4QX7A

Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
total genus 105
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qx7A01
5A7NA 4QXHA 5FYVA 5FZ8A 5FPLA 5FZFA 4IGPA 5IWFA 5A80A 5FPBA 5F5CA 5FZOB 4IGOA 5A1LA 2WWUA 4AAPA 2OQ7A 5FZCA 5FP7A 3KV6A 3DXUA 4CCMA 5IVVA 4Y4RA 2OQ6A 4QXCA 5FYBA 4CCNA 5FY1A 4EZ4A 5FYYA 2PXJA 5IVBA 2GP5A 4CCLA 4GJZA 5F5IA 5IW0A 3K3NA 5FZKA 4UF0A 5A3NA 5FZ3A 5IVJA 3PDQA 5F3EA 5FYUA 3OPTA 2YU1A 4D6QA 3PUSA 5FYMA 3AVRA 2OX0A 3AL6A 5FY4A 5IVEA 5A3TA 3KV4A 2Q8EA 4XDPA 5FXWA 5A7WA 4UF0B 5FZAA 4CSWA 2XDVA 5FZ7A 3AL5A 5F3IA 4XDOA 3N9LA 5FPAA 2OT7A 3DXTA 5FXVA 4AI9A 4DIQA 5FV3A 2GP3A 4IGQA 3K2OA 3N9PA 4ASKA 5A7WB 3N9QA 5FP8A 4D6RA 4LIVA 4QXBA 4TN7A 5F32A 3LD8A 4NUBA 4CCOA 2YBKA 5LY1A 5FZGA 5E6HA 2WWJA 5FXZA 3ZPOA 2XMLA 5FXXA 4CCKA 5A1FA 5FZEA 2YPDA 5FJKA 5FZDA 5K4LA 5FWEA 5FZ9A 3PU3A 5IVYA 3ZLIA 3RVHA 4C8DA 5F37A 4Y33A 4E4HA 5FUNA 4DO0A 5FYCA 4HOOA 3N9NA 3KV9A 5FP4A 3KV5A 4QX8A 5A3WA 4GAZA 3N9MA 3PUAA 5FWJA 5FZMA 5A3PA 4URAA 4LIUA 3UYJA 1VRBA 2OS2A 5FYHA 4BU2A 5LWBA 5LW9A 5A7SA 5FY5A 5F39A 5FY0A 5FYIA 5FBJA 5A7OA 5F2SA 5FZ6A 5FUPA 4D6SA 4GJYA 4BISA 3PTRB 5FZIA 5FZHA 3KVAA 4LITA 5KR7A 2YBPA 5F2WA 3NJYA 4QU1A 3LDBA 2VD7A 5FZ0A 5FJHA 5FPUA 2Q8CA 5IVFA 3KVBA 5FZ4A 5A7QA 3U78A 5FP9A 4V2WA 5FY8A 5FZLA 5FP3A 5F3CA 3K3OA 4EYUA 5LY2A 3U4SA 4GD4A 5IVCA 2XXZA 5F5AA 4Y3OA 2XUEA 5FY7A 5A7PA 4BXFA 2W2IA 5FPVA 5ISLA 5FYSA 3N9OA 2Q8DA 5FZ1A 2YBSA 2YU2A 3PUQA 4LXLA 4QX7A 4QWNA 5FYTA 3AVSA 5FZOA 4CUGA 4EZHA 4CCJA 3PU8A 3OPWA 5F3GA 5FYZA 5CEHA 2P5BA 5FZBA 5ANQA 3PURA 5FY9A 4HONA 4V2VA
chains in the Genus database with same CATH superfamily
5FYVA 1RYYA 2VNOA 3T2OA 1D4M1 1QQP2 3WP5A 3POFA 2R32A 4JKMA 4YW3A 5C8CA 4CE8A 2OQ7A 2FDHA 2C6SA 3WZ1A 3GYDA 1J3QA 2R6QA 5DPNA 1UMZA 2YG0A 1IQDC 2WWSA 3MGUA 2ETEA 2PXJA 3USUB 2WNUC 4JHTA 4M0NA 4CCDA 1PGSA 2HEVF 4PIXA 3VHNA 2A73B 2OUHA 3B5LB 3VZNA 5FLIA 2FDIA 4BIOA 3PUSA 2Z42A 2XJRA 3AYEA 3NO8A 2GALA 1D4M3 2JECA 2XVKA 5LATA 3KV4A 2VZUA 2XOMA 2VH9A 5JI9A 1AJOA 4UF0B 1ULGA 3JQWA 2XDVA 1JYCA 5GALA 4ATFA 5CG8A 1LU1A 4YG6A 2VMIA 2XJTA 1OMIA 4IEWA 4Y5Z0 4BCUA 3BODA 4CDWB 1OH3A 2E51A 1LRHA 1XB9A 1O4TA 4UBGA 4XCAA 4AR2A 4ASKA 3MIDA 3L2HA 3DYPA 5L9BA 3H7JA 1IG0A 2VG9A 4M3CF 1H2LA 5C7GA 2WO1A 1VBC1 3GBFA 1L7RA 3ETQA 3I59B 2C1FA 2PLV3 4LKFA 5IT6A 3VBOB 1K5MA 1NCRA 2B4KA 3HQUA 1S0GA 3ZKUA 2ILMA 1G9AA 1VJ2A 4PDWA 2WC2A 5DXDA 2W1UA 4YVSA 3B94A 1E5RA 3AYCA 1W9SA 2F6BA 4CDXB 3K4ZA 2Q1ZB 4BJ0A 1LHWA 4N8MA 1EUUA 2TNFA 4JKKA 3L2YA 4DO0A 2G1MA 3TBDA 2XBO2 1RHI3 2A7AA 5FWJA 5GZGA 2B8MA 2Y8KA 5JOZA 2XUMA 2J42A 3BALA 1UWWA 1QWRA 1TNFA 4H7LA 1BKZA 2E7QA 3KCCA 2XJSA 4Q0QA 3VBHB 5L19A 4QDQA 1PNGA 1G9FA 3AMMA 4QQPA 3H7YA 4XUOA 1N3PA 5FFOC 5F7UA 4ES9A 2BW8A 5DABA 4NVPA 4JTOA 4NAMA 4LO4B 1GP5A 1Q8SA 3NJYA 4B4RA 4RL7A 4B4PA 3N3HA 1JUHA 1POV1 3CU7A 3A0NA 4JGYC 4L8QA 4QQHA 5JZGC 3RZMA 5IVFA 2NM1A 4WVVA 4XJAA 4E4SA 2JICA 2AYHA 1FNZA 5FZLA 2PELA 1EAH2 5JLVA 1QOSA 2VY0A 5CB7A 1AR91 2Y60A 3N36A 3NRUA 1HXS2 4QPIB 3RJRA 2JDPA 2E26A 2W08A 3BN6A 1GOFA 2VCCA 1LOGA 2W2IA 3TOJA 3W5MA 5J98B 1ULCA 1AL21 1JN2P 4K40A 5JVVA 1SEFA 3I3QA 4IW3A 1C1FA 1SBEA 2CL2A 2MNGA 3BVCA 2HWB3 1RUG3 1F15A 1N1SA 2OIIA 1PO21 3ZN4A 4DNYA 1WLCA 2DUOA 2VO5A 4QX0A 4GH4A 5DDJ1 2P5BA 4Y22B 5SV5A 3T08A 1MEC2 4Q4Y2 1DU3D 4E2GA 1EV12 2JDZA 4KGGA 4LJHA 4HANA 5KWRA 1CAVA 3BIWE 1U5XA 3AXEA 2VZ3A 1RUI2 4Y20B 5FP7A 2GNTA 1AL23 2A6ZA 3FHIB 4HKOA 1O4YA 3PVBB 3QH7A 4D7SA 1SLLA 1OLQA 2ZX1A 3R4DB 1A8DA 4PBPA 4I09A 4CEWA 4UOJA 1S55A 1WLDA 2GH2A 4YWAA 5GLZA 4N53C 4F8AA 5FZ3A 5C3QA 2C24A 2GAUA 2ZGMA 4B4QA 4Y1UA 1QJY1 1QNYA 1ZA4A 3NV1A 5K7PA 1BEV1 1UX6A 1YC61 1FV2A 2DCJA 4J6GA 4RA0A 3H0OA 1JUIA 2D6NA 1TME2 1VPHA 5A3TA 5KHJA 4XDPA 1XE0A 3RSJA 4MHRA 5BXXA 1LU2A 4AEKA 1AR62 1UZYA 3EB7A 3LFMA 1V6KA 1PIV1 3LSDA 3POYA 4WBBA 4ARYA 4MYEA 5CADA 3VHRA 1MS0A 5AVAA 2WZR3 4NRQA 2ET1A 3PJQA 1JZ7A 5ACA3 4FAGA 1X36A 4YW6A 2Y6JA 4JAAA 4EWAA 5CBLA 4CCCA 1KXGA 5B4XA 3ROUA 4UFJA 2ADEA 2D3RA 4BA6A 4YRDA 4L0PA 1UU6A 1B09A 3AJZA 3SNMA 5E88A 1OQEA 1DZQA 3ALQA 3JBG3 2RS53 2BU9A 3D8CA 3R4UA 1JZ8A 3V0BB 4PI0A 3OGSA 2RR13 2YPDA 3VL8A 4YG0A 2HYXA 4K8FA 1WCDJ 4QDSA 3AP6A 3MIEA 1AR73 1RUH3 2UWBA 2UY8A 2ZHKA 3BGAA 4E4HA 2DVGA 3N9MA 2Q1FA 3H1MA 4PIZA 1KDMA 1VBA2 2IXCA 3BTZA 1W0OA 4LULA 5FY5A 1UPSA 1QJX1 3BU7A 4HSJA 1XNKA 4RS5A 5FY0A 5HI0A 1R081 4LBQB 5A6YA 5C3RA 4FPKA 1N1TA 1W8TA 1REDA 1XE7A 3LPFA 1Z7S1 3EJKA 5J48A 2JEMA 5JMOA 4AI0A 5C3OA 2ZJCA 1JZ3A 1JYXA 1E57A 4HBNA 2VTFA 1UY4A 4P9JA 3AKQA 2A1XA 2AGSA 1QJFA 1C3HA 1GQHA 4ARXA 3P3NA 1R092 1H2MA 5DUXA 1CAUB 2BV4A 4XFFA 1FOD1 1W9FA 4WM7A 3VDDA 2J1UA 3CJXA 2W52A 3DKQA 4CDUB 2WT1A 4C90A 3R4SA 3JB4C 3IMNA 2H6BA 2WNEA 5A7PA 1QJU2 4BXFA 1IKQA 2RS31 4IE7A 3T30A 3NNMA 3D82A 3GGLA 1ASJ1 2CTVA 2ZX2A 1DZTA 2QBXA 3I2HA 5I8YA 2BGCA 2WS91 3EXUA 3R05A 3T09A 3AVSA 3BI3A 1DDLA 5C3SA 2HWF3 1AZDA 5BNNB 3WXPA 1WCSA 2PN5A 3CJIA 4XFIA 3ZSJA 1R64A 1FOD3 4YGBA 1XC6A 3MYXA 3QCWA 4W50A 2ARBA 1EPWA 3IDEA 4PIYA 5JSRA 1DYOA 2RMU2 3WG2A 4DXSA 4AQ2A 2PHTA 3HQXA 4AQ6A 3ORJA 3FJSA 1UX7A 4CDWC 1GOGA 1OF4A 3ABZA 1O59A 3NW4A 4J25A 3LOIA 4KBZA 3T2QA 4XAAA 3K3NA 1PX4A 3POEA 5IVJA 2R30A 5EHDA 5JWPA 1LAJA 3MUZ1 2BWAA 3VBOC 5IAVA 3IBMA 3Q8FA 3VBSB 5HCFA 2MEV1 4XACA 2MPFA 3D5OA 3URFA 3SISA 3I49A 4CDXC 4BPZA 4FPJA 1QXJA 3M70A 5FRAA 1DG6A 4P5YA 3FN9A 1W6QB 4M4PA 3N9LA 5FOBB 4DZGA 4META 4K1ZA 2RE9A 3M2MA 3OOXA 3I97A 1YLLA 2W46A 2CAUA 2HWD3 1E5IA 3VBHC 2A6WA 3ZDSA 4AVVA 1HRV2 1ZRIA 2EVXA 2FQPA 3KGLA 3OTFA 4OUEA 4QPWA 5LY1A 1GZWA 4BK4A 1D2QA 5FXZA 1UOBA 2XMLA 2VJXA 2ZGNA 3GBGA 1J3PA 3NJZA 2WABA 1MS9A 3POGA 4GB33 4FOWA 2HYKA 2PYTA 3RDIA 2GC0A 4CA9A 4LUMA 3EMRA 1QJEA 1CN1A 1NYWA 1WZXA 3F2ZA 1AXZA 4QGNA 4XF1A 4H55A 1DGLA 3W58A 5KBFA 2JDNA 4FI9A 2VNGA 5EXOA 4GAZA 3CF6E 4W65A 1UW8A 4R52A 4S2GA 4QHZA 4F3JA 5L9VA 4BQ4A 4QPIC 3I2GA 3UYJA 2YHJA 5IYYA 2DVDA 4D7TA 3AXDA 3ME2A 3OUIA 2ORXA 1ALYA 5HCBA 5F2SA 3I3DA 3JU9A 3KS7A 5E8AA 2W39A 5JXJA 1LHOA 1OURA 3DYOA 4AFBA 1S0DA 1W8FA 1AL0G 5D8AA 3AYDA 3HN3A 5EIYB 1AX0A 4BYYA 3HBZA 1JODA 2V5YA 2Q8CA 2ZHLA 1VBE3 1D2SA 4I02A 4N43A 4MGZE 4BQWA 4CU7A 1LECA 5FY8A 4E9KA 1HKDA 2BDRA 1OOPA 5AC93 3ACLA 4ZZ8A 2QQOA 3WEZA 5LA0A 1WCUA 1S0IA 2BZDA 3N9OA 1OA2A 1ZZBA 2VULA 4A3ZA 2YU2A 4YNIA 4QX7A 4Y5TA 1HB4A 5C33A 5JMCA 1LB2A 1VBB2 3NNLA 3WDXA 1UXZA 3IDCB 4LO6B 4QHBA 2ZBJA 4Z1VA 5FYZA 1GR3A 2Y64A 2J1EA 4K6BA 4TLGA 1ZX5A 2E6VA 2VOXA 3NAPB 2AREA 4IE5A 3GZTB 1C5IA 2R072 3AZYA 4IEUA 4S2HA 5K8SA 4TSVA 5DUVA 2VOVA 4WM8B 3UV9A 3S30A 4RYDA 2ORZA 3LFIA 3GZEA 3P5BA 1ENQA 4HPKB 5FO9B 5C5UA 4Q1RA 4UFIA 4EZ4A 1NAEA 1W8HA 2IFWA 1HDKA 4K9SA 5F5IA 5I0UA 5IW0A 3O1UA 1YIPA 4M00A 4QM9A 5A3NA 1FAYA 4LTAA 4A7KA 2WAAA 3OPTA 1RMU1 2AUYA 1BBT2 3ZXKA 2ATFA 3BU0A 1WLWA 1G9DA 5FY4A 3KF5A 4PQ9A 1QXRA 3ZDVA 1TMF1 3M3OA 4QQ2A 5I8SA 4A6SA 3LF7A 1WCQA 1GBGA 5L36A 3DEMA 3RG0A 3DXTA 4XEZA 4XFGA 4DS0A 3WF0A 1U12A 4IV3B 1QGLA 4NIGA 3AC0A 1DQ2A 3O1TA 3GBWA 3W20A 1H8VA 4F83A 2JENA 1FMD1 1FPN3 1ZBE3 1ULOA 2VXJA 4CXWA 5C9AA 4PHZA 1V6JA 4KU7A 4KWJA 2WSVA 2YBKA 1DQ0A 3ZR6A 1PVC3 1W8NA 1NZCA 1O3TA 3NWKA 1UZ0A 4JQTA 2VNVA 2VGDA 3GJAA 1AF9A 3POBA 5FJKA 1R1A1 5JSOA 3D0SA 3SCFA 4DEVA 3LCPA 2HWC1 2A5ZA 1QKQA 1HB1A 1ZBA1 2WFF3 2GNDA 1F31A 5KHKA 1AYN2 4AEJA 1AHSA 4BQ2A 3INAA 1H4GA 3NV2A 4GKYA 2QZ3A 1S0EA 2WR9A 5E16A 3RMXA 1U0AA 3FLRA 1S0CA 2YMZA 4Y1VA 1FMD3 1CAXB 5CFDA 5A3PA 4CDUC 1ZRCA 4URAA 2WRAA 1SFYA 1VBD2 1WW4A 2HWE1 2OS2A 2UY9A 3KZ4C 5JCTA 1W2OA 3SKVA 3HT2A 1D7PM 4PLOA 4DUWA 1SQ4A 4RR3A 4GJYA 1IS3A 2WINB 2QQLA 2RVAA 3MLLA 2FZ2A 1Y4WA 2LROA 2DFBA 4YW4A 4IV1A 3ZFFA 1LGNA 3E6BA 4UWDA 1JBCA 3T0DA 2FCVA 4JGZA 5BNNC 4P9YA 1OFNA 3LDBA 4I0WB 1CZVA 2GNMA 5DAPA 2PHUA 3V0AB 2RM23 1GQGA 2YDEA 5I8TA 4HK9A 2R061 1REEA 2ES3A 5B4NA 4XETA 1W9YA 4Q0PA 5GLTA 1US2A 5T54A 5LCWL 5FKBA 1O6UA 4D7YA 4Q4W3 1NUKA 2DCYA 1CAWA 3HOBA 5IVCA 5FPXA 1X9PA 4NR1A 5FPVA 1OPMA 1IKPA 1MS4A 3ZXEA 3IM0A 2EIEA 3WHUA 3WR0A 2ZGLA 5FZ1A 1F9KA 2ARAA 3B93A 4OHWA 3SC7X 4AFMA 3FHQA 1AJKA 2BRTA 3BB6A 3C7FA 1MS8A 3IN9A 1SLAA 1X50A 1MVEA 4Q4V1 3CIHA 5ANQA 4BZ4A 1WMDA 3OEBA 4XILA 2R063 4CUBA 1W3XA 3ZFEB 2AZ5A 3B7MA 3IT8A 1WBFA 3FE5A 1AYM2 3MW2A 3VBSC 5A80A 4LNVA 2D6LX 1NG0A 2GN7A 5FPBA 1OLRA 3U1XA 1WA4A 3E1F1 1GZTA 5FZCA 5M0TA 1XNBA 1OVSA 3APBA 3V0BA 2C9KA 4EQVA 4M01A 5A1AA 3C7GA 1ND2B 3WF1A 1JZ2A 1GWLA 1PO11 4CCNA 1HLCA 3NKGA 1XYPA 4MGSA 3VKOA 1M4WA 4XAEA 3OYWB 4CCLA 1VRH3 4LBOA 4AK3A 1UF2C 3S0MA 4Y1YA 3FL7A 5T5LA 2FDFA 2A3WA 2YXSA 4MLOA 1DFQA 2VBDA 4GULA 3EYPA 4FOYA 2VVDA 2A6XA 4H2AA 4J1WA 4UW3A 2BNNA 2BVBA 1S0FA 4KWLA 3OJBA 3OGGA 5FZAA 1FI2A 4I30A 3OBTA 1B35B 5BNOB 4XDOA 1W9WA 3QH6A 4NWVA 4XUPA 4G3YC 2P1BA 2QTWB 2RDRA 2EXKA 2W68A 3VBFA 3WP4A 3ZN6A 5LK5A 2R043 2XH6A 2DVBA 2B9UA 3CDZB 3DCQA 1JYVA 3CMGA 5A7WB 5FP8A 1QEXA 2XKOA 3VBRB 3MDPA 5GKAC 3MFCA 3K51A 2VW1A 3CNAA 1C28A 4MSVA 5KC6A 2R0FA 4YW1A 3MIFA 1GANA 2YYOA 5E6HA 1G6NA 2WWJA 1X8MA 2WNVB 4IE6A 1XNDA 2VUCA 3P6BA 4Q4V2 4WVWA 4CCKA 2PHWA 5LBEA 1RUD1 2HBTA 1OLMA 4KNCA 1LOEA 1W6OB 2YGLA 3GNEA 4NJ4A 5FYCA 5FP4A 2VM9A 3KV5A 2X5IA 1NY71 1DLLA 4CEYB 2AR6A 1PO12 2ZZQA 1PM7A 2Q5TA 3D3AA 4KWKA 5FZMA 2WO3A 4HLTA 2VL4A 