4QX7A

Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
b'RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 105
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qx7A01
3UYJA 5FUNA 5F32A 5A80A 3AVSA 5FPLA 5A7SA 3N9LA 2W2IA 4V2WA 3KV4A 5FY5A 5A7OA 3RVHA 5FP7A 5IVJA 4CUGA 5A7NA 4BISA 5FZHA 3N9MA 5FY7A 2OX0A 4ASKA 5FUPA 5LY2A 5FYSA 3ZPOA 5FY8A 5F39A 5A3PA 5IVFA 5FZ9A 5FY0A 5FZDA 5FPVA 5A7PA 5F3GA 5FPBA 3KV6A 2WWUA 3N9NA 4XDOA 5F2SA 4BXFA 5FZ8A 5A3TA 2XUEA 4IGPA 5FPAA 5F37A 5FXZA 3AL5A 4CCKA 5FYHA 2YU1A 3U4SA 2YBSA 5FXWA 5FZGA 5FXVA 5IW0A 4QU1A 5A1FA 5ANQA 2YPDA 5IVYA 4BU2A 5FYCA 3PUQA 2YBKA 5IWFA 4D6SA 3OPTA 5FZLA 3PURA 4Y33A 4E4HA 3KV5A 4CCOA 3LDBA 2XXZA 5F5CA 4GAZA 4IGQA 5FP8A 5FZEA 4CSWA 3K3OA 4XDPA 5KR7A 4UF0B 2WWJA 5FYYA 3N9PA 4LIVA 2XMLA 4UF0A 4CCNA 5F2WA 2Q8CA 3K3NA 4NUBA 4CCJA 5FP3A 3PTRB 5LY1A 5FYMA 5FV3A 3PUSA 3N9QA 5FZMA 5FJKA 5IVBA 2OQ6A 4LITA 5LW9A 3KV9A 5IVCA 4V2VA 4IGOA 4EYUA 5E6HA 5IVEA 4GD4A 2OS2A 5FY1A 3KVBA 4HONA 5FPUA 1VRBA 5FZ0A 2XDVA 5FXXA 4QXCA 5FZOA 2YBPA 5A3NA 4GJZA 5FJHA 3PU3A 5K4LA 5F5AA 4QXHA 5FP4A 4CCMA 2P5BA 5CEHA 5FY9A 3K2OA 5FYVA 2GP3A 3PU8A 4TN7A 2PXJA 3OPWA 3KVAA 5FWEA 4C8DA 4EZ4A 4GJYA 4LIUA 2YU2A 5FZCA 3DXUA 3DXTA 3PDQA 5FZFA 3N9OA 5LWBA 5FP9A 5ISLA 5FWJA 4QX7A 5FYIA 5A3WA 5F3EA 4Y3OA 2OT7A 5A7WB 3AL6A 2OQ7A 4HOOA 5FYZA 5FZAA 5A7WA 5FZ6A 4DO0A 5A1LA 5FY4A 5FZ4A 4D6RA 4D6QA 4AAPA 4DIQA 5FBJA 5FZOB 2GP5A 5F3CA 5F5IA 5FZIA 2VD7A 3LD8A 4QXBA 3U78A 5FZ7A 2Q8DA 5FZ3A 5FYTA 4LXLA 5F3IA 2Q8EA 4QWNA 4URAA 3PUAA 4AI9A 3AVRA 4Y4RA 5FZ1A 4CCLA 4EZHA 5IVVA 5FZBA 5FYUA 5FYBA 5FZKA 4QX8A 5A7QA 3NJYA 3ZLIA
chains in the Genus database with same CATH superfamily
4XJUA 1SZBA 3CL1A 5GLWA 2C0ZA 5GLZA 1K12A 4ZHNA 2DCYA 2P4EA 2NQYA 3KV4A 3WCSA 3IDCB 2E33A 3VL8A 5LCWL 1DLCA 1LJ7A 4A42A 3RZMA 1C57A 1QOTA 4FCAA 5FZHA 3MLKA 1UMIA 1UPSA 2XB6C 5EYYA 5FZ9A 1WW6A 2VBDA 4XMAA 3MW3A 1JYTA 3WHTA 4Q8LA 4AWDA 4BQ1A 3OUJA 4IV1A 4Y1VA 1LODA 1BZWA 1NUKA 1OSGA 4L0PA 1HX6A 3AMNA 5C3RA 4WM7C 3PUIA 4RD7A 4WM8C 4RR3B 1NA1C 4LO6B 1YIFA 2ARBA 3U1XA 3LPGA 2P3YA 2PHTA 3WDVA 1BEV1 2UWCA 4IEXA 4CP9A 1JUIA 5ACA2 4MV2A 2VW1A 2XBO2 3R05A 4DUVA 4ZZ8A 4IEPA 5JDBA 4GZ9A 4FFIA 2EXIA 5C9AC 5A3UA 3PIGA 2HWF2 5SV5A 4Z2WA 4N43B 5T5PA 1RMU1 2AGSA 4JAAA 3VD3A 2RDRA 1UIJA 4QGNA 4N9HA 4QDSA 2B9UA 1XNKA 2ERFA 2FBEA 3GXUA 4GWIA 4XFAA 4CUCA 3WP5A 2J1VA 2OUJA 1AYN2 2A6VA 5KHKA 4M00A 3POJA 2VY0A 3FLPA 1BCXA 4COWA 5BNPA 1CZVA 4PBOA 2DU1A 2IWGB 4MHUA 1VBE3 1TMF3 2WZR3 1NT0A 4K9SA 2JDMA 1AXZA 2O14A 3MV11 5FYMA 1WD4A 4XC9A 2GC1A 2D40A 2VZ3A 2YC4A 1CAXA 3VGIA 2CDPA 1OLME 2ZABA 1DP0A 3AX4A 2RHPA 4RA0A 4UBHA 1ZZCA 5T54A 1OQEA 2W39A 2WINB 1G86A 2V72A 5CKNA 5B2GB 4IV3B 3PJQA 5FY1A 4UFLA 1EV13 2W87A 1UQXA 3KZ4C 5FZ0A 2C4XA 2EF6A 1E5RA 1JYXA 2W92A 1GLHA 3S5AA 2YDEA 3QD6A 2CGPA 4AEDA 4OUMA 1Y9MA 5FJHA 2RJKA 2ZEYA 2XG3A 3OEBA 4I09A 4QXHA 2R1DA 3ZN4A 3E6DA 1VALA 4CDQA 1UY3A 1YXWA 3AMMA 4AYUA 4TN7A 2ZEXA 3ZM8A 4Q0SA 1S2EA 4LBOA 3AC0A 2A3YA 4OCTA 2BGPA 2ZX1A 3ST7A 3DXUA 3AYEA 1NY71 1N1YA 2ZGTA 2QQPA 3FN9A 1HLCA 2ZX0A 1X9PA 3VBFC 5I0SA 1IHMA 4AGVA 2B5HA 4QKFA 3RQ0A 2WSUA 3AZZA 4IE4A 2MHFA 1QNWA 4TWTA 1IGOA 3POSA 4RGGA 1PZ9A 4AHWA 4TZDA 1QF3A 3K51A 2P6CA 1O4ZA 2J1AA 1UAIA 3OGVA 3FUOA 3J7LA 2IUWA 4XHXA 1U0AA 4XW3A 5F5IA 2VMDA 1VBE1 1TMF1 2WZR1 2ZPXA 5L7OB 3JD72 4NRQA 4A41A 3E97A 3UGGA 5A6QA 1W2TA 2BGOA 4JGYA 5D8AA 5HBAA 2W47A 2HWE2 4E8CA 3NNFA 4NMIA 5JIUA 2DV9A 3IT8A 4FPYA 2GMMA 1DF0A 1WUVA 2L9LA 1SLCA 3S7IA 1VIWB 1RUH3 5DG1A 4GWJA 3I3MA 4LKDA 1EV11 5FR3A 3WNMA 1TQ5A 2BFUL 1PO12 4QU2A 5DMYA 1ST8A 1W39A 4Q4W3 1H8TB 4Q4V2 1JZ3A 1NXD1 1HB3A 3WD5A 4V2WA 3RVHA 1O7FA 3GCXA 1S4CA 1QQP3 3WW2A 3CEWA 5H9PA 5DG2A 1SLTA 3K75B 1OH4A 2VM9A 2XOMA 4HN0A 3FHAA 1LOGA 1X36A 3U37A 4DQAA 1ZREA 4Z2AA 1SFNA 1WBFA 2RDNA 2QBXA 3GHMA 4CEWC 4AXOA 5FPBA 3KV6A 3Q8EA 1R091 2A71A 2CGNA 3MPBA 2FCVA 4PIXA 2VW0A 4OHZA 5BNNA 3HBZA 2A6WA 2DVGA 4DB5A 4SBVA 1W9TA 1E5HA 2KXLA 3AL5A 3FC0A 5FYHA 5JZGC 2C1FA 3CJXA 4XBQA 1ZNPA 1QJU3 2WT2A 3WXPA 2X8KA 4JVAA 3PVNA 4W8JA 5FTTC 2WT1A 3CKHA 2RJLA 5E88A 1AUYA 2A7AA 2WNVC 3BODA 3M7AA 1MVEA 2B46X 3VDAA 2E53A 2UY9A 1IG3A 5L19A 1CAWB 4MGKE 5F5CA 5GJ6A 4CVUA 3ZIXA 3DKWA 2R49A 1Z78A 2A75A 3NSTA 3U10A 3Q8CA 4ATFA 1UYXA 1YFUA 3JB4C 1U5ZA 3V0AA 2EXKA 1RUH1 2GALA 1O8PA 1AL22 2D3RA 2GMPA 2LS6A 2GH8A 2BVBA 2G4IA 2K2SA 5BPXA 1VE0A 4LLFA 4Q4W1 3RI9A 1RUJ3 5BNOC 5KHIA 1H4HA 1X9TA 2K0GA 1OFNA 4JQRA 4AFAA 1QQP1 3QCWA 3QACA 2D6KA 4V2VA 2XLGA 2WZPP 1SFYA 3OSDA 3I59B 1RTVA 1LOCA 2R063 3NAPA 1LGNA 3WV6A 2OS2A 4MGSA 1RVF2 4AOCA 3NV3A 4LHKA 4S2DA 2FHRA 1EAH2 5ERLA 3H8XA 3CQOA 3VBHA 2KR2A 2P2KA 2UY8A 2JDNA 4YRDA 2PLV2 2BNMA 4XF1A 1GQPA 3O1RA 5FPZA 2DVFA 5FDBA 3VUOA 3J7HA 3ES1A 4PHZA 4WV8A 1NCRB 3THCA 4BJ0A 3BALA 4UWDA 5K8SA 2DWRA 4R9CA 3DF0A 1QJU1 3PVEA 3ZFGA 1N3OA 1YO8A 3IN9A 3NKGA 4DXRA 2PHWA 3ITQA 3JBG2 2JG8C 2PAMA 4P5YA 5F6LB 4HKOA 1W6NB 3MEPA 5A3WA 3WNNA 5A7WB 2BBVA 1NLRA 4Q1PA 4UW3A 3R4DB 1UZZA 4P02B 4EN8B 2XLAA 1W05A 4B29A 1AR62 1F35A 3PJYA 4L97A 4XJ8A 3PUHA 2D98A 1F4AA 4LKFA 4IETA 3ZSLA 1H6YA 3HT1A 1JN2P 2CWSA 5FZOB 2GP5A 2JKBA 4P08A 3THDA 5I93A 1K5MB 3S0MA 4BB3A 1ZVFA 3N7KA 1GZWA 4Q0QA 3ZXLA 5F3IA 3BTZA 1NYWA 4URAA 1H2LA 4QQ2A 1C28A 3HEIA 1RUJ1 3LEKA 3KHCA 3JXSA 4NHYA 1UZYA 1W2UA 2YUEA 4RQPC 3USSA 5EIYB 4B4QA 4EROA 4FVVA 2R061 4MXWB 5A7QA 5J48A 4WM7A 2EIGA 2XUMA 3WDXA 1KQRA 2D3PA 1OXCA 1Y9QA 4NAOA 3IDEA 1YQ2A 2X09A 1QEXA 2MEV2 1NA1A 4WM8A 5FPLA 3RZZA 2DUPA 4LO8A 2EXJA 2P1BA 3VBOC 3RZLA 2R6QA 4BYYA 3AMHA 2NMNA 2E7AA 2ZMLA 3ACGA 3WDWA 4AVSA 1ULFA 2QFEA 4CU7A 5B4NA 5C9AA 5K0UA 1J84A 2LM3A 4FOVA 3LOBA 3CHXA 1PX4A 4GWMA 3W5NA 5I0RA 1UKGA 1BHGA 5A7PA 3ZSEA 1WW5A 2WO1A 4YARA 3WW3A 2DUQA 1AX1A 1W6QB 2W1WA 4NE9A 1JOBA 2V09A 4MH0E 1U5IA 2ZKNA 1OVPA 4YW5A 4XHBA 2F17A 1LOAA 1NX9A 2XBO3 4W6YA 2HKXA 4QKBA 1UY4A 5FQ0B 3B3QE 4E9KA 1Q8QA 2HWF3 3DYMA 4QQPA 1NCQC 3WDUA 4I2OA 4O65A 3MZHA 5CISA 1J59A 1IKPA 1ZBA3 3ENRA 4JV4A 1AYN3 1Q5OA 1VBA2 1V6NA 3OGGA 1JYVA 1ZRCA 1VAVA 1UYZA 2XGXA 1K5JA 3SKJE 3K77A 1JZ8A 3SH3A 1GR3A 5ABJB 1TZOA 3AK0A 1REDA 4JRAA 4CCNA 4FFHA 2OKXA 3BPZA 1XNCA 1RXGA 1Q8PA 5F1RA 4ZXKA 1V6OA 5GLTA 3J8F2 4AEMA 4AL9A 1HIXA 2VOXA 4MLOA 3IPVA 2BU9A 2WNUC 1UY0A 2YFUA 4H7LA 3LPFA 1XYNA 4AHZA 3TEXA 1AXKA 1GP5A 3NJXA 3RG0A 1UY1A 3VBRB 1N47A 3VKOA 1QH6A 4Z8BA 5JCTA 1S0DA 3VN4A 1FNZA 5JXHA 1IKQA 3HMYA 1KXGA 1LOEA 2BOIA 3LOIA 3PVOA 2P3KA 3BYWA 4FPGA 4AVVA 4EN6B 1V9U2 5CG8A 3I4IA 1ULCA 3PU8A 4UBGA 1Y3TA 3HBKA 4UI9L 2RVAA 3MYXA 4QX1A 3HD8B 1O4TA 4KU7A 3D5OA 1IPSA 1UZWA 2XBO1 4I3GA 2CSGA 2D6NA 4CEYC 2UYBA 2WLQA 5ACA1 4X6QB 5IK8A 2D6OX 1TEIA 2HWF1 2YB7A 1ENXA 1WWYA 4IL7A 2HWD2 2ZXQA 4K8RB 5C5TA 1JHJA 2YFZA 3AL6A 2BFUS 4BQ2A 4XFCA 5A1LA 3IAPA 1XU1A 1AYN1 1SBFA 1WA6X 4NPRA 1ZZ9A 1F31A 5JOZA 3I2IA 4P9GA 1S0CA 1X8EA 5FBJA 1RYYA 3V65A 1PVC2 1LB2A 2J1TA 3CJIB 2KA3A 4LUKA 3VKFC 4I0BA 5FZ7A 1OA2A 3JD73 3HR9A 4UFJA 3RDIA 4BM8A 5I8SA 3UJQA 5G05L 5CFDB 1A8MA 2HWE3 2OVUA 3AZXA 1JI6A 3JQXA 3O0XA 4PDWA 4IUGA 1H1MA 2QTWB 4L11A 4CEWA 4M4PA 1DBNA 4MADA 3H8OA 1CAVA 2NZ9A 4LE3A 3MGUA 3QOPA 5JXGA 3RYPA 3T1LA 5A80A 3AYDA 2JG9C 3OJBA 2JDZA 5JZGA 3WF1A 5L9RA 4S2FA 2WUHA 3RSJA 1ZZBA 3I8TA 3ZYIB 1WCQA 3ZPOA 2O8QA 1FAYA 2WNVA 4QX2A 4Q4X3 4JCKA 4QHOA 4RR3C 3ZO0B 1W06A 2Y8KA 2BBAA 4YZ5A 3LKJA 3ALQA 4JKLA 4ARXA 4AGRA 1W2AX 2C9KA 2XUEA 3P1IA 4XTMA 3VD7A 3AXDA 4B1LA 1DZTA 4NR1A 5J3UA 2ZS6B 3TEWA 1WD3A 3B5LB 2CHHA 2R042 2ZHMA 3K4ZA 5ANQA 1JZ7A 2ARXA 2JEMA 3JU9A 1C3HA 2D7FA 5GZFA 2QJVA 4D6SA 1XNDA 3JD71 4LA2A 1DGLA 2E6VA 3OY8B 4BIOA 3DGTA 3FJSA 4UOJA 2P37A 4FPJA 1JZ5A 4OMDA 4YPJA 2HWE1 1W8UA 4XDPA 4HFSA 1YFWA 1W6MB 3HPNA 3N9PA 4V1PA 4M3CB 1RHI2 4QB2A 5T5OA 4LHNA 2R30A 2ZGOA 4KWUA 4HG6B 4W65A 4XAAA 5CNAA 2RMU2 3ZYFA 1WCDJ 1R64A 4Q4V1 5JXJA 1DYPA 4IV3C 2VUCA 1B35B 1LHNA 1STMA 2KM2A 3EO6A 1MVQA 2WC2A 2JG8A 2JDAA 1ND2B 4HONA 4Q4X1 4BCUA 2PHFA 1EAH3 5KHHA 4X6RB 1OFSA 1RUI2 3FX3A 1WLCA 2Y0OA 4I0AA 4YVWB 1SPPA 3MF6A 4XAEA 2IXIA 2PLV3 1CJDA 4DS0A 3NV2A 4HKLA 5C3PA 1O6UA 4GMP3 1AR93 3B01A 1BVVA 1W0PA 4HK8A 3WW1A 4P9IA 4BQWA 5CVRA 1DZRA 4Y1UA 1DHKB 3I54A 3DPRB 2GMEA 2WJSA 4GJYA 4J25A 2VBBA 1GNZA 3VD4A 4CCCA 3IDBB 1I9RA 1HB4A 3VZKA 3LSDA 2B8MA 2V4AA 1L7RA 4Y3OA 5CKQA 4AFDA 1G9FA 1ONAA 4NIDA 2FDGA 1S2KA 2VMCA 2BGCA 2VNOA 1W9SA 5FZ4A 3P5BA 1US3A 2JB4A 4PBPA 2CY6A 2YXSA 2CAVA 4RYDA 3U78A 3VBOA 4LXLA 2IFWA 1GANA 3QBQA 3WW4A 1GUIA 4JDOA 1HRI2 3WNOA 3UT0A 4AK3A 2ZGUA 2UURA 1OURA 1K3IA 3SEEA 5TSWA 1KJLA 1XOYA 2A1XA 1HKDA 5FYUA 1H8TC 3EYPA 3VHRA 4LBLA 4J6GA 2ATFA 4Y1YA 1ND3B 2ET7A 4IE7A 1UZ0A 3VDDB 1EAH1 2WKKA 3LA2A 1OD5A 4DUWA 2MEV3 1UW8A 1Y4WA 1S55A 2PLV1 5T55A 1FOD2 2ZGQA 3MI8A 3VKMA 4QPGC 1PIV3 4YWAA 5C3SA 2NYYA 1IS6A 4GMP1 1AR91 3N9MA 2A70A 2NM1A 3WZ1A 1PGL2 2R16A 5FY8A 2HEYF 1ASJ2 1G6NA 5IFTA 4HLTA 3I2HA 3WY6A 1NCQA 2MNGA 5JI7A 1W8WA 5IK4A 4OULA 4C1XA 3SITA 2Y6FA 3RNSA 3NV1A 4B7EA 4DEVA 2A6YA 4YSFA 5HV0A 1APNA 4PIZA 3OBTA 4CPBD 1W8HA 1YNAA 2DUOA 2VUAA 3FHIB 4PF1A 3B7MA 1QJY2 3ROUA 3O1SA 4H55A 4LO4B 5JR7B 5A33A 2QVSB 3U14A 2NP0A 1MZEA 2QQKA 5IVYA 4BU2A 5A1FA 1W3VA 2FD8A 1GP6A 1WW7A 4COYA 4JTNA 1VAKA 1W04A 1DQ5A 2DTYA 3EHKA 3VBSB 4AEJA 