4QX7A

Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 105
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qx7A01
5FZ3A 4NUBA 5LY1A 3LD8A 4AI9A 2PXJA 2OX0A 5FZDA 5A7SA 4E4HA 2GP3A 5CEHA 4ASKA 5FUPA 5FY5A 5FWEA 5FXZA 5IVBA 3ZLIA 4Y33A 5FZIA 3N9PA 4GJZA 4BXFA 4EYUA 3N9QA 5IVCA 5FYCA 5FJKA 2OQ7A 5ISLA 5FZ6A 5LWBA 5A7WA 5FJHA 3K3OA 5F5CA 5IW0A 5A7OA 5IVVA 3KV6A 5A7NA 4TN7A 4Y4RA 2XUEA 4BU2A 3AL6A 5FY7A 2YU1A 5FZAA 5F5IA 5FY9A 4QXHA 5A7PA 5FZCA 2YU2A 5KR7A 2OS2A 3DXUA 4LITA 4V2VA 5FBJA 5FZ4A 3K3NA 2VD7A 3OPWA 5F2WA 5FZBA 4QWNA 4BISA 3PTRB 5FYHA 3N9NA 4D6RA 5FYYA 4DO0A 5F39A 4UF0B 5FZ7A 5FYBA 4DIQA 3AVRA 5IWFA 2Q8CA 5IVFA 5F3EA 5A3WA 5E6HA 4D6QA 3N9OA 2OQ6A 5F37A 4EZ4A 2WWJA 3PU8A 3DXTA 2XXZA 5FY1A 2W2IA 5FXXA 5LY2A 5FP7A 5IVJA 5FP8A 4IGOA 3N9MA 5FPLA 3N9LA 5ANQA 5F32A 3PUAA 3KVAA 5FPBA 5FY0A 5FP3A 5FZ8A 5FZFA 4GAZA 2P5BA 4LIVA 5F3GA 5FY8A 5FPUA 5FXVA 4CCJA 4HONA 5F3CA 5LW9A 2WWUA 5FZOB 2GP5A 5FPAA 4HOOA 3KV9A 5A3NA 3ZPOA 1VRBA 5FYMA 3U78A 2YBKA 3U4SA 4XDPA 2YBPA 5A7QA 3PUQA 4QXCA 4Y3OA 4QXBA 3PDQA 4CCKA 5FZ9A 4V2WA 4XDOA 5FV3A 5FY4A 3KV5A 5F5AA 5FXWA 3UYJA 4CSWA 5FZKA 4AAPA 4LXLA 5FYIA 5A3PA 5FZMA 4EZHA 4UF0A 5A80A 2XMLA 5FZ0A 5A7WB 3K2OA 4CUGA 5A1FA 5FWJA 5FZHA 4IGQA 4CCLA 5IVYA 5K4LA 4QU1A 5FYVA 3PURA 4CCMA 4GD4A 5FYTA 2Q8DA 2YBSA 3LDBA 4CCOA 5A1LA 5IVEA 3RVHA 3PUSA 5FZ1A 4IGPA 4URAA 3KVBA 5FP9A 5FZEA 5FPVA 2OT7A 5F3IA 5FYZA 3KV4A 5F2SA 3PU3A 4D6SA 5A3TA 5FP4A 3OPTA 4QX8A 4C8DA 5FZOA 5FUNA 4QX7A 2Q8EA 5FZGA 3AL5A 2YPDA 4GJYA 3AVSA 4LIUA 5FYSA 5FZLA 4CCNA 2XDVA 5FYUA 3NJYA
chains in the Genus database with same CATH superfamily
4BLIA 3TAYA 2I74A 1GLHA 4MGKE 2GP3A 4EWEA 1VMHA 4CDUA 1REEA 1US3A 1DGRA 2VC9A 1V6OA 2XJQA 4DMIA 1YI7A 3D5OA 3VBSB 2VOXA 4KGQA 4Y33A 3RRDA 2XL9A 4O9EA 4Q8LA 1GFF2 2Y38A 3DL3A 4P00B 3FN9A 1PIV2 3C8XA 2P1BA 4B4QA 1E5SA 1VBB3 2ZJCA 1DGRN 4OQ9A 2X5IA 5FKBA 4AQSA 1E5IA 5A7OA 4YYOA 1V6NA 2Y33A 3FHIB 2AZ5A 4BU2A 3H1MA 5FO9B 5FY7A 3J7NA 1J1TA 1RUD3 3MF9A 2R063 1LU2A 2HWF3 1RUJ3 3T4HB 2KD7A 2PAKA 2PELA 2WS93 4BQ1A 3JD72 1W3VA 2KXLA 3C7HA 1OLME 4BPZA 1TNFA 3KQ4B 2CDOA 3R05A 1VBB1 4D7SA 3BOWA 3UKTA 5C3PA 1MVQA 3MLKA 2XJTA 4B4RA 4LLOA 4XMAA 4PDWB 2VOTA 3AMMA 4JZRA 4WVZA 1EV12 1VB4A 4BB3A 5KHGA 2WFPA 1GBGA 2ARBA 2HWF1 1RUJ1 2YV8A 3WG1A 3WDYA 5DQ0A 2WS91 2WRAA 2WWJA 4UT5A 2SLIA 4CZSA 3KT1A 5J1XA 1TME1 2P6CA 3FUOA 1UPSA 1B35B 5FY0A 3KVAA 2ZZJA 4LPLA 1W6NB 5FZFA 5KHHA 4PLOA 5AFBA 4WVMA 1JI6A 3UJQA 4Y4YA 2UWBA 4CXXA 1NCRA 3EO6A 1APNA 1YFWA 1ND2B 1VBC2 1S0GA 1QDCA 2CGPA 2AYHA 3IAQA 3QH7A 1IHMA 3FE5A 3NKTA 1WCKA 2R1DA 4Q4X1 1YFXA 5A7QA 3UT0A 5K0UB 1Q3EA 3RMYA 4CP9A 2CWSA 3MUY1 4DUVA 2V4VA 3MV01 1F5JA 1YNAA 4AGRA 4YG6A 2XVGA 1YC61 3KZ4C 1G9FA 2J7MA 2IC1A 3NJVA 4MHUA 1KXGA 1OFNA 4URTA 3VZLA 4QX1A 3ZFEB 3A21A 2X10A 3VBSC 4Y1XA 2RM23 1PM4A 3OGGA 2VL4A 1DFQA 1PVC2 2VMHA 4U2AA 1H4GA 2DCJA 2ZX0A 4ZU4A 3DCQA 2BU9A 1PO23 2VXJA 5JXHA 5GM0A 5CB7A 4SBVA 4BM8A 1PZ8A 3AP4A 2BGPA 3ZX7A 2VQ0A 1XE7A 2RM21 2BGOA 5KXCA 3LPGA 5FZLA 1XE8A 3ETPA 2VUCA 1PO21 2WT2A 4NHMA 2QZ2A 4DS0A 2WLPA 1LOFA 5KHIA 2K2SA 4JDOA 1A8MA 4PDWC 4BMBA 4DEVA 4UYBA 3TWIA 4NHLA 2W3JA 4PQQA 4MG2A 2PQQA 5FZIA 2QUOA 2UY8A 4ONUA 4EYUA 4Y22A 5IVCA 5J7MA 5JCTA 1ZRIA 2I2SA 2RMU2 2E7AA 3S5QA 1S0DA 3D6EA 1GZTA 1TMF3 5ABJB 3SNMA 1B35C 4XQ4A 1NY71 3OGSA 1N1VA 1W04A 2GH2A 3B9IA 1OH4A 3E6BA 3W59A 4A7KA 4D69A 5HXVA 2VO5A 2ET7A 3BCWA 3MEPA 1DF0A 2O14A 4LITA 4V2VA 3I2FA 1ZZCA 1ND2C 1F8VA 2VD7A 1U5IA 3AZXA 2GN7A 5JOZA 3OPWA 3URFA 1O4ZA 3I2DA 1TMF1 2W92A 1FX5A 3OBZA 3AMHA 4M3CE 5ERLA 5FYYA 2AGSA 1WBFA 1WMDA 1OQEA 3FL7A 2A7AA 4XZPA 1R083 4XC9A 2Q8CA 3W20A 4BOWA 5K0UC 1ENXA 5EJ1B 3TNQA 2HEVF 2WA3A 1OA4A 1XU1A 1DP0A 2NMOA 4NAOA 1IS5A 4YVWA 1VPHA 3D0JA 4COVA 3N7KA 2R043 5BV6A 1O7FA 4P9XA 5FXXA 1ZVFA 1RTVA 4I3PA 5JPNB 4E2GA 3NV3A 5FPLA 1UMZA 1COV1 1Q56A 3ZFEC 2W1SA 1D4VB 3IIIA 4NRQA 1IS6A 1RJ7A 1R081 3M3IA 4R9CA 5F32A 5DG1A 5GLZA 3W5MA 4IW3A 3ZO0B 2ZGTA 2PLV3 1HRV3 2P5BA 5FPUA 4K40A 3TEYA 1JOJA 4M01A 2VBPA 3CZJA 4XFBA 3VKLA 1BVP1 3AMPA 2AENA 1DCSA 5FPAA 4A6SA 1QJZA 2R041 3B5LB 4Y1UA 2RR13 3OGRA 4IETA 3T0DA 1C5IA 3T1MA 2DURA 2A3YA 5DZEA 3CKHA 4ASMB 1VBE2 3O0XA 4BMEA 5CFDB 2RV9A 5JDBA 5FTTC 5K9YA 1QJU3 1UZ0A 4Z82A 1AXYA 1F2NA 5DMYA 4DUWA 2PLV1 1HRV1 3DPRB 1POV3 3N7LA 1PK6A 4P5YA 4Y5Z0 2R49A 5L9BA 3VBHA 1ZZBA 2ZKLA 1YFUA 4LO4B 1A34A 2ATFA 1W2AX 1VMFA 1NXD1 1YJKA 2FBEA 4UW3A 4DRRA 3DN7A 1VP6A 3KMHA 1QJU1 4XQDA 3WUCA 2WYSA 3ZOIA 1H8VA 1POV1 4QGNA 3E5XA 3U0ZA 2A6YA 1W8TA 3WD5A 1DIWA 1UOFA 4CXWA 1FMD1 1NT0A 4OHXA 3LSDA 3PUSA 2YG0A 3P3NA 4A41A 3CJIA 4URAA 1QJX2 3I8TA 2KA3A 5ABJC 1UOGA 3MBWA 1ZBE3 4W4ZA 4YW2A 4EQVA 3AKSA 1NE6A 1VBD3 5T5PA 2XKOA 2RDQA 4LBQA 3V64A 4GXLA 1OA2A 4IEUA 3ME2A 4CU8A 3OYWA 3ZXLA 2EXIA 3AVSA 5DUUA 1FOD3 1AR92 4XF9A 2VW0A 4XJAA 4JHTA 1SCSA 5C9AB 4ZPIA 2PXJA 1G8WA 3SCGA 1IS4A 1RITA 1N1TA 4PT6A 2DVFA 1ZBE1 2QQVA 4TSVA 5FUPA 1VBD1 3I97A 1POQA 1SBEA 1HQNA 2C9KA 2VR4A 3KD4A 3P1IA 1UYZA 1JOPA 1UY2A 3GF6A 3NWKA 3O12A 2WINB 4YFZA 5EJZB 2DFBA 5JMCA 4OUEA 5C8CB 2HWD3 3QH6A 2HBUA 2IXLA 3MI8A 4K6BA 4PBPA 2RDSA 4LUMA 2DVDA 1PZ7A 2RS12 2QDRA 2WFF3 3DF0A 3CIHA 2TBVA 2VZ1A 3UL2A 2XJSA 1KS5A 3VZNA 4BQ4A 5JAXA 5DDJ3 3ZYHA 1I5ZA 3MIBA 2EF6A 3KM5A 2YHJA 3AXDA 5DAXA 4N43A 2D97A 2JKBA 4AAXA 2HWD1 3I2JA 1I1EA 4LO6B 3IN9A 4NE9A 5A32B 5CFDC 3VLBB 4D6RA 4XURA 3SHRA 2WFF1 2WZEA 2ZOEB 3GBGA 2XG3A 2WZPP 3DPRC 4HSLA 5DDJ1 4ZU7A 2CTVA 2WNVA 4AFCA 5F37A 3AP7A 4I01A 4NPRA 1OMIA 3PU8A 1AR83 3VDCA 4UI9L 5KXEA 3M70A 4H55A 4Q0VA 1KGYA 1S0BA 4YPJA 1C3HA 1H2LA 3PUAA 1VLNA 3KCXA 2ZGKA 3LKJA 2ENRA 2VZVA 3OOXA 4WBBA 4QKFA 4LBMA 5L7OA 4F7ZA 3VDBA 1AR81 4M4PA 3C7OA 3GGLA 2EVXA 2L9LA 1H1IA 2ARAA 5F6LB 3I2OA 4CDUB 1REFA 4PQ9A 4QX5A 3THDA 4NOTA 4ZKTB 3TNPB 1HQLA 3AX4A 3U07A 1Q8PA 2VNVA 4B3NA 2ZEWA 2RE9A 1W8FA 3PDQA 5LK5A 4CCKA 1SLTA 2QZ3A 5A3NA 3SKJE 3MW3A 5C9AC 2H6BA 4JAAA 4L99A 4AQTA 4ARXA 4UF0A 3OUIA 4RGGA 5T5JA 2IVJA 3I3QA 2X5IB 1J58A 1IPJA 3K46A 5LA0A 2GNTA 1I9RA 4CUGA 4FFHA 5A1FA 5L9VA 1W9WA 4IGQA 3WVJA 1UIKA 4O7XA 2B39A 1GNHA 1CAVA 4XVHA 2Y0IA 4AVVA 5IT6A 1GOHA 1PMIA 3DGTA 3RJ2X 1M06G 2XJRA 5T52A 5IVEA 5C8CC 2BVVA 1P8JA 3PJQA 1YXWA 3HNMA 4JRAA 1RUI3 4OZOA 3OUHA 1WW4A 3WHTA 4CDWA 4Q4Y1 1XOYA 2LALA 3SCFA 5FPVA 4IERA 1O5UA 2D6LX 3PU3A 3OPZA 3NMBA 1UY3A 5J3UA 1J3QA 4HBNA 1X8EA 5FUNA 2Q8EA 3U1XA 2VU9A 2V4AA 2XR4A 3BIEA 3GCXA 1OI6A 4CCNA 4IE6A 4KWLA 3UESA 1RUI1 1S0IA 3T09A 4Q0UA 4K20A 4LBLA 4FVVA 2RVAA 2W87A 3HWJA 3IDEA 5FLJA 4J25A 4YM1A 4FPLA 4IL7A 4RHV2 4LE3A 3MGUA 4XFFA 2BNOA 2W94A 3NNLA 5T3NA 3SEPA 1AR73 4GB33 3CNAA 1JN2P 2AC1A 3CO2A 2N7GA 2J1RA 1W8UA 2R6QA 4QX0A 2ZTNA 4WVMB 3N9PA 1D2SA 1C1LA 2TUNA 3H0OA 1YWKA 1NCRB 2OQ7A 2VVFA 4LJHA 4QM8A 1KDKA 1ZM1A 4QX3A 5A3MA 1RXFA 1IKPA 3LFIA 1RXGA 4XPVA 4CA9A 3GZTB 3TB0A 2CSGA 5KC6A 3AL6A 3APBA 4MXVA 1AR71 4KWUA 3WW3A 4LULA 1XPWA 5CVRA 5JXGA 1SDDB 4GWNA 4LKDA 3CU7A 4MOAA 4QPGB 4COZA 5BXXA 4CP9B 3S6PA 4F83A 5K8SA 1KS4A 3RWNA 2A6ZA 4QWNA 5HI0A 3ZSJA 4LHNA 4MGIE 3AZVA 3ILFA 1M4WA 2ZHKA 3O0WA 3Q8CA 1OLQA 5K0UA 4GQ7A 2ES3A 4DO0A 5DAQA 1MPXA 1BXHA 2VQTA 4CDUC 5FO8B 2J1EA 2XKPA 3VDDA 4BIFA 2YC0A 4D6QA 1JYXA 1WLTA 1S55A 3LGRA 2IWGB 5D8AA 1AUYA 1AL23 2Y6JA 4MVTA 3WNNA 3AP6A 4DB5A 2X5IC 3J7LA 1HRI3 4XILA 2PA7A 4XHBA 5ANQA 3Q9OA 4YW3A 1NYWA 2QQJA 2HYKA 1S2EA 2IXCA 5J96B 2AEYA 3NNGA 2ZEXA 5FFOC 2VE1A 1V6JA 1N3PA 2GC0A 4Y5TA 4CCJA 4E4SA 2WDBA 3A22A 3UKVA 1EAH3 1WD4A 2NP0A 1AL21 5E89A 3TN93 4W6XA 2WC2A 3BKZA 4NMIA 5A3LA 5E88A 4RR3A 1ZYBA 1YLLA 1HRI1 5A6YA 3SITA 3AKQA 4FOYA 4YGDA 2P3JA 1IS3A 4HLTA 4LKSA 3C7GA 3I3EA 4QXCA 4AFAA 1AVBA 2O8QA 4QB1A 2VMFA 1GNZA 5JSPA 5I8TA 1MS0A 2FCVA 3RFRA 1KQRA 4OMCA 4UW4A 5FXWA 1GMMA 2QQLA 3AJZA 5F8PA 2JDMA 4UOJA 4CYDA 3OGVA 1JYTA 2D40A 1RVF2 2I07B 4HK9A 5C8WA 4Y1ZA 5J48A 2EALA 1QMJA 2E9QA 1ZX5A 5A1AA 2QNKA 4NIGA 2ZGSA 1J84A 1RUH3 3OG2A 5FYVA 2QQNA 5A3UA 2ZABA 4NIDA 3K51A 4MX3A 5GZDA 3VZMA 1NCRC 3VGIA 1ZRDA 5FZEA 1A78A 1IOAA 1AYM2 1K3IA 1H4HA 3WY6A 4AQ6A 4ES8A 1JYCA 1UAIA 1AYN3 2DDUA 3MV11 4AHWA 4X6RB 3OPTA 4QPGC 5DUWA 1AR62 2CWMA 2BWCA 5A6XA 1N1YA 1UKGA 3LAGA 3N7JA 3OEAA 3NJZA 2VM9A 3POWA 4KBZA 4KU7A 4YVWB 3WP4A 3M3CA 2OZJA 4AG4A 5BNNA 1GV9A 3BTAA 1UU4A 4G3YC 3J7MA 3DYPA 2HEYF 3POYA 5IK5A 1GQHA 1QQP3 1UYXA 3K4DA 3SH4A 1AYN1 3GBWA 1ULCA 4QGLA 2O0OA 2VNGA 4A2UA 4I30A 1S1AA 5BY5A 2YYOA 3FLRA 1HN1A 2CY6A 1UZVA 5JSOA 1HW5A 1ZNPA 3CQOA 3Q8FA 3VD4A 4WZFA 2E31A 5LBCA 1NKGA 2YZ4A 1IPKA 2DUPA 4UFMA 4AEDA 2VNOA 1PHMA 2D7FA 2NM1A 3OCPA 5C6CA 1S0EA 1QQP1 2OVUA 2VQUA 4IUGA 3WF1A 1PO13 5K7PA 4OHVA 4N7UA 4N9IA 1BCXA 1CZTA 2BBAA 4FPGA 3T0AA 5J37A 1OUSA 4JQTA 1A8DA 1QOOA 5FAXA 2EAAA 3O14A 1OD3A 1OF4A 5FZCA 3ES4A 5IHRA 2LW8A 4KGGA 4JKLA 3K3NA 5LBBA 2FDFA 3ZR5A 4NWVA 5FUIA 5F2WA 4ES9A 5FZBA 4L92A 3I54A 1JH5A 3LZZA 4YGBA 3WF0A 3M1HA 3AMQA 3ZKUA 4OQ8A 1EY2A 2JX9A 3N9NA 4KH9A 4XTPA 4DRVA 3DPRA 3IMNA 3PJYA 5F39A 1LOFC 1R092 2RDRA 1PO11 3IB3A 2QQMA 3AVRA 4OYUA 1W9YA 5FK8A 4DQAA 5FK7A 1JZ8A 2HWB2 4Q1RA 5KC5A 3I7DA 3K48A 1O3SA 1LOGA 5CNAA 4KMQA 1AL0G 2WZR3 2ZGUA 5CIRA 4C91A 3LPFA 2VZUA 1AX2A 4FPCA 4LBNA 3RYRA 1CAXB 3DYOA 2FDKA 4JKMA 4K1YA 4XFAA 3MLJA 3CJIB 1I6XA 