3EBRA

Crystal structure of an rmlc-like cupin protein (reut_a0381) from ralstonia eutropha jmp134 at 2.60 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
b'MLFESINTGCLDGNDTPWMPFAPYSNDVMVKYFKIDPVRGETITLLKAPAGMEMPRHHHTGTVIVYTVQGSWRYKEHDWVAHAGSVVYETASTRHTPQSAYAEGPDIITFNIVAGELLYLDDKDNIIAVENWKTSMDRYLNYCKAHGIRPKDLSTFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized RmlC-like cupin
publication title Crystal structure of RmlC-like cupin with unknown function (YP_294607.1) from RALSTONIA EUTROPHA JMP134 at 2.60 A resolution
rcsb
source organism Ralstonia eutropha jmp134
molecule tags Unknown function
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ebrA00
3PVBB 4D7SA 4GULA 2Q30A 4XFAA 4LUKA 3RYRA 1WLTA 1UIKA 3NL1A 2EVXA 3USSA 2QCSB 4OFGA 3H8UA 1WGPA 4HN0A 3OGJA 4KWKA 4YSFA 1V70A 2Y0OA 4PJYA 2BNNA 4XEZA 3S7EA 4BYYA 4E2SA 1O5UA 5I0SA 3SXWA 3IDBB 5JSOA 1OI6A 4I09A 1H1IA 3RYPA 4X6QB 4KWLA 5FQ0A 3FE5A 1CX4A 1O5LA 5BPXA 4RD7A 3E6CC 3LA7A 5E1RA 3H3ZA 4I01A 2GU9A 3H50A 1UCXA 3FHIB 3H7YA 4ONUA 2ET7A 3M70A 4QMAA 2WC2A 1ZZBA 2CAVA 2I45A 1DZTA 2GC0A 4CYDA 4EWEA 3MDPA 2H6CA 3SMHA 5FQ0B 3CF6E 3RZZA 1YLLA 1LRHA 4HLTA 1QXRA 3ACLA 5J48A 4QGLA 3H9AA 1EYBA 1NYWA 4N9IA 3RYKA 3RDIA 3HT2A 5KHGA 2PTMA 4IEPA 3ES4A 4B29A 5EZWA 3NJZA 1LKNA 1CAVA 1QWRA 2CAUA 2EA7A 3EHKA 3EBRA 4NVPA 3IBMA 4E2GA 4MGYE 3WW1A 5JSPA 1YUDA 4YYOA 4IETA 4E2QA 2O1QA 1Q3EA 4META 4L2NA 2ETEA 4FT8A 4XFIA 3MZHA 3NSTA 4YRDA 4XF9A 1DGRA 5J7MA 1Y3TA 3L2HA 3DKWA 1IPJA 3E5UA 1CAVB 3UKTA 1VR3A 3H3UA 1LR5A 4LA2A 5I8TA 4HVOA 1UW8A 1XE7A 4QGNA 3VHRA 4QGMA 4XFCA 4ZU5A 1OMIA 2K9ZA 4WBBA 3CO2A 3S0MA 3OCPA 5J3UA 2FMYA 4HZFA 3OD0A 3NVCA 4Q29A 2ZKLA 1DZRA 1RL3A 2BEOA 3OF1A 4HVQA 2B9UA 4OLLA 2HKXA 3HIFA 2IXHA 1Y9QA 2EAAA 4XF0A 2BNOA 3IIAA 3QOPA 4I0BA 3SCGA 1OD5A 4H7LA 4MH0E 2PHLA 2QJVA 3B02A 2PFWA 4ZU4A 5I91A 4UBHA 2IXIA 1ZVFA 4Q0UA 2XGXA 3N4MA 5FPXA 4KL1A 1RUNA 3CL1A 2OZ6A 4QM8A 5I8SA 2Z69A 4X6RB 3SCHA 4I2OA 4MGZE 3U11A 3E97A 3FZ3A 1I6XA 2MHFA 1VP6A 4MZUA 2PAKA 5FPZA 2PQQA 5FLJA 4ZU7A 4Q0PA 4O9GA 1RC6A 4K8FA 5T3NA 2GC2A 1NE6A 4ORFA 1CAUB 3KSCA 1ZRCA 2GC3A 2XL9A 5K8SA 5KHIA 4R52A 4IERA 3ZDSA 4XETA 5FLIA 5LRSA 4XFBA 3KMHA 1UD1A 1PM7A 3H1MA 2PHDA 4TLFA 4HSLA 4FAHA 4AXOA 1PMIA 4XFGA 3ES1A 2PAEA 3NKTA 1DGWA 1SQ4A 4MGKE 5I93A 4PIXA 2D93A 4Z82A 1YWKA 5BUVA 1O7FA 2OPKA 1NZCA 1ZZCA 3RNSA 2ATFA 1UPIA 2CGPA 3FFQA 4P9GA 5E16A 5KHJA 4D7TA 3ST7A 4XF4A 2UYBA 3TNQA 3BB6A 1NE4A 3MPBA 3WW3A 3H1WA 1J3PA 3WW4A 4Q0SA 4AVBA 5I0TA 2HJIA 1RUOA 2H0VA 1X7NA 1QY4A 5I0UA 4JTOA 3TNPB 2XL7A 2VQAA 3BU7A 5BV6A 3H1YA 1FXZA 3GBFA 4I3PA 2MPFA 4UXAA 1YFXA 5FCCA 1O3QA 3CLPA 3ELNA 3KGLA 2XKPA 5HI0A 2ZCWA 2DCTA 3BCWA 3R6SA 3C3VA 4MUVA 1ZRFA 4IEZA 2VECA 3IWZA 4F8AA 1J59A 2K0GA 4J1WA 1O4TA 1YFUA 3LA3A 2BGCA 2ET1A 4QX5A 4L11A 4QXKA 1Q5OA 2XHKA 2MNGA 5CVRA 3WW2A 3LOIA 4FBFA 2WFPA 3E5XA 2XLAA 4JTNA 5JR7B 5LEKA 1EY2A 3UKNA 2N7GA 3I7DA 4JVAA 2Q1ZB 4HBNA 4KU8A 2D5FA 1I5ZA 1SEFA 1ZX5A 4HSJA 1G6NA 2D40A 4LUMA 2BYVE 1LB2A 3JZVA 4I02A 2BNMA 4Q0VA 5CU1A 5KHKA 4MGIE 1RGSA 1ZZ6A 3KGZA 3DV8A 4QM9A 1EP0A 3I59A 4A2UA 4DINB 3DN7A 1EPZA 2B5HA 2UY9A 3NW4A 1YFWA 1GQGA 1X8MA 3E5QA 3KCCA 3LWCA 1SFNA 5F1RA 3IDCB 2P17A 5KHHA 2OA2A 3GYDA 4LEJA 5JCTA 3LA2A 3E6BA 1ZREA 1ZZ7A 1FT9A 1CGPA 4LTAA 4HVRA 5FLHA 1JUHA 1XRUA 5C8WA 3OTFA 1XE8A 1Q43A 1ZRRA 1HW5A 4KWJA 2IXJA 3I59B 4Q0QA 3D0JA 4MX3A 3SHRA 1CAXA 2Q4SA 2XLFA 3BPZA 4MV2A 2FQPA 1J58A 2D5HA 4BH9A 1VJ2A 5I0RA 3SCFA 2IXLA 2IXKA 3ROUA 4LLOA 4IEXA 4R8HA 4EV0A 2UY8A 2B8MA 3RPQA 1H1MA 2XLGA 1QXJA 1X82A 4BHPA 5BXXA 4WZCA 3LAGA 4IESA 1CAXB 1ZZ8A 2PAMA 3D0SA 3LZZA 1O3RA 4BIFA 5BY5A 4YNIA 4PIYA 4AQ6A 2O8QA 3U0ZA 4LULA 5KBFA 2OYZA 1J3RA 4O9EA 1O3SA 2CV6A 2Q0AA 3QACA 1TQ5A 4IEQA 3BALA 2PA7A 4HN1A 5LRRA 5AVPA 2Z2SB 2E9QA 3PLQA 4XFHA 3FJSA 5JAXA 4HMZA 4XFFA 2V09A 4XF1A 2QVSB 5I8YA 3H7JA 3E6DA 3EQEA 4N9HA 4JV4A 1NXMA 3UKVA 2VPVA 4WVZA 4UBGA 3G7DA 2GH2A 3FWEA 1IPKA 2KXLA 4KU7A 2H6BA 2F4PA 4EROA 4I0AA 1ZRDA 3MYXA 2XKOA 4XF3A 3U10A 5D1IA 4J1XA 1X8EA 4IEVA 1YHFA 2PYTA 3HT1A 2QDRA 4Z07A 5C6CA 1UIJA 1RTVA 3S7IA 4YARA 2GC1A 4EWAA 4IEWA 3EJKA 3D82A 4FAGA 2UYAA 2GZWA 3CEWA 1CAWA 1YFYA 4EWDA 4IEOA 3HQXA 5JSRA 4IEYA 4F7ZA 5EFUA 3M3IA 3EO6A 5FDBA 4IEUA 4PIZA 3O14A 1GQHA 1FI2A 1U12A 1L3JA 2C0ZA 3PNAA 4AVCA 3CJXA 1OFNA 4LA3A 1J1LA 2GAUA 3DL3A 2IC1A 5LEJA 1CAWB 5CADA 2OZJA 1ZNPA 1ZZ9A 4AVAA 2QNKA 3ETQA 3FX3A 1J3QA 2IXCA 1O3TA 1WA4A 4AQ2A 1CAUA 3I54A
chains in the Genus database with same CATH superfamily