4GMP0 3Q8AA 4EWAA 1WLTA 2WNUA 4FOQA 4GA9A 4N53C 3WX5A 3M4FA 3EXUA 4JKKA 4CCOA 3WEZA 3H9AA 2VOVA 3SNMA 3ZFEB 4ZU7A 2GN3A 4GAZA 1GV9A 3N7JA 4GH4C 1RUG3 1EY2A 1VBA3 5FZEA 1XYOA 2WWJA 5EJ3A 1JYIA 2XVGA 4QQLA 4YFZA 3I2FA 5F2WA 3VZNA 4AI0A 1D7PM 5B4XA 2C24A 2IXJA 1REFA 4ORFA 4R4ZA 3OBZA 2VZOA 3LWCA 5DUUA 3J8F3 4C0BA 3PUSA 2MEV1 1FV3A 4WVMA 2FMYA 4BK5A 1PIV1 5IVCA 2ARAA 4CEYA 2WAOA 3WNPA 2IFRA 2PTMA 4N7IA 3AKPA 5IVEA 2EAAA 1I5ZA 4JZRA 3ZIWA 2DU0A 3HVDA 1VP6A 2XJVA 3CLPA 1RXFA 4DRVA 4HL0A 1D2SA 5GZCA 1LESA 2BWCA 4DY5A 1NCRC 1XNTA 4PI0A 1JXNA 5FP4A 4CCMA 1V9U3 2JE8A 2P5BA 2WQ8A 4JTOA 1KDKA 2JIJA 3ACIA 4YVSB 1Z7S3 3ATGA 2J1EA 1PGW2 3I2OA 3I2GA 1OBNA 3KVAA 4DMIA 1AJOA 1BVP1 2VZSA 3E6BA 4C8DA 1V6LA 1GNYA 3DEMA 3JUUA 3K4AA 3GBGA 5FYIA 1AYM2 3AMPA 3DCQA 3K46A 1REEA 2HWD3 3ZYHA 2VCBA 3RPQA 3VLBB 2UYAA 3U75A 1ZZ8A 1RB8G 1WMFA 4YM1A 4WZCA 1K5MC 2JICA 2RS12 1VBA1 2BZDA 2JWPA 3POIA 4LBQA 3KF3A 4DIQA 5KWRA 4J1WA 3JQWA 4XFFA 4IQPA 2W9XA 2JG9A 3RRDA 4NO4A 1S0JA 4XE9A 3G6JB 1MPXA 4QXBA 2IXHA 3GZUC 1W0NA 4XCAA 1CAUA 4Y1ZA 1BK1A 1XSQA 3WP4A 3J4UH 1DZQA 1YQ8A 3J8F1 4O9GA 5HCAA 1S0FA 1WLWA 1ZBE2 4E2SA 2XVLA 4D0QA 4CDUC 2P17A 2VZTA 4RR3A 4HZFA 5EWSA 2VNRA 2XJUA 4QX8A 1O5UA 4F7ZA 1MQTC 4HN1A 2LRPA 1HB2A 1BJQA 3POYA 1O3QA 4CXYA 3N9LA 3N7LA 2VTXA 1V9U1 3VZLA 3AP9A 4AR2A 4A45A 3OBRA 1Z7S1 5FY7A 5F8PA 3FE5A 5A32A 2Z5WA 3IMMA 1RMU3 2EALA 4OZXA 3EB7A 3BTYA 3OD4A 2CU5A 3WT3A 3WF3A 4S2HA 5CFCA 2WWUA 1WKYA 2HLEA 4PT6A 4IW3A 1O91A 1CIYA 1KGYA 2BERA 2I2SA 2HWD1 4COVA 5C7GA 2ZZJA 3L9JT 5A6ZA 4MZUA 3VBUB 3TEZA 2Q1MA 2GNDA 1W9WA 4LEJA 3WUCA 5DDJ3 1YQ5A 4XIOA 5M0TA 2J1UA 1XXNA 1YRZA 3PUQA 2D44A 4LHSA 4E4HA 3KCXA 4D7TA 3GJAA 5IT6A 3GBWA 3LSEA 1MEC2 3UGHA 4L8QA 1LTEA 1ZRIA 3IIAA 4MVTA 4EWDA 3T08A 3WP3A 4BZ4A 5HXVA 4QM8A 1ZYBA 4XJWA 5KR7A 5LA9A 2PHUA 3L2HA 3ORJA 3USUB 2WO2A 1SDWA 4UF0A 4OUSA 4Y20B 2XJRA 1RHI3 4Q27A 5JIAA 4NUBA 4CCJA 3T0AA 1EUUA 4INDA 4FAGA 1RL3A 1N3QA 1H30A 1Q43A 3AYCA 2HEVF 3N9QA 2ZGMA 2IXKA 4RGKA 4JX0A 4LITA 1PMHX 2R072 2VQ0A 2WZEA 5CG9A 2HJIA 4OHVA 1ZM1A 2BVVA 2Y33A 5JMOA 5KC5A 3A21A 3OG2A 5GM0A 1RUI3 3OYWA 3F2ZA 4DUXA 4M3CF 1GU3A 1QDCA 5FY9A 4FQZA 4IE5A 5FKCA 3IIIA 3MDPA 5KHGA 5L36A 1QXJA 4CU6A 1GKBA 4OLLA 4QB1A 4CDXA 2Y0IA 3HQRA 5FK8A 2VVFA 1SQ4A 3POBA 3RYRA 3TRSB 4E4SA 2NLRA 4CPBA 5A70A 3CF6E 5DDJ1 2YV8A 3V0BB 2XQXA 2XH6A 3AFGA 3M3QA 3WQ1A 5ISLA 4YM3A 4YM2A 4PF5A 1GZCA 2D93A 4MGTA 4A7ZA 3TN92 3THPA 3A0NA 4U2AA 5FZ6A 3WQ0A 1CVNA 3H8UA 4YZ1A 2EA7A 4MYEA 4AAPA 1T2XA 5T5JA 3K48A 4LTAA 1KITA 2V5DA 3J7MA 2GC2A 5CFDC 1RHI1 1C8M2 3LA3A 2Q5TA 4KBZA 3UJOA 2VPVA 2Q8OA 3RZHA 4QPGA 2OA2A 2Q30A 3LEGA 3ZFFB 2DFCA 1MS9A 3ILRA 4HPKA 4TXWA 3AXEA 1HRI3 2DF7A 3PUAA 4GQ7A 3LZZA 1W2OA 2VW2A 5T52A 4MXVA 3OGJA 3T2QA 1LNSA 3JCIA 4BOWA 1H8VA 4BQXA 1R093 2YMZA 5C71A 1NZCA 2Y6GA 2AYHA 4XQDA 1RUI1 5LBEA 4O7XA 4OYUA 1LEMA 5FY5A 5FOJB 5D2AA 5A7OA 1UOBA 1LKNA 1X8MA 4ZS2A 4BQ4A 4CUGA 4TLGA 1OOPC 4BISA 1D0GA 2ZBJA 3VD5A 4BIFA 1I6XA 3N36A 4QGMA 4R4XA 2O1QA 2DBNA 3OB8A 1ASJ3 4GALA 5FZDA 4IV1B 4RS5C 1XPWA 5LA2A 4N53A 4YGDA 4C1WA 1H1IA 3WP6A 1POQA 5DZEA 4BXFA 4XF0A 5JSRA 2QQUA 4GH4A 2ZMKA 4L92A 5A3LA 2XKOA 4XFBA 3VZOA 3BUCA 4FOWA 4CP9B 2W46A 4MGYE 1RIRA 1QJY3 1VPHA 3DECA 1X33A 5IW0A 5FK7A 2B39A 1PM7A 1YLLA 2V5YA 2Y6JA 3HNMA 5IUQA 4D7SA 3R6SA 2ZGNA 3ZMOA 2XWBB 3B93A 2UU8A 4KI5M 1TVGA 2LTNA 1UMZA 2LUWA 3WQBA 4Q0UA 1O8SA 1BBT2 4IERA 5LASA 5HI0A 1HRI1 5BNPB 3KS7A 3VDCA 2ZCWA 4HK9A 3RYKA 3WNKA 2QQLA 5FOBB 2WO7A 1G9CA 1VBD2 2E26A 1NCRA 2R7EB 1RJ8A 3PLQA 3ZXEA 1B35C 1EUTA 4XACA 3EBRA 4MGQA 2G9ZA 1CAXB 4NN0A 4QGLA 4JRLA 4G9SB 1UOGA 3ZMNA 4KNCA 2ORZA 1ND2C 4UFMA 1RUC2 2JD9A 4FAHA 3AKTA 1PGL1 4PI2A 3ZDSA 4DOUA 5FPXA 1XB9A 2WLPA 1ASJ1 2QCSB 2BPA2 1IQAA 3NVCA 4Q0VA 4AEDB 1GYKA 5FZOA 1I3HA 5A3NA 1YIPA 3N35A 3ZN5A 3B02A 1ZRFA 5CB7A 4Y22A 1DIWA 1LHOA 3VHOA 4K21A 5BV6A 2O0OA 4XFIA 1QNYA 1QJY1 5FLHA 2W0XA 4DXTA 1FPN2 2E9QA 1UU4A 3N3HA 4QPIC 3T4VA 4ATEA 3POEA 1JMUB 5J1XA 2QDNA 2WSVA 3QH7A 4CP2A 1MS3A 4HVOA 3MIBA 1AYM3 2B4KA 1CESA 2SBAA 3GF6A 4CDUA 2WWSA 5FYZA 3GZAA 3NRUA 5KXBA 2RR13 3H1YA 4YM0A 3OD0A 4HBNA 1MQTA 1A78A 1UWWA 4IEWA 4BLIA 4LHLA 4B8EA 4D6QA 5I0UA 4Y5Z0 1VB2A 1VMJA 5FKBA 2RS53 3J9SA 3GM8A 5E8AA 3HJRA 4IESA 3LFIA 4JGYB 5D8AB 3DYPA 4GWNA 2KD7A 2VQTA 1AZDA 1ZBE3 3VDDC 4UAPA 5EXOA 1PO22 1R083 2ILMA 3RMYA 3GYDA 2GSYA 1NLQA 4NHKA 4Q1RA 3ZLIA 2EVXA 1VBB2 3HOBA 5F5QA 4A7KA 5BUVA 4FT8A 1QJFA 5HPOA 3ZKUA 2ZGKA 4NIGA 2TBVA 4JGZC 5A7NA 3ZXKA 1H6XA 1UKRA 4RHV3 1C1FA 3RI8A 1F4HA 1EP0A 4Y5SA 3FL7A 4YLZA 1PGW1 2HYXA 4CDWC 2WAAA 1MS4A 3I2DA 3M3CA 3BU7A 3LIHA 2OPWA 3BTXA 1NE6A 3N9NA 1CWPA 1FX5A 3KGZA 5BNNB 4U36A 1OA4A 5HCHA 2E51A 3L2YA 1AYM1 5DAWA 2VOTA 2ZEWA 1D4M2 4LUMA 3RGBA 4AI8A 4P14A 1ZRRA 2AH2A 5FXZA 2RR11 2YU1A 1G9BA 4FQ4A 3ASIA 3AYAA 3TEYA 1WA4A 4QU1A 1ULEA 2RS11 2A6ZA 2YPDA 1ENSA 1TNRA 2PMWB 2VC9A 4D3WA 5LRSA 5E89A 4QX3A 5IWFA 3BU0A 5LBBA 2RS51 3AZVA 3ZX7A 3PURA 1KD7A 2FZ2A 4W50A 4XTPA 3R4UA 1ENRA 4C90A 2JKXA 2FDHA 1MEC3 1TME2 1BXHA 2SLIA 5F9TA 4XPVA 3C7HA 5C70A 3TNPB 1ZBE1 4EQVA 3V0AB 5FYYA 3WG1A 1R081 1ALYA 4BQYA 4DZGA 2C5DA 1YI7A 5FP3A 4GXLA 5H9RA 2TUNA 5KBFA 1X82A 1LOFC 2FDIA 5L9BA 5KXEA 3OBAA 3EMRA 1OHFA 2DVDA 4YGBA 5LA0A 4AQTA 3KV9A 3NAPB 2R073 2XJTA 4IGOA 5ACA3 4RHV1 1W28A 1JW6A 4GD4A 1N1SA 3VDBA 1RUD2 3VBHB 3VKNA 2X5IC 3KVBA 3O0WA 1XRUA 1LECA 4YVSC 3BB6A 3HNYM 4TSVA 3HWJA 1D2QA 2QQWA 1ULGA 1GMMA 2BWAA 4M4RA 3P6BA 3HQUA 1ODMA 5H9QA 3A4UA 4MO3M 2PXJA 5LEKA 1D0HA 2BP6A 4OI4A 1MZFA 1LHVA 1WMXA 3ZFGB 1G8WA 4NOTA 5F7UA 2AC1A 2JD4A 4S2GA 3T2PA 1QH7A 3FUQA 5FMCA 3KQ4B 3LGRA 1EPZA 2VG9A 4QX0A 5F3EA 1RJ7A 2ZHLA 4BHPA 1M4WA 1MEC1 4DFSA 4LA3A 3D8CA 3D4KA 3LAGA 4XOGA 4CZSA 3VBFA 2F4PA 1Q3EA 3TOJA 1ULDA 2D5FA 2VMFA 4DPNA 4FSJA 1Q56A 1YJKA 2RG4A 3B69A 4BLJA 4PLNA 1OOPA 4B4PA 1WBLA 2R0HA 1AL0G 3LEIA 4Y1XA 4IEOA 2YHJA 1Q8SA 5EZWA 4FI9A 1C5IA 2XQRA 1TG7A 1YQ6A 3F95A 1ZZ7A 3GHNA 5C4WB 4Q4Y2 4RS5A 5JSPA 2R071 2XPJA 2EIBA 2JECA 3KHBA 4WM7B 1YUDA 3U4XA 1C5HA 1HQNA 1UXZA 5CZKA 5KXCA 3ETPA 2VVDA 4WM8B 2LROA 3NJYA 1NA1B 5I91A 3NV4A 3FLTA 4NHXA 3QH6A 2E32A 3AFKA 3MFCA 4UW4A 5L73A 4XJZA 2HWC2 4K20A 5C9AB 5K0UB 1Y7BA 5KXDA 1VRH2 5DAVA 3FBMA 3RMXA 5CAZA 1BMV2 2VZ1A 2OX0A 5JPNB 5FYSA 3C2UA 2V4VA 3T09A 2ZGLA 1CPMA 3I3EA 1W6OA 5SV8A 1IQDC 2FDFA 3O1MA 1KS4A 1OMIA 2Z79A 4R9AA 4W6XA 3SQOA 1E57A 4OHXA 3VBUC 2PELA 1CQ9A 2VZVA 2VQUA 2EIEA 2W68A 3T30A 5IATA 4AHYA 2AACA 1WGPA 5T3NA 1RUE2 5DABA 2YGMA 2YC0A 1AR82 4M01A 4P00B 2AREA 4KWJA 1PO13 1DU3D 4E27A 3B94A 4TLFA 4Q4V3 2EICA 2GAUA 3U11A 4BE3A 3POWA 3KV5A 3LDBA 5EYXA 5A1AA 1YQCA 2NPIA 2VZRA 1QMJA 3ZXFA 1BBT3 2AEZA 3B9CA 3BOWA 5DN2A 1SMVA 2BUKA 1SEFA 2G9FA 2DCJA 5FLJA 4AQ6A 3NJZA 2Y64A 4E2QA 3B00A 4XJAA 2GC3A 3JZVA 3Q8BA 2WABA 2J22A 3IPVB 1BYHA 3AZYA 3URFA 3HIFA 5JMCA 5A6YA 4N43C 1V6JA 2D5HA 3LDKA 3UV9A 3CBNA 3T3YA 1FI2A 4QPIA 2WDBA 1G7YA 5I0DA 1CD3G 4HETA 5EHDA 2XWJB 5BNOA 3OUIA 3UKNA 4BQ5A 4P9XA 5J96B 2PAKA 2WNEA 3CMGA 5EFUA 4ZY9A 2VUDA 2ZX3A 1GQGA 5IAVA 1GP4A 3WCRA 2TEPA 1A3KA 4DXZA 3UESA 2GP3A 2DCTA 1H9PA 1OH3A 4Y26A 2CL2A 1UX7A 4KWLA 4EZ4A 4QDRA 4A44A 1LGCA 3NO8A 5T50A 1UU5A 4Q26A 1AL23 3DXTA 5G04L 5E16A 2QQVA 2W1UA 1PO11 1QJX2 2Y6HA 3KSCA 4ZU5A 3VDDA 5A6XA 4KWKA 1QOOA 1KEXA 3DN7A 3AP6A 4CYDA 2ADEA 4QQOA 1JYNA 1JOJA 1BBT1 1Z0HA 2BNNA 4WBBA 4D6RA 5EJZB 1OUSA 1RVF3 4COUA 3ZFFC 5CA6A 5F3CA 3PNAA 4ITCA 1J83A 1GWLA 4AW7A 2WO3A 2DVAA 3A0KA 3A22A 3ZPYA 5FYTA 5JAXA 1MZ6A 1QU0A 1HW5A 3MIHA 4JGZA 3WNXA 4LORA 2CTVA 4PDWB 2CAUA 1IOAA 4XBLA 4CDWA 2I45A 3AJYA 2HH9A 4CEWB 5FFOC 4IE6A 4Q2FA 4F8AA 2D97A 1PO23 4I3PA 1NQJA 1CAVB 1EYBA 3BCWA 3N7MA 3JBG3 2P3JA 1DGWA 5C3QA 1QY4A 1VAMA 2ZHKA 2XLFA 5FUNA 4IDZA 1JU4A 3ME2A 5A7SA 5JZGB 1VBB3 2JDHA 4RQPA 1OA3A 2OYZA 1SLBA 1JZ4A 1AR63 4Y5TA 5L7OC 3ZSKA 2AZ5A 1PX3A 3NW4A 4A7YA 4KG0A 2WNVB 1FXZA 3AM2A 2PN5A 5GLVA 5IVFA 1SHWB 3OUHA 2HEWF 2QE3A 2CWMA 3C7FA 3KT4A 1SDDB 1TMF2 1AL21 1UZVA 1W6PA 3D6EA 4XUOA 5JOXA 1F9KA 4FPOB 1PZ7A 1D4M3 2VULA 1WMEA 3U4SA 5LBFA 4A3ZA 3ZDVA 1XU2A 1RVF1 4E8DA 4BA6A 2D6LX 4FPCA 2WZ8A 2YBKA 4LQRA 1OD3A 1NZIA 4AGGA 1V6IA 4YZ4A 4Q29A 1IPKA 1OC1A 1J3RA 3J7NA 2PFWA 4IGQA 4AFBA 2ZEZA 2X5IA 2Y34A 1JZ6A 2BW8A 2Y6KA 4B7KA 3T0DA 2OZ6A 3N4MA 1FYUA 2YY1A 3KD4A 5FCCA 1PO21 1RINA 3LFMA 4URTA 4D69A 3K3NA 1MR5A 1OPMA 3FZ3A 1SFPA 3I3QA 3JBG1 4XIKA 4CP0A 3CDZB 2GNTA 1N1VA 5FV3A 2W52A 5D21A 4CRQA 1PK6B 3DV8A 2ZGPA 1VBB1 2DFBA 2RJ2A 4COZA 1UO9A 4FPEA 1AR72 1W03A 4YGEA 1AR61 4XDQA 5FJKA 1V70A 1O3TA 2Y26A 2IC1A 1WCUA 3W21A 2JG8B 2AR6A 2VOKA 1YWKA 2FQPA 2DTWA 3D0JA 2GZWA 2FDKA 5K7PA 3O1VA 1RGSA 1SPPB 4NWVA 1CR7A 5J36A 1FV2A 4LBMA 5DAQA 1U5XA 3C7EA 3MFAA 3FMGA 4L99A 5AC92 4RN5A 3ELNA 2B7YA 4IEYA 4XF3A 1D4M1 3AJZA 1JTZX 4LIUA 5T5LA 4XCBA 4BMEA 2YU2A 2VXRA 5DQ0A 1XE0A 4XURA 1I1EA 4NWWA 4ZKTB 5C33A 2Y6LA 2EIDA 4XQ4A 2IXLA 1DYOA 1KFXL 4NIHA 2W95A 4CP1A 4FFGA 5FZAA 4QPYA 2BNOA 4LLOA 1QQP2 4O61A 1YYNA 3AKRA 4XXAA 4N8MA 4XUTA 1GICA 5E1RA 1GQHA 4GULA 4JGYC 1MACA 1V6MA 3KWVA 4AZZA 4DY3A 4W4ZA 3IZOA 5DPNA 5CBLA 1OPOA 1DQ1A 1OLQA 1CGPA 2IVJA 1R1A2 2Q8DA 1LU2A 3ILNA 3LE0A 3HQXA 1CZSA 3ZN6A 4C91A 4IEQA 4XETA 5GZEA 1QKQA 4CCLA 2EAKA 5IVVA 1GOFA 4Q4Y3 3E6CC 