5KC6A

Crystal structure of cbln1 (val55-gly58 deletion mutant)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
SAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cerebellin-1
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kc6A00
4DB5A 1D2QA 2HEVF 4KG8A 1JH5A 4HT1T 5L36A 3URFA 5KWRA 1ALYA 1TNRA 2HEYF 2TNFA 4NN0A 3MI8A 3L9JT 3ME2A 2JG8C 1S55A 2JG8A 2R6QA 2TUNA 3B93A 3FC0A 2QE3A 2WNUA 3K51A 3QBQA 2RJLA 1PK6C 4OUMA 3B9IA 1U5XA 4QQLA 4QQPA 2RE9A 3IT8A 2RJKA 1D0GA 1IQAA 5TSWA 4EN0A 4MXWB 4QQHA 1RJ7A 1DG6A 4QPYA 3B94A 4E4DX 4MXWA 1C3HA 2OIIA 1PK6A 1OSGA 5L19A 2QDNA 4KGGA 4TSVA 1D4VB 1PK6B 2E7AA 4TWTA 4QQ2A 2AZ5A 2Q8OA 1JTZX 4N90A 4GIQA 1C28A 4MXVA 2X29A 5HBAA 4E4SA 5CIRA 1KXGA 4QQOA 3LKJA 4F3JA 4G4FA 1XU2A 4OUSA 3AB0A 1KD7A 1U5YA 2O0OA 4RSUA 1I9RA 2WNVB 5KC5A 2KA3A 1OQDA 1XU1A 1OQEA 2ZPXA 2WNVA 2R32A 3ALQA 4J6GA 1GR3A 2WNVC 1RJ8A 3QD6A 2JG8B 1TNFA 1U5ZA 2Z5WA 4DOUA 3WD5A 4MSVA 5BNQA 2JG9C 2JG9A 4OULA 2HEWF 2WNUB 1A8MA 3V56A 2Q1MA 5KC6A 1WCKA 3TWIA 2JG9B 2R30A 2ZJCA 3K48A 4G3YC 2WNUC 1DU3D 3TYJA 4D7YA 1O91A 4KGQA
chains in the Genus database with same CATH superfamily
1UY4A 1BBT3 4LULA 1GFF2 5ABJB 4KWJA 1D2QA 3M3OA 5CZKA 1GQPA 1IOAA 4RL7A 1Y7BA 5EQUA 2TBVA 1I6XA 5ABJC 3OGJA 4Q4V2 4LLFA 2VZTA 3K3NA 1QDOA 1HV1A 3T0DA 1GP6A 2OW4A 5J09A 2V4AA 3ETPA 1JU4A 1LOEA 2HBTA 3AJZA 3CBNA 1QJU3 4BQ3A 2VVEA 1OF4A 5JSRA 3ZIWA 3VBFB 4WV8A 3WDXA 2E9QA 1JOJA 2EAAA 4K9SA 4O61A 5DAXA 4N9IA 5EXOA 1AF9A 2ZHLA 3JZVA 5GALA 3H8OA 4MG2A 1LEDA 1C5HA 3Q8FA 3WEZA 3MIEA 1RGSA 4PHZA 4MV2A 1O3SA 4QHZA 4YZ4A 5ABJA 5ACA2 5L9VA 1NX9A 2D43A 4JDNA 3T30A 3RZKA 3ZDVA 2OZ6A 2PQSA 5TSWA 1VB2A 3BU0A 3ZN6B 4LBNA 2R073 4XACA 1GANA 3CF6E 4ZXKA 4A7KA 3NV1A 5JOYA 1QJFA 3V0BB 1IS6A 4FPCA 4XF3A 1OC1A 3A0KA 4R8HA 4C91A 2C1FA 3U07A 5FY1A 1SLCA 2PAEA 2UWAA 4H7LA 2QQPA 1OLME 2J1SA 2B4KA 1PMJX 1QDCA 4JVAA 3EXUA 1EAH2 1ODMA 3ACHA 1AR63 4XTPA 1FI2A 1AR93 2E7QA 1YIFA 2DFBA 3HD8B 4YGCA 3BPSA 3JQWA 5A3MA 1I5PA 3B02A 2Q8OA 2DDUA 1HJFA 1YXWA 2D6LX 5L9RA 5A80A 3T4HB 3H1WA 1HX6A 5HBAA 1MZ6A 4NWVA 3TB0A 4NIDA 3D0JA 3C2UA 1G6NA 1Q5OA 2ZEZA 2BFUS 1V6IA 3RVHA 2C9AA 1VBA2 2VOTA 5LBFA 4LOSA 3I8TA 1AR71 3O1VA 4WVWA 1NA1A 1QU0A 2WSVA 1D0HA 4Y1XA 3THCA 2CAUA 4OHYA 2OA2A 1AYM3 4NUBA 1K45A 2GZWA 4S2HA 2BDRA 3ITQA 3ZKYA 3UT0A 4K20A 2VTFA 3MIDA 5C33A 2UYBA 5T52A 3H9AA 4ES8A 4R4XA 3VHPA 3N9NA 3T2TA 3VUOA 3KT1A 4JZRA 2YYOA 4LO6B 4QXBA 3E5UA 4LK6A 1NCQB 1OI6A 4MGIE 1LGNA 5A7NA 4GXLA 3WDWA 1W6OB 3IIAA 4I09A 4QKNA 1HXS2 1MVQA 3KV9A 4LO8A 3FLPA 4DRRA 2AC1A 1REEA 4CP9A 1SPPB 1NYWA 1YWKA 3BIWE 4MZUA 3HBKA 2YC2A 2HWF1 2VMHA 3M3IA 5BYNA 5GZGA 1JI6A 1NLRA 4CP2A 4EN7B 2R0FA 1EV13 4M4PA 4LE4A 4OHXA 1RUI1 4AQSA 5CEHA 3RZHA 1A3KA 4KBZA 3RWKX 2BW8A 5FP9A 5FUPA 2E6VA 3AMQA 1POV1 3QOPA 4OI4A 2C6SA 2R0HA 4UYBA 5FZDA 2G19A 4NRMA 4S2GA 3URFA 2UY8A 4W6WA 4HVRA 4UWDA 3RFRA 2ZX0A 2D6KA 5T5LA 1UXZA 2Y38A 4LHLA 5FZIA 2BOIA 2B46X 3FFZA 5EIYB 3D82A 3HQXA 3T1LA 2BRTA 3WNMA 4MGKE 5FZAA 3VKLA 2CU5A 1OFSA 4CU8A 2D5HA 4QB6A 4OUMA 4LPLA 3ZDSA 5FYTA 4FPFA 4N9HA 5FXWA 4RGGA 3OTFA 3WLUA 1TE1B 2IXIA 2ZHMA 2H6CA 3GHMA 3NNFA 3S6PA 3DXTA 3ZN6A 5BNOC 1W8WA 1LR5A 4O9EA 5FYMA 3VD4A 3M1HA 3IAPA 1B35C 3KHBA 4LORA 1FATA 4GKYA 1PHMA 3FMGA 3J8F1 4Q4Y2 2WINB 3NRUA 2P3IA 3MIGA 3GJBA 4JQTA 4QPYA 5KHJA 1FYUA 3ZPOA 4BXFA 1PVXA 2XJUA 4RA0A 3U37A 4KI5M 2E51A 3AKQA 4QDSA 4IW3A 5FPUA 3AVSA 5LWBA 1W99A 2XOMA 4AVBA 4DS0A 1ZBE3 2A1XA 3BALA 4I0AA 4PIYA 4BPZA 2MEV3 5JI9A 2P2KA 4WM7B 1HB4A 3VZLA 4QMAA 2XLFA 2X5IA 1DFQA 2VGDA 1LU1A 3VBOA 4CDXC 2VQ0A 4AI9A 3ILFA 1N1TA 3NW4A 3WDVA 3D8CA 1QY4A 2P17A 1W05A 5ERLA 5CFCC 1W3XA 1FMD1 3L2HA 4LBQB 4UT5A 1VMHA 3VD3A 2JECA 1R64A 4IE5A 1UZZA 3AKPA 1VR3A 3AZZA 3ZSKA 4G4FA 3ZXKA 2PTMA 1XU2A 3J9SA 4AZZA 3PU3A 4O65A 5FO7B 5JWPA 4INDA 5CFCB 1KD7A 1RUG3 1VRH3 4FVVA 4B29A 4GALA 2JDKA 2DVFA 1OBNA 2YMZA 1JOBA 3PU8A 2WWSA 1QKQA 4JTNA 4AOCA 1WKYA 3TAYA 5IK4A 1WW6A 1CAVA 3AP7A 2ILMA 5GKAC 3FHAA 5A32B 2D6OX 3J8F2 5FPLA 1ZRFA 4GB31 4BB3A 4CDXA 2RDNA 4CU9A 1EAH3 4IGQA 4BM8A 3WP4A 5CG8A 2VCBA 3U11A 1M4WA 5FJKA 1NXD1 4LKEA 4LBKA 1IGOA 1CD3G 2Z5WA 1CJDA 4BQWA 2V5YA 3SLIA 3U10A 3UKTA 4DY5A 4JHTA 2JG9A 4MGTA 5EFUA 4UFJA 1CZTA 1OT5A 4F83A 5FV3A 5J3UA 2Q8EA 2Y6HA 2XDVA 3O1OA 4XDPA 3ZO0B 1JYXA 5LRSA 3PJQA 2RHPA 3P1IA 5LBEA 4QGMA 4LBJA 3A22A 4NHYA 4MHUA 4IEYA 3SXWA 1XNBA 4H7MA 3R4SA 5BNOB 3ZSMA 2DVDA 4J1WA 1CX4A 1NAEA 5GLWA 1B09A 1VIWB 4GZ9A 1RINA 4CA9A 1R083 3MV11 4Q1RA 5ISLA 4B3NA 3BTYA 2LS6A 2IFRA 1NY71 4KBBA 3WQBA 3OYWA 3VBRC 2NN8A 3DEMA 1TNRA 1CAUA 1Q8PA 4C0HA 3L9JT 3HN1A 4UXAA 4XETA 2KM2A 1ASJ2 5LA9A 5T5PA 1NG0A 4D7SA 2JDHA 4C1XA 1PX3A 1TZOA 1S0EA 5E16A 4LLOA 1LAJA 5F3CA 3HPNA 3O1RA 1XJAA 4WM7C 4ZZ8A 3I7DA 4FFIA 2FZ2A 3POGA 3J4UH 3WUCA 1VE0A 5JMCA 1ZZ8A 2HYKA 3RYKA 2EXKA 3ENRA 3LEKA 4Y4YA 4YG0A 1EV12 1LKNA 1VMJA 5DN2A 3LA2A 3SH5A 1BEV3 1PVC3 4RR3C 2ZTNA 1QXPA 4RFT0 4I0WB 3VBRA 3KLSA 2A70A 3K77A 1JYNA 2RJKA 4LO7A 2RS12 2PQQA 2ARXA 1IQAA 5LBCA 2F6BA 1ZZ9A 1WCSA 2VBPA 3GM8A 5C3QA 2HLEA 3D4KA 4LQRA 2XVGA 3N3HA 3PMSA 