2PELA

Peanut lectin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEANUT LECTIN
publication title Conformation, protein-carbohydrate interactions and a novel subunit association in the refined structure of peanut lectin-lactose complex.
pubmed doi rcsb
molecule tags Lectin (agglutinin)
total genus 52
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pelA00
2E7QA 2WT2A 2XB6C 1W6PB 3WCRA 1AZDA 3AYEA 1JYIA 5T54A 1QDOA 1JYCA 4C1WA 1TEIA 4LBKA 1APNA 3B69A 3CNAA 2GNBA 3NV2A 3O5SA 3R4UA 4BMBA 2ZGNA 4R9DA 3ZVXA 2UWAA 1YO8A 5CA6A 2D6NA 4ITCA 4XXAA 2ZHMA 4YG6A 3ZYRA 2SLIA 3N7JA 5LK5A 1IOAA 1V6OA 5L73A 4XHBA 5BYNA 3ZPYA 3FBYA 1LENA 1LGCA 1ULGA 4PBPA 3UJQA 2EXIA 2ZMLA 5GALA 3INAA 4XJ8A 1GV9A 1G9FA 3A4UA 5FREA 4AGRA 2ZKNA 1GZWA 3SH5A 2NN8A 3ZSMA 3ZSJA 2NMOA 2UWBA 5IK4A 1AXKA 1A8DA 1WBFA 1WW4A 2ENRA 4XIOA 4TZDA 3A0KA 1N1YA 2GN7A 5H9SA 3WZ1A 2A5ZA 2EALA 3ILRA 1QF3A 1ULFA 3W58A 1Z78A 1LU2A 1AJKA 1LHUA 5DUVA 3SH4A 5KXEA 5DUUA 1H30A 2ZMNA 1G9AA 3AYDA 1DQ2A 1BKZA 1UN1A 1AX0A 3PMEA 3M3QA 4HL0A 2D6OX 3IMNA 3VUOA 1C1LA 2CYFA 2A6XA 4FPEA 3AP4A 3FFZA 5H9PA 1LOFA 3MW3A 3AZVA 1CPNA 2GN3A 4YGEA 4Y20A 1KDMA 1IS6A 2W08A 5EYYA 1GYKA 3ZXLA 1HQLA 3GALA 2D44A 2WKKA 4JC1A 3D5OA 3O12A 1DQ0A 4LBNA 2WT0A 1LEMA 4DS0A 1PZ8A 4PQ9A 1A3KA 4UW4A 4FQ4A 1SBDA 2E53A 2CWMA 3H0OA 1W6OA 1Q8OA 2VW2A 1MZ6A 3MW4A 2ZGSA 1JHNA 3HN1A 2NM1A 5T5JA 1SFYA 5DZGA 2ZGQA 3KM5A 1WD3A 2ZHNA 2A70A 2JJ6A 5AVAA 1W6MB 1MVEA 3LCPA 4YM3A 1I1EA 2B7YA 1AXZA 1WW7A 3W59A 4FPHA 4XJZA 1FYUA 4WVWA 1R1ZA 2PHUA 2SBAA 3PJQA 4DFSA 1RINA 1KJLA 4YM2A 3V0AA 1F31A 2AH2A 4GWMA 2ZAAA 5HCAA 3DGTA 3JUUA 2P37A 1KDKA 4UW6A 1SACA 3ZXFA 5GZCA 2ZABA 3AZZA 2NP0A 2EF6A 1DQ4A 3ILNA 1W6QA 1SLBA 5GZFA 2GMMA 5SV8A 2VY0A 4UW3A 4P9XA 3TAYA 4ATFA 1FX5A 4FOYA 2AGSA 3POWA 4HANA 4DQAA 5KXCA 5GJ6A 4Q1RA 4ZKTB 2DVDA 1LGNA 1X50A 2JD4A 3UK9A 3OY8A 3R4SA 5GLZA 1QDCA 4Q8LA 5GM0A 4WV8A 1I3HA 2VUAA 2WLQA 5IUQA 3WG2A 3V0BB 2E6VA 1WBLA 1KQRA 4ZXKA 1FNYA 1VAVA 1O4ZA 5E88A 3WDVA 4NO4A 1V6MA 4FPCA 1ZA4A 2PHRA 5GLVA 1LOGA 4YZ4A 1NLSA 5EWSA 4GKXA 5DZEA 5DXDA 1UZZA 5IK5A 4LBLA 2UU8A 1C4RA 1VAMA 4XJAA 4SLIA 1AX2A 1SLAA 1MS8A 1LHWA 3D6EA 3NWKA 4YW1A 4FPFA 1G9CA 2EXHA 5F5QA 2EXJA 2D43A 3O0VA 1IS5A 3M2MA 2GMPA 4R9CA 4MYEA 4LBQD 3RS6A 3AYAA 1JUIA 1FV2A 3V64A 2WT1A 2P2KA 1N3PA 3MPPG 3FUQA 1LOBA 4D69A 1CN1A 2GALA 2A3XA 5T55A 5EYXA 2D6PA 2EXKA 2AENA 2C5DA 2UWCA 1AJOA 1N47A 4Y22B 2P3KA 1EPWA 3N3HA 4FOVA 4GWNA 4XMAA 1SBEA 4YM0A 4R9AA 1LTEA 4Y1UA 2DWRA 3IM0A 5IK7A 3LSEA 2P3IA 1FATA 5JMCA 1HDKA 3MW2A 3WG3A 1Q8SA 2A7AA 2Q5TA 5T5OA 3VKFC 2WSVA 3POSA 4W65A 3OYWA 4H55A 4XBQA 1ULEA 1BZWA 3AP9A 2AREA 1CJPA 2YXSA 1YXWA 3USUA 5CB7A 4M3CF 2AR6A 5GZEA 2VH9A 2ZBJA 1V6KA 2LALA 3FLRA 4M3CA 4FVVA 4LBQB 4Q27A 2DTWA 2ZGUA 3PVEA 5H9QA 3VKMA 4YM1A 2DVAA 2GNDA 3AJZA 2DUQA 1WD4A 1F5FA 1MS0A 4YW5A 4Y26A 3ILFA 4GA9A 2CNAA 3WG4A 3HMYA 3SISA 2A6VA 3N35A 3B9CA 2FMDA 2ZGPA 3AK0A 4KBBA 1LOFC 1JW6A 2OVUA 2WSUA 1WLCA 5DG2A 5T52A 4FQZA 5DUXA 1BXHA 4YFWA 2R49A 4Y24A 4M00A 1ONAA 2DTYA 3BODA 4XTMA 1LEDA 1V6LA 3SH3A 1LOCA 4XZPA 5JLVA 1YIFA 4K1YA 2CWSA 4AVVA 5CAZA 2EAKA 3QLQA 1W6NB 2ZA9A 1LESA 1UX6A 2BQPA 2PELA 2R1DA 2LTNA 4FPGA 2WQZC 4RL7A 4AVTA 4DPNA 5IK8A 1S1AA 1DBNA 2NMNA 3O0WA 2PHFA 2E51A 1BQPA 3WV6A 2GDFA 2JE9A 4DRVA 1LHOA 1S0BA 1LOEA 4BMEA 1OQ1A 3B00A 3WHUA 1CR7A 4AWDA 2FHRA 2I2SA 2A3WA 2YZ4A 3IPVA 1UAIA 1SCRA 2A75A 2XG3A 4BM8A 5JOZA 1PZ9A 1VIWB 3AYCA 4WVVA 1QOOA 3ENRA 1MS9A 3HR9A 1AVBA 1SLLA 2NZ9A 2ZACA 2ZGMA 4U36A 2NYYA 1O4YA 1RIRA 1CQ9A 1ULCA 2R0HA 5GLTA 3T1MA 4Y1ZA 2OUHA 1G9DA 3B3QE 5JOYA 1SLIA 4YLZA 4Y20B 4FPOB 3SITA 4F83A 1QGLA 4GALA 4GKYA 3KQRA 3UJOA 4LBOA 1S0FA 1W0PA 5T50A 1GZ9A 1AXYA 5JDBA 4XILA 1LGBA 1QMJA 1LHNA 1U0AA 2A6YA 3AP5A 3M1HA 1HLCA 4XBLA 2WNEA 2UURA 3AX4A 1V6JA 1GSLA 1V6NA 3WUDA 3WDXA 3AJYA 3NV4A 1SBFA 3AFKA 3LSDA 3AZWA 4WZFA 4Y1YA 3ZXJA 2D3SA 3N36A 1V00A 2P3JA 3M3EA 3Q9OA 4LBMA 3PVNA 2ZGOA 4LBJA 4P9WA 3V0AB 1IS4A 1PZ7A 5GZDA 5T5PA 1W6PA 3IN9A 3AP6A 1N1VA 3MEPA 4CRQA 2OUJA 4FPKA 4FP2A 1OFSA 2DYCA 3VKLA 1WW6A 1W6QB 2A6WA 2KM2A 1MS3A 1B09A 4AGGA 2CL2A 3M3OA 1GANA 2GNTA 5EXOA 3WUCA 1DHKB 2DURA 3RSJA 3TB0A 1N1SA 3WDWA 1F9KA 3BIWE 3N7KA 2VU9A 3ZYPA 3ZXKA 4P9YA 3O0XA 3OY8B 2YY1A 1G8WA 1Z0HA 3UL2A 3VKOA 4DRRA 5KXBA 3AXDA 1LHVA 3WCSA 2H0BA 2DUOA 2ZMKA 3WVJA 2ES3A 3VKNA 4AGVA 1DYKA 5E8AA 2VW0A 4NOTA 2G4IA 1N3OA 1JXNA 4I30A 4XIKA 1MVQA 2R1BA 4Q26A 4YFZA 1QNYA 1MR5A 4YG3A 1MS4A 1H9WA 1HQWA 4XE9A 1BYHA 2DU0A 4YW3A 4OZXA 1UKGA 5DG1A 1V6IA 2D6MA 1SCSA 3ZXEA 1LU1A 3AXEA 2YMZA 4BOWA 3PVOA 3SLIA 4XBNA 3WNXA 1GBGA 4Q1PA 2VW1A 2PHXA 3ZSKA 1UZYA 1DGLA 4JCKA 5FRAA 3JU9A 1GLHA 1KRIA 3QCWA 1CESA 3RRDA 1WCSA 3AZYA 4BLIA 1GNHA 2Z42A 3OGGA 3U4XA 2PHTA 1N1TA 1NXD1 1W6NA 1UPSA 1FV3A 1S0IA 3ASIA 1D2SA 2V73A 3OBTA 2D3PA 1DFQA 3RMXA 2V5YA 2WJSA 3D4KA 4AVSA 2YV8A 4YG0A 2RHPA 2D7FA 4JRAA 1CVNA 4YW4A 2W52A 3VV1A 2JKBA 4XTPA 1URXA 2CY6A 5GLWA 2D3RA 1FNZA 4XJUA 4PBOA 1W6MA 1RITA 2YROA 1OKQA 4FPYA 3SNMA 3WHTA 1QOTA 2GNMA 1QKQA 1YYNA 3WLUA 4XHXA 3NV3A 1MS5A 3OYWB 1HKDA 1GZWB 1WUVA 2D6KA 