4BQ3A

Structural analysis of an exo-beta-agarase
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
747
structure length
740
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLENDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 253
structure length 740
sequence length 747
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq3A02
1JZ2A 4JHZA 5A2CA 4UTFA 4TX6A 4CVUA 3A3HA 3FNDA 4PMZA 3WF0A 7A3HA 5E0CA 4YWAA 1E43A 3THCA 2VQUA 1U2YA 3CUGA 3IJ8A 2J7CA 5I79A 3VMPA 3VX1A 1BAGA 1E4MM 3VMOA 1EXPA 3L4YA 3ECQA 4W84A 4ATWA 4K68A 4XUYA 4U2ZA 1ZBVA 1SFSA 2F2HA 2PWFA 1JI2A 4MB3A 1CTNA 2GSJA 2WPGA 2WMIB 2WZHA 4WKHA 3QHMA 3W81A 3AS0A 3W6MA 2XYLA 3M46A 3WUEA 1H11A 1OWQA 3THDA 2OSXA 3VIGA 1HN0A 2J47A 2QMJA 5IFTA 2PWEA 5A6SA 1UZ1A 1Q6FA 5A6MA 3F5KA 2IUZA 5AC5A 2VCAA 4KRTA 4AZIA 3PBGA 1HX0A 4MJ4A 1JZ7A 1HKJA 1QNPA 2YJQA 2ZUVA 3VM7A 2BNJA 1KWGA 3CLWA 3M07A 1H2JA 1GOKA 2VRQA 4TVUA 1UWQA 3LPGA 4EKJA 5M03A 1FA2A 4CCEA 2LROA 3I3DA 2XFFA 4PTWA 3WIJA 3VNZA 2A3EA 2G3NA 4AMCA 1GOMA 4W93A 1QHOA 1C91A 5A6AA 2EPOA 2CEQA 3AHXA 5AY7A 1JYNA 3IJ7A 3GBEA 4MNJA 3NSXA 1BFNA 3I3BA 4JFTA 1W9BM 2D24A 5IHSA 3EYPA 3A6OA 4OZOA 4PCSA 2JEPA 5C8BB 3KWXA 1E0WA 2XUCA 1WDSA 3ALFA 3T2PA 3VUPA 5A6KA 2G4FA 2YBUA 2ZXQA 1ISVA 3DHUA 5ABHA 3N1AA 1IT0A 2WMFA 5FL0A 4GQQA 2WVVA 1B3XA 1CXKA 1BG4A 1XYFA 1EQCA 1D3CA 2WHLA 3L2MA 3MMDA 3FAWA 1CNVA 3ARZA 6CGTA 3BH4A 4N42A 1AQHA 5E0FA 2ZE0A 2LRPA 1ISWA 1G5AA 1NH6A 2W4XA 3SCQA 1UKQA 3OGRA 1MW1A 2Y2WA 4UQ9A 3W24A 4IUGA 1XC6A 1HL9A 1DWHM 1C7SA 2NT1A 4BF7A 2DSKA 3PZOA 1BYBA 5HPOA 3NSNA 1CXIA 1WAWA 1CXLA 4V2XA 3ORJA 4W87A 3CUJA 1HF6A 2BFGA 5FIPA 1M04A 1XCXA 3VOCA 2QPUA 1UG6A 2DPEA 4HA4A 3MUIA 4QFUA 3AQUA 3RM8A 2W67A 1JNDA 3AIEA 1HT6A 4UOJA 1CYGA 3PTKA 4KWUA 2B31A 3NDZA 1TFVA 3QHNA 3AS2A 4EK7A 1VAHA 4ACZB 4HA3A 2V38A 3U7VA 1I1WA 3BCDA 2GDUA 3RCNA 4ATLA 5AC4A 5A2AA 4RE2A 2VCBA 3CIVA 4W7VA 1KCKA 3SURA 1LWJA 4MDPA 1VBRA 1V3KA 3UERA 1QPKA 5CXPA 3F95A 3WDHA 4D1IA 1JYVA 2C24A 1W2VA 1TA3A 2V3EA 1W9PA 2VC9A 2XGIA 1HVXA 1QI5A 3UETA 2CITA 4FLRA 3WDPP 1WZKA 4DWSC 5GPRA 2CCRA 2OSYA 5IHRA 1AMYA 1V08A 2YIHA 4IPNB 1E72M 1KBKA 1KGWA 4Z2JA 3DC0A 2JF6A 4ZXLA 1V3LA 4PSPA 4LYQA 2EXOA 4CU6A 2CHOA 5BRQA 1V02E 3MMWA 3WY1A 4HOXA 2BY2A 3W25A 2WK2A 2UWFA 1U30A 4R5EA 3TP4A 4UFIA 5JBEA 2JF7A 3W4RA 4W86A 4TUFA 3WSUA 5A8PA 4UFJA 3T0AA 3U57A 2WWCA 1V0KA 2J8GA 1K9TA 1JF5A 1WO2A 5IXEA 4QLJA 3IJ9A 1GOQA 2VZUA 2GDVA 1RP8A 4D6HA 2WSKA 2A3AA 3AIWA 3M6DA 5FCZA 2GFTA 4D6JA 3AYRA 4M24A 2VCCA 3NCOA 2QV4A 1JAKA 4H04A 4U31A 5A3HA 3K8MA 3SCOA 3WEZA 2CESA 3DYMA 2CBUA 3L2LA 2ZXBA 2FHCA 3WF2A 5JUVA 5LA2A 3MS8A 3ARSA 3VMNA 1UR4A 1H49A 5ABGA 2YA2A 4GQRA 1WZAA 3DHPA 1EHNA 5CGTA 1NOUA 1W9XA 4D6IA 4D6GA 1CLXA 4RL3A 1HVQA 4BQ5A 3AXHA 3SIMA 3LPOA 4F66A 1QI4A 1MFUA 3GH7A 3A4XA 2WKGA 5HBFA 1IZJA 4Z2GA 2BVDA 3VTRA 1MW2A 4EAMA 3VO0A 2J7HA 1JZ5A 1DHKA 2VZOA 2XVLA 2GJRA 4AZBA 2DSVA 1UR1A 3W6LA 2EPKX 1G0CA 2CBVA 4TXEA 2ZICA 5A2BA 1VBUA 4QLLA 4PMRA 1QVBA 1W9UA 3DYOA 1WNOA 1L7LA 3KL0A 3MUY1 2EO7A 3SCPA 3GXMA 3N13A 1KCLA 3EMZA 4RE4A 1R8LA 5BCAA 2J78A 4AD1A 2WVUA 3FHAA 3UG5A 2WC3A 3OBAA 5E6ZA 1GW1A 2ZUUA 1GQJA 1E15A 1XGZA 5E6YA 2GVYA 2WCAA 4U5IA 4HOZA 1US3A 3RIKA 4AD5A 1SMDA 1KQZA 1WCUA 1EA9C 2VQTA 2W5FA 2UY5A 1US2A 4LXFA 1E5JA 1CZ1A 1ZB5A 3O2LA 3WKZA 4DUXA 5D9PA 2J77A 1JDDA 1UD2A 1J18A 1E6RA 1HXJA 4PN2A 2J4GA 3ZJ6A 3EDKA 4AIUA 4U3AA 4WIWA 1Y7VA 1EIBA 3VD3A 5KZ6A 3W53A 4LGXA 2W92A 1UH2A 4UQCA 3WD4A 4QLKA 3PHAA 3PZUA 2WZIA 1HL8A 1QHZA 2A3HA 2VUYA 3ARUA 1V6XA 1UA3A 3CPUA 3CZGA 5M3WA 2CIPA 1RP9A 4M56A 2XWDA 4JIEA 4CPBA 2J7DA 4PSRA 4J27A 2XG9A 3U5YA 3AXIA 4H2CA 3S2CA 3WF4A 1V6UA 4U5KA 2W61A 4AIOA 3GDBA 3VD9A 1CLVA 3EDDA 4H8HA 1W1TA 2EPNA 4HZ6A 1NP2A 4CUCA 1ZBKA 4U33A 2WXDM 3B9DA 2CERA 1CGXA 1SMAA 4PUDA 4PTVA 3AIQA 3ZYHA 1UYQA 1CXFA 1LG2A 3CUHA 4U2YA 1XD0A 2EEXA 1TUXA 2PBGA 5HXMA 4DM2A 4Q22A 4B16A 1MQPA 1A3HA 1QI2A 4LKEA 5LYRA 4QDMA 3TONA 1CGYA 1E1FA 3BSHA 1OGGA 5BXRA 1NQ6A 3CO4A 1PPIA 5IDIA 4LYRA 2Q8XA 3FN9A 4GO9A 4XX6A 1VRXA 3GXDA 1QOXA 1UR2A 3ZO9A 4HMEA 2J79A 4B9YA 1W1PA 4CPBD 1GCYA 3PTQA 2BS9A 4Z2HA 3N9KA 1VENA 1J12A 4M80A 2DT1A 2X05A 1LL7A 3ZJKA 1V03A 2CXGA 1UD3A 4JKKA 4E8DA 2YL6A 3VIPA 3VDBA 2VOTA 2BXZA 3ZT5A 1OT1A 4TVDA 1W9FA 2VZTA 1QW9A 3D5HA 5A8NA 3VPLA 4GI9A 1R7OA 1PX4A 3EDEA 2WMIA 5A8QA 2AAAA 4TTGA 5BWFA 3VILA 1BHGA 3ZSTA 6A3HA 2ESCA 4Z2LA 5I6SA 3PTMA 1X1NA 2FDMA 2V3GA 1KXVA 1UH3A 1JZ8A 4J28A 3ARRA 1OGSA 2BY3A 4ZXOA 4B3LA 1CGUA 1QI3A 1VEPA 5CJ5A 3HJEA 3WN6A 2G3IA 1PIFA 4GIAA 1K6AA 2E0PA 2CBJA 2VZVA 3UR7A 3AOFA 3OGSA 1CXEA 4WKAA 4UOQA 5A8MA 3VX0A 1I75A 2C8NA 4ZE5A 3VIOA 2AMGA 4J3VA 1E6SM 2Z1SA 2Q1FA 4S3KA 1DWGM 2VR4A 1B1YA 1DP0A 3RJXA 2WM0A 1PZ2A 3CGTA 2WC4A 3BMVA 4HMDA 4XB3A 4CN6A 2XFRA 4W8LA 1SYTA 3VKKA 4UFLA 2JFEX 1I1XA 4GZJA 2VMFA 3TTSA 1BLIA 2O9OA 3ARXA 4OBSA 3HN3A 4UQAA 4NRSA 3WEOA 3WF3A 3HU7A 5E70A 4HZ7A 1NWSA 2QHAA 4TOQA 3UG3A 1KGUA 2EJ1A 1C3FA 1UD5A 4CU7A 3POHA 3MUAA 1BVNP 3W37A 2G8ZA 1UQZA 2WVSA 3E1F1 3WMSA 1QBBA 4OBRA 4PTMA 1J0IA 1S46A 1TG7A 1B2YA 1XRVA 4BQ3A 2VTFA 