5KC6A

Crystal structure of cbln1 (val55-gly58 deletion mutant)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
SAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPLGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cerebellin-1
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kc6A00
4MXWB 3IT8A 2Q8OA 3QBQA 4OULA 4TWTA 2R30A 4EN0A 1XU1A 2RE9A 1ALYA 1PK6A 2WNUB 1U5ZA 1JTZX 1TNRA 1O91A 4E4SA 1KXGA 1OSGA 1A8MA 5CIRA 3L9JT 1GR3A 5KWRA 4TSVA 1D4VB 1OQEA 2O0OA 5HBAA 4OUMA 1RJ7A 1WCKA 4MXVA 5KC6A 2QE3A 3K48A 4F3JA 2HEYF 4DB5A 2JG8C 1U5XA 4KGGA 4GIQA 3MI8A 4NN0A 1U5YA 1C28A 2RJLA 2Q1MA 2ZPXA 4MSVA 4QQPA 2WNVB 5TSWA 3V56A 2JG9C 2R6QA 2AZ5A 4E4DX 2JG8A 2TUNA 1XU2A 5BNQA 2R32A 1TNFA 3B9IA 3B94A 4RSUA 1DG6A 2JG9B 1PK6C 3LKJA 5KC5A 2KA3A 1KD7A 4KGQA 4J6GA 4MXWA 1PK6B 2X29A 1OQDA 2WNUA 2ZJCA 1C3HA 2HEVF 4QQOA 4QQHA 3URFA 4QQLA 1DU3D 4OUSA 4DOUA 5L36A 4HT1T 3ME2A 4N90A 2WNUC 3TWIA 1JH5A 3TYJA 3AB0A 4QPYA 4D7YA 2JG9A 2HEWF 4KG8A 4G3YC 4QQ2A 2WNVC 1S55A 2OIIA 4G4FA 3B93A 5L19A 1IQAA 3ALQA 3QD6A 2WNVA 1D2QA 2E7AA 1I9RA 2JG8B 2Z5WA 1D0GA 2RJKA 1RJ8A 3WD5A 3FC0A 2TNFA 2QDNA 3K51A
chains in the Genus database with same CATH superfamily
3R05A 4AQ2A 1F4AA 3AKTA 4P9YA 3RJRA 4Z1VA 2BDRA 1BYHA 1RHI2 2MHFA 2QVSB 2P17A 3M3IA 3OD0A 1U5ZA 3PVEA 4S2FA 2RV9A 1UOGA 1JW6A 4MADA 5IT6A 1W28A 1NXMA 2DDUA 4XTPA 5T55A 5IK4A 2J1EA 2OZ6A 3OGSA 3SQOA 4UFHA 3VD7A 5CEHA 1UU6A 2W2IA 3ZFFA 1NZIA 4NHLA 1H1IA 4FT8A 5D8AA 1DBNA 2Q1ZB 3VZLA 4DMIA 1W6MB 2LROA 3P5BA 2NN8A 5F3GA 1HXS1 3JD72 2Q4SA 4B1MA 2GH8A 3B7MA 5F6LB 3WP6A 5DQ0A 3RJ2X 5KXCA 1BVP1 5DZGA 4QAWA 2JG8C 2HWF3 2W91A 1GSLA 3AKQA 2D6MA 4EWDA 4CCDA 3AZWA 1D7PM 1V9U2 1W2AX 4XAAA 2BZDA 2JDUA 1H9WA 3S6PA 1OPOA 2I2SA 4E4HA 2DURA 3D3AA 1BMV1 1LODA 5C8WA 4ZS2A 4FQ4A 1QOSA 4QX0A 1XRUA 4AFDA 2V5DA 3IPVB 1FMD2 2XHKA 3B02A 3WUDA 4I01A 2GC0A 1I6XA 4PQQA 3S7EA 5AC92 3DGTA 4K8FA 1MEC1 1NKGA 2VBPA 1NA1B 2GNTA 1VAMA 1VBA1 5JIUA 4KGQA 3O7OA 3KF3A 4AYUA 3A7QA 3Q9OA 3W59A 3VDAA 1PK6B 2X29A 4P9WA 1AR62 2W92A 2YHJA 2WNUA 3HOBA 5JUVA 4XDPA 1BHGA 4IEVA 3WP3A 3HNYM 3UL2A 1QKQA 2Q1FA 2P5BA 2D98A 2Y6GA 1ZRIA 2ZGQA 4CEYA 3VBHB 4LUKA 1JYVA 5C70A 1C8NA 4JKMA 4A42A 4JRLA 2CSGA 5LWBA 1ZZ6A 4FFGA 3WXPA 2JKXA 3ZDSA 4LA2A 5FZEA 2E9QA 2G9ZA 3ZXDA 4UT5A 4IEXA 1FMD3 4IEUA 2RG4A 2WSVA 2XLAA 3WDVA 4YPJA 3RZZA 2AYHA 2ET1A 3DN7A 2XPJA 3T2TA 1O3TA 1DGWX 2VMGA 5GLTA 1AYN1 1D0HA 2CL2A 3Q8FA 2XBO1 4IUGA 4XUTA 2C0ZA 3USUB 2CGOA 1ND2C 2BGPA 5CAZA 2UWBA 3WF2A 5IVBA 3UK9A 3FLTA 4ITCA 3P6BA 3VN4A 2ARXA 4IGOA 4A41A 3MUY1 4YZ1A 4UWDA 2JG8B 4NROA 2W08A 2ADEA 4Y5TA 5FFOC 3T1LA 3ZSMA 3WF1A 3S57A 5FQ0A 3CF6E 3IDEA 4META 3G7DA 3ILFA 4HBNA 3WDXA 1DZRA 2HWE2 3ETPA 1HB2A 2Y38A 4FP3A 1XJAA 5FP7A 1ZZ7A 3WNKA 2VQAA 3K75B 1AXZA 1GUIA 1ALYA 2XVGA 3NJXA 5J98B 1UMZA 2WNUB 3W58A 4XBQA 3AMPA 4GMP1 1VRH3 3ACGA 5F8PA 5FYCA 1YEWA 1SDWA 2VZRA 3DUIA 2B7YA 1AR73 5IVFA 1LR5A 4JGYC 3O1SA 1A8MA 5JOXA 1F8VA 3RVHA 5IVCA 1WLDA 2WO7A 4LE4A 1W8FA 1JXNA 1OQEA 4LIUA 5DUUA 4KWJA 3ACLA 4FPHA 1AF9A 3WW3A 2YB7A 3SC7X 1N1TA 1RJ7A 1ND3A 1J3RA 3CEWA 3HQXA 4Q4V2 5FXXA 2VTXA 3CDZB 3MLJA 2WWJA 5K9YA 2W95A 4SBVA 4PLOA 2RJ2A 3R0RA 3JQWA 4JVAA 4E8CA 4B3NA 2RM21 1LNSA 1XOYA 5FKBA 4XAEA 1OF3A 1OXCA 2ATFA 1U5IA 2HWB2 1DGRA 4LQRA 4I3PA 4Q4X1 5FPUA 4AI8A 2A6VA 1QQP3 1DP0A 3SXWA 2XWBB 2VZVA 4NUBA 1VBE2 1CIYA 4YVSA 5J36A 3KT7A 1UOBA 2GH2A 4LA3A 4XABA 1M4WA 1TME2 3HPNA 5LK7B 4HANA 4JGZB 3ZFEC 3H8XA 2A3XA 4DXZA 1W04A 1RMU3 2NMOA 2Y33A 3LB9A 3IIIA 3AVRA 4PF5A 4E8DA 2W1UA 1J3PA 2AUYA 5LA9A 1OURA 3N9PA 4IE6A 1NCQC 4IGPA 5AVPA 2D5HA 2LRPA 1GNZA 4QHZA 2WO2A 2ZMKA 5C3RA 5A3OA 5FAXA 1QDCA 1FOD2 3N4MA 4XQDA 2VVEA 1JYWA 2R042 2WUHA 5BXXA 2PLV2 2P3JA 4GH4B 4D7YA 2EAKA 2HWB3 5FO7B 4L2NA 4WVZA 4Y5Z0 3O1PA 4RHV3 1G9AA 5JCTA 1QQP2 4ORFA 4B4PA 1QEXA 4UF0B 3GHMA 4RQPB 1GZCA 1GICA 1HXS2 1S55A 4DZGA 1WUVA 2VZTA 5EWSA 3RSJA 1E5SA 3F95A 4ASLA 4J1XA 1JYTA 4H3WA 2XL7A 2ZS6B 3LDBA 5L9BA 4LNVA 3LFMA 4Q4W2 5DG2A 2WLPA 2BTVC 1VBB1 1L7QA 1W03A 5FMCA 4GAZA 1AHSA 4GULA 4Z2AA 1YQ8A 4MG2A 2ID4A 2ZMLA 4K8RB 3ZFFC 5KXBA 5FZ4A 4OMCA 3AZZA 4AQ6A 4BM8A 1SBDA 4BQXA 1YFYA 2VQ0A 5FPXA 4NHMA 1NUKA 1QJZA 3JBG2 3UJOA 3IZOA 5FKCA 2N7GA 2Y60A 1JODA 2H6BA 1QMJA 2XVKA 4CEWB 4B4RA 4EYUA 5HV0A 4OHVA 3UT0A 4JKLA 4FPGA 4BQ2A 1RVF2 2A6ZA 1URXA 1WCSA 5M0TA 2R043 1H2KA 3T0BA 1SZBA 5L7OC 1HRI3 3NV2A 2JIJA 4LHLA 3T0AA 4A45A 1WD3A 1RUG3 1LGCA 1C4RA 3D6EA 3H1WA 5JOYA 1K45A 4H14A 3HIFA 1FPN3 5FPBA 3ZXEA 3ELNA 2YMZA 1S0FA 1XYOA 3QOPA 4QPIC 1UW8A 1HW5A 2UURA 5ANNA 4N9IA 4BK5A 3FBYA 1O6UA 4X8PA 1UIJA 3OUJA 1YCIA 1RUD3 1EAH2 2D43A 2ZHKA 3O0VA 1NOVA 1MQTA 4FPCA 1UY2A 3MDPA 4N53B 1FNZA 4GIQA 4UF0A 5FYMA 5C7GA 1B35C 5GLVA 1OLMA 4M3CA 1BKZA 3ES1A 4OCTA 1GWLA 1VR3A 2VMHA 3VBHC 3PU8A 3AC0A 5FZ0A 3LQCA 1PGW2 3WG4A 4UFIA 2F4PA 4CUGA 4K1YA 4GZ9A 4CP2A 1YYNA 4QXHA 3MUZ1 3PU3A 1AYM1 3O12A 1RUH3 1WW4A 4Q1PA 4QD2A 3OEAA 4AL9A 3LKJA 3GZUC 3WNXA 5J96B 1HQNA 1PVC2 1SFYA 3I97A 2ARBA 2H0VA 2A3YA 4MGZE 5DMYA 4ZHNA 3B5LB 1NCRC 4LLFA 3AM2A 2X53S 4XFBA 5ERLA 5LATA 3H8RA 