3PVBB 3PU3A 5H9PA 1YIPA 3VZJA 1NLRA 3P3NA 2DF7A 2LTNA 2RMU3 3T2OA 4Q4Y3 3VBRB 2JG8A 2UWBA 4Q1PA 3AVRA 1K5MB 1TZOA 1UIKA 4GH4A 2D44A 2QQKA 3USSA 3HJRA 2W0XA 2Y38A 1MEC3 4E8CA 4WVVA 2X5IC 1C8M3 4HN0A 3WNNA 4FPYA 2K46A 2RM23 3OGJA 1UNBA 4EN8B 2Y0OA 4PJYA 2BNNA 4XEZA 1GWKA 4XVHA 3S7EA 5CISA 4E2SA 3WXPA 1PHMA 4E9KA 2BWCA 3LEKA 1OPMA 4FPCA 2EIGA 4M0HA 5JSOA 4R9BA 1EAH3 3RJRA 2PQSA 1SBFA 3ZX7A 1Z0HA 1RHI3 2VUJA 4X6QB 4AYUA 4JHZA 4KWLA 2JKXA 4IV1B 4R9DA 3HQRA 4LE4A 5A32A 1R1A3 2V5DA 4YWAA 3R0RA 1JZ7A 4QB1A 4XHXA 4XBLA 4MHUA 5BPXA 4JGZB 3LA7A 4AWDA 4BB3A 2JD4A 5C4WA 4CP0A 2WNUB 3H3ZA 1LHUA 4MGQA 5SV5A 2WRAA 4BOWA 2W94A 2D97A 1UCXA 1WCDJ 1F5FA 2WNVB 3M70A 4YW4A 3FFZA 1ZA4A 1V6KA 1AYN3 2GC0A 4XUTA 4YVWB 4YLZA 5AVAA 3WP3A 3SMHA 5FZBA 4EWEA 4OYUA 1YLLA 3VL9A 5CFDB 1JYCA 1K5JA 1KXGA 3VBOB 3PL0A 5AFEA 1DQ1A 3I8TA 1VLNA 5K4LA 4CUCA 4N9IA 4PBPA 4JDNA 5CEHA 5KHGA 1OQ1A 3GBWA 4IEPA 3ES4A 1IG3A 3ZFEB 5FYTA 1LKNA 4JQRA 2VBPA 2ID4A 2VVFA 3OGSA 1RUD2 1QQP3 4BE3A 2EA7A 4X8PA 3BIWE 3Q9OA 4NVPA 1HRI2 2IWGB 3UV9A 4BLJA 5ACA3 1O6UA 1O8PA 3VDCA 4IETA 1LHVA 3ZIXA 2B7YA 4YW6A 2LM3A 4N53C 1ASJ3 1XQNA 4DEVA 1VMJA 4QX8A 4DRVA 2YDEA 2WYSA 1RUD1 3AKPA 3KWVA 2ETEA 4FT8A 1YQ2A 3NSTA 4FXKB 4QT6A 4XF9A 3B9CA 4AFMA 1DGRA 2ZX3A 4NROA 1GBGA 2L9LA 3DKWA 4M0NA 1IPJA 4MXWA 3ZM8A 4CCLA 1VR3A 5CKMA 4UFJA 1UY1A 1UO9A 1UKRA 2JEMA 1HQWA 3INAA 3AXDA 4LA2A 5HPOA 1R64A 4NR1A 4H14A 4S2DA 1D2SA 2GMEA 4QGNA 4A41A 5JXJA 3KM5A 3POEA 4YPJA 5IK4A 1IQDC 1PVC2 2OIIA 4TXWA 4CDUA 3F95A 4KGGA 2K9ZA 3GALA 4L0PA 4FXGB 4RS5A 4ZZ5A 3S0MA 1KJRA 1ODMA 1YJLA 1W3XA 4NHXA 4CCMA 1LGCA 3VD3A 5J3UA 4Q1RA 2ZPXA 1WW6A 3WV6A 4H7MA 2G1MA 1G8WA 5C9AC 5FK8A 4LR4A 4URTA 4W50A 3VBUB 1DZRA 4I30A 4HVQA 4AI3A 2WL1A 1QDCA 4XTMA 2HKXA 2JD9A 5FOBB 3QOPA 1AJKA 2Q8DA 2XMLA 1S2EA 3SCGA 4JZRA 3Q8AA 1VRH2 3MF6A 3OUJA 4MH0E 5T54A 2QJVA 4A42A 2ZGLA 1DZQA 1HN1A 2PFWA 4XHBA 3HN3A 4LKEA 4UBHA 4WVWA 5I91A 1H8TA 1ZVFA 3NJVA 2WS93 4CPBD 5K0UC 1G9BA 2XGXA 3I2OA 1QJU2 5GZEA 4AFDA 2P3IA 1W8WA 2ARBA 2DUOA 3EMRA 3ILFA 2CGNA 4Y22B 4AI1A 1VRH1 1GP6A 4C8DA 2Z69A 1E57A 4QX0A 4CCOA 3VBRC 4MGZE 2UU8A 3OGGA 3U1XA 4JKLA 1QJU1 3AFKA 3H42B 2VZVA 4FOVA 2MHFA 3V0AA 1QKQA 1RIRA 5IHRA 5A7SA 1CD3G 2PQQA 1VMFA 1BKZA 1KJLA 4I3GA 1A6CA 1OQDA 1TME3 4XMIA 5T3NA 2GC2A 1NE6A 1G9FA 2GC3A 1UXXX 4FFHA 3FL7A 2A6WA 3BODA 3CBNA 4R52A 3AMQA 2HWF2 3ZKYA 4Q5OA 1KQRA 1WW7A 4LBLA 3WUDA 4URAA 1BEV3 4UFKA 5FLIA 4P5HA 5JVVA 1OF3A 2E7QA 2FDJA 2RM22 2ZA9A 3CIHA 5BNPB 5FZLA 4FTEA 4IV1C 2QFEA 4XJAA 1GOHA 1YIFA 3MW4A 3P5BA 4AXOA 3JXSA 1PMIA 1OOPA 1N3PA 4HT1T 5FBZA 3VZNA 1VB2A 3RGBA 3SNMA 2D98A 2HWF1 4JGZC 2JE9A 3NKTA 4COUA 3AKQA 3I2KA 3O1OA 2VMFA 1DCSA 1EAH2 5GLZA 4DUWA 2WNUC 5EP9A 4XCBA 2KR2A 4MGKE 2RM21 4YM2A 5JUVA 1D2QA 1RHI2 5FP8A 5LASA 2FCVA 2XJSA 2WNVC 4AEDB 4M3CA 4Z82A 4GQ7A 4P9JA 1PNGA 3RS6A 2IFRA 1RUF3 2YGMA 1O7FA 3DXTA 5DUUA 4NPMA 4Y1ZA 4YVWC 3ZXDA 3V0BB 3UNPA 2OPKA 1APNA 3AP9A 1ZZCA 1N1TA 2VNOA 5CFDC 1JZ5A 2Z4FA 2ZGOA 4ZS3A 3ZLIA 2OS2A 1RHI1 1LOCA 1QGLA 4BXFA 2CGPA 3FFQA 3LD8A 3OBZA 4RR3C 1KITA 1US3A 5E16A 3DCQA 1ND2B 5FMOL 1CIYA 3ST7A 5C3OA 3BB6A 3BVCA 1I3HA 5FZOB 4TWTA 5FZ9A 1J3PA 4LK6A 5D8AA 4WVMB 4LO7A 1ST8A 2RJ2A 4IL7A 3UL2A 5C8CA 1AJOA 5I0TA 1JYTA 1R093 5A33A 2ZHNA 2H0VA 4AAXA 2CDOA 3OD4A 1QOOA 3K4DA 3TEZA 5FAXA 2W9XA 2VNGA 3VV1A 1SDDB 2DV9A 3AYDA 4JHTA 4JTOA 1YI7A 2XONA 4Q4V2 4GA9A 4Y3OA 2BGPA 2HWD3 2BVBA 4Y1VA 2QQVA 1W8ZA 4LPLA 5GM0A 5ABJA 4JKMA 3H1YA 5FYCA 1JOPA 4BK4A 3GBFA 5BNOA 1GNYA 1NUKA 4UOJA 1GFF2 2ZBJA 1HXS3 1QQP2 2J1AA 1UY3A 3A4UA 4LBQA 4LKSA 1FMD2 4Q27A 2X10A 4I3PA 1UY2A 4Q4V1 5JMCA 3ZYHA 4XXPA 1V00A 4RFT0 2YHJA 1F5JA 1ASJ2 1IKPA 4C0HA 2ZGKA 4ZHNA 1S2KA 2RJKA 2DCTA 1BLZA 3KCYA 1A34A 1QQP1 2ZGQA 3BCWA 1Y4WA 1WBFA 2W91A 3K3OA 1AF9A 1FMD1 3J7HA 4IEZA 1W6NB 5SV8A 2WINB 4N7UA 3ZVXA 4LHSA 1CJPA 5JLVA 1TNRA 4RQPB 4JDOA 1VBB2 1ASJ1 4ZONA 2YUEA 2WWSA 5E8AA 5JWPA 4TLGA 3LA3A 4MVTA 4NIGA 4L92A 4XILA 5EXOA 1XU1A 5DAQA 3VBHA 1UU6A 4IE6A 5AFBA 2D7FA 2PHRA 1W0NA 5GZCA 3LOIA 4KH9A 1AR92 3ZYRA 3AP6A 1NCQC 1T2XA 4FO9A 5HV0A 3Q8BA 3BYWA 1VBB1 2X29A 2JDNA 4CP9B 3WLUA 2RJLA 3NRUA 4UW3A 3UKNA 2N7GA 2FZ2A 3GXUA 4QQPA 1RJ8A 2JG9A 4GMP0 4HSJA 1A8MA 4XJ9A 4QQOA 1AR91 4UF0A 2BYVE 1UZZA 1QH7A 2D6OX 4I02A 3TWIA 1UKGA 2BNMA 5IVJA 4JGYB 4JDMA 1UN1A 3MIBA 3C7GA 1GZWA 1IG0A 1RGSA 3LSEA 1ZBA3 1ZBE1 5FZ3A 3DV8A 3IB3A 1A8DA 4QM9A 4YGBA 4CDWA 4XACA 4OI1A 3ENRA 1K5MA 4GWMA 3DN7A 3ZXFA 2B5HA 3N9OA 4EN0A 3B9IA 5CIRA 3AVSA 2QDNA 3VB9A 2NP0A 5EHDA 3E5QA 5FYYA 1SFNA 2UWCA 5F1RA 3IDCB 4RA0A 5C3SA 5FZ4A 2P17A 2R062 3WDVA 2WS92 1PX3A 5EV7A 1TG7A 4AVVA 4A3ZA 5JCTA 3BUCA 3LA2A 4S2HA 1CIWA 3M3CA 4ASLA 4B1MA 1FT9A 2VUAA 4AGRA 4D6QA 4FTSA 2VCAA 5FLHA 1W9YA 3RI9A 1J1TA 1DYKA 2ZGPA 2XVGA 3D5OA 3OTFA 4NOTA 4OUSA 1Q43A 1ZRRA 4HXCA 4HG6B 3WQBA 1H6YA 2R061 2WS91 3I59B 5D2AA 3ITQA 4GWJA 2A71A 1VAVA 2R0FA 3M4FA 3LIGA 3SHRA 5EYXA 1OA2A 1RUJ1 5DAPA 2A1XA 1AX2A 4C0BA 5LA9A 4CDXB 1RUI3 2FQPA 4OHXA 4AK3A 2I07B 1B35C 1JOJA 5GZGA 3WUCA 4CEWC 5DUXA 3JD73 5I0RA 1VJ2A 1OUSA 1BEV2 1F2NA 2R043 2IXLA 3ROUA 1OPOA 1DQ4A 4HKLA 1XJAA 3PDQA 3PHMA 5JPNB 3S5QA 3U14A 2XLGA 1AX0A 2AR6A 3WZ1A 3VBOA 3SH4A 1GV9A 4NIDA 1OQEA 1BEV1 5A7WB 4CP2A 3IAQA 1CAXB 3ZFEA 4JAAA 4YZ3A 4ET7A 2G4IA 1YO8A 2JDUA 2RDSA 4YNIA 4BIFA 2J1VA 2PN5A 1ND2C 3MLLA 4KBBA 4K3UA 4YFWA 2PHUA 3UGGA 4LBKA 4QPIB 3U0ZA 1EV13 3D8CA 3CHXA 2GP5A 5JIUA 3QACA 1WUVA 2ARAA 2Y6GA 2XBO3 1SFPA 1WBLA 3ZPOA 4FPEA 2ZMKA 3KT7A 4HN1A 4K8RB 3DF0A 3HBKA 3DGTA 3APBA 2E63A 3WDWA 1HJFA 3QD6A 4CXXA 3HOBA 3THTA 2V09A 3K2OA 4RL7A 1AYM1 4XF1A 3ZR5A 3POSA 5HXVA 3DYMA 2OKXA 5JXIA 3W5NA 3H7JA 1W9FA 1PGL2 3TEYA 5CBLA 1PO21 3PUAA 3I3BA 4WVZA 3CQOA 5AC92 5BYNA 3MIDA 4PQQA 2W1WA 