4JDNA 1HV1A 3MV01 5FZKA 1QJU2 2D3SA 3BGAA 3VBUA 2Z2SB 4FXGB 4K40A 3H3UA 4OUEA 4AQSA 3KCYA 1ENQA 1URXA 4E4DX 3DKQA 1LOBA 3O7OA 4ISRA 3BKZA 2EXHA 2TNFA 4XBNA 5EV7A 2HWC3 4A2UA 4BDVB 1NKGA 1GNHA 3S6PA 5DXDA 4KBBA 3AP4A 1KRIA 3LB9A 1DLLA 1NCQB 3MUZ1 5LEJA 1PVC3 2YYOA 4FFFA 1GSLA 4QHZA 4CE8A 1UX6A 3SHRA 4LE4A 2ZAAA 3O5SA 2C6SA 4N9IA 4GB32 4Y20A 2W91A 1IG0A 1JYCA 4OQ9A 4DEQA 5FREA 1UN1A 3U0ZA 4WVWA 4XUQA 5FPAA 3APBA 5F37A 1W90A 2JX9A 3ACFA 4D7YA 5A33B 5KHJA 2E63A 1S0IA 1PZ8A 4AI1A 5AFBA 1RUE3 2W5FA 4QKDA 2VR4A 4IEUA 1AR83 1LHUA 1A8DA 1V00A 4FO9A 2IVIB 5IYYA 1C4RA 2WNUB 3WG4A 1SLAA 4UT5A 1H4GA 2QQOA 1W9YA 4N43A 2BOJA 2DVBA 3LF7A 4A3XA 1K42A 3MIGA 4KMQA 1N1TA 5FUIA 2BRTA 1XBFA 3C7GA 3OGSA 3RZJA 2WN2A 1DCSA 4P9LA 4XFHA 3ZVXA 2FCUA 4Q4Y1 4LIVA 5CKMA 2ORXA 3CNAA 1UF2C 3G7DA 3S30A 4RL7A 3K4DA 1POV3 1SCSA 1KDMA 3NAPC 4YW4A 2ARCA 4WVMB 3ECQA 2K9ZA 1PGSA 2X05A 4HVRA 1DQ0A 4CEYB 2HWC1 4MGIE 1UY2A 3H7YA 2W08A 4RGAA 5LW9A 1RUOA 2R043 3I2JA 4P5HA 3A7QA 3E5UA 1OVSA 4I30A 3OTFA 4ZZ5A 1PVC1 2ETEA 4LKEA 2DYCA 4IV3A 4P9YA 5C8CB 2VZPA 4WVZA 3KMHA 3MPPG 5ABJC 2ADDA 4HXCA 1UOFA 5LATA 3SKVA 5F5AA 1BKZA 3ZSMA 2W1SA 5CEHA 4TTGA 4H3WA 3NNJA 1XYPA 4XZUG 5FYVA 3W58A 1CONA 3ZFFA 4EN7B 2VH9A 1HRV2 4D94A 2FDJA 2WIIB 1MZ5A 5AVPA 1RUE1 3SLIA 1HV0A 1F8VA 1AR81 1XSRA 5FZFA 3N9OA 4OMCA 2RMU3 1A34A 4YGCA 1QJX3 1RUF2 1AJKA 1W3XA 2A3WA 3CO2A 3I7DA 2ZZQA 4LOTA 3VBRC 2VE1A 5KC6A 3ZOIA 2OQ7A 5DZGA 4HOOA 5FMOL 1NLSA 4JHTA 4XABA 4EN0A 4LBQB 3GBFA 1ZZ6A 5JUVA 2JG9B 1K45A 4HANA 2Y60A 5JLVA 3B9IA 2A3XA 2XONA 1MS8A 4AEKA 2D43A 4I02A 4UFKA 4ZONA 1AX0A 3LD8A 1SBDA 1CAUB 5AFEA 2OZJA 3ETQA 2PHXA 1OQDA 4L9BA 5FZ3A 3TWIA 1POV1 3P3NA 5C4WC 5L7OA 1WMDA 4FPHA 2VTFA 4QWNA 2PHLA 3SCHA 1W8NA 3RZGA 5HXMA 4LO7A 1ULPA 1W99A 3JB8A 5BY5A 4ONUA 4OVEA 2R041 4AVCA 4UFIA 1F15A 1UPIA 5FWJA 1VR3A 1XE7A 2ZKLA 3T2OA 4C0HA 1O3SA 5K0UC 3NJVA 5F32A 4FBFA 3AP7A 1JS9A 4IEVA 3Q8FA 3ZR5A 1H8TA 1LCLA 3CJIC 4PQQA 5JPMB 3NNMA 1ZBA2 5A32B 1NQDA 3VL9A 3M2MA 1POV0 2Q4SA 4PIYA 2ZGRA 4I0WB 5CFCB 3AB0A 3TNQA 4QMAA 2OW4A 3SH4A 1LAJA 1PNFA 2RMU1 4FTSA 1QJX1 5FRAA 3INAA 5FZ8A 3X29B 2ZOEB 4D8MA 1CZTA 2X53S 2Q0AA 3WLUA 4XVHA 3ZKYA 4ES9A 2BQPA 4KG8A 5FXVA 1U12A 4GIQA 5J37A 2NMOA 4Y4YA 2VQAA 4CU9A 1DYKA 2WNOA 3E5QA 3IB3A 2PYTA 2VOWA 3NKTA 2GH2A 3ES4A 3OPTA 5FLIA 5FZLA 3W5MA 1FOD3 4UW5A 1JHNA 4GKXA 2J1RA 5LBCA 3EQEA 3WQ7A 3V64A 5JWPA 1V6KA 5JI9A 4A4AA 1CAWA 4CXWA 4UF0B 1L7LA 2WS92 1XC6A 2XMLA 3MLJA 3OF1A 4MG2A 3I49A 4KH9A 4HKWA 4CCDA 1RUNA 1LENA 5GLUA 4K1ZA 5EJ1B 2ZAHA 2Z42A 3AP5A 1NOVA 1COV2 4Q0PA 1AR73 1I5PA 1UCXA 1FNYA 2A6XA 4YFWA 3WR0A 5BNQA 1RITA 3SXWA 4PLOA 2HYKA 3I59A 3ZYBA 1VRBA 3OYWB 4SLIA 5IJRA 4QXCA 4UFHA 3THTA 1J3QA 2VGDA 4HMZA 4OQ8A 3J26N 5JOWA 4LULA 3BIEA 5K4LA 4OI1A 3FHQA 1W0OA 2JB8A 2AENA 2WFPA 3WF4A 4AHXA 4CDXB 5AC93 1PHMA 1ZRDA 4CCEA 5I0TA 4AG4A 1GFF2 1E5SA 1W9FA 2ZGSA 3SISA 4NAMA 2BYVE 1UYYA 3KQRA 4R9BA 1NAEA 4R52A 3KF5A 4HT1T 1Y9GA 1PMIA 5LWBA 1AHSA 5DUVA 4QX7A 5CYYA 4M0NA 4KGGA 3W59A 1CPNA 2D6MA 2OIIA 1W6NA 2OT7A 1FOD1 1X7NA 3OGRA 5JSOA 5A7WA 5C8WA 4YVWC 3LCPA 5A3OA 2QQMA 2RV9A 2I07B 3IDAA 4PDWC 1YFXA 4Q4X2 1C1LA 2LW8A 4XF4A 1TE1B 5FZIA 4QPGB 4CDQB 4HPKB 3DPRC 1K5MA 1R1A3 2ID4A 4B3NA 5EQUA 1ZA4A 1N3PA 5DAPA 1W8FA 4ZPIA 2WT0A 1AR71 2B42B 3H8RA 5FZBA 2ZX2A 3MIFA 3O12A 1H2KA 3ZYRA 2ET1A 3MIDA 4FXKB 2XL7A 4LBKA 1SBEA 4QDQA 5F6KA 3WNLA 4I01A 4MXWA 3WSOA 5I8TA 4EJRA 1QOSA 1SG3A 1IPJA 1HJFA 4DNYA 3ILFA 4CXXA 1PM4A 1QXPA 1OF4A 3AZWA 3CZUA 5LK7B 5GKAC 1HQLA 2RS13 1S0BA 1HJGA 2QQJA 5AC91 4XQWA 1EPWA 3GALA 5IK5A 2WA4A 5FUPA 1AVBA 5F39A 4XF9A 4FPLA 4N53B 2Q1ZB 4IE0A 5F3GA 2JDPA 1O5LA 1QJEA 3M1HA 4XDOA 4GH4B 3WDTA 4GB33 3GZEA 1J1LA 2QUOA 1ND3C 3CU7A 1W6QA 1S0EA 3MUY1 4IGPA 3FWEA 1VBC2 2JENA 4LMFA 1ACCA 1A6CA 4AI3A 3OEAA 5FZGA 3DUIA 4YG3A 3FFZA 5HV4A 5EP9A 1CJPA 2JIGA 1XQNA 3WINE 5FMDA 5FQ0A 1JOPA 3ZXGA 3KT1A 3PIJA 3CZJA 4Y33A 3MW4A 1Q8VA 1R1A1 4AFCA 2WFF2 2ZA9A 3DL3A 3IWZA 3M3IA 4OHWA 1AR92 2GU9A 3K3OA 5FP8A 3LEMA 2E31A 2VCMA 3MICA 3UNPA 1GZTA 4N7UA 1PK6C 5FBZA 5GALA 4Z07A 5ABJA 3VHNA 3W20A 1YC61 4QAWA 3CIHA 4BWOA 2G19A 1MS0A 1IS3A 3O0VA 3NNGA 5FMBA 3NQHA 1G9AA 4UXAA 3VBSC 3MLLA 3WF0A 1QWRA 2OPKA 4Y24A 4B1MA 1YI9A 5E6HA 5FMOS 5LRRA 3ZFEC 5FPUA 3VBRA 2NN8A 2XDVA 5FXXA 3O1UA 4K7JA 4YW2A 4LOSA 3I2KA 4EWEA 2C26A 4Y22B 3M3EA 4GB31 1JODA 4FTEA 3A23A 4NHMA 3K2OA 1WLDA 3OOXA 1UU6A 4KL1A 4AF9A 1QHDA 4NRPA 4FP2A 2MPFA 3KB5A 2VMIA 1HRV3 4PQ9A 3VD9A 1J3PA 3OPZA 4NIAA 4NPMA 5C4WA 1VMFA 1KS5A 1WCSA 2XJSA 3PDQA 3ACHA 4NIIA 1YEWA 5DAXA 3VZJA 3FLRA 1RUF3 4LR4A 4CDUB 1YHFA 2WBKA 1QXRA 1MQTB 3SCFA 1J1TA 1PIV2 1QIQA 3D82A 3ABZA 2VXJA 3POGA 3AKQA 3M8LA 1O4YA 3LIGA 2VZQA 2HBUA 2RM22 4AVAA 2XHNA 4J1XA 2VD7A 2HBTA 3LDRA 4CTEA 2P6HA 3CJIA 4MSVA 3MHZA 2VZUA 3UKVA 1QJZA 1VB4A 1H0BA 4WZFA 2YC2A 1HXS2 2JE7A 4G3YC 5CFDA 5J7MA 3D0SA 4O9EA 5FZ1A 3ZYGA 4ES8A 2K46A 4DRRA 2J42A 2DBIA 3ZXAC 4LO5B 3SEPA 4YW1A 4YW6A 4BQ3A 3BVCA 3ACLA 4TYSA 2VMGA 3RWNA 3KLSA 2BV4A 3TN93 5IVJA 4PCRA 1CX4A 5FP7A 3WG3A 2VECA 1LR5A 3KM5A 2HWB2 1RUG2 2UWBA 1UD1A 4F3JA 1HRV1 1GZWB 4GKYA 5J09A 1CN1A 1E5IA 1C8M3 5FPVA 5K9YA 1US2A 2X29A 2XKPA 5F2SA 3UKTA 4QHBA 2XJPA 1RUF1 4NRMA 3I3DA 2LALA 5CADA 1PMJX 4CUBA 3T2TA 1WW4A 2F6BA 4KQ7A 4XUNA 3T1MA 2JDYA 3VB9A 1SCRA 5JR2A 2VBPA 1HDKA 3P3PA 1H9WA 1AX2A 1LHWA 2IZWA 2N7GA 3GGLA 3I3BA 5FYCA 5A3MA 2VNVA 4DINB 2ZACA 3R4SA 1WCKA 2WYSA 4XUPA 1FMD2 4H2AA 2GDFA 5DUWA 3UK9A 2Y38A 1C8NA 1H2MA 3TAYA 3OY8A 4RFT0 1W8ZA 1Z7S2 4AVTA 2A5ZA 1DGWX 5L9VA 2WS93 5APAA 3VKLA 1W6MA 2RS32 4M3CA 4NJ4A 2BEOA 1UYPA 3RFRA 1AXYA 3D3AA 4NHLA 3RJ2X 3TN91 5FZMA 4ASLA 5LA1A 4L2NA 1COV3 1P8JA 2OQ6A 3NL1A 1JYWA 4Q8KA 1O59A 1ZBA1 1B35A 5C8CC 2RDSA 1VMHA 5ANNA 1YFYA 2OUHA 4BK4A 1C8M1 1ND2A 4BH9A 2YBPA 1WZXA 1QGLA 4GJZA 4ZS3A 4CUAA 2GNMA 3SMHA 4YVWA 2PQQA 2E7QA 3S5QA 1OI6A 2VU9A 2QDRA 1HB1A 1LU1A 3GNEA 1ULOA 3OPWA 1YJLA 4MX3A 2DCKA 3AKSA 5FWEA 3WG2A 1VBD3 2YZ4A 3IKWA 4OHYA 3S57A 2BDRA 3DPRA 5DUXA 3FBYA 2QZ3A 4K6BA 2DURA 3H7JA 4W6WA 3KCCA 2JXAA 1FATA 1Y43B 1BEV2 1RUC3 3SCGA 2WN3A 2XHKA 3IAQA 4UYBA 3VBFB 3WUDA 4B4RA 2Z4FA 2CV6A 5C3OA 3O14A 1ZA7A 3H1WA 2WS91 4FP3A 1QDOA 1RMU2 1F5FA 4E4ZA 2Q1FA 1W2NA 1OOPB 4RFRB 3T0BA 4G4FA 5IHRA 2BJSA 1ODNA 2VJXA 3KT7A 4LK7A 4H14A 4LJHA 3VHPA 4XYXA 5HCFA 4PJYA 4AI9A 5JVVA 1UMHA 1XE8A 2PHDA 3AVRA 4RS5B 4YYOA 1COV1 2YROA 4Y4RA 4EV0A 4A6OA 1FPN3 3BTAA 3WOGA 2DCZA 4R9DA 2I74A 1NXMA 3RJRA 5DDJ2 3MF9A 2D6PA 5FO7B 3T4HB 2XJQA 3WF2A 1ND3A 4JDMA 1HN0A 2F4LA 1PNGA 2W2IA 4FPKA 4LBQD 2VCCA 2ZHNA 3O1TA 2H6BA 1UOJA 1MS5A 4N90A 5CFCC 1DGRN 1DG6A 4ASKA 5A3PA 1DQ2A 1W6OB 4QKNA 2W3JA 1OKQA 1VBD1 5FY0A 1W8TA 4IEZA 3WHUA 1R1ZA 3PMSA 2W1QA 2J1SA 2ZTNA 5A3TA 4PLMA 2WQZC 3HAGA 4MOAA 2XVKA 2H0VA 1VBC3 1RUC1 1PK6A 4CCKA 4AI2A 4AVBA 4P9WA 1F2NA 3MIEA 1NY72 3MO4A 2ZX4A 3C7OA 2R0FA 3DYOA 1PVXA 3VBSA 4OFGA 1F5JA 3TB0A 4IV1C 1DDLA 1GOGA 2XXZA 2YGLA 5IK7A 1S1AA 1Q8OA 4ZU4A 2G1MA 4Q5OA 4K3UA 4CSWA 2WFF3 1IS4A 3NWKA 3ZFEA 4EE2A 5GZGA 1TNFA 3H3ZA 3MW2A 1FPN1 3ZSJA 3H1MA 1VBE2 2WZR2 3EJKA 4X8NA 2Q8CA 4ASMB 2VNGA 4HVQA 4DXSA 5LY1A 5LZ6A 1CX1A 4LBJA 4QPIB 1IZ3A 3IMNA 3AMQA 1LRHA 4YZ2A 5BNOB 4M3CE 1LOFA 2WRAA 4YG0A 1EV12 1LGBA 1T6BX 1LULA 5HCBA 5BNPC 3NMBA 3UL2A 1BK0A 3SH5A 4XFGA 4CDXC 5JXIA 1B09A 4QX5A 2CNAA 4ARYA 3PU3A 1S0GA 1TME3 3HN1A 4KU8A 5LK5A 4MHRA 5BXXA 4YVSA 4AFMA 1MS1A 4JC1A 1VBC1 1JH5A 4XJ9A 3SC7X 3ZR6A 4JKMA 5FZCA 2VUJA 5J98B 4Z1VA 4ISQA 4KGQA 5FO9B 1R092 3H42B 5FP9A 3TYJA 3LA7A 3BIWE 1RC6A 2VAUA 5FAXA 3VV1A 2WQ4A 4A6SA 3BI3A 2GNBA 2B9VA 4AEDC 2V73A 4QQHA 5FY4A 1O3RA 5JOYA 3PHMA 2WFF1 3ZYJB 4CDQC 4F83A 1RUD3 4YW3A 4QPWA 2E7TA 2PQSA 3W9AA 2VTXJ 1VJ2A 3HNBM 2G9GA 2RM23 4META 3O1PA 1GWKA 4JGZB 3QLQA 1T6GC 3GDBA 2FMDA 4AE2A 3E5XA 1X50A 4LPLA 4CDWB 4XILA 2QQNA 1V0AA 1HXS3 2VVEA 3BPSA 3V56A 1RUH2 1OQ1A 2JDKA 4Z82A 1KJRA 5H9SA 3BOPA 3UYJA 2ZMNA 1D4VB 4RQPB 2QQIA 3AVSA 3PMEA 4Q4W2 4FTBA 3ON7A 1AF9A 3NNLA 1H2NA 1TME1 1HN1A 4NROA 2WYFA 3RZKA 2FZ1A 4XMIA 4QM9A 4BXSV 5D8AC 1XNAA 4CU8A 1SLLA 2HWB3 2YG0A 3GZTB 5D1IA 5LY2A 3VBOB 4MUVA 4QD2A 1W6PB 1XNBA 2XR4A 1SLIA 4FPFA 4NVPA 2RE9A 2CDOA 2YPJA 2P3IA 2AEYA 4AAXA 3R0RA 5IFPA 2VMHA 1J58A 3OCPA 3WDYA 2JDUA 4LK6A 3UGFA 5I8YA 4X8PA 4MGZE 1UNBA 1JU3A 2A73B 3C8XA 2FCTA 2YBSA 2VMEA 3MBWA 1DGRA 3HN3A 5FIXA 1OT5A 5FXWA 1RUD1 1SACA 3H0OA 4QB6A 2QKDA 3KGLA 2RM21 1GBGA 4XXPA 1W8OA 1DQ4A 3S7EA 3ZXJA 3U07A 3IBMA 3C3VA 4QT6A 2CGOA 5CIRA 1FMD3 1ZX5A 2BTVC 2PAEA 2QNKA 3PL0A 5C8CA 1BLZA 1OKOA 1VRH3 2QZ2A 2X5IB 3M70A 1H1AA 2ZJCA 4HSLA 3UETA 5C6CA 5BNNC 1HXS1 2WA3A 1OLMA 1KFUL 3RS6A 1GWMA 5IAXA 2WR9A 4NPLA 4HSJA 3USUA 4LBNA 2Z69A 1UIKA 4YG6A 3ZYPA 2VL4A 4WVVA 2RS33 2PA7A 3PTRB 5GZDA 3POFA 2H0BA 1RUJ2 3BN6A 2DDUA 2JE9A 4YNIA 4CA9A 4Z92B 2AUYA 4RSUA 4EN9B 4XEZA 1G9DA 5C5UA 5IVBA 3I97A 2GC0A 4H7MA 2CYFA 1L7QA 1OUXA 2RR12 3LQCA 4M0HA 4EYUA 2R062 3GCWA 4ET7A 2HWB1 1JBCA 5CU1A 1RUG1 1JUHA 2VO5A 4IXLA 3PTYA 5BYNA 1CIWA 5LB6A 2RS52 1OF3A 1GOHA 1YCIA 1S2BA 2OXBA 4JHZA 2XL9A 4JQTA 4R8HA 1LEDA 2RDQA 1DFQA 3H3LA 4OZOA 1HQWA 2VCAA 1R082 3E1F1 3V0BA 1XJAA 4UW6A 2ENRA 4OI2A 4K8FA 3TBDA 2H6CA 2X10A 4YZ3A 2B45X 3Q9OA 3VBHC 5DZFA 1FMD1 4BMBA 1JZ2A 4LT5A 4DO0A 1BMV1 1BEV3 1VRH1 4P9JA 4AQ2A 1UXXX 2JJ6A 2P34A 2W94A 3IM0A 3ZXDA 2R32A 4RHV2 5EPAA 1DQ6A 2IXCA 3HT2A 4LNVA 3M3OA 4QXKA 3O1OA 1UL9A 4YW7A 1BQPA 3FFQA 2C9AA 4FOYA 1IS5A 1NG0A 5AVAA 1L3JA 2RS31 4XZPA 3VZMA 2WL1A 2Q8EA 3ZFGC 4OI0A 4K1YA 1U5YA 1OLRA 1VLNA 3GJBA 3ZN6B 1GZ9A 2J7MA 3RWKX 2GN7A 2R1BA 3PVBB 4LKSA 1NE4A 4EZHA 2ES3A 3H50A 4ZXEA 5FYBA 5FO8B 3WVJA 1M06G 4E2GA 2UWAA 1FT9A 4BPZA 2O8OA 2PHRA