2RS11 3B9IA 2VBBA 3QD6A 4HXCA 2ENRA 3RYPA 4EN0A 1SLIA 2ZAHA 2JE9A 4Q4X2 5FZ6A 5DAQA 4MUVA 1DZRA 2XLGA 4QX1A 2LM3A 1V9U3 4IL7A 1VB2A 1DGRN 2ZX0A 4IQPA 3VKNA 5I0SA 2NZ9A 3H3LA 3HNYM 4DRVA 1RUF2 5T52A 4JV4A 4FTEA 5FJHA 1NCQA 2ZGTA 2VOTA 4AVCA 3NAPC 3J8F1 2OVUA 4KQ7A 4YYOA 1SLTA 5HXMA 2E31A 4NHKA 3U75A 2B45X 4XFHA 4C0HA 1QQP1 1YQ2A 1F5FA 4WM8C 3H8UA 3WNKA 3C7OA 1QH6A 2JG9A 2ZGRA 3OD4A 1ZREA 3BOPA 3VZOA 1W8ZA 1H8TB 2VVEA 4QPGB 2ZPXA 3UL2A 4FFHA 1QDOA 4SBVA 1JYIA 2AC1A 2NQYA 1G7YA 3RI8A 1OPOA 1RB8G 3OPWA 2A3YA 4IEQA 4MGTA 3J8F3 1W2NA 3WNMA 1UQXA 3U4XA 4HONA 4V2VA 1BVP1 1QQP3 2D98A 4FPHA 5LRRA 1MQTA 2VZVA 1J1TA 3N7JA 5L7OB 2BVVA 1W6MA 2I2SA 2WBKA 1WMXA 5FO7B 4QXKA 4RHV3 5I0DA 3KQRA 4AAPA 3JD73 1QH7A 3HNBM 1C8M3 1NY72 3G6JB 1UMIA 3POIA 3IKWA 3GHMA 1Y9GA 2FMYA 5ABJA 1HJGA 4IV3C 4QXCA 1OKOA 3V65A 3H8RA 2RS12 4AVAA 2V73A 4XDQA 5T50A 5F9TA 3NNFA 4BQYA 4XTMA 1HRI2 4AG4A 1VE0A 4Z2AA 5IATA 1J84A 4W4ZA 1RVF2 3ZFGA 5F3EA 2SBAA 1TEIA 4YVWB 4ZS2A 1W06A 2LS6A 4AEDA 3RI9A 1G9CA 2VUDA 4LA2A 4C91A 1A3KA 1LULA 4MADA 4P9WA 5HPOA 1SPPB 1HN0A 2HJIA 1V6LA 4IEYA 3LDKA 2GU9A 2PA7A 5CYYA 1CESA 1OD3A 3EO6A 1MS1A 4AHZA 4DRRA 3P1IA 3H3UA 3ZO0B 4XC9A 3AMNA 2TUNA 4QT6A 3O7OA 2J7MA 3UGGA 4F7ZA 3N7LA 4AI9A 3AFKA 2XBO1 2D6OX 3Q8BA 2VUJA 4KL1A 2PHLA 4MH0E 2JDAA 5JUVA 1ND3B 1COV2 1XSQA 2Z79A 5F32A 1LOAA 1NA1B 4ZZ5A 5JOYA 4XJZA 3ZYBA 2WS93 2IXJA 4JRLA 2QQKA 3PIJA 5BNPB 2RDNA 3N7MA 4KG8A 1A8MA 4FPCA 4BQ1A 1Q8OA 3ZLIA 1OF3A 3RVHA 4YZ5A 2WZ8A 3PMEA 5CKNA 1N1VA 2W9XA 2BNOA 3VKLA 4LK6A 3UKTA 2DBNA 3T4VA 2EA7A 4DUVA 5JAXA 5EZWA 1RUJ2 4LBKA 1EAH1 3D0JA 5CFCA 3PIGA 1NKGA 2VMDA 3I2KA 1HXS1 4YLZA 3WINE 5I91A 2EAAA 4NPMA 5IFPA 4FAHA 1S2BA 2C4XA 3QOPA 4D6SA 4LHSA 1LHUA 4M3CA 1UL9A 5FZHA 1Y43B 1UD1A 4Q26A 1UYXA 5F2WA 1H1AA 3J7NA 1YNAA 3A23A 4P02B 3VKFC 2CWMA 1SACA 3N4MA 1J83A 2CGNA 2FD8A 1MEC1 2G9GA 4Q4Y1 2VW0A 3C3VA 1EV11 3ZFEC 2D5FA 3MLJA 1AXKA 2GDFA 4UI9L 1RUNA 5GZCA 3VD4A 2ID4A 4AWDA 2J1AA 1GNYA 1BLZA 2PHFA 2DWRA 3R0RA 1PHMA 1WMFA 4FTSA 3AJYA 3SLIA 1RUI1 2FZ1A 1OKQA 5J1XA 1VBC3 5FY7A 1ND2C 1SCRA 2G4IA 1GNHA 4AHXA 2QFEA 3K46A 1XRUA 1C1LA 5A32A 3TEYA 2XG3A 4K3UA 3S5AA 2BNMA 1EP0A 3WQBA 3ZXGA 5BYNA 4UW6A 4KMQA 1PGW2 3PU8A 4FOVA 2ZHNA 4JX0A 1MACA 1EV13 4UW4A 3VKMA 1O3QA 1H1IA 1PK6C 2VC9A 4HVOA 3MF6A 4YM1A 2VXRA 2JD4A 1QOOA 2WSUA 1MR5A 1TME1 1GUIA 3J26N 2P2KA 3LEIA 4RFRB 2IUWA 4PI2A 4XOGA 5FZOB 2W87A 2WWUA 4YGEA 3RFRA 1AR61 1B35C 5BNOC 2BPA2 2ZGQA 1MZEA 4E4ZA 1YJKA 4RGGA 4ZY9A 3V64A 1AUYA 3BCWA 3DV8A 2BOJA 4P5HA 5GJ6A 5A3MA 5CIRA 1UPIA 2X09A 2DV9A 1DQ4A 4XURA 3VBRC 5FZKA 3ZMOA 2ZKLA 4IETA 4YFZA 3MZHA 3Q9OA 5LA2A 4Z07A 3A22A 2PLV2 3OBZA 1POV3 2V72A 4X8NA 1H9WA 1BQPA 2WNVC 5APAA 2CHHA 5IHRA 4WVMA 2W0XA 1OVPA 2WNUA 4R8HA 4D8MA 1N3OA 3PLQA 1W6PB 1LENA 1JW6A 1AR93 4XHXA 3W59A 3FBMA 4MVTA 1UIJA 3RNSA 2VPVA 3ZKYA 3AKRA 1RUC2 3HIFA 1RHI2 3OGVA 4I0AA 4LHKA 4ZU5A 4BH9A 1K42A 4CEYC 5CG9A 2QQUA 2PQQA 4MXWB 1UY2A 3ZYJB 4HL0A 1F8VA 2VQTA 1GZCA 2QQJA 3KT4A 3GHNA 3A7QA 1J59A 1PO23 1VBA1 4HVRA 4NUBA 3WW4A 2D93A 2DYCA 1OUXA 2V5DA 5DDJ3 2BYVE 3WF4A 1TNRA 4AVTA 2NLRA 3RWKX 1GICA 2EAKA 4XJ8A 1GWKA 3TN91 2P17A 4RQPB 1NXMA 5FZ9A 2VQAA 3OBRA 1S2KA 5F37A 2IXHA 2P4EA 2ARCA 2YV8A 1ZVFA 2EXIA 4AW7A 3MEPA 2Q0AA 1NLQA 1R091 4HOOA 4LLFA 4EV0A 2VZRA 4CP9B 3IIAA 5JIUA 1QXPA 4R4XA 3I2DA 5F1RA 2VOKA 4LHLA 1GQPA 1VIWB 4UFHA 1OQ1A 3WCSA 2ADDA 5GLVA 1QJU1 5C3PA 4S2FA 1H8TC 1QJY3 5JXHA 3QLQA 1BEV3 4MGYE 5A3OA 1UOGA 3PVNA 2HWB2 1RUG2 4YARA 3DGTA 4QAWA 1OUSA 1AR81 4KGQA 1ENXA 2XONA 4YFWA 3S6PA 1AX1A 2W95A 1PIV3 2Y0OA 5L7OC 3KCYA 4N9IA 3NMBA 2WT0A 5F6KA 2RMU1 3MHZA 2XLAA 1V70A 1PK6A 3K77A 4LBQD 1KS5A 1JYTA 4NPRA 1O5UA 2XUEA 1PVXA 4IERA 4JGYA 3O12A 5JZGA 2BFUL 2VZPA 1H6YA 1OI6A 1OHFA 4FFIA 2YC4A 3DL3A 5ERLA 1VP6A 1S0JA 3O1OA 3RZKA 3KD4A 3TN92 4YVWC 2I07B 1W6NB 3ILRA 1HQNA 2Z5WA 1Q8QA 3ZYFA 5FPLA 2JG8B 3M3EA 3ILNA 3VBUB 4L11A 4IEXA 3I2OA 1CJPA 4GWJA 5JOWA 1I5ZA 2B7YA 4NN0A 1O7FA 4DFSA 5C70A 3U11A 3SH3A 3AZXA 4RGAA 1YYNA 4IEVA 4CCMA 2WZR2 2K46A 2RV9A 3ZX7A 1I1EA 2JB4A 1ACCA 4R4ZA 4CDQB 1QJX3 4DMIA 5FY1A 5ACA2 4Q1PA 4TLFA 3E97A 4XW3A 1R083 3AP7A 3MFAA 4GJZA 1ND3C 3I3BA 3KM5A 3O0WA 1Z7S3 3PDQA 4COVA 4NIIA 1BZWA 3PUIA 1NA1C 3OGJA 5H9RA 4AZZA 2QQNA 4QM8A 1HRV1 3JBG2 3WDYA 2RS52 2ZXQA 1AR82 2Y33A 4NWWA 2KM2A 2JDUA 1W28A 2RR12 5BNPC 2QCSB 2IVIB 2Y34A 1W8OA 5JOXA 3A4UA 2GZWA 4Q0UA 3SCHA 1C4RA 1MS3A 4N53A 1JOBA 1AR72 1LHNA 1RUH2 2ZEXA 2LTNA 3B69A 3OY8B 4PLMA 5F3IA 3RWNA 1GMMA 4C1XA 4ZU7A 1UYYA 4NIHA 4E4DX 3M3QA 1CX1A 5I93A 2RS33 4XBNA 1OBNA 2CV6A 1ASJ3 1O8PA 4OHYA 5K0UB 5LK7B 1QOTA 5LA9A 2HLEA 1DQ6A 4IEZA 3KT7A 1YRZA 4MX3A 3ON7A 1UXXX 5JPMB 4LQRA 2AEYA 1BXHA 1CJDA 5JIAA 1JU4A 1MVQA 4QQLA 1GFF2 1W0PA 2A71A 3POSA 5FZDA 3M7AA 3IPVA 3RMYA 2W47A 3WOGA 2X05A 3WD5A 4UXAA 3MPBA 1WCKA 1Q43A 4YZ3A 3S57A 1O91A 1CONA 1UN1A 1IPKA 3U07A 2R49A 2ZCWA 5DMYA 3MLKA 5FUNA 1W99A 4LORA 3HWJA 5FTTC 1SBDA 3RYRA 3ZSKA 1XBFA 4HETA 5FYHA 2ZX3A 5FQ0A 5FYIA 5GLWA 4JKLA 4HG6B 4HSLA 2D97A 1VAKA 4LLOA 1VBB1 2O0OA 4QDRA 2MEV3 2H0BA 1J58A 2HWF2 2JDYA 4NHMA 3U10A 4AYUA 5FZ0A 5A33A 1Y3TA 2JWPA 1H1MA 3KVBA 4AFCA 3FFQA 2R071 2EIDA 1YJLA 5G04L 4CUCA 2SLIA 4GD4A 3AKTA 1SG3A 3ACGA 3WQ0A 3E6CC 2QDNA 1EYBA 1D0GA 4AQTA 1I6XA 2ZOEB 5T5PA 5H9PA 2O14A 4BLJA 4N7UA 4Q8LA 3E6DA 4WVZA 1UNBA 4P00B 1I9RA 2DUQA 5KHHA 4CP0A 1WD3A 2C9AA 2ZKNA 3MW3A 5C4WB 4XXAA 3FWEA 4BOWA 4URTA 2D7FA 1ENRA 5F3GA 1BBT1 3LAGA 3EQEA 4L92A 5EWSA 4BWOA 4A3XA 4JDMA 5LZ6A 3USUA 1UCXA 3TEZA 2B5HA 2CU5A 4NE9A 1WMEA 4YM3A 1FYUA 3NNGA 4BDVB 2VBPA 4FXKB 2OQ6A 5FMOL 4COZA 5D1IA 3AK0A 4FPGA 2HWD2 2NP0A 5C8CB 2G9ZA 4UF0A 4YG3A 1BBT3 4YW7A 3ZXFA 1X82A 2HKXA 4ASMB 2RJLA 2CY6A 1RUE1 4CDWA 2OX0A 4LE4A 4BE3A 2JIJA 4GB32 5FK7A 5FXWA 4LA3A 4LPLA 4RQPC 4CSWA 2WQ4A 4COWA 2WN2A 3DN7A 3AX4A 1PM4A 5D21A 5A3UA 5HCAA 2UYBA 1AYN1 4ISQA 2BFUS 2QQWA 1U5IA 3I59A 4GKXA 3RQ0A 4K1YA 1CR7A 4HFSA 5FMDA 3VBOA 1BVVA 3OGRA 5JSPA 4D6RA 5JR7B 4IEOA 1YIFA 1ZRRA 3GZAA 5CKMA 1W0NA 1GNZA 4RN5A 1VBD1 2XVGA 4ZU4A 4CDXA 4Q27A 3CZUA 3LGRA 2CYFA 4B29A 4CCOA 1G86A 3BOWA 2QQVA 2CDPA 2HEWF 3O1RA 1OA4A 1WUVA 2R7EB 3MIGA 2DU1A 4OHXA 2CNAA 1KJRA 5FUIA 4JTNA 1JI6A 4HVQA 3HD8B 3ZYGA 4LBMA 4D69A 2ZEYA 3T1MA 5J7MA 1UZWA 3M1HA 3DF0A 3K4AA 4ISRA 1VBE2 4Y33A 3VBHA 5BUVA 1GV9A 2NPIA 3TB0A 1K5MB 1DP0A 1NCRB 3WDVA 1F2NA 2XWJB 3J7HA 3C7HA 4B7EA 1LKNA 4PDWB 2DVFA 1T6BX 5HXVA 2OUJA 1RITA 4YVSB 4CPBD 5AC92 4MXVA 4QQOA 4EROA 3VL9A 2JIGA 1LOFC 1LOCA 1O8SA 4LT5A 1RMU3 5A7SA 4BQXA 1JXNA 1Y7BA 5C8WA 1AXYA 4AXOA 4EE2A 4OLLA 5EPAA 1A78A 2K9ZA 4LKSA 5BNQA 3PTRB 1RUE2 2BQPA 3IDBB 4B8EA 4XJWA 1DHKB 1TMF3 3VN4A 2XR4A 4QPIA 2Z2SB 4FVVA 5JXIA 1CZTA 5LEKA 2VE1A 4AI8A 5FPZA 2WQZC 5FZ4A 1AYM1 2JG8C 2YFUA 4FTBA 4BHPA 2CDOA 3UETA 3VBUC 4FQ4A 1UO9A 1NX9A 3AMHA 5CKQA 1IS5A 2XXZA 4XQDA 3MV11 4Y22A 3ZN5A 2ET7A 2ZAAA 4CDQC 2FHRA 2XJQA 4O61A 1DBNA 4ZXKA 3O1SA 2B9VA 2YBSA 4I3PA 4RGKA 1QMJA 1BMV2 3KMHA 4QWNA 3AP9A 1HQWA 1R1A3 4NOTA 3KLSA 4CUGA 5I0RA 5F5QA 1DGWX 2HWC3 4Y20A 3EHKA 1ZBA3 1WW7A 1W2UA 1AVBA 4CUAA 3ZYPA 1O3SA 2XLFA 4M0HA 2P3IA 1TE1B 2EICA 1W2AX 2XHNA 3MO4A 4LBJA 3QACA 1BJQA 3NL1A 4L97A 1T6GC 3IAPA 3WLUA 1JOPA 5H9SA 4GH4B 3N7KA 2HWE3 1TQ5A 3DXUA 3KGZA 4Y4RA 3ZVXA 1IPJA 4EJRA 3KHCA 3IIIA 3I7DA 2XHKA 1CAVB 5K0UC 3ZXJA 2VECA 3ES1A 1L3JA 1FPN2 1ZBE2 3QBQA 5DAXA 4B1MA 1KFUL 3AKSA 4JCKA 2EXJA 5FYMA 4FPLA 1PVC2 4A4AA 5D2AA 2PFWA 2XQXA 1BK1A 4JZRA 1APNA 5FK8A 4CEWB 4OYUA 2CSGA 2WFF2 3ATGA 3Q8AA 3SCGA 1S0BA 4MHUA 3H8XA 3AM2A 3KCXA 3GJBA 5FXVA 3GDBA 3TNQA 2QVSB 5LEJA 4O65A 1LGBA 4LIVA 1PZ7A 4DQAA 3TEWA 3VDBA 5IFTA 1E5HA 1YWKA 2VMFA 4HZFA 2O8OA 4Q4V3 4Q4X1 3WNPA 1OXCA 2L9LA 3LA7A 3LKJA 4C1WA 1ZRDA 1HW5A 1EY2A 5FXXA 2V4VA 3J8F2 1UMHA 2EALA 4GWIA 3RZJA 3O1VA 3DUIA 4OULA 4FP2A 3WNNA 2J22A 1RUF1 2ZABA 3DPRB 5FMOS 1CZSA 2AEZA 2VTXJ 2RM22 2W3JA 2ZACA 3HAGA 5I0TA 1UKRA 5B2GB 3LSEA 4CU8A 1REFA 2WIIB 4TTGA 1PO13 4LBQA 3M3IA 1C8NA 3OPZA 1FX5A 5T3NA 4Q4W2 3ASIA 1M06G 2QZ2A 2P6HA 3KQ4B 2VZ1A 3GXUA 2B46X 4BU2A 2A6VA 3LE0A 4XUQA 3O1MA 4LEJA 4CXXA 4YZ4A 3FZ3A 1NQDA 4N9HA 1K3IA 3N35A 1YQCA 3TRSB 5HV0A 1CAUA 4HN0A 4NHYA 5KXEA 3B3QE 3WF3A 1PNFA 5C4WC 4CDUA 5KR7A 5KHGA 4GWMA 4EN8B 1JOJA 1ZM1A 4AL9A 1FATA 3T1LA 3O0VA 2DFCA 4XFCA 3UKVA 2W91A 4RS5B 3SKJE 1URXA 4OQ8A 4I3GA 4AE2A 3U78A 2X8KA 3HQRA 4V2WA 3ZYHA 2YUEA 5F3CA 4JVAA 2OKXA 3LWCA 1T2XA 5J3UA 2MHFA 5BNNA 3MBWA 4OI2A 4QB2A 2J1RA 5BPXA 2DF7A 1L7QA 1NT0A 2RDQA 3BTYA 2VCBA 2D6MA 2Q8DA 3VLBB 5DUWA 3WG1A 1VRH2 4WM7B 2OA2A 3VDDB 1WA6X 5C8CC 1ULPA 4QD2A 1HRI1 4QKBA 5J96B 1QU0A 1RVF1 3LEKA 4E2QA 2GMPA 4Y26A 1RUD3 2R1BA 5CNAA 3PURA 1FXZA 1HIXA 1DYKA 2F4PA 3UJOA 1DF0A 2ARXA 5AFEA 5C71A 3LEMA 3SH5A 2XPJA 3AZWA 5FREA 5FZFA 3WW3A 4IGPA 3ST7A 3PHMA 3LEGA 1KFXL 3FMGA 1JU3A 4WV8A 4QX2A 2WKKA 3WDTA 2RG4A 3CJIB 2BGOA 2RS13 2E7TA 1QIQA 2J1VA 2KR2A 2R042 1NZIA 4Z82A 5DZEA 5L73A 3TNPB 1RVF3 3VBSA 3O5SA 1COV1 4P14A 1JTZX 3J7MA 4IDZA 4P9IA 2GN3A 1QY4A 1W6QA 4MV2A 3SEPA 4CYDA 1XU1A 1WWYA 2ZX4A 5IK5A 4COUA 3U0ZA 4XTPA 3K75B 1WD4A 3THPA 2ZGSA 3AL5A 2X29A 4Q2FA 2BBAA 1ULDA 2ZZJA 4GIQA 1GZ9A 4DY5A 4QX3A 2KA3A 2W1SA 1K5MC 1NCRC 2GC2A 4TXWA 1FNYA 4XVHA 2VTXA 1RUJ1 1KRIA 3K2OA 1BCXA 