4BQ3A

Structural analysis of an exo-beta-agarase
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
747
structure length
740
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLENDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
total genus 253
structure length 740
sequence length 747
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq3A02
4HU8A 3WDPP 2ZX9A 2EBNA 2XGBA 3RM8A 1C92A 3MUZ1 2ZIDA 4DUVA 3LPFA 3WQ5A 1E15A 2ZUVA 1W9PA 4PYSA 2WSPA 1QHOA 5FCZA 4UTFA 3SIMA 4PMYA 1GPFA 1GZJA 4UFMA 2YLAA 2XGIA 5BXPA 3M07A 5I24A 1W1VA 4JFWA 2VCAA 4CCCA 1BYDA 4MNLA 1K9DA 1ZBKA 3DC0A 1V0MA 5DEZA 5I6SA 5FOOA 3SUWA 4MDOA 4WK9A 2W63A 4J27A 4AD2A 4OZOA 2UWFA 4E8CA 1JYWA 5A69A 2OWWA 3PZ9A 4W7UA 4D6GA 1H5VA 3ALFA 3MMWA 5I23A 3F4VA 4QAWA 5E0FA 3SUSA 3ZOAA 3OZOA 2W62A 1CGXA 1C91A 3SUUA 3ZSSA 2DGAA 4AD1A 2CETA 3EMQA 1UZ1A 1HJVA 4TVDA 2PBOA 2DH3A 3VIKA 2E3ZA 3BGAA 2A3HA 3AXIA 2YOCA 1V3KA 2ZWZA 4M1RA 1UKQA 3ARYA 4X0VA 3AIRA 3MO4A 3N13A 6A3HA 3GTNA 3N15A 3G6MA 4AZ6A 3KWXA 2CKRA 1C7TA 5E70A 2D3LA 1CYGA 2XSBA 4AWEA 3VIJA 3BXWA 5A8NA 2PWDA 1GORA 1H3GA 2WMHA 4AD3A 4GZEA 4RE3A 1UQZA 3VGFA 3VO0A 2G4FA 2ESCA 1W1TA 3ARSA 5BROA 3WMSA 3CZKA 5ABFB 2UY4A 3AIWA 1ZU8A 5KZ6A 1I1XA 4WSJA 4M29A 4HOXA 2DPEA 4PTWA 1BG9A 2JEPA 1QW9A 1JFHA 2QMJA 1J0IA 1JYXA 1WZAA 7A3HA 1OGSA 1V6XA 3SCSA 5ECUA 4B16A 3KEHA 5CLWA 4UFLA 3WF0A 1BYBA 1GVIA 1H41A 1Q6FA 4DWSD 3QOKA 1XCWA 2ZX7A 4LKDA 2DH2A 3ZJ8A 1JD7A 1TE1A 3VDBA 2O9OA 1E9LA 1ITCA 3AS1A 2VZSA 2MANA 3AFBA 3I3DA 1SMDA 2GJRA 4CVUA 5A6SA 2E0PA 2A3CA 1B3WA 3ARZA 5CQ1A 1NWSA 2DIJA 4F79A 2ZXBA 1HN1A 4KRTA 1JZ4A 1TMQA 1ZBVA 4GKLA 3PBGA 4JHOA 3MUAA 1R86A 2CBUA 2Y24A 2XWDA 2GJPA 4HZ8A 3W37A 2Q8XA 3AISA 5ABHA 1E55A 1LL6A 2TAAA 4JIEA 1SMAA 1HKMA 2ZUSA 4AMCA 1CBGA 1E5NA 5EBAA 2ZXDA 2FGZA 5A8PA 3EDEA 1PEZA 1BVNP 1WCGA 5LA2A 2GK1A 2HVMA 5E9AA 2X0HA 1LG1A 3LPGA 3GXDA 2BY1A 3WFLA 1H1NA 2C7FA 1GVYA 1V0AA 1VFUA 4AW7A 2XVPA 2JALA 1B30A 4WIWA 3UESA 1EQCA 2RGLA 1ITXA 2D2OA 3W25A 3WEZA 2VX5A 5D9NA 1US3A 2CBJA 2PWHA 3PZTA 1CGVA 3SCVA 1JIBA 2AAAA 4DWSC 3ZR5A 2D0HA 3AHTA 3AHZA 1CLXA 4W8BA 4ZEPA 3DECA 1XC6A 2C8NA 2Y2WA 6CGTA 4OJYA 1HL8A 4ACZA 2F8QA 3U5UA 1LG2A 3FHAA 3WY1A 3CPUA 1E6RA 4UR9A 1QI0A 5I3DA 5A2CA 1H4PA 2XSAA 4D6EA 5D21A 2GVYA 2JIWA 3AIBA 2DSKA 1D2KA 2VZUA 1JG9A 1VEMA 2GJXA 3GXIA 4D72A 3WH8A 1M01A 3NUKA 5D9MA 3VIPA 3WQ4A 1OH3A 3VILA 3S6TA 1E56A 4PTXA 4CPBD 3SUTA 3WD3A 1RD6A 4X9YA 1JYNA 2J79A 1S46A 5JUVA 2DDXA 2Q1FA 1QBBA 3VD9A 4CP9A 1QHZA 1CXEA 2WM0A 3OA5A 3AMGA 1W8TA 1EO7A 3U7VA 1KWKA 1QHPA 4Z2LA 2PWGA 4YW6A 3K46A 3E1F1 3U5YA 2WK2A 4W8LA 2ZX6A 1QNOA 1V03A 3ARXA 1V6UA 3VX1A 5AYBA 1CWYA 3N11A 1EIBA 3GBEA 3WDQA 1W9FA 1VB9A 5HDRA 3RMEA 2OSXA 3VVGA 4FLRA 3CIVA 1SFSA 1O6IA 3VIOA 3GBDA 5A3HA 5ABEA 1CGYA 1ESWA 1UWQA 1MYRA 1WAWA 2A3BA 3TTSA 3WBAA 1UR4A 5M3WA 4H41A 4U3CA 4B9YA 4M24A 1FFRA 2GDVA 3B9EA 4D6DA 1M53A 4W93A 3TTQA 3S2CA 1H09A 2WZIA 3AMDA 2W4XA 3WD0A 4H7VA 1GOKA 3FAXA 1EOKA 3ORJA 4PMZA 4U2ZA 1V6YA 4FLQA 3WMBA 5DT7A 1JZ5A 1HKKA 2E4TA 1XSKA 2WZHA 1JYVA 2FHBA 4JAWA 4PMXA 4RL3A 1W9DM 4UCFA 4LQ1A 5FIPA 2ZE0A 3W26A 1GOIA 1SR0A 4D1JA 1CDGA 3AQUA 1OT2A 4AEEA 2NT1A 3FW6A 1WDRA 2WB5A 5EMYA 1QI2A 3L4VA 3TA9A 4MTVA 1MXGA 3KE0A 2PWEA 1W2PA 1HIZA 4AIUA 1E5JA 3VMNA 4PMRA 1SYTA 1A47A 2J8GA 2YBTA 3NDYA 1G1YA 1K6AA 4CCEA 1XCXA 4MNMA 1XHGA 4LYRA 2WVVA 2EPNA 2J77A 2DT3A 2XPKA 4JFUA 4UFKA 4BQ2A 1NARA 1Q6CA 5CGTA 2X05A 1KGUA 1UD3A 2CCRA 3ZJ6A 1JZ3A 3CMJA 1HX0A 1OT1A 1WKYA 4JKMA 1E4IA 2CXGA 4PRWA 3VIHA 4GXPA 3ZYFA 3FXYA 3A4AA 1G01A 4HOZA 1DWIM 2CPUA 3RCNA 2WKLA 5GPRA 3CHFA 1HF6A 1WP6A 1TZ7A 3W28A 4JFSA 4AL9A 3VIMA 4HPHA 4PTVA 4ZE5A 2YDRA 1KWGA 4WF7A 3MU7A 2CYGA 1BF2A 1CZ1A 1W8WA 2J8FA 4WKAA 1QI4A 2WVUA 1GNXA 3WH6A 1DTUA 1E6SM 1OSEA 4GZIA 1VJZA 2WAGA 5M5DA 1V02E 3WKZA 1L7LA 3ZT5A 1KQZA 1NWTA 1J0ZA 1NQ6A 2Y8KA 1JI1A 2VZOA 4F8XA 1OKOA 3OZPA 3WUGA 2CHNA 5DMYA 2EJ1A 2XFRA 3VGHA 1CNVA 1V0NA 1UOJA 2PB1A 3DYMA 3WMCA 2GFTA 4X0NA 2V3GA 1MVYA 5FD0A 2J7CA 4U3AA 1OB0A 4MJ2A 3W82A 4ML4A 5CLTA 1E4MM 1EGZA 2BY0A 1B9ZA 3HN3A 2CNCA 2WMGA 2EO7A 3GDBA 5BRQA 1YQ2A 1EDTA 3RM4A 2YJQA 3VX0A 5A2AA 2D22A 3QHOA 5CG0A 2XFFA 4CN4A 1XV8A 1G9HA 4W5ZA 2XWEA 2XYLA 1E6XM 4WLCA 3WDHA 3AIEA 4LK6A 1PAMA 4ATWA 4Z2GA 1UA7A 2FHCA 3WL0A 4W7VA 3ZM8A 1CENA 3K4AA 4WKFA 3ZMRA 3N17A 3N9KA 4JFVA 3UT0A 2CKSA 5ABFA 4A3HA 3MMUA 3MUY1 3AMCA 1LL7A 1KR1A 3GYCA 1KXVA 3OIHA 4HPGA 1QOXA 3RPMA 1V6VA 4EANA 4GI9A 3AIQA 5BCAA 2J7GA 3VNZA 3AZTA 1D3CA 3UG3A 4R27A 5FKYA 2YA2A 4D6HA 2VZTA 1JI2A 2D24A 3IK2A 1BLIA 5D8WA 1DWHM 1M7XA 5FL1A 1ZS2A 2XUCA 1UKSA 3GNPA 3SCWA 3AROA 4N0RA 3NYDA 2WWCA 2ZUTA 5AC5A 1U2YA 1JD9A 3I3BA 2VVNA 3UCQA 3A4WA 4W87A 3IJ7A 1ZBCA 2K46A 2EEXA 3K1DA 3ARTA 5LA0A 3L4UA 3AXXA 4D6IA 5JBFA 2DT1A 3PZVA 4L4PA 2CITA 1C8QA 3NDZA 4W85A 1UKOA 1ZJAA 3L2LA 1N82A 1E6PA 4U5IA 1KBKA 4CD8A 3CZ8A 2XM2A 1B90A 4OOZA 5FL0A 3AICA 4NI3A 2XG9A 1WZMA 4HTYA 1TA3B 1WZLA 2VI0A 1W8ZA 2ZUNA 1HP4A 1WPCA 2GSJA 1UWUA 3GNRA 1JZ8A 2G3NA 2YBUA 4TXEA 3VM7A 5A1AA 2OWXA 1MFUA 2BNJA 2W66A 3WUFA 2ZX8A 3L2MA 3UG5A 1B2YA 