4BQ3A

Structural analysis of an exo-beta-agarase
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
747
structure length
740
Chain Sequence
b'SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLENDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 253
structure length 740
sequence length 747
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq3A02
2JFEX 5A6SA 5A6BD 1H4PA 1W9DM 5D21A 1OB0A 2OLHA 2WVVA 1J12A 1QNSA 2W62A 4FLRA 3CUFA 2WNWA 2JIEA 4JFTA 5D8ZA 4EANA 3UG4A 3T09A 2UWFA 1W9VA 3VTRA 5A3HA 4W7VA 5D8WA 3GTNA 2EPLX 3AQUA 3CUGA 3WEOA 1HJVA 1MQRA 2Q1FA 1I1WA 3ZIZA 2CXGA 2GJPA 4ZEPA 3FXYA 2BV9A 3CZEA 2WAGA 3L4YA 2EPNA 5CQ1A 4AZBA 1E6NA 1JDDA 4GO9A 4MJ4A 1C3FA 3PZTA 3NJ3A 4R27A 3U57A 1CYGA 1W3KA 1D3CA 2VQTA 4DM1A 1EO5A 1W1YA 4M80A 1GZJA 2VJXA 3WDJA 3U7BA 3VIMA 5ABHA 4JFUA 5GNYA 3QHNA 3AHTA 4GO8A 2WBGA 4XZBA 4JKLA 2JE8A 1E40A 1GHRA 4WSJA 1QBAA 4D71A 2WYSA 2J7GA 1X6LA 2ZOXA 5BXRA 2CHNA 2WHKA 2WLZA 3QHOA 3OGSA 3RPMA 5ABGA 3MSDA 3DHPA 3D3AA 2X8RA 4HMCA 1QW9A 4PMDA 3OZOA 3BAKA 4OUEA 4AZHA 1V6VA 4W84A 4B9YA 5BCAA 2BNJA 3WNMA 1NP0A 4AZCB 2VRKA 3I3BA 3WF3A 3A4XA 3ZJKA 1UR2A 1CLXA 2JF6A 2UY2A 1GOOA 3AIVA 3PTMA 5A2AA 4UQCA 1V02E 3MMUA 1OIFA 1O7AA 1LJYA 4CU8A 4P7QA 1HL9A 4YPJA 1GQJA 3LPOA 3VD3A 3AZTA 2XIBA 1EOMA 1OINA 2O9TA 5A6BA 3M7SA 1WMXA 1XH1A 3EDEA 1HP5A 2VX4A 2XGIA 4CN4A 4HMDA 2D0HA 1ESWA 3ZJ7A 1H09A 1UKPA 1OT1A 4NI3A 2DGAA 1XH0A 5GPRA 1UKQA 3JUGA 1AMYA 4NF7A 1B0IA 1TUXA 1KBKA 1HN0A 4QLJA 4NZCA 2YKKA 3VIKA 3WH8A 1ZU8A 1BAGA 2O9PA 4HA1A 1R86A 3VDHA 3VM7A 4CU7A 1UH4A 3BGAA 2WC7A 5A8PA 1GCYA 3OG2A 5ABFB 2VZTA 5FOOA 3UT0A 3ZT6A 1BSIA 1VIWA 3L2MA 1LG2A 4LKFA 1FH7A 3NUKA 1J18A 2GDUA 3A4AA 3VUPA 2EBNA 3AZRA 1ISZA 2A3AA 4BQ5A 3VGFA 2WM0A 1CLVA 3PZ9A 2VZOA 3AIWA 3SCTA 2VX5A 5D4YA 4MDOA 1HJSA 3EDKA 1H1NA 4H8HA 5IXEA 3AHZA 1VRXA 2YJQA 3RILA 4PMNA 1E4IA 1FP8A 5EFDA 4FK9A 1TMQA 3B9EA 3RM8A 3O2LA 4IM4A 1CEOA 1I1XA 1ZS2A 1U30A 2EQDA 1AQHA 2VURA 4J27A 3UCQA 1Q6EA 3IAPA 1WDRA 1JZ2A 1GOKA 3E1F1 2GUYA 2WKGA 4P7NA 4U3CA 3TP4A 1KBBA 1EHAA 3SCSA 3AMGA 2VUYA 1ISYA 5D9PA 1CZ1A 3ALGA 2WHMA 1BVNP 1E43A 3OGVA 1W9XA 4F79A 2G3JA 1HKJA 7CGTA 3RO8A 2RGMA 3ZYHA 4GINA 3KZSA 4QCFA 4XB3A 2ZX5A 1CWYA 1C8YA 1D2KA 3VNZA 3AJ7A 3MO4A 2XHYA 4L4OA 9CGTA 2E40A 5ECUA 4RE3A 1XV8A 1FHLA 1JNEA 3TTOA 4W8AA 1JD9A 1UWUA 5CPQA 1JZ6A 3KL5A 1W8TA 2X0YA 4ZE4A 4YWAA 2VVNA 2VX6A 4JFWA 3QHMA 4LK7A 4JZ5A 3VU2A 4PTWA 3B8SA 4P7OA 5JIPA 4GI8A 2WHJA 3WELA 1KCKA 4HP5A 3O9NA 1LWJA 3L4TA 4MNKA 5KEZA 1EHNA 1M04A 4AMCA 4E8CA 3AIEA 3WD3A 2V3FA 2QV4A 3IK2A 1FH8A 1UQYA 2BS9A 1UZ1A 1BQCA 1XD1A 1V6UA 5I6SA 3IAQA 4PSRA 2W63A 1VBUA 1UD5A 3AMLA 1ISWA 3CPUA 2Z1SA 4D6CA 4AZCA 1CENA 3IJ8A 3WDPP 1TE1A 1UOKA 4PCTA 4M8UA 5M03A 1PBGA 3T2QA 4MNMA 1FFQA 1JYVA 1EH9A 3SUWA 3VM5A 1V0AA 1B9ZA 4CD7A 1UD8A 2V3GA 2YDSA 1H41A 3WDIA 4CD4A 5LYRA 3ZOAA 2GFTA 3T2OA 1BG9A 4C7FA 2CBUA 4GIAA 4HOXA 2EO7A 3LMYA 2X05A 1NOUA 1TA3A 1VEOA 4FLQA 4CD8A 4XX6A 1WP6A 8A3HA 1W3HA 4D6JA 1OH3A 4CCDA 3SURA 1A3HA 5LA1A 4GZIA 3W6LA 4B16A 2O9RA 4Q7NA 4U2ZA 3SCOA 1W3LA 4JKKA 3AS2A 2OYLA 1ZJAA 1HVXA 3OLEA 1V02A 2WBKA 3CMJA 3SUUA 1SMAA 4AD2A 2NW0A 3WD1A 3WNOA 2CITA 1GWKA 1PPIA 3OGRA 2QMKA 2WMIB 4B15A 1JYNA 3OZPA 1NWUA 4JHZA 4W7WA 1QOXA 4GZEA 3ORJA 4MPKA 4WKHA 1TZ7A 1IT0A 3GZAA 1G5AA 4AXNA 4OIFA 1UWQA 4W88A 1E1EA 2YBUA 1BYCA 1XYFA 1BYBA 3WH5A 2WZIA 4Z2HA 7TAAA 2D0FA 3CUIA 4H7VA 1CGVA 1WE5A 2GJRA 4TVUA 3CO4A 1LL4A 4MB4A 3GNPA 5KZ6A 5E6ZA 1GONA 1Y7VA 3CTTA 2DEPA 2VX7A 1BGGA 2LRPA 4OOZA 4OKDA 1HX0A 2PWGA 3WF2A 1XHGA 3RCNA 2FGLA 4M82A 2ZXDA 2D3LA 1JNDA 1W32A 2E0PA 2WVSA 3GH7A 4WKFA 1KGUA 3AHVA 1K9TA 2GJXB 4J3TA 1QPKA 1YQ2A 1S46A 3GNRA 4P8VA 3TTSA 3VMPA 4ATLA 3PZNA 3M46A 2XPKA 2W5FA 2DH3A 4P8UA 3PHAA 3THCA 1X1NA 5CPTA 4CD5A 4N42A 5DEZA 2NT1A 5DT5A 2VMFA 1E0XA 2DT1A 2GVYA 5HDRA 1E55A 1RPKA 1N82A 1UH3A 1V3MA 3VIIA 3DHUA 4BQ4A 3VX1A 1OGBA 2J7CA 2PC8A 1R85A 2BY0A 1HKIA 1DWIM 5A6LA 1Q4NX 5DO8A 2E8YA 1CGYA 3WFLA 2BHYA 4JL1A 2WMHA 5AC5A 3K46A 2YDRA 3UG3A 3VMOA 1OM0A 1F4HA 4D1JA 1UR1A 4R5EA 3PZMA 3LPGA 1UH2A 3L4WA 2CBJA 4CKQA 2YA2A 1C8QA 4H41A 4PMVA 2GSJA 2KR2A 2A3CA 1J01A 2VNCA 4UZUA 3CZKA 5EB8A 2PWHA 2CEQA 2YL9A 1MW1A 1DWJM 3ARZA 5D9OA 4ZXOA 2AAAA 2WCSA 5E0CA 1UD2A 3W24A 4AIEA 4ACZB 1VBRA 2XFRA 4C7GA 1ZJBA 4PTMA 3ZJ6A 1BHGA 3S6TA 3T0BA 4Z2GA 4D72A 4TTGA 5BRPA 3SIMA 2WYFA 1UD3A 1G0CA 3WIJA 2ZUTA 2IXVA 4HMEA 3BXWA 5TD4A 5AYIA 1UZ4A 2B31A 3VIGA 1OBAA 3D5HA 4J3XA 1ECEA 2CBVA 1WZAA 4UR9A 1HL8A 3VIJA 3WN6A 5AC4A 2F2HA 4PUDA 2D23A 2X0HA 1HVQA 1V03A 1BVZA 3SCQA 3GXIA 4TX6A 3WSUA 3AXHA 4ZE5A 3WUEA 3MV01 2XVGA 3AS0A 4QAWA 4DUWA 3FN9A 3OLDA 1UR0A 3ARWA 2D24A 4MAZA 2EPKX 1E9LA 1PIFA 1JF5A 1UWIA 2WMJA 3EDDA 1VEPA 5HOSA 4CVWA 2W66A 1GOQA 1VFOA 3EMQA 3AYRA 1MVYA 2YL8A 5CLWA 1EDGA 4W8BA 1RP8A 2AOSA 1DP0A 1PIGA 1HF6A 3EDJA 1RP9A 2WVTA 2VO5A 2C8NA 2WMIA 1DWHM 2ZXQA 2EJ1A 1WDPA 4IPNB 1CBGA 4AD3A 5HBFA 4D6HA 1M01A 1V0LA 2ZUMA 3DYPA 2VXJA 1R7OA 5LA0A 5BYWA 3W38A 5A69A 1A47A 1J0KA 5I5RA 2D22A 1PZ2A 1JG9A 2BVDA 1HN1A 1OT2A 3WQWA 4OBSA 5FL0A 1J11A 2VCBA 