1H4PA 4X0VA 3WDIA 2O9TA 4W85A 4OOUA 1E1EA 3ARWA 1RH9A 2WVVB 1QNOA 3AS1A 2D1ZA 4CD6A 4UQEA 4AZHA 4PMOA 2G41A 2F61A 4AIEA 2PF0A 1V3JA 1VB9A 1L0PA 2BVYA 2DGAA 2E9LA 4URIA 5DF0A 2AOSA 3EBVA 3W29A 2X09A 1UKPA 1HJVA 3BCFA 5TD4A 4WJXA 4A3YA 2FHFA 2WCGA 4P8UA 2CKRA 1E6ZA 2D0FA 3VIHA 1E4IA 3ZMRA 1SR0A 9CGTA 2JEQA 1TVPA 5FD0A 4D1JA 4FLSA 1OSEA 3L4ZA 1LLOA 1UD8A 2E8ZA 4D6EA 4ZFMA 2WAGA 5JBDA 1HN1A 1R7AA 2DH3A 2VVNA 2NW0A 3A47A 1Q6GA 2GUYA 1JAEA 1QW8A 2DDXA 2XHYA 1PJ9A 2UY4A 1V0MA 3SCRA 1GQLA 5ECUA 1EO5A 1JI1A 4MNMA 1R86A 2J62A 5HPCA 3IANA 1C8QA 2J8FA 1HJQA 1FP8A 1C93A 1L8NA 1LF1A 1E0XA 3AIUA 1H3GA 3SCSA 3ZT6A 3WEMA 3AHZA 4LJHA 2X1IA 1K9FA 4HPGA 4P7LA 2YA1A 1W8TA 2ZX6A 1OM0A 1F4AA 3HMCA 1JDAA 3WQWA 3L4TA 3AMLA 1E71M 1UKSA 3AIBA 1MYRA 2BXYA 4OJYA 2VVSA 4X9YA 4CD8A 2K46A 3T2OA 5EBAA 1M53A 4DWSB 1GOWA 2BHUA 3BAXA 2UY2A 4CU8A 3WD3A 1BGGA 3ZYFA 1JXJA 2YA0A 1GOOA 1LQ0A 1JFHA 4AC1X 1EOMA 1LL4A 3GH4A 3AIRA 5IFPA 4QCFA 3RMEA 2O14A 4UOZA 3ARTA 1KXTA 1W3KA 3S6TA 4XZBA 2D0HA 3WQ5A 1J9YA 2WYSA 1F4HA 4PMUA 4Z2KA 4AXNA 3SCWA 3WL1A 2V5DA 3D3AA 1CPUA 5A6JA 2PWDA 1B31A 1CENA 5ABFB 4P8VA 3RM4A 4CD5A 5I0DA 3MO4A 3CHDA 2ZX8A 4UNIA 2MANA 2ZXDA 3N11A 3NUKA 1E3XA 4MNKA 1V6VA 4D6FA 5FKYA 1H0IA 3ZR6A 2ZUWA 3N12A 4PMVA 3WH9A 2WBGA 2ZXAA 1PAMA 1HJWA 1PZ3A 1ITCA 3VD5A 3AMGA 3BXWA 4OOZA 3SCTA 4MJ2A 1ITXA 3WBAA 1MVYA 1MXGA 3WNPA 4GPNA 1OD0A 1AQ0A 1V3HA 3KZSA 4N0RA 2F8QA 1E3ZA 1W8WA 3B8SA 3AHYA 4QP0A 3WUBA 2D2OA 3BC9A 1EDGA 5I24A 3RO8A 3PZ9A 2VX7A 1JZ3A 4U3CA 1GOIA 3GYCA 4W7UA 2ZX5A 4UR9A 1H0GA 4GI8A 1JD7A 2IXUA 3BAJA 2GK1A 3POCA 3I3EA 3UCQA 2VNCA 1UR0A 2ZUSA 1VEOA 5GNXA 1H09A 5A6LA 3OLEA 4W8AA 2JIEA 4YW6A 4AZCB 3L4VA 3K46A 1EH9A 1KXHA 1JGIA 3NDYA 1TCMA 1GUVA 3APGA 4X0NA 2OYMA 1KGXA 1ODZA 5A8OA 2PC8A 1XSJA 2E9MA 1GWLA 1HKMA 4F9DA 3WD2A 4BZYA 3L4XA 3MV01 3K4AA 1HKKA 1OIMA 3BAIA 1O6IA 2EPLX 2DQXA 4WKFA 3WQVA 4HPHA 3UG4A 4MAZA 3MSGA 3ZM8A 1HP4A 3TTYA 4KMQA 3ZR5A 3VINA 1W2PA 1OD8A 2VT0A 4TTUA 1VFOA 1O7AA 2Y8KA 2Y24A 1GWMA 4FK9A 2WNWA 1UA7A 3GTNA 2UY3A 1EOKA 4OKDA 3ZT7A 1FFRA 1ISYA 2WYFA 1BYCA 3OG2A 1UR9A 2G3MA 4W8BA 5CPTA 4P8WA 4DWSA 4BQ2A 2GJPA 2J7FA 7CGTA 3WMCA 2X2YA 1W1YA 5EB8A 5EFDA 3GZAA 1IV8A 4W5ZA 3MKKA 4GXPA 5HDRA 4Q7NA 5I3DA 1PIGA 4JAWA 1WDRA 2WANA 2QPSA 1W90A 4P7QA 2WBKA 3TTQA 3ZSSA 2WMJA 3B9AA 1EQPA 3DECA 5CQ1A 3T0DA 1W3HA 4CKQA 4NZCA 3OLGA 1KR1A 4AL9A 2D3NA 4JKLA 2GJXA 2BHZA 1ZBWA 1VFMA 1K9EA 1WPCA 4PMXA 2VI0A 3OA5A 3LPFA 3BAWA 3N18A 4ACYA 1YHTA 2NT0A 2E4TA 4AZCA 5GNYA 1B3YA 5DT5A 3RILA 1GNXA 1WCGA 2WMHA 3WUFA 1G9HA 5CZKA 3ZYBA 1Q6CA 1VIWA 4J3SA 3CZLA 1CGTA 1UHVA 5D4YA 5DEZA 5A69A 3EMCA 2WHJA 1CDGA 2Y4SA 1H41A 3BMWA 2W62A 2W91A 3SUTA 2O92A 1EDTA 1UD4A 2WWDA 3MMUA 1CIUA 4PRWA 3VGHA 3VU2A 2A3BA 4FLQA 3O6AA 2WHMA 5E9AA 4Z2IA 3KL5A 4MAVA 3VIFA 5GQBA 1JF6A 3T08A 4CP9A 3WNNA 5GNZA 3TA9A 1ZJBA 1XV8A 1DTUA 2WVTA 3WL0A 5A94A 3RPMA 3VIMA 2OWXA 1V0LA 5AYBA 1JNEA 4AW7A 2VL4A 2WC7A 5I78A 5E09A 1H5VA 3WQ8A 4PMYA 1M7XA 1C8YA 3ARVA 4JFWA 4KGJA 1E6XM 1W3JA 1JZ4A 2E40A 1JDCA 3GXFA 3VIKA 3G6LA 4TVCA 4QAWA 3WMBA 4PYSA 5DMYA 1UQYA 2XJ7A 1X6NA 3T2QA 2J75A 1DWIM 3WD1A 2CHNA 4WSJA 1G94A 2VRJA 1D2KA 4UZSA 1MXDA 3K8LA 3MV11 3SUSA 3WBEA 3CMGA 4KRUA 4YHGA 3LPPA 3WQ6A 3U5UA 3ZQ9A 1FHDA 1V6WA 1J0HA 2EPMX 3CHEA 1ODUA 5D8ZA 1R85A 3PZVA 2ZWYA 3T0BA 1V6YA 3VD4A 5D9NA 1QBAA 1XSIA 3AISA 1VJSA 1MW0A 3ARQA 3CTTA 1C90A 2VX5A 1GVYA 1HJSA 5BYWA 3N15A 5I77A 3FXYA 4V27A 3W82A 2JWPA 1C7TA 3B9EA 1HKIA 3BLKA 3WQ4A 5FOOA 1XYZA 1DWAM 1ZU8A 4PTXA 4AZ5A 1GPFA 3AZTA 3MU7A 4CCCA 2Z1KA 5KEZA 1UH4A 1RD6A 2ZX9A 5M17A 5ABFA 4UCFA 3W0KA 2E9BA 2FH6A 2OWCA 2GJXB 4P7NA 4FMVA 5M5DA 1BF2A 3FAXA 2WCSA 1DWJM 1UZ4A 3OIHA 4WK9A 2PWGA 3FW6A 1BQCA 4MADA 2PB1A 1JFXA 1LWHA 1VF8A 1JYWA 2YOCA 3MANA 4AEEA 4CVWA 3VDHA 4M29A 3QR3A 2XPKA 1AQMA 3PN8A 4J7RA 5EMYA 4CN4A 1TA3B 1WZXA 2IXVA 1LL6A 1UUQA 4HTYA 3UEQA 5LA0A 3GH5A 4A3HA 1JD9A 5A95A 2X0HA 2YL5A 1JL8A 2ZUNA 4ML4A 1GHRA 1N82A 1XSKA 3AXXA 3W38A 1J0JA 4YPJA 3KE0A 3CUIA 3TOPA 1UWSA 3LMYA 1BGAA 4C7GA 3VDCA 3OB8A 1XH2A 3K4DA 4V28A 2WLZA 3PZMA 1G01A 4AEFA 3N04A 3PZGA 3T09A 1JYXA 4C7DA 4UFMA 4ATDA 1GJWA 1NOWA 2C7FA 2XIBA 2FHBA 4BS0A 4YHEA 4IPLA 1EGZA 1KFWA 2W66A 3VD7A 5JIWA 4MB1A 3WF1A 8CGTA 4E4PA 3W28A 3AHTA 4CGTA 4LK6A 4DUWA 4MB5A 3IK2A 3VGBA 1TR1A 1ESWA 1HNYA 2O9PA 4XV0A 4AISA 3F4VA 3WH5A 5CSUA 4PUEA 4R27A 3AJ7A 1UOJA 3F5LA 1QHPA 4TX8A 4UFHA 5D9OA 1UWTA 1E6PA 1BPLB 1PX8A 4IM4A 1C92A 4J3XA 3ZJ7A 4DUVA 3RDKA 3BLPX 1WE5A 3SEPA 4H8UA 4AD3A 3J7HA 1FH7A 2V3DA 1J0ZA 3GXIA 3WH8A 3PZNA 4LK7A 4EE9A 3VM5A 2E8YA 2DT2A 2YLLA 1MQQA 4H41A 3WNLA 4ACZA 4PEEA 1GQIA 1XH1A 3AIVA 3VGFA 1PX3A 4JFSA 3W26A 1BG9A 4AD4A 1W8ZA 1TVNA 2VURA 3WDRA 1VJZA 5F7UA 1GJUA 4HU0A 2DSUA 4D72A 4P7RA 4BQ4A 1WDQA 4PCTA 3G6MA 4WF7A 3AFBA 2PWHA 1ZJAA 4ZEPA 1BYAA 2G3JA 1MWOA 2DH2A 2WMGA 3ZJ8A 4A4AA 1QNQA 2J74A 3WFLA 3NJ3A 5EFFA 4F9JA 3BAYA 1KB3A 1NP0A 2XGBA 1FFQA 1WKYA 1JG9A 4GZIA 3BSGA 4JFVA 2V5CA 2XM2A 3ARPA 1FOBA 3SUWA 1YQ2A 1E9LA 4B9ZA 1QNRA 2YL8A 3TTOA 4LKFA 1HJUA 4AY1A 2V3FA 2ZIDA 1UR8A 2QF8A 3II1A 1QI0A 