4BQ3A

Structural analysis of an exo-beta-agarase
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
747
structure length
740
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLENDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNEKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 253
structure length 740
sequence length 747
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq3A02
4UQCA 5D9NA 3HN3A 3ZR6A 2DDXA 1QI5A 2PWGA 1JIBA 3GNRA 2ZXBA 3QOMA 3TTQA 4CD4A 4PSPA 1EA9C 5FKYA 1B3WA 3UG3A 2PWFA 3MSGA 3B9EA 2YBUA 3HU7A 2XFRA 2XM2A 1KGWA 4HA1A 3WENA 4W7WA 3SCOA 1JZ4A 1V0AA 1BVNP 1OGGA 4MB1A 1E71M 2Q1FA 2Z1SA 4LKEA 4UQEA 3N15A 1BG4A 1WDPA 4E2OA 3WQ8A 3OGVA 1JDAA 1EO7A 2VX4A 4EANA 1K9TA 1V0MA 4AZ7A 4BCEA 4QFUA 3WD2A 1GVYA 4B3LA 3KE0A 3L4VA 2YLAA 5IXEA 2O9TA 2CBVA 4PMNA 2EEXA 1GWMA 1M01A 4AZHA 4NSBA 5HXMA 2F8QA 1WE5A 2XJ7A 3L4TA 3VOCA 1WZKA 3ALGA 1Q6GA 4UCFA 4HOXA 2WMHA 2W5FA 1HKKA 1UD4A 1CGXA 3ARXA 1H5VA 3VU2A 3CZKA 2VQUA 4TXEA 2D22A 3RILA 1IV8A 2DIEA 2EPKX 1E40A 1UKTA 4AZGA 3WNOA 4CGTA 1C8XA 2BHZA 1JYXA 2BVYA 2V3EA 3GNPA 3GYCA 3K4AA 1CXHA 1E3XA 1US3A 3BXWA 4J3WA 1A47A 4PMUA 4EAMA 1HKMA 4S3JA 3AS2A 5A8MA 3WBEA 5A94A 1UKSA 3VIPA 1UD2A 1D2KA 1C7SA 1ZBVA 1JZ7A 5I78A 3U7BA 2W61A 2ZUMA 4D6FA 1WDQA 1OH3A 4E8CA 1SMDA 1NOUA 1OKOA 3EYPA 2FH8A 2EQDA 1QNSA 3SURA 4PSRA 1O7AA 4U2YA 5BYWA 3EDEA 4KGLA 2JWPA 2WANA 3NCOA 5ECUA 3SCQA 3QHNA 4PEEA 1UQZA 3CO4A 1RPKA 5ABGA 2CESA 3II1A 6TAAA 1UA3A 1FHLA 5HDRA 4BZYA 3AICA 3VDBA 2EPLX 1JYWA 3AJ7A 5A8NA 5HPCA 2E9LA 2UY2A 3WELA 3N12A 2VNCA 2YL9A 4QLLA 3BSGA 5KZ6A 1W9UA 5AC4A 4PMXA 2OWCA 4HOZA 4UTFA 5C8BB 2GUYA 4H8VA 1DEDA 3W0KA 3OZOA 2J77A 1TVPA 2JEQA 4D6IA 1F4AA 2EO7A 1JGIA 2BNJA 5M5DA 2VCAA 2WYSA 3CUHA 4R5EA 2ESCA 2XSAA 5D8ZA 3VIOA 2WVTA 1JAKA 4KH2A 2WCGA 3RIKA 1UYQA 3L4ZA 2GJRA 3VD4A 4U3AA 2XVPA 3RM8A 2BV9A 5D8WA 3SCVA 3FY1A 4D6CA 1KWGA 1NP0A 1QVBA 2CHNA 2DPEA 4Z2GA 1HJXA 1MQPA 3N04A 4PTMA 1XH0A 3MMWA 1B3XA 1R7AA 1E6NA 2XVGA 2J7HA 5BCAA 1IZKA 4JFUA 1SMAA 4JCMA 1FH9A 4H7VA 2YIHA 1UR0A 1PIGA 2CERA 4PRWA 4IM4A 4FK9A 2ZUUA 3EMCA 1E72M 2O9PA 5FOOA 2ZWZA 3SCTA 1KGXA 4UFLA 5GNYA 1UWTA 5E6ZA 1OINA 1WPCA 3BAYA 3OG2A 2X1IA 1DWFM 2YA1A 1V3IA 2WSKA 4DUWA 1K9DA 2BY2A 2J25A 3VGDA 4HPGA 1VEPA 4MDPA 3VMNA 4J28A 1TE1A 3DHPA 1KGUA 1JNDA 3BMWA 3WNKA 1ZB5A 3TTYA 4JFSA 3O9NA 2FH6A 1IZJA 1VAHA 3WH7A 1R87A 1D3CA 4DWSA 2Q8XA 1JFXA 1LLOA 1GZJA 5ABHA 1JL8A 4U2ZA 4CD6A 4BQ4A 1UKOA 1KQYA 2UY3A 3ALFA 3OGSA 2J8GA 3OGRA 2CXGA 4FLSA 1MW1A 2XSBA 2J7CA 2WSPA 1NOFA 2ZUVA 3DYOA 4KMQA 4C7GA 3AMLA 1FHDA 1HF6A 3AZSA 3MUAA 5FD0A 1QBAA 2OYLA 4LYRA 2J79A 1UH2A 5AYIA 2J7BA 2WNWA 3VKKA 1UD5A 1W8ZA 3VD3A 2CKRA 3VUPA 5LYRA 1G1YA 2DT2A 4P7NA 3GBDA 3VO0A 2ZWYA 3ZIZA 3CGTA 3OBAA 2X0HA 2YDSA 1GOKA 5D21A 5BXRA 1UD6A 2JIEA 4MB4A 4BQ2A 1MFVA 2XVKA 3ZQ9A 2ZOXA 3NDYA 3ZYBA 2ZIDA 5E0FA 5HBFA 3NSNA 2UY5A 1QNQA 4AXNA 3ORJA 2WKGA 5JBDA 3AIWA 4AZIA 4HPHA 3ZJ8A 3SCRA 4AW7A 5CQ1A 3D3AA 3SCUA 1EGZA 3LPOA 3WNNA 1ISZA 2RGMA 2WMFA 2A3HA 2VZOA 3WNMA 2FGLA 4DUXA 4PCTA 1VFMA 2D20A 4JFWA 1X6NA 4B9YA 2PF0A 3WFLA 1KXTA 2VI0A 5CLTA 2C24A 1KCKA 4YWAA 4AYSA 1GQIA 2WCSA 3PTQA 2XWEA 1DWAM 4TOQA 2A3CA 3ARSA 1CIUA 2XG9A 1TUXA 2FHCA 4AISA 1HN0A 3TOPA 3W6MA 4IUGA 4P8VA 4MAVA 3ARYA 1HJSA 1JZ5A 3CZJA 1CXFA 1GHRA 2J8FA 4YW6A 4CCEA 1VBRA 5E0CA 5M3WA 1E0WA 1GORA 3T0BA 5I23A 1I75A 3G6LA 1U30A 3WD3A 4AEEA 1OD8A 3VGFA 3PZTA 4AD0A 5A1AA 3CZGA 3WH6A 1BFNA 2X0YA 3BLKA 4X0NA 5AY7A 1BYBA 3SCPA 4YW7A 1J9YA 4KWUA 3FHAA 2YDQA 3VM5A 4X0VA 1GOOA 3VDHA 5A6AA 5JIPA 3VX1A 2QMKA 5BRQA 5FL0A 1UWSA 3MU7A 4F8XA 4PMOA 1HT6A 5ABEA 1NWTA 2GVYA 3WD0A 1CDGA 1HJVA 4AZCA 4JL1A 4JKKA 3S2CA 1UR2A 4Z2IA 1L7LA 4J27A 2DQXA 2VMFA 4AMCA 1FA2A 2IXVA 2X8RA 4JFTA 1R7OA 4A3YA 4D6HA 2V5CA 5CSYA 3N9KA 5CXPA 4C7DA 3POCA 3AMCA 3M46A 3VDCA 2X05A 1QNPA 1E4IA 1E73M 1H0IA 3AHZA 4QDMA 1QI3A 1W1VA 2V3FA 1ISVA 1J0JA 2YBTA 2XFYA 4W8AA 4P8WA 2V5DA 4FLRA 4AD1A 2EJ1A 1R8LA 3I3EA 4TX8A 3BSHA 3VD9A 3RPMA 5LA1A 3IJ7A 2CPUA 1GONA 3N18A 5CPSA 5I24A 2WHLA 4TX6A 1EDQA 2JF7A 4TVUA 4UFMA 5EFFA 3RM4A 3AHTA 3PHAA 1JI2A 1UZ1A 2V38A 3T09A 3CZLA 1W90A 1GOMA 4XX6A 4DWSB 1EIBA 1WAWA 2W62A 3L4UA 3MANA 1CBGA 2JIWA 4UOZA 2W92A 3FAXA 4UQBA 4PTVA 2D0HA 4XUYA 5TD4A 2C8NA 1V08A 4P7LA 2VOTA 2VZUA 3WD1A 2W63A 2GJXB 1GQLA 3VIJA 2Y5EA 2F61A 1JAEA 4EKJA 2XVNA 3WDIA 3ZOAA 3PZUA 4ZE4A 2D1ZA 2ZXAA 2TAAA 1B3VA 4D6JA 2D23A 3LPPA 2EBNA 1DP0A 1UR1A 2BY1A 3I3BA 3HMCA 4YHEA 1KBKA 3AHXA 3AS3A 3MSDA 3HJEA 3BGAA 4DUVA 3W24A 3NYDA 4LJHA 2WKLA 1KBBA 4CU8A 3CBWA 1PAMA 3A3HA 4HP5A 2OSYA 2WVSA 1W1YA 2YLLA 1J18A 1K9EA 5IHRA 2DSWA 3B8SA 3AZRA 1JZ8A 4E8DA 4H8UA 1B3ZA 3DC0A 2YL6A 3LPGA 1H0GA 4JAWA 4F9JA 2VRJA 5AYBA 3AMGA 3NUKA 4AIOA 4AIUA 1W2VA 3UG4A 1GQKA 5EB8A 1AQHA 2D3NA 2G3MA 2EXOA 1BF2A 2BXYA 4CN4A 1J10A 1EQCA 3F4VA 1PZ2A 3F5JA 5CZKA 1LL4A 4XZWA 1JZ3A 3AMKA 3K1DA 1EDTA 1I1WA 2WK2A 3UESA 1H3GA 3SUTA 3T2PA 1W9VA 3DECA 3WF3A 4M1RA 1KR1A 2J4GA 3VMPA 3EDJA 1EDGA 1UUQA 3T08A 1UR9A 1XRVA 2EPOA 4H8HA 1H49A 4OIFA 3SCNA 2XWDA 4IPLA 1JZ2A 1V3HA 4EK7A 3VGHA 2ZX7A 1QNRA 