4PIZA 3N9LA 1ZBA1 1RUE2 3RQ0A 5FZ8A 5F7UA 4META 2QFEA 5T54A 3IMMA 4LBQB 4L8QA 4TZDA 2Y6LA 5GJ6A 4BLJA 2WZR1 1PX3A 5FO7B 4Q8KA 3KV9A 4Q29A 3ILRA 4N53A 1YO8A 1RHI1 1O3QA 1FATA 2CNAA 2DTYA 1VRH2 2LTNA 5GALA 2FCUA 3J8F2 1J1LA 4OMDA 4YM2A 5IATA 2I45A 4JV4A 5FMDA 1XYNA 2G9GA 3U10A 2RHPA 1O3RA 1XNAA 3NL1A 5C9AA 3T2OA 1SMVA 4YVWC 2ARXA 3PTYA 4LOSA 4DXRA 1O4TA 3POGA 1Y9QA 1QIQA 2B7YA 3WCSA 1GZCA 3M7AA 1UPIA 4WVWA 1GWKA 5F5QA 3X29B 2G9FA 2ID4A 2WL1A 2CV6A 5FPXA 5JPMB 1V6KA 3B94A 1QH7A 4CCCA 5T5OA 4FOVA 2NMNA 1HN0A 1IG0A 4NRMA 2RS52 4QU1A 2C1FA 1UIJA 1T2XA 2B46X 2D6OX 2XJPA 1BMV1 3H7YA 4CCOA 4IEOA 4MUVA 2VMDA 4A45A 1R1A1 1JUIA 4N43B 3T2PA 4XJWA 3VL9A 1IGOA 3V56A 2HWE2 1QNYA 2OT7A 4NHYA 3VBFB 1JTZX 5ACA2 2BUKA 2WA4A 2A71A 3JBG3 3VHPA 2XJVA 5C70A 4QKNA 3BODA 3UGFA 5IK8A 2HWC2 3H8UA 2VMGA 2WNVB 1WW5A 3K4AA 1U0AA 3MFAA 3B3QE 4X8PA 3RDIA 2NZ9A 1C8M3 4HETA 2FZ1A 1IQAA 2WQ4A 4IE4A 4OVEA 5CKQA 1PZ9A 1XNDA 4XAAA 1V9U2 4G4FA 2PHWA 4P02B 2PHUA 2BBVA 2EXHA 2ERFA 3JU9A 5FKCA 4GIQA 2FD8A 3AXEA 5SV5A 3PUIA 4FFIA 4YZ2A 5LCWL 2ZZQA 3RJRA 1WLWA 1RUC3 3N9QA 4FTSA 1VBB2 1CONA 1ODNA 2B8MA 2PTMA 2V72A 4MGQA 4BDVB 1K5JA 2NPIA 2H0VA 3C7FA 5L7OB 3CJIC 2YGLA 2IVIB 2BGCA 2VULA 3K3OA 2R0HA 3OTFA 3POBA 3RWKX 3KV6A 4F3JA 3J26N 2XUEA 2ORXA 1XE0A 2YU1A 3H3ZA 2HWF2 5F5IA 1BHGA 1QU0A 4A44A 5HXMA 2W1UA 2CYFA 2OA2A 1RUC1 5FZ4A 3R4DB 1C57A 3WR0A 3WW1A 1FPN3 1MQTA 2WN3A 1GSLA 1TME2 1STMA 4S2DA 5JVVA 5JLVA 4A6OA 1QJY3 4YZ4A 1CAWA 4UF0B 2ZGNA 1YIFA 3TYJA 4CXYA 2J1AA 1VR3A 1XNKA 3NAPB 4DNYA 3KHCA 3LDKA 1LHNA 2W95A 1YQ2A 2SBAA 1CAVB 1VB2A 2W08A 3LOIA 3VB9A 1FPN1 3OBAA 3DKWA 4QU2A 4CDWB 3UGHA 1QJY1 1ALYA 2ZPXA 1VIWB 3A7QA 2D6PA 3JB8A 4Q4X2 4XF4A 1ND3A 1ENRA 5FP3A 4QGMA 4A7ZA 1XBFA 4NJ4A 1LULA 1H8TA 2YY1A 3WXPA 1W99A 1W39A 2D6KA 2R0FA 1XXNA 3WSOA 4COUA 4C1WA 4E8CA 1E5HA 2ADEA 1SFYA 4N43C 5F6KA 2VQAA 1DGWA 4HG6B 5JR2A 3G7DA 2JDAA 4GMP3 4EN9B 3FFQA 2OPKA 3ACGA 3VBFC 1LNSA 2D3RA 1UO9A 3R4UA 4O9GA 3U4SA 3H8RA 1AJOA 1RUD1 4M0NA 4YW1A 3PIGA 1V6LA 2R061 4FAGA 1QF3A 4XBQA 4YW6A 4Z2WA 1YJLA 3H1YA 3ES1A 4EN8B 4SLIA 2WNVC 1GZ9A 4X6QB 1W6PA 5F9TA 2GMEA 2AREA 1JHNA 2C26A 1RYYA 1GP5A 4GMP1 4AI2A 4RGKA 2VOKA 3JB4C 1XNTA 1GQGA 1CX4A 3MIGA 4H3WA 5FWJA 4YW4A 1JU4A 1EPZA 1KFXL 2VZQA 5I0TA 2H0BA 3FC0A 4BXSV 1X36A 4XACA 3ON7A 1YQ8A 1WBLA 2O8OA 5JIAA 3RVHA 4TXWA 1CZSA 1QJFA 5C7GA 1L7LA 5L7OC 4AOCA 1QXJA 3QLQA 1PIV3 4QDQA 3T0BA 2W52A 3I3BA 3U11A 4QPGA 4FAHA 4AHXA 5I0RA 5J09A 4L11A 4DZGA 5IFTA 3KT4A 3ZN4A 3HPNA 3VDDB 4LMFA 4P08A 4CUBA 3WW2A 2PHLA 1BEV2 1LEMA 3AL5A 5E16A 4CEWB 4XUQA 3WHUA 4TWTA 3ZYFA 5D8AB 4Z8BA 2E51A 1NY72 4ASKA 5FLHA 1LR5A 2VG9A 3ZXFA 1BLZA 3WZ1A 4XJ9A 1HXS2 3PNAA 2WNEA 1GYKA 3H1WA 3NAPC 4G9SB 4MGTA 3U4XA 4Q26A 4AR2A 3FHQA 3ITQA 1GZWA 4YNIA 3MPBA 5JUVA 4C0HA 1WA4A 2X53S 3ECQA 4K9SA 4CDWC 3ZFGA 4W8JA 4KU8A 4QKDA 2DCYA 1ACCA 1OKOA 4RR3B 2BJSA 3VZJA 3WCRA 2F6BA 4R8HA 2VOWA 4HFSA 1UY4A 3JXSA 4LHLA 2D5HA 1BJQA 1HX6A 4E4DX 2VJXA 4HANA 5I93A 1HB4A 4YARA 3DUIA 5C4WB 3B01A 3PTRB 1COV2 2D3SA 1RUF2 1VBC3 2Z4FA 1JOBA 2DV9A 5AC93 3ZDSA 3OD4A 3RGBA 3MF6A 1ZRFA 1OPMA 5A3WA 3ZYRA 4CU9A 2B45X 4MGYE 3ZYPA 2XWJB 1LOEA 3ACFA 4OUSA 4DXSA 2R042 3P5BA 2A3XA 2ZXQA 4LA2A 2D98A 3HAGA 3RMXA 2PAEA 3IWZA 1GNYA 3WP3A 3JQWA 3POFA 1N47A 3ZXKA 1OT5A 1SZBA 4R52A 1VBC1 1W8WA 4UFHA 4GWMA 5AC91 1N3QA 4PLMA 1HRV2 2BNNA 4CU6A 3O1SA 2XQXA 1FI2A 2O1QA 1H9PA 3USSA 2BERA 4FPHA 3BUCA 1SQ4A 4AVAA 1PVC3 3FBYA 3T30A 5BNNB 1D7PM 2XOMA 1UN1A 3F2ZA 5GKAC 5HBAA 4QHZA 1VRBA 1ULEA 4XYXA 1J3RA 3JQXA 3ROUA 3ZM8A 2VNRA 3GBFA 4YFWA 3VDDC 1HB1A 4FPKA 1JZ6A 3BU0A 4CEWC 1DHKB 3B69A 1FMD2 4XW3A 2Q8OA 2GU9A 2XLGA 4XUPA 1PVC1 2DCKA 3AB0A 4W50A 1S2KA 4XFHA 5D8AC 5SV8A 4AZZA 5JOXA 1RINA 3PVBB 3FUQA 3RS6A 4AEDB 2VMIA 1AJKA 1UZZA 3AK0A 4Y20A 3EMRA 3D82A 1CESA 1ZREA 3WDUA 3Q8BA 4R4XA 1OC1A 4RQPA 3O1TA 3TBDA 4MADA 4HN0A 2YBSA 4ATFA 4QM9A 4RA0A 4Z2AA 4XF3A 2D93A 3MIHA 3EXUA 4P5HA 2PHRA 4KI5M 5H9QA 1VBA2 1D0HA 2QVSB 4JKKA 5CYYA 2RMU3 1QOSA 3KV4A 4RR3C 4LQRA 4B7EA 4CCEA 1Z7S3 4BQXA 5ANNA 2CHHA 5CADA 4HL0A 5GZCA 2E26A 1W9FA 4LE4A 1CIWA 4HK8A 2A6VA 5AVAA 5H9SA 2G1MA 4IE5A 3VN4A 1JUHA 1IZ3A 3OUJA 2RR11 1OD5A 5GLUA 3VD7A 4K3UA 5DPNA 5C4WC 3MIFA 3ELNA 4MXWA 3LEKA 3KF3A 1LJ7A 1AXZA 4I02A 1D4M3 3LWCA 4LBQD 1ULFA 3GDBA 1Z7S1 1MS9A 5IVBA 1UF2C 2PHFA 1FV2A 1CAXA 3I2HA 1US2A 4XETA 3VBOA 4EN6B 2MHFA 4YW5A 4O61A 2Y26A 2VZRA 5A7WA 3SISA 1GU3A 2QE3A 2WFF2 1D4M1 4N53B 3PIJA 3ZXEA 4PLNA 5A7NA 1OOPA 3AM2A 3WG2A 1IKQA 2YB7A 1G7YA 4Q1PA 2IXKA 5FY9A 4QXHA 4AQ2A 1G9DA 2QCSB 3WG3A 1LTEA 1H1AA 1XYPA 3ZSMA 1LHWA 1PNFA 2ET1A 5BNNC 1CX1A 3VUOA 3USUA 1ZA4A 4UFLA 3RYKA 1SDWA 4FFGA 3I2GA 4DIQA 1KDMA 1Z0HA 3LOBA 4B1MA 1W0PA 3CLPA 3EYPA 3SC7X 1J83A 1FOD1 3D0SA 5LBEA 2GMPA 1W2UA 2C4XA 1AR82 2D3PA 2JE9A 5JIUA 4A3XA 4N7IA 2PFWA 4Q27A 3CHXA 3ZFFA 4ISRA 4ATEA 5FP8A 4XBLA 4AEDC 1NZCA 1KD7A 1W90A 2KM2A 2MEV2 2XQRA 1KRIA 2XHNA 2WT1A 1H0BA 1LHUA 4FP3A 4QPIC 3MIEA 3VZKA 2VXRA 4FO9A 1ASJ2 1HV0A 1WMFA 4HONA 1WD3A 1YI9A 1YRZA 4BJ0A 4LT5A 3WNLA 1WMXA 2DWRA 4DY5A 3VBFA 5T5LA 2VTXJ 4S2FA 3MZHA 1YQCA 4ZS3A 4GH4A 4FFFA 4MO3M 3DEMA 4HKWA 1VAVA 4HKOA 1LOBA 1QJX3 2R072 3BI3A 3WDXA 5LATA 4FP2A 3WP5A 5C3RA 3KF5A 1CPNA 4QD2A 3NQHA 1GR3A 2WBKA 5FZ9A 3HN1A 5FY4A 1JZ3A 4CSWA 3ZSKA 4Q4Y2 1CPMA 5JSRA 1EP0A 1O4YA 3BGAA 3LA2A 5FZMA 5LRRA 5H9RA 1QKQA 1Z78A 2ZHMA 4GALA 1QJX1 2IFRA 4EE2A 2VH9A 3BTXA 1NA1B 4M4RA 5IVYA 4XFCA 2BTVC 4UFIA 5G05L 2V5YA 2VZPA 4HXCA 5LASA 2DUOA 4D3WA 1I3HA 4IXLA 4IGPA 2Y34A 3OBTA 3FLTA 2YUEA 2A1XA 4IQPA 1MQTB 3OB8A 4N53C 2ZHNA 1W0NA 2RDNA 3BPZA 4Z92B 1ZZ8A 4XZUG 1CAWB 4IDZA 1AX1A 1PNGA 2RS13 2W46A 1RIRA 2W91A 3Q8EA 3VKOA 5FZOA 4QQPA 3HBZA 2JE7A 5FZGA 4GJYA 4Q4W2 2ZX4A 3RZMA 4LKEA 1NAEA 1SBFA 2JIGA 1OPOA 4BH9A 2WAOA 4LA3A 4DPNA 1R1ZA 3NAPA 4RGAA 1LAJA 4CEYA 1GWLA 1OLMA 2ZGMA 3PVEA 2HBTA 1MZ6A 3NJXA 5B4NA 1ND3B 3HR9A 1GANA 2F4LA 3ZN5A 4FT8A 1H8TB 2BPA2 1HIXA 4INDA 1U5YA 4Q5OA 2P6HA 2WUHA 4WM7A 4EWDA 2RS33 1UZYA 3WQ0A 5L9RA 4A3ZA 1BKZA 4HT1T 4NVPA 4B8EA 5IK4A 4Y4RA 5IAXA 5L19A 3RZHA 4XJUA 4UAPA 2GALA 3OY8A 2JECA 3FWEA 4A4AA 4PI0A 3POEA 2RJ2A 5D21A 2J1VA 5FBZA 1BBT2 2G19A 2LROA 1RL3A 3D4KA 3SH5A 3VD9A 3IT8A 3NV1A 1ULOA 2RS31 1W6PB 2JEMA 5BYNA 1Y4WA 2VMCA 3L9JT 5DAVA 3CEWA 3T3YA 1W3XA 2J42A 1S4CA 2EXKA 1K12A 5D2AA 2UURA 2XVLA 2LUWA 1ODMA 4XOGA 5I8YA 5GZFA 5FY1A 2W2IA 2XONA 1WKYA 5FP7A 3ZKYA 4NRPA 1HRI2 1MEC2 4COYA 2JJ6A 2BFUL 3M8LA 3ACHA 2Y8KA 3V0AB 1RC6A 2KR2A 3H3UA 4GB31 3ZYBA 1NA1C 1LGCA 4A7YA 2JDUA 3MYXA 4Y1YA 3C2UA 4NHKA 5FXVA 1REDA 1W2TA 1Y7BA 1W2NA 2J1SA 2Q1MA 3TRSB 5I0SA 2JG8A 3GJBA 3AP9A 3SQOA 1LEDA 1MQTC 2EIDA 3NV2A 1OQ1A 4R9DA 5CBLA 1UD1A 2OZ6A 4XFIA 1H6XA 3PMEA 1CJPA 3S7EA 3GCWA 4CEWA 4XCAA 1WW6A 5E8AA 4XJ8A 1DQ4A 1L3JA 3R6SA 5FREA 2XBO3 4QQHA 3ZXGA 2DYCA 2UYBA 3VBUA 1GZWB 1KEXA 5FZKA 5I8SA 3TEZA 3HT2A 5CKNA 2WT0A 1GP6A 3FHAA 4NIAA 3ZFGB 5LEJA 3LSEA 1OBNA 2DVBA 4COWA 1ND3C 4ISQA 3E97A 1VE0A 2YMZA 2HYXA 2BVBA 3KHBA 2XVKA 4RHV3 3O7OA 4ITCA 5KXBA 1H8TC 2ILMA 2XBO1 3FMGA 3LEMA 3ZR6A 3AJYA 2Z79A 4PIYA 5I0DA 4RN5A 3A0NA 3FLPA 1W6QA 4XF1A 1BQPA 1GQPA 4GA9A 5FIXA 5BPXA 5JOYA 4B4PA 1S0FA 1W2OA 2Q5TA 5GLWA 1AYN2 5DXDA 1VALA 1H6YA 1S0JA 2JDPA 4D6SA 2B5HA 1PGL2 5C4WA 1F9KA 1EAH1 3HD8B 3ACLA 1WLCA 5G04L 3TN91 1NG0A 1F35A 5KWRA 1JYVA 1U5XA 4CRQA 4DOUA 5KHKA 2NYYA 3B7MA 5FZDA 3NNJA 5A7SA 1K45A 2WO2A 5H9PA 5CEHA 5FY5A 5FWEA 5CISA 3RZGA 1ST8A 3ZMOA 5BNPA 1HB2A 4CP2A 4DY3A 1X9TA 1DZTA 2V73A 4M3CA 1AX0A 1RMU3 1WCDJ 2XPJA 1LKNA 4AFBA 1G86A 1SG3A 2E33A 3MW4A 2P3YA 5DN2A 5F5CA 5FJHA 5IVVA 3S57A 1PO12 1CIYA 2CAUA 4E2QA 5IUQA 1WZXA 1RUH1 4XF0A 3PUHA 1OFSA 4IEWA 3WDTA 4TLFA 4Y24A 3U75A 2OS2A 4AEMA 1RMU1 4QQOA 2VUDA 5J98B 4B7KA 5JXJA 3BALA 5FMCA 1H2NA 1Y9MA 4FPJA 2CAVA 2EXJA 3VKNA 3RZJA 1ZBA2 1W6MA 3D8CA 1GOGA 3HJRA 2JD9A 4CDQA 2ZHLA 2OIIA 3EHKA 4OCTA 4EROA 4PIXA 2PHXA 2WNUA 4LR4A 5IVFA 3V65A 4Y20B 5AVPA 2K0GA 3FFZA 3F95A 3KWVA 4DUXA 3ZVXA 4OHZA 4FTBA 3BTZA 4RQPB 5DUXA 3UK9A 3ZXDA 2P17A 1YCIA 1RHI2 3WNMA 1SPPA 2AEZA 2V5DA 5LY2A 4D94A 2VZOA 3AZWA 2AH2A 3RZLA 3HQXA 2JDHA 5EV7A 3ZFGC 4QPIA 1RVF3 4CDXB 3WEZA 4ASLA 1RUG2 2VMEA 4L9BA 3MDPA 1QEXA 1UXXX 1QXPA 1PGW2 3MW2A 5F3CA 1OA3A 4ZZ8A 2H6CA 2ADDA 4YM3A 4MYEA 4S2HA 4WVVA 5IAVA 3THPA 4FPEA 4MXWB 2CL2A 4MGSA 4OI0A 1PMHX 2XLAA 2UYAA 4XDPA 2YBPA 4QQ2A 4WZCA 3N3HA 3AYCA 1AYM3 4JCKA 1XC6A 1LESA 1BMV2 4QXBA 5CFCB 1H9WA 2WJSA 2JXAA 4IE7A 1R1A2 1AR63 2X29A 3EB7A 3ETQA 4FPYA 5LB6A 3VBOB 4EV0A 3WNPA 5HV4A 2K46A 1LU1A 4NAMA 3ZYGA 1RB8G 1HJGA 4W6WA 5A7WB 5TSWA 2BW8A 4LOTA 1SLLA 4WM8A 3T1LA 2QBXA 3OEBA 1OOPB 1OKQA 5EYYA 3NSTA 3KSCA 3PURA 5HCAA 3WNXA 2W0XA 1FNYA 4M00A 4AHYA 3HNYM 1AR61 5DUVA 5FZ1A 2DFCA 4YZ5A 4B1LA 2WR9A 1ZZ9A 1MACA 2GC3A 1XQNA 3PLQA 3UJOA 3VBRB 4ZXEA 5F3IA 5FYZA 4DFSA 3USUB 3GJAA 1J59A 4QDRA 1W9TA 2BOIA 2UU8A 1YUDA 4QX8A 5EWSA 2ZMKA 4QPYA 3MHZA 4KWJA 5FYSA 4ET7A 3NNMA 1O59A 1UWWA 4NHXA 2JDKA 1F5FA 4LHKA 1W8OA 2QDNA 4UWDA 3THCA 3S0MA 4LHSA 4MH0E 5IJRA 2J1TA 3GXUA 3SH3A 3E6CC 5CZKA 3ZFFB 1LOCA 1F31A 2VECA 4WV8A 2GNBA 3B9CA 1DQ5A 3RYPA 1EYBA 4AK3A 1R093 4BA6A 1IPSA 1PGSA 4RQPC 4XUOA 4BXFA 3WQBA 2HWB3 1DYKA 1H1MA 5FYCA 5GZEA 1OHFA 5FZ6A 3SEEA 4ZY9A 