYA 2VOXA 3W21A 1KS4A 4QX1A 2XUMA 4JGYB 2RMU1 2VZ1A 3AVRA 3KT7A 4DEQA 4QPWA 5A6QA 2YPDA 4LUMA 3WDWA 2G9ZA 3I2KA 4NRQA 4NHMA 5I8SA 2A6WA 3RI8A 3NSTA 1YQ8A 3T3YA 3LDBA 3MV11 4M3CE 3EQEA 3OUJA 4Y33A 1H2MA 1ZYBA 1CAWA 2NN8A 2YY1A 1W8FA 1ASJ3 2YG0A 1ULGA 2CAUA 5FLJA 4IV1C 2GMMA 3THTA 1IHMA 2IXHA 5D8AC 1N1TA 1WZXA 4XF3A 1O8PA 5A7PA 3KT1A 4EQVA 3T2TA 5ABJC 1FI2A 1AL21 4LULA 3RMXA 1BKZA 4QB6A 4I02A 1VPHA 4Y5TA 1Z0HA 5CBLA 2D6MA 3K3OA 4YGEA 5F3CA 1STMA 3WD5A 1HN1A 4GB32 4XIOA 1N3OA 1YQ5A 4D94A 4W8JA 4L97A 3WCRA 1YNAA 2WSVA 1OFNA 2YBPA 3UKVA 4UFHA 1W6MA 2UU8A 4D6SA 2WWJA 4CDXB 3ZXJA 3WW3A 4N9IA 4YZ5A 5JOYA 1PM7A 3PTYA 5HXMA 5FZDA 3B00A 1UKRA 2JDUA 1LOFC 4QPIA 4QMAA 4CRQA 1NY72 2BBVA 1GP5A 4WVWA 5FMOS 3VBUC 4CP9B 2GC0A 1RJ7A 3FLPA 2W0XA 5LWBA 3LE0A 4AAPA 3O14A 4Q0VA 5T5PA 5HI0A 5IVBA 5KC5A 2ZAHA 3SKJE 3DV8A 2WZEA 3DYOA 2OVUA 4Q4X3 5T54A 5L7OA 2UYBA 3JBG2 1L7RA 1UO9A 3OGJA 4GXLA 2CAVA 4N43A 3ZKYA 1L7QA 5DAXA 5CVRA 1G9AA 1D4M2 1JOPA 4QKFA 2XLFA 2FDJA 1WLTA 4WVVA 1NLSA 4COVA 5C33A 5JPNB 5HCHA 2DTYA 3TYJA 4EJRA 5DAVA 4Q4W1 4QGNA 1SLLA 4RR3C 2O8OA 5JMOA 2WNUC 4JTOA 1C8M3 4JGZA 4V2VA 4BDVB 1WD4A 4UF0B 5DPNA 1AHSA 3OB8A 3TB0A 3VHPA 1WMXA 1LGBA 1WCDJ 1GFF2 2MPFA 5FKBA 2EVXA 3F2ZA 5FJHA 1UYPA 2CSGA 1POV1 2DVAA 3PUAA 4KNCA 2PHXA 4M3CA 3KF3A 1POQA 3PVOA 4H7LA 5FP4A 2R061 3UKTA 2VBBA 3OBZA 2HWE2 1MS8A 3ZPYA 4LOTA 3POWA 3O7OA 3OCPA 4JV4A 3ZXEA 2WO1A 1ZZ6A 4IV1B 1HV1A 2ZGLA 3TN91 2WABA 1O8SA 3PUIA 4CEWC 5LA0A 1QF3A 3FC0A 4P9LA 3H7JA 2GU9A 4QQPA 1H8VA 4XFCA 5AC93 4YGCA 2B5HA 4N7UA 1EUUA 1QU0A 2QQUA 2J22A 2W5FA 3DPRA 2NMOA 4IEOA 1HJFA 4EZ4A 3U4SA 4LBKA 1GLHA 4COUA 1AR61 4UI9L 3WDUA 5C3OA 1RUG2 3KCCA 1I3HA 4RFT0 1V6MA 2D3SA 5B4NA 2GC2A 4LE3A 1RVF2 4AR2A 1ENQA 1PZ8A 2ZMKA 1SG3A 3KF5A 3DGTA 1C1FA 5BPXA 4P00B 2R32A 4LBOA 4CDWB 1R64A 4LE4A 4AQ2A 4MLOA 1DP0A 1S4CA 4MXWB 3VBUB 4FAGA 3T30A 4AHYA 1C3HA 2GMPA 2XHNA 5TSWA 4KU8A 5FZLA 1EAH3 3C7HA 4TLFA 2YBKA 5FBJA 3LWCA 5FMDA 2ZGPA 4E4DX 3VDDA 2C0ZA 1MEC1 5A7WA 3CZJA 1UNBA 4OI1A 2JDAA 2OT7A 3NMBA 3BYWA 2JWPA 2PHLA 2PN5A 4RHV1 5I91A 3AZWA 4UFMA 3S57A 2IC1A 3ES4A 1AYN1 1W6QB 2IVJA 2RMU2 2XR4A 5FMOL 3M3IA 5KHJA 3BU0A 4RQPA 2XH6A 2RVAA 3MLLA 2ZMNA 1W6NB 1A3KA 2A5ZA 2WYSA 4LIUA 1OH4A 4XC9A 4BK5A 2VTXA 3AL6A 3ILFA 3WDVA 2WNUB 3RZLA 1MS1A 1AXYA 2VVFA 4IERA 3VD5A 4META 3E6CC 1TE1B 2PFWA 1S2EA 4XIKA 2YC0A 3AX4A 3ACHA 5DAWA 3RWNA 3ME2A 2Z79A 1H30A 1F31A 2BGCA 4RGAA 5HCFA 3DL3A 3HPNA 5KHKA 3FWEA 2FZ2A 4QB2A 1AL22 2JX9A 2W08A 4OVEA 4AHXA 1QNYA 1VBC2 4A7ZA 1RUE3 2ARCA 3BALA 1UZWA 2BBAA 2DU0A 2OXBA 4XILA 3VZMA 2VOWA 5I0TA 5JZGA 2HWF3 1UF2C 5EQUA 3FFQA 4CXYA 4FXKB 4CEWB 1LU2A 2P3JA 1QJY2 3I3EA 4I09A 5FZBA 3VZLA 4FOYA 4IXLA 5CB7A 3GCWA 1R1A3 2G1MA 4NWWA 3AK0A 3THDA 1OI6A 1CN1A 4GH4B 1RGSA 1RUC1 2VQ0A 5FZOA 1GOHA 1RUI1 4JC1A 3VKFC 2Z5WA 4OHZA 3D8CA 3WXPA 3UGFA 1ODMA 4LR4A 2YDEA 3AJYA 2WLPA 