3EBRA

Crystal structure of an rmlc-like cupin protein (reut_a0381) from ralstonia eutropha jmp134 at 2.60 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
MLFESINTGCLDGNDTPWMPFAPYSNDVMVKYFKIDPVRGETITLLKAPAGMEMPRHHHTGTVIVYTVQGSWRYKEHDWVAHAGSVVYETASTRHTPQSAYAEGPDIITFNIVAGELLYLDDKDNIIAVENWKTSMDRYLNYCKAHGIRPKDLSTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized RmlC-like cupin
publication title Crystal structure of RmlC-like cupin with unknown function (YP_294607.1) from RALSTONIA EUTROPHA JMP134 at 2.60 A resolution
rcsb
source organism Ralstonia eutropha jmp134
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ebrA00
3S0MA 5KHJA 2OZJA 1ZVFA 3H1MA 3ROUA 1EYBA 2OZ6A 4AQ2A 2DCTA 4L11A 4OFGA 3SXWA 3BB6A 3I7DA 4MX3A 3KGZA 4DINB 2CGPA 5JCTA 3RYRA 2KXLA 1O5UA 1RL3A 3HIFA 4EWAA 3IDCB 2PQQA 4Q0QA 2QCSB 1YWKA 4OLLA 3EQEA 2E9QA 4J1XA 2D40A 4J1WA 3FE5A 4QM8A 3R6SA 4MGZE 2IXKA 3GBFA 4X6RB 4Q0UA 5I8YA 3I59B 2V09A 3CLPA 4CYDA 4QMAA 3UKTA 1O5LA 4PIYA 4IEVA 4Z82A 4B29A 1VP6A 5JSPA 4ZU4A 2XLFA 4O9GA 4JVAA 4AVAA 4IETA 5E16A 1EY2A 4LULA 5FLJA 3M3IA 3CO2A 3QACA 5FCCA 2OPKA 3E6BA 5AVPA 1WGPA 3HT2A 2MHFA 2UYAA 3C3VA 3WW4A 4WZCA 1ZZ7A 5BV6A 5C8WA 1CAXB 4XETA 4IEWA 5KHIA 1VR3A 2QVSB 2O1QA 1SEFA 2XHKA 3HT1A 5BXXA 3H8UA 4IEZA 4ORFA 4E2GA 4XF0A 4FAGA 3SCGA 1J3PA 5I0UA 3BU7A 5T3NA 3UKNA 2QDRA 1UPIA 3ZDSA 3VHRA 1FI2A 4LA2A 3U0ZA 2VPVA 4MUVA 4LA3A 1CAWA 3RDIA 1YFXA 3D0JA 1ZRRA 5E1RA 2IC1A 3NW4A 2XL9A 2WFPA 4LEJA 3E6DA 4MGIE 2XLGA 3OGJA 5I0RA 3PVBB 4PJYA 4IEQA 4QGMA 2MPFA 3PNAA 2FMYA 4HBNA 2XLAA 1UIKA 2BNNA 4BHPA 1DZTA 3H1WA 5EZWA 1XRUA 2I45A 3SMHA 2F4PA 3EO6A 1I6XA 1WA4A 3S7EA 1X8EA 4F7ZA 3RZZA 4KWLA 4IEXA 1ZREA 1VJ2A 3TNQA 4I0AA 2XGXA 2IXHA 2H6BA 4HLTA 5JSOA 4XFAA 4LUMA 3RYPA 1Q5OA 3IIAA 1UIJA 1PM7A 3RNSA 4YYOA 1CGPA 1H1MA 4MZUA 4JV4A 4JTNA 3E5QA 4P9GA 1J3QA 1UD1A 3LAGA 4BIFA 1ZX5A 1YFUA 4QM9A 1GQGA 3LA3A 1QXJA 5KHKA 1OI6A 5KBFA 3FHIB 2CV6A 2HKXA 2BGCA 4H7LA 3E5XA 2ZKLA 1Q43A 4EWDA 1YLLA 2CAUA 2FQPA 2Q1ZB 4QX5A 2GAUA 3I54A 2PAKA 2GU9A 4UBHA 3FFQA 4XFIA 2XKPA 3G7DA 3USSA 2EA7A 5I91A 2PYTA 2XKOA 4IEYA 3H3ZA 3DKWA 4I0BA 2QJVA 4LLOA 5LEJA 3BALA 5BY5A 4HMZA 1LR5A 3H3UA 3DV8A 1X8MA 4YARA 1V70A 5CVRA 4I2OA 5KHHA 3BPZA 3ETQA 3M70A 1DGWA 1Y3TA 3D82A 1IPJA 4Z07A 1ZZ9A 3TNPB 4HVRA 3OF1A 1ZZ8A 2B5HA 4LTAA 3KSCA 4K8FA 4ONUA 3MPBA 5J7MA 1NZCA 1RTVA 5FQ0B 4YSFA 5JAXA 3E5UA 2K0GA 3CF6E 2B9UA 1ZZ6A 2HJIA 3IBMA 4QXKA 2BEOA 4X6QB 4PIZA 2BNMA 4HSJA 5JR7B 2BYVE 3FJSA 5BPXA 1H1IA 1NYWA 3RYKA 1CX4A 1DGRA 3BCWA 3H7YA 2VQAA 4R52A 1YFWA 1SQ4A 4Q0PA 4AVBA 3H9AA 1RUOA 4I09A 4XEZA 3LOIA 4XFGA 5D1IA 3L2HA 1QWRA 2PHLA 3EJKA 3CJXA 4AVCA 3KCCA 4HSLA 3UKVA 1UW8A 3IDBB 4D7SA 3CL1A 4D7TA 4HVQA 1OMIA 5FPXA 1CAVB 2D5FA 4XFBA 2PAEA 4AXOA 2PAMA 5I8TA 3LA7A 1G6NA 3SCFA 1QXRA 1NE4A 2UYBA 1CAUB 4QGNA 3E6CC 4HN1A 4E2QA 2PA7A 2ZCWA 4WVZA 3FWEA 3NJZA 2D5HA 3NSTA 4TLFA 1X82A 4Q29A 3ES4A 2K9ZA 1SFNA 2N7GA 2WC2A 3DN7A 1O4TA 4EV0A 1LKNA 3LZZA 3GYDA 5BUVA 1XE8A 5FPZA 5I0TA 1O3SA 4O9EA 2OYZA 3U10A 2ET7A 3ES1A 1X7NA 3SHRA 2BNOA 3H7JA 4WBBA 3RPQA 4HN0A 4XFCA 4GULA 4I02A 1EPZA 1DZRA 4IEUA 4HZFA 2Z2SB 2CAVA 4BH9A 4I3PA 1ZRFA 2UY8A 4PIXA 4N9HA 4FAHA 3KGLA 3I59A 1YFYA 4ZU7A 2B8MA 2PHDA 2O8QA 3OCPA 1NE6A 3ST7A 4YNIA 4IEPA 1LB2A 2GC3A 4IEOA 1O7FA 4NVPA 5F1RA 3HQXA 2Q30A 3FX3A 4ZU5A 2GZWA 4UXAA 4IERA 4KU8A 1ZZBA 4E2SA 3ELNA 4EWEA 1EP0A 4R8HA 3WW1A 1L3JA 5J3UA 1LRHA 3WW2A 1J58A 5J48A 4KWKA 4HVOA 1CAXA 5FQ0A 1RUNA 5CADA 4YRDA 3MZHA 1JUHA 2GH2A 2PFWA 1NXMA 4F8AA 1RC6A 5C6CA 3O14A 4FBFA 4XF1A 3EBRA 5FLIA 5K8SA 1ZNPA 3DL3A 3H1YA 3D0SA 4MGKE 5I93A 2D93A 3ACLA 5I0SA 4Q0VA 4AQ6A 1J3RA 2XL7A 2PTMA 2GC0A 1Q3EA 3U11A 3LWCA 1ZRDA 4RD7A 3B02A 2IXCA 2P17A 1J59A 2GC1A 3S7IA 1O3QA 2EAAA 4QGLA 1I5ZA 4XF4A 4KU7A 4Q0SA 4BYYA 3N4MA 3E97A 5FLHA 1UCXA 4JTOA 2H6CA 3OD0A 2C0ZA 1WLTA 1IPKA 5I8SA 1FXZA 3IWZA 2H0VA 1QY4A 2QNKA 1CAVA 4MGYE 2IXJA 3WW3A 3FZ3A 4XFHA 2VECA 3KMHA 3JZVA 2Z69A 4UBGA 1Y9QA 5LRSA 1FT9A 1CAUA 1O3TA 1YHFA 4A2UA 5KHGA 5CU1A 1OD5A 3QOPA 4KWJA 4XFFA 2IXLA 2Q4SA 2IXIA 2MNGA 5HI0A 4MH0E 2Q0AA 3EHKA 3MYXA 1CAWB 4FT8A 4I01A 3NVCA 3LA2A 4KL1A 4MV2A 3CEWA 4N9IA 3NL1A 1XE7A 2OA2A 1TQ5A 1YUDA 3SCHA 5LRRA 4EROA 5JSRA 3NKTA 3H50A 4IESA 4LUKA 2ATFA 2Y0OA 2ETEA 5FDBA 1J1LA 3PLQA 4XF3A 1HW5A 2GC2A 3OTFA 2UY9A 1OFNA 4XF9A 1U12A 5EFUA 5LEKA 1ZRCA 4L2NA 3MDPA 2ET1A 1GQHA 1O3RA 1ZZCA 2EVXA 1PMIA 4META 1RGSA
chains in the Genus database with same CATH superfamily
