5KC6A

Crystal structure of cbln1 (val55-gly58 deletion mutant)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
SAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cerebellin-1
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kc6A00
4GIQA 2WNUB 3B93A 4NN0A 2HEYF 2R32A 2R6QA 4J6GA 4KGQA 2HEVF 5KWRA 3ALQA 1DG6A 2KA3A 4OUSA 1JH5A 4E4DX 5TSWA 1IQAA 1A8MA 3B9IA 3URFA 2R30A 2WNUA 2E7AA 5KC5A 1RJ8A 4KG8A 4G4FA 3IT8A 2TUNA 3B94A 2QE3A 4TSVA 5HBAA 4DB5A 1XU2A 3K51A 2WNUC 2HEWF 2ZJCA 1KD7A 4F3JA 4MXWB 2Q8OA 5BNQA 1RJ7A 1C3HA 1C28A 1D2QA 2O0OA 1WCKA 3V56A 4KGGA 4G3YC 4QPYA 1O91A 4MXWA 4OUMA 3ME2A 4HT1T 2RJKA 2AZ5A 2WNVB 3QD6A 3K48A 5L19A 2WNVC 1OQDA 5CIRA 1TNFA 1PK6B 4QQHA 2JG9B 3FC0A 4MXVA 2Q1MA 1DU3D 1PK6C 4QQ2A 2JG9C 3L9JT 4OULA 2RE9A 1S55A 1OSGA 2WNVA 2TNFA 1JTZX 1XU1A 1KXGA 4QQLA 1GR3A 4MSVA 4E4SA 3TYJA 1PK6A 1TNRA 4D7YA 2JG9A 2QDNA 4N90A 3AB0A 2JG8B 1D0GA 1U5ZA 4RSUA 3WD5A 3LKJA 5KC6A 2JG8C 4TWTA 1U5XA 2X29A 2Z5WA 2OIIA 3MI8A 4DOUA 4EN0A 3TWIA 2ZPXA 1I9RA 1D4VB 1OQEA 4QQOA 4QQPA 5L36A 1ALYA 3QBQA 2JG8A 2RJLA 1U5YA
chains in the Genus database with same CATH superfamily
3DPRA 2WUHA 4Q4Y2 4KGQA 2VZPA 2PHFA 1MEC2 4AFCA 4XFIA 1VLNA 3B69A 5FPXA 1XSRA 1QH6A 2XDVA 5T3NA 4RN5A 4ZU4A 1CX1A 3V0AB 2Y6KA 3NL1A 4I01A 5A6QA 5D8AC 5C8WA 3BCWA 3CMGA 1ENRA 5EJ3A 3LOIA 5FZOA 4FFHA 4HVRA 3ZR5A 3S57A 4B8EA 5FWEA 2VMDA 3NQHA 1CAWB 1DCSA 5DDJ2 1X8MA 2JIJA 3AMMA 3WCRA 1X36A 3VD4A 3NW4A 3AC0A 1HQWA 1RJ8A 2VUAA 3OY8A 1GWLA 4GWIA 4OI1A 2FCUA 2VMCA 2XJPA 4PLMA 3AKPA 1RYYA 1FI2A 4KMQA 4HL0A 5FO9B 2QE3A 1KS5A 3U4SA 5IVCA 1YFUA 3VDCA 2RMU3 2G9GA 5F1RA 3KVAA 4ZU7A 1V9U3 2C6SA 4H2AA 1OLRA 2YU2A 1CJDA 2MEV1 4HK9A 1WMEA 2XJVA 3OG2A 1RUF3 3M7AA 2F17A 3MPPG 1QDOA 3T3YA 5FKBA 5AC91 1KD7A 4XCBA 1KDKA 1W8TA 2VXRA 4NRMA 2JB8A 3DUIA 3TRSB 5IVVA 1DDLA 3R05A 3M3IA 3VZOA 3CZUA 4HK8A 4K1YA 3W9AA 4YW5A 1C28A 4IETA 4EN6B 1Q8QA 4EN9B 2LRPA 1WCKA 5GKAC 2GMEA 1NQJA 1G9CA 1FOD3 3KGZA 3HT2A 3O5SA 2DBIA 4JKKA 2XONA 4LBQA 1OPOA 2W68A 1CONA 3WDTA 4D7TA 4AEMA 5FXXA 1JZ3A 2RVAA 2J42A 4AL9A 3ORJA 4K3UA 4PCRA 4BPZA 4N43A 2VOTA 3INAA 3WW1A 1GNYA 4UT5A 2QDRA 4LITA 3GNEA 4C91A 5I8SA 3MIHA 1EPZA 1NA1C 1UOJA 3OUJA 1W6MA 4OCTA 1MS5A 1R64A 5I0DA 1STMA 2WZR1 1E5IA 3R4UA 1OHFA 2RG4A 4COVA 1VR3A 4GWMA 1HJGA 4GAZA 4OZXA 1QEXA 2YC2A 3WDVA 4MXVA 5FV3A 5A1FA 5BNPA 2QBXA 1OURA 4PBPA 4TLFA 4DXZA 5M0TA 1W0PA 3AP6A 3E5XA 4ITCA 2VMHA 2ZBJA 2XUEA 1N3OA 1MS8A 2XLAA 3QLQA 4OULA 2OUJA 5FZ9A 1PX4A 1LHWA 3UKNA 3S6PA 5CA6A 4CCKA 4QPGB 3GXUA 4UBHA 5A80A 1B09A 3A0NA 4WV8A 3U11A 4ZHNA 4WM8C 4Y22A 2GDFA 1RB8G 2ARCA 2IXKA 4AVAA 4BXSV 1O59A 2YFZA 1UD1A 4ISQA 1D0GA 1U5ZA 2R49A 3J8F2 2D3PA 2O1QA 1DQ6A 2UU8A 3AZWA 3DL3A 2YBKA 4XFBA 4Y24A 3PUSA 1H9PA 5FMDA 4AXOA 2P2KA 4B1MA 1PGL2 2GC2A 4GZ9A 5L9BA 1PVC2 2VNOA 2ZAHA 4WZCA 4BIFA 2J1AA 3HOBA 4O65A 3ZSEA 2A3YA 4AE2A 4CEYA 1COV2 4BCUA 1D4VB 4NAOA 4BU2A 1ALYA 2P37A 2V5DA 1GYKA 2Y6LA 2XVKA 2RJLA 1OI6A 5HPOA 4QGLA 3M3OA 3NKTA 2TBVA 2GP5A 3NNGA 4IL7A 5KHHA 3KGLA 4IV3A 4QDQA 2A6YA 5AVAA 1W6NA 4PDWC 3AMHA 4J6GA 5FZHA 4CDWC 1HDKA 3SH4A 3I2KA 1AF9A 5B4NA 2FD8A 3HPNA 2X5IA 4XFAA 4EE2A 1GWMA 3M4FA 3B9IA 4Q0UA 3N9PA 2K0GA 4EN8B 2R30A 2ZHNA 1VBD2 2VOVA 5LA2A 1A78A 1DGRA 4NWWA 1AR82 1Y7BA 5A70A 1XOYA 2GAUA 4IEQA 1IS3A 1V6IA 3WVJA 2WRAA 4LIVA 1SCRA 2D6PA 4TSVA 4RQPB 1W2NA 3V0AA 3Q8CA 5K9YA 2JDUA 2EICA 1HW5A 2GU9A 3UJQA 2RR13 5FFOC 2H0BA 4A45A 1CAWA 2UY9A 3WQBA 1MEC3 4PT6A 5FZIA 4CCMA 2E33A 2YROA 1ULPA 2G9ZA 1FMD3 1ULDA 2Q8OA 1E5SA 3CL1A 2WDBA 4DY3A 4XMAA 4KWKA 5FZLA 4CUCA 5FO7B 2GNTA 3IDAA 5DDJ3 5GLTA 1C4RA 4DS0A 5DG2A 2VTFA 1H2KA 3C7HA 3D0JA 3PJQA 2LM3A 5F3GA 4Z92B 3ZFEB 3EB7A 4W4ZA 1NLRA 2NQYA 5GZCA 2LUWA 4NMIA 2UYAA 2IXLA 2WSUA 2ADDA 1O3SA 2XVLA 4QKFA 3WUDA 1LENA 3I2JA 3OBTA 2I2SA 4H55A 5JLVA 5JUVA 1REEA 3RZKA 4YM3A 5I8TA 4OI2A 5JXHA 2NM1A 4CSWA 3ES1A 2QQLA 2WC2A 2VUCA 1WLWA 3LB9A 2Y34A 3A23A 1BEV3 2Q4SA 4DRRA 4MO3M 3V65A 4M3CB 2ZGSA 3TEXA 3THPA 2BV4A 4XUOA 2RS11 3ACGA 4YPJA 3UGFA 2LS6A 2JE8A 1HJFA 3ZDVA 2P5BA 3Q8FA 1YFWA 2RE9A 3ZFGC 5LY2A 4NWVA 1W2AX 2QCSB 2VGDA 1JU4A 3BTXA 3K4ZA 2VZRA 5GLUA 1Y9GA 2ZGTA 3MZHA 1OF3A 5FZ3A 4Y5Z0 2CGPA 1ODNA 1US2A 1YEWA 3OEBA 4S2GA 3LEGA 3O14A 5GZFA 3ZPYA 3O1OA 1C8M1 4Z1VA 3AZZA 1VAMA 4DOUA 1AL22 4FQZA 2HWD2 4KBBA 4IGOA 3PL0A 2ID4A 4QPGA 5EJZB 3PMSA 1L7QA 5IYYA 4EWDA 1HB3A 5C71A 5IT6A 1EAH3 3ZYFA 2JDPA 5KXBA 1RVF1 4CUAA 1I3HA 4FPOB 3R0RA 3NNJA 3Q8AA 4TN7A 2DVBA 5FP9A 5F37A 1PGW1 3LQCA 1YIPA 4NPLA 5JZGB 4F8AA 2ZGPA 3JBG1 1JYWA 2HEYF 2R32A 2Y6HA 4I3GA 2D44A 3GJBA 4XFFA 5LBCA 2HEVF 1BMV1 1GP4A 3PUQA 2QNKA 3EBRA 3VGIA 2VZ1A 4YG3A 1GBGA 4HBNA 2RHPA 3LFMA 2B9UA 2WZ8A 3ZSJA 1S0BA 1UX6A 2AREA 4M0HA 4NOTA 4AOCA 4RGGA 1K5MC 2WJSA 3WG2A 1PVC3 1G9AA 2ES3A 1YUDA 4FPEA 3ZXKA 4YFZA 1COV3 2RM21 4KQ7A 4QGMA 1LEDA 3KVBA 4Y33A 4COYA 1SZBA 2X8KA 4JDMA 2WLQA 3AVRA 3ZFFC 1XNDA 2WFF1 3N9QA 4WM7C 3WF4A 4XZUG 3CU7A 2BGCA 4DB5A 2R042 3POJA 1O3TA 1XPWA 3AZXA 3HQUA 1H1IA 4UFIA 3WQ1A 4LULA 5LEKA 3T4VA 4DUVA 4F3JA 1OXCA 3LA2A 4HN0A 3N7KA 1VBB1 2G19A 