2BWCA 2RS51 5F5AA 1COV3 4RYDA 1I5ZA 1WLTA 3GHNA 2ZOEB 1T2XA 3NAPC 4WM7A 1KJRA 3TBDA 2XL7A 3PUQA 4JC1A 3SKVA 4OLLA 4QX5A 2VOKA 4TSVA 3SH3A 1D4VB 2GNBA 1X7NA 1AR83 3BYWA 2VUJA 2EAKA 4QPGA 5FYZA 5C3PA 2GH2A 1TMF2 2HKXA 3B69A 1JYTA 4XURA 4Y33A 3S5QA 5GZFA 1RVF2 4N43A 4AXOA 2CDOA 4AVTA 2HWD3 4QM9A 2ZEWA 3LE0A 1FT9A 4EE2A 4RS5A 2Z42A 1GOGA 3NAPA 5J36A 4BU2A 3SCHA 3WQ1A 2VOXA 2XQRA 4A45A 1A6CA 1IPJA 1KRIA 4JGYB 5FCCA 1AJOA 4AQTA 5A3OA 4P14A 2AENA 2XUEA 4J6GA 2VBBA 1LHUA 1H8TC 1MQTC 5APAA 1SLIA 4RD7A 1VBB2 2P4EA 2QBXA 4Y1ZA 4R9DA 1YC61 1CPMA 4XJZA 5DABA 3U1XA 3WNKA 2YC0A 4P9WA 4DUXA 4Z82A 1AYN2 5IAXA 3H8XA 4QPGB 1A8MA 4BIOA 4FPHA 2G9FA 4XDOA 1UQXA 3CIHA 4RS5C 5F5CA 5IJRA 2I45A 4FFFA 1VLNA 4FOVA 4GH4C 4HG6B 2R30A 2XBO3 1W6NA 1UPIA 3PLQA 1SFYA 4FO9A 4G3YC 1JZ2A 3I2OA 4LUMA 2FDHA 5FY0A 5J37A 5DZGA 1PNFA 1J84A 2CWMA 2YGMA 4ORFA 4YVSB 4DB5A 3GBGA 4FTSA 4A44A 3IDAA 1PGSA 5I8SA 1YO8A 1MQTA 2R1DA 4HT1T 1ZVFA 3MFCA 4QPWA 2BP6A 1AR81 1F4HA 3HNYM 4UFMA 2ENRA 3IPVA 3I59B 3AM2A 4LBQD 5FYIA 3I49A 2TNFA 4UOJA 2VPVA 5C7GA 3ME2A 2QTWB 1A78A 3T4VA 4XJWA 4AQ6A 1WA6X 2GDFA 3LAGA 2WDBA 3NV2A 5M0TA 5HCBA 2WA3A 4EV0A 5FO9B 3EJKA 5F9TA 2ZBJA 3LA7A 3SEEA 3IMNA 4PT6A 1GICA 1SPPA 2DUOA 5C3RA 1CGPA 1COV1 2AEZA 2EIBA 3AMMA 4RQPB 3V65A 3NKGA 3O12A 5CVRA 4CXWA 4LE3A 2P5BA 5BXXA 5H9SA 1Y43B 1HB3A 1HQLA 1PM7A 2F4PA 2VNRA 3POWA 4PIXA 1TG7A 3S0MA 4WVMA 3A0NA 2WS93 1W6PA 4HLTA 5JOZA 3JBG2 5C4WC 3RDIA 2OXBA 4DUVA 4XDQA 4KWLA 3TNPB 2F4LA 2WFF3 1BEV1 3KF5A 4IEOA 3PUSA 3SNMA 2A7AA 2NQYA 1EPZA 4BMBA 1RUE2 1ND3C 5A6ZA 1POV0 4A3ZA 4U2AA 2ATFA 2QKDA 3IPVB 4LUKA 4QAWA 1JMUB 2VR4A 3ZFEB 1LOAA 3CLPA 2DCYA 2YBSA 3DUIA 5AFEA 1QJY2 2XKPA 1C3HA 4Q8KA 5LA2A 5DDJ1 5FY8A 4DIQA 2HWD2 2VMDA 3IM0A 3PURA 4Y1UA 4AEKA 3ZFEC 2QVSB 3ASIA 3WW4A 3M2MA 4PDWA 4XJUA 4JGZB 3SMHA 4BZ4A 1J1LA 1PZ9A 1W0PA 3ZMOA 3NVCA 1UF2C 1CESA 5DUWA 5IVFA 2MNGA 4E27A 4NIGA 3KV5A 3HVDA 1CJPA 4GMP0 4JGZC 4H14A 5F37A 4YW5A 2HWC1 4CDWC 4Q1PA 4IV3B 1CX1A 4V2VA 2BGPA 2YB7A 3VLBB 3C7HA 4LMFA 5IWFA 1V00A 1W6QB 3M4FA 1ULPA 2W5FA 4HSLA 3ZR6A 1UZ0A 2JIJA 4NE9A 1CAXB 2WC2A 4MGZE 4NWWA 5HI0A 5FTTC 1IG3A 4G9SB 2ZEYA 2GC3A 2IWGB 3PNAA 3WX5A 4YVWA 1BBT2 1N3OA 1XU1A 1XE0A 4OZOA 3IIIA 4KNCA 5C8CA 2W1QA 1UO9A 2BFUL 2XBO2 3DV8A 1BK1A 2UWCA 4F7ZA 2DFCA 1CVNA 3AP4A 4YZ3A 4IEZA 2XPJA 4XCBA 2JG8B 1U5ZA 5I0DA 1MZ5A 3IKWA 5A3TA 3CU7A 1EAH1 2YV8A 3VBFA 2W52A 3MGUA 4GB33 1J58A 2D3PA 1LENA 3CJIB 3LDKA 4RQPC 3TWIA 2DCKA 3FFQA 4YZ1A 4IGOA 4F8AA 1J3RA 5FZLA 5FPVA 3T3YA 3P3NA 1LOGA 1VRH1 4E9KA 3BKZA 2D6PA 1C8NA 2Z69A 2GP5A 4KGQA 1NCRA 1G9CA 4NROA 1AR92 5IVCA 2FDFA 4HFSA 3PIGA 4L99A 2VTXJ 1FMD3 2DTYA 5GZEA 4AWDA 3ZYRA 3LOIA 4L0PA 1UIKA 3RJ2X 5A32A 2Y0IA 1QNYA 1UU4A 3QCWA 3VKMA 4OI2A 3N36A 4CPBD 3EQEA 3VZMA 4LO5B 4ITCA 3MI8A 4YSFA 3AMNA 2RJ2A 1Z0HA 1IZ3A 1UZYA 5T50A 3CL1A 1GWLA 2JG8A 4I3PA 4META 4RQPA 1ZBE1 3NJZA 4HMZA 1G9AA 1YQ2A 4RGAA 3NNMA 5DUXA 4HVQA 1VBD3 4URTA 2R1BA 4FI9A 1ZBA2 3TEWA 4N7UA 2CAVA 1BMV1 4BHPA 3NO8A 3AMPA 1V6KA 3WVJA 3WP5A 2DYCA 3RZLA 3WZ1A 5J98B 1DDLA 4YW4A 4DXRA 3BTAA 5LASA 4QGNA 1G9DA 2A6YA 3AFGA 1KS4A 2EIGA 4IV3C 1OD3A 4Y20A 4Y22B 2WWUA 2YU2A 5J7MA 3U4XA 1RUD1 2H0BA 3HAGA 3KS7A 4CEWA 1UMHA 3PUHA 4M01A 4Y4RA 3OYWB 1MS0A 2DVBA 1OOPC 1CAUB 3RZMA 4K1YA 3KF3A 3E97A 3R05A 3TEXA 4XQDA 1CPNA 2BNMA 1PZ8A 3L2YA 4NAOA 3RWNA 1R1A2 2VZRA 3E6DA 5JSPA 5FKCA 1S2BA 1NLSA 2I07B 3O7OA 4HK8A 1AHSA 4ASLA 4BIFA 4XMAA 5DPNA 5FZ3A 1UN1A 4LITA 3LGRA 5D2AA 2XJTA 5JIAA 1C28A 2TEPA 4PF5A 4K8FA 2VJXA 1LOFA 3DPRC 4DRVA 5A1AA 3CJIC 1GNZA 2D7FA 4M0NA 5JDBA 1C8M3 1F35A 1H6XA 2VNVA 4XF1A 1RUI3 4QX3A 1EV11 2IVIB 2D93A 3T1MA 1S0CA 2VULA 2HWF3 1W0OA 2YHJA 4XJ8A 5JIUA 4Z2AA 4TTGA 3CZUA 3IBMA 2VMGA 5A6YA 3I3EA 3UK9A 3G7DA 3DN7A 3ZIXA 3VZNA 5A3PA 3MDPA 4JGYC 4C90A 2CGPA 3QD6A 3ELNA 2D6MA 3VZOA 1LOFC 2DCZA 1LHVA 4FPOB 3ZSJA 1W2AX 3KVAA 4A41A 2WNUB 3OOXA 4UFHA 3ATGA 4LIUA 2Q1MA 3DYPA 3H8RA 1ZZBA 1AYM1 4FXKB 1SDDB 2DBIA 5FXXA 3WP6A 4PBOA 1URXA 1AR73 1ND2C 1BKZA 3Q9OA 1OUXA 1WBLA 1XE7A 5A7OA 5IYYA 1RUG2 1V70A 4NOTA 3AZWA 3CMGA 4YYOA 4BQ4A 5CKNA 3FWEA 2NM1A 2QQUA 4CCLA 4Q4V1 3C7GA 1GU3A 1DBNA 2YFUA 4IEWA 4XZPA 1V6JA 1QH6A 1KITA 1RUJ2 1ZZ7A 5FR3A 4JGYA 3WCRA 2YZ4A 5J48A 4QPIC 4UFIA 4YVSC 1R1ZA 3O0WA 2JB8A 1PO13 1LHOA 2FD8A 1W06A 3Q8CA 1WUVA 2W68A 4QDRA 1VRH2 3KB5A 3FC0A 4C0BA 4WM8B 2ARBA 1PIV1 2PLV2 4FQ4A 5L7OC 4GQ7A 4AI2A 3THPA 1ULOA 1RTVA 2QDRA 4A42A 1R091 4YW2A 2DU0A 5ACA1 2VNGA 1MS4A 3VZKA 3RRDA 1W03A 2Z4FA 4Y22A 3ROUA 2WAAA 1WLWA 1XB9A 1C1FA 4BJ0A 4BQ1A 4QPIA 3VBSA 4LHNA 4EYUA 2R7EB 2G9GA 1SDWA 3OBTA 1MACA 3H50A 4Y5SA 2VZVA 4NHXA 2JD4A 4EN0A 2VZPA 3RSJA 2RVAA 1F31A 2HWE1 1FV3A 5FYYA 3WINE 3POSA 3UKVA 2PHWA 1LHWA 3BN6A 4BQXA 1MS3A 1ASJ3 1RXGA 4I0BA 5DZFA 5FP4A 4LA2A 2Y6LA 2QNKA 2AACA 1IKQA 4Q26A 3V0BA 2LRPA 2PHXA 1QJU1 2ZAHA 3DL3A 3WNPA 5CYYA 3J7LA 5F6LB 2VE1A 1QOOA 2A6VA 2AH2A 4RHV1 3NJVA 3S5AA 4TWTA 1PK6B 3T0BA 2HBUA 2BGCA 1UOGA 2E33A 2WFPA 1WGPA 4Q0QA 1JTZX 1J1TA 1IS5A 1SLLA 4YNIA 3ZVXA 2GAUA 4UBHA 2EF6A 3OD4A 2WT1A 4MXVA 2QQOA 4D8MA 1QHDA 