3WQ0A 3FHAA 4LKDA 4XUPA 1UYZA 1WCKA 5J1XA 2YBSA 2F4PA 3KF3A 2RS53 1NA1C 1BYHA 5FO8B 1PGL1 3MI8A 4QWNA 1JZ2A 4QXCA 3K3NA 1XNCA 4OQ8A 1HIXA 3T0AA 5AC91 1BBT2 5D1IA 4J1XA 3SLIA 2JDPA 1X8EA 3U10A 1OC1A 2E6VA 5C6CA 1SCSA 1ULDA 4RQPC 1Q8PA 1IHMA 3MF9A 3S7IA 4YARA 1AXKA 3VBUA 4IEWA 4Y20A 2CNAA 4FAGA 3E1F1 5FYSA 4WM7C 1HB4A 4AI9A 1BBT1 2WZR2 3KF5A 3LPFA 1WMDA 3N9PA 1W2NA 1D0GA 2J7MA 5H9SA 5JSRA 4IEYA 1XNDA 5EFUA 2FMDA 2B46X 1X50A 5F2SA 2X05A 4WM8A 4IE0A 1QHDA 2WZR1 5F6KA 2GNTA 4N7IA 4XMAA 2C0ZA 4Y22A 2EIDA 3B93A 1W3VA 4LA3A 1WW4A 4BK5A 2D6KA 3RZMA 4MADA 5D21A 4XBQA 2C9AA 1JZ6A 3IMMA 4CUAA 1SLAA 2WNOA 1F9KA 5T5LA 1YCIA 2D3SA 2C5DA 2RS13 1XOYA 2WQZC 3WSOA 5CADA 4QB6A 1IZ3A 2A73B 2WDBA 1KDMA 4FPGA 4W65A 4Y24A 2YV8A 4CE8A 1PIV3 1AZDA 1ZBA2 2R6QA 1WA4A 1MS1A 5FY7A 4AQ2A 2BZDA 1CESA 3I54A 4S2FA 2PLV3 2VTFA 2JICA 4D7SA 4Y1XA 5A7NA 1FV2A 2YB7A 2W92A 1W2TA 4A6SA 1HN0A 4XFAA 5HBAA 5FZHA 3VDDA 2Q1FA 3I2HA 3VZMA 4YZ1A 1ZBA1 4HETA 5BNPA 3NNFA 1DQ0A 3WNLA 2P6CA 3FUOA 1WGPA 1H30A 5C3QA 3OYWB 3TEWA 4BPZA 1NOVA 1OSGA 4QPGB 4KWKA 3ZFGC 4XUNA 4YSFA 2E7AA 3V65A 1LOFC 5L9RA 5GLWA 3RI8A 2HBUA 4XDOA 3A0NA 5FO9B 2Z79A 4ZZ8A 5I0SA 1WWYA 2P1BA 3SXWA 2QBXA 4AEDA 4Y5SA 4QU1A 3RYPA 4GALA 1QJY3 3DUIA 4IV3B 3VZOA 3NMBA 1E5SA 3OUIA 3MUY1 4IGQA 3FE5A 2XOMA 1GZ9A 1RVF3 1RUG2 2WAAA 2VZUA 2NPIA 1O5LA 1RUI2 2VMHA 1WZXA 3AZZA 1WW5A 3U4SA 2OXBA 4XJUA 1LAJA 1S0FA 1UMHA 3C7HA 3UJOA 2ZJCA 3JD72 5E1RA 2QZ3A 2VL4A 2Z42A 3OEBA 4I01A 2GU9A 4U2AA 5LK5A 1JU3A 3ZXJA 1QNYA 4WVMA 2FDHA 1RUG1 1I9RA 5A1LA 4AGVA 2J1RA 2CWSA 4QPIC 1LOAA 4OUEA 2VCMA 2DBIA 1CZVA 5FY5A 1DZTA 2VOVA 4D3WA 5JOYA 1RUD3 2H6CA 2P37A 4X8NA 5FQ0B 3RZZA 4W4ZA 1M06G 1NXD1 1NY72 2C6SA 3KHBA 4HLTA 1IPSA 4QGLA 2YPJA 3ZMNA 3NJYA 4LO5B 2WLQA 1UAIA 4YZ5A 3I2FA 2ZABA 1U5XA 2WT1A 1LNSA 4JX0A 5EZWA 3JCIA 1IS3A 3AKSA 2XJUA 3GM8A 4LHLA 3ZYGA 1CAVA 4AR2A 2BBVA 1OHFA 1KD7A 3T08A 3PURA 1NY71 4C1XA 4DXSA 3K4AA 1N3OA 1WD4A 2WWJA 3LEGA 3OY8A 4BZ4A 3GZTB 2A3XA 3EBRA 4QPYA 3IDAA 2VU9A 4LO8A 2VBBA 2JX9A 3NNJA 1WCQA 4HKOA 4ISQA 5DAXA 5JOWA 3CJIB 5FUNA 5LA0A 2FDIA 3VKLA 2J22A 4L99A 3TAYA 3WDYA 3PVEA 1RYYA 1C28A 2VOKA 4META 2D3PA 3I3DA 1OF4A 5FRAA 4XFIA 3T09A 1JODA 1JHNA 3AJZA 1NQJA 4BCUA 1GP4A 3WDUA 2RG4A 3L2HA 5LY2A 3P1IA 4QHBA 2VNRA 2D6LX 5LBEA 1LR5A 5DG1A 3AMNA 5F9TA 2SLIA 3VKNA 4LIVA 4HVOA 1UW8A 1XE7A 2W2IA 4IDZA 5GJ6A 5CFCC 5FZKA 4W6XA 3QH6A 2RS52 3VHRA 1PGW2 3OPZA 4QGMA 4GJZA 4ZU5A 1OMIA 4CEWA 3WP4A 5LY1A 3O0XA 3CO2A 1C1LA 1K45A 1S0DA 4ES9A 1MS8A 2PELA 3I2DA 4MGSA 1BHGA 3J4UH 4U36A 3VBFB 3POWA 3WINE 5IVCA 4FFIA 1DYOA 2HWC3 1CVNA 3UYJA 4LJHA 1VRH3 4A44A 4ZPIA 1OA4A 2RS51 2XUEA 4IXLA 4JGYA 1POV0 5HCFA 1PGW1 4ATFA 4IE5A 3WHUA 4EZ4A 3WP5A 1JZ8A 3KQRA 4UWDA 2LUWA 1GP5A 1QJU3 5EJ1B 2B9UA 3R4SA 5FK7A 3HAGA 3WT3A 1HX6A 2W39A 2EAAA 4YVSA 4XF0A 3BN6A 2W68A 4I0BA 3RZHA 3IPVB 1Q8VA 1QXPA 5FKCA 2WBKA 1OD5A 2WO2A 2FD8A 4PDWC 2ENRA 4W8JA 3RZJA 5FTTC 2PHLA 4J25A 1J83A 2EF6A 1W2AX 4XBNA 2IXIA 3BIEA 4Q0UA 5A7PA 4NPRA 2O8OA 4QQHA 5G04L 1S2BA 1T6BX 2F4LA 3CMGA 1ULEA 3MIHA 5FPXA 3K77A 4OI2A 2KD7A 4H55A 5I0DA 4KL1A 1ONAA 4LLFA 4Y5TA 4DNYA 3SC7X 3H0OA 3GZAA 4QM8A 3I2GA 2RS12 3J9SA 4X6RB 4GXLA 3SCHA 5F3CA 1LULA 2HWF3 3OGRA 3OG2A 3OGVA 4HOOA 4Y1YA 2FDGA 3T30A 4Q2FA 1MVEA 5FIXA 3U11A 1I6XA 3SH5A 1PIV2 1W2UA 1JYXA 1VRBA 1FOD3 1VP6A 3AFGA 3K46A 4OMCA 4YG0A 4QPGC 1H0BA 5FPZA 3VL8A 4CDXA 5C5TA 1ULOA 2RS11 3JB8A 4HKWA 2PLV2 3BGAA 4ORFA 1LGBA 5T5OA 5CA6A 1N1SA 2XL9A 2JENA 3RQ0A 5L7OA 1OH3A 5K7PA 1GSLA 5KHIA 1MR5A 1V6MA 4OI4A 1PIV1 4IERA 2ZOEB 5CAZA 4IV3C 2QQJA 1ENXA 4NHYA 3WQ7A 4AEKA 2PLV1 3JUUA 3B69A 1W8HA 4DB5A 2ZX1A 3H1MA 5FXVA 1CPMA 3NO8A 4FAHA 3KHCA 1WMFA 2JDZA 2CSGA 4COZA 3ES1A 3NAPB 1AL22 1HQNA 1DGWA 2VBDA 4JQTA 3S5AA 1OLMA 1SQ4A 2ARCA 2TNFA 4PLMA 2ZHLA 3FLPA 1QJY2 3ZDVA 3M3QA 4PIXA 5I93A 4CDQB 3DPRB 3C7OA 1X9TA 1RVF2 4QKNA 4B7EA 3IKWA 4NIAA 4BMEA 5DN2A 4D6RA 1AL21 5BUVA 4LBOA 4OHZA 2XJTA 3J8F2 4M4RA 1BK0A 3RNSA 4G9SB 2J42A 1UYPA 1QJY1 2ATFA 1W6PB 1UPIA 2WA3A 2A6ZA 4RR3B 5FZDA 2ZHKA 4Q4V3 5LA2A 1JW6A 1CJDA 1RVF1 4QXBA 4BLIA 2UYBA 3MPBA 3WW3A 1H6XA 2JECA 5A70A 4M4PA 1N3QA 1IQAA 3HN1A 2AC1A 3WF4A 4D7YA 3J7NA 3J8F1 4AVBA 5JOXA 1GKBA 1X36A 4LHKA 1QU0A 1XYPA 1FMD3 2HWE1 3ZXGA 2G9ZA 1UF2C 2RDNA 4K6BA 1QF3A 3TRSB 1QY4A 3BKZA 2EICA 2ZZJA 3CJIC 4CU7A 4FCAA 4RN5A 3N3HA 2VQAA 1FXZA 1WCSA 5FMCA 1DLLA 4N43C 2R0HA 2VQUA 1DGRN 1P8JA 1AX1A 1POQA 3ASIA 3H3LA 1DFQA 3R05A 4DUXA 2Y34A 1V6OA 2C9KA 2VCBA 2G9FA 1GQPA 1VBB3 2VC9A 3IT8A 1NCRA 4UXAA 4M01A 1H4HA 4UYBA 5D8AC 1O3QA 3ELNA 1VBD2 3JBG3 5F6LB 2A75A 4B4PA 5BNNB 5J96B 5FUPA 2Q8OA 1WLDA 1JXNA 3MFCA 1SBEA 2ZCWA 4JRAA 3W20A 5C71A 2BDRA 4B1LA 2CU5A 2Y6JA 3O12A 5FREA 1U0AA 1WLWA 1AR93 5FZFA 5KWRA 1O4YA 4MUVA 1AR72 1JYWA 5FJHA 5GZDA 1ZBE3 1VBD1 2Y60A 3FHQA 3VBFC 5IVYA 1JHJA 5FMOS 2XG3A 1IS5A 2JB8A 2P3KA 3WF0A 2A3WA 1REEA 2BGCA 3QBQA 1JN2P 4QU2A 4QX5A 5JOZA 2R1BA 1Q5OA 2R32A 2XHKA 4K1YA 2F6BA 1NCQB 1VIWB 1AR71 2MNGA 3C7EA 3QLQA 5CVRA 1W28A 4ASKA 2WT2A 5IATA 3POIA 1F35A 2OT7A 1D4VB 2XHNA 4JTNA 5FZIA 4LOSA 1MS4A 4XOGA 5LEKA 3WY6A 3U4XA 1BMV2 2HWC2 2NZ9A 2Q1ZB 