5KC6A

Crystal structure of cbln1 (val55-gly58 deletion mutant)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
SAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cerebellin-1
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kc6A00
4TWTA 4QQ2A 4TSVA 5KWRA 3TYJA 2WNUB 2KA3A 4QQLA 5KC5A 2Q1MA 1A8MA 4MXVA 2AZ5A 3AB0A 2RJLA 5BNQA 3B93A 1XU2A 3URFA 1O91A 4G3YC 1PK6B 3TWIA 1RJ8A 4QQHA 1OQDA 1D2QA 2HEVF 5CIRA 4E4SA 2RJKA 2WNVC 2E7AA 2WNVA 4NN0A 1TNFA 2JG8B 3L9JT 2ZPXA 2OIIA 5HBAA 1D0GA 3K51A 4MSVA 5L36A 2O0OA 1DU3D 2JG9C 2R30A 5KC6A 4HT1T 2JG9A 1IQAA 4OUMA 4D7YA 4DOUA 3V56A 4RSUA 4J6GA 2Q8OA 3MI8A 5L19A 4MXWA 1RJ7A 4KGQA 2HEYF 2R6QA 1C3HA 4GIQA 3ALQA 1JTZX 2QDNA 4QPYA 3LKJA 4OULA 3B94A 3FC0A 1KXGA 2Z5WA 1U5YA 3QBQA 2WNVB 1ALYA 3WD5A 1U5ZA 1GR3A 2RE9A 2WNUC 2TNFA 4QQOA 2WNUA 4DB5A 4EN0A 4F3JA 1D4VB 3QD6A 3B9IA 2JG9B 2R32A 4KG8A 2QE3A 5TSWA 4QQPA 4E4DX 4OUSA 3K48A 1TNRA 1C28A 4MXWB 1PK6C 1PK6A 2TUNA 2HEWF 2ZJCA 4N90A 1KD7A 1OQEA 3ME2A 3IT8A 1JH5A 1I9RA 1S55A 1WCKA 4KGGA 1XU1A 1OSGA 1DG6A 4G4FA 1U5XA 2JG8C 2X29A 2JG8A
chains in the Genus database with same CATH superfamily
2HBTA 4Q4W1 2BNOA 5JPMB 3MIGA 4K3UA 3VZJA 2VECA 1DHKB 3MLJA 1RYYA 4E2QA 4QM8A 4ZZ5A 3FE5A 3V0AB 1QJY3 2BPA2 4P9GA 1YQCA 2WWUA 4RS5A 4EN8B 1UXZA 3W5NA 3VBFA 2A6YA 2XGXA 1R1A2 3WW2A 2RM22 4F83A 2YBKA 3CU7A 1O91A 3OYWB 1JZ6A 4OYUA 1COV2 5FY8A 4DS0A 4G3YC 3ZR6A 1I1EA 2J1EA 3GGLA 2B9UA 2HWB2 4I0BA 1RUNA 2XVLA 2PAEA 3BOWA 2HKXA 3KM5A 1AR62 5IVYA 4NO4A 2NZ9A 4PF5A 4GWMA 3T2TA 2WINB 1HW5A 1K3IA 1KRIA 2RS33 4E9KA 1DQ5A 2WNVC 1OOPC 1B09A 5HV4A 4EWDA 5JAXA 1IPSA 2FDGA 3NO8A 1W90A 4YGCA 4EJRA 3MPBA 4DUXA 3AP7A 2W0XA 1GWMA 1AVBA 5JXIA 3MGUA 3I49A 1CPNA 4IEOA 1N3QA 2BEOA 4MSVA 3PU3A 5EPAA 3UKTA 1VBB3 2PHLA 3ACGA 5D1IA 1S4CA 3HT2A 3VD4A 2R30A 3KF3A 1QOOA 2IUWA 3KV4A 3LPFA 1OA3A 3SH4A 5A3MA 1US3A 3NAPB 3ZO0B 5J36A 1HXS3 3MI8A 1DYOA 1LOAA 4QX0A 3ST7A 3ZLIA 3T2OA 3WCRA 2KM2A 1W6QB 4Y4YA 2BV4A 2RJ2A 1WD4A 4M00A 1CAUA 4AHYA 1MS8A 1W2TA 1N3OA 1NX9A 1VBA1 2OW4A 3I3DA 5HCAA 4BQYA 2BW8A 1UOFA 1C57A 2OS2A 2BYVE 4LHNA 4NIIA 1NCQA 1XNDA 1RIRA 2IFRA 2I07B 4QDRA 1RUC3 3H8UA 4LIVA 1UOJA 4AEKA 5E6HA 2YBSA 3ATGA 1QWRA 2VVDA 2DCKA 3QBQA 1SHWB 2JICA 4JC1A 2E31A 4LK6A 1W8ZA 4X6QB 3TEYA 5C8CB 5T52A 2PA7A 3OBZA 4QHZA 4COVA 3RZHA 1HV0A 1MR5A 1PIV1 3BI3A 1RL3A 3MLLA 1UU6A 4LUKA 4DRVA 2EXKA 2IXLA 3LOIA 1NCRA 1AL0G 2VW0A 3CNAA 3VZOA 3ON7A 2VZQA 1NQJA 3WNXA 4FT8A 4CEWB 4RGAA 5G05L 1PX4A 3AP9A 4HSJA 3DKQA 3VBSB 3J26N 1WCQA 1DGRN 1VJ2A 1XNTA 2VUCA 4B3NA 5JSPA 4X6RB 3FBYA 1GWLA 3WG4A 2R062 3VDCA 1H8VA 4INDA 5FZ8A 5IVFA 2BRTA 1JYXA 1NQDA 4QX5A 2QBXA 3OSDA 5LB6A 2HWF3 4Q4X3 5J09A 2K46A 1O4YA 1S0EA 4Y20B 1ASJ1 4CCKA 1M06G 1C8NA 2Y6KA 3FLRA 4CXXA 2UY9A 5A1FA 4BIOA 1VBA2 1J58A 1PMIA 2IXKA 3MPPG 5BNPB 5LA0A 1RUF1 1VPHA 2ORZA 1WMXA 1W3VA 2WNUB 4MH0E 1X7NA 2HWC3 4KH9A 5AVAA 5KXBA 2WO2A 2Y6FA 1RUI3 3ZYGA 3W5MA 4HKLA 3D6EA 1J59A 1HN0A 3VZKA 5KHKA 2J1VA 4GJZA 1QJX1 5AC92 2VBDA 1CR7A 1XE0A 4FQZA 3G7DA 3KT7A 2W2IA 5FZHA 2QVSB 1LOBA 1E5RA 4XFGA 4WM7A 4YVWB 5A7PA 1C1FA 5DUVA 4AQ2A 1GWKA 2EXJA 3MLKA 2VULA 1OD3A 2ZX3A 4OFGA 2ZX0A 4WM8C 5K0UA 3VB9A 4KL1A 1C8M2 4M01A 4XACA 3RZKA 1GNZA 1V0AA 4FFHA 4NOTA 3C3VA 2AREA 5CAZA 2ENRA 2OQ6A 2VUJA 1Q8SA 3EYPA 3WY6A 2ADEA 4MGTA 3BN6A 1IPKA 2C5DA 2CWSA 3FFQA 4OQ9A 1BCXA 1ULCA 2FCVA 3HD8B 2ZAHA 4EV0A 5LASA 3LPGA 4CP0A 2RG4A 4CDQB 3DKWA 1XE8A 1BYHA 5A33B 4RS5C 2OIIA 4O65A 3OGVA 4NMIA 4UW4A 3VDDB 4XZUG 1ENRA 3K51A 1F15A 2JDHA 3EB7A 3OUHA 4Q4V3 4RQPB 3UGHA 2C1FA 3D0SA 1H8TC 1RTVA 2YC2A 3OPWA 5A80A 3RYRA 5HXMA 1JYIA 5BPXA 4IV1A 3AKQA 1POV0 2CGOA 4W6YA 3VD5A 3P1IA 1F5JA 5HXVA 3H42B 3MZHA 3AMHA 2JDKA 1NLRA 1PVC1 4CP9B 4JKMA 3H1MA 1HJGA 3DECA 5FPAA 2OX0A 5FKBA 5LW9A 1DGLA 1JTZX 1OH3A 3U78A 4COZA 4XF4A 1KXGA 3I7DA 3ROUA 4B8EA 5FYVA 4EE2A 1V6KA 5C9AB 1RVF2 4I30A 4IW3A 4Z8BA 2F6BA 2WKKA 1LHWA 2JDAA 5IATA 5FY4A 5AFBA 2W92A 1GR3A 3THCA 5BNOB 4PIYA 2JJ6A 2JKXA 4KWKA 4AQ6A 2QQLA 5H9RA 3AP5A 2UYBA 4DXTA 4EWEA 3BTYA 4UT5A 2LS6A 1UZZA 1UY0A 2A3WA 5CBLA 2LALA 2Y0IA 1WMDA 3ZXAC 1N1SA 4NRMA 4OVEA 3QH7A 3CZJA 3JB8A 3HNBM 3QH6A 1RC6A 1H4GA 1I5PA 4MXWB 4WV8A 3ZN6B 3HQRA 2SBAA 1QOTA 4N8MA 4PBPA 4J1XA 1UZ0A 4LULA 1ZRDA 1LENA 4JDNA 5A6ZA 5FMBA 3S7IA 3SNMA 1EYBA 4A6OA 4LT5A 5L9RA 4AFDA 4B1MA 4Y24A 4UFJA 2VPVA 4HK8A 1D4M3 3WNPA 4CDXC 5D8AB 2ZZQA 2QQIA 1LHVA 1NG0A 1UU5A 4NAMA 1AR93 5HCFA 3WG1A 2ZGTA 5DQ0A 2P3IA 3H8RA 3ACIA 5FY9A 5FOJB 2OA2A 4SLIA 1YCIA 1YWKA 5A7WB 3TYJA 3I3BA 4RFT0 2VTXJ 1Y7BA 4AVVA 5K9YA 2HWE1 2VCMA 1N1TA 1HKDA 3V64A 1ULDA 5FZAA 4ZXEA 3WHUA 1RHI2 3K75B 3OD4A 1PZ7A 2YXSA 2ZGMA 4N53B 5EJ3A 4BMEA 5BNQA 3NKTA 3RZGA 5CG8A 1RB8G 1JYTA 4CEYA 1W9WA 3PHMA 2RS51 1J83A 5F5CA 3PIGA 1PNGA 1O8SA 2PLV3 5CNAA 1UU4A 5EXOA 3KD4A 4CUGA 2BBVA 4IERA 3WQ1A 2MEV1 3ZXGA 1J3RA 1ST8A 3PU8A 3SLIA 4Z92B 1D2QA 5CIRA 4YM1A 3RI8A 1JZ8A 3N4MA 1MQTC 3CL1A 4RHV1 2Y64A 1RUG2 3WP3A 3UGFA 1S1AA 5T5JA 4TTGA 1VB2A 1GZWA 1J1LA 3ZFEB 2CGPA 3LAGA 1AR81 3LOBA 4EYUA 3TOJA 5I8TA 4LBQA 2GH2A 4OZXA 3RZMA 1TME1 