1VFFA 4CKQA 4PMQA 1TA3B 2GJPA 2WW5A 3ZYHA 1FFRA 1HP5A 4L4PA 1QI2A 3GH5A 4PMDA 1H41A 3VM7A 1HIZA 2CKSA 2WAGA 1PX4A 2E9BA 4HA3A 4LXFA 4LYPA 2UY4A 3BAXA 2J62A 2MANA 1TVNA 3BMVA 4QCEA 3CIVA 4M24A 4AC1X 4BA0A 2XYLA 4P7OA 1XD1A 2D24A 4LX4A 4H2CA 1GHSA 3QOKA 2E9MA 1ZL1A 1GJUA 3WUFA 3PZVA 3VMOA 3O2LA 1GNXA 1HVXA 2PBGA 3L2LA 1CXEA 4CU6A 3GXFA 1XYZA 2WBGA 2Y2WA 5IFPA 4M29A 2WMGA 1XV8A 2A3EA 2CBIA 3QHMA 5A2AA 1CPUA 2CNCA 1U2YA 1E55A 1HJWA 1GOQA 1QPKA 3IK2A 3WNLA 3WFZA 3GXMA 1W3HA 2QLYA 1E70M 3VDAA 4MTVA 1PEZA 1DHKA 3WF4A 1G94A 5BXSA 1Q6DA 1GOIA 3CHFA 1Z32X 4GI6A 5BXTA 1H2JA 3SEPA 2VTFA 5CPQA 1CLVA 2VCBA 1JDDA 4D1IA 3MMDA 3OB8A 1KWKA 1JD7A 5CGMA 3VIHA 2O92A 1X1NA 3VGEA 6A3HA 2J74A 1VFOA 2VO5A 3CHEA 1JFHA 2VXJA 2WM0A 4GINA 3WH5A 5I0DA 3CHDA 2ZX9A 4W7UA 2NW0A 1E6XM 2A3BA 3RJXA 4F79A 5FL1A 4F9DA 1DWJM 1ESWA 1YHTA 5EBAA 2WBKA 4PYSA 1NM9A 1BGAA 1W1PA 2XVLA 3WL0A 4HU0A 1CEOA 3PTKA 4GI8A 3WMBA 4D6EA 1OGBA 4UNIA 1K9FA 1HJUA 2BFGA 1WKYA 3CZEA 1CNVA 2ZXDA 1W8TA 4HZ8A 1BYCA 2QPUA 1G5AA 2ZX6A 1W91A 1RD6A 2BY3A 4WLCA 3ZT7A 4RE3A 3QHOA 2WXDM 5I79A 1GCYA 3WDJA 4ACZB 1C8QA 4CPBD 1WO2A 4JZ5A 4W5UA 3M7SA 3ARQA 5GPRA 3CHCA 4CD7A 1V3LA 4W85A 3VIIA 3L4WA 1E56A 3VIGA 1W32A 3S6TA 1C7TA 2CBUA 3WUBA 4PN2A 1C93A 4HU8A 5I5RA 2Y4SA 3QR3A 1BGGA 4AD5A 4J3XA 1E0VA 2BY0A 3LPFA 2CCRA 3CMJA 3RDKA 4LKDA 1EH9A 1G9HA 2BVDA 3A47A 5E09A 3THCA 2VZSA 3OLGA 3EBVA 4B16A 2WMKA 3KL0A 1E4MM 1V6YA 4UFKA 1V02A 3LMYA 1XYFA 1CYGA 4CP9A 2KR2A 3IAQA 3ECQA 3GZAA 1TG7A 4LK7A 2XFFA 1M53A 5BXPA 1B0IA 4P7RA 2WCAA 1ZBWA 1BSIA 3AYRA 1DTUA 2IXUA 4PCSA 4U3CA 3PZIA 4J7RA 3A4AA 2GDUA 5BWFA 4W87A 3VINA 4TUFA 1E6PA 3TP4A 1H11A 5CJ5A 2VX5A 4OJYA 2DEPA 3WKZA 1WP6A 3N13A 2WZIA 1E0XA 1CGTA 3BCFA 3E1F1 1P6WA 4JIEA 5A95A 3CPUA 3RO8A 1OD0A 2YL5A 1TFVA 4W86A 3CUIA 4HZ7A 4D72A 7CGTA 1EHNA 3W38A 2XGIA 1LG1A 5A6LA 3EDKA 1VJSA 1JYVA 3WD4A 3MUY1 1L0PA 1E1FA 3WF0A 3IJ9A 4Z2LA 1VFUA 2ZXQA 1R85A 4AL9A 3MV11 1X6LA 1W9BM 1CZ1A 4UQ9A 2WMIA 2LRPA 4AWEA 1JNEA 2E8ZA 2F2HA 3WDQA 4LKFA 1W9DM 1HJQA 3F5KA 4IPNB 2FDMA 3UCQA 1UHVA 1EOKA 2G3IA 2QMJA 3WMSA 4UQDA 4Z2HA 3VD7A 4UQAA 3TTOA 4GO9A 1XD0A 4GI9A 2VX7A 3MS8A 3ZM8A 1HX0A 1HP4A 4CD8A 3GTNA 1E1EA 2VVSA 4N0RA 2JFEX 1W3KA 1E9LA 3NSXA 5JUVA 3SUWA 1MYRA 3OZPA 1MW3A 4YN5A 1KXHA 1AVAA 5LA0A 1Q4NX 4PTWA 4CVUA 2XIIA 2VC9A 4N42A 3SUUA 1RP9A 4AZ6A 2B31A 2HISA 1KR0A 1XH1A 1Y7VA 2NSXA 4A6SA 3OA5A 2J47A 4HTYA 4UR9A 1TCMA 5CGTA 5HNNA 2V3GA 4TVDA 1V3JA 3FXYA 3UERA 1JD9A 2WZEA 3RMEA 5A6BD 3WH8A 3POHA 5A8QA 1J11A 5D9PA 4J3SA 4Z2KA 2RGLA 3CUFA 3ARWA 1NWRA 1OIMA 1UD3A 4GO8A 1NARA 3UR8A 2QF8A 1TR1A 4HZ6A 1FFQA 1QI0A 2J7DA 2CBJA 1BHGA 3WUGA 1LL6A 3L4XA 1C3FA 1KXVA 2BS9A 3U7VA 4AIEA 1H4PA 3D5HA 1I1XA 5I3DA 2WPGA 1XCXA 4NZCA 4URIA 1PJ9A 4J3VA 1FH7A 1IT0A 5BRPA 4ATWA 2C7FA 2YJQA 4BF7A 3AISA 3EDDA 1C91A 3L2MA 1WNOA 3AS0A 3UEQA 2BHUA 1QW9A 1ZBCA 4L4OA 1OB0A 4AZBA 4R27A 1UH4A 2WB5A 2XM1A 4PUDA 5FCZA 4W7VA 2ZUNA 3AQUA 1E15A 3NDZA 2DSUA 1V03A 2WVVA 1B3YA 2D3LA 1LWHA 4H41A 3I3DA 2J78A 4UFIA 8CGTA 2ZUTA 1Q6FA 3U57A 1QW8A 1UWIA 4OUEA 2VRQA 1JYNA 3UT0A 2FHFA 4HMCA 3WDRA 1GPFA 3WQWA 2AMGA 1KB3A 4WIWA 1L8NA 1AQ0A 3F95A 1GJWA 5C71A 4GZJA 3PBGA 1BAGA 3OLIA 1OIFA 3GNOA 1E6SM 2PWDA 3KEHA 1KCLA 1OM0A 1XHGA 5DO8A 4QLJA 1GWKA 4U5IA 4WSJA 4YHGA 3KL3A 3CMGA 5CPTA 1B1YA 4P7QA 3BAJA 4GPNA 3AXXA 3AYSA 4CCCA 3CUGA 4MNJA 5A6BA 1V02E 1M04A 5A6KA 3SCSA 3FAWA 4RE4A 3VTRA 4MDOA 4WKHA 2JALA 3WEMA 4Z2JA 1ZU8A 2CIPA 2W67A 1GW1A 1VEMA 3BC9A 3WF2A 1MQRA 5DMYA 2ZX8A 4NF7A 1QHZA 2XTKA 4M56A 3SCWA 3NIYA 2D0FA 1ZJBA 3K4DA 4ZFMA 3BAKA 5F7UA 1B30A 4Q7NA 4MNMA 5A69A 4ATDA 4UFJA 4CN1A 1XSIA 2D2OA 1LQ0A 4V2XA 3UR7A 1NWSA 2VVNA 1V6XA 3AHYA 3W37A 9CGTA 2J7FA 3VGGA 4UOQA 5I77A 3WBAA 3WQVA 2DSVA 4JCLA 1QOXA 1ODZA 1V6VA 1V0LA 4CN6A 2PB1A 3VVGA 2EPMX 1J12A 5CG0A 1VJZA 3O6AA 3W26A 1HNYA 1W3LA 1W8WA 5DT7A 2WC4A 3WEOA 2YA0A 2PWHA 4E4PA 1XSKA 5CLWA 2DH2A 3AROA 3IJ8A 1A3HA 2YA2A 4MJ2A 3NSMA 4JHZA 1AMYA 3MUIA 5ABFA 4LPCA 1RH9A 1S46A 2XUCA 3CTTA 1ITXA 1KXQA 4C7FA 5BROA 5GNZA 3F5LA 5KEZA 4QP0A 3BCDA 1EOMA 4HA4A 3EMZA 3WY1A 2LROA 3KZSA 4ML4A 2D0GA 4ACYA 1UWRA 4DM2A 4JKLA 1MWOA 1H09A 2E0PA 2WHJA 4PMYA 3VIKA 1WDRA 3KWXA 4W84A 3W27A 1ITCA 3IANA 1GUVA 2G8ZA 4WSKA 5M03A 2AAAA 3W81A 2HVMA 2XHYA 2Y24A 4AZ5A 4MB5A 1Q6EA 4OOZA 4B9ZA 3T0AA 3J7HA 1NWUA 1J0YA 2VX6A 6CGTA 4OBRA 1F4HA 1WDSA 1CXIA 4OKDA 1XSJA 3M07A 2PWEA 4S3KA 1BYAA 2X2YA 3AIQA 1B9ZA 3BH4A 1CXKA 5DF0A 4CU7A 1WMXA 2OSWA 2BHYA 1ISXA 1NQ6A 4MB3A 3BAIA 1SFSA 2ZUSA 1W9PA 1J0HA 4YPJA 2G3JA 1C92A 3WNPA 1XCWA 4AZCB 1MQQA 1LJYA 4JL2A 1XH2A 2CEQA 1E6QM 1UA7A 4PUEA 3KL5A 1W8UA 3AZTA 1PX3A 2DSZA 1FOBA 3IAPA 3AXHA 5C70A 2DT3A 5IFTA 1E3ZA 1CWYA 1EQPA 2JEPA 2E40A 3B9DA 1NOWA 5IHSA 1N82A 1KFWA 2WC7A 1WZLA 2WVVB 4D1JA 1LG2A 2VR5A 3VNYA 1HXJA 4XZBA 1WB0A 3K8KA 4U31A 4IISA 4AD3A 5JBEA 2O9RA 2G4FA 1US2A 5HOSA 2A3AA 2OYKA 4A3HA 4BS0A 4HOWA 3ZSTA 3AIVA 3APGA 5CSUA 2GSJA 1GWLA 4GXPA 2CITA 4V28A 1UR8A 3ZYFA 1UOJA 3VX0A 2DT1A 3W82A 4GZIA 7A3HA 1VIWA 2E4TA 3PZMA 4KRTA 1B90A 1V3KA 3WSUA 1K6AA 3EMQA 3GXDA 4ZXLA 1ISYA 