3HVDA 4PDWC 3OUJA 3N9QA 4YVSC 3WCRA 1YFUA 1VAVA 2AACA 1HQLA 1UOJA 1ODMA 2KD7A 1Q5OA 4OUMA 3M4FA 4CP2A 5EFUA 1ZZCA 2IC1A 1UKGA 3THTA 3W9AA 4R9CA 1YO8A 1V9U2 1UZVA 2XGXA 2PAEA 5H9QA 1RJ8A 1O4ZA 1ZZ6A 1DLCA 5EYYA 1PMJX 5LASA 4PT6A 1SCSA 4C8DA 1YEWA 3E5XA 4IE0A 3O14A 4OI4A 1V6IA 3TEXA 4XJUA 1JZ4A 3ZOIA 1LOBA 5FMBA 3C7EA 1GZWB 3N9NA 3UESA 4FFGA 4UAPA 4UT5A 1G8WA 3SEEA 4A42A 1PZ9A 1VRBA 2E7AA 2WA4A 2WDBA 1DIWA 5IJRA 1YI9A 3I8TA 4Y4YA 2AENA 2CGOA 5F39A 5CISA 5FBJA 3ZSEA 1TVGA 2EIBA 3U14A 4MGIE 1VB4A 3VHOA 1PGW1 1IQAA 1ODNA 2NMOA 1DGRA 4QU1A 1QNWA 5FOJB 1Q3EA 4O7XA 5FCCA 2ZEZA 4NIAA 4HK8A 4AI2A 2Y38A 3THCA 2XBO3 4MZUA 2YB7A 4O9EA 4RHV2 1Z78A 4R9BA 3JD72 5DZGA 5FIXA 4PF5A 4EYUA 3IMMA 4XMIA 1C8M2 2BP6A 5FAXA 1H6XA 5D8AB 3WF2A 4AOCA 3BIEA 1V6NA 1QDCA 3OBAA 4GH4C 3D4KA 4RFT0 4XE9A 1XNTA 4BMEA 3H50A 1Y9QA 4X6QB 1XXNA 4N43B 5ISLA 3NAPA 2WZPP 2JDMA 4AF9A 1XQNA 4D3WA 1JZ6A 2G9FA 3IZOA 1OQDA 3R6SA 4JHZA 4P9GA 3WX5A 2VQUA 1OOPB 3LDRA 4WM8A 2WLPA 3ILFA 2BERA 4WZFA 1LCLA 2PLV1 4ZS3A 4HPKA 1CIWA 4XFBA 3HNMA 2OZJA 3KB5A 3OD0A 3OB8A 1X9TA 5AVPA 4CEWC 2UURA 5KHIA 4OFGA 1CGPA 4IGOA 2OZ6A 1EAH3 2ZA9A 4FFFA 3PUHA 5LBFA 3B9CA 3CQOA 4IE4A 1MS5A 1HXS3 1GKBA 3MV01 1RUC1 3L9JT 1RHI1 2I74A 3HJRA 1STMA 1PGL2 3NJXA 4E2SA 3SH4A 3KHBA 2GP5A 1HV1A 1XNCA 4QHOA 1TG7A 5JR2A 4LBNA 2YY1A 1YUDA 1IHMA 1SBFA 2YU1A 1JMUB 2PTMA 2WS92 3AVRA 2A75A 1MEC3 4LO5B 4Q4Y3 4IV3A 4LBLA 1OFSA 3SHRA 4DY3A 1D4M2 3BKZA 3HN1A 3LPGA 4Y1XA 3NSTA 4DUXA 3ZIXA 1J1LA 1XOYA 1YXWA 3DPRC 2VMCA 1RUC3 3CBNA 1RUI3 4UYBA 3VUOA 1ZYBA 5E89A 2OT7A 3MIBA 4CPBA 2GP3A 2WN3A 1UU4A 1MZ5A 2LW8A 4P9XA 1DYPA 3NV4A 2ZMNA 5C6CA 5HV4A 2XB6C 1LEMA 3GCXA 3HBKA 3KWVA 5GM0A 3H1WA 1SLBA 1MZFA 2PAKA 4ZPIA 2B42B 3RZGA 5IAXA 4FP3A 4K8RB 1LEDA 2HWB1 1RUG1 4ET7A 1US3A 1TME3 2VUAA 1O5LA 1CAXA 1I5PA 2Y6GA 1LHVA 3OG2A 4M4RA 3PU3A 5EP9A 5IVYA 3AYAA 3LA3A 2JE7A 3FLPA 3ACFA 1AR63 4W6YA 4C0BA 3JCIA 5C9AB 2A3XA 2B39A 3H1YA 4RS5C 3JZVA 5GLUA 3ZIWA 1ULFA 2VW2A 3ELNA 1V00A 4EWDA 3X29B 5KXCA 5A3WA 3A0KA 3VZKA 3VHPA 3H9AA 4NAOA 4LKDA 1K45A 4CXYA 5LW9A 1SMVA 1VBC2 1ZRFA 2JDHA 3I2IA 4OZXA 4ATEA 4CRQA 3V0AA 3VZLA 3FUQA 4JDNA 1NE6A 2VZQA 5GZFA 4WM7C 3VDDC 5FZIA 3T2PA 5CFDB 4LITA 2X53S 2VZOA 4ZKTB 2C5DA 5E1RA 2ZEWA 2VD7A 1XSRA 4DXRA 4I01A 2JE8A 3OCPA 4A7ZA 3AB0A 3RS6A 3CKHA 2FCTA 4RR3B 1JYNA 1YCIA 2Y6FA 1BHGA 2DCKA 4IEPA 4AGGA 3T3YA 4IV1B 3ZFFB 4Z8BA 3DECA 5IK7A 2O1QA 4JGZB 2W1QA 1YFXA 3CJIC 5F5AA 3ZXAC 1VBA3 3WP6A 2WZR1 4AGRA 2VZTA 5ACA1 4NO4A 3ZFEA 4TWTA 3WQ7A 2OW4A 2HBUA 3PUQA 3TN93 4QPGC 5JPNB 2J1SA 3SXWA 3T0AA 4EZHA 2WQ8A 3ZXDA 2O8QA 1CAWB 2GSYA 5CEHA 4XHBA 4DXZA 3M3CA 3JBG1 2RS51 1W90A 1LTEA 1ND2A 4NROA 4LO7A 2UU8A 2AH2A 2RR11 3JQXA 1R093 5FZ8A 2N7GA 4B3NA 2WJSA 3OYWA 3ES4A 2FCUA 3MICA 5FKCA 1ST8A 2UWAA 3UK9A 1ZNPA 3AZZA 2VOWA 1AR92 1AR71 1RUH1 4XUNA 4CP1A 4YW5A 1ULEA 2ERFA 1W04A 1QJU3 4QX5A 3WW1A 1AL22 5FO8B 4K7JA 5HCHA 5FYYA 4YW2A 4YZ2A 2Y0IA 1XJAA 1MPXA 3DPRA 3CL1A 5IUQA 1N3QA 1H30A 3VV1A 4GALA 1PO22 2DTYA 1NQJA 1AR83 1B35A 3AMPA 5BNOA 5DDJ2 4GZ9A 2HEYF 3ZMNA 1CIYA 3HEIA 2XJVA 3E5UA 2JJ6A 4NHLA 3WDWA 3VDCA 3WNOA 3FC0A 2WT2A 4Q0VA 3USSA 4AEMA 3FLTA 5A7WA 4BIFA 3VBRA 1RXGA 2RMU3 4CTEA 5IK8A 1HB2A 2PAMA 3WSOA 1F35A 1LESA 1W9TA 2G19A 2WAOA 3A21A 5FPAA 3UKNA 3T2TA 1J3RA 3ENRA 3J4UH 5FV3A 1CWPA 2WNVA 3ECQA 1CD3G 3N9PA 3PL0A 4XF3A 5DAVA 4NPLA 4OCTA 4G4FA 2PHDA 3B01A 5DN2A 5FBZA 4UFKA 3LD8A 4CU9A 2KXLA 1QJY2 4FXGB 2W92A 1BEV2 3RRDA 3Q8EA 1W6OA 3H3ZA 3VBFB 3ZN6B 5FZGA 2BOIA 3ITQA 1RGSA 4JDOA 5A1FA 1H0BA 2BGPA 5FZEA 4QGMA 4CEYA 1SDWA 5BY5A 3HT1A 2HWF1 2IXLA 4LHNA 5C5TA 4OHZA 2QKDA 3HPNA 3NKTA 4QKDA 1PIV2 4FSJA 5FMCA 4FOQA 2JX9A 1XE8A 2BEOA 5JXGA 1UY3A 1LODA 2XL9A 1XU2A 4FCAA 4Z2WA 4QX8A 4A41A 1PMIA 1HB3A 1GOHA 2Q4SA 1V0AA 2RDSA 1KQRA 4LIUA 5D8AC 3I2FA 4ZONA 4N43C 1GP4A 1HRV3 4YM2A 3WNXA 4TZDA 1F5JA 2DTWA 2X5IB 2R1DA 1KD7A 4BISA 2ZS6B 1KS4A 4PLNA 4XZPA 2GNBA 1QJZA 1OOPC 3RZHA 3Q8CA 4XUTA 3B02A 5DG1A 1CPNA 3PTYA 2P3KA 5FPUA 1C5HA 1H8TA 3AP4A 3KF3A 3W5NA 2QQIA 4FQZA 4QPGA 5FP9A 4AVBA 4GWNA 4BQ3A 3JUUA 1WLTA 2DUPA 3DYMA 4Q8KA 1LNSA 3H42B 4XPVA 4G9SB 5A6ZA 5FR3A 1NCQB 4E27A 1XNAA 2W1WA 3OEAA 1QJX2 5FYSA 5BV6A 5L7OA 1R082 1VAMA 2HH9A 1UY0A 2R0HA 4BB3A 2FDKA 2HWD1 2XWBB 1Z7S2 2H6CA 3LB9A 1YI7A 1WBLA 2XJUA 3GALA 4PBOA 2JG9B 5DQ0A 4CCJA 2P3JA 2RHPA 5FZBA 3ZSLA 4IUGA 5GZEA 1YHFA 2VZSA 2NYYA 1IS4A 3BUCA 4QXHA 2DURA 1IS6A 1FOD2 4GB31 5IWFA 3THDA 4XCBA 2TBVA 1RJ7A 2ZMKA 4OHVA 4OUSA 1KGYA 3CEWA 4UBHA 5CVRA 4AI3A 4AQSA 4YVWA 1UU5A 1I3HA 3RYKA 1CQ9A 4DB5A 1FT9A 1NLSA 2CAVA 2RS32 2WO7A 4KI5M 1HV0A 1KEXA 1MQTB 4L9BA 1ASJ2 4GQ7A 1W6MB 1SPPA 1W39A 2Y6LA 2JKXA 3C2UA 5IVBA 1X33A 3HMYA 4RD7A 5SV8A 2EF6A 1Q8VA 1VBB3 2WYSA 1UYPA 5FLHA 4A6OA 3BTXA 3P3PA 4D6QA 5ABJB 2IWGB 2K0GA 3FX3A 4HKWA 1OA3A 1ZA7A 4IXLA 4JRAA 3UJQA 4UFMA 2Y26A 5LA1A 5IVEA 1FV3A 4DEQA 2R073 4BMBA 1ND3A 1OD5A 1S4CA 3NV3A 3ZFGB 2TEPA 1IPSA 4ZHNA 4AEDB 5C9AC 1NA1A 1VBE1 2E9QA 1WKYA 2X10A 3G7DA 5EV7A 1OLME 3ZXLA 3VD9A 1W03A 1XYNA 4KG0A 1SHWB 5BNPA 4XF4A 1D4VB 3PVEA 1LGCA 2V09A 4LE3A 4TYSA 5F6LB 4TN7A 5LRSA 5AC91 2VCAA 3S7IA 3LZZA 1F4AA 5LBCA 3WT3A 4MGKE 4QKFA 2BTVC 1K5JA 3ETPA 4XBQA 4XF9A 1Q56A 3GM8A 3BPSA 2CWSA 4LK7A 4LKEA 2VU9A 3UNPA 1U5ZA 3BTAA 1ZZ8A 2PHXA 5CFDC 2CGPA 2MEV2 5FWEA 2VCMA 2DU0A 3KT1A 4UFLA 1NXD1 3J7LA 2YPJA 5TSWA 2OYZA 4OMCA 1X7NA 3UGHA 1Q8PA 3FUOA 4RR3C 4FT8A 2VNRA 3JXSA 3ZPYA 5G05L 3ZFFC 1LR5A 4GMP0 4IV1C 3WV6A 5JDBA 4HKLA 2XVLA 4JGZC 3T0BA 1YQ6A 1ZZ7A 1GLHA 5A6XA 5EJ3A 4XJ9A 1H2NA 4QMAA 4KBBA 4R9DA 1RUE3 2D3PA 4QB1A 4XQ4A 3NJVA 1BMV1 1QHDA 1AX2A 4GA9A 2WFPA 1O3RA 5CFCB 3NNJA 1VMFA 3LQCA 1Y9MA 2Q8OA 1K12A 2WUHA 3T4HB 4AI1A 1MZ6A 3W21A 1IZ3A 1HN1A 2Z69A 3DKWA 2W94A 1RIRA 4A2UA 4MO3M 5CU1A 1AYN3 3PNAA 2D6KA 4RSUA 5DZFA 5AFBA 2WYFA 5DAWA 5A7QA 1A6CA 4AFAA 1RL3A 4M3CB 4LO8A 4FPYA 5HBAA 3S5QA 3VGIA 1HJFA 1YQ8A 3U37A 2ZGOA 3IWZA 1VBD3 4XXPA 2YC2A 2XL7A 2VQ0A 5KXBA 3ZSMA 2LALA 1CX4A 4OVEA 5CA6A 2RJ2A 5FZOA 1FPN1 1ZBE1 1VMJA 5K9YA 2JDKA 4XYXA 4OI0A 4DPNA 1PVC1 4K20A 4EN7B 3F95A 5A32B 3I2JA 1SFPA 2J1TA 4YPJA 2DCTA 1OSGA 2JD9A 3D6EA 4U36A 3SITA 4Y24A 5CZKA 4Y1ZA 2WFF1 4Q5OA 2YGMA 4J1XA 3C8XA 1UYZA 4FPFA 2ZGKA 3KV6A 2C0ZA 4BXSV 3OF1A 2F17A 2K2SA 3KSCA 1W8WA 3MIHA 1XPWA 2IZWA 1WW5A 2P3YA 4QU2A 4XQWA 2IXIA 3WUDA 2YROA 3WG3A 1H4HA 2GH8A 3O0XA 2WL1A 3GCWA 3WW2A 4AGVA 3SQOA 1W6PA 1SDDB 4CVUA 3M8LA 4SLIA 4P08A 3B00A 2ZHMA 3MF9A 4AHYA 4MGQA 3ACIA 4X8PA 5L9RA 4B1LA 4PF1A 1JZ5A 1YFWA 1QF3A 3VBFC 4Y5SA 4W8JA 2P6CA 3AL6A 1SZBA 4MOAA 2Q8EA 1AYM3 4MXWA 3E5QA 3VD3A 4K21A 3ZYIB 1RTVA 4YSFA 4YM0A 2XQRA 4OZOA 5FZ7A 4V1PA 4BLIA 1S2EA 1NLRA 1D0HA 1ONAA 3UT0A 2Z4FA 2RM21 3ZYRA 1CVNA 4COYA 2WZEA 4UW5A 1LJ7A 4DIQA 4LOTA 4IGQA 1SFNA 4WVMB 2WNUB 4FBFA 1YQ5A 2BWCA 4WZCA 4Q4W1 4QXBA 3CLPA 3MW4A 4RQPA 4MG2A 2PQSA 2GC1A 3CO2A 4D94A 3MPPG 3JB8A 4ES8A 1RMU2 5T5JA 4B7KA 2D3SA 3VZMA 4HMZA 4OMDA 4H7MA 2X5IC 2C26A 3WY6A 4CP9A 4KH9A 2UYAA 2D44A 2VR4A 3BYWA 3LOBA 4M3CE 2D6PA 1TMF2 3RZZA 1V6MA 4CZSA 2FBEA 3WUCA 4NMIA 3GZUC 1TZOA 1DGWA 1HX6A 3CZJA 1CPMA 2E32A 2JXAA 2D5HA 3KV9A 3I54A 2YFZA 1DQ1A 4PJYA 2GMMA 3PUAA 1X8EA 2PMWB 2VVFA 3WDUA 5CAZA 2DBIA 2E53A 2Q30A 2W5FA 1FMD2 3ACHA 1ZZ9A 3LIGA 4FPOB 5LWBA 2WLQA 3EBRA 1NCQC 4I0BA 4Q0SA 3TYJA 5KXDA 1W8UA 1OC1A 5JI7A 1G9BA 4I2OA 5A7OA 1EUTA 1KITA 5EJZB 5FUPA 4W6XA 5T55A 1VRH1 4E8CA 2LUWA 1VLNA 2FDJA 5FDBA 4Q29A 2YZ4A 1R1A2 4OI1A 3FFZA 4YGCA 4R9AA 2ZTNA 4NIDA 2HWC2 1BYHA 1POV0 1E5SA 1ZBA2 2JG9C 4ZXEA 4A45A 4AHWA 3GF6A 1N47A 1LOFA 4W6WA 1UY1A 2D43A 2QQPA 1P8JA 1EPZA 2Y6HA 4L99A 2XKPA 2PHRA 3J9SA 4XIOA 3VZJA 3LA2A 3NVCA 3POJA 5FP3A 5IK4A 4AFDA 4QKNA 1C57A 4L2NA 1PZ8A 3NQHA 3U4SA 3WVJA 1JYWA 2HWE2 1BK0A 4KWUA 3I3MA 2OPKA 2VMGA 4Y3OA 5T5OA 4EN9B 1W6NA 4EN6B 1IG3A 2NN8A 3HR9A 1MQTC 2R041 4U2AA 4Q4X3 4CCEA 5A3LA 4LR4A 4QGLA 2JG8A 1RXFA 4FO9A 4LOSA 3VBUA 2VAUA 2E63A 1R1ZA 3RJ2X 1PK6B 3PVOA 1JHNA 4LUKA 3VB9A 2IFRA 5ABJC 5LBBA 1RUF3 3ZM8A 2H0VA 2UWCA 4JGYB 2QE3A 5EQUA 5JZGB 2BBVA 5FY9A 4A44A 5FLJA 4AAXA 5A7NA 4CDQA 3VDAA 3FBYA 3POWA 2R062 3AFGA 1H9PA 4S2DA 5F5CA 4ASLA 4BM8A 2XJPA 5A1LA 1L7LA 1ENSA 2EIGA 2IXKA 1OT5A 3ZFGC 3WP3A 4A7YA 2ZGUA 2IVJA 2Q1MA 1JH5A 4AEDC 5IVVA 3IDAA 4ORFA 4ITCA 2NMNA 4ONUA 1W2TA 2V4AA 1U5YA 1SLCA 4NHXA 5FYBA 1A34A 5A70A 3VD5A 4BQ5A 4DOUA 4CU6A 5FYUA 2DVAA 1UIKA 2QDRA 3OY8A 2QJVA 4OQ9A 2OXBA 5J09A 5GZDA 1GSLA 4HN1A 3WHTA 3BPZA 4P9LA 1V9U1 1VALA 5K0UA 3FHAA 4XFAA 2QQMA 2VMEA 2FDGA 4XZUG 2D40A 3LIHA 4JQRA 3TWIA 1F4HA 3I4IA 2BUKA 4N7IA 2E33A 1PX3A 1NOVA 3OSDA 3V56A 5KC5A 3AZVA 3UGFA 4PQQA 4FPEA 5A6QA 3OUHA 5DUUA 1IOAA 1UAIA 4HT1T 1KDKA 1PMHX 3VD7A 4N53B 3PJYA 3SMHA 1HRI3 4H3WA 2F4LA 4XF0A 1GU3A 4EWEA 1RC6A 2GC3A 1UOFA 4XIKA 2WNOA 5DG2A 3WNLA 2LRPA 2QUOA 4E8DA 3MUY1 3WG4A 3ZPOA 1GP6A 5CFCC 5EJ1B 5K4LA 3I3EA 1V6OA 4INDA 1JHJA 1WGPA 5F8PA 4XBLA 1RUOA 1YFYA 4GXLA 4JC1A 1VMHA 3AMQA 3RPQA 3H8OA 3PMSA 1GWMA 2P34A 3MI8A 3K48A 4X6RB 4QB6A 1Z0HA 2JB8A 4RHV1 3IPVB 3JD71 3RZLA 4KU8A 5EYXA 2BJSA 1C8M1 4XABA 1COV3 4GMP1 1JS9A 2A70A 2WA3A 2A6YA 4AVSA 3IB3A 4YGDA 3ZR5A 4NRMA 2ZGPA 1RINA 2YC0A 1DCSA 3K4DA 3CHXA 4N90A 2ZMLA 3KVAA 2Y6KA 2YBPA 5LB6A 1POQA 1RUD2 4D0QA 2WO2A 4XMAA 4DINB 2RJKA 4O9GA 2QNKA 1N1YA 2VMHA 2EXHA 3AKPA 5FQ0B 2P37A 2I45A 4H14A 1W3VA 1UZZA 1IGOA 2DCZA 1OH4A 1H2KA 1RUJ3 1VR3A 1GYKA 2OPWA 3K3OA 4GMP3 4Z92B 1XYOA 5LY2A 3O1PA 5C4WA 1KJLA 4YZ1A 2DDUA 4NRPA 5A33B 3WQ1A 4DXTA 3TAYA 4QPYA 4BK5A 1NE4A 1PGL1 1S1AA 2R16A 4PCRA 1WW6A 5J37A 4LXLA 5FYTA 3IAQA 2GMEA 2JKBA 1DQ5A 5J36A 5ANNA 4LMFA 2FMDA 3S7EA 3RGBA 1W05A 4IESA 3AP5A