3PIJA 3FLPA 3VBRC 1C5HA 1IS6A 4FPYA 5BNNA 1V9U2 4M3CE 2BP6A 3SISA 1DYPA 1R1A3 1ZZCA 3E6DA 4EZ4A 4J6GA 1ND2B 1OUSA 5FMDA 4CE8A 1F4HA 4XVHA 4DIQA 4P9LA 2PHFA 5AFEA 4XCBA 5FXWA 3ZM8A 2HWB3 2DURA 2DBIA 5FO8B 4N43C 4XC9A 4B7EA 4LJHA 5I0UA 1OI6A 1CD3G 1ZZBA 1K5MB 4OULA 2RDNA 1HRI3 1QIQA 1YI7A 2D93A 2Q4SA 4DNYA 4AFBA 1QJY1 2NP0A 3IZOA 5I0SA 1YYNA 4A7KA 3OY8B 4XHBA 1G86A 4XF1A 3ZFGB 3KWVA 4DO0A 2EF6A 3D82A 3O5SA 1U5ZA 2JKBA 1CN1A 4JRAA 1XRUA 4IE4A 4ASLA 1CAWB 5A3WA 2ZABA 3V65A 2ES3A 5FY7A 4NWVA 4F7ZA 5K8SA 3X29B 4TN7A 5FYUA 3ZSLA 3UNPA 3Q9OA 1HB3A 4HPKB 5I8SA 4A7ZA 1EUTA 2PQQA 4QWNA 1ODNA 1S2BA 5JZGA 3PLQA 3ZIWA 2XBO3 2RS31 2DWRA 1K5JA 3IAPA 2L9LA 3OBAA 2A7AA 3B7MA 1TME2 4GULA 1PK6C 2WQZC 4UFLA 3WZ1A 2ZS6B 1VB4A 2WQ8A 4BCUA 5FO9B 1Y9GA 3POGA 4TZDA 1J1TA 2E33A 3O1OA 4ZS2A 2R0FA 1REDA 1VBB1 3AYCA 4R52A 3KCYA 5FPXA 4AI1A 1T6GC 1T2XA 5LRRA 1OSGA 1HXS1 2FDJA 3B02A 3Q8EA 2QQPA 3DGTA 4AZZA 2JG8A 1BKZA 4JKLA 2YBPA 4LBJA 5F3CA 3AMMA 1NE6A 2Y6GA 4QAWA 1VLNA 1DQ4A 2V5YA 5FFOC 1QJY2 2GZWA 2J7MA 4QPGC 4QX7A 1AX0A 3NNGA 4W65A 4JX0A 4AGGA 1EV12 2X5IA 3AL5A 4D69A 2ET7A 2QJVA 1OKOA 4HZFA 2I45A 1RUC1 4XTMA 2XL7A 1ZRRA 3DL3A 4FOYA 5CFCA 1UXXX 4QT6A 3TN93 3AZVA 5FZCA 3KT4A 4QGNA 3WQ0A 2JE7A 3UJOA 3ZFFA 4B29A 5A7QA 4D8MA 3BCWA 2OKXA 4NWWA 1OH4A 2X10A 3CF6E 4IGPA 4DXRA 4MUVA 4AF9A 2RVAA 4GA9A 1CVNA 1J3PA 3BPSA 3DF0A 1W2UA 1VE0A 2PHRA 5IWFA 3D3AA 3LDRA 2RR12 2Z4FA 3IDBB 4NHLA 1QNYA 2VXJA 3GZAA 1SMVA 3LIHA 2CU5A 2VVEA 2V09A 3BU7A 3L9JT 5CFDA 1WA4A 2Y6LA 3AM2A 2ZPXA 3KQRA 2AH2A 2GU9A 1VBB2 1QHDA 4YM2A 4ES9A 2J1AA 4CTEA 3WLUA 1SCSA 5FK7A 2QZ2A 2HWF1 5FLJA 4Q4X1 1SEFA 4CXWA 3DUIA 4CPBD 2JG9A 2ZHMA 4D7YA 4J1WA 3RZJA 4QKDA 4P9XA 5AC93 1NA1B 4EROA 1GQGA 3B9CA 5ABJC 2Z2SB 4FBFA 3M70A 4IL7A 2DYCA 3G6JB 5E16A 3VBUB 4I2OA 4XCAA 4QXBA 3ZSJA 5JVVA 2YC4A 3WT3A 1OLME 4KMQA 2BOJA 5CKNA 4Z2AA 2HWC1 3GJBA 5F2SA 3CJIC 1GU3A 3JQWA 4ITCA 4DXZA 1OURA 2P6HA 1RUI1 4JGYA 4XFCA 4QPWA 5FZ1A 4YVSC 4CDUB 1DP0A 1OVSA 2JDNA 2WWSA 5FLHA 1O6UA 2D6KA 3USUB 4QM9A 1PGL2 4TXWA 2D6LX 5IUQA 3VGIA 1QJFA 3AMQA 2R16A 3P3PA 1UY3A 1QU0A 1GZTA 1YQ6A 4IUGA 1DDLA 2OPWA 3K46A 1A78A 4UXAA 4NHXA 5EWSA 2XVGA 1V6JA 2E51A 4XIOA 2JD4A 1RINA 1W8TA 2WA4A 4EN7B 2VD7A 2LTNA 4K20A 1DQ2A 2D6OX 4X8PA 3NL1A 3WNNA 5CA6A 4LBMA 3WV6A 3SEPA 2HEWF 2FD8A 2Y0OA 2ZGQA 3JUUA 2XJVA 4LE3A 3ME2A 3IT8A 2WZR3 2JX9A 1UAIA 1JH5A 2JE9A 4XW3A 3SITA 1PO13 3U14A 1KJRA 1RVF3 3EBRA 1AX1A 2EIGA 4FPKA 3AXDA 3T0AA 1URXA 5F3EA 3S7EA 1G9DA 3MICA 3V0BA 4DUVA 5DN2A 5FMOL 4PDWA 3SMHA 1U5XA 1A34A 3IKWA 3TRSB 4IV3C 3ILFA 4IEWA 4AG4A 2P3KA 3WW1A 2HYKA 2WDBA 2WT2A 3WW4A 1VAKA 2WO7A 3O0WA 1O5UA 1TVGA 4L92A 1JHJA 4Y5SA 3VDAA 3OBRA 1JI6A 1PHMA 4S2FA 5L7OC 1W8FA 4KWJA 3VZNA 3U4XA 2N7GA 3B93A 3S57A 3OGGA 2BGPA 1F9KA 2XL9A 4MLOA 4NVPA 2C0ZA 3HWJA 3JBG2 4O9EA 1W8NA 3VHOA 4CDWC 3TEXA 1IQDC 3T1MA 3AX4A 1PVXA 4GH4B 5F39A 3FUOA 5JOYA 1GYKA 4HK9A 4IE6A 4BZ4A 5KHJA 1GZCA 5A3PA 3HR9A 2OXBA 1CIYA 5LBFA 3GM8A 3IM0A 3NV4A 2JDYA 1EAH3 1MZFA 1UNBA 2VZ3A 3THTA 1UX7A 1JHNA 4URAA 2D6MA 2WNVA 1OOPA 5IVJA 1IKPA 4S2HA 3FWEA 2E9QA 2IWGB 2P1BA 2W08A 3MFAA 3AFGA 5IVCA 3JZVA 1RUE2 4OHZA 5HBAA 1LR5A 1P8JA 3CBNA 1GV9A 3W59A 4Q4V2 1BJQA 2XG3A 3U07A 2BDRA 1SFNA 4BWOA 3WQBA 1RHI3 5K7PA 4BQ2A 3PMSA 4LXLA 2VG9A 3D8CA 2Y6JA 3CLPA 3PUQA 4A7YA 3BALA 4HKWA 1DZRA 2PHXA 3HQXA 1TMF3 1FOD2 4UF0A 2EIBA 4YW2A 1GQPA 2PAKA 5L19A 1AR91 4DFSA 5DUWA 4Y4RA 2ZEWA 4AVTA 1RJ7A 4YZ2A 3WF1A 1E5HA 1H1IA 4Y1ZA 1MEC3 2QZ3A 3POYA 1AUYA 3VBOB 2YU1A 2VOVA 4LOTA 5CYYA 1ZZ6A 1PGW2 5JR2A 2Q8CA 2JENA 1F35A 3CMGA 3PURA 2EVXA 3HQUA 2JEMA 3ZIXA 3LEIA 4DPNA 2UY8A 3HBZA 1LEMA 2YGMA 4QPIC 5FV3A 5LCWL 5I0DA 5IVVA 2PFWA 5F3GA 3A21A 4NR1A 4QQOA 4L8QA 1YLLA 3E6BA 3T0BA 1X8MA 1Q3EA 1VBE3 1V9U3 3N9OA 3R6SA 3IIAA 3IPVB 4ZHNA 1AHSA 3PL0A 1MS1A 2K9ZA 3UT0A 3H1WA 5C4WB 1R082 3SHRA 1WW7A 3UKNA 4Y22A 1YRZA 2W47A 3W20A 2GC3A 2WFF2 2XQXA 3D4KA 2XJUA 3MEPA 3RNSA 1TNRA 4D0QA 3E97A 4OHYA 4LOSA 4AVCA 4OHWA 2TUNA 2ZJCA 2EIEA 1O4TA 4XQ4A 1D4M2 2GMEA 2VE1A 1AYN2 1Y9QA 4LO8A 3RMXA 3E5UA 1W6OB 2D3SA 5H9SA 1K42A 2BOIA 5CB7A 5J48A 3T2QA 4KNCA 5ANNA 1R1A1 1YC61 2RM21 2A70A 1D2SA 2WWJA 3M3IA 4DQAA 5GM0A 1KDKA 1COV1 5FP7A 1LHNA 3LZZA 2X29A 5LZ6A 2JDMA 4HONA 3ZMNA 5JXGA 2HWB1 3WF4A 2WJSA 2DFBA 4TSVA 5DAXA 1G7YA 1V6IA 2EXIA 2JE8A 1AR73 2IXCA 2BU9A 1A8MA 2J1TA 4G9SB 3AZZA 4LE4A 3NAPC 1IS3A 4I3PA 1JU4A 1BXHA 5IT6A 1SLIA 3GNEA 2PLV2 2NLRA 3BPZA 2ZGLA 1PNFA 3NJXA 1LULA 3MV01 2X5IB 4AXOA 3VUOA 4BU2A 1HQWA 5LBEA 4AE2A 2BJSA 4LMFA 2IVJA 5JOXA 1BVVA 5A7SA 2XONA 5LEJA 4WM8A 3VL8A 2G19A 4YZ4A 3VHNA 5FYBA 5FCCA 1VAVA 5GZEA 3BB6A 3INAA 4Z82A 3VLBB 2XH6A 4XZPA 5JXJA 3IN9A 3OJBA 3RI9A 2XBO1 4HMZA 2R0HA 2I2SA 1LECA 5C8CC 1RUH2 1G9CA 2GMPA 2YUEA 2PQSA 2VCAA 4NROA 4U2AA 4XUPA 3T2PA 2FMDA 1EV13 4FPOB 4UYBA 5CISA 5FYTA 4Q1RA 1STMA 5LA2A 1Q8OA 1DU3D 1FYUA 1HQLA 2XHNA 3KT1A 4PLMA 4CEWC 4FPGA 1SLLA 1H8TA 1UZVA 2XHKA 4RSUA 4NHMA 5F5QA 2B4KA 2XJTA 3U37A 2PN5A 2VNGA 2ZA9A 1UKRA 4NJ4A 5GALA 2QQMA 3POFA 5I8YA 1OXCA 1OF4A 2R6QA 1WCUA 5LA1A 3O1TA 1GNHA 