1OLRA 3CL1A 4DEQA 4FPOB 1BK0A 2DUQA 4GH4B 4QHBA 4OI2A 4CUCA 3FX3A 3KS7A 1TG7A 4CDXC 1JHJA 2OPWA 3H9AA 5FZAA 4MZUA 1R091 2R7EB 2YU2A 4AI1A 4FCAA 1C1FA 5FBJA 2C24A 1WW7A 2IXJA 2GMMA 2HWB1 4OI1A 3WNOA 4RS5A 4XXAA 3AYEA 5HCBA 5C71A 1CD3G 2E63A 2VCCA 3ABZA 3ZXAC 4BISA 2XUMA 1GICA 3ZSLA 4UFKA 4NROA 3JBG1 4EN0A 4GULA 3IIAA 3JUUA 2Q0AA 4J6GA 1VRH3 5F3EA 5AFEA 2WNOA 3J8F3 5EJ3A 4BHPA 3P6BA 5CFCC 3FJSA 3CMGA 4XQWA 1YYNA 4NO4A 3VBOC 1C8M1 4I0AA 4IV3A 5DABA 3E5UA 1LENA 1NA1A 4QMAA 1RUD2 4RFT0 4PF5A 1L7RA 2R062 2WO7A 1RUJ2 5FPBA 1QWRA 2QKDA 1OOPC 2HKXA 1VJ2A 1WGPA 2WS92 1UW8A 2A3WA 4NWWA 1ZZ7A 5FY8A 1UU6A 3J8F1 1EUTA 1LECA 2E7TA 4AHZA 1ZRRA 4GKXA 5FZOB 1SFPA 2RS53 4FXKB 4RYDA 2VZTA 4AXOA 2Y6FA 2YFZA 1UMHA 4IE0A 4I2OA 3VBRC 2XHKA 2GDFA 4ARYA 4Y26A 1XYOA 3RZKA 3C7EA 1JYNA 4CEYB 2HWE3 3PUQA 1SLIA 2OW4A 4Q4V3 4Y3OA 4AI3A 4H7MA 5ACA3 1K42A 2VTFA 1AZDA 5B4XA 2P2KA 1NCQB 2JENA 2VBDA 4BK4A 5FOJB 5HCHA 2RS51 3EJKA 4KBBA 4UBHA 2MNGA 4XMIA 4O65A 2HWC3 1MZEA 4Y5SA 5FYIA 5A3PA 1HB3A 4M0HA 4WM7B 5A80A 3ZFFC 2X09A 2HLEA 3S7IA 4EWAA 4MSVA 1ULDA 3K2OA 3SXWA 1WWYA 1WUVA 1DBNA 1MS4A 2HWE1 3PVOA 3N4MA 1UQXA 2OXBA 3B93A 3ASIA 1V9U3 4Q4V1 4GD4A 1NLRA 3OY8B 4CCMA 5ACA1 5CG9A 4IESA 4XEZA 2Y0OA 4LO5B 4I3GA 1G6NA 2HWC1 3RNSA 4KWKA 2HEWF 5D1IA 2VY0A 4LORA 3U37A 4TYSA 2FHRA 3M3OA 4GH4C 2YDEA 4D8MA 1I5PA 5F2SA 4ZU5A 4BQ2A 3VDAA 2PQSA 2EAKA 1DLCA 4C8DA 1V9U1 2CGOA 2DVAA 1UXZA 1H30A 1DU3D 5HPOA 2WAAA 3KQRA 1LGBA 1JZ4A 4NPLA 4QX2A 5GLVA 1URXA 2ZGLA 1TME3 1BZWA 2RM22 2QTWB 3MO4A 2EIEA 2ZX2A 4QXKA 3ZIXA 3ILNA 1PO22 3NRUA 1MR5A 2E53A 2JICA 4XFGA 1W05A 5L36A 2C5DA 3V0AA 1PX4A 3S30A 2JG8B 5KHJA 1V0AA 5FMOS 2BP6A 1C4RA 1UYYA 4HSJA 4BCUA 4TN7A 1AF9A 2R30A 3TEWA 4YVSA 4Q4X3 4QAWA 4LKFA 1YHFA 3ZDVA 5IYYA 4MGZE 3JD73 1W6OA 1OVSA 1PIV1 4XBNA 1F15A 3VBUB 5FPZA 2W5FA 1MVEA 4UW5A 3I4IA 1W0OA 2C9AA 2QQIA 4C90A 5AC92 4ZHNA 3RZZA 3A4UA 4H14A 2XLFA 4W6YA 2RG4A 1NE4A 4AYUA 4B29A 4PBOA 5E1RA 4CEYC 2CDPA 2X8KA 1N1SA 3N9OA 1EV13 2BFUS 1JZ5A 5JZGA 2VUJA 1NCQC 4XUTA 1C28A 1JXNA 1POV0 2FDJA 2VOVA 2OUHA 4LBJA 1JYIA 1TMF2 3DXTA 3JD71 1XSQA 2JG9A 2WKKA 3AKPA 4WM7C 1W6QB 3PHMA 5C3OA 4IGOA 1L7QA 3AP5A 2HJIA 2LRPA 2V09A 3WF3A 2C6SA 3RSJA 1MS8A 3KT7A 3NVCA 4H7LA 1FV3A 1CR7A 3IM0A 4CUAA 3EQEA 5F3GA 1EV11 4XUNA 1U12A 3GALA 1ZA7A 1LODA 3NO8A 4YGCA 4P9GA 2WABA 5JMOA 4HOOA 2VZSA 4U36A 2JDYA 4NPMA 1R082 3HQRA 3N7MA 4UFJA 1O5LA 4D7TA 2EICA 2FDIA 1Y9GA 1OF3A 1WCSA 3H3LA 1X8MA 3IZOA 4K21A 2OKXA 4R9AA 3I49A 1O8PA 4NR1A 5BNPB 1V6IA 3I3MA 3WX5A 1FT9A 2QQKA 4M3CB 2VCBA 3KV5A 5FV3A 1DGWX 4A42A 1BEV3 1NQDA 3L2YA 2Y6KA 1TZOA 3BB6A 1MS5A 1XJAA 4R9BA 2BYVE 2PLV2 3POSA 4PI2A 3VZOA 3CBNA 1FXZA 3JCIA 4FOQA 4Q0SA 3RI8A 2RR12 5FYTA 2Q8DA 5BNOA 1GWMA 1HXS3 3VHRA 5A1LA 5JWPA 1V6MA 2JB4A 1BEV1 3I2KA 2DCZA 4NIIA 1QJU2 2JG8C 3BU7A 1ZRCA 3HOBA 3LEGA 3K75B 1Z7S2 1T6BX 1W6MB 3OGJA 2VZ3A 3HNBM 4P9WA 2ZGQA 4CDQB 2PHTA 3LB9A 2ZCWA 3ZMNA 5A3TA 2WNUB 3N36A 2WWSA 1Q5OA 2ZX3A 1HXS1 5APAA 1C5HA 4GWIA 1RUOA 2VCAA 1LCLA 1NQJA 2B9UA 1NZIA 1AHSA 4W65A 1MZ5A 5FZ3A 1Y3TA 4JDNA 3VBUC 5CG8A 4BQ3A 1D4M2 1GKBA 5A6QA 2DTWA 5HV0A 1SPPB 4QQLA 2GH8A 1N3OA 2ZX1A 3GZAA 3CDZB 5FOBB 1COV3 3POJA 3TEXA 3R0RA 4I09A 1RUF3 1MS1A 4P9IA 4QPIB 3ZLIA 4CP1A 5LEKA 3V0BB 5DG2A 3WDVA 4AGGA 3POIA 2QQPA 4YRDA 1X7NA 4BWOA 5GZGA 2FMDA 1CQ9A 1QY4A 1ZBE2 5LWBA 1CN1A 1VBD2 2BOJA 2JB8A 2WQ8A 5CU1A 1E57A 1GUIA 5IW0A 1DQ2A 1KFUL 4CDXA 2Y64A 5A6ZA 3AFGA 3LA7A 4KG0A 4JGZA 4AFDA 1RUF1 1JZ7A 1DG6A 1FOD2 4FOWA 3BVCA 2IXHA 4ZS2A 3AMNA 2JDNA 1DYOA 5BNQA 1DZQA 1TEIA 4RSUA 4YM0A 4ZONA 1OSGA 5FYHA 1RGSA 2GNDA 2RMU1 4FQZA 5EP9A 4AVSA 5FQ0A 2W1QA 5CAZA 3WV6A 3N35A 1K5MB 1YQ6A 2GZWA 5CFCA 2Z42A 2BNMA 4XTMA 1R64A 4WM8B 5C5TA 2Q30A 5BNPC 1ENQA 2HWD2 1CAUA 4AVCA 1UMIA 5IK7A 4JC1A 3ZN6A 1JODA 1FMD3 2IXIA 2G9ZA 4CPBD 3W21A 2PYTA 3I59A 5C3SA 5DDJ2 2BV4A 3MPPG 3J9SA 1O6UA 1RUNA 3PVNA 2W39A 4FQ4A 3MLLA 2D5FA 2WWUA 4LO7A 3WQ1A 4F8AA 3VBRA 4TLGA 1DGLA 3RPQA 1ONAA 1HV1A 3WP6A 1W8ZA 1J3PA 4CPBA 4IV1A 3U78A 1XRUA 1VBE3 3GM8A 4OI4A 1VBA3 2AR6A 3T08A 4CDQC 1JYWA 1W8NA 1JS9A 4Q0PA 3T2QA 2WNUC 3O1PA 4MHRA 2XH6A 4JGYA 4QB2A 1RJ8A 1DYPA 4XDOA 3UYJA 1SHWB 1XB9A 1AXKA 4LXLA 2XJUA 3GNEA 2RJKA 2A6WA 1NX9A 1F4HA 2VTXA 3W58A 4OHYA 2A70A 3H8OA 2XB6C 1VBE1 1VBA1 3H50A 1UOBA 3ACIA 2DU1A 3SCHA 1QXRA 3AC0A 5K4LA 4LUKA 5DAPA 3TOJA 1IQDC 2NN8A 3FBMA 4C1XA 3KLSA 4LNVA 3WUDA 1VAKA 1BYHA 1SLBA 4E9KA 2FDGA 5JOWA 4RS5B 2ZBJA 4QDSA 2D44A 2A5ZA 4CE8A 4QB6A 2Q1ZB 4X8NA 1WA6X 3VKMA 5FP4A 3MUZ1 1QJEA 4QKBA 3NNFA 1PVXA 1TVGA 3BYWA 4OULA 2D6NA 4Q0QA 2C0ZA 4LIUA 3B02A 3AZZA 5A33B 2XDVA 2EA7A 3ALQA 2ZKNA 3MFCA 5C5UA 2W68A 5LY1A 1O91A 3LD8A 3O1VA 1AR93 4AE2A 2E32A 2OX0A 2ZEYA 3R4SA 4IV3B 5FCCA 1GP4A 1W06A 4CVUA 4UW6A 3ZYJB 4XCBA 1K5MC 4XJZA 4UBGA 1W8HA 1G9CA 3ST7A 1PM7A 1U5ZA 2JD4A 2B42B 1W28A 1ULGA 4MV2A 4WM8C 4KG8A 4XAEA 4HKLA 1UZWA 1RUI2 4JVAA 1Q8OA 2RJLA 4TTGA 1W03A 3IPVA 1UY1A 4HPKA 2PN5A 2RS32 1HLCA 1X50A 2GNMA 2QQOA 3O0VA 5FJKA 5ISLA 3O1MA 1AR91 4DINB 4ZZ5A 3W5NA 4RD7A 3T2TA 4HMZA 3DKQA 3Q8AA 3LCPA 3O1RA 3KCYA 1NUKA 1WCQA 3ZXJA 1UU5A 5EXOA 2IFWA 1SACA 2ZS6B 3INAA 1KJLA 2MEV3 3B00A 3THTA 1Q8QA 2P34A 1QGLA 4N9HA 4BK5A 1NOVA 4D0QA 3M3EA 1ASJ3 2UWCA 1JW6A 1AR72 4GB32 1QDOA 4HN1A 2QQWA 2RS11 2YROA 5FYBA 3AKTA 3M3QA 1NCQA 5E6HA 4P9LA 1G9BA 2MEV1 2R073 3IKWA 2YC2A 4OLLA 3HQUA 2LS6A 3H8XA 1ASJ1 5C33A 4XIOA 4LK7A 3H7JA 2WSVA 3M4FA 4AFMA 4P9JA 5IVJA 5LK7B 1MZFA 4DXTA 2XGXA 1OUXA 4Q4Y3 4RFRB 3VBSA 2PHDA 4YG0A 5A3OA 3VHOA 3NV4A 4CP0A 4BQYA 4LO8A 3GHNA 3ZYIB 1DLLA 3A23A 5BUVA 1QH6A 1UL9A 5FMOL 1XNBA 1QOTA 2BWAA 2CGNA 2R071 4JRLA 2W9XA 4XHXA 3VD5A 5LW9A 3U14A 3WT3A 2CU5A 4RS5C 4H2AA 3DV8A 5EFUA 5FYMA 1JZ2A 1B09A 2YBKA 3VV1A 5EQUA 3WG4A 3BTYA 1ZZ6A 1H2MA 2VGDA 2WZ8A 4JDMA 1SLCA 2D6MA 2XBO2 1AL22 2ETEA 3G6JB 3K77A 3IDAA 3NW4A 1H2KA 4HVRA 4XDQA 3WNKA 4S2GA 2P4EA 5F5AA 5I91A 2ZGRA 3VL8A 2YXSA 3OSDA 1LHOA 1Q8SA 4IV3C 4Q4W3 4AW7A 4EZHA 2XMLA 1V00A 4PDWA 1LGNA 2JWPA 4YZ3A 2DBIA 2J1UA 4KNCA 4CTEA 3OJBA 1TQ5A 1LHVA 1EAH2 1DQ6A 2P37A 2JE8A 3ATGA 1CJDA 4YVSB 3K4ZA 3TN92 5FDBA 4AVTA 4IEQA 4K8FA 3GHMA 1HJFA 1SCRA 4OHWA 4JHZA 2P3IA 2VVDA 4Q4W1 1W6OB 3A0KA 4BE3A 1B35A 4FXGB 2GSYA 3GZEA 4EJRA 1XU2A 2IUWA 1W6NA 2DU0A 2LM3A 3BPSA 1WCUA 4V1PA 4K8RB 2WIIB 1OURA 4QX7A 1ND2A 2PAMA 2YPJA 3SLIA 2TEPA 2FMYA 4XABA 3VD3A 5JZGB 2BEOA 4NUBA 3ZSEA 2DBNA 1BBT3 4OUMA 1OXCA 4AI9A 1C8NA 1Y43B 3PMSA 4PF1A 2JG9B 5JI9A 1BK1A 2OUJA 2UY9A 1RUH2 1OH3A 3GZUC 3D3AA 2WLQA 5FMBA 1Q43A 2BZDA 1RMU2 1D0GA 3KB5A 4YZ1A 4I0BA 3FZ3A 1HKDA 4IEZA 5LA2A 5F1RA 3HVDA 1O8SA 1BBT1 1FYUA 4IEVA 4I0WB 3HN3A 2R32A 1JU3A 2Y6HA 3ZFEA 2WSUA 3E1F1 4HZFA 2W47A 4DXZA 2A73B 2YC4A 4RL7A 4XIKA 1MEC3 3P3PA 4RHV1 4XE9A 4FSJA 5EZWA 5A7PA 3SMHA 3VKFC 3WOGA 3O5SA 4MLOA 3DXUA 1UOJA 2G4IA 4YSFA 4AF9A 5JI7A 1SEFA 1QNWA 1QQP2 1X9PA 3C3VA 1GOFA 2GC1A 3CJXA 4GKYA 5FZ7A 4AWDA 1ENSA 1X33A 1MEC1 5KR7A 5IWFA 5B2GB 2ORZA 2BDRA 2XL7A 3OD0A 4YGEA 2DCTA 4ZXKA 4Y1VA 2OQ6A 2FQPA 3DECA 3JZVA 3LA3A 3E5QA 5BNOB 4JQRA 2XXZA 4YWAA 2JDZA 2DVGA 1DDLA 1QHDA 4LEJA 3PL0A 4J1XA 4Y22B 3IDBB 1W9SA 4LBOA 4AGVA 1EPWA 4Z1VA 3HEIA 5EHDA 4FBFA 1LRHA 1YFYA 5C3QA 2FCTA 4IEPA 3AKRA 4YVSC 5FLIA 4LIVA 2BQPA 2W1WA 2VBBA 3WDWA 2VAUA 1E5RA 4JX0A 3J4UH 2GP5A 1PMJX 4JTNA 3UKNA 3HMYA 5CA6A 1MS3A 5ABJA 4M3CF 5KXDA 1VMJA 4E8DA 3QCWA 3M2MA 1XNCA 2DF7A 2ZA9A 2QQUA 3QOPA 1OVPA 3LEIA 1DZRA 1CGPA 2WZR2 2Q1FA 3RG0A 2VVEA 2WYFA 4FI9A 5A70A 4KQ7A 1NLSA 1Q8VA 3O1OA 1CWPA 1X82A 2ZMNA 3HT1A 5I0UA 3NKGA 3WLUA 3LE0A 5JZGC 1UY0A 4AAPA 2GN3A 5LA1A 2AACA 3BOPA 4P14A 1UYPA 2ZGOA 1UX6A 3IBMA 4YLZA 4BYYA 2WQZC 2JG9C 4EN7B 5FZ0A 5HCFA 4L0PA 3V0BA 1SBDA 1UKRA 5FZHA 1IG3A 1LB2A 2GAUA 5FR3A 3QBQA 1KJRA 4JGZB 3UGGA 2ZGPA 2BRTA 2J22A 3S5AA 1FAYA 2E6VA 1YIPA 4LK6A 1PGL1 2WO1A 4CU7A 2ZMLA 1FNZA 2K9ZA 4PHZA 5FP9A 3IDCB 4UXAA 3ENRA 1VAMA 1RVF1 2VCMA 1UX7A 5FQ0B 4AI8A 2NQYA 3HIFA 2TNFA 3AZYA 2B4KA 3KCCA 2Z5WA 3W9AA 1SLAA 3AYDA 4L97A 1CAUB 2OYZA 5FYUA 4EZ4A 3NJYA 1PK6B 3VBHB 5CFDA 1K5MA 1WLDA 3QACA 5LZ6A 2VW1A 3ZN6B 4E4HA 1NXMA 1ULPA 1TNRA 3I59B 1EUUA 3AFKA 1AYM1 2PMWB 5FXZA 1ZBA3 5GLTA 2X05A 5LA9A 4HVQA 4BIOA 3DYMA 5JXIA 5M0TA 4NN0A 4GJZA 5BNOC 4K7JA 3QD6A 2MPFA 5EIYB 4QHOA 1G9AA 2EIGA 1A6CA 2GC2A 3J7HA 2WN2A 3JBG2 3T4VA 1RHI3 2YGMA 2B9VA 1NLQA 4IV1B 1S0CA 3CF6E 3RI9A 4AVBA 3LQCA 4LLFA 4D7YA 1C8M2 4JGYB 5DZGA 4NIHA 1RUG3 1YQ5A 3LFMA 3LF7A 5T50A 3ORJA 3AYAA 1OQDA 3E6DA 3OYWB 4L2NA 1BVVA 4YG3A 4FPFA 2P3KA 4GMP0 1KITA 3I2IA 4KL1A 5DAWA 2R16A 5LBFA 2WO3A 4P9YA 1HDKA 4HVOA 1RUC2 2E7QA 1O3TA 3WQ7A 1DQ1A 4BQ5A 4E4ZA 1RUG1 2D43A 3MICA 5J36A 4J1WA 4ORFA 1PGW1 4YW7A 1CVNA 5EPAA 3VHNA 3UNPA 4IEYA 4E27A 4AL9A 1R1A3 3H42B 1S2BA 3N9MA 2IZWA 2EIBA 4GZ9A 2JKXA 4N8MA 1HQWA 1RUE3 3KGLA 5CKMA 4JGZC 4GAZA 2Z69A 1FPN2 4Z07A 4K1ZA 4CCDA 2ZEZA 2HH9A 5C8CA 1WMEA 2JIJA 4AEKA 1QJY2 1DQ0A 4Q2FA 5T55A 1TE1B 2UWAA 2VUAA 3L2HA 1YEWA 1UCXA 2R1BA 4PJYA 1F4AA 3ZPOA 4XXPA 3WW4A 1D2QA 2XWBB 1CZVA 3BN6A 5IFPA 3WINE 5EYXA 2ZAHA 2Y6GA 5A33A 4Q4V2 1RUE1 2VW2A 3CZUA 3ZIWA 1T6GC 1UNBA 1XSRA 2Q4SA 2Y60A 1JBCA 1JMUB 4R4ZA 4FTEA 4N90A 4QPWA 4V2WA 5A32A 1PK6C 3VBHC 3OF1A 4BZ4A 3IPVB 4HPKB 4OFGA 3MIDA 1SFNA 2FDHA 2FZ2A 2Z2SB 5JR7B 3WF4A 1VRH1 2A75A 3I3DA 3IAPA 3OBRA 3KGZA 3LDRA 4LTAA 3UV9A 5KBFA 4CCLA 1A3KA 2YFUA 5FRAA 2AUYA 4BQWA 4IEXA 3GYDA 3LIGA 3ZPYA 3LDBA 2ZACA 3UETA 3HBKA 1LOAA 3EBRA 4PCRA 4LBKA 3KVBA 2VPVA 4JTOA 2A6XA 4OZXA 4AI0A 2QJVA 4IV1C 2ZAAA 5L73A 3SKVA 3WF2A 4AEJA 4E2SA 2F4PA 1V70A 4C0BA 4GWJA 2ARCA 5DZFA 5LRSA 2F17A 2NLRA 2YPDA 3LIHA 4JGYC 3O1UA 3BIWE 4QT6A