4LOSA 3ZOIA 1DQ6A 2BNMA 3CU7A 4XQDA 3SITA 5BNNC 1ZRCA 4NIDA 2A1XA 1VBD1 3IM0A 4QDQA 1CPMA 2GN3A 2N7GA 4AEMA 2FD8A 2VTXJ 2QNKA 4YW5A 5IJRA 2QBXA 3PDQA 4YWAA 3HT2A 3H7YA 1XB9A 5F5IA 1H8TA 2NM1A 5FO7B 1D2QA 3CNAA 1KGYA 1UYYA 3HIFA 4XF4A 1DFQA 4CU7A 1H1MA 4QGMA 1ZRIA 4B1LA 1LESA 1IS6A 2DUQA 1JUHA 5GLZA 2VCAA 2RV9A 3P1IA 2Q1ZB 1UYZA 4RYDA 1P8JA 1LEMA 2W1SA 1N47A 2JG9C 4N53A 5J36A 4HK9A 4S2FA 3ROUA 3BPSA 3W5MA 4Q4W2 1OKOA 2VNRA 4DY5A 3VDCA 4D7TA 1VB2A 3BOWA 3GZAA 1JW6A 3MFCA 3GNEA 2X8KA 4CCOA 3WNOA 3ZYIB 3LFIA 3OGSA 2VMIA 2ZHKA 4NPLA 1VBA2 1BK1A 1U5ZA 3CJIA 1HKDA 1NUKA 3AB0A 4XQWA 1J1TA 2ARAA 3ZYBA 3LOIA 4YZ2A 1CZVA 4F7ZA 3LOBA 4NN0A 2ZEZA 3FZ3A 5IVJA 3H3ZA 2R062 2V4VA 4A3ZA 2DVFA 5IK7A 4YW2A 4PIXA 1RL3A 5FLIA 3QBQA 5FKCA 2D93A 4AI1A 3PVEA 5FZ7A 3TN92 3D0JA 2E31A 1AR71 1SDDB 1UY3A 3D4KA 3PTRB 4ATEA 2EICA 4K8RB 4RGKA 3W9AA 4HVQA 3THPA 4AVAA 2R0FA 1JZ5A 1XOYA 1WCQA 1CZSA 4D6QA 1KEXA 5JXGA 1NCQA 4FPLA 3E5UA 1PIV3 1AUYA 4DEVA 1Y3TA 4QX0A 2B42B 2KD7A 5JIAA 3ZM8A 3IBMA 3MFAA 3C8XA 3QH6A 3AZXA 1FV3A 3D6EA 1ZNPA 4K9SA 2X05A 2B45X 4ISQA 4XDOA 5A33A 2WQ4A 1OKQA 1NQDA 2Q5TA 4C1XA 4CP0A 1PNFA 3OJBA 4IE4A 5E16A 2VO5A 1BEV1 4A4AA 1I9RA 2WS93 2W1QA 1NCRA 4HFSA 1NYWA 4RGGA 1QH6A 2D44A 4UW3A 4K1YA 1F4AA 1F2NA 5K0UA 2YBSA 1FOD1 2A75A 2D43A 1LHUA 4JCKA 2JG8B 1W9TA 4P9YA 2GSYA 4RHV2 4V1PA 4XDQA 5LA9A 3WT3A 2VCBA 1UMHA 3NV1A 4AXOA 1PNGA 3FE5A 5EJ3A 3GBWA 1VRBA 3AFKA 5FO8B 4I2OA 1VBB3 5HPOA 1GZWB 5DZGA 2X5IC 1S1AA 3Q9OA 4IEUA 4YVWA 1UY4A 2J1VA 1JZ2A 3O0XA 4L9BA 3D82A 2ZS6B 4COZA 3MEPA 4OHVA 3ZXAC 4YZ1A 1RMU3 2MEV1 4LA3A 1JTZX 2IXKA 3R05A 2WNVA 2VJXA 3C7GA 2F4LA 3H50A 1L7LA 1YFXA 3INAA 3H1MA 2R49A 4YVSC 5IVYA 4EN6B 3THCA 3HOBA 2RE9A 4P5HA 5A3PA 4BQ1A 3ZIXA 1COV3 3LPFA 1TG7A 1LGNA 5EYXA 2VZUA 1DYPA 4HKWA 4JQRA 3AXEA 1PGW1 1X33A 2ZGQA 4LO4B 4QU2A 5LRSA 3VBHA 2D3RA 3R0RA 5GLTA 2W68A 2Y6FA 1KRIA 5EV7A 5ACA1 2CWSA 1US2A 1QQP1 1APNA 1KFXL 1RUC2 1U12A 1RUI2 3VBFC 3VBSC 5DDJ1 1YQ2A 2A3WA 3ZXDA 2XDVA 4ORFA 5JI7A 2XQXA 3WR0A 4EN0A 4AFMA 4MGSA 1SLIA 3IZOA 3QCWA 2CY6A 1VBD2 1AX2A 3E97A 3KV6A 4QHZA 1HV0A 2FDIA 4QX8A 4L0PA 4LXLA 2JDHA 4OMCA 3LGRA 1G9BA 2ATFA 3UNPA 5FZ8A 5FYZA 1G8WA 5CFDB 2HWC3 4QQ2A 3ZDSA 1JI6A 5A6XA 1NXMA 1REEA 3H42B 2OZ6A 1XJAA 3AXDA 3I3DA 4AEDC 1RUD1 1DIWA 4L99A 2UYAA 3ZXKA 2IWGB 3AVSA 2VOVA 2H0VA 2VZOA 3J8F3 2JICA 3LKJA 2EIGA 3AJZA 3WY6A 4NIIA 4FTBA 1VRH1 5F3EA 3WQ1A 5JXJA 3GM8A 3JXSA 1UZ0A 3H1WA 3VKNA 4M00A 4Q4V3 1ALYA 3B94A 4FXGB 3LPGA 5C8CB 5KXCA 4TWTA 2GALA 3C7FA 5FAXA 1SLAA 1PMIA 5J1XA 4OHXA 1HB2A 3VD7A 1VP6A 1RUH2 1WW7A 4XACA 2X5IB 2ZX0A 4LK6A 1UOGA 2WFF3 1BBT3 3PJQA 4KWUA 4N7IA 2WA4A 4ATFA 5FZIA 4XYXA 3PUQA 1NE6A 4A6OA 3PUSA 5LA2A 5FBZA 4ET7A 3SH5A 1W99A 2GNBA 2F17A 3NVCA 3NAPC 2EXHA 2WL1A 3LA3A 4CA9A 4CDUA 4LA2A 5LEJA 4LITA 1LTEA 2QQLA 2VZQA 2VZRA 4OMDA 3GHNA 4PDWA 3WG2A 1CJPA 1SACA 4R4XA 2XL7A 