3N11A 5A3HA 4DWSD 3BAWA 3WL1A 3UG5A 1OT1A 1CGYA 3DYPA 5A8PA 4J3TA 3ZT5A 1PZ3A 7TAAA 4TTGA 3MMUA 1EO5A 1MXGA 4WKFA 1W9XA 1J0KA 1DWHM 5E70A 1UOKA 3OLDA 1D7FA 1QBBA 4GIAA 4U33A 3TONA 3L4YA 1E6ZA 4UFHA 5IDIA 2FHBA 1V0KA 4ZXOA 4PMZA 1OBAA 5EMYA 4W93A 3ZSSA 3UETA 4MAZA 5DFAA 3WUEA 2CHOA 4MNKA 4MPKA 4CD5A 4V27A 3ARVA 3A6OA 4MNLA 1W9FA 4W8BA 1UR4A 3WN6A 3ZMRA 2Y8VA 3W53A 1E6RA 3A4WA 4M80A 1MW0A 3MKKA 1V6WA 4RL3A 2ZE0A 3VPLA 4ATLA 1JF5A 4FMVA 1R86A 3RM9A 1OWQA 2W66A 1V6UA 1HL8A 2VUYA 4FLQA 3RJYA 1PBGA 2V3DA 2VR4A 1E5JA 4NRRA 1HN1A 2BVTA 2J7EA 1CENA 1XC6A 4P8UA 3BLPX 2VJXA 1EHAA 3SUVA 3PN8A 4HMDA 4AY1A 3AFBA 3RCNA 3WIJA 3CZ8A 2DH3A 4PMRA 2OYMA 5ABFB 5I2UA 2X09A 3VD5A 3WDPP 4K68A 2DGAA 3PTMA 4BQ5A 4CVWA 2FGZA 3WH9A 4A4AA 4PMVA 4KRUA 1XGZA 1W3JA 1QI4A 4W89A 3U5UA 2YL8A 3VNZA 2IUZA 3WF1A 3ZT6A 2JF6A 1EXPA 1UD8A 1PX8A 5GNXA 2E8YA 8A3HA 2O14A 5A6SA 1LL7A 2ZX5A 3T2OA 3K8MA 5A8OA 5DEZA 4GQQA 1E5NA 3AXIA 4TTUA 4M82A 1QNOA 1U33A 3AIUA 4D71A 4PBGA 1MFUA 2JE8A 3ZR5A 4UOJA 1E43A 1BLIA 1ZS2A 4U5KA 4XV0A 3PZOA 5GQBA 1MXDA 2Z1KA 1KQZA 2GJXA 2VZVA 2ZICA 3ZO9A 3PZNA 4NRSA 1W1TA 3ARUA 5D4YA 1UG6A 1VF8A 2GK1A 1VB9A 4W88A 2BXZA 1G0CA 2WYFA 2W91A 2GFTA 4CPBA 3U5YA 1JXJA 3JUGA 1VBUA 1CGVA 4QLKA 1TMQA 1CGWA 1WCGA 4NI3A 2GDVA 4ZE5A 3CH9A 4DM1A 4P8XA 1QHOA 2VL4A 1UQYA 3TTSA 2O9OA 2XIBA 1PPIA 1W2PA 5FIPA 5HPOA 5JIWA 4OBSA 5E6YA 3W29A 4D6GA 1WCUA 2DT0A 3AIRA 4X9YA 3WEZA 1WZAA 3THDA 2DIJA 1HL9A 3DYMA 1PIFA 3OLEA 4ZEPA 2AOSA 3VILA 1UWUA 4RE2A 1ISWA 3SIMA 2EPNA 2ZUWA 3N1AA 2PI6A 2YDRA 2VQTA 3W28A 4LK6A 3NJ3A 1YQ2A 1CXLA 2QV4A 3ARPA 3GM8A 1CECA 1ODUA 2WWCA 2Y8KA 2WMJA 1G01A 4XB3A 4FLOA 1GOWA 4BQ3A 3G6MA 4B3KA 1C8YA 4PTXA 2E3ZA 1JXKA 4D6DA 5I6SA 1CGUA 3QGVA 1OCQA 4QAWA 1J0IA 1B31A 2NT1A 1ZJAA 2WZHA 2YKKA 4AEFA 1O6IA 5LA2A 1JZ6A 1CTNA 1TA3A 3K46A 1VENA 4M8UA 4JKMA 1MVYA 4UZSA 3PZQA 4FF5A 3W6LA 3GH7A 3M6DA 4Y7EA 2K46A 5D9OA 4JFVA 4QCFA 5E9AA 3MV01 1ZBKA 3ZJ6A 1DWIM 4HMEA 2W4XA 1CLXA 4GZEA 1UWQA 2CETA 2WC3A 5A6MA 2WLZA 1C90A 4B15A 1JI1A 1RP8A 3VGBA 4J3UA 3ARTA 4Q22A 5DT5A 1JDCA 3PZGA 3A4XA 2OWWA 3ZJ7A 1HKIA 1E4LA 4W8LA 3WQ4A 3FW6A 2OSXA 1NH6A 1JG9A 3AI0A 3GXIA 3AIEA 1BQCA 1QHPA 3T2QA 2J7GA 4CUCA 5A2BA 1OGSA 3WMCA 1V3MA 3TA9A 5JBFA 1J0ZA 3PZ9A 4TVCA 1LF1A 4GKLA 5A6JA 4H04A 3GH4A 3FNDA 1LWJA 3AS1A 4GQRA 4LGXA 3GBEA 4W5ZA 2XGBA 4KGJA 4DWSC 1V0NA 4CCDA 2WHKA 1UKPA 2G41A 1SR0A 1JF6A 3K8LA 4LQ1A 2UWFA 1BVZA 3EDFA 1AQMA 1OSEA 3FN9A 1BG9A 4AD4A 2WHMA 3AOFA 5A2CA 4CP9B 2VRKA 3WQ5A 5AC5A 2G3NA 2YOCA 3CLWA 3VIFA 1OT2A 1H1NA 4WJXA 4ZENA 1M7XA 2DSKA 2VCCA 3VIMA 5EFDA 1J01A 4M81A 4OOUA 1BPLB 2XPKA 3MUZ1 2VURA 1FP8A 3N17A 1HKJA 1HVQA 2J75A 2PC8A 4UZUA 1GVIA 1WZXA 2C0HA 1Q6CA 1MW2A 2WLYA 4JHOA 1E4NA 1FH8A 1TZ7A 3FHQA 3ZJKA 3AIBA 3SUSA 4WF7A 1BYDA 3AHVA 3ARZA 1UZ4A 2GK1B 2OWXA 2VT0A 1WZMA 1FP9A 1VRXA 5D9MA 1GQJA 3DHUA 3MO4A 1DWGM 1ECEA 4LYQA 2VZTA 3AMDA 3GDBA 4MADA 4ACZA 2QPSA 3OIHA 1UKQA 3CUJA 4F66A 3WQ6A 1SYTA 1VEOA 4EE9A 2CYGA 3W25A 4WK9A 2WVUA 2PBOA 1M03A 1UH3A 3ARRA 4AD2A 2WWDA 2QHAA 5M17A 3B9AA 2OLHA 1BTCA 4WKAA 3WDHA 1B2YA 4OZOA 2NT0A 3T0DA 4MJ4A 2WMIB 3W4RA 1NP2A
chains in the Genus database with same CATH superfamily
4AYGA 3ZR6A 2DDXA 1QI5A 1UOBA 3BV7A 3L65A 1XYCA 1H6YA 3SCFA 1V51A 1RHCA 3DFPA 4CD4A 1EA9C 2XBO2 5FKYA 1B3WA 1MNZA 4OHWA 2XGXA 1Y5WA 1J1LA 1TPEA 4DMIA 2VFHA 4HA1A 3WENA 4W7WA 1V0AA 2RM22 2YDEA 3WW3A 3BW2A 4MB1A 4OZXA 1BRLB 1D3GA 2Q1FA 4RD7A 3E2QA 1HB1A 4O1FA 5F2IA 1BG4A 1Y7BA 3R05A 4CEYB 4E2OA 1Q6LA 3WQ8A 2CAUA 1GJPA 1JDAA 2GMMA 2Z27A 5T5LA 5HJXA 3TQPA 2WM1A 4EANA 1K9TA 1V0MA 2D3RA 3O15A 4PFHA 1W3NA 3EXTA 4QFUA 2WZ8A 1GQPA 1XLEA 4JGYB 4M3CE 2YPIA 3H2OA 1BMV1 4NJJA 2CBVA 3URQA 3L9CA 2Z7KA 2GL5A 3TN3A 5HXMA 4FNQA 3VGIA 3ALGA 2XJUA 1Q6GA 2ZGOA 4UCFA 1XQNA 5BNOC 2V5YA 1ULDA 3EX3A 4QGNA 1W8FA 5IAXA 2PAMA 2W46A 1HKKA 4BOWA 1CGXA 1T6MA 3I7QA 2OVUA 4FPHA 2DFCA 1XIHA 3RILA 2WS93 3BB6A 3LOIA 4OFGA 3LA7A 2JK2A 3TRSB 5EBUA 2EPKX 5BU6A 1UKTA 3AKTA 3WNOA 1C8XA 5JQ9A 1KQRA 1CAWA 2BVYA 3BG3A 4URTA 1EYWA 2BASA 3K4AA 3GYCA 4KEVA 5T8GA 2ZS6B 1E3XA 1TJRA 3BXWA 5GALA 2Q8DA 1VBA2 1A47A 1EC7A 1HKMA 2NV1A 2AAMA 5A8MA 1S1PA 3TWBA 1ZUAX 1JN2P 1LHNA 4NU7A 2PDBA 4WM8C 2OKXA 1AD4A 3FVDA 3F2DA 1EX5A 2H6BA 5CZSA 1O3SA 1D2KA 4L6DA 1PK6A 1ULEA 5I78A 2VXNA 2JDMA 2ACSA 5FESA 4D6FA 3PIJA 3H2NA 2FBEA 1YFWA 5CKQA 1ND2C 3IMMA 1OOPC 5FF0A 2OZTA 1ZCCA 3EYPA 2WS91 1ZZ7A 1UOFA 2FH8A 4GVGA 7TIMA 1EYBA 2DU1A 3PVNA 4PSRA 2PLMA 5BOFA 4NYYA 5BYWA 1BXCA 2GP3A 2VUNA 1EPZA 3EDEA 3SGZA 8XIAA 3B3QE 1VYSX 4DOUA 4HK8A 4GA9A 4LMFA 4CQCA 3LB0A 1TWWA 4PEEA 2VZ1A 4YVWA 2CESA 2Y6JA 5J37A 1NQKA 5GLZA 5FZBA 5C5TA 2WLQA 1K7FA 1D4M2 3R0KA 1B4EA 3LI1A 4DN1A 4O0KA 4EV0A 4JTEA 5HPCA 5HMFA 3ZVXA 1EUUA 3UFYA 4AVNA 1RA5A 1NFBA 1GP4A 5DAXA 3GXPA 3H24A 3QVQA 2VNCA 3DIPA 1W28A 3ALQA 4QG8A 3DENA 3CV1A 5KZ6A 2WA3A 1KD0A 3MUXA 3G5EA 4QM8A 2W94A 4P9XA 1LDCA 2OZJA 1QXPA 3W0KA 1BXNA 4J5NA 4Y5SA 3OEAA 4CP0A 5IK8A 1AJ2A 3U4FA 3JZVA 2BNJA 3KVLA 2J9XA 4Z08A 4YYOA 2VCAA 1Z48A 3V5CA 4YVPA 1XGEA 2AKZA 3BSMA 4N43A 1VKFA 1V70A 2XSAA 1D4VB 