1HRI2 2PHUA 3UYJA 2YHJA 1CAXB 1YIPA 2RDRA 4F8AA 3M3EA 3C7EA 4ZU4A 1UOBA 5FXZA 3CKHA 5LWBA 2ZGSA 2RR13 2A6WA 3IDCB 5FP4A 4MVTA 2LM3A 3ZR5A 1FV2A 1JZ4A 3NRUA 3HBKA 3H7YA 1G9FA 4BQXA 2ZGOA 3RDIA 1UPIA 1EUUA 1GOFA 2VXRA 2WO3A 4YW4A 3BTXA 1WLWA 2GC1A 3AZYA 3WP6A 5BNPC 1JYNA 2R061 2VU9A 4XDPA 3TN91 3I2GA 2LRPA 3LA7A 4FI9A 2WNUC 2W1SA 3OBTA 4JDOA 3GCWA 1LKNA 2GAUA 3QD6A 1LU2A 5FZGA 1W6NB 4V2WA 4I0WB 2KXLA 4PI0A 3FHIB 4RR3B 3EQEA 2XBO2 3HEIA 5C5TA 3N7LA 3F95A 5FXVA 4MO3M 1MZ5A 5A1AA 4NPMA 3SXWA 1GP5A 1NZCA 1Q5OA 3CQOA 2JDZA 4QXCA 3ZVXA 3K48A 4Q0VA 5GKAC 5FJHA 4M3CB 3KLSA 4RGGA 2OYZA 4D7SA 2G4IA 4FTBA 4C91A 2IXHA 4L2NA 2FZ1A 5FZEA 4N9IA 3ZSKA 2FZ2A 1LHOA 4XJZA 2ZEZA 2AUYA 3FJSA 3OGJA 4GMP3 3AKTA 4CDXA 1YFYA 2DFCA 4MGQA 1BQPA 5AC91 3RS6A 3ZX7A 1QMJA 1ONAA 4QX8A 1XXNA 1W0NA 2OUHA 3M3OA 4E8DA 4XF9A 4MV2A 4XDQA 1W6PA 2ZX2A 2CY6A 2QFEA 1R64A 3I2JA 1H9WA 2R1DA 4QQ2A 1LTEA 2EALA 1C8M1 2GN7A 2XR4A 2Z69A 3VDDC 2BFUS 1GLHA 1OA2A 2CDPA 4E4HA 1O59A 4LKDA 2WN3A 1H1MA 4JGZB 2D43A 4O9GA 4RQPC 5C6CA 4PQQA 2RDSA 5FZOA 3AB0A 2E32A 4YM3A 5ACA2 1QH7A 3IIIA 5I91A 3FBMA 2WZ8A 3TN92 1E57A 4HVRA 3WF2A 4NIGA 1AXKA 1CAVB 1ND3B 2PXJA 5JDBA 4AEDC 4CZSA 1W2OA 2SLIA 1KEXA 1BBT3 4GALA 2VTXA 5IK7A 1RUJ2 5FUIA 2DCYA 1H30A 1KQRA 4YW6A 2E7TA 4M0HA 2D3PA 4PCRA 1DFQA 3KMHA 3ZYBA 2W3JA 1UW8A 3J9SA 3FL7A 5C9AC 1MQTA 4EWAA 2R043 1Q56A 2VMEA 5IVBA 2GP3A 1QXRA 1POV1 3IMNA 3KS7A 2EICA 4JHZA 3RQ0A 2FMYA 2XDVA 3RRDA 1EP0A 5BNOC 1YI9A 4YLZA 4GQ7A 1NYWA 1L7LA 4ASMB 2YZ4A 3WNKA 4PF1A 4AI0A 4CCCA 3VBRA 2C9KA 4AGVA 3KGLA 1BZWA 2WFPA 3CEWA 3ORJA 1OPOA 3J7MA 1RVF1 5ERLA 1O8PA 1CWPA 4TLFA 1Q8QA 3DXUA 3M7AA 1FMD2 5LATA 5F6KA 4FPJA 1YHFA 1B35B 1W06A 3JBG3 1ZBA2 2E7QA 1IHMA 1YQ5A 5J1XA 1O7FA 3FX3A 5A1LA 1R092 3LEKA 3ELNA 1JOBA 4LHSA 4N43A 4UFKA 2VTFA 4HKOA 4Y1XA 3UKVA 4NE9A 4ES8A 1MZEA 2P3JA 3PUIA 1V6NA 3WINE 5D8AC 4CCJA 1X36A 1XSRA 3ACHA 3ZOIA 3K4ZA 4FSJA 2GNTA 1YJLA 1VMFA 3WHTA 4JKKA 5JLVA 2K0GA 1S2EA 2WRAA 3DYOA 1N3PA 1W8UA 3VBHB 5F5AA 1NUKA 3B5LB 3HNMA 3T4VA 3O1MA 1JN2P 1DLLA 1RUE3 3MW4A 1LESA 2WZEA 5FBJA 3MW3A 2TNFA 3O12A 4P9IA 3VHRA 3TNQA 2FQPA 1SLTA 4ASKA 1VIWB 1V6MA 4URTA 3SKVA 1FOD3 3GYDA 4N53C 1UPSA 1Y4WA 4YARA 1EAH1 4ZS3A 4D6RA 3I59B 2A6VA 2JIJA 1LGCA 5JIAA 3EXUA 1UMZA 3PUHA 4I0AA 2P4EA 1PK6A 1TG7A 2ADDA 2WZR2 4KU8A 1YFUA 2XLAA 1CZVA 4A2UA 4CP2A 1PO12 4HLTA 3T0DA 4UFMA 1D7PM 1RHI1 3KCXA 4HANA 4BOWA 5F37A 2WR9A 3U0ZA 5FXXA 4GWNA 1CZTA 3W21A 2VL4A 5A3NA 3FUQA 5H9PA 4FOVA 5E1RA 1XYPA 4XPVA 3ZFEC 2XLGA 2W68A 2VMCA 2XJSA 5FAXA 5I0RA 2VOKA 3PDQA 5IFTA 1W99A 5GZDA 4NHYA 1A6CA 3MF9A 4FOQA 5EYYA 4YZ5A 1W6MB 1APNA 1UL9A 1R083 3M2MA 4QPGA 4WVZA 3LE0A 1FXZA 1RUG1 3MIHA 3THPA 1ND2C 2WFF3 3B00A 4XBQA 3JXSA 2OT7A 2PMWB 4CPBA 2P17A 3ETQA 1G9AA 2VBPA 2WYFA 2IXIA 3MIEA 1S0FA 1YIFA 3T30A 2PHDA 2XUEA 3CHXA 3NNJA 1C5IA 5FYMA 4DY3A 3MYXA 4AQTA 1ZRFA 1GMMA 5FZ7A 3P5BA 1AYN3 1R1ZA 4JHTA 2VNOA 1KFXL 1J84A 1K5MC 1XC6A 5EZWA 4OUEA 4Z1VA 3EJKA 4A3XA 5BUVA 1V9U1 5CEHA 1EAH2 5HI0A 5JWPA 4YG6A 5LEKA 1TQ5A 3A4UA 3EHKA 4JZRA 3OEBA 4LBOA 4GD4A 2WA3A 4R9DA 1KGYA 2ZMKA 2R49A 3ZFGC 4A6SA 4W50A 4R4XA 3LSDA 1GSLA 5C3SA 1NXD1 2GMMA 4LBKA 3HOBA 4BJ0A 1LODA 3AKRA 2DTYA 2ZKNA 4AVSA 2C24A 4C90A 2XQRA 5F5IA 2G9ZA 1M4WA 1WWYA 2V4VA 4WVVA 5FZKA 5IK4A 1ZRCA 1QDOA 4QDQA 2ID4A 2DUPA 3A23A 4PBOA 1TMF2 5FKCA 3PVBB 3W58A 4BIFA 1CESA 3N9LA 1PO23 1XB9A 4RS5B 2WN2A 3IB3A 3KB5A 3VBFB 4O7XA 2GSYA 4S2GA 4QPIB 1MEC2 3PJYA 2WBKA 4FPFA 4QKFA 5ABJA 2XB6C 1H6XA 4XXPA 3WNOA 4AVBA 5IHRA 2MNGA 1X9TA 1LOGA 1W8OA 2VQTA 4GIQA 1AR71 3E5XA 4Q8KA 1JU3A 4YWAA 2AR6A 3LKJA 3ZSMA 4WVMA 3E5QA 5KBFA 3CJIA 2DVGA 3MV11 2UWCA 1QDCA 4IGOA 5F6LB 1S0JA 1S0BA 2VJXA 2D44A 3WDVA 1EPWA 2ET1A 4YVSA 1RUH3 2ZMLA 2ZGUA 1U0AA 2NPIA 5HPOA 2D6NA 3S5AA 5KHGA 3SEEA 5A3LA 2CYFA 4N9HA 2RE9A 2D6PA 1VBE2 3S5QA 3WOGA 2Q30A 3A7QA 3AFKA 1SLCA 3GBWA 3O0VA 1TE1B 1WLDA 1F2NA 2UWBA 4QXKA 2BUKA 1XJAA 5FQ0A 4K8FA 4BQ5A 1H9PA 1RUOA 1XSQA 2W52A 5A32A 1BEV2 2VZVA 1AXYA 4HSLA 3E6CC 1DIWA 3JU9A 1HRV3 3AMPA 4GJYA 4N90A 4W8JA 1CAUB 5LBBA 4ZKTB 5L9BA 3PUAA 2ZHKA 1NT0A 4YW5A 3TEZA 1EV11 4XUQA 2Q8DA 5GLUA 1X50A 2DVAA 4Q0PA 4SBVA 2WLPA 3KF5A 1WCKA 4FPCA 4OHXA 1NCQB 4Q8LA 5GJ6A 3SCFA 3N9MA 2A1XA 3OCPA 4IDZA 1DG6A 2XJRA 1ZYBA 1JZ7A 4YW7A 1UIKA 4LORA 4P14A 1ZA4A 4QB2A 5FYZA 3P6BA 3GHNA 1PX3A 4P02B 4E2GA 1AR72 3I3EA 4IV3A 4I01A 3PTRB 3WNMA 3ACFA 3NMBA 1UO9A 2J22A 3RMYA 5C7GA 3GCXA 1JBCA 1UZWA 1Z7S3 1WW6A 1HN1A 3KV9A 1NCRB 1W6PB 2RR11 1W2AX 1W04A 1NA1C 4OHVA 1DZQA 5LY2A 3RYKA 4M3CF 4N7IA 3U75A 3HPNA 5L7OA 2BGCA 2Y26A 5GLWA 1GZ9A 1JOPA 3VBUC 4CSWA 3I2KA 3URFA 1WLCA 2RMU2 2GNBA 1AZDA 1WKYA 2OQ7A 3BGAA 3DPRA 3POIA 3WEZA 4CDWA 4MOAA 3JCIA 1OMIA 1LEDA 2QQNA 3PMEA 4IEYA 3E1F1 4Q4W3 4QB1A 1WMFA 3LQCA 4W6WA 5DDJ2 3RSJA 5SV5A 5L9VA 4E27A 4CDUC 1TZOA 5F8PA 4AEMA 3L2YA 2VGDA 3N7MA 5FRAA 1A3KA 1HJFA 4R9AA 5EIYB 2BERA 1UOGA 1HIXA 2QTWB 4A3ZA 4YZ1A 3VL9A 1JZ3A 5FPVA 1NLSA 1RMU3 2H0BA 3J8F2 1MS4A 3NNFA 4XJ8A 2AACA 4M0NA 4XILA 2JDUA 2VBBA 3ZYRA 5GZFA 5ACA3 2AENA 3TBDA 3AK0A 3PVNA 1VALA 