1ASJ1 4QXKA 5A3WA 2ERFA 5F3IA 1ULCA 3ZFEB 1CD3G 1CVNA 1VRBA 1IS4A 3WNLA 2Y0IA 5BNNC 5LA2A 5JMOA 2GC1A 2BWCA 4LOTA 5F6KA 3E6DA 1Q43A 1FT9A 4TLFA 4BDVB 4Z2WA 3J26N 3OCPA 4HT1T 1RITA 5IVYA 1LKNA 2E7QA 2HWF1 2J1SA 1KDKA 4ISQA 3PUIA 4NAOA 1JN2P 2CDPA 4Q4Y1 1CR7A 3WINE 4AEKA 4YFZA 4LBQB 5L7OB 3A21A 2FD8A 2XQRA 1KS5A 2ZHNA 3A0NA 3ORJA 3ZSLA 2GDFA 3HVDA 4QMAA 3LOBA 2J1VA 4EROA 1NLSA 2Q8CA 1BLZA 5DAPA 1UZYA 2BVVA 3T2OA 2BFUL 3WR0A 3WDYA 3BU0A 2OIIA 2QTWB 3CJIA 1REDA 2ZEXA 1GMMA 1ZA4A 1HJFA 3IDAA 3VD3A 3M3CA 3ACIA 2VZ3A 4XJWA 3RYKA 2GMEA 3KCYA 1K5MB 3U0ZA 4YGCA 4YGEA 4DEQA 4FPKA 1KDMA 3I3BA 4W8JA 3VDBA 1OLRA 1R1ZA 5ACA2 1W6OB 1KFXL 2OKXA 3RZJA 3VBSB 3KGZA 3K2OA 3KB5A 2FMDA 4YZ3A 2JB8A 1GOHA 2NLRA 2B39A 3H0OA 3OBTA 3IT8A 2GN3A 2E63A 1EPWA 3BU7A 1QH6A 2J1UA 4GB31 4JGZA 2VVFA 5F5QA 5L9VA 3WW4A 4BQ5A 1YJLA 1TVGA 5T5OA 5FV3A 3LEIA 4AAXA 1LOFA 3LFIA 1PZ8A 4E9KA 2EXJA 2VPVA 4N9HA 3EMRA 3RZGA 1LJ7A 2WYSA 4IEOA 2NYYA 3IB3A 1RINA 5CIRA 1MS9A 5FK8A 4AK3A 2LS6A 2P4EA 3C7OA 2VZUA 1NA1A 4Q4W1 2A70A 1BQPA 3T4HB 1OLQA 3PVNA 2VUDA 1ZBE1 3O14A 1DHKB 4MXVA 4ZONA 4AF9A 1OPMA 3BTXA 2ZGNA 4DPNA 1S0JA 2O8QA 4IERA 5I8SA 5A6YA 1TMF3 2DYCA 2B9UA 2KR2A 3ZFEA 4WM8C 5EHDA 4PBPA 4C1WA 4ATFA 4INDA 3CJIB 4FPYA 4L92A 1G7YA 3NO8A 1O59A 2DFBA 4C8DA 1IPSA 2OQ7A 3H9AA 5GJ6A 4C90A 3S5AA 2C1FA 3ATGA 3ILNA 2BJSA 1HB4A 3MV01 5A32A 1MS5A 2ARCA 4D7TA 2DUOA 3QH7A 5JI9A 1BBT3 3PURA 1AZDA 1XNCA 1RUE2 1W99A 3ES4A 3VBUB 1APNA 4BWOA 1R082 3VBRC 2O1QA 4F8AA 5B4XA 1CAUB 2ZACA 4I2OA 1W6QA 2NPIA 1JZ8A 5LRSA 1OHFA 1C8M1 1QNWA 1UYYA 1OUSA 2Z4FA 4HKOA 4X8NA 4XURA 1RUF2 4ES9A 3RZLA 4XBNA 3BTYA 2Y6FA 4NHXA 2E53A 3H3LA 2OZJA 3NJZA 4BU2A 3OTFA 1UU4A 1CX4A 5AVAA 5A3MA 1SHWB 2F17A 2R16A 2QJVA 4DUWA 5JSRA 2HWB1 3I2OA 1HKDA 1GNYA 1IPKA 1J58A 1UPSA 2YPDA 1CJPA 1YI7A 4CZSA 3FMGA 1Y7BA 1VBD3 1SQ4A 2BOJA 3MBWA 4RGKA 3VBRA 1OA3A 3E5XA 3ZXGA 2YG0A 1JHNA 3POBA 1DIWA 2PHLA 3DYPA 1VALA 3ZFGA 3PLQA 1RUI2 2IWGB 2VTXJ 4MH0E 1Y3TA 5C3QA 1NCQB 1RUG2 1T6GC 2EF6A 2LW8A 3DEMA 2JE7A 4J25A 3C7HA 4Q0SA 4BA6A 4HONA 4DO0A 1ULOA 1Q3EA 2QQOA 1VB4A 1D4M2 2WKKA 1W9TA 1K12A 4EV0A 1OOPB 3OGRA 1YUDA 1MS4A 1PVC1 4L11A 1AR83 1JU4A 3I8TA 2O8OA 3WSOA 4BH9A 1X82A 4IEYA 1D2QA 2JB4A 4AGRA 1MVEA 1W8TA 3DYOA 1POQA 1Q8QA 2CWMA 3AZVA 4B7KA 5C9AA 3ZFGC 2LUWA 4UXAA 1W3XA 1CAVB 1WMEA 1NY72 1P8JA 4CVUA 1O8SA 1OOPC 4LMFA 4DS0A 4IE5A 4KQ7A 5EJZB 2BBAA 1PVXA 4NOTA 3VD9A 3UGFA 1GZ9A 4FPLA 4FOYA 1HIXA 3HJRA 4ET7A 2G19A 3OSDA 4HKLA 4E2GA 2IXCA 2BBVA 4GB32 4JDMA 4TTGA 1S4CA 1LAJA 5A7WB 3TNPB 2BRTA 3CHXA 1J1TA 1OSGA 2Y6HA 3RI8A 1KFUL 1ZZ9A 1POV1 3VLBB 3UGGA 1US2A 3N7JA 1RUH1 5C9AC 1PNGA 3HT2A 4XHXA 3U14A 2RDQA 5GZFA 4R8HA 3BPSA 1MZ6A 5HCFA 3UKTA 1WCKA 1OVPA 2ETEA 3FHIB 2EXKA 2QE3A 1BCXA 2HWE1 2BVBA 5FY8A 1MPXA 2RHPA 2VOKA 4FVVA 2HEYF 4I09A 1AL23 2FMYA 4Y24A 1DF0A 1ULEA 4RQPA 1RMU2 3PTYA 3O0XA 1XNDA 4Y4YA 1S1AA 2A6WA 5C8CB 3CZUA 2ZMNA 3TNQA 5TSWA 4R52A 4JX0A 4YYOA 5T52A 4NIIA 3WG1A 2RS51 3CMGA 2FZ1A 4YG0A 5T54A 3MZHA 4M0NA 5T50A 1G8WA 3N3HA 1AX1A 2YC0A 5FUPA 1NX9A 4URAA 3NKTA 1WBFA 5A1LA 4UW6A 4GWNA 3TB0A 3DKWA 4NHKA 4XOGA 1AR61 5F5IA 4Y1VA 4RHV2 3LD8A 1A78A 4YLZA 1UMIA 4MGIE 2V4AA 5CFCB 1IKQA 2WBKA 1GV9A 4XFFA 1GZTA 3AP4A 2GALA 1N3QA 4DIQA 2EA7A 1UYZA 3AP6A 4QGMA 4DY5A 4XQ4A 4TYSA 1SACA 2OX0A 1LOCA 2RMU3 1HN1A 1BVVA 2YFZA 2HWC2 3O1MA 5APAA 5FP9A 5JXGA 1XNAA 2D6PA 1RUOA 5BNPC 2XLGA 1LENA 4R9BA 5FCCA 2BEOA 4QX2A 4ZU5A 2XVLA 3EO6A 2R062 4XFGA 5FZ8A 3WF0A 3V65A 1YQCA 3L2HA 2G9GA 4Q8KA 1RUF1 5BNNA 1LB2A 3J9SA 1WCDJ 4LIVA 3SH3A 2HWC1 5K0UA 3WCSA 4DUXA 4KG8A 5LB6A 1UZ0A 1OT5A 4CEWC 4OVEA 1EV11 2WQ4A 1NE4A 3JZVA 1N3PA 2DV9A 3VHNA 4C0HA 5JXHA 4FPFA 1UOJA 2PFWA 5JOZA 4NHYA 2CY6A 4IL7A 5E6HA 5CB7A 3CJXA 1HRV3 2DBNA 2ZA9A 4PDWB 4M00A 1IQAA 3ALQA 4FXGB 1X9PA 2XUMA 4XE9A 5F2SA 5DXDA 5FIXA 5FPAA 4S2DA 1H9PA 5A32B 5DAVA 1Q5OA 2JDMA 4U36A 4LHKA 5IFPA 4XUNA 4DXTA 2YC4A 5FYZA 2YROA 3AYAA 3LF7A 3FLPA 5GZDA 4FOQA 5FXZA 2Z5WA 1LTEA 1T2XA 1W8WA 3K4ZA 4AVVA 2ZX4A 3GXUA 4CCNA 1NCRA 3HNBM 2Q8EA 3UKNA 2WO3A 1MR5A 4FFIA 5HI0A 2RR12 3EBRA 3JB4C 4MHRA 1GANA 4WVMA 2VNVA 4OULA 3AYCA 1PK6A 1QJEA 4QPIA 3NNLA 3W9AA 2XJQA 2D6KA 3I2IA 2BPA2 5LY2A 5C71A 1JS9A 1CPMA 1QIQA 3FE5A 1QU0A 1Y4WA 4AQTA 2ZEWA 3AYDA 4NPMA 1S0EA 1RXFA 2AR6A 3DV8A 1RUC3 4P5YA 1QF3A 3L9JT 5H9QA 4CCOA 1GR3A 4XDOA 4NIHA 1PO23 2MPFA 4TLGA 4TSVA 3WQ1A 1RUH2 3LPFA 3I49A 5IWFA 2GC3A 2CV6A 2Y8KA 2J7MA 5I0TA 1WD4A 2A7AA 2H0BA 4LT5A 4RFRB 4COZA 1GFF2 1IGOA 3DXUA 4CCJA 4FQZA 3FX3A 2G4IA 1GOGA 1PMJX 1VBB2 4I3GA 1YIPA 4XPVA 3U78A 3LDRA 5I8TA 5I93A 4IESA 2BP6A 5FDBA 1AR63 4ARYA 1SLLA 1VMJA 3RZKA 3THTA 2GU9A 2QQVA 4QX5A 3NV1A 4NN0A 2B42B 5FY0A 4BLIA 3KGLA 4LBOA 1VBD2 3E6BA 5FZ6A 2QQMA 1X33A 3J8F1 2A5ZA 5A1AA 1VBC2 1OKOA 2PLV1 2R0FA 2VO5A 3VV1A 3K4DA 4FO9A 5A6XA 1FV2A 2UYBA 1UN1A 1X9TA 2J1AA 3AKPA 3OB8A 1G86A 3AZXA 4PIXA 5F2WA 3MHZA 2JG9B 3SH4A 1GWKA 1LHOA 1PMHX 3K4AA 3RYRA 3GCXA 1KD7A 3K3OA 4F83A 3C3VA 1LHNA 2XJTA 1AYN2 3WNPA 3CZJA 4LUMA 4XF1A 1OFSA 2VTFA 3B9CA 2IFRA 1DGWA 2HWF2 5FREA 4KI5M 5B4NA 2B5HA 4KMQA 