4QX7A

Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
total genus 105
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qx7A01
5FXVA 3AVSA 4D6QA 5ANQA 5F5AA 3ZPOA 2PXJA 4QXHA 5A7PA 2OX0A 3N9NA 4GD4A 5FP3A 1VRBA 4CCMA 4URAA 5A7WA 5FZCA 5F39A 3K3OA 5FV3A 5K4LA 5FY9A 4CCLA 5FYBA 4D6SA 3KV5A 5FZIA 2Q8CA 5LWBA 4GJZA 5FZFA 5IVJA 5E6HA 4V2VA 5F3GA 5FUPA 2GP3A 4E4HA 4CCKA 4QXBA 5F32A 4HONA 5A7WB 5FUNA 2XDVA 3PDQA 5FPAA 4DO0A 4QX7A 5FZHA 3ZLIA 5FZ1A 5FZMA 3N9MA 4NUBA 5FYSA 5ISLA 4XDPA 3UYJA 4CSWA 5FXZA 3NJYA 5IVFA 5FZDA 4LIUA 5A3NA 5FZAA 2WWJA 3KVAA 5FYIA 5A7OA 3U78A 5FYHA 5IVCA 3AL6A 4BXFA 4TN7A 5KR7A 5FZGA 5FJKA 3KVBA 5FZ8A 4EYUA 4QX8A 3N9PA 5FZLA 5FP9A 5FZEA 5FZBA 3DXUA 4BU2A 5A1LA 2XUEA 4DIQA 3AVRA 5A3TA 5FY8A 4AI9A 2OQ7A 2XXZA 3PTRB 3PU3A 4C8DA 2YU2A 5FY1A 5FPUA 2Q8DA 5FXXA 3AL5A 5IVEA 3PUAA 3OPTA 2W2IA 4QWNA 4XDOA 5FWEA 4AAPA 5IVBA 4LXLA 5F5IA 4GAZA 5FZOB 2OT7A 4UF0B 5FWJA 5A7NA 2OQ6A 5F3IA 4HOOA 2Q8EA 4EZHA 5FJHA 3KV4A 4Y33A 5FYVA 5FZKA 2YPDA 5FYMA 5FZ3A 5A7SA 5LW9A 5FZOA 3DXTA 5FYTA 4Y3OA 5FP8A 4UF0A 5A3PA 2WWUA 5FZ9A 2YBSA 4EZ4A 5FY0A 2GP5A 5IW0A 3N9OA 5FXWA 5LY2A 5FZ0A 5F3EA 3KV6A 5FYYA 3K2OA 4IGOA 4IGPA 5FPVA 3LD8A 5FYCA 4CCNA 5F37A 4BISA 5FZ4A 5FPBA 4CUGA 2OS2A 5FP4A 3OPWA 3K3NA 4GJYA 5FY7A 5IWFA 5A80A 4CCJA 2VD7A 5FBJA 4ASKA 2YBPA 5FY4A 5IVVA 5FZ7A 4IGQA 5A7QA 5LY1A 4LITA 5FY5A 3PUQA 5F5CA 5CEHA 5A3WA 5A1FA 3PU8A 5FPLA 3N9LA 5IVYA 3U4SA 4CCOA 5FYZA 4QXCA 3RVHA 5FYUA 2XMLA 5F2SA 3N9QA 4QU1A 2YBKA 5FZ6A 4D6RA 2P5BA 3LDBA 3PURA 5F2WA 3PUSA 4V2WA 5FP7A 2YU1A 4LIVA 4Y4RA 5F3CA 3KV9A
chains in the Genus database with same CATH superfamily
3VLBB 5A33B 2WO7A 1AJOA 1AX1A 1S55A 1FMD2 3OY8A 4CUCA 4LORA 4QX0A 1PO11 3POFA 1EAH3 3KT4A 4YW2A 4OQ9A 4MO3M 4PQ9A 1GZCA 3PUIA 5LB6A 4CDXC 4XF1A 3ZN5A 4Z92B 3H7YA 1B35B 2ENRA 2ZEXA 4V2VA 1E5SA 1RB8G 2OIIA 1LEDA 1WLTA 4E4SA 2QQIA 1WD3A 2HYXA 4HONA 2W87A 4KWKA 4C0HA 2WZ8A 4L8QA 4NUBA 5KHIA 3INAA 5F6LB 2JG8B 2J42A 1APNA 4D69A 1OH3A 3AP7A 4A3XA 1Q3EA 5BYNA 1XXNA 2IFWA 3W21A 1RHI3 3GXUA 4Q8LA 1TG7A 4QKFA 1IQDC 1REEA 1W04A 1SZBA 2A3YA 2VBPA 3C8XA 4HL0A 2GC3A 1YI9A 4PQQA 4Q1PA 5FFOC 3ES1A 5FYHA 3WSOA 4YGCA 1BCXA 2IXCA 1V9U1 1FOD2 3E97A 3AKTA 5IVCA 1MS3A 1ST8A 3WHUA 2WKKA 2D6MA 4B29A 1JTZX 1YQ8A 1IOAA 3NRUA 1GP5A 1VLNA 4AHWA 4DPNA 2FZ2A 3JU9A 4DRRA 3IAPA 2QBXA 5FO9B 3B02A 4Q5OA 3SITA 1RXFA 2BOIA 4UFKA 2X29A 1GR3A 2R073 3E1F1 1GLHA 1PHMA 1F35A 1XE0A 1AUYA 1YQ5A 3WF3A 2JG9A 3AFGA 3AYAA 3H9AA 5KWRA 4JHZA 4LBKA 5T5LA 5FZOB 1RHI1 2JX9A 4QGLA 4GWMA 1DGLA 3VZMA 4Q27A 3LZZA 4N43A 1PMIA 2WR9A 2ZEZA 4MX3A 1H6YA 3WD5A 2Q8EA 4XBLA 3SKVA 3ILNA 1MS8A 1HX6A 3ACIA 5LEJA 2PHXA 3HPNA 1CJPA 4UW6A 1RUC3 2AENA 4UAPA 2GDFA 3VDDC 4IE0A 2XJSA 2PHRA 5T54A 1OOPA 1J83A 3G7DA 2FCUA 3POJA 1MQTC 1A3KA 4L97A 3LE0A 4XTPA 3TYJA 5K7PA 4RFRB 1V9U2 3VDDB 4A2UA 1YIFA 4UFJA 4AFMA 1KQRA 5FPVA 3THTA 1DHKB 4CDUA 5JI9A 1GOHA 1PK6B 1AL22 4LULA 3UK9A 2R16A 4EWDA 3HN1A 4HXCA 3J4UH 3CL1A 1VRH1 2A3WA 4TLGA 1VBD2 4XF0A 4CU7A 3I8TA 4PDWA 4FPLA 4CDQC 1MZFA 3WW4A 3QH7A 4DY5A 5FQ0A 4EN9B 2F17A 4IGQA 1PZ8A 4NMIA 3ACGA 2JE8A 4RGAA 4GWIA 4YVSC 1HRV1 3UL2A 3ZX7A 2UY9A 1DP0A 3NV1A 1UPIA 1UOJA 5ABJB 2QQKA 2YHJA 3ZIXA 3WNXA 4CDQB 2QQJA 2JD9A 2E32A 1MQTA 3BB6A 5I8TA 3S0MA 5JOXA 4NWWA 4GH4C 2MEV2 5FREA 3EJKA 4OMCA 2OYZA 2QCSB 1WMDA 4AEDA 4AQTA 1WW5A 5FUIA 1C8M2 3K46A 3Q9OA 2CYFA 3O5SA 1ZREA 1OVPA 4LTAA 4LIVA 4HKWA 2A6ZA 1CAVB 4OULA 5JCTA 3ZSMA 2JDPA 1LJ7A 2Q8OA 1NCQA 1E5HA 1SDWA 1ZZCA 2EIDA 2ZMKA 3VHNA 4BB3A 2PN5A 3IPVA 4FPOB 4Y20A 5LRSA 1RUF2 1LECA 1U5IA 1W8UA 2A1XA 3MPBA 4OZXA 3LA3A 3T2QA 1BKZA 3KV5A 4B1LA 1VBD1 2BP6A 2F4LA 5E6HA 3WQ1A 2GAUA 4Y5SA 5AVPA 3IMNA 3MLLA 1O5UA 3DUIA 1C4RA 4WBBA 5HXVA 3B93A 4C90A 2ORXA 4EWAA 3VDBA 3PDQA 3WOGA 5FPAA 4D8MA 1ZBE1 2GALA 1ACCA 1ZM1A 3UGGA 4FPHA 1W6OB 2ZHLA 1NQDA 4GMP3 3AMPA 2DVDA 1BK1A 3FZ3A 2VUAA 3A0NA 1XPWA 1W6NA 3VZOA 2RV9A 3KD4A 3U78A 3DYOA 4XUNA 3NVCA 2D6KA 4AAXA 5CB7A 2WZR1 4I2OA 5FZGA 2VZRA 2RVAA 4AR2A 4A44A 4A41A 2IXKA 1SMVA 2C9AA 2HWB1 2RS13 2YMZA 2Y0IA 1S1AA 1NLQA 4M0NA 4QPGB 2ZEWA 3HBKA 4AFAA 1V6JA 3U1XA 3CJIA 2QZ3A 4PIZA 4OHYA 2ZX4A 1ZBE3 2XLAA 2C9KA 1ND2B 3OBAA 2Q1MA 1H9WA 3VKFC 1LHOA 4AAPA 4FTEA 4GMP1 1YCIA 3AMNA 4LXLA 1RUI2 2VVDA 5LCWL 2B46X 3U4XA 4A7YA 2Z69A 2PHUA 5GZDA 3ZMNA 3ZFFA 1OVSA 3KMHA 5C8CA 2AC1A 3A0KA 1TVGA 4F83A 2YPDA 3PJYA 2BVBA 2JDMA 1RTVA 5FYTA 1W0OA 3VBUA 3IDCB 4U36A 1E5IA 2E63A 2VZUA 4XFHA 4XJ9A 1UKGA 3USUB 2H6CA 1WCDJ 2E51A 2VCMA 2HWB3 2RS11 1PVC1 1EYBA 1FMD3 2GMEA 2VUCA 2KM2A 3I2GA 5GM0A 4LK7A 3AXEA 4FPCA 5F37A 3LB9A 2DVBA 1UU4A 3FBMA 3ZN6B 3IMMA 4NIGA 2GNMA 3O1PA 1G9FA 3H3LA 2YGLA 1TQ5A 3AKRA 2VMCA 4NRPA 4IEYA 2QQLA 1YFUA 3IWZA 3LEMA 1MZ5A 3F2ZA 2FQPA 1EUUA 1QOSA 2RR11 3HJRA 3VBUC 4DUVA 3EXUA 2LW8A 3O1OA 1RUI1 1S0BA 4DY3A 5FPXA 1UF2C 2ETEA 1WCSA 3FHQA 4LA3A 3SLIA 4Y1ZA 1U5ZA 3N9QA 2FMYA 4BM8A 4Y1VA 4XABA 4XUPA 4COZA 4D7YA 1QQP2 5JWPA 1FPN3 1JZ4A 2YBKA 5T5JA 3IBMA 1RC6A 5LBCA 2C24A 1AR81 3VZKA 4CPBA 2YU1A 3CO2A 1PX4A 3AMHA 2G1MA 5BNOB 5GLTA 3I4IA 5DG1A 3ZXEA 2HWB2 4ONUA 5F5AA 1CIYA 1DIWA 1WMEA 2ZHKA 5CFCB 5IFPA 2ZCWA 1LGBA 4LHKA 5K8SA 4QQPA 1G9CA 5DUWA 1L3JA 1WA6X 3IN9A 4N53C 5KHHA 1XSRA 2ERFA 2J22A 4CEWB 4RFT0 4E2QA 4URAA 1N1VA 4I3GA 1HQLA 4D6SA 3I49A 3DPRB 4JAAA 5DMYA 1GYKA 5IVJA 4IUGA 2RR13 3JD73 2LS6A 3M3IA 4N90A 3T0DA 1OF3A 1PIV1 2FDJA 3IPVB 4LHSA 2YXSA 5A3TA 2ADDA 5L73A 2OW4A 2ZKLA 4FO9A 4J25A 5JVVA 4M3CB 4XIKA 5AFBA 5J09A 5HCAA 1BEV1 2B39A 3AZYA 1W9WA 4LQRA 2RMU2 4GB33 4LIUA 2EXHA 1TMF3 1OFNA 2Z5WA 3DEMA 1POV0 1LOAA 1JOPA 1HB1A 1VAMA 1X33A 2WYSA 3WINE 4QQOA 1OURA 3AYEA 1GNZA 1JZ2A 3MIEA 3T09A 4AGRA 5KR7A 5A3OA 1JU3A 4Z07A 3ZFEC 4XJZA 1OD5A 1MS5A 4LBLA 5LK5A 3WDWA 3ES4A 2BNOA 1TE1B 1WA4A 5FBZA 2A71A 3BPSA 1F5JA 4XHXA 3ZSJA 4UWDA 1I1EA 2VBBA 3OD0A 1H2LA 4RR3A 3H1MA 2W2IA 5FK7A 5J7MA 4Q4Y3 1OLRA 4LLOA 4XCBA 2JDNA 4HN1A 2WAOA 4IETA 4A6SA 1HB4A 2BTVC 3FWEA 1NY72 2CAVA 1OSGA 3UESA 1K42A 3AKSA 2Y6JA 1GFF2 1LHWA 3ZYPA 4S2HA 4P9JA 4Q4X1 2XVGA 1OBNA 3LPFA 2WA3A 2FCVA 2BDRA 2RS31 3NNJA 4K8RB 5K0UC 4YG0A 3C7OA 1QJX1 5KXBA 3KCCA 3KM5A 5DAPA 3MLJA 1S4CA 1LTEA 3ZXAC 3A4UA 1RJ8A 4Q4W2 3K48A 4AFCA 1QNWA 4YFZA 3D8CA 2KR2A 2YC2A 1HRV2 2H0BA 2LTNA 5JR7B 4AGGA 3KB5A 1U12A 4OFGA 3SCFA 4AEMA 2JENA 2A6XA 1RUJ3 1SLCA 2CY6A 1ZRCA 1JBCA 3K3NA 1BZWA 4JGZA 1D4VB 2CU5A 3U07A 1GQGA 1ZZ9A 2RJKA 5A7QA 4FOQA 5EJZB 4MXWA 2VOKA 1IZ3A 3ZN6A 2B4KA 1S0CA 1S0DA 4PT6A 3T4HB 1NQJA 2EALA 2VNRA 5A1FA 1O3TA 2AEYA 3TAYA 5LA0A 5IK7A 2OVUA 1CZVA 4QM9A 1I5PA 5C9AC 4LBOA 3RMYA 3FMGA 1FYUA 1VRH2 3GM8A 4NPLA 1AYM3 3MIBA 4BMEA 2GU9A 2A7AA 2ZX3A 1F4HA 4CA9A 4OMDA 1Z7S3 4E9KA 5C3OA 1LRHA 1NXD1 1OPMA 1BMV2 4X8PA 3TB0A 1UY4A 5I8YA 3C7HA 3OEAA 4W65A 5GALA 5JAXA 3ZDVA 3VZNA 5JZGC 1RUD2 4KNCA 1K5MA 5FXVA 3ZIWA 4Q4W1 1O91A 2BGPA 3WT3A 2RM21 1GKBA 1HRI2 4A4AA 3TEXA 2OX0A 4HN0A 1POQA 3UGFA 4OI2A 5A7WA 2BYVE 2VCAA 3I7DA 1W03A 3U11A 3AJZA 3ZXGA 4PLMA 4LKSA 3V0BB 1NLSA 1MS4A 1O3RA 1PGW1 3RPQA 5IT6A 2W1WA 1DZTA 1UQXA 2X5IC 4CEWA 1QEXA 3T3YA 1OQDA 3IIIA 4MXVA 4IE7A 3FJSA 3NAPA 4AQ6A 3PMSA 1Q8OA 2ATFA 2YDEA 3R4DB 4DQAA 4Z2AA 4XFAA 3CJXA 2PHTA 4IDZA 2QUOA 4HKLA 3V56A 3BTYA 1WW6A 2VZOA 4G4FA 5A7OA 3ETPA 2ID4A 4Q0SA 2TNFA 4QGNA 1DBNA 1RUC1 5GZCA 2G9ZA 3LEIA 4B7KA 5LEKA 2QQNA 4N9IA 3GDBA 1V70A 3S7EA 4Q8KA 2O8QA 3VBFC 4AQ2A 1ULEA 3RYPA 1W2TA 3O14A 4QQ2A 4IL7A 2CAUA 1RUE3 3ZFGB 1XNKA 2ZMNA 1CPMA 2I74A 1BBT2 3HT2A 3OUJA 4AHYA 3HR9A 5DDJ2 3A23A 1W28A 2QVSB 2ZPXA 1HRV3 2OPWA 3LFMA 3ILFA 4GWNA 4OUMA 4WZFA 3LKJA 3OGGA 2ZGMA 2DVAA 3B7MA 2R072 3N7MA 3UV9A 2E26A 1FNZA 3AMMA 1DGWA 3BUCA 1OLQA 2FDHA 1UU5A 3FFQA 3QH6A 2BGCA 3A21A 4AVBA 1S0GA 4HK9A 2AACA 5CBLA 1ENQA 2WFPA 1QJY3 3F95A 3WQ7A 4ZU7A 3WLUA 1SACA 2JB8A 3D4KA 3E5XA 4PBPA 4OI1A 4CDWA 1R082 2WFF2 4JGYA 2XQXA 4KBZA 2EXKA 1FAYA 1GQPA 1QKQA 5F3EA 5FYYA 1JHJA 1LB2A 1AF9A 1D2SA 3W59A 1SLBA 3RZHA 2JE9A 1HXS2 1OA2A 1H8VA 4LO8A 2GC0A 1KJLA 4QPWA 5BXXA 5ACA2 3DF0A 4XQDA 5C5UA 4R4XA 1JYXA 1Y9MA 3RJRA 2A70A 1BVP1 1PNFA 4LK6A 4FAHA 3OPZA 5DZGA 1K3IA 1QJU2 1RITA 2VZQA 1GUIA 3B69A 2ZGLA 3PUQA 2JICA 4JQRA 5A32B 4DUXA 1SCSA 1S0JA 2ET1A 2KD7A 2XBO3 3KQ4B 4HSJA 4JTOA 4H55A 3OUHA 2KXLA 3ZN4A 2EA7A 4XTMA 5DUVA 1S0EA 3MYXA 5AC92 1XRUA 2RS52 3HT1A 4ITCA 4HANA 3DECA 2XVLA 1QJY1 4NJ4A 1OT5A 1AR61 3UJQA 4QMAA 5C3QA 1CESA 1ENSA 1NCQB 1YUDA 4J1XA 3S7IA 2I45A 3IB3A 5BV6A 4CDXA 2DUQA 2AUYA 5F2WA 5I8SA 4WV8A 2CWSA 3OD4A 2CWMA 4Y22B 4LOTA 2R061 1P8JA 3M7AA 3U37A 1VRH3 4M0HA 5APAA 4XFFA 5IATA 5SV5A 2QQUA 3WNMA 1UW8A 2JG8C 4XBQA 5FZCA 5K4LA 1STMA 1K5MB 1AR82 1RMU3 3E6DA 3X29B 1C1LA 4Q4Y2 2HWC3 3K77A 2RJ2A 4D7TA 1D4M3 5K0UB 3MDPA 2XUMA 4JC1A 1Q8QA 1J1TA 1EUTA 2ZGTA 4FP2A 5D21A 5A7WB 1OLME 4XC9A 3NV4A 4FPKA 5GLZA 4AG4A 3WF0A 4YW7A 5EYXA 2HWE3 5BNNB 1QF3A 2UURA 2C5DA 1JYWA 1S0FA 1PZ7A 2VNVA 1QMJA 1LGCA 2Y6FA 2YC4A 1EY2A 2J1RA 2P3IA 4UFHA 3I97A 1PVXA 3IDAA 3JBG3 4QPGA 4XYXA 4BXSV 3HVDA 3C7GA 4TN7A 1G9BA 3VBSA 1UZYA 3FHIB 1TMF2 2ZZQA 4Y4YA 5FZEA 5FZBA 2PAEA 1AX0A 4QHOA 3JXSA 3D5OA 4BU2A 4Q0QA 5ACA1 2Y26A 1FMD1 1VB4A 2ET7A 4FPEA 2P37A 2XXZA 4C8DA 1DLLA 1QJU1 3WY6A 4DUWA 3GZUC 2EAKA 5FXXA 5C8CB 4BQWA 4JDNA 5IVEA 1MACA 