4AD0A 1MQPA 1NWTA 4KH2A 4TXEA 2DT0A 5A6JA 1VFFA 3N13A 4D6FA 1ITXA 1JAKA 1V6WA 3AICA 1M03A 2CIPA 4UQDA 1NOWA 4FLSA 1GWLA 5HPOA 2J7HA 3WMSA 3AS1A 2GJXA 1UYQA 4GQQA 3WQ4A 1ODUA 1M7XA 1WZMA 1W9BM 4CGTA 1DEDA 2WVUA 4D6IA 2CKSA 1F4AA 4OJYA 1HP4A 1QHZA 3FNDA 5I77A 2ZX8A 3N18A 4U5KA 3ZSSA 4CPBD 1W1TA 1XCWA 3WD0A 1R7AA 1JDCA 1HJUA 3RMEA 1HIZA 1WCUA 1UWRA 3F5KA 1W3JA 4MNLA 2DT3A 1V08A 1BGAA 1QI2A 4TVDA 4PMXA 3KL0A 5JBEA 2AMGA 3UR8A 4B9ZA 1L0PA 3AYSA 3F5LA 3BAYA 3BLPX 4LYPA 4ZFMA 3WEZA 3AOFA 4AZ7A 1IV8A 3BAJA 4OZOA 2XVPA 3MANA 2FHCA 1ODZA 4X9YA 1GNXA 5CPSA 4F8XA 2VZUA 4U31A 3EDFA 3PTKA 2WPGA 1LWHA 3AIBA 3MV11 3T2PA 5I23A 1M53A 4J7RA 3UR7A 4ACZA 4F66A 5A6AA 3RM4A 1U2YA 4D6GA 3LPPA 2XUCA 2CERA 1UQZA 3GXFA 3VINA 2WMFA 1W90A 1OD8A 2XSBA 2BXZA 2MANA 1MW2A 3AFBA 4S3JA 3W4RA 2PI6A 5IHRA 3EMCA 4OBRA 1QHOA 3U7VA 3W0KA 4A6SA 1LF1A 3WEMA 1MFUA 4W7UA 5FCZA 2WZHA 2CNCA 1H3GA 4D6EA 1OCQA 1UKTA 3WNKA 2E9BA 3W53A 3ARUA 3VD5A 4E4PA 3CGTA 2CBIA 3POCA 5AYBA 1GOWA 3BSGA 4CD6A 2V5CA 2X1IA 2VTFA 4H8VA 4UFMA 1XGZA 3WF4A 4CPBA 1Q6DA 3WUFA 4IUGA 4TUFA 4X0NA 1C90A 4BQ3A 2C7FA 2J74A 4MNJA 3CIVA 2VCAA 2WK2A 2G8ZA 3NYDA 3WY1A 1VAHA 1W2VA 2BY3A 2WHLA 1PEZA 2J75A 2Y4SA 4UQ9A 2XWDA 5E6YA 3TONA 1R87A 4AISA 1UWSA 1GJUA 1E4NA 1V0KA 3QOKA 3RJXA 1C8XA 3GDBA 1UG6A 4LPCA 8CGTA 1CPUA 4JHOA 2WB5A 1Q6CA 5A8NA 3OIHA 3U5UA 2J78A 2WANA 3L2LA 3VIOA 5I78A 3VKKA 3WH9A 4MB1A 1BYAA 4WJXA 1FA2A 2UY3A 4MB5A 4P8WA 4JL2A 2VR5A 2DPEA 2XFFA 4EK7A 1NP2A 1G01A 3DYMA 3WMCA 5HPCA 5C71A 7A3HA 1V3KA 4AWEA 4HA3A 3VIHA 1CXEA 1JDAA 4LJHA 1KB3A 2OYKA 4CCEA 4AZ6A 5JBDA 5GQBA 4KGLA 2CKRA 3A47A 3AIUA 1DWAM 4JFSA 1UR9A 6CGTA 1BFNA 3F5JA 3N17A 3LPFA 1XSJA 4CCCA 1E3XA 3ZM8A 1CXFA 3G6LA 1YHTA 1E6PA 1E72M 1OSEA 4OOUA 3K8MA 1QHPA 3MUIA 5ABEA 1B30A 2GDVA 4RE4A 4HU8A 3ZR5A 3K1DA 3ZT5A 1QBBA 3GBEA 2D1ZA 4U3AA 2DSKA 1CTNA 3K8LA 4NRSA 4E8DA 3VX0A 3I3EA 3FAWA 1B3ZA 3OLGA 1B90A 2PWDA 1E6SM 3CMGA 1IZJA 1B1YA 1KXQA 2OSYA 1B3XA 4UFLA 2WC4A 2FH6A 1SMDA 2FGZA 3BLKA 1QNRA 3OLIA 3GH4A 1EOKA 1W9UA 2YIHA 4AW7A 3AMCA 4EKJA 4PMOA 3PZGA 2XVKA 1JD7A 3QGVA 4ACYA 4LYRA 1PX4A 3SCVA 2TAAA 1VF8A 4LKDA 2OWXA 1JZ5A 2C24A 2XVNA 4BQ2A 1H0GA 1UUQA 3AIRA 1CGUA 5A8OA 2JALA 4WF7A 3DC0A 1V6XA 1U33A 3UERA 2XJ7A 4W5UA 1PZ3A 1SYTA 1KWGA 1OGSA 1HKMA 3CZJA 1W9PA 2BFGA 2ZUVA 3KEHA 1J0IA 3AMKA 1ISXA 5ABFA 1UHVA 4UQEA 1VENA 5HNNA 5D9NA 4J3WA 1NARA 3DECA 4M1RA 2VI0A 1ZBKA 2GK1B 3ZJ8A 4U2YA 5F7UA 1ZBWA 1H2JA 3W28A 4QLLA 4PMUA 1CGTA 1H0IA 1US2A 1QNQA 2WVVB 2VR4A 4NRRA 5EFFA 2QLYA 1HKKA 4EAMA 3IJ9A 1JYWA 3M6DA 4J3SA 4P7RA 2PB1A 3CZGA 3KL3A 2XIIA 4QFUA 1QNOA 1KGXA 2DDXA 1OD0A 1KQYA 1L8NA 1CXKA 4JCMA 5I2UA 4WK9A 2OWWA 1ZB5A 3KWXA 2C0HA 3WUGA 4HTYA 5I79A 4B3LA 1JZ7A 1NOFA 5FKYA 5A1AA 4IPLA 3AIQA 4D1IA 3N04A 4WLCA 1BPLB 3UESA 4FF5A 1W8WA 4YW6A 3NDYA 2PF0A 4CU6A 2X2YA 3VDCA 3CHFA 2G3MA 1SR0A 1QI0A 3SCNA 2YLAA 3HMCA 3N1AA 1KXTA 3WNNA 1UA3A 1BG4A 2XFYA 1E70M 1V3LA 3VD9A 3FHQA 2K46A 6TAAA 4S3KA 1UA7A 3AS3A 2WCGA 4XV0A 1TG7A 1XD0A 3A6OA 3MUZ1 3BCDA 4WIWA 3NDZA 1KFWA 4N0RA 3J7HA 3EBVA 5FL1A 4DWSB 1JXJA 4AZ5A 4Z2JA 2ZX6A 3AISA 4UFKA 1E15A 1CIUA 1E0WA 1KXHA 4UQBA 3PZOA 3FW6A 4P8XA 3ZO9A 4YN5A 4DM2A 5CJ5A 5E0FA 4PRWA 5BROA 3MUY1 1CECA 2ESCA 1JIBA 1CGWA 2O9OA 3APGA 3BMVA 3ZYBA 3WDRA 1EA9C 3ZT7A 5A2CA 1VEMA 2BHZA 4MDPA 3SUVA 3WQ8A 1MW3A 1E6XM 4LKEA 3ARVA 3CHCA 4LGXA 2ZXBA 5A6KA 1EXPA 1DWGM 1P6WA 3VIPA 1NWSA 2J25A 3WF0A 1WAWA 1HNYA 4W87A 2ZE0A 2XYLA 5IFPA 2UY5A 1AQMA 1HJXA 4AZIA 4GZJA 3UETA 1XCXA 3VIFA 2A3BA 2HVMA 2J7EA 3VMNA 2XSAA 2PBOA 3NSMA 3N12A 2WMKA 5C8BB 2FHFA 5BXPA 1Q6GA 4PUEA 3AHYA 1JAEA 2J77A 1J9YA 1QI5A 2IXUA 3I3DA 2YOCA 4L4PA 3MMWA 1BYDA 2OSXA 4Y7EA 2DH2A 3PZIA 1B3WA 2VVSA 3IANA 2CYGA 2D0GA 1E71M 4BZYA 2VRQA 1FP9A 1GQKA 1JFHA 1TCMA 3F95A 4DWSD 3GBDA 5JBFA 5FIPA 1HJWA 3WKZA 1JI2A 3CUJA 1OKOA 4HU0A 2DSWA 1WDSA 3CUHA 3S2CA 3UG5A 3THDA 5BWFA 1W8ZA 3PZVA 1BTCA 1K9DA 3WBAA 3II1A 5BRQA 2D3NA 5JIWA 3AROA 3RDKA 1E56A 5M17A 4GPNA 3NIYA 4P7LA 4AYSA 4MAVA 2GK1A 3W6MA 5I3DA 4Q22A 2JIWA 3VGEA 3WL0A 4XUYA 1BF2A 1Q6FA 4AIUA 4AZGA 5I0DA 1XRVA 4AD5A 3N9KA 3VOCA 4MTVA 2Y5EA 2WC3A 3AXXA 1JXKA 1VB9A 4J28A 2E9MA 4FMVA 3TA9A 5EBAA 1EO7A 1XC6A 1JFXA 1JGIA 2OWCA 2ZWZA 1FFRA 1K6AA 2QMJA 3IJ7A 3PZQA 2WW5A 2NSXA 2W91A 1GUVA 4PMZA 1E4LA 3SCUA 3CHDA 1GVYA 4QDMA 1V6YA 3L4XA 4PTXA 4HOWA 1OGGA 1UOJA 4UOJA 3MKKA 1UR8A 1KGWA 2OYMA 5E70A 5JUVA 1QI4A 5A2BA 1VFUA 1GWMA 1UKOA 4ZENA 3W26A 5LA2A 1KCLA 3CH9A 4FLOA 4PMRA 4CN1A 1TVPA 2XVLA 2WWCA 2JWPA 2ZUNA 4PSPA 1JL8A 2PBGA 3BMWA 1G94A 1V3HA 2G41A 1HXJA 3RJYA 3PZUA 3PBGA 1MXGA 3WH6A 4JAWA 1GORA 1MW0A 3VNYA 1JZ3A 3A4WA 2FHBA 3VGDA 2BHUA 3OB8A 1E3ZA 1J0ZA 1WCGA 3WMBA 2EEXA 1ZL1A 4NSBA 3POHA 3SCWA 3PTQA 4DWSA 4F9DA 2Y8KA 3WD4A 3T08A 1NQ6A 1J0HA 4TTUA 4CP9B 3VPLA 1US3A 1GJWA 2VCCA 4W93A 3WFZA 1QW8A 2OSWA 3MSGA 3WUBA 2DIEA 3NSXA 4UNIA 3VGGA 4X0VA 1E5NA 2DSUA 5DF0A 1I75A 3M07A 3GXMA 4DUVA 5DT7A 4K68A 2ZIDA 4A4AA 4U33A 3VGBA 1FOBA 2VZSA 4LX4A 2DT2A 4TOQA 2DSZA 1G9HA 3TTYA 4PN2A 1C7SA 1TA3B 4W89A 3ARPA 5CZKA 2WWDA 3SCPA 2WZEA 1C7TA 3CZ8A 3OBAA 