3SKVA 1Q56A 1MS3A 2VJXA 3ZFFA 4RYDA 1I1EA 4A4AA 1BVP1 2VZTA 1Y7BA 3ZR6A 1G6NA 2R063 2A3YA 2GN7A 3PU8A 4Q0VA 5KHKA 3TB0A 4F83A 3O1VA 4HK8A 2XWBB 2VMGA 4BIOA 3ORJA 2B42B 2VVDA 1ZZ6A 1BMV1 4MGTA 2HWC1 2HEWF 1RUJ3 4PF5A 1EP0A 2KM2A 1IKQA 2BFUL 2OUJA 2VO5A 4AI0A 3BTZA 4P00B 2UY9A 1RJ7A 4WV8A 5A6ZA 2A6VA 3HBZA 2X5IA 5E6HA 1YFWA 4KWUA 1L7LA 3KCCA 1OVPA 2ZX0A 3G6JB 3LWCA 4UT5A 4MOAA 1W8NA 1YQ5A 5KHHA 4CZSA 5F37A 3BOPA 1MQTB 2XH6A 1ZREA 2MEV1 3AYEA 1CGPA 4LTAA 3RZGA 1XRUA 2JKBA 4K21A 5C8WA 2GMMA 1QJFA 1UQXA 3D4KA 3J7MA 3MBWA 5FZ8A 1JOBA 3OBAA 5IYYA 3CZJA 4QX1A 4Y26A 3VBSC 1MZ5A 4AVSA 2LS6A 3T1MA 1FOD2 1WMEA 2FHRA 2PHWA 1H2KA 2Q4SA 1B35B 3O0VA 3POFA 1UZVA 1N47A 4XDQA 3OSDA 1FX5A 3GCWA 2VXRA 2VOTA 1AR63 3NAPC 4CEWB 1AR81 1YI9A 3NV3A 1DU3D 1MZ6A 1FOD1 2DVGA 2VH9A 2IXKA 3PMEA 4IQPA 4CDQC 3DPRC 1RXGA 2B8MA 2VNVA 1W04A 1QJZA 3B00A 1GR3A 3EYPA 3PVOA 1X82A 1XYNA 2BOIA 4XTPA 5DZEA 1AYM3 2NLRA 5BXXA 5B2GB 5KXBA 3H8RA 1DP0A 1OH4A 3M1HA 2P4EA 5F7UA 2WZPP 2AH2A 2DCZA 3D6EA 1PO23 1ZZ8A 3D0SA 3LZZA 2BPA2 3N35A 1W6QB 2WAOA 5G05L 2A70A 2YU2A 4CCKA 1G9DA 2E51A 2JJ6A 2OYZA 2BJSA 3WR0A 1VPHA 4AI2A 1MS5A 4XIOA 2Q0AA 3LF7A 4UW6A 3KLSA 3KB5A 4IEQA 2VM9A 3BALA 4N53A 4Z1VA 1LECA 5AC93 2ZMLA 3ZN6B 2XJRA 4DQAA 1BQPA 2DBNA 3CZUA 3FLTA 1IS4A 4GIQA 5LRRA 4LBQD 2VMEA 1G86A 5AVPA 2DTWA 1JBCA 5C33A 4Y33A 3MPPG 4OCTA 5J37A 3MUZ1 5F32A 2A7AA 4TTGA 1UYYA 4GWIA 4IUGA 5I8YA 1BBT3 1FPN3 2WKKA 3E6DA 3EQEA 4PBOA 4N9HA 2NYYA 4ZXKA 1NXMA 2VPVA 3KT1A 4UBGA 2EXHA 3OBTA 5FFOC 4DY5A 1W6OA 3X29B 3O1RA 4HONA 4DPNA 5BNNC 5EQUA 5DDJ2 2I2SA 1NA1B 4KU7A 5FJKA 3IDEA 5F39A 4EROA 2WZR3 2YXSA 1K42A 3SEPA 1CWPA 5FP9A 2XKOA 4XF3A 2B9VA 1S1AA 3F2ZA 3WQ1A 2IFWA 4L97A 2WN3A 4NPLA 2QDRA 5A3WA 5C9AA 1FATA 4Z07A 1UIJA 3JBG2 3M3EA 3U37A 2QQWA 4P14A 1PMJX 5J09A 3ILNA 4AOCA 3DXUA 4WM7B 3D82A 1BXHA 3I3EA 2X53S 2UYAA 5FYUA 1W9WA 2GZWA 5CKNA 1NZIA 1LHOA 1CAWA 3CEWA 3MICA 4H2AA 5A3TA 5FP3A 4AE2A 5FZCA 1ZBE2 4IEOA 3HQXA 1KFXL 1SLCA 1HV0A 2VXJA 3IPVA 3JBG1 3T4HB 3RWNA 1VMHA 2V73A 2JDHA 3RG0A 2W3JA 4XJ8A 5K0UA 5ANNA 3USUB 2WQ8A 3A23A 3EO6A 2ADEA 1VBA1 4PIZA 5FR3A 5JZGB 1FI2A 3LFMA 4QHOA 4QQ2A 5LZ6A 1U12A 2YY1A 4AF9A 2XB6C 1S0IA 5BNQA 1R1ZA 3CJXA 4SLIA 1LOBA 3VBRA 3WNMA 1J1LA 2NM1A 4N90A 5FYHA 4A45A 3PIGA 3I4IA 3VLBB 5A3PA 4YFZA 2YG0A 1KGYA 1H2NA 4FSJA 2BP6A 1QJX2 1V0AA 2Q5TA 1PK6B 2DWRA 3ETQA 3HQUA 1A78A 3ACHA 1DHKB 2VAUA 3TN91 2Y6KA 1JU4A 5A7QA 4XQDA 3GBGA 1RUJ2 1MQTC 2GNDA 3UT0A 1C1FA 2NQYA 3MHZA 5DDJ3 2Z5WA 4LITA 1QJX1 3C8XA 4GULA 3VKOA 4B7KA 2Q30A 3IM0A 2ZEWA 2DUQA 4GMP1 4QD2A 1PGSA 1V6IA 3VKMA 5A6YA 4G3YC 1QJEA 1WLTA 4IV1A 3NL1A 2E32A 4QDQA 4QHZA 2VGDA 4MXVA 4OFGA 4INDA 2BVVA 3ZFGB 1HJGA 1CX1A 2AACA 3Q8EA 4JGZA 1GU3A 1RUG3 2RV9A 4GB33 2E7TA 5FBJA 1V70A 4M3CF 2WNUA 3LPGA 2WO1A 2NMNA 1W06A 3B5LB 1O5UA 1LOGA 4BYYA 3LE0A 1OURA 2WNVA 3AKTA 4MYEA 5K9YA 3M7AA 3LQCA 3IDBB 1ACCA 1PZ8A 3AJYA 1OI6A 2QQIA 4BM8A 1H1IA 1H8VA 1NQDA 4KMQA 3KD4A 4ISRA 4YVWA 2JG8B 1C57A 1UOFA 2VUCA 4NMIA 2JXAA 1C5IA 4QX7A 2WSUA 5CFDA 4GH4B 1CX4A 2GDFA 3MEPA 2YYOA 2VZ3A 1W6PA 2GN3A 3ABZA 1XNBA 4FOQA 4RD7A 4RR3A 3ZKUA 1AR62 3E6CC 1W9SA 1OBNA 2DU1A 3FBMA 3PVNA 2V4AA 1ND3C 5FPVA 4FPOB 3AX4A 2YROA 2OX0A 3HNBM 1LU2A 4NE9A 3WEZA 2YPDA 2QQMA 2ZAHA 3FHIB 2PHFA 3H7YA 2J1EA 3HWJA 3UESA 4A6OA 5FP7A 3FUQA 2F17A 2R30A 1ZZBA 2DCJA 2I45A 4UAPA 1AR61 4BQ4A 4PI2A 1AYM2 2ZHMA 3WCRA 2QTWB 3C7FA 1KFUL 5A32B 1XE0A 4P08A 1PO22 4UI9L 3ZSJA 2OPWA 2WO3A 3H9AA 1NYWA 4XUOA 3WG1A 5IK5A 4DXTA 4AEJA 3VD4A 2GNBA 4XQ4A 3ALQA 3RDIA 1UZ0A 5EWSA 2PTMA 3A7QA 3WNXA 5C4WB 3NJZA 3SEEA 4AHXA 1QWRA 4CCJA 1UZWA 4R9CA 2CAUA 3V56A 4CSWA 2Y6LA 4PLOA 2VZPA 3T0BA 3AZXA 3EHKA 4P9WA 2HLEA 2ZKNA 1CZSA 4ATEA 4E2GA 3IBMA 1Y9MA 4MGYE 2W87A 5FO7B 1YUDA 4Z2WA 5A3MA 3ZYBA 3KZ4C 4MO3M 4B4QA 4UFLA 5IK8A 4WZFA 4L2NA 1JYVA 2CY6A 2JWPA 5F5AA 5FY4A 1FPN2 2VULA 2VTXA 4LT5A 3SISA 3OB8A 1Y3TA 1RUE2 1VBE2 3KV4A 2A6YA 2W5FA 1PZ7A 2LALA 3BOWA 3JQXA 1XPWA 3H3UA 1NX9A 3POJA 3ZIWA 4XC9A 3ZYPA 1LTEA 2R49A 2YU1A 1NCQA 1GYKA 5CFCB 1UMIA 3BI3A 3AYAA 3T4VA 3DYPA 4KQ7A 1FPN1 4A7YA 4AGGA 3NJXA 1RUE1 1VBE1 4RGGA 4E27A 2BWAA 1LHNA 2J1SA 2UURA 4W6YA 4CU6A 2YBKA 5JDBA 2VVEA 3GJBA 1K12A 3PUQA 4TN7A 3OCPA 1LOEA 3W59A 1ZA7A 2QQPA 1E5RA 2FZ1A 2GNMA 5FP4A 2DFCA 3OOXA 2JE8A 1OLRA 3ZXLA 4B8EA 4NIIA 5IT6A 4HZFA 3WCSA 1MS0A 3NVCA 1EPWA 2UWAA 2D3RA 4Q29A 1UY0A 4QAWA 3ZXEA 1XSRA 4ARXA 5EIYB 2YC4A 2WR9A 1RL3A 2PXJA 3OF1A 5EJZB 1YYNA 2YC2A 1XNAA 4OLLA 3VGIA 5C5UA 3N9MA 4YZ4A 3HIFA 2ZGNA 4MHRA 5FPUA 1G7YA 1V9U3 1H9PA 2BERA 3AMPA 3IIAA 1QMJA 1M4WA 4FFFA 5M0TA 4CDUB 4PDWB 2RR12 2JDMA 4DOUA 2WZ8A 3VZLA 4EN6B 4FTBA 1KS5A 3ZPYA 4Q26A 4RFRB 3AM2A 1PK6C 3I2JA 3B02A 2OQ7A 2QE3A 3WNOA 2ARXA 3WOGA 3NNGA 1W2OA 3N4MA 4OI0A 2NN8A 2VTXJ 5T5JA 1RUNA 1XNTA 2RR11 3CL1A 1HB1A 2OZ6A 5I8SA 5JR2A 3ZMOA 1UYXA 2W1SA 3LFIA 2GSYA 4I2OA 3UJQA 4CUBA 3VD7A 3MIGA 3P6BA 3FN9A 4UFMA 5CB7A 4UW4A 3A22A 1OXCA 1S0BA 3E97A 3FZ3A 4P9YA 3T2TA 3BU0A 2XDVA 4MZUA 2PAKA 4J6GA 4UFIA 2O0OA 2I74A 1RC6A 4K9SA 1H8TB 1UZYA 1O59A 1VALA 2WJSA 4K8FA 3VDAA 3RZKA 1UWWA 3THPA 1Z78A 1CAUB 3N36A 1AL23 4CEYC 2ZGRA 