3EBRA

Crystal structure of an rmlc-like cupin protein (reut_a0381) from ralstonia eutropha jmp134 at 2.60 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
157
Chain Sequence
MLFESINTGCLDGNDTPWMPFAPYSNDVMVKYFKIDPVRGETITLLKAPAGMEMPRHHHTGTVIVYTVQGSWRYKEHDWVAHAGSVVYETASTRHTPQSAYAEGPDIITFNIVAGELLYLDDKDNIIAVENWKTSMDRYLNYCKAHGIRPKDLSTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized RmlC-like cupin
publication title Crystal structure of RmlC-like cupin with unknown function (YP_294607.1) from RALSTONIA EUTROPHA JMP134 at 2.60 A resolution
rcsb
source organism Ralstonia eutropha jmp134
molecule tags Unknown function
total genus 27
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ebrA00
1EYBA 1QXJA 4XFFA 4I01A 4HN1A 4I3PA 4I09A 4ONUA 3UKTA 4ZU4A 2MNGA 1LRHA 4EROA 5FCCA 3CLPA 5AVPA 4GULA 2CAVA 3E5QA 3H1MA 2ET7A 4A2UA 1O3RA 2XHKA 4XETA 5CADA 4AXOA 5LEJA 1X8EA 1OFNA 3IDCB 2D40A 4IEUA 2XLGA 3RNSA 2PA7A 3MYXA 5FQ0A 5E1RA 1O7FA 2QJVA 4KWJA 3S7IA 1G6NA 2XLAA 3KSCA 3OCPA 3RPQA 1YFWA 3E5XA 4YRDA 1CAWA 4LLOA 1CAXB 4AQ2A 2D93A 4I0AA 3FJSA 4XFBA 2Y0OA 2DCTA 2Q4SA 1U12A 2VQAA 3HIFA 4EWEA 3H1YA 1I6XA 2XL7A 4Q0VA 1FT9A 4BYYA 3H1WA 4E2QA 1QY4A 3GYDA 4PJYA 4J1XA 3WW2A 1Y9QA 4XF0A 3USSA 1TQ5A 2ZKLA 3D82A 3M70A 2UYBA 4MGIE 4EV0A 1CAUB 2H6CA 1ZVFA 5I8TA 2CGPA 1O4TA 3PNAA 3H50A 1O5LA 5FLHA 2PQQA 1SQ4A 3SCGA 3OGJA 4Q0QA 3WW1A 1RGSA 3KMHA 2GC2A 1QWRA 5EFUA 4K8FA 1O3SA 5FLJA 2PHDA 2XLFA 3RYRA 5KHIA 2BNMA 2Z69A 4HBNA 5I0RA 3LAGA 4L11A 5C6CA 4E2GA 4QGLA 3E6CC 3H3UA 1VJ2A 3S0MA 1UPIA 3H9AA 1J3PA 2PAMA 2Q0AA 2ATFA 4XFCA 2D5FA 4QM9A 1O5UA 4R52A 5BV6A 3TNQA 3D0JA 3BB6A 4AVBA 3SCFA 3I59B 3CEWA 4QX5A 1YWKA 4IEVA 2O8QA 2QCSB 3U10A 2CV6A 2UYAA 2QNKA 5I8SA 4JTOA 5JSOA 2PHLA 2OYZA 4HVRA 4KWLA 4P9GA 4HN0A 1YUDA 3CF6E 3NL1A 3FHIB 1QXRA 4ZU7A 1DZTA 4HVOA 3KGLA 2QDRA 3OTFA 3LA7A 3NJZA 4UBGA 4PIYA 2XKOA 5J48A 4PIZA 2GC1A 5BUVA 2I45A 4BHPA 1YLLA 4LUMA 5K8SA 1H1IA 3IIAA 3O14A 3E5UA 1Q5OA 4E2SA 1CAVB 2VECA 3U11A 4IEPA 3DV8A 4JTNA 2OA2A 3MZHA 2GH2A 4LUKA 4HSLA 5E16A 1ZZ7A 2GU9A 3FWEA 3KCCA 4QGNA 4IEQA 4KU7A 3ELNA 3ROUA 3E97A 4R8HA 3PVBB 4N9IA 1RUNA 4YARA 1RC6A 5JSRA 1J3QA 2FMYA 5EZWA 2CAUA 2QVSB 4QXKA 4QMAA 1ZZ8A 4Q0SA 3WW3A 4L2NA 1DZRA 1UIKA 3JZVA 3LA3A 2EVXA 3H8UA 3SXWA 4MGKE 2Z2SB 1RUOA 3EHKA 1ZZ9A 2P17A 2PTMA 3I54A 3IWZA 2EAAA 3CL1A 4N9HA 5CVRA 3RYPA 5BPXA 1CAXA 4Q29A 2K0GA 4WZCA 5CU1A 3ZDSA 2OPKA 1WGPA 4F8AA 4MZUA 1X8MA 1V70A 4MUVA 3ES4A 1PMIA 4XFHA 3EO6A 3ETQA 2IXHA 1RL3A 1YHFA 2PFWA 2V09A 4LEJA 1J1LA 2PYTA 1ZRDA 2IXKA 1ZZBA 5FLIA 3SHRA 4FAGA 2XL9A 5I0TA 1CAUA 2HJIA 3LZZA 5FDBA 4AQ6A 3VHRA 1LR5A 4JVAA 2B8MA 4XFGA 4IESA 5KHJA 5I8YA 5JAXA 1ZRCA 2E9QA 1UCXA 3BCWA 4IEYA 3UKVA 3HT2A 4BH9A 2HKXA 4IERA 4XFIA 2WC2A 4Z82A 4YYOA 4F7ZA 2IXLA 2GC3A 4MGYE 4X6RB 1FI2A 1Q43A 2UY9A 4OLLA 3RYKA 2MHFA 2IC1A 2KXLA 1IPJA 4DINB 5I0SA 2GZWA 5FPZA 1FXZA 1LKNA 3QACA 2BNNA 2EA7A 4TLFA 1EPZA 4HZFA 5D1IA 3FE5A 4BIFA 4D7TA 4I2OA 3I7DA 2OZ6A 4XF3A 1YFUA 3SCHA 4RD7A 4Q0UA 2VPVA 2BNOA 3NSTA 5JCTA 4AVAA 1NE6A 3SMHA 4EWAA 3U0ZA 3I59A 4MGZE 3BPZA 4XF4A 4KU8A 1VP6A 2IXIA 1Q3EA 2XKPA 1DGRA 3HT1A 1ZRFA 3N4MA 1UD1A 1OMIA 3MDPA 4EWDA 4MV2A 4IEZA 1J3RA 4D7SA 4Q0PA 1J58A 3E6BA 2Q30A 4LA2A 5T3NA 2PAKA 5BY5A 4I02A 2B9UA 1I5ZA 2WFPA 1CX4A 3ACLA 3NW4A 1CAVA 1XE7A 5I93A 1IPKA 5KHHA 1LB2A 5JR7B 2H0VA 4OFGA 2N7GA 5FQ0B 2BYVE 5J3UA 2IXJA 1YFYA 2BGCA 4WBBA 2IXCA 1ZZCA 5I0UA 2D5HA 4X6QB 1SEFA 3UKNA 5C8WA 3DL3A 4HLTA 1CAWB 1H1MA 1OD5A 2C0ZA 4LA3A 3E6DA 2FQPA 1UW8A 5BXXA 4IEOA 4Z07A 3CO2A 5LRRA 1XRUA 1VR3A 4KWKA 3LOIA 3NKTA 1NYWA 4J1WA 5FPXA 4MH0E 1NZCA 5J7MA 3G7DA 3BALA 3IDBB 1GQHA 3WW4A 2ET1A 3FZ3A 4UBHA 4NVPA 4H7LA 3EQEA 5HI0A 4META 1CGPA 4XF9A 3QOPA 2OZJA 4MX3A 4HSJA 1WLTA 3L2HA 5I91A 3PLQA 4IETA 3C3VA 4ORFA 2PAEA 3EBRA 3FX3A 4I0BA 4UXAA 4XF1A 3H3ZA 4QGMA 4LTAA 3KGZA 1EP0A 3RDIA 1HW5A 5LRSA 1GQGA 1ZX5A 1O3TA 2ETEA 3TNPB 1NXMA 2F4PA 2K9ZA 4YNIA 3IBMA 3HQXA 1WA4A 1XE8A 4LULA 4XEZA 4IEWA 3CJXA 1EY2A 2H6BA 1PM7A 3B02A 1ZRRA 1X7NA 1X82A 4FT8A 1ZNPA 5KHKA 1SFNA 3LA2A 4JV4A 3DKWA 5KHGA 2ZCWA 2GC0A 5JSPA 4O9EA 4KL1A 3OF1A 4CYDA 2GAUA 4FAHA 4HVQA 5F1RA 3ES1A 4PIXA 3S7EA 3DN7A 5LEKA 3BU7A 1JUHA 1DGWA 1YFXA 1J59A 4AVCA 3MPBA 4WVZA 2BEOA 3OD0A 3H7JA 3ST7A 1ZREA 5KBFA 2O1QA 3EJKA 3GBFA 4O9GA 3R6SA 4QM8A 4B29A 1RTVA 4HMZA 2MPFA 3LWCA 1NE4A 1O3QA 1Y3TA 1L3JA 2Q1ZB 2XGXA 2B5HA 3H7YA 3FFQA 2UY8A 1OI6A 4XFAA 4IEXA 3RZZA 3M3IA 4ZU5A 4FBFA 4YSFA 1ZZ6A 3NVCA 3D0SA 1UIJA
chains in the Genus database with same CATH superfamily