chains in the Genus database with same CATH topology
3UYJA 5FUNA 5F32A 5A80A 3AVSA 5FPLA 5A7SA 3N9LA 2W2IA 4V2WA 3KV4A 5FY5A 5A7OA 3RVHA 5FP7A 5IVJA 4CUGA 5A7NA 4BISA 5FZHA 3N9MA 5FY7A 2OX0A 4ASKA 5FUPA 5LY2A 5FYSA 3ZPOA 5FY8A 5F39A 5A3PA 5IVFA 5FZ9A 5FY0A 5FZDA 5FPVA 5A7PA 5F3GA 5FPBA 3KV6A 2WWUA 3N9NA 4XDOA 5F2SA 4BXFA 5FZ8A 5A3TA 2XUEA 4IGPA 5FPAA 5F37A 5FXZA 3AL5A 4CCKA 5FYHA 2YU1A 3U4SA 2YBSA 5FXWA 5FZGA 5FXVA 5IW0A 4QU1A 5A1FA 5ANQA 2YPDA 5IVYA 4BU2A 5FYCA 3PUQA 2YBKA 5IWFA 4D6SA 3OPTA 5FZLA 3PURA 4Y33A 4E4HA 3KV5A 4CCOA 3LDBA 2XXZA 5F5CA 4GAZA 4IGQA 5FP8A 5FZEA 4CSWA 3K3OA 4XDPA 5KR7A 4UF0B 2WWJA 5FYYA 3N9PA 4LIVA 2XMLA 4UF0A 4CCNA 5F2WA 2Q8CA 3K3NA 4NUBA 4CCJA 5FP3A 3PTRB 5LY1A 5FYMA 5FV3A 3PUSA 3N9QA 5FZMA 5FJKA 5IVBA 2OQ6A 4LITA 5LW9A 3KV9A 5IVCA 4V2VA 4IGOA 4EYUA 5E6HA 5IVEA 4GD4A 2OS2A 5FY1A 3KVBA 4HONA 5FPUA 1VRBA 5FZ0A 2XDVA 5FXXA 4QXCA 5FZOA 2YBPA 5A3NA 4GJZA 5FJHA 3PU3A 5K4LA 5F5AA 4QXHA 5FP4A 4CCMA 2P5BA 5CEHA 5FY9A 3K2OA 5FYVA 2GP3A 3PU8A 4TN7A 2PXJA 3OPWA 3KVAA 5FWEA 4C8DA 4EZ4A 4GJYA 4LIUA 2YU2A 5FZCA 3DXUA 3DXTA 3PDQA 5FZFA 3N9OA 5LWBA 5FP9A 5ISLA 5FWJA 4QX7A 5FYIA 5A3WA 5F3EA 4Y3OA 2OT7A 5A7WB 3AL6A 2OQ7A 4HOOA 5FYZA 5FZAA 5A7WA 5FZ6A 4DO0A 5A1LA 5FY4A 5FZ4A 4D6RA 4D6QA 4AAPA 4DIQA 5FBJA 5FZOB 2GP5A 5F3CA 5F5IA 5FZIA 2VD7A 3LD8A 4QXBA 3U78A 5FZ7A 2Q8DA 5FZ3A 5FYTA 4LXLA 5F3IA 2Q8EA 4QWNA 4URAA 3PUAA 4AI9A 3AVRA 4Y4RA 5FZ1A 4CCLA 4EZHA 5IVVA 5FZBA 5FYUA 5FYBA 5FZKA 4QX8A 5A7QA 3NJYA 3ZLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UYJ A;  5FUN A;  5F32 A;  5A80 A;  3AVS A;  5FPL A;  5A7S A;  3N9L A;  2W2I A;  4V2W A;  3KV4 A;  5FY5 A;  5A7O A;  3RVH A;  5FP7 A;  5IVJ A;  4CUG A;  5A7N A;  4BIS A;  5FZH A;  3N9M A;  5FY7 A;  2OX0 A;  4ASK A;  5FUP A;  5LY2 A;  5FYS A;  3ZPO A;  5FY8 A;  5F39 A;  5A3P A;  5IVF A;  5FZ9 A;  5FY0 A;  5FZD A;  5FPV A;  5A7P A;  5F3G A;  5FPB A;  3KV6 A;  2WWU A;  3N9N A;  4XDO A;  5F2S A;  4BXF A;  5FZ8 A;  5A3T A;  2XUE A;  4IGP A;  5FPA A;  5F37 A;  5FXZ A;  3AL5 A;  4CCK A;  5FYH A;  2YU1 A;  3U4S A;  2YBS A;  5FXW A;  5FZG A;  5FXV A;  5IW0 A;  4QU1 A;  5A1F A;  5ANQ A;  2YPD A;  5IVY A;  4BU2 A;  5FYC A;  3PUQ A;  2YBK A;  5IWF A;  4D6S A;  3OPT A;  5FZL A;  3PUR A;  4Y33 A;  4E4H A;  3KV5 A;  4CCO A;  3LDB A;  2XXZ A;  5F5C A;  4GAZ A;  4IGQ A;  5FP8 A;  5FZE A;  4CSW A;  3K3O A;  4XDP A;  5KR7 A;  4UF0 B;  2WWJ A;  5FYY A;  3N9P A;  4LIV A;  2XML A;  4UF0 A;  4CCN A;  5F2W A;  2Q8C A;  3K3N A;  4NUB A;  4CCJ A;  5FP3 A;  3PTR B;  5LY1 A;  5FYM A;  5FV3 A;  3PUS A;  3N9Q A;  5FZM A;  5FJK A;  5IVB A;  2OQ6 A;  4LIT A;  5LW9 A;  3KV9 A;  5IVC A;  4V2V A;  4IGO A;  4EYU A;  5E6H A;  5IVE A;  4GD4 A;  2OS2 A;  5FY1 A;  3KVB A;  4HON A;  5FPU A;  1VRB A;  5FZ0 A;  2XDV A;  5FXX A;  4QXC A;  5FZO A;  2YBP A;  5A3N A;  4GJZ A;  5FJH A;  3PU3 A;  5K4L A;  5F5A A;  4QXH A;  5FP4 A;  4CCM A;  2P5B A;  5CEH A;  5FY9 A;  3K2O A;  5FYV A;  2GP3 A;  3PU8 A;  4TN7 A;  2PXJ A;  3OPW A;  3KVA A;  5FWE A;  4C8D A;  4EZ4 A;  4GJY A;  4LIU A;  2YU2 A;  5FZC A;  3DXU A;  3DXT A;  3PDQ A;  5FZF A;  3N9O A;  5LWB A;  5FP9 A;  5ISL A;  5FWJ A;  4QX7 A;  5FYI A;  5A3W A;  5F3E A;  4Y3O A;  2OT7 A;  5A7W B;  3AL6 A;  2OQ7 A;  4HOO A;  5FYZ A;  5FZA A;  5A7W A;  5FZ6 A;  4DO0 A;  5A1L A;  5FY4 A;  5FZ4 A;  4D6R A;  4D6Q A;  4AAP A;  4DIQ A;  5FBJ A;  5FZO B;  2GP5 A;  5F3C A;  5F5I A;  5FZI A;  2VD7 A;  3LD8 A;  4QXB A;  3U78 A;  5FZ7 A;  2Q8D A;  5FZ3 A;  5FYT A;  4LXL A;  5F3I A;  2Q8E A;  4QWN A;  4URA A;  3PUA A;  4AI9 A;  3AVR A;  4Y4R A;  5FZ1 A;  4CCL A;  4EZH A;  5IVV A;  5FZB A;  5FYU A;  5FYB A;  5FZK A;  4QX8 A;  5A7Q A;  3NJY A;  3ZLI A; 
#chains in the Genus database with same CATH topology
 4XJU A;  1SZB A;  3CL1 A;  5GLW A;  2C0Z A;  5GLZ A;  1K12 A;  4ZHN A;  2DCY A;  2P4E A;  2NQY A;  3KV4 A;  3WCS A;  3IDC B;  2E33 A;  3VL8 A;  5LCW L;  1DLC A;  1LJ7 A;  4A42 A;  3RZM A;  1C57 A;  1QOT A;  4FCA A;  5FZH A;  3MLK A;  1UMI A;  1UPS A;  2XB6 C;  5EYY A;  5FZ9 A;  1WW6 A;  2VBD A;  4XMA A;  3MW3 A;  1JYT A;  3WHT A;  4Q8L A;  4AWD A;  4BQ1 A;  3OUJ A;  4IV1 A;  4Y1V A;  1LOD A;  1BZW A;  1NUK A;  1OSG A;  4L0P A;  1HX6 A;  3AMN A;  5C3R A;  4WM7 C;  3PUI A;  4RD7 A;  4WM8 C;  4RR3 B;  1NA1 C;  4LO6 B;  1YIF A;  2ARB A;  3U1X A;  3LPG A;  2P3Y A;  2PHT A;  3WDV A;  1BEV 1;  2UWC A;  4IEX A;  4CP9 A;  1JUI A;  5ACA 2;  4MV2 A;  2VW1 A;  2XBO 2;  3R05 A;  4DUV A;  4ZZ8 A;  4IEP A;  5JDB A;  4GZ9 A;  4FFI A;  2EXI A;  5C9A C;  5A3U A;  3PIG A;  2HWF 2;  5SV5 A;  4Z2W A;  4N43 B;  5T5P A;  1RMU 1;  2AGS A;  4JAA A;  3VD3 A;  2RDR A;  1UIJ A;  4QGN A;  4N9H A;  4QDS A;  2B9U A;  1XNK A;  2ERF A;  2FBE A;  3GXU A;  4GWI A;  4XFA A;  4CUC A;  3WP5 A;  2J1V A;  2OUJ A;  1AYN 2;  2A6V A;  5KHK A;  4M00 A;  3POJ A;  2VY0 A;  3FLP A;  1BCX A;  4COW A;  5BNP A;  1CZV A;  4PBO A;  2DU1 A;  2IWG B;  4MHU A;  1VBE 3;  1TMF 3;  2WZR 3;  1NT0 A;  4K9S A;  2JDM A;  1AXZ A;  2O14 A;  3MV1 1;  5FYM A;  1WD4 A;  4XC9 A;  2GC1 A;  2D40 A;  2VZ3 A;  2YC4 A;  1CAX A;  3VGI A;  2CDP A;  1OLM E;  2ZAB A;  1DP0 A;  3AX4 A;  2RHP A;  4RA0 A;  4UBH A;  1ZZC A;  5T54 A;  1OQE A;  2W39 A;  2WIN B;  1G86 A;  2V72 A;  5CKN A;  5B2G B;  4IV3 B;  3PJQ A;  5FY1 A;  4UFL A;  1EV1 3;  2W87 A;  1UQX A;  3KZ4 C;  5FZ0 A;  2C4X A;  2EF6 A;  1E5R A;  1JYX A;  2W92 A;  1GLH A;  3S5A A;  2YDE A;  3QD6 A;  2CGP A;  4AED A;  4OUM A;  1Y9M A;  5FJH A;  2RJK A;  2ZEY A;  2XG3 A;  3OEB A;  4I09 A;  4QXH A;  2R1D A;  3ZN4 A;  3E6D A;  1VAL A;  4CDQ A;  1UY3 A;  1YXW A;  3AMM A;  4AYU A;  4TN7 A;  2ZEX A;  3ZM8 A;  4Q0S A;  1S2E A;  4LBO A;  3AC0 A;  2A3Y A;  4OCT A;  2BGP A;  2ZX1 A;  3ST7 A;  3DXU A;  3AYE A;  1NY7 1;  1N1Y A;  2ZGT A;  2QQP A;  3FN9 A;  1HLC A;  2ZX0 A;  1X9P A;  3VBF C;  5I0S A;  1IHM A;  4AGV A;  2B5H A;  4QKF A;  3RQ0 A;  2WSU A;  3AZZ A;  4IE4 A;  2MHF A;  1QNW A;  4TWT A;  1IGO A;  3POS A;  4RGG A;  1PZ9 A;  4AHW A;  4TZD A;  1QF3 A;  3K51 A;  2P6C A;  1O4Z A;  2J1A A;  1UAI A;  3OGV A;  3FUO A;  3J7L A;  2IUW A;  4XHX A;  1U0A A;  4XW3 A;  5F5I A;  2VMD A;  1VBE 1;  1TMF 1;  2WZR 1;  2ZPX A;  5L7O B;  3JD7 2;  4NRQ A;  4A41 A;  3E97 A;  3UGG A;  5A6Q A;  1W2T A;  2BGO A;  4JGY A;  5D8A A;  5HBA A;  2W47 A;  2HWE 2;  4E8C A;  3NNF A;  4NMI A;  5JIU A;  2DV9 A;  3IT8 A;  4FPY A;  2GMM A;  1DF0 A;  1WUV A;  2L9L A;  1SLC A;  3S7I A;  1VIW B;  1RUH 3;  5DG1 A;  4GWJ A;  3I3M A;  4LKD A;  1EV1 1;  5FR3 A;  3WNM A;  1TQ5 A;  2BFU L;  1PO1 2;  4QU2 A;  5DMY A;  1ST8 A;  1W39 A;  4Q4W 3;  1H8T B;  4Q4V 2;  1JZ3 A;  1NXD 1;  1HB3 A;  3WD5 A;  4V2W A;  3RVH A;  1O7F A;  3GCX A;  1S4C A;  1QQP 3;  3WW2 A;  3CEW A;  5H9P A;  5DG2 A;  1SLT A;  3K75 B;  1OH4 A;  2VM9 A;  2XOM A;  4HN0 A;  3FHA A;  1LOG A;  1X36 A;  3U37 A;  4DQA A;  1ZRE A;  4Z2A A;  1SFN A;  1WBF A;  2RDN A;  2QBX A;  3GHM A;  4CEW C;  4AXO A;  5FPB A;  3KV6 A;  3Q8E A;  1R09 1;  2A71 A;  2CGN A;  3MPB A;  2FCV A;  4PIX A;  2VW0 A;  4OHZ A;  5BNN A;  3HBZ A;  2A6W A;  2DVG A;  4DB5 A;  4SBV A;  1W9T A;  1E5H A;  2KXL A;  3AL5 A;  3FC0 A;  5FYH A;  5JZG C;  2C1F A;  3CJX A;  4XBQ A;  1ZNP A;  1QJU 3;  2WT2 A;  3WXP A;  2X8K A;  4JVA A;  3PVN A;  4W8J A;  5FTT C;  2WT1 A;  3CKH A;  2RJL A;  5E88 A;  1AUY A;  2A7A A;  2WNV C;  3BOD A;  3M7A A;  1MVE A;  2B46 X;  3VDA A;  2E53 A;  2UY9 A;  1IG3 A;  5L19 A;  1CAW B;  4MGK E;  5F5C A;  5GJ6 A;  4CVU A;  3ZIX A;  3DKW A;  2R49 A;  1Z78 A;  2A75 A;  3NST A;  3U10 A;  3Q8C A;  4ATF A;  1UYX A;  1YFU A;  3JB4 C;  1U5Z A;  3V0A A;  2EXK A;  1RUH 1;  2GAL A;  1O8P A;  1AL2 2;  2D3R A;  2GMP A;  2LS6 A;  2GH8 A;  2BVB A;  2G4I A;  2K2S A;  5BPX A;  1VE0 A;  4LLF A;  4Q4W 1;  3RI9 A;  1RUJ 3;  5BNO C;  5KHI A;  1H4H A;  1X9T A;  2K0G A;  1OFN A;  4JQR A;  4AFA A;  1QQP 1;  3QCW A;  3QAC A;  2D6K A;  4V2V A;  2XLG A;  2WZP P;  1SFY A;  3OSD A;  3I59 B;  1RTV A;  1LOC A;  2R06 3;  3NAP A;  1LGN A;  3WV6 A;  2OS2 A;  4MGS A;  1RVF 2;  4AOC A;  3NV3 A;  4LHK A;  4S2D A;  2FHR A;  1EAH 2;  5ERL A;  3H8X A;  3CQO A;  3VBH A;  2KR2 A;  2P2K A;  2UY8 A;  2JDN A;  4YRD A;  2PLV 2;  2BNM A;  4XF1 A;  1GQP A;  3O1R A;  5FPZ A;  2DVF A;  5FDB A;  3VUO A;  3J7H A;  3ES1 A;  4PHZ A;  4WV8 A;  1NCR B;  3THC A;  4BJ0 A;  3BAL A;  4UWD A;  5K8S A;  2DWR A;  4R9C A;  3DF0 A;  1QJU 1;  3PVE A;  3ZFG A;  1N3O A;  1YO8 A;  3IN9 A;  3NKG A;  4DXR A;  2PHW A;  3ITQ A;  3JBG 2;  2JG8 C;  2PAM A;  4P5Y A;  5F6L B;  4HKO A;  1W6N B;  3MEP A;  5A3W A;  3WNN A;  5A7W B;  2BBV A;  1NLR A;  4Q1P A;  4UW3 A;  3R4D B;  1UZZ A;  4P02 B;  4EN8 