5BXSA 5ABEA 3AMDA 4LQ1A 3WNKA 4JCMA 4GO8A 2XM1A 3KL3A 3O9NA 5BRPA 4LKDA 2CPUA 1M03A 2KR2A 5CG0A 4AYSA 2XVGA 3NYDA 2CNCA 1E6NA 1GZJA 1E70M 4FF5A 1UD6A 2BY1A 1UKTA 3VGGA 1P6WA 2VXJA 4OIFA 4J3WA 4W88A 1J11A 4C7FA 1Q4NX 1HJXA 4JKMA 1KR0A 1NM9A 2DEPA 3EMQA 5I23A 2D23A 2YBTA 1GORA 3A4WA 5CPSA 2DIJA 1UOKA 2BY0A 2NSXA 4MNLA 2TAAA 3AYSA 3CHFA 5HOSA 4LPCA 1WMXA 4B15A 1PBGA 5D21A 4CD4A 4HOWA 1VFUA 2A3CA 2ZUMA 1V0AA 4DWSD 4MB4A 1XHGA 1KBBA 3CZEA 5D9MA 1UKOA 3K8KA 3CZJA 1W91A 1ISXA 2WSPA 2CYGA 2X0YA 4QCEA 3L4WA 2Y8VA 3SCUA 1R87A 1K9DA 3VGDA 3UR8A 1FH8A 4YW7A 2YL9A 3PZQA 5CGMA 4KH2A 2BVTA 3FY1A 1JXKA 1NWTA 4D6CA 3AMKA 6TAAA 1GHSA 1OB0A 2VR5A 4OUEA 3OGVA 2J7GA 4HZ8A 5A6BD 4GKLA 2FGLA 2J7BA 5DFAA 1TZ7A 1A47A 1UWRA 3F5JA 1RPKA 4J3UA 4L4OA 4Y7EA 3WUGA 3AI0A 4HMCA 3PZIA 1TE1A 3WH7A 1NOFA 4M81A 2VJXA 3GNOA 1E5NA 5CSYA 3QHOA 2XSBA 1OINA 3RJYA 4AD2A 1GWKA 2D0GA 1FP9A 4W7WA 2XSAA 1HIZA 3QOKA 3PZTA 1OKOA 4JZ5A 1W9DM 2XIIA 2YKKA 3OLIA 4PBGA 1H1NA 4JFUA 1W1VA 2VO5A 1W9VA 3AROA 3RM9A 1LG1A 4HA1A 4GINA 4A6SA 2DT3A 3EDFA 3ALGA 1OT2A 2CBIA 3N17A 2OSWA 3WNOA 1CEOA 3WDJA 2XWEA 3CUFA 1TMQA 5LA1A 4W5UA 3AZSA 4KGLA 2OWWA 1OBAA 2FGZA 3CMJA 1DWFM 2D3LA 1ZS2A 1ZL1A 4CN1A 2JIWA 1WZMA 2BHYA 3AMCA 3BGAA 2PI6A 5C71A 2ZOXA 4HP5A 4CP9B 4B3KA 4MTVA 2VZSA 2D22A 1G1YA 1XD1A 3DYPA 3VVGA 4AZ6A 1NWRA 1B30A 1WB0A 4HU8A 4NF7A 2CETA 5JIPA 7TAAA 1KQYA 4S3JA 1CBGA 4D71A 1E6QM 1FH9A 2O9RA 3IAPA 1X6LA 2OLHA 2WB5A 1E0VA 2ZUTA 2WHKA 1W32A 2J25A 4GZEA 2XVPA 1HP5A 1V02A 2E3ZA 2XVKA 3VIIA 2DIEA 1MQRA 4LX4A 2HISA 4H7VA 1B0IA 3ZIZA 4XZWA 2ZX7A 4EANA 4NRRA 2JE8A 2WMKA 1JZ6A 1J10A 5BROA 1BSIA 3VDAA 1CGWA 1E4NA 2BV9A 1MW3A 2VRKA 5DT7A 5BXTA 1ECEA 3WDQA 1KWKA 1BYDA 1V0NA 3AZRA 2QLYA 1VFFA 1PEZA 2ZWZA 1JIBA 5C70A 3K1DA 4WLCA 1B3VA 2WLYA 4YN5A 4AD0A 1CXHA 2WW5A 1U33A 3VNYA 1QNSA 2EBNA 5CPQA 1IZKA 3WNMA 3GBDA 1OGBA 3CZ8A 1XCWA 4W89A 3CHCA 4E2OA 2W63A 5FL1A 1E73M 2DT0A 1J0KA 4JL2A 4UQBA 2Y5EA 4M1RA 5A1AA 4BA0A 1C8XA 3VGEA 3OZPA 1MFVA 2PBOA 5A6BA 8A3HA 4PMNA 3AHVA 1B3ZA 5DO8A 1OH3A 3QOMA 2DSWA 1Z32X 1GQKA 4P8XA 4BCEA 1W8UA 1KXQA 1DEDA 4LYPA 3VIJA 2VX4A 4F8XA 3SUVA 3NIYA 3WH6A 4UQDA 4AWEA 2C0HA 1E40A 4AZ7A 2XTKA 1E4LA 2XFYA 4NSBA 1CWYA 3GM8A 5CLTA 1B9ZA 3JUGA 4AZGA 2WKLA 2YDSA 1CECA 3WELA 4JL1A 1UWIA 2YDQA 2YDRA 3AS3A 1M01A 1LJYA 1VEMA 1EDQA 4RE3A 1WP6A 3W27A 4FLOA 1XH0A 2GK1B 2OYKA 4NI3A 4MPKA 1GONA 3M7SA 4CD7A 1J01A 1WZLA 3MUZ1 3AICA 3UT0A 3ZOAA 1Q6DA 4JCLA 3UESA 2WZEA 3SCVA 4UZUA 4WSKA 1WDPA 3OZOA 2OYLA 4M8UA 2RGLA 5BXPA 3IAQA 2EQDA 1BVZA 2XVNA 2JALA 4ZENA 1EO7A 3CBWA 4DM1A 1OIFA 2J7EA 2RGMA 3WFZA 2VX6A 4JHOA 3QGVA 4MDOA 5I5RA 2YLAA 3GNPA 4IISA 5JBFA 3GNRA 3L4UA 2HVMA 1FHLA 1D7FA 5CLWA 3BAKA 4L4PA 2X8RA 1OCQA 1V3IA 4CCDA 3U7BA 1W3LA 4F79A 1BTCA 3EDJA 1E55A 1Q6EA 4ZE4A 5HNNA 2QMKA 4H8VA 3NSMA 2D20A 5I2UA 1ISZA 1EHAA 1CGVA 2DSZA 1ZBCA 4J3TA 3WENA 1UWUA 5AYIA 1V3MA 4P7OA 4GI6A 1B90A 5D8WA 3SCNA 3SUUA 2CKSA 3MSDA 1E56A 3KEHA 4PMDA 1AVAA 3A4AA 3FHQA 3CH9A 3WD0A 2FH8A 3CZKA 1NWUA 4PMQA 4E8CA 4UFKA 1NARA 4M82A 4D6DA 1B3WA 3ARYA 1J0YA 3OLDA 1GVIA
chains in the Genus database with same CATH superfamily
1XB9A 5FYMA 2OG9A 4XJZA 4UTFA 3IIVA 1XBYA 4LBNA 4CP1A 5FYTA 3AUJA 1NZIA 5L9RA 5K0UB 3DKWA 4AMAA 3CL8A 3S1GA 4UR8A 1JGMA 1P0DA 5E0CA 2RG4A 3C0QA 4I3GA 1U2YA 1N55A 4Z1YA 3VMPA 5I0RA 2XXZA 2JG9A 4M4RA 1E4MM 3NQVA 3ECQA 1H62A 4OI1A 1PIV3 4K37A 4AAJA 1XPGA 3VA8A 1U12A 2WJSA 2F2HA 3GNXA 5GJMA 4XWUA 2PDIA 1SJBA 1TQJA 1OG0A 2WMIB 3K1GA 2GDQA 4NWWA 3ICJA 2IPGA 4H1ZA 1DLCA 2VM8A 3DPRC 1YEYA 2XYLA 3THQA 3TN4A 2PU1A 1OWQA 2VVFA 1HN0A 3USSA 3IM0A 3JRKA 5IFTA 1OQ1A 4LA3A 3G1DA 2G19A 4INFA 2YW4A 1E1CA 5F2LA 3HM7A 3RHGA 3K3NA 5LY2A 2IUZA 1GUIA 5CFDC 4AZIA 1KFBA 2E32A 4WBBA 4ZFCA 2J1EA 3HV8A 3RPQA 3VCRA 4R4XA 2YJQA 4YW1A 3VM7A 1YBQA 3EX2A 5C0QA 3VOFA 3LXAA 2E6FA 4L5ZA 2VMDA 1ICSA 5FMDA 1AJ2A 1GOKA 2PA6A 3V16A 4EKJA 5G05L 4M3CA 2LROA 1X1OA 2C9AA 2F9RA 2A3EA 2WQPA 1GOMA 4DJED 1KFEA 5FAGA 3JBG1 1OFNA 2NXGA 4OHYA 3COTA 5A6AA 1TIWA 2Z2BA 3E2QA 1NEYA 5L9VA 4JTHA 1W6MB 2PCQA 3VKJA 1CZTA 4S1FA 1QWRA 3IJ7A 3GBEA 4MNJA 3NSXA 4B5UA 4M0HA 3D4KA 4YGBA 3BCWA 1R9YA 4A8IA 4QQUA 5FJHA 3NZQA 4RR3C 3I3BA 2NLYA 1JCYA 3VKOA 5C8BB 2PHDA 3H3ZA 1E0WA 2WNVB 5A7WB 5CBLA 3TAOA 3AMMA 4A7YA 2H6RA 2VMEA 4CUAA 2GN3A 3LMZA 2PCEA 3QR1A 5T26A 5ABHA 1B09A 2WMFA 1GKBA 5IWFA 1PGW1 1JDEA 4J1WA 2O56A 1B3XA 1W6QB 3D3FA 4KG8A 2WHLA 3FE5A 4NZ4A 3KGLA 4HKOA 1RBAA 3GNDA 5T55A 3E3HA 1VRBA 4ERIA 4GLEA 5FJIA 3AP6A 1NH6A 2GGGA 3SCQA 1QK0A 3KLSA 1AJOA 2KD7A 1UKQA 1MW1A 5KXDA 3W24A 1UYZA 2Z1XA 5M2FX 4MH0E 3WSOA 1C7SA 2C1IA 2NT1A 4Q8MA 2WJEA 1UY1A 2F7FA 3PZOA 2HEYF 3UJQA 1L6GA 1PKMA 3NSNA 4D8ZA 4D0QA 4D94A 5JAXA 3A12A 4W87A 1YTDA 2OZ3A 3TXZA 4QXIA 4E5TA 3B9OA 1XCXA 5HCHA 3OVQA 5GZFA 3IKWA 4KEMA 2VZQA 2QPUA 4F2TA 3NQMA 1LT7A 3PNUA 4ZONA 4QFUA 5HAOA 1G4EA 4LCSA 3AQUA 3QGKC 1BKZA 2TUNA 1JNDA 2EPHA 3AIEA 4LO4B 1WMDA 4UOJA 1H63A 4XJUA 3FXGA 4KWUA 4CUGA 1VBA1 4PB3A 4IP4A 3Q4DA 1IKQA 3AS2A 4EK7A 1HJGA 3BKZA 3ANYA 2GZWA 1VAHA 4DXRA 4HA3A 3U7VA 1I1WA 2GDUA 3WLUA 