2HWC1 1PGSA 2ZX1A 3O12A 4FPOB 4OCTA 4XAEA 1EYBA 4NAOA 3WDYA 1QXJA 5FBZA 4FXKB 3WG3A 4WVMA 4DNYA 4YM1A 5FP9A 2JD9A 2WAAA 4I3PA 4YM3A 3KT7A 3WINE 3IIIA 4WM8B 4Z2WA 1DBNA 4Y1XA 1O8SA 4AHWA 5FZ7A 1HKDA 3OYWA 1JYNA 1F15A 1XQNA 1NLSA 5AVPA 1DQ2A 4GULA 5D8AC 2XONA 2ET7A 3Q8EA 1O3RA 4JDOA 1NX9A 1M4WA 3MUZ1 2UWAA 1X8EA 5FZ1A 2VBDA 4IV3A 3NJXA 1OOPA 4BQ1A 1V6NA 3OEAA 2QQIA 5IAVA 1C1LA 1Q8QA 2XLGA 5LA2A 2B9VA 3MUY1 2XJQA 3T0AA 4IW3A 5FQ0A 3RVHA 2QJVA 4KWJA 1XXNA 4LO8A 4M0NA 5IT6A 3A0KA 2VCBA 1W3XA 1AR62 3JQXA 3A7QA 1APNA 3P1IA 1YI9A 2R071 1NA1C 4LLOA 1FPN2 2Y6LA 1RUF3 3VBUC 4AQ2A 2WZR1 4BQ3A 1SACA 4WVWA 4GMP1 3KB5A 4ISRA 1LU2A 5BNPC 2Y6KA 3FJSA 1YQCA 2WLQA 2ZX4A 5C71A 2VUAA 2FZ1A 4XJ8A 1PHMA 1U12A 1DGRN 4Q4Y1 2DCKA 3HIFA 3RQ0A 2QKDA 3BVCA 4HETA 4A3ZA 2JECA 5KXEA 2XL7A 5J1XA 3VBRC 1FT9A 1WCDJ 2JG8B 3PUAA 3WNPA 3WLUA 2WSUA 4URAA 5JUVA 4TSVA 3WEZA 3NNJA 3N7LA 4AVTA 3O1TA 1LOFA 2NMNA 4MGIE 2Z5WA 1V0AA 3GDBA 4GXLA 2DF7A 3HJRA 4XTMA 2OT7A 3A0NA 5F2SA 4MSVA 1STMA 3M8LA 3PVOA 1VBB3 5B2GB 5I8TA 2CGPA 1QIQA 1R092 1UZVA 1QNYA 2JDHA 2VQUA 3H50A 4RGKA 1NT0A 3WP6A 3SCGA 2ZX2A 3OGJA 1RUE2 2KM2A 4CUCA 4XIKA 5K0UC 3CJIA 1MS8A 3VLBB 2C9KA 1QWRA 1JZ3A 5ISLA 3MIDA 5DABA 4K8FA 5EFUA 2DUQA 2IFRA 1FV2A 4XDOA 2VGDA 4A41A 5KHIA 5AC93 2BNMA 4O7XA 2VZ1A 1SBDA 1UMHA 4KH9A 1BEV2 5I0RA 4E2GA 1VLNA 4QGLA 2PLV1 2YFZA 3LDBA 5CG8A 4YVWA 4AI3A 1N3QA 2Y26A 2EICA 4DPNA 1AYM2 4AFAA 5A7WA 1PGW2 1UPIA 4OI2A 5L7OC 1C8NA 1PIV3 3SH5A 1FPN3 4XCAA 1W8ZA 1H6YA 1WMEA 1C5IA 3VDCA 5BYNA 2ZOEB 4S2HA 4QM9A 1ND2A 2BDRA 3FBYA 2JD4A 4KBBA 1DYPA 1JS9A 1HRI1 1N1TA 4GB33 1RUI2 3SCFA 3I59B 1ZBE1 2WWUA 3MO4A 3VD5A 1OA3A 2IVJA 1NAEA 3J4UH 4LIVA 1G9CA 1UY3A 3BYWA 4P9WA 4BDVB 3C7HA 2YDEA 2QCSB 2NP0A 4JTOA 5JSOA 3UGFA 4S2DA 3IT8A 1BJQA 1PVXA 1D0HA 2UWBA 1NKGA 3VD3A 2DV9A 4AQTA 4AFCA 3WG2A 4LBQD 4IDZA 4FPEA 4XDPA 3AXDA 3ZMNA 1HDKA 4ZXKA 3NAPB 3JCIA 2QTWB 4QB6A 4DMIA 2C9AA 3V0BB 2QDRA 1HV0A 3LA7A 3OGGA 4PI0A 4NIIA 1W28A 4CDQC 2CYFA 5A7SA 5FO9B 1CIWA 4FP3A 1RUE3 1GOHA 1TNFA 4PIZA 1PZ8A 4BLJA 5BUVA 2VNOA 4BXFA 2I45A 5K8SA 1H1IA 3OUIA 3IIAA 4NWVA 4FTEA 2W68A 3KVBA 5FMBA 2ZGQA 3IZOA 4XHXA 5IVVA 4Z8BA 3OY8A 2P34A 3JB4C 4V1PA 2OA2A 2GH2A 2VTFA 3WCSA 4GJZA 5JI7A 4CP2A 1QEXA 4GH4C 4HSLA 5A70A 4AWDA 5AFEA 2GU9A 1BEV3 5C4WB 3UNPA 3J9SA 2FCTA 2JIJA 5E6HA 1Z7S1 2D44A 3ELNA 4WM8A 4Q4V1 4XABA 1NCQB 1S0BA 3FL7A 5FIXA 4YW2A 5C9AB 3CZUA 2VZTA 2HH9A 3PVBB 3WG1A 5AFBA 1AYM3 1BCXA 3UETA 4LO6B 1TZOA 2P3YA 1HV1A 1BZWA 1WMFA 2O8OA 4CEYB 1BBT2 2VXJA 1FX5A 4CVUA 1H2KA 4J6GA 4QQLA 1ACCA 1MACA 4FXGB 4XBQA 1ENRA 4Q0SA 1WKYA 2WNVC 1QJU2 1DZRA 3WR0A 3ZSKA 3ZXLA 4HPKB 5F8PA 3WX5A 2EVXA 4KG0A 1RUI3 1YQ8A 4BM8A 4IV1C 5JOXA 1RVF2 5FPLA 1IHMA 3S5AA 4IGPA 2Y8KA 4YW4A 4TN7A 3HNMA 3EHKA 5FYZA 5A7PA 1E5RA 3NO8A 5FZCA 2ARCA 2P17A 2PTMA 5C3PA 3NKGA 3CL1A 1U5YA 2NN8A 3FFZA 2PQSA 3ON7A 4XQWA 4AI0A 5DG1A 4WZCA 1KEXA 5CU1A 3ZDSA 2OPKA 3QCWA 1WGPA 3LEMA 1H2LA 4N53C 5FP8A 3KV9A 2DYCA 3JUUA 3VKOA 3KF3A 5BNPB 2YFUA 2D43A 4AEJA 2RS33 5HCFA 2YG0A 3MEPA 3RWKX 1OLRA 2EIGA 5GLZA 4AF9A 4B4RA 1QJY1 1SHWB 2JG8A 4GIQA 4JDMA 4E4DX 5ACA2 1PVC2 4XVHA 2PYTA 1W6MB 1HN1A 3FUOA 1RINA 5FLIA 3TWIA 2E7QA 1LHUA 2WIIB 1N3OA 5J36A 1D7PM 3OEBA 3SH4A 5BNOB 4ZHNA 2RMU2 3BIWE 4LBJA 5I0TA 4XE9A 4A4AA 1B09A 2EXIA 4YVSA 3LFMA 1DYOA 1LULA 4DUVA 5HV0A 4WM7C 2BZDA 3LZZA 4CU7A 1SZBA 4AQ6A 5T52A 5FPAA 1LENA 3AP5A 3JB8A 4AW7A 1OLME 2CU5A 3ZXGA 5T5OA 4AI9A 1DFQA 3WQ7A 1NG0A 4IESA 4XFGA 3T0BA 5KHJA 3NRUA 2Z79A 4NPRA 4Y33A 5I8YA 1BBT3 1PM4A 1SDWA 3FHAA 3J26N 4LKEA 2XB6C 1WW4A 3MFCA 2HKXA 1YCIA 2HWD2 2R49A 4WVVA 5A7OA 5J37A 3O1OA 2R042 2ZXQA 4YYOA 1QJU3 3QH7A 3WP3A 5C33A 3AL6A 2GC3A 4NRPA 3RZJA 2ZEXA 4ZS2A 4K9SA 1FI2A 1Q43A 1AL22 4N90A 4OLLA 3RYKA 1A8DA 2VZUA 1RVF3 2VOVA 4HT1T 1WZXA 3MIGA 5FZ8A 2IWGB 2KXLA 4HG6B 1QQP2 3HOBA 2JDMA 4IE5A 1X33A 1VBD1 2GZWA 1HB3A 2UWCA 2Y38A 2XWBB 4XUQA 3N7KA 5DAXA 5FZMA 2VW0A 3QACA 3DXTA 4S2GA 1LU1A 4EN0A 1QJX3 1P8JA 4QKBA 3W21A 2OZ6A 4FPKA 3UL2A 2Y6JA 1OF4A 1YC61 2CDPA 3P5BA 3LOBA 3SCHA 4RD7A 4Q0UA 5LBBA 3AMHA 1RUG1 2VPVA 1C1FA 4DIQA 1OQEA 5FREA 3DKQA 5HV4A 4DXRA 4W4ZA 4OHYA 1JHJA 3IKWA 4K40A 2D6KA 2YPDA 3U0ZA 3FN9A 1IS4A 3I59A 4P08A 1DF0A 3GBWA 1XYOA 1E5HA 3WZ1A 5LBFA 4V2WA 3BPZA 1RUC2 2J1TA 5ACA3 1MS4A 2GMPA 1UAIA 2IXIA 3TYJA 4FCAA 1S0FA 2CWMA 2ZEWA 3IM0A 1Q3EA 3WF0A 5JMCA 3W5NA 4NIHA 1ULOA 2PN5A 2QQPA 5FZHA 2XKPA 2ZJCA 2ZZQA 3KCXA 3T2PA 3LE0A 2RMU3 1OOPC 2ZMNA 2WL1A 3NV1A 3R0RA 2ZBJA 3KS7A 3P6BA 3BOWA 2W39A 1J3RA 1WWYA 2X8KA 2W1WA 3GZEA 3U78A 4Q0PA 3V56A 3V0BA 3BN6A 5CIRA 3BTAA 2ZGUA 1RUD2 2YV8A 5IK7A 2VR4A 2BFUL 3C2UA 3P3PA 2HWF2 2VQTA 2VW2A 4I02A 3AYEA 4CDQB 1JUIA 4PI2A 3ILNA 5FXZA 4Q4X2 4BQYA 4BLIA 5CB7A 4CCLA 2F4LA 2J1RA 1KFXL 2DCYA 2QZ2A 2R1BA 3AKPA 2HWD3 3NQHA 3WDXA 1JYVA 5JXGA 2XG3A 3H8RA 1Y7BA 2VULA 3SEEA 3AZXA 4AZZA 5IHRA 1IPKA 2YMZA 3LSDA 4Y4YA 5C4WA 3HBZA 4ZXEA 5J3UA 4C0BA 1VRH2 5FY9A 5GZGA 5GLVA 1PO11 4KQ7A 4LK7A 5C9AA 1G9FA 1FOD1 1NCQA 4YWAA 2D97A 5SV5A 2ZABA 2W92A 4P9XA 2XMLA 5FY1A 5FJKA 3USUB 1CAWB 2JENA 4UFJA 4PQQA 3THCA 1CZSA 1KRIA 4XQ4A 1JODA 1GUIA 1LOFC 4GAZA 3N7JA 3K77A 1TG7A 2MEV1 1UQXA 3ZYJB 1RUF1 2QQWA 4Z1VA 4SBVA 1W2OA 1S55A 2WYSA 5LRRA 2JICA 3M7AA 1VR3A 5A3TA 4KWKA 3ZKUA 2ZX3A 4O61A 2BBVA 1NYWA 5FPXA 2OS2A 3AMPA 2GH8A 2JKBA 2P1BA 4LE3A 4OUMA 2NQYA 1RUC3 2Y0IA 4MH0E 3TRSB 1NZCA 2VJXA 4IV1B 5C5UA 4QU2A 4D94A 3H8XA 1K5JA 1GWKA 3IDBB 5DAPA 4B7KA 1UXZA 1W03A 1IQDC 5A1AA 2J1AA 5KR7A 2RDQA 4NVPA 4JGZC 2OZJA 4HSJA 4QX1A 4K21A 4OHWA 2BPA2 1CR7A 3ZXJA 1DQ0A 3L2HA 5BNPA 5CFDC 4QQHA 4MOAA 5FY0A 1MZ6A 3BODA 3LIGA 3ENRA 1SLTA 2HWF3 2ZGLA 4CA9A 4LTAA 2EXHA 3ACFA 5FYUA 4BQWA 1CJPA 1W99A 3WNKA 3FUQA 4XZPA 