4KRTA 3VVGA 3MMDA 1H5VA 1RD6A 4UFHA 2W61A 1QVBA 3MUAA 1KQZA 3WNPA 2A3HA 4GI6A 1CXIA 2QPSA 2WSKA 1E73M 3OA5A 1UKSA 4AL9A 2VZVA 5CGTA 3KE0A 3GYCA 4ATWA 3W37A 2YL5A 1CNVA 2BXYA 2CPUA 3O6AA 2XWEA 4GI9A 1WPCA 3BCFA 1VJSA 2W4XA 4LYQA 2O92A 3TOPA 1DTUA 1W1PA 2WXDM 4HZ6A 2W67A 1JF6A 3WNLA 2V5DA 3CLWA 5D9MA 3HU7A 2VRJA 3ARSA 4PMYA 4M24A 2BY1A 1E0VA 1CXLA 4W86A 2VC9A 1V0MA 2CCRA 5CLTA 1TVNA 4U5IA 1Z32X 1KXVA 2UY4A 1VFMA 1E6QM 3SUSA 4DUXA 4PCSA 2VT0A 1CXHA 1B3YA 1K9EA 4HOZA 1AQ0A 3EYPA 1G1YA 2Y8VA 5A6MA 3VD7A 1EQPA 2DIJA 1GOIA 1SFSA 4UFIA 1E6RA 4BA0A 3T0DA 1C91A 3RM9A 1GPFA 4WSKA 4IISA 5CGMA 3A3HA 2V3DA 2FDMA 2XG9A 2LROA 4MJ2A 3PN8A 3U5YA 4D6DA 4LXFA 4KWUA 3ARTA 2ZICA 1B3VA 2QPUA 2J8GA 4RE2A 5CXPA 4JKMA 3MS8A 4BF7A 2Z1KA 1W9FA 4Z2LA 1CDGA 2J79A 4J3VA 4AD4A 1PX3A 3CZLA 4HZ8A 2E9LA 3B9AA 1WZKA 2F61A 1KWKA 4PTVA 2J4GA 2XGBA 3N15A 2EXOA 1LG1A 5E09A 2ZX7A 4M29A 3FY1A 1E1FA 2WMGA 1EDQA 4UTFA 2J8FA 1W2PA 1UR4A 3WL1A 2QF8A 4W5ZA 3K8KA 3VDBA 2BY2A 1UD6A 1MFVA 1WZXA 1DWFM 1H49A 3GNOA 2WLYA 5A8MA 1V0NA 3SEPA 1AVAA 2E8ZA 3F4VA 1H11A 3DYOA 1R8LA 2YA1A 4JIEA 4PEEA 1NH6A 4CUCA 4TVCA 1J0YA 1FHDA 3WD2A 1VJZA 4CP9A 2Y24A 3FAXA 4W85A 4H2CA 1GHSA 4YHGA 5CSYA 1W8UA 1XSKA 1QNPA 2A3EA 3W27A 5IDIA 1ISVA 2G3NA 1TR1A 1XYZA 3AMDA 3FHAA 1GW1A 5DFAA 3WBEA 4AC1X 4GXPA 2ZUUA 4M56A 1EQCA 4H8UA 1JZ8A 2Y2WA 2PWFA 1UWTA 2YA0A 5E9AA 3GXDA 2G4FA 4GQRA 3VO0A 3ECQA 4CN6A 3BAWA 4QLKA 4UFJA 1RH9A 2J7BA 3RIKA 3WF1A 5A95A 1BLIA 1KR0A 4YW7A 4LK6A 1NM9A 1UD4A 4PYSA 6A3HA 3N11A 5FD0A 4URIA 1W1VA 2FH8A 4QP0A 2XM1A 2RGLA 5M3WA 4YHEA 4C7DA 3VGHA 1WKYA 2HISA 1XH2A 3GH5A 4ZXLA 3AZSA 2J62A 1PJ9A 4V2XA 1W91A 1ZBCA 4CVUA 2BVYA 4GKLA 4MB3A 4TX8A 1E4MM 4F9JA 3VILA 2DSVA 1LLOA 4RL3A 3BAIA 4DWSC 5DMYA 1C93A 1JZ4A 2JF7A 1NWRA 3WH7A 3BAXA 1ITCA 3AXIA 5CG0A 2XM2A 1XSIA 1GQLA 4ML4A 1DHKA 2D2OA 4HA4A 4AEFA 4ATDA 3BC9A 4MADA 4UCFA 2JEPA 2NT0A 4UOZA 2G3IA 1IZKA 1FH9A 4Z2KA 3QR3A 1WZLA 1E5JA 4UZSA 2PWEA 3T0AA 4M81A 1JI1A 3NCOA 3ZR6A 4W8LA 1B31A 2DQXA 4BS0A 1PX8A 1PAMA 4PBGA 4HPHA 4AD1A 5GNZA 1J10A 2YL6A 4Z2IA 5BXSA 3W29A 2QHAA 1MWOA 2CETA 1B2YA 1J0JA 3EMZA 3ALFA 1LL7A 5C70A 3NSNA 2J7FA 2VQUA 3W25A 3ARYA 3ZSTA 2YDQA 4E2OA 4JCLA 3UEQA 2ZX9A 4V28A 2J7DA 3BH4A 1E6ZA 3MU7A 3AHXA 1GVIA 3VD4A 5AY7A 3VDAA 3QOMA 3WDHA 5EMYA 2EPMX 2E3ZA 4UQAA 2CHOA 1X6NA 3B9DA 4UOQA 3ARQA 1L7LA 2CESA 1LL6A 5M5DA 2WSPA 2VOTA 3TTQA 1GQIA 4KMQA 1D7FA 2WCAA 2JEQA 2V3EA 3ARRA 1EDTA 3K4AA 1WB0A 1EIBA 3CBWA 1MYRA 1OIMA 1TFVA 2EPOA 3L4VA 4KGJA 4AEEA 4PMQA 3WQ5A 2YLLA 4B3KA 1O6IA 2E4TA 3K4DA 3SCRA 2ZUSA 2ZUWA 3AI0A 3L4UA 1WO2A 1WNOA 5I24A 5HXMA 2V38A 1V3JA 4KRUA 4LQ1A 1KR1A 3G6MA 5CSUA 4QCEA 2F8QA 2XTKA 1V3IA 3WQVA 2ZWYA 1LQ0A 1MXDA 1CGXA 3ZMRA 1JYXA 5A94A 5IHSA 2BVTA 2W92A 3WDQA 2IUZA 5IFTA 4HZ7A 4J3UA 1QI3A 2VL4A 5GNXA 2X09A 4A3HA 2Q8XA 4HPGA 3GM8A 3WQ6A 2D20A 5BXTA 1WDQA 1HJQA 3L4ZA 2O14A 3ZYFA 3BSHA 3CHEA 3W81A 1HT6A 2WKLA 4AY1A 3ARXA 4A3YA 1EGZA 4V27A 5A8QA 3HJEA 4H04A 4XZWA 1OWQA 4WKAA 3ZQ9A 4JFVA 1MQQA 3WENA 1GOMA 4BCEA 1C92A 2YBTA 2J47A 2ZXAA 3W82A 3HN3A 3SUTA 1K9FA 4AIOA 1ZBVA 4EE9A
chains in the Genus database with same CATH superfamily
5D21A 1OB0A 2YV8A 3W86A 2VDHA 2WVVA 3N9RA 1MQTB 1J12A 5CCZA 2EPHA 2W62A 4FLRA 4FSAA 3PC0A 1BLZA 4M7TA 3OVGA 4QHRA 1ASJ3 2Y64A 3UG4A 3H1YA 4WY0A 1YEWA 2P37A 3QBQA 2I5QA 5A3HA 2P3JA 3MPBA 3VCNA 2HV5A 4IV1B 2QCHA 3V0AA 1QJX1 1ZX5A 4BIFA 1B54A 4XZPA 1AJZA 5F39A 5D8WA 2PF8A 1EJ7L 3AQUA 3ES1A 1O5UA 1HJVA 3DAQA 3E0FA 4A6OA 2V09A 4ZEPA 4D8AA 2GC3A 1YMYA 1W99A 1ZYBA 4O54A 3SY8A 1WKFA 1W37A 1UWAA 4QQOA 1VFLA 1JDDA 1H2LA 4GO9A 4XDOA 2OQLA 2TUNA 3G3MA 3W1AA 1CYGA 4FO9A 1LGNA 5T3NA 1M41A 4HSLA 4GUGA 3TE9A 4KNCA 5LK7B 1WA6X 4Q5OA 5BOOA 4D7TA 2EKCA 1DYPA 3ZXFA 1G7UA 2ZMNA 5G1YA 4LV4A 1GR3A 5FJHA 1BVWA 3M3OA 2GMEA 2I5GA 5T55A 4C6CA 2JDYA 3LENA 2W94A 3R89A 2J7GA 4LUKA 3TLLA 1EX5A 4YGBA 1SLLA 2WHKA 1RUF3 5KXEA 4SBVA 4JICA 3OGSA 1UR3M 4GYJA 3RITA 4ZO6A 4D8LA 1L2UA 5G2IA 2OPJA 4XIMA 4PMDA 2RM22 2OPWA 2A2IA 3P3NA 3OZOA 3BAKA 4B9YA 1RXGA 4EIVA 2BNJA 3TIMA 2ZZQA 3RYKA 3CJIC 3WLLA 3ZJKA 3A4XA 3BQ5A 1WX0A 2NUXA 4LTSA 4ORIA 1O1ZA 1V70A 4OI2A 4XFBA 3FBYA 4XHXA 1LOQA 3P14A 4B91A 1RUC2 2YC0A 3N9NA 5BV6A 4P7QA 3DI1A 2WLPA 3IJQA 3VD3A 1HTIA 2F17A 3FS2A 2JGYA 1NCRA 3D0JA 3J7LA 4IEYA 4PBPA 2VX4A 2HYKA 3VOGA 2AH2A 5IOBA 2CLHA 3HGSA 3ZJ7A 3SH3A 3W1PA 1VKFA 2YGMA 1AL22 3AAMA 2CGNA 2PLV2 4M01A 1XH0A 4EZHA 1L7QA 4OI1A 4NF7A 5CYYA 1TUXA 3W7CA 3PMSA 4OMCA 1I45A 4NR1A 4NZCA 2RVAA 2EHHA 1O5QA 4Q27A 4GGBA 3KGZA 2RHGA 1E0UA 4FX8A 4BMBA 3M5VA 3P0XA 2CGPA 2QULA 3VM7A 5C55A 4CU7A 3TSDA 2HWC3 3MFCA 4NIAA 3H2AA 1XLJA 2VOXA 2NLRA 1FOD2 4GIEA 4Y5SA 4GUIA 2ERFA 2WC7A 4IE4A 4KPLA 1GCYA 5A8PA 3OG2A 3GNDA 2EXJA 1XG4A 4A45A 2GH2A 4DI9A 4R4ZA 2DF7A 1BSIA 1KTBA 2ARCA 4RHV1 4KBXA 3TAKA 4GYKA 3P1IA 2QBXA 2VUDA 1KFUL 1RGSA 2EBNA 4N53A 3AZRA 2YROA 2GSEA 3LA7A 4BQ5A 1RYYA 1Q3NA 3OU8A 4JHTA 3KBVA 2LLEA 3NWRA 2RS52 1D4VB 4Q33A 3XISA 5A7SA 2CLKA 4GIYA 3EDKA 4PRRA 2AKMA 3VB9A 1VRXA 3OZYA 1GYLA 4PMNA 1J83A 1E4IA 1FP8A 4L4LA 5DMLA 1OK6A 3W2UA 