4WDTA 4QQ3A 2WVTA 4B3NA 1AR72 3QZAA 2WCGA 3CAKA 1XL9A 3LD8A 4DJFC 1TUFA 5IDZA 4U3AA 4AQSA 3RM8A 2BV9A 5D8WA 3SCVA 3KB5A 2ZTJA 2O1QA 3FA4A 1WA4A 3K48A 1E51A 1NP0A 4J3ZA 5L6UA 4XF9A 1VGAA 2GMPA 1QO2A 1VBE2 4M1BA 4XPVA 1MQPA 1Z44A 2BLEA 4PTMA 4JIHA 1B3XA 3ZKYA 2VNVA 2OZ3A 2XVGA 4YZ1A 1GZTA 1OHFA 5CKMA 4N2YA 4PDWC 1IZKA 4JFUA 4L6HA 1SMAA 5JZGC 4NY2A 1I0BA 3MP4A 1OQDA 4X8NA 4QDWA 3SISA 1PIGA 4UTWA 4S2GA 3URFA 3N9RA 3BKZA 4IM4A 1TNRA 2ZUUA 3R58A 4QEEA 3PUQA 3KRUA 2P37A 2Y7GA 3ASIA 3C52A 4MWAC 1PHMA 3P60A 1HRI2 4L1WA 4LALA 4XD5A 4AEDA 4R85A 2VW2A 1UWTA 4BJHA 4D0QA 5FTTC 5LHFA 1V4YA 5EYYA 1IXQA 1QOSA 3B06A 4RW5A 1UOZA 1V3IA 1BXHA 2YCEA 4IPJA 4ASLA 3CYVA 2NPIA 2J25A 3IGSA 3VGDA 1VEPA 3W23A 2UZ9A 1JNDA 2VFEA 2PP1A 1I2OA 1ZB5A 3TTYA 3CNAA 4QR6A 1LHUA 2FH6A 2VMGA 4O16A 1T5AA 3ZSMA 2EXKA 4O52A 4FPKA 2BSLA 3W59A 4DWSA 4N53B 1XJBA 3UJSA 5CKNA 5JXQA 1G7UA 3N9QA 3QF0A 4O53A 3O3RA 2IZWA 4W6WA 3OVPA 2OOFA 2XMLA 2MNRA 2GGIA 2HQAA 4ZTXA 4IGNA 3ALFA 4UTMA 4DZAA 1GFF2 3EOSA 2P5NA 4F0KA 1ASJ2 3BG5A 1QJFA 2WSPA 2NLRA 4AI1A 2XLGA 4MWAE 2PTDA 3AMLA 4B3ZA 3RNSA 1HF6A 4XXPA 2J8TA 3IWPA 1W8HA 4PA8A 3MUAA 5HNUA 3RF9A 2F6XA 3OJBA 3VKCA 1UH2A 4KBBA 5AYIA 1HFBA 1C8NA 5FK7A 4HHMA 1LORA 3JD73 5FWEA 3UJFA 2VHLA 3VD3A 4G1NA 1QJY2 3VFCA 3ZXDA 4N9BA 4I5UA 1DZRA 1G1YA 2PDQA 3UGGA 3APYA 2OEMA 3VO0A 2ZWYA 5JDBA 3CGTA 3OBAA 2YDSA 3OQ8A 1GOKA 2NV2A 1HO1A 4BQ2A 4KG8A 2GGGA 3ZYBA 5B4XA 4I30A 2I14A 1LRNA 2WKGA 5FMCA 4H6QA 3FIGA 3OOQA 3N3MA 2ACQA 4O9EA 4YG6A 5B4NA 5BNNB 2RGMA 1ZBE2 4XUPA 3HPZA 3ZLFA 1QJX3 4TO8A 3TSBA 4DUXA 4EXAA 3H2MA 2FGLA 2ZVRA 3R2GA 3APTA 4E3TA 3TROA 1VFMA 2XKOA 1SHWB 4H7ZA 4PUJA 3JD71 3H50A 3MFCA 1IXOA 4FI9A 4QX7A 1KCKA 4YWAA 3GG1A 5H8UA 3C2YA 3G1XA 4HJFA 3WLRA 5AHIA 2VU9A 2A79A 1CIUA 4CRQA 2XG9A 4KCWA 2WSYA 1TUXA 2G95A 3H2AA 3S9IA 5CPOA 2WSVA 4F0MA 3LV6A 4JICA 1ZQ5A 3IACA 4Q8MA 3DN5A 4IGMA 1HJSA 5J98B 3CZJA 1XLDA 4GYPC 3U3HA 2GC1A 5E0CA 4B4HA 2HWB3 2XXZA 1BSLA 2QCEA 2BBFA 3A12A 5I23A 1I75A 3B4YA 3EWUA 5AHEA 4LSBA 1QJX1 4E3VA 3PTDA 4EWJA 4AHZA 3KV5A 2PAEA 4ASTA 1BFNA 3S2NA 1W6OB 1AR93 1XYBA 2L9LA 3FKRA 3M0YA 1CX9A 1YIXA 3GNEA 1DE5A 3FSUA 4A8LA 3SCPA 4PEKA 3FYPA 2YDQA 4X0VA 3UXDA 4NIGA 5REQA 5A6AA 3VDHA 1NLRA 2ZGTA 1OLMA 4ORIA 1UWSA 3R0UA 1DYPA 3UVIA 5ABEA 1NWTA 1H7NA 2YZ5A 3EKLA 4IX0A 4K6BA 1PO22 5I7GA 5GLTA 2Z26A 4AZCA 4N90A 3IV3A 1XE7A 4NHLA 5EY5A 3W5MA 4MZYA 5IUQA 4LPLA 1RA0A 3M9YA 4AMCA 1QJU3 1TME3 2X8RA 2ZADA 2P3EA 4SLIA 4NJIA 3BLFA 4ASMB 4JHTA 2HNHA 3L66A 5CXPA 1AG1O 1LRQA 4A3ZA 3VDCA 1H63A 3BTZA 2WO1A 1YQ6A 2E09A 4XKYB 1W1VA 2V3FA 3FYOA 2ZRVA 4JBRA 5DMMA 1ISVA 4WR3A 1PZ8A 1BBT2 2YBTA 2XFYA 1LOGA 3DBPA 3WDYA 1O5XA 2PC4A 3QQWA 4MGKE 4KPLA 1WBLA 2WZTA 4ZO8A 2HVOA 3RPMA 3CAVA 3B9IA 1GONA 2HJPA 2ZTNA 3E97A 4UR7A 2PZNA 4FPOB 3KRBA 4QG6A 1ND2A 2FB2A 1OOPA 3LCXA 4TVUA 1HKVA 4LHKA 2Z2BA 3AHTA 3T05A 5K0UC 3H8AA 3MMTA 1QQP1 3TFCA 2X41A 4M6QA 3RYRA 3I2DA 1QJU1 1TME1 5C8CC 2IQ0A 3HQ1A 3CZLA 5MF5A 1OVPA 1A6CA 2IMRA 1ZLPA 5JXHA 2W62A 2JIWA 3P6LA 2W92A 3HQPA 3HMJG 5FYMA 4XUYA 1QWGA 3D6NA 1QATA 1NA1B 1WAUA 4AXKA 4OT7A 2YSWA 3RLVA 2VZRA 2XIJA 2HXTA 2VOTA 2VZUA 2W63A 2GJXB 3C3VA 5F5IA 4Y8EA 3O1VA 4DYJA 1W5MA 4EKJA 3HG4A 3PZUA 2ZXAA 4MVTA 4LAMA 1LKNA 5FJUA 2B9UA 4IE0A 3BANA 4LEQA 1O94A 3HQOA 3M4FA 1KTNA 3NXFA 1WV2A 4FPSA 3NWRA 2ARXA 3IVTA 4XTPA 1U83A 1Q85A 3P2VA 3OPZA 1K1DA 1KBKA 5KINA 4ORMA 3MSDA 2HTMA 3NL2A 3NYDA 3SGUA 3PG9A 2X8KA 1A78A 1ZBA3 1KBBA 3PBYA 3A3HA 4Y24A 1KDKA 2OSYA 1W1YA 4YMZA 2I17A 2Q30A 3N9PA 4JTNA 3FMGA 1WD4A 1M7PA 5EGRA 1LHWA 4ES8A 3AZRA 5F6KA 2PAJA 4E8DA 5JXIA 2VYOA 1IF2A 4YTUA 3TA6A 3ZFFC 3LPGA 1H0GA 1GVSA 2VRJA 3FOKA 3VBSA 1N1SA 1ME8A 4AIUA 1GZGA 2ZMKA 3AJYA 1MZHA 3W83A 5H8PA 1EJVC 1F6YA 1GQKA 3CAWA 4AYUA 5FJTA 5J36A 1J10A 4N8MA 4BIFA 4YL2A 4YW2A 8XIMA 3F5JA 5LEKA 1GZWB 3U0HA 4FXSA 3F4CA 4XD6A 1UX6A 3FDKA 1JZ3A 4LOTA 3K1DA 1AJZA 1P6BA 4IL2A 4G2DA 1H3GA 5JZGA 2QCDB 3CLMA 3AMNA 1QAPA 1ZM1A 3G24A 1O8PA 1PKYA 1QNVA 1RUF3 2RHGA 3WF3A 3ZSKA 1K12A 2A6VA 3UGVA 1BTMA 3K13A 2OPJA 4CUBA 3EDJA 1UR9A 1XRVA 2RS13 2EPOA 2KAUC 1IS5A 4OIFA 4LVBA 3SCNA 2X40A 1EA0A 4AQ6A 4IPLA 3MDWA 1V3HA 2CHRA 3VGHA 2VEMA 3VBOB 1QNRA 5FP8A 2FPYA 1W54A 1GT8A 3N7MA 2DQWA 4P9LA 2VC5A 3N9NA 3PB2A 4HKOA 1HP5A 4ZO9A 3U78A 4Q1PA 2E6AA 3AP5A 3OBRA 5JPMB 2CKSA 5H9RA 3VDDA 3S1VA 4F0SA 5C2GA 1EX1A 4HA3A 5LNRA 1R2TA 4CUGA 3EWZA 1SZEA 2R91A 3OTFA 4LYPA 2UY4A 5CC7A 2MANA 1TVNA 3KVAA 3OUHA 2V5BA 3DFHA 3CIVA 4AC1X 1RUF1 4EQVA 1RIRA 4H2CA 3EQEA 1VBHA 2PD5A 1TVLA 2WJZA 3LXAA 4GNJA 5E9XA 4LYKA 3HIJA 1ZL1A 4FBFA 4UAPA 2GPTA 2FTPA 4LO7A 2Y6LA 2D6MA 3EJKA 1GNXA 1RVKA 1TJPA 3L2LA 4CU6A 3SSZA 3GXFA 3T1GA 3EX2A 4CDQB 2B4KA 2WBGA 3K3NA 1JULA 2A3EA 1PTDA 3G6JB 4Q2FA 4FNSA 5LIUX 4DXXA 3OPSA 4NN0A 1HJWA 1GOQA 3MHUA 3WNLA 4PFMA 4YJ5A 1FWEC 3DHDA 4MTVA 1PEZA 4WZCA 3LAGA 5BXSA 3DKQA 1Q6DA 3NOEA 2EIEA 1FWRA 1VBC1 5K4LA 4UXDA 3UGFA 4QDRA 3OQEA 1NQDA 3SEPA 3VOHA 3MCMA 1CAUB 1AH4A 1PTAA 1CLVA 1PVC1 4ZQPA 4NZ1A 3MLLA 2FPVA 4UC5A 3W84A 1DQ5A 3ZN6A 4R9OA 3THAA 2FZ1A 1H6XA 3KBWA 1KWKA 5FCCA 2ZGRA 1JD7A 4QRNA 