1W6MA 1S0IA 3H42B 4D6QA 5CA6A 3ECQA 2W5FA 4XZUG 1QOSA 2GALA 4YFWA 5BNOA 1I3HA 4FSJA 1ND2C 1KITA 4YNIA 4LULA 4UFHA 3GBGA 3AZVA 1VRH3 4Q1PA 4MXWB 3B5LB 4IEWA 1NCRC 3RFRA 2VMEA 1EY2A 3K46A 2PLV3 2QQOA 2ZEYA 3U4SA 4CCOA 3O0XA 3SITA 5GZEA 1RB8G 3ZSLA 3PJYA 1QH6A 1ENQA 1SFNA 2NLRA 1AR61 3GGLA 3LA2A 4JV4A 3WNXA 4G9SB 5KHGA 2OKXA 5FZKA 3WUDA 1LGCA 1SPPB 2PHRA 1FPN1 4YM0A 5LA9A 3OF1A 2VZSA 2GAUA 2VZ3A 3WV6A 2NYYA 3OJBA 4AEDB 1ONAA 4FAHA 4HVQA 3NNFA 1D2SA 2JB4A 3K48A 3ZO0B 3S7EA 1HRI3 1EV12 3DN7A 2CGOA 2VL4A 3POBA 4Y4RA 3RZGA 3BU7A 4UFKA 5H9SA 4IGQA 4FPFA 3N9QA 2ARXA 4B1MA 1QJFA 2VMDA 2G9FA 2I2SA 4LMFA 2BEOA 4FTSA 4LKDA 4CP1A 1ZREA 4LQRA 2O1QA 3OBAA 4WV8A 3GBFA 2OVUA 4Y20B 1XSRA 4AI1A 3PIGA 3IDEA 4ISQA 1C8M2 1HQLA 4AL9A 1RTVA 4A6OA 2AREA 1EAH2 1LNSA 1XPWA 2Q8OA 2D6PA 2Q1ZB 2RDRA 4AG4A 1CN1A 4WM8C 1XNAA 3L9JT 1MR5A 5JXIA 2FCVA 3UESA 5C3SA 1R091 4XFAA 3VHPA 2XJPA 3RZZA 4XUPA 4P02B 5IK8A 1WLDA 1RUE1 2WR9A 5F3GA 4BU2A 4D6SA 2E6VA 2A6VA 4FBFA 2YU2A 3D5OA 3NVCA 1UIJA 1RUJ2 4GWJA 4XAAA 1J83A 3WDTA 1T6BX 1JOBA 1PO22 4INDA 4HKWA 1POV3 1GZ9A 3C8XA 3POSA 4LBLA 1OVSA 1R64A 2WZPP 3TN92 4Q8LA 5EIYB 1O8PA 5FBJA 3VZMA 4CP9A 4HN1A 4NHLA 4NHXA 4ONUA 2V4VA 1BEV1 1HXS2 2WO1A 3AX4A 3PURA 1GOFA 4O65A 1FYUA 1ULEA 1AUYA 1LRHA 1QMJA 1OC1A 1WMXA 2P37A 2V72A 2P6HA 3CLPA 5IFTA 3T2OA 5FO8B 1H0BA 4CDQA 3ZN5A 1XU1A 1JBCA 2XHKA 2R7EB 1AYM1 2BFUS 2R0FA 3NV2A 4GKXA 2BGOA 4GWNA 4RHV2 3VBOB 1ULCA 2R062 1GZWB 4Z92B 2D40A 3SKVA 5FRAA 3RNSA 1Q8PA 2FCUA 1Y4WA 4LHSA 1ZRIA 4YG0A 1OLQA 2P4EA 3VZOA 5LW9A 2A3XA 3ZX7A 4JCKA 3KSCA 4IUGA 3AXEA 1YFWA 4LBMA 1RUI1 3E5XA 3FLTA 4NUBA 3ZYHA 2J1VA 2QQLA 4W8JA 2JG8C 2HEVF 3T4VA 1JHNA 4YRDA 1LECA 5G05L 3USUA 1CAWA 5FXVA 1KJRA 4NN0A 4JKMA 2PHXA 1H8VA 4CU9A 4GMP0 2VMCA 1H4HA 1C8M3 1YRZA 2FZ2A 3ZSJA 2Y0OA 2DCTA 1W04A 2WBKA 2WNEA 2VZRA 2ARAA 3HN3A 2P2KA 3RG0A 1H8TB 4E4ZA 2E7TA 4E8CA 1LGBA 1OUXA 2VM9A 5LA1A 1N3PA 1YJLA 2X09A 3HVDA 2WYFA 3MF6A 3MW4A 5C5TA 2VOTA 2VOXA 3LSEA 3W9AA 1GOGA 4PJYA 3TB0A 4IV1A 4F83A 2P6CA 4J1XA 4JC1A 3IMNA 1O4YA 4XDQA 1CX1A 2Q8EA 4IXLA 1TQ5A 3D82A 3M70A 2RS12 2O0OA 1PO23 2YU1A 3R05A 4B4QA 3OBZA 3ZM8A 3O1VA 2K2SA 1WW6A 1CESA 1Q8SA 5FK8A 3M4FA 4L92A 3OPTA 4BQXA 1DG6A 1URXA 3PNAA 4RFRB 1DIWA 5DZEA 5FLHA 2YXSA 3WW1A 4M4PA 2VMHA 1RGSA 1SCRA 2D7FA 3KMHA 2FDIA 5HCBA 2GC2A 1VBC2 3ILFA 4RHV3 4OI0A 1U0AA 5H9RA 3AP6A 3VKFC 1O3SA 4QHOA 1L7RA 5J96B 2CNAA 2PHDA 1UMIA 5F3IA 2R063 2XLFA 1BBT1 2GN7A 3RYRA 4BMBA 5IATA 1YYNA 2WS92 1WMDA 5LK5A 4AHZA 4P5HA 3ZYGA 1W0NA 3I3MA 5H9PA 3AZYA 5IFPA 3NNLA 4L11A 4YW6A 4DRVA 1FMD2 1QJU1 4OI4A 4MXWA 4M01A 5FKBA 3SQOA 1W9TA 3H3UA 3NMBA 3VB9A 1WLCA 1PNGA 4NHYA 1RVF1 1NCRB 1VBD3 3S0MA 2Y34A 1GLHA 3U14A 5AVAA 3PU8A 2XH6A 3DGTA 1I9RA 3RI9A 1LESA 1NXD1 2Q0AA 1UY2A 4L97A 3KLSA 4XFCA 3VD7A 3ZXDA 1NQJA 1SPPA 2Y64A 3DPRC 3AVRA 4CXWA 1O5UA 4R52A 3WNOA 2BOIA 3TNQA 3NAPC 4AEDA 3VZJA 3BB6A 3GJAA 4AVBA 2VTXA 3LDKA 3N3HA 3CEWA 4B8EA 2DVFA 1YWKA 1KGYA 2F17A 2IZWA 3T2TA 2O8QA 4Y1ZA 1UU6A 2WJSA 5FAXA 5I8SA 5FYTA 5DDJ2 4J25A 5A7NA 3ZSEA 4RN5A 5ACA1 1IS3A 3BUCA 1PVC1 1BQPA 5FPBA 4Y20A 1BMV2 5F37A 1YUDA 3MIHA 5BNNB 1XNBA 3WDVA 4ZU7A 1DZTA 1TE1B 4HVOA 5C4WC 1OF3A 2RMU1 3OTFA 1CZVA 4DXZA 4NAMA 1DYKA 4UBGA 2R32A 5C8CB 4LO5B 4A44A 5C9AC 1NCQC 1KXGA 2RS52 2W2IA 4IE4A 2YY1A 1YLLA 1VBC3 1OVPA 4LUMA 3CHXA 4PLOA 4R9DA 5FYBA 1OT5A 3C7EA 3NNGA 3O14A 4HONA 3E5UA 1N47A 1ENSA 1Q5OA 1W90A 3OGVA 4QQOA 4CEYC 5JZGB 3TBDA 3MZHA 3T1MA 2WS93 5HPOA 2HWD1 3CMGA 1ZZ7A 2R041 3FWEA 1E57A 2FHRA 2XBO2 4PDWB 1FMD3 1C28A 4KU7A 4OHVA 3ROUA 4ARYA 4IE7A 2X29A 1PO13 1ZM1A 4R8HA 4NPMA 1FOD3 4JKLA 4JRAA 1RJ8A 3PUHA 1W05A 4YGCA 1J3QA 1QQP1 2NM1A 4ZY9A 2ZGPA 2W52A 4BXSV 3UV9A 5EZWA 5F2WA 2SBAA 3DYMA 1BK0A 1OPOA 1S0GA 1QH7A 4FFIA 2DUPA 2CL2A 2AENA 1GZWA 1AX1A 1QGLA 2VO5A 4D8MA 2MEV3 1JYWA 2VD7A 3DUIA 4N7IA 4CEWC 3LA3A 4R4XA 1G9DA 1PGL2 1QOTA 1GZTA 2B46X 1GU3A 2E26A 2E32A 3I97A 4D3WA 3WVJA 1RUOA 1W8NA 3S30A 2BTVC 3ZOIA 2WQ4A 1W6PB 3I54A 3IWZA 4Y22B 5DDJ3 5F5QA 2X10A 1RUC1 1JZ6A 1AR82 3KHCA 2J22A 3GZTB 2OUHA 4RYDA 4MG2A 4QX8A 1EUTA 4LBNA 3BTZA 5BNOC 3T2QA 2BRTA 2HBUA 3KM5A 3AFKA 4FPYA 4BHPA 4CCMA 3HR9A 3MLLA 4RL7A 2RDNA 3ES4A 1H8TA 1NY72 2RR12 5EYYA 3T08A 3N9NA 3ETQA 2Q8DA 5A1LA 3AKQA 4XILA 5CKMA 3LEGA 3VDDB 2RS53 3INAA 4OUSA 4XQDA 1JZ4A 1W8TA 3A22A 2FDHA 3D3AA 2HWF1 3E1F1 3AK0A 3BIEA 1V6LA 3POEA 3K3OA 1V6MA 1ZZBA 4YLZA 3SHRA 2LUWA 1W0OA 5C3OA 1GNYA 3I3QA 2ORXA 5C7GA 4GJYA 5DAQA 2XBO3 5GZCA 1YEWA 2JDNA 4FFFA 4L8QA 2DUOA 2JE8A 4JGZA 3KWVA 4FP2A 1W3VA 1VRH1 1LR5A 2JIGA 3PUQA 5CFDA 2J1UA 1BVP1 3CU7A 5IK5A 1FAYA 3N9OA 5FP3A 5G04L 5FZ9A 5IYYA 1V6OA 3KVAA 4BWOA 1UCXA 1SMVA 3KQ4B 4IEYA 5FOBB 3HT2A 1AR63 1DP0A 2QZ3A 4ZPIA 4XFIA 2DFCA 2VNGA 2WC2A 3C7GA 3I2JA 4Z82A 4BCUA 2XWJB 2IXLA 4Y1UA 1W9FA 4COZA 4AFDA 4CDXB 2FBEA 1RXFA 2VXRA 5HBAA 2RJ2A 4BZ4A 2IC1A 4DINB 5LCWL 2BWAA 5FPZA 4H3WA 1FXZA 4GA9A 1R082 3VZNA 4D69A 4R4ZA 3AZWA 1LODA 4K3UA 1NCRA 2BNNA 4TLFA 4HZFA 4BIFA 4D7TA 4I2OA 3N36A 3I7DA 3FC0A 3T30A 2I74A 3QD6A 4EE2A 3I2KA 4XJZA 2LROA 4XF3A 3TEYA 5LBEA 2Y33A 5CNAA 3MHZA 2YBKA 2BNOA 1HJGA 5KXDA 2VNVA 2ZHNA 