3EBRA

Crystal structure of an rmlc-like cupin protein (reut_a0381) from ralstonia eutropha jmp134 at 2.60 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
MLFESINTGCLDGNDTPWMPFAPYSNDVMVKYFKIDPVRGETITLLKAPAGMEMPRHHHTGTVIVYTVQGSWRYKEHDWVAHAGSVVYETASTRHTPQSAYAEGPDIITFNIVAGELLYLDDKDNIIAVENWKTSMDRYLNYCKAHGIRPKDLSTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized RmlC-like cupin
publication title Crystal structure of RmlC-like cupin with unknown function (YP_294607.1) from RALSTONIA EUTROPHA JMP134 at 2.60 A resolution
rcsb
source organism Ralstonia eutropha jmp134
molecule tags Unknown function
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ebrA00
4AQ6A 3M70A 1CAXA 5EZWA 5FLHA 2UY8A 4FAHA 1O4TA 1RC6A 1I6XA 2B9UA 2K9ZA 4Z07A 5FPZA 2D40A 4E2QA 1J3QA 2GC1A 5I8TA 3CL1A 2EAAA 1OMIA 3EQEA 3HIFA 4IEOA 3ES1A 5KHJA 4XFFA 1CAVB 3D82A 3KMHA 2CAUA 4XFBA 2CAVA 4XFGA 4MGKE 4MUVA 1O3QA 5I93A 2XKOA 2GC0A 3HT1A 3EHKA 4N9HA 2IXJA 5FLJA 1YWKA 4D7SA 4EWDA 5KBFA 1ZZ6A 2H6CA 5HI0A 3U10A 1NZCA 4HVRA 2OA2A 3E6BA 4WVZA 2DCTA 4YNIA 4XF9A 1XE7A 5I0TA 2PAKA 2OZJA 2D5FA 2GH2A 4HBNA 4GULA 1O5LA 3ES4A 3USSA 4LLOA 1O5UA 4XF3A 2ATFA 4YSFA 5E1RA 5JSOA 3RPQA 2D5HA 1QWRA 2O8QA 2V09A 5LRSA 5FCCA 1Q5OA 3DV8A 2BYVE 2GAUA 5FDBA 4L2NA 1YFYA 2HJIA 4FT8A 1YFUA 1IPKA 4H7LA 2O1QA 3I59A 4ORFA 1SEFA 1XRUA 2OZ6A 2PHLA 3CEWA 3MZHA 2MHFA 4IEXA 4N9IA 4IETA 1UIJA 3BPZA 3RYRA 2B5HA 1NXMA 1WA4A 3OTFA 3KSCA 1QXJA 1G6NA 1QY4A 4QM8A 4AXOA 3ACLA 5K8SA 2XL7A 2Z69A 4F7ZA 4WZCA 5JSRA 2FQPA 2PYTA 1CAUB 3LAGA 1CGPA 3E97A 3IBMA 3FFQA 5FQ0B 4YRDA 4UBGA 4XFIA 1CAWA 2QJVA 1L3JA 5BUVA 4HVQA 3IDBB 4MGYE 2EA7A 4XETA 5C6CA 1CAXB 3EO6A 1X8MA 1LB2A 2Q4SA 3R6SA 2Q0AA 5I91A 2VQAA 1YUDA 4R52A 5EFUA 1U12A 1ZZBA 1J1LA 4IEYA 3E5UA 4ZU7A 4QX5A 3L2HA 1PMIA 3KGZA 3SHRA 3DL3A 4QM9A 2N7GA 1O7FA 4I3PA 5BV6A 2OPKA 4A2UA 2ET1A 2BNMA 2B8MA 3H1YA 1JUHA 1SFNA 4JVAA 5KHGA 1DGWA 2MPFA 4R8HA 2ET7A 4OLLA 3UKVA 2F4PA 1YFWA 4J1WA 1J58A 4QGLA 1FXZA 4Q0VA 4Z82A 4AVBA 2FMYA 4LA2A 1ZRCA 2VECA 2ZCWA 5LRRA 3FX3A 2CV6A 3UKNA 1OI6A 2Y0OA 5KHKA 5FLIA 3H50A 3U11A 1EPZA 1NE4A 2EVXA 3TNQA 3SCFA 4B29A 1RGSA 2OYZA 2PAEA 1Q3EA 2WC2A 2I45A 4TLFA 3RNSA 4OFGA 3S7EA 3LA7A 2PFWA 1J59A 1Y9QA 3TNPB 4EV0A 4KU8A 2C0ZA 1V70A 4LULA 3LOIA 5JR7B 3U0ZA 3D0JA 3PLQA 1EP0A 2XLAA 5CU1A 4MGZE 1EYBA 4HVOA 4ZU5A 2IXKA 5CVRA 4BIFA 3H7JA 1ZZCA 1CAVA 3FE5A 4LUMA 4MGIE 5F1RA 3DN7A 4D7TA 5CADA 2IXLA 4AQ2A 3NVCA 3S0MA 1EY2A 1X8EA 4HN1A 1CX4A 3IWZA 3MPBA 3FWEA 2ETEA 4I0BA 4Q29A 4LEJA 3CJXA 1ZZ7A 2PA7A 4IESA 5BXXA 3LWCA 3I7DA 3RZZA 3SCGA 3VHRA 1J3RA 4IEVA 3EBRA 4KU7A 1LKNA 3UKTA 2H6BA 2BNOA 4RD7A 3BB6A 1DZRA 1CAWB 3D0SA 4QGMA 1UW8A 1VR3A 1GQHA 1DGRA 4HN0A 4IEUA 2Z2SB 3NJZA 3NSTA 5J48A 2KXLA 4IEPA 3HT2A 2UY9A 4XEZA 1FT9A 4UXAA 5AVPA 3H1MA 5I0SA 3OF1A 4XF4A 3WW1A 4YARA 2PTMA 3RYKA 4MH0E 4NVPA 4I0AA 4BH9A 3H8UA 3IIAA 4Q0UA 3H1WA 4FBFA 5I8YA 4PIZA 3B02A 2IXHA 4LA3A 4EROA 4P9GA 3ETQA 1YLLA 4K8FA 4PIXA 4AVAA 4KWKA 1ZREA 4DINB 3SXWA 4MZUA 2XL9A 3ROUA 1XE8A 3E6CC 4KL1A 3E6DA 5E16A 1LRHA 5FPXA 4O9GA 3KCCA 4JTNA 4LUKA 4QXKA 4XFCA 1CAUA 1YHFA 4JV4A 2BEOA 3OGJA 3FHIB 2QVSB 4IEZA 2QDRA 5FQ0A 1TQ5A 1ZRRA 1I5ZA 2PQQA 3EJKA 1VJ2A 4HSLA 3SCHA 4ONUA 1X82A 5BPXA 1PM7A 5J7MA 5LEJA 3MDPA 1YFXA 1WGPA 2Q1ZB 4IEQA 2H0VA 1RUOA 1QXRA 1O3TA 1NYWA 1UIKA 3GBFA 4BHPA 4KWJA 4L11A 5J3UA 4I2OA 1ZNPA 2D93A 3NL1A 5JCTA 3H7YA 4E2SA 3FJSA 4FAGA 2XGXA 3GYDA 3OD0A 3BCWA 1ZRDA 2UYAA 3CO2A 2XHKA 2BNNA 5KHHA 3ELNA 1GQGA 3I59B 2GZWA 4PIYA 4UBHA 5I0UA 4X6QB 3QACA 2ZKLA 2GU9A 3WW2A 3JZVA 4MX3A 4Q0QA 1OD5A 4WBBA 1WLTA 3NW4A 3NKTA 1ZVFA 3MYXA 4LTAA 1DZTA 2K0GA 5I8SA 4IERA 3I54A 1UD1A 1OFNA 3WW3A 4F8AA 3H3ZA 3RDIA 4EWAA 3WW4A 2CGPA 4Q0SA 4HLTA 2XLGA 5C8WA 1ZX5A 4PJYA 4JTOA 4IEWA 2E9QA 2UYBA 2QCSB 4J1XA 2BGCA 1RTVA 2WFPA 3BU7A 4I09A 1SQ4A 2P17A 3E5QA 5JSPA 3KGLA 3IDCB 4O9EA 1O3SA 3RYPA 4XFAA 4Q0PA 4I01A 4BYYA 5BY5A 3N4MA 1Y3TA 2PAMA 3CLPA 4E2GA 2VPVA 3O14A 3M3IA 2Q30A 2HKXA 3LA2A 4MV2A 3QOPA 1X7NA 4KWLA 3ZDSA 2IXIA 1VP6A 3OCPA 1RUNA 1O3RA 3PNAA 4HMZA 2GC2A 3C3VA 2QNKA 1ZZ9A 1ZZ8A 5LEKA 5T3NA 5D1IA 1IPJA 4HSJA 2IXCA 4HZFA 4META 4YYOA 3FZ3A 3ST7A 4AVCA 1RL3A 1UPIA 2MNGA 3DKWA 4QGNA 5I0RA 1HW5A 3LA3A 4ZU4A 1H1IA 1Q43A 4EWEA 4I02A 4XF1A 5KHIA 3G7DA 1H1MA 2IC1A 3CF6E 3LZZA 4QMAA 3S7IA 4XF0A 1ZRFA 3SMHA 3H3UA 2XKPA 3PVBB 1J3PA 3BALA 3HQXA 2XLFA 3E5XA 4X6RB 1UCXA 4CYDA 5JAXA 2GC3A 3H9AA 4XFHA 2PHDA 1FI2A 1LR5A 1NE6A
chains in the Genus database with same CATH superfamily