chains in the Genus database with same CATH topology
5A7NA 4QXHA 5FYVA 5FZ8A 5FPLA 5FZFA 4IGPA 5IWFA 5A80A 5FPBA 5F5CA 5FZOB 4IGOA 5A1LA 2WWUA 4AAPA 2OQ7A 5FZCA 5FP7A 3KV6A 3DXUA 4CCMA 5IVVA 4Y4RA 2OQ6A 4QXCA 5FYBA 4CCNA 5FY1A 4EZ4A 5FYYA 2PXJA 5IVBA 2GP5A 4CCLA 4GJZA 5F5IA 5IW0A 3K3NA 5FZKA 4UF0A 5A3NA 5FZ3A 5IVJA 3PDQA 5F3EA 5FYUA 3OPTA 2YU1A 4D6QA 3PUSA 5FYMA 3AVRA 2OX0A 3AL6A 5FY4A 5IVEA 5A3TA 3KV4A 2Q8EA 4XDPA 5FXWA 5A7WA 4UF0B 5FZAA 4CSWA 2XDVA 5FZ7A 3AL5A 5F3IA 4XDOA 3N9LA 5FPAA 2OT7A 3DXTA 5FXVA 4AI9A 4DIQA 5FV3A 2GP3A 4IGQA 3K2OA 3N9PA 4ASKA 5A7WB 3N9QA 5FP8A 4D6RA 4LIVA 4QXBA 4TN7A 5F32A 3LD8A 4NUBA 4CCOA 2YBKA 5LY1A 5FZGA 5E6HA 2WWJA 5FXZA 3ZPOA 2XMLA 5FXXA 4CCKA 5A1FA 5FZEA 2YPDA 5FJKA 5FZDA 5K4LA 5FWEA 5FZ9A 3PU3A 5IVYA 3ZLIA 3RVHA 4C8DA 5F37A 4Y33A 4E4HA 5FUNA 4DO0A 5FYCA 4HOOA 3N9NA 3KV9A 5FP4A 3KV5A 4QX8A 5A3WA 4GAZA 3N9MA 3PUAA 5FWJA 5FZMA 5A3PA 4URAA 4LIUA 3UYJA 1VRBA 2OS2A 5FYHA 4BU2A 5LWBA 5LW9A 5A7SA 5FY5A 5F39A 5FY0A 5FYIA 5FBJA 5A7OA 5F2SA 5FZ6A 5FUPA 4D6SA 4GJYA 4BISA 3PTRB 5FZIA 5FZHA 3KVAA 4LITA 5KR7A 2YBPA 5F2WA 3NJYA 4QU1A 3LDBA 2VD7A 5FZ0A 5FJHA 5FPUA 2Q8CA 5IVFA 3KVBA 5FZ4A 5A7QA 3U78A 5FP9A 4V2WA 5FY8A 5FZLA 5FP3A 5F3CA 3K3OA 4EYUA 5LY2A 3U4SA 4GD4A 5IVCA 2XXZA 5F5AA 4Y3OA 2XUEA 5FY7A 5A7PA 4BXFA 2W2IA 5FPVA 5ISLA 5FYSA 3N9OA 2Q8DA 5FZ1A 2YBSA 2YU2A 3PUQA 4LXLA 4QX7A 4QWNA 5FYTA 3AVSA 5FZOA 4CUGA 4EZHA 4CCJA 3PU8A 3OPWA 5F3GA 5FYZA 5CEHA 2P5BA 5FZBA 5ANQA 3PURA 5FY9A 4HONA 4V2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7N A;  4QXH A;  5FYV A;  5FZ8 A;  5FPL A;  5FZF A;  4IGP A;  5IWF A;  5A80 A;  5FPB A;  5F5C A;  5FZO B;  4IGO A;  5A1L A;  2WWU A;  4AAP A;  2OQ7 A;  5FZC A;  5FP7 A;  3KV6 A;  3DXU A;  4CCM A;  5IVV A;  4Y4R A;  2OQ6 A;  4QXC A;  5FYB A;  4CCN A;  5FY1 A;  4EZ4 A;  5FYY A;  2PXJ A;  5IVB A;  2GP5 A;  4CCL A;  4GJZ A;  5F5I A;  5IW0 A;  3K3N A;  5FZK A;  4UF0 A;  5A3N A;  5FZ3 A;  5IVJ A;  3PDQ A;  5F3E A;  5FYU A;  3OPT A;  2YU1 A;  4D6Q A;  3PUS A;  5FYM A;  3AVR A;  2OX0 A;  3AL6 A;  5FY4 A;  5IVE A;  5A3T A;  3KV4 A;  2Q8E A;  4XDP A;  5FXW A;  5A7W A;  4UF0 B;  5FZA A;  4CSW A;  2XDV A;  5FZ7 A;  3AL5 A;  5F3I A;  4XDO A;  3N9L A;  5FPA A;  2OT7 A;  3DXT A;  5FXV A;  4AI9 A;  4DIQ A;  5FV3 A;  2GP3 A;  4IGQ A;  3K2O A;  3N9P A;  4ASK A;  5A7W B;  3N9Q A;  5FP8 A;  4D6R A;  4LIV A;  4QXB A;  4TN7 A;  5F32 A;  3LD8 A;  4NUB A;  4CCO A;  2YBK A;  5LY1 A;  5FZG A;  5E6H A;  2WWJ A;  5FXZ A;  3ZPO A;  2XML A;  5FXX A;  4CCK A;  5A1F A;  5FZE A;  2YPD A;  5FJK A;  5FZD A;  5K4L A;  5FWE A;  5FZ9 A;  3PU3 A;  5IVY A;  3ZLI A;  3RVH A;  4C8D A;  5F37 A;  4Y33 A;  4E4H A;  5FUN A;  4DO0 A;  5FYC A;  4HOO A;  3N9N A;  3KV9 A;  5FP4 A;  3KV5 A;  4QX8 A;  5A3W A;  4GAZ A;  3N9M A;  3PUA A;  5FWJ A;  5FZM A;  5A3P A;  4URA A;  4LIU A;  3UYJ A;  1VRB A;  2OS2 A;  5FYH A;  4BU2 A;  5LWB A;  5LW9 A;  5A7S A;  5FY5 A;  5F39 A;  5FY0 A;  5FYI A;  5FBJ A;  5A7O A;  5F2S A;  5FZ6 A;  5FUP A;  4D6S A;  4GJY A;  4BIS A;  3PTR B;  5FZI A;  5FZH A;  3KVA A;  4LIT A;  5KR7 A;  2YBP A;  5F2W A;  3NJY A;  4QU1 A;  3LDB A;  2VD7 A;  5FZ0 A;  5FJH A;  5FPU A;  2Q8C A;  5IVF A;  3KVB A;  5FZ4 A;  5A7Q A;  3U78 A;  5FP9 A;  4V2W A;  5FY8 A;  5FZL A;  5FP3 A;  5F3C A;  3K3O A;  4EYU A;  5LY2 A;  3U4S A;  4GD4 A;  5IVC A;  2XXZ A;  5F5A A;  4Y3O A;  2XUE A;  5FY7 A;  5A7P A;  4BXF A;  2W2I A;  5FPV A;  5ISL A;  5FYS A;  3N9O A;  2Q8D A;  5FZ1 A;  2YBS A;  2YU2 A;  3PUQ A;  4LXL A;  4QX7 A;  4QWN A;  5FYT A;  3AVS A;  5FZO A;  4CUG A;  4EZH A;  4CCJ A;  3PU8 A;  3OPW A;  5F3G A;  5FYZ A;  5CEH A;  2P5B A;  5FZB A;  5ANQ A;  3PUR A;  5FY9 A;  4HON A;  4V2V A; 
#chains in the Genus database with same CATH topology
 5FYV A;  1RYY A;  2VNO A;  3T2O A;  1D4M 1;  1QQP 2;  3WP5 A;  3POF A;  2R32 A;  4JKM A;  4YW3 A;  5C8C A;  4CE8 A;  2OQ7 A;  2FDH A;  2C6S A;  3WZ1 A;  3GYD A;  1J3Q A;  2R6Q A;  5DPN A;  1UMZ A;  2YG0 A;  1IQD C;  2WWS A;  3MGU A;  2ETE A;  2PXJ A;  3USU B;  2WNU C;  4JHT A;  4M0N A;  4CCD A;  1PGS A;  2HEV F;  4PIX A;  3VHN A;  2A73 B;  2OUH A;  3B5L B;  3VZN A;  5FLI A;  2FDI A;  4BIO A;  3PUS A;  2Z42 A;  2XJR A;  3AYE A;  3NO8 A;  2GAL A;  1D4M 3;  2JEC A;  2XVK A;  5LAT A;  3KV4 A;  2VZU A;  2XOM A;  2VH9 A;  5JI9 A;  1AJO A;  4UF0 B;  1ULG A;  3JQW A;  2XDV A;  1JYC A;  5GAL A;  4ATF A;  5CG8 A;  1LU1 A;  4YG6 A;  2VMI A;  2XJT A;  1OMI A;  4IEW A;  4Y5Z 0;  4BCU A;  3BOD A;  4CDW B;  1OH3 A;  2E51 A;  1LRH A;  1XB9 A;  1O4T A;  4UBG A;  4XCA A;  4AR2 A;  4ASK A;  3MID A;  3L2H A;  3DYP A;  5L9B A;  3H7J A;  1IG0 A;  2VG9 A;  4M3C F;  1H2L A;  5C7G A;  2WO1 A;  1VBC 1;  3GBF A;  1L7R A;  3ETQ A;  3I59 B;  2C1F A;  2PLV 3;  4LKF A;  5IT6 A;  3VBO B;  1K5M A;  1NCR A;  2B4K A;  3HQU A;  1S0G A;  3ZKU A;  2ILM A;  1G9A A;  1VJ2 A;  4PDW A;  2WC2 A;  5DXD A;  2W1U A;  4YVS A;  3B94 A;  1E5R A;  3AYC A;  1W9S A;  2F6B A;  4CDX B;  3K4Z A;  2Q1Z B;  4BJ0 A;  1LHW A;  4N8M A;  1EUU A;  2TNF A;  4JKK A;  3L2Y A;  4DO0 A;  2G1M A;  3TBD A;  2XBO 2;  1RHI 3;  2A7A A;  5FWJ A;  5GZG A;  2B8M A;  2Y8K A;  5JOZ A;  2XUM A;  2J42 A;  3BAL A;  1UWW A;  1QWR A;  1TNF A;  4H7L A;  1BKZ A;  2E7Q A;  3KCC A;  2XJS A;  4Q0Q A;  3VBH B;  5L19 A;  4QDQ A;  1PNG A;  1G9F A;  3AMM A;  4QQP A;  3H7Y A;  4XUO A;  1N3P A;  5FFO C;  5F7U A;  4ES9 A;  2BW8 A;  5DAB A;  4NVP A;  4JTO A;  4NAM A;  4LO4 B;  1GP5 A;  1Q8S A;  3NJY A;  4B4R A;  4RL7 A;  4B4P A;  3N3H A;  1JUH A;  1POV 1;  3CU7 A;  3A0N A;  4JGY C;  4L8Q A;  4QQH A;  5JZG C;  3RZM A;  5IVF A;  2NM1 A;  4WVV A;  4XJA A;  4E4S A;  2JIC A;  2AYH A;  1FNZ A;  5FZL A;  2PEL A;  1EAH 2;  5JLV A;  1QOS A;  2VY0 A;  5CB7 A;  1AR9 1;  2Y60 A;  3N36 A;  3NRU A;  1HXS 2;  4QPI B;  3RJR A;  2JDP A;  2E26 A;  2W08 A;  3BN6 A;  1GOF A;  2VCC A;  1LOG A;  2W2I A;  3TOJ A;  3W5M A;  5J98 B;  1ULC A;  1AL2 1;  1JN2 P;  4K40 A;  5JVV A;  1SEF A;  3I3Q A;  4IW3 A;  1C1F A;  1SBE A;  2CL2 A;  2MNG A;  3BVC A;  2HWB 3;  1RUG 3;  1F15 A;  1N1S A;  2OII A;  1PO2 1;  3ZN4 A;  4DNY A;  1WLC A;  2DUO A;  2VO5 A;  4QX0 A;  4GH4 A;  5DDJ 1;  2P5B A;  4Y22 B;  5SV5 A;  3T08 A;  1MEC 2;  4Q4Y 2;  1DU3 D;  4E2G A;  1EV1 2;  2JDZ A;  4KGG A;  4LJH A;  4HAN A;  5KWR A;  1CAV A;  3BIW E;  1U5X A;  3AXE A;  2VZ3 A;  1RUI 2;  4Y20 B;  5FP7 A;  2GNT A;  1AL2 3;  2A6Z A;  3FHI B;  4HKO A;  1O4Y A;  3PVB B;  3QH7 A;  4D7S A;  1SLL A;  1OLQ A;  2ZX1 A;  3R4D B;  1A8D A;  4PBP A;  4I09 A;  4CEW A;  4UOJ A;  1S55 A;  1WLD A;  2GH2 A;  4YWA A;  5GLZ A;  4N53 C;  4F8A A;  5FZ3 A;  5C3Q A;  2C24 A;  2GAU A;  2ZGM A;  4B4Q A;  4Y1U A;  1QJY 1;  1QNY A;  1ZA4 A;  3NV1 A;  5K7P A;  1BEV 1;  1UX6 A;  1YC6 1;  1FV2 A;  2DCJ A;  4J6G A;  4RA0 A;  3H0O A;  1JUI A;  2D6N A;  1TME 2;  1VPH A;  5A3T A;  5KHJ A;  4XDP A;  1XE0 A;  3RSJ A;  4MHR A;  5BXX A;  1LU2 A;  4AEK A;  1AR6 2;  1UZY A;  3EB7 A;  3LFM A;  1V6K A;  1PIV 1;  3LSD A;  3POY A;  4WBB A;  4ARY A;  4MYE A;  5CAD A;  3VHR A;  1MS0 A;  5AVA A;  2WZR 3;  4NRQ A;  2ET1 A;  3PJQ A;  1JZ7 A;  5ACA 3;  4FAG A;  1X36 A;  4YW6 A;  2Y6J A;  4JAA A;  4EWA A;  5CBL A;  4CCC A;  1KXG A;  5B4X A;  3ROU A;  4UFJ A;  2ADE A;  2D3R A;  4BA6 A;  4YRD A;  4L0P A;  1UU6 A;  1B09 A;  3AJZ A;  3SNM A;  5E88 A;  1OQE A;  1DZQ A;  3ALQ A;  3JBG 3;  2RS5 3;  2BU9 A;  3D8C A;  3R4U A;  1JZ8 A;  3V0B B;  4PI0 A;  3OGS A;  2RR1 3;  2YPD A;  3VL8 A;  4YG0 A;  2HYX A;  4K8F A;  1WCD J;  4QDS A;  3AP6 A;  3MIE A;  1AR7 3;  1RUH 3;  2UWB A;  2UY8 A;  2ZHK A;  3BGA A;  4E4H A;  2DVG A;  3N9M A;  2Q1F A;  3H1M A;  4PIZ A;  1KDM A;  1VBA 2;  2IXC A;  3BTZ A;  1W0O A;  4LUL A;  5FY5 A;  1UPS A;  1QJX 1;  3BU7 A;  4HSJ A;  1XNK A;  4RS5 A;  5FY0 A;  5HI0 A;  1R08 1;  4LBQ B;  5A6Y A;  5C3R A;  4FPK A;  1N1T A;  1W8T A;  1RED A;  1XE7 A;  3LPF A;  1Z7S 1;  3EJK A;  5J48 A;  2JEM A;  5JMO A;  4AI0 A;  5C3O A;  2ZJC A;  1JZ3 A;  1JYX A;  1E57 A;  4HBN A;  2VTF A;  1UY4 A;  4P9J A;  3AKQ A;  2A1X A;  2AGS A;  1QJF A;  1C3H A;  1GQH A;  4ARX A;  3P3N A;  1R09 2;  1H2M A;  5DUX A;  1CAU B;  2BV4 A;  4XFF A;  1FOD 1;  1W9F A;  4WM7 A;  3VDD A;  2J1U A;  3CJX A;  2W52 A;  3DKQ A;  4CDU B;  2WT1 A;  4C90 A;  3R4S A;  3JB4 C;  3IMN A;  2H6B A;  2WNE A;  5A7P A;  1QJU 2;  4BXF A;  1IKQ A;  2RS3 1;  4IE7 A;  3T30 A;  3NNM A;  3D82 A;  3GGL A;  1ASJ 1;  2CTV A;  2ZX2 A;  1DZT A;  2QBX A;  3I2H A;  5I8Y A;  2BGC A;  2WS9 1;  3EXU A;  3R05 A;  3T09 A;  3AVS A;  3BI3 A;  1DDL A;  5C3S A;  2HWF 3;  1AZD A;  5BNN B;  3WXP A;  1WCS A;  2PN5 A;  3CJI A;  4XFI A;  3ZSJ A;  1R64 A;  1FOD 3;  4YGB A;  1XC6 A;  3MYX A;  