2VUDA 3AP4A 3UGFA 2JB4A 3ZDSA 4XETA 2TUNA 5LRSA 5KC5A 4MLOA 3FLRA 1HDKA 3V0BA 4XJZA 5DPNA 2JG8C 5DDJ1 3VUOA 3AYCA 3NNMA 4GB32 3I49A 4GH4C 4PQ9A 1MZFA 3WNKA 3J8F3 4XFGA 3V0AB 1LJ7A 2ZX4A 1ND2A 3S30A 5GLVA 1W6QA 1F4AA 3RMXA 5GALA 4Z2AA 2HWE3 4O7XA 5FZOA 1TMF1 2V4VA 2VOWA 4NRMA 1DYPA 1H2MA 2HEVF 1UXZA 4GB31 1PM4A 4K40A 3VHNA 5KXDA 2D93A 3EXUA 3HD8B 2R1DA 4BQWA 3LOBA 2D6PA 5C3PA 5DG2A 1IS6A 3PUHA 1HB3A 3ZN6A 2ZX2A 3VKFC 4RHV3 1S0GA 5FKBA 4CU9A 3I97A 4M00A 1NKGA 1W8FA 4OHVA 1O91A 1YQ6A 3PUSA 3ECQA 2HWB3 4IW3A 4P9GA 4BXSV 3I2IA 1ULGA 3TNQA 3GNEA 3D3AA 1NE4A 3PUIA 5C4WC 1SLLA 3NWKA 1UPSA 2BUKA 1TE1B 1CPNA 3SITA 5F8PA 4DMIA 1RUOA 4M3CB 2E53A 1UX7A 1X7NA 4BQ2A 1D0HA 1CZTA 3HMYA 1VBD3 1JUIA 4ZY9A 2HBTA 1URXA 4NAMA 3ZSLA 3RSJA 4YW2A 3VD9A 1X9PA 1W6NA 1GOFA 3BU7A 2AEZA 4N43B 4SBVA 4XW3A 3BTXA 3M8LA 4COWA 2WFF1 3H8OA 4RQPA 1OFSA 4CA9A 1AR73 1KEXA 3N7KA 4CP1A 2XWJB 1LGNA 5GZFA 1X33A 3NNLA 5D8AB 1C5HA 2ZGSA 5C8CB 3O1UA 4GJYA 5JZGC 1S4CA 4OHYA 4XAAA 4S2GA 1YFXA 2VW0A 5FCCA 5A33B 4WM7A 2AREA 1R082 1A3KA 3VD5A 1JS9A 2XKPA 5HI0A 4JRLA 1W0OA 4LBMA 3M3OA 3THDA 1VB4A 4XURA 2XJQA 4K1ZA 3AP7A 4AAPA 4CP9A 3C3VA 4XABA 1SMVA 2XVLA 3K4ZA 4XPVA 4PHZA 5ABJB 4KI5M 3IWZA 1C3HA 4YGCA 4R4ZA 1SLIA 2DTYA 4F8AA 1R081 1J59A 2K0GA 5HCAA 1CR7A 3MIFA 2RVAA 2ZZQA 4LBQB 4YGEA 1Q8OA 1YFUA 3WF3A 2ET1A 4AVTA 3GCXA 1MS9A 4L11A 4OZOA 1MACA 1NCRC 4FOYA 3ACFA 3LGRA 3WHTA 3AL6A 4FBFA 5A80A 4OQ9A 2D6MA 1IOAA 2WFPA 3B94A 3E5XA 3CU7A 1PMHX 1WMXA 2XLAA 4ZKTB 5JR7B 1EY2A 1SG3A 2V72A 1IGOA 2MEV3 2WZEA 4GZ9A 4RGAA 4YM0A 3I7DA 1LU1A 4ES8A 2QKDA 3AKRA 4HBNA 4NHMA 2ES3A 1UMZA 4KU8A 4CDUC 1I5ZA 4RS5C 5FOJB 2GALA 1SEFA 1ZX5A 2JIGA 3WF2A 1NLSA 3URFA 2VQTA 1L7QA 5A3UA 2FDFA 5CU1A 3N7MA 5B4XA 4MGIE 3FBYA 3ZYIB 1NLQA 1PNFA 1V9U2 5IWFA 1N1YA 2QZ2A 3I59A 2BGOA 4A2UA 4DINB 4YM3A 1EPZA 4KG8A 5ISLA 3ZFGA 1AR83 3N7JA 3WVJA 1LOFA 2SBAA 1D4M2 1EUUA 3AXEA 2GH8A 3VDBA 1YC61 1QOSA 2JG9B 1TEIA 2VR4A 1GZCA 1OKQA 3GYDA 1V9U1 1Q8QA 4LEJA 3ZXKA 5DZFA 5IAXA 1ZZ7A 4UF0B 2PHTA 1COV2 3OEAA 1H8TC 2VG9A 4Y4RA 1GZWB 1PO13 1XE8A 1JYIA 4DEQA 4QDSA 2CYFA 3A0KA 2AZ5A 1HW5A 1PX4A 1HV1A 1D4M1 2DYCA 3AZWA 3PTRB 4KWJA 2IXJA 4BDVB 4CDWB 4DRRA 4E4SA 3VBSB 5HCHA 4DIQA 3ON7A 4YZ2A 4AFBA 2P3JA 3ACGA 3D0JA 5GLTA 1COV1 1PZ9A 3GHNA 1NT0A 5A7WA 5ANQA 1HRV2 1CAXA 2XLFA 2XR4A 3MW3A 1YNAA 5FV3A 1GUIA 1SPPB 5LWBA 2A5ZA 4XZUG 3OJBA 2D5HA 2BV4A 3KV6A 3PMSA 4QPIA 4R9AA 1AVBA 1YRZA 4AFCA 4DO0A 4DXZA 4DZGA 3LKJA 4OMDA 4YW3A 3HPNA 4LLOA 4IEXA 4P9IA 4R8HA 1HRV1 4EV0A 2UY8A 2CTVA 1GWLA 4JC1A 2ZGTA 3NV4A 3TBDA 4CCDA 2BFUS 1H1MA 1ENSA 1XNKA 1DQ5A 1LENA 4D69A 3AK0A 4V2VA 1XB9A 3MV11 3LAGA 1STMA 3S6PA 2HWE2 3ZYFA 4GKYA 5H9QA 1OOPC 4A3XA 4NIHA 1O8SA 2O8QA 3KV9A 4P5YA 4AQ6A 4MG2A 1DBNA 1XSQA 2OUHA 3AMHA 2JDAA 2CV6A 1AUYA 2W46A 2BOJA 4RHV2 5FZ1A 2VCCA 1TQ5A 2WWUA 4LO6B 4PI0A 3UGHA 1W39A 1RINA 5FPLA 5FZAA 4NHLA 2BW8A 2HWB2 4COYA 4CXWA 1DF0A 4XFHA 5JAXA 4HFSA 4KNCA 1WKYA 2G19A 2DCYA 4RHV1 4RSUA 4XFFA 1ZM1A 4HK9A 4EJRA 4LIUA 2QVSB 1ZRIA 2P2KA 4XIKA 4UFHA 4NHKA 2HWB1 4G4FA 3FC0A 5C8CC 5CFCA 3W58A 4CXYA 1RUH2 2GH2A 1QDOA 2WN2A 5A3LA 2EXIA 4PF1A 2ADDA 4QPWA 3A21A 2PHXA 4LQRA 1S0JA 2KXLA 3SH3A 4Q4X3 3MO4A 1VBA3 4IGOA 4I0AA 5F5CA 5CYYA 1ALYA 1SCRA 3GZEA 3MYXA 4AHWA 5ABJC 4IEVA 1HRI1 1YHFA 2PYTA 1RUH1 2VW1A 3HT1A 4HANA 3VHOA 4CTEA 2WLPA 5BNOC 1HB2A 1RTVA 4L8QA 1SBDA 2BU9A 3MGUA 2GC1A 4W6WA 4EWAA 1FNZA 1ULFA 2CDPA 1UU5A 3EJKA 3IMNA 3T2PA 5IVEA 2ZMNA 2Q8EA 4QX2A 2IUWA 5H9RA 4BQYA 1JTZX 4OUMA 4EWDA 3TN93 4PDWA 2JIJA 1JH5A 2OVUA 4BISA 3POYA 2RS33 4LO4B 1QJX3 3SQOA 4DUVA 2P34A 1E5IA 2AYHA 2ERFA 4GMP3 1LHWA 4Q8LA 3K51A 4A7KA 3O14A 1GQHA 2DVDA 4O65A 5J36A 5FY1A 3T0DA 2YMZA 1PVC1 3AL5A 3PNAA 4AVCA 1F8VA 4Y20B 3VBHC 4B4RA 2GAUA 3ME2A 4YG3A 4TZDA 1YEWA 2MEV2 4K7JA 4KBZA 3DL3A 2DVAA 1TNFA 5IVFA 5LEJA 3KS7A 1EUTA 3B3QE 1UX6A 1ZYBA 1RUC2 5FYVA 3W9AA 3OYWA 5CG8A 4AVAA 4QPGA 2QNKA 3MLJA 1LEMA 1Z7S2 3FX3A 1WLCA 2IXCA 3LEMA 4AL9A 2G9GA 2JG9C 4WM8B 3I3QA 5FZGA 3BTAA 4I0WB 2HEYF 2WABA 1CAUA 4RGKA 2P6HA 1RUC1 1NAEA 4CPBA 3O1SA 3JQWA 4IV3A 1BCXA 1Z7S1 5J98B 5DMYA 3EB7A 2ZXQA 1AR82 3Q8FA 4LUKA 4OHWA 3RYRA 1Q8SA 3T2QA 4CDWC 1GLHA 5JXGA 5JPMB 5KC6A 5L9BA 2EVXA 1K5MC 2QCSB 3WNPA 1RMU2 3H8UA 3RZLA 4Z92B 5T52A 5LA1A 2VMCA 2J1TA 3RJ2X 3P3PA 1W8TA 2W08A 2ORXA 2WSVA 5IAVA 5FYZA 1AHSA 3NV1A 1E5HA 2C24A 1PO12 4LBNA 3UETA 1XXNA 3MIEA 4YM1A 5KXEA 2RMU2 4Q4Y2 2LW8A 1FYUA 5A7OA 4FQZA 1RMU1 4I09A 4D0QA 1MEC2 2RDRA 3JB4C 5FQ0A 1C8M2 3VDDB 1W8OA 1PO11 4XYXA 2KA3A 2RMU1 4BQ3A 4Q4Y1 1ND3B 3SKJE 2DCKA 4NWVA 2XQXA 4BQXA 1AXYA 1MEC1 3H50A 4NUBA 1C8M1 3GGLA 4QMAA 4GAZA 2ET7A 2K2SA 1WD3A 2FBEA 4ONUA 1DGWX 4GWNA 2WC2A 2ZAAA 2OQ6A 2VZRA 2RDQA 2CAVA 2X8KA 5F3GA 1R1A2 4EN9B 4CYDA 3MDPA 3B01A 3CJIA 3CF6E 1MZEA 2YC0A 1LRHA 3CNAA 1EAH1 1XC6A 3LCPA 4YG6A 1QXRA 3ACLA 3IAPA 4QX3A 4D8MA 5J48A 1EYBA 2B45X 4QKFA 4XQWA 4N43A 1C4RA 3RYKA 3VBOC 5A6XA 2EAKA 3O1MA 1QEXA 1ULPA 1H9WA 2QQOA 2Y0IA 3HT2A 3W5MA 1L7RA 2VMIA 4QKBA 1R1A1 1W6MB 4B29A 3ZFEC 5LBBA 1OT5A 1HQLA 3AZVA 1I5PA 1AYN2 3OPWA 4F3JA 1KRIA 2BRTA 1RUE3 1VBE3 4E4ZA 5FWJA 4EN7B 3WW1A 5JSPA 3GHMA 