4MUVA 3KT4A 1K42A 1QWRA 1K3IA 1YI9A 4L8QA 4QKBA 5FZAA 2UY8A 4G3YC 3ZSEA 4BLIA 3G6JB 2ZGKA 1OOPA 3HBKA 2ZJCA 3NNGA 1UY1A 1ND2C 4L2NA 1N1VA 4YW6A 5FJKA 1Q8OA 4O7XA 3POEA 1C5HA 3N36A 4CP1A 1UZVA 4IEXA 2XPJA 1N3QA 3U11A 5LY2A 2W92A 4HKOA 3VBSB 4IL7A 4WM8A 2ZACA 4PJYA 4R9AA 1WW4A 2ZGTA 1PO13 3K4ZA 4FPKA 1C57A 3SISA 4WM7A 4C8DA 4COYA 4AI9A 2NPIA 1A78A 1Q5OA 3TNPB 2FCVA 3VBRC 1BEV2 1TMF3 1TNRA 2YC2A 5FY4A 2BVVA 2OUHA 3RZZA 3KV5A 2WJSA 4YZ4A 3M8LA 4HLTA 5C4WC 3ENRA 1LNSA 1F35A 2P4EA 1ZBE3 4PCRA 4RSUA 4XFAA 5FZ6A 1JODA 1AR81 1FOD2 1GWLA 1LU1A 3HQUA 4K8FA 3SCHA 4AEDB 5I0RA 3HN1A 3O5SA 3M3EA 2YFUA 4Y1UA 2QQMA 3PU3A 5IAVA 2WLQA 1OVSA 1QGLA 2ZPXA 1V00A 1ZM1A 5KXDA 2SBAA 1S0JA 1HN0A 4CXWA 5CKQA 4FPFA 1RUF3 2ID4A 3C2UA 4O9EA 3WUDA 3IT8A 1V6LA 4O61A 2VOKA 2D98A 5A1AA 5FY9A 4LEJA 4NE9A 4NAOA 1YIPA 3IB3A 4Y1ZA 3IN9A 2WQ8A 4BQ3A 1NE4A 2XVLA 4E2SA 2MEV2 3IAPA 2XMLA 3LQCA 3O1PA 2UWBA 3LIHA 2VG9A 2ZAAA 1RUJ3 4ISRA 4Y4YA 4ASLA 2YZ4A 2VULA 1Q8QA 3JZVA 4W4ZA 4BISA 4Z1VA 3ZLIA 1WLDA 1O59A 5BNOC 2ZOEB 2RHPA 3AKSA 3BPZA 3ZYGA 3MPBA 3OPTA 1QHDA 3M2MA 4RS5C 5BNPB 5FXWA 1ZVFA 2Y64A 2JD9A 3X29B 5IATA 3O1UA 1O3SA 1JZ7A 2RJ2A 4WBBA 5BXXA 1PGW2 1HJGA 4LLFA 2XJSA 3WF4A 5K4LA 3MPPG 3VDBA 1CR7A 1A8DA 4MYEA 2WZR3 4LHNA 5CKMA 3ILNA 3LDKA 5DDJ2 5FP8A 4ZHNA 3MW3A 2VE1A 4HMZA 1EAH2 4I3PA 4LBNA 1SCRA 2VTFA 4LJHA 4Q4Y3 3ZN6B 1EP0A 4LBQB 4AQ6A 4U36A 2KA3A 1HW5A 1KQRA 1J3PA 2XONA 4S2HA 4AHWA 5K8SA 4XJWA 2XJTA 5F9TA 2YV8A 3ACGA 1HRV1 2D6KA 1VIWB 3RZGA 3GZTB 3JBG1 3M70A 1ST8A 3U4XA 4NHYA 3BTAA 3PMSA 5A80A 2WFPA 3OSDA 3VZNA 3IDAA 1TVGA 2TNFA 1RUD2 1V9U2 1HB4A 3LCPA 5IUQA 2YC4A 3OG2A 3VBRB 3WP3A 1QIQA 4IV3A 2Y6LA 2G4IA 4CCNA 1RUOA 4CSWA 1BCXA 3OEBA 1XXNA 2YB7A 4FPGA 3U78A 5A3TA 3O1OA 3AYEA 1ULEA 2DCTA 1IZ3A 4PI0A 1GUIA 5FPLA 1D0GA 1HB3A 1VRH2 2DF7A 2HWD3 1PX4A 2P34A 3HBZA 4QD2A 2HWB1 2BPA2 2PXJA 4AEKA 2VVDA 4P14A 4BYYA 1W04A 4QPGB 5FXVA 2VBPA 1CESA 4GJYA 1LODA 2XJVA 5DAPA 1TQ5A 1Y7BA 3R4SA 1CAVA 4ZU7A 1RUE2 1OD3A 4AVVA 4FOVA 1XE0A 3LFMA 5ERLA 3N3HA 5I0DA 1SLTA 2HWF2 1MVQA 2HWE1 4I0WB 1SBFA 2C24A 2O1QA 3PUHA 3WQ0A 3T1LA 4KBZA 5A3MA 5LCWL 4E9KA 1OVPA 1F5JA 1A8MA 1MEC3 3MIDA 4EROA 2W95A 2VH9A 4I30A 1DCSA 3ZFFB 1R1A2 4Q0QA 2B39A 3ZFGB 2X10A 5C9AC 2VZSA 5BNOB 2W52A 4FFIA 3VD9A 2R071 2QE3A 1AYN3 1IG3A 4RS5B 4JGYA 4IDZA 4P9GA 4LBMA 1WGPA 2D97A 4P9JA 1IKPA 2B9UA 3VKLA 3GZEA 4M0NA 5F8PA 4FPOB 1MPXA 4BXSV 4E4SA 1UKGA 2GC3A 2ZEYA 1QY4A 4CYDA 1WMDA 1RVF1 4IEWA 1YCIA 2JE7A 4WVZA 3SKVA 5D21A 3I2IA 1VMHA 5B4XA 2JEMA 1XQNA 1S55A 5C3SA 1UX6A 5EFUA 4NHKA 3H3UA 1W8WA 4LORA 2V5DA 1D2SA 3T2OA 1RHI3 1K5MC 1W6OB 4IGOA 2BQPA 1JMUB 3WV6A 5J3UA 4K40A 2AYHA 1W3VA 2ZX2A 3LSEA 1DQ2A 1BZWA 4Q26A 4YLZA 2DVDA 2OA2A 3AYAA 3KVAA 5LEKA 3AZVA 3ASIA 1AR82 4BXFA 2QZ2A 4JX0A 1KJRA 2PHDA 1NQJA 1Z7S3 5FXXA 5JVVA 3RGBA 4NIHA 1XE8A 3B69A 5J37A 1KITA 4O65A 4BQWA 1PGSA 1W8ZA 