3QCW A;  4W50 A;  2ARB A;  1EPW A;  3IDE A;  4PIY A;  5JSR A;  1DYO A;  2RMU 2;  3WG2 A;  4DXS A;  4AQ2 A;  2PHT A;  3HQX A;  4AQ6 A;  3ORJ A;  3FJS A;  1UX7 A;  4CDW C;  1GOG A;  1OF4 A;  3ABZ A;  1O59 A;  3NW4 A;  4J25 A;  3LOI A;  4KBZ A;  3T2Q A;  4XAA A;  3K3N A;  1PX4 A;  3POE A;  5IVJ A;  2R30 A;  5EHD A;  5JWP A;  1LAJ A;  3MUZ 1;  2BWA A;  3VBO C;  5IAV A;  3IBM A;  3Q8F A;  3VBS B;  5HCF A;  2MEV 1;  4XAC A;  2MPF A;  3D5O A;  3URF A;  3SIS A;  3I49 A;  4CDX C;  4BPZ A;  4FPJ A;  1QXJ A;  3M70 A;  5FRA A;  1DG6 A;  4P5Y A;  3FN9 A;  1W6Q B;  4M4P A;  3N9L A;  5FOB B;  4DZG A;  4MET A;  4K1Z A;  2RE9 A;  3M2M A;  3OOX A;  3I97 A;  1YLL A;  2W46 A;  2CAU A;  2HWD 3;  1E5I A;  3VBH C;  2A6W A;  3ZDS A;  4AVV A;  1HRV 2;  1ZRI A;  2EVX A;  2FQP A;  3KGL A;  3OTF A;  4OUE A;  4QPW A;  5LY1 A;  1GZW A;  4BK4 A;  1D2Q A;  5FXZ A;  1UOB A;  2XML A;  2VJX A;  2ZGN A;  3GBG A;  1J3P A;  3NJZ A;  2WAB A;  1MS9 A;  3POG A;  4GB3 3;  4FOW A;  2HYK A;  2PYT A;  3RDI A;  2GC0 A;  4CA9 A;  4LUM A;  3EMR A;  1QJE A;  1CN1 A;  1NYW A;  1WZX A;  3F2Z A;  1AXZ A;  4QGN A;  4XF1 A;  4H55 A;  1DGL A;  3W58 A;  5KBF A;  2JDN A;  4FI9 A;  2VNG A;  5EXO A;  4GAZ A;  3CF6 E;  4W65 A;  1UW8 A;  4R52 A;  4S2G A;  4QHZ A;  4F3J A;  5L9V A;  4BQ4 A;  4QPI C;  3I2G A;  3UYJ A;  2YHJ A;  5IYY A;  2DVD A;  4D7T A;  3AXD A;  3ME2 A;  3OUI A;  2ORX A;  1ALY A;  5HCB A;  5F2S A;  3I3D A;  3JU9 A;  3KS7 A;  5E8A A;  2W39 A;  5JXJ A;  1LHO A;  1OUR A;  3DYO A;  4AFB A;  1S0D A;  1W8F A;  1AL0 G;  5D8A A;  3AYD A;  3HN3 A;  5EIY B;  1AX0 A;  4BYY A;  3HBZ A;  1JOD A;  2V5Y A;  2Q8C A;  2ZHL A;  1VBE 3;  1D2S A;  4I02 A;  4N43 A;  4MGZ E;  4BQW A;  4CU7 A;  1LEC A;  5FY8 A;  4E9K A;  1HKD A;  2BDR A;  1OOP A;  5AC9 3;  3ACL A;  4ZZ8 A;  2QQO A;  3WEZ A;  5LA0 A;  1WCU A;  1S0I A;  2BZD A;  3N9O A;  1OA2 A;  1ZZB A;  2VUL A;  4A3Z A;  2YU2 A;  4YNI A;  4QX7 A;  4Y5T A;  1HB4 A;  5C33 A;  5JMC A;  1LB2 A;  1VBB 2;  3NNL A;  3WDX A;  1UXZ A;  3IDC B;  4LO6 B;  4QHB A;  2ZBJ A;  4Z1V A;  5FYZ A;  1GR3 A;  2Y64 A;  2J1E A;  4K6B A;  4TLG A;  1ZX5 A;  2E6V A;  2VOX A;  3NAP B;  2ARE A;  4IE5 A;  3GZT B;  1C5I A;  2R07 2;  3AZY A;  4IEU A;  4S2H A;  5K8S A;  4TSV A;  5DUV A;  2VOV A;  4WM8 B;  3UV9 A;  3S30 A;  4RYD A;  2ORZ A;  3LFI A;  3GZE A;  3P5B A;  1ENQ A;  4HPK B;  5FO9 B;  5C5U A;  4Q1R A;  4UFI A;  4EZ4 A;  1NAE A;  1W8H A;  2IFW A;  1HDK A;  4K9S A;  5F5I A;  5I0U A;  5IW0 A;  3O1U A;  1YIP A;  4M00 A;  4QM9 A;  5A3N A;  1FAY A;  4LTA A;  4A7K A;  2WAA A;  3OPT A;  1RMU 1;  2AUY A;  1BBT 2;  3ZXK A;  2ATF A;  3BU0 A;  1WLW A;  1G9D A;  5FY4 A;  3KF5 A;  4PQ9 A;  1QXR A;  3ZDV A;  1TMF 1;  3M3O A;  4QQ2 A;  5I8S A;  4A6S A;  3LF7 A;  1WCQ A;  1GBG A;  5L36 A;  3DEM A;  3RG0 A;  3DXT A;  4XEZ A;  4XFG A;  4DS0 A;  3WF0 A;  1U12 A;  4IV3 B;  1QGL A;  4NIG A;  3AC0 A;  1DQ2 A;  3O1T A;  3GBW A;  3W20 A;  1H8V A;  4F83 A;  2JEN A;  1FMD 1;  1FPN 3;  1ZBE 3;  1ULO A;  2VXJ A;  4CXW A;  5C9A A;  4PHZ A;  1V6J A;  4KU7 A;  4KWJ A;  2WSV A;  2YBK A;  1DQ0 A;  3ZR6 A;  1PVC 3;  1W8N A;  1NZC A;  1O3T A;  3NWK A;  1UZ0 A;  4JQT A;  2VNV A;  2VGD A;  3GJA A;  1AF9 A;  3POB A;  5FJK A;  1R1A 1;  5JSO A;  3D0S A;  3SCF A;  4DEV A;  3LCP A;  2HWC 1;  2A5Z A;  1QKQ A;  1HB1 A;  1ZBA 1;  2WFF 3;  2GND A;  1F31 A;  5KHK A;  1AYN 2;  4AEJ A;  1AHS A;  4BQ2 A;  3INA A;  1H4G A;  3NV2 A;  4GKY A;  2QZ3 A;  1S0E A;  2WR9 A;  5E16 A;  3RMX A;  1U0A A;  3FLR A;  1S0C A;  2YMZ A;  4Y1V A;  1FMD 3;  1CAX B;  5CFD A;  5A3P A;  4CDU C;  1ZRC A;  4URA A;  2WRA A;  1SFY A;  1VBD 2;  1WW4 A;  2HWE 1;  2OS2 A;  2UY9 A;  3KZ4 C;  5JCT A;  1W2O A;  3SKV A;  3HT2 A;  1D7P M;  4PLO A;  4DUW A;  1SQ4 A;  4RR3 A;  4GJY A;  1IS3 A;  2WIN B;  2QQL A;  2RVA A;  3MLL A;  2FZ2 A;  1Y4W A;  2LRO A;  2DFB A;  4YW4 A;  4IV1 A;  3ZFF A;  1LGN A;  3E6B A;  4UWD A;  1JBC A;  3T0D A;  2FCV A;  4JGZ A;  5BNN C;  4P9Y A;  1OFN A;  3LDB A;  4I0W B;  1CZV A;  2GNM A;  5DAP A;  2PHU A;  3V0A B;  2RM2 3;  1GQG A;  2YDE A;  5I8T A;  4HK9 A;  2R06 1;  1REE A;  2ES3 A;  5B4N A;  4XET A;  1W9Y A;  4Q0P A;  5GLT A;  1US2 A;  5T54 A;  5LCW L;  5FKB A;  1O6U A;  4D7Y A;  4Q4W 3;  1NUK A;  2DCY A;  1CAW A;  3HOB A;  5IVC A;  5FPX A;  1X9P A;  4NR1 A;  5FPV A;  1OPM A;  1IKP A;  1MS4 A;  3ZXE A;  3IM0 A;  2EIE A;  3WHU A;  3WR0 A;  2ZGL A;  5FZ1 A;  1F9K A;  2ARA A;  3B93 A;  4OHW A;  3SC7 X;  4AFM A;  3FHQ A;  1AJK A;  2BRT A;  3BB6 A;  3C7F A;  1MS8 A;  3IN9 A;  1SLA A;  1X50 A;  1MVE A;  4Q4V 1;  3CIH A;  5ANQ A;  4BZ4 A;  1WMD A;  3OEB A;  4XIL A;  2R06 3;  4CUB A;  1W3X A;  3ZFE B;  2AZ5 A;  3B7M A;  3IT8 A;  1WBF A;  3FE5 A;  1AYM 2;  3MW2 A;  3VBS C;  5A80 A;  4LNV A;  2D6L X;  1NG0 A;  2GN7 A;  5FPB A;  1OLR A;  3U1X A;  1WA4 A;  3E1F 1;  1GZT A;  5FZC A;  5M0T A;  1XNB A;  1OVS A;  3APB A;  3V0B A;  2C9K A;  4EQV A;  4M01 A;  5A1A A;  3C7G A;  1ND2 B;  3WF1 A;  1JZ2 A;  1GWL A;  1PO1 1;  4CCN A;  1HLC A;  3NKG A;  1XYP A;  4MGS A;  3VKO A;  1M4W A;  4XAE A;  3OYW B;  4CCL A;  1VRH 3;  4LBO A;  4AK3 A;  1UF2 C;  3S0M A;  4Y1Y A;  3FL7 A;  5T5L A;  2FDF A;  2A3W A;  2YXS A;  4MLO A;  1DFQ A;  2VBD A;  4GUL A;  3EYP A;  4FOY A;  2VVD A;  2A6X A;  4H2A A;  4J1W A;  4UW3 A;  2BNN A;  2BVB A;  1S0F A;  4KWL A;  3OJB A;  3OGG A;  5FZA A;  1FI2 A;  4I30 A;  3OBT A;  1B35 B;  5BNO B;  4XDO A;  1W9W A;  3QH6 A;  4NWV A;  4XUP A;  4G3Y C;  2P1B A;  2QTW B;  2RDR A;  2EXK A;  2W68 A;  3VBF A;  3WP4 A;  3ZN6 A;  5LK5 A;  2R04 3;  2XH6 A;  2DVB A;  2B9U A;  3CDZ B;  3DCQ A;  1JYV A;  3CMG A;  5A7W B;  5FP8 A;  1QEX A;  2XKO A;  3VBR B;  3MDP A;  5GKA C;  3MFC A;  3K51 A;  2VW1 A;  3CNA A;  1C28 A;  4MSV A;  5KC6 A;  2R0F A;  4YW1 A;  3MIF A;  1GAN A;  2YYO A;  5E6H A;  1G6N A;  2WWJ A;  1X8M A;  2WNV B;  4IE6 A;  1XND A;  2VUC A;  3P6B A;  4Q4V 2;  4WVW A;  4CCK A;  2PHW A;  5LBE A;  1RUD 1;  2HBT A;  1OLM A;  4KNC A;  1LOE A;  1W6O B;  2YGL A;  3GNE A;  4NJ4 A;  5FYC A;  5FP4 A;  2VM9 A;  3KV5 A;  2X5I A;  1NY7 1;  1DLL A;  4CEY B;  2AR6 A;  1PO1 2;  2ZZQ A;  1PM7 A;  2Q5T A;  3D3A A;  4KWK A;  5FZM A;  2WO3 A;  4HLT A;  2VL4 A;  2RS1 1;  3B9I A;  2VBB A;  3QD6 A;  4HXC A;  2ENR A;  3RYP A;  4EN0 A;  1SLI A;  2ZAH A;  2JE9 A;  4Q4X 2;  5FZ6 A;  5DAQ A;  4MUV A;  1DZR A;  2XLG A;  4QX1 A;  2LM3 A;  1V9U 3;  4IL7 A;  1VB2 A;  1DGR N;  2ZX0 A;  4IQP A;  3VKN A;  5I0S A;  2NZ9 A;  3H3L A;  3HNY M;  4DRV A;  1RUF 2;  5T52 A;  4JV4 A;  4FTE A;  5FJH A;  1NCQ A;  2ZGT A;  2VOT A;  4AVC A;  3NAP C;  3J8F 1;  2OVU A;  4KQ7 A;  4YYO A;  1SLT A;  5HXM A;  2E31 A;  4NHK A;  3U75 A;  2B45 X;  4XFH A;  4C0H A;  1QQP 1;  1YQ2 A;  1F5F A;  4WM8 C;  3H8U A;  3WNK A;  3C7O A;  1QH6 A;  2JG9 A;  2ZGR A;  3OD4 A;  1ZRE A;  3BOP A;  3VZO A;  1W8Z A;  1H8T B;  2VVE A;  4QPG B;  2ZPX A;  3UL2 A;  4FFH A;  1QDO A;  4SBV A;  1JYI A;  2AC1 A;  2NQY A;  1G7Y A;  3RI8 A;  1OPO A;  1RB8 G;  3OPW A;  2A3Y A;  4IEQ A;  4MGT A;  3J8F 3;  1W2N A;  3WNM A;  1UQX A;  3U4X A;  4HON A;  4V2V A;  1BVP 1;  1QQP 3;  2D98 A;  4FPH A;  5LRR A;  1MQT A;  2VZV A;  1J1T A;  3N7J A;  5L7O B;  2BVV A;  1W6M A;  2I2S A;  2WBK A;  1WMX A;  5FO7 B;  4QXK A;  4RHV 3;  5I0D A;  3KQR A;  4AAP A;  3JD7 3;  1QH7 A;  3HNB M;  1C8M 3;  1NY7 2;  3G6J B;  1UMI A;  3POI A;  3IKW A;  3GHM A;  1Y9G A;  2FMY A;  5ABJ A;  1HJG A;  4IV3 C;  4QXC A;  1OKO A;  3V65 A;  3H8R A;  2RS1 2;  4AVA A;  2V73 A;  4XDQ A;  5T50 A;  5F9T A;  3NNF A;  4BQY A;  4XTM A;  1HRI 2;  4AG4 A;  1VE0 A;  4Z2A A;  5IAT A;  1J84 A;  4W4Z A;  1RVF 2;  3ZFG A;  5F3E A;  2SBA A;  1TEI A;  4YVW B;  4ZS2 A;  1W06 A;  2LS6 A;  4AED A;  3RI9 A;  1G9C A;  2VUD A;  4LA2 A;  4C91 A;  1A3K A;  1LUL A;  4MAD A;  4P9W A;  5HPO A;  1SPP B;  1HN0 A;  2HJI A;  1V6L A;  4IEY A;  3LDK A;  2GU9 A;  2PA7 A;  5CYY A;  1CES A;  1OD3 A;  3EO6 A;  1MS1 A;  4AHZ A;  4DRR A;  3P1I A;  3H3U A;  3ZO0 B;  4XC9 A;  3AMN A;  2TUN A;  4QT6 A;  3O7O A;  2J7M A;  3UGG A;  4F7Z A;  3N7L A;  4AI9 A;  3AFK A;  2XBO 1;  2D6O X;  3Q8B A;  2VUJ A;  4KL1 A;  2PHL A;  4MH0 E;  2JDA A;  5JUV A;  1ND3 B;  1COV 2;  1XSQ A;  2Z79 A;  5F32 A;  1LOA A;  1NA1 B;  4ZZ5 A;  5JOY A;  4XJZ A;  3ZYB A;  2WS9 3;  2IXJ A;  4JRL A;  2QQK A;  3PIJ A;  5BNP B;  2RDN A;  3N7M A;  4KG8 A;  1A8M A;  4FPC A;  4BQ1 A;  1Q8O A;  3ZLI A;  1OF3 A;  3RVH A;  4YZ5 A;  2WZ8 A;  3PME A;  5CKN A;  1N1V A;  2W9X A;  2BNO A;  3VKL A;  4LK6 A;  3UKT A;  2DBN A;  3T4V A;  2EA7 A;  4DUV A;  5JAX A;  5EZW A;  1RUJ 2;  4LBK A;  1EAH 1;  3D0J A;  5CFC A;  3PIG A;  1NKG A;  2VMD A;  3I2K A;  1HXS 1;  4YLZ A;  3WIN E;  5I91 A;  2EAA A;  4NPM A;  5IFP A;  4FAH A;  1S2B A;  2C4X A;  3QOP A;  4D6S A;  4LHS A;  1LHU A;  4M3C A;  1UL9 A;  5FZH A;  1Y43 B;  1UD1 A;  4Q26 A;  1UYX A;  5F2W A;  1H1A A;  3J7N A;  1YNA A;  3A23 A;  4P02 B;  3VKF C;  2CWM A;  1SAC A;  3N4M A;  1J83 A;  2CGN A;  2FD8 A;  1MEC 1;  2G9G A;  4Q4Y 1;  2VW0 A;  3C3V A;  1EV1 1;  3ZFE C;  2D5F A;  3MLJ A;  