chains in the Genus database with same CATH topology
5FZ3A 4NUBA 5LY1A 3LD8A 4AI9A 2PXJA 2OX0A 5FZDA 5A7SA 4E4HA 2GP3A 5CEHA 4ASKA 5FUPA 5FY5A 5FWEA 5FXZA 5IVBA 3ZLIA 4Y33A 5FZIA 3N9PA 4GJZA 4BXFA 4EYUA 3N9QA 5IVCA 5FYCA 5FJKA 2OQ7A 5ISLA 5FZ6A 5LWBA 5A7WA 5FJHA 3K3OA 5F5CA 5IW0A 5A7OA 5IVVA 3KV6A 5A7NA 4TN7A 4Y4RA 2XUEA 4BU2A 3AL6A 5FY7A 2YU1A 5FZAA 5F5IA 5FY9A 4QXHA 5A7PA 5FZCA 2YU2A 5KR7A 2OS2A 3DXUA 4LITA 4V2VA 5FBJA 5FZ4A 3K3NA 2VD7A 3OPWA 5F2WA 5FZBA 4QWNA 4BISA 3PTRB 5FYHA 3N9NA 4D6RA 5FYYA 4DO0A 5F39A 4UF0B 5FZ7A 5FYBA 4DIQA 3AVRA 5IWFA 2Q8CA 5IVFA 5F3EA 5A3WA 5E6HA 4D6QA 3N9OA 2OQ6A 5F37A 4EZ4A 2WWJA 3PU8A 3DXTA 2XXZA 5FY1A 2W2IA 5FXXA 5LY2A 5FP7A 5IVJA 5FP8A 4IGOA 3N9MA 5FPLA 3N9LA 5ANQA 5F32A 3PUAA 3KVAA 5FPBA 5FY0A 5FP3A 5FZ8A 5FZFA 4GAZA 2P5BA 4LIVA 5F3GA 5FY8A 5FPUA 5FXVA 4CCJA 4HONA 5F3CA 5LW9A 2WWUA 5FZOB 2GP5A 5FPAA 4HOOA 3KV9A 5A3NA 3ZPOA 1VRBA 5FYMA 3U78A 2YBKA 3U4SA 4XDPA 2YBPA 5A7QA 3PUQA 4QXCA 4Y3OA 4QXBA 3PDQA 4CCKA 5FZ9A 4V2WA 4XDOA 5FV3A 5FY4A 3KV5A 5F5AA 5FXWA 3UYJA 4CSWA 5FZKA 4AAPA 4LXLA 5FYIA 5A3PA 5FZMA 4EZHA 4UF0A 5A80A 2XMLA 5FZ0A 5A7WB 3K2OA 4CUGA 5A1FA 5FWJA 5FZHA 4IGQA 4CCLA 5IVYA 5K4LA 4QU1A 5FYVA 3PURA 4CCMA 4GD4A 5FYTA 2Q8DA 2YBSA 3LDBA 4CCOA 5A1LA 5IVEA 3RVHA 3PUSA 5FZ1A 4IGPA 4URAA 3KVBA 5FP9A 5FZEA 5FPVA 2OT7A 5F3IA 5FYZA 3KV4A 5F2SA 3PU3A 4D6SA 5A3TA 5FP4A 3OPTA 4QX8A 4C8DA 5FZOA 5FUNA 4QX7A 2Q8EA 5FZGA 3AL5A 2YPDA 4GJYA 3AVSA 4LIUA 5FYSA 5FZLA 4CCNA 2XDVA 5FYUA 3NJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZ3 A;  4NUB A;  5LY1 A;  3LD8 A;  4AI9 A;  2PXJ A;  2OX0 A;  5FZD A;  5A7S A;  4E4H A;  2GP3 A;  5CEH A;  4ASK A;  5FUP A;  5FY5 A;  5FWE A;  5FXZ A;  5IVB A;  3ZLI A;  4Y33 A;  5FZI A;  3N9P A;  4GJZ A;  4BXF A;  4EYU A;  3N9Q A;  5IVC A;  5FYC A;  5FJK A;  2OQ7 A;  5ISL A;  5FZ6 A;  5LWB A;  5A7W A;  5FJH A;  3K3O A;  5F5C A;  5IW0 A;  5A7O A;  5IVV A;  3KV6 A;  5A7N A;  4TN7 A;  4Y4R A;  2XUE A;  4BU2 A;  3AL6 A;  5FY7 A;  2YU1 A;  5FZA A;  5F5I A;  5FY9 A;  4QXH A;  5A7P A;  5FZC A;  2YU2 A;  5KR7 A;  2OS2 A;  3DXU A;  4LIT A;  4V2V A;  5FBJ A;  5FZ4 A;  3K3N A;  2VD7 A;  3OPW A;  5F2W A;  5FZB A;  4QWN A;  4BIS A;  3PTR B;  5FYH A;  3N9N A;  4D6R A;  5FYY A;  4DO0 A;  5F39 A;  4UF0 B;  5FZ7 A;  5FYB A;  4DIQ A;  3AVR A;  5IWF A;  2Q8C A;  5IVF A;  5F3E A;  5A3W A;  5E6H A;  4D6Q A;  3N9O A;  2OQ6 A;  5F37 A;  4EZ4 A;  2WWJ A;  3PU8 A;  3DXT A;  2XXZ A;  5FY1 A;  2W2I A;  5FXX A;  5LY2 A;  5FP7 A;  5IVJ A;  5FP8 A;  4IGO A;  3N9M A;  5FPL A;  3N9L A;  5ANQ A;  5F32 A;  3PUA A;  3KVA A;  5FPB A;  5FY0 A;  5FP3 A;  5FZ8 A;  5FZF A;  4GAZ A;  2P5B A;  4LIV A;  5F3G A;  5FY8 A;  5FPU A;  5FXV A;  4CCJ A;  4HON A;  5F3C A;  5LW9 A;  2WWU A;  5FZO B;  2GP5 A;  5FPA A;  4HOO A;  3KV9 A;  5A3N A;  3ZPO A;  1VRB A;  5FYM A;  3U78 A;  2YBK A;  3U4S A;  4XDP A;  2YBP A;  5A7Q A;  3PUQ A;  4QXC A;  4Y3O A;  4QXB A;  3PDQ A;  4CCK A;  5FZ9 A;  4V2W A;  4XDO A;  5FV3 A;  5FY4 A;  3KV5 A;  5F5A A;  5FXW A;  3UYJ A;  4CSW A;  5FZK A;  4AAP A;  4LXL A;  5FYI A;  5A3P A;  5FZM A;  4EZH A;  4UF0 A;  5A80 A;  2XML A;  5FZ0 A;  5A7W B;  3K2O A;  4CUG A;  5A1F A;  5FWJ A;  5FZH A;  4IGQ A;  4CCL A;  5IVY A;  5K4L A;  4QU1 A;  5FYV A;  3PUR A;  4CCM A;  4GD4 A;  5FYT A;  2Q8D A;  2YBS A;  3LDB A;  4CCO A;  5A1L A;  5IVE A;  3RVH A;  3PUS A;  5FZ1 A;  4IGP A;  4URA A;  3KVB A;  5FP9 A;  5FZE A;  5FPV A;  2OT7 A;  5F3I A;  5FYZ A;  3KV4 A;  5F2S A;  3PU3 A;  4D6S A;  5A3T A;  5FP4 A;  3OPT A;  4QX8 A;  4C8D A;  5FZO A;  5FUN A;  4QX7 A;  2Q8E A;  5FZG A;  3AL5 A;  2YPD A;  4GJY A;  3AVS A;  4LIU A;  5FYS A;  5FZL A;  4CCN A;  2XDV A;  5FYU A;  3NJY A; 
#chains in the Genus database with same CATH topology
 4BLI A;  3TAY A;  2I74 A;  1GLH A;  4MGK E;  2GP3 A;  4EWE A;  1VMH A;  4CDU A;  1REE A;  1US3 A;  1DGR A;  2VC9 A;  1V6O A;  2XJQ A;  4DMI A;  1YI7 A;  3D5O A;  3VBS B;  2VOX A;  4KGQ A;  4Y33 A;  3RRD A;  2XL9 A;  4O9E A;  4Q8L A;  1GFF 2;  2Y38 A;  3DL3 A;  4P00 B;  3FN9 A;  1PIV 2;  3C8X A;  2P1B A;  4B4Q A;  1E5S A;  1VBB 3;  2ZJC A;  1DGR N;  4OQ9 A;  2X5I A;  5FKB A;  4AQS A;  1E5I A;  5A7O A;  4YYO A;  1V6N A;  2Y33 A;  3FHI B;  2AZ5 A;  4BU2 A;  3H1M A;  5FO9 B;  5FY7 A;  3J7N A;  1J1T A;  1RUD 3;  3MF9 A;  2R06 3;  1LU2 A;  2HWF 3;  1RUJ 3;  3T4H B;  2KD7 A;  2PAK A;  2PEL A;  2WS9 3;  4BQ1 A;  3JD7 2;  1W3V A;  2KXL A;  3C7H A;  1OLM E;  4BPZ A;  1TNF A;  3KQ4 B;  2CDO A;  3R05 A;  1VBB 1;  4D7S A;  3BOW A;  3UKT A;  5C3P A;  1MVQ A;  3MLK A;  2XJT A;  4B4R A;  4LLO A;  4XMA A;  4PDW B;  2VOT A;  3AMM A;  4JZR A;  4WVZ A;  1EV1 2;  1VB4 A;  4BB3 A;  5KHG A;  2WFP A;  1GBG A;  2ARB A;  2HWF 1;  1RUJ 1;  2YV8 A;  3WG1 A;  3WDY A;  5DQ0 A;  2WS9 1;  2WRA A;  2WWJ A;  4UT5 A;  2SLI A;  4CZS A;  3KT1 A;  5J1X A;  1TME 1;  2P6C A;  3FUO A;  1UPS A;  1B35 B;  5FY0 A;  3KVA A;  2ZZJ A;  4LPL A;  1W6N B;  5FZF A;  5KHH A;  4PLO A;  5AFB A;  4WVM A;  1JI6 A;  3UJQ A;  4Y4Y A;  2UWB A;  4CXX A;  1NCR A;  3EO6 A;  1APN A;  1YFW A;  1ND2 B;  1VBC 2;  1S0G A;  1QDC A;  2CGP A;  2AYH A;  3IAQ A;  3QH7 A;  1IHM A;  3FE5 A;  3NKT A;  1WCK A;  2R1D A;  4Q4X 1;  1YFX A;  5A7Q A;  3UT0 A;  5K0U B;  1Q3E A;  3RMY A;  4CP9 A;  2CWS A;  3MUY 1;  4DUV A;  2V4V A;  3MV0 1;  1F5J A;  1YNA A;  4AGR A;  4YG6 A;  2XVG A;  1YC6 1;  3KZ4 C;  1G9F A;  2J7M A;  2IC1 A;  3NJV A;  4MHU A;  1KXG A;  1OFN A;  4URT A;  3VZL A;  4QX1 A;  3ZFE B;  3A21 A;  2X10 A;  3VBS C;  4Y1X A;  2RM2 3;  1PM4 A;  3OGG A;  2VL4 A;  1DFQ A;  1PVC 2;  2VMH A;  4U2A A;  1H4G A;  2DCJ A;  2ZX0 A;  4ZU4 A;  3DCQ A;  2BU9 A;  1PO2 3;  2VXJ A;  5JXH A;  5GM0 A;  5CB7 A;  4SBV A;  4BM8 A;  1PZ8 A;  3AP4 A;  2BGP A;  3ZX7 A;  2VQ0 A;  1XE7 A;  2RM2 1;  2BGO A;  5KXC A;  3LPG A;  5FZL A;  1XE8 A;  3ETP A;  2VUC A;  1PO2 1;  2WT2 A;  4NHM A;  2QZ2 A;  4DS0 A;  2WLP A;  1LOF A;  5KHI A;  2K2S A;  4JDO A;  1A8M A;  4PDW C;  4BMB A;  4DEV A;  4UYB A;  3TWI A;  4NHL A;  2W3J A;  4PQQ A;  4MG2 A;  2PQQ A;  5FZI A;  2QUO A;  2UY8 A;  4ONU A;  4EYU A;  4Y22 A;  5IVC A;  5J7M A;  5JCT A;  1ZRI A;  2I2S A;  2RMU 2;  2E7A A;  3S5Q A;  1S0D A;  3D6E A;  1GZT A;  1TMF 3;  5ABJ B;  3SNM A;  1B35 C;  4XQ4 A;  1NY7 1;  3OGS A;  1N1V A;  1W04 A;  2GH2 A;  3B9I A;  1OH4 A;  3E6B A;  3W59 A;  4A7K A;  4D69 A;  5HXV A;  2VO5 A;  2ET7 A;  3BCW A;  3MEP A;  1DF0 A;  2O14 A;  4LIT A;  4V2V A;  3I2F A;  1ZZC A;  1ND2 C;  1F8V A;  2VD7 A;  1U5I A;  3AZX A;  2GN7 A;  5JOZ A;  3OPW A;  3URF A;  1O4Z A;  3I2D A;  1TMF 1;  2W92 A;  1FX5 A;  3OBZ A;  3AMH A;  4M3C E;  5ERL A;  5FYY A;  2AGS A;  1WBF A;  1WMD A;  1OQE A;  3FL7 A;  2A7A A;  4XZP A;  1R08 3;  4XC9 A;  2Q8C A;  3W20 A;  4BOW A;  5K0U C;  1ENX A;  5EJ1 B;  3TNQ A;  2HEV F;  2WA3 A;  1OA4 A;  1XU1 A;  1DP0 A;  2NMO A;  4NAO A;  1IS5 A;  4YVW A;  1VPH A;  3D0J A;  4COV A;  3N7K A;  2R04 3;  5BV6 A;  1O7F A;  4P9X A;  5FXX A;  1ZVF A;  1RTV A;  4I3P A;  5JPN B;  4E2G A;  3NV3 A;  5FPL A;  1UMZ A;  1COV 1;  1Q56 A;  3ZFE C;  2W1S A;  1D4V B;  3III A;  4NRQ A;  1IS6 A;  1RJ7 A;  1R08 1;  3M3I A;  4R9C A;  5F32 A;  5DG1 A;  5GLZ A;  3W5M A;  4IW3 A;  3ZO0 B;  2ZGT A;  2PLV 3;  1HRV 3;  2P5B A;  5FPU A;  4K40 A;  3TEY A;  1JOJ A;  4M01 A;  2VBP A;  3CZJ A;  4XFB A;  3VKL A;  1BVP 1;  3AMP A;  2AEN A;  1DCS A;  5FPA A;  4A6S A;  1QJZ A;  2R04 1;  3B5L B;  4Y1U A;  2RR1 3;  3OGR A;  4IET A;  3T0D A;  1C5I A;  3T1M A;  2DUR A;  2A3Y A;  5DZE A;  3CKH A;  4ASM B;  1VBE 2;  3O0X A;  4BME A;  5CFD B;  2RV9 A;  5JDB A;  5FTT C;  5K9Y A;  1QJU 3;  1UZ0 A;  4Z82 A;  1AXY A;  1F2N A;  5DMY A;  4DUW A;  2PLV 1;  1HRV 1;  3DPR B;  1POV 3;  3N7L A;  1PK6 A;  4P5Y A;  4Y5Z 0;  2R49 A;  5L9B A;  3VBH A;  1ZZB A;  2ZKL A;  1YFU A;  4LO4 B;  1A34 A;  2ATF A;  1W2A X;  1VMF A;  1NXD 1;  1YJK A;  2FBE A;  4UW3 A;  4DRR A;  3DN7 A;  1VP6 A;  3KMH A;  1QJU 1;  4XQD A;  3WUC A;  2WYS A;  3ZOI A;  1H8V A;  1POV 1;  4QGN A;  3E5X A;  3U0Z A;  2A6Y A;  1W8T A;  3WD5 A;  1DIW A;  1UOF A;  4CXW A;  1FMD 1;  1NT0 A;  4OHX A;  3LSD A;  3PUS A;  2YG0 A;  3P3N A;  4A41 A;  3CJI A;  4URA A;  1QJX 2;  3I8T A;  2KA3 A;  5ABJ C;  1UOG A;  3MBW A;  1ZBE 3;  4W4Z A;  4YW2 A;  4EQV A;  3AKS A;  1NE6 A;  1VBD 3;  5T5P A;  2XKO A;  2RDQ A;  4LBQ A;  3V64 A;  4GXL A;  1OA2 A;  4IEU A;  3ME2 A;  4CU8 A;  3OYW A;  3ZXL A;  2EXI A;  3AVS A;  5DUU A;  1FOD 3;  1AR9 2;  4XF9 A;  2VW0 A;  4XJA A;  4JHT A;  1SCS A;  5C9A B;  4ZPI A;  2PXJ A;  1G8W A;  3SCG A;  1IS4 A;  1RIT A;  1N1T A;  4PT6 A;  2DVF A;  1ZBE 1;  2QQV A;  4TSV A;  5FUP A;  1VBD 1;  3I97 A;  1POQ A;  1SBE A;  1HQN A;  2C9K A;  