2JDHA 4LBNA 4K1ZA 2RDRA 4RQPA 4JTNA 1J84A 1EYBA 1VBD3 2VZQA 3RRDA 3V56A 4KGGA 5IVBA 3GCXA 1VP6A 5A6YA 3AP5A 5HCHA 1AR83 1DGRN 2BYVE 2WNEA 1PZ7A 1CIWA 1YQ6A 2BWAA 3CHXA 5CYYA 4AGVA 2WFPA 3GM8A 4GB31 1UOGA 2XXZA 1DGWX 2FDKA 4QX5A 3DYOA 4URTA 4XFHA 5FP7A 1JHNA 1XNKA 1OA3A 3AYEA 2RS33 3RSJA 2PHDA 1RXFA 1V0AA 3VZMA 2VXJA 5IHRA 1HRV1 3ZFEA 4M3CE 3VL8A 2GSYA 1E5RA 3FWEA 4MLOA 4QQHA 2PHUA 4MGQA 1UU5A 2OW4A 4P9WA 4V2WA 5KR7A 3H8RA 4CDXC 4LHNA 1QF3A 1VPHA 3T30A 1W99A 2UWBA 1YRZA 5CNAA 5J37A 3FHAA 5FUIA 4IW3A 3D82A 3AZYA 4HPKB 4HN1A 1VBE1 1WLTA 3ON7A 1SQ4A 2VG9A 1ZA4A 2W39A 3QOPA 1CJPA 3J4UH 4FPYA 5JIAA 3MFCA 2D40A 4HLTA 5FTTC 4D7YA 4Q4X1 3AMQA 1RUG3 4CUBA 2Z2SB 1ZBA1 3HD8B 3LKJA 4M3CA 3WEZA 2JG8C 1QY4A 1HB4A 1PIV2 3UETA 4HANA 1JMUB 4AI0A 4BHPA 3E5QA 1IS6A 1PNGA 2JWPA 5EJ1B 3I49A 1AR71 1ZYBA 2WQ8A 3OF1A 3RZHA 1ZBE3 4S2DA 3EXUA 2BP6A 5FBZA 4QHOA 4XILA 2JECA 3H9AA 3D3AA 4GD4A 1G9BA 4NUBA 4BLIA 4XUNA 2R6QA 3ST7A 1V6OA 3HJRA 5ACA1 1W8NA 5DUXA 1KRIA 2VNGA 4OZOA 3IAPA 4E4DX 5IVJA 3RPQA 3MV01 4R9DA 1AL23 1JYVA 2BQPA 2HWD3 2P17A 4FTSA 5FOJB 4BB3A 1BBT1 5JZGA 2E7AA 3H3ZA 4Q4V1 1XC6A 5HCBA 2HWE2 3GBWA 2EIEA 3WDUA 2PHTA 1S0IA 5FPLA 3HQRA 3T0DA 1B35B 1D4M2 1H6XA 1UU4A 2P3JA 3MUY1 3VDAA 3MLKA 4AFBA 3OGSA 5BNOC 5IFPA 1TMF1 1S2KA 2YMZA 3NSTA 1TE1B 1YI7A 4YZ3A 4CRQA 4YW4A 3HNYM 3KQ4B 4IEZA 5E16A 2GNDA 5KXEA 3MW4A 5A1AA 4MXWB 2ATFA 1KJLA 4W8JA 3WINE 3DXUA 4BIOA 2VL4A 4AF9A 1IPJA 5A1LA 2VH9A 3FUQA 5LA1A 1LOGA 4GMP3 4OQ8A 1ASJ1 3WR0A 4ISRA 4AFAA 5BNNC 3PU3A 1HLCA 3ILFA 3KB5A 1W9FA 4FVVA 5FZ0A 2VZVA 3JD71 2PHLA 1HKDA 2D97A 1NLQA 2JE9A 3O0XA 3SC7X 1RMU1 3FMGA 2JD9A 4QPYA 1XNTA 1GNZA 4LOTA 3M70A 1VBC1 3A22A 3VBHB 4YRDA 4QB1A 4ZZ8A 2CGNA 2XL9A 4CTEA 1P8JA 3JCIA 2CHHA 3CJIB 3C7GA 5DZEA 2R043 1LOCA 1GOFA 4XDPA 2YUEA 2ZX1A 1OA4A 3U07A 3N7MA 4UFHA 2RS53 1OQDA 1YO8A 2DVDA 5FYIA 3I97A 4HETA 4AI8A 5AC92 1ZZ9A 2QVSB 2W52A 3M3QA 4NO4A 1QXRA 2FZ2A 2FDHA 3UGHA 1KITA 2P34A 2WQ4A 2VAUA 4XE9A 3ZSLA 1W9WA 2E7TA 1SEFA 2YPDA 4QM8A 1HRI3 4QXCA 3MLJA 1J3PA 1SMVA 1QJX1 2VVDA 2QQKA 2WT1A 1UNBA 3AYAA 2XJUA 1ZZCA 4LO5B 4CEWA 1AYN1 4ONUA 5F2SA 1PHMA 2TEPA 4B1LA 2R061 4FI9A 3UESA 1WD3A 2BJSA 4FOVA 1K5JA 2BVVA 3GDBA 5JOWA 2WZR2 1PO11 3BPSA 3WNPA 1XXNA 4HPKA 1WBLA 5IK5A 3AMPA 2VCAA 2MPFA 5E88A 4B29A 1IPSA 3H0OA 5FZ6A 3UKVA 1JYXA 3H3UA 3OBRA 4RGAA 3PVNA 1QJZA 1LB2A 1UYYA 1UMZA 4XC9A 4D7SA 4Z2WA 3EQEA 4R9BA 1KQRA 2D93A 3VBFC 1NXMA 1S0DA 3P5BA 3J9SA 4OHZA 1R1A2 2ORXA 1UPSA 1SFPA 5KHJA 5HXVA 3PUIA 5CFCC 1LRHA 2XMLA 1JZ6A 3E6CC 5T52A 5L9VA 1XB9A 3AVSA 3TEZA 4YZ5A 3LD8A 4CP9B 1PIV3 4LHLA 5CG8A 2DU1A 2XJTA 4AI1A 4BQ2A 4CU8A 1H2LA 3R6SA 1RUC2 1PX3A 5A3PA 1W05A 5GJ6A 1GMMA 2HYKA 4QDRA 1AR61 2XKPA 4Q1PA 3LAGA 1M06G 1FX5A 4FFIA 3NJYA 1WMDA 5FZEA 3IT8A 4CU6A 3OPTA 4WBBA 3LIHA 1GU3A 3WCSA 1LAJA 5FZOB 3T09A 2VE1A 2W1WA 5CFDC 5FJHA 3O1RA 3BIEA 4MGSA 5KXDA 2O14A 3Q8EA 3DYMA 3GALA 1W28A 1Q8PA 3M8LA 3POIA 4QKBA 2JDNA 3A7QA 2Y0IA 4GALA 1FPN1 1X9PA 2D3SA 3BU7A 4YVSC 1DBNA 1UW8A 1BCXA 2LROA 4YM0A 4CCNA 1W03A 5EZWA 3N7LA 1F15A 3VKLA 4MG2A 5FO8B 1YC61 1B35A 2WR9A 5JSOA 1I5PA 2HJIA 4I30A 5F3IA 4CE8A 5C7GA 1UOBA 5A7QA 4C1XA 2Z42A 3S5QA 4IEXA 1XE8A 2ZKNA 2CTVA 1O91A 3I59B 1CAUB 4MXWA 4OUMA 1D4M3 1BYHA 3D0SA 3HIFA 3KV6A 4J1WA 1K3IA 1H8TB 5FKCA 3EHKA 3IIAA 5FY0A 2R0FA 1WLCA 1CZTA 4I0AA 4MX3A 4UBGA 4AQ2A 1DGLA 1O8PA 2X53S 3K48A 4Q8KA 3VKMA 1RHI1 4RHV1 4YFWA 3TN91 2ET1A 2VMFA 1R083 4UXAA 2B9VA 4CP0A 1UQXA 3HEIA 2C24A 1APNA 2J1TA 3NAPB 1QOTA 5FZ1A 4YGDA 3ZXDA 4JAAA 4IESA 5FOBB 3ZN5A 5C9AC 2WO1A 5F5CA 5JDBA 1VMHA 3CJIA 4D69A 1ST8A 5DQ0A 2QQPA 4AEDC 2PA7A 2PQSA 2DFCA 3M3CA 1ULEA 4DNYA 3ZM8A 4MHRA 3BI3A 4NIIA 5DAPA 3MPBA 4MSVA 2BWCA 1Z7S1 2WZPP 4XJAA 2JDAA 1WW5A 1O5UA 4BA6A 4E2GA 1WA4A 2QDNA 1R091 5IVEA 3WW4A 4BQXA 1DZTA 1C57A 2OA2A 1H2NA 2IXHA 1JZ2A 3PURA 2JD4A 4LBMA 5AVPA 1GKBA 1FT9A 1UY3A 5AC93 1VBA1 5A7OA 3K3OA 4GA9A 4YVWB 3P3NA 1W9TA 2ERFA 2WA4A 1MS3A 4W6XA 2K9ZA 4Q0QA 2JXAA 1S4CA 3ZFFB 3FBYA 1DYPA 4WM7B 1UF2C 1V6NA 4JGZB 2D6KA 2RS12 4E27A 1CIYA 1F2NA 4OHXA 4AI2A 2HWC1 4GH4B 4BK4A 3LIGA 2F6BA 3VDBA 1WMFA 5EYYA 3VD5A 1QQP2 1ZZ8A 4RR3B 1POV0 5KWRA 1RUE2 2BOJA 4S2HA 4IERA 3R4SA 4QX1A 4XQDA 2KA3A 4LHKA 5JMCA 1HN1A 4IE0A 1U12A 5FXZA 1POV1 2EXIA 2RDSA 4FPCA 2WZR3 5DXDA 2PHWA 1C8M2 3WY6A 2PMWB 2A75A 4XUTA 4Y4RA 3VBSB 1VRH2 1JU3A 3LPFA 1QJFA 3RGBA 3PVOA 1JXNA 2ETEA 3VZNA 2YGMA 3LDKA 2Z69A 2DF7A 1GOGA 3LGRA 1RVF2 1W6QB 1CX4A 3QACA 2R16A 4UOJA 4P9XA 1JBCA 1PGW2 2VCMA 2G1MA 4CP9A 1O4ZA 1R1A3 4X6QB 5LY1A 1Q8VA 2ZGKA 4WVMB 5A3NA 1RUNA 3V0BB 4HKLA 3KMHA 3TBDA 1BMV2 2GNMA 3I2OA 2O8QA 3MBWA 4IV1C 4CDQB 3W5NA 1LESA 4MGZE 3JXSA 1C3HA 4BH9A 5FZDA 2Q0AA 4FXKB 4N9HA 1X82A 3OPZA 4BXFA 5FMBA 4NIAA 5FYTA 4KL1A 5JAXA 1RUC3 4DINB 4AVSA 1NCQC 3BB6A 5I91A 2BBVA 2WS93 1Q43A 2BEOA 4LXLA 3MW3A 3THDA 4ZXEA 5FMOS 5KHKA 4JC1A 1UY1A 4YNIA 2WFF2 2F4PA 3T1LA 4I0BA 3RG0A 3I7DA 3KCYA 4OUEA 4OFGA 4XYXA 4TXWA 3WQ7A 2LALA 3FBMA 3RDIA 1H30A 3NO8A 5DAQA 4FPKA 5JXJA 4WVZA 2JE7A 3WV6A 4JHZA 2EIGA 2VQ0A 4FPLA 2ZMKA 1HXS1 4EWEA 5LBEA 