5A7WA 3VDCA 2WWUA 1C1FA 1B09A 4QU1A 1IS5A 4LJHA 4IV3B 3LGRA 4LITA 4LLOA 4QPGB 4HETA 1OD5A 1KJRA 4UBGA 5F5AA 4DOUA 5L36A 2WC2A 2R49A 5D8AB 4KNCA 2JE9A 1QHDA 4Y1YA 3WW2A 1IS3A 1YQ2A 4UFKA 1LGBA 4W65A 3T08A 3NNFA 1UL9A 4XCBA 3HNMA 1CZVA 2JDAA 5KHIA 2BW8A 3SNMA 2I07B 4A3ZA 3B3QE 4G3YC 4LE3A 3Q8EA 4BJ0A 2XMLA 2OYZA 2DVFA 1RIRA 1CQ9A 4LEJA 5C33A 3V0AA 3V64A 3V0BA 3R4UA 5HPOA 1OH3A 2VR4A 4GQ7A 2ZABA 3THPA 4XFHA 3RI9A 3KLSA 5DABA 3UJQA 1AR72 1PGW1 4XBLA 5FUIA 4RS5B 4A4AA 3EYPA 1ND2B 1U0AA 2RDSA 2E31A 2XBO3 3KD4A 3RQ0A 4XZPA 2I74A 5AC91 1MACA 1CAWB 5CNAA 3GALA 4ZKTB 1W0OA 2ZZJA 1HV1A 4LULA 2YC2A 3RWNA 4CCKA 3WG3A 5I0DA 2WLQA 1HB1A 5FZIA 2FQPA 5LRRA 5A33A 2D6NA 4U2AA 4AZZA 4B8EA 5FXWA 3VUOA 3T4VA 3FHQA 1TMF2 4LBQA 4XYXA 4DNYA 3HBKA 4IEQA 3PVBB 4QHOA 4XIOA 4Y33A 5A3PA 2QQNA 5I8YA 1ONAA 3O0WA 4CU9A 2PHRA 3H1MA 1AL21 4XXPA 5AFEA 4CEYB 4I30A 4Y22A 1VBA3 1ZBE2 4OMDA 3FUOA 1JI6A 3OG2A 1MEC3 2R072 5IFTA 2EIBA 3BPZA 1FAYA 1R083 2FCTA 3SH5A 2ORXA 5ISLA 2BNMA 4UBHA 1O5UA 2LM3A 2AEZA 3BOPA 4OHWA 4URTA 5F3CA 4CU8A 1W6OA 4FFHA 4XZUG 1W9YA 4D8MA 2HWC3 2FDFA 1TE1B 1TME3 1RUF3 1K5MC 2BERA 2XBO2 1WCQA 1XPWA 1PGL1 1ENQA 1U5XA 1XSRA 5D2AA 1WZXA 2RJLA 5FPVA 4CXWA 5F9TA 3OEBA 1UPIA 2FDGA 2WNEA 2ZPXA 3VBOB 4BQYA 1OKQA 2RDNA 4RFT0 3ZN5A 2VU9A 2BNOA 1F35A 1LOFC 3GZTB 3ZFGB 1JZ2A 3PJQA 3FFQA 4NMIA 1FATA 1A6CA 4AI0A 1V6KA 3J7LA 1VP6A 1W3VA 3ITQA 3IAQA 3NJYA 4JTOA 4QT6A 4AI1A 4BISA 4XJ8A 4CCCA 3AP7A 3WG2A 2A3WA 5CFDA 3KWVA 2A1XA 3DPRC 4AI2A 4B7EA 3APBA 4EN9B 4IE7A 5C4WA 4MX3A 4Q2FA 1PO12 1Z7S1 4IXLA 1PO11 1QJX3 3X29B 3VZMA 4CRQA 2HEVF 1O4ZA 3SCFA 3WNOA 3VZKA 1KGYA 4FP2A 3HQRA 1QJY1 3URFA 2VM9A 3WNMA 2JKBA 1Q8VA 1AX0A 4L0PA 5FY9A 1GOFA 1H6YA 2XJPA 3B01A 3J8F2 3KHBA 5IAVA 2A75A 3ME2A 2X5IC 2YU2A 1RC6A 1VBD1 3OY8B 2B9VA 4AOCA 5KHGA 1QNYA 4AEDA 2ZGRA 2YPJA 3C2UA 2JG9A 5C4WC 2ZEZA 5LY1A 1RUC2 2VOTA 3KT1A 4RR3C 1VLNA 2FCUA 3QH6A 3IDCB 5FYBA 5FZHA 5HCHA 3SCHA 1G6NA 4PIZA 3OGGA 3MO4A 1RTVA 4M3CB 2RS52 2XL9A 5A80A 2JDYA 2C24A 2VECA 3NNMA 2XKOA 3BYWA 3AMQA 4AVAA 2OVUA 2KD7A 2XHNA 2Y26A 4XACA 3FL7A 3WF3A 3VBUA 2P3YA 1QJX2 3SISA 1D0GA 1BEV1 4RS5C 4NPRA 4E4ZA 1SLCA 2DVBA 2W9XA 4BZ4A 1ZBA2 1W8UA 1NLRA 2WS92 1WBLA 1BK1A 1UWWA 5BPXA 1QOTA 3NQHA 3BIEA 4DUVA 2ZX1A 2XQXA 4Q1RA 3KV5A 3MIDA 4FXKB 4COWA 3IMNA 1WGPA 2ENRA 2WZ8A 1OH4A 4YW1A 4AGGA 5FZGA 3TOJA 1R091 1JTZX 3MPBA 3NNGA 1IQDC 1VPHA 4WVVA 1CONA 1JBCA 1OOPA 4XMIA 1AYN3 2UWCA 4D3WA 3RZMA 1S0BA 2HWD3 3LEMA 3VBOC 1W0NA 2O0OA 5ACA1 2HLEA 5DG1A 3AFGA 1K5JA 2RS53 2VUCA 5FJHA 5JXJA 1CAWA 3JBG3 3E5UA 2VZQA 3KSCA 1RB8G 5E1RA 4AVTA 1WA6X 2R7EB 3KCCA 5FZLA 3GM8A 2DFCA 4F3JA 1HQWA 3LPGA 4M3CF 1ZZ8A 2P2KA 3H50A 1STMA 2I45A 5GLUA 3MIFA 1COV3 4YW5A 3JUUA 3EJKA 3ZR6A 2JENA 4LO8A 2CU5A 2HWE3 4P9JA 2WFF3 4GB33 2WNVB 4Q5OA 2VMDA 3I59A 5EZWA 4AVBA 3VKOA 1JYIA 3JBG1 5FYIA 2AZ5A 3BALA 4Q4Y2 4XHBA 4H55A 4HOOA 1S0DA 3U1XA 2NP0A 3I3MA 3J4UH 1JZ7A 3T0DA 4BK4A 2QBXA 3BN6A 1DG6A 5KC5A 2ZGPA 4Q26A 1H30A 2WRAA 1LECA 1ZM1A 4N43A 4OHZA 2VMFA 1W6MA 4B1LA 1RUD1 4QX3A 1V70A 1RUD2 2WDBA 1VAVA 4ZS3A 4EWEA 2XJRA 1JYXA 1XE8A 2BU9A 2ZGSA 3O1UA 1IPJA 4JC1A 3T1MA 5FMOS 4NRPA 1TEIA 5T3NA 2EXHA 3H3ZA 3H42B 4C1XA 4UW4A 4QKBA 4DY3A 3CBNA 3I2HA 2XJSA 1QJY2 1UXXX 4JDNA 1S2BA 1DU3D 3C7EA 4Q0QA 2Q8DA 1HRI1 4AAPA 4UW3A 4W6XA 1COV2 4N90A 3ZXKA 2E6VA 2NMNA 2UWAA 4HXCA 1SMVA 4XF9A 3TYJA 1V6MA 3W20A 1R1A2 1LRHA 1K3IA 2BGOA 3LA3A 3O1RA 3VL9A 3UETA 1MQTB 2MEV3 3WCRA 4DRVA 3W21A 1VBA2 1ZBE3 3E5QA 2J42A 1UZVA 4FTEA 4FAHA 3W5NA 4XQWA 4QGNA 5BYNA 3BTAA 4IEPA 1JZ5A 3DL3A 3ZYGA 2VH9A 5C8CA 1N47A 3OGVA 1XNTA 4LK6A 1GP4A 2HJIA 1S0GA 2YBSA 1OC1A 2P6HA 4IEWA 4LKFA 4Y3OA 5DZFA 5FZDA 3ECQA 1IZ3A 1C5HA 3VBFC 3AXEA 4WV8A 4HSJA 1GNHA 2Z42A 4W50A 3T3YA 5EXOA 2OW4A 3WV6A 1NE6A 1QGLA 4MGSA 1V6JA 3FC0A 4YZ4A 3HEIA 5L73A 2R1DA 2PAEA 2HYKA 2ZGUA 4R9CA 2JD9A 4QM8A 4N43B 4GH4C 3QBQA 2V4VA 4C91A 1UKGA 2RVAA 5FYSA 4YW3A 2X5IB 4BYYA 1H4GA 1CAXB 3VDDB 2QNKA 2R071 3VBFB 3Q8BA 3JU9A 3N9LA 1HRV2 1QJFA 3NSTA 4AHWA 1TNRA 4CDUA 4LTAA 1W90A 3D82A 1BBT2 2JDNA 3ACHA 3OUIA 4AHXA 4BE3A 5IYYA 2TBVA 1D4M1 1B35A 4LBLA 4E27A 4P9IA 4R9AA 1ZRFA 4QHBA 3DPRB 1J3QA 1RUC1 4XCAA 3HAGA 4MVTA 4N8MA 1GP6A 1L3JA 1RUG1 5FLHA 2WL1A 3WQBA 4IE4A 1ZREA 4BLJA 3GF6A 2XH6A 1W6NA 2BGCA 4AEMA 3O1VA 3WQ7A 3ZXAC 1C28A 5KXDA 1O3QA 4F7ZA 2QQPA 4P9XA 1QQP1 1G9FA 5BV6A 5CA6A 1Q56A 3F2ZA 3AFKA 3LSEA 4H7LA 2BQPA 2VW0A 1WLCA 3PNAA 2RDRA 4CDWA 3D0SA 2B45X 1RVF3 1XU2A 2BNNA 1ASJ3 3SEPA 1RHI3 3ZMOA 1ZVFA 4ASMB 4I02A 2R061 2ZAHA 2DF7A 5H9RA 1YJKA 1PIV2 2W3JA 1MS0A 1H8VA 2FDJA 1HRI2 2OA2A 1O3SA 3HN3A 1WW7A 1NQJA 2A71A 2ZCWA 3ACFA 3ZKYA 2PHXA 4J6GA 4CP0A 4D6RA 4JRAA 1VBB3 2C5DA 2PAMA 4CCLA 4JCKA 2JE8A 5FY4A 3VD4A 3ZMNA 1UOFA 1PZ9A 2WZR3 2WZEA 3WLUA 4AFMA 2ZJCA 4Z82A 4EN6B 1R081 4N7IA 1L7LA 5C3SA 3NRUA 5JZGC 1Y9QA 3U07A 5JOWA 4QX8A 1EAH3 4K3UA 5JZGB 2KXLA 4QQHA 2L9LA 4FPEA 4YW2A 5C9AB 4GWMA 3WY6A 1AVBA 3IKWA 4GMP3 5JWPA 4CUCA 4QWNA 4QDQA 1SEFA 1H4HA 1ZZCA 4PIYA 3A4UA 2W46A 3TWIA 2ARAA 1YWKA 2VCAA 4Q0UA 2W68A 3KHCA 3R6SA 1EYBA 2B46X 4IGQA 