2VR4 A;  3KD4 A;  3P1I A;  1UYZ A;  1JOP A;  1UY2 A;  3GF6 A;  3NWK A;  3O12 A;  2WIN B;  4YFZ A;  5EJZ B;  2DFB A;  5JMC A;  4OUE A;  5C8C B;  2HWD 3;  3QH6 A;  2HBU A;  2IXL A;  3MI8 A;  4K6B A;  4PBP A;  2RDS A;  4LUM A;  2DVD A;  1PZ7 A;  2RS1 2;  2QDR A;  2WFF 3;  3DF0 A;  3CIH A;  2TBV A;  2VZ1 A;  3UL2 A;  2XJS A;  1KS5 A;  3VZN A;  4BQ4 A;  5JAX A;  5DDJ 3;  3ZYH A;  1I5Z A;  3MIB A;  2EF6 A;  3KM5 A;  2YHJ A;  3AXD A;  5DAX A;  4N43 A;  2D97 A;  2JKB A;  4AAX A;  2HWD 1;  3I2J A;  1I1E A;  4LO6 B;  3IN9 A;  4NE9 A;  5A32 B;  5CFD C;  3VLB B;  4D6R A;  4XUR A;  3SHR A;  2WFF 1;  2WZE A;  2ZOE B;  3GBG A;  2XG3 A;  2WZP P;  3DPR C;  4HSL A;  5DDJ 1;  4ZU7 A;  2CTV A;  2WNV A;  4AFC A;  5F37 A;  3AP7 A;  4I01 A;  4NPR A;  1OMI A;  3PU8 A;  1AR8 3;  3VDC A;  4UI9 L;  5KXE A;  3M70 A;  4H55 A;  4Q0V A;  1KGY A;  1S0B A;  4YPJ A;  1C3H A;  1H2L A;  3PUA A;  1VLN A;  3KCX A;  2ZGK A;  3LKJ A;  2ENR A;  2VZV A;  3OOX A;  4WBB A;  4QKF A;  4LBM A;  5L7O A;  4F7Z A;  3VDB A;  1AR8 1;  4M4P A;  3C7O A;  3GGL A;  2EVX A;  2L9L A;  1H1I A;  2ARA A;  5F6L B;  3I2O A;  4CDU B;  1REF A;  4PQ9 A;  4QX5 A;  3THD A;  4NOT A;  4ZKT B;  3TNP B;  1HQL A;  3AX4 A;  3U07 A;  1Q8P A;  2VNV A;  4B3N A;  2ZEW A;  2RE9 A;  1W8F A;  3PDQ A;  5LK5 A;  4CCK A;  1SLT A;  2QZ3 A;  5A3N A;  3SKJ E;  3MW3 A;  5C9A C;  2H6B A;  4JAA A;  4L99 A;  4AQT A;  4ARX A;  4UF0 A;  3OUI A;  4RGG A;  5T5J A;  2IVJ A;  3I3Q A;  2X5I B;  1J58 A;  1IPJ A;  3K46 A;  5LA0 A;  2GNT A;  1I9R A;  4CUG A;  4FFH A;  5A1F A;  5L9V A;  1W9W A;  4IGQ A;  3WVJ A;  1UIK A;  4O7X A;  2B39 A;  1GNH A;  1CAV A;  4XVH A;  2Y0I A;  4AVV A;  5IT6 A;  1GOH A;  1PMI A;  3DGT A;  3RJ2 X;  1M06 G;  2XJR A;  5T52 A;  5IVE A;  5C8C C;  2BVV A;  1P8J A;  3PJQ A;  1YXW A;  3HNM A;  4JRA A;  1RUI 3;  4OZO A;  3OUH A;  1WW4 A;  3WHT A;  4CDW A;  4Q4Y 1;  1XOY A;  2LAL A;  3SCF A;  5FPV A;  4IER A;  1O5U A;  2D6L X;  3PU3 A;  3OPZ A;  3NMB A;  1UY3 A;  5J3U A;  1J3Q A;  4HBN A;  1X8E A;  5FUN A;  2Q8E A;  3U1X A;  2VU9 A;  2V4A A;  2XR4 A;  3BIE A;  3GCX A;  1OI6 A;  4CCN A;  4IE6 A;  4KWL A;  3UES A;  1RUI 1;  1S0I A;  3T09 A;  4Q0U A;  4K20 A;  4LBL A;  4FVV A;  2RVA A;  2W87 A;  3HWJ A;  3IDE A;  5FLJ A;  4J25 A;  4YM1 A;  4FPL A;  4IL7 A;  4RHV 2;  4LE3 A;  3MGU A;  4XFF A;  2BNO A;  2W94 A;  3NNL A;  5T3N A;  3SEP A;  1AR7 3;  4GB3 3;  3CNA A;  1JN2 P;  2AC1 A;  3CO2 A;  2N7G A;  2J1R A;  1W8U A;  2R6Q A;  4QX0 A;  2ZTN A;  4WVM B;  3N9P A;  1D2S A;  1C1L A;  2TUN A;  3H0O A;  1YWK A;  1NCR B;  2OQ7 A;  2VVF A;  4LJH A;  4QM8 A;  1KDK A;  1ZM1 A;  4QX3 A;  5A3M A;  1RXF A;  1IKP A;  3LFI A;  1RXG A;  4XPV A;  4CA9 A;  3GZT B;  3TB0 A;  2CSG A;  5KC6 A;  3AL6 A;  3APB A;  4MXV A;  1AR7 1;  4KWU A;  3WW3 A;  4LUL A;  1XPW A;  5CVR A;  5JXG A;  1SDD B;  4GWN A;  4LKD A;  3CU7 A;  4MOA A;  4QPG B;  4COZ A;  5BXX A;  4CP9 B;  3S6P A;  4F83 A;  5K8S A;  1KS4 A;  3RWN A;  2A6Z A;  4QWN A;  5HI0 A;  3ZSJ A;  4LHN A;  4MGI E;  3AZV A;  3ILF A;  1M4W A;  2ZHK A;  3O0W A;  3Q8C A;  1OLQ A;  5K0U A;  4GQ7 A;  2ES3 A;  4DO0 A;  5DAQ A;  1MPX A;  1BXH A;  2VQT A;  4CDU C;  5FO8 B;  2J1E A;  2XKP A;  3VDD A;  4BIF A;  2YC0 A;  4D6Q A;  1JYX A;  1WLT A;  1S55 A;  3LGR A;  2IWG B;  5D8A A;  1AUY A;  1AL2 3;  2Y6J A;  4MVT A;  3WNN A;  3AP6 A;  4DB5 A;  2X5I C;  3J7L A;  1HRI 3;  4XIL A;  2PA7 A;  4XHB A;  5ANQ A;  3Q9O A;  4YW3 A;  1NYW A;  2QQJ A;  2HYK A;  1S2E A;  2IXC A;  5J96 B;  2AEY A;  3NNG A;  2ZEX A;  5FFO C;  2VE1 A;  1V6J A;  1N3P A;  2GC0 A;  4Y5T A;  4CCJ A;  4E4S A;  2WDB A;  3A22 A;  3UKV A;  1EAH 3;  1WD4 A;  2NP0 A;  1AL2 1;  5E89 A;  3TN9 3;  4W6X A;  2WC2 A;  3BKZ A;  4NMI A;  5A3L A;  5E88 A;  4RR3 A;  1ZYB A;  1YLL A;  1HRI 1;  5A6Y A;  3SIT A;  3AKQ A;  4FOY A;  4YGD A;  2P3J A;  1IS3 A;  4HLT A;  4LKS A;  3C7G A;  3I3E A;  4QXC A;  4AFA A;  1AVB A;  2O8Q A;  4QB1 A;  2VMF A;  1GNZ A;  5JSP A;  5I8T A;  1MS0 A;  2FCV A;  3RFR A;  1KQR A;  4OMC A;  4UW4 A;  5FXW A;  1GMM A;  2QQL A;  3AJZ A;  5F8P A;  2JDM A;  4UOJ A;  4CYD A;  3OGV A;  1JYT A;  2D40 A;  1RVF 2;  2I07 B;  4HK9 A;  5C8W A;  4Y1Z A;  5J48 A;  2EAL A;  1QMJ A;  2E9Q A;  1ZX5 A;  5A1A A;  2QNK A;  4NIG A;  2ZGS A;  1J84 A;  1RUH 3;  3OG2 A;  5FYV A;  2QQN A;  5A3U A;  2ZAB A;  4NID A;  3K51 A;  4MX3 A;  5GZD A;  3VZM A;  1NCR C;  3VGI A;  1ZRD A;  5FZE A;  1A78 A;  1IOA A;  1AYM 2;  1K3I A;  1H4H A;  3WY6 A;  4AQ6 A;  4ES8 A;  1JYC A;  1UAI A;  1AYN 3;  2DDU A;  3MV1 1;  4AHW A;  4X6R B;  3OPT A;  4QPG C;  5DUW A;  1AR6 2;  2CWM A;  2BWC A;  5A6X A;  1N1Y A;  1UKG A;  3LAG A;  3N7J A;  3OEA A;  3NJZ A;  2VM9 A;  3POW A;  4KBZ A;  4KU7 A;  4YVW B;  3WP4 A;  3M3C A;  2OZJ A;  4AG4 A;  5BNN A;  1GV9 A;  3BTA A;  1UU4 A;  4G3Y C;  3J7M A;  3DYP A;  2HEY F;  3POY A;  5IK5 A;  1GQH A;  1QQP 3;  1UYX A;  3K4D A;  3SH4 A;  1AYN 1;  3GBW A;  1ULC A;  4QGL A;  2O0O A;  2VNG A;  4A2U A;  4I30 A;  1S1A A;  5BY5 A;  2YYO A;  3FLR A;  1HN1 A;  2CY6 A;  1UZV A;  5JSO A;  1HW5 A;  1ZNP A;  3CQO A;  3Q8F A;  3VD4 A;  4WZF A;  2E31 A;  5LBC A;  1NKG A;  2YZ4 A;  1IPK A;  2DUP A;  4UFM A;  4AED A;  2VNO A;  1PHM A;  2D7F A;  2NM1 A;  3OCP A;  5C6C A;  1S0E A;  1QQP 1;  2OVU A;  2VQU A;  4IUG A;  3WF1 A;  1PO1 3;  5K7P A;  4OHV A;  4N7U A;  4N9I A;  1BCX A;  1CZT A;  2BBA A;  4FPG A;  3T0A A;  5J37 A;  1OUS A;  4JQT A;  1A8D A;  1QOO A;  5FAX A;  2EAA A;  3O14 A;  1OD3 A;  1OF4 A;  5FZC A;  3ES4 A;  5IHR A;  2LW8 A;  4KGG A;  4JKL A;  3K3N A;  5LBB A;  2FDF A;  3ZR5 A;  4NWV A;  5FUI A;  5F2W A;  4ES9 A;  5FZB A;  4L92 A;  3I54 A;  1JH5 A;  3LZZ A;  4YGB A;  3WF0 A;  3M1H A;  3AMQ A;  3ZKU A;  4OQ8 A;  1EY2 A;  2JX9 A;  3N9N A;  4KH9 A;  4XTP A;  4DRV A;  3DPR A;  3IMN A;  3PJY A;  5F39 A;  1LOF C;  1R09 2;  2RDR A;  1PO1 1;  3IB3 A;  2QQM A;  3AVR A;  4OYU A;  1W9Y A;  5FK8 A;  4DQA A;  5FK7 A;  1JZ8 A;  2HWB 2;  4Q1R A;  5KC5 A;  3I7D A;  3K48 A;  1O3S A;  1LOG A;  5CNA A;  4KMQ A;  1AL0 G;  2WZR 3;  2ZGU A;  5CIR A;  4C91 A;  3LPF A;  2VZU A;  1AX2 A;  4FPC A;  4LBN A;  3RYR A;  1CAX B;  3DYO A;  2FDK A;  4JKM A;  4K1Y A;  4XFA A;  3MLJ A;  3CJI B;  1I6X A;  4PIZ A;  3N9L A;  1ZBA 1;  1RUE 2;  3RQ0 A;  5FZ8 A;  5F7U A;  4MET A;  2QFE A;  5T54 A;  3IMM A;  4LBQ B;  4L8Q A;  4TZD A;  2Y6L A;  5GJ6 A;  4BLJ A;  2WZR 1;  1PX3 A;  5FO7 B;  4Q8K A;  3KV9 A;  4Q29 A;  3ILR A;  4N53 A;  1YO8 A;  1RHI 1;  1O3Q A;  1FAT A;  2CNA A;  2DTY A;  1VRH 2;  2LTN A;  5GAL A;  2FCU A;  3J8F 2;  1J1L A;  4OMD A;  4YM2 A;  5IAT A;  2I45 A;  4JV4 A;  5FMD A;  1XYN A;  2G9G A;  3U10 A;  2RHP A;  1O3R A;  1XNA A;  3NL1 A;  5C9A A;  3T2O A;  1SMV A;  4YVW C;  2ARX A;  3PTY A;  4LOS A;  4DXR A;  1O4T A;  3POG A;  1Y9Q A;  1QIQ A;  2B7Y A;  3WCS A;  1GZC A;  3M7A A;  1UPI A;  4WVW A;  1GWK A;  5F5Q A;  3X29 B;  2G9F A;  2ID4 A;  2WL1 A;  2CV6 A;  5FPX A;  5JPM B;  1V6K A;  3B94 A;  1QH7 A;  4CCC A;  5T5O A;  4FOV A;  2NMN A;  1HN0 A;  1IG0 A;  4NRM A;  2RS5 2;  4QU1 A;  2C1F A;  1UIJ A;  1T2X A;  2B46 X;  2D6O X;  2XJP A;  1BMV 1;  3H7Y A;  4CCO A;  4IEO A;  4MUV A;  2VMD A;  4A45 A;  1R1A 1;  1JUI A;  4N43 B;  3T2P A;  4XJW A;  3VL9 A;  1IGO A;  3V56 A;  2HWE 2;  1QNY A;  2OT7 A;  4NHY A;  3VBF B;  1JTZ X;  5ACA 2;  2BUK A;  2WA4 A;  2A71 A;  3JBG 3;  3VHP A;  2XJV A;  5C70 A;  4QKN A;  3BOD A;  3UGF A;  5IK8 A;  2HWC 2;  3H8U A;  2VMG A;  2WNV B;  1WW5 A;  3K4A A;  1U0A A;  3MFA A;  3B3Q E;  4X8P A;  3RDI A;  2NZ9 A;  1C8M 3;  4HET A;  2FZ1 A;  1IQA A;  2WQ4 A;  4IE4 A;  4OVE A;  5CKQ A;  1PZ9 A;  1XND A;  4XAA A;  1V9U 2;  4G4F A;  2PHW A;  4P02 B;  2PHU A;  2BBV A;  2EXH A;  2ERF A;  3JU9 A;  5FKC A;  4GIQ A;  2FD8 A;  3AXE A;  5SV5 A;  3PUI A;  4FFI A;  4YZ2 A;  5LCW L;  2ZZQ A;  3RJR A;  1WLW A;  1RUC 3;  3N9Q A;  4FTS A;  1VBB 2;  1CON A;  1ODN A;  2B8M A;  2PTM A;  2V72 A;  4MGQ A;  4BDV B;  1K5J A;  2NPI A;  2H0V A;  3C7F A;  5L7O B;  3CJI C;  2YGL A;  2IVI B;  2BGC A;  2VUL A;  3K3O A;  2R0H A;  3OTF A;  3POB A;  3RWK X;  3KV6 A;  4F3J A;  3J26 N;  2XUE A;  2ORX A;  1XE0 A;  2YU1 A;  3H3Z A;  2HWF 2;  5F5I A;  1BHG A;  1QU0 A;  4A44 A;  5HXM A;  2W1U A;  2CYF A;  2OA2 A;  1RUC 1;  5FZ4 A;  3R4D B;  1C57 A;  3WR0 A;  3WW1 A;  1FPN 3;  1MQT A;  2WN3 A;  1GSL A;  1TME 2;  1STM A;  4S2D A;  5JVV A;  5JLV A;  4A6O A;  1QJY 3;  4YZ4 A;  1CAW A;  4UF0 B;  2ZGN A;  1YIF A;  3TYJ A;  4CXY A;  2J1A A;  1VR3 A;  1XNK A;  3NAP B;  4DNY A;  3KHC A;  3LDK A;  1LHN A;  2W95 A;  1YQ2 A;  2SBA A;  1CAV B;  1VB2 A;  2W08 A;  3LOI A;  3VB9 A;  1FPN 1;  3OBA A;  3DKW A;  4QU2 A;  4CDW B;  3UGH A;  1QJY 1;  1ALY A;  2ZPX A;  1VIW B;  3A7Q A;  2D6P A;  3JB8 A;  4Q4X 2;  4XF4 A;  1ND3 A;  1ENR A;  5FP3 A;  4QGM A;  4A7Z A;  1XBF A;  4NJ4 A;  1LUL A;  1H8T A;  2YY1 A;  3WXP A;  1W99 A;  1W39 A;  2D6K A;  2R0F A;  1XXN A;  3WSO A;  4COU A;  4C1W A;  4E8C A;  1E5H A;  2ADE A;  1SFY A;  4N43 C;  5F6K A;  2VQA A;  1DGW A;  4HG6 B;  5JR2 A;  3G7D A;  2JDA A;  4GMP 