3OBZA 1VMFA 4IXLA 5FPZA 3ZSLA 1PMHX 2BEOA 3HR9A 2ORZA 3POYA 3ZMNA 2IVJA 1BBT1 5KXDA 4AFAA 2B39A 2HJIA 1Z7S2 5IUQA 3TN93 1JUIA 5LRRA 5A7QA 4COYA 3KD4A 4CE8A 1F2NA 2J1EA 2HWB3 3OD0A 4PCRA 3T2QA 3HQUA 4CCEA 5FUNA 4Q2FA 2BQPA 5AVPA 5FYHA 4FPKA 2A3YA 3KCCA 4MX3A 1NA1B 1OQEA 1ZZCA 3O14A 2ZPXA 1T6BX 4LKDA 1G9BA 1GR3A 2YPJA 1CAWB 2D3SA 2KXLA 3KV4A 1EY2A 4AI1A 2W0XA 3H1MA 5A3WA 4NMIA 2WA4A 1RIRA 5LY1A 5KHGA 2D44A 4XXAA 2YU1A 5GJ6A 1XNAA 2VTXA 2W08A 4AR2A 2ZXQA 1O4YA 1VALA 1DGWX 1G8WA 1RUH1 5IK5A 2WWJA 3GXUA 4NPRA 4Q4X3 3TEYA 4COUA 4JQRA 4PF1A 4OMDA 4Y5Z0 1H8VA 2XR4A 1C1LA 3N7LA 3K3OA 4NVPA 1YJKA 4CDQA 4K6BA 4WZFA 3KGZA 3GBFA 3UGFA 1WD4A 5IFPA 1GV9A 1L7RA 2ARCA 1LOBA 4MOAA 4AGRA 1WA4A 5CADA 1XNDA 2ZGQA 5DAPA 4A4AA 3JD73 3PVNA 1TVGA 3H42B 1QQP2 1OHFA 4MGYE 1APNA 5FOJB 2YG0A 5KWRA 2JICA 2RR11 3RMXA 1GP4A 1QJU2 2B45X 3CKHA 4ZS2A 4NN0A 3VBUC 5HPOA 2BPA2 5KR7A 5CFDA 1QQP1 1VBE3 4WZCA 2ZX2A 3ZFFC 3WW3A 5LBBA 1DLLA 3I4IA 4IEPA 1C5IA 1XYNA 4KQ7A 1XSQA 2I74A 2J42A 5CB7A 4CDQC 1ULCA 2XLGA 1HQNA 2PN5A 4RR3B 5A33A 3NKTA 2ZGLA 4WBBA 1W39A 1OPMA 2BV4A 2UU8A 2VM9A 2WQ4A 5FBJA 1LULA 4HVOA 2XVKA 1POQA 3ZYGA 1H6YA 5BNNC 4E2SA 4QQPA 3W5MA 1YEWA 1UXXX 3H7YA 5E6HA 4SBVA 4D3WA 1MS5A 4W50A 2V73A 2VY0A 1AYN3 1NZCA 5CFDC 5LA1A 5A3NA 4QQHA 5EPAA 2VZ1A 2YC4A 3ZFFA 1RHI1 1WCUA 5EV7A 3AP9A 2IXLA 4DEVA 2D98A 4XXPA 5AC93 2YGLA 1HRI1 1N47A 3KQRA 3THDA 5J1XA 3DECA 4B8EA 5A3UA 3ZXGA 4XBLA 3BODA 5FAXA 4PLNA 3VBOB 5D21A 3DCQA 4MVTA 5FPAA 5FZ6A 1O8PA 3CJXA 1ZYBA 3AYEA 3KM5A 2YPDA 5JOXA 1GSLA 2V72A 1GNYA 3T08A 3WOGA 2E7AA 2R063 1AXZA 4E8CA 1OKQA 3KSCA 3HEIA 5CU1A 3RPQA 3NMBA 2W46A 2WZR2 3I2IA 2JDZA 2YUEA 4TLGA 3BTXA 3B01A 5HCHA 5DQ0A 3O1TA 1B35B 1HRV2 2KR2A 3I2GA 5HXVA 5LY2A 1S0IA 3AB0A 4LBQA 4LJHA 3ZFGA 1HIXA 1K5JA 1RUE3 2XQXA 5DG1A 1FPN3 2XJSA 1UY1A 1W04A 5JPNB 4XUOA 1F9KA 3ZXJA 5B4NA 4E8DA 2DF7A 2ZMNA 4XEZA 4AFDA 4YZ2A 2NMNA 3O1MA 2OS2A 2FQPA 2GC2A 4FOYA 4IESA 5K0UB 3H0OA 2VNOA 3W20A 2J7MA 3I59A 2WNVA 4GAZA 4XUQA 4B1LA 5F7UA 1H2KA 1HXS3 1GMMA 1V6NA 3IB3A 4GWMA 3H3UA 1CAVB 4FP2A 2CV6A 5F32A 2VOWA 3VL9A 3H1YA 2ZKNA 4YG3A 2DURA 5F2SA 3ILNA 3LEMA 4KH9A 3SQOA 4L8QA 5FLHA 1VBA1 1YRZA 1PO23 3FL7A 2ZHNA 4AI0A 1H4GA 1BQPA 5A1LA 2VC9A 5F39A 3R4UA 3K48A 2Q1ZB 2WNUC 3I2KA 4N8MA 4COZA 2WL1A 5FMOL 1Y3TA 2FBEA 4QX8A 1W6PB 1Z7S3 1I1EA 2O1QA 3WDTA 1UPSA 2WYSA 4EWEA 3I2JA 3I2HA 4N7IA 5L9BA 4XIOA 4CCMA 3HWJA 2HWB2 1H9WA 3VDDB 2ET1A 3H3ZA 1RUC3 4HPKB 3DKWA 3AYAA 5DAWA 5JXJA 5DZEA 2VCAA 5KHIA 5IVYA 2CDPA 4LIVA 5FMCA 2EXHA 5LW9A 4NR1A 3LOBA 4L2NA 4M3CB 3NSTA 1WZXA 3WT3A 1MPXA 2CTVA 1J3PA 4COWA 3E5QA 5A7PA 5JR7B 5C6CA 1W6OA 3WNLA 2QQVA 4MGSA 4SLIA 2JDAA 2ZMKA 3MLJA 2WNUA 4OZXA 4PIZA 3EBRA 1ULDA 2FZ1A 2AR6A 3VKFC 2OUJA 4K1ZA 4B7KA 1ZM1A 3B9IA 3HBZA 1QGLA 4P9LA 4AF9A 1BVVA 2F17A 3MUY1 3AX4A 3IDEA 4QX7A 3QLQA 5H9RA 1US3A 2BBVA 4Y1YA 2ZABA 4MADA 1XNTA 1RXFA 1DZRA 4Q0PA 1KEXA 4Q4W3 3CEWA 3WF0A 1BMV2 4MGQA 2DUQA 2RM23 4IDZA 3SH4A 4C8DA 1JYVA 1P8JA 1RHI2 3GCWA 4MXWB 4PLMA 4CP0A 4CSWA 1O6UA 1DG6A 1CAXA 4HPKA 1PGW2 1HKDA 2B8MA 3I3QA 4AEJA 1DYOA 1WMDA 4YGDA 4JDOA 5K0UC 2JDYA 2W95A 2XJVA 3FZ3A 1O59A 1FXZA 1QJX2 5GLUA 4OI1A 5C70A 1VAVA 1UZWA 2OIIA 2Q0AA 2X10A 3WXPA 1YFUA 2CHHA 5EWSA 4Y26A 1NE4A 2WN2A 3FLTA 2WRAA 3GZUC 3MO4A 5F5IA 2RMU3 1FPN2 1S1AA 2DCJA 2PHFA 1Q56A 4CCJA 4W6XA 3KHCA 4Q4Y1 2EALA 3QH7A 4R9BA 5LEKA 1H1MA 4CEYA 2JJ6A 4KU8A 4GH4B 3MW4A 3VBSB 3POBA 3BTZA 3MEPA 1ZZ6A 1UKGA 1BLZA 3GJAA 2QQIA 4GB32 1LEMA 4JKKA 2OUHA 5K0UA 1RMU1 1H0BA 4N43B 2DBNA 4MHRA 3AP6A 2WNVB 1NT0A 1X50A 5F3EA 2RS31 1BEV2 3ABZA 3MW3A 3ZN4A 1AX1A 4FFHA 2GMEA 4V1PA 2JE9A 4GMP1 4FAHA 4HBNA 2WT0A 1A34A 2IFWA 2ERFA 4XTMA 3DKQA 5L73A 3WD5A 5LA0A 4IETA 1PZ7A 4OQ8A 3GBWA 4AE2A 3N7JA 4CP1A 4DUWA 1HDKA 1C57A 1Q8SA 2QQWA 2V5DA 2KD7A 2VO5A 2QJVA 5C3OA 1SMVA 1KDKA 3NNGA 1O91A 2VOVA 4IEQA 5ANQA 1GNHA 1BVP1 2R043 5FY7A 4D6SA 2UWBA 3JQXA 2OYZA 4YW7A 5FZ4A 1SZBA 2W9XA 3USUA 1HLCA 1E5IA 2ORXA 1HV0A 2GN3A 2VQTA 2VQUA 2A6XA 2OPWA 2VCCA 1DF0A 4KG8A 4L92A 4QWNA 1K42A 4CUBA 1JH5A 1LGBA 3KCXA 3OPWA 5IFTA 5L36A 2QQNA 1SFNA 3LDRA 2DVAA 2VL4A 3ZXAC 2WZEA 3I54A 2RMU1 3AFKA 3FUOA 3H7JA 5AVAA 4AFCA 3ZYPA 1Q8OA 4QM8A 4AGVA 2WYFA 1X33A 3VBUB 3WHTA 1SHWB 2RM22 3EO6A 1ZA4A 3FBYA 5FPBA 4CCNA 2W39A 1W8NA 2ZGUA 2BJSA 3A21A 3SCGA 3O1PA 1H2NA 1IS4A 4BE3A 5C5TA 3CO2A 5CBLA 2PYTA 2VG9A 1YIPA 4QU1A 1W8UA 2VVFA 4CDQB 4UAPA 1GP5A 1OMIA 1QJX3 3HNMA 1YQ5A 5FZ8A 3UGGA 3WP3A 2UYAA 5BNOA 3IT8A 1Y9MA 4XF0A 3QACA 1W2UA 1LU2A 1H4HA 1PMIA 3CHXA 1YNAA 2P1BA 3OSDA 3AKRA 1DGRN 1UOFA 5JSOA 5JXHA 3B94A 1XC6A 1DQ0A 2IXJA 4QKFA 3OY8B 1WWYA 3N35A 3PDQA 4UW5A 4LXLA 5CNAA 4ZU5A 5IVVA 5HCAA 5H9QA 5CFDB 3OEAA 2GNTA 1GWKA 1RUI2 1K12A 3W5NA 1FX5A 1MR5A 3KQ4B 3C3VA 3FBMA 1UD1A 4NHKA 4YRDA 5DXDA 5B2GB 5L19A 4PQ9A 3UESA 1SEFA 5HV0A 1DIWA 3DPRB 1Z78A 2B9UA 2RG4A 2EICA 1RUJ3 2ID4A 2SLIA 1YQ6A 2ZX1A 3KT7A 4CEYB 2X5IC 2HWC2 2P6CA 3VBOC 1X82A 2XHKA 3USSA 2CY6A 1WMEA 1RUC1 4KG0A 4PDWB 3VDCA 1V9U3 4AEDB 1C4RA 1IG0A 1UX7A 4L97A 5CFCA 4FT8A 4URAA 4XBNA 2VAUA 3D0SA 3D3AA 