5AVPA 2VNRA 1Y9MA 4GMP1 4DOUA 3T3YA 5FOBB 4MHRA 4WBBA 4C0BA 4CUAA 2OVUA 2TEPA 1ZM1A 4MGSA 4MGYE 3VBRB 5FDBA 1PGL1 1YQ2A 1RUJ3 1SPPA 2QNKA 4JQRA 4IQPA 1FPN2 2J1RA 4QHBA 4C0HA 3CIHA 3VN4A 5C8WA 4WM7B 3H7JA 5T3NA 3RJRA 5K0UB 1OUXA 3NVCA 5DUUA 1V00A 1QQP2 3VHPA 3CZUA 1F8VA 4C1XA 4GZ9A 1XNAA 2FDIA 1NZIA 3S30A 5C3PA 2RDQA 2EXHA 1XNKA 4OI1A 1AXZA 4K1ZA 3LEGA 2FBEA 4LO7A 2CWMA 5IYYA 1J3QA 3VKFC 2ZEYA 3N7KA 4IE7A 4QPIA 3D0JA 5LK5A 5FZIA 2BFUL 5CU1A 2WAAA 1S2KA 1W28A 2ZGRA 4BMBA 4NRPA 3H50A 2HWD2 3KSCA 4ISQA 4EN9B 4DMIA 2VMIA 1FMD3 3V0AA 2DCZA 2J1SA 2XJPA 4JTOA 4XHXA 3MDPA 4I09A 4KG8A 1ZBA3 4IV1B 1NY72 4QGMA 4XUOA 2W87A 1CONA 1OA4A 3OYWA 1PMJX 2NMNA 2BBAA 4NRQA 1R093 4CCLA 2PAMA 2BWCA 1RUD3 4GH4C 1L7QA 4GMP0 3WG3A 1UYXA 3ILNA 4GWIA 1OQEA 3ZXEA 4D6QA 5FWJA 3O1UA 1H1AA 2VQAA 1PZ8A 3ZYJB 4BISA 4COWA 1ODMA 2RV9A 4IEZA 2VZUA 4UI9L 3ZN4A 4IEVA 2W1UA 4YRDA 2FDKA 1KDMA 2XOMA 2A6ZA 1I6XA 1REEA 1OLRA 3WUDA 3JBG1 5FO7B 1DBNA 2ZTNA 2BTVC 3BTZA 2AGSA 3GZUC 4BK5A 5JI9A 4DUWA 4IETA 5KWRA 1U5IA 3LSEA 4OI2A 2D5HA 2W1WA 3P3NA 2ZCWA 4BQ1A 2ZEXA 3KVBA 2Q1MA 2W94A 4XDOA 5FZ6A 5FTTC 3AZXA 4LKFA 4AFAA 1IG0A 2W5FA 2Q5TA 1NAEA 3NAPA 1ULEA 3BOPA 4OZOA 1BBT2 3ZYFA 2JD9A 1XU2A 4L11A 2PHTA 5BY5A 5JXHA 1BHGA 1VBD2 1W6QA 1RUE1 3ZXJA 2A75A 1ASJ3 4D3WA 3LFMA 4Q4V1 5FZ0A 1QOSA 3AP4A 3MIBA 3VBOC 1US2A 4IESA 4ATEA 3O1VA 5IJRA 2UYAA 2Y8KA 3M8LA 2R042 4CXYA 2AEYA 2HEVF 2V4AA 3FN9A 1FOD1 4FXKB 1UIJA 3JD72 4LO6B 1MS0A 5EFUA 3DYMA 2JB4A 1RXGA 1GUIA 4PIXA 2Z79A 3IMMA 5C8CA 1X82A 3PJQA 2ZAAA 4Y5TA 1DGWA 1PGW1 4V1PA 3A22A 4LUMA 3TNPB 5IFPA 5J3UA 4AYUA 4XTPA 3T08A 2W9XA 1POQA 1XYNA 2GALA 3PVEA 4ZONA 3FLTA 3U1XA 2GNDA 2X05A 3UESA 5C4WC 4HT1T 4OUMA 1N47A 4CEWA 3DPRC 2PHWA 3AL6A 1LRHA 2GNMA 1DQ1A 1FT9A 2ZX1A 4MADA 2Q8OA 4CEYB 3VBSA 5F1RA 1QJU2 3ZSEA 2C6SA 2O8QA 3T1LA 1WGPA 4B4PA 1HB4A 1YUDA 2VCCA 5JSRA 4LQRA 1SG3A 2VNVA 4X8NA 1ZZ7A 4XURA 4YFWA 2YYOA 1VRH2 3ENRA 2QDNA 1WCDJ 2WAOA 4LPLA 1R081 4OLLA 2BZDA 2XMLA 3FC0A 3NV2A 4Y20A 1KJLA 1S0GA 2B45X 2Z5WA 2WFF1 1DQ0A 4QX2A 2J42A 2RS13 3KGZA 4Q5OA 1GZWB 1LGNA 4XIKA 1OQ1A 2YGLA 4DXSA 5BNPA 4LBQB 5FYHA 1D4M1 2BNMA 2WYSA 1AYN1 1YFWA 2WNUA 1JODA 4L99A 1ENSA 3RJ2X 4DB5A 5I0TA 1D4VB 4CVUA 4WZCA 2R1BA 1UF2C 1W9FA 5EP9A 5DAWA 3ES4A 5DZGA 5BNNB 5IW0A 3DN7A 4HL0A 1WW5A 2ZGNA 3QOPA 4R4ZA 4Y33A 4HOOA 3IBMA 4UWDA 3WF0A 3C8XA 3OUJA 1ZX5A 4B1LA 2JECA 4NIHA 1Z0HA 2ARAA 2ZACA 3ZYPA 4BLJA 2BVVA 4YVWA 1S0CA 2YFUA 1LOFC 1W05A 2E26A 2Y34A 1UCXA 2R072 5IAVA 5EJ1B 4XFAA 2OZJA 1JMUB 2VMHA 3O1PA 3GF6A 4E8CA 5FZ3A 1O3SA 2PLV1 2IZWA 2W1QA 2EAKA 2XVKA 4QXHA 4N7UA 1G6NA 2P5BA 3SQOA 1H6YA 5A70A 5FYIA 3IDEA 4ISRA 5A33A 2ZZJA 3ZDSA 3MHZA 3JQXA 2VZ1A 4BM8A 5KC5A 3LCPA 3VDDA 2EAAA 2WSUA 4O61A 5FPBA 1H2NA 4KI5M 4AL9A 4ZU7A 1SBEA 4QU1A 1KFUL 4RQPA 5KXEA 4CCEA 2AZ5A 4QX1A 2DF7A 4ONUA 2FHRA 3R0RA 5JZGB 1Y3TA 1BEV3 3DEMA 3PVOA 5FZBA 5L73A 3VD9A 2OPKA 1IOAA 3LD8A 1RUH1 1UX6A 1HX6A 4AW7A 2DVFA 4AEDA 2CTVA 5FZLA 4CP9A 1G8WA 2JIGA 3EMRA 4XJWA 4Q26A 3RWKX 2A5ZA 3S0MA 4LEJA 4P9JA 4EZHA 3WG2A 4PQ9A 2D7FA 2FCTA 4H7MA 5IK5A 1ZZ8A 1T6BX 4C1WA 5DG1A 1YEWA 2P2KA 2VQUA 4YW3A 1ZBE2 2VCBA 4KU7A 5C9AA 3A0NA 2FDHA 1DQ6A 2HWE3 4A4AA 1W8HA 4NHKA 4CCNA 2JG8B 3ABZA 5C5UA 5JMOA 2V72A 5BNOA 4IEXA 1HRI1 2G9GA 3NWKA 1BLZA 1OLMA 2YROA 2RS53 4RR3C 1PO22 3I2DA 1UYZA 3THDA 2O0OA 4FOWA 4EQVA 3WSOA 3CJXA 4BQWA 1IQAA 3U11A 2MEV3 1IGOA 1ULPA 3TB0A 4QD2A 4HVQA 2RMU3 1NLQA 2YDEA 1DGRA 4P00B 4HG6B 4CYDA 5CFCB 4MXWA 3ZN6A 2O14A 4H3WA 3MO4A 3SH5A 4AEJA 4KGQA 4QKBA 1JZ2A 3ZFFB 5ISLA 1C3HA 5IAXA 3J7HA 4OMDA 1X33A 5FBZA 2QQJA 3ALQA 2HBUA 3ETPA 3KHBA 3NW4A 1Z7S1 4XUNA 4QPYA 5DDJ3 5E89A 5EHDA 2YG0A 3U10A 3MF6A 3NNLA 2DTWA 1PM7A 5D8AA 1CQ9A 1ENXA 1AJOA 4AFCA 3KCCA 4ZPIA 1FV3A 4KBZA 2VQ0A 2WS92 3DXTA 2ETEA 4KG0A 5BXXA 2BNNA 3J8F3 5CFDB 1LAJA 2HH9A 3WUCA 3R4UA 5A7WA 3I54A 4Q4Y2 4EN0A 4W6XA 2ERFA 1QH6A 4JGZC 4LITA 4YG0A 3VBSC 1LB2A 4CU9A 4BB3A 2B5HA 2JB8A 3H9AA 2JG9B 5H9QA 2YY1A 3AKSA 4N53A 4E4ZA 2GN3A 3H3UA 3F2ZA 1VAMA 1VBC2 1ND3C 1FPN3 1HRV2 1XBFA 2NYYA 1JYCA 3K4DA 2W46A 2VZPA 2WT0A 3LIGA 2JDPA 2H6BA 4XJ9A 5B2GB 2CDOA 5C3OA 1ZNPA 3H1YA 5LK7B 1RMU1 1QQP3 2WO1A 4LR4A 5BV6A 1SDWA 5HV0A 3M1HA 4I02A 5DZFA 1GFF2 2Q1ZB 3SCHA 3ZKYA 2DU1A 2DUOA 2F4PA 4XXAA 3N9NA 3NKGA 5KHHA 1AL23 2CAVA 3ASIA 4UBGA 2D98A 4CUBA 4AOCA 5ACA1 2VO5A 1BMV2 4JGYB 5FP8A 1NOVA 3ZFEA 4NUBA 3ZYHA 1PZ9A 2VUDA 4ZXKA 4A44A 1RUJ1 4AR2A 1BK0A 2A71A 3WDUA 4AAXA 2MHFA 2WNOA 4NPLA 1Z7S2 3ZXKA 2HWD3 4IXLA 3RZLA 1EPZA 3MFCA 4RN5A 3UV9A 5FP3A 1BK1A 5F32A 1CIWA 2LW8A 4MXVA 4PT6A 4QU2A 2H6CA 4AHWA 4ARXA 4YVWC 3J4UH 2NMOA 2VW1A 4XF3A 1ND2A 1B35C 1ZA7A 1FI2A 5FP9A 3H3ZA 3B3QE 1UMHA 4R9BA 5GZGA 4LK7A 3NJYA 1PM4A 1X8EA 5T50A 3OOXA 3OGRA 5LRSA 3MBWA 5E88A 4GB33 2VMGA 2ZMNA 4FFIA 2B46X 4Q4W2 5T5LA 5FLIA 4XJUA 1K5MA 3AXEA 4M4RA 3ZN5A 4CDQC 1FMD1 3DCQA 4FP2A 4E4SA 1DLCA 1A8DA 3OY8A 4MGIE 1JZ5A 2WUHA 3VBHC 1W39A 3V0BB 1ZBA1 3ZFGA 3KV5A 2XPJA 5CZKA 4PDWB 5LY1A 3HN3A 1RMU2 1W9SA 1LGBA 3OG2A 3POSA 1R091 2WIIB 1CAWA 1YNAA 2OZ6A 4HETA 4JVAA 4XEZA 1G9BA 5T55A 