5HCFA 1Q8VA 4C1XA 4BQ1A 4FPJA 3T2TA 1VLNA 3AP7A 1AF9A 1MACA 3IKWA 4Y1XA 3USUB 3NV1A 1G86A 1GICA 2OW4A 4XJ9A 3OBRA 2A71A 2HYKA 2CTVA 4M3CB 2C9AA 3FLTA 3ATGA 4XXPA 3ZSLA 4XDQA 2D6LX 3N7MA 1JN2P 1W0OA 1AX1A 5H9RA 1LCLA 1D0HA 1CIWA 3DUIA 3R05A 1DZQA 4PF5A 1ENQA 1YRZA 1CPMA 2ZGLA 1UL9A 4K1ZA 4ATEA 1DQ1A 3V0BA 5F9TA 3AZXA 1H9PA 1J1TA 2AYHA 3M3CA 4XOGA 3RMYA 1DQ5A 1S0CA 3A0NA 4FOWA 4YZ5A 2DUPA 3B01A 4YGCA 3V65A 3N7LA 2ARXA 2JE7A 4ASMB 2DVGA 4M01A 1S0GA 4YZ2A 5GZGA 4FOQA 1XQNA 1A78A 3APBA 1KITA 3T1LA 4P14A 4BLJA 1Q8PA 1ENRA 1SLCA 2AUYA 4YW2A 2JDZA 3POYA 4R9BA 1MZ5A 4RA0A 1LECA 3OPZA 1W6OB 2A6ZA 4XJWA 4Z8BA 2ERFA 1JBCA 5E89A 4U2AA 5GLUA 3C2UA 2ZGTA 1Q8QA 1Q56A 1SLTA 1LODA 4YZ3A 1GNZA 1S0JA 1S0EA 3IPVB 3WDUA 1ENSA 2ZGKA 1MS1A 2ZHLA 3L2YA 4IQPA 2R16A 2TEPA 4XMIA 4Q8KA 1IKPA 1LOAA 1FAYA 4FPLA 1GKBA 5CNAA 5JOWA 1LULA 2E7TA 1C1FA 4FP3A 2W68A 4PCRA 4XYXA 2GMEA 3OJBA 4AYUA 4Y22A 1ZM1A 3WOGA 1QNWA 1ULDA 1Y7BA 5JOXA 4K21A 2DVFA 3FUOA 2ZGRA 4YGDA 1DLLA 3RG0A 4L8QA 1UMZA 1C57A 2JECA 3I8TA 2A3YA 1KJRA 2R0FA 1WLDA 5HCBA 2P34A 3I4IA 4CZSA 1IKQA 3RQ0A 1S0DA 2W39A 4ISRA 3WDYA 1WW5A 1JOJA 1G9BA 2EIGA 2DU1A 4YZ1A 5KXDA 2VXRA 4GXLA 5IT6A 4Y1VA 3BOPA 3BTAA 1IS3A 2DV9A 1VALA 1YI7A 2ZZJA 3GNEA 4UW5A 5DZFA 1QOSA 2PHWA 1WLWA 1BJQA 1N3QA 3FLPA 1G7YA 1GZCA 1DYPA 4M3CE 5JVVA 4ISQA 4BPZA 2DVBA 2ZHKA 4LBQA 1QU0A 4YGBA 5T5LA 1CONA 2ARBA 4Q2FA 5CBLA 4TYSA 1LJ7A 4K20A 3WG1A 4CTEA 3WDTA 1DIWA 1DQ6A 5DUWA
chains in the Genus database with same CATH superfamily
4LHKA 2XB6C 1AZDA 1S2KA 5T54A 1BEV3 1EAH2 1UOFA 3WW1A 1QDOA 2J1UA 3I3DA 1JYCA 3PMSA 3CLPA 2GNBA 3NJXA 4JKLA 3O1PA 3GHNA 1XXNA 1T6GC 2Y8KA 1RHI3 4DY5A 3N7JA 5LK5A 1LGCA 2PLV3 4PBPA 3UJQA 1W9SA 5GALA 3BTYA 1G9FA 3MBWA 1B35C 1LR5A 3A4UA 3H42B 3THDA 2VCMA 5IK4A 5GKAC 1PK6B 4XFIA 1AXKA 1DGWA 1WCDJ 1WW4A 4XIOA 3B9IA 4BA6A 4TZDA 1QQP3 1PMJX 2FDIA 1GWLA 4AW7A 4DNYA 1H4GA 3OEAA 4ZU4A 3S6PA 1XYOA 1Y9MA 3B94A 4XUOA 1ULFA 5CEHA 2DCJA 2JDYA 4OQ9A 1H30A 1RUH1 3JQXA 4C90A 5C8CC 1AX0A 1QJY1 1PGW1 3M3QA 3A23A 4HL0A 4LHLA 2D6OX 3PJYA 1ZRRA 3VUOA 3I3MA 1C1LA 4Q0PA 3ES1A 2CYFA 1NCQB 2A6XA 5I0UA 4OZOA 4EQVA 5F6LB 3OF1A 4J25A 4XF0A 1LOFA 4PF1A 1W9WA 4DMIA 1ND3C 1RHI2 4KG0A 1KDMA 4Y20A 5BNQA 1FPN3 2RS31 5CISA 2WZR1 4M0NA 4MGYE 2JG8C 2X5IB 2KR2A 3GF6A 2WKKA 4A3XA 2PLV2 5JZGA 3VDCA 1WKYA 1QJZA 4PQ9A 4Q4X3 1A3KA 3UESA 1DYOA 4AQTA 1RVF2 4FQ4A 4NRPA 2CWMA 3SKVA 1KXGA 5LEJA 3PIJA 1QQP2 5IVVA 3AKRA 1SFYA 5DZGA 1NX9A 2EA7A 3LOIA 3FHQA 2W95A 2ZHNA 4GH4A 2JJ6A 1FI2A 3TNQA 2B7YA 3H1MA 2QDRA 3ACGA 4WVWA 2SBAA 1MEC1 3PJQA 5DDJ3 4F7ZA 4ES8A 5JIUA 3H3LA 5FYYA 2V4AA 4GWMA 5HCAA 2QBXA 2VULA 3HPNA 3HAGA 2GC1A 4E4HA 4RR3C 4LITA 1TME3 2DCTA 4MV2A 5FMBA 4YARA 1DQ4A 5JXJA 1K12A 5FPZA 1OLRA 5FZHA 5SV8A 2JB8A 4UWDA 3SCFA 4P9XA 4QKFA 2HWC2 4FOYA 4DQAA 4HANA 1T2XA 4MOAA 1RUC3 4Q4Y1 4AVBA 1GU3A 1LGNA 1OA3A 1QJX1 1RMU1 1QXPA 3EXUA 4MHRA 3NW4A 4Q4X2 2ZX2A 2VUJA 2ADEA 3NKTA 1RUNA 2WLQA 5JWPA 2RDNA 1FNYA 3KV4A 3IIIA 3VDBA 4L92A 3WDVA 2X10A 2BERA 4NO4A 5ACA3 3ACHA 2GP5A 1V70A 4HN0A 1VJ2A 1MPXA 1NQDA 4KNCA 1RUH2 4IEUA 2RM22 4GKXA 5DZEA 1O91A 4COUA 5FZ0A 2R063 1QJY2 2WN2A 1C4RA 4LBLA 3KSCA 1AL22 1LHWA 2VNVA 5AFBA 4RHV3 1TME2 5EV7A 4C0BA 2EXHA 1XC6A 2O8OA 3BB6A 2VCCA 3FBMA 3H8UA 4QXHA 2RR11 3KF5A 3PUSA 4Y5SA 1NQJA 3MUY1 2GMPA 4FFHA 2Y64A 3HVDA 2RS32 1X9TA 1RUC2 3RS6A 3AYAA 3SMHA 1FV2A 5A6QA 3V64A 1R64A 5K4LA 1N3PA 2BGOA 1NCQC 2GALA 4UFKA 5T55A 2D6PA 3RWKX 1VRH1 4WM8B 4XDOA 3O7OA 1NKGA 2UWCA 4IEZA 2O1QA 2X8KA 1EPWA 5ACA2 5EP9A 2OA2A 4D8MA 4OULA 1Y9QA 4LHSA 1NY71 4XMAA 4N43B 4R9AA 3VDAA 1NCRB 2HBUA 2KXLA 2P6CA 2QUOA 2VZ3A 2ZJCA 2VMGA 1QEXA 2DWRA 1KFUL 2P3IA 1FATA 2YBKA 4F3JA 3E5QA 1PO13 5HPOA 1GMMA 4MGZE 3WG3A 2B9VA 4WM7B 5T5OA 3POSA 4RN5A 4W65A 1OPMA 4H55A 3ZYHA 1AR63 3EJKA 1HIXA 5LCWL 1XNCA 4OHXA 2CDPA 2YXSA 3USUA 5BNNA 1ZRIA 5KR7A 5JPMB 2ZBJA 2HWD2 1RMU2 2LALA 3FLRA 4MX3A 4LBQB 3PVEA 2IXLA 3KHBA 3WR0A 4ZZ5A 4YM1A 4GMP1 2WNUB 4JV4A 1F5FA 1MS0A 1T6BX 5FZ1A 4GA9A 4RFT0 3OD4A 3TYJA 3U4SA 2RMU1 3SISA 2A6VA 3N35A 1HX6A 4QPGA 5AC91 4A7KA 4MVTA 4E8CA 1LOFC 1W8FA 3K2OA 2WSUA 4PLOA 4MGKE 4XAAA 2EIDA 3FFQA 4FQZA 1BBT3 1RYYA 1XSQA 2RE9A 3MV01 3WY6A 3F2ZA 1RUI3 2GZWA 4JGYA 1POV3 5JZGC 1LEDA 3NMBA 3H3ZA 3NAPA 5JLVA 1PO12 1FOD3 4OMCA 1AR91 5CAZA 5FZ7A 3QLQA 1W6NB 1JUHA 4OUEA 2BQPA 1PVC1 4RL7A 1TMF3 2Y60A 3TEXA 1HRV1 2Y0IA 3K4ZA 1R081 1AR62 2BBAA 2VOKA 3TWIA 2RR12 1S0BA 4GH4C 5FAXA 4Q0SA 5F3CA 1S2EA 4BMEA 3GHMA 3OSDA 4EWAA 2A3WA 3KT4A 3DF0A 1SCRA 2A75A 3WW2A 5J98B 5FO8B 2HEWF 4QKNA 3VHOA 2VQAA 2BVBA 2NPIA 4V1PA 2B45X 1SFNA 4HSLA 4FBFA 2ZGMA 1CWPA 4HZFA 2NYYA 1H0BA 4XF3A 4B3NA 4BK4A 1W8OA 3DKQA 1CQ9A 4Y1ZA 5FOBB 1G9DA 3A22A 2G9ZA 1RUI2 2JB4A 5CFCA 4ONUA 1QJU1 1GP6A 2GH2A 5FZ4A 5F6KA 4GKYA 1TMF2 1O7FA 4P9JA 4ASKA 3UJOA 1NLRA 4LBOA 5T50A 3CL1A 4LLFA 5FZLA 4CDXC 2J1SA 3UV9A 4N43C 4HK8A 3S0MA 1QMJA 2A6YA 4I0AA 5D2AA 4RD7A 2Z79A 3AX4A 4QGLA 4IDZA 1GSLA 1V6NA 2VUCA 2XKOA 2Y33A 4LE4A 2Q8CA 4OI1A 3CF6E 3O14A 4UFJA 2VUDA 4OHWA 1SBFA 3JZVA 4WM7C 3AFKA 3AZWA 4AEDB 1V00A 3M3EA 3CJXA 3DECA 