1W54A 4Q8KA 4Z8BA 1TPVA 1JN2P 1U30A 3ZYIB 3TJLA 2X29A 1AQHA 1LOFA 5A32B 3B4YA 2B7NA 5KITA 1JGMA 5M1TA 1MO0A 3GHSA 3E1F1 1RJ7A 2VOWA 2B0MA 3Q8BA 3LKJA 2WKGA 1TR9A 3BTXA 4A22A 3LXAA 1EHAA 1SLTA 5G2HA 3KBJA 2VUYA 2HMCA 4Y1ZA 1F5ZA 1BVNP 3ZFGC 3UG8A 1A6CA 3OGVA 1W9XA 3VNJA 1XC4A 2PYTA 3O1MA 1M9HA 3ZYHA 4GINA 1AW5A 3KZSA 5JI7A 4WCJA 5FKBA 3LCGA 3V65A 1C8YA 1CWYA 4S3GA 1C5HA 2ABAA 3QH6A 4RZBA 3GBGA 1R082 4Q8OA 5T5PA 1SFTA 3VA8A 4G2DA 3H7YA 1AF9A 5F2GA 1W8TA 1FXQA 4ES8A 2WOQA 4YWAA 2WAOA 5J3UA 3V18A 1Y5XA 3EX4A 4JTOA 4JFWA 1YYAA 3G1VA 3QHMA 4EACA 3VU2A 1FUYA 4GY7A 2RM21 4WV8A 5JIPA 2WHJA 4JGYA 5I3IA 3ID7A 1FNYA 1CAXA 4HHMA 4ZB5A 2K2SA 2GQ9A 2CV6A 4P9JA 1XKYA 1QJU2 4J40A 4Q0VA 1EZ2A 2BZNA 2V3FA 2QV4A 3FUOA 1FH8A 1OD5A 3LDKA 3GW3A 1UQYA 2EXIA 5I03A 2XBO3 3KF3A 4YW3A 1V6UA 5I6SA 3CV2A 3RZKA 5C3SA 4JVAA 2LALA 4PSRA 1FDJA 2ZZ2A 3UYIA 4WOQA 1GG0A 1LCLA 2IQTA 2GGIA 1CENA 4ZCWA 1TE1A 1OF4A 1CR7A 3THAA 1Q5MA 1MMFA 1GKRA 2DZAA 3WQPA 3FLUA 3T2QA 5CKMA 4MNMA 2PS2A 4BQWA 5SV5A 1ITQA 1GYKA 3SUWA 5FEXA 3VM5A 1V0AA 1AL21 5JAXA 4LLOA 4NYUA 5FUIA 4LFYA 1H41A 3P60A 4IFKA 4LULA 2IPWA 1VPQA 4NY2A 5IT6A 5BMXA 3SO7A 3B01A 3BG5A 3R4SA 3L66A 2G96A 4AQ2A 3LMYA 1GOFA 4K9SA 3QYQA 5E0KA 1UY3A 4QPIB 5DX7A 4Y5TA 2QV5A 1WP6A 5T8GA 3OYZA 4LAZA 4BISA 4CCDA 1S2AA 4H6QA 4AHXA 4CDWC 2PDYA 1WBHA 3W6LA 3KCJA 3HZ3A 4GKYA 1VB4A 1Q43A 3SCOA 4JKKA 1FWGC 1W3LA 3EWYA 3AALA 4KWVA 2EG6A 4RGAA 3OLEA 1AJOA 5F1RA 1NOVA 1SMAA 3F1QA 3FL7A 3TEWA 1YADA 2WNZA 1W9WA 1GWKA 1UPSA 2DVTA 4Y9NA 2X40A 3DKLA 5K9YA 3HPXA 1QNVA 3OZPA 3ZMNA 2HPMA 1JHJA 4M3CA 3OYWA 1NE4A 5LGXA 4H7MA 2RS51 4M0NA 1IT0A 4M6PA 1O5XA 2VNVA 4S3BA 4HVRA 1UWQA 4I90A 4XKYB 1J3RA 4P9IA 2R073 2AYHA 1KC7A 4H7VA 4DI8A 1WE5A 5F2LA 2GJRA 4GUHA 3CO4A 1LL4A 5KZ6A 4XKMA 1GONA 1GW9A 5JDBA 1YKWA 4A35A 4PTNA 3ZLHA 1OOPA 2LRPA 4OKDA 2B7YA 1AUSL 1FMD2 5F5IA 3ZKYA 2VUCA 2Z28A 4MPQA 3M0HA 2BUKA 3S4TA 4ZQOA 2GC2A 1W32A 3GH7A 4JX0A 4WKFA 1ZBE1 1DLCA 1W2TA 4AXOA 3OBTA 5DG1A 3IK4A 1N3PA 1K9TA 1W6QA 4J3TA 1E0TA 2WFPA 1I0BA 4P8VA 3TTSA 4N9HA 3RU8X 1XBYA 4AQTA 2GJNA 2D2GA 3N4MA 4AZZA 4P8UA 3PHAA 3THCA 1Y7BA 4QSHA 4FPSA 4N42A 3AKPA 3A4JA 3REQA 1R3TA 4UWMA 3WLOA 5B4XA 3ALQA 2FZ1A 1VFHA 1NLRA 3D8CA 4JQAA 4D8MA 4C6BA 4WM8B 1IWPA 2P10A 1R081 2DT1A 4YWSA 1YIFA 1C9WA 3OUJA 4QDRA 2E5DA 4B5NA 1E55A 1UH3A 4MY9A 1V3MA 3ERPA 1OGBA 2QQOA 5HV0A 2IKGA 2PC8A 3HGOA 1XBFA 1VALA 4S2FA 5AC6A 1HKIA 5A6LA 4AQLA 4GLEA 3OCPA 3ZXKA 3KDOA 4JL1A 4HXCA 3WFLA 1LUCB 3I2FA 5AC7A 3ETQA 2YDRA 3KOWA 4DWDA 3ITYA 3UG3A 1QJU1 4IIHA 4LHKA 3ZFHA 1VP5A 5C4WC 1IS5A 3FXGA 2WNVC 2CBJA 5BPXA 4N6FA 1UY4A 1I2QA 4FFGA 3WDUA 3OTRA 4H41A 2BERA 4L6OA 2XH7A 2VZQA 2GSJA 3GWQA 5EL1A 1NA1A 1ZUAX 3EZ4A 2BVWA 3MB9A 3DHFA 5BNNB 3G1HA 4XAGA 4CCZA 1MW1A 4GIRA 4C6LA 5FZHA 2E5BA 3XIMA 5A6XA 3AYTA 4ZXOA 4GE8A 5A3OA 4P14A 4YS1A 1DTNA 4LUSA 5BW6A 4C7GA 1EJSC 5A7WB 2QJMA 2ZE3A 3B0XA 1RK5A 2WSUA 1X7NA 2W3ZA 4RR4A 1LRQA 4QHOA 4NNBA 4MGQA 5BRPA 5LCWL 1M7PA 1UD3A 1EJUC 1UPMB 2IXVA 1Y9QA 4FQ4A 4HMEA 5DUWA 3VDDA 1OJXA 2ON3A 3S6PA 4Y4RA 4A8IA 3VIGA 4Q4W3 3T7VA 3T78A 1ECQA 2W67A 3P5YA 3VOHA 3WN6A 2P50A 4BH9A 3APTA 3U4SA 4H4IA 4I8YA 1DXEA 1V03A 4UTWA 1D9EA 4TR9A 2A3WA 5FY5A 1XSQA 3P0WA 4LC6A 5B7ZA 2ET1A 5FZ7A 4PIXA 3MY9A 2NWSA 2ZGKA 3UK9A 3RUBL 1UR0A 3ARWA 2WNUA 2D24A 4C6DA 3OGJA 2NYYA 1OY0A 2EPKX 4AHZA 2QDEA 3N19B 4A3RA 1JF5A 3QF0A 3UZZA 3FMGA 5FK8A 5HOSA 3QV9A 3SECA 3W00A 3RRAA 1VYPX 1WW5A 4OI4A 2ANUA 1FWSA 1HF6A 1DGWX 3BLDA 1DFQA 5F3EA 4JDBA 3QSTA 1RP9A 3SH4A 5FR3A 3NNMA 2C8NA 4XUTA 1WDPA 2KD7A 1CBGA 4AD3A 2PU0A 1RTVA 2D69A 4DYEA 4RR3A 3GXNA 3S57A 1V0LA 2ZUMA 2WSRA 1EBGA 1XLKA 3M5ZA 3HD8B 1IHIA 4NJHA 3WDYA 1BK1A 1M4WA 5DLCA 4WM7A 5IVEA 2WT2A 1FWEC 3FX4A 1WLCA 5LA0A 5BYWA 2QQ6A 4IGMA 2OLAA 4DQAA 5A69A 1A47A 2OQYA 5I5RA 2D22A 4NJIA 3EBRA 1FMD1 4Z1VA 1PZ2A 5HJLA 2PQQA 1DOSA 2BVDA 4GVIA 4LIUA 3QYSA 1UB3A 5H8PA 3BVJA 3IVUA 4KEVA 4AD0A 3N2TA 4DJFA 4JDYA 2A6NA 5CC6A 3DCPA 1JOBA 4TSVA 3LRLA 1X38A 1WWYA 4JTSA 2P88A 1V6WA 3AICA 5CVRA 4A21A 1V6IA 5JLVA 3LV5A 4HSHA 4IIDA 2I74A 2NV2A 2GJXA 4J3ZA 1DIOA 1WZMA 1ONRA 4M1BA 5IM51 4TYSA 4EXQA 2FVKA 4JTCA 5KZEA 1ZZ6A 4OJYA 1ULCA 3CK5A 3N18A 4U5KA 1CAUA 3BL3A 4CPBD 1W1TA 1S2VA 3NV1A 4XHBA 1R7AA 5HNUA 2YZ5A 3QACA 1X96A 5HAOA 3HT2A 3G22A 5D2VA 3Q8CA 1TV7A 4DF2A 1W0OA 4QPYA 4A29A 4ZY9A 2DT3A 4JTJA 1KXGA 2NV1A 1BGAA 2ZPXA 3DBNA 5GLZA 3U2OA 5FJPA 2VC7A 5KSWA 3N73A 4FI9A 3LX9A 3DPRC 4JBRA 4PMXA 3KL0A 1Y5WA 4IGNA 4JTFA 4H2AA 4MLOA 5ANQA 3LHTA 1PYMA 1AR81 3AYSA 4BWLC 3BAYA 3NZ1A 1AXKA 3W9AA 2IFRA 4FPJA 4LBQB 3WEZA 3EXTA 4WJ8A 1QJFA 1BSLA 1QASA 5BYNA 1IV8A 4OZOA 1NDYA 4EN7B 4AXKA 2BDQA 2Q8DA 1YBQB 2QZ3A 2OQHA 4NT0A 2RDWA 1GNXA 3GR7A 1R1A3 1UXXX 2ACUA 2YR1A 2G4JA 3PDQA 3NMBA 3PTKA 3ZOIA 2X7WA 3NQ6A 3WQCA 1GQNA 3T2PA 2OKTA 4IG2A 5I23A 4DZGA 4J7RA 4DAIA 1ULOA 1KO0A 2DUXA 3IM0A 5D2AA 5FMCA 1IR2A 4UTTA 4LY8A 1BYHA 1RUI1 4D6GA 2XUCA 4ZZ8A 2CLMA 4HSJA 4ZOAA 2H3DA 2NUWA 3LHZA 3GQYA 1BTMA 4NMIA 1UQZA 1CJDA 2HS6A 2WMFA 1SACA 1C3HA 5IUQA 4R7OA 2V6AA 3IIIA 1MW2A 5HCAA 4S3JA 3B9CA 4MMWA 1RXOB 