5KC6A

Crystal structure of cbln1 (val55-gly58 deletion mutant)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
SAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerebellin-1
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kc6A00
4QPYA 3ALQA 4QQHA 3K51A 3ME2A 4EN0A 3IT8A 3L9JT 3URFA 4KG8A 2X29A 2Q1MA 4DB5A 1PK6B 1U5ZA 4MXWA 4QQOA 1D0GA 2AZ5A 1JH5A 1RJ8A 4E4DX 5KC6A 3LKJA 2Q8OA 4F3JA 3QD6A 3AB0A 1OQEA 1O91A 2JG9B 3WD5A 2R32A 4TSVA 4RSUA 4G3YC 1DU3D 2R30A 1I9RA 1TNFA 2JG8C 2WNVC 4GIQA 1KXGA 1XU1A 5HBAA 3K48A 5L36A 4QQPA 1U5XA 5KWRA 1PK6C 2TUNA 5KC5A 1ALYA 3TWIA 2JG8A 2WNVA 2RJLA 4MXWB 4NN0A 1C3HA 4E4SA 1OQDA 4KGGA 5BNQA 2WNUB 1PK6A 1C28A 4G4FA 2JG9C 2HEVF 2RE9A 1DG6A 1D4VB 4OUSA 2ZJCA 4DOUA 1IQAA 4TWTA 3MI8A 3B93A 4MSVA 5TSWA 2JG9A 4HT1T 4MXVA 2QDNA 1U5YA 2QE3A 5CIRA 4OULA 2ZPXA 4J6GA 2E7AA 2RJKA 2JG8B 3TYJA 2WNVB 2WNUC 4QQ2A 2R6QA 1D2QA 3FC0A 2HEWF 4OUMA 5L19A 2KA3A 2TNFA 2OIIA 4D7YA 2HEYF 4KGQA 4N90A 3QBQA 1A8MA 2Z5WA 3B9IA 2WNUA 1RJ7A 1JTZX 3B94A 1WCKA 1S55A 1GR3A 1KD7A 1TNRA 4QQLA 2O0OA 3V56A 1XU2A 1OSGA
chains in the Genus database with same CATH superfamily
5FMOL 3SLIA 3T2PA 1W6MA 3R4SA 4PDWC 4EWAA 3MHZA 2A70A 1AXZA 4JZRA 1O8SA 2W0XA 2XBO3 3L9JT 4O65A 4J1WA 4CPBD 3NO8A 2AYHA 4R9CA 1FAYA 3E97A 3PIJA 5LCWL 4AF9A 5A1LA 2IFWA 4URAA 1TVGA 2RS52 5FYSA 4BQ3A 2DWRA 1KITA 2XKPA 1RJ8A 3J4UH 4AVAA 2D97A 1W0NA 3KM5A 3GBFA 1PGW1 2VQ0A 2YGMA 4RR3B 5GM0A 1ASJ3 5CBLA 1JW6A 5H9SA 3J9SA 2BVBA 3SXWA 3WNNA 5IVVA 1BBT1 2Y60A 2XB6C 1MQTC 5FXWA 1VBA2 4P02B 5F3EA 1LESA 5ABJA 3EMRA 4H3WA 1FPN1 2DFCA 2VVEA 1RYYA 2VCBA 2OXBA 3I2FA 4WBBA 3HVDA 4LTAA 2A7AA 3ZVXA 1IQDC 4A42A 4AR2A 3B01A 4N53B 3RZLA 5FZ3A 3DECA 1W6MB 2R1DA 3CLPA 1EPWA 3RFRA 5L36A 5DUUA 3O1RA 4Q4X3 3IDBB 5DUWA 1JUIA 5A7SA 1HB3A 1O4ZA 3ZLIA 5H9QA 1ALYA 2QQVA 3NKTA 4BU2A 4PBOA 4LO6B 3ITQA 4QGNA 3R05A 2LROA 4JRLA 4Y20A 2ZKNA 1EV12 5JR2A 4OI0A 4YVWA 3LEKA 1KS4A 4IERA 3NJVA 3FLPA 1OBNA 5LATA 2ORZA 2VOKA 2AREA 4OLLA 3NQHA 2JX9A 3CDZB 3POSA 2GH2A 2ZGOA 1D2SA 2CV6A 4NHXA 1Q8VA 2ZHLA 1DG6A 2YC2A 3AYAA 4DRRA 5A3MA 3MDPA 2K9ZA 1WLWA 5I8YA 1S0IA 3PUSA 5CU1A 1KDKA 2ES3A 5ABJB 1TME3 5IT6A 4N53C 1BEV1 4LR4A 5DDJ1 1RUG2 1GWLA 2DYCA 2Z42A 1GQGA 2WQZC 2G9GA 2YBPA 5B2GB 4OCTA 4Y24A 3MW4A 1VBC2 1PM7A 3HEIA 3POEA 4UFIA 3HNMA 4LUMA 1LJ7A 4A6SA 4ZU5A 2AUYA 3A23A 2VG9A 1TG7A 1FV2A 2RDQA 5GJ6A 3ABZA 2ZTNA 5FJKA 3KD4A 3ZR5A 3NKGA 4YVWB 4OUEA 4QX0A 1W8UA 3PUIA 3V64A 3RZJA 1OLQA 3ZSKA 1UX6A 3ELNA 3W9AA 3OUIA 2XJRA 1MS8A 2YGLA 4D7YA 2ZABA 4DXTA 1OOPA 4N90A 5FY7A 4UFKA 2W46A 2IWGB 1AXKA 1PIV2 1RUE1 1ND2A 1UY0A 2C9AA 4P08A 2VZPA 3UETA 4BK5A 1H1IA 4NPMA 2ATFA 4LK7A 4PQQA 2NZ9A 3VBFA 1V9U3 3PTYA 4RA0A 3LZZA 1YQ8A 1WMXA 2WO2A 2PHTA 4XIKA 2RDSA 2WO7A 1O59A 4NWVA 1AUYA 1XB9A 5FCCA 3ZXDA 1GMMA 3W21A 2XQRA 3ZYRA 1V00A 2EA7A 2BW8A 2PHWA 5D8AC 3VBRA 4XIOA 2JDMA 4GZ9A 2C1FA 4RGAA 1VLNA 4UT5A 3MLJA 3ORJA 3FMGA 4LBJA 1SBFA 2QQJA 1RVF3 3MGUA 2Y26A 4HMZA 4JGYC 3UGGA 3Q8FA 1JZ4A 4W6YA 3O1VA 4OHVA 4UBGA 2AZ5A 2R061 1Q8PA 3LKJA 1OOPB 3WF0A 2ZACA 2HYXA 4QKNA 3WNXA 1K45A 4GJZA 1ND2B 2VJXA 4DNYA 2BNNA 2VW0A 3ZSJA 4B4RA 2J1EA 2KM2A 4EZHA 3LAGA 3VBFB 4JHTA 4DUVA 1TZOA 2C9KA 4PQ9A 3I3DA 1Q8QA 3NNGA 1AYM1 1W6OA 5FZ9A 2NPIA 2RJ2A 1J1LA 1MS3A 2DUQA 1JN2P 1GYKA 3DUIA 4FXKB 4XF1A 2JB4A 5FMCA 2Y6LA 5DDJ2 5J3UA 4XFFA 1K12A 1PZ7A 4QXBA 3SC7X 1OMIA 1W39A 2RS33 1CIWA 2WA4A 1U5XA 2WFF1 2TUNA 2XDVA 5A7NA 3UGFA 1O4YA 1MS4A 4W6XA 3OG2A 1U0AA 2Z79A 2JDZA 2QZ3A 3ZR6A 2DCYA 5HXMA 2OKXA 3AFGA 4AZZA 5IVBA 1QWRA 2H0BA 1MACA 1C8M3 3A4UA 4MGZE 4C91A 5IUQA 3DYMA 3AXEA 3S5AA 2ZX4A 4Y1VA 5FY0A 4AFBA 4CUAA 2VMHA 4YARA 1C28A 3NSTA 1ASJ1 1NE4A 2LS6A 1C5IA 4LBKA 3SISA 4AGGA 4DEQA 1U5IA 2VNVA 4K40A 5E6HA 4AEKA 2BPA2 3WW3A 2RS13 3TB0A 3C8XA 3FHAA 1CAUA 3ZXFA 5C8WA 1ENSA 3SNMA 3WQ7A 4A7KA 4QAWA 4LHSA 1VBB2 4X8NA 3P3NA 2OQ6A 1W6OB 4XVHA 1MEC1 4BYYA 4MH0E 2O14A 2VBBA 4OHZA 4JCKA 3AC0A 4JGZA 2WJSA 4PJYA 1W2UA 2GU9A 1HV1A 1V0AA 2WWJA 1X33A 3UKNA 2V5DA 3N7LA 2VULA 3TYJA 2VOVA 1C57A 3FE5A 1RUC1 3ILNA 2W08A 4NRQA 1DIWA 5LBCA 1RHI1 4E9KA 4E8DA 5DG2A 1W90A 4NOTA 1NY71 4OUMA 3S5QA 3ZYHA 1W9YA 4P14A 3AJYA 1T6BX 4QB2A 5FAXA 3ES4A 1DYOA 4FPEA 1XJAA 2R062 2XLFA 4QT6A 2HJIA 1EY2A 3OTFA 5HCHA 1J3RA 1LHWA 4QM8A 1CAUB 3EXUA 1RMU3 1NUKA 2H6BA 4AAPA 2E33A 4FFFA 1Y4WA 1TNRA 2WSVA 1CZSA 2EALA 3IN9A 2OUHA 5C3OA 2XQXA 3HNBM 3CF6E 1CQ9A 3ALQA 2DBIA 1TEIA 1YXWA 5JMCA 3AFKA 1YFWA 4JGZB 3S7EA 3FX3A 1SLBA 3PUQA 3ZFGC 2VZQA 3WNOA 4S2GA 5GLTA 5HCAA 2ZMNA 1AYN3 5IATA 2WWSA 2V4AA 5IVYA 3USSA 1HRI1 1YQ6A 3V0AA 2VE1A 2WRAA 3UJOA 5FDBA 4C1XA 4DMIA 1NT0A 4NMIA 4QPGC 3CJXA 4E4HA 4LKEA 3R4UA 4BPZA 4Z8BA 2VZUA 1UU5A 3IBMA 2VUAA 5LEKA 5FUNA 4OVEA 1F5JA 1MZEA 4AHYA 4MVTA 2HWF1 1ASJ2 3RGBA 4DIQA 1WMEA 3VBUA 2G9FA 1GZWA 1WLDA 2N7GA 1S0EA 4MADA 4COZA 5BY5A 3KZ4C 1OVPA 2ZKLA 5FMOS 3SCHA 4ISRA 1YQCA 3WSOA 2Q1FA 5BNNA 1CIYA 1QKQA 3FJSA 4BHPA 1YEWA 2ARBA 1DCSA 2ZAAA 2ET1A 4AI9A 2YB7A 4Q4X2 1RVF1 4NAMA 3WXPA 3ZKUA 3C7HA 2PQQA 2RJLA 3D6EA 3IIAA 1I5ZA 4KL1A 3V0AB 3TBDA 1I6XA 4GKYA 