4N43C 2QQJA 3A4UA 3RS6A 3DPRB 3ZYIB 4AVAA 2LALA 3T0DA 4AGRA 1NE6A 2RR13 3SMHA 4EWAA 1DGWX 4UW3A 4Z2AA 4MGZE 3OUJA 4FQ4A 1C5HA 3JU9A 3ZLIA 1D0GA 3GJBA 4A6SA 1R093 5FYVA 1YI7A 3PJQA 1H30A 3WG4A 1D4M2 2VCMA 1LHWA 4ITCA 1GNZA 4BQ2A 5KWRA 2TEPA 1M06G 3TEWA 1DGRA 1CWPA 1LOAA 2D6LX 2VQ0A 3NJVA 1W8WA 4LBQB 3N4MA 5FV3A 3MDPA 2VZPA 4EWDA 3UJQA 1NUKA 2BW8A 5IVCA 3LB9A 3VBSB 4D7SA 1POV1 1J58A 2XJVA 3DYPA 3E6BA 5ANNA 5FY5A 4OUEA 3VGIA 1NZIA 3X29B 5FWJA 1YIFA 5GJ6A 5C8CA 5CYYA 4L0PA 4PCRA 4H55A 3AYCA 5J98B 1H4GA 3I2OA 1GANA 1L7LA 4DB5A 4QPYA 1I5ZA 1WCQA 2WFPA 4HL0A 5C3RA 5JZGA 4AQSA 2BVVA 5LZ6A 4MADA 3ASIA 3I3BA 3URFA 5KHHA 3JBG2 1W0PA 5JR7B 4FOVA 4JGYC 3WUCA 4D6RA 2BYVE 2W91A 1F5JA 1B35B 1D2QA 4MHUA 4CCJA 4COWA 3GALA 4WBBA 2WO7A 1J84A 2IXCA 5I0UA 2V73A 4BISA 4LNVA 1R083 1SEFA 1EV11 1RUH2 3ZPOA 1AX2A 2ZEZA 2VH9A 1PK6B 3JD72 4HLTA 1AZDA 2QQKA 3M3CA 1S2KA 4HK9A 2C0ZA 1G8WA 3E6DA 3I4IA 1RJ7A 4XBNA 5FFOC 4AI2A 4LR4A 5L9BA 2FDGA 4IEOA 4Z07A 3DF0A 1XRUA 2QUOA 2YBSA 3APBA 1C8M1 4P00B 3T1LA 1JI6A 3ZFGB 3MLKA 2UU8A 4YGBA 2GMMA 2KD7A 4CEWB 1EAH1 5DUWA 3AJYA 3BALA 1D4M3 3W20A 4G4FA 1W6PA 4Y22A 2CSGA 2DVGA 3UGGA 3WW4A 4ZKTB 2WA3A 3PVEA 4UW5A 3FZ3A 3U37A 2JDUA 4UBHA 4XBLA 2XDVA 1XC6A 5HI0A 4CUGA 1MVEA 3GCXA 2AEYA 1RUJ1 2DVDA 1K5MB 3QOPA 4MX3A 4XF9A 4BPZA 1WLTA 1C57A 1PO21 2PHFA 3TN91 4OZOA 1ULDA 1Y43B 3MBWA 4K1YA 4SLIA 3TOJA 1UY0A 4Q27A 2FDFA 3VDDA 4XF1A 1HXS1 4FOWA 3LPFA 4QGMA 4XTPA 1OH4A 1ZA4A 3QLQA 5D21A 4CCEA 1TEIA 4DQAA 1R1A2 1Q8VA 3F95A 4NJ4A 4AEKA 1DZQA 1EP0A 4AK3A 1RYYA 3BOPA 1HW5A 4M3CF 3ZXAC 4HK8A 1O3TA 4RHV1 5A6YA 2F4PA 3Q8AA 2EXKA 2W94A 2Y6HA 5FXWA 2C24A 5L73A 1GZCA 4ARXA 2R061 2ZZJA 5HCHA 1AXYA 1UY4A 2J1SA 3HQXA 4AEDC 1W2AX 1FV3A 2DBIA 1Q56A 1QOOA 1XBFA 3CJXA 5B4NA 2WDBA 1PM7A 1EUUA 2JDPA 2ZGNA 1RUH3 3B00A 4FT8A 4BK5A 3JD73 4AOCA 4IGOA 3PTRB 4R9AA 5IWFA 5FZEA 4AFBA 2HWB2 2RM22 4DEVA 3POFA 2XUMA 4CDUC 4DXTA 5JPNB 2ZCWA 2GC0A 5JSPA 3AP9A 4KL1A 4A7KA 3GZAA 2AH2A 4S2FA 4CYDA 3VBHB 1BKZA 2G19A 3WQ1A 4W50A 4CDXA 4PIXA 4HOOA 2NZ9A 4ASLA 5GM0A 4HANA 5IUQA 3ZYBA 1F4HA 2ADEA 5JLVA 1O59A 1J59A 3PHMA 4WVZA 4LHLA 1DDLA 1RHI2 3H7JA 3OD0A 3ST7A 3VHNA 2QBXA 2VUCA 3PMSA 1JYTA 3MLJA 1PVC3 1UKRA 1PMHX 4ZZ8A 2C4XA 2HLEA 2ZACA 4QM8A 5FZFA 2RS11 4HMZA 2VNRA 3HPNA 4DS0A 2WO2A 3UK9A 1QF3A 1Y3TA 3DPRA 2A6YA 2EIBA 1SLBA 3NWKA 5FYHA 2X05A 3R4UA 4UYBA 4N43B 3FFQA 3NAPA 2UY8A 1OI6A 2VAUA 3K2OA 2XVLA 3CBNA 1W8HA 1R1A3 1A8MA 1HLCA 3GF6A 5DN2A 2R30A 4CE8A 3D0SA 3WF2A 1VBC1 4ES8A 1HQWA 3VBOC 1LEMA 3BTYA 1KFUL 1W8UA 4LBQA 4I01A 3FLPA 3ABZA 4F3JA 2IVIB 2R043 2WS91 2W95A 4I09A 1TVGA 2X53S 1UZZA 2CTVA 3UKTA 1E5SA 3MI8A 3SEPA 3VBSA 4AE2A 1IG0A 1SFYA 2MNGA 4K6BA 4CXXA 4YZ1A 1FMD1 3NNMA 1OQDA 3M3EA 1AL23 3GM8A 3I2DA 4EJRA 3RJRA 1AR72 1N1SA 1ND3B 1QQP3 2R0HA 1VAVA 2HWB3 2RM23 4XETA 4NIAA 5CADA 4QHBA 1UKGA 5LEJA 5FZ6A 2EXJA 3IDCB 5JOWA 1QKQA 4IEUA 3UJOA 4CEYA 2QE3A 4A42A 5EXOA 4A7ZA 3THPA 5M0TA 5CAZA 2ZMKA 4P14A 1B35A 1CPNA 1Z78A 2ZKNA 1H8TC 1KQRA 3S7IA 2WSVA 3GCWA 4JGYB 1G6NA 4LHNA 3OCPA 1ENXA 5FY7A 3RPQA 3GZUC 3WQ0A 3WDUA 4HPKA 5F3CA 4RQPB 1PK6A 4FPLA 4U2AA 4QPIB 5DPNA 1RHI3 3S57A 1GNHA 2EALA 1K45A 5DDJ1 4MO3M 1VIWB 2D93A 4FO9A 5IJRA 2YHJA 3I3DA 4I0AA 1D4VB 4QDRA 1OSGA 3WSOA 2Q4SA 1UX6A 3OSDA 1BMV1 1OA2A 3ZFGA 4YZ5A 1V9U2 3N9PA 3H1YA 2AC1A 3D8CA 3ZN6B 4CEWA 1I6XA 4Q0VA 4H7MA 1WCSA 1XNTA 4YZ3A 2VVEA 4E2QA 1JZ7A 4E8DA 3O7OA 4OULA 1DQ5A 1ODNA 1RUD3 2JKXA 3WW2A 2RS51 4HKLA 3BI3A 4XF0A 2G9GA 3USSA 1CPMA 2OUJA 4EV0A 1U5XA 4Q4X3 2W46A 5A6XA 1MZEA 1HJFA 1XNDA 2H6CA 3MW3A 4EN7B 1UZYA 3RJ2X 4MGQA 3Q9OA 2Z42A 2VZOA 1O4TA 2HWE2 4LOSA 2XBO1 1O5LA 3SNMA 2JDKA 2XQRA 1SQ4A 2WKKA 1GV9A 2DU1A 3AMNA 1JW6A 4Q0QA 1FATA 1VAMA 1OH3A 5IVFA 1IPSA 1GQPA 4K7JA 1WLWA 1AR73 4XJAA 2RJKA 1C3HA 5T50A 1QDOA 2X5IB 4XJWA 2ZAHA 5EJ3A 1RXGA 1VMFA 1X9TA 3N9MA 3NV4A 4RR3B 2VG9A 5DAVA 1XOYA 3FMGA 1JZ8A 4UFMA 3S6PA 2JG9B 2ADDA 1UOGA 3J7HA 2VCAA 5JIUA 3L2YA 4K20A 1JH5A 3LAGA 4LO7A 4XUOA 3W58A 2DWRA 5C6CA 1CIYA 4AEMA 3E6CC 3A23A 5A32B 2WA4A 1PGL1 5A3UA 4NRQA 4Q5OA 3ZIWA 5LY1A 5K7PA 2YGLA 3O0WA 5FYIA 4EN6B 1YNAA 3M3QA 1BLZA 2ZGSA 4OMCA 1POQA 4QPGB 2ZGKA 3SLIA 1DQ1A 1KS5A 5LY2A 2HYXA 1AXKA 1QJZA 1OURA 1JU3A 1RITA 2G9ZA 3KT1A 4TZDA 1AR81 2TNFA 5F32A 2YUEA 3VZKA 4CDUB 1AYN2 5BNNC 3VBHA 5BV6A 4C1WA 3AYDA 5FR3A 3D0JA 2RJLA 2WFF2 5I0DA 1MS0A 1V9U3 2EIEA 5JVVA 4TYSA 1ZYBA 2VMIA 2FDKA 4H2AA 4W6WA 5C8CC 1LHOA 1RMU2 5JMOA 4IEVA 1NY71 2RR11 2R1DA 3ATGA 3OOXA 1H9PA 2CV6A 1OQ1A 3RI8A 2QNKA 1TME2 4XURA 2OYZA 1UZ0A 4L99A 5IVJA 4P9GA 3PMEA 5CZKA 5IK4A 5JZGC 5JWPA 5ABJB 1MEC2 3JQWA 3ZN4A 1N1YA 3NL1A 3OD4A 3O1MA 1WD3A 1ASJ2 2W9XA 3RMXA 1MZFA 2XJRA 3KGLA 4XMAA 1UX7A 3VBFB 3T3YA 3I8TA 1LEDA 1XYNA 3UGHA 4PDWC 4KBZA 3DEMA 4FI9A 1F2NA 2XKOA 1W2UA 4UOJA 2WNUC 1LOBA 5J48A 4N43A 4QKNA 2A6ZA 2GC1A 1U5ZA 4OVEA 2HYKA 3I2FA 5K4LA 3WHTA 3V0AB 2VECA 3U11A 4C91A 1BXHA 3DV8A 4JTNA 5FMOL 1TMF2 3IMMA 5FZ3A 2OPWA 3PDQA 1PGW1 2PHTA 5FPVA 4XJ9A 4QGNA 4DO0A 1VBA2 4H14A 4YW1A 4DY3A 4QDSA 4DUWA 2ENRA 1RUNA 1CZTA 4YARA 5F7UA 1RC6A 2VC9A 4U36A 3N7MA 2A70A 2ZHLA 4ES9A 3SC7X 1EV13 5LK7B 4DXSA 1R081 