3S0MA 1NCQC 4FP2A 4P9WA 2DU1A 1SPPB 1TNRA 2VXJA 4HXCA 5C70A 2W68A 3T0BA 2R16A 5CAZA 1C5HA 3LDKA 2VBDA 4GWJA 2AACA 2B4KA 4MVTA 4TN7A 3SXWA 2HWB2 4IE5A 3MFCA 1ENSA 4Y20B 3BB6A 3LFIA 4NIHA 2VH9A 3DECA 3SQOA 3MUY1 4IUGA 1GQPA 2BBAA 3WZ1A 3AL5A 3LSEA 5T55A 2F4LA 1R081 2WO2A 1GP4A 1O5UA 4B1MA 1FPN1 1W2NA 2ENRA 3CQOA 5DAWA 3LCPA 1WW5A 2HYXA 3VZLA 4UWDA 3AFKA 2W1QA 1W8UA 3OSDA 3I3QA 1QJEA 5IFTA 4J1XA 4CDQB 5BNQA 4OZOA 1UMHA 1XXNA 5C8CC 4FCAA 4D6RA 3UGGA 3FE5A 4NHLA 3PU8A 2E26A 2QQVA 1DCSA 4JGYA 2WZEA 1FYUA 3KHBA 4X8PA 5T5PA 3V0BA 1PVC2 1ST8A 1BK1A 5FZAA 1VLNA 3KV9A 4Q0UA 5A6ZA 3I59B 2A75A 3IPVB 1JZ7A 5J1XA 4XOGA 3W5NA 3UKTA 1PX4A 1AX0A 4JCKA 3FL7A 4Y1ZA 4P5YA 3U4XA 2QFEA 4DXRA 2PHFA 1XNTA 2VMDA 4O9GA 4IV1A 2WDBA 4R9DA 5IVFA 1W2UA 4LK6A 4ZS2A 1WW6A 5E16A 4BQYA 1DYKA 3NNJA 4RGGA 4DB5A 2JG9B 3OBTA 1YJLA 5IW0A 4DMIA 1JYTA 5KC5A 4ISRA 2OPKA 3E6BA 1H9WA 3KZ4C 3KQ4B 3M2MA 3NRUA 5EQUA 5AVPA 4OI1A 3WUCA 5LK7B 4RS5A 4L8QA 2UYAA 4QX0A 3I2GA 2O14A 3BKZA 4GMP1 4LOSA 3KT4A 1A6CA 4Y33A 5DQ0A 1CAXB 3AZYA 1NQDA 4PI2A 4GWMA 1AR81 4R9AA 5GLUA 1UL9A 2JJ6A 2Y8KA 2JKXA 2XHKA 3D3AA 4CCCA 3A23A 4QPWA 3ZXLA 4JHTA 3S57A 2ZMKA 3NKGA 2ZGMA 5K9YA 4RQPC 4XF0A 2ZGPA 3KV5A 3NJYA 2RS53 3N7MA 2WNUC 1PMJX 3NJXA 5T52A 3UKNA 4XCBA 2VMCA 5FPAA 1IS3A 3C7GA 2UURA 4GB33 4W6YA 4BJ0A 3ZDSA 3VHRA 4P00B 2BFUS 4LA2A 4P9LA 1J1TA 3JQWA 2XOMA 4LA3A 4BK4A 5C4WC 3TEZA 2IC1A 3NW4A 1Q8OA 2ZHKA 2VXRA 1RJ8A 2LALA 2ZBJA 1ND3B 5GKAC 2IWGB 5FY1A 5SV5A 4Y1VA 3QLQA 2XLGA 5C3QA 3OGJA 2ZGOA 4FP3A 1A3KA 3U07A 4JX0A 4IEQA 5L7OC 2QQIA 1AR82 2ZTNA 1G7YA 1LHVA 1OKOA 5JMCA 2WZ8A 1UIKA 3QH6A 5DAPA 4HANA 4BHPA 4LIVA 1RIRA 4AFBA 2B9VA 3H1WA 1NT0A 1ULDA 4MHRA 1C8M1 1D2QA 2VJXA 3F2ZA 3CKHA 1ASJ3 1MVQA 1WA4A 2AGSA 1GKBA 4MHUA 4WM8C 3I2DA 1UXZA 3TNQA 1DU3D 2WNEA 3J8F1 2BGPA 3VKMA 5J37A 5LK5A 1RUG3 2V5DA 4K1YA 5FUIA 2FDJA 4FQ4A 3RI9A 2D97A 2EF6A 5CBLA 5A7OA 1KS5A 1UIJA 1RUC1 2OVUA 3FUOA 1YI9A 3SEEA 2AREA 5FZFA 1Z0HA 5E89A 3RNSA 1HN1A 1EV13 4Y20A 4YG3A 4DZGA 1H1MA 1TEIA 3AYCA 3LEMA 3PIGA 5EYYA 3WY6A 4FFGA 2E7TA 2R061 4KG8A 4C0BA 3O1VA 1SCSA 1KQRA 2QQPA 4JQTA 4QM9A 1GANA 4HETA 3SEPA 1RYYA 1UY1A 1Y9GA 2XVLA 3PL0A 1QXJA 3A7QA 4FTSA 1A8MA 3ZIWA 5KBFA 4BE3A 1VAVA 2BGCA 5FZ6A 1VB2A 1HRV3 3SH3A 4CEWC 2A3WA 4OCTA 1OLMA 4MG2A 2CAUA 1T6BX 3H0OA 5EV7A 4OI0A 3RZGA 3ZFGA 4BXSV 1XSQA 2GAUA 1YXWA 3I54A 5A33B 1OLME 3AMPA 2GU9A 3ATGA 3J8F2 1NA1C 4U2AA 4A45A 1XC6A 2IFRA 2WNVB 2RS52 2XKPA 2JD9A 1ASJ1 1ODMA 2R6QA 1RMU3 2Y34A 2P3JA 3B94A 3G7DA 2D6LX 5GZGA 2ORXA 5LZ6A 2FZ2A 1RUC2 2WSUA 4FOYA 2ZPXA 4WM7C 4Q2FA 1QJY3 3RMYA 3AZZA 4URTA 1RUD1 5LY2A 1W05A 1SHWB 2R062 2JDMA 1JHJA 5EJ3A 2JG9A 3ZXFA 4QPIC 4YZ4A 2HWF1 3KV6A 1QQP3 2QQMA 4EE2A 2PHWA 4RHV1 3BOPA 2P1BA 4I2OA 2VCCA 3GJAA 1V00A 3ETQA 1GV9A 3M70A 1DGWA 1LHNA 1QJU1 1NQJA 1Y3TA 2R1BA 3D82A 1OA2A 3N9QA 3WUDA 3MF9A 3P6BA 4HVRA 4MADA 5F6KA 4A3ZA 2DUQA 4LBOA 1MS3A 1MEC1 1ULGA 2CY6A 4LTAA 3VBHC 2R32A 3AYAA 1HRV1 1NCQB 2E53A 3ZYPA 1QJZA 4K8FA 3NV4A 5CIRA 4ONUA 2BUKA 2JG8A 1ASJ2 2NPIA 5LA2A 2Y33A 5FQ0B 1KFUL 5JAXA 2PN5A 4BIOA 5JDBA 4R9BA 3ZOIA 1IQAA 1LULA 3E5UA 5FZ1A 4B4PA 1WW7A 2EICA 2XJUA 4CP1A 1W8FA 4KQ7A 5A7WA 2WRAA 2XXZA 5F3IA 1RUD2 4PBOA 1WCKA 4MSVA 5DUWA 5IK4A 1B35A 3NMBA 1EUUA 3PVNA 5ABJC 4AGRA 5HCAA 1UZWA 3CDZB 1QJY1 2HWF2 4H3WA 1BQPA 2D6NA 4PIZA 3HNBM 4RHV2 1RUF3 4HSJA 4V2VA 2I74A 5FREA 2DFCA 2ZX3A 4XJAA 1QJU2 5BPXA 3WNLA 1UU5A 3FMGA 1V6KA 1YJKA 2QQUA 1AL0G 1FV2A 1SDWA 4TSVA 1HV0A 2XDVA 5IVYA 4Y26A 1SQ4A 1UU6A 4OHYA 2CDPA 3H9AA 4GKYA 1RUOA 2JECA 1HRV2 1AYM3 1N3QA 2E51A 4XBNA 2DBIA 3POGA 2XBO3 2WNOA 2Y0IA 4XFGA 2AH2A 3K2OA 3GCWA 4LBKA 2DU0A 4D69A 3PUQA 4HSLA 5F5AA 5J09A 1HQLA 1BCXA 3IDBB 4D7SA 2R7EB 3JU9A 2Q8DA 2Q1FA 4HVQA 1UXXX 5DZGA 4QKFA 1S1AA 2VNVA 1OMIA 4MGSA 3EMRA 5FPLA 5FZOB 1UYPA 2D5FA 2B42B 4XFBA 2VBBA 1QJY2 4NHXA 5AFBA 4KH9A 1G6NA 2PMWB 1VMHA 4QPGB 3SCFA 2VZSA 1AJOA 5BNPA 4CU6A 4QGNA 3HMYA 3O12A 4AAXA 1W8HA 4E2QA 2ZCWA 3FC0A 5FMBA 3GZTB 3I2KA 3NJZA 1SLTA 2ZKNA 3PU3A 5ANQA 1X82A 2YPJA 3ES4A 3N7KA 3NV3A 4MLOA 3BPSA 4RQPB 1DGLA 2N7GA 3C2UA 2B39A 4XQWA 5FZ0A 3BTXA 1GBGA 1NLQA 3GYDA 5FZ8A 5FPZA 4LBMA 3BTZA 5I0TA 1GUIA 2A1XA 2XJTA 2ET7A 1V6JA 4B1LA 4Q5OA 5JI9A 2RJKA 2D3RA 2VULA 2WNVA 3ILNA 1W90A 1WA6X 4WBBA 3HNMA 5FY7A 1S0DA 2D3PA 2VMEA 4HN0A 1E5IA 1E5SA 1EPZA 4HZFA 3WQ0A 2ID4A 1KFXL 2WLQA 2XJQA 4PIXA 4FAHA 3KGLA 1UY4A 4E8DA 5FYZA 4KI5M 1Q8VA 2GMPA 1W99A 1JOPA 2B8MA 3GXUA 4CP2A 3OJBA 4ZU7A 1NE6A 1IZ3A 2H0BA 3CU7A 4YZ3A 4NWWA 1GU3A 5JXGA 3NJVA 2Q5TA 4OI2A 4NVPA 5FZ4A 3ZYBA 1ENQA 3MO4A 4PF1A 2GZWA 2IVJA 3ZN6B 2CU5A 2XWBB 4KU8A 2VMIA 5T5JA 4M3CB 1LCLA 2ZGTA 3LEKA 2QQLA 2QDNA 3HBKA 4ATFA 4CXWA 1JMUB 4CRQA 4ZZ8A 4WM8B 4FPJA 4CCDA 2YHJA 4R8HA 2VE1A 5JOWA 1DQ1A 3KV4A 3LF7A 5FYHA 2XBO2 4IV1C 4DFSA 4NHMA 4FVVA 2WA4A 4NIAA 5J48A 1W2OA 3NNLA 2VD7A 4HG6B 5FQ0A 5CYYA 3WLUA 4Y22B 4YRDA 3WP6A 3AX4A 4UW6A 4UAPA 3T0AA 3VBUC 4LLFA 4AHYA 1NXMA 3DPRC 1RC6A 4TWTA 5C6CA 4XF1A 1TZOA 3EBRA 1R093 1ZNPA 3ILRA 3RI8A 3LPFA 4MGKE 2K2SA 5FYYA 4AQ6A 2UWBA 4M4PA 4YVWC 2TUNA 1HB4A 2W52A 4AHWA 2GC0A 1Q3EA 3U11A 1BLZA 1O8SA 4CEWB 5FR3A 4ES9A 2GP3A 5CFCC 1ZRDA 3CNAA 2CHHA 4RD7A 1CD3G 2IXCA 3AP4A 4LHLA 3ZSKA 1S0FA 2GC1A 4NROA 1Q8QA 3S30A 2JDAA 1DLCA 3CZUA 2YBPA 4K20A 1UZYA 3ZXDA 3HBZA 4MGQA 4BU2A 2PXJA 5KC6A 4BYYA 4Z92B 4WM7B 5FLHA 1VMFA 1L7RA 1OQ1A 3J7NA 1FXZA 4AFCA 3RZMA 1RHI3 4LBQB 4MGYE 4FXKB 4UYBA 4LO6B 4LMFA 4NE9A 2VECA 5JZGB 1POV3 3JZVA 2C9KA 3K48A 2NM1A 2Z69A 3PHMA 1DP0A 4QPGA 4UBGA 2LM3A 4XUOA 4AI2A 5F5CA 4DRVA 5FYIA 1FT9A 3ZN4A 3CJIC 1ZM1A 2VOXA 4UFLA 3IT8A 1R64A 5KHGA 1UPSA 4ZONA 3VDCA 4Q1RA 3U1XA 3QOPA 1IS6A 4BOWA 4BXFA 1GZWB 2Q4SA 1I1EA 1S4CA 4BQ3A 4QKBA 1UZ0A 5IJRA 1LU1A 4LE3A 5CA6A 5FUNA 1MACA 1KDKA 1ULOA 