4XDOA 4COYA 2YROA 4MH0E 2IWGB 3ELNA 2JIGA 3CEWA 4YG6A 2VH9A 3H7JA 4PCRA 4ZZ8A 5FWJA 4PHZA 4OI4A 1LOBA 4ZKTB 3H8XA 3RZJA 2YY1A 1PMJX 2ZZJA 5DAQA 4QX2A 4TYSA 1LEMA 2RDQA 3AKQA 3MW3A 5CZKA 5FYMA 3ZXLA 4B8EA 4YARA 1C8M1 1HQNA 1A8DA 2VMHA 4I0WB 3WF2A 1JZ8A 4XJWA 4BOWA 3URFA 3N9OA 2WNEA 4OHVA 2NMOA 3H0OA 3Q8CA 3S30A 3KV6A 3GCXA 3PVBB 4GQ7A 4X8NA 5C70A 1RUF1 2D40A 2F6BA 3KGLA 4LBQD 5E1RA 2ARAA 4S2GA 1MVQA 2R0FA 2IXJA 4UBGA 3WP4A 3BN6A 2X05A 4EQVA 5FZ7A 1IPSA 1WGPA 2OKXA 5AVAA 1QOOA 3TN92 4GXLA 1G9DA 2DVGA 2V4VA 1UZ0A 1XB9A 2CGOA 3HD8B 3SXWA 5LK7B 3NO8A 2P3KA 2YB7A 2DCZA 4XOGA 1QH7A 4OHXA 3VKNA 4CCOA 4P9YA 2HEVF 1BLZA 1QIQA 2XHNA 3KGZA 1RINA 4S2FA 1QY4A 3ZXFA 1UYPA 3J26N 2W91A 1YFXA 3LDBA 2V4AA 1V6LA 3KV9A 4BJ0A 1TMF1 4AI1A 3WDXA 2R49A 3UKTA 3OBZA 1JOBA 4Y5Z0 4D6QA 1Z7S2 2PXJA 4B4RA 1G86A 2RDSA 1XNDA 5G05L 1NG0A 4HMZA 4L99A 2ZGUA 4EN7B 4WM8A 1Q8VA 1ALYA 1O5LA 1Z0HA 3BPZA 2WABA 4K9SA 1UCXA 4OYUA 4BQ4A 1X50A 1ONAA 2LM3A 4TTGA 4CP0A 3OY8B 2EIGA 5FUPA 2JDKA 2WUHA 3QACA 1RUI3 4I02A 4QXBA 5L9BA 2BWAA 1FOD1 2XDVA 4COUA 4AI0A 3ZYHA 3UYJA 4K21A 4LE4A 5A1AA 2QQOA 4Q4V2 1CAWB 1W8TA 4QKNA 1FPN1 1TNRA 2QDRA 4NROA 1QU0A 2Y64A 4AI8A 3VKOA 5KXDA 1AVBA 2DCKA 2RS12 3VHPA 4UW3A 3U10A 4Q4V3 4CEYC 4A7KA 3VBRC 3EQEA 4EN6B 1CR7A 4DXZA 2V5YA 4QPGC 4RQPA 3WG2A 2WQZC 4DMIA 5IK4A 3DN7A 2P1BA 3H3ZA 3SQOA 3NNMA 5CFCC 2WNUB 4AE2A 1RHI2 5GZEA 4L92A 2W3JA 1QJZA 3RG0A 3CDZB 2OQ7A 1OQ1A 3PTRB 3JD71 4Q29A 1CGPA 5KXEA 3GF6A 2RE9A 3QOPA 2Q8DA 1Y9GA 2TBVA 4YVSA 1PNGA 1QXPA 5IYYA 4X6RB 1BEV3 2V72A 1UZZA 4KGGA 5IVBA 2BPA2 4GAZA 4MGYE 1UYZA 3SCHA 3D0JA 1UY2A 4GB31 2V73A 4JV4A 2VOXA 4XE9A 3TNQA 1JMUB 2YV8A 5LBBA 1SLTA 2JDYA 2WBKA 2LRPA 4GH4A 4Q4V1 2ZGNA 3FHAA 1VBB2 2D5FA 3MICA 5FZKA 3TEZA 5FZOA 3DXTA 3O1MA 3E6CC 1C3HA 2KA3A 5FP8A 1YQCA 2WWUA 4FTBA 2VOTA 4K40A 4MG2A 2BNNA 4RGGA 1Z7S1 3RZGA 1W2UA 5LY2A 3VBOC 2DU1A 3JZVA 2PLV3 4Z82A 4YW1A 4MXWB 1EV13 5JIAA 2DTWA 1MPXA 5C3PA 1FATA 1L7LA 5A80A 4GJYA 3CMGA 4C91A 2VD7A 2VMIA 2VMGA 4LBQB 4QPIA 1VMFA 1XU2A 2AREA 1BQPA 5LY1A 5H9SA 4OQ8A 4QXKA 5L9RA 5FIXA 4OHZA 5FCCA 1N3OA 3NW4A 4AL9A 5FOJB 1KD7A 3Q8FA 1DQ2A 1ULPA 1MS1A 2GMMA 1DZQA 2EF6A 2CDOA 3PJQA 3VD9A 4DFSA 1H8TC 2RS33 2YGMA 5FQ0B 2VTXJ 3UKNA 1XNAA 4BQ1A 5JXHA 1U0AA 1W3XA 4W50A 5T5PA 1LU1A 4UI9L 3WG4A 4NIDA 4R8HA 3I2DA 1YLLA 2E7TA 3I3EA 1E5RA 5FYUA 5F2SA 5DUXA 5IUQA 2QZ2A 4LO5B 2OPKA 2PHLA 2Z2SB 3QLQA 3AP5A 2RS32 3ZSEA 2PLV1 1TME1 1IKPA 2HWD1 3WQ0A 3VBHC 3QCWA 4ZONA 5L19A 2XB6C 3NNFA 1B09A 2B5HA 3BCWA 4CPBD 3AVSA 1OH4A 2Y60A 5FO7B 5A7PA 3V65A 5J37A 3MF6A 3I59A 4TLFA 4P9WA 1X9PA 3MIFA 1VRBA 4IE5A 4XPVA 4IEVA 2DU0A 3KSCA 1X8MA 5FV3A 1SBEA 1HJGA 4XURA 4XF4A 3VZLA 5LWBA 4ZZ5A 2JD4A 3MIHA 3PUHA 4P5HA 2C4XA 2GP3A 2WT1A 2VW1A 2ZA9A 4K3UA 4ET7A 1C5IA 2WNUC 4KWLA 4WM8B 3MBWA 4XUOA 1AYM1 3MEPA 3J8F2 3AK0A 4N53B 4MADA 5FAXA 1EP0A 1ZBA3 2ZBJA 2W1UA 3CLPA 5DQ0A 5BPXA 3TRSB 3JBG2 1LCLA 5DPNA 1DYPA 3VBHA 5C5TA 2B9VA 4YW5A 2QE3A 2XBO2 1MVEA 3ZXJA 2QKDA 3LPGA 1OA3A 2WWSA 5FZAA 3THCA 3DYPA 1PO22 4Q4W3 1VBE3 2GN7A 4XCAA 1CAWA 5GJ6A 2XJUA 1W90A 5L7OC 5DN2A 1N1YA 1VIWB 2DFCA 2VJXA 4NHXA 4RR3C 4AEJA 4QX5A 4DRVA 2VZ3A 5AFEA 4P9IA 2IVJA 4ASMB 2DUOA 1AX2A 3WZ1A 3NV2A 4NPRA 4ZPIA 3PNAA 4JDOA 3POSA 4YZ4A 2PA7A 2BUKA 4XAEA 4I0BA 3FL7A 1CZTA 4NRMA 2EXIA 3WF1A 3C7FA 5D8AA 1H2KA 2NQYA 3GBWA 3HN3A 3I54A 3LIGA 2ZGKA 5F5IA 4FBFA 1RYYA 4DINB 1GICA 4M00A 3HQRA 2VULA 4YVSB 2FDFA 3ITQA 4JGYB 2HWF1 4P02B 3HQUA 3KV4A 1PMHX 5FZ3A 3O1UA 2GH8A 1E57A 3CQOA 2DCJA 5SV8A 4FOYA 3WV6A 2X10A 4AOCA 1HKDA 4EZ4A 2HWE2 3WW2A 4QB2A 1W6QA 2EIEA 1AR63 5IW0A 3MV11 2RM22 1J3QA 2E7QA 4XFBA 5KHKA 4CCNA 5LRRA 1VALA 1UYXA 3BU7A 5FZ4A 3TN93 3TWIA 4IEZA 4GALA 1YC61 2FZ1A 2WQ4A 2VOVA 4QT6A 4KWUA 4AF9A 1ND3A 1G6NA 5H9QA 4QPIC 1HIXA 3KCXA 1W9FA 2UU8A 4F3JA 3WF4A 2Y6HA 4M4RA 1RMU1 3FE5A 2VW2A 3IZOA 4WVZA 1HXS1 2Q30A 4COVA 4Q2FA 4QPYA 1JZ6A 4CZSA 1K5MC 1NY71 4XVHA 5JXJA 3FBYA 5C8CC 4GKXA 2JDZA 4MOAA 3MZHA 1WZXA 4BLJA 1UY1A 1SLIA 2EICA 5F9TA 2E53A 1CWPA 2WIIB 1D0GA 3O0XA 3S6PA 4R9DA 2VVFA 5C3RA 3WR0A 1QH6A 3OGRA 4A45A 5C9AB 5C4WA 4AI3A 2X09A 3OUIA 4SLIA 4J6GA 1B35A 4DXSA 2GSYA 2PYTA 2ZJCA 1LOCA 1ZBE2 1AR62 4LUKA 3MFCA 1H4GA 3LFIA 4FOVA 3K3OA 4FAGA 2Q8CA 2XBO1 2Z42A 3GYDA 2VXRA 3POBA 3QBQA 3THPA 5BNNA 1RUJ2 4CUBA 4BCUA 5JSPA 5A3UA 2YYOA 3QD6A 3WDYA 1H2MA 2VGDA 1DGWX 5FZMA 3WNNA 3ZYGA 2MPFA 5A6YA 4H3WA 5JPMB 4IEUA 2Q4SA 2XL9A 2J1SA 5IVFA 4B3NA 1AXKA 1N3QA 3WDTA 4K1YA 1UIJA 2GN3A 5GZGA 2WWJA 4CVUA 2R32A 4TXWA 5FYIA 3RRDA 2R0HA 2IC1A 4QQLA 4S2DA 1XNBA 3AL6A 2W5FA 3FN9A 3GNEA 5JXIA 1C8M3 3Q8BA 1FI2A 3LA7A 1H2NA 3OYWA 5C7GA 3DXUA 3I2HA 4QHZA 3AMQA 4NAMA 3B9IA 5LZ6A 1PVC3 1ZA4A 2I07B 3AVRA 3K4AA 3GBFA 4FXGB 2VZVA 3HNYM 5EQUA 4YGBA 5FMOS 1D4M1 1LHUA 3M3OA 4K6BA 1F8VA 2WQ8A 2NPIA 1VBB1 5FKBA 1LHNA 2JECA 3WEZA 3H1YA 1GMMA 1PGW2 3ZKYA 4RL7A 2HWE1 5FTTC 2JG9C 5L9VA 1GP4A 4AFBA 3BALA 3NWKA 1OOPB 2XJQA 1X7NA 5BNPA 4N7IA 2ZACA 1AL23 4LKEA 3VD5A 3ZYFA 1VJ2A 1F4AA 2G9FA 1YRZA 1ZZ7A 3H1WA 4LJHA 4CDUB 2XKPA 2ZHNA 1AYN1 1J58A 3ZYBA 2Y6LA 2D43A 3WNKA 2AH2A 3BIEA 1UIKA 4F7ZA 5FY0A 3IAQA 5LATA 3DV8A 3MFAA 1YJLA 4DEVA 1MR5A 1HW5A 4Q0VA 3RDIA 3K2OA 1CN1A 5K9YA 1JN2P 1AR83 1RMU2 1KGYA 1O8PA 1VB2A 2X8KA 1J59A 1QJU3 4P00B 2D97A 4A6OA 3WNLA 4YZ1A 3ECQA 2RR12 4Y24A 1OFSA 2GH2A 1V6IA 1BJQA 3GBGA 3VD7A 5GLVA 1MZEA 4CRQA 1GZTA 1YO8A 4CDQA 3R0RA 4DZGA 1T6GC 1H9PA 2CNAA 3ZSLA 5DG2A 1LENA 1XYOA 4YG3A 2VTFA 3N9LA 2WA4A 5LA9A 4JGZB 2RJLA 3ZMOA 5FO8B 3BI3A 3NL1A 3B00A 1PGL1 4SBVA 2W1QA 3NJXA 5CYYA 5FMOL 1A34A 4Z1VA 4D0QA 3N7LA 5T55A 3ZM8A 1QDOA 4G9SB 1ZZBA 4XJ8A 4FT8A 4X6QB 3CNAA 1AYN2 1XQNA 4P9XA 1LOEA 4IEWA 1Y7BA 3TOJA 2ZABA 2AR6A 3AYDA 5C4WC 4UYBA 2TUNA 2YC0A 3JQXA 3K75B 3EYPA 2XHKA 2ZOEB 4GULA 5EJ1B 1SBDA 4WM7C 1R1A1 4C1WA 5DXDA 3WDUA 3C2UA 1X36A 3ZSKA 4ZU5A 2O1QA 1W8HA 1GOFA 4GJZA 2CHHA 3LGRA 3AJYA 2E33A 2J1VA 2BJSA 4DS0A 4E4HA 3D3AA 3N7KA 4CXYA 4ZXEA 5FR3A 1IS3A 3HWJA 3T4VA 5IK8A 3BOWA 5ISLA 2DBIA 5DUUA 4FSJA 1AXZA 1WWYA 4L11A 4CSWA 1VMJA 4NO4A 1NOVA 1GV9A 2BEOA 3GGLA 3I2JA 4QDQA 2JKBA 2LALA 5AC93 2DCYA 5HBAA 2OXBA 2RS51 4JKLA 2CGNA 4JKKA 3I2KA 2P2KA 2WNUA 1ZBA2 5GLUA 3R6SA 1COV2 2CTVA 4KI5M 1R081 2WFF1 2DYCA 1Q43A 1L7RA 3NAPB 2CDPA 4ZS2A 4XAAA 4P08A 1R1A3 1BEV2 3BU0A 2C26A 1AR93 1ND2A 2WN3A 2VECA 2Q1FA 3H3UA 4YGDA 1BXHA 2FMDA 2TEPA 5FY8A 3DGTA 2A75A 4IEXA 2FHRA 1CJDA 1EV11 2C0ZA 2YU2A 3M4FA 4LO6B 3T08A 2YZ4A 3HAGA 5DZEA 3AL5A 4NIAA 1OA4A 3SC7X 3H8UA 1GZWA 1YFYA 4UXAA 2BFUL 3WHTA 2OT7A 3VBUB 5CNAA 4UF0B 3GALA 4NHLA 4XBNA 1DDLA 2R042 4UBHA 3RZKA 3LAGA 4XEZA 3ZKUA 5BNPC 4LO7A 1DGRA 4Y33A 5FYVA 2BBVA 5JLVA 3AP4A 3MF9A 4Y3OA 1I3HA 1RVF3 3SH3A 5KHGA 3LSEA 3VHOA 4XMIA 4P5YA 1COV1 2NYYA 4YGEA 4E2GA 3ENRA 3SISA 3TBDA 4GIQA 3VBRB 4LBQA 4QPIB 4P9GA 2HWD3 4YFWA 2H6BA 3V0AB 4GMP0 3POWA 1R1A2 2R30A 5B2GB 4MVTA 1J3PA 2NN8A 4LBJA 2VOWA 1XSQA 1YNAA 3GZTB 4FPGA 5JZGA 4CDWB 2RM23 1ULDA 3MUZ1 2A5ZA 2VR4A 1TNFA 3BTXA 4CCCA 2HKXA 1JYIA 2HJIA 1GSLA 3RZZA 2PHFA 2VPVA 1VPHA 1BVVA 1DQ0A 4K7JA 4A42A 3B5LB 3DKQA 1YXWA 2K46A 2BGOA 2UWCA 4K8FA 1WD4A 1V6OA 2X5IA 1RVF1 1VBC3 3BIWE 3VDAA 2GNBA 1C57A 1JYNA 4YLZA 4RS5C 3EB7A 4CP9A 4CP1A 3APBA 4I0AA 3NAPC 2J1TA 4XZPA 5CAZA 1RJ7A 4XUTA 5J98B 4HVRA 3VBSC 3SMHA 2BQPA 1LU2A 4CU6A 2JJ6A 4MUVA 4JGYC 2K0GA 1I5ZA 1PVC2 1DYOA 2IUWA 1VBE1 2VZTA 4WM7B 3SKJE 4JHTA 4XQWA 1RUOA 3N9NA 4W6XA 5FP3A 3U14A 1ZRDA 4O65A 4K20A 4IEQA 5A6ZA 4N53A 4Q0PA 5F39A 3LEKA 5FY9A 4Y22A 3V64A 2BOJA 4M3CA 5FZIA 2WJSA 3HMYA 3M1HA 5A33A 4E4DX 3GHNA 5F5QA 3THDA 5DABA 1ENRA 1O7FA 1SFNA 1XC6A 1W2AX 1W39A 2J1EA 2IZWA 1PO23 4ZXKA 3ZYJB 1JZ3A 2PELA 2BRTA 5F32A 4AYUA 1RUE1 5FUNA 4DNYA 3O7OA 3WW3A 1C8NA 5HV0A 4KWJA 4CEYA 1S2EA 1US2A 2HBTA 2UY8A 4XDPA 1C28A 3JCIA 5DZFA 3S5AA 2OZJA 2VXJA 1VBA2 3H42B 5CFDA 1TME3 5L36A 2QQMA 3KS7A 2BNMA 1K45A 1ULFA 3P3NA 3LDKA 4GKYA 5A3NA 1KXGA 3ABZA 1KDMA 2DV9A 3T1LA 1MEC1 1DQ5A 3L2YA 2W39A 2JWPA 3WNOA 4CU9A 4ZHNA 5E16A 3UNPA 3BKZA 1HN0A 2VG9A 2YFZA 3O1TA 4XUQA 5EV7A 4RA0A 1GWLA 4LE3A 4AHXA 3N9PA 5BNOC 1WLCA 4OCTA 4RSUA 1VAVA 2ARBA 4AVAA 5A1LA 3OGSA 2WINB 1SLAA 2VY0A 1GBGA 2BW8A 5JPNB 2A3XA 2WS93 1K5JA 1PO21 2VO5A 4GA9A 5FLJA 3TN91 5HCFA 1T2XA 4OUSA 2E9QA 1SFPA 4TZDA 3VBFB 1EPWA 4NIIA 1UX6A 5GKAC 4IW3A 2LROA 4FFIA 4CXXA 5KBFA 1JZ5A 2B42B 2PHDA 3N7JA 2P4EA 2XOMA 1WKYA 3PHMA 4YWAA 4FTSA 1NLRA 1XE8A 4QX1A 4XILA 3VV1A 3A7QA 1PIV2 3ASIA 5CADA 1GOGA 5HCHA 4H14A 5GLWA 1GANA 2Z4FA 2VUDA 2JG9B 2WO1A 4RD7A 3ACFA 4AXOA 3WNPA 4ARXA 1YJKA 2VQAA 4HT1T 3O12A 1AHSA 4P14A 3KWVA 4YVWA 1NZIA 3RWNA 5A3PA 2DVFA 2YBSA 1CD3G 2CGPA 2VBDA 4FCAA 2JB4A 4QKDA 3KF5A 1FV3A 4CDUC 1YEWA 2WS91 2XGXA 3HQXA 1LOGA 5FYCA 4JKMA 3ZFGC 5CKNA 1ZRFA 4BISA 1OXCA 4QQHA 5FPBA 2XLFA 2R063 1AXYA 4GZ9A 5FY7A 1LKNA 2XL7A 3K4DA 1W8OA 4CCJA 2QJVA 5EXOA 4QD2A 5EHDA 4XXPA 2YPJA 4YM0A 2YBPA 4ZU4A 1NCRB 3RQ0A 4AI2A 1FV2A 1NYWA 3KQRA 4JGZC 3V0AA 2XH6A 3RJ2X 1FX5A 4LR4A 3KHCA 5JIUA 4OUEA 5CEHA 4IV1B 1FNYA 2HWC1 4PDWB 2PFWA 2RG4A 3ZOIA 1RUD3 4YZ3A 4ES8A 2ZAHA 1KFUL 1OPOA 3U4SA 1WMXA 1W3VA 3T30A 4GB32 5C9AA 5FYZA 4QXCA 1ASJ3 1RUG2 2QQWA 3RVHA 2XJPA 1O3SA 4IESA 4AEDC 1KRIA 1NE4A 1MEC2 3JQWA 3OG2A 1YYNA 4PF1A 5ERLA 4RS5A 5HPOA 