1ND3A 4CCKA 1MS3A 2CAUA 2QVSB 2UURA 4QXKA 2QQVA 5HXMA 1LCLA 4EYUA 1SBEA 1XB9A 3RZKA 1AYN3 1UIKA 1ZBA2 2YC0A 2IFWA 1KD7A 4W6XA 5HXVA 3JZVA 2VCCA 2WFF3 3H8UA 1GFF2 5EJ1B 5GKAC 4MGKE 4OHZA 3D6EA 1RMU3 1VPHA 4JGYA 1BHGA 4XW3A 1EAH3 2WZ8A 3VDDC 3ETPA 5FTTC 4BMEA 4MYEA 5IVYA 1L7QA 4M3CB 4RQPA 1TME3 3MIEA 2EAAA 3P3NA 4QPIA 2WQ8A 5CVRA 3RYPA 1UOJA 5L9VA 3KV4A 4Q29A 2K0GA 1D4M1 3K51A 1MEC3 5GLUA 3ZFEB 4MGTA 3RSJA 3I2GA 1X8MA 2PHWA 1AJOA 4GQ7A 1RUJ3 5J09A 1W06A 1WCKA 1VB4A 1FNYA 3NV3A 1OXCA 4Y5TA 1PMIA 4XFHA 3B93A 3EO6A 1S0DA 4LBKA 1UY1A 4IE0A 3TN93 2YC4A 3ZN6A 2PFWA 5F9TA 3ZIXA 4LBOA 4QB1A 2V09A 1HXS3 2W1SA 1ZRDA 3VN4A 2W08A 3HBKA 3IAPA 2ZTNA 3BGAA 3MW2A 1Q8OA 4JQTA 5EHDA 1UYZA 3O1UA 3J8F2 1TMF3 1F35A 4JDNA 4PLMA 2ZMLA 4IQPA 3SISA 2VUJA 1MS1A 2TBVA 3ZVXA 1X36A 2CGNA 2G4IA 3O0VA 5T55A 3IB3A 2A6WA 1VBA3 1UU5A 4CDXC 5FDBA 5FZGA 4QB2A 5A3OA 3O1RA 4JVAA 4KWUA 3GHNA 2B8MA 2A1XA 3RRDA 3BKZA 3U4XA 1YIPA 1DCSA 1RUH1 4FPJA 2E9QA 3WNLA 1YQ6A 3WF1A 1UNBA 3BCWA 3IAQA 2X5IA 4LORA 3UKVA 1CONA 3JD71 4BH9A 4IERA 2J7MA 3VUOA 4UI9L 3POGA 3K4AA 4OMDA 4RR3A 4TWTA 1ZBA3 1LAJA 4F7ZA 4GWIA 2JG9A 4MGYE 2W0XA 2WWJA 2ZGTA 4X6RB 1MS9A 3LDRA 3LPGA 4OHXA 4QU1A 4XUNA 1QDCA 2AGSA 4XOGA 5F5IA 4RA0A 4NWWA 5A32A 1T6GC 1HQNA 5DUUA 4CPBA 5E89A 4GKYA 4KMQA 2EA7A 5JXJA 1EPZA 5D1IA 5TSWA 1AR92 1UWWA 1UO9A 2YZ4A 4LIUA 1LHVA 5A33B 4DRRA 4CDWC 3IPVB 4ASKA 2BU9A 4CDUA 3WNMA 3NSTA 5FZ0A 1X9PA 2VOWA 2RS13 5DAWA 4PQ9A 5DXDA 2A71A 3WP4A 3ZXEA 3AB0A 3VBSC 1IOAA 1DLLA 5E88A 5CBLA 1SFPA 5FXXA 5A3PA 2Q8CA 4XF4A 4KU8A 1VP6A 2Z4FA 5FZAA 3I2HA 1V6KA 4X8NA 4A7YA 3J8F3 1R1A1 2QQMA 1WW5A 1VB2A 1JYCA 4P9JA 4YW3A 3HT1A 4GD4A 5ABJA 3CNAA 1ZRFA 3B69A 1SBFA 4QKDA 4COUA 5C70A 3AP4A 1JXNA 4P9YA 5KXBA 3PTYA 2ERFA 4AGVA 3J7LA 3PU3A 3FHQA 3UYJA 3VBFA 1B35C 1POV0 3KZ4C 2ZPXA 4LA2A 1NLRA 2PAKA 3OY8B 5BY5A 1GP5A 3CDZB 1W8FA 1F31A 5F6KA 2WNUB 1PK6C 4YGDA 5LA0A 4BJ0A 1AL21 4A3XA 2A3WA 3V0AA 1XE7A 2XJSA 3KV5A 2XHNA 2ZA9A 4E4SA 4JZRA 1VBB2 2HWB1 1SLIA 2RM21 1V6IA 5I93A 4EZHA 2WT1A 4PHZA 2RV9A 2DU0A 4OFGA 5FMOS 2ARBA 3VBOA 2IXJA 1SCSA 2NPIA 4CCNA 1YFYA 5FYYA 5SV8A 3ZFGC 3TAYA 4CP0A 4G3YC 2BUKA 1ZZCA 2D3RA 1AXZA 4X6QB 3UKNA 2K46A 1DQ6A 5DMYA 4FFHA 3I3EA 2W3JA 4GWMA 2DVAA 2VBPA 1DGLA 3DL3A 4Y1VA 4TTGA 3AFGA 1MVQA 5AC92 1AR93 1OD5A 4BE3A 5A6ZA 1HB2A 1UN1A 4AVSA 1FNZA 2JWPA 1UW8A 2FQPA 1RHI1 1J1TA 1EPWA 3PUIA 4FPGA 4ZONA 5DQ0A 1K5MC 3B9IA 3EMRA 3CO2A 2PXJA 1UL9A 4AHXA 5A1FA 4D7YA 5T5JA 3H3LA 3NKTA 1PIV2 2BOJA 2E7AA 2OQ7A 4KG8A 4FTBA 3GHMA 1VE0A 4LHKA 2WAOA 5FWEA 3WF4A 1REDA 4M3CA 4ZZ5A 2RDSA 3EYPA 2VZQA 2ILMA 3ZYFA 1ODMA 3MF9A 2ET1A 3MV11 4P5YA 1RUD1 4GB32 3ZFEA 3D4KA 3EQEA 1R1ZA 3ZYRA 3B7MA 1JZ2A 4UW4A 1HX6A 4Q4X1 2ZHKA 4BA6A 4EQVA 4P9LA 1W9WA 3ME2A 1Z0HA 2YBPA 5I91A 4BQ5A 2DFBA 4N7UA 2PAEA 3EBRA 3FX3A 4I0BA 4ORFA 4EN8B 2D6OX 1S4CA 4B4PA 3KGZA 4WZFA 3ZR6A 3ZFFB 2RVAA 3C7FA 4YZ4A 4YVSB 3QH6A 3LGRA 3AZZA 1CD3G 5L9RA 3RDIA 1ZX5A 1AR71 3WT3A 2ETEA 3M1HA 3TNPB 1NXMA 4QT6A 2PELA 3DECA 5FK7A 4XHBA 1O91A 1DLCA 3Q8CA 2E63A 4FPHA 4AVVA 4DEQA 1IS6A 3TEXA 4Y24A 4XEZA 2JDAA 3VBHC 1A6CA 1HRV2 2JDZA 2V4AA 3OGSA 1GBGA 3VKLA 1SLAA 3H0OA 1ZRRA 1OFSA 1COV2 1X82A 1W2NA 2AEZA 4UWDA 1VBE2 3AMQA 4B3NA 4CUAA 4NE9A 1ZNPA 5KHKA 3WY6A 4LKFA 2BP6A 1PNFA 5JAXA 1OKQA 2CDOA 2F6BA 1LJ7A 5EV7A 1AR83 4MHRA 1QHDA 3LEIA 2ES3A 1S2EA 3ES1A 1T2XA 4UW6A 4ATFA 5FPUA 4YG3A 1AVBA 1JUHA 3T09A 3AP7A 1V9U1 2JE7A 1YFXA 2ZGMA 3ORJA 1LOEA 1XYPA 4AVCA 3MPBA 2BVBA 3MFAA 5CKQA 2GNDA 2C26A 5KBFA 3EJKA 2TUNA 5EJZB 5A33A 2D3PA 4O9GA 5FP4A 2YB7A 5IVEA 1CQ9A 5A6QA 3R6SA 3HNYM 4B29A 3IPVA 4HXCA 1I1EA 2A7AA 5A80A 4NOTA 2MPFA 2D3SA 2OIIA 1NE4A 3LWCA 4JQRA 3UT0A 5DZFA 3BPSA 4CDWB 1L3JA 1H1AA 3WXPA 2XGXA 5BNNA 3AC0A 2B5HA 3H7YA 3AVSA 3CKHA 2A6XA 5FYCA 2HWE1 2P3IA 1GSLA 2WABA 3V64A 1UOBA 3S5QA 4GALA 4RS5B 1AHSA 1IKQA 4XCBA 5FMDA 1ND3C 2JB8A 3ZSMA 2YROA 3ZDVA 2GN3A 2CY6A 2RS32 4TXWA 4XFFA 1TNRA 2GNMA 2XPJA 1HRV3 1YQ2A 4JHZA 1G86A 3V65A 3R4DB 4ZU4A 4Q4W2 4Y5SA 3HQRA 1COV3 1MQTB 4Y5Z0 4EROA 2DBNA 1JOJA 5FCCA 1VBE3 4PDWA 4QQPA 4YPJA 2CAVA 3E5QA 3H1MA 4LLFA 4RQPC 4A2UA 1S0EA 2WNUA 3KQRA 3ZXFA 4QPIC 4AXOA 4DOUA 1VALA 5JXHA 3ACIA 1OFNA 1W39A 2DTWA 5EPAA 2C1FA 3K3NA 3ZXKA 4AAPA 2DCZA 1GKBA 5CKNA 1NOVA 2AYHA 2PA7A 3VD4A 2JDYA 1WBFA 2EF6A 3MYXA 2XR4A 5FYSA 5E1RA 5JOYA 2BQPA 1O7FA 1UPSA 1AYN1 1S2BA 1XE0A 2JE9A 4FQZA 3VL9A 4MGSA 2XLAA 2WFF1 4YG6A 4JRLA 4UF0B 1IQAA 4C0HA 5ANQA 4XC9A 5D8AB 2HEWF 1RMU1 4XACA 4NHMA 5IW0A 1CAXB 3B9CA 2WQZC 5EQUA 2VW1A 1TME1 1IG3A 2IUWA 5FY4A 2WN2A 5T5LA 1SDDB 2P3KA 4QX7A 2C6SA 1IGOA 1GYKA 4QQ2A 4XFBA 4V2VA 2VQAA 1MEC1 2Y6GA 4UAPA 3ZYPA 3VDAA 5T54A 4YZ2A 4EWEA 1ASJ1 5GZFA 4CSWA 3O1PA 3VKNA 3OG2A 4C90A 4UT5A 1QJX2 1E5IA 2ZAAA 2ZX0A 5B4XA 2VTXJ 3HQUA 4KNCA 1W6NB 4BYYA 3H1WA 4YFZA 1QY4A 3GYDA 5F5AA 5L19A 1NA1B 1WUVA 3VBUB 1Y9QA 3EXUA 4XPVA 4CCCA 1UYYA 2X5IC 3DCQA 2ZKLA 1S0CA 2UYBA 1ZRCA 3PUSA 1UYXA 1CJDA 4JX0A 4RR3C 1CAUB 2DTYA 2VUDA 1TMF1 2JG9C 4OI1A 2QFEA 5IVBA 1ZVFA 4HKOA 4TLGA 2R16A 3CQOA 4Q4W3 3JBG3 5IAXA 2PQQA 3VBRB 1BK1A 4ATEA 1QU0A 1VBA1 1Y9MA 5FUPA 3WP5A 3B3QE 1AJKA 2BBAA 3WCRA 5A3MA 