4QQ2A 3EMCA 3R10A 3U7VA 4DXRA 2V9DA 3KXQA 1Q3EA 4QQPA 5C9AB 1UJQA 5CFCC 5FCZA 2WZHA 4Q8QA 1H4GA 4D6EA 1KFEA 5AVPA 2GC0A 3QY6A 1Q8JA 1X9TA 5DZGA 3WNKA 1BEV2 2QZ2A 3ARUA 3MDUA 1I5ZA 4E4PA 1R47A 4Q8MA 3L9JT 3CGTA 2CBIA 4M4PA 1D7KA 1NF0A 5J1XA 5HNTA 3CJIB 2X1IA 2AENA 3KF5A 1W8FA 2PA7A 2R1NA 3GU1A 4HHHA 2E6DA 1JYIA 4O53A 3VABA 3Q8AA 4BDVB 1CAWB 4DYJA 4QDSA 3PANA 4CSWA 2WS92 1WCDJ 3ABRA 3CIVA 3M3QA 2VCAA 2WK2A 3ME2A 3O1NA 3WY1A 1M7OA 3L12A 2Y33A 2DWRA 2JE7A 1PEZA 4GYFA 4JGDA 4UQ9A 5ACA1 5E6YA 1AR92 2ZTJA 2QZRA 3NL2A 4AISA 4G9SB 2HWF3 3RJXA 1EIXA 1C8XA 1SSDA 2UWBA 4YVSC 1UG6A 5A7PA 3O1VA 4LPCA 3W85A 4CXWA 5F1UA 3W7HA 3H2CA 2WB5A 5LK5A 1ENQA 5GZEA 1RUD2 4UI9L 5LZLA 3OIHA 1AJKA 4UMCA 3U5UA 2JX9A 2J78A 3VIOA 3L2LA 3ZFEC 4IP4A 5I78A 1POV1 3VKOA 4D7SA 1QRQA 4HN1A 3E2SA 4RXGA 5EJZB 1CONA 2HWD2 4UBPC 1ZHAA 1ZRDA 2XMLA 4JL2A 5AC92 2VR5A 5FZLA 3IEBA 3NO8A 3ZWSA 1NP2A 1G01A 4EK7A 5C9WA 3JVAA 3MCMA 1YNYA 5ANNA 1PL9A 3A23A 4NI8A 1R3YA 4B4RA 3ZYPA 2DUOA 3VKLA 3VL8A 3ZFFC 2QUOA 3VIHA 4LVFA 4DBSA 5B2GB 5T9BG 9RUBA 1AL7A 4AZ6A 4TV6A 2WWJA 2R063 1NT0A 3FFZA 1G6CA 2CKRA 1NXD1 1QH7A 5G4EA 4B1LA 4ZR8A 3BOXA 3RNDA 6CGTA 1UL9A 5FZKA 3F5JA 4L4MA 1XSJA 2NWRA 3UWQA 1YW1A 4CYDA 3U48A 1IIHA 2WZR1 3E5XA 4AEMA 4OHVA 1CT5A 2NVDA 3MUIA 2DJLA 5JH1A 1R2TA 5LNUA 5AYZA 5LB6A 4HU8A 3MZNA 3PUQA 3GZ3A 4GX8A 4PBFA 3I6EA 3QZEA 5FAJA 3MF9A 2A6ZA 3CT2A 1QBBA 2XGXA 4R34A 4WDWA 4K3UA 4U3AA 3TEVA 3BARA 1Q8AA 3T07A 4HYRA 5HWMA 3LDBA 4QDPA 2ZHLA 4XBSA 4WVWA 5B80A 3FAWA 3LHYA 3RR1A 3HG3A 1W0MA 3G0SA 4MGSA 4S3CA 2NXHA 1E6SM 3SRFA 3U0HA 3CMGA 3SCGA 2RJGA 4G7EB 1IZJA 1PHWA 1MSSA 1KXQA 4COWA 3OZMA 1IR1A 2Y62A 2WC4A 3I6TA 2XHKA 1QNRA 5LATA 4JQ1A 3NQDA 1XLHA 3RNSA 3QPZA 1CZSA 2YIHA 3QZAA 5EMKA 3UPBA 1W5PA 2XVKA 3O07A 2AL1A 1WXYA 2B81A 3QGVA 4PC8A 3ENRA 5F9TA 1YIXA 2QDGA 3SCVA 4Z17A 4CNPA 2AC1A 2WABA 4AVTA 1OZMA 1A53A 1XISA 4WZHA 4TIMA 4AVNA 1NXMA 2C24A 2XVNA 5LEJA 1UP0A 4BQ2A 5CPMA 4JNMA 1UUQA 1DE6A 1CGUA 3UNTA 3JUUA 2JALA 1ZA7A 2GQ3A 5E1QA 3KCXA 1BBT2 1RUG1 5TNVA 1PZ3A 1SYTA 1BEV1 2QIWA 5EMUA 2VCMA 2GC1A 3FVMA 4MZ8A 3AYCA 5FLHA 1C29A 2CAVA 4GVFA 1PVC2 3KEHA 4RZ6A 3SJNA 2J13A 1CPNA 1ISXA 3JQXA 2R91A 2UU8A 1JJKA 3B0PA 1WBJA 3V5FA 2PHXA 3EGJA 3PBUA 5HNNA 4M1RA 2Y61A 5GJMA 2JDZA 1ZBKA 5A3MA 1UY0A 3HB9A 3MHFA 1S4CA 2WS91 4QU2A 4C6NA 2Q6ZA 3ZJ8A 1JUHA 3NFUA 4UR8A 5F7UA 4XETA 1MS1A 3WSOA 3CPGA 3TZNA 4LRTA 3H53A 2PU1A 1GK8A 5I0RA 2VR4A 2QLYA 4LO5B 4NPLA 3C0SA 3IJ9A 3CUXA 1IWAA 2GU9A 1HZYA 4HN0A 1JYTA 3HR9A 4XC9A 4AF0B 1AUYA 4IEQA 3KL3A 4B5SA 1KKRA 1KQYA 2PP0A 4JCMA 4O15A 2OWWA 1P48A 4H7ZA 1K5JA 2C0HA 3M70A 5J98B 4PRTA 2I9EA 2ZRZA 1XUUA 1UKRA 4XF3A 2A85A 1IKQA 2VW1A 1R5YA 5AC91 4PL2A 3J9SA 3M0XA 5FKYA 4IPLA 1UF2C 4O1EA 4HPKA 1WW6A 1HQLA 4EE2A 2Z7KA 1H9WA 5GZGA 5G04L 4C6EA 2WINB 5E16A 2ATFA 4Z82A 4D94A 3KLKA 2YYTA 4K37A 1W8WA 3NXLA 1D8CA 1FCBA 1XX1A 3VDCA 2G3MA 1AFSA 2JECA 1WCKA 5H9SA 3WNNA 4J9JA 1UA3A 5U7SA 3IZOA 3HA1A 4WGXA 3R4IA 2XFYA 1NCQB 1V3LA 3LE0A 2CZFA 5BOFA 2ZC1A 5BRBA 4JN7A 5FYSA 1UA7A 2AAMA 3AS3A 1P0KA 4LAMA 1L6FA 3MUZ1 1LYXA 4RYDA 4CQCA 5IJRA 2QR6A 1KFWA 1HRV2 4N0RA 4AI3A 4LBKA 2FCTA 3PU3A 3S5ZA 1OX5A 4L65A 4WVMA 1Y4WA 5FZ8A 4UFKA 1E15A 1E0WA 2PE4A 4N6EA 4H9XA 3DHDA 4UQBA 3H2MA 3CAKA 3INAA 3TYZA 1YTKA 1W6PB 1XSRA 1CECA 2GPTA 3FSTA 3CO8A 4V1YA 3ZYBA 3LEGA 2L5HA 2K9ZA 4A2UA 5FDBA 5AFBA 3EPNA 3SFKA 3SUVA 5G1MA 4CQ8A 1MW3A 1E6XM 3LN3A 4K20A 4ZSTA 5GKAC 3ARVA 2BWGA 1GP6A 3I7DA 4D6QA 3CHCA 3O6YX 4Z1BA 2ZXBA 1W9TA 4OGZA 1CD3G 3SGUA 2FJKA 1DWGM 4BR1A 3M0KA 3WF0A 1WAWA 1OFRA 4W87A 1RINA 3MFAA 4B5WA 2ZE0A 3U2EA 2BGSA 2CLEA 4Z42C 5IFPA 1ND2A 1HJXA 2HEYF 4Q4SA 1SGJA 4U10A 1IE7C 3UETA 2XJUA 1UP3A 4PFHA 3VIFA 4CEWA 3PSVA 4IEZA 4ZU4A 3KB5A 2PBOA 1YE4A 1DKWA 5EYXA 1F31A 1VBC2 3NSMA 3BOLA 2VE1A 3UR2A 2RJLA 4KCWA 2FHFA 1W8GA 4U4MA 1BBT1 1OA4A 4GI4A 4Q4V3 2J77A 4FP1A 5BNOA 2YOCA 5I3KA 4NZ5A 5FJUA 2A4AA 2VMIA 1FWIC 2ZVIA 3F4DA 1PVC1 2NN8A 3UZYA 3DUGA 3K5XA 2BTVC 4CCMA 3DN7A 3IANA 4WGHA 3G0XA 5CPLA 1X9PA 2VULA 1QT1A 3RXZA 3GF6A 1JFHA 4ASMB 5C4WB 3TXVA 5HQMA 3GBDA 1JI2A 4GIQA 5C5TA 1WDSA 3CUHA 2QCCA 1X36A 5A70A 4AVAA 4KQNA 3RYPA 3KT4A 2OKOA 5A3NA 3AROA 3RDKA 3AP9A 4R7WA 3NEVA 4P7LA 1QJY3 2CHHA 3A21A 1LOSA 2QNKA 3BZGA 5FYZA 3W6MA 2FQPA 3SH5A 1TMLA 1M5WA 2OB3A 2POTA 2VD9A 3SGZA 5I3DA 1TO3A 1Q45A 1ENXA 5EPAA 3WL0A 1UJPA 2BASA 4FNSA 3C56A 3M2MA 1PGW2 5K9DA 5LNSA 4AD5A 2R1PA 2Y7DA 3VOCA 3TQ0A 1XXXA 3AWOA 1JXKA 4ARXA 4JYFA 2GWNA 4J28A 1PO21 3FLTA 4FMVA 2H6CA 1AW1A 4E27A 1EO7A 1WV2A 1E5IA 1NX9A 1AR71 4JDNA 4O9EA 2OWCA 4H01A 1FFRA 4PCPA 2IC1A 3OBRA 1K6AA 2PMWB 2ZC8A 1FWRA 2KX9A 3VZKA 2VZ3A 2WW5A 3ZSKA 3LTYA 4EWEA 4B4QA 3WDXA 2NSXA 3TV8A 3SCUA 1TVLA 2FZ9A 1V6YA 4HOWA 3OVQA 3NQAA 5XIMA 4PULA 2HBUA 3KHDA 1KGWA 4Q6XA 4S2HA 2W2IA 3S1GA 1XIFA 1KRMA 1ZJIA 1LQ2A 4AVVA 7REQA 1UKOA 3NNFA 3MW4A 1KCLA 3DEMA 4G7FA 1B57A 2W79A 3ABZA 4YTSA 3HMYA 1HRV1 1S2WA 3WJXA 4M6QA 3BMWA 4DN1A 4L80A 1UU4A 1I2NA 1LOBA 4ERGA 1CZVA 2A0NA 3VNYA 1JPDX 2Q01A 3VGDA 4F3JA 3MIBA 3OTFA 4RNHA 2YZRA 1OQEA 5C5UA 3UYCA 1I0DA 1ZL1A 3POHA 