4BQ3A

Structural analysis of an exo-beta-agarase
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
747
structure length
740
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLENDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 253
structure length 740
sequence length 747
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq3A02
1LQ0A 3BCDA 4GKLA 3W0KA 3WD2A 1UQYA 2BHYA 1B0IA 3OZPA 4PMDA 3OB8A 4KGJA 2J79A 3VMPA 1VJZA 1VRXA 5C8BB 3N15A 3L4XA 3SUTA 3VTRA 4H2CA 4LXFA 3SCOA 2EO7A 1EO5A 4LJHA 2WHKA 4U2ZA 5DT7A 1W3KA 3AJ7A 2ESCA 1ISVA 1JZ8A 3K46A 3EDEA 1MW1A 1BVNP 4LPCA 4ZEPA 4GI9A 4J3TA 3RJXA 1WO2A 1C3FA 4DWSC 3ZJKA 5M03A 4IPNB 2OSYA 4MPKA 4AWEA 1GWKA 3VDCA 4QAWA 4AD0A 3WD3A 1JAEA 1OINA 2DSKA 1RD6A 4EAMA 1U33A 4BQ4A 1ZS2A 2VCAA 4D6JA 4UFIA 2CITA 2G4FA 3GH4A 5ABEA 3VGEA 3F5LA 1R7OA 4MNJA 1UD8A 1V3HA 2JFEX 4DWSA 1CWYA 3W37A 1OD8A 4W86A 3AFBA 1R87A 3TTQA 3AMLA 2WAGA 1W2VA 3W27A 4AXNA 1BQCA 4BQ3A 1MW3A 3AS2A 3N18A 4AEEA 4B9YA 3FHQA 4JKMA 1GORA 4D6HA 1K9FA 1J0JA 3CUFA 1CXLA 3IAPA 4CD4A 3AHZA 3CGTA 4UOJA 2C0HA 1DEDA 4AD1A 1C8XA 4AD5A 5A8OA 2XGIA 1JZ5A 3AS3A 4OBRA 1HJXA 5DMYA 4JAWA 3ARXA 4CPBD 1E5NA 1BGGA 1FP9A 1W9PA 3RM9A 4FLOA 1E6SM 3B9AA 4MB1A 4TOQA 3CLWA 2DGAA 4GI8A 4W89A 4M81A 1QHPA 1GWMA 4HZ8A 1V08A 5GQBA 1B3ZA 3W6LA 4LQ1A 3L4YA 1PBGA 3BMWA 4WKFA 3WH9A 3CPUA 1RP8A 1PX8A 3ARRA 5BRQA 1B2YA 4MADA 3BCFA 3WH7A 3VOCA 1W90A 1GOMA 3MV11 1UH3A 1E6QM 5CLWA 4TVDA 4EK7A 1MWOA 3VD9A 1MXDA 4J3SA 4W5ZA 1E0XA 1HL9A 3VDAA 4QFUA 4V2XA 4R5EA 3AHYA 1ZU8A 1UHVA 5A8PA 4H7VA 3CUHA 4M29A 2VNCA 3AIWA 1GQIA 4CN1A 3FNDA 4YW7A 1V3LA 4N42A 2WMGA 3T2QA 5KZ6A 2GDUA 2C7FA 3RPMA 1JF5A 3G6MA 1HP4A 4UR9A 2J8FA 3S2CA 1R86A 2G3JA 3GYCA 4ZE5A 2VVNA 2XHYA 4JL1A 4AZHA 1CENA 1K9EA 1B30A 1MW0A 4AZBA 5FL1A 5AYIA 2DEPA 1KGWA 3WMSA 3AQUA 2EPOA 3KL3A 4X0VA 3AMDA 3O6AA 3WQWA 3O9NA 4W5UA 4CP9B 1W3JA 1ZJAA 1CTNA 1D2KA 2W5FA 2YA2A 2Q1FA 1UD6A 1VJSA 1DP0A 4U33A 4DUXA 1LL4A 3ZO9A 3D3AA 1BTCA 4P8XA 2V3FA 4QDMA 4BZYA 3K4AA 4AEFA 3ALFA 2ZOXA 3HU7A 3CZEA 1NOFA 5EB8A 1B3WA 1QPKA 2RGLA 3QHMA 3IJ8A 5E6ZA 1JD7A 3WDQA 2JWPA 1ZB5A 1HVQA 1E73M 1MFVA 5FD0A 3AMKA 4W8AA 3WNOA 4AD4A 2VRJA 3MUY1 2UWFA 3T0BA 4AL9A 1V3MA 1BG9A 3NJ3A 1HJUA 1V02E 1VBUA 1E1FA 3AHTA 1FH8A 3AIEA 4F9DA 1M04A 3CZGA 2VQTA 2WWDA 2ZUWA 1WZLA 3PHAA 4DWSB 1EQPA 3DC0A 3IANA 3VGFA 1KB3A 5A8QA 1XRVA 2GJPA 1V02A 3J7HA 2CNCA 2C24A 1Q6FA 2ZUSA 5F7UA 4H41A 5CPTA 4AIEA 1TVNA 1BG4A 1PAMA 1H09A 3UG4A 1OH3A 4AZ7A 3WSUA 2ZE0A 3GNOA 2EPLX 2BVTA 3WL1A 1W8TA 2QPUA 4N0RA 1O6IA 4D1IA 4UZSA 3SEPA 3CUJA 2VRKA 2GJXA 4FMVA 1XCWA 4QLKA 2J62A 4PMOA 1WZAA 1KWKA 3MSDA 1CXKA 3ZT5A 1KBBA 1V3KA 3CHDA 3LPFA 4J27A 3ORJA 1BYAA 4MB5A 4JFUA 5A6BA 3SCWA 5A95A 2VT0A 5A1AA 3M46A 3W82A 1V0AA 2J7EA 3ECQA 4WKAA 2DSVA 5HPCA 2ZUTA 5EMYA 2XVNA 2Y24A 1PX3A 4C7DA 4PTXA 4KH2A 3BAJA 2JIEA 3WNMA 1JZ3A 4GZJA 5A94A 2ZWZA 2JF7A 4D71A 1QI2A 2WZHA 3OGSA 1GOIA 1G1YA 3PZ9A 3AZTA 1FHDA 1UR9A 1HP5A 3MU7A 3WF2A 5ABFB 1BAGA 1H41A 3AXIA 5IDIA 4PSRA 1W3HA 3BC9A 2XGBA 4L4PA 3AOFA 2DQXA 2BY3A 4X9YA 1UWSA 1VEOA 4D1JA 1MQRA 5CSYA 3WDIA 4S3KA 2QLYA 4WJXA 5DF0A 3VIKA 2LROA 5IFTA 4FLSA 2D3NA 1BF2A 1KFWA 5BROA 3PZNA 3BSGA 1QHZA 1WZMA 1KGXA 3PTQA 2OYKA 1A47A 1B3XA 1E0WA 1PEZA 1QBAA 1W9UA 2G3NA 2YDSA 3VX1A 4J3VA 3ZJ6A 4JFSA 1JFXA 1R8LA 3N9KA 4AZCB 3W24A 1NP0A 4HZ7A 1XH2A 2D24A 3PBGA 5AYBA 3VIPA 1UOJA 2MANA 2XFFA 5M3WA 2CIPA 3ZSSA 1Q4NX 4V27A 3SIMA 4ACZA 3RILA 1BSIA 1C7SA 1DWAM 4M56A 2F61A 3U5UA 5LA1A 5GNYA 1OB0A 1V0KA 5ABHA 3E1F1 2ZX9A 1CXEA 2CEQA 1E6ZA 4C7FA 2WKGA 4XUYA 2A3HA 5EFFA 2UY4A 4TUFA 1Z32X 2W67A 1D7FA 2EEXA 5DFAA 3WQ4A 1UWIA 4UQAA 1RH9A 1W2PA 1HJQA 1WNOA 1JFHA 5AC5A 5CSUA 4FK9A 3TP4A 2OYMA 3UCQA 3VGBA 5AY7A 2OSWA 1EOKA 3CBWA 3N04A 2OWXA 2D2OA 5M17A 5TD4A 5BXSA 1JZ4A 1J10A 5CG0A 4DUVA 2G41A 5BXRA 2ZX8A 3FN9A 1C90A 3CO4A 5ECUA 5IHSA 3OLDA 2YJQA 1E1EA 4PBGA 3N12A 4P7OA 3KL5A 2BVDA 4UZUA 4QCEA 4DWSD 1DWHM 2WNWA 3WD4A 4PMNA 1I1XA 4HP5A 1HVXA 3EDDA 1XHGA 2VR5A 3DHPA 4GPNA 3MSGA 2BHZA 1YQ2A 4AISA 5I78A 1LLOA 3VGHA 3WUBA 1OIMA 1HJSA 1UWTA 2WYSA 2WC7A 4UCFA 2ZUMA 4GZEA 2GFTA 2XUCA 4QLLA 3UR7A 1EA9C 3ZR5A 4B3KA 3MUZ1 1XC6A 2WANA 4H8VA 5D21A 3SCNA 1Q6EA 2OLHA 2DPEA 1G9HA 4WSKA 1E0VA 3WIJA 3FY1A 5JBEA 2ZX7A 1WZXA 2PWFA 1UKQA 2VURA 2DDXA 5HDRA 3ZYFA 3ZR6A 2D0FA 3AMGA 1W1TA 3VU2A 2BNJA 1UKTA 3K4DA 1Y7VA 1QW8A 1NARA 4CN4A 3FAWA 3SCQA 3GBEA 2V5DA 2X2YA 4XZBA 3OA5A 2J8GA 3RMEA 4V28A 1VFFA 1C92A 4PMQA 3RM8A 1E9LA 2YBTA 1V6VA 1Q6CA 1LJYA 3EMZA 2XFYA 1EO7A 3BAWA 1QI5A 1V3IA 1JF6A 2WVVA 5CLTA 3LPGA 2XM2A 4E2OA 3VD7A 3MV01 1C8YA 1K6AA 2VRQA 4JFWA 7CGTA 1V6WA 5DO8A 1W9BM 4P8VA 1UZ4A 1HJWA 2ZICA 4JKLA 3B8SA 4AD3A 4Z2HA 4DM1A 2WC4A 9CGTA 1MW2A 3WBAA 4BF7A 3AXHA 3BMVA 5A6AA 1J0YA 2F8QA 5M5DA 5D9OA 1D3CA 1EGZA 2DIEA 4HA1A 5I79A 1G01A 2WVUA 4BCEA 4HZ6A 4HPHA 3CH9A 4D72A 3ARZA 3POCA 4FLQA 2E8ZA 1ODZA 1V3JA 5CXPA 2YA1A 4U2YA 2G3IA 1ISXA 3VMOA 3U57A 3WUEA 2WLZA 4PMRA 3I3DA 3OIHA 3L4UA 4WLCA 1DWFM 3L4ZA 2NSXA 2J7CA 1PIGA 3OLGA 2J7FA 2O9PA 4JHZA 2LRPA 1U30A 4OJYA 5HPOA 3TTYA 2AOSA 2Y8KA 