3PVNA 3VZMA 4DEQA 1ZRCA 5G05L 5FZBA 1CIYA 2WUHA 3E97A 5AVPA 4E27A 1ASJ1 1JZ4A 4YW7A 1R1A1 3OGVA 3N9PA 4CVUA 4Q0UA 1WA6X 5DQ0A 1VMFA 2DYCA 2WNVB 3U07A 2A6WA 3EHKA 2HLEA 3CMGA 4IEVA 1B09A 2Q8OA 3ZDVA 2B39A 1Y43B 2GNTA 3ZYFA 5EXOA 2XDVA 2DURA 1N1SA 2Y6JA 4IEPA 2GH8A 2GC0A 5HXVA 1PNFA 2XVGA 2YBPA 4G4FA 1G8WA 1WCKA 5JUVA 3UNPA 5CVRA 2CGOA 1W9FA 2I74A 3WVJA 3VKNA 2PMWB 1LKNA 4MO3M 5E8AA 3IDAA 1CAWB 2IXKA 5FBZA 3WEZA 2D5HA 3M3IA 4I30A 4XIKA 2R1BA 1W8WA 2FCVA 3IZOA 5IVCA 1K5MA 5D8AB 3LOBA 4HSJA 1H9WA 4WZCA 4XE9A 2W46A 1UPIA 4COYA 1GOHA 2DBIA 2K2SA 4OZXA 4A45A 2QQOA 3QBQA 1V6IA 4BIFA 4HT1T 3PL0A 1O8PA 1LU1A 4HPKA 5J37A 1OHFA 2IXIA 2WWSA 3WNXA 1QY4A 3H50A 3SLIA 5BNNC 1GBGA 3E6CC 2PHLA 3POEA 1KS4A 4Q1PA 1VPHA 3ZSKA 3AFGA 1ZZ7A 1DGLA 3UETA 1SPPB 3JU9A 1V0AA 3LAGA 3QCWA 1CESA 4GJZA 2BFUL 1W0NA 5C4WB 1JYTA 4UFMA 3W9AA 5LBFA 2ZZQA 2JDHA 2OT7A 5FLIA 2Z42A 3M70A 2C1FA 2QKDA 3OGGA 3OPTA 5FZIA 5J96B 1RB8G 5C9AC 1AYN1 5J48A 4FPYA 2W9XA 2ORXA 2D3PA 4N90A 4NHXA 2WJSA 2BJSA 4AVSA 2YV8A 3H8OA 2RHPA 3WXPA 3TEWA 1CVNA 2JICA 2RDSA 3VV1A 1AYM3 3ZKUA 1URXA 2W1WA 3NAPC 3I49A 3J8F1 2D3RA 3WNNA 4PBOA 3OEBA 1D7PM 3ZFGC 2WYFA 3J7MA 5FUNA 2Q8DA 3WHTA 4IE4A 4AXOA 2GNMA 3RJRA 1NA1B 1YYNA 1ASJ2 5C5UA 2RVAA 4NAOA 1R1A2 3NV3A 5C5TA 2J1VA 5FBJA 1X33A 3K4DA 1HKDA 1PO21 4BHPA 1VBA1 1NXMA 1WUVA 3JD73 2ZTNA 2FMYA 1O4TA 4EWEA 1VLNA 3KVBA 1AF9A 3IKWA 4FFGA 1EPZA 3WF1A 3NV1A 4AEDC 3CU7A 1GICA 2JDNA 2ZEXA 4KG8A 2ZKLA 1Q5OA 3OBRA 5FO9B 4M3CB 4HKOA 2Y6FA 2E9QA 3ZLIA 4XXPA 3HNYM 3OUIA 4XDQA 2D6LX 3BOWA 3PUHA 5F2SA 1AX1A 3OGRA 1XBFA 5FZAA 5K7PA 3RZLA 5A3UA 4PF5A 1ENQA 4Y4YA 5FY5A 4DXTA 1YRZA 5DAXA 4HXCA 3CQOA 3VD5A 1DQ1A 1ZNPA 3VBSB 5F9TA 1AYM2 5I0SA 3AZXA 5JIAA 4XUPA 5CFCC 1GOGA 3M3CA 3VLBB 3PDQA 3V56A 3Q8EA 3BI3A 3LIHA 4M01A 1M4WA 1X7NA 1COV3 5TSWA 2Q8EA 3AVSA 4P14A 1CAXB 4COWA 3KGLA 1RTVA 1ENRA 2VVFA 2AUYA 4BLJA 4EZ4A 2H6CA 4CEWB 1LECA 1NLQA 1JZ5A 1W6OB 5BPXA 4Z8BA 4DIQA 2WS91 5E89A 1H6XA 3M8LA 4Q4V2 4U2AA 3UT0A 5FKCA 2BPA2 5HBAA 3T4HB 4YZ3A 1RUF1 2WQ4A 3T09A 3GZAA 3BKZA 1OMIA 1GNZA 1UOJA 4XQ4A 1DLCA 1OKOA 1D2QA 2XJQA 3IPVB 3WDUA 4IQPA 4P5YA 3WT3A 4A2UA 2BWCA 3ORJA 5A33B 2GSYA 4XAEA 4Y4RA 5J36A 3Q8CA 2PFWA 1YC61 1QWRA 2QQKA 1O5UA 2MEV3 3RZJA 4IE7A 2XJVA 3O1SA 4XYXA 3LA3A 2HBTA 3VZJA 4B8EA 1QNWA 1ULDA 3J8F2 3RWNA 1CAUB 2C24A 4K21A 1HRI1 2JDMA 2XLGA 3BALA 3FUOA 3MUZ1 4YGDA 3RG0A 3POBA 1UMZA 4YYOA 4TWTA 2WNOA 1KJRA 4NROA 5J1XA 4CZSA 3I4IA 1VBD1 2ZEYA 4YVWA 3UYJA 4ISRA 2W39A 3LFMA 2YYOA 3VBOB 3WDYA 3DPRB 3FJSA 4BQWA 2B42B 1G9BA 2VM9A 4LNVA 4ORFA 3AKPA 1TG7A 1PO22 1IHMA 2IVJA 1DP0A 1STMA 1VBA2 3ZFFB 2XWJB 5G04L 2YC4A 5JPNB 1VALA 1YI7A 5A7WA 3GNEA 4A44A 3H8RA 3SHRA 4ZY9A 4KGQA 5APAA 5FYVA 1WLWA 1BJQA 1C8M3 1NE4A 1GZCA 1XYNA 2E63A 4KI5M 5F1RA 1VBE3 1FXZA 4Q2FA 4Y33A 2R043 4TYSA 1D0GA 3D82A 4NHYA 1DIWA 4NR1A 1GNYA 3C7EA 2JG9C 4FTBA 2YGMA 3E6BA 2XOMA 1W6PB 4BQ5A 2JENA 3I3BA 3KV5A 1W2UA 3AVRA 3GM8A 4C1WA 4LBKA 1APNA 4GB32 2RG4A 1RL3A 1JU3A 1PGSA 3I3EA 4R9DA 2Z4FA 1WA4A 4BMBA 3E5XA 3THTA 3RZMA 3IMMA 3NO8A 1SMVA 2R073 2XWBB 1E5IA 2ZHMA 2AEZA 4FFFA 2SLIA 4XXAA 4YG6A 2VZQA 5BYNA 4XHBA 1JHJA 1IG3A 5FV3A 1NT0A 2EXIA 1OOPB 1GV9A 5HV0A 1E5SA 1YQ5A 3KS7A 4PQQA 5FREA 4XQDA 1GZWA 3JB4C 3MFCA 3NNMA 3WF2A 4CP9A 1C8M2 1ND2C 2VVEA 1RUF2 1BMV2 2XBO1 4RFRB 2VPVA 1VBE2 4CDQB 2A5ZA 5L7OB 2HWF1 3RJ2X 1OUSA 3VBFA 3CO2A 1QF3A 1W05A 3THPA 1YHFA 1Z78A 3T2PA 1XNKA 2WABA 4LR4A 4RGAA 1G9AA 4WVZA 3WP5A 1TQ5A 1UN1A 4Q4W3 5FJHA 2K46A 3QH7A 4HVQA 3IMNA 1UY4A 3GBWA 3HT2A 4XEZA 1HRI2 4HK9A 3BTXA 1FMD3 2G9FA 4XF9A 2W5FA 4EE2A 3DV8A 3OB8A 4I2OA 3MW3A 3AZVA 4XUNA 1CPNA 2DFBA 2GN3A 4J1XA 4X8NA 4YGEA 1IS6A 5EYYA 1H1MA 1GYKA 1HQLA 3VHNA 1MQTB 1BCXA 1IPSA 4OFGA 2D44A 1H2LA 2VQ0A 4JC1A 3N4MA 2FDKA 3DYMA 2J7MA 1DQ0A 4LBNA 2WT0A 4V2WA 3ZN6B 5C70A 5FOJB 2W91A 4XUQA 4XVHA 1OQEA 5FPBA 1UY2A 4P00B 4QB6A 3ZXGA 1Q8OA 4OI2A 4QB1A 3RYRA 1EAH1 5A3LA 2ZGSA 3HN1A 5FK8A 2NM1A 2FCUA 1B35B 2YB7A 5C8WA 3LF7A 1WD3A 1S2BA 5AVAA 4BXSV 1MVEA 5EJZB 3KB5A 4QDRA 1AXZA 1JZ2A 4XJZA 1AR73 3BPSA 2PHUA 4DFSA 5FCCA 1KJLA 2O0OA 4Q4W2 4RQPB 3V0AA 5BNPC 3OD0A 1VBC3 3I2OA 1IZ3A 3DGTA 1KDKA 1FMD2 3ZXFA 2FZ2A 1AUYA 2NP0A 2EF6A 3ILNA 1W6QA 3IWZA 4QKBA 4COZA 5C8CB 4FXKB 3MIGA 1KFXL 3KCXA 3TAYA 1ZBA3 1VE0A 5FUPA 5FPXA 3POWA 2VTXJ 5I93A 5A32B 4E9KA 4ZKTB 3WNMA 2DVDA 1ZX5A 2E26A 1X50A 2JD4A 5LA1A 1TZOA 3UK9A 1ND3B 3R4SA 1GQPA 2ZAHA 3JBG3 5JAXA 2JG8B 5GM0A 1JH5A 4WV8A 1KEXA 4IE6A 3WP6A 5IUQA 3H1YA 1IQAA 1BEV1 2E6VA 3UKTA 3V0BB 1KQRA 1C5HA 4LJHA 1VMJA 1O4ZA 4IEOA 2J1EA 2HWF2 1V6MA 4YVWC 4FPCA 4D94A 4NIIA 1RUE3 4URAA 3TN93 2TUNA 3PTYA 1RHI1 1OSGA 1ALYA 4YZ4A 5EWSA 4AQSA 1W8TA 3J7HA 4C8DA 3BIEA 5DXDA 1UZZA 5IK5A 4WBBA 3DYPA 2VZPA 1VAMA 2PLV1 4QX5A 1AX2A 2P4EA 4LUMA 1MS8A 2RS53 4LTAA 4OQ8A 3EBRA 3JB8A 4FPFA 3VB9A 1VR3A 1G9CA 1F2NA 3POGA 5F5QA 2EXJA 1W8ZA 4YVSB 4DB5A 1QQP1 3M2MA 1POQA 1ZBA2 3GZTB 4QPIB 4QQ2A 4RR3B 1ZRDA 3O1UA 1WZXA 4LHNA 3KHCA 5LY1A 3T3YA 2PTMA 4QQPA 3CIHA 3JCIA 4JGZA 2VMEA 1LOBA 2Y6LA 4D69A 3JBG2 1VAKA 3WNOA 5FY1A 5EYXA 2EXKA 4CXYA 4Y5Z0 1XSRA 