4TZDA 2DORA 4RLIA 3KF3A 2ZMLA 4IGQA 1BBT3 1M7OA 2C6SA 5LCWL 2RMU1 2XGXA 5AFBA 1LWJA 4YU1A 4MDPA 2BUKA 1XIIA 5FXXA 2V73A 2OT0A 4W8JA 2HLEA 2FZMA 1RINA 3O7OA 4J9JA 3JU2A 3WDHA 2OZTA 1WV2A 2QZ3A 3A0NA 5REQA 1FHVA 5JPMB 1TA3A 3WBXA 2VC9A 3VBUA 3QTPA 2ZGMA 4HVOA 1QI5A 3IIPA 4E4FA 3WLOA 3JUUA 3U8GA 4S3BA 1SLIA 2HWE2 3UETA 2CLLA 3ZN6A 4RL7A 4FLRA 4IE4A 1F35A 2XJPA 3SQMA 4MLRA 3GHSA 3LNPA 2VC6A 5IHRA 1AMYA 1H1YA 2YIHA 3VLBB 3VN4A 4Z2JA 2JF6A 2SBAA 1V3LA 3MVIA 3QC0A 2B9VA 2XZ7A 3UKVA 2P3EA 5A80A 3BW3A 3TRSB 3MMWA 3CB3A 6XIAA 2V2HA 3W25A 5AB3A 2WK2A 1A5OC 4NQ1A 2BP1A 4R5EA 2GGJA 2R062 2AL1A 3W4RA 4TUFA 3FLPA 2A75A 3K77A 2RVAA 4NIIA 1H60A 1K8CA 3W2LA 1XNKA 1EUNA 5I09A 1AJZA 3ABQA 1TV2A 3LRLA 2YZRA 3HQUA 4DNYA 4KT2A 2D3RA 5IXEA 3CHXA 1NIUA 1XXXA 1J96A 2VZUA 4H2AA 1RMU1 2LS6A 5FCZA 4JGYA 3M6DA 3ZYIB 3JD73 4M24A 4HPJA 1PTDA 3PG9A 3UXIA 3T55A 4FR6A 1QXLA 4H04A 5JXHA 5CNAA 2R32A 2BTMA 2I17A 3SCOA 3WEZA 2ALRA 1FY6A 5DN2A 3L2LA 2ZXBA 4PL2A 4QITA 3ARSA 1TO3A 3O0FA 3DFNA 2ZCWA 2YA2A 1WZAA 1MS9A 4L8QA 2Q0AA 4D6IA 3BGJA 1W17A 1PIIA 2ZZ4A 1CLXA 1KDMA 4CNNA 4XIMA 4BQ5A 2Q3RA 1TME3 3BV4A 1ZAJA 4GWEA 3OG3A 2PRLA 3LPOA 4F66A 1QI4A 3I3QA 2HDJA 2GOUA 2BOEX 4IERA 4IMAA 1DQUA 3TYBA 4DWDA 1JZ5A 3GBGA 3EOSA 3MO7A 3VTRA 4IWWA 4EPEC 5BNNA 4B7KA 4Y22B 4G9SB 1UAIA 4AZBA 3S7EA 5LHEA 1K5JA 2A6YA 3VNKA 1UR1A 3ILRA 5BWAA 3RJ2X 1YRZA 2ARAA 2Z2AA 2ZA1A 3EOOA 4BY3A 5A2BA 5FJUA 2YFUA 4DY1A 4TLFA 4RV8A 1OBNA 3KL0A 4QDRA 3MUY1 2GMPA 3ABXA 3KUMA 1I5PA 1J59A 2XPJA 3EMZA 3QPEA 1R47A 5DG2A 2ISDA 1R8LA 2OZ6A 5BCAA 4ZMGA 1EJVC 4AD1A 3LHZA 2QAFA 3OU8A 2D5HA 2XKOA 1GQJA 1E15A 3BGGA 5E6YA 4AI3A 1T0OA 3LK6A 3DL3A 3B4UA 4AXKA 1E51A 1A5BA 1SMDA 2FCUA 4U4MA 2PPGA 2ILMA 3VV1A 1WCUA 2VQTA 3LTPA 1OQDA 1US2A 1E5JA 1YXWA 4PF1A 1ZB5A 4MZ1A 4DUXA 5C8CA 5HWMA 3H7YA 1V4YA 2VWTA 3VOJA 3POEA 4UI9L 3G1VA 2ZGRA 2WLQA 5A7QA 1NFBA 3QSRA 4PN2A 4NROA 3GNEA 5DLCA 1HL2A 1LORA 4U3AA 1UCXA 4JGZA 1TV8A 3WJSA 4FPHA 2W92A 1UH2A 2Q6ZA 4WOQA 4QLKA 3PHAA 2A3LA 2X8KA 2Z2SB 1BJQA 6REQA 1POJA 1V6XA 3R8HA 3ITXA 2XINA 1RUNA 1UA3A 3CZGA 2A73B 4F3JA 3NQBA 4JIEA 2O0TA 1K4HA 5IVEA 4QDWA 3PK7A 2XG9A 3ZWSA 1RHI1 1RLDA 3T1LA 3GZEA 4KG0A 1AR82 4L4LA 2XISA 4U5KA 2W61A 5TQLA 3L0KA 3GDBA 3VD9A 1AD4A 1FWNA 4NIHA 4H8HA 4M19A 4HQVA 3N6HA 4KQNA 1HW5A 4HZ6A 1D2SA 2HWE1 2VNOA 3B9DA 5BNKA 2CERA 5F2WA 4ZXEA 1Q7ZA 4K6AA 3ENLA 3GDRA 1CGXA 3VBRA 2XZ9A 3O8AA 4JYDA 1XCFA 1WYIA 3AIQA 1UYQA 4YVWC 1EWEA 1MZ5A 4REQB 2QJMA 3WINE 4BLIA 3MI2A 2ADDA 4AR2A 2YCEA 3BLEA 1TUXA 4JNZA 2PBGA 3S0MA 3W7IA 2VTXA 4CEWB 1CAWA 4MXVA 1KTNA 3KCOA 5LYRA 4F2BA 2ZBJA 2ZGLA 1OGGA 1HRV2 1SR9A 3CO4A 1PPIA 5IDIA 3JR2A 3FN9A 1DZQA 1XLFA 2DZPA 2CGNA 1QOXA 2G97A 4JDOA 3M0XA 2E1WA 2J79A 5FUIA 4KKXA 5K4LA 3PTQA 3N9KA 3LDKA 1VENA 2CLIA 1KD7A 2Q8OA 5IYYA 4H19A 4M80A 4QSHA 4L11A 2X05A 4N53B 1DQ1A 4BIFA 2Z28A 3UWVA 2F6XA 5J5DA 1ZBA2 4IW3A 2QQUA 2GQ9A 4V33A 3VABA 4UTMA 3OVRA 1TQXA 4JQ3A 3VNIA 3VDBA 2BXZA 2FCTA 4NMIA 3NQEA 4TVDA 5B80A 1A3XA 3BZJA 5I8TA 5A8NA 3KT1A 3OCPA 3WK3A 1TWZA 3TQ0A 2PELA 1IGOA 2D6LX 3DUGA 5J3UA 5I3FA 3LEPA 1PX4A 5LASA 5FBJA 1CD3G 1NFGA 2WMIA 3PHMA 3GWQA 4KPLA 2XH2A 2O8OA 1RUI1 2ESCA 5EYXA 3PTMA 3S2NA 4DJFC 3S3GA 1B9BA 1AZDA 4QXKA 2JG9B 3MYPA 3BZGA 1BVVA 5EZWA 4Y96A 2CSGA 1KBIA 4RPPA 5K0UA 1OGSA 4ZXOA 5CC6A 4ZOCA 5CJ5A 1FWSA 4UWDA 2G3IA 3PVBB 1S5TA 1TV5A 3WN6A 4YIWA 1KFKA 1XG4A 4WV8A 1X1ZA 3HQPA 2GP5A 2E0PA 4IP5A 3M5YA 1H4HA 5D8AA 4N53C 2BGPA 3NXFA 1YJKA 3VKLA 2Y62A 3E49A 2G9FA 3C86A 2YR1A 4S3DA 3VX0A 4H7ZA 3VIOA 1QHDA 1VHNA 5HWNA 4J3VA 1E6SM 2DZAA 4ZXKA 2CLPA 3HFYA 3IT8A 1DL3A 2XJRA 2Q1FA 1Z7S3 1DWGM 4JX4A 3ZVIA 4N43C 4DBUA 1RV8A 4HTBA 2QS8A 5CFCC 2WC4A 3B8TA 3RRXA 1IQDC 3BMVA 2YCLB 1C5IA 1RUH1 1SYTA 4UFLA 2JFEX 3R0RA 4XF9A 5ERLA 3USZA 3ARXA 1SFLA 4WD0A 3BJSA 3WF3A 2YU2A 4PDWA 4LEJA 1ZVFA 2QHAA 3CEUA 4TOQA 1WA6X 2EJ1A 4YLWA 4EXAA 1S4CA 3DEQA 3MUAA 4LOSA 1X39A 5D02A 1NDYA 5D8AB 3E1F1 4U2AA 3WMSA 1AYN2 3FUOA 3I2FA 1RJ8A 1GWJA 1TG7A 3PMSA 1XRVA 2VKZG 2BGOA 1H4PA 4X0VA 2O9TA 4DZ5A 1OF3A 1HXS1 4FAGA 4EWEA 4O11A 2XMLA 2FDFA 4ZQRA 3HFTA 2WVVB 5L36A 5C4WB 4YG0A 1FVPA 3AS1A 1HQWA 1HTIA 1T7LA 3V18A 4BB3A 2D1ZA 3ZS4A 3GLCA 5FY4A 2BNMA 4ZY9A 3BTXA 4LBQD 1X7FA 1J6PA 2PDLA 3VCCA 3D82A 4NJ4A 4LVGA 3WQEA 1OCJA 4PMOA 2DGAA 1D8CA 3DDMA 2AOSA 3SNMA 1LHUA 5TD4A 4IGOA 1JRBA 1Y7BA 2TMDA 1W3XA 3W1PA 1E0TA 3R4SA 2FHFA 1RR2A 1V6JA 2INFA 1R30A 4CCOA 3R4IA 4XZIA 1SR0A 2CZ5A 5K7JA 1TVPA 5FD0A 4HN1A 1OSEA 4D6EA 4YCOA 1UD8A 1MMFA 2WAGA 4XBNA 4B2DD 1EPVA 4MZYA 1SCRA 4BHPA 4Z07A 4XUOA 4OUSA 4PFHA 1QW8A 2XHYA 2A79A 2OKOA 4W6XA 1GQLA 5A6QA 1C8QA 2ZHNA 1UB3A 2J8FA 2JIJA 1NSJA 1ZGDA 2VECA 4CDQA 4R9OA 1L8NA 1LF1A 1SACA 4DAIA 3GF6A 1FATA 1H3GA 3ZT6A 4L92A 3O5SA 4LJHA 3WOGA 1EAH2 4CCMA 4K7VA 1GICA 4P7LA 5DZEA 2ODOA 1W8TA 2ZX6A 4N9CA 5HJYA 5AZ0A 2GYIA 1IPKA 3L4TA 3AMLA 1E71M 1DDLA 1FDZA 1RUG2 4H9YA 3AIBA 1AR73 2BLEA 2BXYA 2PODA 5C3PA 4X9YA 1R3VA 1AX0A 1O5LA 4RS5A 4LBLA 1M53A 1XWYA 2GVGA 3RZZA 2VDGA 3O1OA 3U2OA 2BHUA 1H2LA 3FLUA 5G1MA 1BGGA 3ZYFA 3LCHA 1R2SA 4XW3A 3C8XA 3RGTA 1BLZA 