3LF7A 5FZ8A 3U11A 4XMAA 2VMEA 3VBOA 5DZEA 5CISA 2VZ1A 4RYDA 5C4WA 3A0NA 2WO1A 4GMP3 4ES8A 2W52A 1LENA 4G9SB 1NY72 2GDFA 2GSYA 4Q0VA 4XDOA 3WY6A 2G19A 1LODA 5LY2A 3R4DB 5CEHA 5AVAA 1LHOA 2XVGA 3O1SA 1WA4A 4EJRA 5T5JA 2D5HA 1UXXX 1GZWB 5LWBA 3ZXKA 3BUCA 4WZCA 3FFZA 2RM21 3AP4A 2K46A 1JYTA 1W3XA 3MI8A 1TME2 3HD8B 2OS2A 4XAEA 3KGLA 3L2HA 3UKTA 5FBJA 2VZOA 5FZMA 5BNNB 3UNPA 3OPWA 2JKXA 3D4KA 3T1MA 5LEJA 3WDVA 5CIRA 4OULA 3VDDB 1A8DA 4YLZA 3WQ0A 1SBDA 1QU0A 2D6MA 3IWZA 2Q1ZB 2D3RA 4AAXA 2MEV3 2PAEA 1W8TA 4XZUG 5C5UA 2UWBA 2OA2A 3OPTA 5C3SA 3VBOB 3AKQA 2J1RA 5GZGA 4MGTA 4LO7A 5K7PA 2D3SA 1JU4A 3IMMA 2Z69A 4LE3A 3TAYA 1LECA 1GUIA 2CNAA 3T08A 4JKKA 4YGDA 4QKDA 2PFWA 1NA1A 2VC9A 1G7YA 3LE0A 4GAZA 3LFMA 1RUD3 5T50A 5FFOC 4XJZA 3PU8A 4OYUA 3M7AA 1DFQA 3OEAA 4NPRA 3M3IA 3WDXA 3PUAA 2HWF2 5FZOB 3C7OA 4QQLA 4Q27A 4WM8B 4YVSC 2GC3A 1QOOA 2RVAA 3VDDC 3W59A 3OGGA 5JAXA 4MLOA 1V9U2 2NMNA 1O3TA 4HONA 2Z4FA 1RXGA 3BPSA 3K51A 2W1UA 1LRHA 3WG1A 2JDHA 4XQ4A 2FCVA 2P5BA 3N35A 4BLIA 1W3VA 4U2AA 5AC91 2GC1A 4BDVB 3WV6A 1Z7S1 3I7DA 4AQ2A 2WZEA 4FXGB 4AXOA 1RVF2 4RQPC 4XDPA 4MYEA 3AKPA 1QNWA 4N8MA 4AI3A 1AF9A 1NA1B 4IGOA 1DYKA 3RJRA 1DQ6A 4NUBA 5FZ6A 4WM8C 5A6YA 1K5MA 2UWAA 1ZA7A 1Y43B 1OLME 3ZIWA 2BZDA 1N1TA 1DQ5A 4HG6B 4IE0A 3M3EA 4Q4W3 3WNKA 1KJLA 2RR11 1LNSA 3I2GA 2A6VA 4AVSA 2FD8A 3VHPA 3CJIA 4LO5B 3D0JA 1FV3A 3JB4C 4QQPA 5KWRA 1ZRCA 2WKKA 3I2HA 3U0ZA 1BVP1 2RS32 4FPKA 4B8EA 2JG8A 3I59A 5HPOA 1OKOA 3DKQA 2J42A 4META 4A45A 1KFXL 3GF6A 5A6XA 2L9LA 1XRUA 4IESA 4XAAA 1W04A 2IXCA 4KQ7A 1LGNA 1C8M2 3GBWA 3WCRA 3GGLA 3NNLA 2BGCA 3KCXA 4J25A 5FLIA 4ARXA 3ZFEB 3O1OA 3WNPA 1UY2A 1GSLA 1F31A 1SFPA 1GFF2 2CL2A 2R0FA 2ZX1A 5EIYB 5J96B 1GQHA 2RS12 4RFRB 1IQAA 5ACA1 3Q8BA 2EICA 3KVAA 2VCCA 3ST7A 3KHBA 2DCZA 1N1VA 4XEZA 1UPIA 3BIWE 5EFUA 3F95A 1Q5OA 1H2KA 1R64A 2P3JA 2QQLA 4GMP0 4B3NA 4ES9A 1EV13 1HQWA 2X10A 5LASA 1JZ7A 3CJIB 1PVC3 5JR7B 3G7DA 1OVSA 5FOJB 4PLOA 1HV0A 3BTAA 5KHHA 1R081 5K9YA 1LOFA 4SBVA 1F5FA 4CP0A 4UWDA 1HB4A 4HKWA 4LOTA 3VBSA 1ENXA 2JG8B 3I59B 3KV5A 4CDWA 3KQ4B 5FO8B 5H9PA 4P5YA 4R9DA 2WLQA 3NAPC 2OZJA 2AR6A 4FT8A 1Y3TA 4N9IA 2UYBA 4PIZA 5D21A 3N4MA 1S0JA 2ZCWA 2W92A 3ZFEC 1O5UA 2TNFA 2VZ3A 2VAUA 4GMP1 4WVVA 1NG0A 4GB31 2VGDA 1POQA 1JZ2A 5DAXA 5FYHA 1RUG3 4IV3C 3RSJA 4HL0A 4V2WA 2B9VA 4FPFA 4OHWA 3VZOA 4UOJA 5FPAA 1X50A 4FQ4A 4RHV3 1W99A 3ACIA 2VZSA 3MEPA 3RDIA 3THDA 5JCTA 2XOMA 1FMD3 4HLTA 4LIVA 1NQDA 5KHGA 1RMU2 2BNOA 5APAA 1ZRDA 1XPWA 1UL9A 1EYBA 3WG2A 4Q0PA 4Z92B 4QPYA 4Y1ZA 2WLPA 1XSRA 3I2KA 5ANNA 3JQXA 3VZMA 3ZYJB 1PVXA 3U37A 4COVA 1SCSA 3DEMA 2MEV1 2CDOA 3VZNA 3LSDA 4CDWB 1FOD1 4I3GA 1JS9A 5A3NA 4LBQA 4N43A 4DB5A 3DCQA 4B4QA 2K0GA 2NMOA 1W8FA 3GDBA 4F7ZA 3FUOA 4CVUA 3PUHA 2P3IA 1UNBA 1O8PA 3BVCA 1AYN2 1UKGA 5FZDA 4NIGA 5IK5A 3KF5A 4X6QB 3ZXLA 1S0GA 2G4IA 3WP3A 1BBT3 4FBFA 1NCRC 5T5LA 5FXZA 4PI2A 1ND3C 3U78A 4RS5C 5CNAA 3MF9A 3FWEA 2DVDA 1J1TA 2C5DA 3ZXJA 5IFPA 4FI9A 1EUUA 4XHBA 1HN0A 1L7LA 1FPN3 2A73B 1RUI1 2IVJA 4CDQC 1BYHA 1OKQA 4Q1PA 4WM7C 3NNMA 3UK9A 1JYIA 2R30A 3RPQA 2GC2A 1BMV1 3ZKYA 2ZX0A 4FFGA 3H8RA 2Y6FA 3RYKA 3T30A 2WAAA 1OI6A 2W1SA 1ULEA 2TEPA 1CN1A 1DYPA 4FPGA 1YQ5A 4NWWA 2VW2A 2OVUA 3NJYA 4LBQB 4M0HA 2D6NA 4N43B 4TYSA 1K3IA 3K77A 4URTA 2O8QA 3WW2A 1S2EA 2EXIA 2QZ2A 2ZGKA 4PCRA 1QJU1 5EJ1B 4OFGA 3VBHA 4FFIA 3E5QA 5F2WA 4ARYA 4FSJA 4CUGA 4Q1RA 4D7TA 1URXA 1ULFA 2VL4A 1WW7A 3OJBA 5HV0A 3B5LB 1WWYA 1OT5A 4LA3A 3ZMNA 5I91A 1ZRFA 4Q5OA 4AVBA 1WGPA 1BEV3 2I74A 5DDJ3 3WF2A 4Q2FA 1XYOA 2XXZA 5FPZA 3X29B 2SLIA 1MZ6A 4FCAA 1S2BA 5A6ZA 4Q0UA 4ZS2A 4AK3A 5IJRA 2D7FA 5TSWA 4LE4A 4UFHA 1TQ5A 1H9PA 2VQAA 2BTVC 5GLWA 1CGPA 1CONA 2WL1A 2ZZJA 3KB5A 4P9GA 1N3OA 4KWJA 3N3HA 1TMF1 3GM8A 5F3IA 4HPKA 1V6OA 2ZEZA 3EO6A 4LHKA 4N43C 2QTWB 3VHRA 3WP4A 3KHCA 3NV3A 3QOPA 2BYVE 1W0PA 1R1A3 4NROA 5FXXA 4IE5A 3VBHB 4CU8A 2MEV2 4I02A 1GANA 4XACA 5F9TA 1FOD2 2PLV3 2XONA 3WZ1A 3H3UA 2UU8A 4TTGA 1I3HA 1HB1A 3WQBA 2AEYA 2DTYA 2PN5A 2ZHMA 2WYFA 1RUE3 4I01A 3ZO0B 2ZMLA 5A70A 2A6WA 4O9EA 4Q4V1 4EWEA 1VIWB 4YPJA 4CCDA 5FXVA 5CFDB 2A71A 3MFCA 5GLUA 4EE2A 3FBYA 2QQUA 2BGOA 2X09A 1DZTA 1O7FA 2WN3A 5LZ6A 5A3PA 1OD3A 1RUD2 1UZWA 2W87A 2VCAA 4QXCA 1KD7A 4ORFA 2E6VA 1MS9A 3JU9A 4EN9B 2QQPA 5AFEA 3HWJA 4HSLA 1PVC1 2EIEA 2IXHA 5F5QA 4XW3A 4HPKB 1VB4A 1O3RA 3AMMA 2PHFA 1OLRA 4R9AA 2X29A 1W2AX 1MVQA 1QGLA 1BJQA 5A7QA 3C7GA 5LBEA 4BOWA 1YO8A 3AP9A 3MYXA 1XNCA 5C8CA 3I49A 2E26A 3C7EA 1MZ5A 4CDUB 3U14A 4E4DX 1QJU2 5FY8A 5HXVA 5CFDC 3I54A 2RHPA 1V6LA 2DURA 3NJXA 2WT2A 4H7MA 1UOFA 3THTA 1T6GC 3RZHA 3DL3A 1GNHA 1RUJ3 3A7QA 4TLGA 1AYM3 3POIA 4RSUA 4G3YC 1UYXA 4IE4A 1HB2A 1HIXA 2W1WA 3GALA 4IE7A 3L2YA 3INAA 3PVOA 1V6JA 5BNPC 4CUBA 5IK4A 1QXJA 4XUNA 2WFF3 4AEMA 4XETA 4Q29A 3DF0A 2I45A 3WDYA 4Q4W2 5JPNB 5DMYA 3HQXA 3E6CC 3HBZA 2GMEA 1AR71 2VVFA 3A0KA 4AVVA 3AVSA 2EXHA 5J48A 1W05A 3T2QA 3GHNA 1W8NA 1UU4A 2UWCA 3M4FA 3I3QA 3MW3A 4YZ3A 3SEEA 3KS7A 4B29A 4CDUC 4BQ5A 4HSJA 5C8CB 4FFHA 1LOBA 2WSUA 4LHNA 5DAVA 2JENA 2NLRA 4DZGA 4G4FA 5JOZA 3O1UA 2FDFA 4P9YA 3THPA 3PDQA 