1AXK A;  2GDF A;  4UI9 L;  1RUN A;  5GZC A;  3VD4 A;  2ID4 A;  4AWD A;  2J1A A;  1GNY A;  1BLZ A;  2PHF A;  2DWR A;  3R0R A;  1PHM A;  1WMF A;  4FTS A;  3AJY A;  3SLI A;  1RUI 1;  2FZ1 A;  1OKQ A;  5J1X A;  1VBC 3;  5FY7 A;  1ND2 C;  1SCR A;  2G4I A;  1GNH A;  4AHX A;  2QFE A;  3K46 A;  1XRU A;  1C1L A;  5A32 A;  3TEY A;  2XG3 A;  4K3U A;  3S5A A;  2BNM A;  1EP0 A;  3WQB A;  3ZXG A;  5BYN A;  4UW6 A;  4KMQ A;  1PGW 2;  3PU8 A;  4FOV A;  2ZHN A;  4JX0 A;  1MAC A;  1EV1 3;  4UW4 A;  3VKM A;  1O3Q A;  1H1I A;  1PK6 C;  2VC9 A;  4HVO A;  3MF6 A;  4YM1 A;  2VXR A;  2JD4 A;  1QOO A;  2WSU A;  1MR5 A;  1TME 1;  1GUI A;  3J26 N;  2P2K A;  3LEI A;  4RFR B;  2IUW A;  4PI2 A;  4XOG A;  5FZO B;  2W87 A;  2WWU A;  4YGE A;  3RFR A;  1AR6 1;  1B35 C;  5BNO C;  2BPA 2;  2ZGQ A;  1MZE A;  4E4Z A;  1YJK A;  4RGG A;  4ZY9 A;  3V64 A;  1AUY A;  3BCW A;  3DV8 A;  2BOJ A;  4P5H A;  5GJ6 A;  5A3M A;  5CIR A;  1UPI A;  2X09 A;  2DV9 A;  1DQ4 A;  4XUR A;  3VBR C;  5FZK A;  3ZMO A;  2ZKL A;  4IET A;  4YFZ A;  3MZH A;  3Q9O A;  5LA2 A;  4Z07 A;  3A22 A;  2PLV 2;  3OBZ A;  1POV 3;  2V72 A;  4X8N A;  1H9W A;  1BQP A;  2WNV C;  5APA A;  2CHH A;  5IHR A;  4WVM A;  2W0X A;  1OVP A;  2WNU A;  4R8H A;  4D8M A;  1N3O A;  3PLQ A;  1W6P B;  1LEN A;  1JW6 A;  1AR9 3;  4XHX A;  3W59 A;  3FBM A;  4MVT A;  1UIJ A;  3RNS A;  2VPV A;  3ZKY A;  3AKR A;  1RUC 2;  3HIF A;  1RHI 2;  3OGV A;  4I0A A;  4LHK A;  4ZU5 A;  4BH9 A;  1K42 A;  4CEY C;  5CG9 A;  2QQU A;  2PQQ A;  4MXW B;  1UY2 A;  3ZYJ B;  4HL0 A;  1F8V A;  2VQT A;  1GZC A;  2QQJ A;  3KT4 A;  3GHN A;  3A7Q A;  1J59 A;  1PO2 3;  1VBA 1;  4HVR A;  4NUB A;  3WW4 A;  2D93 A;  2DYC A;  1OUX A;  2V5D A;  5DDJ 3;  2BYV E;  3WF4 A;  1TNR A;  4AVT A;  2NLR A;  3RWK X;  1GIC A;  2EAK A;  4XJ8 A;  1GWK A;  3TN9 1;  2P17 A;  4RQP B;  1NXM A;  5FZ9 A;  2VQA A;  3OBR A;  1S2K A;  5F37 A;  2IXH A;  2P4E A;  2ARC A;  2YV8 A;  1ZVF A;  2EXI A;  4AW7 A;  3MEP A;  2Q0A A;  1NLQ A;  1R09 1;  4HOO A;  4LLF A;  4EV0 A;  2VZR A;  4CP9 B;  3IIA A;  5JIU A;  1QXP A;  4R4X A;  3I2D A;  5F1R A;  2VOK A;  4LHL A;  1GQP A;  1VIW B;  4UFH A;  1OQ1 A;  3WCS A;  2ADD A;  5GLV A;  1QJU 1;  5C3P A;  4S2F A;  1H8T C;  1QJY 3;  5JXH A;  3QLQ A;  1BEV 3;  4MGY E;  5A3O A;  1UOG A;  3PVN A;  2HWB 2;  1RUG 2;  4YAR A;  3DGT A;  4QAW A;  1OUS A;  1AR8 1;  4KGQ A;  1ENX A;  2XON A;  4YFW A;  3S6P A;  1AX1 A;  2W95 A;  1PIV 3;  2Y0O A;  5L7O C;  3KCY A;  4N9I A;  3NMB A;  2WT0 A;  5F6K A;  2RMU 1;  3MHZ A;  2XLA A;  1V70 A;  1PK6 A;  3K77 A;  4LBQ D;  1KS5 A;  1JYT A;  4NPR A;  1O5U A;  2XUE A;  1PVX A;  4IER A;  4JGY A;  3O12 A;  5JZG A;  2BFU L;  2VZP A;  1H6Y A;  1OI6 A;  1OHF A;  4FFI A;  2YC4 A;  3DL3 A;  5ERL A;  1VP6 A;  1S0J A;  3O1O A;  3RZK A;  3KD4 A;  3TN9 2;  4YVW C;  2I07 B;  1W6N B;  3ILR A;  1HQN A;  2Z5W A;  1Q8Q A;  3ZYF A;  5FPL A;  2JG8 B;  3M3E A;  3ILN A;  3VBU B;  4L11 A;  4IEX A;  3I2O A;  1CJP A;  4GWJ A;  5JOW A;  1I5Z A;  2B7Y A;  4NN0 A;  1O7F A;  4DFS A;  5C70 A;  3U11 A;  3SH3 A;  3AZX A;  4RGA A;  1YYN A;  4IEV A;  4CCM A;  2WZR 2;  2K46 A;  2RV9 A;  3ZX7 A;  1I1E A;  2JB4 A;  1ACC A;  4R4Z A;  4CDQ B;  1QJX 3;  4DMI A;  5FY1 A;  5ACA 2;  4Q1P A;  4TLF A;  3E97 A;  4XW3 A;  1R08 3;  3AP7 A;  3MFA A;  4GJZ A;  1ND3 C;  3I3B A;  3KM5 A;  3O0W A;  1Z7S 3;  3PDQ A;  4COV A;  4NII A;  1BZW A;  3PUI A;  1NA1 C;  3OGJ A;  5H9R A;  4AZZ A;  2QQN A;  4QM8 A;  1HRV 1;  3JBG 2;  3WDY A;  2RS5 2;  2ZXQ A;  1AR8 2;  2Y33 A;  4NWW A;  2KM2 A;  2JDU A;  1W28 A;  2RR1 2;  5BNP C;  2QCS B;  2IVI B;  2Y34 A;  1W8O A;  5JOX A;  3A4U A;  2GZW A;  4Q0U A;  3SCH A;  1C4R A;  1MS3 A;  4N53 A;  1JOB A;  1AR7 2;  1LHN A;  1RUH 2;  2ZEX A;  2LTN A;  3B69 A;  3OY8 B;  4PLM A;  5F3I A;  3RWN A;  1GMM A;  4C1X A;  4ZU7 A;  1UYY A;  4NIH A;  4E4D X;  3M3Q A;  1CX1 A;  5I93 A;  2RS3 3;  4XBN A;  1OBN A;  2CV6 A;  1ASJ 3;  1O8P A;  4OHY A;  5K0U B;  5LK7 B;  1QOT A;  5LA9 A;  2HLE A;  1DQ6 A;  4IEZ A;  3KT7 A;  1YRZ A;  4MX3 A;  3ON7 A;  1UXX X;  5JPM B;  4LQR A;  2AEY A;  1BXH A;  1CJD A;  5JIA A;  1JU4 A;  1MVQ A;  4QQL A;  1GFF 2;  1W0P A;  2A71 A;  3POS A;  5FZD A;  3M7A A;  3IPV A;  3RMY A;  2W47 A;  3WOG A;  2X05 A;  3WD5 A;  4UXA A;  3MPB A;  1WCK A;  1Q43 A;  4YZ3 A;  3S57 A;  1O91 A;  1CON A;  1UN1 A;  1IPK A;  3U07 A;  2R49 A;  2ZCW A;  5DMY A;  3MLK A;  5FUN A;  1W99 A;  4LOR A;  3HWJ A;  5FTT C;  1SBD A;  3RYR A;  3ZSK A;  1XBF A;  4HET A;  5FYH A;  2ZX3 A;  5FQ0 A;  5FYI A;  5GLW A;  4JKL A;  4HG6 B;  4HSL A;  2D97 A;  1VAK A;  4LLO A;  1VBB 1;  2O0O A;  4QDR A;  2MEV 3;  2H0B A;  1J58 A;  2HWF 2;  2JDY A;  4NHM A;  3U10 A;  4AYU A;  5FZ0 A;  5A33 A;  1Y3T A;  2JWP A;  1H1M A;  3KVB A;  4AFC A;  3FFQ A;  2R07 1;  2EID A;  1YJL A;  5G04 L;  4CUC A;  2SLI A;  4GD4 A;  3AKT A;  1SG3 A;  3ACG A;  3WQ0 A;  3E6C C;  2QDN A;  1EYB A;  1D0G A;  4AQT A;  1I6X A;  2ZOE B;  5T5P A;  5H9P A;  2O14 A;  4BLJ A;  4N7U A;  4Q8L A;  3E6D A;  4WVZ A;  1UNB A;  4P00 B;  1I9R A;  2DUQ A;  5KHH A;  4CP0 A;  1WD3 A;  2C9A A;  2ZKN A;  3MW3 A;  5C4W B;  4XXA A;  3FWE A;  4BOW A;  4URT A;  2D7F A;  1ENR A;  5F3G A;  1BBT 1;  3LAG A;  3EQE A;  4L92 A;  5EWS A;  4BWO A;  4A3X A;  4JDM A;  5LZ6 A;  3USU A;  1UCX A;  3TEZ A;  2B5H A;  2CU5 A;  4NE9 A;  1WME A;  4YM3 A;  1FYU A;  3NNG A;  4BDV B;  2VBP A;  4FXK B;  2OQ6 A;  5FMO L;  4COZ A;  5D1I A;  3AK0 A;  4FPG A;  2HWD 2;  2NP0 A;  5C8C B;  2G9Z A;  4UF0 A;  4YG3 A;  1BBT 3;  4YW7 A;  3ZXF A;  1X82 A;  2HKX A;  4ASM B;  2RJL A;  2CY6 A;  1RUE 1;  4CDW A;  2OX0 A;  4LE4 A;  4BE3 A;  2JIJ A;  4GB3 2;  5FK7 A;  5FXW A;  4LA3 A;  4LPL A;  4RQP C;  4CSW A;  2WQ4 A;  4COW A;  2WN2 A;  3DN7 A;  3AX4 A;  1PM4 A;  5D21 A;  5A3U A;  5HCA A;  2UYB A;  1AYN 1;  4ISQ A;  2BFU S;  2QQW A;  1U5I A;  3I59 A;  4GKX A;  3RQ0 A;  4K1Y A;  1CR7 A;  4HFS A;  5FMD A;  3VBO A;  1BVV A;  3OGR A;  5JSP A;  4D6R A;  5JR7 B;  4IEO A;  1YIF A;  1ZRR A;  3GZA A;  5CKM A;  1W0N A;  1GNZ A;  4RN5 A;  1VBD 1;  2XVG A;  4ZU4 A;  4CDX A;  4Q27 A;  3CZU A;  3LGR A;  2CYF A;  4B29 A;  4CCO A;  1G86 A;  3BOW A;  2QQV A;  2CDP A;  2HEW F;  3O1R A;  1OA4 A;  1WUV A;  2R7E B;  3MIG A;  2DU1 A;  4OHX A;  2CNA A;  1KJR A;  5FUI A;  4JTN A;  1JI6 A;  4HVQ A;  3HD8 B;  3ZYG A;  4LBM A;  4D69 A;  2ZEY A;  3T1M A;  5J7M A;  1UZW A;  3M1H A;  3DF0 A;  3K4A A;  4ISR A;  1VBE 2;  4Y33 A;  3VBH A;  5BUV A;  1GV9 A;  2NPI A;  3TB0 A;  1K5M B;  1DP0 A;  1NCR B;  3WDV A;  1F2N A;  2XWJ B;  3J7H A;  3C7H A;  4B7E A;  1LKN A;  4PDW B;  2DVF A;  1T6B X;  5HXV A;  2OUJ A;  1RIT A;  4YVS B;  4CPB D;  5AC9 2;  4MXV A;  4QQO A;  4ERO A;  3VL9 A;  2JIG A;  1LOF C;  1LOC A;  1O8S A;  4LT5 A;  1RMU 3;  5A7S A;  4BQX A;  1JXN A;  1Y7B A;  5C8W A;  1AXY A;  4AXO A;  4EE2 A;  4OLL A;  5EPA A;  1A78 A;  2K9Z A;  4LKS A;  5BNQ A;  3PTR B;  1RUE 2;  2BQP A;  3IDB B;  4B8E A;  4XJW A;  1DHK B;  1TMF 3;  3VN4 A;  2XR4 A;  4QPI A;  2Z2S B;  4FVV A;  5JXI A;  1CZT A;  5LEK A;  2VE1 A;  4AI8 A;  5FPZ A;  2WQZ C;  5FZ4 A;  1AYM 1;  2JG8 C;  2YFU A;  4FTB A;  4BHP A;  2CDO A;  3UET A;  3VBU C;  4FQ4 A;  1UO9 A;  1NX9 A;  3AMH A;  5CKQ A;  1IS5 A;  2XXZ A;  4XQD A;  3MV1 1;  4Y22 A;  3ZN5 A;  2ET7 A;  2ZAA A;  4CDQ C;  2FHR A;  2XJQ A;  4O61 A;  1DBN A;  4ZXK A;  3O1S A;  2B9V A;  2YBS A;  4I3P A;  4RGK A;  1QMJ A;  1BMV 2;  3KMH A;  4QWN A;  3AP9 A;  1HQW A;  1R1A 3;  4NOT A;  3KLS A;  4CUG A;  5I0R A;  5F5Q A;  1DGW X;  2HWC 3;  4Y20 A;  3EHK A;  1ZBA 3;  1WW7 A;  1W2U A;  1AVB A;  4CUA A;  3ZYP A;  1O3S A;  2XLF A;  4M0H A;  2P3I A;  1TE1 B;  2EIC A;  1W2A X;  2XHN A;  3MO4 A;  4LBJ A;  3QAC A;  1BJQ A;  3NL1 A;  4L97 A;  1T6G C;  3IAP A;  3WLU A;  1JOP A;  5H9S A;  4GH4 B;  3N7K A;  2HWE 3;  1TQ5 A;  3DXU A;  3KGZ A;  4Y4R A;  3ZVX A;  1IPJ A;  4EJR A;  3KHC A;  3III A;  3I7D A;  2XHK A;  1CAV B;  5K0U C;  3ZXJ A;  2VEC A;  3ES1 A;  1L3J A;  1FPN 2;  1ZBE 2;  3QBQ A;  5DAX A;  4B1M A;  1KFU L;  3AKS A;  4JCK A;  2EXJ A;  5FYM A;  4FPL A;  1PVC 2;  4A4A A;  5D2A A;  2PFW A;  2XQX A;  1BK1 A;  4JZR A;  1APN A;  5FK8 A;  4CEW B;  4OYU A;  2CSG A;  2WFF 2;  3ATG A;  3Q8A A;  3SCG A;  1S0B A;  4MHU A;  3H8X A;  3AM2 A;  3KCX A;  3GJB A;  5FXV A;  3GDB A;  3TNQ A;  2QVS B;  5LEJ A;  4O65 A;  1LGB A;  4LIV A;  1PZ7 A;  4DQA A;  3TEW A;  3VDB A;  5IFT A;  1E5H A;  1YWK A;  2VMF A;  4HZF A;  2O8O A;  4Q4V 3;  4Q4X 1;  3WNP A;  1OXC A;  2L9L A;  3LA7 A;  3LKJ A;  4C1W A;  1ZRD A;  1HW5 A;  1EY2 A;  5FXX A;  2V4V A;  3J8F 2;  1UMH A;  2EAL A;  4GWI A;  3RZJ A;  3O1V A;  3DUI A;  4OUL A;  4FP2 A;  3WNN A;  2J22 A;  1RUF 1;  2ZAB A;  3DPR B;  5FMO S;  1CZS A;  2AEZ A;  2VTX J;  2RM2 2;  2W3J A;  2ZAC A;  3HAG A;  5I0T A;  1UKR A;  5B2G B;  3LSE A;  4CU8 A;  1REF A;  2WII B;  4TTG A;  1PO1 3;  4LBQ A;  3M3I A;  1C8N A;  3OPZ A;  1FX5 A;  5T3N A;  4Q4W 2;  3ASI A;  1M06 G;  2QZ2 A;  2P6H A;  3KQ4 B;  2VZ1 A;  3GXU A;  2B46 X;  4BU2 A;  2A6V A;  3LE0 A;  4XUQ A;  3O1M A;  4LEJ A;  4CXX