3GBWA 2V63A 3TYEA 1VMFA 2JIGA 2V09A 3IDCB 2VO5A 3RZJA 2QUMA 3CHEA 1JFHA 2VXJA 3V0AB 3O1PA 2NLYA 4C6NA 2TYSA 1LRHA 3CF6E 1REQB 3TYZA 1XU2A 1V6KA 3R79A 4DEVA 1JBCA 3CHDA 3I65A 2D7FA 3KSCA 2X53S 1ZHAA 2NQYA 1W1B1 1J8VA 3WLHA 1EJWC 1DWJM 1RTVA 3HT1A 1ESWA 1YHTA 2WBKA 3GZUC 1NM9A 2WJDA 2G9GA 4GUFA 3VABA 1EAH1 3PVBB 2WZPP 3S1GA 3RU8X 1CEOA 3CPGA 2EF6A 2GZWA 4GI8A 2DCTA 3WMBA 1OGBA 4D6EA 2XJRA 2DCYA 3IPVA 4RDYA 4UNIA 3V36A 2BFGA 5CFCB 5G2WA 1RVF3 4HYWA 4DJEA 1ZJIA 4KCVA 4JS3A 3O05A 1Q8AA 5C2XA 2JE9A 1OADA 1BYCA 2FCVA 1QNWA 4OE7A 5LCWL 3VHRA 2PD9A 4OV4A 2WZR2 5BOEA 5XIAA 3SCGA 1S2AA 1DF0A 4H6RA 1VB2A 4G56A 4QAIA 3E38A 1VCGA 2B42B 4ZKTB 2ZX6A 4HONA 2Q3RA 4WLCA 3BG9A 1SJAA 4ACZB 2SBAA 3ZKUA 1RCOB 2QQVA 1XLGA 2WNZA 2FDJA 5A3MA 4JTTA 2V72A 2UU8A 3ARQA 1MEC3 3QN3A 2JEMA 4YXGA 4CD7A 1LTDA 3YPIA 1QJEA 2C1GA 2XR4A 3WXPA 3NVCA 3PPHA 5T3NA 1R64A 4KCTA 4GKYA 5EJ3A 3U4SA 3MPBA 5GVJA 3O7OA 1W32A 2DTYA 1EP0A 3IIAA 5AVNA 3QGKC 1YO8A 1GQNA 3BOPA 1UPPA 1DXFA 1XU1A 1FCQA 1DQ0A 1X1ZA 2H6CA 2ZX3A 3RPQA 2G3FA 4KGGA 4F2UA 3W9ZA 4IG2B 3RDKA 3SY8A 1OEPA 4AY7A 3E6EA 1Z7S3 6TIMA 4AG0A 4IV3A 1HV1A 3XISA 1QWKA 4UT5A 2LS6A 3V3WA 1I60A 1MEC1 3THCA 2VZSA 4ATFA 3EBVA 4IFOA 1P43A 3W2JA 4AF0A 2Z1VA 2WMKA 2QJIA 3B0UX 1WQ5A 4JIQA 3TJLA 3VKAA 1E4MM 1IZCA 1GP5A 3POFA 1V6YA 2PWVA 3GXNA 1V02A 3I3QA 2BEOA 1DPMA 1ULCA 4CP9A 1CYGA 5HUPA 1AL22 3ECQA 3IAQA 5ANNA 3G1AA 4JEJA 2I74A 1QPQA 4LNVA 2XFFA 2PDFA 3FHIB 4UF0B 3WCRA 4I0WB 3P80A 2R7EB 2H3DA 2V2CA 3PNUA 3AUOA 2WCAA 1ZBWA 1BSIA 4O4VA 1RHI2 2OR2A 5FZGA 1DTUA 3WG6A 2DFAA 3ZIWA 4J7RA 3A4AA 2QAPA 2GDUA 3I2JA 4Z82A 2BVWA 2O0OA 1E6PA 1E1CA 4W87A 1L6GA 4B5NA 4BQXA 3WKZA 4OJYA 2DEPA 1U1JA 1AK5A 1VPQA 1Z7S1 2WFF1 1XOYA 3O16A 4LO8A 4P9IA 1U5IA 4K40A 5K0UA 1CGTA 3U10A 3AB0A 1UY0A 4YM0A 5C8CA 1UBPC 1LLWA 2NV9A 3T44A 3BCFA 2G9FA 2Q02A 2XISA 4IXLA 1V6LA 1VQTA 2XWBB 1UIKA 3PR2A 4IP5A 5ABJC 3V0TA 4KS0A 4B7EA 4HVOA 1NCRA 2ZAAA 2Z4FA 5IW0A 3OBTA 4KRZA 3CPUA 2VMCA 4MGSA 4YTRA 3TR2A 4HZ7A 2W1SA 3N9SA 3N29A 4XO7A 1JW6A 3NJYA 2Y70A 5CBBA 4XG1A 2JKAA 4HN4A 3EDKA 4IQLA 3DFOA 3WD4A 3MUY1 2VEGA 2BQPA 3VBUC 3P8IA 4RZ5A 4Z2LA 3MW2A 1UP2A 3W7EA 2ZZ2A 2EXJA 2LTNA 5FO8B 4DJDD 2WMIA 2LRPA 2GGJA 1JNEA 2E8ZA 4HHLA 3M44A 4TN7A 2FDMA 3G1SA 2G3IA 3ZYRA 2QR6A 1LCOA 3B01A 2Z28A 1HV0A 4AI2A 3GDKA 3T0TA 1V77A 1ONXA 2WRAA 4KWVA 3TTOA 3HGSA 3G18A 4IE6A 4GO9A 3GFXA 3WK3A 3VOFA 5DCBA 3MS8A 1YTKA 3GTNA 2PN5A 3W2LA 3EX4A 2IC1A 4QX5A 3EWCA 3VN4A 3WINE 3SUWA 5A3WA 5J09A 4YN5A 1MW3A 2DUQA 1Q4NX 3MIBA 3ZXJA 1RP9A 4D7YA 3DEQA 3M70A 1UZWA 1RCXB 3HZ3A 2PHDA 3USSA 4DYKA 4IEOA 5LNUA 1Y7VA 3E5PA 4E0CA 2D40A 1R2SA 3LXBA 2NSXA 3URNA 2ZBJA 3OA5A 2YW3A 3APBA 1AZ2A 3MLKA 1LRTA 1TCMA 3S47A 4D94A 3M64A 3GDTA 4J1WA 3H8RA 3FXYA 4XZNX 3RITA 1AH0A 5FP4A 1JD9A 1I3HA 4GNVA 3WH8A 3H3UA 4Z2KA 4GK8A 3UZWA 3HBKA 3RYSA 1NWRA 5FPUA 3LE0A 1OFAA 2VOVA 1TMHA 1FWTA 1WOAA 1FFQA 1WUEA 1NYWA 4I01A 4MZ1A 1ECQA 3WUGA 4NG3A 4WZHA 2P53A 3GW0A 5HAOA 3L4XA 2BS9A 4AIEA 1TJ2A 1XINA 5JSRA 1JCMP 1RJPA 2WPGA 3VBRB 4W8JA 2EPHA 4NZCA 4URIA 2O56A 1DQXA 1TWSA 4ICMA 5FPAA 2IPWA 3B9NA 2EF9A 4RKAA 3AISA 4J6GA 3AS0A 1QMJA 4AVSA 4QG9A 1XPYA 3WG3A 1ZZ6A 3FWEA 2WFPA 1A3KA 4AZBA 4ZOBA 2GC3A 4Q8WA 1WA3A 2XM1A 4XUQA 4PUDA 4W7VA 2ZUNA 1XE0A 3B8TA 3AQUA 3NDZA 4CDXB 1EIXA 2WVVA 2V9DA 4WHBA 1R47A 2AQWA 2P0IA 4DXSA 3BZJA 1JH5A 1TPC1 4H41A 5IVCA 3J8F1 3I3DA 2GP5A 3C0QA 1DORA 4O61A 1UWIA 1MZ5A 4JRAA 1VBD2 3IJQA 6PTDA 2A0NA 4HMCA 2Y26A 3A7QA 1Y9GA 1GPFA 5LGZA 4QXHA 2HV5A 3QQ1A 3ZLIA 3IV8A 3WQWA 4CCOA 2VVEA 1T41A 4Z8BA 4W4QA 3F95A 1XIFA 2ZZ3A 4CNUA 1WLDA 1XIMA 4A2RA 4NX0A 5U4NA 5FYSA 4QM9A 3OUJA 1NE4A 4I7UA 2NQJA 4HKWA 3QR1A 1Z41A 4KKXA 3C61A 3KFTA 5JU6A 1NXD1 4WCJA 1QT1A 4W65A 4Q4W3 5A70A 5HWJA 1EZWA 5LEJA 4HNNA 3VUSA 3E2RA 4U5IA 2ZMNA 3B4UA 4WSJA 1VPHA 4M01A 2Y6GA 4XCAA 2Q09A 3CMGA 1ACCA 5CPTA 4X3ZA 3BAJA 3AX4A 1V6MA 3CUGA 1D7PM 4LVAA 4M4PA 3M6YA 3OGGA 4JTQA 3SCSA 1QOQA 2YX0A 3CUZA 2ZZ4A 1S2BA 4FNTA 2CIPA 1RK6A 4V1YA 5KMYA 1HIXA 1GW1A 3RR1A 4I9AA 5LZ6A 2P4EA 4WOZA 4FTEA 2BGOA 2AEYA 2V30A 3NIYA 4DRSA 3FEQA 2ZGLA 1S5NA 5A3OA 2ZABA 2JXAA 1O3TA 1DHPA 3TJXA 4C6DA 3BAKA 4B4FA 1C8M3 4MNMA 4Q4V3 4GYFA 3CJIB 3WQ1A 5T52A 4Q4W1 5FJRA 3UR7A 3HBLA 5HUOA 3IVSA 3N4EA 4YLZA 2VVFA 1R082 4HXCA 4HNVA 3LSDA 3MWCA 2QCCA 1QXJA 4XZPA 1TYGA 1ICSA 2DSVA 4JIIX 1QH7A 1V6VA 1O12A 2EPMX 4DZGA 1J12A 3VZYA 5CG0A 3HEIA 1VJZA 1GK8A 4EPBC 1W3LA 4MYAA 3FDGA 1FPN2 1ME7A 3WEOA 4CEYC 5DQPA 4XKMA 1KGYA 2BGPA 3NURA 4A22A 4E4PA 1OABA 1Y5VA 1X8EA 1T96A 1A3HA 4MJ2A 3NSMA 4EVZA 1AMYA 5ENLA 1HO4A 4JGYC 5BMWA 1XUUA 2XUCA 3NL5A 3PTYA 5C54A 5I8YA 1YNPA 1JHJA 4Q4V1 2D69A 5GNZA 3I7SA 4DB7A 3F5LA 2R94A 1QY4A 1JPMA 3LRMA 1SR9A 4QP0A 2BERA 1JXNA 4DO0A 4HA4A 1TV8A 3EMZA 2LROA 3M5VA 2D0GA 4ACYA 1UWRA 2Q1MA 4DM2A 5H91A 5I3KA 2FZ9A 3GJBA 2HE5A 4PMYA 2WHJA 4QDQA 3QM3A 3KAOA 2CC0A 3W27A 3OBZA 1ITCA 4FB7A 4FHAA 5G1TA 2G5WA 4B9ZA 1Q6EA 3T0AA 5CG8A 2D6LX 1XSJA 3NO1A 4M00A 1BMV2 2E7TA 3I54A 3BH4A 1SBDA 1HB4A 5GJNA 3T7VA 2FHRA 3KT4A 1Q66A 1DCSA 3H7UA 2WN3A 1NDYA 3R5EA 5T9CE 1NQ6A 1U5YA 