B;  2XLA A;  1W05 A;  4B29 A;  1AR6 2;  1F35 A;  3PJY A;  4L97 A;  4XJ8 A;  3PUH A;  2D98 A;  1F4A A;  4LKF A;  4IET A;  3ZSL A;  1H6Y A;  3HT1 A;  1JN2 P;  2CWS A;  5FZO B;  2GP5 A;  2JKB A;  4P08 A;  3THD A;  5I93 A;  1K5M B;  3S0M A;  4BB3 A;  1ZVF A;  3N7K A;  1GZW A;  4Q0Q A;  3ZXL A;  5F3I A;  3BTZ A;  1NYW A;  4URA A;  1H2L A;  4QQ2 A;  1C28 A;  3HEI A;  1RUJ 1;  3LEK A;  3KHC A;  3JXS A;  4NHY A;  1UZY A;  1W2U A;  2YUE A;  4RQP C;  3USS A;  5EIY B;  4B4Q A;  4ERO A;  4FVV A;  2R06 1;  4MXW B;  5A7Q A;  5J48 A;  4WM7 A;  2EIG A;  2XUM A;  3WDX A;  1KQR A;  2D3P A;  1OXC A;  1Y9Q A;  4NAO A;  3IDE A;  1YQ2 A;  2X09 A;  1QEX A;  2MEV 2;  1NA1 A;  4WM8 A;  5FPL A;  3RZZ A;  2DUP A;  4LO8 A;  2EXJ A;  2P1B A;  3VBO C;  3RZL A;  2R6Q A;  4BYY A;  3AMH A;  2NMN A;  2E7A A;  2ZML A;  3ACG A;  3WDW A;  4AVS A;  1ULF A;  2QFE A;  4CU7 A;  5B4N A;  5C9A A;  5K0U A;  1J84 A;  2LM3 A;  4FOV A;  3LOB A;  3CHX A;  1PX4 A;  4GWM A;  3W5N A;  5I0R A;  1UKG A;  1BHG A;  5A7P A;  3ZSE A;  1WW5 A;  2WO1 A;  4YAR A;  3WW3 A;  2DUQ A;  1AX1 A;  1W6Q B;  2W1W A;  4NE9 A;  1JOB A;  2V09 A;  4MH0 E;  1U5I A;  2ZKN A;  1OVP A;  4YW5 A;  4XHB A;  2F17 A;  1LOA A;  1NX9 A;  2XBO 3;  4W6Y A;  2HKX A;  4QKB A;  1UY4 A;  5FQ0 B;  3B3Q E;  4E9K A;  1Q8Q A;  2HWF 3;  3DYM A;  4QQP A;  1NCQ C;  3WDU A;  4I2O A;  4O65 A;  3MZH A;  5CIS A;  1J59 A;  1IKP A;  1ZBA 3;  3ENR A;  4JV4 A;  1AYN 3;  1Q5O A;  1VBA 2;  1V6N A;  3OGG A;  1JYV A;  1ZRC A;  1VAV A;  1UYZ A;  2XGX A;  1K5J A;  3SKJ E;  3K77 A;  1JZ8 A;  3SH3 A;  1GR3 A;  5ABJ B;  1TZO A;  3AK0 A;  1RED A;  4JRA A;  4CCN A;  4FFH A;  2OKX A;  3BPZ A;  1XNC A;  1RXG A;  1Q8P A;  5F1R A;  4ZXK A;  1V6O A;  5GLT A;  3J8F 2;  4AEM A;  4AL9 A;  1HIX A;  2VOX A;  4MLO A;  3IPV A;  2BU9 A;  2WNU C;  1UY0 A;  2YFU A;  4H7L A;  3LPF A;  1XYN A;  4AHZ A;  3TEX A;  1AXK A;  1GP5 A;  3NJX A;  3RG0 A;  1UY1 A;  3VBR B;  1N47 A;  3VKO A;  1QH6 A;  4Z8B A;  5JCT A;  1S0D A;  3VN4 A;  1FNZ A;  5JXH A;  1IKQ A;  3HMY A;  1KXG A;  1LOE A;  2BOI A;  3LOI A;  3PVO A;  2P3K A;  3BYW A;  4FPG A;  4AVV A;  4EN6 B;  1V9U 2;  5CG8 A;  3I4I A;  1ULC A;  3PU8 A;  4UBG A;  1Y3T A;  3HBK A;  4UI9 L;  2RVA A;  3MYX A;  4QX1 A;  3HD8 B;  1O4T A;  4KU7 A;  3D5O A;  1IPS A;  1UZW A;  2XBO 1;  4I3G A;  2CSG A;  2D6N A;  4CEY C;  2UYB A;  2WLQ A;  5ACA 1;  4X6Q B;  5IK8 A;  2D6O X;  1TEI A;  2HWF 1;  2YB7 A;  1ENX A;  1WWY A;  4IL7 A;  2HWD 2;  2ZXQ A;  4K8R B;  5C5T A;  1JHJ A;  2YFZ A;  3AL6 A;  2BFU S;  4BQ2 A;  4XFC A;  5A1L A;  3IAP A;  1XU1 A;  1AYN 1;  1SBF A;  1WA6 X;  4NPR A;  1ZZ9 A;  1F31 A;  5JOZ A;  3I2I A;  4P9G A;  1S0C A;  1X8E A;  5FBJ A;  1RYY A;  3V65 A;  1PVC 2;  1LB2 A;  2J1T A;  3CJI B;  2KA3 A;  4LUK A;  3VKF C;  4I0B A;  5FZ7 A;  1OA2 A;  3JD7 3;  3HR9 A;  4UFJ A;  3RDI A;  4BM8 A;  5I8S A;  3UJQ A;  5G05 L;  5CFD B;  1A8M A;  2HWE 3;  2OVU A;  3AZX A;  1JI6 A;  3JQX A;  3O0X A;  4PDW A;  4IUG A;  1H1M A;  2QTW B;  4L11 A;  4CEW A;  4M4P A;  1DBN A;  4MAD A;  3H8O A;  1CAV A;  2NZ9 A;  4LE3 A;  3MGU A;  3QOP A;  5JXG A;  3RYP A;  3T1L A;  5A80 A;  3AYD A;  2JG9 C;  3OJB A;  2JDZ A;  5JZG A;  3WF1 A;  5L9R A;  4S2F A;  2WUH A;  3RSJ A;  1ZZB A;  3I8T A;  3ZYI B;  1WCQ A;  3ZPO A;  2O8Q A;  1FAY A;  2WNV A;  4QX2 A;  4Q4X 3;  4JCK A;  4QHO A;  4RR3 C;  3ZO0 B;  1W06 A;  2Y8K A;  2BBA A;  4YZ5 A;  3LKJ A;  3ALQ A;  4JKL A;  4ARX A;  4AGR A;  1W2A X;  2C9K A;  2XUE A;  3P1I A;  4XTM A;  3VD7 A;  3AXD A;  4B1L A;  1DZT A;  4NR1 A;  5J3U A;  2ZS6 B;  3TEW A;  1WD3 A;  3B5L B;  2CHH A;  2R04 2;  2ZHM A;  3K4Z A;  5ANQ A;  1JZ7 A;  2ARX A;  2JEM A;  3JU9 A;  1C3H A;  2D7F A;  5GZF A;  2QJV A;  4D6S A;  1XND A;  3JD7 1;  4LA2 A;  1DGL A;  2E6V A;  3OY8 B;  4BIO A;  3DGT A;  3FJS A;  4UOJ A;  2P37 A;  4FPJ A;  1JZ5 A;  4OMD A;  4YPJ A;  2HWE 1;  1W8U A;  4XDP A;  4HFS A;  1YFW A;  1W6M B;  3HPN A;  3N9P A;  4V1P A;  4M3C B;  1RHI 2;  4QB2 A;  5T5O A;  4LHN A;  2R30 A;  2ZGO A;  4KWU A;  4HG6 B;  4W65 A;  4XAA A;  5CNA A;  2RMU 2;  3ZYF A;  1WCD J;  1R64 A;  4Q4V 1;  5JXJ A;  1DYP A;  4IV3 C;  2VUC A;  1B35 B;  1LHN A;  1STM A;  2KM2 A;  3EO6 A;  1MVQ A;  2WC2 A;  2JG8 A;  2JDA A;  1ND2 B;  4HON A;  4Q4X 1;  4BCU A;  2PHF A;  1EAH 3;  5KHH A;  4X6R B;  1OFS A;  1RUI 2;  3FX3 A;  1WLC A;  2Y0O A;  4I0A A;  4YVW B;  1SPP A;  3MF6 A;  4XAE A;  2IXI A;  2PLV 3;  1CJD A;  4DS0 A;  3NV2 A;  4HKL A;  5C3P A;  1O6U A;  4GMP 3;  1AR9 3;  3B01 A;  1BVV A;  1W0P A;  4HK8 A;  3WW1 A;  4P9I A;  4BQW A;  5CVR A;  1DZR A;  4Y1U A;  1DHK B;  3I54 A;  3DPR B;  2GME A;  2WJS A;  4GJY A;  4J25 A;  2VBB A;  1GNZ A;  3VD4 A;  4CCC A;  3IDB B;  1I9R A;  1HB4 A;  3VZK A;  3LSD A;  2B8M A;  2V4A A;  1L7R A;  4Y3O A;  5CKQ A;  4AFD A;  1G9F A;  1ONA A;  4NID A;  2FDG A;  1S2K A;  2VMC A;  2BGC A;  2VNO A;  1W9S A;  5FZ4 A;  3P5B A;  1US3 A;  2JB4 A;  4PBP A;  2CY6 A;  2YXS A;  2CAV A;  4RYD A;  3U78 A;  3VBO A;  4LXL A;  2IFW A;  1GAN A;  3QBQ A;  3WW4 A;  1GUI A;  4JDO A;  1HRI 2;  3WNO A;  3UT0 A;  4AK3 A;  2ZGU A;  2UUR A;  1OUR A;  1K3I A;  3SEE A;  5TSW A;  1KJL A;  1XOY A;  2A1X A;  1HKD A;  5FYU A;  1H8T C;  3EYP A;  3VHR A;  4LBL A;  4J6G A;  2ATF A;  4Y1Y A;  1ND3 B;  2ET7 A;  4IE7 A;  1UZ0 A;  3VDD B;  1EAH 1;  2WKK A;  3LA2 A;  1OD5 A;  4DUW A;  2MEV 3;  1UW8 A;  1Y4W A;  1S55 A;  2PLV 1;  5T55 A;  1FOD 2;  2ZGQ A;  3MI8 A;  3VKM A;  4QPG C;  1PIV 3;  4YWA A;  5C3S A;  2NYY A;  1IS6 A;  4GMP 1;  1AR9 1;  3N9M A;  2A70 A;  2NM1 A;  3WZ1 A;  1PGL 2;  2R16 A;  5FY8 A;  2HEY F;  1ASJ 2;  1G6N A;  5IFT A;  4HLT A;  3I2H A;  3WY6 A;  1NCQ A;  2MNG A;  5JI7 A;  1W8W A;  5IK4 A;  4OUL A;  4C1X A;  3SIT A;  2Y6F A;  3RNS A;  3NV1 A;  4B7E A;  4DEV A;  2A6Y A;  4YSF A;  5HV0 A;  1APN A;  4PIZ A;  3OBT A;  4CPB D;  1W8H A;  1YNA A;  2DUO A;  2VUA A;  3FHI B;  4PF1 A;  3B7M A;  1QJY 2;  3ROU A;  3O1S A;  4H55 A;  4LO4 B;  5JR7 B;  5A33 A;  2QVS B;  3U14 A;  2NP0 A;  1MZE A;  2QQK A;  5IVY A;  4BU2 A;  5A1F A;  1W3V A;  2FD8 A;  1GP6 A;  1WW7 A;  4COY A;  4JTN A;  1VAK A;  1W04 A;  1DQ5 A;  2DTY A;  3EHK A;  3VBS B;  4AEJ A;  4GMP 0;  3Q8A A;  4EWA A;  1WLT A;  2WNU A;  4FOQ A;  4GA9 A;  4N53 C;  3WX5 A;  3M4F A;  3EXU A;  4JKK A;  4CCO A;  3WEZ A;  3H9A A;  2VOV A;  3SNM A;  3ZFE B;  4ZU7 A;  2GN3 A;  4GAZ A;  1GV9 A;  3N7J A;  4GH4 C;  1RUG 3;  1EY2 A;  1VBA 3;  5FZE A;  1XYO A;  2WWJ A;  5EJ3 A;  1JYI A;  2XVG A;  4QQL A;  4YFZ A;  3I2F A;  5F2W A;  3VZN A;  4AI0 A;  1D7P M;  5B4X A;  2C24 A;  2IXJ A;  1REF A;  4ORF A;  4R4Z A;  3OBZ A;  2VZO A;  3LWC A;  5DUU A;  3J8F 3;  4C0B A;  3PUS A;  2MEV 1;  1FV3 A;  4WVM A;  2FMY A;  4BK5 A;  1PIV 1;  5IVC A;  2ARA A;  4CEY A;  2WAO A;  3WNP A;  2IFR A;  2PTM A;  4N7I A;  3AKP A;  5IVE A;  2EAA A;  1I5Z A;  4JZR A;  3ZIW A;  2DU0 A;  3HVD A;  1VP6 A;  2XJV A;  3CLP A;  1RXF A;  4DRV A;  4HL0 A;  1D2S A;  5GZC A;  1LES A;  2BWC A;  4DY5 A;  1NCR C;  1XNT A;  4PI0 A;  1JXN A;  5FP4 A;  4CCM A;  1V9U 3;  2JE8 A;  2P5B A;  2WQ8 A;  4JTO A;  1KDK A;  2JIJ A;  3ACI A;  4YVS B;  1Z7S 3;  3ATG A;  2J1E A;  1PGW 2;  3I2O A;  3I2G A;  1OBN A;  3KVA A;  4DMI A;  1AJO A;  1BVP 1;  2VZS A;  3E6B A;  4C8D A;  1V6L A;  1GNY A;  3DEM A;  3JUU A;  3K4A A;  3GBG A;  5FYI A;  1AYM 2;  3AMP A;  3DCQ A;  3K46 A;  1REE A;  2HWD 3;  3ZYH A;  2VCB A;  3RPQ A;  3VLB B;  2UYA A;  3U75 A;  1ZZ8 A;  1RB8 G;  1WMF A;  4YM1 A;  4WZC A;  1K5M C;  2JIC A;  2RS1 2;  1VBA 1;  2BZD A;  2JWP A;  3POI A;  4LBQ A;  3KF3 A;  4DIQ A;  5KWR A;  4J1W A;  3JQW A;  4XFF A;  4IQP A;  2W9X A;  2JG9 A;  3RRD A;  4NO4 A;  1S0J A;  4XE9 A;  3G6J B;  1MPX A;  4QXB A;  2IXH A;  3GZU C;  1W0N A;  4XCA A;  1CAU A;  4Y1Z A;  1BK1 A;  1XSQ A;  3WP4 A;  3J4U H;  1DZQ A;  1YQ8 A;  3J8F 1;  4O9G A;  5HCA A;  1S0F A;  1WLW A;  1ZBE 2;  4E2S A;  2XVL A;  4D0Q A;  4CDU C;  2P17 A;  2VZT A;  4RR3 A;  4HZF A;  5EWS A;  2VNR A;  2XJU A;  4QX8 A;  1O5U A;  4F7Z A;  1MQT C;  4HN1 A;  2LRP A;  1HB2 A;  1BJQ A;  3POY A;  1O3Q A;  4CXY A;  3N9L A;  3N7L A;  2VTX A;  1V9U 1;  3VZL A;  3AP9 A;  4AR2 A;  4A45 A;  3OBR A;  1Z7S 1;  5FY7 A;  5F8P A;  3FE5 A;  5A32 A;  2Z5W A;  3IMM A;  1RMU 3;  2EAL A;  4OZX A;  3EB7 A;  3BTY A;  3OD4 A;  2CU5 A;  3WT3 A;  3WF3 A;  4S2H A;  5CFC A;  2WWU A;  1WKY A;  2HLE A;  4PT6 A;  4IW3 A;  1O91 A;  1CIY A;  1KGY A;  2BER A;  2I2S A;  2HWD 1;  4COV A;  5C7G A;  2ZZJ A;  3L9J T;  5A6Z A;  4MZU A;  3VBU B;  3TEZ A;  2Q1M A;  2GND A;  1W9W A;  4LEJ A;  3WUC A;  5DDJ 3;  1YQ5 A;  4XIO A;  5M0T A;  2J1U A;  1XXN A;  1YRZ A;  3PUQ A;  2D44 A;  4LHS A;  4E4H A;  3KCX A;  4D7T A;  3GJA A;  5IT6 A;  3GBW A;  3LSE A;  1MEC 2;  3UGH A;  4L8Q A;  1LTE A;  1ZRI A;  3IIA A;  4MVT A;  4EWD A;  3T08 A;  3WP3 A;  4BZ4 A;  5HXV A;  4QM8 A;  1ZYB A;  4XJW A;  5KR7 A;  5LA9 A;  2PHU A;  3L2H A;  3ORJ A;  3USU B;  2WO2 A;  1SDW A;  4UF0 A;  4OUS A;  4Y20 B;  2XJR A;  1RHI 3;  4Q27 A;  5JIA A;  4NUB A;  4CCJ A;  3T0A A;  1EUU A;  4IND A;  4FAG A;  