1XYZA 5A6MA 1ZBWA 3SCUA 1MQQA 3KL0A 2X0YA 2PB1A 4GQQA 3W6MA 5HNNA 5BXTA 4WK9A 1BVZA 2CESA 1F4AA 3IAQA 4NF7A 3AZRA 1V0LA 1W91A 1J9YA 2J4GA 1V0MA 2Z1SA 4PCSA 1CEOA 1NH6A 1JAKA 1GOWA 4D6GA 3AYSA 3BAKA 1C7TA 1UR2A 3AIBA 4A4AA 3W81A 1QI0A 1OGGA 3GXIA 5GPRA 1US2A 4D6CA 1JG9A 1ODUA 4UNIA 2VC9A 1JDAA 4XB3A 3DYOA 2D0GA 1UG6A 2PBGA 2WMFA 2YBUA 4CVWA 4UQBA 1NWUA 1W1PA 2FHFA 2VMFA 1W8WA 4OOZA 4F79A 2BV9A 1LWJA 3DHUA 3PTKA 4MNKA 3WQ6A 3BAXA 2V3GA 2BXYA 1CZ1A 1ZBCA 1W1YA 1W9DM 1XH1A 3UERA 3VDHA 5A6LA 1ZL1A 1SMDA 1GJUA 4CN6A 3OZOA 3VIHA 2GK1B 4HOWA 2X09A 1JYVA 2EPNA 4W93A 3AMCA 4GXPA 1V6XA 4HOZA 3CUIA 3FAXA 5CQ1A 4U5IA 1J0IA 2WMIA 5HBFA 1A3HA 4X0NA 5I23A 3OLEA 3VINA 1GQJA 4Z2JA 1GVIA 1W8UA 2DH2A 2FGLA 2F2HA 4PCTA 3AS0A 1EDTA 1DWJM 4JCLA 2V5CA 3IK2A 5CJ5A 4U31A 3KEHA 1H1NA 4LKFA 1MFUA 1OSEA 1LL6A 3LPOA 1GVYA 1UD4A 1M01A 3M07A 3OGVA 3G6LA 1W32A 3NUKA 2YKKA 3CMJA 2PBOA 3LPPA 3A47A 2VZTA 1B3VA 1TA3A 4PEEA 4QCFA 4GI6A 3UG5A 2EPMX 2XG9A 4IUGA 3SCVA 4LYPA 3IJ7A 5EBAA 4WSJA 3WKZA 1WPCA 3CMGA 1GQLA 3WFZA 1JD9A 2XSBA 4OKDA 4HU8A 1JDDA 5BCAA 4PYSA 1NP2A 1B1YA 4AYSA 2WVTA 1UD2A 3GBDA 2WHLA 1WDQA 4QP0A 5BWFA 2PI6A 4RL3A 5CGMA 4M82A 2WPGA 2XWEA 5CPSA 4ATLA 1OKOA 1UYQA 1UZ1A 2CXGA 2VX4A 4B15A 2WZIA 3UESA 3NYDA 3BAYA 4YHEA 2Y4SA 4JFTA 3WMBA 3WQ8A 1OT2A 2Y5EA 2PF0A 5BRPA 1HNYA 1K9DA 2WB5A 3I3BA 3WNKA 3UT0A 3VUPA 4HMCA 1LWHA 4CCEA 2V3DA 3M6DA 1E3XA 1CGYA 3EDFA 1UOKA 1E70M 1M53A 3VIOA 4URIA 4MB3A 4GZIA 5D9NA 4JCMA 1L0PA 2WW5A 4FLRA 3NCOA 4RE4A 1XD1A 2E8YA 3JUGA 1IZKA 2GDVA 2YDRA 1ZJBA 1R85A 4UQDA 1S46A 3NDZA 4F8XA 5ABGA 3BXWA 1C8QA 1HKMA 2JEPA 2VVSA 2WHJA 1E6NA 4NZCA 5BXPA 3IJ9A 4HPGA 2WSPA 4D6DA 2EPKX 3EBVA 5D9MA 2FGZA 2J47A 5A8NA 1UA3A 3WQ5A 3PZIA 3MANA 3T0AA 1CLXA 3A6OA 2IXVA 2CYGA 1BLIA 3W26A 3SUWA 1GONA 2CHOA 5HOSA 4MDOA 3U7BA 4PUDA 4NRSA 2XM1A 4HMEA 3RIKA 1CDGA 2WMHA 1WP6A 4TVUA 3ARTA 2WKLA 3OG2A 1EQCA 2VCBA 3APGA 5A8MA 3AROA 1RPKA 3QOMA 2GJXB 1UR1A 2UY2A 3FXYA 1UA7A 4ZFMA 2ZXAA 1EXPA 3NSMA 3POHA 3GXDA 2VX7A 1H4PA 5BYWA 1JXKA 1VF8A 1PPIA 1ECEA 1X6NA 2ZXBA 1C93A 4D6IA 4RE3A 2O9RA 1W9VA 4TX8A 1XGZA 2W61A 4DUWA 1HXJA 1Q6GA 4WKHA 3MMDA 2D0HA 3GNRA 2CKSA 3BAIA 2E9LA 2ZUVA 1NWRA 3EDJA 1HX0A 4UFKA 2G3MA 4PMZA 4Z2LA 1SYTA 1EDQA 1QNSA 4JFVA 2W63A 5LA2A 1UUQA 2DSWA 2VUYA 5FIPA 2Y2WA 4AZGA 4OZOA 3BLKA 4D6FA 1IT0A 1EHAA 4UFMA 1E4MM 3VD5A 3AISA 2YL9A 1J0KA 2ZX6A 1NWSA 4U3CA 1AQ0A 4AZ5A 1UKPA 3ZJ7A 2WBKA 3VO0A 3VGGA 3GH7A 3MMUA 5FKYA 3BSHA 1ITXA 1CGXA 1CGUA 1BYDA 3CHCA 2CCRA 3EDKA 1EHNA 4AZ6A 4CCDA 3L4TA 3N1AA 5GNZA 5HXMA 2CETA 3W25A 1PX4A 2J75A 4MNMA 4BS0A 2DT2A 4BA0A 4TTGA 2WSKA 3BGAA 2YDQA 1J0ZA 4AIOA 2E40A 3PZVA 2IXUA 3ARUA 4A3YA 3AIQA 3CZKA 3OGRA 4GIAA 4UOZA 1MVYA 2A3EA 2IUZA 5AC4A 4ACYA 1JYNA 3O2LA 4PUEA 3WDRA 2DT1A 1SR0A 3N11A 2VOTA 5I5RA 3SCPA 1TVPA 2DT0A 4YWAA 7TAAA 1GHRA 1OD0A 1UWRA 1E56A 2BY1A 3WFLA 3CIVA 1HIZA 3GDBA 4OIFA 4AY1A 3HN3A 1CPUA 3ZYHA 1DTUA 2CPUA 2YLLA 3ARQA 1E5JA 2VTFA 1B9ZA 1EH9A 3WNNA 2VXJA 2WCSA 1KXQA 1MYRA 2J7HA 4Q7NA 1GW1A 2YLAA 4Y7EA 2EBNA 3L2MA 1TMQA 1VEPA 1X1NA 4MB4A 4M8UA 1TZ7A 2VX5A 1J18A 1PZ2A 1V03A 4J3XA 3RJYA 1KR1A 1HKJA 3SCRA 2WMJA 1HJVA 3WQVA 2KR2A 3NIYA 1AQHA 2VX6A 4P8UA 4PMUA 1L8NA 5I0DA 1QW9A 3SUUA 4Z2GA 4E8DA 3UG3A 2W91A 3GNPA 2UY5A 3DYPA 4HTYA 4W8BA 5A2BA 3THCA 1QBBA 2W92A 2EJ1A 1ESWA 1OWQA 1RP9A 4ATDA 3CZLA 2FHCA 3PZMA 3K8MA 1L7LA 3ZT7A 1V6UA 3WH8A 4AZCA 2ZXDA 1CECA 1LF1A 3NDYA 5CZKA 4W88A 1BYBA 3WNLA 1FHLA 5I2UA 1XH0A 5E70A 3F95A 2DIJA 3B9DA 5A6BD 3PZUA 1MQPA 1WE5A 3S6TA 4M1RA 1JNDA 3CHEA 4HA3A 2NW0A 5C71A 4KRUA 1VIWA 1UQZA 3II1A 1E40A 1CGWA 2JALA 4W7VA 4YN5A 1H49A 2WCAA 4CU7A 3WH5A 3SCTA 8CGTA 2VQUA 2BXZA 1XD0A 1DWGM 2J7GA 3ARVA 3TOPA 1R7AA 3KZSA 2RGMA 3QGVA 1OGSA 2QHAA 1US3A 5A2CA 1NOUA 1EIBA 1FH7A 2ZUNA 2WMKA 4P7QA 5EFDA 4H8HA 2VZSA 5A3HA 2WZEA 2CBVA 4JHOA 3ZOAA 4AMCA 3LMYA 1QOXA 1FFRA 4ZXOA 1TFVA 5D9PA 3MMWA 4EE9A 2D23A 2NT0A 4PMVA 1BFNA 3AHVA 1UH4A 1G5AA 2O9OA 3VNZA 2WVSA 1UWUA 1W1VA 2E0PA 1KXTA 4OBSA 4ZENA 1UWQA 3W38A 4ML4A 3T09A 4TTUA 4KMQA 4W84A 1CXIA 3OBAA 4CGTA 1VEMA 4NSBA 1OBAA 5IXEA 2WC3A 5A6KA 3QR3A 4PMXA 3SUVA 3A4WA 4P7NA 4P7RA 2YA0A 1VBRA 5CPQA 2EXOA 2UY3A 4CD8A 1KQYA 1WKYA 3A4AA 1E43A 1MXGA 1AMYA 4W87A 3GM8A 2ZX5A 4OUEA 3ZJ8A 3TTSA 3VDBA 2PWHA 4B16A 1PIFA 1UKSA 4HOXA 1VFMA 4AC1X 1NQ6A 2JE8A 1E72M 4LK6A 1WCGA 4W7UA 3VIMA 3WNPA 3WENA 4PTVA 2AAAA 1JZ2A 1E4NA 3WUFA 3BLPX 3W53A 1JXJA 4PN2A 1YHTA 3FHAA 4UFLA 3K8LA 5D8ZA 1E55A 3MUIA 2WXDM 3WF4A 3QOKA 2D20A 3HJEA 6CGTA 2FH6A 3AS1A 2XVGA 2HISA 1GOKA 1UD5A 2TAAA 1U2YA 2O92A 3VIFA 2VR4A 5JBDA 1KBKA 2D22A 1E4IA 3AIUA 2J77A 2WM0A 3WEZA 2J7BA 1KXVA 4A3HA 3QHOA 3THDA 3WBEA 3WDHA 5DEZA 4MJ2A 2XTKA 4F9JA 1JL8A 2B31A 2D1ZA 3CZ8A 4JL2A 1VAHA 2EQDA 1UKOA 1JZ6A 3HMCA 1LG1A 4CD5A 4EANA 1GHSA 3L2LA 4GQRA 1AQMA 4KGLA 4E8CA 1E3ZA 1J12A 2G8ZA 2FDMA 4Q22A 4LX4A 2CKRA 2ZXQA 4CCCA 1DWIM 2YL8A 1ZBKA 3VILA 3F5KA 3K1DA 6TAAA 2K46A 5A2AA 5ABFA 3WN6A 3VM7A 1TE1A 3A3HA 2FH8A 3BH4A 1I1WA 1CXFA 4J7RA 2WWCA 4K68A 1QI3A 5I77A 2GSJA 4TX6A 5I24A 3VVGA 4D6EA 1KQZA 2JEQA 2VI0A 