4O18A 3WHTA 2RAGA 1JRCA 2AQWA 1XYMA 4DJDC 2E7TA 3QLLA 3LDVA 5TSWA 1GZGA 4OYUA 2EF9A 3OIXA 1W8NA 3WD4A 3WQ7A 3TX9A 4FAHA 1WA3A 4TTUA 4GJZA 4CP9B 5I09A 1Q6OA 3VPLA 5AYYA 1SU5A 5HMSA 1RA0A 2QW5A 2OSWA 1SUXA 4XF4A 3E49A 1WAUA 4E5TA 2PZ0A 4GB33 3W7PA 4C6KA 5FY1A 3OUIA 5C2GA 4X0VA 5AVAA 4JY9A 1I75A 3M07A 3GXMA 3K48A 5CBBA 4K68A 1LM1A 5E9XA 3MEPA 4Q8VA 4FPLA 2P53A 4FAGA 4B1MA 4DJED 4CA9A 1D2QA 2DT2A 3DKQA 3FOKA 3LB0A 1OLMA 2D3RA 4TOQA 2DSZA 1W39A 4OHZA 2Y1HA 1N8IA 3PJYA 3B8VA 5JZGC 3TTYA 4J25A 4AHQA 4O9GA 4W89A 4WZCA 5CZKA 2WWDA 3VBRC 5HCFA 4GKTA 1C7TA 2WJFA 3PBWA 4KRTA 4RQPC 2ACRA 3TN5A 3DUIA 1ICPA 1H5VA 2A3YA 1RD6A 4UFHA 3JU9A 4MZ1A 4QEHA 4WX2A 4TZDA 1QVBA 5A6TC 4BK9A 4PUMA 3O1UA 1JCTA 3MUAA 3VBHC 5LXEA 3KV6A 2JK2A 3WNPA 2LW8A 3L2IA 1XXNA 3LEKA 3VBFB 1CXIA 3TA6A 4F0MA 4YYOA 1PO13 3H4GA 4HCDA 1UKSA 4CCNA 5T5LA 4YYFA 2H8XA 1W5MA 4BF9A 1O5LA 3RG0A 3R0DA 4NOTA 4N43C 1KTCA 1J1LA 3DPRB 4QU1A 3GYCA 1AX1A 2CPUA 3EKZA 3O6AA 5FYVA 2Y6HA 3BCFA 2VUJA 4F48A 5IW0A 2E26A 2W4XA 1LRHA 3KW3A 3SRKA 1G9DA 1ZTVA 4ZGYA 1S55A 3WNLA 3CLWA 5BNKA 4XIOA 2VRJA 2OR2A 4GUFA 4P5HA 1PZ0A 3LBOA 5C7GA 1PIV2 2FDIA 5C6MA 4BHPA 4LO6B 1ZP4A 4AGGA 1RHI2 3K51A 3NZQA 1PNFA 2BNOA 2VC9A 1OQDA 3H8UA 4MO3M 4AMAA 3W07A 4E4DX 5LW9A 2HRWA 5EMMA 3I6RA 2XFWA 1KBIA 3EAUA 3AX4A 3GALA 1THFD 1A5UA 1KXVA 2XL9A 1VFMA 2VBPA 1GNZA 4Y4YA 3LRMA 4HU3A 4A44A 3PNZA 1CXHA 4HOZA 1AQ0A 3VZXA 2WQPA 3WP5A 3P82A 3RQ0A 3UV9A 4S38A 5A6MA 1FWAC 1EQPA 2D44A 1K02A 2MNGA 1I6NA 3QEZA 5ERLA 3UJFA 1GZ9A 4IISA 4IFRA 3A3HA 2V3DA 4JGZA 3LGDA 3ST7A 4FOYA 4X9SA 1YQ6A 2BSLA 3WDWA 4MJ2A 2ZVRA 4UTWC 1S1AA 1W03A 2ZGPA 2AZ5A 1B3VA 3QFWA 3LXCA 4DBUA 4FPHA 1J59A 2ATSA 2WNUC 3QJAA 1CDGA 1Y5VA 4BM8A 3C52A 3CZLA 2PCEA 2JD9A 4HZ8A 1FCUA 5IDZA 3B9AA 1VBA1 1N8FA 1Y43B 1DHPA 4FNRA 4Q8UA 1OSGA 3N15A 1LG1A 4OHXA 1UKGA 2ZX7A 3I2OA 4AR2A 1EDQA 2HXUA 2J8FA 1DZTA 2RS33 5C8CA 1DJIA 1XP3A 5FY4A 1NLQA 1ONAA 3KLLA 3Q67A 4AU0A 4H8NA 2DZSA 3VDBA 5I06A 3SNMA 3AU2A 2V5KA 4QXIA 3I68A 3VUSA 2ZAAA 4GBDA 3DH7A 1DWFM 1H49A 5GZDA 2XLFA 3GFZA 2BNNA 3SEPA 2CU5A 3DYOA 1JPKA 1ZJHA 4ZMGA 1ASJ2 3L67A 3AWNA 3TK7A 5LY2A 1NH6A 4TVCA 1N1TA 3CHVA 4FOQA 2HS8A 2R14A 4QDQA 3WQOA 2YXGA 1W05A 3MWAA 1FWCC 4JOMA 1IPJA 4YM0A 4OFCA 4XD6A 1Q6QA 3FAXA 2WSYA 4FNPA 4SLIA 4E8GA 4PEKA 1CQ9A 1QNPA 3WFAA 1XJAA 4DJFC 3A9BA 2HWB2 5IDIA 1RIRA 1XYZA 3AMDA 3FHAA 4HSNA 2PDNA 3KRUA 1DBNA 5DFAA 3FEMA 2CU0A 5I00A 3JB4C 5CG8A 3AFGA 2ZUUA 1O94A 2WRAA 1SPPB 5HWJA 4XFFA 5L9BA 4FTBA 1WBLA 2QVNA 2WJDA 1PZ1A 4H8UA 4IJBA 5BNPA 2VHLA 1KM0A 2PWFA 1Z89A 2G4FA 3JCIA 3USSA 3EWXA 4I30A 4HANA 3ECQA 2IVIB 1VYRA 3M44A 1L6SA 4IIGA 4FB7A 1OPMA 2PXJA 1QXJA 4QXHA 1RJQA 1KRCC 3RIKA 4JX6A 3WF1A 1YRZA 5A95A 4R88A 4JTKA 1Z44A 3N2XA 2FTWA 1XJBA 4FEZA 3AC0A 4GNJA 1NM9A 3O0XA 5D8AB 1H2MA 1UD4A 1UROA 5FD0A 4URIA 1W1VA 2Q8LA 5IVBA 1W6OA 2RGLA 2X8KA 4QX8A 1VPYA 1XI3A 1UZDA 1WKYA 3WBXA 1D7PM 3T4VA 1XH2A 3GH5A 2E33A 1UZHA 2OMAA 5C9XA 2X5IA 4XO7A 4H83A 1PM4A 1PJ9A 1XLIA 1W91A 1XKJA 3OD0A 1XDLA 2EAAA 2BVYA 4PQ9A 4GNKB 4Z1DA 4PI2A 4YW4A 5FZCA 4F7ZA 2Y6ZA 1PIV1 4F9JA 1UMLA 4R85A 3P8JA 4IL2A 1PDYA 1RHI1 2RG4A 3BAIA 1VRDA 4DWSC 1C93A 1JZ4A 1S1PA 3G1XA 4WY0B 1AYN1 3UPMA 3WH7A 5EMJA 3GO2A 3LIGA 3LHVA 1EWEA 2GVLA 1DHKA 2WJZA 2G95A 4ATDA 1EA0A 5ABJC 1FX6A 4KF1A 2PSNA 2ZKLA 2DV9A 1KKOA 1I60A 3MHGA 4H6RA 2J1EA 4WR3A 1OC7A 3RVHA 1RUC3 3ITCA 1QW7A 5JPMB 1H1AA 1WZLA 4F83A 1IEVA 5GJ6A 4Q1PA 4M81A 2BVBA 1R3VA 4RKAA 1GEHA 3ZR6A 1K8XA 3AVSA 1B31A 3H70A 4AI8A 3N2CA 2VOMA 4JCKA 1PX8A 2VH9A 4LUMA 1PAMA 4KBBA 2XJQA 2P76A 4B4FA 1F05A 1EKOA 3JD72 4RDVA 4Z2IA 2PLV3 1J3QA 3M1ZA 1ZAIA 3N3HA 2QHAA 3NXFA 1Q63A 1S1RA 1GQGA 2HWC2 3JZVA 1MWOA 2CETA 3QCWA 4RDZA 2Q0AA 2QDRA 2R82A 3KTXA 2VQUA 3C3UA 2P3EA 5AVHA 5CJNA 3T44A 3AXKA 1VC4A 4V28A 5I07A 5FPZA 3S42A 1AHSA 2C1IA 2PC4A 4RV3A 1FOD3 1TTQA 3AHXA 1AA1B 1LORA 2GNTA 1QK0A 2C1HA 3QW3A 4B2DA 1UYXA 3OBZA 3G1SA 3VHOA 3CAVA 3EHKA 2EPMX 3HV8A 3RMXA 4HETA 1SR9A 2CHOA 1X6NA 4HA0A 4E2BA 3XINA 5FLIA 3E6DA 4IGHA 3WLHA 1WLDA 1TELA 4Z1AA 3W23A 1YHFA 1GOHA 1ASJ1 3WP3A 1UUOA 3MDWA 4QB2A 3ARRA 2W1QA 1DIKA 3NQGA 1NCRB 2ACSA 3CBWA 1OIMA 1TFVA 1Z6KA 3MKCA 1NG0A 3FE5A 5L7OA 3S5QA 2Z1BA 4TU1A 4RUBA 3K4DA 2E4TA 2J6XA 2ZUSA 4GGHA 4KEZA 3STCA 3AI0A 5I24A 1H7RA 3OF1A 3D47A 1V3JA 4YFWA 2ADAA 2X30A 3ES7A 2W0XA 4JDOA 3KHJA 2C5DA 5C8WA 1CESA 5CAHA 1W06A 2ZX0A 1CGXA 3CL8A 2CZVA 4Q0UA 4XBJA 1AR63 1TTJA 4J35A 1H1MA 2WPBA 4HZ7A 5GNXA 4GC3A 3CL1A 3EX2A 3QN3A 3H3ZA 4HPGA 1Z3NA 3DFYA 1LB2A 1KS4A 1WDQA 1HJQA 2ARXA 4NILA 2VTXJ 1A5LC 5DPNA 5LIYX 1UIJA 2H9AA 4XBKA 3UXLA 3R5EA 3CHXA 5FBZA 1RUF1 1VYSX 3QV7A 5KMYA 2C79A 1W2OA 4A3YA 4N53B 5A7NA 2YCEA 5A8QA 1QXRA 2D43A 4DYKA 5FF0A 2P5BA 4XZLX 4XZWA 1S0BA 1G4TA 2OEJA 2IKIA 3G1FA 1ZCOA 4ZZ5A 4WKAA 4R9OA 1EYBA 3QV6A 3WENA 3GDRA 3TYJA 3PU8A 4G5DA 3VBSC 2E7AA 1PGL1 4GFSA 2ZXAA 4P5YA 3BU0A 3HN3A 3WK1A 2OVLA 2PRLA 3ENLA 3EXRA 4C1KA 1P6CA 5A6SA 2UYAA 1U5ZA 3KAOA 1H4PA 3USBA 1S0DA 4KIEA 5DN1A 2BPA2 2ZRYA 3O8AA 3PAOA 2H0BA 4WRHA 3AP6A 5FYIA 2OT0A 2JIEA 4JFTA 5D8ZA 3AZWA 2NQLA 4EANA 