3H1WA 4YZ5A 2B9UA 1G9FA 4NHLA 4XUPA 4YG3A 2VW1A 5F2SA 2VUDA 1VAMA 2QUOA 2ZJCA 1H8TA 3A22A 4I09A 4QU2A 3TEWA 1MEC3 5GLZA 5DZGA 1UYPA 5GZCA 5FYVA 5DAPA 3MUZ1 4IV1A 5FIXA 3S57A 3LSEA 2VXJA 5GZEA 1G9DA 1SLIA 2PAKA 2VNRA 1DQ1A 5GZFA 2FDJA 1RUC3 2G1MA 1PVC2 1RHI3 2VOWA 4KI5M 3NW4A 1RUOA 4CP2A 1QJY1 2DUOA 2DVGA 2VQUA 4RR3C 4EZ4A 5FPUA 3OSDA 4QX3A 3GYDA 1Y9QA 1WCDJ 1ZRIA 3PVNA 1PHMA 1QXRA 2FCTA 3P1IA 3APBA 1X8EA 2QNKA 1QNYA 2MNGA 4KGQA 1L3JA 2Y8KA 4IEUA 2Z5WA 4P9LA 2GN3A 2VH9A 1G9BA 4I3PA 3OGRA 3CU7A 1QQP1 2A3XA 2BRTA 4Y5Z0 1GNZA 2VTXJ 5FYZA 1WW6A 3IIIA 2VECA 4GALA 4RHV2 3ZYGA 1UMZA 4IV1B 3UT0A 2ARCA 1D4M1 2VD7A 1G9CA 1FMD2 4AI2A 4A2UA 4AWDA 2GALA 4QU1A 4KU7A 5KXDA 3N9MA 4Y20B 4ITCA 2OUJA 2VTFA 3IZOA 3VKLA 5KBFA 3LOIA 5FZ4A 3AYEA 1R1A1 1HRI3 3GCWA 3PNAA 5E16A 5C3PA 5CG9A 3HT2A 1KEXA 2BOIA 4GWMA 4IEXA 3LEGA 3TEXA 4OHYA 2PLV1 4H55A 4QQOA 2F4PA 2O1QA 4AQ6A 1BZWA 5ABJC 4PT6A 4Z1VA 3CBNA 2Q4SA 3MLKA 4CCLA 1PGW2 4O9GA 1YJKA 4IL7A 3MF6A 2HWF3 4Y1XA 5FZGA 1ENQA 1UZYA 3T0BA 4CU9A 3ZXAC 4DO0A 5A1AA 1BBT2 4EROA 2VZTA 3DYPA 2BOJA 3PMSA 3WD5A 1VBD1 3FL7A 4JX0A 4QD2A 1Y9MA 2R32A 3OF1A 4NHKA 4AFDA 1FPN2 1I5PA 1J83A 1X36A 1E5RA 1NYWA 3BGAA 3H8XA 3H0OA 3MO4A 1JMUB 1XU1A 1ZBA1 4HXCA 4YVWC 2H6CA 2NN8A 1ZBE3 1C1LA 3AJZA 2HH9A 1H8VA 2HYKA 2RDRA 4EWDA 5KC5A 3BTXA 3TEZA 1GOGA 4YGEA 4C1WA 4UAPA 1W6NA 4JAAA 1IZ3A 1UYZA 3AK0A 5FZFA 2BUKA 3SMHA 4B7EA 5AVPA 4MHUA 2YFUA 5JWPA 1QH7A 5KHJA 1GQPA 4LNVA 1OQDA 4YZ2A 4R4ZA 1NXMA 2Y6HA 2A3YA 2WIIB 3PMEA 1OH3A 3LFIA 1DGRN 3QH6A 5F7UA 3J7NA 3IDAA 3USUA 5H9RA 1IG0A 2JE7A 1RUJ1 2Y38A 2Y0OA 3JQWA 1DGLA 2RM23 4D0QA 3KLSA 1SCRA 4NR1A 4ZHNA 2P6CA 1BEV2 4YM2A 3WCSA 1GICA 3ZSEA 4BXFA 1HKDA 3AZZA 1REEA 3ZX7A 5DPNA 1WCQA 4HBNA 4M4RA 1SEFA 4UBHA 4O7XA 1D4M2 3VD4A 1AR91 1CAWA 1RIRA 4LUKA 4WVMA 4ZU4A 1YNAA 1C1FA 1NLRA 1OOPC 1RGSA 1STMA 1W6NB 1YI9A 3BCWA 3O5SA 4JQRA 5A7WA 3I3MA 4Q8LA 3WHTA 3MIDA 4D3WA 1O6UA 1ND2C 3K75B 3ACHA 1R1A2 1LEDA 5ANQA 3WF4A 2RDNA 1DQ0A 3VDCA 2ZGTA 4ASKA 4QMAA 3H3LA 3UGHA 3VBFC 4EN8B 5FYCA 1QXPA 4ET7A 1H2NA 2PLV2 2XJSA 2WA3A 3LA2A 1RL3A 3TRSB 3OD0A 1MS0A 1RUE2 5FPLA 3USUB 5FREA 2JB8A 4Y3OA 4BB3A 2IXKA 1HXS3 4Y33A 1SFYA 2A5ZA 3N9PA 3LPFA 4K6BA 3ZN6A 3FLTA 3VBRC 5JUVA 3WINE 4LBOA 2Y6KA 4XXPA 4AYUA 1OXCA 5E88A 3RWKX 1NLSA 3UKVA 5C6CA 4UW5A 4M3CF 4UYBA 4LLFA 3D8CA 5D2AA 2VVDA 5AC93 3HBKA 3VL9A 3ME2A 1CAWB 2QFEA 2WN2A 3VD7A 1OH4A 4WVMB 4CXWA 2CY6A 1Z7S3 3B69A 4OMCA 5FY1A 4GWNA 1SLTA 5A7WB 4BISA 2JICA 5C7GA 3BTYA 4HK8A 5I0TA 1XNAA 2A75A 3MV01 1EAH1 5JZGA 1LHVA 2FMYA 1YFYA 4NPLA 3KV4A 4XFGA 2WZR1 2PHRA 1D0GA 3BN6A 1YFUA 4HN1A 3VKOA 2CGOA 4Q0QA 2JXAA 4C90A 2Q8OA 1LOGA 2XVLA 1GP4A 2C26A 3RZMA 4B1LA 1W6QA 4CE8A 4M3CA 5LB6A 3AB0A 3DV8A 1LAJA 1O91A 1KDMA 3AP5A 2Y34A 3FHQA 4MGQA 2ZX3A 1PZ9A 4ASLA 1PGL1 1SACA 4AW7A 1VBE1 3ZN6B 1UYYA 2RR13 1RUJ2 2ARXA 3BIEA 4LKFA 3NWKA 1AYM2 4IUGA 1A6CA 2VXRA 3GNEA 2JD9A 3J26N 5F1RA 1J59A 4XJWA 1AL0G 4OHXA 5BPXA 1VMJA 4QDQA 4QGMA 2QQOA 1AX0A 5CKNA 1CVNA 4DUXA 3JD71 3W5MA 2WFF2 3H9AA 1OC1A 1Y7BA 2FZ1A 4XF4A 3WF3A 1UKRA 4CXYA 4QX7A 4CEYA 3H8UA 5FP3A 4SLIA 3JUUA 2SBAA 2BBAA 2AENA 1GZTA 3JZVA 4QPIA 1WCUA 3T09A 4XUQA 1C4RA 5GALA 4PF1A 4W8JA 4RL7A 1GZCA 1V70A 3IPVA 1F35A 1N1YA 3IKWA 1VRBA 3PJYA 3BOPA 1W6QB 4ZKTB 4M3CB 4AL9A 3O0WA 4S2DA 1BK1A 3I97A 4HKLA 5ACA3 5FZCA 3WDTA 4XXAA 2P37A 2W95A 1NE6A 3FBMA 2Y6JA 3LEMA 4JGZC 3VZLA 3OUHA 2BP6A 5FZAA 3N7MA 4NO4A 4AG4A 3T0AA 4TWTA 5KHIA 2CYFA 2CAUA 3FUQA 3HMYA 2V72A 4AFMA 1MEC2 2X5IA 1R083 1BVVA 4XFHA 5DABA 3KT7A 1ZBE1 1IS6A 5BNOA 1DQ4A 2LALA 3RRDA 2HWB1 2XL7A 2VZRA 5I0UA 2OX0A 2PELA 2KR2A 2ZPXA 3PJQA 2GC0A 1VPHA 4CEYB 1AX2A 3RNSA 2XWBB 3SH3A 3VZKA 1NCQA 1RUC2 1WBFA 3N9QA 1RHI2 2HKXA 1Q56A 2QBXA 3ZXGA 4I0WB 4QPIB 3D0SA 4GB33 4Q26A 4QXKA 4JV4A 5E8AA 5EXOA 5L19A 1PO11 1ZREA 1LHNA 2ZGRA 1G9AA 3IPVB 1BKZA 2HWD1 5IYYA 5FMBA 2ZS6B 3VBUB 4CPBA 1UWWA 1XNTA 4U36A 4QDRA 3WF1A 4XPVA 4TN7A 4XUTA 5JDBA 1UY4A 2B4KA 4LBMA 2E51A 3FHIB 5JI9A 1U12A 3LDRA 3ZDSA 3M8LA 4DUWA 3ON7A 1S55A 3Q8CA 1PGL2 1IGOA 5JPMB 2Q30A 4N9HA 1W03A 4D94A 4QPWA 4MGSA 5BNOB 3BTZA 1QIQA 2I07B 1RTVA 1H1MA 5LBFA 1CX1A 1FOD3 4IGQA 2RMU1 2JEMA 2BFUL 2ZMKA 3S6PA 1QHDA 1OA3A 2YU1A 5HCFA 5C3QA 1WMDA 1IS3A 4XDQA 4A4AA 5C4WB 1R091 5FZEA 4E2QA 1HRI2 5FUIA 1JBCA 4CDXA 1SPPA 2E7QA 4A7YA 3VBUC 4XURA 4LPLA 1HW5A 1SFNA 4UFJA 2D6PA 3B9CA 2ENRA 1RUI3 4AOCA 3BU7A 3VDBA 1S1AA 2ZEYA 1HXS1 5BNNC 3KCYA 5JLVA 3ZYPA 4BQ4A 2O8OA 3KVBA 4TSVA 3AP6A 3THCA 1DU3D 3MLLA 2XGXA 1FNZA 1EUTA 3PVBB 5G05L 2Q8EA 1ZZ7A 4YZ1A 4TZDA 2W91A 3VD3A 2R49A 1CZVA 1NOVA 1HQNA 3K48A 2GP3A 1UZVA 3OGJA 3VBOC 5IFTA 3K4AA 2PQSA 5C4WC 5I93A 2XL9A 1H9WA 1ZBE2 3E1F1 1QJU3 3CNAA 1YQ2A 4L11A 3VL8A 3K4DA 2BU9A 4LULA 3VV1A 3ZFFA 4COYA 1UW8A 2GH8A 2QJVA 5LA9A 5GZDA 5T54A 3POJA 4CDXB 1SPPB 1N1SA 3IM0A 3AKRA 4XF3A 1UQXA 1Z0HA 3AXDA 1ZX5A 4OI1A 5K0UA 2ILMA 4JHZA 2PYTA 1FT9A 1AJOA 3ENRA 5L9RA 2HWD2 2GZWA 2QQWA 3ES1A 3JBG1 3O1PA 1VAVA 1S0DA 2R071 1XSQA 4XMIA 5LA0A 3HJRA 2CTVA 1UX7A 4XJ8A 1YC61 3SCGA 4Q4Y1 2RM22 3MIFA 4BLJA 1LB2A 3WG3A 