3FLRA 4AZZA 1QQP1 2X5IA 5FJKA 5EZWA 1JMUB 4EYUA 2UY8A 4FAHA 1O4TA 4N53C 1QOSA 5FTTC 2JIGA 2EAKA 4Y33A 3M3QA 3VDDA 1XSQA 4FXKB 3KVAA 3NNJA 2G9GA 2XVKA 5GZEA 1JZ3A 4W4ZA 1DYKA 4HXCA 3J8F3 2ADEA 3DCQA 4YZ5A 2WNUC 1OMIA 4UFIA 4IEOA 4JZRA 4PI0A 3UJQA 5GLUA 5KHJA 5JIUA 1SZBA 2IVIB 2P37A 2E7AA 4MGKE 4W6YA 5J1XA 1OUXA 1IS4A 1W0PA 4QXHA 4XZPA 5BNPA 4QWNA 1FV3A 1U5IA 4JC1A 3G6JB 3FUOA 4L92A 3HT1A 4Q1PA 2WWSA 5JUVA 4N9HA 1S0BA 5HCBA 5F6KA 1K5MB 1W8NA 2YROA 2X05A 3ZN5A 2I2SA 4NHKA 4CSWA 2F6BA 2R042 3OPWA 4BB3A 3V0AB 4K9SA 2DURA 2RJLA 4I3GA 4A42A 2ZMKA 4ZPIA 3M1HA 3RZHA 2E31A 3ATGA 1Y7BA 3QD6A 4ZXEA 4AFMA 3OSDA 1OF4A 5I0TA 2QQUA 5FUPA 3UL2A 4JQRA 5C9AB 2C9AA 5FZ3A 2OZJA 2D5FA 3S30A 5DZEA 1CR7A 2I07B 4GJYA 3ES4A 4GULA 5IUQA 1QQP3 2W1QA 4GMP1 4YSFA 5JSOA 2XPJA 1REEA 3M8LA 4IGOA 1IKPA 4NHMA 1COV1 1QWRA 3TWIA 2HWB2 2O8QA 5L9BA 1Y4WA 2V09A 1TMF1 1HN1A 4CXXA 4PDWB 5FCCA 1Q5OA 3VD4A 2BYVE 2D7FA 2ZGPA 1HRV3 2GAUA 1GWMA 2Y38A 5IATA 4MXWA 1W0NA 1YFYA 2WNEA 3NV3A 3UT0A 5KXDA 2W92A 2CWMA 3GGLA 2O1QA 3O7OA 2W87A 4YVSA 3I59A 1XRUA 1OVPA 4DY3A 3AVRA 3I2JA 1LECA 4YG6A 2VW2A 3J7NA 5H9SA 2E7TA 4N9IA 3GZTB 4IETA 3HJRA 4AW7A 5DUUA 1W9SA 4QHOA 3NO8A 1VBD3 1GQPA 1BEV1 3IKWA 2VO5A 2HBUA 1DHKB 4HOOA 4NHXA 5FY8A 3WG2A 1PIV2 1WA4A 2A6XA 4CEYC 3FBYA 3BGAA 1QXJA 4LIVA 4JRLA 3GCWA 4JDNA 3I3QA 1LHVA 2YU2A 3T0AA 3VD9A 2YPJA 3K3NA 2VQ0A 5JSRA 2OQ7A 3O1VA 4MG2A 2PYTA 2QZ2A 1CAUB 3C7EA 4LMFA 1RUJ1 2EF6A 4NPMA 4DXSA 1NLSA 4LBKA 1MS9A 4EJRA 3JB4C 4Q2FA 3RSJA 1VB4A 1VAVA 2R0FA 3B01A 3FFQA 5FQ0B 4GMP3 4YZ3A 5A32A 3LE0A 2X29A 2ZS6B 1COV3 4KMQA 1W6OA 1MZ5A 3PU8A 2Z79A 4XFIA 2Y33A 1TMF3 3I97A 4Q4Y1 2JKXA 1U5XA 1UZWA 2VNVA 4FO9A 4MGYE 2JG8A 4KI5M 2RM23 4XETA 5A3MA 5FPLA 1HDKA 3B00A 4DUWA 3OEBA 4CDWB 4GB31 1VBA1 2Q4SA 3KD4A 2RG4A 3OOXA 2Q0AA 3R6SA 4AYUA 4FPKA 3GZAA 5GALA 4A41A 1E5RA 4LHNA 3ALQA 3OUJA 4INDA 2HWF1 3LEIA 1EV11 1J1LA 2JDZA 2RS12 3ZFGC 3T1MA 1S0IA 3KGZA 3SHRA 4BK4A 3IPVA 5LA1A 1F8VA 3ZR6A 1H8TA 1LHNA 1PO13 1W8TA 3NWKA 4FPJA 1UMHA 2OKXA 5CAZA 2N7GA 2ZX1A 1JXNA 4P9WA 5K9YA 5L36A 1X50A 5ABJC 2ZKNA 3PUHA 4XPVA 4LHLA 5A7SA 3H1YA 1S2BA 1AX1A 3ME2A 4QDSA 3ZX7A 3AP4A 3VBRA 2MPFA 4R8HA 4Q1RA 3LCPA 2VM9A 3Q8FA 3GJBA 1RUJ3 1Z78A 1ASJ1 4ASKA 3MLJA 4E4ZA 5K0UA 1JYIA 4GKXA 4QDRA 1FXZA 2XQRA 4RQPA 4Q0VA 4AVBA 1PZ7A 2JG9C 4ES9A 2DU0A 1R1A1 4QQ2A 1RIRA 2ZCWA 3UKNA 1V9U1 1IOAA 3FX3A 2FCTA 5A1AA 2FZ1A 2ZGRA 1OI6A 5F37A 4Q4Y3 5KHKA 4KWUA 5FLIA 5FYMA 1JOBA 3T2PA 3FN9A 4RS5C 2WIIB 1EPZA 2Q5TA 5FREA 1CJDA 1JU4A 4R9AA 3TNQA 3THTA 4RSUA 1GOGA 4CP2A 3JBG1 4GB33 1VBA3 3MF9A 1FAYA 2PAEA 2OYZA 1ENRA 5T5JA 4Q4X2 1RUI3 4IXLA 3T30A 4LK6A 4CCEA 4Z1VA 3GHMA 4XW3A 4EN6B 3RNSA 1HB2A 5C71A 2DUOA 5JZGA 1UOJA 1H1AA 3T3YA 2PMWB 4CP1A 4Y4RA 2R062 3RZGA 4EV0A 3F95A 4IV1B 4N90A 1UYPA 2C0ZA 3D6EA 1EV13 1NA1B 3OBZA 4XUOA 1ZM1A 5BNNC 4S2HA 1HIXA 3LOIA 5D8AB 1AUYA 1JTZX 1QDOA 4LK7A 5DMYA 5JOXA 2XLAA 5CU1A 1S0DA 2XG3A 1D7PM 3ZXLA 5JLVA 4HVOA 1DYPA 2D3RA 2YBSA 3MBWA 4HPKB 5CB7A 2IXKA 3AKSA 2LALA 3H7JA 2JDYA 2RS33 3UGGA 3VKNA 3I8TA 1BBT3 3KWVA 4DS0A 3DN7A 2Q8DA 1HXS3 4D7TA 5CADA 5F1RA 5IHRA 3WLUA 2PN5A 3NVCA 4C0BA 3S0MA 1Q8VA 4QQHA 1EY2A 4AFCA 3HMYA 5F5IA 3MV01 1ND2A 3P3NA 3FWEA 5I0DA 2WNOA 4AEDB 4XURA 1RINA 5LB6A 2PA7A 4TSVA 1TZOA 4Q5OA 5BXXA 1VIWB 4PHZA 5T5PA 3J7LA 3SCGA 4JX0A 4NE9A 2QDNA 2DVGA 1NQJA 2WWUA 4IEVA 3ZYIB 2HWC1 2D6KA 1WCQA 3EBRA 2EIGA 3HQRA 1MEC2 2P3JA 1UOGA 3AXEA 1F35A 3M3CA 1CAWB 3AMQA 1RUF1 1UW8A 4QGMA 2JDHA 3AL6A 2HLEA 5C9AA 1VR3A 3LPFA 5CG9A 4AI9A 2XJUA 5CG8A 1UQXA 1QJX2 1MQTB 5L9VA 2ARBA 1GYKA 3AX4A 1PHMA 4PDWA 1JW6A 1CD3G 4UXAA 2LUWA 3RZKA 4K8RB 3AFKA 3PTYA 3FLPA 4CUAA 4CDXB 1W6QA 1VBE2 1IZ3A 3ENRA 4K21A 4LBLA 1UL9A 4SBVA 2PLV1 3LPGA 4AHWA 2EXKA 2HEVF 2Y8KA 4BK5A 1GZCA 2BQPA 4Q0UA 2BU9A 3K51A 4B4RA 3JCIA 4AI8A 4AGGA 3B02A 1WBLA 4ATEA 1XXNA 3ZOIA 4P9GA 4ITCA 4Z2WA 3ETQA 3VHNA 4P14A 3UESA 4EZHA 4ZZ5A 4QKFA 4XQ4A 3RS6A 3ZLIA 3AKQA 2RV9A 4DUXA 3C7FA 1QJY1 1POV1 2QBXA 1VE0A 4MZUA 5AC91 3NNLA 2ZGTA 3GF6A 4RGKA 1MZ6A 3OUHA 1HRI3 1LRHA 3VDBA 4O9GA 1WMDA 1LGNA 2R30A 4QXKA 4NN0A 4CDUA 2AEZA 2W3JA 4XFCA 2VUAA 1CAUA 4GH4B 1PMHX 3IMNA 2ID4A 3L9JT 1XU1A 3AZYA 2C6SA 2QVSB 2ZTNA 3J8F2 3LSDA 1PX4A 3T09A 4ASMB 1G9FA 2LM3A 2D98A 3OUIA 4K3UA 2FMDA 4NRMA 1WKYA 4WM7B 1UYZA 2X09A 1JZ5A 4EN7B 5FQ0A 2G9FA 1TQ5A 5GZGA 5GKAC 1BK1A 3GALA 5FY7A 5CFCC 3ETPA 1F5FA 3IM0A 3EJKA 4BQWA 4P9JA 3BKZA 4ONUA 3KLSA 4DEVA 1CIYA 1PM7A 1RUD3 4X8NA 5J7MA 3MDPA 3ZMOA 1XC6A 2Q1ZB 2Z4FA 4XBQA 2DCKA 4LLFA 4QT6A 1W8HA 1WCUA 4NR1A 4P08A 2BFUL 3ZYBA 3ZXKA 4CDWA 3BOPA 3N9OA 4NAOA 3SNMA 2PLV3 1DYOA 3VDDC 3WEZA 1C28A 3JXSA 2JKBA 3TRSB 4CCMA 4GWJA 4CDQB 4UW3A 3WX5A 2WQZC 4AAPA 2YBPA 3FJSA 2VCBA 1I5PA 3AP6A 4UFHA 3IZOA 4Q26A 3BTAA 2VUDA 5ACA1 4YW7A 1W2AX 3IT8A 4O7XA 4FAGA 2VMGA 1OOPB 1PVC3 3GYDA 4Y1UA 3OD0A 1QJY3 2ZGNA 5AC93 3AXDA 3KV4A 1WLCA 3U75A 5KHHA 1UKRA 4HKOA 1QQP2 3SKJE 4K20A 4XC9A 1A8DA 1T6BX 4QQLA 2GZWA 1W2NA 4UBHA 1MS1A 4LBQB 3U4XA 2P6CA 2RDRA 3PJQA 2CGOA 3QACA 2W0XA 4XJUA 3WW2A 3JZVA 1HRV2 1OD5A 5FYBA 1RITA 3APBA 1SLCA 4UFLA 3O0VA 4MVTA 2AZ5A 1S0JA 3DKQA 1TNRA 3FBMA 3OD4A 3FFZA 1BCXA 4TWTA 4DNYA 5DABA 2Q8EA 3EXUA 5ANNA 2GALA 3KZ4C 5FY9A 4AHZA 1V6OA 3ORJA 3MGUA 2JWPA 3OY8B 3WQ0A 2DUPA 2A3XA 4KGGA 3WNOA 3HNBM 2OX0A 1VBD2 4LE3A 3WW4A 3B69A 2ZHLA 4FOWA 1RXGA 2RJ2A 2CGPA 1FATA 2HEYF 4HLTA 4K1ZA 1O4ZA 4QQOA 4Y22A 1GBGA 3RFRA 5CNAA 4URAA 1N47A 3ILNA 1WZXA 2Z5WA 4JTOA 3CBNA 4IEWA 4IE5A 2AR6A 3KT1A 3MIEA 2D6LX 2WO3A 3C2UA 2G9ZA 1QGLA 1DBNA 1R083 4PQQA 2FDHA 1LAJA 4IV1A 1VBC3 4I09A 4YVSC 5ACA3 3T1LA 3E5QA 2VNOA 4K6BA 3OBAA 1NA1A 1OURA 4PBOA 1GNHA 1YIPA 4BQ1A 5JSPA 4O9EA 4OVEA 1RMU1 1O3SA 4B7EA 1VBB3 3TB0A 3HNMA 3OB8A 1Y3TA 2PAMA 3LDKA 