4OYUA 3QTGA 3BAIA 3R4IA 2ZUSA 2GDQA 1J0HA 1TRIA 3W21A 3VV1A 4XD3A 5LXEA 3EOEA 1SFNA 3U9IA 4IE5A 2ZGQA 3KM8A 1AFSA 4ZODA 4Q0VA 4L2NA 1ADDA 1EYEA 2QDHA 4FSJA 3KOFA 4U2AA 1H7WA 3KL5A 1UNBA 5AC93 1PX3A 3N6QA 1FOBA 3IAPA 5BMXA 1W3XA 5GJ6A 1FHUA 1YXDA 1M5WA 3WQEA 5C70A 5IFTA 1SSDA 2VBPA 2HEJA 1H1ZA 1MVEA 1EQPA 4S23A 1IPSA 1XDLA 5IK4A 1JYIA 1JUKA 1BEV3 3LTPA 4FZIA 4XFHA 1XLIA 3C56A 3NFUA 4D6SA 4RPPA 2QDRA 5GZCA 2DZXA 3AYDA 4AEOA 1MR5A 2VR5A 5GJPA 5CYYA 1KTCA 1HXJA 4L7ZA 4P61A 4IISA 1XIJA 3LS9A 4FPCA 3G77A 2G4FA 1XW8A 2NX3A 5T26A 3THQA 3VZXA 2WS92 5HOSA 3VBUA 4XHXA 1B09A 1Z69A 2A3AA 2OYKA 1FNYA 2EIGA 2R1PA 3UK9A 2GSJA 3W20A 3AYAA 3A13A 1GWLA 4YGDA 2ZQ0A 4H6KA 5AC91 3WK1A 3MF9A 3ZYFA 3F7JA 4ZBCA 2D3PA 4FALA 2YC0A 2AH2A 1OX4B 1JVNA 3PAOA 3ZMOA 1VIWA 3PZMA 3W02A 4Y22A 3DXUA 1LBMA 2JICA 4FOVA 3WSUA 1BEV1 2WT1A 2FIQA 3KGZA 2FQPA 3WQCA 1ENUA 1ENQA 2WNUA 3DPRB 3BAWA 3IMNA 3WL1A 1OT1A 2HWC3 2BOGX 3IARA 4DB5A 5A3NA 2D3SA 4Z1CA 3RMXA 3DYPA 1SZFA 4AHYA 5A8PA 2WDBA 3MCNA 4A21A 1PZ3A 2HXUA 2I5GA 3ABZA 1G9BA 4FNPA 3G1HA 4WKFA 1M6JA 1SJDA 4NIHA 1DWHM 3WDVA 3NQ2A 1QFEA 1TQXA 4XZ9A 4QB2A 4MSSA 3UJQA 5D37A 3P5ZA 3CH0A 1C3HA 4U33A 5LASA 3FJ4A 3P84A 2JG8B 4MGZE 3UW6A 2QUVA 2FHBA 4IIBA 3V1HA 4RHV1 4H3DA 5D05A 5EMYA 2J6VA 3T78A 1OQEA 3ZLHA 1H4HA 5FOBB 3IIZA 3ZVHA 4CD5A 3P8JA 1C1LA 4MNLA 4R7WA 3WQPA 1UR4A 5B2GB 3O1OA 2FMYA 2Y8VA 1IPJA 2GNBA 2HWC1 2XWJB 3BODA 1SO4A 2BPA2 1MW0A 4XSLA 3GX9A 4RL3A 3VK5A 2ZE0A 2PHTA 5EP9A 4E27A 1JF5A 3MY9A 4FMVA 4QSHA 4EX4A 5CJNA 2VOKA 3K75B 2VUYA 1TREA 1AQFA 5FXWA 1HN1A 3UR2A 1X7IA 2BVTA 1ULFA 2Q8LA 4YYCA 1XC6A 3C2OA 3QEZA 4N9CA 4Q4RA 2IUWA 1BVVA 2VJXA 3SUVA 1OUSA 4US5D 4N53C 3PJTA 1VZWA 2R1NA 3BPZA 3ES4A 3PURA 3WDPP 4K68A 2BOEX 3H42B 2DGAA 2WJSA 3LV5A 3PTMA 5DCEA 3HG2A 5FMOL 4I09A 3QPZA 4EWND 3R89A 1G4EA 3L0NA 1ZJHA 4NMIA 2D97A 2VP8A 4DY5A 3S6DA 4KRUA 3LKJA 1WLTA 2XONA 1IHMA 1R0MA 1QI4A 4W89A 3U5UA 3TNBA 3A64A 3SIZA 3TCEA 3WF1A 3ZT6A 2JF6A 1EXPA 5GNXA 1LB2A 3LLXA 3PBWA 4KCUA 3FK4A 3LA3A 4I6KA 4LITA 4Y33A 3LNPA 2ZA2A 1JODA 1O8SA 3T2OA 3WLOA 4QEHA 4MGQA 4GQQA 3AXIA 3I6TA 1W8OA 1MUMA 2GUBA 4PBGA 3EZ4A 1SO3A 3AC0A 4UTHA 4UBGA 2QQPA 4O0QA 3HQNA 1YYAA 4I90A 4XV0A 1W5PA 2RMU3 3PZOA 5HJLA 4S3FA 2Z1KA 4FO4A 4S1FA 3PZNA 5TSWA 5HMSA 2A6XA 2GK1A 1VB9A 4W88A 4PB5A 5U7SA 4DF2A 1XISA 3M43A 3IDBB 3REQB 3OJGA 4P5HA 1ZAIA 2QJHA 3CLPA 3U5YA 1CAVB 2VTXJ 3JUGA 1F8MA 1VBUA 2X5IB 3W87A 4QX2A 3FX3A 3M2MA 4GMP3 4FXFA 1CGWA 5MHBA 5BNNC 1OVSA 4B5TA 2X1SA 4TMCA 2GDVA 2PDXA 5LK7B 3WK0A 4HK9A 4NZFA 3GCXA 5E8AA 1JOBA 2PP3A 2VL4A 2Z5WA 1UUOA 3WJWA 1YQ5A 5FBZA 2O9OA 5HBAA 2A3WA 4YWSA 5HPOA 2GVGA 3K4ZA 5E6YA 2IVJA 3AIRA 2PZ0A 1GYLA 2HWD2 2FVLA 1P6CA 3CUXA 2WT2A 3ELNA 1HL9A 1PIFA 1ISWA 2RAGA 1RUG3 3C0JA 2EPNA 5M2FX 2NXHA 4CNTA 3N4AA 5LIYX 4WJEA 4NJKA 1ULOA 4YARA 1FXPA 2C6QA 1UKRA 5IAVA 1TZZA 1WMDA 2QV4A 1Z8AA 2PGWA 1CECA 1ODUA 4FPLA 1MZFA 4QQPA 4GMP1 4XB3A 3MBFA 2OQYA 4IMEA 2FMDA 2XN0A 4QKNA 4Z2AA 4CEYA 1AX2A 3MEPA 4LF2A 1XPWA 1SDWA 3IGHX 3M16A 2J22A 1WCQA 3LCPA 1XIDA 3FLUA 1ALYA 1J0IA 1K45A 3R0RA 4AWUA 1X97A 3GS6A 1RUG1 2NUXA 1D7KA 1OLRA 4MLRA 3ACGA 5FZEA 4Z17A 4UZSA 4GGBA 3FLTA 5AC6A 1R1ZA 2GSEA 3MCOA 2GJNA 3M6DA 2K46A 3W88A 5E9AA 3T30A 2C13A 2F2KA 3ZJ6A 1QXRA 1QJX2 4DHGA 1W2UA 3TQ0A 3R6IA 2ZHKA 4ZO7A 3GAYA 4LC6A 3EA1A 1C90A 4B15A 1JI1A 1ZZCA 1WW5A 4J3UA 1UOGA 2CAVA 1L6FA 3GXTA 5DT5A 5DXXA 1S38A 2NXGA 4QROA 2B4GA 1DDLA 1Q8QA 2IVIB 1PYMA 1W0PA 1RUOA 2C79A 5FSEC 5K9YA 5F5AA 3W7HA 3S7IA 3O7UA 1TZOA 1LT8A 1L2QA 4U28A 3WQ4A 3N36A 4O0ZA 3C2RA 2OSXA 4KETA 5CAKA 3ZPYA 1I2PA 3MBWA 3W58A 3WLMA 1BQCA 3BICA 3VL8A 1Q8VA 3HPNA 3PPFA 2B5HA 2CHHA 1STMA 1XDJA 2HWB2 4JQAA 3PZ9A 8RUCA 4JOMA 2CGPA 4G7EB 4TVCA 3EMRA 2VMIA 3WP3A 4JX6A 1B35B 1UYXA 4QHBA 4XXAA 3NQEA 1J2WA 1XCFA 3SQMA 1VLNA 4EXBA 4LT5A 1TPH1 5A6JA 1JOJA 1PHQA 5D2TA 3W9AA 4C5YA 1R093 2CGNA 3FNDA 4AHOA 1AR92 3AS1A 2HYKA 4GQRA 3D0JA 3W5NA 3GBEA 4W5ZA 1JPIA 3LHZA 2Q0AA 4KGJA 4FFFA 3ZFGA 1UZHA 1V0NA 2ADAA 4CCDA 4YCPA 4KEUA 5FLIA 1I8JA 1REDA 1O68A 2G0WA 3K8LA 1NA1C 1FWSA 1UD1A 3S1UA 1OSEA 2WQDA 4BXSV 3IVUA 1BG9A 4NZ5A 1SM9A 1UIPA 4LB3A 4AD4A 4O12A 4H7CA 4UYBA 3C0LA 3CLWA 1XRUA 4WJXA 2PGFA 1E0TA 1F6PA 1R3VA 5GZGA 3C8NA 4KEMA 4IH3A 1J3RA 2DSKA 3UPMA 4KWOA 1QJU2 1TME2 2WQ4A 1J01A 4M81A 1R091 3GHUA 3U11A 3P5BA 2CU0A 2X16A 1WUVA 1RINA 3N17A 1EF3A 2PC8A 2J75A 1EV13 4UZUA 3PMSA 3WSOA 1XPGA 2WSUA 3WR0A 1WZXA 3FFSA 4DINB 2VC6A 4L65A 4JXCA 3DG3A 1E4NA 3FHQA 2RJLA 1W05A 2BOFX 4WF7A 7ENLA 1UCWA 4QNEA 4Q8VA 3OODA 2VMHA 4LIUA 2QJJA 2HMCA 1FP9A 5FMOS 1VRXA 2D2GA 4A3QA 3C8XA 4S2CA 4JZRA 1F15A 5FKCA 5KWRA 4IGQA 3GDBA 4MADA 1EJRC 3S46A 2QPSA 1XKYA 3AP6A 1FDYA 3ONBA 2NVAA 1B54A 1VCVA 2WWSA 4F66A 1TKKA 2ACRA 4P9WA 1YTEA 1V6IA 4F2BA 3UJ2A 5IK5A 3HM7A 2YCLB 4D69A 1YFXA 4Q4SA 1Q56A 1B2YA 4OZOA 4QE4A 4MJ4A 1EP1A 3LCIA 3VKLA 4A2UA 4JTCA 4XAPA 3B69A 5FZ4A 2XL9A 1ONAA 2VNOA 1QNYA 5APAA 6ALDA 3ZPOA 1N1YA 4Q4QA 1PIV3 3SITA 3VBOC 1NAEA 1ADOA 3UG3A 5LNWA 3ZSLA 5FKBA 5I3JA 3HU7A 3MIGA 3IIXA 1M9HA 4QGMA 1KGWA 2IWGB 3VKFC 2D2JA 4P08A 4RJEA 4QPGC 