3I2FA 3MFAA 4QXBA 1QJU1 1RINA 3I59A 1CAUA 4YYOA 2VECA 3E97A 5E8AA 3PHMA 1H8TA 2D43A 1LOFC 1HB2A 2GH2A 3F95A 1DYOA 3OB8A 4FPFA 2C4XA 2OUHA 3VBOB 5A3OA 2EAAA 2CU5A 3EJKA 2FMYA 2QZ2A 4I09A 5FUNA 3ELNA 4D0QA 5CG9A 4ZU5A 2VNRA 1GZTA 4V2VA 1YIFA 2NMOA 5C3PA 1XYPA 4COZA 4ATFA 3NAPA 3THCA 1REDA 1TNRA 1UIJA 1XJAA 1NCRC 2VMGA 3WF3A 4A6SA 1LOEA 5IK7A 5IFTA 4JZRA 4KWLA 1D0HA 3PUHA 1FAYA 3ZKYA 2JDZA 1W2TA 2OIIA 1HRV2 1RUI3 1YCIA 3VDDB 1RUD3 5L7OC 4GQ7A 3MIDA 3PLQA 2I74A 2ZPXA 1SLCA 3RJ2X 1LHNA 2W94A 4LK6A 2B45X 4XJZA 2E26A 2GMMA 2QQIA 2ZGOA 4UI9L 4M0NA 4LNVA 1C5HA 2OZJA 4EYUA 5FPAA 3O0VA 3LA3A 3L2YA 3LSEA 5DZGA 4CP2A 4K20A 1VBE2 4YVWA 5FZFA 3RI9A 3H8XA 5F32A 5A32B 1D2SA 3MUZ1 3VBFA 1MVQA 3OTFA 4Q4X2 3ZFFA 3JU9A 2HLEA 4WM7A 3RI8A 1UIKA 5E1RA 2XWJB 3BGAA 4CDUB 4J1XA 4CCEA 5FY9A 1JZ7A 3WG3A 4XDQA 1PZ9A 4JGZA 4JVAA 1EV11 3WHTA 1N1SA 1DF0A 4GH4A 3OGRA 3U0ZA 1FXZA 1V6MA 2A7AA 3AM2A 4RSUA 1G86A 4RR3A 4BWOA 4DPNA 3KF3A 1IHMA 2ADEA 4G4FA 1QU0A 2OQ6A 4DIQA 3OBZA 1IS4A 1KEXA 1I5ZA 4INDA 4AQ6A 3POGA 2D6NA 2HWB2 1QQP3 1WBFA 4FBFA 3AKSA 4MGKE 1CAVB 5DUUA 4AHWA 5A6XA 3K51A 3MDPA 4Q1RA 1RUE3 1OOPC 2CYFA 3VBSA 4DFSA 3TEYA 5GALA 3ENRA 5DPNA 2DDUA 4K21A 5BNQA 5ANQA 1ND3B 2NPIA 4OHYA 3RZLA 1W6QA 2HH9A 3A0KA 4QAWA 1S0GA 2CV6A 5LBFA 2J7MA 1VRH3 4RS5C 2J1VA 1QJY2 2AH2A 4OQ9A 4WVMA 3N9OA 3N9LA 4Q4V2 1CGPA 1H2MA 2RMU1 4CYDA 3V0BA 4CVUA 1V9U1 1LULA 4P9LA 2WZEA 5J3UA 1YHFA 1CPMA 4CDQA 4SLIA 1RUF1 4JQRA 2X05A 5I8YA 2VU9A 1AJOA 3B3QE 5A7NA 2W08A 4Q4Y3 3NV4A 2CWMA 3A21A 3WT3A 1W2UA 1JUIA 2YBSA 3G6JB 1TQ5A 1IS5A 3O0WA 2HBTA 2Q8DA 4QHBA 4GJZA 2BPA2 1L3JA 4CPBD 2WNVC 2WAAA 1XE0A 4AQSA 3RNSA 3BALA 4LKSA 1JHJA 2Q1ZB 4RYDA 1FOD1 2FCTA 4NR1A 2JG9B 3IZOA 1W6PB 1OUXA 2JJ6A 1ASJ2 1O5LA 1PK6C 1S1AA 2XBO1 1MACA 4WZFA 3I3DA 1AYM2 2FZ1A 1AX2A 4ZS3A 3JD72 4EV0A 3N4MA 3F2ZA 2K2SA 4N7UA 1JW6A 5C3SA 2XL7A 1GOHA 3ZYHA 5FWJA 5JIUA 4QQLA 5FREA 5FYVA 1UO9A 1QMJA 5JCTA 3ZO0B 1NX9A 2D6OX 1F31A 5FZCA 1OF4A 1S0JA 5A3UA 2EF6A 3ZSMA 5LWBA 2E7QA 1N47A 3VBOA 3N7JA 2EIBA 4LMFA 1VAVA 4XACA 2XPJA 1YFXA 4QPIC 1A3KA 4DZGA 5FYSA 4PIXA 3DPRC 4X8PA 5A7WA 3FZ3A 2VQUA 5LW9A 1JOPA 2CSGA 3RMXA 1REFA 3U4XA 2DCJA 5J09A 4QHZA 4BMEA 3VB9A 2Q8CA 1ACCA 2GN7A 4UFKA 2K46A 4PIYA 3RWNA 2WT2A 4ET7A 5C4WC 5JOXA 3CQOA 2H6CA 4P02B 2KR2A 4ZONA 1UYPA 4FAGA 2GC1A 4A7KA 4YVSB 1YI9A 3VDDA 4XEZA 5E6HA 3WW3A 3WP4A 2AYHA 3MGUA 4XQ4A 2DCKA 1H8VA 4FPJA 3SH5A 2UWAA 2ZS6B 3OBAA 1WCUA 2VVFA 1XBFA 1HRV3 3ZX7A 4IEUA 2Y64A 3WG4A 4Q27A 1PMHX 4FTBA 1UWWA 2PLV2 2C9AA 5LATA 4E8CA 2ZMLA 5A32A 3NWKA 1V70A 4KG8A 1CZSA 2HWF2 1F5FA 5HXMA 3PMEA 1TG7A 3KQRA 4B7EA 4AHYA 1WUVA 2Y6FA 1MR5A 5FPZA 1PO22 4CDUA 2QJVA 3WG1A 3VD9A 1UYXA 2XR4A 4O9GA 5HI0A 3VHRA 3ZVXA 1N1TA 4TLGA 2VMIA 4Q4X3 1JZ5A 1VRBA 1UZVA 3J8F3 2VW0A 2YYOA 4E9KA 2OXBA 3HMYA 1SLIA 4DMIA 4N43C 2UY8A 2W91A 1A34A 2BVBA 5FPUA 3GGLA 3C7FA 1AX0A 3M3EA 4PI2A 4Y1UA 3UGGA 4XOGA 5F7UA 3JB8A 2B5HA 4XF1A 4PJYA 4YW7A 1CAVA 1JI6A 3IIIA 5CKQA 1UY0A 2WYSA 3PU8A 2LTNA 3GBGA 3OOXA 4MHUA 2VC9A 1J1LA 3QCWA 5ABJB 2RR11 2ZOEB 3SEPA 1VAKA 2ZHLA 4MGTA 1MEC1 1C1LA 2V09A 2HWB3 1ND3A 3OUHA 5LEJA 4CPBA 4FPHA 1FMD1 2AZ5A 1RITA 4K8FA 4HVQA 5BNPC 4A6OA 4AVTA 1OUSA 1QDCA 1ZX5A 1QIQA 3CKHA 4UW6A 3U1XA 2OKXA 4DXTA 3DECA 2UURA 4R52A 3AXDA 5DDJ1 3H8UA 5JPMB 4JDNA 5DZFA 5FZ8A 1SLLA 3GZUC 2PN5A 5GLZA 4HXCA 1WMXA 1HQNA 4C1WA 1UMHA 3AZVA 3Q9OA 3WNOA 1IG0A 2H0VA 1DHKB 1QJY3 3UKTA 3OD4A 4E4ZA 4Q4V3 2Y6GA 4XZPA 1D7PM 1LR5A 4NHLA 5SV5A 4FOWA 5CVRA 1JTZX 3D5OA 1SPPB 3RYPA 3VBRB 1J58A 4FAHA 1S0FA 1KXGA 4C8DA 5C3OA 1UMIA 2VBPA 4JGYC 2WWUA 3HN3A 5F5AA 4ZS2A 2JG9A 4CEYC 1OD5A 1W6PA 3S7EA 2V72A 1XNBA 3IDEA 2RV9A 3LEIA 3WD5A 4PF5A 5A3MA 1BEV1 3WDWA 4QU1A 4XBLA 4QX2A 1RHI2 1F4HA 4RHV2 2VULA 3BYWA 3NV3A 3AKQA 3TN92 4YW3A 3WLUA 1YQ8A 2Q1FA 4XPVA 4AK3A 4E8DA 5LK7B 3CF6E 1BQPA 5CFCA 3O7OA 3TWIA 4CEWB 4IV3C 4JRAA 3WZ1A 1RXGA 2QZ3A 1ASJ3 1IGOA 3TNPB 4YSFA 5BUVA 3HVDA 1AYM3 4CP1A 4I2OA 2B42B 4DXRA 2CDOA 5F5QA 2GNBA 1ZNPA 1BJQA 3T0AA 2W1QA 2WBKA 4YLZA 3VKOA 1Z7S2 4IV1B 1W90A 2A71A 4YW6A 3WXPA 4AG4A 5D8AB 1OC1A 4P9YA 1DG6A 5F5IA 3SNMA 5JMOA 1XYOA 1JH5A 5SV8A 2N7GA 3M2MA 1UKGA 1VB4A 4KU7A 1UN1A 1DIWA 2Q5TA 1VBA2 4XJUA 5CU1A 5A6ZA 1GUIA 1J83A 1EAH1 4H7LA 4LKFA 3RS6A 4GWJA 3S0MA 4RFT0 1FATA 4XABA 2PXJA 4YVSA 1T6GC 4Y1ZA 3FLPA 5K0UB 3DEMA 3WNLA 4EJRA 2CL2A 2GN3A 3P1IA 1LGCA 3OUIA 1AL0G 4NRQA 5FP4A 1GZWB 1SBDA 4QGNA 4C90A 2HWC2 2GP3A 3POYA 3W21A 3Q8BA 3D8CA 2BFUS 5CB7A 1DZQA 1OH4A 4JHTA 3JB4C 5EWSA 4NIHA 3NRUA 1YNAA 1OVPA 1UOFA 4YGCA 4NIDA 3WF1A 5CEHA 2A3WA 1PVC1 1S0CA 3O1SA 5IWFA 1MZEA 4H7MA 3GZAA 1D2QA 4BQ1A 5A3TA 2D6MA 3I3QA 1VJ2A 2PLV3 2B7YA 3LOBA 4JCKA 2EALA 2HWF3 2LW8A 2XHKA 3SLIA 2VTXJ 3RWKX 3VBUC 1PO23 3POWA 1NA1B 3ME2A 1G9DA 1G8WA 5T5JA 1YWKA 1C1FA 4AEDA 4AEKA 2VOWA 5FY4A 5JI7A 3QD6A 5FUPA 3ZR6A 2VBBA 1CR7A 5L7OB 2AACA 5FK7A 1KGYA 1O7FA 4QDSA 5LA9A 1GNHA 3SMHA 4YM2A 1VBD1 4B4QA 4DO0A 4TZDA 2PYTA 5APAA 3CIHA 2G9FA 1EUUA 3DKQA 1AR81 4D3WA 2A6VA 3T2TA 5ABJA 4NVPA 2XVGA 3AYCA 1EY2A 1W39A 2ZGRA 4IE6A 4QQ2A 1LHUA 3MO4A 