3HMYA 3HN3A 3OG2A 4YG6A 5EYYA 4ASKA 3ES4A 1GLHA 4PBPA 5FWEA 1OUSA 4CZSA 4DO0A 4XFBA 1S0DA 4XABA 1X8EA 1JHNA 2W1UA 3E6BA 2C4XA 5KC5A 1VBB1 2KA3A 1YFXA 2XUMA 1YCIA 2PHUA 2AREA 2RS11 1PO21 5GLZA 1VBA3 2P37A 5JI7A 2NPIA 1UKRA 2YFZA 3ALQA 4IE7A 4YM2A 3VN4A 5JZGA 3I2DA 1K5MA 4OVEA 4GWJA 3U78A 5IVJA 2DVGA 3WNOA 2P6HA 1DGRA 4UW4A 1HXS1 4Y1VA 2B9VA 4N53C 4H55A 1EYBA 1D4M2 4D6QA 1OA3A 1ND2B 3R0RA 3LSDA 3O0XA 1QJY3 1XOYA 4I30A 3X29B 3K4DA 5GLVA 2GNMA 1S0GA 4CDWB 4D7TA 2ZJCA 3Q8EA 4KWUA 1LESA 5FP3A 1FPN1 2FDIA 1QH7A 1MEC1 1ONAA 1RUE1 3OJBA 2WN3A 5JOWA 1OPOA 1IKPA 1W28A 2J1TA 4LBLA 2JIGA 4Y5TA 2PAMA 4LA3A 1HJGA 5JZGC 3AXDA 1JXNA 5DAQA 1VP6A 3AZXA 3B3QE 3DXUA 1UU5A 1VBC2 3J26N 3HT1A 3ZXDA 4ONUA 1R1A1 2PHDA 4LOTA 1TEIA 2CWSA 5G05L 2R061 4XQWA 3UGHA 5C3SA 4YPJA 1CWPA 3ZXEA 1AXYA 4IE0A 2BNOA 5CAZA 2DU1A 1XYOA 2Q8CA 3D6EA 2XWJB 2ZGNA 4BQYA 3EB7A 2RV9A 4EZ4A 3F2ZA 5I91A 3DGTA 2W1SA 2JDPA 2ZZJA 1SG3A 5HCFA 1RUF1 1HRI3 2WS92 2A6WA 4M3CF 4XVHA 4HZFA 2LROA 5FZGA 5FO8B 3TOJA 3HIFA 1ZNPA 4Y20B 2WFF2 1SCRA 4I01A 1Q3EA 1AYN1 3LQCA 1YLLA 4OQ9A 4AFBA 4CCOA 1NUKA 4XZUG 1JYWA 3OGGA 1YHFA 1D0GA 4GJZA 4DY3A 1D2SA 1NXMA 1FAYA 3NQHA 4UW3A 4AHWA 4V2WA 4ES9A 4P5YA 3ZYBA 1ACCA 1NQJA 1XBFA 2E31A 4ZU4A 3AKTA 3WV6A 1QWRA 5H9PA 4NHLA 4K40A 2OT7A 1DZTA 1ZRCA 3BOWA 4FCAA 1DGWA 2P3JA 4H3WA 1QXRA 1D4M1 2GMMA 3OB8A 4ZS3A 2G9ZA 1OH4A 2QDNA 3GZAA 3S7EA 1GQGA 2FCTA 1ZBA1 2D97A 3J7MA 1QQP3 1VAMA 1VBE1 1W2OA 4X6QB 3KZ4C 1YYNA 5C9AB 3N9QA 1JN2P 5FUIA 1S4CA 1X9PA 1ZBE2 4QPGC 5IVEA 5EZWA 3WCSA 1VBE2 2WJSA 2WZR1 3KT4A 3RYRA 3JD71 3C7EA 4IUGA 4WVMB 3SC7X 4QQOA 4AW7A 4CUAA 5C9AC 3S7IA 2VZSA 5FZCA 2XJQA 2W94A 1FV2A 2QQKA 2Y6KA 3RI9A 2CYFA 3MPBA 1HQWA 1QNWA 1F5FA 1NA1C 2X05A 2O0OA 1SACA 2O14A 2WIIB 4TYSA 4Z1VA 3NNJA 5JZGB 1GZWB 4X8NA 4Q4X1 1RUH3 1K5MB 4W6YA 1QMJA 2IXCA 1DQ5A 1E5RA 1I3HA 4NIAA 4ASMB 3KVBA 5FZHA 3ZM8A 1FNYA 1UY0A 1DGLA 2PHLA 5EJZB 1KQRA 4AI3A 3PL0A 5DUVA 4X8PA 1GOFA 4YFZA 3POIA 5C9AA 1OLQA 4LR4A 5FZMA 2J1RA 2K9ZA 2YROA 3FJSA 3V56A 5BV6A 1NCQA 3H3LA 1YQCA 1H1AA 2AGSA 2JX9A 2GC0A 3LFMA 2RDQA 3HJRA 2C0ZA 1QEXA 3INAA 4LBOA 4IE6A 4GH4A 2K46A 4AL9A 5IK7A 4DEQA 1NOVA 3AXEA 3PTRB 1DU3D 3VBHA 1GZ9A 1JS9A 3TEZA 1XNKA 2JWPA 2JE8A 2W47A 5C4WB 1ENQA 1G86A 4AHYA 2R062 1REFA 2GH8A 5E88A 3WQ7A 4BK4A 2PHTA 3ZFFB 4GWNA 1XRUA 2BGOA 1RITA 2XKOA 4HKWA 2EA7A 5C8CB 2HEYF 2RR12 2BVVA 3ZX7A 3AZVA 1HRV3 3OGVA 1S0FA 5E8AA 3GCXA 4AAXA 3I3MA 3ILRA 4RHV3 1NCQC 1VBD2 1PGL1 3OBAA 1HB2A 2ZZQA 5FK8A 1O3RA 1OVSA 2TUNA 5F3IA 1VAKA 5JUVA 5SV5A 3UJQA 3VBHC 3UNPA 3UYJA 1F15A 1ASJ1 1WD3A 1BXHA 5CISA 2RDSA 1UYXA 3J7HA 3MLLA 4HONA 1PK6C 1HB1A 4WM8A 2Q5TA 2VU9A 3NL1A 4ZXEA 4QX1A 2HWE3 5FZBA 4BQ2A 5LEJA 2XJPA 3HOBA 5C8WA 1B35A 2D6NA 2QZ2A 2GP3A 4XFIA 2GSYA 1COV2 1OQ1A 2CGOA 5C4WA 3OBRA 3DF0A 4DZGA 3RS6A 5JAXA 5JCTA 1ODNA 2WNEA 3VHNA 1IQDC 1VRBA 1QOSA 4I2OA 1VBC3 2O8QA 4L9BA 2PA7A 3ZSEA 5JLVA 5ACA3 1ND3A 4E4DX 1R093 3WY6A 4IGPA 4PJYA 5IATA 3JBG1 3VDBA 2G4IA 2JB4A 1XNCA 4MH0E 1PIV3 2PHRA 1W8HA 2BWAA 5F5QA 4A2UA 1AR82 1NLQA 1PGW1 1PK6A 4WM8C 3WDYA 4XFCA 3PVOA 4Z07A 4BA6A 2DTWA 3VZJA 3ZN5A 3VHOA 3FN9A 5A70A 1RVF3 5FYBA 3ZYIB 2ADEA 3GDBA 4YARA 4L11A 1W2NA 2VXRA 3EHKA 3MPPG 1PO11 2GN7A 1WW4A 3A7QA 1UU6A 5FMBA 4FAGA 4CP9B 5K7PA 4BK5A 3FLRA 1C8M2 3MW2A 1W6MA 1YFWA 5D8AB 4IV1B 1AX2A 1SBEA 4Q4W2 1JZ5A 1AL23 3LKJA 1UYZA 4XQ4A 4Q4V3 2L9LA 1YUDA 1SLBA 5FZOB 1KFUL 1DQ4A 1BJQA 2PLV3 1PO22 1FOD3 2Q30A 2CL2A 3MIFA 1TQ5A 4NJ4A 1PGL2 3O1SA 1TMF3 3J7NA 3POJA 1N1VA 4IV1C 1WBFA 2XWBB 2VUAA 1V6MA 5CKMA 2P34A 1TME3 3OY8A 1QF3A 4R9CA 4XJAA 3KGLA 4BDVB 3T2OA 4HSJA 1BYHA 4YVWC 1X36A 5FK7A 4COVA 5C8CC 2DUPA 3K46A 1IS3A 4XCAA 3LPGA 2QCSB 1OURA 4XUPA 1V6LA 2XMLA 2Y6JA 1FNZA 4QD2A 1KGYA 2JG9C 5LB6A 5DG2A 2ARAA 3WF3A 4OULA 3V0AA 5A7SA 4XILA 3VBFC 1AR72 1Y9GA 4HKOA 3P3PA 2ZGTA 3MUZ1 4QKDA 4DNYA 1UL9A 1TME1 2P3KA 4AI8A 4IV1A 4CXXA 1MS1A 2BYVE 1OA2A 3ZKUA 4XFHA 1QJEA 4LTAA 3T09A 5BUVA 1JODA 1TMF1 5LK5A 4D7YA 3VDAA 1C8M1 1FOD1 2PLV1 2BNNA 3EYPA 4KL1A 4ZPIA 1GYKA 1AL21 1UY3A 2J1VA 3OGSA 2PMWB 2OVUA 5IK8A 3POEA 3OUJA 3FHIB 5JVVA 5LZ6A 2JKBA 3ACIA 1HN1A 3WUDA 4XUNA 1GQHA 3POFA 4Q5OA 5CA6A 5I0RA 2VQAA 2QQMA 4YGEA 1SQ4A 4ARYA 1RVF1 1CIYA 1Q8VA 2QZ3A 4GJYA 3FHQA 3R4DB 4NPMA 5E1RA 3ZR5A 1NQDA 4UI9L 2YY1A 1Y9QA 3LB9A 2MHFA 4GD4A 4BXSV 3VB9A 4HK9A 3AP5A 2GALA 4XBQA 2I2SA 3JBG3 2OKXA 3RGBA 5LK7B 3MYXA 4BMEA 2FMYA 2Q4SA 4D0QA 1VBC1 2ZKLA 4TZDA 2ZA9A 4QKBA 4U36A 4CPBA 1XE8A 4RR3A 1DZQA 3N9PA 1RUD3 5IT6A 4XFAA 4M0HA 3WSOA 1UMIA 2AYHA 2WZPP 1XPWA 1RJ7A 3UKNA 3ES1A 3MF6A 3WW1A 2UY9A 2V4VA 1WMFA 3LWCA 4XF9A 2AEYA 5F8PA 2B5HA 5CG9A 3PVBB 2D40A 1M06G 1VBD1 4XJ9A 5KXCA 3MBWA 3ON7A 3E1F1 3U14A 4H2AA 3AL6A 2GNDA 1MS8A 3GALA 2NP0A 3U0ZA 1V6OA 1NY72 5T54A 2NLRA 1OXCA 3C7FA 5FZ7A 1ZX5A 1JOPA 4JRAA 5KXEA 5A6XA 1HRV1 2VMCA 3C8XA 2ZHKA 1W6MB 1HN0A 4LK7A 4NO4A 3WG1A 1YI7A 4XF4A 5FZOA 2ZAAA 2MEV2 1CN1A 4NHMA 1L7QA 3IWZA 2VMFA 2HWE2 3GNEA 5HV4A 4DFSA 4MYEA 3OEBA 4N43C 1LTEA 4E4SA 2VVDA 1O5LA 2CNAA 1YI9A 4NRPA 1BK0A 4PLOA 3SEPA 5KHKA 3BOPA 4DXZA 3K4AA 