2A5ZA 2P2KA 2XUMA 2DVAA 3RZLA 3C7HA 4ZHNA 3TB0A 1X33A 3AC0A 4TXWA 3LA2A 3OPWA 1DHKB 1W39A 4GIQA 5LA0A 3LKJA 5APAA 2VM9A 4KL1A 2C1FA 1URXA 2ILMA 5FPBA 3NL1A 4KGQA 4NRPA 2JDNA 4QX1A 1WD4A 2ZHNA 1LNSA 1VIWB 2RDRA 1YUDA 2Y6HA 5FZHA 1CZTA 1W6PB 2UWAA 3IKWA 4C90A 2VVDA 5FZEA 3MLKA 3ON7A 1RHI1 1CPMA 2Y0OA 4OUMA 5K4LA 1QGLA 5A7NA 2QTWB 2W39A 2EALA 4EN8B 3PLQA 3J7LA 1YQCA 2GC2A 3OTFA 1OFNA 2VW0A 3ZFFB 4C0HA 5LEKA 2VMFA 3APBA 2WYFA 5FUPA 3MV01 4NRQA 1MPXA 1ND2C 5F5QA 4BCUA 1WBLA 3ZFGC 1LTEA 3DUIA 5C9AC 1PMIA 2VQTA 1RUI1 3AZVA 3ZN6A 2RV9A 1WMXA 5KHJA 1ZVFA 3IAQA 3ROUA 2OW4A 4S2DA 2ZGKA 4ASLA 4BQWA 1CVNA 1GOGA 3KM5A 4YFZA 3KCYA 4ET7A 1GSLA 1AYN3 4MX3A 3FBYA 2E6VA 2YFZA 1JUIA 3MPPG 2CGPA 3AMNA 3RYRA 3CIHA 4IGQA 4MOAA 4EZHA 1NY71 1UF2C 3CMGA 1RL3A 5F8PA 4DXSA 3HIFA 2P34A 3L9JT 1ONAA 2JE9A 1RHI2 2PQQA 3M3OA 4IE0A 4Q0QA 4PHZA 5CB7A 4GH4B 4TTGA 5GALA 4FQZA 1TG7A 3AVSA 3I2IA 5FK7A 3DYPA 2BFUL 1PGL2 3J7HA 2D40A 4CEYA 1G9AA 2GNTA 1CPNA 1PX3A 4AEMA 1XNKA 2IXKA 3GBFA 4MGZE 5I8YA 5IHRA 1W3VA 4BA6A 3ACIA 3MW3A 3VKOA 3CLPA 3KQRA 2BTVC 4CYDA 1RUI2 3WF1A 1BXHA 4NAMA 3INAA 3JB8A 1H4HA 4XZUG 5FZCA 4PIYA 3W9AA 3POIA 5ERLA 1QOOA 4YW5A 4EN0A 1M4WA 1NCRB 1W6OB 3ZYGA 4JVAA 1V6LA 3NNMA 2KR2A 4IQPA 2WZR3 5FO8B 4OI4A 2R043 3M8LA 5F39A 5LY1A 1ACCA 4GQ7A 3M3IA 2AYHA 4XAAA 1B09A 1LOEA 1NY72 3QACA 5DAQA 5FCCA 3WDUA 4QHOA 4F83A 1RXGA 2VCAA 3R0RA 3TRSB 4CDUB 1YO8A 5I0DA 3OGGA 3HT2A 5K0UA 2X53S 5CKQA 1FV3A 1MR5A 4WZCA 3WW4A 3JCIA 3MF6A 2RDSA 2ERFA 3S6PA 3Q8EA 3USUB 1V6OA 1XJAA 3AKSA 2ARAA 3JD73 4XETA 3V56A 2A73B 5JZGA 1SEFA 1FNZA 3NAPB 4FPFA 3HT1A 4JGZB 2Y6GA 2Y64A 1KEXA 5FKCA 1JN2P 3T4VA 3H8UA 1LHOA 4CTEA 1FATA 2TNFA 4ORFA 3VBRA 3I2HA 3VB9A 3AL6A 4FAGA 2W5FA 5I0UA 1POV0 3BU7A 4EJRA 4B7EA 1GICA 1E57A 2WO1A 2RMU1 3I2FA 4X8NA 1MZFA 1JHNA 5F9TA 1FI2A 5FAXA 3O0WA 3EB7A 1X36A 4FFHA 1C3HA 4MUVA 5FRAA 1OH4A 4QQPA 3OGSA 1QJFA 2ZEZA 2Q8CA 5E1RA 1JU4A 3GHNA 2XL9A 5FY0A 2EAKA 1S0IA 3DPRB 1LOFC 4UW3A 3VDBA 2JDYA 5DG1A 4LEJA 2YC4A 3BODA 1PO13 4MO3M 1JI6A 2QQOA 3E6DA 2R0FA 4MGIE 1SLLA 4PQQA 5EJ1B 1WUVA 3PVBB 4YGBA 5GJ6A 2PELA 4OMCA 3FN9A 4YW1A 1DFQA 3ZMNA 4QGMA 2VZRA 2ZMLA 3PNAA 2HWB1 2WN3A 3AB0A 4HBNA 2XQXA 5DMYA 1XB9A 2WWSA 3WNXA 1U0AA 5CFCB 4LXLA 1U5XA 5EZWA 4M4RA 4HOOA 4HK9A 5IUQA 2VGDA 1W03A 2WFF1 3ZFFA 2XUEA 5EJZB 3T2OA 3SMHA 2F4PA 3VZKA 3EO6A 3WP5A 1ULPA 4AFAA 1I6XA 5KXBA 2YUEA 3S7EA 3AMQA 4FOWA 3VD4A 4FPHA 4IEXA 4KWLA 4LKSA 1HRI3 2P6HA 1PK6A 2W47A 1COV3 2J42A 3K4ZA 3N3HA 4I0AA 3A0NA 4I3GA 4NHKA 5A3WA 4HLTA 3ZIXA 1QNWA 5IVCA 4XFAA 3A4UA 3LIHA 5DZFA 4LUMA 1N1SA 3RYPA 1A78A 1Q5OA 4LPLA 2R042 1PM7A 2J1SA 4EN6B 2Q8OA 2XWJB 2YC2A 1Y43B 3IZOA 1JZ3A 2ARBA 2CSGA 3LEIA 4E4ZA 4W6WA 2GH8A 5DABA 3FHAA 4P9GA 3VBOB 1UD1A 1UZZA 2D44A 4K1ZA 2FDFA 3AXEA 1GQGA 4E4HA 5FZ3A 5FP7A 5J98B 3LA3A 2C5DA 1OF3A 3K3NA 4XHXA 2WO7A 5KHKA 4BMEA 5IT6A 1C28A 1UN1A 2BDRA 4N53B 5A3TA 1CN1A 3CJIB 3E1F1 3FHIB 4IW3A 2CV6A 2OUJA 4AK3A 4CCNA 5CG9A 1UMZA 4CDWB 4CCLA 1HB2A 4H7LA 3N7JA 1MQTC 2WFF2 2ZKLA 1W6NB 1YLLA 4JRLA 2VUCA 2FQPA 1GFF2 1BVP1 5A3UA 2FCTA 4PDWB 4QX5A 1VBA3 3VDAA 3ZR6A 1OBNA 1OUSA 2PAKA 2ZOEB 2ZXQA 1H6YA 1Y9MA 4RR3C 4UBHA 4D6QA 5IVVA 3MLJA 4GAZA 1JZ5A 3I49A 4CCOA 1RVF3 5HCBA 2XG3A 1Q56A 2HWE3 2QUOA 1IS5A 2VZVA 2HWC3 3KLSA 3USSA 3WG2A 4XMAA 2R30A 3TOJA 1D4VB 2PYTA 2XKOA 1NCRA 1W6OA 3WDWA 1N3OA 3AKPA 4IEYA 3H3ZA 5GLVA 4AVTA 4LLOA 2QJVA 5LA9A 1S0JA 1CR7A 3BALA 1JS9A 1SBFA 1VBB3 2OX0A 3DV8A 4O65A 4YARA 4XJ8A 5A6YA 3HWJA 5FZIA 1PO12 1PZ9A 3FLPA 4CDUA 1JZ4A 3LQCA 4A7YA 1NOVA 1IPJA 2RR13 1C4RA 2WO3A 3TNPB 3H8OA 4NRMA 3ILFA 1VMJA 3OF1A 3POSA 4XIKA 1ZZ8A 1U5ZA 3IMMA 1ND2B 2VZOA 1HJGA 4BQ5A 1SDDB 1T6GC 2B5HA 3FLTA 3NAPA 5FZBA 4JGZA 1QDOA 3VDDC 1MZEA 2JICA 3SITA 1GNHA 5FPUA 2X5IB 4LNVA 1VAMA 1UOGA 2XJSA 1NZCA 1RTVA 1HRI2 2BVBA 1W6QB 5IK5A 3QD6A 5F3GA 1GNYA 3MICA 3WNMA 4RL7A 3MLLA 2RDNA 2B9UA 2LTNA 4NO4A 4FPYA 2PHRA 1GOHA 1REFA 4JAAA 4UF0A 3MIFA 5C5UA 1H2KA 1VBD3 5F3EA 2JIJA 4FSJA 2ZX2A 5DUXA 5GZDA 4FPGA 4LO4B 2W1WA 3N9OA 1HQNA 2BYVE 5JR7B 1K5JA 1VBB1 3POJA 4AFMA 1F5FA 1G86A 2EIBA 3BTAA 2JDPA 3WV6A 1TMF3 3WEZA 1OVSA 3MIEA 3BCWA 3UGFA 4LJHA 4R52A 1X9TA 1OH3A 5KR7A 5FZLA 2RR11 5SV8A 5DPNA 4TZDA 5A7SA 3DEMA 2WBKA 3LIGA 2ZEWA 4LQRA 4XEZA 2NYYA 3AYEA 3KB5A 4AEDC 5FYTA 2LRPA 1W2TA 1JYVA 2PHLA 2W0XA 2W94A 3N9LA 3NNFA 3O1TA 3THCA 3ME2A 5LA1A 4AVCA 5T5LA 1X50A 5A32B 3B7MA 5F3CA 5F2WA 3GZAA 2VZ3A 5BNOC 4D7TA 2HWC2 4BM8A 5IVJA 5L9BA 3DYOA 5K7PA 1REEA 3U37A 5I8TA 3LA7A 3NQHA 1XNBA 3MI8A 3NWKA 4IGOA 5FZDA 3N9MA 1WKYA 3HNYM 4DPNA 1VBB2 1YI7A 4FPKA 1VBD1 4PBPA 1NE4A 4V2WA 4AWDA 1QKQA 2A6YA 2RS51 3R05A 3VBOA 4FOVA 3B93A 2UWCA 4YGDA 3QBQA 1SPPA 3AYDA 4QQLA 2J1TA 3OPZA 4AOCA 2D5HA 4GB31 1MS8A 2RR12 3VKLA 3AP9A 2VO5A 2ADDA 4KBBA 4YM3A 1H30A 4Y4RA 4AW7A 4FXGB 1OOPB 1H2LA 3VBSB 3WNPA 1LENA 1O4TA 3LZZA 2W46A 1WCUA 1VAKA 2YY1A 2W08A 1XYPA 2EXKA 2WLPA 2GN3A 1AF9A 2WJSA 1ULCA 5FY9A 5C3RA 4YW3A 2BU9A 2XJVA 4AGVA 3SHRA 2BNOA 1VBE3 3H7JA 3RPQA 4O7XA 4A7KA 5FXXA 4AFDA 4CDQA 3KF5A 1K5MB 5L19A 4GULA 4I02A 2P4EA 1MZ6A 1DZRA 2Y6KA 2YBKA 1DQ2A 2Z2SB 2CAVA 3HQRA 4ARYA 4YVSB 