A;  4YZ4 A;  3FZ3 A;  1NQD A;  4N9H A;  1K3I A;  3N35 A;  1YQC A;  3TRS B;  5HV0 A;  1CAU A;  4HN0 A;  4NHY A;  5KXE A;  3B3Q E;  3WF3 A;  1PNF A;  5C4W C;  4CDU A;  5KR7 A;  5KHG A;  4GWM A;  4EN8 B;  1JOJ A;  1ZM1 A;  4AL9 A;  1FAT A;  3T1L A;  3O0V A;  2DFC A;  4XFC A;  3UKV A;  2W91 A;  4RS5 B;  3SKJ E;  1URX A;  4OQ8 A;  4I3G A;  4AE2 A;  3U78 A;  2X8K A;  3HQR A;  4V2W A;  3ZYH A;  2YUE A;  5F3C A;  4JVA A;  2OKX A;  3LWC A;  1T2X A;  5J3U A;  2MHF A;  5BNN A;  3MBW A;  4OI2 A;  4QB2 A;  2J1R A;  5BPX A;  2DF7 A;  1L7Q A;  1NT0 A;  2RDQ A;  3BTY A;  2VCB A;  2D6M A;  2Q8D A;  3VLB B;  5DUW A;  3WG1 A;  1VRH 2;  4WM7 B;  2OA2 A;  3VDD B;  1WA6 X;  5C8C C;  1ULP A;  4QD2 A;  1HRI 1;  4QKB A;  5J96 B;  1QU0 A;  1RVF 1;  3LEK A;  4E2Q A;  2GMP A;  4Y26 A;  1RUD 3;  2R1B A;  5CNA A;  3PUR A;  1FXZ A;  1HIX A;  1DYK A;  2F4P A;  3UJO A;  1DF0 A;  2ARX A;  5AFE A;  5C71 A;  3LEM A;  3SH5 A;  2XPJ A;  3AZW A;  5FRE A;  5FZF A;  3WW3 A;  4IGP A;  3ST7 A;  3PHM A;  3LEG A;  1KFX L;  3FMG A;  1JU3 A;  4WV8 A;  4QX2 A;  2WKK A;  3WDT A;  2RG4 A;  3CJI B;  2BGO A;  2RS1 3;  2E7T A;  1QIQ A;  2J1V A;  2KR2 A;  2R04 2;  1NZI A;  4Z82 A;  5DZE A;  5L73 A;  3TNP B;  1RVF 3;  3VBS A;  3O5S A;  1COV 1;  4P14 A;  1JTZ X;  3J7M A;  4IDZ A;  4P9I A;  2GN3 A;  1QY4 A;  1W6Q A;  4MV2 A;  3SEP A;  4CYD A;  1XU1 A;  1WWY A;  2ZX4 A;  5IK5 A;  4COU A;  3U0Z A;  4XTP A;  3K75 B;  1WD4 A;  3THP A;  2ZGS A;  3AL5 A;  2X29 A;  4Q2F A;  2BBA A;  1ULD A;  2ZZJ A;  4GIQ A;  1GZ9 A;  4DY5 A;  4QX3 A;  2KA3 A;  2W1S A;  1K5M C;  1NCR C;  2GC2 A;  4TXW A;  1FNY A;  4XVH A;  2VTX A;  1RUJ 1;  1KRI A;  3K2O A;  1BCX A;  3HVD A;  4PDW C;  3OUJ A;  3N9Q A;  4YVS C;  3WCR A;  1YFU A;  1VAV A;  2AAC A;  1HQL A;  1UOJ A;  1ODM A;  2KD7 A;  1Q5O A;  4OUM A;  3M4F A;  4CP2 A;  5EFU A;  1ZZC A;  2IC1 A;  1UKG A;  3THT A;  3W9A A;  4R9C A;  1YO8 A;  1V9U 2;  1UZV A;  2XGX A;  2PAE A;  5H9Q A;  1RJ8 A;  1O4Z A;  1ZZ6 A;  1DLC A;  5EYY A;  1PMJ X;  5LAS A;  4PT6 A;  1SCS A;  4C8D A;  1YEW A;  3E5X A;  4IE0 A;  3O14 A;  4OI4 A;  1V6I A;  3TEX A;  4XJU A;  1JZ4 A;  3ZOI A;  1LOB A;  5FMB A;  3C7E A;  1GZW B;  3N9N A;  3UES A;  4FFG A;  4UAP A;  4UT5 A;  1G8W A;  3SEE A;  4A42 A;  1PZ9 A;  1VRB A;  2E7A A;  2WA4 A;  2WDB A;  1DIW A;  5IJR A;  1YI9 A;  3I8T A;  4Y4Y A;  2AEN A;  2CGO A;  5F39 A;  5CIS A;  5FBJ A;  3ZSE A;  1TVG A;  2EIB A;  3U14 A;  4MGI E;  1VB4 A;  3VHO A;  1PGW 1;  1IQA A;  1ODN A;  2NMO A;  1DGR A;  4QU1 A;  1QNW A;  5FOJ B;  1Q3E A;  4O7X A;  5FCC A;  2ZEZ A;  4NIA A;  4HK8 A;  4AI2 A;  2Y38 A;  3THC A;  2XBO 3;  4MZU A;  2YB7 A;  4O9E A;  4RHV 2;  1Z78 A;  4R9B A;  3JD7 2;  5DZG A;  5FIX A;  4PF5 A;  4EYU A;  3IMM A;  4XMI A;  1C8M 2;  2BP6 A;  5FAX A;  1H6X A;  5D8A B;  3WF2 A;  4AOC A;  3BIE A;  1V6N A;  1QDC A;  3OBA A;  4GH4 C;  3D4K A;  4RFT 0;  4XE9 A;  1XNT A;  4BME A;  3H50 A;  1Y9Q A;  4X6Q B;  1XXN A;  4N43 B;  5ISL A;  3NAP A;  2WZP P;  2JDM A;  4AF9 A;  1XQN A;  4D3W A;  1JZ6 A;  2G9F A;  3IZO A;  1OQD A;  3R6S A;  4JHZ A;  4P9G A;  3WX5 A;  2VQU A;  1OOP B;  3LDR A;  4WM8 A;  2WLP A;  3ILF A;  2BER A;  4WZF A;  1LCL A;  2PLV 1;  4ZS3 A;  4HPK A;  1CIW A;  4XFB A;  3HNM A;  2OZJ A;  3KB5 A;  3OD0 A;  3OB8 A;  1X9T A;  5AVP A;  4CEW C;  2UUR A;  5KHI A;  4OFG A;  1CGP A;  4IGO A;  2OZ6 A;  1EAH 3;  2ZA9 A;  4FFF A;  3PUH A;  5LBF A;  3B9C A;  3CQO A;  4IE4 A;  1MS5 A;  1HXS 3;  1GKB A;  3MV0 1;  1RUC 1;  3L9J T;  1RHI 1;  2I74 A;  3HJR A;  1STM A;  1PGL 2;  3NJX A;  4E2S A;  3SH4 A;  3KHB A;  2GP5 A;  1HV1 A;  1XNC A;  4QHO A;  1TG7 A;  5JR2 A;  4LBN A;  2YY1 A;  1YUD A;  1IHM A;  1SBF A;  2YU1 A;  1JMU B;  2PTM A;  2WS9 2;  3AVR A;  2A75 A;  1MEC 3;  4LO5 B;  4Q4Y 3;  4IV3 A;  4LBL A;  1OFS A;  3SHR A;  4DY3 A;  1D4M 2;  3BKZ A;  3HN1 A;  3LPG A;  4Y1X A;  3NST A;  4DUX A;  3ZIX A;  1J1L A;  1XOY A;  1YXW A;  3DPR C;  2VMC A;  1RUC 3;  3CBN A;  1RUI 3;  4UYB A;  3VUO A;  1ZYB A;  5E89 A;  2OT7 A;  3MIB A;  4CPB A;  2GP3 A;  2WN3 A;  1UU4 A;  1MZ5 A;  2LW8 A;  4P9X A;  1DYP A;  3NV4 A;  2ZMN A;  5C6C A;  5HV4 A;  2XB6 C;  1LEM A;  3GCX A;  3HBK A;  3KWV A;  5GM0 A;  3H1W A;  1SLB A;  1MZF A;  2PAK A;  4ZPI A;  2B42 B;  3RZG A;  5IAX A;  4FP3 A;  4K8R B;  1LED A;  2HWB 1;  1RUG 1;  4ET7 A;  1US3 A;  1TME 3;  2VUA A;  1O5L A;  1CAX A;  1I5P A;  2Y6G A;  1LHV A;  3OG2 A;  4M4R A;  3PU3 A;  5EP9 A;  5IVY A;  3AYA A;  3LA3 A;  2JE7 A;  3FLP A;  3ACF A;  1AR6 3;  4W6Y A;  4C0B A;  3JCI A;  5C9A B;  2A3X A;  2B39 A;  3H1Y A;  4RS5 C;  3JZV A;  5GLU A;  3ZIW A;  1ULF A;  2VW2 A;  3ELN A;  1V00 A;  4EWD A;  3X29 B;  5KXC A;  5A3W A;  3A0K A;  3VZK A;  3VHP A;  3H9A A;  4NAO A;  4LKD A;  1K45 A;  4CXY A;  5LW9 A;  1SMV A;  1VBC 2;  1ZRF A;  2JDH A;  3I2I A;  4OZX A;  4ATE A;  4CRQ A;  3V0A A;  3VZL A;  3FUQ A;  4JDN A;  1NE6 A;  2VZQ A;  5GZF A;  4WM7 C;  3VDD C;  5FZI A;  3T2P A;  5CFD B;  4LIT A;  2X53 S;  2VZO A;  4ZKT B;  2C5D A;  5E1R A;  2ZEW A;  2VD7 A;  1XSR A;  4DXR A;  4I01 A;  2JE8 A;  3OCP A;  4A7Z A;  3AB0 A;  3RS6 A;  3CKH A;  2FCT A;  4RR3 B;  1JYN A;  1YCI A;  2Y6F A;  1BHG A;  2DCK A;  4IEP A;  4AGG A;  3T3Y A;  4IV1 B;  3ZFF B;  4Z8B A;  3DEC A;  5IK7 A;  2O1Q A;  4JGZ B;  2W1Q A;  1YFX A;  3CJI C;  5F5A A;  3ZXA C;  1VBA 3;  3WP6 A;  2WZR 1;  4AGR A;  2VZT A;  5ACA 1;  4NO4 A;  3ZFE A;  4TWT A;  3WQ7 A;  2OW4 A;  2HBU A;  3PUQ A;  3TN9 3;  4QPG C;  5JPN B;  2J1S A;  3SXW A;  3T0A A;  4EZH A;  2WQ8 A;  3ZXD A;  2O8Q A;  1CAW B;  2GSY A;  5CEH A;  4XHB A;  4DXZ A;  3M3C A;  3JBG 1;  2RS5 1;  1W90 A;  1LTE A;  1ND2 A;  4NRO A;  4LO7 A;  2UU8 A;  2AH2 A;  2RR1 1;  3JQX A;  1R09 3;  5FZ8 A;  2N7G A;  4B3N A;  2WJS A;  3OYW A;  3ES4 A;  2FCU A;  3MIC A;  5FKC A;  1ST8 A;  2UWA A;  3UK9 A;  1ZNP A;  3AZZ A;  2VOW A;  1AR9 2;  1AR7 1;  1RUH 1;  4XUN A;  4CP1 A;  4YW5 A;  1ULE A;  2ERF A;  1W04 A;  1QJU 3;  4QX5 A;  3WW1 A;  1AL2 2;  5FO8 B;  4K7J A;  5HCH A;  5FYY A;  4YW2 A;  4YZ2 A;  2Y0I A;  1XJA A;  1MPX A;  3DPR A;  3CL1 A;  5IUQ A;  1N3Q A;  1H30 A;  3VV1 A;  4GAL A;  1PO2 2;  2DTY A;  1NQJ A;  1AR8 3;  1B35 A;  3AMP A;  5BNO A;  5DDJ 2;  4GZ9 A;  2HEY F;  3ZMN A;  1CIY A;  3HEI A;  2XJV A;  3E5U A;  2JJ6 A;  4NHL A;  3WDW A;  3VDC A;  3WNO A;  3FC0 A;  2WT2 A;  4Q0V A;  3USS A;  4AEM A;  3FLT A;  5A7W A;  4BIF A;  3VBR A;  1RXG A;  2RMU 3;  4CTE A;  5IK8 A;  1HB2 A;  2PAM A;  3WSO A;  1F35 A;  1LES A;  1W9T A;  2G19 A;  2WAO A;  3A21 A;  5FPA A;  3UKN A;  3T2T A;  1J3R A;  3ENR A;  3J4U H;  5FV3 A;  1CWP A;  2WNV A;  3ECQ A;  1CD3 G;  3N9P A;  3PL0 A;  4XF3 A;  5DAV A;  4NPL A;  4OCT A;  4G4F A;  2PHD A;  3B01 A;  5DN2 A;  5FBZ A;  4UFK A;  3LD8 A;  4CU9 A;  2KXL A;  1QJY 2;  4FXG B;  2W92 A;  1BEV 2;  3RRD A;  3Q8E A;  1W6O A;  3H3Z A;  3VBF B;  3ZN6 B;  5FZG A;  2BOI A;  3ITQ A;  1RGS A;  4JDO A;  5A1F A;  1H0B A;  2BGP A;  5FZE A;  4QGM A;  4CEY A;  1SDW A;  5BY5 A;  3HT1 A;  2HWF 1;  2IXL A;  4LHN A;  5C5T A;  4OHZ A;  2QKD A;  3HPN A;  3NKT A;  4QKD A;  1PIV 2;  4FSJ A;  5FMC A;  4FOQ A;  2JX9 A;  1XE8 A;  2BEO A;  5JXG A;  1UY3 A;  1LOD A;  2XL9 A;  1XU2 A;  4FCA A;  4Z2W A;  4QX8 A;  4A41 A;  1PMI A;  1HB3 A;  1GOH A;  2Q4S A;  1V0A A;  2RDS A;  1KQR A;  4LIU A;  5D8A C;  3I2F A;  4ZON A;  4N43 C;  1GP4 A;  1HRV 3;  4YM2 A;  3WNX A;  4TZD A;  1F5J A;  2DTW A;  2X5I B;  2R1D A;  1KD7 A;  4BIS A;  2ZS6 B;  1KS4 A;  4PLN A;  4XZP A;  2GNB A;  1QJZ A;  1OOP C;  3RZH A;  3Q8C A;  4XUT A;  3B02 A;  5DG1 A;  1CPN A;  3PTY A;  2P3K A;  5FPU A;  1C5H A;  1H8T A;  3AP4 A;  3KF3 A;  3W5N A;  2QQI A;  4FQZ A;  4QPG A;  5FP9 A;  4AVB A;  4GWN A;  4BQ3 A;  3JUU A;  1WLT A;  2DUP A;  3DYM A;  4Q8K A;  1LNS A;  3H42 B;  4XPV A;  4G9S B;  5A6Z A;  5FR3 A;  1NCQ B;  4E27 A;  1XNA A;  2W1W A;  3OEA A;  1QJX 2;  5FYS A;  5BV6 A;  5L7O A;  1R08 2;  1VAM A;  2HH9 A;  1UY0 A;  2R0H A;  4BB3 A;  2FDK A;  2HWD 1;  2XWB B;  1Z7S 2;  2H6C A;  3LB9 A;  1YI7 A;  1WBL A;  2XJU A;  3GAL A;  4PBO A;  2JG9 B;  5DQ0 A;  4CCJ A;  2P3J A;  2RHP A;  5FZB A;  3ZSL A;  4IUG A;  5GZE A;  1YHF A;  2VZS A;  2NYY A;  1IS4 A;  3BUC A;  4QXH A;  2DUR A;  1IS6 A;  1FOD 2;  4GB3 1;  5IWF A;  3THD A;  4XCB A;  2TBV A;  1RJ7 A;  2ZMK A;  4OHV A;  4OUS A;  1KGY A;  3CEW A;  4UBH A;  5CVR A;  4AI3 A;  4AQS A;  4YVW A;  1UU5 A;  1I3H A;  3RYK A;  1CQ9 A;  4DB5 A;  1FT9 A;  1NLS A;  2CAV A;  2RS3 2;  2WO7 A;  4KI5 M;  1HV0 A;  1KEX A;  1MQT B;  4L9B A;  1ASJ 2;  4GQ7 A;  1W6M B;  1SPP A;  1W39 A;  2Y6L A;  2JKX A;  3C2U A;  5IVB A;  1X33 A;  3HMY A;  4RD7 A;  5SV8 A;  2EF6 A;  1Q8V A;  1VBB 3;  2WYS A;  1UYP A;  5FLH A;  4A6O A;  3BTX A;  3P3P A;  4D6Q A;  5ABJ B;  2IWG B;  2K0G A;  3FX3 A;  4HKW A;  1OA3 A;  1ZA7 A;  4IXL A;  4JRA A;  3UJQ A;  4UFM A;  2Y26 A;  5LA1 A;  5IVE A;  1FV3 A;  4DEQ A;  2R07 3;  4BMB A;  1ND3 A;  1OD5 A;  1S4C A;  3NV3 A;  3ZFG B;  2TEP A;  1IPS A;  4ZHN A;  4AED B;  5C9A C;  1NA1 A;  1VBE 1;  2E9Q A;  1WKY A;  2X10 A;  3G7D A;  