4QM8A 4AQSA 4YW6A 3VD3A 3PUSA 1IS5A 1DQ1A 1UWWA 2X5IB 1O6UA 1J84A 1RUG3 3GCWA 3J7NA 4CTEA 5I91A 3VD4A 2WC2A 4HETA 1TEIA 1JXNA 4CP9B 2ZS6B 3P3PA 1X82A 3P5BA 4KBBA 1Y4WA 3EMRA 5CU1A 1O3QA 2ARCA 3T2OA 1N1TA 3NKTA 5EPAA 2W9XA 3AP6A 4Y1UA 1URXA 4CCLA 4RGKA 1LR5A 2VTXA 2PQSA 5DAWA 1HQWA 1MS9A 5ACA3 2FCTA 5JDBA 1VR3A 1HXS3 1RUD1 3AYCA 1QGLA 5M0TA 3O1RA 3AB0A 3R4SA 2JIJA 5FKCA 1JZ7A 4BE3A 4WVVA 2D93A 4XZUG 4JRLA 4JQTA 5F6KA 2Y0OA 4JX0A 4BQ3A 2A6YA 1WW4A 5KC6A 4OZOA 4LOSA 5A6QA 4XJAA 3NJYA 3WP6A 1FT9A 3EO6A 1ZRRA 3OBTA 4HFSA 3G6JB 1S2BA 1SBFA 4TWTA 1PK6C 1XNTA 5F8PA 4CEYB 4E8CA 2HLEA 1CZSA 3IIAA 1WUVA 3N35A 1UNBA 5CFDB 1O4YA 4XF9A 3AZVA 5FJKA 1AYN3 4LEJA 5H9RA 1BBT3 2AZ5A 1W6NB 1OF4A 3ACHA 1W6MB 3N4MA 2XUEA 3PIGA 3JB8A 1HRI1 3E5QA 4O61A 2HEYF 2D98A 2N7GA 4KGQA 3AZWA 2ZMLA 4RQPB 1W99A 2O0OA 2FBEA 2F4PA 3NSTA 5FPUA 1IG0A 5FMCA 5HCBA 1F31A 1W9SA 4BMBA 5F7UA 4PLNA 5EYYA 3VZJA 4AW7A 1OUXA 5J3UA 1S2KA 4YNIA 1U5XA 1SG3A 1H1IA 3CJIB 4LNVA 4LPLA 2WDBA 1OLMA 3L2HA 1D4M2 2D3PA 1V6MA 2ZGPA 2MEV3 4EROA 2LUWA 1JS9A 3MV01 3W5MA 1R1ZA 4YW3A 1JOJA 4XW3A 5FRAA 2EIBA 4QB1A 1BBT1 5FZ9A 4Z8BA 2OZ6A 3J7MA 4B4QA 5ANNA 2AEZA 3E6BA 5LASA 2ZX2A 4NVPA 1HRI3 4HK8A 4MGKE 2IXIA 3FUQA 1RUC2 4IGPA 1IGOA 4FQ4A 3RWKX 4Y26A 3ST7A 5A32A 1Q5OA 2R071 3BODA 5T50A 4BDVB 1ODNA 2GNDA 1W8WA 3POEA 1ASJ2 3WG3A 1F9KA 4FOWA 5FY4A 5JR2A 2D3SA 3ZFEB 1M4WA 4MGTA 1AYM2 4XACA 1UX7A 1YFWA 3NJVA 3POIA 2J1UA 1US3A 1AL21 4QDRA 4HSLA 1NCRA 4RN5A 2R7EB 5FOBB 4KG8A 3GZEA 4LHNA 2WNOA 3ILRA 3OOXA 1REDA 4IV1A 3OBRA 3H8OA 4AHZA 1Y3TA 2P5BA 3KT1A 5JI7A 4V2WA 4OLLA 1XE7A 4NWVA 1VBC2 4XFIA 1N3PA 1Y9QA 4KH9A 3RGBA 1RUE2 3ETQA 2IXLA 4NAOA 4MLOA 4Q26A 4OI0A 5J36A 2W92A 1AR91 2JG8A 1AR71 3FFZA 5CFCA 5F3GA 3WUDA 1IKQA 1UXZA 3J7HA 4O7XA 4Z2WA 4LBMA 3ME2A 4XETA 2EAAA 2R6QA 3WP5A 1VBE2 3ATGA 2W0XA 1SCRA 3M3EA 3OCPA 4QX7A 5C8WA 5FZ1A 4F8AA 2WSVA 5JUVA 4LA2A 1QHDA 5FXZA 4AVSA 1GQHA 1C5HA 1UMZA 4L2NA 2E7AA 4OHWA 1PM7A 5FK8A 2NP0A 1GWKA 4CCDA 1DGRN 3I2FA 1GWMA 1NKGA 2Y8KA 1ULCA 5B4XA 2VZSA 4J1WA 3VBHB 2EVXA 3K4ZA 1DFQA 2NZ9A 4L9BA 2W46A 5D2AA 4NE9A 4DB5A 3NNGA 5FZLA 4DXRA 1W6PB 2W95A 1VAKA 4P9LA 4QB6A 1CX4A 2BERA 2ZTNA 3FLTA 1AR73 3KT7A 4N8MA 4WVMB 3TNPB 3T1MA 1W0PA 3FLRA 3O0VA 3LWCA 3DL3A 4PIXA 4AI9A 3PU3A 1H0BA 3VKMA 4N43B 3AFKA 3LSDA 1LODA 3ROUA 3HIFA 3LF7A 2D6OX 3PUAA 3LQCA 4CE8A 4CP2A 1JYCA 4BK5A 1XYPA 2X53S 5AC91 1RUNA 1W06A 4YPJA 5CG8A 2RS53 3HEIA 5A70A 1UAIA 1UU6A 2ORZA 5IFTA 5D8AB 4EN8B 4M4PA 5A7SA 1ZZ6A 3VBOB 4BH9A 1H6XA 1ULGA 2QQVA 4BWOA 3GJAA 5JZGB 3LOBA 1LGNA 1UPSA 3CZJA 1SPPB 3BYWA 1SDDB 5EIYB 1LAJA 1R091 5FDBA 4C0BA 3B94A 3PTYA 5I93A 1UD1A 3IT8A 4INDA 4META 5C3SA 1W6QB 1ZVFA 3OPWA 5IWFA 2MHFA 5LA1A 2OUJA 1NX9A 1OUSA 1H8TB 2ZGRA 2B45X 4LITA 1V6NA 2VNOA 3AC0A 3OSDA 4IE4A 3AM2A 3J8F3 4MSVA 1AL0G 5F5CA 2VVEA 5D8AC 4YYOA 1FXZA 3PU8A 2P34A 1Q8SA 4FFFA 2V09A 4AEDB 1DU3D 2A73B 4JRAA 4LMFA 3EHKA 4BIOA 3RS6A 1ZBA1 2R1DA 4Y5TA 4R52A 1X8EA 2EXJA 2VM9A 4WM7A 4IV1C 3Q8AA 4MZUA 1F2NA 3HNBM 5FZ6A 1AR92 5J48A 1W2OA 4BQYA 5FP7A 4UOJA 1PZ9A 4C1XA 2BFUS 3I2IA 4HBNA 1UZWA 2JDHA 2W68A 3SEPA 4BQ2A 1MEC3 4E8DA 3EBRA 4QXHA 2W94A 5JSRA 5A3LA 1IPJA 3I3QA 2JDAA 1EV12 2QNKA 3UT0A 5KC5A 1VMHA 5C4WB 4NIHA 2PLV2 1TME2 1Q8PA 3LIHA 2CSGA 4IEPA 3RFRA 1KJRA 5FZFA 1NA1B 2ZEYA 1ND3C 3RYRA 3HNMA 2O14A 3NV3A 4M3CF 5DAVA 3V0BA 5FZHA 5FLIA 4G3YC 2QTWB 4D94A 1HB2A 1AJKA 2YG0A 3MGUA 1MS0A 1NA1C 5B4NA 2D6LX 5FPZA 5EJ3A 4NHMA 5FZDA 5EP9A 2JEMA 1S0IA 2UYAA 4QKBA 1DCSA 5CKMA 5L7OB 3KVAA 2GNTA 4BA6A 2ES3A 1NXMA 1O4TA 1U5YA 2VQUA 4IE6A 2HWF3 4BXFA 1HV1A 1WW7A 1W9YA 1WCUA 2ZHMA 3MIGA 4EYUA 3MPPG 5FLHA 2NLRA 1ZX5A 3VBFA 1B35C 1OI6A 1WBLA 2RMU1 3ON7A 1M06G 3WUCA 3FX3A 1UN1A 1POV3 2C1FA 4QX3A 3WP3A 5KHJA 2YUEA 3KF3A 3OYWB 3PL0A 4KU7A 2SBAA 3JB4C 4KQ7A 2HH9A 2PAKA 3SEEA 1UO9A 4WVMA 5FWEA 1XU1A 2Y6KA 2XG3A 4NOTA 4IERA 1SFYA 2PMWB 4RYDA 2DDUA 1BK0A 1XYNA 4W4ZA 4YVWB 3USUA 1KEXA 4AEKA 2OQ6A 1CAXB 1R092 2WO2A 3JD72 4Q0UA 3RYKA 4RHV1 2UYBA 1SEFA 4CUAA 1KS4A 4MGQA 1H30A 2VW0A 4EWEA 4JZRA 3ZXKA 3UETA 4AGVA 2VUJA 2ZGSA 4KG0A 3NMBA 1I9RA 4JDMA 1LOFA 1UOBA 3AP9A 1WLDA 1QJEA 5BNPB 1QXRA 4FPYA 2XR4A 4NHKA 5FZ0A 2WLPA 4IGOA 2WZR2 4QGMA 3CU7A 3VBOA 1GU3A 3PMEA 2OS2A 2PTMA 4HVQA 1PGL2 3ZYRA 1OD3A 1OOPC 2RDNA 1GZ9A 2E6VA 4Q4Y1 1AZDA 2JE7A 3JUUA 5FBJA 2HBUA 5CG9A 2DUPA 1CAUB 1V0AA 5JOYA 5I0UA 2WL1A 1QXJA 3AX4A 5T5OA 4D3WA 1VBA1 4RS5B 3UJOA 5IAXA 2R062 1T6BX 1WCQA 5BNNC 1LOFC 1PX3A 1H8TA 3K51A 4PDWC 4PJYA 4XFCA 2JKXA 2P17A 3VHRA 3ZFFC 4ATFA 4MYEA 1D0HA 1UMIA 1PO12 4UFMA 1MZ6A 1UMHA 3RNSA 4MGSA 4XXAA 1KITA 4ISQA 2B7YA 1HJFA 3HBZA 4FVVA 5BNQA 5J1XA 2GC1A 2VL4A 3I59B 2VNGA 3R4UA 4QU1A 3SNMA 1D7PM 3PURA 3BTAA 2WLQA 1IS4A 2WT0A 3I3DA 4TSVA 5CKQA 4Y4RA 4AFDA 3DPRA 1PM4A 3ZPOA 2VU9A 1TZOA 3RZLA 3CHXA 1V9U3 5CIRA 4CDXB 1OKOA 4UFIA 5IK5A 4Q1RA 3B01A 4XDQA 1N1SA 3W20A 4ZS3A 4JCKA 4W8JA 2WYFA 2GZWA 4QU2A 3GJBA 1N47A 4AVCA 2DWRA 3NKGA 1H1AA 1UYYA 2ZXQA 3OGVA 5E88A 4YZ5A 4NN0A 1NCQC 4AVTA 1BHGA 1XOYA 1O59A 1VBB3 5DDJ3 3B9CA 1H4HA 2VMEA 1UXXX 2W47A 3KHBA 4LUMA 4WVWA 4AZZA 1IQAA 3LCPA 1W0NA 2Y34A 3VKLA 1QOTA 1NA1A 5A3MA 5K0UA 3I3BA 3CIHA 1RUH3 3USSA 3O1SA 1RUG1 1IPKA 1DQ6A 1W6MA 1NZCA 4I09A 5C6CA 2MEV1 3W5NA 1YI7A 4H7MA 1PO13 2W1SA 5BUVA 3KVBA 3AXDA 2GMPA 3POYA 2VZ1A 3WVJA 2A6VA 5L7OA 2XJVA 3OF1A 4LKFA 4JTNA 2JXAA 1WCKA 3J9SA 2AYHA 4FPJA 4H2AA 4DIQA 4EE2A 4U2AA 4O9GA 4MHUA 2QDNA 2L9LA 4CEWC 1JHNA 4NPMA 3RZMA 2IFRA 2CL2A 2PAMA 2VMDA 1VP6A 1HN1A 2BBAA 3DCQA 4XFGA 4QWNA 4YM2A 3FC0A 3D6EA 3HOBA 3R05A 4YVWC 3IKWA 4IV3C 4R4ZA 5EWSA 3T2TA 2RHPA 1QNYA 4ISRA 5LA2A 5E89A 1NE6A 4M3CE 4HOOA 2NM1A 4EZHA 1I6XA 3KZ4C 4R9CA 5KXCA 1SQ4A 4EN0A 1O4ZA 5FJHA 3LOIA 1BYHA 2IVIB 4UW4A 4BPZA 1Q56A 1W8FA 3W58A 5T3NA 1NAEA 4LHLA 2CV6A 2J7MA 4UF0A 4PIYA 4I01A 2DF7A 4BHPA 2GP5A 3M8LA 4HVOA 3S5QA 5I0DA 3ZO0B 5FXWA 2FD8A 1CIWA 2K9ZA 3ALQA 4LO4B 3ZFEA 1ND3B 4B7EA 2MNGA 2XQRA 2DCTA 3KCYA 4O9EA 4XMAA 5FP4A 1OMIA 1W2NA 1ZYBA 2BZDA 4MV2A 3M3CA 1LNSA 3C7EA 4ASKA 5IVVA 3P1IA 3SHRA 2D5HA 4FPFA 1W8NA 2P6CA 1UKRA 3W9AA 5FY5A 4B1MA 1OHFA 1F5FA 1JUHA 5F1RA 1V00A 4BZ4A 2VQTA 4HKOA 2WZEA 4NR1A 1W05A 4I30A 2A6WA 2ZAAA 4HG6B 3MLKA 4ORFA 4W6YA 4WZCA 1KS5A 4CCEA 4ES9A 2XMLA 3VL8A 3TEYA 2Y38A 4I3PA 3POGA 1WMFA 5CA6A 1QJX2 1YQ2A 1DG6A 1Z78A 2BV4A 2Q0AA 3LDRA 4Y1YA 4ZY9A 1MQTB 4QHBA 3PVEA 2XJTA 1HLCA 1UY3A 5G04L 2BWCA 5ANQA 1WLWA 1J1LA 4BIFA 2Q1ZB 2VAUA 1R083 2IXHA 2WFF3 2WO3A 3DPRC 4FFHA 2NMNA 4JVAA 3WCRA 4AWDA 3ORJA 1QJY2 4GD4A 1W9TA 4MGZE 4CCMA 2HEWF 4YRDA 4A3ZA 2XJRA 5FMDA 5FYBA 1OKQA 1CAVA 3M2MA 3LA2A 5EZWA 2BVVA 3AZZA 3MUY1 5H9PA 3RI9A 3UKVA 1ND2C 3C3VA 4FP3A 2R043 4PI2A 1HB3A 4BLIA 3A22A 4UFLA 2WNVB 4CCKA 3P6BA 4Y20B 4ATEA 5A6XA 1YWKA 1R64A 4DO0A 2ARXA 3N9MA 5FYSA 2D3RA 4FQZA 4URTA 4E2SA 2WZPP 1XBFA 1ZA7A 2HWF2 3GHMA 2FDIA 4A7ZA 1EPZA 1RL3A 2WRAA 2ZGOA 5FMBA 5J96B 3IDEA 2Y33A 4R9AA 4GWJA 3Q8EA 1W6PA 4DXTA 4XHBA 1JODA 4MGIE 3B3QE 2K2SA 3H50A 3DYMA 3CF6E 1RXGA 1LESA 1W6OA 2H0VA 4Y1XA 5D1IA 4COWA 5FZ8A 4HZFA 3ZR6A 3VUOA 4PI0A 4QX8A 3ZFGA 5FP9A 5I0SA 5JXGA 3T0AA 1LHVA 3OB8A 1COV3 1VBD3 3WX5A 4BQXA 3U0ZA 2R041 2ZX0A 4N43C 5GZFA 3RI8A 2XPJA 4RHV2 1YIPA 5FY1A 4IXLA 3BTZA 4DOUA 4FI9A 4ASLA 5LBFA 4HLTA 2HWC2 2P3JA 1O8SA 2YFUA 2ZGQA 4IQPA 2VCCA 3D82A 2DTYA 2XKOA 4LLFA 2VCBA 3J8F1 4IV3A 5A7NA 2PQQA 2WSUA 5F3IA 3AKPA 5JOZA 1CX1A 1CONA 1UOGA 1HV0A 4YM1A 5CFDC 1JUIA 1SPPA 3JBG1 4XJUA 1OQEA 2VMFA 3I2OA 3BOPA 4HPKA 2D44A 2XWBB 1NT0A 2WZR3 3H8RA 1C1FA 1J3RA 4D7SA 2B9UA 2V5DA 3BGAA 1VBC1 3O0WA 5TSWA 3ZFFB 3ZPYA 4DEQA 3OEBA 2RDRA 2AGSA 3CKHA 4XQ4A 1IS6A 4GH4B 3UGHA 1ODMA 5CISA 3WQBA 1Y43B 3SH5A 3OGJA 3PIJA 4FXKB 1JH5A 3GZAA 3I3MA 5ABJC 2XONA 4EJRA 4N7UA 1NCRC 5EFUA 2JDUA 2W08A 5HV4A 4IEOA 1K12A 1HDKA 1VE0A 4BK4A 2XWJB 2B8MA 1A78A 4AVVA 5C33A 3WXPA 3OJBA 3MI8A 5FPLA 5JOWA 1DF0A 3T0BA 3RSJA 5JSOA 3RMXA 1F15A 1OC1A 4PBOA 5HI0A 1ZZ8A 3IDBB 5DAXA 4KL1A 1KFXL 3MIDA 4YW4A 3VDCA 5JMCA 4UW5A 1EAH2 5C71A 5I0RA 4L0PA 1R093 1RUF3 5T52A 2WNVC 2SLIA 4B4PA 3N36A 2QFEA 1REFA 5F3CA 4CU8A 2P3YA 3KLSA 3NQHA 3D0SA 2OUHA 1RVF2 2G9GA 3ZYIB 1X9TA 1SHWB 2D7FA 3NNLA 1FPN2 4CYDA 2D6NA 4XF3A 5BNOA 2RMU3 5IHRA 2VZPA 1W8ZA 2DURA 1IG3A 2P6HA 3ACLA 1D2QA 2XVKA 3MW4A 3ZLIA 4Q4X2 4BQ5A 1RIRA 2O8OA 3IM0A 4AK3A 4YZ2A 3FLPA 5JMOA 3O1VA 1ZRIA 3VBSB 2WNVA 3M3QA 3OTFA 1H1MA 2R1BA 3WCSA 3PLQA 1XNCA 2Q5TA 3LEGA 4Q4X3 4RHV3 1DZRA 4QDSA 3ZXDA 4E27A 3M70A 1DYKA 1RGSA 3ZDSA 3S57A 3CJIC 1BMV1 1A6CA 3BVCA 1GNYA 3ZR5A 2VE1A 3NJZA 4K1ZA 5IAVA 3N3HA 3U75A 3MHZA 1ULOA 1GZWB 3VB9A 1L7QA 2VC9A 2ILMA 1NUKA 1QDCA 2OA2A 1UL9A 2FDKA 1PIV3 4XIOA 1UZVA 4PLOA 1FOD3 1CAXA 3OPTA 1AR72 1CPNA 1GP6A 3MW2A 1G8WA 1YQ6A 2Z79A 3SCGA 3FUOA 3PVOA 3E5UA 4R9BA 1JYVA 4OVEA 5E8AA 2XLGA 1CQ9A 3WW1A 1QQP3 5CVRA 3T2PA 3WDVA 1WBFA 2D6PA 2I2SA 2C6SA 3AZXA 4LBNA 4RR3B 5LBEA 1UOFA 1ZNPA 1DQ4A 1JU4A 2DFBA 4M01A 4KMQA 4W6WA 1VBA3 3VDDA 3VBRA 4KU8A 4RQPC 5LW9A 2E31A 4N9HA 1RUH2 1YHFA 1PK6A 1ASJ1 2ZKNA 4IV3B 1G9AA 1V6KA 1JI6A 2J1AA 2G4IA 3VN4A 4YM3A 3ZVXA 1QWRA 3CBNA 1POV1 3CZUA 4HPKB 3LD8A 4NHYA 1CAUA 4ARYA 4CUGA 4UT5A 1JW6A 4WM8C 2PHWA 5I0TA 3MO4A 3WG1A 4E4ZA 2ADEA 2BU9A 3J7LA 5ABJA 1SLLA 1UY0A 4PF5A 1XJAA 4NRQA 1A8MA 4CDWC 1EAH1 1G7YA 2HYKA 1KDKA 2UWAA 2Y6GA 3VGIA 2ZX1A 1DLCA 1QQP1 2WAAA 4LT5A 4BYYA 2QQPA 2HWD2 2WS92 2UWBA 2W52A 4MHRA 5A3WA 2WT2A 5IVYA 5HXMA 3TEWA 3SH4A 1IHMA 1LULA 3L9JT 2FDGA 1JYTA 1QJX3 5BY5A 5DDJ1 2DBNA 4EV0A 3PVNA 4CXWA 4FFGA 1QJFA 2VQ0A 5IJRA 1ENXA 3VL9A 1GNHA 2G19A 4LKDA 4D6RA 1PGSA 2WN2A 4V1PA 3DKWA 1RUH1 4YSFA 4H7LA 1CVNA 1RUJ1 4QAWA 2GC2A