4OUEA 5FZLA 3JQWA 1RUC1 4HPKA 1COV2 3GZEA 2YBKA 4KG0A 5LBEA 1TMF2 2ARXA 1H6XA 4XUQA 2XJSA 3QOPA 4L8QA 2RS11 1X7NA 3Q8AA 1VP6A 3MICA 4XMAA 4YGEA 3SH4A 4Q8LA 4LXLA 2RM22 4OI1A 5HV0A 3WDTA 2VXJA 1O3RA 5DAVA 3PNAA 3ZYFA 2ZXQA 3NAPB 1XU2A 5L19A 1ZZ9A 1SBFA 3WHTA 3A0NA 2ZX0A 3GDBA 5LEKA 1UY1A 4AEDA 3C7HA 1UNBA 2BWCA 3D8CA 3IIIA 1AVBA 4HSJA 4LPLA 4META 1URXA 2JIJA 4HL0A 1WD4A 1K42A 3CQOA 2UURA 3AYCA 4XDPA 1RL3A 1D0HA 2MNGA 2XOMA 3DKWA 4QGNA 5I0RA 1HW5A 1O6UA 2E63A 4ZU4A 1H1IA 3ZFEC 4YZ4A 1PO12 1Q43A 4AI2A 5IK5A 4H14A 3BI3A 2YGLA 3DECA 1OUSA 5KHIA 1FX5A 4CPBA 2IC1A 1W05A 1LOFA 2JG8C 5FUNA 3UK9A 3FMGA 5DG1A 5FFOC 5FUIA 4Z8BA 2J22A 1Q8SA 3SMHA 5C8CC 1QHDA 1MQTA 1W8OA 2E7QA 1WW7A 2VOTA 4OZXA 5DZFA 4BJ0A 4QB2A 4HK8A 1K12A 4XE9A 4NOTA 2V5YA 2ZGLA 4EN9B 1XSRA 1H9WA 1RUJ2 2B7YA 2ORXA 1H6YA 1QH7A 4AHYA 3O0XA 1RMU3 1KITA 3CJIB 4CYDA 5JAXA 2XMLA 1F2NA 2W9XA 2R1DA 4N8MA 4Y1YA 4C1XA 4OQ8A 3WCSA 1RUC3 5A33B 2R061 1LR5A 1NE6A 2VW1A 1DF0A 3DPRB 3URFA 3WDYA 4AQ6A 1DQ5A 3ZYHA 4CP0A 1J84A 2VTXA 4Q4Y2 2VZOA 4JRAA 3GM8A 4CXYA 1CAXA 3MIFA 3RZLA 4C90A 2BGOA 2Y6FA 4TN7A 1YO8A 5IK7A 2NQYA 3VBRC 1W8FA 4GB32 1VBA2 1IS3A 5K4LA 1RUI2 4GA9A 4M3CB 2PQSA 4AHXA 2WKKA 1J3QA 2BUKA 3KQ4B 4LO6B 3UGHA 3QCWA 4RR3B 5I8TA 5K0UC 5EXOA 1PMJX 5E6HA 5LK7B 1PVXA 2V5DA 3JU9A 4AVTA 1LJ7A 1CAVB 1EV12 1UXXX 4IL7A 3KMHA 4FCAA 4Y1VA 4D8MA 4M0NA 2CAUA 4NMIA 4FPOB 4DZGA 1O3QA 4GH4A 1MPXA 2WT1A 2XKOA 4FPEA 1KD7A 5F2SA 3VZMA 5JDBA 3MIHA 3I3EA 3SLIA 4WM7A 3VBFA 1JU3A 1YWKA 2RS32 2WO2A 2LTNA 1O59A 3BU0A 5KBFA 2BDRA 3EMRA 1ZZ6A 4PQ9A 1BBT2 2H6CA 2GNMA 3WDVA 5HI0A 1HXS2 3U10A 4HVRA 5AVAA 3SC7X 2QUOA 3N36A 4ZONA 1UY3A 3RJ2X 1MVQA 5BNOB 4XAEA 3E6BA 5JZGC 5HXVA 3BIWE 4ZHNA 1M06G 4R9BA 1JH5A 4MHUA 4HONA 4YNIA 3U1XA 1XE7A 3GZUC 4NIIA 4BDVB 3PU3A 2PAKA 2Q1MA 3LKJA 4QPIA 4LBOA 3VBOA 4XVHA 1ULOA 3B9IA 1O5UA 1L7QA 2D97A 4XTMA 2ATFA 2EIDA 5E1RA 4CDQA 1BKZA 2DFBA 4FVVA 3RPQA 2D5HA 1IKQA 5LRSA 1IS6A 3OGSA 5F32A 1OFSA 4L2NA 1HV1A 1OOPA 2HJIA 3NMBA 1VBE1 3BODA 2ZHKA 2VBBA 3I49A 1YFUA 2VBDA 2WUHA 5T55A 1ND2C 5JR2A 4D6SA 4LBQA 3POBA 1LOCA 3AP5A 5GZCA 1JBCA 1E5SA 2MHFA 4ZXKA 4CPBD 5LCWL 4KG8A 3AP7A 1ODMA 4RYDA 3RMXA 2FHRA 5C33A 1QF3A 1UIJA 3KF3A 1V6MA 3BYWA 3DGTA 3NJYA 4IE6A 2B5HA 4Y24A 4WVWA 1RUG1 5KWRA 1M4WA 5FYSA 2ZGUA 1AYN3 5C9AC 3P3PA 3KSCA 5F3EA 1QY4A 2PHUA 4FI9A 3OY8A 1UX7A 3VLBB 4XJAA 1GWLA 5IFTA 2FQPA 4JKMA 1CGPA 3J8F1 4CCCA 4CTEA 5EJZB 2ZX3A 4PDWC 1WW5A 1TG7A 5FXXA 3AMPA 1Z7S3 4CRQA 3C7OA 2VMHA 1IPSA 1NCQC 1HRI2 5HCFA 5ERLA 4YRDA 1UZZA 2YC4A 1MS4A 1UY0A 3POWA 3DEMA 4N43B 4XUPA 5F5CA 1DGRN 3T08A 2P4EA 1L3JA 2JE8A 1NLQA 5BUVA 4AAXA 2G4IA 3MUY1 1KFXL 4LT5A 3WDUA 1SHWB 4IE4A 4NIDA 1UX6A 1MS0A 2VQUA 3BUCA 5C6CA 2JE7A 2EXJA 2OQ6A 3CNAA 5H9RA 3ZM8A 1X8MA 1L7RA 3HBZA 4MGTA 3I3MA 2D6OX 2XB6C 2JB8A 3ZXJA 4LO4B 3LIHA 1H2MA 5I91A 2A6WA 1JZ6A 2HYKA 1YUDA 4OUSA 4B4QA 2FCUA 1W3XA 4CEWB 4R52A 1REFA 2F4LA 3J7HA 3TYJA 4Y20B 3KCXA 1RUD2 1YI7A 2AGSA 4BMEA 2VQTA 4IEYA 2XDVA 3E5UA 1H4HA 4BQXA 2RMU3 3WP3A 2W5FA 3GBGA 3DL3A 3UGFA 3WP5A 1PK6C 2NN8A 4CDUC 1RUG3 1ZYBA 2PLV2 1O7FA 2ZOEB 5FMCA 4F3JA 5A6XA 4DRRA 4YM1A 4CVUA 4LBMA 3ZKYA 3M3OA 2BNMA 2B8MA 1NT0A 2K2SA 4BLIA 1C5HA 1HRV1 5KHGA 1DGWA 3WNLA 1ZA7A 2FDJA 5A1LA 1ND3C 3UKVA 4C8DA 1PVC2 5C4WB 1OQDA 3NKGA 5FYYA 1QJY2 4QX2A 1DFQA 4J1WA 2VL4A 5AC92 5A7PA 2RS53 3VN4A 4BCUA 4Z82A 2DVFA 3TEXA 2HH9A 2WLPA 3MUZ1 2ES3A 3HEIA 1TME3 2VECA 4CDWC 1LHOA 2CV6A 3VZKA 2GN3A 5DUVA 1VBD1 1SCRA 1OT5A 2PXJA 2Y0OA 2VOKA 1FV2A 1H9PA 3MHZA 4FOQA 4LHSA 4UOJA 3UV9A 1DQ0A 3B9CA 1QNWA 2WR9A 1RB8G 1NG0A 2J1UA 1NE4A 2EVXA 1G9CA 1Z0HA 2FDGA 1DDLA 3USUB 3CJIA 3ZPYA 1UZVA 3ACHA 3MF6A 1RGSA 1Y43B 3M7AA 2WC2A 3P6BA 3LEGA 2W95A 4ISRA 4P9XA 5FKCA 3DPRA 3S7EA 1GZTA 2VMIA 4A44A 2PELA 1Y9QA 3TNPB 2ZX4A 3WF0A 5JI9A 1OSGA 3POFA 4Y3OA 4IGQA 3W21A 1WD3A 2Y64A 2CSGA 1SLLA 1YEWA 4YVWB 3U0ZA 4CUBA 1AJOA 4D69A 3PLQA 3WG3A 2DUQA 3O0WA 2PHWA 3DYMA 3MIBA 1R082 1SLBA 4FOVA 2FDFA 3VBHB 1VBC2 2FD8A 5ACA2 4YZ1A 1ZZCA 1CAVA 3DF0A 2RM21 4LUMA 4LE4A 1C57A 3OG2A 4JAAA 2Y6LA 1AJKA 1LTEA 1VRH3 2UWBA 1VBB2 4N7UA 3WUDA 5IAVA 4AF9A 1E57A 5DQ0A 3WF2A 3PUQA 4JGZB 1US2A 1CX4A 4OHWA 5A70A 3IWZA 4Q27A 3ECQA 3AC0A 5DAXA 2GP3A 2BERA 1UYXA 4E8DA 4E27A 1LOGA 3CJXA 3H8RA 3MW2A 1OH3A 1AX0A 1ULEA 1ULPA 3HBKA 3LWCA 4IESA 1POQA 2E6VA 1J3RA 4H3WA 4JHZA 4UYBA 1PO11 4OQ9A 1BJQA 3WUCA 2BVBA 3THDA 4BU2A 5L73A 5BNOA 3UKTA 2XQXA 2BNOA 4Q4W1 4O65A 3D0SA 4WM8B 1GOFA 1NA1C 1UPSA 1JN2P 4IV3B 3Q8EA 3R4UA 4P02B 2VTXJ 5FMOS 4QX3A 1N1VA 3AJYA 4HN0A 4MYEA 4IEUA 4BWOA 2VXRA 3OGRA 2GMEA 1QMJA 1XYOA 3BTXA 2KXLA 3MIDA 5DAWA 3HT2A 2UY9A 1FT9A 5FZGA 3SQOA 5AVPA 2XUMA 2JDKA 5FAXA 4Z92B 1MR5A 2UWCA 5D21A 2QTWB 4ARYA 4XF4A 5FZ1A 1QDCA 5E8AA 5EQUA 3RYKA 2ZAAA 4IQPA 4AWDA 2DTYA 1HB1A 4UFKA 1WCSA 4FQ4A 4AEDC 1LENA 3IIAA 3H1WA 3LB9A 3SEEA 4FBFA 5I8YA 3A21A 2VZ3A 1LGBA 1RMU2 5FZKA 4S2FA 5GJ6A 1AL23 2O8OA 5CKQA 1RUI1 4N53B 5FZHA 4JHTA 4PIXA 3VZLA 3WQ1A 2CY6A 4UFJA 4AVAA 4ATFA 4DINB 5CEHA 1GICA 1RUC2 3SXWA 3PHMA 5IK8A 4QX7A 2XL9A 1O8PA 3ZN4A 1G9DA 3N9LA 3ON7A 4LO8A 5IT6A 4CP9B 2Q8OA 3E6DA 2WNUB 2KA3A 5FPXA 3U14A 