5K8SA 5HV0A 2ZGMA 4BQYA 2UWCA 2WA3A 3QH6A 4AI9A 1LCLA 4WM8B 5C3RA 5CKNA 2A3XA 2RS31 1GR3A 2ZEYA 3MIFA 4LE3A 4E4SA 4QPGC 3SEEA 4BQ5A 2R7EB 3ETQA 4W50A 5A33B 1VMFA 4AEJA 1AR91 2MNGA 1KFUL 2MEV2 4BYYA 1ND2C 1UU6A 3ZYJB 2XQRA 1U5XA 1FYUA 3KZ4C 2Z5WA 5C70A 3V64A 3AP9A 3MW2A 3VBRA 1SLTA 1SPPA 2WO3A 4CCDA 1UZ0A 2PHXA 4HSJA 1QJU2 3THTA 1XQNA 1G9FA 4LA3A 4MZUA 4PLNA 4XW3A 5EHDA 2OQ7A 3KT1A 3POFA 4Q26A 4YGBA 4I3PA 2FMDA 3K4AA 3NKGA 3QBQA 1BXHA 1SACA 1UZWA 3LEKA 4UW4A 1XYNA 2GC0A 2E51A 3BTAA 3GBFA 4PDWB 4XDOA 4CDWB 3ACIA 4LUMA 3FE5A 3KS7A 1UX7A 1RUG1 2C0ZA 2CAVA 1VIWB 2PTMA 3HWJA 5IK4A 4NHKA 5CADA 5J1XA 1Y3TA 2PHRA 1YJLA 3UV9A 4URAA 1AZDA 2YZ4A 2ET7A 4F7ZA 2CDPA 4GKXA 1RHI3 4HSLA 4RHV3 3HQXA 3TN93 1IQAA 4NPMA 3RVHA 3PUAA 2KD7A 1OQ1A 3UT0A 1ZBE1 4R9CA 4XFCA 4AFDA 1OLQA 5EP9A 1KFXL 1UAIA 1OKQA 2DTWA 4IV1A 3WSOA 1Q56A 2RJ2A 2XQXA 2P3IA 3I8TA 2TUNA 5D8AA 3SITA 1MS4A 1XNCA 1TME1 2J1RA 4CA9A 2A70A 4E2QA 5FR3A 3SCGA 2OX0A 4QXHA 1DZRA 4BDVB 1EUTA 3I2IA 1EPWA 5IVYA 4RQPC 5K0UC 4Q29A 5HCFA 4B7KA 5F39A 4V1PA 1JZ8A 2WNUC 3VKNA 1BK1A 1IG3A 1AL21 2HWD1 4YZ2A 4CCCA 4KBZA 5K0UA 4OYUA 3VKFC 1RJ7A 4D6RA 1ENSA 1WW7A 3IBMA 1GZWA 1EV12 2W46A 3AKTA 4K8RB 3AKRA 3T2QA 5CISA 1HQLA 2QKDA 4AAXA 5E89A 1NZIA 3MICA 3UNPA 1UL9A 2R071 4UFMA 5IW0A 2ZEZA 2DYCA 1BK0A 4LHSA 4AW7A 5I93A 3H1WA 1CVNA 2V4VA 2XB6C 1MQTC 3D6EA 2ZEXA 4XQWA 2VD7A 3EMRA 1XSQA 2ZGLA 4DQAA 3FHQA 5I0RA 1KJRA 2VZUA 2ZACA 1W9YA 4QPIB 2VOXA 4XF4A 4M4PA 4IEPA 5A3WA 1MPXA 5C5UA 1DGWA 3DGTA 2J1EA 4Z07A 5EPAA 3M1HA 5T5LA 4M4RA 3O12A 4OLLA 4XUQA 5B4XA 2VCBA 4Y4YA 5IVFA 4LEJA 2P6HA 4AR2A 1UY4A 2ENRA 2Q1MA 1NA1A 1NXD1 3EYPA 2XLFA 5FY5A 3ZFGB 4BK5A 4H14A 3K77A 5IATA 4LO7A 3ZXEA 3RZJA 1W3XA 4AAPA 2HWE3 4Z82A 3MF9A 5H9QA 5FYHA 1JYTA 2RMU2 1DLLA 3GJAA 5L7OA 3PVEA 3JQWA 1V9U2 2R041 1RUOA 3PNAA 4HMZA 1N3PA 3JUUA 1RUF2 1ZRRA 2RDNA 5BXXA 4N90A 3O1MA 3AB0A 1CWPA 2RS51 2IXJA 2EXKA 4A41A 4XFGA 1UZYA 4R4XA 5FY1A 3AJZA 1W0OA 3SKJE 3JQXA 3MI8A 1QNYA 4EN0A 4WM8A 1FOD2 1UZZA 1HRI1 4Y3OA 2DBNA 3U14A 2AC1A 4AGGA 4B4PA 2A6ZA 2FDFA 3ZMNA 5A33A 2WKKA 2XBO2 2E9QA 2W87A 1SG3A 5LB6A 4OMDA 3VD7A 3ETPA 2UYBA 2XGXA 2R1BA 4QX8A 4MOAA 1LTEA 4QU2A 1JOBA 4N53C 4COUA 2JDMA 3GHNA 5JPNB 1UYZA 3LDBA 5GLWA 1MZ5A 4PLOA 3HBKA 4FFFA 5FZMA 2WYFA 2JICA 5JZGC 1PMIA 5C33A 1H4GA 4UW5A 4UWDA 5F9TA 3AYDA 3WNKA 1AXKA 3ITQA 2MEV3 2FQPA 1ZA7A 1H1MA 4LLFA 4OUSA 4LPLA 1K5MB 2DVAA 2PQQA 2RDQA 3N35A 4QT6A 4W6YA 3WW2A 4K6BA 5TSWA 4RGKA 4FXGB 1G6NA 1T6BX 4Q4W1 3FLTA 4PDWA 4R4ZA 1O8SA 2DWRA 4HONA 4CDWA 5FMCA 1QJU3 4CCOA 1JODA 1QJEA 3PDQA 4LOSA 5F3EA 2YXSA 4Y5TA 2CY6A 5J36A 3H3LA 1UPIA 4QM9A 1OFSA 1SDDB 2WO7A 1GSLA 3WP5A 4MYEA 2YHJA 3HNBM 4RS5A 4OI0A 4FOYA 5I0SA 2ZX0A 5HCAA 4DEVA 3E6BA 2HEWF 2OZ6A 3GHMA 2YGLA 4GXLA 1PIV1 3ACFA 1WA6X 2B8MA 1UCXA 4Q5OA 1ZRIA 3DXTA 4HFSA 3T2OA 4K9SA 4OHWA 1E5HA 5CBLA 4KG0A 3SXWA 2E63A 2BDRA 1CD3G 4G3YC 1TVGA 1AX1A 4JDOA 3ZYRA 2O8OA 4JGYB 1ULCA 3NJXA 4P00B 1W6OB 2BW8A 2HBUA 1MZ6A 2JKBA 2XJSA 2OT7A 3AL6A 1AXYA 4P9GA 4DUXA 1C5IA 1FNZA 2J1UA 5FZ4A 3ABZA 3VZKA 4QB2A 3ZYIB 2WINB 3JBG2 2FCVA 2VQAA 2BFUL 1NKGA 1H9WA 2OVUA 1W8OA 4Q0PA 4B4RA 2YFUA 1NLSA 5CIRA 4CXYA 3O1PA 2AUYA 3HT1A 1RUJ1 3N3HA 4JV4A 5JSPA 4CDXB 5DUVA 4CU9A 1WGPA 2D7FA 2ORZA 1QWRA 2WIIB 1OD3A 2EXHA 1F8VA 1EV13 3ACLA 3IDCB 1F4AA 2D98A 4S2FA 5JXIA 3FUOA 3NVCA 1LECA 4QPIA 2RM22 2XUMA 3ZXJA 4BISA 4BJ0A 3OYWB 3KF5A 4M01A 3PIGA 3VHNA 3WOGA 4YG0A 4YWAA 2QQNA 4EWAA 3J7MA 3TAYA 5JI9A 2RR12 1JN2P 1HIXA 1LOBA 3GZEA 1N1VA 3B5LB 4KI5M 4LORA 4ASLA 1R081 2JG8B 1FMD2 4GJYA 4RL7A 3WHUA 1O3RA 2VOKA 3ZFGA 2J1SA 3NMBA 1CESA 4JKMA 5C4WA 5KC6A 2ZX3A 3NJZA 3T0BA 2P3KA 4ARXA 3K3NA 2X09A 2W92A 3FL7A 5BY5A 1VBB2 1DQ1A 1AHSA 1Q8OA 3BPZA 1JUHA 3CNAA 1AVBA 1OPMA 2CGOA 2E53A 1AXZA 2VZ3A 4N7IA 1Z0HA 5ISLA 5L73A 3ZLIA 4LT5A 4UFJA 1UY2A 3IB3A 1DFQA 3DN7A 2IFWA 2JEMA 3N36A 4GIQA 4XAEA 3J7NA 5FZBA 5A7WB 1F35A 3SQOA 5GZGA 4LBJA 5K7PA 4AVCA 5FZ7A 1RUH1 4GB32 4JRLA 4Y1VA 3B00A 3CEWA 4YZ4A 2AENA 1X8EA 2CAUA 2IUWA 4A3XA 4Y20B 1POQA 2BGOA 2I07B 5L9RA 2DUQA 4BMBA 1BEV2 2ZGQA 3KLSA 3APBA 1A8MA 2YU1A 3A4UA 1HX6A 5GM0A 2ZHMA 3CZJA 4O9EA 5FLIA 5D2AA 4QKNA 3VHPA 3ZSKA 4BQ4A 1U5IA 1WCQA 2Q30A 2Y0OA 3VBUB 4LO4B 1NY71 4P08A 2VTXA 4LBLA 4NPRA 3W59A 5BNOB 2XBO3 1NE6A 4LIUA 2IZWA 1K5MA 2FDJA 3E1F1 5HBAA 2A1XA 5H9SA 1QKQA 1B35C 2GC3A 5FZAA 1CPNA 4COWA 4CZSA 3J7LA 3MHZA 4ARYA 3J26N 1GWKA 2E32A 2XHNA 3ZXGA 2VZSA 4FT8A 5BNNB 1ZBA2 4CXXA 5FY7A 3MLLA 1LU1A 2ZGUA 2P3YA 3EO6A 4IGQA 1ZREA 1PGSA 1EAH2 4LK7A 1XRUA 3FFZA 4J25A 4WVVA 5BV6A 4F83A 3POBA 3BTZA 5A7SA 1WW6A 4A2UA 4ASMB 5EV7A 4AWDA 1AR72 2RS13 1R1A1 1VE0A 2I45A 1J3RA 2D5HA 5KHGA 3AK0A 2XOMA 2W0XA 1ND2B 3VBHC 2HYXA 1K12A 1O4YA 4PI0A 3D4KA 5G05L 3USUB 2JDKA 2IXIA 2VCCA 3CJIC 4LO8A 4NHYA 1ONAA 5C8CC 2DVFA 1WCDJ 3N9MA 4XHBA 5FYMA 1SBEA 5ACA2 1RGSA 3VV1A 2BERA 1W8HA 2VMEA 1RUC1 2ZABA 2PELA 4JGYA 4ZZ5A 1W6OA 3BKZA 1ZRDA 1Y9MA 2WS91 3FC0A 4FFGA 4LJHA 1C8M3 2FHRA 5DABA 1LHOA 2BNNA 3DF0A 4R8HA 4H3WA 1NZCA 3CO2A 2Y60A 2VW1A 4W65A 1BBT2 1I1EA 1DLCA 2YDEA 5LK5A 3WUCA 