1XE7A 2Y6GA 2WUHA 3FZ3A 1TMF3 3MIBA 4K9SA 1ODNA 1ZA4A 3HQRA 1YLLA 3KGZA 1AVBA 3OYWA 1CX4A 1QDCA 1YIPA 4HT1T 5C70A 2ADDA 1O4TA 2P3YA 3E6BA 4CXXA 1ZRRA 3VHOA 5J1XA 2WNOA 4IEPA 4I0AA 5IVCA 1R1ZA 3ZFFB 5CKQA 1E5IA 4HVOA 2A3WA 5EJZB 1F4HA 2WS91 5FO7B 1FATA 3PU3A 1UOGA 4XBLA 5IW0A 1VMFA 2WZPP 1NA1C 1G6NA 3V0BA 3TN91 2R6QA 2R7EB 1REDA 1VE0A 1HRV1 1UIKA 2BVVA 3K3NA 2YXSA 3HN1A 1AR61 4K8RB 4OI4A 4Q4V3 2Q8CA 2KA3A 4W4ZA 1APNA 1CD3G 1REFA 1ENRA 2IXJA 4QKFA 3H1YA 5C5TA 2HEYF 3M3QA 1K5MB 2YC4A 3N9LA 1EPZA 4LIUA 4K7JA 4JKMA 3G6JB 4C8DA 4I30A 1CAVA 3ROUA 3DPRA 2DCKA 1RUH1 1JOJA 3ACGA 3KT1A 4GULA 1EP0A 1HXS2 1WMFA 2VPVA 3ZPYA 1HDKA 1BQPA 2FBEA 2OPKA 4K1YA 2XUEA 5EYXA 4P9WA 5GLVA 3VKMA 1JHNA 4BIOA 3OGSA 4HFSA 3VB9A 2AC1A 3OYWB 2X05A 4QQHA 2W39A 1CPNA 2KXLA 4R9BA 1NLQA 5IHRA 1PZ8A 5AC92 4MOAA 4INDA 1NZIA 1CR7A 2P1BA 1JZ5A 4FOYA 4OMDA 5L73A 2QCSB 4XBQA 1SLAA 1Z7S2 3I3EA 3V0BB 3AL5A 5DQ0A 4FTBA 1J3QA 4TLFA 3W58A 3RG0A 4LXLA 4NRPA 5CFCA 3VZJA 1K5MC 4JRAA 1HN1A 4L92A 1OD5A 1W8WA 2VM9A 3M2MA 4IE6A 5LK7B 4GH4A 5F5CA 4LK6A 3GHMA 5L9VA 3ATGA 1JOBA 1CAVB 3CZUA 2ZHKA 1E5HA 3DPRB 3H42B 4RGKA 1IOAA 2WT1A 3CJIC 4P9IA 1XNKA 1PNGA 4MGYE 3VKNA 3D5OA 5LK5A 1DDLA 1RC6A 2BDRA 4CRQA 4JDNA 2CWMA 2JG8C 3WP5A 2ZX2A 1OFNA 1UPSA 1W9FA 2RR12 1AR73 3VBSB 1H30A 5HCBA 2JDKA 2FDKA 1DLLA 4GKXA 4S2FA 4AEDA 5DAQA 1T2XA 2D44A 1IPSA 1F4AA 2WQ8A 4FAHA 1LU1A 1UMIA 5DZFA 2QQMA 5IVEA 1LGCA 2WNVA 3BOWA 1PMIA 5A1FA 5A6QA 2LW8A 1ST8A 1UAIA 1XYPA 1XBFA 1J3PA 2JD4A 5CFCB 2FQPA 4QX8A 1W9SA 3HQUA 3LPGA 2FDHA 1AL21 4GH4B 1HJGA 4GXLA 1PK6A 5JIAA 2GNTA 1CWPA 3LD8A 4S2HA 4N7IA 2VOXA 4AVTA 4D7SA 2V73A 3KV6A 3CZJA 1US2A 4BH9A 4CP9A 4GWJA 3BYWA 1BK0A 2A6YA 3AMPA 4XFCA 2PAMA 3BU0A 5ACA2 5FWJA 1LOFC 2B5HA 3VBSC 4JDMA 1YUDA 1RUH2 3DXTA 3FFQA 4CDWC 1LU2A 4B7KA 3I4IA 1GP6A 2JG9A 4A44A 5K8SA 1MS5A 2QKDA 3AX4A 4XFBA 3J7LA 2W9XA 5DN2A 1QJY3 1R082 2UURA 4AEDB 2CHHA 4XJAA 3U4SA 2ZZQA 5FZLA 2Q5TA 3BPZA 4DY3A 2RJKA 1LOAA 2WNVB 2V4VA 1QOTA 2HLEA 2X8KA 5J7MA 5IK8A 5I8TA 4K1ZA 1O3SA 2D40A 4L0PA 4BCUA 1XYNA 2ORXA 1D7PM 3WQ1A 3IDEA 2HEWF 4MGIE 2E7TA 2QDRA 4LA2A 4GB32 2WINB 3HR9A 4YFWA 2Q0AA 3ZOIA 1WLTA 1QQP3 5D1IA 3SH5A 4CP9B 4UF0A 2FCUA 4LBNA 3B9IA 1GP5A 1BLZA 1JTZX 2WNUA 2XHNA 3OEBA 4JTOA 4YGCA 3RS6A 3F2ZA 1D4M3 1OPOA 2ZGLA 3BALA 4HVRA 3LB9A 1YHFA 4LLOA 1OA2A 1Y9GA 4AQSA 5GKAC 3DGTA 3FLRA 4GWIA 5I8SA 3PHMA 3OPZA 1M4WA 5F5IA 1JYXA 3VN4A 3H1MA 2AGSA 1I1EA 2JECA 5EQUA 3OD4A 5F8PA 2XJTA 2DV9A 4EN0A 2J1AA 3SHRA 3P5BA 4F8AA 5L7OA 5DUXA 2Z2SB 1B35A 4GJYA 5A7PA 3EB7A 4QKBA 2OYZA 5F6LB 2WDBA 1GLHA 2RS51 4PDWA 4NRMA 1G86A 4E2GA 3O0XA 1MZFA 3EQEA 4HVQA 1OPMA 1VAKA 1VBD3 2WO3A 4LJHA 3HAGA 5FZBA 2QQKA 1JHJA 3QD6A 4CCCA 4PIYA 2ERFA 4FAGA 5FOBB 3I2OA 1RUI2 4AGVA 4FP2A 4EV0A 2Y64A 3CHXA 5FK7A 2GNMA 1LHUA 1W6PA 4Y1YA 5EJ3A 1BMV2 1ZBA3 1NQJA 4QGLA 4Y4YA 4LKDA 1SDWA 4IDZA 1O3QA 5F39A 1X9TA 1UN1A 4LORA 3VBHC 2NQYA 4LQRA 2GN7A 5HBAA 4FO9A 1H2MA 1ULCA 3OBTA 2BFUS 4GA9A 3RVHA 1MQTA 4HANA 4YRDA 5FPXA 4ZZ5A 5KR7A 1DP0A 3NMBA 1IKPA 2EIBA 2ZGPA 2H0VA 2R16A 4NIAA 2E53A 3OCPA 5LA2A 1V6IA 2VMCA 1JYCA 4HKOA 3AYDA 5EV7A 5EYYA 1B09A 1UY1A 1AZDA 4YM0A 1GKBA 1QJZA 3RMXA 4E4SA 4PDWB 2VUJA 4Y26A 5FTTC 1F8VA 2ID4A 4XE9A 3SCFA 1VB2A 3GJBA 4FPLA 5IAVA 2J1SA 2RV9A 3C3VA 1W6PB 4WVZA 2B42B 1OURA 2EXKA 5A3OA 2HWE3 3RYPA 4BQ1A 4DOUA 3VUOA 5FZ7A 5IVJA 4FTEA 4NVPA 3HT1A 1J84A 3B93A 3AYCA 3AMNA 1AR93 5IWFA 1AJKA 2PTMA 3A21A 4IQPA 3AMHA 1DF0A 1XNDA 1TMF2 1MQTB 4KMQA 2QE3A 4UFLA 4CCJA 3D3AA 1POV0 1ZZCA 4BXSV 2GAUA 4XABA 4C0HA 4N53A 4XC9A 1VJ2A 3ZYIB 4MZUA 2JDYA 3T2OA 5FYIA 3MIEA 4F83A 2D6KA 3GJAA 3JXSA 4ASMB 4PHZA 4HZFA 2YMZA 4WZFA 4UW3A 1XXNA 3WX5A 3ZDVA 1W8OA 5JOWA 1X9PA 3IAQA 2VCMA 1WUVA 4ZPIA 4COWA 4Q4V2 2BWAA 3MBWA 3GZUC 5A80A 4XFIA 4BWOA 2UY8A 2YV8A 4LHLA 3U4XA 1POV1 4FVVA 4HK9A 1YWKA 4Y5TA 1OF3A 1PIV1 3B94A 5FZKA 1NKGA 1KJRA 2E9QA 2NYYA 2VBPA 3RJ2X 4BQYA 4QX1A 3O7OA 3I8TA 1AX1A 4PBPA 5FR3A 5FYUA 2WZ8A 4AFCA 5C8CC 1MVEA 4YW4A 3Q9OA 1US3A 3J7HA 3ASIA 5CADA 1EAH3 4L8QA 2PA7A 4C0BA 4B4PA 1XE0A 2WZR3 4UFMA 5J37A 3KQRA 5I0DA 2DF7A 4M4PA 5JXHA 4MXWA 5FY9A 5T3NA 2XJPA 3GZAA 4YW7A 4QWNA 2C4XA 3PURA 4NJ4A 3U1XA 3WG4A 1JH5A 4BA6A 4M01A 2JIJA 4LBLA 5D8AA 5KC6A 4QB1A 5FWEA 1YCIA 3VHNA 1W06A 2F6BA 3AP7A 1H8TB 1P8JA 3W20A 1UOBA 1VBE3 2P3KA 2YBSA 5FY4A 4XCAA 4A6OA 1GOHA 2EVXA 3WR0A 4JGYA 3QACA 3WW1A 5EZWA 1WD4A 1HJFA 3POBA 3H7JA 1N3PA 3T4VA 1WBLA 5FUPA 5FZ0A 4Q8KA 5HV4A 1A34A 1CJDA 4OQ9A 2D93A 2BBVA 4AI1A 3JD73 1SLCA 3WDUA 5CAZA 5A33A 3NL1A 4YNIA 1AR72 1Q3EA 1JZ8A 4BJ0A 1JOPA 4KG0A 5BYNA 4IEYA 1JYVA 1S0BA 2B39A 1DZQA 2YROA 4I0BA 2WWUA 4MXWB 3PLQA 4XTMA 1DBNA 2J7MA 2WQ4A 5G04L 3E6DA 1S0CA 5FV3A 1H8TC 4LO4B 5D8AB 5KHKA 4IV1C 1RUF3 4XQDA 4JTNA 1FI2A 2YHJA 3SEPA 4JGYB 3IB3A 3MPBA 3NV1A 3UL2A 2MHFA 2IXLA 3BODA 4OUSA 1MS1A 3DN7A 3WW4A 5C3RA 2ET7A 3ACFA 5A7OA 1ZZBA 3GXUA 2YPJA 1COV1 2CGNA 2HWB3 2UY9A 3S7IA 1WA6X 2J1UA 2YPDA 4IEVA 1VBB1 5A33B 3SQOA 2AH2A 1PMHX 3ILRA 4IEOA 2CWSA 2VMDA 3RI9A 2ZHNA 1QJY2 5JSOA 3PL0A 2LUWA 5CB7A 2XVKA 5F32A 1GNYA 1PO13 