chains in the Genus database with same CATH topology
5FXVA 3AVSA 4D6QA 5ANQA 5F5AA 3ZPOA 2PXJA 4QXHA 5A7PA 2OX0A 3N9NA 4GD4A 5FP3A 1VRBA 4CCMA 4URAA 5A7WA 5FZCA 5F39A 3K3OA 5FV3A 5K4LA 5FY9A 4CCLA 5FYBA 4D6SA 3KV5A 5FZIA 2Q8CA 5LWBA 4GJZA 5FZFA 5IVJA 5E6HA 4V2VA 5F3GA 5FUPA 2GP3A 4E4HA 4CCKA 4QXBA 5F32A 4HONA 5A7WB 5FUNA 2XDVA 3PDQA 5FPAA 4DO0A 4QX7A 5FZHA 3ZLIA 5FZ1A 5FZMA 3N9MA 4NUBA 5FYSA 5ISLA 4XDPA 3UYJA 4CSWA 5FXZA 3NJYA 5IVFA 5FZDA 4LIUA 5A3NA 5FZAA 2WWJA 3KVAA 5FYIA 5A7OA 3U78A 5FYHA 5IVCA 3AL6A 4BXFA 4TN7A 5KR7A 5FZGA 5FJKA 3KVBA 5FZ8A 4EYUA 4QX8A 3N9PA 5FZLA 5FP9A 5FZEA 5FZBA 3DXUA 4BU2A 5A1LA 2XUEA 4DIQA 3AVRA 5A3TA 5FY8A 4AI9A 2OQ7A 2XXZA 3PTRB 3PU3A 4C8DA 2YU2A 5FY1A 5FPUA 2Q8DA 5FXXA 3AL5A 5IVEA 3PUAA 3OPTA 2W2IA 4QWNA 4XDOA 5FWEA 4AAPA 5IVBA 4LXLA 5F5IA 4GAZA 5FZOB 2OT7A 4UF0B 5FWJA 5A7NA 2OQ6A 5F3IA 4HOOA 2Q8EA 4EZHA 5FJHA 3KV4A 4Y33A 5FYVA 5FZKA 2YPDA 5FYMA 5FZ3A 5A7SA 5LW9A 5FZOA 3DXTA 5FYTA 4Y3OA 5FP8A 4UF0A 5A3PA 2WWUA 5FZ9A 2YBSA 4EZ4A 5FY0A 2GP5A 5IW0A 3N9OA 5FXWA 5LY2A 5FZ0A 5F3EA 3KV6A 5FYYA 3K2OA 4IGOA 4IGPA 5FPVA 3LD8A 5FYCA 4CCNA 5F37A 4BISA 5FZ4A 5FPBA 4CUGA 2OS2A 5FP4A 3OPWA 3K3NA 4GJYA 5FY7A 5IWFA 5A80A 4CCJA 2VD7A 5FBJA 4ASKA 2YBPA 5FY4A 5IVVA 5FZ7A 4IGQA 5A7QA 5LY1A 4LITA 5FY5A 3PUQA 5F5CA 5CEHA 5A3WA 5A1FA 3PU8A 5FPLA 3N9LA 5IVYA 3U4SA 4CCOA 5FYZA 4QXCA 3RVHA 5FYUA 2XMLA 5F2SA 3N9QA 4QU1A 2YBKA 5FZ6A 4D6RA 2P5BA 3LDBA 3PURA 5F2WA 3PUSA 4V2WA 5FP7A 2YU1A 4LIVA 4Y4RA 5F3CA 3KV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXV A;  3AVS A;  4D6Q A;  5ANQ A;  5F5A A;  3ZPO A;  2PXJ A;  4QXH A;  5A7P A;  2OX0 A;  3N9N A;  4GD4 A;  5FP3 A;  1VRB A;  4CCM A;  4URA A;  5A7W A;  5FZC A;  5F39 A;  3K3O A;  5FV3 A;  5K4L A;  5FY9 A;  4CCL A;  5FYB A;  4D6S A;  3KV5 A;  5FZI A;  2Q8C A;  5LWB A;  4GJZ A;  5FZF A;  5IVJ A;  5E6H A;  4V2V A;  5F3G A;  5FUP A;  2GP3 A;  4E4H A;  4CCK A;  4QXB A;  5F32 A;  4HON A;  5A7W B;  5FUN A;  2XDV A;  3PDQ A;  5FPA A;  4DO0 A;  4QX7 A;  5FZH A;  3ZLI A;  5FZ1 A;  5FZM A;  3N9M A;  4NUB A;  5FYS A;  5ISL A;  4XDP A;  3UYJ A;  4CSW A;  5FXZ A;  3NJY A;  5IVF A;  5FZD A;  4LIU A;  5A3N A;  5FZA A;  2WWJ A;  3KVA A;  5FYI A;  5A7O A;  3U78 A;  5FYH A;  5IVC A;  3AL6 A;  4BXF A;  4TN7 A;  5KR7 A;  5FZG A;  5FJK A;  3KVB A;  5FZ8 A;  4EYU A;  4QX8 A;  3N9P A;  5FZL A;  5FP9 A;  5FZE A;  5FZB A;  3DXU A;  4BU2 A;  5A1L A;  2XUE A;  4DIQ A;  3AVR A;  5A3T A;  5FY8 A;  4AI9 A;  2OQ7 A;  2XXZ A;  3PTR B;  3PU3 A;  4C8D A;  2YU2 A;  5FY1 A;  5FPU A;  2Q8D A;  5FXX A;  3AL5 A;  5IVE A;  3PUA A;  3OPT A;  2W2I A;  4QWN A;  4XDO A;  5FWE A;  4AAP A;  5IVB A;  4LXL A;  5F5I A;  4GAZ A;  5FZO B;  2OT7 A;  4UF0 B;  5FWJ A;  5A7N A;  2OQ6 A;  5F3I A;  4HOO A;  2Q8E A;  4EZH A;  5FJH A;  3KV4 A;  4Y33 A;  5FYV A;  5FZK A;  2YPD A;  5FYM A;  5FZ3 A;  5A7S A;  5LW9 A;  5FZO A;  3DXT A;  5FYT A;  4Y3O A;  5FP8 A;  4UF0 A;  5A3P A;  2WWU A;  5FZ9 A;  2YBS A;  4EZ4 A;  5FY0 A;  2GP5 A;  5IW0 A;  3N9O A;  5FXW A;  5LY2 A;  5FZ0 A;  5F3E A;  3KV6 A;  5FYY A;  3K2O A;  4IGO A;  4IGP A;  5FPV A;  3LD8 A;  5FYC A;  4CCN A;  5F37 A;  4BIS A;  5FZ4 A;  5FPB A;  4CUG A;  2OS2 A;  5FP4 A;  3OPW A;  3K3N A;  4GJY A;  5FY7 A;  5IWF A;  5A80 A;  4CCJ A;  2VD7 A;  5FBJ A;  4ASK A;  2YBP A;  5FY4 A;  5IVV A;  5FZ7 A;  4IGQ A;  5A7Q A;  5LY1 A;  4LIT A;  5FY5 A;  3PUQ A;  5F5C A;  5CEH A;  5A3W A;  5A1F A;  3PU8 A;  5FPL A;  3N9L A;  5IVY A;  3U4S A;  4CCO A;  5FYZ A;  4QXC A;  3RVH A;  5FYU A;  2XML A;  5F2S A;  3N9Q A;  4QU1 A;  2YBK A;  5FZ6 A;  4D6R A;  2P5B A;  3LDB A;  3PUR A;  5F2W A;  3PUS A;  4V2W A;  5FP7 A;  2YU1 A;  4LIV A;  4Y4R A;  5F3C A;  3KV9 A; 
#chains in the Genus database with same CATH topology
 3VLB B;  5A33 B;  2WO7 A;  1AJO A;  1AX1 A;  1S55 A;  1FMD 2;  3OY8 A;  4CUC A;  4LOR A;  4QX0 A;  1PO1 1;  3POF A;  1EAH 3;  3KT4 A;  4YW2 A;  4OQ9 A;  4MO3 M;  4PQ9 A;  1GZC A;  3PUI A;  5LB6 A;  4CDX C;  4XF1 A;  3ZN5 A;  4Z92 B;  3H7Y A;  1B35 B;  2ENR A;  2ZEX A;  4V2V A;  1E5S A;  1RB8 G;  2OII A;  1LED A;  1WLT A;  4E4S A;  2QQI A;  1WD3 A;  2HYX A;  4HON A;  2W87 A;  4KWK A;  4C0H A;  2WZ8 A;  4L8Q A;  4NUB A;  5KHI A;  3INA A;  5F6L B;  2JG8 B;  2J42 A;  1APN A;  4D69 A;  1OH3 A;  3AP7 A;  4A3X A;  1Q3E A;  5BYN A;  1XXN A;  2IFW A;  3W21 A;  1RHI 3;  3GXU A;  4Q8L A;  1TG7 A;  4QKF A;  1IQD C;  1REE A;  1W04 A;  1SZB A;  2A3Y A;  2VBP A;  3C8X A;  4HL0 A;  2GC3 A;  1YI9 A;  4PQQ A;  4Q1P A;  5FFO C;  3ES1 A;  5FYH A;  3WSO A;  4YGC A;  1BCX A;  2IXC A;  1V9U 1;  1FOD 2;  3E97 A;  3AKT A;  5IVC A;  1MS3 A;  1ST8 A;  3WHU A;  2WKK A;  2D6M A;  4B29 A;  1JTZ X;  1YQ8 A;  1IOA A;  3NRU A;  1GP5 A;  1VLN A;  4AHW A;  4DPN A;  2FZ2 A;  3JU9 A;  4DRR A;  3IAP A;  2QBX A;  5FO9 B;  3B02 A;  4Q5O A;  3SIT A;  1RXF A;  2BOI A;  4UFK A;  2X29 A;  1GR3 A;  2R07 3;  3E1F 1;  1GLH A;  1PHM A;  1F35 A;  1XE0 A;  1AUY A;  1YQ5 A;  3WF3 A;  2JG9 A;  3AFG A;  3AYA A;  3H9A A;  5KWR A;  4JHZ A;  4LBK A;  5T5L A;  5FZO B;  1RHI 1;  2JX9 A;  4QGL A;  4GWM A;  1DGL A;  3VZM A;  4Q27 A;  3LZZ A;  4N43 A;  1PMI A;  2WR9 A;  2ZEZ A;  4MX3 A;  1H6Y A;  3WD5 A;  2Q8E A;  4XBL A;  3SKV A;  3ILN A;  1MS8 A;  1HX6 A;  3ACI A;  5LEJ A;  2PHX A;  3HPN A;  1CJP A;  4UW6 A;  1RUC 3;  2AEN A;  4UAP A;  2GDF A;  3VDD C;  4IE0 A;  2XJS A;  2PHR A;  5T54 A;  1OOP A;  1J83 A;  3G7D A;  2FCU A;  3POJ A;  1MQT C;  1A3K A;  4L97 A;  3LE0 A;  4XTP A;  3TYJ A;  5K7P A;  4RFR B;  1V9U 2;  3VDD B;  4A2U A;  1YIF A;  4UFJ A;  4AFM A;  1KQR A;  5FPV A;  3THT A;  1DHK B;  4CDU A;  5JI9 A;  1GOH A;  1PK6 B;  1AL2 2;  4LUL A;  3UK9 A;  2R16 A;  4EWD A;  3HN1 A;  4HXC A;  3J4U H;  3CL1 A;  1VRH 1;  2A3W A;  4TLG A;  1VBD 2;  4XF0 A;  4CU7 A;  3I8T A;  4PDW A;  4FPL A;  4CDQ C;  1MZF A;  3WW4 A;  3QH7 A;  4DY5 A;  5FQ0 A;  4EN9 B;  2F17 A;  4IGQ A;  1PZ8 A;  4NMI A;  3ACG A;  2JE8 A;  4RGA A;  4GWI A;  4YVS C;  1HRV 1;  3UL2 A;  3ZX7 A;  2UY9 A;  1DP0 A;  3NV1 A;  1UPI A;  1UOJ A;  5ABJ B;  2QQK A;  2YHJ A;  3ZIX A;  3WNX A;  4CDQ B;  2QQJ A;  2JD9 A;  2E32 A;  1MQT A;  3BB6 A;  5I8T A;  3S0M A;  5JOX A;  4NWW A;  4GH4 C;  2MEV 2;  5FRE A;  3EJK A;  4OMC A;  2OYZ A;  2QCS B;  1WMD A;  4AED A;  4AQT A;  1WW5 A;  5FUI A;  1C8M 2;  3K46 A;  3Q9O A;  2CYF A;  3O5S A;  1ZRE A;  1OVP A;  4LTA A;  4LIV A;  4HKW A;  2A6Z A;  1CAV B;  4OUL A;  5JCT A;  3ZSM A;  2JDP A;  1LJ7 A;  2Q8O A;  1NCQ A;  1E5H A;  1SDW A;  1ZZC A;  2EID A;  2ZMK A;  3VHN A;  4BB3 A;  2PN5 A;  3IPV A;  4FPO B;  4Y20 A;  5LRS A;  1RUF 2;  1LEC A;  1U5I A;  1W8U A;  2A1X A;  3MPB A;  4OZX A;  3LA3 A;  3T2Q A;  1BKZ A;  3KV5 A;  4B1L A;  1VBD 1;  2BP6 A;  2F4L A;  5E6H A;  3WQ1 A;  2GAU A;  4Y5S A;  5AVP A;  3IMN A;  3MLL A;  1O5U A;  3DUI A;  1C4R A;  4WBB A;  5HXV A;  3B93 A;  4C90 A;  2ORX A;  4EWA A;  3VDB A;  3PDQ A;  3WOG A;  5FPA A;  4D8M A;  1ZBE 1;  2GAL A;  1ACC A;  1ZM1 A;  3UGG A;  4FPH A;  1W6O B;  2ZHL A;  1NQD A;  4GMP 3;  3AMP A;  2DVD A;  1BK1 A;  3FZ3 A;  2VUA A;  3A0N A;  1XPW A;  1W6N A;  3VZO A;  2RV9 A;  3KD4 A;  3U78 A;  3DYO A;  4XUN A;  3NVC A;  2D6K A;  4AAX A;  5CB7 A;  2WZR 1;  4I2O A;  5FZG A;  2VZR A;  2RVA A;  4AR2 A;  4A44 A;  4A41 A;  2IXK A;  1SMV A;  2C9A A;  2HWB 1;  2RS1 3;  2YMZ A;  2Y0I A;  1S1A A;  1NLQ A;  4M0N A;  4QPG B;  2ZEW A;  3HBK A;  4AFA A;  1V6J A;  3U1X A;  3CJI A;  2QZ3 A;  4PIZ A;  4OHY A;  2ZX4 A;  1ZBE 3;  2XLA A;  2C9K A;  1ND2 B;  3OBA A;  2Q1M A;  1H9W A;  3VKF C;  1LHO A;  4AAP A;  4FTE A;  4GMP 1;  1YCI A;  3AMN A;  4LXL A;  1RUI 2;  2VVD A;  5LCW L;  2B46 X;  3U4X A;  4A7Y A;  2Z69 A;  2PHU A;  5GZD A;  3ZMN A;  3ZFF A;  1OVS A;  3KMH A;  5C8C A;  2AC1 A;  3A0K A;  1TVG A;  4F83 A;  2YPD A;  3PJY A;  2BVB A;  2JDM A;  1RTV A;  5FYT A;  1W0O A;  3VBU A;  3IDC B;  4U36 A;  1E5I A;  2E63 A;  2VZU A;  4XFH A;  4XJ9 A;  1UKG A;  3USU B;  2H6C A;  1WCD J;  2E51 A;  2VCM A;  2HWB 3;  2RS1 1;  1PVC 1;  1EYB A;  1FMD 3;  2GME A;  2VUC A;  2KM2 A;  3I2G A;  5GM0 A;  4LK7 A;  3AXE A;  4FPC A;  5F37 A;  3LB9 A;  2DVB A;  1UU4 A;  3FBM A;  3ZN6 B;  3IMM A;  4NIG A;  2GNM A;  3O1P A;  1G9F A;  3H3L A;  2YGL A;  1TQ5 A;  3AKR A;  2VMC A;  4NRP A;  4IEY A;  2QQL A;  1YFU A;  3IWZ A;  3LEM A;  1MZ5 A;  3F2Z A;  2FQP A;  1EUU A;  1QOS A;  2RR1 1;  3HJR A;  3VBU C;  4DUV A;  3EXU A;  2LW8 A;  3O1O A;  1RUI 1;  1S0B A;  4DY3 A;  5FPX A;  1UF2 C;  2ETE A;  1WCS A;  3FHQ A;  4LA3 A;  3SLI A;  4Y1Z A;  1U5Z A;  3N9Q A;  2FMY A;  4BM8 A;  4Y1V A;  4XAB A;  4XUP A;  4COZ A;  4D7Y A;  1QQP 2;  5JWP A;  1FPN 3;  1JZ4 A;  2YBK A;  5T5J A;  3IBM A;  1RC6 A;  