5A3LA 2G4IA 2JX9A 5D21A 1U0AA 3ZIWA 5JWPA 2E6VA 1NG0A 3BOPA 4A4AA 1RVF3 5G04L 3GYDA 2A6XA 2BRTA 3NNLA 4Z8BA 1GZCA 4CDXA 1FNYA 1V6JA 4LO6B 1TMF2 3JBG3 5IJRA 3H1MA 3ZXLA 2V73A 3AFKA 4Q0VA 5LASA 4NROA 4EQVA 4AVVA 4LQRA 4LBOA 4L97A 3OYWA 4O61A 4JKLA 3BIWE 2VVEA 5FK8A 5AFBA 4NAMA 1MVEA 2DU0A 2F4LA 2JG8A 4MH0E 5FQ0B 3AFGA 3VBFB 2RM23 5DG1A 2DTYA 1RMU2 2QFEA 3C7EA 3FX3A 3P6BA 4QD2A 2DUPA 3PVBB 5CFCB 2WNUB 3B93A 3IWZA 2RS32 1VBC2 2WFF3 1GZ9A 5DN2A 5FY8A 4MV2A 4LBKA 2C5DA 1H6YA 1RUI1 5LRRA 3K46A 1RUD1 1AR92 1I6XA 2ARXA 2OS2A 2VR4A 3CLPA 1YJKA 3NNFA 4P9JA 5FP8A 5FCCA 4HKWA 1DQ0A 2BGPA 2IXCA 3URFA 1W8FA 4XF0A 4DRVA 1VBB3 1IKQA 2B46X 1IKPA 5F3CA 3PTRB 4IE4A 4L8QA 1W9SA 1R1ZA 1MQTB 1BVP1 1ZM1A 2GH8A 2VPVA 5I0UA 4YZ1A 5CFDB 3TEWA 2PAMA 5HV4A 4Q2FA 4Y20A 4CCLA 2W3JA 2PAKA 1PM7A 1AUYA 4FP2A 3W58A 4LKEA 4NHMA 4AQTA 4MUVA 1QJX2 3FFQA 1QH7A 3KT7A 5C5TA 2EXJA 1RUG2 4GB33 4TYSA 3K2OA 4MGYE 1N3QA 4DUWA 2DURA 4M3CF 2W47A 3VBUA 1CAXB 4ES9A 2IVIB 1AYN2 1CN1A 1US3A 2Q8EA 4HZFA 5BNOA 1MZFA 2R062 1YLLA 3S30A 2NN8A 2VZTA 5FYBA 2WO2A 1OMIA 2B4KA 1PO12 2VUDA 3RYRA 1ZBE2 3I2GA 3ZMOA 4P5HA 1OKOA 1A6CA 2EVXA 4K40A 1HN0A 4LTAA 4QX7A 4CCJA 1JYIA 4XUPA 1QQP1 1DYKA 3ILRA 2GALA 2ILMA 2SLIA 1QNWA 1GQPA 4OI4A 1LODA 1V6LA 5FLHA 5BNNA 1RUE1 3U75A 1TME2 1M4WA 1IOAA 1X9TA 4GULA 1VBE3 2WT0A 4I0WB 1H8TC 2WABA 4FPGA 2JB4A 2Z4FA 2P6CA 2ZKLA 4FOQA 1SCSA 2VW2A 3E6DA 2W2IA 3GF6A 3POEA 2YV8A 4OHVA 5F8PA 5C9AB 5KXCA 1SHWB 5L19A 3NV1A 3B7MA 1ZBA3 1GLHA 1VRH1 1QXPA 3WQ0A 3ZYPA 2YY1A 4AEDB 3NAPC 5FYZA 1UXZA 3FHIB 5FYUA 4X6RB 1ND2A 3DCQA 1GQHA 1NAEA 2H6BA 3DKWA 1GQGA 3KT4A 3USUA 1OSGA 3AXEA 1PM4A 4I02A 4N53B 2R072 5K4LA 4MADA 1AR62 4QMAA 2VZOA 1AR73 3IMMA 4Q4Y1 5ERLA 1S2BA 4YM1A 4XETA 5DAVA 4IEVA 1NOVA 3TYJA 3I2DA 2NYYA 2YC0A 3I2HA 2WWSA 4CXWA 4D8MA 3E5UA 5J98B 1SBFA 1QHDA 3U37A 2EA7A 2WQZC 4DXSA 1TZOA 4EZHA 2X29A 4Y1XA 4G9SB 2DCZA 2QQOA 3BOWA 1FPN2 3WNNA 4XMIA 5ACA3 2Y6JA 4KNCA 3O1VA 2V4AA 2HKXA 2VJXA 2YC4A 4YVWC 3BUCA 1KS4A 1FV2A 2CNAA 4IXLA 1SFNA 4QQPA 1V00A 1ZZ7A 1XE7A 2JKXA 4FQ4A 1BBT3 3C7OA 5FBJA 4PIZA 3RJRA 5EXOA 1J3QA 4KWJA 4JGZC 3H42B 4IGPA 2AEZA 5FDBA 4PBOA 4LA2A 4GH4C 5FMOL 2ZZJA 3MIEA 1ZRFA 2JIGA 2P1BA 2ZXQA 3T1MA 1WD4A 3IDBB 4RR3C 5JXGA 3L2HA 4DY5A 1TMF3 2RS52 5EFUA 2BZDA 4XTPA 3WDXA 1S2EA 4A3ZA 1ULGA 4YGEA 4UF0B 5FQ0A 2QTWB 3UYJA 3VZLA 3IAQA 2W95A 3KM5A 5DAWA 4XURA 2WNUA 3KCCA 4AFMA 3SISA 2DCYA 5D1IA 1MS9A 5H9PA 1HRI2 3JZVA 3VBSC 4O7XA 1BHGA 1DP0A 2EAKA 2Z79A 5T50A 2ZGNA 4QB6A 3JD73 2BNOA 3B94A 2X5IC 4L99A 2FDIA 1RMU3 3W5MA 3I54A 2DVGA 1BZWA 4L11A 4LLOA 4YW2A 1VBC3 4P5YA 2D5FA 5FYCA 5LZ6A 3ROUA 5J96B 4AI3A 1GP5A 1H4HA 4BM8A 5F2WA 5LA0A 4XJ8A 3KHCA 1R092 4NE9A 1QOSA 1VMJA 1AR93 4PQQA 2XKOA 2YPJA 3LF7A 2ZCWA 1MQTA 4WVWA 4XIOA 5CFDA 3FLRA 3S5AA 5FYYA 2PAEA 1NYWA 5F6KA 3WP3A 1NCQB 4CDQC 2O0OA 3CJXA 1SLAA 1IQDC 4CU7A 4OVEA 2YBPA 4Q4W2 3ZXAC 1JZ4A 4XHXA 4XAAA 1OBNA 2KXLA 4UW3A 2R0HA 1KDMA 3BTYA 1BKZA 4IUGA 1CAXA 3HNMA 3J7HA 5T5PA 3O1TA 1ZZBA 4XF3A 4XVHA 5CAZA 1ZRCA 1WWYA 1X7NA 1YQ2A 2GMPA 3AJYA 4HT1T 2ZHKA 1V6KA 1A8DA 1QJX3 2RJKA 3J8F1 4QXKA 3IPVB 4FTEA 3KWVA 5LRSA 1PGL1 1VB2A 2QQMA 5GZDA 3ATGA 1AYN3 4N9IA 3SCHA 2ZX2A 3VLBB 3BVCA 4GKYA 5IK8A 2R063 1ULOA 1C8NA 2AR6A 2C26A 1COV1 4JQTA 3OEAA 3ZDSA 5DAXA 4Y5SA 3HN1A 2B39A 2XJQA 3LDRA 1PO13 4NJ4A 4PQ9A 2X10A 4R9AA 2J22A 1JYNA 4PHZA 1W04A 1CQ9A 1S55A 4L2NA 2ZAAA 5FZKA 4U2AA 3VBOC 2HWB1 2XH6A 4UAPA 1OA2A 4A42A 1XU1A 4LUKA 1NCRB 1J1TA 1HB1A 5LBBA 4BZ4A 5C9AA 1OH3A 3WDYA 2DFBA 1BVVA 1TME3 4DEQA 4HVOA 5JR2A 3H1YA 3LWCA 3SHRA 4AHZA 3C2UA 1NQDA 3H7JA 3GCWA 1IPKA 1W8UA 4N8MA 1J59A 5FPBA 1RL3A 4N53A 1EP0A 4HG6B 1VALA 2SBAA 1N1YA 3LFIA 1RUJ2 2OPWA 1QJY1 2DCTA 2WSVA 1H0BA 4YG6A 3WF2A 5JOZA 3MV11 3MIBA 4AYUA 3VDDC 1W2OA 4KU8A 4QWNA 5FLJA 3ZYBA 5JSRA 5F6LB 2BBAA 5L36A 1NUKA 2QUOA 4ZKTB 1LJ7A 1PNFA 5JVVA 4MVTA 3C8XA 1AR63 1U5YA 2R073 1MS1A 1QGLA 1LKNA 1Y43B 5ANNA 3SKVA 2VQTA 3HR9A 3ECQA 4NN0A 1WKYA 4QKDA 3IKWA 4X8NA 3RYKA 1AJKA 3ALQA 5J7MA 3DV8A 4IEWA 4UYBA 4ZXKA 1JOJA 1R082 3LCPA 4RFRB 3H8OA 3VZJA 3N9NA 3BN6A 2BNMA 1Q3EA 3UJOA 4EN7B 1FPN3 3ZPOA 2AGSA 4CDUC 3HAGA 3T08A 2A6WA 3WNXA 1HXS2 3MF6A 4AGRA 4U36A 1AYM1 2E31A 3I4IA 4Z2AA 2OYZA 5KC5A 3AP4A 3NNMA 4XJ9A 1W0NA 4TTGA 4XF9A 4UFLA 4BOWA 4XXPA 1MS0A 3MEPA 1OVSA 1SLBA 4XXAA 1RC6A 3LZZA 1LNSA 1X50A 5EQUA 5FXWA 4XJWA 1NE4A 4UF0A 2BU9A 1OOPB 5C8CB 3SCFA 3CBNA 4PF1A 1RUH2 2JDYA 1ENXA 3NV2A 3B01A 1F5JA 5FIXA 2ZJCA 4BQ3A 4FSJA 1GANA 2IC1A 5IUQA 2XWBB 2WN3A 2VNVA 3NJVA 4YW1A 1WCSA 4IE5A 4HOOA 3KV9A 4RS5B 3OSDA 1OLME 3ACHA 1W3VA 4M00A 4Y26A 4IEYA 1LOAA 1ND3C 3I3MA 3K75B 2BUKA 5BPXA 1JYCA 1BLZA 3RZZA 5I0TA 4JTOA 2L9LA 2W1UA 4D6SA 1NY72 2ZTNA 2ARAA 2A73B 5J48A 1OFNA 2NP0A 4C0BA 4A7ZA 1G7YA 3AL5A 1IZ3A 1CZVA 4D6QA 5GLVA 1NCQA 3KCXA 3LEMA 1DQ4A 1S0EA 4XIKA 5AFEA 2WNVB 1Z7S3 3H50A 1NT0A 3POSA 4Q0SA 2D6LX 5EYXA 3RMYA 1LHVA 3TOJA 3B9CA 1K45A 1R093 4K7JA 1URXA 2VO5A 3AX4A 1OLMA 2IVJA 2VM9A 1PK6B 2PLV1 2AEYA 2QQJA 2ZEWA 1VBA3 2HWF1 1DU3D 1GV9A 2XG3A 2ZZQA 4Q4W3 3G7DA 2JG9C 5C6CA 1HV0A 