4JTNA 4LUKA 1MQTC 2WN3A 4QPGA 5DAPA 3S5QA 4Q4W3 2XVGA 4PCRA 1R091 1WMEA 5FRAA 1I9RA 2OUJA 1DQ2A 2BEOA 2WN2A 3OGJA 3VBUC 4D6QA 1BK0A 4IEZA 2RS31 3JUUA 3WF3A 4ET7A 2QDRA 1BBT1 4MADA 4BQ4A 3PMEA 5FYZA 1HXS1 2JDNA 3BPSA 1I5ZA 2VE1A 3D4KA 2WZPP 4N43A 3ZXFA 1SMVA 1OQ1A 4HSLA 2ZACA 5IVFA 1H0BA 2LRPA 4LJHA 5LEJA 1TEIA 4BPZA 1K45A 1A3KA 2A3YA 5F39A 2HWE1 4BXSV 5BYNA 1RUOA 2ZAHA 4FTBA 4DMIA 1QXRA 1O3TA 4GD4A 5C5TA 4KWJA 2O14A 4HK9A 3JB8A 2R1BA 3RZJA 5H9QA 2A5ZA 4I2OA 2D93A 2QQNA 4Y20A 5IVJA 2B39A 1GLHA 5F3GA 3P1IA 2ZEYA 3LQCA 1KJRA 1GWKA 3WR0A 4FOYA 3K77A 3JD71 4JKKA 1GP4A 1OVSA 1ST8A 4YGBA 3POGA 3BCWA 4ZY9A 1OC1A 3N9MA 4WVMB 1JZ4A 3KVBA 1SCSA 2BVVA 3AM2A 1QOTA 3U37A 1ZBE3 3L2YA 1Q8OA 5F6LB 3VD3A 3X29B 4WM7C 2BOIA 4X6QB 3VBFC 3T2TA 1F5JA 4MX3A 4KNCA 2A73B 4Q4V1 4AE2A 1N1YA 1R093 3ZYJB 5DZGA 2W94A 4FPCA 1CZTA 2TEPA 2YU1A 5K7PA 4DFSA 5IVVA 1KDKA 1ULCA 3NKTA 1V0AA 4E8CA 3WNPA 1ZVFA 2OS2A 2IFWA 2WS91 3O1TA 2JICA 2OVUA 3N7LA 5I8SA 3TOJA 5KR7A 1UD1A 4M01A 4XQDA 2OT7A 4QPIC 3VBOC 1BMV2 4LR4A 2X8KA 1PNFA 3MO4A 4Y5SA 5A3UA 1JZ8A 2BPA2 4EWAA 4MO3M 1GP6A 4PBPA 5FZ6A 1K5MA 1NUKA 3VGIA 3KS7A 2HWE3 3ZYGA 4XZUG 3USUA 2FBEA 2B4KA 1FOD3 2XLGA 4QKBA 5C8WA 4PJYA 1HRI1 4QXCA 1AYN2 2A3WA 3V0AA 1K5JA 3AK0A 1OOPC 4U2AA 3WY6A 1T2XA 2X53S 2ZGSA 4AG4A 2E9QA 1WWYA 3WQBA 3INAA 1DQ1A 1WCDJ 2R16A 4CU7A 4HANA 2XH6A 1UXZA 4J1XA 5FIXA 1LESA 1SQ4A 2BGPA 2P17A 4XYXA 5LWBA 5A7WB 3JD73 4YVWA 3RYPA 1Y9MA 1V6JA 1G9BA 3IB3A 4I01A 1Z7S2 5J36A 1IQAA 3KM5A 1UOFA 1PO21 2VPVA 3RZMA 2Q30A 4MOAA 1HX6A 4IE7A 4QQPA 3AVSA 5IYYA 3A4UA 5HCHA 3POYA 3MEPA 1SDWA 3ZDVA 2ZGKA 3BOWA 3LA2A 3VBSC 1GR3A 1RUD1 4YW6A 5A3OA 3VBHA 1EUUA 1FPN3 1RJ8A 3PUSA 5FYHA 5GZDA 3M3EA 4Q4V3 3ZDSA 1XE0A 2W91A 2DVAA 4GIQA 1SLIA 2RDSA 2DYCA 1V6IA 3LF7A 1RUNA 1AR63 4J6GA 1UOBA 1A78A 5A6ZA 2QNKA 2NZ9A 4JGZA 2Y6HA 4CCNA 1VALA 2ZEZA 1D4VB 2WS93 4F83A 3T4VA 2A71A 4QXBA 3M2MA 2BRTA 4LIUA 2IXCA 4OMCA 5ABJB 1YI9A 1W90A 4OI4A 3W59A 1U5ZA 3FUQA 2XWJB 2ZMLA 1PVC1 3PJYA 4NJ4A 5EV7A 5IAXA 4UW6A 3WDXA 2RMU2 1ULDA 2VGDA 1EUTA 2ZZJA 3LA3A 3LD8A 4FPFA 1WBFA 4LBNA 5F7UA 2XWBB 2WWJA 1RUG2 3GNEA 5F2WA 4FPGA 4EWEA 4WM8A 1W06A 5FO8B 1QEXA 3G7DA 1H1MA 2F17A 2AH2A 2VZQA 5FYIA 4UFMA 2JG9B 4A3XA 1JYVA 3H3UA 5T5LA 4E4DX 1FMD3 3POIA 5F8PA 1GU3A 2J1EA 3ACFA 4NRQA 2VMCA 1G9AA 3O1UA 3IDEA 3HN1A 3THCA 1CZVA 4OCTA 1C8M1 4MHRA 4D7YA 3N9NA 2RS52 2ZJCA 4RS5B 1YQ5A 3SISA 5C70A 3K2OA 1PO23 2GC3A 3H9AA 3PDQA 4XFHA 1KRIA 1TME2 5IVCA 2W1WA 4AVCA 2X5IC 2HWD3 4NUBA 4RHV3 1S0EA 3AMHA 1V6NA 2R6QA 3KV6A 1RC6A 2GH8A 3WD5A 5LBBA 4YPJA 3ZFFB 2B9UA 4N53A 4YM0A 1NLRA 3O12A 4BMBA 5BNNB 1H8VA 2D40A 4E2QA 3K48A 1GV9A 4E4HA 3I2HA 1R081 3WF1A 4CA9A 4PLOA 2XXZA 3B5LB 5J09A 1VBC1 3CL1A 2EAAA 4NIHA 4CP9A 4QB6A 4XQWA 3EQEA 3HIFA 3U07A 4YLZA 4RGGA 4ASLA 4CCJA 2WNUA 3I2GA 3D82A 1VBB1 4CUCA 5FZEA 5C3QA 1XQNA 4XFBA 4XFGA 4A6OA 1JYTA 5FP9A 5FZ9A 2WZR3 2YZ4A 5BNPC 1LEDA 2YY1A 4MUVA 4OMDA 4YG0A 1TE1B 1JOJA 1NCRB 5A3NA 1W9WA 4GXLA 2IXJA 1CIWA 5FLJA 3CJIC 5JVVA 4D7SA 4EWDA 2XR4A 4GWNA 5FWJA 4XIKA 3W9AA 3VKLA 3ZN6B 2AEYA 2CL2A 5DPNA 1VRH2 1HQNA 4B1MA 2GNTA 5FPAA 1VMFA 3ZO0B 1CJPA 1C8M3 1DQ4A 5FZIA 3VKOA 2IFRA 1KQRA 1RUH3 1F31A 4WVZA 3J7MA 2NYYA 4LKFA 1W9YA 3KV9A 1WW6A 5JOZA 3N9PA 1OLQA 4LLOA 1PGW1 4XF3A 4RFRB 4AFAA 4YGCA 5FO9B 4FTEA 3POJA 2KM2A 2PHRA 5FKBA 1W8WA 3ZIWA 1E5IA 3DV8A 2YHJA 1RHI1 3MIGA 1HB3A 5FDBA 4UF0B 3NV2A 1N3PA 5FZFA 4FT8A 1GKBA 1DG6A 3I2IA 3ZSEA 4WVMA 5HV4A 5A6YA 2Y34A 3TEYA 3HNYM 1QH6A 3NRUA 4H7LA 5AFEA 5ISLA 2D6NA 4EQVA 1SG3A 1YQ8A 1XPWA 2V72A 4HETA 4BQ5A 3ZR5A 2J1RA 2VR4A 5D8AA 5FYUA 3CEWA 3MZHA 1JI6A 3H0OA 5ANQA 4EE2A 1QIQA 3RWNA 4A7KA 2JX9A 1Y9GA 1ONAA 2TBVA 3POSA 2DF7A 3KF5A 4QHBA 5FJHA 1VRBA 4BXFA 1ZRIA 4TTGA 2JXAA 2DCJA 5SV8A 1V6KA 2R32A 4FP2A 3PIGA 2OPWA 3KCYA 3FC0A 2QQOA 2XUEA 3TN91 3OTFA 4QX8A 1W8ZA 2RHPA 2WYFA 3UNPA 3T0BA 1G6NA 4QM8A 5FO7B 3MPPG 5IVYA 3R05A 5L9RA 4HG6B 1IG0A 3ACLA 2V4VA 4AVSA 4AXOA 4L99A 1AL22 2Z69A 4F7ZA 2QKDA 3LAGA 3NQHA 5FZ4A 3V64A 3B7MA 4I30A 3ZKUA 4EZ4A 4YGDA 2WA3A 5J98B 3WNKA 2OXBA 1UU6A 4CCDA 1S0FA 2VH9A 4U36A 5AFBA 1N1SA 1W6NB 2ZPXA 3CHXA 1VAKA 4XTPA 3IBMA 2EIBA 5KC5A 1W3VA 4RFT0 2YC2A 4HKLA 1B35B 1FNYA 1XYPA 4UBGA 2FCVA 2RVAA 5LA9A 3POEA 5M0TA 2DTWA 1CAWA 1KXGA 2CDOA 1T6GC 2ZGOA 1H2LA 4B8EA 3HOBA 4Q4W2 3LEMA 2XBO3 3ZYPA 3ZXAC 4AK3A 4GALA 1RHI3 1UKGA 1AX2A 1YRZA 3IDBB 2JDPA 5A7WA 2EA7A 3O1SA 3EO6A 4GMP0 2WINB 2ERFA 1X36A 4MGQA 4AGVA 1LB2A 3C8XA 4NPLA 1LEMA 1UF2C 2VMFA 1YYNA 2JECA 3GJAA 5EFUA 3OBTA 4W65A 2HEWF 4YZ2A 1U12A 3CDZB 5CBLA 4DOUA 4CDXA 1ULFA 1ZZBA 2YMZA 3O1MA 5CFDB 4ZU7A 4QX5A 1KJLA 1H8TC 1EAH1 5A7NA 5KXBA 4BLJA 1OF3A 2OUHA 3ILRA 3T0DA 1Q8QA 3FHQA 4QPGC 4CXWA 3B3QE 3UYJA 3TN93 1BXHA 3AZWA 4DO0A 1ENXA 5LW9A 2VW0A 3LDBA 2WLQA 3C7GA 2OPKA 4A2UA 2ET1A 4A6SA 4JGYB 5ABJA 2AREA 3PTRB 3WT3A 1SFPA 3I2OA 1JUHA 1SFNA 3KT4A 1KEXA 4P5HA 4NRPA 1GFF2 1PGSA 1RJ7A 1UAIA 1XJAA 4OHXA 1H4GA 4OLLA 2Z42A 1LULA 1UZ0A 4N43C 2F4PA 1LODA 1HJFA 1W2OA 1Q56A 2B45X 1J58A 4RQPC 3KV5A 5DDJ1 4QGLA 4BQYA 1JUIA 1SBDA 2EIEA 2DV9A 4LA2A 3WINE 1ZBE2 1J83A 2J1SA 4LOSA 2ZBJA 4WV8A 5A7OA 