2BERA 4BH9A 5HV0A 1ZRFA 1TME3 4N9HA 3WDYA 5JUVA 4AL9A 3I59A 3IPVA 4W6XA 1VBD2 3WOGA 3POYA 4G4FA 1OF4A 2RM23 4IEPA 4LITA 1DQ0A 1LB2A 2PLV3 4PCRA 4ZY9A 1OD3A 1O7FA 4AEKA 1W9SA 4GB32 5CFDB 1FOD3 1RUG1 2ES3A 3HQXA 4YW2A 1TMF2 4IV3C 4LBNA 3WR0A 4ZU5A 4UXAA 4AGGA 2QQJA 1ZZBA 3O0XA 1ZA7A 3K46A 4EWEA 5B4XA 5CKNA 3VD9A 5IK8A 3O1PA 1EV11 3MIHA 4J25A 2BP6A 4XQ4A 1F4HA 3VZJA 4CP9B 1S2BA 1WZXA 4AHZA 3HOBA 4JRAA 2E7QA 2K46A 4CU7A 5F7UA 1S55A 3Q8FA 5DZEA 4CDXC 1OXCA 1R1A3 2X5IA 4BQ1A 3T1LA 1V6NA 2FZ1A 2Z42A 4HVOA 3BUCA 2DBNA 5CG8A 1CAXA 1W6QA 3ZFEC 5CADA 2GMMA 4XAEA 3AJYA 1XBFA 5HPOA 1M06G 2PFWA 5FFOC 2FD8A 4JC1A 5FLIA 1CZSA 4RGKA 3H1YA 3IMNA 3HJRA 4GA9A 4QXHA 1O59A 3ZXJA 3ZYRA 1TME1 4AE2A 5I93A 4AI8A 1K45A 3N9PA 3PUSA 4AVVA 1D4M3 5H9PA 3AVRA 1RUG2 2GNMA 5GLZA 2RM21 3U14A 1RMU1 2RG4A 2F17A 3MUZ1 4Q27A 5A7QA 4LORA 1IS4A 1FOD1 4XURA 3IB3A 3VBRC 4A6SA 4AI9A 5FZ9A 1EV12 2VNGA 4V1PA 1JYXA 4RR3B 1J59A 4QB1A 4JKKA 1XOYA 2XJRA 3THPA 2FHRA 3WQ1A 4QQ2A 1UY3A 2EAAA 1ND3A 4KMQA 3W21A 4QGLA 4A41A 1QQP1 1I5ZA 3MEPA 5C8CB 4Y1UA 3ACFA 1S2EA 4Q4W3 5FP8A 2W91A 5F5IA 4UFKA 1H8TC 2WINB 1R1A1 3JXSA 3RS6A 4D6SA 1CIYA 4JTOA 5CKMA 2H6CA 3ACHA 2C0ZA 1VBE2 5DG2A 1IPKA 4A7ZA 2FDGA 1H6XA 3AK0A 4Q4Y3 5GLWA 4DY5A 3PTRB 4XHBA 2WSVA 3I2OA 2V4AA 1DGRN 3HN1A 3BYWA 2IXJA 1TME2 4D0QA 3UNPA 4YZ1A 1WLCA 1A34A 2G9ZA 5DAXA 4QX7A 1XU2A 4AHXA 2EXJA 1RB8G 1HB3A 1JW6A 1NUKA 2RM22 3VBFC 1RMU2 1JH5A 4URAA 3DYMA 1S0BA 2PLV2 1O3TA 1D4M1 1GZTA 1YHFA 1FOD2 3T09A 3WF2A 5A3NA 2WIIB 2R073 3SH5A 1NKGA 1PIV3 2WAAA 3ORJA 1S0GA 3RJ2X 2C24A 2LUWA 3TYJA 3TEXA 4XDPA 3THTA 2BWCA 5HI0A 3V64A 3JQXA 1OOPA 1QQP2 3VBSA 3W5MA 2JDHA 1KITA 1RUF1 4OULA 1OQDA 3OPTA 4FOQA 4N43C 3DXTA 4I01A 4YGCA 1H0BA 1NZIA 1TNFA 3NVCA 3OY8B 1R1A2 2ZX4A 4JHZA 1GMMA 1BJQA 3D5OA 3HR9A 4MV2A 3C7FA 4Q4V3 3WINE 2YGMA 4Q4W1 3VGIA 4GWNA 1T2XA 5D8AC 5FK8A 5LBEA 1W04A 1TQ5A 3SCHA 5LRRA 1K5MA 2WN2A 3VL8A 2Q1MA 2WNUB 3W20A 3LOBA 4YW4A 4WVVA 1Z78A 1AYM1 4Q4Y1 2TBVA 5A3PA 4YVSA 3O1UA 1Z7S3 1DGWX 2XBO1 4CCJA 4K3UA 4XZPA 2ETEA 5A33A 3VZOA 4BB3A 3RZKA 1J1LA 3LDBA 2ZS6B 5JWPA 1L7LA 1RITA 2JEMA 5HXVA 1ULEA 1I5PA 2DUPA 1D4M2 2VUAA 3PUHA 4QXCA 5C4WB 3BI3A 1SG3A 5LWBA 3T4HB 4XTPA 1GQHA 3GBWA 5JI7A 2J1AA 3OYWB 1UZVA 2GMEA 3D4KA 4JDMA 1RGSA 4NPRA 5FXZA 2Y6FA 4LHSA 1Q8PA 4AYUA 3NNGA 1RUF2 1EYBA 5L7OB 1KDMA 5F2SA 3IAPA 1D0HA 2DCTA 3B3QE 4CCKA 2BV4A 2WWJA 4JGYC 4L11A 3DGTA 2NMOA 2VMHA 4OFGA 5AVAA 2D6MA 4Q4W2 3I8TA 2OXBA 2AR6A 2BPA2 4LOTA 1GYKA 4PF5A 5JCTA 2BOJA 4N7IA 4HKOA 2KXLA 4A3XA 1NX9A 3GCXA 2ZHLA 2WL1A 3N35A 4LIUA 3ZYJB 1AYM2 3OBAA 3KVBA 4Q4Y2 3KCXA 2QCSB 4DEQA 1YWKA 5FMOS 5BNNB 3D6EA 3EQEA 4XVHA 3K75B 2AC1A 1S0CA 1NCQA 4QX8A 2JX9A 1FNYA 1RINA 1UYYA 2VQUA 4OHWA 3VL9A 1PZ7A 2YFUA 2ZA9A 3AKTA 4HKWA 1C1FA 2XR4A 2E7AA 1RUE3 4KG0A 4QT6A 3R6SA 4CP0A 2HLEA 3WF3A 4C91A 4OYUA 3SNMA 1F9KA 3FHQA 4CUCA 1JOBA 2ADEA 2B46X 2V09A 4UFJA 4RS5C 1PVXA 5FYMA 3ZMOA 4NIDA 4HL0A 2HEVF 2DURA 1C5IA 5FYVA 4CUAA 1PIV2 1US3A 1UAIA 1W8ZA 2A6WA 3FUQA 5IAVA 4OQ9A 2WS93 4B29A 2HWD3 5FMCA 5B2GB 3VD5A 4ZU4A 5JSPA 1OT5A 1LOBA 5FWJA 4AVAA 2VG9A 2ZGQA 3ZXGA 4BWOA 2YXSA 4IETA 4OVEA 4BLIA 4IE6A 5FLJA 3OEAA 2ZGNA 5LCWL 3VHNA 4JDOA 4M01A 1VRH3 4P9XA 4G9SB 3VLBB 3VUOA 2EIEA 1IG0A 2WKKA 1XNDA 3GGLA 3M3QA 1WGPA 4CU8A 1NA1B 4QU1A 2KD7A 2YV8A 3O1RA 4M3CF 1ZZ7A 2OUHA 2DCYA 3WHTA 5C8WA 1Z7S2 5KHIA 1FMD3 3MW4A 3ZPOA 4YW6A 5FOJB 4IV3B 1MS4A 5T5OA 2O1QA 1PHMA 1JZ8A 3WP4A 2JENA 1WLDA 3I4IA 3WXPA 3WDVA 3GZUC 4LO5B 1QHDA 1NXD1 1RUE1 4QPIB 2GNDA 2E63A 4E2GA 1DF0A 1WMDA 5FZOA 2JWPA 1SZBA 4XABA 1JZ6A 3VHPA 1J3PA 2GSYA 1F4AA 1F31A 1W0PA 3IDAA 4DO0A 5JXHA 5T3NA 1R091 2Q8EA 3ZN5A 2QQWA 2WT1A 5FYBA 2HWD1 3OUHA 1D2SA 1UKGA 3U0ZA 2OT7A 2VPVA 3S5AA 1LGBA 4UI9L 1YFXA 3RDIA 5JOZA 1YNAA 1YQ6A 2V72A 3C7EA 3KS7A 2VOKA 3OY8A 1HX6A 3VBHB 2P3YA 2DDUA 5EP9A 3AZWA 1SLIA 4RQPA 1O6UA 4F3JA 1SACA 4DY3A 3M7AA 4KNCA 1QOSA 1W6MB 2ZGRA 2MPFA 4OUSA 4EQVA 1OPOA 1VE0A 2XLAA 2YBSA 3RRDA 3JUUA 1DZTA 1UO9A 3GM8A 2B45X 4AG4A 5ABJB 4LHKA 1RUE2 5JPNB 1XRUA 1YQ5A 2VVFA 3M4FA 3CZJA 4P9JA 5C4WA 1JBCA 1GZ9A 3LB9A 1AXYA 1LEDA 4DIQA 1N3PA 2ZZQA 1CWPA 1SBDA 3T08A 1X8EA 4XBQA 2A7AA 3RZZA 2RDQA 3PURA 4Y1XA 4F7ZA 5ACA3 3WDXA 1R092 3OYWA 3BIWE 2IXHA 3HAGA 1SLBA 2WS92 2AEYA 2HWD2 2YROA 3WSOA 2UU8A 1PGL1 1POV1 1AL23 3WT3A 4DUXA 1H8TB 3IIAA 5L7OA 2AUYA 3B00A 4A44A 2IZWA 2VZQA 1UOBA 5FZ7A 3BIEA 2CDOA 2YZ4A 4YYOA 4H7MA 4NPMA 3HD8B 4MZUA 1PZ8A 2HH9A 3RWNA 3TN93 2R0HA 4JTNA 1UU4A 3E5QA 2C26A 3LAGA 4HONA 4M3CA 5E88A 4BZ4A 3QCWA 1YFUA 3SKJE 3WCRA 4WM8A 4DXTA 2FDHA 4M3CE 4AI3A 1OI6A 3JBG3 3GHMA 1ULFA 1V9U3 1YRZA 2HKXA 4XPVA 1FX5A 2BBVA 1LOGA 1SFYA 2JDZA 2JG9C 1LU2A 1Q43A 3LD8A 4M0NA 5F32A 2VU9A 4BQXA 1AR73 1C57A 2SLIA 4Y22A 3LE0A 5TSWA 1UNBA 2Q1ZB 1XPWA 2RJLA 4GZ9A 1LGCA 4NN0A 1S0EA 4CZSA 1AX2A 3PUIA 1AR93 4LKFA 4XFIA 2CYFA 4YGEA 4Y5SA 1PO23 5EHDA 1SBEA 4AVSA 2DUOA 2EA7A 3ZYIB 1MVEA 5I91A 2DFBA 4R9CA 4XDOA 2D3SA 2G9FA 3OB8A 4I0BA 1WW4A 3OBRA 5FJKA 1OHFA 3IN9A 4FPCA 3THDA 4XTMA 5C3OA 5A6QA 5B4NA 2EIGA 1DQ6A 2BZDA 1LR5A 5DN2A 3H3UA 2JG8C 3J7MA 4CEWA 5BY5A 1X8MA 1US2A 1V70A 2WQ8A 