3W29A 3GTNA 4W8LA 3U7VA 3VX0A 1H11A 1P6WA 4CPBA 3ARYA 1E6RA 1W3LA 3SCSA 2XIBA 4IM4A 3QHNA 2DT3A 5FCZA 5IHRA 3ARSA 2OSXA 3PZOA 1VENA 3WEMA 3KWXA 3EYPA 1GPFA 3AI0A 3TONA 1BHGA 5LA0A 5CGTA 1TG7A 1E6XM 3SUSA 4JKKA 4UQEA 3ZMRA 5A6SA 3PZQA 2DSUA 1B90A 3WF3A 1SMAA 2E4TA 3NSNA 4YPJA 3UR8A 1JYWA 2PC8A 3GZAA 3PZGA 3WELA 4XV0A 3U5YA 3MO4A 2VZUA 2E9MA 2BVYA 2A3BA 3ZM8A 1GZJA 1B3YA 1ITCA 2C8NA 4AW7A 4AD2A 3AIVA 2Y8VA 2XVKA 2YL5A 4WIWA 1XSKA 3TTOA 2J7DA 4JIEA 2OYLA 3VD3A 2O9TA 1XYFA 2Z1KA 3ZT6A 3CHFA 4P8WA 2A3AA 2DSZA 7A3HA 1ZBVA 2GK1A 3VGDA 2WK2A 3CTTA 3WH6A 1WDSA 2XFRA 3VD4A 1WZKA 2W66A 4LKDA 1G94A 4M24A 1IZJA 4BQ5A 1H3GA 1OGBA 4LYQA 2QPSA 4MDPA 3VMNA 2J25A 2AMGA 3WF0A 3T0DA 3KE0A 1WDRA 1GQKA 2QMKA 4NI3A 4ZXLA 1JIBA 3WD0A 2ZUUA 2D3LA 4UQ9A 1Q6DA 1QVBA 4WF7A 3DYMA 4AZIA 1WDPA 3VKKA 3EMCA 4W85A 4CD6A 1JI2A 2PWEA 1GUVA 3ZYBA 4W7WA 1GOQA 1KXHA 2BS9A 1W9FA 4A6SA 1VFUA 1CNVA 2ZIDA 3VPLA 3WEOA 2CBUA 1DHKA 4TXEA 4U3AA 1NM9A 4HA4A 3W4RA 4B3LA 4LYRA 1GWLA 4NRRA 1GNXA 1J11A 5E0CA 3ARPA 1XSIA 2V3EA 4LGXA 5KEZA 2XYLA 4PRWA 2XWDA 1E6PA 1UH2A 2X05A 4C7GA 4IPLA 2GUYA 4CU8A 1HF6A 1CGTA 4BQ2A 5DT5A 3ZIZA 5JBFA 1V6YA 4CU6A 5D8WA 4XX6A 1XCXA 3OLIA 1CGVA 5GNXA 2BY0A 1JDCA 1CYGA 2W4XA 3MKKA 1KGUA 4B9ZA 1QNRA 1E4LA 1M7XA 1AVAA 4PTWA 1BYCA 1C91A 4MJ4A 5I3DA 2X1IA 1WB0A 4UTFA 1SFSA 1ISZA 3RO8A 3CZJA 2DH3A 1EDGA 3RDKA 1OIFA 3TA9A 4GO9A 1LL7A 1HT6A 3WY1A 1HL8A 3VM5A 1G0CA 2WBGA 3N13A 3WL0A 4CVUA 3AIRA 3N17A 1HKIA 1OM0A 3L4WA 4J3UA 2E3ZA 3D5HA 4YW6A 4ATWA 1NOWA 4Z2KA 1H2JA 1X6LA 1WMXA 1W8ZA 4MAZA 3T08A 3WUGA 2WHMA 3WF1A 4QLJA 3UEQA 2CBJA 2XVPA 3GH5A 5IFPA 4J3WA 3GXFA 3ALGA 1JI1A 1TUXA 4F66A 1CLVA 4HU0A 2OWWA 1FA2A 4U5KA 4S3JA 4RE2A 4XZWA 1V0NA 3MS8A 2BHUA 4LKEA 2FHBA 5E09A 1TCMA 2OWCA 4P7LA 3I3EA 2QV4A 1VB9A 3A4XA 2CBIA 2WMIB 1F4HA 2PWGA 5A69A 4UOQA 5C70A 1B31A 2VZVA 3VIIA 2BY2A 2WCGA 1PJ9A 4E4PA 1NWTA 3B9EA 2WYFA 3RCNA 5FL0A 1FP8A 4MNLA 4PTMA 1QNPA 2V38A 2XVLA 1UR4A 1H0GA 1H5VA 2XIIA 1HN1A 3VNYA 2W62A 1KCKA 6A3HA 1J01A 3ZQ9A 2JIWA 5E9AA 1N82A 1ISWA 1JYXA 3RM4A 2YIHA 1UR0A 1QNQA 4KRTA 4JZ5A 4UFJA 1TA3B 5JIPA 2WVVB 1JZ7A 3MUAA 1WCUA 2GVYA 1XV8A 2J74A 1TR1A 4LK7A 1FOBA 1CXHA 4IISA 3AZSA 1JGIA 3F4VA 3L4VA 3CUGA 3NSXA 4OOUA 3AICA 1GCYA 5A6JA 2QF8A 4EKJA 2J78A 1LG2A 1O7AA 3GXMA 2ZWYA 2CERA 4PSPA 1W9XA 1OCQA 3K8KA 4J28A 1KR0A 5E0FA 1HKKA 1XSJA 2XJ7A 2HVMA 4GO8A 2GJRA 5JUVA 4CUCA 3ZSTA 4Z2IA 1OT1A 1I75A 3PTMA 4CP9A 1CBGA 1VFOA 4GINA 1J0HA 1PZ3A 8A3HA 5FOOA 4UFHA 3M7SA 4KWUA 2XPKA 3SURA 2CHNA 3VIGA 1M03A 3F5JA 4ACZB 4YHGA 2XSAA 1QNOA 3AHXA 3DECA 4H04A 1H0IA 1BGAA 5D4YA 3T2PA 2A3CA 3AXXA 4R27A 1WAWA 1E15A 4TVCA 1QHOA 3PN8A 1KCLA 3ARWA 4UQCA 1BPLB 2O14A 1UR8A 2X8RA 2VO5A 4CD7A 1E71M 4H8UA 1CIUA 3PZTA 2NT1A 5I6SA 3T2OA 2JF6A 2WLYA 4DM2A 1QI4A 1FH9A 5E6YA 3W28A 4ZE4A 1KWGA 2VL4A 1IV8A 2VCCA 2E9BA 1FFQA 2X0HA 4CKQA 2VZOA 2BFGA 1EOMA 1JNEA 2VJXA 3EMQA 1K9TA 3AYRA 3WDPP 4AIUA 3FW6A 2PWDA 5JIWA 4HMDA 4MTVA 1ISYA 3WMCA 4FF5A 4L4OA 5LYRA 1HN0A 3UETA 2YL6A 1GJWA 2Q8XA 4MAVA 2QMJA 1UD3A 4M80A 3VIJA 3WD1A 2YOCA 3WDJA 1GOOA 4PMYA
chains in the Genus database with same CATH superfamily
1AR93 3MLJA 4GKLA 3W0KA 3WD2A 1M41A 1F9CA 4GG9A 2BHYA 3SM0A 3E9AA 1B0IA 3W86A 2Y6KA 2JKBA 1W3VA 2J79A 1VJZA 3FJLA 1ALDA 5IDZA 4R9XA 3N15A 2ZVIA 1NVMA 3GUGA 3ZYRA 2J9YA 4NUBA 1PCKA 3VTRA 1T5AA 4H2CA 4LEJA 2EO7A 1YIPA 1V6LA 2CGNA 1Q6RA 1EO5A 2WLPA 2FTYA 1XYCA 4LEQA 1Q7ZA 1TV3A 3DPRC 3AJ7A 1RGSA 2ZHMA 1JUEA 2ESCA 1ISVA 3UPBA 3WQ1A 1PWMA 5KZEA 1JCLA 5A6XA 4BLJA 2PTDA 1L7QA 3G0UA 2A3LA 4ZEPA 4J3TA 3H2NA 1ODMA 1L6GA 5F4SA 3UGGA 1C3FA 1X98A 3ELNA 3CO8A 2WN3A 2PLV1 1U5ZA 4GUGA 3U11A 2XJUA 4AWEA 1GWKA 3KV5A 3OPSA 3L2HA 2Q5TA 1EZ2A 5FOJB 1J79A 3ITYA 4P61A 2EALA 3IKWA 2OZJA 1Q6QA 3AU2A 4NROA 1QF3A 1YNQA 2W52A 4JGYC 2JG9C 4LPLA 4O11A 4K7JA 4UFIA 4LAUA 1Z42A 2DVUA 3GH4A 4NZ4A 4AHOA 3ZSKA 2R30A 3P81A 4CEXC 1RCOB 3H6OA 4MNJA 1UD8A 2GH2A 4QQ2A 1XICA 2Z25A 4DWSA 4IMAA 1DQXA 4PUUA 3S1WA 1QJU1 3ZN6A 2ZPXA 2NQZA 2KD7A 3WQGA 1R87A 3ZZ1A 3ACGA 3H8AA 3UFYA 1W2VA 5FJKA 1ZBE1 5FTTC 3AXMA 4AAXA 4AXNA 1BQCA 4BQ3A 4HPKB 3AS2A 4NZFA 3WX7A 4XBQA 4JKMA 4LJ3A 4A3UA 1GORA 4JEJA 1TV5A 3OW1A 3CUFA 3RRXA 1MI3A 1W17A 1C8XA 3W1NA 4BF9A 1QHDA 3AS3A 1U1HA 4CCNA 1COV3 4MGGA 5IRPA 1NFGA 2CWSA 2TEPA 2OELA 2WNUC 1W9PA 3H0OA 2J7MA 2QS8A 4RS5C 2HPMA 3B9AA 5FFOC 3V5FA 2C5DA 3R4SA 4TOQA 3CLWA 2VELA 3T30A 3ITTA 2Q8CA 3NMBA 4YYFA 2PC4A 4M81A 1XLCA 1GWMA 1P7TB 2ZZ4A 3BMWA 1D8CA 3WH9A 1RP8A 2V5JA 3KFTA 1H5YA 2CZFA 2PHXA 2FCUA 2QE3A 3HPNA 4MADA 3BCFA 1PKNA 3HF3A 4NPLA 3VCNA 1IWBA 3HT1A 2IC1A 1OYBA 5CLWA 1MO0A 4EK7A 3EO6A 5K7PA 2E6DA 1SU5A 1YEYA 4QDRA 1ZRIA 1E0XA 1FX5A 2WQDA 4QFUA 5HAOA 4BK4A 5CEHA 4R5EA 3AHYA 5HULA 4ORIA 5A8PA 3M0MA 1XX1A 3CIHA 4A3RA 4QXHA 2VNCA 4O9GA 2OX4A 3WNXA 2VEMA 5JZGC 3NVDA 4B3ZA 5BOEA 3AXKA 4O0ZA 3FNDA 1BMV1 4JQTA 1V3LA 2QQJA 5F4WA 4IXHA 3RPMA 1EL3A 2VFEA 5K8SA 5FIXA 4UR9A 3VBRA 3S2CA 3M0KA 1WBJA 4FPGA 2YBVA 1ZBA2 5FZ3A 2VBBA 3JB8A 1OF3A 4YVWA 1RUJ1 2ZGQA 4JL1A 1LBLA 1CENA 3ELFA 3CLMA 1MW0A 2DJLA 4JHTA 2R1NA 5FL1A 