3BB6A 1TZOA 3K75B 4HKLA 5C5UA 3RZHA 1O91A 1U5YA 3DN7A 3VZKA 1Y9GA 2WR9A 4CP9A 1PO22 3AMQA 3U0ZA 5LATA 1WBLA 1LHNA 5FP3A 1L3JA 1WLWA 1N3PA 1YFYA 3U10A 1S0FA 4JZRA 5K7PA 1UD1A 2AR6A 3EB7A 3HVDA 1RITA 2WWSA 2D6NA 5J98B 5GZDA 2WINB 4XAAA 1ULOA 2PLV2 3AMMA 3FUOA 3I2FA 5HV4A 5AFEA 3Q8EA 3I49A 2WO2A 4QPIC 1QJX1 1VBC1 2RM23 2DURA 3UL2A 1XNDA 1UCXA 1PIV2 1PVC3 1XYNA 2XUEA 3USUB 2ZGUA 1ENSA 5LZ6A 3SHRA 4OHYA 1X7NA 4X8PA 3WOGA 3W58A 2WA3A 5HBAA 2GDFA 1QJY1 5FFOC 3SLIA 1AX1A 3T2QA 1DGWX 1W3XA 2JECA 5F1RA 4AE2A 1IS3A 5L7OC 3BU7A 3GBGA 1QXPA 2TUNA 4QX5A 5FO9B 1QXRA 3AMHA 3POGA 4UF0A 4ZS3A 4W6XA 2E6VA 4EV0A 1JYVA 3KMHA 4N43C 4XUOA 5FZ4A 3ZN4A 4AFAA 4DXRA 3FMGA 1REFA 1WA4A 2WS92 1J59A 3AP9A 5A6YA 4INDA 2RS52 3KCXA 3WNKA 1Z78A 4HSLA 5F2WA 4MSVA 2OQ7A 5FV3A 1DGRN 4FP2A 4K1ZA 1HXS1 5IK8A 1YUDA 2CDOA 1HRV2 5SV8A 4IV1A 1PK6B 2CNAA 3DKQA 2BOJA 1MZ5A 1YJKA 3M1HA 3UYJA 4JGZC 1K5MB 4ZXEA 4LHLA 4BH9A 3NJVA 4NAMA 3FLRA 3V64A 4FO9A 1OPOA 2ZHNA 5FZ1A 1JYTA 4GWIA 1VBB2 5FY0A 2ZCWA 1BVP1 1DGRA 1EUTA 2V5YA 2XBO1 1REDA 4UW5A 5LBBA 3TEWA 1W8OA 3NNLA 3ZDVA 1OD5A 3N7KA 4FPEA 1CAWB 1NLRA 1Y4WA 3H0OA 4GMP3 4TN7A 2HWB2 1RMU2 3B9IA 3AKTA 2CGOA 4P5YA 1DGLA 3ATGA 1SLCA 4XJ8A 4CTEA 1VBA1 4QWNA 4YM1A 2WN2A 3C7OA 1GQHA 1Y43B 2RS13 4GZ9A 3ZXLA 4A3XA 2ADEA 3KWVA 4CDWA 5FY1A 2ZGMA 4MXWA 3VBUA 3EJKA 1FT9A 1GQGA 1UOJA 4B4PA 3OD0A 5C70A 2BFUS 1UU5A 1HRI3 2W87A 4LTAA 4FQ4A 5D8AB 4D0QA 1D0HA 1CIYA 5ABJB 4KI5M 4FPCA 3QOPA 5G04L 3O1SA 2G9FA 3RJRA 4YG3A 1XSQA 4BB3A 5A32B 4LT5A 2AENA 4IEPA 2R072 4KL1A 4O9GA 2NZ9A 3RFRA 3N7MA 4HT1T 2P6HA 4GULA 4B7KA 1PGL2 4N90A 4A44A 1UMZA 1NA1C 1W6NA 5IFPA 2LTNA 3ACFA 4HVRA 4AEJA 1W8UA 1QJU1 2J1TA 2R6QA 3AP6A 4XZUG 4YW3A 1WA6X 1VBE3 2NLRA 2DVBA 3A0KA 3VDDC 4ARYA 2J1SA 3RZKA 2AZ5A 1YJLA 1YLLA 4IETA 4R8HA 5FZ3A 3NNMA 2D5FA 4XFFA 3A21A 3IDEA 5CYYA 2I74A 3N35A 4DUVA 3CMGA 4E4HA 1SBDA 1XC6A 1T6GC 4FFFA 4FTEA 3C7EA 4LBJA 3WQ7A 4PQ9A 1R081 2HEYF 4OUSA 2WUHA 4OQ9A 2EAKA 1C1LA 1GV9A 4JGZB 5FYVA 2DBIA 4CUGA 4KWLA 2HJIA 5JXIA 4EN8B 5FPAA 1UOFA 2FDFA 1MZFA 1I6XA 3HD8B 1DZRA 2ENRA 4MOAA 1ENRA 1QQP3 3A0NA 2P2KA 2PHTA 4GH4A 5IHRA 2D6PA 3NW4A 1GMMA 1IQDC 2WFF2 4OULA 2J1RA 4RR3B 5FZ9A 3FX3A 3UETA 2CYFA 1UX7A 5JZGC 3WW4A 5GM0A 4HONA 3JCIA 1FAYA 1X9TA 1U0AA 2ZX3A 1K5JA 1JHNA 1JU3A 3JU9A 5I8YA 3BTYA 1HIXA 4BIFA 3PU8A 1O5UA 3SCFA 1BXHA 2ES3A 2VOTA 3HN3A 2PQSA 2ERFA 4Q27A 5C3QA 4BA6A 4NPMA 1QJX2 1GNHA 3VDAA 1JUIA 1FMD2 2ZKLA 3APBA 2DUOA 1XRUA 1QKQA 1WW6A 2JD4A 2VQAA 3J7MA 3VLBB 3NV2A 2P5BA 1IKQA 5HV0A 1FNZA 2FQPA 1JBCA 2KM2A 3MW4A 1DG6A 4CDQC 2QQPA 5T52A 4JKLA 2B8MA 2R043 1H8TC 2EF6A 4IQPA 1NKGA 4PT6A 3PLQA 1WCSA 4QXHA 4YM2A 1PO12 3OYWA 2NQYA 1G9DA 3T0AA 2EIEA 1NA1B 3ABZA 4KG0A 2Y38A 2O0OA 1YWKA 4MGKE 5A7WB 1DZTA 3VBOC 3RRDA 1D7PM 1HXS2 3U07A 4FAHA 1N1SA 1JXNA 3OBTA 4JKMA 4R9DA 3T0BA 4D69A 2FHRA 2XJUA 4XDPA 3J9SA 4L92A 5FPBA 