4OGZA 1UZVA 2WIIB 2XOMA 2NMOA 5LZ6A 5IOBA 2GNMA 4N4QA 1IIGA 5DXYA 2H6BA 2NQLA 4WX2A 2O14A 1GKRA 4IFKB 3A23A 4C8DA 3C7OA 1KXTA 1W3KA 3FDKA 3UA4A 3VB9A 2Q8EA 3CLPA 4XZBA 4KEVA 1LDCA 4G2DA 4N2YA 3HV9A 4ZTYA 4DPPA 4QX5A 1LR5A 4MWAE 3O06A 3D3AA 4HN8A 3WBWA 3JVAA 5F5CA 4F0RA 2WSQA 3ZXWA 1UZ0A 5A6JA 5CFDA 3K2OA 5JOXA 1CENA 4KCTA 3PUGA 1XM3A 4P8VA 1X8CA 3RM4A 4CD5A 4YFWA 3AKTA 3CNYA 1TJ0A 2MANA 4A21A 5I0UA 5GZEA 1HX6A 2ZYFA 2I5IA 4Q0UA 3UFYA 3UL2A 4D6FA 2X10A 4FPFA 5D38A 2VBBA 4PMVA 3GBFA 3CV7A 4W4ZA 2EHHA 1W9YA 4H8NA 2A6LA 4GB31 2V2CA 2WS92 4Y3OA 2C6QA 4FAMA 1T6GC 2PDNA 3E5UA 3PULA 4FXJA 3SCTA 1MXGA 1ZZMA 3N6JA 3F2BA 4A7ZA 4XILA 1OD0A 1R0MA 1V3HA 5AFDA 1ENXA 4LITA 1Q63A 4GH4A 2VUCA 1AYM3 4Q4V3 1X98A 1D4VB 1E3ZA 3B8SA 1G9AA 3GZUC 1HDKA 3BTYA 2JE9A 3MLJA 2ICSA 1GOIA 4URTA 4Q4PA 4ZR8A 5FZAA 3CQJA 2X29A 4CNPA 2ZX5A 4UR9A 1H0GA 4FXSA 1TWIA 2I56A 2ZEYA 4EJRA 3I3EA 3NQ8A 1TZZA 3P8IA 2MEV3 2VMHA 1UR0A 2ZUSA 2GJNA 4QR6A 4GH4B 2VEGA 1YTEA 3JCIA 3KBSA 2JIEA 1H51A 2HYXA 4MGZE 4LBQA 3NQCA 3ZIWA 3CT2A 2O7QA 3BPZA 3K46A 3NNGA 2Y6ZA 1EH9A 1H2KA 1HB3A 3O12A 1GTHA 1VFTA 4AVBA 1K5MC 1KXHA 3H24A 5CISA 3F2DA 1NAEA 1JGIA 1JR1A 3QH7A 3KWSA 3SZ8A 3QW3A 4H9VA 4IUOA 3APGA 5FZ6A 2PE4A 2P50A 4ZSUA 3PY2A 1DQ5A 1TX0A 1V6MA 3ACHA 1QMJA 2O55A 4X0NA 3F4WA 1ODZA 5A8OA 4DEVA 2PC8A 1L7QA 5KXEA 2OIIA 1LQAA 4H6RA 3LBCA 4D8AA 2JDPA 3WD2A 2C3ZA 5DAWA 2Y7EA 1PB0A 2VC5A 3DERA 1XGEA 4ZQNA 4DNHA 2J8TA 4PIZA 5JOYA 3BAIA 4YXGA 2DQXA 5FKCA 4MMWA 5CBJA 1EY2A 1AH4A 3WQVA 3KDNA 3ITGA 3VI2A 5BNOC 1YADA 1VMFA 4B5VA 3ZLIA 4KMQA 3ZR5A 1OD8A 1VBE3 4LS1A 4XFBA 1VFOA 1DBNA 2QTWB 4O61A 5CKNA 4YZ5A 3AYCA 4XTPA 4ORFA 1V7YA 3QKZA 4LBJA 5FPXA 1OUSA 3NV3A 3H8OA 5K7PA 5FY7A 3P84A 3ZT7A 4WGXA 4GACA 3SY8A 2WYFA 3OOQA 3NPWA 3VKBA 3AU2A 2RM23 1OYCA 1RUF1 4IG2B 1UP2A 3OZMA 2F4LA 2BMBA 3GK0A 1RVF1 2DCKA 2FJUB 2GWNA 3IS4A 2KAUC 3K2GA 3W1NA 2CC0A 2EXHA 1ONEA 5EB8A 1F73A 4Y9NA 1QAPA 3QLLA 1EF2A 1W28A 3GG8A 1JDFA 5HDRA 2KXLA 5IVFA 4K38A 4Q7NA 1Z42A 5BXXA 1PIGA 1K70A 2Q1ZB 4GIYA 4GQ0A 3NNLA 5J04A 2YXGA 5A70A 2QPSA 1W90A 2FZ9A 1NDZA 3OHIA 4CP2A 1C28A 1F6PA 2WMJA 1NCQA 1OFBA 4Z1CA 4Z1AA 1I2RA 2WINB 1KKOA 4WR3A 4AL9A 1EEXA 2GJXA 3S7IA 4RZBA 1K9EA 1X36A 1QJFA 5G04L 3IIAA 4K8EA 1MS8A 4MV2A 4Y8EA 1IPJA 5AVAA 4CRQA 1X97A 1B3YA 4Y1YA 5KETA 1IS4A 3IJQA 4JGZB 5E5CA 2WABA 2EIDA 3B0VC 5I3HA 1UHVA 5MKGA 3TEVA 2JICA 4XUNA 5FYCA 4BK5A 2WHJA 1CDGA 3QZEA 3JBG3 1HXS2 1Z78A 3A21A 3RR1A 3H2NA 1EDTA 3OEXA 2WWDA 1RSCA 1CIUA 3UGGA 4C1NB 5F6LB 4LOCA 2A3BA 3ZFFB 4DEQA 3NMBA 1ZRFA 2V9DA 3GYDA 4P5HA 4TSVA 3N73A 3POSA 1JQXA 3QC3A 5LBFA 3IDCB 4Z2IA 3N7MA 3KL5A 4MAVA 3TW7A 3TCSA 3U75A 2Z4FA 3P3PA 2ONEA 1V8EA 4CP9A 3CAWA 1S1AA 5JWPA 3VBHC 1C9DA 4XDQA 1HRV1 1W1A1 1F61A 4GYPC 1XV8A 2WVTA 4Q4Y3 3H70A 3VIMA 5AVNA 2OWXA 3D47A 1X82A 1V70A 2VL4A 3G1FA 1YDOA 2I5GA 3ORWA 5LXEA 1VBGA 3F1QA 3I6TA 3WO8A 1FOD2 4JFWA 2C1FA 1HZYA 1RUOA 3KOZA 3NDOA 3NAPA 5BY5A 2E40A 4YNIA 1ZPTA 1JDCA 1NOVA 4UW3A 2MEV2 4Z1DA 2ZRUA 1FMD1 5C9AA 4MWAC 4HCLA 2DU0A 1EV13 2XWBB 1X6NA 3T2QA 4O1BA 5CH9A 1FNYA 1LYXA 4C1KA 4L65A 4WSJA 2JECA 4BXSV 1JYIA 1D2KA 2I45A 3ZN5A 4GIRA 4KWKA 4FXKB 3MV11 3SUSA 3CMGA 4YHGA 3LPPA 5BUVA 4Q5OA 1GP5A 1FPN2 3SQOA 3J8F3 1AXZA 1FHDA 3DFSA 2H0BA 3CHEA 4YVXA 3WLIA 3UZ5A 1VBB3 5DMMA 3O1VA 3PZVA 1Y9MA 4OVEA 4IV3B 3NWKA 3VD4A 2V0TA 5D9NA 3E0LA 4I6VA 1QBAA 3L0GA 1U83A 3TSBA 3T3YA 4PBOA 1LCLA 1KRAC 3LDBA 1MW0A 4ARYA 3THAA 2HPMA 4S2HA 1C90A 4JTFA 3V0BA 2K9ZA 1FXZA 3U4SA 4DOUA 4YWSA 5BNNC 5F3CA 4RGAA 1K6WA 3G2GA 3W82A 1Q45A 1RJQA 2G4JA 2RJGA 1U22A 4YGCA 3WLLA 1KRCC 5D2AA 9XIMA 1XDMA 4TLGA 4HHPA 1H1IA 4AZ5A 3AZTA 4WVXA 1OA4A 2ZZ1A 2Z1KA 3TOYA 4I8DA 5KEZA 1UH4A 4URAA 5ABFA 2W94A 4OHZA 1IF2A 4NNAA 4UCFA 1RUJ1 3J7NA 2V67A 2P3ZA 4DRRA 2E9BA 3AK0A 1X9TA 5ACA3 3DXIA 3EOUA 3HGJA 1MEIA 1KS5A 1QU0A 2RDUA 4OI4A 4IMGA 1BF2A 2WNNA 1TYGA 3OIHA 2PWGA 3RWNA 1YI9A 3FW6A 3F4NA 5GLWA 1DIDA 1IXPA 4MADA 2PB1A 3QZAA 4I7WA 4XD5A 4ZVJA 4ES9A 3MW2A 2FPTA 3HT1A 4GD0A 2XPKA 4DIQA 3BU0A 4LORA 5I3GA 1ASJ3 3FYOA 4B3ZA 1JCLA 2O4MA 4KWOA 4WVMA 4HXCA 1LL6A 1UUQA 4IH3A 2OPKA 3DIPA 4LEQA 3UZXA 3NQDA 4A3HA 4AVCA 1QOSA 1R3YA 3IUHA 3G1HA 2RJHA 3W00A 1U5VA 2BOIA 3RMJA 3T4CA 5FESA 2A3XA 3CQOA 5DAQA 4AHZA 4ML4A 1CONA 1ZHAA 3W38A 3M0HA 3DCPA 1TCDA 2HVNA 3R58A 3H4GA 4IL2A 5F39A 1WXYA 3AAMA 2PGFA 3RDIA 2V69A 4ERGA 5IVYA 4OHXA 3W7JA 2HWF2 4PLNA 5FP9A 5IVCA 1XH2A 4V28A 2WLZA 1OLQA 3DI0A 4QS5A 4AEFA 4CEYB 1JYXA 3T09A 1UBSA 2XIBA 4ZCWA 1REFA 4BS0A 1VLNA 3A5FA 1KFWA 2QT3A 3MDPA 2VFGA 5LIXX 3WF1A 3CYJA 5F3GA 1MUWA 4M01A 4E4PA 3W28A 1EKOA 4MB5A 3VGBA 4QKFA 4AISA 4YTRA 5CSUA 3F4VA 4HJWA 1OOPA 3AZXA 4CNSA 1UOJA 3F5LA 1QHPA 4TX8A 3UKNA 3KTXA 5KWRA 4FEZA 2YX0A 5D9OA 5FEXA 1DG6A 1R1A2 2MNRA 4G1KA 4PIYA 4IM4A 1CAUA 3ASIA 4GZ9A 1GOGA 2WZR2 4C6KA 3SEPA 3OSDA 3MP5A 4H8UA 4LHNA 1IXNA 1PK6A 5K9CA 1VKFA 5CZSA 3PM6A 4FOJA 3NWRA 3OP2A 1O5XA 1ONXA 1VP5A 2XHNA 1MNSA 1P0BA 2E8YA 5EU9A 4J25A 2YLLA 2VQ0A 3QFWA 4MYEA 4Q4OA 5CSSA 3O3RA 1VBC3 3Q8EA 3E96A 2C0ZA 5C4WA 1P4CA 2IVIB 2XONA 3QLDA 5E9XA 4A7KA 3B8UA 