3MYXA 4AY8A 4R4ZA 5FQ0B 4PR4A 1LGNA 3EX1A 1BXBA 3KL3A 3OBRA 1VCGA 2HRWA 5LXXA 4W50A 3MHGA 3AMDA 1DJIA 3O9NA 1Z3NA 1YDVA 4FTSA 1W3JA 3NKGA 4E2GA 2YA2A 1TYGA 5BMXA 5KZDA 4COWA 4U33A 3NVCA 3KQ4B 5LK5A 4W4ZA 1BTCA 3U0HA 4GQ7A 3H7YA 3GHSA 3BU7A 2AQVA 3VZYA 5CG8A 4BZYA 2G9FA 2UURA 3ALFA 2ZOXA 3HU7A 4ENLA 1RHCA 4PB4A 5BNNB 4K3ZA 4Y2WA 4JIIX 3CZEA 4ASKA 2QGHA 4QWNA 3IJ8A 4Q8VA 3CK5A 2W3ZA 4IQDA 2GMEA 2QQLA 3QXBA 1E73M 4RKAA 5TQLA 3B8VA 4RNFA 3AMKA 3B0XA 4QGNA 3A3WA 5I91A 4AD4A 4E8GA 3G1FA 3VZOA 2UWFA 3IUHA 2JXAA 3T0BA 2PGEA 2VR2A 1R3WA 3NJ3A 1VBUA 4C65A 8RUCA 4D69A 2Z2SB 4R7JA 3AHTA 3SH5A 5A7WA 2VM8A 4D2JA 5G5IA 1NDVA 4Y5TA 5H9SA 3DN5A 2JQXA 4URAA 2VQTA 1CWPA 2NWSA 3LTSA 2WWDA 3SRFA 2ZUWA 3HGRA 1GANA 3E0LA 3IANA 5ECVA 4UTUA 1KB3A 1W0OA 4UTTA 1GTEA 3W1RA 1NLRA 1WCKA 2ZGOA 2A6NA 1NXD1 1F6PA 3APTA 2CNCA 4KWSA 2C24A 5FY1A 1UQXA 2WAOA 4G7FA 4A05A 3LOBA 3FUQA 1SLTA 5F7UA 1B35C 2AKZA 3WLQA 4US5D 2NVCA 3FFZA 1H09A 4C1NA 4IJRA 3UG4A 1PGW2 1GPWA 3KBWA 5IVFA 3NG3A 4C1KA 2OUJA 4ERGA 4MFEA 3WSUA 3WVJA 2FFCA 2OQ7A 3TA6A 3GNOA 1IKPA 2EPLX 3KV6A 2QPUA 3IWZA 5A3OA 3R0RA 4D1IA 2VPVA 4UZSA 4IW3A 1SVDA 3GG0A 4AWDA 3LHYA 3G0SA 3GS6A 1RY0A 4FMVA 2PLMA 4QLKA 5CAHA 3ZT5A 1T2XA 2DV0A 3AMHA 1K8CA 1GMMA 4UWMA 1SZFA 4J27A 1LRQA 4JTRA 4LBJA 5ABJA 1XIJA 4MB5A 1S0DA 2ZGRA 3SCWA 5J37A 4CLMA 3TFCA 1MEIA 4Z2WA 1MEC3 3W82A 4AYGA 1P43A 2A6VA 5HCBA 1V0AA 3ECQA 3K4ZA 4Q7BA 4FR6A 1LULA 2NM1A 1G4SA 1TIWA 3HT2A 4R9CA 1JRCA 4C7DA 1PV8A 4KH2A 4GZJA 2X5IB 5LNVA 2ZMKA 3CH0A 2PAMA 5HCHA 1EYEA 1S3TC 3URNA 3F4DA 3O6CA 1UP2A 1GOIA 5CPMA 1G1YA 2XKOA 1OFEA 2VOVA 1EWDA 5F2WA 2CTVA 3STCA 3WF2A 1QW7A 1W39A 4GXLA 5AVHA 4GYKA 1E9ZB 2XPJA 1W3HA 3FIGA 1N55A 3BC9A 3KCCA 3C8XA 2W95A 1UN1A 4L4PA 4NAMA 1XYBA 3FMGA 4DX3A 4FS9A 3BI3A 2Z4FA 3O05A 4D7YA 2B39A 4AG4A 4XUTA 5HMSA 4WJXA 2RHGA 4ES9A 3TXVA 1ULOA 4RDVA 2LROA 2D3NA 2OT0A 5BROA 2HNHA 3PZNA 5HCFA 3ILNA 1QHZA 1AH0A 3ZIWA 4CUAA 4KGGA 2ZRVA 4JDBA 5FZKA 4MV2A 1OA3A 3A64A 4ZTXA 1PEZA 1ENSA 3BG3A 1XU1A 5EXOA 1YXYA 5HQMA 2YDSA 5DLCA 1K12A 1KA9F 3KS6A 4JFSA 2X1UA 3GQYA 2W79A 1R8LA 4NZ5A 4OUMA 4MKNA 1LWIA 4HZ7A 2Q8DA 1XH2A 1HFBA 1TJRA 1ZM1A 2D24A 3O1VA 5EMKA 3ZSSA 3SGGA 5FZ1A 2PDPA 1Q4NX 1COV1 3UYIA 3SIMA 1PVXA 2IQDA 4Q0SA 3GIPA 3RILA 1BSIA 3LGGA 3O0XA 3RRDA 5DRIA 3BALA 2R072 1OB0A 4LVGA 2DZXA 1J4EA 5FDBA 3W2NA 4FPFA 2NX9A 2ZX9A 2I14A 4GULA 4BQXA 4XD6A 2WKGA 4QPIC 2A3HA 1SO4A 6XIMA 1Z32X 4Y5Z0 1V6MA 3MW3A 4DXSA 5D2YA 1MEHA 4M5PA 4OI0A 3P0WA 1Y8BA 1RH9A 3S9IA 2PF8A 1W2PA 4US5A 1WNOA 1Z9AA 2D69A 2UU8A 1PDZA 2NQ5A 1IPSA 3RZMA 5FUNA 3FJ6A 5CSUA 3DGTA 3VGBA 3RU6A 1XYAA 1F05A 3VC5A 2Y33A 6ALDA 4PF1A 1UY1A 2DZPA 3N04A 1XI3A 1UMLA 4HNTA 5TD4A 1A80A 1RK6A 2G41A 1I4NA 5BXRA 3H12A 5AZ0A 5J04A 3FN9A 3SDOA 2FMDA 1AW1A 3UZJA 1PKMA 1SLCA 2QJJA 4NZJA 5ECUA 5LBCA 2ZA9A 1DKWA 3SXWA 5AC92 1TQXA 2HWD3 4N43C 3UL2A 1OFOA 4CCOA 4DLMA 5IHSA 2R0FA 1E1EA 3QW3A 4HK9A 3USUB 3DH7A 2P6CA 5BMWA 1UPIA 1KRAC 1DWHM 3WD4A 4TX9A 3UWVA 1UCXA 3EDDA 5FBZA 5T3NA 4PQQA 2AREA 3VB9A 2BHZA 5C0QA 1LLOA 3SQSA 1C1LA 1UWTA 4I6KA 4UCFA 5T9CE 4FPEA 1OY0A 1ONWA 5DZEA 2GFTA 2XUCA 1OH4A 1X36A 4LBLA 3AKQA 4NIIA 1NCQA 2JG8B 4AEMA 1YNYA 2WANA 3SCNA 1Q6EA 1JW6A 1G9HA 2R1LA 5HR7A 3FY1A 5JPMB 2PWFA 1UKQA 3HPZA 2DDXA 4HL0A 3ZR6A 4YTRA 2WKKA 3AMGA 1QXRA 2O56A 1F3EA 4DBUA 3N3MA 4GJYA 5CEWA 2UWAA 3W1PA 2ZHNA 1G6CA 4JOMA 1NY71 2WFF3 3GBEA 2QPXA 4JDMA 5A1LA 4WD0A 1F5ZA 3WMLA 4V28A 3UKVA 4PMQA 3ZFEA 4M1BA 2GJLA 3EWZA 3RM8A 1V6IA 2YBTA 1V6VA 4K8GA 1LJYA 1A6CA 1J83A 3H1MA 3QF0A 3GFZA 1V3IA 1FDJA 2G95A 1HRV1 3BURA 2XM2A 1C8YA 1GGOA 1CX4A 2VRQA 4XYXA 4LIVA 4IF2A 5FMOS 4P8VA 4FIQA 1HJWA 4AX6A 1TX2A 3H3LA 4AD3A 4DQWA 3DZ1A 3LEMA 3L67A 3IV8A 2Z4GA 3PG8A 1GQNA 1HXS1 2PFWA 4NMIA 5C3QA 5C7GA 1KD7A 3BMVA 5HNTA 1R092 4AVSA 1J0YA 1TMHA 4GJ1A 5DMLA 1OQDA 4XO6A 1UYPA 2JKXA 3T0TA 3BB6A 3M4FA 3G0XA 1CB7B 5CBLA 3PUOA 5GLTA 2JBMA 1OEPA 3AMMA 2CZVA 2DZUA 4KIRA 1QJFA 1IGSA 4ILSA 2WVUA 2YFNA 4JNMA 4B5VA 3GVWA 5I06A 3S5OA 2XU2A 4XW3A 1VFHA 3MSYA 4K39A 2QZ3A 2JIJA 2D98A 3CV1A 3MJYA 1ODZA 2VG9A 3R4IA 2FHRA 3GXTA 2YA1A 4CEWB 4U36A 1KJLA 4IIGA 4PB3A 4UB9A 2WLZA 4EQVA 3WUEA 3OIHA 3QGAC 3AZYA 3ORWA 1PIGA 5CKQA 2O9PA 4JHZA 2NXGA 1GVOA 1W6QA 5JVVA 5HPOA 1KTBA 5J09A 4GBUA 1UP0A 2CU0A 5T55A 1WD4A 4MVAA 2A3XA 4HPXA 1VCFA 4JN8A 2HBVA 1RJRA 4MLJA 4QU2A 3OD0A 2X0YA 4XIOA 3PULA 3IDBB 5JCTA 1AMKA 3LSDA 3W6MA 2RFGA 5BXTA 1PS9A 4ZODA 1Q6LA 1FAYA 3LNPA 4WK9A 3PM6A 2VMCA 4FPSA 4XDPA 4LBRA 3VBFA 2DORA 3AZRA 4WGXA 3S7IA 1W91A 1GVEA 4NIDA 3MO7A 1J9YA 3C0QA 2Z1SA 3JZUA 4IMGA 5GKAC 4ZKTB 1JAKA 3V5CA 3DOPA 2A85A 3BAKA 4CCMA 3AIBA 1WKFA 4Q4X3 2EAAA 3KBVA 3Q58A 4J2MA 5GPRA 1LOSA 2WDBA 2ZKLA 4CDXA 2GGHA 1PO23 2TRSA 1JDAA 3S1XA 3DYOA 2D0GA 5CU1A 1UG6A 2PBGA 2G4JA 2V5BA 2WMFA 4UQBA 4AEJA 5PTDA 1NWUA 2ZYFA 3ETPA 5D37A 4M7SA 1YNPA 5JH2A 3UJSA 3ZYGA 4CDQC 1FHUA 1KLZA 2GC0A 2Y34A 5FPUA 1W31A 3G8EA 1LWJA 2XGZA 3DHUA 3SY8A 3ZYPA 2IPJA 3B8TA 1KFCA 4A42A 4PH6A 3ACHA 3MY9A 3GC5A 3L0KA 3H24A 3TW9A 4DJDA 2TUNA 4CN6A 4WDWA 1OC7A 4Y1YA 5E88A 5DMNA 1LQAA 4Z1AA 3EWWA 