2WA4A 3N9NA 4YYOA 4E2QA 4E4HA 4LOTA 2O1QA 5CG9A 1GOGA 1SLBA 1Y9GA 2VW2A 2Y6HA 5C3RA 3KV5A 3HNYM 1Q3EA 1AYN1 2XUMA 3VBFA 3MZHA 3LDBA 2ZGUA 4YRDA 5EJ3A 5J7MA 4HPKB 5IFTA 2YFZA 2PMWB 1MVQA 3DEMA 5F5QA 3E5UA 1CAVB 3UKTA 2ZEZA 5ACA2 3W21A 2WT0A 1CQ9A 3ZOIA 1H4GA 4D94A 3OY8B 1BZWA 5I8TA 2E31A 3LEIA 4FP2A 2Y6FA 3U07A 1DQ2A 4Q4X2 1VBA2 4YW1A 2ZTNA 2JDKA 1LEDA 2DVBA 1GNZA 4XFCA 1ULCA 1V6NA 2ORZA 2VMDA 1JI6A 4E4DX 5DAVA 5ACA1 4WBBA 1T6GC 2RE9A 5C7GA 2Y8KA 1FNYA 3ZSKA 3PTYA 2IVJA 3LDKA 2RR13 5IVBA 4Q4X1 5A3NA 2FMYA 4NO4A 3OD0A 5KXCA 1RITA 2ZKLA 2QQUA 2BEOA 2R073 3DYOA 4Y5Z0 3VBUC 3TN92 1S55A 4BQ5A 2IXHA 4NAOA 1Y9QA 3LB9A 3PJYA 4PLNA 4AI8A 1GWMA 2BNOA 4UW5A 1UOGA 4QXHA 2RS32 2HYXA 5FXWA 4DS0A 3KQ4B 4H7LA 4GD4A 4TYSA 4ZU4A 1JYNA 3I3MA 4FPLA 5CZKA 1HKDA 3THCA 1W8UA 1DG6A 4WM8C 1KS4A 2DU0A 2CGOA 3U78A 5ERLA 3KCXA 4ZXEA 2O14A 2RS31 4CCEA 1V6JA 1UOJA 3PIJA 5FZ0A 2P3YA 5DZGA 3VBSA 3L9JT 2QUOA 4ZS2A 5C70A 4E8DA 1LESA 2FCUA 3GZUC 4YVSB 3VN4A 3H8XA 1TMF3 3RFRA 4BMBA 5E89A 2CWMA 4FPHA 4NRQA 3VHPA 1JZ4A 3NAPA 1SPPA 2HYKA 4Y4YA 5FLJA 4ZU7A 4Q0PA 4O9GA 4DXRA 4CEYB 2DUPA 2WUHA 4QDRA 2WO7A 1ZRCA 3KSCA 4CDQA 3DPRA 3R4UA 2D6NA 4DFSA 5K8SA 4XXAA 5F3EA 3LSDA 2ZACA 2C1FA 4XFBA 5L73A 3KMHA 1UD1A 2JE7A 1PM7A 1S0EA 3VDDC 4BJ0A 4C90A 2PHDA 4TLFA 4HSLA 2Y33A 4FPFA 5BNPC 4ITCA 1ENRA 1TME2 2VZ1A 5F5IA 2PAEA 1N1VA 2XJVA 5HXMA 1ODNA 2GMPA 2VZQA 5CKQA 5EYYA 4QKDA 4EQVA 4CUGA 4Q4W3 4A7ZA 1TVGA 4D6SA 5FMDA 2B39A 1O4ZA 5L7OB 5KR7A 3C2UA 1W90A 2CHHA 4AEDC 1TME1 3V64A 1YWKA 4GKXA 2WFF3 2Y64A 1NZCA 2RHPA 2VZOA 4IE7A 1U5YA 2TEPA 2ZEXA 3J7LA 4KGQA 4LMFA 1DIWA 4CU8A 3UK9A 2FDKA 1UU4A 3LIHA 4YGDA 4P9LA 2E26A 5KHJA 3O0WA 4R4XA 4D7TA 4XF4A 1QOTA 3GJAA 2WNEA 1HLCA 3H1WA 5LCWL 3WW4A 1OLME 2VD7A 3KVAA 4Q0SA 1FAYA 2LROA 3T1LA 5APAA 1RUF2 2HJIA 2C26A 3OBRA 5BNNA 2DFBA 3WF1A 2IZWA 5DQ0A 5T55A 2XVKA 5I0UA 2IVIB 1R083 4LHNA 2XQRA 3HVDA 3TNPB 2XL7A 5CNAA 2ZEYA 2YGLA 5FY9A 4HL0A 4QB2A 3MW2A 5BV6A 1DLCA 4V1PA 1RUF1 1XYOA 2BBAA 5FWEA 1GICA 5B4NA 3J26N 5FY8A 1R092 1YQCA 5LBFA 1W03A 1SLTA 4XCAA 2A6XA 4CVUA 1S0CA 2VE1A 2MPFA 3CLPA 4FOWA 2HH9A 3GF6A 1OKOA 3KGLA 4FFGA 2HWD2 2YBPA 4IGPA 2ZS6B 4IE4A 2P5BA 1R091 5IJRA 3R6SA 1JZ3A 1VBC3 4MSVA 1ZRFA 2FCTA 1C8NA 1BK1A 2VECA 1HXS2 2VQ0A 4OZXA 1G9AA 5FYBA 3HR9A 4J1WA 1UY4A 4EZHA 2HWD1 2XJPA 4LK7A 1O4TA 1V6LA 4MXWB 4TSVA 3O7OA 4BU2A 3NKGA 4AFAA 2W1UA 1NCRB 1POV3 1BVVA 4QXKA 4NWWA 5FPAA 1HXS1 3WW2A 3Q8CA 3WD5A 2OW4A 5IK7A 5FXXA 3N7LA 3B7MA 3NV2A 1OLQA 3RMYA 4EE2A 2W1QA 2E33A 3ETPA 2EXJA 1OD3A 4H3WA 4JVAA 3AB0A 4RS5B 2R16A 3U75A 2D5FA 2NMOA 3KVBA 1D4M3 1MQTA 2AEYA 2D40A 4LUMA 5F3IA 3ZO0B 5A1FA 3JZVA 3WDXA 1LB2A 2R072 2XPJA 5FZ7A 4NJ4A 3ZYJB 4JGYC 1VE0A 3ZSEA 3KGZA 4O61A 1COV3 1D7PM 1OA3A 4AW7A 5LK7B 3ILRA 1J84A 3LDRA 4AQSA 3NW4A 1MPXA 2W95A 2XXZA 1GQGA 1X8MA 1CONA 2R071 4YVSC 4CRQA 1B35A 5FMBA 3ZFFB 3WG4A 2V5YA 2OA2A 2ZGMA 4XJWA 1OVSA 5IW0A 3E6BA 1US2A 5GKAC 1HRV3 1QH6A 1LODA 4Z8BA 1U5IA 3DECA 3K48A 5LW9A 1B09A 4FPKA 4HVRA 2LRPA 1JUHA 4OULA 3N9QA 2EALA 3PJQA 1GANA 5DUVA 1FV3A 2X09A 1TMF2 5FXZA 1GMMA 1GZTA 4LNVA 1REDA 4Q0QA 2X5IB 2H0BA 4MX3A 1BJQA 5IFPA 4CCNA 3ATGA 1ND3A 4JCKA 5A6QA 3BPZA 4MV2A 2YZ4A 5HCBA 5T5PA 1F31A 4FP3A 4NRPA 4P9XA 1YJKA 4DY3A 4EYUA 4KG0A 1NG0A 3HNMA 1F4HA 3POBA 4CDXC 5LBCA 1XBFA 1J58A 5L36A 2EIBA 1W05A 1H2LA 1VAKA 1F15A 4BH9A 3SCFA 3OPTA 4K20A 3QH7A 4C1WA 1QIQA 2Q1MA 3HEIA 5A1AA 3DKQA 5GLUA 2AGSA 5JI7A 5L7OC 1RB8G 3RPQA 4AEMA 2AENA 1QXJA 4BHPA 2VZSA 4LORA 5FZEA 4WZCA 3JU9A 3MV01 4IESA 4N8MA 1OOPB 3CKHA 4OVEA 5FUIA 2PAMA 4Q4W2 3RVHA 5IVVA 1O3RA 1W6MA 2Y26A 3AC0A 2R042 3MLKA 4PIYA 4QQLA 3RRDA 5BY5A 1JMUB 3AP5A 4PT6A 4BWOA 4P02B 4LULA 4LXLA 3ZN4A 4COVA 5KBFA 5F2WA 3WG2A 1J3RA 1LCLA 3MFAA 4O9EA 5FZMA 1O3SA 1RUI1 3NQHA 1RXFA 4M3CE 2WFF2 1K3IA 2CL2A 4ASMB 4Q4W1 3JD71 5DXDA 5FPBA 2GP3A 2R041 4XZPA 1HRI3 1NA1A 1RUH3 2BQPA 2PA7A 3M2MA 1OUXA 4BA6A 2VOXA 2DURA 1YXWA 3WG3A 1H1AA 2Z2SB 2E9QA 3AMMA 1SDWA 3PLQA 4PCRA 3FJSA 1CN1A 2W47A 3N9LA 4LKFA 4XUQA 3VZKA 4CCCA 1G9CA 4HMZA 4XE9A 1EV12 3RWKX 4FVVA 4HPKA 5DUWA 3TYJA 4AHYA 3O1TA 4Y1UA 3ZSMA 3WDTA 4JV4A 2WQ4A 3OUHA 3UKVA 2XBO2 3G7DA 3ZN5A 4V2WA 2QQLA 4NN0A 5IUQA 3FWEA 4FI9A 5EPAA 4N53B 1VAMA 2EXKA 3KT4A 1EV11 1IPKA 2AUYA 2TBVA 5DABA 2H6BA 1QNWA 1ENQA 1UL9A 1PVXA 5DAWA 1SHWB 5FY0A 1ZRDA 3QCWA 3ACIA 3L2YA 2XBO1 1REFA 1YQ8A 1PVC3 3AZYA 3USUA 1KDKA 4FPJA 5BNOB 3IZOA 5LB6A 2JDYA 1SZBA 2DDUA 5TSWA 5LATA 3T3YA 1W9TA 4C91A 5JZGA 3BPSA 4L9BA 5JI9A 4XAEA 3TEXA 1W6OB 4XDPA 5JMOA 1VBC2 5FZ6A 3ZXAC 4AHZA 2DVFA 1GNHA 2R7EB 4BQ1A 5JXHA 1YFYA 4FQ4A 1W0PA 4YW5A 2B4KA 1PK6A 3O1PA 2BTVC 3TOJA 4AQTA 4F7ZA 2W52A 3CDZB 1U5ZA 1RUC3 1WA6X 3M3IA 3WP6A 2VY0A 5A3OA 5FDBA 3S57A 1AL0G 2Q8CA 4IEUA 1DQ6A 4JKKA 1Z7S3 5JIAA 5C9AB 1VBC1 3POGA 4LBJA 2EIEA 1DDLA 2WYFA 1L3JA 3VBHB 1SFYA 2ILMA 1Y43B 3R4DB 1OFNA 1AXZA 4LE3A 5T50A 1DGLA 3WX5A 3GDBA 1W99A 5E88A 4B3NA 2IC1A 1CAWB 5L9VA 4YW7A 3O5SA 4AG4A 1POV1 2D43A 3IN9A 2OZJA 3K75B 1WCUA 1UOBA 1ZNPA 1ZZ9A 2J1UA 2QQNA 3IIIA 3BTYA 4AZZA 2WIIB 4ARYA 2C4XA 5FYMA 5K0UB 1RMU3 1J3QA 5HV4A 3FMGA 3ZFFC 1O3TA 4Q8KA 2YFUA 4CEYA 5FYIA 1XU2A 5L19A 1SACA