5CA6A 3B3QE 5FMDA 2HWD3 4CTEA 1NAEA 3ZYBA 5DG1A 2YYOA 2DDUA 1WD3A 1PNFA 2XLGA 2VR4A 2WC2A 4PLMA 4YW6A 1SHWB 1H4HA 3PVEA 3RMYA 2B8MA 3OB8A 4M0NA 4OI2A 1DLCA 1Q8OA 4ATEA 1CZTA 5FO9B 2D3PA 2E63A 1S0FA 1C8NA 2JJ6A 2W5FA 3CQOA 5DUVA 5FZ1A 3ZN5A 3WVJA 4BQ2A 5J36A 1Z78A 3OBZA 2ZBJA 4CEWA 5KXCA 1QQP2 4UI9L 2WYSA 2HWE1 2ADEA 2BEOA 2C6SA 2B7YA 4YW3A 3VBRB 3MUY1 5CYYA 3RZKA 3GCXA 4FPOB 1Q43A 2VU9A 3U10A 1JYWA 5JOXA 5J98B 4XTPA 4P9JA 2RMU3 1OA4A 5FYYA 2NM1A 3B7MA 2UYAA 4IEZA 5EPAA 3LQCA 2ARAA 5JXJA 1FNYA 2AACA 1VRH3 1O5LA 3AVRA 3ECQA 1KQRA 3WEZA 1KGYA 1R093 3IT8A 4BMBA 1S2KA 2ZXQA 4HOOA 1WKYA 4QX5A 3H50A 4GQ7A 1MR5A 1U5ZA 4PLNA 2XBO1 2ETEA 4E27A 5C33A 2FDIA 2NP0A 3LDBA 5C71A 1SG3A 1H1AA 4F3JA 4YWAA 3ZFGA 1ZNPA 1A78A 2DU0A 4DINB 4CEWB 1K42A 1VBD2 5I0RA 4DFSA 5BUVA 2XR4A 2P2KA 2E31A 4PIXA 4AI8A 3AL6A 4COUA 1OF4A 5AFBA 2IUWA 1UU6A 3K3OA 1DQ2A 4QPGA 4XF9A 5A32A 1ZZ8A 2JDPA 1D0HA 3E5XA 1ZBA2 1QJX3 4GIQA 4LBQD 3NJZA 3LOBA 1H6YA 2XWJB 3MW2A 3S30A 4CCMA 1W28A 3UV9A 3RQ0A 1COV2 4JDOA 2DTWA 5JSRA 2QVSB 5B4NA 2EF6A 4D6QA 1BCXA 1GOFA 3J8F3 3OBRA 4QX2A 5CVRA 1LEMA 4J1XA 4OZOA 1W0OA 4Q4X1 3NNFA 4ZZ8A 1ZZ9A 4YM3A 1PO23 3B00A 1C3HA 1V6KA 4MUVA 5FPBA 4V2VA 4QHZA 1JUHA 1WW4A 5A3TA 3J7MA 3JBG3 4A7ZA 4GD4A 2R073 3ZFGB 4FQZA 5KXEA 5A3UA 5LW9A 3GBGA 4LO8A 5IK7A 4Q4Y3 2D5FA 2VOTA 3CKHA 1PX4A 3VKFC 3WP6A 4TXWA 3C7FA 4R4XA 5FYTA 2G9ZA 3NNJA 4QPGB 3RZZA 2W2IA 5A32B 4DXRA 2FDGA 2HWE2 3I2DA 3MICA 4NIIA 4MSVA 4EN7B 5FQ0A 1KRIA 1UZZA 2Y0IA 4XOGA 4EN6B 1XE8A 1TME1 3M1HA 4BE3A 1M06G 1AR92 2WS93 4WV8A 2QDNA 1U5YA 5JZGB 4AE2A 2W1QA 3IDCB 4W50A 4J6GA 3TN93 3U75A 2E7AA 3LWCA 2XKOA 2W94A 1HRV3 5EHDA 5LBBA 2OPWA 3O1MA 5JXIA 1AR63 3M70A 1OLMA 4Y5SA 1UXZA 3JCIA 3RWNA 1SMVA 4QQ2A 4XJ9A 2RG4A 1HX6A 2P6HA 4YM1A 1UD1A 4NHMA 2LTNA 4IXLA 2VTXA 3K46A 3AKTA 2R043 3IMNA 1N47A 2XBO2 2YG0A 2DFBA 2XJQA 3HN3A 2R0HA 4EYUA 3ZSMA 1RUF1 1RUH3 3ETPA 3I2IA 3O12A 5SV5A 2HWC3 2WR9A 3AZYA 1JZ6A 4DPNA 1W2OA 3DKWA 4QXHA 5FKBA 3CO2A 4D8MA 4D6RA 3WOGA 1WCKA 3ZPOA 1V6MA 4B1MA 2DBNA 2GMPA 1GR3A 3H8OA 4H14A 3MIGA 5FQ0B 2C24A 1DGWX 1OFSA 3WUDA 5JZGC 2XHKA 4R8HA 3K2OA 5FLJA 2VUCA 3ZXEA 1LOCA 4DXZA 1V9U1 4AI0A 1ZM1A 1W9TA 2YDEA 4KWLA 5IAXA 2W3JA 1ULGA 4A3XA 1A3KA 1GU3A 1PMJX 1EAH2 2Q1MA 4AVCA 1BHGA 4Z82A 4BZ4A 3EYPA 4YVSA 3POWA 2WZR2 3E5UA 1XC6A 1H0BA 1IPJA 2JKBA 3SKVA 3VDDA 5IVFA 2VMFA 1E57A 1VMHA 1FXZA 4BK4A 2I2SA 1DHKB 5FZHA 3VGIA 1QF3A 4FOWA 5E1RA 3LIHA 4HN0A 1ULOA 4XYXA 4JVAA 4L99A 4LEJA 2XG3A 5K4LA 1VBE2 2X5IB 3QH7A 1SZBA 4YYOA 2ZA9A 4P5HA 1AR83 1QEXA 4RQPA 1QOSA 1TNFA 2FHRA 4CEYC 2OZ6A 2BV4A 2DVFA 2EIGA 2MPFA 4BMEA 5J09A 1JI6A 3PTRB 1QMJA 4QPIC 1NCQB 3JD72 3OY8A 3N36A 4ZXKA 1VRH1 3AMQA 2BGPA 2V5YA 2YUEA 1NXD1 4ZONA 5FZOA 4WM8A 1F15A 2VZVA 4XFAA 4FOQA 2D6LX 2A6XA 4YVSB 4NAOA 1FX5A 2RS31 2PHUA 4D69A 3O14A 1AL23 1DZRA 1W2TA 4NN0A 1UO9A 4XUOA 3TNPB 3KF3A 2KD7A 5BNQA 1AXYA 1W9WA 1X8MA 5CG8A 1SLLA 4E8CA 4YG6A 1C8M1 2BJSA 2JDNA 3AZXA 2X5IC 1IPKA 2ZEWA 3TNQA 5FZIA 4QHBA 3U07A 4QM9A 2RE9A 2YFZA 3KCCA 2WT0A 4IW3A 5BNOC 1RUF2 4H2AA 3QCWA 5F3CA 4RQPB 1NX9A 1X82A 4FPHA 2RS11 4Z07A 5B4XA 2XUMA 1QJX1 1NCQC 2Y33A 4YW5A 3KSCA 3R6SA 2IXIA 4BM8A 4L9BA 3OGVA 5KXBA 2HWB2 1LOEA 3OY8B 3QLQA 4P00B 1RXFA 2C0ZA 5I0SA 1KFUL 2VNOA 4N7UA 1LULA 1C5HA 4AHZA 3J8F1 3SITA 4UW4A 4AQTA 1UY3A 4M3CE 1F9KA 1W8HA 1XNBA 1HLCA 4DS0A 4NIHA 3POFA 1PO21 4X6RB 1LKNA 5DXDA 1YYNA 1PO12 3FC0A 5LRRA 4A41A 5EWSA 2OIIA 3WNMA 1IG3A 2XJUA 2ZEXA 3UJQA 5BXXA 1OUXA 2XMLA 2PHLA 2OT7A 1A8MA 1JXNA 1YIFA 2GMMA 3SKJE 3NAPA 1WW5A 3Q8AA 4NHYA 5T5PA 3BI3A 2VNGA 4FPYA 2J1VA 3ZFEA 4PI0A 2IVIB 4ONUA 1ACCA 4K20A 4KH9A 5FJHA 2O0OA 3V56A 4AHWA 1RMU1 1SQ4A 1XU2A 4IV3A 4CDXC 3LDKA 1PM4A 1OSGA 5JSPA 4ISQA 2RMU2 1ULDA 3AKSA 5ISLA 2YBKA 3I2JA 1LGBA 3HIFA 4K8FA 1L7QA 4X8PA 1GWMA 1F2NA 5DAWA 1G8WA 1VRH2 1R092 3BB6A 2RS53 4MX3A 5FRAA 5A3WA 5K0UB 4CCKA 4L2NA 4NE9A 2BWCA 2CDPA 2XLAA 3CEWA 3KWVA 5F6KA 4YW2A 1IS4A 1W2NA 5FP7A 3MFAA 2R041 3DXUA 1AYN1 3ILFA 4QDSA 2BQPA 2HWC1 2JDAA 3IAPA 2ZGSA 3P6BA 2WAOA 3BKZA 2JE8A 1OQEA 2P17A 1VBA3 3KV9A 4K21A 3VLBB 2W68A 5T5OA 5T52A 3NAPB 4YG0A 1MPXA 1JU3A 5JXGA 1CJPA 4P9XA 1VALA 1BXHA 3RI8A 4EQVA 1UZ0A 4CSWA 1I9RA 5SV8A 3ZFFC 3ACLA 1NCRA 3MPPG 1ND3A 3FN9A 3R0RA 4IV3B 4RS5A 4CZSA 3B02A 5C9AA 2DVAA 3W5NA 4KU8A 2EIDA 5FLHA 2DUPA 1QJX2 1CAXA 1JODA 1ODMA 3NV2A 1WCSA 4CDQA 2K2SA 4CEWC 2P4EA 4WM7A 5K0UC 3LIGA 2DCJA 3WUCA 1JYNA 2F17A 4IGPA 4FPJA 3LA3A 2BERA 2JE9A 5A3LA 4AGRA 3J8F2 4LITA 4I2OA 2TBVA 3PIGA 3OOXA 4DEVA 4KGGA 3UESA 1NZCA 4K3UA 1PO22 5L9BA 1H6XA 4Z2AA 2PHDA 2VO5A 5LY1A 3NVCA 3JBG2 3LCPA 3I3BA 2R072 2E32A 4XJUA 2FZ2A 4QB6A 3HPNA 2IFRA 3K4ZA 2D43A 4ZY9A 1IS5A 3V65A 1D4VB 1UMHA 2GNDA 4M00A 4Q4Y2 1AR81 3OUJA 3RYRA 2CSGA 4IEWA 3GZTB 5LA1A 2DCTA 4CUCA 4H7LA 3T3YA 1QJFA 1NCRB 2LM3A 1RB8G 1ND3B 4RS5B 2J22A 3N9NA 1VBC3 4XILA 4Y4RA 1PX3A 3WLUA 4AFAA 5C9AB 4ZU7A 1ZZ6A 5F5AA 1CAXB 2IC1A 4PF5A 5BV6A 4CDQB 1QH6A 1DGRA 4WM7B 1GV9A 3POGA 3OBAA 2WS92 2WABA 1Q8SA 4UXAA 2WNEA 2F4LA 1N3QA 4YW1A 3AM2A 2GNBA 3TN92 3C2UA 1DGWA 2B45X 3DPRC 