5JSPA 4GNVA 2DZBA 3OF1A 2IMRA 4F0SA 3C61A 3FAXA 5G4HC 5ABTA 1REFA 5CGQA 5I23A 2E9QA 1TWWA 4GH1A 1O3SA 4BI6A 2OKXA 4MO3M 1HDKA 1XWYA 2QJNA 1GQJA 1YTEA 1GZCA 1W8UA 2ZC8A 3UYJA 4AGGA 2FGLA 4WCJA 4YGBA 4DWDA 1DWJM 4CDUB 1I6NA 3VCRA 1UY3A 4XFCA 3WLOA 3WK0A 1FWJC 4U31A 2XDVA 2EIGA 2J1RA 2GMMA 2XHKA 5LIUX 3KOWA 2V4VA 2RVAA 3UZWA 4XFIA 1UD4A 3C7GA 4P9JA 5BNNA 3M07A 4QX0A 3EWXA 1WQ5A 3LMZA 3HG2A 2WS93 2G0WA 3K75B 4GXWA 2YKKA 4GVFA 4PDWC 4GKYA 3LS9A 3LPPA 3H26A 2WINB 3A47A 1B3VA 2BNMA 1YE4A 4QCFA 3WUDA 5FPXA 4IUGA 2XG9A 4C5ZA 2GOUA 3EX6A 2I74A 3LWCA 4OFGA 1Y65A 4A3QA 1YMYA 3WFZA 4K6AA 1A4MA 3LOTA 1AXKA 3U4SA 4OKDA 2DFCA 4IGMA 4PYSA 2C1GA 3HNMA 1WX0A 4O16A 4AF0B 3IIOA 1UD2A 3IIXA 3W7PA 1L6FA 4W6XA 2CU5A 3VHPA 4B7EA 4QBXA 3ZWTA 4DZIA 1ND2A 4PULA 4WVZA 1UYQA 2CXGA 3BLOA 2WZIA 1Y0EA 3UESA 2NQHA 1TE1B 3BAYA 1HZYA 1RXFA 1R3YA 3ZFHA 4IE6A 2Y4SA 2PMWB 2PELA 2RS53 3T1LA 3BTYA 4ZOCA 4QITA 3GBGA 4HYVA 4XO7A 3LFMA 4M01A 3RN6A 3V0AB 4NX5A 1CQ9A 3LRKA 1RQHA 3VUPA 4XABA 3WLNA 3WLSA 2PSNA 1DIDA 2VDHA 2RDWA 5SV8A 2NLYA 3M6DA 3WJXA 4UW4A 3WOGA 1QK0A 1KM6A 1TUFA 1RHI3 3EDFA 3LTYA 2XDFA 2NXIA 3AJZA 3PB0A 2QCLA 1ONAA 3OVPA 2P3IA 4C0HA 2HV5A 5CFDB 2HQAA 2WW5A 3NCOA 4RE4A 1XD1A 2E8YA 4HOOA 5AYYA 3B05A 1ZJBA 1MZHA 4QQLA 4UQDA 2WN2A 3GAKA 1QOQA 2VEPA 5F4XA 5ABGA 3GFYA 3BXWA 4RR3A 1C8QA 1NQJA 1A5OC 2PTXA 2Q4SA 4XJAA 1RLDA 3MF6A 2JEPA 4QPWA 2WHJA 4FEZA 4QXIA 2MEV3 5APAA 2QDRA 5DUUA 1ZA4A 4HPGA 4YTQA 3WLTA 2WSPA 2P1BA 3NV1A 4YZ2A 3EBVA 1NSJA 1WD3A 2FGZA 2P2KA 4UUIA 2RG4A 1ENXA 2J47A 4LO4B 1G4TA 3ZLGA 5CFCC 4DHGA 3I3MA 3MANA 3EPMA 4BIFA 2NQYA 4D6RA 3T4WA 3W26A 1YPFA 2LS6A 3SUWA 2RJ2A 3VZJA 3ETQA 2ZZ6A 5HOSA 1SLIA 3C5QA 4XF4A 4MDOA 4LMFA 5DAXA 3PDQA 5FZOB 4NRSA 2Z42A 3JCIA 2AAMA 4HMEA 3PBYA 2Z79A 2IXHA 1WP6A 3WSOA 2WKLA 3MBFA 4ASLA 2IKHA 2ZFAA 2ZGNA 2OA2A 2ARXA 3EOOA 1UOGA 2UY2A 1KQRA 2F7FA 2ZXAA 4DBWA 3VKBA 4P08A 1Q2SA 4OQ9A 5LK7B 1QT1A 3GXDA 2VX7A 3POHA 2PA7A 4Y33A 5F37A 2JKPA 2GMPA 1D9EA 5C2CA 1UY2A 2DY3A 2ZXBA 1UZ0A 3QH6A 4C5YA 3H2CA 2A6XA 5FCCA 2NZ9A 1WCQA 4TX8A 3EHKA 4DUWA 1RUNA 4WKHA 3TSBA 6TIMA 3K48A 2BVWA 1GBGA 3P80A 4DAIA 1IE7C 2RM21 2E9LA 1NWRA 5FXXA 1SHWB 3HAGA 1HX0A 4PA8A 3QV8A 1SYTA 4GIQA 3GC2A 1BRLA 4GZ7A 4JFVA 5LA2A 1UUQA 4C8DA 2V67A 1IYXA 2WT1A 2FQPA 5FIPA 4S39A 2C15A 3HGSA 4KETA 1LEDA 4Q29A 3SJ3A 3NPXA 3GGLA 1W8FA 1IT0A 1EHAA 3VD5A 1HV1A 1J0KA 4QE1A 1LHVA 1S0FA 2PN5A 1R0MA 3ZLHA 2YXSA 3AL5A 4U3CA 4FX8A 1PKYA 3QMRA 1UKPA 4AZ5A 3F1QA 2YHJA 3GH7A 1S39A 1CESA 4FNRA 1ITXA 4NU7A 4WDXA 4AEDB 4GD0A 3LHVA 2D2HA 2CCRA 1GR3A 3EDKA 3HQRA 4QB6A 2YCKX 1DGWX 1E1CA 1LQ2A 4XFGA 1WOAA 5F2IA 5EMMA 3WQOA 2DCJA 3QV9A 2FDIA 2GVEA 3UGRA 4BA0A 4GNJA 3BGAA 2YDQA 1WLTA 1VRH3 4NXSA 3PZVA 4IX2A 5CPNA 1ZCCA 5D09A 4GIAA 4LUSA 4JQ2A 4HSLA 5C3OA 4UTJA 1J3RA 5DN1A 2VCMA 2D5FA 5AC4A 4ACYA 1NCRA 1ULPA 3H2AA 2ET1A 5XIAA 3O2LA 4PUEA 1R64A 3PPFA 2UY8A 3C7OA 4KRZA 3VNMA 4XTMA 4AVVA 3S3GA 1W3IA 1IXOA 4ROQA 4C1NB 2QNKA 3KT7A 3W2MA 4C6BA 3TLLA 3SCPA 1TVPA 4XPVA 2EVXA 4YWAA 4KEZA 2DU2A 1ONXA 1UWRA 4L8QA 2PGRA 3S2JA 4FXFA 4CDWA 3VC6A 5C7VA 1HIXA 3ITLA 2XLGA 3CIVA 1VMHA 4N9HA 3G3MA 1XBFA 3UF9A 3ZMOA 3BTNA 2VEKA 3KBJA 2YLLA 4V2WA 1VMJA 4IV1C 1E5JA 4JR5A 2D2GA 1TTJA 4KWOA 1SGJA 4HVQA 2WO5A 3NL5A 3NGFA 5KHHA 1KXQA 3L5LA 4ZOEA 3BOXA 2YLAA 4F3JA 3L2MA 1GYKA 3AJYA 5JMOA 4M8UA 1BZWA 1DBNA 5HWNA 4IPPA 3EXTA 1KR1A 1HKJA 3H4WA 2WMJA 3OCPA 4KG0A 1A5MC 4UTTC 4NKCA 1EWEA 2P10A 5J1XA 3MCNA 4UR7A 1JPMA 2DBIA 4P8UA 3BLDA 2BZNA 4PMUA 2PZ0A 4M3CF 1VYPX 2A3WA 3KVMA 2QJVA 3DYPA 1K03A 4W8BA 5A2BA 4DFSA 1W1IE 3B0YA 5EFUA 1OWQA 1RP9A 4ATDA 4NHMA 2VZRA 3CZLA 4CDWB 4LU0A 2RDQA 3E5XA 2FMYA 3FXGA 1O5LA 4AZCA 4J40A 3FA4A 1TVGA 2ZXDA 1CECA 3ONCA 3NDYA 3PURA 4UCGA 4XAEA 4Q8WA 1QQP1 1B35B 2A0NA 5M0TA 1FHLA 1BK1A 2NN8A 2VULA 3QKZA 4XKYA 5I2UA 1XH0A 4HB7A 3TNOA 2YW3A 5EZWA 1QOTA 5J7MA 5A6BD 1MQPA 1WE5A 1DJWA 3AKTA 4HHMA 3CHEA 1UW9A 1FWNA 4QEEA 2WZR1 1VIWA 5FAGA 3T05A 4E2DA 4N6EA 4KI5M 5G1YA 3DG7A 2Y70A 4OI1A 4GYPA 3PVEA 1LBFA 4W7VA 4Y4YA 1OZQA 4Q33A 3PPHA 3UJEA 2HBUA 1BMV2 2QJMA 4CU7A 1TME1 1G4EA 1DE6A 4I8YA 3WCSA 2VQUA 3TYBA 1XD0A 3REQA 4XG1A 1DF0A 2PMQA 2FTPA 5FACA 1W5NA 3CT7A 3KZSA 2RGMA 3M1ZA 1OGSA 3QGVA 4S3EA 4YARA 3NOEA 1UUMA 2BMBA 3C3NA 1FH7A 4FPOB 2V9DA 4HSHA 3EWUA 3TR2A 5EFDA 2VZSA 3ZOIA 3HQNA 5FYBA 2ZRYA 5C9AA 2Q1MA 2VEIA 2ACSA 1DYPA 3EXUA 2ACQA 3ZOAA 1AL23 4FPKA 2B81A 1VBD2 1D4M1 1NDWA 2ZZ3A 1QOXA 3LMYA 3BUCA 1FFRA 2CL2A 2HVNA 1TFVA 2MNGA 3KM5A 1VAVA 3FBMA 1MR5A 4FQ4A 3AHVA 3UW6A 4Z1DA 1QY4A 2XH4A 4PDWB 1DGWA 5LSMA 2WVSA 4Q8TA 3IV3A 3POBA 3W38A 4Q8OA 1PGSA 4Q8KA 4CDXB 4QJ5B 4RNIA 3G1HA 4KMQA 3FOKA 4W84A 2JGQA 2YC2A 3QH2A 5DCBA 4EXAA 4L2NA 4QB2A 3ZKUA 4NSBA 1RUJ3 1ENRA 2RS31 4URTA 4WVMA 1ME9A 1N3QA 3QR3A 2HK0A 3WQ0A 4DMIA 3SUVA 4P7NA 2B7YA 3FLRA 1PK6C 3C86A 5B80A 3OBZA 2EXOA 2UY3A 4U4MA 1F9KA 5FRAA 3RITA 3RZZA 1QNVA 1V77A 4CD8A 3N34A 3C0JA 1U83A 1HLCA 2WSVA 1P48A 4XZLX 3QD6A 2PDBA 1UOFA 2Y8UA 1MXGA 4EVZA 4QE5A 1AR71 1RUSA 2ZCGA 5ISLA 3BDKA 1VFMA 2RHPA 4BE3A 3NQCA 1UYZA 1E72M 3T4VA 4PTVA 2Z27A 