1PMJX 1LGNA 1PO21 3IPVA 1W06A 1YXWA 5T54A 4MGIE 2D3RA 4LE4A 1W8ZA 1YYNA 4ZPIA 4XCAA 5FXVA 3ZFEC 1WLDA 3K4DA 2MHFA 2HWC3 4XBQA 1LOFA 4GMP0 5C3QA 3WX5A 1QXJA 1RIRA 1Y9QA 1Q8SA 3B02A 3KHBA 1X33A 3R4DB 2VY0A 4LKDA 5FJKA 3ZN6B 5EIYB 2IFRA 3QH7A 3T4HB 3RZGA 1K42A 3AMNA 3VL9A 3P3PA 3DPRB 1T2XA 1GFF2 4GMP1 3BODA 2WAOA 2WL1A 4A44A 3KD4A 1F9KA 1NCRA 3RQ0A 1POV3 5KBFA 2WS92 4P14A 4BE3A 3IN9A 2EIDA 3VD3A 5C4WB 3LPGA 3OGGA 5LCWL 3KV4A 4D94A 4L0PA 4P9IA 5IAVA 4Y1YA 3U10A 1SFYA 4META 2W1SA 3OY8B 4LR4A 4W6WA 4BQWA 3AP7A 3KSCA 5DUWA 4JX0A 2CWSA 4Q8LA 4FO9A 4C0HA 3MIGA 2WN2A 2A5ZA 2BOIA 3T2PA 2WWJA 2ZA9A 5JR7B 2QQVA 2BTVC 5GZEA 1JS9A 3ZOIA 1UKRA 1QOOA 4ES8A 3PTYA 3OGJA 4EZ4A 3ZN4A 2IWGB 4E2SA 5KHIA 1RUJ3 2YB7A 2PFWA 3HBZA 3OJBA 1YQ5A 3OGVA 1WZXA 4B3NA 4E4HA 1ENQA 3KV5A 3H7YA 5BYNA 3WP6A 4AVBA 2Y38A 3DYPA 1DQ2A 1ODMA 3LSDA 3PIJA 3VHOA 2VBDA 4HKOA 4LBQB 3ZYGA 5T5OA 3FN9A 5FAXA 4ATEA 1DQ5A 2NMNA 3O1UA 3RZMA 4NRPA 1XU2A 1XNAA 3TNQA 1ULFA 2GZWA 4N43B 3S7IA 4IQPA 1RUI2 1RUD2 1LEMA 2ZX4A 3LA7A 2JENA 2V5YA 2NZ9A 3USSA 3VBHA 2FDGA 2Y8KA 4RA0A 1WW4A 1HXS3 4IDZA 1W6MB 4RD7A 5H9RA 2DUOA 3PJYA 1OOPA 5C8CA 1OT5A 2ARBA 2W9XA 1ZZ6A 4L9BA 4QX3A 4AZZA 1LGBA 2QQWA 3OPWA 3I3EA 4LBQD 4SBVA 5CZKA 2C1FA 2P4EA 5BNPB 3GZTB 4IEOA 1RTVA 4XTMA 2XLGA 2XJRA 5ABJC 2C9KA 4NHXA 1Z78A 2ZMNA 4KH9A 3MYXA 3W20A 1RUH3 2Y33A 3WF0A 4FCAA 3VN4A 2WLPA 2FBEA 1ZVFA 1O4TA 2W5FA 4XBNA 1TNFA 4KWUA 1FV3A 4L92A 4Y22B 3ZIXA 2DV9A 1Q5OA 3LE0A 5DMYA 3BU0A 1YFYA 1O3QA 2NLRA 1E57A 4NIGA 3ASIA 3L9JT 5T55A 2OPKA 3FJSA 1SDWA 1TEIA 2R1DA 2WNVA 5FPVA 2TNFA 1O6UA 3UL2A 1GP6A 3UK9A 1PZ8A 4ORFA 5A7PA 3C3VA 2VUJA 4CEYB 5FZGA 4EROA 4AHXA 4ZY9A 4FP3A 3VBRC 1PK6A 4QPWA 5CKMA 3X29B 3IMNA 1L7LA 3RFRA 3CDZB 3U78A 1YQCA 3ZKUA 5JOYA 3TB0A 3VUOA 1L7RA 1W8WA 3ES4A 4QX0A 5B2GB 4BLJA 3I3BA 4TWTA 4CUGA 2YG0A 1LU2A 4A7YA 3OD0A 2WNOA 4IV3B 4IE7A 1W6NB 3ILNA 3OCPA 1GICA 2QQUA 1UXXX 3SH3A 2HWE1 1I9RA 2KM2A 5FRAA 4ASKA 5IAXA 1OQEA 4GWNA 2X5IB 4QQOA 3ZXFA 4YARA 4OMCA 4CEWC 1PVXA 2Y26A 1HV1A 1D4M1 1Y4WA 3IM0A 3WNMA 3ZN6A 5FP3A 1H1AA
chains in the Genus database with same CATH topology
3DPRA 4Q4Y2 4KGQA 2PHFA 1MEC2 4AFCA 4XFIA 1VLNA 3B69A 5FPXA 1QH6A 5T3NA 4ZU4A 3V0AB 3NL1A 4I01A 5D8AC 5C8WA 3BCWA 1ENRA 5EJ3A 3LOIA 4HVRA 4B8EA 1CAWB 5DDJ2 3WCRA 1X8MA 3AMMA 1X36A 3NW4A 1HQWA 1RJ8A 2VUAA 3OY8A 4OI1A 2XJPA 4PLMA 3AKPA 1FI2A 5FO9B 4HL0A 2QE3A 1KS5A 5K0UC 1YFUA 5F1RA 2RMU3 2G9GA 4ZU7A 1V9U3 1OLRA 1CJDA 2MEV1 4HK9A 1WMEA 2XJVA 1RUF3 3M7AA 3MPPG 1QDOA 5AC91 1KD7A 1KDKA 2VXRA 3DUIA 3TRSB 1DDLA 3R05A 3M3IA 3VZOA 4EN6B 4HK8A 4K1YA 3W9AA 4YW5A 1C28A 4IETA 1Q8QA 4EN9B 1WCKA 5GKAC 2GMEA 1NQJA 1G9CA 1FOD3 3KGZA 3HT2A 3O5SA 4LBQA 1OPOA 2W68A 1CONA 3WDTA 4D7TA 4AEMA 4K3UA 4PCRA 4BPZA 4N43A 3INAA 3WW1A 2QDRA 3GNEA 4C91A 5I8SA 3MIHA 1EPZA 1NA1C 1W6MA 1MS5A 2WZR1 4COVA 3R4UA 1OHFA 1VR3A 4GWMA 4OZXA 3WDVA 4MXVA 5BNPA 4PBPA 4TLFA 4DXZA 1W0PA 3AP6A 3E5XA 4ITCA 2VMHA 2ZBJA 1N3OA 1MS8A 2XLAA 3QLQA 4OULA 2OUJA 1LHWA 3UKNA 3S6PA 5CA6A 4QPGB 4UBHA 1B09A 3A0NA 4WV8A 3U11A 4WM8C 4Y22A 2GDFA 1RB8G 2IXKA 4AVAA 1UD1A 4ISQA 1D0GA 1U5ZA 2R49A 3J8F2 2D3PA 2O1QA 1DQ6A 2UU8A 3AZWA 3DL3A 4RSUA 4XFBA 4Y24A 5I0UA 1H9PA 4AXOA 1PGL2 2P2KA 2GC2A 1PVC2 2VNOA 2ZAHA 4WZCA 4BIFA 3ZSEA 2A3YA 4AE2A 4CEYA 1COV2 4BCUA 1D4VB 1ALYA 2P37A 1GYKA 2XVKA 2RJLA 1OI6A 4QGLA 3M3OA 3NKTA 2TBVA 4IL7A 5KHHA 3KGLA 4IV3A 2A6YA 5AVAA 1W6NA 4PDWC 3AMHA 4J6GA 4CDWC 1HDKA 3SH4A 1AF9A 2X5IA 4XFAA 3M4FA 3B9IA 4Q0UA 4EN8B 2K0GA 2R30A 2ZHNA 1VBD2 2VOVA 1A78A 1DGRA 4NWWA 1AR82 1Y7BA 4IEQA 2GAUA 3WVJA 1IS3A 1V6IA 1SCRA 2D6PA 4TSVA 4RQPB 3V0AA 5K9YA 1HW5A 2GU9A 3UJQA 2RR13 5FFOC 2H0BA 1CAWA 2UY9A 1MEC3 2YROA 1FMD3 1ULDA 2Q8OA 3CL1A 4DY3A 4XMAA 4KWKA 5FO7B 2GNTA 5GLTA 5DDJ3 1C4RA 4DS0A 5DG2A 3PJQA 1H2KA 3D0JA 2LM3A 4Z92B 3ZFEB 1NLRA 2NQYA 5GZCA 2LUWA 2UYAA 2IXLA 2WSUA 1O3SA 2XVLA 3WUDA 1LENA 3OBTA 2I2SA 4H55A 5JLVA 1REEA 4YM3A 5I8TA 4OI2A 2NM1A 3ES1A 2WC2A 3LB9A 1WLWA 1BEV3 2Q4SA 4DRRA 3V65A 4M3CB 2ZGSA 3THPA 2RS11 1YFWA 2RE9A 3ZFGC 4NWVA 2QCSB 2VGDA 5GLUA 2ZGTA 3MZHA 4Y5Z0 2CGPA 4S2GA 3O14A 5GZFA 3ZPYA 1C8M1 4Z1VA 3AZZA 1VAMA 4DOUA 1AL22 4FQZA 2HWD2 4KBBA 4QPGA 3PMSA 4EWDA 1EAH3 5KXBA 1RVF1 1I3HA 4FPOB 3R0RA 2DVBA 1PGW1 1YIPA 5JZGB 4F8AA 2ZGPA 3JBG1 2HEYF 2R32A 4I3GA 2D44A 4XFFA 2HEVF 1BMV1 3VGIA 2QNKA 3EBRA 4YG3A 1GBGA 4HBNA 2RHPA 2B9UA 3ZSJA 1S0BA 1UX6A 2AREA 4M0HA 4NOTA 4RGGA 1K5MC 2WJSA 3WG2A 1PVC3 1G9AA 2ES3A 1YUDA 4FPEA 3ZXKA 4YFZA 1COV3 2RM21 4KQ7A 4QGMA 1LEDA 4COYA 2X8KA 4JDMA 2WLQA 3ZFFC 1XNDA 2WFF1 4WM7C 3CU7A 2BGCA 4DB5A 2R042 1O3TA 3AZXA 1H1IA 3WQ1A 5LEKA 4LULA 4F3JA 3LA2A 4HN0A 3N7KA 1VBB1 4LBNA 4K1ZA 4RQPA 4JTNA 1VBD3 1EYBA 3RRDA 3V56A 4KGGA 1VP6A 3AP5A 1AR83 1DGRN 2BYVE 2WNEA 1PZ7A 1CIWA 2BWAA 4AGVA 2WFPA 4GB31 1DGWX 4QX5A 4URTA 4XFHA 1JHNA 1XNKA 1OA3A 3AYEA 2RS33 3RSJA 2PHDA 3VZMA 1HRV1 3ZFEA 4M3CE 3VL8A 2GSYA 3FWEA 4MLOA 4QQHA 2PHUA 1UU5A 2OW4A 4P9WA 4CDXC 4LHNA 1QF3A 2UWBA 1YRZA 5CNAA 5J37A 3D82A 3AZYA 4HPKB 4HN1A 1VBE1 1WLTA 4FPYA 1SQ4A 2VG9A 1ZA4A 2W39A 