3THCA 2VJXA 3TOPA 3BSHA 2VR4A 2DSWA 2UY2A 2WHKA 1X1NA 1TFVA 1R7AA 4H8VA 3EDKA 1BG4A 4KH2A 2WWDA 4C7GA 2F2HA 1LWJA 3CGTA 3WENA 2QV4A 1JGIA 2V3EA 2BVDA 9CGTA 4AIOA 2NW0A 1E71M 2D0FA 3VIGA 5DF0A 3WD2A 2XIIA 3WBEA 4DUXA 1VENA 4Q22A 4D1IA 2CHOA 3BCFA 3FN9A 3JUGA 3SEPA 1V6WA 3THDA 4NSBA 3NCOA 1E6ZA 2OWCA 3VD3A 5A2BA 2NT0A 3VD7A 3BSGA 4YWAA 2VO5A 4W89A 4JL2A 5AY7A 4FMVA 4BQ3A 4K68A 1DHKA 4HP5A 1HVQA 1LJYA 2WBGA 5JBEA 4D6CA 2X8RA 4HZ6A 3ZT7A 4NRSA 4J3UA 3ZIZA 2J7EA 4QCFA 4EE9A 4A6SA 1IZJA 3FNDA 3UEQA 3GH7A 5IHRA 1AVAA 4H8UA 1WZXA 3ECQA 1ODZA 1MW1A 1B3VA 1E72M 1CGUA 1E3XA 2WMFA 2WHLA 4Z2KA 3RM9A 4M81A 2O9PA 3PN8A 4Z2IA 1EDGA 4NRRA 1MWOA 3AHVA 2VUYA 4LPCA 2ZUMA 1PBGA 1I1WA 1W2VA 4XZWA 2WCSA 2W5FA 2XVKA 4GO8A 3TTOA 4BZYA 4E2OA 4PBGA 1V0KA 2J75A 4UNIA 5A6BD 3D5HA 3L4WA 1ISZA 4KGLA 3PTQA 4XV0A 4UQCA 3O2LA 1J0YA 1UWRA 4AZBA 1H0IA 5GQBA 1PJ9A 1PIFA 4MDPA 3AZRA 1PZ2A 3QOMA 3BAWA 3ARUA 4HA4A 4LYPA 2X0YA 1VJSA 1DWGM 4F66A 4CPBA 1JL8A 4P7LA 3NSMA 1GOMA 3L4TA 1BQCA 2WC3A 1LLOA 3F5LA 1AQHA 3AJ7A 3RJXA 2EXOA 4P8XA 1V08A 4DM2A 1NOWA 5LA1A 3QR3A 1J18A 3AOFA 5D9OA 4B3KA 3EDDA 4ZENA 2BS9A 1CEOA 2FH8A 4CCDA 1UA3A 1QVBA 1XGZA 1BHGA 4BA0A 1J0JA 4DWSB 1O7AA 2XVNA 2WLZA 5GNYA 4BCEA 1MFVA 2Y8VA 4PEEA 5E6ZA 1V3LA 3OB8A 2CESA 1A3HA 3IJ8A 3CZGA 3VIFA 1UKTA 1GQIA 4MAVA 3CZLA 1F4AA 1UQYA 4W86A 2VNCA 4GI8A 2VTFA 1WMXA 1E6NA 1HT6A 2D20A 4WKHA 3M46A 3W81A 1PPIA 4OBSA 1HNYA 2WYFA 3MKKA 1FP9A 3A4XA 1GCYA 2BVYA 1XD0A 2WCAA 2VURA 3J7HA 1V3MA 2HISA 1M03A 1WDQA 3F95A 1YHTA 2J62A 2LRPA 3NSXA 1KXHA 1RPKA 5C71A 4J3SA 4PMQA 3CMGA 4TTUA 1CXFA 2ZXQA 2X2YA 3CBWA 8A3HA 2VRQA 3M6DA 1ISVA 2OYMA 1EA9C 1PZ3A 4PCSA 3EMZA 4W5UA 5BXTA 3WH7A 1J12A 2YDQA 3VMPA 1H11A 1OM0A 1KXTA 4PMDA 1UD5A 4UOZA 3TONA 1LWHA 4A4AA 1ZBWA 3B8SA 2PF0A 1RH9A 2XM1A 4OKDA 2WW5A 3CUHA 2A3AA 3WD4A 5E0CA 1I75A 2VX4A 3PHAA 4GO9A 3W24A 1UHVA 1W8UA 3OLGA 1W91A 3EBVA 1FFQA 1DWFM 2WYSA 4ATLA 1TVNA 4AZGA 5A6LA 4ZXOA 4IM4A 3AHXA 4HU0A 1UWIA 3A3HA 2BVTA 2E8YA 3VGGA 1BFNA 1CXHA 3LMYA 3W27A 2V38A 1CLVA 1VEOA 1NP2A 1B1YA 3AS3A 5IFPA 4LKEA 1DWJM 3B9DA 1Q4NX 1G94A 4IPNB 3PZQA 5CPSA 3T2QA 4ZXLA 3WNLA 2GUYA 4U31A 5AYIA 3WIJA 3CHCA 2CIPA 3IJ9A 1LQ0A 4KWUA 2WMKA 3QHMA 5TD4A 1BSIA 4P7RA 1C90A 2PWFA 4LGXA 1GOQA 3POHA 3NIYA 1FOBA 1V3HA 2YDSA 2Z1SA 1VBUA 2WSKA 3VNYA 1W9XA 1FP8A 5A95A 4BS0A 4HA1A 3U57A 8CGTA 4Y7EA 5A8OA 4LYQA 3AMKA 5I2UA 3SURA 1DWAM 1GJUA 2BXZA 2V3DA 2XIBA 4MJ4A 5I5RA 1Y7VA 4B9ZA 2EPOA 2X09A 4MPKA 2VCBA 3ZYBA 1R85A 1UR8A 4EK7A 2DT0A 2XVGA 4P7QA 3O9NA 3SCNA 4NF7A 2J7DA 3TTYA 4J7RA 1XYZA 1OGBA 1OIMA 2CERA 1XD1A 1B3YA 2JF6A 2VRJA 2J47A 2BFGA 1NM9A 1JF5A 1V0LA 3HJEA 1NOFA 1IZKA 1TA3A 1TCMA 2J4GA 3LPOA 1NP0A 3T0BA 1UUQA 5EFFA 3EDFA 3RO8A 3RIKA 4E4PA 1QNRA 2OLHA 4RE2A 5CXPA 1UR0A 1MQRA 4UZSA 2ZICA 4EKJA 4CD7A 1GONA 5DT5A 1BGAA 1W9VA 4UQAA 4ZFMA 5CSUA 4PMNA 4ZE4A 3WNMA 3BCDA 3AIVA 3N18A 1MQQA 4AZHA 5CPTA 4TTGA 2OYKA 5D9PA 3OLIA 4HA3A 4IPLA 4AZCB 1UH4A 4MNJA 3NJ3A 4YW7A 4F9DA 2BV9A 4KRUA 3ARPA 4P8UA 2BHUA 1BGGA 2XHYA 4JCMA 1B31A 1VRXA 3FAWA 1PX8A 3AXHA 5A6AA 3W29A 7CGTA 1XSJA 4P7OA 2WBKA 1JZ6A 3WSUA 2ZXAA 3FY1A 4PMOA 3K4DA 3BLPX 1IT0A 1W3LA 1W90A 1J0KA 4CUCA 5I77A 2FDMA 2YL9A 2YA1A 4GQRA 1HKIA 1BPLB 4FLSA 4J3XA 1XH2A 1OGGA 2QMKA 4H8HA 2XVLA 4WJXA 1GHRA 2WKGA 2DQXA 2KR2A 3APGA 1JXJA 1QNSA 2VOTA 2WVTA 4CU7A 2WCGA 3A47A 4LKFA 1NWUA 4M8UA 4UQDA 2PI6A 3AIUA 4PMVA 4TVUA 4DUWA 2IXVA 4XX6A 4KMQA 4OBRA 1D7FA 5IHSA 1NWRA 1UWSA 1CTNA 4W84A 3BMVA 1UKPA 4FLOA 4PMUA 1B0IA 1TVPA 4LXFA 4QDMA 2DEPA 1TG7A 1IV8A 3ZJKA 3T2OA 4BQ4A 1JAEA 3K8MA 4PUDA 4MB5A 2UY3A 1ZJBA 3T08A 1JDDA 4NZCA 4AD5A 3OGSA 4B15A 2VX6A 4S3KA 3PZMA 4YPJA 5E09A 2WMIB 5I79A 1MQPA 1VEPA 1E70M 1UD2A 3POCA 1UR2A 1KFWA 1JZ2A 3PZIA 4RE4A 4W8AA 4Q7NA 4URIA 1JFXA 4W88A 1BYAA 2JFEX 3ARVA 3CUIA 1JNDA 3FHQA 2J7BA 4QLKA 4MAZA 2CBIA 4P8VA 5A6KA 1GQKA 1CXIA 1MW2A 3AS0A 1KBBA 3HU7A 3ZQ9A 2E9BA 3CUJA 4Z2HA 4YN5A 5BWFA 4M56A 1GHSA 3KL3A 4BQ5A 4AZIA 4XZBA 4PSRA 4CGTA 3WH5A 1WDSA 4QCEA 1E4LA 4M80A 3PZNA 2O9RA 1KCKA 4AC1X 2NSXA 4WSKA 1VF8A 2D1ZA 3F5JA 1XRVA 4A3YA 2J25A 3VM5A 1QI5A 3RDKA 1E73M 3VIIA 3OG2A 4J3WA 3SCQA 2YIHA 4CU6A 1QPKA 3MV01 1U30A 5GNZA 2DSUA 2V5DA 4U5KA 3BH4A 5EB8A 5AC4A 2QPUA 4DWSA 1HKJA 3W4RA 2EPKX 1CPUA 4R5EA 3ZT6A 4AXNA 3F5KA 3UR8A 4C7FA 5A6JA 1JAKA 4QP0A 4PTMA 1B3ZA 1XH0A 2JIEA 3W0KA 3GZAA 4MNKA 3RJYA 4AY1A 1QI3A 3AMLA 1WO2A 3QGVA 2QF8A 1HJSA 1UWTA 2AOSA 2ZWYA 4AD4A 4UOJA 5I78A 4AZ7A 5A6BA 2G3JA 1VFFA 4HZ7A 4ATDA 5A8MA 3LPPA 2JF7A 1CGTA 1E43A 1JZ7A 4EAMA 1BVZA 3B9AA 2ZUUA 3BC9A 3M7SA 3K8KA 2D23A 2VX7A 3OBAA 2OYLA 4CKQA 3L4ZA 2J74A 5BRPA 1FHLA 1QNPA 3VGBA 3KL5A 7TAAA 4TOQA 2E8ZA 1QNQA 4CD6A 2DIEA 2BXYA 4UQEA 4D6JA 3MANA 2JEQA 5F7UA 3DYPA 1JF6A 4YHEA 3L4XA 2J7HA 1WNOA 5HOSA 4TUFA 4AYSA 1C8YA 1NH6A 1WCUA 3WN6A 1DEDA 2Z1KA 2OSWA 3I3EA 1EDQA 1GJWA 3T0DA 2J78A 3SCUA 5CZKA 5A94A 2RGMA 3HMCA 2D0GA 3WFZA 4B3LA 3PZUA 1HL9A 3DYOA 1E4NA 4TX6A 5JBDA 1ODUA 1OIFA 2VZVA 1L8NA 4LX4A 3AHYA 1GQJA 1OBAA 3MUIA 3WF2A 3PZGA 1XYFA 2G3IA 3GH4A 3BAKA 1GOWA 3AZSA 3WNOA 3MS8A 3WH9A 3UERA 