1QJX3 2A3YA 3BPZA 5KHHA 4S2GA 2VVEA 4FFFA 1HLCA 3C8XA 1NA1A 3HVDA 3WDTA 3FFZA 2X05A 3ZX7A 1OA3A 2FDKA 3HEIA 4Z07A 3TWIA 1IKPA 1ZZ9A 5FP3A 1B35C 3FLRA 3RFRA 1IG3A 1AYN1 4MYEA 4WM7A 1V9U1 2W9XA 2D6PA 2I07B 5DDJ3 4LBLA 4AI1A 5L9RA 1H1AA 4EN9B 4G3YC 1F15A 5FJHA 4Y1YA 4CXYA 3BU0A 1DZQA 2P3IA 3MPBA 2BGOA 4QPIA 5IWFA 3ZO0B 2ZEXA 5D2AA 4LBQA 5HCFA 5BYNA 4JGYB 2A6VA 2XQRA 4YSFA 4ZZ5A 4ISQA 5J7MA 4DS0A 3GJBA 3MHZA 2K0GA 3CF6E 1PO21 1NLRA 2HJIA 2R1DA 4QQOA 5LATA 4QXKA 4COWA 1K42A 2J7MA 2AZ5A 4QPYA 3H8XA 1LHWA 2YDEA 4XILA 4COUA 4IV1B 3VBHA 3TN92 3KD4A 1GZWA 4KWUA 2RS33 2DCKA 3FJSA 4NIIA 1H1IA 4QKNA 4FFIA 1CX4A 4L92A 1HV1A 1WWYA 2VQAA 2NMNA 1YFWA 2WT2A 1AYN2 2WZR1 3I3BA 1V9U2 1W6MA 2DVDA 2R041 4J6GA 4Q0PA 4RS5B 2CWSA 3VBUB 2DCZA 3TEYA 4N8MA 5JIUA 4I09A 3WVJA 5BNPC 1RUH3 1F8VA 3N9NA 5FXVA 5ABJA 3L2HA 1QWRA 4MXWB 2JB8A 1DQ5A 4RN5A 1G9DA 1X9PA 3EJKA 1KXGA 3ASIA 1W6PA 3WD5A 3UKVA 4Y5Z0 2B7YA 2ZAAA 4YVWB 1RXFA 2HBUA 1HIXA 2XPJA 1PO22 1PVC3 1PMHX 5FY4A 5KWRA 3JD71 4XUTA 2ZABA 1TVGA 4Q4X3 1O4ZA 3LEGA 2J1EA 1G9CA 1E5HA 3NV2A 4NOTA 1O4YA 2C4XA 1QXRA 2XMLA 2WYSA 5A1AA 4L0PA 4AAPA 1CAUB 4U36A 2WZPP 1FAYA 1KRIA 4NMIA 2WNVC 3QH7A 2PA7A 4AQTA 4GWIA 4W50A 1UYXA 2WZR2 1R083 3NSTA 2VC9A 3IIIA 3WHUA 4TLFA 3K4AA 1PM4A 4QX2A 5M0TA 4NAOA 1FPN3 2VQ0A 1SFNA 3C7OA 4FPEA 3HPNA 3UGHA 4ARXA 1DYOA 4EV0A 1LKNA 1CJPA 5DDJ2 5BUVA 1XE8A 4P5HA 1XU1A 1SCRA 1PO11 2FDIA 1J83A 4XJ9A 4O9EA 2OYZA 4Y5TA 4BISA 2ZX1A 1WMEA 4GH4A 3JD72 1W9TA 2W3JA 1HQWA 1EAH3 4GALA 4YG6A 4LBQD 3T1MA 4MGTA 4IEUA 1OSGA 3PMEA 1YCIA 2UY8A 4Z1VA 1I9RA 2X29A 4CCMA 1KS4A 3NV1A 4Q4X1 1YFYA 1LESA 2PHDA 4INDA 5EYXA 2O8QA 3OCPA 5EXOA 4NR1A 4R4XA 3ST7A 3N7LA 3G6JB 3VZMA 2GC3A 2RS32 1HRI1 2VUJA 2W1SA 2ZZJA 4IEOA 5ISLA 1COV1 1JU3A 4RFRB 5F1RA 1YIPA 2JKBA 2Q30A 2PHUA 3ZM8A 3X29B 5CZKA 2RHPA 2CWMA 1PGW2 2RVAA 3CBNA 1H8VA 2J1RA 4ASKA 4E2SA 3ELNA 4FPOB 1XQNA 4ZXKA 4GJZA 1EP0A 4OMDA 4GMP3 1UY2A 4B4RA 1L3JA 2D6KA 2NLRA 1MZ5A 4W8JA 1RUH2 1AR83 4XIOA 1LRHA 4IE4A 1GWKA 5DAVA 4FTEA 2KM2A 3USUA 4S2HA 4DRRA 2J1UA 2J22A 2WABA 4YG0A 1SMVA 1OLQA 3ZFGB 5C9AB 1KGYA 1EAH1 2GH2A 2JDUA 4XJWA 4F8AA 3GBGA 3O14A 4Q4X2 4E4DX 5GZEA 4FBFA 5K8SA 2VR4A 1H2NA 4IGPA 1VBA1 1LOAA 2QKDA 5I0SA 3A22A 1COV2 2OS2A 4Q0VA 4XUQA 1BVVA 1RVF1 4NJ4A 1R1ZA 4CU9A 3ZSLA 2ZAHA 4LKEA 2ARCA 1J3RA 2HWE1 2HWC1 1WBFA 4XXPA 1BHGA 4UFMA 3LWCA 3VV1A 3O1SA 1R082 2D43A 4NPLA 5IYYA 3B02A 3SC7X 3WF0A 2NQYA 1FPN2 2P17A 2YU1A 3BTYA 3VBUA 3VD3A 3DPRA 4QKDA 3UK9A 3S7IA 3AP7A 4QPGC 3POEA 2XVKA 3WG4A 1O8PA 5F6LB 1QEXA 2A6ZA 3OGVA 5FO7B 4MXWA 2XONA 3MV11 4Q0SA 4R4ZA 4M00A 5A3LA 5C5TA 3PVOA 1W3XA 3SISA 3Q9OA 2DF7A 1DBNA 1UCXA 4JQRA 4XUNA 1C8M3 5HCHA 4YVWA 1EAH2 1JYCA 3URFA 3WNKA 5I8SA 4CE8A 2L9LA 3IWZA 4ATEA 2H0VA 3F95A 2LS6A 2HEWF 2JG8B 1GP6A 4KGGA 4QDRA 5AFEA 5CFCA 3J8F3 1CJDA 3ZXAC 1OC1A 3NO8A 1CESA 2WAOA 4JKLA 4XFHA 1VBA2 2VL4A 1CONA 5H9SA 5A7WB 4RFT0 4P08A 3DCQA 1RUC3 1RVF2 3BVCA 3RG0A 1B35B 2HWE2 5LRSA 3ZXKA 4E4SA 1CAUA 5LW9A 4P9YA 2QE3A 4PLNA 4FTBA 2WQZC 2R063 5LBBA 4A2UA 5HXMA 1OD5A 3BN6A 1YQ8A 2D98A 2IXLA 1D0GA 4XFFA 4EZ4A 2MNGA 3JB4C 5FMOL 3T2TA 1DYPA 4MH0E 2Q0AA 3EHKA 1OURA 3AKQA 3RQ0A 1CAWB 3D8CA 4NIGA 3RVHA 1WLWA 2W87A 5E6HA 2ZX0A 2TEPA 1MS0A 1GWMA 1GP5A 5A6XA 1KJRA 1UY0A 1DIWA 1GLHA 5HBAA 1PNGA 2WA3A 1DDLA 3RJRA 4TLGA 3UL2A 1TMF1 1UX7A 3CEWA 4NWVA 4CUBA 4N53A 1XE7A 2P3KA 3CJIA 4C1XA 2MEV3 4CDWA 1ENRA 2ARXA 2FCVA 4FO9A 3T30A 2QQKA 5DUVA 3W59A 4QWNA 1W6NA 3NKTA 3H50A 4EROA 1C8NA 1CZVA 5FTTC 3IDEA 5FDBA 1BZWA 4PDWA 2VZTA 4ZXEA 1NAEA 2WT0A 1MS5A 4Q1PA 3RMXA 1YIFA 1RUD3 2DWRA 1HKDA 2IVIB 4S2FA 4L2NA 3LFMA 5JIAA 1RUJ3 3MDPA 2ET1A 5JMOA 1XYOA 2HWF3 4BQ4A 2DCJA 1O3RA 2Z4FA 5BNPB 5A80A 1ZZCA 4QQHA 2P5BA 3AM2A 3B9IA 4META 1APNA 4RHV3 3T2QA 3RZJA 3KVAA 2OZJA 5J36A 1ZA4A 3H1MA 4EYUA 3AJZA 1QJU3 3ZPYA 4CEYC 1XNCA 4BK5A 2OZ6A 1IPSA 3PVEA 1CQ9A 3AP5A 3B01A 3ENRA 4ITCA 4AQ2A 2PHXA 1LECA 2VNOA 3S5QA 2VTFA 3MBWA 3I7DA 1LGNA 4OHVA 2W1UA 1MEC3 1TE1B 3KGZA 4DINB 1H9PA 3AFGA 4AF9A 3VHOA 5H9RA 1C8M2 3J9SA 4QHZA 4LO8A 5FY5A 4GMP0 1DLLA 4BLJA 1ND2A 3L2YA 4EWAA 1XNAA 3IDCB 5C9AA 4OLLA 1OVPA 2MEV1 2E31A 2E9QA 2OKXA 1JXNA 5J96B 2F6BA 3KWVA 1IHMA 1W0OA 4YFWA 1SLCA 3Q8CA 4GD4A 2W92A 3PIJA 4J1WA 3O1MA 3O5SA 2PQSA 4QM8A 2Y38A 3POBA 5C33A 4X6RB 1G9FA 4FI9A 3AMHA 4LK7A 4YZ5A 3DXUA 2VTXJ 1VBE1 1QMJA 2ZGLA 5KXCA 1HDKA 5K0UC 1BK0A 3WNOA 2E32A 3VZNA 4QMAA 4OHZA 1RUJ1 1ALYA 1MS1A 1O5LA 4XMIA 3ZSMA 4AZZA 5IVBA 4IEVA 1POQA 4Z82A 5FZGA 1VP6A 2WUHA 3J4UH 5FP9A 2XLFA 5JZGC 1F35A 3H3LA 2VZPA 2YYOA 4XCAA 1BEV3 2EXHA 3ZYFA 4P02B 2V5YA 1VRBA 1MQTB 1EY2A 2BOIA 2PLV1 4LULA 3T0DA 2I2SA 3CO2A 5H9QA 1GOFA 5JXJA 2ORZA 2CGNA 4B4QA 4JKMA 4JDNA 1YQ2A 3MIDA 1AJKA 2DYCA 1LAJA 3UYJA 4COZA 2MHFA 1GR3A 4KBZA 3C3VA 2MEV2 3IM0A 4QXBA 4W4ZA 1LHUA 4AR2A 2BJSA 4L97A 5BV6A 1OQEA 1JYWA 1DQ4A 4Z2WA 3VD7A 2NP0A 3M1HA 2ZMNA 1W9FA 4IEWA 4UFIA 1VR3A 5G05L 2QVSB 3ZKYA 4N90A 5JOXA 2JD4A 5A32A 4PLMA 1STMA 1XYNA 1GWLA 3ZLIA 5BXXA 3SH4A 4CSWA 5C3SA 4IEZA 2CGOA 2G1MA 3AKRA 5A70A 3POFA 1RUJ2 4CVUA 2OIIA 3PDQA 4DXZA 1YYNA 3BOWA 2P6CA 3OUIA 4OQ8A 3SKVA 3SCGA 1QDCA 3UJQA 