4K21A 1HQWA 4GKYA 4XQ4A 2BUKA 3E5QA 4OQ8A 3I3BA 1JOBA 3CJIC 4CCDA 1ND3C 4JAAA 4DPNA 2F6BA 1RUF2 3EHKA 4FP3A 3O1RA 2XBO2 1BYHA 4LKFA 4LO6B 2ZZQA 3EXUA 4ONUA 3MUZ1 2DDUA 3ACIA 3K46A 4ZY9A 1OMIA 4X6QB 3TOJA 1ACCA 3I59B 2VMCA 3P3NA 5E8AA 1W2TA 4ZKTB 2C6SA 3ORJA 1KD7A 5DQ0A 2IZWA 2GH2A 4E8DA 4Q2FA 3ZFEA 5D1IA 2V72A 4QX7A 2QQVA 1WMFA 4OI4A 4XHBA 1EV13 4HZFA 4WV8A 5CFCC 1RUJ2 1RUH1 3JD73 5BY5A 2BYVE 1TME2 1ZBA3 3M3OA 4UWDA 3GYDA 3R6SA 1X36A 4HANA 1G7YA 1OA3A 5JZGB 4FVVA 2A6XA 2D7FA 4XABA 1W8HA 4NO4A 1NCQC 2BNOA 1XE7A 3R4DB 4XOGA 4Z07A 1CAUB 3RS6A 2RR13 4CUAA 2DBNA 1JYXA 1CWPA 3GCXA 4QXBA 2JG8A 4DXSA 1Y9QA 4Q1RA 1YFWA 1JN2P 2VNVA 2HLEA 2ZZJA 4Z82A 3MW2A 3ZIWA 2HBTA 4ZU5A 2FDHA 1C28A 4IW3A 5HXVA 4YG0A 1AYM3 2OPKA 4JVAA 3Q8AA 2XVGA 1CZTA 4AVSA 1GZWA 1Q56A 1QJU2 4CDQB 1IQAA 2KR2A 1NCRC 3UK9A 3GF6A 3V65A 1H1AA 2PMWB 4MH0E 1FATA 1EYBA 1R1ZA 3FBMA 1H8TB 1CQ9A 3LAGA 5FQ0B 4Q4X1 4KQ7A 2J1AA 3ALQA 2RS32 5K0UC 3I3QA 1ENXA 5H9PA 2TBVA 4A42A 3MBWA 3RWKX 1SEFA 3VKMA 5BNNB 1LOGA 1OBNA 5C71A 5CKNA 4UXAA 4DY3A 4LHSA 3VBOB 3WG4A 1VMFA 5FMCA 5GALA 1R082 2ZKNA 3V0BB 5IK5A 3K4DA 2FCUA 2XG3A 1OLRA 4GB33 3JUUA 3NV3A 4YVWC 4DQAA 1VAVA 3S6PA 1UIJA 3AC0A 4FT8A 5FYBA 2OUJA 3SH4A 3NRUA 1SZBA 4AFCA 1BVVA 2VQTA 1LOCA 5I8TA 3K3NA 3E6BA 3CJIB 2P1BA 5LBCA 1ND3B 1ZZ7A 1OF3A 5FPZA 4BJ0A 1H1IA 2WNVC 2JG9B 1SLBA 3T1MA 1XNKA 2DFCA 3NL1A 2VMDA 3WNMA 3JQXA 3ZYFA 3I2OA 3J26N 3MLJA 4BHPA 2RJKA 2GH8A 1PZ7A 5F32A 1UYXA 4XJ9A 3RDIA 3POYA 5JXHA 3NV4A 3CL1A 1I5ZA 2PHFA 1MS0A 3KD4A 4C90A 5BUVA 5JSPA 1WCUA 4AG4A 2OS2A 1UZZA 2JE8A 5JWPA 5CFCB 1W0OA 4GKXA 5FWEA 4COWA 4SBVA 5AC91 1BMV2 4YM3A 1OF4A 1GKBA 3M3CA 5JR2A 3CO2A 3JBG3 5CFDA 5CAZA 1AR93 1QJZA 2DYCA 2ZMLA 3NQHA 4HN0A 4MZUA 3ZO0B 4PF5A 1D4M3 1NCQB 3BVCA 2EA7A 1V6NA 3HMYA 3PVNA 1KXGA 2ORXA 3OD4A 2AREA 2VCMA 2PAEA 3OY8B 4L11A 5AVPA 3U75A 2D6OX 2ZX4A 1CIWA 2PELA 4XETA 2VD7A 4MGYE 4GIQA 4P08A 4IEZA 5JLVA 4WZCA 3NKTA 2AEZA 4BM8A 5IW0A 5FLHA 2LS6A 3ZR6A 5IVCA 4K7JA 5GLUA 5C8CA 1S2KA 2PYTA 1HB1A 4AK3A 3LA7A 3MIFA 1UL9A 2VZTA 1DGWA 1EAH1 1BQPA 2BGPA 2QKDA 2VZPA 3ZVXA 3O12A 4LPLA 1DYKA 1PVXA 3DKWA 1Y9MA 4HXCA 5BV6A 1DU3D 2RG4A 4PLMA 1MS9A 3IPVB 3GGLA 4AAXA 1MS5A 4BU2A 4C91A 1R092 1FPN3 1Z7S2 3KM5A 3LEKA 4BK4A 3ZYRA 4X6RB 3P3PA 1UN1A 4KU7A 5GLWA 2Y60A 5FIXA 1SPPA 1VLNA 2W47A 1V9U1 3MYXA 4QU1A 3VL8A 4BQXA 1RINA 3IWZA 3MICA 5FY5A 3AYCA 4PBOA 2WZPP 3L2HA 1DF0A 1RUG3 1VAMA 1VB4A 4XW3A 1ASJ2 4P9XA 1E5IA 1RVF3 2W1UA 3KCYA 4MGQA 2EAAA 4QGLA 2WNVB 3PMEA 1VAKA 2YUEA 4MHRA 3IMMA 3H8OA 1DLCA 1UW8A 4MHUA 1E5RA 4AVBA 3VZOA 5DMYA 4XCBA 1RUE1 3GJAA 1D4VB 4PDWC 5FUNA 4ZZ5A 2DCKA 3I97A 4GALA 3ZSMA 1UWWA 3VHOA 2HWF1 1PVC2 2VNGA 3Q8CA 5J96B 2B9VA 5GKAC 3T0DA 2ET1A 2IFWA 4DIQA 1K45A 1OOPC 1S0EA 3B3QE 1W2NA 4AQTA 1O4YA 3LB9A 1CX1A 5FOJB 3WF1A 1IGOA 1R1A1 4FPHA 2GC1A 4YVSB 1GICA 4CZSA 3VHRA 2V4AA 2RMU3 1GQPA 3AL5A 