1JZ2A 1E4NA 3LIHA 4HJFA 4MZUA 3VFCA 1SLAA 6XIAA 2NLRA 4PN2A 3P6LA 3FHAA 5I0UA 3K8LA 5FZ7A 1PCWA 2Y5JA 4KCUA 5JPNB 2JDMA 2VMGA 3QOKA 4LRTA 3HJEA 4NASA 2FH6A 4YTTA 1DQUA 1JN2P 4FVVA 1GOKA 2TAAA 3MSRA 4YVPA 4WZCA 3JR2A 1KBKA 1E4IA 3NSTA 1OA4A 3KMHA 3N7LA 1XNCA 5L7OA 5I7GA 2J7BA 2ZX1A 2DVDA 3QHOA 3NL1A 3THDA 4V33A 1JH5A 4OHZA 5KHIA 3S5AA 5CZTA 4OHYA 1GT8A 5DEZA 1JGMA 2VZ1A 1JL8A 2B7NA 4IL0A 3CZ8A 2WZMA 1ME8A 4ZY9A 4ERIA 1NY1A 1JZ6A 4MYXA 3NOYA 4EANA 4GQRA 3GG8A 1QGLA 4Y9PA 1FWRA 1ND2C 1J12A 2FDMA 1XIFA 2QUUA 1RVF3 2XJPA 4A41A 4LX4A 4NY2A 3GYDA 2ZXQA 1J3PA 1DWIM 3O16A 1XBXA 1RBOB 1KM5A 1F15A 2Z69A 3F5KA 5C8CA 4WR3A 3GTFA 7TIMA 1UC5A 3TEVA 3KLSA 3TCSA 3VM7A 2Q0AA 1TE1A 4L1WA 3NURA 3R5EA 4HU4A 3T7VA 3RSJA 2F2KA 2BU9A 3C7HA 5I8YA 2QDEA 4LBSA 3AL6A 1KV8A 1QI3A 4Q0QA 1LROA 2CYFA 4JXCA 2GSJA 3INAA 1KQZA 2R91A 1QU0A 3W29A 4W8LA 1O94A 3DEMA 3VX0A 3POYA 1NF7A 4CPBA 3ZXLA 4RNHA 4ERAA 3T9PA 1E1CB 4FOYA 3SW6A 1K3IA 5C2XA 2D44A 4GFSA 4H3WA 1AR61 3ARSA 1G9BA 3PZOA 1FWBC 1VENA 3RXZA 4XF1A 4NIAA 3AI0A 1MEC1 3TONA 5LA0A 1E6XM 4ASMB 5FOBB 3MHUA 4X9SA 3ZMRA 2Q8EA 1Q8QA 3PZQA 4JTOA 1ENUA 1JPKA 2JB4A 4ADUA 3UR8A 4ZQRA 3W7DA 5SV5A 1R1A1 4KBXA 5U7SA 4Y1ZA 3MZ2A 3LEGA 4GC3A 4QMAA 2E9MA 3WG3A 3SISA 3UK9A 3A9BA 5DAVA 1TME2 1B3YA 4Q0UA 5HNUA 4F0KA 2HJPA 2WRAA 4YGCA 2QYGA 4WIWA 4JBRA 1XFCA 2I16A 1EJXC 3KF5A 3ZSLA 4JIEA 2D6OX 3ZKYA 1OABA 2OYLA 2GZXA 3VD3A 2F6BA 3KWSA 1R30A 4ATFA 3NO5A 1NCRB 3CHFA 2RR11 3HWJA 2DFAA 3ITQA 3RU8X 5FY5A 4YYOA 1YFYA 1FPN2 3VGDA 2BGNE 2WK2A 3PU3A 2YGLA 3EX4A 2ATMA 1QQP2 2VP8A 1F6KA 5ACA1 3Q8FA 1WZKA 4MUZA 1NAEA 2P3ZA 4LBUA 1EX5A 2H0VA 4ZO7A 3CNYA 3H2EA 1BF6A 1H1IA 1JOPA 3UXKA 1IZ3A 3PU8A 3ILRA 4GABA 1E0TA 4F40A 1C5IA 5FZ4A 1AJ2A 5AHEA 2BZDA 1O5UA 2FJKA 2QMKA 2PA6A 4IIHA 5FY7A 3PPCA 3GRIA 3SGZA 4UQ9A 1Q6DA 4WF7A 2O1QA 4F4RA 3R94A 4RDYA 4WM7C 2K9ZA 3WHUA 4L97A 3E6CC 1HRI2 4R3UA 3U2OA 1CAVB 1G9AA 1GYLA 1SLLA 1KBJA 3LV5A 1JS9A 4YM3A 1FX6A 2MNRA 1OFNA 1XIHA 3M7WA 4IV1B 1XKJA 1HB3A 1QRQA 1X1OA 3E3HA 3KHDA 1XLDA 4FP2A 2CBUA 2QJIA 1XYLA 3KLLA 4TXEA 5G04L 4YFZA 5A33B 1FDZA 1EF3A 4LYRA 3CYVA 5AHLA 4E2VA 4Q26A 2PLKA 4R9OA 4IJBA 4J35A 1TTQA 2GU9A 4RCXA 4YFWA 5EU9A 2W1UA 3ZO0B 3GTXA 3WBXA 1AHSA 2VC6A 4GLEA 4RZ5A 3IUDA 3QQWA 1UH2A 3VFLA 4C1XA 1O91A 3E6DA 3TB0A 4CU8A 3NEVA 1JCJA 3HV8A 1CGTA 4WX2A 5DT5A 1EP0A 1F2NA 4YCOA 1PO13 5JBFA 1GVRA 4Y9MA 4EF8A 4CU6A 1IPKA 1Q6OA 3M4HA 2WZTA 1YFUA 2J1VA 1E57A 2WJZA 5GNXA 3WQEA 2ZMNA 3TWIA 1RSCA 1JDCA 5GVJA 4R88A 2HWD1 3RLVA 3IVSA 4JDYA 1KGUA 4M6VA 5DDJ3 1WW6A 4XIAA 5FP9A 5H9PA 4NJIA 1M7XA 2ZDRA 3G8RA 4ADTA 1CX1A 3IGUA 2Z29A 3KLKA 4MJ4A 2ZRXA 5I3DA 1POV0 4H9VA 2VD7A 4UTFA 3UKTA 5FJRA 3KGZA 3KT4A 3M2MA 3CZJA 2DH3A 1EDGA 3RDKA 1FV2A 4Q7IA 3GWQA 3TA9A 4H2AA 1D3GA 3GHTA 4KQNA 5BU6A 3UJFA 4AHPA 5JOXA 3KOXA 2QGYA 1JHNA 1G0CA 1DQ6A 4XQWA 1BVVA 1AFSA 4HNOA 1HKIA 1IG3A 3JZVA 1AZ2A 1DJYA 3QSRA 2GP3A 3W7EA 2PGFA 1H1MA 4ATWA 3IDEA 1NOWA 4CQDA 3ZFGA 4IGQA 1S2WA 1LGCA 5JXHA 1KC7A 1W6MB 4OTKA 5FEPA 1KFEA 2BB0A 3RQ0A 3PPGA 4QLJA 2FDJA 5IFPA 3GH5A 4AEKA 3PAOA 1UCWA 5M1TA 4NWVA 1GSLA 4F66A 2OWWA 2OG9A 2JE7A 1FA2A 4IP5A 4LEFA 1W0MA 4R52A 3DDMA 1MZ6A 1PZ8A 2FHBA 3MP5A 1RUD2 4P7LA 2I56A 4DXKA 1YO8A 4J6GA 2QV4A 2F6XA 3BOLA 1QXPA 2GPTA 2QVNA 2VUAA 3A4XA 5C9UA 2WMIB 5DZGA 4GALA 1B5TA 4J9JA 2CSGA 5IVCA 3TLQA 5A69A 4KWLA 3R8RA 3FJ4A 3URQA 4LO7A 4XHXA 2JX9A 2VWTA 4H3DA 3C7EA 4EN6B 2WCGA 1HXS3 1PJ9A 1NWTA 1P8JA 2G97A 2E33A 3B9EA 2WYFA 3BVJA 3O15A 1O8PA 3NO3A 3C2UA 3DI0A 4K1YA 1FP8A 3CEWA 4J2PA 4WM8B 1UR4A 4H8NA 1UIJA 5KXEA 2ICSA 2XIIA 3IVUA 1VBA2 2GNBA 3WBYA 4AVTA 1CAUA 1J01A 4NHYA 1HJGA 4M0XA 4CTEA 2QUTA 5E9AA 2Y0IA 3ZXWA 1UR0A 4UW5A 3U48A 4UFJA 2J6VA 4CP0A 5XIMA 1EUNA 2WVVB 2QQPA 3TOYA 4JQ3A 1CZTA 2P3JA 2ASHA 2GVYA 2H3BA 3V1HA 3PUHA 4LK7A 2ALRA 2VMHA 3C2RA 5BOFA 3F4VA 5F32A 3L4VA 4A29A 3CUGA 3NSXA 3AICA 3EKGA 2I5QA 4L61A 4EKJA 5HINA 1LG2A 1W6MA 3AVRA 1O7AA 1QWKA 2XISA 2GALA 4Q1RA 2UZ9A 1HB2A 2X10A 4GH4A 5C4WC 4GYFA 1LOEA 4EACA 1YNAA 1CIWA 3USZA 1I45A 3K8KA 1TRDA 3GCWA 3DGRA 1KKRA 2XJ7A 2ANUA 4Q4QA 4JPGA 1OC1A 3CB8A 3UPMA 2OYZA 1BXHA 4IEWA 1IGOA 3QRHA 1N1TA 2LALA 4GINA 3TQKA 1J0HA 3G6JB 3M7SA 4QS5A 4RSUA 3LDBA 3PTDA 3A0NA 1Q5MA 3VIGA 1ELSA 2UV8G 1R9XA 4Y26A 3DECA 4H04A 4MYAA 3EB7A 1JCTA 4CQCA 1QTWA 3CIXA 5EL1A 3AXXA 4CZSA 1WAWA 3HQXA 3R43A 1ACCA 1J1TA 3BV4A 1PWLA 4W65A 3ARWA 4UQCA 1NKGA 5MKGB 4GC4A 2Q1ZB 3MMTA 4G4FA 5F2MA 2X8RA 2GN3A 2VO5A 3UZ5A 1R1A2 2QVSB 1QJX1 1CIUA 2V5YA 2P3KA 3T2OA 1H2LA 3OA3A 4Q1PA 5E6YA 3W28A 4ZE4A 2WSQA 2PD5A 1RK5A 4FPJA 1SZNA 3POGA 4MUPA 2E51A 3OD4A 3BW2A 3I8TA 4NAEA 1FFQA 2X0HA 4CKQA 3OGGA 4XACA 2BFGA 1EOMA 2HWF2 2ARAA 9RUBA 4UTWA 3EMQA 2C6QA 4PE8A 1ZNNA 2VGGA 3AYEA 2WNNA 3KVKA 3T81A 3NQMA 5JIWA 4JNYA 1N3PA 3LQGA 1C8M3 4HVOA 4HIBA 1XRTA 1LTDA 4JTHA 2YL6A 1GJWA 2WA3A 4ZO9A 3IEBA 1POV1 3QSTA 3WD1A 4UF0A 2QCEA 2R1BA 4FP1A 3M64A 4ZU7A 5CFCA 3CV7A 5BNPC 1UQYA 4MJZA 1GNYA 1Z6KA 5JIAA 3WZ0E 2E67A 5F1RA 3OB8A 3SN4A 4JVAA 3NVTA 1OX5A 1VRXA 4FXSA 4NUWA 1PKLA 3SUTA 3B0PA 2VD8A 4RZBA 2VWSA 1AK5A 1TPUA 