2VY0A 1W8TA 1WMFA 2VW2A 1W0NA 2X8KA 1AVBA 3K77A 1N47A 4XJUA 4E8CA 1QXPA 4BQ2A 2QDRA 1UPIA 3WX5A 4B7KA 2BRTA 1H2MA 1W9YA 2CNAA 1VPHA 5FPVA 1XSRA 1CAWA 1W8OA 3D0JA 5G04L 3ZFFC 2Y60A 1ZRRA 2ZJCA 3RGBA 3A0KA 1BEV1 1LJ7A 2VMGA 1MEC2 3V65A 1CX1A 2WFPA 1Y7BA 3LSDA 4YLZA 1WCQA 5D21A 3VDDB 5L73A 4TYSA 1PK6C 2GNBA 1HN0A 1ZRIA 3P3PA 5I0RA 3ALQA 4PJYA 2DVGA 1OUXA 2Z79A 3POWA 3GNEA 4K8RB 2GP5A 3KF3A 4K21A 1HXS3 2CTVA 4Y4YA 3VKNA 4C1WA 5KXDA 2FMYA 2C9AA 5FMDA 2BNNA 1PNFA 3GF6A 2VW1A 1N1TA 2I45A 4A6OA 3WQBA 3WG1A 1A8DA 1SFPA 1UOJA 5DXDA 4Y24A 1LOFA 1K3IA 2Y6LA 4K9SA 1ZREA 1VJ2A 5C7GA 2XGXA 3KT1A 2H6BA 4GH4C 3U75A 5JSOA 1UYZA 4YM0A 3TAYA 5BNNC 3GALA 1ZBA3 5T54A 5EPAA 1E5RA 2X10A 1BEV2 1YC61 4BPZA 2G9GA 1VBC3 4PT6A 5FBJA 5CFDA 3VKFC 1CGPA 2DV9A 5FYSA 2JDKA 5DUUA 4JV4A 4AEDB 2IFWA 1EPWA 2R071 3O7OA 1J3QA 2VCBA 1PIV1 4CUGA 3P1IA 4BIFA 1ZX5A 4DQAA 2JIGA 4QU2A 3WQ7A 5C3PA 2YMZA 4IXLA 5BNOB 2C6SA 3U78A 2ZEYA 4CP9A 4YPJA 4HKLA 4LE4A 1NCRC 5E8AA 1ZBE3 3K3OA 4COYA 4Z8BA 3MW2A 1BBT3 1Q8SA 1HXS1 3E5XA 4WVMB 1VB4A 2RE9A 3R4DB 1KD7A 4D94A 4YW7A 2BVVA 4Q4V1 4HK8A 4E27A 4EWDA 4OUEA 3PMSA 4AI0A 4B3NA 2VBPA 1ENXA 1JOJA 3OEBA 4CDUC 2YB7A 4NHYA 3FFQA 3AXDA 1CIWA 2XH6A 3PJYA 3TBDA 3OD4A 2ZHMA 1Z7S1 4RSUA 4QDSA 4SLIA 4ZS3A 5IFPA 3BGAA 1VALA 2FCUA 5FWEA 2VTXA 1LEMA 3ZXEA 3DKWA 3NAPC 4JGZC 2Y6JA 4N7UA 5LEJA 1ZBA1 4LR4A 2R072 1MQTA 4HMZA 1VBC1 2RS13 3ECQA 4H2AA 5CVRA 2GALA 2QZ2A 2AEZA 2ZACA 4RR3A 1W8NA 5FZMA 3V0AB 5KXEA 1BYHA 3ZDVA 1WCSA 4WVWA 1HXS2 4UW5A 5C8CA 2W2IA 2XHNA 1GZCA 1P8JA 4L9BA 1EUTA 1XE0A 3HN3A 1ZBE1 4Q4V2 5CISA 1WD3A 1JYNA 4OZXA 4QAWA 1QH7A 5A3OA 3KSCA 1BBT1 2D7FA 3I3EA 2AENA 4P9IA 3R4UA 1AUYA 1NLSA 2LROA 4CEYB 2V4VA 3AMMA 5FYCA 3WCSA 5GLTA 1Y4WA 4I0WB 1I3HA 3GDBA 5EWSA 1OLRA 2VUDA 2JE7A 4LKDA 4HPKB 2OPWA 3WNNA 3PJQA 4GJYA 2WQ4A 4SBVA 3AP6A 2V73A 3LGRA 1ZZ6A 1QOTA 3IBMA 1ZBA2 2BEOA 1JYIA 3U4SA 3K4DA 2J1VA 1VBC2 1F5JA 4X6QB 2BNMA 3PUAA 5FZKA 3VDDA 4CDXB 1W06A 5IK7A 5JVVA 1NYWA 2JXAA 4QX3A 2RS11 3RYKA 4A4AA 2EIDA 2WS91 3UETA 3WG3A 1W8WA 1DGRA 2BW8A 3ABZA 3ZFEB 4DEVA 1AX1A 3H7YA 5FYUA 3ZKUA 3RZHA 4LHNA 1ZBE2 2VOTA 1AHSA 2JB4A 2D6OX 5JLVA 1BBT2 4AVBA 5HV4A 2A6XA 5K0UB 4M0HA 1UMIA 1VRH1 1MS9A 3FBMA 1OA4A 3LOIA 5D1IA 4O61A 3DKQA 4HT1T 5FY8A 3VBOC 3B5LB 3CJXA 4ES8A 1H4GA 4RA0A 2VCMA 2WNUA 5FV3A 4QB6A 1DG6A 3KCCA 5FBZA 5IVEA 5JOYA 3RSJA 1HJFA 1UW8A 2X09A 3M3CA 1AR63 1OKQA 3CL1A 2HBTA 1W28A 2PHTA 2KA3A 4N53C 5FPXA 1CAVB 1FMD1 3VBRB 3I3MA 2PAEA 4XACA 1RUI3 4AXOA 4CDWC 1PGSA 2PAMA 1J84A 3J26N 4LT5A 1QU0A 1WCDJ 4IL7A 2OQ7A 3H42B 4PDWC 4I30A 2RS12 2QZ3A 4AEDA 2UYBA 4RYDA 1HB1A 3ACGA 4DUWA 3ITQA 2DVBA 5LASA 4HN1A 4CDQC 3UT0A 4Q26A 5JR2A 3E6CC 5LB6A 4WVZA 3WF4A 3ZSEA 3FWEA 1S2KA 5BNOA 5CNAA 2YU2A 1AXZA 1UOFA 4Q29A 4ZKTB 2K9ZA 4K6BA 1VRH2 4PLOA 2WC2A 4D8MA 4Z2AA 3K51A 4WZFA 2WWUA 3DN7A 1SLAA 4A42A 1JODA 4WVMA 4COVA 4WV8A 4Y3OA 3SLIA 3TEWA 2A3XA 4D3WA 1O3SA 4CXXA 3I97A 1ODNA 3VBFB 3U10A 2YGLA 5L36A 1UX6A 1F2NA 4PI0A 5BNNA 4XXAA 1NG0A 4QD2A 4OHXA 2A71A 3ES1A 1X7NA 2FMDA 1FMD2 4IDZA 5AC93 1V0AA 2O0OA 5IATA 2YPDA 1L7QA 4XFCA 4ZPIA 1AR61 3W58A 3P5BA 2G19A 2NZ9A 4Q8LA 2A70A 3LDRA 5F37A 4EN7B 4I3PA 5A7PA 1LODA 1PK6B 3B69A 4BMBA 4DNYA 5LBFA 2NN8A 1OPMA 2WR9A 2W95A 2X5IC 5A1LA 1QNYA 4YNIA 4N43B 2JE8A 4XYXA 5FIXA 1AZDA 5ACA1 3EYPA 1LOCA 3MFAA 1IQDC 3I3DA 3OG2A 5A1FA 3MIGA 1BMV1 5D8AB 2VZ1A 3FX3A 2XJPA 2DTYA 4GKXA 1AL21 4XDQA 3V0AA 4CPBA 2GDFA 3MGUA 4IERA 4Q8KA 4XC9A 3AZXA 3WW1A 4HFSA 4B8EA 2OQ6A 3TN91 3VN4A 3WP3A 5FP4A 1UKRA 5FOBB 5J3UA 1QH6A 3M3EA 1U5YA 2ZGSA 3P3NA 2ZGUA 1J58A 3WW2A 4KWKA 1QF3A 4FPLA 4K40A 4JZRA 1RUNA 1AR62 1YEWA 2P37A 3JBG1 5L9VA 4HPKA 3RWKX 3MZHA 3R4SA 1JUHA 1REDA 3OBZA 4IV3A 3N36A 5AC91 4C8DA 3CHXA 4AQSA 3UV9A 2HYKA 1OFSA 3LPGA 2VNRA 2RMU3 1ND3C 1RJ7A 3ETPA 4LBJA 1AR71 1IOAA 3DL3A 4MXVA 5JXIA 2Z5WA 3D0SA 5EIYB 5ACA2 5FKBA 1JZ2A 2D93A 3ACLA 1G9BA 2HEYF 4NUBA 3V0BB 1AR91 3A21A 4XBLA 3T3YA 4CDXA 1D7PM 1BMV2 4DOUA 1AL22 2XL7A 2PTMA 3Q8BA 1JTZX 4LO7A 2VAUA 2R49A 2SBAA 4QHBA 1GNZA 3ZFEA 4XUPA 2EXIA 4CCEA 1N1VA 5IAXA 3OUJA 4UT5A 5A3MA 3ZR5A 4QB2A 5T50A 5GZCA 1O3QA 5GM0A 2HWB3 1AXKA 4XF4A 4KU7A 4L99A 1QJX1 1ZYBA 1IGOA 3N4MA 1K12A 3E97A 2IUWA 3JBG2 4XE9A 2WFF3 4GXLA 3OD0A 1WLTA 1V6IA 5AC92 1W2AX 4H55A 1QY4A 2QNKA 1CAVA 3EXUA 3ZVXA 1AR72 1OOPC 1U5IA 2LW8A 2VOWA 4UW4A 1V6MA 3FZ3A 5DDJ1 3VBSC 3WW3A 3KMHA 5C71A 4DUVA 3GZEA 1QIQA 2XB6C 1KJLA 1AR92 5FO9B 1Y9QA 3KT7A 2GN7A 3H8RA 3T2PA 4UFHA 4UF0B 2BQPA 3Q8AA 5JPMB 2QBXA 1UWWA 1H8TA 4K7JA 5CU1A 4YZ2A 1K5MC 2XVGA 4PQ9A 1G8WA 4YWAA 4KWJA 3KHCA 3OOXA 4W65A 2IXIA 4YVSC 4XJZA 4CPBD 4XW3A 4H14A 5LBCA 3MYXA 4IE7A 2YG0A 1QJX2 1O91A 2FBEA 3I2JA 3O1OA 4FT8A 2RS31 4QDQA 3ZYHA 5CFDC 3VBFA 3PTYA 4N9IA 4XQDA 2Y26A 1BKZA 2BWAA 1PGW1 2QQNA 4P14A 2OA2A 2DTWA 1IKQA 4UOJA 4AEJA 1C1LA 2E33A 5JSRA 4CA9A 2DVFA 1RUH1 2ATFA 2O8OA 2RMU2 3MIBA 3OGRA 4IESA 1W9WA 4LUKA 3UJOA 3DF0A 4BDVB 4D7YA 4XF3A 5CEHA 3ZSJA 1HW5A 2UY9A 4XF9A 2VOVA 4ASMB 4N43A 1U12A 5ANNA 5EFUA 3HQUA 5GZFA 4YM2A 3B9CA 3UESA 4E9KA 1ZRCA 1N1YA 2CL2A 1PVC1 4RGAA 3O0VA 5FXWA 2VZUA 1UQXA 2YC0A 5D8AA 2G4IA 2EVXA 2RJ2A 4YM1A