4IV1C 4YNIA 1CESA 1FNYA 2AGSA 1C1LA 5FLIA 3D5OA 4Y1UA 5F32A 4A2UA 1RMU1 3B93A 2XB6C 1EUTA 5J48A 3FN9A 3T09A 2Y6LA 1R64A 4WM8B 5JSOA 1F15A 4WM7B 5DUWA 1VBC1 3VZNA 4QKFA 5SV5A 4J1WA 1MEC2 3AZYA 5FY1A 2D6OX 3BTZA 3GBFA 1QXJA 1GU3A 4UAPA 4Q8LA 5A70A 2RJKA 2R0HA 4XTMA 2QQJA 1E57A 2TNFA 4RL7A 3SITA 3ZOIA 4EZHA 2P37A 5LEKA 1O7FA 2WFF2 4B4QA 3SKVA 3LIHA 1RUJ2 2Q8OA 1AR93 2PHTA 1V9U1 2QKDA 3DF0A 1MS1A 3LCPA 3VHPA 2CWSA 3NAPB 2RM23 1LCLA 4RN5A 4NWWA 5C4WB 3I3EA 1MS3A 3OOXA 4XJZA 3IWZA 3SCGA 2ADDA 4L9BA 4QGLA 3JB8A 5KHJA 3KZ4C 4K20A 3IPVA 5GLZA 5GZCA 1SLTA 4Y1ZA 3RZHA 3ZYIB 2W94A 4KG0A 4LPLA 1DYPA 2EIDA 4I0AA 2ZX3A 1DQ2A 1MS8A 1YI9A 1POV0 1D4VB 3FLRA 5GLWA 5JPNB 3MLLA 2XGXA 2DU1A 2WN2A 1X50A 4PBOA 2RS31 4EE2A 4ASKA 5FZCA 3IDBB 4IEZA 4MO3M 5FJKA 1POV3 3ST7A 4JAAA 4QM9A 1V6NA 4BIOA 2FBEA 1PM7A 1EP0A 2D44A 2K2SA 5EFUA 4FPJA 1QJU3 1SLBA 2Q30A 1GZWA 3EQEA 4KGGA 1CWPA 1UY3A 1U5YA 4JV4A 2CGPA 4M4RA 5DZEA 5F37A 4RS5A 1AR91 4JGYA 1R1A3 1ND2A 2PLV3 2VVDA 1LOBA 4WM7A 1UO9A 1VB2A 5K0UC 2JDKA 1VMHA 3J8F3 3VBUC 1UYXA 5HXMA 3OY8A 5CYYA 4NIGA 2WQ8A 2X09A 3T2PA 4C0BA 3B9IA 2X10A 2JICA 4TZDA 4A7KA 1WMFA 2Y34A 3PUSA 3J7HA 2C26A 4O61A 2PHWA 4HN0A 5FLJA 1GQHA 4QDSA 4LHSA 1F4HA 2IXJA 3E97A 1OQDA 2AC1A 3HT1A 1DQ6A 4LBMA 5LBFA 1GWMA 3IM0A 3ZM8A 4KU7A 4QXBA 2JEMA 5SV8A 3M3EA 1KEXA 2VQTA 4AEDC 4QXCA 1JYCA 1WA4A 1W6NB 2D40A 2FCVA 4Q4V3 5ABJB 2YGLA 2VXJA 2Y6KA 4ES8A 3HD8B 2VBDA 4AEJA 1NCRB 3MW3A 1W05A 1CIWA 2P6CA 4ZU7A 2C9KA 5FYVA 2ES3A 1TZOA 2YDEA 4AWDA 3LE0A 2UYAA 4Y5SA 5HXVA 2QQLA 4MYEA 3VD5A 4N7UA 4ZXKA 2FZ2A 4Q27A 3HR9A 2W52A 3RPQA 2AH2A 2HKXA 1Y9MA 4LHNA 4O9GA 5K8SA 4KWKA 1NT0A 1Z7S2 2WNVC 1RGSA 4XXAA 5FP8A 3S7IA 3ZKUA 1JHJA 5A3TA 4L97A 5GZEA 2V73A 1EV13 1QXRA 4DRRA 3SEEA 4MZUA 3VGIA 5HV4A 3ILRA 3POYA 5DAWA 3C7GA 2WR9A 4CDWB 3LSDA 3MPPG 4P02B 3FHAA 3POFA 4NWVA 4ZXEA 1HJGA 3OBZA 4XUQA 1HRV1 3LOIA 5T5PA 1J83A 4HK9A 1GP5A 3I2DA 2XJVA 4AI9A 2XLFA 2DTYA 5FZOA 1Z78A 3WQ0A 4AI3A 2R063 3RMYA 3UESA 2GNBA 4DQAA 2W39A 5IK7A 5LEJA 2VOWA 1REFA 5BNOC 4QPWA 2OPKA 3MEPA 4AE2A 1W6PB 3PTRB 2VC9A 4AEDB 2RR11 4JZRA 3RS6A 3GNEA 1AX2A 3ZPOA 1FOD3 5E88A 3ZO0B 5IW0A 2V5YA 4V1PA 5AC93 1OQ1A 1XYPA 2ZKNA 1D2SA 1TMF1 5FZ1A 5KBFA 2IXLA 4KBBA 1KS4A 1VBC3 3K3NA 1S0IA 2CDOA 1KXGA 5ABJA 2VJXA 1C57A 3USUA 2GN7A 3OYWA 4CPBA 4FTBA 5HBAA 1CAUA 1D4M3 1W2OA 2YZ4A 3FJSA 3I3QA 1DQ1A 4DINB 3VKFC 4Q4W3 5K0UB 5BNPA 5G04L 4YW4A 3PJYA 1GQGA 1ZBA3 4KBZA 3AP9A 4NO4A 4OLLA 1KITA 2CAUA 3ON7A 4QKDA 2YBPA 1YFUA 5D8AC 4AW7A 1RUJ1 2WA4A 3MIEA 1UAIA 3EB7A 1DQ4A 1GBGA 4MSVA 4IE0A 1T6BX 5C5UA 5FBZA 5GALA 3WP4A 4XJ9A 3JQXA 2JG9C 2OQ6A 1UIKA 4GWIA 5LASA 3M7AA 4LKEA 3ZN6A 4W6YA 4D7SA 1QH7A 2JG8A 4NJ4A 3T2QA 1X8EA 5A7NA 3WEZA 2PA7A 5BNQA 2R32A 5JDBA 1GQPA 2ZZQA 1VIWB 1RL3A 3BIWE 4K21A 4NIAA 3DYMA 3IIAA 3ZIXA 1YIFA 2EICA 4COUA 5CISA 3S0MA 1AR71 2ZOEB 2D6LX 3AX4A 2VAUA 4Z92B 4HKWA 1JU3A 3WVJA 3ZYBA 2RS11 4BIFA 4LK7A 1UXZA 1WLTA 3BOWA 1VBE1 5J3UA 1XE0A 5JIAA 5J1XA 1HX6A 5ACA3 1WLWA 2YFUA 2ZX0A 4AFBA 4YARA 1CZSA 1DYOA 1ZX5A 2ZX2A 4ZPIA 1CGPA 1G9CA 5A7PA 1E5HA 3Q8CA 1JUIA 5LZ6A 1F31A 2VGDA 4QQLA 3KM5A 2ILMA 5FZOB 4Y22B 1YHFA 4IETA 1JZ3A 2WO1A 1JUHA 2ZGMA 3AKSA 1W2TA 2AREA 1ULGA 4LO4B 1QXPA 5F5CA 5FWEA 1US3A 4HPKB 2QDRA 1JH5A 5FP4A 3AB0A 5DAXA 5CKQA 2VZSA 5FMBA 1UNBA 2Y6JA 3ZN4A 3L2YA 3R4SA 1KQRA 2D3RA 1Y9GA 2R1BA 3AMHA 3TEWA 3A0KA 5CU1A 2FDHA 1GZWB 4HSLA 4QX7A 5HCBA 4XDQA 2YGMA 3EHKA 1LHVA 2CGNA 4PQ9A 2WABA 1PO21 2QQUA 2QZ3A 5L19A 4D6SA 3OPZA 2FHRA 4FBFA 1C5IA 5CBLA 3TEYA 1UY0A 2CTVA 2VE1A 2D97A 4MUVA 2DTWA 4PI0A 2RS13 3UV9A 2F4LA 4B29A 4ZZ5A 2P34A 2Y64A 4UOJA 1XQNA 4A6SA 3H7JA 5IVJA 2R073 4Z07A 5CG8A 2VL4A 4KU8A 2HYXA 2LALA 2W47A 3N9OA 1DGRN 3OGJA 4BPZA 3N9QA 2JWPA 2ZHLA 2NZ9A 3M8LA 5F1RA 1JYNA 4GMP0 1AXYA 2QCSB 3Q8AA 2VNRA 3GDBA 3AJYA 4MXWB 1J84A 4P14A 1PM4A 4JQTA 1AJKA 3JXSA 4DFSA 4A7ZA 4HVQA 3HN1A 2RE9A 4LOSA 4CEYC 1FYUA 3H8UA 4OQ8A 1RUE3 4BHPA 1BEV2 2FDKA 4V2VA 4D94A 2VUAA 3N7KA 4RGGA 1SFNA 1IHMA 1ZRRA 1Q8SA 3I2FA 4R9DA 4K1ZA 4UYBA 3WF4A 1DQ5A 4LBKA 1ZZBA 4QPGA 5JR7B 3G6JB 2BV4A 4GXLA 3J7NA 3VBRB 4AVSA 3NAPC 4W4ZA 5FZ3A 4QB6A 4CUAA 1A34A 1RHI1 1QWRA 3PDQA 2B4KA 4HG6B 4KH9A 1S2EA 3P3NA 4K9SA 4Q0PA 3E6CC 2YU1A 1Q8PA 4P00B 3HQUA 1FX5A 2VXRA 3ZLIA 1L7RA 3N9NA 4JGZC 3I2JA 5EPAA 3RG0A 3MYXA 5A33B 5CFCC 3PMSA 4XILA 2GAUA 2GMPA 4Y1XA 4ARXA 1E5RA 3GHNA 4GWJA 3ROUA 4NRMA 4CUBA 5A6ZA 2V72A 2VOXA 3PMEA 4MV2A 5EV7A 4HLTA 3VBHA 5CFDC 1F2NA 2X5IA 4FCAA 2GZWA 1CAXA 3VDDA 1RUI3 3AL5A 5FO9B 1DZTA 3PUAA 1K5MA 1XSQA 2OUJA 4YVWB 5FO8B 5CVRA 3ZIWA 4GKYA 1BEV3 3MW2A 3ZPYA 3ENRA 2C6SA 3UKVA 3POWA 3NL1A 3PUQA 1YFWA 5C8CC 3LA2A 4JKKA 3VHRA 2W87A 4MHUA 3NV3A 1H2LA 1PO22 2WYFA 1ZA7A 3OJBA 3MFCA 2VZOA 4HMZA 4MXWA 5FUNA 1ULDA 1HB3A 2Z2SB 3TEXA 1IKPA 4WM8A 3USSA 3P3PA 1JOJA 3KT4A 3PL0A 1H6XA 3GYDA 1XBFA 1YXWA 2IVJA 3QACA 3PHMA 1MZEA 4CDXC 3FFZA 4XETA 4DXSA 4YZ5A 3VKMA 3NVCA 4RHV1 2A6YA 1PHMA 1UY4A 4MGTA 4HK8A 4CU6A 1WWYA 1IG0A 3JCIA 1BMV2 1COV1 5FMOL 1ASJ2 2J22A 5FYUA 1NA1C 2GP3A 1N1SA 3MIBA 3LAGA 5JXIA 3KF5A 3I54A 2JECA 1M06G 