4GQGA 1C5HA 1W3XA 4K21A 2EG6A 2ZHLA 4LJHA 4MXWA 1OK6A 2FMNA 5FP4A 1ASJ2 5AYXA 3VBOC 2ZX2A 4U2ZA 4LBQA 1GKQA 2MUCA 3V64A 3GVGA 4Y6GA 1V6KA 3RRAA 2OVLA 3EDEA 4CQAA 1MW1A 2JD4A 4YM0A 4AQ6A 4GI9A 4M6UA 3QGKC 4JGYB 1EX1A 4N9EA 2X7WA 2V81A 4I09A 3NZRA 1QAPA 2TODA 3SITA 4CCZA 2FDSA 4G5DA 1OKQA 4RQPB 1J5TA 5I0RA 1R3RA 2NUYA 2OQHA 3BPZA 3BLIA 3E0WA 4NG3A 2I7GA 3AXDA 3I2JA 1Q8JA 3KCYA 5F5AA 2DSKA 3N3HA 2J22A 3O0VA 1U33A 4GWEA 2Y0OA 3CL1A 3PF3A 3JXSA 1FWSA 1Q5OA 4WZHA 1IS5A 3RG6A 2UBPC 1ZRFA 4D7TA 5IK8A 5DG2A 3ZVHA 3F5LA 4FPCA 3GVQA 4JTJA 4AAJA 4JQRA 3V36A 5LWBA 3M9YA 1LLWA 1N1VA 3ZYJB 4V1PA 3WDUA 1CWYA 3W37A 1V6TA 3QBUA 3NKTA 3TTQA 2J8TA 2WAGA 1BJQA 3TEZA 1JYTA 1VBHA 2BOIA 4P5YA 1NU5A 4L9YA 3W27A 2PDQA 3IVTA 1UX7A 4HONA 1F61A 3UQNA 3OBKA 3WLHA 1WUEA 4IG2B 2OX0A 3V1PA 4PGLA 1J0JA 3IN9A 2VVEA 3K51A 3AMQA 5FZCA 1XC4A 4G56A 1K02A 5EQUA 4AD5A 2XGIA 3M0VA 4P14A 2BP1A 4JAWA 4GH4B 2ISFA 3ILFA 4XUOA 3ZMNA 4CSWA 3ARXA 3EPOA 1YC61 3QW4B 5T9BG 3P8JA 1UOZA 1RITA 5CC6A 1FP9A 3R10A 4FLOA 1KEXA 2WQ4A 1E6SM 3EWDA 1THFD 1RCXB 3ANUA 2VQ0A 4W89A 3VZLA 1W8GA 2RDTA 4K1WA 4JTKA 3F03K 3BIEA 1QFEA 1QCWA 3THUA 5A3MA 1Z7S3 3L4YA 3Q8EA 4QQOA 2BJSA 1PBGA 1PHMA 4WKFA 4FO4A 1VBD1 3GALA 3VBRC 3ARRA 1D4VB 3CPGA 4I90A 4XCBA 2QBXA 3HFTA 4UTIA 3WH7A 3VOCA 1W90A 3MV11 5FMOL 4XOGA 3I7DA 1RUH2 1CPMA 1OG0A 2GWGA 1MWOA 1H30A 2BNNA 4FNSA 3ONBA 4W5ZA 3FJSA 5JXQA 2OUHA 4LUYA 3UVIA 4DB5A 1Q66A 1ZU8A 1UHVA 3W7JA 3MI2A 3BTXA 3WDWA 4M29A 3DIPA 4GX9A 2MHFA 3RJRA 4DO0A 1GQIA 3A5VA 4JIHA 4CN1A 1MUMA 1CIYA 4YW7A 2EAWA 1YHFA 3T2QA 5LNUA 1FWCC 5TIMA 4XHBA 3RMXA 1HP4A 2WZR2 1R86A 1J59A 3HMJG 4ZE5A 3O6DA 1EAH3 1XRFA 2IW0A 2XHYA 3OHMB 1RUF3 1UYYA 1AL22 3UGFA 1SCSA 3OOQA 2X5IA 4S2DA 2HZGA 1SMVA 1XOYA 3UZYA 1VYSX 4M4RA 2EPOA 1VH7A 2GDFA 4W6YA 2ADDA 5LRRA 2VYOA 3M0XA 3H9AA 4W5UA 3HJRA 1TEIA 3CJIC 1ZJAA 4JY9A 4XISA 1D2KA 1VGAA 1H2NA 2QQIA 1XISA 1XPWA 1VJSA 1W1B1 1KS5A 2FD8A 4RR3C 5AHNA 4ZR8A 1OD3A 3WW4A 5GJ6A 4LNYA 1OI6A 1IIGA 1AR72 4GH3A 3KHCA 5FESA 3KOYA 4MOAA 1DYOA 4C6IA 2P5BA 2VNGA 1ENQA 1KJRA 3W76A 3C56A 4K8RB 1HVQA 1ZB5A 4G9PA 1T6BX 2WNQA 4QX2A 2AQWA 5FZFA 3I49A 3IMNA 1UMIA 4MIMA 2ZZJA 3JD73 1EPZA 4QAIA 1LT7A 4I30A 4AL9A 1V3MA 1GICA 4JN6A 1OOPA 3CV2A 2NMOA 4HN1A 3GDKA 3VOGA 1L6WA 5I8SA 1ASJ3 3E5BA 1FH8A 2ZABA 3V75A 4C6JA 3WLLA 1EJUC 5FSDC 4F9DA 1M04A 1I5ZA 1W2NA 3LXAA 5FPLA 3CZGA 3J9SA 5FPZA 3NQFA 4DWSB 2R8WA 2VM9A 4EN0A 4FOQA 5A8QA 3RFAA 2JKEA 1O8SA 2GJPA 2BQPA 4F0HA 4IFKA 2JDYA 4DJFD 3AZXA 1AL8A 2W68A 2DDUA 4Q8LA 4YVSB 4FOJA 4H41A 3DCQA 1BG4A 1PAMA 3BU0A 2Q8ZA 2OLAA 4I9JA 3DXUA 1OX4A 1CLKA 2RS13 3IARA 1XSRA 2VW0A 2R1PA 1POV3 2SFPA 2YFUA 3SH3A 1WA6X 1W8TA 1HUVA 4QM1A 4WM7B 3JS3A 2YMZA 1IXQA 3SEPA 4BXFA 3ZFEB 1PO9A 5CFDC 4Q5OA 2PDKA 3CUJA 2VUJA 4OI4A 1REEA 2DVFA 2GJXA 2VGBA 1QNWA 2J62A 4PMOA 3N7KA 1WZAA 1CXKA 1KWKA 4P2VA 1P0DA 2QDNA 2HWE1 4J25A 4Q4Y3 3PBWA 3LPFA 3JBG2 3O1SA 1V00A 3K4WA 3OP2A 4W9TA 2OKOA 4LAKA 5I3FA 3W07A 5A95A 1H6YA 4GFIA 3O6YX 3M46A 3WJZA 4XSLA 2X0SA 3T42A 4LYKA 1HO1A 2DSVA 2Z28A 3T78A 2XVNA 1DLCA 2Y24A 1KRIA 2ZGPA 4O15A 4G2DA 4PTXA 2WC2A 3PLQA 5F6KA 1WLCA 2WZR3 3MGUA 4C6LA 3BG5A 4EPDC 3LGRA 1B4KA 5FJHA 5CG7A 1QI2A 3I54A 3EKZA 3WDVA 1VBB1 4GE8A 1YFXA 2ZGTA 5T52A 2PQQA 1XLEA 2G9GA 4KU7A 3DBNA 1UB3A 3ZN4A 3H2OA 1H41A 1S0JA 3AXIA 5IDIA 4OV4A 3CAWA 3IB3A 2XGBA 4IHCA 3DCPA 3CJIB 3WV6A 3GW0A 2DQXA 4XJ8A 3HMYA 2BY3A 3STEA 1QPNA 5A7SA 1UWSA 2RR13 2P8BA 3UWZA 5FO8B 2YR1A 1RUC3 1SCRA 2EXHA 4S3KA 7ENLA 4DO7A 1GK8A 2OQLA 1GP6A 4E38A 4XTDA 4HZMA 2IXIA 4XBJA 3WG6A 5FYCA 5FLHA 1VALA 1Q7QA 2D3RA 5IFTA 1BF2A 1UO9A 3DF0A 4LORA 1OT5A 1F76A 3W1AA 4QU1A 1RAKA 1A47A 1QBAA 2R041 4MH0E 1WMFA 1W9UA 4C6OA 1TSIA 1XW8A 1YTKA 5FZ8A 1Y7BA 3RNSA 1ST8A 2X8KA 3C0LA 1NP0A 1HQNA 4INDA 3E5PA 2BDQA 1H2KA 3LM7A 5AYBA 3USBA 3WP3A 2VGFA 5M3WA 3WP6A 2CIPA 4ICCX 3AP4A 5DAQA 2OX1A 4V27A 2Y62A 3MYPA 2A1YA 4ACZA 1DZQA 4SLIA 1LYXA 4M56A 1I1EA 4IERA 1FRBA 3LB0A 1WBFA 2A6ZA 3ITXA 2F61A 3U5UA 5LA1A 5GNYA 3B5LB 4INFA 4K38A 4QQ3A 4NVPA 4Z0SA 4ZSTA 5ABHA 4OI2A 4O9EA 4GCXA 4LO8A 1E6ZA 3G1AA 4C7FA 5FF3A 3ZLIA 1J2WA 2XONA 5FMDA 2AMXA 2JDAA 2A21A 2H90A 4H6KA 4IETA 2GLKA 1J93A 1W5OA 1JFHA 2GVGA 4MYEA 4FPYA 4QM8A 3MC5A 2GNDA 3TP4A 4FF7A 3UCQA 4LO5B 1DORA 2BSLA 1AJZA 1O66A 4E2SA 1DQ2A 4GYPC 1AJOA 1SJCA 5JZGA 1JXNA 4X6RB 1XYNA 5GJNA 5HK4A 4JN7A 4BEUA 1FOD2 2QV5A 3T4CA 4PODA 1JZ4A 3LG3A 2YGMA 2VMDA 1ZZCA 3ZWSA 1R1ZA 2ZX8A 3D6EA 3ABSA 4WEVX 2OZ3A 5KMYA 1VCVA 2PS2A 3CO4A 4HKLA 1P7TA 2DIKA 4HK5A 3NQ8A 3ATGA 3QJAA 4MF4A 1IZCA 1H7PA 2ZZ5A 2ZTJA 4PBGA 1SPPA 1X8MA 1CGPA 3DV8A 4DWSD 2BVDA 4UZUA 4QCEA 4UTMA 1RUF1 3B0VC 1MNZA 4PMNA 4HP5A 3U1XA 2E6YA 2YUEA 4GPNA 4H6RA 1MQTC 4W8JA 4AISA 1KM3A 3U78A 3VGHA 3KCOA 5FY9A 3P5ZA 4MG4A 4PZVA 3QY7A 1DG6A 1CZVA 5KWRA 1K6WA 3LZ5A 3SC7X 4QLLA 2OGJA 1LR5A 5B7YA 2GL5A 4AG0A 1XC6A 1H2MA 3H50A 1XXNA 3K3OA 3URBA 4ZB2A 2CWXA 2DPEA 1E0VA 4OLLA 4G8TA 3WIJA 1RUI2 1QJY1 3N9QA 2VURA 5A5WA 5HDRA 4NPRA 2D0FA 2X40A 3VU2A 4BI7A 2V82A 2VH9A 5CAZA 3DXIA 2VKZG 3Q2DA 3R2GA 4BK9A 5EJZB 4V1YA 2QQ6A 3NXLA 3OOXA 