1ZRCA 2DWRA 5GLZA 5LRRA 2FDKA 1BMV1 1JS9A 2RJKA 3WV6A 1R092 4V2WA 2VJXA 2Y0IA 3H50A 4BA6A 2ARCA 4XDOA 4XAAA 2BJSA 4RS5A 2J42A 1AYN1 2VVFA 3V65A 2J1AA 1CX1A 4B29A 3QLQA 3IAPA 1O91A 1Q3EA 1DQ6A 1VB2A 2GMMA 5FZOB 2D3SA 3DYOA 4A4AA 5A3LA 5HPOA 4OFGA 1O4YA 3LDRA 1ENSA 2PFWA 5L7OB 5D2AA 5B4NA 4KU8A 3VZJA 1QJEA 4HT1T 5HXMA 5FMOL 1V70A 2HWE2 1EAH3 4LULA 1LOEA 1Z7S1 3ZFFA 1FOD2 1WMFA 2ZEWA 5JR7B 5LY2A 5BNNA 5JPNB 3D0JA 3VZNA 1AL0G 1SPPB 4OZOA 2KD7A 2WRAA 4MGZE 2NMOA 1F9KA 4NPRA 1GANA 3M4FA 1GZ9A 5KXEA 5CVRA 3WNXA 3HAGA 4FFFA 5JOYA 1TVGA 4XHXA 2C4XA 2DFCA 3FE5A 3WF4A 1ZBA3 2P6HA 4CUGA 4YW3A 1JODA 3JD72 4AQ2A 3WG1A 1WUVA 3AFGA 2CGNA 3IN9A 4DQAA 4XCAA 1X8EA 5DDJ3 4MSVA 1SBEA 4NROA 4FTSA 1CQ9A 1NCRA 4OULA 1C4RA 5KC6A 3I2FA 3UJOA 2YC0A 1KDMA 2ETEA 4I0BA 2P3YA 5JXHA 1K5MC 4IW3A 1CPMA 1GNZA 1AHSA 1RUE3 4COUA 1ZZ7A 1FPN2 4Q4V2 3ZN6A 2RMU1 1W6PB 3PUAA 1AR62 3KHBA 4KU7A 3JQXA 2H6BA 1NOVA 5C7GA 1BVVA 1KS4A 1MVEA 3MV11 3BB6A 4FFGA 3ZFEB 3R0RA 2WS92 4NWWA 5HBAA 3S57A 1MZFA 1GQHA 1HKDA 2CWSA 1A8MA 2YFZA 4YVWC 4AOCA 2GDFA 3VD5A 5CZKA 5G05L 4GJZA 1DGRA 2Q1FA 2Z2SB 3NJZA 3NSTA 5C8CB 3R4SA 2J1VA 1YQ2A 4FPLA 1D4M1 3OBRA 2RS51 1HQLA 4OHZA 4XEZA 2ZHNA 2QFEA 3H1MA 4FP3A 5I0SA 4UF0A 1JYNA 2WYSA 2P3IA 1TME1 2BBAA 1PNGA 1H2NA 3ZXDA 2PTMA 2BV4A 4M4RA 5FY4A 3DYPA 1FMD2 4NVPA 5A3PA 4QDQA 3H8UA 2FDIA 3LGRA 3CKHA 1WMXA 2MEV3 3KB5A 5LATA 1PZ8A 2IXHA 4TLGA 3ZXEA 1APNA 1LHUA 1YLLA 2VZVA 2BZDA 1ZREA 1PO22 2R49A 2XJRA 3THPA 1IHMA 1X9TA 3D3AA 4PF5A 5FY1A 5FY0A 5CISA 3ROUA 4AGRA 3BTZA 2HWD2 2WAOA 1XE8A 3PVEA 4WM8C 4E4SA 3E6CC 2VY0A 4KL1A 5K0UB 4RHV2 2WFF3 1CZSA 5E88A 4GZ9A 4JKLA 1OA4A 1QKQA 3NAPA 1WLDA 2VOWA 3KCCA 3LFIA 4RL7A 1JYWA 5F3CA 2ADDA 2ZABA 5A6QA 1YHFA 2TUNA 4JV4A 1GMMA 3ACGA 2XJVA 3HQUA 1N1TA 1G8WA 4QAWA 1Q8PA 1W6NA 4QB1A 4ES8A 2VULA 1B35A 4P9LA 1VRH1 1ZRRA 2ORZA 2VZSA 2R7EB 3OGGA 2JE9A 4DXZA 4XXAA 5IK4A 3AKPA 4AI0A 5CFCA 1D4M3 2WDBA 2WZR2 3B94A 5DUXA 3SCHA 2GN7A 5BPXA 5JI7A 2J1TA 3AMMA 3IAQA 1DLCA 1WGPA 4Z2AA 1UY2A 2BW8A 4IE0A 4KQ7A 5LBFA 2RR11 3NV1A 4V2VA 4J25A 3SH3A 4CU6A 1NYWA 4Y4YA 5FP4A 4BE3A 3AYEA 2BWAA 4TYSA 3WG4A 1LNSA 5FYTA 2W1UA 3ABZA 5J3UA 4LBQD 1DZQA 1C8M2 1SFYA 3NL1A 2EXHA 3WCRA 4AFBA 4DEQA 3F2ZA 4E2SA 5FR3A 1BLZA 4LQRA 1OLRA 1RUH2 2BP6A 4KBZA 4XJ8A 5CFDA 3OYWB 5A33A 4H55A 5T5OA 2XGXA 4RA0A 2VOXA 2J7MA 2WL1A 3A7QA 3DXTA 4YWAA 2JB4A 2Y6KA 1JYXA 2ZHMA 2BNNA 5C3OA 4C1WA 1GQGA 4BQ2A 1ND2B 4JGYA 1W03A 5LBCA 4QU1A 5I0UA 2W08A 4PLNA 1PX3A 2W2IA 2ZKLA 1R1ZA 3W58A 2VZTA 3WXPA 4M3CA 4D6RA 5JXGA 1POV0 1W28A 2K46A 4QHZA 4WBBA 1ENQA 4RR3A 1UY4A 4K1YA 3RWKX 4YFZA 1UZYA 1NKGA 1YC61 1JYCA 5FZ7A 5FBZA 5IW0A 3PMSA 1YJLA 5FXWA 2G19A 1XNTA 1YXWA 1DZTA 3TAYA 2C24A 1ZA4A 3J26N 4IERA 4IGPA 1OFNA 1AL21 3WW3A 4P5YA 4A7ZA 3H3ZA 5FV3A 5B4XA 3RDIA 5EPAA 5GLTA 4CE8A 1LU2A 3ILFA 3SEPA 1GZWB 3J9SA 3ZIXA 1PM4A 1OA3A 1P8JA 4LITA 2EICA 4NIAA 2A6VA 3WP6A 3BN6A 5FXZA 1DIWA 5IVEA 1NX9A 2RR13 4GWMA 3WP4A 1ODNA 2E26A 3AJZA 3NJXA 2DBIA 4WZFA 5FZOA 2C26A 3AZZA 2UYBA 1OLMA 1NCQB 2WNVB 1W2UA 2WSUA 2VNRA 2QCSB 1W04A 4IV1C 3TEWA 1UU4A 4KH9A 1W6QB 5CYYA 5L7OA 2BTVC 3N7JA 4CZSA 2R0HA 3BU7A 3T4HB 4UW4A 3BIEA 3QBQA 5D8AC 1LHWA 3NV4A 5DN2A 5CFCB 2Q8CA 1A34A 4XFAA 3U78A 4COVA 3N4MA 1ALYA 4BYYA 5BY5A 1SPPA 1PGW2 3I2KA 3I2DA 4IUGA 5F5QA 1V6LA 3LIGA 4DXRA 3FHAA 5JXJA 1GP5A 4B7KA 2QQJA 3NNFA 1H30A 2XBO2 3FLTA 4XOGA 1RHI2 3HWJA 3A22A 4KWLA 4LKDA 4B4PA 3AKTA 1BZWA 3AYAA 4LKSA 2JDAA 1AXZA 4FFHA 1AXKA 2NMNA 3C3VA 1S2KA 4G3YC 1OXCA 4CDUB 1PK6B 5T3NA 5D1IA 1W9TA 3AKRA 4SLIA 4D0QA 4OI0A 1QU0A 4GKYA 4HZFA 1YCIA 3FZ3A 1HQWA 4UT5A 2G1MA 5IWFA 1W6PA 1SDDB 4LKEA 3ZSKA 1XB9A 2PHTA 1WW4A 1PGL2 1ND3B 2YB7A 4FQZA 3S6PA 3TN92 3ZFEA 4I02A 5CKMA 2XONA 3ZSLA 3MW4A 1LOFC 3WOGA 1ZBE1 4QD2A 2FZ2A 5JOWA 2A75A 3CF6E 4K7JA 3VL9A 4XJZA 1ZRFA 2E33A 5C8CA 4D3WA 2WT2A 4LORA 1OQEA 2SLIA 4R9DA 1X9PA 5E89A 3BALA 2O0OA 2XLFA 5GZFA 4YG3A 3E5XA 2ZA9A 2JENA 2R071 4CDXC 5FPVA 1UCXA 1XBFA 2E51A 2YGMA 1C1FA 4X8PA 5T50A 1B09A 1CESA 1F15A 1DP0A 1VMJA 5FZ0A 4BISA 1BEV3 4XUNA 2B9VA 5FPUA 3M70A 2AACA 3GBWA 4LHKA 4ZKTB 3I4IA 1CVNA 2XJTA 2WAAA 5FLHA 2E53A 2WQ4A 1FOD1 2D6MA 1I6XA 5SV5A 2YDEA 4NO4A 2E32A 2K9ZA 4Z07A 5FPZA 4CEWA 3OPTA 4GQ7A 1YJKA 1GSLA 2GC1A 4OUMA 2CTVA 1NY72 1RVF1 1AZDA 3RMYA 3ES1A 5T54A 1OKOA 1OA2A 4XFFA 3HVDA 1G86A 3DUIA 1QOOA 1EAH2 3BTYA 3MLLA 5EJ3A 3K46A 2CAVA 3RI9A 4GH4C 2YV8A 1AR71 1UN1A 2BOJA 1CN1A 2D3PA 5I93A 2GC0A 5IJRA 1AR81 1X33A 2VCAA 4Q8KA 3CIHA 4DPNA 3EHKA 4FPHA 4XJ9A 1FPN1 2EALA 3NNMA 2QQPA 1NXD1 4NHLA 2VZ1A 4L97A 4YW1A 5JWPA 5B2GB 2CHHA 5C4WA 1IQDC 1ZBA2 2SBAA 2YUEA 1AR61 3MI8A 4Y22B 4COZA 2W46A 1U5YA 4CU9A 1NZCA 2XJQA 1D2QA 2OA2A 5DDJ2 3CZUA 4BM8A 3S5AA 3K4ZA 2R073 4FSJA 2DCTA 4CEYB 4AI1A 3J4UH 5FYVA 4XF9A 2HWF3 3VZOA 3WSOA 1KFUL 5G04L 5F9TA 3ZFFC 1RUE2 5EP9A 1LGCA 1SLTA 4BZ4A 2GH2A 4HBNA 1LOAA 4CDQC 1O5LA 3USSA 1CWPA 1IS5A 3LEKA 3PL0A 4M0HA 4I0WB 3U4SA 1WA6X 1QJU1 5CIRA 2WZ8A 3VKMA 1MS3A 2I74A 3OYWA 4AFDA 3O1OA 3ZXGA 2DCZA 2WJSA 2GP5A 2YYOA 1FMD1 1IPKA 2W68A 2VG9A 1RVF3 1NCRC 1ASJ3 2LW8A 3TEZA 3ZSMA 2WQ8A 1SEFA 2DU1A 2DDUA 4ORFA 5C5UA 2OZ6A 