4YM0A 2GNDA 2ZGLA 5I91A 3BVCA 5GKAC 1PGL2 4LXLA 1W9SA 3J7MA 3M2MA 2HH9A 4OI2A 4Y26A 3UYJA 3P1IA 4QQ2A 1WCUA 2RM22 4JHTA 2NQYA 2CYFA 5DDJ3 4TXWA 2HWD1 1V6OA 1PO13 1KJLA 1NLQA 2RS32 2VULA 3A23A 3NW4A 3UNPA 3NV4A 2VOVA 3KCXA 1WW6A 2Y0OA 3QD6A 2J1RA 4JHZA 5FOJB 2C9AA 2MNGA 5FRAA 1XC6A 4OI1A 4IV1A 3LA7A 1AL22 4NAMA 5G05L 5K7PA 2GSYA 4K6BA 2BOIA 4UW5A 1NZCA 1IS6A 2JIGA 4OHYA 2XUEA 4LO6B 4XC9A 4YFWA 3DXTA 3M1HA 4CCMA 3U37A 4P9GA 4CDUC 4M0HA 4CCEA 1S0CA 2ZGOA 4EN0A 4HN1A 5I0UA 1ENSA 1HDKA 1MZ5A 4IQPA 4PT6A 1GYKA 3U4SA 4YG3A 3FBMA 4M01A 1QJU1 5FYTA 3NNJA 5FZ9A 4QPGC 2H6CA 1UX7A 2W1WA 1GKBA 4E4SA 4H2AA 5FXVA 5LBCA 1DCSA 5LA0A 3OD4A 2XOMA 3D8CA 4I0WB 2E32A 2EIEA 5KWRA 2RS33 2ZXQA 2QQKA 5LBEA 2VNGA 1X8MA 1ENRA 4O7XA 1VBE3 5L7OA 2AEYA 5F7UA 3C8XA 3PVOA 4OUMA 4XEZA 1R092 2EIGA 5LBBA 1LOEA 3ZXJA 4FPOB 4CTEA 3KS7A 5JPMB 1LEDA 1TQ5A 4YM1A 2PQSA 1RUJ3 4QU2A 4AHYA 1UZZA 5EQUA 5JSPA 2DVAA 4LBQD 4N53C 1N1VA 1LGNA 2OS2A 3V0AB 1VE0A 3RRDA 3LZZA 2DCYA 1VRH2 1W2UA 5GZGA 1DFQA 2Z69A 1ZBA1 1CN1A 3BI3A 1NY71 3ZXFA 1KRIA 1HN0A 1AL0G 2IZWA 4EZ4A 3CKHA 5CG9A 2R6QA 3CO2A 1V0AA 1MQTC 3TEZA 2CHHA 2TUNA 4HFSA 4KL1A 1QJX1 1O4TA 2DVGA 3AMNA 3TRSB 2GC2A 1XE7A 5A3LA 2DCZA 3I3DA 2HWD2 5DAQA 4FFFA 4RSUA 2BFUS 4P08A 2D3PA 4YRDA 1C8M3 4BXFA 5FZFA 4M4PA 2PMWB 3KQRA 5FTTC 3THCA 1G9BA 1LOAA 4IW3A 2QZ2A 1OF4A 4OZXA 4FOVA 1N1YA 2R041 2WT0A 3POGA 3LDKA 3KQ4B 1FOD1 1QOOA 2W1SA 3ZYFA 1PIV1 3ASIA 3FWEA 3BCWA 3U4XA 5IAXA 2VMIA 3GGLA 3ZVXA 5IK8A 2HBTA 4QQOA 2JDZA 5JLVA 1RUI1 2ZHMA 1HQLA 2WAOA 4IV1B 4A3XA 3ABZA 3N35A 1ENXA 2ORZA 1H8TC 1V6LA 3OPWA 4BQ3A 3M3OA 4HVOA 4GJYA 1W9WA 2JJ6A 1UCXA 1YRZA 4R4XA 3KV9A 1TME1 3NJVA 2TEPA 4QPYA 1DQ0A 5FYYA 2HEWF 5KHHA 3H8OA 5J09A 1EAH1 4FI9A 2D3SA 1UX6A 3S30A 2Z79A 1OBNA 4UFMA 3QCWA 1DLLA 3MF6A 2VY0A 4XFCA 4RR3B 2P3KA 4OUEA 2D93A 1C8M2 2PAKA 2WFPA 4RQPC 2A73B 4BB3A 2OPWA 3E1F1 4RYDA 4TN7A 1YLLA 3ZFFB 3FZ3A 2CAVA 2JXAA 4GKXA 1YNAA 3JD71 4Y20A 2BWAA 1X36A 2EALA 1YQ5A 1V6IA 4LBJA 1RUE1 2ZGTA 2WT2A 1I9RA 2XONA 3INAA 4O9EA 2UY8A 1UQXA 4IDZA 3ZYRA 5J7MA 2XDVA 1I3HA 1W2NA 1CJDA 2GMMA 2HBUA 4D69A 1RVF1 2QFEA 5CKMA 5JR2A 4PHZA 5EYXA 4L99A 4Q4V1 5ABJC 4WVWA 3ETQA 1VJ2A 2IXHA 1LESA 2Q5TA 2R30A 3EXUA 1H1AA 4JDOA 2XG3A 1F9KA 1XB9A 3BB6A 1Z7S3 3BODA 5A1FA 3VBOA 2P1BA 2F6BA 2P3IA 4COVA 4LORA 3V0BB 3O1OA 2IXKA 2JDHA 4YVWC 2DCKA 4OZOA 2QUOA 2XXZA 4H7MA 3POIA 5EJ3A 5BNOA 2G1MA 5FY7A 1ODMA 1S2KA 3H3UA 1PIV3 1XNBA 4X6RB 4OI4A 1RYYA 3DCQA 2WSUA 2VCBA 3KVBA 1A8DA 1FV3A 3SHRA 4CU7A 2DVDA 2UY9A 1NCQA 5BNNB 2X05A 1W8NA 2IXIA 4NPLA 3RNSA 3ZSJA 4RGAA 4CEWA 3GJBA 3MI8A 3D4KA 3GCWA 5EJ1B 2YUEA 2Q1MA 3ZYPA 2WS93 4QB1A 3IMMA 4QQPA 2G9FA 4N43C 5IHRA 2ZGKA 4Q29A 2ET7A 5A6QA 1SLAA 4XUOA 5KHKA 2GNMA 4BOWA 3I4IA 4XW3A 1FPN2 3S5QA 4AQSA 1BK0A 1V00A 4WBBA 4GD4A 4XF3A 3WP5A 1CX1A 1JOBA 1YO8A 4GA9A 4Q0VA 4AGVA 2W5FA 1OLME 1Z0HA 3AMMA 1ZRDA 1LHWA 5L9RA 2KA3A 4S2GA 1WKYA 2D7FA 3B00A 4FAGA 2V09A 5A7SA 1CPNA 5ANQA 1H0BA 3IN9A 3JD73 4YWAA 2E26A 4RR3A 3DPRA 3AK0A 3M4FA 3RMXA 4RA0A 3SMHA 4YG6A 4LKDA 1UYPA 3OF1A 1O3RA 1JZ6A 4KWLA 3HWJA 1CZTA 3K77A 5T5JA 3RYPA 1H2MA 1OA2A 1V9U3 1PGSA 1I5ZA 1ULPA 2KM2A 3MLKA 2YV8A 4NRQA 4WZFA 3TN92 3VZOA 1ND3C 4CA9A 4R4ZA 3KV6A 2PQQA 3SKJE 3TN91 4COYA 2WA3A 2DWRA 3RFRA 3FUQA 1H8TA 4ATEA 1UD1A 2IVIB 2DCJA 1B35B 5FZBA 2WNUC 1AYM2 3ZSEA 4LO7A 2WIIB 3OBAA 4MOAA 1H1MA 3CIHA 4WM7C 5FPLA 1AR92 3POSA 3MW4A 4SLIA 4ZY9A 4AHZA 5AFBA 2XJUA 2C4XA 2LTNA 4QDRA 5F3EA 2J1TA 2RMU1 3WT3A 2PELA 1AXKA 4GALA 2WZR2 1FPN1 4MGKE 3U11A 5KXEA 3NMBA 4I0BA 1QDOA 4XJAA 4V2WA 2X8KA 1ACCA 1FMD1 5BNOB 2IC1A 3ZN6B 3MGUA 3H7YA 3CNAA 2DUPA 2WNVA 4X6QB 1I1EA 4W6WA 5FZMA 1SLIA 4XF0A 2E7AA 3MICA 4UFLA 3AJZA 3ZR5A 3H1YA 5D1IA 3KMHA 4XUPA 3MF9A 1I5PA 1XXNA 4JQRA 1HV0A 3TN93 5FPZA 1QY4A 2QDNA 3K51A 3RDIA 4HVRA 4YVSB 3CLPA 2XR4A 1K42A 4TWTA 1QJU2 1O8PA 1XU1A 2VZPA 4G9SB 1EY2A 4LO5B 4XVHA 4ZU4A 3AVSA 1OVSA 1DDLA 3B69A 2B8MA 3WHTA 4CDXA 4PI2A 3SLIA 5JZGA 2WINB 4YGDA 1OUXA 5BY5A 4YVWA 4CXYA 2MEV2 2JX9A 4QKNA 3VKLA 1REEA 4O65A 5E8AA 3WUCA 5IVVA 2E51A 4CDQB 5FK7A 5FZ7A 5GM0A 4AVCA 4CSWA 4HPKA 2VCMA 3IBMA 2VZ1A 3WDUA 4AR2A 2Q0AA 2WZR1 3WW1A 1W06A 3PIGA 4AFAA 4NIDA 2AACA 4XFIA 3OBRA 5FBJA 2E33A 1N3OA 2RMU2 1SPPB 1ULFA 3I7DA 5KC6A 1SBFA 2WS91 4CP9B 3KVAA 2WZPP 2JD4A 1SCSA 3VB9A 3U75A 4QB2A 3VKNA 4D6QA 3UGHA 4BMEA 5C3PA 4Z8BA 5FZKA 1W0PA 3N36A 3O5SA 1BZWA 5C3OA 5EIYB 5FR3A 4PLNA 1YC61 3MFAA 3NAPA 3POEA 4BQ4A 4YM3A 3KV4A 2IFWA 5C5TA 2K0GA 4Y20B 3N9MA 4CPBD 5A3UA 5C6CA 2WJSA 3AYEA 1PZ7A 1ZRCA 4EN8B 2NM1A 4E4DX 3MV11 1G9DA 1JOPA 4E2SA 3VL8A 2VQUA 3AP5A 2DU0A 1VAKA 1TNFA 3CJIC 3LEKA 3VBSA 4WZCA 5JVVA 2JDPA 1PMIA 2QQWA 3POJA 2PYTA 2OUHA 3DECA 4OQ9A 5IJRA 3DKQA 3M3QA 1HXS3 2WNOA 4ZZ8A 3GBGA 2A6XA 3GZAA 4BCUA 2PXJA 5JI7A 3WNNA 4A44A 4BQ1A 1EV12 1YQ6A 2FDIA 2GP5A 4IV3C 1F5FA 2ZKLA 4NE9A 4Q4X3 5F39A 4S2HA 1SCRA 3WDTA 2VUJA 4YZ2A 2EVXA 2YYOA 1R1A1 5DPNA 3VBFA 1ODNA 1UU5A 5H9SA 2W1QA 5A7OA 3OUHA 1OI6A 3GJAA 3LIGA 1Y43B 3THDA 3WX5A 4CDWC 2YY1A 4NVPA 5LA1A 3AL6A 3K46A 5FY5A 2DUQA 3OYWB 2VMEA 4E2QA 1UZWA 