1VFOA 4YHGA 1G0CA 5CGMA 1CIUA 2WHJA 1E40A 1XH1A 2ZOXA 3VPLA 2D3NA 4H2CA 3CTTA 4P7NA 3VD4A 2VQTA 3WUEA 3UG4A 4D71A 4UFJA 2WZEA 4UQBA 1H2JA 2WNWA 4TX8A 3WQVA 2FH6A 3SUVA 1PIGA 2VCCA 1MW3A 3N1AA 2YKKA 2ZUWA 2AMGA 1BTCA 5BYWA 1MW0A 1E1EA 5C70A 1DP0A 2G8ZA 1VIWA 3NSNA 1UOKA 1UD8A 2BY3A 2WMJA 2UY5A 2VMFA 2YL8A 2O9TA 5HBFA 2XFYA 3ARQA 3GXFA 5CSYA 1ISYA 1WB0A 1F4HA 1HJQA 5A6MA 1KCLA 2JE8A 3DHUA 3OGRA 3WQWA 3II1A 1ZB5A 2ZX5A 3TP4A 3WQ8A 3K8LA 3PTKA 4UFIA 4S3JA 1X6LA 4J3VA 3CO4A 5ABGA 4AZ5A 4PCTA 2G3MA 4KGJA 2WXDM 3T2PA 3ARRA 3SCTA 3ZSTA 4H04A 1OD8A 4GZJA 1KXQA 1W1YA 1R7OA 3BLKA 3EYPA 1ISWA 1KR0A 2B31A 3VOCA 1ECEA 2CBVA 3IAPA 3CUFA 1J10A 4E8DA 1US2A 1K9TA 1E3ZA 5JIPA 1EO5A 1C8XA 2W61A 3T09A 3RILA 5HPOA 3AYRA 2WC4A 1E0XA 1Q6GA 1K9EA 1U33A 4D6FA 2G41A 1HN0A 1UG6A 2O14A 3L4YA 1L0PA 4ACYA 3WF3A 2GDUA 1OINA 1W9BM 1LF1A 5E6YA 3BAYA 2X1IA 2FHFA 3WL1A 1J11A 4LJHA 1V3JA 2PBGA 4JFTA 2WC7A 3IAQA 4IUGA 1E0VA 3BMWA 4JHZA 4AZCA 3QHNA 1TUXA 1FHDA 4GPNA 2FGLA 1OCQA 3W6MA 4CN1A 3VD5A 1E6QM 2YLLA 5BXSA 1R87A 1LL4A 4HMCA 3VMOA 3BAXA 3WDIA 2Y5EA 5IFTA 4JKLA 4CU8A 4GI6A 4GQQA 2O92A 2YL6A 1VBRA 1JNEA 4HMDA 1Z32X 1X6NA 3WDRA 2IXUA 3VDCA 4OIFA 1H0GA 1EH9A 4P8WA 1QBAA 1CXLA 5C8BB 4CD4A 3GM8A 3PZOA 3ARWA 2BY2A 5I0DA 4JL1A 2DT2A 2EPMX 2VXJA 1JDCA 5HNNA 5A8QA 4J28A 3SCPA 4PSPA 6TAAA 3CHDA 1RP8A 3WNNA 5BXRA 1FH8A 2OSYA 3PTMA 2WLYA 3WELA 3T0AA 3VDAA 4UOQA 4JCLA 1H49A 4MB3A 1GUVA 1PX4A 4MADA 1AMYA 1EHAA 3SCRA 1OD0A 2GK1B 3WQ6A 3AS2A 4V2XA 1GWLA 2DSZA 1KQYA 4UZUA 2C0HA 4F9JA 1GWMA 5HXMA 1P6WA 1W3JA 3CZJA 3WNKA 1WDPA 2XTKA 2IUZA 1ISXA 5EFDA 1UH2A 4L4OA 3VDHA 1VFMA 1PX3A 3N04A 3O6AA 5CJ5A 4U33A 1WE5A 1ZL1A 1Q6DA 4ACZB 2LROA 3VUPA 2WMIA 4FF5A 3VTRA 2YL5A 2C24A 1C93A 1UH3A 1EOMA 3MSGA 4DM1A 1B3XA 1GW1A 4GIAA 5JIWA 3VGDA 4XUYA 1CGWA 3G6LA 2VC9A 1W9UA 4W7WA 2CEQA 1Q6EA 3KL0A 1TR1A 3ZO9A 3EMCA 1AQMA 5HPCA 1G5AA 3BAIA 1OWQA 2VVSA 2Y4SA 3VKKA 3VGEA 1HJUA 3MMDA 2GJXB 3N12A 1JXKA 4MB1A 1RP9A 1UZ4A 2XJ7A 3IANA 1UR1A 1EXPA 4M82A 2V5CA 1KB3A 1V3IA 5GNXA 1HXJA 3UR7A 2WVSA 1HJXA 3OLDA 2VRKA 1R8LA 2VQUA 1GQLA 1UD4A 4CP9B 1FH7A 3ZJ7A 2W67A 4BF7A 3GH5A 2J7FA 1BYCA 3VU2A 3ZYHA 2WANA 2EPLX 1E0WA 5D4YA 1BAGA 2QHAA 3WDJA 3AI0A 4XB3A 1CECA 4LK7A 3WNPA 1GOOA 2VL4A 2JWPA 4JZ5A 3SCOA 3WEMA 1UR9A 3ZR6A 1E1FA 2YA0A 3W38A 1HJWA 2EQDA 4U2YA 3WUBA 4CD5A 4AISA 4GINA 1C7SA 2VR5A 1EQPA 1KGXA 3A6OA 1J0HA 3OGVA 3WF1A 4QFUA 1J01A 3CLWA 4JKKA 2QLYA 4CVWA 2F61A 1AQ0A 3DHPA 1UD6A 1W32A 2A3EA 3GNOA 5M03A 1W3KA 3KZSA 5KEZA 5D8ZA 4PN2A 1QW8A 3CH9A 4N42A 1KGWA 1V02A 3CZEA 3AYSA 1W1PA 1MXDA 2E9MA 3WD1A 2BHZA 4IISA 3WF4A 4QLLA 4Z2JA 2E9LA 1FH9A 5DO8A 5IXEA 4V28A 5IDIA 2WHMA 4CN6A 4HOWA 3BAJA 4TVCA 1UYQA 4PUEA 3U7BA 3MSDA 3CHEA 1XSIA 2DSVA 3GXMA 4AIEA 1JDAA 3MV11 2W91A 1NOUA 1EHNA 1GWKA 3W6LA 4AEFA 2VT0A 3ALGA 4OOUA 1J9YA 3CUGA 5M17A 1HVXA 1WZKA 2E40A 4UQ9A 4C7DA 3OLEA 5DFAA 3UETA 1FA2A 1W3HA 2WPGA 1M04A 4FK9A 4MB4A 4V27A 3EDJA 4OUEA 1CXKA 1HP5A 4QLJA 2BHYA 3W53A 1VAHA 3WEOA 3VINA 2PC8A 1C3FA 5CPQA 1K9FA 2WVVB 4J3TA 5LYRA 2QPSA 3D3AA 2V3FA 2W92A 4UFHA 4HMEA 4AD0A
chains in the Genus database with same CATH superfamily
2FZ8A 1RINA 3GXTA 4HK8A 2EBNA 1WLDA 1SU5A 2Q8DA 3B97A 3WP3A 4WOZA 1TIMA 2Z7GA 1E15A 1UZWA 4RNFA 5FCZA 3LLXA 4UTFA 3SIMA 2VDHA 3WQDA 3QH7A 4AVFA 1G7UA 2XGIA 3UXAA 3GNNA 5HNTA 5JPNB 2WQPA 1I1EA 4MY9A 2BGNE 1W04A 4JFWA 2VCAA 2VFFA 4Q4KA 1K9DA 1OOPC 3AWNA 3GG7A 5FOOA 1R38A 4IIHA 5FESA 1ZZMA 1JYWA 2TODA 5A69A 2TYSA 2VMDA 2ZEXA 3OGGA 4WR3A 2QQLA 3UR5A 1PGL1 3VK5A 5JXGA 4C90A 4PCNA 7ODCA 1I8JA 4MXWA 3ZOAA 1PWMA 5LZLA 3AMHA 4AG4A 4UTHA 1S5VA 1CGXA 5F5IA 4JIPA 1C91A 5IW0A 2DGAA 3EMQA 1ZBA3 5A6XA 4TVDA 4RZBA 3URQA 3S5YA 1YDYA 3V5OA 4X0VA 3E12A 5HAOA 1RQBA 2QZ3A 5C6MA 6REQB 3MO4A 1WMFA 1XYOA 4LU0A 1BKZA 4EWJA 2ABBA 6A3HA 3G6MA 4LS1A 3LSEA 4LV9A 1C7TA 3T1MA 5FI8A 1PWLA 1VPQA 4NILA 2N7GA 1KKRA 3NGJA 3W2UA 1VRDA 2PWDA 4BMBA 1H3GA 3H2OA 1HRV2 1AK5A 4Q8OA 1ZBA1 1QXJA 4G7EA 1VR6A 1UQZA 4IX2A 4PUKA 3VGFA 3BO9A 4KT2A 4JDOA 2ESCA 1SO5A 3OSDA 5CAHA 4DJDC 1U0AA 3VN4A 1SPQA 3CZKA 4UTMA 3AIWA 5KZ6A 4WSJA 3GYEA 3WLQA 1DBTA 1ZZ8A 4QR6A 3V36A 5AC93 4M29A 4BB3A 2WNEA 2Y5JA 5JH2A 1JFHA 5DELA 3L23A 3W58A 5HWJA 4K9SA 1RUSA 2VP8A 3WLTA 1GBGA 7A3HA 4ZA0A 3ZFFB 1PK6A 5ECUA 4M6VA 4UFLA 3TYDA 1U12A 1H41A 1Q6FA 2DVAA 1ZHAA 5TBOA 4I09A 2EALA 4IEVA 4FX6M 4KCWA 1A5MC 3G5EA 4QXHA 4H00A 2VH9A 2DH2A 3PUDA 3VDBA 1X8CA 1IT7A 5AC91 4JQ1A 2Z5WA 3NKGA 2G96A 2MANA 3B8TA 2GJRA 1RUG3 1UX6A 1A49A 1UY1A 1WKFA 3ARZA 2WLQA 5CQ1A 1B09A 3OA3A 1LGNA 2ZXBA 4KRTA 2ZHNA 5CJNA 3GAKA 1FDJA 2W27A 1TMQA 3UWEA 4YTRA 1I45A 3RYKA 2QCNA 3HPXA 4JHOA 3FX3A 4FOVA 1XLIA 3K2OA 3ZVHA 2Y24A 1XIFA 2C5DA 2OT0A 5ABHA 4AXKA 1E55A 3UGFA 4JIEA 3FA5A 3WVJA 4AMCA 1CBGA 1RUG1 1E5NA 1F61A 5EBAA 3AYCA 5I7GA 3W2MA 5FEWA 4P9GA 5GLZA 3R11A 4WVVA 3S1UA 1P6BA 2X7VA 5G4EA 1CB2A 1PEZA 4LBQD 1R2RA 9XIAA 2Y34A 5E9AA 2X0HA 3NQ7A 1RUC2 3GXDA 2BY1A 1H1NA 5HJLA 3U2ZA 3RR4A 4ASTA 1LU2A 3UGGA 1X8EA 2F84A 4WIWA 3U10A 3F4WA 3GXNA 5AVAA 1AX1A 2QCHA 3V7PA 5ISLA 4H9MA 2BGPA 1AUSL 1L7RA 