3;  4EN9 B;  3FFQ A;  2OPK A;  3ACG A;  3VBF C;  1LNS A;  2D3R A;  1UO9 A;  3R4U A;  4O9G A;  3U4S A;  3H8R A;  1AJO A;  1RUD 1;  4M0N A;  4YW1 A;  3PIG A;  1V6L A;  2R06 1;  4FAG A;  1QF3 A;  4XBQ A;  4YW6 A;  4Z2W A;  1YJL A;  3H1Y A;  3ES1 A;  4EN8 B;  4SLI A;  2WNV C;  1GZ9 A;  4X6Q B;  1W6P A;  5F9T A;  2GME A;  2ARE A;  1JHN A;  2C26 A;  1RYY A;  1GP5 A;  4GMP 1;  4AI2 A;  4RGK A;  2VOK A;  3JB4 C;  1XNT A;  1GQG A;  1CX4 A;  3MIG A;  4H3W A;  5FWJ A;  4YW4 A;  1JU4 A;  1EPZ A;  1KFX L;  2VZQ A;  5I0T A;  2H0B A;  3FC0 A;  4BXS V;  1X36 A;  4XAC A;  3ON7 A;  1YQ8 A;  1WBL A;  2O8O A;  5JIA A;  3RVH A;  4TXW A;  1CZS A;  1QJF A;  5C7G A;  1L7L A;  5L7O C;  4AOC A;  1QXJ A;  3QLQ A;  1PIV 3;  4QDQ A;  3T0B A;  2W52 A;  3I3B A;  3U11 A;  4QPG A;  4FAH A;  4AHX A;  5I0R A;  5J09 A;  4L11 A;  4DZG A;  5IFT A;  3KT4 A;  3ZN4 A;  3HPN A;  3VDD B;  4LMF A;  4P08 A;  4CUB A;  3WW2 A;  2PHL A;  1BEV 2;  1LEM A;  3AL5 A;  5E16 A;  4CEW B;  4XUQ A;  3WHU A;  4TWT A;  3ZYF A;  5D8A B;  4Z8B A;  2E51 A;  1NY7 2;  4ASK A;  5FLH A;  1LR5 A;  2VG9 A;  3ZXF A;  1BLZ A;  3WZ1 A;  4XJ9 A;  1HXS 2;  3PNA A;  2WNE A;  1GYK A;  3H1W A;  3NAP C;  4G9S B;  4MGT A;  3U4X A;  4Q26 A;  4AR2 A;  3FHQ A;  3ITQ A;  1GZW A;  4YNI A;  3MPB A;  5JUV A;  4C0H A;  1WA4 A;  2X53 S;  3ECQ A;  4K9S A;  4CDW C;  3ZFG A;  4W8J A;  4KU8 A;  4QKD A;  2DCY A;  1ACC A;  1OKO A;  4RR3 B;  2BJS A;  3VZJ A;  3WCR A;  2F6B A;  4R8H A;  2VOW A;  4HFS A;  1UY4 A;  3JXS A;  4LHL A;  2D5H A;  1BJQ A;  1HX6 A;  4E4D X;  2VJX A;  4HAN A;  5I93 A;  1HB4 A;  4YAR A;  3DUI A;  5C4W B;  3B01 A;  3PTR B;  1COV 2;  2D3S A;  1RUF 2;  1VBC 3;  2Z4F A;  1JOB A;  2DV9 A;  5AC9 3;  3ZDS A;  3OD4 A;  3RGB A;  3MF6 A;  1ZRF A;  1OPM A;  5A3W A;  3ZYR A;  4CU9 A;  2B45 X;  4MGY E;  3ZYP A;  2XWJ B;  1LOE A;  3ACF A;  4OUS A;  4DXS A;  2R04 2;  3P5B A;  2A3X A;  2ZXQ A;  4LA2 A;  2D98 A;  3HAG A;  3RMX A;  2PAE A;  3IWZ A;  1GNY A;  3WP3 A;  3JQW A;  3POF A;  1N47 A;  3ZXK A;  1OT5 A;  1SZB A;  4R52 A;  1VBC 1;  1W8W A;  4UFH A;  4GWM A;  5AC9 1;  1N3Q A;  4PLM A;  1HRV 2;  2BNN A;  4CU6 A;  3O1S A;  2XQX A;  1FI2 A;  2O1Q A;  1H9P A;  3USS A;  2BER A;  4FPH A;  3BUC A;  1SQ4 A;  4AVA A;  1PVC 3;  3FBY A;  3T30 A;  5BNN B;  1D7P M;  2XOM A;  1UN1 A;  3F2Z A;  5GKA C;  5HBA A;  4QHZ A;  1VRB A;  1ULE A;  4XYX A;  1J3R A;  3JQX A;  3ROU A;  3ZM8 A;  2VNR A;  3GBF A;  4YFW A;  3VDD C;  1HB1 A;  4FPK A;  1JZ6 A;  3BU0 A;  4CEW C;  1DHK B;  3B69 A;  1FMD 2;  4XW3 A;  2Q8O A;  2GU9 A;  2XLG A;  4XUP A;  1PVC 1;  2DCK A;  3AB0 A;  4W50 A;  1S2K A;  4XFH A;  5D8A C;  5SV8 A;  4AZZ A;  5JOX A;  1RIN A;  3PVB B;  3FUQ A;  3RS6 A;  4AED B;  2VMI A;  1AJK A;  1UZZ A;  3AK0 A;  4Y20 A;  3EMR A;  3D82 A;  1CES A;  1ZRE A;  3WDU A;  3Q8B A;  4R4X A;  1OC1 A;  4RQP A;  3O1T A;  3TBD A;  4MAD A;  4HN0 A;  2YBS A;  4ATF A;  4QM9 A;  4RA0 A;  4Z2A A;  4XF3 A;  2D93 A;  3MIH A;  3EXU A;  4P5H A;  2PHR A;  4KI5 M;  5H9Q A;  1VBA 2;  1D0H A;  2QVS B;  4JKK A;  5CYY A;  2RMU 3;  1QOS A;  3KV4 A;  4RR3 C;  4LQR A;  4B7E A;  4CCE A;  1Z7S 3;  4BQX A;  5ANN A;  2CHH A;  5CAD A;  4HL0 A;  5GZC A;  2E26 A;  1W9F A;  4LE4 A;  1CIW A;  4HK8 A;  2A6V A;  5AVA A;  5H9S A;  2G1M A;  4IE5 A;  3VN4 A;  1JUH A;  1IZ3 A;  3OUJ A;  2RR1 1;  1OD5 A;  5GLU A;  3VD7 A;  4K3U A;  5DPN A;  5C4W C;  3MIF A;  3ELN A;  4MXW A;  3LEK A;  3KF3 A;  1LJ7 A;  1AXZ A;  4I02 A;  1D4M 3;  3LWC A;  4LBQ D;  1ULF A;  3GDB A;  1Z7S 1;  1MS9 A;  5IVB A;  1UF2 C;  2PHF A;  1FV2 A;  1CAX A;  3I2H A;  1US2 A;  4XET A;  3VBO A;  4EN6 B;  2MHF A;  4YW5 A;  4O61 A;  2Y26 A;  2VZR A;  5A7W A;  3SIS A;  1GU3 A;  2QE3 A;  2WFF 2;  1D4M 1;  4N53 B;  3PIJ A;  3ZXE A;  4PLN A;  5A7N A;  1OOP A;  3AM2 A;  3WG2 A;  1IKQ A;  2YB7 A;  1G7Y A;  4Q1P A;  2IXK A;  5FY9 A;  4QXH A;  4AQ2 A;  1G9D A;  2QCS B;  3WG3 A;  1LTE A;  1H1A A;  1XYP A;  3ZSM A;  1LHW A;  1PNF A;  2ET1 A;  5BNN C;  1CX1 A;  3VUO A;  3USU A;  1ZA4 A;  4UFL A;  3RYK A;  1SDW A;  4FFG A;  3I2G A;  4DIQ A;  1KDM A;  1Z0H A;  3LOB A;  4B1M A;  1W0P A;  3CLP A;  3EYP A;  3SC7 X;  1J83 A;  1FOD 1;  3D0S A;  5LBE A;  2GMP A;  1W2U A;  2C4X A;  1AR8 2;  2D3P A;  2JE9 A;  5JIU A;  4A3X A;  4N7I A;  2PFW A;  4Q27 A;  3CHX A;  3ZFF A;  4ISR A;  4ATE A;  5FP8 A;  4XBL A;  4AED C;  1NZC A;  1KD7 A;  1W90 A;  2KM2 A;  2MEV 2;  2XQR A;  1KRI A;  2XHN A;  2WT1 A;  1H0B A;  1LHU A;  4FP3 A;  4QPI C;  3MIE A;  3VZK A;  2VXR A;  4FO9 A;  1ASJ 2;  1HV0 A;  1WMF A;  4HON A;  1WD3 A;  1YI9 A;  1YRZ A;  4BJ0 A;  4LT5 A;  3WNL A;  1WMX A;  2DWR A;  4DY5 A;  3VBF A;  5T5L A;  2VTX J;  4S2F A;  3MZH A;  1YQC A;  4ZS3 A;  4GH4 A;  4FFF A;  4MO3 M;  3DEM A;  4HKW A;  1VAV A;  4HKO A;  1LOB A;  1QJX 3;  2R07 2;  3BI3 A;  3WDX A;  5LAT A;  4FP2 A;  3WP5 A;  5C3R A;  3KF5 A;  1CPN A;  4QD2 A;  3NQH A;  1GR3 A;  2WBK A;  5FZ9 A;  3HN1 A;  5FY4 A;  1JZ3 A;  4CSW A;  3ZSK A;  4Q4Y 2;  1CPM A;  5JSR A;  1EP0 A;  1O4Y A;  3BGA A;  3LA2 A;  5FZM A;  5LRR A;  5H9R A;  1QKQ A;  1Z78 A;  2ZHM A;  4GAL A;  1QJX 1;  2IFR A;  4EE2 A;  2VH9 A;  3BTX A;  1NA1 B;  4M4R A;  5IVY A;  4XFC A;  2BTV C;  4UFI A;  5G05 L;  2V5Y A;  2VZP A;  4HXC A;  5LAS A;  2DUO A;  4D3W A;  1I3H A;  4IXL A;  4IGP A;  2Y34 A;  3OBT A;  3FLT A;  2YUE A;  2A1X A;  4IQP A;  1MQT B;  3OB8 A;  4N53 C;  2ZHN A;  1W0N A;  2RDN A;  3BPZ A;  4Z92 B;  1ZZ8 A;  4XZU G;  1CAW B;  4IDZ A;  1AX1 A;  1PNG A;  2RS1 3;  2W46 A;  1RIR A;  2W91 A;  3Q8E A;  3VKO A;  5FZO A;  4QQP A;  3HBZ A;  2JE7 A;  5FZG A;  4GJY A;  4Q4W 2;  2ZX4 A;  3RZM A;  4LKE A;  1NAE A;  1SBF A;  2JIG A;  1OPO A;  4BH9 A;  2WAO A;  4LA3 A;  4DPN A;  1R1Z A;  3NAP A;  4RGA A;  1LAJ A;  4CEY A;  1GWL A;  1OLM A;  2ZGM A;  3PVE A;  2HBT A;  1MZ6 A;  3NJX A;  5B4N A;  1ND3 B;  3HR9 A;  1GAN A;  2F4L A;  3ZN5 A;  4FT8 A;  1H8T B;  2BPA 2;  1HIX A;  4IND A;  1U5Y A;  4Q5O A;  2P6H A;  2WUH A;  4WM7 A;  4EWD A;  2RS3 3;  1UZY A;  3WQ0 A;  5L9R A;  4A3Z A;  1BKZ A;  4HT1 T;  4NVP A;  4B8E A;  5IK4 A;  4Y4R A;  5IAX A;  5L19 A;  3RZH A;  4XJU A;  4UAP A;  2GAL A;  3OY8 A;  2JEC A;  3FWE A;  4A4A A;  4PI0 A;  3POE A;  2RJ2 A;  5D21 A;  2J1V A;  5FBZ A;  1BBT 2;  2G19 A;  2LRO A;  1RL3 A;  3D4K A;  3SH5 A;  3VD9 A;  3IT8 A;  3NV1 A;  1ULO A;  2RS3 1;  1W6P B;  2JEM A;  5BYN A;  1Y4W A;  2VMC A;  3L9J T;  5DAV A;  3CEW A;  3T3Y A;  1W3X A;  2J42 A;  1S4C A;  2EXK A;  1K12 A;  5D2A A;  2UUR A;  2XVL A;  2LUW A;  1ODM A;  4XOG A;  5I8Y A;  5GZF A;  5FY1 A;  2W2I A;  2XON A;  1WKY A;  5FP7 A;  3ZKY A;  4NRP A;  1HRI 2;  1MEC 2;  4COY A;  2JJ6 A;  2BFU L;  3M8L A;  3ACH A;  2Y8K A;  3V0A B;  1RC6 A;  2KR2 A;  3H3U A;  4GB3 1;  3ZYB A;  1NA1 C;  1LGC A;  4A7Y A;  2JDU A;  3MYX A;  4Y1Y A;  3C2U A;  4NHK A;  5FXV A;  1RED A;  1W2T A;  1Y7B A;  1W2N A;  2J1S A;  2Q1M A;  3TRS B;  5I0S A;  2JG8 A;  3GJB A;  3AP9 A;  3SQO A;  1LED A;  1MQT C;  2EID A;  3NV2 A;  1OQ1 A;  4R9D A;  5CBL A;  1UD1 A;  2OZ6 A;  4XFI A;  1H6X A;  3PME A;  1CJP A;  3S7E A;  3GCW A;  4CEW A;  4XCA A;  1WW6 A;  5E8A A;  4XJ8 A;  1DQ4 A;  1L3J A;  3R6S A;  5FRE A;  2XBO 3;  4QQH A;  3ZXG A;  2DYC A;  2UYB A;  3VBU A;  1GZW B;  1KEX A;  5FZK A;  5I8S A;  3TEZ A;  3HT2 A;  5CKN A;  2WT0 A;  1GP6 A;  3FHA A;  4NIA A;  3ZFG B;  5LEJ A;  3LSE A;  1OBN A;  2DVB A;  4COW A;  1ND3 C;  4ISQ A;  3E97 A;  1VE0 A;  2YMZ A;  2HYX A;  2BVB A;  3KHB A;  2XVK A;  4RHV 3;  3O7O A;  4ITC A;  5KXB A;  1H8T C;  2ILM A;  2XBO 1;  3FMG A;  3LEM A;  3ZR6 A;  3AJY A;  2Z79 A;  4PIY A;  5I0D A;  4RN5 A;  3A0N A;  3FLP A;  1W6Q A;  4XF1 A;  1BQP A;  1GQP A;  4GA9 A;  5FIX A;  5BPX A;  5JOY A;  4B4P A;  1S0F A;  1W2O A;  2Q5T A;  5GLW A;  1AYN 2;  5DXD A;  1VAL A;  1H6Y A;  1S0J A;  2JDP A;  4D6S A;  2B5H A;  1PGL 2;  5C4W A;  1F9K A;  1EAH 1;  3HD8 B;  3ACL A;  1WLC A;  5G04 L;  3TN9 1;  1NG0 A;  1F35 A;  5KWR A;  1JYV A;  1U5X A;  4CRQ A;  4DOU A;  5KHK A;  2NYY A;  3B7M A;  5FZD A;  3NNJ A;  5A7S A;  1K45 A;  2WO2 A;  5H9P A;  5CEH A;  5FY5 A;  5FWE A;  5CIS A;  3RZG A;  1ST8 A;  3ZMO A;  5BNP A;  1HB2 A;  4CP2 A;  4DY3 A;  1X9T A;  1DZT A;  2V73 A;  4M3C A;  1AX0 A;  1RMU 3;  1WCD J;  2XPJ A;  1LKN A;  4AFB A;  1G86 A;  1SG3 A;  2E33 A;  3MW4 A;  2P3Y A;  5DN2 A;  5F5C A;  5FJH A;  5IVV A;  3S57 A;  1PO1 2;  1CIY A;  2CAU A;  4E2Q A;  5IUQ A;  1WZX A;  1RUH 1;  4XF0 A;  3PUH A;  1OFS A;  4IEW A;  3WDT A;  4TLF A;  4Y24 A;  3U75 A;  2OS2 A;  4AEM A;  1RMU 1;  4QQO A;  2VUD A;  5J98 B;  4B7K A;  5JXJ A;  3BAL A;  5FMC A;  1H2N A;  1Y9M A;  4FPJ A;  2CAV A;  2EXJ A;  3VKN A;  3RZJ A;  1ZBA 2;  1W6M A;  3D8C A;  1GOG A;  3HJR A;  2JD9 A;  4CDQ A;  2ZHL A;  2OII A;  3EHK A;  4OCT A;  4ERO A;  4PIX A;  2PHX A;  2WNU A;  4LR4 A;  5IVF A;  3V65 A;  4Y20 B;  5AVP A;  2K0G A;  3FFZ A;  3F95 A;  3KWV A;  4DUX A;  3ZVX A;  4OHZ A;  4FTB A;  3BTZ A;  4RQP B;  5DUX A;  3UK9 A;  3ZXD A;  2P17 A;  1YCI A;  1RHI 2;  3WNM A;  1SPP A;  2AEZ A;  2V5D A;  5LY2 A;  4D94 A;  