5LBC A;  2C24 A;  1AR8 1;  3VZK A;  4CPB A;  2YU1 A;  3CO2 A;  1PX4 A;  3AMH A;  2G1M A;  5BNO B;  5GLT A;  3I4I A;  5DG1 A;  3ZXE A;  2HWB 2;  4ONU A;  5F5A A;  1CIY A;  1DIW A;  1WME A;  2ZHK A;  5CFC B;  5IFP A;  2ZCW A;  1LGB A;  4LHK A;  5K8S A;  4QQP A;  1G9C A;  5DUW A;  1L3J A;  1WA6 X;  3IN9 A;  4N53 C;  5KHH A;  1XSR A;  2ERF A;  2J22 A;  4CEW B;  4RFT 0;  4E2Q A;  4URA A;  1N1V A;  4I3G A;  1HQL A;  4D6S A;  3I49 A;  3DPR B;  4JAA A;  5DMY A;  1GYK A;  5IVJ A;  4IUG A;  2RR1 3;  3JD7 3;  2LS6 A;  3M3I A;  4N90 A;  3T0D A;  1OF3 A;  1PIV 1;  2FDJ A;  3IPV B;  4LHS A;  2YXS A;  5A3T A;  2ADD A;  5L73 A;  2OW4 A;  2ZKL A;  4FO9 A;  4J25 A;  5JVV A;  4M3C B;  4XIK A;  5AFB A;  5J09 A;  5HCA A;  1BEV 1;  2B39 A;  3AZY A;  1W9W A;  4LQR A;  2RMU 2;  4GB3 3;  4LIU A;  2EXH A;  1TMF 3;  1OFN A;  2Z5W A;  3DEM A;  1POV 0;  1LOA A;  1JOP A;  1HB1 A;  1VAM A;  1X33 A;  2WYS A;  3WIN E;  4QQO A;  1OUR A;  3AYE A;  1GNZ A;  1JZ2 A;  3MIE A;  3T09 A;  4AGR A;  5KR7 A;  5A3O A;  1JU3 A;  4Z07 A;  3ZFE C;  4XJZ A;  1OD5 A;  1MS5 A;  4LBL A;  5LK5 A;  3WDW A;  3ES4 A;  2BNO A;  1TE1 B;  1WA4 A;  5FBZ A;  2A71 A;  3BPS A;  1F5J A;  4XHX A;  3ZSJ A;  4UWD A;  1I1E A;  2VBB A;  3OD0 A;  1H2L A;  4RR3 A;  3H1M A;  2W2I A;  5FK7 A;  5J7M A;  4Q4Y 3;  1OLR A;  4LLO A;  4XCB A;  2JDN A;  4HN1 A;  2WAO A;  4IET A;  4A6S A;  1HB4 A;  2BTV C;  3FWE A;  1NY7 2;  2CAV A;  1OSG A;  3UES A;  1K42 A;  3AKS A;  2Y6J A;  1GFF 2;  1LHW A;  3ZYP A;  4S2H A;  4P9J A;  4Q4X 1;  2XVG A;  1OBN A;  3LPF A;  2WA3 A;  2FCV A;  2BDR A;  2RS3 1;  3NNJ A;  4K8R B;  5K0U C;  4YG0 A;  3C7O A;  1QJX 1;  5KXB A;  3KCC A;  3KM5 A;  5DAP A;  3MLJ A;  1S4C A;  1LTE A;  3ZXA C;  3A4U A;  1RJ8 A;  4Q4W 2;  3K48 A;  4AFC A;  1QNW A;  4YFZ A;  3D8C A;  2KR2 A;  2YC2 A;  1HRV 2;  2H0B A;  2LTN A;  5JR7 B;  4AGG A;  3KB5 A;  1U12 A;  4OFG A;  3SCF A;  4AEM A;  2JEN A;  2A6X A;  1RUJ 3;  1SLC A;  2CY6 A;  1ZRC A;  1JBC A;  3K3N A;  1BZW A;  4JGZ A;  1D4V B;  2CU5 A;  3U07 A;  1GQG A;  1ZZ9 A;  2RJK A;  5A7Q A;  4FOQ A;  5EJZ B;  4MXW A;  2VOK A;  1IZ3 A;  3ZN6 A;  2B4K A;  1S0C A;  1S0D A;  4PT6 A;  3T4H B;  1NQJ A;  2EAL A;  2VNR A;  5A1F A;  1O3T A;  2AEY A;  3TAY A;  5LA0 A;  5IK7 A;  2OVU A;  1CZV A;  4QM9 A;  1I5P A;  5C9A C;  4LBO A;  3RMY A;  3FMG A;  1FYU A;  1VRH 2;  3GM8 A;  4NPL A;  1AYM 3;  3MIB A;  4BME A;  2GU9 A;  2A7A A;  2ZX3 A;  1F4H A;  4CA9 A;  4OMD A;  1Z7S 3;  4E9K A;  5C3O A;  1LRH A;  1NXD 1;  1OPM A;  1BMV 2;  4X8P A;  3TB0 A;  1UY4 A;  5I8Y A;  3C7H A;  3OEA A;  4W65 A;  5GAL A;  5JAX A;  3ZDV A;  3VZN A;  5JZG C;  1RUD 2;  4KNC A;  1K5M A;  5FXV A;  3ZIW A;  4Q4W 1;  1O91 A;  2BGP A;  3WT3 A;  2RM2 1;  1GKB A;  1HRI 2;  4A4A A;  3TEX A;  2OX0 A;  4HN0 A;  1POQ A;  3UGF A;  4OI2 A;  5A7W A;  2BYV E;  2VCA A;  3I7D A;  1W03 A;  3U11 A;  3AJZ A;  3ZXG A;  4PLM A;  4LKS A;  3V0B B;  1NLS A;  1MS4 A;  1O3R A;  1PGW 1;  3RPQ A;  5IT6 A;  2W1W A;  1DZT A;  1UQX A;  2X5I C;  4CEW A;  1QEX A;  3T3Y A;  1OQD A;  3III A;  4MXV A;  4IE7 A;  3FJS A;  3NAP A;  4AQ6 A;  3PMS A;  1Q8O A;  2ATF A;  2YDE A;  3R4D B;  4DQA A;  4Z2A A;  4XFA A;  3CJX A;  2PHT A;  4IDZ A;  2QUO A;  4HKL A;  3V56 A;  3BTY A;  1WW6 A;  2VZO A;  4G4F A;  5A7O A;  3ETP A;  2ID4 A;  4Q0S A;  2TNF A;  4QGN A;  1DBN A;  1RUC 1;  5GZC A;  2G9Z A;  3LEI A;  4B7K A;  5LEK A;  2QQN A;  4N9I A;  3GDB A;  1V70 A;  3S7E A;  4Q8K A;  2O8Q A;  3VBF C;  4AQ2 A;  1ULE A;  3RYP A;  1W2T A;  3O14 A;  4QQ2 A;  4IL7 A;  2CAU A;  1RUE 3;  3ZFG B;  1XNK A;  2ZMN A;  1CPM A;  2I74 A;  1BBT 2;  3HT2 A;  3OUJ A;  4AHY A;  3HR9 A;  5DDJ 2;  3A23 A;  1W28 A;  2QVS B;  2ZPX A;  1HRV 3;  2OPW A;  3LFM A;  3ILF A;  4GWN A;  4OUM A;  4WZF A;  3LKJ A;  3OGG A;  2ZGM A;  2DVA A;  3B7M A;  2R07 2;  3N7M A;  3UV9 A;  2E26 A;  1FNZ A;  3AMM A;  1DGW A;  3BUC A;  1OLQ A;  2FDH A;  1UU5 A;  3FFQ A;  3QH6 A;  2BGC A;  3A21 A;  4AVB A;  1S0G A;  4HK9 A;  2AAC A;  5CBL A;  1ENQ A;  2WFP A;  1QJY 3;  3F95 A;  3WQ7 A;  4ZU7 A;  3WLU A;  1SAC A;  2JB8 A;  3D4K A;  3E5X A;  4PBP A;  4OI1 A;  4CDW A;  1R08 2;  2WFF 2;  4JGY A;  2XQX A;  4KBZ A;  2EXK A;  1FAY A;  1GQP A;  1QKQ A;  5F3E A;  5FYY A;  1JHJ A;  1LB2 A;  1AF9 A;  1D2S A;  3W59 A;  1SLB A;  3RZH A;  2JE9 A;  1HXS 2;  1OA2 A;  1H8V A;  4LO8 A;  2GC0 A;  1KJL A;  4QPW A;  5BXX A;  5ACA 2;  3DF0 A;  4XQD A;  5C5U A;  4R4X A;  1JYX A;  1Y9M A;  3RJR A;  2A70 A;  1BVP 1;  1PNF A;  4LK6 A;  4FAH A;  3OPZ A;  5DZG A;  1K3I A;  1QJU 2;  1RIT A;  2VZQ A;  1GUI A;  3B69 A;  2ZGL A;  3PUQ A;  2JIC A;  4JQR A;  5A32 B;  4DUX A;  1SCS A;  1S0J A;  2ET1 A;  2KD7 A;  2XBO 3;  3KQ4 B;  4HSJ A;  4JTO A;  4H55 A;  3OUH A;  2KXL A;  3ZN4 A;  2EA7 A;  4XTM A;  5DUV A;  1S0E A;  3MYX A;  5AC9 2;  1XRU A;  2RS5 2;  3HT1 A;  4ITC A;  4HAN A;  3DEC A;  2XVL A;  1QJY 1;  4NJ4 A;  1OT5 A;  1AR6 1;  3UJQ A;  4QMA A;  5C3Q A;  1CES A;  1ENS A;  1NCQ B;  1YUD A;  4J1X A;  3S7I A;  2I45 A;  3IB3 A;  5BV6 A;  4CDX A;  2DUQ A;  2AUY A;  5F2W A;  5I8S A;  4WV8 A;  2CWS A;  3OD4 A;  2CWM A;  4Y22 B;  4LOT A;  2R06 1;  1P8J A;  3M7A A;  3U37 A;  1VRH 3;  4M0H A;  5APA A;  4XFF A;  5IAT A;  5SV5 A;  2QQU A;  3WNM A;  1UW8 A;  2JG8 C;  4XBQ A;  5FZC A;  5K4L A;  1STM A;  1K5M B;  1AR8 2;  1RMU 3;  3E6D A;  3X29 B;  1C1L A;  4Q4Y 2;  2HWC 3;  3K77 A;  2RJ2 A;  4D7T A;  1D4M 3;  5K0U B;  3MDP A;  2XUM A;  4JC1 A;  1Q8Q A;  1J1T A;  1EUT A;  2ZGT A;  4FP2 A;  5D21 A;  5A7W B;  1OLM E;  4XC9 A;  3NV4 A;  4FPK A;  5GLZ A;  4AG4 A;  3WF0 A;  4YW7 A;  5EYX A;  2HWE 3;  5BNN B;  1QF3 A;  2UUR A;  2C5D A;  1JYW A;  1S0F A;  1PZ7 A;  2VNV A;  1QMJ A;  1LGC A;  2Y6F A;  2YC4 A;  1EY2 A;  2J1R A;  2P3I A;  4UFH A;  3I97 A;  1PVX A;  3IDA A;  3JBG 3;  4QPG A;  4XYX A;  4BXS V;  3HVD A;  3C7G A;  4TN7 A;  1G9B A;  3VBS A;  1UZY A;  3FHI B;  1TMF 2;  2ZZQ A;  4Y4Y A;  5FZE A;  5FZB A;  2PAE A;  1AX0 A;  4QHO A;  3JXS A;  3D5O A;  4BU2 A;  4Q0Q A;  5ACA 1;  2Y26 A;  1FMD 1;  1VB4 A;  2ET7 A;  4FPE A;  2P37 A;  2XXZ A;  4C8D A;  1DLL A;  1QJU 1;  3WY6 A;  4DUW A;  3GZU C;  2EAK A;  5FXX A;  5C8C B;  4BQW A;  4JDN A;  5IVE A;  1MAC A;  4XDO A;  4COY A;  2YRO A;  4MH0 E;  2IWG B;  3ELN A;  2JIG A;  3CEW A;  4YG6 A;  2VH9 A;  3H7J A;  4PCR A;  4ZZ8 A;  5FWJ A;  4PHZ A;  4OI4 A;  1LOB A;  4ZKT B;  3H8X A;  3RZJ A;  2YY1 A;  1PMJ X;  2ZZJ A;  5DAQ A;  4QX2 A;  4TYS A;  1LEM A;  2RDQ A;  3AKQ A;  3MW3 A;  5CZK A;  5FYM A;  3ZXL A;  4B8E A;  4YAR A;  1C8M 1;  1HQN A;  1A8D A;  2VMH A;  4I0W B;  3WF2 A;  1JZ8 A;  4XJW A;  4BOW A;  3URF A;  3N9O A;  2WNE A;  4OHV A;  2NMO A;  3H0O A;  3Q8C A;  3S30 A;  3KV6 A;  3GCX A;  3PVB B;  4GQ7 A;  4X8N A;  5C70 A;  1RUF 1;  2D40 A;  2F6B A;  3KGL A;  4LBQ D;  5E1R A;  2ARA A;  4S2G A;  1MVQ A;  2R0F A;  2IXJ A;  4UBG A;  3WP4 A;  3BN6 A;  2X05 A;  4EQV A;  5FZ7 A;  1IPS A;  1WGP A;  2OKX A;  5AVA A;  1QOO A;  3TN9 2;  4GXL A;  1G9D A;  2DVG A;  2V4V A;  1UZ0 A;  1XB9 A;  2CGO A;  3HD8 B;  3SXW A;  5LK7 B;  3NO8 A;  2P3K A;  2YB7 A;  2DCZ A;  4XOG A;  1QH7 A;  4OHX A;  3VKN A;  4CCO A;  4P9Y A;  2HEV F;  1BLZ A;  1QIQ A;  2XHN A;  3KGZ A;  1RIN A;  4S2F A;  1QY4 A;  3ZXF A;  1UYP A;  3J26 N;  2W91 A;  1YFX A;  3LDB A;  2V4A A;  1V6L A;  3KV9 A;  4BJ0 A;  1TMF 1;  4AI1 A;  3WDX A;  2R49 A;  3UKT A;  3OBZ A;  1JOB A;  4Y5Z 0;  4D6Q A;  1Z7S 2;  2PXJ A;  4B4R A;  1G86 A;  2RDS A;  1XND A;  5G05 L;  1NG0 A;  4HMZ A;  4L99 A;  2ZGU A;  4EN7 B;  4WM8 A;  1Q8V A;  1ALY A;  1O5L A;  1Z0H A;  3BPZ A;  2WAB A;  4K9S A;  1UCX A;  4OYU A;  4BQ4 A;  1X50 A;  1ONA A;  2LM3 A;  4TTG A;  4CP0 A;  3OY8 B;  2EIG A;  5FUP A;  2JDK A;  2WUH A;  3QAC A;  1RUI 3;  4I02 A;  4QXB A;  5L9B A;  2BWA A;  1FOD 1;  2XDV A;  4COU A;  4AI0 A;  3ZYH A;  3UYJ A;  4K21 A;  4LE4 A;  5A1A A;  2QQO A;  4Q4V 2;  1CAW B;  1W8T A;  4QKN A;  1FPN 1;  1TNR A;  2QDR A;  4NRO A;  1QU0 A;  2Y64 A;  4AI8 A;  3VKO A;  5KXD A;  1AVB A;  2DCK A;  2RS1 2;  3VHP A;  4UW3 A;  3U10 A;  4Q4V 3;  4CEY C;  4A7K A;  3VBR C;  3EQE A;  4EN6 B;  1CR7 A;  4DXZ A;  2V5Y A;  4QPG C;  4RQP A;  3WG2 A;  2WQZ C;  4DMI A;  5IK4 A;  3DN7 A;  2P1B A;  3H3Z A;  3SQO A;  3NNM A;  5CFC C;  2WNU B;  4AE2 A;  1RHI 2;  5GZE A;  4L92 A;  2W3J A;  1QJZ A;  3RG0 A;  3CDZ B;  2OQ7 A;  1OQ1 A;  3PTR B;  3JD7 1;  4Q29 A;  1CGP A;  5KXE A;  3GF6 A;  2RE9 A;  3QOP A;  2Q8D A;  1Y9G A;  2TBV A;  4YVS A;  1PNG A;  1QXP A;  5IYY A;  4X6R B;  1BEV 3;  2V72 A;  1UZZ A;  4KGG A;  5IVB A;  2BPA 2;  4GAZ A;  4MGY E;  1UYZ A;  3SCH A;  3D0J A;  1UY2 A;  4GB3 1;  2V73 A;  4JV4 A;  2VOX A;  4XE9 A;  3TNQ A;  1JMU B;  2YV8 A;  5LBB A;  1SLT A;  2JDY A;  2WBK A;  2LRP A;  4GH4 A;  4Q4V 1;  2ZGN A;  3FHA A;  1VBB 2;  2D5F A;  3MIC A;  5FZK A;  3TEZ A;  5FZO A;  3DXT A;  3O1M A;  3E6C C;  1C3H A;  2KA3 A;  5FP8 A;  1YQC A;  2WWU A;  4FTB A;  2VOT A;  4K40 A;  4MG2 A;  2BNN A;  4RGG A;  1Z7S 1;  3RZG A;  1W2U A;  5LY2 A;  3VBO C;  2DU1 A;  3JZV A;  2PLV 3;  4Z82 A;  4YW1 A;  