8XIAA 1VLIA 2VBDA 4L80A 1YQ6A 5GJPA 1US3A 2OEKA 4PB3A 3SCVA 3EX4A 2ZMKA 1T7LA 3AHZA 2ZX1A 2ZZ2A 1LB2A 3U0HA 4D94A 5F1VA 1L6GA 4LOSA 1P7TB 4K6BA 1M41A 1MZFA 4OFCA 1Q7QA 2E53A 1HL8A 3ZXEA 3IPVB 4OQ9A 1P6CA 2F8QA 3W2JA 3U5UA 3VKMA 1QOTA 1UU5A 1UWAA 3WY1A 2PQQA 4TR9A 4AI0A 3NL3A 3PMSA 4K8GA 4UR9A 1FNZA 4R9AA 1AHSA 1FCUA 2XSAA 4JR5A 1RQHA 3PFMA 2XJUA 3TEYA 3AIBA 3HBKA 1D2KA 4DY3A 1AJZA 4R33A 1AMKA 4GX9A 3O0WA 2GPTA 4R7WA 1UZVA 5J7MA 1AJ2A 4GX8A 5I93A 2GJXA 3I4KA 1MEHA 4XE9A 4PI0A 5FJHA 4D72A 2BASA 3WQ4A 3GHNA 4NJKA 3VILA 5F39A 1E56A 4GUGA 4PTXA 3SUTA 1OG6A 1PO22 3SKVA 4PGLA 3BN6A 2QQIA 2WOQA 3W7OA 3ZOIA 3ME2A 1GOFA 3G3MA 4DZIA 1H1MA 2IC1A 1RMU2 2DDXA 1BMV2 2GQ8A 1QBBA 3L21A 3R6SA 2YPIA 1QHZA 4O1FA 3RG0A 4NIAA 3OA5A 1A5SA 3Q37A 1UZHA 3UA3A 4RR4A 5FF4A 1KWKA 1SGJA 3LQLA 2QVSB 1HW6A 3P0XA 5C3OA 3NXLA 2PWGA 3TJ4A 5EBUA 1I9CB 3LU2A 1XU1A 5FZ9A 3AO0A 3EPOA 1CW2A 2VXNA 5G2HA 4O50A 1LAJA 2BJSA 5AYBA 3K4ZA 2QF7A 1F5ZA 3N11A 4C5ZA 1W3XA 4JGZB 3BKZA 1QWGA 1R3VA 3GBEA 1W9FA 4WM8B 5BPXA 4ZBCA 3VC6A 2OOFA 2H0VA 2GGEA 2OZ6A 2B45X 5HDRA 4FLRA 1WWYA 5G2WA 1I6NA 4PDWB 1BZWA 3VIOA 5HCHA 3GBDA 5A3HA 4WUIA 3TC7A 1CGYA 4BKNA 5M3WA 4XF0A 4JDBA 3QTGA 2G19A 4ONVA 3RLHA 2FTPA 1ICPA 2ZS6B 1HFBA 2C1GA 4NYYA 2BP1A 3GZTB 5FY0A 4HJFA 3TR9A 3V5CA 3WW1A 1M53A 2IS7A 3P0WA 4MJMA 3L0NA 5GM0A 3TFCA 4G2DA 4YU1A 4ZODA 4GI4A 5HCFA 2WZIA 2WO7A 3FAXA 4I01A 3VNJA 4AY7A 2YYUA 5CISA 1NCQB 2Z69A 3ORJA 5BOOA 1V6YA 4FLQA 4Z0SA 1H0BA 1F3WA 1UIKA 2E4TA 4N7IA 5FZ0A 4TXWA 3TYZA 1JYVA 3I65A 4S2FA 2ZX2A 3KRZA 4JAWA 4PMXA 3FGCB 1W9DM 1ZPTA 3PWGA 5KXEA 4CE8A 5JMOA 3BJSA 4YVPA 4D1JA 3DCPA 1OT2A 1OA2A 1EYBA 2CLLA 5F8PA 4AEEA 1R3YA 3N34A 5MKGB 1ZBE2 1W6PB 3ZYIB 1ZZ9A 5A33B 1AF9A 2I5IA 3UA4A 3FW6A 2C13A 2PHTA 5FYMA 5CSRA 5FP4A 2CLFA 4GACA 1Q2SA 1GYMA 1QI2A 3L4VA 1W2PA 3NZGA 4Y8EA 1UXXX 3O6CA 1W31A 3APBA 3PJWA 1UROA 1E5JA 3KRUA 5C5UA 3VMNA 5L36A 2R8WA 1A47A 4RS5B 2J8GA 2YBTA 4FNUA 4ERGA 3GUGA 4LT5A 4MNMA 4NYUA 3TVAA 4LYRA 2WN3A 3FDGA 1QWRA 1AH3A 4ZOAA 4JFUA 5EJ3A 1XE0A 4UFKA 4YNIA 1NARA 1TV2A 4GKTA 3R13A 3AP9A 4FHAA 4HK5A 4IWWA 3C7OA 1UU4A 3U1XA 3WJWA 4F0LA 3GR4A 4CEYC 2WJEA 3CMJA 4Q1PA 1OT1A 1WKYA 3ZX7A 1NAEA 1H9PA 4YVSB 3GKFA 2CXGA 4HNLA 2R30A 3FLPA 2PLKA 3VIHA 1TVGA 4KWOA 3IN9A 3H50A 3A4AA 3POEA 1BWVA 1C3HA 3WUCA 4N4PA 2CPUA 4IFRA 1O5UA 1HZYA 5GPRA 3CHFA 1O66A 2E31A 1GG0A 1TZ7A 3V0UA 3IJ6A 3CWOX 4AL9A 1HUVA 2FZMA 4HPHA 2OKOA 4ATEA 1OC5A 4PTVA 1O5XA 1KWGA 2HE5A 3BVCA 2HSAA 2ES3A 1XXXA 1CZ1A 1GYNA 3I6TA 3WQPA 1NLSA 4RV8A 4EN7B 4BJHA 2WVUA 1R3SA 2BSLA 1E6SM 5JI7A 1VJZA 4AEDA 1WA4A 5IWFA 1V02E 1L7LA 2YCEA 4IV1B 4POCA 5ABJB 5DLCA 4UW5A 3PB0A 1JI1A 3OOXA 4DPPA 3OZPA 3WUGA 4XFHA 1RJRA 4PBEA 4YVXA 1CNVA 1V0NA 2V4VA 4PI2A 3DYMA 5F1RA 3T8QA 1EB3A 3N9QA 2X5IB 4A44A 3BZGA 1RA0A 1IQDC 4U3AA 1OB0A 3AKTA 3D0SA 4FAMA 3W86A 3B02A 5CLTA 1EGZA 4HK6A 4TIMA 3D0CA 2O1QA 3VZJA 2ADEA 1K6WA 1ZZ7A 1J1TA 4CDUC 3S1WA 3A0NA 2YJQA 3VX0A 1Q6RA 3LHWA 1GNHA 4EZHA 4FA3A 3FA4A 4X2RA 5CG0A 1UMLA 5BNPC 1MS0A 1G9HA 2F7FA 4HQVA 4W5ZA 3WDHA 3VA8A 1I0DA 3SCHA 4AXOA 1PAMA 4Z2GA 4Q26A 3W7LA 3U4FA 4WHBA 1CENA 5A7WB 3ZMRA 1ENQA 2CKSA 4MSSA 2MUCA 3MUY1 2ERFA 3AMCA 2RS13 2K0GA 9RUBA 1LL7A 4J35A 1JOBA 1BLZA 4IPPA 4K1ZA 1QOXA 3CQHA 3NQCA 3RPMA 4EANA 1SJBA 4AQ6A 4HN1A 1QU4A 3FV9A 4DFSA 4Q27A 4E27A 5FZKA 2OYZA 1WXYA 4JGYB 2KA3A 5J5DA 5IRPA 1X6UA 3AZTA 3NNMA 1YCIA 1FOD2 4QKNA 5FKYA 4D6HA 2IKJA 1FI2A 1ICQA 3G0XA 1YLVA 1ZSXA 3LERA 4H6QA 2D24A 1REDA 1SACA 2R1DA 2ARAA 5IVVA 1NDWA 4XIAA 4AWTA 1YNQA 2GSEA 2E7TA 2RS11 2AACA 1E9IA 1C9DA 3DFYA 3SCWA 4N0RA 3UWWA 3KV4A 4C6IA 3LZZA 4H9UA 4X3ZA 2OEMA 1DYSA 3VKOA 4S1FA 3UCQA 3RMYA 2K46A 2KAUC 3VBFC 2DZBA 5ANNA 4K39A 4ARXA 5CFDC 5JBFA 1SO6A 4KNCA 5LRRA 2XHKA 2VGFA 3UZJA 3LTPA 4L4PA 1IS4A 4UWMA 2ZEWA 3LZ3A 4RZ5A 2QDRA 3NDZA 4W85A 4I02A 4QM9A 4SLIA 1ZJAA 2WPBA 4YG3A 1E6PA 4JICA 1WD4A 1APNA 4PL1A 4UXAA 2QUVA 2XM2A 1B90A 4LAUA 2R062 3PBUA 4WY0A 1TA3B 3GDLA 2HK1A 3Q4DA 1DYPA 2ZUNA 2EXJA 5T26A 3GS6A 1YRZA 2G3NA 1W2UA 2X40A 1FKWA 2ZADA 4DBEA 2JDMA 3DPRC 1UNBA 4HONA 1IWBA 3E0VA 2OWXA 2GOKA 2WFF2 1MFUA 2BNJA 2J6XA 3UG8A 4CRQA 4ASMB 3DDMA 2NXIA 1VJ2A 2BWGA 1JU3A 1B2YA 2ZZ7A 4MZ1A 4ZQCA 1AR62 1WW4A 1IXQA 3TBDA 4XUNA 3BSHA 5C7VA 1J2WA 4GH4C 4KCUA 3CV7A 1DQ2A 2WZR2 4H8VA 5LY1A 3LBCA 3IIVA 4IICA 5FPBA 1W2TA 2WWDA 3VZXA 2BQPA 4C1NB 1LWJA 5J1XA 1QCWA 1JGIA 4YVWC 4IV3A 1RR2A 9CGTA 1WW7A 2W47A 2A71A 1SMVA 1X33A 4OYUA 3VIGA 9XIMA 2CW6A 5EIYB 1OLRA 2XIIA 3WBEA 3R7MA 4DUXA 4AAPA 4Q22A 2NX9A 3USBA 4D1IA 1MR5A 1FVPA 3I2JA 1JPDX 2XZ9A 4J9JA 4HPKA 5L9BA 1V6WA 1UO9A 1YO8A 3KD4A 3Q8EA 3J9SA 4X8NA 3JVAA 4CSWA 1LODA 4LNCA 2OWCA 2VOKA 5GZEA 3EPNA 1I2OA 2NT0A 5A2BA 2VO5A 2P1BA 2OODA 1RUD3 2KZHA 4NAFA 2WAOA 5AY7A 4FMVA 4K68A 3UQNA 1H9WA 1DHKA 2PDLA 3KBMA 1HVQA 1W5QA 4CYDA 1WV2A 2ZGPA 4FX8A 4NRSA 1POV0 3PUHA 1AA1B 4KEUA 2J7EA 1RJ7A 3QD6A 2JKAA 5BOEA 3UKVA 2C4XA 4U2AA 1NF0A 1EC9A 4GFSA 4EE9A 1IZJA 2V09A 1F8MA 3W7KA 4QM1A 3CH0A 3GH7A 2C18A 4OHQA 2OXNA 2MEV2 3CQ0A 1OX6A 1TJRA 1AVAA 2A21A 3VNKA 7REQA 1WZXA 4LE3A 5FJIA 4QXCA 