3UGRA 4LCQA 5D2AA 1OGGA 1QOOA 3WUCA 1YPXA 4K21A 4AFAA 3N15A 4FR6A 2JG9B 3TN4A 2HJIA 4JTOA 3MI2A 4OQ8A 3SI9A 5FZLA 1OJXA 1ZBA2 3LRLA 1UWAA 1ZNNA 4AE2A 2V6AA 3UQNA 1ZP3A 1U5JA 3HURA 1EO7A 4PIXA 2VX4A 4N53A 5DMNA 1POQA 3AAMA 1GVYA 4B3LA 3GC4A 4KG0A 3O0KA 5B7YA 1RJ8A 1PIV1 2EEXA 1GWMA 1QH6A 2F8QA 2HRWA 4CDQC 1U12A 3SFKA 1HRV3 3ZR4A 2WMHA 4GRSA 1E5SA 2WNEA 3ZO0B 3XINA 4BPZA 5LZLA 2YG0A 1WXZA 3ARXA 3TV8A 3AMPA 1R1A3 3N3HA 3F2BA 1IV8A 2FDHA 4Q8NA 2VM8A 1RUF2 4FPEA 1E40A 4CGTA 4YFWA 2BHZA 4YVSB 2V3EA 3GNPA 3VCCA 3I10A 3MI3A 1W1A1 3IGXA 2RS12 2QIIA 1CXHA 3VC5A 1US3A 1W6NB 3HJRA 3IJLA 2BP1A 3K3OA 4JTLA 4IEWA 2P3ZA 4PMUA 4S3JA 3UJEA 3AS2A 2K2SA 2VUAA 5A94A 1UKSA 2CLHA 1VBJA 3VIPA 5C9XA 3W1NA 4RNHA 1RJ7A 2VQAA 5DQ0A 1XE8A 1HRV1 1C7SA 5HMDA 4WXYA 3SY1A 2ZX4A 3OO2A 2ZUMA 1BQPA 4HB7A 3VZLA 1SLTA 1X8MA 4OBTA 4E8CA 1VYRA 1XYLA 1SMDA 5FF3A 2NQ9A 4Q8TA 4C6FA 1R1A1 3NPUA 4DYEA 3ZYIB 3CT2A 1H2MA 1O7AA 3BOWA 3T07A 4KGLA 2JWPA 1ZZ9A 2O4QA 4GQBA 3NCOA 4Q32A 3H3LA 4M0NA 5ECUA 4AR2A 3SCQA 4H7LA 5FA5A 5CBLA 1RPKA 3RMYA 5CFCC 3O1UA 3HPXA 1GOFA 3PSWA 2FCTA 3VDBA 3AICA 4YYFA 4XIKA 1JYWA 4RS5A 4O7XA 5DZEA 3TUUA 5FZOA 4NPMA 4NAEB 3PF3A 4FOJA 1W9UA 1D8WA 4PUMA 3WY6A 2OOGA 1KLYA 5HJYA 2OZ8A 1OUXA 1SLBA 1DEDA 3QJAA 2ZHMA 2VTXA 1W04A 3AMMA 2J77A 5FK8A 1OFNA 4YIWA 4D6IA 5BUVA 1JGIA 5FRAA 5M5DA 2GDFA 3R0DA 1GKBA 1M1BA 4R5EA 2Q71A 2KXLA 5FJKA 4PR4A 4GWJA 4YVXA 3ATZA 3G0XA 1UYQA 1BK0A 5LRSA 3UU0A 1XNBA 3WX5A 1HGYA 3VBFC 4BCUA 1OC1A 4B4PA 1P0BA 5JOXA 4FAMA 4DIAA 2C3ZA 4DPNA 1HJXA 3VKBA 3RI9A 3VZMA 4CEUC 3DF0A 2YYUA 3N04A 1IT8A 3RLHA 1UX7A 4IX2A 4FFIA 1XG4A 3A22A 4RGAA 1R7AA 4KWKA 1W2OA 1HL2A 4X6RB 1OF6A 1NAL1 4XUNA 5BCAA 4KU7A 1DQ2A 4JCMA 4DO7A 3BTNA 1IEQA 2MEV1 4QDSA 2ZGPA 2B39A 1OXCA 3BE7A 2SFPA 1R3TA 3WLNA 4PRWA 2HH9A 1RVF2 4FK9A 4XKYA 4K8RB 3W74A 5FOOA 3J7NA 2V2DA 2EXIA 1PSCA 4UFLA 1FWAC 4L9ZA 3UZZA 2W2IA 4AEJA 3QYSA 4GUIA 2DU0A 2EALA 3BAYA 2QNKA 2X1IA 1DWFM 1EUNA 1GKPA 1R3YA 1OA2A 1JCXA 2WSKA 1IG0A 4DUWA 3TJIA 1TCDA 4MDPA 4LAKA 3DHPA 2TEPA 3CKHA 1WA6X 1KGUA 3AZXA 2I56A 1FWWA 1MEC2 4AGRA 2PRHA 5AFDA 2DCZA 4Y26A 1T8QA 2REQB 2O7SA 3SH5A 3R25A 2F17A 4XETA 1VAHA 1MRAA 1R87A 1IXNA 1D3CA 3KOXA 2W1UA 4LEJA 2AGSA 5FXZA 2ZZ5A 1JFXA 1LLOA 1GZJA 5F1VA 3SJ3A 1JYCA 2HNEA 1JGMA 4Q3MA 1CAXB 5FYYA 1MS8A 1E5IA 2BNOA 3JQWA 1LOBA 3NQDA 1PHWA 3EA2A 1RY8A 4BQ4A 1OZQA 4A8NA 2H90A 5AC8A 8TIMA 2UY3A 4AF9A 4HMZA 2WJFA 1JJKA 1S0CA 3S3GA 3K4WA 1MW1A 2R6OA 2E53A 5K9DA 1Z7S2 5SV5A 5H8MA 5I3FA 2ZUVA 5CFDB 3TJ4A 4KMQA 2DW7A 5FD0A 2R6QA 3MTWA 4A29A 1FV2A 2Q1ZB 1TJ1A 3VKKA 2RR13 1UY2A 1UD5A 1RQHA 3KOZA 3VUPA 2QCNA 3UWUA 3M0KA 2QKDA 3HJZA 3LNMA 1FWCC 2C0AA 4XFIA 4YZ5A 1WKFA 4AFCA 1OVDA 1MRQA 4HPKB 1OFEA 3ZIZA 1PO13 4JTIA 4D8AA 2Y0IA 3O63A 1COV1 2BXVA 5BXRA 4OHXA 1XUZA 2JIEA 3QSRA 3ME3A 1YJLA 5F2GA 1YE4A 1MFVA 3CDZB 2ZIDA 5E0FA 3KV6A 3HFTA 4L99A 2UY5A 4GKTA 1POJA 4H19A 6XIMA 3ORJA 3PPGA 1SGJA 3IKWA 3KVBA 3AIWA 4HPHA 3ZJ8A 3SCRA 4AW7A 1Y3TA 1EGZA 3LPOA 5HCBA 1F6KA 1Q4WA 3EKZA 4LS1A 1QIQA 3X29B 3ES8A 4DUOA 1VFTA 1NLQA 2A3HA 4INFA 3NGJA 3HD8B 4I8DA 3NGFA 3LA4A 4JFWA 2ANUA 2RR11 3AMHA 2VI0A 2C24A 1Q6OA 2FLIA 4LBJA 4K1WA 5D2WA 1ENXA 4AYSA 3HOJA 1GQIA 5I06A 5JMCA 4XFCA 2XWEA 4TOQA 1GSLA 2EVXA 3ARSA 2I2SA 3PU3A 3NNLA 3JZUA 1XYNA 4CDWB 4WXZA 3NMBA 3GC5A 1JCTA 3WJYA 3VBOA 3AP4A 5CGQA 3TOPA 3W6MA 4MKNA 1XIEA 1TVGA 1B57A 4MAVA 4P8VA 4DRVA 4XVDA 1FTXA 1ND3B 1UQXA 1JZ5A 4M6UA 1DQ6A 1EJUC 1GHRA 1POV3 4QQLA 3K77A 5F4SA 1VBRA 3MZNA 4HOOA 2J27A 1SSGA 1I0DA 3WD3A 4PQ9A 2EGZA 4GC4A 1XJAA 2ZA3A 1AYN3 1XBVA 3BJTA 3VBRC 5KHIA 2WNQA 4CXWA 3LEPA 3MWAA 4AD0A 5A1AA 1DBNA 4Y4RA 1W6MA 1IR2A 1RPXA 2OT0A 4X0NA 3EEGA 3FUQA 3LDBA 1YE6A 3QLLA 4O4WA 3FFZA 1L9WA 4LBMA 3MO7A 3DI0A 5J96B 4KWUA 3FHAA 2E32A 3O6CA 3CS2A 1P7TB 1WCKA 2VD8A 4CDXC 5HA7A 3QW3A 3O0VA 5JIPA 1BLZA 2DY3A 4NXKA 5FL0A 3MI8A 4QB1A 3AM2A 1PUDA 4PBPA 2PDMA 3MU7A 2E77A 1HT6A 2OZ0A 3PBUA 3UJOA 5FJJA 1CDGA 3RO6A 2IXHA 9XIMA 4ONVA 1POV1 4JL1A 2Z00A 4JKKA 3NM1A 5C3PA 4Z2IA 3NJVA 1TSIA 1L7LA 4YNGA 3GYDA 5FZ8A 1TNFA 3URAA 4IPPA 3T4VA 5B7ZA 3WDXA 1TPDA 3IUHA 2FZ8A 3WLUA 1CAUA 3HQXA 1RUD3 1NX9A 3AMCA 3S5NA 3T8QA 4YM3A 1N3QA 1S1RA 1E73M 1H0IA 4QDMA 4BY3A 3POGA 3EXRA 2ES3A 3SMHA 1R3RA 3TSDA 1TIMA 3J9SA 4HN1A 1HB2A 5EHDA 4YW3A 4P8WA 1C9DA 1I45A 2V5DA 3NQ7A 3HOBA 3Q8CA 3V0AA 4YS1A 3UCDA 5C4WB 1PGW1 5FY9A 1REQA 2VY0A 4P5YA 5D32A 3VD9A 5LA1A 4RZ4A 5A3PA 2OQLA 3ITGA 3ZXWA 3ZYJB 3MIDA 1TE1B 3GY1A 5I24A 2AMXA 2AYHA 4M5PA 2WHLA 2ENRA 4FPFA 3MUCA 1CPMA 1W90A 5EL1A 4LBNA 4ZQOA 2GJLA 4JTSA 1UPIA 1DJYA 4NZJA 2V69A 1EIBA 3GHMA 3DCPA 3L4UA 4GZ9A 2I45A 1OYAA 4HU4A 4UOZA 1RCQA 1F05A 4UQBA 1W6PB 3UG8A 2DVDA 1WOBA 2TRSA 3LTYA 3L9JT 3BWWA 3CJIC 3WD1A 4AY8A 4ISRA 3IIVA 3S57A 4PL2A 3SRHA 3VIJA 5H2ZA 2Z4GA 3WQDA 4GUHA 2XVNA 3WDIA 1XNDA 3WD5A 3CL7A 2TAAA 2PURA 3WLTA 4OFCA 1OURA 4RLIA 3LDKA 4JVAA 1DQWA 3VC6A 4AMAA 2GU9A 3LPPA 1BK1A 3EPOA 1DP0A 2DCJA 5F5CA 3NO3A 4LU0A 4QGLA 3KDNA 3V16A 3G0UA 1PMHX 1CQ9A 1NCQB 3GFYA 2QDEA 3AHXA 5DBTA 4CSWA 3RG6A 2PSNA 1EC9A 4LAUA 3BGAA 1NXMA 1I6XA 4E4SA 