1PSCA 1NARA 4RPQA 4ZOBA 3ZLFA 4CN4A 4A7ZA 3FAWA 2X2YA 4X6QB 5TBOA 1GU3A 4XFHA 4TV6A 2HNEA 2H6BA 2WNVA 1YDYA 5RUBA 4BF5A 5BNKA 4XD5A 4CP2A 5C4WB 1PVC2 2DF7A 5FP7A 1W28A 1E9LA 2YZ4A 5C6MA 3JD71 1RR2A 2Y7EA 1OUXA 4EF9A 1EO7A 3LPGA 1QKQA 4CDQB 4S3AA 4LF1A 1AR63 2KXLA 3TN5A 3VD7A 3MV01 4ZQOA 1K6AA 4JFWA 1LUCA 2DP3A 1V6WA 1UJQA 1UZ4A 3M44A 2ZICA 4C0BA 3B8SA 1EIXA 1AD1A 3JB4C 1QK2A 2Y60A 3VHNA 1ECQA 3ZSMA 1MW2A 1K5MC 4IESA 1URXA 3U3HA 3AXHA 1KFUL 4EWDA 4CEWC 4TIMA 3DKLA 3UWWA 1D3CA 1NFBA 3H55A 3LCHA 4L9XA 4XEZA 1RUE3 1RVGA 3TZNA 1G67A 3TN4A 4LW7A 4I0BA 4LB3A 1UZHA 4MSVA 2IWGB 2QJGA 4ICMA 3CF6E 3FSTA 4AWUA 2E8ZA 3FWEA 1D0GA 3POSA 2QULA 4IEXA 1V3JA 3LCXA 3DFSA 4U2YA 1J5SA 3U57A 4BWLA 1SSGA 3P61A 2QCDA 3TC6A 4ZS2A 1TPB1 2J7CA 3VOJA 4AVCA 3NQEA 2OKTA 2J7FA 3SSJA 2E1WA 4OJYA 1QNYA 3TTYA 2AOSA 3BCJA 5ANQA 3LGDA 3OQ8A 1FOD1 2RV9A 3T1GA 2Y8KA 1UWWA 1AVBA 2WWSA 4B4FA 2QT3A 5A6MA 1LUCB 2IXJA 4ATEA 3ZYZA 3SCUA 1GNZA 2F17A 1TPFA 3GG7A 1JR1A 5IUQA 1Y43B 3DKQA 4S2CA 5HNNA 2REQA 3KBNA 1BVZA 3FE5A 1QWRA 5BWAA 5KINA 1V0LA 4RW5A 2J4GA 3GHRA 4PCSA 1Y9GA 1GQPA 4F0RA 1F35A 3VNKA 1M06G 3P14A 1UR2A 1MPXA 5LHEA 1QI0A 1OGGA 3B40A 3PWAA 2C16A 1ODUA 2A73B 4K2SA 1F7BA 3F2DA 4XB3A 2VOXA 1PDYA 5GZGA 3G7DA 4E0CA 5CKMA 3Q4DA 4FOUA 4M3PA 2C1IA 3RZJA 2FHFA 2XQRA 3VUOA 4F2TA 4OOZA 4XQ6A 3IJLA 1KM2A 5DRCA 2XFWA 3LV6A 3PTKA 2VXRA 4MNKA 3K2GA 5I07A 2ZTKA 2JG9A 5HMFA 3U10A 3CXOA 4AEDC 2PD9A 1MVEA 3VDHA 3PP7A 1ZL1A 3ITOA 1SMDA 2WOQA 1TX0A 5FV3A 4K8FA 1TB3A 2GK1B 1OURA 3AM2A 4R9AA 2X09A 1JYVA 2EPNA 5AC6A 3AMCA 2D6LX 3F2ZA 4UIOA 4G1KA 3KDNA 1M6JA 3IJIA 4YZ5A 1TPEA 4MZ1A 2W46A 1UKGA 2UWCA 1HV0A 2WQ8A 3N2OA 5CQ1A 1J0IA 1F3TA 5HBFA 4GB32 1A3HA 4X0NA 3E97A 5CKNA 2H9AB 1KLYA 3MDUA 3PHMA 2DVBA 2PTZA 2FTWA 3TDFA 2X16A 3VINA 4AQTA 2DJXA 1FWEC 1GVIA 3DG3A 2BFUS 3L5AA 4O14A 3S47A 5DABA 1EDTA 1U5JA 3AS0A 3GYEA 3WLIA 4ARXA 1E9IA 4GGBA 4JCLA 2V5CA 3IK2A 2D73A 5CJ5A 1PZ1A 4GY7A 3KEHA 2ZEZA 2Z2AA 1MFUA 5FREA 1LL6A 3E2SA 1GVYA 2ZC1A 3G6LA 1W32A 1S5VA 4BKNA 1BEUA 4RD7A 3LB9A 2PBOA 1XBYA 1RJ7A 2VZTA 1VBB2 1LORA 1TA3A 3N9OA 4N43B 3N14A 3UG5A 2EPMX 1W8NA 4LYPA 4QXKA 3I7RA 4UBPC 1OC6A 1YQ5A 4IE4A 3KS5A 4HU8A 1CAXB 1E0UA 1SJDA 2OQ6A 2WABA 5KC6A 3CIWA 2WVTA 4ONUA 1OF6A 3GBDA 1X96A 2KZHA 2WT0A 5HUOA 4ZZ5A 3LN3A 4QP0A 1A4LA 3ZFFC 2PI6A 4RL3A 5CGMA 4M82A 1AL0G 2EXIA 4XZHA 1OKOA 2XBO1 2VX4A 5AHFA 5A32A 4YHEA 3LD8A 4JFTA 4Q4X2 2WNOA 5I3GA 1W5MA 2XJQA 3IT8A 3N6JA 4QKDA 3BZJA 4XZNX 2HWC3 4FQZA 2WB5A 3I3BA 1J3QA 4QG6A 3W7KA 3SLIA 1Q7MA 1K5JA 5BPXA 1TPWA 1DV7A 3QKEA 1J58A 3UKNA 3OJGA 1E3XA 4NAEB 4Y9NA 1A78A 2R062 5CZSA 1UOKA 1E70M 2JDNA 3E0IA 5KTLA 3VIOA 3GG1A 1R082 2WWUA 3NNGA 1RMU1 3MKCA 4LKSA 1WOBA 4GZIA 5LATA 2P6HA 4JY8A 3M3IA 5D9NA 2CDPA 1L0PA 1MRQA 1Y5XA 3JUGA 1TV2A 1BBT3 3MLLA 2YXXA 2YCLA 3OO2A 3ACLA 3WLKX 5JXJA 1RA0A 4E3TA 3NDZA 1LT8A 4H9XA 1COV2 2JJ6A 3GIYA 3JU9A 2CV6A 4B5SA 1EAH2 4GKTA 1DJNA 4GIEA 2BLEA 1RB8G 3TEWA 1E6NA 4NZCA 3P0XA 1LNSA 3W7RA 1DXFA 3D3FA 3IJ9A 3CLPA 1AH4A 5FYUA 5LCWL 4N53C 3BN6A 1WAUA 3T1MA 3VDDB 4ZGYA 1FCBA 4AVAA 3T0AA 1D7KA 5FJOA 2OJPA 2CYGA 3U2CA 1BLIA 1YX1A 3TSDA 3MDWA 1EEXA 1GONA 3KT1A 1QDSA 2PLJA 1EZWA 1XDJA 4LITA 4PUDA 5T5LA 4R85A 2XM1A 3BE7A 4HVXA 1QPRA 2ZZ2A 5K9CA 3QPYA 2J9ZA 3TROA 3OG2A 1U1UA 4LB4A 3APGA 3R6IA 4FR1A 2HWB2 1HW5A 2QDDA 1XE7A 2GJXB 1UR1A 3L7RA 4KT2A 4ZFMA 3R58A 1EXPA 3USUA 1R093 1W8HA 1MZEA 1WCSA 4I3GA 4TMBA 4C6DA 5BYWA 1RUE1 2A70A 3W70A 2R14A 1PPIA 5E5CA 4N9IA 4HBKA 4Q4V1 1PK6B 1JVNA 1C93A 4D6IA 1F8IA 3P1IA 4RFRB 1W9VA 1XGZA 4FBFA 2CAUA 4Q8MA 4NAFA 2V73A 1DHKB 2F4LA 3GNRA 2XZ7A 5JQ9A 3LHWA 1HG3A 1EXBA 4D8LA 3J7LA 4PUNA 4Z2LA 1LENA 2OVUA 4JYEA 4ZXKA 1EDQA 1QNSA 3W6YA 2VUYA 4Q4OA 1GP5A 3OODA 1BWKA 2XMLA 3LXBA 4OZOA 1T99A 5CNAA 5GZFA 2OT7A 4D6FA 4UFMA 1DJQA 5LBEA 3BW4A 5CJMA 4JTIA 3EOEA 2BWGA 1O4YA 2EG7A 1MSSA 1HRI3 3MBDA 5MF5A 1F31A 5SWUA 3ZJ7A 2WBKA 1K4HA 1RZMA 3L65A 3KXQA 5K0UA 3RPDA 2FZ9A 4NHLA 4PQ9A 3BSHA 2PAKA 3CT2A 4HQVA 4ZZ9A 5F6LB 1CGUA 1M4WA 1CGXA 1GZ1A 5F1VA 3CHCA 1EHNA 4CCDA 1QDCA 4Q8PA 3N1AA 3N7MA 4AQSA 4Y96A 5HXMA 2IPWA 1ZPTA 1AD4A 3NGJA 5DN2A 3GKAA 2E5DA 2IXCA 4AIOA 1XQNA 4JGDA 3ARUA 4MOZA 5A1FA 1VBE3 3TC7A 3CZKA 2C9KA 4UOZA 5FY8A 1ULDA 3OEXA 4COUA 1A5UA 1XLAA 4OHVA 1SEFA 5A7NA 3V4BA 1NT0A 4UMCA 1SR0A 3UCCA 1XNDA 5IK7A 3W87A 1POJA 5FO9B 4QQHA 1ZENA 4XZPA 2Z26A 3P74A 4S2GA 4S3BA 2DT0A 7TAAA 3I10A 1OD0A 1R3SA 2XN0A 1GNHA 4BMEA 1E56A 2WL1A 3I6EA 4DYJA 2J27A 3LX9A 3QFWA 4DJDC 3ZXJA 1HIZA 2WPBA 1YJLA 3ZYHA 2EPHA 2IXLA 3BK0A 2CLPA 3O0KA 1DTUA 1RUH3 1AYM1 4LHKA 1PNFA 1CJDA 2P3EA 3HG3A 5GLVA 4M51A 1O3RA 3SY1A 5I3IA 3WNNA 2WCSA 3UXIA 4D6QA 2GC1A 1MYRA 4Q7NA 4FP3A 3W58A 4ZMGA 3GD6A 1LRNA 2KA3A 2EBNA 2H3DA 4MB4A 1TZ7A 2VX5A 2J1EA 3DUIA 4LBQB 5HJXA 1J18A 4AMAA 1PZ2A 1V03A 5DUVA 3THPA 3K1GA 4LOCA 5K9XA 3MUXA 3OEAA 1HJVA 2D6MA 4Y8FA 4NT0A 4AVBA 3T07A 3GXPA 2VBDA 4L80A 1WW5A 3MI3A 5H2ZA 1AQHA 3MLKA 2XQXA 2VX6A 5F2GA 1L8NA 2QQKA 1Z89A 5AFDA 1H60A 3PVNA 2W91A 1YYAA 3GNPA 2CLHA 4AE2A 2UY5A 4EWEA 2BPA2 2E63A 3EJKA 4GXMA 2R073 1JOJA 4XWUA