5FYSA 5J09A 2ILMA 3DXUA 4D7TA 1YEWA 1N47A 1HV0A 5A7SA 1EUTA 5DABA 3OBAA 1JYVA 3E6DA 3HJRA 1MQTC 1REDA 1SBEA 3U1XA 4CDUA 3DEMA 5FZOB 2NQYA 3W5NA 5IK7A 2HWC1 1FPN1 2QDNA 4BH9A 5JMCA 3RYKA 1HDKA 3N9MA 5EHDA 4AI8A 1F4AA 4Q4X1 1ZYBA 5FYTA 2XPJA 2WSVA 4IV3C 2F17A 1BZWA 3AP9A 3WF4A 2ZX4A 2Q1ZB 4BK5A 5DAVA 2AREA 5C71A 3VBFC 2QTWB 3KV9A 3D8CA 5CB7A 4M3CF 2AR6A 4P9GA 4RQPC 4IERA 4FVVA 5H9QA 1O59A 2DTWA 2ZGUA 3BYWA 3VKMA 1F15A 2RM21 1RUJ2 2DVAA 5DDJ1 5ANNA 4CCLA 3I54A 3ILFA 3NNLA 2CNAA 1BEV2 2G1MA 3B9CA 1AL21 1UYZA 4CCKA 3AK0A 4KBBA 1TME1 2YC0A 3MHZA 1JW6A 4LOSA 2O14A 2VOXA 4G3YC 1PIV3 4JDMA 5HXMA 4GJYA 1H8TC 4TLFA 4PIZA 4CCOA 4QDQA 4M00A 3BODA 4XTMA 1V6LA 1RUC1 4S2DA 3LZZA 3N9OA 2WZPP 1YIFA 1I6XA 5BNOA 5CG8A 1HJFA 1X8EA 2EAKA 2ZA9A 1OLMA 4AVTA 1E5RA 4FPGA 4XF4A 3WW4A 2NMNA 2VVDA 3O0WA 4D6QA 2E51A 1BQPA 1ACCA 4AQ2A 3O1OA 2JDPA 2J1TA 2VZRA 3LQCA 1Z7S3 1W2AX 3ZKYA 4XZUG 5ACA1 4AWDA 4LEJA 3FHAA 1GZTA 3NNJA 4BM8A 1G6NA 3UKVA 4KGGA 4XACA 5FYHA 4J6GA 4MZUA 5LASA 3AYCA 4WVVA 1QOOA 1MS9A 4GULA 3HR9A 4YVSC 5LBBA 1AVBA 2Z69A 2NZ9A 4QPIC 1MZFA 4U36A 3ALQA 1O4YA 5FY7A 5GLTA 1ULCA 3OGSA 5T3NA 4FT8A 2A1XA 4RGKA 3T1MA 4I3GA 5KHIA 4XQWA 4H7MA 1SLIA 1FPN2 3ZR5A 4QGMA 2EAAA 4Y20B 4FPOB 4HVRA 4F83A 3GYDA 2HWD1 4GQ7A 1AR83 2OS2A 4PJYA 5CKNA 4GALA 2BWAA 5FIXA 3VL9A 4TTGA 3DN7A 1W39A 5JZGB 4XDPA 1OI6A 1AXYA 4XILA 3BVCA 1XPWA 1LHNA 1U0AA 3AP5A 3M1HA 4XBLA 1HLCA 3PHMA 4Q5OA 2UURA 4UF0A 1V6JA 3WUDA 1CZVA 1WCUA 2YPDA 3LDBA 3OUJA 2C0ZA 3OOXA 3NV4A 4GH4B 5FZ9A 4AFCA 4E2QA 2K0GA 1O3SA 3WF3A 5KHGA 1IPJA 5FZEA 1UKRA 4UXAA 3O1MA 2YU1A 5DDJ2 1UZ0A 2E32A 2WWUA 3LPFA 2B8MA 3N36A 1PO11 2WFF3 2ZGOA 2FDHA 2DF7A 2IXHA 5ISLA 3ZFEC 4WM8A 5T5PA 3IN9A 3LWCA 4AFAA 4CCJA 1AR61 4FPKA 5A1AA 1ST8A 3WQ1A 4GWJA 1Y9GA 3MF6A 1BK0A 2XHKA 5L19A 4JGZC 3ECQA 1NCRA 3EO6A 3S30A 1AR82 2FDFA 1MZEA 3BIWE 3VBRA 1NE6A 1ZA7A 3ZYPA 4D7SA 4AAXA 2WFPA 3ABZA 5FYMA 3VDDA 4LO4B 5IAVA 3O0XA 2YY1A 3VKOA 4A3ZA 4DRRA 5KXBA 1J3PA 1JS9A 3H9AA 5IJRA 2H0VA 2CAVA 2JX9A 2LRPA 4CDUC 4DOUA 1XNDA 2ZMKA 2ES3A 2UY8A 2RS13 4AGVA 5C3OA 1A8MA 4H3WA 4LPLA 4PLNA 4YPJA 4ASLA 4KWJA 2WRAA 3UGHA 4CDXB 1N3OA 4N7UA 1PHMA 2Q1FA 1NYWA 1RUI1 4Q26A 2WBKA 1POV1 1QNYA 1C8NA 5SV5A 1MS4A 4QDSA 1FOD1 2R062 4O9GA 5EJ1B 1JI6A 2WFF2 2WO1A 4Q4Y3 2VOWA 5FK7A 1QJX3 4YW3A 4E2GA 1DGRA 3KF3A 4HG6B 1YFUA 1TMF1 2RDQA 4LK7A 2D6MA 4RHV2 3ZXEA 4OI0A 5FQ0A 3AXEA 4I0WB 4BDVB 2YMZA 4BOWA 5BUVA 2HWB3 4XBNA 3RFRA 4AL9A 3WP3A 1Q43A 4EN0A 5FRAA 4GMP0 3GCXA 1UNBA 1J83A 1WCSA 1XE0A 4EYUA 4DXSA 3I2FA 5FLHA 3RYPA 1SZBA 4JKKA 3S5AA 1BLZA 2PHTA 1W6NA 3ASIA 1UPSA 2VECA 1WMEA 1D2SA 2P3YA 2V73A 2WL1A 1DFQA 2P6HA 2YG0A 5FMOS 1M06G 2RS12 3KD4A 4YG0A 2UY9A 3T0AA 2LROA 1UXXX 5LRSA 4XTPA 3VHPA 4N53A 2PAMA 5FXZA 1XYPA 2LW8A 1UCXA 2O8QA 2R32A 5BNOC 1JZ6A 1W6MA 1RITA 1UX7A 1JYWA 1VRBA 1ZBE3 1OKQA 1J3RA 3SNMA 4UYBA 4JAAA 5ERLA 1QKQA 2CDOA 5LY2A 1OH3A 4XHXA 4AHXA 4CP1A 1YJLA 3GBGA 4W50A 1VRH3 2WR9A 4BQ3A 2HWB2 3T0BA 1O3QA 4A7YA 3T2TA 3NJZA 2KD7A 2E7AA 3USUB 4LORA 3KCCA 1G86A 5BNNB 1X36A 4MGIE 1W04A 3AMMA 3ZSLA 4NUBA 1LB2A 2ORZA 1CD3G 1D0HA 3LB9A 3R05A 5FR3A 4D3WA 1R093 1K45A 3LDRA 4QQHA 2ZGLA 2Y26A 4HFSA 3AC0A 4ATEA 1SEFA 5LA9A 3PURA 2ARCA 2FZ1A 3EYPA 3U10A 5C9AB 3HOBA 3GJAA 4RGGA 4XOGA 1BBT2 1DQ5A 2QE3A 4IEQA 2PN5A 5A7QA 4BIOA 3P5BA 4ASMB 2YHJA 1J58A 4E8DA 1ZBE2 1KS5A 4HMZA 1FOD2 3MICA 4YZ2A 5GZGA 4FOQA 3NAPB 2G19A 3APBA 3LA7A 2CU5A 3ZXDA 4DUXA 1Q8PA 3ZFGB 2NLRA 2OKXA 2VZ1A 3ACFA 3H8XA 3IBMA 5A80A 2RMU3 2XQRA 4XJWA 4DUWA 1CAVB 1JBCA 3J7LA 3MDPA 5IAXA 5LEKA 3ZX7A 3NVCA 1D4M3 1Q56A 5C3QA 1LODA 3AM2A 4NVPA 2R7EB 1S0JA 3VZKA 3T0DA 3LD8A 5DN2A 2ZGKA 1MS1A 1W8NA 5CFDA 2ARAA 3RZZA 5J7MA 5A1FA 3L2HA 3PIGA 1HB4A 3SQOA 1LOAA 4OLLA 4LIUA 1YJKA 1OVPA 5JOWA 1LULA 3ELNA 1C1FA 1HRV3 3RDIA 3VN4A 2BTVC 4AYUA 4YRDA 4Y22A 4A6OA 5FYUA 3LKJA 4HKWA 3WOGA 4LT5A 2XXZA 4F8AA 2GC2A 5JOXA 4UFIA 2CGPA 2ZGRA 2XMLA 4IV1A 4CP0A 5CFCB 1RUD3 3PU3A 3VDDC 3I8TA 1UYPA 1LRHA 5D8AA 5HV4A 2R0FA 2XKPA 5HCBA 5C33A 2VOTA 1S0DA 2Z5WA 1WW5A 1JOJA 3C7HA 1I9RA 2DU1A 2EIGA 2YBSA 5FXVA 4GXLA 3I2DA 3CJIA 3BTAA 5L36A 2DV9A 4QU1A 3MGUA 3UKNA 1AYM1 3SEEA 1D4M2 2PHWA 3I2JA 4QXBA 5CADA 4ZS3A 2BUKA 4XW3A 1K5JA 4L2NA 2D40A 4ISQA 2DVBA 2ZHKA 3GZEA 4DEVA 2V4VA 1QU0A 3KT1A 5IW0A 4YGBA 1BK1A 1CONA 1UU6A 5T5LA 1W90A 1U5YA 3IT8A 4AAPA 1WMXA 1DQ6A 1XJAA 2EIEA 5B4XA 1I5PA 2WT2A 3WCRA 4E4SA 3WNPA 3JD71 4I02A 1OT5A 2VR4A 4Y3OA 4LULA 4LOTA 1TEIA 1ODNA 1YFYA 3B69A 3CNAA 4Q4V1 2AC1A 1DZRA 2QQIA 5A3NA 3FWEA 1E5HA 1VB2A 1OFNA 2ZX1A 3FX3A 3H1WA 3NV2A 3O5SA 3R4UA 4R4ZA 4UI9L 3ZVXA 2UYBA 4A6SA 4AI0A 3BUCA 3P3NA 2D6NA 4ITCA 4CPBA 4NIHA 5FZ6A 3G7DA 1SG3A 4QPGC 5JR7B 1IOAA 1V6OA 5L73A 1NA1A 5CIRA 3ZPYA 3FBYA 4W6XA 4ES9A 1ULGA 4OVEA 2ZMLA 1DGRN 3INAA 4XJ8A 4COVA 1NZIA 4AGRA 5FPVA 1V9U3 4JGYC 2NN8A 4L11A 4LA3A 3VHRA 4BQ2A 4E4DX 1A8DA 4CEYA 2VOVA 1UWWA 3B7MA 3K48A 3KQ4B 2VQUA 2CAUA 3A0KA 1CJDA 3HT1A 3MO4A 1N1YA 3ACIA 3WZ1A 1HV1A 2EALA 3ILRA 2VC9A 3VBHA 4ZU7A 1COV1 5FZGA 3W58A 1LU2A 1AJKA 1LHUA 5DUVA 3SH4A 3MF9A 4QWNA 5FP8A 5DUUA 1VB4A 4CUAA 2ZMNA 