3T09A 2UWFA 5EP9A 4CDUA 1W9VA 4IPJA 4NN0A 3VTRA 5FZAA 2OX1A 4EVZA 3NQMA 4EP8C 2P3KA 1ICSA 5CNAA 4X3ZA 4N90A 1XBVA 4DBEA 3WEOA 3MHZA 2CLLA 3FXYA 3CZEA 3CIXA 2PWVA 3WK2A 3WDVA 1TME3 4AZBA 1JPIA 1AX2A 4MJ4A 3PZTA 3PTRB 1EFZA 2QCEA 2JD4A 1HKWA 1X39A 3E02A 4R27A 3U57A 4ML9A 2HWC1 1XRFA 1PZ9A 3BTAA 4MXVA 3MP5A 4UBHA 4ZONA 1I2PA 4L92A 4JIPA 4KWOA 2TPSA 3O0KA 3U7BA 3S0MA 2VR2A 5ABHA 3H7VA 4KIRA 5GNYA 1CZTA 4GO8A 3W1QA 3M47A 4JKLA 1GHRA 5MKGA 4D71A 5DN2A 2QUTA 1X6LA 4JGYB 5BXRA 1K3IA 1CAXB 2ZA1A 2E1DA 4ZQNA 1QOQA 4HONA 4R33A 1W1A1 3QHOA 3S5OA 4WUIA 3URBA 2XL7A 2ET7A 5L19A 3MSDA 3RMYA 1VHNA 4TXWA 1JCJA 2X8RA 3MIEA 5FZOA 1QW9A 1XM3A 4RPQA 4HKWA 3IGHX 3NNTA 5A3UA 4YJ5A 3N7JA 1ONWA 2PZNA 2ISVA 2X10A 3LNPA 1MXSA 2R072 4EN8B 1VAVA 1NP0A 3TRSB 4GCAA 1EUTA 2J1RA 2JG9A 1TE1B 2XKOA 4IEXA 2WWUA 1JS9A 1PWMA 3PY2A 2JF6A 4QROA 1TVGA 3MWCA 4PB4A 1OIFA 4MIMA 3KD4A 4UYBA 1DQ1A 4BXSV 1LJYA 1EUNA 4QIUA 1NZCA 4CU8A 1MEHA 3PJXA 3Q8FA 1HL9A 2B4KA 2RMU1 4YPJA 3WG3A 4F8AA 3B93A 3R7MA 5FPBA 1LHWA 4IFKB 3V0BA 4CDXA 4X2PA 5A6BA 4M3CE 2EAWA 4XQWA 2GVGA 3NJXA 1HP5A 2XGIA 1JUKA 3M0MA 2D0HA 4RD7A 1C1FA 4TLFA 3L2YA 3DGBA 4NIIA 2A75A 1R46A 2VFDA 2JEMA 4IEVA 1OT1A 3ZIWA 4JYDA 3LIHA 3O1PA 5KHGA 1WUFA 2PUZA 2ONEA 1UKQA 1XIIA 2G9ZA 1AMYA 2W6RA 3CV7A 3I7SA 3W6YA 1B0IA 5G1TA 2IVJA 4QLJA 3UA4A 1IG0A 1DJZA 2Z1XA 3NQFA 5EHDA 2CZDA 5JMOA 1ZU8A 1C8NA 4WXZA 2D40A 4HA1A 1R86A 1E1CA 4ASKA 3CU7A 2P8BA 1D4M2 1UH4A 3HT1A 3LTSA 1LRNA 2LTNA 4YVWC 2TYSA 4H6EA 1KD0A 2XN1A 2VMDA 4CUBA 1X6UA 1EXBA 4UWDA 5FZIA 4UAPA 7XIMA 5ABFB 1B09A 4M3CB 3UT0A 3OYWB 3FA3A 1T96A 2ISDA 4XQ4A 3ZT6A 1TMHA 5K0UA 1LG2A 3OW1A 1J18A 3A4AA 4XZMX 5CADA 3RZHA 3MYPA 2XBO1 2Y7GA 2BVVA 1L6WA 4CTEA 4V2WA 1PTAA 1QJWA 1TV8A 1DF0A 1CLVA 5EU9A 3AIWA 5J36A 1OLQA 2VX5A 4UNLA 3DESA 2Z42A 4D2JA 1XU2A 1SFJA 2PRMA 2ALRA 4FF7A 1H1NA 5IXEA 3NDOA 2YJQA 2DCJA 1OOPB 4Y33A 2O7SA 4PQQA 3RILA 3I2DA 5EFDA 3BYWA 1QJZA 5FKCA 3B9EA 3O2LA 1CEOA 1I1XA 1ZS2A 3T42A 1GNYA 3UGHA 1R38A 2EQDA 3OUHA 1I3HA 3VNIA 3TW6A 3URFA 1JZ2A 4Z1CA 1Y8BA 4LAOA 3NKTA 2GUYA 1W6QB 4OI0A 3MI2A 2YCIX 4EN0A 2HK0A 1EJRC 4U3CA 4WXYA 4NIGA 2VEKA 3TP4A 3SCSA 3MHUA 3AMGA 2NP0A 3DENA 4YZ1A 4A42A 3QMSA 3BE7A 4I6VA 1ISYA 3REQB 4CEYC 2VGDA 4Q4W2 2AGSA 2WA4A 5BUVA 5H9RA 5CZJA 1NAL1 2CLFA 4MH0E 3F2CA 3UJQA 4IERA 3SITA 3PAJA 1BZWA 2INEA 5FRAA 1HKJA 7CGTA 1OA2A 2RGMA 4OV4A 4Q32A 2VZ1A 2X1TA 2ZX5A 4NIDA 2CL2A 1Q65A 5CG9A 5T9CE 1B3OA 3VNZA 4GBUA 3AJ7A 5AHEA 1RQBA 2XHYA 1XV8A 1JNEA 2PURA 2ACQA 3QY8A 4N43B 5CPQA 5CBLA 5CPOA 3KL5A 1NDZA 1OF8A 2W39A 3G18A 4Q8NA 2F38A 2F2KA 2BODX 4CP1A 2GMMA 3I4EA 1A5BA 4PTWA 1GKPA 2PDJA 5JVLA 4PLNA 3WELA 3OO2A 3HPNA 4HP5A 1B35C 2R071 5JR2A 1NA1B 1VCVA 3L4TA 4MNKA 4PMJA 1WGPA 4QXKA 3OPZA 2BGNE 5G5IA 3WD3A 3DIPA 3IK2A 2C71A 4FNTA 1UOFA 4JTUA 4RXFA 3VC6A 2EA7A 2BS9A 4DXXA 1O95A 1UZ1A 2PMQA 1BQCA 1MDLA 2RH9A 1XD1A 3IAQA 1SW3A 3VKAA 4LUSB 1TJ0A 1UD5A 4CDQA 1EL3A 4AZCA 4KH9A 3WDPP 5KXCA 3CQHA 1ONXA 4QE4A 2P5NA 4M8UA 1ZA4A 1F7BA 1YXWA 5G4WA 1Z42A 1FFQA 1JYVA 4XURA 2KXLA 3WLTA 2PDWA 1YFWA 4CD7A 3VDDB 1WDDA 4A6GA 1O3QA 3IRDA 3VOFA 3WDIA 4KCUA 3WZ1A 5LYRA 3ZOAA 3T2OA 2OZ3A 2CBUA 4GIAA 3SSZA 2PAJA 1Z41A 1LT8A 3KZ4C 5FV3A 3EJKA 4HNNA 3HEIA 4RFRB 4GX9A 1PIIA 3V0SA 5FP9A 4UUIA 1TA3A 5J04A 2XUEA 4FLQA 1JCMP 3WJWA 5K2ZA 4CD8A 3PVNA 1XLMA 4XX6A 2F4LA 3P80A 4Q4MA 2WNUB 4D6JA 4XD4A 3ZPYA 4FR6A 4GA8A 5D2TA 2CXEA 1AL8A 5EY5A 4H9MA 2VGIA 3QH7A 4B16A 4NXKA 4RA0A 2OYLA 3AS2A 4L9BA 1N8WA 1F76A 4GACA 2CLPA 3URAA 2BMBA 5FYCA 4AEJA 1GVEA 2H90A 2WBKA 3SUUA 4DNYA 4Y1YA 3OOXA 1KFJA 4M00A 5AOUA 3UXKA 2A7AA 1PPIA 2Y60A 2QMKA 1JU4A 4R9CA 4JNYA 1C8VA 4B15A 1NWUA 4RR3B 3BALA 5F5QA 1PYFA 1QOXA 3CXOA 1V6LA 3FJ4A 2J6VA 4MPKA 1SFPA 3H3LA 1QR7A 4BQ1A 2VEFA 1QQP2 4NL1A 2DCZA 2P2KA 1RCQA 5RUBA 3PWAA 4Z2HA 5AFDA 2OGJA 4DHGA 2ZEYA 5JSOA 1BWLA 3G1DA 4IP5A 1XYAA 1RR2A 4MB4A 1ZFJA 1I9RA 1W6NA 4L9ZA 2ZMKA 4AFDA 1VAMA 4MOAA 2GNBA 3H2FA 4P9YA 1YXCA 1A3WA 2ZAHA 1WOBA 2VX7A 3LI0A 1GOXA 3NAPA 4GULA 3GZUC 3AKQA 3WF2A 4FPFA 2FGLA 5LIXX 3DERA 3ZLFA 4Y9AA 3URNA 1JNDA 2E0PA 3INPA 4Q4W1 2VGGA 3TWBA 1FT9A 2DUAA 3AHVA 4L0PA 3W5MA 3LG3A 1AJ0A 1DZRA 3WX5A 2GJXB 3HFYA 4PUNA 3TKFA 4CNTA 3UGFA 1JRBA 1WUVA 2QGHA 9XIAA 3PZNA 3M46A 2QJHA 2W5FA 5A3WA 1RCOB 3S8HA 4LOTA 3WVJA 4H9VA 1R0MA 4K39A 3M3EA 4GFIA 3LF7A 4BEQA 5DT5A 5H9PA 3ILRA 2VMFA 3U37A 5I3JA 1CAUB 1E0XA 4DNMA 2GVYA 3EXSA 5HDRA 2FZMA 3HG5A 4IMDA 2XOMA 3C0LA 2UY9A 3RN6A 1LGCA 3DHUA 3VX1A 1Y65A 1R85A 3GHNA 1UD1A 3EOEA 3FC0A 4HK8A 1ALDA 1Q4NX 2E8YA 4CXXA 3UNDA 4AI2A 1QOTA 3GFYA 4HPJA 3W83A 4XVEA 3HNBM 1SEFA 1DJXA 1F4HA 2W27A 4D1JA 2J9YA 2JDNA 3FWEA 1J1TA 2IXJA 1GWJA 4EQVA 2YA2A 4B5VA 3CEPA 4NG3A 1Z69A 2WZ8A 2C1FA 5LHEA 1CLKA 1SJDA 1R3QA 4XF9A 3ANYA 3ZN4A 3GTFA 2O0TA 1MEIA 1J01A 4UZUA 5ABJB 3CZKA 3V5OA 4IMFA 1POKA 1OF3A 2HWF2 1XQNA 2JG8C 4H2HA 4B5UA 4DJFD 4IG2B 4DY5A 1YPXA 4PDWA 2XONA 3R0KA 1VBRA 2XFRA 3NOYA 1ZJBA 1AVBA 2V5LA 4H14A 2W1UA 1AR93 1FPN2 4DO4A 3NPXA 3O7OA 3RDIA 3NVDA 2FB3A 4LOSA 4GWMA 4AI0A 3ITVA 4DINB 3SIMA 2WYFA 2QCNA 3S1UA 1HGYA 3W7NA 1RUD3 