5GZCA 1STMA 1BCXA 3GYDA 1W2TA 2Y26A 3N7KA 4DQAA 5I0SA 1W9SA 1BHGA 1J3QA 1R092 2A3XA 4Z2WA 3M70A 5C71A 3EMRA 1OQDA 3ZFGB 1DQ6A 4B1MA 2R042 4OI0A 5FY5A 1PIV2 3WR0A 2X8KA 1RYYA 4QGLA 2IZWA 2ZGSA 4LNVA 2OX0A 1H8TA 1JUHA 4E4ZA 3QH6A 5FKBA 3V0AB 4AGGA 2JXAA 2J1UA 3OUIA 2E63A 3AK0A 4Q4X2 3BPZA 4HOOA 4OHWA 1MS9A 2ZCWA 4Z92B 4FQZA 3R6SA 4EN9B 1JHJA 4Q0VA 3A4UA 3OUHA 4DXTA 1UYPA 4FXGB 1GOHA 3M3CA 4YM3A 4R4ZA 2OPKA 3W59A 2EIDA 2RS52 3M3QA 2K2SA 3I3DA 3RJRA 1AL22 4QB1A 4GULA 1LOCA 1CONA 3I2FA 4XAAA 5FIXA 3TYJA 2A75A 3VD9A 1ZRIA 1FOD2 4FSJA 2LW8A 4R9AA 4JV4A 2HH9A 1IHMA 3N7MA 5FWJA 4CXYA 4LKSA 3D5OA 2HWC3 2BTVC 1UCXA 2WZR3 3W58A 1O3TA 2UURA 2ZS6B 3O5SA 4FOWA 3B7MA 3OGRA 1Q8QA 2C5DA 4YW3A 1V9U2 4B4PA 4YM1A 2VBDA 1KDMA 1G9FA 2FCUA 3BCWA 1UX6A 4KMQA 5FYCA 4E2GA 4IERA 4ZY9A 1H8TB 2VH9A 3LD8A 1CAWA 1J59A 3U4SA 4J25A 1YQ8A 1ZBA3 2ES3A 4DPNA 1N1YA 1XXNA 1D4M3 2R16A 4CUCA 4YFWA 1H9PA 2VXJA 4OHVA 1F5JA 5DDJ3 2LTNA 3B9CA 3APBA 4QB2A 2ZGKA 4EN6B 4MO3M 3G6JB 1OFNA 2WO1A 5FY9A 1AUYA 5F1RA 4MLOA 2RJLA 2K0GA 3NV4A 1DHKB 1UZVA 1T6GC 1BZWA 4I3GA 5GLTA 2PXJA 2VZOA 3P6BA 1LJ7A 2P3YA 3VBHB 2WFF1 4JHZA 1EPWA 4ATFA 3FE5A 2RE9A 2ETEA 3VBSC 4K3UA 2XHNA 1WCDJ 3IN9A 2WS91 5FQ0B 4E2QA 1ZRDA 1D7PM 3NAPB 4FBFA 2IUWA 2Y33A 1JYIA 3S57A 4TXWA 1UY2A 4ISRA 3MZHA 4BH9A 1RUF3 1XYPA 3U75A 3BUCA 1RUOA 4AVCA 1Q43A 1NZIA 3LDBA 4MXWA 5FZKA 2QQJA 4TLFA 2DV9A 5I0UA 3WW2A 1V0AA 5JMOA 1H2LA 2D5FA 1CIWA 1AZDA 1OSGA 3P5BA 4OUEA 2XLAA 3AC0A 3PJYA 4QHOA 2IC1A 3ZFEA 3ZYJB 4PDWC 3RMYA 1UMZA 1HRI2 4AHZA 3ZXFA 4CDUB 1R1A3 4N90A 4DXSA 2VUCA 2JDMA 2QQLA 4GIQA 4GKXA 2A73B 1W3VA 2X29A 4JGZA 4M3CE 5GZDA 2WZ8A 5FRAA 4A6OA 4CDWA 5FOBB 1OA4A 2HWF2 1ZA7A 2JENA 4NPLA 3VHRA 1RMU2 2O8OA 3HNBM 4OUSA 4BYYA 1MEC3 1XQNA 4QX0A 2EXIA 4FFGA 4OCTA 2Y34A 4RSUA 2XBO1 1I9RA 4XOGA 5C5UA 4WVZA 2ZGRA 1MQTB 1K3IA 1QJY1 3AKSA 3VDDA 3WG2A 4YGBA 2WAOA 4IEVA 5FZ9A 2JDNA 1WW7A 4FP3A 1CZSA 4YLZA 1UW8A 5A3LA 4DOUA 4ZKTB 1PVC2 4CDXB 2WT2A 1KJLA 1ZRRA 3MF9A 1OLRA 2HEWF 4IEUA 4QXCA 4FPJA 5IW0A 1S0BA 4AYUA 5FZFA 5LCWL 1NKGA 2RS13 1QJZA 1H30A 3GZTB 4XHBA 1VBB3 3ZXLA 2JG9B 3OCPA 2NMOA 2XG3A 1F4AA 1LCLA 2W1WA 3USUB 5IHRA 1MZEA 2BERA 4DMIA 2VZ3A 1NCRC 2WNOA 4BISA 5BNNB 1E57A 1SLTA 4QU2A 1Y4WA 2HWD1 3VDDC 2Y64A 2HEVF 4FOQA 1JU3A 1W9WA 2ZGPA 1AR62 1PNGA 1X8MA 2H0VA 1V9U1 2IXKA 1O5UA 1YJLA 4JAAA 2R072 5FLJA 4UBGA 1WLCA 3CDZB 2RDRA 1U5IA 3VD5A 3VBUA 5EJ1B 4W4ZA 1RUJ1 1S2EA 2JG8C 1GUIA 1WMXA 2HYXA 1S55A 5FYSA 3VV1A 2R6QA 1W8TA 4RN5A 3B93A 4YW6A 2JDUA 2ET7A 3HT2A 4A7ZA 1QOTA 4A7YA 1XSRA 4NRQA 5FFOC 3IAQA 4BLJA 3WNNA 1LHNA 3UETA 2RS53 4AFMA 4P9XA 5FXVA 1AVBA 1U5XA 5FZ1A 5FQ0A 3FUQA 4UF0B 2Y8KA 4QQLA 5JR2A 2ZEXA 2Z79A 4FPYA 2VMIA 3IDBB 2SBAA 3RI8A 3NWKA 5BNNA 4NIHA 1EUUA 1MVEA 4IV3A 2WQ8A 2WSUA 2W91A 3PTYA 3ZLIA 1QJX1 1GZTA 1PVC1 1UAIA 4CEWC 1N1SA 1OD5A 2FMDA 2WKKA 3M8LA 3VBRB 4ZHNA 2BOJA 2C26A 1OOPA 3AYDA 3LEIA 4HN0A 2D3RA 3S30A 4XUTA 4OYUA 4OFGA 1J83A 1LNSA 4IL7A 4P9JA 1UWWA 3CZJA 2WO7A 2XGXA 3JXSA 4M3CA 4QHBA 4ARXA 1U12A 5JXGA 5FMOS 5T3NA 5SV8A 2VZQA 1ULGA 2OQ7A 4D6RA 5JPMB 3A23A 4DINB 4IE4A 4BOWA 3NJXA 4KGGA 2Y60A 5FP8A 4J1XA 2LM3A 4ISQA 3LFIA 5A1FA 3PIJA 3JUUA 4K8RB 3NJYA 2Y6GA 3DPRA 3CJIA 5A6QA 1LODA 2CGNA 3WG4A 3RNSA 1R081 4UW6A 1N3PA 2GU9A 4AQ2A 2NZ9A 2R041 1AX0A 1NCRB 2VUDA 1U0AA 2MPFA 3I3BA 5FLIA 4P5HA 3JU9A 5HXMA 1O4ZA 2LALA 3PMEA 2G1MA 5K4LA 3ZOIA 4NAMA 4GA9A 3DYMA 2Q8DA 3TN92 4CVUA 4Q0SA 5FPXA 1UNBA 2R32A 3ECQA 4LEJA 2WNVC 2ZGOA 1H1IA 3ZYHA 3E6CC 1TNFA 3LEGA 4LHKA 4AHXA 4AK3A 4MSVA 2FDKA 2X5IB 3SCFA 3PUIA 3OPTA 4GMP3 5BPXA 1RUNA 5KXBA 1W8FA 1VJ2A 2PELA 4JTOA 4OMCA 1UOJA 2VMEA 4RHV2 2RS33 3WG3A 1WCKA 3LZZA 4GWIA 4QXKA 4HL0A 4KU7A 1A8DA 1LRHA 1DCSA 4QX2A 1ND2A 3IDCB 3Q8BA 1RUG1 5I0TA 4LKFA 1SCSA 5FBZA 3RQ0A 1RMU3 4P9GA 2W2IA 4M00A 3T2PA 1GBGA 4EQVA 3BIEA 1W6NB 4Z8BA 1TME2 3WNXA 1SFPA 4S2FA 4XFFA 4D94A 4CEWB 4Y24A 4P9IA 4YVSA 4IQPA 4JDMA 4Q4Y3 4QXHA 4X6RB 1GZCA 3AYCA 4UFLA 4XMIA 1ALYA 3BB6A 5FYUA 3H8UA 3JD72 4LHSA 1W0NA 2LUWA 4W65A 3VGIA 2MEV1 3NNLA 5EHDA 4ET7A 1DYPA 2QE3A 2E53A 5G04L 5L7OA 1YFYA 2BBAA 4JX0A 5DUUA 4E4HA 2EIEA 5CKQA 3UV9A 3QBQA 5B4XA 2ZACA 3GZEA 4O7XA 4YWAA 4AVVA 5KBFA 1O4TA 3IZOA 2VW0A 3J8F3 1O7FA 2A6ZA 1JBCA 3SITA 5BNPA 2RM21 4JKMA 5I93A 5F3GA 2ZMLA 3PUAA 2PAKA 5AC92 4Q4W1 2R49A 3WF1A 2WO2A 1OOPB 2JD9A 4Q27A 5ANNA 3UJOA 3K4ZA 4B4QA 5FZ0A 2IXHA 4I02A 1IPKA 1VB4A 5BNQA 1VPHA 3MICA 2FDGA 1SBFA 3KWVA 4XIKA 4CCCA 3BI3A 1OKOA 2XXZA 1UOBA 4K21A 5KHHA 1OF3A 4P08A 4EN8B 4M4RA 2W87A 2YBKA 3O0VA 4EZHA 3PHMA 3HQRA 4RGKA 1L7LA 3BGAA 2BU9A 4FTBA 4QDQA 1SLAA 2W3JA 3K2OA 2X53S 2Z2SB 3DYOA 3KMHA 3ORJA 4LO4B 5L7OB 4FPEA 4HXCA 2A5ZA 5BNPC 1DQ1A 1CZVA 2XVLA 1OVPA 1QXJA 1R082 1ULFA 2QFEA 4Y3OA 5FDBA 2YDEA 4XC9A 4ZU7A 1HW5A 4P9YA 1E5SA 1FMD2 1RL3A 1ST8A 4D69A 4CEYC 3F95A 3WF2A 1DP0A 1JW6A 1W8OA 3CNAA 1POV3 3TNQA 4CDUC 2E32A 3ACLA 4EWDA 1AXKA 1DQ2A 5GM0A 3AVRA 1UIJA 2XB6C 1Z7S1 1GZWA 3ST7A 1JZ3A 3VKNA 3BVCA 2BZDA 3MIBA 3BU7A 2WQZC 1U5YA 2C24A 4YVWB 4XPVA 3LSEA 3C7OA 3M7AA 4FPLA 3WQ0A 5T55A 1WLDA 1H2MA 4FTEA 