1FI2A 1DGLA 5FMDA 2VBBA 1NYWA 4BQWA 5JMCA 2VG9A 1NG0A 2AENA 4OFGA 4K7JA 1AJOA 1IOAA 4JTNA 2ZAAA 2YXSA 5B2GB 1WW5A 1YFXA 2ZTNA 3PIJA 5IATA 2QQIA 4G4FA 3C7FA 4N53A 2XKPA 4PJYA 4PLMA 5FZAA 5HCAA 5FP3A 2CNAA 2PHUA 4NR1A 5E16A 4JGYB 4L8QA 2IUWA 4XJUA 4CDQA 4HL0A 1DZQA 3MIGA 4CP1A 5LW9A 3I2GA 4CE8A 1JMUB 1BXHA 2OXBA 1VRH1 2D5FA 1W8OA 5CZKA 1IG3A 3O1TA 2PHDA 3AXDA 1LU2A 3CL1A 1NXD1 1ZNPA 3I2KA 4BXSV 3WD5A 1H8TB 4Q4X2 4YSFA 1H2NA 1NAEA 1SBEA 2W0XA 4ISRA 1BBT1 5D21A 2OT7A 1W6QB 3ZSKA 3U10A 3N7MA 1U12A 2MEV1 3D0JA 3WOGA 5J37A 1W39A 1MZFA 3GBWA 1SDDB 5I0SA 2EXIA 1OFNA 1OD3A 5DUXA 5CFDB 4GH4A 1RXGA 3GZEA 4Q4Y3 4YM2A 4AFCA 2VNOA 3N7LA 1LHUA 5DDJ2 3LEGA 1EPZA 2WN3A 3CQOA 4CYDA 3BGAA 4A6OA 2VD7A 1LEMA 1DLCA 2YBKA 5T5LA 3T30A 4YGBA 4IV3A 2E7TA 4GJZA 4CXXA 1AR81 2VCCA 4EJRA 1O91A 1AR82 2DBIA 4Y4RA 1WMDA 3HBZA 3LWCA 3ZDVA 5LCWL 3ZX7A 5JAXA 3TBDA 1O5LA 1PNFA 2SLIA 1LULA 2DCTA 3NWKA 5DDJ1 5IVEA 1J59A 1EUUA 3WHUA 5A7QA 1W8HA 1ZYBA 4A7YA 4P9LA 2SBAA 5I0RA 2WFF1 3W5MA 2K9ZA 3K48A 4EN7B 4YW7A 5A3NA 4UI9L 5K4LA 3NKGA 5EYYA 4DB5A 4DXRA 3R4DB 1RUNA 4ONUA 1Q8OA 4P5HA 4OHXA 4YW6A 4PDWC 4XMAA 5FWJA 1AYM3 2ZBJA 1UKRA 3PUHA 1AUYA 1ST8A 3ZYHA 4YVSC 4MLOA 3V56A 1O4YA 4CDQC 4CDXB 5E89A 2EAAA 1E5IA 5FOBB 4M3CE 3VBSC 3B94A 1WMXA 5DN2A 1CAVA 5H9PA 2PHFA 1PK6C 1MVQA 1SG3A 4QX1A 5CKNA 5EP9A 1W6PA 5BUVA 1FXZA 1VMFA 4PF1A 4XIKA 1R093 3BUCA 4K40A 5BNPB 4RD7A 2WT1A 1W9FA 1SPPA 1PX3A 4PDWA 1BJQA 1UF2C 2VW2A 1X7NA 4OI0A 4QPIB 3QLQA 1C3HA 2XWJB 1JZ4A 4CDUB 4LBNA 2RS12 2PTMA 3VZJA 4EQVA 4OYUA 4UFJA 3RGBA 3MIHA 3IAPA 1W8ZA 1GLHA 4XFAA 4MGYE 2UU8A 4MGQA 4BMBA 4OUSA 5FQ0B 3OPTA 4LKSA 2BUKA 5DUVA 4WVMB 2RR13 3M70A 4CP9A 1J1LA 1LOGA 1PVC3 3A22A 1TG7A 5IK5A 3VDDC 1HLCA 1ND3B 2WWSA 3TAYA 4FTSA 1XYNA 5IUQA 2VW1A 2BYVE 2K46A 1OMIA 1XNKA 2O14A 1DYKA 1LU1A 1F5JA 3ZXLA 3BKZA 3VHOA 4AXOA 3AKRA 4KWUA 1PX4A 4DEVA 4FSJA 4AG4A 4LR4A 4XF4A 4HZFA 3I59B 4PCRA 5CADA 2ZEYA 4EWAA 3WDWA 3WZ1A 5LK5A 1RJ8A 1UMHA 5CFCA 1UY1A 1OA4A 1SFPA 5FYHA 1NQDA 2VMCA 4D0QA 3CU7A 3HMYA 3RWKX 2WQZC 2WAAA 1QJY3 3ZYJB 1A3KA 4FOWA 2PN5A 5KR7A
chains in the Genus database with same CATH topology
3R05A 4AQ2A 3AKTA 4P9YA 3RJRA 4Z1VA 1BYHA 1RHI2 2MHFA 2QVSB 2P17A 3M3IA 3OD0A 1U5ZA 3PVEA 4S2FA 1JW6A 5IT6A 1NXMA 4XTPA 5IK4A 5T55A 2OZ6A 1UU6A 3ZFFA 4NHLA 1H1IA 4FT8A 5D8AA 1DBNA 2Q1ZB 3VZLA 4DMIA 1W6MB 2NN8A 1HXS1 3JD72 2Q4SA 2GH8A 3B7MA 5F6LB 3WP6A 3RJ2X 5KXCA 1BVP1 5DZGA 2JG8C 2HWF3 1GSLA 3AKQA 2D6MA 4EWDA 3AZWA 1V9U2 1H9WA 3S6PA 1OPOA 2I2SA 2DURA 1BMV1 1LODA 5C8WA 4FQ4A 1QOSA 1XRUA 4AFDA 3IPVB 1FMD2 2XHKA 3B02A 3WUDA 4I01A 2GC0A 1I6XA 3S7EA 5AC92 3DGTA 4K8FA 1MEC1 1NA1B 2GNTA 1VAMA 1VBA1 5JIUA 4KGQA 3O7OA 4AYUA 3Q9OA 3W59A 1PK6B 2X29A 4P9WA 1AR62 2YHJA 2WNUA 4IEVA 3WP3A 3UL2A 1QKQA 2D98A 2ZGQA 4CEYA 3VBHB 4LUKA 1C8NA 4JRLA 1ZZ6A 3WXPA 3ZDSA 4LA2A 2E9QA 3ZXDA 4IEXA 1FMD3 4IEUA 2WSVA 2XLAA 3WDVA 3RZZA 2AYHA 2ET1A 3DN7A 2XPJA 3T2TA 1O3TA 1DGWX 2VMGA 5GLTA 1AYN1 1D0HA 2CL2A 2XBO1 5CAZA 3USUB 2C0ZA 2CGOA 1ND2C 2UWBA 3UK9A 3FLTA 4ITCA 3VN4A 2ARXA 4YZ1A 2JG8B 2W08A 5FFOC 3T1LA 3ZSMA 5FQ0A 3CF6E 3IDEA 4META 3G7DA 3ILFA 4HBNA 3WDXA 1DZRA 2HWE2 2Y38A 4FP3A 1ZZ7A 2VQAA 1AXZA 1ALYA 2XVGA 5J98B 1UMZA 2WNUB 3W58A 4XBQA 3AMPA 4GMP1 1VRH3 1SDWA 3DUIA 2B7YA 1AR73 1LR5A 4JGYC 1A8MA 5JOXA 1F8VA 1WLDA 4LE4A 1JXNA 1OQEA 5DUUA 4KWJA 3ACLA 4FPHA 1AF9A 3WW3A 1N1TA 1RJ7A 1ND3A 1J3RA 3CEWA 3HQXA 4Q4V2 3MLJA 5K9YA 4SBVA 4PLOA 3R0RA 3JQWA 4JVAA 4B3NA 2RM21 2ATFA 1U5IA 2HWB2 1DGRA 4Q4X1 4I3PA 4AI8A 2A6VA 1QQP3 3SXWA 2XWBB 1VBE2 4YVSA 5J36A 3KT7A 2GH2A 4LA3A 1M4WA 1TME2 5LK7B 4HANA 4JGZB 3ZFEC 2A3XA 4DXZA 1RMU3 2NMOA 3LB9A 4PF5A 1J3PA 2AUYA 1NCQC 5AVPA 2D5HA 1GNZA 2ZMKA 5FAXA 1QDCA 1FOD2 4XQDA 2VVEA 2R042 5BXXA 2PLV2 2P3JA 4GH4B 4D7YA 2EAKA 2HWB3 5FO7B 4L2NA 4WVZA 4Y5Z0 4RHV3 1G9AA 5JCTA 1QQP2 4ORFA 4B4PA 3GHMA 4RQPB 1GZCA 1GICA 1HXS2 1S55A 4DZGA 1WUVA 5EWSA 3RSJA 4ASLA 4J1XA 4H3WA 2XL7A 2ZS6B 4LNVA 4Q4W2 5DG2A 2WLPA 2BTVC 1VBB1 1AHSA 4GULA 2ZMLA 3ZFFC 5KXBA 4BM8A 3AZZA 4AQ6A 1SBDA 1YFYA 2VQ0A 5FPXA 4NHMA 3JBG2 1QJZA 3UJOA 2N7GA 2H6BA 1QMJA 2XVKA 4CEWB 4B4RA 4OHVA 4FPGA 1RVF2 2A6ZA 1URXA 1WCSA 2R043 1H2KA 5L7OC 1HRI3 3NV2A 4LHLA 1WD3A 1RUG3 1LGCA 1C4RA 3D6EA 3H1WA 5JOYA 4H14A 3HIFA 1FPN3 3ZXEA 3ELNA 2YMZA 1S0FA 1XYOA 3QOPA 4QPIC 1UW8A 1HW5A 2UURA 4N9IA 3FBYA 4X8PA 1UIJA 1YCIA 1RUD3 1EAH2 2D43A 2ZHKA 3O0VA 1NOVA 1MQTA 4FPCA 3MDPA 4N53B 1FNZA 4GIQA 1B35C 5GLVA 4M3CA 1BKZA 3ES1A 1VR3A 2VMHA 3VBHC 1PGW2 3WG4A 2F4PA 4K1YA 4CP2A 1YYNA 1AYM1 3O12A 1RUH3 1WW4A 4Q1PA 4QD2A 3LKJA 3GZUC 3WNXA 5J96B 1HQNA 1PVC2 1SFYA 2ARBA 2H0VA 2A3YA 4MGZE 3B5LB 1NCRC 4LLFA 3AM2A 2X53S 4XFBA 1ASJ1 4QXKA 2ERFA 1ULCA 3ZFEB 1CD3G 1CVNA 5BNNC 1IS4A 2Y0IA 2GC1A 2BWCA 5F6KA 3E6DA 1Q43A 1FT9A 4TLFA 4Z2WA 3J26N 3OCPA 4HT1T 1RITA 1LKNA 2E7QA 2HWF1 1KDKA 4ISQA 1JN2P 4Q4Y1 1CR7A 3WINE 4AEKA 4LBQB 5L7OB 1KS5A 3A0NA 2ZHNA 3ZSLA 3LOBA 2GDFA 4QMAA 4EROA 1NLSA 1UZYA 2BVVA 2BFUL 3WR0A 3WDYA 2OIIA 3CJIA 1REDA 1ZA4A 3M3CA 4XJWA 3RYKA 2GMEA 3KCYA 1K5MB 3U0ZA 4YGCA 4YGEA 4FPKA 