1YHFA 4EN7B 3NNFA 3SXWA 2F4PA 1X8EA 2VMHA 3A23A 1JYCA 4XJZA 3OGRA 4D3WA 2BU9A 4PF1A 5EJZB 4E2QA 3K4AA 1J84A 4NRMA 1QXJA 3KS7A 2Q1MA 1TEIA 4Q4X2 4Q8KA 5F37A 2VXJA 5DUXA 3VBFB 1X8MA 1GOGA 3B01A 4ES9A 2ET7A 3MDPA 2P3IA 1GNYA 1DDLA 4NJ4A 2D6LX 4IEYA 3Q8FA 2XHKA 4EE2A 4XCAA 1AL23 3N7LA 5FYUA 5CG8A 1DYOA 4XBNA 1W8NA 3VN4A 2R16A 5E89A 4D6RA 1OSGA 1YXWA 3I3MA 2PA7A 1NX9A 3I2DA 4QQLA 4ZONA 2LW8A 4XMIA 4CE8A 3P5BA 5BNPA 1VE0A 3ZX7A 4CCJA 5JCTA 4Z2WA 4XURA 2VQUA 3VD3A 1XU1A 3ETQA 1C8M2 2DFBA 5A3UA 1GU3A 1LOAA 4IUGA 4DXTA 4DZGA 4YM0A 2QZ3A 4CVUA 3ETPA 2GZWA 3DCQA 3WF2A 2EALA 4TXWA 4AFDA 4Y22B 1G6NA 3OGVA 5DUVA 4GWJA 2E7QA 1YFUA 2GNMA 3VZJA 2XB6C 4CCCA 1XU2A 4AVCA 4TTGA 2LRPA 4UW4A 1W28A 1MACA 1JS9A 1PO21 1G86A 3PIJA 2Y33A 1JYIA 3DYPA 3ZN6A 3H8UA 4LBQA 1DZQA 1F9KA 1W9FA 3PVBB 4NR1A 5JOZA 1O4TA
chains in the Genus database with same CATH topology
1B35C 3QLQA 5DZEA 5AC92 3AMPA 4G9SB 4QHBA 2PLV1 5DUUA 4Y1YA 2A73B 2C5DA 2VNOA 4RD7A 5T5JA 3VBRA 2PAKA 1PIV1 2HEVF 2R1DA 2DTWA 3NAPB 1WUVA 4Q4W3 3ELNA 1VBE2 1ZREA 4RA0A 3WLUA 3AYDA 5JPMB 3JB4C 4KBBA 3KB5A 2CV6A 1BJQA 4B4QA 1M06G 5H9QA 1EPWA 1VBA3 5BNQA 4QPGA 3BOPA 1UPSA 1POV3 3ST7A 1ND2B 4IV3C 4CEYC 2P37A 2WS91 2HYKA 1V6JA 2RS51 2R063 2VU9A 4YZ3A 4MX3A 4A2UA 3MZHA 3WP4A 4AI3A 3TN93 1HDKA 3ZYJB 4OI2A 2XLAA 3ZFFA 1XYPA 1MQTC 3ZFGA 3OBRA 4ZXKA 1AF9A 2WNEA 5BNOA 2H6BA 1LCLA 1VBB1 1QOOA 2HKXA 2VW0A 1E57A 1NG0A 3IIAA 4RS5A 5C4WB 5DXDA 3OF1A 4KH9A 2B7YA 4NWVA 1AR63 2AUYA 2DV9A 3HQXA 4JRAA 2E63A 1PHMA 1MZEA 4GMP0 4K20A 1RMU1 3JQWA 4MVTA 3TRSB 1DLLA 4W65A 1CAXB 4M01A 1FX5A 1W6PB 1GR3A 2WSUA 2QDRA 4WVMB 2X53S 1QDCA 2ETEA 5FREA 4AI2A 1F8VA 4JGYC 1W6OA 1COV1 1N1YA 1X82A 3O0VA 4OZXA 1FYUA 2ZX1A 4JTNA 3AM2A 2E7TA 1B35B 2IFRA 4BE3A 1UPIA 3BIWE 2UURA 1LKNA 5FOBB 4RHV3 1DQ5A 3IKWA 4YFZA 3RPQA 1WBFA 5E1RA 3WDXA 3PJYA 5DG1A 1J58A 4N9HA 5T5OA 1LJ7A 4Y1XA 1PGL1 1V70A 4ES8A 4CP2A 4QM8A 2A6YA 2XWJB 4Z8BA 5T5LA 4YG6A 4IESA 2PHWA 1UZYA 4AVTA 2Y0OA 2JE9A 2Q8OA 1OLQA 3AP5A 2K2SA 3L9JT 4XHXA 1IPJA 4IV3B 4CEYB 2YHJA 3RNSA 3R4UA 4E4ZA 2FBEA 3J8F1 4P9IA 1OA2A 3B02A 3RYPA 3V56A 4LO5B 2X29A 3USUA 1Q8PA 1UU6A 4TZDA 2R1BA 1DBNA 4D7YA 4HVOA 4K6BA 1MQTB 4AGGA 5I0UA 3FFZA 4CDXA 2PHRA 3JD72 2A3YA 1U5XA 1CAVB 1RUC3 5B2GB 1RUI3 3LZZA 2WFF1 3ZSKA 1LEDA 1H0BA 3KZ4C 4XXAA 1CPNA 4XPVA 2OZJA 1CVNA 1OA4A 2Z2SB 1W0PA 1AJOA 1SCSA 1VBD3 3B9CA 1M4WA 2XKOA 4JDMA 4S2GA 1MS3A 3LSDA 3B93A 1SBEA 4Y20B 1PK6A 1S0DA 4J1WA 5EYYA 1FNYA 1QOSA 1K5MA 5JSOA 2MNGA 2QVSB 3UJQA 1FMD1 4Z92B 1AYM2 4BMBA 4HN1A 3MIEA 4HETA 4AHZA 3BCWA 4EWDA 3KGLA 1V6KA 1UU4A 2EXKA 5C9AB 2E7AA 4BCUA 3MF6A 2DU1A 1J1LA 5GJ6A 4HPKB 4Y26A 3UJOA 2QDNA 1PO11 1SQ4A 1IS5A 1RUH3 4XFBA 4JRLA 5EWSA 4EWEA 1WW5A 1EY2A 4PLNA 5A3LA 2ZHMA 1TMF1 2BEOA 3ES1A 4PLOA 4XMAA 4XXPA 1H2KA 3ZXFA 4XF0A 1S0BA 1ZBE1 2ARXA 2Z69A 2E51A 4AFBA 2UY9A 1SMVA 4J6GA 5D8AA 2DWRA 