4MXW B;  1EV1 3;  5JIA A;  2DTW A;  1MPX A;  5C3P A;  1FAT A;  1L7L A;  5A80 A;  4GJY A;  3CMG A;  4C91 A;  2VD7 A;  2VMI A;  2VMG A;  4LBQ B;  4QPI A;  1VMF A;  1XU2 A;  2ARE A;  1BQP A;  5LY1 A;  5H9S A;  4OQ8 A;  4QXK A;  5L9R A;  5FIX A;  4OHZ A;  5FCC A;  1N3O A;  3NW4 A;  4AL9 A;  5FOJ B;  1KD7 A;  3Q8F A;  1DQ2 A;  1ULP A;  1MS1 A;  2GMM A;  1DZQ A;  2EF6 A;  2CDO A;  3PJQ A;  3VD9 A;  4DFS A;  1H8T C;  2RS3 3;  2YGM A;  5FQ0 B;  2VTX J;  3UKN A;  1XNA A;  4BQ1 A;  5JXH A;  1U0A A;  1W3X A;  4W50 A;  5T5P A;  1LU1 A;  4UI9 L;  3WG4 A;  4NID A;  4R8H A;  3I2D A;  1YLL A;  2E7T A;  3I3E A;  1E5R A;  5FYU A;  5F2S A;  5DUX A;  5IUQ A;  2QZ2 A;  4LO5 B;  2OPK A;  2PHL A;  2Z2S B;  3QLQ A;  3AP5 A;  2RS3 2;  3ZSE A;  2PLV 1;  1TME 1;  1IKP A;  2HWD 1;  3WQ0 A;  3VBH C;  3QCW A;  4ZON A;  5L19 A;  2XB6 C;  3NNF A;  1B09 A;  2B5H A;  3BCW A;  4CPB D;  3AVS A;  1OH4 A;  2Y60 A;  5FO7 B;  5A7P A;  3V65 A;  5J37 A;  3MF6 A;  3I59 A;  4TLF A;  4P9W A;  1X9P A;  3MIF A;  1VRB A;  4IE5 A;  4XPV A;  4IEV A;  2DU0 A;  3KSC A;  1X8M A;  5FV3 A;  1SBE A;  1HJG A;  4XUR A;  4XF4 A;  3VZL A;  5LWB A;  4ZZ5 A;  2JD4 A;  3MIH A;  3PUH A;  4P5H A;  2C4X A;  2GP3 A;  2WT1 A;  2VW1 A;  2ZA9 A;  4K3U A;  4ET7 A;  1C5I A;  2WNU C;  4KWL A;  4WM8 B;  3MBW A;  4XUO A;  1AYM 1;  3MEP A;  3J8F 2;  3AK0 A;  4N53 B;  4MAD A;  5FAX A;  1EP0 A;  1ZBA 3;  2ZBJ A;  2W1U A;  3CLP A;  5DQ0 A;  5BPX A;  3TRS B;  3JBG 2;  1LCL A;  5DPN A;  1DYP A;  3VBH A;  5C5T A;  2B9V A;  4YW5 A;  2QE3 A;  2XBO 2;  1MVE A;  3ZXJ A;  2QKD A;  3LPG A;  1OA3 A;  2WWS A;  5FZA A;  3THC A;  3DYP A;  1PO2 2;  4Q4W 3;  1VBE 3;  2GN7 A;  4XCA A;  1CAW A;  5GJ6 A;  2XJU A;  1W90 A;  5L7O C;  5DN2 A;  1N1Y A;  1VIW B;  2DFC A;  2VJX A;  4NHX A;  4RR3 C;  4AEJ A;  4QX5 A;  4DRV A;  2VZ3 A;  5AFE A;  4P9I A;  2IVJ A;  4ASM B;  2DUO A;  1AX2 A;  3WZ1 A;  3NV2 A;  4NPR A;  4ZPI A;  3PNA A;  4JDO A;  3POS A;  4YZ4 A;  2PA7 A;  2BUK A;  4XAE A;  4I0B A;  3FL7 A;  1CZT A;  4NRM A;  2EXI A;  3WF1 A;  3C7F A;  5D8A A;  1H2K A;  2NQY A;  3GBW A;  3HN3 A;  3I54 A;  3LIG A;  2ZGK A;  5F5I A;  4FBF A;  1RYY A;  4DIN B;  1GIC A;  4M00 A;  3HQR A;  2VUL A;  4YVS B;  2FDF A;  3ITQ A;  4JGY B;  2HWF 1;  4P02 B;  3HQU A;  3KV4 A;  1PMH X;  5FZ3 A;  3O1U A;  2GH8 A;  1E57 A;  3CQO A;  2DCJ A;  5SV8 A;  4FOY A;  3WV6 A;  2X10 A;  4AOC A;  1HKD A;  4EZ4 A;  2HWE 2;  3WW2 A;  4QB2 A;  1W6Q A;  2EIE A;  1AR6 3;  5IW0 A;  3MV1 1;  2RM2 2;  1J3Q A;  2E7Q A;  4XFB A;  5KHK A;  4CCN A;  5LRR A;  1VAL A;  1UYX A;  3BU7 A;  5FZ4 A;  3TN9 3;  3TWI A;  4IEZ A;  4GAL A;  1YC6 1;  2FZ1 A;  2WQ4 A;  2VOV A;  4QT6 A;  4KWU A;  4AF9 A;  1ND3 A;  1G6N A;  5H9Q A;  4QPI C;  1HIX A;  3KCX A;  1W9F A;  2UU8 A;  4F3J A;  3WF4 A;  2Y6H A;  4M4R A;  1RMU 1;  3FE5 A;  2VW2 A;  3IZO A;  4WVZ A;  1HXS 1;  2Q30 A;  4COV A;  4Q2F A;  4QPY A;  1JZ6 A;  4CZS A;  1K5M C;  1NY7 1;  4XVH A;  5JXJ A;  3FBY A;  5C8C C;  4GKX A;  2JDZ A;  4MOA A;  3MZH A;  1WZX A;  4BLJ A;  1UY1 A;  1SLI A;  2EIC A;  5F9T A;  2E53 A;  1CWP A;  2WII B;  1D0G A;  3O0X A;  3S6P A;  4R9D A;  2VVF A;  5C3R A;  3WR0 A;  1QH6 A;  3OGR A;  4A45 A;  5C9A B;  5C4W A;  4AI3 A;  2X09 A;  3OUI A;  4SLI A;  4J6G A;  1B35 A;  4DXS A;  2GSY A;  2PYT A;  2ZJC A;  1LOC A;  1ZBE 2;  1AR6 2;  4LUK A;  3MFC A;  1H4G A;  3LFI A;  4FOV A;  3K3O A;  4FAG A;  2Q8C A;  2XBO 1;  2Z42 A;  3GYD A;  2VXR A;  3POB A;  3QBQ A;  3THP A;  5BNN A;  1RUJ 2;  4CUB A;  4BCU A;  5JSP A;  5A3U A;  2YYO A;  3QD6 A;  3WDY A;  1H2M A;  2VGD A;  1DGW X;  5FZM A;  3WNN A;  3ZYG A;  2MPF A;  5A6Y A;  4H3W A;  5JPM B;  4IEU A;  2Q4S A;  2XL9 A;  2J1S A;  5IVF A;  4B3N A;  1AXK A;  1N3Q A;  3WDT A;  4K1Y A;  1UIJ A;  2GN3 A;  5GZG A;  2WWJ A;  4CVU A;  2R32 A;  4TXW A;  5FYI A;  3RRD A;  2R0H A;  2IC1 A;  4QQL A;  4S2D A;  1XNB A;  3AL6 A;  2W5F A;  3FN9 A;  3GNE A;  5JXI A;  1C8M 3;  3Q8B A;  1FI2 A;  3LA7 A;  1H2N A;  3OYW A;  5C7G A;  3DXU A;  3I2H A;  4QHZ A;  3AMQ A;  4NAM A;  3B9I A;  5LZ6 A;  1PVC 3;  1ZA4 A;  2I07 B;  3AVR A;  3K4A A;  3GBF A;  4FXG B;  2VZV A;  3HNY M;  5EQU A;  4YGB A;  5FMO S;  1D4M 1;  1LHU A;  3M3O A;  4K6B A;  1F8V A;  2WQ8 A;  2NPI A;  1VBB 1;  5FKB A;  1LHN A;  2JEC A;  3WEZ A;  3H1Y A;  1GMM A;  1PGW 2;  3ZKY A;  4RL7 A;  2HWE 1;  5FTT C;  2JG9 C;  5L9V A;  1GP4 A;  4AFB A;  3BAL A;  3NWK A;  1OOP B;  2XJQ A;  1X7N A;  5BNP A;  4N7I A;  2ZAC A;  1AL2 3;  4LKE A;  3VD5 A;  3ZYF A;  1VJ2 A;  1F4A A;  2G9F A;  1YRZ A;  1ZZ7 A;  3H1W A;  4LJH A;  4CDU B;  2XKP A;  2ZHN A;  1AYN 1;  1J58 A;  3ZYB A;  2Y6L A;  2D43 A;  3WNK A;  2AH2 A;  3BIE A;  1UIK A;  4F7Z A;  5FY0 A;  3IAQ A;  5LAT A;  3DV8 A;  3MFA A;  1YJL A;  4DEV A;  1MR5 A;  1HW5 A;  4Q0V A;  3RDI A;  3K2O A;  1CN1 A;  5K9Y A;  1JN2 P;  1AR8 3;  1RMU 2;  1KGY A;  1O8P A;  1VB2 A;  2X8K A;  1J59 A;  1QJU 3;  4P00 B;  2D97 A;  4A6O A;  3WNL A;  4YZ1 A;  3ECQ A;  2RR1 2;  4Y24 A;  1OFS A;  2GH2 A;  1V6I A;  1BJQ A;  3GBG A;  3VD7 A;  5GLV A;  1MZE A;  4CRQ A;  1GZT A;  1YO8 A;  4CDQ A;  3R0R A;  4DZG A;  1T6G C;  1H9P A;  2CNA A;  3ZSL A;  5DG2 A;  1LEN A;  1XYO A;  4YG3 A;  2VTF A;  3N9L A;  2WA4 A;  5LA9 A;  4JGZ B;  2RJL A;  3ZMO A;  5FO8 B;  3BI3 A;  3NL1 A;  3B00 A;  1PGL 1;  4SBV A;  2W1Q A;  3NJX A;  5CYY A;  5FMO L;  1A34 A;  4Z1V A;  4D0Q A;  3N7L A;  5T55 A;  3ZM8 A;  1QDO A;  4G9S B;  1ZZB A;  4XJ8 A;  4FT8 A;  4X6Q B;  3CNA A;  1AYN 2;  1XQN A;  4P9X A;  1LOE A;  4IEW A;  1Y7B A;  3TOJ A;  2ZAB A;  2AR6 A;  3AYD A;  5C4W C;  4UYB A;  2TUN A;  2YC0 A;  3JQX A;  3K75 B;  3EYP A;  2XHK A;  2ZOE B;  4GUL A;  5EJ1 B;  1SBD A;  4WM7 C;  1R1A 1;  4C1W A;  5DXD A;  3WDU A;  3C2U A;  1X36 A;  3ZSK A;  4ZU5 A;  2O1Q A;  1W8H A;  1GOF A;  4GJZ A;  2CHH A;  3LGR A;  3AJY A;  2E33 A;  2J1V A;  2BJS A;  4DS0 A;  4E4H A;  3D3A A;  3N7K A;  4CXY A;  4ZXE A;  5FR3 A;  1IS3 A;  3HWJ A;  3T4V A;  5IK8 A;  3BOW A;  5ISL A;  2DBI A;  5DUU A;  4FSJ A;  1AXZ A;  1WWY A;  4L11 A;  4CSW A;  1VMJ A;  4NO4 A;  1NOV A;  1GV9 A;  2BEO A;  3GGL A;  3I2J A;  4QDQ A;  2JKB A;  2LAL A;  5AC9 3;  2DCY A;  5HBA A;  2OXB A;  2RS5 1;  4JKL A;  2CGN A;  4JKK A;  3I2K A;  2P2K A;  2WNU A;  1ZBA 2;  5GLU A;  3R6S A;  1COV 2;  2CTV A;  4KI5 M;  1R08 1;  2WFF 1;  2DYC A;  1Q43 A;  1L7R A;  3NAP B;  2CDP A;  4ZS2 A;  4XAA A;  4P08 A;  1R1A 3;  1BEV 2;  3BU0 A;  2C26 A;  1AR9 3;  1ND2 A;  2WN3 A;  2VEC A;  2Q1F A;  3H3U A;  4YGD A;  1BXH A;  2FMD A;  2TEP A;  5FY8 A;  3DGT A;  2A75 A;  4IEX A;  2FHR A;  1CJD A;  1EV1 1;  2C0Z A;  2YU2 A;  3M4F A;  4LO6 B;  3T08 A;  2YZ4 A;  3HAG A;  5DZE A;  3AL5 A;  4NIA A;  1OA4 A;  3SC7 X;  3H8U A;  1GZW A;  1YFY A;  4UXA A;  2BFU L;  3WHT A;  2OT7 A;  3VBU B;  5CNA A;  4UF0 B;  3GAL A;  4NHL A;  4XBN A;  1DDL A;  2R04 2;  4UBH A;  3RZK A;  3LAG A;  4XEZ A;  3ZKU A;  5BNP C;  4LO7 A;  1DGR A;  4Y33 A;  5FYV A;  2BBV A;  5JLV A;  3AP4 A;  3MF9 A;  4Y3O A;  1I3H A;  1RVF 3;  3SH3 A;  5KHG A;  3LSE A;  3VHO A;  4XMI A;  4P5Y A;  1COV 1;  2NYY A;  4YGE A;  4E2G A;  3ENR A;  3SIS A;  3TBD A;  4GIQ A;  3VBR B;  4LBQ A;  4QPI B;  4P9G A;  2HWD 3;  4YFW A;  2H6B A;  3V0A B;  4GMP 0;  3POW A;  1R1A 2;  2R30 A;  5B2G B;  4MVT A;  1J3P A;  2NN8 A;  4LBJ A;  2VOW A;  1XSQ A;  1YNA A;  3GZT B;  4FPG A;  5JZG A;  4CDW B;  2RM2 3;  1ULD A;  3MUZ 1;  2A5Z A;  2VR4 A;  1TNF A;  3BTX A;  4CCC A;  2HKX A;  1JYI A;  2HJI A;  1GSL A;  3RZZ A;  2PHF A;  2VPV A;  1VPH A;  1BVV A;  1DQ0 A;  4K7J A;  4A42 A;  3B5L B;  3DKQ A;  1YXW A;  2K46 A;  2BGO A;  2UWC A;  4K8F A;  1WD4 A;  1V6O A;  2X5I A;  1RVF 1;  1VBC 3;  3BIW E;  3VDA A;  2GNB A;  1C57 A;  1JYN A;  4YLZ A;  4RS5 C;  3EB7 A;  4CP9 A;  4CP1 A;  3APB A;  4I0A A;  3NAP C;  2J1T A;  4XZP A;  5CAZ A;  1RJ7 A;  4XUT A;  5J98 B;  4HVR A;  3VBS C;  3SMH A;  2BQP A;  1LU2 A;  4CU6 A;  2JJ6 A;  4MUV A;  4JGY C;  2K0G A;  1I5Z A;  1PVC 2;  1DYO A;  2IUW A;  1VBE 1;  2VZT A;  4WM7 B;  3SKJ E;  4JHT A;  4XQW A;  1RUO A;  3N9N A;  4W6X A;  5FP3 A;  3U14 A;  1ZRD A;  4O65 A;  4K20 A;  4IEQ A;  5A6Z A;  4N53 A;  4Q0P A;  5F39 A;  3LEK A;  5FY9 A;  4Y22 A;  3V64 A;  2BOJ A;  4M3C A;  5FZI A;  2WJS A;  3HMY A;  3M1H A;  5A33 A;  4E4D X;  3GHN A;  5F5Q A;  3THD A;  5DAB A;  1ENR A;  1O7F A;  1SFN A;  1XC6 A;  1W2A X;  1W39 A;  2J1E A;  2IZW A;  1PO2 3;  4ZXK A;  3ZYJ B;  1JZ3 A;  2PEL A;  2BRT A;  5F32 A;  4AYU A;  1RUE 1;  5FUN A;  4DNY A;  3O7O A;  3WW3 A;  1C8N A;  5HV0 A;  4KWJ A;  4CEY A;  1S2E A;  1US2 A;  2HBT A;  2UY8 A;  4XDP A;  1C28 A;  3JCI A;  5DZF A;  3S5A A;  2OZJ A;  2VXJ A;  1VBA 2;  3H42 B;  5CFD A;  1TME 3;  5L36 A;  2QQM A;  3KS7 A;  2BNM A;  1K45 A;  1ULF A;  3P3N A;  3LDK A;  4GKY A;  5A3N A;  1KXG A;  3ABZ A;  1KDM A;  2DV9 A;  3T1L A;  1MEC 1;  1DQ5 A;  3L2Y A;  2W39 A;  2JWP A;  3WNO A;  4CU9 A;  4ZHN A;  5E16 A;  3UNP A;  3BKZ A;  1HN0 A;  2VG9 A;  2YFZ A;  3O1T A;  4XUQ A;  5EV7 A;  4RA0 A;  1GWL A;  4LE3 A;  4AHX A;  3N9P A;  5BNO C;  1WLC A;  4OCT