4QKDA 3AYDA 4BYYA 1RUG3 4UBHA 1DQ2A 3PMEA 1F5JA 4AVCA 4P9IA 4HPKB 2ZCWA 1TNFA 3POJA 1UU4A 2JDKA 2JG9B 3AP4A 4H7LA 5JSRA 2WAAA 1ZZBA 2R6QA 3MIHA 4LO5B 1GWMA 3K3NA 3HWJA 3WNKA 4MGQA 4B29A 5JSOA 2W08A 1JOPA 3ZXLA 4XABA 4N9IA 3GALA 1A34A 4AE2A 2EIBA 4QD2A 5IVEA 3D5OA 2N7GA 2ZEWA 3KV6A 1PZ8A 4O7XA 1ENXA 4UW4A 1V9U2 4CEWA 2E53A 4AVAA 3H0OA 1W6OA 3ZN5A 4BZ4A 2EICA 1MZ6A 3KMHA 1JHNA 3RVHA 3CZUA 4QX7A 4GB31 3Q8BA 2I07B 2VMDA 4GD4A 1QXRA 4NJ4A 1ND2B 2HWE3 3VBUA 1I1EA 3O1RA 3BU0A 2JXAA 3POFA 4FPHA 3N9QA 2JWPA 1RUG2 3DL3A 4YM2A 5DMYA 1AYN3 2Y6GA 4IUGA 4B1MA 3FC0A 3JD72 4XFBA 2BNOA 3JUUA 4UW6A 4AR2A 5A3PA 1SACA 5KHJA 5GZCA 2ZABA 3AZZA 4CU8A 1GR3A 3TEZA 1SLBA 5GZFA 2QFEA 5CFDC 1C8M1 2VY0A 4UW3A 5L7OC 4LKFA 3X29B 1BMV1 3HBZA 4ATFA 1FX5A 1VBE1 2AGSA 4CUCA 4HBNA 3LGRA 2C4XA 4Q1RA 4EJRA 4QU2A 3MZHA 3URFA 1C5IA 5EQUA 3OY8A 4MXWB 5GLZA 5LB6A 3ST7A 5K9YA 4EROA 4Q8LA 2BYVE 1I3HA 4UOJA 5FP4A 4R8HA 1H1AA 2V09A 4ZXKA 1VAVA 2V72A 4QX8A 5E88A 4S2GA 5CZKA 4JTOA 4A4AA 1ZA4A 2HWE2 1COV2 2PQQA 1OA4A 5F3GA 5EJ3A 3VGIA 1YQCA 1PGL2 1LOGA 2R071 3CKHA 3K46A 2QNKA 3CJIC 4D7YA 2UYAA 2EVXA 5JXIA 1ZREA 4SLIA 4FAHA 3D6EA 4RS5A 4UFHA 3OBZA 4YW1A 4CXWA 2XL9A 4K9SA 5BNPB 4D6RA 1K5MC 1L7LA 4KL1A 2D43A 4LO7A 3O0VA 1IS5A 2BBVA 2YPJA 2FQPA 2VNRA 4R9CA 4ZZ8A 4LBQD 4L0PA 3ZR6A 4EN7B 1JUIA 2IFRA 3H7YA 4BE3A 4PDWA 1OPOA 2WT1A 4DXZA 2YDEA 3KZ4C 3FUQA 3DKWA 2MEV2 2XL7A 3J7NA 3LDKA 5BXXA 3U14A 1C28A 2BDRA 4Q4W1 1JZ8A 4C91A 2AENA 2W47A 2C5DA 3IAPA 4ZONA 2VMIA 2QQLA 1AJOA 4ZXEA 5IFTA 3WINE 3PTRB 4OCTA 2BEOA 2KA3A 2V5DA 1FMD1 3N3HA 4QX2A 1OQDA 5EFUA 1W3VA 4CCEA 5KHHA 4ZS2A 1RJ7A 1LTEA 2FDGA 3IM0A 3LSEA 1OLME 4OYUA 5K0UA 4QXCA 4YVWB 3J9SA 1W8HA 3VKFC 4BB3A 1NG0A 4CEYC 5CYYA 3OYWA 4XBQA 1ULEA 2QQVA 4Z07A 5FJKA 3ROUA 4JQRA 1WGPA 3WNLA 4X8PA 3VBHC 5JXHA 1CJPA 1YXWA 3WX5A 4B7EA 2YFUA 3PNAA 5DAQA 5F8PA 5GZEA 2AEYA 2X53S 2VH9A 1QH7A 1V6KA 2R042 4CXXA 4FXGB 4N8MA 3TBDA 1AR71 4WVMB 4A7ZA 1ULPA 2GNDA 2DUQA 1WD4A 4YW6A 2WDBA 1VBC1 1AL0G 3FZ3A 2ET1A 4B4PA 3HMYA 2JIJA 5FMOL 3AKTA 4X6QB 1DGWX 5IVYA 2BGPA 4Q29A 5L9BA 5T52A 4AEKA 1BXHA 1B35A 5ABJA 1TVGA 3HQXA 1ZBA1 2R072 1ONAA 1YIPA 2XUEA 2XVKA 1HXS3 1W99A 2P17A 1CZTA 4AVVA 2D93A 4I09A 1OURA 4LMFA 1RXGA 2R1DA 3JBG1 3W21A 2WQZC 5IK8A 4FO9A 2PHFA 3WV6A 2VTXA 5FFOC 4YNIA 1C3HA 4DRVA 1UYYA 1W2TA 4CP9B 1LOEA 2B9UA 1SDWA 4IV3B 1OQ1A 3VBUC 5C8CA 4AHWA 5FY4A 2FHRA 2VMFA 1RUE1 1VP6A 3TN91 3I3QA 4MG2A 3A7QA 3VBFB 5FUIA 4QPWA 5A32A 5IWFA 5JOZA 1PZ9A 1UQXA 4LKDA 4OHVA 1EV13 4CU9A 4OHYA 4EV0A 2C9KA 1XOYA 1YUDA 3ENRA 3ZXAC 1SLLA 2RS51 2JG8A 4XFGA 1YI9A 5DPNA 2Y34A 3RZHA 1H6YA 2JDUA 1RIRA 3LE0A 4NMIA 4DUVA 3U37A 2OUHA 3VZNA 3B3QE 5E1RA 2VMCA 3MV11 4I0BA 4P9LA 4ARXA 2OZJA 4M0HA 4QX3A 5C3RA 1AHSA 1GQGA 5FWEA 3SC7X 3SITA 1H8TB 4GAZA 4IXLA 2D5FA 3I59A 5FY0A 1RUJ1 4W6WA 4KWKA 1HB1A 1WCQA 3FMGA 1W0PA 3LFIA 3ZIWA 4AF9A 1GZ9A 1YQ8A 4O65A 4KH9A 5I8YA 1XE8A 5JDBA 4JDNA 4CDWA 2VL4A 3ZMNA 3AKQA 4IGPA 1PNGA 5KC5A 3HEIA 2GC3A 4HVOA 3RI9A 3WDXA 1HN0A 4RSUA 3GDBA 3NQHA 1RXFA 1AR72 4JTNA 1SDDB 1VBB3 4WZFA 1EV12 2D3SA 3D0SA 4RS5C 2VZOA 1WWYA 1VBC2 4LBMA 4QHBA 4LBJA 3MYXA 3BGAA 4P9WA 5JMOA 4CSWA 1IS4A 3V0AB 4NRMA 3AKSA 4OMDA 3MEPA 1N1VA 5KHKA 5LZ6A 2OUJA 1PVXA 2FDJA 4AHYA 4XURA 5FXWA 1OFSA 3VKLA 1W6QB 4NPRA 1EAH3 4PDWC 3BN6A 4JX0A 4V2VA 2WZ8A 1DG6A 2CL2A 3M3OA 1GANA 4IGOA 5FZOA 1DHKB 3RSJA 3TB0A 3NNFA 1F9KA 3N7KA 1GWKA 2ZX0A 3ZXKA 4QPYA 3Q8FA 4DY3A 4P9YA 3BTZA 3RPQA 1NAEA 3UL2A 4CYDA 1Z0HA 4HLTA 5A3OA 3AXDA 4BXFA 1LHVA 4AG4A 4M4RA 2H0BA 4AEJA 2WAOA 3ZO0B 3ZMOA 1JZ7A 3C8XA 2BU9A 4AHZA 1DF0A 4QX1A 5FTTC 1DYKA 1PK6A 1ZZCA 3U11A 3MI8A 4Z2AA 4IEYA 3PUIA 5F2WA 1RUE2 5K0UC 3TN92 4URTA 2HYXA 2W1QA 1MVQA 4PHZA 4YFZA 3OPWA 3ZSEA 4CPBD 5A3MA 3A21A 4LO8A 1IG0A 1MR5A 4YG3A 1HQWA 4FFIA 5FYCA 2AACA 2DU0A 1YWKA 2RS52 1OD3A 3P1IA 1SCSA 1VMHA 2W1SA 3G6JB 1GP5A 1UMHA 2J1RA 2QCSB 5IVJA 5F5AA 4I01A 1PX3A 1NCQA 2Y6HA 1U12A 1Z7S1 3AL6A 4PIXA 3ZFEB 4AI9A 2PHXA 4PIYA 1UZYA 5HCHA 4K6BA 4LA2A 2BFUS 3I2KA 1GLHA 1JOBA 5AFEA 3RRDA 4QM9A 3LEGA 5FKBA 4BLIA 2K9ZA 1GNHA 2X5IA 1W06A 4JGZB 1Y3TA 1FV3A 4P02B 1ULOA 3QH6A 2V5YA 4AEMA 3D4KA 1F35A 4MHUA 2D7FA 2ETEA 1RVF3 4JRAA 4X6RB 4YW4A 5ABJC 1UU5A 2VG9A 1UY1A 2OPKA 2QZ3A 3OG2A 2Y38A 3DYOA 3D0JA 4CDUB 3ZN4A 4IEWA 1RUOA 1FNZA 4JHTA 4XJUA 5FMDA 1O3RA 4XCAA 5CKQA 4LQRA 5CU1A 1AR81 3EB7A 1QOTA 1OH4A 4CUGA 5FO7B 4NIDA 1DDLA 4CCDA 4Z2WA 2F4LA 2DFCA 2OPWA 5JSPA 2G9GA 2HKXA 4NAMA 5HCFA 1Q8VA 2PAKA 4JVAA 5F39A 3AP7A 4Y1XA 4ZHNA 1K42A 5FP9A 2OW4A 1JYNA 4S2FA 4BCUA 3ACLA 4XJ9A 2HYKA 2A71A 4L97A 2HWC3 5FP7A 1F4HA 2L9LA 3ME2A 2XJUA 4DO0A 1JN2P 3MIFA 5FYBA 2R061 4DXRA 2WFF1 4TLGA 4EN9B 4NPMA 1OBNA 1JYXA 4A42A 1QHDA 4RHV1 1CPMA 4SBVA 4E4ZA 1UL9A 4K1ZA 2XR4A 3T4VA 2W2IA 3SKJE 1OF3A 3NNGA 4Z1VA 1PIV2 1H2NA 2AYHA 2CSGA 4YZ5A 4MSVA 3GBFA 4FOWA 1WMFA 1XU1A 1J1LA 2DUPA 3B01A 2JIGA 3LEKA 4PT6A 3V65A 2JE7A 1JU4A 1W2NA 1QJFA 2MPFA 2VAUA 1S0GA 1P8JA 1W8UA 2WC2A 2YFZA 3BCWA 5EZWA 5A7PA 4PI2A 1X8MA 1KITA 5BNOB 5JCTA 1RUH3 4CDWC 2RM23 4ARYA 1J84A 1SLCA 2JKXA 2R30A 2VTFA 3D3AA 3POYA 4LK6A 