5EV7 A;  1OLM E;  3ZXL A;  3VD9 A;  1W03 A;  1XYN A;  4KG0 A;  1SHW B;  5BNP A;  4XF4 A;  1D4V B;  3PVE A;  1LGC A;  2V09 A;  4LE3 A;  4TYS A;  5F6L B;  4TN7 A;  5LRS A;  5AC9 1;  2VCA A;  3S7I A;  3LZZ A;  1F4A A;  5LBC A;  3WT3 A;  4MGK E;  4QKF A;  2BTV C;  1K5J A;  3ETP A;  4XBQ A;  4XF9 A;  1Q56 A;  3GM8 A;  3BPS A;  2CWS A;  4LK7 A;  4LKE A;  2VU9 A;  3UNP A;  1U5Z A;  3BTA A;  1ZZ8 A;  2PHX A;  5CFD C;  2CGP A;  2MEV 2;  5FWE A;  2VCM A;  2DU0 A;  3KT1 A;  4UFL A;  1NXD 1;  3J7L A;  2YPJ A;  5TSW A;  2OYZ A;  4OMC A;  1X7N A;  3UGH A;  1Q8P A;  3FUO A;  4RR3 C;  4FT8 A;  2VNR A;  3JXS A;  3ZPY A;  5G05 L;  3ZFF C;  1LR5 A;  4GMP 0;  4IV1 C;  3WV6 A;  5JDB A;  4HKL A;  2XVL A;  4JGZ C;  3T0B A;  1YQ6 A;  1ZZ7 A;  1GLH A;  5A6X A;  5EJ3 A;  4XJ9 A;  1H2N A;  4QMA A;  4KBB A;  4R9D A;  1RUE 3;  2D3P A;  4QB1 A;  4XQ4 A;  3NJV A;  1BMV 1;  1QHD A;  1AX2 A;  4GA9 A;  2WFP A;  1O3R A;  5CFC B;  3NNJ A;  1VMF A;  3LQC A;  1Y9M A;  2Q8O A;  1K12 A;  2WUH A;  3T4H B;  4AI1 A;  1MZ6 A;  3W21 A;  1IZ3 A;  1HN1 A;  2Z69 A;  3DKW A;  2W94 A;  1RIR A;  4A2U A;  4MO3 M;  5CU1 A;  1AYN 3;  3PNA A;  2D6K A;  4RSU A;  5DZF A;  5AFB A;  2WYF A;  5DAW A;  5A7Q A;  1A6C A;  4AFA A;  1RL3 A;  4M3C B;  4LO8 A;  4FPY A;  5HBA A;  3S5Q A;  3VGI A;  1HJF A;  1YQ8 A;  3U37 A;  2ZGO A;  3IWZ A;  1VBD 3;  4XXP A;  2YC2 A;  2XL7 A;  2VQ0 A;  5KXB A;  3ZSM A;  2LAL A;  1CX4 A;  4OVE A;  5CA6 A;  2RJ2 A;  5FZO A;  1FPN 1;  1ZBE 1;  1VMJ A;  5K9Y A;  2JDK A;  4XYX A;  4OI0 A;  4DPN A;  1PVC 1;  4K20 A;  4EN7 B;  3F95 A;  5A32 B;  3I2J A;  1SFP A;  2J1T A;  4YPJ A;  2DCT A;  1OSG A;  2JD9 A;  3D6E A;  4U36 A;  3SIT A;  4Y24 A;  5CZK A;  4Y1Z A;  2WFF 1;  4Q5O A;  2YGM A;  4J1X A;  3C8X A;  1UYZ A;  4FPF A;  2ZGK A;  3KV6 A;  2C0Z A;  4BXS V;  3OF1 A;  2F17 A;  2K2S A;  3KSC A;  1W8W A;  3MIH A;  1XPW A;  2IZW A;  1WW5 A;  2P3Y A;  4QU2 A;  4XQW A;  2IXI A;  3WUD A;  2YRO A;  3WG3 A;  1H4H A;  2GH8 A;  3O0X A;  2WL1 A;  3GCW A;  3WW2 A;  4AGV A;  3SQO A;  1W6P A;  1SDD B;  4CVU A;  3M8L A;  4SLI A;  4P08 A;  3B00 A;  2ZHM A;  3MF9 A;  4AHY A;  4MGQ A;  3ACI A;  4X8P A;  5L9R A;  4B1L A;  4PF1 A;  1JZ5 A;  1YFW A;  1QF3 A;  3VBF C;  4Y5S A;  4W8J A;  2P6C A;  3AL6 A;  1SZB A;  4MOA A;  2Q8E A;  1AYM 3;  4MXW A;  3E5Q A;  3VD3 A;  4K21 A;  3ZYI B;  1RTV A;  4YSF A;  4YM0 A;  2XQR A;  4OZO A;  5FZ7 A;  4V1P A;  4BLI A;  1S2E A;  1NLR A;  1D0H A;  1ONA A;  3UT0 A;  2Z4F A;  2RM2 1;  3ZYR A;  1CVN A;  4COY A;  2WZE A;  4UW5 A;  1LJ7 A;  4DIQ A;  4LOT A;  4IGQ A;  1SFN A;  4WVM B;  2WNU B;  4FBF A;  1YQ5 A;  2BWC A;  4WZC A;  4Q4W 1;  4QXB A;  3CLP A;  3MW4 A;  4RQP A;  4MG2 A;  2PQS A;  2GC1 A;  3CO2 A;  4D94 A;  3MPP G;  3JB8 A;  4ES8 A;  1RMU 2;  5T5J A;  4B7K A;  2D3S A;  3VZM A;  4HMZ A;  4OMD A;  4H7M A;  2X5I C;  2C26 A;  3WY6 A;  4CP9 A;  4KH9 A;  2UYA A;  2D44 A;  2VR4 A;  3BYW A;  3LOB A;  4M3C E;  2D6P A;  1TMF 2;  3RZZ A;  1V6M A;  4CZS A;  2FBE A;  3WUC A;  4NMI A;  3GZU C;  1TZO A;  1DGW A;  1HX6 A;  3CZJ A;  1CPM A;  2E32 A;  2JXA A;  2D5H A;  3KV9 A;  3I54 A;  2YFZ A;  1DQ1 A;  4PJY A;  2GMM A;  3PUA A;  1X8E A;  2PMW B;  2VVF A;  3WDU A;  5CAZ A;  2DBI A;  2E53 A;  2Q30 A;  2W5F A;  1FMD 2;  3ACH A;  1ZZ9 A;  3LIG A;  4FPO B;  5LWB A;  2WLQ A;  3EBR A;  1NCQ C;  4I0B A;  4Q0S A;  3TYJ A;  5KXD A;  1W8U A;  1OC1 A;  5JI7 A;  1G9B A;  4I2O A;  5A7O A;  1EUT A;  1KIT A;  5EJZ B;  5FUP A;  4W6X A;  5T55 A;  1VRH 1;  4E8C A;  2LUW A;  1VLN A;  2FDJ A;  5FDB A;  4Q29 A;  2YZ4 A;  1R1A 2;  4OI1 A;  3FFZ A;  4YGC A;  4R9A A;  2ZTN A;  4NID A;  2HWC 2;  1BYH A;  1POV 0;  1E5S A;  1ZBA 2;  2JG9 C;  4ZXE A;  4A45 A;  4AHW A;  3GF6 A;  1N47 A;  1LOF A;  4W6W A;  1UY1 A;  2D43 A;  2QQP A;  1P8J A;  1EPZ A;  2Y6H A;  4L99 A;  2XKP A;  2PHR A;  3J9S A;  4XIO A;  3VZJ A;  3LA2 A;  3NVC A;  3POJ A;  5FP3 A;  5IK4 A;  4AFD A;  4QKN A;  1C57 A;  4L2N A;  1PZ8 A;  3NQH A;  3U4S A;  3WVJ A;  1JYW A;  2HWE 2;  1BK0 A;  4KWU A;  3I3M A;  2OPK A;  2VMG A;  4Y3O A;  5T5O A;  4EN9 B;  1W6N A;  4EN6 B;  1IG3 A;  2NN8 A;  3HR9 A;  1MQT C;  2R04 1;  4U2A A;  4Q4X 3;  4CCE A;  5A3L A;  4LR4 A;  4QGL A;  2JG8 A;  1RXF A;  4FO9 A;  4LOS A;  3VBU A;  2VAU A;  2E63 A;  1R1Z A;  3RJ2 X;  1PK6 B;  3PVO A;  1JHN A;  4LUK A;  3VB9 A;  2IFR A;  5ABJ C;  5LBB A;  1RUF 3;  3ZM8 A;  2H0V A;  2UWC A;  4JGY B;  2QE3 A;  5EQU A;  5JZG B;  2BBV A;  5FY9 A;  4A44 A;  5FLJ A;  4AAX A;  5A7N A;  4CDQ A;  3VDA A;  3FBY A;  3POW A;  2R06 2;  3AFG A;  1H9P A;  4S2D A;  5F5C A;  4ASL A;  4BM8 A;  2XJP A;  5A1L A;  1L7L A;  1ENS A;  2EIG A;  2IXK A;  1OT5 A;  3ZFG C;  3WP3 A;  4A7Y A;  2ZGU A;  2IVJ A;  2Q1M A;  1JH5 A;  4AED C;  5IVV A;  3IDA A;  4ORF A;  4ITC A;  2NMN A;  4ONU A;  1W2T A;  2V4A A;  1U5Y A;  1SLC A;  4NHX A;  5FYB A;  1A34 A;  5A70 A;  3VD5 A;  4BQ5 A;  4DOU A;  4CU6 A;  5FYU A;  2DVA A;  1UIK A;  2QDR A;  3OY8 A;  2QJV A;  4OQ9 A;  2OXB A;  5J09 A;  5GZD A;  1GSL A;  4HN1 A;  3WHT A;  3BPZ A;  4P9L A;  1V9U 1;  1VAL A;  5K0U A;  3FHA A;  4XFA A;  2QQM A;  2VME A;  2FDG A;  4XZU G;  2D40 A;  3LIH A;  4JQR A;  3TWI A;  1F4H A;  3I4I A;  2BUK A;  4N7I A;  2E33 A;  1PX3 A;  1NOV A;  3OSD A;  3V56 A;  5KC5 A;  3AZV A;  3UGF A;  4PQQ A;  4FPE A;  5A6Q A;  3OUH A;  5DUU A;  1IOA A;  1UAI A;  4HT1 T;  1KDK A;  1PMH X;  3VD7 A;  4N53 B;  3PJY A;  3SMH A;  1HRI 3;  4H3W A;  2F4L A;  4XF0 A;  1GU3 A;  4EWE A;  1RC6 A;  2GC3 A;  1UOF A;  4XIK A;  2WNO A;  5DG2 A;  3WNL A;  2LRP A;  2QUO A;  4E8D A;  3MUY 1;  3WG4 A;  3ZPO A;  1GP6 A;  5CFC C;  5EJ1 B;  5K4L A;  3I3E A;  1V6O A;  4IND A;  1JHJ A;  1WGP A;  5F8P A;  4XBL A;  1RUO A;  1YFY A;  4GXL A;  4JC1 A;  1VMH A;  3AMQ A;  3RPQ A;  3H8O A;  3PMS A;  1GWM A;  2P34 A;  3MI8 A;  3K48 A;  4X6R B;  4QB6 A;  1Z0H A;  2JB8 A;  4RHV 1;  3IPV B;  3JD7 1;  3RZL A;  4KU8 A;  5EYX A;  2BJS A;  1C8M 1;  4XAB A;  1COV 3;  4GMP 1;  1JS9 A;  2A70 A;  2WA3 A;  2A6Y A;  4AVS A;  3IB3 A;  4YGD A;  3ZR5 A;  4NRM A;  2ZGP A;  1RIN A;  2YC0 A;  1DCS A;  3K4D A;  3CHX A;  4N90 A;  2ZML A;  3KVA A;  2Y6K A;  2YBP A;  5LB6 A;  1POQ A;  1RUD 2;  4D0Q A;  2WO2 A;  4XMA A;  4DIN B;  2RJK A;  4O9G A;  2QNK A;  1N1Y A;  2VMH A;  2EXH A;  3AKP A;  5FQ0 B;  2P37 A;  2I45 A;  4H14 A;  1W3V A;  1UZZ A;  1IGO A;  2DCZ A;  1OH4 A;  1H2K A;  1RUJ 3;  1VR3 A;  1GYK A;  2OPW A;  3K3O A;  4GMP 3;  4Z92 B;  1XYO A;  5LY2 A;  3O1P A;  5C4W A;  1KJL A;  4YZ1 A;  2DDU A;  4NRP A;  5A33 B;  3WQ1 A;  4DXT A;  3TAY A;  4QPY A;  4BK5 A;  1NE4 A;  1PGL 1;  1S1A A;  2R16 A;  4PCR A;  1WW6 A;  5J37 A;  4LXL A;  5FYT A;  3IAQ A;  2GME A;  2JKB A;  1DQ5 A;  5J36 A;  5ANN A;  4LMF A;  2FMD A;  3S7E A;  3RGB A;  1W05 A;  4IES A;  3AP5 A; 
#chains in the Genus database with same CATH homology
 5A7N A;  4QXH A;  5FYV A;  5FZ8 A;  5FPL A;  5FZF A;  4IGP A;  5IWF A;  5A80 A;  5FPB A;  5F5C A;  5FZO B;  4IGO A;  5A1L A;  2WWU A;  4AAP A;  2OQ7 A;  5FZC A;  5FP7 A;  3KV6 A;  3DXU A;  4CCM A;  5IVV A;  4Y4R A;  2OQ6 A;  4QXC A;  5FYB A;  4CCN A;  5FY1 A;  4EZ4 A;  5FYY A;  2PXJ A;  5IVB A;  2GP5 A;  4CCL A;  4GJZ A;  5F5I A;  5IW0 A;  3K3N A;  5FZK A;  4UF0 A;  5A3N A;  5FZ3 A;  5IVJ A;  3PDQ A;  5F3E A;  5FYU A;  3OPT A;  2YU1 A;  4D6Q A;  3PUS A;  5FYM A;  3AVR A;  2OX0 A;  3AL6 A;  5FY4 A;  5IVE A;  5A3T A;  3KV4 A;  2Q8E A;  4XDP A;  5FXW A;  5A7W A;  4UF0 B;  5FZA A;  4CSW A;  2XDV A;  5FZ7 A;  3AL5 A;  5F3I A;  4XDO A;  3N9L A;  5FPA A;  2OT7 A;  3DXT A;  5FXV A;  4AI9 A;  4DIQ A;  5FV3 A;  2GP3 A;  4IGQ A;  3K2O A;  3N9P A;  4ASK A;  5A7W B;  3N9Q A;  5FP8 A;  4D6R A;  4LIV A;  4QXB A;  4TN7 A;  5F32 A;  3LD8 A;  4NUB A;  4CCO A;  2YBK A;  5LY1 A;  5FZG A;  5E6H A;  2WWJ A;  5FXZ A;  3ZPO A;  2XML A;  5FXX A;  4CCK A;  5A1F A;  5FZE A;  2YPD A;  5FJK A;  5FZD A;  5K4L A;  5FWE A;  5FZ9 A;  3PU3 A;  5IVY A;  3ZLI A;  3RVH A;  4C8D A;  5F37 A;  4Y33 A;  4E4H A;  5FUN A;  4DO0 A;  5FYC A;  4HOO A;  3N9N A;  3KV9 A;  5FP4 A;  3KV5 A;  4QX8 A;  5A3W A;  4GAZ A;  3N9M A;  3PUA A;  5FWJ A;  5FZM A;  5A3P A;  4URA A;  4LIU A;  3UYJ A;  1VRB A;  2OS2 A;  5FYH A;  4BU2 A;  5LWB A;  5LW9 A;  5A7S A;  5FY5 A;  5F39 A;  5FY0 A;  5FYI A;  5FBJ A;  5A7O A;  5F2S A;  5FZ6 A;  5FUP A;  4D6S A;  4GJY A;  4BIS A;  3PTR B;  5FZI A;  5FZH A;  3KVA A;  4LIT A;  5KR7 A;  2YBP A;  5F2W A;  3NJY A;  4QU1 A;  3LDB A;  2VD7 A;  5FZ0 A;  5FJH A;  5FPU A;  2Q8C A;  5IVF A;  3KVB A;  5FZ4 A;  5A7Q A;  3U78 A;  5FP9 A;  4V2W A;  5FY8 A;  5FZL A;  5FP3 A;  5F3C A;  3K3O A;  4EYU A;  5LY2 A;  3U4S A;  4GD4 A;  5IVC A;  2XXZ A;  5F5A A;  4Y3O A;  2XUE A;  5FY7 A;  5A7P A;  4BXF A;  2W2I A;  5FPV A;  5ISL A;  5FYS A;  3N9O A;  2Q8D A;  5FZ1 A;  2YBS A;  2YU2 A;  3PUQ A;  4LXL A;  4QX7 A;  4QWN A;  5FYT A;  3AVS A;  5FZO A;  4CUG A;  4EZH A;  4CCJ A;  3PU8 A;  3OPW A;  5F3G A;  5FYZ A;  5CEH A;  2P5B A;  5FZB A;  5ANQ A;  3PUR A;  5FY9 A;  4HON A;  4V2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...