1RL3 A;  1N3Q A;  1H30 A;  1Q43 A;  3AYC A;  2HEV F;  3N9Q A;  2ZGM A;  2IXK A;  4RGK A;  4JX0 A;  4LIT A;  1PMH X;  2R07 2;  2VQ0 A;  2WZE A;  5CG9 A;  2HJI A;  4OHV A;  1ZM1 A;  2BVV A;  2Y33 A;  5JMO A;  5KC5 A;  3A21 A;  3OG2 A;  5GM0 A;  1RUI 3;  3OYW A;  3F2Z A;  4DUX A;  4M3C F;  1GU3 A;  1QDC A;  5FY9 A;  4FQZ A;  4IE5 A;  5FKC A;  3III A;  3MDP A;  5KHG A;  5L36 A;  1QXJ A;  4CU6 A;  1GKB A;  4OLL A;  4QB1 A;  4CDX A;  2Y0I A;  3HQR A;  5FK8 A;  2VVF A;  1SQ4 A;  3POB A;  3RYR A;  3TRS B;  4E4S A;  2NLR A;  4CPB A;  5A70 A;  3CF6 E;  5DDJ 1;  2YV8 A;  3V0B B;  2XQX A;  2XH6 A;  3AFG A;  3M3Q A;  3WQ1 A;  5ISL A;  4YM3 A;  4YM2 A;  4PF5 A;  1GZC A;  2D93 A;  4MGT A;  4A7Z A;  3TN9 2;  3THP A;  3A0N A;  4U2A A;  5FZ6 A;  3WQ0 A;  1CVN A;  3H8U A;  4YZ1 A;  2EA7 A;  4MYE A;  4AAP A;  1T2X A;  5T5J A;  3K48 A;  4LTA A;  1KIT A;  2V5D A;  3J7M A;  2GC2 A;  5CFD C;  1RHI 1;  1C8M 2;  3LA3 A;  2Q5T A;  4KBZ A;  3UJO A;  2VPV A;  2Q8O A;  3RZH A;  4QPG A;  2OA2 A;  2Q30 A;  3LEG A;  3ZFF B;  2DFC A;  1MS9 A;  3ILR A;  4HPK A;  4TXW A;  3AXE A;  1HRI 3;  2DF7 A;  3PUA A;  4GQ7 A;  3LZZ A;  1W2O A;  2VW2 A;  5T52 A;  4MXV A;  3OGJ A;  3T2Q A;  1LNS A;  3JCI A;  4BOW A;  1H8V A;  4BQX A;  1R09 3;  2YMZ A;  5C71 A;  1NZC A;  2Y6G A;  2AYH A;  4XQD A;  1RUI 1;  5LBE A;  4O7X A;  4OYU A;  1LEM A;  5FY5 A;  5FOJ B;  5D2A A;  5A7O A;  1UOB A;  1LKN A;  1X8M A;  4ZS2 A;  4BQ4 A;  4CUG A;  4TLG A;  1OOP C;  4BIS A;  1D0G A;  2ZBJ A;  3VD5 A;  4BIF A;  1I6X A;  3N36 A;  4QGM A;  4R4X A;  2O1Q A;  2DBN A;  3OB8 A;  1ASJ 3;  4GAL A;  5FZD A;  4IV1 B;  4RS5 C;  1XPW A;  5LA2 A;  4N53 A;  4YGD A;  4C1W A;  1H1I A;  3WP6 A;  1POQ A;  5DZE A;  4BXF A;  4XF0 A;  5JSR A;  2QQU A;  4GH4 A;  2ZMK A;  4L92 A;  5A3L A;  2XKO A;  4XFB A;  3VZO A;  3BUC A;  4FOW A;  4CP9 B;  2W46 A;  4MGY E;  1RIR A;  1QJY 3;  1VPH A;  3DEC A;  1X33 A;  5IW0 A;  5FK7 A;  2B39 A;  1PM7 A;  1YLL A;  2V5Y A;  2Y6J A;  3HNM A;  5IUQ A;  4D7S A;  3R6S A;  2ZGN A;  3ZMO A;  2XWB B;  3B93 A;  2UU8 A;  4KI5 M;  1TVG A;  2LTN A;  1UMZ A;  2LUW A;  3WQB A;  4Q0U A;  1O8S A;  1BBT 2;  4IER A;  5LAS A;  5HI0 A;  1HRI 1;  5BNP B;  3KS7 A;  3VDC A;  2ZCW A;  4HK9 A;  3RYK A;  3WNK A;  2QQL A;  5FOB B;  2WO7 A;  1G9C A;  1VBD 2;  2E26 A;  1NCR A;  2R7E B;  1RJ8 A;  3PLQ A;  3ZXE A;  1B35 C;  1EUT A;  4XAC A;  3EBR A;  4MGQ A;  2G9Z A;  1CAX B;  4NN0 A;  4QGL A;  4JRL A;  4G9S B;  1UOG A;  3ZMN A;  4KNC A;  2ORZ A;  1ND2 C;  4UFM A;  1RUC 2;  2JD9 A;  4FAH A;  3AKT A;  1PGL 1;  4PI2 A;  3ZDS A;  4DOU A;  5FPX A;  1XB9 A;  2WLP A;  1ASJ 1;  2QCS B;  2BPA 2;  1IQA A;  3NVC A;  4Q0V A;  4AED B;  1GYK A;  5FZO A;  1I3H A;  5A3N A;  1YIP A;  3N35 A;  3ZN5 A;  3B02 A;  1ZRF A;  5CB7 A;  4Y22 A;  1DIW A;  1LHO A;  3VHO A;  4K21 A;  5BV6 A;  2O0O A;  4XFI A;  1QNY A;  1QJY 1;  5FLH A;  2W0X A;  4DXT A;  1FPN 2;  2E9Q A;  1UU4 A;  3N3H A;  4QPI C;  3T4V A;  4ATE A;  3POE A;  1JMU B;  5J1X A;  2QDN A;  2WSV A;  3QH7 A;  4CP2 A;  1MS3 A;  4HVO A;  3MIB A;  1AYM 3;  2B4K A;  1CES A;  2SBA A;  3GF6 A;  4CDU A;  2WWS A;  5FYZ A;  3GZA A;  3NRU A;  5KXB A;  2RR1 3;  3H1Y A;  4YM0 A;  3OD0 A;  4HBN A;  1MQT A;  1A78 A;  1UWW A;  4IEW A;  4BLI A;  4LHL A;  4B8E A;  4D6Q A;  5I0U A;  4Y5Z 0;  1VB2 A;  1VMJ A;  5FKB A;  2RS5 3;  3J9S A;  3GM8 A;  5E8A A;  3HJR A;  4IES A;  3LFI A;  4JGY B;  5D8A B;  3DYP A;  4GWN A;  2KD7 A;  2VQT A;  1AZD A;  1ZBE 3;  3VDD C;  4UAP A;  5EXO A;  1PO2 2;  1R08 3;  2ILM A;  3RMY A;  3GYD A;  2GSY A;  1NLQ A;  4NHK A;  4Q1R A;  3ZLI A;  2EVX A;  1VBB 2;  3HOB A;  5F5Q A;  4A7K A;  5BUV A;  4FT8 A;  1QJF A;  5HPO A;  3ZKU A;  2ZGK A;  4NIG A;  2TBV A;  4JGZ C;  5A7N A;  3ZXK A;  1H6X A;  1UKR A;  4RHV 3;  1C1F A;  3RI8 A;  1F4H A;  1EP0 A;  4Y5S A;  3FL7 A;  4YLZ A;  1PGW 1;  2HYX A;  4CDW C;  2WAA A;  1MS4 A;  3I2D A;  3M3C A;  3BU7 A;  3LIH A;  2OPW A;  3BTX A;  1NE6 A;  3N9N A;  1CWP A;  1FX5 A;  3KGZ A;  5BNN B;  4U36 A;  1OA4 A;  5HCH A;  2E51 A;  3L2Y A;  1AYM 1;  5DAW A;  2VOT A;  2ZEW A;  1D4M 2;  4LUM A;  3RGB A;  4AI8 A;  4P14 A;  1ZRR A;  2AH2 A;  5FXZ A;  2RR1 1;  2YU1 A;  1G9B A;  4FQ4 A;  3ASI A;  3AYA A;  3TEY A;  1WA4 A;  4QU1 A;  1ULE A;  2RS1 1;  2A6Z A;  2YPD A;  1ENS A;  1TNR A;  2PMW B;  2VC9 A;  4D3W A;  5LRS A;  5E89 A;  4QX3 A;  5IWF A;  3BU0 A;  5LBB A;  2RS5 1;  3AZV A;  3ZX7 A;  3PUR A;  1KD7 A;  2FZ2 A;  4W50 A;  4XTP A;  3R4U A;  1ENR A;  4C90 A;  2JKX A;  2FDH A;  1MEC 3;  1TME 2;  1BXH A;  2SLI A;  5F9T A;  4XPV A;  3C7H A;  5C70 A;  3TNP B;  1ZBE 1;  4EQV A;  3V0A B;  5FYY A;  3WG1 A;  1R08 1;  1ALY A;  4BQY A;  4DZG A;  2C5D A;  1YI7 A;  5FP3 A;  4GXL A;  5H9R A;  2TUN A;  5KBF A;  1X82 A;  1LOF C;  2FDI A;  5L9B A;  5KXE A;  3OBA A;  3EMR A;  1OHF A;  2DVD A;  4YGB A;  5LA0 A;  4AQT A;  3KV9 A;  3NAP B;  2R07 3;  2XJT A;  4IGO A;  5ACA 3;  4RHV 1;  1W28 A;  1JW6 A;  4GD4 A;  1N1S A;  3VDB A;  1RUD 2;  3VBH B;  3VKN A;  2X5I C;  3KVB A;  3O0W A;  1XRU A;  1LEC A;  4YVS C;  3BB6 A;  3HNY M;  4TSV A;  3HWJ A;  1D2Q A;  2QQW A;  1ULG A;  1GMM A;  2BWA A;  4M4R A;  3P6B A;  3HQU A;  1ODM A;  5H9Q A;  3A4U A;  4MO3 M;  2PXJ A;  5LEK A;  1D0H A;  2BP6 A;  4OI4 A;  1MZF A;  1LHV A;  1WMX A;  3ZFG B;  1G8W A;  4NOT A;  5F7U A;  2AC1 A;  2JD4 A;  4S2G A;  3T2P A;  1QH7 A;  3FUQ A;  5FMC A;  3KQ4 B;  3LGR A;  1EPZ A;  2VG9 A;  4QX0 A;  5F3E A;  1RJ7 A;  2ZHL A;  4BHP A;  1M4W A;  1MEC 1;  4DFS A;  4LA3 A;  3D8C A;  3D4K A;  3LAG A;  4XOG A;  4CZS A;  3VBF A;  2F4P A;  1Q3E A;  3TOJ A;  1ULD A;  2D5F A;  2VMF A;  4DPN A;  4FSJ A;  1Q56 A;  1YJK A;  2RG4 A;  3B69 A;  4BLJ A;  4PLN A;  1OOP A;  4B4P A;  1WBL A;  2R0H A;  1AL0 G;  3LEI A;  4Y1X A;  4IEO A;  2YHJ A;  1Q8S A;  5EZW A;  4FI9 A;  1C5I A;  2XQR A;  1TG7 A;  1YQ6 A;  3F95 A;  1ZZ7 A;  3GHN A;  5C4W B;  4Q4Y 2;  4RS5 A;  5JSP A;  2R07 1;  2XPJ A;  2EIB A;  2JEC A;  3KHB A;  4WM7 B;  1YUD A;  3U4X A;  1C5H A;  1HQN A;  1UXZ A;  5CZK A;  5KXC A;  3ETP A;  2VVD A;  4WM8 B;  2LRO A;  3NJY A;  1NA1 B;  5I91 A;  3NV4 A;  3FLT A;  4NHX A;  3QH6 A;  2E32 A;  3AFK A;  3MFC A;  4UW4 A;  5L73 A;  4XJZ A;  2HWC 2;  4K20 A;  5C9A B;  5K0U B;  1Y7B A;  5KXD A;  1VRH 2;  5DAV A;  3FBM A;  3RMX A;  5CAZ A;  1BMV 2;  2VZ1 A;  2OX0 A;  5JPN B;  5FYS A;  3C2U A;  2V4V A;  3T09 A;  2ZGL A;  1CPM A;  3I3E A;  1W6O A;  5SV8 A;  1IQD C;  2FDF A;  3O1M A;  1KS4 A;  1OMI A;  2Z79 A;  4R9A A;  4W6X A;  3SQO A;  1E57 A;  4OHX A;  3VBU C;  2PEL A;  1CQ9 A;  2VZV A;  2VQU A;  2EIE A;  2W68 A;  3T30 A;  5IAT A;  4AHY A;  2AAC A;  1WGP A;  5T3N A;  1RUE 2;  5DAB A;  2YGM A;  2YC0 A;  1AR8 2;  4M01 A;  4P00 B;  2ARE A;  4KWJ A;  1PO1 3;  1DU3 D;  4E27 A;  3B94 A;  4TLF A;  4Q4V 3;  2EIC A;  2GAU A;  3U11 A;  4BE3 A;  3POW A;  3KV5 A;  3LDB A;  5EYX A;  5A1A A;  1YQC A;  2NPI A;  2VZR A;  1QMJ A;  3ZXF A;  1BBT 3;  2AEZ A;  3B9C A;  3BOW A;  5DN2 A;  1SMV A;  2BUK A;  1SEF A;  2G9F A;  2DCJ A;  5FLJ A;  4AQ6 A;  3NJZ A;  2Y64 A;  4E2Q A;  3B00 A;  4XJA A;  2GC3 A;  3JZV A;  3Q8B A;  2WAB A;  2J22 A;  3IPV B;  1BYH A;  3AZY A;  3URF A;  3HIF A;  5JMC A;  5A6Y A;  4N43 C;  1V6J A;  2D5H A;  3LDK A;  3UV9 A;  3CBN A;  3T3Y A;  1FI2 A;  4QPI A;  2WDB A;  1G7Y A;  5I0D A;  1CD3 G;  4HET A;  5EHD A;  2XWJ B;  5BNO A;  3OUI A;  3UKN A;  4BQ5 A;  4P9X A;  5J96 B;  2PAK A;  2WNE A;  3CMG A;  5EFU A;  4ZY9 A;  2VUD A;  2ZX3 A;  1GQG A;  5IAV A;  1GP4 A;  3WCR A;  2TEP A;  1A3K A;  4DXZ A;  3UES A;  2GP3 A;  2DCT A;  1H9P A;  1OH3 A;  4Y26 A;  2CL2 A;  1UX7 A;  4KWL A;  4EZ4 A;  4QDR A;  4A44 A;  1LGC A;  3NO8 A;  5T50 A;  1UU5 A;  4Q26 A;  1AL2 3;  3DXT A;  5G04 L;  5E16 A;  2QQV A;  2W1U A;  1PO1 1;  1QJX 2;  2Y6H A;  3KSC A;  4ZU5 A;  3VDD A;  5A6X A;  4KWK A;  1QOO A;  1KEX A;  3DN7 A;  3AP6 A;  4CYD A;  2ADE A;  4QQO A;  1JYN A;  1JOJ A;  1BBT 1;  1Z0H A;  2BNN A;  4WBB A;  4D6R A;  5EJZ B;  1OUS A;  1RVF 3;  4COU A;  3ZFF C;  5CA6 A;  5F3C A;  3PNA A;  4ITC A;  1J83 A;  1GWL A;  4AW7 A;  2WO3 A;  2DVA A;  3A0K A;  3A22 A;  3ZPY A;  5FYT A;  5JAX A;  1MZ6 A;  1QU0 A;  1HW5 A;  3MIH A;  4JGZ A;  3WNX A;  4LOR A;  2CTV A;  4PDW B;  2CAU A;  1IOA A;  4XBL A;  4CDW A;  2I45 A;  3AJY A;  2HH9 A;  4CEW B;  5FFO C;  4IE6 A;  4Q2F A;  4F8A A;  2D97 A;  1PO2 3;  4I3P A;  1NQJ A;  1CAV B;  1EYB A;  3BCW A;  3N7M A;  3JBG 3;  2P3J A;  1DGW A;  5C3Q A;  1QY4 A;  1VAM A;  2ZHK A;  2XLF A;  5FUN A;  4IDZ A;  1JU4 A;  3ME2 A;  5A7S A;  5JZG B;  1VBB 3;  2JDH A;  4RQP A;  1OA3 A;  2OYZ A;  1SLB A;  1JZ4 A;  1AR6 3;  4Y5T A;  5L7O C;  3ZSK A;  2AZ5 A;  1PX3 A;  3NW4 A;  4A7Y A;  4KG0 A;  2WNV B;  1FXZ A;  3AM2 A;  2PN5 A;  5GLV A;  5IVF A;  1SHW B;  3OUH A;  2HEW F;  2QE3 A;  2CWM A;  3C7F A;  3KT4 A;  1SDD B;  1TMF 2;  1AL2 1;  1UZV A;  1W6P A;  3D6E A;  4XUO A;  5JOX A;  1F9K A;  4FPO B;  1PZ7 A;  1D4M 3;  2VUL A;  1WME A;  3U4S A;  5LBF A;  4A3Z A;  3ZDV A;  1XU2 A;  1RVF 1;  4E8D A;  4BA6 A;  2D6L X;  4FPC A;  2WZ8 A;  2YBK A;  