A;  4RSU A;  1VAV A;  2ARB A;  4AVA A;  5A1L A;  3OGS A;  2WIN B;  1SLA A;  2VY0 A;  1GBG A;  2BW8 A;  5JPN B;  2A3X A;  2WS9 3;  1K5J A;  1PO2 1;  2VO5 A;  4GA9 A;  5FLJ A;  3TN9 1;  5HCF A;  1T2X A;  4OUS A;  2E9Q A;  1SFP A;  4TZD A;  3VBF B;  1EPW A;  4NII A;  1UX6 A;  5GKA C;  4IW3 A;  2LRO A;  4FFI A;  4CXX A;  5KBF A;  1JZ5 A;  2B42 B;  2PHD A;  3N7J A;  2P4E A;  2XOM A;  1WKY A;  3PHM A;  4YWA A;  4FTS A;  1NLR A;  1XE8 A;  4QX1 A;  4XIL A;  3VV1 A;  3A7Q A;  1PIV 2;  3ASI A;  5CAD A;  1GOG A;  5HCH A;  4H14 A;  5GLW A;  1GAN A;  2Z4F A;  2VUD A;  2JG9 B;  2WO1 A;  4RD7 A;  3ACF A;  4AXO A;  3WNP A;  4ARX A;  1YJK A;  2VQA A;  4HT1 T;  3O12 A;  1AHS A;  4P14 A;  3KWV A;  4YVW A;  1NZI A;  3RWN A;  5A3P A;  2DVF A;  2YBS A;  1CD3 G;  2CGP A;  2VBD A;  4FCA A;  2JB4 A;  4QKD A;  3KF5 A;  1FV3 A;  4CDU C;  1YEW A;  2WS9 1;  2XGX A;  3HQX A;  1LOG A;  5FYC A;  4JKM A;  3ZFG C;  5CKN A;  1ZRF A;  4BIS A;  1OXC A;  4QQH A;  5FPB A;  2XLF A;  2R06 3;  1AXY A;  4GZ9 A;  5FY7 A;  1LKN A;  2XL7 A;  3K4D A;  1W8O A;  4CCJ A;  2QJV A;  5EXO A;  4QD2 A;  5EHD A;  4XXP A;  2YPJ A;  4YM0 A;  2YBP A;  4ZU4 A;  1NCR B;  3RQ0 A;  4AI2 A;  1FV2 A;  1NYW A;  3KQR A;  4JGZ C;  3V0A A;  2XH6 A;  3RJ2 X;  1FX5 A;  4LR4 A;  3KHC A;  5JIU A;  4OUE A;  5CEH A;  4IV1 B;  1FNY A;  2HWC 1;  4PDW B;  2PFW A;  2RG4 A;  3ZOI A;  1RUD 3;  4YZ3 A;  4ES8 A;  2ZAH A;  1KFU L;  1OPO A;  3U4S A;  1WMX A;  1W3V A;  3T30 A;  4GB3 2;  5C9A A;  5FYZ A;  4QXC A;  1ASJ 3;  1RUG 2;  2QQW A;  3RVH A;  2XJP A;  1O3S A;  4IES A;  4AED C;  1KRI A;  1NE4 A;  1MEC 2;  3JQW A;  3OG2 A;  1YYN A;  4PF1 A;  5ERL A;  4RS5 A;  5HPO A;  4QM8 A;  4AQS A;  4YW6 A;  3VD3 A;  3PUS A;  1IS5 A;  1DQ1 A;  1UWW A;  2X5I B;  1O6U A;  1J84 A;  1RUG 3;  3GCW A;  3J7N A;  4CTE A;  5I91 A;  3VD4 A;  2WC2 A;  4HET A;  1TEI A;  1JXN A;  4CP9 B;  2ZS6 B;  3P3P A;  1X82 A;  3P5B A;  4KBB A;  1Y4W A;  3EMR A;  5CU1 A;  1O3Q A;  2ARC A;  3T2O A;  1N1T A;  3NKT A;  5EPA A;  2W9X A;  3AP6 A;  4Y1U A;  1URX A;  4CCL A;  4RGK A;  1LR5 A;  2VTX A;  2PQS A;  5DAW A;  1HQW A;  1MS9 A;  5ACA 3;  2FCT A;  5JDB A;  1VR3 A;  1HXS 3;  1RUD 1;  3AYC A;  1QGL A;  5M0T A;  3O1R A;  3AB0 A;  3R4S A;  2JIJ A;  5FKC A;  1JZ7 A;  4BE3 A;  4WVV A;  2D93 A;  4XZU G;  4JRL A;  4JQT A;  5F6K A;  2Y0O A;  4JX0 A;  4BQ3 A;  2A6Y A;  1WW4 A;  5KC6 A;  4OZO A;  4LOS A;  5A6Q A;  4XJA A;  3NJY A;  3WP6 A;  1FT9 A;  3EO6 A;  1ZRR A;  3OBT A;  4HFS A;  3G6J B;  1S2B A;  1SBF A;  4TWT A;  1PK6 C;  1XNT A;  5F8P A;  4CEY B;  4E8C A;  2HLE A;  1CZS A;  3IIA A;  1WUV A;  3N35 A;  1UNB A;  5CFD B;  1O4Y A;  4XF9 A;  3AZV A;  5FJK A;  1AYN 3;  4LEJ A;  5H9R A;  1BBT 3;  2AZ5 A;  1W6N B;  1OF4 A;  3ACH A;  1W6M B;  3N4M A;  2XUE A;  3PIG A;  3JB8 A;  1HRI 1;  3E5Q A;  4O61 A;  2HEY F;  2D98 A;  2N7G A;  4KGQ A;  3AZW A;  2ZML A;  4RQP B;  1W99 A;  2O0O A;  2FBE A;  2F4P A;  3NST A;  5FPU A;  1IG0 A;  5FMC A;  5HCB A;  1F31 A;  1W9S A;  4BMB A;  5F7U A;  4PLN A;  5EYY A;  3VZJ A;  4AW7 A;  1OUX A;  5J3U A;  1S2K A;  4YNI A;  1U5X A;  1SG3 A;  1H1I A;  3CJI B;  4LNV A;  4LPL A;  2WDB A;  1OLM A;  3L2H A;  1D4M 2;  2D3P A;  1V6M A;  2ZGP A;  2MEV 3;  4ERO A;  2LUW A;  1JS9 A;  3MV0 1;  3W5M A;  1R1Z A;  4YW3 A;  1JOJ A;  4XW3 A;  5FRA A;  2EIB A;  4QB1 A;  1BBT 1;  5FZ9 A;  4Z8B A;  2OZ6 A;  3J7M A;  4B4Q A;  5ANN A;  2AEZ A;  3E6B A;  5LAS A;  2ZX2 A;  4NVP A;  1HRI 3;  4HK8 A;  4MGK E;  2IXI A;  3FUQ A;  1RUC 2;  4IGP A;  1IGO A;  4FQ4 A;  3RWK X;  4Y26 A;  3ST7 A;  5A32 A;  1Q5O A;  2R07 1;  3BOD A;  5T50 A;  4BDV B;  1ODN A;  2GND A;  1W8W A;  3POE A;  1ASJ 2;  3WG3 A;  1F9K A;  4FOW A;  5FY4 A;  5JR2 A;  2D3S A;  3ZFE B;  1M4W A;  4MGT A;  1AYM 2;  4XAC A;  1UX7 A;  1YFW A;  3NJV A;  3POI A;  2J1U A;  1US3 A;  1AL2 1;  4QDR A;  4HSL A;  1NCR A;  4RN5 A;  2R7E B;  5FOB B;  4KG8 A;  3GZE A;  4LHN A;  2WNO A;  3ILR A;  3OOX A;  1RED A;  4IV1 A;  3OBR A;  3H8O A;  4AHZ A;  1Y3T A;  2P5B A;  3KT1 A;  5JI7 A;  4V2W A;  4OLL A;  1XE7 A;  4NWV A;  1VBC 2;  4XFI A;  1N3P A;  1Y9Q A;  4KH9 A;  3RGB A;  1RUE 2;  3ETQ A;  2IXL A;  4NAO A;  4MLO A;  4Q26 A;  4OI0 A;  5J36 A;  2W92 A;  1AR9 1;  2JG8 A;  1AR7 1;  3FFZ A;  5CFC A;  5F3G A;  3WUD A;  1IKQ A;  1UXZ A;  3J7H A;  4O7X A;  4Z2W A;  4LBM A;  3ME2 A;  4XET A;  2EAA A;  2R6Q A;  3WP5 A;  1VBE 2;  3ATG A;  2W0X A;  1SCR A;  3M3E A;  3OCP A;  4QX7 A;  5C8W A;  5FZ1 A;  4F8A A;  2WSV A;  5JUV A;  4LA2 A;  1QHD A;  5FXZ A;  4AVS A;  1GQH A;  1C5H A;  1UMZ A;  4L2N A;  2E7A A;  4OHW A;  1PM7 A;  5FK8 A;  2NP0 A;  1GWK A;  4CCD A;  1DGR N;  3I2F A;  1GWM A;  1NKG A;  2Y8K A;  1ULC A;  5B4X A;  2VZS A;  4J1W A;  3VBH B;  2EVX A;  3K4Z A;  1DFQ A;  2NZ9 A;  4L9B A;  2W46 A;  5D2A A;  4NE9 A;  4DB5 A;  3NNG A;  5FZL A;  4DXR A;  1W6P B;  2W95 A;  1VAK A;  4P9L A;  4QB6 A;  1CX4 A;  2BER A;  2ZTN A;  3FLT A;  1AR7 3;  3KT7 A;  4N8M A;  4WVM B;  3TNP B;  3T1M A;  1W0P A;  3FLR A;  3O0V A;  3LWC A;  3DL3 A;  4PIX A;  4AI9 A;  3PU3 A;  1H0B A;  3VKM A;  4N43 B;  3AFK A;  3LSD A;  1LOD A;  3ROU A;  3HIF A;  3LF7 A;  2D6O X;  3PUA A;  3LQC A;  4CE8 A;  4CP2 A;  1JYC A;  4BK5 A;  1XYP A;  2X53 S;  5AC9 1;  1RUN A;  1W06 A;  4YPJ A;  5CG8 A;  2RS5 3;  3HEI A;  5A70 A;  1UAI A;  1UU6 A;  2ORZ A;  5IFT A;  5D8A B;  4EN8 B;  4M4P A;  5A7S A;  1ZZ6 A;  3VBO B;  4BH9 A;  1H6X A;  1ULG A;  2QQV A;  4BWO A;  3GJA A;  5JZG B;  3LOB A;  1LGN A;  1UPS A;  3CZJ A;  1SPP B;  3BYW A;  1SDD B;  5EIY B;  1LAJ A;  1R09 1;  5FDB A;  4C0B A;  3B94 A;  3PTY A;  5I93 A;  1UD1 A;  3IT8 A;  4IND A;  4MET A;  5C3S A;  1W6Q B;  1ZVF A;  3OPW A;  5IWF A;  2MHF A;  5LA1 A;  2OUJ A;  1NX9 A;  1OUS A;  1H8T B;  2ZGR A;  2B45 X;  4LIT A;  1V6N A;  2VNO A;  3AC0 A;  3OSD A;  4IE4 A;  3AM2 A;  3J8F 3;  4MSV A;  1AL0 G;  5F5C A;  2VVE A;  5D8A C;  4YYO A;  1FXZ A;  3PU8 A;  2P34 A;  1Q8S A;  4FFF A;  2V09 A;  4AED B;  1DU3 D;  2A73 B;  4JRA A;  4LMF A;  3EHK A;  4BIO A;  3RS6 A;  1ZBA 1;  2R1D A;  4Y5T A;  4R52 A;  1X8E A;  2EXJ A;  2VM9 A;  4WM7 A;  4IV1 C;  3Q8A A;  4MZU A;  1F2N A;  3HNB M;  5FZ6 A;  1AR9 2;  5J48 A;  1W2O A;  4BQY A;  5FP7 A;  4UOJ A;  1PZ9 A;  4C1X A;  2BFU S;  3I2I A;  4HBN A;  1UZW A;  2JDH A;  2W68 A;  3SEP A;  4BQ2 A;  1MEC 3;  4E8D A;  3EBR A;  4QXH A;  2W94 A;  5JSR A;  5A3L A;  1IPJ A;  3I3Q A;  2JDA A;  1EV1 2;  2QNK A;  3UT0 A;  5KC5 A;  1VMH A;  5C4W B;  4NIH A;  2PLV 2;  1TME 2;  1Q8P A;  3LIH A;  2CSG A;  4IEP A;  3RFR A;  1KJR A;  5FZF A;  1NA1 B;  2ZEY A;  1ND3 C;  3RYR A;  3HNM A;  2O14 A;  3NV3 A;  4M3C F;  5DAV A;  3V0B A;  5FZH A;  5FLI A;  4G3Y C;  2QTW B;  4D94 A;  1HB2 A;  1AJK A;  2YG0 A;  3MGU A;  1MS0 A;  1NA1 C;  5B4N A;  2D6L X;  5FPZ A;  5EJ3 A;  4NHM A;  5FZD A;  5EP9 A;  2JEM A;  1S0I A;  2UYA A;  4QKB A;  1DCS A;  5CKM A;  5L7O B;  3KVA A;  2GNT A;  4BA6 A;  2ES3 A;  1NXM A;  1O4T A;  1U5Y A;  2VQU A;  4IE6 A;  2HWF 3;  4BXF A;  1HV1 A;  1WW7 A;  1W9Y A;  1WCU A;  2ZHM A;  3MIG A;  4EYU A;  3MPP G;  5FLH A;  2NLR A;  1ZX5 A;  3VBF A;  1B35 C;  1OI6 A;  1WBL A;  2RMU 1;  3ON7 A;  1M06 G;  3WUC A;  3FX3 A;  1UN1 A;  1POV 3;  2C1F A;  4QX3 A;  3WP3 A;  5KHJ A;  2YUE A;  3KF3 A;  3OYW B;  3PL0 A;  4KU7 A;  2SBA A;  3JB4 C;  4KQ7 A;  2HH9 A;  2PAK A;  3SEE A;  1UO9 A;  4WVM A;  5FWE A;  1XU1 A;  2Y6K A;  2XG3 A;  4NOT A;  4IER A;  1SFY A;  2PMW B;  4RYD A;  2DDU A;  1BK0 A;  1XYN A;  4W4Z A;  4YVW B;  3USU A;  1KEX A;  4AEK A;  2OQ6 A;  1CAX B;  1R09 2;  2WO2 A;  3JD7 2;  4Q0U A;  3RYK A;  4RHV 1;  2UYB A;  1SEF A;  4CUA A;  1KS4 A;  4MGQ A;  1H30 A;  2VW0 A;  4EWE A;  4JZR A;  3ZXK A;  3UET A;  4AGV A;  2VUJ A;  2ZGS A;  4KG0 A;  3NMB A;  1I9R A;  4JDM A;  1LOF A;  1UOB A;  3AP9 A;  1WLD A;  1QJE A;  5BNP B;  1QXR A;  4FPY A;  2XR4 A;  4NHK A;  5FZ0 A;  2WLP A;  4IGO A;  2WZR 2;  4QGM A;  3CU7 A;  3VBO A;  1GU3 A;  3PME A;  2OS2 A;  2PTM A;  4HVQ A;  1PGL 2;  3ZYR A;  1OD3 A;  1OOP C;  2RDN A;  1GZ9 A;  2E6V A;  4Q4Y 1;  1AZD A;  2JE7 A;  3JUU A;  5FBJ A;  2HBU A;  5CG9 A;  2DUP A;  1CAU B;  1V0A A;  5JOY A;  5I0U A;  2WL1 A;  1QXJ A;  3AX4 A;  5T5O A;  4D3W A;  1VBA 1;  4RS5 B;  3UJO A;  5IAX A;  2R06 2;  1T6B X;  1WCQ A;  5BNN C;  1LOF C;  1PX3 A;  1H8T A;  3K51 A;  4PDW C;  4PJY A;  4XFC A;  2JKX A;  2P17 A;  3VHR A;  3ZFF C;  4ATF A;  4MYE A;  1D0H A;  1UMI A;  1PO1 2;  4UFM A;  1MZ6 A;  1UMH A;  3RNS A;  4MGS A;  4XXA A;  1KIT A;  4ISQ A;  2B7Y A;  1HJF A;  3HBZ A;  4FVV A;  5BNQ A;  5J1X A;  2GC1 A;  2VL4 A;  3I59 B;  2VNG A;  3R4U A;  4QU1 A;  3SNM A;  1D7P M;  3PUR A;  3BTA A;  2WLQ A;  1IS4 A;  2WT0 A;  3I3D A;  4TSV A;  5CKQ A;  4Y4R A;  4AFD A;  3DPR A;  1PM4 A;  3ZPO A;  2VU9 A;  1TZO A;  3RZL A;  3CHX A;  1V9U 3;  5CIR A;  4CDX B;  1OKO A;  4UFI A;  5IK5 A;  4Q1R A;  3B01 A;  4XDQ A;  1N1S A;  3W20 A;  4ZS3 A;  4JCK A;  4W8J A;  2WYF A;  2GZW A;  4QU2 A;  3GJB A;  1N47 A;  4AVC A;  2DWR A;  3NKG A;  1H1A A;  1UYY A;  2ZXQ A;  3OGV A;  5E88 A;  4YZ5 A;  