3QOPA 1CJPA 3J4UH 5JIAA 3MFCA 2D40A 4HLTA 5FTTC 4D7YA 4Q4X1 3AMQA 1RUG3 2Z2SB 1ZBA1 3HD8B 3LKJA 4M3CA 2JG8C 1QY4A 1PIV2 4HANA 4AI0A 4BHPA 3E5QA 1IS6A 1PNGA 1AR71 1ZYBA 3OF1A 1ZBE3 4S2DA 3EXUA 5FBZA 4XILA 2JECA 3H9AA 1G9BA 4BLIA 2R6QA 3ST7A 1V6OA 5ACA1 5DUXA 1KRIA 2VNGA 4E4DX 3RPQA 4R9DA 1AL23 4FTSA 2BQPA 2HWD3 2P17A 5FOJB 1BBT1 5JZGA 2E7AA 3H3ZA 4Q4V1 5HCBA 2HWE2 3GBWA 3WDUA 2PHTA 1S0IA 1B35B 1D4M2 1UU4A 2P3JA 3MLKA 4AFBA 5BNOC 1TMF1 1S2KA 2YMZA 3NSTA 1TE1B 1YI7A 4YZ3A 4CRQA 4YW4A 4IEZA 5E16A 2GNDA 5KXEA 3MW4A 4MXWB 2ATFA 1KJLA 3WINE 4BIOA 4AF9A 1IPJA 2VH9A 3FUQA 1LOGA 4GMP3 1ASJ1 3WR0A 4ISRA 4AFAA 5BNNC 1HLCA 3ILFA 3KB5A 4FVVA 3JD71 2PHLA 1HKDA 2D97A 2JE9A 3O0XA 1RMU1 3FMGA 4QPYA 1GNZA 3M70A 1VBC1 3VBHB 4YRDA 2CGNA 2XL9A 4CTEA 3JCIA 3CJIB 5DZEA 2R043 1LOCA 2YUEA 2ZX1A 1OA4A 3U07A 3N7MA 5AC92 2RS53 1OQDA 1YO8A 2DVDA 4AI8A 4HETA 1ZZ9A 2QVSB 2W52A 3M3QA 4NO4A 1QXRA 2FZ2A 1KITA 2P34A 2WQ4A 4XE9A 3ZSLA 2E7TA 1SEFA 4QM8A 1HRI3 3MLJA 1J3PA 1SMVA 1QJX1 2VVDA 2WT1A 3AYAA 2XJUA 1ZZCA 4LO5B 4CEWA 1AYN1 4ONUA 1PHMA 2TEPA 2R061 1WD3A 4FOVA 2BVVA 5JOWA 2WZR2 1PO11 1XXNA 4HPKA 1WBLA 5IK5A 3AMPA 2MPFA 5E88A 4B29A 3H0OA 3UKVA 3H3UA 3OBRA 4RGAA 3PVNA 1QJZA 1LB2A 1UMZA 4D7SA 4Z2WA 3EQEA 4R9BA 1KQRA 2D93A 3VBFC 1NXMA 1S0DA 4OHZA 3J9SA 1R1A2 5KHJA 1UPSA 5HXVA 5CFCC 1LRHA 3E6CC 5T52A 4YZ5A 1PIV3 4LHLA 5CG8A 2DU1A 2XJTA 4AI1A 1H2LA 3R6SA 1RUC2 5GJ6A 2HYKA 1AR61 2XKPA 4Q1PA 3LAGA 1M06G 1FX5A 1WMDA 3IT8A 4WBBA 3WCSA 5CFDC 5KXDA 3GALA 1Q8PA 3M8LA 2Y0IA 4GALA 1FPN1 2D3SA 3BU7A 4YVSC 1DBNA 1UW8A 1BCXA 4YM0A 5EZWA 3N7LA 3VKLA 5FO8B 1B35A 5JSOA 2HJIA 4I30A 4C1XA 2Z42A 4IEXA 1XE8A 2ZKNA 2CTVA 1O91A 3I59B 1CAUB 4MXWA 4OUMA 1D4M3 1BYHA 3D0SA 3HIFA 4J1WA 1H8TB 3EHKA 3IIAA 2R0FA 1WLCA 4I0AA 4MX3A 4AQ2A 4UBGA 1DGLA 2X53S 3K48A 4Q8KA 3VKMA 1RHI1 4RHV1 4YFWA 3TN91 2ET1A 4CP0A 1R083 4UXAA 1APNA 3NAPB 1QOTA 4YGDA 3ZXDA 4JAAA 4IESA 5FOBB 3ZN5A 5C9AC 5JDBA 3CJIA 4D69A 2QQPA 4AEDC 2PA7A 2DFCA 3M3CA 1ULEA 4DNYA 3MPBA 4MSVA 2BWCA 1Z7S1 2WZPP 4XJAA 1WW5A 1O5UA 4BA6A 4E2GA 1WA4A 2QDNA 1R091 3WW4A 1DZTA 1C57A 2OA2A 1H2NA 2IXHA 5AVPA 2JD4A 4LBMA 1GKBA 1FT9A 5AC93 1VBA1 4YVWB 4GA9A 3P3NA 2ERFA 2WA4A 1MS3A 4W6XA 2K9ZA 4Q0QA 2JXAA 3ZFFB 3FBYA 1DYPA 4WM7B 1UF2C 1V6NA 4JGZB 2D6KA 2RS12 4E27A 1F2NA 4OHXA 4AI2A 2HWC1 4GH4B 2F6BA 1WMFA 5EYYA 1QQP2 1ZZ8A 4RR3B 1POV0 5KWRA 1RUE2 4S2HA 4IERA 3R4SA 4XQDA 2KA3A 4LHKA 5JMCA 1U12A 1POV1 2EXIA 4FPCA 2WZR3 5DXDA 2PHWA 1C8M2 3WY6A 2A75A 3VBSB 1VRH2 3PVOA 1JXNA 2ETEA 3VZNA 2YGMA 2Z69A 2DF7A 3LGRA 1RVF2 1W6QB 1CX4A 3QACA 2R16A 4P9XA 1JBCA 1PGW2 1O4ZA 1R1A3 4X6QB 1Q8VA 2ZGKA 4WVMB 1RUNA 3V0BB 4HKLA 3KMHA 3TBDA 1BMV2 2GNMA 2O8QA 4CDQB 4IV1C 1LESA 4MGZE 1C3HA 4BH9A 2Q0AA 4FXKB 4N9HA 1X82A 3OPZA 5JAXA 4KL1A 2BBVA 1RUC3 4DINB 4AVSA 1NCQC 3BB6A 5I91A 2WS93 1Q43A 2BEOA 3MW3A 5KHKA 5FMOS 4JC1A 4YNIA 2WFF2 2F4PA 3T1LA 4I0BA 3RG0A 3I7DA 3KCYA 4OFGA 4XYXA 3WQ7A 2LALA 3FBMA 3RDIA 1H30A 3NO8A 4FPKA 4WVZA 2JE7A 3WV6A 2EIGA 2VQ0A 4FPLA 2ZMKA 1HXS1 4EWEA 3MFAA 1QJU1 1RINA 3I59A 1CAUA 4YYOA 2VECA 3E97A 5E8AA 3PHMA 1H8TA 2D43A 1LOFC 2GH2A 4FPFA 3VBOB 2OUHA 2EAAA 3EJKA 2FMYA 2QZ2A 4I09A 3ELNA 5CG9A 4ZU5A 2VNRA 1YIFA 2NMOA 1XYPA 4COZA 4ATFA 3NAPA 1REDA 1TNRA 1UIJA 2VMGA 1NCRC 1LOEA 5IK7A 4KWLA 1D0HA 1FAYA 2JDZA 2OIIA 1HRV2 1RUI3 1YCIA 3VDDB 1RUD3 5L7OC 4GQ7A 3MIDA 3PLQA 2I74A 2ZPXA 1SLCA 3RJ2X 1LHNA 2B45X 4XJZA 2GMMA 2ZGOA 4M0NA 4LNVA 1C5HA 2OZJA 3O0VA 3LA3A 3L2YA 3LSEA 5DZGA 4CP2A 4K20A 1VBE2 4YVWA 3RI9A 5A32B 1D2SA 1MVQA 3OTFA 4Q4X2 3ZFFA 3JU9A 4WM7A 3RI8A 1UIKA 5E1RA 2XWJB 4CDUB 4J1XA 3WG3A 4XDQA 1PZ9A 4JGZA 4JVAA 1EV11 3WHTA 1N1SA 1DF0A 4GH4A 3U0ZA 1FXZA 1V6MA 2A7AA 3AM2A 4DPNA 1G86A 4RR3A 4BWOA 1IHMA 4G4FA 1QU0A 1IS4A 4INDA 1I5ZA 4AQ6A 2D6NA 2HWB2 1QQP3 1WBFA 4FBFA 3AKSA 4MGKE 1CAVB 5DUUA 4AHWA 3K51A 3MDPA 4Q1RA 1RUE3 1OOPC 2CYFA 3VBSA 4DFSA 5GALA 3ENRA 4K21A 5BNQA 1ND3B 2NPIA 4OHYA 1W6QA 3A0KA 1S0GA 2CV6A 1VRH3 4RS5C 1QJY2 2AH2A 4WVMA 4Q4V2 1CGPA 1H2MA 2RMU1 4CYDA 3V0BA 1V9U1 1LULA 4P9LA 5J3UA 1YHFA 1CPMA 4CDQA 4SLIA 1RUF1 4JQRA 5I8YA 2VU9A 1AJOA 3B3QE 2W08A 4Q4Y3 3NV4A 2CWMA 1W2UA 1JUIA 3G6JB 1TQ5A 1IS5A 3O0WA 4QHBA 2BPA2 1L3JA 2WNVC 4AQSA 3RNSA 3BALA 2Q1ZB 1FOD1 4NR1A 2JG9B 1W6PB 2JJ6A 1ASJ2 1O5LA 1PK6C 1S1AA 2XBO1 1MACA 4WZFA 1AYM2 2FZ1A 1AX2A 3JD72 4EV0A 3N4MA 2K2SA 4N7UA 1JW6A 2XL7A 5JIUA 4QQLA 5FREA 1QMJA 3ZO0B 2D6OX 1F31A 1S0JA 2EF6A 3ZSMA 2E7QA 1N47A 3VBOA 3N7JA 2XPJA 1VAVA 1YFXA 4QPIC 1A3KA 4DZGA 4PIXA 3DPRC 4X8PA 3FZ3A 3RMXA 1REFA 3U4XA 2DCJA 5J09A 4BMEA 2GN7A 4PIYA 3RWNA 2WT2A 5C4WC 5JOXA 4FAGA 2H6CA 2GC1A 4A7KA 4YVSB 1YI9A 3VDDA 4XEZA 3WW3A 3WP4A 2AYHA 3MGUA 4XQ4A 2DCKA 1H8VA 4FPJA 3SH5A 2UWAA 2ZS6B 2VVFA 3ZX7A 1HRV3 4IEUA 3WG4A 4Q27A 4FTBA 2PLV2 2C9AA 2ZMLA 5A32A 3NWKA 1V70A 4KG8A 2HWF2 1F5FA 3PMEA 3KQRA 4B7EA 4AHYA 1WUVA 1MR5A 5FPZA 1PO22 4CDUA 2QJVA 3WG1A 4O9GA 5HI0A 3VHRA 3ZVXA 1N1TA 2VMIA 4Q4X3 3J8F3 2VW0A 2YYOA 4E9KA 3HMYA 1SLIA 4DMIA 4N43C 2UY8A 2BVBA 1AX0A 3M3EA 4Y1UA 4XOGA 3JB8A 2B5HA 4XF1A 4PJYA 1CAVA 2LTNA 