3KOFA 2D6PA 1E72M 4K21A 3GFZA 1RUD1 4XZHA 3I3MA 3QACA 1EJRC 1PVC1 4Z2KA 3IMMA 5REQB 3U2OA 4HD5A 4JPGA 5DN1A 4ZONA 2VYOA 3MCNA 3HBZA 4RHV2 3V65A 3PN8A 1EDGA 4NRRA 3RXZA 4PFHA 2VUYA 5F3GA 1JW6A 4I5UA 4D6SA 2ZUMA 3QMTA 3A64A 1PBGA 1I1WA 4XZWA 2E33A 1UPSA 1GQHA 1OXCA 3M3EA 2C26A 3GU9A 4R34A 5C4WA 3TTOA 4BZYA 4E2OA 3NM1A 1V0KA 5A6BD 3OO2A 2I07B 3GG8A 4HYRA 1XBYA 5LEKA 3OTRA 3MFAA 2DJLA 1Z48A 3PTQA 1J0YA 4AZBA 1PIFA 2ZCWA 5GZCA 4M0NA 3S5NA 4HCDA 4GY7A 3SJNA 3R05A 3A7QA 1EA0A 1XYLA 3ARUA 3KCOA 1OH4A 5FF2A 5F2SA 2CAUA 4YGEA 4LYPA 1XYCA 1VJSA 2VDIA 4XXAA 2WNVC 4CPBA 1JL8A 3SITA 2F4LA 3TQ0A 4Z0JA 4AYGA 3W7HA 3FJSA 3OBTA 4DHGA 2SLIA 3L4TA 2VZQA 3UGHA 2POTA 5IOBA 3F5LA 1OFSA 3ZYRA 4IZGA 4N9CA 1SPPB 5BNNC 1NOWA 1J18A 4GWMA 2VDGA 1CI1A 3IIIA 4CXWA 4B3KA 2BS9A 1CEOA 1FWFC 1NQKA 2Q1ZB 5FZDA 2OLAA 4XJWA 4RGGA 1BHGA 4TN7A 1QPOA 4AF0A 4DWSB 2ZGUA 3ACLA 3PSWA 4DS0A 4U10A 4Q4Y3 1UY4A 4H9TA 1UJPA 1QPQA 1REFA 4BCEA 2EG8A 2Y8VA 4B7KA 2PDPA 1V3LA 5XIAA 1A3HA 3SHRA 1CCWB 2WNZA 3IJ8A 4IMDA 5ENLA 3B0XA 3GKAA 3O1OA 4D8MA 1BVWA 3VIFA 3EOSA 3H8UA 1GQIA 3DAQA 1A5LC 4LO6B 1LR5A 3DH7A 2E6FA 1W0PA 3OEXA 4ILSA 3POBA 1WMXA 4NN0A 5AHEA 3WLSA 1PPIA 5M2FX 1V9U3 1TME3 4F0RA 5A6YA 4C91A 4Q6JA 3COTA 4Q4Y1 1ZRDA 3IJQA 4IL2A 3P74A 3BOXA 3SDOA 3ZKYA 1W3NA 2YFZA 5F3IA 1O4YA 1V3MA 4S2BA 1WDQA 2J62A 4B5TA 2LRPA 3SY8A 3NSXA 4R7JA 3CK5A 1ODMA 2DZWA 5C71A 4PMQA 5JOZA 5LNSA 4V2VA 2RDXA 4BHPA 2ON3A 8A3HA 4IGQA 1VBA2 3FUOA 2QNKA 1Q8VA 3M6DA 1V9U1 1MNSA 1TME1 4KWKA 3ZMNA 1EA9C 1Q6QA 3EMZA 1DZQA 4W5UA 2HYXA 4N6FA 5BXTA 4A8IA 3RLUA 5FXWA 4CZSA 1J12A 2YDQA 2VQAA 3W2LA 3TAOA 3MWCA 1TV8A 1UD5A 4UOZA 3H9AA 3V5FA 1D2SA 4LHNA 4IMEA 2V73A 2FDGA 2PF0A 1RH9A 4OKDA 4LE4A 1DJWA 6ALDA 4IGMA 1OT5A 1X50A 3ROUA 1G7YA 3UJOA 2FZDA 3CUHA 1IKPA 2DURA 1I75A 4NO4A 2VX4A 4AFMA 2HNHA 3FUQA 4B2DD 3S42A 5M0TA 4EN8B 4NNAA 3GJAA 2QUTA 1DJYA 1W8UA 3OVPA 1W6NA 1IE7C 4CDXA 4HZMA 4OV9A 5EYXA 1HX6A 2FGBA 3EBVA 1KKOA 2X0SA 2HH9A 1FFQA 3CWNA 1Y7BA 1DWFM 2ICSA 1D4M1 2HEVF 2YUEA 1H8TC 1EUNA 5A6LA 2D6OX 3PURA 4UNKA 1DJIA 1SFPA 4NAEB 1XRUA 2Y5SA 1UWIA 2P0IA 3A3WA 2E8YA 3NL5A 1NJJA 2R1LA 4Y24A 1BFNA 3GCXA 4H6RA 5FEZA 1CLVA 4XW3A 3NV3A 2A7RA 3FS2A 4RGKA 2XBO3 1G67A 3DFNA 1YMYA 1FWBC 1Q8QA 3TN93 1G94A 2GQ9A 2ZDSA 3N14A 4IPNB 2QYGA 3M3OA 5CPSA 3VNIA 4L4LA 3RZZA 2HWF2 4C1LA 3WNLA 4E2GA 3Q9OA 3N29A 2GZWA 3SQSA 3WIJA 2RE9A 4XF1A 2CIPA 4QDPA 2NLIA 1B35B 1LQ0A 4KWUA 4GJZA 1Z78A 1RC6A 3N9MA 5C9RA 5DAWA 2PWFA 5DMMA 4CNTA 2Z1XA 1HO1A 1H7RA 2YBVA 3R25A 1TSIA 2WS92 1VBC2 3VNYA 4JIRA 4RR3B 3TN91 5A95A 5C33A 1JUBA 1WD3A 3APYA 1UIOA 3ZFGB 4KL1A 1V70A 1O68A 3SURA 2YBSA 2Z2SB 1LZOA 1NZIA 4QX2A 3E2QA 5FPUA 4ZHNA 1X8MA 1MQTA 1Y7VA 4A8LA 3T6CA 3DKLA 4B9ZA 3QOPA 4IEWA 3W01A 3MBDA 3M44A 4MFEA 3GF6A 1P0DA 2XVGA 2DT0A 4P7QA 1SFNA 3RZJA 3EPMA 2J7DA 1YPIA 4UR8A 4J7RA 1XYZA 1OIMA 2PFHA 2JF6A 2VRJA 2BFGA 1V0LA 3MPGA 2VOXA 1BKHA 3T0BA 3PANA 4GABA 5EFFA 4W6XA 3RIKA 1RPXA 3W59A 1XXNA 4PQ9A 2RJLA 4NNBA 3ZXDA 4IGNA 3ZWSA 1W6OA 4EKJA 3S47A 4YTSA 1QY4A 4XFAA 5FWEA 1MS9A 1DJNA 4ZQMA 3TSMA 4A29A 1M5WA 3CV2A 5JU6A 3W88A 4ZE4A 1XUUA 1P0NA 4S3CA 2F4PA 4XBNA 1IF2A 4C6PA 2YYTA 4M51A 4TTGA 1FWSA 3OUJA 4HA3A 4IPLA 4Q4MA 4FPHA 3AXEA 4CCNA 3HPZA 4KU7A 3NJ3A 5LSMA 1DZRA 4C1WA 3CJIA 1MNZA 2BV9A 5AECA 3ARPA 4TSVA 4O12A 4P8UA 2BHUA 3WP6A 2WZMA 1PX8A 3RFAA 4YZ5A 5A6AA 4GQ0A 3ES8A 2WO2A 1PO13 3W74A 2FZ2A 2WBKA 4IGPA 3EX2A 3FY1A 3RYSA 4Z1AA 3BLPX 1IT0A 1OKQA 1QK0A 1W90A 3UYJA 1J0KA 2V69A 1PMJX 1ZP3A 3AZVA 4O15A 2CWSA 2Q8EA 1HKIA 4S3GA 1GKRA 5C9ZA 1BPLB 4FLSA 2ZZ4A 1T6MA 5F3EA 4OHZA 2QMKA 4IPJA 3SZ8A 1L6SA 3A4JA 3KBJA 4FR1A 2XVLA 4TV6A 2QT3A 2KR2A 1LECA 1JXJA 1QNSA 3P3BA 4GQ7A 2NWSA 1ICSA 3F2ZA 4S3EA 1PO11 1QDOA 4QXKA 1ADSA 4GVGA 4N43A 4UQDA 2RS33 3B4UA 1A53A 3LTSA 4IJBA 4E3TA 4EYUA 1QQP3 1BTMA 4P5UA 3AIUA 4QX4A 4ZFCA 1SJDA 3C3UA 4RYDA 1QJWA 1HV1A 4PMVA 1WX0A 4DAFA 5FEXA 3LNPA 5FMCA 2RMU2 4FTBA 3ZIWA 5JIAA 1ZNNA 2IXVA 2QR6A 4KMQA 4OBRA 5HR6A 3VZKA 1UWSA 1LROA 1U83A 4IXLA 5J98B 5I07A 1TWWA 2VMEA 3BMVA 4AWUA 1UKPA 4PMUA 3OYWB 5A70A 4M5PA 5EYYA 2R82A 4H3WA 4QDMA 1J59A 2VENA 4LCSA 3ZJKA 4EZ4A 2RS31 3TN5A 4UTJA 4BQ4A 4XHBA 3ZYGA 1MRAA 3HBLA 5BZAA 1QQP1 2DU2A 3H1YA 4MB5A 2UY3A 4FCAA 2NPIA 3IGUA 4A6OA 4NZCA 3B7MA 4JAAA 3UY8A 1Z7S2 3RNDA 3ZO0B 3UXDA 3GNDA 2O55A 2ZRUA 2GN7A 2E1WA 4W50A 3I7QA 1IOAA 1X9PA 3U07A 3POCA 4M3CA 1UR2A 2DIKA 4LBMA 1JZ2A 3LCGA 3NZRA 3GUWA 1F6YA 1JFXA 4DXSA 1PGL2 4BPZA 1OYBA 3SEEA 1JNDA 2ENRA 4QPGB 3KTSA 3E74A 2CBIA 2OGJA 1GQKA 1CXIA 1MW2A 2ZKMX 1KBBA 4OTKA 2OJPA 1JS9A 3SXWA 4H1ZA 1HB2A 2PDKA 4KIRA 1S2KA 3CHXA 4AEOA 5I8TA 1GHSA 4FOKA 1ZRRA 3SCGA 1KJRA 1TWSA 1SLAA 3PG9A 4PSRA 4CGTA 2GNDA 2GGGA 3JD73 3CLPA 4IMCA 2PLV3 3G0SA 3QC0A 3MCOA 1GP6A 3Q8BA 3LMZA 4I9TA 2NSXA 2EPHA 1VF8A 2D1ZA 1UN1A 3IT8A 1QI5A 1E73M 1ZZ6A 4DEVA 1VFTA 4IE6A 3OBRA 1UWWA 3GDMA 2QDNA 4Q4SA 3MC5A 4YW1A 2Y7FA 3IWPA 1ZRIA 3BPZA 3BH4A 2QQVA 4QGLA 4L6OA 4RZ6A 4OVEA 2BW8A 4Q29A 3IJIA 4Y1ZA 3W5NA 4GD0A 3GLCA 1CPUA 2B7YA 2W9MA 2Z1BA 3ZT6A 2Z27A 1S1RA 5T50A 2PLV1 5A6JA 4XACA 3WQ7A 