2XJTA 4LO6B 4R9BA 4XFCA 4W4ZA 1QJY3 5J3UA 3O1TA 2F6BA 1Z7S2 2A6ZA 2ERFA 1AL23 2RS11 1PX4A 2FCTA 2GU9A 3FL7A 3PVBB 2OYZA 1YFXA 2LM3A 3OCPA 4K40A 4LUKA 4ZU5A 2RJKA 2ZHLA 3L2YA 2RS33 2R16A 2TEPA 3KCYA 5FZCA 2WZR3 3I2GA 4XMIA 2WA4A 2GP3A 2OQ7A 2MHFA 1OVSA 3ZYJB 3U0ZA 5CNAA 3FE5A 2E31A 2E7TA 2PXJA 2XJRA 3AMNA 3ITQA 3JXSA 4PCRA 5I8SA 5FWJA 1ZM1A 2HWB1 5IHRA 2WN3A 4AOCA 2DVFA 3NL1A 3LA2A 4UT5A 5F3IA 3B5LB 3RI8A 3S5QA 3T2OA 4L8QA 4N43A 4QGNA 4OHZA 4CDXA 4KWLA 1QJEA 4AFBA 1XE7A 2XHNA 2JECA 2A3YA 1TE1B 3RQ0A 1MEC3 5K8SA 3ON7A 3IB3A 2XUMA 4YZ1A 5KXDA 1PK6C 4JRLA 1PGW2 4WM7A 2VO5A 2W92A 1IS3A 1POV0 4QXKA 3QACA 3AMPA 5LA2A 4UW5A 1UIJA 4UF0B 4MGTA 1BBT1 3UGFA 5A6YA 1N3QA 1G7YA 2Q30A 2YGLA 4M3CE 1DCSA 2WQ8A 5LBCA 3TNPB 4BPZA 4HN1A 3P6BA 2WZR2 1ZBE1 3QOPA 4LBQA 4Q0QA 4E2SA 1GOFA 2DDUA 1RMU3 2HWD3 2QQUA 5CBLA 5F32A 2WNUA 4CTEA 3WSOA 2B5HA 4IL7A 3MFAA 5DUWA 4QT6A 2BV4A 4KMQA 2E7QA 1JYIA 3B93A 3NKGA 3AYEA 1YQ6A 4RYDA 5FYZA 3NJVA 3IDCB 3K75B 3THCA 4CCMA 2ZOEB 1I5ZA 5HI0A 2X5IC 1LAJA 2QZ2A 1K3IA 5EIYB 2ZGNA 2UWAA 1YO8A 5CA6A 1QXJA 3ZYRA 2H6BA 3VBRB 2ZXQA 1MEC2 4QX0A 4QHOA 1GQHA 2PQSA 3VDDB 1R091 2VJXA 1LENA 2XQXA 3I97A 1PM4A 3L9JT 4OUMA 2VCBA 3H3UA 1IPKA 2ZKNA 3SH5A 3WD5A 2JEMA 2Q1MA 3NSTA 2NMOA 2UWBA 4HOOA 3ZSMA 1WBFA 2ENRA 2RR13 2GN7A 2XVLA 1JODA 5H9SA 2VNGA 4XF1A 5F5IA 4BQYA 4IETA 4IESA 4Q4Y2 4JDOA 1ODMA 1QJX2 2B4KA 4JZRA 5KXEA 2WO7A 3R0RA 1H8VA 4YSFA 1DU3D 2YUEA 1BKZA 3IAQA 2W94A 4JKMA 5FQ0B 3S7EA 5C9AA 5FZ3A 4FPEA 1HN1A 5L9RA 5F5CA 2Y0OA 1D4M1 3FFZA 4OUSA 5FZ8A 5H9PA 2VZTA 5A7NA 5C3SA 2W1UA 3CEWA 2OQ6A 2WWJA 4K8FA 4MGSA 4LKEA 3I2IA 4A41A 4NHMA 4PLMA 2X05A 3WQBA 1LNSA 3O12A 2Z2SB 3AMHA 4CP2A 3ZFGA 1LEMA 3T08A 5A3WA 4DS0A 2WLPA 1UYXA 2WINB 3BPZA 1SBDA 3Q8AA 4QPGB 2JE8A 2P1BA 1CAVA 2IZWA 2VW2A 2VE1A 2BGCA 4IGQA 3MW4A 3ZDSA 5B4NA 2D98A 4N53B 5T5JA 4EN6B 2ZGQA 3KM5A 4JGYB 1OXCA 1RUD1 2BOJA 1UOBA 2A70A 1O8SA 1W6MB 3LCPA 4YM3A 3KVAA 1WW7A 3W59A 4AEDA 1ZZ9A 5C3PA 1FYUA 4I3PA 1R1ZA 3ZOIA 2WYSA 1RINA 4GMP3 2XONA 1VRH2 2DCZA 1F31A 2AH2A 1JZ3A 5FMCA 2ZAAA 3RNSA 2YU2A 3ZYBA 2VQTA 5AC93 1UZWA 2P37A 4GWIA 1Q3EA 1XU2A 4ET7A 2WNVA 1NY72 1UF2C 2GMMA 4CU7A 2I45A 5LATA 4Q0VA 2BZDA 1WMDA 1US2A 2OXBA 3HQRA 2VZUA 4Z82A 5KXCA 2DCYA 5GJ6A 4WM8C 3DXTA 1R092 4Z92B 1AR93 2BW8A 1PVC3 2WZEA 1QDCA 4K8RB 1H2MA 4N9HA 2QJVA 2ZS6B 3MIEA 1R083 4PI0A 1J3QA 2VUAA 4K3UA 3GCWA 3WG2A 3WF0A 1WBLA 5LK7B 1NCRC 4AFMA 3RZGA 2C26A 3OUHA 5I8TA 1CAWA 2DCKA 3GXUA 3HNMA 3HBKA 3C7OA 3VBRC 5IVFA 2A73B 3GGLA 4QMAA 1ZVFA 5FZMA 3SCGA 2PHRA 5GLVA 1EYBA 3M4FA 1GP4A 2ZEZA 1NZCA 2VBBA 4YWAA 5M0TA 1NLSA 4FI9A 2HJIA 2JDAA 1PMHX 3O1VA 4L99A 2UU8A 4XJAA 5A3TA 4BQXA 1SLAA 2RMU2 5AC92 1UY3A 3NWKA 1V9U1 2XLAA 1S55A 4N7IA 1GUIA 3VD9A 5F3EA 2QQNA 1SPPA 1UIKA 4LLOA 2CHHA 3I2HA 4CUBA 4MYEA 5IVBA 2WNUC 4MH0E 4KU8A 5C4WA 5CFDB 3LIGA 1H4HA 1QJU3 2P2KA 1AR92 2PYTA 3HD8B 3MPPG 4J1WA 4B4RA 4EZHA 1PVC2 5FZFA 4AFDA 3HIFA 1CN1A 1HRV2 1RUG1 2A3XA 4LXLA 5E16A 1R082 1FT9A 4CA9A 1UZVA 1W3XA 4IW3A 5FDBA 4FTSA 1RGSA 4Y22B 2P3KA 2RJLA 2J1AA 1IQDC 1RUD2 1SFPA 4FOVA 4GWNA 4YM0A 1JTZX 1X9PA 4IV1B 3VD7A 4TSVA 4NPLA 1JMUB 1TNRA 4Y1UA 3RGBA 1UXZA 1BVP1 1REFA 2XLFA 3MW2A 1S4CA 1Q8SA 2A7AA 2B46X 2VXJA 4KU7A 2Q5TA 4QM8A 1ASJ3 3DCQA 4N53C 1YLLA 3HNBM 3CJIB 1R1A3 3IDBB 3ES4A 3FHIB 3E5UA 4META 4MLOA 3T30A 3FN9A 1O3TA 1SQ4A 2IVIB 3U78A 2JG9A 4EN8B 2VGDA 3AMQA 3VL8A 3SEPA 5FZDA 1K5MB 4FAGA 3PU8A 1QJU2 2CV6A 2HWE1 2RV9A 4M3CA 4HETA 4Q27A 4NRQA 4XZPA 5FPAA 1F8VA 3K4AA 2TBVA 4BJ0A 2IWGB 2ID4A 1PGL1 3AJZA 2VBDA 2W3JA 3J4UH 4YW5A 1W9TA 4Y26A 5DAPA 1RC6A 1REEA 4QQOA 3VBSA 2FMDA 2ZGPA 4AK3A 2OVUA 2J22A 3R4DB 1WLCA 1CGPA 2VD7A 1KD7A 5LA0A 5DG2A 3PUAA 5DUXA 4YFWA 2HEVF 2R49A 4Y24A 4O61A 4AQ6A 4B1LA 5FPUA 3VD4A 2DTYA 5LRRA 3SH3A 4R52A 1W9YA 1ND2A 1LOCA 1YFWA 3OGJA 4QQLA 2VZVA 1DZTA 4K1YA 2CWSA 1CAXA 3AL5A 1LESA 1UX6A 1H2KA 2OIIA 2PELA 2LTNA 2MEV1 5I0TA 3SXWA 4B4QA 4DPNA 1S1AA 1DBNA 3LPGA 2QQMA 2RDRA 1W2OA 3LEMA 4IE0A 2GDFA 4H14A 1OA2A 1UW8A 2JE9A 3OTFA 2P5BA 1LHOA 4CEYB 4D6SA 5B2GB 1W28A 1RJ8A 3UGGA 3EQEA 2D97A 3B00A 4Q4V3 3WHUA 1CR7A 1OF4A 2VBPA 2I2SA 5I91A 4EWDA 5KC6A 2YZ4A 3IPVA 4ZPIA 1UAIA 3VBHB 3B02A 1XB9A 2XG3A 2QQWA 5A33A 1VIWB 3VZOA 2PA7A 5A70A 3H7JA 2X09A 2ADDA 4MXWA 4DINB 1CZSA 2WNVC 2IFWA 4P5HA 3GJBA 2IC1A 4XFAA 2ZACA 1PMIA 2R0HA 4AZZA 1CAUA 2HEYF 3K51A 3POIA 5IATA 3J8F3 3ZM8A 5JOYA 4YLZA 3LEIA 3WP4A 1L3JA 2PAEA 4IEXA 2R041 1QGLA 3VBOA 4L9BA 3DPRA 3KQRA 3EMRA 3ZIXA 1YCIA 1OD5A 3NRUA 1H1IA 1S0FA 2PHDA 2WIIB 3HN3A 4KQ7A 4TXWA 3MIDA 3ZFFA 4IV1C 4P08A 1LGBA 1PO23 1VBA3 5FZKA 2WNEA 5BNPA 1U5IA 5D8AC 1UD1A 2LUWA 5I0RA 3AJYA 2RJ2A 4CCCA 3NJYA 3LSDA 3VBUB 4Y1YA 2XH6A 3ZXJA 4FTEA 4IE5A 4MXVA 4XETA 2P3JA 1AYN2 3VD3A 3Q9OA 4BU2A 4NHKA 2BNNA 1PZ7A 5GZDA 1W6PA 2GAUA 3AP6A 4CRQA 3C3VA 4QAWA 2FBEA 4FP2A 1CX1A 4C0HA 2QQPA 1UMIA 1WW6A 3TRSB 5C4WC 5F7UA 4G9SB 3MLLA 2KM2A 4D0QA 5JI7A 1MS3A 5L9VA 4GB33 3WUCA 4CE8A 4XCBA 3WDWA 3CBNA 4AI3A 2VU9A 3ZYIB 4XC9A 3E1F1 3MPBA 5BV6A 3OY8B 4INDA 1ZRFA 1US3A 1OOPA 3WCSA 3KWVA 2DUOA 4MADA 5LWBA 2WS93 3F95A 5BY5A 