2VZO A;  3AZW A;  2AH2 A;  3RZL A;  3HQX A;  2JDH A;  5EV7 A;  3ZFG C;  4QPI A;  1RVF 3;  4CDX B;  3WEZ A;  4ASL A;  1RUG 2;  2VME A;  4L9B A;  3MDP A;  1QEX A;  1UXX X;  1QXP A;  1PGW 2;  3MW2 A;  5F3C A;  1OA3 A;  4ZZ8 A;  2H6C A;  2ADD A;  4YM3 A;  4MYE A;  4S2H A;  4WVV A;  5IAV A;  3THP A;  4FPE A;  4MXW B;  2CL2 A;  4MGS A;  4OI0 A;  1PMH X;  2XLA A;  2UYA A;  4XDP A;  2YBP A;  4QQ2 A;  4WZC A;  3N3H A;  3AYC A;  1AYM 3;  4JCK A;  1XC6 A;  1LES A;  1BMV 2;  4QXB A;  5CFC B;  1H9W A;  2WJS A;  2JXA A;  4IE7 A;  1R1A 2;  1AR6 3;  2X29 A;  3EB7 A;  3ETQ A;  4FPY A;  5LB6 A;  3VBO B;  4EV0 A;  3WNP A;  5HV4 A;  2K46 A;  1LU1 A;  4NAM A;  3ZYG A;  1RB8 G;  1HJG A;  4W6W A;  5A7W B;  5TSW A;  2BW8 A;  4LOT A;  1SLL A;  4WM8 A;  3T1L A;  2QBX A;  3OEB A;  1OOP B;  1OKQ A;  5EYY A;  3NST A;  3KSC A;  3PUR A;  5HCA A;  3WNX A;  2W0X A;  1FNY A;  4M00 A;  4AHY A;  3HNY M;  1AR6 1;  5DUV A;  5FZ1 A;  2DFC A;  4YZ5 A;  4B1L A;  2WR9 A;  1ZZ9 A;  1MAC A;  2GC3 A;  1XQN A;  3PLQ A;  3UJO A;  3VBR B;  4ZXE A;  5F3I A;  5FYZ A;  4DFS A;  3USU B;  3GJA A;  1J59 A;  4QDR A;  1W9T A;  2BOI A;  2UU8 A;  1YUD A;  4QX8 A;  5EWS A;  2ZMK A;  4QPY A;  3MHZ A;  4KWJ A;  5FYS A;  4ET7 A;  3NNM A;  1O59 A;  1UWW A;  4NHX A;  2JDK A;  1F5F A;  4LHK A;  1W8O A;  2QDN A;  4UWD A;  3THC A;  3S0M A;  4LHS A;  4MH0 E;  5IJR A;  2J1T A;  3GXU A;  3SH3 A;  3E6C C;  5CZK A;  3ZFF B;  1LOC A;  1F31 A;  2VEC A;  4WV8 A;  2GNB A;  3B9C A;  1DQ5 A;  3RYP A;  1EYB A;  4AK3 A;  1R09 3;  4BA6 A;  1IPS A;  1PGS A;  4RQP C;  4XUO A;  4BXF A;  3WQB A;  2HWB 3;  1DYK A;  1H1M A;  5FYC A;  5GZE A;  1OHF A;  5FZ6 A;  3SEE A;  4ZY9 A;  1OLR A;  3CL1 A;  4DEQ A;  4FPO B;  1BK0 A;  2DUQ A;  4GH4 B;  4QHB A;  4OI2 A;  4CUC A;  3FX3 A;  3KS7 A;  1TG7 A;  4CDX C;  1JHJ A;  2OPW A;  3H9A A;  5FZA A;  4MZU A;  1R09 1;  2R7E B;  2YU2 A;  4AI1 A;  4FCA A;  1C1F A;  5FBJ A;  2C24 A;  1WW7 A;  2IXJ A;  2GMM A;  2HWB 1;  4OI1 A;  3WNO A;  4RS5 A;  4XXA A;  3AYE A;  5HCB A;  5C71 A;  1CD3 G;  2E63 A;  2VCC A;  3ABZ A;  3ZXA C;  4BIS A;  2XUM A;  1GIC A;  3ZSL A;  4UFK A;  4NRO A;  3JBG 1;  4EN0 A;  4GUL A;  3IIA A;  3JUU A;  2Q0A A;  4J6G A;  1VRH 3;  5F3E A;  5AFE A;  2WNO A;  3J8F 3;  5EJ3 A;  4BHP A;  3P6B A;  5CFC C;  3FJS A;  3CMG A;  4XQW A;  1YYN A;  4NO4 A;  3VBO C;  1C8M 1;  4I0A A;  4IV3 A;  5DAB A;  3E5U A;  1LEN A;  1NA1 A;  4QMA A;  1RUD 2;  4RFT 0;  4PF5 A;  1L7R A;  2R06 2;  2WO7 A;  1RUJ 2;  5FPB A;  1QWR A;  2QKD A;  1OOP C;  2HKX A;  1VJ2 A;  1WGP A;  2WS9 2;  1UW8 A;  2A3W A;  4NWW A;  1ZZ7 A;  5FY8 A;  1UU6 A;  3J8F 1;  1EUT A;  1LEC A;  2E7T A;  4AHZ A;  1ZRR A;  4GKX A;  5FZO B;  1SFP A;  2RS5 3;  4FXK B;  4RYD A;  2VZT A;  4AXO A;  2Y6F A;  2YFZ A;  1UMH A;  4IE0 A;  4I2O A;  3VBR C;  2XHK A;  2GDF A;  4ARY A;  4Y26 A;  1XYO A;  3RZK A;  3C7E A;  1JYN A;  4CEY B;  2HWE 3;  3PUQ A;  1SLI A;  2OW4 A;  4Q4V 3;  4Y3O A;  4AI3 A;  4H7M A;  5ACA 3;  1K42 A;  2VTF A;  1AZD A;  5B4X A;  2P2K A;  1NCQ B;  2JEN A;  2VBD A;  4BK4 A;  5FOJ B;  5HCH A;  2RS5 1;  3EJK A;  4KBB A;  4UBH A;  2MNG A;  4XMI A;  4O65 A;  2HWC 3;  1MZE A;  4Y5S A;  5FYI A;  5A3P A;  1HB3 A;  4M0H A;  4WM7 B;  5A80 A;  3ZFF C;  2X09 A;  2HLE A;  3S7I A;  4EWA A;  4MSV A;  1ULD A;  3K2O A;  3SXW A;  1WWY A;  1WUV A;  1DBN A;  1MS4 A;  2HWE 1;  3PVO A;  3N4M A;  1UQX A;  2OXB A;  3B93 A;  3ASI A;  1V9U 3;  4Q4V 1;  4GD4 A;  1NLR A;  3OY8 B;  4CCM A;  5ACA 1;  5CG9 A;  4IES A;  4XEZ A;  2Y0O A;  4LO5 B;  4I3G A;  1G6N A;  2HWC 1;  3RNS A;  4KWK A;  2HEW F;  5D1I A;  2VY0 A;  4LOR A;  3U37 A;  4TYS A;  2FHR A;  3M3O A;  4GH4 C;  2YDE A;  4D8M A;  1I5P A;  5F2S A;  4ZU5 A;  4BQ2 A;  3VDA A;  2PQS A;  2EAK A;  1DLC A;  4C8D A;  1V9U 1;  2CGO A;  2DVA A;  1UXZ A;  1H30 A;  1DU3 D;  5HPO A;  2WAA A;  3KQR A;  1LGB A;  1JZ4 A;  4NPL A;  4QX2 A;  5GLV A;  1URX A;  2ZGL A;  1TME 3;  1BZW A;  2RM2 2;  2QTW B;  3MO4 A;  2EIE A;  2ZX2 A;  4QXK A;  3ZIX A;  3ILN A;  1PO2 2;  3NRU A;  1MR5 A;  2E53 A;  2JIC A;  4XFG A;  1W05 A;  5L36 A;  2C5D A;  3V0A A;  1PX4 A;  3S30 A;  2JG8 B;  5KHJ A;  1V0A A;  5FMO S;  2BP6 A;  1C4R A;  1UYY A;  4HSJ A;  4BCU A;  4TN7 A;  1AF9 A;  2R30 A;  3TEW A;  4YVS A;  4Q4X 3;  4QAW A;  4LKF A;  1YHF A;  3ZDV A;  5IYY A;  4MGZ E;  3JD7 3;  1W6O A;  1OVS A;  1PIV 1;  4XBN A;  1F15 A;  3VBU B;  5FPZ A;  2W5F A;  1MVE A;  4UW5 A;  3I4I A;  1W0O A;  2C9A A;  2QQI A;  4C90 A;  5AC9 2;  4ZHN A;  3RZZ A;  3A4U A;  4H14 A;  2XLF A;  4W6Y A;  2RG4 A;  1NE4 A;  4AYU A;  4B29 A;  4PBO A;  5E1R A;  4CEY C;  2CDP A;  2X8K A;  1N1S A;  3N9O A;  1EV1 3;  2BFU S;  1JZ5 A;  5JZG A;  2VUJ A;  1NCQ C;  4XUT A;  1C28 A;  1JXN A;  1POV 0;  2FDJ A;  2VOV A;  2OUH A;  4LBJ A;  1JYI A;  1TMF 2;  3DXT A;  3JD7 1;  1XSQ A;  2JG9 A;  2WKK A;  3AKP A;  4WM7 C;  1W6Q B;  3PHM A;  5C3O A;  4IGO A;  1L7Q A;  3AP5 A;  2HJI A;  2LRP A;  2V09 A;  3WF3 A;  2C6S A;  3RSJ A;  1MS8 A;  3KT7 A;  3NVC A;  4H7L A;  1FV3 A;  1CR7 A;  3IM0 A;  4CUA A;  3EQE A;  5F3G A;  1EV1 1;  4XUN A;  1U12 A;  3GAL A;  1ZA7 A;  1LOD A;  3NO8 A;  4YGC A;  4P9G A;  2WAB A;  5JMO A;  4HOO A;  2VZS A;  4U36 A;  2JDY A;  4NPM A;  1R08 2;  3HQR A;  3N7M A;  4UFJ A;  1O5L A;  4D7T A;  2EIC A;  2FDI A;  1Y9G A;  1OF3 A;  1WCS A;  3H3L A;  1X8M A;  3IZO A;  4K21 A;  2OKX A;  4R9A A;  3I49 A;  1O8P A;  4NR1 A;  5BNP B;  1V6I A;  3I3M A;  3WX5 A;  1FT9 A;  2QQK A;  4M3C B;  2VCB A;  3KV5 A;  5FV3 A;  1DGW X;  4A42 A;  1BEV 3;  1NQD A;  3L2Y A;  2Y6K A;  1TZO A;  3BB6 A;  1MS5 A;  1XJA A;  4R9B A;  2BYV E;  2PLV 2;  3POS A;  4PI2 A;  3VZO A;  3CBN A;  1FXZ A;  3JCI A;  4FOQ A;  4Q0S A;  3RI8 A;  2RR1 2;  5FYT A;  2Q8D A;  5BNO A;  1GWM A;  1HXS 3;  3VHR A;  5A1L A;  5JWP A;  1V6M A;  2JB4 A;  1BEV 1;  3I2K A;  2DCZ A;  4NII A;  1QJU 2;  2JG8 C;  3BU7 A;  1ZRC A;  3HOB A;  3LEG A;  3K75 B;  1Z7S 2;  1T6B X;  1W6M B;  3OGJ A;  2VZ3 A;  3HNB M;  4P9W A;  2ZGQ A;  4CDQ B;  2PHT A;  3LB9 A;  2ZCW A;  3ZMN A;  5A3T A;  2WNU B;  3N36 A;  2WWS A;  1Q5O A;  2ZX3 A;  1HXS 1;  5APA A;  1C5H A;  4GWI A;  1RUO A;  2VCA A;  1LCL A;  1NQJ A;  2B9U A;  1NZI A;  1AHS A;  4W65 A;  1MZ5 A;  5FZ3 A;  1Y3T A;  4JDN A;  3VBU C;  5CG8 A;  4BQ3 A;  1D4M 2;  1GKB A;  5A6Q A;  2DTW A;  5HV0 A;  1SPP B;  4QQL A;  2GH8 A;  1N3O A;  2ZX1 A;  3GZA A;  3CDZ B;  5FOB B;  1COV 3;  3POJ A;  3TEX A;  3R0R A;  4I09 A;  1RUF 3;  1MS1 A;  4P9I A;  4QPI B;  3ZLI A;  4CP1 A;  5LEK A;  3V0B B;  5DG2 A;  3WDV A;  4AGG A;  3POI A;  2QQP A;  4YRD A;  1X7N A;  4BWO A;  5GZG A;  2FMD A;  1CQ9 A;  1QY4 A;  1ZBE 2;  5LWB A;  1CN1 A;  1VBD 2;  2BOJ A;  2JB8 A;  2WQ8 A;  5CU1 A;  1E57 A;  1GUI A;  5IW0 A;  1DQ2 A;  1KFU L;  4CDX A;  2Y64 A;  5A6Z A;  3AFG A;  3LA7 A;  4KG0 A;  4JGZ A;  4AFD A;  1RUF 1;  1JZ7 A;  1DG6 A;  1FOD 2;  4FOW A;  3BVC A;  2IXH A;  4ZS2 A;  3AMN A;  2JDN A;  1DYO A;  5BNQ A;  1DZQ A;  1TEI A;  4RSU A;  4YM0 A;  4ZON A;  1OSG A;  5FYH A;  1RGS A;  2GND A;  2RMU 1;  4FQZ A;  5EP9 A;  4AVS A;  5FQ0 A;  2W1Q A;  5CAZ A;  3WV6 A;  3N35 A;  1K5M B;  1YQ6 A;  2GZW A;  5CFC A;  2Z42 A;  2BNM A;  4XTM A;  1R64 A;  4WM8 B;  5C5T A;  2Q30 A;  5BNP C;  1ENQ A;  2HWD 2;  1CAU A;  4AVC A;  1UMI A;  5IK7 A;  4JC1 A;  3ZN6 A;  1JOD A;  1FMD 3;  2IXI A;  2G9Z A;  4CPB D;  3W21 A;  2PYT A;  3I59 A;  5C3S A;  5DDJ 2;  2BV4 A;  3MPP G;  3J9S A;  1O6U A;  1RUN A;  3PVN A;  2W39 A;  4FQ4 A;  3MLL A;  2D5F A;  2WWU A;  4LO7 A;  3WQ1 A;  4F8A A;  3VBR A;  4TLG A;  1DGL A;  3RPQ A;  1ONA A;  1HV1 A;  3WP6 A;  1W8Z A;  1J3P A;  4CPB A;  4IV1 A;  3U78 A;  1XRU A;  1VBE 3;  3GM8 A;  4OI4 A;  1VBA 3;  2AR6 A;  3T08 A;  4CDQ C;  1JYW A;  1W8N A;  1JS9 A;  4Q0P A;  3T2Q A;  2WNU C;  3O1P A;  4MHR A;  2XH6 A;  4JGY A;  4QB2 A;  1RJ8 A;  1DYP A;  4XDO A;  3UYJ A;  1SHW B;  1XB9 A;  1AXK A;  4LXL A;  2XJU A;  3GNE A;  2RJK A;  2A6W A;  1NX9 A;  1F4H A;  2VTX A;  3W58 A;  4OHY A;  2A70 A;  3H8O A;  2XB6 C;  1VBE 1;  1VBA 1;  3H50 A;  1UOB A;  3ACI A;  2DU1 A;  3SCH A;  1QXR A;  3AC0 A;  5K4L A;  4LUK A;  5DAP A;  3TOJ A;  1IQD C;  2NN8 A;  3FBM A;  4C1X A;  3KLS A;  4LNV A;  3WUD A;  1VAK A;  1BYH A;  1SLB A;  4E9K A;  2FDG A;  5JOW A;  4RS5 B;  2ZBJ A;  4QDS A;  2D44 A;  2A5Z A;  4CE8 A;  4QB6 A;  2Q1Z B;  4X8N A;  1WA6 X;  3VKM A;  5FP4 A;  3MUZ 1;  1QJE A;  4QKB A;  3NNF A;  1PVX A;  1TVG A;  3BYW A;  4OUL A;  2D6N A;  4Q0Q A;  2C0Z A;  4LIU A;  3B02 A;  3AZZ A;  5A33 B;  2XDV A;  2EA7 A;  3ALQ A;  2ZKN A;  3MFC A;  5C5U A;  2W68 A;  5LY1 A;  1O91 A;  3LD8 A;  3O1V A;  1AR9 3;  4AE2 A;  2E32 A;  2OX0 A;  2ZEY A;  3R4S A;  4IV3 B;  5FCC A;  1GP4 A;  1W06 A;  4CVU A;  4UW6 A;  3ZYJ B;  4XCB A;  1K5M C;  4XJZ A;  4UBG A;  1W8H A;  1G9C A;  3ST7 A;  1PM7 A;  1U5Z A;  2JD4 A;  2B42 B;  1W28 A;  1ULG A;  4MV2 A;  4WM8 C;  4KG8 A;  4XAE A;  4HKL A;  1UZW A;  1RUI 2;  4JVA A;  1Q8O A;  2RJL A;  4TTG A;  1W03 A;  3IPV A;  1UY1 A;  4HPK A;  2PN5 A;  2RS3 2;  1HLC A;  1X50 A;  2GNM A;  2QQO A;  