4LQR A;  1OD3 A;  1NZI A;  4AGG A;  1V6I A;  4YZ4 A;  4Q29 A;  1IPK A;  1OC1 A;  1J3R A;  3J7N A;  2PFW A;  4IGQ A;  4AFB A;  2ZEZ A;  2X5I A;  2Y34 A;  1JZ6 A;  2BW8 A;  2Y6K A;  4B7K A;  3T0D A;  2OZ6 A;  3N4M A;  1FYU A;  2YY1 A;  3KD4 A;  5FCC A;  1PO2 1;  1RIN A;  3LFM A;  4URT A;  4D69 A;  3K3N A;  1MR5 A;  1OPM A;  3FZ3 A;  1SFP A;  3I3Q A;  3JBG 1;  4XIK A;  4CP0 A;  3CDZ B;  2GNT A;  1N1V A;  5FV3 A;  2W52 A;  5D21 A;  4CRQ A;  1PK6 B;  3DV8 A;  2ZGP A;  1VBB 1;  2DFB A;  2RJ2 A;  4COZ A;  1UO9 A;  4FPE A;  1AR7 2;  1W03 A;  4YGE A;  1AR6 1;  4XDQ A;  5FJK A;  1V70 A;  1O3T A;  2Y26 A;  2IC1 A;  1WCU A;  3W21 A;  2JG8 B;  2AR6 A;  2VOK A;  1YWK A;  2FQP A;  2DTW A;  3D0J A;  2GZW A;  2FDK A;  5K7P A;  3O1V A;  1RGS A;  1SPP B;  4NWV A;  1CR7 A;  5J36 A;  1FV2 A;  4LBM A;  5DAQ A;  1U5X A;  3C7E A;  3MFA A;  3FMG A;  4L99 A;  5AC9 2;  4RN5 A;  3ELN A;  2B7Y A;  4IEY A;  4XF3 A;  1D4M 1;  3AJZ A;  1JTZ X;  4LIU A;  5T5L A;  4XCB A;  4BME A;  2YU2 A;  2VXR A;  5DQ0 A;  1XE0 A;  4XUR A;  1I1E A;  4NWW A;  4ZKT B;  5C33 A;  2Y6L A;  2EID A;  4XQ4 A;  2IXL A;  1DYO A;  1KFX L;  4NIH A;  2W95 A;  4CP1 A;  4FFG A;  5FZA A;  4QPY A;  2BNO A;  4LLO A;  1QQP 2;  4O61 A;  1YYN A;  3AKR A;  4XXA A;  4N8M A;  4XUT A;  1GIC A;  5E1R A;  1GQH A;  4GUL A;  4JGY C;  1MAC A;  1V6M A;  3KWV A;  4AZZ A;  4DY3 A;  4W4Z A;  3IZO A;  5DPN A;  5CBL A;  1OPO A;  1DQ1 A;  1OLQ A;  1CGP A;  2IVJ A;  1R1A 2;  2Q8D A;  1LU2 A;  3ILN A;  3LE0 A;  3HQX A;  1CZS A;  3ZN6 A;  4C91 A;  4IEQ A;  4XET A;  5GZE A;  1QKQ A;  4CCL A;  2EAK A;  5IVV A;  1GOF A;  4Q4Y 3;  3E6C C;  4JDN A;  1HV1 A;  3MV0 1;  5FZK A;  1QJU 2;  2D3S A;  3BGA A;  3VBU A;  2Z2S B;  4FXG B;  4K40 A;  3H3U A;  4OUE A;  4AQS A;  3KCY A;  1ENQ A;  1URX A;  4E4D X;  3DKQ A;  1LOB A;  3O7O A;  4ISR A;  3BKZ A;  2EXH A;  2TNF A;  4XBN A;  5EV7 A;  2HWC 3;  4A2U A;  4BDV B;  1NKG A;  1GNH A;  3S6P A;  5DXD A;  4KBB A;  3AP4 A;  1KRI A;  3LB9 A;  1DLL A;  1NCQ B;  3MUZ 1;  5LEJ A;  1PVC 3;  2YYO A;  4FFF A;  1GSL A;  4QHZ A;  4CE8 A;  1UX6 A;  3SHR A;  4LE4 A;  2ZAA A;  3O5S A;  2C6S A;  4N9I A;  4GB3 2;  4Y20 A;  2W91 A;  1IG0 A;  1JYC A;  4OQ9 A;  4DEQ A;  5FRE A;  1UN1 A;  3U0Z A;  4WVW A;  4XUQ A;  5FPA A;  3APB A;  5F37 A;  1W90 A;  2JX9 A;  3ACF A;  4D7Y A;  5A33 B;  5KHJ A;  2E63 A;  1S0I A;  1PZ8 A;  4AI1 A;  5AFB A;  1RUE 3;  2W5F A;  4QKD A;  2VR4 A;  4IEU A;  1AR8 3;  1LHU A;  1A8D A;  1V00 A;  4FO9 A;  2IVI B;  5IYY A;  1C4R A;  2WNU B;  3WG4 A;  1SLA A;  4UT5 A;  1H4G A;  2QQO A;  1W9Y A;  4N43 A;  2BOJ A;  2DVB A;  3LF7 A;  4A3X A;  1K42 A;  3MIG A;  4KMQ A;  1N1T A;  5FUI A;  2BRT A;  1XBF A;  3C7G A;  3OGS A;  3RZJ A;  2WN2 A;  1DCS A;  4P9L A;  4XFH A;  3ZVX A;  2FCU A;  4Q4Y 1;  4LIV A;  5CKM A;  2ORX A;  3CNA A;  1UF2 C;  3G7D A;  3S30 A;  4RL7 A;  3K4D A;  1POV 3;  1SCS A;  1KDM A;  3NAP C;  4YW4 A;  2ARC A;  4WVM B;  3ECQ A;  2K9Z A;  1PGS A;  2X05 A;  4HVR A;  1DQ0 A;  4CEY B;  2HWC 1;  4MGI E;  1UY2 A;  3H7Y A;  2W08 A;  4RGA A;  5LW9 A;  1RUO A;  2R04 3;  3I2J A;  4P5H A;  3A7Q A;  3E5U A;  1OVS A;  4I30 A;  3OTF A;  4ZZ5 A;  1PVC 1;  2ETE A;  4LKE A;  2DYC A;  4IV3 A;  4P9Y A;  5C8C B;  2VZP A;  4WVZ A;  3KMH A;  3MPP G;  5ABJ C;  2ADD A;  4HXC A;  1UOF A;  5LAT A;  3SKV A;  5F5A A;  1BKZ A;  3ZSM A;  2W1S A;  5CEH A;  4TTG A;  4H3W A;  3NNJ A;  1XYP A;  4XZU G;  5FYV A;  3W58 A;  1CON A;  3ZFF A;  4EN7 B;  2VH9 A;  1HRV 2;  4D94 A;  2FDJ A;  2WII B;  1MZ5 A;  5AVP A;  1RUE 1;  3SLI A;  1HV0 A;  1F8V A;  1AR8 1;  1XSR A;  5FZF A;  3N9O A;  4OMC A;  2RMU 3;  1A34 A;  4YGC A;  1QJX 3;  1RUF 2;  1AJK A;  1W3X A;  2A3W A;  3CO2 A;  3I7D A;  2ZZQ A;  4LOT A;  3VBR C;  2VE1 A;  5KC6 A;  3ZOI A;  2OQ7 A;  5DZG A;  4HOO A;  5FMO L;  1NLS A;  4JHT A;  4XAB A;  4EN0 A;  4LBQ B;  3GBF A;  1ZZ6 A;  5JUV A;  2JG9 B;  1K45 A;  4HAN A;  2Y60 A;  5JLV A;  3B9I A;  2A3X A;  2XON A;  1MS8 A;  4AEK A;  2D43 A;  4I02 A;  4UFK A;  4ZON A;  1AX0 A;  3LD8 A;  1SBD A;  1CAU B;  5AFE A;  2OZJ A;  3ETQ A;  2PHX A;  1OQD A;  4L9B A;  5FZ3 A;  3TWI A;  1POV 1;  3P3N A;  5C4W C;  5L7O A;  1WMD A;  4FPH A;  2VTF A;  4QWN A;  2PHL A;  3SCH A;  1W8N A;  3RZG A;  5HXM A;  4LO7 A;  1ULP A;  1W99 A;  3JB8 A;  5BY5 A;  4ONU A;  4OVE A;  2R04 1;  4AVC A;  4UFI A;  1F15 A;  1UPI A;  5FWJ A;  1VR3 A;  1XE7 A;  2ZKL A;  3T2O A;  4C0H A;  1O3S A;  5K0U C;  3NJV A;  5F32 A;  4FBF A;  3AP7 A;  1JS9 A;  4IEV A;  3Q8F A;  3ZR5 A;  1H8T A;  1LCL A;  3CJI C;  4PQQ A;  5JPM B;  3NNM A;  1ZBA 2;  5A32 B;  1NQD A;  3VL9 A;  3M2M A;  1POV 0;  2Q4S A;  4PIY A;  2ZGR A;  4I0W B;  5CFC B;  3AB0 A;  3TNQ A;  4QMA A;  2OW4 A;  3SH4 A;  1LAJ A;  1PNF A;  2RMU 1;  4FTS A;  1QJX 1;  5FRA A;  3INA A;  5FZ8 A;  3X29 B;  2ZOE B;  4D8M A;  1CZT A;  2X53 S;  2Q0A A;  3WLU A;  4XVH A;  3ZKY A;  4ES9 A;  2BQP A;  4KG8 A;  5FXV A;  1U12 A;  4GIQ A;  5J37 A;  2NMO A;  4Y4Y A;  2VQA A;  4CU9 A;  1DYK A;  2WNO A;  3E5Q A;  3IB3 A;  2PYT A;  2VOW A;  3NKT A;  2GH2 A;  3ES4 A;  3OPT A;  5FLI A;  5FZL A;  3W5M A;  1FOD 3;  4UW5 A;  1JHN A;  4GKX A;  2J1R A;  5LBC A;  3EQE A;  3WQ7 A;  3V64 A;  5JWP A;  1V6K A;  5JI9 A;  4A4A A;  1CAW A;  4CXW A;  4UF0 B;  1L7L A;  2WS9 2;  1XC6 A;  2XML A;  3MLJ A;  3OF1 A;  4MG2 A;  3I49 A;  4KH9 A;  4HKW A;  4CCD A;  1RUN A;  1LEN A;  5GLU A;  4K1Z A;  5EJ1 B;  2ZAH A;  2Z42 A;  3AP5 A;  1NOV A;  1COV 2;  4Q0P A;  1AR7 3;  1I5P A;  1UCX A;  1FNY A;  2A6X A;  4YFW A;  3WR0 A;  5BNQ A;  1RIT A;  3SXW A;  4PLO A;  2HYK A;  3I59 A;  3ZYB A;  1VRB A;  3OYW B;  4SLI A;  5IJR A;  4QXC A;  4UFH A;  3THT A;  1J3Q A;  2VGD A;  4HMZ A;  4OQ8 A;  3J26 N;  5JOW A;  4LUL A;  3BIE A;  5K4L A;  4OI1 A;  3FHQ A;  1W0O A;  2JB8 A;  2AEN A;  2WFP A;  3WF4 A;  4AHX A;  4CDX B;  5AC9 3;  1PHM A;  1ZRD A;  4CCE A;  5I0T A;  4AG4 A;  1GFF 2;  1E5S A;  1W9F A;  2ZGS A;  3SIS A;  4NAM A;  2BYV E;  1UYY A;  3KQR A;  4R9B A;  1NAE A;  4R52 A;  3KF5 A;  4HT1 T;  1Y9G A;  1PMI A;  5LWB A;  1AHS A;  5DUV A;  4QX7 A;  5CYY A;  4M0N A;  4KGG A;  3W59 A;  1CPN A;  2D6M A;  2OII A;  1W6N A;  2OT7 A;  1FOD 1;  1X7N A;  3OGR A;  5JSO A;  5A7W A;  5C8W A;  4YVW C;  3LCP A;  5A3O A;  2QQM A;  2RV9 A;  2I07 B;  3IDA A;  4PDW C;  1YFX A;  4Q4X 2;  1C1L A;  2LW8 A;  4XF4 A;  1TE1 B;  5FZI A;  4QPG B;  4CDQ B;  4HPK B;  3DPR C;  1K5M A;  1R1A 3;  2ID4 A;  4B3N A;  5EQU A;  1ZA4 A;  1N3P A;  5DAP A;  1W8F A;  4ZPI A;  2WT0 A;  1AR7 1;  2B42 B;  3H8R A;  5FZB A;  2ZX2 A;  3MIF A;  3O12 A;  1H2K A;  3ZYR A;  2ET1 A;  3MID A;  4FXK B;  2XL7 A;  4LBK A;  1SBE A;  4QDQ A;  5F6K A;  3WNL A;  4I01 A;  4MXW A;  3WSO A;  5I8T A;  4EJR A;  1QOS A;  1SG3 A;  1IPJ A;  1HJF A;  4DNY A;  3ILF A;  4CXX A;  1PM4 A;  1QXP A;  1OF4 A;  3AZW A;  3CZU A;  5LK7 B;  5GKA C;  1HQL A;  2RS1 3;  1S0B A;  1HJG A;  2QQJ A;  5AC9 1;  4XQW A;  1EPW A;  3GAL A;  5IK5 A;  2WA4 A;  5FUP A;  1AVB A;  5F39 A;  4XF9 A;  4FPL A;  4N53 B;  2Q1Z B;  4IE0 A;  5F3G A;  2JDP A;  1O5L A;  1QJE A;  3M1H A;  4XDO A;  4GH4 B;  3WDT A;  4GB3 3;  3GZE A;  1J1L A;  2QUO A;  1ND3 C;  3CU7 A;  1W6Q A;  1S0E A;  3MUY 1;  4IGP A;  3FWE A;  1VBC 2;  2JEN A;  4LMF A;  1ACC A;  1A6C A;  4AI3 A;  3OEA A;  5FZG A;  3DUI A;  4YG3 A;  3FFZ A;  5HV4 A;  5EP9 A;  1CJP A;  2JIG A;  1XQN A;  3WIN E;  5FMD A;  5FQ0 A;  1JOP A;  3ZXG A;  3KT1 A;  3PIJ A;  3CZJ A;  4Y33 A;  3MW4 A;  1Q8V A;  1R1A 1;  4AFC A;  2WFF 2;  2ZA9 A;  3DL3 A;  3IWZ A;  3M3I A;  4OHW A;  1AR9 2;  2GU9 A;  3K3O A;  5FP8 A;  3LEM A;  2E31 A;  2VCM A;  3MIC A;  3UNP A;  1GZT A;  4N7U A;  1PK6 C;  5FBZ A;  5GAL A;  4Z07 A;  5ABJ A;  3VHN A;  3W20 A;  1YC6 1;  4QAW A;  3CIH A;  4BWO A;  2G19 A;  1MS0 A;  1IS3 A;  3O0V A;  3NNG A;  5FMB A;  3NQH A;  1G9A A;  4UXA A;  3VBS C;  3MLL A;  3WF0 A;  1QWR A;  2OPK A;  4Y24 A;  4B1M A;  1YI9 A;  5E6H A;  5FMO S;  5LRR A;  3ZFE C;  5FPU A;  3VBR A;  2NN8 A;  2XDV A;  5FXX A;  3O1U A;  4K7J A;  4YW2 A;  4LOS A;  3I2K A;  4EWE A;  2C26 A;  4Y22 B;  3M3E A;  4GB3 1;  1JOD A;  4FTE A;  3A23 A;  4NHM A;  3K2O A;  1WLD A;  3OOX A;  1UU6 A;  4KL1 A;  4AF9 A;  1QHD A;  4NRP A;  4FP2 A;  2MPF A;  3KB5 A;  2VMI A;  1HRV 3;  4PQ9 A;  3VD9 A;  1J3P A;  3OPZ A;  4NIA A;  4NPM A;  5C4W A;  1VMF A;  1KS5 A;  1WCS A;  2XJS A;  3PDQ A;  3ACH A;  4NII A;  1YEW A;  5DAX A;  3VZJ A;  3FLR A;  1RUF 3;  4LR4 A;  4CDU B;  1YHF A;  2WBK A;  1QXR A;  1MQT B;  3SCF A;  1J1T A;  1PIV 2;  1QIQ A;  3D82 A;  3ABZ A;  2VXJ A;  3POG A;  3AKQ A;  3M8L A;  1O4Y A;  3LIG A;  2VZQ A;  2HBU A;  2RM2 2;  4AVA A;  2XHN A;  4J1X A;  2VD7 A;  2HBT A;  3LDR A;  4CTE A;  2P6H A;  3CJI A;  4MSV A;  3MHZ A;  2VZU A;  3UKV A;  1QJZ A;  1VB4 A;  1H0B A;  4WZF A;  2YC2 A;  1HXS 2;  2JE7 A;  4G3Y C;  5CFD A;  5J7M A;  3D0S A;  4O9E A;  5FZ1 A;  3ZYG A;  4ES8 A;  2K46 A;  4DRR A;  2J42 A;  2DBI A;  3ZXA C;  4LO5 B;  3SEP A;  4YW1 A;  4YW6 A;  4BQ3 A;  3BVC A;  3ACL A;  4TYS A;  2VMG A;  3RWN A;  3KLS A;  2BV4 A;  3TN9 3;  5IVJ A;  4PCR