2VW0A 4NOTA 1PM7A 2XGXA 2ZPXA 2G4IA 3KGZA 3KT7A 1UO9A 1JXNA 2AZ5A 2IUWA 3C7GA 4XUTA 2ET7A 3SCHA 1RUF3 4CDQA 5L7OA 1NA1C 3GZUC 5A7OA 1HW5A 1HXS1 5FYIA 3M7AA 5JR2A 1BYHA 4HKLA 5I0DA 3MIBA 4WVMA 2IXCA 1HB2A 3MLKA 1UKGA 1QIQA 5DG1A 4DZGA 3AB0A 2WO2A 2QVSB 4RS5B 3WG4A 5FY8A 5A7WB 2DBNA 3W20A 3W5MA 3PVOA 2VMHA 5LW9A 5D1IA 4BWOA 1HRI3 2VW1A 5EPAA 4JCKA 2YC2A 2JD9A 1BVVA 4KWUA 1KRIA 5IYYA 1ZZ8A 3AZYA 4PDWB 1MQTA 2BNMA 1L7RA 1VBD3 1EV11 3U4XA 3VBSC 1N1TA 1NXD1 3VZLA 3ZN6A 5E6HA 1S0IA 1O5LA 2WO3A 3OBTA 3RMXA 3T2QA 3CDZB 1OLQA 2WS92 3MLJA 1EY2A 4FSJA 2C6SA 2HH9A 4NE9A 1IGOA 2W52A 4MUVA 2JKBA 1J59A 5D21A 2CY6A 4IV3A 3R6SA 5GLWA 3KLSA 5C6CA 1CX4A 2BRTA 4GZ9A 1HJGA 4LIVA 3S7IA 1WLTA 2YROA 1U5ZA 2CGNA 5K0UB 5A1LA 4CEWC 2FD8A 3ETPA 3WLUA 4RQPA 3I7DA 3IDEA 1D4VB 5C7GA 5CG9A 1MS5A 3OYWB 1GZWB 3K77A 2D6KA 2TNFA 1EUUA 4HONA 4C1XA 4R4XA 4UBGA 2VCAA 4BQ1A 4FPJA 4BISA 4CU6A 1MACA 3ZPOA 3K3OA 1U5XA 4JQTA 1W03A 2CTVA 1VBB1 2IXJA 2C9AA 1VBD2 3FLTA 3ATGA 1ZZ6A 2E33A 5FPLA 3N7MA 1H8TA 3USSA 1W0OA 2BVVA 5FY9A 5H9RA 1LCLA 1O6UA 1CIWA 3DUIA 4NIAA 1ND3A 5FLJA 4FCAA 1DZQA 4QB2A 4XFFA 4K7JA 3V0BA 4NN0A 4OI4A 4LE3A 5LBEA 1H9PA 1J1TA 3RMYA 1S0CA 3A0NA 4AI2A 1QH6A 5KWRA 4NHLA 1UY0A 2XBO3 3N7LA 4TN7A 1HXS2 2ARXA 4YGCA 5ABJB 4LKSA 3VBOC 4B7KA 3DPRC 2DVGA 2HWF3 3PLQA 2J42A 2X29A 1XQNA 1GFF2 1A78A 3C7FA 5FXXA 3ZFFC 2W0XA 3PUQA 3T1LA 4UAPA 4CCNA 3IIAA 4XPVA 4YW2A 4Y5TA 3TEYA 2JDZA 4AI1A 4H2AA 3ZSJA 4QHZA 1MZ5A 5IFPA 1NUKA 3OPZA 4RA0A 5JXGA 1Y4WA 2Y6KA 2QQJA 5GLUA 3C2UA 4YVSA 4S2HA 2ZGTA 3ETQA 4QPIA 4O9EA 1Q8QA 5A6ZA 1SLTA 4RR3A 3S57A 3RZKA 1XRUA 2Q4SA 1S0EA 4NWWA 1OUXA 1ENSA 2XJSA 3CZJA 3N9LA 1NOVA 2LS6A 4Q8KA 1IKPA 1FAYA 5FP3A 1EP0A 4FPLA 1GKBA 2F4PA 3P3PA 3CHXA 4W6YA 3WQ0A 1XNAA 1UOGA 2BP6A 2W68A 4FP3A 4KBZA 4JHZA 5CKMA 2GMEA 3OJBA 5DAWA 3WQ7A 3U75A 4GIQA 1XNBA 1Y7BA 2VZSA 3TOJA 2XBO2 2MNGA 4BQ4A 1DLLA 5F37A 5A6XA 3HQUA 3BU7A 1L7QA 1C57A 2WA3A 2ZX3A 3JQWA 1KGYA 1YQ2A 1WLDA 1OOPC 2P34A 3J26N 1IKQA 5JI9A 4M4PA 2BOIA 1HQNA 4XFHA 2ATFA 3I59B 4UFLA 2OX0A 2VXRA 2W87A 2OZ6A 5IT6A 4Y1VA 3BOPA 1SHWB 5ANQA 4CDWB 1RVF1 2ZZJA 3QD6A 1BHGA 2VNOA 3N9NA 4NWVA 3WW3A 1HB3A 1PIV1 5DZFA 4CDQC 1OC1A 1A6CA 1E57A 1QOSA 1XNTA 3ZFEA 2Q0AA 5KBFA 5JVVA 3FLPA 1DYPA 1VBB2 1YNAA 2XJPA 2ARBA 4NIGA 1LJ7A 4K20A 3WG1A 1X82A 3WDTA 4W8JA 4AGGA 1RUJ3 3ZYGA
chains in the Genus database with same CATH topology
4LHKA 2XB6C 1AZDA 1S2KA 5T54A 1BEV3 1EAH2 3WW1A 1QDOA 1JYCA 3PMSA 3CLPA 2GNBA 3GHNA 1XXNA 1T6GC 1RHI3 4DY5A 3N7JA 5LK5A 1LGCA 2PLV3 4PBPA 3UJQA 5GALA 1G9FA 1B35C 1LR5A 3A4UA 5IK4A 5GKAC 1PK6B 4XFIA 1AXKA 1DGWA 1WCDJ 1WW4A 4XIOA 3B9IA 4BA6A 4TZDA 1QQP3 4AW7A 4DNYA 1H4GA 4ZU4A 3S6PA 1XYOA 3B94A 1ULFA 2DCJA 1H30A 1RUH1 3JQXA 4C90A 5C8CC 1AX0A 1QJY1 1PGW1 3M3QA 4HL0A 4LHLA 2D6OX 3PJYA 1ZRRA 3VUOA 1C1LA 4Q0PA 3ES1A 2CYFA 1NCQB 2A6XA 5I0UA 5F6LB 3OF1A 4XF0A 1LOFA 4DMIA 1ND3C 1RHI2 4KG0A 1KDMA 4Y20A 5BNQA 1FPN3 2RS31 2WZR1 4M0NA 4MGYE 2JG8C 2X5IB 3GF6A 2WKKA 4A3XA 2PLV2 5JZGA 1QJZA 4PQ9A 4Q4X3 1A3KA 4AQTA 1RVF2 4FQ4A 2CWMA 1KXGA 5LEJA 1QQP2 3AKRA 1SFYA 5DZGA 2EA7A 3LOIA 2ZHNA 4GH4A 2JJ6A 1FI2A 2B7YA 3H1MA 2QDRA 4WVWA 2SBAA 1MEC1 3PJQA 5DDJ3 4F7ZA 4ES8A 5JIUA 4GWMA 5HCAA 2VULA 3HAGA 2GC1A 4RR3C 1TME3 2DCTA 4MV2A 4YARA 1DQ4A 5FPZA 1OLRA 5SV8A 3SCFA 4P9XA 2HWC2 4FOYA 4DQAA 4HANA 1RUC3 4Q4Y1 4AVBA 1LGNA 1OA3A 1QJX1 1RMU1 1QXPA 3EXUA 3NW4A 4Q4X2 2ZX2A 2VUJA 3NKTA 1RUNA 2WLQA 5JWPA 1FNYA 4L92A 3WDVA 5ACA3 4NO4A 1V70A 4HN0A 1VJ2A 1NQDA 4KNCA 1RUH2 4IEUA 2RM22 4GKXA 5DZEA 1O91A 4COUA 2R063 1QJY2 4LBLA 1C4RA 3KSCA 1AL22 1LHWA 5AFBA 4RHV3 1TME2 5EV7A 4C0BA 2EXHA 3FBMA 2O8OA 3BB6A 3H8UA 2RR11 1NQJA 2GMPA 2RS32 1RUC2 3RS6A 3AYAA 3SMHA 1FV2A 3V64A 1N3PA 1NCQC 2GALA 5T55A 2D6PA 1VRH1 4WM8B 3O7OA 2UWCA 4IEZA 2O1QA 2X8KA 1EPWA 5ACA2 2OA2A 4OULA 1Y9QA 1NY71 4XMAA 4N43B 4R9AA 1NCRB 2KXLA 2QUOA 2ZJCA 2VMGA 2DWRA 1KFUL 2P3IA 1FATA 4F3JA 3E5QA 1PO13 4MGZE 3WG3A 4WM7B 5T5OA 3POSA 4W65A 1OPMA 4H55A 1AR63 3EJKA 1HIXA 1XNCA 4OHXA 3USUA 2YXSA 5BNNA 5JPMB 2ZBJA 2HWD2 1RMU2 2LALA 3FLRA 4MX3A 4LBQB 3PVEA 2IXLA 3WR0A 4YM1A 4GMP1 2WNUB 4JV4A 1F5FA 1MS0A 4GA9A 4RFT0 3OD4A 3TYJA 3WG4A 2RMU1 3SISA 2A6VA 3N35A 1HX6A 4QPGA 5AC91 4A7KA 4MVTA 1LOFC 4PLOA 2WSUA 4MGKE 3FFQA 4FQZA 1BBT3 2RE9A 3WY6A 1RUI3 2GZWA 4JGYA 1POV3 5JZGC 1LEDA 3H3ZA 3NAPA 5JLVA 1PO12 1FOD3 1AR91 5CAZA 3QLQA 1W6NB 1JUHA 2BQPA 1PVC1 4RL7A 1TMF3 1HRV1 2Y0IA 1R081 1AR62 2VOKA 3TWIA 2RR12 1S0BA 4GH4C 5FAXA 4Q0SA 4BMEA 3GHMA 4EWAA 2A3WA 3KT4A 3DF0A 1SCRA 2A75A 3WW2A 5J98B 5FO8B 2HEWF 3VHOA 2VQAA 2BVBA 2NPIA 4V1PA 2B45X 1SFNA 4HSLA 4FBFA 2ZGMA 4HZFA 2NYYA 1H0BA 4XF3A 4B3NA 1CQ9A 4Y1ZA 5FOBB 1G9DA 1RUI2 5CFCA 4ONUA 1QJU1 2GH2A 5F6KA 4GKYA 1TMF2 1O7FA 4P9JA 3UJOA 1NLRA 4LBOA 5T50A 3CL1A 4LLFA 4CDXC 3UV9A 4N43C 4HK8A 3S0MA 1QMJA 2A6YA 4I0AA 4RD7A 2Z79A 3AX4A 4QGLA 1GSLA 1V6NA 2XKOA 4LE4A 4OI1A 3CF6E 3O14A 4OHWA 1SBFA 3JZVA 4WM7C 3AFKA 3AZWA 4AEDB 1V00A 3M3EA 3CJXA 3PVNA 3VZMA 1ZRCA 5AVPA 3E97A 4E27A 1ASJ1 1R1A1 4Q0UA 2DYCA 2WNVB 3U07A 2A6WA 3EHKA 4IEVA 2Q8OA 1B09A 2B39A 1Y43B 