4F7ZA 5BV6A 3VGFA 3BWWA 1K7XA 3HT2A 3QQ0A 2PGRA 2QULA 2VURA 2CLMA 2HRWA 2ES3A 2Y5SA 5F7UA 1KXGA 2WKKA 2DU1A 4HU0A 4AHYA 4XAPA 1AG1O 2DSUA 4P7RA 3T0CA 1SU5A 2QCDA 2VEKA 2H9AB 1QJX1 4WF7A 4BF9A 3AFBA 4IE6A 4QTGA 2R0HA 3TNPB 4XJ9A 5BNNB 1ZJAA 2HTMA 3K51A 1AXKA 4INDA 4WM7A 4BR1A 4IEPA 1BYAA 2J66A 4BH9A 3GW3A 5A1LA 5F5AA 5B7YA 2WMGA 3MJYA 4QJ5B 1JU3A 1QNQA 2BZNA 3NJ3A 1JCJA 5K4ZA 4F9JA 1SZFA 2J1SA 1KB3A 1NP0A 1DJGA 3WP4A 2XGBA 4EN7B 4L9XA 3KGZA 1KFCA 1WKYA 4XUPA 3BSGA 1BEV1 1W06A 3I8TA 3JQWA 4AFAA 2V5CA 1RUJ2 2ET7A 3NVDA 2BFUS 1SGJA 3SUWA 4HETA 1RJ7A 2RS53 2Z6JA 1QNRA 1DHKB 2FCVA 4AY1A 3EBRA 4RW3A 3KLLA 5T8GA 3IGXA 4B4HA 2QF8A 1SO4A 1RUG3 3EX4A 2VR2A 3DU0A 3EEGA 3RX3A 2YYUA 2J9YA 2A70A 1A3WA 3WNKA 1UZZA 1VHCA 3N7JA 2E6DA 1TE1B 2VUNA 3W1QA 4GJJA 3O1UA 4JCMA 2OX0A 1MQTA 4KGQA 4XAGA 2HWF1 3EAUA 4FPJA 1S0IA 3CPGA 1N3QA 2CPUA 3EB7A 2W0XA 1OABA 4AYSA 2EKGA 4LAZA 3NYDA 4K2SA 3SMHA 3UWUA 4K8FA 3JD72 1XIDA 3THUA 3AL5A 1QPNA 1Y9GA 3QV9A 1UW9A 4PA8A 4E6MA 1GSLA 5FXZA 1JOJA 1UKTA 3MT1A 1PO22 3M64A 2Z1VA 2GSEA 1M1BA 3TMLA 4ZA0A 3V1PA 2WC2A 4CDXA 5M0TA 1HJXA 2OJPA 1NM9A 3S1VA 5F2IA 4ES4A 2D23A 3A4WA 1TPH1 2JKAA 3WJXA 3H9AA 1YXDA 1PDZA 1EBGA 3KWVA 4BLJA 1UMLA 4B15A 2DVBA 2MPFA 3KT4A 4CD4A 1H6YA 3C0JA 3RN6A 2A7AA 1HB2A 1V0AA 3B9IA 4LR4A 4AAXA 2JIGA 3EHKA 4DXSA 5F9TA 1QJY3 4MKVA 1S0BA 4OMDA 1CLKA 3APYA 1QJU3 2EF6A 1W91A 3WMLA 5F5QA 4GB33 5C7GA 1BXNA 4FP1A 2WSPA 4QCEA 1VJ2A 1GOFA 2PD5A 2V5JA 2XN2A 2Y8VA 2MUCA 5T54A 3VGDA 3UR8A 3RLGA 1FH8A 1ML1A 1VCVA 5C9UA 3DZ1A 3MIDA 4B4PA 2ZDRA 5K2ZA 3C2VA 3CO8A 5EXOA 2Z79A 3P5BA 4EV0A 4D6CA 4R9AA 3MA8A 4FOYA 2QKDA 4L9BA 4QXCA 3H2AA 4FP2A 1OB0A 1KV5A 4HZ8A 4GKLA 2FGLA 4NHKA 3DGRA 4AVNA 3HWJA 4PULA 3DKJA 3W1TA 2ACRA 4TV6A 2D6OX 4DI9A 3Q9OA 1FV3A 2AZ5A 4YWIA 4FNUA 1RPKA 2ZZQA 2FVKA 1XRFA 4W65A 4HMCA 3PZIA 4Q4Y1 3KHCA 4JQ4A 1QH6A 4LBSA 3W2JA 3WH7A 2E68A 1LZOA 2ISFA 1O4ZA 4C6OA 3G1XA 2QDEA 5FXWA 1E5NA 2XSBA 1DHPA 2RS11 4L6HA 1OINA 2JDZA 3OYWB 2PZNA 2DUQA 1BWVA 4KCUA 4W7WA 4DZGA 1PO13 4HA0A 4OI2A 3QOKA 5HCFA 1OKOA 4NAFB 3N9OA 1GKQA 2XIIA 2YKKA 4GBDA 3DN7A 5I3JA 1LODA 5T3NA 3ABRA 5KXBA 3AROA 3N2XA 1LG1A 4HA1A 2GAUA 3RM9A 2RR13 4D69A 3E6CC 4PCFA 3RX2A 1EWDA 5KC5A 4A6SA 5C5TA 3F4CA 3EDFA 4RPQA 1COV2 1EYWA 3B8DA 2WQZC 3N17A 4CXYA 4WJ8A 1VFSA 3WNOA 3R12A 5KHKA 1UW8A 1CEOA 2PUZA 3O16A 3WDJA 3W02A 5L9FA 5LA1A 2WNOA 3VDDC 4YTTA 2OWWA 2FGZA 3AALA 4QB6A 3CDZB 1FHUA 1VBE2 1ZS2A 2QAPA 3V0TA 1SLTA 4CN1A 2D43A 3AMCA 1F6KA 1H50A 3B00A 3S9IA 2ZOXA 2ATMA 4CQCA 4HP5A 3WDXA 3VZZA 3EEZA 3GD6A 1VIWB 3LSEA 4V15A 2QDDA 1XU2A 4I3PA 4AU0A 2PRMA 3N2OA 3DYPA 1MACA 3VVGA 5FI8A 1MSSA 3C2EA 4WDTA 4R7OA 1QT1A 1O95A 3O6YX 4HU8A 2CETA 1KNWA 5KHJA 1XS2A 2P3YA 3MDWA 3EKZA 3WT3A 2DUPA 2O9RA 3IAPA 2OLHA 2WHKA 1W32A 3U6WA 5FIXA 5FYSA 4QSFA 2HISA 1PM4A 1R092 1J5TA 3HURA 3QJAA 3G0XA 5F6KA 3GZTB 1FKWA 4ISQA 4DXVA 3AVRA 4P00B 2QF7A 4XZWA 3ZIZA 4EANA 1N1TA 1BWLA 1RUD2 2E7TA 4QKDA 1E1CB 2WMKA 2WA4A 5BOOA 3THPA 2V30A 4M3CB 3ZXJA 2WZMA 3O07A 4NE9A 4GAZA 3E0WA 4S3AA 4QB1A 1CGWA 3RRAA 1O3RA 1PMIA 4JTDA 1Q85A 1MW3A 3F4DA 3ZFEC 4Q0SA 4Q4X3 3DKQA 5DT7A 3CWOX 1FWEC 1IG0A 1D9EA 3BOWA 1BYDA 1NVMA 4KEUA 2ZX1A 4B5SA 3KS5A 3K1DA 2C15A 2WLYA 4YN5A 4AD0A 2ZX3A 3S2JA 2WW5A 3M9YA 3FK4A 3VNYA 2PZ0A 4XE9A 3U78A 1QJY2 3TYJA 3HNMA 1EL3A 3PBVA 2Y64A 4A2SA 3O1NA 3CZ8A 1XCWA 4GXWA 4C0BA 3L0NA 4NIDA 5TBOA 3NO3A 2W63A 1W0MA 5FL1A 1E73M 3PUHA 4AQ2A 3M0MA 4YTQA 4JL2A 4UNLA 5H8MA 4FOKA 1UMHA 5A1AA 3RAOA 2GN7A 4Q0PA 4RUBA 2O7SA 1C8XA 1DE6A 1L7RA 2JDKA 3RPDA 4EZHA 3G0SA 1MFVA 2PBOA 1E9YB 3EA2A 3LHYA 3NZRA 1KM2A 4ZQOA 2ZEZA 5GLTA 3IPWA 1RUI2 1B3ZA 1PTAA 1OH3A 2DSWA 1Z32X 4I5RA 4XJAA 2WS91 4BCEA 1O4YA 1W8UA 2FZNA 1KXQA 1H9WA 4IE0A 2RUSA 1DEDA 1XP3A 4QPIA 3M43A 2R24A 2PDFA 3WG3A 3EPNA 1YQ6A 3OPWA 1RQBA 2DZBA 1L6YA 2C0HA 1O8SA 4XBQA 4AXOA 4MWAB 3E5QA 1CWYA 3L5AA 4LV4A 3MC5A 4O16A 5CLTA 1KM3A 4CCKA 5GZGA 1W3TA 3LBMA 3AMQA 4JL1A 3AS3A 5C3SA 3W27A 1A5UA 1XGDA 2D6PA 2CU5A 1SG3A 4F0KA 2RS13 5LK5A 2OYKA 4LE4A 1OA3A 4CYDA 3VUOA 1GONA 4MPKA 4O18A 3RLHA 4BE3A 3W1LA 5FLIA 1S2KA 5HQMA 3UESA 3SCVA 3LCPA 4AVSA 4FS9A 3S1XA 4H7LA 1VR6A 3NZPA 3OY8A 3AKSA 3IAQA 3ZMOA 2EQDA 2A85A 3ZMNA 2IUWA 5C5UA 4DM1A 1TUFA 1M06G 4Y4RA 2L9LA 4FNPA 5I5RA 4H9ZA 3STCA 1G8WA 4BXFA 1M41A 3VBSB 4MZ8A 1HLCA 4Y5Z0 1O5UA 5LGXA 4UR7A 4MX3A 1CQ9A 3ZFFA 3GKFA 3L9CA 4MFEA 4AB4A 4QJ1A 2JB4A 1D7FA 1RMU2 3BAKA 4L4PA 4C90A 1GBGA 1OCQA 2R1BA 2Y0IA 4PBEA 1B4EA 1J2BA 5C3QA 3RK8A 2SFPA 1DFQA 4F79A 2IKIA 1GYLA 1MEHA 3CL1A 5G4EA 3UA3A 1FDJA 2ZEXA 2JD4A 3WQ7A 1MEWA 4O4VA 5HNNA 1LQ2A 5F1UA 4H8VA 3NZ1A 5DAXA 3TMQA 1PZ7A 1CGVA 4IEYA 2DSZA 1DJNA 2D69A 3WENA 2RS32 1N3PA 5CKMA 4GYKA 4O28A 5I03A 5AYIA 3TW6A 1V3MA 3KT7A 1TMLA 4DHGA 3C8NA 3B05A 4B4FA 2GGHA 5EHDA 1LUCA 2GC0A 1VD6A 1B35C 3G8EA 3ES1A 1UJQA 4AI1A 4E3TA 5LW9A 1Q6LA 5PTDA 3A4AA 3CBNA 3SC7X 3CH9A 4QHBA 2FH8A 1NWUA 3X29B 3U2EA 3QYQA 3W5NA 2FB2A 1GFF2 2Y7DA 4XKYB 4D6DA 3FS2A 1FX6A 5FBZA 3GTFA 1GVIA 3AYVA 3K75B 2D2HA 1DJXA 1EZWA 1XYCA 3AJYA 4CVUA 3FNDA 1PKLA 4CNOA 5F37A 3M41A 1JU4A 