chains in the Genus database with same CATH topology
3PVBB 5H9PA 1YIPA 3VZJA 1NLRA 3P3NA 2DF7A 2LTNA 2RMU3 3VBRB 4Q4Y3 2JG8A 2UWBA 4Q1PA 1K5MB 1UIKA 4GH4A 2D44A 3USSA 2W0XA 2Y38A 1MEC3 4WVVA 2X5IC 1C8M3 4HN0A 4FPYA 2RM23 3OGJA 4EN8B 2Y0OA 4PJYA 2BNNA 4XEZA 3S7EA 4E2SA 3WXPA 1PHMA 4E9KA 2BWCA 1OPMA 4FPCA 2EIGA 4M0HA 5JSOA 4R9BA 1EAH3 3RJRA 1SBFA 3ZX7A 1Z0HA 1RHI3 2VUJA 4X6QB 4AYUA 4KWLA 4IV1B 4R9DA 4LE4A 5A32A 1R1A3 3R0RA 4XHXA 4XBLA 5BPXA 4JGZB 3LA7A 4AWDA 2JD4A 5C4WA 4CP0A 2WNUB 3H3ZA 1LHUA 5SV5A 4BOWA 2D97A 1UCXA 1WCDJ 1F5FA 2WNVB 3M70A 4YW4A 3FFZA 1ZA4A 1V6KA 1AYN3 2GC0A 4YVWB 5AVAA 4YLZA 3WP3A 4EWEA 3SMHA 1YLLA 3VL9A 5CFDB 1JYCA 1KXGA 3VBOB 5AFEA 1DQ1A 3I8TA 1VLNA 4N9IA 4PBPA 4JDNA 5KHGA 1OQ1A 3GBWA 4IEPA 3ES4A 3ZFEB 1LKNA 4JQRA 2VVFA 1RUD2 1QQP3 4BE3A 2EA7A 4X8PA 3BIWE 3Q9OA 4NVPA 1HRI2 2IWGB 3UV9A 4BLJA 5ACA3 4IETA 1LHVA 3ZIXA 2B7YA 2LM3A 4N53C 1ASJ3 1XQNA 4DRVA 2YDEA 3AKPA 1RUD1 2ETEA 4FT8A 3NSTA 4FXKB 4QT6A 4XF9A 3B9CA 4AFMA 1DGRA 2ZX3A 1GBGA 3DKWA 4M0NA 1IPJA 4MXWA 1VR3A 1UKRA 2JEMA 1HQWA 3INAA 3AXDA 4LA2A 4NR1A 4H14A 4S2DA 1D2SA 2GMEA 4QGNA 3KM5A 5IK4A 2OIIA 1PVC2 4CDUA 4KGGA 2K9ZA 3GALA 4RS5A 4FXGB 3S0MA 1KJRA 1YJLA 5J3UA 1LGCA 4Q1RA 2ZPXA 1WW6A 3WV6A 4H7MA 1G8WA 5C9AC 4LR4A 4URTA 3VBUB 1DZRA 4I30A 4HVQA 4AI3A 2WL1A 1QDCA 4XTMA 2HKXA 5FOBB 3QOPA 1AJKA 3SCGA 1VRH2 3MF6A 4MH0E 5T54A 2QJVA 2ZGLA 1DZQA 2PFWA 4XHBA 5I91A 4UBHA 4WVWA 5K0UC 1H8TA 1ZVFA 2WS93 1G9BA 2XGXA 1QJU2 5GZEA 4AFDA 2P3IA 2ARBA 2DUOA 3ILFA 2CGNA 4Y22B 4AI1A 1VRH1 2Z69A 1E57A 3VBRC 4MGZE 2UU8A 3OGGA 1QJU1 3AFKA 4FOVA 2MHFA 3V0AA 1QKQA 1RIRA 1CD3G 2PQQA 1BKZA 1KJLA 4I3GA 1A6CA 1OQDA 1TME3 4XMIA 5T3NA 2GC2A 1NE6A 1G9FA 2GC3A 2A6WA 3BODA 4R52A 3AMQA 2HWF2 1KQRA 1WW7A 4LBLA 3WUDA 1BEV3 5FLIA 4P5HA 5JVVA 2E7QA 2ZA9A 2RM22 5BNPB 4FTEA 4IV1C 2QFEA 4XJAA 1YIFA 3MW4A 4AXOA 1PMIA 1OOPA 1N3PA 4HT1T 5FBZA 3VZNA 1VB2A 3SNMA 2D98A 2HWF1 4JGZC 2JE9A 3NKTA 4COUA 3AKQA 1EAH2 5GLZA 2WNUC 4MGKE 4YM2A 2RM21 1D2QA 1RHI2 4AEDB 2XJSA 2WNVC 4M3CA 4Z82A 4GQ7A 4P9JA 1PNGA 3RS6A 2IFRA 1RUF3 2YGMA 1O7FA 5DUUA 4YVWC 4Y1ZA 3ZXDA 3V0BB 2OPKA 1APNA 3AP9A 1ZZCA 1N1TA 2VNOA 5CFDC 2ZGOA 1RHI1 1LOCA 1QGLA 2CGPA 3FFQA 4RR3C 1KITA 5E16A 1ND2B 5FMOL 3ST7A 3BB6A 1I3HA 4TWTA 1J3PA 5D8AA 4WVMB 4LO7A 4IL7A 3UL2A 5C8CA 1AJOA 5I0TA 1R093 5A33A 2ZHNA 2H0VA 3OD4A 1QOOA 5FAXA 2VNGA 3VV1A 2DV9A 3AYDA 4JTOA 1YI7A 4Q4V2 4GA9A 2HWD3 2BVBA 4Y1VA 5GM0A 5ABJA 3H1YA 3GBFA 5BNOA 1GFF2 2ZBJA 1HXS3 1QQP2 3A4UA 4LBQA 1FMD2 4Q27A 4I3PA 4Q4V1 5JMCA 4XXPA 1V00A 4RFT0 2YHJA 1F5JA 1ASJ2 1IKPA 4C0HA 2ZGKA 1S2KA 2RJKA 2DCTA 3KCYA 1QQP1 2ZGQA 3BCWA 1WBFA 1AF9A 1FMD1 4IEZA 1W6NB 5SV8A 2WINB 4N7UA 3ZVXA 1CJPA 5JLVA 1TNRA 4RQPB 4JDOA 1VBB2 1ASJ1 2YUEA 2WWSA 5E8AA 5JWPA 3LA3A 4MVTA 4L92A 4XILA 5EXOA 1XU1A 3VBHA 1UU6A 5AFBA 2D7FA 2PHRA 5GZCA 3LOIA 4KH9A 1AR92 3ZYRA 3AP6A 1NCQC 4FO9A 1VBB1 2X29A 3WLUA 2RJLA 3UKNA 4UW3A 2N7GA 2FZ2A 4QQPA 1RJ8A 2JG9A 4GMP0 4HSJA 1A8MA 4XJ9A 4QQOA 1AR91 2BYVE 1UZZA 1QH7A 2D6OX 4I02A 3TWIA 1UKGA 2BNMA 4JGYB 4JDMA 1UN1A 3MIBA 3LSEA 1GZWA 1RGSA 1ZBA3 1ZBE1 3DV8A 4QM9A 1A8DA 4YGBA 4CDWA 4OI1A 3ENRA 1K5MA 4GWMA 3DN7A 3ZXFA 2B5HA 4EN0A 3B9IA 5CIRA 2QDNA 3E5QA 1SFNA 2UWCA 5F1RA 3IDCB 4RA0A 3WDVA 2P17A 2R062 2WS92 5EV7A 4AVVA 5JCTA 3LA2A 4S2HA 1CIWA 3M3CA 4ASLA 1FT9A 2VUAA 4AGRA 4FTSA 5FLHA 3RI9A 1J1TA 1DYKA 2ZGPA 2XVGA 3D5OA 3OTFA 4NOTA 4OUSA 1Q43A 1ZRRA 2R061 2WS91 3I59B 2A71A 1VAVA 2R0FA 3M4FA 3SHRA 5EYXA 1OA2A 1RUJ1 1AX2A 4C0BA 4CDXB 1RUI3 2FQPA 4OHXA 4AK3A 2I07B 1B35C 1JOJA 5GZGA 3WUCA 4CEWC 5DUXA 3JD73 5I0RA 1VJ2A 1BEV2 1F2NA 2R043 2IXLA 3ROUA 1OPOA 1DQ4A 4HKLA 3PHMA 5JPNB 2XLGA 1AX0A 2AR6A 3WZ1A 3VBOA 3SH4A 1GV9A 1OQEA 1BEV1 4CP2A 1CAXB 3ZFEA 4JAAA 4YZ3A 2G4IA 1YO8A 4BIFA 4YNIA 2PN5A 1ND2C 3MLLA 4KBBA 4K3UA 4YFWA 2PHUA 3U0ZA 4LBKA 4QPIB 1EV13 3D8CA 5JIUA 3QACA 1WUVA 2XBO3 1WBLA 4FPEA 2ZMKA 3KT7A 4HN1A 3DF0A 3DGTA 3APBA 2E63A 3WDWA 3QD6A 3THTA 2V09A 4RL7A 4XF1A 1AYM1 3POSA 5HXVA 3H7JA 1PGL2 5CBLA 1PO21 4WVZA 5AC92 5BYNA 3MIDA 3WQ0A 1WCKA 2F4PA 2RS53 1NA1C 1BYHA 5FO8B 1PGL1 3MI8A 1XNCA 1HIXA 5AC91 1BBT2 5D1IA 4J1XA 3SLIA 3U10A 1X8EA 2E6VA 5C6CA 1SCSA 1ULDA 4RQPC 1Q8PA 1IHMA 3MF9A 3S7IA 4YARA 1AXKA 3VBUA 4IEWA 4Y20A 2CNAA 4FAGA 4WM7C 1BBT1 2WZR2 1WMDA 1D0GA 5H9SA 5JSRA 4IEYA 1XNDA 5EFUA 2FMDA 2B46X 1X50A 4WM8A 1QHDA 2WZR1 5F6KA 2GNTA 4N7IA 4XMAA 2C0ZA 4Y22A 3B93A 4LA3A 1WW4A 2D6KA 4XBQA 2C9AA 1SLAA 1F9KA 5T5LA 1YCIA 2D3SA 2C5DA 2RS13 2WQZC 5CADA 1IZ3A 2A73B 1KDMA 4FPGA 4W65A 4Y24A 2YV8A 1PIV3 1AZDA 1ZBA2 2R6QA 1WA4A 1MS1A 4AQ2A 4S2FA 1CESA 3I54A 2PLV3 2JICA 4D7SA 4Y1XA 1FV2A 4XFAA 5HBAA 3VDDA 3VZMA 4YZ1A 5BNPA 1ZBA1 4HETA 1DQ0A 3FUOA 1WGPA 1H30A 3OYWB 4BPZA 1NOVA 1OSGA 4QPGB 4KWKA 3ZFGC 4YSFA 2E7AA 3V65A 1LOFC 5GLWA 3RI8A 3A0NA 5FO9B 2Z79A 5I0SA 3SXWA 4AEDA 3RYPA 4GALA 1QJY3 3DUIA 4IV3B 3VZOA 3FE5A 1GZ9A 1RVF3 1RUG2 2NPIA 1O5LA 1RUI2 2VMHA 3AZZA 1WW5A 4XJUA 1S0FA 3UJOA 2ZJCA 3JD72 5E1RA 2QZ3A 2Z42A 4I01A 2GU9A 4U2AA 5LK5A 3ZXJA 1QNYA 4WVMA 1RUG1 1I9RA 4AGVA 2CWSA 4QPIC 1LOAA 4D3WA 1DZTA 2VOVA 5JOYA 1RUD3 