1W6QA 4CYDA 1GKBA 3KV6A 2H6BA 2VW2A 2N7GA 1AL0G 3ZPYA 1RUD2 1W9YA 4AVSA 4W8JA 4QT6A 5FYVA 3LPFA 3ZYFA 1ENSA 1EP0A 2J22A 4C1WA 4AG4A 1CQ9A 4HN1A 5FREA 3JCIA 2CSGA 1QIQA 3GGLA 4B4RA 1ZREA 3MFAA 3Q8AA 4CDUA 4PI0A 3LCPA 1JZ6A 1ULEA 2A3WA 1PM4A 1LGCA 3GF6A 3VL8A 4Q29A 3ETQA 3IMMA 4YM0A 2E7TA 3RZZA 3AL5A 3UL2A 5FJHA 4JCKA 3PVEA 3N9OA 4JKLA 1ENXA 3MLKA 1RB8G 2AUYA 3LF7A 5FMDA 2BUKA 2B42B 4QPIB 1O8SA 4RS5B 4XW3A 2BVBA 5K8SA 1W9TA 3ACFA 3I97A 3MV01 1PX4A 3RYPA 5J96B 1US2A 2FHRA 3VD7A 1GWMA 4CU7A 5FP7A 2EVXA 2ZGMA 3K75B 3FX3A 4JRLA 2VZUA 4TN7A 1KS5A 3B5LB 2NYYA 1REDA 1AR91 5A7WB 1AR61 4CRQA 5F2WA 1RUC2 1PO12 4K7JA 5E89A 4XFGA 3NV3A 5FZEA 5I8YA 4BLIA 1RUH2 4OHZA 4EROA 2JKXA 2YXSA 2C9KA 5D1IA 3K51A 3MHZA 5BNPB 3RG0A 2RS32 4MUVA 4CCDA 2WO3A 5AC91 1L3JA 3MIHA 4BQ5A 4S2DA 3JB8A 1RHI3 3O1UA 2EXJA 2R071 1MZFA 4AEDC 2VCMA 3M3EA 4NIIA 3VKOA 5A33B 3WF4A 1JZ4A 4O9GA 2WR9A 2B7YA 5IAVA 5AFBA 1G7YA 3N9MA 5F6KA 1EUTA 3LIGA 3N4MA 2XL9A 2JE7A 2WLQA 4CTEA 3OF1A 2ZX4A 4A3XA 4ATEA 1OH3A 2X09A 2GC1A 2WBKA 1W9FA 3CQOA 4Q0UA 1AYM2 2W92A 2WUHA 4R52A 3WDUA 3KCYA 5A7WA 2E26A 2ADDA 2YBPA 4XHXA 5EYXA 1LB2A 1S0JA 1ND3B 2XH6A 4XYXA 3OPZA 5DDJ2 3AMHA 3AZYA 1AJKA 1N3QA 2OQ6A 5DAVA 5I8TA 3THTA 4A6SA 2DWRA 4YZ5A 4AEDA 4EWAA 4WVVA 1W90A 4N53B 3E5XA 1NE6A 1SBDA 4P02B 1LECA 2AZ5A 2RR13 1IPSA 4Q8LA 1UYYA 4QQ2A 5FY4A 4LT5A 1OLMA 4B7EA 3N9LA 4UF0A 5EP9A 4CU6A 2JEMA 3ACGA 2RMU2 2DCTA 2V09A 1KXGA 5CIRA 3SHRA 3T0AA 4YW1A 3WHUA 1ENRA 2PFWA 2OZJA 1WCQA 4PQQA 2QUOA 3B00A 4UFKA 3W21A 4F3JA 5BY5A 4LBMA 1O3QA 2ZX3A 2Y0OA 1KFXL 3ZFGC 4EJRA 2Y6FA 3LIHA 5T5OA 3AJYA 5D8AA 4BWOA 2J1AA 5IVBA 3JB4C 4AAPA 2Q1FA 1RUF2 1DYKA 5T5JA 4AEMA 2XJRA 1F8VA 5EJ3A 4HKLA 5K9YA 4KWKA 2FCVA 4XAEA 2XONA 4AVAA 4BCUA 1CR7A 4ZZ5A 3SISA 4CUGA 4HETA 1RC6A 4CCKA 5JXIA 5DMYA 1RJ8A 3RZGA 1K5MC 4RFRB 1S2KA 5FXZA 2VECA 5LATA 4XE9A 4N53A 2WABA 3SKJE 3TRSB 3V64A 1DLCA 4P00B 1JZ7A 4FPGA 4HANA 2FDJA 3W9AA 2GMPA 2VW1A 2VD7A 3LA3A 5KC6A 1WW5A 5D8AC 2HWB1 1JYCA 2A71A 4PI2A 3RZJA 4IEXA 1JZ8A 1W8ZA 2WLPA 4ZONA 3TN91 1X9TA 1E5HA 1MEC2
chains in the Genus database with same CATH topology
1BBT3 4LULA 1GFF2 5ABJB 4KWJA 1D2QA 3M3OA 1IOAA 4RL7A 1Y7BA 2TBVA 1I6XA 5ABJC 3OGJA 4Q4V2 4LLFA 1QDOA 1HV1A 2OW4A 5J09A 3AJZA 1LOEA 1QJU3 2VVEA 5JSRA 3ZIWA 3VBFB 4WV8A 3WDXA 2E9QA 1JOJA 2EAAA 4K9SA 4N9IA 5EXOA 1AF9A 2ZHLA 3JZVA 5GALA 1LEDA 1C5HA 3MIEA 1RGSA 4MV2A 1O3SA 4YZ4A 5ABJA 5ACA2 2D43A 4JDNA 2OZ6A 5TSWA 1VB2A 3ZN6B 4LBNA 2R073 1GANA 3CF6E 4ZXKA 4A7KA 3NV1A 5JOYA 3V0BB 1IS6A 4FPCA 4XF3A 3A0KA 4R8HA 4C91A 2C1FA 3U07A 1SLCA 2PAEA 2UWAA 4H7LA 2QQPA 1QDCA 4JVAA 3EXUA 1EAH2 1AR63 4XTPA 1FI2A 1AR93 2E7QA 1YIFA 2DFBA 3HD8B 4YGCA 3JQWA 5A3MA 3B02A 2Q8OA 1YXWA 2D6LX 3H1WA 1HX6A 5HBAA 1MZ6A 4NWVA 3TB0A 3D0JA 3C2UA 1G6NA 1Q5OA 2BFUS 1V6IA 2C9AA 1VBA2 3I8TA 1AR71 4WVWA 1NA1A 1QU0A 2WSVA 1D0HA 4Y1XA 2CAUA 4OHYA 2OA2A 1AYM3 2GZWA 4S2HA 4K20A 3MIDA 5C33A 2UYBA 5T52A 3H9AA 4ES8A 4R4XA 3VHPA 3T2TA 3VUOA 3KT1A 2YYOA 4LO6B 3E5UA 1NCQB 1OI6A 4MGIE 1LGNA 3WDWA 4GXLA 1W6OB 3IIAA 4I09A 1HXS2 1MVQA 4LO8A 4DRRA 3FLPA 1REEA 1NYWA 1YWKA 3BIWE 4MZUA 2HWF1 2VMHA 3M3IA 5BYNA 5GZGA 1NLRA 4CP2A 4EN7B 2R0FA 1EV13 4LE4A 4OHXA 1RUI1 4AQSA 1A3KA 2BW8A 2E6VA 3AMQA 1POV1 3QOPA 4OI4A 2R0HA 4S2GA 3URFA 2UY8A 4W6WA 4HVRA 2ZX0A 2D6KA 5T5LA 2Y38A 4LHLA 3FFZA 2B46X 3D82A 3HQXA 3T1LA 4MGKE 3VKLA 1OFSA 2D5HA 4OUMA 3ZDSA 4FPFA 4N9HA 4RGGA 3OTFA 3WLUA 1TE1B 2IXIA 2ZHMA 2H6CA 3GHMA 3S6PA 3ZN6A 5BNOC 1LR5A 4O9EA 3M1HA 1B35C 1FATA 4GKYA 1PHMA 3FMGA 3J8F1 4Q4Y2 2WINB 5KHJA 2P3IA 3MIGA 4QPYA 1FYUA 1PVXA 2XJUA 4RA0A 2E51A 3AKQA 4AVBA 4DS0A 1ZBE3 3BALA 4I0AA 4PIYA 4BPZA 5JI9A 2MEV3 2P2KA 4WM7B 3VZLA 4QMAA 2XLFA 2X5IA 1DFQA 2VGDA 1LU1A 3VBOA 4CDXC 2VQ0A 3ILFA 1N1TA 3NW4A 3WDVA 3D8CA 1QY4A 2P17A 5CFCC 1FMD1 3L2HA 4LBQB 2JECA 1UZZA 3AKPA 1VR3A 3AZZA 3ZSKA 4G4FA 3ZXKA 2PTMA 1XU2A 3J9SA 5FO7B 5JWPA 4INDA 5CFCB 1KD7A 1RUG3 1VRH3 4FVVA 4B29A 4GALA 2DVFA 2YMZA 2WWSA 1QKQA 4JTNA 3TAYA 5IK4A 1WW6A 1CAVA 3AP7A 2ILMA 5GKAC 5A32B 1ZRFA 2D6OX 3J8F2 4GB31 4CDXA 1EAH3 4BM8A 3WP4A 5CG8A 1M4WA 1NXD1 4LBKA 1IGOA 1CD3G 2Z5WA 1CJDA 2V5YA 3SLIA 3U10A 3UKTA 4DY5A 2JG9A 5EFUA 4F83A 5J3UA 3ZO0B 5LRSA 3PJQA 2RHPA 4QGMA 4LBJA 4IEYA 3SXWA 1XNBA 4H7MA 3R4SA 5BNOB 3ZSMA 2DVDA 4J1WA 1CX4A 5GLWA 1B09A 1VIWB 1RINA 1R083 4Q1RA 4B3NA 2IFRA 1NY71 4KBBA 3OYWA 3VBRC 2NN8A 1TNRA 1CAUA 1Q8PA 4C0HA 3L9JT 3HN1A 4UXAA 4XETA 2KM2A 1ASJ2 5T5PA 1NG0A 4D7SA 4C1XA 5E16A 1S0EA 4LLOA 4WM7C 3I7DA 2FZ2A 3J4UH 3WUCA 5JMCA 1ZZ8A 2HYKA 3RYKA 2EXKA 3ENRA 4Y4YA 4YG0A 1EV12 1LKNA 3LA2A 3SH5A 1BEV3 1PVC3 4RR3C 2ZTNA 1QXPA 4RFT0 4I0WB 3VBRA 3KLSA 2A70A 2RJKA 4LO7A 2RS12 2PQQA 2ARXA 1IQAA 2F6BA 1ZZ9A 1WCSA 3D4KA 2XVGA 3N3HA 3PMSA 2BWCA 2RS51 1COV3 3U11A 1I5ZA 1WLTA 3GHNA 2ZOEB 3NAPC 4WM7A 1KJRA 2XL7A 4JC1A 4OLLA 4QX5A 2VOKA 4TSVA 3SH3A 1D4VB 2GNBA 1X7NA 1AR83 2VUJA 2EAKA 4QPGA 2GH2A 1TMF2 2HKXA 3B69A 5GZFA 1RVF2 4N43A 4AXOA 4AVTA 2HWD3 4QM9A 1FT9A 4RS5A 2Z42A 3NAPA 5J36A 3SCHA 3WQ1A 2VOXA 1KRIA 1A6CA 1IPJA 4JGYB 5FCCA 1AJOA 