A;  1CX4 A;  5FP7 A;  3WG3 A;  2VEC A;  1LR5 A;  3KM5 A;  2HWB 2;  1RUG 2;  2UWB A;  1UD1 A;  4F3J A;  1HRV 1;  1GZW B;  4GKY A;  5J09 A;  1CN1 A;  1E5I A;  1C8M 3;  5FPV A;  5K9Y A;  1US2 A;  2X29 A;  2XKP A;  5F2S A;  3UKT A;  4QHB A;  2XJP A;  1RUF 1;  4NRM A;  3I3D A;  2LAL A;  5CAD A;  1PMJ X;  4CUB A;  3T2T A;  1WW4 A;  2F6B A;  4KQ7 A;  4XUN A;  3T1M A;  2JDY A;  3VB9 A;  1SCR A;  5JR2 A;  2VBP A;  1HDK A;  3P3P A;  1H9W A;  1AX2 A;  1LHW A;  2IZW A;  2N7G A;  3GGL A;  3I3B A;  5FYC A;  5A3M A;  2VNV A;  4DIN B;  2ZAC A;  3R4S A;  1WCK A;  2WYS A;  4XUP A;  1FMD 2;  4H2A A;  2GDF A;  5DUW A;  3UK9 A;  2Y38 A;  1C8N A;  1H2M A;  3TAY A;  3OY8 A;  4RFT 0;  1W8Z A;  1Z7S 2;  4AVT A;  2A5Z A;  1DGW X;  5L9V A;  2WS9 3;  5APA A;  3VKL A;  1W6M A;  2RS3 2;  4M3C A;  4NJ4 A;  2BEO A;  1UYP A;  3RFR A;  1AXY A;  3D3A A;  4NHL A;  3RJ2 X;  3TN9 1;  5FZM A;  4ASL A;  5LA1 A;  4L2N A;  1COV 3;  1P8J A;  2OQ6 A;  3NL1 A;  1JYW A;  4Q8K A;  1O59 A;  1ZBA 1;  1B35 A;  5C8C C;  2RDS A;  1VMH A;  5ANN A;  1YFY A;  2OUH A;  4BK4 A;  1C8M 1;  1ND2 A;  4BH9 A;  2YBP A;  1WZX A;  1QGL A;  4GJZ A;  4ZS3 A;  4CUA A;  2GNM A;  3SMH A;  4YVW A;  2PQQ A;  2E7Q A;  3S5Q A;  1OI6 A;  2VU9 A;  2QDR A;  1HB1 A;  1LU1 A;  3GNE A;  1ULO A;  3OPW A;  1YJL A;  4MX3 A;  2DCK A;  3AKS A;  5FWE A;  3WG2 A;  1VBD 3;  2YZ4 A;  3IKW A;  4OHY A;  3S57 A;  2BDR A;  3DPR A;  5DUX A;  3FBY A;  2QZ3 A;  4K6B A;  2DUR A;  3H7J A;  4W6W A;  3KCC A;  2JXA A;  1FAT A;  1Y43 B;  1BEV 2;  1RUC 3;  3SCG A;  2WN3 A;  2XHK A;  3IAQ A;  4UYB A;  3VBF B;  3WUD A;  4B4R A;  2Z4F A;  2CV6 A;  5C3O A;  3O14 A;  1ZA7 A;  3H1W A;  2WS9 1;  4FP3 A;  1QDO A;  1RMU 2;  1F5F A;  4E4Z A;  2Q1F A;  1W2N A;  1OOP B;  4RFR B;  3T0B A;  4G4F A;  5IHR A;  2BJS A;  1ODN A;  2VJX A;  3KT7 A;  4LK7 A;  4H14 A;  4LJH A;  3VHP A;  4XYX A;  5HCF A;  4PJY A;  4AI9 A;  5JVV A;  1UMH A;  1XE8 A;  2PHD A;  3AVR A;  4RS5 B;  4YYO A;  1COV 1;  2YRO A;  4Y4R A;  4EV0 A;  4A6O A;  1FPN 3;  3BTA A;  3WOG A;  2DCZ A;  4R9D A;  2I74 A;  1NXM A;  3RJR A;  5DDJ 2;  3MF9 A;  2D6P A;  5FO7 B;  3T4H B;  2XJQ A;  3WF2 A;  1ND3 A;  4JDM A;  1HN0 A;  2F4L A;  1PNG A;  2W2I A;  4FPK A;  4LBQ D;  2VCC A;  2ZHN A;  3O1T A;  2H6B A;  1UOJ A;  1MS5 A;  4N90 A;  5CFC C;  1DGR N;  1DG6 A;  4ASK A;  5A3P A;  1DQ2 A;  1W6O B;  4QKN A;  2W3J A;  1OKQ A;  1VBD 1;  5FY0 A;  1W8T A;  4IEZ A;  3WHU A;  1R1Z A;  3PMS A;  2W1Q A;  2J1S A;  2ZTN A;  5A3T A;  4PLM A;  2WQZ C;  3HAG A;  4MOA A;  2XVK A;  2H0V A;  1VBC 3;  1RUC 1;  1PK6 A;  4CCK A;  4AI2 A;  4AVB A;  4P9W A;  1F2N A;  3MIE A;  1NY7 2;  3MO4 A;  2ZX4 A;  3C7O A;  2R0F A;  3DYO A;  1PVX A;  3VBS A;  4OFG A;  1F5J A;  3TB0 A;  4IV1 C;  1DDL A;  1GOG A;  2XXZ A;  2YGL A;  5IK7 A;  1S1A A;  1Q8O A;  4ZU4 A;  2G1M A;  4Q5O A;  4K3U A;  4CSW A;  2WFF 3;  1IS4 A;  3NWK A;  3ZFE A;  4EE2 A;  5GZG A;  1TNF A;  3H3Z A;  3MW2 A;  1FPN 1;  3ZSJ A;  3H1M A;  1VBE 2;  2WZR 2;  3EJK A;  4X8N A;  2Q8C A;  4ASM B;  2VNG A;  4HVQ A;  4DXS A;  5LY1 A;  5LZ6 A;  1CX1 A;  4LBJ A;  4QPI B;  1IZ3 A;  3IMN A;  3AMQ A;  1LRH A;  4YZ2 A;  5BNO B;  4M3C E;  1LOF A;  2WRA A;  4YG0 A;  1EV1 2;  1LGB A;  1T6B X;  1LUL A;  5HCB A;  5BNP C;  3NMB A;  3UL2 A;  1BK0 A;  3SH5 A;  4XFG A;  4CDX C;  5JXI A;  1B09 A;  4QX5 A;  2CNA A;  4ARY A;  3PU3 A;  1S0G A;  1TME 3;  3HN1 A;  4KU8 A;  5LK5 A;  4MHR A;  5BXX A;  4YVS A;  4AFM A;  1MS1 A;  4JC1 A;  1VBC 1;  1JH5 A;  4XJ9 A;  3SC7 X;  3ZR6 A;  4JKM A;  5FZC A;  2VUJ A;  5J98 B;  4Z1V A;  4ISQ A;  4KGQ A;  5FO9 B;  1R09 2;  3H42 B;  5FP9 A;  3TYJ A;  3LA7 A;  3BIW E;  1RC6 A;  2VAU A;  5FAX A;  3VV1 A;  2WQ4 A;  4A6S A;  3BI3 A;  2GNB A;  2B9V A;  4AED C;  2V73 A;  4QQH A;  5FY4 A;  1O3R A;  5JOY A;  3PHM A;  2WFF 1;  3ZYJ B;  4CDQ C;  4F83 A;  1RUD 3;  4YW3 A;  4QPW A;  2E7T A;  2PQS A;  3W9A A;  2VTX J;  1VJ2 A;  3HNB M;  2G9G A;  2RM2 3;  4MET A;  3O1P A;  1GWK A;  4JGZ B;  3QLQ A;  1T6G C;  3GDB A;  2FMD A;  4AE2 A;  3E5X A;  1X50 A;  4LPL A;  4CDW B;  4XIL A;  2QQN A;  1V0A A;  1HXS 3;  2VVE A;  3BPS A;  3V56 A;  1RUH 2;  1OQ1 A;  2JDK A;  4Z82 A;  1KJR A;  5H9S A;  3BOP A;  3UYJ A;  2ZMN A;  1D4V B;  4RQP B;  2QQI A;  3AVS A;  3PME A;  4Q4W 2;  4FTB A;  3ON7 A;  1AF9 A;  3NNL A;  1H2N A;  1TME 1;  1HN1 A;  4NRO A;  2WYF A;  3RZK A;  2FZ1 A;  4XMI A;  4QM9 A;  4BXS V;  5D8A C;  1XNA A;  4CU8 A;  1SLL A;  2HWB 3;  2YG0 A;  3GZT B;  5D1I A;  5LY2 A;  3VBO B;  4MUV A;  4QD2 A;  1W6P B;  1XNB A;  2XR4 A;  1SLI A;  4FPF A;  4NVP A;  2RE9 A;  2CDO A;  2YPJ A;  2P3I A;  2AEY A;  4AAX A;  3R0R A;  5IFP A;  2VMH A;  1J58 A;  3OCP A;  3WDY A;  2JDU A;  4LK6 A;  3UGF A;  5I8Y A;  4X8P A;  4MGZ E;  1UNB A;  1JU3 A;  2A73 B;  3C8X A;  2FCT A;  2YBS A;  2VME A;  3MBW A;  1DGR A;  3HN3 A;  5FIX A;  1OT5 A;  5FXW A;  1RUD 1;  1SAC A;  3H0O A;  4QB6 A;  2QKD A;  3KGL A;  2RM2 1;  1GBG A;  4XXP A;  1W8O A;  1DQ4 A;  3S7E A;  3ZXJ A;  3U07 A;  3IBM A;  3C3V A;  4QT6 A;  2CGO A;  5CIR A;  1FMD 3;  1ZX5 A;  2BTV C;  2PAE A;  2QNK A;  3PL0 A;  5C8C A;  1BLZ A;  1OKO A;  1VRH 3;  2QZ2 A;  2X5I B;  3M70 A;  1H1A A;  2ZJC A;  4HSL A;  3UET A;  5C6C A;  5BNN C;  1HXS 1;  2WA3 A;  1OLM A;  1KFU L;  3RS6 A;  1GWM A;  5IAX A;  2WR9 A;  4NPL A;  4HSJ A;  3USU A;  4LBN A;  2Z69 A;  1UIK A;  4YG6 A;  3ZYP A;  2VL4 A;  4WVV A;  2RS3 3;  2PA7 A;  3PTR B;  5GZD A;  3POF A;  2H0B A;  1RUJ 2;  3BN6 A;  2DDU A;  2JE9 A;  4YNI A;  4CA9 A;  4Z92 B;  2AUY A;  4RSU A;  4EN9 B;  4XEZ A;  1G9D A;  5C5U A;  5IVB A;  3I97 A;  2GC0 A;  4H7M A;  2CYF A;  1L7Q A;  1OUX A;  2RR1 2;  3LQC A;  4M0H A;  4EYU A;  2R06 2;  3GCW A;  4ET7 A;  2HWB 1;  1JBC A;  5CU1 A;  1RUG 1;  1JUH A;  2VO5 A;  4IXL A;  3PTY A;  5BYN A;  1CIW A;  5LB6 A;  2RS5 2;  1OF3 A;  1GOH A;  1YCI A;  1S2B A;  2OXB A;  4JHZ A;  2XL9 A;  4JQT A;  4R8H A;  1LED A;  2RDQ A;  1DFQ A;  3H3L A;  4OZO A;  1HQW A;  2VCA A;  1R08 2;  3E1F 1;  3V0B A;  1XJA A;  4UW6 A;  2ENR A;  4OI2 A;  4K8F A;  3TBD A;  2H6C A;  2X10 A;  4YZ3 A;  2B45 X;  3Q9O A;  3VBH C;  5DZF A;  1FMD 1;  4BMB A;  1JZ2 A;  4LT5 A;  4DO0 A;  1BMV 1;  1BEV 3;  1VRH 1;  4P9J A;  4AQ2 A;  1UXX X;  2JJ6 A;  2P34 A;  2W94 A;  3IM0 A;  3ZXD A;  2R32 A;  4RHV 2;  5EPA A;  1DQ6 A;  2IXC A;  3HT2 A;  4LNV A;  3M3O A;  4QXK A;  3O1O A;  1UL9 A;  4YW7 A;  1BQP A;  3FFQ A;  2C9A A;  4FOY A;  1IS5 A;  1NG0 A;  5AVA A;  1L3J A;  2RS3 1;  4XZP A;  3VZM A;  2WL1 A;  2Q8E A;  3ZFG C;  4OI0 A;  4K1Y A;  1U5Y A;  1OLR A;  1VLN A;  3GJB A;  3ZN6 B;  1GZ9 A;  2J7M A;  3RWK X;  2GN7 A;  2R1B A;  3PVB B;  4LKS A;  1NE4 A;  4EZH A;  2ES3 A;  3H50 A;  4ZXE A;  5FYB A;  5FO8 B;  3WVJ A;  1M06 G;  4E2G A;  2UWA A;  1FT9 A;  4BPZ A;  2O8O A;  2PHR A; 
#chains in the Genus database with same CATH homology
 3UYJ A;  5FUN A;  5F32 A;  5A80 A;  3AVS A;  5FPL A;  5A7S A;  3N9L A;  2W2I A;  4V2W A;  3KV4 A;  5FY5 A;  5A7O A;  3RVH A;  5FP7 A;  5IVJ A;  4CUG A;  5A7N A;  4BIS A;  5FZH A;  3N9M A;  5FY7 A;  2OX0 A;  4ASK A;  5FUP A;  5LY2 A;  5FYS A;  3ZPO A;  5FY8 A;  5F39 A;  5A3P A;  5IVF A;  5FZ9 A;  5FY0 A;  5FZD A;  5FPV A;  5A7P A;  5F3G A;  5FPB A;  3KV6 A;  2WWU A;  3N9N A;  4XDO A;  5F2S A;  4BXF A;  5FZ8 A;  5A3T A;  2XUE A;  4IGP A;  5FPA A;  5F37 A;  5FXZ A;  3AL5 A;  4CCK A;  5FYH A;  2YU1 A;  3U4S A;  2YBS A;  5FXW A;  5FZG A;  5FXV A;  5IW0 A;  4QU1 A;  5A1F A;  5ANQ A;  2YPD A;  5IVY A;  4BU2 A;  5FYC A;  3PUQ A;  2YBK A;  5IWF A;  4D6S A;  3OPT A;  5FZL A;  3PUR A;  4Y33 A;  4E4H A;  3KV5 A;  4CCO A;  3LDB A;  2XXZ A;  5F5C A;  4GAZ A;  4IGQ A;  5FP8 A;  5FZE A;  4CSW A;  3K3O A;  4XDP A;  5KR7 A;  4UF0 B;  2WWJ A;  5FYY A;  3N9P A;  4LIV A;  2XML A;  4UF0 A;  4CCN A;  5F2W A;  2Q8C A;  3K3N A;  4NUB A;  4CCJ A;  5FP3 A;  3PTR B;  5LY1 A;  5FYM A;  5FV3 A;  3PUS A;  3N9Q A;  5FZM A;  5FJK A;  5IVB A;  2OQ6 A;  4LIT A;  5LW9 A;  3KV9 A;  5IVC A;  4V2V A;  4IGO A;  4EYU A;  5E6H A;  5IVE A;  4GD4 A;  2OS2 A;  5FY1 A;  3KVB A;  4HON A;  5FPU A;  1VRB A;  5FZ0 A;  2XDV A;  5FXX A;  4QXC A;  5FZO A;  2YBP A;  5A3N A;  4GJZ A;  5FJH A;  3PU3 A;  5K4L A;  5F5A A;  4QXH A;  5FP4 A;  4CCM A;  2P5B A;  5CEH A;  5FY9 A;  3K2O A;  5FYV A;  2GP3 A;  3PU8 A;  4TN7 A;  2PXJ A;  3OPW A;  3KVA A;  5FWE A;  4C8D A;  4EZ4 A;  4GJY A;  4LIU A;  2YU2 A;  5FZC A;  3DXU A;  3DXT A;  3PDQ A;  5FZF A;  3N9O A;  5LWB A;  5FP9 A;  5ISL A;  5FWJ A;  4QX7 A;  5FYI A;  5A3W A;  5F3E A;  4Y3O A;  2OT7 A;  5A7W B;  3AL6 A;  2OQ7 A;  4HOO A;  5FYZ A;  5FZA A;  5A7W A;  5FZ6 A;  4DO0 A;  5A1L A;  5FY4 A;  5FZ4 A;  4D6R A;  4D6Q A;  4AAP A;  4DIQ A;  5FBJ A;  5FZO B;  2GP5 A;  5F3C A;  5F5I A;  5FZI A;  2VD7 A;  3LD8 A;  4QXB A;  3U78 A;  5FZ7 A;  2Q8D A;  5FZ3 A;  5FYT A;  4LXL A;  5F3I A;  2Q8E A;  4QWN A;  4URA A;  3PUA A;  4AI9 A;  3AVR A;  4Y4R A;  5FZ1 A;  4CCL A;  4EZH A;  5IVV A;  5FZB A;  5FYU A;  5FYB A;  5FZK A;  4QX8 A;  5A7Q A;  3NJY A;  3ZLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...