2PHLA 1R1A3 4IEXA 2CU5A 1V9U3 2AC1A 4G4FA 1AR73 1AYM1 2VVDA 3GXUA 3MW3A 2VMDA 4HKWA 4P00B 1AR83 3BPZA 3IDAA 4XABA 5DXDA 3RYRA 4D94A 2HWD1 2ZMNA 1NXMA 2NPIA 4YM2A 5FBJA 4RHV1 4ZS3A 3RI8A 2ZX2A 3KHCA 4R4XA 2RDQA 2HYXA 3EYPA 2NLRA 4LBJA 3JBG3 2DBNA 4BQ3A 2MEV2 3K4DA 2BBVA 3ZFGB 5K8SA 5C3PA 1REDA 2XL7A 4UWDA 3W20A 2H0BA 5FP7A 4QX1A 5CA6A 1GZWA 4WZCA 3H3LA 3H42B 4CCKA 3K75B 4PF1A 1BQPA 1MZEA 5GLVA 3E97A 5C3SA 1S55A 2JDUA 3AZXA 1U0AA 3VBUB 4S2GA 3AP9A 4BIOA 5A3TA 2WFF2 2QQLA 2WNVA 1NCQA 2WZR1 4XJWA 1XYNA 1QJU3 1QJFA 4XMIA 1XNAA 1AR91 2QJVA 2ZEXA 4DXTA 4IV3A 1D0GA 2V73A 4HVQA 3LFMA 3HR9A 4H2AA 4M3CE 4CU8A 1GUIA 1CAXB 4S2DA 4Y26A 4M4PA 1CONA 1SLAA 1UMIA 2YPDA 2C1FA 4YFWA 1UWWA 4A3ZA 2B42B 2VQAA 2XVLA 3ZMNA 1D4M2 5FMDA 1YQ6A 4LNVA 1RUH1 1YIFA 1W8UA 2VMEA 1W6MB 4FPYA 1AYM3 1C1LA 3NAPC 3L2HA 4E9KA 5EJ1B 1PMIA 3VL8A 2WZEA 2HWC3 2D43A 1RXFA 4QM9A 3E1F1 1PK6A 4I3PA 4W6WA 2A6ZA 3QH6A 5BV6A 2VZRA 1RUF3 5FZBA 3N7MA 3WZ1A 1VMHA 2W47A 4HFSA 4JVAA 1K3IA 2HBTA 1B35C 2ET7A 4QPWA 3VBFB 1OLME 1IG3A 2R041 3ACIA 1YFWA 1ND3A 4NAMA 4QKNA 1N3OA 1S0GA 4JDMA 3VHPA 1PZ9A 2PHFA 1XNDA 1KGYA 2XJPA 3B93A 1XNKA 5FZAA 5C3RA 2FMYA 3VUOA 2QQVA 1W0OA 3RJRA 2LS6A 4JQTA 2UWAA 2D44A 1HLCA 1AR93 4O61A 2A6YA 4XHBA 3NJVA 1O8SA 1RYYA 4QPIB 5EYYA 3VBOB 4W50A 3KT7A 4Y5TA 1JZ7A 5JIAA 2W39A 2HWB1 3U11A 1H2KA 1OHFA 3SCFA 2VU9A 4IDZA 4PT6A 2YXSA 5CFDC 1DGLA 1G7YA 2DCYA 2XHNA 3DPRC 5KXCA 1MS8A 2VZPA 2I45A 4TLFA 1VLNA 4CCLA 1OKQA 1C3HA 1WCKA 2ILMA 2RDNA 3T2OA 4URTA 1POV3 3VB9A 3LA7A 1J59A 3AL5A 4ISQA 4JGYC 2ZGQA 5DUWA 4XIOA 4XDQA 2RR12 3MFCA 1C8NA 4XILA 4AQTA 3RG0A 2IWGB 2ZGMA 1EP0A 5FP8A 4B3NA 2QZ3A 2Y26A 4RR3C 3V0BB 3WNMA 1W39A 1EYBA 4ZU5A 4AEJA 2XBO1 1PIV1 4M00A 4BIFA 2WO1A 5CKNA 1ACCA 4LOTA 3VBSB 5J37A 1I1EA 3PURA 5EHDA 1YQCA 3OJBA 4MGIE 2R043 4A7YA 1OBNA 2IXLA 1YNAA 4HN1A 3AYDA 3CMGA 3I3DA 3EB7A 4ARXA 2P2KA 3MPBA 2AENA 4R4ZA 5LK5A 5FK7A 4M3CF 4Q29A 5JXIA 4LEJA 4YW2A 2VUJA 4R9CA 2VCMA 3RZZA 3I7DA 2VNGA 3LSEA 3VHRA 4XBNA 5BNOC 2VC9A 2QQWA 1PGL1 2QQMA 3K4AA 1LKNA 1HB4A 1QNYA 2HWB3 4OHVA 4UW5A 4CCOA 3LOBA 5L7OC 4RD7A 1R64A 1DZRA 4XCBA 1JOPA 2JJ6A 4CEYA 4DIQA 2VCCA 5F5AA 5A3WA 3O5SA 5FMBA 4RN5A 1XNBA 2WABA 1NQDA 2VTFA 5FZ8A 4B1LA 3VDCA 4AEKA 5J48A 2OW4A 4IEPA 2UU8A 4QPYA 2QQIA 3D5OA 4EN8B 1FNZA 2JD4A 3OF1A 4NHYA 1HN0A 2ZZQA 3WW1A 4YARA 1PIV3 4MH0E 4KBBA 2QQKA 5EIYB 1LCLA 1S2EA 4I0AA 4LO5B 1KS5A 4BH9A 2X5IB 3A0KA 1CPNA 4PIZA 4H7MA 5LZ6A 3OPZA 4LO7A 3GHNA 3OEAA 4LA3A 4EROA 4XACA 1BVP1 2CNAA 2LROA 3AMNA 4K8FA 2B46X 4MGSA 4KWKA 3VDDB 4AVVA 5IVBA 1L7LA 2GMPA 4W6XA 1NY71 5LA2A 2VOVA 1BEV2 4DUVA 3VKFC 5A1FA 3W5MA 4DRVA 4YW4A 3A23A 5FK8A 4AR2A 4GAZA 5E16A 1DLLA 5EWSA 1W2TA 3WVJA 3ZFGA 2GNBA 2EXIA 5A7QA 5FXVA 4YW5A 1BYHA 2PHXA 5BNPB 1AF9A 5FYCA 2X10A 3FHIB 1AXYA 4RGAA 1OPOA 3VBUA 5A80A 3PIJA 1ZBA1 5EYXA 2L9LA 4Q4X1 3TBDA 5F3IA 2PQQA 3AB0A 4UI9L 2VD7A 1VJ2A 4QU2A 1STMA 3V56A 4MLOA 2P3KA 1GNYA 1JHNA 1VPHA 1WLWA 1X82A 4OYUA 4W8JA 4L9BA 5FPBA 2TNFA 5FOBB 2Y60A 1YFXA 1DCSA 2JG9A 2WSVA 1RUE1 2RS13 4IEQA 2H0VA 3N7KA 1UMZA 1UIKA 3GBFA 4XUTA 4BHPA 4CEWC 3ZSJA 1E5HA 2IZWA 5J96B 5GM0A 1A6CA 3SH5A 4L11A 4Y1ZA 2YFUA 2DVDA 4XBLA 1ZNPA 1EPWA 5JCTA 3ASIA 3H7YA 2AYHA 2D6PA 2R072 1W6MA 2A1XA 1VAMA 3RQ0A 2JD9A 3ZYRA 1S0CA 2HWF2 4MXWB 2IVJA 3T2QA 3VDAA 3HN3A 1ZRDA 2UYAA 3CO2A 2XHKA 3MLKA 5GLWA 2AUYA 1DU3D 3ELNA 4YVSB 3I59B 5FWEA 1BHGA 4NIGA 4PIYA 2ENRA 4FFIA 2WA4A 4AEMA 1SACA 4OHYA 2GU9A 2OIIA 4Q0QA 5C4WC 3N9QA 1WLTA 3MFAA 4K40A 3NW4A 1MS5A 1JZ2A 1D2SA 4KGQA 1MEC1 1RVF2 3R4DB 1ASJ2 4COYA 1IGOA 3MYXA 4LTAA 3SITA 2JEMA 2MEV1 3Q8BA 5LY1A 2K0GA 3VD7A 5H9PA 4Q4X3 4FXGB 3I54A 3SKVA 1R1A2 4F8AA 1FYUA 2CYFA 2Y6GA 4A45A 1QJX1 1V9U2 4V1PA 3H8XA 2BFUS 1AR72 2R063 1AR82 1MACA 5APAA 1W99A 4Q0SA 2KR2A 2RE9A 3BVCA 2GNDA 2WFF1 1ZX5A 5JPMB 1OD3A 5T52A 3JBG2 1HV0A 3ZVXA 3HD8B 3VV1A 2CDPA 4Y5Z0 5A32B 1GOHA 1ULGA 2V4AA 3N3HA 1N3QA 3Q8CA 1W6OB 1LU1A 2A70A 2BGCA 3PVNA 1RTVA 2WFPA 4NWVA 3GCXA 5TSWA 2JDMA 4G9SB 2IUWA 3I3BA 2WO7A 4JDOA 2A7AA 3IDCB 3KGLA 2JG8B 4AQSA 1TNFA 4BOWA 2DVBA 2P34A 4Q0PA 1F4HA 4YM3A 1NZIA 2VAUA 4MXVA 5FP3A 3V0BA 3CLPA 4QKDA 4E2GA 4TXWA 3O14A 3M3IA 4N7IA 2HKXA 1NAEA 1C5IA 3VBHC 5DAQA 4ZS2A 1I3HA 1QJU2 4MV2A 4P9YA 3ITQA 2VVEA 3K3OA 3CZJA 3O1RA 4DB5A 4GWIA 5FZCA 3VBSA 3VHOA 3ZPOA 3DXUA 2IXIA 2WBKA 2VUCA 3OCPA 2P5BA 4JCKA 3RVHA 4JGZC 4EN0A 4WVVA 4COWA 3IPVB 4HMZA 5LA0A 2GC2A 1MEC3 1H8TB 1W9FA 5LASA 1US3A 1ZZ8A 3H8OA 1F4AA 2W1SA 2C9KA 5BNQA 4OI2A 4QPGB 2Y6JA 3AZVA 5FOJB 1IPJA 1S4CA 4QX0A 3QH7A 4YYOA 1QXPA 3ST7A 1QJX3 1HJGA 3VBRB 1S1AA 5FY5A 1AYM2 1UPIA 3WQ7A 4AI3A 1QJZA 2WNVC 3FL7A 5FZMA 4Y1XA 5FZDA 3IMMA 4C91A 4ZZ8A 1LOBA 2HWC2 2WT0A 2P1BA 4IV3C 4L0PA 1UO9A 4XF1A 4C0HA 3O1PA 1OH4A 2NM1A 3Q9OA 4RQPB 3WDWA 3LZZA 1RUF2 4QMAA 3RGBA 2YG0A 1XNCA 3N35A 4XF0A 2VZUA 3S7IA 4PLMA 5IFPA 1UU5A 1UYYA 1VBE3 4TZDA 2W52A 3PVOA 2XKPA 5DG2A 2QE3A 3WNNA 3KQRA 3PVBB 3HPNA 4P9IA 1DGWX 1JHJA 3UETA 1J3PA 2ARAA 3HQXA 2VBPA 4DY5A 2NP0A 4UAPA 1J1TA 3NNGA 1XOYA 3OGVA 4XXPA 4X6RB 3W5NA 5JMCA 1OPMA 3CU7A 3PUIA 2C5DA 4AL9A 2PHDA 3P5BA 3RRDA 5HCAA 1V00A 2GSYA 4PI2A 1FI2A 1AR92 5JMOA 5JZGB 3WHUA