4NN0 A;  1NCQ C;  4AVT A;  1BHG A;  1XOY A;  1O59 A;  1VBB 3;  5DDJ 3;  3B9C A;  1H4H A;  2VME A;  1UXX X;  2W47 A;  3KHB A;  4LUM A;  4WVW A;  4AZZ A;  1IQA A;  3LCP A;  1W0N A;  2Y34 A;  3VKL A;  1QOT A;  1NA1 A;  5A3M A;  5K0U A;  3I3B A;  3CIH A;  1RUH 3;  3USS A;  3O1S A;  1RUG 1;  1IPK A;  1DQ6 A;  1W6M A;  1NZC A;  4I09 A;  5C6C A;  2MEV 1;  3W5N A;  1YI7 A;  4H7M A;  1PO1 3;  2W1S A;  5BUV A;  3KVB A;  3AXD A;  2GMP A;  3POY A;  2VZ1 A;  3WVJ A;  2A6V A;  5L7O A;  2XJV A;  3OF1 A;  4LKF A;  4JTN A;  2JXA A;  1WCK A;  3J9S A;  2AYH A;  4FPJ A;  4H2A A;  4DIQ A;  4EE2 A;  4U2A A;  4O9G A;  4MHU A;  2QDN A;  2L9L A;  4CEW C;  1JHN A;  4NPM A;  3RZM A;  2IFR A;  2CL2 A;  2PAM A;  2VMD A;  1VP6 A;  1HN1 A;  2BBA A;  3DCQ A;  4XFG A;  4QWN A;  4YM2 A;  3FC0 A;  3D6E A;  3HOB A;  3R05 A;  4YVW C;  3IKW A;  4IV3 C;  4R4Z A;  5EWS A;  3T2T A;  2RHP A;  1QNY A;  4ISR A;  5LA2 A;  5E89 A;  1NE6 A;  4M3C E;  4HOO A;  2NM1 A;  4EZH A;  1I6X A;  3KZ4 C;  4R9C A;  5KXC A;  1SQ4 A;  4EN0 A;  1O4Z A;  5FJH A;  3LOI A;  1BYH A;  2IVI B;  4UW4 A;  4BPZ A;  1Q56 A;  1W8F A;  3W58 A;  5T3N A;  1NAE A;  4LHL A;  2CV6 A;  2J7M A;  4UF0 A;  4PIY A;  4I01 A;  2DF7 A;  4BHP A;  2GP5 A;  3M8L A;  4HVO A;  3S5Q A;  5I0D A;  3ZO0 B;  5FXW A;  2FD8 A;  1CIW A;  2K9Z A;  3ALQ A;  4LO4 B;  3ZFE A;  1ND3 B;  4B7E A;  2MNG A;  2XQR A;  2DCT A;  3KCY A;  4O9E A;  4XMA A;  5FP4 A;  1OMI A;  1W2N A;  1ZYB A;  2BZD A;  4MV2 A;  3M3C A;  1LNS A;  3C7E A;  4ASK A;  5IVV A;  3P1I A;  3SHR A;  2D5H A;  4FPF A;  1W8N A;  2P6C A;  1UKR A;  3W9A A;  5FY5 A;  4B1M A;  1OHF A;  1F5F A;  1JUH A;  5F1R A;  1V00 A;  4BZ4 A;  2VQT A;  4HKO A;  2WZE A;  4NR1 A;  1W05 A;  4I30 A;  2A6W A;  2ZAA A;  4HG6 B;  3MLK A;  4ORF A;  4W6Y A;  4WZC A;  1KS5 A;  4CCE A;  4ES9 A;  2XML A;  3VL8 A;  3TEY A;  2Y38 A;  4I3P A;  3POG A;  1WMF A;  5CA6 A;  1QJX 2;  1YQ2 A;  1DG6 A;  1Z78 A;  2BV4 A;  2Q0A A;  3LDR A;  4Y1Y A;  4ZY9 A;  1MQT B;  4QHB A;  3PVE A;  2XJT A;  1HLC A;  1UY3 A;  5G04 L;  2BWC A;  5ANQ A;  1WLW A;  1J1L A;  4BIF A;  2Q1Z B;  2VAU A;  1R08 3;  2IXH A;  2WFF 3;  2WO3 A;  3DPR C;  4FFH A;  2NMN A;  4JVA A;  3WCR A;  4AWD A;  3ORJ A;  1QJY 2;  4GD4 A;  1W9T A;  4MGZ E;  4CCM A;  2HEW F;  4YRD A;  4A3Z A;  2XJR A;  5FMD A;  5FYB A;  1OKQ A;  1CAV A;  3M2M A;  3LA2 A;  5EZW A;  2BVV A;  3AZZ A;  3MUY 1;  5H9P A;  3RI9 A;  3UKV A;  1ND2 C;  3C3V A;  4FP3 A;  2R04 3;  4PI2 A;  1HB3 A;  4BLI A;  3A22 A;  4UFL A;  2WNV B;  4CCK A;  3P6B A;  4Y20 B;  4ATE A;  5A6X A;  1YWK A;  1R64 A;  4DO0 A;  2ARX A;  3N9M A;  5FYS A;  2D3R A;  4FQZ A;  4URT A;  4E2S A;  2WZP P;  1XBF A;  1ZA7 A;  2HWF 2;  3GHM A;  2FDI A;  4A7Z A;  1EPZ A;  1RL3 A;  2WRA A;  2ZGO A;  5FMB A;  5J96 B;  3IDE A;  2Y33 A;  4R9A A;  4GWJ A;  3Q8E A;  1W6P A;  4DXT A;  4XHB A;  1JOD A;  4MGI E;  3B3Q E;  2K2S A;  3H50 A;  3DYM A;  3CF6 E;  1RXG A;  1LES A;  1W6O A;  2H0V A;  4Y1X A;  5D1I A;  4COW A;  5FZ8 A;  4HZF A;  3ZR6 A;  3VUO A;  4PI0 A;  4QX8 A;  3ZFG A;  5FP9 A;  5I0S A;  5JXG A;  3T0A A;  1LHV A;  3OB8 A;  1COV 3;  1VBD 3;  3WX5 A;  4BQX A;  3U0Z A;  2R04 1;  2ZX0 A;  4N43 C;  5GZF A;  3RI8 A;  2XPJ A;  4RHV 2;  1YIP A;  5FY1 A;  4IXL A;  3BTZ A;  4DOU A;  4FI9 A;  4ASL A;  5LBF A;  4HLT A;  2HWC 2;  2P3J A;  1O8S A;  2YFU A;  2ZGQ A;  4IQP A;  2VCC A;  3D82 A;  2DTY A;  2XKO A;  4LLF A;  2VCB A;  3J8F 1;  4IV3 A;  5A7N A;  2PQQ A;  2WSU A;  5F3I A;  3AKP A;  5JOZ A;  1CX1 A;  1CON A;  1UOG A;  1HV0 A;  4YM1 A;  5CFD C;  1JUI A;  1SPP A;  3JBG 1;  4XJU A;  1OQE A;  2VMF A;  3I2O A;  3BOP A;  4HPK A;  2D44 A;  2XWB B;  1NT0 A;  2WZR 3;  3H8R A;  1C1F A;  1J3R A;  4D7S A;  2B9U A;  2V5D A;  3BGA A;  1VBC 1;  3O0W A;  5TSW A;  3ZFF B;  3ZPY A;  4DEQ A;  3OEB A;  2RDR A;  2AGS A;  3CKH A;  4XQ4 A;  1IS6 A;  4GH4 B;  3UGH A;  1ODM A;  5CIS A;  3WQB A;  1Y43 B;  3SH5 A;  3OGJ A;  3PIJ A;  4FXK B;  1JH5 A;  3GZA A;  3I3M A;  5ABJ C;  2XON A;  4EJR A;  4N7U A;  1NCR C;  5EFU A;  2JDU A;  2W08 A;  5HV4 A;  4IEO A;  1K12 A;  1HDK A;  1VE0 A;  4BK4 A;  2XWJ B;  2B8M A;  1A78 A;  4AVV A;  5C33 A;  3WXP A;  3OJB A;  3MI8 A;  5FPL A;  5JOW A;  1DF0 A;  3T0B A;  3RSJ A;  5JSO A;  3RMX A;  1F15 A;  1OC1 A;  4PBO A;  5HI0 A;  1ZZ8 A;  3IDB B;  5DAX A;  4KL1 A;  1KFX L;  3MID A;  4YW4 A;  3VDC A;  5JMC A;  4UW5 A;  1EAH 2;  5C71 A;  5I0R A;  4L0P A;  1R09 3;  1RUF 3;  5T52 A;  2WNV C;  2SLI A;  4B4P A;  3N36 A;  2QFE A;  1REF A;  5F3C A;  4CU8 A;  2P3Y A;  3KLS A;  3NQH A;  3D0S A;  2OUH A;  1RVF 2;  2G9G A;  3ZYI B;  1X9T A;  1SHW B;  2D7F A;  3NNL A;  1FPN 2;  4CYD A;  2D6N A;  4XF3 A;  5BNO A;  2RMU 3;  5IHR A;  2VZP A;  1W8Z A;  2DUR A;  1IG3 A;  2P6H A;  3ACL A;  1D2Q A;  2XVK A;  3MW4 A;  3ZLI A;  4Q4X 2;  4BQ5 A;  1RIR A;  2O8O A;  3IM0 A;  4AK3 A;  4YZ2 A;  3FLP A;  5JMO A;  3O1V A;  1ZRI A;  3VBS B;  2WNV A;  3M3Q A;  3OTF A;  1H1M A;  2R1B A;  3WCS A;  3PLQ A;  1XNC A;  2Q5T A;  3LEG A;  4Q4X 3;  4RHV 3;  1DZR A;  4QDS A;  3ZXD A;  4E27 A;  3M70 A;  1DYK A;  1RGS A;  3ZDS A;  3S57 A;  3CJI C;  1BMV 1;  1A6C A;  3BVC A;  1GNY A;  3ZR5 A;  2VE1 A;  3NJZ A;  4K1Z A;  5IAV A;  3N3H A;  3U75 A;  3MHZ A;  1ULO A;  1GZW B;  3VB9 A;  1L7Q A;  2VC9 A;  2ILM A;  1NUK A;  1QDC A;  2OA2 A;  1UL9 A;  2FDK A;  1PIV 3;  4XIO A;  1UZV A;  4PLO A;  1FOD 3;  1CAX A;  3OPT A;  1AR7 2;  1CPN A;  1GP6 A;  3MW2 A;  1G8W A;  1YQ6 A;  2Z79 A;  3SCG A;  3FUO A;  3PVO A;  3E5U A;  4R9B A;  1JYV A;  4OVE A;  5E8A A;  2XLG A;  1CQ9 A;  3WW1 A;  1QQP 3;  5CVR A;  3T2P A;  3WDV A;  1WBF A;  2D6P A;  2I2S A;  2C6S A;  3AZX A;  4LBN A;  4RR3 B;  5LBE A;  1UOF A;  1ZNP A;  1DQ4 A;  1JU4 A;  2DFB A;  4M01 A;  4KMQ A;  4W6W A;  1VBA 3;  3VDD A;  3VBR A;  4KU8 A;  4RQP C;  5LW9 A;  2E31 A;  4N9H A;  1RUH 2;  1YHF A;  1PK6 A;  1ASJ 1;  2ZKN A;  4IV3 B;  1G9A A;  1V6K A;  1JI6 A;  2J1A A;  2G4I A;  3VN4 A;  4YM3 A;  3ZVX A;  1QWR A;  3CBN A;  1POV 1;  3CZU A;  4HPK B;  3LD8 A;  4NHY A;  1CAU A;  4ARY A;  4CUG A;  4UT5 A;  1JW6 A;  4WM8 C;  2PHW A;  5I0T A;  3MO4 A;  3WG1 A;  4E4Z A;  2ADE A;  2BU9 A;  3J7L A;  5ABJ A;  1SLL A;  1UY0 A;  4PF5 A;  1XJA A;  4NRQ A;  1A8M A;  4CDW C;  1EAH 1;  1G7Y A;  2HYK A;  1KDK A;  2UWA A;  2Y6G A;  3VGI A;  2ZX1 A;  1DLC A;  1QQP 1;  2WAA A;  4LT5 A;  4BYY A;  2QQP A;  2HWD 2;  2WS9 2;  2UWB A;  2W52 A;  4MHR A;  5A3W A;  2WT2 A;  5IVY A;  5HXM A;  3TEW A;  3SH4 A;  1IHM A;  1LUL A;  3L9J T;  2FDG A;  1JYT A;  1QJX 3;  5BY5 A;  5DDJ 1;  2DBN A;  4EV0 A;  3PVN A;  4CXW A;  4FFG A;  1QJF A;  2VQ0 A;  5IJR A;  1ENX A;  3VL9 A;  1GNH A;  2G19 A;  4LKD A;  4D6R A;  1PGS A;  2WN2 A;  4V1P A;  3DKW A;  1RUH 1;  4YSF A;  4H7L A;  1CVN A;  1RUJ 1;  4QAW A;  2GC2 A; 
#chains in the Genus database with same CATH homology
 5FXV A;  3AVS A;  4D6Q A;  5ANQ A;  5F5A A;  3ZPO A;  2PXJ A;  4QXH A;  5A7P A;  2OX0 A;  3N9N A;  4GD4 A;  5FP3 A;  1VRB A;  4CCM A;  4URA A;  5A7W A;  5FZC A;  5F39 A;  3K3O A;  5FV3 A;  5K4L A;  5FY9 A;  4CCL A;  5FYB A;  4D6S A;  3KV5 A;  5FZI A;  2Q8C A;  5LWB A;  4GJZ A;  5FZF A;  5IVJ A;  5E6H A;  4V2V A;  5F3G A;  5FUP A;  2GP3 A;  4E4H A;  4CCK A;  4QXB A;  5F32 A;  4HON A;  5A7W B;  5FUN A;  2XDV A;  3PDQ A;  5FPA A;  4DO0 A;  4QX7 A;  5FZH A;  3ZLI A;  5FZ1 A;  5FZM A;  3N9M A;  4NUB A;  5FYS A;  5ISL A;  4XDP A;  3UYJ A;  4CSW A;  5FXZ A;  3NJY A;  5IVF A;  5FZD A;  4LIU A;  5A3N A;  5FZA A;  2WWJ A;  3KVA A;  5FYI A;  5A7O A;  3U78 A;  5FYH A;  5IVC A;  3AL6 A;  4BXF A;  4TN7 A;  5KR7 A;  5FZG A;  5FJK A;  3KVB A;  5FZ8 A;  4EYU A;  4QX8 A;  3N9P A;  5FZL A;  5FP9 A;  5FZE A;  5FZB A;  3DXU A;  4BU2 A;  5A1L A;  2XUE A;  4DIQ A;  3AVR A;  5A3T A;  5FY8 A;  4AI9 A;  2OQ7 A;  2XXZ A;  3PTR B;  3PU3 A;  4C8D A;  2YU2 A;  5FY1 A;  5FPU A;  2Q8D A;  5FXX A;  3AL5 A;  5IVE A;  3PUA A;  3OPT A;  2W2I A;  4QWN A;  4XDO A;  5FWE A;  4AAP A;  5IVB A;  4LXL A;  5F5I A;  4GAZ A;  5FZO B;  2OT7 A;  4UF0 B;  5FWJ A;  5A7N A;  2OQ6 A;  5F3I A;  4HOO A;  2Q8E A;  4EZH A;  5FJH A;  3KV4 A;  4Y33 A;  5FYV A;  5FZK A;  2YPD A;  5FYM A;  5FZ3 A;  5A7S A;  5LW9 A;  5FZO A;  3DXT A;  5FYT A;  4Y3O A;  5FP8 A;  4UF0 A;  5A3P A;  2WWU A;  5FZ9 A;  2YBS A;  4EZ4 A;  5FY0 A;  2GP5 A;  5IW0 A;  3N9O A;  5FXW A;  5LY2 A;  5FZ0 A;  5F3E A;  3KV6 A;  5FYY A;  3K2O A;  4IGO A;  4IGP A;  5FPV A;  3LD8 A;  5FYC A;  4CCN A;  5F37 A;  4BIS A;  5FZ4 A;  5FPB A;  4CUG A;  2OS2 A;  5FP4 A;  3OPW A;  3K3N A;  4GJY A;  5FY7 A;  5IWF A;  5A80 A;  4CCJ A;  2VD7 A;  5FBJ A;  4ASK A;  2YBP A;  5FY4 A;  5IVV A;  5FZ7 A;  4IGQ A;  5A7Q A;  5LY1 A;  4LIT A;  5FY5 A;  3PUQ A;  5F5C A;  5CEH A;  5A3W A;  5A1F A;  3PU8 A;  5FPL A;  3N9L A;  5IVY A;  3U4S A;  4CCO A;  5FYZ A;  4QXC A;  3RVH A;  5FYU A;  2XML A;  5F2S A;  3N9Q A;  4QU1 A;  2YBK A;  5FZ6 A;  4D6R A;  2P5B A;  3LDB A;  3PUR A;  5F2W A;  3PUS A;  4V2W A;  5FP7 A;  2YU1 A;  4LIV A;  4Y4R A;  5F3C A;  3KV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...