2H6CA 2P37A 4X8NA 5FQ0B 3RZZA 1M06G 1NXD1 1NY72 4HLTA 4QGLA 2YPJA 3ZMNA 4LO5B 2WLQA 1UAIA 4YZ5A 2ZABA 1U5XA 2WT1A 5EZWA 3JCIA 1IS3A 3AKSA 2XJUA 4LHLA 3ZYGA 2BBVA 1CAVA 1OHFA 1KD7A 1NY71 4C1XA 1N3OA 1WD4A 3OY8A 4BZ4A 3GZTB 2A3XA 3EBRA 4QPYA 4LO8A 2VU9A 2QQPA 2JX9A 4ISQA 4HKOA 5JOWA 3CJIB 3VKLA 4L99A 3TAYA 3WDYA 3PVEA 1C28A 2VOKA 4META 2D3PA 5FRAA 4XFIA 1JHNA 3AJZA 1NQJA 4BCUA 3WDUA 3L2HA 4QHBA 2VNRA 2D6LX 1LR5A 5DG1A 3AMNA 5F9TA 2SLIA 3VKNA 4HVOA 1UW8A 1XE7A 5GJ6A 5CFCC 4W6XA 3QH6A 2RS52 3VHRA 1PGW2 3OPZA 4QGMA 4ZU5A 1OMIA 4CEWA 3WP4A 3O0XA 3CO2A 1C1LA 1S0DA 4ES9A 1MS8A 2PELA 3I2DA 4U36A 3J4UH 3VBFB 3WINE 3POWA 2HWC3 1CVNA 1VRH3 1OA4A 2RS51 4IXLA 4JGYA 4ATFA 1POV0 5HCFA 1PGW1 3WHUA 3WP5A 3KQRA 2LUWA 1QJU3 2B9UA 3R4SA 3HAGA 3WT3A 1HX6A 2W39A 2EAAA 4YVSA 4XF0A 2W68A 4I0BA 3IPVB 1Q8VA 1QXPA 1OD5A 4PDWC 2ENRA 5FTTC 2PHLA 2EF6A 4XBNA 2IXIA 4Q0UA 4NPRA 2O8OA 4QQHA 1S2BA 3MIHA 5FPXA 1ULEA 4OI2A 4H55A 4KL1A 1ONAA 4LLFA 4DNYA 3H0OA 3GZAA 4QM8A 2RS12 3J9SA 4X6RB 4GXLA 3SCHA 1LULA 2HWF3 4Y1YA 4Q2FA 1MVEA 3U11A 1I6XA 3SH5A 1PIV2 1W2UA 1FOD3 1VP6A 3AFGA 4YG0A 4CDXA 5FPZA 4QPGC 1H0BA 3VL8A 2RS11 3JB8A 4HKWA 2PLV2 4ORFA 1LGBA 5T5OA 5CA6A 1N1SA 2XL9A 2JENA 3RQ0A 5L7OA 5K7PA 1GSLA 5KHIA 1MR5A 1V6MA 4OI4A 1PIV1 4IERA 2ZOEB 5CAZA 4IV3C 3WQ7A 1ENXA 4AEKA 2PLV1 3JUUA 3B69A 4DB5A 2ZX1A 3H1MA 1CPMA 3NO8A 4FAHA 1WMFA 2JDZA 4COZA 3ES1A 3NAPB 1AL22 1HQNA 1DGWA 1SQ4A 2TNFA 4PLMA 2ZHLA 3FLPA 1QJY2 3M3QA 4PIXA 5I93A 4CDQB 3DPRB 1RVF2 4B7EA 3IKWA 4BMEA 5BUVA 1AL21 4LBOA 4OHZA 2XJTA 3J8F2 3RNSA 4G9SB 2WA3A 1QJY1 2ATFA 1W6PB 1UPIA 2A6ZA 4RR3B 2ZHKA 4Q4V3 1JW6A 1CJDA 1RVF1 4BLIA 2UYBA 3MPBA 3WW3A 2JECA 1N3QA 1IQAA 3HN1A 4D7YA 5JOXA 3J8F1 4AVBA 1GKBA 1X36A 4LHKA 1QU0A 1XYPA 1FMD3 2HWE1 3ZXGA 1UF2C 4K6BA 3TRSB 1QF3A 1QY4A 2ZZJA 3CJIC 4FCAA 3N3HA 2VQAA 1FXZA 1WCSA 1DLLA 4N43C 2R0HA 1DGRN 1AX1A 3ASIA 3R05A 1DFQA 1V6OA 2G9FA 1VBB3 3IT8A 4UXAA 1NCRA 4M01A 1H4HA 5D8AC 1O3QA 3ELNA 1VBD2 3JBG3 5F6LB 2A75A 4B4PA 5BNNB 5J96B 2Q8OA 1WLDA 1JXNA 3MFCA 1SBEA 2ZCWA 4JRAA 3O12A 5FREA 1U0AA 1WLWA 1AR93 5KWRA 1O4YA 4MUVA 1AR72 5GZDA 1ZBE3 1VBD1 3VBFC 5FMOS 2XG3A 1IS5A 2P3KA 2A3WA 1REEA 2BGCA 3QBQA 1JN2P 4QU2A 4QX5A 5JOZA 2R1BA 2XHKA 1Q5OA 2R32A 4K1YA 2F6BA 1NCQB 1VIWB 1AR71 2MNGA 3QLQA 5CVRA 2WT2A 1D4VB 4JTNA 1MS4A 4XOGA 5LEKA 3WY6A 3U4XA 1BMV2 2HWC2 2NZ9A 2Q1ZB 1Q56A 1MS3A 3ZFFA 1I1EA 1BVP1 1Y7BA 1G6NA 2R063 2A3YA 2GN7A 4Q0VA 5KHKA 3TB0A 4F83A 4HK8A 2XWBB 2VMGA 4BIOA 2B42B 2VVDA 1ZZ6A 1BMV1 2HWC1 2HEWF 1RUJ3 4PF5A 1EP0A 2KM2A 1IKQA 2BFUL 2OUJA 4AI0A 2UY9A 1RJ7A 4WV8A 2A6VA 3HBZA 2X5IA 1YFWA 3KCCA 3LWCA 2ZX0A 3G6JB 5KHHA 4CZSA 3BOPA 1MQTB 2XH6A 1ZREA 2MEV1 3AYEA 1CGPA 4LTAA 1XRUA 2JKBA 4K21A 5C8WA 2GMMA 3D4KA 4Y26A 3VBSC 1MZ5A 4AVSA 3T1MA 1FOD2 1WMEA 2FHRA 2PHWA 1H2KA 2Q4SA 1B35B 3O0VA 1N47A 4XDQA 1FX5A 2VXRA 4CEWB 1AR63 3NAPC 1AR81 1YI9A 3NV3A 1DU3D 1MZ6A 1FOD1 2DVGA 2VH9A 2IXKA 3PMEA 4IQPA 4CDQC 3DPRC 2B8MA 1QJZA 3B00A 1GR3A 3PVOA 1X82A 1XYNA 4XTPA 5KXBA 5DZEA 1AYM3 2NLRA 5BXXA 5B2GB 3M1HA 2WZPP 2AH2A 2DCZA 3D6EA 1PO23 1ZZ8A 3D0SA 3LZZA 2BPA2 3N35A 1W6QB 2A70A 1G9DA 2E51A 2JJ6A 2OYZA 3WR0A 4AI2A 1MS5A 4XIOA 2Q0AA 4UW6A 3KLSA 3KB5A 4IEQA 3BALA 4N53A 4Z1VA 1LECA 5AC93 2ZMLA 3ZN6B 2XJRA 4DQAA 1BQPA 3FLTA 1IS4A 4GIQA 5LRRA 4LBQD 5AVPA 1G86A 2DTWA 1JBCA 5C33A 3MPPG 5J37A 2A7AA 5I8YA 1BBT3 1FPN3 2WKKA 3E6DA 3EQEA 4PBOA 4N9HA 2NYYA 4ZXKA 1NXMA 2VPVA 3KT1A 4UBGA 2EXHA 3OBTA 5FFOC 4DY5A 1W6OA 3X29B 4DPNA 5BNNC 2I2SA 1NA1B 4KU7A 3IDEA 4EROA 2WZR3 2YXSA 2XKOA 4XF3A 1S1AA 3WQ1A 2IFWA 4L97A 5C9AA 2QDRA 1FATA 4Z07A 1UIJA 3JBG2 3M3EA 4P14A 5J09A 3ILNA 4WM7B 3D82A 1BXHA 2X53S 2UYAA 2GZWA 3CEWA 1LHOA 1CAWA 3MICA 4AE2A 1ZBE2 4IEOA 3HQXA 1KFXL 1SLCA 1HV0A 3IPVA 3JBG1 3RWNA 2V73A 3RG0A 4XJ8A 5K0UA 3USUB 3EO6A 1VBA1 4PIZA 5JZGB 1FI2A 4QQ2A 1U12A 2YY1A 4AF9A 2XB6C 1S0IA 5BNQA 1R1ZA 3CJXA 4SLIA 1LOBA 3VBRA 1J1LA 2NM1A 4N90A 3I4IA 3VLBB 4YFZA 4FSJA 1H2NA 1QJX2 2Q5TA 1PK6B 2DWRA 3ETQA 1A78A 1DHKB 3TN91 4XQDA 3GBGA 1RUJ2 1MQTC 2GNDA 1C1FA 2NQYA 5DDJ3 2Z5WA 1QJX1 4GULA 3VKOA 4B7KA 2Q30A 3IM0A 4QD2A 2DUQA 4GMP1 1PGSA 1V6IA 3VKMA 4G3YC 1WLTA 4IV1A 3NL1A 2VGDA 4MXVA 4OFGA 4INDA 2BVVA 3ZFGB 4JGZA 1RUG3 4GB33 2E7TA 1V70A 4M3CF 2WNUA 2NMNA 3B5LB 4BYYA 1O5UA 1LOGA 2WNVA 3AKTA 4MYEA 5K9YA 3M7AA 3IDBB 1PZ8A 3AJYA 1OI6A 4BM8A 1H1IA 1H8VA 1NQDA 3KD4A 4ISRA 4YVWA 2JG8B 1C57A 2JXAA 1C5IA 2WSUA 5CFDA 4GH4B 1CX4A 2GDFA 3MEPA 2YYOA 1W6PA 2GN3A 4FOQA 1XNBA 4RD7A 4RR3A 3E6CC 1AR62 3FBMA 2DU1A 3PVNA 1ND3C 4FPOB 3AX4A 2YROA 1LU2A 2ZAHA 3FHIB 2PHFA 3H7YA 3HWJA 3FUQA 2R30A 1ZZBA 2DCJA 2I45A 1AR61 1AYM2 2ZHMA 3WCRA 1KFUL 5A32B 1PO22 3ZSJA 3H9AA 1NYWA 3WG1A 5IK5A 4AEJA 2GNBA 4XQ4A 3ALQA 3RDIA 5EWSA 2PTMA 3WNXA 5C4WB 3NJZA 4AHXA 1QWRA 4R9CA 2CAUA 3V56A 4PLOA 3AZXA 3EHKA 4P9WA 2ZKNA 4ATEA 4E2GA 3IBMA 4MGYE 5FO7B 1YUDA 4Z2WA 5A3MA 3KZ4C 4B4QA 5IK8A 4WZFA 4L2NA 2CY6A 1FPN2 2VULA 4LT5A 3SISA 1Y3TA 1RUE2 1VBE2 2A6YA 1PZ7A 2LALA 3BOWA 3JQXA 3H3UA 3ZYPA 3ZIWA 1LTEA 2R49A 1NCQA 1GYKA 5CFCB 3AYAA 4KQ7A 1FPN1 4A7YA 4AGGA 1RUE1 1VBE1 4RGGA 4E27A 2BWAA 1LHNA 2UURA