chains in the Genus database with same CATH topology
3S0MA 1NCQC 4FP2A 4P9WA 2DU1A 1TNRA 2W68A 2R16A 5CAZA 1C5HA 4MVTA 3SXWA 2HWB2 3MFCA 1ENSA 4Y20B 3BB6A 2VH9A 3WZ1A 3LSEA 5T55A 1R081 1O5UA 1FPN1 2ENRA 3LCPA 1WW5A 3VZLA 3AFKA 4J1XA 4CDQB 5BNQA 1XXNA 5C8CC 4FCAA 3FE5A 4NHLA 4JGYA 1FYUA 4X8PA 5T5PA 3V0BA 1PVC2 1BK1A 1VLNA 4Q0UA 3I59B 2A75A 3IPVB 4XOGA 3UKTA 1AX0A 4JCKA 4Y1ZA 3U4XA 2QFEA 2PHFA 4O9GA 4R9DA 4IV1A 1W2UA 1WW6A 5E16A 4DB5A 1DYKA 4RGGA 2JG9B 3OBTA 1YJLA 4DMIA 5KC5A 4ISRA 2OPKA 3E6BA 1H9WA 3KZ4C 3M2MA 5AVPA 4OI1A 3WUCA 5LK7B 4RS5A 4L8QA 2UYAA 4GMP1 3KT4A 1A6CA 1CAXB 3AZYA 1NQDA 4GWMA 1AR81 4R9AA 5GLUA 1UL9A 2JJ6A 2XHKA 3ZXLA 2ZMKA 3NKGA 2ZGMA 5K9YA 4RQPC 4XF0A 2ZGPA 2RS53 3N7MA 2WNUC 5T52A 3UKNA 1IS3A 4W6YA 2UURA 4GB33 3ZDSA 3VHRA 4P9LA 2BFUS 4LA2A 1J1TA 3JQWA 4LA3A 5C4WC 2IC1A 3NW4A 1Q8OA 2ZHKA 2VXRA 1RJ8A 2LALA 2ZBJA 1ND3B 5GKAC 2IWGB 5SV5A 4Y1VA 3QLQA 2XLGA 3OGJA 2ZGOA 4FP3A 1A3KA 3U07A 4IEQA 5L7OC 2ZTNA 1AR82 1G7YA 1LHVA 5JMCA 1UIKA 3QH6A 4HANA 4BHPA 1RIRA 4AFBA 3H1WA 1ULDA 1C8M1 1D2QA 1ASJ3 1MVQA 1WA4A 2AGSA 1GKBA 4WM8C 3I2DA 3TNQA 1DU3D 2WNEA 3J8F1 3VKMA 5J37A 5LK5A 1RUG3 4K1YA 4FQ4A 3RI9A 2D97A 2EF6A 5CBLA 1KS5A 1UIJA 1RUC1 2OVUA 3FUOA 1YI9A 2AREA 3RNSA 1Z0HA 5E89A 1EV13 4Y20A 4YG3A 4DZGA 1H1MA 1TEIA 3AYCA 5EYYA 3WY6A 2E7TA 2R061 4KG8A 4C0BA 1SCSA 1KQRA 2QQPA 4QM9A 1GANA 4HETA 2XVLA 1QXJA 4FTSA 1A8MA 3ZIWA 5KBFA 4BE3A 1VAVA 2BGCA 1VB2A 1HRV3 3SH3A 4CEWC 2A3WA 2CAUA 5EV7A 3H0OA 4OI0A 3ZFGA 5A33B 2GAUA 1YXWA 3I54A 3AMPA 3J8F2 2GU9A 3ATGA 4U2AA 1NA1C 2IFRA 2WNVB 2RS52 2XKPA 2R6QA 1ASJ1 3B94A 4DRVA 1RMU3 3G7DA 2P3JA 2D6LX 5GZGA 2FZ2A 1RUC2 2WSUA 4FOYA 2ZPXA 4WM7C 4Q2FA 1QJY3 3RMYA 3AZZA 4URTA 1RUD1 2R062 5EJ3A 2JG9A 3ZXFA 4QPIC 4YZ4A 2HWF1 1QQP3 2PHWA 4RHV1 3BOPA 4I2OA 1V00A 3ETQA 1GV9A 3M70A 1DGWA 1LHNA 1QJU1 1NQJA 1Y3TA 2R1BA 3D82A 1OA2A 3WUDA 3MF9A 4HVRA 5F6KA 2DUQA 4LBOA 1MS3A 1MEC1 1ULGA 2CY6A 4LTAA 3VBHC 2R32A 3AYAA 1HRV1 1NCQB 2E53A 3ZYPA 1QJZA 4K8FA 3NV4A 5CIRA 4ONUA 2BUKA 2JG8A 1ASJ2 2NPIA 5FQ0B 1KFUL 5JAXA 2PN5A 4BIOA 5JDBA 4R9BA 1IQAA 1LULA 3E5UA 4B4PA 1WW7A 2XJUA 4CP1A 4KQ7A 1RUD2 4PBOA 1WCKA 4MSVA 5DUWA 5IK4A 1B35A 3PVNA 5ABJC 4AGRA 5HCAA 1QJY1 2HWF2 4H3WA 1BQPA 2D6NA 4PIZA 4RHV2 1RUF3 4HSJA 2I74A 5FREA 2DFCA 2ZX3A 4XJAA 1QJU2 5BPXA 1UU5A 3FMGA 1V6KA 1YJKA 1AL0G 1FV2A 1SDWA 4TSVA 1HV0A 4Y26A 1SQ4A 1UU6A 4OHYA 3H9AA 4GKYA 1RUOA 2JECA 1HRV2 1AYM3 1N3QA 2E51A 4XBNA 2XBO3 2Y0IA 4XFGA 2AH2A 4LBKA 2DU0A 4D69A 4HSLA 5J09A 1HQLA 1BCXA 3IDBB 4D7SA 3JU9A 4HVQA 5DZGA 1S1AA 1OMIA 2D5FA 4XFBA 2B42B 1QJY2 5AFBA 4KH9A 1G6NA 4QPGB 3SCFA 1AJOA 5BNPA 4QGNA 3HMYA 3O12A 4E2QA 2ZCWA 3FC0A 3GZTB 3NJZA 1SLTA 2ZKNA 1X82A 2YPJA 3ES4A 3N7KA 3NV3A 4MLOA 4RQPB 1DGLA 2N7GA 3C2UA 2B39A 4XQWA 1GBGA 3GYDA 5FPZA 4LBMA 5I0TA 2XJTA 2ET7A 1V6JA 5JI9A 2RJKA 2D3RA 2VULA 2WNVA 3ILNA 4WBBA 1S0DA 2D3PA 4HN0A 1EPZA 4HZFA 3WQ0A 1KFXL 2WLQA 2XJQA 4PIXA 4FAHA 3KGLA 1Q8VA 2GMPA 2B8MA 4CP2A 4ZU7A 3OJBA 1NE6A 1IZ3A 2H0BA 3CU7A 4YZ3A 4NWWA 2Q5TA 4OI2A 4NVPA 1ENQA 2GZWA 3ZN6B 2XWBB 4KU8A 2VMIA 5T5JA 4M3CB 1LCLA 2ZGTA 4ATFA 2QDNA 4CRQA 4WM8B 4FPJA 2YHJA 4R8HA 5JOWA 1DQ1A 2XBO2 4IV1C 4DFSA 4NHMA 4FVVA 2WA4A 5J48A 5FQ0A 3WLUA 4Y22B 4YRDA 3WP6A 3AX4A 4UW6A 3VBUC 4LLFA 4AHYA 1NXMA 3DPRC 1RC6A 4TWTA 5C6CA 4XF1A 3EBRA 1R093 1ZNPA 3ILRA 3RI8A 4MGKE 2K2SA 4AQ6A 2UWBA 4YVWC 2TUNA 2W52A 4AHWA 2GC0A 1Q3EA 3U11A 4CEWB 4ES9A 5CFCC 1ZRDA 3CNAA 4RD7A 1CD3G 2IXCA 3AP4A 4LHLA 3ZSKA 1S0FA 2GC1A 1Q8QA 3S30A 4K20A 1UZYA 3ZXDA 3HBZA 5KC6A 4BYYA 4Z92B 4WM7B 5FLHA 1OQ1A 1FXZA 4AFCA 1RHI3 4LBQB 4MGYE 4FXKB 4LO6B 2VECA 5JZGB 1POV3 3JZVA 3K48A 2NM1A 2Z69A 3PHMA 4QPGA 4UBGA 4AI2A 2LM3A 1FT9A 3ZN4A 3CJIC 1ZM1A 2VOXA 3IT8A 5KHGA 1UPSA 4Q1RA 3QOPA 1IS6A 4BOWA 1GZWB 2Q4SA 1I1EA 1LU1A 4LE3A 5CA6A 1MACA 1KDKA 2A5ZA 2P2KA 2XUMA 2DVAA 3TB0A 1X33A 3LA2A 1DHKB 1W39A 4GIQA 3LKJA 4KL1A 2C1FA 1URXA 2ILMA 3NL1A 4KGQA 1WD4A 2ZHNA 1VIWB 1YUDA 1W6PB 2UWAA 3IKWA 4C90A 2VVDA 3MLKA 1RHI1 2Y0OA 1CPMA 4OUMA 1QGLA 2W39A 2EALA 4EN8B 3PLQA 2GC2A 3OTFA 2VW0A 1OFNA 3ZFFB 4C0HA 5LEKA 3APBA 1ND2C 5F5QA 4BCUA 1WBLA 3ZFGC 1LTEA 3DUIA 5C9AC 1PMIA 1RUI1 3AZVA 3ZN6A 5KHJA 1ZVFA 3ROUA 2OW4A 4S2DA 2ZGKA 4ASLA 1CVNA 3KM5A 4YFZA 3KCYA 1GSLA 1AYN3 4MX3A 3FBYA 2E6VA 1JUIA 3MPPG 2CGPA 3AMNA 3RYRA 1NY71 1UF2C 1RL3A 3HIFA 2P34A 3L9JT 1ONAA 2JE9A 1RHI2 2PQQA 3M3OA 4Q0QA 5CB7A 4GH4B 5GALA 4FQZA 1PGL2 2BFUL 2D40A 4CEYA 1G9AA 2GNTA 1CPNA 4AEMA 1XNKA 2IXKA 3GBFA 4MGZE 4BA6A 3MW3A 3VKOA 3CLPA 3KQRA 2BTVC 4CYDA 1RUI2 1BXHA 3INAA 3JB8A 1H4HA 4PIYA 3W9AA 1QOOA 4YW5A 4EN0A 1M4WA 1NCRB 1W6OB 3ZYGA 4JVAA 1V6LA 4IQPA 2WZR3 5FO8B 4OI4A 2R043 3M8LA 4GQ7A 3M3IA 2AYHA 1B09A 1LOEA 1NY72 3QACA 5FCCA 3WDUA 4F83A 3R0RA 3TRSB 4CDUB 1YO8A 3OGGA 3HT2A 5K0UA 2X53S 3WW4A 1FV3A 1MR5A 4WZCA 3JCIA 3MF6A 2ERFA 3S6PA 3USUB 1V6OA 3AKSA 3JD73 4XETA 3V56A 2A73B 5JZGA 1SEFA 1FNZA 3NAPB 4FPFA 3HT1A 4JGZB 1JN2P 4CTEA 3H8UA 1LHOA 1FATA 2TNFA 4ORFA 3VBRA 4FAGA 5I0UA 1POV0 3BU7A 4EJRA 4B7EA 1GICA 1E57A 4X8NA 2RMU1 1MZFA 1JHNA 5F9TA 1FI2A 5FAXA 3O0WA 1X36A 1C3HA 4MUVA 