2HV5A 1YUDA 4AQ2A 1X96A 3BZJA 4QP0A 2G9GA 4V15A 1COV3 4YW3A 1XPGA 4MNKA 3RJYA 5EHDA 1X7NA 1IIHA 1RHCA 5DPNA 2ZWYA 3T4CA 4CEWA 4QXIA 4KEVA 1O6UA 1AR83 1PIIA 3UFYA 5DAPA 3IIAA 1QXRA 4JTAA 5SV8A 4EAMA 1NA1B 2VWTA 2WNUB 3DKQA 3AKQA 3IBMA 3Q94A 1IR1A 4Q8TA 4CNPA 2UYBA 2H6RA 3LM7A 1O1ZA 5BRPA 2V63A 1SLTA 5EL1A 4RGAA 3RHGA 5B7YA 4Z2AA 2D69A 4QE5A 2EKGA 2ZKNA 4XCAA 5A7PA 1QNQA 2E8ZA 5HR7A 2YC4A 2NVAA 3M5YA 5FZLA 2XJQA 1O60A 1EEPA 5J36A 1JI6A 1AR81 4CQBA 3MHGA 3MANA 3QW3A 4NJ4A 4G6CA 5F7UA 2BEOA 3SISA 4QMAA 2VECA 3IARA 4V33A 4YHEA 3L4XA 3NQ8A 1X8FA 2EA7A 2VZ3A 2J7HA 2B42B 2CYFA 5T52A 1XDMA 4FXJA 4QJ1A 2YXXA 4TUFA 4AHQA 4AYSA 3CQOA 1NH6A 1QMJA 2HQAA 1G9BA 3GG1A 1DEDA 2Z1KA 2VCMA 2OSWA 3ZFFC 3DEQA 3EJKA 2YXGA 5CPOA 2J78A 5CZKA 5FY5A 1W03A 5G05L 3CLMA 3PUSA 4BK4A 1XIIA 3PB2A 1RUG2 1WLCA 3UZWA 1X97A 2C0ZA 1E4NA 4TX6A 3TXZA 1EF3A 3VBHB 1GQJA 1K1DA 3OY8B 1WW6A 1OBAA 3MUIA 2YDAA 1XF0A 3W2NA 3WF2A 4AI2A 5FZ8A 1NY72 2XJVA 3H21A 1GOWA 2YBKA 4NAMA 3WNOA 2V0TA 1ULDA 2YPJA 3WH9A 5LIKX 1S55A 4N4QA 3UERA 5KTLA 4YHGA 5CGMA 4FAGA 3AB0A 2WHJA 4QPIA 2EGZA 1JJKA 1LOAA 1E40A 4N9BA 4I5RA 1RIRA 3VD4A 2ZHMA 2VQTA 3PWAA 5RUBA 2BOFX 4A8NA 2WZEA 3G1YA 1H2JA 2WNWA 5J96B 2D2HA 4LFYA 3WQVA 1CAVA 3SUVA 2HWB3 3K3OA 5FV3A 1AL0G 4B3ZA 1GFF2 3A24A 1DIKA 1B5TA 2PDNA 4MGTA 2Y6FA 4JRLA 2ZUWA 2EF6A 2OLSA 5CAKA 4Y9NA 5HCAA 1BTCA 2HE8A 2ZGOA 5C70A 5IVBA 4MWAE 2O8OA 1TMHA 3BG3A 1W1ZA 2JG8A 1VIWA 2ZAAA 2L9LA 3TEXA 1BKSA 4HHMA 3NSNA 1CZTA 2QE3A 3ITXA 1WBHA 3KQ4B 1P43A 4MXWB 2QUNA 2AREA 3SO7A 4C6JA 3LDRA 3OHIA 2HWB1 1P0BA 4BDVB 4JTJA 1F4HA 3POIA 1OCBA 5IK5A 1KCLA 3DHUA 3QV8A 2HKXA 3SM0A 1JYIA 3ILRA 2ZABA 3RMXA 4XAPA 1DQ1A 3ZR4A 1MS4A 2C3ZA 1YQ8A 4XSLA 3AZZA 3MDWA 3H3LA 4DO0A 4RV3A 4PCTA 2LTNA 3RRXA 1MEC2 2BVVA 1Q43A 1WCQA 4IMFA 3ARRA 3LCPA 3SCTA 3N73A 3H8AA 3T55A 1TV5A 3VFLA 1SW0A 2ZYFA 1KXQA 4JV4A 2P34A 1ISWA 1ECEA 3CUFA 1TWZA 1J10A 3UL2A 2J9XA 3FEMA 3G1DA 1K9TA 2H6CA 5MHBA 4Z1DA 5JIPA 3LGRA 3T09A 2A5HA 4G7EB 4IFOA 3RILA 4XBQA 2XL7A 1FUYA 2WNNA 3BLFA 1NELA 4S2CA 5KXBA 5IYYA 2X53S 4O0ZA 4AOCA 1E0XA 3GSMA 4ERAA 1FY6A 1VHCA 1HN0A 4HT3A 2OQ7A 4FNSA 4GVFA 4HYVA 2CWXA 3BMXA 3TYCA 1WOBA 1W1A1 3U2EA 4KWLA 3FYYA 4EWAA 5EQUA 1XINA 1R64A 4C6DA 4JFTA 2L5HA 2WC7A 4IUGA 1E0VA 2ZOEB 3G1FA 1URXA 4R9XA 3WD5A 3BMWA 5JMCA 4RD7A 1PK6B 3QHNA 3SMHA 1TUXA 4QQHA 3OU8A 2FGLA 4XUGA 4DNHA 4D7SA 1GNZA 1B4KA 2A6VA 2GJLA 3SQLA 3HURA 1FMD3 2IFRA 3AKSA 2B0MA 3T1GA 1E6QM 5BXSA 6TIMA 3G18A 2BNMA 3TK7A 2CNAA 4QRNA 1DXIA 1R87A 1LL4A 2R042 2A75A 1JN2P 3BE7A 5AVHA 2XQXA 3VMOA 2CLKA 3ZPOA 4JGZC 2QQUA 3C3VA 2Y8UA 3WDIA 3FZ3A 4WM8C 1LNSA 5IFTA 4CU8A 2VEGA 2E5BA 2YL6A 1O5LA 1Z32X 3B8UA 4PDWC 1ONRA 1R9ZA 1C8M3 3WDRA 2IXUA 4OUMA 1CXLA 4LO5B 3GM8A 4GK8A 3PZOA 3NMBA 5I0DA 4RL7A 4JL1A 4Q5OA 1S0BA 1YDOA 4PUWA 5FZCA 3ZVHB 4Q4OA 1MZEA 2ZCGA 3KGZA 3FE5A 5CC3A 4YZ4A 1GQPA 1X39A 5FXZA 4PSPA 3VKBA 4P61A 3V75A 4PE8A 1RP8A 3PJQA 3WLRA 2R91A 1Q85A 3U4SA 5H9QA 3L2IA 4XISA 2OSYA 2AL2A 3BL3A 3VZOA 2KXLA 3POWA 1QJU2 3I97A 3OF1A 1H49A 1NCQC 5C8CA 5IUQA 1GVFA 1PX4A 1C8M1 1EHAA 2DVDA 1OD0A 2OVUA 4ECLA 2OXBA 3AUOA 2G4IA 3SSJA 4YM2A 1GWLA 1VBB1 1YQ5A 1J4EA 1KRMA 4AX7A 1GWMA 3OJGA 5FXVA 2A6NA 3T44A 4HETA 1WDPA 1BEV1 3LCXA 3LEMA 4GA9A 4AI1A 1OC1A 5EMMA 1Y9QA 4RQPA 1UKGA 1TTQA 4ES4A 2P2KA 2HXUA 3RSJA 3SGGA 1VFMA 4W9TA 1OQFA 3S0MA 1RTVA 4WEVX 4PLOA 3SECA 2XKPA 3SN0A 4FOUA 2LROA 4RS5C 3A22A 3P6BA 2YL5A 1C93A 4RNJA 1WCDJ 3BOLA 3MSGA 1B3XA 1VQTA 4GIAA 3VGDA 4XUYA 4Z1BA 1CGWA 1R093 1VBJA 2HWC3 3VUSA 1YJLA 3ZO9A 3EWZA 3EMCA 4L1WA 3KHDA 2H8XA 1G5AA 3BAIA 3I2GA 5IK8A 4US5D 1YFXA 1I2QA 1PKLA 1FHUA 1MXSA 1S2UA 3H2NA 1FT9A 4WGHA 2QCFA 4DIAA 3VGEA 4YVSC 2VMHA 3H8RA 1DXFA 2GJXB 3N12A 1UZ4A 3IANA 1PKNA 2XN2A 4EIVA 1R3WA 4K40A 1J1LA 3B8IA 4I0BA 1R1A3 4J25A 2GGJA 2VVFA 4NROA 3E2RA 4H9ZA 4NHVA 4KCTA 1SCSA 5DN2A 1R091 2VRKA 3LWCA 4IE7A 3ES7A 3IUDA 2HWC1 3QY7A 2YGLA 5F1UA 4JTDA 1PNGA 4GJJA 4LSBA 2DUXA 3GH5A 1V6NA 1E1CA 1KTBA 4DRRA 2Y33A 3ZYHA 4OBTA 2TEPA 1PVXA 2D3RA 1SW3A 1C57A 3M7AA 1LT8A 5D4YA 4IV1C 1VCGA 2F6BA 5ABJC 3UJRA 8XIMA 4HN8A 3KS5A 2EAAA 1E9ZB 2ZGRA 1EBGA 4O14A 1RVF3 1CECA 4LK7A 4YWSA 4BISA 1GOOA 2HWE2 2VL4A 2OPJA 3SCOA 2B5HA 1R1A1 5JXJA 2YA0A 2FZNA 4H7ZA 2X5IC 2PP1A 3Q8AA 1QOQA 2UBPC 5I0UA 3P6LA 5AHNA 5A32A 1U1UA 3WDTA 2KM2A 1J0HA 3WF1A 4GWIA 4AWDA 1DGRA 4CVWA 3PVBB 2F61A 2OIIA 2YHJA 5F2MA 3MVTA 1AQ0A 2DCYA 1UD6A 2A3EA 1W3KA 3BCWA 3C7GA 3NV1A 4QB1A 4Q8NA 2NQZA 4A35A 3CH9A 3EX3A 2R9RA 1V02A 1W1PA 3WD1A 3MBFA 4GNKB 1YYNA 3ENLA 4O0KA 1R2SA 4G9PA 4EWDA 1EV12 1FH9A 4F3HA 2PN5A 5C9XA 4HPNA 3JQWA 5IDIA 3LSCA 4ICMA 3PK7A 4CN6A 3UVIA 1EL3A 1DYOA 3D6EA 5DANA 4PUEA 4QJ5B 4QX0A 5CKNA 1A78A 1SCRA 2VFHA 1QNWA 5U7SA 3DUIA 1C1FA 4A05A 3RZLA 3D47A 4FP1A 5TIMA 5FZBA 2W91A 3BVJA 4CUBA 3W6LA 2A6WA 3NAPA 1H4GA 2VT0A 4JGYC 1J9YA 3MHUA 3CF6E 3DV8A 1LGBA 1WDDA 2PHUA 3QY6A 4RPPA 2Y63A 1XLDA 3OLEA 5DFAA 2WPGA 1IZ3A 4FK9A 2FDHA 5FY7A 3EDJA 1V00A 4OUEA 2XIJA 1CXKA 3H7JA 1HP5A 4QKFA 4P5HA 3LRLA 4NL1A 3W53A 2Q3RA 5C3PA 1H1YA 5H8MA 2X41A 1LHNA 3H8XA 3MIEA 1YDNA 3LQGA 