1RUD1 1RXFA 3GBFA 5FYYA 3VZLA 2G1MA 4LIUA 1HQNA 4RFRB 1D0GA 3OGSA 4K9SA 2F4LA 2VOWA 2GP5A 4HPKA 4YW1A 2H0VA 4BPZA 4I3GA 5FY0A 3A0KA 1VBD3 1FATA 1PMHX 1ENQA 4L0PA 3MUZ1 3O1RA 1S0DA 2D3RA 5A6QA 2IFWA 3NV3A 4AAPA 2WL1A 3FZ3A 4XJAA 5A6XA 3S6PA 4K21A 4BA6A 1U12A 2BQPA 3HT1A 3JD73 4Q0SA 4Y3OA 2D40A 5T54A 4A45A 2DDUA 5J96B 4YGBA 4RGKA 1UY1A 2RHPA 1SFYA 1OFSA 2VY0A 3AJZA 3IAQA 2WNVB 1OOPB 1ALYA 4PIZA 3H8XA 1O3RA 2WZR1 4XQWA 3KV6A 3OUIA 3PNAA 3ACLA 2HYXA 2WSVA 4LBLA 1PO11 2QQUA 4YGEA 5FPZA 3RWNA 5F9TA 1ULFA 4PI2A 2DVDA 4Y26A 2OUJA 3ZMOA 1H4HA 1JYVA 4UW6A 3B9IA 4Z07A 4C8DA 1HLCA 4RL7A 4CU7A 1VRBA 4UF0B 2GDFA 3BUCA 1QJU3 4XAEA 2PTMA 4NIDA 3N3HA 5K4LA 1QXJA 1QY4A 3WF3A 4AWDA 1RUD2 3MUY1 3KZ4C 4P9WA 1C28A 4XABA 3OEAA 4FPLA 2W95A 2VR4A 4AI3A 5JR7B 1VRH3 5EJZB 5FWEA 5F3IA 3C7FA 3OD0A 1PIV2 1WUVA 2C9AA 1GKBA 1UZYA 3HAGA 3N35A 4QHOA 4XYXA 4NPRA 3I3MA 5DG2A 2QDRA 2B39A 2VW2A 3AP6A 3LDKA 3Q8BA 1XE7A 5T5OA 4AHZA 3BIWE 4UAPA 2UWAA 2Q0AA 1JW6A 2VC9A 5C33A 1QXPA 4LHLA 5G04L 5B4XA 1MPXA 2XKPA 2NN8A 3K2OA 4NIAA 3KHCA 3B69A 1YQ8A 3AVRA 1VMHA 5A3OA 4XFHA 1OLQA 1D0HA 3IDAA 5FMOS 4AVAA 1MVEA 4HXCA 1CPMA 2EA7A 2ZOEB 4RA0A 3UJQA 2CHHA 1HDKA 1S0IA 3NQHA 4AK3A 4YFZA 4Q2FA 1NA1A 5FZ4A 4Y22B 3VBFC 1Q8VA 2YFZA 4CCOA 2RS11 1ASJ2 5FIXA 4BE3A 4BLIA 4COUA 2CAUA 4MG2A 1OVPA 5SV8A 1E5IA 3VBUA 1ACCA 1ULOA 1F31A 3GJAA 2R073 5A3UA 3USSA 3I97A 4A42A 1O3QA 3TWIA 3Q8AA 1RUF2 3WW3A 1SACA 1TMF1 2ZGPA 4IEQA 1OF3A 4TLGA 3TAYA 1C1LA 4AEDB 2W91A 2F17A 5FZ9A 2P3YA 4MGKE 4XAAA 5CG9A 1WCSA 3K77A 1LU1A 1HB2A 4FO9A 1ZREA 3L2HA 1YFXA 1MEC1 4CDUA 4KWUA 1CGPA 2QUOA 4NN0A 1KITA 4XMIA 3USUA 1W0OA 1QJX2 1F4AA 1GNYA 1WD3A 2XUMA 3FHQA 4FFFA 3M4FA 1AYM3 3J7LA 1MACA 3GXUA 5GLVA 2Q8EA 3AVSA 5JCTA 5B4NA 4MGZE 2XWJB 4AHXA 3WQ7A 1WMEA 3VKLA 4BHPA 3AC0A 2NM1A 1KS4A 4COYA 1Y43B 2VM9A 1IPJA 2YPJA 3IWZA 1XNCA 3I2FA 1IZ3A 1NE4A 5T5PA 3I3QA 1VBE1 1OFNA 2KR2A 2XJQA 2E53A 3I8TA 4Q0QA 2QQVA 2ZX4A 3WDYA 3SCGA 4WM8B 2BVBA 3H0OA 1NCQC 5BYNA 1ZBE3 2RS12 1REFA 2WC2A 2Y33A 1V6OA 2LUWA 2VAUA 3BTAA 1BEV1 5DPNA 3WP4A 4CCDA 3LWCA 5HCBA 4Q0UA 3Q8FA 5FYSA 1QKQA 4YG3A 4K7JA 4YZ3A 1PVC2 2YC0A 4W4ZA 4D6SA 4E2SA 2B42B 1NCRC 5J37A 4XUTA 5GLZA 2R32A 4YPJA 4ET7A 5D21A 1H8TB 5TSWA 3WDXA 1H2KA 3WR0A 1WA6X 4QQPA 3RFRA 3WCSA 3VKOA 4OUSA 2TBVA 4YSFA 5FY1A 2ARXA 4BQ3A 3K3NA 1DYKA 2X53S 1IKQA 1FAYA 2DVBA 4BDVB 3LB9A 4GH4A 3ECQA 4GXLA 5JSOA 3AYDA 1JYWA 1LOEA 2Q1FA 3LEMA 4QX3A 3O1SA 3O7OA 4CP1A 3RPQA 1H0BA 3Q8CA 4KGGA 2WS93 5A3TA 1XU1A 1ZVFA 5JPNB 1LOCA 2RMU1 3RYPA 3UK9A 3ZKUA 1WLTA 4AI9A 3RVHA 1DZTA 3POJA 4Q4Y3 2B9VA 1CJDA 1IG3A 5GLTA 1H2MA 3PTYA 1WBFA 4OQ8A 4MHUA 1NKGA 4QQLA 2YB7A 1UMIA 1DGWX 3K3OA 4QDSA 5DAPA 2WLQA 5DDJ1 1E5SA 4HFSA 2IXJA 5EYXA 3WDTA 1VBC3 4BQ4A 2BGOA 5KXDA 1CZSA 3H3LA 4BXFA 4PLNA 5KXCA 3OB8A 4QKNA 4BH9A 3QACA 4OMCA 4WM7C 4FPEA 3J8F1 5FK8A 1JXNA 1L7RA 3ZDVA 2RM23 3DV8A 5C3RA 5K0UC 2ARBA 5JI7A 1COV3 1QJZA 3DYPA 3VBOA 5HCHA 5APAA 2D5FA 2ZHNA 1OBNA 1OQDA 4XETA 3VD3A 2E63A 1AR63 2HWE2 2VMFA 4CDXB 4L97A 4R9CA 2X09A 4LA3A 2VZOA 4D7TA 1FPN1 1CX4A 1XPWA 4S2DA 3AKPA 2NQYA 2VZTA 4P5HA 4PLOA 2RS52 3CDZB 5EV7A 4AI8A 3POEA 4Q1PA 1LCLA 1QQP1 1UY2A 4V2VA 4XBNA 3C2UA 4LHKA 3BU0A 5L36A 3VV1A 3IPVA 2MEV2 4FVVA 2UURA 4FQ4A 4DEVA 2QQWA 4GWJA 1AL21 4BXSV 1O4ZA 5FZOB 2ZBJA 5C4WA 2O1QA 4IV1C 4U36A 3VD7A 2VUAA 4PJYA 4RHV2 2WABA 2CL2A 1V6LA 2I74A 4TYSA 5DZEA 3RGBA 3UGGA 5FJKA 4Y1YA 4FFGA 2VOTA 1W3XA 1AR82 4P9YA 4IGQA 5FYCA 4KQ7A 2DCTA 2HWD1 5A7OA 4H14A 3GBGA 4WVWA 3C7GA 3ITQA 3U4SA 1W6OA 2ZHLA 4RD7A 5FZFA 1MQTB 1NY71 3HNYM 4XFBA 1U5YA 5JOWA 2A6XA 1XNBA 2ZXQA 3UETA 2D97A 3APBA 2E6VA 3WD5A 3POWA 1W8WA 5F2WA 3RZZA 1SDDB 4B7KA 3LA2A 3I2HA 3GZEA 5A6YA 5FUPA 5JIUA 2VMDA 3HIFA 4GB31 4UOJA 3GDBA 4ARYA 1Q8PA 2K2SA 4K6BA 1XYOA 5JUVA 3LA3A 1JUIA 1KS5A 2A73B 2AEZA 1SBDA 3SC7X 1UWWA 4LLFA 4XOGA 1WBLA 3ZPYA 2CNAA 4QMAA 4B4RA 5I93A 1SLAA 1OPMA 1DCSA 4UW5A 5LBCA 3NJVA 2XWBB 1KD7A 2J1UA 1LOFA 3MIFA 4XF0A 3T4HB 1QF3A 1UYYA 2XLFA 3K4AA 1AL22 1V70A 4N43B 4ORFA 3ZYIB 5CKMA 5FMCA 2R063 1I9RA 1LJ7A 1S55A 4IE0A 3W9AA 2QQKA 2JWPA 1BBT1 2LROA 4P5YA 3NSTA 4LTAA 4FPHA 1W0PA 4L9BA 1SBFA 1VBD1 2RS32 2DUQA 1I3HA 3ILRA 1UYPA 3HMYA 2A3XA 1VBA3 1SFPA 2KA3A 4GKYA 5J7MA 2R041 4ZY9A 4K8RB 4ZZ8A 4BYYA 1W03A 5E8AA 3JD71 3AMNA 3VKMA 3ZXFA 1SZBA 4LKSA 4Q27A 1IS5A 4JQTA 3R05A 5FY5A 1VR3A 2RJLA 2QQOA 4CEYC 4JDMA 4LBNA 1JUHA 3HN1A 3LGRA 1ULGA 1HXS2 1K45A 4D94A 5FREA 4GB32 2ZGKA 1PK6B 4AFMA 4MZUA 1PIV3 3JB4C 1RJ8A 4CUCA 1CAXA 5DAQA 4XE9A 1C8M3 2C4XA 2RJKA 2P34A 5DAVA 4MYEA 3H8OA 2B7YA 4H2AA 1FX5A 1QJU1 3BVCA 3HJRA 4FAGA 1QGLA 4META 1MS5A 2E7AA 1GICA 3N9QA 1RUC2 5J98B 4XQDA 3R4DB 5IK8A 2V73A 2QCSB 1VRH1 2YU2A 4DEQA 1YXWA 3LFIA 1GQHA 1N1YA 2FDFA 1W6NA 1SQ4A 4FXGB 3NV1A 3ZXDA 4JAAA 4RR3A 5BNNC 4QPGB 5F7UA 2AC1A 3V56A 5DMYA 3BYWA 4UFHA 1C4RA 4QB6A 5FUNA 3SKJE 5CADA 4HN1A 2FCUA 1N1VA 2ORXA 4OI4A 2AYHA 3RG0A 5KHIA 2Y6HA 2WQ4A 2DBNA 1RUF3 1W2NA 1GBGA 4KWLA 1POV3 4M3CA 1GANA 1X9PA 1MS3A 2CSGA 1AX2A 3HVDA 4JCKA 3QCWA 1LHUA 3T09A 3M3CA 2DV9A 4RYDA 3B94A 2HWF2 3POBA 