5FRAA 4QQPA 5E1RA 3GHNA 2XL9A 2EAKA 1S0IA 3DPRB 1LOFC 4UW3A 5DG1A 4LEJA 3BODA 1PO13 3E6DA 2R0FA 4MGIE 1SLLA 1WUVA 3PVBB 4YGBA 5GJ6A 2PELA 3ZMNA 4YW1A 1DFQA 4QGMA 2ZMLA 3PNAA 2HWB1 3AB0A 4HBNA 2WWSA 3WNXA 1U0AA 5CFCB 1U5XA 5EZWA 4HK9A 5IUQA 2VGDA 3ZFFA 2WFF1 3SMHA 2F4PA 3VZKA 3EO6A 3WP5A 4AFAA 5KXBA 1I6XA 2YUEA 3S7EA 3AMQA 4FOWA 4FPHA 4IEXA 4KWLA 1HRI3 1PK6A 3N3HA 1COV3 4I0AA 4I3GA 3ZIXA 3A0NA 4NHKA 4HLTA 1QNWA 4XFAA 3A4UA 5DZFA 4LUMA 1N1SA 3RYPA 1A78A 1Q5OA 2R042 1PM7A 4EN6B 2Q8OA 2XWJB 1Y43B 2ARBA 4E4ZA 4W6WA 2GH8A 3VBOB 4P9GA 1UD1A 1UZZA 2D44A 4K1ZA 3AXEA 1GQGA 5J98B 3LA3A 2C5DA 5KHKA 4XHXA 4BMEA 5IT6A 1C28A 1UN1A 4N53B 1CN1A 3CJIB 5CG9A 3FHIB 4AK3A 2CV6A 2OUJA 1UMZA 4CDWB 4H7LA 3N7JA 1MQTC 2WFF2 2ZKLA 1W6NB 1YLLA 4JRLA 2FQPA 1GFF2 1BVP1 4PDWB 4QX5A 1VBA3 4RR3C 2PAKA 2ZOEB 4UBHA 3MLJA 1RVF3 5HCBA 2XG3A 2QUOA 1Q56A 2HWE3 1IS5A 3USSA 2HWC3 3KLSA 3WG2A 4XMAA 2R30A 3TOJA 1D4VB 2PYTA 2XKOA 1NCRA 1W6OA 3WDWA 1N3OA 3AKPA 4IEYA 3H3ZA 5GLVA 4AVTA 4LLOA 2QJVA 1S0JA 1CR7A 3BALA 1SBFA 1VBB3 3DV8A 4YARA 4XJ8A 3HWJA 1PO12 1PZ9A 3FLPA 4CDUA 4A7YA 1NOVA 1IPJA 2RR13 1C4RA 3TNPB 3ILFA 3OF1A 3POSA 4XIKA 1ZZ8A 1U5ZA 1ND2B 1T6GC 2B5HA 3FLTA 3NAPA 4JGZA 1QDOA 3VDDC 1MZEA 2JICA 3SITA 1GNHA 2X5IB 4LNVA 1VAMA 2XJSA 1NZCA 1RTVA 1HRI2 2BVBA 1W6QB 5IK5A 3QD6A 3MICA 4RL7A 3MLLA 2B9UA 2LTNA 4NO4A 4FPYA 2PHRA 1REFA 4JAAA 3MIFA 1H2KA 1VBD3 4FSJA 2ZX2A 5DUXA 5GZDA 4FPGA 4LO4B 5JR7B 1HQNA 2BYVE 1VBB1 4AFMA 1F5FA 1G86A 3BTAA 3WV6A 1TMF3 3MIEA 3BCWA 4R52A 2RR11 5SV8A 4TZDA 4XEZA 2NYYA 3AYEA 3KB5A 4AEDC 2PHLA 2W0XA 3ME2A 4AVCA 5T5LA 1X50A 5A32B 3B7MA 3GZAA 5BNOC 4D7TA 2HWC2 4BM8A 5K7PA 1REEA 5I8TA 3LA7A 1XNBA 3MI8A 3NWKA 4DPNA 1VBB2 1YI7A 4FPKA 1VBD1 4PBPA 1NE4A 5BNNC 4AWDA 1QKQA 2A6YA 2RS51 3R05A 3VBOA 4FOVA 3B93A 2UWCA 4YGDA 3QBQA 3AYDA 4QQLA 3OPZA 2D5HA 4GB31 1MS8A 2RR12 3VKLA 3AP9A 4KBBA 4YM3A 1H30A 4AW7A 4FXGB 1OOPB 1H2LA 3VBSB 1LENA 1O4TA 3LZZA 1VAKA 2YY1A 2W08A 1XYPA 2EXKA 2WLPA 2GN3A 1AF9A 2WJSA 1ULCA 4YW3A 2XJVA 4AGVA 3SHRA 2BNOA 1VBE3 3H7JA 3RPQA 4A7KA 4CDQA 4AFDA 5L19A 1K5MB 4GULA 4I02A 1MZ6A 1DZRA 1DQ2A 2Z2SB 2CAVA 4BH9A 4YVSB 1ZRFA 1TME3 4N9HA 3WDYA 3I59A 3IPVA 4W6XA 1VBD2 3WOGA 3POYA 4G4FA 2RM23 4IEPA 1LB2A 1DQ0A 2PLV3 4PCRA 1O7FA 4AEKA 5CFDB 4GB32 1FOD3 1RUG1 2ES3A 3HQXA 4YW2A 1TMF2 4IV3C 4LBNA 3WR0A 4ZU5A 4UXAA 4AGGA 3O0XA 1ZZBA 4EWEA 5IK8A 1EV11 3MIHA 4XQ4A 3VZJA 1S2BA 4AHZA 4JRAA 2E7QA 1S55A 5DZEA 4CDXC 1R1A3 2X5IA 4BQ1A 3T1LA 1V6NA 2FZ1A 2Z42A 4HVOA 5CG8A 1CAXA 1W6QA 3ZFEC 5CADA 2GMMA 3AJYA 1M06G 2PFWA 5FFOC 4JC1A 5FLIA 3H1YA 3IMNA 3ZXJA 4GA9A 4AE2A 3ZYRA 1TME1 5I93A 4AI8A 4AVVA 1D4M3 5H9PA 1RUG2 2GNMA 5GLZA 2RM21 1RMU1 4Q27A 1IS4A 1FOD1 3VBRC 1EV12 2VNGA 4V1PA 4RR3B 1J59A 2XJRA 3THPA 2FHRA 3WQ1A 4QQ2A 2EAAA 1ND3A 4QGLA 1QQP1 1I5ZA 3MEPA 5C8CB 4Y1UA 4Q4W3 1H8TC 2WINB 1R1A1 3RS6A 4JTOA 2H6CA 2C0ZA 1VBE2 5DG2A 1IPKA 4A7ZA 4DY5A 3AK0A 4Q4Y3 5GLWA 4XHBA 2WSVA 3HN1A 1DGRN 2IXJA 1TME2 4YZ1A 1WLCA 1XU2A 4AHXA 2EXJA 1RB8G 1JW6A 3VBFC 2RM22 1RMU2 1JH5A 1S0BA 2PLV2 1O3TA 1D4M1 1YHFA 1FOD2 2WIIB 2R073 3SH5A 1PIV3 1S0GA 3RJ2X 2LUWA 3TYJA 3THTA 2BWCA 5HI0A 3V64A 3JQXA 1OOPA 1QQP2 3VBSA 1KITA 1RUF1 4OULA 1OQDA 4FOQA 4N43C 4I01A 4YGCA 1H0BA 1TNFA 3NVCA 3OY8B 1R1A2 2ZX4A 3D5OA 1BJQA 3HR9A 4MV2A 4Q4V3 3WINE 2YGMA 4Q4W1 3VGIA 4GWNA 5D8AC 1TQ5A 3SCHA 5LRRA 1K5MA 3VL8A 2Q1MA 2WNUB 3LOBA 4YW4A 4WVVA 1Z78A 1AYM1 4Q4Y1 2TBVA 4YVSA 1Z7S3 2XBO1 1DGWX 4K3UA 4XZPA 2ETEA 5A33A 3VZOA 1J1LA 2ZS6B 5JWPA 1RITA 2JEMA 5HXVA 1ULEA 2DUPA 1D4M2 2VUAA 5C4WB 4XTPA 1GQHA 3GBWA 5JI7A 3OYWB 2GMEA 3D4KA 4JDMA 1RGSA 4NPRA 1Q8PA 4AYUA 1RUF2 1EYBA 5L7OB 1KDMA 1D0HA 2DCTA 3B3QE 4JGYC 4L11A 4OFGA 3DGTA 2NMOA 2VMHA 5AVAA 2D6MA 4Q4W2 3I8TA 2AR6A 2BPA2 1GYKA 4PF5A 5JCTA 4N7IA 4HKOA 2KXLA 4A3XA 3N35A 2ZHLA 2WL1A 3ZYJB 1AYM2 4Q4Y2 3KCXA 2QCSB 1YWKA 5FMOS 5BNNB 3D6EA 3EQEA 1S0CA 1NCQA 2JX9A 1FNYA 1RINA 4OHWA 3VL9A 1PZ7A 2ZA9A 3AKTA 4HKWA 1C1FA 4KG0A 2E7AA 1RUE3 4QT6A 3R6SA 4CP0A 4C91A 3SNMA 1F9KA 5I8YA 2B46X 2V09A 3ZMOA 4RS5C 1PVXA 4HL0A 2HEVF 2DURA 1C5IA 1PIV2 1UAIA 2A6WA 3FUQA 2WS93 4B29A 2HWD3 5B2GB 5JSPA 4ZU4A 1LOBA 4AVAA 2VG9A 2ZGQA 3ZXGA 4BWOA 2YXSA 4IETA 4OVEA 4BLIA 5FLJA 2ZGNA 3VHNA 4JDOA 4M01A 1VRH3 4P9XA 4G9SB 3VLBB 3VUOA 2WKKA 1XNDA 3M3QA 1WGPA 1NA1B 2YV8A 4M3CF 1ZZ7A 2OUHA 2DCYA 3WHTA 5C8WA 1Z7S2 5KHIA 1FMD3 3MW4A 5FOJB 4IV3B 1MS4A 5T5OA 2O1QA 1PHMA 3WP4A 2JENA 1WLDA 3I4IA 3WXPA 3WDVA 3GZUC 4LO5B 1QHDA 1NXD1 1RUE1 4QPIB 2GNDA 2E63A 4E2GA 1DF0A 1WMDA 3VHPA 1J3PA 1F31A 2GSYA 1W0PA 5T3NA 1R091 3ZN5A 2WT1A 2HWD1 1D2SA 1UKGA 3U0ZA 2VPVA 1LGBA 3RDIA 1YFXA 5JOZA 1YNAA 3KS7A 3OY8A 3VBHB 2VOKA 1HX6A 3AZWA 1SLIA 4RQPA 4F3JA 1SACA 4DY3A 3M7AA 4KNCA 1QOSA 1W6MB 2ZGRA 2MPFA 4OUSA 1OPOA 2XLAA 3RRDA 3JUUA 1DZTA 2B45X 4AG4A 5ABJB 4LHKA 1RUE2 5JPNB 1XRUA 2VVFA 3M4FA 4P9JA 5C4WA 1JBCA 1GZ9A 3LB9A 1AXYA 1LEDA 1N3PA 2ZZQA 1SBDA 1X8EA 4XBQA 2A7AA 3RZZA 4F7ZA 4Y1XA 5ACA3 3WDXA 1R092 3OYWA 3BIWE 2IXHA 3HAGA 1SLBA 2WS92 2HWD2 2YROA 1PGL1 2UU8A 1POV1 1AL23 3WT3A 1H8TB 3IIAA 5L7OA 2AUYA 3B00A 2IZWA 2YZ4A 4YYOA 4H7MA 3HD8B 4MZUA 1PZ8A