3NO8A 4NPRA 2W92A 1XDLA 5CG7A 5C3QA 3RS6A 5I3FA 3KHJA 3VBRA 3M16A 4F40A 2D2JA 3CS2A 4QXBA 2XGBA 3RM8A 4XTIA 4AEJA 1H8VA 1PTAA 4XPVA 4PTNA 2VM9A 4DUVA 1V6IA 1YDVA 4O9GA 3AKRA 5FK8A 1QXLA 4JTEA 4YYCA 4EF9A 4DJDD 2YLAA 2WDBA 3EWDA 4PT6A 3BPSA 3N2CA 2NUYA 3TOYA 5BXPA 4FNTA 1UQXA 5ABTA 3M07A 3AK0A 5I24A 1DGWX 5LK5A 5IVFA 1W1VA 4CCCA 1BYDA 4MNLA 1RV8A 1OLQA 4XJAA 3ZYJB 5I6SA 1XE7A 4HIBA 5DEZA 2UURA 3SUWA 2P3ZA 4MDOA 4J27A 4AD2A 2QV5A 3WDWA 2AC1A 1SZRA 4PR4A 1PE1A 1UXZA 1HG3A 3C61A 4JHTA 2F2KA 3CT7A 3PZ9A 4W7UA 4D6GA 1EPXA 1DBNA 2PELA 3H2FA 4LYKA 5D38A 4AEDB 3ALFA 1QDSA 1B3OA 4LT9A 1SDWA 3W73A 2Y38A 5I23A 3H23A 4QAWA 2GNBA 4O1AA 3K4WA 2VUCA 4UMBA 3W7DA 2W62A 5HA7A 3QH6A 2OO6A 3R0UA 3MW7A 3VGIA 2FMYA 2CETA 4HXCA 4HCLA 4N6EA 1UZ1A 1DQ4A 4QKDA 3S4TA 1ITUA 3MP3A 3W7CA 5HANA 2DH3A 2QXWA 2A3HA 4M1RA 4GJIA 1XG3A 2H8ZA 5AC7A 5EXOA 3AIRA 4QBXA 3N13A 2PE4A 3GTNA 3N15A 5I00A 4LEJA 4GLEA 3VZLA 1TRIA 2OZ3A 4AZ6A 1VRBA 3AZXA 4ZVJA 1IG0A 5A6TC 2SBAA 1UX7A 3VHOA 2XSBA 4AWEA 4O8AA 2X10A 1QIQA 4ZO7A 5HK4A 1D7PM 3VIJA 5CEWA 4OLLA 5A8NA 4LA3A 1GORA 1PM7A 1RUD2 4GZEA 4BEUA 4JTNA 2WKKA 1TPWA 4RE3A 1PVC2 2YXOA 2GP3A 3VBSA 1S39A 2RV9A 3WHTA 2INFA 1IPSA 2G4FA 1W1TA 3ARSA 1K7FA 1HRV3 1O5KA 3ITTA 3WMSA 4ML9A 1JMUB 1POQA 2UY4A 1I1XA 2JBMA 4O52A 4JQ4A 3GDRA 3H22A 2J8TA 4ISRA 4JBRA 5DXYA 4HOXA 2YW4A 4PTWA 1AR72 2JEPA 4UC5A 5D05A 4EE2A 2GZXA 3EB4A 1QOOA 3BOPA 4XZMX 1QW9A 4XF4A 1J0IA 3T0TA 1EXBA 1WZAA 4JD4A 2D6LX 4FXRA 4QG6A 2Y64A 3BTNA 2FCVA 2HEJA 3WF0A 1ONWA 1BYBA 2CLMA 1BRLA 1GVIA 1FWEC 1HRV1 3D8CA 4LKDA 4H7CA 2J7MA 2RJGA 3ZJ8A 1JD7A 4QEHA 1SSDA 1XDJA 2JX9A 5C3RA 1E9LA 1KA9F 4PODA 3VBOA 1WDWA 1ITCA 3AS1A 2VZSA 3I3DA 5I3IA 2E0PA 2A3CA 4ICCX 3A9IA 1NYWA 4XD5A 4XOGA 5DUVA 1XUZA 4NHYA 4EAYA 1HN1A 3C5QA 1EC8A 5A3LA 3H2MA 5F9TA 1PCWA 3T4VA 4GKLA 4L56A 3C52A 3ZLGA 3ISIX 3J26N 2VFIA 3KM8A 1CN1A 3ITVA 3PBGA 3Q65A 1I2NA 3ZXGA 2V9DA 4SBVA 4JN6A 2XWDA 2GJPA 3LX9A 4E4DX 2Q8XA 3PVNA 1RCQA 2ZZ6A 2AEZA 2HXTA 1ZZBA 4IX0A 5HWMA 3L65A 1UB3A 2XH2A 4O10A 1FWCC 2ZXDA 4WY0B 1JHJA 3AZWA 1BD0A 3VKAA 4PF5A 5A8PA 2FHRA 5BNOA 1C28A 1X1OA 4BOWA 3TROA 2Y62A 1OI6A 4YLZA 2PCEA 4YL2A 1HQWA 3M0ZA 4EWND 3FXGA 3P14A 3NNLA 3HV9A 3R10A 1QH6A 2FJKA 5LIXX 2ZACA 2V5BA 1JYCA 2NMNA 1B30A 3UESA 2ISVA 4AQTA 1UOGA 1R0MA 2RGLA 1GMMA 1RUC3 5FAJA 4N9HA 2D2OA 1NDVA 1OFAA 2PHRA 3W25A 5D9NA 5CU1A 3LA4A 3P5BA 7TIMA 2CBJA 2PWHA 2WLPA 5FYZA 2DYCA 1CGVA 4DWSC 1ZX5A 2ZRXA 4Z08A 2D0HA 3AHTA 2D97A 1CLXA 2YZ5A 2E1DA 4L4MA 2CWMA 3I2HA 1CX4A 3GU2A 3F4CA 2HJPA 5B4NA 3GO2A 3OIXA 3BG9A 6CGTA 1QUMA 4BIOA 4IV3B 1XG4A 4LBUA 1RY8A 4IP5A 1XQNA 2Z29A 4UT5A 3MW4A 1LRNA 1V9U2 1TME2 3STCA 3CPUA 3UK9A 1QI0A 3BGJA 5I3DA 1PXGA 5A2CA 3IPWA 1W37A 4GALA 1RBLA 4O1BA 4NRMA 1OK6A 1XBFA 1SZEA 3QPZA 5H6HA 2PZNA 2JIWA 3ONBA 5FYTA 4F0KA 4GJYA 4HPKB 3M1ZA 4PQQA 4UUIA 2OTDA 3IJLA 3OP2A 2VGBA 1VGAA 1VEMA 2YY1A 4UTWC 2B9VA 2VW0A 1M01A 2V2CA 4Y9AA 4BXSV 3THAA 4NAFB 1OH3A 3SIZA 4CPBD 3WD3A 2FDKA 3R89A 1DHKB 1HO4A 3B9OA 3JCIA 3V1PA 4X9YA 1XLHA 5DG1A 2GVGA 4CCOA 3HJRA 2J79A 4HZFA 2KX9A 3Q2DA 1S46A 1N7KA 3KS6A 4MZ8A 3R6IA 4AH7A 4QPYA 2ATMA 2E9QA 4K1GA 1PO23 1ST8A 4HMZA 3VD9A 2EHHA 4L6DA 1IEIA 1D4M2 1YKWA 1CXEA 2WM0A 2REQA 1FBAA 4ZOCA 4YARA 3EQEA 1Q7MA 1VRH1 5T5OA 4ET7A 1EO7A 1RMU3 4YFWA 2ANUA 7REQB 5EPAA 2A7PA 5LHEA 5LNWA 2JGYA 3U7VA 4GZ7A 3V0BA 4HNOA 1WLTA 4Z2LA 1DU3D 5ABJA 4IQLA 2RH9A 4GCXA 3RR1A 1V03A 4DXRA 3ARXA 2XXZA 4V1PA 3VX1A 4HSLA 1EC7A 1CWYA 3VFCA 4HNVA 4UR7A 3E3HA 4K8FA 3QTPA 5B80A 1VB9A 3PHMA 3RMEA 2VFDA 1Z8AA 2R1KA 3WK3A 4RX0A 1LUCA 5C4WB 1BMV1 3EXTA 3WBAA 1UR4A 3P1IA 3KS7A 2Q02A 5KHIA 5CNAA 3LI0A 3U2CA 3ITLA 3LEIA 2B8MA 3T78A 1FFRA 3QYQA 3HGRA 1JQVA 3UZXA 4XKMA 4WY0F 1CAUA 2YC0A 3OCPA 1H09A 1XNAA 4DXVA 3USSA 3FBYA 4U2ZA 3WMBA 5DT7A 1XSKA 4B8EA 4MG2A 5FJRA 3AYVA 4Z07A 4P00B 4L92A 4LQ1A 1EEXA 4LVGA 2RM23 3W26A 1ME8A 1CDGA 2XPJA 3A0KA 4Q4RA 5J3UA 1VMHA 3EX1A 3L5AA 3IGHX 3MP5A 4M0XA 5H8PA 1B35C 1H6YA 2NT1A 1JU4A 1WDRA 5KZEA 3BTZA 2WB5A 3IIXA 2WINB 4FI4A 4AF0B 4XJZA 1DZTA 3T42A 2XZ7A 1ZBE3 1DIOA 3TYUA 3TA9A 4MTVA 3B5LB 3H3UA 2PWEA 4DZGA 5CFCA 1PDZA 4RR3C 2UV8G 4PMRA 2B7NA 4RXGA 3FCPA 1KFCA 3N9NA 2JDHA 4CCEA 1FWWA 1XCXA 4NIRA 2JDPA 2RM21 3ZFGC 1VFHA 4FZIA 1K42A 1G6NA 2DT3A 2QPXA 2XPKA 2HRWA 3BWWA 3GXUA 1H7WA 3UPWA 1Q6CA 4AF9A 3ATGA 2CCRA 4QE4A 3K30A 4XC9A 1XSQA 1ZBE1 4JKMA 1M68A 4MPQA 3AMPA 4GYFA 4NJIA 4PRWA 4JIQA 3ZYFA 5FZGA 2XDFA 2OPWA 1S5NA 2JD4A 4FFHA 2ONEA 2XLAA 2E7QA 2DJXA 4HOZA 3JQXA 2WKLA 3BG5A 2CHHA 5K0UA 3W28A 4JFSA 1AH0A 4RNHA 3KHBA 1K8ZA 5FEPA 5HMSA 1S2AA 4XK2A 3I59A 1BF2A 1W2AX 3HZ3A 4H55A 2EXHA 4G1KA 5PTDA 2PAMA 4L1XA 1CGPA 4OVXA 1CVNA 2LW8A 3HPSA 5CEHA 3PJYA 3ZMOA 4I2OA 3QF0A 1GYLA 3WKZA 4NX0A 4PCPA 5M5DA 3DC8A 2BOGX 1Z69A 2Y6KA 1EGMA 1Q65A 1NQ6A 1LESA 4HNUA 3RU8X 4NZJA 2Z2BA 1W8OA 5F32A 1OKOA 4K20A 3AJYA 2EJ1A 1V8EA 4LBSA 3B06A 5A80A 4QM8A 3W72A 4XG1A 1JUHA 1UOJA 3VKLA 4EWEA 2PB1A 3G8RA 3LCIA 3WMCA 5G1TA 2FDFA 1LQ2A 3IVUA 2V3GA 5FD0A 1HJGA 1BVP1 1PO12 4NI8A 1AX0A 1TR9A 3M0KA 4ADTA 4MJ2A 1W6NB 4X6QB 4CDXB 5EA9A 