4PBPA 5ABJA 1AR73 1KJLA 4JDNA 4MGIE 2VMGA 2XL9A 2IXCA 5A32A 1Q8SA 3TAYA 4CDWC 1RUF1 2A71A 1V6OA 4E27A 2FMYA 4XJUA 1CJDA 3ILRA 3SCGA 5HCAA 5JOWA 1CGPA 4BIOA 4XBLA 3USSA 3ECQA 1VR3A 3J4UH 1IS4A 1LOFA 1RUJ1 1AR92 4Q1PA 5CNAA 5H9SA 1TME1 1RTVA 3DPRC 4I0BA 1COV2 5DG2A 1ZRDA 1BEV3 3FLTA 2PHUA 4DRVA 4B29A 2GN7A 1VJ2A 3MIHA 1DQ4A 4PIZA 1W6MB 4XF1A 2PAMA 3NWKA 1FOD3 4ITCA 5JMCA 3O0WA 3AKPA 5FPXA 5K9YA 4QPIB 2WZR1 3GALA 2UWAA 3HAGA 4DNYA 1W6QA 4NHLA 3ZN5A 2C9AA 4OI0A 4Q4Y1 2VECA 4AYUA 4DS0A 2P3KA 3ZMNA 4RR3A 2I2SA 2WNUA 1DQ1A 1LULA 2NYYA 5L7OB 2UWCA 2RS31 2HWC2 1FPN2 2VY0A 3H1YA 2MEV3 4N43B 1XNBA 3WUCA 2Q30A 3E6DA 2ZBJA 1F5FA 2JENA 3CEWA 4RQPC 2ILMA 5F5QA 4E2GA 2YGMA 3J8F2 4GH4C 3BODA 1OFSA 3M4FA 3AP4A 2XKPA 3WX5A 2CWMA 3ZXGA 2HWD1 5F6LB 4CEWA 4Q4V2 3TWIA 1AL0G 1V6IA 4A7KA 1H9WA 2TEPA 3WINE 4AQSA 4I3GA 3MIGA 5ACA3 4M3CB 5LRRA 5DDJ3 3ZSLA 1BBT2 1MS4A 1NA1A 3AKQA 3RG0A 4DMIA 1QOTA 4G4FA 4FOQA 2XJQA 4IEVA 1LHOA 4WZFA 1ZRRA 5IT6A 1J3RA 1MVEA 5JR7B 4DOUA 1BMV1 4LBQD 1AX0A 3DPRB 4NVPA 2VXRA 4YNIA 1RUD3 1V9U3 4XEZA 4XF9A 4B8EA 5GZFA 1RC6A 4DINB 1NXD1 1YO8A 3S7IA 1GBGA 5J09A 1VRH3 3I59A 2RJLA 1H2LA 1ONAA 2D40A 4H14A 5SV5A 2B46X 1LECA 4LHKA 2I07B 4Y5Z0 1RHI1 2G9GA 3OGGA 5LK5A 3WHTA 1YIFA 2E9QA 2BFUL 3ZSJA 2E53A 1TMF2 4AI8A 2QFEA 2GNTA 3HWJA 3VDDB 4N53C 3WCSA 5I0SA 3WW2A 4QQHA 1ZBE2 4M3CF 4UW6A 1CAUA 2WC2A 4QM9A 1R091 1Z7S1 4M0HA 2NP0A 4UBHA 3ZFEC 4BWOA 4DRRA 1ULCA 3WZ1A 2NMNA 4RQPB 1GZCA 1G9FA 3I4IA 2A3XA 3UKNA 5JDBA 5FCCA 2R30A 1LB2A 1X50A 2VVEA 4A7YA 5AFBA 4KGGA 1ASJ1 4CDQA 4IEQA 5KHIA 2ZGNA 4YRDA 3GHMA 1JH5A 5FQ0A 1GANA 1B09A 1Q3EA 2LALA 3CJXA 2JG8C 2QJVA 2O8QA 3RYKA 1H9PA 2RM21 1LHWA 2CGNA 4Q29A 3QD6A 5BNNA 1GSLA 3MF9A 1PVC1 5CG9A 3VBOA 2FMDA 1OPMA 3N7JA 4Q0SA 5CA6A 3OTFA 4XFGA 3V0BA 2LUWA 3FUQA 1AR83 4OHWA 1PZ9A 1OHFA 2WZR2 1AZDA 3OYWB 3S0MA 1ND3A 2WT1A 5FTTC 2JG9A 1URXA 1ZX5A 4Q4Y2 1HLCA 1G9CA 1W2UA 1CD3G 3UV9A 1PO23 5E88A 3RSJA 2DVGA 5KHGA 2P17A 1O3TA 2VPVA 4C0BA 1C4RA 4OLLA 4XTPA 4DFSA 4XZPA 5CFCA 2ZA9A 3VHNA 2Y0IA 3WVJA 5JAXA 3QH7A 2PLV3 3VGIA 4B3NA 4N53B 1OQDA 3HR9A 2Y26A 4DB5A 2VW2A 4SLIA 1AR62 4FBFA 4GMP1 1O3QA 2HWD2 2YYOA 2DCYA 2V09A 2JKBA 3OY8A 3ACLA 3ZFEB 1C8M1 1RB8G 4U2AA 2WT2A 4H3WA 4BLJA 2YPJA 1FXZA 2PTMA 4NOTA 3EBRA 3KSCA 2RS11 2QUOA 5CFDC 4F83A 2YROA 4YW4A 2OW4A 3WG3A 1U5IA 5GLVA 1AXZA 4R4ZA 2Q0AA 1O5LA 2ZABA 1HRI1 2BWCA 4UBGA 2RS53 3A4UA 1MEC2 2DCZA 3AZZA 5EXOA 2A6VA 4I01A 3NKGA 1A6CA 1VALA 1HRV3 3IPVA 4XJAA 4AI0A 3JB8A 3VBHC 4LO7A 1KDMA 5C8CC 1AYN2 5IK4A 4PIYA 1ULFA 2AGSA 2KXLA 2BTVC 2ZHLA 2XWBB 1GYKA 4FSJA 1VBE1 4HBNA 1CONA 1YI7A 4TYSA 4URTA 3TBDA 2YMZA 3AFGA 1HX6A 1ZZ9A 2HWB3 3D0SA 2XJRA 1XYOA 4QPYA 5A33B 5KC6A 4BZ4A 2ARBA 5DUWA 2D5HA 3NO8A 3W59A 1RHI2 1O3RA 4GA9A 1RIRA 1C5IA 4FTSA 1I1EA 2X5IA 1NCRB 1POV0 4HL0A 3WP6A 5DZFA 3ZYPA 2HWE3 2IXJA 4ASMB 4KGQA 5K0UB 3L2YA 4QT6A 4EN9B 