3O0V A;  5FJK A;  5ISL A;  3O1M A;  1AR9 1;  4DIN B;  4ZZ5 A;  3W5N A;  4RD7 A;  3T2T A;  4HMZ A;  3DKQ A;  3Q8A A;  3LCP A;  3O1R A;  3KCY A;  1NUK A;  1WCQ A;  3ZXJ A;  1UU5 A;  5EXO A;  2IFW A;  1SAC A;  2ZS6 B;  3INA A;  1KJL A;  2MEV 3;  3B00 A;  3THT A;  1Q8Q A;  2P34 A;  1QGL A;  4N9H A;  4BK5 A;  1NOV A;  4D0Q A;  3M3E A;  1ASJ 3;  2UWC A;  1JW6 A;  1AR7 2;  4GB3 2;  1QDO A;  4HN1 A;  2QQW A;  2RS1 1;  2YRO A;  5FYB A;  3AKT A;  3M3Q A;  1NCQ A;  5E6H A;  4P9L A;  1G9B A;  2MEV 1;  2R07 3;  3IKW A;  2YC2 A;  4OLL A;  3HQU A;  2LS6 A;  3H8X A;  1ASJ 1;  5C33 A;  4XIO A;  4LK7 A;  3H7J A;  2WSV A;  3M4F A;  4AFM A;  4P9J A;  5IVJ A;  5LK7 B;  1MZF A;  4DXT A;  2XGX A;  1OUX A;  4Q4Y 3;  4RFR B;  3VBS A;  2PHD A;  4YG0 A;  5A3O A;  3VHO A;  3NV4 A;  4CP0 A;  4BQY A;  4LO8 A;  3GHN A;  3ZYI B;  1DLL A;  3A23 A;  5BUV A;  1QH6 A;  1UL9 A;  5FMO L;  1XNB A;  1QOT A;  2BWA A;  2CGN A;  2R07 1;  4JRL A;  2W9X A;  4XHX A;  3VD5 A;  5LW9 A;  3U14 A;  3WT3 A;  2CU5 A;  4RS5 C;  4H2A A;  3DV8 A;  5EFU A;  5FYM A;  1JZ2 A;  1B09 A;  2YBK A;  3VV1 A;  5EQU A;  3WG4 A;  3BTY A;  1ZZ6 A;  1H2M A;  2VGD A;  2WZ8 A;  4JDM A;  1SLC A;  2D6M A;  2XBO 2;  1AL2 2;  2ETE A;  3G6J B;  3K77 A;  3IDA A;  3NW4 A;  1H2K A;  4HVR A;  4XDQ A;  3WNK A;  4S2G A;  2P4E A;  5F5A A;  5I91 A;  2ZGR A;  3VL8 A;  2YXS A;  3OSD A;  1LHO A;  1Q8S A;  4IV3 C;  4Q4W 3;  4AW7 A;  4EZH A;  2XML A;  1V00 A;  4PDW A;  1LGN A;  2JWP A;  4YZ3 A;  2DBI A;  2J1U A;  4KNC A;  4CTE A;  3OJB A;  1TQ5 A;  1LHV A;  1EAH 2;  1DQ6 A;  2P37 A;  2JE8 A;  3ATG A;  1CJD A;  4YVS B;  3K4Z A;  3TN9 2;  5FDB A;  4AVT A;  4IEQ A;  4K8F A;  3GHM A;  1HJF A;  1SCR A;  4OHW A;  4JHZ A;  2P3I A;  2VVD A;  4Q4W 1;  1W6O B;  3A0K A;  4BE3 A;  1B35 A;  4FXG B;  2GSY A;  3GZE A;  4EJR A;  1XU2 A;  2IUW A;  1W6N A;  2DU0 A;  2LM3 A;  3BPS A;  1WCU A;  4V1P A;  4K8R B;  2WII B;  1OUR A;  4QX7 A;  1ND2 A;  2PAM A;  2YPJ A;  3SLI A;  2TEP A;  2FMY A;  4XAB A;  3VD3 A;  5JZG B;  2BEO A;  4NUB A;  3ZSE A;  2DBN A;  1BBT 3;  4OUM A;  1OXC A;  4AI9 A;  1C8N A;  1Y43 B;  3PMS A;  4PF1 A;  2JG9 B;  5JI9 A;  1BK1 A;  2OUJ A;  2UY9 A;  1RUH 2;  1OH3 A;  3GZU C;  3D3A A;  2WLQ A;  5FMB A;  1Q43 A;  2BZD A;  1RMU 2;  1D0G A;  3KB5 A;  4YZ1 A;  4I0B A;  3FZ3 A;  1HKD A;  4IEZ A;  5LA2 A;  5F1R A;  3HVD A;  1O8S A;  1BBT 1;  1FYU A;  4IEV A;  4I0W B;  3HN3 A;  2R32 A;  1JU3 A;  2Y6H A;  3ZFE A;  2WSU A;  3E1F 1;  4HZF A;  2W47 A;  4DXZ A;  2A73 B;  2YC4 A;  4RL7 A;  4XIK A;  1MEC 3;  3P3P A;  4RHV 1;  4XE9 A;  4FSJ A;  5EZW A;  5A7P A;  3SMH A;  3VKF C;  3WOG A;  3O5S A;  4MLO A;  3DXU A;  1UOJ A;  2G4I A;  4YSF A;  4AF9 A;  5JI7 A;  1SEF A;  1QNW A;  1QQP 2;  1X9P A;  3C3V A;  1GOF A;  2GC1 A;  3CJX A;  4GKY A;  5FZ7 A;  4AWD A;  1ENS A;  1X33 A;  1MEC 1;  5KR7 A;  5IWF A;  5B2G B;  2ORZ A;  2BDR A;  2XL7 A;  3OD0 A;  4YGE A;  2DCT A;  4ZXK A;  4Y1V A;  2OQ6 A;  2FQP A;  3DEC A;  3JZV A;  3LA3 A;  3E5Q A;  5BNO B;  4JQR A;  2XXZ A;  4YWA A;  2JDZ A;  2DVG A;  1DDL A;  1QHD A;  4LEJ A;  3PL0 A;  4J1X A;  4Y22 B;  3IDB B;  1W9S A;  4LBO A;  4AGV A;  1EPW A;  4Z1V A;  3HEI A;  5EHD A;  4FBF A;  1LRH A;  1YFY A;  5C3Q A;  2FCT A;  4IEP A;  3AKR A;  4YVS C;  5FLI A;  4LIV A;  2BQP A;  2W1W A;  2VBB A;  3WDW A;  2VAU A;  1E5R A;  4JX0 A;  3J4U H;  2GP5 A;  1PMJ X;  4JTN A;  3UKN A;  3HMY A;  5CA6 A;  1MS3 A;  5ABJ A;  4M3C F;  5KXD A;  1VMJ A;  4E8D A;  3QCW A;  3M2M A;  1XNC A;  2DF7 A;  2ZA9 A;  2QQU A;  3QOP A;  1OVP A;  3LEI A;  1DZR A;  1CGP A;  2WZR 2;  2Q1F A;  3RG0 A;  2VVE A;  2WYF A;  4FI9 A;  5A70 A;  4KQ7 A;  1NLS A;  1Q8V A;  3O1O A;  1CWP A;  1X82 A;  2ZMN A;  3HT1 A;  5I0U A;  3NKG A;  3WLU A;  3LE0 A;  5JZG C;  1UY0 A;  4AAP A;  2GN3 A;  5LA1 A;  2AAC A;  3BOP A;  4P14 A;  1UYP A;  2ZGO A;  1UX6 A;  3IBM A;  4YLZ A;  4BYY A;  2WQZ C;  2JG9 C;  4EN7 B;  5FZ0 A;  5HCF A;  4L0P A;  3V0B A;  1SBD A;  1UKR A;  5FZH A;  1IG3 A;  1LB2 A;  2GAU A;  5FR3 A;  3QBQ A;  1KJR A;  4JGZ B;  3UGG A;  2ZGP A;  2BRT A;  2J22 A;  3S5A A;  1FAY A;  2E6V A;  1YIP A;  4LK6 A;  1PGL 1;  2WO1 A;  4CU7 A;  2ZML A;  1FNZ A;  2K9Z A;  4PHZ A;  5FP9 A;  3IDC B;  4UXA A;  3ENR A;  1VAM A;  1RVF 1;  2VCM A;  1UX7 A;  5FQ0 B;  4AI8 A;  2NQY A;  3HIF A;  2TNF A;  3AZY A;  2B4K A;  3KCC A;  2Z5W A;  3W9A A;  1SLA A;  3AYD A;  4L97 A;  1CAU B;  2OYZ A;  5FYU A;  4EZ4 A;  3NJY A;  1PK6 B;  3VBH B;  5CFD A;  1K5M A;  1WLD A;  3QAC A;  5LZ6 A;  2VW1 A;  3ZN6 B;  4E4H A;  1NXM A;  1ULP A;  1TNR A;  3I59 B;  1EUU A;  3AFK A;  1AYM 1;  2PMW B;  5FXZ A;  1ZBA 3;  5GLT A;  2X05 A;  5LA9 A;  4HVQ A;  4BIO A;  3DYM A;  5JXI A;  5M0T A;  4NN0 A;  4GJZ A;  5BNO C;  4K7J A;  3QD6 A;  2MPF A;  5EIY B;  4QHO A;  1G9A A;  2EIG A;  1A6C A;  2GC2 A;  3J7H A;  2WN2 A;  3JBG 2;  3T4V A;  1RHI 3;  2YGM A;  2B9V A;  1NLQ A;  4IV1 B;  1S0C A;  3CF6 E;  3RI9 A;  4AVB A;  3LQC A;  4LLF A;  4D7Y A;  1C8M 2;  4JGY B;  5DZG A;  4NIH A;  1RUG 3;  1YQ5 A;  3LFM A;  3LF7 A;  5T50 A;  3ORJ A;  3AYA A;  1OQD A;  3E6D A;  3OYW B;  4L2N A;  1BVV A;  4YG3 A;  4FPF A;  2P3K A;  4GMP 0;  1KIT A;  3I2I A;  4KL1 A;  5DAW A;  2R16 A;  5LBF A;  2WO3 A;  4P9Y A;  1HDK A;  4HVO A;  1RUC 2;  2E7Q A;  1O3T A;  3WQ7 A;  1DQ1 A;  4BQ5 A;  4E4Z A;  1RUG 1;  2D43 A;  3MIC A;  5J36 A;  4J1W A;  4ORF A;  1PGW 1;  4YW7 A;  1CVN A;  5EPA A;  3VHN A;  3UNP A;  4IEY A;  4E27 A;  4AL9 A;  1R1A 3;  3H42 B;  1S2B A;  3N9M A;  2IZW A;  2EIB A;  4GZ9 A;  2JKX A;  4N8M A;  1HQW A;  1RUE 3;  3KGL A;  5CKM A;  4JGZ C;  4GAZ A;  2Z69 A;  1FPN 2;  4Z07 A;  4K1Z A;  4CCD A;  2ZEZ A;  2HH9 A;  5C8C A;  1WME A;  2JIJ A;  4AEK A;  1QJY 2;  1DQ0 A;  4Q2F A;  5T55 A;  1TE1 B;  2UWA A;  2VUA A;  3L2H A;  1YEW A;  1UCX A;  2R1B A;  4PJY A;  1F4A A;  3ZPO A;  4XXP A;  3WW4 A;  1D2Q A;  2XWB B;  1CZV A;  3BN6 A;  5IFP A;  3WIN E;  5EYX A;  2ZAH A;  2Y6G A;  5A33 A;  4Q4V 2;  1RUE 1;  2VW2 A;  3CZU A;  3ZIW A;  1T6G C;  1UNB A;  1XSR A;  2Q4S A;  2Y60 A;  1JBC A;  1JMU B;  4R4Z A;  4FTE A;  4N90 A;  4QPW A;  4V2W A;  5A32 A;  1PK6 C;  3VBH C;  3OF1 A;  4BZ4 A;  3IPV B;  4HPK B;  4OFG A;  3MID A;  1SFN A;  2FDH A;  2FZ2 A;  2Z2S B;  5JR7 B;  3WF4 A;  1VRH 1;  2A75 A;  3I3D A;  3IAP A;  3OBR A;  3KGZ A;  3LDR A;  4LTA A;  3UV9 A;  5KBF A;  4CCL A;  1A3K A;  2YFU A;  5FRA A;  2AUY A;  4BQW A;  4IEX A;  3GYD A;  3LIG A;  3ZPY A;  3LDB A;  2ZAC A;  3UET A;  3HBK A;  1LOA A;  3EBR A;  4PCR A;  4LBK A;  3KVB A;  2VPV A;  4JTO A;  2A6X A;  4OZX A;  4AI0 A;  2QJV A;  4IV1 C;  2ZAA A;  5L73 A;  3SKV A;  3WF2 A;  4AEJ A;  4E2S A;  2F4P A;  1V70 A;  4C0B A;  4GWJ A;  2ARC A;  5DZF A;  5LRS A;  2F17 A;  2NLR A;  2YPD A;  3LIH A;  4JGY C;  3O1U A;  3BIW E;  4QT6 A; 
#chains in the Genus database with same CATH homology
 5FZ3 A;  4NUB A;  5LY1 A;  3LD8 A;  4AI9 A;  2PXJ A;  2OX0 A;  5FZD A;  5A7S A;  4E4H A;  2GP3 A;  5CEH A;  4ASK A;  5FUP A;  5FY5 A;  5FWE A;  5FXZ A;  5IVB A;  3ZLI A;  4Y33 A;  5FZI A;  3N9P A;  4GJZ A;  4BXF A;  4EYU A;  3N9Q A;  5IVC A;  5FYC A;  5FJK A;  2OQ7 A;  5ISL A;  5FZ6 A;  5LWB A;  5A7W A;  5FJH A;  3K3O A;  5F5C A;  5IW0 A;  5A7O A;  5IVV A;  3KV6 A;  5A7N A;  4TN7 A;  4Y4R A;  2XUE A;  4BU2 A;  3AL6 A;  5FY7 A;  2YU1 A;  5FZA A;  5F5I A;  5FY9 A;  4QXH A;  5A7P A;  5FZC A;  2YU2 A;  5KR7 A;  2OS2 A;  3DXU A;  4LIT A;  4V2V A;  5FBJ A;  5FZ4 A;  3K3N A;  2VD7 A;  3OPW A;  5F2W A;  5FZB A;  4QWN A;  4BIS A;  3PTR B;  5FYH A;  3N9N A;  4D6R A;  5FYY A;  4DO0 A;  5F39 A;  4UF0 B;  5FZ7 A;  5FYB A;  4DIQ A;  3AVR A;  5IWF A;  2Q8C A;  5IVF A;  5F3E A;  5A3W A;  5E6H A;  4D6Q A;  3N9O A;  2OQ6 A;  5F37 A;  4EZ4 A;  2WWJ A;  3PU8 A;  3DXT A;  2XXZ A;  5FY1 A;  2W2I A;  5FXX A;  5LY2 A;  5FP7 A;  5IVJ A;  5FP8 A;  4IGO A;  3N9M A;  5FPL A;  3N9L A;  5ANQ A;  5F32 A;  3PUA A;  3KVA A;  5FPB A;  5FY0 A;  5FP3 A;  5FZ8 A;  5FZF A;  4GAZ A;  2P5B A;  4LIV A;  5F3G A;  5FY8 A;  5FPU A;  5FXV A;  4CCJ A;  4HON A;  5F3C A;  5LW9 A;  2WWU A;  5FZO B;  2GP5 A;  5FPA A;  4HOO A;  3KV9 A;  5A3N A;  3ZPO A;  1VRB A;  5FYM A;  3U78 A;  2YBK A;  3U4S A;  4XDP A;  2YBP A;  5A7Q A;  3PUQ A;  4QXC A;  4Y3O A;  4QXB A;  3PDQ A;  4CCK A;  5FZ9 A;  4V2W A;  4XDO A;  5FV3 A;  5FY4 A;  3KV5 A;  5F5A A;  5FXW A;  3UYJ A;  4CSW A;  5FZK A;  4AAP A;  4LXL A;  5FYI A;  5A3P A;  5FZM A;  4EZH A;  4UF0 A;  5A80 A;  2XML A;  5FZ0 A;  5A7W B;  3K2O A;  4CUG A;  5A1F A;  5FWJ A;  5FZH A;  4IGQ A;  4CCL A;  5IVY A;  5K4L A;  4QU1 A;  5FYV A;  3PUR A;  4CCM A;  4GD4 A;  5FYT A;  2Q8D A;  2YBS A;  3LDB A;  4CCO A;  5A1L A;  5IVE A;  3RVH A;  3PUS A;  5FZ1 A;  4IGP A;  4URA A;  3KVB A;  5FP9 A;  5FZE A;  5FPV A;  2OT7 A;  5F3I A;  5FYZ A;  3KV4 A;  5F2S A;  3PU3 A;  4D6S A;  5A3T A;  5FP4 A;  3OPT A;  4QX8 A;  4C8D A;  5FZO A;  5FUN A;  4QX7 A;  2Q8E A;  5FZG A;  3AL5 A;  2YPD A;  4GJY A;  3AVS A;  4LIU A;  5FYS A;  5FZL A;  4CCN A;  2XDV A;  5FYU A;  3NJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...