1FYUA 1HRV2 1RUNA 4A3ZA 1WZXA 3KMHA 3ZIXA 1AR62 2P34A 1LTEA 4MO3M 1TE1B 2PHXA 3ZYFA 2PMWB 4DY5A 1L7RA 2AEZA 1POV3 4E4ZA 2ZGNA 1LR5A 1UF2C 5JMOA 4OQ8A 1PIV3 2Q8DA 4CCOA 4DRVA 2EAAA 2R042 4DXSA 4YZ4A 3WNLA 1K5JA 5EP9A 2DVBA 4MG2A 1RJ7A 4LT5A 3WDWA 2HWC2 4QHOA 5FK8A 2VY0A 4XZPA 4ZS3A 5FYBA 3EBRA 2EAKA 1E5SA 2IZWA 4FPCA 5C9AC 3ZMOA 1X7NA 3ETQA 1RUD1 1IHMA 2BNMA 4BQWA 3NRUA 5M0TA 4D6SA 1CPMA 1S4CA 3AZVA 2D6OX 1AHSA 3ZM8A 2XJVA 2A6ZA 2LRPA 1RITA 2QQIA 5CFCC 3MV11 3GZEA 3VD9A 4GH4C 5FY5A 3URFA 2A1XA 4KG8A 4Y1UA 3LGRA 1PK6B 1YFXA 2YU2A 4LMFA 4CCEA 2HBUA 2W47A 3N9OA 2ZGMA 4XHXA 4AEJA 3MIHA 2XPJA 3RZGA 1WLCA 3N7JA 4LKSA 3P3PA 3POYA 3VD5A 2YZ4A 1KS5A 3ZN4A 3T0DA 2JG9B 4LOSA 5CZKA 4RGGA 3CMGA 4MHRA 4AEDC 3SH4A 3WHUA 1YRZA 1SDDB 1VR3A 4KBBA 5FP4A 4BQXA 5CFDA 4L97A 4RN5A 1UOJA 1AR82 1LCLA 2WNVC 4KBZA 4CCNA 1UCXA 3NV4A 1KXGA 2J1TA 4YFZA 3M3CA 3TEYA 4XF0A 1IKQA 3TOJA 5JOYA 3N7KA 4Q4W1 2ZOEB 4XCBA 4JC1A 2VMGA 1PK6C 5FPVA 1QDOA 1VP6A 4DQAA 2XH6A 3TWIA 2JDUA 2ZGQA 5BNPA 2JWPA 1QY4A 4Z2WA 1ZVFA 4CU7A 2CAVA 4UF0B 2ZAHA 1AL22 3Q8EA 1PGSA 2WNUB 3S0MA 3O1TA 4IETA 3MZHA 2YC0A 4W65A 5FP8A 1H2LA 2WBKA 5LRSA 2JG9C 1VBA1 2HEVF 4OZXA 4WVWA 4Y22A 3T2TA 5F3GA 1RINA 4FP3A 1W8ZA 2V09A 4CDUA 2VMIA 1GWKA 4CU6A 1COV3 3T1LA 2PXJA 4MGKE 3T4HB 4W6WA 3CL1A 1VBB3 3HOBA 3CIHA 3O0VA 4O61A 5JI7A 3UYJA 1V6NA 3LA7A 1ZYBA 2EXJA 2GP5A 5F37A 4XBNA 4ATFA 3DYOA 4IEQA 4JKLA 3JB8A 4UW6A 2OQ7A 4AHXA 5ERLA 4YGBA 5E89A 4XQWA 5L7OB 5T55A 3KT4A 2QQNA 4MXVA 4YSFA 1B35B 1SBEA 2CU5A 2D98A 2FMDA 3M3OA 5FKCA 4ZXEA 4KWKA 5JVVA 4NIDA 4FTSA 1EV11 1YI7A 1UIJA 3EHKA 3ZSLA 1HQLA 2VBDA 1OQ1A 5BNPB 4RFT0 3H7YA 1YJLA 2WNUC 3H3ZA 4MV2A 3LEIA 4BIFA 1J58A 1D2QA 1OUSA 1QJEA 2WFPA 4CYDA 5FBZA 4E2SA 5JIUA 3VDAA 4HETA 2X53S 4V1PA 2DU1A 1JZ3A 2R063 2B46X 1H4GA 1XQNA 3AZWA 4JQTA 1ULPA 2ZGUA 4Q0SA 4Y22B 3WT3A 4RR3A 4KNCA 1XOYA 1GBGA 2JIGA 3QBQA 5FYMA 1CESA 2YY1A 5FP9A 4CP1A 4CA9A 2CGPA 2OW4A 3HNYM 1RUG1 4KWUA 3EJKA 1ONAA 5HI0A 4RD7A 4RHV1 1VBC1 5CKMA 1GZ9A 2R1BA 4FOVA 5L7OC 1B35C 2VQTA 4R52A 3D82A 1FMD1 2HBTA 1OHFA
chains in the Genus database with same CATH topology
5FMOL 3SLIA 1W6MA 3R4SA 4PDWC 4EWAA 2A70A 1AXZA 2W0XA 2XBO3 3L9JT 4J1WA 3NO8A 2AYHA 4R9CA 1FAYA 3E97A 4AF9A 2IFWA 2RS52 2DWRA 1KITA 2XKPA 1RJ8A 3J4UH 4AVAA 2D97A 3KM5A 3GBFA 1PGW1 2VQ0A 2YGMA 4RR3B 5GM0A 1ASJ3 5CBLA 1JW6A 5H9SA 3J9SA 2BVBA 3SXWA 1BBT1 2XB6C 1MQTC 1VBA2 1LESA 5ABJA 4H3WA 1FPN1 2DFCA 2VVEA 4WBBA 4LTAA 2A7AA 3ZVXA 3B01A 4N53B 1W6MB 2R1DA 3CLPA 1EPWA 5L36A 5DUUA 4Q4X3 3IDBB 5DUWA 1JUIA 1O4ZA 5H9QA 1ALYA 3NKTA 4PBOA 4LO6B 4QGNA 3R05A 4OI0A 4JRLA 4Y20A 2ZKNA 1EV12 4YVWA 4IERA 1KS4A 3FLPA 2VOKA 2AREA 4OLLA 2JX9A 3POSA 2GH2A 2ZGOA 1D2SA 2CV6A 1Q8VA 2ZHLA 1DG6A 3AYAA 4DRRA 5A3MA 3MDPA 2K9ZA 1WLWA 5I8YA 1S0IA 5CU1A 1KDKA 2ES3A 5ABJB 1TME3 5IT6A 4N53C 1BEV1 4LR4A 5DDJ1 1RUG2 2DYCA 2Z42A 1GQGA 2WQZC 2G9GA 5B2GB 4Y24A 3MW4A 1VBC2 1PM7A 4LUMA 1LJ7A 4ZU5A 2AUYA 2VG9A 1FV2A 5GJ6A 2ZTNA 3KD4A 3NKGA 4YVWB 3V64A 1OLQA 3ZSKA 1UX6A 3ELNA 2XJRA 1MS8A 2YGLA 4D7YA 2ZABA 1OOPA 4N90A 2IWGB 1AXKA 1PIV2 1RUE1 1ND2A 2C9AA 1H1IA 2ATFA 2NZ9A 3VBFA 1V9U3 3PTYA 4RA0A 3LZZA 2PHTA 4XIKA 4NWVA 5FCCA 1AUYA 3ZXDA 3ZYRA 1V00A 2EA7A 2BW8A 2PHWA 5D8AC 3VBRA 4XIOA 2C1FA 4RGAA 1VLNA 3MLJA 3FMGA 4LBJA 1SBFA 1RVF3 3MGUA 2Y26A 4HMZA 4JGYC 4W6YA 4OHVA 4UBGA 2AZ5A 2R061 1Q8PA 3LKJA 1OOPB 2ZACA 3WNXA 1ND2B 4DNYA 2BNNA 2VW0A 3ZSJA 4B4RA 2KM2A 3LAGA 3VBFB 4PQ9A 1Q8QA 1AYM1 1W6OA 2NPIA 4FXKB 1J1LA 1MS3A 2DUQA 1JN2P 1GYKA 3DUIA 4XF1A 5J3UA 5DDJ2 4XFFA 1PZ7A 1OMIA 1W39A 2RS33 1CIWA 2WA4A 1U5XA 2WFF1 2TUNA 3VBRB 1O4YA 1MS4A 4W6XA 1U0AA 2Z79A 2JDZA 2QZ3A 2DCYA 3AFGA 1QWRA 2H0BA 1MACA 1C8M3 3A4UA 4MGZE 4C91A 5IUQA 3AXEA 2ZX4A 4Y1VA 4AFBA 2VMHA 4YARA 1C28A 3NSTA 1ASJ1 1NE4A 4LBKA 1C5IA 3SISA 4AGGA 1U5IA 4K40A 4AEKA 2BPA2 3WW3A 2RS13 3TB0A 1CAUA 3ZXFA 5C8WA 1ENSA 3SNMA 3WQ7A 4A7KA 1VBB2 4X8NA 3P3NA 1W6OB 1MEC1 4BYYA 4MH0E 4OHZA 4JCKA 4JGZA 2WJSA 4PJYA 1W2UA 2GU9A 1HV1A 1X33A 3UKNA 3N7LA 2VULA 3TYJA 2VOVA 1C57A 3FE5A 1RUC1 3ILNA 2W08A 4CEWC 1DIWA 4E9KA 1RHI1 5DG2A 4NOTA 1NY71 4OUMA 4P14A 3AJYA 5FAXA 3ES4A 4FPEA 2R062 2XLFA 4QT6A 2HJIA 1EY2A 3OTFA 1J3RA 1LHWA 4QM8A 1CAUB 3EXUA 1RMU3 2H6BA 1TNRA 2WSVA 3IN9A 2EALA 2OUHA 3CF6E 1CQ9A 3ALQA 1TEIA 1YXWA 5JMCA 3AFKA 1YFWA 4JGZB 3S7EA 3FX3A 1SLBA 3ZFGC 4S2GA 5GLTA 5HCAA 2ZMNA 1AYN3 2WWSA 3USSA 1HRI1 3V0AA 3UJOA 5FDBA 4C1XA 4DMIA 4QPGC 3CJXA 3R4UA 4BPZA 4Z8BA 1UU5A 3IBMA 2VUAA 5LEKA 4OVEA 1F5JA 1MZEA 4AHYA 4MVTA 2HWF1 1ASJ2 1WMEA 3VBUA 2G9FA 1GZWA 1WLDA 2N7GA 1S0EA 4COZA 5BY5A 3KZ4C 2ZKLA 5FMOS 3SCHA 4ISRA 5BNNA 1QKQA 3FJSA 4BHPA 2ARBA 2ZAAA 2ET1A 4Q4X2 1RVF1 3WXPA 2PQQA 2RJLA 3D6EA 3IIAA 1I5ZA 4KL1A 3V0AB 3TBDA 1I6XA 4GKYA 3VBOA 3U11A 4XMAA 5DZEA 5C4WA 3A0NA 4GMP3 4ES8A 2W52A 1LENA 4G9SB 1NY72 2GDFA 2GSYA 4Q0VA 3WY6A 5IK5A 1LODA 3R4DB 5AVAA 1LHOA 2XVGA 1WA4A 4EJRA 5T5JA 2D5HA 1GZWB 3ZXKA 4WZCA 3FFZA 2RM21 3AP4A 3MI8A 1TME2 3HD8B 3KGLA 3L2HA 3UKTA 5BNNB 5LEJA 3D4KA 3T1MA 3WDVA 5CIRA 4OULA 3VDDB 1A8DA 4YLZA 3WQ0A 1SBDA 