chains in the Genus database with same CATH topology
3FLRA 1QQP1 2X5IA 5EZWA 2UY8A 4FAHA 1O4TA 4N53C 1QOSA 5FTTC 2EAKA 3M3QA 3VDDA 4FXKB 2G9GA 2XVKA 5GZEA 1DYKA 3J8F3 4YZ5A 2WNUC 1OMIA 4IEOA 3UJQA 5GLUA 5KHJA 5JIUA 2P37A 2E7AA 4MGKE 4W6YA 1IS4A 1W0PA 4XZPA 5BNPA 1FV3A 1U5IA 4JC1A 3G6JB 3FUOA 4L92A 3HT1A 4Q1PA 2WWSA 4N9HA 1S0BA 5HCBA 5F6KA 1K5MB 2YROA 3ZN5A 2I2SA 4NHKA 2F6BA 2R042 3V0AB 4K9SA 2DURA 2RJLA 4I3GA 2ZMKA 3M1HA 3ATGA 1Y7BA 3QD6A 4AFMA 5I0TA 5C9AB 3UL2A 4JQRA 2C9AA 2OZJA 2D5FA 3S30A 5DZEA 1CR7A 2I07B 4GULA 3ES4A 5IUQA 1QQP3 4GMP1 4YSFA 5JSOA 1REEA 3M8LA 1IKPA 4NHMA 1COV1 1QWRA 3TWIA 2HWB2 2O8QA 2V09A 1TMF1 4PDWB 5FCCA 1Q5OA 2BYVE 2D7FA 2ZGPA 1HRV3 2GAUA 2Y38A 4MXWA 1YFYA 2WNEA 3NV3A 5KXDA 2CWMA 2O1QA 3O7OA 4YVSA 3I59A 1XRUA 4DY3A 1LECA 4YG6A 2VW2A 5H9SA 2E7TA 4N9IA 3GZTB 4IETA 4AW7A 5DUUA 3NO8A 1VBD3 3IKWA 1BEV1 3WG2A 1DHKB 1PIV2 1WA4A 2A6XA 4CEYC 3FBYA 1QXJA 4JRLA 4JDNA 1LHVA 2YPJA 2VQ0A 5JSRA 2PYTA 2QZ2A 1CAUB 1RUJ1 2EF6A 1NLSA 4LBKA 1MS9A 4EJRA 3JB4C 4Q2FA 3RSJA 1VB4A 1VAVA 2R0FA 3B01A 3FFQA 5FQ0B 4GMP3 4YZ3A 5A32A 2X29A 2ZS6B 1COV3 4XFIA 1W6OA 1MZ5A 2Z79A 1TMF3 4Q4Y1 1U5XA 4FO9A 4MGYE 2JG8A 4XETA 2RM23 5A3MA 1HDKA 3B00A 4CDWB 4GB31 1VBA1 2Q4SA 3KD4A 3R6SA 2Q0AA 4AYUA 4FPKA 3GZAA 5GALA 4LHNA 3ALQA 4INDA 2HWF1 1EV11 1J1LA 2JDZA 2RS12 3ZFGC 3T1MA 1S0IA 3KGZA 3SHRA 3IPVA 1F8VA 1H8TA 1LHNA 1PO13 3NWKA 4FPJA 5CAZA 5L36A 2N7GA 2ZX1A 1JXNA 4P9WA 5K9YA 1X50A 5ABJC 2ZKNA 4XPVA 4LHLA 3H1YA 1S2BA 1AX1A 3ME2A 3ZX7A 3AP4A 3VBRA 2MPFA 4R8HA 4Q1RA 3LCPA 1RUJ3 1Z78A 1ASJ1 3MLJA 4E4ZA 5K0UA 1JYIA 4GKXA 1FXZA 4RQPA 4Q0VA 4AVBA 1PZ7A 2JG9C 4ES9A 2DU0A 1R1A1 4QQ2A 1RIRA 2ZCWA 3UKNA 1V9U1 1IOAA 3FX3A 2FZ1A 2ZGRA 1OI6A 4Q4Y3 5KHKA 5FLIA 4RS5C 2WIIB 1EPZA 2Q5TA 5FREA 1CJDA 4R9AA 3TNQA 3THTA 4RSUA 4CP2A 3JBG1 4GB33 1VBA3 3MF9A 1FAYA 2PAEA 2OYZA 1ENRA 5T5JA 4Q4X2 1RUI3 4IXLA 4Z1VA 3GHMA 4XW3A 4EN6B 3RNSA 5JZGA 2DUOA 1H1AA 4CP1A 2R062 4EV0A 4IV1B 4N90A 2C0ZA 3D6EA 1EV13 1NA1B 1ZM1A 5BNNC 4S2HA 1HIXA 3LOIA 5D8AB 1AUYA 1JTZX 1QDOA 5JOXA 2XLAA 5CU1A 1S0DA 2XG3A 3ZXLA 5JLVA 4HVOA 1DYPA 2D3RA 4HPKB 5CB7A 2IXKA 3AKSA 2LALA 3H7JA 2RS33 3VKNA 3I8TA 1BBT3 4DS0A 3DN7A 4D7TA 1HXS3 5CADA 5F1RA 3WLUA 2PN5A 3NVCA 4C0BA 3S0MA 1Q8VA 4QQHA 1EY2A 4AFCA 3HMYA 1ND2A 3P3NA 3FWEA 4AEDB 1RINA 5T5PA 2PA7A 4TSVA 5BXXA 1VIWB 3SCGA 2QDNA 2DVGA 1NQJA 3ZYIB 4IEVA 2HWC1 2D6KA 3EBRA 2EIGA 1MEC2 2P3JA 3AXEA 3M3CA 1CAWB 3AMQA 1RUF1 1UW8A 4QGMA 5C9AA 1VR3A 5CG9A 2XJUA 5CG8A 1QJX2 1MQTB 2ARBA 1GYKA 3AX4A 1PHMA 4PDWA 1JW6A 1CD3G 4UXAA 2LUWA 3AFKA 3PTYA 3FLPA 4CDXB 1W6QA 1VBE2 1IZ3A 3ENRA 4K21A 4LBLA 1UL9A 4SBVA 2PLV1 4AHWA 2EXKA 2HEVF 1GZCA 2BQPA 4Q0UA 3K51A 4B4RA 3JCIA 4AI8A 4AGGA 3B02A 1WBLA 4ATEA 1XXNA 4P9GA 4ITCA 4Z2WA 3ETQA 3VHNA 4P14A 4XQ4A 3RS6A 3AKQA 1QJY1 1POV1 4MZUA 5AC91 2ZGTA 3GF6A 1MZ6A 1HRI3 1LRHA 4O9GA 1WMDA 1LGNA 2R30A 4QXKA 4NN0A 4CDUA 4XFCA 2VUAA 1CAUA 4GH4B 3IMNA 3L9JT 1XU1A 3AZYA 2QVSB 2ZTNA 3J8F2 3LSDA 4ASMB 1G9FA 2LM3A 2D98A 4K3UA 2FMDA 4WM7B 4EN7B 5FQ0A 2G9FA 1TQ5A 5GZGA 5GKAC 1BK1A 3GALA 5CFCC 1F5FA 3IM0A 3EJKA 4P9JA 4ONUA 3KLSA 1PM7A 1RUD3 4X8NA 5J7MA 3MDPA 3ZMOA 2Q1ZB 4XBQA 2DCKA 4LLFA 4QT6A 3ZXKA 4NR1A 4CDWA 2BFUL 3BOPA 3SNMA 3VDDC 2PLV3 1C28A 3TRSB 2JKBA 4CDQB 4UW3A 3WX5A 2WQZC 3FJSA 3AP6A 4Q26A 3BTAA 5ACA1 3IT8A 4FAGA 2VMGA 1OOPB 1PVC3 3GYDA 4Y1UA 3OD0A 1QJY3 2ZGNA 5AC93 3AXDA 1WLCA 5KHHA 1UKRA 4HKOA 1QQP2 4K20A 1A8DA 4QQLA 2GZWA 4UBHA 1MS1A 4LBQB 3U4XA 3PJQA 2CGOA 3QACA 2W0XA 4XJUA 3WW2A 3JZVA 1HRV2 1OD5A 1RITA 3APBA 1SLCA 3O0VA 4MVTA 2AZ5A 1S0JA 1TNRA 3FBMA 3OD4A 3FFZA 1BCXA 4TWTA 4DNYA 3EXUA 2GALA 3KZ4C 4AHZA 1V6OA 3MGUA 3WQ0A 3OY8B 2DUPA 2A3XA 4KGGA 1VBD2 4LE3A 3WW4A 3B69A 2ZHLA 4FOWA 2CGPA 1FATA 2HEYF 4HLTA 4K1ZA 1O4ZA 4QQOA 4Y22A 1GBGA 5CNAA 1N47A 3ILNA 2Z5WA 4JTOA 4IEWA 2AR6A 3KT1A 3MIEA 2D6LX 3C2UA 1QGLA 1DBNA 1R083 4IV1A 1VBC3 4I09A 4YVSC 5ACA3 3T1LA 3E5QA 2VNOA 4K6BA 2XPJA 1NA1A 4PBOA 4BQ1A 1GNHA 1YIPA 5JSPA 4O9EA 4OVEA 1RMU1 1O3SA 4B7EA 1VBB3 3TB0A 1Y3TA 2PAMA 3JQWA 1RUC1 4HPKA 1COV2 4KG0A 1TMF2 2ARXA 2XJSA 3QOPA 4L8QA 2RS11 1X7NA 1VP6A 3MICA 4XMAA 4YGEA 3SH4A 4Q8LA 2RM22 4OI1A 3WDTA 1O3RA 3PNAA 5L19A 3NAPB 1XU2A 1ZZ9A 1SBFA 3WHTA 3A0NA 2ZX0A 5LEKA 4AEDA 3D8CA 2BWCA 4HSJA 1AVBA 4META 1URXA 4HL0A 1WD4A 2UURA 3AYCA 1RL3A 1D0HA 2MNGA 3DKWA 4QGNA 5I0RA 1HW5A 2E63A 4ZU4A 1H1IA 3ZFEC 4YZ4A 1PO12 1Q43A 4AI2A 5IK5A 4H14A 2YGLA 5KHIA 1FX5A 2IC1A 2JG8C 1LOFA 3UK9A 3FMGA 5DG1A 5FFOC 4Z8BA 5C8CC 1Q8SA 3SMHA 1QHDA 1MQTA 2E7QA 1WW7A 4OZXA 5DZFA 4HK8A 4XE9A 4NOTA 2V5YA 2ZGLA 4EN9B 1H9WA 1RUJ2 2B7YA 1QH7A 4AHYA 3O0XA 1RMU3 1KITA 3CJIB 4CYDA 5JAXA 1F2NA 4C1XA 2R1DA 4Y1YA 3WCSA 1RUC3 5A33B 2R061 1LR5A 1NE6A 2VW1A 1DF0A 3DPRB 3URFA 3WDYA 4AQ6A 1DQ5A 4CP0A 4Q4Y2 4JRAA 1CAXA 3MIFA 4C90A 1YO8A 5IK7A 2NQYA 3VBRC 4GB32 1VBA2 1IS3A 1RUI2 4GA9A 4M3CB 4AHXA 2WKKA 1J3QA 2BUKA 4LO6B 3QCWA 4RR3B 5I8TA 5K0UC 5EXOA 5LK7B 1PVXA 3JU9A 4AVTA 1LJ7A 1CAVB 1EV12 4IL7A 3KMHA 4FCAA 4Y1VA 4M0NA 2CAUA 4FPOB 4DZGA 1O3QA 4GH4A 2WT1A 2XKOA 4FPEA 1KD7A 5JDBA 3VZMA 3MIHA 3SLIA 4WM7A 3VBFA 