4AQTA 4P14A 2AENA 4J6GA 1LHUA 1H8TC 1MQTC 1SLIA 4RD7A 1VBB2 4Y1ZA 5BNQA 4BIOA 4R9DA 1CPMA 4XJZA 2YC0A 4P9WA 4Z82A 1AYN2 4QPGB 1A8MA 4FPHA 2G9FA 4RS5C 2I45A 1VLNA 4FOVA 4GH4C 2R30A 2XBO3 1W6NA 1UPIA 3PLQA 1SFYA 4FO9A 4G3YC 4LUMA 5J37A 5DZGA 1PNFA 2YGMA 2CWMA 4ORFA 4YVSB 4FTSA 4DB5A 3GBGA 1PGSA 5I8SA 1YO8A 1MQTA 2R1DA 4HT1T 1ZVFA 3MFCA 3VDDB 1AR81 2ENRA 3IPVA 3I59B 3AM2A 4LBQD 2TNFA 2VPVA 3ME2A 1A78A 4XJWA 4AQ6A 3LAGA 2GDFA 3NV2A 5HCBA 2WA3A 4EV0A 5FO9B 3EJKA 5F9TA 2ZBJA 3LA7A 3IMNA 1GICA 2DUOA 1CGPA 1COV1 4RQPB 3AMMA 3V65A 3NKGA 3O12A 5CVRA 4LE3A 5BXXA 5H9SA 1Y43B 3POWA 1HQLA 1PM7A 2F4PA 2VNRA 4PIXA 3S0MA 4WVMA 3A0NA 2WS93 1W6PA 4HLTA 5JOZA 3JBG2 5C4WC 3RDIA 4XDQA 4KWLA 3TNPB 2WFF3 1BEV1 4IEOA 3SNMA 2A7AA 2NQYA 1EPZA 4BMBA 1RUE2 1ND3C 1POV0 4U2AA 2ATFA 2QKDA 3IPVB 4LUKA 3ZFEB 1LOAA 3CLPA 2DCYA 3DUIA 5AFEA 1QJY2 2XKPA 1C3HA 4Q8KA 5DDJ1 2HWD2 3IM0A 4AEKA 4Y1UA 3ZFEC 2QVSB 3ASIA 3WW4A 3M2MA 4PDWA 4XJUA 4JGZB 3SMHA 4BZ4A 1J1LA 1PZ9A 1W0PA 3ZMOA 3NVCA 1UF2C 1CESA 5DUWA 2MNGA 4E27A 1CJPA 4GMP0 4JGZC 4H14A 4YW5A 2HWC1 4CDWC 4Q1PA 4IV3B 3VLBB 1V00A 1W6QB 3M4FA 4HSLA 1CAXB 2WC2A 4MGZE 4NWWA 5HI0A 5FTTC 4G9SB 2GC3A 2IWGB 3PNAA 3WX5A 4YVWA 1BBT2 1N3OA 1XU1A 4KNCA 5C8CA 2BFUL 2XBO2 3DV8A 1BK1A 2UWCA 4F7ZA 2DFCA 1CVNA 3AP4A 4YZ3A 4IEZA 2XPJA 2JG8B 1U5ZA 1MZ5A 3IKWA 3CU7A 1EAH1 2YV8A 3VBFA 2W52A 3MGUA 4GB33 1J58A 2D3PA 1LENA 3CJIB 3TWIA 4RQPC 2DCKA 3FFQA 4YZ1A 4F8AA 1J3RA 3P3NA 1LOGA 1VRH1 4E9KA 2Z69A 1C8NA 2D6PA 4KGQA 1NCRA 1G9CA 1AR92 4HFSA 4L99A 1FMD3 2DTYA 5GZEA 4AWDA 3ZYRA 3LOIA 1UIKA 3RJ2X 5A32A 2Y0IA 1QNYA 1UU4A 3QCWA 3VKMA 4OI2A 3N36A 3EQEA 3VZMA 4LO5B 4ITCA 3MI8A 4YSFA 3AMNA 1Z0HA 1IZ3A 1UZYA 5T50A 3CL1A 2JG8A 4I3PA 4META 4RQPA 1ZBE1 3NJZA 4HMZA 1G9AA 4RGAA 5DUXA 4HVQA 1VBD3 4URTA 2R1BA 1ZBA2 4N7UA 2CAVA 1BMV1 4BHPA 3NO8A 3AMPA 1V6KA 3WVJA 3WP5A 2DYCA 3WZ1A 5J98B 1DDLA 4YW4A 3BTAA 4QGNA 1G9DA 2A6YA 3AFGA 1KS4A 2EIGA 4IV3C 4Y20A 4Y22B 5J7MA 3U4XA 1RUD1 2H0BA 3HAGA 3KS7A 4CEWA 4M01A 3OYWB 1MS0A 2DVBA 1OOPC 1CAUB 4K1YA 3R05A 3E97A 4XQDA 1CPNA 2BNMA 1PZ8A 3L2YA 3RWNA 1R1A2 3E6DA 5JSPA 1S2BA 1NLSA 2I07B 3O7OA 4HK8A 1AHSA 4ASLA 4BIFA 4XMAA 1UN1A 3LGRA 2XJTA 5JIAA 1C28A 2TEPA 4PF5A 4K8FA 3DPRC 1LOFA 4DRVA 3CJIC 1GNZA 2D7FA 4M0NA 5JDBA 1C8M3 4XF1A 1RUI3 1EV11 2D93A 3T1MA 1S0CA 2VULA 2HWF3 1W0OA 2YHJA 4XJ8A 5JIUA 3IBMA 2VMGA 3UK9A 3G7DA 3DN7A 3ZIXA 3VZNA 3MDPA 4JGYC 4C90A 2CGPA 3QD6A 3ELNA 2D6MA 3VZOA 1LOFC 2DCZA 1LHVA 4FPOB 3ZSJA 2WNUB 3ATGA 2Q1MA 1ZZBA 1AYM1 4FXKB 3WP6A 4PBOA 1URXA 1AR73 1ND2C 1BKZA 3Q9OA 1WBLA 1XE7A 1RUG2 1V70A 4NOTA 3AZWA 4YYOA 3FWEA 2NM1A 4Q4V1 1DBNA 4IEWA 4XZPA 1V6JA 1QH6A 1KITA 1RUJ2 1ZZ7A 4JGYA 3WCRA 2YZ4A 5J48A 4QPIC 4YVSC 1R1ZA 3O0WA 1PO13 1LHOA 1WUVA 2W68A 1VRH2 3KB5A 3FC0A 4C0BA 4WM8B 2ARBA 1PIV1 2PLV2 4FQ4A 5L7OC 4GQ7A 4AI2A 3THPA 2QDRA 1RTVA 1R091 4YW2A 2DU0A 5ACA1 2VNGA 1MS4A 3VZKA 3RRDA 4Y22A 3ROUA 1WLWA 1C1FA 4BQ1A 4QPIA 3VBSA 4LHNA 2G9GA 1SDWA 3OBTA 1MACA 3H50A 2JD4A 4EN0A 3RSJA 1F31A 2HWE1 1FV3A 3WINE 3POSA 3UKVA 2PHWA 1LHWA 1MS3A 1ASJ3 4I0BA 5DZFA 4LA2A 2QNKA 1IKQA 4Q26A 3V0BA 2PHXA 1QJU1 2ZAHA 3DL3A 5F6LB 1QOOA 2A6VA 2AH2A 4RHV1 4TWTA 1PK6B 3U0ZA 2BGCA 2WFPA 4YNIA 1WGPA 4Q0QA 1JTZX 1J1TA 1IS5A 1SLLA 3ZVXA 2GAUA 4UBHA 2EF6A 3OD4A 2WT1A 4MXVA 1QHDA 4IXLA 5FPZA 3ZSLA 2BEOA 3HR9A 3POYA 3ZMNA 5KXDA 1BBT1 4AFAA 2B39A 2HJIA 1Z7S2 5IUQA 3TN93 1JUIA 5LRRA 4COYA 3KD4A 1F2NA 2HWB3 3OD0A 4PCRA 4Q2FA 2BQPA 5AVPA 4FPKA 2A3YA 3KCCA 4MX3A 1NA1B 1OQEA 1ZZCA 3O14A 2ZPXA 1G9BA 1GR3A 2YPJA 1CAWB 2D3SA 2KXLA 1EY2A 4AI1A 2W0XA 3H1MA 2WA4A 1RIRA 5KHGA 2D44A 4XXAA 5GJ6A 2W08A 1O4YA 1VALA 1DGWX 1G8WA 1RUH1 5IK5A 4NPRA 4Q4X3 4COUA 4JQRA 4Y5Z0 1H8VA 1C1LA 3N7LA 4NVPA 1YJKA 4CDQA 4K6BA 4WZFA 3KGZA 3GBFA 1WD4A 1GV9A 1LOBA 4AGRA 5CADA 1WA4A 1XNDA 2ZGQA 3JD73 3PVNA 1QQP2 1OHFA 4MGYE 1APNA 5FOJB 5KWRA 2JICA 2RR11 3RMXA 1QJU2 2B45X 3VBUC 4NN0A 2BPA2 5CFDA 1QQP1 1VBE3 4WZCA 2ZX2A 3ZFFC 3WW3A 1DLLA 3I4IA 4IEPA 1C5IA 1XYNA 4KQ7A 2I74A 5CB7A 4CDQC 1ULCA 2XLGA 1HQNA 2PN5A 4RR3B 5A33A 3NKTA 2ZGLA 4WBBA 1W39A 1OPMA 2UU8A 2WQ4A 1LULA 4HVOA 2XVKA 3ZYGA 5BNNC 4E2SA 4QQPA 3H7YA 4SBVA 4D3WA 1MS5A 2V73A 2VY0A 1AYN3 1NZCA 5CFDC 4QQHA 3ZFFA 1RHI1 5EV7A 3AP9A 2IXLA 2D98A 4XXPA 5AC93 2YGLA 1HRI1 1N47A 3KQRA 4B8EA 3ZXGA 4XBLA 3BODA 5FAXA 4PLNA 3VBOB 4MVTA 3CJXA 1ZYBA 3AYEA 3KM5A 5JOXA 1GSLA 3WOGA 2R063 2E7AA 1AXZA 1OKQA 3KSCA 5CU1A 3RPQA 2WZR2 2JDZA 2YUEA 3B01A 1B35B 1HRV2 5HXVA 1S0IA 3AB0A 4LBQA 3ZFGA 1HIXA 1RUE3 5DG1A 1FPN3 2XJSA 5JPNB 1F9KA 3ZXJA 2DF7A 2ZMNA 4XEZA 4AFDA 4YZ2A 2NMNA 2FQPA 2GC2A 4FOYA 4IESA 5K0UB 3H0OA 2VNOA 3I59A 2WNVA 1H2KA 1HXS3 4GWMA 1V6NA 3VL9A 3H3UA 1CAVB 4FP2A 2CV6A 2VOWA 3H1YA 2ZKNA 4YG3A 2DURA 3ILNA 4KH9A 4L8QA 5FLHA 1VBA1 1YRZA 1PO23 2ZHNA 4AI0A 1H4GA 1BQPA 3R4UA 3K48A 2Q1ZB 2WNUC 4COZA 2WL1A 5FMOL 1Y3TA 2FBEA 1W6PB 1Z7S3 1I1EA 2O1QA 3WDTA 1UPSA 4EWEA 4N7IA 4XIOA 3HWJA 2HWB2 1H9WA 2ET1A 3H3ZA 1RUC3 4HPKB 3DKWA 3AYAA 5KHIA 5DZEA 2EXHA 3LOBA 4NR1A 4L2NA 4M3CB 3NSTA 3WT3A 2CTVA 1J3PA 4COWA 3E5QA 5JR7B 