1ELSA 3LDVA 3GHRA 1NEYA 1U5IA 3PBVA 1REEA 4ZU4A 2GLKA 4LO8A 1AG1O 4ORIA 3W1LA 2A1YA 5BRQA 1J79A 1V6LA 3QR0A 4WZHA 3H2CA 2UYAA 3THPA 2PODA 3W2KA 1DJGA 5BOFA 1WCKA 3NL1A 2YDEA 5K7PA 4UIOA 3NEHA 1LDCA 2XWEA 4JX0A 1AVBA 2G1MA 3T05A 5BU6A 3WUDA 3N9LA 3CYVA 3KV6A 4E4UA 3KCYA 4YNGA 1POV3 3P5YA 3ZM8A 1UOBA 2I74A 3K4AA 3QQWA 4MLOA 2RS32 2C0AA 1CONA 4ES8A 4Y26A 2ZHLA 3MMUA 2WA3A 2BFUS 4JDMA 3X29B 1KR1A 4DF1A 3GYCA 2Q30A 5BU9A 3P7YA 1S3HA 1TJPA 1JEZA 4I30A 1V6VA 3BALA 3UYCA 2FPTA 3AIQA 1AR92 3VKNA 3LBMA 4RXFA 1ZENA 1P4CA 1Q56A 1D3CA 3WDXA 3IDBB 3WOGA 3R4SA 4LBKA 4N7UA 1X7IA 2CV6A 1JI2A 2A79A 4REQA 3O5SA 5D8WA 2ZDRA 3GY1A 4M19A 4ZU7A 1DWHM 4CNNA 3GHUA 1GV9A 1M7XA 5FL1A 1FOD3 2C9KA 2Z79A 1UKSA 4F8AA 1XWYA 1UIJA 5AC5A 5AYYA 4C65A 4FPYA 1JD9A 3GFYA 3P82A 1OQ1A 3A4WA 3OZMA 1YBQA 4IPIA 4W87A 3UJFA 1NIUA 3IJ7A 3QZ6A 3IB3A 2EEXA 1ULFA 3L4UA 1MQTB 4R85A 4JIIX 3V56A 2MPFA 3ACHA 5F6KA 1OHLA 2WNOA 2CU5A 2CITA 1XQKA 3OJBA 5LGZA 4PB4A 2EAKA 3TOJA 1OY0A 3H54A 1F76A 1GZCA 1NU5A 1TJ2A 3FFSA 2CDOA 2XMLA 4QPGC 1RZMA 2QGHA 1M1BA 2R1NA 3CZ8A 2PLV2 4OI0A 1WZMA 2ZGKA 1TO3A 3CO8A 1W8ZA 2H9AA 3GX9A 1JZ8A 2PDGA 3E9AA 1W3VA 1R1ZA 2R0HA 3K3NA 1W6OB 2R063 1LBMA 4XTMA 4NASA 3SGZA 2W66A 3UJQA 3MEPA 3WUFA 4JS3A 2R1MA 4TU1A 1SFYA 5JZGA 3TLLA 2VJXA 5L7OA 4UTTC 4PIXA 3U14A 1KBJA 2ODOA 1WBFA 3IS4A 1HKWA 2DSWA 1T0OA 2WHKA 1CIYA 1TFVA 3C8NA 2QQPA 2Y26A 1BG4A 1AR63 4MOAA 3WLHA 3CJIB 3JUUA 2TPSA 3WENA 2QV4A 3E5BA 2WZR3 2R061 4QSFA 4X9SA 2BNOA 1E71M 4DJFA 2LALA 4DO5A 4F48A 4GB33 2QULA 5DF0A 1XRTA 5C5YA 2PTWA 3E6EA 1XIEA 2IPGA 3EXSA 1HQLA 1L9WA 5E1QA 1GVSA 3FN9A 2Q09A 3N3TA 3THDA 2QJVA 1AR61 3C0LA 1TCDA 5E16A 1BEUA 3VD3A 1KGYA 1NA1C 2FDIA 4RKAA 4MJZA 2WNUC 4P9WA 3EB3A 3CJPA 2WZR1 5FUNA 4BQ3A 2QJIA 2WBGA 3J7NA 3MI8A 4GB31 5JBEA 5FF0A 4HZ6A 3SRHA 4N43B 4AE2A 2ZZ3A 4MVAA 3KZ4C 2CZVA 3T40A 4BK9A 2OPKA 5JOXA 3UVAA 3B93A 1PKMA 4LVAA 1GZWA 3W22A 3GAYA 3UEQA 4CEUC 5I03A 1K4HA 4Y9PA 5IHRA 3BTXA 3GRIA 4H8UA 2ET7A 1ODZA 3HAGA 4HVQA 1J96A 5GKAC 2WMFA 3BANA 3PU3A 3TLQA 2VNRA 1GT8A 4CEXC 2FIQA 4M81A 1XIMA 2DZAA 4XABA 5ERLA 3DN7A 1W3IA 2O9PA 4MY8A 1MUCA 4Q4W3 4BWOA 1MWOA 3NO5A 4LPCA 1Z3NA 3E6BA 4LO7A 1L6WA 4BJ0A 1W0NA 2FPVA 3C8FA 1BXBA 4ZS2A 1A8DA 3S7IA 5TF0A 4GXLA 1K8CA 3VBHC 2J75A 4HSNA 3HJZA 2NVDA 1ISZA 4KFPA 1EP0A 4LW7A 4J1XA 4M3CB 3C6CA 4UQCA 3W20A 3RRAA 5ACA1 1UWRA 5GQBA 1PJ9A 3DN5A 3MYXA 3EWUA 3OVGA 3BAWA 4IHCA 4Q4W1 4OQVA 3B69A 3S30A 1QJZA 3ATZA 4IE4A 1QO5A 1DWGM 1HGWA 4GQGA 4F66A 1TQXA 2PU0A 3L66A 1IZCA 3A4UA 3CL8A 2J6VA 4P7LA 5DBUA 2ARCA 2R072 1BQCA 2BB0A 2WC3A 4OUIA 2XLGA 1LLOA 1KRAC 3AJ7A 1AYN1 4TWTA 2EXOA 4P8XA 3AX4A 1XGDA 1XJAA 3VB9A 2A6YA 4WD0A 2V72A 4YXGA 3Q45A 3IMNA 5FMBA 3QEZA 3QBQA 1RVGA 4NIGA 2W79A 1UA3A 1QVBA 3H70A 3KAOA 5FPLA 4PEKA 1XGZA 4L8QA 3LCFA 4JC1A 2QKDA 1J0JA 1O7AA 3IV3A 3TZNA 4OT7A 2QDEA 4JTRA 2PRMA 3D82A 1AZ1A 5E1RA 3HGJA 3S2LA 1T40A 2VFEA 2WC2A 4K3UA 2NXGA 4X63A 3UXKA 1UKTA 4JTQA 3PPHA 3UXIA 2DVGA 1LGCA 3CZLA 1F4AA 2HJIA 3CU7A 4W86A 1LHVA 4H9VA 4BIFA 2GC2A 4CEWB 3IIPA 2ZFAA 1HNYA 4RA0A 1F7BA 4NZ1A 2WYFA 1DOSA 1S0JA 2P37A 3ABSA 3D6NA 2A1XA 3QFWA 3LA7A 3R8GA 3SH4A 2VUDA 5FZAA 3AXKA 5CG9A 3SFWA 1IWPA 3A4XA 4EACA 3J7HA 2WSQA 4MWAA 5CKMA 2VHLA 2XHNA 3MDPA 3SSZA 1ZALA 3S1VA 1RPKA 1GZ9A 4J3SA 1YHFA 2DBIA 3LD8A 2F17A 4NIDA 4ZSTA 1HDKA 1AJKA 1YNAA 3BLDA 3R8RA 3BUVA 2VRQA 1W5MA 1ISVA 4WZCA 3CM4A 3DZ1A 3LB0A 4I3GA 1EJTC 3O8AA 3W71A 7XIMA 4QGCA 1ENSA 4KIEA 4XCBA 2NWRA 1QJX2 3LOTA 1LHOA 1IXNA 2RR13 3VMPA 1SLBA 1VBA3 4FPCA 1H11A 1X36A 1OM0A 4XBKA 1HRI1 1DLLA 4LHLA 3ZVXA 5L73A 1LWHA 3GVRA 4NPLA 3MQTA 4X61A 2D43A 4LO4B 4CP0A 4AHPA 3B8SA 3JU9A 3B8DA 1W6QA 3UPBA 1UZ0A 3E02A 3WQOA 2WW5A 4E6MA 4Y20A 4A7KA 1ZREA 1PK6C 5FFOC 3H26A 3O1NA 3PHAA 2K2SA 2P17A 1RAKA 4MGQA 4HLTA 4GO9A 4M7TA 1UHVA 4H2HA 4Q4QA 4WVZA 3OLGA 3AU2A 4DF0A 4QS5A 2W08A 4DEQA 2WYSA 2VC5A 4ATLA 4M3CF 2RR11 1RUOA 1VBA1 1C8M2 3N4AA 2ZA3A 3T3YA 1QWKA 4I0WB 3THUA 3O1UA 1I2RA 2ZRYA 2ZQ0A 3BPWA 3UJEA 1T99A 4MKSA 2ZC8A 5H9RA 1VBB2 2ATFA 4W8JA 4A3ZA 1CJDA 3SCFA 1KC7A 3G22A 3O1PA 4QPIB 1MACA 1V7AA 2ZVRA 4AK3A 3PM6A 1CXHA 4MUZA 3PLQA 3W1NA 4AUBA 3W27A 2V38A 1BEV2 2QCEA 1W39A 1NP2A 5SV5A 1FPN3 2ZJCA 2OKTA 4YS1A 3GD6A 2QS8A 1DWJM 1A4LA 2Y0FA 1VB2A 1OF3A 1UUOA 4OHXA 2AL1A 1UYZA 3S0CA 2LUWA 2ZZQA 3VHPA 3E0LA 3T2QA 5K9XA 1SBFA 4LBJA 4YJ5A 3DI0A 4E4HA 3D5OA 2GUYA 4U31A 4G4FA 2Z2UA 3QH2A 4ZQNA 3QRHA 5C9WA 3IJ9A 1N8IA 2WMKA 3QHMA 1GWJA 4P7RA 4XZUG 1CESA 2JG8B 1VIWB 5I02A 4LGXA 4D6RA 4OCTA 3H0OA 2OX0A 2BTMA 4AGGA 1FPN1 3EWBX 4L9BA 3M9YA 1FATA 1OYAA 2Z1SA 1VBUA 1XL9A 2BGQA 3N2TA 2WSKA 1PYFA 1W9XA 1O8SA 1GQNA 3ACGA 1IWAA 1K3UA 3U57A 2IPWA 2FMOA 4XJ8A 2WS93 1VBC3 4TZDA 3PVFA 1GJUA 1JRBA 1YPFA 2V3DA 2XIBA 3MVIA 3H4GA 4R88A 4XDOA 1XI3A 4Q8WA 1DL3A 4H19A 5I5RA 1QMLA 1CJPA 2UWCA 3EA2A 4M6PA 2FDSA 2HWC2 3BV7A 3VV1A 4IERA 3CNAA 3ZYBA 1UR8A 1JCLA 4HG6B 4R53A 3SCNA 4CXYA 4N9IA 1F8VA 3ABQA 3IUIA 4FIQA 4FT8A 2CERA 4HMNA 1B3YA 4HN4A 4AB4A 4XFIA 5FYYA 3BI3A 3MHFA 3JBG2 2J47A 3ABZA 1AUYA 1HJFA 2YGMA 3WG6A 2WS91 1NM9A 1VBC1 1TCMA 3MKCA