5C3QA 3VL8A 3ZFFA 2HWC2 2XJTA 4LT5A 5FLJA 1CVNA 4QPGC 1H6XA 3JXSA 1IS5A 1ZA7A 3M2MA 4PLNA 3PL0A 4ET7A 4PF1A 5ERLA 2Z69A 4HBNA 1OBNA 3C7OA 2WWSA 5CFCC 2E51A 1ULPA 1ZBA1 1K3IA 1V00A 2GP5A 3T4HB 3OPWA 5GZDA 1VJ2A 1O6UA 2KR2A 5K0UB 4IL7A 1I5PA 3O5SA 1LOGA 4RSUA 3H9AA 4PBPA 1Y9GA 1J3PA 2PAMA 1S0JA 2KA3A 1K12A 4Q8KA 1QXPA 2AUYA 2ATFA 3AMMA 4C8DA 2D5FA 1RIRA 5ABJC 5CISA 3MGUA 3AKRA 5LBCA 4QKFA 3VBFC 2QQNA 3AM2A 5F5CA 1W2TA 1ULGA 4IE6A 1X50A 4QX5A 5BNQA 2R072 5L7OB 4XYXA 3QBQA 1A34A 3U10A 2GP3A 2UYAA 4JKKA 2WZR2 4OZXA 3AKTA 5FZ4A 4BQ4A 2PHLA 5FJHA 1A3KA 4HVRA 1XU2A 5KXCA 3POWA 4GZ9A 4KWLA 4FOQA 4HN0A 1G9AA 1HB1A 5F6LB 1ST8A 3CF6E 4Q4Y2 4A45A 1WD4A 3FHIB 1QXRA 2AR6A 2XVGA 2OQ6A 3J8F1 1VMHA 3KCYA 4LOTA 5FYMA 3K4DA 4E4HA 4CDWA 1MZ5A 1QNWA 3NJZA 5JOZA 1LOCA 4PIYA 4X8PA 1JYXA 3N9LA 4FPCA 2V5DA 1LHNA 3R4SA 4QD2A 1UU4A 2L9LA 1YJKA 5JPMB 5FP7A 4IV3C 3HNBM 4RS5A 1GICA 1UOFA 1W8OA 2G1MA 2HWC3 3W59A 3WHUA 1YO8A 4CP9B 1CAVB 4E2SA 4IEPA 5DG2A 4E27A 4EN9B 1G7YA 5FUNA 3MIFA 4LUKA 5E16A 3KCCA 1W9SA 4IEQA 3W5MA 1A78A 3E97A 4Q26A 4RFT0 2LW8A 5FO7B 4N9IA 5JDBA 1MQTA 5JSRA 2NMOA 2XXZA 3RGBA 2WT2A 1SLCA 3LEKA 3IDAA 1XSQA 4LPLA 2FMYA 4QX0A 3ACHA 1JOPA 1WBLA 3GNEA 3RZLA 4PBOA 4QMAA 1G9BA 3KT4A 2Y60A 5FKCA 1ZZ8A 1AR91 3U1XA 4GH4B 3ZFEC 4L9BA 3BTXA 2BV4A 4L2NA 2Y6FA 5T5PA 3WW3A 2PLV2 3K4ZA 1SLLA 5GLWA 2D98A 5A3WA 2HBTA 1PX3A 3SXWA 2B39A 2WN3A 2WO3A 2XOMA 3VKMA 5DUVA 1BYHA 1UZWA 5A3LA 2Z2SB 3F2ZA 3MIBA 2R073 3ALQA 4UF0A 4MLOA 5A7QA 3LIHA 1ZZ9A 2XUEA 2WZR3 4Y1YA 5D8AA 5EYXA 4GMP3 5FZDA 1W6OB 1WA6X 4N9HA 1W6QB 3HN1A 5BPXA 1CAXA 3IN9A 2J42A 1XNCA 1YXWA 3VD9A 4M4RA 1SG3A 1NQDA 2WNVB 4KI5M 4Q4Y3 4F8AA 1OA4A 1GR3A 1HRI2 3AJZA 2B4KA 1V70A 4MZUA 2EAKA 2QQUA 2VU9A 4XXPA 4LK6A 1ZBE2 1XNKA 4MUVA 5EP9A 4CXYA 1OLMA 2ZGOA 3CJIC 5HCAA 2I07B 3KV6A 3LF7A 4NPLA 4CCDA 2IXHA 1K5MA 3U75A 1RL3A 1YHFA 2EIDA 2E53A 1W6NA 4QHZA 4LEJA 2VE1A 1MS5A 1J1LA 1NA1A 2DDUA 2LS6A 2ZS6B 4FOYA 4P9IA 3VBUA 2IXKA 1WCUA 1GP4A 3B01A 1KJLA 4FAGA 4N53B 2YPJA 4QXHA 4CTEA 2XL9A 3Q8FA 3LD8A 4AR2A 1CAUA 4N8MA 4YVWC 2R6QA 1VBB1 2OXBA 4I30A 4LITA 1K42A 2H0BA 2HJIA 4DFSA 4NO4A 4B7EA 3VHRA 3OB8A 4URTA 4I0WB 3VBRA 2GNBA 2WNOA 5KC6A 3VZLA 4QXCA 1JMUB 4OYUA 1US2A 2WRAA 3FLRA 3THTA 3CZJA 2JXAA 3BU0A 3POJA 1O4ZA 1VRBA 2JX9A 3NJYA 1REEA 5AC91 3WF3A 4JAAA 2BGPA 2P3JA 3WDWA 3MV01 4K1ZA 4RGAA 1V6JA 3OGRA 4CPBD 3HAGA 1Z7S2 3AKSA 3J7MA 2J1EA 2XQXA 4Q4V2 4WM7B 3FBMA 3J7NA 3Q8BA 1REFA 3H8OA 2UY9A 1NLQA 1S1AA 3G6JB 2LM3A 3HMYA 4XJUA 4NR1A 2MHFA 1H2MA 5JIAA 5FZOB 1IPJA 2AACA 2SLIA 3POYA 5CFCB 5I0SA 4XXAA 1F4AA 1LKNA 1BVVA 1PIV1 1PX4A 5K0UA 2YYOA 3LKJA 1PZ7A 3RWNA 3FE5A 4Y3OA 5CG9A 4W6YA 1YQ5A 4CU8A 4HFSA 4AAXA 5JI9A 2AZ5A 2WINB 4MXVA 1YFUA 4QDQA 2VBBA 4PF5A 5FUIA 3VHOA 4AI8A 5L36A 1MPXA 4GB31 1ZBE3 2QDNA 2VOKA 5JCTA 4B1LA 2VMFA 5GALA 3ZMOA 4BK4A 4Q2FA 3ACGA 3ZPYA 1N1VA 3ZR5A 5L7OA 2HWE3 3VDBA 3ZKYA 2ORZA 3RZHA 3ILRA 4LJHA 3MICA 2DVBA 2JJ6A 1GWMA 3M3OA 2W47A 1DHKB 4BIOA 1GMMA 3OPZA 2A73B 3CIHA 4Y26A 3LCPA 1UD1A 2WT0A 2CHHA 4WVMB 1OMIA 4ASMB 4CU6A 5F3EA 4MV2A 2GMEA 3HD8B 5KC5A 4IEZA 3PIJA 1PZ9A 1AF9A 3POIA 4AYUA 3OYWB 2Q30A 3WOGA 1QJY2 2XJUA 4Q1RA 1HRV1 4XIOA 2BWCA 2D6NA 5T3NA 4I3GA 1OPMA 3U07A 4NIDA 5EWSA 1COV1 1H2NA 2P5BA 2FDJA 2B9UA 1W9YA 3PVNA 1VBE1 1CX4A 4QWNA 3ACLA 3NW4A 1CAVA 4COVA 2FD8A 4IV3B 3WNNA 4D0QA 1F8VA 1OOPB 2OW4A 1JU4A 1Z7S3 5FZBA 1LB2A 3DYOA 5CEHA 2H0VA 3ITQA 2N7GA 4Q4V3 5FQ0B 2BERA 1IKPA 1F5FA 2BGCA 3AYAA 4YM2A 4CRQA 4DZGA 5A3NA 2D5HA 2E31A 5D2AA 5F39A 2VZVA 5LASA 1KDKA 3MPPG 5C8WA 4UFLA 1QJEA 3OBTA 1AL0G 4R9BA 4YGEA 1H1MA 4C1XA 4LO4B 1WW7A 4LA3A 4NROA 4RGGA 2YC2A 4NIGA 2RG4A 2RHPA 2CWSA 5H9QA 2A5ZA 4LE4A 4GH4A 4CUBA 2A75A 2B45X 2V5YA 5BXXA 1HIXA 3EB7A 3K75B 1VBD2 4QX3A 4QAWA 3LOIA 1ASJ3 4J1WA 2LTNA 2PMWB 1PMJX 2D6MA 4DY5A 3KF5A 1HB4A 5J7MA 3G7DA 4FVVA 2B7YA 5FY8A 1VMJA 5FMCA 1IZ3A 3DXUA 1KDMA 1GQHA 2VVDA 1W6OA 4PT6A 3ZFFC 4YVSC 1W6QA 2BJSA 1RUG2 3HWJA 4NMIA 1OKOA 1XJAA 3O1SA 1LGNA 1DU3D 2XVKA 2WNVA 4H7LA 5LATA 4META 4NRMA 2WLPA 1CGPA 1C4RA 1F9KA 1JZ5A 2W1UA 4NHKA 2RS31 3PLQA 1QJY3 4IETA 3C3VA 4W65A 4UXAA 3SKJE 1UXXX 4EZ4A 5K9YA 4XUTA 3H3ZA 4Q4W1 5LWBA 3CJIB 2YGMA 1JN2P 3JBG1 3SH3A 4COYA 1U5IA 5LRSA 1GWLA 1GQGA 4LXLA 4M3CE 2K9ZA 4UFIA 4JGZB 4N53A 1ULFA 1H9WA 3N35A 2VVFA 2DURA 3IBMA 1WA4A 1XE8A 3OUHA 1HN0A 2DCJA 4M00A 5CFDB 1GP6A 2Q1MA 4YW7A 4ZS3A 2H6BA 3B02A 3B94A 4JHTA 4M0HA 1X7NA 2JEMA 4YVWB 2FMDA 4CZSA 2HEYF 4KGGA 5LB6A 4LKSA 5A7WB 3RZMA 2PHUA 4QPWA 3LFIA 4AHYA 2W87A 3AL5A 1OUSA 4E9KA 3LQCA 2O14A 3DKWA 2C5DA 2ZHMA 3THDA 4O9EA 4QXBA 4QX2A 1UYPA 1ND2B 2RE9A 2B42B 4XMIA 3HEIA 4OQ8A 1PO12 4QPGA 5F1RA 5APAA 1UMZA 3GXUA 4WM7A 1FOD2 2VMGA 3I2IA 2GSYA 5LEKA 1OHFA 2E33A 3RMYA 2OX0A 5FZOA 1DGWA 5CFCA 3WQBA 5FZLA 5FZIA 1QJX1 4MVTA 4FFGA 2GNTA 4RS5C 1LTEA 1KS4A 2MEV2 4KGQA 4R9CA 4DUXA 1RUF2 1RUG3 2W1QA 3KD4A 4BOWA 2ZGRA 2WZEA 1UF2C 2GDFA 2Q5TA 2ID4A 2WUHA 3A21A 1US3A 2LRPA 1ALYA 1JYIA 1O3QA 1DQ4A 5DZGA 3TEZA 5GLTA 5FOJB 4OQ9A 1JTZX 4BB3A 5DUXA 5JR2A 1VAKA 5E8AA 4YW5A 2Q1FA 3VV1A 1OD3A 2VY0A 1MQTC 3OBRA 4IEXA 4AFMA 3M3IA 4ZU5A 4AGGA 2A3YA 1AX0A 4YSFA 1ZZ6A 3I49A 3KHBA 3WD5A 4K8RB