3MDUA 3WF0A 3VHNA 4YWAA 1SO5A 3CWHA 3RGBA 4UT5A 3CUGA 5I79A 2J7CA 4HHHA 3WQ0A 1BAGA 5IK4A 4W84A 4ATWA 1Q5MA 3BLOA 1XLMA 4U2ZA 2VNGA 3VBOC 1ZBVA 2PAKA 1C1LA 4JYEA 3C7GA 1NY1A 1CTNA 1RAKA 2OPJA 3P61A 2NX9A 1WUVA 4WKHA 1XLHA 3W81A 1JPMA 1AH3A 3AS0A 3W6MA 3T4VA 1LTEA 3S47A 1H11A 4NPMA 4D3WA 2VFHA 4COVA 4BZ4A 4R33A 2Q5TA 2BJSA 2J47A 3LHVA 3VIGA 4META 1PVXA 3WNXA 4A6GA 1ZUAX 5A6SA 3NKTA 1UZ1A 1Y4WA 3F5KA 2ZVRA 1GMMA 4KRTA 3GVRA 4DO6A 2AQOA 1RXOB 1KCXA 1HKJA 4Z2AA 3IGUA 2PQSA 5B2GB 2BNJA 1LUCB 3BU7A 3CLWA 3M07A 3UWYA 5A32A 1WW6A 5JOZA 1PSCA 3EPOA 4BU2A 1MXSA 3G3MA 4Q7BA 5IRPA 1UWQA 3LPGA 3MFCA 3H7RA 4O4WA 4CCEA 2X1SA 4PUNA 3I3DA 2QCSB 1SFYA 2XFFA 5I07A 4J3ZA 1MS1A 1P0NA 4RHV3 5DDJ3 1RJPA 1VCGA 4HMNA 4COYA 1JEZA 1VBC2 2W68A 1E9ZB 1ICQA 4NP7A 2EPOA 1Z44A 2UBPC 1UOBA 3E2SA 4N7UA 1LROA 2NUXA 4PGLA 2VZPA 3SH3A 1T40A 1VAMA 3N3HA 4QGNA 2O1QA 2X16A 4C1XA 1D4M3 1P0EA 3B4YA 1TJPA 2VOKA 4LS0A 4RQPC 1F3EA 4L9ZA 2FPVA 1VP6A 1KO0A 3FEQA 1F05A 1EC7A 4KIEA 5IHSA 2CV6A 5C54A 2OPWA 2JEPA 1K45A 2XUCA 4YCPA 4O14A 2DCTA 4QAIA 3TZFA 1VC4A 1FBAA 2CNAA 4O0KA 4EACA 2Q8LA 1IT0A 2OT7A 2OODA 5FL0A 4GFSA 4CDUA 3I4KA 1CXKA 1XYBA 2YYTA 1XDJA 1BG4A 5FUNA 4AFMA 3CAQA 1XIGA 1QXJA 3FAWA 1CNVA 3ARZA 3SDOA 6CGTA 2HWC1 1XW8A 5FPBA 4NVPA 3L7RA 4DB5A 1YIXA 1W0OA 3M6YA 1ZRDA 1G5AA 3V65A 4BM8A 2W4XA 5DCBA 4HNTA 4UQ9A 1F9KA 4GNVA 2Z69A 3R0KA 4US5D 1HL9A 1DWHM 2YB4A 1FWFC 1REQA 5FF4A 4BF7A 3RS6A 5C8WA 5LIYX 1Q8AA 3NQGA 2R7EB 1BYBA 2J1UA 1CXIA 1WAWA 1CXLA 5HR7A 3IDEA 4J2PA 2PHFA 2I16A 3UPBA 3ORJA 5FQ0B 3CUJA 2REQA 4QIUA 2PLV3 3C2OA 4N90A 1AR63 3NO5A 4QGCA 1M04A 2NV2A 5HQLA 1PVNA 5FREA 2LW8A 4QPGB 2DPEA 1LT8A 1ZZ8A 3OEAA 4N6EA 2E51A 1QO2A 3RM8A 4LUTA 1PVC3 1W56A 4GX8A 2ZEWA 2OS2A 2YU1A 1CYGA 1YDYA 1W8FA 2B31A 1D0GA 1UXXX 4LUSB 2RDNA 4OLLA 1N7KA 1J58A 2XJQA 1TFVA 1CJPA 3QHNA 1GOXA 3M44A 2RMU3 1AK5A 3RU8X 4LAKA 2Y26A 4PTNA 2QW5A 3O7UA 1X8EA 4Q4X1 4XHBA 5AC4A 4JEQA 5A2AA 3H0OA 4RE2A 2VCBA 2Y34A 1LLWA 2ZGTA 3VBOB 1TIMA 4P5UA 1V3KA 3UERA 3F95A 4N9BA 4NJIA 1A34A 3KM8A 5GKAC 1LOGA 1JYVA 5DUUA 2XGIA 1W9PA 1DGWX 4YL2A 1HVXA 1NCQB 4Y1XA 1VBHA 1DQ0A 3PU3A 3Q67A 5KBFA 5SV8A 2Q71A 1Z41A 4RS5C 2RJKA 4I09A 5FZDA 1GVOA 3MW7A 3T42A 4QPWA 2WFF2 3LBOA 5GPRA 4K8GA 3S83A 5JSOA 4GVFA 3GIYA 1ECQA 3JZUA 4EN9B 4FALA 3GDTA 1QOPA 2IXHA 2WT1A 5J98B 3UR5A 4F83A 3DC0A 3C7HA 4DYJA 3VHPA 1OC7A 4AFBA 4JDBA 3BN6A 4LLFA 3I59A 1HB1A 1QXPA 3FGCA 4XMAA 1EBHA 4HZMA 4U28A 3LF7A 2BY2A 3P81A 4LBRA 2LUWA 4LY4A 1GW9A 2ZGNA 3TP4A 3IB3A 2PLCA 1A4LA 1YKWA 2OVUA 1C3HA 3PG8A 5DBUA 2D3SA 1OOPC 2BOJA 1XLCA 2CZFA 1TME1 1XFBA 3ATZA 1BEUA 3NTYA 3VGIA 3O15A 1UIOA 2HBXA 1JF5A 4FX7A 2VGDA 1WO2A 4IP7A 2OKXA 3FBYA 2VYOA 5A6TC 3BANA 1QJU1 1W8NA 1S0DA 1OI6A 2ETEA 1RZMA 3BQ5A 2WSKA 3AIWA 4ONVA 1EC9A 2GFTA 1WCQA 3ZYZA 4Q0QA 2VCCA 3ZKYA 5FUPA 4U31A 3QCWA 5IUQA 5A3HA 3K8MA 3T78A 1FWHC 4XZHA 3AXEA 4FQZA 4ZTXA 2FHCA 5GVJA 5JUVA 2ZX0A 3I2DA 5LA2A 2HWD2 3MS8A 1A5NC 2HH9A 2ZA3A 5ABGA 2Y5JA 1EHNA 3W1MA 4JN7A 5D1IA 4ZOEA 2NV9A 1NOUA 1W9XA 5AECA 3WG4A 4D6GA 2ET1A 3NNJA 1HVQA 3HG2A 3KBNA 1CW2A 4POCA 4JTCA 3H4XA 2GSHA 3AXHA 3SIMA 4A29A 1GZCA 3AFGA 4TV5A 4WVVA 2WKGA 4IT1A 5HBFA 4PI2A 1FV2A 1IZJA 3KD4A 1DHKA 1XFCA 5AN7A 2QVSB 3H12A 2YGYA 4C6QA 4Q8UA 2EPKX 1G0CA 2DCZA 5AHEA 4PDWC 3HPXA 4NZ5A 3AX4A 4QLLA 3RLVA 3WLRA 2ISSA 2OLSA 1QVBA 2X0SA 1XE0A 3DYOA 4QM1A 3SCPA 1DCSA 1K5MA 4LBQB 3GKAA 2OGJA 4UTUA 4H3DA 4NPLA 4IX2A 1U1UA 2WVUA 3UG5A 3IV3A 2RDQA 2MNGA 3E9AA 4MG2A 3TLLA 2ABAA 3OBAA 1NXMA 2P2KA 1XGZA 1YDVA 4IGHA 4Q8QA 1K8ZA 1F8VA 1KQZA 1EJ7L 2V2DA 2OZ8A 1JUEA 2PDXA 3QN3A 3FVDA 5AC8A 5EFUA 1A4MA 1ITQA 1CZ1A 3O2LA 3WKZA 1AR93 5FP7A 4DRSA 4AEOA 1OFSA 2YXXA 2VBPA 1OVSA 1O7FA 1TMF1 1XL9A 1PWLA 3LA2A 1E6RA 5A3UA 3L12A 3ZJ6A 2CGOA 4DJDA 3EDKA 2W79A 4AIUA 4G7EA 5K9YA 4WIWA 4DBSA 2Y6KA 1EIBA 3IRDA 3RR4A 1XNTA 1XPWA 3NO1A 1VAKA 3WD4A 2FHRA 4FFHA 3NRUA 4LVDA 3ZFEB 3NQ2A 3LSCA 4Q26A 4HPNA 1WUFA 1MS3A 3FA3A 3WK1A 4P5YA 3VAVA 3NA8A 3CPUA 2HWE3 4R4ZA 4QQLA 1RP9A 2ZADA 1R3RA 5A3TA 3VKAA 2H90A 4AWSA 1VPHA 4CPBA 4PSRA 4US6A 5IVBA 3U5YA 3T44A 5CADA 4NRMA 4AHXA 2ZKNA 3IIXA 1BXCA 3O63A 1VBC1 3S2CA 5EY5A 1V6UA 1X33A 4H6EA 4FQ4A 4YVSC 4RW5A 3V5OA 3RMXA 1QNVA 3MCOA 5RUBA 1TWSA 5C9RA 3WDWA 4AIOA 3EDDA 4H4IA 2UU8A 3WP5A 1OZMA 3N2MA 5DQPA 4IIGA 5FLJA 4DY5A 2X53S 1NP2A 3LD8A 3M47A 5FZEA 1ZBKA 4OBTA 5A3NA 4U33A 3SRFA 4MKNA 5D30A 1NF7A 1CAWB 1VBD1 2EKCA 3W7PA 2WUHA 1UASA 4IEQA 4CCNA 1CESA 3T30A 2QDGA 2W1WA 4GUGA 2GH8A 3SY1A 4XF1A 1LG2A 3CUHA 1I9CB 4N6FA 4U2YA 2AKZA 2E6VA 4MOAA 5FZ1A 3RZKA 2A5ZA 1ZNNA 4AFYA 3PNAA 1RBLA 3AP9A 2GU9A 5ANNA 2Z4GA 2HV5A 4BI5A 2G50A 3WFAA 1F3XA 2I9UA 4B16A 1V9U3 1QI2A 5JLVA 3GVQA 4KQ7A 1H0BA 3TONA 1ND2C 1CGYA 3EB3A 3AYEA 4LWWA 3BSHA 5BXRA 1NQ6A 4JTTA 2V72A 4M5PA 1DE5A 2ZX4A 2Q8XA 2HBUA 4LYRA 3SQSA 5LHFA 3N35A 1IWAA 1FYUA 2BZDA 4XX6A 4ZOBA 5LK7B 1VRXA 4QE1A 2I5QA 2R1NA 2RDSA 1SFTA 1W1PA 3LDRA 4CPBD 1GCYA 4KI5M 3QMSA 4B4QA 3I97A 3B40A 1AA1B 1HRI1 1KGYA 3STEA 2NQ9A 2WWSA 4L0PA 3C61A 4EP8C 1J1TA 2HJPA 3ZJKA 1V03A 2HWD1 1UD3A 1BZWA 4A8NA 1IQ8A 1NF0A 