1QU0A 2D6MA 3IWZA 2Q1ZB 2D3RA 2MEV3 2PAEA 2UWBA 2OA2A 3VBOB 3AKQA 5GZGA 4LO7A 5K7PA 2D3SA 2Z69A 4LE3A 3TAYA 1LECA 2CNAA 4YGDA 2PFWA 1NA1A 1G7YA 1RUD3 5T50A 5FFOC 4XJZA 3M7AA 1DFQA 4NPRA 3M3IA 3WDXA 2HWF2 4QQLA 4WM8B 4Q27A 4YVSC 2GC3A 1QOOA 3VDDC 3W59A 3OGGA 5JAXA 4MLOA 1V9U2 2NMNA 1O3TA 3K51A 1LRHA 3WG1A 4XQ4A 3N35A 4BLIA 5AC91 4U2AA 2GC1A 3WV6A 1Z7S1 3I7DA 4AQ2A 4FXGB 4AXOA 1RVF2 4RQPC 4MYEA 3AKPA 1QNWA 4AI3A 1AF9A 1NA1B 1DYKA 3RJRA 1DQ6A 4WM8C 1K5MA 2UWAA 1Y43B 3ZIWA 1N1TA 1DQ5A 3M3EA 4Q4W3 1KJLA 2RR11 2A6VA 4AVSA 3VHPA 3CJIA 4LO5B 3D0JA 1FV3A 3JB4C 4QQPA 5KWRA 1ZRCA 2WKKA 3U0ZA 1BVP1 2RS32 4FPKA 4B8EA 2JG8A 3I59A 4META 1KFXL 3GF6A 1XRUA 4IESA 2IXCA 4KQ7A 1LGNA 1C8M2 3GBWA 3WCRA 2BGCA 3KCXA 5FLIA 3ZFEB 1GSLA 1F31A 1GFF2 2CL2A 2R0FA 2ZX1A 5J96B 1GQHA 2RS12 1IQAA 5ACA1 3ST7A 2DCZA 1N1VA 4XEZA 1UPIA 3BIWE 5EFUA 1Q5OA 1H2KA 2P3JA 4B3NA 4GMP0 4ES9A 1EV13 1HQWA 3CJIB 1PVC3 5JR7B 3G7DA 5FOJB 4PLOA 1HV0A 3BTAA 5KHHA 1R081 5K9YA 1LOFA 4SBVA 1F5FA 4CP0A 3VBSA 4HKWA 1ENXA 2JG8B 3I59B 4CDWA 5FO8B 5H9PA 4R9DA 2WLQA 3NAPC 2OZJA 2AR6A 4FT8A 1Y3TA 4N9IA 2UYBA 4PIZA 1S0JA 2ZCWA 3ZFEC 1O5UA 2TNFA 4GMP1 4WVVA 1NG0A 4GB31 2VGDA 1RUG3 4IV3C 3RSJA 4HL0A 4FPFA 4OHWA 3VZOA 1X50A 4FQ4A 4RHV3 3MEPA 3RDIA 5JCTA 1FMD3 4HLTA 1NQDA 5KHGA 1RMU2 2BNOA 1ZRDA 1UL9A 1EYBA 3WG2A 4Q0PA 4Z92B 4QPYA 4Y1ZA 2WLPA 3ZYJB 3VZMA 3JQXA 1PVXA 4COVA 1SCSA 2MEV1 3VZNA 3LSDA 4CDWB 1FOD1 4I3GA 4LBQA 4N43A 4DB5A 4B4QA 2K0GA 2NMOA 4F7ZA 3FUOA 2P3IA 1AYN2 1UKGA 4X6QB 3ZXLA 1S0GA 2G4IA 3WP3A 1BBT3 4FBFA 1NCRC 5T5LA 1ND3C 4RS5C 5CNAA 3MF9A 3FWEA 2DVDA 1J1TA 2C5DA 3ZXJA 4XHBA 1FPN3 2A73B 1RUI1 4CDQC 1BYHA 1OKQA 4Q1PA 4WM7C 3UK9A 1JYIA 2R30A 3RPQA 2GC2A 1BMV1 2ZX0A 3RYKA 1OI6A 1ULEA 2TEPA 1CN1A 1DYPA 4FPGA 4NWWA 2VW2A 2OVUA 4M0HA 4LBQB 4N43B 2D6NA 4TYSA 4URTA 4YSFA 3WW2A 2O8QA 2EXIA 2QZ2A 2ZGKA 4PCRA 3VBHA 1QJU1 3LOBA 4OFGA 3E5QA 4FSJA 4Q1RA 4D7TA 1URXA 1ULFA 1WW7A 3OJBA 3B5LB 4LA3A 3ZMNA 5I91A 1ZRFA 4AVBA 1WGPA 1BEV3 2I74A 5DDJ3 4Q2FA 1XYOA 5FPZA 3X29B 2SLIA 1MZ6A 4FCAA 1S2BA 4Q0UA 4AK3A 2D7FA 5TSWA 4LE4A 1TQ5A 1H9PA 2VQAA 2BTVC 5GLWA 1CGPA 1CONA 2WL1A 2ZZJA 3KB5A 4P9GA 1N3OA 4KWJA 3N3HA 1TMF1 4HPKA 1V6OA 3EO6A 4LHKA 4N43C 3VHRA 3WP4A 3NV3A 3QOPA 2BYVE 1W0PA 1R1A3 3VBHB 2MEV2 4I02A 1GANA 5F9TA 1FOD2 2PLV3 3WZ1A 3H3UA 2UU8A 1I3HA 2ZHMA 2DTYA 2PN5A 4I01A 3ZO0B 1RUE3 2ZMLA 2A6WA 4O9EA 4Q4V1 4EWEA 1VIWB 5CFDB 2A71A 3MFCA 5GLUA 3FBYA 1DZTA 1O7FA 1RUD2 1KD7A 4ORFA 2E6VA 1MS9A 3JU9A 4EN9B 2QQPA 5AFEA 3HWJA 4HSLA 1PVC1 2IXHA 5F5QA 4XW3A 4HPKB 1VB4A 1O3RA 3AMMA 2PHFA 1OLRA 4R9AA 2X29A 1MVQA 1QGLA 1BJQA 4BOWA 1YO8A 3AP9A 3MYXA 1XNCA 5C8CA 1MZ5A 4CDUB 4E4DX 1QJU2 5HXVA 5CFDC 3I54A 2RHPA 1V6LA 2DURA 2WT2A 4H7MA 3THTA 1T6GC 3DL3A 1GNHA 1RUJ3 1AYM3 4RSUA 4G3YC 1HIXA 3GALA 3L2YA 3INAA 3PVOA 1V6JA 5BNPC 5IK4A 1QXJA 4AEMA 2WFF3 4XETA 4Q29A 3DF0A 2I45A 3WDYA 4Q4W2 5JPNB 3HQXA 3E6CC 3HBZA 2GMEA 1AR71 2VVFA 3A0KA 4AVVA 2EXHA 5J48A 3GHNA 1UU4A 2UWCA 3M4FA 4CDUC 3MW3A 4YZ3A 4B29A 3KS7A 5C8CB 4HSJA 1LOBA 2WSUA 4LHNA 2JENA 2NLRA 4DZGA 4G4FA 5JOZA 4P9YA 3THPA 3H1WA 4YZ5A 2B9UA 1G9FA 4NHLA 4YG3A 2VW1A 1VAMA 2QUOA 2ZJCA 1H8TA 4I09A 4QU2A 1MEC3 5GLZA 5DZGA 5GZCA 4IV1A 3LSEA 5GZEA 1G9DA 1SLIA 2PAKA 2VNRA 1DQ1A 5GZFA 1RUC3 1PVC2 1RHI3 2VOWA 1RUOA 3NW4A 4CP2A 1QJY1 2DUOA 2DVGA 4RR3C 3GYDA 1Y9QA 1WCDJ 3PVNA 1PHMA 1QXRA 3APBA 1X8EA 2QNKA 1QNYA 2MNGA 4KGQA 1L3JA 4IEUA 2Z5WA 4P9LA 2GN3A 2VH9A 1G9BA 4I3PA 3CU7A 1QQP1 2A3XA 4Y5Z0 1GNZA 1WW6A 2VECA 4GALA 4RHV2 3ZYGA 1UMZA 4IV1B 1D4M1 1G9CA 1FMD2 4AI2A 4A2UA 4AWDA 2GALA 5KXDA 4KU7A 4Y20B 4ITCA 2OUJA 5KBFA 3VKLA 3LOIA 3AYEA 1R1A1 1HRI3 3PNAA 5E16A 5CG9A 3HT2A 4GWMA 4IEXA 4OHYA 2PLV1 4H55A 4QQOA 2F4PA 2O1QA 4AQ6A 1BZWA 5ABJC 4Z1VA 3MLKA 2Q4SA 1PGW2 4O9GA 1YJKA 4IL7A 3MF6A 2HWF3 4Y1XA 1ENQA 1UZYA 3ZXAC 1BBT2 4EROA 3PMSA 3WD5A 1VBD1 4QD2A 2R32A 3OF1A 4NHKA 4AFDA 1FPN2 1X36A 1NYWA 3H0OA 1ZBA1 1XU1A 4YVWC 2H6CA 2NN8A 1ZBE3 1C1LA 3AJZA 1H8VA 2HYKA 4EWDA 5KC5A 4YGEA 4C1WA 1W6NA 4JAAA 1IZ3A 3SMHA 3AK0A 2BUKA 4B7EA 5AVPA 5JWPA 1QH7A 5KHJA 4LNVA 1OQDA 4YZ2A 4R4ZA 1NXMA 2A3YA 2WIIB 3PMEA 3QH6A 1DGRN 3USUA 5H9RA 2JE7A 2Y38A 1RUJ1 3JQWA 2Y0OA 1DGLA 2RM23 3KLSA 1SCRA 4NR1A 1BEV2 4YM2A 3WCSA 1GICA 3ZSEA 1HKDA 3AZZA 1REEA 3ZX7A 4HBNA 1SEFA 4UBHA 1D4M2 1AR91 1CAWA 1RIRA 4LUKA 4WVMA 4ZU4A 1YNAA 1C1FA 1NLRA 1OOPC 1RGSA 1W6NB 1YI9A 3BCWA 3O5SA 4JQRA 4Q8LA 3WHTA 3MIDA 4D3WA 1ND2C 1R1A2 1LEDA 1DQ0A 2ZGTA 4QMAA 4EN8B 3VBFC 1QXPA 1H2NA 2PLV2 2XJSA 2WA3A 3LA2A 1RL3A 3TRSB 3OD0A 1MS0A 1RUE2 3USUB 5FREA 2IXKA 1HXS3 1SFYA 2A5ZA 4K6BA 3ZN6A 3FLTA 3VBRC 3WINE 4LBOA 4XXPA 4AYUA 5E88A 1NLSA 3UKVA 5C6CA 4UW5A 4M3CF 4LLFA 3D8CA 2VVDA 5AC93 3VL9A 3ME2A 1CAWB 2QFEA 4WVMB 2CY6A 1Z7S3 3B69A 4GWNA 1SLTA 2JICA 4HK8A 5I0TA 2A75A 1EAH1 5JZGA 1LHVA 2FMYA 1YFYA 4XFGA 2WZR1 2PHRA 1D0GA 1YFUA 4HN1A 3VKOA 2CGOA 4Q0QA 2JXAA 4C90A 2Q8OA 1LOGA 2XVLA 1W6QA 4M3CA 3AB0A 3DV8A 1O91A 1KDMA 3AP5A 4ASLA 2ZX3A 1PZ9A 1PGL1 1SACA 4AW7A 1VBE1 3ZN6B 2RR13 1RUJ2 2ARXA 3NWKA 1AYM2 1A6CA 2VXRA 3GNEA 3J26N 