1YWKA 2RS32 2LTNA 5KBFA 1ZZ6A 4PQ9A 1BBT2 2H6CA 2GNMA 3WDVA 5HI0A 1HXS2 3U10A 4HVRA 5AVAA 2QUOA 3N36A 3RJ2X 5JZGC 5BNOB 1MVQA 3E6BA 5HXVA 3BIWE 1M06G 4R9BA 1JH5A 4YNIA 1XE7A 3GZUC 2PAKA 2Q1MA 3LKJA 4QPIA 4LBOA 3VBOA 3B9IA 1O5UA 2D97A 4XTMA 2ATFA 4CDQA 5E1RA 1BKZA 2DFBA 4FVVA 3RPQA 2D5HA 1IKQA 5LRSA 1IS6A 1OFSA 4L2NA 1HV1A 1OOPA 2HJIA 1VBE1 3BODA 2ZHKA 1YFUA 5T55A 1ND2C 4LBQA 5GZCA 1LOCA 3AP5A 1JBCA 2MHFA 4ZXKA 4KG8A 3AP7A 3RMXA 2FHRA 5C33A 1QF3A 1UIJA 1V6MA 3DGTA 2B5HA 4Y24A 4WVWA 1RUG1 5KWRA 1M4WA 2ZGUA 1AYN3 5C9AC 3P3PA 3KSCA 1QY4A 2PHUA 3OY8A 3VLBB 4XJAA 2FQPA 1CGPA 3J8F1 4CTEA 2ZX3A 4PDWC 1WW5A 3AMPA 1Z7S3 4CRQA 2VMHA 1NCQC 1HRI2 5HCFA 4YRDA 1UZZA 1MS4A 3POWA 4N43B 1DGRN 1L3JA 5BUVA 2G4IA 4LT5A 1KFXL 3WDUA 1UX6A 1MS0A 5C6CA 2JE7A 2EXJA 3CNAA 5H9RA 1X8MA 3HBZA 2D6OX 2XB6C 3ZXJA 4LO4B 1H2MA 5I91A 2A6WA 2HYKA 1YUDA 4OUSA 4B4QA 4CEWB 4R52A 1REFA 3TYJA 4Y20B 3KCXA 1RUD2 1YI7A 2AGSA 4BMEA 4IEYA 3E5UA 1H4HA 2RMU3 3WP3A 3GBGA 3DL3A 3WP5A 4CDUC 1PK6C 2NN8A 1RUG3 1ZYBA 2PLV2 1O7FA 2ZOEB 4F3JA 4DRRA 4YM1A 4LBMA 3M3OA 2BNMA 2B8MA 2K2SA 4BLIA 1C5HA 1HRV1 5KHGA 1DGWA 1ND3C 3UKVA 1PVC2 5C4WB 1OQDA 3NKGA 1QJY2 1DFQA 4J1WA 5AC92 2RS53 3VN4A 4BCUA 4Z82A 2DVFA 2WLPA 2ES3A 1TME3 2VECA 4CDWC 1LHOA 2CV6A 3VZKA 2GN3A 5DUVA 1VBD1 1SCRA 2Y0OA 4FOQA 2VOKA 1FV2A 1H9PA 3UV9A 1DQ0A 3B9CA 1QNWA 1RB8G 1NG0A 1NE4A 2EVXA 1G9CA 1Z0HA 1DDLA 3USUB 3CJIA 3ZPYA 3MF6A 1RGSA 1Y43B 3M7AA 2WC2A 4ISRA 4P9XA 3DPRA 3S7EA 2VMIA 2PELA 1Y9QA 3TNPB 2ZX4A 5JI9A 1OSGA 1WD3A 1SLLA 4YVWB 3U0ZA 1AJOA 4D69A 3PLQA 3WG3A 2DUQA 3O0WA 2PHWA 3MIBA 1R082 1SLBA 4FOVA 3VBHB 1VBC2 5ACA2 4YZ1A 1ZZCA 1CAVA 3DF0A 2RM21 4LUMA 4LE4A 1C57A 4JAAA 1AJKA 1LTEA 1VRH3 2UWBA 1VBB2 4N7UA 3WUDA 4AF9A 1E57A 4JGZB 4OHWA 1CX4A 3IWZA 4Q27A 3ECQA 4E27A 1LOGA 3CJXA 3MW2A 1AX0A 1ULEA 4IESA 3LWCA 2E6VA 1J3RA 4H3WA 1PO11 1BJQA 3WUCA 2BVBA 5BNOA 5L73A 3UKTA 2BNOA 4Q4W1 3D0SA 4WM8B 1NA1C 1UPSA 1JN2P 4IV3B 3R4UA 5FMOS 1N1VA 3AJYA 4HN0A 4MYEA 4IEUA 4BWOA 2VXRA 2GMEA 1QMJA 1XYOA 2KXLA 3MIDA 3HT2A 2UY9A 1FT9A 5AVPA 2XUMA 5FAXA 4Z92B 1MR5A 2UWCA 4XF4A 1QDCA 5E8AA 3RYKA 2ZAAA 4IQPA 4AWDA 2DTYA 1WCSA 4FQ4A 4AEDC 1LENA 3IIAA 3H1WA 3LB9A 4FBFA 5I8YA 1LGBA 1RMU2 4S2FA 5GJ6A 1AL23 2O8OA 1RUI1 4N53B 4PIXA 3VZLA 4AVAA 3WQ1A 2CY6A 4DINB 4ATFA 1GICA 1RUC2 3SXWA 3PHMA 5IK8A 2XL9A 3ZN4A 1G9DA 4LO8A 5IT6A 2Q8OA 3E6DA 2WNUB 2KA3A 5FPXA 4JTNA 4LUKA 1MQTC 4QPGA 4Q4W3 2XVGA 4PCRA 1R091 1WMEA 5FRAA 1I9RA 2OUJA 1DQ2A 2BEOA 3OGJA 3VBUC 4IEZA 2RS31 3JUUA 2QDRA 1BBT1 3PMEA 1HXS1 1I5ZA 3D4KA 2WZPP 4N43A 3ZXFA 1SMVA 1OQ1A 4HSLA 2ZACA 1H0BA 5LEJA 1TEIA 4BPZA 1A3KA 2A3YA 5BYNA 2HWE1 1RUOA 2ZAHA 4FTBA 4DMIA 1QXRA 1O3TA 4KWJA 4HK9A 3JB8A 2R1BA 5H9QA 2A5ZA 4I2OA 2D93A 4Y20A 2B39A 1GLHA 1KJRA 3WR0A 4FOYA 4YGBA 3JD71 3BCWA 4WVMB 1SCSA 2BVVA 3AM2A 1QOTA 1ZBE3 3L2YA 1Q8OA 5F6LB 3X29B 4WM7C 3VBFC 4X6QB 3T2TA 1F5JA 4MX3A 4KNCA 2A73B 4Q4V1 4AE2A 1N1YA 1R093 3ZYJB 5DZGA 4FPCA 2TEPA 5K7PA 4DFSA 1KDKA 1ULCA 3NKTA 1ZVFA 2IFWA 2WS91 2JICA 2OVUA 3N7LA 5I8SA 3TOJA 1UD1A 4M01A 4XQDA 4QPIC 3VBOC 1BMV2 4LR4A 2X8KA 1PNFA 2BPA2 4EWAA 4PBPA 1K5MA 3VGIA 3KS7A 2HWE3 3ZYGA 3USUA 2FBEA 1FOD3 2XLGA 5C8WA 4PJYA 1HRI1 1AYN2 2A3WA 3V0AA 3AK0A 1OOPC 4U2AA 3WY6A 2X53S 2ZGSA 4AG4A 2E9QA 3INAA 1DQ1A 2R16A 1WCDJ 4HANA 2XH6A 4J1XA 1LESA 1SQ4A 2P17A 4XYXA 3JD73 4YVWA 3RYPA 1V6JA 1G9BA 5J36A 4I01A 1Z7S2 1IQAA 3KM5A 1PO21 2VPVA 2Q30A 1HX6A 4QQPA 3A4UA 3POYA 3MEPA 1SDWA 2ZGKA 3BOWA 3LA2A 3VBSC 1GR3A 1RUD1 3VBHA 1FPN3 1RJ8A 5GZDA 3M3EA 4Q4V3 3ZDSA 2DVAA 4GIQA 1SLIA 2DYCA 1V6IA 1RUNA 1AR63 4J6GA 1A78A 2QNKA 2NZ9A 4JGZA 1VALA 1D4VB 2WS93 4F83A 2A71A 3M2MA 2IXCA 5ABJB 1YI9A 4OI4A 3W59A 1U5ZA 3FUQA 2XWJB 2ZMLA 1PVC1 3PJYA 5EV7A 4UW6A 3WDXA 2RMU2 1ULDA 2VGDA 2ZZJA 3LA3A 4FPFA 4LBNA 1WBFA 2XWBB 1RUG2 3GNEA 4FPGA 4EWEA 4WM8A 5FO8B 3G7DA 1H1MA 2AH2A 2JG9B 4A3XA 3H3UA 5T5LA 4E4DX 1FMD3 1G9AA 3IDEA 3HN1A 1C8M1 4D7YA 2RS52 2ZJCA 4RS5B 3SISA 1PO23 2GC3A 3H9AA 4XFHA 1KRIA 1TME2 4AVCA 2X5IC 2HWD3 4RHV3 1S0EA 3AMHA 1V6NA 2R6QA 1RC6A 2GH8A 3WD5A 3ZFFB 2B9UA 4N53A 4YM0A 1NLRA 3O12A 4BMBA 5BNNB 1H8VA 2D40A 4E2QA 3K48A 1GV9A 1R081 4PLOA 5J09A 3B5LB 1VBC1 3CL1A 2EAAA 4XQWA 3U07A 3EQEA 3HIFA 4ASLA 4YLZA 4RGGA 2WNUA 3D82A 1VBB1 1XQNA 4XFBA 4XFGA 5BNPC 2WZR3 2YZ4A 1LEDA 2YY1A 4MUVA 4YG0A 1TE1B 1JOJA 1NCRB 4GXLA 2IXJA 1CIWA 5FLJA 3CJIC 5JVVA 4D7SA 4EWDA 4GWNA 4XIKA 3W9AA 3VKLA 3ZN6B 2CL2A 1VRH2 1HQNA 2GNTA 3ZO0B 1CJPA 1C8M3 1DQ4A 3VKOA 2IFRA 1KQRA 1RUH3 1F31A 4WVZA 2NYYA 1WW6A 5JOZA 1OLQA 4LLOA 1PGW1 4XF3A 4AFAA 4YGCA 5FO9B 4FTEA 2KM2A 2PHRA 3ZIWA 3DV8A 2YHJA 1RHI1 3MIGA 5FDBA 3NV2A 1N3PA 4FT8A 1GKBA 1DG6A 3ZSEA 4WVMA 4H7LA 1QH6A 5AFEA 2D6NA 4HETA 5D8AA 3MZHA 3CEWA 3H0OA 3RWNA 4A7KA 2JX9A 2TBVA 1ONAA 3POSA 2DF7A 4QHBA 2JXAA 2DCJA 5SV8A 1V6KA 2R32A 4FP2A 3KCYA 3FC0A 3TN91 3OTFA 2RHPA 1G6NA 4QM8A 5FO7B 3MPPG 3R05A 4AXOA 4AVSA 3ACLA 4L99A 1AL22 2Z69A 4F7ZA 2QKDA 3LAGA 3V64A 3B7MA 4I30A 4YGDA 2WA3A 5J98B 1UU6A 1S0FA 2VH9A 4U36A 5AFBA 1N1SA 1W6NB 2ZPXA 1VAKA 4XTPA 3IBMA 5KC5A 4RFT0 4HKLA 1B35B 1FNYA 1XYPA 4UBGA 2DTWA 1CAWA 1KXGA 2ZGOA