1AJKA 5GZEA 5J48A 2VGDA 1QNWA 1ZA4A 4GWMA 5JIUA 3PHMA 3PNAA 2A6ZA 1YRZA 1C8NA 2BW8A 2OYZA 4YVSA 5KHHA 5BYNA 5KXEA 2FZ1A 3TNQA 1UAIA 2R073 5T55A 4MGZE 1ZZCA 4X8NA 4YVWB 1LOEA 3FHIB 5KWRA 4XE9A 4I0AA 5JSRA 3POSA 1RJ8A 3K51A 4YFWA 1O4ZA 1ULDA 2DCJA 4F8AA 3IDCB 1YYNA 3VUOA 3CF6E 3AMNA 4CDUC 4W6YA 3VBFA 3VBSA 2LM3A 4AW7A 1DHKB 4FPYA 1IOAA 4LNVA 2RM22 3M7AA 2GAUA 1RUNA 2BWAA 4FPJA 4W6WA 5HCBA 1TNFA 2VUAA 5KBFA 2W39A 4LBLA 3SNMA 4J1XA 3VBHB 2PQQA 4YSFA 3GZUC 2R041 4KG8A 5GZCA 4AEDA 4Q0PA 2QCSB 3RJ2X 4F3JA 2HEWF 4WM8C 3CLPA 4Y24A 3FJSA 4H7MA 3I8TA 4Y22A 1WLCA 4WM7C 4YYOA 1CX4A 4AGRA 2XVKA 4XFIA 1WMEA 2XGXA 3MGUA 2YXSA 4XBQA 4LLOA 3D5OA 5BNPC 3URFA 3AZYA 1KFUL 1AR72 1IPKA 1Q8VA 2VW1A 1WCKA 2IXLA 4B7EA 2BNNA 1QJX3 1VBC3 2WT0A 4OUMA 4C1WA 1FMD3 1XNCA 3I7DA 3MLKA 5T50A 2DUPA 2WQZC 1GNZA 1HQLA 3NAPA 3QACA 3RYRA 4FQZA 4P9WA 1QJY3 4LO8A 1EV11 1MR5A 4RL7A 4AGVA 3JD71 2RS12 5L36A 1ZBA1 3KQRA 3IDBB 1FV2A 3WDTA 3KLSA 4R9BA 4BMEA 2WKKA 1ND2A 5KXBA 1HRI2 5T3NA 2RR11 3IMNA 4HSJA 4C0HA 4CDUB 2VUJA 1HXS3 2A7AA 1OQEA 2K9ZA 3M3QA 4PDWB 5CADA 4KWKA 1AYM1 4QPGC 1KDKA 1ZRFA 1OOPB 3AP7A 4YARA 2XBO3 3KGZA 5C4WA 2ZGOA 4Q8LA 1UIKA 4AF9A 3HT1A 5CIRA 2SLIA 4WM8B 3SH3A 3WDYA 1S0GA 2XJPA 4XFHA 5J7MA 1CAXA 1W6PA 3K48A 4WM7B 2CL2A 3EO6A 3ZFFC 3AKRA 3E5XA 3ZFGC 1EPZA 1TME3 3GBFA 4WVMA 4JDOA 1KS5A 3N4MA 4GB31 3RI9A 4GWNA 3FBYA 5JI9A 5JOXA 2JJ6A 1ZZ8A 2H0BA 1B35A 3LA2A 2ZTNA 4QXKA 3SMHA 5AVAA 4TSVA 2R0HA 1LGCA 5ACA2 1QQP2 3ZMOA 1NY71 3H9AA 1WD3A 5H9RA 4K3UA 1Q43A 4AWDA 2OIIA 3S30A 3G7DA 1QJU3 2BVBA 4Q0UA 3RQ0A 2GMEA 3DF0A 2RS33 3DUIA 3V0AB 1DQ0A 1AR91 3WP5A 2JXAA 5FRAA 1SFNA 1D4M1 2K0GA 1LR5A 3B5LB 2CTVA 5GZGA 3VV1A 4CEYA 1JOJA 4MV2A 3WNXA 5C6CA 2Z42A 4YGBA 1ZZBA 3C3VA 1R083 1HQNA 2AH2A 4FOWA 4QQOA 4MXVA 4BOWA 1AXKA 4ZU4A 2YGLA 2C1FA 3I54A 2R042 5CU1A 2IXIA 2ZGRA 1MQTA 1LENA 1QH7A 1NOVA 4HK8A 3MI8A 1S2BA 5LK7B 4S2DA 1QMJA 2I45A 3WW1A 1LHVA 4KWJA 1H4HA 1H4GA 1O7FA 5I93A 1S0CA 4OFGA 2HWC1 1AVBA 1FPN1 4Y1VA 1W39A 3B7MA 1SDWA 2MHFA 4YW1A 1GZ9A 4Y20A 4EWAA 4CDXC 2Q4SA 4XTMA 4B4RA 2WIIB 2D3PA 3NJZA 2A70A 4FCAA 2GNDA 4GQ7A 3VKOA 5L19A 1RUG1 1QDOA 1H2NA 3MIBA 4BPZA 4Q4V1 4H55A 5F6KA 2V73A 5C9AA 2CGPA 1EV12 1OQ1A 3WG1A 1MZ6A 2JDZA 3VL9A 2XLGA 1PK6C 4HPKA 1ZBA2 1NZCA 1S0IA 2H6CA 4NPRA 1BBT1 1J3QA 2EXIA 5L73A 4DXZA 5EZWA 1LOBA 1LRHA 4R9CA 4D7SA 1SFYA 2ZGSA 2RR12 4R52A 5C8WA 2EXJA 4YGDA 3S7EA 4LUKA 3OPZA 1R093 3RMYA 2VOXA 1KS4A 2XUMA 4JGYB 2RMU1 3KT7A 4LUMA 3WDWA 4NHMA 5I8SA 2A6WA 3RI8A 3NSTA 4M3CE 3EQEA 1H2MA 1ZYBA 1CAWA 2NN8A 2YY1A 1ASJ3 1ULGA 2CAUA 5FLJA 4IV1C 2GMMA 3THTA 1IHMA 2IXHA 5D8AC 1N1TA 4XF3A 3KT1A 3T2TA 5ABJC 1FI2A 1AL21 4LULA 3RMXA 1BKZA 4I02A 1Z0HA 5CBLA 2D6MA 4YGEA 3WD5A 4GB32 4XIOA 1N3OA 4D94A 3WCRA 4L97A 1YNAA 2WSVA 1OFNA 3UKVA 1W6MA 2UU8A 4CDXB 3ZXJA 3WW3A 4N9IA 4YZ5A 5JOYA 1PM7A 3PTYA 3B00A 1UKRA 4QPIA 1LOFC 4QMAA