3QBUA 2WKLA 4CU8A 1QK0A 1U22A 4X9SA 1J18A 4ICNA 4V2WA 2ZZQA 2RG4A 4Q4X1 2DSWA 3OOXA 2RDQA 2RH9A 1S2WA 2CY6A 2YL6A 3EWWA 1GEHA 4JAWA 4F9JA 4GYJA 2MNGA 3GAKA 2GNDA 3AMGA 1YTDA 2RDNA 5EB8A 2C26A 3KF3A 4LA2A 1NG0A 2G3MA 3ERPA 2EXOA 3NOYA 4HPNA 1BF2A 3TEWA 1S2VA 2IXKA 4CCMA 1VJIA 4IG2A 2DTWA 3G2GA 3Q65A 4JYEA 4PULA 1EDTA 3UESA 3WP5A 2WK2A 7XIMA 4ZGYA 5HCFA 5LK5A 3LHUA 4TX9A 4BJ0A 4HK6A 5JVLA 3GU1A 5A33B 1C8M2 2W87A 4NVPA 4Q4V2 5G4WA 1PMIA 3BLOA 4XBSA 3VMPA 3PHMA 3GKFA 3NZQA 4HK5A 2Y1HA 4AVOA 3LWCA 2ET1A 5K8SA 4PMQA 5LBCA 3FGCB 1TV4A 3WUDA 4H3WA 1TA3B 3VNLA 2WW5A 3TH6A 2IPFA 2WWUA 4PCRA 3DFSA 1ICPA 4FFGA 3HGRA 1A5LC 4O57A 2P5BA 4BWOA 1EB3A 1FFRA 3WLPA 4XF4A 4ARXA 3BU0A 4DI9A 1YDNA 1THFD 5KITA 1PX4A 3RGTA 5LB6A 4B7KA 5LSMA 4K39A 4DJED 4LXFA 1G9CA 3RI8A 1LROA 4NL1A 4Q8UA 2QBXA 3WLJA 4QCEA 4PRTA 2K9ZA 4P7OA 1WW4A 2IXCA 2HDJA 1EUTA 2DBIA 3GDRA 3UXIA 3SQOA 3T55A 1KLZA 3ISIX 2CGOA 3VMOA 2R0HA 1HVXA 3H4GA 4DPPA 1GTEA 1P0EA 5IFPA 4LFYA 2WMGA 1IKQA 1OK6A 4GY0A 2GSYA 2CBIA 3SGGA 2D5HA 2VFFA 1E55A 3STGA 3IK2A 1QPKA 1FT9A 3HVDA 2C19A 2I9UA 1E5HA 1W9YA 4Y1VA 3KCCA 1W3HA 2QGYA 3VDAA 4E4ZA 1G94A 5EQUA 2PU0A 2Z24A 2H8ZA 3CHFA 2YGYA 3H26A 2VBBA 3WLLA 3U6WA 4DXRA 3SW6A 1MEIA 1PS9A 3Q37A 5CPQA 2VCBA 2OFJA 3ACLA 1DZTA 5EJZB 1D0GA 1TZ9A 2CXEA 3SJNA 4IMDA 3S5QA 3PC0A 3QPEA 2O92A 4ZHNA 6A3HA 3DPRC 1VFOA 5HMEA 3O1TA 3Q2DA 4GJZA 3T3YA 1MQTA 3FYYA 4LRSA 3TVAA 3JZEA 4C6JA 4KBXA 3NNMA 4YVVA 4ML9A 2NW0A 3RJXA 1G6CA 5AC92 1F3TA 2DUZA 2DDUA 2R073 4HN0A 5JI9A 2HPIA 4PYSA 1XBYA 4AWDA 1QGLA 2EAAA 3MHZA 3WL0A 5JH2A 4JGZB 4LBQA 3MF6A 1ZY9A 1CLKA 2NVCA 2JG8C 1X39A 1MEWA 2VGFA 1BEV2 3G1YA 4Q4PA 4AHPA 5FPLA 4DO6A 3HT2A 1N1VA 4DZ5A 5FZ1A 1PNFA 4IV1A 3CZEA 1WKYA 2PDIA 2VFIA 1CNVA 4YW4A 3S5SA 3NQ8A 4L0PA 3C5QA 5A5WA 4AHQA 4KT2A 5T5OA 1W3VA 1GYMA 1A50A 1MS5A 3D5OA 1MZEA 1A4LA 1QDSA 3QHOA 2R071 4D6RA 2D98A 1ENSA 3KDOA 3WDJA 2YROA 1IEIA 4CPBD 3N7LA 1WO2A 3M7SA 2Z1BA 2B7QA 3VBRA 1DXEA 2HBVA 2FZBA 3E02A 3GWQA 4W85A 3B0YA 5C9RA 2B9VA 3VKNA 2GWGA 2NMOA 4M19A 4AXOA 3KX6A 3WVJA 4MVAA 3LSBA 1MUCA 1E56A 2BBVA 5XIMA 5XINA 3QQ0A 5DAPA 2HLEA 2HWC2 4C1XA 1RUNA 2BGNE 4GI4A 2P50A 4WOQA 2I07B 4CDXA 3T9PA 2GQ8A 3KHDA 4PN2A 1JUBA 4F48A 3DFNA 3FCPA 2Y4SA 1KXGA 1K8XA 1MMFA 4JX5A 1DQ4A 1BGGA 3NZRA 2ORXA 4IESA 3CEUA 1DG6A 5CC3A 3DKWA 3NRUA 4EJRA 1E0VA 3MYOA 3R6SA 4R8HA 3CMJA 4HKLA 2D43A 2A6WA 1YQ8A 3A47A 5FYUA 4EF8A 2CWMA 2HWF1 4FXRA 4ZL1A 1DZQA 3OLGA 3V0BA 2YDAA 3AWOA 3RHGA 1KA9F 3O1RA 3L5MA 4KIRA 5LIKX 3ZWSA 3IRDA 3DX5A 4UFKA 3R4DB 5DX7A 3ZSEA 2KR2A 4OHYA 4LK7A 1RSCA 5L73A 3NQGA 4EOUA 1WKDA 2QJVA 2Q4SA 2R82A 1W3IA 3QMTA 3K2OA 4NXSA 4FOQA 4WGXA 2IXUA 2X5IC 1EL3A 4U3CA 5BWFA 4NRMA 4BHYA 2R9RA 5CJ5A 4XDPA 2VX5A 3BZGA 4Q8PA 3ZXKA 4DX3A 1UW9A 3ITQA 3B5LB 3GYEA 4LS2A 1XLKA 2R1MA 2VEIA 4MKVA 4FPGA 2DVAA 1D0HA 1P6WA 2IXJA 3KT1A 5A95A 1OMIA 4CQBA 1SLAA 2J7MA 1TFVA 3QH2A 2Y7DA 2VMDA 4D72A 5EPDA 3P61A 2XGIA 4N4QA 1F3EA 3S1XA 3M1ZA 5CJMA 3SN4A 4HK7A 4YGBA 1XP3A 2VECA 3POWA 4WGHA 5LIXX 2VNGA 4EN0A 1E1FA 2BDRA 3IJ9A 4A7KA 3KQRA 4H01A 3FLPA 1FWHC 2ZXQA 4PTNA 2IFWA 1R85A 3GG0A 1ZZ8A 3VBHB 3MI6A 4S3EA 4PUNA 5A3LA 1IWBA 1DHKB 5FZHA 4FNRA 3WT3A 3WDQA 1UUMA 1W9DM 3PUDA 2RMU2 3BGGA 3F5KA 3ITVA 4FX7A 4IPNB 3UCQA 3M0VA 5AFEA 2VR2A 5IM51 1B4KA 4UQDA 4HNTA 1TV7A 2R1KA 3WW1A 1EJXC 1HX0A 3N6JA 4IP7A 4CD8A 3E74A 1IGOA 5C6MA 1AYM3 2Q8ZA 1HJFA 2GSHA 2OO0A 2VVSA 2JDKA 4YVWB 2D73A 2JFEX 2JECA 5JUVA 1XIBA 3OZPA 1KXHA 4CVUA 6REQA 5F2MA 5FY0A 3TAKA 1SZRA 2QCFA 1YXCA 1XH1A 4MYEA 4A6SA 1OA4A 6ENLA 1IR1A 1DXIA 2J47A 3GTXA 4Y4YA 2IS7A 4FA3A 2QW5A 3SN0A 1Q5OA 1HTIA 4FAGA 3W7IA 3C86A 4Q4OA 5HNNA 4JAAA 3G7DA 4JCKA 3OHMB 5KZMA 4TVDA 3GUGA 1RALA 1RUG2 1O95A 1QCWA 1KCXA 2Y60A 3MICA 3K51A 4B5WA 3RFAA 1MDLA 2DW6A 2WUHA 5D9PA 1KM6A 3R8HA 4GWNA 2C15A 2ASHA 2X1TA 4N43B 4EACA 4J3SA 5AYZA 1A5BA 1IS6A 3RX3A 1AYM1 3LYEA 2ISWA 4S3GA 5FF4A 3R11A 3CUFA 3ARWA 1OIMA 1UD3A 3AYVA 2QVHA 2PLV1 3UR8A 1W8SA 4HKPA 3L67A 4HZ6A 1YW1A 3I6EA 1RUJ3 4ZB0A 4CE8A 5D8AC 1R2RA 3OYWA 2VGGA 1EZ2A 4ZQMA 1KFKA 4CNOA 1I1XA 1PCKA 3TYUA 5ACA3 3E5UA 5G05L 3R8RA 5LY1A 1PJ9A 1L2UA 4IIEA 4J3VA 2QZ3A 1AUYA 4KFNA 5DRIA 4BU2A 5BRPA 2FVMA 4AFMA 2C7FA 1RUSA 2W27A 2VOMA 4XOGA 3CL1A 3EDDA 1X33A 4HT3A 4DO5A 1H2LA 4QIUA 1QW9A 1ZBCA 4JTGA 3GNNA 3WMLA 3A24A 4OTKA 4R27A 1UH4A 3UNDA 5FCZA 1JUEA 1IIHA 3CQKA 2DSUA 4E2QA 2HPMA 1YIPA 4Z2WA 5HR7A 4G6CA 1DTNA 5FREA 4GUJA 4AEDB 1LWHA 4ZQCA 4J25A 4LJ3A 1RUJ1 2J78A 3WJXA 8CGTA 4NZ4A 4MHUA 2ZRWA 2ZUTA 1Q6FA 3ZFEB 3FJSA 2MHFA 5HV4A 4FP2A 4OUEA 1W9SA 3WDTA 5CEHA 1ZFJA 1K5MB 3GJAA 3CU7A 5ACA1 1KB3A 1TMF3 4JTDA 2WC2A 1P5BA 2OKOA 3PBGA 5A32B 1WYIA 2FVKA 3H7JA 4HNUA 3BGJA 3GNOA 4ZR8A 1KCLA 1XHGA 4Q8LA 1T6GC 3DN7A 1JRBA 4RV3A 4KERA 4Y20A 3NL3A 3F03K 3RX4A 2WABA 3B7MA 1GWKA 4LUMA 1EBGA 1GNYA 1RZMA 5DCDA 3PNAA 2HKXA 3T1MA 4Z0SA 1R092 1F3XA 4EZ4A 3K5XA 1TR9A 3OVQA 4IQJA 5C9ZA 4CCCA 3O0WA 3AYSA 4E2DA 4FF7A 4MNJA 1TQ5A 4ZTYA 1IWPA 4XQ6A 4S3AA 2ISVA 2VZQA 4MZ8A 4H2HA 3WZ1A 4IDZA 4COVA 1TMF1 3MZHA 5FPXA 1RITA 1YQCA 4P9JA 4OVEA 1MQRA 4BFAA 2JKXA 2E9QA 5FY8A