5F1RA 1J59A 4XJWA 1AL0G 4OHXA 5BPXA 4QGMA 1AX0A 1CVNA 3JD71 2WFF2 3H9AA 1Y7BA 2FZ1A 4XF4A 1UKRA 4CEYA 3H8UA 4SLIA 3JUUA 2SBAA 2AENA 3JZVA 4QPIA 1C4RA 5GALA 4RL7A 1GZCA 1V70A 3IPVA 3IKWA 1N1YA 3PJYA 4ZKTB 3BOPA 1W6QB 4M3CB 3O0WA 4S2DA 1BK1A 4HKLA 5ACA3 3WDTA 4XXAA 2P37A 1NE6A 3FBMA 4JGZC 3VZLA 3N7MA 4NO4A 4AG4A 4TWTA 5KHIA 2CYFA 2CAUA 3FUQA 3HMYA 4AFMA 1MEC2 2X5IA 1R083 1BVVA 4XFHA 3KT7A 1ZBE1 1IS6A 5BNOA 1DQ4A 2LALA 3RRDA 2HWB1 2XL7A 5I0UA 2PELA 2ZPXA 3PJQA 2GC0A 4CEYB 1AX2A 3RNSA 2XWBB 3SH3A 3VZKA 1NCQA 1RUC2 1WBFA 1RHI2 2HKXA 1Q56A 3ZXGA 4I0WB 4QPIB 3D0SA 4GB33 4Q26A 4QXKA 4JV4A 5E8AA 5EXOA 5L19A 1PO11 1ZREA 1LHNA 2ZGRA 1G9AA 3IPVB 1BKZA 2HWD1 2ZS6B 3VBUB 4U36A 5JDBA 4XPVA 4LBMA 2E51A 3FHIB 5JI9A 1U12A 3ZDSA 3M8LA 1S55A 1PGL2 1IGOA 5JPMB 2Q30A 4N9HA 4D94A 5BNOB 2I07B 1RTVA 1H1MA 1FOD3 2RMU1 2JEMA 2BFUL 2ZMKA 3S6PA 1QHDA 1OA3A 5HCFA 1WMDA 1IS3A 4XDQA 5C4WB 1R091 4E2QA 1HRI2 1JBCA 4CDXA 2E7QA 4A7YA 3VBUC 1HW5A 1SFNA 2D6PA 3B9CA 2ENRA 1RUI3 3BU7A 1S1AA 1HXS1 5BNNC 3KCYA 5JLVA 3ZYPA 2O8OA 4TSVA 3AP6A 1DU3D 3MLLA 2XGXA 1FNZA 3PVBB 1ZZ7A 4YZ1A 4TZDA 2R49A 1NOVA 1HQNA 3K48A 3OGJA 3VBOC 5C4WC 5I93A 2XL9A 1H9WA 1ZBE2 1QJU3 3CNAA 3VL8A 4L11A 3VV1A 3ZFFA 4LULA 4COYA 1UW8A 2GH8A 2QJVA 5GZDA 5T54A 4CDXB 1N1SA 3IM0A 3AKRA 4XF3A 1Z0HA 3AXDA 1ZX5A 4OI1A 5K0UA 2ILMA 2PYTA 1FT9A 1AJOA 3ENRA 2HWD2 2GZWA 3ES1A 3JBG1 1VAVA 1S0DA 2R071 4XMIA 2CTVA 4XJ8A 3SCGA 4Q4Y1 2RM22 3MIFA 4BLJA 1LB2A 3WG3A 1XE7A 3FZ3A 1TMF3 3MIBA 4K9SA 1ZA4A 1YLLA 3KGZA 1AVBA 3OYWA 1CX4A 1QDCA 1YIPA 4HT1T 1O4TA 3E6BA 1ZRRA 3VHOA 4IEPA 4I0AA 1R1ZA 3ZFFB 4HVOA 2A3WA 5FO7B 2WS91 1FATA 4XBLA 2WZPP 1NA1C 1G6NA 3V0BA 3TN91 2R6QA 1REDA 1HRV1 1UIKA 2BVVA 2YXSA 3HN1A 1AR61 4Q4V3 4OI4A 2KA3A 1APNA 1CD3G 1REFA 1ENRA 2IXJA 3H1YA 2HEYF 3M3QA 1K5MB 1EPZA 4K7JA 3G6JB 4I30A 1CAVA 3ROUA 3DPRA 2DCKA 1RUH1 1JOJA 3KT1A 4GULA 1EP0A 1HXS2 1WMFA 2VPVA 3ZPYA 1HDKA 1BQPA 2FBEA 2OPKA 4K1YA 5EYXA 4P9WA 5GLVA 3VKMA 1JHNA 4BIOA 4HFSA 3OYWB 4QQHA 2W39A 1CPNA 2KXLA 4R9BA 1PZ8A 5AC92 4INDA 1CR7A 4FOYA 5L73A 2QCSB 4XBQA 1SLAA 1Z7S2 3V0BB 4FTBA 1J3QA 4TLFA 3W58A 3RG0A 5CFCA 3VZJA 1K5MC 4JRAA 4L92A 1OD5A 3M2MA 5LK7B 4GH4A 3GHMA 3ATGA 1CAVB 2ZHKA 3DPRB 1IOAA 2WT1A 3CJIC 4P9IA 1XNKA 1PNGA 4MGYE 3VKNA 3D5OA 5LK5A 1DDLA 1RC6A 4CRQA 4JDNA 2CWMA 2JG8C 3WP5A 2ZX2A 1OFNA 1UPSA 2RR12 1AR73 3VBSB 1H30A 5HCBA 1DLLA 4GKXA 4S2FA 4AEDA 2D44A 4FAHA 1LU1A 5DZFA 1LGCA 2WNVA 3BOWA 1PMIA 1UAIA 1XYPA 1J3PA 2JD4A 5CFCB 2FQPA 1AL21 4GH4B 4GXLA 1PK6A 5JIAA 2GNTA 4S2HA 4N7IA 2VOXA 4AVTA 4D7SA 2V73A 4BH9A 2A6YA 3AMPA 4XFCA 2PAMA 5ACA2 1LOFC 2B5HA 3VBSC 4JDMA 1YUDA 1RUH2 4CDWC 3FFQA 1LU2A 4B7KA 3I4IA 2JG9A 5K8SA 1MS5A 2QKDA 3AX4A 4XFBA 1QJY3 1R082 2UURA 4AEDB 4XJAA 2ZZQA 2Q5TA 3BPZA 4DY3A 2RJKA 1LOAA 2WNVB 1QOTA 2X8KA 5IK8A 5J7MA 1O3SA 5I8TA 4K1ZA 2D40A 4BCUA 1XYNA 3WQ1A 3IDEA 2HEWF 4MGIE 2E7TA 2QDRA 4LA2A 4GB32 2WINB 3HR9A 4YFWA 2Q0AA 1WLTA 1QQP3 5D1IA 3SH5A 4LBNA 3B9IA 2WNUA 3RS6A 1JTZX 4JTOA 4YGCA 1D4M3 1OPOA 2ZGLA 3BALA 4HVRA 3LB9A 1YHFA 4LLOA 1OA2A 4AQSA 5GKAC 3DGTA 3FLRA 5I8SA 3PHMA 3OPZA 1M4WA 3VN4A 3H1MA 2AGSA 1I1EA 2JECA 3OD4A 2XJTA 2DV9A 4EN0A 3SHRA 4F8AA 5L7OA 5DUXA 2Z2SB 1B35A 2OYZA 5F6LB 1GLHA 2RS51 4PDWA 1G86A 4E2GA 3O0XA 1MZFA 3EQEA 4HVQA 1OPMA 1VAKA 1VBD3 3HAGA 3QD6A 4PIYA 2ERFA 4FAGA 5FOBB 1RUI2 4AGVA 4FP2A 4EV0A 1LHUA 1W6PA 2GNMA 4Y1YA 5EJ3A 1BMV2 1ZBA3 1NQJA 4QGLA 4Y4YA 1SDWA 1O3QA 1UN1A 3VBHC 2NQYA 2GN7A 5HBAA 4FO9A 1H2MA 1ULCA 3OBTA 2BFUS 4GA9A 5FPXA 1MQTA 4HANA 4YRDA 1IKPA 2ZGPA 2H0VA 2R16A 2E53A 3OCPA 1V6IA 1JYCA 4HKOA 3AYDA 5EV7A 5EYYA 1B09A 1AZDA 4YM0A 1GKBA 1QJZA 3RMXA 4E4SA 4PDWB 2VUJA 4Y26A 5FTTC 1F8VA 4XE9A 3SCFA 1VB2A 4FPLA 4WVZA 3C3VA 1W6PB 2B42B 2EXKA 3RYPA 2HWE3 4BQ1A 4DOUA 3VUOA 4FTEA 4NVPA 3HT1A 3B93A 3AYCA 3AMNA 1AR93 1AJKA 2PTMA 4IQPA 3AMHA 1DF0A 1XNDA 1TMF2 1MQTB 2QE3A 1POV0 1ZZCA 2GAUA 4C0HA 4N53A 1VJ2A 3ZYIB 4MZUA 3MIEA 4F83A 2D6KA 4ASMB 4HZFA 2YMZA 4WZFA 4UW3A 1XXNA 3WX5A 5JOWA 1WUVA 4COWA 4Q4V2 2BWAA 3GZUC 4BWOA 4XFIA 2UY8A 2YV8A 4LHLA 3U4XA 1POV1 4FVVA 4HK9A 1YWKA 3B94A 1PIV1 1KJRA 2E9QA 2NYYA 3RJ2X 3O7OA 3I8TA 1AX1A 4PBPA 4AFCA 5C8CC 1MVEA 4YW4A 3Q9OA 3ASIA 5CADA 1EAH3 4L8QA 2PA7A 4C0BA 4B4PA 2WZR3 5J37A 3KQRA 2DF7A 4MXWA 5T3NA 2XJPA 3GZAA 3WG4A 1JH5A 4BA6A 4M01A 4LBLA 5D8AA 5KC6A 3VHNA 1YCIA 3AP7A 2F6BA 1H8TB 3N4MA 1VBE3 2P3KA 2EVXA 3WR0A 4JGYA 3QACA 3WW1A 5EZWA 1WD4A 3H7JA 1N3PA 4Q8KA 1WBLA 1CJDA 2D93A 2BBVA 4AI1A 3JD73 1SLCA 3WDUA 5CAZA 5A33A 3NL1A 4YNIA 1AR72 1Q3EA 4KG0A 5BYNA 4IEYA 1S0BA 2B39A 1DZQA 2YROA 4I0BA 4MXWB 3PLQA 4XTMA 1DBNA 2WQ4A 3E6DA 1S0CA 1H8TC 4LO4B 5D8AB 5KHKA 4IV1C 1RUF3 4XQDA 4JTNA 1FI2A 2YHJA 4JGYB 3MPBA 3NV1A 3UL2A 2MHFA 2IXLA 3BODA 4OUSA 1MS1A 3DN7A 3WW4A 2ET7A 1ZZBA 2YPJA 1COV1 2CGNA 2HWB3 2UY9A 3S7IA 4IEVA 1VBB1 5A33B 2AH2A 3ILRA 4IEOA 2CWSA 3RI9A 2ZHNA 1QJY2 5JSOA 2LUWA 5CB7A 2XVKA 1PO13 5CA6A 3B3QE 2HWD3 4CTEA 5DG1A 2YYOA 1WD3A 1PNFA 2XLGA 2WC2A 4PLMA 1H4HA 3PVEA 3RMYA 2B8MA 4OI2A 4M0NA 5FO9B 1Q8OA 4ATEA 2D3PA 2E63A 1S0FA 1C8NA 2JJ6A