2VOTA 4FTEA 4XFIA 1MEC2 1OT1A 3M5XA 3VOHA 1W9FA 3TOJA 4RA0A 4XABA 2VZTA 4AZZA 1QW9A 3D5HA 4UTJA 3VPLA 2PTZA 4GI9A 4F2UA 1R7OA 2IKHA 3MHUA 3KVMA 4BWLC 2RHGA 3GC5A 3CU7A 1DVJA 1RCOB 2XKPA 4Z8BA 5A8QA 1IS5A 3LXBA 1T6BX 4TTGA 3WQGA 4NIAA 4HVRA 2CWSA 1YIPA 1BHGA 2PDGA 3HF3A 3ONBA 5DMNA 3WLPA 5I6SA 1XQNA 2JJ6A 2V3GA 1OVPA 4AGVA 3N4MA 2FVLA 3PS7A 4OFGA 1JZ8A 1ULEA 5MF5A 1IOAA 4MPQA 1SZGA 1H7RA 2BY3A 4B3LA 2QCHA 5H9RA 4EF8A 3VBFB 4HB7A 3HQRA 4FPGA 1VEPA 3MIHA 3HJEA 2NZ9A 1S2UA 4XAYA 2L5HA 1PIFA 5HUPA 4YM1A 2W1UA 1C29A 1OEPA 1AUYA 3FSUA 1PKYA 4ADUA 3KM5A 3UR7A 3LTYA 3SAZA 4QE5A 2BDRA 3CF6E 3WX5A 3S5ZA 1CXEA 1MS0A 2PURA 3GAKA 3NOYA 2AMGA 2NQJA 3RQ0A 1R46A 3E5XA 2G5WA 3VL8A 1RVF3 3RJXA 3MMTA 3GFYA 1WA4A 2DV9A 2X5IC 1N3OA 4LV9A 4UYBA 3CGTA 4FPCA 3PVOA 3ACLA 1XRTA 4XB3A 2XFRA 1LM1A 1WCDJ 3XINA 2R30A 4RD7A 1IEXA 2VMFA 4KESA 3TTSA 2ZABA 3CXOA 4UQAA 1VR3A 4OBSA 1KLYA 3JZVA 1J79A 3WEOA 1W8HA 2QDNA 5H91A 4GQGA 3WDVA 5F3EA 5E70A 3WX7A 1NWSA 3UG3A 1KGUA 4K3UA 1C3FA 4G7EB 1UD5A 5BPXA 1KBJA 4CU7A 2AR6A 4B91A 4IGNA 4CQAA 4MGKE 1UQZA 2D7FA 3ZFGB 4OBRA 2R94A 3IDAA 5C33A 1G7UA 2RS12 4XZNX 1TX2A 3TYAA 1C8M2 2V81A 2HYKA 2VTFA 3WDIA 4W85A 5LNVA 4MZUA 2PDWA 2ZQ0A 2FMYA 4KCVA 3ARWA 3HQ1A 1KBLA 3B8VA 3LCLA 3VNDA 3BO9A 1LEMA 3FFSA 1Q8PA 3S2LA 3V7PA 5H2ZA 1RYYA 3W72A 4IE5A 2FIQA 3I7SA 3EOEA 3INPA 4CD6A 4GA8A 2QCMA 4UQEA 3TQKA 4AZHA 3U0HA 2G41A 5CAKA 1V3JA 1VB9A 1L0PA 5I8YA 5GJ6A 5DF0A 1JPIA 3W29A 3BCFA 1HJVA 1XQKA 4OWGA 3GY1A 1ZBE2 4OE7A 4LO7A 1POQA 3TR9A 3P8JA 2YBKA 2D0FA 4LT9A 4D1JA 4YYFA 2CGPA 2JGQA 5JBDA 5HMDA 1HXS3 5G1TA 1R7AA 2VVNA 4KWLA 1XINA 1QXRA 2HSAA 3GFZA 1RITA 1PJ9A 3P0XA 1V0MA 4NYYA 1C4RA 5ECUA 3SCRA 3UYIA 5FZ3A 1OA2A 1SFPA 4MNMA 3SN1A 1R86A 2J62A 3JS3A 1HJQA 2NUYA 1FP8A 3N3TA 1FXPA 2CLEA 1QW7A 1ZYBA 2BVWA 4LSBA 4HZFA 3AIUA 2DZXA 3AHZA 4I0AA 2X1IA 3PL0A 2WO3A 1RQEA 3AXKA 4QDSA 1UBPC 4NIGA 4I6KA 4PE8A 4A3ZA 4ORIA 1F4AA 3LI1A 3HMCA 3M3CA 4Z1BA 3NL2A 1O5QA 2OOFA 3WQWA 1B35B 4UAPA 5K3VA 1C57A 1XF0A 9RUBA 1HFBA 3MF9A 2VVSA 3E5PA 1VBA2 1D4M1 3WP6A 2WJZA 2BOGX 1SZBA 1UY3A 2RJLA 1GOWA 1YFYA 2E5DA 3MP4A 3IK4A 3EA3A 2HJIA 4MG4A 3WD3A 1OUXA 4LBUA 5TSWA 3DX5A 4I5XA 1GOOA 3RXZA 4LFYA 2DP3A 1JFHA 2XU2A 4UTLA 2QUOA 3W87A 3GH4A 3AIRA 1EC8A 4MYAA 3A5VA 2B5HA 4WSHA 4QCFA 3PMEA 2AYHA 5FJKA 5DELA 3RMEA 1KD0A 5EJ3A 2AEZA 3I59B 1W1ZA 1P43A 2PHWA 4FI9A 3R05A 2WYSA 1IWBA 1F4HA 4PMUA 4AXNA 4DXKA 3SCWA 4M0NA 1ZZ9A 3B01A 5HBAA 3WL1A 4JTOA 1OKQA 5LEJA 1LHOA 4FT8A 4TMBA 2QCLA 1KM0A 1SBFA 2PWDA 4WM8B 2UYAA 2DZSA 3VBHA 4DO7A 5ABFB 1PO9A 4XBKA 4ARXA 1ZCOA 4LW7A 4C6DA 2ZRVA 1W6PB 3ETPA 5H9QA 3STFA 2A4AA 2R072 3MLLA 3ZR6A 3MZHA 1PZ1A 3WH9A 2WBGA 3U48A 4DO5A 2ZMKA 2FZBA 1NELA 5DZFA 2EG7A 7REQB 4LUYA 3AYTA 3AZZA 2H3DA 2XLFA 4PT6A 3SITA 3S5AA 3VD5A 1ITCA 4IE7A 2GMMA 1AYN1 2W27A 3AMGA 3BXWA 4MJ2A 4GPNA 1W6QA 3S5SA 5IK5A 3TNOA 5F2MA 2VFDA 3KZSA 2AEYA 1ZENA 1MZEA 3MEPA 3OPSA 2AQWA 1W8WA 3W2KA 5FZIA 1LBLA 1CI1A 1OC6A 2V5BA 2ZZ6A 3OQ8A 1I2PA 1V6OA 4QP0A 2D2OA 3ABSA 3BC9A 1EDGA 3G24A 2N7GA 2VX7A 4ATFA 4TR9A 1JZ3A 3I7DA 1K02A 3W75A 3H2OA 1AR81 3DESA 1QQP3 1FOD3 4O7XA 2FZ1A 2E63A 5AKQA 3WP3A 3MHGA 5FYIA 1CX9A 3VKFC 2JGYA 3POCA 2WQ4A 3O1RA 1R3QA 1PNFA 3MFAA 4LPLA 3NEVA 1H09A 2A7RA 3ZDSA 3LV5A 2ZHLA 2QJHA 4UB9A 1KFXL 2FMNA 4D7SA 1FUYA 4X6RB 3TYUA 4AZCB 2H6CA 1JHNA 5CFCA 5A3OA 3WCSA 3T1MA 2QCNA 1PHQA 3HIJA 1KS4A 1L8PA 4XOGA 1V79A 2WO5A 3UK9A 1Q7MA 3QH2A 1HRI2 4NXKA 2P5BA 4Y1ZA 5FAXA 1TCMA 3NG3A 1GUVA 1ADOA 3MIFA 4MXWB 3E6BA 5ABTA 1UC4A 4KU8A 4Y9OA 1I2NA 2BRTA 1KGXA 4UTWC 4A8LA 5KR7A 1XSJA 1XR2A 3OUIA 5FOJB 1BKHA 2QCGA 3P3BA 3B9NA 3L4XA 4BFAA 3PFRA 5BW6A 5HNUA 3VC5A 4MM1A 4FPEA 4B92A 3V5FA 1TVGA 1O6IA 1L6FA 2EPLX 4IF2A 5T5PA 3IJIA 4MJMA 2P3JA 3N4EA 1W2NA 4HPHA 2Y1HA 4RZ5A 4JRLA 4HPXA 2R14A 4MAZA 3CEPA 1QF3A 4E2QA 4ZO6A 1TMHA 4HPKA 3W88A 3POGA 1W2PA 2VT0A 1UPMB 2X5IA 2Y8KA 2ZZ7A 2Y24A 4P9XA 1GZWB 5IJRA 1IT7A 5E8AA 2JDUA 4HNLA 1MNZA 3LEIA 4OKDA 4YG3A 3E2VA 4UW5A 1BYCA 3H7UA 1XQLA 4Y5TA 2YC4A 3V0SA 1EP3A 4O9GA 2G3MA 2IQ0A 1U1HA 4ES8A 2C26A 3G3DA 3UKTA 2GJPA 7CGTA 4GZ7A 4C6EA 4TX9A 3BICA 3DF0A 5XIMA 5EFDA 5LIUX 4XO7A 3SQLA 5FZOB 5HCBA 4E2DA 1I6NA 2FMOA 1SZNA 4XQDA 3N19B 4GNKB 3W7MA 3AM2A 1MDLA 1G4TA 1M68A 1UROA 3TTQA 3DECA 1R082 3T0DA 2WWUA 2C5DA 3GUGA 4S2FA 4S2GA 3SSJA 1OD5A 4JKLA 3RX4A 5CSRA 2DBIA 4Q8OA 3OA5A 5JMUA 3N18A 2FKPA 2R82A 2NT0A 3VZXA 3MCNA 2E4TA 4AZCA 5GNYA 4N9HA 2WDBA 4ERAA 4QJ4B 1X7NA 1WCGA 1R2RA 1RHCA 4B7EA 1G9HA 3WUFA 5CZKA 1VIWA 2FDKA 2F17A 5C3OA 5AYZA 3S4TA 4BJ0A 2IPJA 2WN2A 4XQ6A 2R1PA 2UY8A 3EMCA 3QR0A 4M3PA 1CAVA 5JXGA 1H41A 2KZHA 3M2MA 2W91A 2O92A 2Z24A 4HBKA 1VLIA 3W83A 2VVDA 3TQVA 2RH9A 1DPMA 4GMEA 4B8EA 4PRWA 2HEJA 3VU2A 2ATSA 3GB6A 2WHMA 1G6NA 4X3ZA 1AF9A 2HPIA 3WJYA 5GQBA 3FWEA 1OLMA 5FJPA 1H7NA 3HO8A 2XLAA 1DKWA 3LV6A 4E27A 2WO7A 4NNBA 5FO8B 5FDBA 1V0LA 3U1XA 4L1GA 1UU5A 1A8DA 5I78A 2UY9A 3M1ZA 5E09A 1H5VA 1C8NA 4PMYA 3GG0A 1IPSA 2PFWA 4K6BA 1R091 3ZYPA 1VPQA 3LEGA 5C55A 1RUE3 3ARVA 1EIXA 4FOUA 1UX7A 2NV1A 3W1UA 4Y5SA 1OK6A 3PB0A 4GWJA 4HU4A 4KGJA