1KDMA 1OLRA 1R1ZA 5ACA2 1W6OB 1KFXL 3VBSB 3KGZA 3KB5A 2FMDA 4YZ3A 2NLRA 2B39A 3H0OA 3OBTA 3IT8A 2GN3A 2E63A 1EPWA 3BU7A 1QH6A 4GB31 4JGZA 2VVFA 5F5QA 3WW4A 1YJLA 5T5OA 1LOFA 1PZ8A 4E9KA 2EXJA 2VPVA 4N9HA 1LJ7A 4IEOA 2NYYA 5CIRA 1RINA 1MS9A 4AK3A 4Q4W1 1NA1A 2A70A 1BQPA 1OLQA 3PVNA 1ZBE1 3O14A 1DHKB 4MXVA 4AF9A 1OPMA 2ZGNA 4DPNA 1S0JA 2O8QA 4IERA 5I8SA 1TMF3 2DYCA 2B9UA 3ZFEA 4WM8C 4PBPA 4C1WA 4ATFA 4INDA 3CJIB 4FPYA 4L92A 1G7YA 3NO8A 2DFBA 3H9AA 5GJ6A 4C90A 2C1FA 3ATGA 3ILNA 5A32A 1MS5A 4D7TA 2DUOA 3QH7A 5JI9A 1BBT3 1AZDA 1XNCA 1RUE2 3ES4A 3VBUB 4BWOA 1APNA 1R082 3VBRC 2O1QA 4F8AA 1CAUB 2ZACA 4I2OA 1W6QA 2NPIA 5LRSA 1OHFA 1C8M1 1QNWA 4X8NA 4ES9A 4HKOA 1RUF2 4XBNA 2E53A 2OZJA 3NJZA 3OTFA 1UU4A 1CX4A 5AVAA 5A3MA 5JSRA 2R16A 2QJVA 2HWB1 1HKDA 1IPKA 1J58A 1UPSA 1CJPA 1YI7A 4CZSA 3FMGA 1Y7BA 1VBD3 1SQ4A 3VBRA 1OA3A 3E5XA 3ZXGA 1JHNA 1DIWA 2PHLA 1VALA 3ZFGA 3PLQA 1RUI2 2IWGB 4MH0E 1Y3TA 1NCQB 1RUG2 1T6GC 2EF6A 4Q0SA 2JE7A 4BA6A 1Q3EA 1VB4A 1D4M2 2WKKA 4EV0A 1OOPB 1YUDA 1MS4A 1PVC1 4L11A 1AR83 3I8TA 2O8OA 4BH9A 1X82A 4IEYA 1D2QA 4AGRA 1MVEA 1Q8QA 2CWMA 3AZVA 4B7KA 5C9AA 3ZFGC 2LUWA 4UXAA 1CAVB 1WMEA 1NY72 1OOPC 4DS0A 4KQ7A 1PVXA 4NOTA 1GZ9A 4FPLA 4FOYA 1HIXA 4E2GA 4HKLA 2IXCA 2BBVA 4GB32 4JDMA 3TNPB 1J1TA 1OSGA 3RI8A 1KFUL 1ZZ9A 1POV1 3VLBB 3N7JA 1RUH1 5C9AC 1PNGA 3HT2A 4XHXA 5GZFA 4R8HA 1MZ6A 5HCFA 3UKTA 1WCKA 2ETEA 3FHIB 2EXKA 2QE3A 1BCXA 2HWE1 2BVBA 2RHPA 4FVVA 2VOKA 4I09A 2HEYF 1AL23 2FMYA 4Y24A 1DF0A 1ULEA 4RQPA 1RMU2 3PTYA 3O0XA 1XNDA 4Y4YA 1S1AA 2A6WA 5C8CB 2ZMNA 3TNQA 5TSWA 4R52A 5T52A 4YYOA 3WG1A 2RS51 2FZ1A 4YG0A 5T54A 3MZHA 4M0NA 5T50A 1G8WA 3N3HA 1AX1A 2YC0A 3NKTA 1WBFA 4UW6A 4GWNA 3TB0A 3DKWA 4NHKA 4XOGA 1AR61 4Y1VA 4RHV2 1A78A 4YLZA 4MGIE 1IKQA 1GV9A 4XFFA 3AP4A 2GALA 1N3QA 2EA7A 3AP6A 4QGMA 4DY5A 4XQ4A 4TYSA 1SACA 1LOCA 2RMU3 1BVVA 2HWC2 2D6PA 1RUOA 5BNPC 2XLGA 1LENA 4R9BA 5FCCA 2BEOA 4ZU5A 2XVLA 3EO6A 2R062 4XFGA 3V65A 3L2HA 2G9GA 4Q8KA 1RUF1 5BNNA 1LB2A 3J9SA 1WCDJ 3SH3A 2HWC1 5K0UA 3WCSA 4KG8A 4CEWC 4OVEA 1EV11 2WQ4A 1NE4A 3JZVA 1N3PA 2DV9A 3VHNA 4C0HA 4FPFA 2PFWA 5JOZA 2CY6A 4IL7A 5CB7A 3CJXA 1HRV3 2ZA9A 4PDWB 4M00A 1IQAA 3ALQA 4FXGB 2XUMA 4XE9A 5A32B 4AGVA 5DXDA 5LRRA 4S2DA 1H9PA 1Q5OA 4U36A 4LHKA 2YROA 3AYAA 3FLPA 5GZDA 4FOQA 2Z5WA 1LTEA 4AVVA 2ZX4A 1NCRA 3UKNA 1MR5A 5HI0A 2RR12 3EBRA 3JB4C 1GANA 4WVMA 4OULA 3AYCA 1PK6A 3W9AA 4QPIA 2XJQA 2D6KA 2BPA2 1CPMA 3FE5A 1QU0A 4AQTA 3AYDA 1S0EA 2AR6A 3DV8A 1RUC3 5H9QA 1QF3A 3L9JT 1GR3A 1PO23 2MPFA 4TSVA 3WQ1A 1RUH2 2GC3A 2CV6A 5I0TA 1WD4A 2A7AA 2H0BA 4LT5A 4COZA 1GFF2 1IGOA 4FQZA 3FX3A 2G4IA 1VBB2 4I3GA 1YIPA 4XPVA 5I8TA 5I93A 4IESA 5FDBA 1AR63 1SLLA 3THTA 2GU9A 4BLIA 4QX5A 3NV1A 4NN0A 2B42B 3KGLA 4LBOA 1VBD2 3E6BA 1X33A 3J8F1 2A5ZA 1VBC2 2R0FA 2PLV1 3VV1A 4FO9A 1FV2A 2UYBA 1UN1A 4PIXA 3AKPA 1G86A 3AZXA 2JG9B 3SH4A 1LHOA 3RYRA 1KD7A 4F83A 3C3VA 1LHNA 2XJTA 1AYN2 4LUMA 4XF1A 1OFSA 3B9CA 2IFRA 1DGWA 2HWF2 5FREA 2B5HA 1C1FA 1B09A 1IS5A 4IV3B 3LGRA 4LLOA 4QPGB 4HETA 1OD5A 1KJRA 4UBGA 4DOUA 5L36A 2WC2A 2R49A 5D8AB 4KNCA 2JE9A 1QHDA 4Y1YA 3WW2A 1IS3A 4W65A 1LGBA 1UL9A 5KHIA 2BW8A 3SNMA 2I07B 3B3QE 4G3YC 4LE3A 2OYZA 2DVFA 1RIRA 1CQ9A 4LEJA 5C33A 3V0AA 3V64A 3V0BA 3R4UA 4GQ7A 2ZABA 3THPA 4XFHA 3RI9A 3KLSA 3UJQA 1AR72 1PGW1 4XBLA 4RS5B 1ND2B 1U0AA 2XBO3 3KD4A 5AC91 3RQ0A 4XZPA 2I74A 1MACA 1CAWB 5CNAA 3GALA 4ZKTB 1W0OA 2ZZJA 1HV1A 4LULA 3RWNA 3WG3A 2WLQA 2FQPA 5A33A 2D6NA 4U2AA 4B8EA 3VUOA 4LBQA 1TMF2 4XYXA 4DNYA 4IEQA 3PVBB 4XIOA 5I8YA 1ONAA 3O0WA 2PHRA 3H1MA 1AL21 4XXPA 5AFEA 4CEYB 4I30A 4Y22A 1VBA3 1ZBE2 3FUOA 1MEC3 2R072 3BPZA 1FAYA 1R083 3SH5A 2BNMA 4UBHA 1O5UA 2LM3A 3BOPA 4OHWA 4URTA 1W6OA 2HWC3 1TE1B 1TME3 1RUF3 1K5MC 2XBO2 1PGL1 1ENQA 1U5XA 5F9TA 2RJLA 1UPIA 2WNEA 2ZPXA 3VBOB 1OKQA 4RFT0 3ZN5A 2VU9A 2BNOA 1LOFC 3GZTB 3ZFGB 3PJQA 3FFQA 1FATA 1A6CA 4AI0A 1V6KA 5CFCB 1VP6A 4JTOA 4QT6A 4AI1A 4XJ8A 3AP7A 3WG2A 2A3WA 5CFDA 3DPRC 4AI2A 4B7EA 3APBA 4EN9B 5C4WA 4MX3A 4Q2FA 1PO12 1Z7S1 4IXLA 1PO11 1QJX3 3X29B 3VZMA 4CRQA 2HEVF 1O4ZA 3SCFA 3VZKA 4FP2A 1QJY1 3URFA 2JKBA 1Q8VA 1AX0A 3B01A 2XJPA 3J8F2 2A75A 3ME2A 2X5IC 1RC6A 1VBD1 3OY8B 5KHGA 1QNYA 4AEDA 2ZGRA 2YPJA 3C2UA 2JG9A 5C4WC 1RUC2 3KT1A 4RR3C 1VLNA 3QH6A 3IDCB 3SCHA 1G6NA 4PIZA 3OGGA 1RTVA 4M3CB 2RS52 2XL9A 2VECA 2XKOA 3AMQA 4AVAA 2OVUA 2Y26A 3VBUA 1QJX2 3SISA 1D0GA 1BEV1 4RS5C 4NPRA 4E4ZA 1SLCA 2DVBA 4BZ4A 1ZBA2 1NLRA 2WS92 1WBLA 1BK1A 5BPXA 1QOTA 2ZX1A 4Q1RA 3MIDA 4FXKB 4COWA 3IMNA 1WGPA 2ENRA 4YW1A 4AGGA 3TOJA 1R091 1JTZX 3MPBA 4WVVA 4XMIA 1CONA 1JBCA 1OOPA 1AYN3 2UWCA 4D3WA 1S0BA 2HWD3 3VBOC 2O0OA 5ACA1 5DG1A 3AFGA 2RS53 1CAWA 3JBG3 3E5UA 3KSCA 1RB8G 5E1RA 4AVTA 3KCCA 2DFCA 4F3JA 1HQWA 4M3CF 1ZZ8A 2P2KA 3H50A 2I45A 5GLUA 3MIFA 1COV3 4YW5A 3JUUA 3EJKA 2JENA 4LO8A 4P9JA 2HWE3 2WFF3 4GB33 2WNVB 5EZWA 3I59A 1JYIA 4AVBA 3VKOA 3JBG1 2AZ5A 3BALA 4Q4Y2 4XHBA 4H55A 1S0DA 2NP0A 3J4UH 1DG6A 5KC5A 2ZGPA 4Q26A 1H30A 1LECA 1ZM1A 4N43A 4OHZA 1W6MA 1RUD1 1V70A 1RUD2 1VAVA 4EWEA 2XJRA 1XE8A 2ZGSA 1IPJA 4JC1A 3T1MA 5FMOS 