3GBGA 1J1LA 3QCWA 5ABJB 2RR11 2ZOEB 1VAKA 2ZHLA 1MEC1 1C1LA 2V09A 2HWB3 1ND3A 5LEJA 4FPHA 1FMD1 2AZ5A 1RITA 4K8FA 4HVQA 5BNPC 4AVTA 1QDCA 1ZX5A 4UW6A 2UURA 4R52A 3AXDA 5DDJ1 3H8UA 5JPMB 4JDNA 5DZFA 1SLLA 3GZUC 2PN5A 5GLZA 1HQNA 4C1WA 3AZVA 3Q9OA 2H0VA 1DHKB 1QJY3 3UKTA 3OD4A 4E4ZA 4Q4V3 4XZPA 1LR5A 4NHLA 5SV5A 4FOWA 5CVRA 1JTZX 3D5OA 3RYPA 3VBRB 4FAHA 1J58A 5IT6A 1S0FA 1KXGA 4JGYC 2JG9A 4CEYC 1OD5A 1W6PA 3S7EA 1XNBA 3IDEA 3WD5A 4PF5A 5A3MA 1BEV1 3WDWA 4XBLA 3VBFA 1RHI2 4RHV2 3TN92 2VULA 3NV3A 3WT3A 3AKQA 4AK3A 4YW3A 4XPVA 3CF6E 1BQPA 5CFCA 3O7OA 3TWIA 4CEWB 4IV3C 4JRAA 3WZ1A 2QZ3A 1ASJ3 1IGOA 3TNPB 4YSFA 5BUVA 1AYM3 4CP1A 4I2OA 2B42B 5F5QA 2GNBA 1ZNPA 1BJQA 4YLZA 3VKOA 1Z7S2 4IV1B 4AG4A 2A71A 3WXPA 5D8AB 4P9YA 1DG6A 3SNMA 1XYOA 1JH5A 5SV8A 2N7GA 3M2MA 1UKGA 1VB4A 4KU7A 1UN1A 1DIWA 2Q5TA 1VBA2 4XJUA 5CU1A 1EAH1 4H7LA 3RS6A 3S0MA 4RFT0 1FATA 4YVSA 1T6GC 4Y1ZA 3FLPA 5K0UB 4EJRA 2CL2A 2GN3A 1LGCA 1AL0G 1GZWB 1SBDA 4QGNA 4C90A 2HWC2 3POYA 3D8CA 2BFUS 5CB7A 1DZQA 5EWSA 3JB4C 1YNAA 4YGCA 2A3WA 1PVC1 1S0CA 1MZEA 4H7MA 3GZAA 1D2QA 4BQ1A 2D6MA 1VJ2A 2PLV3 2B7YA 3LOBA 4JCKA 2EALA 2HWF3 3SLIA 2XHKA 3VBUC 1PO23 3POWA 1NA1B 3ME2A 1G9DA 1G8WA 5T5JA 1YWKA 1C1FA 4AEDA 4AEKA 2VOWA 5JI7A 3QD6A 1CR7A 5L7OB 1O7FA 1GNHA 3SMHA 4YM2A 1VBD1 4B4QA 4TZDA 2PYTA 2G9FA 1AR81 4D3WA 2A6VA 3T2TA 5ABJA 4NVPA 2XVGA 3AYCA 1EY2A 1W39A 2ZGRA 4QQ2A 1LHUA 5K8SA 2ZGMA 2UWCA 2WA3A 3QH6A 1LCLA 4WM8B 2A3XA 2RS31 1GR3A 3MIFA 4LE3A 4E4SA 4QPGC 3ETQA 5A33B 4AEJA 1AR91 2MNGA 1KFUL 2MEV2 4BYYA 1ND2C 1UU6A 3ZYJB 1U5XA 1FYUA 3KZ4C 2Z5WA 3V64A 3AP9A 3MW2A 3VBRA 1SLTA 2PHXA 4HSJA 1QJU2 3THTA 1XQNA 1G9FA 4LA3A 4MZUA 4PLNA 4XW3A 3KT1A 4Q26A 4YGBA 4I3PA 2FMDA 3NKGA 3QBQA 1BXHA 1SACA 4UW4A 1XYNA 2GC0A 2E51A 3BTAA 3GBFA 4PDWB 4CDWB 4LUMA 3FE5A 3KS7A 2CAVA 1RUG1 2C0ZA 2PTMA 1VIWB 3HWJA 5IK4A 4NHKA 5CADA 1Y3TA 2PHRA 1YJLA 3UV9A 1AZDA 2YZ4A 2ET7A 4F7ZA 4GKXA 1RHI3 4HSLA 4RHV3 3HQXA 3TN93 1IQAA 1OQ1A 1ZBE1 4R9CA 4XFCA 4AFDA 1OLQA 1KFXL 1UAIA 1OKQA 2DTWA 4IV1A 1Q56A 3I8TA 2P3IA 2TUNA 5D8AA 3SITA 1MS4A 1XNCA 1TME1 2A70A 4E2QA 3SCGA 1DZRA 1EPWA 4RQPC 4Q29A 5HCFA 4B7KA 4V1PA 2WNUC 3VKNA 1BK1A 1AL21 2HWD1 4YZ2A 5K0UA 3VKFC 1RJ7A 1ENSA 1WW7A 3IBMA 1GZWA 1EV12 3AKTA 3AKRA 1HQLA 2QKDA 5E89A 3MICA 1UL9A 2R071 2DYCA 4AW7A 5I93A 3H1WA 1CVNA 4XQWA 2XB6C 1MQTC 3D6EA 2ZGLA 5I0RA 4DQAA 1KJRA 2ZACA 4QPIB 2VOXA 4XF4A 4IEPA 1DGWA 3DGTA 4Z07A 3M1HA 5T5LA 3O12A 4OLLA 4Y4YA 4LEJA 2ENRA 2Q1MA 1NA1A 1NXD1 2XLFA 3ZFGB 4H14A 4LO7A 3ZXEA 2HWE3 4Z82A 3MF9A 5H9QA 2RMU2 1DLLA 5L7OA 3PVEA 3JQWA 1V9U2 2R041 1RUOA 3PNAA 4HMZA 1N3PA 3JUUA 1RUF2 1ZRRA 5BXXA 4N90A 3AB0A 2RS51 2IXJA 2EXKA 4XFGA 1UZYA 4R4XA 3AJZA 1W0OA 3JQXA 3MI8A 1QNYA 4EN0A 4WM8A 1FOD2 1UZZA 1HRI1 4AGGA 4B4PA 2A6ZA 3ZMNA 5A33A 2WKKA 2XBO2 2E9QA 2UYBA 2XGXA 2R1BA 1LTEA 4QU2A 4N53C 4COUA 3GHNA 5JPNB 5GLWA 1MZ5A 4PLOA 5JZGC 2JICA 1PMIA 5C33A 1H4GA 4UW5A 5F9TA 3AYDA 1AXKA 2MEV3 2FQPA 1H1MA 4LLFA 4OUSA 1K5MB 2DVAA 2PQQA 3N35A 4QT6A 4W6YA 3WW2A 4K6BA 5TSWA 4FXGB 1G6NA 4Q4W1 3FLTA 4PDWA 4R4ZA 2DWRA 4CDWA 1QJU3 2YXSA 2CY6A 5J36A 1UPIA 4QM9A 1OFSA 1GSLA 3WP5A 4MYEA 2YHJA 4RS5A 4OI0A 4FOYA 5I0SA 2ZX0A 5HCAA 3E6BA 2HEWF 2OZ6A 3GHMA 2YGLA 4GXLA 1PIV1 2B8MA 1UCXA 4HFSA 4K9SA 4OHWA 5CBLA 4KG0A 3SXWA 2E63A 1CD3G 4G3YC 1AX1A 4JDOA 3ZYRA 2O8OA 4JGYB 1ULCA 1W6OB 2BW8A 2XJSA 1MZ6A 2JKBA 4P9GA 5JCTA 1AXYA 1C5IA 1FNZA 3VZKA 3ZYIB 2WINB 3JBG2 2VQAA 2BFUL 1H9WA 2OVUA 4Q0PA 4B4RA 5CIRA 1NLSA 2AUYA 3HT1A 1RUJ1 3N3HA 4JV4A 5JSPA 4CDXB 5DUVA 1WGPA 2D7FA 2WIIB 1QWRA 1F8VA 2EXHA 1EV13 3ACLA 3IDCB 4S2FA 2D98A 3FUOA 3NVCA 1LECA 4QPIA 2RM22 2XUMA 3ZXJA 3OYWB 4M01A 3VHNA 3WOGA 4YG0A 5JI9A 4EWAA 3TAYA 2RR12 1JN2P 1HIXA 1LOBA 1N1VA 3B5LB 4ASLA 1R081 2JG8B 1FMD2 4RL7A 3WHUA 1O3RA 2VOKA 3ZFGA 1CESA 5C4WA 5KC6A 2ZX3A 3NJZA 2P3KA 5BY5A 1VBB2 1DQ1A 1AHSA 1Q8OA 3BPZA 1JUHA 3CNAA 1AVBA 1OPMA 2CGOA 2E53A 1AXZA 4N7IA 1Z0HA 5L73A 4LT5A 3WLUA 1DFQA 3DN7A 2IFWA 2JEMA 3N36A 4GIQA 5K7PA 5GZGA 4LBJA 4AVCA 1RUH1 4GB32 4JRLA 4Y1VA 3B00A 3CEWA 4YZ4A 2AENA 1X8EA 2CAUA 4A3XA 4Y20B 2I07B 4BMBA 2DUQA 1BEV2 2ZGQA 3KLSA 3APBA 1A8MA 3A4UA 1HX6A 5GM0A 2ZHMA 4O9EA 5FLIA 3VHPA 3ZSKA 1U5IA 2Q30A 2Y0OA 3VBUB 4LO4B 1NY71 4LBLA 4NPRA 3W59A 5BNOB 2XBO3 1NE6A 2IZWA 1K5MA 5HBAA 5H9SA 1QKQA 1B35C 2GC3A 1CPNA 4COWA 4CZSA 3J26N 3ZXGA 4FT8A 5BNNB 1ZBA2 3MLLA 1LU1A 2ZGUA 3EO6A 1ZREA 1PGSA 1EAH2 1XRUA 3FFZA 4WVVA 5BV6A 4F83A 1WW6A 4A2UA 4ASMB 5EV7A 4AWDA 1AR72 2RS13 1R1A1 2I45A 1J3RA 2D5HA 5KHGA 3AK0A 2W0XA 1ND2B 3VBHC 1O4YA 3D4KA 3USUB 2IXIA 3CJIC 4LO8A 1ONAA 5C8CC 2DVFA 1WCDJ 4XHBA 1SBEA 5ACA2 1RGSA 3VV1A 2ZABA 1RUC1 4JGYA 2PELA 1ZRDA 1W6OA 2WS91 3FC0A 1C8M3 2FHRA 1LHOA 2BNNA 3DF0A 4R8HA 4H3WA 1NZCA 3CO2A 2VW1A 4W65A 1BBT2 1I1EA 2YDEA 5LK5A 3WUCA 5A3LA 2G4IA 2JX9A 1U0AA 3ZIWA 5JWPA 1NG0A 2E6VA 3BOPA 1RVF3 3GYDA 2A6XA 4Z8BA 1GZCA 4CDXA 1FNYA 1V6JA 4LO6B 1TMF2 3JBG3 3H1MA 3ZXLA 2V73A 3AFKA 4Q0VA 4AVVA 4LBOA 4L97A 3OYWA 3BIWE 2VVEA 5AFBA 1MVEA 2DU0A 2JG8A 4MH0E 5FQ0B 3VBFB 3AFGA 2RM23 5DG1A 2DTYA 1RMU2