4Q4X2 1I5ZA 1W9YA 4OCTA 4LLOA 3VZMA 1GOHA 4FCAA 1QJX3 2XXZA 4LBQD 4J25A 2O8OA 4XMAA 2VZSA 5FR3A 1CX1A 2R071 2WNEA 4DY5A 4IEPA 1SLBA 1FNZA 3WNLA 4JGZA 3OPZA 1AF9A 4CU6A 2HWC2 5JZGC 1Z78A 3M3QA 1FNYA 1CJPA 1YJKA 1RUI2 1BVP1 1OKQA 3N36A 4E4DX 1ND3A 1CAVA 4FTEA 3WXPA 3MIDA 5ABJB 5FPLA 2VVFA 5DUXA 3J7NA 4JRLA 5FZMA 4ATFA 1AYM1 1JS9A 2DU0A 1LNSA 1RITA 3TEWA 1XOYA 5GZCA 2ILMA 4ZU5A 3B01A 2UU8A 4R8HA 4LKEA 4WVMB 3CJIB 4LA2A 3FFZA 3NNMA 2GC2A 4AI2A 1EY2A 1MZ6A 2IC1A 4YNIA 4YVSB 3GZTB 2JG8C 2JXAA 2MPFA 5A7NA 4TWTA 5FZDA 1PVC3 3ZPOA 4CA9A 4YGDA 1QEXA 1QNWA 3GALA 1DF0A 2HJIA 4DRRA 3BIEA 1K12A 5C3QA 4XFFA 3I2OA 2BWAA 2X5IC 3CO2A 1OT5A 4K40A 5FQ0B 3WX5A 1ZBE1 2XKOA 4IEUA 4Y5Z0 3EO6A 3AYAA 1UN1A 3WVJA 2ATFA 2PELA 4UFIA 5CFCC 1B35A 5A32B 3C7HA 4UW3A 4H55A 3SH3A 3OPTA 4HBNA 1VMJA 3ZFFC 2GH8A 1GP4A 1PO21 5C71A 1IS4A 1UKGA 3I2IA 5EQUA 4QQHA 1O3TA 5DABA 3FHAA 4LNVA 4CDQA 4EN6B 3FMGA 2P6CA 1NXMA 1VP6A 2KD7A 2IVIB 1RGSA 1AJKA 2VZRA 1F5FA 3VBHA 4AQSA 2ARCA 3ES1A 1AYM2 1RUG3 4XFIA 5CFDC 1TNFA 5IVEA 3VDBA 4OI0A 1MVQA 4A41A 4IV3B 2A3YA 3VKNA 1WZXA 3LF7A 3WDWA 1OHFA 2Y38A 2B8MA 1QJEA 2JG9C 2Z42A 1SCRA 5KC6A 1GP6A 4CU8A 2WS91 3QLQA 4LO4B 4Z2WA 5L7OB 3I59A 2WZPP 4WZFA 3R4SA 3D5OA 4YM0A 1YO8A 5ANQA 1XQNA 3LDBA 4M4PA 4PHZA 2P37A 2X8KA 2HLEA 3GHMA 4KBBA 4Q4Y1 5CKQA 2HEYF 1UD1A 3O14A 3DPRB 1HV1A 1ZRIA 2DCJA 3N9PA 4IE5A 4CDWB 4JTNA 4JV4A 2G9FA 1MS9A 4FP3A 3KVAA 4CRQA 3AZWA 1O5LA 4H7LA 5KR7A 2VOXA 3N7JA 1W9TA 4JGYC 4GAZA 2YPDA 1VBC1 3PUSA 1JOJA 1HRV1 1PGSA 4B4QA 4DZGA 1ZZ9A 2ZKLA 4YYOA 1HB1A 1L3JA 3BKZA 2C26A 3BODA 4LO5B 1AR92 3AJYA 1OC1A 3O0XA 3WP5A 4GKXA 4F3JA 2PYTA 5JMCA 4AGRA 1UY4A 1W6MA 2W39A 4HN0A 4Y1VA 4Q29A 4MX3A 4DINB 1BMV1 4FTSA 5JOZA 4UBHA 1AR61 4K1YA 4RHV3 4BK4A 1TEIA 2QE3A 1WW4A 5M0TA 2CGNA 5C70A 1AR83 3OF1A 4Y1UA 1UQXA 2V5DA 1SPPB 2CV6A 2R7EB 5LA9A 1OD5A 4HVOA 4CCMA 5CVRA 3NJZA 1TME3 4XBLA 2VH9A 1GOGA 2QKDA 5DXDA 2YMZA 3C7OA 4FAHA 5FPUA 2WT1A 4NAOA 3AYEA 4P08A 2GC0A 1Q43A 2EIDA 4QGLA 3KQ4B 4PDWC 3MW2A 1H2LA 3ZXLA 3I4IA 2YV8A 4G4FA 3UL2A 5D2AA 2Y60A 3OTFA
chains in the Genus database with same CATH topology
4Q4W1 2BNOA 5JPMB 3MIGA 4K3UA 3VZJA 2VECA 1DHKB 3MLJA 4E2QA 4QM8A 3FE5A 3V0AB 1QJY3 2BPA2 4P9GA 4EN8B 4RS5A 3VBFA 2A6YA 2XGXA 1R1A2 3WW2A 2RM22 4F83A 3CU7A 1O91A 3OYWB 1COV2 4DS0A 4G3YC 1I1EA 2B9UA 2HWB2 4I0BA 2XVLA 2PAEA 3BOWA 2HKXA 3KM5A 1AR62 4NO4A 2NZ9A 4PF5A 4GWMA 3T2TA 2WINB 1HW5A 1KRIA 2RS33 4E9KA 1DQ5A 2WNVC 1OOPC 1B09A 4EWDA 5JAXA 3NO8A 4YGCA 4EJRA 3MPBA 3AP7A 2W0XA 1AVBA 3MGUA 1CPNA 4IEOA 1N3QA 2BEOA 4MSVA 3UKTA 1VBB3 2PHLA 5D1IA 3HT2A 2R30A 1QOOA 5A3MA 3SH4A 1OA3A 3NAPB 3ZO0B 5J36A 1HXS3 3MI8A 3ST7A 1LOAA 3WCRA 2KM2A 1W6QB 4Y4YA 1WD4A 4M00A 1CAUA 4AHYA 1MS8A 1N3OA 5HCAA 1VBA1 2OW4A 2BW8A 1C57A 2BYVE 4LHNA 1NCQA 1XNDA 1RIRA 2IFRA 2I07B 1RUC3 3H8UA 4AEKA 3QBQA 3ATGA 1QWRA 2VVDA 2DCKA 2JICA 4JC1A 4X6QB 5C8CB 5T52A 2PA7A 4COVA 1HV0A 1MR5A 1PIV1 1RL3A 3MLLA 1UU6A 4LUKA 4DRVA 2EXKA 2IXLA 3LOIA 1NCRA 1AL0G 2VW0A 3CNAA 3VZOA 1NQJA 3WNXA 4FT8A 4CEWB 4RGAA 3AP9A 4HSJA 3VBSB 3J26N 1DGRN 1VJ2A 5JSPA 4B3NA 4X6RB 3FBYA 3WG4A 2R062 1H8VA 4INDA 1NQDA 4QX5A 2HWF3 4Q4X3 5J09A 1O4YA 1S0EA 4Y20B 1ASJ1 1M06G 1C8NA 3FLRA 2UY9A 4BIOA 1VBA2 1J58A 1PMIA 2IXKA 3MPPG 5BNPB 1RUF1 4MH0E 2WNUB 1X7NA 2HWC3 4KH9A 5AVAA 5KXBA 1RUI3 3ZYGA 4HKLA 3D6EA 1J59A 3VZKA 5KHKA 1QJX1 5AC92 1CR7A 4FQZA 3G7DA 3KT7A 2QVSB 1LOBA 4XFGA 4AQ2A 4WM7A 4YVWB 1C1FA 5DUVA 2EXJA 3MLKA 2VULA 2ZX3A 4OFGA 5K0UA 2ZX0A 4WM8C 4KL1A 1C8M2 4M01A 1GNZA 4NOTA 3C3VA 2AREA 5CAZA 2ENRA 2VUJA 1Q8SA 3WY6A 1IPKA 2C5DA 2CWSA 3FFQA 1BCXA 1ULCA 3HD8B 2ZAHA 4EV0A 4CP0A 4CDQB 3DKWA 1XE8A 1BYHA 5A33B 4RS5C 2OIIA 4UW4A 3VDDB 1ENRA 3K51A 4Q4V3 4RQPB 2C1FA 3D0SA 1H8TC 1RTVA 3RYRA 1JYIA 5BPXA 4IV1A 3AKQA 1POV0 2CGOA 4W6YA 1F5JA 5HXVA 3MZHA 3AMHA 1NLRA 1PVC1 3H1MA 1DGLA 1JTZX 4COZA 4XF4A 1KXGA 3I7DA 3ROUA 4B8EA 1V6KA 5C9AB 1RVF2 4I30A 4Z8BA 2F6BA 2WKKA 1LHWA 5AFBA 1GR3A 5BNOB 4PIYA 2JJ6A 4KWKA 4AQ6A 5H9RA 3AP5A 2UYBA 4EWEA 1UZZA 2A3WA 5CBLA 2LALA 2Y0IA 1WMDA 3ZXAC 1N1SA 4OVEA 3QH7A 3JB8A 3QH6A 1RC6A 1H4GA 4MXWB 4WV8A 3ZN6B 2SBAA 1QOTA 4PBPA 4J1XA 1ZRDA 4LULA 1LENA 4JDNA 3S7IA 3SNMA 1EYBA 4LT5A 4AFDA 4Y24A 2VPVA 4HK8A 1D4M3 4CDXC 5D8AB 2ZZQA 1LHVA 1NG0A 1UU5A 5HCFA 1AR93 3WG1A 2ZGTA 2P3IA 5FOJB 2OA2A 4SLIA 1YCIA 1YWKA 3TYJA 4RFT0 1Y7BA 4AVVA 5K9YA 2HWE1 1N1TA 1HKDA 3V64A 1ULDA 3WHUA 1RHI2 3OD4A 1PZ7A 2YXSA 2ZGMA 4N53B 5EJ3A 4BMEA 5BNQA 3NKTA 5CG8A 1RB8G 4CEYA 3PHMA 2RS51 1PNGA 2PLV3 5CNAA 1UU4A 5EXOA 3KD4A 2BBVA 4IERA 3WQ1A 2MEV1 3ZXGA 1J3RA 3SLIA 4Z92B 1D2QA 5CIRA 4YM1A 3RI8A 3N4MA 1MQTC 3CL1A 4RHV1 1RUG2 3WP3A 1S1AA 5T5JA 1VB2A 1GZWA 1J1LA 3ZFEB 2CGPA 3LAGA 1AR81 3LOBA 3TOJA 5I8TA 4LBQA 2GH2A 4OZXA 1TME1 3FLPA 3VBRC 1C5HA 1IS6A 4FPYA 5BNNA 1V9U2 4M3CE 3SISA 1DYPA 1R1A3 1ZZCA 3E6DA 4J6GA 1ND2B 4P9LA 2PHFA 5AFEA 2HWB3 2DURA 5FO8B 4N43C 4B7EA 5I0UA 1OI6A 1CD3G 1ZZBA 1K5MB 4OULA 1HRI3 1YI7A 2D93A 2Q4SA 4DNYA 4AFBA 1QJY1 2NP0A 5I0SA 1YYNA 4A7KA 3OY8B 4XHBA 1G86A 4XF1A 3ZFGB 2EF6A 3D82A 3O5SA 