1TEIA 5T3NA 2EXHA 3H3ZA 4C1XA 4UW4A 4DY3A 2XJSA 1QJY2 4JDNA 1S2BA 1DU3D 4Q0QA 1HRI1 4UW3A 4W6XA 1COV2 4N90A 3ZXKA 2E6VA 2NMNA 2UWAA 1SMVA 4XF9A 3TYJA 1V6MA 1R1A2 1LRHA 3LA3A 3VL9A 3WCRA 1MQTB 2MEV3 4DRVA 1VBA2 1ZBE3 3E5QA 4FTEA 4FAHA 4XQWA 4QGNA 5BYNA 3BTAA 4IEPA 3DL3A 3ZYGA 2VH9A 5C8CA 1N47A 2HJIA 1S0GA 4IEWA 5DZFA 3ECQA 1IZ3A 1C5HA 3VBFC 3AXEA 4WV8A 4HSJA 1GNHA 2Z42A 5EXOA 2OW4A 3WV6A 1NE6A 1QGLA 1V6JA 3FC0A 4YZ4A 5L73A 2R1DA 2PAEA 2HYKA 2ZGUA 4R9CA 4QM8A 4N43B 4GH4C 3QBQA 4C91A 1UKGA 4YW3A 2X5IB 4BYYA 1H4GA 1CAXB 3VDDB 2QNKA 2R071 3VBFB 3JU9A 4CDUA 1HRV2 3NSTA 4AHWA 1TNRA 4LTAA 3D82A 1BBT2 4AHXA 4BE3A 2TBVA 1D4M1 1B35A 4LBLA 4E27A 4P9IA 4R9AA 1ZRFA 4QHBA 3DPRB 1J3QA 1RUC1 3HAGA 4MVTA 1L3JA 1RUG1 5FLHA 2WL1A 1ZREA 4BLJA 3GF6A 2XH6A 1W6NA 2BGCA 4AEMA 3WQ7A 3ZXAC 1C28A 5KXDA 1O3QA 4F7ZA 2QQPA 4P9XA 1QQP1 1G9FA 5BV6A 5CA6A 1Q56A 3AFKA 3LSEA 4H7LA 2BQPA 2VW0A 1WLCA 3PNAA 4CDWA 4YFZA 3D0SA 2B45X 1RVF3 1XU2A 2BNNA 1ASJ3 1RHI3 3ZMOA 1ZVFA 4ASMB 4I02A 2R061 2ZAHA 2DF7A 5H9RA 1YJKA 1PIV2 1MS0A 1H8VA 1HRI2 2OA2A 1O3SA 1WW7A 1NQJA 2A71A 2ZCWA 2PHXA 4J6GA 4CP0A 4JRAA 1VBB3 2C5DA 2PAMA 4JCKA 3ZMNA 1PZ9A 2WZR3 3WLUA 4AFMA 2ZJCA 4Z82A 4EN6B 1R081 4N7IA 5JZGC 1Y9QA 3U07A 5JOWA 1EAH3 4K3UA 5JZGB 2KXLA 4QQHA 4FPEA 4YW2A 5C9AB 4GWMA 3WY6A 1AVBA 3IKWA 4GMP3 5JWPA 1SEFA 1H4HA 1ZZCA 4PIYA 3A4UA 3TWIA 1YWKA 4Q0UA 2W68A 3R6SA 1EYBA 2B46X 4IV1C 4YNIA 1CESA 1FNYA 2AGSA 1C1LA 5FLIA 3D5OA 4Y1UA 4A2UA 1RMU1 3B93A 2XB6C 5J48A 4WM8B 5JSOA 4WM7B 5DUWA 1VBC1 3VZNA 5SV5A 4J1WA 1MEC2 3AZYA 2D6OX 3GBFA 1QXJA 4Q8LA 2RJKA 2R0HA 4XTMA 1E57A 2TNFA 4RL7A 3SITA 2P37A 5LEKA 1O7FA 2WFF2 4B4QA 2Q8OA 1RUJ2 1AR93 3DF0A 1V9U1 2PHTA 2QKDA 1MS1A 3LCPA 3VHPA 2CWSA 3NAPB 2RM23 1LCLA 4NWWA 5C4WB 4XJZA 1MS3A 3SCGA 5KHJA 3IWZA 4L9BA 4QGLA 3JB8A 3KZ4C 4K20A 3IPVA 5GLZA 5GZCA 1SLTA 4Y1ZA 3ZYIB 4KG0A 1DYPA 4I0AA 2ZX3A 1DQ2A 1MS8A 1YI9A 1POV0 1D4VB 3FLRA 5GLWA 5JPNB 3MLLA 2XGXA 2DU1A 4PBOA 1X50A 2RS31 3IDBB 4IEZA 3ST7A 1POV3 4JAAA 4QM9A 1V6NA 4BIOA 2FBEA 1PM7A 1EP0A 2D44A 2K2SA 5EFUA 4FPJA 1QJU3 1SLBA 2Q30A 1GZWA 3EQEA 4KGGA 1U5YA 4JV4A 2CGPA 5DZEA 4RS5A 1AR91 4JGYA 1R1A3 1ND2A 2PLV3 2VVDA 1LOBA 4WM7A 1VB2A 5K0UC 3J8F3 3VBUC 3OY8A 4C0BA 3B9IA 4TZDA 2JICA 4A7KA 1WMFA 2PHWA 4HN0A 5FLJA 1GQHA 3E97A 2IXJA 1OQDA 3HT1A 1DQ6A 4LBMA 3IM0A 4KU7A 2JEMA 5SV8A 3M3EA 4AEDC 1JYCA 1WA4A 1W6NB 2D40A 4Q4V3 5ABJB 2YGLA 4ES8A 3HD8B 4AEJA 1NCRB 3MW3A 1CIWA 4ZU7A 2ES3A 2YDEA 4AWDA 2UYAA 5HXVA 4MYEA 4N7UA 4ZXKA 2FZ2A 4Q27A 3HR9A 2W52A 3RPQA 2AH2A 2HKXA 4LHNA 4O9GA 5K8SA 4KWKA 1Z7S2 2WNVC 4XXAA 1RGSA 3S7IA 4L97A 5GZEA 2V73A 1EV13 1QXRA 4DRRA 4MZUA 3VGIA 3ILRA 3POYA 4CDWB 3LSDA 3MPPG 4NWVA 1HRV1 3LOIA 5T5PA 4HK9A 3I2DA 2XJVA 2XLFA 2DTYA 4AI3A 1Z78A 3WQ0A 4DQAA 2R063 3RMYA 5IK7A 2GNBA 2W39A 5LEJA 2VOWA 1REFA 5BNOC 2OPKA 3MEPA 4AE2A 1W6PB 4AEDB 2RR11 3RS6A 3GNEA 1AX2A 1FOD3 5E88A 3ZO0B 2V5YA 4V1PA 5AC93 1OQ1A 1XYPA 2ZKNA 1D2SA 1TMF1 5KBFA 2IXLA 4KBBA 1KS4A 1VBC3 1S0IA 5ABJA 1KXGA 3USUA 1C57A 2GN7A 3OYWA 4FTBA 5HBAA 1CAUA 1D4M3 2YZ4A 3FJSA 1DQ1A 4DINB 3VKFC 4Q4W3 5K0UB 5BNPA 4YW4A 3PJYA 1GQGA 1ZBA3 3AP9A 4NO4A 4OLLA 1KITA 2CAUA 1YFUA 5D8AC 4AW7A 1RUJ1 2WA4A 3MIEA 1UAIA 1DQ4A 1GBGA 4MSVA 5FBZA 5GALA 3WP4A 4XJ9A 3JQXA 2JG9C 3ZN6A 1UIKA 3M7AA 4D7SA 4W6YA 1QH7A 2JG8A 5JDBA 1X8EA 2PA7A 5BNQA 2R32A 2ZZQA 1VIWB 1RL3A 3BIWE 4K21A 3IIAA 3ZIXA 1YIFA 4COUA 3S0MA 1AR71 2ZOEB 2D6LX 3AX4A 4Z92B 4HKWA 3WVJA 2RS11 4BIFA 1WLTA 3BOWA 1VBE1 5J3UA 5JIAA 1HX6A 5ACA3 1WLWA 2ZX0A 4AFBA 4YARA 2ZX2A 1ZX5A 1CGPA 1G9CA 1JUIA 1F31A 2VGDA 4QQLA 3KM5A 2ILMA 4Y22B 1YHFA 4IETA 1JUHA 2ZGMA 3AKSA 2AREA 1ULGA 4LO4B 1QXPA 4HPKB 2QDRA 1JH5A 3AB0A 3ZN4A 3L2YA 3R4SA 1KQRA 2D3RA 2R1BA 3AMHA 3A0KA 5CU1A 1GZWB 4HSLA 5HCBA 4XDQA 2YGMA 3EHKA 1LHVA 2CGNA 4PQ9A 1PO21 2QZ3A 5L19A 3OPZA 2FHRA 4FBFA 1C5IA 5CBLA 2CTVA 4MUVA 2D97A 3UV9A 2DTWA 4B29A 2RS13 2P34A 1XQNA 3H7JA 2R073 4Z07A 5CG8A 4KU8A 2LALA 3OGJA 1DGRN 4BPZA 2ZHLA 2NZ9A 3M8LA 5F1RA 4GMP0 1AXYA 2QCSB 2VNRA 3AJYA 4MXWB 4P14A 1AJKA 4DFSA 4A7ZA 4HVQA 3HN1A 2RE9A 4CEYC 1FYUA 3H8UA 1RUE3 4BHPA 1BEV2 4D94A 2VUAA 3N7KA 4RGGA 1SFNA 1IHMA 1ZRRA 1Q8SA 4R9DA 4K1ZA 1DQ5A 4LBKA 1ZZBA 4QPGA 5JR7B 3G6JB 4GXLA 3VBRB 4AVSA 3NAPC 1RHI1 1QWRA 4KH9A 3P3NA 4K9SA 4Q0PA 3E6CC 1Q8PA 1FX5A 2VXRA 4JGZC 3RG0A 3MYXA 5A33B 5CFCC 3PMSA 4XILA 2GAUA 2GMPA 4Y1XA 3GHNA 3ROUA 2VOXA 3PMEA 5EV7A 4MV2A 4HLTA 3VBHA 5CFDC 1F2NA 2X5IA 4FCAA 2GZWA 1CAXA 3VDDA 1RUI3 5FO9B 1DZTA 1K5MA 2OUJA 4YVWB 5FO8B 5CVRA 3ZIWA 4GKYA 1BEV3 3MW2A 3ZPYA 3ENRA 3UKVA 3POWA 3NL1A 1YFWA 5C8CC 3LA2A 3VHRA 3NV3A 1H2LA 1PO22 3OJBA 4MXWA 4HMZA 3MFCA 1ULDA 2Z2SB 1IKPA 4WM8A 3USSA 3P3PA 1JOJA 3KT4A 3GYDA 1YXWA 3QACA 3PHMA 1MZEA 4CDXC 3FFZA 4XETA 4YZ5A 3VKMA 3NVCA 4RHV1 2A6YA 1PHMA 4HK8A 3JCIA 1BMV2 1COV1 5FMOL 1ASJ2 1NA1C 3MIBA 1N1SA 3LAGA 3I54A 2JECA 1M06G 4YM0A 2GNDA 2ZGLA 5I91A 5GKAC 1PGL2 4OI2A 3M2MA 4Y26A 4QQ2A 2RM22 2NQYA 2CYFA 5DDJ3 1V6OA 2HWD1 1PO13 1KJLA 2RS32 2VULA 3NW4A 3NV4A 2VOVA 3KCXA 1WW6A 2Y0OA 3QD6A 5FOJB 2C9AA 2MNGA 5FRAA 4OI1A