2GNTA 5EXOA 2DURA 1N1SA 4IEPA 2GH8A 2GC0A 5HXVA 1PNFA 2XVGA 4G4FA 1G8WA 1WCKA 5CVRA 2CGOA 2I74A 3WVJA 3VKNA 1LKNA 5E8AA 1CAWB 2IXKA 5FBZA 2D5HA 3M3IA 4I30A 4XIKA 2R1BA 1K5MA 5D8AB 3LOBA 4HSJA 1H9WA 4WZCA 4XE9A 1UPIA 4COYA 2K2SA 4OZXA 3QBQA 1V6IA 4BIFA 4HT1T 1LU1A 4HPKA 5J37A 1OHFA 2IXIA 2WWSA 3WNXA 1QY4A 3H50A 3SLIA 5BNNC 1GBGA 3E6CC 2PHLA 1KS4A 4Q1PA 3ZSKA 3AFGA 1ZZ7A 1DGLA 3JU9A 3LAGA 3QCWA 1CESA 2BFUL 5C4WB 3W9AA 2ZZQA 5FLIA 2Z42A 3M70A 2C1FA 2QKDA 3OGGA 1RB8G 5J96B 5C9AC 1AYN1 5J48A 4FPYA 2D3PA 4N90A 2WJSA 4AVSA 2YV8A 2RHPA 3WXPA 1CVNA 2JICA 3VV1A 1AYM3 1URXA 3NAPC 3J8F1 2D3RA 4PBOA 3ZFGC 3WHTA 4AXOA 2GNMA 3RJRA 1NA1B 1YYNA 1ASJ2 1R1A2 3NV3A 1X33A 1HKDA 1PO21 4BHPA 1VBA1 1NXMA 1WUVA 3JD73 2ZTNA 2FMYA 1O4TA 4EWEA 1VLNA 1AF9A 3IKWA 4AEDC 1EPZA 3NV1A 3CU7A 1GICA 4KG8A 2ZKLA 1Q5OA 3OBRA 5FO9B 4M3CB 4HKOA 2E9QA 4XXPA 4XDQA 2D6LX 3BOWA 1AX1A 5K7PA 4PF5A 1ENQA 4Y4YA 1YRZA 1DQ1A 1ZNPA 3VBSB 5F9TA 1AYM2 5I0SA 3AZXA 5JIAA 5CFCC 3M3CA 3VLBB 3V56A 4M01A 1M4WA 1X7NA 1COV3 5TSWA 4P14A 1CAXB 4COWA 3KGLA 1RTVA 1ENRA 2VVFA 2AUYA 4BLJA 2H6CA 4CEWB 1LECA 1W6OB 5BPXA 4Z8BA 2WS91 5E89A 3M8LA 4Q4V2 4U2AA 2BPA2 5HBAA 4YZ3A 1RUF1 2WQ4A 3GZAA 1OMIA 1GNZA 4XQ4A 3IPVB 2XJQA 1D2QA 3WDUA 4A2UA 4IQPA 2BWCA 5A33B 2GSYA 5J36A 2PFWA 1QWRA 1O5UA 2MEV3 2XJVA 4XYXA 3LA3A 3VZJA 4B8EA 1QNWA 1ULDA 3J8F2 3RWNA 1CAUB 4K21A 1HRI1 2XLGA 3BALA 3FUOA 4YGDA 3RG0A 1UMZA 4YYOA 4TWTA 1KJRA 4CZSA 3I4IA 1VBD1 4YVWA 3WDYA 3VBOB 4ISRA 2W39A 2YYOA 3DPRB 3FJSA 1G9BA 2B42B 4LNVA 4ORFA 3AKPA 1PO22 1IHMA 3ZFFB 1VBA2 2XWJB 5JPNB 1VALA 1YI7A 3GNEA 3SHRA 4KGQA 1BJQA 1C8M3 1NE4A 1WLWA 1GZCA 1XYNA 2E63A 5F1RA 1VBE3 1FXZA 4Q2FA 2R043 4TYSA 1D0GA 3D82A 1DIWA 4NR1A 2JG9C 4FTBA 2YGMA 3E6BA 1W6PB 2JENA 1W2UA 4C1WA 4LBKA 1APNA 4GB32 1RL3A 1PGSA 4BMBA 4R9DA 1WA4A 3E5XA 3THTA 3NO8A 1SMVA 2R073 2XWBB 2ZHMA 4XXAA 4YG6A 2SLIA 5BYNA 4XHBA 2EXIA 1OOPB 1GV9A 3KS7A 5FREA 4XQDA 1GZWA 3JB4C 3MFCA 1C8M2 1ND2C 2VVEA 1RUF2 1BMV2 2XBO1 2VPVA 1VBE2 4CDQB 2A5ZA 5L7OB 2HWF1 3RJ2X 3VBFA 3CO2A 1QF3A 3THPA 1YHFA 1Z78A 1XNKA 4LR4A 4RGAA 1G9AA 4WVZA 3WP5A 1TQ5A 1UN1A 4Q4W3 3QH7A 4HVQA 3IMNA 3GBWA 3HT2A 4XEZA 1HRI2 4HK9A 1FMD3 2G9FA 4XF9A 3DV8A 4I2OA 3MW3A 3AZVA 1CPNA 2DFBA 2GN3A 4J1XA 4X8NA 4YGEA 1IS6A 5EYYA 1H1MA 1GYKA 1HQLA 3VHNA 1MQTB 1BCXA 4OFGA 2D44A 1H2LA 2VQ0A 4JC1A 3N4MA 1DQ0A 4LBNA 2WT0A 3ZN6B 5FOJB 1OQEA 3ZXGA 1Q8OA 4OI2A 3RYRA 1EAH1 5A3LA 2ZGSA 3HN1A 2NM1A 1B35B 5C8WA 1WD3A 1S2BA 5AVAA 1MVEA 3KB5A 1AXZA 4XJZA 1AR73 2PHUA 4DFSA 5FCCA 1KJLA 2O0OA 4Q4W2 4RQPB 3V0AA 5BNPC 3OD0A 1VBC3 1IZ3A 3DGTA 1KDKA 1FMD2 3ZXFA 2FZ2A 1AUYA 2NP0A 2EF6A 3ILNA 1W6QA 3IWZA 4COZA 5C8CB 4FXKB 3MIGA 1KFXL 3KCXA 3TAYA 1ZBA3 5FPXA 3POWA 5I93A 5A32B 4E9KA 4ZKTB 2DVDA 1ZX5A 1X50A 2JD4A 3UK9A 1ND3B 3R4SA 2ZAHA 3JBG3 5JAXA 2JG8B 5GM0A 1JH5A 4WV8A 3WP6A 5IUQA 3H1YA 1IQAA 1BEV1 2E6VA 3UKTA 3V0BB 1KQRA 1C5HA 1O4ZA 4IEOA 2HWF2 1V6MA 4YVWC 4FPCA 4D94A 1RUE3 3TN93 2TUNA 3PTYA 1RHI1 1OSGA 1ALYA 4YZ4A 5EWSA 4AQSA 5DXDA 1UZZA 5IK5A 4WBBA 1VAMA 2PLV1 4QX5A 1AX2A 4LUMA 1MS8A 2RS53 4LTAA 3EBRA 3JB8A 4FPFA 1VR3A 1G9CA 1F2NA 5F5QA 2EXJA 4YVSB 4DB5A 1QQP1 3M2MA 4QPIB 1ZBA2 3GZTB 4QQ2A 4RR3B 1ZRDA 4LHNA 2PTMA 4QQPA 4JGZA 3JCIA 1LOBA 4D69A 3JBG2 1VAKA 5EYXA 2EXKA 4Y5Z0 5J09A 2ILMA 4D7TA 1N47A 1HV0A 3E6DA 1MQTC 1REDA 1SBEA 4CDUA 2NQYA 5IK7A 2HWC1 1FPN1 2QDNA 4BH9A 5JMCA 3RYKA 1HDKA 4AI8A 4Q4X1 1ZYBA 2XPJA 2WSVA 4IV3C 1BZWA 3AP9A 2ZX4A 2Q1ZB 2AREA 3VBFC 3D8CA 5CB7A 4M3CF 2AR6A 4P9GA 4RQPC 4IERA 4FVVA 5H9QA 2DTWA 2ZGUA 3VKMA 2RM21 1RUJ2 2DVAA 5DDJ1 3I54A 3ILFA 2CNAA 1BEV2 3B9CA 1AL21 3AK0A 4KBBA 1TME1 2YC0A 1JW6A 2VOXA 4G3YC 1PIV3 4JDMA 1H8TC 4TLFA 4PIZA 4M00A 3BODA 4XTMA 1V6LA 1RUC1 4S2DA 3LZZA 2WZPP 1YIFA 1I6XA 5BNOA 5CG8A 1X8EA 2EAKA 2ZA9A 4AVTA 4FPGA 4XF4A 3WW4A 2NMNA 2VVDA 3O0WA 2E51A 1BQPA 4AQ2A 1Z7S3 5ACA1 4AWDA 4LEJA 4BM8A 1G6NA 3UKVA 4KGGA 4J6GA 4MZUA 3AYCA 4WVVA 1QOOA 1MS9A 4GULA 3HR9A 4YVSC 1AVBA 2Z69A 2NZ9A 4QPIC 1MZFA 4U36A 3ALQA 1O4YA 5GLTA 1ULCA 5T3NA 4FT8A 3T1MA 4I3GA 5KHIA 4XQWA 4H7MA 1SLIA 1FPN2 4QGMA 2EAAA 4Y20B 4FPOB 4HVRA 4F83A 3GYDA 2HWD1 4GQ7A 1AR83 4PJYA 4GALA 2BWAA 3VL9A 3DN7A 1W39A 5JZGB 1OI6A 1AXYA 4XILA 1LHNA 1U0AA 3AP5A 3M1HA 4XBLA 1HLCA 3PHMA 2UURA 1V6JA 3WUDA 2C0ZA 3NV4A 4GH4B 4AFCA 4E2QA 2K0GA 1O3SA 5KHGA 1IPJA 1UKRA 4UXAA 5DDJ2 3N36A 2B8MA 1PO11 2WFF3 2ZGOA 2DF7A 2IXHA 3ZFEC 4WM8A 5T5PA 3IN9A 3LWCA 4AFAA 1AR61 4FPKA 3WQ1A 3MF6A 2XHKA 5L19A 4JGZC 3ECQA 1NCRA 3EO6A 3S30A 1AR82 1MZEA 3BIWE 3VBRA 1NE6A 3ZYPA 4D7SA 2WFPA 3VDDA 4LO4B 3O0XA 2YY1A 3VKOA 4DRRA 5KXBA 1J3PA 3H9AA 2H0VA 2CAVA 2JX9A 4CDUC 4DOUA 1XNDA 2ZMKA 2ES3A 2UY8A 2RS13 4AGVA 1A8MA 4H3WA 4PLNA 4ASLA 4KWJA 4CDXB 1N3OA 4N7UA 1PHMA 1NYWA 1RUI1 4Q26A 1POV1 1QNYA 1C8NA 5SV5A 1MS4A 1FOD1 2R062 4O9GA 2WFF2 4Q4Y3 2VOWA 4E2GA 1QJX3 4YW3A 1DGRA 1YFUA 1TMF1 4RHV2 2D6MA 3ZXEA 4OI0A 5FQ0A 3AXEA 4I0WB 5BUVA 2YMZA 4BOWA 2HWB3 4XBNA 3WP3A 1Q43A 4EN0A 5FRAA 4GMP0 1WCSA 5FLHA 3RYPA 2PHTA 1W6NA 3ASIA 1UPSA 2VECA 1WMEA 1D2SA 2V73A 2WL1A 5FMOS 1DFQA 1M06G 2RS12 3KD4A 4YG0A