1U5ZA 2JKBA 1CN1A 4JRAA 1XRUA 4ASLA 1CAWB 2ZABA 3V65A 2ES3A 4NWVA 5K8SA 3X29B 3ZSLA 3Q9OA 4HPKB 5I8SA 4A7ZA 2PQQA 1S2BA 5JZGA 3PLQA 3ZIWA 2XBO3 2RS31 2DWRA 2A7AA 3B7MA 1TME2 4GULA 1PK6C 2WQZC 3WZ1A 2ZS6B 1VB4A 4BCUA 5FO9B 4TZDA 1J1TA 2R0FA 1REDA 1VBB1 3AYCA 4R52A 3KCYA 5FPXA 4AI1A 1T6GC 5LRRA 1OSGA 1HXS1 3B02A 2QQPA 3DGTA 2JG8A 1BKZA 4LBJA 3AMMA 1NE6A 1VLNA 1DQ4A 2V5YA 5FFOC 1QJY2 2GZWA 4QPGC 1AX0A 4W65A 4AGGA 1EV12 2X5IA 4D69A 2ET7A 2QJVA 4HZFA 2I45A 1RUC1 4XTMA 2XL7A 1ZRRA 3DL3A 4FOYA 5CFCA 4QT6A 3TN93 3AZVA 3KT4A 4QGNA 3WQ0A 2JE7A 3UJOA 3ZFFA 4B29A 3BCWA 4NWWA 3CF6E 4MUVA 4AF9A 4GA9A 1CVNA 1J3PA 3DF0A 1W2UA 2PHRA 4NHLA 2RR12 3IDBB 1QNYA 3GZAA 1SMVA 2VVEA 2V09A 3BU7A 3L9JT 5CFDA 1WA4A 3AM2A 2ZPXA 3KQRA 2AH2A 2GU9A 1VBB2 1QHDA 4YM2A 4ES9A 4CTEA 3WLUA 1SCSA 2QZ2A 2HWF1 5FLJA 4Q4X1 1SEFA 3DUIA 2JG9A 2ZHMA 4D7YA 4J1WA 4P9XA 5AC93 1NA1B 4EROA 1GQGA 3B9CA 5ABJC 2Z2SB 4FBFA 3M70A 4IL7A 2DYCA 3G6JB 5E16A 3VBUB 4I2OA 3ZSJA 5JVVA 3WT3A 2HWC1 3CJIC 3JQWA 4ITCA 4DXZA 1RUI1 4JGYA 4XFCA 4YVSC 4CDUB 2WWSA 5FLHA 2D6KA 3USUB 4QM9A 1PGL2 3VGIA 2D6LX 5IUQA 3AMQA 2R16A 3P3PA 1QU0A 1DDLA 1A78A 4UXAA 5EWSA 2XVGA 1V6JA 2E51A 4XIOA 2JD4A 1RINA 2WA4A 4EN7B 2LTNA 4K20A 1DQ2A 2D6OX 4X8PA 3NL1A 5CA6A 4LBMA 3WV6A 2HEWF 2Y0OA 2ZGQA 3JUUA 2XJVA 4LE3A 3ME2A 3IT8A 2WZR3 2JX9A 1UAIA 1JH5A 2JE9A 4XW3A 3SITA 1PO13 1KJRA 1RVF3 3EBRA 1AX1A 2EIGA 4FPKA 3AXDA 1URXA 3S7EA 1G9DA 3MICA 3V0BA 5FMOL 4PDWA 3SMHA 1U5XA 3IKWA 3TRSB 4IV3C 3ILFA 4IEWA 4AG4A 2P3KA 3WW1A 2HYKA 3WW4A 2WT2A 1VAKA 3O0WA 1O5UA 4L92A 3OBRA 1PHMA 5L7OC 4S2FA 4KWJA 3VZNA 3U4XA 2N7GA 3B93A 3OGGA 1F9KA 2XL9A 4MLOA 4NVPA 2C0ZA 3HWJA 3JBG2 4O9EA 3VHOA 4CDWC 3T1MA 3AX4A 1PVXA 4GH4B 5JOYA 3FUOA 1GYKA 4HK9A 4BZ4A 5KHJA 1GZCA 3HR9A 3IM0A 3NV4A 1EAH3 1MZFA 3THTA 1JHNA 2D6MA 2WNVA 1OOPA 1IKPA 4S2HA 3FWEA 2E9QA 2IWGB 2W08A 3MFAA 3AFGA 3JZVA 1RUE2 4OHZA 5HBAA 1LR5A 1GV9A 3W59A 4Q4V2 1BJQA 2XG3A 3U07A 4BWOA 1SFNA 5K7PA 1RHI3 3PMSA 2VG9A 3D8CA 3CLPA 4A7YA 3BALA 4HKWA 1DZRA 2PHXA 3HQXA 1TMF3 1FOD2 4YW2A 2PAKA 5L19A 1AR91 4DFSA 5DUWA 4AVTA 1RJ7A 4YZ2A 1H1IA 4Y1ZA 1MEC3 2QZ3A 3POYA 1AUYA 3VBOB 2VOVA 1ZZ6A 1PGW2 2JENA 2EVXA 2JEMA 3ZIXA 4DPNA 2UY8A 3HBZA 1LEMA 2YGMA 4QPIC 2PFWA 4NR1A 4QQOA 4L8QA 1YLLA 3E6BA 1X8MA 1Q3EA 1VBE3 1V9U3 3R6SA 3IIAA 3IPVB 1AHSA 1MS1A 2K9ZA 3H1WA 5C4WB 1R082 3SHRA 1WW7A 3UKNA 4Y22A 1YRZA 2GC3A 2WFF2 3D4KA 2XJUA 3MEPA 3RNSA 1TNRA 4OHYA 3E97A 4AVCA 4OHWA 2TUNA 2ZJCA 1O4TA 4XQ4A 1D4M2 2GMEA 1AYN2 1Y9QA 4LO8A 3RMXA 3E5UA 1W6OB 2D3SA 5H9SA 5CB7A 5J48A 4KNCA 1R1A1 2RM21 2A70A 1D2SA 3M3IA 4DQAA 5GM0A 1KDKA 1COV1 1LHNA 3LZZA 2X29A 3ZMNA 2HWB1 2WJSA 2DFBA 4TSVA 1G7YA 1V6IA 2EXIA 1AR73 2IXCA 4G9SB 1A8MA 3AZZA 4LE4A 3NAPC 1IS3A 4I3PA 1BXHA 5IT6A 1SLIA 3GNEA 2PLV2 2NLRA 3BPZA 2ZGLA 1PNFA 1LULA 4AXOA 2X5IB 3VUOA 1HQWA 4AE2A 5JOXA 1BVVA 5LEJA 4WM8A 3VL8A 4YZ4A 3VHNA 5FCCA 1VAVA 5GZEA 3BB6A 3INAA 4Z82A 3VLBB 2XH6A 4XZPA 3IN9A 3OJBA 3RI9A 2XBO1 4HMZA 2R0HA 2I2SA 1LECA 5C8CC 1RUH2 1G9CA 2GMPA 2YUEA 4U2AA 2FMDA 1EV13 4FPOB 4Q1RA 1Q8OA 1DU3D 1FYUA 1HQLA 3KT1A 4PLMA 4CEWC 4FPGA 1SLLA 1H8TA 2XHKA 4RSUA 5F5QA 4NHMA 2XJTA 2PN5A 2VNGA 2ZA9A 1UKRA 5GALA 5I8YA 2R6QA 1GNHA 1HRI2 2PHUA 2YHJA 1CAXB 1YIPA 4F8AA 3M3EA 4ZU4A 2ZGSA 2RR13 2A6WA 3IDCB 4MVTA 2LM3A 1FV2A 3H7YA 1G9FA 2ZGOA 3RDIA 1UPIA 2VXRA 4YW4A 1WLWA 2GC1A 3AZYA 3WP6A 5BNPC 2R061 2VU9A 3TN91 3LA7A 2WNUC 3OBTA 4JDOA 1LKNA 2GAUA 3QD6A 1LU2A 1W6NB 4I0WB 2KXLA 3FHIB 4RR3B 3EQEA 2XBO2 3N7LA 1MZ5A 3SXWA 1NZCA 1Q5OA 2JDZA 3ZVXA 3K48A 4Q0VA 5GKAC 4M3CB 3KLSA 4RGGA 2OYZA 4D7SA 2G4IA 4FTBA 4C91A 2IXHA 4L2NA 2FZ1A 3ZSKA 4N9IA 2FZ2A 1LHOA 4XJZA 4GMP3 2AUYA 3FJSA 3OGJA 4CDXA 3AKTA 1YFYA 2DFCA 1BQPA 5AC91 3RS6A 3ZX7A 1QMJA 1ONAA 1XXNA 2OUHA 3M3OA 4XF9A 4MV2A 4XDQA 1W6PA 2ZX2A 2CY6A 2QFEA 4QQ2A 4AGRA 1H9WA 2R1DA 1LTEA 2EALA 1C8M1 2GN7A 2Z69A 3VDDC 2BFUS 1GLHA 1OA2A 1H1MA 4JGZB 2D43A 4O9GA 4RQPC 5C6CA 3AB0A 4YM3A 5ACA2 1QH7A 5I91A 3FBMA 3TN92 1E57A 4HVRA 1AXKA 1CAVB 1ND3B 5JDBA 4AEDC 4CZSA 2SLIA 4GALA 1BBT3 5IK7A 1RUJ2 2DCYA 1H30A 1KQRA 2E7TA 4M0HA 2D3PA 4PCRA 1DFQA 3KMHA 1UW8A 3J9SA 5C9AC 1MQTA 4EWAA 2R043 1Q56A 1QXRA 1POV1 3IMNA 3KS7A 3RQ0A 2FMYA 3RRDA 1EP0A 5BNOC 1YI9A 4YLZA 4GQ7A 1NYWA 4ASMB 2YZ4A 4AI0A 3VBRA 4AGVA 3KGLA 1BZWA 2WFPA 3CEWA 1OPOA 1RVF1 4TLFA 1Q8QA 3M7AA 1FMD2 5F6KA 4FPJA 1YHFA 1B35B 3JBG3 1ZBA2 2E7QA 1IHMA 1O7FA 3FX3A 1R092 3ELNA 4N43A 4Y1XA 4HKOA 4ES8A 1MZEA 2P3JA 3WINE 1V6NA 5D8AC 1X36A 4FSJA 2GNTA 1YJLA 3WHTA 5JLVA 2K0GA 3VBHB 1N3PA 3B5LB 1JN2P 1DLLA 1RUE3 3MW4A 1LESA 3MW3A 2TNFA 3O12A 4P9IA 3VHRA 3TNQA 2FQPA 1SLTA 1VIWB 1V6MA 4URTA 1FOD3 3GYDA 4N53C 1UPSA 4YARA 1EAH1 3I59B 2A6VA 1LGCA 5JIAA 3EXUA 1UMZA 4I0AA 2WZR2 1PK6A 4KU8A 1YFUA 2XLAA 4A2UA 4CP2A 1PO12 4HLTA 4BOWA 3KCXA 1RHI1 4HANA 3U0ZA 4GWNA 3FUQA 5H9PA 4FOVA 5E1RA 1XYPA 4XPVA 3ZFEC 2XLGA 2W68A 2XJSA 5FAXA 5I0RA 2VOKA 5GZDA 1A6CA 3MF9A 4FOQA 5EYYA 4YZ5A 1W6MB 1APNA 1UL9A 1R083 3M2MA 4QPGA 4WVZA 1FXZA 1RUG1 3MIHA 3THPA 1ND2C 2WFF3 3B00A 4XBQA 2P17A 3ETQA 1G9AA 2IXIA 3MIEA 