chains in the Genus database with same CATH topology
2HWC1 1PGSA 2ZX1A 3O12A 4FPOB 3WDYA 1EYBA 1QXJA 5FBZA 4FXKB 3WG3A 4WVMA 4DNYA 4YM1A 4I3PA 4YM3A 3KT7A 3WINE 4Z2WA 4WM8B 1DBNA 4Y1XA 4AHWA 1HKDA 3OYWA 1XQNA 1NLSA 5AVPA 1DQ2A 4GULA 5D8AC 2ET7A 1O3RA 4JDOA 1M4WA 2UWAA 1X8EA 4IV3A 1OOPA 4BQ1A 1V6NA 1C1LA 1Q8QA 2XLGA 2XJQA 5FQ0A 2QJVA 4KWJA 1XXNA 4LO8A 4M0NA 5IT6A 3A0KA 1AR62 3JQXA 1APNA 1YI9A 2R071 1NA1C 4LLOA 1FPN2 1RUF3 3VBUC 4AQ2A 2WZR1 1SACA 4WVWA 4GMP1 3KB5A 4ISRA 1LU2A 5BNPC 3FJSA 2ZX4A 2WLQA 2VUAA 2FZ1A 4XJ8A 1PHMA 1U12A 1DGRN 4Q4Y1 2DCKA 3HIFA 3RQ0A 2QKDA 4HETA 2JECA 5KXEA 2XL7A 3VBRC 1FT9A 1WCDJ 2JG8B 3WLUA 2WSUA 4TSVA 3N7LA 4AVTA 1LOFA 2NMNA 4MGIE 2Z5WA 4GXLA 2DF7A 4XTMA 3A0NA 4MSVA 3M8LA 3PVOA 1VBB3 5B2GB 5I8TA 2CGPA 1R092 3H50A 1QNYA 3WP6A 3SCGA 2ZX2A 3OGJA 1RUE2 2KM2A 4XIKA 5K0UC 3CJIA 1MS8A 3VLBB 1QWRA 3MIDA 5EFUA 4K8FA 2DUQA 2IFRA 1FV2A 2VGDA 5KHIA 5AC93 2BNMA 1SBDA 4KH9A 1BEV2 5I0RA 4E2GA 1VLNA 4QGLA 2PLV1 5CG8A 4YVWA 4AI3A 1N3QA 2Y26A 4DPNA 1AYM2 4AFAA 1PGW2 1UPIA 4OI2A 5L7OC 1C8NA 1PIV3 3SH5A 1FPN3 1WMEA 5BYNA 1C5IA 2ZOEB 4S2HA 4QM9A 1ND2A 3FBYA 2JD4A 4KBBA 1DYPA 1N1TA 1HRI1 4GB33 1RUI2 3SCFA 3I59B 1ZBE1 1OA3A 1G9CA 3J4UH 4P9WA 2YDEA 2QCSB 2NP0A 4JTOA 5JSOA 4S2DA 3IT8A 1BJQA 1PVXA 1D0HA 2UWBA 2DV9A 4AQTA 4AFCA 3WG2A 4LBQD 4FPEA 3AXDA 3ZMNA 1HDKA 4ZXKA 3NAPB 3JCIA 4DMIA 2C9AA 3V0BB 2QDRA 1HV0A 3LA7A 3OGGA 4CDQC 2CYFA 5FO9B 1CIWA 4FP3A 1RUE3 4PIZA 1TNFA 1PZ8A 4BLJA 5BUVA 2VNOA 2I45A 5K8SA 1H1IA 3IIAA 4NWVA 4FTEA 2W68A 2ZGQA 4XHXA 4Z8BA 3OY8A 2P34A 3JB4C 4V1PA 2OA2A 2GH2A 3WCSA 5JI7A 4CP2A 4GH4C 4HSLA 5AFEA 4AWDA 2GU9A 1BEV3 5C4WB 3J9SA 1Z7S1 2D44A 3ELNA 4WM8A 4Q4V1 4YW2A 1NCQB 1S0BA 5C9AB 3WG1A 3PVBB 5AFBA 1AYM3 1BCXA 4LO6B 1HV1A 1BZWA 1WMFA 2O8OA 4CEYB 1BBT2 1FX5A 1H2KA 4J6GA 4QQLA 1MACA 4FXGB 4XBQA 1ENRA 4Q0SA 2WNVC 1QJU2 1DZRA 3WR0A 3ZSKA 4HPKB 3WX5A 2EVXA 4KG0A 1RUI3 4BM8A 4IV1C 5JOXA 1RVF2 1IHMA 4YW4A 3EHKA 3NO8A 2P17A 2PTMA 3NKGA 3CL1A 1U5YA 2NN8A 3FFZA 4AI0A 4XQWA 5DG1A 4WZCA 5CU1A 3ZDSA 2OPKA 3QCWA 1WGPA 1H2LA 4N53C 2DYCA 3JUUA 3VKOA 5BNPB 2D43A 2RS33 5HCFA 3MEPA 1OLRA 2EIGA 5GLZA 4AF9A 4B4RA 1QJY1 2JG8A 4GIQA 4JDMA 4E4DX 5ACA2 1PVC2 2PYTA 1W6MB 3FUOA 1RINA 5FLIA 3TWIA 2E7QA 1LHUA 2WIIB 1N3OA 5J36A 5BNOB 3SH4A 2RMU2 3BIWE 4LBJA 5I0TA 4XE9A 1B09A 2EXIA 4YVSA 1LULA 4WM7C 3LZZA 4AQ6A 5T52A 4AW7A 1LENA 3AP5A 3JB8A 3ZXGA 5T5OA 1DFQA 3WQ7A 1NG0A 4IESA 4XFGA 5KHJA 2Z79A 4NPRA 5I8YA 1BBT3 1SDWA 3J26N 2XB6C 1WW4A 3MFCA 2HKXA 1YCIA 2HWD2 2R49A 4WVVA 5J37A 2R042 4YYOA 1QJU3 3QH7A 3WP3A 5C33A 2GC3A 4K9SA 1FI2A 1Q43A 1AL22 4N90A 4OLLA 3RYKA 1A8DA 4HT1T 1RVF3 2VOVA 3MIGA 2IWGB 2KXLA 1QQP2 1X33A 1VBD1 2GZWA 2Y38A 2UWCA 2XWBB 5KC5A 4EN0A 3N7KA 2VW0A 3QACA 4S2GA 1LU1A 1QJX3 2OZ6A 4FPKA 3UL2A 3LOBA 3SCHA 4RD7A 4Q0UA 3AMHA 1RUG1 2VPVA 1C1FA 1OQEA 5FREA 4OHYA 3IKWA 4K40A 2D6KA 3U0ZA 1IS4A 3I59A 1DF0A 3GBWA 1XYOA 3WZ1A 3BPZA 1RUC2 5ACA3 1MS4A 2GMPA 1UAIA 2IXIA 3TYJA 4FCAA 1S0FA 2CWMA 3IM0A 5JMCA 1Q3EA 2PN5A 2QQPA 2XKPA 2ZJCA 2ZZQA 3KCXA 2RMU3 1OOPC 2ZMNA 2WL1A 3NV1A 3R0RA 2ZBJA 3KS7A 3BOWA 2W39A 1J3RA 2X8KA 3V56A 3V0BA 4Q0PA 5CIRA 3BTAA 2ZGUA 1RUD2 2YV8A 5IK7A 3C2UA 2BFUL 3P3PA 2HWF2 2VW2A 4I02A 3AYEA 4CDQB 1JUIA 3ILNA 4Q4X2 4BLIA 5CB7A 2QZ2A 1KFXL 2DCYA 2R1BA 3AKPA 2HWD3 3WDXA 2XG3A 1Y7BA 2VULA 3AZXA 1IPKA 2YMZA 3LSDA 4Y4YA 5C4WA 3HBZA 5J3UA 4C0BA 1VRH2 5GZGA 1PO11 4KQ7A 5C9AA 1G9FA 1FOD1 1NCQA 2D97A 5SV5A 2ZABA 4P9XA 3USUB 1CAWB 2JENA 1KRIA 4XQ4A 1LOFC 3N7JA 2MEV1 3ZYJB 4Z1VA 1RUF1 4SBVA 1S55A 5LRRA 2JICA 3M7AA 1VR3A 4KWKA 2ZX3A 2BBVA 1NYWA 5FPXA 3AMPA 2GH8A 2JKBA 4LE3A 4OUMA 3ZXLA 2NQYA 1RUC3 2Y0IA 4MH0E 3TRSB 1NZCA 4IV1B 4QU2A 4D94A 3IDBB 4B7KA 4NVPA 4JGZC 2OZJA 4HSJA 4K21A 4OHWA 2BPA2 1CR7A 3ZXJA 1DQ0A 3L2HA 5BNPA 5CFDC 4QQHA 1MZ6A 3BODA 3ENRA 1SLTA 2HWF3 2ZGLA 4LTAA 2EXHA 1CJPA 3FUQA 4XZPA 1W6MA 1S0IA 5CA6A 3ECQA 4YFWA 1QOSA 2GALA 5BNOA 1I3HA 4FSJA 1ND2C 1KITA 4YNIA 4LULA 3GBGA 3AZVA 1VRH3 4Q1PA 4MXWB 3B5LB 4IEWA 1NCRC 1EY2A 2PLV3 3O0XA 3SITA 5GZEA 1RB8G 3ZSLA 3PJYA 1QH6A 1ENQA 1SFNA 2NLRA 1AR61 3LA2A 3WNXA 4JV4A 4G9SB 5KHGA 3WUDA 1LGCA 2PHRA 1FPN1 4YM0A 3OF1A 2GAUA 3WV6A 2NYYA 3OJBA 4AEDB 1ONAA 4FAHA 4HVQA 1D2SA 3K48A 3ZO0B 3S7EA 1HRI3 1EV12 3DN7A 2CGOA 3BU7A 5H9SA 4FPFA 2ARXA 2G9FA 2I2SA 2BEOA 4FTSA 4CP1A 1ZREA 2O1QA 4WV8A 3GBFA 2OVUA 4Y20B 4AI1A 3IDEA 4ISQA 1C8M2 1HQLA 1RTVA 2AREA 1EAH2 2Q8OA 2D6PA 2Q1ZB 4AG4A 1CN1A 4WM8C 3L9JT 1MR5A 1R091 4XFAA 3VHPA 2XJPA 3RZZA 5IK8A 1WLDA 1RUE1 4FBFA 2E6VA 2A6VA 3D5OA 3NVCA 1UIJA 1RUJ2 3WDTA 4INDA 1PO22 4HKWA 1POV3 1GZ9A 3POSA 4LBLA 2WZPP 3TN92 3WCRA 4Q8LA 3VZMA 4HN1A 4NHLA 4ONUA 1BEV1 1HXS2 3AX4A 1FYUA 1ULEA 1AUYA 1LRHA 1QMJA 2P37A 4HKOA 3CLPA 5FO8B 1H0BA 4CDQA 3ZN5A 1XU1A 1JBCA 2XHKA 4RHV2 1AYM1 2BFUS 2R0FA 3NV2A 4GKXA 4GWNA 3VBOB 1ULCA 2R062 1GZWB 4Z92B 2D40A 5FRAA 3RNSA 1Q8PA 4YG0A 1OLQA 3VZOA 2A3XA 3ZX7A 4JCKA 3KSCA 3AXEA 1YFWA 4LBMA 1RUI1 3E5XA 3FLTA 2JG8C 2HEVF 1JHNA 4YRDA 1LECA 3USUA 1CAWA 1KJRA 4NN0A 2PHXA 1H8VA 4GMP0 1H4HA 1C8M3 1YRZA 2FZ2A 3ZSJA 2Y0OA 2DCTA 2WNEA 3RG0A 