5C6CA 1W6OA 4SLIA 2ZMKA 3MLJA 2WNUA 4OZXA 4PIZA 3EBRA 1ULDA 2FZ1A 2AR6A 3VKFC 2OUJA 4K1ZA 4B7KA 1ZM1A 3B9IA 3HBZA 1QGLA 4P9LA 4AF9A 1BVVA 3AX4A 3IDEA 5H9RA 3QLQA 2BBVA 4Y1YA 2ZABA 4Q0PA 4Q4W3 1DZRA 3CEWA 1BMV2 2DUQA 2RM23 3SH4A 1RHI2 4MXWB 4PLMA 4CP0A 1DG6A 1CAXA 4HPKA 1PGW2 1HKDA 2B8MA 4AEJA 1WMDA 4YGDA 4JDOA 5K0UC 2XJVA 3FZ3A 1FXZA 1QJX2 5GLUA 4OI1A 1VAVA 2Q0AA 2OIIA 3WXPA 1YFUA 5EWSA 4Y26A 1NE4A 3GZUC 3FLTA 2RMU3 1FPN2 1S1AA 2DCJA 2PHFA 1Q56A 4W6XA 4Q4Y1 2EALA 3QH7A 4R9BA 5LEKA 1H1MA 4CEYA 2JJ6A 4KU8A 4GH4B 3MW4A 3VBSB 3MEPA 1ZZ6A 1UKGA 4GB32 1LEMA 2OUHA 5K0UA 1RMU1 1H0BA 4N43B 3AP6A 2WNVB 1X50A 2RS31 1BEV2 3MW3A 3ZN4A 1AX1A 2GMEA 4V1PA 2JE9A 4GMP1 4FAHA 4HBNA 2WT0A 2IFWA 2ERFA 4XTMA 5L73A 3WD5A 4IETA 1PZ7A 3GBWA 4AE2A 3N7JA 4CP1A 1HDKA 1C57A 1Q8SA 2QJVA 1SMVA 1KDKA 1O91A 2VOVA 4IEQA 1GNHA 1BVP1 2R043 2UWBA 3JQXA 2OYZA 3USUA 1HLCA 1HV0A 2GN3A 3TBDA 2A6XA 4KG8A 4L92A 1DF0A 1JH5A 1LGBA 3KCXA 5L36A 1SFNA 2DVAA 3ZXAC 3I54A 2RMU1 3AFKA 3FUOA 3H7JA 5AVAA 4AFCA 3ZYPA 1Q8OA 4QM8A 4AGVA 1X33A 3VBUB 3WHTA 2RM22 3EO6A 1ZA4A 3FBYA 2W39A 2ZGUA 3SCGA 1H2NA 1IS4A 4BE3A 3CO2A 5CBLA 2PYTA 2VG9A 1YIPA 2VVFA 4CDQB 1OMIA 1QJX3 3WP3A 5BNOA 2UYAA 3IT8A 4XF0A 3QACA 1W2UA 1LU2A 1H4HA 1PMIA 1YNAA 3AKRA 1DGRN 5JSOA 3B94A 1DQ0A 2IXJA 3OY8B 3N35A 4UW5A 5CNAA 4ZU5A 5HCAA 5H9QA 5CFDB 2GNTA 1RUI2 1FX5A 1MR5A 3C3VA 3FBMA 1UD1A 4NHKA 4YRDA 5DXDA 5B2GB 5L19A 4PQ9A 1SEFA 1DIWA 3DPRB 1Z78A 2B9UA 4CEYB 1RUJ3 3KT7A 2SLIA 2ZX1A 2X5IC 2HWC2 3VBOC 1X82A 2XHKA 3USSA 2CY6A 1WMEA 1RUC1 4KG0A 4PDWB 4AEDB 1V9U3 1C4RA 4L97A 5CFCA 4FT8A 4XBNA 3D0SA 3HMYA 4YG6A 5EYYA 3ES4A 1GLHA 4PBPA 4CZSA 4XFBA 1S0DA 1X8EA 1JHNA 3E6BA 5KC5A 1VBB1 2KA3A 1YFXA 2XUMA 1YCIA 2PHUA 2AREA 2RS11 1PO21 5GLZA 1VBA3 2P37A 5JI7A 2NPIA 1UKRA 3ALQA 3VN4A 4YM2A 5JZGA 3I2DA 1K5MA 4OVEA 2DVGA 1DGRA 4UW4A 1HXS1 4Y1VA 4N53C 4H55A 1EYBA 1D4M2 1OA3A 1ND2B 3R0RA 3LSDA 3O0XA 1QJY3 4I30A 3X29B 5GLVA 2GNMA 1S0GA 4CDWB 4D7TA 2ZJCA 1LESA 1FPN1 1QH7A 1MEC1 1ONAA 1RUE1 3OJBA 5JOWA 1OPOA 1IKPA 4LBLA 2PAMA 4LA3A 5JZGC 3AXDA 1JXNA 1VP6A 3B3QE 3AZXA 3J26N 1UU5A 1VBC2 3ZXDA 3HT1A 4ONUA 1R1A1 2PHDA 1TEIA 2CWSA 2R061 4XQWA 3ZXEA 1AXYA 2BNOA 5CAZA 2DU1A 1XYOA 3D6EA 2XWJB 2ZGNA 5I91A 3DGTA 2ZZJA 5HCFA 1RUF1 1HRI3 2WS92 2A6WA 4M3CF 5FO8B 4HZFA 3TOJA 3HIFA 1ZNPA 4Y20B 2WFF2 1SCRA 4I01A 1Q3EA 1AYN1 1YLLA 4AFBA 3OGGA 1YHFA 1D0GA 4DY3A 1D2SA 1NXMA 1FAYA 4UW3A 4AHWA 4ES9A 1NQJA 4ZU4A 3AKTA 3WV6A 1QWRA 5H9PA 4NHLA 4K40A 1DZTA 1ZRCA 3BOWA 4FCAA 1DGWA 2P3JA 4H3WA 1QXRA 1D4M1 2GMMA 2QDNA 3GZAA 3S7EA 1GQGA 1ZBA1 2D97A 1QQP3 1VAMA 1VBE1 4X6QB 3KZ4C 1YYNA 5C9AB 1JN2P 1ZBE2 4QPGC 5EZWA 3WCSA 1VBE2 2WJSA 2WZR1 3KT4A 3RYRA 3JD71 4WVMB 4QQOA 4AW7A 5C9AC 3S7IA 2XJQA 1FV2A 3RI9A 2CYFA 3MPBA 1HQWA 1QNWA 1F5FA 1NA1C 2O0OA 1SACA 2WIIB 4TYSA 4Z1VA 5JZGB 1GZWB 4X8NA 4Q4X1 1RUH3 1K5MB 4W6YA 1QMJA 2IXCA 1DQ5A 1I3HA 4ASMB 1FNYA 1DGLA 2PHLA 1KQRA 4AI3A 5DUVA 4X8PA 4YFZA 5C9AA 1OLQA 4LR4A 3FJSA 2K9ZA 2YROA 3V56A 5BV6A 1NCQA 1H1AA 2AGSA 2JX9A 2GC0A 3INAA 2C0ZA 4LBOA 5IK7A 4GH4A 1NOVA 3AXEA 1DU3D 3VBHA 1GZ9A 1XNKA 5C4WB 1ENQA 1G86A 4AHYA 2R062 1REFA 2GH8A 5E88A 3WQ7A 2PHTA 3ZFFB 4GWNA 1XRUA 1RITA 2XKOA 4HKWA 2EA7A 5C8CB 2HEYF 2RR12 2BVVA 3ZX7A 3AZVA 1HRV3 1S0FA 5E8AA 3ILRA 4RHV3 1NCQC 1VBD2 1PGL1 2ZZQA 1O3RA 2TUNA 1VAKA 5SV5A 3UJQA 3VBHC 1ASJ1 1WD3A 1BXHA 3MLLA 1PK6C 4WM8A 2Q5TA 2VU9A 3NL1A 2HWE3 5LEJA 2XJPA 5C8WA 1B35A 2D6NA 2QZ2A 4XFIA 5C4WA 2GSYA 1COV2 1OQ1A 2CGOA 4DZGA 3OBRA 3DF0A 5JCTA 3RS6A 5JAXA 2WNEA 3VHNA 1QOSA 4I2OA 1VBC3 2O8QA 4L9BA 2PA7A 3ZSEA 5JLVA 5ACA3 1ND3A 4E4DX 1R093 3WY6A 4PJYA 3JBG1 2G4IA 1XNCA 4MH0E 1PIV3 2PHRA 5F5QA 2BWAA 4A2UA 1AR82 1PK6A 1PGW1 4WM8C 3WDYA 4XFCA 3PVOA 4Z07A 4BA6A 2DTWA 3VZJA 3ZN5A 3VHOA 1RVF3 3ZYIB 4YARA 4L11A 2VXRA 3EHKA 3MPPG 1PO11 2GN7A 1WW4A 1UU6A 4FAGA 5K7PA 3FLRA 1C8M2 3MW2A 1W6MA 1YFWA 5D8AB 4IV1B 1AX2A 1SBEA 4Q4W2 1AL23 3LKJA 4XQ4A 4Q4V3 1YUDA 1SLBA 1KFUL 1DQ4A 2Q30A 1BJQA 1PO22 1FOD3 2PLV3 2CL2A 3MIFA 1TQ5A 1PGL2 1TMF3 1N1VA 4IV1C 1WBFA 2XWBB 2VUAA 1V6MA 2P34A 1TME3 3OY8A 1QF3A 4R9CA 4XJAA 3KGLA 4HSJA 1BYHA 4YVWC 1X36A 4COVA 5C8CC 2DUPA 1IS3A 2QCSB 1V6LA 1FNZA 4QD2A 2JG9C 5DG2A 4OULA 3V0AA 4XILA 3VBFC 1AR72 4HKOA 3P3PA 2ZGTA 4DNYA 1UL9A 1TME1 2P3KA 4AI8A 4IV1A 1MS1A 2BYVE 1OA2A 4XFHA 4LTAA 5BUVA 1TMF1 5LK5A 4D7YA 1C8M1 1FOD1 2PLV1 2BNNA 4KL1A 1GYKA 1AL21 5IK8A 2OVUA 3FHIB 5JVVA 2JKBA 3WUDA 5CA6A 1GQHA 5I0RA 2VQAA 4YGEA 1SQ4A 1RVF1 1Q8VA 2QZ3A 3R4DB 5E1RA 1NQDA 2YY1A 1Y9QA 3LB9A 2MHFA 4HK9A 3AP5A 2GALA 4XBQA 2I2SA 3JBG3 5LK7B 3MYXA 4BMEA 2FMYA 2Q4SA 1VBC1 2ZKLA 4TZDA 2ZA9A 4U36A 1XE8A 4RR3A 1DZQA 1RUD3 5IT6A 4XFAA 4M0HA 2AYHA 2WZPP 1RJ7A 3UKNA 3ES1A 3MF6A 3WW1A 2UY9A 1WMFA 3LWCA 4XF9A 2B5HA 5CG9A 3PVBB 2D40A 1M06G 1VBD1 4XJ9A 5KXCA 2GNDA 1MS8A 3GALA 2NP0A 1V6OA 1NY72 5T54A 2NLRA 1ZX5A 4JRAA 5KXEA 1HRV1 2ZHKA 1W6MB 4NO4A 3WG1A 1YI7A 4XF4A 2ZAAA 2MEV2 1CN1A 4NHMA 3IWZA 3GNEA 2HWE2 4DFSA 4MYEA 4N43C 1LTEA 4E4SA 2VVDA 1O5LA 2CNAA 1YI9A 4PLOA 5KHKA 3BOPA 4DXZA 5GZCA 1BCXA 3GYDA 2Y26A