5M0TA 3BXWA 5TD4A 3CIWA 1GVQA 2PGFA 4IV1C 5E5CA 1A5SA 1OBAA 1T5AA 1N47A 1W5NA 4J3XA 3UCDA 2HWD3 4IX2A 4JGZC 1WZAA 4PUDA 5HCHA 1RZMA 1J8VA 5D03A 1O66A 3H2EA 4K7VA 2RDSA 3GXIA 4TX6A 4NAFB 3WUEA 2VEPA 4REQB 3I49A 3GKAA 3FN9A 2V0TA 4EWAA 4XTIA 4ZO8A 4DS0A 3DZ1A 4Q4Y3 2Y0FA 2WQDA 4O13A 1PIFA 3KM5A 4DO7A 2G50A 1UWIA 4JIHA 1PV8A 3EDDA 1X97A 1VEPA 4HZMA 4BLJA 3E2VA 1YLVA 1GOQA 1XE0A 1FWWA 3AYRA 3V1HA 1RP8A 2AOSA 1DP0A 1PIGA 2I17A 4EAYA 3T30A 5C8CC 3GHUA 2PLMA 4AFAA 3QTGA 2VO5A 5C3OA 4S3DA 2WMIA 2ZXQA 4YW1A 4Z2AA 3TUUA 2EJ1A 1WMDA 4GISA 4IPNB 5D37A 4D6HA 1JHNA 4K36A 1M01A 8TIMA 3WUDA 4Q0QA 4NHVA 4ILSA 1R7OA 1R1A1 2HWE3 4F2UA 5CC7A 2DIKA 4RNJA 3GAKA 1PB0A 2JDPA 3W38A 3BANA 5BU6A 2C15A 4WDTA 4WJEA 2Y5SA 4YNGA 1OT2A 1TIMA 3G77A 4HKLA 3O1RA 3WQWA 3D6NA 1J11A 3N7KA 4ADTA 1R9YA 2AL2B 1RK6A 5BMWA 3DX5A 4N4PA 5CJMA 1PNGA 1Q8PA 3OG3A 1EGMA 1J58A 4AE2A 2DT0A 4K6BA 4ES9A 5KINA 3I7RA 2DVDA 1ITXA 3WO8A 1IXQA 3ME3A 4NZJA 2FDJA 4ZOCA 1JAKA 1XICA 1M03A 4FLSA 4YW2A 1EZWA 2XJRA 1U1UA 2ZA2A 1NFBA 1KA9F 1H8TA 1W6MA 2JDMA 3WMSA 1PM7A 1VP6A 1PVNA 4I02A 1UYQA 2VEMA 2CY6A 3P62A 3A13A 1K6WA 1H4HA 4BA6A 3S46A 2ZJCA 4CGTA 1S5MA 4JIIX 3EOLA 4LO4B 4QKDA 4A8LA 5KETA 1UX7A 3LGEA 1F4AA 3NNLA 3TBDA 4HN8A 3DOPA 1QHZA 1OFAA 3N6QA 1XCWA 2WO3A 3HQNA 1SLIA 1SW7A 1W1ZA 4EF9A 1HJUA 1XDJA 4QJ4B 1HIZA 1WCUA 3LZZA 1UWRA 3GUGA 1W9YA 4QX5A 2Q71A 3ITQA 3JW7A 1RJ8A 3K4ZA 2P8CA 1V08A 1IS6A 2YC4A 4LUIA 1QI2A 4FXKB 2O4QA 4HLTA 4TVDA 2XH4A 1HKVA 5FY8A 5JBEA 3UR8A 5HMDA 1L0PA 2MUCA 1QPNA 4ATEA 3O1SA 2HWF1 4BYYA 2BGOA 4RNFA 3F5LA 2DZPA 3BLPX 4FPCA 4ZFMA 1LULA 4FFIA 1WXJA 3BUVA 4OU1A 1XNCA 6ENLA 1UAIA 4AZ7A 4XOGA 3MANA 2FHCA 3CT7A 1ODZA 3H3UA 4ONVA 7TIMA 1XYPA 5CPSA 3SN4A 1XIMA 2WJSA 4B8EA 4P9WA 1J84A 1JH5A 5FREA 5JMCA 3HV9A 3G1AA 4LBRA 1QJX3 3RX2A 1LU1A 2NMOA 4LE4A 4IXXA 3ES4A 1U2YA 3LPPA 4XQDA 3AKRA 3R1ZA 3W7QA 3VINA 3W7MA 4Y22B 4X8NA 4AB4A 3M64A 5HXVA 2R061 1D3GA 4D7YA 3LCXA 2PI6A 4COZA 5IHRA 4QJ3B 3IBMA 4YGEA 5I8YA 1OVDA 1XNDA 3VHRA 1NUKA 3WEMA 1PK6A 2BWAA 3KVMA 4CCOA 4I9TA 4AY8A 3HQXA 3AYAA 4PCNA 4IL7A 2CYFA 1IQDC 2XUMA 4Y1XA 3NURA 1EYWA 3RPQA 1YPIA 4GD4A 2DU2A 3LHWA 1DYSA 4NYYA 3KCYA 4LHLA 2J1SA 3W7RA 1P4CA 3RX4A 4CD6A 4DIQA 3R0RA 2P3YA 4C1WA 2FVMA 4K2SA 2PDXA 1GVOA 4UFMA 4H8VA 1NJJA 1GVSA 3VKNA 1G4SA 1U0AA 3R2GA 1WKDA 5DXYA 1Q6DA 3THQA 3WUFA 4QQ3A 1C90A 2J74A 2OZTA 3LLFA 5CC5A 4YTQA 4R3UA 4GQ7A 2G8ZA 4E2DA 1OCBA 4LNCA 1A4MA 2ZGSA 1VAHA 2BEOA 2WHLA 3T8LA 2J75A 4ZTYA 3TONA 2VVFA 3GTXA 4D8ZA 4Q0SA 1UWSA 1MQTA 1TPB1 1GJUA 2BX7A 1MZFA 3TC7A 1V0KA 3UU0A 3DEQA 2GGJA 4MUPA 2P6HA 4C6QA 2E63A 2UBPC 1GBGA 1F2JA 3LCWA 4HPKB 2FHRA 4NROA 2WLQA 6PTDA 5GLWA 2YXXA 2CNAA 4IEPA 3IIXA 4FNQA 2WO5A 3VKKA 3HG2A 1LJ7A 4Q4OA 3U2ZA 3KCLA 2UY3A 4NIHA 4MB5A 4P8WA 4C5ZA 3OODA 2YY1A 4LPLA 2DPEA 3H23A 3WMCA 3VHPA 5DQ0A 3U2CA 3LGRA 2C13A 4PUUA 1LT7A 4BHYA 1PMJX 1TV4A 1XNAA 3GHMA 4Q4V2 5E8AA 4O50A 4HK6A 3LGGA 1NYWA 1VBC3 2DORA 2CDPA 2OYKA 2R49A 2VFIA 5JBDA 4IE5A 3MCNA 3NM3A 4IQDA 1ZNPA 3A47A 4RV8A 4M4RA 1UU6A 4GMP0 1VRH3 4QPIC 5J48A 4WVMB 3AMHA 4YIWA 3NV3A 2ZGMA 1HB4A 3PNUA 4IESA 4LV9A 3ONBA 2GL5A 4CCCA 3DFTA 4QISA 4AHPA 3RI9A 1E3XA 2OPKA 1ST8A 1XBXA 3K8MA 3GTHA 1K03A 4QX1A 1B30A 2GDVA 2R1KA 1YNAA 5LRSA 4GH4A 1W6TA 1GZCA 2GN3A 1QJY2 3ZR5A 3IDCB 4NZ1A 3T2TA 4HD5A 1KCZA 3QSRA 2D1ZA 2DSKA 1QOSA 4ICNA 1X1OA 1A78A 1CTNA 1VBD3 3K8LA 4E8DA 2ZRXA 5FACA 2UYBA 3I54A 4KWJA 1B3ZA 3FFSA 4MSSA 3NL1A 5JIAA 1ND2B 4BQYA 1VS1A 5CAZA 2XZ9A 3GIPA 2PWDA 1QEXA 2ZGRA 4QX4A 4CEWB 4R52A 1B3XA 4Z08A 4L7ZA 3OLIA 3BQ6A 1TMF3 3GH4A 4AVFA 1W9UA 3A24A 2ZBTA 4AW7A 3KZPA 3BTYA 4FPYA 2HSAA 3KUMA 4BJHA 4GH3A 3SHRA 2PLKA 3PZGA 2FYMA 3UP8A 1Z7AA 4KFNA 1JD7A 1N3OA 4LYRA 2HBTA 4FTSA 4XMIA 5BNOB 2CW6A 1VF8A 3UR5A 1U1JA 4MHBA 2OWXA 1VMFA 3G1RA 4Q6JA 3ZN5A 1EGVA 3W7IA 1JZ5A 1ZZMA 2ZGNA 4RGGA 3V36A 1TPH1 1K45A 1ULPA 2BBAA 3ILNA 2DUZA 4PA8A 5A8OA 3W73A 4WF7A 3RGTA 2O56A 3DC0A 1BKSA 1PTGA 3UERA 2EVXA 2XJ7A 2XB6C 4W5UA 1JEZA 4L6DA 3LU2A 3TYEA 1KWGA 1DYOA 4O1AA 1KJLA 1WOAA 1HKMA 2D2JA 3CZJA 1SFLA 1SO4A 2VFGA 3STEA 3O12A 4KG8A 5AHLA 2FD8A 3DFNA 2NZLA 2GP5A 4URAA 1EC7A 4Q4PA 2QQJA 2OOGA 4XABA 4Q4RA 4J3WA 3TAYA 1NZIA 1O7FA 2ZZ7A 4ICMA 5CZ0A 3VZLA 2JKBA 3CWOX 1Y0EA 4FNUA 1F5JA 1FVPA 2IMRA 1XQLA 1H2JA 5C9ZA 2VOVA 2B7OA 2XXZA 4CEUC 3ZWTA 2VP8A 4I7WA 1XIGA 4C1XA 4LOCA 1J5TA 5EFFA 2QF7A 2RKXA 1HKKA 3ETPA 3UWUA 4YARA 3MUCA 2K0GA 3GLCA 4AUBA 2DDXA 1OD0A 4IEOA 1CXKA 4KWKA 4WK9A 2POZA 2RDUA 3S5SA 1MZ6A 5F2SA 4B4HA 5BNNC 4HTYA 5BWAA 5I79A 3FYYA 3ZR4A 4Z07A 1VHCA 2Y26A 1FCVA 1U83A 2PDCA 1NOFA 2C91A 1CPMA 5A1AA 3QTPA 4MG2A 1GZ1A 1KM4A 4E0CA 4OE7A 1F74A 4HSOA 3BURA 3POJA 4Q4V1 1P5BA 3BLFA 5LIKX 3NWKA 4FF5A 2Z27A 4N9EA 4YW6A 3LLDA 2PF0A 3NDYA 4F4RA 2X2YA 3Q9OA 4ZPIA 3N6JA 1V4YA 7REQB 2FMOA 2QDHA 3EA2A 3SCNA 1P7TA 1LLWA 1XYBA 1C5IA 4JTHA 4UC5A 4GZ7A 1E70M 3MP4A 3R11A 1OH4A 3AB0A 2ZTNA 5JR7B 3G6JB 1KCXA 4A3UA 2K46A 4HG6B 1SW0A 4S3KA 3W9ZA 2XQRA 2WCGA 4XV0A 3JU2A 3LDRA 1OLME 3GU9A 4HGXA 4C91A 1UZWA 4D6SA 4NKCA 2DCTA 3W58A 4FX7A 5JOXA 4DBDA 1F3EA 4XCAA 1SFNA 4EWND