2P2KA 1H8TB 4E4ZA 2E7TA 1LGBA 1N3PA 1YJLA 3MF6A 3MW4A 2VOXA 3LSEA 3W9AA 4PJYA 3TB0A 4IV1A 4F83A 4J1XA 4JC1A 3IMNA 1O4YA 4XDQA 4IXLA 1TQ5A 3D82A 3M70A 2RS12 2O0OA 1PO23 3R05A 4B4QA 2K2SA 1WW6A 1CESA 1Q8SA 3M4FA 4L92A 1DG6A 1URXA 3PNAA 5DZEA 1DIWA 5FLHA 2YXSA 3WW1A 2VMHA 1RGSA 1SCRA 2D7FA 3KMHA 5HCBA 2GC2A 1VBC2 3ILFA 4RHV3 4OI0A 1U0AA 5H9RA 3AP6A 3VKFC 1O3SA 5J96B 2CNAA 2PHDA 2R063 2XLFA 1BBT1 2GN7A 3RYRA 4BMBA 1YYNA 2WS92 1WMDA 5LK5A 4AHZA 4P5HA 3ZYGA 5H9PA 3AZYA 4L11A 4DRVA 1FMD2 1QJU1 4OI4A 4MXWA 4M01A 3H3UA 1WLCA 1PNGA 1RVF1 1NCRB 1VBD3 3S0MA 1GLHA 5AVAA 2XH6A 3DGTA 1I9RA 3RI9A 1LESA 1NXD1 2Q0AA 4L97A 3KLSA 4XFCA 3ZXDA 1NQJA 3DPRC 1O5UA 4R52A 3TNQA 3NAPC 4AEDA 3VZJA 3BB6A 4AVBA 3N3HA 3CEWA 4B8EA 2DVFA 1YWKA 2IZWA 3T2TA 2O8QA 4Y1ZA 1UU6A 2WJSA 5FAXA 5I8SA 5DDJ2 3ZSEA 5ACA1 1IS3A 1PVC1 1BQPA 4Y20A 1BMV2 1YUDA 3MIHA 5BNNB 1XNBA 3WDVA 4ZU7A 1DZTA 1TE1B 4HVOA 5C4WC 2RMU1 3OTFA 4DXZA 1DYKA 4UBGA 2R32A 5C8CB 4LO5B 5C9AC 1NCQC 1KXGA 2RS52 2YY1A 1YLLA 1VBC3 4LUMA 4PLOA 5GLVA 4R9DA 4AEJA 4BHPA 3O14A 3E5UA 1N47A 1ENSA 1Q5OA 4QQOA 4CEYC 5JZGB 3TBDA 3MZHA 3T1MA 2WS93 2HWD1 1ZZ7A 2R041 3FWEA 1E57A 2FHRA 2XBO2 4PDWB 1FMD3 1C28A 4KU7A 4OHVA 3ROUA 2X29A 1PO13 1ZM1A 4R8HA 1FOD3 4JRAA 1RJ8A 4YGCA 1J3QA 1QQP1 2NM1A 2ZGPA 2W52A 3UV9A 5EZWA 2SBAA 1OPOA 1S0GA 1QH7A 2CL2A 2DUPA 2AENA 1GZWA 1AX1A 1QGLA 2MEV3 3DUIA 4N7IA 4CEWC 3LA3A 4R4XA 1G9DA 1PGL2 1QOTA 2B46X 4D3WA 3WVJA 1RUOA 3S30A 2BTVC 2WQ4A 1W6PB 3I54A 3IWZA 4Y22B 5DDJ3 5F5QA 1RUC1 1AR82 3GZTB 2OUHA 4LBNA 5BNOC 3KM5A 3AFKA 4FPYA 3HR9A 3MLLA 4RL7A 3ES4A 1H8TA 1NY72 2RR12 5EYYA 3ETQA 3AKQA 4XILA 3VDDB 2RS53 3INAA 4OUSA 4XQDA 2HWF1 3AK0A 1V6LA 1V6MA 1ZZBA 4YLZA 3SHRA 2LUWA 1W0OA 2XBO3 5GZCA 4L8QA 2DUOA 4JGZA 4FP2A 1VRH1 1LR5A 5CFDA 1BVP1 3CU7A 5IK5A 1FAYA 1V6OA 4BWOA 1UCXA 1SMVA 4IEYA 3HT2A 1AR63 2QZ3A 4XFIA 2DFCA 2VNGA 2WC2A 4Z82A 4BCUA 2XWJB 2IXLA 4Y1UA 4COZA 4AFDA 4CDXB 2FBEA 5HBAA 2VXRA 4BZ4A 2IC1A 4DINB 2BWAA 5FPZA 4H3WA 1FXZA 4GA9A 1R082 3VZNA 4D69A 4R4ZA 3AZWA 1LODA 4K3UA 1NCRA 2BNNA 4TLFA 4HZFA 4BIFA 4D7TA 4I2OA 3N36A 3I7DA 3FC0A 2I74A 3QD6A 4XJZA 4XF3A 5CNAA 2BNOA 5KXDA 3ZYIB 2ZHNA 4N43C 3A4UA 3RS6A 4AVAA 3DPRB 2LALA 4AGRA 1NE6A 2RR13 3SMHA 4EWAA 1DGWX 4UW3A 4MGZE 4FQ4A 1C5HA 3JU9A 1D0GA 1R093 1YI7A 3PJQA 1H30A 3WG4A 1D4M2 4ITCA 1LHWA 1GNZA 5KWRA 2TEPA 1M06G 1DGRA 1LOAA 2D6LX 2VQ0A 3N4MA 4LBQB 3MDPA 4EWDA 3UJQA 2BW8A 3LB9A 3VBSB 4D7SA 1POV1 1J58A 2XJVA 3VGIA 3E6BA 3X29B 1YIFA 5GJ6A 5C8CA 4PCRA 4H55A 3AYCA 5J98B 1H4GA 1GANA 4DB5A 4QPYA 1I5ZA 2WFPA 4HL0A 5JZGA 4AQSA 2BVVA 3ASIA 3URFA 5KHHA 3JBG2 1W0PA 5JR7B 4FOVA 4JGYC 3WUCA 2BYVE 1F5JA 1B35B 1D2QA 4COWA 3GALA 4WBBA 2IXCA 5I0UA 2V73A 4LNVA 1R083 1SEFA 1EV11 1RUH2 1AX2A 2VH9A 1PK6B 3JD72 4HLTA 1AZDA 3M3CA 1S2KA 4HK9A 2C0ZA 1G8WA 3E6DA 3I4IA 1RJ7A 4XBNA 5FFOC 4AI2A 4LR4A 4IEOA 4Z07A 3DF0A 1XRUA 2QUOA 3ZFGB 3APBA 1C8M1 3T1LA 3MLKA 2UU8A 4YGBA 2GMMA 4CEWB 1EAH1 5DUWA 3AJYA 3BALA 1D4M3 4G4FA 1W6PA 4Y22A 2DVGA 3WW4A 4ZKTB 2WA3A 3PVEA 4UW5A 3FZ3A 4UBHA 4XBLA 5HI0A 1MVEA 4XF9A 1RUJ1 2DVDA 1K5MB 3QOPA 4MX3A 4BPZA 1WLTA 1C57A 1PO21 2PHFA 3TN91 1ULDA 1Y43B 4K1YA 4SLIA 3TOJA 4Q27A 3VDDA 4XF1A 1HXS1 4FOWA 4QGMA 4XTPA 1ZA4A 3QLQA 4DQAA 1TEIA 1R1A2 1Q8VA 4AEKA 1DZQA 1EP0A 4AK3A 3BOPA 1HW5A 4M3CF 3ZXAC 4HK8A 1O3TA 4RHV1 2F4PA 2EXKA 5L73A 1GZCA 2R061 2ZZJA 1AXYA 3HQXA 4AEDC 1FV3A 1Q56A 1QOOA 3CJXA 1PM7A 2ZGNA 1RUH3 3B00A 4FT8A 3JD73 4R9AA 4AFBA 2HWB2 2RM22 4CDUC 2XUMA 5JPNB 2ZCWA 2GC0A 5JSPA 3AP9A 4KL1A 4A7KA 3GZAA 2AH2A 4S2FA 4CYDA 3VBHB 1BKZA 3WQ1A 4CDXA 4PIXA 2NZ9A 4ASLA 5GM0A 4HANA 5IUQA 5JLVA 1J59A 3PHMA 4WVZA 4LHLA 1DDLA 1RHI2 3H7JA 3OD0A 3ST7A 3VHNA 3PMSA 3MLJA 1PVC3 1UKRA 2ZACA 4QM8A 2RS11 4HMZA 2VNRA 4DS0A 3UK9A 1QF3A 1Y3TA 3DPRA 2A6YA 3NWKA 1SLBA 3R4UA 4N43B 3FFQA 3NAPA 2UY8A 1OI6A 2XVLA 1R1A3 1A8MA 1HLCA 3GF6A 2R30A 3D0SA 1VBC1 4ES8A 1HQWA 3VBOC 1LEMA 1KFUL 4LBQA 4I01A 3FLPA 4F3JA 2R043 2WS91 4I09A 3UKTA 2X53S 1UZZA 2CTVA 3VBSA 3MI8A 5FOBB 4AE2A 2MNGA 1SFYA 4K6BA 4YZ1A 1FMD1 1OQDA 3M3EA 1AL23 3I2DA 4EJRA 3RJRA 1AR72 1N1SA 1ND3B 1QQP3 2R0HA 1VAVA 2HWB3 2RM23 4XETA 5CADA 4QHBA 1UKGA 5LEJA 2EXJA 3IDCB 5JOWA 1QKQA 4IEUA 3UJOA 4CEYA 2QE3A 5EXOA 4A7ZA 3THPA 5CAZA 2ZMKA 4P14A 1B35A 1CPNA 1Z78A 2ZKNA 1H8TC 1KQRA 3S7IA 2WSVA 4JGYB 1G6NA 4LHNA 3OCPA 1ENXA 3RPQA 3WQ0A 3GZUC 3WDUA 4HPKA 4RQPB 1PK6A 4FPLA 4U2AA 4QPIB 1RHI3 1GNHA 2EALA 5DDJ1 1VIWB 2D93A 4FO9A 2YHJA 4I0AA 1D4VB 1OSGA 2Q4SA 1UX6A 1BMV1 1OA2A 3ZFGA 4YZ5A 1V9U2 3H1YA 3D8CA 3ZN6B 4CEWA 1I6XA 4Q0VA 4H7MA 1WCSA 4YZ3A 2VVEA 4E2QA 3O7OA 4OULA 1DQ5A 1RUD3 3WW2A 2RS51 4HKLA 4XF0A 2G9GA 3USSA 1CPMA 2OUJA 4EV0A 1U5XA 4Q4X3 1MZEA 1XNDA 2H6CA 3MW3A 4EN7B 1UZYA 3RJ2X 3Q9OA 2Z42A 1O4TA 2HWE2 2XBO1 1O5LA 3SNMA 1SQ4A 2WKKA 1GV9A 2DU1A 3AMNA 1JW6A 4Q0QA 1FATA 1VAMA 4K7JA 1WLWA 1AR73 4XJAA 2RJKA 1C3HA 5T50A 1QDOA 2X5IB 4XJWA 2ZAHA 5EJ3A 3NV4A 4RR3B 2VG9A 3FMGA 3S6PA 2JG9B 5JIUA 3L2YA 4K20A 1JH5A 3LAGA 4LO7A 3W58A 5C6CA 2DWRA 4AEMA 3E6CC 5A32B 2WA4A 1PGL1 3ZIWA 5K7PA 2YGLA 3O0WA 4EN6B 1YNAA 3M3QA 2ZGSA 4QPGB 2ZGKA 3SLIA 1DQ1A 1KS5A 1AXKA 1QJZA