1S0FA 1YIFA 2PHDA 1ZRFA 4DY3A 1C5IA 3MYXA 4AQTA 1AYN3 1R1ZA 2VNOA 1KFXL 4Z1VA 1K5MC 5EZWA 5BUVA 3EJKA 4A3XA 1V9U1 5HI0A 1EAH2 5JWPA 4YG6A 5LEKA 1TQ5A 3A4UA 3EHKA 4LBOA 4R9DA 2WA3A 2ZMKA 2R49A 3ZFGC 4R4XA 3LSDA 1GSLA 1NXD1 2GMMA 4LBKA 1LODA 3AKRA 2DTYA 2ZKNA 4AVSA 4C90A 1M4WA 1ZRCA 4WVVA 5IK4A 1QDOA 2DUPA 4PBOA 1TMF2 3W58A 3PVBB 4BIFA 1CESA 1PO23 4RS5B 3KB5A 3VBFB 2GSYA 4S2GA 1MEC2 3PJYA 5ABJA 4FPFA 2XB6C 4XXPA 4AVBA 2MNGA 1LOGA 4GIQA 1AR71 3E5XA 4Q8KA 2AR6A 3LKJA 3ZSMA 4WVMA 3E5QA 5KBFA 3CJIA 2DVGA 2UWCA 1QDCA 5F6LB 1S0JA 1S0BA 2D44A 3WDVA 1EPWA 2ET1A 4YVSA 1RUH3 2ZMLA 2ZGUA 1U0AA 2NPIA 2D6NA 5KHGA 5A3LA 2CYFA 4N9HA 2RE9A 2D6PA 1VBE2 3WOGA 2Q30A 3AFKA 3GBWA 1SLCA 3O0VA 1TE1B 1WLDA 1F2NA 2UWBA 4QXKA 2BUKA 5FQ0A 4K8FA 1H9PA 1RUOA 2W52A 5A32A 1BEV2 1AXYA 4HSLA 3E6CC 1DIWA 3JU9A 1HRV3 3AMPA 4N90A 4ZKTB 1CAUB 2ZHKA 4YW5A 1EV11 5GLUA 1X50A 2DVAA 4Q0PA 4SBVA 2WLPA 4FPCA 1WCKA 4OHXA 1NCQB 4Q8LA 5GJ6A 3SCFA 3OCPA 1DG6A 2XJRA 1ZYBA 1UIKA 4P14A 1ZA4A 3GHNA 4E2GA 1AR72 4IV3A 4I01A 3RMYA 1JBCA 1Z7S3 1WW6A 1NCRB 1W6PB 2RR11 1NA1C 4OHVA 1DZQA 3RYKA 4M3CF 4N7IA 5L7OA 2BGCA 2Y26A 5GLWA 1GZ9A 3VBUC 3URFA 1WLCA 2RMU2 2GNBA 1AZDA 3DPRA 4CDWA 3JCIA 1OMIA 1LEDA 3PMEA 4IEYA 4Q4W3 1WMFA 4W6WA 5DDJ2 3RSJA 5SV5A 4E27A 4CDUC 4AEMA 3L2YA 2VGDA 3N7MA 5FRAA 1A3KA 4R9AA 4YZ1A 1HIXA 3VL9A 1NLSA 1RMU3 2H0BA 3J8F2 1MS4A 4XJ8A 4M0NA 4XILA 3ZYRA 5GZFA 5ACA3 2AENA 3TBDA 3AK0A 3PVNA 1VALA 5AVPA 2VNRA 4DOUA 4GMP1 5FOBB 4C0BA 4WBBA 2OVUA 2TEPA 1ZM1A 4MGYE 3VBRB 5FDBA 1PGL1 1RUJ3 2QNKA 4JQRA 4QHBA 4IQPA 1FPN2 4C0HA 3VN4A 5C8WA 4WM7B 3H7JA 5T3NA 3RJRA 5K0UB 3NVCA 5DUUA 1V00A 1QQP2 3VHPA 1F8VA 4C1XA 3S30A 2EXHA 1XNKA 4OI1A 1AXZA 4K1ZA 2FBEA 4LO7A 2CWMA 1J3QA 3VKFC 3N7KA 4QPIA 3D0JA 5LK5A 2BFUL 5CU1A 1S2KA 2ZGRA 4BMBA 3H50A 2HWD2 3KSCA 4ISQA 4EN9B 4DMIA 2VMIA 1FMD3 3V0AA 2DCZA 2XJPA 4XHXA 4JTOA 3MDPA 4I09A 4KG8A 1ZBA3 4IV1B 1NY72 4QGMA 1CONA 1OA4A 3OYWA 2NMNA 1R093 2PAMA 2BWCA 1RUD3 4GH4C 4GMP0 3WG3A 3ZXEA 4BA6A 3ILNA 1OQEA 1H1AA 2VQAA 1PZ8A 3ZYJB 4COWA 4IEZA 3ZN4A 4IEVA 4YRDA 1KDMA 2A6ZA 1I6XA 1REEA 1OLRA 3WUDA 3JBG1 5FO7B 1DBNA 2ZTNA 2BTVC 2AGSA 3GZUC 5JI9A 4IETA 5KWRA 1U5IA 3LSEA 4OI2A 2D5HA 4BQ1A 3P3NA 2ZCWA 2Q1MA 5FTTC 3AZXA 4AFAA 2Q5TA 3NAPA 1ULEA 3BOPA 1BBT2 1XU2A 4L11A 2PHTA 5BY5A 1VBD2 1W6QA 1RUE1 3ZXJA 2A75A 1ASJ3 4D3WA 4Q4V1 3VBOC 1QOSA 3AP4A 3MIBA 4ATEA 4IESA 2UYAA 3M8LA 2R042 2HEVF 1FOD1 4FXKB 1UIJA 3JD72 4LO6B 1MS0A 5EFUA 4PIXA 2Z79A 5C8CA 1X82A 3PJQA 2ZAAA 1DGWA 1PGW1 4V1PA 3TNPB 4LUMA 5J3UA 4AYUA 4XTPA 1XYNA 2GALA 3PVEA 3FLTA 2GNDA 5C4WC 4HT1T 4OUMA 1N47A 4CEWA 3DPRC 2PHWA 1LRHA 2GNMA 1DQ1A 1FT9A 2ZX1A 2Q8OA 4CEYB 3VBSA 5F1RA 1QJU2 3ZSEA 2O8QA 3T1LA 1WGPA 4B4PA 1YUDA 5JSRA 4X8NA 1ZZ7A 4YFWA 2YYOA 1VRH2 3ENRA 2QDNA 1WCDJ 1R081 4OLLA 3FC0A 3NV2A 4Y20A 1KJLA 1S0GA 2B45X 2Z5WA 2WFF1 1DQ0A 2RS13 3KGZA 1GZWB 1LGNA 4XIKA 1OQ1A 2YGLA 5BNPA 4LBQB 1D4M1 2BNMA 1AYN1 1YFWA 2WNUA 4L99A 3RJ2X 1ENSA 4DB5A 5I0TA 1D4VB 4WZCA 2R1BA 1UF2C 3ES4A 5DZGA 5BNNB 3DN7A 4HL0A 1WW5A 2ZGNA 3QOPA 4R4ZA 3IBMA 1ZX5A 2JECA 1Z0HA 4BLJA 2ZACA 3ZYPA 2BVVA 4YVWA 1S0CA 1LOFC 1UCXA 2R072 4XFAA 2OZJA 2VMHA 3GF6A 1O3SA 2PLV1 2IZWA 2EAKA 2XVKA 4N7UA 1G6NA 3IDEA 4ISRA 5A33A 2ZZJA 3ZDSA 3JQXA 4BM8A 5KC5A 3LCPA 3VDDA 2EAAA 2WSUA 1H2NA 4ZU7A 1SBEA 1KFUL 4RQPA 5KXEA 2AZ5A 2DF7A 4ONUA 2FHRA 3R0RA 5JZGB 1Y3TA 1BEV3 3PVOA 5L73A 2OPKA 1IOAA 1RUH1 1UX6A 1HX6A 4AW7A 2DVFA 4AEDA 2CTVA 1G8WA 4XJWA 4Q26A 3S0MA 2A5ZA 4LEJA 4P9JA 3WG2A 4PQ9A 2D7FA 4H7MA 5IK5A 1ZZ8A 4C1WA 5DG1A 4YW3A 2P2KA 5C9AA 1ZBE2 4KU7A 3A0NA 1DQ6A 2HWE3 4NHKA 2JG8B 5BNOA 4IEXA 1HRI1 2G9GA 3NWKA 2YROA 2RS53 4RR3C 1PO22 3I2DA 2O0OA 4FOWA 3CJXA 1IQAA 3U11A 2MEV3 1IGOA 3TB0A 4QD2A 4HVQA 2RMU3 2YDEA 1DGRA 4CYDA 5CFCB 4MXWA 3ZN6A 3SH5A 4H3WA 4AEJA 4KGQA 3ZFFB 1C3HA 5FBZA 1X33A 3ALQA 3NW4A 5E89A 5DDJ3 1Z7S1 4QPYA 3U10A 3MF6A 2DTWA 1PM7A 5D8AA 1CQ9A 1ENXA 1AJOA 4AFCA 3KCCA 1FV3A 2VQ0A 2WS92 4KG0A 2ETEA 5BXXA 2BNNA 3J8F3 5CFDB 3WUCA 3R4UA 3I54A 4Q4Y2 4EN0A 4W6XA 2ERFA 1QH6A 4JGZC 4YG0A 3VBSC 1LB2A 2B5HA 3H9AA 2JG9B 5H9QA 2YY1A 3AKSA 4N53A 4E4ZA 2GN3A 3H3UA 1VAMA 1VBC2 1ND3C 1FPN3 2NYYA 1HRV2 1JYCA 5B2GB 2WT0A 4XJ9A 2H6BA 1ZNPA 3H1YA 5LK7B 1RMU1 1QQP3 4LR4A 5BV6A 1SDWA 3M1HA 4I02A 5DZFA 1GFF2 2Q1ZB 3SCHA 2DU1A 2DUOA 2F4PA 4XXAA 3NKGA 5KHHA 1AL23 2CAVA 3ASIA 4UBGA 2D98A 5ACA1 1BMV2 4JGYB 1NOVA 3ZFEA 1PZ9A 4ZXKA 1RUJ1 2A71A 3WDUA 2MHFA 1Z7S2 3ZXKA 2HWD3 4IXLA 1EPZA 3MFCA 3UV9A 1BK1A 1CIWA 4MXVA 4QU2A 2H6CA 4AHWA 4YVWC 3J4UH 2NMOA 2VW1A 4XF3A 1ND2A 1B35C 1FI2A 3H3ZA 3B3QE 4R9BA 5GZGA 1X8EA 5T50A 5LRSA 5E88A 4GB33 2VMGA 2ZMNA 4Q4W2 2B46X 5T5LA 5FLIA 4XJUA 1K5MA 3AXEA 3ZN5A 4CDQC 1FMD1 4FP2A 4E4SA 1A8DA 3OY8A 4MGIE 3VBHC 1W39A 3V0BB 1ZBA1 3ZFGA 2XPJA 4PDWB 1RMU2 1LGBA 3POSA 1R091 2WIIB 1CAWA 1YNAA 2OZ6A 4HETA 4JVAA 4XEZA 1G9BA 5T55A 1RUD1 3GBFA 3VZLA 1HQNA 1D0GA 4K9SA 2VOWA 4HPKA 4YW1A 2H0VA 4BPZA 4I3GA 3A0KA 1VBD3 1FATA 1ENQA 1S0DA 2D3RA 2IFWA 3NV3A 2WL1A 3FZ3A 4XJAA 3S6PA 4K21A 1U12A 2BQPA 3HT1A 3JD73 4Q0SA 2D40A 5T54A 5J96B